4HPLB

Pcgf1 ub fold (rawul)/bcor pufd complex
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
90
structure length
83
Chain Sequence
TREQLNLCLERLSSVLQNKYVRCSVRAEVRHLRRVLCHRLMLNPQHVQLLFDNEVLPDHMTMKQIWLSRWFGKPSPLLLQYSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords BCL-6 corepressor
publication title Structure of the Polycomb Group Protein PCGF1 in Complex with BCOR Reveals Basis for Binding Selectivity of PCGF Homologs.
pubmed doi rcsb
source organism Homo sapiens
total genus 22
structure length 83
sequence length 90
ec nomenclature
pdb deposition date 2012-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF16207 RAWUL RAWUL domain RING finger- and WD40-associated ubiquitin-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4hplB00
3QK0A 4DBGA 1UBQA 4I6NB 3DDCB 3PLVA 2CS4A 1C3TA 4W9LA 5AZHA 3M63B 1E5WA 4JL9A 5DPTA 2AWTA 1OTRB 1EUVB 2KFJA 1KLVA 2K6DB 2KVRA 2IY1B 3JW0X 1M94A 3ML8A 2KMCA 2O6VB 3T9LA 4CHKA 2Z0EB 2OOBB 4MJSA 5J17A 5D6JB 2IYDB 3HM3A 4AUQC 1RAXA 3OJ4B 1E7UA 2KANA 1OEYA 3Q3JA 3IFWB 3JSVA 1WR6E 3VDZA 1T0YA 1WXVA 4G0NB 2C5LC 2XK5A 5J18A 1RRBA 2C7HA 2CHWA 2KLCA 3OAWA 3QC8B 1WGGA 4RMAA 5IAAC 3PPAA 2I1JA 2C9WB 5C1ZA 2DX5B 4EFOA 2KWUB 2L3ZA 2GBJA 2BGFA 4HVBA 1V9JA 2C60A 2M0XA 2CHXA 3RULA 2L7RA 5CX3A 1WMHA 1E8ZA 1WI0A 4GDLA 2K8BA 2A5UA 1WJ4A 2JWZA 3H7PB 3IHPC 4HDQA 3U30A 2PE6B 4BKSD 4HXDA 4XC2A 3EC8A 2Z0DB 4F7ZA 2G45B 4IW0A 4DHZE 2GMIC 4LJOB 3OLMD 1WGDA 1FXTB 2PE9A 4G50A 3B1LX 1GC6A 1V5OA 3RT3B 4F8CB 3CF6E 3ZRFA 1ZGUB 2KWCA 3HM6X 3ZNZB 1EO6A 1GUAB 4FA6A 3AU5A 1GC7A 5E6NA 2MBEA 1R4NI 3L0WB 3QAQA 2DAJA 3DBLI 3QA8A 2O6VD 3RUIB 2AYOB 4URKA 1V81A 2WX0A 3R66C 4XX5A 4BKTA 3HHMA 1TZ1A 1WXAA 3DVNU 3BINA 4ANWA 3APFA 3L17A 2A4ZA 4YL8A 1UD7A 4HK2A 2M1MA 1J0GA 3VVWB 1EF1A 4W9HA 3PT2B 4XZ4A 5AZGA 3VTUA 3NHEB 2FCMA 5EDSA 1YX6B 1H4RA 2BYEA 3UQAA 2M8SA 4KIKB 3TBLD 4DK5A 1XD3B 1AARA 2EMTA 1WM3A 1WRDB 2LGYA 5E6OA 2O2VB 4PYUA 4TV3A 3RD2A 3ZDMC 4ANXA 4EZKA 5L95C 1OGWA 5CHWA 3PGEA 4EZLA 1P3QU 3MTNB 3X0WA 3SHQA 1K8RB 2MCNB 1PQSA 3DBRI 1WGRA 4NPNA 4BVUC 3PV1A 3DPDA 1YD8U 2KHWB 3KUCB 4IM2A 4KSKC 4WWNA 2N9EB 4TUUA 2K1FA 1Z2MA 3QCAA 2M17A 4GN1A 2FAZA 3H7SA 4WJQA 3WALA 1VD2A 2KJ6A 4FADA 3PSEB 5C23A 3TIXA 1LXDA 2MLBA 3V60A 2J0KA 4MELA 3A9KA 3KVFB 2KFKB 1X1MA 1WXMA 2UYZB 2V4LA 2EKEC 1UH6A 2JZ3B 2DAFA 2KO3A 3CSFA 4PYZA 1IYFA 2BKRB 4IM3A 1UELA 3ZUNA 4MM3A 1SE9A 4FHJA 4NAWA 3AI5A 2DENB 1E8XA 2LVQA 4DDID 2D10A 3LJ3A 1Q0WB 4PS8A 3WAPA 4G3XB 4MSMB 3A4SC 1J8CA 3JYUA 2KDFB 4A20A 2MA9B 1WGHA 4ASWC 3B08A 3TJPA 1S3SG 3VUWA 4NQLB 4FBJB 3ZIMA 2KX3A 2N9PC 2KOXA 1WE7A 2CU1A 2NVUI 4AP4C 5G2NA 2EMSA 4K7WA 4E3CA 4IUMB 4LDTB 3PREA 1WJNA 3EHVA 4GOCA 4HPLB 3N32A 4W9FA 2NS5A 1E8YA 1TTNA 3AULA 3LDZE 2K6QA 4TQ1A 1XT9B 4N9F4 4FJZA 4DHJB 2WDTB 4KDIC 2KNBA 3W1SC 3PS6A 2JVCA 4GB9A 3N3KB 4JGHB 1E7VA 1V80A 4HCPB 2IY0B 4W9EA 1UBIA 2AEHA 4GU2A 4MH0E 1LQBA 4MGIE 2FIDA 2NPTA 1L7YA 2KQ7A 2NBUA 3AU4A 5BO4B 2XEWA 4M0WB 4KV2A 3QHTA 4RM8A 4FULA 2AL6A 4MGKE 3RZFA 1UZXB 3VTVA 1V5TA 2KDEB 1XQQA 2MBBB 3T8MA 2ZNVC 2MWSB 3WAMA 3ZTDA 2KC1A 5JH5C 2RPQA 2KJRA 1C1YB 3OJ3A 4GDKA 4MJSB 5TR5A 4B9KA 3W1SA 2K8HA 3U8ZA 1H8CA 2JXXA 3NOBA 2BYVE 2DYMA 2L8JA 2DYBA 2KMAA 3N30A 3KH0A 3QARA 3JSVB 5KHQA 3DCGA 3ALBA 3HIZA 3L10B 4W9KA 4JQWC 4NY0A 2XK5B 4GGQA 4W9JA 4WJNA 4B6WA 3R7RA 2JT4B 4ZRIA 3H9DA 2NCNA 4GMVA 2J0MA 3A9JA 2B3AA 4LDTD 3DQVA 3VXWA 3L16A 4GIVA 4W9DA 2D07B 1OQYA 1E90A 2JY6A 3PVLA 3IVFA 1WMHB 3NZUA 2YLMA 4DHJD 5LXIB 4GDLB 3ZLZA 4F1SA 2LRWA 2ZCBA 1P0RA 2KTRA 5GMVA 2LUEA 4BBNC 2IBIB 1L2NA 1U4AA 2LI5A 2KWVB 2LJ5A 2GBMA 3MHSD 2KQSA 1E8WA 4FLHA 2LWPA 5CHVC 2D2QA 1WF9A 2LVPA 4TQ0A 3A33B 3ZVVA 3QIJA 4FN2A 2HTHA 3ZNID 1I42A 4X57B 1D3ZA 1WE6A 1GG3A 2KXJA 3DVGY 2JUOA 4ICUA 4KDLB 3RCZA 2KTFA 3TCAA 3V6EB 3UQBA 3D32A 2ZZPB 4NNJB 3VTWA 1LFDA 4IWQA 3NZSA 1EF5A 1J19A 4ANVA 1WH3A 2MP2A 3M62B 4KSLC 5AEKB 3SDLC 1WX9A 4DWFA 1YIWA 4TKNA 2KJHB 4PS7A 2DZKA 2Y5BB 2MBHA 4AJYB 1WFYA 4FJVB 1ZKHA 3PHWB 4I6PA 4EUTA 2LVOA 4MSQB 3A4RA 1P1AA 3ECIA 3EECA 2BF8B 4ZRKA 4MGZE 4GXBA 1WZ3A 4IWOA 3APDA 3L54A 3P2BA 3ZDTA 3ZO5B 1YX5B 2GBNA 3M95A 1Z5SB 4MEMA 2ZEQA 4K81A 1TGZB 2ASQA 4FHKA 2BWFA 1ZW7A 4A3OA 2HJ8A 3VQIA 4BBNF 2GBKA 3ONSA 2GBRA 2L0TA 5CTRC 5D7GA 3JVZX 1BT0A 2W9NA 3H1UA 3QJZA 3PRZA 4OVUA 2KDIA 1Q1OA 1WX7A 2ZPYA 4IC7B 1WJ6A 2KK8A 3R3MA 1I35A 3A9KB 2DZMA 3ZTCA 2N4FA 4EOYA 4E74A 3RYTA 3VHTC 4CYEA 2DYOA 2MSED 2MBOA 2DZIA 2KZRA 1WX8A 1S1QB 3EFUA 2WWZA 3ZKJC 4NAWB 1F9JA 1TBEA 2N9XA 1JRUA 3CSTA 3U7DA 4HLEA 2K25A 3ENEA 2HD5B 4BKGA 3A1QA 1WY8A 4BKSA 2L76A 3PHXB 2MBQA 4II2B 2L05A 2DHZA 4FJYA 4M8NA 3KYCD 3B0AA 3WAOA 5JHAA 4AJWA 2C7MB 2CR5A 1WZ0A 3UF8A 5D2MB 5E6PA 4ICVA 4BFRA 2AL3A 5JHBA 2R2QA 2RD0A 3M3JA 3V62A 2Z59B 2WX1A 1NDDA 2FUHB 2G3QB 3WIMA 5DPSA 2ZJDA 2J0JA 3DVNV 4RM9A 4WQOB 4A3PA 1P9DU 1KOTA 1WIAA 2KKCA 3L13A 2FCSA 2O6VA 1ISNA 3V61A 4ANUA 1MG8A 4W9GA 1WR1A 2FNJB 4I6LB 2IO1B 3KUDB 4ZDVA 2NPTB 2RGFA 3ML9A 4AWJA 1IP9A 1Y8RC 2NR2A 2KD0A 3BY4B 3X23A 3PRMB 2JRHA 5J2RA 1NI2A 1V6EA 4IM0A 2KX0A 5CHFA 2LGDA 2M4NA 1WM2A 4M8MA 5JZEB 1R4MI 3GZNI 3K9OB 4WJPA 2D11A 2IO2B 2IZVB 4GDKB 1WJUA 3WA0A 3H7PA 2BKFA 2UWQA 3IG3A 3PZDA 1V86A 2FIFA 2QHOA 4EZJA 4K7SA 3KYDD 3AXCA 4HPMB 5D94A 2RSUA 2N1VA 3KW5B 2KC2A 3S2AA 5KHOA 1A5RA 4WWOA 3A9JB 4B95A 3K9PB 2D3GA 5DPRA 4W9IA 4IWPA 3VH4B 3PLUA 2LRUA 2VRRB 3VFKA 4BOSC 2KTRB 1G6JA 3PTFC 4WAAA 1YQBA 3APCA 4MGYE 5DCNA 5AZFA 4JIOU 2RR9A 2LD9A 4NJ6A 2JZZA 3UINB 4ZYNA 3VUXA 2LGXA 2HE7A 4E71A 2ZNVB 3QQ8B 5LLIA 2L0FA 4J6IA 4HCNB 4K7UA 2BWES 1LM8B 2GOWA 2N1WA 2K39A 3DBSA 3TL5A 3C0RB 2ZVOA 4KIKA 2NBVB 4DXAB 2G4DB 1NBFC 1UGMA 3ZW3A 2BPSA 4NJ7A 2O2VA 3RZWC 1RFAA 3R7QA 3SU8X 2DZJA 2PEAA 3TMPB 5IA7A 3H6NA 2IO0B 3QX1A 1KM7A 2MP2B 1WXSA 3QWZB 2CKHB 5L83A 2K8CA 2LXCA 1CMXB 3HK0A 4EKUA 3NS8A 2ZCCA 2PPHA 2G4SA 2MX2A 3L08A 4DDGD 2JPHA 4HWIB 4II3B 5LXHA 4K1RB 2I1KA 2XBBC 4KZCA 1V49A 4NQKE 2REXA 3KUZA 2J7QB 2C7NB 2WYQA 5HKHA 1YJ1A 1GNUA 4WWPA 2JF5A 3PRPB 2KFKA 3DOWA 2ZPNA 4WJOA 4GSWA 2FCNA 2IO3B 2N7EA 4HJKA 2NBWB 4W9CA 4MDKE 4HDOA 4KZ0A 3VAWA 3VH3B 2LASA 2ZVNA 2LXAA 3V6CB 4AOFA 2KDBA 1VCBA 4LJPB 2BYFA 2MQJA 4BOZB 2OJRA 3GOEA 4P7IA 3IBEA 3UIPB 3W1YA 1Q5WB 1P98A 2LZ6A 2KLGA 1IPGA 4G11A 4DHZB 4EEWA 4JLCA 1SGHA 4OVVA 5G55A 3UIOB 1GJZA 3O65B 2JRIB 3DVGX 1RLFA 1SIFA 3NY5A 1WGYA 1QZEA 2N7DA 3ZNHB 4CO7A 3DBHI 4IG7B 1V2YA 1HE8A 2MW5A 2MRPA 3MJWA 3SD5A 2R2OA 5FR6A 1KJTA 3UGBB 4ZRJA 4LCDE 3Q3FA 2FCQA 2PJHA 3CMMB 2YVCA 4PS3A 3ZRCA 2L00B 3WANA 3ZNGC 1WYWB 5DPWA 4KVGB 2V3SA 2V1YA 3A1QB 3I3TB 2CHZA 2KN5A 3VUYA 1OEYJ
chains in the Genus database with same CATH superfamily
