4HPLB

Pcgf1 ub fold (rawul)/bcor pufd complex
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
90
structure length
83
Chain Sequence
TREQLNLCLERLSSVLQNKYVRCSVRAEVRHLRRVLCHRLMLNPQHVQLLFDNEVLPDHMTMKQIWLSRWFGKPSPLLLQYSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords BCL-6 corepressor
publication title Structure of the Polycomb Group Protein PCGF1 in Complex with BCOR Reveals Basis for Binding Selectivity of PCGF Homologs.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 22
structure length 83
sequence length 90
ec nomenclature
pdb deposition date 2012-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF16207 RAWUL RAWUL domain RING finger- and WD40-associated ubiquitin-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4hplB00
2DAJA 2FCMA 4AWJA 4MSQB 4FLHA 2EMSA 2PEAA 4K7WA 3U7DA 2O2VA 1WRDB 1AARA 4KDLB 2JRIB 2KXJA 3L17A 3H7PB 2M0XA 1YX5B 4KIKA 4W9HA 2LGDA 2MQJA 2XBBC 2KMAA 2YLMA 3VAWA 2KDBA 2KVRA 4BBNC 3EHVA 2KWCA 3PHXB 4K81A 4TQ1A 1UBQA 1P98A 4HWIB 2HJ8A 1WXMA 2CKHB 2FAZA 2MP2A 5AZFA 3D32A 4P7IA 3B08A 1TBEA 3QHTA 3PREA 1IPGA 1WFYA 2DZJA 4FJYA 1WM3A 2JWZA 3QCAA 3PT2B 4FJZA 4FN2A 4BOZB 1LFDA 1WE6A 3APDA 4NQKE 3V61A 3PS6A 3WA0A 1XD3B 5L95C 2HTHA 2RSUA 1WYWB 4HDQA 3V60A 2N7EA 1Y8RC 4MGYE 4PS3A 3VTWA 2K8HA 5JHBA 4GDLA 2KX0A 2MLBA 3CMMB 4LJPB 2OJRA 2C7NB 2LZ6A 2L00B 2PE6B 3DBHI 4I6NB 4DXAB 4GDKA 1Q1OA 2J7QB 4HCNB 4ZRJA 3ZTCA 4W9EA 3UIOB 5DPSA 1E90A 2FCSA 2A4ZA 2GMIC 5AZHA 3M62B 5LLIA 1K8RB 3WALA 3WANA 3ZNID 1RRBA 1WR1A 2K6DB 2G4SA 3M3JA 1KJTA 3V6EB 4IC7B 4PS7A 3SU8X 1I42A 3AXCA 1WJNA 2DYMA 3ALBA 2I1KA 2V3SA 3AI5A 1GG3A 2C7MB 3OAWA 1LM8B 2KOXA 3GOEA 3A9KA 3TL5A 3ZNHB 1IP9A 1C3TA 1H8CA 4ZRIA 1OTRB 2RR9A 4GU2A 2FCQA 1C1YB 4HXDA 2RD0A 3JSVB 4JGHB 3A9JB 1FXTB 5D2MB 2KNBA 2JF5A 2J0KA 4MJSA 3X23A 3NOBA 3AULA 2JPHA 2L0TA 4DHJD 4KZCA 2R2OA 2DZKA 4K1RB 2JZ3B 2R2QA 3UGBB 3R3MA 4RMAA 2IO1B 1YIWA 3ZLZA 3ZNGC 2MBQA 4MDKE 1J0GA 3CF6E 1L2NA 4KVGB 2V4LA 1WR6E 2L3ZA 2C9WB 2XK5B 1R4MI 2KWVB 3DDCB 3L54A 4F7ZA 3AU5A 3SD5A 2C7HA 3SHQA 3R66C 2K1FA 3TBLD 3HK0A 3NS8A 4DHZB 3L08A 5DPWA 1OGWA 4IW0A 3MTNB 4EZJA 2AYOB 2C5LC 2OOBB 2PPHA 3DVGX 1RLFA 2N9EB 3H7PA 1OEYA 2D2QA 2ZCCA 3K9PB 2Z0DB 5J2RA 2IY1B 2LXAA 1GC6A 4B9KA 1E8WA 1SIFA 2LRUA 2KFKB 5IA7A 5J17A 5FR6A 3EFUA 4EKUA 4FHJA 3VXWA 2HE7A 4IWOA 2LD9A 4EOYA 4NQLB 2KLCA 2O6VA 4ZDVA 4GXBA 4KZ0A 3VH4B 3H6NA 3I3TB 4AUQC 4MEMA 3QC8B 2KN5A 3HM3A 4W9CA 2J0JA 3V6CB 1TTNA 4HPLB 2KTRB 3DBSA 1D3ZA 3W1SA 2N1VA 2MA9B 4DHJB 1WJ6A 5CTRC 5LXIB 4M8NA 3AU4A 1F9JA 2KWUB 1ZGUB 4GB9A 1RFAA 5CHVC 2DYBA 2MW5A 3A1QB 3OJ3A 3JVZX 3PHWB 1CMXB 3PZDA 4HCPB 5C1ZA 2BWFA 1LQBA 2IO2B 4MGKE 4HJKA 2MCNB 3PPAA 2NBUA 3H7SA 4DWFA 2NPTB 1WXSA 4G0NB 3DBLI 2LWPA 2V1YA 4CHKA 3HHMA 2JRHA 4NNJB 3UQBA 2DX5B 4BBNF 1UBIA 2YVCA 3QAQA 4M8MA 3WAPA 3RT3B 4BOSC 5G55A 2A5UA 2FIDA 4FHKA 4BFRA 4JL9A 2IY0B 3PVLA 4FJVB 3BINA 4BKSA 2ZEQA 3ZTDA 3TCAA 1WM2A 3W1SC 4ZYNA 2L05A 1TGZB 5LXHA 2KJHB 4FBJB 1V49A 4F1SA 2N4FA 2K8CA 4WJQA 1WMHA 3TMPB 4DDID 4WWPA 2KO3A 2MBBB 2CS4A 3ZNZB 2ZNVB 3ONSA 4G3XB 2L7RA 4FULA 2K39A 4PYUA 1E8ZA 1WX9A 1EO6A 2K6QA 3H9DA 4GN1A 3RULA 5E6NA 3IBEA 5C23A 3A4RA 4ANXA 5D7GA 2J0MA 3WAOA 2EKEC 5DPRA 3MJWA 1E7UA 2BKFA 3NHEB 3KUCB 3Q3FA 2NVUI 3PRMB 2IO3B 3PV1A 1UZXB 2BGFA 2ZVNA 2KK8A 3ENEA 1V9JA 3QA8A 4RM9A 1E8YA 3DOWA 3JW0X 4NJ7A 4XX5A 2Y5BB 3ZRCA 1M94A 3VH3B 3H1UA 4EFOA 1IYFA 3DVNV 2KZRA 2NS5A 3IVFA 3B1LX 3RD2A 1GUAB 3KVFB 1U4AA 5CHFA 3T9LA 3VUWA 2PJHA 3VDZA 4CYEA 2MBEA 4M0WB 3W1YA 4EEWA 5BO4B 1KOTA 2BYFA 1V86A 2LGXA 3DBRI 4GSWA 2O2VB 2ZPYA 3ECIA 3ML9A 5DCNA 4JQWC 4NAWA 2MBOA 2KTFA 2ZZPB 4KIKB 1Z2MA 2KTRA 4KSLC 3PLUA 3DCGA 3QWZB 4B95A 2IO0B 1YD8U 4TUUA 2D10A 2BWES 2KDEB 1HE8A 4MSMB 2WYQA 4GGQA 4AOFA 4J6IA 2AL6A 2QHOA 3A1QA 5DPTA 2KHWB 3R7RA 3S2AA 1WJUA 1WZ0A 1Z5SB 2JY6A 2LVQA 2XEWA 3ZRFA 1P1AA 1T0YA 2NPTA 1VCBA 3VUXA 3KYDD 5CX3A 2WWZA 4E74A 3VQIA 3OJ4B 3RCZA 1WZ3A 3NZUA 4X57B 1WX7A 1TZ1A 3HM6X 3N30A 3ZDMC 4NJ6A 1WGGA 1I35A 1GNUA 1NDDA 2N1WA 1S1QB 2LVPA 4G50A 4GDKB 3QQ8B 1UH6A 1V5OA 3QIJA 4OVUA 1WY8A 1ZKHA 2K8BA 5EDSA 3MHSD 3GZNI 2MSED 2GBKA 5JZEB 3RZFA 4IM3A 3SDLC 2ZPNA 2G3QB 1ISNA 1GC7A 2KDIA 2Z0EB 2K25A 3UF8A 3ZKJC 4ASWC 2D3GA 2WX1A 4E71A 1V5TA 2EMTA 2LGYA 4IM0A 4XC2A 3A9KB 3VFKA 3VHTC 3ZUNA 1LXDA 3X0WA 2LASA 2KFJA 2LXCA 3EECA 3APFA 2BF8B 4II3B 3B0AA 1WJ4A 1WXAA 1J8CA 2IBIB 2BKRB 4LDTD 5HKHA 4IUMB 4II2B 4I6LB 5AEKB 4WJPA 4W9LA 3O65B 4ANWA 4MJSB 1V80A 2ZCBA 4N9F4 4MGZE 2LUEA 2NCNA 4YL8A 3NY5A 3T8MA 1GJZA 2MX2A 1L7YA 3PGEA 4EUTA 2KLGA 5AZGA 4XZ4A 3ZO5B 3QK0A 4URKA 2M8SA 1WGDA 3PRZA 3C0RB 3BY4B 2IZVB 2UYZB 2CU1A 5D94A 1PQSA 4PS8A 3ML8A 3JSVA 3HIZA 4KSKC 2KQ7A 2RPQA 3A9JA 3IFWB 2DYOA 4LCDE 3PSEB 2ZVOA 2D11A 2M17A 3ZDTA 4B6WA 2CHWA 4KDIC 3VVWB 3UIPB 2G4DB 4EZKA 2MRPA 2W9NA 1E5WA 4IWPA 1WI0A 3DPDA 2BYEA 3RYTA 4DK5A 2AEHA 2REXA 1Q0WB 3QJZA 3DQVA 4DDGD 4BKSD 3IG3A 3UINB 1JRUA 4W9GA 1NI2A 4BVUC 2XK5A 2O6VB 5KHOA 4OVVA 2KMCA 4W9DA 2LI5A 4LDTB 1G6JA 2DZIA 4HK2A 3N32A 2KKCA 2N9XA 4JIOU 4MH0E 4AJWA 4G11A 2CR5A 1E7VA 3JYUA 2KJ6A 1KLVA 3WIMA 2N7DA 4BKGA 3DVNU 1V2YA 2KC2A 2KQSA 2ZJDA 2ASQA 1WE7A 2KFKA 2L0FA 1WX8A 3TIXA 2DZMA 3L10B 4KV2A 4F8CB 5JHAA 1WH3A 4HDOA 5KHQA 4IWQA 3L0WB 2CHZA 4MELA 1WGHA 5CHWA 2FNJB 1YX6B 3N3KB 1A5RA 2FIFA 4WWNA 4MM3A 1UD7A 4K7SA 5IAAC 1QZEA 4I6PA 4K7UA 4DBGA 5J18A 3RZWC 2DHZA 2NR2A 3VUYA 4A3PA 1R4NI 1WIAA 3PLVA 1RAXA 4NPNA 3L13A 5GMVA 1P0RA 2L76A 2KDFB 2LRWA 2I1JA 1ZW7A 4WAAA 2BYVE 4TKNA 1WF9A 2CHXA 2JUOA 2C60A 2GBNA 2MP2B 2RGFA 5G2NA 5JH5C 5E6OA 1V81A 4W9IA 4A20A 2KC1A 2Z59B 2DAFA 2D07B 4ZRKA 2LVOA 4ANUA 2JT4B 3KH0A 4ICUA 4TV3A 5E6PA 4HVBA 3KUDB 2JVCA 1WMHB 2KJRA 2GOWA 1X1MA 2JZZA 2MWSB 1Q5WB 2JXXA 4GDLB 1BT0A 1YQBA 1OQYA 4FA6A 2IYDB 2HD5B 3OLMD 4CO7A 4FADA 2KANA 4W9KA 5TR5A 4AJYB 2AWTA 3QX1A 3A33B 1WXVA 2L8JA 4GIVA 3R7QA 2G45B 4WJNA 2FUHB 2M1MA 2NBWB 3U30A 4ANVA 4GMVA 3RUIB 2GBMA 3L16A 3CSFA 4AP4C 3ZW3A 3LDZE 3M95A 3NZSA 4ICVA 4W9JA 4IG7B 1EF1A 2NBVB 4MGIE 4EZLA 1KM7A 1P3QU 4W9FA 4DHZE 5L83A 3KUZA 1WGRA 3CSTA 1EUVB 2KX3A 3LJ3A 1YJ1A 4HPMB 1SGHA 3P2BA 1MG8A 2GBRA 4HLEA 1VD2A 4WWOA 2MBHA 1P9DU 3WAMA 4NY0A 2WDTB 3DVGY 3M63B 4PYZA 2O6VD 4TQ0A 3U8ZA 3KYCD 4WJOA 1SE9A 2UWQA 3K9OB 3PRPB 1J19A 4JLCA 3PTFC 1WGYA 3KW5B 3UQAA 2N9PC 1NBFC 4LJOB 1S3SG 3IHPC 3V62A 4WQOB 2B3AA 1XQQA 3EC8A 3Q3JA 4IM2A 3QARA 3ZIMA 2AL3A 4NAWB 3VTVA 1UELA 1V6EA 4E3CA 4RM8A 3APCA 2LJ5A 1XT9B 3VTUA 5D6JB 1OEYJ 4A3OA 2KD0A 1UGMA 2M4NA 1EF5A 4GOCA 2FCNA 2PE9A 3ZVVA 1E8XA 1H4RA 2GBJA 2VRRB 2ZNVC 2BPSA 3A4SC 3TJPA 2WX0A 4BKTA 2DENB
chains in the Genus database with same CATH superfamily
