2MJDA

Oxidized yeast adrenodoxin homolog 1
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
115
structure length
115
Chain Sequence
GEELKITFILKDGSQKTYEVCEGETILDIAQGHNLDMEGACGGSCACSTCHVIVDPDYYDALPEPEDDENDMLDLAYGLTETSRLGCQIKMSKDIDGIRVALPQMTRNVNNNDFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functional reconstitution of mitochondrial Fe/S cluster synthesis on Isu1 reveals the involvement of ferredoxin.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Metal binding protein
molecule keywords Adrenodoxin homolog, mitochondrial
total genus 17
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2014-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2mjdA00
3LXFA 2WLBA 3FAHA 4JWSC 2WU5B 1FM0D 1N62A 3AE3B 4ZHOA 1N5XA 4JWUC 3DWGC 1YQ3B 3AE5B 3AE4B 1SF0A 2MJEA 1TYGB 1ZUD2 2WU2B 1QF6A 1TJEA 2W55A 3P4RB 1DOYA 3AN1A 2JQRB 2PKOA 2CU3A 3B2GA 1ZXIA 4P6VF 3NVZA 1RWSA 1FXAA 4KX6B 1E10A 3W5UB 1J7BA 3HUIA 3AEBB 1OQRA 2WS3B 3W9CB 3WCQA 5G5HA 5EE9A 1F0ZA 3NVYA 5EE0A 2W3SA 3AECB 1OQQA 1JWBD 2DBYA 2H89B 1IUEA 1WYGA 3AEDB 3BIID 4YTMB 1L5PA 1WGKA 3HRDD 3AE7B 2G1EA 3L4PA 3P4PB 2L83A 4IDIA 1PDXA 5C3JB 2WDRB 4HRSA 1KF6B 1QOFA 2E3TA 2QIEB 5EE1A 1J7AA 4YSYB 1L0VB 1WRIA 3AEGB 3SFEB 4C80A 4YSXB 1SB3C 4US9A 1DGJA 2FBWB 3B9JA 2DWQA 1L6VA 3VR9B 1VDVA 2Y5CA 1YQ4B 4ITKA 2MJDA 1KFYB 4YXDB 2N0SB 2ACZB 2BS4B 1NENB 2KAJA 2MH7A 3AE8B 3NVWA 4WWMA 1FXIA 3SR6A 4ZOHC 3AH7A 1KRHA 2PVOD 3CIRB 1N5WA 1A70A 1FRDA 2L52A 3NVVA 2CJOA 2CJNA 4FXCA 2K5PA 2KMMA 1QT9A 4C7ZA 1AYFA 1B9RA 1UWMA 2BS3B 3AMZA 5EE3A 5H8YE 1SIJA 1CZPA 1N63A 1XLOA 1FFVA 2WQYB 3ETRA 1E0ZA 2PIAA 1FIQA 1PFDA 4ZHPA 1GPXA 2OHFA 1OFFA 3SFDB 1WXQA 1RFKA 1FFUA 3KWLA 1E7PB 4N58A 3DWMA 5H92C 3AE1B 3AB5A 4N59A 1R7SA 1TKYA 3AM9A 3LB8C 4YTPB 3ZYYX 2EKIA 2H88B 5C2TB 3NRZA 3VR8B 3NS1A 1NYRA 1QLBB 1ZP0B 3B2FA 1FRRA 1RM6C 1DOIA 1NYQA 2JX5A 2W54A 1AWDA 1VJKA 4JX1C 1JALA 1FMAD 2K9XA 1GAQB 1JROA 2HTME 3VRBB 1QOAA 3AEEB 4C7YA 3RPFC 2AX5A 4YSZB 1V97A 2Q5WD 1YJJA 3P4SB 5MPOA 2WP9B 5GXGB 1QOGA 1E9MA 1N60A 1FO4A 4USAA 1I7HA 2PVGC 3EUB2 1YJIA 1RYJA 1QOBA 2M56B 1JWAD 4YT0B 1TKEA 1PUTA 2B76B 4WQMA 4LTUA 1TKGA 1L6UA 3W5VB 1ROEA 2WDQB 2K22A 2M19A 2WDVB 4A9AA 1N61A 1WWTA 1XLPA 1ZOYB 3AE2B 3AV8A 1J7CA 3HVZA 3CWIA 1NEKB 2QJLA 3FC4A 3P1MA 5AUIA 2BT6A 2W3RA 5G5GA 2BS2B 3AEAB 3VRAB 1V8CA 3P63A 3P4QB 2MJ3A 5AUKA 4US8A 1E6EB 1CJEA 1JRPA 1NI3A 3ABVB 1DOXA 3AE6B 1NVID 1XO3A 4HROA 3AE9B 4YTNB 3AEFB 1T3QA 1XLNA 4N6EB 2LEKA 1VLBA 1XLQA 1JW9D 1JQ4A 3PO0A 1EWYC
chains in the Genus database with same CATH superfamily
2LRWA 3KUDB 3CF6E 2WXLA 3M3JA 2WU5B 1WXSA 2VH1A 5GMVA 1BT0A 3B2GA 2BKFA 2K3UA 4BFRA 1OTRB 2KJHB 2KJRA 2L7RA 3RZFA 1ISNA 2X38A 3R66C 4P16A 1YJ1A 4NJ6A 2LGIA 3DVGY 1JRUA 2D2QA 4II3B 1MHHE 3BK1A 2A5UA 4Q2JA 1YQ4B 1IP9A 4OVUA 1SGHA 2MH7A 4P1CC 1I4XA 2MP2A 1KRHA 2QILA 3CIRB 2XN9C 4JPSA 1V81A 3H7PA 3HHMA 1FNWA 2LXAA 2I1JA 1QT9A 4G3XB 3APCA 1CZPA 2NVUI 3I5JC 1EU4A 3KH0A 1UF0A 4MGKE 2Y5BB 2WGSA 3NS1A 4LJPB 1NYQA 2LHEA 2I2YA 5AEKB 1HZ6A 2LJ5A 1CK1A 1QILA 3A33B 4HEA1 3HM3A 3L54A 3PRZA 4K3CA 2FIFA 3MHZA 1RYJA 3GP7A 3SD5A 2J42A 5D94A 3I3TB 1TIFA 4B95A 2BKRB 3RNGC 4HCPB 4WJQA 2KQ7A 2NBUA 4REZA 2G4SA 5JXVA 2IY1B 2MJ3A 2PPHA 3QWZB 1NI3A 3ZTDA 1WJ6A 1XO3A 2C7NB 4ZRPA 2PE6B 1WYWB 3JVZX 1C76A 3WAMA 3BINA 2KN4A 2QCZA 4FLHA 2J53A 2IGHA 1GOZA 2WS3B 2ZW0A 1UH6A 1IUEA 3AEDB 5TR5A 3VQIA 1EU3A 1WJUA 4S0RA 1V6EA 1PGAA 3RNFC 1ENFA 2FBWB 2KKCA 2Z0EB 3PLVA 1E5WA 1SJED 4FXCA 5J2RA 1B9RA 2WX1A 4GDKA 1NDDA 3MTNB 2WXFA 2L0FA 3RFZB 3SFDB 3KWLA 3DBHB 4I6PA 3ZO5B 1WR1A 3AB5A 2EMSA 3APDA 1D5MC 2C9WB 4YTPB 3BK2A 3B2FA 2JWZA 4M0WA 1MG8A 2NPTB 1LXDA 2TSSA 3U4EG 2LMCA 5I4DA 5L95C 2JZZA 1WXMA 4W9KA 1XD3B 2D5GA 3DBSA 3OLMD 4R3DA 5FR3A 5JHBA 2O2VB 2IBIB 1D6EC 4WWOA 3DOWA 2K22A 2WDVB 5E6PA 3AV8A 2N9LA 2CS4A 3H7PB 2IO1B 3TEXA 3TSSA 4IUMB 4A3PA 2JXTA 1V8CA 1MJDA 3Q3NC 1FNVA 1CJEA 3DCGA 4W9GA 1E7UA 2LJIA 5TSSA 2INCC 5BO4B 5D6JB 2YLMA 1L4DB 1IYFA 3U7DA 2L3ZA 4RMAA 5HKHA 1F77A 3PTFC 3AN1A 4E71A 2CU3A 2NR2A 2WXQA 4ASWC 1JWMD 1CMXB 2BYFA 4L1BA 1OQYA 4B9KA 1D3ZA 3ZXVA 4DXGA 5IO9A 1R4NI 1XCTL 5C3JB 3AEGB 1WRIA 4MSQB 1K52A 2LHDA 1J19A 2RDBC 2J4XA 1RLFA 2KAJA 2WHIA 2VZKD 3Q3MC 1JWUD 2JSVX 1SE4A 3NVVA 1C77A 1P7EA 3DBHI 3EHVA 4HLEA 1WJNA 3L16A 2KOXA 3MC0B 1WX8A 3T3NA 5IOIA 4HDOA 4N58A 2KC2A 2GRIA 4FBJB 4UDUC 3TCAA 2WXJA 5DPRA 4JIOU 3RYTA 3M62B 3U7ZA 1DOIA 1ZKHA 1WX9A 4S17A 3VRBB 4OZCA 3ECIA 1I4HA 2PEAA 2KWVB 3QQ8B 1WFYA 4IM0A 4GGQA 4L23A 3QX1A 1T0QC 1RFAA 2LVPA 1LO5D 1T0SC 1GG3A 1J7CA 3VFKA 1MHXA 2BB5A 2BT6A 4BOSC 4F1SA 3ZJTA 1KJTA 3WIMA 1E6EB 1I4RA 3ZIMA 2I1KA 4BOZB 1T0RC 5IA7A 1WE7A 2DENB 3FAHA 2MLBA 4BKTA 1N62A 3DBLI 4PYUA 4IG7B 1YQBA 4PYZA 3Q14C 3NOBA 1C78A 3ZXRA 1GUAB 3TEYA 4P6VF 1FXAA 3ZRFA 3W9CB 1V86A 5G5HA 1UBIA 3PRPB 2G1EA 1KM7A 4MACA 1CQVA 3EGRA 2QIEB 5IP4D 4BBNF 3EECA 1HQRD 3DHHC 2N0SB 3AE8B 1FXIA 5DPSA 4WWNA 4ARIA 2FNJB 2CJOA 2CJNA 4CQNA 1AYFA 2IJ0A 1UWMA 2AL6A 2BS3B 5H8YE 4PS7A 2DZIA 2WNMA 2WQYB 3PHXB 3ZVVA 2HJ8A 2FCMA 2NTSA 3X23A 3MC9A 4WURA 3AU5A 2JU6X 1TT5B 1Q0WB 2IYDB 3PS6A 4OHJA 3KYCD 2K9XA 1K50A 1YJJA 3P4SB 2JYEA 5GXGB 1Y8RC 1FO4A 2LVOA 3DQVA 1TS4A 2LI5A 3UF8A 2K39A 3VUXA 2K1FA 1SIFA 2N7DA 3JW0X 2BS2B 3CMMB 3AEAB 4TV3A 3P4QB 4W9CA 2KYWA 3Q6BA 3RN9C 2BYVE 1XLNA 2LEKA 1JW9D 4XZ4A 4XE0A 3GB1A 4JWSC 4KZ0A 1L2NA 2ZVNA 4JWUC 1YQ3B 3JYUA 3ONSA 1I4GA 2W55A 3BZDB 4K7WA 3NVZA 1V9JA 2JT4B 3W5UB 3HUIA 2N9EB 2K8BA 1GB4A 4BVUC 2MEKA 2W3SA 1M94A 2JF5A 2QEJC 3ENEA 3WAOA 2CHZA 4W9JA 2ZZPB 1L0VB 1V5OA 4FADA 2M4NA 4C00A 1TTNA 1YMHE 2KFKA 4KSKC 4MEMA 1B1ZA 2KT7A 2KK8A 3UIOB 3UI3A 3V62A 