4HPLB

Pcgf1 ub fold (rawul)/bcor pufd complex
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
90
structure length
83
Chain Sequence
TREQLNLCLERLSSVLQNKYVRCSVRAEVRHLRRVLCHRLMLNPQHVQLLFDNEVLPDHMTMKQIWLSRWFGKPSPLLLQYSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the Polycomb Group Protein PCGF1 in Complex with BCOR Reveals Basis for Binding Selectivity of PCGF Homologs.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords BCL-6 corepressor
total genus 22
structure length 83
sequence length 90
ec nomenclature
pdb deposition date 2012-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF16207 RAWUL RAWUL domain RING finger- and WD40-associated ubiquitin-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4hplB00
2Y5BB 4LJOB 2RPQA 2KZRA 2KMAA 1J19A 2ZNVC 1E5WA 1WFYA 3A1QA 4WAAA 3ECIA 4HPLB 4JLCA 1OEYA 2C60A 2WX0A 2GBKA 2QHOA 1WR1A 1YX6B 4EZLA 4BOZB 2MBQA 2LUEA 2RSUA 4DXAB 4HLEA 3C0RB 1E8ZA 3PGEA 2KQSA 4FJVB 2D10A 3DVGY 3PSEB 3WAPA 1IYFA 2Z59B 2KANA 4W9HA 3WAOA 4GOCA 2PJHA 4IWPA 3VVWB 1TGZB 5E6OA 4J6IA 3ZTCA 3ZRCA 2ZZPB 4FULA 2KDIA 3D32A 3H9DA 1E90A 4FJZA 4IM2A 3S2AA 2M4NA 4WJQA 1ZKHA 2FAZA 2L0FA 3DBHI 4W9LA 3UGBB 3V6EB 2KX3A 2KOXA 1TBEA 3H1UA 3HM6X 3ZNZB 1LXDA 4GMVA 2LZ6A 5KHOA 1VD2A 4W9GA 2KJ6A 1WIAA 2KK8A 3VH3B 3B0AA 4MGYE 2N9XA 4EUTA 2LXAA 1TTNA 2I1KA 3MJWA 1L2NA 1WF9A 2IYDB 3EECA 4ASWC 2GMIC 4HDQA 4GDLA 4URKA 3AXCA 2LVOA 3ONSA 3QCAA 4I6PA 1WMHB 1WZ3A 4KSLC 1WM2A 2FCQA 2CU1A 2FUHB 4M8NA 3W1SC 4ANXA 1OQYA 2BGFA 3DBSA 3N3KB 2K1FA 4EEWA 1WRDB 2GOWA 3PTFC 1ISNA 4ANUA 3UQBA 2WDTB 2C7MB 2O6VA 1E8XA 2EMSA 2L7RA 4BKSD 2DHZA 5TR5A 1H4RA 2N9PC 3N30A 3IHPC 3T9LA 1KM7A 1YD8U 3W1SA 2L8JA 2FCNA 2N1VA 3NY5A 5D94A 4HPMB 4PS8A 2XK5A 4IWQA 4A20A 3PLVA 1IP9A 1WH3A 2KTFA 3HHMA 4GDKB 2GBRA 1UD7A 4F7ZA 2FCMA 4XX5A 3PVLA 3GZNI 3H7SA 4FJYA 4II3B 3WANA 2VRRB 2MBHA 4HWIB 3ZKJC 2MX2A 2KC1A 3JVZX 2LGDA 3A9JA 4DHJB 4LDTD 2BKRB 5DCNA 2AEHA 5C23A 1YJ1A 2L76A 5D7GA 3RUIB 4EZKA 4KVGB 5DPSA 1SE9A 3A9JB 3AU5A 2LGXA 2ZCBA 3X0WA 2HD5B 4FN2A 1F9JA 2KLCA 1P0RA 4EKUA 4FA6A 3OJ3A 2BKFA 2KHWB 2JUOA 5LXHA 1P98A 3IVFA 3AU4A 1WI0A 5DPTA 4K7WA 2ASQA 2L00B 2MP2A 4M0WB 3MHSD 3QIJA 5GMVA 4GXBA 5L95C 4W9EA 3ZNHB 4K7UA 4W9KA 2IZVB 2AWTA 3VUYA 3V60A 4JL9A 4IC7B 4HDOA 2PPHA 1CMXB 2L3ZA 3NHEB 3DBLI 1E7UA 2LI5A 3DVNV 1V5TA 3M62B 3A9KA 4LDTB 3RD2A 1EF5A 3SU8X 4FHKA 1GG3A 2JF5A 3U8ZA 3ZDMC 2JWZA 2D3GA 3L17A 2IO1B 4BBNC 4ANWA 1RFAA 4B6WA 4FLHA 3DQVA 3WAMA 3LDZE 5LLIA 3UF8A 2B3AA 4IM3A 1WXVA 1V2YA 4WWNA 2Z0EB 2NVUI 3A1QB 3A9KB 3ZLZA 1WM3A 4AP4C 2IO0B 4DK5A 2LVPA 2O6VD 3DVNU 2M8SA 1KLVA 4RM9A 2V4LA 1RRBA 5EDSA 1EF1A 4MJSA 1WGYA 3ENEA 4DDID 4NQLB 3ZTDA 4GB9A 3VUXA 1H8CA 3VDZA 1UH6A 2FCSA 3OAWA 4G3XB 1YIWA 2ZNVB 4GGQA 4ZRIA 3WA0A 4NQKE 2DX5B 3GOEA 4OVVA 1L7YA 3PV1A 1AARA 3Q3FA 1PQSA 4M8MA 4CHKA 1I42A 3L08A 4WQOB 2KD0A 3QHTA 3ZIMA 2NCNA 3SHQA 5IA7A 3EFUA 2BYEA 2DYMA 2NBWB 2L0TA 3I3TB 3JYUA 2ZJDA 2D2QA 5G2NA 2PEAA 3ALBA 2DAFA 2RR9A 3A33B 4E71A 2J0MA 1GJZA 4F1SA 2MLBA 1R4NI 1T0YA 4MDKE 2CKHB 4PYUA 4RM8A 1WXAA 3NS8A 4JQWC 1JRUA 1E8WA 1WJ6A 4DHZE 2G4DB 1C3TA 2OJRA 2MRPA 3UIPB 4HCPB 2ZEQA 1P9DU 2PE6B 2LWPA 3H7PB 3ZW3A 4BFRA 2CHWA 2UYZB 4W9FA 4EFOA 2OOBB 4CO7A 3APDA 3RT3B 3KVFB 2XK5B 4NNJB 4PYZA 2JRIB 3VUWA 1WZ0A 3PHXB 4FBJB 2KXJA 4AWJA 4DHJD 4GN1A 4X57B 2MQJA 2KLGA 3KYCD 2KX0A 2D07B 2HE7A 3L13A 4WJPA 2IO2B 3R7RA 3UIOB 5AZHA 3QX1A 1YX5B 2N9EB 3OLMD 5G55A 3RZFA 2MW5A 3QARA 2FNJB 1RAXA 5CTRC 1Y8RC 2KFKB 3V62A 3VXWA 2W9NA 1E7VA 4GDLB 1J8CA 1Z2MA 2YLMA 4KIKB 3PS6A 3BY4B 4NAWA 4NJ6A 1V81A 4ANVA 1XD3B 2J0KA 4A3OA 1LM8B 3MTNB 2ZPYA 1WE7A 4BVUC 1S1QB 1V80A 2M1MA 2XBBC 3H6NA 4II2B 3PT2B 4MSMB 3TCAA 2GBJA 1NDDA 2LD9A 4IW0A 2N7EA 2J7QB 1V49A 2BWFA 3DOWA 1GNUA 2XEWA 4HK2A 3VAWA 2IO3B 1V6EA 2KO3A 3WALA 2V3SA 3TJPA 4PS3A 2IY1B 1P1AA 3RCZA 1GC6A 1UGMA 3HIZA 4NY0A 3T8MA 4AJYB 1WX9A 1WGRA 5AZFA 1NBFC 3EC8A 1X1MA 4BOSC 3ZUNA 1OGWA 2IBIB 5C1ZA 2MA9B 3CMMB 3DVGX 4BKTA 1G6JA 3K9OB 3IBEA 4K81A 2G3QB 2KWCA 3KW5B 4KV2A 1Q1OA 4EZJA 3X23A 3WIMA 2KWVB 3ZRFA 2HTHA 5KHQA 3ZDTA 2BYVE 4TQ0A 2KJHB 3DCGA 4FADA 2ZVNA 5DPRA 3PLUA 3M63B 3U7DA 2JY6A 3PPAA 3LJ3A 3TBLD 3V61A 3PRZA 4KZ0A 3R3MA 4GIVA 4CYEA 3AULA 4E3CA 2KDFB 5J18A 3EHVA 2HJ8A 5E6NA 1WY8A 2JVCA 4DDGD 1WGDA 2LVQA 2MSED 2EMTA 1KOTA 1ZW7A 3DPDA 5JH5C 2KJRA 4XZ4A 4KZCA 3QC8B 4LJPB 4ZYNA 4MELA 1WXMA 4HJKA 2JZZA 2NBUA 1Z5SB 3TIXA 3K9PB 3Q3JA 2O2VB 2BYFA 2K25A 3DBRI 2DENB 2C9WB 4W9IA 2WWZA 2G4SA 4W9DA 1RLFA 2CHZA 2WX1A 4TQ1A 2K8CA 1QZEA 3PZDA 4OVUA 2C7HA 3JSVB 4HXDA 3QQ8B 2KKCA 2YVCA 4K7SA 2KN5A 4BKGA 2V1YA 5DPWA 1OEYJ 2GBNA 3KUZA 2MBBB 4HVBA 1OTRB 1WGHA 2JPHA 1XT9B 3ZNID 3JW0X 4ICUA 3JSVA 3ZNGC 5JHBA 2KC2A 2KDEB 3RZWC 2KVRA 3CF6E 1WXSA 3QAQA 4P7IA 1Q5WB 1XQQA 3PREA 5AZGA 4NAWB 1K8RB 2DYBA 2MP2B 2NBVB 2O2VA 2KMCA 3RYTA 3V6CB 3VHTC 2G45B 4KDIC 3A4RA 3IFWB 2K39A 1LQBA 2LXCA 3ZVVA 1TZ1A 3NZUA 4JIOU 4IM0A 1WX7A 3TL5A 2I1JA 1WE6A 2CR5A 1V9JA 5CHVC 1A5RA 2O6VB 1WR6E 5LXIB 4IG7B 4W9JA 4WJOA 4WWOA 4GU2A 3QWZB 4MGZE 3KYDD 1GC7A 4AUQC 3P2BA 5CX3A 2A4ZA 1V86A 2K8HA 3VTVA 3VFKA 1MG8A 1P3QU 2DZMA 3VTWA 1IPGA 3R7QA 2DZJA 2A5UA 5IAAC 3L10B 3M3JA 2K6QA 5FR6A 3BINA 3B1LX 4HCNB 4MJSB 2EKEC 1U4AA 3RULA 2AL3A 2RD0A 4B9KA 2ZVOA 3KH0A 2MCNB 2BWES 3CSFA 5J17A 2BF8B 3R66C 1WJUA 4BBNF 2LGYA 3NZSA 2NPTA 4NPNA 4MSQB 1LFDA 1WX8A 2N1WA 1EO6A 5CHWA 1SIFA 2D11A 4I6NB 2NS5A 3AI5A 2AYOB 2JXXA 2KTRA 3ML9A 3OJ4B 4ZRJA 4WJNA 5JZEB 2KDBA 2NPTB 4MGIE 2K8BA 2KWUB 4IWOA 4PS7A 5HKHA 2KFJA 3HM3A 3PRPB 1WYWB 3TMPB 3N32A 1I35A 1EUVB 2LRUA 4GSWA 4WWPA 2ZPNA 2K6DB 4K1RB 1HE8A 5D6JB 2KFKA 3PHWB 2Z0DB 2JZ3B 4GDKA 4G11A 3DDCB 2DZIA 3QK0A 2FIFA 3L54A 2WYQA 3NOBA 3VTUA 3UQAA 5D2MB 1WJ4A 2UWQA 2IY0B 2C7NB 2LRWA 3L0WB 1BT0A 2FIDA 5JHAA 3L16A 3KUDB 3W1YA 4ZDVA 2JT4B 3APFA 4KSKC 3A4SC 4W9CA 2N4FA 4KDLB 4FHJA 1UZXB 3H7PA 4KIKA 1FXTB 2PE9A 3O65B 3KUCB 4B95A 4I6LB 5L83A 4MM3A 3VQIA 4N9F4 2L05A 1UBQA 2KQ7A 2MBOA 2BPSA 1S3SG 1YQBA 3B08A 4MH0E 1GUAB 2LASA 2J0JA 1V5OA 4TUUA 1WMHA 2KNBA 4TV3A 2GBMA 5J2RA 2MBEA 1SGHA 3HK0A 4G50A 3U30A 4LCDE 2DYOA 5BO4B 2KTRB 3ML8A 2NR2A 1D3ZA 3SDLC 2R2OA 2CHXA 2M17A 4YL8A 5E6PA 1ZGUB 2JRHA 5CHFA 4AOFA 4AJWA 2REXA 1C1YB 4BKSA 4EOYA 1R4MI 4DWFA 4MEMA 1WJNA 2CS4A 3IG3A 4JGHB 2LJ5A 2DZKA 3ZO5B 4RMAA 1E8YA 3M95A 2AL6A 2MWSB 2RGFA 2ZCCA 2C5LC 4DBGA 1UELA 4NJ7A 4XC2A 3PRMB 4E74A 2R2QA 4F8CB 4A3PA 4ZRKA 5AEKB 3VH4B 1NI2A 1VCBA 2N7DA 4DHZB 3SD5A 1M94A 2DAJA 4G0NB 4TKNA 3APCA 1WGGA 4IUMB 3CSTA 4MGKE 1KJTA 3QA8A 1Q0WB 3QJZA 1UBIA 3UINB 4ICVA 1J0GA 2M0XA
chains in the Genus database with same CATH superfamily
