3GE3C

Crystal structure of the reduced toluene 4-monooxygenase hd t201a mutant complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
83
structure length
83
Chain Sequence
SAFPVHAAFEKDFLVQLVVVDLNDSMDQVAEKVAYHCVNRRVAPREGVMRVRKHRSTELFPRDMTIAESGLNPTEVIDVVFEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toluene-4-monooxygenase system protein A
publication title Role for threonine 201 in the catalytic cycle of the soluble diiron hydroxylase toluene 4-monooxygenase.
pubmed doi rcsb
source organism Pseudomonas mendocina
molecule tags Oxidoreductase
total genus 25
structure length 83
sequence length 83
ec nomenclature ec 1.14.13.236: Toluene 4-monooxygenase.
pdb deposition date 2009-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 3ge3C00
3N1ZC 1T0QC 3N20C 3Q3MC 1T0SC 3I63C 3N1YC 3RNBC 3GE8C 3RNGC 1T0RC 3I5JC 3GE3C 4P1CC 3DHIC 3Q14C 3RN9C 3Q3OC 3RI7C 3RMKC 2INCC 2INDC 3RNAC 4P1BC 3RNFC 3RNCC 2RDBC 3DHGC 3RNEC 3DHHC 3Q2AC 3Q3NC 3N1XC
chains in the Genus database with same CATH superfamily
2MH7A 2LVPA 3CWIA 1WXQA 1TYGB 1KF6B 2QCZA 1TT5B 2GBNA 2JXTA 2WGSA 1TKGA 2XK5A 2KMMA 2BVCA 2D07B 1HEZE 1ZE3D 4GDLA 3L54A 4WJOA 3APCA 1FXIA 3KUDB 2O6VD 3U2SC 3Q3OC 5BYRA 1YN5A 3V61A 2LHEA 1IGDA 2JQRB 2KAJA 2MWSB 4M02A 1HTQA 2PVOD 3KW5B 2N9KA 1SGHA 1SIFA 1UH6A 2H89B 4WWOA 1RAXA 3WANA 2WLBA 4MELA 5AUIA 2RSUA 2VH1A 2ZNVB 1AYFA 2LMCA 3QK0A 4ARCA 4BVUC 1TBEA 3ZLZA 3ZRFA 3BY4B 4LNIA 2DZMA 2ZW1A 5H8YE 4IWPA 5IP4D 2IBIB 1AWDA 3CSTA 3GB1A 4OZAA 3J9CA 4ASWC 4UDUC 3FC4A 2MP2B 3DPDA 3QX1A 2WQYB 2KWCA 1WGGA 2PEAA 3Q14C 4WH4A 1XLPA 1PDXA 3OAWA 2LI5A 3ZO5B 2QSDA 1C78A 3RNFC 2YLMA 2NTTA 2FAZA 3OLMD 3ZJUA 1SB3C 3U52E 3U7ZA 3V60A 2KTFA 2IYDB 3RPFC 1N5XA 3GZNB 3AEBB 1B9RA 1A5RA 2CR5A 2HTHA 1L0VB 3ZTDA 4YSZB 3PS6A 1CJEA 1JWAD 2BKFA 4FXCA 3SHQA 2V0GA 4JQWC 4CHKA 1WWTA 2RR9A 2DNFA 2BW2A 4MJSA 1WM2A 4JIOU 4K3BA 1Y56A 1SXTA 2N9LA 2M8SA 1M94A 2W82A 2YVCA 4KVGB 4M0WA 5D6JB 2JU6X 4YTNB 1IPGA 2W3SA 4K1RB 1FIQA 5FK9C 1E5WA 1NYQA 3TBLD 2IPKD 3AE1B 4E3CA 2QJLA 2KWVB 1WM3A 3W9CB 2KK8A 5EDSA 1C4AA 1TS5A 2MRPA 4EZKA 3QCAA 4HKZE 4J6IA 4NY0A 3AEEB 2V1YA 5EE1A 4CYEA 1H4RA 1YOVB 2BT6A 3BIID 2AQ1B 1KRHA 4MGKE 4PK1A 5TR5A 3AE3B 2KQ4X 1XCTL 4BFRA 2ZW0A 1I4HA 3HHMA 1D3ZA 3NZ3A 1EU4A 2GBKA 3HM3A 3KWLA 1ZXHA 3ZRCA 3IAS1 3RFZB 4JPSA 2SEBD 4RMAA 1EO6A 2N0SB 3VAWA 2WXNA 2C9WB 2N7DA 1WE6A 1YN4A 3JVZX 4LNKA 4WQMA 2NBVB 2IO0B 1D5ZC 4PS3A 3RN9C 3NY5A 4S17A 4E74A 4GB9A 4AUQC 2WU5B 5L83A 2JSVX 4KDIC 3KWVA 2L3ZA 3VTWA 4DBGA 5J18A 4HDOA 1MFWA 3AU5A 1WXSA 2Z0DB 3AE2B 2MSED 1UD7A 4MSQB 4BBNF 1F0ZA 3O13A 1N5WA 3H7PA 1GNUA 3DWMA 1LXDA 3U8ZA 4LTUA 2I2YA 1TJEA 1EU3A 3BZDB 1WE7A 4H2AA 4F1SA 2JZZA 2ZVNA 1P0RA 2MJEA 4HPLB 3HVDA 3ZDMC 2DYBA 2DZJA 1WX9A 1V80A 3QA8A 2KQSA 3DBRB 2MBQA 3AEDB 4K3CA 1R4NB 1E7UA 4N6EB 1XT9B 4HK2A 2G1EA 3Q3MC 3ZNGC 1NDDA 4E71A 2KZRA 3TEZA 1FEHA 2CHXA 4AJWA 4PS7A 4W9DA 2BYFA 4NZLB 5BYQA 3Q8BA 3EA6A 3N1ZC 1UWXA 4AOFA 4C56C 1D5MC 2ZVOA 1HQRD 1ACCA 2J0MA 4W9HA 3URYA 3LYYA 3UINB 1FCCC 3BVGA 3HUIA 2O2VB 2FUG1 3NVWA 4W9FA 2FE8A 4IUMB 2E3TA 3AEAB 2BWES 3A9JB 3V6EB 4BAXA 1WXMA 1V49A 4PYZA 4ZRPA 2J42A 1RM6C 3VUWA 2OEDA 5DCNA 3B2GA 4N58A 2C7MB 1GAQB 4URKA 2BGFA 4ZRQA 2OJWA 1MHXA 3VUXA 2MLBA 1GC6A 2FIFA 4Q2JA 4S0RA 2M1MA 2WXMA 3NZSA 3L0WB 2EKIA 3IVFA 2MX2A 3BVMA 1T0QC 4I6PA 2PMVA 2VRRB 4KIKA 4XWTA 2BKRB 2XK5B 3Q6BA 3RNGC 1L6UA 3RT3B 1TY2A 4GDLB 2K8HA 5BO4B 3L08A 4XX5A 4PS8A 3P2BA 3UI3A 1UGJA 1WGRA 3HRDD 4HJGE 3NVVA 4HCNB 3GZNI 2V3NA 1CQVA 4LNOA 5LXHA 1F9JA 1TGZB 3AE9B 1C79A 5IA7A 4I6NB 2Z59B 2G45B 3R8BA 3DHIC 1FM0D 2MJDA 2H88B 3JSVA 4K7WA 5D3IB 2AL3A 2BPSA 3MTNB 1WXVA 1WSPA 2C5LC 3R2IA 3BYYB 4IWQA 3AB5A 2AL6A 3A4SC 5CHWA 4NNJB 1VD2A 2IO1B 4MH8A 