3GE3C

Crystal structure of the reduced toluene 4-monooxygenase hd t201a mutant complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
83
structure length
83
Chain Sequence
SAFPVHAAFEKDFLVQLVVVDLNDSMDQVAEKVAYHCVNRRVAPREGVMRVRKHRSTELFPRDMTIAESGLNPTEVIDVVFEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Role for threonine 201 in the catalytic cycle of the soluble diiron hydroxylase toluene 4-monooxygenase.
pubmed doi rcsb
source organism Pseudomonas mendocina
molecule tags Oxidoreductase
molecule keywords Toluene-4-monooxygenase system protein A
total genus 25
structure length 83
sequence length 83
ec nomenclature ec 1.14.13.236: Toluene 4-monooxygenase.
pdb deposition date 2009-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 3ge3C00
3GE3C 3Q3MC 3N1YC 3Q3OC 3DHIC 3RN9C 3RNFC 1T0QC 3RI7C 3RNBC 3N20C 3RNCC 3RNGC 3GE8C 3I5JC 3DHGC 1T0SC 3Q3NC 3RNAC 3DHHC 1T0RC 4P1CC 3RNEC 3RMKC 2INCC 3Q14C 4P1BC 2INDC 2RDBC 3N1ZC 3I63C 3Q2AC 3N1XC
chains in the Genus database with same CATH superfamily
1N5XA 1FO4A 3P4QB 4OVVA 1FPYA 1SIFA 2QILA 2RDHA 1X1MA 4AP4C 5IO9A 2NPTB 3M62B 3ZVVA 2IBIB 2KK8A 4IWPA 1WJ6A 1YOVB 1AW7A 4ZRKA 3VR9B 3L08A 3UQAA 3AE1B 2K6QA 3EGRA 1L6UA 1V49A 1NYQA 1Y8RC 4ZYNA 1P9DU 1L0XB 3NVZA 3NZSA 2CHXA 2NPTA 1WX7A 1I4QA 3EC8A 1S3SG 2WDQB 2N9LA 4EE2A 4WJNA 4XDCA 2KWCA 4HKQA 4LJPB 2N7DA 2O6VB 2KLGA 1UZXB 3E9SA 3WALA 1JCKB 2J0JA 1CK1A 2KX3A 1KF6B 2DYBA 2INDC 3AB5A 1EU3A 4LNKA 4FXCA 4MSQB 5G2NA 3V60A 3V62A 2WXKA 2K6DB 1TS5A 3Q8CA 4FHKA 2ZEQA 2O6VD 4C7YA 2O2VA 4RF1A 2BB6A 3NVWA 1TS4A 5JHBA 2DLBA 3AE3B 2CS4A 2VZKB 4FJVB 2G45B 2R61A 3V6EB 2JUOA 1GOZA 2D07B 4WIPA 3TUOA 1E8WA 3J9CA 2QEJC 1N5WA 5FK9C 4ICVA 3MC8A 4HRSA 3R7QA 1P7FA 1HXYD 2I1JA 3EECA 2V4LA 1KOTA 2DWQA 3VTVA 3WA0A 4E71A 3TSSA 4J3OD 3CSTA 4LNOA 2W3RA 5CX3A 3ABVB 1F2RI 4KGTA 4KZ0A 2KD0A 4M00A 1TGZB 2LGSA 1SGHA 3W2DA 2BVCA 1Q0WB 2IDYA 5HG2A 1TKYA 4HXDA 2JXXA 2WXHA 3BIID 4HPLB 5AUKA 3MJWA 1D6EC 4RGOS 1F52A 2AX5A 3SHQA 2MP2A 3IT6B 1ISNA 4LNIA 1BUIC 3DBHI 2KACA 3E56A 1T5XD 1TBEA 2D2QA 3C19A 3AEFB 4II3B 2KVZA 2M0AA 1CJEA 2G3QB 4E74A 4C00A 1TZOA 2N1WA 4XGAB 4W9KA 2GOWA 3V3XA 2IPKD 1CMXB 4IUMB 4ZRIA 1QOFA 1WGHA 1FNWA 5IP4D 4BBNF 4W9HA 2YEPB 2JF5A 3ALBA 2V0GA 3AXCA 2INNE 2NBUA 2IO0B 1WJ4A 1QOAA 4II2B 5FR6A 2WLBA 4B6WA 3ZLZA 2JQRB 2KFKA 4A3PA 1YN3A 4DXFA 4KGSA 1IUEA 4WAAA 3N3KB 5JH5C 5JHAA 4FBJB 3ETRA 2Z8LA 3PSEB 2A4ZA 1YJ1A 1R4MB 2DAFA 4L2YA 2N9XA 2SAKA 4HDQA 2L05A 3V05A 4WJOA 4JWSC 1IYFA 2AEHA 4OW0A 4W9IA 4WURA 5E6JA 2L32A 1ZP0B 1GUAB 2WXQA 3H8HA 1RLFA 1WE7A 4RF0A 1V5TA 3GOEA 5CHWA 5BYQA 5IA7A 1KLVA 2ZPYA 2BS3B 3ZNZB 3RZFA 3AU4A 4GIVA 2W55A 4JWUC 1EF5A 3A1QA 2WQYB 3CF6E 4JX1C 4UDUC 1WYGA 2N9KA 2PJHA 1RWSA 5D3IB 3ONSA 1C4PA 1XLPA 4CO7A 4J6IA 1JRPA 5CHVC 1NDDA 4GN1A 1FIQA 2WX1A 1I4GA 3RFZB 1V86A 5GXGB 1TJEA 2HTME 5G5GA 3ZKJC 1HA5A 1WGDA 2MLBA 1E0ZA 2QSDA 4XDDA 2BTEA 4ZOHC 4ANVA 3FILA 1BXTA 3T3NA 1I4HA 3CIRB 1E10A 2I38A 3ZNGC 4DHJD 2LRWA 1T0QC 2QC8A 1YMHE 3L10B 2GMIC 2M1MA 3AEGB 4AWJA 3PHWB 2LGXA 4LNNA 3BK2A 2ONQA 3RULA 4I6PA 1WYWB 2WNMA 3T8MA 2JT4B 4HJKA 3LDZE 2Y3AA 1UWXA 2BKFA 2ICIA 5JXVA 2N9EB 2CR5A 4A90A 2J0MA 4WQMA 1DOIA 5LLIA 4MH0E 2BW2A 2LUMA 2MBHA 1ACCA 3IXSA 3B2FA 1V6EA 2LVPA 3KQ4A 3QIJA 4YTNB 3GP7A 2INPE 2J4XA 2CJNA 4IW0A 4GU2A 4I6NB 4A8XC 2BS4B 2GBRA 1J7AA 3UGBB 4TKNA 4P1CC 1ZXIA 3RNEC 2CJOA 1ET6A 4HDOA 1TY0A 2DBYA 4C56C 2C5LC 1MHHE 3NZUA 5HKHA 4AQ7A 3I63C 3VFKA 3PZ8A 3M95A 1TS2A 1FRRA 3NS8A 1MVKA 4O1NA 3ZTCA 4L1BA 2IO1B 2N7JA 2IYDB 1TKEA 4C80A 1VZ8A 3BINA 1XQQA 1N63A 1ZXHA 2MEKA 2KDMA 1WJNA 2MW5A 1IGCA 2KX0A 1MJDA 2LHEA 4K7SA 3WIMA 4DHJB 4DHZE 1FFUA 3R66C 4RGMA 1XLOA 1VRAB 3TIXA 4A3OA 4WH4A 3RNBC 1HTQA 2ZW1A 4KSLC 4EOYA 