1JQ4A

[2fe-2s] domain of methane monooxygenase reductase from methylococcus capsulatus (bath)
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
98
structure length
98
Chain Sequence
MQRVHTITAVTEDGESLRFECRSDEDVITAALRQNIFLMSSCREGGCATCKALCSEGDYDLKGCSVQALPPEEEEEGLVLLCRTYPKTDLEIELPYTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHANE MONOOXYGENASE COMPONENT C
publication title NMR structure of the [2Fe-2S] ferredoxin domain from soluble methane monooxygenase reductase and interaction with its hydroxylase.
pubmed doi rcsb
source organism Methylococcus capsulatus str. bath
molecule tags Oxidoreductase
total genus 9
structure length 98
sequence length 98
ec nomenclature ec 1.14.13.25: Methane monooxygenase (soluble).
pdb deposition date 2001-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1jq4A00
3AN1A 3KWLA 2M19A 2K5PA 3NVVA 1DOYA 1CZPA 2WLBA 2L83A 1N5WA 3CWIA 1FRDA 4YTPB 4C80A 5EE9A 1JW9D 3HRDD 2M56B 3B2FA 1SB3C 1NYRA 2QJLA 3BIID 3NVWA 2MJEA 3AE2B 4C7YA 1I7HA 4JWUC 2PVGC 3W9CB 2W54A 2G1EA 1E10A 2MJDA 2FBWB 1J7AA 4USAA 1QF6A 3DWMA 1WGKA 1YJJA 5G5GA 1R7SA 3AE4B 3HVZA 1N60A 3LB8C 4WQMA 5C2TB 1WRIA 4YXDB 1NVID 5EE1A 1FRRA 3AE3B 3FAHA 2JX5A 1E9MA 1QOFA 1JWBD 5MPOA 2KAJA 3NS1A 3AE5B 1UWMA 1E6EB 1WYGA 3P4PB 4A9AA 1J7CA 2JQRB 2EKIA 5AUKA 1ZXIA 2QIEB 3W5VB 2BS4B 3SFDB 2HTME 1B9RA 4LTUA 1L5PA 5GXGB 1QOGA 4YTNB 1QOAA 3P4SB 1VDVA 3CIRB 3NVYA 1ROEA 2WU5B 1NYQA 1TKGA 1XLQA 2CU3A 2DBYA 2LEKA 3VRAB 1NENB 3WCQA 4US9A 1IUEA 1PFDA 1V8CA 2ACZB 2BS2B 2MJ3A 3VR9B 1L6UA 2MH7A 2K9XA 1N61A 1FFUA 3HUIA 1EWYC 1YQ3B 1KF6B 2PVOD 3W5UB 4YT0B 3P4QB 3NRZA 2PIAA 2Q5WD 1KRHA 1TKEA 2BS3B 4YTMB 3PO0A 1F0ZA 2WDQB 5AUIA 4ZHPA 4N6EB 3AE9B 1FIQA 4YSXB 3AE6B 1JQ4A 1XLOA 1DGJA 2DWQA 1NEKB 2CJNA 3AEEB 3AMZA 4IDIA 2CJOA 1OQRA 1SIJA 1ZUD2 2WS3B 1QLBB 1N62A 2PKOA 5H8YE 2K22A 3LXFA 4ITKA 5H92C 1A70A 1L6VA 1FXAA 3AEAB 1WWTA 5EE0A 2B76B 5G5HA 2H88B 1YJIA 3AB5A 3AEGB 1WXQA 1KFYB 1RFKA 2N0SB 1JROA 3P4RB 4YSZB 1XLPA 1OFFA 1DOXA 2W55A 1FMAD 1GPXA 3AEDB 4ZHOA 1TKYA 3P63A 4HRSA 1YQ4B 3L4PA 2KMMA 4FXCA 1QOBA 2WDVB 3AEBB 3ETRA 2W3SA 2WQYB 1E0ZA 1AYFA 3B9JA 3AM9A 1GAQB 1VJKA 1JALA 3AV8A 4ZOHC 2L52A 2WU2B 3B2GA 1L0VB 2W3RA 1RM6C 4N58A 2OHFA 3NVZA 3ABVB 1XO3A 4P6VF 1AWDA 1T3QA 1CJEA 1PUTA 4JX1C 1RWSA 3AEFB 1DOIA 1XLNA 3FC4A 3RPFC 1J7BA 3VRBB 2BT6A 1FM0D 3AE7B 2Y5CA 1ZP0B 3AECB 3SR6A 3VR8B 3DWGC 1OQQA 5EE3A 1FXIA 1SF0A 3EUB2 1V97A 1JRPA 1VLBA 1ZOYB 3P1MA 4C7ZA 1N5XA 2H89B 1E7PB 1RYJA 1TYGB 3SFEB 3AH7A 1JWAD 4HROA 4JWSC 1QT9A 4KX6B 1N63A 1TJEA 4N59A 4US8A 3AE8B 2AX5A 1FO4A 1NI3A 2WP9B 2E3TA 2WDRB 3AE1B 4YSYB 1PDXA 5C3JB 1FFVA 3ZYYX 4WWMA
chains in the Genus database with same CATH superfamily
5J2RA 2FCMA 1P7EA 4IWOA 2MHJA 3VH4B 2WXQA 4FJZA 1T0RC 3KH0A 2MEKA 3HM6X 1F9JA 2KMCA 1TBEA 2BF8B 3HRDD 1Q1OA 4WWNA 2L3ZA 2KWUB 3DBLB 1WGYA 5D3IB 2WXOA 3E9SA 2ZEQA 1QF6A 1WSPA 1WE7A 1YN3A 3ZNHB 5E6PA 3C19A 4ZYNA 3I9V1 1WJUA 5JXVA 3DVGX 2BS4B 2KDIA 3PRPB 2MBHA 2BYVE 1E7UA 1N6ZA 3PTFC 4DWFA 1I4GA 3QCAA 3WAPA 2LUMA 4MEMA 4XE0A 1H8CA 3R2TA 4KGSA 4DXAB 3H8HA 1UWXA 4F1SA 5D7GA 1V1PA 3A9JA 3PO0A 4EFOA 4ZHPA 2IZVB 2FCQA 4R3DA 2B3AA 4PS8A 4MT5A 1WH3A 1LGRA 2LGXA 1A70A 2D3CA 1FXAA 4NPNA 1MPEA 5CHWA 1TKYA 1HZ6A 2X38A 1E0ZA 5G2NA 4PS7A 2V0GA 4HKZE 2IY1B 4P1CC 1F1HA 1RM6C 1JWMD 1Q10A 2K25A 4OVUA 3BINA 1ZGUB 4DDGD 3BVGA 4J3OD 2MLBA 3DWGC 4URKA 3CMMB 2XNAC 4EEWA 2FAZA 3UGBB 2AX5A 2WP9B 3IBEA 1LM8B 2KX0A 5IP4D 2K8BA 1V81A 3Q3OC 5FR6A 2DX5B 1SB3C 2G45B 4FULA 2LZ6A 3IFWB 2WXLA 1E90A 2LHEA 2K8HA 2JXXA 1RAXA 1J7AA 3DHGC 3QARA 5G5GA 2RD0A 4HCPB 2KDEB 5HI1A 