4DXGA 3IG3A 4XGAB 2DYMA 3TL5A 4GU2A 2Q5WD 1JWBD 2WDRB 4FULA 2FCMA 5AUKA 3DBLI 2FIDA 1J19A 5CTRC 2J7QB 2L83A 4P1BC 1XO3A 3APFA 4BOZB 2KYWA 3P63A 2PJHA 2KO3A 4YL8A 1E7VA 3H8HA 1V86A 3ZUNA 4BKTA 4A55A 5BYSA 4HVBA 1OFFA 1WFYA 2N9EB 1SJED 1EWCA 2OJRA 3ONSA 1F77A 4M00A 2Y5BB 3ZTCA 2K8CA 1LGRA 1JQ4A 4RH6A 4MJSB 1YNTE 3KQ4A 4ZYSA 2KVRA 3N9YC 1L0YB 1GUAB 4YT0B 4REZA 2IGGA 1YQ4B 2G3QB 3X23A 2HD5B 3S2AA 4X57B 5EE0A 3QAQA 3WCQA 3EHVA 5E6JA 1ZDXA 1VZ8A 2AQ2B 3N20C 5D2MB 2JVCA 1ZGUB 2MEKA 3GE8C 1ET9A 3IFWB 4RM8A 3PRMB 4AP4C 2WDTB 2HTME 4A8XC 3AE6B 4N59A 4F7ZA 3JW0X 1V1PB 4BOSC 3MJ5A 2ZJDA 2MBHA 2D3GA 3UF8A 1J7CA 4FBJB 3DVGY 5EE3A 1L0XB 4HLEA 5JHAA 1FXTB 4PT5A 4HJKA 1XLNA 3EECA 2D10A 1LFDA 3NS8A 1C4PA 1DYQA 1UBIA 1TS4A 4G0NB 3ZXRA 3DBRI 4NPNA 3TEYA 5IKCM 2IO2B 2BF8B 1SJHD 2ZCCA 1YMHE 1JWMD 5FKAC 3Q8FA 1FNVA 1UGMA 1T3QA 3IXSA 1ISNA 2QMTA 2GLSA 1RFAA 3UQBA 4RM9A 3APDA 4DHZB 4IWOA 1LO5D 2WXKA 1RLFA 3H7PB 3Q3NC 3VRBB 1VLBA 3NUHB 2Z0EB 3R7RA 4P7IA 1R4MI 2BQQA 3DQVA 5AZGA 1MG4A 1MJDA 3MC9A 1TY0A 2INCC 1I4PA 4C7YA 2K6QA 2V4LA 4G11A 2JYEA 4B6WA 3V3XA 2LUEA 4LCDE 4ANVA 4JWSC 2L8JA 3E9SA 2K22A 1VDVA 2Y5PA 3TCAA 1R7SA 1JMLA 1JRUA 3K9PB 2JWUA 3PZDA 1WIAA 3AM9A 4WWNA 5HG2A 2AQ3B 3RULA 3BK2A 3B2FA 4W9IA 3RZWC 1WMHA 4USAA 3I57A 1NENB 3T8MA 4FADA 2KLCA 4B0EA 1WR1A 2V9HA 1ZP0B 1IBXA 3X0WA 3QHTA 3KLSX 4ICUA 2JRIB 1FO4A 1FPYA 3NG0A 4IKGA 3AE4B 5CHVC 2KDMA 1D4BA 3EGRA 2JX5A 4HXDA 2XEWA 3ML8A 1JCKB 3EC8A 2PW9A 2AYOB 4ZRKA 4OZCA 2WX1A 3U7DA 1N62A 1XLOA 2KDIA 1UNSA 5LXIB 1TS2A 2KANA 2WNMA 3OWEB 4P1CC 2JWZA 2ZZPB 4W9LA 2M4NA 2VH2A 3U30A 3ZKJC 1UZXB 1GOZA 1YJ1A 2QC8A 3PZ7A 2K25A 1KLGD 2KDBA 4MGIE 3RUIB 5GMVA 2TSSA 4EZJA 3WAMA 3ZJTA 3GE3C 1WYWB 4KIKB 2N1VA 1N60A 5LLIA 4OW0A 2KMCA 5EE9A 2E6XA 2VZKD 1QOFA 3TUOA 4HPMB 1XD3B 4HRSA 4YSXB 4GN1A 1NYRA 1KOTA 4A3PA 2N4FA 4B0MA 1DOXA 2EMTA 2KNBA 1AARA 1K8RB 4WAFA 4EOYA 3RD2A 2ON8A 4W9EA 2N7EA 1WGKA 2WXGA 2IY0B 1WGHA 3M3JA 1XEEA 1IP9A 5J2RA 2M17A 3DBLB 2NS5A 3JSVB 1WZ0A 3Q2AC 2KQ7A 4HKQA 5AEKB 3SEBA 3LB8C 2X38A 4KZCA 3PHXB 3Q8EA 2D3BA 5E6PA 2M0XA 2XN9C 4C00A 3PZ8A 2I1KA 1V5TA 2R2QA 1V1PA 2HJ8A 3ZXVA 2L52A 2C60A 2V3SA 2OOBB 2KHWB 1FFUA 2DYOA 4AJYB 4II3B 4TV3A 5H92C 1BMLC 5AZFA 4EEWA 3HM6X 3AU4A 5BMGA 3MC8A 3LXFA 2WS3B 2WDVB 3UQAA 4IDIA 3TEXA 1ZDVA 2DZKA 4KGSA 4L1BA 4XDCA 5HHDG 4LNNA 3PSEB 3AE7B 2KWDA 2KFKA 2C7NB 2JZ3B 2WDQB 5JZEB 1H8CA 3I9V1 2KVZA 2W9NA 1FRRA 3FAHA 1N63A 2LHDA 4LK0M 2D5GA 1V81A 2GBJA 2RDGA 4MGYE 2LJ5A 5HKHA 3FKYA 4DDID 1YJJA 3BINA 1D6EC 3RNBC 5CHFA 5AZHA 4MM3A 2CJOA 1BT0A 3ECIA 3RMKC 2M0AA 1PQSA 4KZ0A 3RNCC 1WX8A 4EFOA 3PO0A 2BYTA 1L4ZB 2KX0A 4M01A 1WRDB 4LJPB 3FILB 3N1YC 3MHZA 4OVVA 4K7UA 2DX5B 1YN3A 2LWPA 1FMAD 1XF5L 3H7SA 3I5JC 2R2OA 4HCPB 1TKYA 2V4IB 1BXTA 3C0RB 1TS3A 5DPTA 3SFDB 3DCGA 1P1AA 2RDBC 2MCNB 2UWQA 4YSYB 3SFEB 2L05A 1E0ZA 3M62B 4ZHPA 1E9MA 1D5XC 1R4MB 2CS4A 2EELA 1WRIA 2CKHB 3KYDD 5G5HA 3B0AA 2WXLA 4ZHOA 1ET6A 3EFUA 1EF5A 4GIVA 3AE8B 2JXXA 1E8ZA 2MBBB 2GB1A 3ZIMA 4A6QA 3R66C 1L4DB 3HK0A 4KX6B 2NVUI 4LLGM 3V62A 4YTMB 2ACZB 4DQOC 3BVZA 4EKUA 2LGYA 5D94A 4GGQA 4F8CB 1VZ6A 4ZYNA 3Q69A 4BBNC 3ABVB 1PGAA 2BTEA 3R3MA 3P42A 1MI0A 2ASQA 3AECB 2WXJA 3PVLA 4PYUA 2B76B 1CK1A 4GOCA 2A4ZA 3WAOA 4FN2A 2JYTA 1HXYD 2JRHA 1JALA 2B3AA 3PTFC 3W5VB 3CIRB 4NAWA 3AE5B 1VR9A 5DPSA 1YX6B 3HVZA 3N1XC 4P6VF 3MP9A 1ZW7A 4W9CA 2QHOA 1F52A 3BK1A 3N3KB 1WMHB 2K1FA 5C2TB 3SR6A 4CQNA 3KH0A 3VFKA 1PYWD 3GOEA 3IBEA 2HE7A 4AQ7A 2K0PA 3ZNID 3DBSA 2IY1B 1IBXB 2INDC 3VXWA 4LDTD 4LJOB 2MA9B 3T3NA 4KSLC 4TMAB 3QJZA 3LDZE 2J0KA 2NR2A 3IT6B 2GBMA 1V9JA 4FA6A 2I1JA 3NHEB 4FJZA 5FR3A 2PIAA 3T3OA 4NQLB 2K9XA 2VZKB 3NRZA 5DPRA 3KUZA 2N9PC 3B9JA 4C4VA 4JWUC 2WXQA 5BMHA 3QQ8B 4WJPA 1EF1A 3WALA 3H9DA 