2DAJA 3BK2A 4AWJA 2EMSA 2PEAA 4K7WA 2N0SB 2KXJA 3H7PB 2XBBC 1L5PA 4YWGG 2KDBA 2KWCA 3P42A 2HJ8A 2CKHB 1VJKA 3C19A 1VZ8A 1IPGA 2JWZA 2V4IB 4FJZA 3V61A 3WA0A 1PUTA 1XD3B 5L95C 3DBLB 2N7EA 3MHZA 4PS3A 3EGRA 2K8HA 3VTWA 1J7AA 2LZ6A 2L00B 3DBHI 1FM0D 4DXAB 4HCNB 1ZDXA 2GMIC 3WALA 1YOVB 2K6DB 1KJTA 2KN4A 1I42A 3AXCA 1WJNA 3ALBA 3SEBA 1IP9A 1UGJA 4GU2A 1NEKB 1C79A 3GS2A 1D5ZC 1DOXA 4DXFA 2JF5A 2J0KA 4MJSA 1ZXIA 4XWWA 2KAJA 2DZKA 2R2OA 4RF1A 3UGBB 3R3MA 1KRHA 1YIWA 3AE5B 3ZNGC 1I7HA 2MBQA 3CF6E 2XK5B 3AU5A 1SB3C 5DPWA 1JW9D 1OGWA 3H7PA 3TMPB 1RLFA 5J2RA 2ZCCA 1VR9A 4RGMA 1R4NB 1N61A 2L1AA 4B9KA 1SIFA 3EFUA 2WNMA 3NVYA 2HE7A 3P63A 4EOYA 3L4PA 2JYTA 3I3TB 2KN5A 2KTRB 3DBSA 2KWDA 3W1SA 2MA9B 1FCLA 1C77A 2SEBD 3NG0A 2EKIA 3AV8A 4LNFA 5LXIB 3AU4A 1ZGUB 5CHVC 1RFAA 4EE2A 3JVZX 3PHWB 1CMXB 4HCPB 5C1ZA 1JRPA 2BWFA 4MGKE 1F52A 4HJKA 2NBUA 3H7SA 4DWFA 2NPTB 4A8XC 2RDHA 4G0NB 1FFUA 2V1YA 3UQBA 2WXLA 4WURA 4US9A 1UBIA 2W54A 2YVCA 4M8MA 2FBWB 5G5GA 1GPXA 2FIDA 4XWTA 4LTUA 4FJVB 4BKSA 3TCAA 3W1SC 5LXHA 3AB5A 2CJOA 3W9CB 4F1SA 1WMHA 2KT7A 1TKEA 2L7RA 4A9AA 4FULA 2K39A 1E8ZA 1WX9A 2WGSA 2J0MA 1FXIA 1EM7A 3R2TA 3KWLA 3NHEB 3Q3FA 2NVUI 2IO3B 3PV1A 4RM9A 1E8YA 3DOWA 2QILA 2IPKD 5H92C 3NVWA 4EFOA 3OG5A 3AE1B 3DVNV 2SAKA 1HZ5A 2NS5A 5BYQA 1EU4A 3BIID 1GB4A 4CYEA 3W1YA 5BO4B 3DBRI 1KFYB 3ECIA 4R3DA 2WXOA 4B0EA 2KTFA 4KIKB 2KTRA 3ZJVA 1JMLA 1ENFA 1YD8U 4BAXA 4MSMB 4GGQA 2AL6A 1C4CA 1MVKA 5DPTA 3R7RA 2KHWB 2V3PA 3Q3OC 1P1AA 2NPTA 1VCBA 3NJTA 3AE8B 2E6XA 1WX7A 3HM6X 2Y5CA 2N1WA 4KGTA 2OHFA 2LVPA 4GDKB 3J9CA 1XLPA 1N5XA 2GI9A 4HRSA 3URYA 2K3UA 5EDSA 2KMMA 4YXDB 2GBKA 1NENB 3N20C 3RZFA 5BYSA 1TJEA 2KDIA 4LNNA 4YTPB 2D3GA 2D3BA 1V5TA 4C7ZA 3A9KB 3VHTC 1LXDA 4II3B 3B0AA 3I57A 3AE4B 2BKRB 4IUMB 4WJPA 1SJED 4ANWA 2INPE 1QQRA 2NCNA 2WXFA 2BS2B 3SFDB 2LHDA 2WQYB 3PGEA 4XE0A 4XZ4A 1N60A 1NVID 4URKA 3PRZA 3C0RB 1V97A 5BMIA 3BY4B 4LK0M 1SE4A 2L32A 2YEPF 5C2TB 3AEBB 3JSVA 2KQ7A 4LCDE 2QDFA 3PSEB 2D11A 2B76B 2V9HA 1QILA 3VVWB 2DLBA 3OWEB 1RM6C 2AQ1B 3RYTA 1Q0WB 2E3TA 2ONQA 4BKSD 2K5PA 4P6VF 4W9GA 1NI2A 4TSSA 1YNTE 2JZPA 1SXTA 4W9DA 4C56C 1FPYA 2BYTA 1P7EA 1G6JA 2N9XA 4RGNA 2CR5A 3JYUA 1HEZE 4MT5A 2YEPB 3DVNU 4LNIA 5GXGB 1E9MA 2KQSA 2ZJDA 4HKZE 3RN9C 2DZMA 2LGIA 1WH3A 4HDOA 4IWQA 2BS3B 1AN8A 1QOGA 2BQQA 4J3OD 3N3KB 1A5RA 2VZKD 4WWNA 2PTLA 3E9SA 4K7SA 1QZEA 4K7UA 4DBGA 1YJJA 2FE8A 2NR2A 3VUYA 4YTMB 1FIQA 4NPNA 3R2IA 2LRWA 2I1JA 1YQ3B 2BYVE 2MP2B 2BS4B 4W9IA 5JXVA 1YMHE 4ZRKA 3AE9B 3TEWA 4ANUA 2JT4B 3BYYB 3KH0A 4HVBA 3ZXVA 2MWSB 1X1MA 2JXXA 4FA6A 1YQBA 3RNGC 3OLMD 5TR5A 4W9KA 3A33B 1WXVA 4GIVA 1AWDA 1JWAD 2G45B 4OW0A 4WJNA 2M1MA 2NBWB 4IG7B 1EF1A 3P4QB 4W9FA 4ARIA 3CSTA 1XCTL 2JX5A 1MG8A 2GBRA 3NUHB 4HLEA 1VD2A 4WWOA 1F2RC 1P9DU 2JYEA 2WDTB 3Q6BA 3DVGY 4PYZA 4TQ0A 1J7BA 1HTQA 3ZXRA 1FXAA 1WGYA 3UQAA 3GP7A 2N9PC 2LEKA 4LJOB 3EUB2 1S3SG 3IHPC 5FK9C 2IGGA 3V62A 3ZIMA 2AL3A 1UELA 1UWMA 2AX5A 3APCA 3VTUA 1XT9B 3A4SC 1JWUD 3TJPA 2FCMA 3FKYA 4HEA1 3U7DA 1TKYA 1LGRA 2VH1A 2LGDA 2MQJA 1TT5B 2KMAA 3MC0B 3VAWA 3PHXB 4K81A 4TQ1A 3P4RB 1P98A 3NRZA 2FAZA 2MP2A 3B08A 1TBEA 1WGKA 5IOIA 1WFYA 4FJYA 4HROA 3PT2B 4FN2A 1KTKA 3AE2B 4NQKE 1K51A 2RSUA 1WYWB 4HDQA 3CMMB 1BUIC 2OJRA 1IGCA 3Q69A 4I6NB 1YJIA 4ZRJA 1E90A 1XEEA 2FCSA 5AZHA 1SJHD 1J7CA 4IC7B 4RNAA 2I1KA 2V0GA 3PZ8A 3AI5A 1GG3A 3GOEA 1T6BX 3ZNHB 1C3TA 2J53A 4ZRPA 1OTRB 1WYGA 2RR9A 2FCQA 4JGHB 1I4GA 3A9JB 1FXTB 1T5XD 5D2MB 4UDUC 2JPHA 4DHJD 4KZCA 3BZDB 4IOIE 4K1RB 2JZ3B 2R2QA 4USAA 3FC4A 4ZYSA 1L2NA 4KVGB 3VR8B 1WR6E 2JXTA 2C9WB 1N63A 1R4MI 2KWVB 3L54A 1PDXA 3SHQA 4QAYA 4D2KA 4EZJA 2C5LC 4EUTA 3RCZA 1OEYA 2D2QA 3DHHC 4M02A 2LXAA 2LRUA 2KFKB 1L0XB 2N9KA 2JU6X 2LD9A 4NQLB 3EFCA 2O6VA 5EE3A 1N5WA 2KACA 4MM3B 1FNWA 3HM3A 2J0JA 1FD6A 4HPLB 1TKGA 4YSXB 2VH2A 1D4BA 1XLQA 2DYBA 2MW5A 3NZ3A 3A1QB 3HRDD 1LQBA 1JWSD 3RNFC 1WXSA 2J52A 3DBLI 3HHMA 2JRHA 2HTME 4BBNF 1TIFA 2R61A 3QAQA 3BVGA 5G55A 2A5UA 4MACA 2ZW1A 4BFRA 2XNAC 3RNAC 3ZTDA 2AQ3B 4FBJB 1V49A 4DDID 2ZNVB 3ONSA 4JE3B 2I38A 4PYUA 3RULA 5E6NA 3IBEA 3FAHA 4ANXA 2EKEC 5DPRA 1L0YB 4YT0B 2BKFA 3KUCB 2N7JA 2MJEA 2JSVX 3PRMB 4K3BA 2BGFA 2ZVNA 1PFDA 2FUG1 2PLPA 4XX5A 2ZW0A 2K0PA 1CQVA 1U4AA 1D6EC 3C8YA 1MI0A 2LGXA 1HZ6A 2O2VB 2ZPYA 3ML9A 2BTEA 3P1MA 4JQWC 4NAWA 4HKQA 2MBOA 3V05A 4KSLC 4B95A 4JWSC 1SE2A 2JWUA 2KDEB 1HE8A 3DBHB 3W2DA 3E56A 3A1QA 1TZOA 1I4PA 2JY6A 2LVQA 2WDRB 3ZRFA 3I63C 2M19A 1F0ZA 4L1BA 5CX3A 4P1CC 1VRAB 4X57B 3NZUA 4YTNB 4P16A 3N30A 4NJ6A 1I35A 1NDDA 4G50A 3LXFA 3QQ8B 1TS3A 1ZKHA 1OQRA 3GZNI 5MPOA 2QEJC 1GC7A 2IJ0A 2Z0EB 3UF8A 1IBXB 5BMGA 4K3CA 2WX1A 3H8HA 2LGYA 4IM0A 3TEZA 3Q14C 3VFKA 3X0WA 5E6JA 3APFA 2BF8B 2IBIB 2NMQA 1YN3A 5HKHA 1E0ZA 4I6LB 5AEKB 4ZHOA 3NY5A 2WDVB 5AZGA 4KGRA 4C7YA 3QK0A 4AS1A 2IZVB 1AYFA 4Q2JA 2UYZB 5D94A 4S0RA 1PQSA 4PS8A 3IFWB 1QOFA 2LHEA 2ZVOA 2M17A 2CHWA 4KDIC 2WDQB 2W9NA 4L23A 1E5WA 3DPDA 4H2AA 3QJZA 3UINB 2Q5WD 4BVUC 2XK5A 4O1NA 5KHOA 4OVVA 4L2YA 1TS5A 4LDTB 2DZIA 2KKCA 2W82A 4MH0E 4G11A 3TUOA 1KLVA 2N7DA 4IDIA 1V2YA 4RH6A 3HVDA 1WX8A 2WXHA 3TIXA 4KV2A 5JHAA 4ITKA 2X38A 2PMVA 4YSYB 5KHQA 3L0WB 3NVVA 5CHWA 2FNJB 1YX6B 3R8BA 2FIFA 4RCOA 1UD7A 3ETRA 3RPFC 5J18A 3IT4B 4A3PA 1WIAA 4JX1C 1IBXA 5GMVA 1P0RA 1ZW7A 1EU3A 1V81A 1NYQA 3AMZA 2KC1A 2Z59B 1NYRA 4ICUA 4TV3A 5E6PA 4M00A 2JVCA 2WS3B 1Q5WB 4GDLB 1BT0A 1OQYA 1QLBB 1BMLC 2KANA 4AJYB 2AWTA 2EELA 3QX1A 2PW9A 2Y5PA 2GBMA 3BVZA 5AUIA 1F2RI 4AP4C 3AECB 1VZ7A 3DBRB 1UWXA 1KM7A 1P3QU 4REZA 2WLBA 5IO9A 1EUVB 2KX3A 1SGHA 3P2BA 3BK1A 3Q8CA 3O13A 1XXGA 3KLSX 4WIPA 2RMMA 3M63B 3U8ZA 3PRPB 2QIEB 1VDVA 2WXQA 3DHIC 4WQOB 2B3AA 3VTVA 3RFZB 1PGBA 3I5JC 3DWMA 5D6JB 3MC8A 4A3OA 2KD0A 1UGMA 4GOCA 2FCNA 2PE9A 1A70A 4MSQB 4FLHA 2G9HD 4KDLB 1V1PB 3P4PB 2M0XA 1YX5B 4KIKA 4W9HA 3Q8FA 2KVRA 3EHVA 1GAQB 1UBQA 1WWTA 4HWIB 1CJEA 1WXMA 2DWQA 5AZFA 2GLSA 4P7IA 3QHTA 3PREA 2DZJA 2INNE 1WE6A 3LYYA 1I4RA 4IKGA 1OQQA 3GE3C 4MGYE 5JHBA 1ROEA 4GDLA 2KX0A 2MLBA 4LJPB 2PE6B 1QF6A 4GDKA 1Q1OA 3AEEB 1TS4A 4W9EA 1UF0A 2IGHA 5DPSA 2QCZA 3ZNID 1RRBA 3V6EB 1QOAA 5EE0A 1YN4A 4PK1A 4PS7A 4N58A 2DYMA 4OZCA 3TSSA 4PT5A 1QKZA 2C7MB 2KOXA 5I4DA 3A9KA 3TL5A 1H8CA 4WAFA 2RD0A 2MH7A 2KNBA 4AQ7A 2LFIA 2WXPA 3RNEC 3IAS1 2L0TA 2PKOA 1OFFA 2WXRA 1KH0A 2K9XA 4RMAA 2IO1B 2M0AA 3AE3B 3ZQ4A 4MDKE 1KF6B 2V4LA 2L3ZA 1JQ4A 4F7ZA 1MPEA 3SD5A 3R66C 1XLNA 3L08A 2INCC 1V1PA 3MTNB 2AYOB 2PPHA 3AE6B 2N9EB 3K9PB 2Z0DB 1HXYD 2J4XA 1JWMD 1GC6A 1E8WA 3V3XA 4EKUA 4FHJA 3VXWA 2QMTA 2V3NA 2KLCA 4N59A 4ZDVA 3RNBC 2WXIA 3VH4B 1AW7A 4AUQC 4YSZB 1K53A 3U4EG 4MEMA 3QC8B 2NTSA 3V6CB 1TTNA 1D3ZA 3ZYYX 5CTRC 3EA6A 3OJ3A 2MCNB 1ZXHA 2Z8LA 2LWPA 2DNFA 2W3RA 4NNJB 2L83A 3CWIA 3RT3B 4BOSC 3KWVA 4LNKA 3P4SB 2AQ2B 4JL9A 3BINA 2ZEQA 1WM2A 4ZYNA 1TGZB 2KJHB 1ZUD2 2N4FA 4WJQA 4WWPA 2CS4A 4OHJA 1B1ZA 1Q10A 4G3XB 1EO6A 4GN1A 3DHGC 3A4RA 2WU5B 5D7GA 1F77A 3WAOA 1GOZA 1QOBA 3FILB 3HVZA 1E7UA 2BB6A 2OJWA 1L0VB 3ENEA 3QA8A 4ZOHC 4NJ7A 2Y5BB 1M94A 3BVMA 2WXGA 1DOYA 2KZRA 3RD2A 3IVFA 3B1LX 3Q3MC 1YQ4B 1GUAB 3KVFB 3T9LA 1SE3A 1MHXA 2PJHA 3VDZA 4M0WB 1KOTA 1ZPSA 4GSWA 1B9RA 1GB1A 2PIAA 5DCNA 2ZZPB 1Z2MA 1QT9A 3PLUA 3DCGA 1TY0A 2K22A 2KQ4X 2BWES 4OZBA 2INDC 4J6IA 3S2AA 1WJUA 1Z5SB 1SSNA 3NVZA 3UI3A 1VZ6A 1EWYC 2WXNA 3AEAB 1WGGA 2TSSA 3T3NA 3AE7B 1S1QB 1WRIA 3N9YC 1UH6A 3QIJA 1SBBB 1F1HA 3MHSD 1IGDA 2MSED 3LB8C 5JZEB 2ZPNA 5HHDG 1ISNA 3VRAB 4ASWC 2K25A 4E71A 4ZRQA 4C00A 1UNSA 3ZUNA 2KFJA 3EECA 2Y3AA 3FILA 4NAMA 1WJ4A 1WXAA 4II2B 1R4MB 1E7PB 4W9LA 4MJSB 1V80A 2ZCBA 2I2YA 4XDDA 2LUEA 4YL8A 3T8MA 1GJZA 2MX2A 3RMKC 2KLGA 2M8SA 3RNCC 1WGDA 1ACCA 2CU1A 1P7FA 1T0QC 4KSKC 2RPQA 3A9JA 1UUPA 2JQRB 4A90A 5D3DA 2G4DB 4EZKA 2MRPA 4IWPA 4DK5A 2AEHA 2REXA 3DQVA 1N6ZA 3Q3NC 3GB1A 1E10A 2UU7A 3IXSA 4HK2A 4AJWA 4JIOU 1T0SC 1E7VA 3B2GA 2KJ6A 3WIMA 3CIRB 2ASQA 1XF5L 