3GE3C

Crystal structure of the reduced toluene 4-monooxygenase hd t201a mutant complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
83
structure length
83
Chain Sequence
b'SAFPVHAAFEKDFLVQLVVVDLNDSMDQVAEKVAYHCVNRRVAPREGVMRVRKHRSTELFPRDMTIAESGLNPTEVIDVVFEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toluene-4-monooxygenase system protein A
publication title Role for threonine 201 in the catalytic cycle of the soluble diiron hydroxylase toluene 4-monooxygenase.
pubmed doi rcsb
source organism Pseudomonas mendocina
molecule tags Oxidoreductase
total genus 25
structure length 83
sequence length 83
ec nomenclature ec 1.14.13.236: Toluene 4-monooxygenase.
pdb deposition date 2009-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 3ge3C00
3N1YC 2INCC 3GE3C 4P1BC 1T0RC 3N1XC 3Q14C 3Q3OC 3RN9C 3GE8C 3RNAC 4P1CC 3RNEC 3I5JC 3RNGC 3Q3MC 3RNFC 3N1ZC 3RI7C 3N20C 3DHIC 3Q2AC 1T0SC 1T0QC 3I63C 3DHHC 2INDC 3RMKC 3RNCC 2RDBC 3Q3NC 3RNBC 3DHGC
chains in the Genus database with same CATH superfamily
4LJPB 3QIJA 1VCBA 4FJYA 4MACA 1I4GA 1XT9B 3RFZB 3IAS1 1ENFA 2KWVB 4M0WB 2KKCA 2JQRB 2DZJA 5G5GA 5HHDG 4LNNA 4RGNA 5KHOA 4IKGA 3M63B 4REZA 4F1SA 2J7QB 1WGRA 2FNJB 1WX8A 3QC8B 3PZ8A 3T3NA 4NQLB 3QQ8B 1PYWD 3RI7C 2DBYA 4I6PA 4LK0M 1VJKA 4ZHPA 3VUYA 2FUHB 2A4ZA 2PVOD 4TQ1A 4MSQB 2RDBC 4OW0A 3DWMA 1AN8A 2MBOA 2D11A 2L83A 4NAWB 1IPGA 4P1CC 1UNSA 2LJIA 4GDKB 1UBQA 4P6VF 4PS7A 2SEBD 1V80A 4BVUC 3ZRCA 2JWZA 2YEPB 4XE0A 4ZOHC 1B9RA 2N9LA 3BIID 2BKFA 5JXVA 4ARCA 1WGKA 2IJ0A 3HVZA 2R2QA 4JWUC 3AB5A 3ONSA 2V9HA 3DHIC 4L1BA 4MGYE 2YEPF 2GLSA 2KVZA 2K6DB 5LXIB 4G11A 2BT6A 1XXGA 3U8ZA 5D3DA 4GGQA 3TMPB 4E74A 4HLEA 2OOBB 5FKAC 3SD5A 4NNJB 2WXRA 2KXJA 3AI5A 2N7JA 5IO9A 3ECIA 2N7DA 3NZ3A 1AW7A 3V6EB 3KYCD 1TT5B 3C8YA 1RYJA 2LRWA 3V6CB 2MEKA 1IGDA 1SGHA 5JHBA 2V1YA 3APDA 1C1YB 3R2TA 1QLBB 1V6EA 2AQ1B 4BFRA 4CHKA 2IO1B 1C4PA 3S2AA 1PGAA 4E3CA 1CMXB 5E6OA 2LWPA 3A1QB 2FUG1 3ML9A 1T0YA 3BINA 4MELA 1TKEA 4P16A 3TIXA 4WWPA 1RWSA 2KFJA 2W3RA 4USAA 2BS2B 2H88B 5C23A 2AYOB 2PLPA 3NRZA 1YMHE 2KDBA 1QF6A 2WXKA 1K51A 1V1PB 3KYDD 2CKHB 4MH0E 1ZE3D 2INCC 3NG0A 3D32A 4DDGD 5C1ZA 3JYUA 4M8NA 4AUQC 2KVRA 3SHQA 1ZUD2 2AX5A 2WX0A 1WWTA 4KKJA 4JPSA 2MBHA 4BOZB 1GOZA 4ANWA 1T0SC 1V97A 1OQQA 2WXOA 5DPWA 1E9MA 5C3JB 1JRPA 2JXXA 4TQ0A 1XF5L 4A8XC 4J6IA 3UIPB 1WE6A 2L0TA 3U4EG 5AZHA 3QA8A 4I6LB 4IWPA 2LGSA 3ZJVA 3UINB 1WX9A 3NVYA 4YTMB 3WCQA 4D2KA 3DVGX 2L7RA 4AJYB 2Z0EB 3DVGY 2QJLA 3ENEA 3QWZB 4W9IA 2JU6X 2PEAA 1SBBB 1WM2A 2CHZA 5G2NA 1EM7A 3PTFC 2MP2A 4BAXA 3KQ4A 1YJIA 1WIAA 1P0RA 4L2YA 2RPVA 2WXPA 2KFKB 5E6PA 2NPTB 1GUAB 2J0KA 5FK9C 4AS1A 4N6EB 1GB4A 5GMVA 1GC6A 3RNBC 1SE4A 1YOVB 4PS3A 3PPAA 4HK2A 3IAM1 3L10B 1ZOYB 1ESFA 3N3KB 4ZRIA 1TTNA 4YXDB 4W9FA 4ZHOA 2JZPA 2INNE 3DQVA 4C56C 2L0FA 4W9DA 1QQRA 2FAZA 2LGIA 3TEYA 2DWQA 3APCA 3EC8A 3N32A 3AULA 2BW2A 4PK1A 2BVCA 4KX6B 1I4QA 2ZPYA 3PHWB 1K52A 3U30A 2WQYB 1LXDA 3RN9C 2K6QA 2PMVA 3A9JA 3P2BA 1LQBA 1GG3A 2JVCA 1RRBA 2LGXA 2RDHA 1WR6E 3ZYYX 1N63A 3BY4B 1YD8U 3BVZA 3ZO5B 3PRZA 2KD0A 2KDEB 3L13A 2H89B 4WAAA 1UWMA 1H4RA 3ZVVA 3DBRI 5BMHA 4W9JA 1V5TA 2BS3B 2QC8A 3I9V1 1DGJA 1IGCA 3KWLA 1WXQA 3H8HA 3V05A 2C7NB 2SAKA 3CF6E 2KC2A 2JF5A 4WJNA 4WJPA 1WRIA 4HROA 3AECB 4MGKE 3A4SC 2NS5A 4YT0B 4FLHA 4K3CA 2NBUA 2CS4A 2G45B 2JRHA 4PT5A 1S1QB 1HZ6A 4XZ4A 2QILA 3AE8B 4KSKC 2EMTA 4W9KA 3OG5A 4DDID 4DXFA 4RFBA 1P7EA 1NVID 2VRRB 5I4DA 4ANUA 5BYSA 3ZDTA 3EA6A 3KW5B 2N1WA 4KKIA 1N62A 5AUKA 2M0XA 2DAJA 2PPHA 2V3SA 1IBXB 3BVGA 4HPMB 4JX1C 3CIRB 5HG2A 4HEA1 1V5OA 4N58A 3IBEA 1ZXIA 2QMTA 3RPFC 5IOIA 3IHPC 3OWEB 4AJWA 2M56B 4TMAB 5CHWA 3H7PA 3HM6X 2MA9B 1V8CA 2WWZA 3MJ5A 4I6NB 4M01A 5E6NA 1N6ZA 3PREA 2CR5A 