3AE1B 4DBGA 1YQ3B 4I6NB 2WP9B 2RDHA 3HUIA 3RNFC 4D2KA 4JL9A 3MC8A 2K9XA 1KFYB 1XEEA 2J42A 2K6DB 3JW0X 1M94A 3R8BA 1SJHD 2Z0EB 2JQRB 5AUKA 2PW9A 1RM6C 4AUQC 3Q8CA 1RAXA 3OJ4B 3Q3JA 1OEYA 2WU5B 3RNEC 4ZRQA 4YTNB 3B9JA 5J18A 2KLCA 1E10A 1WGGA 4YSYB 2DWQA 1F52A 2KWUB 2L3ZA 1F0ZA 2C60A 2M0XA 2RPVA 5HHDG 2L7RA 4K3CA 1WI0A 2K8BA 4HDQA 3U30A 4C7YA 3RFZB 5H8YE 3EC8A 2Z0DB 1V1OA 1WGDA 4G50A 1RYJA 1FM0D 2K0PA 3NVWA 1ZGUB 3HM6X 5T8IA 1EO6A 1GC7A 5E6NA 2MBEA 5C3JB 2DAJA 3QA8A 3RUIB 1V81A 3NVYA 3VR8B 4LK0M 1TZ1A 3DVNU 3UI3A 1CK1A 1FXIA 3NZ3A 1EF1A 4W9HA 4XZ4A 2FCMA 3P1MA 1UWMA 4RH6A 2D3CA 2GB1A 2M8SA 4KIKB 1AARA 2LGYA 5E6OA 2JWUA 3ZDMC 4PYUA 4EZKA 4LNOA 1MVKA 3MTNB 3X0WA 1D5XC 4YSZB 3PV1A 1MHXA 2N9EB 1UF0A 4GN1A 1KH0A 4WJQA 2ZW1A 1QQRA 2MLBA 4MELA 2GI9A 4K3BA 3NJTA 2KO3A 1IYFA 3ZUNA 1SE9A 1TS4A 1IUEA 1Q0WB 3JYUA 4A20A 1TIFA 3TJPA 1S3SG 4FBJB 4L2YA 2N9PC 2KOXA 1WE7A 2CU1A 4AQ7A 4AP4C 5G2NA 2EMSA 4LDTB 2G9HD 1E8YA 3AULA 1UWXA 4YWGG 4US8A 4DHJB 2GRIA 2WDTB 2D3AA 2KNBA 4GB9A 3N3KB 2LHDA 1V80A 2EELA 3HVZA 4MH0E 2NPTA 2H89B 2XEWA 3URYA 2BYTA 3P4SB 4IDIA 1JWMD 3I57A 3H8HA 4LTUA 4YXDB 1MPEA 1TKEA 2ZNVC 2KC1A 2NTTA 4GDKA 1I4GA 4B9KA 2KMMA 2K8HA 3U8ZA 3NOBA 1VZ7A 2BYVE 2L8JA 4JX1C 3QARA 4P16A 2L83A 3L10B 3HIZA 4GGQA 4W9JA 3R7RA 2JT4B 3H9DA 2NCNA 1AW7A 3VXWA 3L16A 3TUOA 2D07B 1T3QA 3NZUA 2CU3A 4J3OD 2KTRA 4XYCA 1SE2A 2KWVB 4A8XC 1KRHA 2INPE 2LWPA 5CHVC 1WF9A 3GE8C 3P63A 3ZNID 2HTHA 4ARCA 1GG3A 3DVGY 3RCZA 3V6EB 3TEWA 4L1BA 1LFDA 5BMHA 4IWQA 1EF5A 1JWAD 1WH3A 2MP2A 2WDQB 5AEKB 3FC4A 1QF6A 2KJHB 1GAQB 4PS7A 2DZKA 1N61A 4MSQB 3A4RA 3EECA 2BF8B 4ZRKA 3NS1A 4LNFA 4KKJA 1ACCA 3APDA 2GBNA 1Z5SB 4MEMA 4YTPB 1TGZB 4FHKA 2BWFA 1UUPA 4A3OA 2QCZA 3B2GA 1Q10A 3ONSA 4A90A 2L0TA 3NVZA 3JVZX 4PK1A 3ABVB 4OVUA 2KQ4X 1Q1OA 1WJ6A 4BAXA 1J7CA 2HDEA 2B76B 4EOYA 2JSVX 3VHTC 2MBOA 4MM3B 3E9SA 4NAWB 1F9JA 1JRUA 3U7DA 1VZ6A 3ENEA 1WY8A 2L76A 2DHZA 4M8NA 5GXGB 3UF8A 5E6PA 2MJ3A 2AL3A 2RD0A 3M3JA 2Z59B 2WU2B 3DVNV 4RM9A 4WQOB 1KOTA 2VH1A 2O6VA 3OWEB 1TJEA 2JX5A 3SR6A 2FNJB 1HTOA 2IDYA 1EU3A 3BY4B 2BS2B 4HPPA 2HJ1A 3KWVA 3FKYA 1ENFA 2KX0A 1VR9A 5CHFA 4CQNA 2M4NA 5JZEB 1R4MI 2PLPA 1R7SA 3AE8B 3K9OB 1YJIA 2D11A 2YEPB 1N62A 3H7PA 1UNSA 2BKFA 3IG3A 4S0RA 1I4QA 3AM9A 3AXCA 4BZAA 4HPMB 3KW5B 2KC2A 1A5RA 4C4VA 4A6QA 3ZJVA 4B95A 1P7FA 4ZOHC 1PDXA 4NZLB 3AE7B 4MT5A 3DWMA 3IT4B 1OFFA 2WLBA 5FK9C 1YQBA 4MGYE 5DCNA 5AZFA 4NJ6A 2J53A 3QQ8B 1HQRD 1JROA 2N1WA 3DBSA 1TZOA 1NBFC 3R7QA 2WXPA 3SU8X 1GPXA 2W55A 5L83A 1D5MC 4EKUA 3I5JC 4HWIB 3WCQA 5LXHA 5FR3A 2I1KA 4NQKE 2C7NB 3AE3B 2WYQA 1WWTA 4GSWA 4M02A 2LASA 2LXAA 4LJPB 2MQJA 1DOXA 3GOEA 3I63C 3UIPB 1YN3A 1P98A 2LZ6A 1IPGA 4G11A 4DHZB 3MJ5A 1HZ6A 1QILA 1QZEA 4IG7B 5BMIA 3MFGA 2MW5A 2R2OA 1V1PB 4NJCA 2PMVA 5DPWA 2KN5A 3NVVA 1EWYC 5AZHA 5DPTA 2WXLA 3LXFA 1OTRB 3BZDB 2KFJA 3AEGB 1KLVA 1RWSA 2IY1B 4RGTA 2KMCA 3T9LA 2WGSA 4MJSA 2IYDB 3HM3A 1E7UA 2KANA 3JSVA 1WR6E 1T0YA 2UU7A 5IN7A 2C5LC 2XK5A 1RRBA 5IAAC 2CHWA 4A55A 3OAWA 3SFEB 3PPAA 1V9JA 3RULA 3ZQ4A 3DHGC 5CX3A 1WMHA 1E8ZA 2PIAA 3IHPC 4BKSD 4HXDA 3T3NA 2LMCA 4IOIE 3NUHB 4US9A 1ZDXA 3BK2A 1GC6A 1C79A 3CF6E 2KWCA 3ZNZB 3AU5A 1F2RI 1ET9A 5TSSA 3DBLI 1MJDA 2AYOB 4URKA 3R66C 3HHMA 1QOGA 1WXAA 3L17A 2A4ZA 4WIPA 2KVZA 4HK2A 5AZGA 3VTUA 1AYFA 2NTSA 1XLQA 3UQAA 3TBLD 1WSPA 1L4DB 1K52A 2O2VB 2PKOA 5JXVA 1SE4A 1FMAD 4FXCA 1KTKA 1UGJA 3GZNB 2D3BA 1B1ZA 1D4BA 4BVUC 3DPDA 1YD8U 4WWNA 1JMLA 1Z2MA 1ZE3D 3QCAA 4C80A 2G1EA 3H7SA 1LXDA 2J0KA 1E0ZA 2LGIA 3A9KA 3KVFB 3RNAC 1WXMA 2UYZB 2KAJA 1UH6A 2JZ3B 3CSFA 1XCTL 1UELA 4FHJA 2DENB 4N58A 4DDID 2AX5A 3BIID 4G3XB 3A4SC 2MA9B 1E9MA 3PO0A 3ZIMA 1TKYA 5IKCM 1YOVB 2NVUI 5HI1A 1PUTA 3GP7A 3PREA 1DOIA 1YQ4B 2NS5A 2BB6A 2K6QA 2LHEA 1TS3A 5AUIA 3FAHA 1JCKB 4HCPB 2IY0B 4W9EA 3RMKC 2AEHA 2NBUA 3AU4A 4M0WB 4KV2A 3RI7C 4MGKE 3RZFA 1V5TA 2KDEB 1XQQA 1YN5A 2IGHA 2BS4B 2MBBB 4RGMA 2MWSB 5JH5C 2J52A 3W1SA 1H8CA 4JWSC 2JXXA 4USAA 2KMAA 3KH0A 2FUG1 4WH4A 5KHQA 3N20C 4JQWC 4ZRIA 2YEPF 1FIQA 3ZJUA 3PVLA 3IVFA 5LXIB 4GDLB 2LUEA 5EE9A 2IBIB 1L2NA 2LI5A 2KQSA 1CJEA 2D2QA 2LVPA 4TQ0A 3A33B 3ZVVA 4FN2A 1I42A 4OHJA 1WE6A 2JUOA 4ICUA 4ARIA 2WHIA 3BWUD 2VH2A 3NZSA 3M62B 2L52A 2FBWB 3SDLC 1VRAB 2Y3AA 4DWFA 3RNCC 2V9HA 2Y5BB 2MBHA 1MI0A 1VLBA 4MGZE 4GXBA 3L54A 3AEFB 1YX5B 3M95A 1QLBB 1LGRA 3HRDD 4K81A 1RFKA 4C56C 2Y5PA 2X8XX 2WXKA 4GLSC 4OZBA 1K53A 2ZPYA 4P1CC 3KQ4A 2DZMA 3ZTCA 1K50A 2N4FA 4C00A 3FILB 3ZKJC 3C19A 1TYGB 3Q6BA 1TBEA 2N9XA 1VDVA 4YT0B 1IBXA 3A1QA 4II2B 1XLNA 2ONQA 3B0AA 5JHAA 1DYQA 4ICVA 3AN1A 3V62A 2FUHB 1PFDA 3TEZA 2J0JA 3IT6B 4B0EA 3RPFC 1EWCA 2I38A 3V61A 4ZHOA 2N7JA 1JALA 4W9GA 1MHHE 4XGAB 2R61A 4TSSA 1XCQL 2IO1B 3KUDB 1MFWA 1C77A 2RGFA 1IP9A 1PGXA 2NR2A 1OQRA 3X23A 3PRMB 3TEYA 1FO4A 5J2RA 1NI2A 3KLSX 1TT5B 1WM2A 4M8MA 4WJPA 4OVZA 3WA0A 2IZVB 5BMGA 2W82A 2FIFA 2QHOA 3U2SC 4HROA 2V3NA 3A9JB 3K9PB 2D3GA 2J4XA 4IWPA 3PLUA 2LRUA 4JPSA 2BTEA 2VRRB 2WXNA 1OQQA 3GE3C 4Q2JA 1G6JA 4WAAA 3APCA 4JIOU 2RR9A 4MACA 5G5GA 3AEDB 5LLIA 4J6IA 4HCNB 2D5GA 1LM8B 1C78A 2ZVOA 4KIKA 2NBVB 2WXJA 3ZW3A 4NJ7A 3RZWC 3AEAB 3TMPB 5IA7A 3H6NA 2IO0B 2QIEB 1F2RC 1KM7A 2K8CA 1CMXB 2WXHA 1C4AA 1C76A 2ZCCA 4DDGD 1DGJA 3Q8FA 1QOBA 2XBBC 1V49A 1C9FA 2REXA 4RFBA 5HKHA 1LO5D 1GNUA 3DOWA 4WJOA 2IO3B 3N1YC 3VAWA 3VH3B 2ZVNA 1NENB 2XNAC 4AOFA 1VZ8A 1VCBA 3IBEA 5D3IB 3W1YA 4WQMA 1GJZA 3UIOB 2WNMA 2JRIB 3NY5A 3ZNHB 3DBHI 1V2YA 3L4PA 1GB4A 5FR6A 1KJTA 4ZRJA 3Q3FA 1KLGD 2NMQA 2WXFA 4PS3A 1WYWB 2V3SA 3R2TA 1E6EB 1UBQA 3DDCB 3W9CB 2CS4A 3C8YA 3M63B 4LLGM 2AWTA 4OW0A 2RDGA 1KLUD 1EUVB 2KWDA 2XN9C 2KVRA 4CHKA 1SF0A 2OOBB 1HEZE 5J17A 5D6JB 5IO9A 2C7HA 3QC8B 2EKIA 2IPKD 5C1ZA 4HVBA 5EE0A 2CHXA 3TEXA 3U52E 1SB3C 3AE2B 1ZOYB 2JWZA 1WJ4A 1HTQA 3AECB 4XC2A 2MJDA 2N0SB 4F7ZA 2G45B 4DHZE 2FE8A 3OLMD 3LYYA 3PZ7A 5D3DA 3B1LX 1V5OA 3I9V1 2LGSA 4F8CB 1GUAB 2BVCA 4FA6A 1J7BA 4JE3B 1FD6A 4B0MA 2O6VD 3P4RB 4RGOS 4XX5A 5EE3A 2RMMA 4ANWA 3APFA 4YL8A 4LNIA 2INNE 3PT2B 3NHEB 1CZPA 1XLOA 1YX6B 2BYEA 1N5XA 1WRDB 4ANXA 3RD2A 5L95C 4TV3A 1OGWA 5CHWA 1EM7A 5G5HA 2Z8LA 1R4MB 3ZXRA 4HKQA 1WGRA 4NPNA 3KUCB 5E6JA 2DLBA 3T3OA 1T0RC 3WALA 1VD2A 4FADA 3TIXA 3V60A 2KFKB 1X1MA 2N9LA 2BW2A 3R2IA 4PYZA 2WS3B 2BKRB 4IM3A 1FCCC 4ZRPA 4MM3A 4NAWA 3AI5A 2LVQA 2D10A 3LJ3A 1QOAA 4N6EB 4PS8A 2V0GA 1J8CA 2KDFB 1SEBD 3VUWA 4NQLB 3AE5B 2KX3A 1FRRA 4K7WA 4GOCA 3EHVA 4HPLB 1GB1A 1XT9B 2BB5A 4KDIC 1YN4A 4HEA1 3VRBB 4JGHB 1E7VA 1UBIA 4GU2A 5BYQA 1LQBA 4MGIE 2FIDA 3Q3MC 1L7YA 2KQ7A 1N63A 5BO4B 3QHTA 4FULA 1UZXB 3IAS1 2W3SA 2IGGA 2ON8A 1D5ZC 1XF5L 3T8MA 2M0AA 3ZTDA 3E56A 2IJ0A 5TR5A 3DHIC 4KX6B 2DYMA 2QILA 2DYBA 2BQQA 4REZA 3ALBA 4W9KA 4O1NA 4WJNA 3ZJTA 2SEBD 2J0MA 4M00A 4GIVA 1OQYA 4NAMA 3V3XA 2JY6A 3P4PB 4RCOA 4QAYA 4F1SA 3N9YC 4ZYSA 1ZXIA 4P6VF 5GMVA 4BBNC 3MHSD 2QC8A 3QIJA 2VZKB 4P1BC 1D3ZA 1SJED 2L32A 2KTFA 3UQBA 3D32A 1FXAA 3VTWA 1ESFA 1J19A 1ZP0B 4KSLC 1TS5A 1NYRA 2WQYB 4TKNA 4AJYB 1WFYA 3PHWB 1STEA 1P1AA 2QJLA 1WZ3A 4IWOA 3P2BA 1FPYA 3ZO5B 3Q14C 3IAM1 3BVZA 2ASQA 2JYTA 4UDUC 3PZ8A 3Q69A 5HG2A 2MJEA 1ZW7A 1T0SC 2HJ8A 3VQIA 4BBNF 2GBKA 1WRIA 5CTRC 1SXTA 2K3UA 1BT0A 3QJZA 3PRZA 4TMAB 2KDIA 4IC7B 2KK8A 3R3MA 5H92C 1ZXHA 1I35A 1V8CA 4LNKA 4KKIA 4CYEA 3Q8EA 1V1PA 1WX8A 3DBLB 4YTMB 3CSTA 3J9CA 4HLEA 2HD5B 4BKGA 1F1HA 3PHXB 1SE3A 2MBQA 3N1ZC 1D6EC 4FJYA 5EE1A 1WZ0A 3B2FA 1ET6A 5D2MB 2HTME 5JHBA 2R2QA 3WIMA 3P4QB 2RDBC 5DPSA 2ZJDA 2OHFA 4A3PA 1P9DU 1WIAA 2KKCA 2JYEA 3L13A 2FCSA 1ISNA 5C2TB 2X38A 1MG8A 2TSSA 1ZPSA 2NPTB 3DHHC 2KD0A 1WXQA 1JW9D 1YNTE 1V6EA 4IKGA 1FNWA 2LGDA 1QOFA 4GDKB 1WJUA 2M19A 2IGDA 2UWQA 4RF0A 4K7SA 4HJGE 5D94A 2RSUA 3DWGC 1E7PB 3TSSA 3S2AA 4WWOA 1P7EA 4XDDA 4WURA 2KYWA 5BYRA 1GOZA 2SAKA 3VFKA 2KTRB 1AN8A 3LB8C 3P42A 4R3DA 2N9KA 2JZZA 4ITKA 2WDVB 3UINB 4ZYNA 2HE7A 3SEBA 2WXGA 2L0FA 1L4ZB 2BWES 