5G55A 1JROA 1Z2MA 2J0JA 2LJIA 3AV8A 1SSNA 3B1LX 4XE0A 5JH5C 1YQ3B 3AH7A 1DOYA 2KMAA 3AXCA 4CO7A 2RDHA 1J7BA 2GMIC 2KN5A 2YEPF 1E8XA 2CU1A 4GXBA 1A70A 2NBUA 4C80A 4ACFA 2NTSA 3ZDTA 2QDFA 2L7RA 2RGFA 1WXAA 4DXFA 4M8MA 5C3JB 3DOWA 3ZNZB 1TTNA 2KN4A 1WZ3A 2K39A 2NMQA 3P4PB 4L2YA 1KJTA 4MH0E 1V2YA 1K51A 1JW9D 4ANWA 1OQQA 1STEA 1WI0A 1TZ1A 2PTLA 2FCQA 3ZVVA 1B1ZA 2FBWB 3IAM1 3JYUA 4KGTA 1ZXIA 3AULA 1HTOA 4ARIA 1J0GA 3QWZB 3FILA 4A9AA 2KFJA 2DZIA 3UGBB 1ZPSA 2CHWA 2JPHA 4ANUA 2W55A 5KHQA 5KHOA 1QKZA 3VVWB 1MVKA 4JLCA 3SU8X 2AX5A 4IC7B 3VH4B 1UUPA 1UELA 4IG7B 4K81A 4DK5A 4GDKA 2JZPA 2C7HA 3TIXA 2MBOA 2HDEA 4MDKE 2IZVB 2N9XA 4P16A 4W9KA 1E8WA 2DAJA 4JGHB 1WJUA 2K3UA 3PHWB 3ZNHB 3ZYYX 1WYGA 2KFKB 4RGNA 2V3PA 4DHZE 1TIFA 3KUCB 1YIWA 3V05A 3N30A 1FRDA 1QOGA 1WH3A 3RNEC 4MGZE 4EUTA 2M56B 4JL9A 2Y3AA 2ZPNA 2OHFA 2KTRA 3RYTA 2D3CA 2GBRA 2WWZA 3KVFB 1V1OA 3VR8B 4MM3B 4FHJA 5GXGB 1ZOYB 3VUYA 5CX3A 4DHJD 3OG5A 3QARA 3D32A 3WAPA 1FNWA 3RCZA 2UU7A 5J17A 1VCBA 2MW5A 2WXHA 3DVNV 1QT9A 2RPQA 3M63B 4QAYA 2O6VA 4K7SA 1L6VA 1GB1A 1WJNA 1XXGA 1FNUA 4A3OA 4WIPA 3PLUA 3QC8B 4B9KA 3A1QA 2LXAA 2CJNA 2LVQA 2PVGC 1C76A 4KKJA 3DWGC 1SEBD 3W1YA 4HPPA 4ZRJA 1SE2A 1V8CA 4HROA 5HFYA 4JE3B 2KC2A 1KH0A 2EMSA 1P7EA 3MHSD 2JT4B 1WGDA 5TSSA 4GSWA 2LGSA 4YTPB 3AI5A 2LXCA 1SF0A 3UIPB 1GC7A 2KJRA 1GPXA 2DBYA 2BS2B 2DHZA 1I4QA 3DBHI 4EZLA 2LZ6A 2L1AA 2N7JA 5LNK1 3NS1A 2PPHA 1LM8B 4G3XB 4R3DA 1K52A 2PE9A 1AN8A 1QLBB 4GLSC 2BWFA 3PGEA 2FNJB 5E6NA 2DLBA 2INNE 5HI1A 3Q3FA 2QILA 4KDLB 5D3DA 4MSMB 3RZFA 3L4PA 3I3TB 2L76A 2WP9B 2LRUA 1NBFC 4XC2A 4LNFA 4RFBA 1F1HA 4OHJA 2BB5A 4RF0A 1IGCA 2DAFA 4J3OD 4LDTB 4OVUA 1U4AA 1HA5A 4ZRIA 1P9DU 5IO9A 2L32A 4FHKA 2WXFA 4NAWB 1I4GA 1OEYA 1UF0A 1QOBA 2MQJA 3VRAB 2L00B 2ICIA 3VTVA 3NZUA 3VDZA 1Q1OA 1TZOA 2WU2B 1TKEA 4WURA 4IM2A 3DDCB 2ZNVC 5D7GA 2PKOA 3QIJA 3A33B 3AEFB 2IGHA 1E6EB 2IGDA 1XCQL 1CMXB 2D3AA 1SE3A 2QEJC 3K9OB 3PREA 3L16A 1T0RC 2BB6A 3VQIA 1XLQA 1K53A 2PE6B 3Q8AA 3RNAC 1Y8RC 5MPOA 1XQQA 1C4CA 3CMMB 1J8CA 3H1UA 4N9F4 2NBWB 2RPVA 4C4VB 2NPTA 1OQYA 4W9GA 1RFKA 1FXAA 3AN1A 3W5UB 1YQBA 1T0YA 1OGWA 3E56A 1I4RA 2KWUB 4I6LB 1HZ5A 5G5GA 1S3SG 4MEMA 1PGXA 4A20A 2AEHA 4TQ1A 1V6EA 4NJCA 2KT7A 4WWMA 2WX0A 2A5UA 3H6NA 1SIJA 2RD0A 1EUVB 1ESFA 1WY8A 2AWTA 2MJ3A 4US8A 1Q5WB 2LGXA 1UBQA 3RI7C 2GRIA 1ZKHA 2LASA 3ENEA 4WJQA 1J7AA 4KKIA 1GJZA 3T9LA 3ZJVA 1JRPA 1F2RC 1GG3A 1L5PA 3R7QA 3PV1A 5E6OA 3A9KA 1NEKB 2LVOA 3PRZA 5T8IA 3IT4B 1P98A 1MG8A 3PLVA 2J53A 2XBBC 1VJKA 4IW0A 4HWIB 4ITKA 2JUOA 4XZ4A 4HEA1 4WJNA 1P7FA 3CF6E 4IOIE 3MC0B 4YXDB 2ZPYA 4NJ6A 4US9A 1NI3A 2MBEA 4NJ7A 1WGYA 2FCNA 4RGTA 1QZEA 4GDKB 4B95A 3DVGX 1ZUD2 3VTUA 3N32A 5IAAC 1SE4A 1E8YA 4NAMA 3CSFA 2INPE 1E7PB 4TUUA 2REXA 3ALBA 1P3QU 1I7HA 4DWFA 2R61A 2WHIA 2KDEB 1KLUD 4HDQA 4DHJB 2W54A 3GS2A 1VRAB 4ANXA 2HJ1A 3DVNU 5L95C 5FR6A 4NQKE 1L7YA 3TJPA 1Q0WB 3ZGZA 1KLVA 1T0SC 2WYQA 2SAKA 2DENB 4RNAA 4RGOS 3VR9B 2KTRB 3L17A 1QILA 2K8BA 1BUIC 1C1YB 3P4RB 3UIOB 1YX5B 1FD6A 3B08A 2GI9A 3NVZA 3P1MA 3GP7A 3SD5A 2MP2A 2ZEQA 2LRWA 1C9FA 1Q10A 2BYVE 2IJ0A 4FJYA 3V6CB 1YD8U 1N6ZA 2D11A 3W1SC 1OTRB 3L10B 4MACA 4WWPA 2O6VB 1AW7A 3C8YA 2KD0A 1OEYJ 3R2TA 1YJIA 3A1QB 4YWGG 4XDDA 1QQRA 4ZDVA 3L13A 2FCSA 4II2B 1OQRA 2LUMA 3PRPB 4ICVA 1PUTA 2J52A 1IYFA 4RCOA 3PPAA 2L0FA 3AMZA 1WJ4A 3DBHB 3U4EG 2QIEB 1NI2A 4XWWA 2KJHB 5JHBA 1I4XA 2WXIA 3C19A 3ETRA 2WXRA 1WF9A 2LGIA 2ONQA 1T5XD 2Y5CA 1IUEA 3ZQ4A 4D2KA 3WIMA 4BKGA 3WA0A 2IO3B 2N1WA 3O65B 1WX7A 2KOXA 4C7ZA 2JY6A 4DXAB 2ZCBA 3DHHC 1M4VA 1NVID 1SBBB 3OJ4B 2I38A 1JWSD 2WXOA 5C23A 1GB4A 4OZBA 3IHPC 1T6BX 4ZOHC 1WR6E 4DDGD 4OVZA 3P4QB 2W3RA 5I4DA 1E10A 1FFVA 1V97A 2XNAC 2MHJA 1F2RI 4WQOB 3PT2B 4RF1A 4A90A 2KXJA 4M8NA 1I42A 2G9HD 