2EKIA 4FHJA 1V2YA 3JW0X 2A5UA 2KJ6A 3OJ3A 2IGGA 1L6UA 3I63C 4FN2A 1TZOA 4YL8A 2IO3B 1T5XD 3OAWA 1DOYA 1JWSD 3VRBB 3AE4B 3X23A 1L4ZB 1PUTA 1N5WA 2BWES 3RNAC 2JUOA 1VLBA 4DXGA 2DYBA 4KV2A 3BVMA 2IPKD 4URKA 1FRDA 4YSZB 1OEYA 1FNVA 5HKHA 4HCPB 4HJKA 3R8BA 5LNK1 4FJZA 2ZPNA 4GIVA 3NOBA 2K0PA 3P4PB 3A9KA 3L08A 3B08A 1FMAD 2HE7A 2C9WB 1XCQL 4KIKA 4ZYNA 1CJEA 4H2AA 1NYQA 3MC9A 3ZKJC 3NUHB 4GU2A 2RD0A 1SSNA 3Q3FA 4UDUC 3T8MA 3DVNU 4W9CA 2ZNVC 2KO3A 1HA5A 1FCCC 1J7BA 3Q3JA 5BYQA 1YN5A 2NVUI 4JIOU 1WZ0A 2DHZA 3NVZA 4NQKE 3RMKC 1E5WA 2IBIB 1XCTL 4YTPB 2NTSA 2K22A 3IXSA 3H7SA 1A5RA 1Q5WB 2KMMA 1TZ1A 4HDQA 1JALA 1TS5A 1YQ3B 2W9NA 1Q10A 2IY1B 2D2QA 1P1AA 3X0WA 3DBRB 1F0ZA 1V1PA 2W82A 3AXCA 1WH3A 4WJQA 3PSEB 1E8XA 3DCGA 4KSLC 1I42A 2MH7A 1IUEA 1L0XB 1F77A 2CU1A 1WXAA 2HDEA 4N9F4 5DPRA 2LMCA 2K3UA 2IZVB 2KLGA 2N7EA 4XGAB 2V4LA 2LFIA 1NBFC 1QOFA 4HVBA 1E7PB 1E6EB 2O2VB 2WXQA 2Z8LA 3VTWA 4AQ7A 2BYTA 4HPPA 3VRAB 3ZNHB 1DOIA 2XEWA 2KQ4X 1ET9A 4YSXB 1J8CA 1L2NA 3DWGC 1HEZE 5H8YE 2MX2A 3EHVA 4LLGM 4C7ZA 1OGWA 2ASQA 4KVGB 2QIEB 2L32A 2JX5A 3QHTA 3VUXA 2QHOA 4LDTD 2KJRA 4OVUA 4GB9A 2JT4B 1EF5A 1SIFA 3RZWC 1ACCA 2CHXA 3P4QB 3RNCC 1LGRA 1N61A 3P4RB 3RUIB 2KWUB 3M3JA 2AWTA 3N1YC 2L3ZA 4DBGA 1FCLA 3TCAA 4AOFA 1MG8A 5AZFA 3RNEC 4ITKA 3BYYB 1ZGUB 3AU4A 2KN4A 3Q2AC 4WH4A 1XQQA 2MHJA 2GB1A 2Q5WD 3Q8EA 2VZKD 3MC8A 2IO2B 1J19A 4NAMA 3AEGB 4MM3B 1UGJA 3MHZA 2FE8A 5E6JA 1MFWA 1JRUA 1L0YB 3ZRFA 4JL9A 3Q14C 4OZBA 2JRIB 2LRUA 3CSTA 1BMLC 1J7AA 4GDLA 1QOAA 3M62B 2NMQA 5KHQA 1L0VB 3RD2A 3ZQ4A 4WWNA 1ZPSA 4WWOA 3Q3NC 3ZW3A 2J52A 3AE1B 3JSVA 3AE7B 2K25A 2KQSA 4TV3A 2FBWB 4ZRKA 3H1UA 3B1LX 3T3OA 1MG4A 5BO4B 2HJ8A 2JXTA 4KDIC 2WDRB 1M4VA 3I3TB 3Q8BA 2WXGA 4NJ7A 4P7IA 2WYQA 5EDSA 4G50A 1I4RA 4NY0A 2LJ5A 5FR3A 2B76B 1WXMA 1KFYB 3N1ZC 2AL3A 4FBJB 3AE9B 1C4AA 2DENB 3ZLZA 4K7SA 4OZAA 4E71A 1S3SG 1GPXA 3WAMA 3ZNZB 3RT3B 2EKEC 4XWWA 1DYQA 4KGSA 4IOIE 4FADA 1WGGA 4RGOS 1QOGA 1SJHD 4K7WA 1EO6A 3H6NA 2N9KA 2Y5PA 5H92C 5J2RA 3U7DA 1K8RB 2ACZB 3BWUD 2WDTB 2JPHA 2RMMA 3B9JA 3CWIA 2ZW0A 2XK5A 3IT6B 1WI0A 2AL6A 2BBCA 3B2FA 3MHSD 3DPDA 5CHVC 2RSUA 4N59A 4RGTA 1E0ZA 4HPLB 1G6JA 2W55A 5DPSA 2KTRA 1STEA 3KUDB 1EU4A 1DOXA 1E8YA 3VHTC 1I35A 4DHJD 2WLBA 2TSSA 4ANXA 1OQRA 1C76A 2XBBC 4FULA 1BUIC 4W9LA 1PFDA 1QKZA 4IDIA 1WJ6A 4K81A 4XDCA 3I5JC 3MJWA 2KWDA 4US9A 4C4VB 4IWQA 3PZ7A 1D5MC 3W9CB 3Q8AA 4MEMA 2KTFA 4KGTA 3AV8A 4PYZA 1E90A 2BTEA 2M8SA 2M4NA 3N9YC 3GZNI 2BGFA 3CMMB 3GOEA 4M02A 1V9JA 1FM0D 3TSSA 5IN7A 2BYFA 2LI5A 1K53A 2MWSB 1WMHB 2NBVB 2BPSA 1LM8B 2FCMA 4A3OA 1XLNA 4C7YA 3Q8FA 2G3QB 1Q0WB 2N4FA 2J53A 1X1MA 3NVVA 1XD3B 3W1SA 1YIWA 1V86A 1JQ4A 2G4DB 3RZFA 2K1FA 3VXWA 1JWAD 3V3XA 4HRSA 1TYGB 3L0WB 3AEAB 4S0RA 2L05A 4XC2A 5BYRA 1FIQA 1VZ6A 1V49A 2WU5B 4A3PA 1IP9A 4BKSD 4KZ0A 3ZDMC 3PO0A 3AE6B 3VVWB 2M1MA 4F8CB 5BMGA 4ICUA 5IA7A 3ETRA 2C7HA 1SE3A 3FILB 1WM3A 2CU3A 4XYCA 4BKSA 2J0MA 4B0MA 3Q69A 3ZIMA 1SB3C 3WAOA 2XN9C 2IYDB 4CYEA 2M19A 1A70A 3KLSX 3QK0A 4DHZE 2IY0B 2WU2B 1FNUA 2M0AA 2PVGC 3L54A 2WS3B 2ZCBA 3AMZA 1I4HA 4CQNA 1JMLA 3ABVB 1FFVA 5D2MB 1AYFA 1SE2A 1HQRD 2EMSA 1KM7A 1JROA 4ZRQA 1WGYA 2VH1A 4MJSB 1E8WA 4LTUA 4ACFA 3ZUNA 4HWIB 4DWFA 1HTQA 3PGEA 4WIPA 2LXCA 1FRRA 2J0JA 4LNFA 4G3XB 2V4IB 4NJ6A 1NEKB 1SXTA 3AU5A 1YJJA 5IAAC 2RGFA 1HXYD 1WX7A 4EEWA 1TBEA 3NJTA 1ROEA 1L4DB 1F1HA 2N1VA 2ON8A 3W5VB 2DZKA 3GP7A 4W9HA 3VTUA 3UQBA 2KACA 2M17A 2O6VB 4KDLB 4IW0A 5L95C 5IP4D 4M0WA 3SR6A 3MP9A 2LGDA 2MSED 4FA6A 1PQSA 2ZEQA 1TY0A 1XLOA 5EE9A 1R4NI 1YNTE 1XLPA 4ZDVA 4KGRA 5TR5A 1MHXA 2ZNVB 3P1MA 3QAQA 3GZNB 4B0EA 3W1YA 1UBIA 1ZXHA 3V62A 3VQIA 2DZIA 3J9CA 1F2RC 4NZLB 1E7VA 2LZ6A 1WSPA 2DYOA 4BKTA 2OJRA 3L16A 1VD2A 1PGXA 4NAWA 1TY2A 2QDFA 2JYTA 3I57A 4GDKA 2DYMA 