1WE7A 2KFKA 2M56B 3L10B 4F8CB 3TEYA 2BVCA 5BMHA 3W5UB 2HJ1A 2PVOD 4MM3A 5IAAC 1C4PA 2DHZA 4N6EB 1R4NI 4LNOA 3L13A 2IDYA 4TKNA 1D5MC 1WF9A 2CHXA 5G2NA 2C60A 4US8A 5E6OA 3ZJUA 1R7SA 4XDCA 1JWBD 3KUDB 1WMHB 2GOWA 2JZZA 2G1EA 2IYDB 4JWUC 2WXJA 4FADA 2KVZA 5FKAC 2L8JA 4S17A 5G5HA 2FUHB 4GMVA 3RUIB 1L4DB 3CSFA 4EZLA 2NBVB 2RDGA 4C80A 1WGRA 1TYGB 1HTOA 2VZKB 1YJ1A 1WSPA 1FMAD 1RFKA 2MBHA 2NTTA 4NY0A 3AM9A 2O6VD 4WJOA 3ZGZA 3K9OB 1J19A 1VLBA 5IN7A 3QARA 2H88B 5HI1A 1CZPA 4RM8A 3Q2AC 1DYQA 1ZE3D 1OEYJ 1EF5A 4NJCA 3ZVVA 1E8XA 1H4RA 1STEA 2ZNVC 2BPSA 3RI7C 3AH7A 4BKTA 1ET6A 5D3IB 3GZNB 2O2VA 1WRDB 1AARA 2W55A 2JRIB 1L6UA 3L17A 1YN5A 2YLMA 4BBNC 1JROA 1HA5A 3D32A 1XLOA 1PGXA 4FXCA 1WM3A 3U7ZA 3QCAA 4BOZB 1LFDA 3APDA 2RPVA 3PS6A 2HTHA 1MHHE 3V60A 1Y8RC 5BYRA 2C7NB 1JCKB 1I4HA 3B9JA 2J7QB 3ZTCA 3UIOB 4RGTA 1JALA 4B0MA 2A4ZA 3VRBB 3AEGB 1MFWA 3M62B 1K8RB 1L4ZB 5LLIA 3WANA 1WR1A 2WP9B 2G4SA 3M3JA 2LGSA 1K50A 3SU8X 4KX6B 2V3SA 5EE1A 3OAWA 1LM8B 3DWGC 3AN1A 1HQRD 1RYJA 4ZRIA 2HDEA 1C1YB 4HXDA 2GRIA 3W5VB 3JSVB 1T0RC 1EWCA 3X23A 3NOBA 3AULA 4KGSA 2CU3A 4DQOC 3ZLZA 1J0GA 2WXMA 3DDCB 3SR6A 1LO5D 2C7HA 2D5GA 2K1FA 3TBLD 3HK0A 3NS8A 4DHZB 1ESFA 3MJ5A 4IW0A 3ZJTA 2OOBB 3N1XC 3DVGX 2BBCA 2J42A 1C76A 1T3QA 2IY1B 4BZAA 5IA7A 5J17A 5FR6A 2QSDA 1SEBD 2N9LA 4P1BC 2DBYA 3KQ4A 4IWOA 1ZP0B 4GXBA 4KZ0A 3H6NA 4KKJA 2D3CA 1E6EB 4JPSA 4W9CA 2N1VA 1FNVA 4DXGA 4DHJB 1WJ6A 4NZLB 4M8NA 1F9JA 2KWUB 4GB9A 3PZDA 5IKCM 2IO2B 3VR9B 3PPAA 3AEFB 1WXQA 4CHKA 4ARCA 2DX5B 1KLUD 2D3AA 4OVZA 1FRDA 3WAPA 1SF0A 1FRRA 4FHKA 2IY0B 3PVLA 2L05A 5LNK1 2K8CA 2OEDA 5EE9A 2KO3A 2MBBB 1FEHA 3ZNZB 3B2FA 1FNUA 3H9DA 2K6QA 3BYTB 1PYWD 5C23A 1CK1A 2WU2B 1L6VA 3MJWA 3MC9A 3U52E 3IT6B 3WCQA 1UZXB 2KK8A 2L52A 1V9JA 4RGOS 2IGDA 3JW0X 1NI3A 3ZRCA 5HG2A 3VH3B 3H1UA 1IYFA 3HUIA 3GE8C 5CHFA 3VUWA 2MBEA 5FR3A 4EEWA 2BYFA 1V86A 4TMAB 5T8IA 4CQNA 1XCQL 2BW2A 3ABVB 1MG4A 2LUMA 1Y56A 3QWZB 3Q8BA 2IO0B 4TUUA 2D10A 2WYQA 4AOFA 5AUKA 2QHOA 3AEDB 1WZ0A 2BB5A 2XEWA 1T0YA 3VUXA 3KYDD 1V8CA 2WWZA 4E74A 3VQIA 3OJ4B 1WZ3A 1TZ1A 3IAM1 3ZDMC 3NS1A 3SFEB 1ZOYB 1GNUA 2W3SA 2RDBC 2QJLA 1PGAA 1V5OA 4OVUA 1V1OA 1C78A 1WY8A 2K8BA 2GB1A 5HFYA 4IM3A 3SDLC 1K52A 2G3QB 2ACZB 3ZKJC 1TY2A 2EMTA 4XYCA 4A55A 4XC2A 3TEXA 1ET9A 2LASA 2LXCA 4WH4A 2DENB 3BWUD 3PZ7A 1J8CA 2MJDA 3PO0A 4LDTD 4WQMA 3O65B 4N9F4 4MGZE 1DGJA 1L7YA 3Q8EA 3ZO5B 1FO4A 4M01A 1M4VA 1MJDA 2XN9C 3ML8A 3HIZA 2DYOA 4OZAA 3ZDTA 4B6WA 3UIPB 1WI0A 2BYEA 2LJIA 4DDGD 3IG3A 4HJGE 1D5XC 1JRUA 1N62A 3N1ZC 2BT6A 1DOIA 2O6VB 2KMCA 2LI5A 3U2SC 4BKGA 2LMCA 2KC2A 1FFVA 3N1YC 3MFGA 4WWMA 2L0FA 5TSSA 4LLGM 4RF0A 2PVGC 4C4VB 2CHZA 2MEKA 4MELA 1WGHA 4KKIA 4A6QA 5H8YE 1IUEA 2ON8A 4I6PA 3I9V1 3RZWC 3PLVA 1RAXA 2KDMA 2L76A 2KDFB 4WAAA 4MH8A 3T3OA 4ZHPA 2JUOA 2GBNA 2RGFA 5JH5C 4A20A 1TS2A 1ZDVA 2WHIA 3MP9A 2DAFA 2D07B 2CJNA 2LVOA 2MHJA 1FCCC 2KJRA 5IP4D 2MJ3A 5C3JB 4ACFA 2HD5B 4CO7A 3R7QA 4ANVA 3U30A 4HPPA 1RWSA 3L16A 3ZW3A 4RFBA 3LDZE 3M95A 3NZSA 4ICVA 4W9JA 4MGIE 3Q8AA 4DHZE 5L83A 3KUZA 3LJ3A 1BXTA 4HPMB 1XO3A 2H89B 1C9FA 1I4XA 2X8XX 3WAMA 3KYCD 1SE9A 2UWQA 4JLCA 3PTFC 3KW5B 1NBFC 2WXKA 4GLSC 1XQQA 3EC8A 3Q3JA 4IM2A 1C4AA 4NAWB 1V6EA 1I4QA 4E3CA 1KLGD 2KYWA 2ICIA 2QC8A 2LJ5A 2M4NA 4XGAB 4C4VA 2GBJA 2VRRB 4M0WA 1SIJA 2WX0A 3N32A
chains in the Genus database with same CATH topology
2DAJA 2FCMA 4AWJA 4MSQB 4FLHA 2EMSA 2PEAA 4K7WA 3U7DA 2O2VA 1WRDB 1AARA 4KDLB 2JRIB 2KXJA 3L17A 3H7PB 2M0XA 1YX5B 4KIKA 4W9HA 2LGDA 2MQJA 2XBBC 2KMAA 2YLMA 3VAWA 2KDBA 2KVRA 4BBNC 3EHVA 2KWCA 3PHXB 4K81A 4TQ1A 1UBQA 1P98A 4HWIB 2HJ8A 1WXMA 2CKHB 2FAZA 2MP2A 5AZFA 3D32A 4P7IA 3B08A 1TBEA 3QHTA 3PREA 1IPGA 1WFYA 2DZJA 4FJYA 1WM3A 2JWZA 3QCAA 3PT2B 4FJZA 4FN2A 4BOZB 1LFDA 1WE6A 3APDA 4NQKE 3V61A 3PS6A 3WA0A 1XD3B 5L95C 2HTHA 2RSUA 1WYWB 4HDQA 3V60A 2N7EA 1Y8RC 4MGYE 4PS3A 3VTWA 2K8HA 5JHBA 4GDLA 2KX0A 2MLBA 3CMMB 4LJPB 2OJRA 2C7NB 2LZ6A 2L00B 2PE6B 3DBHI 4I6NB 4DXAB 4GDKA 1Q1OA 2J7QB 4HCNB 4ZRJA 3ZTCA 4W9EA 3UIOB 5DPSA 1E90A 2FCSA 2A4ZA 2GMIC 5AZHA 3M62B 5LLIA 1K8RB 3WALA 3WANA 3ZNID 1RRBA 1WR1A 2K6DB 2G4SA 3M3JA 1KJTA 3V6EB 4IC7B 4PS7A 3SU8X 1I42A 3AXCA 1WJNA 2DYMA 3ALBA 2I1KA 2V3SA 3AI5A 1GG3A 2C7MB 3OAWA 1LM8B 2KOXA 3GOEA 3A9KA 3TL5A 3ZNHB 1IP9A 1C3TA 1H8CA 4ZRIA 1OTRB 2RR9A 4GU2A 2FCQA 1C1YB 4HXDA 2RD0A 3JSVB 4JGHB 3A9JB 1FXTB 5D2MB 2KNBA 2JF5A 2J0KA 4MJSA 3X23A 3NOBA 3AULA 2JPHA 2L0TA 4DHJD 4KZCA 2R2OA 2DZKA 4K1RB 2JZ3B 2R2QA 3UGBB 3R3MA 4RMAA 2IO1B 1YIWA 3ZLZA 3ZNGC 2MBQA 4MDKE 1J0GA 3CF6E 1L2NA 4KVGB 2V4LA 1WR6E 2L3ZA 2C9WB 2XK5B 1R4MI 2KWVB 3DDCB 3L54A 4F7ZA 3AU5A 3SD5A 2C7HA 3SHQA 3R66C 2K1FA 3TBLD 3HK0A 3NS8A 4DHZB 3L08A 5DPWA 1OGWA 4IW0A 3MTNB 4EZJA 2AYOB 2C5LC 2OOBB 2PPHA 3DVGX 1RLFA 2N9EB 3H7PA 1OEYA 2D2QA 2ZCCA 3K9PB 2Z0DB 5J2RA 2IY1B 2LXAA 1GC6A 4B9KA 1E8WA 1SIFA 2LRUA 2KFKB 5IA7A 5J17A 5FR6A 3EFUA 4EKUA 4FHJA 3VXWA 2HE7A 4IWOA 2LD9A 4EOYA 4NQLB 2KLCA 2O6VA 4ZDVA 4GXBA 4KZ0A 3VH4B 3H6NA 3I3TB 4AUQC 4MEMA 3QC8B 2KN5A 3HM3A 4W9CA 2J0JA 3V6CB 1TTNA 4HPLB 2KTRB 3DBSA 1D3ZA 3W1SA 2N1VA 2MA9B 4DHJB 1WJ6A 5CTRC 5LXIB 4M8NA 3AU4A 1F9JA 2KWUB 1ZGUB 4GB9A 1RFAA 5CHVC 2DYBA 2MW5A 3A1QB 3OJ3A 3JVZX 3PHWB 1CMXB 3PZDA 4HCPB 5C1ZA 2BWFA 1LQBA 2IO2B 4MGKE 4HJKA 2MCNB 3PPAA 2NBUA 3H7SA 4DWFA 2NPTB 1WXSA 4G0NB 3DBLI 2LWPA 2V1YA 4CHKA 3HHMA 2JRHA 4NNJB 3UQBA 2DX5B 4BBNF 1UBIA 2YVCA 3QAQA 4M8MA 3WAPA 3RT3B 4BOSC 5G55A 2A5UA 2FIDA 4FHKA 4BFRA 4JL9A 2IY0B 3PVLA 4FJVB 3BINA 4BKSA 2ZEQA 3ZTDA 3TCAA 1WM2A 3W1SC 4ZYNA 2L05A 1TGZB 5LXHA 2KJHB 4FBJB 1V49A 4F1SA 2N4FA 2K8CA 4WJQA 1WMHA 3TMPB 4DDID 4WWPA 2KO3A 2MBBB 2CS4A 3ZNZB 2ZNVB 3ONSA 4G3XB 2L7RA 4FULA 2K39A 4PYUA 1E8ZA 1WX9A 1EO6A 2K6QA 3H9DA 4GN1A 3RULA 5E6NA 3IBEA 5C23A 3A4RA 4ANXA 5D7GA 2J0MA 3WAOA 2EKEC 5DPRA 3MJWA 1E7UA 2BKFA 3NHEB 3KUCB 3Q3FA 2NVUI 3PRMB 2IO3B 3PV1A 1UZXB 2BGFA 2ZVNA 2KK8A 3ENEA 1V9JA 3QA8A 4RM9A 1E8YA 3DOWA 3JW0X 4NJ7A 4XX5A 2Y5BB 3ZRCA 1M94A 3VH3B 3H1UA 4EFOA 1IYFA 3DVNV 2KZRA 2NS5A 3IVFA 3B1LX 3RD2A 1GUAB 3KVFB 1U4AA 5CHFA 3T9LA 3VUWA 2PJHA 3VDZA 4CYEA 2MBEA 4M0WB 3W1YA 4EEWA 5BO4B 1KOTA 2BYFA 1V86A 2LGXA 3DBRI 4GSWA 2O2VB 2ZPYA 3ECIA 3ML9A 5DCNA 4JQWC 4NAWA 2MBOA 2KTFA 2ZZPB 4KIKB 1Z2MA 2KTRA 4KSLC 3PLUA 3DCGA 3QWZB 4B95A 2IO0B 1YD8U 4TUUA 2D10A 2BWES 2KDEB 1HE8A 4MSMB 2WYQA 4GGQA 4AOFA 4J6IA 2AL6A 2QHOA 3A1QA 5DPTA 2KHWB 3R7RA 3S2AA 1WJUA 1WZ0A 1Z5SB 2JY6A 2LVQA 2XEWA 3ZRFA 1P1AA 1T0YA 2NPTA 1VCBA 3VUXA 3KYDD 5CX3A 2WWZA 4E74A 3VQIA 3OJ4B 3RCZA 1WZ3A 3NZUA 4X57B 1WX7A 1TZ1A 3HM6X 3N30A 3ZDMC 4NJ6A 1WGGA 1I35A 1GNUA 1NDDA 2N1WA 1S1QB 2LVPA 4G50A 4GDKB 3QQ8B 1UH6A 1V5OA 3QIJA 4OVUA 1WY8A 1ZKHA 2K8BA 5EDSA 3MHSD 3GZNI 2MSED 2GBKA 5JZEB 3RZFA 4IM3A 3SDLC 2ZPNA 2G3QB 1ISNA 1GC7A 2KDIA 2Z0EB 2K25A 3UF8A 3ZKJC 4ASWC 2D3GA 2WX1A 4E71A 1V5TA 2EMTA 2LGYA 4IM0A 4XC2A 3A9KB 3VFKA 3VHTC 3ZUNA 1LXDA 3X0WA 2LASA 2KFJA 2LXCA 3EECA 3APFA 2BF8B 4II3B 3B0AA 1WJ4A 1WXAA 1J8CA 2IBIB 2BKRB 4LDTD 5HKHA 4IUMB 4II2B 4I6LB 5AEKB 4WJPA 4W9LA 3O65B 4ANWA 4MJSB 1V80A 2ZCBA 4N9F4 4MGZE 2LUEA 2NCNA 4YL8A 3NY5A 3T8MA 1GJZA 2MX2A 1L7YA 3PGEA 4EUTA 2KLGA 5AZGA 4XZ4A 3ZO5B 3QK0A 4URKA 2M8SA 1WGDA 3PRZA 3C0RB 3BY4B 2IZVB 2UYZB 2CU1A 5D94A 1PQSA 4PS8A 3ML8A 3JSVA 