1T0QC 4EZKA 2KTRA 2QDFA 1JWUD 2KAJA 3NS1A 2L1AA 3AE5B 5FK9C 2R61A 2WXJA 2K6DB 1L5PA 4TQ0A 4W9GA 3ZGZA 2LEKA 3ZNGC 5KHQA 2YLMA 4KZ0A 1UGMA 3CF6E 2SEBD 3UI3A 2GBKA 1YX6B 3MJWA 4W9LA 1Q0WB 4YT0B 2WX1A 4ZRQA 4YTMB 1PGAA 4IUMB 3U8ZA 1C77A 3AEEB 1AN8A 4K3CA 1P1AA 1V2YA 2RDHA 3N9YC 1WXSA 3AEGB 4NY0A 3C0RB 2PTLA 1GPXA 1C76A 4ZRPA 4O1NA 4HRSA 2KMMA 1QOBA 2D3AA 2IYDB 3X0WA 2JWUA 3U4EG 4I6PA 3VTVA 4OZAA 3WANA 4NZLB 3SR6A 3DVGY 1R4NI 1C9FA 4LLGM 2REXA 3PLUA 2N1WA 3SFEB 3ENEA 4JWSC 1UUPA 4N59A 2ZW0A 3AE1B 4L23A 3GZNI 1HEZE 2SAKA 1WM3A 1FRDA 4WJQA 4ANVA 1I4HA 2KN4A 4TSSA 2K1FA 3LDZE 2KX3A 4K81A 3RNBC 2C7MB 1V49A 4MGKE 3AU5A 2BYTA 3HVZA 4E74A 4LNFA 1D3ZA 3V62A 3UQAA 4G3XB 2QSDA 3DBSA 1E5WA 1UWMA 1FNWA 4NJ7A 2M17A 3URYA 3W5VB 1ZDXA 1E8ZA 1G6JA 4NQLB 1V5TA 2V3PA 1HE8A 4KSLC 2E6XA 1V8CA 3NZUA 4MM3B 4BKTA 2K9XA 1ZPSA 3Q8BA 2MWSB 2GOWA 2BPSA 4GLSC 1TTNA 4IC7B 2VZKB 2J4XA 5AUIA 1JWSD 1JQ4A 3FKYA 2FUHB 2GI9A 3BVZA 2VZKD 3H7PB 4ICVA 2D2QA 4LJOB 4GXBA 4ZYSA 4AQ7A 3WAMA 2O2VB 1DOXA 3OWEB 3V3XA 2UU7A 1EUVB 3T9LA 2C5LC 3WALA 1KTKA 4RGNA 2L0TA 2GLSA 2HDEA 2W82A 2AWTA 3RNGC 4UDUC 3NVZA 3PT2B 2J7QB 1IYFA 4HPPA 1XLNA 4MH8A 3ZVVA 1WM2A 1TZ1A 2CS4A 3VR8B 4GB9A 4MDKE 3L08A 1Y56A 1TYGB 3KYDD 3M63B 3OAWA 2VH1A 1F2RC 2PPHA 3DVNU 2JXTA 3CWIA 5EE9A 1JW9D 2FIDA 2JUOA 4HCNB 3N1YC 2BGFA 1GNUA 2NPTA 1EO6A 4BFRA 1WFYA 1WGKA 1C4AA 3H1UA 2XK5B 4MJSB 1WRIA 3PPAA 2NMQA 2KC1A 4TQ1A 4C4VA 2V1YA 2K0PA 3DDCB 2QCZA 4A20A 3PS6A 3U30A 1J7CA 4IWPA 4TV3A 4M01A 5CHFA 1B9RA 2OEDA 4LTUA 4DXFA 4EOYA 2PMVA 2KJHB 2CHXA 1ROEA 2OOBB 2C7HA 4MELA 2ZNVB 1N61A 4IOIE 1ESFA 3W5UB 2WDQB 1F77A 1EF1A 4DQOC 4OZBA 4L2YA 2EELA 4WQOB 3W1YA 1R4NB 1NEKB 1OGWA 1YN4A 3AMZA 2N7EA 1QKZA 3ZJVA 2CJOA 2D10A 1QLBB 4RNAA 5HFYA 1TS5A 1I4RA 2WYQA 3GZNB 4M0WA 3KUDB 4CQNA 4ZHOA 4IM3A 4ARCA 1YMHE 1GOZA 3B9JA 1WMHA 2DAJA 1JALA 2O6VA 2ZW1A 2D11A 1RWSA 4LK0M 1FM0D 4WWOA 2VH2A 3N3KB 1C79A 1JRPA 1L2NA 4F8CB 3L54A 4HDOA 4Q2JA 3OLMD 4US8A 3DCGA 3FILB 5C3JB 5AZFA 2N9PC 1RLFA 3AN1A 4XZ4A 5T8IA 2WXFA 4N9F4 4C80A 1I42A 3NVWA 1EU4A 1YN5A 4ZRJA 3W2DA 2J0JA 1C1YB 2NBWB 4RGMA 3GE3C 2FBWB 4USAA 2D3GA 4WQMA 2CKHB 3HM3A 3TEWA 2L05A 1TS4A 1FRRA 1J19A 1FNVA 2JX5A 2DYOA 1SE2A 5AUKA 2HTME 3KUZA 3UIPB 2LGIA 3MHZA 3KYCD 1K52A 2N4FA 2W9NA 1FFUA 1YQ3B 4W9HA 3BVMA 3TBLD 3HHMA 3ECIA 3ML8A 4BBNF 1Y8RC 2I1JA 4KZCA 1E8WA 3VTWA 2N9LA 1EWCA 4ICUA 2WS3B 3TL5A 1EU3A 2PE6B 2K22A 4M8MA 1WWTA 2R2QA 2DZIA 3RZWC 2M4NA 1JCKB 2LFIA 2WDVB 4NAWA 3IAM1 1UD7A 3HVDA 2LJ5A 2IJ0A 2BYEA 2OHFA 1WY8A 2JPHA 1AWDA 4K3BA 1RRBA 2CHZA 3PV1A 1XXGA 3EUB2 1KLUD 3P1MA 1WYWB 2BW2A 2JVCA 1N5XA 4GDKB 4TMAB 4FN2A 1N63A 2EMSA 2N7JA 2MP2B 5HKHA 2J52A 4AJWA 2GRIA 3NS8A 4KGRA 3WIMA 1XCTL 4W9KA 3Q8CA 4M02A 4FA6A 4DDID 2L76A 2MBBB 4DHZE 1D4BA 2JF5A 2KFKA 4OVVA 4HVBA 4RGTA 3AE4B 3Q3JA 2JRIB 3ZXRA 5EDSA 3MHSD 3AE3B 1I4XA 1QOFA 2LGYA 1WGHA 4II3B 2EKIA 4EE2A 3P4SB 3NVYA 1UF0A 2ONQA 3GE8C 1C4PA 2KXJA 3VDZA 4YWGG 3VR9B 4B9KA 3ZIMA 2TSSA 4ZDVA 1VCBA 4IW0A 4FBJB 1TS3A 3H7SA 3NRZA 4LJPB 2LGDA 2MX2A 5JHAA 3MFGA 3MC0B 2INCC 3ZJTA 4IM0A 2IO1B 2CJNA 4ZRIA 1TY2A 3KQ4A 4I6LB 3AXCA 5H8YE 1N62A 3PZDA 2B76B 4YSZB 3ZDTA 4HPLB 4A6QA 3P63A 4GDLB 3L4PA 4HEA1 3V60A 1WGGA 1PUTA 4BVUC 3RUIB 3RFZB 3MJ5A 2ZPYA 2Y5CA 3UINB 5D94A 2IPKD 1VLBA 4GN1A 3VQIA 3BY4B 2GBMA 3RN9C 4WJNA 3IT6B 4YSYB 2N1VA 3JSVA 1FCLA 4PS3A 2IBIB 2IGGA 4HK2A 1FD6A 3WAOA 3BIID 1K8RB 4B6WA 4XGAB 1PGXA 1E10A 5LXIB 4FLHA 4LNOA 1GC7A 3LB8C 1C4CA 3IT4B 3BK1A 2DHZA 4KSKC 3PSEB 3A1QB 3ZRFA 1PQSA 4E3CA 5MPOA 3QX1A 1UBQA 1E6EB 4A90A 3B1LX 3SFDB 3UF8A 2ZZPB 1XCQL 1GB1A 4YTNB 1QOAA 2AL6A 4DHZB 1UBIA 3NY5A 