3GE3C

Crystal structure of the reduced toluene 4-monooxygenase hd t201a mutant complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
83
structure length
83
Chain Sequence
SAFPVHAAFEKDFLVQLVVVDLNDSMDQVAEKVAYHCVNRRVAPREGVMRVRKHRSTELFPRDMTIAESGLNPTEVIDVVFEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Role for threonine 201 in the catalytic cycle of the soluble diiron hydroxylase toluene 4-monooxygenase.
pubmed doi rcsb
source organism Pseudomonas mendocina
molecule tags Oxidoreductase
molecule keywords Toluene-4-monooxygenase system protein A
total genus 25
structure length 83
sequence length 83
ec nomenclature ec 1.14.13.236: Toluene 4-monooxygenase.
pdb deposition date 2009-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 3ge3C00
3Q3MC 3N1YC 3RI7C 1T0QC 3Q3OC 3RNAC 3Q2AC 1T0SC 2INCC 3N1XC 3RMKC 4P1BC 3RNCC 3RNBC 3N1ZC 3RNFC 3RNEC 3N20C 3GE8C 2INDC 3Q14C 1T0RC 3DHHC 3DHGC 3I5JC 3I63C 2RDBC 3GE3C 3DHIC 4P1CC 3RNGC 3RN9C 3Q3NC
chains in the Genus database with same CATH superfamily
1UZXB 4YSYB 3Q8AA 4FN2A 3W5UB 3VH4B 3PGEA 4M01A 4KVGB 2KYWA 3DQVA 1GOZA 4W9KA 3ML8A 1FCCC 1IYFA 1WMHA 3I63C 1WXQA 1E9MA 1TS4A 3EHVA 2DZIA 3QK0A 4IKGA 4C7ZA 1WRDB 4B9KA 3PPAA 2HE7A 2IGGA 2KD0A 4LLGM 3R7RA 1D6EC 2OJRA 2GBJA 1E0ZA 4PK1A 1I7HA 1C1YB 1TKEA 4HCPB 1BXTA 4ZRKA 3A9KA 2L00B 2BWFA 2LASA 2X8XX 3AM9A 1DYQA 4US9A 1GG3A 2KQ4X 3RI7C 1MG8A 2KTFA 3H7PA 1AWDA 5EE1A 4A6QA 1HZ5A 2K39A 1MHXA 4WQMA 1UNSA 2KN4A 1V97A 4RH6A 2LGIA 4BKGA 2JT4B 4JX1C 2PIAA 1WI0A 3V3XA 4G11A 1M94A 1CZPA 3CIRB 4HK2A 4TMAB 2LRWA 5AZFA 4C7YA 4FHKA 4OZCA 3ZNGC 3D32A 4WWOA 4EE2A 2X38A 3AE3B 2BBCA 2DZJA 2BYEA 4LCDE 4C56C 5CHVC 1M4VA 4RM8A 1ZPSA 4FA6A 3W1SA 2PW9A 3AV8A 4L2YA 4I6LB 1K50A 2DBYA 2LXAA 2NS5A 1I4GA 1SB3C 1K51A 2BB5A 5D2MB 4YTPB 4FHJA 3RZWC 3ZQ4A 4K81A 2JF5A 2J53A 1N6ZA 2D5GA 1YX6B 3RNBC 1EWYC 3ECIA 1B1ZA 4FULA 4HCNB 3W1YA 5J18A 2FAZA 4CO7A 2KDBA 4W9JA 1DOXA 1FMAD 4KSLC 1J19A 4B6WA 2MX2A 1E7UA 2REXA 2LEKA 2HJ8A 2M19A 2JU6X 2QMTA 2R61A 4A55A 3FILB 1VZ8A 2C60A 2NBUA 2L52A 4YSXB 2Y5PA 1CJEA 1ZUD2 3OWEB 2KVZA 1D5XC 3QQ8B 2JZZA 2K0PA 2WDQB 2IYDB 2NCNA 4MDKE 4GDLA 3UGBB 2KFJA 1Q0WB 2DYMA 2WXPA 2G1EA 3IG3A 4BKSA 3UINB 4KV2A 4HEA1 1SIFA 2DLBA 3AEAB 3RMKC 2W82A 2KHWB 3AN1A 4JL9A 5FR6A 3RNEC 1A5RA 2ZCCA 1ZP0B 2PLPA 1D4BA 4MH8A 5DPRA 1TYGB 5BMHA 1AN8A 2YEPF 1SXTA 5FKAC 2N0SB 4DXGA 3P4PB 3VTWA 3ZDMC 3ZRCA 1TBEA 2BYFA 3A9KB 4HKZE 2K9XA 4R3DA 2LHDA 2EKEC 4ZDVA 3RD2A 2WXMA 3V60A 2BKFA 4W9CA 3NS1A 1P0RA 4FJYA 3ZYYX 2MP2A 4NJ6A 3RYTA 3VDZA 4FADA 3DBRI 3MC8A 1GNUA 2M8SA 2BWES 1F77A 1XT9B 3DWMA 1Z2MA 2KWUB 1T0YA 3NHEB 2NPTB 2V3PA 4PYZA 1LFDA 5GXGB 2GBKA 2Y5CA 1EO6A 3ZO5B 3B2FA 4N59A 2IO0B 1FPYA 1FFVA 1KFYB 3NUHB 1WH3A 1N61A 2O6VB 4EZKA 3MHSD 3L0WB 1K8RB 4K7WA 5D3IB 2M4NA 2R2QA 4WWNA 2GBMA 5E6PA 3RNFC 1D5ZC 1FCLA 4AOFA 2GBRA 2DENB 3AEBB 2ZVOA 5CHWA 2Q5WD 2WXJA 3WAOA 2LJ5A 2FUHB 2WX1A 4P16A 3C8YA 2KDEB 3HVZA 2N9PC 2G4SA 2PVOD 3BVZA 4EZJA 4MH0E 4RGNA 2JX5A 2MHJA 2BW2A 3C0RB 3I5JC 3Q3FA 1PYWD 3KUZA 4FJVB 5IA7A 2DYOA 2I1KA 3ZGZA 3KVFB 2SEBD 1V49A 3S2AA 3MHZA 1OGWA 1TS3A 1T0SC 3GZNI 1L5PA 3V05A 4KIKB 3KYCD 5IP4D 3M63B 4FLHA 4IWPA 5CTRC 2RMMA 2K3UA 4TQ1A 1ENFA 5BMGA 1SE3A 4MELA 1Q10A 4XX5A 4I6NB 3OJ3A 2N9KA 3RCZA 3U8ZA 2KN5A 5G2NA 3H1UA 3A33B 1HA5A 1V80A 5C2TB 3ETRA 2MEKA 2Z0EB 1LM8B 1XXGA 1F2RC 4WAAA 2ZW0A 3DOWA 3VAWA 4EFOA 5AZGA 5BYRA 3TCAA 4A8XC 2J52A 4HLEA 2QCZA 1OTRB 3ABVB 2LVQA 4KGRA 1SBBB 1N63A 5EE3A 3Q69A 3KWVA 1GJZA 3N20C 1NI3A 4IUMB 1F0ZA 4DQOC 4M8MA 5D94A 1ISNA 3NJTA 4FBJB 2L1AA 2BYTA 4GU2A 1V81A 3QA8A 4BZAA 1YJJA 1I4XA 2OOBB 2BVCA 2KDMA 1TGZB 2G45B 2IZVB 2QIEB 2RD0A 4GN1A 2Z0DB 4ZHPA 4NAWB 1TY2A 3ZXVA 2KDIA 3N3KB 4BBNF 4RNAA 1CK1A 