3HIZA 4KSKC 2KQ7A 2RPQA 3A9JA 3IFWB 2DYOA 4LCDE 3PSEB 2ZVOA 2D11A 2M17A 3ZDTA 4B6WA 2CHWA 4KDIC 3VVWB 3UIPB 2G4DB 4EZKA 2MRPA 2W9NA 1E5WA 4IWPA 1WI0A 3DPDA 2BYEA 3RYTA 4DK5A 2AEHA 2REXA 1Q0WB 3QJZA 3DQVA 4DDGD 4BKSD 3IG3A 3UINB 1JRUA 4W9GA 1NI2A 4BVUC 2XK5A 2O6VB 5KHOA 4OVVA 2KMCA 4W9DA 2LI5A 4LDTB 1G6JA 2DZIA 4HK2A 3N32A 2KKCA 2N9XA 4JIOU 4MH0E 4AJWA 4G11A 2CR5A 1E7VA 3JYUA 2KJ6A 1KLVA 3WIMA 2N7DA 4BKGA 3DVNU 1V2YA 2KC2A 2KQSA 2ZJDA 2ASQA 1WE7A 2KFKA 2L0FA 1WX8A 3TIXA 2DZMA 3L10B 4KV2A 4F8CB 5JHAA 1WH3A 4HDOA 5KHQA 4IWQA 3L0WB 2CHZA 4MELA 1WGHA 5CHWA 2FNJB 1YX6B 3N3KB 1A5RA 2FIFA 4WWNA 4MM3A 1UD7A 4K7SA 5IAAC 1QZEA 4I6PA 4K7UA 4DBGA 5J18A 3RZWC 2DHZA 2NR2A 3VUYA 4A3PA 1R4NI 1WIAA 3PLVA 1RAXA 4NPNA 3L13A 5GMVA 1P0RA 2L76A 2KDFB 2LRWA 2I1JA 1ZW7A 4WAAA 2BYVE 4TKNA 1WF9A 2CHXA 2JUOA 2C60A 2GBNA 2MP2B 2RGFA 5G2NA 5JH5C 5E6OA 1V81A 4W9IA 4A20A 2KC1A 2Z59B 2DAFA 2D07B 4ZRKA 2LVOA 4ANUA 2JT4B 3KH0A 4ICUA 4TV3A 5E6PA 4HVBA 3KUDB 2JVCA 1WMHB 2KJRA 2GOWA 1X1MA 2JZZA 2MWSB 1Q5WB 2JXXA 4GDLB 1BT0A 1YQBA 1OQYA 4FA6A 2IYDB 2HD5B 3OLMD 4CO7A 4FADA 2KANA 4W9KA 5TR5A 4AJYB 2AWTA 3QX1A 3A33B 1WXVA 2L8JA 4GIVA 3R7QA 2G45B 4WJNA 2FUHB 2M1MA 2NBWB 3U30A 4ANVA 4GMVA 3RUIB 2GBMA 3L16A 3CSFA 4AP4C 3ZW3A 3LDZE 3M95A 3NZSA 4ICVA 4W9JA 4IG7B 1EF1A 2NBVB 4MGIE 4EZLA 1KM7A 1P3QU 4W9FA 4DHZE 5L83A 3KUZA 1WGRA 3CSTA 1EUVB 2KX3A 3LJ3A 1YJ1A 4HPMB 1SGHA 3P2BA 1MG8A 2GBRA 4HLEA 1VD2A 4WWOA 2MBHA 1P9DU 3WAMA 4NY0A 2WDTB 3DVGY 3M63B 4PYZA 2O6VD 4TQ0A 3U8ZA 3KYCD 4WJOA 1SE9A 2UWQA 3K9OB 3PRPB 1J19A 4JLCA 3PTFC 1WGYA 3KW5B 3UQAA 2N9PC 1NBFC 4LJOB 1S3SG 3IHPC 3V62A 4WQOB 2B3AA 1XQQA 3EC8A 3Q3JA 4IM2A 3QARA 3ZIMA 2AL3A 4NAWB 3VTVA 1UELA 1V6EA 4E3CA 4RM8A 3APCA 2LJ5A 1XT9B 3VTUA 5D6JB 1OEYJ 4A3OA 2KD0A 1UGMA 2M4NA 1EF5A 4GOCA 2FCNA 2PE9A 3ZVVA 1E8XA 1H4RA 2GBJA 2VRRB 2ZNVC 2BPSA 3A4SC 3TJPA 2WX0A 4BKTA 2DENB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DAJ A;  2FCM A;  4AWJ A;  4MSQ B;  4FLH A;  2EMS A;  2PEA A;  4K7W A;  3U7D A;  2O2V A;  1WRD B;  1AAR A;  4KDL B;  2JRI B;  2KXJ A;  3L17 A;  3H7P B;  2M0X A;  1YX5 B;  4KIK A;  4W9H A;  2LGD A;  2MQJ A;  2XBB C;  2KMA A;  2YLM A;  3VAW A;  2KDB A;  2KVR A;  4BBN C;  3EHV A;  2KWC A;  3PHX B;  4K81 A;  4TQ1 A;  1UBQ A;  1P98 A;  4HWI B;  2HJ8 A;  1WXM A;  2CKH B;  2FAZ A;  2MP2 A;  5AZF A;  3D32 A;  4P7I A;  3B08 A;  1TBE A;  3QHT A;  3PRE A;  1IPG A;  1WFY A;  2DZJ A;  4FJY A;  1WM3 A;  2JWZ A;  3QCA A;  3PT2 B;  4FJZ A;  4FN2 A;  4BOZ B;  1LFD A;  1WE6 A;  3APD A;  4NQK E;  3V61 A;  3PS6 A;  3WA0 A;  1XD3 B;  5L95 C;  2HTH A;  2RSU A;  1WYW B;  4HDQ A;  3V60 A;  2N7E A;  1Y8R C;  4MGY E;  4PS3 A;  3VTW A;  2K8H A;  5JHB A;  4GDL A;  2KX0 A;  2MLB A;  3CMM B;  4LJP B;  2OJR A;  2C7N B;  2LZ6 A;  2L00 B;  2PE6 B;  3DBH I;  4I6N B;  4DXA B;  4GDK A;  1Q1O A;  2J7Q B;  4HCN B;  4ZRJ A;  3ZTC A;  4W9E A;  3UIO B;  5DPS A;  1E90 A;  2FCS A;  2A4Z A;  2GMI C;  5AZH A;  3M62 B;  5LLI A;  1K8R B;  3WAL A;  3WAN A;  3ZNI D;  1RRB A;  1WR1 A;  2K6D B;  2G4S A;  3M3J A;  1KJT A;  3V6E B;  4IC7 B;  4PS7 A;  3SU8 X;  1I42 A;  3AXC A;  1WJN A;  2DYM A;  3ALB A;  2I1K A;  2V3S A;  3AI5 A;  1GG3 A;  2C7M B;  3OAW A;  1LM8 B;  2KOX A;  3GOE A;  3A9K A;  3TL5 A;  3ZNH B;  1IP9 A;  1C3T A;  1H8C A;  4ZRI A;  1OTR B;  2RR9 A;  4GU2 A;  2FCQ A;  1C1Y B;  4HXD A;  2RD0 A;  3JSV B;  4JGH B;  3A9J B;  1FXT B;  5D2M B;  2KNB A;  2JF5 A;  2J0K A;  4MJS A;  3X23 A;  3NOB A;  3AUL A;  2JPH A;  2L0T A;  4DHJ D;  4KZC A;  2R2O A;  2DZK A;  4K1R B;  2JZ3 B;  2R2Q A;  3UGB B;  3R3M A;  4RMA A;  2IO1 B;  1YIW A;  3ZLZ A;  3ZNG C;  2MBQ A;  4MDK E;  1J0G A;  3CF6 E;  1L2N A;  4KVG B;  2V4L A;  1WR6 E;  2L3Z A;  2C9W B;  2XK5 B;  1R4M I;  2KWV B;  3DDC B;  3L54 A;  4F7Z A;  3AU5 A;  3SD5 A;  2C7H A;  3SHQ A;  3R66 C;  2K1F A;  3TBL D;  3HK0 A;  3NS8 A;  4DHZ B;  3L08 A;  5DPW A;  1OGW A;  4IW0 A;  3MTN B;  4EZJ A;  2AYO B;  2C5L C;  2OOB B;  2PPH A;  3DVG X;  1RLF A;  2N9E B;  3H7P A;  1OEY A;  2D2Q A;  2ZCC A;  3K9P B;  2Z0D B;  5J2R A;  2IY1 B;  2LXA A;  1GC6 A;  4B9K A;  1E8W A;  1SIF A;  2LRU A;  2KFK B;  5IA7 A;  5J17 A;  5FR6 A;  3EFU A;  4EKU A;  4FHJ A;  3VXW A;  2HE7 A;  4IWO A;  2LD9 A;  4EOY A;  4NQL B;  2KLC A;  2O6V A;  4ZDV A;  4GXB A;  4KZ0 A;  3VH4 B;  3H6N A;  3I3T B;  4AUQ C;  4MEM A;  3QC8 B;  2KN5 A;  3HM3 A;  4W9C A;  2J0J A;  3V6C B;  1TTN A;  4HPL B;  2KTR B;  3DBS A;  1D3Z A;  3W1S A;  2N1V A;  2MA9 B;  4DHJ B;  1WJ6 A;  5CTR C;  5LXI B;  4M8N A;  3AU4 A;  1F9J A;  2KWU B;  1ZGU B;  4GB9 A;  1RFA A;  5CHV C;  2DYB A;  2MW5 A;  3A1Q B;  3OJ3 A;  3JVZ X;  3PHW B;  1CMX B;  3PZD A;  4HCP B;  5C1Z A;  2BWF A;  1LQB A;  2IO2 B;  4MGK E;  4HJK A;  2MCN B;  3PPA A;  2NBU A;  3H7S A;  4DWF A;  2NPT B;  1WXS A;  4G0N B;  3DBL I;  2LWP A;  2V1Y A;  4CHK A;  3HHM A;  2JRH A;  4NNJ B;  3UQB A;  2DX5 B;  4BBN F;  1UBI A;  2YVC A;  3QAQ A;  4M8M A;  3WAP A;  3RT3 B;  4BOS C;  5G55 A;  2A5U A;  2FID A;  4FHK A;  4BFR A;  4JL9 A;  2IY0 B;  3PVL A;  4FJV B;  3BIN A;  4BKS A;  2ZEQ A;  3ZTD A;  3TCA A;  1WM2 A;  3W1S C;  4ZYN A;  2L05 A;  1TGZ B;  5LXH A;  2KJH B;  4FBJ B;  1V49 A;  4F1S A;  2N4F A;  2K8C A;  4WJQ A;  1WMH A;  3TMP B;  4DDI D;  4WWP A;  2KO3 A;  2MBB B;  2CS4 A;  3ZNZ B;  2ZNV B;  3ONS A;  4G3X B;  2L7R A;  4FUL A;  2K39 A;  4PYU A;  1E8Z A;  1WX9 A;  1EO6 A;  2K6Q A;  3H9D A;  4GN1 A;  3RUL A;  5E6N A;  3IBE A;  5C23 A;  3A4R A;  4ANX A;  5D7G A;  2J0M A;  3WAO A;  2EKE C;  5DPR A;  3MJW A;  1E7U A;  2BKF A;  3NHE B;  3KUC B;  3Q3F A;  2NVU I;  3PRM B;  2IO3 B;  3PV1 A;  1UZX B;  2BGF A;  2ZVN A;  2KK8 A;  3ENE A;  1V9J A;  3QA8 A;  4RM9 A;  1E8Y A;  3DOW A;  3JW0 X;  4NJ7 A;  4XX5 A;  2Y5B B;  3ZRC A;  1M94 A;  3VH3 B;  3H1U A;  4EFO A;  1IYF A;  3DVN V;  2KZR A;  2NS5 A;  3IVF A;  3B1L X;  3RD2 A;  1GUA B;  3KVF B;  1U4A A;  5CHF A;  3T9L A;  3VUW A;  2PJH A;  3VDZ A;  4CYE A;  2MBE A;  4M0W B;  3W1Y A;  4EEW A;  5BO4 B;  1KOT A;  2BYF A;  1V86 A;  2LGX A;  3DBR I;  4GSW A;  2O2V B;  2ZPY A;  3ECI A;  3ML9 A;  5DCN A;  4JQW C;  4NAW A;  2MBO A;  2KTF A;  2ZZP B;  4KIK B;  1Z2M A;  2KTR A;  4KSL C;  3PLU A;  3DCG A;  3QWZ B;  4B95 A;  2IO0 B;  1YD8 U;  4TUU A;  2D10 A;  2BWE S;  2KDE B;  1HE8 A;  4MSM B;  2WYQ A;  4GGQ A;  4AOF A;  4J6I A;  2AL6 A;  2QHO A;  3A1Q A;  5DPT A;  2KHW B;  3R7R A;  3S2A A;  1WJU A;  1WZ0 A;  1Z5S B;  2JY6 A;  2LVQ A;  2XEW A;  3ZRF A;  1P1A A;  1T0Y A;  2NPT A;  1VCB A;  3VUX A;  3KYD D;  5CX3 A;  2WWZ A;  4E74 A;  3VQI A;  3OJ4 B;  3RCZ A;  1WZ3 A;  3NZU A;  4X57 B;  1WX7 A;  1TZ1 A;  3HM6 X;  3N30 A;  3ZDM C;  4NJ6 A;  1WGG A;  1I35 A;  1GNU A;  1NDD A;  2N1W A;  1S1Q B;  2LVP A;  4G50 A;  4GDK B;  3QQ8 B;  1UH6 A;  1V5O A;  3QIJ A;  4OVU A;  1WY8 A;  1ZKH A;  2K8B A;  5EDS A;  3MHS D;  3GZN I;  2MSE D;  2GBK A;  5JZE B;  3RZF A;  4IM3 A;  3SDL C;  2ZPN A;  2G3Q B;  1ISN A;  1GC7 A;  2KDI A;  2Z0E B;  2K25 A;  3UF8 A;  3ZKJ C;  4ASW C;  2D3G A;  2WX1 A;  4E71 A;  1V5T A;  2EMT A;  2LGY A;  4IM0 A;  4XC2 A;  3A9K B;  3VFK A;  3VHT C;  3ZUN A;  1LXD A;  3X0W A;  2LAS