2BQQA 2MBEA 2V3NA 3W2DA 2CJNA 2BWFA 5HFYA 2D3CA 1MVKA 1N5XA 4II3B 3R7RA 2KHWB 3EUB2 1V81A 3WALA 3IFWB 3U2SC 5EE3A 1Y56A 2JZZA 3OLMD 1UF0A 1Y8RC 2C7MB 3LXFA 1P3QU 1I4PA 4US8A 2QSDA 3FAHA 4L23A 3NY5A 4R3DA 1J7CA 1C79A 1VZ8A 1JWMD 3NS8A 1T6BX 2PIAA 1FO4A 1IYFA 4MGIE 1ZW7A 3TEWA 2WDQB 1TS3A 5LLIA 2MP2B 5CHFA 1YJ1A 2GRIA 2MW5A 3ZXRA 1OTRB 1HTOA 4WAFA 5D3IB 4RGMA 2LVOA 3BZDB 1P7FA 5EE1A 1KF6B 1FFUA 3A1QA 4ZRJA 2N9EB 5FR6A 4XWTA 3HRDD 4II2B 1YX6B 2WHIA 1NI3A 2LD9A 4RNAA 5D94A 2JSVX 5CX3A 4OZCA 1RAXA 3LDZE 4GLSC 2PJHA 2N9PC 3DHGC 4TKNA 3P63A 2BB5A 1V1OA 4BOSC 2WP9B 2IGDA 3ZJTA 4ASWC 3Q6BA 3L17A 3A9JB 2AQ2B 1RLFA 1CZPA 3KWVA 1NYRA 2MBBB 4O1NA 3VH4B 4EZLA 2K8CA 1SIJA 4ARIA 4FJVB 1B1ZA 2DNFA 3BK1A 3ML8A 1UH6A 3ZTDA 3GE8C 4B95A 4ZRPA 3P4SB 4WQMA 1WJ4A 4HDOA 3W1SC 2XNAC 4MH8A 4A9AA 4EKUA 3MTNB 2WXMA 3AE2B 1XEEA 2DZMA 4RM8A 5G5HA 1AWDA 2MJ3A 2D07B 5BMIA 1E10A 3VR8B 2MJEA 4RF1A 3SDLC 3WIMA 1TS4A 3IVFA 3R66C 4J3OD 1UD7A 2CJOA 2KFKA 2DLBA 2NPTA 2I1JA 2W3SA 1WXSA 2LUMA 5L83A 2D3AA 2MLBA 1FXTB 1R4NB 4HJGE 4JLCA 3IT4B 2MRPA 3PV1A 5IKCM 1FPYA 2B3AA 4W9EA 1KH0A 3PRPB 3M95A 1KLUD 2LHDA 3C19A 3RNGC 1BT0A 1YQBA 2LASA 1J0GA 4RCOA 5MPOA 1T0QC 1NDDA 3JVZX 2GBKA 2IDYA 1SF0A 3FILA 1UWXA 3QX1A 1E8ZA 4NJCA 2LHEA 2LGYA 2I38A 3H7PB 4IM3A 4WWMA 4FXCA 2LEKA 3TBLD 1SJED 3A33B 2I1KA 2K8BA 2K9XA 2KMCA 4WJOA 1C3TA 1L7YA 4GSWA 2V0GA 2Y3AA 4TUUA 2JZ3B 5CTRC 1EU3A 1GAQB 4AP4C 1WGHA 4GN1A 1UZXB 3ZGZA 3N1XC 1XO3A 1OQYA 3Q8CA 5AEKB 4LJOB 2KX0A 1WY8A 4K1RB 2E6XA 4RF0A 3KH0A 1WR1A 2D5GA 5AZGA 4HCNB 4MJSA 3PLVA 1WF9A 1Z2MA 1PDXA 3KVFB 3TEZA 1BXTA 1TKYA 4LNKA 2J42A 1WYWB 2OHFA 3CSFA 2YLMA 1F2RI 2GBMA 4X57B 1GNUA 5C2TB 2HTHA 2LUEA 4MDKE 1LFDA 2O6VD 3NVWA 1VZ7A 3QARA 3A9KB 1UELA 4KIKB 1YN3A 1WRDB 2AQ3B 2X38A 1D5XC 1D6EC 1M94A 1EUVB 1MHHE 1IBXA 5D6JB 4MSMB 3UIOB 1FXIA 2O6VA 3TL5A 3DDCB 1P98A 3R3MA 2D3GA 1D3ZA 1L5PA 2FCSA 3R7QA 1C4CA 4YSYB 2R61A 1F52A 2WXNA 3W5UB 1C78A 4B9KA 3IG3A 4MGZE 3QJZA 4GOCA 4M00A 4ZYSA 1Z5SB 2PE9A 3N30A 4IM2A 2D10A 1TS2A 1WGDA 2D3BA 3LYYA 3WANA 3DBSA 2KT7A 1AARA 1RM6C 4RMAA 1WFYA 1D4BA 2ICIA 2K39A 4PS8A 3SFEB 1CK1A 3PZDA 5EE0A 4EE2A 1ZP0B 2UWQA 3P42A 3VTVA 3PT2B 2KOXA 4IUMB 3H9DA 2JY6A 3WA0A 3BYTB 1CQVA 2KDIA 3AEEB 2KDMA 3EFUA 2LVQA 2GBRA 1ZDXA 2KK8A 1KTKA 3AEBB 4LNIA 4DHZB 3DBHI 4YTNB 3DVNV 4ICVA 1T3QA 2QCZA 4P1BC 2J4XA 2I2YA 3VR9B 5DPTA 5TSSA 5J18A 4BKGA 1ISNA 1YX5B 2KAJA 3AE3B 4AWJA 1YN4A 4TSSA 3RNFC 1FNWA 3O65B 2NBWB 1R4MI 3HUIA 2NTTA 1WJUA 1H8CA 1SEBD 3ZJUA 2V3PA 4A90A 3AH7A 2BS4B 3HK0A 1KLGD 2WXJA 3HHMA 4LDTB 2GI9A 2WDVB 2KYWA 3GS2A 4S17A 3TEXA 3VDZA 3SU8X 1R7SA 2CHWA 4XX5A 1E7UA 2G9HD 2N9XA 1UUPA 4Q2JA 3FKYA 3EGRA 3PHXB 2JWUA 4RM9A 2KANA 4GDLB 2BF8B 2L8JA 3L4PA 2LXAA 3HM3A 3RCZA 2VZKB 1WYGA 4A20A 3RYTA 3ZXVA 2KQ7A 3U52E 1P9DU 2K8HA 3UQAA 3DBLI 1RFKA 3AEDB 3GE3C 1T0RC 1NI2A 3NHEB 2HJ1A 3MC0B 3JSVB 2Y5BB 2KDFB 2O2VA 1KLVA 2BYVE 3AM9A 2UU7A 2FIFA 3R2IA 3NZSA 3A4RA 2KJHB 3LB8C 2ZVNA 2W54A 4PYUA 2K5PA 2N0SB 1HE8A 2G1EA 1WJNA 3KUZA 2MCNB 1TIFA 1QT9A 4K3BA 2MQJA 2KLCA 2KX3A 3N20C 3DOWA 4IC7B 2ZCCA 2L52A 3VUWA 2PTLA 2AEHA 4EZJA 1PGBA 4OHJA 4DK5A 4LCDE 2QEJC 4C00A 1FEHA 2Y5CA 3AEFB 2YVCA 4OVZA 4IWOA 1ZKHA 1HZ5A 1I7HA 3Q3MC 2LVPA 2C5LC 3B2GA 5JHAA 3GB1A 3AN1A 5G55A 4HKQA 2NCNA 2WXHA 3K9PB 1TKGA 1K50A 4MM3A 4BZAA 1FD6A 5D7GA 4EZKA 1C9FA 2OEDA 2XK5B 3UGBB 1MI0A 3UF8A 3HIZA 4EOYA 3PLUA 2FCQA 5JZEB 3LJ3A 2KNBA 2ONQA 2KTRB 2WGSA 2DX5B 2GOWA 1VR9A 2KWCA 2GMIC 3HVDA 4DQOC 4WQOB 4F7ZA 1KJTA 4RH6A 1KRHA 1U4AA 1MJDA 4B6WA 2BB6A 1QOBA 3Q3OC 3DBHB 1KOTA 3OJ4B 1RFAA 3U7ZA 4YWGG 5AUIA 3ZNID 4DHJB 4XDDA 2BKRB 4HKZE 4MT5A 2IO0B 5GXGB 1EWCA 2KZRA 5LXHA 1OFFA 1QZEA 1R4MB 3VFKA 5DCNA 1GC7A 3C0RB 3WAPA 4JGHB 2ZVOA 2WXFA 4IG7B 4QAYA 