1PQSA 1RWSA 2KWVB 3I3TB 5TR5A 4JWUC 2AL3A 4GLSC 1IUEA 3P4SB 3A1QB 1MPEA 2J0JA 4FXCA 3TBLD 1R4NB 3A9JB 3AEDB 3VR8B 5H92C 3ZLZA 4AUQC 4AJWA 3DVGX 1TT5B 3DHGC 1OQQA 1JQ4A 3U7ZA 2MBEA 3NVYA 4EUTA 2L7RA 3UQBA 2ZPYA 1NENB 1SGHA 1RLFA 3BK1A 2HDEA 4P6VF 3MP9A 3JVZX 1L4ZB 4OZBA 1F9JA 3ZTCA 4KIKA 2QEJC 4WJNA 1S3SG 1WSPA 3UF8A 5G5HA 1VR9A 2NTTA 4HDQA 2LFIA 1TS5A 1Q1OA 4D2KA 3WANA 1OEYA 2K8CA 3AULA 5E6JA 3QJZA 1NYRA 4W9LA 3LDZE 2DHZA 4CHKA 4F7ZA 1V1OA 4MGKE 3AECB 3L16A 2JSVX 3SHQA 2V0GA 4BVUC 4OVVA 4RCOA 3ZRFA 5AUKA 2KJ6A 5EE0A 3VTVA 4ASWC 1Y8RC 3W9CB 2AQ1B 3KQ4A 3L4PA 2J4XA 1XLQA 5E6NA 4GGQA 4GOCA 2ICIA 2HTHA 2IY1B 3DHIC 2DZMA 2PVGC 2WLBA 3H7SA 1XEEA 3PZ7A 1V8CA 4KDIC 2CHZA 3R2IA 5BYSA 1R4MB 2TSSA 4PS7A 1V9JA 1WR1A 1GPXA 1WIAA 4E3CA 4MJSB 4IOIE 4NY0A 1IGDA 1WM3A 3RN9C 2ZVNA 1U4AA 3OJ4B 4LJOB 3N1YC 1WYGA 2MJ3A 3KLSX 1UH6A 1JWUD 3Q2AC 2LZ6A 2ZPNA 3P2BA 1XLPA 1E7PB 2NMQA 3O65B 1SE9A 4GB9A 1QZEA 2WS3B 5LXIB 3OG5A 2WU5B 4LNOA 5DPSA 5KHOA 3NZSA 1ZKHA 2J42A 3IXSA 3TUOA 4DWFA 3PZDA 3A1QA 2RPVA 3UQAA 1RAXA 1XLOA 4XE0A 1HE8A 3IHPC 2WXGA 3MC0B 1PGAA 1WR6E 3H6NA 1KH0A 5C23A 1N5XA 2FIFA 1VZ6A 2XK5B 1YJ1A 2B76B 2O6VD 4WH4A 1MJDA 4IWQA 1S1QB 3IAS1 3NVVA 1V2YA 2KJHB 4DK5A 3LYYA 1QOBA 3Q3OC 1YN3A 3ZJUA 5IN7A 4IM0A 5H8YE 3H7PB 1P98A 1UWXA 2ZNVB 2FBWB 2EMSA 4CYEA 1C9FA 2QC8A 2J7QB 1T5XD 5HFYA 3PREA 1IBXB 1SE2A 2FCQA 3JW0X 1EWCA 1LO5D 3RZFA 4M02A 2M1MA 3W5VB 1LQBA 4PYUA 5DPTA 2DX5B 1ZXHA 2JXTA 2JWUA 4TUUA 3A4SC 3VUXA 1P3QU 3NY5A 1VD2A 2VRRB 3WALA 1E8WA 3LB8C 4XDDA 2LWPA 1IGCA 4MGZE 1FRDA 1UBQA 4WJQA 3M62B 1PGBA 2KQSA 3CMMB 3L17A 3APDA 4DHJD 3HRDD 2N7DA 3MTNB 3ZKJC 2PTLA 3TL5A 1HTQA 4XC2A 3SR6A 4ICVA 3DBSA 3U52E 2ZNVC 2BB6A 1BMLC 4ANWA 1TJEA 2MQJA 4OVUA 2I1JA 4P1CC 2LD9A 2FE8A 2PEAA 4GSWA 2DAFA 3I57A 1A70A 5D3DA 1WX9A 3RFZB 2N4FA 4JE3B 2M0AA 2KMMA 1FXAA 3BZDB 2YLMA 4HXDA 3DHHC 2KOXA 1E90A 1E8YA 2L76A 1YN4A 4UDUC 5AUIA 2IBIB 3ML9A 1RRBA 5IO9A 3EUB2 1KF6B 1UBIA 3SFEB 4ZHOA 2VH2A 1AW7A 2D11A 3GZNB 4YXDB 4LK0M 1EU3A 1QF6A 4REZA 2LUEA 2GLSA 5C1ZA 1KM7A 2AL6A 4ANXA 4XWWA 1VRAB 2M17A 4RGOS 3DWGC 2VZKB 3J9CA 3AH7A 2G9HD 4LDTB 1N62A 1YD8U 2WP9B 4G0NB 2WYQA 2C7NB 2W3SA 1WX8A 3L08A 2PE9A 2FNJB 4HROA 2KNBA 2IO1B 4W9FA 1FNVA 3P4RB 4ARIA 3RT3B 2M56B 1QKZA 1FO4A 1KTKA 1ROEA 2QILA 1GUAB 3R66C 3N32A 5J17A 2ON8A 3BYTB 2KMCA 3U7DA 2D3CA 2IO3B 3LXFA 2CHXA 2KC1A 2VH1A 1K52A 3T3NA 2IGHA 5D7GA 3PLUA 2LVOA 5LXHA 4N6EB 2J0KA 2AQ3B 3PRPB 4JLCA 1UELA 2WDTB 2KTRA 5HI1A 3VR9B 2KX0A 3N9YC 4XZ4A 3NG0A 1J7CA 4HVBA 2IO2B 2BS2B 4RGMA 4WJOA 5LLIA 4GIVA 3TEZA 1FIQA 3GE8C 5MPOA 1MG4A 3LJ3A 1E10A 4KZ0A 2RDBC 4WAFA 4YWGG 3I9V1 3VRBB 4IC7B 2KFKA 1XCTL 4MM3B 4DHZB 2CU1A 1HXYD 1WJNA 2W9NA 1ACCA 3MJWA 1UWMA 1AYFA 1ZXIA 4NNJB 2I2YA 2LRUA 3FILA 2BTEA 4MT5A 1JWSD 1YOVB 4C4VA 5EE9A 1MVKA 3ZJVA 3VH3B 4TSSA 2DNFA 4KDLB 2LVPA 4E71A 4Q2JA 4NPNA 2K8BA 1KOTA 3Q6BA 1H8CA 5D6JB 1CMXB 1E7VA 5CX3A 2WXFA 3AE5B 3W1SC 4IDIA 1KLVA 1WFYA 1J0GA 1SJHD 1XO3A 3NS8A 5AZHA 2CS4A 1I4QA 1IP9A 2UWQA 4J6IA 2KLCA 2EMTA 3AU4A 3U4EG 1C3TA 1YJIA 1P1AA 2KDFB 1D5MC 3IFWB 4KGSA 3VQIA 1F2RI 4W9IA 4US8A 3K9PB 3AXCA 3DBLB 5EDSA 1MHHE 4NQKE 4EOYA 3PHXB 1FFUA 1MFWA 3PVLA 2RR9A 2IY0B 4IW0A 2LGXA 1C77A 2IPKD 1J7AA 3GOEA 4IWOA 4EEWA 1VJKA 2ZZPB 4ITKA 3DVGY 2L3ZA 1IBXA 1F1HA 3Q14C 4XWTA 3R2TA 4S0RA 3AE2B 3Q8CA 3PO0A 4HPMB 3WAPA 2XN9C 4N58A 2NBWB 1C4PA 3CF6E 3ZJTA 3AE8B 4PS3A 2XNAC 3W2DA 5BMIA 1UGJA 1WZ3A 3R7QA 3UIPB 1TTNA 3P63A 3JYUA 3QARA 3ZDTA 2KZRA 3C19A 1WXAA 2WXQA 3ZVVA 3PT2B 3BWUD 3T3OA 2DZKA 1JWBD 2K6DB 2KO3A 3QX1A 2BKRB 3QHTA 1E8ZA 2ZEQA 3B0AA 1N5WA 4LNNA 2MH7A 2MLBA 4W9GA 1VZ7A 3X23A 2KJRA 1EF5A 1ZOYB 2WU2B 3MC9A 2KC2A 3AE6B 3R3MA 1V1PA 2JRHA 2KMAA 3HK0A 4K7SA 2XEWA 2O6VA 1I35A 3GE3C 1JWMD 