A;  2KFJ A;  2LXC A;  3EEC A;  3APF A;  2BF8 B;  4II3 B;  3B0A A;  1WJ4 A;  1WXA A;  1J8C A;  2IBI B;  2BKR B;  4LDT D;  5HKH A;  4IUM B;  4II2 B;  4I6L B;  5AEK B;  4WJP A;  4W9L A;  3O65 B;  4ANW A;  4MJS B;  1V80 A;  2ZCB A;  4N9F 4;  4MGZ E;  2LUE A;  2NCN A;  4YL8 A;  3NY5 A;  3T8M A;  1GJZ A;  2MX2 A;  1L7Y A;  3PGE A;  4EUT A;  2KLG A;  5AZG A;  4XZ4 A;  3ZO5 B;  3QK0 A;  4URK A;  2M8S A;  1WGD A;  3PRZ A;  3C0R B;  3BY4 B;  2IZV B;  2UYZ B;  2CU1 A;  5D94 A;  1PQS A;  4PS8 A;  3ML8 A;  3JSV A;  3HIZ A;  4KSK C;  2KQ7 A;  2RPQ A;  3A9J A;  3IFW B;  2DYO A;  4LCD E;  3PSE B;  2ZVO A;  2D11 A;  2M17 A;  3ZDT A;  4B6W A;  2CHW A;  4KDI C;  3VVW B;  3UIP B;  2G4D B;  4EZK A;  2MRP A;  2W9N A;  1E5W A;  4IWP A;  1WI0 A;  3DPD A;  2BYE A;  3RYT A;  4DK5 A;  2AEH A;  2REX A;  1Q0W B;  3QJZ A;  3DQV A;  4DDG D;  4BKS D;  3IG3 A;  3UIN B;  1JRU A;  4W9G A;  1NI2 A;  4BVU C;  2XK5 A;  2O6V B;  5KHO A;  4OVV A;  2KMC A;  4W9D A;  2LI5 A;  4LDT B;  1G6J A;  2DZI A;  4HK2 A;  3N32 A;  2KKC A;  2N9X A;  4JIO U;  4MH0 E;  4AJW A;  4G11 A;  2CR5 A;  1E7V A;  3JYU A;  2KJ6 A;  1KLV A;  3WIM A;  2N7D A;  4BKG A;  3DVN U;  1V2Y A;  2KC2 A;  2KQS A;  2ZJD A;  2ASQ A;  1WE7 A;  2KFK A;  2L0F A;  1WX8 A;  3TIX A;  2DZM A;  3L10 B;  4KV2 A;  4F8C B;  5JHA A;  1WH3 A;  4HDO A;  5KHQ A;  4IWQ A;  3L0W B;  2CHZ A;  4MEL A;  1WGH A;  5CHW A;  2FNJ B;  1YX6 B;  3N3K B;  1A5R A;  2FIF A;  4WWN A;  4MM3 A;  1UD7 A;  4K7S A;  5IAA C;  1QZE A;  4I6P A;  4K7U A;  4DBG A;  5J18 A;  3RZW C;  2DHZ A;  2NR2 A;  3VUY A;  4A3P A;  1R4N I;  1WIA A;  3PLV A;  1RAX A;  4NPN A;  3L13 A;  5GMV A;  1P0R A;  2L76 A;  2KDF B;  2LRW A;  2I1J A;  1ZW7 A;  4WAA A;  2BYV E;  4TKN A;  1WF9 A;  2CHX A;  2JUO A;  2C60 A;  2GBN A;  2MP2 B;  2RGF A;  5G2N A;  5JH5 C;  5E6O A;  1V81 A;  4W9I A;  4A20 A;  2KC1 A;  2Z59 B;  2DAF A;  2D07 B;  4ZRK A;  2LVO A;  4ANU A;  2JT4 B;  3KH0 A;  4ICU A;  4TV3 A;  5E6P A;  4HVB A;  3KUD B;  2JVC A;  1WMH B;  2KJR A;  2GOW A;  1X1M A;  2JZZ A;  2MWS B;  1Q5W B;  2JXX A;  4GDL B;  1BT0 A;  1YQB A;  1OQY A;  4FA6 A;  2IYD B;  2HD5 B;  3OLM D;  4CO7 A;  4FAD A;  2KAN A;  4W9K A;  5TR5 A;  4AJY B;  2AWT A;  3QX1 A;  3A33 B;  1WXV A;  2L8J A;  4GIV A;  3R7Q A;  2G45 B;  4WJN A;  2FUH B;  2M1M A;  2NBW B;  3U30 A;  4ANV A;  4GMV A;  3RUI B;  2GBM A;  3L16 A;  3CSF A;  4AP4 C;  3ZW3 A;  3LDZ E;  3M95 A;  3NZS A;  4ICV A;  4W9J A;  4IG7 B;  1EF1 A;  2NBV B;  4MGI E;  4EZL A;  1KM7 A;  1P3Q U;  4W9F A;  4DHZ E;  5L83 A;  3KUZ A;  1WGR A;  3CST A;  1EUV B;  2KX3 A;  3LJ3 A;  1YJ1 A;  4HPM B;  1SGH A;  3P2B A;  1MG8 A;  2GBR A;  4HLE A;  1VD2 A;  4WWO A;  2MBH A;  1P9D U;  3WAM A;  4NY0 A;  2WDT B;  3DVG Y;  3M63 B;  4PYZ A;  2O6V D;  4TQ0 A;  3U8Z A;  3KYC D;  4WJO A;  1SE9 A;  2UWQ A;  3K9O B;  3PRP B;  1J19 A;  4JLC A;  3PTF C;  1WGY A;  3KW5 B;  3UQA A;  2N9P C;  1NBF C;  4LJO B;  1S3S G;  3IHP C;  3V62 A;  4WQO B;  2B3A A;  1XQQ A;  3EC8 A;  3Q3J A;  4IM2 A;  3QAR A;  3ZIM A;  2AL3 A;  4NAW B;  3VTV A;  1UEL A;  1V6E A;  4E3C A;  4RM8 A;  3APC A;  2LJ5 A;  1XT9 B;  3VTU A;  5D6J B;  1OEY J;  4A3O A;  2KD0 A;  1UGM A;  2M4N A;  1EF5 A;  4GOC A;  2FCN A;  2PE9 A;  3ZVV A;  1E8X A;  1H4R A;  2GBJ A;  2VRR B;  2ZNV C;  2BPS A;  3A4S C;  3TJP A;  2WX0 A;  4BKT A;  2DEN B; 
#chains in the Genus database with same CATH topology
 2DAJ A;  3BK2 A;  4AWJ A;  2EMS A;  2PEA A;  4K7W A;  2N0S B;  2KXJ A;  3H7P B;  2XBB C;  1L5P A;  4YWG G;  2KDB A;  2KWC A;  3P42 A;  2HJ8 A;  2CKH B;  1VJK A;  3C19 A;  1VZ8 A;  1IPG A;  2JWZ A;  2V4I B;  4FJZ A;  3V61 A;  3WA0 A;  1PUT A;  1XD3 B;  5L95 C;  3DBL B;  2N7E A;  3MHZ A;  4PS3 A;  3EGR A;  2K8H A;  3VTW A;  1J7A A;  2LZ6 A;  2L00 B;  3DBH I;  1FM0 D;  4DXA B;  4HCN B;  1ZDX A;  2GMI C;  3WAL A;  1YOV B;  2K6D B;  1KJT A;  2KN4 A;  1I42 A;  3AXC A;  1WJN A;  3ALB A;  3SEB A;  1IP9 A;  1UGJ A;  4GU2 A;  1NEK B;  1C79 A;  3GS2 A;  1D5Z C;  1DOX A;  4DXF A;  2JF5 A;  2J0K A;  4MJS A;  1ZXI A;  4XWW A;  2KAJ A;  2DZK A;  2R2O A;  4RF1 A;  3UGB B;  3R3M A;  1KRH A;  1YIW A;  3AE5 B;  3ZNG C;  1I7H A;  2MBQ A;  3CF6 E;  2XK5 B;  3AU5 A;  1SB3 C;  5DPW A;  1JW9 D;  1OGW A;  3H7P A;  3TMP B;  1RLF A;  5J2R A;  2ZCC A;  1VR9 A;  4RGM A;  1R4N B;  1N61 A;  2L1A A;  4B9K A;  1SIF A;  3EFU A;  2WNM A;  3NVY A;  2HE7 A;  3P63 A;  4EOY A;  3L4P A;  2JYT A;  3I3T B;  2KN5 A;  2KTR B;  3DBS A;  2KWD A;  3W1S A;  2MA9 B;  1FCL A;  1C77 A;  2SEB D;  3NG0 A;  2EKI A;  3AV8 A;  4LNF A;  5LXI B;  3AU4 A;  1ZGU B;  5CHV C;  1RFA A;  4EE2 A;  3JVZ X;  3PHW B;  1CMX B;  4HCP B;  5C1Z A;  1JRP A;  2BWF A;  4MGK E;  1F52 A;  4HJK A;  2NBU A;  3H7S A;  4DWF A;  2NPT B;  4A8X C;  2RDH A;  4G0N B;  1FFU A;  2V1Y A;  3UQB A;  2WXL A;  4WUR A;  4US9 A;  1UBI A;  2W54 A;  2YVC A;  4M8M A;  2FBW B;  5G5G A;  1GPX A;  2FID A;  4XWT A;  4LTU A;  4FJV B;  4BKS A;  3TCA A;  3W1S C;  5LXH A;  3AB5 A;  2CJO A;  3W9C B;  4F1S A;  1WMH A;  2KT7 A;  1TKE A;  2L7R A;  4A9A A;  4FUL A;  2K39 A;  1E8Z A;  1WX9 A;  2WGS A;  2J0M A;  1FXI A;  1EM7 A;  3R2T A;  3KWL A;  3NHE B;  3Q3F A;  2NVU I;  2IO3 B;  3PV1 A;  4RM9 A;  1E8Y A;  3DOW A;  2QIL A;  2IPK D;  5H92 C;  3NVW A;  4EFO A;  3OG5 A;  3AE1 B;  3DVN V;  2SAK A;  1HZ5 A;  2NS5 A;  5BYQ A;  1EU4 A;  3BII D;  1GB4 A;  4CYE A;  3W1Y A;  5BO4 B;  3DBR I;  1KFY B;  3ECI A;  4R3D A;  2WXO A;  4B0E A;  2KTF A;  4KIK B;  2KTR A;  3ZJV A;  1JML A;  1ENF A;  1YD8 U;  4BAX A;  4MSM B;  4GGQ A;  2AL6 A;  1C4C A;  1MVK A;  5DPT A;  3R7R A;  2KHW B;  2V3P A;  3Q3O C;  1P1A A;  2NPT A;  1VCB A;  3NJT A;  3AE8 B;  2E6X A;  1WX7 A;  3HM6 X;  2Y5C A;  2N1W A;  4KGT A;  2OHF A;  2LVP A;  4GDK B;  3J9C A;  1XLP A;  1N5X A;  2GI9 A;  4HRS A;  3URY A;  2K3U A;  5EDS A;  2KMM A;  4YXD B;  2GBK A;  1NEN B;  3N20 C;  3RZF A;  5BYS A;  1TJE A;  2KDI A;  4LNN A;  4YTP B;  2D3G A;  2D3B A;  1V5T A;  4C7Z A;  3A9K B;  3VHT C;  1LXD A;  4II3 B;  3B0A A;  3I57 A;  3AE4 B;  2BKR B;  4IUM B;  4WJP A;  1SJE D;  4ANW A;  2INP E;  1QQR A;  2NCN A;  2WXF A;  2BS2 B;  3SFD B;  2LHD A;  2WQY B;  3PGE A;  4XE0 A;  4XZ4 A;  1N60 A;  1NVI D;  4URK A;  3PRZ A;  3C0R B;  1V97 A;  5BMI A;  3BY4 B;  4LK0 M;  1SE4 A;  2L32 A;  2YEP F;  5C2T B;  3AEB B;  3JSV A;  2KQ7 A;  4LCD E;  2QDF A;  3PSE B;  2D11 A;  2B76 B;  2V9H A;  1QIL A;  3VVW B;  2DLB A;  3OWE B;  1RM6 C;  2AQ1 B;  3RYT A;  1Q0W B;  2E3T A;  2ONQ A;  4BKS D;  2K5P A;  4P6V F;  4W9G A;  1NI2 A;  4TSS A;  1YNT E;  2JZP A;  1SXT A;  4W9D A;  4C56 C;  1FPY A;  2BYT A;  1P7E A;  1G6J A;  2N9X A;  4RGN A;  2CR5 A;  3JYU A;  1HEZ E;  4MT5 A;  2YEP B;  3DVN U;  4LNI A;  5GXG B;  1E9M A;  2KQS A;  2ZJD A;  4HKZ E;  3RN9 C;  2DZM A;  2LGI A;  1WH3 A;  4HDO A;  4IWQ A;  2BS3 B;  1AN8 A;  1QOG A;  2BQQ A;  4J3O D;  3N3K B;  1A5R A;  2VZK D;  4WWN A;  2PTL A;  3E9S A;  4K7S A;  1QZE A;  4K7U A;  4DBG A;  1YJJ A;  2FE8 A;  2NR2 A;  3VUY A;  4YTM B;  1FIQ A;  4NPN A;  3R2I A;  2LRW A;  2I1J A;  1YQ3 B;  2BYV E;  2MP2 B;  2BS4 B;  4W9I A;  5JXV A;  1YMH E;  4ZRK A;  3AE9 B;  3TEW A;  