5G55A 1SJED 3OJ4B 4BKSA 4HDQA 2RR9A 1V1PB 3A9JB 3HUIA 1IPGA 2KN5A 2LGSA 2JZPA 1VZ6A 4NJCA 3R7RA 2MCNB 1EM7A 2JZ3B 5CHVC 5BO4B 3VH3B 3U52E 3PZ8A 3I5JC 3EC8A 2L32A 3ZUNA 4KVGB 1ACCA 3AB5A 1KFYB 2KDMA 1JROA 1LO5D 4EKUA 2RPVA 4FXCA 1WRDB 4EZLA 1AW7A 4FADA 4RF0A 4AOFA 2GMIC 2NS5A 2LJIA 2KO3A 2WWZA 1SGHA 5EE3A 3Q3NC 4B0MA 2KOXA 2KANA 2MBOA 1E7PB 4OW0A 1TJEA 2KVZA 1TY0A 4RM8A 4RM9A 3I57A 3HIZA 3EECA 4LNNA 4ANWA 3GS2A 4YTPB 4KDLB 2M56B 3AULA 5D2MB 3AE2B 2FE8A 5DPTA 4BOZB 4EZJA 4BZAA 5IAAC 3S2AA 3V61A 3N32A 1V80A 4KKJA 4BKSD 4WH4A 1C3TA 2FCSA 2D5GA 4FHJA 2KK8A 3RYTA 2I38A 1VZ8A 2R2OA 3VUWA 1ZE3D 1JWBD 2NTSA 5IOIA 1WYGA 1BT0A 2FNJB 1Z5SB 1PGBA 1VZ7A 1MFWA 1QOGA 1H4RA 4P16A 1KM7A 3H7PA 4TUUA 2L0FA 3TJPA 3RNEC 2HJ1A 1WJ6A 2O2VA 2L7RA 3NOBA 4MSQB 1X1MA 2NBVB 2CU1A 3ZW3A 4CYEA 1FIQA 4GOCA 1WE6A 5L83A 1SJHD 3QHTA 1E7VA 1YIWA 2DENB 3VUYA 1NBFC 5G5HA 2IGDA 3DBHB 2KKCA 3SD5A 3L10B 3AEDB 4KIKA 4HPMB 3MTNB 1QILA 3ETRA 1AYFA 1HA5A 1HTOA 2PW9A 1UNSA 2BKFA 4J6IA 1V9JA 1T6BX 3Q2AC 3RPFC 3VRBB 2BT6A 4CO7A 2YVCA 4A55A 3A9KA 5CX3A 1ENFA 1ZOYB 2FCNA 1TS2A 3C8YA 3O13A 1QT9A 2IO2B 4P7IA 3EFCA 3ZYYX 3T8MA 4RF1A 2QMTA 1SIFA 3H6NA 3NVVA 1MHHE 4C56C 3SHQA 1B1ZA 1L0XB 1YJ1A 1NYRA 5FKAC 1L4DB 2C7NB 2INDC 3LYYA 2K6QA 4D2KA 3BYYB 2Z59B 1KJTA 3PHXB 2UYZB 4REZA 1YNTE 1UH6A 2X8XX 3ZJUA 2BB5A 2BKRB 3VXWA 3JW0X 2AQ2B 3P4PB 4ANXA 2Y3AA 3X23A 4GMVA 2N7DA 3MC8A 2N9EB 1TZOA 4XWTA 3VRAB 1NENB 4ARIA 1IUEA 1L6UA 2C60A 2MH7A 1TKEA 2BS3B 4WJOA 4P1BC 2NVUI 2PE9A 3AE9B 2JYEA 3IVFA 3KWVA 3IG3A 2JT4B 3PRMB 4ITKA 2FIFA 3Q14C 4GSWA 2VRRB 1YJIA 3RNCC 3KUCB 1K51A 4MGIE 2BVCA 2PEAA 1YQ4B 4RH6A 3U7ZA 3QIJA 2QC8A 3T3NA 1VJKA 3ZTDA 4DHJD 2RSUA 3FC4A 1ET6A 5LNK1 4W9FA 2DZKA 1WJ4A 5CTRC 4C7ZA 2AQ3B 2H89B 4HWIB 4HROA 1GUAB 2LRWA 2KC2A 2UWQA 3W1SC 4GIVA 3KLSX 5HHDG 2NPTB 3GP7A 1YD8U 2WXIA 1D5ZC 3ML9A 2JU6X 4BBNC 4RCOA 3VVWB 3I3TB 1VD2A 2KJ6A 4C4VB 4M8NA 3H9DA 4PYUA 1BUIC 4II2B 4C00A 1IBXA 3MC9A 4LNKA 4W9CA 3ZLZA 4DK5A 3ZNZB 1WXVA 1WGDA 1XD3B 1VDVA 3CIRB 3RNAC 4DBGA 5AZHA 1MJDA 4W9JA 1WIAA 5J18A 1HZ5A 3MP9A 1TGZB 4IM2A 3DBRB 4XDDA 1IGCA 1KRHA 2M8SA 3L16A 3TEXA 4YSXB 3VUXA 1ISNA 1GG3A 4M0WB 3AEAB 5LXHA 3U2SC 2N0SB 2W55A 1FMAD 2G4SA 1UGJA 4FHKA 2GB1A 5AEKB 4JE3B 2O6VB 3Q3MC 3BK2A 3AM9A 1C78A 4N58A 2O6VD 2KNBA 4P6VF 3RZFA 3APCA 1ZP0B 3BZDB 3VTUA 2ASQA 4KDIC 1XF5L 3ZTCA 1GC6A 4XWWA 3UQBA 3L13A 1T0YA 2C9WB 2L00B 3Q8FA 4G11A 2K5PA 2WLBA 2AL3A 3IXSA 4JL9A 2CHWA 5I4DA 2D07B 1V5OA 1ZXHA 3SEBA 3ZDMC 1JRUA 3RI7C 2W54A 3ZRCA 1KH0A 3EFUA 2MQJA 2JRHA 1OEYJ 2GBJA 2BQQA 2MJDA 2ZCBA 1OEYA 1YQBA 2MBQA 1YJJA 3ZNID 3K9OB 5C2TB 4YXDB 2Z8LA 1E9MA 1WGRA 3PHWB 4AWJA 2JQRB 1NI2A 2HD5B 1OTRB 4XX5A 4W9DA 2LXCA 1AARA 3DHIC 2KHWB 1TKGA 1XLQA 2CU3A 2DBYA 1FNUA 3EA6A 1SSNA 3M3JA 2ACZB 1MI0A 1ZKHA 1GJZA 4F7ZA 3PZ7A 2M1MA 4BOSC 4N6EB 3P42A 2KWVB 1ZUD2 1E8XA 5H92C 1WZ3A 5C1ZA 2LXAA 2WNMA 2NBUA 1T0SC 2I2YA 4NAWB 3W1SA 4LCDE 3ZO5B 2MBEA 3EGRA 2WGSA 3Q69A 1ZW7A 1P9DU 2LRUA 3BYTB 1M4VA 2KACA 2GBRA 3K9PB 1L0VB 2W3RA 4QAYA 2WHIA 1TT5B 2DYBA 2QEJC 2KLCA 1E8YA 5IN7A 1WI0A 1YX5B 2WXMA 2KQ7A 2LUEA 3AH7A 4IWQA 1NI3A 3RULA 1WX7A 4XDCA 3A1QA 2N9KA 2KWCA 1MVKA 2EMTA 4B0EA 3IAS1 5BMGA 3N30A 4LDTB 2KFKB 4JWUC 5JH5C 1Q5WB 3APFA 1LQBA 1S1QB 4LDTD 3RMKC 1D5XC 1P7FA 1R7SA 2ZPNA 5HG2A 3DBHI 2JSVX 2YEPB 1NVID 1A5RA 4H2AA 4AUQC 1WXMA 3E56A 1SEBD 4A9AA 3O65B 1I4PA 3ZKJC 3BWUD 5BYSA 1NDDA 2EKEC 2WXGA 2JZZA 3R3MA 2FUG1 3N20C 1WX8A 5J17A 1PFDA 2BS2B 2KFJA 4LNIA 3R2IA 2PIAA 4IG7B 2Q5WD 1F0ZA 2LI5A 4K7UA 2G9HD 5LLIA 3DVNV 3TSSA 2DWQA 1XQQA 2BTEA 3A4SC 2IO3B 4ASWC 2JWZA 3QC8B 5D6JB 1L6VA 2DAFA 1OQYA 