4N59A 3TL5A 3C0RB 4DXAB 2G4DB 2BPSA 2O2VA 2MHJA 2DZJA 2PEAA 1TKGA 5HFYA 2MP2B 1L0XB 2CKHB 3HK0A 3CIRB 2PPHA 2G4SA 2MX2A 3L08A 4ZHPA 1L6UA 4II3B 1HA5A 4KGRA 4KZCA 4A9AA 3GB1A 2J7QB 1YJ1A 1YMHE 4WWPA 3CWIA 3PRPB 4HRSA 2ZPNA 4W9CA 2NBWB 4HDOA 2VZKD 2LUMA 4DXFA 1MG4A 2KDBA 2BYFA 2KLGA 1EU4A 4EEWA 2BBCA 1SGHA 5G55A 2WXRA 2MH7A 3O65B 3DVGX 1RLFA 1N60A 1WGYA 2N7DA 2MRPA 3MJWA 4RGNA 2PJHA 2YVCA 2AQ2B 5IP4D 1I4PA 3KWLA 3WANA 3ZNGC 1V97A 2V1YA 2CHZA 4E71A 3PGEA 3W1SC 3Q3NC 3QK0A 2QEJC 3ETRA 5MPOA 2AQ3B 2QSDA 3PLVA 1C3TA 3RNGC 4W9LA 4M0WA 1E5WA 1FNVA 2V3PA 1WYGA 3AE9B 3O13A 1FFVA 3EA6A 1JWUD 2Q5WD 3Q8AA 3BYTB 3ML8A 2E3TA 2O6VB 1FCLA 1I4RA 3SFDB 1XLPA 1A70A 3AMZA 2H88B 3IFWB 3VDZA 1CQVA 2BS3B 1WXVA 3MP9A 3W5UB 1L0YB 4G0NB 3ZYYX 4RMAA 1NI3A 1DOYA 2I1JA 2C9WB 3AE4B 2DX5B 4EFOA 2GBJA 2BGFA 4GDLA 2A5UA 3H7PB 2PE6B 1L0VB 4MH8A 4IW0A 2GMIC 4LJOB 1YJJA 3MC0B 1FXTB 2PE9A 4C4VB 1BXTA 3RT3B 3ZRFA 1JWSD 3GS2A 1R4NI 3L0WB 1TY0A 3QAQA 1ZDVA 2WX0A 4BKTA 2WXMA 3BINA 2K22A 4OZCA 2GLSA 1UD7A 2M1MA 1J0GA 3HVDA 3VVWB 2PTLA 5EDSA 1AWDA 1H4RA 1N6ZA 4DK5A 1NVID 1XD3B 4JWUC 2EMTA 1WM3A 2WDRB 4EZLA 1P3QU 4H2AA 3SHQA 1K8RB 2MCNB 1PQSA 2WXOA 3DBRI 4XWWA 1I7HA 1VJKA 4IM2A 2KHWB 4KSKC 4TUUA 2K1FA 2M17A 2FAZA 4DQOC 4C7ZA 2KJ6A 3PSEB 5C23A 2V4LA 2EKEC 1FEHA 3VRAB 2DAFA 3FILA 2V4IB 4XWTA 1F77A 1E8XA 1QKZA 5IOIA 3WAPA 2CJOA 4MSMB 4L23A 1L5PA 1WGHA 4ASWC 3B08A 2L1AA 1R4NB 4E3CA 4IUMB 1WJNA 3N32A 4W9FA 1TTNA 3LDZE 1TS2A 4TQ1A 4N9F4 4FJZA 2DNFA 1Y56A 3PS6A 2JVCA 2MEKA 1M4VA 1T5XD 4KGTA 1HZ5A 1WGKA 4RM8A 5FKAC 2AL6A 3VTVA 4WWMA 3IXSA 3W5VB 4ACFA 3AEBB 3DBRB 3WAMA 2RPQA 2KJRA 1C1YB 3OJ3A 4MJSB 3NG0A 4HKZE 2I2YA 3N30A 4DXGA 3JSVB 3DCGA 1ROEA 1PYWD 4NY0A 2JU6X 1K51A 2XK5B 4B6WA 5LNK1 4GMVA 3A9JA 4LDTD 2B3AA 1FFUA 3DQVA 4W9DA 3DBHB 1E90A 5BYSA 1WMHB 2YLMA 4DHJD 3ZLZA 2LRWA 2ZCBA 1SBBB 1P0RA 1U4AA 2OJWA 2LJ5A 2GBMA 4RNAA 1BMLC 1E8WA 4FLHA 1C4CA 4OZAA 3AE6B 4X57B 3TCAA 4KDLB 2KXJA 1JRPA 3N1XC 1PGBA 1JWBD 2ZZPB 4NNJB 2QDFA 2JXTA 4ANVA 1WX9A 1YIWA 4FJVB 1ZKHA 4I6PA 4EUTA 2LVOA 3ECIA 3OG5A 4WAFA 1T0QC 3V05A 3ZDTA 4AS1A 1IGCA 4LNNA 2ZEQA 4M01A 2KN4A 2GBRA 2KDMA 1C4PA 5D7GA 2W9NA 3EGRA 3H1UA 1QT9A 2Y5CA 3W2DA 1WX7A 2ACZB 3A9KB 2K5PA 4E74A 2AQ1B 3RYTA 2DYOA 2MSED 2DZIA 2KZRA 3EFUA 1S1QB 2WWZA 1XXGA 4PT5A 2K25A 5I4DA 1SIJA 4XDCA 2BT6A 2KACA 4BKSA 2L05A 3MC9A 4EE2A 2OEDA 3KYCD 2E6XA 3WAOA 4AJWA 2C7MB 2CR5A 4BFRA 3ZXVA 2WX1A 1NDDA 2G3QB 2INCC 1L6VA 3BK1A 3AH7A 3BYYB 4ANUA 4RF1A 1WR1A 4I6LB 1NEKB 4ZDVA 3ML9A 4AWJA 1Y8RC 2JRHA 3Q3OC 2DBYA 4IM0A 3Q8BA 2CJNA 1JQ4A 1FNUA 1IGDA 1ZUD2 3GZNI 2LFIA 2IO2B 3BVGA 3PZDA 1V86A 4EZJA 3KYDD 2INDC 1PGAA 2ICIA 2N1VA 5KHOA 1B9RA 2PVGC 1BUIC 5DPRA 4W9IA 3VH4B 4BOSC 3U4EG 3AV8A 3PTFC 4KGSA 2LD9A 3BVMA 3VUXA 2LGXA 2ZNVB 1KF6B 3Q2AC 4K7UA 2GOWA 2K39A 3NRZA 3MHZA 1TY2A 1UGMA 1RFAA 1I4HA 4S17A 3AB5A 3QX1A 1WXSA 3QWZB 2QMTA 2JZPA 3EUB2 2LXCA 3NS8A 1J7AA 3RN9C 1NYQA 2JPHA 4K1RB 2WXIA 3KUZA 2W54A 3U7ZA 1N5WA 2JF5A 2KT7A 2KFKA 3RNBC 2FCNA 4HJKA 2N7EA 4MDKE 2LJIA 1FRDA 4KZ0A 1XO3A 3V6CB 2LEKA 4BOZB 2M56B 2OJRA 4P7IA 1Q5WB 3AEEB 1HXYD 2PVOD 1SSNA 4JLCA 4OVVA 4YSXB 3EFCA 1SIFA 4CO7A 3ZGZA 1HE8A 3SD5A 3UGBB 2WXQA 2W3RA 4LCDE 2FCQA 3CMMB 1I4XA 3ZRCA 2L00B 1T6BX 4KVGB 1IBXB 3A1QB 3I3TB 4XE0A 2ZW0A 3VR9B 3VUYA 1OEYJ
chains in the Genus database with same CATH topology
3QK0A 4DBGA 1UBQA 4I6NB 3DDCB 3PLVA 2CS4A 1C3TA 4W9LA 5AZHA 3M63B 1E5WA 4JL9A 5DPTA 2AWTA 1OTRB 1EUVB 2KFJA 1KLVA 2K6DB 2KVRA 2IY1B 3JW0X 1M94A 3ML8A 2KMCA 2O6VB 3T9LA 4CHKA 2Z0EB 2OOBB 4MJSA 5J17A 5D6JB 2IYDB 3HM3A 4AUQC 1RAXA 3OJ4B 1E7UA 2KANA 1OEYA 3Q3JA 3IFWB 3JSVA 1WR6E 3VDZA 1T0YA 1WXVA 4G0NB 2C5LC 2XK5A 5J18A 1RRBA 2C7HA 2CHWA 2KLCA 3OAWA 3QC8B 1WGGA 4RMAA 5IAAC 3PPAA 2I1JA 2C9WB 5C1ZA 2DX5B 4EFOA 2KWUB 2L3ZA 2GBJA 2BGFA 4HVBA 1V9JA 2C60A 2M0XA 2CHXA 3RULA 2L7RA 5CX3A 1WMHA 1E8ZA 1WI0A 4GDLA 2K8BA 2A5UA 1WJ4A 2JWZA 3H7PB 3IHPC 4HDQA 3U30A 2PE6B 4BKSD 4HXDA 4XC2A 3EC8A 2Z0DB 4F7ZA 2G45B 4IW0A 4DHZE 2GMIC 4LJOB 3OLMD 1WGDA 1FXTB 2PE9A 4G50A 3B1LX 1GC6A 1V5OA 3RT3B 4F8CB 3CF6E 3ZRFA 1ZGUB 2KWCA 3HM6X 3ZNZB 1EO6A 1GUAB 4FA6A 3AU5A 1GC7A 5E6NA 2MBEA 1R4NI 3L0WB 3QAQA 2DAJA 3DBLI 3QA8A 2O6VD 3RUIB 2AYOB 4URKA 1V81A 2WX0A 3R66C 4XX5A 4BKTA 3HHMA 1TZ1A 1WXAA 3DVNU 3BINA 4ANWA 3APFA 3L17A 2A4ZA 4YL8A 1UD7A 4HK2A 2M1MA 1J0GA 3VVWB 1EF1A 4W9HA 3PT2B 4XZ4A 5AZGA 3VTUA 3NHEB 2FCMA 5EDSA 1YX6B 1H4RA 2BYEA 3UQAA 2M8SA 4KIKB 3TBLD 4DK5A 1XD3B 1AARA 2EMTA 1WM3A 1WRDB 2LGYA 5E6OA 2O2VB 4PYUA 4TV3A 3RD2A 3ZDMC 4ANXA 4EZKA 5L95C 1OGWA 5CHWA 3PGEA 4EZLA 1P3QU 3MTNB 3X0WA 3SHQA 1K8RB 2MCNB 1PQSA 3DBRI 1WGRA 4NPNA 4BVUC 3PV1A 3DPDA 1YD8U 2KHWB 3KUCB 4IM2A 4KSKC 4WWNA 2N9EB 4TUUA 2K1FA 1Z2MA 3QCAA 2M17A 4GN1A 2FAZA 3H7SA 4WJQA 3WALA 1VD2A 2KJ6A 4FADA 3PSEB 5C23A 3TIXA 1LXDA 2MLBA 3V60A 2J0KA 4MELA 3A9KA 3KVFB 2KFKB 1X1MA 1WXMA 2UYZB 2V4LA 2EKEC 1UH6A 2JZ3B 2DAFA 2KO3A 3CSFA 4PYZA 1IYFA 2BKRB 4IM3A 1UELA 3ZUNA 4MM3A 1SE9A 4FHJA 4NAWA 3AI5A 2DENB 1E8XA 2LVQA 4DDID 2D10A 3LJ3A 1Q0WB 4PS8A 3WAPA 4G3XB 4MSMB 3A4SC 1J8CA 3JYUA 2KDFB 4A20A 2MA9B 1WGHA 4ASWC 3B08A 3TJPA 1S3SG 3VUWA 4NQLB 4FBJB 3ZIMA 2KX3A 2N9PC 2KOXA 1WE7A 2CU1A 2NVUI 4AP4C 5G2NA 2EMSA 4K7WA 4E3CA 4IUMB 4LDTB 3PREA 1WJNA 3EHVA 4GOCA 4HPLB 3N32A 4W9FA 2NS5A 1E8YA 1TTNA 3AULA 3LDZE 2K6QA 4TQ1A 1XT9B 4N9F4 4FJZA 4DHJB 2WDTB 4KDIC 2KNBA 3W1SC 3PS6A 2JVCA 4GB9A 3N3KB 4JGHB 1E7VA 1V80A 4HCPB 2IY0B 4W9EA 1UBIA 2AEHA 4GU2A 4MH0E 1LQBA 4MGIE 2FIDA 2NPTA 1L7YA 2KQ7A 2NBUA 3AU4A 5BO4B 2XEWA 4M0WB 4KV2A 3QHTA 4RM8A 4FULA 2AL6A 4MGKE 3RZFA 1UZXB 3VTVA 1V5TA 2KDEB 1XQQA 2MBBB 3T8MA 2ZNVC 2MWSB 3WAMA 3ZTDA 2KC1A 5JH5C 2RPQA 2KJRA 1C1YB 3OJ3A 4GDKA 4MJSB 5TR5A 4B9KA 3W1SA 2K8HA 3U8ZA 1H8CA 2JXXA 3NOBA 2BYVE 2DYMA 2L8JA 2DYBA 2KMAA 3N30A 3KH0A 3QARA 3JSVB 5KHQA 3DCGA 3ALBA 3HIZA 3L10B 4W9KA 4JQWC 4NY0A 2XK5B 4GGQA 4W9JA 4WJNA 4B6WA 3R7RA 2JT4B 4ZRIA 3H9DA 2NCNA 4GMVA 2J0MA 3A9JA 2B3AA 4LDTD 3DQVA 3VXWA 3L16A 4GIVA 4W9DA 2D07B 1OQYA 1E90A 2JY6A 3PVLA 3IVFA 1WMHB 3NZUA 2YLMA 4DHJD 5LXIB 4GDLB 3ZLZA 4F1SA 2LRWA 2ZCBA 1P0RA 2KTRA 5GMVA 2LUEA 4BBNC 2IBIB 1L2NA 1U4AA 2LI5A 2KWVB 2LJ5A 2GBMA 3MHSD 2KQSA 1E8WA 4FLHA 2LWPA 5CHVC 2D2QA 1WF9A 2LVPA 4TQ0A 3A33B 3ZVVA 3QIJA 4FN2A 2HTHA 3ZNID 1I42A 4X57B 1D3ZA 1WE6A 1GG3A 2KXJA 3DVGY 2JUOA 4ICUA 4KDLB 3RCZA 2KTFA 3TCAA 3V6EB 3UQBA 3D32A 2ZZPB 4NNJB 3VTWA 1LFDA 4IWQA 3NZSA 1EF5A 1J19A 4ANVA 1WH3A 2MP2A 3M62B 4KSLC 5AEKB 3SDLC 1WX9A 4DWFA 1YIWA 4TKNA 2KJHB 4PS7A 2DZKA 2Y5BB 2MBHA 4AJYB 1WFYA 4FJVB 1ZKHA 3PHWB 4I6PA 4EUTA 2LVOA 4MSQB 3A4RA 1P1AA 3ECIA 3EECA 2BF8B 4ZRKA 4MGZE 4GXBA 1WZ3A 4IWOA 3APDA 3L54A 3P2BA 3ZDTA 3ZO5B 1YX5B 2GBNA 3M95A 1Z5SB 4MEMA 2ZEQA 4K81A 1TGZB 2ASQA 4FHKA 2BWFA 1ZW7A 4A3OA 2HJ8A 3VQIA 4BBNF 2GBKA 3ONSA 2GBRA 2L0TA 5CTRC 5D7GA 3JVZX 1BT0A 2W9NA 3H1UA 3QJZA 3PRZA 4OVUA 2KDIA 1Q1OA 1WX7A 2ZPYA 4IC7B 1WJ6A 2KK8A 3R3MA 1I35A 3A9KB 2DZMA 3ZTCA 2N4FA 4EOYA 4E74A 3RYTA 3VHTC 4CYEA 2DYOA 2MSED 2MBOA 2DZIA 2KZRA 1WX8A 1S1QB 3EFUA 2WWZA 3ZKJC 4NAWB 1F9JA 1TBEA 2N9XA 1JRUA 3CSTA 3U7DA 4HLEA 2K25A 3ENEA 2HD5B 4BKGA 3A1QA 1WY8A 4BKSA 2L76A 3PHXB 2MBQA 4II2B 2L05A 2DHZA 4FJYA 4M8NA 3KYCD 3B0AA 3WAOA 5JHAA 4AJWA 2C7MB 