3GE3C

Crystal structure of the reduced toluene 4-monooxygenase hd t201a mutant complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
83
structure length
83
Chain Sequence
SAFPVHAAFEKDFLVQLVVVDLNDSMDQVAEKVAYHCVNRRVAPREGVMRVRKHRSTELFPRDMTIAESGLNPTEVIDVVFEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Toluene-4-monooxygenase system protein A
publication title Role for threonine 201 in the catalytic cycle of the soluble diiron hydroxylase toluene 4-monooxygenase.
pubmed doi rcsb
source organism Pseudomonas mendocina
total genus 25
structure length 83
sequence length 83
ec nomenclature ec 1.14.13.236: Toluene 4-monooxygenase.
pdb deposition date 2009-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 3ge3C00
2INDC 3GE3C 1T0QC 2RDBC 1T0SC 3Q2AC 3I5JC 3Q14C 3Q3NC 3N20C 2INCC 3N1XC 3RI7C 3RN9C 3RNGC 3N1YC 3GE8C 3RMKC 3DHHC 1T0RC 3DHIC 3N1ZC 4P1BC 3RNEC 3RNFC 3DHGC 3Q3OC 3RNCC 3RNBC 3Q3MC 4P1CC 3RNAC 3I63C
chains in the Genus database with same CATH superfamily
3GE3C 4HCNB 2M0AA 3ONSA 1I4RA 3I5JC 2BYVE 3CSTA 1TY0A 1KTKA 2PEAA 5LNK1 1E7PB 2LI5A 4GDLB 4XZ4A 1YX6B 3PPAA 2IPKD 1I42A 5AUKA 2MJEA 1MG4A 3ZNID 1LGRA 3W5UB 2KOXA 1XF5L 4ASWC 2XNAC 4DXGA 2HD5B 3O13A 2L8JA 2LJIA 1WXAA 3A9JA 1ISNA 4GU2A 4W9GA 4GGQA 1B1ZA 2NBVB 1K51A 3K9OB 2BS2B 1UGMA 1E90A 3VQIA 4MT5A 3KUCB 1C4AA 2FCNA 4A3OA 2KWDA 4P7IA 3QQ8B 4BKSD 4KV2A 1KRHA 1J7BA 1HXYD 3HVDA 4ITKA 2L76A 3L13A 2XN9C 1D4BA 2MQJA 3L08A 2N9XA 1XQQA 4FULA 3ZJTA 4MJSA 1U4AA 1IUEA 2N0SB 2C60A 2INNE 5AZGA 4BBNC 2JU6X 1OFFA 2FNJB 4ZHPA 1XCTL 3RFZB 2M17A 1N61A 1MFWA 5TSSA 2WXIA 2Y5BB 1VJKA 2MWSB 1L2NA 3Q2AC 3RZFA 3BY4B 2PTLA 4WJQA 4AP4C 1A5RA 2DZJA 4KIKB 4LNFA 3UI3A 1ENFA 3BZDB 5EE0A 4WH4A 3EGRA 3ML9A 4EZKA 4W9JA 2C5LC 2LHEA 1NI3A 1GB4A 1TJEA 1GC7A 3JSVB 1JWUD 3A33B 3PVLA 3PRZA 1XXGA 2DLBA 1WI0A 1V6EA 3VAWA 4MGIE 2KACA 2YEPB 4LNOA 2D10A 3H7PB 4D2KA 1WYWB 3AULA 5JHAA 1QOGA 4MGKE 1GPXA 3M63B 3QWZB 4ARCA 4ICVA 3H6NA 4P1CC 4HEA1 2FCQA 4OZBA 2M1MA 3BVZA 2KC1A 3EC8A 1V8CA 2KD0A 3LYYA 1C79A 2A4ZA 2BPSA 2I1JA 1GUAB 1J7CA 1WGGA 4CYEA 4H2AA 4J3OD 3ECIA 1KLGD 5IOIA 4RF0A 4GLSC 2JVCA 5E6NA 3A4SC 5GMVA 4EEWA 2W9NA 3W5VB 3ZTDA 1Q1OA 1V1PB 1C78A 1J19A 3QARA 4BKTA 4FJVB 5C23A 1EM7A 2IGHA 2KX3A 2W54A 4RM9A 1I4HA 1JMLA 3ZUNA 2AEHA 1L4ZB 3OLMD 3AE9B 2DYBA 1HE8A 3EUB2 3DVNU 1PQSA 4KGTA 2B3AA 4FLHA 1MVKA 2REXA 4XDCA 2LGDA 3ZO5B 3Q8CA 2W3RA 3A9JB 5E6OA 3Q6BA 2L0FA 5IO9A 4XC2A 2JRHA 1V9JA 1PGXA 2Y5PA 4XWWA 2X38A 2MHJA 4YTMB 1XT9B 4HJGE 1FFVA 2LASA 2D11A 3QC8B 1F9JA 2K39A 1EU3A 1RLFA 3HVZA 4FHKA 3PLVA 4WWMA 4MJSB 2K8CA 4G3XB 1I4PA 2L7RA 2MW5A 3OJ4B 2CHXA 5HFYA 4I6NB 3ZVVA 2JT4B 3MHZA 1EUVB 5BMGA 2VZKD 3CSFA 2HE7A 1EWCA 1P0RA 5L83A 5DPWA 3RN9C 3DVNV 4C00A 2PE6B 1T6BX 2KJ6A 3EFCA 1BXTA 4LK0M 2DNFA 3BK1A 1XLOA 2XEWA 3KWLA 1DOXA 5J18A 2INPE 4YTPB 2K25A 3C19A 4KGSA 3PSEB 2JQRB 2NMQA 1PGBA 2WDVB 3VH3B 1ROEA 4KZ0A 1E7VA 3UIPB 4HKZE 3U7ZA 3RNBC 3TEYA 1YN5A 1FCLA 2WXNA 4CHKA 2BF8B 2RDBC 3VUWA 1T0SC 1JCKB 4PYZA 3MTNB 1M4VA 1KH0A 1NENB 4EKUA 1YQ3B 2ZPNA 3UGBB 1JRPA 2XK5A 3PV1A 4QAYA 3H1UA 3V6EB 1Y8RC 2MJ3A 3DWMA 4KVGB 3CIRB 3AH7A 2WGSA 3ZKJC 2KVZA 1LM8B 2JXTA 5EE3A 5JXVA 1CK1A 1EF1A 2CJOA 3VFKA 2WU2B 4K81A 4OZCA 4BAXA 2FIFA 2KT7A 1F52A 2RGFA 1FNVA 1L0XB 2KDIA 2MBBB 2PVOD 2QEJC 2Q5WD 2WQYB 4R3DA 2R2OA 1R4MB 3PHXB 3Q3FA 5D7GA 1GJZA 1F2RI 1HTOA 2WXGA 3CMMB 1QQRA 1JRUA 1SF0A 2KDBA 5J2RA 4KKJA 1DOIA 4E3CA 4YTNB 1YQBA 2LMCA 4ZRJA 3WAMA 3UINB 2KLCA 1MI0A 1WGKA 4WWPA 1V5OA 4BVUC 2WXFA 2ZVNA 3WCQA 3Q69A 2LVOA 1IGCA 4TSSA 2LJ5A 1XEEA 2BW2A 4PS3A 1SSNA 3B1LX 2NS5A 1FM0D 1SGHA 2N1VA 2KX0A 3EHVA 2O6VB 2I1KA 1FNWA 2WXKA 3APDA 2IO1B 4CO7A 2J53A 3NZUA 1VLBA 1YD8U 3EA6A 3GS2A 3UIOB 1C76A 3KYCD 