1JQ4A

[2fe-2s] domain of methane monooxygenase reductase from methylococcus capsulatus (bath)
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
98
structure length
98
Chain Sequence
MQRVHTITAVTEDGESLRFECRSDEDVITAALRQNIFLMSSCREGGCATCKALCSEGDYDLKGCSVQALPPEEEEEGLVLLCRTYPKTDLEIELPYTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords METHANE MONOOXYGENASE COMPONENT C
publication title NMR structure of the [2Fe-2S] ferredoxin domain from soluble methane monooxygenase reductase and interaction with its hydroxylase.
pubmed doi rcsb
source organism Methylococcus capsulatus str. bath
total genus 9
structure length 98
sequence length 98
ec nomenclature ec 1.14.13.25: Methane monooxygenase (soluble).
pdb deposition date 2001-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1jq4A00
1YJJA 1JROA 1UWMA 2HTME 2LEKA 1JALA 1VLBA 4A9AA 1QOAA 2E3TA 1I7HA 2BS3B 2MJ3A 3B9JA 1L6UA 5EE0A 1QF6A 3ABVB 3PO0A 1OQRA 1NVID 1VJKA 2WU2B 3NVVA 2W3SA 2CJOA 2CU3A 3AEAB 3NS1A 2ACZB 2M19A 3P4QB 2JQRB 3EUB2 3NRZA 3CIRB 1N61A 1PFDA 1TKEA 4YTMB 1XLNA 1FMAD 1ZOYB 1WYGA 2CJNA 3FC4A 1FFVA 3LB8C 5H8YE 3VR8B 4C80A 2QIEB 1E7PB 2JX5A 3AE1B 3AE5B 1J7AA 3NVWA 3P4RB 4YT0B 2PIAA 3WCQA 1SIJA 1N5XA 2AX5A 2G1EA 2H89B 3AB5A 3AEDB 3DWGC 1XO3A 4YTNB 4ZOHC 4YSZB 1QT9A 2K5PA 2WLBA 1AWDA 1SF0A 1E9MA 2N0SB 2MJDA 2DWQA 2PVOD 1L6VA 3AH7A 3KWLA 1QLBB 4YXDB 1TYGB 1TJEA 1XLQA 2H88B 2W3RA 1GPXA 1IUEA 3B2GA 2DBYA 3P4PB 4N6EB 3W9CB 4US8A 1NENB 4USAA 1N5WA 5AUKA 3VR9B 4YSXB 1FIQA 1SB3C 1WXQA 1FFUA 1KRHA 1YQ4B 3AEEB 1A70A 2OHFA 4P6VF 1NEKB 2KMMA 4JWSC 5EE3A 1XLPA 1V8CA 1E6EB 2KAJA 4FXCA 3AE3B 3AE2B 1TKYA 2L83A 3AEBB 5C3JB 1E10A 1RM6C 2Q5WD 3NVYA 1ZXIA 4ZHOA 3AE7B 1JW9D 1KFYB 1JRPA 3BIID 1DOIA 2EKIA 1FO4A 3AV8A 3FAHA 3RPFC 3VRAB 1J7CA 4N58A 3ZYYX 1L0VB 1KF6B 5AUIA 1N63A 5MPOA 4WQMA 1VDVA 3AEFB 1FXAA 1FXIA 3LXFA 4C7ZA 3AEGB 2BS2B 2WQYB 1QOBA 3W5UB 2WS3B 3SR6A 1NYRA 2QJLA 1FRRA 1T3QA 1ZUD2 4WWMA 1J7BA 3L4PA 1NI3A 1CZPA 3CWIA 4YTPB 1RWSA 4LTUA 1YJIA 3ETRA 3AE9B 4HRSA 2FBWB 1CJEA 2MJEA 5H92C 4JX1C 1E0ZA 2WDVB 2Y5CA 5GXGB 1AYFA 1WWTA 3AE8B 4US9A 1DGJA 2BT6A 1TKGA 2K9XA 4JWUC 1B9RA 1F0ZA 1NYQA 1L5PA 1QOFA 1RYJA 3NVZA 4IDIA 3AE4B 5G5GA 4ZHPA 3P1MA 1XLOA 3P63A 2B76B 3B2FA 2K22A 3W5VB 5G5HA 1R7SA 3SFDB 3AN1A 2BS4B 1QOGA 1OQQA 1RFKA 3DWMA 1OFFA 1WGKA 1GAQB 1PDXA 3AMZA 1JQ4A 2PKOA 2WDQB 3HRDD 3AE6B 1DOXA 1ZP0B 4HROA 4YSYB 1ROEA 1FRDA 3HVZA 2MH7A 4ITKA 4N59A 3VRBB 1YQ3B 1DOYA 3AM9A 2W55A 1PUTA 2W54A 5EE9A 1JWBD 1N62A 1WRIA 3SFEB 2L52A 4C7YA 1EWYC 2WP9B 5C2TB 2M56B 1V97A 2WU5B 2WDRB 5EE1A 1JWAD 1N60A 2PVGC 3P4SB 4KX6B 1FM0D 3AECB 3HUIA
chains in the Genus database with same CATH superfamily
1OGWA 2A5UA 2LRUA 1C4PA 2K6DB 3NS1A 2JRHA 4ZRQA 3P2BA 2WX0A 4WJOA 4GGQA 2KMAA 2PW9A 3FC4A 4HPMB 2N9EB 3BINA 1D6EC 3DPDA 1T6BX 3V61A 4CQNA 2KNBA 2BTEA 1GC7A 2K5PA 2N0SB 3OWEB 2LXCA 2DWQA 3B2GA 2KX0A 1NENB 1WFYA 2L0FA 4JWSC 1T0YA 2WXQA 3U4EG 2JZ3B 3AE2B 1TKYA 5IKCM 1WE6A 1ZXIA 3TMPB 1KFYB 5TR5A 1V1PB 3BIID 1CMXB 4MGIE 2MP2A 1E90A 3FAHA 3ZW3A 1T0QC 3W1SC 1N63A 3ML9A 3SD5A 1S1QB 1K52A 1WYWB 1EO6A 3H7PB 2WXNA 2XEWA 1LGRA 2JYTA 2LASA 2LWPA 1J7BA 3DBHI 4KV2A 3CWIA 3RUIB 1YJIA 3ETRA 2L00B 1YX5B 1TKGA 1Q1OA 1B9RA 3U30A 4HPPA 4K3BA 1FNWA 2EELA 2BQQA 3RMKC 4JE3B 2ZW1A 3RFZB 3Q3JA 4GB9A 2V1YA 2NBUA 2R2QA 4FJZA 1K51A 5HI1A 2VZKB 1PUTA 1N62A 2K8CA 3BYTB 1TTNA 5LLIA 3KUZA 2IGHA 1ACCA 1MI0A 4W9IA 3NUHB 1L6UA 3DHIC 2C5LC 1R4MB 4WAFA 3QQ8B 3EUB2 2RDGA 3NRZA 4IW0A 4FADA 1XLNA 1ZOYB 1FFVA 2NBVB 2KTRA 4ZRKA 2D3BA 1SF0A 4XC2A 4ZDVA 2AL6A 4PS7A 1XLQA 1TGZB 2DBYA 2PJHA 1EF5A 3W9CB 1H8CA 1TBEA 1WIAA 1FFUA 2LGDA 1KRHA 4IC7B 3WA0A 1WMHA 4XE0A 1IGCA 1WH3A 2LXAA 1V8CA 2RPVA 3JW0X 2K8BA 4TUUA 5D3IB 3UGBB 3Q8EA 1RM6C 3H1UA 3PREA 4LK0M 2KDEB 1JRPA 3EGRA 3ZO5B 3Q3FA 1TY2A 3VTVA 1FO4A 3WALA 3L17A 3APDA 3OJ3A 1J7CA 4N58A 1V2YA 1OEYJ 2ON8A 1F2RC 2HDEA 3AEFB 2ZNVB 3BK1A 1C4CA 2NS5A 2ZJDA 3W5UB 5D6JB 1T3QA 5G55A 2M4NA 3VDZA 3AE8B 4MSQB 4JPSA 4JWUC 1NYQA 1WJ6A 3MHSD 1XLOA 2G45B 2BVCA 4DBGA 1XXGA 1P7EA 2KWVB 4UDUC 2MRPA 3UINB 4WAAA 1YD8U 1F77A 4WIPA 4ZRJA 1JWBD 3SU8X 2WU5B 1PGXA 3RN9C 3A1QB 4KDIC 2ONQA 3SHQA 3AECB 5LXHA 2V3PA 2B3AA 3VTUA 4FHJA 5AZGA 3I57A 5I4DA 3ZNID 2W3SA 2CJOA 3ML8A 5DPTA 1CK1A 2N4FA 3PZ8A 3RYTA 4GIVA 1L4ZB 5D7GA 4AJYB 1WXMA 1SIJA 1FEHA 3RNBC 1WI0A 5CX3A 4ACFA 2DZMA 3P4PB 4N6EB 1K8RB 1FIQA 2FUG1 2J4XA 2VRRB 4HDQA 3RCZA 1WXVA 2YEPB 5EE3A 2CU1A 4R3DA 4GLSC 2Y5BB 1NBFC 5BYQA 2JSVX 3MTNB 4LNIA 4GU2A 2KWCA 2LVPA 3JVZX 1FXIA 2KHWB 4OZAA 3RI7C 3TUOA 4PYUA 2QHOA 4NJCA 3RNGC 2GRIA 4D2KA 2J52A 1ZKHA 1WZ3A 3GZNB 4LNKA 1IBXB 3AE9B 2MJEA 4JX1C 3Q8AA 2WWZA 5CHWA 1HXYD 3DBHB 3CSFA 1MG8A 3B2FA 1P9DU 2SAKA 3KUCB 3GP7A 3APFA 2KC2A 1YIWA 4DXFA 3HVZA 1ZXHA 2DNFA 4TSSA 1GUAB 1L7YA 3KLSX 3LYYA 3N9YC 2KLCA 2W82A 4M0WB 4P7IA 2ASQA 2REXA 1FM0D 2ZVNA 3HUIA 2LGSA 3O65B 1V86A 3ZUNA 4BFRA 5BMIA 3R7RA 3KYCD 3RD2A 2CU3A 2IY1B 2M19A 2JQRB 2HE7A 4KKJA 5LXIB 3VR8B 4G0NB 1GJZA 3ZGZA 4B9KA 3WCQA 2AX5A 2G1EA 4A8XC 4YSZB 3C0RB 4HEA1 2RPQA 3AH7A 2N7JA 3UI3A 2MQJA 1IUEA 2DX5B 2DZIA 2FNJB 4X57B 4HPLB 1EWCA 4NAMA 1B1ZA 3KQ4A 1V80A 1E8XA 3N1ZC 1F52A 2N9PC 2KJHB 3NVYA 3SDLC 4EFOA 2K6QA 3EFUA 3GE3C 2JF5A 4ZYNA 2KZRA 1QZEA 2G9HD 2KXJA 4KIKB 3M3JA 5FK9C 1RFAA 4HCPB 1MHXA 3KWVA 5AZFA 2DYBA 3I9V1 4HRSA 4DDGD 1E5WA 3Q8FA 2I1JA 2DLBA 2WXKA 4RGTA 3A9KA 3QJZA 2PEAA 2RR9A 1TZ1A 4NJ6A 1TS5A 2M8SA 4I6LB 2WDQB 3LJ3A 3Q14C 3JYUA 3FKYA 3NZ3A 1SE3A 2ZNVC 4DDID 3SFEB 2DAFA 2EMTA 1T5XD 2N9LA 2DZJA 4GDLB 4MDKE 1SSNA 3C19A 4M00A 1MVKA 2RMMA 1JMLA 3PO0A 3NHEB 2HJ1A 2KDMA 4NAWB 1E8WA 1ZGUB 3I5JC 2XNAC 4AUQC 4DHZB 