2D2QA 4IM0A 1DGJA 3Q8CA 3BYTB 2LD9A 1C3TA 2KX3A 3NJTA 2CU3A 4FLHA 1V5OA 1HZ6A 2NCNA 4L23A 3W2DA 1KTKA 1FCLA 3NOBA 5DPWA 3MJWA 1ROEA 1RRBA 2BBCA 2K5PA 4O1NA 3OJ3A 1QOAA 1X1MA 1C77A 1PGBA 2KACA 4EE2A 5JXVA 1HE8A 2G4SA 2EKEC 2RMMA 2LFIA 4AWJA 4M0WB 2J4XA 2K6DB 1MPEA 1KM7A 2KC1A 2KDFB 3SDLC 1MHHE 4KGRA 1RYJA 5IN7A 3LJ3A 4BKSA 5BMIA 4JX1C 3AEGB 3TSSA 4KSKC 3VHTC 2X8XX 3ML9A 2WXPA 3ZW3A 2Z8LA 1SE9A 1VZ7A 1QF6A 1KFYB 2BS4B 2BS3B 2NPTB 2UYZB 1Z5SB 4MT5A 4BZAA 2PLPA 3TEWA 4GMVA 4KV2A 3MFGA 3TMPB 1WJ6A 1CZPA 4BKSD 2YEPB 4RGMA 2KLGA 4TSSA 2GOWA 3W1SA 1I35A 5G2NA 5C1ZA 3BWUD 1EWYC 2LGDA 3I63C 2FUHB 2KKCA 1E90A 2BYEA 2LEKA 4WAAA 2KJ6A 4W9JA 1RWSA 2IDYA 1LQBA 3HIZA 2L0TA 3KYCD 1R4NI 3NVYA 1ENFA 1L2NA 5IOIA 2CHZA 3DHGC 3VH3B 3Q3JA 2JF5A 1K50A 1G6JA 1EM7A 4G50A 4IM3A 4TQ0A 4XYCA 1N61A 3A4RA 3EUB2 1S1QB 1PFDA 2DWQA 2O2VA 2M19A 4TKNA 3EFCA 3A9JA 4FJVB 2G4DB 3A9KB 3M95A 4AS1A 3P4SB 1UWMA 1DOIA 1JWUD
chains in the Genus database with same CATH topology
3N1ZC 1T0QC 3N20C 3Q3MC 1T0SC 3I63C 3N1YC 3RNBC 3GE8C 3RNGC 1T0RC 3I5JC 3GE3C 4P1CC 3DHIC 3Q14C 3RN9C 3Q3OC 3RI7C 3RMKC 2INCC 2INDC 3RNAC 4P1BC 3RNFC 3RNCC 2RDBC 3DHGC 3RNEC 3DHHC 3Q2AC 3Q3NC 3N1XC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N1Z C;  1T0Q C;  3N20 C;  3Q3M C;  1T0S C;  3I63 C;  3N1Y C;  3RNB C;  3GE8 C;  3RNG C;  1T0R C;  3I5J C;  3GE3 C;  4P1C C;  3DHI C;  3Q14 C;  3RN9 C;  3Q3O C;  3RI7 C;  3RMK C;  2INC C;  2IND C;  3RNA C;  4P1B C;  3RNF C;  3RNC C;  2RDB C;  3DHG C;  3RNE C;  3DHH C;  3Q2A C;  3Q3N C;  3N1X C; 
#chains in the Genus database with same CATH topology
 2MH7 A;  2LVP A;  3CWI A;  1WXQ A;  1TYG B;  1KF6 B;  2QCZ A;  1TT5 B;  2GBN A;  2JXT A;  2WGS A;  1TKG A;  2XK5 A;  2KMM A;  2BVC A;  2D07 B;  1HEZ E;  1ZE3 D;  4GDL A;  3L54 A;  4WJO A;  3APC A;  1FXI A;  3KUD B;  2O6V D;  3U2S C;  3Q3O C;  5BYR A;  1YN5 A;  3V61 A;  2LHE A;  1IGD A;  2JQR B;  2KAJ A;  2MWS B;  4M02 A;  1HTQ A;  2PVO D;  3KW5 B;  2N9K A;  1SGH A;  1SIF A;  1UH6 A;  2H89 B;  4WWO A;  1RAX A;  3WAN A;  2WLB A;  4MEL A;  5AUI A;  2RSU A;  2VH1 A;  2ZNV B;  1AYF A;  2LMC A;  3QK0 A;  4ARC A;  4BVU C;  1TBE A;  3ZLZ A;  3ZRF A;  3BY4 B;  4LNI A;  2DZM A;  2ZW1 A;  5H8Y E;  4IWP A;  5IP4 D;  2IBI B;  1AWD A;  3CST A;  3GB1 A;  4OZA A;  3J9C A;  4ASW C;  4UDU C;  3FC4 A;  2MP2 B;  3DPD A;  3QX1 A;  2WQY B;  2KWC A;  1WGG A;  2PEA A;  3Q14 C;  4WH4 A;  1XLP A;  1PDX A;  3OAW A;  2LI5 A;  3ZO5 B;  2QSD A;  1C78 A;  3RNF C;  2YLM A;  2NTT A;  2FAZ A;  3OLM D;  3ZJU A;  1SB3 C;  3U52 E;  3U7Z A;  3V60 A;  2KTF A;  2IYD B;  3RPF C;  1N5X A;  3GZN B;  3AEB B;  1B9R A;  1A5R A;  2CR5 A;  2HTH A;  1L0V B;  3ZTD A;  4YSZ B;  3PS6 A;  1CJE A;  1JWA D;  2BKF A;  4FXC A;  3SHQ A;  2V0G A;  4JQW C;  4CHK A;  1WWT A;  2RR9 A;  2DNF A;  2BW2 A;  4MJS A;  1WM2 A;  4JIO U;  4K3B A;  1Y56 A;  1SXT A;  2N9L A;  2M8S A;  1M94 A;  2W82 A;  2YVC A;  4KVG B;  4M0W A;  5D6J B;  2JU6 X;  4YTN B;  1IPG A;  2W3S A;  4K1R B;  1FIQ A;  5FK9 C;  1E5W A;  1NYQ A;  3TBL D;  2IPK D;  3AE1 B;  4E3C A;  2QJL A;  2KWV B;  1WM3 A;  3W9C B;  2KK8 A;  5EDS A;  1C4A A;  1TS5 A;  2MRP A;  4EZK A;  3QCA A;  4HKZ E;  4J6I A;  4NY0 A;  3AEE B;  2V1Y A;  5EE1 A;  4CYE A;  1H4R A;  1YOV B;  2BT6 A;  3BII D;  2AQ1 B;  1KRH A;  4MGK E;  4PK1 A;  5TR5 A;  3AE3 B;  2KQ4 X;  1XCT L;  4BFR A;  2ZW0 A;  1I4H A;  3HHM A;  1D3Z A;  3NZ3 A;  1EU4 A;  2GBK A;  3HM3 A;  3KWL A;  1ZXH A;  3ZRC A;  3IAS 1;  3RFZ B;  4JPS A;  2SEB D;  4RMA A;  1EO6 A;  2N0S B;  3VAW A;  2WXN A;  2C9W B;  2N7D A;  1WE6 A;  1YN4 A;  3JVZ X;  4LNK A;  4WQM A;  2NBV B;  2IO0 B;  1D5Z C;  4PS3 A;  3RN9 C;  3NY5 A;  4S17 A;  4E74 A;  4GB9 