5G5GA 3GZNI 2A5UA 3X0WA 2SEBD 3VR9B 1WY8A 1QOBA 3L16A 3T8MA 1RYJA 2WXLA 4XYCA 1UBIA 2E3TA 4HDOA 1IPGA 2BS4B 1SJED 2MRPA 2KC2A 4DQOC 1QOAA 5CX3A 2ZW0A 1YJJA 2Z0DB 2L00B 3N20C 1KM7A 1ET9A 3DDCB 2J42A 4G50A 2HDEA 2MBHA 4N58A 1T0RC 2MBEA 4NY0A 4NAMA 3L54A 5G2NA 3KLSX 1KFYB 2D3GA 4I6PA 3EFUA 1RFKA 2Y5CA 2KFJA 3V6CB 1JROA 2CU3A 4LCDE 1OEYJ 2DHZA 3JW0X 1VRAB 2KNBA 1M94A 2M19A 3IXSA 1TGZB 2GBNA 2BGFA 2QHOA 3EECA 2XK5B 2N9PC 2RPVA 4JL9A 4URKA 4IG7B 1B9RA 1NVID 4K7SA 4MM3A 4IWPA 1TKYA 5G55A 4HKQA 4LNIA 1P7FA 1SJHD 3DWGC 2M56B 4IDIA 5BO4B 4A20A 5DPRA 2GLSA 4AUQC 2OHFA 5G5HA 1TKGA 3DHIC 4S17A 5BMIA 4YXDB 2WXOA 2IO2B 4WIPA 3A1QA 4PT5A 3LJ3A 1SXTA 3KUDB 3Q14C 3PO0A 1JWSD 4BBNF 1F77A 1JW9D 1PUTA 3MC9A 4HDQA 4JE3B 2O2VA 3TJPA 1WZ0A 3P1MA 2KQSA 3RNEC 2D07B 2EKIA 2WXHA 4EOYA 2ZZPB 3MC8A 1WWTA 4LDTB 3A4RA 3R7QA 2D3CA 4KX6B 1FMAD 2KQ7A 4PS7A 1G6JA 4E71A 5GXGB 2ZCCA 4HROA 4B0EA 3AU5A 1CMXB 1A70A 3TBLD 1WX8A 4KDLB 3Q8EA 1QT9A 1TT5B 3H7SA 3NHEB 1HZ6A 1ZDVA 2JF5A 2G9HD 4WAFA 3WA0A 1FIQA 4MSMB 1PDXA 3ZNZB 1DOYA 3QK0A 2JYEA 3TIXA 2R61A 5I4DA 3QHTA 4MACA 4P16A 2OEDA 1TS2A 1F0ZA 4RGNA 3AU4A 4KSKC 4BKSA 1EF5A 4S0RA 4DHJB 1S3SG 2DAFA 2I38A 2CHZA 2KANA 3ETRA 4PS8A 4LJOB 4FJYA 1GAQB 5KHOA 4DDID 4C4VB 2N4FA 2QIEB 2BQQA 4TQ1A 4M8NA 2DAJA 2QCZA 2WWZA 2CKHB 2FAZA 2WXJA 2PW9A 3DPDA 2M8SA 4KKIA 1Q0WB 2OJRA 3NVVA 3FC4A 4LNKA 1E7UA 2WP9B 3QX1A 3KVFB 3GE8C 3MC0B 3IAS1 3RCZA 2DYOA 1JALA 1WXMA 2PJHA 1R7SA 1AWDA 4GOCA 4W9CA 2OJWA 1D6EC 3HIZA 4HWIB 5CTRC 3L10B 1I4GA 2NTSA 2RSUA 1WXVA 4MM3B 1E5WA 3ZRFA 4WJNA 1E9MA 3T3NA 3ALBA 1WRIA 3VRBB 5J17A 3TEWA 1P3QU 3VTUA 2MEKA 3UQAA 1Q5WB 2KYWA 4AJYB 1C4CA 5C1ZA 2KFKA 2LRWA 3A1QB 4EFOA 3T3OA 2JY6A 2LXCA 2NPTA 3ZGZA 2KO3A 1SE4A 4BZAA 3SEBA 1ZKHA 3AEFB 2PIAA 2LVPA 1IP9A 3SFEB 1WE6A 3LXFA 4NAWA 3VRAB 4M02A 2KMMA 2LVQA 3UQBA 4IWOA 3CWIA 4MH8A 1N5XA 4IM0A 2J0MA 3AMZA 4JX1C 2KDEB 1FNUA 3PLUA 2WXPA 2JXXA 1ZP0B 1XO3A 1OEYA 2WHIA 3B0AA 2WYQA 3NUHB 3QAQA 3U52E 3U4EG 1UELA 3B08A 2K6DB 5JZEB 1WR1A 3AE4B 1C4PA 3ML8A 5LXIB 2DZKA 2V9HA 3X23A 4RGOS 2JZ3B 3N1ZC 4WAAA 5EE1A 3RNCC 2DWQA 2H89B 1D3ZA 2C7MB 2KZRA 1WMHA 4XX5A 3HRDD 1LXDA 2IO3B 3ZDTA 2V3NA 1WJUA 4ARIA 1NBFC 3KWVA 3R2TA 1UGJA 2IGDA 2JX5A 1KF6B 1L4DB 2WX1A 3TSSA 2EMTA 2M0XA 3L17A 3Q8AA 1XLQA 1IYFA 1KLVA 3I3TB 2DENB 1V49A 4KGRA 2MP2A 4L23A 3N1XC 3VH4B 4EUTA 2BBCA 3APFA 3DBSA 1R4MI 4IC7B 4I6LB 2W55A 1DGJA 4II3B 3AE7B 2N1WA 2N7JA 4WJPA 2PE9A 3H9DA 1TKEA 1E8ZA 4W9EA 1E6EB 5H92C 3IG3A 2EELA 2MBOA 1V2YA 3P4RB 4REZA 4LTUA 1WGYA 2ON8A 3KYDD 3RNFC 3PREA 2MJDA 3D32A 2C9WB 1QZEA 4TMAB 2BB6A 2UWQA 2EMSA 3KUZA 4K3CA 1ZUD2 2WS3B 2KFKB 3BVGA 3PZ8A 3QCAA 3E56A 3SHQA 2O6VD 5EDSA 2GB1A 5T8IA 2B76B 2RMMA 5D2MB 2KTFA 2YLMA 3SDLC 2JWZA 3U7DA 1ZW7A 4NAWB 2IYDB 3GB1A 2D3BA 3SU8X 2WDTB 4PK1A 2K8BA 2SAKA 2WU5B 5AZHA 3P4PB 2IBIB 4GSWA 3HM3A 1TYGB 2KDFB 3PS6A 4K3BA 2KK8A 4MGZE 4XGAB 4ANVA 2INDC 4MEMA 1C77A 1YNTE 3HHMA 3RYTA 4E74A 4K7WA 4ZYSA 1N60A 1WJNA 2ZPYA 4IM3A 4ZDVA 2RDHA 1WIAA 2JZZA 4YWGG 1IGDA 3BYYB 3ZTCA 3SD5A 1V1OA 2AQ3B 2C7HA 4FN2A 4AWJA 3RUIB 3I63C 2BYEA 2WLBA 3KH0A 3DVGY 4TKNA 1WGRA 1RWSA 2LGYA 2NCNA 2E6XA 1WMHB 3SR6A 1FPYA 4RGTA 4ZRQA 2BVCA 3AN1A 4M00A 2L05A 3NZSA 4JIOU 1TY2A 3AB5A 2G1EA 2NBUA 2G3QB 2PPHA 1R4NB 1N5WA 4HRSA 3TEZA 4NJCA 1EO6A 3ZRCA 4N59A 3PRMB 4DXFA 4YSYB 2VZKB 2L32A 4BFRA 3RMKC 4AOFA 3BYTB 4DDGD 4KSLC 1AYFA 4ZHOA 1WJ4A 1Z2MA 2IJ0A 2ICIA 2WX0A 2K3UA 3U8ZA 3PZDA 4W9FA 3NG0A 3OJ3A 2NBWB 3PT2B 2WXQA 4WQMA 3Q3NC 3RPFC 5D3IB 2KN5A 2INCC 1PYWD 4JPSA 4RM8A 1ZXIA 2DX5B 2WXRA 3OG5A 4RGMA 3BK2A 2KTRA 1TBEA 2L52A 4GDKA 1WH3A 3JVZX 5BMHA 2HTME 1MPEA 3U2SC 1CQVA 4IUMB 3LB8C 4GDLA 3FKYA 1D5XC 3N3KB 4JWSC 4RF1A 2LZ6A 1LO5D 2GI9A 1ZXHA 1RRBA 1I35A 3RULA 1MHHE 