2X8XX 2WXLA 2OJWA 4LNOA 2G4SA 4EUTA 2IGHA 4C80A 3FC4A 4G0NB 3O13A 1OEYJ 3EFCA 5J17A 2UYZB 3TJPA 1EWYC 2PE6B 3UI3A 4WURA 3URYA 1WXVA 2WXIA 2L1AA 2NR2A 1F9JA 1WZ3A 1GJZA 1VRAB 1GB1A 3DHHC 1SE9A 3PRMB 4HXDA 2GBJA 3VH3B 2WX1A 4A55A 1MPEA 2R2OA 2RDGA 2E3TA 1YQ4B 4KZCA 1D5ZC 2RPQA 4M8MA 2C60A 4BBNF 3QCAA 2ZZPB 1ET6A 3DBLB 1JWUD 3T9LA 3RULA 1JCKB 2HTME 1N60A 3NS1A 3BK2A 3ZTCA 2MJDA 2INPE 4ANVA 5JH5C 2VH2A 4JE3B 2PKOA 2PW9A 4DXAB 1UGMA 4JWSC 3NZUA 4NPNA 1I4XA 4C4VA 3SFDB 1L6VA 1VDVA 2FCNA 3E56A 4FHKA 1WE7A 3EECA 2RR9A 2ZW1A 3K9OB 4A6QA 2HD5B 1NENB 2INDC 1JW9D 1Q1OA 2Z0DB 3TUOA 3V60A 3PS6A 2L00B 3V61A 2KN5A 3B0AA 3E9SA 4IM0A 2KC1A 2GBNA 2KMAA 3KUCB 4K7UA 2DAFA 1TGZB 3SEBA 1WMHA 5HI1A 1EF1A 4BBNC 2FIDA 2JYEA 2L76A 2WNMA 4CO7A 2Z59B 2EELA 1QILA 2REXA 4W9GA 3VAWA 4EFOA 1FXAA 1LO5D 4GXBA 3APFA 3ZNGC 1XLQA 3PVLA 3MFGA 1C77A 2BYEA 1JWBD 3ALBA 5T8IA 1ZDVA 4GMVA 4OVVA 2MBQA 3AE5B 2ZJDA 1TJEA 4JQWC
chains in the Genus database with same CATH topology
3N1YC 2INCC 3GE3C 4P1BC 1T0RC 3N1XC 3Q14C 3Q3OC 3RN9C 3GE8C 3RNAC 4P1CC 3RNEC 3I5JC 3RNGC 3Q3MC 3RNFC 3N1ZC 3RI7C 3N20C 3DHIC 3Q2AC 1T0SC 1T0QC 3I63C 3DHHC 2INDC 3RMKC 3RNCC 2RDBC 3Q3NC 3RNBC 3DHGC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N1Y C;  2INC C;  3GE3 C;  4P1B C;  1T0R C;  3N1X C;  3Q14 C;  3Q3O C;  3RN9 C;  3GE8 C;  3RNA C;  4P1C C;  3RNE C;  3I5J C;  3RNG C;  3Q3M C;  3RNF C;  3N1Z C;  3RI7 C;  3N20 C;  3DHI C;  3Q2A C;  1T0S C;  1T0Q C;  3I63 C;  3DHH C;  2IND C;  3RMK C;  3RNC C;  2RDB C;  3Q3N C;  3RNB C;  3DHG C; 
#chains in the Genus database with same CATH topology
 4LJP B;  3QIJ A;  1VCB A;  4FJY A;  4MAC A;  1I4G A;  1XT9 B;  3RFZ B;  3IAS 1;  1ENF A;  2KWV B;  4M0W B;  2KKC A;  2JQR B;  2DZJ A;  5G5G A;  5HHD G;  4LNN A;  4RGN A;  5KHO A;  4IKG A;  3M63 B;  4REZ A;  4F1S A;  2J7Q B;  1WGR A;  2FNJ B;  1WX8 A;  3QC8 B;  3PZ8 A;  3T3N A;  4NQL B;  3QQ8 B;  1PYW D;  3RI7 C;  2DBY A;  4I6P A;  4LK0 M;  1VJK A;  4ZHP A;  3VUY A;  2FUH B;  2A4Z A;  2PVO D;  4TQ1 A;  4MSQ B;  2RDB C;  4OW0 A;  3DWM A;  1AN8 A;  2MBO A;  2D11 A;  2L83 A;  4NAW B;  1IPG A;  4P1C C;  1UNS A;  2LJI A;  4GDK B;  1UBQ A;  4P6V F;  4PS7 A;  2SEB D;  1V80 A;  4BVU C;  3ZRC A;  2JWZ A;  2YEP B;  4XE0 A;  4ZOH C;  1B9R A;  2N9L A;  3BII D;  2BKF A;  5JXV A;  4ARC A;  1WGK A;  2IJ0 A;  3HVZ A;  2R2Q A;  4JWU C;  3AB5 A;  3ONS A;  2V9H A;  3DHI C;  4L1B A;  4MGY E;  2YEP F;  2GLS A;  2KVZ A;  2K6D B;  5LXI B;  4G11 A;  2BT6 A;  1XXG A;  3U8Z A;  5D3D A;  4GGQ A;  3TMP B;  4E74 A;  4HLE A;  2OOB B;  5FKA C;  3SD5 A;  4NNJ B;  2WXR A;  2KXJ A;  3AI5 A;  2N7J A;  5IO9 A;  3ECI A;  2N7D A;  3NZ3 A;  1AW7 A;  3V6E B;  3KYC D;  1TT5 B;  3C8Y A;  1RYJ A;  2LRW A;  3V6C B;  2MEK A;  1IGD A;  1SGH A;  5JHB A;  2V1Y A;  3APD A;  1C1Y B;  3R2T A;  1QLB B;  1V6E A;  2AQ1 B;  4BFR A;  4CHK A;  2IO1 B;  1C4P A;  3S2A A;  1PGA A;  4E3C A;  1CMX B;  5E6O A;  2LWP A;  3A1Q B;  2FUG 1;  3ML9 A;  1T0Y A;  3BIN A;  4MEL A;  1TKE A;  4P16 A;  3TIX A;  4WWP A;  1RWS A;  2KFJ A;  2W3R A;  4USA A;  2BS2 B;  2H88 B;  5C23 A;  2AYO B;  2PLP A;  3NRZ A;  1YMH E;  2KDB A;  1QF6 A;  2WXK A;  1K51 A;  1V1P B;  3KYD D;  2CKH B;  4MH0 E;  1ZE3 D;  2INC C;  3NG0 A;  3D32 A;  4DDG D;  5C1Z A;  3JYU A;  4M8N A;  4AUQ C;  2KVR A;  3SHQ A;  1ZUD 2;  2AX5 A;  2WX0 A;  1WWT A;  4KKJ A;  4JPS A;  2MBH A;  4BOZ B;  1GOZ A;  4ANW A;  1T0S C;  1V97 A;  1OQQ A;  2WXO A;  5DPW A;  1E9M A;  5C3J B;  1JRP A;  2JXX A;  4TQ0 A;  1XF5 L;  4A8X C;  4J6I A;  3UIP B;  1WE6 A;  2L0T A;  3U4E G;  5AZH A;  3QA8 A;  4I6L B;  4IWP A;  2LGS A;  3ZJV A;  3UIN B;  1WX9 A;  3NVY A;  4YTM B;  3WCQ A;  4D2K A;  3DVG X;  