3CIRB 1N61A 2KACA 3EECA 4BAXA 3UQAA 2UU7A 3A9JA 2UWQA 3HM3A 3APCA 1MJDA 1VZ7A 4P1CC 3QC8B 3IG3A 2H89B 2XBBC 3DWGC 1C78A 2XN9C 1XF5L 1AWDA 4ANWA 1C77A 1X1MA 3EHVA 4H2AA 3PGEA 4W9CA 4WURA 2C7MB 1SJHD 2G4SA 4TV3A 3ZJUA 1WR1A 3BZDB 2KMMA 2O2VA 2O6VB 4JIOU 4IM0A 1WE7A 4GDKB 4FJVB 3IT4B 1WX8A 4RH6A 1UGJA 1L0VB 2IGDA 2V4LA 3H8HA 3LXFA 3V05A 4ZRIA 3R7QA 3TEWA 1LFDA 1Q5WB 2DYMA 3DBSA 2M17A 1GG3A 2LJ5A 1QQRA 2WDVB 5GXGB 1DGJA 1M94A 3RZWC 3U7ZA 2AYOB 2V9HA 3BWUD 1D5XC 1OEYA 2YVCA 2C60A 2BS4B 2GMIC 3VH3B 2KX3A 2KFJA 2D3GA 4B6WA 4OVVA 1YJ1A 4HK2A 3DHHC 2JXXA 4MM3A 1Z5SB 1JWAD 2GI9A 2X8XX 3CF6E 4KX6B 2BS2B 1UELA 4A3PA 2WXFA 1NI2A 3B9JA 1HZ6A 2MBOA 5TSSA 1IPGA 1UNSA 2KDIA 1OQRA 3BVZA 5FKAC 1VJKA 2WU2B 3NVVA 4ICVA 2GBJA 4EZJA 2WXJA 1I4GA 2D07B 3A4SC 2IPKD 1EM7A 3BVGA 2DZKA 1L2NA 3W1SA 3U8ZA 4OVUA 4BOSC 1WGHA 4DWFA 1N5XA 1EU4A 2FCNA 3B0AA 3MJ5A 1XCQL 4AOFA 2MJDA 4KZCA 3DVNU 2C7HA 3Q8BA 3QK0A 3UIOB 1SB3C 1WXQA 1D5ZC 4E74A 4FA6A 2D11A 4XYCA 5DPSA 2DHZA 1E6EB 1ET6A 3AE3B 1H4RA 4ARCA 2I1KA 1D3ZA 2KFKB 4URKA 2AL3A 4OW0A 5CTRC 3VRAB 2D5GA 2NPTB 2WXRA 2M1MA 2VH1A 3ZVVA 4KGRA 2BWES 2RSUA 2KJ6A 4W9FA 4ANXA 3VUYA 1NI3A 1C4AA 4GDLA 1I4QA 1TS4A 1R4NB 4LJPB 3VUWA 2J42A 2V4IB 2MLBA 2QCZA 3Q2AC 3DWMA 4HDOA 2KN5A 3AE6B 3N30A 2N9KA 5BMGA 4BBNF 4PT5A 1WRIA 3N20C 4WJQA 3DVNV 1WZ0A 3FILA 1YJJA 1UWMA 2HTME 2LEKA 1L0YB 2M0AA 3AU4A 5EE0A 1JWUD 2EKEC 2PE6B 4LDTD 3R3MA 2LD9A 1V9JA 2BB6A 5D3DA 1WXSA 4P1BC 3AE5B 1FCLA 2EMSA 1RRBA 2KTFA 3ZXRA 2QC8A 1E9MA 4BKTA 3R2IA 4US8A 2IZVB 2LHEA 4FJYA 1U4AA 2L32A 1HTOA 1WSPA 2AEHA 3CSTA 4LJOB 2GBRA 3IAS1 5C3JB 3N32A 1K50A 1I35A 3R2TA 1KF6B 1MPEA 1HQRD 1SBBB 5E6PA 2KDFB 2GBNA 1C9FA 2WXPA 4HJKA 3PHWB 4AQ7A 1ENFA 1YQBA 5LNK1 4XWTA 3VFKA 2WX1A 4M8NA 2JYEA 4QAYA 2J0MA 5G5HA 4GMVA 1V81A 4EZKA 3DDCB 2KQSA 2MBQA 4CHKA 2KLGA 3HRDD 3ZKJC 3OJ4B 1LXDA 3PZDA 4DQOC 4YL8A 1YQ3B 1VZ8A 3K9OB 1STEA 4C7YA 1EWYC 4EE2A 2IO0B 2PVGC 4OZCA 2NBWB 2N7DA 2IDYA 4DHJD 2IO2B 3IAM1 4HWIB 2NTSA 2ZEQA 1QOAA 1PQSA 2MBHA 3ABVB 1IYFA 1NVID 3HVDA 4MGZE 3TJPA 2KANA 3GOEA 1K53A 3PVLA 4C56C 2X38A 2C9WB 4XWWA 4F8CB 4MH8A 2PE9A 1WY8A 3AE1B 4S0RA 3PLVA 1UD7A 4HKZE 2BPSA 2QILA 1L6VA 5AEKB 1E7VA 4AJWA 2JT4B 4WJPA 4S17A 3T9LA 5EDSA 3DBLI 3IBEA 3DCGA 1GOZA 3EC8A 2SEBD 4K7WA 2K1FA 1V1PA 4ZHOA 3OLMD 4ANUA 1PGBA 3RPFC 4K7UA 3ZYYX 1EU3A 5AUIA 3ZXVA 2IBIB 3SEBA 1FXAA 1UH6A 1WJ4A 3H7PA 3VVWB 2MWSB 4BZAA 2K3UA 4WWPA 1VCBA 5J18A 3DBRI 1ZE3D 1UWXA 4RM8A 4N9F4 4W9HA 2NVUI 1HEZE 3NVZA 3MC8A 2J0KA 2LMCA 4RGMA 4O1NA 1JQ4A 1RAXA 5HKHA 3KUDB 1F2RI 1ROEA 3DVGX 3W1YA 1WX7A 2CS4A 3MJWA 1WJNA 3Q3MC 2LI5A 4BKGA 2I2YA 2N9XA 1Q10A 4HXDA 4B0MA 2ICIA 2MSED 2MCNB 2L8JA 4OVZA 2KMCA 3QIJA 3TSSA 4A9AA 1L4DB 2MJ3A 1MFWA 1FXTB 2ZVOA 2BKFA 3QAQA 3IT6B 4KZ0A 3VQIA 3KYDD 4ANVA 4EUTA 4RF1A 3O13A 3RT3B 1LO5D 3TEYA 5T8IA 1J7AA 3RNFC 2KK8A 1FPYA 4WQOB 2IO1B 4I6PA 1XD3B 3Q6BA 4NQLB 3QWZB 1TY0A 4W9JA 2JWUA 1TYGB 2W3RA 3PSEB 3WAOA 1ESFA 1SEBD 3JSVB 2LGXA 2IY0B 4M01A 1J8CA 2KAJA 5J17A 4ARIA 1WXAA 2NTTA 4MELA 1FD6A 2N1VA 4LLGM 1IP9A 2PLPA 3AEGB 2L0TA 2BW2A 1SJED 4BOZB 5IO9A 3ZRCA 5C23A 3PZ7A 4Q2JA 3N3KB 2LFIA 1D4BA 3U2SC 3U52E 1L5PA 1V49A 2XK5B 1AARA 4MJSB 1YN4A 4GN1A 2OJRA 5BMHA 3IVFA 2PKOA 3X23A 1DOXA 5CHVC 4LNOA 2GOWA 1YNTE 4HLEA 1GC6A 3HIZA 2KJRA 4A55A 3A1QA 2KVRA 2MW5A 2ZCBA 4RF0A 3BY4B 1J0GA 1E8ZA 2NMQA 1P0RA 3TIXA 1WJUA 1ZDVA 2JUOA 3UIPB 3IFWB 2QDFA 3P4QB 4RM9A 1EF1A 3MHZA 1OTRB 2LVQA 3LB8C 1VRAB 1E7PB 1XQQA 2FIFA 2KDBA 2W9NA 3AXCA 5KHQA 4BKSA 5IP4D 4MGYE 2I38A 4AS1A 4RCOA 3PHXB 3AEEB 3TL5A 1NEKB 5IN7A 2BBCA 1XLPA 5DCNA 3ALBA 3W2DA 2L83A 3ZTDA 4A3OA 1JW9D 3KW5B 2ZZPB 3DBLB 4XGAB 4W9DA 1UZXB 3L10B 4HVBA 2GBMA 2MP2B 2FCSA 4P16A 1HZ5A 4WQMA 1FNUA 1KLVA 4EKUA 3Q3OC 1FCCC 3PRMB 2JU6X 1V1OA 2QJLA 1IBXA 4YTPB 4LTUA 2KOXA 4RGOS 2BYVE 3QA8A 1WWTA 1VD2A 4US9A 2WXIA 2BT6A 1R4MI 1QOFA 4JQWC 2CHXA 4K7SA 3AE4B 2BYEA 1ET9A 2K22A 3K9PB 3DBRB 1R7SA 4W9KA 1OFFA 5HFYA 2KQ4X 3HM6X 4LCDE 1J19A 3HK0A 3KVFB 3DHGC 3H9DA 4N59A 2KWDA 2MA9B 2L52A 3T3NA 5C2TB 2ZPNA 4M0WA 1V97A 3PPAA 2R2OA 2PMVA 4IM2A 1UGMA 1HA5A 1JROA 3V62A 4F7ZA 2E3TA 3ZJVA 4GOCA 3JSVA 1I4XA 2UYZB 3B08A 2KD0A 2OJWA 3MFGA 2MHJA 2LGIA 2MX2A 5JXVA 1PFDA 2D10A 2GBKA 1E8YA 3BYYB 2KTRB 1XCTL 2FCMA 4YTNB 3V60A 3WAMA 1V5TA 2PVOD 2WXHA 1I4RA 2L05A 3URYA 2OEDA 4XDCA 4II2B 1A70A 2OHFA 3A4RA 4WWNA 1WMHB 2VZKD 2XK5A 3EFCA 4RMAA 1DOIA 2LGYA 4NY0A 1UF0A 4KIKA 1VDVA 1WX9A 3AI5A 4PS3A 2JPHA 1N6ZA 1YN5A 2BB5A 4OZBA 3NY5A 1FRRA 4WWMA 4ASWC 3WAPA 4C4VB 5FR6A 1CZPA 2IGGA 1MG4A 1DYQA 4W9LA 4TKNA 3B1LX 4WH4A 1KOTA 5E6JA 1F0ZA 5G5GA 4XZ4A 1GB1A 2WXLA 3P1MA 2FCQA 1E7UA 3SFDB 3AN1A 3WANA 5IAAC 1GAQB 1PGAA 2JY6A 1Z2MA 4YSYB 5D2MB 3U7DA 2AQ1B 3VRBB 2DENB 4F1SA 3QX1A 1QKZA 2J7QB 5EE9A 1CQVA 4NQKE 5JHAA 3ZNGC 1WGGA 4FN2A 4KGTA 2IJ0A 1KLUD 1P98A 2INDC 4LNFA 3ZQ4A 4XDDA 4L23A 2QEJC 1Y8RC 2WYQA 3NS8A 2BKRB 4CO7A 1MHHE 4NAWA 4J3OD 1I4PA 2WHIA 3NG0A 5BYSA 1AW7A 1KJTA 5DPRA 2D2QA 4AWJA 1TIFA 1SXTA 4CYEA 4W9EA 1IGDA 2KO3A 3DQVA 3ZTCA 1WGDA 2WLBA 3AULA 3GZNI 1WM2A 2PTLA 1TS2A 2J53A 3IXSA 3VHTC 4MGKE 2HJ8A 1T0SC 2O6VA 1SIFA 4IM3A 3ZLZA 4GDKA 2A4ZA 2FIDA 2VH2A 1YX6B 3AV8A 3BK2A 2N7EA 4NNJB 3MP9A 3PRPB 1P3QU 4K81A 1FNVA 1UBIA 2WQYB 3ZRFA 3TEZA 3T3OA 3H6NA 1RWSA 3ZIMA 3J9CA 1XT9B 2Y5CA 3GE8C 3ENEA 3BVMA 3RNEC 3W5VB 3RNAC 1OQQA 2HTHA 2Z0DB 3AMZA 3VAWA 4RFBA 2CHWA 3VTWA 2YLMA 1ZW7A 1Q0WB 4HROA 4BKSD 4I6NB 2NCNA 2JWZA 2W55A 2AQ2B 3ZNZB 1JCKB 2G4DB 2KKCA 5CHFA 4IWQA 2KYWA 1KTKA 2OOBB 3ZDTA 1SE9A 2JVCA 1TT5B 3T8MA 1QILA 1QF6A 1JWSD 3A33B 1ZDXA 2YEPF 2GLSA 3C8YA 2ACZB 4HJGE 2AQ3B 2FAZA 3GS2A 1TKEA 4KVGB 2IO3B 3I3TB 3DVGY 3MC9A 2L3ZA 1VZ6A 4YT0B 