1B9RA 2RPQA 1T5XD 2ZNVC 4ZHOA 3R8BA 4LNIA 4Q2JA 2KN4A 2L32A 1I4QA 1WR1A 2MBQA 4L1BA 1E8ZA 4FJVB 4TSSA 2MH7A 2PJHA 4NZLB 4IWPA 2E3TA 2KVZA 3ZTCA 4FULA 2NTSA 3S2AA 2QDFA 2M4NA 1PDXA 3V6EB 4KX6B 2KX3A 2KOXA 4BAXA 2QEJC 3ZNZB 1LXDA 1PUTA 2LZ6A 2MJ3A 2V4IB 4KKIA 2KK8A 3VH3B 1NEKB 2M19A 2LXAA 1V1OA 3MJWA 2K9XA 4I6PA 1WM2A 2CU1A 2GOWA 1CJEA 4BKSD 2DHZA 4WQMA 1KM7A 2L8JA 3T3NA 4M01A 2B76B 1LGRA 4IWQA 2KTFA 2FCMA 2VRRB 2MBHA 1TKYA 2KC1A 4DHJB 3AE7B 3Q69A 1WWTA 3GP7A 2ICIA 2AEHA 5DCNA 5D7GA 3V05A 5DPSA 1SE9A 3AU5A 1MG4A 3X0WA 4FA6A 4HPPA 5LXHA 3IVFA 1DOXA 1BMLC 3Q3OC 4ZYSA 2AWTA 3R2TA 3V60A 4JL9A 1CMXB 3NHEB 2I2YA 1HZ5A 1SJHD 2YEPB 3U8ZA 1V97A 1F2RC 2JWZA 3L17A 4B6WA 3DQVA 2MJEA 5LLIA 1T3QA 2B3AA 4WWNA 1V2YA 2Z0EB 2NVUI 3A1QB 3A9KB 4HEA1 3LYYA 2KWDA 2M8SA 3HUIA 2V4LA 2INNE 4RFBA 1FIQA 5JXVA 3VDZA 3SEBA 1CZPA 3OAWA 1YIWA 2ZNVB 3AEAB 4ZRIA 3ABVB 2MHJA 3GOEA 2V3NA 4OVVA 4ACFA 1A70A 3Q3FA 1PQSA 2L83A 2KD0A 3SHQA 3EFUA 2L0TA 3ALBA 4RH6A 2Z8LA 1T0YA 3OG5A 4PYUA 3NS8A 4JQWC 1WJ6A 3I5JC 2ZEQA 4RF1A 2UYZB 4W9FA 2LGSA 4CO7A 1C79A 4NNJB 1MFWA 4AWJA 1JCKB 4WJPA 2M56B 5LNK1 3QX1A 1YX5B 2WXKA 3AB5A 3VXWA 1E7VA 1JWAD 1ZOYB 1Z2MA 5FKAC 4ANVA 4A6QA 1WE7A 4XWTA 1FCCC 3H6NA 4II2B 4IW0A 4HK2A 2KO3A 1TT5B 4PS3A 2IY1B 3RCZA 1DOIA 1UGMA 3T8MA 2LMCA 1FXAA 1WGRA 2LUMA 5AZFA 1NBFC 1YOVB 2IGDA 3EC8A 4KGRA 1OGWA 5C1ZA 1C4CA 4KGTA 3K9OB 4B0EA 4IKGA 2NTTA 4PK1A 3CWIA 3RN9C 2KWVB 5KHQA 3ZDTA 4TQ0A 1IBXA 3DCGA 1UNSA 4OZAA 2JY6A 3PPAA 3R3MA 4GIVA 3P4QB 2QSDA 1ZE3D 2KDFB 2WXGA 2JVCA 3N1XC 2WHIA 2EMTA 1ZW7A 3DPDA 5JH5C 4ZYNA 4KZCA 3ZXRA 4MELA 1WXMA 3NJTA 2BYFA 3DBRI 2C9WB 2FUG1 1IBXB 2WWZA 4W9DA 1FNUA 2CHZA 2VZKB 2WX1A 1QZEA 2C7HA 3JSVB 1F2RI 2KN5A 1OEYJ 2MBBB 3ZXVA 3HRDD 3RNGC 1XT9B 3ZNID 3JW0X 3RZWC 2AQ1B 3DHGC 3I9V1 1IGCA 2G1EA 2MP2B 3RYTA 2KMCA 4FXCA 3IFWB 2LXCA 4IM0A 3TL5A 2CR5A 1V9JA 1A5RA 2VZKD 2O6VB 3B9JA 1WRIA 1L5PA 5CX3A 2A4ZA 1V86A 3VTVA 2DZMA 3VTWA 1IPGA 3R7QA 1OQRA 1XCQL 5I4DA 2KMMA 3IAM1 1FFVA 3BINA 5IOIA 4RGMA 4HCNB 2WU2B 2AL3A 1P7FA 4B9KA 5IO9A 2BWES 2BF8B 4P1CC 1WJUA 3BVZA 3AE2B 4NPNA 1EO6A 2LGIA 3GS2A 2D11A 3AI5A 1UWMA 1AYFA 2KTRA 3ML9A 2CU3A 4ZRJA 2KDBA 2NPTB 2K8BA 2BQQA 5AUKA 2KFJA 1WYWB 2LRUA 4GSWA 3RNCC 1QLBB 2K6DB 5HG2A 1EU3A 1BXTA 3PHWB 2Z0DB 2JZ3B 3O13A 1IGDA 4GDKA 4G11A 3DDCB 1EWYC 3QK0A 2WYQA 3UQAA 2C7NB 1KLGD 2FIDA 5JHAA 3KUDB 1L4DB 1HTOA 4ZDVA 2JT4B 3APFA 4KDLB 3AECB 4KIKA 1JWBD 3KUCB 4B95A 4JX1C 3B2FA 3AEGB 4QAYA 3VQIA 2L05A 2WXMA 4RGNA 2BPSA 1S3SG 4REZA 1WMHA 2KNBA 2GBMA 5J2RA 1SGHA 2KTRB 3ML8A 3SDLC 2R2OA 4YL8A 5CHFA 1NENB 4AOFA 4AJWA 1C1YB 1MVKA 1WJNA 2LJ5A 2WDVB 1L0YB 2C5LC 3TUOA 1IUEA 2R2QA 4ZRKA 3VH4B 1NI2A 2N7DA 1XXGA 1UBIA 3UINB 4LNKA 2Y5BB 2KZRA 1E5WA 1WFYA 3A1QA 5T8IA 1MJDA 4JLCA 1OEYA 5HFYA 2C60A 2WX0A 2QHOA 2JX5A 1ZXIA 3C0RB 3N20C 4OHJA 3PGEA 3DVGY 4OVZA 3WAPA 1IYFA 2Z59B 4W9HA 4GOCA 4XWWA 3EGRA 1YQ4B 1HEZE 5E6OA 3NRZA 2ZZPB 2W3SA 2KDIA 4IM2A 1E90A 1YJJA 4UDUC 2L0FA 3DBHI 3AN1A 1TBEA 3AEBB 3T3OA 4GMVA 3AH7A 1R4MB 5KHOA 4W9GA 3B0AA 4MGYE 1J7BA 2I1KA 3CIRB 2IYDB 4ASWC 1F77A 2GMIC 2YEPF 4KSLC 1WGKA 3W1SC 4RGTA 1C78A 1MI0A 1TIFA 4EEWA 3PTFC 3UQBA 4ZOHC 1MPEA 2PTLA 1E8XA 1HZ6A 2JYEA 2HTME 1YMHE 1JWMD 1NVID 1TZOA 1H4RA 1Y56A 1YD8U 3W1SA 4K3BA 1TKGA 2FCNA 3ZJTA 2RDBC 4ZRPA 4A20A 3PLVA 1N5WA 2Q5WD 3GZNI 3H7SA 4FJYA 4II3B 3VRAB 3WANA 2XN9C 3JVZX 2LGDA 3A9JA 4MACA 1L6VA 1YJ1A 2K0PA 4KVGB 3AE8B 4US8A 5D3DA 2KLCA 4XYCA 3OJ3A 2J4XA 1P98A 1F52A 2BS4B 1WI0A 3AU4A 2IDYA 2L00B 2MP2A 3MHSD 1JW9D 1UUPA 4W9KA 2IZVB 3VUYA 2WS3B 4IC7B 2Y5CA 2L3ZA 4L2YA 3DBLI 3DVNV 3M62B 4YSYB 1V5TA 1QF6A 3A9KA 4FHKA 5EE9A 2JF5A 3AE5B 2D3GA 3GE3C 4BBNC 1KTKA 3LDZE 3UF8A 2V3PA 5HHDG 1WXVA 3BVGA 1TS3A 2FE8A 4DK5A 2O6VD 3DVNU 1TS5A 3TEXA 4JWSC 3W9CB 3ENEA 4NQLB 1H8CA 4MM3B 1UH6A 4G3XB 4GGQA 3U52E 2X38A 4NQKE 2WXIA 2DX5B 2GRIA 2H89B 3PV1A 4ZRQA 1VZ7A 2WU5B 3RMKC 1I42A 4WQOB 3QHTA 3N1YC 2NCNA 1QOGA 5IA7A 2BYEA 1KLUD 2DYMA 2NBWB 2PIAA 3JYUA 1SE2A 2DAFA 2RR9A 1I4XA 1NI3A 2MLBA 2OJWA 4RM8A 4LNOA 1WXAA 1L4ZB 2WXHA 1E8WA 4GLSC 1FM0D 2G4DB 3UIPB 1J7AA 4HCPB 1P9DU 4XDCA 4BFRA 3DHIC 3APDA 3Q2AC 3UI3A 5C3JB 3KVFB 3BWUD 4PYZA 3ZQ4A 4FBJB 2MQJA 4YTNB 4DXFA 4MT5A 2JWUA 2N9EB 3RZFA 3QARA 2FNJB 5BYSA 1YN5A 2ZW0A 1J8CA 3RNAC 2WXJA 4KIKB 1D4BA 3I63C 4A3OA 1LM8B 3MTNB 4BVUC 1S1QB 3N9YC 3E56A 3PT2B 4XGAB 1NDDA 2LD9A 2J7QB 1GNUA 1PGBA 2XEWA 3VAWA 1V6EA 1VR9A 3WALA 2CJOA 4HKZE 3TJPA 5GXGB 2LEKA 1P1AA 4NY0A 1C4AA 4J3OD 2BYTA 2K22A 2MA9B 3IBEA 2OHFA 4K81A 2WXPA 2JZPA 2IGGA 4MH8A 2G3QB 1XLQA 3WIMA 1PFDA 2SEBD 2KJHB 3Q8EA 5DPRA 1GOZA 2QCZA 3LJ3A 2J42A 1EU4A 4RF0A 1KFYB 4CYEA 5E6NA 1WY8A 4ARCA 4DXGA 1WGDA 1AW7A 4HJKA 2JZZA 2O2VB 2K25A 1AN8A 3FC4A 4W9IA 2J53A 1RLFA 4AS1A 4JWUC 2KACA 3VRBB 1E10A 5FR3A 3LB8C 3KWVA 1RFKA 1D6EC 1OTRB 1WGHA 3JSVA 5JHBA 1N6ZA 2KVRA 3CF6E 1FCLA 2AQ2B 1Q5WB 1EWCA 2DBYA 3Q8AA 2O2VA 1J7CA 3VHTC 1PYWD 1LQBA 1N5XA 3W2DA 4H2AA 1WE6A 3BYTB 3PO0A 3GE8C 5IP4D 1KF6B 4WJOA 3BK1A 2V9HA 3QWZB 3P2BA 2BB6A 1P3QU 1FO4A 4C80A 1XO3A 5FR6A 2D3CA 3B1LX 3HVDA 3ZJUA 2RD0A 1I4GA 2ZVOA 3KH0A 4N59A 2MCNB 3CSFA 2JQRB 2MJDA 3NVZA 4RNAA 4BBNF 3NZSA 4MSQB 1LFDA 4US9A 2I38A 4I6NB 3FILB 2NS5A 2RDHA 3ZGZA 3OJ4B 2JXXA 1ZXHA 4YWGG 4WJNA 5JZEB 3RNEC 2KWUB 5E6JA 3TMPB 3N32A 3FAHA 1EUVB 3KWLA 2N0SB 1HE8A 5D6JB 4XDDA 1TKEA 3L54A 4LNFA 1I7HA 1SXTA 3NOBA 3VTUA 1WJ4A 2JYTA 3AM9A 1SEBD 2Y3AA 1BT0A 4NAMA 1D5MC 3W1YA 1K50A 1SJED 2J52A 3A4SC 4W9CA 2WNMA 1FMAD 2N4FA 1FXTB 3LXFA 1VZ6A 3IXSA 1RWSA 4N9F4 1UBQA 3GZNB 4MH0E 3B08A 1GUAB 2J0JA 1SIJA 4TUUA 2MBEA 4G50A 1QOBA 4C7ZA 1BUIC 2PVOD 3PZ7A 5E6PA 3NVWA 1HXYD 1DYQA 4MEMA 3IG3A 1SE3A 2AL6A 4NJ7A 1C76A 1T0RC 1E7PB 4DHZB 1M94A 1JQ4A 4G0NB 2BS2B 4IUMB 4MGKE 1KJTA 3VR9B 1Q0WB 4ICVA 3WAMA 1J0GA 1J19A 1B1ZA 4WAAA 4HPLB 3KQ4A 2GBKA 3NVYA 2PW9A 1YX6B 1XEEA 1YJIA 4BOZB 2LUEA 1HQRD 2KQSA 4C4VA 2D10A 1RYJA 3PSEB 4LTUA 3VVWB 1TGZB 3ZRCA 3D32A 3H9DA 4WJQA 1ZKHA 1F0ZA 3UGBB 3H1UA 1L0XB 1K53A 3HM6X 2AQ3B 3VR8B 1K51A 2KJ6A 1HTQA 1WIAA 4EUTA 2BT6A 1FNWA 4A8XC 1L2NA 1WF9A 1ZPSA 4GDLA 4URKA 1UGJA 2LVOA 3AXCA 3ONSA 3QCAA 1WMHB 1WZ3A 4M8NA 3X23A 3BK2A 1SF0A 4ANXA 1VZ8A 4M0WA 4HJGE 3N3KB 2K1FA 2HJ1A 5BMGA 2WDTB 2C7MB 5MPOA 1ET9A 5TR5A 1SSNA 1FEHA 3IHPC 4YXDB 3Q8BA 2D3BA 1YN3A 2N1VA 5D94A 2ONQA 2XK5A 2H88B 1WH3A 3HHMA 2GBRA 1UD7A 4XX5A 5EE1A 4HWIB 1SE4A 1QOAA 4LDTD 2D5GA 5G5GA 2GB1A 3A9JB 2E6XA 5C2TB 2LGXA 2HDEA 2WGSA 2HD5B 3NG0A 4FN2A 1F9JA 1GB4A 4WAFA 2BKFA 2JUOA 4K7WA 4M0WB 3QIJA 5GMVA 4GXBA 2G9HD 3ZNHB 4YTPB 2OEDA 4K7UA 3BZDB 1XCTL 3RFZB 2PPHA 2LI5A 4EE2A 1XF5L 3ZDMC 2IO1B 4ANWA 1JALA 1GB1A 4IM3A 3ZLZA 2RDGA 1CK1A 5EDSA 1EF1A 1WGYA 3VUXA 2FCSA 3BIID 3WCQA 2KAJA 1L7YA 1EM7A 4M8MA 4CHKA 3L08A 3ZIMA 3I3TB 2D2QA 2PEAA 1FFUA 2J0MA 2QJLA 1GJZA 4F1SA 4A9AA 1R4NI 3SR6A 2WXOA 1C3TA 2OJRA 3H7PB 1SB3C 2CHWA 3B2GA 2OOBB 3FKYA 5BYRA 1V1PB 2XK5B 2JRIB 3VUWA 4DHJD 4GN1A 4X57B 2KLGA 2KX0A 3L13A 1XLNA 2IO2B 3UIOB 3OLMD 5G55A 2DNFA 2MW5A 4AQ7A 3V62A 5CTRC 3URYA 2W9NA 3SFDB 4GDLB 2LHEA 2YLMA 3PS6A 1FRRA 3BY4B 4NAWA 1V81A 2ZPYA 3AE3B 1QT9A 2XBBC 5G5HA 4MSMB 3TCAA 1FNVA 2N7EA 5BMHA 1VLBA 2BWFA 3DOWA 3ZYYX 1R4NB 1GC6A 3HIZA 3Q6BA 3DBRB 1X1MA 2QC8A 3ZUNA 1VDVA 3CMMB 3DVGX 4BKTA 2LFIA 2KWCA 4KV2A 1Q1OA 4EZJA 3ZRFA 2HTHA 2D3AA 2ZVNA 2KDMA 2PVGC 3PLUA 4KGSA 3TBLD 3V61A 3PRZA 1OFFA 1E0ZA 3AULA 1MHHE 1WXQA 4E3CA 4ZHPA 5J18A 1NYQA 2Y5PA 4IOIE 4DDGD 2LVQA 1KOTA 2KJRA 3BYYB 3QC8B 4LJPB 1Z5SB 3K9PB 3Q3JA 5IN7A 3R2IA 1MHXA 2UU7A 3U4EG 1XLOA 4TQ1A 2K8CA 4OVUA 2KKCA 2YVCA 4WWMA 4P1BC 3U2SC 4BKGA 2V1YA 1N62A 3N1ZC 5H92C 5DPWA 2GBNA 3KUZA 3MC8A 4IDIA 3RNFC 4ICUA 2ACZB 2L1AA 2KDEB 4A55A 1C4PA 3QAQA 1XQQA 3Q14C 1K8RB 2DYBA 2BTEA 4DQOC 1TZ1A 4JIOU 3P42A 3NZ3A 5CHVC 2X8XX 1WR6E 5LXIB 4IG7B 2WDQB 2WXRA 4GU2A 4D2KA 2NMQA 3KYDD 1D5XC 1GC7A 1JMLA 2K8HA 2VH1A 2A5UA 2RPVA 4LNNA 1E6EB 