1Q1OA 1WM3A 4LDTB 1OFFA 1YX5B 5JHAA 3W1YA 5H92C 1YN3A 4A8XC 4A55A 1EO6A 2C7MB 2EKIA 3ZNHB 1GC7A 1NYRA 3DBLB 2L00B 5D3DA 2V3PA 1WRDB 2RPVA 3IBEA 1MG4A 4HWIB 3UGBB 1JROA 4MJSA 3AEEB 3QK0A 1R4MB 3RNAC 2IGGA 1WMHA 1A5RA 2QHOA 1Q10A 2K8CA 1TKEA 4MGYE 3IVFA 4PT5A 4LNKA 1SEBD 2GMIC 3EC8A 1ZOYB 2KVZA 1WGRA 1AARA 3H8HA 2ZPNA 2AL3A 2M1MA 2W3RA 4FJYA 4NQLB 5AUKA 5BMIA 3ZDTA 4W9FA 3OJ4B 3Q2AC 1UNSA 2JZ3B 3DVNU 3TUOA 3V05A 3Q3FA 2J0MA 3LXFA 1UWXA 2X8XX 3ZLZA 1I35A 2HD5B 1XT9B 3AE3B 3MJ5A 4WH4A 1DYQA 1FCCC 3C19A 3AE4B 1GJZA 3WANA 2KNBA 4HKQA 4W9LA 3VHTC 1FEHA 2ONQA 3BYTB 1T6BX 4B6WA 3AE7B 1WZ3A 1PDXA 2NPTA 2YVCA 1J7AA 4YWGG 3E56A 2AQ2B 2KTFA 2KLCA 4TSSA 4M00A 4DHJB 2O6VB 2PVOD 5DCNA 1VZ7A 3W2DA 2RDGA 2WXPA 1KLUD 5CX3A 5D2MB 1YN4A 1SIJA 2D07B 1FFVA 3QA8A 1RAXA 2DYBA 4EZLA 3Q8BA 2WXNA 3GS2A 1E90A 4FULA 3VXWA 2QMTA 3AM9A 1F2RI 4KGSA 3PVLA 4K7SA 3VTUA 1VJKA 3RNEC 1LGRA 3R7QA 4A3OA 1UBQA 2GBKA 5AZGA 1KOTA 2AX5A 3IT6B 2LGDA 3OJ3A 3QIJA 2BF8B 1YJIA 2IPKD 4IKGA 4YT0B 1WIAA 3NJTA 2DHZA 4WQMA 1HZ5A 4A9AA 4ZYSA 4W9DA 1YIWA 1V49A 2QJLA 3LDZE 4BBNC 4MJSB 5G5GA 2BB6A 5IN7A 2V1YA 2D10A 3ZNZB 4WWPA 1P98A 3KUCB 4NAMA 3RNBC 3AE9B 1BXTA 4URKA 2ZEQA 4BKGA 1HEZE 2FE8A 3VH4B 1V97A 3ZKJC 4OW0A 2N4FA 3N9YC 1L7YA 1FNUA 4EFOA 4RM9A 4KVGB 3V6EB 2JQRB 2OJRA 1XXGA 1UGJA 2PMVA 3DDCB 2RGFA 5EE9A 5EDSA 2KACA 2KANA 4RM8A 1K51A 4WIPA 3H6NA 1JWBD 1WM2A 2MBOA 2CKHB 2L83A 1U4AA 3ML9A 2KO3A 4RF0A 2W9NA 3KVFB 3FKYA 2KWCA 4AQ7A 5FKAC 3ZJUA 3VR9B 4ANUA 4ZDVA 2JXXA 2ACZB 2L05A 3NVWA 1D5ZC 2LASA 2DAFA 2UYZB 3TJPA 1N5WA 1F9JA 4HVBA 2J7QB 3DPDA 2CHXA 4GB9A 4ZRQA 3IXSA 4RNAA 4ZHPA 2OOBB 2MP2B 1RFKA 2BPSA 2M17A 1TKYA 3ZYYX 2ZCBA 3PV1A 3ZRCA 1YN5A 4HKZE 5DPTA 4C4VA 1HTQA 2JX5A 4HPPA 4ZRKA 3VTWA 2C5LC 4JX1C 5BYSA 4EKUA 2JZPA 1E7VA 4D2KA 2B3AA 1JMLA 4JL9A 1L0YB 2MA9B 4W9HA 5BMHA 4HCNB 2B76B 3RCZA 2KFKB 2UWQA 1TY0A 4EE2A 2KZRA 3AXCA 2D3BA 4K81A 2LVQA 4AJWA 2WYQA 1H4RA 5KHOA 1ZE3D 3SEBA 2MCNB 3ZNID 1G6JA 2KTRA 3RD2A 2KDMA 2GBRA 2KTRB 2IO2B 2K6QA 3KQ4A 1WI0A 3Q8FA 4BAXA 2MX2A 3AE5B 2J0JA 1IGCA 1ZUD2 3ZUNA 1SSNA 3P4RB 2PKOA 1ZXIA 5CHWA 1F0ZA 2ZCCA 3VVWB 2EELA 3A1QA 4XX5A 3AECB 4HPLB 2DBYA 3TMPB 3L17A 1WYGA 4YTMB 1FCLA 2JY6A 1T0YA 5T8IA 1UUPA 1ACCA 3SFEB 3ZW3A 3WA0A 2Y3AA 4KZCA 3A1QB 1P9DU 3JSVB 2BS4B 2G3QB 1PGXA 2M0XA 1V1OA 1TS5A 3J9CA 2K5PA 2KMMA 5J18A 2NS5A 1VZ6A 4IWOA 1E0ZA 4ICUA 2NCNA 1FIQA 1XEEA 1L0XB 1TBEA 1C4AA 4N59A 5CHVC 4NAWB 4BKSA 3VR8B 4DK5A 1ZP0B 1L4ZB 2KMAA 4XDDA 5HG2A 4RGMA 2K0PA 3PRMB 3N1XC 1QOAA 4C7YA 1SXTA 2D3CA 1QOGA 2BWES 5DPWA 2LXCA 4P7IA 2WDQB 3MJWA 2NTTA 4XGAB 2KJ6A 4MT5A 1FPYA 4J3OD 3C0RB 2O6VA 5AUIA 4A6QA 1KH0A 1C4CA 2KVRA 4KIKB 2DX5B 2VRRB 2XK5A 1QQRA 1KLGD 3PO0A 5KHQA 2WLBA 2GOWA 3B08A 3PHWB 2OJWA 4O1NA 3Q8EA 2ZVOA 1EF1A 2OEDA 3H7SA 3RNCC 1UZXB 3AEBB 2D11A 4GDLA 3NVYA 1J0GA 2PTLA 2H89B 1Q5WB 4YL8A 2HDEA 4IWPA 4NPNA 1QOFA 3Q8AA 1UGMA 4EZJA 3KLSX 1ZDVA 1L6VA 4ITKA 3M95A 1AN8A 4WJNA 3SR6A 1S3SG 2J0KA 1C79A 2YEPF 4C7ZA 3R2IA 4LNIA 4PS3A 3V60A 1GC6A 2GBMA 2WXMA 4RGTA 2PW9A 2AYOB 1R7SA 4BZAA 2KMCA 1PQSA 4CHKA 4JQWC 3SHQA 1V1PB 2PLPA 2KWDA 4ANXA 2Q5WD 3RI7C 5LNK1 4NNJB 2N9XA 1K53A 3Q3JA 1EUVB 1WZ0A 1ZW7A 1V80A 2N7EA 1Z2MA 1E8WA 3AE2B 3HVZA 2FUG1 1TS3A 3GZNI 1NEKB 4EOYA 5IAAC 4B0EA 2VH2A 4JLCA 3GE8C 4KKIA 4XWWA 2IZVB 1MPEA 3QAQA 3PGEA 1DOXA 1NVID 4LNOA 4IW0A 4A20A 4AUQC 4AP4C 3H1UA 3R3MA 5C1ZA 3PREA 4KX6B 1OQRA 3LJ3A 3N3KB 1J8CA 2D3GA 1WGYA 2N9PC 4LNFA 2DYMA 3BWUD 1AW7A 1HA5A 2XNAC 4DHZB 1WGKA 2KWUB 5FR6A 2KC1A 1V5TA 2KFJA 2E3TA 4HXDA 4I6NB 2FCQA 2G9HD 4MGZE 3A9KA 3IHPC 2VZKB 1WGHA 2MJDA 3DBRI 3PZ8A 4WWMA 4H2AA 3QJZA 5C23A 2KQ4X 3AH7A 4KGTA 1HTOA 3U2SC 2BYEA 3UIPB 5EE3A 2NBVB 2MWSB 3DWMA 3NS8A 1JWSD 2V0GA 3NRZA 2O6VD 1QLBB 2MBBB 4KKJA 2ICIA 1JCKB 2W54A 4KDLB 2BYTA 2KDBA 2PE9A 3P42A 2R2QA 1C9FA 4FN2A 4MH0E 5HHDG 1BUIC 4WQOB 1PUTA 1EM7A 2EKEC 2LFIA 3W5VB 2K8HA 1WWTA 2L1AA 2XBBC 1HE8A 3CWIA 4IC7B 4G50A 1V1PA 2SAKA 1WY8A 5JZEB 4US8A 4LDTD 1WF9A 3AE6B 1C1YB 3V6CB 5J17A 4E3CA 1T3QA 2ZW1A 4GSWA 1XQQA 2MQJA 2V3NA 1TYGB 4JE3B 2AEHA 2ZNVB 4MM3A 3AU4A 3UQAA 5FK9C 3WCQA 4W9EA 1MI0A 4RFBA 2YEPB 4DDID 2V3SA 3I9V1 4KSLC 2RPQA 1OQQA 3ZQ4A 3HRDD 1WH3A 2ZPYA 2O2VA 3U52E 2XK5B 2Z59B 4YSXB 2KN5A 2ON8A 3N30A 2QSDA 4WJPA 3KWVA 4EUTA 3TEWA 4KGRA 4G11A 1YX6B 2D3AA 1I4PA 3IAS1 3C8YA 2L52A 2KXJA 3Q3OC 1IPGA 2JUOA 2CHWA 4F8CB 1WXQA 1TZ1A 2G45B 3PZDA 4GU2A 2INDC 2H88B 2HJ1A 4QAYA 5C2TB 4B0MA 1FRRA 5IKCM 1FD6A 2DZJA 3QARA 1MVKA 4E74A 3CSTA 1SE2A 1GB1A 5LXIB 1EWCA 2NBWB 5CTRC 2WP9B 4M01A 4G0NB 4P1BC 4DHZE 2BVCA 1JWAD 1BMLC 4A90A 4LTUA 2IY0B 3DHIC 2WXRA 1N6ZA 1K8RB 4IM3A 2MW5A 3P1MA 2WDTB 3TIXA 5G55A 4MDKE 4M8NA 3N1YC 2G4DB 1I42A 3Q8CA 1JRPA 2GBJA 4N6EB 4ICVA 2LGSA 3LYYA 2MBHA 2AWTA 2SEBD 4RGOS 1YOVB 3R2TA 1N5XA 2UU7A 3EA6A 1TGZB 1QF6A 4XWTA 2N1WA 4GN1A 4AWJA 1J7BA 2KLGA 3IFWB 3VUWA 1SBBB 4DHJD 1PGBA 4FA6A 3BIID 4M8MA 1C3TA 4NZLB 4MM3B 3L10B 3N1ZC 2DNFA 4DBGA 4FHKA 4US9A 3B0AA 3TBLD 1VDVA 3A4RA 4XC2A 2JRIB 3PLUA 4ZOHC 2IDYA 2M0AA 1QKZA 3ML8A 2DAJA 2HE7A 3AMZA 3ETRA 2PIAA 1TY2A 1NBFC 2FIDA 2KDFB 1PYWD 1E8ZA 2RSUA 3BY4B 1ZXHA 1RM6C 4IOIE 1WGDA 3PPAA 4MSMB 2HTME 3O13A 2INNE 4EEWA 1ZPSA 5MPOA 3QC8B 1I7HA 3X0WA 5D3IB 1QOBA 4HK2A 3T9LA 3V3XA 4MGIE 1L6UA 1ROEA 1LFDA 3UINB 2Y5PA 1F2RC 4KV2A 4ANWA 2AQ1B 2LUMA 2GBNA 3P2BA 1P1AA 1FXTB 4AS1A 2AQ3B 3H9DA 2KX0A 2R61A 2IGDA 1VLBA 1ZGUB 4ZRIA 2KD0A 1ESFA 1WGGA 1E8YA 1WMHB 1FM0D 3EFUA 5HFYA 2V9HA 3DWGC 4LLGM 1SF0A 2NMQA 1TJEA 2GI9A 4J6IA 1DOYA 2QDFA 3FILA 1E10A 3T3OA 5EE0A 2RMMA 4NY0A 2HTHA 4OZBA 4IM2A 3L4PA 2R2OA 3IT4B 4HJGE 4WAAA 4ZYNA 1LQBA 5EE1A 2KDIA 4DWFA 1EF5A 2MSED 3HK0A 