2CR5A 1WZ0A 3UF8A 5D2MB 5E6PA 4ICVA 4BFRA 2AL3A 5JHBA 2R2QA 2RD0A 3M3JA 3V62A 2Z59B 2WX1A 1NDDA 2FUHB 2G3QB 3WIMA 5DPSA 2ZJDA 2J0JA 3DVNV 4RM9A 4WQOB 4A3PA 1P9DU 1KOTA 1WIAA 2KKCA 3L13A 2FCSA 2O6VA 1ISNA 3V61A 4ANUA 1MG8A 4W9GA 1WR1A 2FNJB 4I6LB 2IO1B 3KUDB 4ZDVA 2NPTB 2RGFA 3ML9A 4AWJA 1IP9A 1Y8RC 2NR2A 2KD0A 3BY4B 3X23A 3PRMB 2JRHA 5J2RA 1NI2A 1V6EA 4IM0A 2KX0A 5CHFA 2LGDA 2M4NA 1WM2A 4M8MA 5JZEB 1R4MI 3GZNI 3K9OB 4WJPA 2D11A 2IO2B 2IZVB 4GDKB 1WJUA 3WA0A 3H7PA 2BKFA 2UWQA 3IG3A 3PZDA 1V86A 2FIFA 2QHOA 4EZJA 4K7SA 3KYDD 3AXCA 4HPMB 5D94A 2RSUA 2N1VA 3KW5B 2KC2A 3S2AA 5KHOA 1A5RA 4WWOA 3A9JB 4B95A 3K9PB 2D3GA 5DPRA 4W9IA 4IWPA 3VH4B 3PLUA 2LRUA 2VRRB 3VFKA 4BOSC 2KTRB 1G6JA 3PTFC 4WAAA 1YQBA 3APCA 4MGYE 5DCNA 5AZFA 4JIOU 2RR9A 2LD9A 4NJ6A 2JZZA 3UINB 4ZYNA 3VUXA 2LGXA 2HE7A 4E71A 2ZNVB 3QQ8B 5LLIA 2L0FA 4J6IA 4HCNB 4K7UA 2BWES 1LM8B 2GOWA 2N1WA 2K39A 3DBSA 3TL5A 3C0RB 2ZVOA 4KIKA 2NBVB 4DXAB 2G4DB 1NBFC 1UGMA 3ZW3A 2BPSA 4NJ7A 2O2VA 3RZWC 1RFAA 3R7QA 3SU8X 2DZJA 2PEAA 3TMPB 5IA7A 3H6NA 2IO0B 3QX1A 1KM7A 2MP2B 1WXSA 3QWZB 2CKHB 5L83A 2K8CA 2LXCA 1CMXB 3HK0A 4EKUA 3NS8A 2ZCCA 2PPHA 2G4SA 2MX2A 3L08A 4DDGD 2JPHA 4HWIB 4II3B 5LXHA 4K1RB 2I1KA 2XBBC 4KZCA 1V49A 4NQKE 2REXA 3KUZA 2J7QB 2C7NB 2WYQA 5HKHA 1YJ1A 1GNUA 4WWPA 2JF5A 3PRPB 2KFKA 3DOWA 2ZPNA 4WJOA 4GSWA 2FCNA 2IO3B 2N7EA 4HJKA 2NBWB 4W9CA 4MDKE 4HDOA 4KZ0A 3VAWA 3VH3B 2LASA 2ZVNA 2LXAA 3V6CB 4AOFA 2KDBA 1VCBA 4LJPB 2BYFA 2MQJA 4BOZB 2OJRA 3GOEA 4P7IA 3IBEA 3UIPB 3W1YA 1Q5WB 1P98A 2LZ6A 2KLGA 1IPGA 4G11A 4DHZB 4EEWA 4JLCA 1SGHA 4OVVA 5G55A 3UIOB 1GJZA 3O65B 2JRIB 3DVGX 1RLFA 1SIFA 3NY5A 1WGYA 1QZEA 2N7DA 3ZNHB 4CO7A 3DBHI 4IG7B 1V2YA 1HE8A 2MW5A 2MRPA 3MJWA 3SD5A 2R2OA 5FR6A 1KJTA 3UGBB 4ZRJA 4LCDE 3Q3FA 2FCQA 2PJHA 3CMMB 2YVCA 4PS3A 3ZRCA 2L00B 3WANA 3ZNGC 1WYWB 5DPWA 4KVGB 2V3SA 2V1YA 3A1QB 3I3TB 2CHZA 2KN5A 3VUYA 1OEYJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QK0 A;  4DBG A;  1UBQ A;  4I6N B;  3DDC B;  3PLV A;  2CS4 A;  1C3T A;  4W9L A;  5AZH A;  3M63 B;  1E5W A;  4JL9 A;  5DPT A;  2AWT A;  1OTR B;  1EUV B;  2KFJ A;  1KLV A;  2K6D B;  2KVR A;  2IY1 B;  3JW0 X;  1M94 A;  3ML8 A;  2KMC A;  2O6V B;  3T9L A;  4CHK A;  2Z0E B;  2OOB B;  4MJS A;  5J17 A;  5D6J B;  2IYD B;  3HM3 A;  4AUQ C;  1RAX A;  3OJ4 B;  1E7U A;  2KAN A;  1OEY A;  3Q3J A;  3IFW B;  3JSV A;  1WR6 E;  3VDZ A;  1T0Y A;  1WXV A;  4G0N B;  2C5L C;  2XK5 A;  5J18 A;  1RRB A;  2C7H A;  2CHW A;  2KLC A;  3OAW A;  3QC8 B;  1WGG A;  4RMA A;  5IAA C;  3PPA A;  2I1J A;  2C9W B;  5C1Z A;  2DX5 B;  4EFO A;  2KWU B;  2L3Z A;  2GBJ A;  2BGF A;  4HVB A;  1V9J A;  2C60 A;  2M0X A;  2CHX A;  3RUL A;  2L7R A;  5CX3 A;  1WMH A;  1E8Z A;  1WI0 A;  4GDL A;  2K8B A;  2A5U A;  1WJ4 A;  2JWZ A;  3H7P B;  3IHP C;  4HDQ A;  3U30 A;  2PE6 B;  4BKS D;  4HXD A;  4XC2 A;  3EC8 A;  2Z0D B;  4F7Z A;  2G45 B;  4IW0 A;  4DHZ E;  2GMI C;  4LJO B;  3OLM D;  1WGD A;  1FXT B;  2PE9 A;  4G50 A;  3B1L X;  1GC6 A;  1V5O A;  3RT3 B;  4F8C B;  3CF6 E;  3ZRF A;  1ZGU B;  2KWC A;  3HM6 X;  3ZNZ B;  1EO6 A;  1GUA B;  4FA6 A;  3AU5 A;  1GC7 A;  5E6N A;  2MBE A;  1R4N I;  3L0W B;  3QAQ A;  2DAJ A;  3DBL I;  3QA8 A;  2O6V D;  3RUI B;  2AYO B;  4URK A;  1V81 A;  2WX0 A;  3R66 C;  4XX5 A;  4BKT A;  3HHM A;  1TZ1 A;  1WXA A;  3DVN U;  3BIN A;  4ANW A;  3APF A;  3L17 A;  2A4Z A;  4YL8 A;  1UD7 A;  4HK2 A;  2M1M A;  1J0G A;  3VVW B;  1EF1 A;  4W9H A;  3PT2 B;  4XZ4 A;  5AZG A;  3VTU A;  3NHE B;  2FCM A;  5EDS A;  1YX6 B;  1H4R A;  2BYE A;  3UQA A;  2M8S A;  4KIK B;  3TBL D;  4DK5 A;  1XD3 B;  1AAR A;  2EMT A;  1WM3 A;  1WRD B;  2LGY A;  5E6O A;  2O2V B;  4PYU A;  4TV3 A;  3RD2 A;  3ZDM C;  4ANX A;  4EZK A;  5L95 C;  1OGW A;  5CHW A;  3PGE A;  4EZL A;  1P3Q U;  3MTN B;  3X0W A;  3SHQ A;  1K8R B;  2MCN B;  1PQS A;  3DBR I;  1WGR A;  4NPN A;  4BVU C;  3PV1 A;  3DPD A;  1YD8 U;  2KHW B;  3KUC B;  4IM2 A;  4KSK C;  4WWN A;  2N9E B;  4TUU A;  2K1F A;  1Z2M A;  3QCA A;  2M17 A;  4GN1 A;  2FAZ A;  3H7S A;  4WJQ A;  3WAL A;  1VD2 A;  2KJ6 A;  4FAD A;  3PSE B;  5C23 A;  3TIX A;  1LXD A;  2MLB A;  3V60 A;  2J0K A;  4MEL A;  3A9K A;  3KVF B;  2KFK B;  1X1M A;  1WXM A;  2UYZ B;  2V4L A;  2EKE C;  1UH6 A;  2JZ3 B;  2DAF A;  2KO3 A;  3CSF A;  4PYZ A;  1IYF A;  2BKR B;  4IM3 A;  1UEL A;  3ZUN A;  4MM3 A;  1SE9 A;  4FHJ A;  4NAW A;  3AI5 A;  2DEN B;  1E8X A;  2LVQ A;  4DDI D;  2D10 A;  3LJ3 A;  1Q0W B;  4PS8 A;  3WAP A;  4G3X B;  4MSM B;  3A4S C;  1J8C A;  3JYU A;  2KDF B;  4A20 A;  2MA9 B;  1WGH A;  4ASW C;  3B08 A;  3TJP A;  1S3S G;  3VUW A;  4NQL B;  4FBJ B;  3ZIM A;  2KX3 A;  2N9P C;  2KOX A;  1WE7 A;  2CU1 A;  2NVU I;  4AP4 C;  5G2N A;  2EMS A;  4K7W A;  4E3C A;  4IUM B;  4LDT B;  3PRE A;  1WJN A;  3EHV A;  4GOC A;  4HPL B;  3N32 A;  4W9F A;  2NS5 A;  1E8Y A;  1TTN A;  3AUL A;  3LDZ E;  2K6Q A;  4TQ1 A;  1XT9 B;  4N9F 4;  4FJZ A;  4DHJ B;  2WDT B;  4KDI C;  2KNB A;  3W1S C;  3PS6 A;  2JVC A;  4GB9 A;  3N3K B;  4JGH B;  1E7V A;  1V80 A;  4HCP B;  2IY0 B;  4W9E A;  1UBI A;  2AEH A;  4GU2 A;  4MH0 E;  1LQB A;  4MGI E;  2FID A;  2NPT A;  1L7Y A;  2KQ7 A;  2NBU A;  3AU4 A;  5BO4 B;  2XEW A;  4M0W B;  4KV2 A;  3QHT A;  4RM8 A;  4FUL A;  2AL6 A;  4MGK E;  3RZF A;  1UZX B;  3VTV A;  1V5T A;  2KDE B;  1XQQ A;  2MBB B;  3T8M A;  2ZNV C;  2MWS B;  3WAM A;  3ZTD A;  2KC1 A;  5JH5 C;  2RPQ A;  2KJR A;  1C1Y B;  3OJ3 A;  4GDK A;  4MJS B;  5TR5 A;  4B9K A;  3W1S A;  2K8H A;  3U8Z A;  1H8C A;  2JXX A;  3NOB A;  2BYV E;  2DYM A;  2L8J A;  2DYB A;  2KMA A;  3N30 A;  3KH0 A;  3QAR A;  3JSV B;  5KHQ A;  3DCG A;  3ALB A;  3HIZ A;  3L10 B;  4W9K A;  4JQW C;  4NY0 A;  2XK5 B;  4GGQ A;  4W9J A;  4WJN A;  4B6W A;  3R7R A;  2JT4 B;  4ZRI A;  3H9D A;  2NCN A;  4GMV A;  2J0M A;  3A9J A;  2B3A A;  4LDT D;  3DQV A;  3VXW A;  3L16 A;  4GIV A;  4W9D A;  2D07 B;  1OQY A;  1E90 A;  2JY6 A;  3PVL A;  3IVF A;  1WMH B;  3NZU A;  2YLM A;  4DHJ D;  5LXI B;  4GDL B;  3ZLZ A;  4F1S A;  2LRW A;  2ZCB A;  1P0R A;  2KTR A;  5GMV A;  2LUE A;  4BBN C;  2IBI B;  1L2N A;  1U4A A;  2LI5 A;  2KWV B;  2LJ5 A;  2GBM A;  3MHS D;  2KQS A;  1E8W A;  4FLH A;  2LWP A;  5CHV C;  2D2Q A;  1WF9 A;  2LVP A;  4TQ0 A;  3A33 B;  3ZVV A;  3QIJ A;  4FN2 A;  2HTH A;  3ZNI D;  1I42 A;  4X57 B;  1D3Z A;  1WE6 A;  1GG3 A;  2KXJ A;  3DVG Y;  2JUO A;  4ICU A;  4KDL B;  3RCZ A;  2KTF A;  3TCA A;  3V6E B;  3UQB A;  3D32 A;  2ZZP B;  4NNJ B;  3VTW A;  1LFD A;  4IWQ A;  3NZS A;  1EF5 A;  1J19 A;  4ANV A;  1WH3 A;  2MP2 A;  3M62 B;  4KSL C;  5AEK B;  3SDL C;  1WX9 A;  4DWF A;  1YIW A;  4TKN A;  2KJH B;  4PS7 A;  2DZK A;  2Y5B B;  2MBH A;  4AJY B;  1WFY A;  4FJV B;  1ZKH A;  3PHW B;  4I6P A;  4EUT A;  2LVO A;  4MSQ B;  3A4R A;  1P1A A;  3ECI A;  3EEC A;  2BF8 B;  4ZRK A;  4MGZ E;  4GXB A;  1WZ3 A;  4IWO A;  3APD A;  3L54 A;  3P2B A;  3ZDT A;  3ZO5 B;  1YX5 B;  2GBN A;  3M95 A;  1Z5S B;  4MEM A;  2ZEQ A;  4K81 A;  1TGZ B;  2ASQ A;  4FHK A;  2BWF A;  1ZW7 A;  4A3O A;  2HJ8 A;  3VQI A;  4BBN F;  2GBK A;  3ONS A;  2GBR A;  2L0T A;  5CTR C;  5D7G A;  3JVZ X;  1BT0 A;  2W9N A;  3H1U A;  3QJZ A;  3PRZ A;  4OVU A;  2KDI A;  1Q1O