1RFKA 1OFFA 3T3OA 4S0RA 3TEZA 2W3SA 4AJYB 3QQ8B 1GAQB 4A3PA 4NQKE 1VRAB 3AV8A 4ZOHC 2LVQA 2RDBC 4RGOS 1ZDVA 2HTHA 1MG8A 2ZNVC 1LXDA 2WXPA 3B08A 1LFDA 4OZCA 1I35A 1SF0A 1R4MB 3JSVB 4KX6B 1FO4A 1WR6E 1M94A 1PDXA 4FJYA 4WWMA 2M19A 1SE9A 1JMLA 1I7HA 1D5MC 3QWZB 3PLVA 3N1XC 1N60A 4K7SA 2CR5A 2Z0EB 4NAMA 3PGEA 2IO0B 1ZXIA 2QIEB 3R66C 3QA8A 3TUOA 2M0AA 5GXGB 3NZSA 5L95C 2J0KA 3EHVA 1NYQA 2M0XA 2V9HA 2ICIA 3PVLA 4OVZA 1V6EA 2G4DB 2OJWA 2KTRB 4MH0E 4HJKA 4MM3A 1BMLC 2OJRA 1J0GA 2A5UA 4ANUA 4BKGA 3V6CB 4GU2A 4G50A 5AZGA 3Q3FA 4CHKA 1Z2MA 2RPQA 3N1ZC 5D3DA 4E71A 3I63C 3JYUA 1BXTA 3TEYA 4G0NB 3PRZA 1MHXA 4JQWC 3SU8X 5C23A 3Q8EA 2HE7A 1XO3A 5IO9A 1T3QA 4WURA 1WR1A 2ZJDA 2WXNA 1F52A 4HXDA 4DXGA 2KDFB 4MSMB 4EUTA 3LJ3A 3OJ3A 4HLEA 4W9IA 3KWLA 2J53A 3NZ3A 1DOYA 1CZPA 3DBRI 1RFAA 2Y5PA 3ZXVA 3QK0A 2N9XA 1SE4A 4XC2A 2BBCA 3WA0A 1PYWD 2Z0DB 2LVOA 1T5XD 4FJVB 4WIPA 3TMPB 2MRPA 3DWMA 4JPSA 2K8CA 2V4LA 2D3BA 2PLPA 1P3QU 2INPE 3V05A 2V3NA 2XK5A 2J0MA 4MJSA 3SDLC 1WF9A 3ZQ4A 3AI5A 2DNFA 2DZMA 2K39A 2WU5B 3TIXA 4PK1A 3WCQA 3NUHB 3CSFA 1EWYC 4A3OA 5E6JA 2QILA 2JYTA 4NJ6A 1FPYA 5FR3A 4PYZA 2HJ8A 1WZ0A 2K3UA 2PKOA 3LXFA 4BAXA 1J8CA 4KIKB 1YOVB 2H88B 3L17A 3P4RB 4GGQA 4TKNA 3IHPC 5DPRA 3VFKA 4HJGE 1K53A 3NJTA 3Q8AA 5BMHA 1WXAA 4WJPA 3JVZX 3AEBB 3M95A 2L8JA 2L52A 2NR2A 3KVFB 3OG5A 1FEHA 4WAFA 2KQSA 2KLGA 2KZRA 2WXKA 3R7QA 2G3QB 1CJEA 3AEFB 3A9KB 3A4RA 3AE7B 3QJZA 4AP4C 2NCNA 1HQRD 1P0RA 4ACFA 2KT7A 1WX9A 5E6NA 2V4IB 1JWAD 3RD2A 3AE8B 1XEEA 4WAAA 1FFVA 4DHJB 2BWFA 3FILA 3R8BA 4B95A 1U4AA 3B2FA 2QJLA 3V6EB 4XYCA 2G1EA 2KJRA 3TCAA 2I1KA 2WXRA 4I6NB 1F2RI 4MGZE 3B0AA 1ET9A 3P2BA 4KV2A 3FAHA 3Q6BA 4M00A 4S17A 1KLGD 2RDGA 4WWPA 2LVPA 1MG4A 3D32A 2ON8A 1CQVA 2LD9A 1WJNA 4MACA 2AQ1B 2KD0A 4K1RB 2BWES 2MW5A 1HXYD 2DLBA 1VR9A 1KLVA 2WX0A 1KOTA 2PJHA 2MJ3A 3DBLI 4PT5A 4A8XC 2ZCCA 4RFBA 2J42A 1KF6B 3U7DA 5DPWA 2PVOD 2BYFA 2XBBC 1IP9A 3P4QB 1SXTA 1DYQA 2KTFA 1CMXB 2WDTB 2BB6A 1XT9B 1SIJA 2MA9B 3NG0A 5BYQA 2KYWA 5EE0A 5IKCM 3ONSA 3QAQA 1XLPA 4YL8A 5KHOA 1I4QA 1V86A 3M62B 1TIFA 2XN9C 2RGFA 4OHJA 1UELA 2WQYB 2WU2B 3B2GA 2V3SA 3VHTC 1D6EC 4JX1C 1DOIA 2INNE 4KKIA 2RMMA 2IDYA 3AECB 1FXIA 1V97A 1RYJA 2Y5BB 4JLCA 1EF5A 2LASA 1WMHB 5DPSA 4GDKA 2IGHA 4ZRKA 1UZXB 4KGTA 5JHBA 2DZJA 3DOWA 2GBNA 2MP2A 2YEPF 5DCNA 5BMIA 2L83A 1S3SG 1FCCC 1N5WA 3GOEA 1L0YB 3HK0A 2MJEA 4C7YA 2ZVOA 3CSTA 2PVGC 3W9CB 2KVRA 4IKGA 4NNJB 3RCZA 3AU4A 4JGHB 2NTTA 1IBXB 2LHDA 5EE1A 2ZVNA 2AYOB 3UIOB 2KWDA 1STEA 5E6OA 4L1BA 4JIOU 1CK1A 3DQVA 4K7WA 3RNFC 4HKQA 5GMVA 3J9CA 5IA7A 4RMAA 1FXTB 1QZEA 1L4ZB 4US9A 2LWPA 3A33B 2KDBA 2JY6A 5TR5A 2A4ZA 1L7YA 5JZEB 1GB4A 1R4MI 1SE3A 2AEHA 2MSED 1K50A 2WXHA 3AE6B 1XLOA 2QHOA 3VAWA 1DGJA 3NHEB 4IDIA 1OQRA 2KMAA 4X57B 3DHHC 3PREA 1WXQA 4W9EA 3APDA 3KW5B 1SBBB 1V1OA 4GDLA 3GB1A 1QQRA 3L0WB 2LMCA 3ALBA 2IY0B 3ABVB 1J7BA 4MGYE 1OQQA 4AS1A 5TSSA 1IGDA 1HTQA 3DPDA 1P98A 2DYMA 2KQ4X 2E3TA 2WDRB 2XEWA 3RT3B 5BYRA
chains in the Genus database with same CATH topology
3AN1A 2M19A 2QMTA 4RF1A 1P7EA 3NVVA 1MHHE 2WXQA 5T8IA 2WXFA 2MEKA 4C56C 4C80A 1B1ZA 1L0XB 3HRDD 1NYRA 3NVWA 1EU4A 5FKAC 1YN5A 1JMLA 1I7HA 1L4DB 3W2DA 1D5MC 3LYYA 5D3IB 4D2KA 3BYYB 4RGMA 2WXOA 3E9SA 2FBWB 4USAA 4REZA 1YNTE 1QF6A 1WSPA 4WQMA 1N60A 3TEWA 3ZJUA 1TS4A 2BB5A 1YN3A 1FRRA 4NAMA 1FNVA 2JX5A 3I9V1 2AQ2B 2DYOA 3P4PB 1SE2A 5AUKA 5JXVA 1ZXIA 2QIEB 2Y3AA 2BS4B 2HTME 3TUOA 4DQOC 2M0AA 5GXGB 1TZOA 2LGIA 3MHZA 1I4GA 1NYQA 4XWTA 3VRAB 1NENB 4OVZA 2ICIA 2LUMA 4ARIA 1IUEA 1K52A 1L6UA 2MH7A 4XE0A 1FFUA 1YQ3B 3R2TA 4KGSA 3H8HA 1UWXA 1BMLC 3BVMA 5D7GA 1TKEA 1V1PA 2BS3B 3PO0A 