2HD5B 2W55A 5G55A 2CKHB 3FC4A 1WF9A 2GOWA 1WGKA 3JSVA 1YIWA 4JWSC 1YNTE 2ONQA 3V6EB 2WXOA 4USAA 3TSSA 3A4RA 4P1BC 1Y56A 2GBNA 3EA6A 2Z8LA 4B95A 5KHQA 4G50A 2GRIA 4X57B 2E6XA 3AE7B 2ZW1A 1QILA 2CU3A 3SD5A 4BAXA 3N1XC 1X1MA 1WXVA 1RFAA 1FEHA 3DBHB 2N7EA 3SU8X 4QAYA 2JUOA 4RM9A 1TZOA 3BVGA 3TEWA 4N9F4 2MBHA 3IT6B 1WGGA 4RMAA 4ZOHC 4F1SA 1K53A 2KQ7A 1SSNA 1C4AA 3HIZA 3IT4B 5C3JB 1KJTA 3WAMA 3Q8BA 4FJZA 2EKIA 2INPE 2C9WB 1P7FA 1WY8A 3KUCB 3GP7A 4LNIA 5L95C 1KLUD 1YQ4B 2FIDA 4KKIA 3AE9B 1KLGD 4K3CA 4II2B 2MW5A 1UF0A 4JIOU 1PGXA 4A9AA 1SJED 3E9SA 4LNKA 3WIMA 5HHDG 1V5OA 3APFA 1WJ6A 1VLBA 2KK8A 2WHIA 2LI5A 4DBGA 3PSEB 4K7UA 3DVNV 3APCA 2WGSA 1PDXA 3B2GA 2PJHA 4MEMA 4NQLB 2LJIA 3GB1A 2FUG1 4DHZE 3AMZA 2W54A 4MGYE 4MM3A 2KTRB 2DWQA 2GMIC 4L1BA 1WX7A 3P42A 2LGSA 1L6VA 1L0XB 4M0WB 1ESFA 2Y3AA 2KXJA 1DOYA 3RNGC 2L0FA 1T3QA 4GDLB 3ALBA 2INNE 2N9EB 3BK2A 4AQ7A 2QJLA 4WWMA 1J7BA 2HJ1A 2BYVE 3KUDB 5BYQA 4TV3A 1B9RA 3RPFC 1XLNA 2L0TA 2BS3B 3AI5A 4LDTD 2MJEA 2V3NA 2JZ3B 3OAWA 1ZE3D 3BVMA 1C78A 2KT7A 2V4IB 2K5PA 1WJ4A 1NBFC 4ZYNA 2K22A 1WMHB 2A5UA 4BBNC 4L23A 1V86A 3AB5A 2D07B 3OLMD 1WJUA 2ZCBA 3NRZA 2NTSA 2PMVA 4LNFA 5CHFA 2LXCA 1E5WA 5JH5C 2CJOA 4GXBA 2N7JA 2JQRB 1D3ZA 3VVWB 2MP2B 3VUWA 2RDHA 5FK9C 5GMVA 3EFCA 1R4NI 1OEYJ 2INCC 3TIXA 2N1VA 1NDDA 3HHMA 4JGHB 3DVNU 1EUVB 1MI0A 4BKTA 2KX3A 3GS2A 4GDKA 3IBEA 4ACFA 1SF0A 3TEYA 1XCQL 1GAQB 4ZRJA 4B0EA 3NVWA 1ET6A 1QT9A 4C00A 2FCSA 2BQQA 5IOIA 3EGRA 4DDGD 4JPSA 3N1ZC 3QAQA 4DHJB 4E74A 3O13A 1YX5B 2GB1A 1SE4A 1BUIC 1YMHE 3PZ8A 2LUMA 1NVID 4ZRQA 2UYZB 2MSED 4M8NA 3EECA 2ACZB 2BPSA 1I42A 3ZUNA 2BT6A 2JY6A 1FM0D 4I6PA 4B0MA 4URKA 4J3OD 1TKYA 3PTFC 4ANUA 5TSSA 3DCGA 1GC6A 4WURA 3V6CB 3DBHI 4IM3A 3PS6A 3HM3A 4MGIE 3UIOB 4KSKC 1YQBA 3ZNZB 2OJWA 2E3TA 4YT0B 2BF8B 1YN5A 3M3JA 1QOFA 2L8JA 1L7YA 2MBOA 2C7MB 1YQ3B 4HRSA 1JCKB 1NI2A 1DGJA 1STEA 4MSMB 5JZEB 1WRIA 3VHTC 1FXTB 2XK5A 2RDGA 3AEGB 4ZRPA 2CHWA 3T9LA 3T8MA 3CWIA 3SFDB 5DCNA 3BINA 1SIJA 2IJ0A 4PS8A 2GI9A 2NVUI 4OW0A 1DOIA 3PLVA 1L6UA 2WQYB 1XF5L 3ENEA 3ZIMA 2D3AA 3RUIB 1E6EB 2QDFA 1P7EA 2JWZA 3Q3MC 3PV1A 3JSVB 4A90A 3X0WA 3MJ5A 1QLBB 1TKGA 1WGYA 2WXLA 1TIFA 4KX6B 3QWZB 1OQRA 5E6OA 3HM6X 5JHBA 4OZAA 1L0VB 4NZLB 1WM2A 2NR2A 3P4QB 3B1LX 5BO4B 2MRPA 4WWPA 4ANVA 1LXDA 3AEEB 1C79A 1H4RA 2MJDA 3KH0A 4H2AA 3TEXA 4NJ7A 1G6JA 3Q8FA 3EFUA 2Z59B 4PT5A 2M0XA 4MSQB 2K25A 4IM2A 2BGFA 4DDID 4F8CB 5JHAA 4RGTA 3RNAC 1WE6A 2L83A 1JRPA 2KANA 4C80A 3UI3A 4W9DA 3VXWA 4RF0A 4AP4C 2KWCA 3BYYB 2R2OA 3DBLI 2CR5A 2SAKA 3K9OB 1RFKA 4A3PA 3ONSA 2L05A 2KKCA 1JALA 1WXSA 4XGAB 4HKQA 4NAMA 2NPTA 4ZYSA 2JYEA 2KWDA 2K6QA 3DPDA 2AX5A 2WXKA 2C5LC 2LGDA 2J0MA 4BOZB 3BY4B 3Q3NC 1Z5SB 2FCMA 5G5GA 1RM6C 3HVDA 2IDYA 2V1YA 3E56A 1TZ1A 2DYBA 1PFDA 2OHFA 1Q5WB 2L32A 4NJCA 2LMCA 2D10A 1EF1A 3NVZA 4ARCA 2YVCA 1FRRA 3Q3JA 2I38A 4HDOA 2KAJA 5HKHA 1F52A 4HPPA 3TJPA 2HTME 2KLGA 3KWLA 1NYQA 2V4LA 1RYJA 3WCQA 4KGTA 5FR3A 2WDVB 2NBVB 1R4MI 2D2QA 2OEDA 2JZPA 2ZJDA 3RULA 1TS2A 2FCNA 3SEBA 1FD6A 1ZGUB 5J2RA 2AEHA 3VUYA 4GDKB 3L10B 1C4CA 1WYWB 1HTOA 3ZTDA 2YEPB 4WIPA 1WXMA 4GMVA 4EZLA 1UD7A 1WGDA 4YL8A 1LGRA 4RFBA 4ZRIA 1JWAD 2PE6B 3EC8A 1NEKB 3NOBA 4LTUA 4IG7B 2ASQA 3L54A 4AS1A 1XD3B 5L83A 3V62A 1GB1A 1KRHA 4OVZA 2CJNA 1WZ0A 3QC8B 2UU7A 3NZ3A 5IKCM 2G4DB 1V6EA 4II3B 2AYOB 3HUIA 1WWTA 2D3BA 1AARA 3B9JA 4NAWA 4KZCA 4JQWC 4KKJA 4XDCA 4BOSC 1UUPA 2JRIB 3ZXRA 3PHWB 3TMPB 1QQRA 5JXVA 2KFKB 5I4DA 2WWZA 4HJKA 2IGDA 3VRAB 4DXAB 4O1NA 1XQQA 3AU5A 2K8HA 5HG2A 3IAM1 3L13A 2XBBC 4HWIB 1ZW7A 2VZKD 1GC7A 1L0YB 2O2VA 1VCBA 1FNWA 1HZ6A 1WE7A 4C4VB 3IVFA 1T0QC 2MBQA 3H9DA 4A3OA 3ZNID 1GB4A 2K1FA 3ZNHB 1TY0A 1L4DB 1P9DU 1SEBD 3KW5B 2INDC 2AQ2B 1R7SA 1JRUA 3KYDD 2KVRA 4G3XB 4YTMB 1J8CA 