4A20A 4XX5A 2KFJA 3Q14C 2J53A 2MJEA 3AE2B 2M4NA 1JWAD 1J8CA 2GBNA 1C1YB 5CTRC 5D94A 2KMCA 4EZLA 3H6NA 3JVZX 3NVVA 2MA9B 2JWUA 2BS2B 5J2RA 4PS7A 4ZHOA 2KDEB 3DBRI 1UGJA 3ZIMA 4YXDB 2V1YA 2EMTA 1Q1OA 4GXBA 1E8XA 2ZCCA 3ZRFA 4MJSA 2KTRB 2MP2B 2M0XA 4DHZB 3SD5A 1C79A 3AEEB 2Z0DB 1SIJA 3B9JA 5D3DA 3FC4A 3UIOB 2QMTA 3BYYB 3DHIC 1IGDA 3VQIA 1R4MI 4HROA 1ENFA 1WF9A 1D3ZA 3P4PB 2BF8B 5DPSA 4CQNA 2MHJA 1ZDXA 3PRZA 2K22A 2QHOA 2LGIA 3QK0A 4M01A 2PVGC 1NYRA 4K3CA 4MJSB 5EE0A 2VH2A 4WWPA 1MFWA 1N62A 4ASWC 4BKGA 1ZGUB 3PV1A 3KVFB 2PPHA 4IKGA 4EEWA 4B95A 4BVUC 1FEHA 1LGRA 4N9F4 4ZRQA 1EF1A 4N59A 1MG4A 3LYYA 2KAJA 3VAWA 4ZYSA 2UYZB 4BBNC 5DCNA 1SJHD 3SEBA 3AEAB 2V3PA 4ARCA 4B0EA 3UIPB 2M8SA 2KWVB 3OJ3A 2JU6X 2KOXA 5HFYA 3ZDMC 2L8JA 3PLUA 1UNSA 1XT9B 2BYVE 1I4PA 1SE9A 2KC1A 2QIEB 3I5JC 3L16A 4W9FA 2JRIB 4PS8A 1VJKA 2UWQA 2K9XA 4XWWA 4MGZE 3BK1A 2PW9A 2D10A 3MFGA 1KFYB 4ACFA 1WXMA 3ZRCA 3UINB 1JQ4A 2LXCA 2MRPA 2LGYA 4C4VA 3DVNV 3D32A 2MBQA 1WXSA 2NMQA 2I2YA 4H2AA 2BQQA 4G0NB 3TEWA 2G4DB 5BYRA 2OJWA 1STEA 5D7GA 1XCQL 1UWMA 3B0AA 3ZNID 4RNAA 1V97A 5MPOA 1QF6A 3ZGZA 3KYCD 1T3QA 2KJ6A 3B1LX 4ZHPA 3MC0B 2BKRB 4XYCA 3APDA 2E6XA 2BT6A 2KWDA 4US8A 3IAM1 4HPPA 2JWZA 1ZE3D 5G5HA 2KJRA 2LHDA 2C60A 5CHFA 4P7IA 4LLGM 3EHVA 1ZOYB 4QAYA 4DDGD 4NAMA 3NVYA 3AMZA 3PGEA 3GE3C 4F7ZA 3NG0A 3QQ8B 1Q10A 3W1YA 1SF0A 1FMAD 1VLBA 2AQ2B 2DAJA 2JYTA 2N1VA 1UD7A 1A70A 2LD9A 4A55A 2O2VB 4KGRA 2DX5B 3BVGA 3NJTA 3SR6A 4OZAA 1WX9A 2J52A 2KDBA 2LXAA 1HE8A 2W9NA 2FUHB 2HDEA 4USAA 3RD2A 4OZCA 5BYSA 3Q3NC 3OAWA 1J19A 3AN1A 4DQOC 1WJUA 4OZBA 5C1ZA 3RT3B 4NJ7A 4W9EA 3R2IA 3VXWA 2WXPA 2H88B 3HVDA 4PK1A 4W9GA 4W9LA 4OHJA 4NQKE 3Q2AC 3LJ3A 3W1SC 1WIAA 3VVWB 1K8RB 2PE6B 2ZPNA 3N1YC 3V6CB 3N32A 2FCNA 2GRIA 3H1UA 5KHQA 1B9RA 3OG5A 3X23A 5DPRA 2KHWB 4W9JA 1VDVA 3AE8B 2PE9A 4G3XB 1YN5A 2CKHB 1I42A 1WX8A 2NVUI 1UF0A 2DZKA 4F8CB 3DVNU 1VZ6A 1E7UA 1BT0A 5HI1A 4NNJB 2JX5A 2ZZPB 2G9HD 1R4NB 2XNAC 5LXHA 3PTFC 3Q3JA 2IO3B 3APFA 1OQQA 4WWMA 3KWLA 3TEZA 3DHHC 3M3JA 3NRZA 3DQVA 1ET9A 1HQRD 4US9A 3EFUA 4S0RA 1F2RC 1SE2A 4DWFA 1J7BA 3ENEA 1GJZA 4BKSD 1E7PB 1HEZE 4IWQA 1K51A 2XN9C 1XCTL 1JWSD 3L17A 2L1AA 1OQRA 2FAZA 2RGFA 3DBRB 1NEKB 4GDLA 1KTKA 1T0YA 2KO3A 4HPMB 5KHOA 4M0WB 2X38A 1T0SC 5I4DA 3C0RB 3AV8A 2JYEA 3K9PB 3HK0A 3R8BA 2LJ5A 4YTMB 1RFKA 2FNJB 2C7NB 4FA6A 2LZ6A 1PDXA 1DGJA 4WJQA 3NS1A 2LWPA 2L0FA 1N60A 2NS5A 1LFDA 3KW5B 1TZ1A 4N58A 1OTRB 3RNGC 2KFKB 1UUPA 1XF5L 2UU7A 4GOCA 1WMHA 2V3SA 2C9WB 4DDID 2G4SA 3AE4B 3U7DA 4HCNB 1UGMA 4C4VB 3EFCA 1WXQA 4GDKB 1P0RA 2NBVB 4LNFA 1WGKA 4AJYB 4KIKA 2W54A 2GB1A 1PGAA 4I6LB 1FCCC 1K52A 1M4VA 1GC7A 2KQ7A 4HKZE 1WXAA 3PREA 4NQLB 5HHDG 4RMAA 2KLCA 3Q3MC 4GDKA 1TY2A 3Q8AA 2WXRA 3VDZA 4MDKE 4FN2A 3N9YC 3VUYA 5IOIA 3L54A 2INCC 4IG7B 4F1SA 3RCZA 1EO6A 2K1FA 2YVCA 2FE8A 3X0WA 2BWFA 3MP9A 4MACA 1A5RA 5EE9A 3ZQ4A 2J0KA 4EZJA 4G50A 3RNFC 2MSED 1P98A 5E6PA 1EUVB 3U4EG 3FILB 5AZFA 2LRUA 4NJ6A 2NCNA 1VD2A 1B1ZA 2BGFA 4WAFA 1WGRA 3ML9A 1WE6A 5TSSA 3PHXB 2AQ3B 1PGXA 1JMLA 2RMMA 2WDTB 3QHTA 2MBEA 3RN9C 2XBBC 3CWIA 1HTOA 1QOBA 3VR8B 3ZUNA 1RYJA 1Y56A 3MC9A 1FRDA 3P2BA 4KDIC 1FCLA 1TS3A 5J18A 2L52A 4A9AA 3VTUA 2IO2B 3S2AA 2D11A 2W82A 1QT9A 4G11A 4PYZA 2WDVB 1HZ5A 2LVOA 5D2MB 5E6OA 3ZJUA 1D5XC 5C23A 3TBLD 3RNAC 1UH6A 2K5PA 3KWVA 2KVRA 1YD8U 4P1BC 2A5UA 3EUB2 3P63A 2EKEC 3O65B 4RM8A 4KV2A 1WY8A 2GI9A 2V3NA 4BZAA 3VHTC 1PYWD 4PS3A 3N20C 2K8HA 4EFOA 3CMMB 1WSPA 4AUQC 3PLVA 1F77A 2KT7A 2YLMA 2HJ8A 4D2KA 1YN4A 4LDTD 3OWEB 3HM6X 4L23A 2KN4A 2OJRA 3PVLA 3Q8EA 1JRUA 4HLEA 3IBEA 2ZVOA 4ZRJA 3ECIA 3Q69A 2K8CA 2FIDA 3DOWA 1BMLC 2IZVB 3HHMA 2NBWB 2N7EA 3T9LA 3DHGC 5BMHA 4TUUA 3MHSD 1TIFA 1E7VA 5IN7A 2ON8A 4MGKE 2CHZA 2BPSA 3PZ7A 3HUIA 4WQOB 2LI5A 