3GE3C

Crystal structure of the reduced toluene 4-monooxygenase hd t201a mutant complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
83
structure length
83
Chain Sequence
SAFPVHAAFEKDFLVQLVVVDLNDSMDQVAEKVAYHCVNRRVAPREGVMRVRKHRSTELFPRDMTIAESGLNPTEVIDVVFEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Role for threonine 201 in the catalytic cycle of the soluble diiron hydroxylase toluene 4-monooxygenase.
pubmed doi rcsb
source organism Pseudomonas mendocina
molecule tags Oxidoreductase
molecule keywords Toluene-4-monooxygenase system protein A
total genus 25
structure length 83
sequence length 83
ec nomenclature ec 1.14.13.236: Toluene 4-monooxygenase.
pdb deposition date 2009-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 3ge3C00
3N1YC 3DHIC 3Q2AC 3RI7C 3GE8C 3Q14C 3DHHC 3Q3OC 3RNEC 3Q3NC 1T0SC 2INCC 3RMKC 3RNCC 2RDBC 3GE3C 3I63C 3DHGC 4P1CC 3I5JC 1T0QC 3N1XC 3Q3MC 3RNFC 3RNAC 3N20C 3RNBC 3RNGC 2INDC 1T0RC 3RN9C 3N1ZC 4P1BC
chains in the Genus database with same CATH superfamily
2EMSA 4YL8A 1FNVA 2MBQA 1CJEA 4NQKE 1HA5A 2KFKB 2DZJA 1C79A 4L2YA 2BKRB 2QHOA 2ZEQA 2Z59B 2JYTA 4REZA 4A90A 2ZZPB 2CR5A 2N9KA 2EKEC 4NNJB 3DWGC 3ZNHB 3X0WA 4MACA 4LJOB 5GXGB 4KIKB 1DYQA 2KVZA 3NRZA 1VZ7A 1T0SC 4WIPA 4B0EA 3MC9A 4IWOA 2L76A 4OHJA 3UQBA 3B08A 1TBEA 1V5TA 3H1UA 3H9DA 2V3NA 1XLQA 1BXTA 4ZRPA 4YSYB 3U4EG 5CHVC 3HK0A 1N62A 4II2B 1UBIA 1L0VB 3A9KA 4B95A 3B9JA 5C1ZA 2N4FA 3DBRB 3S2AA 4EFOA 4NAWB 2O6VB 4K3BA 2WX1A 3IT6B 2DYMA 3KVFB 2INNE 2JYEA 2M8SA 4MH8A 3AMZA 2WXMA 1JMLA 3HVDA 2K6QA 5L95C 2MBBB 3PHXB 2GBJA 3L08A 2LVPA 1ET9A 4US8A 1H8CA 1OEYA 3H7SA 1ZPSA 4G50A 2PIAA 2L05A 4A9AA 3AE7B 3DWMA 2X8XX 2JWUA 2KQ7A 3BK1A 4TMAB 4ANVA 3TMPB 3KUCB 1LM8B 3TIXA 2KAJA 1V2YA 4FLHA 1JWMD 2QCZA 3J9CA 2WS3B 2LRUA 2KTRB 4AQ7A 4FJZA 4AS1A 5HI1A 5J17A 2K3UA 2O6VD 2L8JA 4MGIE 2D5GA 1TS2A 1V9JA 1SXTA 2BT6A 3A1QB 3JSVA 4YWGG 5BYQA 1FO4A 1LO5D 1P7EA 1TKEA 5D3IB 2NBUA 2O2VA 2ZJDA 5EE1A 1T0QC 2D2QA 4W9DA 3P4QB 3QC8B 4WWMA 4IOIE 2J52A 4NAWA 2K8BA 3SFDB 1AARA 4W9LA 2AQ3B 2E6XA 2CKHB 1S3SG 2KWUB 3CWIA 2JPHA 5FKAC 1WMHA 3AEGB 2C7HA 4WWPA 4BAXA 2AQ2B 4BKTA 3WAPA 2D3CA 3WANA 2KT7A 1AYFA 2FNJB 2KOXA 3C8YA 2JF5A 2IO1B 1UWMA 3BIID 1HTQA 2AL6A 4JL9A 3ZYYX 3BINA 2ZVNA 3QARA 2KTRA 2IGHA 1J7BA 4KVGB 3WCQA 2RD0A 2FIDA 3RT3B 1EU4A 3B2GA 3MP9A 1RWSA 1SGHA 4HJKA 2VRRB 1YQ4B 4MELA 2DNFA 2V4IB 4LNFA 3W1YA 2FCSA 2RDHA 2PKOA 1HZ6A 2MJEA 1IYFA 1IPGA 2PEAA 4XX5A 4YXDB 3PRZA 2DX5B 3O65B 3ZIMA 1C4CA 1L0YB 1NDDA 2J42A 3A4RA 4GDLB 1BUIC 2JX5A 4KGSA 4JX1C 2IGDA 2CU3A 2IDYA 4M00A 2FCQA 4X57B 4P1BC 2KLGA 4JE3B 4BZAA 2MEKA 3OG5A 2BTEA 1QZEA 4LNIA 1KLVA 2INCC 3Q69A 2GBKA 4JLCA 1SEBD 3V6CB 3EFUA 3FAHA 1YX5B 4AJWA 5E6PA 2EELA 1QKZA 4WAAA 4XZ4A 2QMTA 3T3NA 4PT5A 1TKYA 4G0NB 2OJRA 5AUIA 4HCPB 4KX6B 3CSTA 2LGXA 2J4XA 1WGHA 2WNMA 1E9MA 2IGGA 3V62A 1SF0A 2LD9A 1XLNA 5J18A 2LWPA 4ICUA 5AZHA 4A20A 4BOSC 1RYJA 4OVZA 3ETRA 3JYUA 1WXSA 4NAMA 2NS5A 4ZRKA 3RN9C 1EO6A 1PFDA 1UWXA 3ZW3A 2WXHA 4K3CA 1ZE3D 3N1ZC 4PS3A 3A9JA 2M17A 2HD5B 3H7PA 4KZ0A 1F1HA 4MJSB 1TS5A 2L7RA 1I7HA 2BS3B 3KWLA 1I4QA 4YT0B 2L0FA 4RGTA 4N6EB 1C4PA 1IBXA 4KDLB 4W9JA 4YSZB 4JGHB 1ESFA 2Z8LA 3UGBB 3NS1A 2Z0EB 4BKSA 4JQWC 4EE2A 1M94A 3KWVA 3U30A 2CJNA 1OQRA 1E7VA 3OJ4B 3AULA 4NJCA 3JVZX 1PGAA 1E8YA 2D3GA 2CU1A 2IPKD 3SR6A 5BMHA 1S1QB 5HFYA 4BKSD 4P16A 4DXFA 1JQ4A 3FILB 1DOXA 1NI2A 2IO0B 4WURA 4URKA 2XK5B 4RCOA 4MEMA 2M19A 3VAWA 3QIJA 3Q14C 3P2BA 4ZHOA 2G45B 1ZW7A 2MJ3A 3T3OA 2WU2B 1I35A 1N63A 1V1PA 2EKIA 1HQRD 2QSDA 2KJHB 1FCLA 1Q10A 3AXCA 2Y5BB 1PGBA 2KC1A 3NG0A 1OTRB 1XT9B 4KDIC 3ZRCA 3AE6B 2KC2A 1LFDA 3RMKC 2N1WA 1KLGD 2RR9A 2K0PA 4A8XC 2KX0A 1I4HA 3I5JC 3U7DA 3HIZA 3PLVA 5BO4B 1C77A 