3PT2B 1SB3C 3B9JA 1P3QU 3V61A 1F52A 2Y5CA 1KFYB 4NJ7A 2JPHA 2WXGA 2N1VA 4MELA 1OGWA 1PFDA 1GPXA 3TL5A 3LB8C 5E6NA 3K9OB 4JGHB 3CSFA 1ET9A 3U8ZA 1GAQB 3VDZA 2BTEA 2L32A 1STEA 1N60A 3UQBA 3EUB2 4N9F4 3ZGZA 2LRUA 3I57A 4TUUA 4KIKA 2ASQA 3MC8A 1VD2A 3DVGX 4HPMB 1WJ4A 4II2B 4MH8A 1F1HA 4ZRJA 3FC4A 2IO0B 3ZDMC 3VRAB 4OVZA 1C4PA 4YTNB 3S2AA 3RMKC 2BQQA 3BVGA 2C60A 1T5XD 1VRAB 4M02A 2GB1A 3SDLC 4ARCA 2MJEA 2WU2B 5LXHA 3DVNV 3AI5A 2WWZA 3DHGC 3OWEB 5LLIA 3HVDA 3Q69A 3QCAA 1X1MA 1TS2A 1L5PA 2MRPA 3EFCA 1KLVA 3I63C 2ZJDA 4YSYB 2REXA 2L76A 5L83A 2DWQA 3NUHB 3GE3C 1VR9A 1P7FA 1H8CA 4HDQA 1E8XA 1QZEA 4RF1A 4TKNA 4K3BA 3NG0A 2J52A 1N63A 1TZOA 4W9IA 2OHFA 2DLBA 3BYYB 2M8SA 3L0WB 4LK0M 3ZJVA 3AE1B 2JYTA 2WXKA 2CU1A 2FCNA 3PSEB 2FCSA 1VZ8A 1XF5L 1JALA 2MHJA 3NY5A 3RPFC 3D32A 3IG3A 3JSVA 4GDKB 4HJKA 4YSZB 4NAWA 3QHTA 2PVGC 3MFGA 1S1QB 1UELA 1SJHD 1TKGA 2EMTA 3RT3B 1XLPA 2GLSA 3HIZA 5CHFA 4XYCA 3PZ7A 4PS8A 2L0TA 2BBCA 2RR9A 2K6DB 2FUHB 4M0WB 3VUYA 3VAWA 4CYEA 3AEFB 3MP9A 3RULA 2Z0DB 3U30A 1XLQA 3KYDD 3ZTCA 1JQ4A 1EWYC 2INPE 4X57B 1ET6A 3N32A 3TEZA 1WSPA 2L8JA 4ZHOA 2LZ6A 2CR5A 3APFA 1OEYJ 2WXIA 1RWSA 1HXYD 1KTKA 4ANVA 1MFWA 3L08A 3KW5B 1R4MI 4F7ZA 2I38A 4LJOB 4GMVA 2KX3A 5D7GA 3GOEA 5E6OA 2WDRB 3DBRB 4RH6A 4L2YA 2KDEB 5BYQA 4GOCA 3A9JB 4TMAB 3B1LX 1DGJA 4C56C 4EZKA 4YXDB 1NENB 2LWPA 3GZNB 4LNNA 4K1RB 1A70A 4XDCA 2Z8LA 1IBXB 3A9JA 3WAPA 5AZHA 1XLOA 1NI2A 3M63B 4IWQA 4FHJA 2MBEA 2KHWB 3KUZA 1WX7A 2FAZA 4FJVB 1ZDXA 4BKSD 1FFUA 1E7PB 1WXVA 1XCQL 4K7UA 2QC8A 4NJCA 2W82A 1IBXA 4FJZA 2WX0A 3AULA 1Z5SB 4CO7A 2JVCA 1D4BA 3SU8X 2E6XA 2RDHA 1E9MA 3K9PB 4USAA 1VCBA 3WALA 1IGDA 3NZSA 3VTVA 5BMGA 2WXOA 3OG5A 3L13A 4KDIC 5E6JA 2V4IB 4DDGD 1V2YA 1WR6E 4WJOA 1SE9A 1P0RA 2V4LA 3E9SA 1WE6A 1OEYA 4OVVA 2BW2A 4OZAA 3A4SC 2N7JA 4DXAB 3NHEB 4TQ1A 1R4NB 1YNTE 2A4ZA 3W1SC 3ZNGC 3P4PB 4IDIA 4GIVA 4HRSA 1KF6B 3BVMA 3BVZA 4GLSC 4C4VB 2WXHA 3URYA 3IAM1 4C80A 3ALBA 2C7HA 3N20C 3OAWA 4WAFA 4RGNA 4AOFA 3A9KB 2KQSA 2PJHA 3RZWC 1UD7A 2JWUA 2DZMA 4GDLB 2DZKA 1I4QA 4DXFA 1FRDA 4RCOA 2LGYA 2LUEA 1Y56A 2N9KA 3HM6X 4DQOC 1YD8U 5BYRA 1RRBA 4I6LB 4ACFA 5JH5C 3T8MA 1WXAA 3RUIB 1GNUA 4TQ0A 1AWDA 3MHSD 2XEWA 1FMAD 2JRHA 4AJYB 2LGXA 5G2NA 2BGFA 1SE3A 2DYOA 2RD0A 2M56B 3R8BA 4GXBA 4LCDE 5AZFA 2M19A 1N61A 3NZ3A 3W1SA 3O65B 2IO3B 2MBQA 1D5XC 2ZNVC 4PK1A 3P63A 3FILB 2BWFA 1M4VA 2K25A 3ABVB 4NQKE 1LM8B 4HROA 2LD9A 5HI1A 3R7RA 3VH3B 3NZUA
chains in the Genus database with same CATH topology
2WLBA 1ESFA 2WXLA 4JWSC 2WU5B 1FM0D 4O1NA 5HFYA 4JWUC 3DWGC 1YQ3B 3Q8EA 4LLGM 1SF0A 2NMQA 1I4GA 2OEDA 1TJEA 2GI9A 2W55A 3BZDB 1DOYA 3B2GA 3FILA 3NVZA 1E10A 2K3UA 3W5UB 3HUIA 3AEBB 3T3OA 3NVYA 1GB4A 5EE0A 2RMMA 2MEKA 2W3SA 4OZBA 2PTLA 2H89B 2QEJC 2X38A 4P16A 2HDEA 3L4PA 2LGIA 3IT4B 4HJGE 1QOFA 5EE1A 1L0VB 1MHHE 3Q8AA 3BK1A 1SB3C 3KLSX 1ZDVA 3B9JA 1L6VA 2Y5CA 1YQ4B 4ITKA 4Q2JA 1KFYB 1AN8A 3SR6A 2MH7A 1YMHE 1I4XA 2QILA 1KRHA 1B1ZA 2WXGA 3CIRB 2XN9C 1C79A 4JPSA 2YEPF 1FNWA 3UI3A 4C7ZA 1QT9A 3R2IA 1CZPA 1PFDA 1GPXA 1OFFA 2WXMA 4RGTA 5H92C 1YN3A 2PW9A 4A8XC 4A55A 1R7SA 1EU4A 3LB8C 2EKIA 3NS1A 1NYRA 5D3DA 2V3PA 2LHEA 1NYQA 1ET9A 2RPVA 2I2YA 1HZ6A 1CK1A 1V1PB 2PLPA 1GAQB 1JROA 3AEEB 1QILA 2BTEA 2KWDA 4HEA1 2Q5WD 5LNK1 2L32A 2IGGA 1STEA 1N60A 3MHZA 1K53A 3EUB2 1RYJA 3GP7A 1Q10A 2J42A 3ZGZA 1TKEA 4PT5A 3I57A 1SEBD 3AE2B 1ZOYB 3HVZA 2FUG1 1TS3A 3H8HA 1NEKB 4MH8A 3FC4A 4REZA 4B0EA 2W3RA 4KKIA 5JXVA 3VRAB 4XWWA 2MJ3A 5AUKA 1MPEA 5BMIA 4OVZA 1C4PA 1NI3A 1DOXA 1NVID 1XO3A 4ZRPA 1UNSA 4YTNB 3TUOA 3BVGA 3V05A 1T5XD 3LXFA 1UWXA 1VRAB 2GB1A 1C76A 3MJ5A 3AE3B 4WH4A 1DYQA 1FCCC 4ARCA 3AE4B 2MJEA 2KN4A 2WU2B 4HKQA 2J53A 4KX6B 3OWEB 2IGHA 1GOZA 1OQRA 2WS3B 2ZW0A 3HVDA 3Q69A 1FEHA 2DYMA 2ONQA 3BYTB 1T6BX 3BWUD 1AW7A 1HA5A 1IUEA 2XNAC 3AEDB 1TS2A 1L5PA 1WGKA 3VQIA 1EU3A 3AE7B 1PDXA 2E3TA 1J7AA 4YSYB 4YWGG 2G9HD 1PGAA 3E56A 1ENFA 2AQ2B 2FBWB 2VZKB 2DWQA 3NUHB 2MJDA 1VR9A 3PZ8A 4WWMA 4H2AA 1P7FA 2KQ4X 4TSSA 3AH7A 2PVOD 4KGTA 1SJED 3U2SC 1VZ7A 3W2DA 4FXCA 2RDGA 2WXPA 4RF1A 1KLUD 1B9RA 5EE3A 2J52A 1YN4A 1SIJA 1N63A 1TZOA 1FFVA 2WXFA 2OHFA 2DLBA 3BYYB 3Q8BA 3SFDB 3RFZB 3KWLA 2WXNA 4LK0M 3DWMA 3GS2A 3AE1B 3ZJVA 3AB5A 2JYTA 2QMTA 1D5MC 3AM9A 4YTPB 2WXKA 1JWSD 2V0GA 3BK2A 1F2RI 3NRZA 4KGSA 1QLBB 3B2FA 4M0WA 4KKJA 2ICIA 1JCKB 2W54A 2TSSA 2BYTA 1VJKA 3U4EG 1VZ8A 1XF5L 1JALA 2LMCA 5I4DA 3P42A 3RPFC 2AX5A 3IT6B 4YSZB 4GDKB 1C9FA 2PVGC 1YJIA 2D5GA 2IPKD 3MFGA 4IKGA 5HHDG 1BUIC 4R3DA 4YT0B 1PUTA 1EM7A 5FR3A 4WQMA 1SJHD 1TKGA 1HZ5A 1D6EC 2LFIA 3W5VB 2K22A 2WDVB 4A9AA 1WWTA 1XLPA 3AV8A 2L1AA 4ZYSA 2N9LA 3CWIA 2QJLA 3TEXA 3TSSA 3PZ7A 5G5GA 2JXTA 2BB6A 1V1PA 2SAKA 1V8CA 1FNVA 2BBCA 4US8A 4NAMA 1CJEA 2LJIA 3AE6B 5TSSA 3AE9B 3AEFB 1T3QA 2ZW1A 3MP9A 1BXTA 1XLQA 1HEZE 2FE8A 1JQ4A 2INPE 1V97A 1EWYC 1ET6A 2V3NA 4OW0A 1L4DB 3TEZA 3N9YC 1WSPA 4ZHOA 1FNUA 1TYGB 4JE3B 1F77A 3AN1A 2JQRB 2CU3A 2WXQA 1XXGA 1UGJA 2WXIA 5FK9C 1RWSA 1HXYD 2PMVA 3WCQA 1JWMD 1KTKA 1MI0A 5EE9A 4RFBA 2YEPB 3I9V1 2KACA 4L1BA 1K51A 4WIPA 1OQQA 1JWBD 3ZQ4A 2I38A 4DXGA 3HRDD 5D7GA 2L83A 1XCTL 5C3JB 2WDRB 4RF0A 4RH6A 3U52E 4L2YA 3AEGB 1WRIA 4YSXB 5BYQA 1K52A 4AQ7A 4TMAB 5FKAC 1DGJA 2LHDA 2ON8A 3ZJUA 4C56C 2QSDA 3VR9B 3KWVA 2J4XA 4YXDB 3TEWA 2ACZB 3NVWA 1NENB 2KAJA 4KGRA 2VZKD 1D5ZC 1JWUD 2JSVX 1I4PA 1A70A 1N5WA 3IAS1 3C8YA 1SE4A 4XDCA 2L52A 3NVVA 1C77A 2Z8LA 1P7EA 1IBXB 4ZRQA 1XLOA 3IXSA 4RNAA 4ZHPA 3MC0B 3T3NA 1ZDXA 1WXQA 1RFKA 1FFUA 1E7PB 4N58A 2GRIA 4UDUC 1TKYA 1XCQL 2WXJA 3ZYYX 2H88B 5C2TB 1YN5A 4B0MA 4HKZE 2W82A 4NJCA 1IBXA 3U7ZA 1FRRA 1DOIA 2JX5A 1FD6A 1MVKA 4JX1C 5BYSA 1SE2A 1GB1A 2JZPA 3VRBB 