4C7ZA 5IKCM 3UI3A 2PTLA 2MBOA 3QWZB 3KLSX 4M0WA 4BKSA 2LGDA 2DHZA 4MEMA 4PYUA 1HZ6A 4HEA1 1WFYA 1JWMD 1EU4A 1F0ZA 2LASA 2BB5A 4BOSC 1E8ZA 4ANXA 3L13A 1FM0D 1N6ZA 4MELA 4KKIA 2J42A 1K50A 2G1EA 5FR3A 3URYA 3W5UB 2RPVA 3MTNB 3H7PB 3I3TB 4EKUA 2AYOB 1L0YB 2KJHB 3ML8A 2IJ0A 4NAWA 3P4SB 4HWIB 2K39A 3DWGC 5G55A 2KYWA 4ANWA 1FXIA 2L7RA 2MJ3A 2WP9B 3NZ3A 4GDLB 4GB9A 4HK2A 2TSSA 2BBCA 1PUTA 1YX6B 1SSNA 2L83A 4B9KA 4DXGA 1K53A 2WU2B 2ZW0A 4MH8A 3AM9A 4M8NA 3JYUA 3BVZA 4ARIA 3VRAB 2PKOA 1AN8A 4OVZA 2RD0A 3HRDD 1ZUD2 5EE1A 1E9MA 4M02A 1YJIA 3U52E 1GC6A 1RM6C 1C78A 3AULA 2M19A 2W3SA 2RR9A 1U4AA 4MT5A 2WXOA 1OEYJ 1KM7A 4LCDE 3P42A 4P6VF 1ZPSA 1XXGA 2D3CA 1E90A 1WXVA 1Q5WB 4AS1A 3SFEB 1KLUD 2LJIA 1V5OA 3DBLI 1DOXA 2KQ4X 3N30A 3KUDB 4IM2A 4BOZB 1JWBD 2WYQA 3RUIB 1FFVA 4LTUA 1D5ZC 4YTPB 2WU5B 3SFDB 2QJLA 1EWYC 1SJED 1WM2A 1RFAA 1IBXA 4WWNA 3PPAA 1SB3C 2ZNVC 1DOYA 1E8YA 5EE3A 1P7EA 5J17A 4B0MA 5H92C 1KLGD 2WGSA 1QLBB 2KNBA 1C76A 4JPSA 2BYFA 1XD3B 3RYTA 4HCPB 1FD6A 3R7RA 3NHEB 3QA8A 3QX1A 3QJZA 4YT0B 1IBXB 3BY4B 4MGYE 1WR6E 2QDFA 2RSUA 3DWMA 3GS2A 4TMAB 4GSWA 1QQRA 1LM8B 4BFRA 3TJPA 4MM3B 2Z0EB 4NZLB 1H8CA 3W5VB 4FHJA 3HVZA 5BMIA 4KKJA 3PRPB 1P3QU 3UF8A 1V1OA 1FXAA 1UELA 2OHFA 1TYGB 1OEYA 3IT4B 1WGGA 3CSFA 2BWES 4MM3A 1V1PA 3PO0A 4HJGE 3NOBA 3DBSA 3VH4B 2DYMA 2AL6A 2GBKA 1MHXA 1GPXA 3U2SC 2JXTA 3L0WB 2IGHA 5T8IA 2WWZA 3U8ZA 2KWUB 3AEBB 1Z2MA 2K8BA 2DZMA 2LUEA 2JZPA 1WRDB 2IY0B 1T0RC 2B76B 4ANUA 2OOBB 1V1PB 4KX6B 1TT5B 1KRHA 2Y5PA 1C3TA 2VZKD 2JPHA 4JE3B 2M56B 3AE7B 1YIWA 3C8YA 5GMVA 2D3AA 3HIZA 1YNTE 4EZKA 2O6VA 1C4CA 2YEPF 1IP9A 1V2YA 4A6QA 2WDRB 4E3CA 2EMSA 3JW0X 1YX5B 3FAHA 1XEEA 3GZNI 1T6BX 2ZVNA 2IGGA 4NAWB 2LVQA 2WXGA 1MG8A 1Z5SB 2QCZA 5BMGA 2WXNA 1TTNA 1WR1A 1WGYA 1UBQA 3B08A 5AEKB 1VCBA 2FUG1 1RRBA 2B3AA 1OGWA 2WXIA 4IM0A 2R2OA 3GB1A 3R3MA 3DBLB 1SEBD 3Q3FA 2GBMA 1J7CA 4RM9A 2KKCA 2D3BA 3V61A 2ASQA 4N6EB 2Y5CA 4RFBA 3IFWB 2WXMA 2IGDA 2K3UA 1PQSA 1ESFA 4DK5A 2PVOD 4YL8A 2XEWA 1WRIA 3OLMD 2OEDA 4X57B 2N4FA 3FKYA 3AE5B 2MCNB 4W9DA 2KANA 2DZIA 1R7SA 2L76A 1LQBA 2NTTA 2JZ3B 4K7WA 1J0GA 1ZW7A 2MWSB 3OJ4B 4FJYA 2FCMA 4S17A 1RAXA 2IY1B 1EM7A 4P16A 3A9KB 3NY5A 3O13A 1C9FA 3ZJVA 4XWTA 1PGBA 3R2TA 2KXJA 1H4RA 1QILA 3H7SA 5E6NA 1WMHB 2HTHA 5H8YE 3P1MA 1KH0A 1KJTA 2PMVA 2XK5A 2HD5B 2JZZA 3ZDTA 1GB4A 2JSVX 3TCAA 1G6JA 4NY0A 3Q6BA 5L95C 3N1ZC 1C4AA 2KN5A 5C2TB 2PLPA 3ZYYX 3A9KA 1IPGA 2D5GA 4KIKB 2RPQA 3Q3OC 4XZ4A 1L5PA 3BVMA 1V81A 1YQ4B 1SBBB 3VTWA 2HJ1A 3DPDA 3I9V1 1MI0A 3IHPC 4ITKA 1SXTA 3JSVA 5EDSA 1L0VB 2DYOA 2CU1A 4XE0A 3DVGY 4TSSA 3GZNB 5AZHA 5C3JB 2R2QA 3W1SA 2KMAA 1R4NI 3TEXA 1GG3A 3WAPA 1WZ0A 1ZDVA 2L00B 3DDCB 2FIFA 4TQ0A 4URKA 3UQBA 2N0SB 2M17A 3WANA 3ZXVA 2AWTA 3PRMB 2PEAA 4NPNA 3ZW3A 4NJCA 2SEBD 5LNK1 1VR9A 1QOGA 3GE8C 4TQ1A 1V80A 1S1QB 1CZPA 1F1HA 2ZCBA 3WCQA 3ZNHB 3VUXA 5L83A 1PFDA 3BZDB 3TEYA 4XC2A 1JW9D 2MH7A 4MGIE 5JZEB 3KH0A 5FKAC 3M63B 4CHKA 4ICUA 1NI2A 2MX2A 3U7ZA 3AE9B 3AI5A 2DZJA 2MJDA 2BYEA 1I7HA 2DENB 4AJWA 3KUZA 5DPTA 2E3TA 1E5WA 2ZJDA 3A9JA 3T3OA 1N61A 1AYFA 4IWOA 4RGNA 1FNVA 3P4RB 2JVCA 2Z59B 4LDTB 2Q5WD 2KDFB 2WX0A 3QAQA 2V4IB 2DNFA 1WWTA 4RH6A 2K25A 3AECB 2GBJA 3DVGX 1EWCA 2L3ZA 1F9JA 1I4XA 2CHWA 2FCSA 1QZEA 2RDGA 3A9JB 2MQJA 3AH7A 3Q8BA 4RCOA 1SE4A 2HE7A 1NENB 4ZRPA 2FCQA 1VZ7A 3A4SC 3H9DA 1MPEA 4DBGA 2WXFA 4YSZB 1L4DB 1AARA 5AZGA 3B2GA 3N1XC 1D4BA 4GGQA 1WM3A 2NTSA 5D6JB 4MSMB 4K3BA 4AOFA 1C77A 2AQ1B 3MHZA 3Q8FA 4JGHB 4JIOU 3DCGA 1L6VA 3KYDD 3AEDB 3QARA 3VUWA 2REXA 1ZKHA 3MJ5A 2EELA 4DXAB 3RI7C 3RNCC 4ZDVA 1TKGA 3LB8C 4Q2JA 2WXJA 4YSYB 3QC8B 2KDIA 1NBFC 4K7UA 3PS6A 4JQWC 1NVID 3TL5A 3BYTB 3H7PA 4KVGB 4YSXB 4WWOA 1ROEA 2N9PC 3KUCB 4GLSC 5AUIA 4LK0M 3I57A 1I4RA 2XK5B 2ZNVB 4K1RB 