5GMVA 2PIAA 2LUEA 3AB5A 3MC0B 1XO3A 2QSDA 5E6NA 4IOIE 1GB4A 3N1XC 4C4VA 1BT0A 1WM3A 4LNNA 1YQ4B 1V5OA 4P6VF 4RGNA 4GSWA 5BO4B 3AEBB 2WXOA 2Q5WD 3NZSA 1F1HA 3AE7B 2KFKA 2ZCCA 4RNAA 1T0RC 1RLFA 1SGHA 5HHDG 2NPTA 2RD0A 4LDTB 5C1ZA 5MPOA 2INPE 4IWPA 3UF8A 1JWMD 2J0JA 4KDLB 2INCC 2FBWB 3N1YC 3ONSA 4PK1A 2MBBB 4YWGG 4ZHPA 3A9KB 4MEMA 2Z8LA 3WIMA 2ZW0A 5BYRA 4WJNA 1C76A 4IWOA 2LHDA 5KHOA 2Y3AA 5EE1A 1I4HA 3KH0A 4MACA 1AN8A 2BYFA 2KT7A 3ECIA 2HD5B 2KN4A 2L1AA 3R8BA 3RZFA 1KH0A 4E3CA 1JALA 1L0XB 2IYDB 2Z0EB 1WF9A 5IA7A 2GB1A 2V0GA 3TBLD 3PLUA 2FE8A 3VUXA 3AEAB 4FHKA 1SE2A 2K8HA 3OAWA 2RDHA 4NJ7A 3E56A 2CJNA 1UUPA 2JX5A 3A9JB 3TEXA 3AEDB 1QT9A 3L16A 4B95A 2TSSA 1WR6E 4ZRPA 1TJEA 1KLGD 3OG5A 4USAA 4L2YA 4YSXB 5E6OA 1ISNA 4KSKC 2O2VB 4DHJB 1UBQA 3M95A 4DXGA 2PPHA 3PTFC 4KGSA 4PYZA 4ZYSA 2MEKA 4C00A 3V3XA 2JZZA 1TZOA 4GXBA 3V6CB 3TCAA 1V6EA 2WS3B 1SE4A 1ZUD2 3E9SA 3PRZA 1E0ZA 5H92C 4ICUA 4A20A 3ZJTA 1AYFA 1OQYA 3EA6A 4FLHA 3AU5A 5FR3A 4TQ0A 1LQBA 2KVZA 3P63A 1YN3A 4JGHB 2MBEA 4WWOA 1YMHE 1S3SG 1G6JA 2E6XA 1PYWD 2MH7A 2BYTA 1DOYA 4JL9A 4MM3B 2LUMA 2WP9B 1D5MC 3IHPC 2WDRB 1EUVB 3NOBA 2N1WA 3P4SB 2O6VD 5JZEB 2LJIA 1C79A 1VLBA 4EEWA 1I7HA 2BS3B 1C1YB 4IUMB 4HKQA 2L7RA 4B0EA 5L83A 2WXGA 2K39A 4TMAB 5D94A 2ZPYA 1BMLC 4II3B 4YTMB 1WYGA 4C80A 4NZLB 3PT2B 3VXWA 2KC1A 2BWFA 4NPNA 4K1RB 3RULA 2LRWA 3V6EB 4M8MA 3I63C 4YXDB 3KWLA 1WRDB 3ZDMC 3Q8CA 3P42A 1R4NI 3VR9B 3CMMB 2DYOA 4MT5A 3UQBA 2KWUB 5HG2A 1P1AA 4HCNB 4BBNC 4PS8A 2EKIA 3D32A 4TQ1A 2K0PA 4W9GA 1GNUA 3HHMA 5L95C 2D3AA 4L1BA 1TS3A 2BGFA 1QOBA 3SR6A 1ZPSA 2FUHB 4REZA 2WGSA 4XX5A 5JHBA 4J6IA 1CJEA 3L08A 3RNCC 2Z59B 4A6QA 1KM7A 2K9XA 1RYJA 2JRIB 5DPWA 1BUIC 2B76B 1I42A 2BF8B 3L0WB 4G50A 2LZ6A 1QOGA 1VR9A 4FBJB 3NJTA 3LDZE 4KSLC 4G3XB 2G3QB 4AP4C 4FULA 2LVOA 5AZHA 3VH4B 3FILB 2V3NA 2CHZA 2L76A 4DXAB 4EOYA 2DAJA 4MSMB 2CKHB 2R61A 3QARA 2AWTA 2K25A 1FMAD 1HTQA 5H8YE 2QIEB 5IOIA 1P7FA 3NVWA 3P4RB 2D3CA 1A5RA 2RDBC 4ZOHC 1M4VA 1QLBB 2NR2A 2H88B 2JZPA 1GPXA 2Y5PA 1Y56A 1N5WA 1C3TA 5G2NA 5AUKA 4DHZE 4EZLA 5JH5C 1NDDA 1WGYA 4G11A 5J2RA 3S2AA 3Q69A 3PS6A 3NZUA 1F9JA 4FXCA 4E71A 4K3CA 1E10A 1YOVB 1XEEA 1WGRA 4IG7B 3M63B 4IKGA 2QMTA 3GB1A 4C7ZA 2INNE 2WXMA 4A90A 1NYRA 3QCAA 2KQ7A 3L13A 3L4PA 3R66C 4KKIA 1HE8A 2WDTB 2CR5A 4BVUC 3PV1A 3M62B 2WNMA 1BXTA 3DOWA 4OHJA 2M0XA 4IDIA 2RGFA 4MJSA 3H7SA 1JRUA 1RFKA 3Q3NC 1WGKA 1PDXA 2JXTA 4M02A 4MH0E 1ZP0B 1FRDA 4ITKA 4JLCA 3AM9A 2W54A 3L54A 2C7NB 2V3SA 3ZNHB 1LM8B 2M56B 4DK5A 1N60A 3QHTA 3X0WA
chains in the Genus database with same CATH topology
2ICIA 4OVZA 3TSSA 4A9AA 1L4DB 1QILA 2MJ3A 1QF6A 1C4PA 1MVKA 2RMMA 1JMLA 3PO0A 1JWSD 2KDMA 1ZDXA 4NAWB 2YEPF 3C8YA 3NS1A 2ACZB 3IT6B 4HJGE 3VQIA 2XNAC 2AQ3B 4ZRQA 3CIRB 1N61A 3GS2A 2KACA 1TKEA 4RF1A 2PW9A 3FC4A 3O13A 1LO5D 3TEYA 1D6EC 5T8IA 1J7AA 1T6BX 1VZ6A 4YT0B 1VZ7A 4CQNA 2PIAA 2BTEA 2H89B 3DWGC 3AB5A 3MC0B 1C78A 1XO3A 2QSDA 2XN9C 4IOIE 2K5PA 1XF5L 1AWDA 1TY0A 2N0SB 3OWEB 2DWQA 1C77A 2JWUA 4H2AA 1GB4A 1TYGB 2W3RA 1ESFA 3B2GA 4WURA 1SEBD 1NENB 1SJHD 3ZJUA 1YQ4B 3BZDB 4P6VF 2KMMA 4JWSC 4RGNA 2KAJA 2WXQA 3U4EG 3AE2B 1TKYA 3AEBB 2WXOA 2Q5WD 1ZXIA 3AE7B 1KFYB 4ARIA 1V1PB 3BIID 4GDKB 4RNAA 3FAHA 2NTTA 3IT4B 5HHDG 4RH6A 1FD6A 1UGJA 4LLGM 1L0VB 1N63A 5MPOA 2INPE 2IGDA 3H8HA 1K52A 2PLPA 3LXFA 3V05A 3AEGB 2BW2A 3TEWA 1JWMD 1SJED 2DYMA 2WXNA 2JYTA 1J7BA 3CWIA 1YJIA 3ETRA 3PZ7A 2FBWB 4Q2JA 1QQRA 2WDVB 5GXGB 1DGJA 2LFIA 1D4BA 3U2SC 1TKGA 4YWGG 1B9RA 3U52E 3U7ZA 1L5PA 4ZHPA 3BWUD 1D5XC 1YN4A 1FNWA 2EELA 2BS4B 2Z8LA 5BMHA 4JE3B 2PKOA 2ZW0A 2ZW1A 3RFZB 1DOXA 5BYRA 1C76A 1K51A 5HI1A 2VZKB 1PUTA 2LHDA 1YNTE 1N62A 3BYTB 2Y3AA 4A55A 5EE1A 1I4HA 1JWAD 2IGHA 1ACCA 4MACA 2GI9A 4KX6B 1AN8A 1MI0A 2BS2B 2KN4A 3R8BA 2L1AA 1KH0A 4RF0A 1JALA 2WXFA 1L0XB 3NUHB 3B9JA 1HZ6A 1L6UA 2GB1A 2NMQA 5TSSA 2V0GA 1UNSA 1ZDVA 1OQRA 3BVZA 5FKAC 1VJKA 2WU2B 3NVVA 2FE8A 3AEAB 1SE2A 2WXJA 4WAFA 3P4QB 1I4GA 3EUB2 2IPKD 2RDHA 2RDGA 3MHZA 3NRZA 1EM7A 3E56A 1XLNA 1ZOYB 3BVGA 3LB8C 2CJNA 1VRAB 1FFVA 1UUPA 1E7PB 2JX5A 3W1SA 3TEXA 3AEDB 1N5XA 1EU4A 1QT9A 3MJ5A 1SF0A 1XCQL 2MJDA 2TSSA 4ZRPA 1TJEA 1XLQA 1KLGD 2DBYA 3Q8BA 3W9CB 2I38A 4USAA 4L2YA 4AS1A 4YSXB 1SB3C 1WXQA 1D5ZC 1FFUA 4RCOA 1KRHA 3AEEB 1NEKB 4XE0A 1IGCA 2BBCA 1XLPA 1V8CA 1E6EB 1ET6A 2RPVA 3AE3B 3W2DA 5D3IB 4ARCA 2L83A 4DXGA 3Q8EA 1RM6C 4LK0M 1JW9D 1JRPA 3EGRA 1TY2A 4KGSA 4ZYSA 1FO4A 2MEKA 4OW0A 3VRAB 3V3XA 1J7CA 1TZOA 2D5GA 2ON8A 4N58A 4P16A 1F2RC 2WXRA 1HZ5A 2HDEA 4WQMA 1FNUA 3AEFB 4KGRA 1FCCC 3BK1A 1C4CA 2JU6X 3W5UB 2WS3B 1V1OA 1SE4A 1ZUD2 1T3QA 2QJLA 3E9SA 1IBXA 1NI3A 1C4AA 4YTPB 4LTUA 4RGOS 5H92C 1E0ZA 3ZJTA 1AYFA 1I4QA 1WWTA 3AE8B 4US9A 1TS4A 2WXIA 3EA6A 2BT6A 4JPSA 4JWUC 5FR3A 1NYQA 1QOFA 4TQ0A 3AE4B 1XLOA 3P63A 1YN3A 1ET9A 2J42A 2V4IB 2K22A 1R7SA 1YMHE 3DWMA 1OFFA 1XXGA 5HFYA 1P7EA 2KQ4X 2E6XA 4UDUC 1PYWD 3AE6B 2N9KA 2MH7A 4N59A 5BMGA 2BYTA 2KWDA 1DOYA 1F77A 4WIPA 4PT5A 1JWBD 1WRIA 4MM3B 2LUMA 2L52A 3T3NA 2WP9B 5C2TB 2WU5B 1D5MC 1PGXA 1V97A 2WDRB 4M0WA 2PMVA 3P4SB 3FILA 2ONQA 3AECB 2LJIA 2V3PA 1HA5A 1YJJA 1JROA 1UWMA 2HTME 2LEKA 1L0YB 1C79A 1VLBA 2E3TA 2M0AA 1I7HA 2BS3B 5EE0A 1JWUD 3ZJVA 3I57A 1I4XA 5I4DA 4HKQA 2W3SA 2CJOA 4B0EA 1CK1A 3MFGA 2WXGA 4TMAB 2LGIA 3PZ8A 2BB6A 5JXVA 1BMLC 1PFDA 5D3DA 4YTMB 1WYGA 4C80A 4NZLB 3AE5B 1L4ZB 3BYYB 5D7GA 1SIJA 1XCTL 1FCLA 4YTNB 1FEHA 1E9MA 2PVOD 2WXHA 4YXDB 3KWLA 1I4RA 3P4PB 4N6EB 3Q8CA 3P42A 3R2IA 4US8A 2LHEA 3URYA 2OEDA 4XDCA 3VR9B 4MT5A 1FIQA 2DYOA 2FUG1 2J4XA 1A70A 2OHFA 5HG2A 2L32A 2YEPB 5EE3A 1WSPA 2VZKD 3IAS1 5C3JB 4R3DA 4GLSC 1K50A 1DOIA 2EKIA 3R2TA 5BYQA 2JSVX 4TQ1A 2K0PA 1KF6B 1MPEA 