2QHOA 2WNMA 4TKNA 4TQ0A 1EM7A 3A9JA 3FKYA 3FAHA 2N9XA 1WGHA 3ZW3A 4M00A 2B3AA 1PUTA 3PRMB 1FXIA 3U30A 4XYCA 1T0RC 1HQRD 1JW9D 2G3QB 4K3BA 1T6BX 4BKSD 4MACA 2V3SA 2N9LA 5AEKB 1EU4A 4WJPA 4A20A 2QSDA 3CSFA 2D3GA 2JPHA 2MA9B 4EKUA 4DXFA 1N60A 1I4RA 1CQVA 1ZDXA 2PKOA 3QCAA 2MCNB 1IPGA 2WXNA 3AE1B 2LHEA 2PPHA 3VTUA 3MFGA 3SDLC 2KACA 4W9HA 1V5TA 3PRZA 1I4HA 2JYTA 4CQNA 4S17A 1BT0A 1C76A 3DDCB 1ZDVA 2WXRA 3H8HA 3QIJA 4HPLB 1HEZE 3URYA 4YTNB 2RGFA 2Y5BB 2WXHA 4AWJA 1QOAA 3R8BA 4M0WA 2AWTA 2LGYA 3N30A 4MJSA 3CSTA 4YSZB 2MWSB 3NZUA 4AJYB 3M95A 1QOGA 1L2NA 1OFFA 3V61A 5LNK1 1JROA 1I4PA 2JXXA 3RNCC 3VFKA 2RPQA 2A4ZA 1E8XA 2JVCA 1OQYA 1VDVA 4LJPB 1WGRA 4ICUA 2BS4B 4RF1A 3B08A 2V9HA 1FNUA 2DAJA 4WQOB 1V1PB 2H89B 3Q8EA 5T8IA 1JMLA 2H88B 3AE4B 2WXIA 2RSUA 2N1WA 2MBBB 2WDRB 4P7IA 5DPWA 1ET9A 2W3RA 2O2VB 3BIID 5IAAC 3P1MA 4OHJA 2EELA 2C7HA 3AEFB 2WX0A 4HJGE 4K1RB 4W9EA 3DBRB 3WA0A 1UGMA 4BFRA 3U2SC
chains in the Genus database with same CATH topology
3Q3MC 3N1YC 3RI7C 1T0QC 3Q3OC 3RNAC 3Q2AC 1T0SC 2INCC 3N1XC 3RMKC 4P1BC 3RNCC 3RNBC 3N1ZC 3RNFC 3RNEC 3N20C 3GE8C 2INDC 3Q14C 1T0RC 3DHHC 3DHGC 3I5JC 3I63C 2RDBC 3GE3C 3DHIC 4P1CC 3RNGC 3RN9C 3Q3NC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q3M C;  3N1Y C;  3RI7 C;  1T0Q C;  3Q3O C;  3RNA C;  3Q2A C;  1T0S C;  2INC C;  3N1X C;  3RMK C;  4P1B C;  3RNC C;  3RNB C;  3N1Z C;  3RNF C;  3RNE C;  3N20 C;  3GE8 C;  2IND C;  3Q14 C;  1T0R C;  3DHH C;  3DHG C;  3I5J C;  3I63 C;  2RDB C;  3GE3 C;  3DHI C;  4P1C C;  3RNG C;  3RN9 C;  3Q3N C; 
#chains in the Genus database with same CATH topology
 1UZX B;  4YSY B;  3Q8A A;  4FN2 A;  3W5U B;  3VH4 B;  3PGE A;  4M01 A;  4KVG B;  2KYW A;  3DQV A;  1GOZ A;  4W9K A;  3ML8 A;  1FCC C;  1IYF A;  1WMH A;  3I63 C;  1WXQ A;  1E9M A;  1TS4 A;  3EHV A;  2DZI A;  3QK0 A;  4IKG A;  4C7Z A;  1WRD B;  4B9K A;  3PPA A;  2HE7 A;  2IGG A;  2KD0 A;  4LLG M;  3R7R A;  1D6E C;  2OJR A;  2GBJ A;  1E0Z A;  4PK1 A;  1I7H A;  1C1Y B;  1TKE A;  4HCP B;  1BXT A;  4ZRK A;  3A9K A;  2L00 B;  2BWF A;  2LAS A;  2X8X X;  3AM9 A;  1DYQ A;  4US9 A;  1GG3 A;  2KQ4 X;  3RI7 C;  1MG8 A;  2KTF A;  3H7P A;  1AWD A;  5EE1 A;  4A6Q A;  1HZ5 A;  2K39 A;  1MHX A;  4WQM A;  1UNS A;  2KN4 A;  1V97 A;  4RH6 A;  2LGI A;  4BKG A;  2JT4 B;  4JX1 C;  2PIA A;  1WI0 A;  3V3X A;  4G11 A;  1M94 A;  1CZP A;  3CIR B;  4HK2 A;  4TMA B;  2LRW A;  5AZF A;  4C7Y A;  4FHK A;  4OZC A;  3ZNG C;  3D32 A;  4WWO A;  4EE2 A;  2X38 A;  3AE3 B;  2BBC A;  2DZJ A;  2BYE A;  4LCD E;  4C56 C;  5CHV C;  1M4V A;  4RM8 A;  1ZPS A;  4FA6 A;  3W1S A;  2PW9 A;  3AV8 A;  4L2Y A;  4I6L B;  1K50 A;  2DBY A;  2LXA A;  2NS5 A;  1I4G A;  1SB3 C;  1K51 A;  2BB5 A;  5D2M B;  4YTP B;  4FHJ A;  3RZW C;  3ZQ4 A;  4K81 A;  2JF5 A;  2J53 A;  1N6Z A;  2D5G A;  1YX6 B;  3RNB C;  1EWY C;  3ECI A;  1B1Z A;  4FUL A;  4HCN B;  3W1Y A;  5J18 A;  2FAZ A;  4CO7 A;  2KDB A;  4W9J A;  1DOX A;  1FMA D;  4KSL C;  1J19 A;  4B6W A;  2MX2 A;  1E7U A;  2REX A;  2LEK A;  2HJ8 A;  2M19 A;  2JU6 X;  2QMT A;  2R61 A;  4A55 A;  3FIL B;  1VZ8 A;  2C60 A;  2NBU A;  2L52 A;  4YSX B;  2Y5P A;  1CJE A;  1ZUD 2;  3OWE B;  2KVZ A;  1D5X C;  3QQ8 B;  2JZZ A;  2K0P A;  2WDQ B;  2IYD B;  2NCN A;  4MDK E;  4GDL A;  3UGB B;  2KFJ A;  1Q0W B;  2DYM A;  2WXP A;  2G1E A;  3IG3 A;  4BKS A;  3UIN B;  4KV2 A;  4HEA 1;  1SIF A;  2DLB A;  3AEA B;  3RMK C;  2W82 A;  2KHW B;  3AN1 A;  4JL9 A;  5FR6 A;  3RNE C;  1A5R A;  2ZCC A;  1ZP0 B;  2PLP A;  1D4B A;  4MH8 A;  5DPR A;  1TYG B;  5BMH A;  1AN8 A;  2YEP F;  1SXT A;  5FKA C;  2N0S B;  4DXG A;  3P4P B;  3VTW A;  3ZDM C;  3ZRC A;  1TBE A;  2BYF A;  3A9K B;  4HKZ E;  2K9X A;  4R3D A;  2LHD A;  2EKE