2L7R A;  4AJY B;  2Z0E B;  3DVG Y;  2QJL A;  3ENE A;  3QWZ B;  4W9I A;  2JU6 X;  2PEA A;  1SBB B;  1WM2 A;  2CHZ A;  5G2N A;  1EM7 A;  3PTF C;  2MP2 A;  4BAX A;  3KQ4 A;  1YJI A;  1WIA A;  1P0R A;  4L2Y A;  2RPV A;  2WXP A;  2KFK B;  5E6P A;  2NPT B;  1GUA B;  2J0K A;  5FK9 C;  4AS1 A;  4N6E B;  1GB4 A;  5GMV A;  1GC6 A;  3RNB C;  1SE4 A;  1YOV B;  4PS3 A;  3PPA A;  4HK2 A;  3IAM 1;  3L10 B;  1ZOY B;  1ESF A;  3N3K B;  4ZRI A;  1TTN A;  4YXD B;  4W9F A;  4ZHO A;  2JZP A;  2INN E;  3DQV A;  4C56 C;  2L0F A;  4W9D A;  1QQR A;  2FAZ A;  2LGI A;  3TEY A;  2DWQ A;  3APC A;  3EC8 A;  3N32 A;  3AUL A;  2BW2 A;  4PK1 A;  2BVC A;  4KX6 B;  1I4Q A;  2ZPY A;  3PHW B;  1K52 A;  3U30 A;  2WQY B;  1LXD A;  3RN9 C;  2K6Q A;  2PMV A;  3A9J A;  3P2B A;  1LQB A;  1GG3 A;  2JVC A;  1RRB A;  2LGX A;  2RDH A;  1WR6 E;  3ZYY X;  1N63 A;  3BY4 B;  1YD8 U;  3BVZ A;  3ZO5 B;  3PRZ A;  2KD0 A;  2KDE B;  3L13 A;  2H89 B;  4WAA A;  1UWM A;  1H4R A;  3ZVV A;  3DBR I;  5BMH A;  4W9J A;  1V5T A;  2BS3 B;  2QC8 A;  3I9V 1;  1DGJ A;  1IGC A;  3KWL A;  1WXQ A;  3H8H A;  3V05 A;  2C7N B;  2SAK A;  3CF6 E;  2KC2 A;  2JF5 A;  4WJN A;  4WJP A;  1WRI A;  4HRO A;  3AEC B;  4MGK E;  3A4S C;  2NS5 A;  4YT0 B;  4FLH A;  4K3C A;  2NBU A;  2CS4 A;  2G45 B;  2JRH A;  4PT5 A;  1S1Q B;  1HZ6 A;  4XZ4 A;  2QIL A;  3AE8 B;  4KSK C;  2EMT A;  4W9K A;  3OG5 A;  4DDI D;  4DXF A;  4RFB A;  1P7E A;  1NVI D;  2VRR B;  5I4D A;  4ANU A;  5BYS A;  3ZDT A;  3EA6 A;  3KW5 B;  2N1W A;  4KKI A;  1N62 A;  5AUK A;  2M0X A;  2DAJ A;  2PPH A;  2V3S A;  1IBX B;  3BVG A;  4HPM B;  4JX1 C;  3CIR B;  5HG2 A;  4HEA 1;  1V5O A;  4N58 A;  3IBE A;  1ZXI A;  2QMT A;  3RPF C;  5IOI A;  3IHP C;  3OWE B;  4AJW A;  2M56 B;  4TMA B;  5CHW A;  3H7P A;  3HM6 X;  2MA9 B;  1V8C A;  2WWZ A;  3MJ5 A;  4I6N B;  4M01 A;  5E6N A;  1N6Z A;  3PRE A;  2CR5 A;  2EKI A;  4FHJ A;  1V2Y A;  3JW0 X;  2A5U A;  2KJ6 A;  3OJ3 A;  2IGG A;  1L6U A;  3I63 C;  4FN2 A;  1TZO A;  4YL8 A;  2IO3 B;  1T5X D;  3OAW A;  1DOY A;  1JWS D;  3VRB B;  3AE4 B;  3X23 A;  1L4Z B;  1PUT A;  1N5W A;  2BWE S;  3RNA C;  2JUO A;  1VLB A;  4DXG A;  2DYB A;  4KV2 A;  3BVM A;  2IPK D;  4URK A;  1FRD A;  4YSZ B;  1OEY A;  1FNV A;  5HKH A;  4HCP B;  4HJK A;  3R8B A;  5LNK 1;  4FJZ A;  2ZPN A;  4GIV A;  3NOB A;  2K0P A;  3P4P B;  3A9K A;  3L08 A;  3B08 A;  1FMA D;  2HE7 A;  2C9W B;  1XCQ L;  4KIK A;  4ZYN A;  1CJE A;  4H2A A;  1NYQ A;  3MC9 A;  3ZKJ C;  3NUH B;  4GU2 A;  2RD0 A;  1SSN A;  3Q3F A;  4UDU C;  3T8M A;  3DVN U;  4W9C A;  2ZNV C;  2KO3 A;  1HA5 A;  1FCC C;  1J7B A;  3Q3J A;  5BYQ A;  1YN5 A;  2NVU I;  4JIO U;  1WZ0 A;  2DHZ A;  3NVZ A;  4NQK E;  3RMK C;  1E5W A;  2IBI B;  1XCT L;  4YTP B;  2NTS A;  2K22 A;  3IXS A;  3H7S A;  1A5R A;  1Q5W B;  2KMM A;  1TZ1 A;  4HDQ A;  1JAL A;  1TS5 A;  1YQ3 B;  2W9N A;  1Q10 A;  2IY1 B;  2D2Q A;  1P1A A;  3X0W A;  3DBR B;  1F0Z A;  1V1P A;  2W82 A;  3AXC A;  1WH3 A;  4WJQ A;  3PSE B;  1E8X A;  3DCG A;  4KSL C;  1I42 A;  2MH7 A;  1IUE A;  1L0X B;  1F77 A;  2CU1 A;  1WXA A;  2HDE A;  4N9F 4;  5DPR A;  2LMC A;  2K3U A;  2IZV B;  2KLG A;  2N7E A;  4XGA B;  2V4L A;  2LFI A;  1NBF C;  1QOF A;  4HVB A;  1E7P B;  1E6E B;  2O2V B;  2WXQ A;  2Z8L A;  3VTW A;  4AQ7 A;  2BYT A;  4HPP A;  3VRA B;  3ZNH B;  1DOI A;  2XEW A;  2KQ4 X;  1ET9 A;  4YSX B;  1J8C A;  1L2N A;  3DWG C;  1HEZ E;  5H8Y E;  2MX2 A;  3EHV A;  4LLG M;  4C7Z A;  1OGW A;  2ASQ A;  4KVG B;  2QIE B;  2L32 A;  2JX5 A;  3QHT A;  3VUX A;  2QHO A;  4LDT D;  2KJR A;  4OVU A;  4GB9 A;  2JT4 B;  1EF5 A;  1SIF A;  3RZW C;  1ACC A;  2CHX A;  3P4Q B;  3RNC C;  1LGR A;  1N61 A;  3P4R B;  3RUI B;  2KWU B;  3M3J A;  2AWT A;  3N1Y