1VDVA 1FXIA 4L1BA 1TS3A 1YN5A 2BB5A 1HQRD 1QOBA 1SBBB 4OZAA 3SR6A 3TUOA 4OZBA 1FRRA 4NJCA 4WWMA 2GRIA 4D2KA 1ZPSA 1C9FA 1CZPA 2J52A 2IGGA 4REZA 1IBXB 2WXPA 3AE9B 1DYQA 1CJEA 2MJEA 4JX1C 3Q8AA 4AQ7A 1ENFA 4A6QA 5LNK1 4WH4A 4XWTA 2K9XA 5E6JA 1F0ZA 1HXYD 1RYJA 5G5GA 2JYEA 1GB1A 2WXLA 3P1MA 1BUIC 2B76B 3B2FA 5G5HA 3SFDB 2SAKA 3AN1A 1QOGA 1GAQB 1VR9A 3GP7A 3HRDD 1PGAA 4DQOC 4YSYB 4DXFA 3HVZA 1ZXHA 2AQ1B 3VRBB 1YQ3B 4TSSA 1QKZA 1VZ8A 5EE9A 1CQVA 3KLSX 3LYYA 1STEA 4C7YA 1EWYC 4EE2A 3N9YC 2W82A 4KGTA 2IJ0A 1KLUD 2PVGC 4OZCA 3ZQ4A 2IDYA 1FM0D 4XDDA 3FILB 3HUIA 3IAM1 4L23A 2V3NA 2NTSA 2QEJC 1QOAA 5BMIA 3ABVB 1MHHE 1NVID 3HVDA 4J3OD 2CU3A 2R61A 1I4PA 4C56C 1K53A 2M19A 2JQRB 5BYSA 2X38A 4KKJA 1AW7A 3VR8B 1FMAD 5H8YE 4XWWA 4MH8A 2QIEB 3ZGZA 3AE1B 1P7FA 3NVWA 3P4RB 1SXTA 3WCQA 2AX5A 2G1EA 4A8XC 1IGDA 4YSZB 4ZOHC 2WLBA 4HEA1 1M4VA 3AH7A 4HKZE 2QILA 1L6VA 1QLBB 2N7JA 2PTLA 3UI3A 2H88B 1TS2A 2J53A 2JZPA 3IXSA 1GPXA 1IUEA 2Y5PA 1Y56A 1N5WA 5AUKA 1EWCA 4NAMA 1B1ZA 3KQ4A 1GOZA 3Q69A 2SEBD 4FXCA 1E10A 3NVYA 4ZHOA 1V1PA 1XEEA 3BK2A 3AV8A 1PGBA 3RPFC 3MP9A 3ZYYX 1EU3A 5AUIA 4IKGA 2G9HD 2QMTA 3SEBA 1FXAA 3GB1A 4C7ZA 2INNE 1FNVA 5FK9C 2WXMA 2WQYB 1MHXA 3KWVA 4A90A 2K3UA 1NYRA 3TEZA 3T3OA 3L4PA 3I9V1 4KKIA 1RWSA 1ZE3D 4HRSA 1UWXA 3J9CA 2WNMA 2Y5CA 1BXTA 3Q8FA 2DLBA 2WXKA 3BVMA 4RGTA 1HEZE 3NVZA 4OHJA 4IDIA 2LMCA 4RGMA 4O1NA 3W5VB 1TS5A 1RFKA 1OQQA 1WGKA 1PDXA 3AMZA 2JXTA 1JQ4A 4RFBA 2WDQB 1ZP0B 4HROA 1F2RI 1FRDA 1ROEA 4ITKA 3NZ3A 1SE3A 3AM9A 2W55A 2W54A 2AQ2B 3SFEB 1JCKB 1T5XD 2N9LA 2M56B 2I2YA 1KTKA 4GDLB 1N60A 1SSNA 1Q10A 4B0MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJJ A;  1JRO A;  1UWM A;  2HTM E;  2LEK A;  1JAL A;  1VLB A;  4A9A A;  1QOA A;  2E3T A;  1I7H A;  2BS3 B;  2MJ3 A;  3B9J A;  1L6U A;  5EE0 A;  1QF6 A;  3ABV B;  3PO0 A;  1OQR A;  1NVI D;  1VJK A;  2WU2 B;  3NVV A;  2W3S A;  2CJO A;  2CU3 A;  3AEA B;  3NS1 A;  2ACZ B;  2M19 A;  3P4Q B;  2JQR B;  3EUB 2;  3NRZ A;  3CIR B;  1N61 A;  1PFD A;  1TKE A;  4YTM B;  1XLN A;  1FMA D;  1ZOY B;  1WYG A;  2CJN A;  3FC4 A;  1FFV A;  3LB8 C;  5H8Y E;  3VR8 B;  4C80 A;  2QIE B;  1E7P B;  2JX5 A;  3AE1 B;  3AE5 B;  1J7A A;  3NVW A;  3P4R B;  4YT0 B;  2PIA A;  3WCQ A;  1SIJ A;  1N5X A;  2AX5 A;  2G1E A;  2H89 B;  3AB5 A;  3AED B;  3DWG C;  1XO3 A;  4YTN B;  4ZOH C;  4YSZ B;  1QT9 A;  2K5P A;  2WLB A;  1AWD A;  1SF0 A;  1E9M A;  2N0S B;  2MJD A;  2DWQ A;  2PVO D;  1L6V A;  3AH7 A;  3KWL A;  1QLB B;  4YXD B;  1TYG B;  1TJE A;  1XLQ A;  2H88 B;  2W3R A;  1GPX A;  1IUE A;  3B2G A;  2DBY A;  3P4P B;  4N6E B;  3W9C B;  4US8 A;  1NEN B;  4USA A;  1N5W A;  5AUK A;  3VR9 B;  4YSX B;  1FIQ A;  1SB3 C;  1WXQ A;  1FFU A;  1KRH A;  1YQ4 B;  3AEE B;  1A70 A;  2OHF A;  4P6V F;  1NEK B;  2KMM A;  4JWS C;  5EE3 A;  1XLP A;  1V8C A;  1E6E B;  2KAJ A;  4FXC A;  3AE3 B;  3AE2 B;  1TKY A;  2L83 A;  3AEB B;  5C3J B;  1E10 A;  1RM6 C;  2Q5W D;  3NVY A;  1ZXI A;  4ZHO A;  3AE7 B;  1JW9 D;  1KFY B;  1JRP A;  3BII D;  1DOI A;  2EKI A;  1FO4 A;  3AV8 A;  3FAH A;  3RPF C;  3VRA B;  1J7C A;  4N58 A;  3ZYY X;  1L0V B;  1KF6 B;  5AUI A;  1N63 A;  5MPO A;  4WQM A;  1VDV A;  3AEF B;  1FXA A;  1FXI A;  3LXF A;  4C7Z A;  3AEG B;  2BS2 B;  2WQY B;  1QOB A;  3W5U B;  2WS3 B;  3SR6 A;  1NYR A;  2QJL A;  1FRR A;  1T3Q A;  1ZUD 2;  4WWM A;  1J7B A;  3L4P A;  1NI3 A;  1CZP A;  3CWI A;  4YTP B;  1RWS A;  4LTU A;  1YJI A;  3ETR A;  3AE9 B;  4HRS A;  2FBW B;  1CJE A;  2MJE A;  5H92 C;  4JX1 C;  1E0Z A;  2WDV B;  2Y5C A;  5GXG B;  1AYF A;  1WWT A;  3AE8 B;  4US9 A;  1DGJ A;  2BT6 A;  1TKG A;  2K9X A;  4JWU C;  1B9R A;  1F0Z A;  1NYQ A;  1L5P A;  1QOF A;  1RYJ A;  3NVZ A;  4IDI A;  3AE4 B;  5G5G A;  4ZHP A;  3P1M A;  1XLO A;  3P63 A;  2B76 B;  3B2F A;  2K22 A;  3W5V B;  5G5H A;  1R7S A;  3SFD B;  3AN1 A;  2BS4 B;  1QOG A;  1OQQ A;  1RFK A;  3DWM A;  1OFF A;  1WGK A;  1GAQ B;  1PDX A;  3AMZ A;  1JQ4 A;  2PKO A;  2WDQ B;  3HRD D;  3AE6 B;  1DOX A;  1ZP0 B;  4HRO A;  4YSY B;  1ROE A;  1FRD A;  3HVZ A;  2MH7 A;  4ITK A;  4N59 A;  3VRB B;  1YQ3 B;  1DOY A;  3AM9 A;  2W55 A;  1PUT A;  2W54 A;  5EE9 A;  1JWB D;  1N62 A;  1WRI A;  3SFE B;  2L52 A;  4C7Y A;  1EWY C;  2WP9 B;  5C2T B;  2M56 B;  1V97 A;  2WU5 B;  2WDR B;  5EE1 A;  1JWA D;  1N60 A;  2PVG C;  3P4S B;  4KX6 B;  1FM0 D;  3AEC B;  3HUI A; 
#chains in the Genus database with same CATH topology
 1OGW A;  2A5U A;  2LRU A;  1C4P A;  2K6D B;  3NS1 A;  2JRH A;  4ZRQ A;  3P2B A;  2WX0 A;  4WJO A;  4GGQ A;  2KMA A;  2PW9 A;  3FC4 A;  4HPM B;  2N9E B;  3BIN A;  1D6E C;  3DPD A;  1T6B X;  3V61 A;  4CQN A;  2KNB A;  2BTE A;  1GC7 A;  2K5P A;  2N0S B;  3OWE B;  2LXC A;  2DWQ A;  3B2G A;  2KX0 A;  1NEN B;  1WFY A;  2L0F A;  4JWS C;  1T0Y A;  2WXQ A;  3U4E G;  2JZ3 B;  3AE2 B;  1TKY A;  5IKC M;  1WE6 A;  1ZXI A;  3TMP B;  1KFY B;  5TR5 A;  1V1P B;  3BII D;  1CMX B;  4MGI E;  2MP2 A;  1E90 A;  3FAH A;  3ZW3 A;  1T0Q C;  3W1S C;  1N63 A;  3ML9 A;  3SD5 A;  1S1Q B;  1K52 A;  1WYW B;  1EO6 A;  3H7P B;  2WXN A;  2XEW A;  1LGR A;  2JYT A;  2LAS A;  2LWP A;  1J7B A;  3DBH I;  4KV2 A;  3CWI A;  3RUI B;  1YJI A;  3ETR A;  2L00 B;  1YX5 B;  1TKG A;  1Q1O A;  1B9R A;  3U30 A;  4HPP A;  4K3B A;  1FNW A;  2EEL A;  2BQQ A;  3RMK C;  4JE3 B;  2ZW1 A;  3RFZ B;  3Q3J A;  4GB9 A;  2V1Y A;  2NBU A;  2R2Q A;  4FJZ A;  1K51 A;  5HI1 A;  2VZK B;  1PUT A;  1N62 A;  2K8C A;  3BYT B;  1TTN A;  5LLI A;  3KUZ A;  2IGH A;  1ACC A;  1MI0 A;  4W9I A;  3NUH B;  1L6U A;  3DHI C;  2C5L C;  1R4M B;  4WAF A;  3QQ8 B;  3EUB 2;  2RDG A;  3NRZ A;  4IW0 A;  4FAD A;  