C;  4ZDV A;  3RD2 A;  2WXM A;  3V60 A;  2BKF A;  4W9C A;  3NS1 A;  1P0R A;  4FJY A;  3ZYY X;  2MP2 A;  4NJ6 A;  3RYT A;  3VDZ A;  4FAD A;  3DBR I;  3MC8 A;  1GNU A;  2M8S A;  2BWE S;  1F77 A;  1XT9 B;  3DWM A;  1Z2M A;  2KWU B;  1T0Y A;  3NHE B;  2NPT B;  2V3P A;  4PYZ A;  1LFD A;  5GXG B;  2GBK A;  2Y5C A;  1EO6 A;  3ZO5 B;  3B2F A;  4N59 A;  2IO0 B;  1FPY A;  1FFV A;  1KFY B;  3NUH B;  1WH3 A;  1N61 A;  2O6V B;  4EZK A;  3MHS D;  3L0W B;  1K8R B;  4K7W A;  5D3I B;  2M4N A;  2R2Q A;  4WWN A;  2GBM A;  5E6P A;  3RNF C;  1D5Z C;  1FCL A;  4AOF A;  2GBR A;  2DEN B;  3AEB B;  2ZVO A;  5CHW A;  2Q5W D;  2WXJ A;  3WAO A;  2LJ5 A;  2FUH B;  2WX1 A;  4P16 A;  3C8Y A;  2KDE B;  3HVZ A;  2N9P C;  2G4S A;  2PVO D;  3BVZ A;  4EZJ A;  4MH0 E;  4RGN A;  2JX5 A;  2MHJ A;  2BW2 A;  3C0R B;  3I5J C;  3Q3F A;  1PYW D;  3KUZ A;  4FJV B;  5IA7 A;  2DYO A;  2I1K A;  3ZGZ A;  3KVF B;  2SEB D;  1V49 A;  3S2A A;  3MHZ A;  1OGW A;  1TS3 A;  1T0S C;  3GZN I;  1L5P A;  3V05 A;  4KIK B;  3KYC D;  5IP4 D;  3M63 B;  4FLH A;  4IWP A;  5CTR C;  2RMM A;  2K3U A;  4TQ1 A;  1ENF A;  5BMG A;  1SE3 A;  4MEL A;  1Q10 A;  4XX5 A;  4I6N B;  3OJ3 A;  2N9K A;  3RCZ A;  3U8Z A;  2KN5 A;  5G2N A;  3H1U A;  3A33 B;  1HA5 A;  1V80 A;  5C2T B;  3ETR A;  2MEK A;  2Z0E B;  1LM8 B;  1XXG A;  1F2R C;  4WAA A;  2ZW0 A;  3DOW A;  3VAW A;  4EFO A;  5AZG A;  5BYR A;  3TCA A;  4A8X C;  2J52 A;  4HLE A;  2QCZ A;  1OTR B;  3ABV B;  2LVQ A;  4KGR A;  1SBB B;  1N63 A;  5EE3 A;  3Q69 A;  3KWV A;  1GJZ A;  3N20 C;  1NI3 A;  4IUM B;  1F0Z A;  4DQO C;  4M8M A;  5D94 A;  1ISN A;  3NJT A;  4FBJ B;  2L1A A;  2BYT A;  4GU2 A;  1V81 A;  3QA8 A;  4BZA A;  1YJJ A;  1I4X A;  2OOB B;  2BVC A;  2KDM A;  1TGZ B;  2G45 B;  2IZV B;  2QIE B;  2RD0 A;  4GN1 A;  2Z0D B;  4ZHP A;  4NAW B;  1TY2 A;  3ZXV A;  2KDI A;  3N3K B;  4BBN F;  4RNA A;  1CK1 A;  1PQS A;  1RWS A;  2KWV B;  3I3T B;  5TR5 A;  4JWU C;  2AL3 A;  4GLS C;  1IUE A;  3P4S B;  3A1Q B;  1MPE A;  2J0J A;  4FXC A;  3TBL D;  1R4N B;  3A9J B;  3AED B;  3VR8 B;  5H92 C;  3ZLZ A;  4AUQ C;  4AJW A;  3DVG X;  1TT5 B;  3DHG C;  1OQQ A;  1JQ4 A;  3U7Z A;  2MBE A;  3NVY A;  4EUT A;  2L7R A;  3UQB A;  2ZPY A;  1NEN B;  1SGH A;  1RLF A;  3BK1 A;  2HDE A;  4P6V F;  3MP9 A;  3JVZ X;  1L4Z B;  4OZB A;  1F9J A;  3ZTC A;  4KIK A;  2QEJ C;  4WJN A;  1S3S G;  1WSP A;  3UF8 A;  5G5H A;  1VR9 A;  2NTT A;  4HDQ A;  2LFI A;  1TS5 A;  1Q1O A;  4D2K A;  3WAN A;  1OEY A;  2K8C A;  3AUL A;  5E6J A;  3QJZ A;  1NYR A;  4W9L A;  3LDZ E;  2DHZ A;  4CHK A;  4F7Z A;  1V1O A;  4MGK E;  3AEC B;  3L16 A;  2JSV X;  3SHQ A;  2V0G A;  4BVU C;  4OVV A;  4RCO A;  3ZRF A;  5AUK A;  2KJ6 A;  5EE0 A;  3VTV A;  4ASW C;  1Y8R C;  3W9C B;  2AQ1 B;  3KQ4 A;  3L4P A;  2J4X A;  1XLQ A;  5E6N A;  4GGQ A;  4GOC A;  2ICI A;  2HTH A;  2IY1 B;  3DHI C;  2DZM A;  2PVG C;  2WLB A;  3H7S A;  1XEE A;  3PZ7 A;  1V8C A;  4KDI C;  2CHZ A;  3R2I A;  5BYS A;  1R4M B;  2TSS A;  4PS7 A;  1V9J A;  1WR1 A;  1GPX A;  1WIA A;  4E3C A;  4MJS B;  4IOI E;  4NY0 A;  1IGD A;  1WM3 A;  3RN9 C;  2ZVN A;  1U4A A;  3OJ4 B;  4LJO B;  3N1Y C;  1WYG A;  2MJ3 A;  3KLS X;  1UH6 A;  1JWU D;  3Q2A C;  2LZ6 A;  2ZPN A;  3P2B A;  1XLP A;  1E7P B;  2NMQ A;  3O65 B;  1SE9 A;  4GB9 A;  1QZE A;  2WS3 B;  5LXI B;  3OG5 A;  2WU5 B;  4LNO A;  5DPS A;  5KHO A;  3NZS A;  1ZKH A;  2J42 A;  3IXS A;  3TUO A;  4DWF A;  3PZD A;  3A1Q A;  2RPV A;  3UQA A;  1RAX A;  1XLO A;  4XE0 A;  1HE8 A;  3IHP C;  2WXG A;  3MC0 B;  1PGA A;  1WR6 E;  3H6N A;  1KH0 A;  5C23 A;  1N5X A;  2FIF A;  1VZ6 A;  2XK5 B;  1YJ1 A;  2B76 B;  2O6V D;  4WH4 A;  1MJD A;  4IWQ A;  1S1Q B;  3IAS 1;  3NVV A;  1V2Y A;  2KJH B;  4DK5 