A;  1WX7 A;  2ZPY A;  4IC7 B;  1WJ6 A;  2KK8 A;  3R3M A;  1I35 A;  3A9K B;  2DZM A;  3ZTC A;  2N4F A;  4EOY A;  4E74 A;  3RYT A;  3VHT C;  4CYE A;  2DYO A;  2MSE D;  2MBO A;  2DZI A;  2KZR A;  1WX8 A;  1S1Q B;  3EFU A;  2WWZ A;  3ZKJ C;  4NAW B;  1F9J A;  1TBE A;  2N9X A;  1JRU A;  3CST A;  3U7D A;  4HLE A;  2K25 A;  3ENE A;  2HD5 B;  4BKG A;  3A1Q A;  1WY8 A;  4BKS A;  2L76 A;  3PHX B;  2MBQ A;  4II2 B;  2L05 A;  2DHZ A;  4FJY A;  4M8N A;  3KYC D;  3B0A A;  3WAO A;  5JHA A;  4AJW A;  2C7M B;  2CR5 A;  1WZ0 A;  3UF8 A;  5D2M B;  5E6P A;  4ICV A;  4BFR A;  2AL3 A;  5JHB A;  2R2Q A;  2RD0 A;  3M3J A;  3V62 A;  2Z59 B;  2WX1 A;  1NDD A;  2FUH B;  2G3Q B;  3WIM A;  5DPS A;  2ZJD A;  2J0J A;  3DVN V;  4RM9 A;  4WQO B;  4A3P A;  1P9D U;  1KOT A;  1WIA A;  2KKC A;  3L13 A;  2FCS A;  2O6V A;  1ISN A;  3V61 A;  4ANU A;  1MG8 A;  4W9G A;  1WR1 A;  2FNJ B;  4I6L B;  2IO1 B;  3KUD B;  4ZDV A;  2NPT B;  2RGF A;  3ML9 A;  4AWJ A;  1IP9 A;  1Y8R C;  2NR2 A;  2KD0 A;  3BY4 B;  3X23 A;  3PRM B;  2JRH A;  5J2R A;  1NI2 A;  1V6E A;  4IM0 A;  2KX0 A;  5CHF A;  2LGD A;  2M4N A;  1WM2 A;  4M8M A;  5JZE B;  1R4M I;  3GZN I;  3K9O B;  4WJP A;  2D11 A;  2IO2 B;  2IZV B;  4GDK B;  1WJU A;  3WA0 A;  3H7P A;  2BKF A;  2UWQ A;  3IG3 A;  3PZD A;  1V86 A;  2FIF A;  2QHO A;  4EZJ A;  4K7S A;  3KYD D;  3AXC A;  4HPM B;  5D94 A;  2RSU A;  2N1V A;  3KW5 B;  2KC2 A;  3S2A A;  5KHO A;  1A5R A;  4WWO A;  3A9J B;  4B95 A;  3K9P B;  2D3G A;  5DPR A;  4W9I A;  4IWP A;  3VH4 B;  3PLU A;  2LRU A;  2VRR B;  3VFK A;  4BOS C;  2KTR B;  1G6J A;  3PTF C;  4WAA A;  1YQB A;  3APC A;  4MGY E;  5DCN A;  5AZF A;  4JIO U;  2RR9 A;  2LD9 A;  4NJ6 A;  2JZZ A;  3UIN B;  4ZYN A;  3VUX A;  2LGX A;  2HE7 A;  4E71 A;  2ZNV B;  3QQ8 B;  5LLI A;  2L0F A;  4J6I A;  4HCN B;  4K7U A;  2BWE S;  1LM8 B;  2GOW A;  2N1W A;  2K39 A;  3DBS A;  3TL5 A;  3C0R B;  2ZVO A;  4KIK A;  2NBV B;  4DXA B;  2G4D B;  1NBF C;  1UGM A;  3ZW3 A;  2BPS A;  4NJ7 A;  2O2V A;  3RZW C;  1RFA A;  3R7Q A;  3SU8 X;  2DZJ A;  2PEA A;  3TMP B;  5IA7 A;  3H6N A;  2IO0 B;  3QX1 A;  1KM7 A;  2MP2 B;  1WXS A;  3QWZ B;  2CKH B;  5L83 A;  2K8C A;  2LXC A;  1CMX B;  3HK0 A;  4EKU A;  3NS8 A;  2ZCC A;  2PPH A;  2G4S A;  2MX2 A;  3L08 A;  4DDG D;  2JPH A;  4HWI B;  4II3 B;  5LXH A;  4K1R B;  2I1K A;  2XBB C;  4KZC A;  1V49 A;  4NQK E;  2REX A;  3KUZ A;  2J7Q B;  2C7N B;  2WYQ A;  5HKH A;  1YJ1 A;  1GNU A;  4WWP A;  2JF5 A;  3PRP B;  2KFK A;  3DOW A;  2ZPN A;  4WJO A;  4GSW A;  2FCN A;  2IO3 B;  2N7E A;  4HJK A;  2NBW B;  4W9C A;  4MDK E;  4HDO A;  4KZ0 A;  3VAW A;  3VH3 B;  2LAS A;  2ZVN A;  2LXA A;  3V6C B;  4AOF A;  2KDB A;  1VCB A;  4LJP B;  2BYF A;  2MQJ A;  4BOZ B;  2OJR A;  3GOE A;  4P7I A;  3IBE A;  3UIP B;  3W1Y A;  1Q5W B;  1P98 A;  2LZ6 A;  2KLG A;  1IPG A;  4G11 A;  4DHZ B;  4EEW A;  4JLC A;  1SGH A;  4OVV A;  5G55 A;  3UIO B;  1GJZ A;  3O65 B;  2JRI B;  3DVG X;  1RLF A;  1SIF A;  3NY5 A;  1WGY A;  1QZE A;  2N7D A;  3ZNH B;  4CO7 A;  3DBH I;  4IG7 B;  1V2Y A;  1HE8 A;  2MW5 A;  2MRP A;  3MJW A;  3SD5 A;  2R2O A;  5FR6 A;  1KJT A;  3UGB B;  4ZRJ A;  4LCD E;  3Q3F A;  2FCQ A;  2PJH A;  3CMM B;  2YVC A;  4PS3 A;  3ZRC A;  2L00 B;  3WAN A;  3ZNG C;  1WYW B;  5DPW A;  4KVG B;  2V3S A;  2V1Y A;  3A1Q B;  3I3T B;  2CHZ A;  2KN5 A;  3VUY A;  1OEY J; 
#chains in the Genus database with same CATH topology
 3AE1 B;  4DBG A;  1YQ3 B;  4I6N B;  2WP9 B;  2RDH A;  3HUI A;  3RNF C;  4D2K A;  4JL9 A;  3MC8 A;  2K9X A;  1KFY B;  1XEE A;  2J42 A;  2K6D B;  3JW0 X;  1M94 A;  3R8B A;  1SJH D;  2Z0E B;  2JQR B;  5AUK A;  2PW9 A;  1RM6 C;  4AUQ C;  3Q8C A;  1RAX A;  3OJ4 B;  3Q3J A;  1OEY A;  2WU5 B;  3RNE C;  4ZRQ A;  4YTN B;  3B9J A;  5J18 A;  2KLC A;  1E10 A;  1WGG A;  4YSY B;  2DWQ A;  1F52 A;  2KWU B;  2L3Z A;  1F0Z A;  2C60 A;  2M0X A;  2RPV A;  5HHD G;  2L7R A;  4K3C A;  1WI0 A;  2K8B A;  4HDQ A;  3U30 A;  4C7Y A;  3RFZ B;  5H8Y E;  3EC8 A;  2Z0D B;  1V1O A;  1WGD A;  4G50 A;  1RYJ A;  1FM0 D;  2K0P A;  3NVW A;  1ZGU B;  3HM6 X;  5T8I A;  1EO6 A;  1GC7 A;  5E6N A;  2MBE A;  5C3J B;  2DAJ A;  3QA8 A;  3RUI B;  1V81 A;  3NVY A;  3VR8 B;  4LK0 M;  1TZ1 A;  3DVN U;  3UI3 A;  1CK1 A;  1FXI A;  3NZ3 A;  1EF1 A;  4W9H A;  4XZ4 A;  2FCM A;  3P1M A;  1UWM A;  4RH6 A;  2D3C A;  2GB1 A;  2M8S A;  4KIK B;  1AAR A;  2LGY A;  5E6O A;  2JWU A;  3ZDM C;  4PYU A;  4EZK A;  4LNO A;  1MVK A;  3MTN B;  3X0W A;  1D5X C;  4YSZ B;  3PV1 A;  1MHX A;  2N9E B;  1UF0 A;  4GN1 A;  1KH0 A;  4WJQ A;  2ZW1 A;  1QQR A;  2MLB A;  4MEL A;  2GI9 A;  4K3B A;  3NJT A;  2KO3 A;  1IYF A;  3ZUN A;  1SE9 A;  1TS4 A;  1IUE A;  1Q0W B;  3JYU A;  4A20 A;  1TIF A;  3TJP A;  1S3S G;  4FBJ B;  4L2Y A;  2N9P C;  2KOX A;  1WE7 A;  2CU1 A;  4AQ7 A;  4AP4 C;  5G2N A;  2EMS A;  4LDT B;  2G9H D;  1E8Y A;  3AUL A;  1UWX A;  4YWG G;  4US8 A;  4DHJ B;  2GRI A;  2WDT B;  2D3A A;  2KNB A;  4GB9 A;  3N3K B;  2LHD A;  1V80 A;  2EEL A;  3HVZ A;  4MH0 E;  2NPT A;  2H89 B;  2XEW A;  3URY A;  2BYT A;  3P4S B;  4IDI A;  1JWM D;  3I57 A;  3H8H A;  4LTU A;  4YXD B;  1MPE A;  1TKE A;  2ZNV C;  2KC1 A;  2NTT A;  4GDK A;  1I4G A;  4B9K A;  2KMM A;  2K8H A;  3U8Z A;  3NOB A;  1VZ7 A;  2BYV E;  2L8J A;  4JX1 C;  3QAR A;  4P16 A;  2L83 A;  3L10 B;  3HIZ A;  4GGQ A;  4W9J A;  3R7R A;  2JT4 B;  3H9D A;  2NCN A;  1AW7 A;  3VXW A;  3L16 A;  3TUO A;  2D07 B;  1T3Q A;  3NZU A;  2CU3 A;  4J3O D;  2KTR A;  4XYC A;  1SE2 A;  2KWV B;  4A8X C;  1KRH A;  2INP E;  2LWP A;  5CHV C;  1WF9 A;  3GE8 C;  3P63 A;  3ZNI D;  2HTH A;  4ARC A;  1GG3 A;  3DVG Y;  3RCZ A;  3V6E B;  3TEW A;  4L1B A;  1LFD A;  5BMH A;  4IWQ A;  1EF5 A;  1JWA D;  1WH3 A;  2MP2 A;  2WDQ B;  5AEK B;  3FC4 A;  1QF6 A;  2KJH B;  1GAQ B;  4PS7 A;  2DZK A;  1N61 A;  4MSQ B;  3A4R A;  3EEC A;  2BF8 B;  4ZRK A;  3NS1 A;  4LNF A;  4KKJ A;  1ACC A;  3APD A;  2GBN A;  1Z5S B;  4MEM A;  4YTP B;  1TGZ B;  4FHK A;  2BWF A;  1UUP A;  4A3O A;  2QCZ A;  3B2G A;  1Q10 A;  3ONS A;  4A90 A;  2L0T A;  3NVZ A;  3JVZ X;  4PK1 A;  3ABV B;  4OVU A;  2KQ4 X;  1Q1O A;  1WJ6 A;  4BAX A;  1J7C A;  2HDE A;  2B76 B;  4EOY A;  2JSV X;  3VHT C;  2MBO A;  4MM3 B;  3E9S A;  4NAW B;  1F9J A;  1JRU A;  3U7D A;  1VZ6 A;  3ENE A;  1WY8 A;  2L76 A;  2DHZ A;  4M8N A;  5GXG B;  3UF8 A;  5E6P A;  2MJ3 A;  2AL3 A;  2RD0 A;  3M3J A;  2Z59 B;  2WU2 B;  3DVN V;  4RM9 A;  4WQO B;  1KOT A;  2VH1 A;  2O6V A;  3OWE B;  1TJE A;  2JX5 A;  3SR6 A;  2FNJ B;  1HTO A;  2IDY A;  1EU3 A;  3BY4 B;  2BS2 B;  4HPP A;  2HJ1 A;  3KWV A;  3FKY A;  1ENF A;  2KX0 A;  1VR9 A;  5CHF A;  4CQN A;  2M4N A;  5JZE B;  1R4M I;  2PLP A;  1R7S A;  3AE8 B;  3K9O B;  1YJI A;  2D11 A;  2YEP B;  1N62 A;  3H7P A;  1UNS A;  2BKF A;  3IG3 A;  4S0R A;  1I4Q A;  3AM9 A;  3AXC A;  4BZA A;  4HPM B;  3KW5 B;  2KC2 A;  1A5R A;  4C4V A;  4A6Q A;  3ZJV A;  4B95 A;  1P7F A;  4ZOH C;  1PDX A;  4NZL B;  3AE7 B;  4MT5 A;  3DWM A;  3IT4 B;  1OFF A;  2WLB A;  5FK9 C;  1YQB A;  4MGY E;  5DCN A;  5AZF A;  4NJ6 A;  2J53 A;  3QQ8 B;  1HQR D;  1JRO A;  2N1W A;  3DBS A;  1TZO A;  1NBF C;  3R7Q A;  2WXP A;  3SU8 X;  1GPX A;  2W55 A;  