2EKIA 4KDLB 4BKTA 1JALA 2C7MB 3NUHB 4BAXA 3DBHB 2D3GA 4LJOB 2ACZB 1XLQA 4GMVA 3SU8X 2LFIA 1L7YA 4W9CA 4JLCA 5TR5A 3VH3B 2K0PA 2JY6A 3PZDA 1L2NA 1JROA 2I1KA 2MBBB 2LEKA 1OQYA 1LXDA 2KMMA 1I35A 2Y5BB 1M94A 3ZO5B 3TMPB 2GLSA 3PT2B 2KTRA 1WZ3A 1GAQB 2X8XX 2KTFA 2WHIA 3APCA 3K9OB 4RGTA 2J7QB 1P1AA 1OFFA 4IM3A 3RMKC 4IC7B 1D5MC 2V9HA 2PIAA 3A4RA 4WJPA 2C7HA 1AWDA 2JRHA 3WAOA 4R3DA 3BWUD 4FADA 1DYQA 2FBWB 4OVUA 4IOIE 2H89B 3LXFA 3HM3A 1GNUA 3AU5A 4CYEA 1XLNA 4IDIA 3AE6B 2VH1A 4TV3A 2KZRA 4REZA 3ZJTA 1L4ZB 1XO3A 3JSVB 1FXTB 2L0TA 3W9CB 1V9JA 4FULA 5IAAC 3QCAA 3IAS1 5DPWA 1YQ3B 4FLHA 3SDLC 4KSKC 5BO4B 1LO5D 4HVBA 1SE3A 1WI0A 3WAMA 3ZTDA 3RZWC 2WXLA 3A1QB 4EUTA 3ZXRA 4PT5A 4FJZA 3RPFC 1YQBA 3U30A 2WS3B 3L4PA 2AL3A 3EA6A 2RDBC 2CU3A 4M8MA 2VRRB 5LXIB 3A33B 1GB1A 3VRBB 1CQVA 4YWGG 4K81A 4KZCA 1NI3A 3IVFA 2NR2A 2KQSA 2BYTA 1JWUD 1UBIA 1YJJA 1QKZA 1WH3A 1FNUA 4JL9A 3IG3A 1E6EB 1V8CA 2LMCA 2KC2A
chains in the Genus database with same CATH topology
3GE3C 3Q3MC 3N1YC 3Q3OC 3DHIC 3RN9C 3RNFC 1T0QC 3RI7C 3RNBC 3N20C 3RNCC 3RNGC 3GE8C 3I5JC 3DHGC 1T0SC 3Q3NC 3RNAC 3DHHC 1T0RC 4P1CC 3RNEC 3RMKC 2INCC 3Q14C 4P1BC 2INDC 2RDBC 3N1ZC 3I63C 3Q2AC 3N1XC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GE3 C;  3Q3M C;  3N1Y C;  3Q3O C;  3DHI C;  3RN9 C;  3RNF C;  1T0Q C;  3RI7 C;  3RNB C;  3N20 C;  3RNC C;  3RNG C;  3GE8 C;  3I5J C;  3DHG C;  1T0S C;  3Q3N C;  3RNA C;  3DHH C;  1T0R C;  4P1C C;  3RNE C;  3RMK C;  2INC C;  3Q14 C;  4P1B C;  2IND C;  2RDB C;  3N1Z C;  3I63 C;  3Q2A C;  3N1X C; 
#chains in the Genus database with same CATH topology
 1N5X A;  1FO4 A;  3P4Q B;  4OVV A;  1FPY A;  1SIF A;  2QIL A;  2RDH A;  1X1M A;  4AP4 C;  5IO9 A;  2NPT B;  3M62 B;  3ZVV A;  2IBI B;  2KK8 A;  4IWP A;  1WJ6 A;  1YOV B;  1AW7 A;  4ZRK A;  3VR9 B;  3L08 A;  3UQA A;  3AE1 B;  2K6Q A;  3EGR A;  1L6U A;  1V49 A;  1NYQ A;  1Y8R C;  4ZYN A;  1P9D U;  1L0X B;  3NVZ A;  3NZS A;  2CHX A;  2NPT A;  1WX7 A;  1I4Q A;  3EC8 A;  1S3S G;  2WDQ B;  2N9L A;  4EE2 A;  4WJN A;  4XDC A;  2KWC A;  4HKQ A;  4LJP B;  2N7D A;  2O6V B;  2KLG A;  1UZX B;  3E9S A;  3WAL A;  1JCK B;  2J0J A;  1CK1 A;  2KX3 A;  1KF6 B;  2DYB A;  2IND C;  3AB5 A;  1EU3 A;  4LNK A;  4FXC A;  4MSQ B;  5G2N A;  3V60 A;  3V62 A;  2WXK A;  2K6D B;  1TS5 A;  3Q8C A;  4FHK A;  2ZEQ A;  2O6V D;  4C7Y A;  2O2V A;  4RF1 A;  2BB6 A;  3NVW A;  1TS4 A;  5JHB A;  2DLB A;  3AE3 B;  2CS4 A;  2VZK B;  4FJV B;  2G45 B;  2R61 A;  3V6E B;  2JUO A;  1GOZ A;  2D07 B;  4WIP A;  3TUO A;  1E8W A;  3J9C A;  2QEJ C;  1N5W A;  5FK9 C;  4ICV A;  3MC8 A;  4HRS A;  3R7Q A;  1P7F A;  1HXY D;  2I1J A;  3EEC A;  2V4L A;  1KOT A;  2DWQ A;  3VTV A;  3WA0 A;  4E71 A;  3TSS A;  4J3O D;  3CST A;  4LNO A;  2W3R A;  5CX3 A;  3ABV B;  1F2R I;  4KGT A;  4KZ0 A;  2KD0 A;  4M00 A;  1TGZ B;  2LGS A;  1SGH A;  3W2D A;  2BVC A;  1Q0W B;  2IDY A;  5HG2 A;  1TKY A;  4HXD A;  2JXX A;  2WXH A;  3BII D;  4HPL B;  5AUK A;  3MJW A;  1D6E C;  4RGO S;  1F52 A;  2AX5 A;  3SHQ A;  2MP2 A;  3IT6 B;  1ISN A;  4LNI A;  1BUI C;  3DBH I;  2KAC A;  3E56 A;  1T5X D;  1TBE A;  2D2Q A;  3C19 A;  3AEF B;  4II3 B;  2KVZ A;  2M0A A;  1CJE A;  2G3Q B;  4E74 A;  4C00 A;  1TZO A;  2N1W A;  4XGA B;  4W9K A;  2GOW A;  3V3X A;  2IPK D;  1CMX B;  4IUM B;  4ZRI A;  1QOF A;  1WGH A;  1FNW A;  5IP4 D;  4BBN F;  4W9H A;  2YEP B;  2JF5 A;  3ALB A;  2V0G A;  3AXC A;  2INN E;  2NBU A;  2IO0 B;  1WJ4 A;  1QOA A;  4II2 B;  5FR6 A;  2WLB A;  4B6W A;  3ZLZ A;  2JQR B;  2KFK A;  4A3P A;  1YN3 A;  4DXF A;  4KGS A;  1IUE A;  4WAA A;  3N3K B;  5JH5 C;  5JHA A;  4FBJ B;  3ETR A;  2Z8L A;  3PSE B;  2A4Z A;  1YJ1 A;  1R4M B;  2DAF A;  4L2Y A;  2N9X A;  2SAK