1XLN A;  1ZOY B;  1FFV A;  2NBV B;  2KTR A;  4ZRK A;  2D3B A;  1SF0 A;  4XC2 A;  4ZDV A;  2AL6 A;  4PS7 A;  1XLQ A;  1TGZ B;  2DBY A;  2PJH A;  1EF5 A;  3W9C B;  1H8C A;  1TBE A;  1WIA A;  1FFU A;  2LGD A;  1KRH A;  4IC7 B;  3WA0 A;  1WMH A;  4XE0 A;  1IGC A;  1WH3 A;  2LXA A;  1V8C A;  2RPV A;  3JW0 X;  2K8B A;  4TUU A;  5D3I B;  3UGB B;  3Q8E A;  1RM6 C;  3H1U A;  3PRE A;  4LK0 M;  2KDE B;  1JRP A;  3EGR A;  3ZO5 B;  3Q3F A;  1TY2 A;  3VTV A;  1FO4 A;  3WAL A;  3L17 A;  3APD A;  3OJ3 A;  1J7C A;  4N58 A;  1V2Y A;  1OEY J;  2ON8 A;  1F2R C;  2HDE A;  3AEF B;  2ZNV B;  3BK1 A;  1C4C A;  2NS5 A;  2ZJD A;  3W5U B;  5D6J B;  1T3Q A;  5G55 A;  2M4N A;  3VDZ A;  3AE8 B;  4MSQ B;  4JPS A;  4JWU C;  1NYQ A;  1WJ6 A;  3MHS D;  1XLO A;  2G45 B;  2BVC A;  4DBG A;  1XXG A;  1P7E A;  2KWV B;  4UDU C;  2MRP A;  3UIN B;  4WAA A;  1YD8 U;  1F77 A;  4WIP A;  4ZRJ A;  1JWB D;  3SU8 X;  2WU5 B;  1PGX A;  3RN9 C;  3A1Q B;  4KDI C;  2ONQ A;  3SHQ A;  3AEC B;  5LXH A;  2V3P A;  2B3A A;  3VTU A;  4FHJ A;  5AZG A;  3I57 A;  5I4D A;  3ZNI D;  2W3S A;  2CJO A;  3ML8 A;  5DPT A;  1CK1 A;  2N4F A;  3PZ8 A;  3RYT A;  4GIV A;  1L4Z B;  5D7G A;  4AJY B;  1WXM A;  1SIJ A;  1FEH A;  3RNB C;  1WI0 A;  5CX3 A;  4ACF A;  2DZM A;  3P4P B;  4N6E B;  1K8R B;  1FIQ A;  2FUG 1;  2J4X A;  2VRR B;  4HDQ A;  3RCZ A;  1WXV A;  2YEP B;  5EE3 A;  2CU1 A;  4R3D A;  4GLS C;  2Y5B B;  1NBF C;  5BYQ A;  2JSV X;  3MTN B;  4LNI A;  4GU2 A;  2KWC A;  2LVP A;  3JVZ X;  1FXI A;  2KHW B;  4OZA A;  3RI7 C;  3TUO A;  4PYU A;  2QHO A;  4NJC A;  3RNG C;  2GRI A;  4D2K A;  2J52 A;  1ZKH A;  1WZ3 A;  3GZN B;  4LNK A;  1IBX B;  3AE9 B;  2MJE A;  4JX1 C;  3Q8A A;  2WWZ A;  5CHW A;  1HXY D;  3DBH B;  3CSF A;  1MG8 A;  3B2F A;  1P9D U;  2SAK A;  3KUC B;  3GP7 A;  3APF A;  2KC2 A;  1YIW A;  4DXF A;  3HVZ A;  1ZXH A;  2DNF A;  4TSS A;  1GUA B;  1L7Y A;  3KLS X;  3LYY A;  3N9Y C;  2KLC A;  2W82 A;  4M0W B;  4P7I A;  2ASQ A;  2REX A;  1FM0 D;  2ZVN A;  3HUI A;  2LGS A;  3O65 B;  1V86 A;  3ZUN A;  4BFR A;  5BMI A;  3R7R A;  3KYC D;  3RD2 A;  2CU3 A;  2IY1 B;  2M19 A;  2JQR B;  2HE7 A;  4KKJ A;  5LXI B;  3VR8 B;  4G0N B;  1GJZ A;  3ZGZ A;  4B9K A;  3WCQ A;  2AX5 A;  2G1E A;  4A8X C;  4YSZ B;  3C0R B;  4HEA 1;  2RPQ A;  3AH7 A;  2N7J A;  3UI3 A;  2MQJ A;  1IUE A;  2DX5 B;  2DZI A;  2FNJ B;  4X57 B;  4HPL B;  1EWC A;  4NAM A;  1B1Z A;  3KQ4 A;  1V80 A;  1E8X A;  3N1Z C;  1F52 A;  2N9P C;  2KJH B;  3NVY A;  3SDL C;  4EFO A;  2K6Q A;  3EFU A;  3GE3 C;  2JF5 A;  4ZYN A;  2KZR A;  1QZE A;  2G9H D;  2KXJ A;  4KIK B;  3M3J A;  5FK9 C;  1RFA A;  4HCP B;  1MHX A;  3KWV A;  5AZF A;  2DYB A;  3I9V 1;  4HRS A;  4DDG D;  1E5W A;  3Q8F A;  2I1J A;  2DLB A;  2WXK A;  4RGT A;  3A9K A;  3QJZ A;  2PEA A;  2RR9 A;  1TZ1 A;  4NJ6 A;  1TS5 A;  2M8S A;  4I6L B;  2WDQ B;  3LJ3 A;  3Q14 C;  3JYU A;  3FKY A;  3NZ3 A;  1SE3 A;  2ZNV C;  4DDI D;  3SFE B;  2DAF A;  2EMT A;  1T5X D;  2N9L A;  2DZJ A;  4GDL B;  4MDK E;  1SSN A;  3C19 A;  4M00 A;  1MVK A;  2RMM A;  1JML A;  3PO0 A;  3NHE B;  2HJ1 A;  2KDM A;  4NAW B;  1E8W A;  1ZGU B;  3I5J C;  2XNA C;  4AUQ C;  4DHZ B;  3CIR B;  1N61 A;  2KAC A;  3EEC A;  4BAX A;  3UQA A;  2UU7 A;  3A9J A;  2UWQ A;  3HM3 A;  3APC A;  1MJD A;  1VZ7 A;  4P1C C;  3QC8 B;  3IG3 A;  2H89 B;  2XBB C;  3DWG C;  1C78 A;  2XN9 C;  1XF5 L;  1AWD A;  4ANW A;  1C77 A;  1X1M A;  3EHV A;  4H2A A;  3PGE A;  4W9C A;  4WUR A;  2C7M B;  1SJH D;  2G4S A;  4TV3 A;  3ZJU A;  1WR1 A;  3BZD B;  2KMM A;  2O2V A;  2O6V B;  4JIO U;  4IM0 A;  1WE7 A;  4GDK B;  4FJV B;  3IT4 B;  1WX8 A;  4RH6 A;  1UGJ A;  1L0V B;  2IGD A;  2V4L A;  3H8H A;  3LXF A;  3V05 A;  4ZRI A;  3R7Q A;  3TEW A;  1LFD A;  1Q5W B;  2DYM A;  3DBS A;  2M17 A;  1GG3 A;  2LJ5 A;  1QQR A;  2WDV B;  5GXG B;  1DGJ A;  1M94 A;  3RZW C;  3U7Z A;  2AYO B;  2V9H A;  3BWU D;  1D5X C;  1OEY A;  2YVC A;  2C60 A;  2BS4 B;  2GMI C;  3VH3 B;  2KX3 A;  2KFJ A;  2D3G A;  4B6W A;  4OVV A;  1YJ1 A;  4HK2 A;  3DHH C;  2JXX A;  4MM3 A;  1Z5S B;  1JWA D;  2GI9 A;  2X8X X;  3CF6 E;  4KX6 B;  2BS2 B;  1UEL A;  4A3P A;  2WXF A;  1NI2 A;  3B9J A;  1HZ6 A;  2MBO A;  5TSS A;  1IPG A;  1UNS A;  2KDI A;  1OQR A;  3BVZ A;  5FKA C;  1VJK A;  2WU2 B;  3NVV A;  4ICV A;  2GBJ A;  4EZJ A;  2WXJ A;  1I4G A;  2D07 B;  3A4S C;  2IPK D;  1EM7 A;  3BVG A;  2DZK A;  1L2N A;  3W1S A;  3U8Z A;  4OVU A;  4BOS C;  1WGH A;  4DWF A;  1N5X A;  1EU4 A;  2FCN A;  3B0A A;  3MJ5 A;  1XCQ L;  4AOF A;  2MJD A;  4KZC A;  3DVN U;  2C7H A;  3Q8B A;  3QK0 A;  3UIO B;  1SB3 C;  1WXQ A;  1D5Z C;  4E74 A;  4FA6 A;  2D11 A;  4XYC A;  5DPS A;  2DHZ A;  1E6E B;  1ET6 A;  3AE3 B;  1H4R A;  4ARC A;  2I1K A;  1D3Z A;  2KFK B;  4URK A;  2AL3 A;  4OW0 A;  5CTR C;  3VRA B;  2D5G A;  2NPT B;  2WXR A;  2M1M A;  2VH1 A;  3ZVV A;  4KGR A;  2BWE S;  2RSU A;  2KJ6 A;  4W9F A;  4ANX A;  3VUY A;  1NI3 A;  1C4A A;  4GDL A;  1I4Q A;  1TS4 A;  1R4N B;  4LJP B;  3VUW A;  2J42 A;  2V4I B;  2MLB A;  2QCZ A;  3Q2A C;  3DWM A;  4HDO A;  2KN5 A;  3AE6 B;  3N30 A;  2N9K A;  5BMG A;  4BBN F;  4PT5 A;  1WRI A;  3N20 C;  4WJQ A;  3DVN V;  1WZ0 A;  3FIL A;  1YJJ A;  1UWM A;  2HTM E;  2LEK A;  1L0Y B;  2M0A A;  3AU4 A;  5EE0 A;  1JWU D;  2EKE C;  2PE6 B;  4LDT D;  3R3M A;  2LD9 A;  1V9J A;  2BB6 A;  5D3D A;  1WXS A;  4P1B C;  3AE5 B;  1FCL A;  2EMS A;  1RRB A;  2KTF A;  3ZXR A;  2QC8 A;  1E9M A;  4BKT A;  3R2I A;  4US8 A;  2IZV B;  2LHE A;  4FJY A;  1U4A A;  2L32 A;  1HTO A;  1WSP A;  2AEH A;  3CST A;  4LJO B;  2GBR A;  3IAS 1;  5C3J B;  3N32 A;  1K50 A;  1I35 A;  