5L83 A;  1D5M C;  4EKU A;  3I5J C;  4HWI B;  3WCQ A;  5LXH A;  5FR3 A;  2I1K A;  4NQK E;  2C7N B;  3AE3 B;  2WYQ A;  1WWT A;  4GSW A;  4M02 A;  2LAS A;  2LXA A;  4LJP B;  2MQJ A;  1DOX A;  3GOE A;  3I63 C;  3UIP B;  1YN3 A;  1P98 A;  2LZ6 A;  1IPG A;  4G11 A;  4DHZ B;  3MJ5 A;  1HZ6 A;  1QIL A;  1QZE A;  4IG7 B;  5BMI A;  3MFG A;  2MW5 A;  2R2O A;  1V1P B;  4NJC A;  2PMV A;  5DPW A;  2KN5 A;  3NVV A;  1EWY C;  5AZH A;  5DPT A;  2WXL A;  3LXF A;  1OTR B;  3BZD B;  2KFJ A;  3AEG B;  1KLV A;  1RWS A;  2IY1 B;  4RGT A;  2KMC A;  3T9L A;  2WGS A;  4MJS A;  2IYD B;  3HM3 A;  1E7U A;  2KAN A;  3JSV A;  1WR6 E;  1T0Y A;  2UU7 A;  5IN7 A;  2C5L C;  2XK5 A;  1RRB A;  5IAA C;  2CHW A;  4A55 A;  3OAW A;  3SFE B;  3PPA A;  1V9J A;  3RUL A;  3ZQ4 A;  3DHG C;  5CX3 A;  1WMH A;  1E8Z A;  2PIA A;  3IHP C;  4BKS D;  4HXD A;  3T3N A;  2LMC A;  4IOI E;  3NUH B;  4US9 A;  1ZDX A;  3BK2 A;  1GC6 A;  1C79 A;  3CF6 E;  2KWC A;  3ZNZ B;  3AU5 A;  1F2R I;  1ET9 A;  5TSS A;  3DBL I;  1MJD A;  2AYO B;  4URK A;  3R66 C;  3HHM A;  1QOG A;  1WXA A;  3L17 A;  2A4Z A;  4WIP A;  2KVZ A;  4HK2 A;  5AZG A;  3VTU A;  1AYF A;  2NTS A;  1XLQ A;  3UQA A;  3TBL D;  1WSP A;  1L4D B;  1K52 A;  2O2V B;  2PKO A;  5JXV A;  1SE4 A;  1FMA D;  4FXC A;  1KTK A;  1UGJ A;  3GZN B;  2D3B A;  1B1Z A;  1D4B A;  4BVU C;  3DPD A;  1YD8 U;  4WWN A;  1JML A;  1Z2M A;  1ZE3 D;  3QCA A;  4C80 A;  2G1E A;  3H7S A;  1LXD A;  2J0K A;  1E0Z A;  2LGI A;  3A9K A;  3KVF B;  3RNA C;  1WXM A;  2UYZ B;  2KAJ A;  1UH6 A;  2JZ3 B;  3CSF A;  1XCT L;  1UEL A;  4FHJ A;  2DEN B;  4N58 A;  4DDI D;  2AX5 A;  3BII D;  4G3X B;  3A4S C;  2MA9 B;  1E9M A;  3PO0 A;  3ZIM A;  1TKY A;  5IKC M;  1YOV B;  2NVU I;  5HI1 A;  1PUT A;  3GP7 A;  3PRE A;  1DOI A;  1YQ4 B;  2NS5 A;  2BB6 A;  2K6Q A;  2LHE A;  1TS3 A;  5AUI A;  3FAH A;  1JCK B;  4HCP B;  2IY0 B;  4W9E A;  3RMK C;  2AEH A;  2NBU A;  3AU4 A;  4M0W B;  4KV2 A;  3RI7 C;  4MGK E;  3RZF A;  1V5T A;  2KDE B;  1XQQ A;  1YN5 A;  2IGH A;  2BS4 B;  2MBB B;  4RGM A;  2MWS B;  5JH5 C;  2J52 A;  3W1S A;  1H8C A;  4JWS C;  2JXX A;  4USA A;  2KMA A;  3KH0 A;  2FUG 1;  4WH4 A;  5KHQ A;  3N20 C;  4JQW C;  4ZRI A;  2YEP F;  1FIQ A;  3ZJU A;  3PVL A;  3IVF A;  5LXI B;  4GDL B;  2LUE A;  5EE9 A;  2IBI B;  1L2N A;  2LI5 A;  2KQS A;  1CJE A;  2D2Q A;  2LVP A;  4TQ0 A;  3A33 B;  3ZVV A;  4FN2 A;  1I42 A;  4OHJ A;  1WE6 A;  2JUO A;  4ICU A;  4ARI A;  2WHI A;  3BWU D;  2VH2 A;  3NZS A;  3M62 B;  2L52 A;  2FBW B;  3SDL C;  1VRA B;  2Y3A A;  4DWF A;  3RNC C;  2V9H A;  2Y5B B;  2MBH A;  1MI0 A;  1VLB A;  4MGZ E;  4GXB A;  3L54 A;  3AEF B;  1YX5 B;  3M95 A;  1QLB B;  1LGR A;  3HRD D;  4K81 A;  1RFK A;  4C56 C;  2Y5P A;  2X8X X;  2WXK A;  4GLS C;  4OZB A;  1K53 A;  2ZPY A;  4P1C C;  3KQ4 A;  2DZM A;  3ZTC A;  1K50 A;  2N4F A;  4C00 A;  3FIL B;  3ZKJ C;  3C19 A;  1TYG B;  3Q6B A;  1TBE A;  2N9X A;  1VDV A;  4YT0 B;  1IBX A;  3A1Q A;  4II2 B;  1XLN A;  2ONQ A;  3B0A A;  5JHA A;  1DYQ A;  4ICV A;  3AN1 A;  3V62 A;  2FUH B;  1PFD A;  3TEZ A;  2J0J A;  3IT6 B;  4B0E A;  3RPF C;  1EWC A;  2I38 A;  3V61 A;  4ZHO A;  2N7J A;  1JAL A;  4W9G A;  1MHH E;  4XGA B;  2R61 A;  4TSS A;  1XCQ L;  2IO1 B;  3KUD B;  1MFW A;  1C77 A;  2RGF A;  1IP9 A;  1PGX A;  2NR2 A;  1OQR A;  3X23 A;  3PRM B;  3TEY A;  1FO4 A;  5J2R A;  1NI2 A;  3KLS X;  1TT5 B;  1WM2 A;  4M8M A;  4WJP A;  4OVZ A;  3WA0 A;  2IZV B;  5BMG A;  2W82 A;  2FIF A;  2QHO A;  3U2S C;  4HRO A;  2V3N A;  3A9J B;  3K9P B;  2D3G A;  2J4X A;  4IWP A;  3PLU A;  2LRU A;  4JPS A;  2BTE A;  2VRR B;  2WXN A;  1OQQ A;  3GE3 C;  4Q2J A;  1G6J A;  4WAA A;  3APC A;  4JIO U;  2RR9 A;  4MAC A;  5G5G A;  3AED B;  5LLI A;  4J6I A;  4HCN B;  2D5G A;  1LM8 B;  1C78 A;  2ZVO A;  4KIK A;  2NBV B;  2WXJ A;  3ZW3 A;  4NJ7 A;  3RZW C;  3AEA B;  3TMP B;  5IA7 A;  3H6N A;  2IO0 B;  2QIE B;  1F2R C;  1KM7 A;  2K8C A;  1CMX B;  2WXH A;  1C4A A;  1C76 A;  2ZCC A;  4DDG D;  1DGJ A;  3Q8F A;  1QOB A;  2XBB C;  1V49 A;  1C9F A;  2REX A;  4RFB A;  5HKH A;  1LO5 D;  1GNU A;  3DOW A;  4WJO A;  2IO3 B;  3N1Y C;  3VAW A;  3VH3 B;  2ZVN A;  1NEN B;  2XNA C;  4AOF A;  1VZ8 A;  1VCB A;  3IBE A;  5D3I B;  3W1Y A;  4WQM A;  1GJZ A;  3UIO B;  2WNM A;  2JRI B;  3NY5 A;  3ZNH B;  3DBH I;  1V2Y A;  3L4P A;  1GB4 A;  5FR6 A;  1KJT A;  4ZRJ A;  3Q3F A;  1KLG D;  2NMQ A;  2WXF A;  4PS3 A;  1WYW B;  2V3S A;  3R2T A;  1E6E B;  1UBQ A;  3DDC B;  3W9C B;  2CS4 A;  3C8Y A;  3M63 B;  4LLG M;  2AWT A;  4OW0 A;  2RDG A;  1KLU D;  1EUV B;  2KWD A;  2XN9 C;  2KVR A;  4CHK A;  1SF0 A;  2OOB B;  1HEZ E;  5J17 A;  5D6J B;  5IO9 A;  2C7H A;  3QC8 B;  2EKI A;  2IPK D;  5C1Z A;  4HVB A;  5EE0 A;  2CHX A;  3TEX A;  3U52 E;  1SB3 C;  3AE2 B;  1ZOY B;  2JWZ A;  1WJ4 A;  1HTQ A;  3AEC B;  4XC2 A;  2MJD A;  2N0S B;  4F7Z A;  2G45 B;  4DHZ E;  2FE8 A;  3OLM D;  3LYY A;  3PZ7 A;  5D3D A;  3B1L X;  1V5O A;  3I9V 1;  2LGS A;  4F8C B;  1GUA B;  2BVC A;  4FA6 A;  1J7B A;  4JE3 B;  1FD6 A;  4B0M A;  2O6V D;  3P4R B;  4RGO S;  4XX5 A;  5EE3 A;  2RMM A;  4ANW A;  3APF A;  4YL8 A;  4LNI A;  2INN E;  3PT2 B;  3NHE B;  1CZP A;  1XLO A;  1YX6 B;  2BYE A;  1N5X A;  1WRD B;  4ANX A;  3RD2 A;  5L95 C;  4TV3 A;  1OGW A;  5CHW A;  1EM7 A;  5G5H A;  2Z8L A;  1R4M B;  3ZXR A;  4HKQ A;  1WGR A;  4NPN A;  3KUC B;  5E6J A;  2DLB A;  3T3O A;  1T0R C;  3WAL A;  1VD2 A;  4FAD A;  3TIX A;  3V60 A;  2KFK B;  1X1M A;  2N9L A;  2BW2 A;  3R2I A;  4PYZ A;  2WS3 B;  2BKR B;  4IM3 A;  1FCC C;  4ZRP A;  4MM3 A;  4NAW A;  3AI5 A;  2LVQ A;  2D10 A;  3LJ3 A;  1QOA A;  4N6E B;  4PS8 A;  2V0G A;  1J8C A;  2KDF B;  1SEB D;  3VUW A;  4NQL B;  3AE5 B;  2KX3 A;  1FRR A;  4K7W A;  4GOC A;  3EHV A;  4HPL B;  1GB1 A;  1XT9 B;  2BB5 A;  4KDI C;  1YN4 A;  4HEA 1;  3VRB B;  4JGH B;  1E7V A;  1UBI A;  4GU2 A;  5BYQ A;  1LQB A;  4MGI E;  2FID A;  3Q3M C;  1L7Y A;  2KQ7 A;  1N63 A;  5BO4 B;  3QHT A;  4FUL A;  1UZX B;  3IAS 1;  2W3S A;  2IGG A;  2ON8 A;  1D5Z C;  1XF5 L;  3T8M A;  2M0A A;  3ZTD A;  3E56 A;  2IJ0 A;  5TR5 A;  3DHI C;  4KX6 B;  2DYM A;  2QIL A;  2DYB A;  2BQQ A;  4REZ A;  3ALB A;  4W9K A;  4O1N A;  4WJN A;  3ZJT A;  2SEB D;  2J0M A;  4M00 A;  4GIV A;  1OQY A;  4NAM A;  3V3X A;  2JY6 A;  3P4P B;  4RCO A;  4QAY A;  4F1S A;  3N9Y C;  4ZYS A;  1ZXI A;  4P6V F;  5GMV A;  4BBN C;  3MHS D;  2QC8 A;  3QIJ A;  2VZK B;  4P1B C;  1D3Z A;  1SJE D;  2L32 A;  2KTF A;  3UQB A;  3D32 A;  1FXA A;  3VTW A;  1ESF A;  1J19 A;  1ZP0 B;  4KSL C;  1TS5 A;  1NYR A;  2WQY B;  4TKN A;  4AJY B;  1WFY A;  3PHW B;  1STE A;  1P1A A;  2QJL A;  1WZ3 A;  4IWO A;  3P2B A;  1FPY A;  3ZO5 B;  3Q14 C;  3IAM 1;  3BVZ A;  2ASQ A;  2JYT A;  4UDU C;  3PZ8 A;  3Q69 A;  5HG2 A;  2MJE A;  1ZW7 A;  1T0S C;  2HJ8 A;  3VQI A;  4BBN F;  2GBK A;  1WRI A;  5CTR C;  1SXT A;  2K3U A;  1BT0 A;  3QJZ A;  3PRZ A;  4TMA B;  2KDI A;  4IC7 B;  2KK8 A;  3R3M A;  5H92 C;  1ZXH A;  1I35 A;  1V8C A;  4LNK A;  4KKI A;  4CYE A;  3Q8E A;  1V1P A;  1WX8 A;  3DBL B;  4YTM B;  3CST A;  3J9C A;  4HLE A;  2HD5 B;  4BKG A;  1F1H A;  3PHX B;  1SE3 A;  2MBQ A;  3N1Z C;  1D6E C;  4FJY A;  5EE1 A;  1WZ0 