4ZHPA 3AE9B 4R3DA 2JYEA 4MT5A 3KWVA 2N9LA 1EWCA 2WS3B 1EU3A 2K22A 4ITKA 1A70A 1FXAA 1WWTA 1YJIA 1MPEA 1K51A 5D3DA 1JCKB 2LFIA 1TKYA 1YQ4B 1BXTA 4RH6A 3TEYA 1HZ6A 3U7ZA 2WDVB 3T3NA 2X38A 1E0ZA 1MHXA 3IAM1 4HKZE 1VJKA 2V0GA 3HVDA 2IJ0A 1RM6C 1JWMD 2OHFA 3Q8EA 1Q10A 1XO3A 1AWDA 1T3QA 4WURA 3FC4A 1ET6A 3BVGA 5LNK1 4J3OD 3DWGC 1XXGA 2WXNA 3EUB2 1KLUD 3P1MA 4C7ZA 2BW2A 2XNAC 4DXGA 1N5XA 2AQ3B 2H89B 4GDKB 4TMAB 4HROA 1N63A 2N7JA 2AX5A 2WP9B 2J52A 2GRIA 3KWLA 4KGRA 1XCTL 2J53A 3KLSX 3NZ3A 1DOYA 3Q8CA 1CZPA 5HHDG 2Y5PA 3GP7A 1D4BA 1SB3C 2WXIA 1SE4A 1D5ZC 2WXLA 2JU6X 4RCOA 2BBCA 2LHEA 1PYWD 1T5XD 4WIPA 4A6QA 1J7AA 3DWMA 5G5GA 4JPSA 4RGTA 3AE4B 5HI1A 2PLPA 2INPE 1BUIC 3V05A 3AE3B 1I4XA 2V3NA 1QOFA 1IBXA 1JWUD 2KAJA 3NS1A 2L1AA 3AE5B 5FK9C 2R61A 3ZQ4A 2WXJA 2EKIA 1L5PA 4EE2A 3P4SB 1VDVA 3CIRB 3NVYA 2WU5B 4TQ0A 3ZGZA 2LEKA 2ONQA 3WCQA 1C4PA 3NUHB 2SEBD 4YWGG 3UI3A 3VR9B 1HZ5A 3MP9A 1EWYC 2TSSA 5E6JA 2QILA 2JYTA 4XDDA 1TS3A 4YT0B 1IGCA 3NRZA 1KRHA 4ZRQA 4YTMB 5FR3A 3MFGA 3MC0B 1PGAA 3TEXA 4YSXB 3ZJTA 2K3UA 1C77A 2CJNA 3AEEB 1AN8A 1TY2A 3KQ4A 2PKOA 1N62A 5H8YE 3LXFA 2RDHA 3AEAB 3N9YC 3U2SC 2B76B 2H88B 3AEGB 3P4RB 2N0SB 4YSZB 2PTLA 4HJGE 1K53A 2W55A 1FMAD 1GPXA 1C76A 4ZRPA 3Q8AA 3P63A 4GDLB 1UGJA 4HRSA 3L4PA 4HEA1 2GB1A 2KMMA 4O1NA 4JE3B 1QOBA 3AEBB 3BK2A 3AM9A 1C78A 2L52A 1FEHA 4N58A 4WAFA 4P6VF 2JWUA 2WXKA 1CJEA 1PUTA 3U4EG 3AEFB 3RFZB 3MJ5A 4OZAA 3AE7B 2Y5CA 4NZLB 1ZP0B 3BZDB 3SR6A 2IPKD 1HQRD 1C9FA 1XF5L 1VLBA 4LLGM 3VQIA 2V4IB 4XWWA 3SFEB 5BMHA 1JWAD 4JWSC 1UUPA 4N59A 3AE8B 3IT6B 5BYRA 4YSYB 2ZW0A 3AE1B 1XEEA 4L23A 1FFVA 3Q8FA 1HEZE 2SAKA 1FCLA 3FILA 2K5PA 2WLBA 2IGGA 3IXSA 3R8BA 1FRDA 1FD6A 3B2FA 5I4DA 2QJLA 3BIID 1ZXHA 3SEBA 1I4HA 2W54A 2KN4A 4TSSA 1KH0A 2G1EA 1PGXA 1E10A 2MJDA 2WXRA 1YJJA 2BYTA 3HVZA 1F2RI 3LB8C 1C4CA 5C2TB 1ET9A 4YXDB 3IT4B 3BK1A 2Z8LA 2QSDA 3FAHA 1E9MA 1KLGD 2RDGA 5MPOA 1UWMA 1FNWA 1E6EB 2ON8A 2JQRB 1CQVA 3URYA 3W5VB 4A90A 1ZDXA 3SFDB 1XCQL 1GB1A 4YTNB 4MACA 1QOAA 2AQ1B 1TKGA 1XLQA 2V3PA 2CU3A 2DBYA 1FNUA 1HXYD 2DLBA 1VR9A 3EA6A 1SSNA 1SJED 2ACZB 1V8CA 2E6XA 2MJ3A 4MM3B 4PT5A 4A8XC 1MI0A 2K9XA 1V1PB 1ZPSA 4RFBA 3HUIA 2J42A 3Q8BA 1KF6B 2PVOD 3P4QB 1SXTA 1DYQA 2JZPA 4GLSC 2VZKB 3PZ7A 1VZ6A 2J4XA 5AUIA 1JWSD 4NJCA 4N6EB 3P42A 1JQ4A 1EM7A 2BB6A 2GI9A 3BVZA 2VZKD 1ZUD2 1SIJA 3U52E 3PZ8A 4ZYSA 4AQ7A 5H92C 2L32A 5BYQA 5EE0A 2WNMA 1ACCA 3AB5A 1KFYB 2KDMA 1JROA 1DOXA 1XLPA 1LO5D 3OWEB 2I2YA 4NAWB 1I4QA 3W1SA 3V3XA 2RPVA 2XN9C 3EGRA 4FXCA 4OHJA 3Q69A 2WQYB 1AW7A 3BYTB 1M4VA 2KACA 1KTKA 4RGNA 2WU2B 2HDEA 2W82A 1L0VB 2W3RA 3B2GA 4RF0A 4UDUC 3NVZA 1D6EC 2QEJC 4JX1C 1DOIA 1XLNA 2INNE 2LJIA 2RMMA 4KKIA 4MH8A 2IDYA 3AECB 3VR8B 5EE3A 1FXIA 1V97A 4B0MA 1Y56A 1E7PB 1RYJA 1TYGB 2WXMA 3AH7A 4OW0A 1TJEA 1TY0A 1NI3A 2IGHA 4KGTA 3I57A 5BMIA 1F2RC 2YEPF 2L83A 4XDCA 1FCCC 1N5WA 2JXTA 3CWIA 2N9KA 3GS2A 4YTPB 5EE9A 1JW9D 1MVKA 1L0YB 2M56B 4B0EA 3IAS1 5BMGA 2MJEA 3AE2B 2FE8A 4C7YA 4JWUC 2PVGC 3W9CB 4IKGA 1D5XC 1P7FA 4KKJA 4WH4A 1WGKA 1C4AA 2D5GA 1R7SA 5HG2A 1IBXB 2NTTA 1WRIA 2NMQA 2JSVX 2YEPB 1NVID 2I38A 2LHDA 4TQ1A 1VZ8A 2K0PA 5EE1A 1ZE3D 1STEA 2KWDA 4H2AA 4L1BA 1JWBD 3E56A 2NTSA 1CK1A 1WYGA 1SEBD 1J7CA 4A9AA 1I4PA 1B9RA 1PGBA 2OEDA 1VZ7A 4LTUA 4DXFA 3BWUD 1QOGA 2PMVA 4HKQA 4P16A 5BYSA 2WXGA 3J9CA 1ROEA 2FUG1 1L4ZB 4US9A 1PFDA 2BS2B 1N61A 3R2IA 4IOIE 1ESFA 3W5UB 1GB4A 2PIAA 2Q5WD 1F0ZA 1SE3A 2WDQB 1F77A 1K50A 1FIQA 2WXHA 2G9HD 3AE6B 2EELA 4L2YA 4OZBA 1XLOA 3TSSA 1DGJA 2DWQA 1NEKB 3ZJVA 1YN4A 3AMZA 2BTEA 1QKZA 1SJHD 2CJOA 4IDIA 1OQRA 1QLBB 4RNAA 1L6VA 5HFYA 1TS5A 1I4RA 5G5HA 2IGDA 1WXQA 