1MPEA 2KX3A 2KMCA 2ZPNA 2MA9B 3NUHB 4E74A 2JY6A 2KDIA 1R4MB 1I4GA 2R61A 3V3XA 3OWEB 1A5RA 1PYWD 4TQ1A 1UNSA 4IKGA 1WSPA 3JSVB 5CX3A 1VZ6A 1T0RC 2W55A 2Y5PA 3B0AA 1WR1A 5GMVA 2IO2B 1ROEA 1FXAA 4W9IA 1FM0D 5IO9A 4K7SA 2HE7A 2JZPA 4IW0A 1EF1A 3ZDMC 2LRWA 2N0SB 3UF8A 4C4VB 1N61A 1GNUA 3P4PB 2ZW1A 2W54A 1ZDXA 2KMMA 2MP2A 2PE6B 1NYQA 3W5VB 3DBLB 4F1SA 3H8HA 3NZUA 1K52A 3QQ8B 2PJHA 3ZJVA 2ZNVB 1UZXB 4M8NA 1AN8A 2DYBA 1WXQA 2NTTA 3IXSA 1L2NA 3PV1A 4C56C 3N30A 2VH1A 3N9YC 1AW7A 3C0RB 4DHZE 3URYA 1CZPA 3ZNGC 2GMIC 2AEHA 3AEBB 2L00B 3MJWA 1L6VA 3BY4B 3AEFB 4KGRA 3AE2B 2FAZA 4W9EA 1C4AA 2W3SA 2TSSA 4US9A 2KDBA 1I4PA 4F8CB 3QJZA 5E6JA 2PLPA 5DPTA 3K9OB 1FNUA 3W1SC 5D94A 2G4SA 3UQAA 5KHOA 2QJLA 1QF6A 1DOYA 2BPSA 1C76A 1SB3C 2CHWA 4IG7B 2RGFA 2BYTA 4TSSA 2N9XA 3Q3OC 2IYDB 4GIVA 2KJ6A 4BKGA 3NVVA 1KH0A 1MG8A 3WIMA 1P98A 4HDOA 1JRPA 1WR6E 1QOGA 4NZLB 5JHAA 3PRPB 3SDLC 4Q2JA 2Z0DB 2MLBA 4ZHPA 1FPYA 2SAKA 3FILA 3AE9B 1UF0A 4OZBA 2LUEA 2FBWB 3TSSA 4RH6A 5BYSA 3PVLA 5LXHA 4MJSA 1QOBA 4NPNA 4RM9A 4E3CA 1F2RC 3AB5A 4NQLB 1NENB 4WJNA 1OQQA 1Z2MA 2LUMA 3N32A 1MI0A 4AWJA 4IDIA 4H2AA 2ON8A 1VCBA 4WJOA 1WJ6A 2WXFA 4LCDE 3AH7A 3I57A 5HG2A 2GB1A 3ALBA 5CTRC 2LHDA 5CHWA 1V81A 3KUDB 1FXTB 3R8BA 3ML8A 4LNOA 4M0WB 1JCKB 3VR9B 2BKFA 1ENFA 1E8WA 1WIAA 4MM3B 2BQQA 3IAS1 4C7ZA 3GZNB 1LQBA 4TKNA 1WX7A 3Q8FA 3Q8BA 1WRDB 2KKCA 3Q8AA 1NVID 2AYOB 4II3B 3L13A 1XF5L 5H8YE 4GGQA 1TJEA 2W82A 3GE3C 2IZVB 4ANUA 5CHFA 2WX0A 1MJDA 2EMTA 5C23A 3EUB2 2XK5A 2BF8B 2M1MA 2KDMA 1QOAA 2O2VB 4HPMB 1FIQA 2KDFB 2KQ4X 2BS2B 1EWYC 3DBSA 2WU5B 4FHKA 4YSXB 1D5MC 3W1SA 2KXJA 4HDQA 1TZOA 4I6NB 1SE2A 1UGJA 4CQNA 3HM3A 4OVVA 4A55A 3P63A 5DPSA 4EKUA 3GS2A 2DHZA 4CO7A 3K9PB 3PHWB 2L83A 2KNBA 2QILA 4L1BA 2N9PC 3NS8A 2BBCA 5LNK1 3ZGZA 3TEWA 4ARIA 2UU7A 2XN9C 3PT2B 1ZXHA 4YTPB 2H89B 3H6NA 4M0WA 3T9LA 1GC7A 3AECB 3WA0A 2ZNVC 1KLUD 4O1NA 3A9KB 3PO0A 3PZ7A 1V6EA 3RNFC 1R7SA 2WXNA 1YQBA 2B76B 2M0XA 2KANA 4AJYB 5DPRA 2JT4B 2WXIA 3IFWB 1E7PB 3AE1B 1SBBB 2IY0B 5HKHA 5G5HA 1GJZA 4W9HA 1UH6A 4MH0E 2NTSA 2KVRA 3PS6A 3VTUA 4GXBA 4FA6A 3E56A 2GRIA 1TY0A 2AWTA 4ICVA 1F2RI 3AM9A 4W9FA 5E6NA 4G3XB 2JRIB 3VRBB 3W9CB 2NBVB 1HZ5A 4XDDA 2RSUA 4XWTA 1MFWA 3NOBA 2LFIA 2OHFA 3R7QA 1GUAB 4RMAA 1ZGUB 2WGSA 1D6EC 1YJJA 3WALA 1TT5B 4GDLA 3RZWC 1V49A 1JW9D 2BB5A 3APFA 1F9JA 2J0MA 2KACA 1YOVB 1EF5A 1N5XA 3RUIB 3ENEA 4E71A 5IP4D 3PPAA 2KD0A 2QC8A 2KFKA 5G55A 3PZ8A 3VUYA 5BMIA 1P7FA 4XE0A 3UINB 1WZ3A 1XEEA 2FIFA 3AEAB 3KLSX 1WI0A 3L10B 4K7UA 1HTOA 3APCA 1J7CA 4ITKA 4M01A 2G4DB 2DZIA 3DBHI 3AI5A 3LJ3A 1WXMA 4LJPB 3PZDA 2WXOA 4DK5A 1ISNA 2I2YA 4XDCA 4P6VF 1Q1OA 1VD2A 3C19A 2BB6A 2G3QB 1ZUD2 2K6DB 2DENB 4GU2A 5H92C 2KWVB 2BW2A 4AOFA 1YD8U 2JWZA 2JXXA 1RAXA 4BBNC 1K50A 2WYQA 4GLSC 1YIWA 3EECA 4N9F4 3SFEB 1K51A 2QIEB 3P4SB 4HWIB 2JVCA 4EUTA 1SIJA 1EUVB 1VZ8A 2HJ8A 2ZCCA 3PRMB 2BVCA 3RNEC 4KKIA 1WZ0A 5AUKA 1WJNA 4JWSC 1N6ZA 1AWDA 2LI5A 3R2TA 1NI3A 5IKCM 5I4DA 2ACZB 3AEDB 2O6VA 3ZJUA 4GN1A 1V5OA 1C78A 2JRHA 2LHEA 4MT5A 4K1RB 3ZNID 2RPQA 1U4AA 3L17A 3AU5A 4HVBA 2MHJA 1VR9A 2MP2B 4PYUA 2R2OA 2YEPF 2A4ZA 4HEA1 5D3DA 1L0XB 3NVZA 3HM6X 2NPTB 3T8MA 1MHXA 2W3RA 2CHXA 3QK0A 1VRAB 3PREA 3N3KB 2MX2A 4DBGA 2V3SA 3LYYA 3P1MA 3Q3NC 1PDXA 4W9CA 2GBRA 2AX5A 5C2TB 1TIFA 2ZCBA 3AV8A 2JZ3B 1IUEA 4MM3A 2J0JA 3Q2AC 3EA6A 3DBHB 1WGRA 1Q5WB 2LVQA 4WQOB 4RFBA 2N1VA 3ABVB 3L4PA 4WJQA 1TGZB 5J2RA 2N9LA 1HE8A 5D6JB 1SE4A 2LXCA 3UIPB 4DDGD 1WH3A 1TZ1A 2MBEA 1T3QA 2L0TA 2WXJA 4KSKC 5AZFA 4RF1A 2VZKB 1B9RA 5IAAC 1G6JA 2G1EA 3DQVA 1V8CA 1NEKB 3DDCB 4NY0A 1D5XC 1OEYJ 1GB1A 4IWQA 4ZYSA 4ASWC 3MHSD 4NJ7A 3VH3B 2FUG1 3OLMD 4IM2A 2WWZA 1H4RA 4I6LB 4JIOU 3JW0X 5DPWA 1WGKA 2J53A 4B0MA 4HKZE 3RFZB 4EZJA 4LLGM 1WJUA 4ZYNA 2M56B 