4OZCA 1EWCA 1I4HA 1D4BA 4D2KA 2E6XA 2WP9B 2RDHA 1E9MA 1JMLA 4USAA 1L0YB 4L23A 1JWAD 5BMHA 1IGDA 1BMLC 2B76B 4A90A 4LTUA 1TY0A 2WXRA 4EE2A 1LO5D 1J7CA 1MHXA 2BB5A 3P1MA 5BMGA 2BT6A 3ZJTA 1ZE3D 3SEBA 2WXOA 1E6EB 3Q8CA 1JRPA 2KDMA 1I4RA 5E6JA 2V4IB 4N6EB 3LYYA 3KQ4A 3FAHA 2SEBD 1N62A 3Q8FA 4RGOS 3R2TA 1N5XA 3E9SA 3AE5B 1IGCA 3EA6A 1ZUD2 1QF6A 1SSNA 1C78A 2BW2A 3P4RB 4OZAA 4XWTA 2N7JA 2PKOA 1ZXIA 4P6VF 4TQ1A 3TEYA 1FXAA 1J7BA 3W9CB 5G5HA 1F0ZA 1SBBB 1YNTE 2EELA 1PGBA 3AECB 2DBYA 3BIID 1WYGA 4YTMB 1FCLA 2G1EA 3P4PB 4NZLB 4IDIA 4MM3B 4MACA 1CQVA 3EGRA 1KF6B 3BVMA 3BVZA 4GLSC 1UUPA 2QIEB 4HRSA 5T8IA 1ACCA 2WXHA 3IAM1 3SFEB 3URYA 4C80A 4US9A 2Y3AA 1HQRD 1VDVA 4RGNA 4WAFA 2N0SB 2BS4B 3AE8B 1PGXA 2JWUA 1FXIA 4GDLB 4ZOHC 1I4QA 2IDYA 4ARIA 2M0AA 4DXFA 1FRDA 1V1OA 1TS5A 3J9CA 2CJOA 2CJNA 4RCOA 2K5PA 1QKZA 2KMMA 4CQNA 1AYFA 2IJ0A 1VZ6A 1UWMA 2BS3B 3AMZA 5H8YE 2WNMA 2WQYB 3ETRA 1E0ZA 2PIAA 1FIQA 1XEEA 1TY2A 1L0XB 1Y56A 2N9KA 4DQOC 1C4AA 5BYRA 1PYWD 4N59A 4NAWB 2NTSA 3VR8B 1ZXHA 1ZP0B 4WURA 1RM6C 1L4ZB 2JU6X 4XDDA 4IOIE 5HG2A 1AWDA 4TQ0A 4OHJA 4RGMA 2K9XA 1FMAD 2K0PA 2HTME 1QOAA 3O13A 2INNE 4C7YA 1SXTA 1K50A 1YJJA 1ZPSA 3P4SB 2JYEA 5GXGB 5MPOA 1QOGA 1FO4A 1I7HA 5D3IB 1QOBA 1SE3A 2DYOA 1TS4A 2M56B 3R8BA 3V3XA 1L6UA 1ROEA 2WDQB 2M19A 1N61A 2Y5PA 2NTTA 1F2RC 3NZ3A 3W1SA 4MT5A 2AQ1B 4J3OD 5AUIA 1D5XC 2BS2B 4A6QA 3AEAB 2LUMA 3P63A 3FILB 1KH0A 3P4QB 1C4CA 4AS1A 1M4VA 2AQ3B 3ABVB 4HROA 2R61A 1XLNA 2IGDA 5HI1A 1QQRA 2LEKA 1VLBA 1KLGD 1JW9D 4XE0A 3PO0A 3GB1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LXF A;  2WLB A;  3FAH A;  4JWS C;  2WU5 B;  1FM0 D;  1N62 A;  3AE3 B;  4ZHO A;  1N5X A;  4JWU C;  3DWG C;  1YQ3 B;  3AE5 B;  3AE4 B;  1SF0 A;  2MJE A;  1TYG B;  1ZUD 2;  2WU2 B;  1QF6 A;  1TJE A;  2W55 A;  3P4R B;  1DOY A;  3AN1 A;  2JQR B;  2PKO A;  2CU3 A;  3B2G A;  1ZXI A;  4P6V F;  3NVZ A;  1RWS A;  1FXA A;  4KX6 B;  1E10 A;  3W5U B;  1J7B A;  3HUI A;  3AEB B;  1OQR A;  2WS3 B;  3W9C B;  3WCQ A;  5G5H A;  5EE9 A;  1F0Z A;  3NVY A;  5EE0 A;  2W3S A;  3AEC B;  1OQQ A;  1JWB D;  2DBY A;  2H89 B;  1IUE A;  1WYG A;  3AED B;  3BII D;  4YTM B;  1L5P A;  1WGK A;  3HRD D;  3AE7 B;  2G1E A;  3L4P A;  3P4P B;  2L83 A;  4IDI A;  1PDX A;  5C3J B;  2WDR B;  4HRS A;  1KF6 B;  1QOF A;  2E3T A;  2QIE B;  5EE1 A;  1J7A A;  4YSY B;  1L0V B;  1WRI A;  3AEG B;  3SFE B;  4C80 A;  4YSX B;  1SB3 C;  4US9 A;  1DGJ A;  2FBW B;  3B9J A;  2DWQ A;  1L6V A;  3VR9 B;  1VDV A;  2Y5C A;  1YQ4 B;  4ITK A;  2MJD A;  1KFY B;  4YXD B;  2N0S B;  2ACZ B;  2BS4 B;  1NEN B;  2KAJ A;  2MH7 A;  3AE8 B;  3NVW A;  4WWM A;  1FXI A;  3SR6 A;  4ZOH C;  3AH7 A;  1KRH A;  2PVO D;  3CIR B;  1N5W A;  1A70 A;  1FRD A;  2L52 A;  3NVV A;  2CJO A;  2CJN A;  4FXC A;  2K5P A;  2KMM A;  1QT9 A;  4C7Z A;  1AYF A;  1B9R A;  1UWM A;  2BS3 B;  3AMZ A;  5EE3 A;  5H8Y E;  1SIJ A;  1CZP A;  1N63 A;  1XLO A;  1FFV A;  2WQY B;  3ETR A;  1E0Z A;  2PIA A;  1FIQ A;  1PFD A;  4ZHP A;  1GPX A;  2OHF A;  1OFF A;  3SFD B;  1WXQ A;  1RFK A;  1FFU A;  3KWL A;  1E7P B;  4N58 A;  3DWM A;  5H92 C;  3AE1 B;  3AB5 A;  4N59 A;  1R7S A;  1TKY A;  3AM9 A;  3LB8 C;  4YTP B;  3ZYY X;  2EKI A;  2H88 B;  5C2T B;  3NRZ A;  3VR8 B;  3NS1 A;  1NYR A;  1QLB B;  1ZP0 B;  3B2F A;  1FRR A;  1RM6 C;  1DOI A;  1NYQ A;  2JX5 A;  2W54 A;  1AWD A;  1VJK A;  4JX1 C;  1JAL A;  1FMA D;  2K9X A;  1GAQ B;  1JRO A;  2HTM E;  3VRB B;  1QOA A;  3AEE B;  4C7Y A;  3RPF C;  2AX5 A;  4YSZ B;  1V97 A;  2Q5W D;  1YJJ A;  3P4S B;  5MPO A;  2WP9 B;  5GXG B;  1QOG A;  1E9M A;  1N60 A;  1FO4 A;  4USA A;  1I7H A;  2PVG C;  3EUB 2;  1YJI A;  1RYJ A;  1QOB A;  2M56 B;  1JWA D;  4YT0 B;  1TKE A;  1PUT A;  2B76 B;  4WQM A;  4LTU A;  1TKG A;  1L6U A;  3W5V B;  1ROE A;  2WDQ B;  2K22 A;  2M19 A;  2WDV B;  4A9A A;  1N61 A;  1WWT A;  1XLP A;  1ZOY B;  3AE2 B;  3AV8 A;  1J7C A;  3HVZ A;  3CWI A;  1NEK B;  2QJL A;  3FC4 A;  3P1M A;  5AUI A;  2BT6 A;  2W3R A;  5G5G A;  2BS2 B;  3AEA B;  3VRA B;  1V8C A;  3P63 A;  3P4Q B;  2MJ3 A;  5AUK A;  4US8 A;  1E6E B;  1CJE A;  1JRP A;  1NI3 A;  3ABV B;  1DOX A;  3AE6 B;  1NVI D;  1XO3 A;  4HRO A;  3AE9 B;  4YTN B;  3AEF B;  1T3Q A;  1XLN A;  4N6E B;  2LEK A;  1VLB A;  1XLQ A;  1JW9 D;  1JQ4 A;  3PO0 A;  1EWY C; 
#chains in the Genus database with same CATH topology
 2LRW A;  3KUD B;  3CF6 E;  2WXL A;  3M3J A;  2WU5 B;  1WXS A;  2VH1 A;  5GMV A;  1BT0 A;  3B2G A;  2BKF A;  2K3U A;  4BFR A;  1OTR B;  2KJH B;  2KJR A;  2L7R A;  3RZF A;  1ISN A;  2X38 A;  3R66 C;  4P16 A;  1YJ1 A;  4NJ6 A;  2LGI A;  3DVG Y;  1JRU A;  2D2Q A;  4II3 B;  1MHH E;  3BK1 A;  2A5U A;  4Q2J A;  1YQ4 B;  1IP9 A;  4OVU A;  1SGH A;  2MH7 A;  4P1C C;  1I4X A;  2MP2 A;  1KRH A;  2QIL A;  3CIR B;  2XN9 C;  4JPS A;  1V81 A;  3H7P A;  3HHM A;  1FNW A;  2LXA A;  2I1J A;  1QT9 A;  4G3X B;  3APC A;  1CZP A;  2NVU I;  3I5J C;  1EU4 A;  3KH0 A;  1UF0 A;  4MGK E;  2Y5B B;  2WGS A;  3NS1 A;  4LJP B;  1NYQ A;  2LHE A;  2I2Y A;  5AEK B;  1HZ6 A;  2LJ5 A;  1CK1 A;  1QIL A;  3A33 B;  4HEA 1;  3HM3 A;  3L54 A;  3PRZ A;  4K3C A;  2FIF A;  3MHZ A;  1RYJ A;  3GP7 A;  3SD5 A;  2J42 A;  5D94 A;  3I3T B;  1TIF A;  4B95 A;  2BKR B;  3RNG C;  4HCP B;  4WJQ A;  2KQ7 A;  2NBU A;  4REZ A;  2G4S A;  5JXV A;  2IY1 B;  2MJ3 A;  2PPH A;  3QWZ B;  1NI3 A;  3ZTD A;  1WJ6 A;  1XO3 A;  2C7N B;  4ZRP A;  2PE6 B;  1WYW B;  3JVZ X;  1C76 A;  3WAM A;  3BIN A;  2KN4 A;  2QCZ A;  4FLH A;  2J53 A;  2IGH A;  1GOZ A;  2WS3 B;  2ZW0 A;  1UH6 A;  1IUE A;  3AED B;  5TR5 A;  3VQI A;  1EU3 A;  1WJU A;  4S0R A;  1V6E A;  