1RFKA 1OFFA 4M0WA 3T3OA 4CQNA 3AEDB 4ZHOA 1SBBB 4ARCA 1YMHE 1GOZA 1QILA 3ETRA 3TEZA 1V1OA 2W3SA 1AYFA 3B9JA 1HA5A 1GAQB 2PW9A 1JALA 1VRAB 3AV8A 3GB1A 4ZOHC 1QQRA 1UNSA 2LMCA 3ABVB 4RGOS 1ZDVA 2ZW1A 1RWSA 1T6BX 3RPFC 3VRBB 1J7BA 2WXPA 2BT6A 4LK0M 4OZCA 1FM0D 1OQQA 4A55A 1SF0A 5TSSA 1IGDA 1C79A 4AS1A 1ENFA 1JRPA 1ZOYB 2DYMA 1TS2A 3C8YA 3O13A 4Q2JA 1QT9A 4KX6B 4US8A 2KQ4X 1FO4A 3FILB 2E3TA 2WDRB 5C3JB 1PDXA 3ZYYX 4WWMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AN1 A;  3KWL A;  2M19 A;  2K5P A;  3NVV A;  1DOY A;  1CZP A;  2WLB A;  2L83 A;  1N5W A;  3CWI A;  1FRD A;  4YTP B;  4C80 A;  5EE9 A;  1JW9 D;  3HRD D;  2M56 B;  3B2F A;  1SB3 C;  1NYR A;  2QJL A;  3BII D;  3NVW A;  2MJE A;  3AE2 B;  4C7Y A;  1I7H A;  4JWU C;  2PVG C;  3W9C B;  2W54 A;  2G1E A;  1E10 A;  2MJD A;  2FBW B;  1J7A A;  4USA A;  1QF6 A;  3DWM A;  1WGK A;  1YJJ A;  5G5G A;  1R7S A;  3AE4 B;  3HVZ A;  1N60 A;  3LB8 C;  4WQM A;  5C2T B;  1WRI A;  4YXD B;  1NVI D;  5EE1 A;  1FRR A;  3AE3 B;  3FAH A;  2JX5 A;  1E9M A;  1QOF A;  1JWB D;  5MPO A;  2KAJ A;  3NS1 A;  3AE5 B;  1UWM A;  1E6E B;  1WYG A;  3P4P B;  4A9A A;  1J7C A;  2JQR B;  2EKI A;  5AUK A;  1ZXI A;  2QIE B;  3W5V B;  2BS4 B;  3SFD B;  2HTM E;  1B9R A;  4LTU A;  1L5P A;  5GXG B;  1QOG A;  4YTN B;  1QOA A;  3P4S B;  1VDV A;  3CIR B;  3NVY A;  1ROE A;  2WU5 B;  1NYQ A;  1TKG A;  1XLQ A;  2CU3 A;  2DBY A;  2LEK A;  3VRA B;  1NEN B;  3WCQ A;  4US9 A;  1IUE A;  1PFD A;  1V8C A;  2ACZ B;  2BS2 B;  2MJ3 A;  3VR9 B;  1L6U A;  2MH7 A;  2K9X A;  1N61 A;  1FFU A;  3HUI A;  1EWY C;  1YQ3 B;  1KF6 B;  2PVO D;  3W5U B;  4YT0 B;  3P4Q B;  3NRZ A;  2PIA A;  2Q5W D;  1KRH A;  1TKE A;  2BS3 B;  4YTM B;  3PO0 A;  1F0Z A;  2WDQ B;  5AUI A;  4ZHP A;  4N6E B;  3AE9 B;  1FIQ A;  4YSX B;  3AE6 B;  1JQ4 A;  1XLO A;  1DGJ A;  2DWQ A;  1NEK B;  2CJN A;  3AEE B;  3AMZ A;  4IDI A;  2CJO A;  1OQR A;  1SIJ A;  1ZUD 2;  2WS3 B;  1QLB B;  1N62 A;  2PKO A;  5H8Y E;  2K22 A;  3LXF A;  4ITK A;  5H92 C;  1A70 A;  1L6V A;  1FXA A;  3AEA B;  1WWT A;  5EE0 A;  2B76 B;  5G5H A;  2H88 B;  1YJI A;  3AB5 A;  3AEG B;  1WXQ A;  1KFY B;  1RFK A;  2N0S B;  1JRO A;  3P4R B;  4YSZ B;  1XLP A;  1OFF A;  1DOX A;  2W55 A;  1FMA D;  1GPX A;  3AED B;  4ZHO A;  1TKY A;  3P63 A;  4HRS A;  1YQ4 B;  3L4P A;  2KMM A;  4FXC A;  1QOB A;  2WDV B;  3AEB B;  3ETR A;  2W3S A;  2WQY B;  1E0Z A;  1AYF A;  3B9J A;  3AM9 A;  1GAQ B;  1VJK A;  1JAL A;  3AV8 A;  4ZOH C;  2L52 A;  2WU2 B;  3B2G A;  1L0V B;  2W3R A;  1RM6 C;  4N58 A;  2OHF A;  3NVZ A;  3ABV B;  1XO3 A;  4P6V F;  1AWD A;  1T3Q A;  1CJE A;  1PUT A;  4JX1 C;  1RWS A;  3AEF B;  1DOI A;  1XLN A;  3FC4 A;  3RPF C;  1J7B A;  3VRB B;  2BT6 A;  1FM0 D;  3AE7 B;  2Y5C A;  1ZP0 B;  3AEC B;  3SR6 A;  3VR8 B;  3DWG C;  1OQQ A;  5EE3 A;  1FXI A;  1SF0 A;  3EUB 2;  1V97 A;  1JRP A;  1VLB A;  1ZOY B;  3P1M A;  4C7Z A;  1N5X A;  2H89 B;  1E7P B;  1RYJ A;  1TYG B;  3SFE B;  3AH7 A;  1JWA D;  4HRO A;  4JWS C;  1QT9 A;  4KX6 B;  1N63 A;  1TJE A;  4N59 A;  4US8 A;  3AE8 B;  2AX5 A;  1FO4 A;  1NI3 A;  2WP9 B;  2E3T A;  2WDR B;  3AE1 B;  4YSY B;  1PDX A;  5C3J B;  1FFV A;  3ZYY X;  4WWM A; 
#chains in the Genus database with same CATH topology