3KW5B 2Y5CA 3NZ3A 3TJPA 2BGFA 2L32A 1SE9A 2MRPA 3W2DA 1YN3A 1WGDA 4DDID 2KDEB 4MSQB 1WY8A 4HCNB 2OJWA 1XCTL 2WXPA 5MPOA 4FJYA 3VHTC 3EGRA 1WGGA 1RFKA 1T6BX 5JXVA 3MFGA 4K7WA 3KYCD 4W9KA 2WHIA 1D4BA 3PLUA 1E8ZA 2BYVE 1XXGA 5HHDG 3RNAC 1YJIA 3QAQA 4M8MA 4LNNA 4FN2A 1E0ZA 1WX9A 1RRBA 3BK2A 3NY5A 3PGEA 4DXAB 4WH4A 3U2SC 2PVOD 3RPFC 4FJVB 4OW0A 3A4SC 4KIKA 1YX6B 4GOCA 4MGYE 1TTNA 3AEEB 1P0RA 1PQSA 2K5PA 5TSSA 3VTWA 1EU3A 2K25A 2HJ1A 2MH7A 3CMMB 3ZJTA 1SJHD 1WF9A 2RMMA 4ZDVA 3PSEB 5BMGA 2KQSA 4ANXA 3A9JB 4HK2A 4RF0A 4IWPA 4P1CC 1FMAD 3RNBC 2DYOA 2MJDA 1CK1A 2WDTB 4IM0A 4DHZB 3B1LX 1XD3B 3NVYA 1HXYD 3GE8C 4RGOS 3DVGX 3B2FA 5FK9C 3APDA 1RM6C 2DWQA 4ZOHC 2ZW0A 2K8HA 3DCGA 1WM3A 2KYWA 4LTUA 3QX1A 2INDC 3EHVA 2A5UA 5T8IA 4GDKB 3MC0B 4A3PA 3M62B 3BYYB 4ZRQA 1KM7A 4JWUC 1YN5A 2IO3B 1FXIA 2WXGA 1E90A 1FEHA 1E8XA 2LASA 3TEYA 2IJ0A 1F0ZA 1WJ4A 2PTLA 3VRAB 1LGRA 2MBHA 2C5LC 2DLBA 3KYDD 1UD7A 4QAYA 2DAFA 3BWUD 3L16A 1WX8A 2LJ5A 4I6PA 1KTKA 1UELA 1J8CA 2VZKD 3M63B 1GB4A 4BBNF 2C7MB 3DVNU 3ZXRA 3O13A 2KJRA 3TEZA 5BYRA 2JQRB 2WXRA 2DZMA 1Y56A 1E6EB 2DBYA 1L6UA 2LVOA 4DHJB 2N7EA 1R4MI 1ZKHA 1Y8RC 1V1OA 2WXKA 1WXAA 2IY1B 4PS8A 5LXIB 3R7RA 1MVKA 1WMHB 3V6EB 3VUWA 4B6WA 3VVWB 1BT0A 2AL3A 2D07B 3A33B 4LDTD 3I63C 4FXCA 2MWSB 5D2MB 2NBWB 2L3ZA 2PW9A 1XLPA 2NMQA 1SJED 3TCAA 1E5WA 3VTVA 4USAA 2L1AA 3L54A 1YMHE 1OQYA 1F77A 3HHMA 3TBLD 1JWUD 2BWFA 4HLEA 2CS4A 2KK8A 3P4RB 3MHZA 3MC8A 1ZDVA 3UIOB 3CIRB 3VUXA 3IVFA 2LGYA 4ACFA 4HKQA 4C7YA 2JXTA 1Q0WB 4MGKE 2KO3A 2PVGC 2NPTA 1L7YA 4C00A 4J3OD 3FC4A 3GP7A 2M4NA 1UBQA 2PE9A 5AEKB 2KZRA 2G9HD 3LXFA 3D32A 4N58A 3CF6E 4KV2A 1D5ZC 3HRDD 1TS3A 2WXLA 2NVUI 4A3OA 3R2IA 2BS4B 2E3TA 1GC6A 3SHQA 3DOWA 1STEA 1WGYA 3RD2A 3AU4A 2REXA 2GI9A 2INPE 4TV3A 3RULA 2YVCA 3NZSA 1YJ1A 4KSLC 4TUUA 2GBMA 1T5XD 1XCQL 2MQJA 2CJOA 2C7NB 2BYFA 2LZ6A 1MHHE 3V61A 4IUMB 1WYGA 4LDTB 2N7JA 2WDRB 3BYTB 1Z5SB 3AE4B 4IM3A 4MGZE 1KRHA 3RZFA 4NJ6A 3FKYA 2HTME 4FULA 3ZUNA 3V05A 4LNKA 3U7ZA 1FCCC 5IA7A 5LLIA 3E9SA 2LGSA 1N5WA 2K8CA 3Q3JA 3AE3B 2FUHB 3NVWA 3BVGA 5D7GA 4HPLB 3NJTA 4MSMB 1WE6A 1ACCA 4CYEA 3Q3FA 1JWBD 3OJ3A 1RFAA 2GOWA 1L4ZB 4PS7A 2JUOA 2IBIB 1P3QU 3HUIA 4A6QA 1SIFA 2V4LA 2K39A 2GLSA 5KHQA 4BVUC 1CMXB 2BYEA 2HTHA 3ZTCA 4IC7B 4DXGA 2ASQA 4XGAB 4YTMB 3SD5A 1M4VA 2D3BA 1TYGB 3IG3A 1FRDA 4W9GA 1UGMA 2NR2A 1E10A 2MBOA 4C80A 4C4VA 5G2NA 3TEXA 3BVZA 3ZKJC 2D3AA 3RNCC 1A70A 3R3MA 4WAFA 4ARCA 2WP9B 4K81A 4HRSA 3GOEA 5C3JB 2K22A 1BMLC 4PK1A 1V86A 1TS4A 3DBRI 1JWAD 5TR5A 1QQRA 5IN7A 4XC2A 1VJKA 2KFJA 3M95A 2MCNB 3RI7C 4FBJB 2WQYB 1X1MA 2I1KA 1K53A 2UWQA 2RDBC 2N7DA 3EFCA 3EC8A 4GB9A 5DCNA 4N59A 3ML9A 3ZRFA 2ZVOA 4EZLA 1IGCA 5EE0A 1OFFA 3N20C 4G11A 2H88B 2V3PA 2XNAC 1EM7A 5EE3A 1I42A 2X38A 3GB1A 4ZRJA 1KFYB 1YQ3B 1FRRA 3IAM1 2SEBD 5FR6A 1GAQB 3LB8C 1XLOA 4DHJD 2PPHA 2LJIA 3V60A 4S0RA 1J0GA 1QT9A 2KN4A 3GZNI 3M3JA 3VH4B 2VH2A 4HJGE 3LDZE 1GOZA 2UYZB 1CQVA 1B1ZA 4AP4C 3CSFA 3KUZA 2HDEA 3IBEA 1PGXA 1WWTA 3QHTA 4FADA 3ZDTA 4KGTA 3ZNZB 3I9V1 1T0YA 1WE7A 4EOYA 2BWES 2WDVB 3AN1A 4HROA 2DAJA 4AUQC 3RCZA 1WM2A 2KLCA 1J19A 1MG4A 2JSVX 2LEKA 2XEWA 1NBFC 3KH0A 2GBNA 4P7IA 2NCNA 5FR3A 3ZO5B 3DHHC 1L5PA 4GDKA 2KHWB 4EEWA 4JPSA 1YNTE 3UI3A 4S17A 1FNWA 1IGDA 2LXAA 2CHZA 1V80A 3RNGC 3SU8X 1J7AA 2K9XA 3SEBA 1GPXA 4KZCA 3IHPC 1L4DB 2WDQB 1ZXIA 2B3AA 2LMCA 2YEPB 1IBXB 1FFUA 2FCMA 1ZP0B 1C3TA 2KWDA 2D10A 4M02A 1V1PB 3W5UB 3ZVVA 4OZCA 4HXDA 2KTFA 2C9WB 1FD6A 1I4XA 3N1XC 1TY2A 1ZOYB 1JALA 4LK0M 2AQ1B 3R66C 5E6OA 2XBBC 1V97A 3DVGY 1VDVA 2LGDA 3I3TB 3QA8A 1HEZE 1QLBB 2KWCA 1QILA 3TUOA 1I4RA 3TL5A 4GSWA 1E7UA 3MTNB 1R4NB 4DQOC 1PUTA 3AE5B 1P9DU 1YN4A 3AE8B 3VFKA 3WAMA 1XQQA 1VLBA 2R2QA 1JROA 2PMVA 4L23A 2OOBB 4RNAA 3U52E 2FE8A 1NYRA 