A;  3LYY A;  1QOB A;  3Q3O C;  1YN3 A;  3ZJU A;  5IN7 A;  4IM0 A;  5H8Y E;  3H7P B;  1P98 A;  1UWX A;  2ZNV B;  2FBW B;  2EMS A;  4CYE A;  1C9F A;  2QC8 A;  2J7Q B;  1T5X D;  5HFY A;  3PRE A;  1IBX B;  1SE2 A;  2FCQ A;  3JW0 X;  1EWC A;  1LO5 D;  3RZF A;  4M02 A;  2M1M A;  3W5V B;  1LQB A;  4PYU A;  5DPT A;  2DX5 B;  1ZXH A;  2JXT A;  2JWU A;  4TUU A;  3A4S C;  3VUX A;  1P3Q U;  3NY5 A;  1VD2 A;  2VRR B;  3WAL A;  1E8W A;  3LB8 C;  4XDD A;  2LWP A;  1IGC A;  4MGZ E;  1FRD A;  1UBQ A;  4WJQ A;  3M62 B;  1PGB A;  2KQS A;  3CMM B;  3L17 A;  3APD A;  4DHJ D;  3HRD D;  2N7D A;  3MTN B;  3ZKJ C;  2PTL A;  3TL5 A;  1HTQ A;  4XC2 A;  3SR6 A;  4ICV A;  3DBS A;  3U52 E;  2ZNV C;  2BB6 A;  1BML C;  4ANW A;  1TJE A;  2MQJ A;  4OVU A;  2I1J A;  4P1C C;  2LD9 A;  2FE8 A;  2PEA A;  4GSW A;  2DAF A;  3I57 A;  1A70 A;  5D3D A;  1WX9 A;  3RFZ B;  2N4F A;  4JE3 B;  2M0A A;  2KMM A;  1FXA A;  3BZD B;  2YLM A;  4HXD A;  3DHH C;  2KOX A;  1E90 A;  1E8Y A;  2L76 A;  1YN4 A;  4UDU C;  5AUI A;  2IBI B;  3ML9 A;  1RRB A;  5IO9 A;  3EUB 2;  1KF6 B;  1UBI A;  3SFE B;  4ZHO A;  2VH2 A;  1AW7 A;  2D11 A;  3GZN B;  4YXD B;  4LK0 M;  1EU3 A;  1QF6 A;  4REZ A;  2LUE A;  2GLS A;  5C1Z A;  1KM7 A;  2AL6 A;  4ANX A;  4XWW A;  1VRA B;  2M17 A;  4RGO S;  3DWG C;  2VZK B;  3J9C A;  3AH7 A;  2G9H D;  4LDT B;  1N62 A;  1YD8 U;  2WP9 B;  4G0N B;  2WYQ A;  2C7N B;  2W3S A;  1WX8 A;  3L08 A;  2PE9 A;  2FNJ B;  4HRO A;  2KNB A;  2IO1 B;  4W9F A;  1FNV A;  3P4R B;  4ARI A;  3RT3 B;  2M56 B;  1QKZ A;  1FO4 A;  1KTK A;  1ROE A;  2QIL A;  1GUA B;  3R66 C;  3N32 A;  5J17 A;  2ON8 A;  3BYT B;  2KMC A;  3U7D A;  2D3C A;  2IO3 B;  3LXF A;  2CHX A;  2KC1 A;  2VH1 A;  1K52 A;  3T3N A;  2IGH A;  5D7G A;  3PLU A;  2LVO A;  5LXH A;  4N6E B;  2J0K A;  2AQ3 B;  3PRP B;  4JLC A;  1UEL A;  2WDT B;  2KTR A;  5HI1 A;  3VR9 B;  2KX0 A;  3N9Y C;  4XZ4 A;  3NG0 A;  1J7C A;  4HVB A;  2IO2 B;  2BS2 B;  4RGM A;  4WJO A;  5LLI A;  4GIV A;  3TEZ A;  1FIQ A;  3GE8 C;  5MPO A;  1MG4 A;  3LJ3 A;  1E10 A;  4KZ0 A;  2RDB C;  4WAF A;  4YWG G;  3I9V 1;  3VRB B;  4IC7 B;  2KFK A;  1XCT L;  4MM3 B;  4DHZ B;  2CU1 A;  1HXY D;  1WJN A;  2W9N A;  1ACC A;  3MJW A;  1UWM A;  1AYF A;  1ZXI A;  4NNJ B;  2I2Y A;  2LRU A;  3FIL A;  2BTE A;  4MT5 A;  1JWS D;  1YOV B;  4C4V A;  5EE9 A;  1MVK A;  3ZJV A;  3VH3 B;  4TSS A;  2DNF A;  4KDL B;  2LVP A;  4E71 A;  4Q2J A;  4NPN A;  2K8B A;  1KOT A;  3Q6B A;  1H8C A;  5D6J B;  1CMX B;  1E7V A;  5CX3 A;  2WXF A;  3AE5 B;  3W1S C;  4IDI A;  1KLV A;  1WFY A;  1J0G A;  1SJH D;  1XO3 A;  3NS8 A;  5AZH A;  2CS4 A;  1I4Q A;  1IP9 A;  2UWQ A;  4J6I A;  2KLC A;  2EMT A;  3AU4 A;  3U4E G;  1C3T A;  1YJI A;  1P1A A;  2KDF B;  1D5M C;  3IFW B;  4KGS A;  3VQI A;  1F2R I;  4W9I A;  4US8 A;  3K9P B;  3AXC A;  3DBL B;  5EDS A;  1MHH E;  4NQK E;  4EOY A;  3PHX B;  1FFU A;  1MFW A;  3PVL A;  2RR9 A;  2IY0 B;  4IW0 A;  2LGX A;  1C77 A;  2IPK D;  1J7A A;  3GOE A;  4IWO A;  4EEW A;  1VJK A;  2ZZP B;  4ITK A;  3DVG Y;  2L3Z A;  1IBX A;  1F1H A;  3Q14 C;  4XWT A;  3R2T A;  4S0R A;  3AE2 B;  3Q8C A;  3PO0 A;  4HPM B;  3WAP A;  2XN9 C;  4N58 A;  2NBW B;  1C4P A;  3CF6 E;  3ZJT A;  3AE8 B;  4PS3 A;  2XNA C;  3W2D A;  5BMI A;  1UGJ A;  1WZ3 A;  3R7Q A;  3UIP B;  1TTN A;  3P63 A;  3JYU A;  3QAR A;  3ZDT A;  2KZR A;  3C19 A;  1WXA A;  2WXQ A;  3ZVV A;  3PT2 B;  3BWU D;  3T3O A;  2DZK A;  1JWB D;  2K6D B;  2KO3 A;  3QX1 A;  2BKR B;  3QHT A;  1E8Z A;  2ZEQ A;  3B0A A;  1N5W A;  4LNN A;  2MH7 A;  2MLB A;  4W9G A;  1VZ7 A;  3X23 A;  2KJR A;  1EF5 A;  1ZOY B;  2WU2 B;  3MC9 A;  2KC2 A;  3AE6 B;  3R3M A;  1V1P A;  2JRH A;  2KMA A;  3HK0 A;  4K7S A;  2XEW A;  2O6V