A;  4AUQ C;  2WU5 B;  5L83 A;  2JSV X;  4KDI C;  3KWV A;  2L3Z A;  3VTW A;  4DBG A;  5J18 A;  4HDO A;  1MFW A;  3AU5 A;  1WXS A;  2Z0D B;  3AE2 B;  2MSE D;  1UD7 A;  4MSQ B;  4BBN F;  1F0Z A;  3O13 A;  1N5W A;  3H7P A;  1GNU A;  3DWM A;  1LXD A;  3U8Z A;  4LTU A;  2I2Y A;  1TJE A;  1EU3 A;  3BZD B;  1WE7 A;  4H2A A;  4F1S A;  2JZZ A;  2ZVN A;  1P0R A;  2MJE A;  4HPL B;  3HVD A;  3ZDM C;  2DYB A;  2DZJ A;  1WX9 A;  1V80 A;  3QA8 A;  2KQS A;  3DBR B;  2MBQ A;  3AED B;  4K3C A;  1R4N B;  1E7U A;  4N6E B;  1XT9 B;  4HK2 A;  2G1E A;  3Q3M C;  3ZNG C;  1NDD A;  4E71 A;  2KZR A;  3TEZ A;  1FEH A;  2CHX A;  4AJW A;  4PS7 A;  4W9D A;  2BYF A;  4NZL B;  5BYQ A;  3Q8B A;  3EA6 A;  3N1Z C;  1UWX A;  4AOF A;  4C56 C;  1D5M C;  2ZVO A;  1HQR D;  1ACC A;  2J0M A;  4W9H A;  3URY A;  3LYY A;  3UIN B;  1FCC C;  3BVG A;  3HUI A;  2O2V B;  2FUG 1;  3NVW A;  4W9F A;  2FE8 A;  4IUM B;  2E3T A;  3AEA B;  2BWE S;  3A9J B;  3V6E B;  4BAX A;  1WXM A;  1V49 A;  4PYZ A;  4ZRP A;  2J42 A;  1RM6 C;  3VUW A;  2OED A;  5DCN A;  3B2G A;  4N58 A;  2C7M B;  1GAQ B;  4URK A;  2BGF A;  4ZRQ A;  2OJW A;  1MHX A;  3VUX A;  2MLB A;  1GC6 A;  2FIF A;  4Q2J A;  4S0R A;  2M1M A;  2WXM A;  3NZS A;  3L0W B;  2EKI A;  3IVF A;  2MX2 A;  3BVM A;  1T0Q C;  4I6P A;  2PMV A;  2VRR B;  4KIK A;  4XWT A;  2BKR B;  2XK5 B;  3Q6B A;  3RNG C;  1L6U A;  3RT3 B;  1TY2 A;  4GDL B;  2K8H A;  5BO4 B;  3L08 A;  4XX5 A;  4PS8 A;  3P2B A;  3UI3 A;  1UGJ A;  1WGR A;  3HRD D;  4HJG E;  3NVV A;  4HCN B;  3GZN I;  2V3N A;  1CQV A;  4LNO A;  5LXH A;  1F9J A;  1TGZ B;  3AE9 B;  1C79 A;  5IA7 A;  4I6N B;  2Z59 B;  2G45 B;  3R8B A;  3DHI C;  1FM0 D;  2MJD A;  2H88 B;  3JSV A;  4K7W A;  5D3I B;  2AL3 A;  2BPS A;  3MTN B;  1WXV A;  1WSP A;  2C5L C;  3R2I A;  3BYY B;  4IWQ A;  3AB5 A;  2AL6 A;  3A4S C;  5CHW A;  4NNJ B;  1VD2 A;  2IO1 B;  4MH8 A;  4DXG A;  3IG3 A;  4XGA B;  2DYM A;  3TL5 A;  4GU2 A;  2Q5W D;  1JWB D;  2WDR B;  4FUL A;  2FCM A;  5AUK A;  3DBL I;  2FID A;  1J19 A;  5CTR C;  2J7Q B;  2L83 A;  4P1B C;  1XO3 A;  3APF A;  4BOZ B;  2KYW A;  3P63 A;  2PJH A;  2KO3 A;  4YL8 A;  1E7V A;  3H8H A;  1V86 A;  3ZUN A;  4BKT A;  4A55 A;  5BYS A;  4HVB A;  1OFF A;  1WFY A;  2N9E B;  1SJE D;  1EWC A;  2OJR A;  3ONS A;  1F77 A;  4M00 A;  2Y5B B;  3ZTC A;  2K8C A;  1LGR A;  1JQ4 A;  4RH6 A;  4MJS B;  1YNT E;  3KQ4 A;  4ZYS A;  2KVR A;  3N9Y C;  1L0Y B;  1GUA B;  4YT0 B;  4REZ A;  2IGG A;  1YQ4 B;  2G3Q B;  3X23 A;  2HD5 B;  3S2A A;  4X57 B;  5EE0 A;  3QAQ A;  3WCQ A;  3EHV A;  5E6J A;  1ZDX A;  1VZ8 A;  2AQ2 B;  3N20 C;  5D2M B;  2JVC A;  1ZGU B;  2MEK A;  3GE8 C;  1ET9 A;  3IFW B;  4RM8 A;  3PRM B;  4AP4 C;  2WDT B;  2HTM E;  4A8X C;  3AE6 B;  4N59 A;  4F7Z A;  3JW0 X;  1V1P B;  4BOS C;  3MJ5 A;  2ZJD A;  2MBH A;  2D3G A;  3UF8 A;  1J7C A;  4FBJ B;  3DVG Y;  5EE3 A;  1L0X B;  4HLE A;  5JHA A;  1FXT B;  4PT5 A;  4HJK A;  1XLN A;  3EEC A;  2D10 A;  1LFD A;  3NS8 A;  1C4P A;  1DYQ A;  1UBI A;  1TS4 A;  4G0N B;  3ZXR A;  3DBR I;  4NPN A;  3TEY A;  5IKC M;  2IO2 B;  2BF8 B;  1SJH D;  2ZCC A;  1YMH E;  1JWM D;  5FKA C;  3Q8F A;  1FNV A;  1UGM A;  1T3Q A;  3IXS A;  1ISN A;  2QMT A;  2GLS A;  1RFA A;  3UQB A;  4RM9 A;  3APD A;  4DHZ B;  4IWO A;  1LO5 D;  2WXK A;  1RLF A;  3H7P B;  3Q3N C;  3VRB B;  1VLB A;  3NUH B;  2Z0E B;  3R7R A;  4P7I A;  1R4M I;  2BQQ A;  3DQV A;  5AZG A;  1MG4 A;  1MJD A;  3MC9 A;  1TY0 A;  2INC C;  1I4P A;  4C7Y A;  2K6Q A;  2V4L A;  4G11 A;  2JYE A;  4B6W A;  3V3X A;  2LUE A;  4LCD E;  4ANV A;  4JWS C;  2L8J A;  3E9S A;  2K22 A;  1VDV A;  2Y5P A;  3TCA A;  1R7S A;  1JML A;  1JRU A;  3K9P B;  2JWU A;  3PZD A;  1WIA A;  3AM9 A;  4WWN A;  5HG2 