C;  2L3Z A;  4DBG A;  1FCL A;  3TCA A;  4AOF A;  1MG8 A;  5AZF A;  3RNE C;  4ITK A;  3BYY B;  1ZGU B;  3AU4 A;  2KN4 A;  3Q2A C;  4WH4 A;  1XQQ A;  2MHJ A;  2GB1 A;  2Q5W D;  3Q8E A;  2VZK D;  3MC8 A;  2IO2 B;  1J19 A;  4NAM A;  3AEG B;  4MM3 B;  1UGJ A;  3MHZ A;  2FE8 A;  5E6J A;  1MFW A;  1JRU A;  1L0Y B;  3ZRF A;  4JL9 A;  3Q14 C;  4OZB A;  2JRI B;  2LRU A;  3CST A;  1BML C;  1J7A A;  4GDL A;  1QOA A;  3M62 B;  2NMQ A;  5KHQ A;  1L0V B;  3RD2 A;  3ZQ4 A;  4WWN A;  1ZPS A;  4WWO A;  3Q3N C;  3ZW3 A;  2J52 A;  3AE1 B;  3JSV A;  3AE7 B;  2K25 A;  2KQS A;  4TV3 A;  2FBW B;  4ZRK A;  3H1U A;  3B1L X;  3T3O A;  1MG4 A;  5BO4 B;  2HJ8 A;  2JXT A;  4KDI C;  2WDR B;  1M4V A;  3I3T B;  3Q8B A;  2WXG A;  4NJ7 A;  4P7I A;  2WYQ A;  5EDS A;  4G50 A;  1I4R A;  4NY0 A;  2LJ5 A;  5FR3 A;  2B76 B;  1WXM A;  1KFY B;  3N1Z C;  2AL3 A;  4FBJ B;  3AE9 B;  1C4A A;  2DEN B;  3ZLZ A;  4K7S A;  4OZA A;  4E71 A;  1S3S G;  1GPX A;  3WAM A;  3ZNZ B;  3RT3 B;  2EKE C;  4XWW A;  1DYQ A;  4KGS A;  4IOI E;  4FAD A;  1WGG A;  4RGO S;  1QOG A;  1SJH D;  4K7W A;  1EO6 A;  3H6N A;  2N9K A;  2Y5P A;  5H92 C;  5J2R A;  3U7D A;  1K8R B;  2ACZ B;  3BWU D;  2WDT B;  2JPH A;  2RMM A;  3B9J A;  3CWI A;  2ZW0 A;  2XK5 A;  3IT6 B;  1WI0 A;  2AL6 A;  2BBC A;  3B2F A;  3MHS D;  3DPD A;  5CHV C;  2RSU A;  4N59 A;  4RGT A;  1E0Z A;  4HPL B;  1G6J A;  2W55 A;  5DPS A;  2KTR A;  1STE A;  3KUD B;  1EU4 A;  1DOX A;  1E8Y A;  3VHT C;  1I35 A;  4DHJ D;  2WLB A;  2TSS A;  4ANX A;  1OQR A;  1C76 A;  2XBB C;  4FUL A;  1BUI C;  4W9L A;  1PFD A;  1QKZ A;  4IDI A;  1WJ6 A;  4K81 A;  4XDC A;  3I5J C;  3MJW A;  2KWD A;  4US9 A;  4C4V B;  4IWQ A;  3PZ7 A;  1D5M C;  3W9C B;  3Q8A A;  4MEM A;  2KTF A;  4KGT A;  3AV8 A;  4PYZ A;  1E90 A;  2BTE A;  2M8S A;  2M4N A;  3N9Y C;  3GZN I;  2BGF A;  3CMM B;  3GOE A;  4M02 A;  1V9J A;  1FM0 D;  3TSS A;  5IN7 A;  2BYF A;  2LI5 A;  1K53 A;  2MWS B;  1WMH B;  2NBV B;  2BPS A;  1LM8 B;  2FCM A;  4A3O A;  1XLN A;  4C7Y A;  3Q8F A;  2G3Q B;  1Q0W B;  2N4F A;  2J53 A;  1X1M A;  3NVV A;  1XD3 B;  3W1S A;  1YIW A;  1V86 A;  1JQ4 A;  2G4D B;  3RZF A;  2K1F A;  3VXW A;  1JWA D;  3V3X A;  4HRS A;  1TYG B;  3L0W B;  3AEA B;  4S0R A;  2L05 A;  4XC2 A;  5BYR A;  1FIQ A;  1VZ6 A;  1V49 A;  2WU5 B;  4A3P A;  1IP9 A;  4BKS D;  4KZ0 A;  3ZDM C;  3PO0 A;  3AE6 B;  3VVW B;  2M1M A;  4F8C B;  5BMG A;  4ICU A;  5IA7 A;  3ETR A;  2C7H A;  1SE3 A;  3FIL B;  1WM3 A;  2CU3 A;  4XYC A;  4BKS A;  2J0M A;  4B0M A;  3Q69 A;  3ZIM A;  1SB3 C;  3WAO A;  2XN9 C;  2IYD B;  4CYE A;  2M19 A;  1A70 A;  3KLS X;  3QK0 A;  4DHZ E;  2IY0 B;  2WU2 B;  1FNU A;  2M0A A;  2PVG C;  3L54 A;  2WS3 B;  2ZCB A;  3AMZ A;  1I4H A;  4CQN A;  1JML A;  3ABV B;  1FFV A;  5D2M B;  1AYF A;  1SE2 A;  1HQR D;  2EMS A;  1KM7 A;  1JRO A;  4ZRQ A;  1WGY A;  2VH1 A;  4MJS B;  1E8W A;  4LTU A;  4ACF A;  3ZUN A;  4HWI B;  4DWF A;  1HTQ A;  3PGE A;  4WIP A;  2LXC A;  1FRR A;  2J0J A;  4LNF A;  4G3X B;  2V4I B;  4NJ6 A;  1NEK B;  1SXT A;  3AU5 A;  1YJJ A;  5IAA C;  2RGF A;  1HXY D;  1WX7 A;  4EEW A;  1TBE A;  3NJT A;  1ROE A;  1L4D B;  1F1H A;  2N1V A;  2ON8 A;  3W5V B;  2DZK A;  3GP7 A;  4W9H A;  3VTU A;  3UQB A;  2KAC A;  2M17 A;  2O6V B;  4KDL B;  4IW0 A;  5L95 C;  5IP4 D;  4M0W A;  3SR6 A;  3MP9 A;  2LGD A;  2MSE D;  4FA6 A;  1PQS A;  2ZEQ A;  1TY0 A;  1XLO A;  5EE9 A;  1R4N I;  1YNT E;  1XLP A;  4ZDV A;  4KGR A;  5TR5 A;  1MHX A;  2ZNV B;  3P1M A;  3QAQ A;  3GZN B;  4B0E A;  3W1Y A;  1UBI A;  1ZXH A;  3V62 A;  3VQI A;  2DZI A;  3J9C A;  1F2R C;  4NZL B;  1E7V A;  2LZ6 A;  1WSP A;  2DYO A;  4BKT A;  2OJR A;  3L16 A;  1VD2 A;  1PGX A;  4NAW A;  1TY2 A;  2QDF A;  2JYT