3R2T A;  1KF6 B;  1MPE A;  1HQR D;  1SBB B;  5E6P A;  2KDF B;  2GBN A;  1C9F A;  2WXP A;  4HJK A;  3PHW B;  4AQ7 A;  1ENF A;  1YQB A;  5LNK 1;  4XWT A;  3VFK A;  2WX1 A;  4M8N A;  2JYE A;  4QAY A;  2J0M A;  5G5H A;  4GMV A;  1V81 A;  4EZK A;  3DDC B;  2KQS A;  2MBQ A;  4CHK A;  2KLG A;  3HRD D;  3ZKJ C;  3OJ4 B;  1LXD A;  3PZD A;  4DQO C;  4YL8 A;  1YQ3 B;  1VZ8 A;  3K9O B;  1STE A;  4C7Y A;  1EWY C;  4EE2 A;  2IO0 B;  2PVG C;  4OZC A;  2NBW B;  2N7D A;  2IDY A;  4DHJ D;  2IO2 B;  3IAM 1;  4HWI B;  2NTS A;  2ZEQ A;  1QOA A;  1PQS A;  2MBH A;  3ABV B;  1IYF A;  1NVI D;  3HVD A;  4MGZ E;  3TJP A;  2KAN A;  3GOE A;  1K53 A;  3PVL A;  4C56 C;  2X38 A;  2C9W B;  4XWW A;  4F8C B;  4MH8 A;  2PE9 A;  1WY8 A;  3AE1 B;  4S0R A;  3PLV A;  1UD7 A;  4HKZ E;  2BPS A;  2QIL A;  1L6V A;  5AEK B;  1E7V A;  4AJW A;  2JT4 B;  4WJP A;  4S17 A;  3T9L A;  5EDS A;  3DBL I;  3IBE A;  3DCG A;  1GOZ A;  3EC8 A;  2SEB D;  4K7W A;  2K1F A;  1V1P A;  4ZHO A;  3OLM D;  4ANU A;  1PGB A;  3RPF C;  4K7U A;  3ZYY X;  1EU3 A;  5AUI A;  3ZXV A;  2IBI B;  3SEB A;  1FXA A;  1UH6 A;  1WJ4 A;  3H7P A;  3VVW B;  2MWS B;  4BZA A;  2K3U A;  4WWP A;  1VCB A;  5J18 A;  3DBR I;  1ZE3 D;  1UWX A;  4RM8 A;  4N9F 4;  4W9H A;  2NVU I;  1HEZ E;  3NVZ A;  3MC8 A;  2J0K A;  2LMC A;  4RGM A;  4O1N A;  1JQ4 A;  1RAX A;  5HKH A;  3KUD B;  1F2R I;  1ROE A;  3DVG X;  3W1Y A;  1WX7 A;  2CS4 A;  3MJW A;  1WJN A;  3Q3M C;  2LI5 A;  4BKG A;  2I2Y A;  2N9X A;  1Q10 A;  4HXD A;  4B0M A;  2ICI A;  2MSE D;  2MCN B;  2L8J A;  4OVZ A;  2KMC A;  3QIJ A;  3TSS A;  4A9A A;  1L4D B;  2MJ3 A;  1MFW A;  1FXT B;  2ZVO A;  2BKF A;  3QAQ A;  3IT6 B;  4KZ0 A;  3VQI A;  3KYD D;  4ANV A;  4EUT A;  4RF1 A;  3O13 A;  3RT3 B;  1LO5 D;  3TEY A;  5T8I A;  1J7A A;  3RNF C;  2KK8 A;  1FPY A;  4WQO B;  2IO1 B;  4I6P A;  1XD3 B;  3Q6B A;  4NQL B;  3QWZ B;  1TY0 A;  4W9J A;  2JWU A;  1TYG B;  2W3R A;  3PSE B;  3WAO A;  1ESF A;  1SEB D;  3JSV B;  2LGX A;  2IY0 B;  4M01 A;  1J8C A;  2KAJ A;  5J17 A;  4ARI A;  1WXA A;  2NTT A;  4MEL A;  1FD6 A;  2N1V A;  4LLG M;  1IP9 A;  2PLP A;  3AEG B;  2L0T A;  2BW2 A;  1SJE D;  4BOZ B;  5IO9 A;  3ZRC A;  5C23 A;  3PZ7 A;  4Q2J A;  3N3K B;  2LFI A;  1D4B A;  3U2S C;  3U52 E;  1L5P A;  1V49 A;  2XK5 B;  1AAR A;  4MJS B;  1YN4 A;  4GN1 A;  2OJR A;  5BMH A;  3IVF A;  2PKO A;  3X23 A;  1DOX A;  5CHV C;  4LNO A;  2GOW A;  1YNT E;  4HLE A;  1GC6 A;  3HIZ A;  2KJR A;  4A55 A;  3A1Q A;  2KVR A;  2MW5 A;  2ZCB A;  4RF0 A;  3BY4 B;  1J0G A;  1E8Z A;  2NMQ A;  1P0R A;  3TIX A;  1WJU A;  1ZDV A;  2JUO A;  3UIP B;  3IFW B;  2QDF A;  3P4Q B;  4RM9 A;  1EF1 A;  3MHZ A;  1OTR B;  2LVQ A;  3LB8 C;  1VRA B;  1E7P B;  1XQQ A;  2FIF A;  2KDB A;  2W9N A;  3AXC A;  5KHQ A;  4BKS A;  5IP4 D;  4MGY E;  2I38 A;  4AS1 A;  4RCO A;  3PHX B;  3AEE B;  3TL5 A;  1NEK B;  5IN7 A;  2BBC A;  1XLP A;  5DCN A;  3ALB A;  3W2D A;  2L83 A;  3ZTD A;  4A3O A;  1JW9 D;  3KW5 B;  2ZZP B;  3DBL B;  4XGA B;  4W9D A;  1UZX B;  3L10 B;  4HVB A;  2GBM A;  2MP2 B;  2FCS A;  4P16 A;  1HZ5 A;  4WQM A;  1FNU A;  1KLV A;  4EKU A;  3Q3O C;  1FCC C;  3PRM B;  2JU6 X;  1V1O A;  2QJL A;  1IBX A;  4YTP B;  4LTU A;  2KOX A;  4RGO S;  2BYV E;  3QA8 A;  1WWT A;  1VD2 A;  4US9 A;  2WXI A;  2BT6 A;  1R4M I;  1QOF A;  4JQW C;  2CHX A;  4K7S A;  3AE4 B;  2BYE A;  1ET9 A;  2K22 A;  3K9P B;  3DBR B;  1R7S A;  4W9K A;  1OFF A;  5HFY A;  2KQ4 X;  3HM6 X;  4LCD E;  1J19 A;  3HK0 A;  3KVF B;  3DHG C;  3H9D A;  4N59 A;  2KWD A;  2MA9 B;  2L52 A;  3T3N A;  5C2T B;  2ZPN A;  4M0W A;  1V97 A;  3PPA A;  2R2O A;  2PMV A;  4IM2 A;  1UGM A;  1HA5 A;  1JRO A;  3V62 A;  4F7Z A;  2E3T A;  3ZJV A;  4GOC A;  3JSV A;  1I4X A;  2UYZ B;  3B08 A;  2KD0 A;  2OJW A;  3MFG A;  2MHJ A;  2LGI A;  2MX2 A;  5JXV A;  1PFD A;  2D10 A;  2GBK A;  1E8Y A;  3BYY B;  2KTR B;  1XCT L;  2FCM A;  4YTN B;  3V60 A;  3WAM A;  1V5T A;  2PVO D;  2WXH A;  1I4R A;  2L05 A;  3URY A;  2OED A;  4XDC A;  4II2 B;  1A70 A;  2OHF A;  3A4R A;  4WWN A;  1WMH B;  2VZK D;  2XK5 A;  3EFC A;  4RMA A;  1DOI A;  2LGY A;  4NY0 A;  1UF0 A;  4KIK A;  1VDV A;  1WX9 A;  3AI5 A;  4PS3 A;  2JPH A;  1N6Z A;  1YN5 A;  2BB5 A;  4OZB A;  3NY5 A;  1FRR A;  4WWM A;  4ASW C;  3WAP A;  4C4V B;  5FR6 A;  1CZP A;  2IGG A;  1MG4 A;  1DYQ A;  4W9L A;  4TKN A;  3B1L X;  4WH4 A;  1KOT A;  5E6J A;  1F0Z A;  5G5G A;  4XZ4 A;  1GB1 A;  2WXL A;  3P1M A;  2FCQ A;  1E7U A;  3SFD B;  3AN1 A;  3WAN A;  5IAA C;  1GAQ B;  1PGA A;  2JY6 A;  1Z2M A;  4YSY B;  5D2M B;  3U7D A;  2AQ1 B;  3VRB B;  2DEN B;  4F1S A;  3QX1 A;  1QKZ A;  2J7Q B;  5EE9 A;  1CQV A;  4NQK E;  5JHA A;  3ZNG C;  1WGG A;  4FN2 A;  4KGT A;  2IJ0 A;  1KLU D;  1P98 A;  2IND C;  4LNF A;  3ZQ4 A;  4XDD A;  4L23 A;  2QEJ C;  1Y8R C;  2WYQ A;  3NS8 A;  2BKR B;  4CO7 A;  1MHH E;  4NAW A;  4J3O D;  1I4P A;  2WHI A;  3NG0 A;  5BYS A;  1AW7 A;  1KJT A;  5DPR A;  2D2Q A;  4AWJ A;  1TIF A;  1SXT A;  4CYE A;  4W9E A;  1IGD A;  2KO3 A;  3DQV A;  3ZTC A;  1WGD A;  2WLB A;  3AUL A;  3GZN I;  1WM2 A;  2PTL A;  1TS2 A;  2J53 A;  3IXS A;  3VHT C;  4MGK E;  2HJ8 A;  1T0S C;  2O6V A;  1SIF A;  4IM3 A;  3ZLZ A;  4GDK A;  2A4Z A;  2FID A;  2VH2 A;  1YX6 B;  3AV8 A;  3BK2 A;  2N7E A;  4NNJ B;  3MP9 A;  3PRP B;  1P3Q U;  4K81 A;  1FNV A;  1UBI A;  2WQY B;  3ZRF A;  3TEZ A;  3T3O A;  3H6N A;  1RWS A;  3ZIM A;  3J9C A;  1XT9 B;  2Y5C A;  3GE8 C;  3ENE A;  3BVM A;  3RNE C;  3W5V B;  3RNA C;  1OQQ A;  2HTH A;  2Z0D B;  3AMZ A;  3VAW A;  4RFB A;  2CHW A;  3VTW A;  2YLM A;  1ZW7 A;  1Q0W B;  4HRO A;  4BKS D;  4I6N B;  2NCN