A;  1I35 A;  3GE3 C;  1JWM D;  2HD5 B;  2W55 A;  5G55 A;  2CKH B;  3FC4 A;  1WF9 A;  2GOW A;  1WGK A;  3JSV A;  1YIW A;  4JWS C;  1YNT E;  2ONQ A;  3V6E B;  2WXO A;  4USA A;  3TSS A;  3A4R A;  4P1B C;  1Y56 A;  2GBN A;  3EA6 A;  2Z8L A;  4B95 A;  5KHQ A;  4G50 A;  2GRI A;  4X57 B;  2E6X A;  3AE7 B;  2ZW1 A;  1QIL A;  2CU3 A;  3SD5 A;  4BAX A;  3N1X C;  1X1M A;  1WXV A;  1RFA A;  1FEH A;  3DBH B;  2N7E A;  3SU8 X;  4QAY A;  2JUO A;  4RM9 A;  1TZO A;  3BVG A;  3TEW A;  4N9F 4;  2MBH A;  3IT6 B;  1WGG A;  4RMA A;  4ZOH C;  4F1S A;  1K53 A;  2KQ7 A;  1SSN A;  1C4A A;  3HIZ A;  3IT4 B;  5C3J B;  1KJT A;  3WAM A;  3Q8B A;  4FJZ A;  2EKI A;  2INP E;  2C9W B;  1P7F A;  1WY8 A;  3KUC B;  3GP7 A;  4LNI A;  5L95 C;  1KLU D;  1YQ4 B;  2FID A;  4KKI A;  3AE9 B;  1KLG D;  4K3C A;  4II2 B;  2MW5 A;  1UF0 A;  4JIO U;  1PGX A;  4A9A A;  1SJE D;  3E9S A;  4LNK A;  3WIM A;  5HHD G;  1V5O A;  3APF A;  1WJ6 A;  1VLB A;  2KK8 A;  2WHI A;  2LI5 A;  4DBG A;  3PSE B;  4K7U A;  3DVN V;  3APC A;  2WGS A;  1PDX A;  3B2G A;  2PJH A;  4MEM A;  4NQL B;  2LJI A;  3GB1 A;  2FUG 1;  4DHZ E;  3AMZ A;  2W54 A;  4MGY E;  4MM3 A;  2KTR B;  2DWQ A;  2GMI C;  4L1B A;  1WX7 A;  3P42 A;  2LGS A;  1L6V A;  1L0X B;  4M0W B;  1ESF A;  2Y3A A;  2KXJ A;  1DOY A;  3RNG C;  2L0F A;  1T3Q A;  4GDL B;  3ALB A;  2INN E;  2N9E B;  3BK2 A;  4AQ7 A;  2QJL A;  4WWM A;  1J7B A;  2HJ1 A;  2BYV E;  3KUD B;  5BYQ A;  4TV3 A;  1B9R A;  3RPF C;  1XLN A;  2L0T A;  2BS3 B;  3AI5 A;  4LDT D;  2MJE A;  2V3N A;  2JZ3 B;  3OAW A;  1ZE3 D;  3BVM A;  1C78 A;  2KT7 A;  2V4I B;  2K5P A;  1WJ4 A;  1NBF C;  4ZYN A;  2K22 A;  1WMH B;  2A5U A;  4BBN C;  4L23 A;  1V86 A;  3AB5 A;  2D07 B;  3OLM D;  1WJU A;  2ZCB A;  3NRZ A;  2NTS A;  2PMV A;  4LNF A;  5CHF A;  2LXC A;  1E5W A;  5JH5 C;  2CJO A;  4GXB A;  2N7J A;  2JQR B;  1D3Z A;  3VVW B;  2MP2 B;  3VUW A;  2RDH A;  5FK9 C;  5GMV A;  3EFC A;  1R4N I;  1OEY J;  2INC C;  3TIX A;  2N1V A;  1NDD A;  3HHM A;  4JGH B;  3DVN U;  1EUV B;  1MI0 A;  4BKT A;  2KX3 A;  3GS2 A;  4GDK A;  3IBE A;  4ACF A;  1SF0 A;  3TEY A;  1XCQ L;  1GAQ B;  4ZRJ A;  4B0E A;  3NVW A;  1ET6 A;  1QT9 A;  4C00 A;  2FCS A;  2BQQ A;  5IOI A;  3EGR A;  4DDG D;  4JPS A;  3N1Z C;  3QAQ A;  4DHJ B;  4E74 A;  3O13 A;  1YX5 B;  2GB1 A;  1SE4 A;  1BUI C;  1YMH E;  3PZ8 A;  2LUM A;  1NVI D;  4ZRQ A;  2UYZ B;  2MSE D;  4M8N A;  3EEC A;  2ACZ B;  2BPS A;  1I42 A;  3ZUN A;  2BT6 A;  2JY6 A;  1FM0 D;  4I6P A;  4B0M A;  4URK A;  4J3O D;  1TKY A;  3PTF C;  4ANU A;  5TSS A;  3DCG A;  1GC6 A;  4WUR A;  3V6C B;  3DBH I;  4IM3 A;  3PS6 A;  3HM3 A;  4MGI E;  3UIO B;  4KSK C;  1YQB A;  3ZNZ B;  2OJW A;  2E3T A;  4YT0 B;  2BF8 B;  1YN5 A;  3M3J A;  1QOF A;  2L8J A;  1L7Y A;  2MBO A;  2C7M B;  1YQ3 B;  4HRS A;  1JCK B;  1NI2 A;  1DGJ A;  1STE A;  4MSM B;  5JZE B;  1WRI A;  3VHT C;  1FXT B;  2XK5 A;  2RDG A;  3AEG B;  4ZRP A;  2CHW A;  3T9L A;  3T8M A;  3CWI A;  3SFD B;  5DCN A;  3BIN A;  1SIJ A;  2IJ0 A;  4PS8 A;  2GI9 A;  2NVU I;  4OW0 A;  1DOI A;  3PLV A;  1L6U A;  2WQY B;  1XF5 L;  3ENE A;  3ZIM A;  2D3A A;  3RUI B;  1E6E B;  2QDF A;  1P7E A;  2JWZ A;  3Q3M C;  3PV1 A;  3JSV B;  4A90 A;  3X0W A;  3MJ5 A;  1QLB B;  1TKG A;  1WGY A;  2WXL A;  1TIF A;  4KX6 B;  3QWZ B;  1OQR A;  5E6O A;  3HM6 X;  5JHB A;  4OZA A;  1L0V B;  4NZL B;  1WM2 A;  2NR2 A;  3P4Q B;  3B1L X;  5BO4 B;  2MRP A;  4WWP A;  4ANV A;  1LXD A;  3AEE B;  1C79 A;  1H4R A;  2MJD A;  3KH0 A;  4H2A A;  3TEX A;  4NJ7 A;  1G6J A;  3Q8F A;  3EFU A;  2Z59 B;  4PT5 A;  2M0X A;  4MSQ B;  2K25 A;  4IM2 A;  2BGF A;  4DDI D;  4F8C B;  5JHA A;  4RGT A;  3RNA C;  1WE6 A;  2L83 A;  1JRP A;  2KAN A;  4C80 A;  3UI3 A;  