2K1FA 3BZDB 5EDSA 2DZKA 4WQMA 4FHJA 4F7ZA 3DHGC 4WWOA 2J7QB 5JZEB 3Q3MC 3ONSA 5AZGA 3Q6BA 1N60A 4PYZA 1C9FA 5EE9A 3DVNV 1JWSD 2C60A 3QWZB 2JU6X 4OZAA 3N1YC 3VR8B 1KF6B 2FCNA 2QDFA 3VDZA 2W9NA 3U8ZA 2I1JA 1TKGA 4HPPA 1DGJA 2YLMA 3DPDA 2L52A 3ZQ4A 1QOFA 2ZPYA 2MSED 4WWNA 1WXVA 3HVZA 1GG3A 2Q5WD 2RDGA 1OGWA 4GMVA 3Q8CA 1ET6A 3Q8EA 2N9EB 2LGIA 4XWWA 1D3ZA 2M0AA 2I38A 3VXWA 3WAOA 1F52A 4CHKA 3DBLI 4KKJA 2V0GA 2ICIA 2V9HA 5IOIA 1JRUA 2J0KA 1SSNA 1WYWB 1WFYA 3ECIA 2OEDA 3X23A 4YTNB 2V1YA 1K8RB 1DOIA 1IP9A 2WLBA 1KJTA 5JHBA 3BVMA 4R3DA 3PTFC 2QEJC 4TQ0A 2KN5A 4OVUA 3MJ5A 4DWFA 3P42A 1C1YB 1KOTA 2WXQA 3ZXVA 1LXDA 1SE3A 4MDKE 4RGMA 2KMAA 2ONQA 4J6IA 5L83A 4RGNA 4ANWA 5G5GA 4BFRA 1R4NI 3DHIC 3RYTA 1XO3A 4XYCA 3QCAA 2MW5A 3OAWA 4BOZB 1P1AA 1WRIA 2D11A 3NHEB 1FFVA 3L0WB 3VQIA 2JZZA 4B9KA 5JH5C 3H7PB 4EZKA 2Y3AA 3A1QA 3KQ4A 4UDUC 3IT4B 4ZRIA 3ZTDA 4WJPA 4D2KA 1UUPA 4RM8A 1RLFA 3ZLZA 1EWCA 2RPVA
chains in the Genus database with same CATH topology
3N1YC 3DHIC 3Q2AC 3RI7C 3GE8C 3Q14C 3DHHC 3Q3OC 3RNEC 3Q3NC 1T0SC 2INCC 3RMKC 3RNCC 2RDBC 3GE3C 3I63C 3DHGC 4P1CC 3I5JC 1T0QC 3N1XC 3Q3MC 3RNFC 3RNAC 3N20C 3RNBC 3RNGC 2INDC 1T0RC 3RN9C 3N1ZC 4P1BC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N1Y C;  3DHI C;  3Q2A C;  3RI7 C;  3GE8 C;  3Q14 C;  3DHH C;  3Q3O C;  3RNE C;  3Q3N C;  1T0S C;  2INC C;  3RMK C;  3RNC C;  2RDB C;  3GE3 C;  3I63 C;  3DHG C;  4P1C C;  3I5J C;  1T0Q C;  3N1X C;  3Q3M C;  3RNF C;  3RNA C;  3N20 C;  3RNB C;  3RNG C;  2IND C;  1T0R C;  3RN9 C;  3N1Z C;  4P1B C; 
#chains in the Genus database with same CATH topology
 2EMS A;  4YL8 A;  1FNV A;  2MBQ A;  1CJE A;  4NQK E;  1HA5 A;  2KFK B;  2DZJ A;  1C79 A;  4L2Y A;  2BKR B;  2QHO A;  2ZEQ A;  2Z59 B;  2JYT A;  4REZ A;  4A90 A;  2ZZP B;  2CR5 A;  2N9K A;  2EKE C;  4NNJ B;  3DWG C;  3ZNH B;  3X0W A;  4MAC A;  4LJO B;  5GXG B;  4KIK B;  1DYQ A;  2KVZ A;  3NRZ A;  1VZ7 A;  1T0S C;  4WIP A;  4B0E A;  3MC9 A;  4IWO A;  2L76 A;  4OHJ A;  3UQB A;  3B08 A;  1TBE A;  1V5T A;  3H1U A;  3H9D A;  2V3N A;  1XLQ A;  1BXT A;  4ZRP A;  4YSY B;  3U4E G;  5CHV C;  3HK0 A;  1N62 A;  4II2 B;  1UBI A;  1L0V B;  3A9K A;  4B95 A;  3B9J A;  5C1Z A;  2N4F A;  3DBR B;  3S2A A;  4EFO A;  4NAW B;  2O6V B;  4K3B A;  2WX1 A;  3IT6 B;  2DYM A;  3KVF B;  2INN E;  2JYE A;  2M8S A;  4MH8 A;  3AMZ A;  2WXM A;  1JML A;  3HVD A;  2K6Q A;  5L95 C;  2MBB B;  3PHX B;  2GBJ A;  3L08 A;  2LVP A;  1ET9 A;  4US8 A;  1H8C A;  1OEY A;  3H7S A;  1ZPS A;  4G50 A;  2PIA A;  2L05 A;  4A9A A;  3AE7 B;  3DWM A;  2X8X X;  2JWU A;  2KQ7 A;  3BK1 A;  4TMA B;  4ANV A;  3TMP B;  3KUC B;  1LM8 B;  3TIX A;  2KAJ A;  1V2Y A;  4FLH A;  1JWM D;  2QCZ A;  3J9C A;  2WS3 B;  2LRU A;  2KTR B;  4AQ7 A;  4FJZ A;  4AS1 A;  5HI1 A;  5J17 A;  2K3U A;  2O6V D;  2L8J A;  4MGI E;  2D5G A;  1TS2 A;  1V9J A;  1SXT A;  2BT6 A;  3A1Q B;  3JSV A;  4YWG G;  5BYQ A;  1FO4 A;  1LO5 D;  1P7E A;  1TKE A;  5D3I B;  2NBU A;  2O2V A;  2ZJD A;  5EE1 A;  1T0Q C;  2D2Q A;  4W9D A;  3P4Q B;  3QC8 B;  4WWM A;  4IOI E;  2J52 A;  4NAW A;  2K8B A;  3SFD B;  1AAR A;  4W9L A;  2AQ3 B;  2E6X A;  2CKH B;  1S3S G;  2KWU B;  3CWI A;  2JPH A;  5FKA C;  1WMH A;  3AEG B;  2C7H A;  4WWP A;  4BAX A;  2AQ2 B;  4BKT A;  3WAP A;  2D3C A;  3WAN A;  2KT7 A;  1AYF A;  2FNJ B;  2KOX A;  3C8Y A;  2JF5 A;  2IO1 B;  1UWM A;  3BII D;  1HTQ A;  2AL6 A;  4JL9 A;  3ZYY X;  3BIN A;  2ZVN A;  3QAR A;  2KTR A;  2IGH A;  1J7B A;  4KVG B;  3WCQ A;  2RD0 A;  2FID A;  3RT3 B;  1EU4 A;  3B2G A;  3MP9 A;  1RWS A;  1SGH A;  4HJK A;  2VRR B;  1YQ4 B;  4MEL A;  2DNF A;  2V4I B;  4LNF A;  3W1Y A;  2FCS A;  2RDH A;  2PKO A;  1HZ6 A;  2MJE A;  1IYF A;  1IPG A;  2PEA