 5J2R A;  2FCM A;  1P7E A;  4IWO A;  2MHJ A;  3VH4 B;  2WXQ A;  4FJZ A;  1T0R C;  3KH0 A;  2MEK A;  3HM6 X;  1F9J A;  2KMC A;  1TBE A;  2BF8 B;  3HRD D;  1Q1O A;  4WWN A;  2L3Z A;  2KWU B;  3DBL B;  1WGY A;  5D3I B;  2WXO A;  3E9S A;  2ZEQ A;  1QF6 A;  1WSP A;  1WE7 A;  1YN3 A;  3ZNH B;  5E6P A;  3C19 A;  4ZYN A;  3I9V 1;  1WJU A;  5JXV A;  3DVG X;  2BS4 B;  2KDI A;  3PRP B;  2MBH A;  2BYV E;  1E7U A;  1N6Z A;  3PTF C;  4DWF A;  1I4G A;  3QCA A;  3WAP A;  2LUM A;  4MEM A;  4XE0 A;  1H8C A;  3R2T A;  4KGS A;  4DXA B;  3H8H A;  1UWX A;  4F1S A;  5D7G A;  1V1P A;  3A9J A;  3PO0 A;  4EFO A;  4ZHP A;  2IZV B;  2FCQ A;  4R3D A;  2B3A A;  4PS8 A;  4MT5 A;  1WH3 A;  1LGR A;  2LGX A;  1A70 A;  2D3C A;  1FXA A;  4NPN A;  1MPE A;  5CHW A;  1TKY A;  1HZ6 A;  2X38 A;  1E0Z A;  5G2N A;  4PS7 A;  2V0G A;  4HKZ E;  2IY1 B;  4P1C C;  1F1H A;  1RM6 C;  1JWM D;  1Q10 A;  2K25 A;  4OVU A;  3BIN A;  1ZGU B;  4DDG D;  3BVG A;  4J3O D;  2MLB A;  3DWG C;  4URK A;  3CMM B;  2XNA C;  4EEW A;  2FAZ A;  3UGB B;  2AX5 A;  2WP9 B;  3IBE A;  1LM8 B;  2KX0 A;  5IP4 D;  2K8B A;  1V81 A;  3Q3O C;  5FR6 A;  2DX5 B;  1SB3 C;  2G45 B;  4FUL A;  2LZ6 A;  3IFW B;  2WXL A;  1E90 A;  2LHE A;  2K8H A;  2JXX A;  1RAX A;  1J7A A;  3DHG C;  3QAR A;  5G5G A;  2RD0 A;  4HCP B;  2KDE B;  5HI1 A;  1T0Q C;  4EZK A;  2KTR A;  2QDF A;  1JWU D;  2KAJ A;  3NS1 A;  2L1A A;  3AE5 B;  5FK9 C;  2R61 A;  2WXJ A;  2K6D B;  1L5P A;  4TQ0 A;  4W9G A;  3ZGZ A;  2LEK A;  3ZNG C;  5KHQ A;  2YLM A;  4KZ0 A;  1UGM A;  3CF6 E;  2SEB D;  3UI3 A;  2GBK A;  1YX6 B;  3MJW A;  4W9L A;  1Q0W B;  4YT0 B;  2WX1 A;  4ZRQ A;  4YTM B;  1PGA A;  4IUM B;  3U8Z A;  1C77 A;  3AEE B;  1AN8 A;  4K3C A;  1P1A A;  1V2Y A;  2RDH A;  3N9Y C;  1WXS A;  3AEG B;  4NY0 A;  3C0R B;  2PTL A;  1GPX A;  1C76 A;  4ZRP A;  4O1N A;  4HRS A;  2KMM A;  1QOB A;  2D3A A;  2IYD B;  3X0W A;  2JWU A;  3U4E G;  4I6P A;  3VTV A;  4OZA A;  3WAN A;  4NZL B;  3SR6 A;  3DVG Y;  1R4N I;  1C9F A;  4LLG M;  2REX A;  3PLU A;  2N1W A;  3SFE B;  3ENE A;  4JWS C;  1UUP A;  4N59 A;  2ZW0 A;  3AE1 B;  4L23 A;  3GZN I;  1HEZ E;  2SAK A;  1WM3 A;  1FRD A;  4WJQ A;  4ANV A;  1I4H A;  2KN4 A;  4TSS A;  2K1F A;  3LDZ E;  2KX3 A;  4K81 A;  3RNB C;  2C7M B;  1V49 A;  4MGK E;  3AU5 A;  2BYT A;  3HVZ A;  4E74 A;  4LNF A;  1D3Z A;  3V62 A;  3UQA A;  4G3X B;  2QSD A;  3DBS A;  1E5W A;  1UWM A;  1FNW A;  4NJ7 A;  2M17 A;  3URY A;  3W5V B;  1ZDX A;  1E8Z A;  1G6J A;  4NQL B;  1V5T A;  2V3P A;  1HE8 A;  4KSL C;  2E6X A;  1V8C A;  3NZU A;  4MM3 B;  4BKT A;  2K9X A;  1ZPS A;  3Q8B A;  2MWS B;  2GOW A;  2BPS A;  4GLS C;  1TTN A;  4IC7 B;  2VZK B;  2J4X A;  5AUI A;  1JWS D;  1JQ4 A;  3FKY A;  2FUH B;  2GI9 A;  3BVZ A;  2VZK D;  3H7P B;  4ICV A;  2D2Q A;  4LJO B;  4GXB A;  4ZYS A;  4AQ7 A;  3WAM A;  2O2V B;  1DOX A;  3OWE B;  3V3X A;  2UU7 A;  1EUV B;  3T9L A;  2C5L C;  3WAL A;  1KTK A;  4RGN A;  2L0T A;  2GLS A;  2HDE A;  2W82 A;  2AWT A;  3RNG C;  4UDU C;  3NVZ A;  3PT2 B;  2J7Q B;  1IYF A;  4HPP A;  1XLN A;  4MH8 A;  3ZVV A;  1WM2 A;  1TZ1 A;  2CS4 A;  3VR8 B;  4GB9 A;  4MDK E;  3L08 A;  1Y56 A;  1TYG B;  3KYD D;  3M63 B;  3OAW A;  2VH1 A;  1F2R C;  2PPH A;  3DVN U;  2JXT A;  3CWI A;  5EE9 A;  1JW9 D;  2FID A;  2JUO A;  4HCN B;  3N1Y C;  2BGF A;  1GNU A;  2NPT A;  1EO6 A;  4BFR A;  1WFY A;  1WGK A;  1C4A A;  3H1U A;  2XK5 B;  4MJS B;  1WRI A;  3PPA A;  2NMQ A;  2KC1 A;  4TQ1 A;  4C4V A;  2V1Y A;  2K0P A;  3DDC B;  2QCZ A;  4A20 A;  3PS6 A;  3U30 A;  1J7C A;  4IWP A;  4TV3 A;  4M01 A;  5CHF A;  1B9R A;  2OED A;  4LTU A;  4DXF A;  4EOY A;  2PMV A;  2KJH B;  2CHX A;  1ROE A;  2OOB B;  2C7H A;  4MEL A;  2ZNV B;  1N61 A;  4IOI E;  1ESF A;  3W5U B;  2WDQ B;  1F77 A;  1EF1 A;  4DQO C;  4OZB A;  4L2Y A;  2EEL A;  4WQO B;  3W1Y A;  1R4N B;  1NEK B;  1OGW A;  1YN4 A;  3AMZ A;  2N7E A;  1QKZ A;  3ZJV A;  2CJO A;  2D10 A;  1QLB B;  4RNA A;  5HFY A;  