A;  4HDQ A;  2L05 A;  3V05 A;  4WJO A;  4JWS C;  1IYF A;  2AEH A;  4OW0 A;  4W9I A;  4WUR A;  5E6J A;  2L32 A;  1ZP0 B;  1GUA B;  2WXQ A;  3H8H A;  1RLF A;  1WE7 A;  4RF0 A;  1V5T A;  3GOE A;  5CHW A;  5BYQ A;  5IA7 A;  1KLV A;  2ZPY A;  2BS3 B;  3ZNZ B;  3RZF A;  3AU4 A;  4GIV A;  2W55 A;  4JWU C;  1EF5 A;  3A1Q A;  2WQY B;  3CF6 E;  4JX1 C;  4UDU C;  1WYG A;  2N9K A;  2PJH A;  1RWS A;  5D3I B;  3ONS A;  1C4P A;  1XLP A;  4CO7 A;  4J6I A;  1JRP A;  5CHV C;  1NDD A;  4GN1 A;  1FIQ A;  2WX1 A;  1I4G A;  3RFZ B;  1V86 A;  5GXG B;  1TJE A;  2HTM E;  5G5G A;  3ZKJ C;  1HA5 A;  1WGD A;  2MLB A;  1E0Z A;  2QSD A;  4XDD A;  2BTE A;  4ZOH C;  4ANV A;  3FIL A;  1BXT A;  3T3N A;  1I4H A;  3CIR B;  1E10 A;  2I38 A;  3ZNG C;  4DHJ D;  2LRW A;  1T0Q C;  2QC8 A;  1YMH E;  3L10 B;  2GMI C;  2M1M A;  3AEG B;  4AWJ A;  3PHW B;  2LGX A;  4LNN A;  3BK2 A;  2ONQ A;  3RUL A;  4I6P A;  1WYW B;  2WNM A;  3T8M A;  2JT4 B;  4HJK A;  3LDZ E;  2Y3A A;  1UWX A;  2BKF A;  2ICI A;  5JXV A;  2N9E B;  2CR5 A;  4A90 A;  2J0M A;  4WQM A;  1DOI A;  5LLI A;  4MH0 E;  2BW2 A;  2LUM A;  2MBH A;  1ACC A;  3IXS A;  3B2F A;  1V6E A;  2LVP A;  3KQ4 A;  3QIJ A;  4YTN B;  3GP7 A;  2INP E;  2J4X A;  2CJN A;  4IW0 A;  4GU2 A;  4I6N B;  4A8X C;  2BS4 B;  2GBR A;  1J7A A;  3UGB B;  4TKN A;  4P1C C;  1ZXI A;  3RNE C;  2CJO A;  1ET6 A;  4HDO A;  1TY0 A;  2DBY A;  4C56 C;  2C5L C;  1MHH E;  3NZU A;  5HKH A;  4AQ7 A;  3I63 C;  3VFK A;  3PZ8 A;  3M95 A;  1TS2 A;  1FRR A;  3NS8 A;  1MVK A;  4O1N A;  3ZTC A;  4L1B A;  2IO1 B;  2N7J A;  2IYD B;  1TKE A;  4C80 A;  1VZ8 A;  3BIN A;  1XQQ A;  1N63 A;  1ZXH A;  2MEK A;  2KDM A;  1WJN A;  2MW5 A;  1IGC A;  2KX0 A;  1MJD A;  2LHE A;  4K7S A;  3WIM A;  4DHJ B;  4DHZ E;  1FFU A;  3R66 C;  4RGM A;  1XLO A;  1VRA B;  3TIX A;  4A3O A;  4WH4 A;  3RNB C;  1HTQ A;  2ZW1 A;  4KSL C;  4EOY A;  4A20 A;  4XX5 A;  2KFJ A;  3Q14 C;  2J53 A;  2MJE A;  3AE2 B;  2M4N A;  1JWA D;  1J8C A;  2GBN A;  1C1Y B;  5CTR C;  5D94 A;  2KMC A;  4EZL A;  3H6N A;  3JVZ X;  3NVV A;  2MA9 B;  2JWU A;  2BS2 B;  5J2R A;  4PS7 A;  4ZHO A;  2KDE B;  3DBR I;  1UGJ A;  3ZIM A;  4YXD B;  2V1Y A;  2EMT A;  1Q1O A;  4GXB A;  1E8X A;  2ZCC A;  3ZRF A;  4MJS A;  2KTR B;  2MP2 B;  2M0X A;  4DHZ B;  3SD5 A;  1C79 A;  3AEE B;  2Z0D B;  1SIJ A;  3B9J A;  5D3D A;  3FC4 A;  3UIO B;  2QMT A;  3BYY B;  3DHI C;  1IGD A;  3VQI A;  1R4M I;  4HRO A;  1ENF A;  1WF9 A;  1D3Z A;  3P4P B;  2BF8 B;  5DPS A;  4CQN A;  2MHJ A;  1ZDX A;  3PRZ A;  2K22 A;  2QHO A;  2LGI A;  3QK0 A;  4M01 A;  2PVG C;  1NYR A;  4K3C A;  4MJS B;  5EE0 A;  2VH2 A;  4WWP A;  1MFW A;  1N62 A;  4ASW C;  4BKG A;  1ZGU B;  3PV1 A;  3KVF B;  2PPH A;  4IKG A;  4EEW A;  4B95 A;  4BVU C;  1FEH A;  1LGR A;  4N9F 4;  4ZRQ A;  1EF1 A;  4N59 A;  1MG4 A;  3LYY A;  2KAJ A;  3VAW A;  4ZYS A;  2UYZ B;  4BBN C;  5DCN A;  1SJH D;  3SEB A;  3AEA B;  2V3P A;  4ARC A;  4B0E A;  3UIP B;  2M8S A;  2KWV B;  3OJ3 A;  2JU6 X;  2KOX A;  5HFY A;  3ZDM C;  2L8J A;  3PLU A;  1UNS A;  1XT9 B;  2BYV E;  1I4P A;  1SE9 A;  2KC1 A;  2QIE B;  3I5J C;  3L16 A;  4W9F A;  2JRI B;  4PS8 A;  1VJK A;  2UWQ A;  2K9X A;  4XWW A;  4MGZ E;  3BK1 A;  2PW9 A;  2D10 A;  3MFG A;  1KFY B;  4ACF A;  1WXM A;  3ZRC A;  3UIN B;  1JQ4 A;  2LXC A;  2MRP A;  2LGY A;  4C4V A;  3DVN V;  3D32 A;  2MBQ A;  1WXS A;  2NMQ A;  2I2Y A;  4H2A A;  2BQQ A;  4G0N B;  3TEW A;  2G4D B;  5BYR A;  2OJW A;  1STE A;  5D7G A;  1XCQ L;  1UWM A;  3B0A A;  3ZNI D;  4RNA A;  1V97 A;  5MPO A;  1QF6 A;  3ZGZ A;  3KYC D;  1T3Q A;  2KJ6 A;  3B1L X;  4ZHP A;  3MC0 B;  2BKR B;  4XYC A;  3APD A;  2E6X A;  2BT6 A;  2KWD A;  4US8 A;  3IAM 1;  4HPP A;  2JWZ A;  1ZE3 