4W9D A;  3VXW A;  4RF0 A;  4AP4 C;  2KWC A;  3BYY B;  2R2O A;  3DBL I;  2CR5 A;  2SAK A;  3K9O B;  1RFK A;  4A3P A;  3ONS A;  2L05 A;  2KKC A;  1JAL A;  1WXS A;  4XGA B;  4HKQ A;  4NAM A;  2NPT A;  4ZYS A;  2JYE A;  2KWD A;  2K6Q A;  3DPD A;  2AX5 A;  2WXK A;  2C5L C;  2LGD A;  2J0M A;  4BOZ B;  3BY4 B;  3Q3N C;  1Z5S B;  2FCM A;  5G5G A;  1RM6 C;  3HVD A;  2IDY A;  2V1Y A;  3E56 A;  1TZ1 A;  2DYB A;  1PFD A;  2OHF A;  1Q5W B;  2L32 A;  4NJC A;  2LMC A;  2D10 A;  1EF1 A;  3NVZ A;  4ARC A;  2YVC A;  1FRR A;  3Q3J A;  2I38 A;  4HDO A;  2KAJ A;  5HKH A;  1F52 A;  4HPP A;  3TJP A;  2HTM E;  2KLG A;  3KWL A;  1NYQ A;  2V4L A;  1RYJ A;  3WCQ A;  4KGT A;  5FR3 A;  2WDV B;  2NBV B;  1R4M I;  2D2Q A;  2OED A;  2JZP A;  2ZJD A;  3RUL A;  1TS2 A;  2FCN A;  3SEB A;  1FD6 A;  1ZGU B;  5J2R A;  2AEH A;  3VUY A;  4GDK B;  3L10 B;  1C4C A;  1WYW B;  1HTO A;  3ZTD A;  2YEP B;  4WIP A;  1WXM A;  4GMV A;  4EZL A;  1UD7 A;  1WGD A;  4YL8 A;  1LGR A;  4RFB A;  4ZRI A;  1JWA D;  2PE6 B;  3EC8 A;  1NEK B;  3NOB A;  4LTU A;  4IG7 B;  2ASQ A;  3L54 A;  4AS1 A;  1XD3 B;  5L83 A;  3V62 A;  1GB1 A;  1KRH A;  4OVZ A;  2CJN A;  1WZ0 A;  3QC8 B;  2UU7 A;  3NZ3 A;  5IKC M;  2G4D B;  1V6E A;  4II3 B;  2AYO B;  3HUI A;  1WWT A;  2D3B A;  1AAR A;  3B9J A;  4NAW A;  4KZC A;  4JQW C;  4KKJ A;  4XDC A;  4BOS C;  1UUP A;  2JRI B;  3ZXR A;  3PHW B;  3TMP B;  1QQR A;  5JXV A;  2KFK B;  5I4D A;  2WWZ A;  4HJK A;  2IGD A;  3VRA B;  4DXA B;  4O1N A;  1XQQ A;  3AU5 A;  2K8H A;  5HG2 A;  3IAM 1;  3L13 A;  2XBB C;  4HWI B;  1ZW7 A;  2VZK D;  1GC7 A;  1L0Y B;  2O2V A;  1VCB A;  1FNW A;  1HZ6 A;  1WE7 A;  4C4V B;  3IVF A;  1T0Q C;  2MBQ A;  3H9D A;  4A3O A;  3ZNI D;  1GB4 A;  2K1F A;  3ZNH B;  1TY0 A;  1L4D B;  1P9D U;  1SEB D;  3KW5 B;  2IND C;  2AQ2 B;  1R7S A;  1JRU A;  3KYD D;  2KVR A;  4G3X B;  4YTM B;  1J8C A;  2QHO A;  2WNM A;  4TKN A;  4TQ0 A;  1EM7 A;  3A9J A;  3FKY A;  3FAH A;  2N9X A;  1WGH A;  3ZW3 A;  4M00 A;  2B3A A;  1PUT A;  3PRM B;  1FXI A;  3U30 A;  4XYC A;  1T0R C;  1HQR D;  1JW9 D;  2G3Q B;  4K3B A;  1T6B X;  4BKS D;  4MAC A;  2V3S A;  2N9L A;  5AEK B;  1EU4 A;  4WJP A;  4A20 A;  2QSD A;  3CSF A;  2D3G A;  2JPH A;  2MA9 B;  4EKU A;  4DXF A;  1N60 A;  1I4R A;  1CQV A;  1ZDX A;  2PKO A;  3QCA A;  2MCN B;  1IPG A;  2WXN A;  3AE1 B;  2LHE A;  2PPH A;  3VTU A;  3MFG A;  3SDL C;  2KAC A;  4W9H A;  1V5T A;  3PRZ A;  1I4H A;  2JYT A;  4CQN A;  4S17 A;  1BT0 A;  1C76 A;  3DDC B;  1ZDV A;  2WXR A;  3H8H A;  3QIJ A;  4HPL B;  1HEZ E;  3URY A;  4YTN B;  2RGF A;  2Y5B B;  2WXH A;  4AWJ A;  1QOA A;  3R8B A;  4M0W A;  2AWT A;  2LGY A;  3N30 A;  4MJS A;  3CST A;  4YSZ B;  2MWS B;  3NZU A;  4AJY B;  3M95 A;  1QOG A;  1L2N A;  1OFF A;  3V61 A;  5LNK 1;  1JRO A;  1I4P A;  2JXX A;  3RNC C;  3VFK A;  2RPQ A;  2A4Z A;  1E8X A;  2JVC A;  1OQY A;  1VDV A;  4LJP B;  1WGR A;  4ICU A;  2BS4 B;  4RF1 A;  3B08 A;  2V9H A;  1FNU A;  2DAJ A;  4WQO B;  1V1P B;  2H89 B;  3Q8E A;  5T8I A;  1JML A;  2H88 B;  3AE4 B;  2WXI A;  2RSU A;  2N1W A;  2MBB B;  2WDR B;  4P7I A;  5DPW A;  1ET9 A;  2W3R A;  2O2V B;  3BII D;  5IAA C;  3P1M A;  4OHJ A;  2EEL A;  2C7H A;  3AEF B;  2WX0 A;  4HJG E;  4K1R B;  4W9E A;  3DBR B;  3WA0 A;  1UGM A;  4BFR A;  3U2S C; 
#chains in the Genus database with same CATH homology
 3Q3M C;  3N1Y C;  3RI7 C;  1T0Q C;  3Q3O C;  3RNA C;  3Q2A C;  1T0S C;  2INC C;  3N1X C;  3RMK C;  4P1B C;  3RNC C;  3RNB C;  3N1Z C;  3RNF C;  3RNE C;  3N20 C;  3GE8 C;  2IND C;  3Q14 C;  1T0R C;  3DHH C;  3DHG C;  3I5J C;  3I63 C;  2RDB C;  3GE3 C;  3DHI C;  4P1C C;  3RNG C;  3RN9 C;  3Q3N C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...