2WLBA 4MJSB 2EKEC 3E9SA 1V1PA 3RULA 1YN4A 2RMMA 1I4HA 3R66C 2IGHA 3AV8A 2LGYA 3AE1B 2N1WA 2EELA 3ZJVA 5EE3A 1P7EA 3TEWA 1SIFA 3MJ5A 2BVCA 3P4SB 2SAKA 2TSSA 1GAQB 4MGIE 3P1MA 4NJCA 1LO5D 2FBWB 2LJIA 4IWOA 4PS7A 5BMIA 3HM3A 5HKHA 4WWPA 1TJEA 2N7JA 2FIFA 4RGOS 2IY0B 2WQYB 3OWEB 4KSKC 1RM6C 1WSPA 1UZXB 3O65B 4I6LB 5L83A 4MM3A 2KQ7A 2QILA 1YQBA 1V5OA 4TV3A 3HK0A 3U30A 4LCDE 2DYOA 1D3ZA 2WXNA 2IJ0A 3P4PB 2JXTA 4USAA 1UF0A 1R4MI 4BKSA 4EOYA 4DWFA 5EE0A 1ACCA 1VRAB 2CS4A 4JGHB 3DBLB 3ZO5B 4BZAA 1E8YA 4XE0A 3M95A 2RGFA 1UELA 4E74A 4LK0M 2ZW1A 4A3PA 4OW0A 2DAJA 3QA8A 4LJOB 2KMAA 1JRPA 1JROA 2IPKD 3ECIA 2INCC 3H8HA 3AE9B 4EZLA 2RSUA 1K52A 4DXAB 1VJKA 4YT0B 4HLEA 4A90A 2KANA 3WAOA 2INPE 4J6IA 4FJZA 2BBCA 2FAZA 4W9LA 1C77A 4RCOA 2W54A 1VD2A 2KT7A 2N9XA 1TTNA 3RNBC 3EECA 4HDQA 2AX5A 2FUHB 2FCQA 1OQYA 2BGFA 3DBSA 3DWMA 1TY0A 1WRDB 4ANUA 1ISNA 4WURA 1HA5A 2O6VA 2MEKA 2EMSA 2L7RA 2N9LA 2N9PC 3N30A 4ITKA 3T9LA 1ET6A 2WXQA 2L52A 4WH4A 3NY5A 4HPMB 4PS8A 1IP9A 4GDKB 4F7ZA 1L6UA 3PVLA 3ZKJC 2MX2A 4JE3B 2INDC 1XLPA 4YTMB 3P63A 4JPSA 2BKRB 5C23A 4OZBA 2L76A 4OZCA 2KQ4X 3RUIB 4EZKA 1QILA 2BW2A 2VH2A 1NYRA 2ZCBA 2DLBA 3IT4B 1P0RA 4EKUA 2KHWB 1ZDXA 3AEDB 4LLGM 5DPTA 2ASQA 1ZUD2 2BS3B 5L95C 3L4PA 4W9EA 4HRSA 4C4VB 4HDOA 4M00A 1N61A 4L23A 2ON8A 4LDTB 1E7UA 3SU8X 3RD2A 1EF5A 1JWSD 1GG3A 1RFAA 2W3RA 4FLHA 1M4VA 3U7ZA 2PKOA 3AEEB 1WM3A 4AP4C 2IO0B 3EFCA 2LVPA 1KLVA 4RM9A 1STEA 1RRBA 4MJSA 3PZ8A 4DDID 3ZTDA 1FPYA 1KH0A 4GB9A 1N60A 3WA0A 1CQVA 2WP9B 1AARA 4S17A 4WIPA 2PMVA 3Q3NC 2ZJDA 5G2NA 3TSSA 3A33B 4E71A 2JU6X 4MDKE 2CKHB 1JRUA 4DHZE 2MRPA 1FXIA 3GB1A 2PE6B 2LWPA 3ZW3A 4EFOA 3V3XA 3RT3B 1TYGB 3BVMA 1WZ0A 3PHXB 2KXJA 2PLPA 3KYCD 2D07B 2HE7A 3R7RA 5AZHA 3RI7C 3MC9A 1RAXA 1Y8RC 2KFKB 1PGAA 2CJNA 4NJ6A 1FRDA 4HROA 1XD3B 2BB5A 2LHDA 1V8CA 2J0KA 2JSVX 3FILA 1V80A 2M1MA 4ARIA 2GBJA 1V49A 1YQ3B 2IO3B 2WXLA 1TY2A 2V3SA 1ROEA 3DWGC 1QOFA 4AJYB 1WX9A 3KLSX 4BOSC 1QKZA 2IBIB 1G6JA 3KW5B 1E9MA 2BYVE 1N63A 4FADA 3M63B 3U7DA 1F1HA 3TEYA 3AMZA 4N58A 4KZ0A 3EHVA 2HJ8A 2MSED 4XZ4A 3HVZA 4O1NA 4M02A 5H8YE 3W5VB 2NBUA 3RPFC 3Q3MC 3TIXA 3C19A 4HKQA 1ZP0B 1FD6A 4C00A 2DENB 4N6EB 3MP9A 5HI1A 2G4SA 3PZDA 2W82A 4HXDA 3QQ8B 4K7SA 3IAS1 1T0QC 3MHZA 4HVBA 4K3CA 2JPHA 3ZNGC 2EKIA 2KC2A 3NS1A 1WXSA 4P7IA 1TS4A 3PREA 5AZGA 4NAWB 2XNAC 2NBVB 3V6CB 1JWUD 2G45B 4KDIC 1I4PA 3A4RA 2K39A 1T6BX 3ZVVA 3NZUA 1DOYA 1WX7A 2I1JA 1PGXA 4W9JA 4WWOA 4MGZE 4AUQC 3NVVA 3VFKA 3TEZA 1MG8A 2DZJA 4C56C 5IAAC 3EUB2 3L10B 3ETRA 3M3JA 1ZDVA 2V0GA 2K6QA 2W55A 3Q8FA 1U4AA 1T0SC 3J9CA 5J17A 3IT6B 2NPTA 3EA6A 1WX8A 2N9KA 3MFGA 3Q8CA 5CHWA 2WDRB 2M0AA 3MC0B 5TSSA 1L0VB 3DHHC 2AYOB 1TS2A 1D5ZC 2DWQA 1ENFA 1I4RA 3PRPB 1SBBB 5BYQA 1I35A 1YNTE 2ZPNA 4K1RB 2KFKA 3AE4B 2DZIA 1C9FA 5FK9C 2GLSA 4YSZB 5D2MB 2UWQA 2LRWA 3L0WB 4YSXB 3AE6B 3L16A 3W5UB 4FHJA 1R7SA 5IKCM 2R61A 1UWXA 3H7PA 2PE9A 3P4RB 2K3UA 5D3IB 1ESFA 2MBOA 2LASA 1QQRA 1AWDA 3I57A 2GI9A 4P16A 4P6VF 1DGJA 3C8YA 2QIEB 1Q10A 5BO4B 4KKJA 2NR2A 3DBHB 2CHXA 2M17A 2K5PA 3SFEB 1ZGUB 2JRHA 1WYGA 2REXA 3NUHB 1KRHA 2DZKA 4TMAB 4RMAA 2KYWA 1GPXA 4C7YA 2MWSB 2ZCCA 4DBGA 4R3DA 4XC2A 3PRMB 4B0MA 1OQQA 2WXFA 4F8CB 5AEKB 5AUIA 4S0RA 4PT5A 1VCBA 3SD5A 4TKNA 4CQNA 3APCA 1WGGA 3CSTA 2QMTA 3QJZA 3AEFB 2M0XA
chains in the Genus database with same CATH topology
2Y5BB 4LJOB 2RPQA 2KZRA 2KMAA 1J19A 2ZNVC 1E5WA 1WFYA 3A1QA 4WAAA 3ECIA 4HPLB 4JLCA 1OEYA 2C60A 2WX0A 2GBKA 2QHOA 1WR1A 1YX6B 4EZLA 4BOZB 2MBQA 2LUEA 2RSUA 4DXAB 4HLEA 3C0RB 1E8ZA 3PGEA 2KQSA 4FJVB 2D10A 3DVGY 3PSEB 3WAPA 1IYFA 2Z59B 2KANA 4W9HA 3WAOA 4GOCA 2PJHA 4IWPA 3VVWB 1TGZB 5E6OA 4J6IA 3ZTCA 3ZRCA 2ZZPB 4FULA 2KDIA 3D32A 3H9DA 1E90A 4FJZA 4IM2A 3S2AA 2M4NA 4WJQA 1ZKHA 2FAZA 2L0FA 3DBHI 4W9LA 3UGBB 3V6EB 2KX3A 2KOXA 1TBEA 3H1UA 3HM6X 3ZNZB 1LXDA 4GMVA 2LZ6A 5KHOA 1VD2A 4W9GA 2KJ6A 1WIAA 2KK8A 3VH3B 3B0AA 4MGYE 2N9XA 4EUTA 2LXAA 1TTNA 2I1KA 3MJWA 1L2NA 1WF9A 2IYDB 3EECA 4ASWC 2GMIC 4HDQA 4GDLA 4URKA 3AXCA 2LVOA 3ONSA 3QCAA 4I6PA 1WMHB 1WZ3A 4KSLC 1WM2A 2FCQA 2CU1A 2FUHB 4M8NA 3W1SC 4ANXA 1OQYA 2BGFA 3DBSA 3N3KB 2K1FA 4EEWA 1WRDB 2GOWA 3PTFC 1ISNA 4ANUA 3UQBA 2WDTB 2C7MB 2O6VA 1E8XA 2EMSA 2L7RA 4BKSD 2DHZA 5TR5A 1H4RA 2N9PC 3N30A 3IHPC 3T9LA 1KM7A 1YD8U 3W1SA 2L8JA 2FCNA 2N1VA 3NY5A 5D94A 4HPMB 4PS8A 2XK5A 4IWQA 4A20A 3PLVA 1IP9A 1WH3A 2KTFA 3HHMA 4GDKB 2GBRA 1UD7A 4F7ZA 2FCMA 4XX5A 3PVLA 3GZNI 3H7SA 4FJYA 4II3B 3WANA 2VRRB 2MBHA 4HWIB 3ZKJC 2MX2A 2KC1A 3JVZX 2LGDA 3A9JA 4DHJB 4LDTD 2BKRB 5DCNA 2AEHA 5C23A 1YJ1A 2L76A 5D7GA 3RUIB 4EZKA 4KVGB 5DPSA 1SE9A 3A9JB 3AU5A 2LGXA 2ZCBA 3X0WA 2HD5B 4FN2A 1F9JA 2KLCA 1P0RA 4EKUA 4FA6A 3OJ3A 2BKFA 2KHWB 2JUOA 5LXHA 1P98A 3IVFA 3AU4A 1WI0A 5DPTA 4K7WA 2ASQA 2L00B 2MP2A 4M0WB 3MHSD 3QIJA 5GMVA 4GXBA 5L95C 4W9EA 3ZNHB 4K7UA 4W9KA 2IZVB 2AWTA 3VUYA 3V60A 4JL9A 4IC7B 4HDOA 2PPHA 1CMXB 2L3ZA 3NHEB 3DBLI 1E7UA 2LI5A 3DVNV 1V5TA 3M62B 3A9KA 4LDTB 3RD2A 1EF5A 3SU8X 4FHKA 1GG3A 2JF5A 3U8ZA 3ZDMC 2JWZA 2D3GA 3L17A 2IO1B 4BBNC 4ANWA 1RFAA 4B6WA 4FLHA 3DQVA 3WAMA 3LDZE 5LLIA 3UF8A 2B3AA 4IM3A 1WXVA 1V2YA 4WWNA 2Z0EB 2NVUI 3A1QB 3A9KB 3ZLZA 1WM3A 4AP4C 2IO0B 4DK5A 2LVPA 2O6VD 3DVNU 2M8SA 1KLVA 4RM9A 2V4LA 1RRBA 5EDSA 1EF1A 4MJSA 1WGYA 3ENEA 4DDID 4NQLB 3ZTDA 4GB9A 3VUXA 1H8CA 3VDZA 1UH6A 2FCSA 3OAWA 4G3XB 1YIWA 2ZNVB 4GGQA 4ZRIA 3WA0A 4NQKE 2DX5B 3GOEA 4OVVA 1L7YA 3PV1A 1AARA 3Q3FA 1PQSA 4M8MA 4CHKA 1I42A 3L08A 4WQOB 2KD0A 3QHTA 3ZIMA 2NCNA 3SHQA 5IA7A 3EFUA 2BYEA 2DYMA 2NBWB 2L0TA 3I3TB 3JYUA 2ZJDA 2D2QA 5G2NA 2PEAA 3ALBA 2DAFA 2RR9A 3A33B 4E71A 2J0MA 1GJZA 4F1SA 2MLBA 1R4NI 1T0YA 4MDKE 2CKHB 4PYUA 4RM8A 1WXAA 3NS8A 4JQWC 1JRUA 1E8WA 1WJ6A 4DHZE 2G4DB 1C3TA 2OJRA 2MRPA 3UIPB 4HCPB 2ZEQA 1P9DU 2PE6B 2LWPA 3H7PB 3ZW3A 4BFRA 2CHWA 2UYZB 4W9FA 4EFOA 2OOBB 4CO7A 3APDA 3RT3B 3KVFB 2XK5B 4NNJB 4PYZA 2JRIB 3VUWA 1WZ0A 3PHXB 4FBJB 2KXJA 4AWJA 4DHJD 4GN1A 4X57B 2MQJA 2KLGA 3KYCD 2KX0A 2D07B 2HE7A 3L13A 4WJPA 2IO2B 3R7RA 3UIOB 5AZHA 3QX1A 1YX5B 2N9EB 3OLMD 5G55A 3RZFA 2MW5A 3QARA 2FNJB 1RAXA 5CTRC 1Y8RC 2KFKB 3V62A 3VXWA 2W9NA 1E7VA 4GDLB 1J8CA 1Z2MA 2YLMA 4KIKB 3PS6A 3BY4B 4NAWA 4NJ6A 1V81A 4ANVA 1XD3B 2J0KA 4A3OA 1LM8B 3MTNB 2ZPYA 1WE7A 4BVUC 1S1QB 1V80A 2M1MA 2XBBC 3H6NA 4II2B 3PT2B 4MSMB 3TCAA 2GBJA 1NDDA 2LD9A 4IW0A 2N7EA 2J7QB 1V49A 2BWFA 3DOWA 1GNUA 2XEWA 4HK2A 3VAWA 2IO3B 1V6EA 2KO3A 3WALA 2V3SA 3TJPA 4PS3A 2IY1B 1P1AA 3RCZA 1GC6A 1UGMA 3HIZA 4NY0A 3T8MA 4AJYB 1WX9A 1WGRA 5AZFA 1NBFC 3EC8A 1X1MA 4BOSC 3ZUNA 1OGWA 2IBIB 5C1ZA 2MA9B 3CMMB 3DVGX 4BKTA 1G6JA 3K9OB 3IBEA 4K81A 2G3QB 2KWCA 3KW5B 4KV2A 1Q1OA 4EZJA 3X23A 3WIMA 2KWVB 3ZRFA 2HTHA 5KHQA 3ZDTA 2BYVE 4TQ0A 2KJHB 3DCGA 4FADA 2ZVNA 5DPRA 3PLUA 3M63B 3U7DA 2JY6A 3PPAA 3LJ3A 3TBLD 3V61A 3PRZA 4KZ0A 3R3MA 4GIVA 4CYEA 3AULA 4E3CA 2KDFB 5J18A 3EHVA 2HJ8A 5E6NA 1WY8A 2JVCA 4DDGD 1WGDA 2LVQA 2MSED 2EMTA 1KOTA 1ZW7A 3DPDA 5JH5C 2KJRA 4XZ4A 4KZCA 3QC8B 4LJPB 4ZYNA 4MELA 1WXMA 4HJKA 2JZZA 2NBUA 1Z5SB 3TIXA 3K9PB 3Q3JA 2O2VB 2BYFA 2K25A 3DBRI 2DENB 2C9WB 4W9IA 2WWZA 2G4SA 4W9DA 1RLFA 2CHZA 2WX1A 4TQ1A 2K8CA 1QZEA 3PZDA 4OVUA 2C7HA 3JSVB 4HXDA 3QQ8B 2KKCA 2YVCA 4K7SA 2KN5A 4BKGA 2V1YA 5DPWA 1OEYJ 2GBNA 3KUZA 2MBBB 4HVBA 1OTRB 1WGHA 2JPHA 