D;  5G5H A;  2KJR A;  2LHD A;  2C60 A;  5CHF A;  4P7I A;  4LLG M;  3EHV A;  1ZOY B;  4QAY A;  4DDG D;  4NAM A;  3NVY A;  3AMZ A;  3PGE A;  3GE3 C;  4F7Z A;  3NG0 A;  3QQ8 B;  1Q10 A;  3W1Y A;  1SF0 A;  1FMA D;  1VLB A;  2AQ2 B;  2DAJ A;  2JYT A;  2N1V A;  1UD7 A;  1A70 A;  2LD9 A;  4A55 A;  2O2V B;  4KGR A;  2DX5 B;  3BVG A;  3NJT A;  3SR6 A;  4OZA A;  1WX9 A;  2J52 A;  2KDB A;  2LXA A;  1HE8 A;  2W9N A;  2FUH B;  2HDE A;  4USA A;  3RD2 A;  4OZC A;  5BYS A;  3Q3N C;  3OAW A;  1J19 A;  3AN1 A;  4DQO C;  1WJU A;  4OZB A;  5C1Z A;  3RT3 B;  4NJ7 A;  4W9E A;  3R2I A;  3VXW A;  2WXP A;  2H88 B;  3HVD A;  4PK1 A;  4W9G A;  4W9L A;  4OHJ A;  4NQK E;  3Q2A C;  3LJ3 A;  3W1S C;  1WIA A;  3VVW B;  1K8R B;  2PE6 B;  2ZPN A;  3N1Y C;  3V6C B;  3N32 A;  2FCN A;  2GRI A;  3H1U A;  5KHQ A;  1B9R A;  3OG5 A;  3X23 A;  5DPR A;  2KHW B;  4W9J A;  1VDV A;  3AE8 B;  2PE9 A;  4G3X B;  1YN5 A;  2CKH B;  1I42 A;  1WX8 A;  2NVU I;  1UF0 A;  2DZK A;  4F8C B;  3DVN U;  1VZ6 A;  1E7U A;  1BT0 A;  5HI1 A;  4NNJ B;  2JX5 A;  2ZZP B;  2G9H D;  1R4N B;  2XNA C;  5LXH A;  3PTF C;  3Q3J A;  2IO3 B;  3APF A;  1OQQ A;  4WWM A;  3KWL A;  3TEZ A;  3DHH C;  3M3J A;  3NRZ A;  3DQV A;  1ET9 A;  1HQR D;  4US9 A;  3EFU A;  4S0R A;  1F2R C;  1SE2 A;  4DWF A;  1J7B A;  3ENE A;  1GJZ A;  4BKS D;  1E7P B;  1HEZ E;  4IWQ A;  1K51 A;  2XN9 C;  1XCT L;  1JWS D;  3L17 A;  2L1A A;  1OQR A;  2FAZ A;  2RGF A;  3DBR B;  1NEK B;  4GDL A;  1KTK A;  1T0Y A;  2KO3 A;  4HPM B;  5KHO A;  4M0W B;  2X38 A;  1T0S C;  5I4D A;  3C0R B;  3AV8 A;  2JYE A;  3K9P B;  3HK0 A;  3R8B A;  2LJ5 A;  4YTM B;  1RFK A;  2FNJ B;  2C7N B;  4FA6 A;  2LZ6 A;  1PDX A;  1DGJ A;  4WJQ A;  3NS1 A;  2LWP A;  2L0F A;  1N60 A;  2NS5 A;  1LFD A;  3KW5 B;  1TZ1 A;  4N58 A;  1OTR B;  3RNG C;  2KFK B;  1UUP A;  1XF5 L;  2UU7 A;  4GOC A;  1WMH A;  2V3S A;  2C9W B;  4DDI D;  2G4S A;  3AE4 B;  3U7D A;  4HCN B;  1UGM A;  4C4V B;  3EFC A;  1WXQ A;  4GDK B;  1P0R A;  2NBV B;  4LNF A;  1WGK A;  4AJY B;  4KIK A;  2W54 A;  2GB1 A;  1PGA A;  4I6L B;  1FCC C;  1K52 A;  1M4V A;  1GC7 A;  2KQ7 A;  4HKZ E;  1WXA A;  3PRE A;  4NQL B;  5HHD G;  4RMA A;  2KLC A;  3Q3M C;  4GDK A;  1TY2 A;  3Q8A A;  2WXR A;  3VDZ A;  4MDK E;  4FN2 A;  3N9Y C;  3VUY A;  5IOI A;  3L54 A;  2INC C;  4IG7 B;  4F1S A;  3RCZ A;  1EO6 A;  2K1F A;  2YVC A;  2FE8 A;  3X0W A;  2BWF A;  3MP9 A;  4MAC A;  1A5R A;  5EE9 A;  3ZQ4 A;  2J0K A;  4EZJ A;  4G50 A;  3RNF C;  2MSE D;  1P98 A;  5E6P A;  1EUV B;  3U4E G;  3FIL B;  5AZF A;  2LRU A;  4NJ6 A;  2NCN A;  1VD2 A;  1B1Z A;  2BGF A;  4WAF A;  1WGR A;  3ML9 A;  1WE6 A;  5TSS A;  3PHX B;  2AQ3 B;  1PGX A;  1JML A;  2RMM A;  2WDT B;  3QHT A;  2MBE A;  3RN9 C;  2XBB C;  3CWI A;  1HTO A;  1QOB A;  3VR8 B;  3ZUN A;  1RYJ A;  1Y56 A;  3MC9 A;  1FRD A;  3P2B A;  4KDI C;  1FCL A;  1TS3 A;  5J18 A;  2L52 A;  4A9A A;  3VTU A;  2IO2 B;  3S2A A;  2D11 A;  2W82 A;  1QT9 A;  4G11 A;  4PYZ A;  2WDV B;  1HZ5 A;  2LVO A;  5D2M B;  5E6O A;  3ZJU A;  1D5X C;  5C23 A;  3TBL D;  3RNA C;  1UH6 A;  2K5P A;  3KWV A;  2KVR A;  1YD8 U;  4P1B C;  2A5U A;  3EUB 2;  3P63 A;  2EKE C;  3O65 B;  4RM8 A;  4KV2 A;  1WY8 A;  2GI9 A;  2V3N A;  4BZA A;  3VHT C;  1PYW D;  4PS3 A;  3N20 C;  2K8H A;  4EFO A;  3CMM B;  1WSP A;  4AUQ C;  3PLV A;  1F77 A;  2KT7 A;  2YLM A;  2HJ8 A;  4D2K A;  1YN4 A;  4LDT D;  3OWE B;  3HM6 X;  4L23 A;  2KN4 A;  2OJR A;  3PVL A;  3Q8E A;  1JRU A;  4HLE A;  3IBE A;  2ZVO A;  4ZRJ A;  3ECI A;  3Q69 A;  2K8C A;  2FID A;  3DOW A;  1BML C;  2IZV B;  3HHM A;  2NBW B;  2N7E A;  3T9L A;  3DHG C;  5BMH A;  4TUU A;  3MHS D;  1TIF A;  1E7V A;  5IN7 A;  2ON8 A;  4MGK E;  2CHZ A;  2BPS A;  3PZ7 