A;  2AQ3 B;  3RUL A;  3BK2 A;  3B2F A;  4W9I A;  3RZW C;  1WMH A;  4USA A;  3I57 A;  1NEN B;  3T8M A;  4FAD A;  2KLC A;  4B0E A;  1WR1 A;  2V9H A;  1ZP0 B;  1IBX A;  3X0W A;  3QHT A;  3KLS X;  4ICU A;  2JRI B;  1FO4 A;  1FPY A;  3NG0 A;  4IKG A;  3AE4 B;  5CHV C;  2KDM A;  1D4B A;  3EGR A;  2JX5 A;  4HXD A;  2XEW A;  3ML8 A;  1JCK B;  3EC8 A;  2PW9 A;  2AYO B;  4ZRK A;  4OZC A;  2WX1 A;  3U7D A;  1N62 A;  1XLO A;  2KDI A;  1UNS A;  5LXI B;  1TS2 A;  2KAN A;  2WNM A;  3OWE B;  4P1C C;  2JWZ A;  2ZZP B;  4W9L A;  2M4N A;  2VH2 A;  3U30 A;  3ZKJ C;  1UZX B;  1GOZ A;  1YJ1 A;  2QC8 A;  3PZ7 A;  2K25 A;  1KLG D;  2KDB A;  4MGI E;  3RUI B;  5GMV A;  2TSS A;  4EZJ A;  3WAM A;  3ZJT A;  3GE3 C;  1WYW B;  4KIK B;  2N1V A;  1N60 A;  5LLI A;  4OW0 A;  2KMC A;  5EE9 A;  2E6X A;  2VZK D;  1QOF A;  3TUO A;  4HPM B;  1XD3 B;  4HRS A;  4YSX B;  4GN1 A;  1NYR A;  1KOT A;  4A3P A;  2N4F A;  4B0M A;  1DOX A;  2EMT A;  2KNB A;  1AAR A;  1K8R B;  4WAF A;  4EOY A;  3RD2 A;  2ON8 A;  4W9E A;  2N7E A;  1WGK A;  2WXG A;  2IY0 B;  1WGH A;  3M3J A;  1XEE A;  1IP9 A;  5J2R A;  2M17 A;  3DBL B;  2NS5 A;  3JSV B;  1WZ0 A;  3Q2A C;  2KQ7 A;  4HKQ A;  5AEK B;  3SEB A;  3LB8 C;  2X38 A;  4KZC A;  3PHX B;  3Q8E A;  2D3B A;  5E6P A;  2M0X A;  2XN9 C;  4C00 A;  3PZ8 A;  2I1K A;  1V5T A;  2R2Q A;  1V1P A;  2HJ8 A;  3ZXV A;  2L52 A;  2C60 A;  2V3S A;  2OOB B;  2KHW B;  1FFU A;  2DYO A;  4AJY B;  4II3 B;  4TV3 A;  5H92 C;  1BML C;  5AZF A;  4EEW A;  3HM6 X;  3AU4 A;  5BMG A;  3MC8 A;  3LXF A;  2WS3 B;  2WDV B;  3UQA A;  4IDI A;  3TEX A;  1ZDV A;  2DZK A;  4KGS A;  4L1B A;  4XDC A;  5HHD G;  4LNN A;  3PSE B;  3AE7 B;  2KWD A;  2KFK A;  2C7N B;  2JZ3 B;  2WDQ B;  5JZE B;  1H8C A;  3I9V 1;  2KVZ A;  2W9N A;  1FRR A;  3FAH A;  1N63 A;  2LHD A;  4LK0 M;  2D5G A;  1V81 A;  2GBJ A;  2RDG A;  4MGY E;  2LJ5 A;  5HKH A;  3FKY A;  4DDI D;  1YJJ A;  3BIN A;  1D6E C;  3RNB C;  5CHF A;  5AZH A;  4MM3 A;  2CJO A;  1BT0 A;  3ECI A;  3RMK C;  2M0A A;  1PQS A;  4KZ0 A;  3RNC C;  1WX8 A;  4EFO A;  3PO0 A;  2BYT A;  1L4Z B;  2KX0 A;  4M01 A;  1WRD B;  4LJP B;  3FIL B;  3N1Y C;  3MHZ A;  4OVV A;  4K7U A;  2DX5 B;  1YN3 A;  2LWP A;  1FMA D;  1XF5 L;  3H7S A;  3I5J C;  2R2O A;  4HCP B;  1TKY A;  2V4I B;  1BXT A;  3C0R B;  1TS3 A;  5DPT A;  3SFD B;  3DCG A;  1P1A A;  2RDB C;  2MCN B;  2UWQ A;  4YSY B;  3SFE B;  2L05 A;  1E0Z A;  3M62 B;  4ZHP A;  1E9M A;  1D5X C;  1R4M B;  2CS4 A;  2EEL A;  1WRI A;  2CKH B;  3KYD D;  5G5H A;  3B0A A;  2WXL A;  4ZHO A;  1ET6 A;  3EFU A;  1EF5 A;  4GIV A;  3AE8 B;  2JXX A;  1E8Z A;  2MBB B;  2GB1 A;  3ZIM A;  4A6Q A;  3R66 C;  1L4D B;  3HK0 A;  4KX6 B;  2NVU I;  4LLG M;  3V62 A;  4YTM B;  2ACZ B;  4DQO C;  3BVZ A;  4EKU A;  2LGY A;  5D94 A;  4GGQ A;  4F8C B;  1VZ6 A;  4ZYN A;  3Q69 A;  4BBN C;  3ABV B;  1PGA A;  2BTE A;  3R3M A;  3P42 A;  1MI0 A;  2ASQ A;  3AEC B;  2WXJ A;  3PVL A;  4PYU A;  2B76 B;  1CK1 A;  4GOC A;  2A4Z A;  3WAO A;  4FN2 A;  2JYT A;  1HXY D;  2JRH A;  1JAL A;  2B3A A;  3PTF C;  3W5V B;  3CIR B;  4NAW A;  3AE5 B;  1VR9 A;  5DPS A;  1YX6 B;  3HVZ A;  3N1X C;  4P6V F;  3MP9 A;  1ZW7 A;  4W9C A;  2QHO A;  1F52 A;  3BK1 A;  3N3K B;  1WMH B;  2K1F A;  5C2T B;  3SR6 A;  4CQN A;  3KH0 A;  3VFK A;  1PYW D;  3GOE A;  3IBE A;  2HE7 A;  4AQ7 A;  2K0P A;  3ZNI D;  3DBS A;  2IY1 B;  1IBX B;  2IND C;  3VXW A;  4LDT D;  4LJO B;  2MA9 B;  3T3N A;  4KSL C;  4TMA B;  3QJZ A;  3LDZ E;  2J0K A;  2NR2 A;  3IT6 B;  2GBM A;  1V9J A;  4FA6 A;  2I1J A;  3NHE B;  4FJZ A;  5FR3 A;  2PIA A;  3T3O A;  4NQL B;  2K9X A;  2VZK B;  3NRZ A;  5DPR A;  3KUZ A;  2N9P C;  3B9J A;  4C4V A;  4JWU C;  2WXQ A;  5BMH A;  3QQ8 B;  4WJP