A;  3I57 A;  4GDK A;  2DYM A;  2BQQ A;  2MBE A;  2V3N A;  3W2D A;  2CJN A;  2BWF A;  5HFY A;  2D3C A;  1MVK A;  1N5X A;  4II3 B;  3R7R A;  2KHW B;  3EUB 2;  1V81 A;  3WAL A;  3IFW B;  3U2S C;  5EE3 A;  1Y56 A;  2JZZ A;  3OLM D;  1UF0 A;  1Y8R C;  2C7M B;  3LXF A;  1P3Q U;  1I4P A;  4US8 A;  2QSD A;  3FAH A;  4L23 A;  3NY5 A;  4R3D A;  1J7C A;  1C79 A;  1VZ8 A;  1JWM D;  3NS8 A;  1T6B X;  2PIA A;  1FO4 A;  1IYF A;  4MGI E;  1ZW7 A;  3TEW A;  2WDQ B;  1TS3 A;  5LLI A;  2MP2 B;  5CHF A;  1YJ1 A;  2GRI A;  2MW5 A;  3ZXR A;  1OTR B;  1HTO A;  4WAF A;  5D3I B;  4RGM A;  2LVO A;  3BZD B;  1P7F A;  5EE1 A;  1KF6 B;  1FFU A;  3A1Q A;  4ZRJ A;  2N9E B;  5FR6 A;  4XWT A;  3HRD D;  4II2 B;  1YX6 B;  2WHI A;  1NI3 A;  2LD9 A;  4RNA A;  5D94 A;  2JSV X;  5CX3 A;  4OZC A;  1RAX A;  3LDZ E;  4GLS C;  2PJH A;  2N9P C;  3DHG C;  4TKN A;  3P63 A;  2BB5 A;  1V1O A;  4BOS C;  2WP9 B;  2IGD A;  3ZJT A;  4ASW C;  3Q6B A;  3L17 A;  3A9J B;  2AQ2 B;  1RLF A;  1CZP A;  3KWV A;  1NYR A;  2MBB B;  4O1N A;  3VH4 B;  4EZL A;  2K8C A;  1SIJ A;  4ARI A;  4FJV B;  1B1Z A;  2DNF A;  3BK1 A;  3ML8 A;  1UH6 A;  3ZTD A;  3GE8 C;  4B95 A;  4ZRP A;  3P4S B;  4WQM A;  1WJ4 A;  4HDO A;  3W1S C;  2XNA C;  4MH8 A;  4A9A A;  4EKU A;  3MTN B;  2WXM A;  3AE2 B;  1XEE A;  2DZM A;  4RM8 A;  5G5H A;  1AWD A;  2MJ3 A;  2D07 B;  5BMI A;  1E10 A;  3VR8 B;  2MJE A;  4RF1 A;  3SDL C;  3WIM A;  1TS4 A;  3IVF A;  3R66 C;  4J3O D;  1UD7 A;  2CJO A;  2KFK A;  2DLB A;  2NPT A;  2I1J A;  2W3S A;  1WXS A;  2LUM A;  5L83 A;  2D3A A;  2MLB A;  1FXT B;  1R4N B;  4HJG E;  4JLC A;  3IT4 B;  2MRP A;  3PV1 A;  5IKC M;  1FPY A;  2B3A A;  4W9E A;  1KH0 A;  3PRP B;  3M95 A;  1KLU D;  2LHD A;  3C19 A;  3RNG C;  1BT0 A;  1YQB A;  2LAS A;  1J0G A;  4RCO A;  5MPO A;  1T0Q C;  1NDD A;  3JVZ X;  2GBK A;  2IDY A;  1SF0 A;  3FIL A;  1UWX A;  3QX1 A;  1E8Z A;  4NJC A;  2LHE A;  2LGY A;  2I38 A;  3H7P B;  4IM3 A;  4WWM A;  4FXC A;  2LEK A;  3TBL D;  1SJE D;  3A33 B;  2I1K A;  2K8B A;  2K9X A;  2KMC A;  4WJO A;  1C3T A;  1L7Y A;  4GSW A;  2V0G A;  2Y3A A;  4TUU A;  2JZ3 B;  5CTR C;  1EU3 A;  1GAQ B;  4AP4 C;  1WGH A;  4GN1 A;  1UZX B;  3ZGZ A;  3N1X C;  1XO3 A;  1OQY A;  3Q8C A;  5AEK B;  4LJO B;  2KX0 A;  1WY8 A;  4K1R B;  2E6X A;  4RF0 A;  3KH0 A;  1WR1 A;  2D5G A;  5AZG A;  4HCN B;  4MJS A;  3PLV A;  1WF9 A;  1Z2M A;  1PDX A;  3KVF B;  3TEZ A;  1BXT A;  1TKY A;  4LNK A;  2J42 A;  1WYW B;  2OHF A;  3CSF A;  2YLM A;  1F2R I;  2GBM A;  4X57 B;  1GNU A;  5C2T B;  2HTH A;  2LUE A;  4MDK E;  1LFD A;  2O6V D;  3NVW A;  1VZ7 A;  3QAR A;  3A9K B;  1UEL A;  4KIK B;  1YN3 A;  1WRD B;  2AQ3 B;  2X38 A;  1D5X C;  1D6E C;  1M94 A;  1EUV B;  1MHH E;  1IBX A;  5D6J B;  4MSM B;  3UIO B;  1FXI A;  2O6V A;  3TL5 A;  3DDC B;  1P98 A;  3R3M A;  2D3G A;  1D3Z A;  1L5P A;  2FCS A;  3R7Q A;  1C4C A;  4YSY B;  2R61 A;  1F52 A;  2WXN A;  3W5U B;  1C78 A;  4B9K A;  3IG3 A;  4MGZ E;  3QJZ A;  4GOC A;  4M00 A;  4ZYS A;  1Z5S B;  2PE9 A;  3N30 A;  4IM2 A;  2D10 A;  1TS2 A;  1WGD A;  2D3B A;  3LYY A;  3WAN A;  3DBS A;  2KT7 A;  1AAR A;  1RM6 C;  4RMA A;  1WFY A;  1D4B A;  2ICI A;  2K39 A;  4PS8 A;  3SFE B;  1CK1 A;  3PZD A;  5EE0 A;  4EE2 A;  1ZP0 B;  2UWQ A;  3P42 A;  3VTV A;  3PT2 B;  2KOX A;  4IUM B;  3H9D A;  2JY6 A;  3WA0 A;  3BYT B;  1CQV A;  2KDI A;  3AEE B;  2KDM A;  3EFU A;  2LVQ A;  2GBR A;  1ZDX A;  2KK8 A;  1KTK A;  3AEB B;  4LNI A;  4DHZ B;  3DBH I;  4YTN B;  3DVN V;  4ICV A;  1T3Q A;  2QCZ A;  4P1B C;  2J4X A;  2I2Y A;  3VR9 B;  5DPT A;  5TSS A;  5J18 A;  4BKG A;  1ISN A;  1YX5 B;  2KAJ A;  3AE3 B;  4AWJ A;  1YN4 A;  4TSS A;  3RNF C;  1FNW A;  3O65 B;  2NBW B;  1R4M I;  3HUI A;  