1XT9B 3ZNID 3JW0X 4ICUA 3JSVA 3ZNGC 5JHBA 2KC2A 2KDEB 3RZWC 2KVRA 3CF6E 1WXSA 3QAQA 4P7IA 1Q5WB 1XQQA 3PREA 5AZGA 4NAWB 1K8RB 2DYBA 2MP2B 2NBVB 2O2VA 2KMCA 3RYTA 3V6CB 3VHTC 2G45B 4KDIC 3A4RA 3IFWB 2K39A 1LQBA 2LXCA 3ZVVA 1TZ1A 3NZUA 4JIOU 4IM0A 1WX7A 3TL5A 2I1JA 1WE6A 2CR5A 1V9JA 5CHVC 1A5RA 2O6VB 1WR6E 5LXIB 4IG7B 4W9JA 4WJOA 4WWOA 4GU2A 3QWZB 4MGZE 3KYDD 1GC7A 4AUQC 3P2BA 5CX3A 2A4ZA 1V86A 2K8HA 3VTVA 3VFKA 1MG8A 1P3QU 2DZMA 3VTWA 1IPGA 3R7QA 2DZJA 2A5UA 5IAAC 3L10B 3M3JA 2K6QA 5FR6A 3BINA 3B1LX 4HCNB 4MJSB 2EKEC 1U4AA 3RULA 2AL3A 2RD0A 4B9KA 2ZVOA 3KH0A 2MCNB 2BWES 3CSFA 5J17A 2BF8B 3R66C 1WJUA 4BBNF 2LGYA 3NZSA 2NPTA 4NPNA 4MSQB 1LFDA 1WX8A 2N1WA 1EO6A 5CHWA 1SIFA 2D11A 4I6NB 2NS5A 3AI5A 2AYOB 2JXXA 2KTRA 3ML9A 3OJ4B 4ZRJA 4WJNA 5JZEB 2KDBA 2NPTB 4MGIE 2K8BA 2KWUB 4IWOA 4PS7A 5HKHA 2KFJA 3HM3A 3PRPB 1WYWB 3TMPB 3N32A 1I35A 1EUVB 2LRUA 4GSWA 4WWPA 2ZPNA 2K6DB 4K1RB 1HE8A 5D6JB 2KFKA 3PHWB 2Z0DB 2JZ3B 4GDKA 4G11A 3DDCB 2DZIA 3QK0A 2FIFA 3L54A 2WYQA 3NOBA 3VTUA 3UQAA 5D2MB 1WJ4A 2UWQA 2IY0B 2C7NB 2LRWA 3L0WB 1BT0A 2FIDA 5JHAA 3L16A 3KUDB 3W1YA 4ZDVA 2JT4B 3APFA 4KSKC 3A4SC 4W9CA 2N4FA 4KDLB 4FHJA 1UZXB 3H7PA 4KIKA 1FXTB 2PE9A 3O65B 3KUCB 4B95A 4I6LB 5L83A 4MM3A 3VQIA 4N9F4 2L05A 1UBQA 2KQ7A 2MBOA 2BPSA 1S3SG 1YQBA 3B08A 4MH0E 1GUAB 2LASA 2J0JA 1V5OA 4TUUA 1WMHA 2KNBA 4TV3A 2GBMA 5J2RA 2MBEA 1SGHA 3HK0A 4G50A 3U30A 4LCDE 2DYOA 5BO4B 2KTRB 3ML8A 2NR2A 1D3ZA 3SDLC 2R2OA 2CHXA 2M17A 4YL8A 5E6PA 1ZGUB 2JRHA 5CHFA 4AOFA 4AJWA 2REXA 1C1YB 4BKSA 4EOYA 1R4MI 4DWFA 4MEMA 1WJNA 2CS4A 3IG3A 4JGHB 2LJ5A 2DZKA 3ZO5B 4RMAA 1E8YA 3M95A 2AL6A 2MWSB 2RGFA 2ZCCA 2C5LC 4DBGA 1UELA 4NJ7A 4XC2A 3PRMB 4E74A 2R2QA 4F8CB 4A3PA 4ZRKA 5AEKB 3VH4B 1NI2A 1VCBA 2N7DA 4DHZB 3SD5A 1M94A 2DAJA 4G0NB 4TKNA 3APCA 1WGGA 4IUMB 3CSTA 4MGKE 1KJTA 3QA8A 1Q0WB 3QJZA 1UBIA 3UINB 4ICVA 1J0GA 2M0XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y5B B;  4LJO B;  2RPQ A;  2KZR A;  2KMA A;  1J19 A;  2ZNV C;  1E5W A;  1WFY A;  3A1Q A;  4WAA A;  3ECI A;  4HPL B;  4JLC A;  1OEY A;  2C60 A;  2WX0 A;  2GBK A;  2QHO A;  1WR1 A;  1YX6 B;  4EZL A;  4BOZ B;  2MBQ A;  2LUE A;  2RSU A;  4DXA B;  4HLE A;  3C0R B;  1E8Z A;  3PGE A;  2KQS A;  4FJV B;  2D10 A;  3DVG Y;  3PSE B;  3WAP A;  1IYF A;  2Z59 B;  2KAN A;  4W9H A;  3WAO A;  4GOC A;  2PJH A;  4IWP A;  3VVW B;  1TGZ B;  5E6O A;  4J6I A;  3ZTC A;  3ZRC A;  2ZZP B;  4FUL A;  2KDI A;  3D32 A;  3H9D A;  1E90 A;  4FJZ A;  4IM2 A;  3S2A A;  2M4N A;  4WJQ A;  1ZKH A;  2FAZ A;  2L0F A;  3DBH I;  4W9L A;  3UGB B;  3V6E B;  2KX3 A;  2KOX A;  1TBE A;  3H1U A;  3HM6 X;  3ZNZ B;  1LXD A;  4GMV A;  2LZ6 A;  5KHO A;  1VD2 A;  4W9G A;  2KJ6 A;  1WIA A;  2KK8 A;  3VH3 B;  3B0A A;  4MGY E;  2N9X A;  4EUT A;  2LXA A;  1TTN A;  2I1K A;  3MJW A;  1L2N A;  1WF9 A;  2IYD B;  3EEC A;  4ASW C;  2GMI C;  4HDQ A;  4GDL A;  4URK A;  3AXC A;  2LVO A;  3ONS A;  3QCA A;  4I6P A;  1WMH B;  1WZ3 A;  4KSL C;  1WM2 A;  2FCQ A;  2CU1 A;  2FUH B;  4M8N A;  3W1S C;  4ANX A;  1OQY A;  2BGF A;  3DBS A;  3N3K B;  2K1F A;  4EEW A;  1WRD B;  2GOW A;  3PTF C;  1ISN A;  4ANU A;  3UQB A;  2WDT B;  2C7M B;  2O6V A;  1E8X A;  2EMS A;  2L7R A;  4BKS D;  2DHZ A;  5TR5 A;  1H4R A;  2N9P C;  3N30 A;  3IHP C;  3T9L A;  1KM7 A;  1YD8 U;  3W1S A;  2L8J A;  2FCN A;  2N1V A;  3NY5 A;  5D94 A;  4HPM B;  4PS8 A;  2XK5 A;  4IWQ A;  4A20 A;  3PLV A;  1IP9 A;  1WH3 A;  2KTF A;  3HHM A;  4GDK B;  2GBR A;  1UD7 A;  4F7Z A;  2FCM A;  4XX5 A;  3PVL A;  3GZN I;  3H7S A;  4FJY A;  4II3 B;  3WAN A;  2VRR B;  2MBH A;  4HWI B;  3ZKJ C;  2MX2 A;  2KC1 A;  3JVZ X;  2LGD A;  3A9J A;  4DHJ B;  4LDT D;  2BKR B;  5DCN A;  2AEH A;  5C23 A;  1YJ1 A;  2L76 A;  5D7G A;  3RUI B;  4EZK A;  4KVG B;  5DPS A;  1SE9 A;  3A9J B;  3AU5 A;  2LGX A;  2ZCB A;  3X0W A;  2HD5 B;  4FN2 A;  1F9J A;  2KLC A;  1P0R A;  4EKU A;  4FA6 A;  3OJ3 A;  2BKF A;  2KHW B;  2JUO A;  5LXH A;  1P98 A;  3IVF A;  3AU4 A;  1WI0 A;  5DPT A;  4K7W A;  2ASQ A;  2L00 B;  2MP2 A;  4M0W B;  3MHS D;  3QIJ A;  5GMV A;  4GXB A;  5L95 C;  4W9E A;  3ZNH B;  4K7U A;  4W9K A;  2IZV B;  2AWT A;  3VUY A;  3V60 A;  4JL9 A;  4IC7 B;  4HDO A;  2PPH A;  1CMX B;  2L3Z A;  3NHE B;  3DBL I;  1E7U A;  2LI5 A;  3DVN V;  1V5T A;  3M62 B;  3A9K A;  4LDT B;  3RD2 A;  1EF5 A;  3SU8 X;  4FHK A;  1GG3 A;  2JF5 A;  3U8Z A;  3ZDM C;  2JWZ A;  2D3G A;  3L17 A;  2IO1 B;  4BBN C;  4ANW A;  1RFA A;  4B6W A;  4FLH A;  3DQV A;  3WAM A;  3LDZ E;  5LLI A;  3UF8 A;  2B3A A;  4IM3 A;  1WXV A;  1V2Y A;  4WWN A;  2Z0E B;  2NVU I;  3A1Q B;  3A9K B;  3ZLZ A;  1WM3 A;  4AP4 C;  2IO0 B;  4DK5 A;  2LVP A;  2O6V D;  3DVN U;  2M8S A;  1KLV A;  4RM9 A;  2V4L A;  1RRB A;  5EDS A;  1EF1 A;  4MJS A;  1WGY A;  3ENE A;  4DDI D;  4NQL B;  3ZTD A;  4GB9 A;  3VUX A;  1H8C A;  3VDZ A;  1UH6 A;  2FCS A;  3OAW A;  4G3X B;  1YIW A;  2ZNV B;  4GGQ A;  4ZRI A;  3WA0 A;  4NQK E;  2DX5 B;  3GOE A;  4OVV A;  1L7Y A;  3PV1 A;  1AAR A;  3Q3F A;  1PQS A;  4M8M A;  4CHK A;  1I42 A;  3L08 A;  4WQO B;  2KD0 A;  3QHT A;  3ZIM A;  2NCN A;  3SHQ A;  5IA7 A;  3EFU A;  2BYE A;  2DYM A;  2NBW B;  2L0T A;  3I3T B;  3JYU A;  2ZJD A;  2D2Q A;  5G2N A;  2PEA A;  3ALB A;  2DAF A;  2RR9 A;  3A33 B;  4E71 A;  2J0M A;  1GJZ A;  4F1S A;  2MLB A;  1R4N I;  1T0Y A;  4MDK E;  2CKH B;  4PYU A;  4RM8 A;  1WXA A;  3NS8 A;  4JQW C;  1JRU A;  1E8W A;  1WJ6 A;  4DHZ E;  2G4D B;  1C3T A;  2OJR A;  2MRP A;  3UIP B;  4HCP B;  2ZEQ A;  1P9D U;  2PE6 B;  2LWP A;  3H7P B;  3ZW3 A;  4BFR A;  2CHW A;  2UYZ B;  4W9F A;  4EFO A;  2OOB B;  4CO7 A;  3APD A;  3RT3 B;  3KVF B;  2XK5 B;  4NNJ B;  4PYZ A;  2JRI B;  3VUW A;  1WZ0 A;  3PHX B;  4FBJ B;  2KXJ A;  4AWJ A;  4DHJ D;  4GN1 A;  4X57 B;  2MQJ A;  2KLG A;  3KYC D;  2KX0 A;  2D07 B;  2HE7 A;  3L13 A;  4WJP A;  2IO2 B;  3R7R A;  3UIO B;  5AZH A;  3QX1 A;  1YX5 B;  2N9E B;  3OLM D;  5G55 A;  3RZF A;  2MW5 A;  3QAR A;  2FNJ B;  1RAX A;  5CTR C;  1Y8R C;  2KFK B;  3V62 A;  3VXW A;  2W9N A;  1E7V A;  4GDL B;  1J8C A;  1Z2M A;  2YLM A;  4KIK B;  3PS6 A;  3BY4 B;  4NAW A;  4NJ6 A;  1V81 A;  4ANV A;  1XD3 B;  2J0K A;  4A3O A;  1LM8 B;  3MTN B;  2ZPY A;  1WE7 A;  4BVU C;  1S1Q B;  1V80 A;  2M1M A;  2XBB C;  3H6N A;  4II2 B;  3PT2 B;  4MSM B;  3TCA A;  2GBJ A;  1NDD A;  2LD9 A;  4IW0 A;  2N7E A;  2J7Q B;  1V49 A;  2BWF A;  3DOW A;  1GNU A;  2XEW A;  4HK2 A;  3VAW A;  2IO3 B;  1V6E A;  2KO3 A;  3WAL A;  2V3S A;  3TJP A;  4PS3 A;  2IY1 B;  1P1A A;  3RCZ A;  1GC6 A;  1UGM A;  3HIZ A;  4NY0 A;  3T8M A;  4AJY B;  1WX9 A;  1WGR A;  5AZF A;  1NBF C;  3EC8 A;  1X1M A;  4BOS C;  3ZUN A;  1OGW A;  2IBI B;  5C1Z A;  2MA9 B;  3CMM B;  3DVG X;  4BKT A;  1G6J A;  3K9O B;  3IBE A;  4K81 A;  2G3Q B;  2KWC A;  3KW5 B;  4KV2 A;  1Q1O A;  4EZJ A;  3X23 A;  3WIM A;  2KWV B;  3ZRF A;  2HTH A;  5KHQ A;  3ZDT A;  2BYV E;  4TQ0 A;  2KJH B;  3DCG A;  4FAD A;  2ZVN A;  5DPR A;  3PLU A;  3M63 B;  3U7D A;  2JY6 A;  3PPA A;  3LJ3 A;  3TBL D;  3V61 A;  3PRZ A;  4KZ0 A;  3R3M A;  4GIV A;  4CYE A;  3AUL A;  4E3C A;  2KDF B;  5J18 A;  3EHV A;  2HJ8 A;  5E6N A;  1WY8 A;  2JVC A;  4DDG D;  1WGD A;  2LVQ A;  2MSE D;  