2GBKA 4LJPB 3AI5A 2LGIA 4F7ZA 1V97A 2FCSA 1C9FA 2VRRB 5LXHA 2WDRB 1I4XA 2QSDA 2D3AA 4G0NB 2OOBB 4DXAB 2KAJA 1FD6A 2MH7A 2KJRA 2QJLA 1E0ZA 4OW0A 3URYA 2QILA 3N1YC 1V86A 3Q8FA 4ANUA 1ESFA 4RMAA 3KW5B 2AL3A 1ZPSA 3AEAB 3Q3OC 1WX9A 3AECB 5DCNA 1Y56A 1V80A 3AEEB 3DOWA 5FKAC 2L0TA 1UBQA 4P6VF 3W1SA 1FXIA 4M01A 3Q3JA 3ZQ4A 1UH6A 3VR8B 2JRIB 1I7HA 2K22A 3AE5B 2BS3B 4C56C 3R2IA 2KLGA 1WJ6A 2G4DB 1UUPA 4W9DA 1K50A 2NVUI 5HKHA 2K5PA 1YIWA 2LFIA 1N6ZA 2AQ1B 2KWVB 5EE9A 4K1RB 4A55A 2K1FA 2N9KA 4MELA 1CJEA 3W1SC 3AXCA 3ZYYX 1FRRA 1UZXB 2KDMA 2W82A 3WANA 4IOIE 4B0MA 3JYUA 2Z0EB 2FIDA 3RD2A 3H7PA 1YX5B 4ZRKA 2Z59B 2V3PA 1HTQA 2V4IB 1ZE3D 4YL8A 1WF9A 1VR9A 4YSZB 1E10A 2HJ8A 3LDZE 2QDFA 3AEDB 4BOZB 2BB5A 3TL5A 2GBRA 4GXBA 1EU4A 2BT6A 2K0PA 2K6QA 3IFWB 4XWTA 1LFDA 5DPSA 1UNSA 1WFYA 4DBGA 4M0WA 2KTRB 3WAOA 3A9KA 2GBJA 4GDKB 3DBLI 1WZ3A 2LUMA 4WQOB 3FILA 4JLCA 3SFDB 1T0QC 4ANXA 4C7YA 4W9HA 3UF8A 1KJTA 1OQRA 3P4SB 3V3XA 1P9DU 4WURA 1J7AA 3PRPB 1H8CA 4M8MA 4MDKE 5JH5C 1YOVB 3TMPB 3QJZA 3TCAA 4C80A 1L6VA 3DCGA 1NYRA 3IAM1 1SE2A 1YN4A 2FCMA 3WALA 3IBEA 2AYOB 4DK5A 2IO0B 2PMVA 1FEHA 3M3JA 1TTNA 3BVMA 5FK9C 1QF6A 3DBHB 1SBBB 2H88B 3NVZA 3NOBA 3MJWA 4P1BC 4G11A 5L95C 3IT6B 4AQ7A 1ZDXA 2GOWA 4GIVA 4A8XC 4EE2A 3AE3B 1SE9A 4HPPA 4B9KA 2KN4A 1RFAA 3Q8BA 1WRDB 4F1SA 4WWNA 2ZNVC 2N7EA 3VVWB 3R3MA 4ICUA 2J0KA 3O65B 2CJNA 5AUIA 1ZOYB 4K7UA 4FA6A 3NRZA 2PKOA 1RAXA 1XLNA 4HPLB 3PTFC 1QLBB 1BMLC 1JQ4A 2WDQB 3AE8B 3ZLZA 1V5TA 2IZVB 1RM6C 3QIJA 2LEKA 3WIMA 3V62A 1NYQA 1C1YB 3NVWA 2M4NA 4NQLB 1QKZA 2AX5A 5BYRA 1N63A 5D6JB 3ABVB 4A90A 3HM6X 2O2VB 4OVZA 2ZW1A 4US8A 2KHWB 3ZXRA 3RT3B 3ZXVA 1NI2A 2ACZB 2N9EB 5AEKB 1V81A 1MJDA 3B2FA 3KQ4A 3R7RA 2ZVOA 4OVVA 2LD9A 4W9IA 1E8WA 1TZ1A 3T9LA 2WXMA 3DBLB 4Q2JA 2YVCA 2KQ4X 4L2YA 1UD7A 3N32A 1YJIA 1VZ8A 2AL6A 3Q3MC 4EZJA 2BYTA 1UF0A 1VZ6A 3IHPC 4IW0A 4WJOA 1HQRD 3VHTC 5IA7A 1T0YA 1OTRB 4NNJB 3S2AA 3VUXA 5C2TB 1KOTA 1WSPA 4PYUA 4JGHB 3APCA 2TSSA 3M95A 4US9A 5JHBA 4F8CB 1WXSA 1VD2A 4CQNA 4M0WB 1TS3A 4ZOHC 1BT0A 2ONQA 3A9KB 5KHQA 1L0YB 2DYMA 3FILB 2RDGA 3P42A 1T5XD 2FE8A 3RI7C 1JWMD 5MPOA 2DBYA 2BWFA 2N9LA 3DBRI 4LLGM 4HVBA 2DZMA 4FHJA 1K8RB 2JSVX 2LRUA 2ZNVB 1SIFA 2QMTA 4KZCA 2JPHA 1VDVA 3BIID 1P7EA 1JWAD 4TV3A 3AV8A 1E8YA 3C8YA 3L4PA 1VZ7A 1L7YA 4XE0A 2MBQA 4DHZE 4AS1A 2C7NB 4IKGA 4KDIC 5IAAC 2GRIA 2ZEQA 1FCCC 1WR6E 3ENEA 4YT0B 4LNNA 2J52A 1CZPA 2RD0A 3NVYA 1WYGA 2MA9B 3V61A 4XDDA 1R4NI 1IBXA 1OQQA 4IM2A 2ASQA 2G45B 1TIFA 2FUHB 4NPNA 2LHDA 2K9XA 2O6VA 2KVRA 3NY5A 1AARA 1GG3A 5TR5A 1MG8A 2JUOA 4FBJB 2AQ2B 2J7QB 2KKCA 1WM2A 1X1MA 2XBBC 3HUIA 4HJKA 3GOEA 1SEBD 2MCNB 1LQBA 4JQWC 3I57A 1WM3A 3ZNGC 2IY1B 4RNAA 3V60A 5BYSA 2HTHA 2KJHB 1OGWA 3ZJVA 3IT4B 3ZDMC 3W9CB 2VH1A 5LLIA 2RR9A 3MP9A 1Q10A 4N9F4 1XD3B 2NPTB 3AE2B 2D5GA 3NJTA 5AZFA 3J9CA 1MHXA 2LGXA 4NZLB 3WAPA 4TQ0A 1C3TA 3B9JA 2KXJA 2W3SA 3B2GA 2LUEA 4JWUC 4RCOA 3P63A 5D94A 3AM9A 4A9AA 3PGEA 2Y3AA 5FR6A 3HK0A 2UU7A 2D2QA 4A3PA 2EKEC 4HCPB 1YQ4B 1WXQA 1AW7A 2NTTA 4USAA 3FAHA 1D5MC 4YSXB 3RNAC 1L5PA 1TZOA 1E8XA 3V05A 4GMVA 1Z5SB 4TUUA 1QILA 2JWUA 3DBRB 1J8CA 2AWTA 4WWOA 3QA8A 5IKCM 3RNGC 1YJ1A 5E6JA 2LXAA 2WNMA 3MFGA 1WE7A 2QC8A 3L0WB 3BWUD 2V0GA 2Z8LA 2V3SA 3P4QB 1GC6A 1XLPA 3H8HA 4RFBA 4EZLA 4IWQA 5H8YE 3W2DA 4HK2A 4FXCA 3CF6E 2CU1A 1YMHE 1GOZA 3N9YC 4NJ6A 4NQKE 3ZIMA 1TS5A 3R8BA 2MLBA 1TS4A 1PFDA 4AJWA 3U30A 3VTVA 1FXAA 1NDDA 1D5ZC 4ZRPA 3MHSD 1S1QB 3AE1B 3ZJUA 2VH2A 1JWBD 4J6IA 2L83A 2K8HA 2GMIC 3N30A 1P1AA 2IGGA 2GBMA 1F2RC 2JZPA 3I9V1 2UYZB 2IDYA 3PZ7A 3OAWA 5HHDG 3VUYA 2MP2B 1OQYA 4GB9A 4UDUC 3DHGC 3W1YA 2V4LA 5BYQA 4O1NA 2HJ1A 4OHJA 3NZ3A 4OVUA 4BKGA 4ZYNA 2CR5A 1FRDA 2JYTA 1GNUA 1L0VB 1J0GA 1IBXB 2RPQA 1N62A 4HLEA 1GB1A 1VCBA 