A;  2JWZ A;  2W55 A;  2AQ2 B;  3ZNZ B;  1JCK B;  2G4D B;  2KKC A;  5CHF A;  4IWQ A;  2KYW A;  1KTK A;  2OOB B;  3ZDT A;  1SE9 A;  2JVC A;  1TT5 B;  3T8M A;  1QIL A;  1QF6 A;  1JWS D;  3A33 B;  1ZDX A;  2YEP F;  2GLS A;  3C8Y A;  2ACZ B;  4HJG E;  2AQ3 B;  2FAZ A;  3GS2 A;  1TKE A;  4KVG B;  2IO3 B;  3I3T B;  3DVG Y;  3MC9 A;  2L3Z A;  1VZ6 A;  4YT0 B;  5GMV A;  2PIA A;  2LUE A;  3AB5 A;  3MC0 B;  1XO3 A;  2QSD A;  5E6N A;  4IOI E;  1GB4 A;  3N1X C;  4C4V A;  1BT0 A;  1WM3 A;  4LNN A;  1YQ4 B;  1V5O A;  4P6V F;  4RGN A;  4GSW A;  5BO4 B;  3AEB B;  2WXO A;  2Q5W D;  3NZS A;  1F1H A;  3AE7 B;  2KFK A;  2ZCC A;  4RNA A;  1T0R C;  1RLF A;  1SGH A;  5HHD G;  2NPT A;  2RD0 A;  4LDT B;  5C1Z A;  5MPO A;  2INP E;  4IWP A;  3UF8 A;  1JWM D;  2J0J A;  4KDL B;  2INC C;  2FBW B;  3N1Y C;  3ONS A;  4PK1 A;  2MBB B;  4YWG G;  4ZHP A;  3A9K B;  4MEM A;  2Z8L A;  3WIM A;  2ZW0 A;  5BYR A;  4WJN A;  1C76 A;  4IWO A;  2LHD A;  5KHO A;  2Y3A A;  5EE1 A;  1I4H A;  3KH0 A;  4MAC A;  1AN8 A;  2BYF A;  2KT7 A;  3ECI A;  2HD5 B;  2KN4 A;  2L1A A;  3R8B A;  3RZF A;  1KH0 A;  4E3C A;  1JAL A;  1L0X B;  2IYD B;  2Z0E B;  1WF9 A;  5IA7 A;  2GB1 A;  2V0G A;  3TBL D;  3PLU A;  2FE8 A;  3VUX A;  3AEA B;  4FHK A;  1SE2 A;  2K8H A;  3OAW A;  2RDH A;  4NJ7 A;  3E56 A;  2CJN A;  1UUP A;  2JX5 A;  3A9J B;  3TEX A;  3AED B;  1QT9 A;  3L16 A;  4B95 A;  2TSS A;  1WR6 E;  4ZRP A;  1TJE A;  1KLG D;  3OG5 A;  4USA A;  4L2Y A;  4YSX B;  5E6O A;  1ISN A;  4KSK C;  2O2V B;  4DHJ B;  1UBQ A;  3M95 A;  4DXG A;  2PPH A;  3PTF C;  4KGS A;  4PYZ A;  4ZYS A;  2MEK A;  4C00 A;  3V3X A;  2JZZ A;  1TZO A;  4GXB A;  3V6C B;  3TCA A;  1V6E A;  2WS3 B;  1SE4 A;  1ZUD 2;  3E9S A;  3PRZ A;  1E0Z A;  5H92 C;  4ICU A;  4A20 A;  3ZJT A;  1AYF A;  1OQY A;  3EA6 A;  4FLH A;  3AU5 A;  5FR3 A;  4TQ0 A;  1LQB A;  2KVZ A;  3P63 A;  1YN3 A;  4JGH B;  2MBE A;  4WWO A;  1YMH E;  1S3S G;  1G6J A;  2E6X A;  1PYW D;  2MH7 A;  2BYT A;  1DOY A;  4JL9 A;  4MM3 B;  2LUM A;  2WP9 B;  1D5M C;  3IHP C;  2WDR B;  1EUV B;  3NOB A;  2N1W A;  3P4S B;  2O6V D;  5JZE B;  2LJI A;  1C79 A;  1VLB A;  4EEW A;  1I7H A;  2BS3 B;  1C1Y B;  4IUM B;  4HKQ A;  2L7R A;  4B0E A;  5L83 A;  2WXG A;  2K39 A;  4TMA B;  5D94 A;  2ZPY A;  1BML C;  4II3 B;  4YTM B;  1WYG A;  4C80 A;  4NZL B;  3PT2 B;  3VXW A;  2KC1 A;  2BWF A;  4NPN A;  4K1R B;  3RUL A;  2LRW A;  3V6E B;  4M8M A;  3I63 C;  4YXD B;  3KWL A;  1WRD B;  3ZDM C;  3Q8C A;  3P42 A;  1R4N I;  3VR9 B;  3CMM B;  2DYO A;  4MT5 A;  3UQB A;  2KWU B;  5HG2 A;  1P1A A;  4HCN B;  4BBN C;  4PS8 A;  2EKI A;  3D32 A;  4TQ1 A;  2K0P A;  4W9G A;  1GNU A;  3HHM A;  5L95 C;  2D3A A;  4L1B A;  1TS3 A;  2BGF A;  1QOB A;  3SR6 A;  1ZPS A;  2FUH B;  4REZ A;  2WGS A;  4XX5 A;  5JHB A;  4J6I A;  1CJE A;  3L08 A;  3RNC C;  2Z59 B;  4A6Q A;  1KM7 A;  2K9X A;  1RYJ A;  2JRI B;  5DPW A;  1BUI C;  2B76 B;  1I42 A;  2BF8 B;  3L0W B;  4G50 A;  2LZ6 A;  1QOG A;  1VR9 A;  4FBJ B;  3NJT A;  3LDZ E;  4KSL C;  4G3X B;  2G3Q B;  4AP4 C;  4FUL A;  2LVO A;  5AZH A;  3VH4 B;  3FIL B;  2V3N A;  2CHZ A;  2L76 A;  4DXA B;  4EOY A;  2DAJ A;  4MSM B;  2CKH B;  2R61 A;  3QAR A;  2AWT A;  2K25 A;  1FMA D;  1HTQ A;  5H8Y E;  2QIE B;  5IOI A;  1P7F A;  3NVW A;  3P4R B;  2D3C A;  1A5R A;  2RDB C;  4ZOH C;  1M4V A;  1QLB B;  2NR2 A;  2H88 B;  2JZP A;  1GPX A;  2Y5P A;  1Y56 A;  1N5W A;  1C3T A;  5G2N A;  5AUK A;  4DHZ E;  4EZL A;  5JH5 C;  1NDD A;  1WGY A;  4G11 A;  5J2R A;  3S2A A;  3Q69 A;  3PS6 A;  3NZU A;  1F9J A;  4FXC A;  4E71 A;  4K3C A;  1E10 A;  1YOV B;  1XEE A;  1WGR A;  4IG7 B;  3M63 B;  4IKG A;  2QMT A;  3GB1 A;  4C7Z A;  2INN E;  2WXM A;  4A90 A;  1NYR A;  3QCA A;  2KQ7 A;  3L13 A;  3L4P A;  3R66 C;  4KKI A;  1HE8 A;  2WDT B;  2CR5 A;  4BVU C;  3PV1 A;  3M62 B;  2WNM A;  1BXT A;  3DOW A;  4OHJ A;  2M0X A;  4IDI A;  2RGF A;  4MJS A;  3H7S A;  1JRU A;  1RFK A;  3Q3N C;  1WGK A;  1PDX A;  2JXT A;  4M02 A;  4MH0 E;  1ZP0 B;  1FRD A;  4ITK A;  4JLC A;  3AM9 A;  2W54 A;  3L54 A;  2C7N B;  2V3S A;  3ZNH B;  1LM8 B;  2M56 B;  4DK5 A;  1N60 A;  3QHT A;  3X0W A; 
#chains in the Genus database with same CATH homology
 2ICI A;  4OVZ A;  3TSS A;  4A9A A;  1L4D B;  1QIL A;  2MJ3 A;  1QF6 A;  1C4P A;  1MVK A;  2RMM A;  1JML A;  3PO0 A;  1JWS D;  2KDM A;  1ZDX A;  4NAW B;  2YEP F;  3C8Y A;  3NS1 A;  2ACZ B;  3IT6 B;  4HJG E;  3VQI A;  2XNA C;  2AQ3 B;  4ZRQ A;  3CIR B;  1N61 A;  3GS2 A;  2KAC A;  1TKE A;  4RF1 A;  2PW9 A;  3FC4 A;  3O13 A;  1LO5 D;  3TEY A;  1D6E C;  5T8I A;  1J7A A;  1T6B X;  1VZ6 A;  4YT0 B;  1VZ7 A;  4CQN A;  2PIA A;  2BTE A;  2H89 B;  3DWG C;  3AB5 A;  3MC0 B;  1C78 A;  1XO3 A;  2QSD A;  2XN9 C;  4IOI E;  2K5P A;  1XF5 L;  1AWD A;  1TY0 A;  2N0S B;  3OWE B;  2DWQ A;  1C77 A;  2JWU A;  4H2A A;  1GB4 A;  1TYG B;  2W3R A;  1ESF A;  3B2G A;  4WUR A;  1SEB D;  1NEN B;  1SJH D;  3ZJU A;  1YQ4 B;  3BZD B;  4P6V F;  2KMM A;  4JWS C;  4RGN A;  2KAJ A;  2WXQ A;  3U4E G;  3AE2 B;  1TKY A;  3AEB B;  2WXO A;  2Q5W D;  1ZXI A;  3AE7 B;  1KFY B;  4ARI A;  1V1P B;  3BII D;  4GDK B;  4RNA A;  3FAH A;  2NTT A;  3IT4 B;  5HHD G;  4RH6 A;  1FD6 A;  1UGJ A;  4LLG M;  1L0V B;  1N63 A;  5MPO A;  2INP E;  2IGD A;  3H8H A;  1K52 A;  2PLP A;  3LXF A;  3V05 A;  3AEG B;  2BW2 A;  3TEW A;  1JWM D;  1SJE D;  2DYM A;  2WXN A;  2JYT A;  1J7B A;  3CWI A;  1YJI A;  3ETR A;  3PZ7 A;  2FBW B;  4Q2J A;  1QQR A;  2WDV B;  5GXG B;  1DGJ A;  2LFI A;  1D4B A;  3U2S C;  1TKG A;  4YWG G;  1B9R A;  3U52 E;  3U7Z A;  1L5P A;  4ZHP A;  3BWU D;  1D5X C;  1YN4 A;  1FNW