A;  4XX5 A;  4YXD B;  3PRZ A;  2DX5 B;  3O65 B;  3ZIM A;  1C4C A;  1L0Y B;  1NDD A;  2J42 A;  3A4R A;  4GDL B;  1BUI C;  2JX5 A;  4KGS A;  4JX1 C;  2IGD A;  2CU3 A;  2IDY A;  4M00 A;  2FCQ A;  4X57 B;  4P1B C;  2KLG A;  4JE3 B;  4BZA A;  2MEK A;  3OG5 A;  2BTE A;  1QZE A;  4LNI A;  1KLV A;  2INC C;  3Q69 A;  2GBK A;  4JLC A;  1SEB D;  3V6C B;  3EFU A;  3FAH A;  1YX5 B;  4AJW A;  5E6P A;  2EEL A;  1QKZ A;  4WAA A;  4XZ4 A;  2QMT A;  3T3N A;  4PT5 A;  1TKY A;  4G0N B;  2OJR A;  5AUI A;  4HCP B;  4KX6 B;  3CST A;  2LGX A;  2J4X A;  1WGH A;  2WNM A;  1E9M A;  2IGG A;  3V62 A;  1SF0 A;  2LD9 A;  1XLN A;  5J18 A;  2LWP A;  4ICU A;  5AZH A;  4A20 A;  4BOS C;  1RYJ A;  4OVZ A;  3ETR A;  3JYU A;  1WXS A;  4NAM A;  2NS5 A;  4ZRK A;  3RN9 C;  1EO6 A;  1PFD A;  1UWX A;  3ZW3 A;  2WXH A;  4K3C A;  1ZE3 D;  3N1Z C;  4PS3 A;  3A9J A;  2M17 A;  2HD5 B;  3H7P A;  4KZ0 A;  1F1H A;  4MJS B;  1TS5 A;  2L7R A;  1I7H A;  2BS3 B;  3KWL A;  1I4Q A;  4YT0 B;  2L0F A;  4RGT A;  4N6E B;  1C4P A;  1IBX A;  4KDL B;  4W9J A;  4YSZ B;  4JGH B;  1ESF A;  2Z8L A;  3UGB B;  3NS1 A;  2Z0E B;  4BKS A;  4JQW C;  4EE2 A;  1M94 A;  3KWV A;  3U30 A;  2CJN A;  1OQR A;  1E7V A;  3OJ4 B;  3AUL A;  4NJC A;  3JVZ X;  1PGA A;  1E8Y A;  2D3G A;  2CU1 A;  2IPK D;  3SR6 A;  5BMH A;  1S1Q B;  5HFY A;  4BKS D;  4P16 A;  4DXF A;  1JQ4 A;  3FIL B;  1DOX A;  1NI2 A;  2IO0 B;  4WUR A;  4URK A;  2XK5 B;  4RCO A;  4MEM A;  2M19 A;  3VAW A;  3QIJ A;  3Q14 C;  3P2B A;  4ZHO A;  2G45 B;  1ZW7 A;  2MJ3 A;  3T3O A;  2WU2 B;  1I35 A;  1N63 A;  1V1P A;  2EKI A;  1HQR D;  2QSD A;  2KJH B;  1FCL A;  1Q10 A;  3AXC A;  2Y5B B;  1PGB A;  2KC1 A;  3NG0 A;  1OTR B;  1XT9 B;  4KDI C;  3ZRC A;  3AE6 B;  2KC2 A;  1LFD A;  3RMK C;  2N1W A;  1KLG D;  2RR9 A;  2K0P A;  4A8X C;  2KX0 A;  1I4H A;  3I5J C;  3U7D A;  3HIZ A;  3PLV A;  5BO4 B;  1C77 A;  1MPE A;  2KX3 A;  2KMC A;  2ZPN A;  2MA9 B;  3NUH B;  4E74 A;  2JY6 A;  2KDI A;  1R4M B;  1I4G A;  2R61 A;  3V3X A;  3OWE B;  1A5R A;  1PYW D;  4TQ1 A;  1UNS A;  4IKG A;  1WSP A;  3JSV B;  5CX3 A;  1VZ6 A;  1T0R C;  2W55 A;  2Y5P A;  3B0A A;  1WR1 A;  5GMV A;  2IO2 B;  1ROE A;  1FXA A;  4W9I A;  1FM0 D;  5IO9 A;  4K7S A;  2HE7 A;  2JZP A;  4IW0 A;  1EF1 A;  3ZDM C;  2LRW A;  2N0S B;  3UF8 A;  4C4V B;  1N61 A;  1GNU A;  3P4P B;  2ZW1 A;  2W54 A;  1ZDX A;  2KMM A;  2MP2 A;  2PE6 B;  1NYQ A;  3W5V B;  3DBL B;  4F1S A;  3H8H A;  3NZU A;  1K52 A;  3QQ8 B;  2PJH A;  3ZJV A;  2ZNV B;  1UZX B;  4M8N A;  1AN8 A;  2DYB A;  1WXQ A;  2NTT A;  3IXS A;  1L2N A;  3PV1 A;  4C56 C;  3N30 A;  2VH1 A;  3N9Y C;  1AW7 A;  3C0R B;  4DHZ E;  3URY A;  1CZP A;  3ZNG C;  2GMI C;  2AEH A;  3AEB B;  2L00 B;  3MJW A;  1L6V A;  3BY4 B;  3AEF B;  4KGR A;  3AE2 B;  2FAZ A;  4W9E A;  1C4A A;  2W3S A;  2TSS A;  4US9 A;  2KDB A;  1I4P A;  4F8C B;  3QJZ A;  5E6J A;  2PLP A;  5DPT A;  3K9O B;  1FNU A;  3W1S C;  5D94 A;  2G4S A;  3UQA A;  5KHO A;  2QJL A;  1QF6 A;  1DOY A;  2BPS A;  1C76 A;  1SB3 C;  2CHW A;  4IG7 B;  2RGF A;  2BYT A;  4TSS A;  2N9X A;  3Q3O C;  2IYD B;  4GIV A;  2KJ6 A;  4BKG A;  3NVV A;  1KH0 A;  1MG8 A;  3WIM A;  1P98 A;  4HDO A;  1JRP A;  1WR6 E;  1QOG A;  4NZL B;  5JHA A;  3PRP B;  3SDL C;  4Q2J A;  2Z0D B;  2MLB A;  4ZHP A;  1FPY A;  2SAK A;  3FIL A;  3AE9 B;  1UF0 A;  4OZB A;  2LUE A;  2FBW B;  3TSS A;  4RH6 A;  5BYS A;  3PVL A;  5LXH A;  4MJS A;  1QOB A;  4NPN A;  4RM9 A;  4E3C A;  1F2R C;  3AB5 A;  4NQL B;  1NEN B;  4WJN A;  1OQQ A;  1Z2M A;  2LUM A;  3N32 A;  1MI0 A;  4AWJ A;  4IDI A;  4H2A A;  2ON8 A;  1VCB A;  4WJO A;  1WJ6 A;  2WXF A;  4LCD E;  3AH7 A;  3I57 A;  5HG2 A;  2GB1 A;  3ALB A;  5CTR C;  2LHD A;  5CHW A;  1V81 