1PGA A;  3RNF C;  1ENF A;  2FBW B;  2KKC A;  2Z0E B;  3PLV A;  1E5W A;  1SJE D;  4FXC A;  5J2R A;  1B9R A;  2WX1 A;  4GDK A;  1NDD A;  3MTN B;  2WXF A;  2L0F A;  3RFZ B;  3SFD B;  3KWL A;  3DBH B;  4I6P A;  3ZO5 B;  1WR1 A;  3AB5 A;  2EMS A;  3APD A;  1D5M C;  2C9W B;  4YTP B;  3BK2 A;  3B2F A;  2JWZ A;  4M0W A;  1MG8 A;  2NPT B;  1LXD A;  2TSS A;  3U4E G;  2LMC A;  5I4D A;  5L95 C;  2JZZ A;  1WXM A;  4W9K A;  1XD3 B;  2D5G A;  3DBS A;  3OLM D;  4R3D A;  5FR3 A;  5JHB A;  2O2V B;  2IBI B;  1D6E C;  4WWO A;  3DOW A;  2K22 A;  2WDV B;  5E6P A;  3AV8 A;  2N9L A;  2CS4 A;  3H7P B;  2IO1 B;  3TEX A;  3TSS A;  4IUM B;  4A3P A;  2JXT A;  1V8C A;  1MJD A;  3Q3N C;  1FNV A;  1CJE A;  3DCG A;  4W9G A;  1E7U A;  2LJI A;  5TSS A;  2INC C;  5BO4 B;  5D6J B;  2YLM A;  1L4D B;  1IYF A;  3U7D A;  2L3Z A;  4RMA A;  5HKH A;  1F77 A;  3PTF C;  3AN1 A;  4E71 A;  2CU3 A;  2NR2 A;  2WXQ A;  4ASW C;  1JWM D;  1CMX B;  2BYF A;  4L1B A;  1OQY A;  4B9K A;  1D3Z A;  3ZXV A;  4DXG A;  5IO9 A;  1R4N I;  1XCT L;  5C3J B;  3AEG B;  1WRI A;  4MSQ B;  1K52 A;  2LHD A;  1J19 A;  2RDB C;  2J4X A;  1RLF A;  2KAJ A;  2WHI A;  2VZK D;  3Q3M C;  1JWU D;  2JSV X;  1SE4 A;  3NVV A;  1C77 A;  1P7E A;  3DBH I;  3EHV A;  4HLE A;  1WJN A;  3L16 A;  2KOX A;  3MC0 B;  1WX8 A;  3T3N A;  5IOI A;  4HDO A;  4N58 A;  2KC2 A;  2GRI A;  4FBJ B;  4UDU C;  3TCA A;  2WXJ A;  5DPR A;  4JIO U;  3RYT A;  3M62 B;  3U7Z A;  1DOI A;  1ZKH A;  1WX9 A;  4S17 A;  3VRB B;  4OZC A;  3ECI A;  1I4H A;  2PEA A;  2KWV B;  3QQ8 B;  1WFY A;  4IM0 A;  4GGQ A;  4L23 A;  3QX1 A;  1T0Q C;  1RFA A;  2LVP A;  1LO5 D;  1T0S C;  1GG3 A;  1J7C A;  3VFK A;  1MHX A;  2BB5 A;  2BT6 A;  4BOS C;  4F1S A;  3ZJT A;  1KJT A;  3WIM A;  1E6E B;  1I4R A;  3ZIM A;  2I1K A;  4BOZ B;  1T0R C;  5IA7 A;  1WE7 A;  2DEN B;  3FAH A;  2MLB A;  4BKT A;  1N62 A;  3DBL I;  4PYU A;  4IG7 B;  1YQB A;  4PYZ A;  3Q14 C;  3NOB A;  1C78 A;  3ZXR A;  1GUA B;  3TEY A;  4P6V F;  1FXA A;  3ZRF A;  3W9C B;  1V86 A;  5G5H A;  1UBI A;  3PRP B;  2G1E A;  1KM7 A;  4MAC A;  1CQV A;  3EGR A;  2QIE B;  5IP4 D;  4BBN F;  3EEC A;  1HQR D;  3DHH C;  2N0S B;  3AE8 B;  1FXI A;  5DPS A;  4WWN A;  4ARI A;  2FNJ B;  2CJO A;  2CJN A;  4CQN A;  1AYF A;  2IJ0 A;  1UWM A;  2AL6 A;  2BS3 B;  5H8Y E;  4PS7 A;  2DZI A;  2WNM A;  2WQY B;  3PHX B;  3ZVV A;  2HJ8 A;  2FCM A;  2NTS A;  3X23 A;  3MC9 A;  4WUR A;  3AU5 A;  2JU6 X;  1TT5 B;  1Q0W B;  2IYD B;  3PS6 A;  4OHJ A;  3KYC D;  2K9X A;  1K50 A;  1YJJ A;  3P4S B;  2JYE A;  5GXG B;  1Y8R C;  1FO4 A;  2LVO A;  3DQV A;  1TS4 A;  2LI5 A;  3UF8 A;  2K39 A;  3VUX A;  2K1F A;  1SIF A;  2N7D A;  3JW0 X;  2BS2 B;  3CMM B;  3AEA B;  4TV3 A;  3P4Q B;  4W9C A;  2KYW A;  3Q6B A;  3RN9 C;  2BYV E;  1XLN A;  2LEK A;  1JW9 D;  4XZ4 A;  4XE0 A;  3GB1 A;  4JWS C;  4KZ0 A;  1L2N A;  2ZVN A;  4JWU C;  1YQ3 B;  3JYU A;  3ONS A;  1I4G A;  2W55 A;  3BZD B;  4K7W A;  3NVZ A;  1V9J A;  2JT4 B;  3W5U B;  3HUI A;  2N9E B;  2K8B A;  1GB4 A;  4BVU C;  2MEK A;  2W3S A;  1M94 A;  2JF5 A;  2QEJ C;  3ENE A;  3WAO A;  2CHZ A;  4W9J A;  2ZZP B;  1L0V B;  1V5O A;  4FAD A;  2M4N A;  4C00 A;  1TTN A;  1YMH E;  2KFK A;  4KSK C;  4MEM A;  1B1Z A;  2KT7 A;  2KK8 A;  3UIO B;  3UI3 A;  3V62 A;  1Q1O A;  1WM3 A;  4LDT B;  1OFF A;  1YX5 B;  5JHA A;  3W1Y A;  5H92 C;  1YN3 A;  4A8X C;  4A55 A;  1EO6 A;  2C7M B;  2EKI A;  3ZNH B;  1GC7 A;  1NYR A;  3DBL B;  2L00 B;  5D3D A;  2V3P A;  1WRD B;  2RPV A;  3IBE A;  1MG4 A;  4HWI B;  3UGB B;  1JRO A;  4MJS A;  3AEE B;  3QK0 A;  1R4M B;  3RNA C;  2IGG A;  1WMH A;  1A5R A;  2QHO A;  1Q10 A;  2K8C A;  1TKE A;  4MGY E;  3IVF A;  4PT5 A;  4LNK A;  1SEB D;  2GMI C;  3EC8 A;  1ZOY B;  2KVZ A;  1WGR A;  1AAR A;  3H8H A;  2ZPN A;  2AL3 A;  2M1M A;  2W3R A;  4FJY A;  4NQL B;  5AUK A;  5BMI A;  3ZDT A;  4W9F A;  3OJ4 B;  3Q2A C;  1UNS A;  2JZ3 B;  3DVN U;  3TUO A;  3V05 A;  3Q3F A;  2J0M A;  3LXF A;  1UWX A;  2X8X X;  3ZLZ A;  1I35 A;  2HD5 B;  1XT9 B;  3AE3 B;  3MJ5 A;  4WH4 A;  1DYQ A;  1FCC C;  3C19 A;  3AE4 B;  1GJZ A;  3WAN A;  2KNB A;  4HKQ A;  4W9L A;  3VHT C;  1FEH A;  2ONQ A;  3BYT B;  1T6B X;  4B6W A;  3AE7 B;  1WZ3 A;  1PDX A;  2NPT A;  2YVC A;  1J7A A;  4YWG G;  3E56 A;  2AQ2 B;  2KTF A;  2KLC A;  4TSS A;  4M00 A;  4DHJ B;  2O6V B;  2PVO D;  5DCN A;  1VZ7 A;  3W2D A;  2RDG A;  2WXP A;  1KLU D;  5CX3 A;  5D2M B;  1YN4 A;  1SIJ A;  2D07 B;  1FFV A;  3QA8 A;  1RAX A;  2DYB A;  4EZL A;  3Q8B A;  2WXN A;  3GS2 A;  1E90 A;  4FUL A;  3VXW A;  2QMT A;  3AM9 A;  1F2R I;  4KGS A;  3PVL A;  4K7S A;  3VTU A;  1VJK A;  3RNE C;  1LGR A;  3R7Q A;  4A3O A;  1UBQ A;  2GBK A;  5AZG A;  1KOT A;  2AX5 A;  3IT6 B;  2LGD A;  3OJ3 A;  3QIJ A;  2BF8 B;  1YJI A;  2IPK D;  4IKG A;  4YT0 B;  1WIA A;  3NJT A;  2DHZ A;  4WQM A;  1HZ5 A;  4A9A A;  4ZYS A;  4W9D A;  1YIW A;  1V49 A;  2QJL A;  3LDZ E;  4BBN C;  4MJS B;  5G5G A;  2BB6 A;  5IN7 A;  2V1Y A;  2D10 A;  3ZNZ B;  4WWP A;  1P98 A;  3KUC B;  4NAM A;  3RNB C;  3AE9 B;  1BXT A;  4URK A;  2ZEQ A;  4BKG A;  1HEZ E;  2FE8 A;  3VH4 B;  1V97 A;  3ZKJ C;  4OW0 A;  2N4F A;  3N9Y C;  1L7Y A;  1FNU A;  4EFO A;  4RM9 A;  4KVG B;  3V6E B;  2JQR B;  2OJR A;  1XXG A;  1UGJ A;  2PMV A;  3DDC B;  2RGF A;  5EE9 A;  5EDS A;  2KAC A;  2KAN A;  4RM8 A;  1K51 A;  4WIP A;  3H6N A;  1JWB D;  1WM2 A;  2MBO A;  2CKH B;  2L83 A;  1U4A A;  3ML9 A;  2KO3 A;  4RF0 A;  2W9N A;  3KVF B;  3FKY A;  2KWC A;  4AQ7 A;  5FKA C;  3ZJU A;  3VR9 B;  4ANU A;  4ZDV A;  2JXX A;  2ACZ B;  2L05 A;  3NVW A;  1D5Z C;  2LAS A;  2DAF A;  2UYZ B;  