A;  1EF1 A;  3WAL A;  3H9D A;  5G55 A;  1JRO A;  1Z2M A;  2J0J A;  2LJI A;  3AV8 A;  1SSN A;  3B1L X;  4XE0 A;  5JH5 C;  1YQ3 B;  3AH7 A;  1DOY A;  2KMA A;  3AXC A;  4CO7 A;  2RDH A;  1J7B A;  2GMI C;  2KN5 A;  2YEP F;  1E8X A;  2CU1 A;  4GXB A;  1A70 A;  2NBU A;  4C80 A;  4ACF A;  2NTS A;  3ZDT A;  2QDF A;  2L7R A;  2RGF A;  1WXA A;  4DXF A;  4M8M A;  5C3J B;  3DOW A;  3ZNZ B;  1TTN A;  2KN4 A;  1WZ3 A;  2K39 A;  2NMQ A;  3P4P B;  4L2Y A;  1KJT A;  4MH0 E;  1V2Y A;  1K51 A;  1JW9 D;  4ANW A;  1OQQ A;  1STE A;  1WI0 A;  1TZ1 A;  2PTL A;  2FCQ A;  3ZVV A;  1B1Z A;  2FBW B;  3IAM 1;  3JYU A;  4KGT A;  1ZXI A;  3AUL A;  1HTO A;  4ARI A;  1J0G A;  3QWZ B;  3FIL A;  4A9A A;  2KFJ A;  2DZI A;  3UGB B;  1ZPS A;  2CHW A;  2JPH A;  4ANU A;  2W55 A;  5KHQ A;  5KHO A;  1QKZ A;  3VVW B;  1MVK A;  4JLC A;  3SU8 X;  2AX5 A;  4IC7 B;  3VH4 B;  1UUP A;  1UEL A;  4IG7 B;  4K81 A;  4DK5 A;  4GDK A;  2JZP A;  2C7H A;  3TIX A;  2MBO A;  2HDE A;  4MDK E;  2IZV B;  2N9X A;  4P16 A;  4W9K A;  1E8W A;  2DAJ A;  4JGH B;  1WJU A;  2K3U A;  3PHW B;  3ZNH B;  3ZYY X;  1WYG A;  2KFK B;  4RGN A;  2V3P A;  4DHZ E;  1TIF A;  3KUC B;  1YIW A;  3V05 A;  3N30 A;  1FRD A;  1QOG A;  1WH3 A;  3RNE C;  4MGZ E;  4EUT A;  2M56 B;  4JL9 A;  2Y3A A;  2ZPN A;  2OHF A;  2KTR A;  3RYT A;  2D3C A;  2GBR A;  2WWZ A;  3KVF B;  1V1O A;  3VR8 B;  4MM3 B;  4FHJ A;  5GXG B;  1ZOY B;  3VUY A;  5CX3 A;  4DHJ D;  3OG5 A;  3QAR A;  3D32 A;  3WAP A;  1FNW A;  3RCZ A;  2UU7 A;  5J17 A;  1VCB A;  2MW5 A;  2WXH A;  3DVN V;  1QT9 A;  2RPQ A;  3M63 B;  4QAY A;  2O6V A;  4K7S A;  1L6V A;  1GB1 A;  1WJN A;  1XXG A;  1FNU A;  4A3O A;  4WIP A;  3PLU A;  3QC8 B;  4B9K A;  3A1Q A;  2LXA A;  2CJN A;  2LVQ A;  2PVG C;  1C76 A;  4KKJ A;  3DWG C;  1SEB D;  3W1Y A;  4HPP A;  4ZRJ A;  1SE2 A;  1V8C A;  4HRO A;  5HFY A;  4JE3 B;  2KC2 A;  1KH0 A;  2EMS A;  1P7E A;  3MHS D;  2JT4 B;  1WGD A;  5TSS A;  4GSW A;  2LGS A;  4YTP B;  3AI5 A;  2LXC A;  1SF0 A;  3UIP B;  1GC7 A;  2KJR A;  1GPX A;  2DBY A;  2BS2 B;  2DHZ A;  1I4Q A;  3DBH I;  4EZL A;  2LZ6 A;  2L1A A;  2N7J A;  5LNK 1;  3NS1 A;  2PPH A;  1LM8 B;  4G3X B;  4R3D A;  1K52 A;  2PE9 A;  1AN8 A;  1QLB B;  4GLS C;  2BWF A;  3PGE A;  2FNJ B;  5E6N A;  2DLB A;  2INN E;  5HI1 A;  3Q3F A;  2QIL A;  4KDL B;  5D3D A;  4MSM B;  3RZF A;  3L4P A;  3I3T B;  2L76 A;  2WP9 B;  2LRU A;  1NBF C;  4XC2 A;  4LNF A;  4RFB A;  1F1H A;  4OHJ A;  2BB5 A;  4RF0 A;  1IGC A;  2DAF A;  4J3O D;  4LDT B;  4OVU A;  1U4A A;  1HA5 A;  4ZRI A;  1P9D U;  5IO9 A;  2L32 A;  4FHK A;  2WXF A;  4NAW B;  1I4G A;  1OEY A;  1UF0 A;  1QOB A;  2MQJ A;  3VRA B;  2L00 B;  2ICI A;  3VTV A;  3NZU A;  3VDZ A;  1Q1O A;  1TZO A;  2WU2 B;  1TKE A;  4WUR A;  4IM2 A;  3DDC B;  2ZNV C;  5D7G A;  2PKO A;  3QIJ A;  3A33 B;  3AEF B;  2IGH A;  1E6E B;  2IGD A;  1XCQ L;  1CMX B;  2D3A A;  1SE3 A;  2QEJ C;  3K9O B;  3PRE A;  3L16 A;  1T0R C;  2BB6 A;  3VQI A;  1XLQ A;  1K53 A;  2PE6 B;  3Q8A A;  3RNA C;  1Y8R C;  5MPO A;  1XQQ A;  1C4C A;  3CMM B;  1J8C A;  3H1U A;  4N9F 4;  2NBW B;  2RPV A;  4C4V B;  2NPT A;  1OQY A;  4W9G A;  1RFK A;  1FXA A;  3AN1 A;  3W5U B;  1YQB A;  1T0Y A;  1OGW A;  3E56 A;  1I4R A;  2KWU B;  4I6L B;  1HZ5 A;  5G5G A;  1S3S G;  4MEM A;  1PGX A;  4A20 A;  2AEH A;  4TQ1 A;  1V6E A;  4NJC A;  2KT7 A;  4WWM A;  2WX0 A;  2A5U A;  3H6N A;  1SIJ A;  2RD0 A;  1EUV B;  1ESF A;  1WY8 A;  2AWT A;  2MJ3 A;  4US8 A;  1Q5W B;  2LGX A;  1UBQ A;  3RI7 C;  2GRI A;  1ZKH A;  2LAS A;  3ENE A;  4WJQ A;  1J7A A;  4KKI A;  1GJZ A;  3T9L A;  3ZJV A;  1JRP A;  1F2R C;  1GG3 A;  1L5P A;  3R7Q A;  3PV1 A;  5E6O A;  3A9K A;  1NEK B;  2LVO A;  3PRZ A;  5T8I A;  3IT4 B;  