A;  3KUD B;  1FXT B;  3R8B A;  3ML8 A;  4LNO A;  4M0W B;  1JCK B;  3VR9 B;  2BKF A;  1ENF A;  1E8W A;  1WIA A;  4MM3 B;  2BQQ A;  3IAS 1;  4C7Z A;  3GZN B;  1LQB A;  4TKN A;  1WX7 A;  3Q8F A;  3Q8B A;  1WRD B;  2KKC A;  3Q8A A;  1NVI D;  2AYO B;  4II3 B;  3L13 A;  1XF5 L;  5H8Y E;  4GGQ A;  1TJE A;  2W82 A;  3GE3 C;  2IZV B;  4ANU A;  5CHF A;  2WX0 A;  1MJD A;  2EMT A;  5C23 A;  3EUB 2;  2XK5 A;  2BF8 B;  2M1M A;  2KDM A;  1QOA A;  2O2V B;  4HPM B;  1FIQ A;  2KDF B;  2KQ4 X;  2BS2 B;  1EWY C;  3DBS A;  2WU5 B;  4FHK A;  4YSX B;  1D5M C;  3W1S A;  2KXJ A;  4HDQ A;  1TZO A;  4I6N B;  1SE2 A;  1UGJ A;  4CQN A;  3HM3 A;  4OVV A;  4A55 A;  3P63 A;  5DPS A;  4EKU A;  3GS2 A;  2DHZ A;  4CO7 A;  3K9P B;  3PHW B;  2L83 A;  2KNB A;  2QIL A;  4L1B A;  2N9P C;  3NS8 A;  2BBC A;  5LNK 1;  3ZGZ A;  3TEW A;  4ARI A;  2UU7 A;  2XN9 C;  3PT2 B;  1ZXH A;  4YTP B;  2H89 B;  3H6N A;  4M0W A;  3T9L A;  1GC7 A;  3AEC B;  3WA0 A;  2ZNV C;  1KLU D;  4O1N A;  3A9K B;  3PO0 A;  3PZ7 A;  1V6E A;  3RNF C;  1R7S A;  2WXN A;  1YQB A;  2B76 B;  2M0X A;  2KAN A;  4AJY B;  5DPR A;  2JT4 B;  2WXI A;  3IFW B;  1E7P B;  3AE1 B;  1SBB B;  2IY0 B;  5HKH A;  5G5H A;  1GJZ A;  4W9H A;  1UH6 A;  4MH0 E;  2NTS A;  2KVR A;  3PS6 A;  3VTU A;  4GXB A;  4FA6 A;  3E56 A;  2GRI A;  1TY0 A;  2AWT A;  4ICV A;  1F2R I;  3AM9 A;  4W9F A;  5E6N A;  4G3X B;  2JRI B;  3VRB B;  3W9C B;  2NBV B;  1HZ5 A;  4XDD A;  2RSU A;  4XWT A;  1MFW A;  3NOB A;  2LFI A;  2OHF A;  3R7Q A;  1GUA B;  4RMA A;  1ZGU B;  2WGS A;  1D6E C;  1YJJ A;  3WAL A;  1TT5 B;  4GDL A;  3RZW C;  1V49 A;  1JW9 D;  2BB5 A;  3APF A;  1F9J A;  2J0M A;  2KAC A;  1YOV B;  1EF5 A;  1N5X A;  3RUI B;  3ENE A;  4E71 A;  5IP4 D;  3PPA A;  2KD0 A;  2QC8 A;  2KFK A;  5G55 A;  3PZ8 A;  3VUY A;  5BMI A;  1P7F A;  4XE0 A;  3UIN B;  1WZ3 A;  1XEE A;  2FIF A;  3AEA B;  3KLS X;  1WI0 A;  3L10 B;  4K7U A;  1HTO A;  3APC A;  1J7C A;  4ITK A;  4M01 A;  2G4D B;  2DZI A;  3DBH I;  3AI5 A;  3LJ3 A;  1WXM A;  4LJP B;  3PZD A;  2WXO A;  4DK5 A;  1ISN A;  2I2Y A;  4XDC A;  4P6V F;  1Q1O A;  1VD2 A;  3C19 A;  2BB6 A;  2G3Q B;  1ZUD 2;  2K6D B;  2DEN B;  4GU2 A;  5H92 C;  2KWV B;  2BW2 A;  4AOF A;  1YD8 U;  2JWZ A;  2JXX A;  1RAX A;  4BBN C;  1K50 A;  2WYQ A;  4GLS C;  1YIW A;  3EEC A;  4N9F 4;  3SFE B;  1K51 A;  2QIE B;  3P4S B;  4HWI B;  2JVC A;  4EUT A;  1SIJ A;  1EUV B;  1VZ8 A;  2HJ8 A;  2ZCC A;  3PRM B;  2BVC A;  3RNE C;  4KKI A;  1WZ0 A;  5AUK A;  1WJN A;  4JWS C;  1N6Z A;  1AWD A;  2LI5 A;  3R2T A;  1NI3 A;  5IKC M;  5I4D A;  2ACZ B;  3AED B;  2O6V A;  3ZJU A;  4GN1 A;  1V5O A;  1C78 A;  2JRH A;  2LHE A;  4MT5 A;  4K1R B;  3ZNI D;  2RPQ A;  1U4A A;  3L17 A;  3AU5 A;  4HVB A;  2MHJ A;  1VR9 A;  2MP2 B;  4PYU A;  2R2O A;  2YEP F;  2A4Z A;  4HEA 1;  5D3D A;  1L0X B;  3NVZ A;  3HM6 X;  2NPT B;  3T8M A;  1MHX A;  2W3R A;  2CHX A;  3QK0 A;  1VRA B;  3PRE A;  3N3K B;  2MX2 A;  4DBG A;  2V3S A;  3LYY A;  3P1M A;  3Q3N C;  1PDX A;  4W9C A;  2GBR A;  2AX5 A;  5C2T B;  1TIF A;  2ZCB A;  3AV8 A;  2JZ3 B;  1IUE A;  4MM3 A;  2J0J A;  3Q2A C;  3EA6 A;  3DBH B;  1WGR A;  1Q5W B;  2LVQ A;  4WQO B;  4RFB A;  2N1V A;  3ABV B;  3L4P A;  4WJQ A;  1TGZ B;  5J2R A;  2N9L A;  1HE8 A;  5D6J B;  1SE4 A;  2LXC A;  3UIP B;  4DDG D;  1WH3 A;  1TZ1 A;  2MBE A;  1T3Q A;  2L0T A;  2WXJ A;  4KSK C;  5AZF A;  4RF1 A;  2VZK B;  1B9R A;  5IAA C;  1G6J A;  2G1E A;  3DQV A;  1V8C A;  1NEK B;  3DDC B;  4NY0 A;  1D5X C;  1OEY J;  1GB1 A;  4IWQ A;  4ZYS A;  4ASW C;  3MHS D;  4NJ7 A;  3VH3 B;  2FUG 1;  3OLM D;  4IM2 A;  2WWZ A;  1H4R A;  4I6L B;  4JIO U;  3JW0 X;  5DPW A;  1WGK A;  2J53 A;  4B0M A;  4HKZ E;  3RFZ B;  4EZJ A;  4LLG