4FADA 2L1AA 1XCQL 1UWMA 4LDTD 4X57B 4HXDA 3K9PB 3TEXA 3GP7A 2L3ZA 4W9KA 4B6WA 2IY0B 3DHHC 4MGYE 2V1YA 1WGDA 2MX2A 4DHZB 2ZCBA 1ET6A 3C0RB 2BKFA 2BYFA 3P2BA 1FO4A 4C4VA 2ZJDA 1UWXA 2YEPF 1WGHA 5DPTA 4GN1A 2PVGC 2BWES 2FBWB 1I4QA 3R66C 1T3QA 2KMAA 1HA5A 3M62B 4L1BA 1FXTB 5CHVC 2G4SA 1H4RA 1EWYC 4HPMB 5E6PA 4DHJD 4NJ7A 4ACFA 4BOSC 3OWEB 2LGSA 2KWUB 2BKRB 5CHFA 4B95A 3RZWC 2R2QA 3PHWB 5FR3A 4C7ZA 3MJ5A 4A6QA 3VXWA 1K53A 3VTWA 4RH6A 2J4XA 2X8XX 4II2B 2NR2A 1L6UA 1FFUA 2KWCA 5CHWA 3DBHI 1SIJA 2I2YA 1ACCA 3ZNHB 5HI1A 2CHWA 2KMCA 4OZAA 3NS1A 4KIKA 1HEZE 2N7DA 4N6EB 1HZ5A 2LWPA 4ANWA 2PLPA 2DZIA 3JSVA 1AN8A 3AE6B 5C3JB 5IP4D 1PGAA 3AEBB 3AEGB 1F1HA 4ZRIA 1SB3C 3VDZA 1P98A 1ZGUB 1DYQA 1QOFA 5HG2A 3TUOA 5IN7A 1BUIC 1SE3A 5D3DA 1KLUD 3BINA 3DVGX 3GZNB 3IVFA 1WX7A 2MSED 1K52A 1YN3A 3ZW3A 4MH0E 2BTEA 3NS8A 4MSQB 2FUG1 1STEA 1NEKB 4DWFA 2J0JA 4FJZA 2CS4A 4W9LA 3DQVA 3E9SA 1V1PA
chains in the Genus database with same CATH topology
2INDC 3GE3C 1T0QC 2RDBC 1T0SC 3Q2AC 3I5JC 3Q14C 3Q3NC 3N20C 2INCC 3N1XC 3RI7C 3RN9C 3RNGC 3N1YC 3GE8C 3RMKC 3DHHC 1T0RC 3DHIC 3N1ZC 4P1BC 3RNEC 3RNFC 3DHGC 3Q3OC 3RNCC 3RNBC 3Q3MC 4P1CC 3RNAC 3I63C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IND C;  3GE3 C;  1T0Q C;  2RDB C;  1T0S C;  3Q2A C;  3I5J C;  3Q14 C;  3Q3N C;  3N20 C;  2INC C;  3N1X C;  3RI7 C;  3RN9 C;  3RNG C;  3N1Y C;  3GE8 C;  3RMK C;  3DHH C;  1T0R C;  3DHI C;  3N1Z C;  4P1B C;  3RNE C;  3RNF C;  3DHG C;  3Q3O C;  3RNC C;  3RNB C;  3Q3M C;  4P1C C;  3RNA C;  3I63 C; 
#chains in the Genus database with same CATH topology
 3GE3 C;  4HCN B;  2M0A A;  3ONS A;  1I4R A;  3I5J C;  2BYV E;  3CST A;  1TY0 A;  1KTK A;  2PEA A;  5LNK 1;  1E7P B;  2LI5 A;  4GDL B;  4XZ4 A;  1YX6 B;  3PPA A;  2IPK D;  1I42 A;  5AUK A;  2MJE A;  1MG4 A;  3ZNI D;  1LGR A;  3W5U B;  2KOX A;  1XF5 L;  4ASW C;  2XNA C;  4DXG A;  2HD5 B;  3O13 A;  2L8J A;  2LJI A;  1WXA A;  3A9J A;  1ISN A;  4GU2 A;  4W9G A;  4GGQ A;  1B1Z A;  2NBV B;  1K51 A;  3K9O B;  2BS2 B;  1UGM A;  1E90 A;  3VQI A;  4MT5 A;  3KUC B;  1C4A A;  2FCN A;  4A3O A;  2KWD A;  4P7I A;  3QQ8 B;  4BKS D;  4KV2 A;  1KRH A;  1J7B A;  1HXY D;  3HVD A;  4ITK A;  2L76 A;  3L13 A;  2XN9 C;  1D4B A;  2MQJ A;  3L08 A;  2N9X A;  1XQQ A;  4FUL A;  3ZJT A;  4MJS A;  1U4A A;  1IUE A;  2N0S B;  2C60 A;  2INN E;  5AZG A;  4BBN C;  2JU6 X;  1OFF A;  2FNJ B;  4ZHP A;  1XCT L;  3RFZ B;  2M17 A;  1N61 A;  1MFW A;  5TSS A;  2WXI A;  2Y5B B;  1VJK A;  2MWS B;  1L2N A;  3Q2A C;  3RZF A;  3BY4 B;  2PTL A;  4WJQ A;  4AP4 C;  1A5R A;  2DZJ A;  4KIK B;  4LNF A;  3UI3 A;  1ENF A;  3BZD B;  5EE0 A;  4WH4 A;  3EGR A;  3ML9 A;  4EZK A;  4W9J A;  2C5L C;  2LHE A;  1NI3 A;  1GB4 A;  1TJE A;  1GC7 A;  3JSV B;  1JWU D;  3A33 B;  3PVL A;  3PRZ A;  1XXG A;  2DLB A;  1WI0 A;  1V6E A;  3VAW A;  4MGI E;  2KAC A;  2YEP B;  4LNO A;  2D10 A;  3H7P B;  4D2K A;  1WYW B;  3AUL A;  5JHA A;  1QOG A;  4MGK E;  1GPX A;  3M63 B;  3QWZ B;  4ARC A;  4ICV A;  3H6N A;  4P1C C;  4HEA 1;  2FCQ A;  4OZB A;  2M1M A;  3BVZ A;  2KC1 A;  3EC8 A;  1V8C A;  2KD0 A;  3LYY A;  1C79 A;  2A4Z A;  2BPS A;  2I1J A;  1GUA B;  1J7C A;  1WGG A;  4CYE A;  4H2A A;  4J3O D;  3ECI A;  1KLG D;  5IOI A;  4RF0 A;  4GLS C;  2JVC A;  5E6N A;  3A4S C;  5GMV A;  4EEW A;  2W9N A;  3W5V B;  3ZTD A;  1Q1O A;  1V1P B;  1C78 A;  1J19 A;  3QAR A;  4BKT A;  4FJV B;  5C23 A;  1EM7 A;  2IGH A;  2KX3 A;  2W54 A;  4RM9 A;  1I4H A;  1JML A;  3ZUN A;  2AEH A;  1L4Z B;  3OLM D;  3AE9 B;  2DYB A;  1HE8 A;  3EUB 2;  3DVN U;  1PQS A;  4KGT A;  2B3A A;  4FLH A;  1MVK A;  2REX A;  4XDC A;  2LGD A;  3ZO5 B;  3Q8C A;  2W3R A;  3A9J B;  5E6O A;  3Q6B A;  2L0F A;  5IO9 A;  