3TJP A;  1N5W A;  1F9J A;  4HVB A;  2J7Q B;  3DPD A;  2CHX A;  4GB9 A;  4ZRQ A;  3IXS A;  4RNA A;  4ZHP A;  2OOB B;  2MP2 B;  1RFK A;  2BPS A;  2M17 A;  1TKY A;  3ZYY X;  2ZCB A;  3PV1 A;  3ZRC A;  1YN5 A;  4HKZ E;  5DPT A;  4C4V A;  1HTQ A;  2JX5 A;  4HPP A;  4ZRK A;  3VTW A;  2C5L C;  4JX1 C;  5BYS A;  4EKU A;  2JZP A;  1E7V A;  4D2K A;  2B3A A;  1JML A;  4JL9 A;  1L0Y B;  2MA9 B;  4W9H A;  5BMH A;  4HCN B;  2B76 B;  3RCZ A;  2KFK B;  2UWQ A;  1TY0 A;  4EE2 A;  2KZR A;  3AXC A;  2D3B A;  4K81 A;  2LVQ A;  4AJW A;  2WYQ A;  1H4R A;  5KHO A;  1ZE3 D;  3SEB A;  2MCN B;  3ZNI D;  1G6J A;  2KTR A;  3RD2 A;  2KDM A;  2GBR A;  2KTR B;  2IO2 B;  2K6Q A;  3KQ4 A;  1WI0 A;  3Q8F A;  4BAX A;  2MX2 A;  3AE5 B;  2J0J A;  1IGC A;  1ZUD 2;  3ZUN A;  1SSN A;  3P4R B;  2PKO A;  1ZXI A;  5CHW A;  1F0Z A;  2ZCC A;  3VVW B;  2EEL A;  3A1Q A;  4XX5 A;  3AEC B;  4HPL B;  2DBY A;  3TMP B;  3L17 A;  1WYG A;  4YTM B;  1FCL A;  2JY6 A;  1T0Y A;  5T8I A;  1UUP A;  1ACC A;  3SFE B;  3ZW3 A;  3WA0 A;  2Y3A A;  4KZC A;  3A1Q B;  1P9D U;  3JSV B;  2BS4 B;  2G3Q B;  1PGX A;  2M0X A;  1V1O A;  1TS5 A;  3J9C A;  2K5P A;  2KMM A;  5J18 A;  2NS5 A;  1VZ6 A;  4IWO A;  1E0Z A;  4ICU A;  2NCN A;  1FIQ A;  1XEE A;  1L0X B;  1TBE A;  1C4A A;  4N59 A;  5CHV C;  4NAW B;  4BKS A;  3VR8 B;  4DK5 A;  1ZP0 B;  1L4Z B;  2KMA A;  4XDD A;  5HG2 A;  4RGM A;  2K0P A;  3PRM B;  3N1X C;  1QOA A;  4C7Y A;  1SXT A;  2D3C A;  1QOG A;  2BWE S;  5DPW A;  2LXC A;  4P7I A;  2WDQ B;  3MJW A;  2NTT A;  4XGA B;  2KJ6 A;  4MT5 A;  1FPY A;  4J3O D;  3C0R B;  2O6V A;  5AUI A;  4A6Q A;  1KH0 A;  1C4C A;  2KVR A;  4KIK B;  2DX5 B;  2VRR B;  2XK5 A;  1QQR A;  1KLG D;  3PO0 A;  5KHQ A;  2WLB A;  2GOW A;  3B08 A;  3PHW B;  2OJW A;  4O1N A;  3Q8E A;  2ZVO A;  1EF1 A;  2OED A;  3H7S A;  3RNC C;  1UZX B;  3AEB B;  2D11 A;  4GDL A;  3NVY A;  1J0G A;  2PTL A;  2H89 B;  1Q5W B;  4YL8 A;  2HDE A;  4IWP A;  4NPN A;  1QOF A;  3Q8A A;  1UGM A;  4EZJ A;  3KLS X;  1ZDV A;  1L6V A;  4ITK A;  3M95 A;  1AN8 A;  4WJN A;  3SR6 A;  1S3S G;  2J0K A;  1C79 A;  2YEP F;  4C7Z A;  3R2I A;  4LNI A;  4PS3 A;  3V60 A;  1GC6 A;  2GBM A;  2WXM A;  4RGT A;  2PW9 A;  2AYO B;  1R7S A;  4BZA A;  2KMC A;  1PQS A;  4CHK A;  4JQW C;  3SHQ A;  1V1P B;  2PLP A;  2KWD A;  4ANX A;  2Q5W D;  3RI7 C;  5LNK 1;  4NNJ B;  2N9X A;  1K53 A;  3Q3J A;  1EUV B;  1WZ0 A;  1ZW7 A;  1V80 A;  2N7E A;  1Z2M A;  1E8W A;  3AE2 B;  3HVZ A;  2FUG 1;  1TS3 A;  3GZN I;  1NEK B;  4EOY A;  5IAA C;  4B0E A;  2VH2 A;  4JLC A;  3GE8 C;  4KKI A;  4XWW A;  2IZV B;  1MPE A;  3QAQ A;  3PGE A;  1DOX A;  1NVI D;  4LNO A;  4IW0 A;  4A20 A;  4AUQ C;  4AP4 C;  3H1U A;  3R3M A;  5C1Z A;  3PRE A;  4KX6 B;  1OQR A;  3LJ3 A;  3N3K B;  1J8C A;  2D3G A;  1WGY A;  2N9P C;  4LNF A;  2DYM A;  3BWU D;  1AW7 A;  1HA5 A;  2XNA C;  4DHZ B;  1WGK A;  2KWU B;  5FR6 A;  2KC1 A;  1V5T A;  2KFJ A;  2E3T A;  4HXD A;  4I6N B;  2FCQ A;  2G9H D;  4MGZ E;  3A9K A;  3IHP C;  2VZK B;  1WGH A;  2MJD A;  3DBR I;  3PZ8 A;  4WWM A;  4H2A A;  3QJZ A;  5C23 A;  2KQ4 X;  3AH7 A;  4KGT A;  1HTO A;  3U2S C;  2BYE A;  3UIP B;  5EE3 A;  2NBV B;  2MWS B;  3DWM A;  3NS8 A;  1JWS D;  2V0G A;  3NRZ A;  2O6V D;  1QLB B;  2MBB B;  4KKJ A;  2ICI A;  1JCK B;  2W54 A;  4KDL B;  2BYT A;  2KDB A;  2PE9 A;  3P42 A;  2R2Q A;  1C9F A;  4FN2 A;  4MH0 E;  5HHD G;  1BUI C;  4WQO B;  1PUT A;  1EM7 A;  2EKE C;  2LFI A;  3W5V B;  2K8H A;  1WWT A;  2L1A A;  2XBB C;  1HE8 A;  3CWI A;  4IC7 B;  4G50 A;  1V1P A;  2SAK A;  1WY8 A;  5JZE B;  4US8 A;  4LDT D;  1WF9 A;  3AE6 B;  1C1Y B;  3V6C B;  5J17 A;  4E3C A;  1T3Q A;  2ZW1 A;  4GSW A;  1XQQ A;  2MQJ A;  2V3N A;  1TYG B;  4JE3 B;  2AEH A;  2ZNV B;  4MM3 A;  3AU4 A;  3UQA A;  5FK9 C;  3WCQ A;  4W9E A;  1MI0 A;  4RFB A;  2YEP B;  4DDI D;  2V3S A;  3I9V 1;  4KSL C;  2RPQ A;  1OQQ A;  3ZQ4 A;  3HRD D;  1WH3 A;  2ZPY A;  2O2V A;  3U52 E;  2XK5 B;  2Z59 B;  4YSX B;  2KN5 A;  2ON8 A;  3N30 A;  2QSD A;  4WJP A;  3KWV A;  4EUT A;  3TEW A;  4KGR A;  4G11 A;  1YX6 B;  2D3A A;  1I4P A;  3IAS 1;  3C8Y A;  2L52 A;  2KXJ A;  3Q3O C;  1IPG A;  2JUO A;  2CHW A;  4F8C B;  1WXQ A;  1TZ1 A;  2G45 B;  3PZD A;  4GU2 A;  2IND C;  2H88 B;  2HJ1 A;  4QAY A;  5C2T B;  4B0M A;  1FRR A;  5IKC M;  1FD6 A;  2DZJ A;  3QAR A;  1MVK A;  4E74 A;  3CST A;  1SE2 A;  1GB1 A;  5LXI B;  1EWC A;  2NBW B;  5CTR C;  2WP9 B;  4M01 A;  4G0N B;  4P1B C;  4DHZ E;  2BVC A;  1JWA D;  1BML C;  4A90 A;  4LTU A;  2IY0 B;  3DHI C;  2WXR A;  1N6Z A;  1K8R B;  4IM3 A;  2MW5 A;  3P1M A;  2WDT B;  3TIX A;  5G55 A;  4MDK E;  4M8N A;  3N1Y C;  2G4D B;  1I42 A;  3Q8C A;  1JRP A;  2GBJ A;  4N6E B;  4ICV A;  2LGS A;  3LYY A;  2MBH A;  2AWT A;  2SEB D;  4RGO S;  1YOV B;  3R2T A;  1N5X A;  2UU7 A;  3EA6 A;  1TGZ B;  1QF6 A;  4XWT A;  2N1W A;  4GN1 A;  4AWJ A;  1J7B A;  2KLG A;  3IFW B;  3VUW A;  1SBB B;  4DHJ D;  1PGB A;  4FA6 A;  3BII D;  4M8M A;  1C3T A;  4NZL B;  4MM3 B;  3L10 B;  3N1Z C;  2DNF A;  4DBG A;  4FHK A;  4US9 A;  3B0A A;  3TBL D;  1VDV A;  3A4R A;  4XC2 A;  2JRI B;  3PLU A;  4ZOH C;  2IDY A;  2M0A A;  1QKZ A;  3ML8 A;  2DAJ A;  2HE7 A;  3AMZ A;  3ETR A;  2PIA A;  1TY2 A;  1NBF C;  2FID A;  2KDF B;  1PYW D;  1E8Z A;  2RSU A;  3BY4 B;  1ZXH A;  1RM6 C;  4IOI E;  1WGD A;  3PPA A;  4MSM B;  2HTM E;  3O13 A;  2INN E;  4EEW A;  1ZPS A;  5MPO A;  3QC8 B;  1I7H A;  3X0W A;  5D3I B;  1QOB A;  4HK2 A;  3T9L A;  3V3X A;  4MGI E;  1L6U A;  1ROE A;  1LFD A;  3UIN B;  2Y5P A;  1F2R C;  4KV2 A;  4ANW A;  2AQ1 B;  2LUM A;  2GBN A;  3P2B A;  1P1A