2EMT A;  1KOT A;  1ZW7 A;  3DPD A;  5JH5 C;  2KJR A;  4XZ4 A;  4KZC A;  3QC8 B;  4LJP B;  4ZYN A;  4MEL A;  1WXM A;  4HJK A;  2JZZ A;  2NBU A;  1Z5S B;  3TIX A;  3K9P B;  3Q3J A;  2O2V B;  2BYF A;  2K25 A;  3DBR I;  2DEN B;  2C9W B;  4W9I A;  2WWZ A;  2G4S A;  4W9D A;  1RLF A;  2CHZ A;  2WX1 A;  4TQ1 A;  2K8C A;  1QZE A;  3PZD A;  4OVU A;  2C7H A;  3JSV B;  4HXD A;  3QQ8 B;  2KKC A;  2YVC A;  4K7S A;  2KN5 A;  4BKG A;  2V1Y A;  5DPW A;  1OEY J;  2GBN A;  3KUZ A;  2MBB B;  4HVB A;  1OTR B;  1WGH A;  2JPH A;  1XT9 B;  3ZNI D;  3JW0 X;  4ICU A;  3JSV A;  3ZNG C;  5JHB A;  2KC2 A;  2KDE B;  3RZW C;  2KVR A;  3CF6 E;  1WXS A;  3QAQ A;  4P7I A;  1Q5W B;  1XQQ A;  3PRE A;  5AZG A;  4NAW B;  1K8R B;  2DYB A;  2MP2 B;  2NBV B;  2O2V A;  2KMC A;  3RYT A;  3V6C B;  3VHT C;  2G45 B;  4KDI C;  3A4R A;  3IFW B;  2K39 A;  1LQB A;  2LXC A;  3ZVV A;  1TZ1 A;  3NZU A;  4JIO U;  4IM0 A;  1WX7 A;  3TL5 A;  2I1J A;  1WE6 A;  2CR5 A;  1V9J A;  5CHV C;  1A5R A;  2O6V B;  1WR6 E;  5LXI B;  4IG7 B;  4W9J A;  4WJO A;  4WWO A;  4GU2 A;  3QWZ B;  4MGZ E;  3KYD D;  1GC7 A;  4AUQ C;  3P2B A;  5CX3 A;  2A4Z A;  1V86 A;  2K8H A;  3VTV A;  3VFK A;  1MG8 A;  1P3Q U;  2DZM A;  3VTW A;  1IPG A;  3R7Q A;  2DZJ A;  2A5U A;  5IAA C;  3L10 B;  3M3J A;  2K6Q A;  5FR6 A;  3BIN A;  3B1L X;  4HCN B;  4MJS B;  2EKE C;  1U4A A;  3RUL A;  2AL3 A;  2RD0 A;  4B9K A;  2ZVO A;  3KH0 A;  2MCN B;  2BWE S;  3CSF A;  5J17 A;  2BF8 B;  3R66 C;  1WJU A;  4BBN F;  2LGY A;  3NZS A;  2NPT A;  4NPN A;  4MSQ B;  1LFD A;  1WX8 A;  2N1W A;  1EO6 A;  5CHW A;  1SIF A;  2D11 A;  4I6N B;  2NS5 A;  3AI5 A;  2AYO B;  2JXX A;  2KTR A;  3ML9 A;  3OJ4 B;  4ZRJ A;  4WJN A;  5JZE B;  2KDB A;  2NPT B;  4MGI E;  2K8B A;  2KWU B;  4IWO A;  4PS7 A;  5HKH A;  2KFJ A;  3HM3 A;  3PRP B;  1WYW B;  3TMP B;  3N32 A;  1I35 A;  1EUV B;  2LRU A;  4GSW A;  4WWP A;  2ZPN A;  2K6D B;  4K1R B;  1HE8 A;  5D6J B;  2KFK A;  3PHW B;  2Z0D B;  2JZ3 B;  4GDK A;  4G11 A;  3DDC B;  2DZI A;  3QK0 A;  2FIF A;  3L54 A;  2WYQ A;  3NOB A;  3VTU A;  3UQA A;  5D2M B;  1WJ4 A;  2UWQ A;  2IY0 B;  2C7N B;  2LRW A;  3L0W B;  1BT0 A;  2FID A;  5JHA A;  3L16 A;  3KUD B;  3W1Y A;  4ZDV A;  2JT4 B;  3APF A;  4KSK C;  3A4S C;  4W9C A;  2N4F A;  4KDL B;  4FHJ A;  1UZX B;  3H7P A;  4KIK A;  1FXT B;  2PE9 A;  3O65 B;  3KUC B;  4B95 A;  4I6L B;  5L83 A;  4MM3 A;  3VQI A;  4N9F 4;  2L05 A;  1UBQ A;  2KQ7 A;  2MBO A;  2BPS A;  1S3S G;  1YQB A;  3B08 A;  4MH0 E;  1GUA B;  2LAS A;  2J0J A;  1V5O A;  4TUU A;  1WMH A;  2KNB A;  4TV3 A;  2GBM A;  5J2R A;  2MBE A;  1SGH A;  3HK0 A;  4G50 A;  3U30 A;  4LCD E;  2DYO A;  5BO4 B;  2KTR B;  3ML8 A;  2NR2 A;  1D3Z A;  3SDL C;  2R2O A;  2CHX A;  2M17 A;  4YL8 A;  5E6P A;  1ZGU B;  2JRH A;  5CHF A;  4AOF A;  4AJW A;  2REX A;  1C1Y B;  4BKS A;  4EOY A;  1R4M I;  4DWF A;  4MEM A;  1WJN A;  2CS4 A;  3IG3 A;  4JGH B;  2LJ5 A;  2DZK A;  3ZO5 B;  4RMA A;  1E8Y A;  3M95 A;  2AL6 A;  2MWS B;  2RGF A;  2ZCC A;  2C5L C;  4DBG A;  1UEL A;  4NJ7 A;  4XC2 A;  3PRM B;  4E74 A;  2R2Q A;  4F8C B;  4A3P A;  4ZRK A;  5AEK B;  3VH4 B;  1NI2 A;  1VCB A;  2N7D A;  4DHZ B;  3SD5 A;  1M94 A;  2DAJ A;  4G0N B;  4TKN A;  3APC A;  1WGG A;  4IUM B;  3CST A;  4MGK E;  1KJT A;  3QA8 A;  1Q0W B;  3QJZ A;  1UBI A;  3UIN B;  4ICV A;  1J0G A;  2M0X A; 
#chains in the Genus database with same CATH topology
 1B9R A;  2RPQ A;  1T5X D;  2ZNV C;  4ZHO A;  3R8B A;  4LNI A;  4Q2J A;  2KN4 A;  2L32 A;  1I4Q A;  1WR1 A;  2MBQ A;  4L1B A;  1E8Z A;  4FJV B;  4TSS A;  2MH7 A;  2PJH A;  4NZL B;  4IWP A;  2E3T A;  2KVZ A;  3ZTC A;  4FUL A;  2NTS A;  3S2A A;  2QDF A;  2M4N A;  1PDX A;  3V6E B;  4KX6 B;  2KX3 A;  2KOX A;  4BAX A;  2QEJ C;  3ZNZ B;  1LXD A;  1PUT A;  2LZ6 A;  2MJ3 A;  2V4I B;  4KKI A;  2KK8 A;  3VH3 B;  1NEK B;  2M19 A;  2LXA A;  1V1O A;  3MJW A;  2K9X A;  4I6P A;  1WM2 A;  2CU1 A;  2GOW A;  1CJE A;  4BKS D;  2DHZ A;  4WQM A;  1KM7 A;  2L8J A;  3T3N A;  4M01 A;  2B76 B;  1LGR A;  4IWQ A;  2KTF A;  2FCM A;  2VRR B;  2MBH A;  1TKY A;  2KC1 A;  4DHJ B;  3AE7 B;  3Q69 A;  1WWT A;  3GP7 A;  2ICI A;  2AEH A;  5DCN A;  5D7G A;  3V05 A;  5DPS A;  1SE9 A;  3AU5 A;  1MG4 A;  3X0W A;  4FA6 A;  4HPP A;  5LXH A;  3IVF A;  1DOX A;  1BML C;  3Q3O C;  4ZYS A;  2AWT A;  3R2T A;  3V60 A;  4JL9 A;  1CMX B;  3NHE B;  2I2Y A;  1HZ5 A;  1SJH D;  2YEP B;  3U8Z A;  1V97 A;  1F2R C;  2JWZ A;  3L17 A;  4B6W A;  3DQV A;  2MJE A;  5LLI A;  1T3Q A;  2B3A A;  4WWN A;  1V2Y A;  2Z0E B;  2NVU I;  3A1Q B;  3A9K B;  4HEA 1;  3LYY A;  2KWD A;  2M8S A;  3HUI A;  2V4L A;  2INN E;  4RFB A;  1FIQ A;  5JXV A;  3VDZ A;  3SEB A;  1CZP A;  3OAW A;  1YIW A;  2ZNV B;  3AEA B;  4ZRI A;  3ABV B;  2MHJ A;  3GOE A;  2V3N A;  4OVV A;  4ACF A;  1A70 A;  3Q3F A;  1PQS A;  2L83 A;  2KD0 A;  3SHQ A;  3EFU A;  2L0T A;  3ALB A;  4RH6 A;  2Z8L A;  1T0Y A;  3OG5 A;  4PYU A;  3NS8 A;  4JQW C;  1WJ6 A;  3I5J C;  2ZEQ A;  4RF1 A;  2UYZ B;  4W9F A;  2LGS A;  4CO7 A;  1C79 A;  4NNJ B;  1MFW A;  4AWJ A;  1JCK B;  4WJP A;  2M56 B;  5LNK 1;  3QX1 A;  1YX5 B;  2WXK A;  3AB5 A;  3VXW A;  1E7V A;  1JWA D;  1ZOY B;  1Z2M A;  5FKA C;  4ANV A;  4A6Q A;  1WE7 A;  4XWT A;  1FCC C;  3H6N A;  4II2 B;  4IW0 A;  4HK2 A;  2KO3 A;  1TT5 B;  4PS3 A;  2IY1 B;  3RCZ A;  1DOI A;  1UGM A;  3T8M A;  2LMC A;  1FXA A;  1WGR A;  2LUM A;  5AZF A;  1NBF C;  1YOV B;  2IGD A;  3EC8 A;  4KGR A;  1OGW A;  5C1Z A;  1C4C A;  4KGT A;  3K9O B;  4B0E A;  4IKG A;  2NTT A;  4PK1 A;  3CWI A;  3RN9 C;  2KWV B;  5KHQ A;  3ZDT A;  4TQ0 A;  1IBX A;  3DCG A;  1UNS A;  4OZA A;  2JY6 A;  3PPA A;  3R3M A;  4GIV A;  3P4Q B;  2QSD A;  1ZE3 D;  2KDF B;  2WXG A;  2JVC A;  3N1X C;  2WHI A;  2EMT A;  1ZW7 A;  3DPD A;  5JH5 C;  4ZYN A;  4KZC A;  3ZXR A;  4MEL A;  1WXM A;  3NJT A;  2BYF A;  3DBR I;  2C9W B;  2FUG 1;  1IBX B;  2WWZ A;  4W9D A;  1FNU A;  2CHZ A;  2VZK B;  2WX1 A;  1QZE A;  2C7H A;  3JSV B;  1F2R I;  2KN5 A;  1OEY J;  2MBB B;  3ZXV A;  3HRD D;  3RNG C;  1XT9 B;  3ZNI D;  3JW0 X;  3RZW C;  2AQ1 B;  3DHG C;  3I9V 1;  1IGC A;  2G1E A;  2MP2 B;  3RYT A;  2KMC A;  4FXC A;  3IFW B;  2LXC A;  4IM0 A;  3TL5 A;  2CR5 A;  1V9J A;  1A5R A;  2VZK D;  2O6V B;  3B9J A;  1WRI A;  1L5P A;  5CX3 A;  2A4Z A;  1V86 A;  3VTV A;  2DZM A;  3VTW A;  1IPG A;  3R7Q A;  1OQR A;  1XCQ L;  5I4D A;  2KMM A;  3IAM 1;  1FFV A;  3BIN A;  5IOI A;  4RGM A;  4HCN B;  2WU2 B;  2AL3 A;  1P7F A;  4B9K A;  5IO9 A;  2BWE S;  2BF8 B;  4P1C C;  1WJU A;  3BVZ A;  3AE2 B;  4NPN A;  1EO6 A;  2LGI A;  3GS2 A;  2D11 A;  3AI5 A;  1UWM A;  1AYF A;  2KTR A;  3ML9 A;  2CU3 A;  4ZRJ A;  2KDB A;  2NPT B;  2K8B A;  2BQQ A;  5AUK A;  2KFJ A;  1WYW B;  2LRU A;  4GSW A;  3RNC C;  1QLB B;  2K6D B;  5HG2 A;  1EU3 A;  1BXT A;  3PHW B;  2Z0D B;  2JZ3 B;  3O13 A;  1IGD A;  4GDK A;  4G11 A;  3DDC B;  1EWY C;  3QK0 A;  2WYQ A;  3UQA A;  2C7N B;  1KLG D;  2FID A;  5JHA A;  3KUD B;  1L4D B;  1HTO A;  4ZDV A;  2JT4 B;  3APF A;  4KDL B;  3AEC B;  4KIK A;  1JWB D;  3KUC B;  4B95 A;  4JX1 C;  3B2F A;  3AEG B;  4QAY A;  3VQI A;  2L05 A;  2WXM A;  4RGN A;  2BPS A;  1S3S G;  4REZ A;  1WMH A;  