4XC2 A;  2JRH A;  1V9J A;  1PGX A;  2Y5P A;  4XWW A;  2X38 A;  2MHJ A;  4YTM B;  1XT9 B;  4HJG E;  1FFV A;  2LAS A;  2D11 A;  3QC8 B;  1F9J A;  2K39 A;  1EU3 A;  1RLF A;  3HVZ A;  4FHK A;  3PLV A;  4WWM A;  4MJS B;  2K8C A;  4G3X B;  1I4P A;  2L7R A;  2MW5 A;  3OJ4 B;  2CHX A;  5HFY A;  4I6N B;  3ZVV A;  2JT4 B;  3MHZ A;  1EUV B;  5BMG A;  2VZK D;  3CSF A;  2HE7 A;  1EWC A;  1P0R A;  5L83 A;  5DPW A;  3RN9 C;  3DVN V;  4C00 A;  2PE6 B;  1T6B X;  2KJ6 A;  3EFC A;  1BXT A;  4LK0 M;  2DNF A;  3BK1 A;  1XLO A;  2XEW A;  3KWL A;  1DOX A;  5J18 A;  2INP E;  4YTP B;  2K25 A;  3C19 A;  4KGS A;  3PSE B;  2JQR B;  2NMQ A;  1PGB A;  2WDV B;  3VH3 B;  1ROE A;  4KZ0 A;  1E7V A;  3UIP B;  4HKZ E;  3U7Z A;  3RNB C;  3TEY A;  1YN5 A;  1FCL A;  2WXN A;  4CHK A;  2BF8 B;  2RDB C;  3VUW A;  1T0S C;  1JCK B;  4PYZ A;  3MTN B;  1M4V A;  1KH0 A;  1NEN B;  4EKU A;  1YQ3 B;  2ZPN A;  3UGB B;  1JRP A;  2XK5 A;  3PV1 A;  4QAY A;  3H1U A;  3V6E B;  1Y8R C;  2MJ3 A;  3DWM A;  4KVG B;  3CIR B;  3AH7 A;  2WGS A;  3ZKJ C;  2KVZ A;  1LM8 B;  2JXT A;  5EE3 A;  5JXV A;  1CK1 A;  1EF1 A;  2CJO A;  3VFK A;  2WU2 B;  4K81 A;  4OZC A;  4BAX A;  2FIF A;  2KT7 A;  1F52 A;  2RGF A;  1FNV A;  1L0X B;  2KDI A;  2MBB B;  2PVO D;  2QEJ C;  2Q5W D;  2WQY B;  4R3D A;  2R2O A;  1R4M B;  3PHX B;  3Q3F A;  5D7G A;  1GJZ A;  1F2R I;  1HTO A;  2WXG A;  3CMM B;  1QQR A;  1JRU A;  1SF0 A;  2KDB A;  5J2R A;  4KKJ A;  1DOI A;  4E3C A;  4YTN B;  1YQB A;  2LMC A;  4ZRJ A;  3WAM A;  3UIN B;  2KLC A;  1MI0 A;  1WGK A;  4WWP A;  1V5O A;  4BVU C;  2WXF A;  2ZVN A;  3WCQ A;  3Q69 A;  2LVO A;  1IGC A;  4TSS A;  2LJ5 A;  1XEE A;  2BW2 A;  4PS3 A;  1SSN A;  3B1L X;  2NS5 A;  1FM0 D;  1SGH A;  2N1V A;  2KX0 A;  3EHV A;  2O6V B;  2I1K A;  1FNW A;  2WXK A;  3APD A;  2IO1 B;  4CO7 A;  2J53 A;  3NZU A;  1VLB A;  1YD8 U;  3EA6 A;  3GS2 A;  3UIO B;  1C76 A;  3KYC D;  5G5G A;  3GZN I;  2A5U A;  3X0W A;  2SEB D;  3VR9 B;  1WY8 A;  1QOB A;  3L16 A;  3T8M A;  1RYJ A;  2WXL A;  4XYC A;  1UBI A;  2E3T A;  4HDO A;  1IPG A;  2BS4 B;  1SJE D;  2MRP A;  2KC2 A;  4DQO C;  1QOA A;  5CX3 A;  2ZW0 A;  1YJJ A;  2Z0D B;  2L00 B;  3N20 C;  1KM7 A;  1ET9 A;  3DDC B;  2J42 A;  4G50 A;  2HDE A;  2MBH A;  4N58 A;  1T0R C;  2MBE A;  4NY0 A;  4NAM A;  3L54 A;  5G2N A;  3KLS X;  1KFY B;  2D3G A;  4I6P A;  3EFU A;  1RFK A;  2Y5C A;  2KFJ A;  3V6C B;  1JRO A;  2CU3 A;  4LCD E;  1OEY J;  2DHZ A;  3JW0 X;  1VRA B;  2KNB A;  1M94 A;  2M19 A;  3IXS A;  1TGZ B;  2GBN A;  2BGF A;  2QHO A;  3EEC A;  2XK5 B;  2N9P C;  2RPV A;  4JL9 A;  4URK A;  4IG7 B;  1B9R A;  1NVI D;  4K7S A;  4MM3 A;  4IWP A;  1TKY A;  5G55 A;  4HKQ A;  4LNI A;  1P7F A;  1SJH D;  3DWG C;  2M56 B;  4IDI A;  5BO4 B;  4A20 A;  5DPR A;  2GLS A;  4AUQ C;  2OHF A;  5G5H A;  1TKG A;  3DHI C;  4S17 A;  5BMI A;  4YXD B;  2WXO A;  2IO2 B;  4WIP A;  3A1Q A;  4PT5 A;  3LJ3 A;  1SXT A;  3KUD B;  3Q14 C;  3PO0 A;  1JWS D;  4BBN F;  1F77 A;  1JW9 D;  1PUT A;  3MC9 A;  4HDQ A;  4JE3 B;  2O2V A;  3TJP A;  1WZ0 A;  3P1M A;  2KQS A;  3RNE C;  2D07 B;  2EKI A;  2WXH A;  4EOY A;  2ZZP B;  3MC8 A;  1WWT A;  4LDT B;  3A4R A;  3R7Q A;  2D3C A;  4KX6 B;  1FMA D;  2KQ7 A;  4PS7 A;  1G6J A;  4E71 A;  5GXG B;  2ZCC A;  4HRO A;  4B0E A;  3AU5 A;  1CMX B;  1A70 A;  3TBL D;  1WX8 A;  4KDL B;  3Q8E A;  1QT9 A;  1TT5 B;  3H7S A;  3NHE B;  1HZ6 A;  1ZDV A;  2JF5 A;  2G9H D;  4WAF A;  3WA0 A;  1FIQ A;  4MSM B;  1PDX A;  3ZNZ B;  1DOY A;  3QK0 A;  2JYE A;  3TIX A;  2R61 A;  5I4D A;  3QHT A;  4MAC A;  4P16 A;  2OED A;  1TS2 A;  1F0Z A;  4RGN A;  3AU4 A;  4KSK C;  4BKS A;  1EF5 A;  4S0R A;  4DHJ B;  1S3S G;  2DAF A;  2I38 A;  2CHZ A;  2KAN A;  3ETR