2NTT A;  1WJU A;  1H8C A;  1SEB D;  3ZJU A;  2V3P A;  4A90 A;  3AH7 A;  2BS4 B;  3HK0 A;  1KLG D;  2WXJ A;  3HHM A;  4LDT B;  2GI9 A;  2WDV B;  2KYW A;  3GS2 A;  4S17 A;  3TEX A;  3VDZ A;  3SU8 X;  1R7S A;  2CHW A;  4XX5 A;  1E7U A;  2G9H D;  2N9X A;  1UUP A;  4Q2J A;  3FKY A;  3EGR A;  3PHX B;  2JWU A;  4RM9 A;  2KAN A;  4GDL B;  2BF8 B;  2L8J A;  3L4P A;  2LXA A;  3HM3 A;  3RCZ A;  2VZK B;  1WYG A;  4A20 A;  3RYT A;  3ZXV A;  2KQ7 A;  3U52 E;  1P9D U;  2K8H A;  3UQA A;  3DBL I;  1RFK A;  3AED B;  3GE3 C;  1T0R C;  1NI2 A;  3NHE B;  2HJ1 A;  3MC0 B;  3JSV B;  2Y5B B;  2KDF B;  2O2V A;  1KLV A;  2BYV E;  3AM9 A;  2UU7 A;  2FIF A;  3R2I A;  3NZS A;  3A4R A;  2KJH B;  3LB8 C;  2ZVN A;  2W54 A;  4PYU A;  2K5P A;  2N0S B;  1HE8 A;  2G1E A;  1WJN A;  3KUZ A;  2MCN B;  1TIF A;  1QT9 A;  4K3B A;  2MQJ A;  2KLC A;  2KX3 A;  3N20 C;  3DOW A;  4IC7 B;  2ZCC A;  2L52 A;  3VUW A;  2PTL A;  2AEH A;  4EZJ A;  1PGB A;  4OHJ A;  4DK5 A;  4LCD E;  2QEJ C;  4C00 A;  1FEH A;  2Y5C A;  3AEF B;  2YVC A;  4OVZ A;  4IWO A;  1ZKH A;  1HZ5 A;  1I7H A;  3Q3M C;  2LVP A;  2C5L C;  3B2G A;  5JHA A;  3GB1 A;  3AN1 A;  5G55 A;  4HKQ A;  2NCN A;  2WXH A;  3K9P B;  1TKG A;  1K50 A;  4MM3 A;  4BZA A;  1FD6 A;  5D7G A;  4EZK A;  1C9F A;  2OED A;  2XK5 B;  3UGB B;  1MI0 A;  3UF8 A;  3HIZ A;  4EOY A;  3PLU A;  2FCQ A;  5JZE B;  3LJ3 A;  2KNB A;  2ONQ A;  2KTR B;  2WGS A;  2DX5 B;  2GOW A;  1VR9 A;  2KWC A;  2GMI C;  3HVD A;  4DQO C;  4WQO B;  4F7Z A;  1KJT A;  4RH6 A;  1KRH A;  1U4A A;  1MJD A;  4B6W A;  2BB6 A;  1QOB A;  3Q3O C;  3DBH B;  1KOT A;  3OJ4 B;  1RFA A;  3U7Z A;  4YWG G;  5AUI A;  3ZNI D;  4DHJ B;  4XDD A;  2BKR B;  4HKZ E;  4MT5 A;  2IO0 B;  5GXG B;  1EWC A;  2KZR A;  5LXH A;  1OFF A;  1QZE A;  1R4M B;  3VFK A;  5DCN A;  1GC7 A;  3C0R B;  3WAP A;  4JGH B;  2ZVO A;  2WXF A;  4IG7 B;  4QAY A;  2X8X X;  2WXL A;  2OJW A;  4LNO A;  2G4S A;  4EUT A;  2IGH A;  4C80 A;  3FC4 A;  4G0N B;  3O13 A;  1OEY J;  3EFC A;  5J17 A;  2UYZ B;  3TJP A;  1EWY C;  2PE6 B;  3UI3 A;  4WUR A;  3URY A;  1WXV A;  2WXI A;  2L1A A;  2NR2 A;  1F9J A;  1WZ3 A;  1GJZ A;  1VRA B;  1GB1 A;  3DHH C;  1SE9 A;  3PRM B;  4HXD A;  2GBJ A;  3VH3 B;  2WX1 A;  4A55 A;  1MPE A;  2R2O A;  2RDG A;  2E3T A;  1YQ4 B;  4KZC A;  1D5Z C;  2RPQ A;  4M8M A;  2C60 A;  4BBN F;  3QCA A;  2ZZP B;  1ET6 A;  3DBL B;  1JWU D;  3T9L A;  3RUL A;  1JCK B;  2HTM E;  1N60 A;  3NS1 A;  3BK2 A;  3ZTC A;  2MJD A;  2INP E;  4ANV A;  5JH5 C;  2VH2 A;  4JE3 B;  2PKO A;  2PW9 A;  4DXA B;  1UGM A;  4JWS C;  3NZU A;  4NPN A;  1I4X A;  4C4V A;  3SFD B;  1L6V A;  1VDV A;  2FCN A;  3E56 A;  4FHK A;  1WE7 A;  3EEC A;  2RR9 A;  2ZW1 A;  3K9O B;  4A6Q A;  2HD5 B;  1NEN B;  2IND C;  1JW9 D;  1Q1O A;  2Z0D B;  3TUO A;  3V60 A;  3PS6 A;  2L00 B;  3V61 A;  2KN5 A;  3B0A A;  3E9S A;  4IM0 A;  2KC1 A;  2GBN A;  2KMA A;  3KUC B;  4K7U A;  2DAF A;  1TGZ B;  3SEB A;  1WMH A;  5HI1 A;  1EF1 A;  4BBN C;  2FID A;  2JYE A;  2L76 A;  2WNM A;  4CO7 A;  2Z59 B;  2EEL A;  1QIL A;  2REX A;  4W9G A;  3VAW A;  4EFO A;  1FXA A;  1LO5 D;  4GXB A;  3APF A;  3ZNG C;  1XLQ A;  3PVL A;  3MFG A;  1C77 A;  2BYE A;  1JWB D;  3ALB A;  5T8I A;  1ZDV A;  4GMV A;  4OVV A;  2MBQ A;  3AE5 B;  2ZJD A;  1TJE A;  4JQW C; 
#chains in the Genus database with same CATH homology
 3N1Y C;  2INC C;  3GE3 C;  4P1B C;  1T0R C;  3N1X C;  3Q14 C;  3Q3O C;  3RN9 C;  3GE8 C;  3RNA C;  4P1C C;  3RNE C;  3I5J C;  3RNG C;  3Q3M C;  3RNF C;  3N1Z C;  3RI7 C;  3N20 C;  3DHI C;  3Q2A C;  1T0S C;  1T0Q C;  3I63 C;  3DHH C;  2IND C;  3RMK C;  3RNC C;  2RDB C;  3Q3N C;  3RNB C;  3DHG C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...