A;  3B2F A;  1ET6 A;  5D2M B;  2HTM E;  5JHB A;  2R2Q A;  3WIM A;  3P4Q B;  2RDB C;  5DPS A;  2ZJD A;  2OHF A;  4A3P A;  1P9D U;  1WIA A;  2KKC A;  2JYE A;  3L13 A;  2FCS A;  1ISN A;  5C2T B;  2X38 A;  1MG8 A;  2TSS A;  1ZPS A;  2NPT B;  3DHH C;  2KD0 A;  1WXQ A;  1JW9 D;  1YNT E;  1V6E A;  4IKG A;  1FNW A;  2LGD A;  1QOF A;  4GDK B;  1WJU A;  2M19 A;  2IGD A;  2UWQ A;  4RF0 A;  4K7S A;  4HJG E;  5D94 A;  2RSU A;  3DWG C;  1E7P B;  3TSS A;  3S2A A;  4WWO A;  1P7E A;  4XDD A;  4WUR A;  2KYW A;  5BYR A;  1GOZ A;  2SAK A;  3VFK A;  2KTR B;  1AN8 A;  3LB8 C;  3P42 A;  4R3D A;  2N9K A;  2JZZ A;  4ITK A;  2WDV B;  3UIN B;  4ZYN A;  2HE7 A;  3SEB A;  2WXG A;  2L0F A;  1L4Z B;  2BWE S;  4N59 A;  3TL5 A;  3C0R B;  4DXA B;  2G4D B;  2BPS A;  2O2V A;  2MHJ A;  2DZJ A;  2PEA A;  1TKG A;  5HFY A;  2MP2 B;  1L0X B;  2CKH B;  3HK0 A;  3CIR B;  2PPH A;  2G4S A;  2MX2 A;  3L08 A;  4ZHP A;  1L6U A;  4II3 B;  1HA5 A;  4KGR A;  4KZC A;  4A9A A;  3GB1 A;  2J7Q B;  1YJ1 A;  1YMH E;  4WWP A;  3CWI A;  3PRP B;  4HRS A;  2ZPN A;  4W9C A;  2NBW B;  4HDO A;  2VZK D;  2LUM A;  4DXF A;  1MG4 A;  2KDB A;  2BYF A;  2KLG A;  1EU4 A;  4EEW A;  2BBC A;  1SGH A;  5G55 A;  2WXR A;  2MH7 A;  3O65 B;  3DVG X;  1RLF A;  1N60 A;  1WGY A;  2N7D A;  2MRP A;  3MJW A;  4RGN A;  2PJH A;  2YVC A;  2AQ2 B;  5IP4 D;  1I4P A;  3KWL A;  3WAN A;  3ZNG C;  1V97 A;  2V1Y A;  2CHZ A;  4E71 A;  3PGE A;  3W1S C;  3Q3N C;  3QK0 A;  2QEJ C;  3ETR A;  5MPO A;  2AQ3 B;  2QSD A;  3PLV A;  1C3T A;  3RNG C;  4W9L A;  4M0W A;  1E5W A;  1FNV A;  2V3P A;  1WYG A;  3AE9 B;  3O13 A;  1FFV A;  3EA6 A;  1JWU D;  2Q5W D;  3Q8A A;  3BYT B;  3ML8 A;  2E3T A;  2O6V B;  1FCL A;  1I4R A;  3SFD B;  1XLP A;  1A70 A;  3AMZ A;  2H88 B;  3IFW B;  3VDZ A;  1CQV A;  2BS3 B;  1WXV A;  3MP9 A;  3W5U B;  1L0Y B;  4G0N B;  3ZYY X;  4RMA A;  1NI3 A;  1DOY A;  2I1J A;  2C9W B;  3AE4 B;  2DX5 B;  4EFO A;  2GBJ A;  2BGF A;  4GDL A;  2A5U A;  3H7P B;  2PE6 B;  1L0V B;  4MH8 A;  4IW0 A;  2GMI C;  4LJO B;  1YJJ A;  3MC0 B;  1FXT B;  2PE9 A;  4C4V B;  1BXT A;  3RT3 B;  3ZRF A;  1JWS D;  3GS2 A;  1R4N I;  3L0W B;  1TY0 A;  3QAQ A;  1ZDV A;  2WX0 A;  4BKT A;  2WXM A;  3BIN A;  2K22 A;  4OZC A;  2GLS A;  1UD7 A;  2M1M A;  1J0G A;  3HVD A;  3VVW B;  2PTL A;  5EDS A;  1AWD A;  1H4R A;  1N6Z A;  4DK5 A;  1NVI D;  1XD3 B;  4JWU C;  2EMT A;  1WM3 A;  2WDR B;  4EZL A;  1P3Q U;  4H2A A;  3SHQ A;  1K8R B;  2MCN B;  1PQS A;  2WXO A;  3DBR I;  4XWW A;  1I7H A;  1VJK A;  4IM2 A;  2KHW B;  4KSK C;  4TUU A;  2K1F A;  2M17 A;  2FAZ A;  4DQO C;  4C7Z A;  2KJ6 A;  3PSE B;  5C23 A;  2V4L A;  2EKE C;  1FEH A;  3VRA B;  2DAF A;  3FIL A;  2V4I B;  4XWT A;  1F77 A;  1E8X A;  1QKZ A;  5IOI A;  3WAP A;  2CJO A;  4MSM B;  4L23 A;  1L5P A;  1WGH A;  4ASW C;  3B08 A;  2L1A A;  1R4N B;  4E3C A;  4IUM B;  1WJN A;  3N32 A;  4W9F A;  1TTN A;  3LDZ E;  1TS2 A;  4TQ1 A;  4N9F 4;  4FJZ A;  2DNF A;  1Y56 A;  3PS6 A;  2JVC A;  2MEK A;  1M4V A;  1T5X D;  4KGT A;  1HZ5 A;  1WGK A;  4RM8 A;  5FKA C;  2AL6 A;  3VTV A;  4WWM A;  3IXS A;  3W5V B;  4ACF A;  3AEB B;  3DBR B;  3WAM A;  2RPQ A;  2KJR A;  1C1Y B;  3OJ3 A;  4MJS B;  3NG0 A;  4HKZ E;  2I2Y A;  3N30 A;  4DXG A;  3JSV B;  3DCG A;  1ROE A;  1PYW D;  4NY0 A;  2JU6 X;  1K51 A;  2XK5 B;  4B6W A;  5LNK 1;  4GMV A;  3A9J A;  4LDT D;  2B3A A;  1FFU A;  3DQV A;  4W9D A;  3DBH B;  1E90 A;  5BYS A;  1WMH B;  2YLM A;  4DHJ D;  3ZLZ A;  2LRW A;  2ZCB A;  1SBB B;  1P0R A;  1U4A A;  2OJW A;  2LJ5 A;  2GBM A;  4RNA A;  1BML C;  1E8W A;  4FLH A;  1C4C A;  4OZA A;  3AE6 B;  4X57 B;  3TCA A;  4KDL B;  2KXJ A;  1JRP A;  3N1X C;  1PGB A;  1JWB D;  2ZZP B;  4NNJ B;  2QDF A;  2JXT A;  4ANV A;  1WX9 A;  1YIW A;  4FJV B;  1ZKH A;  4I6P A;  4EUT A;  2LVO A;  3ECI A;  3OG5 A;  4WAF A;  1T0Q C;  3V05 A;  3ZDT A;  4AS1 A;  1IGC A;  4LNN A;  2ZEQ A;  4M01 A;  2KN4 A;  2GBR A;  2KDM A;  1C4P A;  5D7G A;  2W9N A;  3EGR A;  3H1U A;  1QT9 A;  2Y5C A;  3W2D A;  1WX7 A;  2ACZ B;  3A9K B;  2K5P A;  4E74 A;  2AQ1 B;  3RYT A;  2DYO A;  2MSE D;  2DZI A;  2KZR A;  3EFU A;  1S1Q B;  2WWZ A;  1XXG A;  4PT5 A;  2K25 A;  5I4D A;  1SIJ A;  4XDC A;  2BT6 A;  2KAC A;  4BKS A;  2L05 A;  3MC9 A;  4EE2 A;  2OED A;  3KYC D;  2E6X A;  3WAO A;  4AJW A;  2C7M B;  2CR5 A;  4BFR A;  3ZXV A;  2WX1 A;  1NDD A;  2G3Q B;  2INC C;  1L6V A;  3BK1 A;  3AH7 A;  3BYY B;  4ANU A;  4RF1 A;  1WR1 A;  4I6L B;  1NEK B;  4ZDV A;  3ML9 A;  4AWJ A;  1Y8R C;  2JRH A;  3Q3O C;  2DBY A;  4IM0 A;  3Q8B A;  2CJN A;  1JQ4 A;  1FNU A;  1IGD A;  1ZUD 2;  3GZN I;  2LFI A;  2IO2 B;  3BVG A;  3PZD A;  1V86 A;  4EZJ A;  3KYD D;  2IND C;  1PGA A;  2ICI A;  2N1V A;  5KHO A;  1B9R A;  2PVG C;  1BUI C;  5DPR A;  4W9I A;  3VH4 B;  4BOS C;  3U4E G;  3AV8 A;  3PTF C;  4KGS A;  2LD9 A;  3BVM A;  3VUX A;  2LGX A;  2ZNV B;  1KF6 B;  3Q2A C;  4K7U A;  2GOW A;  2K39 A;  3NRZ A;  3MHZ A;  1TY2 A;  1UGM A;  1RFA A;  1I4H A;  4S17 A;  3AB5 A;  3QX1 A;  1WXS A;  3QWZ B;  2QMT A;  2JZP A;  3EUB 2;  2LXC A;  3NS8 A;  1J7A A;  3RN9 C;  1NYQ A;  2JPH A;  4K1R B;  2WXI A;  3KUZ A;  2W54 A;  3U7Z A;  1N5W A;  2JF5 A;  2KT7 A;  2KFK A;  3RNB C;  2FCN A;  4HJK A;  2N7E A;  4MDK E;  2LJI A;  1FRD A;  4KZ0 A;  1XO3 A;  3V6C B;  2LEK A;  4BOZ B;  2M56 B;  2OJR A;  4P7I A;  1Q5W B;  3AEE B;  1HXY D;  2PVO D;  1SSN A;  4JLC A;  4OVV A;  4YSX B;  3EFC A;  1SIF A;  4CO7 A;  3ZGZ A;  1HE8 A;  3SD5 A;  3UGB B;  2WXQ A;  2W3R A;  4LCD E;  2FCQ A;  3CMM B;  1I4X A;  3ZRC A;  2L00 B;  1T6B X;  4KVG B;  1IBX B;  3A1Q B;  3I3T B;  4XE0 A;  2ZW0 A;  3VR9 B;  3VUY A;  1OEY J; 
#chains in the Genus database with same CATH homology
 3QK0 A;  4DBG A;  1UBQ A;  4I6N B;  3DDC B;  3PLV A;  2CS4 A;  1C3T A;  4W9L A;  5AZH A;  3M63 B;  1E5W A;  4JL9 A;  5DPT A;  2AWT A;  1OTR B;  1EUV B;  2KFJ A;  1KLV A;  2K6D B;  2KVR A;  2IY1 B;  3JW0 X;  1M94 A;  3ML8 A;  2KMC A;  2O6V B;  3T9L A;  4CHK A;  2Z0E B;  2OOB B;  4MJS A;  5J17 A;  5D6J B;  2IYD B;  3HM3 A;  4AUQ C;  1RAX A;  3OJ4 B;  1E7U A;  2KAN A;  1OEY A;  3Q3J A;  3IFW B;  3JSV A;  1WR6 E;  3VDZ A;  1T0Y A;  1WXV A;  4G0N B;  2C5L C;  2XK5 A;  5J18 A;  1RRB A;  2C7H A;  2CHW A;  2KLC A;  3OAW A;  3QC8 B;  1WGG A;  4RMA A;  5IAA C;  3PPA A;  2I1J A;  2C9W B;  5C1Z A;  2DX5 B;  4EFO A;  2KWU B;  2L3Z A;  2GBJ A;  2BGF A;  4HVB A;  1V9J A;  2C60 A;  2M0X A;  2CHX A;  3RUL A;  2L7R A;  5CX3 A;  1WMH A;  1E8Z A;  1WI0 A;  4GDL A;  2K8B A;  2A5U A;  1WJ4 A;  2JWZ A;  3H7P B;  3IHP C;  4HDQ A;  3U30 A;  2PE6 B;  4BKS D;  4HXD A;  4XC2 A;  3EC8 A;  2Z0D B;  4F7Z A;  2G45 B;  4IW0 A;  4DHZ E;  2GMI C;  4LJO B;  3OLM D;  1WGD A;  1FXT B;  2PE9 A;  4G50 A;  3B1L X;  1GC6 A;  1V5O A;  3RT3 B;  4F8C B;  3CF6 E;  3ZRF A;  1ZGU B;  2KWC A;  3HM6 X;  3ZNZ B;  1EO6 A;  1GUA B;  4FA6 A;  3AU5 A;  1GC7 A;  5E6N A;  2MBE A;  1R4N I;  3L0W B;  3QAQ A;  2DAJ A;  3DBL I;  3QA8 A;  2O6V D;  3RUI B;  2AYO B;  4URK A;  1V81 A;  2WX0 A;  3R66 C;  4XX5 A;  4BKT A;  3HHM A;  1TZ1 A;  1WXA A;  3DVN U;  3BIN A;  4ANW A;  3APF A;  3L17 A;  2A4Z A;  4YL8 A;  1UD7 A;  4HK2 A;  2M1M A;  1J0G A;  