A;  4PS8 A;  4LJO B;  4FJY A;  1GAQ B;  5KHO A;  4DDI D;  4C4V B;  2N4F A;  2QIE B;  2BQQ A;  4TQ1 A;  4M8N A;  2DAJ A;  2QCZ A;  2WWZ A;  2CKH B;  2FAZ A;  2WXJ A;  2PW9 A;  3DPD A;  2M8S A;  4KKI A;  1Q0W B;  2OJR A;  3NVV A;  3FC4 A;  4LNK A;  1E7U A;  2WP9 B;  3QX1 A;  3KVF B;  3GE8 C;  3MC0 B;  3IAS 1;  3RCZ A;  2DYO A;  1JAL A;  1WXM A;  2PJH A;  1R7S A;  1AWD A;  4GOC A;  4W9C A;  2OJW A;  1D6E C;  3HIZ A;  4HWI B;  5CTR C;  3L10 B;  1I4G A;  2NTS A;  2RSU A;  1WXV A;  4MM3 B;  1E5W A;  3ZRF A;  4WJN A;  1E9M A;  3T3N A;  3ALB A;  1WRI A;  3VRB B;  5J17 A;  3TEW A;  1P3Q U;  3VTU A;  2MEK A;  3UQA A;  1Q5W B;  2KYW A;  4AJY B;  1C4C A;  5C1Z A;  2KFK A;  2LRW A;  3A1Q B;  4EFO A;  3T3O A;  2JY6 A;  2LXC A;  2NPT A;  3ZGZ A;  2KO3 A;  1SE4 A;  4BZA A;  3SEB A;  1ZKH A;  3AEF B;  2PIA A;  2LVP A;  1IP9 A;  3SFE B;  1WE6 A;  3LXF A;  4NAW A;  3VRA B;  4M02 A;  2KMM A;  2LVQ A;  3UQB A;  4IWO A;  3CWI A;  4MH8 A;  1N5X A;  4IM0 A;  2J0M A;  3AMZ A;  4JX1 C;  2KDE B;  1FNU A;  3PLU A;  2WXP A;  2JXX A;  1ZP0 B;  1XO3 A;  1OEY A;  2WHI A;  3B0A A;  2WYQ A;  3NUH B;  3QAQ A;  3U52 E;  3U4E G;  1UEL A;  3B08 A;  2K6D B;  5JZE B;  1WR1 A;  3AE4 B;  1C4P A;  3ML8 A;  5LXI B;  2DZK A;  2V9H A;  3X23 A;  4RGO S;  2JZ3 B;  3N1Z C;  4WAA A;  5EE1 A;  3RNC C;  2DWQ A;  2H89 B;  1D3Z A;  2C7M B;  2KZR A;  1WMH A;  4XX5 A;  3HRD D;  1LXD A;  2IO3 B;  3ZDT A;  2V3N A;  1WJU A;  4ARI A;  1NBF C;  3KWV A;  3R2T A;  1UGJ A;  2IGD A;  2JX5 A;  1KF6 B;  1L4D B;  2WX1 A;  3TSS A;  2EMT A;  2M0X A;  3L17 A;  3Q8A A;  1XLQ A;  1IYF A;  1KLV A;  3I3T B;  2DEN B;  1V49 A;  4KGR A;  2MP2 A;  4L23 A;  3N1X C;  3VH4 B;  4EUT A;  2BBC A;  3APF A;  3DBS A;  1R4M I;  4IC7 B;  4I6L B;  2W55 A;  1DGJ A;  4II3 B;  3AE7 B;  2N1W A;  2N7J A;  4WJP A;  2PE9 A;  3H9D A;  1TKE A;  1E8Z A;  4W9E A;  1E6E B;  5H92 C;  3IG3 A;  2EEL A;  2MBO A;  1V2Y A;  3P4R B;  4REZ A;  4LTU A;  1WGY A;  2ON8 A;  3KYD D;  3RNF C;  3PRE A;  2MJD A;  3D32 A;  2C9W B;  1QZE A;  4TMA B;  2BB6 A;  2UWQ A;  2EMS A;  3KUZ A;  4K3C A;  1ZUD 2;  2WS3 B;  2KFK B;  3BVG A;  3PZ8 A;  3QCA A;  3E56 A;  3SHQ A;  2O6V D;  5EDS A;  2GB1 A;  5T8I A;  2B76 B;  2RMM A;  5D2M B;  2KTF A;  2YLM A;  3SDL C;  2JWZ A;  3U7D A;  1ZW7 A;  4NAW B;  2IYD B;  3GB1 A;  2D3B A;  3SU8 X;  2WDT B;  4PK1 A;  2K8B A;  2SAK A;  2WU5 B;  5AZH A;  3P4P B;  2IBI B;  4GSW A;  3HM3 A;  1TYG B;  2KDF B;  3PS6 A;  4K3B A;  2KK8 A;  4MGZ E;  4XGA B;  4ANV A;  2IND C;  4MEM A;  1C77 A;  1YNT E;  3HHM A;  3RYT A;  4E74 A;  4K7W A;  4ZYS A;  1N60 A;  1WJN A;  2ZPY A;  4IM3 A;  4ZDV A;  2RDH A;  1WIA A;  2JZZ A;  4YWG G;  1IGD A;  3BYY B;  3ZTC A;  3SD5 A;  1V1O A;  2AQ3 B;  2C7H A;  4FN2 A;  4AWJ A;  3RUI B;  3I63 C;  2BYE A;  2WLB A;  3KH0 A;  3DVG Y;  4TKN A;  1WGR A;  1RWS A;  2LGY A;  2NCN A;  2E6X A;  1WMH B;  3SR6 A;  1FPY A;  4RGT A;  4ZRQ A;  2BVC A;  3AN1 A;  4M00 A;  2L05 A;  3NZS A;  4JIO U;  1TY2 A;  3AB5 A;  2G1E A;  2NBU A;  2G3Q B;  2PPH A;  1R4N B;  1N5W A;  4HRS A;  3TEZ A;  4NJC A;  1EO6 A;  3ZRC A;  4N59 A;  3PRM B;  4DXF A;  4YSY B;  2VZK B;  2L32 A;  4BFR A;  3RMK C;  4AOF A;  3BYT B;  4DDG D;  4KSL C;  1AYF A;  4ZHO A;  1WJ4 A;  1Z2M A;  2IJ0 A;  2ICI A;  2WX0 A;  2K3U A;  3U8Z A;  3PZD A;  4W9F A;  3NG0 A;  3OJ3 A;  2NBW B;  3PT2 B;  2WXQ A;  4WQM A;  3Q3N C;  3RPF C;  5D3I B;  2KN5 A;  2INC C;  1PYW D;  4JPS A;  4RM8 A;  1ZXI A;  2DX5 B;  2WXR A;  3OG5 A;  4RGM A;  3BK2 A;  2KTR A;  1TBE A;  2L52 A;  4GDK A;  1WH3 A;  3JVZ X;  5BMH A;  2HTM E;  1MPE A;  3U2S C;  1CQV A;  4IUM B;  3LB8 C;  4GDL A;  3FKY A;  1D5X C;  3N3K B;  4JWS C;  4RF1 A;  2LZ6 A;  1LO5 