4ANU A;  2JT4 B;  3BYY B;  3KH0 A;  4HVB A;  3ZXV A;  2MWS B;  1X1M A;  2JXX A;  4FA6 A;  1YQB A;  3RNG C;  3OLM D;  5TR5 A;  4W9K A;  3A33 B;  1WXV A;  4GIV A;  1AWD A;  1JWA D;  2G45 B;  4OW0 A;  4WJN A;  2M1M A;  2NBW B;  4IG7 B;  1EF1 A;  3P4Q B;  4W9F A;  4ARI A;  3CST A;  1XCT L;  2JX5 A;  1MG8 A;  2GBR A;  3NUH B;  4HLE A;  1VD2 A;  4WWO A;  1F2R C;  1P9D U;  2JYE A;  2WDT B;  3Q6B A;  3DVG Y;  4PYZ A;  4TQ0 A;  1J7B A;  1HTQ A;  3ZXR A;  1FXA A;  1WGY A;  3UQA A;  3GP7 A;  2N9P C;  2LEK A;  4LJO B;  3EUB 2;  1S3S G;  3IHP C;  5FK9 C;  2IGG A;  3V62 A;  3ZIM A;  2AL3 A;  1UEL A;  1UWM A;  2AX5 A;  3APC A;  3VTU A;  1XT9 B;  3A4S C;  1JWU D;  3TJP A;  2FCM A;  3FKY A;  4HEA 1;  3U7D A;  1TKY A;  1LGR A;  2VH1 A;  2LGD A;  2MQJ A;  1TT5 B;  2KMA A;  3MC0 B;  3VAW A;  3PHX B;  4K81 A;  4TQ1 A;  3P4R B;  1P98 A;  3NRZ A;  2FAZ A;  2MP2 A;  3B08 A;  1TBE A;  1WGK A;  5IOI A;  1WFY A;  4FJY A;  4HRO A;  3PT2 B;  4FN2 A;  1KTK A;  3AE2 B;  4NQK E;  1K51 A;  2RSU A;  1WYW B;  4HDQ A;  3CMM B;  1BUI C;  2OJR A;  1IGC A;  3Q69 A;  4I6N B;  1YJI A;  4ZRJ A;  1E90 A;  1XEE A;  2FCS A;  5AZH A;  1SJH D;  1J7C A;  4IC7 B;  4RNA A;  2I1K A;  2V0G A;  3PZ8 A;  3AI5 A;  1GG3 A;  3GOE A;  1T6B X;  3ZNH B;  1C3T A;  2J53 A;  4ZRP A;  1OTR B;  1WYG A;  2RR9 A;  2FCQ A;  4JGH B;  1I4G A;  3A9J B;  1FXT B;  1T5X D;  5D2M B;  4UDU C;  2JPH A;  4DHJ D;  4KZC A;  3BZD B;  4IOI E;  4K1R B;  2JZ3 B;  2R2Q A;  4USA A;  3FC4 A;  4ZYS A;  1L2N A;  4KVG B;  3VR8 B;  1WR6 E;  2JXT A;  2C9W B;  1N63 A;  1R4M I;  2KWV B;  3L54 A;  1PDX A;  3SHQ A;  4QAY A;  4D2K A;  4EZJ A;  2C5L C;  4EUT A;  3RCZ A;  1OEY A;  2D2Q A;  3DHH C;  4M02 A;  2LXA A;  2LRU A;  2KFK B;  1L0X B;  2N9K A;  2JU6 X;  2LD9 A;  4NQL B;  3EFC A;  2O6V A;  5EE3 A;  1N5W A;  2KAC A;  4MM3 B;  1FNW A;  3HM3 A;  2J0J A;  1FD6 A;  4HPL B;  1TKG A;  4YSX B;  2VH2 A;  1D4B A;  1XLQ A;  2DYB A;  2MW5 A;  3NZ3 A;  3A1Q B;  3HRD D;  1LQB A;  1JWS D;  3RNF C;  1WXS A;  2J52 A;  3DBL I;  3HHM A;  2JRH A;  2HTM E;  4BBN F;  1TIF A;  2R61 A;  3QAQ A;  3BVG A;  5G55 A;  2A5U A;  4MAC A;  2ZW1 A;  4BFR A;  2XNA C;  3RNA C;  3ZTD A;  2AQ3 B;  4FBJ B;  1V49 A;  4DDI D;  2ZNV B;  3ONS A;  4JE3 B;  2I38 A;  4PYU A;  3RUL A;  5E6N A;  3IBE A;  3FAH A;  4ANX A;  2EKE C;  5DPR A;  1L0Y B;  4YT0 B;  2BKF A;  3KUC B;  2N7J A;  2MJE A;  2JSV X;  3PRM B;  4K3B A;  2BGF A;  2ZVN A;  1PFD A;  2FUG 1;  2PLP A;  4XX5 A;  2ZW0 A;  2K0P A;  1CQV A;  1U4A A;  1D6E C;  3C8Y A;  1MI0 A;  2LGX A;  1HZ6 A;  2O2V B;  2ZPY A;  3ML9 A;  2BTE A;  3P1M A;  4JQW C;  4NAW A;  4HKQ A;  2MBO A;  3V05 A;  4KSL C;  4B95 A;  4JWS C;  1SE2 A;  2JWU A;  2KDE B;  1HE8 A;  3DBH B;  3W2D A;  3E56 A;  3A1Q A;  1TZO A;  1I4P A;  2JY6 A;  2LVQ A;  2WDR B;  3ZRF A;  3I63 C;  2M19 A;  1F0Z A;  4L1B A;  5CX3 A;  4P1C C;  1VRA B;  4X57 B;  3NZU A;  4YTN B;  4P16 A;  3N30 A;  4NJ6 A;  1I35 A;  1NDD A;  4G50 A;  3LXF A;  3QQ8 B;  1TS3 A;  1ZKH A;  1OQR A;  3GZN I;  5MPO A;  2QEJ C;  1GC7 A;  2IJ0 A;  2Z0E B;  3UF8 A;  1IBX B;  5BMG A;  4K3C A;  2WX1 A;  3H8H A;  2LGY A;  4IM0 A;  3TEZ A;  3Q14 C;  3VFK A;  3X0W A;  5E6J A;  3APF A;  2BF8 B;  2IBI B;  2NMQ A;  1YN3 A;  5HKH A;  1E0Z A;  4I6L B;  5AEK B;  4ZHO A;  3NY5 A;  2WDV B;  5AZG A;  4KGR A;  4C7Y A;  3QK0 A;  4AS1 A;  2IZV B;  1AYF A;  4Q2J A;  2UYZ B;  5D94 A;  4S0R A;  1PQS A;  4PS8 A;  3IFW B;  1QOF A;  2LHE A;  2ZVO A;  2M17 A;  2CHW A;  4KDI C;  2WDQ B;  2W9N A;  4L23 A;  1E5W A;  3DPD A;  4H2A A;  3QJZ A;  3UIN B;  2Q5W D;  4BVU C;  2XK5 A;  4O1N A;  5KHO A;  4OVV A;  4L2Y A;  1TS5 A;  4LDT B;  2DZI A;  2KKC A;  2W82 A;  4MH0 E;  4G11 A;  3TUO A;  1KLV A;  2N7D A;  4IDI A;  1V2Y A;  4RH6 A;  3HVD A;  1WX8 A;  2WXH A;  3TIX A;  4KV2 A;  5JHA A;  4ITK A;  2X38 A;  2PMV A;  4YSY B;  5KHQ A;  3L0W B;  3NVV A;  5CHW A;  2FNJ B;  1YX6 B;  3R8B A;  2FIF A;  4RCO A;  1UD7 A;  3ETR A;  3RPF C;  5J18 A;  3IT4 B;  4A3P A;  1WIA A;  4JX1 C;  1IBX A;  5GMV A;  1P0R A;  1ZW7 A;  1EU3 A;  1V81 A;  1NYQ A;  3AMZ A;  2KC1 A;  2Z59 B;  1NYR A;  4ICU A;  4TV3 A;  5E6P A;  4M00 A;  2JVC A;  2WS3 B;  1Q5W B;  4GDL B;  1BT0 A;  1OQY A;  1QLB B;  1BML C;  2KAN A;  4AJY B;  2AWT A;  2EEL A;  3QX1 A;  2PW9 A;  2Y5P A;  2GBM A;  3BVZ A;  5AUI A;  1F2R I;  4AP4 C;  3AEC B;  1VZ7 A;  3DBR B;  1UWX A;  1KM7 A;  1P3Q U;  4REZ A;  2WLB A;  5IO9 A;  1EUV B;  2KX3 A;  1SGH A;  3P2B A;  3BK1 A;  3Q8C A;  3O13 A;  1XXG A;  3KLS X;  4WIP A;  2RMM A;  3M63 B;  3U8Z A;  3PRP B;  2QIE B;  1VDV A;  2WXQ A;  3DHI C;  4WQO B;  2B3A A;  3VTV A;  3RFZ B;  1PGB A;  3I5J C;  3DWM A;  5D6J B;  3MC8 A;  4A3O A;  2KD0 A;  1UGM A;  4GOC A;  2FCN A;  2PE9 A;  1A70 A;  4MSQ B;  4FLH A;  2G9H D;  4KDL B;  1V1P B;  3P4P B;  2M0X A;  1YX5 B;  4KIK A;  4W9H A;  3Q8F A;  2KVR A;  3EHV A;  1GAQ B;  1UBQ A;  1WWT A;  4HWI B;  1CJE A;  1WXM A;  2DWQ A;  5AZF A;  2GLS A;  4P7I A;  3QHT A;  3PRE A;  2DZJ A;  2INN E;  1WE6 A;  3LYY A;  1I4R A;  4IKG A;  1OQQ A;  3GE3 C;  4MGY E;  5JHB A;  1ROE A;  4GDL A;  2KX0 A;  2MLB A;  4LJP B;  2PE6 B;  1QF6 A;  4GDK A;  1Q1O A;  3AEE B;  1TS4 A;  4W9E A;  1UF0 A;  2IGH A;  5DPS A;  2QCZ A;  3ZNI D;  1RRB A;  3V6E B;  1QOA A;  5EE0 A;  1YN4 A;  4PK1 A;  4PS7 A;  4N58 A;  2DYM A;  4OZC A;  3TSS A;  4PT5 A;  1QKZ A;  2C7M B;  2KOX A;  5I4D A;  3A9K A;  3TL5 A;  1H8C A;  4WAF A;  2RD0 A;  2MH7 A;  2KNB A;  4AQ7 A;  2LFI A;  2WXP A;  3RNE C;  3IAS 1;  2L0T A;  2PKO A;  1OFF A;  2WXR A;  1KH0 A;  2K9X A;  4RMA A;  2IO1 B;  2M0A A;  3AE3 B;  3ZQ4 A;  4MDK E;  1KF6 B;  2V4L A;  2L3Z A;  1JQ4 A;  4F7Z A;  1MPE A;  3SD5 A;  3R66 C;  1XLN A;  3L08 A;  2INC C;  1V1P A;  3MTN B;  2AYO B;  2PPH A;  3AE6 B;  2N9E B;  3K9P B;  2Z0D B;  1HXY D;  2J4X A;  1JWM D;  1GC6 A;  1E8W A;  3V3X A;  4EKU A;  4FHJ A;  3VXW A;  2QMT A;  2V3N A;  2KLC A;  4N59 A;  4ZDV A;  3RNB C;  2WXI A;  3VH4 B;  1AW7 A;  4AUQ C;  4YSZ B;  1K53 A;  3U4E G;  4MEM A;  3QC8 B;  2NTS A;  3V6C B;  1TTN A;  1D3Z A;  3ZYY X;  5CTR C;  3EA6 A;  3OJ3 A;  2MCN B;  1ZXH A;  2Z8L A;  2LWP A;  2DNF A;  2W3R A;  4NNJ B;  2L83 A;  3CWI A;  3RT3 B;  4BOS C;  3KWV A;  4LNK A;  3P4S B;  2AQ2 B;  4JL9 A;  3BIN A;  2ZEQ A;  1WM2 A;  4ZYN A;  1TGZ B;  2KJH B;  1ZUD 2;  2N4F A;  4WJQ A;  4WWP A;  2CS4 A;  4OHJ A;  1B1Z A;  1Q10 A;  4G3X B;  1EO6 A;  4GN1 A;  3DHG C;  3A4R A;  2WU5 B;  5D7G A;  1F77 A;  3WAO A;  1GOZ A;  1QOB A;  3FIL B;  3HVZ A;  1E7U A;  2BB6 A;  2OJW A;  1L0V B;  3ENE A;  3QA8 A;  4ZOH C;  4NJ7 A;  2Y5B B;  1M94 A;  3BVM A;  2WXG A;  1DOY A;  2KZR A;  3RD2 A;  3IVF A;  3B1L X;  3Q3M C;  1YQ4 B;  1GUA B;  3KVF B;  3T9L A;  1SE3 A;  1MHX A;  2PJH A;  3VDZ A;  4M0W B;  1KOT A;  1ZPS A;  4GSW A;  1B9R A;  1GB1 A;  2PIA A;  5DCN A;  2ZZP B;  1Z2M A;  1QT9 A;  3PLU A;  3DCG A;  1TY0 A;  2K22 A;  2KQ4 X;  2BWE S;  4OZB A;  2IND C;  4J6I A;  3S2A A;  1WJU A;  1Z5S B;  1SSN A;  3NVZ A;  3UI3 A;  1VZ6 A;  1EWY C;  2WXN A;  3AEA B;  1WGG A;  2TSS A;  3T3N A;  3AE7 B;  1S1Q B;  1WRI A;  3N9Y C;  1UH6 A;  3QIJ A;  1SBB B;  1F1H A;  3MHS D;  1IGD