A;  1FXT B;  4AS1 A;  2AQ3 B;  3H9D A;  2KX0 A;  2R61 A;  2IGD A;  1VLB A;  1ZGU B;  4ZRI A;  2KD0 A;  1ESF A;  1WGG A;  1E8Y A;  1WMH B;  1FM0 D;  3EFU A;  5HFY A;  2V9H A;  3DWG C;  4LLG M;  1SF0 A;  2NMQ A;  1TJE A;  2GI9 A;  4J6I A;  1DOY A;  2QDF A;  3FIL A;  1E10 A;  3T3O A;  5EE0 A;  2RMM A;  4NY0 A;  2HTH A;  4OZB A;  4IM2 A;  3L4P A;  2R2O A;  3IT4 B;  4HJG E;  4WAA A;  4ZYN A;  1LQB A;  5EE1 A;  2KDI A;  4DWF A;  1EF5 A;  2MSE D;  3HK0 A;  3PT2 B;  1SB3 C;  3B9J A;  1P3Q U;  3V61 A;  1F52 A;  2Y5C A;  1KFY B;  4NJ7 A;  2JPH A;  2WXG A;  2N1V A;  4MEL A;  1OGW A;  1PFD A;  1GPX A;  3TL5 A;  3LB8 C;  5E6N A;  3K9O B;  4JGH B;  3CSF A;  1ET9 A;  3U8Z A;  1GAQ B;  3VDZ A;  2BTE A;  2L32 A;  1STE A;  1N60 A;  3UQB A;  3EUB 2;  4N9F 4;  3ZGZ A;  2LRU A;  3I57 A;  4TUU A;  4KIK A;  2ASQ A;  3MC8 A;  1VD2 A;  3DVG X;  4HPM B;  1WJ4 A;  4II2 B;  4MH8 A;  1F1H A;  4ZRJ A;  3FC4 A;  2IO0 B;  3ZDM C;  3VRA B;  4OVZ A;  1C4P A;  4YTN B;  3S2A A;  3RMK C;  2BQQ A;  3BVG A;  2C60 A;  1T5X D;  1VRA B;  4M02 A;  2GB1 A;  3SDL C;  4ARC A;  2MJE A;  2WU2 B;  5LXH A;  3DVN V;  3AI5 A;  2WWZ A;  3DHG C;  3OWE B;  5LLI A;  3HVD A;  3Q69 A;  3QCA A;  1X1M A;  1TS2 A;  1L5P A;  2MRP A;  3EFC A;  1KLV A;  3I63 C;  2ZJD A;  4YSY B;  2REX A;  2L76 A;  5L83 A;  2DWQ A;  3NUH B;  3GE3 C;  1VR9 A;  1P7F A;  1H8C A;  4HDQ A;  1E8X A;  1QZE A;  4RF1 A;  4TKN A;  4K3B A;  3NG0 A;  2J52 A;  1N63 A;  1TZO A;  4W9I A;  2OHF A;  2DLB A;  3BYY B;  2M8S A;  3L0W B;  4LK0 M;  3ZJV A;  3AE1 B;  2JYT A;  2WXK A;  2CU1 A;  2FCN A;  3PSE B;  2FCS A;  1VZ8 A;  1XF5 L;  1JAL A;  2MHJ A;  3NY5 A;  3RPF C;  3D32 A;  3IG3 A;  3JSV A;  4GDK B;  4HJK A;  4YSZ B;  4NAW A;  3QHT A;  2PVG C;  3MFG A;  1S1Q B;  1UEL A;  1SJH D;  1TKG A;  2EMT A;  3RT3 B;  1XLP A;  2GLS A;  3HIZ A;  5CHF A;  4XYC A;  3PZ7 A;  4PS8 A;  2L0T A;  2BBC A;  2RR9 A;  2K6D B;  2FUH B;  4M0W B;  3VUY A;  3VAW A;  4CYE A;  3AEF B;  3MP9 A;  3RUL A;  2Z0D B;  3U30 A;  1XLQ A;  3KYD D;  3ZTC A;  1JQ4 A;  1EWY C;  2INP E;  4X57 B;  1ET6 A;  3N32 A;  3TEZ A;  1WSP A;  2L8J A;  4ZHO A;  2LZ6 A;  2CR5 A;  3APF A;  1OEY J;  2WXI A;  1RWS A;  1HXY D;  1KTK A;  4ANV A;  1MFW A;  3L08 A;  3KW5 B;  1R4M I;  4F7Z A;  2I38 A;  4LJO B;  4GMV A;  2KX3 A;  5D7G A;  3GOE A;  5E6O A;  2WDR B;  3DBR B;  4RH6 A;  4L2Y A;  2KDE B;  5BYQ A;  4GOC A;  3A9J B;  4TMA B;  3B1L X;  1DGJ A;  4C56 C;  4EZK A;  4YXD B;  1NEN B;  2LWP A;  3GZN B;  4LNN A;  4K1R B;  1A70 A;  4XDC A;  2Z8L A;  1IBX B;  3A9J A;  3WAP A;  5AZH A;  1XLO A;  1NI2 A;  3M63 B;  4IWQ A;  4FHJ A;  2MBE A;  2KHW B;  3KUZ A;  1WX7 A;  2FAZ A;  4FJV B;  1ZDX A;  4BKS D;  1FFU A;  1E7P B;  1WXV A;  1XCQ L;  4K7U A;  2QC8 A;  4NJC A;  2W82 A;  1IBX A;  4FJZ A;  2WX0 A;  3AUL A;  1Z5S B;  4CO7 A;  2JVC A;  1D4B A;  3SU8 X;  2E6X A;  2RDH A;  1E9M A;  3K9P B;  4USA A;  1VCB A;  3WAL A;  1IGD A;  3NZS A;  3VTV A;  5BMG A;  2WXO A;  3OG5 A;  3L13 A;  4KDI C;  5E6J A;  2V4I B;  4DDG D;  1V2Y A;  1WR6 E;  4WJO A;  1SE9 A;  1P0R A;  2V4L A;  3E9S A;  1WE6 A;  1OEY A;  4OVV A;  2BW2 A;  4OZA A;  3A4S C;  2N7J A;  4DXA B;  3NHE B;  4TQ1 A;  1R4N B;  1YNT E;  2A4Z A;  3W1S C;  3ZNG C;  3P4P B;  4IDI A;  4GIV A;  4HRS A;  1KF6 B;  3BVM A;  3BVZ A;  4GLS C;  4C4V B;  2WXH A;  3URY A;  3IAM 1;  4C80 A;  3ALB A;  2C7H A;  3N20 C;  3OAW A;  4WAF A;  4RGN A;  4AOF A;  3A9K B;  2KQS A;  2PJH A;  3RZW C;  1UD7 A;  2JWU A;  2DZM A;  4GDL B;  2DZK A;  1I4Q A;  4DXF A;  1FRD A;  4RCO A;  2LGY A;  2LUE A;  1Y56 A;  2N9K A;  3HM6 X;  4DQO C;  1YD8 U;  5BYR A;  1RRB A;  4I6L B;  4ACF A;  5JH5 C;  3T8M A;  1WXA A;  3RUI B;  1GNU A;  4TQ0 A;  1AWD A;  3MHS D;  2XEW A;  1FMA D;  2JRH A;  4AJY B;  2LGX A;  5G2N A;  2BGF A;  1SE3 A;  2DYO A;  2RD0 A;  2M56 B;  3R8B A;  4GXB A;  4LCD E;  5AZF A;  2M19 A;  1N61 A;  3NZ3 A;  3W1S A;  3O65 B;  2IO3 B;  2MBQ A;  1D5X C;  2ZNV C;  4PK1 A;  3P63 A;  3FIL B;  2BWF A;  1M4V A;  2K25 A;  3ABV B;  4NQK E;  1LM8 B;  4HRO A;  2LD9 A;  5HI1 A;  3R7R A;  3VH3 B;  3NZU A; 
#chains in the Genus database with same CATH homology
 2WLB A;  1ESF A;  2WXL A;  4JWS C;  2WU5 B;  1FM0 D;  4O1N A;  5HFY A;  4JWU C;  3DWG C;  1YQ3 B;  3Q8E A;  4LLG M;  1SF0 A;  2NMQ A;  1I4G A;  2OED A;  1TJE A;  2GI9 A;  2W55 A;  3BZD B;  1DOY A;  3B2G A;  3FIL A;  3NVZ A;  1E10 A;  2K3U A;  3W5U B;  3HUI A;  3AEB B;  3T3O A;  3NVY A;  1GB4 A;  5EE0 A;  2RMM A;  2MEK A;  2W3S A;  4OZB A;  2PTL A;  2H89 B;  2QEJ C;  2X38 A;  4P16 A;  2HDE A;  3L4P A;  2LGI A;  3IT4 B;  4HJG E;  1QOF A;  5EE1 A;  1L0V B;  1MHH E;  3Q8A A;  3BK1 A;  1SB3 C;  3KLS X;  1ZDV A;  3B9J A;  1L6V A;  2Y5C A;  1YQ4 B;  4ITK A;  4Q2J A;  1KFY B;  1AN8 A;  3SR6 A;  2MH7 A;  1YMH E;  1I4X A;  2QIL A;  1KRH A;  1B1Z A;  2WXG A;  3CIR B;  2XN9 C;  1C79 A;  4JPS A;  2YEP F;  1FNW A;  3UI3 A;  4C7Z A;  1QT9 A;  3R2I A;  1CZP A;  1PFD A;  1GPX A;  1OFF A;  2WXM A;  4RGT A;  5H92 C;  1YN3 A;  2PW9 A;  4A8X C;  4A55 A;  1R7S A;  1EU4 A;  3LB8 C;  2EKI A;  3NS1 A;  1NYR A;  5D3D A;  2V3P A;  2LHE A;  1NYQ A;  1ET9 A;  2RPV A;  2I2Y A;  1HZ6 A;  1CK1 A;  1V1P B;  2PLP A;  1GAQ B;  1JRO A;  3AEE B;  1QIL A;  2BTE A;  2KWD A;  4HEA 1;  2Q5W D;  5LNK 1;  2L32 A;  2IGG A;  1STE A;  1N60 A;  3MHZ A;  1K53 A;  3EUB 2;  1RYJ A;  3GP7 A;  1Q10 A;  2J42 A;  3ZGZ A;  1TKE A;  4PT5 A;  3I57 A;  1SEB D;  3AE2 B;  1ZOY B;  3HVZ A;  2FUG 1;  1TS3 A;  3H8H A;  1NEK B;  4MH8 A;  3FC4 A;  4REZ A;  4B0E A;  2W3R A;  4KKI A;  5JXV A;  3VRA B;  