D;  2GI9 A;  1ZXH A;  1RRB A;  1I35 A;  3RUL A;  1MHH E;  2GBK A;  4LJP B;  3AI5 A;  2LGI A;  4F7Z A;  1V97 A;  2FCS A;  1C9F A;  2VRR B;  5LXH A;  2WDR B;  1I4X A;  2QSD A;  2D3A A;  4G0N B;  2OOB B;  4DXA B;  2KAJ A;  1FD6 A;  2MH7 A;  2KJR A;  2QJL A;  1E0Z A;  4OW0 A;  3URY A;  2QIL A;  3N1Y C;  1V86 A;  3Q8F A;  4ANU A;  1ESF A;  4RMA A;  3KW5 B;  2AL3 A;  1ZPS A;  3AEA B;  3Q3O C;  1WX9 A;  3AEC B;  5DCN A;  1Y56 A;  1V80 A;  3AEE B;  3DOW A;  5FKA C;  2L0T A;  1UBQ A;  4P6V F;  3W1S A;  1FXI A;  4M01 A;  3Q3J A;  3ZQ4 A;  1UH6 A;  3VR8 B;  2JRI B;  1I7H A;  2K22 A;  3AE5 B;  2BS3 B;  4C56 C;  3R2I A;  2KLG A;  1WJ6 A;  2G4D B;  1UUP A;  4W9D A;  1K50 A;  2NVU I;  5HKH A;  2K5P A;  1YIW A;  2LFI A;  1N6Z A;  2AQ1 B;  2KWV B;  5EE9 A;  4K1R B;  4A55 A;  2K1F A;  2N9K A;  4MEL A;  1CJE A;  3W1S C;  3AXC A;  3ZYY X;  1FRR A;  1UZX B;  2KDM A;  2W82 A;  3WAN A;  4IOI E;  4B0M A;  3JYU A;  2Z0E B;  2FID A;  3RD2 A;  3H7P A;  1YX5 B;  4ZRK A;  2Z59 B;  2V3P A;  1HTQ A;  2V4I B;  1ZE3 D;  4YL8 A;  1WF9 A;  1VR9 A;  4YSZ B;  1E10 A;  2HJ8 A;  3LDZ E;  2QDF A;  3AED B;  4BOZ B;  2BB5 A;  3TL5 A;  2GBR A;  4GXB A;  1EU4 A;  2BT6 A;  2K0P A;  2K6Q A;  3IFW B;  4XWT A;  1LFD A;  5DPS A;  1UNS A;  1WFY A;  4DBG A;  4M0W A;  2KTR B;  3WAO A;  3A9K A;  2GBJ A;  4GDK B;  3DBL I;  1WZ3 A;  2LUM A;  4WQO B;  3FIL A;  4JLC A;  3SFD B;  1T0Q C;  4ANX A;  4C7Y A;  4W9H A;  3UF8 A;  1KJT A;  1OQR A;  3P4S B;  3V3X A;  1P9D U;  4WUR A;  1J7A A;  3PRP B;  1H8C A;  4M8M A;  4MDK E;  5JH5 C;  1YOV B;  3TMP B;  3QJZ A;  3TCA A;  4C80 A;  1L6V A;  3DCG A;  1NYR A;  3IAM 1;  1SE2 A;  1YN4 A;  2FCM A;  3WAL A;  3IBE A;  2AYO B;  4DK5 A;  2IO0 B;  2PMV A;  1FEH A;  3M3J A;  1TTN A;  3BVM A;  5FK9 C;  1QF6 A;  3DBH B;  1SBB B;  2H88 B;  3NVZ A;  3NOB A;  3MJW A;  4P1B C;  4G11 A;  5L95 C;  3IT6 B;  4AQ7 A;  1ZDX A;  2GOW A;  4GIV A;  4A8X C;  4EE2 A;  3AE3 B;  1SE9 A;  4HPP A;  4B9K A;  2KN4 A;  1RFA A;  3Q8B A;  1WRD B;  4F1S A;  4WWN A;  2ZNV C;  2N7E A;  3VVW B;  3R3M A;  4ICU A;  2J0K A;  3O65 B;  2CJN A;  5AUI A;  1ZOY B;  4K7U A;  4FA6 A;  3NRZ A;  2PKO A;  1RAX A;  1XLN A;  4HPL B;  3PTF C;  1QLB B;  1BML C;  1JQ4 A;  2WDQ B;  3AE8 B;  3ZLZ A;  1V5T A;  2IZV B;  1RM6 C;  3QIJ A;  2LEK A;  3WIM A;  3V62 A;  1NYQ A;  1C1Y B;  3NVW A;  2M4N A;  4NQL B;  1QKZ A;  2AX5 A;  5BYR A;  1N63 A;  5D6J B;  3ABV B;  4A90 A;  3HM6 X;  2O2V B;  4OVZ A;  2ZW1 A;  4US8 A;  2KHW B;  3ZXR A;  3RT3 B;  3ZXV A;  1NI2 A;  2ACZ B;  2N9E B;  5AEK B;  1V81 A;  1MJD A;  3B2F A;  3KQ4 A;  3R7R A;  2ZVO A;  4OVV A;  2LD9 A;  4W9I A;  1E8W A;  1TZ1 A;  3T9L A;  2WXM A;  3DBL B;  4Q2J A;  2YVC A;  2KQ4 X;  4L2Y A;  1UD7 A;  3N32 A;  1YJI A;  1VZ8 A;  2AL6 A;  3Q3M C;  4EZJ A;  2BYT A;  1UF0 A;  1VZ6 A;  3IHP C;  4IW0 A;  4WJO A;  1HQR D;  3VHT C;  5IA7 A;  1T0Y A;  1OTR B;  4NNJ B;  3S2A A;  3VUX A;  5C2T B;  1KOT A;  1WSP A;  4PYU A;  4JGH B;  3APC A;  2TSS A;  3M95 A;  4US9 A;  5JHB A;  4F8C B;  1WXS A;  1VD2 A;  4CQN A;  4M0W B;  1TS3 A;  4ZOH C;  1BT0 A;  2ONQ A;  3A9K B;  5KHQ A;  1L0Y B;  2DYM A;  3FIL B;  2RDG A;  3P42 A;  1T5X D;  2FE8 A;  3RI7 C;  1JWM D;  5MPO A;  2DBY A;  2BWF A;  2N9L A;  3DBR I;  4LLG M;  4HVB A;  2DZM A;  4FHJ A;  1K8R B;  2JSV X;  2LRU A;  2ZNV B;  1SIF A;  2QMT A;  4KZC A;  2JPH A;  1VDV A;  3BII D;  1P7E A;  1JWA D;  4TV3 A;  3AV8 A;  1E8Y A;  3C8Y A;  3L4P A;  1VZ7 A;  1L7Y A;  4XE0 A;  2MBQ A;  4DHZ E;  4AS1 A;  2C7N B;  4IKG A;  4KDI C;  5IAA C;  2GRI A;  2ZEQ A;  1FCC C;  1WR6 E;  3ENE A;  4YT0 B;  4LNN A;  2J52 A;  1CZP A;  2RD0 A;  3NVY A;  1WYG A;  2MA9 B;  3V61 A;  4XDD A;  1R4N I;  