2KNB A;  2GBM A;  5J2R A;  1SGH A;  2KTR B;  3ML8 A;  3SDL C;  2R2O A;  4YL8 A;  5CHF A;  1NEN B;  4AOF A;  4AJW A;  1C1Y B;  1MVK A;  1WJN A;  2LJ5 A;  2WDV B;  1L0Y B;  2C5L C;  3TUO A;  1IUE A;  2R2Q A;  4ZRK A;  3VH4 B;  1NI2 A;  2N7D A;  1XXG A;  1UBI A;  3UIN B;  4LNK A;  2Y5B B;  2KZR A;  1E5W A;  1WFY A;  3A1Q A;  5T8I A;  1MJD A;  4JLC A;  1OEY A;  5HFY A;  2C60 A;  2WX0 A;  2QHO A;  2JX5 A;  1ZXI A;  3C0R B;  3N20 C;  4OHJ A;  3PGE A;  3DVG Y;  4OVZ A;  3WAP A;  1IYF A;  2Z59 B;  4W9H A;  4GOC A;  4XWW A;  3EGR A;  1YQ4 B;  1HEZ E;  5E6O A;  3NRZ A;  2ZZP B;  2W3S A;  2KDI A;  4IM2 A;  1E90 A;  1YJJ A;  4UDU C;  2L0F A;  3DBH I;  3AN1 A;  1TBE A;  3AEB B;  3T3O A;  4GMV A;  3AH7 A;  1R4M B;  5KHO A;  4W9G A;  3B0A A;  4MGY E;  1J7B A;  2I1K A;  3CIR B;  2IYD B;  4ASW C;  1F77 A;  2GMI C;  2YEP F;  4KSL C;  1WGK A;  3W1S C;  4RGT A;  1C78 A;  1MI0 A;  1TIF A;  4EEW A;  3PTF C;  3UQB A;  4ZOH C;  1MPE A;  2PTL A;  1E8X A;  1HZ6 A;  2JYE A;  2HTM E;  1YMH E;  1JWM D;  1NVI D;  1TZO A;  1H4R A;  1Y56 A;  1YD8 U;  3W1S A;  4K3B A;  1TKG A;  2FCN A;  3ZJT A;  2RDB C;  4ZRP A;  4A20 A;  3PLV A;  1N5W A;  2Q5W D;  3GZN I;  3H7S A;  4FJY A;  4II3 B;  3VRA B;  3WAN A;  2XN9 C;  3JVZ X;  2LGD A;  3A9J A;  4MAC A;  1L6V A;  1YJ1 A;  2K0P A;  4KVG B;  3AE8 B;  4US8 A;  5D3D A;  2KLC A;  4XYC A;  3OJ3 A;  2J4X A;  1P98 A;  1F52 A;  2BS4 B;  1WI0 A;  3AU4 A;  2IDY A;  2L00 B;  2MP2 A;  3MHS D;  1JW9 D;  1UUP A;  4W9K A;  2IZV B;  3VUY A;  2WS3 B;  4IC7 B;  2Y5C A;  2L3Z A;  4L2Y A;  3DBL I;  3DVN V;  3M62 B;  4YSY B;  1V5T A;  1QF6 A;  3A9K A;  4FHK A;  5EE9 A;  2JF5 A;  3AE5 B;  2D3G A;  3GE3 C;  4BBN C;  1KTK A;  3LDZ E;  3UF8 A;  2V3P A;  5HHD G;  1WXV A;  3BVG A;  1TS3 A;  2FE8 A;  4DK5 A;  2O6V D;  3DVN U;  1TS5 A;  3TEX A;  4JWS C;  3W9C B;  3ENE A;  4NQL B;  1H8C A;  4MM3 B;  1UH6 A;  4G3X B;  4GGQ A;  3U52 E;  2X38 A;  4NQK E;  2WXI A;  2DX5 B;  2GRI A;  2H89 B;  3PV1 A;  4ZRQ A;  1VZ7 A;  2WU5 B;  3RMK C;  1I42 A;  4WQO B;  3QHT A;  3N1Y C;  2NCN A;  1QOG A;  5IA7 A;  2BYE A;  1KLU D;  2DYM A;  2NBW B;  2PIA A;  3JYU A;  1SE2 A;  2DAF A;  2RR9 A;  1I4X A;  1NI3 A;  2MLB A;  2OJW A;  4RM8 A;  4LNO A;  1WXA A;  1L4Z B;  2WXH A;  1E8W A;  4GLS C;  1FM0 D;  2G4D B;  3UIP B;  1J7A A;  4HCP B;  1P9D U;  4XDC A;  4BFR A;  3DHI C;  3APD A;  3Q2A C;  3UI3 A;  5C3J B;  3KVF B;  3BWU D;  4PYZ A;  3ZQ4 A;  4FBJ B;  2MQJ A;  4YTN B;  4DXF A;  4MT5 A;  2JWU A;  2N9E B;  3RZF A;  3QAR A;  2FNJ B;  5BYS A;  1YN5 A;  2ZW0 A;  1J8C A;  3RNA C;  2WXJ A;  4KIK B;  1D4B A;  3I63 C;  4A3O A;  1LM8 B;  3MTN B;  4BVU C;  1S1Q B;  3N9Y C;  3E56 A;  3PT2 B;  4XGA B;  1NDD A;  2LD9 A;  2J7Q B;  1GNU A;  1PGB A;  2XEW A;  3VAW A;  1V6E A;  1VR9 A;  3WAL A;  2CJO A;  4HKZ E;  3TJP A;  5GXG B;  2LEK A;  1P1A A;  4NY0 A;  1C4A A;  4J3O D;  2BYT A;  2K22 A;  2MA9 B;  3IBE A;  2OHF A;  4K81 A;  2WXP A;  2JZP A;  2IGG A;  4MH8 A;  2G3Q B;  1XLQ A;  3WIM A;  1PFD A;  2SEB D;  2KJH B;  3Q8E A;  5DPR A;  1GOZ A;  2QCZ A;  3LJ3 A;  2J42 A;  1EU4 A;  4RF0 A;  1KFY B;  4CYE A;  5E6N A;  1WY8 A;  4ARC A;  4DXG A;  1WGD A;  1AW7 A;  4HJK A;  2JZZ A;  2O2V B;  2K25 A;  1AN8 A;  3FC4 A;  4W9I A;  2J53 A;  1RLF A;  4AS1 A;  4JWU C;  2KAC A;  3VRB B;  1E10 A;  5FR3 A;  3LB8 C;  3KWV A;  1RFK A;  1D6E C;  1OTR B;  1WGH A;  3JSV A;  5JHB A;  1N6Z A;  2KVR A;  3CF6 E;  1FCL A;  2AQ2 B;  1Q5W B;  1EWC A;  2DBY A;  3Q8A A;  2O2V A;  1J7C A;  3VHT C;  1PYW D;  1LQB A;  1N5X A;  3W2D A;  4H2A A;  1WE6 A;  3BYT B;  3PO0 A;  3GE8 C;  5IP4 D;  1KF6 B;  4WJO A;  3BK1 A;  2V9H A;  3QWZ B;  3P2B A;  2BB6 A;  1P3Q U;  1FO4 A;  4C80 A;  1XO3 A;  5FR6 A;  2D3C A;  3B1L X;  3HVD A;  3ZJU A;  2RD0 A;  1I4G A;  2ZVO A;  3KH0 A;  4N59 A;  2MCN B;  3CSF A;  2JQR B;  2MJD A;  3NVZ A;  4RNA A;  4BBN F;  3NZS A;  4MSQ B;  1LFD A;  4US9 A;  2I38 A;  4I6N B;  3FIL B;  2NS5 A;  2RDH A;  3ZGZ A;  3OJ4 B;  2JXX A;  1ZXH A;  4YWG G;  4WJN A;  5JZE B;  3RNE C;  2KWU B;  5E6J A;  3TMP B;  3N32 A;  3FAH A;  1EUV B;  3KWL A;  2N0S B;  1HE8 A;  5D6J B;  4XDD A;  1TKE A;  3L54 A;  4LNF A;  1I7H A;  1SXT A;  3NOB A;  3VTU A;  1WJ4 A;  2JYT A;  3AM9 A;  1SEB D;  2Y3A A;  1BT0 A;  4NAM A;  1D5M C;  3W1Y A;  1K50 A;  1SJE D;  2J52 A;  3A4S C;  4W9C A;  2WNM A;  1FMA D;  2N4F A;  1FXT B;  3LXF A;  1VZ6 A;  3IXS A;  1RWS A;  4N9F 4;  1UBQ A;  3GZN B;  4MH0 E;  3B08 A;  1GUA B;  2J0J A;  1SIJ A;  4TUU A;  2MBE A;  4G50 A;  1QOB A;  4C7Z A;  1BUI C;  2PVO D;  3PZ7 A;  5E6P A;  3NVW A;  1HXY D;  1DYQ A;  4MEM A;  3IG3 A;  1SE3 A;  2AL6 A;  4NJ7 A;  1C76 A;  1T0R C;  1E7P B;  4DHZ B;  1M94 A;  1JQ4 A;  4G0N B;  2BS2 B;  4IUM B;  4MGK E;  1KJT A;  3VR9 B;  1Q0W B;  4ICV A;  3WAM A;  1J0G A;  1J19 A;  1B1Z A;  4WAA A;  4HPL B;  3KQ4 A;  2GBK A;  3NVY A;  2PW9 A;  1YX6 B;  1XEE A;  1YJI A;  4BOZ B;  2LUE A;  1HQR D;  2KQS A;  4C4V A;  2D10 A;  1RYJ A;  3PSE B;  4LTU A;  3VVW B;  1TGZ B;  3ZRC A;  3D32 A;  3H9D A;  4WJQ A;  1ZKH A;  1F0Z A;  3UGB B;  3H1U A;  1L0X B;  1K53 A;  3HM6 X;  2AQ3 B;  3VR8 B;  1K51 A;  2KJ6 A;  1HTQ A;  1WIA A;  4EUT A;  2BT6 A;  1FNW A;  4A8X C;  1L2N A;  1WF9 A;  1ZPS A;  4GDL A;  4URK A;  1UGJ A;  2LVO A;  3AXC A;  3ONS A;  3QCA A;  1WMH B;  1WZ3 A;  4M8N A;  3X23 A;  3BK2 A;  1SF0 A;  4ANX A;  1VZ8 A;  4M0W A;  4HJG E;  3N3K B;  2K1F A;  2HJ1 A;  5BMG A;  2WDT B;  2C7M B;  5MPO A;  1ET9 A;  5TR5 A;  1SSN A;  1FEH A;  3IHP C;  4YXD B;  3Q8B A;  2D3B A;  1YN3 A;  2N1V A;  5D94 A;  2ONQ A;  2XK5 A;  2H88 B;  1WH3 A;  3HHM A;  2GBR A;  1UD7 A;  4XX5 A;  5EE1 A;  4HWI B;  1SE4 A;  1QOA A;  4LDT D;  2D5G A;  5G5G A;  2GB1 A;  3A9J B;  2E6X A;  5C2T B;  2LGX A;  2HDE A;  2WGS A;  2HD5 B;  3NG0 A;  4FN2 A;  1F9J A;  1GB4 A;  4WAF A;  2BKF A;  2JUO A;  4K7W A;  4M0W B;  3QIJ A;  5GMV A;  4GXB A;  2G9H D;  3ZNH B;  4YTP B;  2OED A;  4K7U A;  3BZD B;  1XCT L;  3RFZ B;  2PPH A;  2LI5 A;  4EE2 A;  1XF5 L;  3ZDM C;  2IO1 B;  4ANW A;  1JAL A;  1GB1 A;  4IM3 A;  3ZLZ A;  2RDG A;  1CK1 A;  5EDS A;  1EF1 A;  1WGY A;  3VUX A;  2FCS A;  3BII D;  3WCQ A;  2KAJ A;  1L7Y A;  1EM7 A;  4M8M A;  4CHK A;  3L08 A;  3ZIM A;  3I3T B;  2D2Q A;  2PEA A;  1FFU A;  2J0M A;  2QJL A;  1GJZ A;  4F1S A;  4A9A A;  1R4N I;  3SR6 A;  2WXO A;  1C3T A;  2OJR A;  3H7P B;  1SB3 C;  2CHW A;  3B2G A;  2OOB B;  3FKY A;  5BYR A;  1V1P B;  2XK5 B;  2JRI B;  3VUW A;  4DHJ D;  4GN1 A;  4X57 B;  2KLG A;  2KX0 A;  3L13 A;  1XLN A;  2IO2 B;  3UIO B;  3OLM D;  5G55 A;  2DNF A;  2MW5 A;  4AQ7 A;  3V62 A;  5CTR C;  3URY A;  2W9N A;  3SFD B;  4GDL B;  2LHE A;  2YLM A;  3PS6 A;  1FRR A;  3BY4 B;  4NAW A;  1V81 A;  2ZPY A;  3AE3 B;  1QT9 A;  2XBB C;  5G5H A;  4MSM B;  3TCA A;  1FNV A;  2N7E A;  5BMH A;  1VLB A;  2BWF A;  3DOW A;  3ZYY X;  1R4N B;  1GC6 A;  3HIZ A;  3Q6B A;  3DBR B;  1X1M A;  2QC8 A;  3ZUN A;  1VDV A;  3CMM B;  3DVG X;  4BKT A;  2LFI A;  2KWC A;  4KV2 A;  1Q1O A;  4EZJ A;  3ZRF A;  2HTH A;  2D3A A;  2ZVN A;  2KDM A;  2PVG C;  3PLU A;  4KGS A;  3TBL D;  3V61 A;  3PRZ A;  1OFF A;  1E0Z A;  3AUL A;  1MHH E;  