A;  2EEL A;  2BS4 B;  2Z8L A;  5BMH A;  4JE3 B;  2PKO A;  2ZW0 A;  2ZW1 A;  3RFZ B;  1DOX A;  5BYR A;  1C76 A;  1K51 A;  5HI1 A;  2VZK B;  1PUT A;  2LHD A;  1YNT E;  1N62 A;  3BYT B;  2Y3A A;  4A55 A;  5EE1 A;  1I4H A;  1JWA D;  2IGH A;  1ACC A;  4MAC A;  2GI9 A;  4KX6 B;  1AN8 A;  1MI0 A;  2BS2 B;  2KN4 A;  3R8B A;  2L1A A;  1KH0 A;  4RF0 A;  1JAL A;  2WXF A;  1L0X B;  3NUH B;  3B9J A;  1HZ6 A;  1L6U A;  2GB1 A;  2NMQ A;  5TSS A;  2V0G A;  1UNS A;  1ZDV A;  1OQR A;  3BVZ A;  5FKA C;  1VJK A;  2WU2 B;  3NVV A;  2FE8 A;  3AEA B;  1SE2 A;  2WXJ A;  4WAF A;  3P4Q B;  1I4G A;  3EUB 2;  2IPK D;  2RDH A;  2RDG A;  3MHZ A;  3NRZ A;  1EM7 A;  3E56 A;  1XLN A;  1ZOY B;  3BVG A;  3LB8 C;  2CJN A;  1VRA B;  1FFV A;  1UUP A;  1E7P B;  2JX5 A;  3W1S A;  3TEX A;  3AED B;  1N5X A;  1EU4 A;  1QT9 A;  3MJ5 A;  1SF0 A;  1XCQ L;  2MJD A;  2TSS A;  4ZRP A;  1TJE A;  1XLQ A;  1KLG D;  2DBY A;  3Q8B A;  3W9C B;  2I38 A;  4USA A;  4L2Y A;  4AS1 A;  4YSX B;  1SB3 C;  1WXQ A;  1D5Z C;  1FFU A;  4RCO A;  1KRH A;  3AEE B;  1NEK B;  4XE0 A;  1IGC A;  2BBC A;  1XLP A;  1V8C A;  1E6E B;  1ET6 A;  2RPV A;  3AE3 B;  3W2D A;  5D3I B;  4ARC A;  2L83 A;  4DXG A;  3Q8E A;  1RM6 C;  4LK0 M;  1JW9 D;  1JRP A;  3EGR A;  1TY2 A;  4KGS A;  4ZYS A;  1FO4 A;  2MEK A;  4OW0 A;  3VRA B;  3V3X A;  1J7C A;  1TZO A;  2D5G A;  2ON8 A;  4N58 A;  4P16 A;  1F2R C;  2WXR A;  1HZ5 A;  2HDE A;  4WQM A;  1FNU A;  3AEF B;  4KGR A;  1FCC C;  3BK1 A;  1C4C A;  2JU6 X;  3W5U B;  2WS3 B;  1V1O A;  1SE4 A;  1ZUD 2;  1T3Q A;  2QJL A;  3E9S A;  1IBX A;  1NI3 A;  1C4A A;  4YTP B;  4LTU A;  4RGO S;  5H92 C;  1E0Z A;  3ZJT A;  1AYF A;  1I4Q A;  1WWT A;  3AE8 B;  4US9 A;  1TS4 A;  2WXI A;  3EA6 A;  2BT6 A;  4JPS A;  4JWU C;  5FR3 A;  1NYQ A;  1QOF A;  4TQ0 A;  3AE4 B;  1XLO A;  3P63 A;  1YN3 A;  1ET9 A;  2J42 A;  2V4I B;  2K22 A;  1R7S A;  1YMH E;  3DWM A;  1OFF A;  1XXG A;  5HFY A;  1P7E A;  2KQ4 X;  2E6X A;  4UDU C;  1PYW D;  3AE6 B;  2N9K A;  2MH7 A;  4N59 A;  5BMG A;  2BYT A;  2KWD A;  1DOY A;  1F77 A;  4WIP A;  4PT5 A;  1JWB D;  1WRI A;  4MM3 B;  2LUM A;  2L52 A;  3T3N A;  2WP9 B;  5C2T B;  2WU5 B;  1D5M C;  1PGX A;  1V97 A;  2WDR B;  4M0W A;  2PMV A;  3P4S B;  3FIL A;  2ONQ A;  3AEC B;  2LJI A;  2V3P A;  1HA5 A;  1YJJ A;  1JRO A;  1UWM A;  2HTM E;  2LEK A;  1L0Y B;  1C79 A;  1VLB A;  2E3T A;  2M0A A;  1I7H A;  2BS3 B;  5EE0 A;  1JWU D;  3ZJV A;  3I57 A;  1I4X A;  5I4D A;  4HKQ A;  2W3S A;  2CJO A;  4B0E A;  1CK1 A;  3MFG A;  2WXG A;  4TMA B;  2LGI A;  3PZ8 A;  2BB6 A;  5JXV A;  1BML C;  1PFD A;  5D3D A;  4YTM B;  1WYG A;  4C80 A;  4NZL B;  3AE5 B;  1L4Z B;  3BYY B;  5D7G A;  1SIJ A;  1XCT L;  1FCL A;  4YTN B;  1FEH A;  1E9M A;  2PVO D;  2WXH A;  4YXD B;  3KWL A;  1I4R A;  3P4P B;  4N6E B;  3Q8C A;  3P42 A;  3R2I A;  4US8 A;  2LHE A;  3URY A;  2OED A;  4XDC A;  3VR9 B;  4MT5 A;  1FIQ A;  2DYO A;  2FUG 1;  2J4X A;  1A70 A;  2OHF A;  5HG2 A;  2L32 A;  2YEP B;  5EE3 A;  1WSP A;  2VZK D;  3IAS 1;  5C3J B;  4R3D A;  4GLS C;  1K50 A;  1DOI A;  2EKI A;  3R2T A;  5BYQ A;  2JSV X;  4TQ1 A;  2K0P A;  1KF6 B;  1MPE A;  1VDV A;  1FXI A;  4L1B A;  1TS3 A;  1YN5 A;  2BB5 A;  1HQR D;  1QOB A;  1SBB B;  4OZA A;  3SR6 A;  3TUO A;  4OZB A;  1FRR A;  4NJC A;  4WWM A;  2GRI A;  4D2K A;  1ZPS A;  1C9F A;  1CZP A;  2J52 A;  2IGG A;  4REZ A;  1IBX B;  2WXP A;  3AE9 B;  1DYQ A;  1CJE A;  2MJE A;  4JX1 C;  3Q8A A;  4AQ7 A;  1ENF A;  4A6Q A;  5LNK 1;  4WH4 A;  4XWT A;  2K9X A;  5E6J A;  1F0Z A;  1HXY D;  1RYJ A;  5G5G A;  2JYE A;  1GB1 A;  2WXL A;  3P1M A;  1BUI C;  2B76 B;  3B2F A;  5G5H A;  3SFD B;  2SAK A;  3AN1 A;  1QOG A;  1GAQ B;  1VR9 A;  3GP7 A;  3HRD D;  1PGA A;  4DQO C;  4YSY B;  4DXF A;  3HVZ A;  1ZXH A;  2AQ1 B;  3VRB B;  1YQ3 B;  4TSS A;  1QKZ A;  1VZ8 A;  5EE9 A;  1CQV A;  3KLS X;  3LYY A;  1STE A;  4C7Y A;  1EWY C;  4EE2 A;  3N9Y C;  2W82 A;  4KGT A;  2IJ0 A;  1KLU D;  2PVG C;  4OZC A;  3ZQ4 A;  2IDY A;  1FM0 D;  4XDD A;  3FIL B;  3HUI A;  3IAM 1;  4L23 A;  2V3N A;  2NTS A;  2QEJ C;  1QOA A;  5BMI A;  3ABV B;  1MHH E;  1NVI D;  3HVD A;  4J3O D;  2CU3 A;  2R61 A;  1I4P A;  4C56 C;  1K53 A;  2M19 A;  2JQR B;  5BYS A;  2X38 A;  4KKJ A;  1AW7 A;  3VR8 B;  1FMA D;  5H8Y E;  4XWW A;  4MH8 A;  2QIE B;  3ZGZ A;  3AE1 B;  1P7F A;  3NVW A;  3P4R B;  1SXT A;  3WCQ A;  2AX5 A;  2G1E A;  4A8X C;  1IGD A;  4YSZ B;  4ZOH C;  2WLB A;  4HEA 1;  1M4V A;  3AH7 A;  4HKZ E;  2QIL A;  1L6V A;  1QLB B;  2N7J A;  2PTL A;  3UI3 A;  2H88 B;  1TS2 A;  2J53 A;  2JZP A;  3IXS A;  1GPX A;  1IUE A;  2Y5P A;  1Y56 A;  1N5W A;  5AUK A;  1EWC A;  4NAM A;  1B1Z A;  3KQ4 A;  1GOZ A;  3Q69 A;  2SEB D;  4FXC A;  1E10 A;  3NVY A;  4ZHO A;  1V1P A;  1XEE A;  3BK2 A;  3AV8 A;  1PGB A;  3RPF C;  3MP9 A;  3ZYY X;  1EU3 A;  5AUI A;  4IKG A;  2G9H D;  2QMT A;  3SEB A;  1FXA A;  3GB1 A;  4C7Z A;  2INN E;  1FNV A;  5FK9 C;  2WXM A;  2WQY B;  1MHX A;  3KWV A;  4A90 A;  2K3U A;  1NYR A;  3TEZ A;  3T3O A;  3L4P A;  3I9V 1;  4KKI A;  1RWS A;  1ZE3 D;  4HRS A;  1UWX A;  3J9C A;  2WNM A;  2Y5C A;  1BXT A;  3Q8F A;  2DLB A;  2WXK A;  3BVM A;  4RGT A;  1HEZ E;  3NVZ A;  4OHJ A;  4IDI A;  2LMC A;  4RGM A;  4O1N A;  3W5V B;  1TS5 A;  1RFK A;  1OQQ A;  1WGK A;  1PDX A;  3AMZ A;  2JXT A;  1JQ4 A;  4RFB A;  2WDQ B;  1ZP0 B;  4HRO A;  1F2R I;  1FRD A;  1ROE A;  4ITK A;  3NZ3 A;  1SE3 A;  3AM9 A;  2W55 A;  2W54 A;  2AQ2 B;  3SFE B;  1JCK B;  1T5X D;  2N9L A;  2M56 B;  2I2Y A;  1KTK A;  4GDL B;  1N60 A;  1SSN A;  1Q10 A;  4B0M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...