4XWW A;  2MJ3 A;  5AUK A;  1MPE A;  5BMI A;  4OVZ A;  1C4P A;  1NI3 A;  1DOX A;  1NVI D;  1XO3 A;  4ZRP A;  1UNS A;  4YTN B;  3TUO A;  3BVG A;  3V05 A;  1T5X D;  3LXF A;  1UWX A;  1VRA B;  2GB1 A;  1C76 A;  3MJ5 A;  3AE3 B;  4WH4 A;  1DYQ A;  1FCC C;  4ARC A;  3AE4 B;  2MJE A;  2KN4 A;  2WU2 B;  4HKQ A;  2J53 A;  4KX6 B;  3OWE B;  2IGH A;  1GOZ A;  1OQR A;  2WS3 B;  2ZW0 A;  3HVD A;  3Q69 A;  1FEH A;  2DYM A;  2ONQ A;  3BYT B;  1T6B X;  3BWU D;  1AW7 A;  1HA5 A;  1IUE A;  2XNA C;  3AED B;  1TS2 A;  1L5P A;  1WGK A;  3VQI A;  1EU3 A;  3AE7 B;  1PDX A;  2E3T A;  1J7A A;  4YSY B;  4YWG G;  2G9H D;  1PGA A;  3E56 A;  1ENF A;  2AQ2 B;  2FBW B;  2VZK B;  2DWQ A;  3NUH B;  2MJD A;  1VR9 A;  3PZ8 A;  4WWM A;  4H2A A;  1P7F A;  2KQ4 X;  4TSS A;  3AH7 A;  2PVO D;  4KGT A;  1SJE D;  3U2S C;  1VZ7 A;  3W2D A;  4FXC A;  2RDG A;  2WXP A;  4RF1 A;  1KLU D;  1B9R A;  5EE3 A;  2J52 A;  1YN4 A;  1SIJ A;  1N63 A;  1TZO A;  1FFV A;  2WXF A;  2OHF A;  2DLB A;  3BYY B;  3Q8B A;  3SFD B;  3RFZ B;  3KWL A;  2WXN A;  4LK0 M;  3DWM A;  3GS2 A;  3AE1 B;  3ZJV A;  3AB5 A;  2JYT A;  2QMT A;  1D5M C;  3AM9 A;  4YTP B;  2WXK A;  1JWS D;  2V0G A;  3BK2 A;  1F2R I;  3NRZ A;  4KGS A;  1QLB B;  3B2F A;  4M0W A;  4KKJ A;  2ICI A;  1JCK B;  2W54 A;  2TSS A;  2BYT A;  1VJK A;  3U4E G;  1VZ8 A;  1XF5 L;  1JAL A;  2LMC A;  5I4D A;  3P42 A;  3RPF C;  2AX5 A;  3IT6 B;  4YSZ B;  4GDK B;  1C9F A;  2PVG C;  1YJI A;  2D5G A;  2IPK D;  3MFG A;  4IKG A;  5HHD G;  1BUI C;  4R3D A;  4YT0 B;  1PUT A;  1EM7 A;  5FR3 A;  4WQM A;  1SJH D;  1TKG A;  1HZ5 A;  1D6E C;  2LFI A;  3W5V B;  2K22 A;  2WDV B;  4A9A A;  1WWT A;  1XLP A;  3AV8 A;  2L1A A;  4ZYS A;  2N9L A;  3CWI A;  2QJL A;  3TEX A;  3TSS A;  3PZ7 A;  5G5G A;  2JXT A;  2BB6 A;  1V1P A;  2SAK A;  1V8C A;  1FNV A;  2BBC A;  4US8 A;  4NAM A;  1CJE A;  2LJI A;  3AE6 B;  5TSS A;  3AE9 B;  3AEF B;  1T3Q A;  2ZW1 A;  3MP9 A;  1BXT A;  1XLQ A;  1HEZ E;  2FE8 A;  1JQ4 A;  2INP E;  1V97 A;  1EWY C;  1ET6 A;  2V3N A;  4OW0 A;  1L4D B;  3TEZ A;  3N9Y C;  1WSP A;  4ZHO A;  1FNU A;  1TYG B;  4JE3 B;  1F77 A;  3AN1 A;  2JQR B;  2CU3 A;  2WXQ A;  1XXG A;  1UGJ A;  2WXI A;  5FK9 C;  1RWS A;  1HXY D;  2PMV A;  3WCQ A;  1JWM D;  1KTK A;  1MI0 A;  5EE9 A;  4RFB A;  2YEP B;  3I9V 1;  2KAC A;  4L1B A;  1K51 A;  4WIP A;  1OQQ A;  1JWB D;  3ZQ4 A;  2I38 A;  4DXG A;  3HRD D;  5D7G A;  2L83 A;  1XCT L;  5C3J B;  2WDR B;  4RF0 A;  4RH6 A;  3U52 E;  4L2Y A;  3AEG B;  1WRI A;  4YSX B;  5BYQ A;  1K52 A;  4AQ7 A;  4TMA B;  5FKA C;  1DGJ A;  2LHD A;  2ON8 A;  3ZJU A;  4C56 C;  2QSD A;  3VR9 B;  3KWV A;  2J4X A;  4YXD B;  3TEW A;  2ACZ B;  3NVW A;  1NEN B;  2KAJ A;  4KGR A;  2VZK D;  1D5Z C;  1JWU D;  2JSV X;  1I4P A;  1A70 A;  1N5W A;  3IAS 1;  3C8Y A;  1SE4 A;  4XDC A;  2L52 A;  3NVV A;  1C77 A;  2Z8L A;  1P7E A;  1IBX B;  4ZRQ A;  1XLO A;  3IXS A;  4RNA A;  4ZHP A;  3MC0 B;  3T3N A;  1ZDX A;  1WXQ A;  1RFK A;  1FFU A;  1E7P B;  4N58 A;  2GRI A;  4UDU C;  1TKY A;  1XCQ L;  2WXJ A;  3ZYY X;  2H88 B;  5C2T B;  1YN5 A;  4B0M A;  4HKZ E;  2W82 A;  4NJC A;  1IBX A;  3U7Z A;  1FRR A;  1DOI A;  2JX5 A;  1FD6 A;  1MVK A;  4JX1 C;  5BYS A;  1SE2 A;  1GB1 A;  2JZP A;  3VRB B;  4OZC A;  1EWC A;  1I4H A;  1D4B A;  4D2K A;  2E6X A;  2WP9 B;  2RDH A;  1E9M A;  1JML A;  4USA A;  1L0Y B;  4L23 A;  1JWA D;  5BMH A;  1IGD A;  1BML C;  2B76 B;  4A90 A;  4LTU A;  1TY0 A;  2WXR A;  4EE2 A;  1LO5 D;  1J7C A;  1MHX A;  2BB5 A;  3P1M A;  5BMG A;  2BT6 A;  3ZJT A;  1ZE3 D;  3SEB A;  2WXO A;  1E6E B;  3Q8C A;  1JRP A;  2KDM A;  1I4R A;  5E6J A;  2V4I B;  4N6E B;  3LYY A;  3KQ4 A;  3FAH A;  2SEB D;  1N62 A;  3Q8F A;  4RGO S;  3R2T A;  1N5X A;  3E9S A;  3AE5 B;  1IGC A;  3EA6 A;  1ZUD 2;  1QF6 A;  1SSN A;  1C78 A;  2BW2 A;  3P4R B;  4OZA A;  4XWT A;  2N7J A;  2PKO A;  1ZXI A;  4P6V F;  4TQ1 A;  3TEY A;  1FXA A;  1J7B A;  3W9C B;  5G5H A;  1F0Z A;  1SBB B;  1YNT E;  2EEL A;  1PGB A;  3AEC B;  2DBY A;  3BII D;  1WYG A;  4YTM B;  1FCL A;  2G1E A;  3P4P B;  4NZL B;  4IDI A;  4MM3 B;  4MAC A;  1CQV A;  3EGR A;  1KF6 B;  3BVM A;  3BVZ A;  4GLS C;  1UUP A;  2QIE B;  4HRS A;  5T8I A;  1ACC A;  2WXH A;  3IAM 1;  3SFE B;  3URY A;  4C80 A;  4US9 A;  2Y3A A;  1HQR D;  1VDV A;  4RGN A;  4WAF A;  2N0S B;  2BS4 B;  3AE8 B;  1PGX A;  2JWU A;  1FXI A;  4GDL B;  4ZOH C;  1I4Q A;  2IDY A;  4ARI A;  2M0A A;  4DXF A;  1FRD A;  1V1O A;  1TS5 A;  3J9C A;  2CJO A;  2CJN A;  4RCO A;  2K5P A;  1QKZ A;  2KMM A;  4CQN A;  1AYF A;  2IJ0 A;  1VZ6 A;  1UWM A;  2BS3 B;  3AMZ A;  5H8Y E;  2WNM A;  2WQY B;  3ETR A;  1E0Z A;  2PIA A;  1FIQ A;  1XEE A;  1TY2 A;  1L0X B;  1Y56 A;  2N9K A;  4DQO C;  1C4A A;  5BYR A;  1PYW D;  4N59 A;  4NAW B;  2NTS A;  3VR8 B;  1ZXH A;  1ZP0 B;  4WUR A;  1RM6 C;  1L4Z B;  2JU6 X;  4XDD A;  4IOI E;  5HG2 A;  1AWD A;  4TQ0 A;  4OHJ A;  4RGM A;  2K9X A;  1FMA D;  2K0P A;  2HTM E;  1QOA A;  3O13 A;  2INN E;  4C7Y A;  1SXT A;  1K50 A;  1YJJ A;  1ZPS A;  3P4S B;  2JYE A;  5GXG B;  5MPO A;  1QOG A;  1FO4 A;  1I7H A;  5D3I B;  1QOB A;  1SE3 A;  2DYO A;  1TS4 A;  2M56 B;  3R8B A;  3V3X A;  1L6U A;  1ROE A;  2WDQ B;  2M19 A;  1N61 A;  2Y5P A;  2NTT A;  1F2R C;  3NZ3 A;  3W1S A;  4MT5 A;  2AQ1 B;  4J3O D;  5AUI A;  1D5X C;  2BS2 B;  4A6Q A;  3AEA B;  2LUM A;  3P63 A;  3FIL B;  1KH0 A;  3P4Q B;  1C4C A;  4AS1 A;  1M4V A;  2AQ3 B;  3ABV B;  4HRO A;  2R61 A;  1XLN A;  2IGD A;  5HI1 A;  1QQR A;  2LEK A;  1VLB A;  1KLG D;  1JW9 D;  4XE0 A;  3PO0 A;  3GB1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...