1WXQ A;  4E3C A;  4ZHP A;  5J18 A;  1NYQ A;  2Y5P A;  4IOI E;  4DDG D;  2LVQ A;  1KOT A;  2KJR A;  3BYY B;  3QC8 B;  4LJP B;  1Z5S B;  3K9P B;  3Q3J A;  5IN7 A;  3R2I A;  1MHX A;  2UU7 A;  3U4E G;  1XLO A;  4TQ1 A;  2K8C A;  4OVU A;  2KKC A;  2YVC A;  4WWM A;  4P1B C;  3U2S C;  4BKG A;  2V1Y A;  1N62 A;  3N1Z C;  5H92 C;  5DPW A;  2GBN A;  3KUZ A;  3MC8 A;  4IDI A;  3RNF C;  4ICU A;  2ACZ B;  2L1A A;  2KDE B;  4A55 A;  1C4P A;  3QAQ A;  1XQQ A;  3Q14 C;  1K8R B;  2DYB A;  2BTE A;  4DQO C;  1TZ1 A;  4JIO U;  3P42 A;  3NZ3 A;  5CHV C;  2X8X X;  1WR6 E;  5LXI B;  4IG7 B;  2WDQ B;  2WXR A;  4GU2 A;  4D2K A;  2NMQ A;  3KYD D;  1D5X C;  1GC7 A;  1JML A;  2K8H A;  2VH1 A;  2A5U A;  2RPV A;  4LNN A;  1E6E B;  2WLB A;  4MJS B;  2EKE C;  3E9S A;  1V1P A;  3RUL A;  1YN4 A;  2RMM A;  1I4H A;  3R66 C;  2IGH A;  3AV8 A;  2LGY A;  3AE1 B;  2N1W A;  2EEL A;  3ZJV A;  5EE3 A;  1P7E A;  3TEW A;  1SIF A;  3MJ5 A;  2BVC A;  3P4S B;  2SAK A;  2TSS A;  1GAQ B;  4MGI E;  3P1M A;  4NJC A;  1LO5 D;  2FBW B;  2LJI A;  4IWO A;  4PS7 A;  5BMI A;  3HM3 A;  5HKH A;  4WWP A;  1TJE A;  2N7J A;  2FIF A;  4RGO S;  2IY0 B;  2WQY B;  3OWE B;  4KSK C;  1RM6 C;  1WSP A;  1UZX B;  3O65 B;  4I6L B;  5L83 A;  4MM3 A;  2KQ7 A;  2QIL A;  1YQB A;  1V5O A;  4TV3 A;  3HK0 A;  3U30 A;  4LCD E;  2DYO A;  1D3Z A;  2WXN A;  2IJ0 A;  3P4P B;  2JXT A;  4USA A;  1UF0 A;  1R4M I;  4BKS A;  4EOY A;  4DWF A;  5EE0 A;  1ACC A;  1VRA B;  2CS4 A;  4JGH B;  3DBL B;  3ZO5 B;  4BZA A;  1E8Y A;  4XE0 A;  3M95 A;  2RGF A;  1UEL A;  4E74 A;  4LK0 M;  2ZW1 A;  4A3P A;  4OW0 A;  2DAJ A;  3QA8 A;  4LJO B;  2KMA A;  1JRP A;  1JRO A;  2IPK D;  3ECI A;  2INC C;  3H8H A;  3AE9 B;  4EZL A;  2RSU A;  1K52 A;  4DXA B;  1VJK A;  4YT0 B;  4HLE A;  4A90 A;  2KAN A;  3WAO A;  2INP E;  4J6I A;  4FJZ A;  2BBC A;  2FAZ A;  4W9L A;  1C77 A;  4RCO A;  2W54 A;  1VD2 A;  2KT7 A;  2N9X A;  1TTN A;  3RNB C;  3EEC A;  4HDQ A;  2AX5 A;  2FUH B;  2FCQ A;  1OQY A;  2BGF A;  3DBS A;  3DWM A;  1TY0 A;  1WRD B;  4ANU A;  1ISN A;  4WUR A;  1HA5 A;  2O6V A;  2MEK A;  2EMS A;  2L7R A;  2N9L A;  2N9P C;  3N30 A;  4ITK A;  3T9L A;  1ET6 A;  2WXQ A;  2L52 A;  4WH4 A;  3NY5 A;  4HPM B;  4PS8 A;  1IP9 A;  4GDK B;  4F7Z A;  1L6U A;  3PVL A;  3ZKJ C;  2MX2 A;  4JE3 B;  2IND C;  1XLP A;  4YTM B;  3P63 A;  4JPS A;  2BKR B;  5C23 A;  4OZB A;  2L76 A;  4OZC A;  2KQ4 X;  3RUI B;  4EZK A;  1QIL A;  2BW2 A;  2VH2 A;  1NYR A;  2ZCB A;  2DLB A;  3IT4 B;  1P0R A;  4EKU A;  2KHW B;  1ZDX A;  3AED B;  4LLG M;  5DPT A;  2ASQ A;  1ZUD 2;  2BS3 B;  5L95 C;  3L4P A;  4W9E A;  4HRS A;  4C4V B;  4HDO A;  4M00 A;  1N61 A;  4L23 A;  2ON8 A;  4LDT B;  1E7U A;  3SU8 X;  3RD2 A;  1EF5 A;  1JWS D;  1GG3 A;  1RFA A;  2W3R A;  4FLH A;  1M4V A;  3U7Z A;  2PKO A;  3AEE B;  1WM3 A;  4AP4 C;  2IO0 B;  3EFC A;  2LVP A;  1KLV A;  4RM9 A;  1STE A;  1RRB A;  4MJS A;  3PZ8 A;  4DDI D;  3ZTD A;  1FPY A;  1KH0 A;  4GB9 A;  1N60 A;  3WA0 A;  1CQV A;  2WP9 B;  1AAR A;  4S17 A;  4WIP A;  2PMV A;  3Q3N C;  2ZJD A;  5G2N A;  3TSS A;  3A33 B;  4E71 A;  2JU6 X;  4MDK E;  2CKH B;  1JRU A;  4DHZ E;  2MRP A;  1FXI A;  3GB1 A;  2PE6 B;  2LWP A;  3ZW3 A;  4EFO A;  3V3X A;  3RT3 B;  1TYG B;  3BVM A;  1WZ0 A;  3PHX B;  2KXJ A;  2PLP A;  3KYC D;  2D07 B;  2HE7 A;  3R7R A;  5AZH A;  3RI7 C;  3MC9 A;  1RAX A;  1Y8R C;  2KFK B;  1PGA A;  2CJN A;  4NJ6 A;  1FRD A;  4HRO A;  1XD3 B;  2BB5 A;  2LHD A;  1V8C A;  2J0K A;  2JSV X;  3FIL A;  1V80 A;  2M1M A;  4ARI A;  2GBJ A;  1V49 A;  1YQ3 B;  2IO3 B;  2WXL A;  1TY2 A;  2V3S A;  1ROE A;  3DWG C;  1QOF A;  4AJY B;  1WX9 A;  3KLS X;  4BOS C;  1QKZ A;  2IBI B;  1G6J A;  3KW5 B;  1E9M A;  2BYV E;  1N63 A;  4FAD A;  3M63 B;  3U7D A;  1F1H A;  3TEY A;  3AMZ A;  4N58 A;  4KZ0 A;  3EHV A;  2HJ8 A;  2MSE D;  4XZ4 A;  3HVZ A;  4O1N A;  4M02 A;  5H8Y E;  3W5V B;  2NBU A;  3RPF C;  3Q3M C;  3TIX A;  3C19 A;  4HKQ A;  1ZP0 B;  1FD6 A;  4C00 A;  2DEN B;  4N6E B;  3MP9 A;  5HI1 A;  2G4S A;  3PZD A;  2W82 A;  4HXD A;  3QQ8 B;  4K7S A;  3IAS 1;  1T0Q C;  3MHZ A;  4HVB A;  4K3C A;  2JPH A;  3ZNG C;  2EKI A;  2KC2 A;  3NS1 A;  1WXS A;  4P7I A;  1TS4 A;  3PRE A;  5AZG A;  4NAW B;  2XNA C;  2NBV B;  3V6C B;  1JWU D;  2G45 B;  4KDI C;  1I4P A;  3A4R A;  2K39 A;  1T6B X;  3ZVV A;  3NZU A;  1DOY A;  1WX7 A;  2I1J A;  1PGX A;  4W9J A;  4WWO A;  4MGZ E;  4AUQ C;  3NVV A;  3VFK A;  3TEZ A;  1MG8 A;  2DZJ A;  4C56 C;  5IAA C;  3EUB 2;  3L10 B;  3ETR A;  3M3J A;  1ZDV A;  2V0G A;  2K6Q A;  2W55 A;  3Q8F A;  1U4A A;  1T0S C;  3J9C A;  5J17 A;  3IT6 B;  2NPT A;  3EA6 A;  1WX8 A;  2N9K A;  3MFG A;  3Q8C A;  5CHW A;  2WDR B;  2M0A A;  3MC0 B;  5TSS A;  1L0V B;  3DHH C;  2AYO B;  1TS2 A;  1D5Z C;  2DWQ A;  1ENF A;  1I4R A;  3PRP B;  1SBB B;  5BYQ A;  1I35 A;  1YNT E;  2ZPN A;  4K1R B;  2KFK A;  3AE4 B;  2DZI A;  1C9F A;  5FK9 C;  2GLS A;  4YSZ B;  5D2M B;  2UWQ A;  2LRW A;  3L0W B;  4YSX B;  3AE6 B;  3L16 A;  3W5U B;  4FHJ A;  1R7S A;  5IKC M;  2R61 A;  1UWX A;  3H7P A;  2PE9 A;  3P4R B;  2K3U A;  5D3I B;  1ESF A;  2MBO A;  2LAS A;  1QQR A;  1AWD A;  3I57 A;  2GI9 A;  4P16 A;  4P6V F;  1DGJ A;  3C8Y A;  2QIE B;  1Q10 A;  5BO4 B;  4KKJ A;  2NR2 A;  3DBH B;  2CHX A;  2M17 A;  2K5P A;  3SFE B;  1ZGU B;  2JRH A;  1WYG A;  2REX A;  3NUH B;  1KRH A;  2DZK A;  4TMA B;  4RMA A;  2KYW A;  1GPX A;  4C7Y A;  2MWS B;  2ZCC A;  4DBG A;  4R3D A;  4XC2 A;  3PRM B;  4B0M A;  1OQQ A;  2WXF A;  4F8C B;  5AEK B;  5AUI A;  4S0R A;  4PT5 A;  1VCB A;  3SD5 A;  4TKN A;  4CQN A;  3APC A;  1WGG A;  3CST A;  2QMT A;  3QJZ A;  3AEF B;  2M0X A; 
#chains in the Genus database with same CATH homology
 2Y5B B;  4LJO B;  2RPQ A;  2KZR A;  2KMA A;  1J19 A;  2ZNV C;  1E5W A;  1WFY A;  3A1Q A;  4WAA A;  3ECI A;  4HPL B;  4JLC A;  1OEY A;  2C60 A;  2WX0 A;  2GBK A;  2QHO A;  1WR1 A;  1YX6 B;  4EZL A;  4BOZ B;  2MBQ A;  2LUE A;  2RSU A;  4DXA B;  4HLE A;  3C0R B;  1E8Z A;  3PGE A;  2KQS A;  4FJV B;  2D10 A;  3DVG Y;  3PSE B;  3WAP A;  1IYF A;  2Z59 B;  2KAN A;  4W9H A;  3WAO A;  4GOC A;  2PJH A;  4IWP A;  3VVW B;  1TGZ B;  5E6O A;  4J6I A;  3ZTC A;  3ZRC A;  2ZZP B;  4FUL A;  2KDI A;  3D32 A;  3H9D A;  1E90 A;  4FJZ A;  4IM2 A;  3S2A A;  2M4N A;  4WJQ A;  1ZKH A;  2FAZ A;  2L0F A;  3DBH I;  4W9L A;  3UGB B;  3V6E B;  2KX3 A;  2KOX A;  1TBE A;  3H1U A;  3HM6 X;  3ZNZ B;  1LXD A;  4GMV A;  2LZ6 A;  5KHO A;  1VD2 A;  4W9G A;  2KJ6 A;  1WIA A;  2KK8 A;  3VH3 B;  3B0A A;  4MGY E;  2N9X A;  4EUT A;  2LXA A;  1TTN A;  2I1K A;  3MJW A;  1L2N A;  1WF9 A;  2IYD B;  3EEC A;  4ASW C;  2GMI C;  4HDQ A;  4GDL A;  4URK A;  3AXC A;  2LVO A;  3ONS A;  3QCA A;  4I6P A;  1WMH B;  1WZ3 A;  4KSL C;  1WM2 A;  2FCQ A;  2CU1 A;  2FUH B;  4M8N A;  3W1S C;  4ANX A;  1OQY A;  2BGF A;  3DBS A;  3N3K B;  2K1F A;  4EEW A;  1WRD B;  2GOW A;  3PTF C;  1ISN A;  4ANU A;  3UQB A;  2WDT B;  2C7M B;  2O6V A;  1E8X A;  2EMS A;  2L7R A;  4BKS D;  2DHZ A;  5TR5 A;  1H4R A;  2N9P C;  3N30 A;  3IHP C;  3T9L A;  1KM7 A;  1YD8 U;  3W1S A;  2L8J A;  2FCN A;  2N1V A;  3NY5 A;  5D94 A;  4HPM B;  4PS8 A;  2XK5 A;  4IWQ A;  4A20 A;  3PLV