A;  2MSE D;  3LB8 C;  5JZE B;  2ZPN A;  5HHD G;  1ISN A;  3VRA B;  4ASW C;  2K25 A;  4E71 A;  4ZRQ A;  4C00 A;  1UNS A;  3ZUN A;  2KFJ A;  3EEC A;  2Y3A A;  3FIL A;  4NAM A;  1WJ4 A;  1WXA A;  4II2 B;  1R4M B;  1E7P B;  4W9L A;  4MJS B;  1V80 A;  2ZCB A;  2I2Y A;  4XDD A;  2LUE A;  4YL8 A;  3T8M A;  1GJZ A;  2MX2 A;  3RMK C;  2KLG A;  2M8S A;  3RNC C;  1WGD A;  1ACC A;  2CU1 A;  1P7F A;  1T0Q C;  4KSK C;  2RPQ A;  3A9J A;  1UUP A;  2JQR B;  4A90 A;  5D3D A;  2G4D B;  4EZK A;  2MRP A;  4IWP A;  4DK5 A;  2AEH A;  2REX A;  3DQV A;  1N6Z A;  3Q3N C;  3GB1 A;  1E10 A;  2UU7 A;  3IXS A;  4HK2 A;  4AJW A;  4JIO U;  1T0S C;  1E7V A;  3B2G A;  2KJ6 A;  3WIM A;  3CIR B;  2ASQ A;  1XF5 L;  1WE7 A;  2KFK A;  2M56 B;  3L10 B;  4F8C B;  3TEY A;  2BVC A;  5BMH A;  3W5U B;  2HJ1 A;  2PVO D;  4MM3 A;  5IAA C;  1C4P A;  2DHZ A;  4N6E B;  1R4N I;  4LNO A;  3L13 A;  2IDY A;  4TKN A;  1D5M C;  1WF9 A;  2CHX A;  5G2N A;  2C60 A;  4US8 A;  5E6O A;  3ZJU A;  1R7S A;  4XDC A;  1JWB D;  3KUD B;  1WMH B;  2GOW A;  2JZZ A;  2G1E A;  2IYD B;  4JWU C;  2WXJ A;  4FAD A;  2KVZ A;  5FKA C;  2L8J A;  4S17 A;  5G5H A;  2FUH B;  4GMV A;  3RUI B;  1L4D B;  3CSF A;  4EZL A;  2NBV B;  2RDG A;  4C80 A;  1WGR A;  1TYG B;  1HTO A;  2VZK B;  1YJ1 A;  1WSP A;  1FMA D;  1RFK A;  2MBH A;  2NTT A;  4NY0 A;  3AM9 A;  2O6V D;  4WJO A;  3ZGZ A;  3K9O B;  1J19 A;  1VLB A;  5IN7 A;  3QAR A;  2H88 B;  5HI1 A;  1CZP A;  4RM8 A;  3Q2A C;  1DYQ A;  1ZE3 D;  1OEY J;  1EF5 A;  4NJC A;  3ZVV A;  1E8X A;  1H4R A;  1STE A;  2ZNV C;  2BPS A;  3RI7 C;  3AH7 A;  4BKT A;  1ET6 A;  5D3I B;  3GZN B;  2O2V A;  1WRD B;  1AAR A;  2W55 A;  2JRI B;  1L6U A;  3L17 A;  1YN5 A;  2YLM A;  4BBN C;  1JRO A;  1HA5 A;  3D32 A;  1XLO A;  1PGX A;  4FXC A;  1WM3 A;  3U7Z A;  3QCA A;  4BOZ B;  1LFD A;  3APD A;  2RPV A;  3PS6 A;  2HTH A;  1MHH E;  3V60 A;  1Y8R C;  5BYR A;  2C7N B;  1JCK B;  1I4H A;  3B9J A;  2J7Q B;  3ZTC A;  3UIO B;  4RGT A;  1JAL A;  4B0M A;  2A4Z A;  3VRB B;  3AEG B;  1MFW A;  3M62 B;  1K8R B;  1L4Z B;  5LLI A;  3WAN A;  1WR1 A;  2WP9 B;  2G4S A;  3M3J A;  2LGS A;  1K50 A;  3SU8 X;  4KX6 B;  2V3S A;  5EE1 A;  3OAW A;  1LM8 B;  3DWG C;  3AN1 A;  1HQR D;  1RYJ A;  4ZRI A;  2HDE A;  1C1Y B;  4HXD A;  2GRI A;  3W5V B;  3JSV B;  1T0R C;  1EWC A;  3X23 A;  3NOB A;  3AUL A;  4KGS A;  2CU3 A;  4DQO C;  3ZLZ A;  1J0G A;  2WXM A;  3DDC B;  3SR6 A;  1LO5 D;  2C7H A;  2D5G A;  2K1F A;  3TBL D;  3HK0 A;  3NS8 A;  4DHZ B;  1ESF A;  3MJ5 A;  4IW0 A;  3ZJT A;  2OOB B;  3N1X C;  3DVG X;  2BBC A;  2J42 A;  1C76 A;  1T3Q A;  2IY1 B;  4BZA A;  5IA7 A;  5J17 A;  5FR6 A;  2QSD A;  1SEB D;  2N9L A;  4P1B C;  2DBY A;  3KQ4 A;  4IWO A;  1ZP0 B;  4GXB A;  4KZ0 A;  3H6N A;  4KKJ A;  2D3C A;  1E6E B;  4JPS A;  4W9C A;  2N1V A;  1FNV A;  4DXG A;  4DHJ B;  1WJ6 A;  4NZL B;  4M8N A;  1F9J A;  2KWU B;  4GB9 A;  3PZD A;  5IKC M;  2IO2 B;  3VR9 B;  3PPA A;  3AEF B;  1WXQ A;  4CHK A;  4ARC A;  2DX5 B;  1KLU D;  2D3A A;  4OVZ A;  1FRD A;  3WAP A;  1SF0 A;  1FRR A;  4FHK A;  2IY0 B;  3PVL A;  2L05 A;  5LNK 1;  2K8C A;  2OED A;  5EE9 A;  2KO3 A;  2MBB B;  1FEH A;  3ZNZ B;  3B2F A;  1FNU A;  3H9D A;  2K6Q A;  3BYT B;  1PYW D;  5C23 A;  1CK1 A;  2WU2 B;  1L6V A;  3MJW A;  3MC9 A;  3U52 E;  3IT6 B;  3WCQ A;  1UZX B;  2KK8 A;  2L52 A;  1V9J A;  4RGO S;  2IGD A;  3JW0 X;  1NI3 A;  3ZRC A;  5HG2 A;  3VH3 B;  3H1U A;  1IYF A;  3HUI A;  3GE8 C;  5CHF A;  3VUW A;  2MBE A;  5FR3 A;  4EEW A;  2BYF A;  1V86 A;  4TMA B;  5T8I A;  4CQN A;  1XCQ L;  2BW2 A;  3ABV B;  1MG4 A;  2LUM A;  1Y56 A;  3QWZ B;  3Q8B A;  2IO0 B;  4TUU A;  2D10 A;  2WYQ A;  4AOF A;  5AUK A;  2QHO A;  3AED B;  1WZ0 A;  2BB5 A;  2XEW A;  1T0Y A;  3VUX A;  3KYD D;  1V8C A;  2WWZ A;  4E74 A;  3VQI A;  3OJ4 B;  1WZ3 A;  1TZ1 A;  3IAM 1;  3ZDM C;  3NS1 A;  3SFE B;  1ZOY B;  1GNU A;  2W3S A;  2RDB C;  2QJL A;  1PGA A;  1V5O A;  4OVU A;  1V1O A;  1C78 A;  1WY8 A;  2K8B A;  2GB1 A;  5HFY A;  4IM3 A;  3SDL C;  1K52 A;  2G3Q B;  2ACZ B;  3ZKJ C;  1TY2 A;  2EMT A;  4XYC A;  4A55 A;  4XC2 A;  3TEX A;  1ET9 A;  2LAS A;  2LXC A;  4WH4 A;  2DEN B;  3BWU D;  3PZ7 A;  1J8C A;  2MJD A;  3PO0 A;  4LDT D;  4WQM A;  3O65 B;  4N9F 4;  4MGZ E;  1DGJ A;  1L7Y A;  3Q8E A;  3ZO5 B;  1FO4 A;  4M01 A;  1M4V A;  1MJD A;  2XN9 C;  3ML8 A;  3HIZ A;  2DYO A;  4OZA A;  3ZDT A;  4B6W A;  3UIP B;  1WI0 A;  2BYE A;  2LJI A;  4DDG D;  3IG3 A;  4HJG E;  1D5X C;  1JRU A;  1N62 A;  3N1Z C;  2BT6 A;  1DOI A;  2O6V B;  2KMC A;  2LI5 A;  3U2S C;  4BKG A;  2LMC A;  2KC2 A;  1FFV A;  3N1Y C;  3MFG A;  4WWM A;  2L0F A;  5TSS A;  4LLG M;  4RF0 A;  2PVG C;  4C4V B;  2CHZ A;  2MEK A;  4MEL A;  1WGH A;  4KKI A;  4A6Q A;  5H8Y E;  1IUE A;  2ON8 A;  4I6P A;  3I9V 1;  3RZW C;  3PLV A;  1RAX A;  2KDM A;  2L76 A;  2KDF B;  4WAA A;  4MH8 A;  3T3O A;  4ZHP A;  2JUO A;  2GBN A;  2RGF A;  5JH5 C;  4A20 A;  1TS2 A;  1ZDV A;  2WHI A;  3MP9 A;  2DAF A;  2D07 B;  2CJN A;  2LVO A;  2MHJ A;  1FCC C;  2KJR A;  5IP4 D;  2MJ3 A;  5C3J B;  4ACF A;  2HD5 B;  4CO7 A;  3R7Q A;  4ANV A;  3U30 A;  4HPP A;  1RWS A;  3L16 A;  3ZW3 A;  4RFB A;  3LDZ E;  3M95 A;  3NZS A;  4ICV A;  4W9J A;  4MGI E;  3Q8A A;  4DHZ E;  5L83 A;  3KUZ A;  3LJ3 A;  1BXT A;  4HPM B;  1XO3 A;  2H89 B;  1C9F A;  1I4X A;  2X8X X;  3WAM A;  3KYC D;  1SE9 A;  2UWQ A;  4JLC A;  3PTF C;  3KW5 B;  1NBF C;  2WXK A;  4GLS C;  1XQQ A;  3EC8 A;  3Q3J A;  4IM2 A;  1C4A A;  4NAW B;  1V6E A;  1I4Q A;  4E3C A;  1KLG D;  2KYW A;  2ICI A;  2QC8 A;  2LJ5 A;  2M4N A;  4XGA B;  4C4V A;  2GBJ A;  2VRR B;  4M0W A;  1SIJ A;  2WX0 A;  3N32 A; 
#chains in the Genus database with same CATH homology
 2DAJ A;  2FCM A;  4AWJ A;  4MSQ B;  4FLH A;  2EMS A;  2PEA A;  4K7W A;  3U7D A;  2O2V A;  1WRD B;  1AAR A;  4KDL B;  2JRI B;  2KXJ A;  3L17 A;  3H7P B;  2M0X A;  1YX5 B;  4KIK A;  4W9H A;  2LGD A;  2MQJ A;  2XBB C;  2KMA A;  2YLM A;  3VAW A;  2KDB A;  2KVR A;  4BBN C;  3EHV A;  2KWC A;  3PHX B;  4K81 A;  4TQ1 A;  1UBQ A;  1P98 A;  4HWI B;  2HJ8 A;  1WXM A;  2CKH B;  2FAZ A;  2MP2 A;  5AZF A;  3D32 A;  4P7I A;  3B08 A;  1TBE A;  3QHT A;  3PRE A;  1IPG A;  1WFY A;  2DZJ A;  4FJY A;  1WM3 A;  2JWZ A;  3QCA A;  3PT2 B;  4FJZ A;  4FN2 A;  4BOZ B;  1LFD A;  1WE6 A;  3APD A;  4NQK E;  3V61 A;  3PS6 A;  3WA0 A;  1XD3 B;  5L95 C;  2HTH A;  2RSU A;  1WYW B;  4HDQ A;  3V60 A;  2N7E A;  1Y8R C;  4MGY E;  4PS3 A;  3VTW A;  2K8H A;  5JHB A;  4GDL A;  2KX0 A;  2MLB A;  3CMM B;  4LJP B;  2OJR A;  2C7N B;  2LZ6 A;  2L00 B;  2PE6 B;  3DBH I;  4I6N B;  4DXA B;  4GDK A;  1Q1O A;  2J7Q B;  4HCN B;  4ZRJ A;  3ZTC A;  4W9E A;  3UIO B;  5DPS A;  1E90 A;  2FCS A;  2A4Z A;  2GMI C;  5AZH A;  3M62 B;  5LLI A;  1K8R B;  3WAL A;  3WAN A;  3ZNI D;  1RRB A;  1WR1 A;  2K6D B;  2G4S A;  3M3J A;  1KJT A;  3V6E B;  4IC7 B;  4PS7 A;  3SU8 X;  1I42 A;  3AXC A;  1WJN A;  2DYM A;  3ALB A;  2I1K A;  2V3S A;  3AI5 A;  1GG3 A;  2C7M B;  3OAW A;  1LM8 B;  2KOX A;  3GOE A;  3A9K A;  3TL5 A;  3ZNH B;  1IP9 A;  1C3T A;  1H8C A;  4ZRI A;  1OTR B;  2RR9 A;  4GU2 A;  2FCQ A;  1C1Y B;  4HXD A;  2RD0 A;  3JSV B;  4JGH B;  3A9J B;  