1P98 A;  1MG8 A;  3PLV A;  2J53 A;  2XBB C;  1VJK A;  4IW0 A;  4HWI B;  4ITK A;  2JUO A;  4XZ4 A;  4HEA 1;  4WJN A;  1P7F A;  3CF6 E;  4IOI E;  3MC0 B;  4YXD B;  2ZPY A;  4NJ6 A;  4US9 A;  1NI3 A;  2MBE A;  4NJ7 A;  1WGY A;  2FCN A;  4RGT A;  1QZE A;  4GDK B;  4B95 A;  3DVG X;  1ZUD 2;  3VTU A;  3N32 A;  5IAA C;  1SE4 A;  1E8Y A;  4NAM A;  3CSF A;  2INP E;  1E7P B;  4TUU A;  2REX A;  3ALB A;  1P3Q U;  1I7H A;  4DWF A;  2R61 A;  2WHI A;  2KDE B;  1KLU D;  4HDQ A;  4DHJ B;  2W54 A;  3GS2 A;  1VRA B;  4ANX A;  2HJ1 A;  3DVN U;  5L95 C;  5FR6 A;  4NQK E;  1L7Y A;  3TJP A;  1Q0W B;  3ZGZ A;  1KLV A;  1T0S C;  2WYQ A;  2SAK A;  2DEN B;  4RNA A;  4RGO S;  3VR9 B;  2KTR B;  3L17 A;  1QIL A;  2K8B A;  1BUI C;  1C1Y B;  3P4R B;  3UIO B;  1YX5 B;  1FD6 A;  3B08 A;  2GI9 A;  3NVZ A;  3P1M A;  3GP7 A;  3SD5 A;  2MP2 A;  2ZEQ A;  2LRW A;  1C9F A;  1Q10 A;  2BYV E;  2IJ0 A;  4FJY A;  3V6C B;  1YD8 U;  1N6Z A;  2D11 A;  3W1S C;  1OTR B;  3L10 B;  4MAC A;  4WWP A;  2O6V B;  1AW7 A;  3C8Y A;  2KD0 A;  1OEY J;  3R2T A;  1YJI A;  3A1Q B;  4YWG G;  4XDD A;  1QQR A;  4ZDV A;  3L13 A;  2FCS A;  4II2 B;  1OQR A;  2LUM A;  3PRP B;  4ICV A;  1PUT A;  2J52 A;  1IYF A;  4RCO A;  3PPA A;  2L0F A;  3AMZ A;  1WJ4 A;  3DBH B;  3U4E G;  2QIE B;  1NI2 A;  4XWW A;  2KJH B;  5JHB A;  1I4X A;  2WXI A;  3C19 A;  3ETR A;  2WXR A;  1WF9 A;  2LGI A;  2ONQ A;  1T5X D;  2Y5C A;  1IUE A;  3ZQ4 A;  4D2K A;  3WIM A;  4BKG A;  3WA0 A;  2IO3 B;  2N1W A;  3O65 B;  1WX7 A;  2KOX A;  4C7Z A;  2JY6 A;  4DXA B;  2ZCB A;  3DHH C;  1M4V A;  1NVI D;  1SBB B;  3OJ4 B;  2I38 A;  1JWS D;  2WXO A;  5C23 A;  1GB4 A;  4OZB A;  3IHP C;  1T6B X;  4ZOH C;  1WR6 E;  4DDG D;  4OVZ A;  3P4Q B;  2W3R A;  5I4D A;  1E10 A;  1FFV A;  1V97 A;  2XNA C;  2MHJ A;  1F2R I;  4WQO B;  3PT2 B;  4RF1 A;  4A90 A;  2KXJ A;  4M8N A;  1I42 A;  2G9H D;  2D2Q A;  4IM0 A;  1DGJ A;  3Q8C A;  3BYT B;  2LD9 A;  1C3T A;  2KX3 A;  3NJT A;  2CU3 A;  4FLH A;  1V5O A;  1HZ6 A;  2NCN A;  4L23 A;  3W2D A;  1KTK A;  1FCL A;  3NOB A;  5DPW A;  3MJW A;  1ROE A;  1RRB A;  2BBC A;  2K5P A;  4O1N A;  3OJ3 A;  1QOA A;  1X1M A;  1C77 A;  1PGB A;  2KAC A;  4EE2 A;  5JXV A;  1HE8 A;  2G4S A;  2EKE C;  2RMM A;  2LFI A;  4AWJ A;  4M0W B;  2J4X A;  2K6D B;  1MPE A;  1KM7 A;  2KC1 A;  2KDF B;  3SDL C;  1MHH E;  4KGR A;  1RYJ A;  5IN7 A;  3LJ3 A;  4BKS A;  5BMI A;  4JX1 C;  3AEG B;  3TSS A;  4KSK C;  3VHT C;  2X8X X;  3ML9 A;  2WXP A;  3ZW3 A;  2Z8L A;  1SE9 A;  1VZ7 A;  1QF6 A;  1KFY B;  2BS4 B;  2BS3 B;  2NPT B;  2UYZ B;  1Z5S B;  4MT5 A;  4BZA A;  2PLP A;  3TEW A;  4GMV A;  4KV2 A;  3MFG A;  3TMP B;  1WJ6 A;  1CZP A;  4BKS D;  2YEP B;  4RGM A;  2KLG A;  4TSS A;  2GOW A;  3W1S A;  1I35 A;  5G2N A;  5C1Z A;  3BWU D;  1EWY C;  2LGD A;  3I63 C;  2FUH B;  2KKC A;  1E90 A;  2BYE A;  2LEK A;  4WAA A;  2KJ6 A;  4W9J A;  1RWS A;  2IDY A;  1LQB A;  3HIZ A;  2L0T A;  3KYC D;  1R4N I;  3NVY A;  1ENF A;  1L2N A;  5IOI A;  2CHZ A;  3DHG C;  3VH3 B;  3Q3J A;  2JF5 A;  1K50 A;  1G6J A;  1EM7 A;  4G50 A;  4IM3 A;  4TQ0 A;  4XYC A;  1N61 A;  3A4R A;  3EUB 2;  1S1Q B;  1PFD A;  2DWQ A;  2O2V A;  2M19 A;  4TKN A;  3EFC A;  3A9J A;  4FJV B;  2G4D B;  3A9K B;  3M95 A;  4AS1 A;  3P4S B;  1UWM A;  1DOI A;  1JWU D; 
#chains in the Genus database with same CATH homology
 3N1Z C;  1T0Q C;  3N20 C;  3Q3M C;  1T0S C;  3I63 C;  3N1Y C;  3RNB C;  3GE8 C;  3RNG C;  1T0R C;  3I5J C;  3GE3 C;  4P1C C;  3DHI C;  3Q14 C;  3RN9 C;  3Q3O C;  3RI7 C;  3RMK C;  2INC C;  2IND C;  3RNA C;  4P1B C;  3RNF C;  3RNC C;  2RDB C;  3DHG C;  3RNE C;  3DHH C;  3Q2A C;  3Q3N C;  3N1X C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...