A;  1IP9 A;  1WH3 A;  2KTF A;  3HHM A;  4GDK B;  2GBR A;  1UD7 A;  4F7Z A;  2FCM A;  4XX5 A;  3PVL A;  3GZN I;  3H7S A;  4FJY A;  4II3 B;  3WAN A;  2VRR B;  2MBH A;  4HWI B;  3ZKJ C;  2MX2 A;  2KC1 A;  3JVZ X;  2LGD A;  3A9J A;  4DHJ B;  4LDT D;  2BKR B;  5DCN A;  2AEH A;  5C23 A;  1YJ1 A;  2L76 A;  5D7G A;  3RUI B;  4EZK A;  4KVG B;  5DPS A;  1SE9 A;  3A9J B;  3AU5 A;  2LGX A;  2ZCB A;  3X0W A;  2HD5 B;  4FN2 A;  1F9J A;  2KLC A;  1P0R A;  4EKU A;  4FA6 A;  3OJ3 A;  2BKF A;  2KHW B;  2JUO A;  5LXH A;  1P98 A;  3IVF A;  3AU4 A;  1WI0 A;  5DPT A;  4K7W A;  2ASQ A;  2L00 B;  2MP2 A;  4M0W B;  3MHS D;  3QIJ A;  5GMV A;  4GXB A;  5L95 C;  4W9E A;  3ZNH B;  4K7U A;  4W9K A;  2IZV B;  2AWT A;  3VUY A;  3V60 A;  4JL9 A;  4IC7 B;  4HDO A;  2PPH A;  1CMX B;  2L3Z A;  3NHE B;  3DBL I;  1E7U A;  2LI5 A;  3DVN V;  1V5T A;  3M62 B;  3A9K A;  4LDT B;  3RD2 A;  1EF5 A;  3SU8 X;  4FHK A;  1GG3 A;  2JF5 A;  3U8Z A;  3ZDM C;  2JWZ A;  2D3G A;  3L17 A;  2IO1 B;  4BBN C;  4ANW A;  1RFA A;  4B6W A;  4FLH A;  3DQV A;  3WAM A;  3LDZ E;  5LLI A;  3UF8 A;  2B3A A;  4IM3 A;  1WXV A;  1V2Y A;  4WWN A;  2Z0E B;  2NVU I;  3A1Q B;  3A9K B;  3ZLZ A;  1WM3 A;  4AP4 C;  2IO0 B;  4DK5 A;  2LVP A;  2O6V D;  3DVN U;  2M8S A;  1KLV A;  4RM9 A;  2V4L A;  1RRB A;  5EDS A;  1EF1 A;  4MJS A;  1WGY A;  3ENE A;  4DDI D;  4NQL B;  3ZTD A;  4GB9 A;  3VUX A;  1H8C A;  3VDZ A;  1UH6 A;  2FCS A;  3OAW A;  4G3X B;  1YIW A;  2ZNV B;  4GGQ A;  4ZRI A;  3WA0 A;  4NQK E;  2DX5 B;  3GOE A;  4OVV A;  1L7Y A;  3PV1 A;  1AAR A;  3Q3F A;  1PQS A;  4M8M A;  4CHK A;  1I42 A;  3L08 A;  4WQO B;  2KD0 A;  3QHT A;  3ZIM A;  2NCN A;  3SHQ A;  5IA7 A;  3EFU A;  2BYE A;  2DYM A;  2NBW B;  2L0T A;  3I3T B;  3JYU A;  2ZJD A;  2D2Q A;  5G2N A;  2PEA A;  3ALB A;  2DAF A;  2RR9 A;  3A33 B;  4E71 A;  2J0M A;  1GJZ A;  4F1S A;  2MLB A;  1R4N I;  1T0Y A;  4MDK E;  2CKH B;  4PYU A;  4RM8 A;  1WXA A;  3NS8 A;  4JQW C;  1JRU A;  1E8W A;  1WJ6 A;  4DHZ E;  2G4D B;  1C3T A;  2OJR A;  2MRP A;  3UIP B;  4HCP B;  2ZEQ A;  1P9D U;  2PE6 B;  2LWP A;  3H7P B;  3ZW3 A;  4BFR A;  2CHW A;  2UYZ B;  4W9F A;  4EFO A;  2OOB B;  4CO7 A;  3APD A;  3RT3 B;  3KVF B;  2XK5 B;  4NNJ B;  4PYZ A;  2JRI B;  3VUW A;  1WZ0 A;  3PHX B;  4FBJ B;  2KXJ A;  4AWJ A;  4DHJ D;  4GN1 A;  4X57 B;  2MQJ A;  2KLG A;  3KYC D;  2KX0 A;  2D07 B;  2HE7 A;  3L13 A;  4WJP A;  2IO2 B;  3R7R A;  3UIO B;  5AZH A;  3QX1 A;  1YX5 B;  2N9E B;  3OLM D;  5G55 A;  3RZF A;  2MW5 A;  3QAR A;  2FNJ B;  1RAX A;  5CTR C;  1Y8R C;  2KFK B;  3V62 A;  3VXW A;  2W9N A;  1E7V A;  4GDL B;  1J8C A;  1Z2M A;  2YLM A;  4KIK B;  3PS6 A;  3BY4 B;  4NAW A;  4NJ6 A;  1V81 A;  4ANV A;  1XD3 B;  2J0K A;  4A3O A;  1LM8 B;  3MTN B;  2ZPY A;  1WE7 A;  4BVU C;  1S1Q B;  1V80 A;  2M1M A;  2XBB C;  3H6N A;  4II2 B;  3PT2 B;  4MSM B;  3TCA A;  2GBJ A;  1NDD A;  2LD9 A;  4IW0 A;  2N7E A;  2J7Q B;  1V49 A;  2BWF A;  3DOW A;  1GNU A;  2XEW A;  4HK2 A;  3VAW A;  2IO3 B;  1V6E A;  2KO3 A;  3WAL A;  2V3S A;  3TJP A;  4PS3 A;  2IY1 B;  1P1A A;  3RCZ A;  1GC6 A;  1UGM A;  3HIZ A;  4NY0 A;  3T8M A;  4AJY B;  1WX9 A;  1WGR A;  5AZF A;  1NBF C;  3EC8 A;  1X1M A;  4BOS C;  3ZUN A;  1OGW A;  2IBI B;  5C1Z A;  2MA9 B;  3CMM B;  3DVG X;  4BKT A;  1G6J A;  3K9O B;  3IBE A;  4K81 A;  2G3Q B;  2KWC A;  3KW5 B;  4KV2 A;  1Q1O A;  4EZJ A;  3X23 A;  3WIM A;  2KWV B;  3ZRF A;  2HTH A;  5KHQ A;  3ZDT A;  2BYV E;  4TQ0 A;  2KJH B;  3DCG A;  4FAD A;  2ZVN A;  5DPR A;  3PLU A;  3M63 B;  3U7D A;  2JY6 A;  3PPA A;  3LJ3 A;  3TBL D;  3V61 A;  3PRZ A;  4KZ0 A;  3R3M A;  4GIV A;  4CYE A;  3AUL A;  4E3C A;  2KDF B;  5J18 A;  3EHV A;  2HJ8 A;  5E6N A;  1WY8 A;  2JVC A;  4DDG D;  1WGD A;  2LVQ A;  2MSE D;  2EMT A;  1KOT A;  1ZW7 A;  3DPD A;  5JH5 C;  2KJR A;  4XZ4 A;  4KZC A;  3QC8 B;  4LJP B;  4ZYN A;  4MEL A;  1WXM A;  4HJK A;  2JZZ A;  2NBU A;  1Z5S B;  3TIX A;  3K9P B;  3Q3J A;  2O2V B;  2BYF A;  2K25 A;  3DBR I;  2DEN B;  2C9W B;  4W9I A;  2WWZ A;  2G4S A;  4W9D A;  1RLF A;  2CHZ A;  2WX1 A;  4TQ1 A;  2K8C A;  1QZE A;  3PZD A;  4OVU A;  2C7H A;  3JSV B;  4HXD A;  3QQ8 B;  2KKC A;  2YVC A;  4K7S A;  2KN5 A;  4BKG A;  2V1Y A;  5DPW A;  1OEY J;  2GBN A;  3KUZ A;  2MBB B;  4HVB A;  1OTR B;  1WGH A;  2JPH A;  1XT9 B;  3ZNI D;  3JW0 X;  4ICU A;  3JSV A;  3ZNG C;  5JHB A;  2KC2 A;  2KDE B;  3RZW C;  2KVR A;  3CF6 E;  1WXS A;  3QAQ A;  4P7I A;  1Q5W B;  1XQQ A;  3PRE A;  5AZG A;  4NAW B;  1K8R B;  2DYB A;  2MP2 B;  2NBV B;  2O2V A;  2KMC A;  3RYT A;  3V6C B;  3VHT C;  2G45 B;  4KDI C;  3A4R A;  3IFW B;  2K39 A;  1LQB A;  2LXC A;  3ZVV A;  1TZ1 A;  3NZU A;  4JIO U;  4IM0 A;  1WX7 A;  3TL5 A;  2I1J A;  1WE6 A;  2CR5 A;  1V9J A;  5CHV C;  1A5R A;  2O6V B;  1WR6 E;  5LXI B;  4IG7 B;  4W9J A;  4WJO A;  4WWO A;  4GU2 A;  3QWZ B;  4MGZ E;  3KYD D;  1GC7 A;  4AUQ C;  3P2B A;  5CX3 A;  2A4Z A;  1V86 A;  2K8H A;  3VTV A;  3VFK A;  1MG8 A;  1P3Q U;  2DZM A;  3VTW A;  1IPG A;  3R7Q A;  2DZJ A;  2A5U A;  5IAA C;  3L10 B;  3M3J A;  2K6Q A;  5FR6 A;  3BIN A;  3B1L X;  4HCN B;  4MJS B;  2EKE C;  1U4A A;  3RUL A;  2AL3 A;  2RD0 A;  4B9K A;  2ZVO A;  3KH0 A;  2MCN B;  2BWE S;  3CSF A;  5J17 A;  2BF8 B;  3R66 C;  1WJU A;  4BBN F;  2LGY A;  3NZS A;  2NPT A;  4NPN A;  4MSQ B;  1LFD A;  1WX8 A;  2N1W A;  1EO6 A;  5CHW A;  1SIF A;  2D11 A;  4I6N B;  2NS5 A;  3AI5 A;  2AYO B;  2JXX A;  2KTR A;  3ML9 A;  3OJ4 B;  4ZRJ A;  4WJN A;  5JZE B;  2KDB A;  2NPT B;  4MGI E;  2K8B A;  2KWU B;  4IWO A;  4PS7 A;  5HKH A;  2KFJ A;  3HM3 A;  3PRP B;  1WYW B;  3TMP B;  3N32 A;  1I35 A;  1EUV B;  2LRU A;  4GSW A;  4WWP A;  2ZPN A;  2K6D B;  4K1R B;  1HE8 A;  5D6J B;  2KFK A;  3PHW B;  2Z0D B;  2JZ3 B;  4GDK A;  4G11 A;  3DDC B;  2DZI A;  3QK0 A;  2FIF A;  3L54 A;  2WYQ A;  3NOB A;  3VTU A;  3UQA A;  5D2M B;  1WJ4 A;  2UWQ A;  2IY0 B;  2C7N B;  2LRW A;  3L0W B;  1BT0 A;  2FID A;  5JHA A;  3L16 A;  3KUD B;  3W1Y A;  4ZDV A;  2JT4 B;  3APF A;  4KSK C;  3A4S C;  4W9C A;  2N4F A;  4KDL B;  4FHJ A;  1UZX B;  3H7P A;  4KIK A;  1FXT B;  2PE9 A;  3O65 B;  3KUC B;  4B95 A;  4I6L B;  5L83 A;  4MM3 A;  3VQI A;  4N9F 4;  2L05 A;  1UBQ A;  2KQ7 A;  2MBO A;  2BPS A;  1S3S G;  1YQB A;  3B08 A;  4MH0 E;  1GUA B;  2LAS A;  2J0J A;  1V5O A;  4TUU A;  1WMH A;  2KNB A;  4TV3 A;  2GBM A;  5J2R A;  2MBE A;  1SGH A;  3HK0 A;  4G50 A;  3U30 A;  4LCD E;  2DYO A;  5BO4 B;  2KTR B;  3ML8 A;  2NR2 A;  1D3Z A;  3SDL C;  2R2O A;  2CHX A;  2M17 A;  4YL8 A;  5E6P A;  1ZGU B;  2JRH A;  5CHF A;  4AOF A;  4AJW A;  2REX A;  1C1Y B;  4BKS A;  4EOY A;  1R4M I;  4DWF A;  4MEM A;  1WJN A;  2CS4 A;  3IG3 A;  4JGH B;  2LJ5 A;  2DZK A;  3ZO5 B;  4RMA A;  1E8Y A;  3M95 A;  2AL6 A;  2MWS B;  2RGF A;  2ZCC A;  2C5L C;  4DBG A;  1UEL A;  4NJ7 A;  4XC2 A;  3PRM B;  4E74 A;  2R2Q A;  4F8C B;  4A3P A;  4ZRK A;  5AEK B;  3VH4 B;  1NI2 A;  1VCB A;  2N7D A;  4DHZ B;  3SD5 A;  1M94 A;  2DAJ A;  4G0N B;  4TKN A;  3APC A;  1WGG A;  4IUM B;  3CST A;  4MGK E;  1KJT A;  3QA8 A;  1Q0W B;  3QJZ A;  1UBI A;  3UIN B;  4ICV A;  1J0G A;  2M0X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...