A;  3HUI A;  4WQO B;  2LI5 A;  4C7Z A;  5IKC M;  3UI3 A;  2PTL A;  2MBO A;  3QWZ B;  3KLS X;  4M0W A;  4BKS A;  2LGD A;  2DHZ A;  4MEM A;  4PYU A;  1HZ6 A;  4HEA 1;  1WFY A;  1JWM D;  1EU4 A;  1F0Z A;  2LAS A;  2BB5 A;  4BOS C;  1E8Z A;  4ANX A;  3L13 A;  1FM0 D;  1N6Z A;  4MEL A;  4KKI A;  2J42 A;  1K50 A;  2G1E A;  5FR3 A;  3URY A;  3W5U B;  2RPV A;  3MTN B;  3H7P B;  3I3T B;  4EKU A;  2AYO B;  1L0Y B;  2KJH B;  3ML8 A;  2IJ0 A;  4NAW A;  3P4S B;  4HWI B;  2K39 A;  3DWG C;  5G55 A;  2KYW A;  4ANW A;  1FXI A;  2L7R A;  2MJ3 A;  2WP9 B;  3NZ3 A;  4GDL B;  4GB9 A;  4HK2 A;  2TSS A;  2BBC A;  1PUT A;  1YX6 B;  1SSN A;  2L83 A;  4B9K A;  4DXG A;  1K53 A;  2WU2 B;  2ZW0 A;  4MH8 A;  3AM9 A;  4M8N A;  3JYU A;  3BVZ A;  4ARI A;  3VRA B;  2PKO A;  1AN8 A;  4OVZ A;  2RD0 A;  3HRD D;  1ZUD 2;  5EE1 A;  1E9M A;  4M02 A;  1YJI A;  3U52 E;  1GC6 A;  1RM6 C;  1C78 A;  3AUL A;  2M19 A;  2W3S A;  2RR9 A;  1U4A A;  4MT5 A;  2WXO A;  1OEY J;  1KM7 A;  4LCD E;  3P42 A;  4P6V F;  1ZPS A;  1XXG A;  2D3C A;  1E90 A;  1WXV A;  1Q5W B;  4AS1 A;  3SFE B;  1KLU D;  2LJI A;  1V5O A;  3DBL I;  1DOX A;  2KQ4 X;  3N30 A;  3KUD B;  4IM2 A;  4BOZ B;  1JWB D;  2WYQ A;  3RUI B;  1FFV A;  4LTU A;  1D5Z C;  4YTP B;  2WU5 B;  3SFD B;  2QJL A;  1EWY C;  1SJE D;  1WM2 A;  1RFA A;  1IBX A;  4WWN A;  3PPA A;  1SB3 C;  2ZNV C;  1DOY A;  1E8Y A;  5EE3 A;  1P7E A;  5J17 A;  4B0M A;  5H92 C;  1KLG D;  2WGS A;  1QLB B;  2KNB A;  1C76 A;  4JPS A;  2BYF A;  1XD3 B;  3RYT A;  4HCP B;  1FD6 A;  3R7R A;  3NHE B;  3QA8 A;  3QX1 A;  3QJZ A;  4YT0 B;  1IBX B;  3BY4 B;  4MGY E;  1WR6 E;  2QDF A;  2RSU A;  3DWM A;  3GS2 A;  4TMA B;  4GSW A;  1QQR A;  1LM8 B;  4BFR A;  3TJP A;  4MM3 B;  2Z0E B;  4NZL B;  1H8C A;  3W5V B;  4FHJ A;  3HVZ A;  5BMI A;  4KKJ A;  3PRP B;  1P3Q U;  3UF8 A;  1V1O A;  1FXA A;  1UEL A;  2OHF A;  1TYG B;  1OEY A;  3IT4 B;  1WGG A;  3CSF A;  2BWE S;  4MM3 A;  1V1P A;  3PO0 A;  4HJG E;  3NOB A;  3DBS A;  3VH4 B;  2DYM A;  2AL6 A;  2GBK A;  1MHX A;  1GPX A;  3U2S C;  2JXT A;  3L0W B;  2IGH A;  5T8I A;  2WWZ A;  3U8Z A;  2KWU B;  3AEB B;  1Z2M A;  2K8B A;  2DZM A;  2LUE A;  2JZP A;  1WRD B;  2IY0 B;  1T0R C;  2B76 B;  4ANU A;  2OOB B;  1V1P B;  4KX6 B;  1TT5 B;  1KRH A;  2Y5P A;  1C3T A;  2VZK D;  2JPH A;  4JE3 B;  2M56 B;  3AE7 B;  1YIW A;  3C8Y A;  5GMV A;  2D3A A;  3HIZ A;  1YNT E;  4EZK A;  2O6V A;  1C4C A;  2YEP F;  1IP9 A;  1V2Y A;  4A6Q A;  2WDR B;  4E3C A;  2EMS A;  3JW0 X;  1YX5 B;  3FAH A;  1XEE A;  3GZN I;  1T6B X;  2ZVN A;  2IGG A;  4NAW B;  2LVQ A;  2WXG A;  1MG8 A;  1Z5S B;  2QCZ A;  5BMG A;  2WXN A;  1TTN A;  1WR1 A;  1WGY A;  1UBQ A;  3B08 A;  5AEK B;  1VCB A;  2FUG 1;  1RRB A;  2B3A A;  1OGW A;  2WXI A;  4IM0 A;  2R2O A;  3GB1 A;  3R3M A;  3DBL B;  1SEB D;  3Q3F A;  2GBM A;  1J7C A;  4RM9 A;  2KKC A;  2D3B A;  3V61 A;  2ASQ A;  4N6E B;  2Y5C A;  4RFB A;  3IFW B;  2WXM A;  2IGD A;  2K3U A;  1PQS A;  1ESF A;  4DK5 A;  2PVO D;  4YL8 A;  2XEW A;  1WRI A;  3OLM D;  2OED A;  4X57 B;  2N4F A;  3FKY A;  3AE5 B;  2MCN B;  4W9D A;  2KAN A;  2DZI A;  1R7S A;  2L76 A;  1LQB A;  2NTT A;  2JZ3 B;  4K7W A;  1J0G A;  1ZW7 A;  2MWS B;  3OJ4 B;  4FJY A;  2FCM A;  4S17 A;  1RAX A;  2IY1 B;  1EM7 A;  4P16 A;  3A9K B;  3NY5 A;  3O13 A;  1C9F A;  3ZJV A;  4XWT A;  1PGB A;  3R2T A;  2KXJ A;  1H4R A;  1QIL A;  3H7S A;  5E6N A;  1WMH B;  2HTH A;  5H8Y E;  3P1M A;  1KH0 A;  1KJT A;  2PMV A;  2XK5 A;  2HD5 B;  2JZZ A;  3ZDT A;  1GB4 A;  2JSV X;  3TCA A;  1G6J A;  4NY0 A;  3Q6B A;  5L95 C;  3N1Z C;  1C4A A;  2KN5 A;  5C2T B;  2PLP A;  3ZYY X;  3A9K A;  1IPG A;  2D5G A;  4KIK B;  2RPQ A;  3Q3O C;  4XZ4 A;  1L5P A;  3BVM A;  1V81 A;  