1IBX A;  1OQQ A;  4IM2 A;  2ASQ A;  2G45 B;  1TIF A;  2FUH B;  4NPN A;  2LHD A;  2K9X A;  2O6V A;  2KVR A;  3NY5 A;  1AAR A;  1GG3 A;  5TR5 A;  1MG8 A;  2JUO A;  4FBJ B;  2AQ2 B;  2J7Q B;  2KKC A;  1WM2 A;  1X1M A;  2XBB C;  3HUI A;  4HJK A;  3GOE A;  1SEB D;  2MCN B;  1LQB A;  4JQW C;  3I57 A;  1WM3 A;  3ZNG C;  2IY1 B;  4RNA A;  3V60 A;  5BYS A;  2HTH A;  2KJH B;  1OGW A;  3ZJV A;  3IT4 B;  3ZDM C;  3W9C B;  2VH1 A;  5LLI A;  2RR9 A;  3MP9 A;  1Q10 A;  4N9F 4;  1XD3 B;  2NPT B;  3AE2 B;  2D5G A;  3NJT A;  5AZF A;  3J9C A;  1MHX A;  2LGX A;  4NZL B;  3WAP A;  4TQ0 A;  1C3T A;  3B9J A;  2KXJ A;  2W3S A;  3B2G A;  2LUE A;  4JWU C;  4RCO A;  3P63 A;  5D94 A;  3AM9 A;  4A9A A;  3PGE A;  2Y3A A;  5FR6 A;  3HK0 A;  2UU7 A;  2D2Q A;  4A3P A;  2EKE C;  4HCP B;  1YQ4 B;  1WXQ A;  1AW7 A;  2NTT A;  4USA A;  3FAH A;  1D5M C;  4YSX B;  3RNA C;  1L5P A;  1TZO A;  1E8X A;  3V05 A;  4GMV A;  1Z5S B;  4TUU A;  1QIL A;  2JWU A;  3DBR B;  1J8C A;  2AWT A;  4WWO A;  3QA8 A;  5IKC M;  3RNG C;  1YJ1 A;  5E6J A;  2LXA A;  2WNM A;  3MFG A;  1WE7 A;  2QC8 A;  3L0W B;  3BWU D;  2V0G A;  2Z8L A;  2V3S A;  3P4Q B;  1GC6 A;  1XLP A;  3H8H A;  4RFB A;  4EZL A;  4IWQ A;  5H8Y E;  3W2D A;  4HK2 A;  4FXC A;  3CF6 E;  2CU1 A;  1YMH E;  1GOZ A;  3N9Y C;  4NJ6 A;  4NQK E;  3ZIM A;  1TS5 A;  3R8B A;  2MLB A;  1TS4 A;  1PFD A;  4AJW A;  3U30 A;  3VTV A;  1FXA A;  1NDD A;  1D5Z C;  4ZRP A;  3MHS D;  1S1Q B;  3AE1 B;  3ZJU A;  2VH2 A;  1JWB D;  4J6I A;  2L83 A;  2K8H A;  2GMI C;  3N30 A;  1P1A A;  2IGG A;  2GBM A;  1F2R C;  2JZP A;  3I9V 1;  2UYZ B;  2IDY A;  3PZ7 A;  3OAW A;  5HHD G;  3VUY A;  2MP2 B;  1OQY A;  4GB9 A;  4UDU C;  3DHG C;  3W1Y A;  2V4L A;  5BYQ A;  4O1N A;  2HJ1 A;  4OHJ A;  3NZ3 A;  4OVU A;  4BKG A;  4ZYN A;  2CR5 A;  1FRD A;  2JYT A;  1GNU A;  1L0V B;  1J0G A;  1IBX B;  2RPQ A;  1N62 A;  4HLE A;  1GB1 A;  1VCB A;  4FAD A;  2L1A A;  1XCQ L;  1UWM A;  4LDT D;  4X57 B;  4HXD A;  3K9P B;  3TEX A;  3GP7 A;  2L3Z A;  4W9K A;  4B6W A;  2IY0 B;  3DHH C;  4MGY E;  2V1Y A;  1WGD A;  2MX2 A;  4DHZ B;  2ZCB A;  1ET6 A;  3C0R B;  2BKF A;  2BYF A;  3P2B A;  1FO4 A;  4C4V A;  2ZJD A;  1UWX A;  2YEP F;  1WGH A;  5DPT A;  4GN1 A;  2PVG C;  2BWE S;  2FBW B;  1I4Q A;  3R66 C;  1T3Q A;  2KMA A;  1HA5 A;  3M62 B;  4L1B A;  1FXT B;  5CHV C;  2G4S A;  1H4R A;  1EWY C;  4HPM B;  5E6P A;  4DHJ D;  4NJ7 A;  4ACF A;  4BOS C;  3OWE B;  2LGS A;  2KWU B;  2BKR B;  5CHF A;  4B95 A;  3RZW C;  2R2Q A;  3PHW B;  5FR3 A;  4C7Z A;  3MJ5 A;  4A6Q A;  3VXW A;  1K53 A;  3VTW A;  4RH6 A;  2J4X A;  2X8X X;  4II2 B;  2NR2 A;  1L6U A;  1FFU A;  2KWC A;  5CHW A;  3DBH I;  1SIJ A;  2I2Y A;  1ACC A;  3ZNH B;  5HI1 A;  2CHW A;  2KMC A;  4OZA A;  3NS1 A;  4KIK A;  1HEZ E;  2N7D A;  4N6E B;  1HZ5 A;  2LWP A;  4ANW A;  2PLP A;  2DZI A;  3JSV A;  1AN8 A;  3AE6 B;  5C3J B;  5IP4 D;  1PGA A;  3AEB B;  3AEG B;  1F1H A;  4ZRI A;  1SB3 C;  3VDZ A;  1P98 A;  1ZGU B;  1DYQ A;  1QOF A;  5HG2 A;  3TUO A;  5IN7 A;  1BUI C;  1SE3 A;  5D3D A;  1KLU D;  3BIN A;  3DVG X;  3GZN B;  3IVF A;  1WX7 A;  2MSE D;  1K52 A;  1YN3 A;  3ZW3 A;  4MH0 E;  2BTE A;  3NS8 A;  4MSQ B;  2FUG 1;  1STE A;  1NEK B;  4DWF A;  2J0J A;  4FJZ A;  2CS4 A;  4W9L A;  3DQV A;  3E9S A;  1V1P A; 
#chains in the Genus database with same CATH homology
 2IND C;  3GE3 C;  1T0Q C;  2RDB C;  1T0S C;  3Q2A C;  3I5J C;  3Q14 C;  3Q3N C;  3N20 C;  2INC C;  3N1X C;  3RI7 C;  3RN9 C;  3RNG C;  3N1Y C;  3GE8 C;  3RMK C;  3DHH C;  1T0R C;  3DHI C;  3N1Z C;  4P1B C;  3RNE C;  3RNF C;  3DHG C;  3Q3O C;  3RNC C;  3RNB C;  3Q3M C;  4P1C C;  3RNA C;  3I63 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...