M;  1WJU A;  4ZYN A;  2M56 B;  3KW5 B;  2Y5C A;  3NZ3 A;  3TJP A;  2BGF A;  2L32 A;  1SE9 A;  2MRP A;  3W2D A;  1YN3 A;  1WGD A;  4DDI D;  2KDE B;  4MSQ B;  1WY8 A;  4HCN B;  2OJW A;  1XCT L;  2WXP A;  5MPO A;  4FJY A;  3VHT C;  3EGR A;  1WGG A;  1RFK A;  1T6B X;  5JXV A;  3MFG A;  4K7W A;  3KYC D;  4W9K A;  2WHI A;  1D4B A;  3PLU A;  1E8Z A;  2BYV E;  1XXG A;  5HHD G;  3RNA C;  1YJI A;  3QAQ A;  4M8M A;  4LNN A;  4FN2 A;  1E0Z A;  1WX9 A;  1RRB A;  3BK2 A;  3NY5 A;  3PGE A;  4DXA B;  4WH4 A;  3U2S C;  2PVO D;  3RPF C;  4FJV B;  4OW0 A;  3A4S C;  4KIK A;  1YX6 B;  4GOC A;  4MGY E;  1TTN A;  3AEE B;  1P0R A;  1PQS A;  2K5P A;  5TSS A;  3VTW A;  1EU3 A;  2K25 A;  2HJ1 A;  2MH7 A;  3CMM B;  3ZJT A;  1SJH D;  1WF9 A;  2RMM A;  4ZDV A;  3PSE B;  5BMG A;  2KQS A;  4ANX A;  3A9J B;  4HK2 A;  4RF0 A;  4IWP A;  4P1C C;  1FMA D;  3RNB C;  2DYO A;  2MJD A;  1CK1 A;  2WDT B;  4IM0 A;  4DHZ B;  3B1L X;  1XD3 B;  3NVY A;  1HXY D;  3GE8 C;  4RGO S;  3DVG X;  3B2F A;  5FK9 C;  3APD A;  1RM6 C;  2DWQ A;  4ZOH C;  2ZW0 A;  2K8H A;  3DCG A;  1WM3 A;  2KYW A;  4LTU A;  3QX1 A;  2IND C;  3EHV A;  2A5U A;  5T8I A;  4GDK B;  3MC0 B;  4A3P A;  3M62 B;  3BYY B;  4ZRQ A;  1KM7 A;  4JWU C;  1YN5 A;  2IO3 B;  1FXI A;  2WXG A;  1E90 A;  1FEH A;  1E8X A;  2LAS A;  3TEY A;  2IJ0 A;  1F0Z A;  1WJ4 A;  2PTL A;  3VRA B;  1LGR A;  2MBH A;  2C5L C;  2DLB A;  3KYD D;  1UD7 A;  4QAY A;  2DAF A;  3BWU D;  3L16 A;  1WX8 A;  2LJ5 A;  4I6P A;  1KTK A;  1UEL A;  1J8C A;  2VZK D;  3M63 B;  1GB4 A;  4BBN F;  2C7M B;  3DVN U;  3ZXR A;  3O13 A;  2KJR A;  3TEZ A;  5BYR A;  2JQR B;  2WXR A;  2DZM A;  1Y56 A;  1E6E B;  2DBY A;  1L6U A;  2LVO A;  4DHJ B;  2N7E A;  1R4M I;  1ZKH A;  1Y8R C;  1V1O A;  2WXK A;  1WXA A;  2IY1 B;  4PS8 A;  5LXI B;  3R7R A;  1MVK A;  1WMH B;  3V6E B;  3VUW A;  4B6W A;  3VVW B;  1BT0 A;  2AL3 A;  2D07 B;  3A33 B;  4LDT D;  3I63 C;  4FXC A;  2MWS B;  5D2M B;  2NBW B;  2L3Z A;  2PW9 A;  1XLP A;  2NMQ A;  1SJE D;  3TCA A;  1E5W A;  3VTV A;  4USA A;  2L1A A;  3L54 A;  1YMH E;  1OQY A;  1F77 A;  3HHM A;  3TBL D;  1JWU D;  2BWF A;  4HLE A;  2CS4 A;  2KK8 A;  3P4R B;  3MHZ A;  3MC8 A;  1ZDV A;  3UIO B;  3CIR B;  3VUX A;  3IVF A;  2LGY A;  4ACF A;  4HKQ A;  4C7Y A;  2JXT A;  1Q0W B;  4MGK E;  2KO3 A;  2PVG C;  2NPT A;  1L7Y A;  4C00 A;  4J3O D;  3FC4 A;  3GP7 A;  2M4N A;  1UBQ A;  2PE9 A;  5AEK B;  2KZR A;  2G9H D;  3LXF A;  3D32 A;  4N58 A;  3CF6 E;  4KV2 A;  1D5Z C;  3HRD D;  1TS3 A;  2WXL A;  2NVU I;  4A3O A;  3R2I A;  2BS4 B;  2E3T A;  1GC6 A;  3SHQ A;  3DOW A;  1STE A;  1WGY A;  3RD2 A;  3AU4 A;  2REX A;  2GI9 A;  2INP E;  4TV3 A;  3RUL A;  2YVC A;  3NZS A;  1YJ1 A;  4KSL C;  4TUU A;  2GBM A;  1T5X D;  1XCQ L;  2MQJ A;  2CJO A;  2C7N B;  2BYF A;  2LZ6 A;  1MHH E;  3V61 A;  4IUM B;  1WYG A;  4LDT B;  2N7J A;  2WDR B;  3BYT B;  1Z5S B;  3AE4 B;  4IM3 A;  4MGZ E;  1KRH A;  3RZF A;  4NJ6 A;  3FKY A;  2HTM E;  4FUL A;  3ZUN A;  3V05 A;  4LNK A;  3U7Z A;  1FCC C;  5IA7 A;  5LLI A;  3E9S A;  2LGS A;  1N5W A;  2K8C A;  3Q3J A;  3AE3 B;  2FUH B;  3NVW A;  3BVG A;  5D7G A;  4HPL B;  3NJT A;  4MSM B;  1WE6 A;  1ACC A;  4CYE A;  3Q3F A;  1JWB D;  3OJ3 A;  1RFA A;  2GOW A;  1L4Z B;  4PS7 A;  2JUO A;  2IBI B;  1P3Q U;  3HUI A;  4A6Q A;  1SIF A;  2V4L A;  2K39 A;  2GLS A;  5KHQ A;  4BVU C;  1CMX B;  2BYE A;  2HTH A;  3ZTC A;  4IC7 B;  4DXG A;  2ASQ A;  4XGA B;  4YTM B;  3SD5 A;  1M4V A;  2D3B A;  1TYG B;  3IG3 A;  1FRD A;  4W9G A;  1UGM A;  2NR2 A;  1E10 A;  2MBO A;  4C80 A;  4C4V A;  5G2N A;  3TEX A;  3BVZ A;  3ZKJ C;  2D3A A;  3RNC C;  1A70 A;  3R3M A;  4WAF A;  4ARC A;  2WP9 B;  4K81 A;  4HRS A;  3GOE A;  5C3J B;  2K22 A;  