3VVW B;  1EF1 A;  4W9H A;  3PT2 B;  4XZ4 A;  5AZG A;  3VTU A;  3NHE B;  2FCM A;  5EDS A;  1YX6 B;  1H4R A;  2BYE A;  3UQA A;  2M8S A;  4KIK B;  3TBL D;  4DK5 A;  1XD3 B;  1AAR A;  2EMT A;  1WM3 A;  1WRD B;  2LGY A;  5E6O A;  2O2V B;  4PYU A;  4TV3 A;  3RD2 A;  3ZDM C;  4ANX A;  4EZK A;  5L95 C;  1OGW A;  5CHW A;  3PGE A;  4EZL A;  1P3Q U;  3MTN B;  3X0W A;  3SHQ A;  1K8R B;  2MCN B;  1PQS A;  3DBR I;  1WGR A;  4NPN A;  4BVU C;  3PV1 A;  3DPD A;  1YD8 U;  2KHW B;  3KUC B;  4IM2 A;  4KSK C;  4WWN A;  2N9E B;  4TUU A;  2K1F A;  1Z2M A;  3QCA A;  2M17 A;  4GN1 A;  2FAZ A;  3H7S A;  4WJQ A;  3WAL A;  1VD2 A;  2KJ6 A;  4FAD A;  3PSE B;  5C23 A;  3TIX A;  1LXD A;  2MLB A;  3V60 A;  2J0K A;  4MEL A;  3A9K A;  3KVF B;  2KFK B;  1X1M A;  1WXM A;  2UYZ B;  2V4L A;  2EKE C;  1UH6 A;  2JZ3 B;  2DAF A;  2KO3 A;  3CSF A;  4PYZ A;  1IYF A;  2BKR B;  4IM3 A;  1UEL A;  3ZUN A;  4MM3 A;  1SE9 A;  4FHJ A;  4NAW A;  3AI5 A;  2DEN B;  1E8X A;  2LVQ A;  4DDI D;  2D10 A;  3LJ3 A;  1Q0W B;  4PS8 A;  3WAP A;  4G3X B;  4MSM B;  3A4S C;  1J8C A;  3JYU A;  2KDF B;  4A20 A;  2MA9 B;  1WGH A;  4ASW C;  3B08 A;  3TJP A;  1S3S G;  3VUW A;  4NQL B;  4FBJ B;  3ZIM A;  2KX3 A;  2N9P C;  2KOX A;  1WE7 A;  2CU1 A;  2NVU I;  4AP4 C;  5G2N A;  2EMS A;  4K7W A;  4E3C A;  4IUM B;  4LDT B;  3PRE A;  1WJN A;  3EHV A;  4GOC A;  4HPL B;  3N32 A;  4W9F A;  2NS5 A;  1E8Y A;  1TTN A;  3AUL A;  3LDZ E;  2K6Q A;  4TQ1 A;  1XT9 B;  4N9F 4;  4FJZ A;  4DHJ B;  2WDT B;  4KDI C;  2KNB A;  3W1S C;  3PS6 A;  2JVC A;  4GB9 A;  3N3K B;  4JGH B;  1E7V A;  1V80 A;  4HCP B;  2IY0 B;  4W9E A;  1UBI A;  2AEH A;  4GU2 A;  4MH0 E;  1LQB A;  4MGI E;  2FID A;  2NPT A;  1L7Y A;  2KQ7 A;  2NBU A;  3AU4 A;  5BO4 B;  2XEW A;  4M0W B;  4KV2 A;  3QHT A;  4RM8 A;  4FUL A;  2AL6 A;  4MGK E;  3RZF A;  1UZX B;  3VTV A;  1V5T A;  2KDE B;  1XQQ A;  2MBB B;  3T8M A;  2ZNV C;  2MWS B;  3WAM A;  3ZTD A;  2KC1 A;  5JH5 C;  2RPQ A;  2KJR A;  1C1Y B;  3OJ3 A;  4GDK A;  4MJS B;  5TR5 A;  4B9K A;  3W1S A;  2K8H A;  3U8Z A;  1H8C A;  2JXX A;  3NOB A;  2BYV E;  2DYM A;  2L8J A;  2DYB A;  2KMA A;  3N30 A;  3KH0 A;  3QAR A;  3JSV B;  5KHQ A;  3DCG A;  3ALB A;  3HIZ A;  3L10 B;  4W9K A;  4JQW C;  4NY0 A;  2XK5 B;  4GGQ A;  4W9J A;  4WJN A;  4B6W A;  3R7R A;  2JT4 B;  4ZRI A;  3H9D A;  2NCN A;  4GMV A;  2J0M A;  3A9J A;  2B3A A;  4LDT D;  3DQV A;  3VXW A;  3L16 A;  4GIV A;  4W9D A;  2D07 B;  1OQY A;  1E90 A;  2JY6 A;  3PVL A;  3IVF A;  1WMH B;  3NZU A;  2YLM A;  4DHJ D;  5LXI B;  4GDL B;  3ZLZ A;  4F1S A;  2LRW A;  2ZCB A;  1P0R A;  2KTR A;  5GMV A;  2LUE A;  4BBN C;  2IBI B;  1L2N A;  1U4A A;  2LI5 A;  2KWV B;  2LJ5 A;  2GBM A;  3MHS D;  2KQS A;  1E8W A;  4FLH A;  2LWP A;  5CHV C;  2D2Q A;  1WF9 A;  2LVP A;  4TQ0 A;  3A33 B;  3ZVV A;  3QIJ A;  4FN2 A;  2HTH A;  3ZNI D;  1I42 A;  4X57 B;  1D3Z A;  1WE6 A;  1GG3 A;  2KXJ A;  3DVG Y;  2JUO A;  4ICU A;  4KDL B;  3RCZ A;  2KTF A;  3TCA A;  3V6E B;  3UQB A;  3D32 A;  2ZZP B;  4NNJ B;  3VTW A;  1LFD A;  4IWQ A;  3NZS A;  1EF5 A;  1J19 A;  4ANV A;  1WH3 A;  2MP2 A;  3M62 B;  4KSL C;  5AEK B;  3SDL C;  1WX9 A;  4DWF A;  1YIW A;  4TKN A;  2KJH B;  4PS7 A;  2DZK A;  2Y5B B;  2MBH A;  4AJY B;  1WFY A;  4FJV B;  1ZKH A;  3PHW B;  4I6P A;  4EUT A;  2LVO A;  4MSQ B;  3A4R A;  1P1A A;  3ECI A;  3EEC A;  2BF8 B;  4ZRK A;  4MGZ E;  4GXB A;  1WZ3 A;  4IWO A;  3APD A;  3L54 A;  3P2B A;  3ZDT A;  3ZO5 B;  1YX5 B;  2GBN A;  3M95 A;  1Z5S B;  4MEM A;  2ZEQ A;  4K81 A;  1TGZ B;  2ASQ A;  4FHK A;  2BWF A;  1ZW7 A;  4A3O A;  2HJ8 A;  3VQI A;  4BBN F;  2GBK A;  3ONS A;  2GBR A;  2L0T A;  5CTR C;  5D7G A;  3JVZ X;  1BT0 A;  2W9N A;  3H1U A;  3QJZ A;  3PRZ A;  4OVU A;  2KDI A;  1Q1O A;  1WX7 A;  2ZPY A;  4IC7 B;  1WJ6 A;  2KK8 A;  3R3M A;  1I35 A;  3A9K B;  2DZM A;  3ZTC A;  2N4F A;  4EOY A;  4E74 A;  3RYT A;  3VHT C;  4CYE A;  2DYO A;  2MSE D;  2MBO A;  2DZI A;  2KZR A;  1WX8 A;  1S1Q B;  3EFU A;  2WWZ A;  3ZKJ C;  4NAW B;  1F9J A;  1TBE A;  2N9X A;  1JRU A;  3CST A;  3U7D A;  4HLE A;  2K25 A;  3ENE A;  2HD5 B;  4BKG A;  3A1Q A;  1WY8 A;  4BKS A;  2L76 A;  3PHX B;  2MBQ A;  4II2 B;  2L05 A;  2DHZ A;  4FJY A;  4M8N A;  3KYC D;  3B0A A;  3WAO A;  5JHA A;  4AJW A;  2C7M B;  2CR5 A;  1WZ0 A;  3UF8 A;  5D2M B;  5E6P A;  4ICV A;  4BFR A;  2AL3 A;  5JHB A;  2R2Q A;  2RD0 A;  3M3J A;  3V62 A;  2Z59 B;  2WX1 A;  1NDD A;  2FUH B;  2G3Q B;  3WIM A;  5DPS A;  2ZJD A;  2J0J A;  3DVN V;  4RM9 A;  4WQO B;  4A3P A;  1P9D U;  1KOT A;  1WIA A;  2KKC A;  3L13 A;  2FCS A;  2O6V A;  1ISN A;  3V61 A;  4ANU A;  1MG8 A;  4W9G A;  1WR1 A;  2FNJ B;  4I6L B;  2IO1 B;  3KUD B;  4ZDV A;  2NPT B;  2RGF A;  3ML9 A;  4AWJ A;  1IP9 A;  1Y8R C;  2NR2 A;  2KD0 A;  3BY4 B;  3X23 A;  3PRM B;  2JRH A;  5J2R A;  1NI2 A;  1V6E A;  4IM0 A;  2KX0 A;  5CHF A;  2LGD A;  2M4N A;  1WM2 A;  4M8M A;  5JZE B;  1R4M I;  3GZN I;  3K9O B;  4WJP A;  2D11 A;  2IO2 B;  2IZV B;  4GDK B;  1WJU A;  3WA0 A;  3H7P A;  2BKF A;  2UWQ A;  3IG3 A;  3PZD A;  1V86 A;  2FIF A;  2QHO A;  4EZJ A;  4K7S A;  3KYD D;  3AXC A;  4HPM B;  5D94 A;  2RSU A;  2N1V A;  3KW5 B;  2KC2 A;  3S2A A;  5KHO A;  1A5R A;  4WWO A;  3A9J B;  4B95 A;  3K9P B;  2D3G A;  5DPR A;  4W9I A;  4IWP A;  3VH4 B;  3PLU A;  2LRU A;  2VRR B;  3VFK A;  4BOS C;  2KTR B;  1G6J A;  3PTF C;  4WAA A;  1YQB A;  3APC A;  4MGY E;  5DCN A;  5AZF A;  4JIO U;  2RR9 A;  2LD9 A;  4NJ6 A;  2JZZ A;  3UIN B;  4ZYN A;  3VUX A;  2LGX A;  2HE7 A;  4E71 A;  2ZNV B;  3QQ8 B;  5LLI A;  2L0F A;  4J6I A;  4HCN B;  4K7U A;  2BWE S;  1LM8 B;  2GOW A;  2N1W A;  2K39 A;  3DBS A;  3TL5 A;  3C0R B;  2ZVO A;  4KIK A;  2NBV B;  4DXA B;  2G4D B;  1NBF C;  1UGM A;  3ZW3 A;  2BPS A;  4NJ7 A;  2O2V A;  3RZW C;  1RFA A;  3R7Q A;  3SU8 X;  2DZJ A;  2PEA A;  3TMP B;  5IA7 A;  3H6N A;  2IO0 B;  3QX1 A;  1KM7 A;  2MP2 B;  1WXS A;  3QWZ B;  2CKH B;  5L83 A;  2K8C A;  2LXC A;  1CMX B;  3HK0 A;  4EKU A;  3NS8 A;  2ZCC A;  2PPH A;  2G4S A;  2MX2 A;  3L08 A;  4DDG D;  2JPH A;  4HWI B;  4II3 B;  5LXH A;  4K1R B;  2I1K A;  2XBB C;  4KZC A;  1V49 A;  4NQK E;  2REX A;  3KUZ A;  2J7Q B;  2C7N B;  2WYQ A;  5HKH A;  1YJ1 A;  1GNU A;  4WWP A;  2JF5 A;  3PRP B;  2KFK A;  3DOW A;  2ZPN A;  4WJO A;  4GSW A;  2FCN A;  2IO3 B;  2N7E A;  4HJK A;  2NBW B;  4W9C A;  4MDK E;  4HDO A;  4KZ0 A;  3VAW A;  3VH3 B;  2LAS A;  2ZVN A;  2LXA A;  3V6C B;  4AOF A;  2KDB A;  1VCB A;  4LJP B;  2BYF A;  2MQJ A;  4BOZ B;  2OJR A;  3GOE A;  4P7I A;  3IBE A;  3UIP B;  3W1Y A;  1Q5W B;  1P98 A;  2LZ6 A;  2KLG A;  1IPG A;  4G11 A;  4DHZ B;  4EEW A;  4JLC A;  1SGH A;  4OVV A;  5G55 A;  3UIO B;  1GJZ A;  3O65 B;  2JRI B;  3DVG X;  1RLF A;  1SIF A;  3NY5 A;  1WGY A;  1QZE A;  2N7D A;  3ZNH B;  4CO7 A;  3DBH I;  4IG7 B;  1V2Y A;  1HE8 A;  2MW5 A;  2MRP A;  3MJW A;  3SD5 A;  2R2O A;  5FR6 A;  1KJT A;  3UGB B;  4ZRJ A;  4LCD E;  3Q3F A;  2FCQ A;  2PJH A;  3CMM B;  2YVC A;  4PS3 A;  3ZRC A;  2L00 B;  3WAN A;  3ZNG C;  1WYW B;  5DPW A;  4KVG B;  2V3S A;  2V1Y A;  3A1Q B;  3I3T B;  2CHZ A;  2KN5 A;  3VUY A;  1OEY J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...