1YQ4 B;  1SBB B;  3VTW A;  2HJ1 A;  3DPD A;  3I9V 1;  1MI0 A;  3IHP C;  4ITK A;  1SXT A;  3JSV A;  5EDS A;  1L0V B;  2DYO A;  2CU1 A;  4XE0 A;  3DVG Y;  4TSS A;  3GZN B;  5AZH A;  5C3J B;  2R2Q A;  3W1S A;  2KMA A;  1R4N I;  3TEX A;  1GG3 A;  3WAP A;  1WZ0 A;  1ZDV A;  2L00 B;  3DDC B;  2FIF A;  4TQ0 A;  4URK A;  3UQB A;  2N0S B;  2M17 A;  3WAN A;  3ZXV A;  2AWT A;  3PRM B;  2PEA A;  4NPN A;  3ZW3 A;  4NJC A;  2SEB D;  5LNK 1;  1VR9 A;  1QOG A;  3GE8 C;  4TQ1 A;  1V80 A;  1S1Q B;  1CZP A;  1F1H A;  2ZCB A;  3WCQ A;  3ZNH B;  3VUX A;  5L83 A;  1PFD A;  3BZD B;  3TEY A;  4XC2 A;  1JW9 D;  2MH7 A;  4MGI E;  5JZE B;  3KH0 A;  5FKA C;  3M63 B;  4CHK A;  4ICU A;  1NI2 A;  2MX2 A;  3U7Z A;  3AE9 B;  3AI5 A;  2DZJ A;  2MJD A;  2BYE A;  1I7H A;  2DEN B;  4AJW A;  3KUZ A;  5DPT A;  2E3T A;  1E5W A;  2ZJD A;  3A9J A;  3T3O A;  1N61 A;  1AYF A;  4IWO A;  4RGN A;  1FNV A;  3P4R B;  2JVC A;  2Z59 B;  4LDT B;  2Q5W D;  2KDF B;  2WX0 A;  3QAQ A;  2V4I B;  2DNF A;  1WWT A;  4RH6 A;  2K25 A;  3AEC B;  2GBJ A;  3DVG X;  1EWC A;  2L3Z A;  1F9J A;  1I4X A;  2CHW A;  2FCS A;  1QZE A;  2RDG A;  3A9J B;  2MQJ A;  3AH7 A;  3Q8B A;  4RCO A;  1SE4 A;  2HE7 A;  1NEN B;  4ZRP A;  2FCQ A;  1VZ7 A;  3A4S C;  3H9D A;  1MPE A;  4DBG A;  2WXF A;  4YSZ B;  1L4D B;  1AAR A;  5AZG A;  3B2G A;  3N1X C;  1D4B A;  4GGQ A;  1WM3 A;  2NTS A;  5D6J B;  4MSM B;  4K3B A;  4AOF A;  1C77 A;  2AQ1 B;  3MHZ A;  3Q8F A;  4JGH B;  4JIO U;  3DCG A;  1L6V A;  3KYD D;  3AED B;  3QAR A;  3VUW A;  2REX A;  1ZKH A;  3MJ5 A;  2EEL A;  4DXA B;  3RI7 C;  3RNC C;  4ZDV A;  1TKG A;  3LB8 C;  4Q2J A;  2WXJ A;  4YSY B;  3QC8 B;  2KDI A;  1NBF C;  4K7U A;  3PS6 A;  4JQW C;  1NVI D;  3TL5 A;  3BYT B;  3H7P A;  4KVG B;  4YSX B;  4WWO A;  1ROE A;  2N9P C;  3KUC B;  4GLS C;  5AUI A;  4LK0 M;  3I57 A;  1I4R A;  2XK5 B;  2ZNV B;  4K1R B;  2EKI A;  4KDL B;  4BKT A;  1JAL A;  2C7M B;  3NUH B;  4BAX A;  3DBH B;  2D3G A;  4LJO B;  2ACZ B;  1XLQ A;  4GMV A;  3SU8 X;  2LFI A;  1L7Y A;  4W9C A;  4JLC A;  5TR5 A;  3VH3 B;  2K0P A;  2JY6 A;  3PZD A;  1L2N A;  1JRO A;  2I1K A;  2MBB B;  2LEK A;  1OQY A;  1LXD A;  2KMM A;  1I35 A;  2Y5B B;  1M94 A;  3ZO5 B;  3TMP B;  2GLS A;  3PT2 B;  2KTR A;  1WZ3 A;  1GAQ B;  2X8X X;  2KTF A;  2WHI A;  3APC A;  3K9O B;  4RGT A;  2J7Q B;  1P1A A;  1OFF A;  4IM3 A;  3RMK C;  4IC7 B;  1D5M C;  2V9H A;  2PIA A;  3A4R A;  4WJP A;  2C7H A;  1AWD A;  2JRH A;  3WAO A;  4R3D A;  3BWU D;  4FAD A;  1DYQ A;  2FBW B;  4OVU A;  4IOI E;  2H89 B;  3LXF A;  3HM3 A;  1GNU A;  3AU5 A;  4CYE A;  1XLN A;  4IDI A;  3AE6 B;  2VH1 A;  4TV3 A;  2KZR A;  4REZ A;  3ZJT A;  1L4Z B;  1XO3 A;  3JSV B;  1FXT B;  2L0T A;  3W9C B;  1V9J A;  4FUL A;  5IAA C;  3QCA A;  3IAS 1;  5DPW A;  1YQ3 B;  4FLH A;  3SDL C;  4KSK C;  5BO4 B;  1LO5 D;  4HVB A;  1SE3 A;  1WI0 A;  3WAM A;  3ZTD A;  3RZW C;  2WXL A;  3A1Q B;  4EUT A;  3ZXR A;  4PT5 A;  4FJZ A;  3RPF C;  1YQB A;  3U30 A;  2WS3 B;  3L4P A;  2AL3 A;  3EA6 A;  2RDB C;  2CU3 A;  4M8M A;  2VRR B;  5LXI B;  3A33 B;  1GB1 A;  3VRB B;  1CQV A;  4YWG G;  4K81 A;  4KZC A;  1NI3 A;  3IVF A;  2NR2 A;  2KQS A;  2BYT A;  1JWU D;  1UBI A;  1YJJ A;  1QKZ A;  1WH3 A;  1FNU A;  4JL9 A;  3IG3 A;  1E6E B;  1V8C A;  2LMC A;  2KC2 A; 
#chains in the Genus database with same CATH homology
 3GE3 C;  3Q3M C;  3N1Y C;  3Q3O C;  3DHI C;  3RN9 C;  3RNF C;  1T0Q C;  3RI7 C;  3RNB C;  3N20 C;  3RNC C;  3RNG C;  3GE8 C;  3I5J C;  3DHG C;  1T0S C;  3Q3N C;  3RNA C;  3DHH C;  1T0R C;  4P1C C;  3RNE C;  3RMK C;  2INC C;  3Q14 C;  4P1B C;  2IND C;  2RDB C;  3N1Z C;  3I63 C;  3Q2A C;  3N1X C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...