1BML C;  4PK1 A;  1V86 A;  1TS4 A;  3DBR I;  1JWA D;  5TR5 A;  1QQR A;  5IN7 A;  4XC2 A;  1VJK A;  2KFJ A;  3M95 A;  2MCN B;  3RI7 C;  4FBJ B;  2WQY B;  1X1M A;  2I1K A;  1K53 A;  2UWQ A;  2RDB C;  2N7D A;  3EFC A;  3EC8 A;  4GB9 A;  5DCN A;  4N59 A;  3ML9 A;  3ZRF A;  2ZVO A;  4EZL A;  1IGC A;  5EE0 A;  1OFF A;  3N20 C;  4G11 A;  2H88 B;  2V3P A;  2XNA C;  1EM7 A;  5EE3 A;  1I42 A;  2X38 A;  3GB1 A;  4ZRJ A;  1KFY B;  1YQ3 B;  1FRR A;  3IAM 1;  2SEB D;  5FR6 A;  1GAQ B;  3LB8 C;  1XLO A;  4DHJ D;  2PPH A;  2LJI A;  3V60 A;  4S0R A;  1J0G A;  1QT9 A;  2KN4 A;  3GZN I;  3M3J A;  3VH4 B;  2VH2 A;  4HJG E;  3LDZ E;  1GOZ A;  2UYZ B;  1CQV A;  1B1Z A;  4AP4 C;  3CSF A;  3KUZ A;  2HDE A;  3IBE A;  1PGX A;  1WWT A;  3QHT A;  4FAD A;  3ZDT A;  4KGT A;  3ZNZ B;  3I9V 1;  1T0Y A;  1WE7 A;  4EOY A;  2BWE S;  2WDV B;  3AN1 A;  4HRO A;  2DAJ A;  4AUQ C;  3RCZ A;  1WM2 A;  2KLC A;  1J19 A;  1MG4 A;  2JSV X;  2LEK A;  2XEW A;  1NBF C;  3KH0 A;  2GBN A;  4P7I A;  2NCN A;  5FR3 A;  3ZO5 B;  3DHH C;  1L5P A;  4GDK A;  2KHW B;  4EEW A;  4JPS A;  1YNT E;  3UI3 A;  4S17 A;  1FNW A;  1IGD A;  2LXA A;  2CHZ A;  1V80 A;  3RNG C;  3SU8 X;  1J7A A;  2K9X A;  3SEB A;  1GPX A;  4KZC A;  3IHP C;  1L4D B;  2WDQ B;  1ZXI A;  2B3A A;  2LMC A;  2YEP B;  1IBX B;  1FFU A;  2FCM A;  1ZP0 B;  1C3T A;  2KWD A;  2D10 A;  4M02 A;  1V1P B;  3W5U B;  3ZVV A;  4OZC A;  4HXD A;  2KTF A;  2C9W B;  1FD6 A;  1I4X A;  3N1X C;  1TY2 A;  1ZOY B;  1JAL A;  4LK0 M;  2AQ1 B;  3R66 C;  5E6O A;  2XBB C;  1V97 A;  3DVG Y;  1VDV A;  2LGD A;  3I3T B;  3QA8 A;  1HEZ E;  1QLB B;  2KWC A;  1QIL A;  3TUO A;  1I4R A;  3TL5 A;  4GSW A;  1E7U A;  3MTN B;  1R4N B;  4DQO C;  1PUT A;  3AE5 B;  1P9D U;  1YN4 A;  3AE8 B;  3VFK A;  3WAM A;  1XQQ A;  1VLB A;  2R2Q A;  1JRO A;  2PMV A;  4L23 A;  2OOB B;  4RNA A;  3U52 E;  2FE8 A;  1NYR A;  2K1F A;  3BZD B;  5EDS A;  2DZK A;  4WQM A;  4FHJ A;  4F7Z A;  3DHG C;  4WWO A;  2J7Q B;  5JZE B;  3Q3M C;  3ONS A;  5AZG A;  3Q6B A;  1N60 A;  4PYZ A;  1C9F A;  5EE9 A;  3DVN V;  1JWS D;  2C60 A;  3QWZ B;  2JU6 X;  4OZA A;  3N1Y C;  3VR8 B;  1KF6 B;  2FCN A;  2QDF A;  3VDZ A;  2W9N A;  3U8Z A;  2I1J A;  1TKG A;  4HPP A;  1DGJ A;  2YLM A;  3DPD A;  2L52 A;  3ZQ4 A;  1QOF A;  2ZPY A;  2MSE D;  4WWN A;  1WXV A;  3HVZ A;  1GG3 A;  2Q5W D;  2RDG A;  1OGW A;  4GMV A;  3Q8C A;  1ET6 A;  3Q8E A;  2N9E B;  2LGI A;  4XWW A;  1D3Z A;  2M0A A;  2I38 A;  3VXW A;  3WAO A;  1F52 A;  4CHK A;  3DBL I;  4KKJ A;  2V0G A;  2ICI A;  2V9H A;  5IOI A;  1JRU A;  2J0K A;  1SSN A;  1WYW B;  1WFY A;  3ECI A;  2OED A;  3X23 A;  4YTN B;  2V1Y A;  1K8R B;  1DOI A;  1IP9 A;  2WLB A;  1KJT A;  5JHB A;  3BVM A;  4R3D A;  3PTF C;  2QEJ C;  4TQ0 A;  2KN5 A;  4OVU A;  3MJ5 A;  4DWF A;  3P42 A;  1C1Y B;  1KOT A;  2WXQ A;  3ZXV A;  1LXD A;  1SE3 A;  4MDK E;  4RGM A;  2KMA A;  2ONQ A;  4J6I A;  5L83 A;  4RGN A;  4ANW A;  5G5G A;  4BFR A;  1R4N I;  3DHI C;  3RYT A;  1XO3 A;  4XYC A;  3QCA A;  2MW5 A;  3OAW A;  4BOZ B;  1P1A A;  1WRI A;  2D11 A;  3NHE B;  1FFV A;  3L0W B;  3VQI A;  2JZZ A;  4B9K A;  5JH5 C;  3H7P B;  4EZK A;  2Y3A A;  3A1Q A;  3KQ4 A;  4UDU C;  3IT4 B;  4ZRI A;  3ZTD A;  4WJP A;  4D2K A;  1UUP A;  4RM8 A;  1RLF A;  3ZLZ A;  1EWC A;  2RPV A; 
#chains in the Genus database with same CATH homology
 3N1Y C;  3DHI C;  3Q2A C;  3RI7 C;  3GE8 C;  3Q14 C;  3DHH C;  3Q3O C;  3RNE C;  3Q3N C;  1T0S C;  2INC C;  3RMK C;  3RNC C;  2RDB C;  3GE3 C;  3I63 C;  3DHG C;  4P1C C;  3I5J C;  1T0Q C;  3N1X C;  3Q3M C;  3RNF C;  3RNA C;  3N20 C;  3RNB C;  3RNG C;  2IND C;  1T0R C;  3RN9 C;  3N1Z C;  4P1B C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...