1FXT B;  5D2M B;  2KNB A;  2JF5 A;  2J0K A;  4MJS A;  3X23 A;  3NOB A;  3AUL A;  2JPH A;  2L0T A;  4DHJ D;  4KZC A;  2R2O A;  2DZK A;  4K1R B;  2JZ3 B;  2R2Q A;  3UGB B;  3R3M A;  4RMA A;  2IO1 B;  1YIW A;  3ZLZ A;  3ZNG C;  2MBQ A;  4MDK E;  1J0G A;  3CF6 E;  1L2N A;  4KVG B;  2V4L A;  1WR6 E;  2L3Z A;  2C9W B;  2XK5 B;  1R4M I;  2KWV B;  3DDC B;  3L54 A;  4F7Z A;  3AU5 A;  3SD5 A;  2C7H A;  3SHQ A;  3R66 C;  2K1F A;  3TBL D;  3HK0 A;  3NS8 A;  4DHZ B;  3L08 A;  5DPW A;  1OGW A;  4IW0 A;  3MTN B;  4EZJ A;  2AYO B;  2C5L C;  2OOB B;  2PPH A;  3DVG X;  1RLF A;  2N9E B;  3H7P A;  1OEY A;  2D2Q A;  2ZCC A;  3K9P B;  2Z0D B;  5J2R A;  2IY1 B;  2LXA A;  1GC6 A;  4B9K A;  1E8W A;  1SIF A;  2LRU A;  2KFK B;  5IA7 A;  5J17 A;  5FR6 A;  3EFU A;  4EKU A;  4FHJ A;  3VXW A;  2HE7 A;  4IWO A;  2LD9 A;  4EOY A;  4NQL B;  2KLC A;  2O6V A;  4ZDV A;  4GXB A;  4KZ0 A;  3VH4 B;  3H6N A;  3I3T B;  4AUQ C;  4MEM A;  3QC8 B;  2KN5 A;  3HM3 A;  4W9C A;  2J0J A;  3V6C B;  1TTN A;  4HPL B;  2KTR B;  3DBS A;  1D3Z A;  3W1S A;  2N1V A;  2MA9 B;  4DHJ B;  1WJ6 A;  5CTR C;  5LXI B;  4M8N A;  3AU4 A;  1F9J A;  2KWU B;  1ZGU B;  4GB9 A;  1RFA A;  5CHV C;  2DYB A;  2MW5 A;  3A1Q B;  3OJ3 A;  3JVZ X;  3PHW B;  1CMX B;  3PZD A;  4HCP B;  5C1Z A;  2BWF A;  1LQB A;  2IO2 B;  4MGK E;  4HJK A;  2MCN B;  3PPA A;  2NBU A;  3H7S A;  4DWF A;  2NPT B;  1WXS A;  4G0N B;  3DBL I;  2LWP A;  2V1Y A;  4CHK A;  3HHM A;  2JRH A;  4NNJ B;  3UQB A;  2DX5 B;  4BBN F;  1UBI A;  2YVC A;  3QAQ A;  4M8M A;  3WAP A;  3RT3 B;  4BOS C;  5G55 A;  2A5U A;  2FID A;  4FHK A;  4BFR A;  4JL9 A;  2IY0 B;  3PVL A;  4FJV B;  3BIN A;  4BKS A;  2ZEQ A;  3ZTD A;  3TCA A;  1WM2 A;  3W1S C;  4ZYN A;  2L05 A;  1TGZ B;  5LXH A;  2KJH B;  4FBJ B;  1V49 A;  4F1S A;  2N4F A;  2K8C A;  4WJQ A;  1WMH A;  3TMP B;  4DDI D;  4WWP A;  2KO3 A;  2MBB B;  2CS4 A;  3ZNZ B;  2ZNV B;  3ONS A;  4G3X B;  2L7R A;  4FUL A;  2K39 A;  4PYU A;  1E8Z A;  1WX9 A;  1EO6 A;  2K6Q A;  3H9D A;  4GN1 A;  3RUL A;  5E6N A;  3IBE A;  5C23 A;  3A4R A;  4ANX A;  5D7G A;  2J0M A;  3WAO A;  2EKE C;  5DPR A;  3MJW A;  1E7U A;  2BKF A;  3NHE B;  3KUC B;  3Q3F A;  2NVU I;  3PRM B;  2IO3 B;  3PV1 A;  1UZX B;  2BGF A;  2ZVN A;  2KK8 A;  3ENE A;  1V9J A;  3QA8 A;  4RM9 A;  1E8Y A;  3DOW A;  3JW0 X;  4NJ7 A;  4XX5 A;  2Y5B B;  3ZRC A;  1M94 A;  3VH3 B;  3H1U A;  4EFO A;  1IYF A;  3DVN V;  2KZR A;  2NS5 A;  3IVF A;  3B1L X;  3RD2 A;  1GUA B;  3KVF B;  1U4A A;  5CHF A;  3T9L A;  3VUW A;  2PJH A;  3VDZ A;  4CYE A;  2MBE A;  4M0W B;  3W1Y A;  4EEW A;  5BO4 B;  1KOT A;  2BYF A;  1V86 A;  2LGX A;  3DBR I;  4GSW A;  2O2V B;  2ZPY A;  3ECI A;  3ML9 A;  5DCN A;  4JQW C;  4NAW A;  2MBO A;  2KTF A;  2ZZP B;  4KIK B;  1Z2M A;  2KTR A;  4KSL C;  3PLU A;  3DCG A;  3QWZ B;  4B95 A;  2IO0 B;  1YD8 U;  4TUU A;  2D10 A;  2BWE S;  2KDE B;  1HE8 A;  4MSM B;  2WYQ A;  4GGQ A;  4AOF A;  4J6I A;  2AL6 A;  2QHO A;  3A1Q A;  5DPT A;  2KHW B;  3R7R A;  3S2A A;  1WJU A;  1WZ0 A;  1Z5S B;  2JY6 A;  2LVQ A;  2XEW A;  3ZRF A;  1P1A A;  1T0Y A;  2NPT A;  1VCB A;  3VUX A;  3KYD D;  5CX3 A;  2WWZ A;  4E74 A;  3VQI A;  3OJ4 B;  3RCZ A;  1WZ3 A;  3NZU A;  4X57 B;  1WX7 A;  1TZ1 A;  3HM6 X;  3N30 A;  3ZDM C;  4NJ6 A;  1WGG A;  1I35 A;  1GNU A;  1NDD A;  2N1W A;  1S1Q B;  2LVP A;  4G50 A;  4GDK B;  3QQ8 B;  1UH6 A;  1V5O A;  3QIJ A;  4OVU A;  1WY8 A;  1ZKH A;  2K8B A;  5EDS A;  3MHS D;  3GZN I;  2MSE D;  2GBK A;  5JZE B;  3RZF A;  4IM3 A;  3SDL C;  2ZPN A;  2G3Q B;  1ISN A;  1GC7 A;  2KDI A;  2Z0E B;  2K25 A;  3UF8 A;  3ZKJ C;  4ASW C;  2D3G A;  2WX1 A;  4E71 A;  1V5T A;  2EMT A;  2LGY A;  4IM0 A;  4XC2 A;  3A9K B;  3VFK A;  3VHT C;  3ZUN A;  1LXD A;  3X0W A;  2LAS A;  2KFJ A;  2LXC A;  3EEC A;  3APF A;  2BF8 B;  4II3 B;  3B0A A;  1WJ4 A;  1WXA A;  1J8C A;  2IBI B;  2BKR B;  4LDT D;  5HKH A;  4IUM B;  4II2 B;  4I6L B;  5AEK B;  4WJP A;  4W9L A;  3O65 B;  4ANW A;  4MJS B;  1V80 A;  2ZCB A;  4N9F 4;  4MGZ E;  2LUE A;  2NCN A;  4YL8 A;  3NY5 A;  3T8M A;  1GJZ A;  2MX2 A;  1L7Y A;  3PGE A;  4EUT A;  2KLG A;  5AZG A;  4XZ4 A;  3ZO5 B;  3QK0 A;  4URK A;  2M8S A;  1WGD A;  3PRZ A;  3C0R B;  3BY4 B;  2IZV B;  2UYZ B;  2CU1 A;  5D94 A;  1PQS A;  4PS8 A;  3ML8 A;  3JSV A;  3HIZ A;  4KSK C;  2KQ7 A;  2RPQ A;  3A9J A;  3IFW B;  2DYO A;  4LCD E;  3PSE B;  2ZVO A;  2D11 A;  2M17 A;  3ZDT A;  4B6W A;  2CHW A;  4KDI C;  3VVW B;  3UIP B;  2G4D B;  4EZK A;  2MRP A;  2W9N A;  1E5W A;  4IWP A;  1WI0 A;  3DPD A;  2BYE A;  3RYT A;  4DK5 A;  2AEH A;  2REX A;  1Q0W B;  3QJZ A;  3DQV A;  4DDG D;  4BKS D;  3IG3 A;  3UIN B;  1JRU A;  4W9G A;  1NI2 A;  4BVU C;  2XK5 A;  2O6V B;  5KHO A;  4OVV A;  2KMC A;  4W9D A;  2LI5 A;  4LDT B;  1G6J A;  2DZI A;  4HK2 A;  3N32 A;  2KKC A;  2N9X A;  4JIO U;  4MH0 E;  4AJW A;  4G11 A;  2CR5 A;  1E7V A;  3JYU A;  2KJ6 A;  1KLV A;  3WIM A;  2N7D A;  4BKG A;  3DVN U;  1V2Y A;  2KC2 A;  2KQS A;  2ZJD A;  2ASQ A;  1WE7 A;  2KFK A;  2L0F A;  1WX8 A;  3TIX A;  2DZM A;  3L10 B;  4KV2 A;  4F8C B;  5JHA A;  1WH3 A;  4HDO A;  5KHQ A;  4IWQ A;  3L0W B;  2CHZ A;  4MEL A;  1WGH A;  5CHW A;  2FNJ B;  1YX6 B;  3N3K B;  1A5R A;  2FIF A;  4WWN A;  4MM3 A;  1UD7 A;  4K7S A;  5IAA C;  1QZE A;  4I6P A;  4K7U A;  4DBG A;  5J18 A;  3RZW C;  2DHZ A;  2NR2 A;  3VUY A;  4A3P A;  1R4N I;  1WIA A;  3PLV A;  1RAX A;  4NPN A;  3L13 A;  5GMV A;  1P0R A;  2L76 A;  2KDF B;  2LRW A;  2I1J A;  1ZW7 A;  4WAA A;  2BYV E;  4TKN A;  1WF9 A;  2CHX A;  2JUO A;  2C60 A;  2GBN A;  2MP2 B;  2RGF A;  5G2N A;  5JH5 C;  5E6O A;  1V81 A;  4W9I A;  4A20 A;  2KC1 A;  2Z59 B;  2DAF A;  2D07 B;  4ZRK A;  2LVO A;  4ANU A;  2JT4 B;  3KH0 A;  4ICU A;  4TV3 A;  5E6P A;  4HVB A;  3KUD B;  2JVC A;  1WMH B;  2KJR A;  2GOW A;  1X1M A;  2JZZ A;  2MWS B;  1Q5W B;  2JXX A;  4GDL B;  1BT0 A;  1YQB A;  1OQY A;  4FA6 A;  2IYD B;  2HD5 B;  3OLM D;  4CO7 A;  4FAD A;  2KAN A;  4W9K A;  5TR5 A;  4AJY B;  2AWT A;  3QX1 A;  3A33 B;  1WXV A;  2L8J A;  4GIV A;  3R7Q A;  2G45 B;  4WJN A;  2FUH B;  2M1M A;  2NBW B;  3U30 A;  4ANV A;  4GMV A;  3RUI B;  2GBM A;  3L16 A;  3CSF A;  4AP4 C;  3ZW3 A;  3LDZ E;  3M95 A;  3NZS A;  4ICV A;  4W9J A;  4IG7 B;  1EF1 A;  2NBV B;  4MGI E;  4EZL A;  1KM7 A;  1P3Q U;  4W9F A;  4DHZ E;  5L83 A;  3KUZ A;  1WGR A;  3CST A;  1EUV B;  2KX3 A;  3LJ3 A;  1YJ1 A;  4HPM B;  1SGH A;  3P2B A;  1MG8 A;  2GBR A;  4HLE A;  1VD2 A;  4WWO A;  2MBH A;  1P9D U;  3WAM A;  4NY0 A;  2WDT B;  3DVG Y;  3M63 B;  4PYZ A;  2O6V D;  4TQ0 A;  3U8Z A;  3KYC D;  4WJO A;  1SE9 A;  2UWQ A;  3K9O B;  3PRP B;  1J19 A;  4JLC A;  3PTF C;  1WGY A;  3KW5 B;  3UQA A;  2N9P C;  1NBF C;  4LJO B;  1S3S G;  3IHP C;  3V62 A;  4WQO B;  2B3A A;  1XQQ A;  3EC8 A;  3Q3J A;  4IM2 A;  3QAR A;  3ZIM A;  2AL3 A;  4NAW B;  3VTV A;  1UEL A;  1V6E A;  4E3C A;  4RM8 A;  3APC A;  2LJ5 A;  1XT9 B;  3VTU A;  5D6J B;  1OEY J;  4A3O A;  2KD0 A;  1UGM A;  2M4N A;  1EF5 A;  4GOC A;  2FCN A;  2PE9 A;  3ZVV A;  1E8X A;  1H4R A;  2GBJ A;  2VRR B;  2ZNV C;  2BPS A;  3A4S C;  3TJP A;  2WX0 A;  4BKT A;  2DEN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...