1TS5 A;  1I4R A;  2WYQ A;  3GZN B;  4M0W A;  3KUD B;  4CQN A;  4ZHO A;  4IM3 A;  4ARC A;  1YMH E;  1GOZ A;  3B9J A;  1WMH A;  2DAJ A;  1JAL A;  2O6V A;  2ZW1 A;  2D11 A;  1RWS A;  4LK0 M;  1FM0 D;  4WWO A;  2VH2 A;  3N3K B;  1C79 A;  1JRP A;  1L2N A;  4F8C B;  3L54 A;  4HDO A;  4Q2J A;  3OLM D;  4US8 A;  3DCG A;  3FIL B;  5C3J B;  5AZF A;  2N9P C;  1RLF A;  3AN1 A;  4XZ4 A;  5T8I A;  2WXF A;  4N9F 4;  4C80 A;  1I42 A;  3NVW A;  1EU4 A;  1YN5 A;  4ZRJ A;  3W2D A;  2J0J A;  1C1Y B;  2NBW B;  4RGM A;  3GE3 C;  2FBW B;  4USA A;  2D3G A;  4WQM A;  2CKH B;  3HM3 A;  3TEW A;  2L05 A;  1TS4 A;  1FRR A;  1J19 A;  1FNV A;  2JX5 A;  2DYO A;  1SE2 A;  5AUK A;  2HTM E;  3KUZ A;  3UIP B;  2LGI A;  3MHZ A;  3KYC D;  1K52 A;  2N4F A;  2W9N A;  1FFU A;  1YQ3 B;  4W9H A;  3BVM A;  3TBL D;  3HHM A;  3ECI A;  3ML8 A;  4BBN F;  1Y8R C;  2I1J A;  4KZC A;  1E8W A;  3VTW A;  2N9L A;  1EWC A;  4ICU A;  2WS3 B;  3TL5 A;  1EU3 A;  2PE6 B;  2K22 A;  4M8M A;  1WWT A;  2R2Q A;  2DZI A;  3RZW C;  2M4N A;  1JCK B;  2LFI A;  2WDV B;  4NAW A;  3IAM 1;  1UD7 A;  3HVD A;  2LJ5 A;  2IJ0 A;  2BYE A;  2OHF A;  1WY8 A;  2JPH A;  1AWD A;  4K3B A;  1RRB A;  2CHZ A;  3PV1 A;  1XXG A;  3EUB 2;  1KLU D;  3P1M A;  1WYW B;  2BW2 A;  2JVC A;  1N5X A;  4GDK B;  4TMA B;  4FN2 A;  1N63 A;  2EMS A;  2N7J A;  2MP2 B;  5HKH A;  2J52 A;  4AJW A;  2GRI A;  3NS8 A;  4KGR A;  3WIM A;  1XCT L;  4W9K A;  3Q8C A;  4M02 A;  4FA6 A;  4DDI D;  2L76 A;  2MBB B;  4DHZ E;  1D4B A;  2JF5 A;  2KFK A;  4OVV A;  4HVB A;  4RGT A;  3AE4 B;  3Q3J A;  2JRI B;  3ZXR A;  5EDS A;  3MHS D;  3AE3 B;  1I4X A;  1QOF A;  2LGY A;  1WGH A;  4II3 B;  2EKI A;  4EE2 A;  3P4S B;  3NVY A;  1UF0 A;  2ONQ A;  3GE8 C;  1C4P A;  2KXJ A;  3VDZ A;  4YWG G;  3VR9 B;  4B9K A;  3ZIM A;  2TSS A;  4ZDV A;  1VCB A;  4IW0 A;  4FBJ B;  1TS3 A;  3H7S A;  3NRZ A;  4LJP B;  2LGD A;  2MX2 A;  5JHA A;  3MFG A;  3MC0 B;  2INC C;  3ZJT A;  4IM0 A;  2IO1 B;  2CJN A;  4ZRI A;  1TY2 A;  3KQ4 A;  4I6L B;  3AXC A;  5H8Y E;  1N62 A;  3PZD A;  2B76 B;  4YSZ B;  3ZDT A;  4HPL B;  4A6Q A;  3P63 A;  4GDL B;  3L4P A;  4HEA 1;  3V60 A;  1WGG A;  1PUT A;  4BVU C;  3RUI B;  3RFZ B;  3MJ5 A;  2ZPY A;  2Y5C A;  3UIN B;  5D94 A;  2IPK D;  1VLB A;  4GN1 A;  3VQI A;  3BY4 B;  2GBM A;  3RN9 C;  4WJN A;  3IT6 B;  4YSY B;  2N1V A;  3JSV A;  1FCL A;  4PS3 A;  2IBI B;  2IGG A;  4HK2 A;  1FD6 A;  3WAO A;  3BII D;  1K8R B;  4B6W A;  4XGA B;  1PGX A;  1E10 A;  5LXI B;  4FLH A;  4LNO A;  1GC7 A;  3LB8 C;  1C4C A;  3IT4 B;  3BK1 A;  2DHZ A;  4KSK C;  3PSE B;  3A1Q B;  3ZRF A;  1PQS A;  4E3C A;  5MPO A;  3QX1 A;  1UBQ A;  1E6E B;  4A90 A;  3B1L X;  3SFD B;  3UF8 A;  2ZZP B;  1XCQ L;  1GB1 A;  4YTN B;  1QOA A;  2AL6 A;  4DHZ B;  1UBI A;  3NY5 A;  5G55 A;  1SJE D;  3OJ4 B;  4BKS A;  4HDQ A;  2RR9 A;  1V1P B;  3A9J B;  3HUI A;  1IPG A;  2KN5 A;  2LGS A;  2JZP A;  1VZ6 A;  4NJC A;  3R7R A;  2MCN B;  1EM7 A;  2JZ3 B;  5CHV C;  5BO4 B;  3VH3 B;  3U52 E;  3PZ8 A;  3I5J C;  3EC8 A;  2L32 A;  3ZUN A;  4KVG B;  1ACC A;  3AB5 A;  1KFY B;  2KDM A;  1JRO A;  1LO5 D;  4EKU A;  2RPV A;  4FXC A;  1WRD B;  4EZL A;  1AW7 A;  4FAD A;  4RF0 A;  4AOF A;  2GMI C;  2NS5 A;  2LJI A;  2KO3 A;  2WWZ A;  1SGH A;  5EE3 A;  3Q3N C;  4B0M A;  2KOX A;  2KAN A;  2MBO A;  1E7P B;  4OW0 A;  1TJE A;  2KVZ A;  1TY0 A;  4RM8 A;  4RM9 A;  3I57 A;  3HIZ A;  3EEC A;  4LNN A;  4ANW A;  3GS2 A;  4YTP B;  4KDL B;  2M56 B;  3AUL A;  5D2M B;  3AE2 B;  2FE8 A;  5DPT A;  4BOZ B;  4EZJ A;  4BZA A;  5IAA C;  3S2A A;  3V61 A;  3N32 A;  1V80 A;  4KKJ A;  4BKS D;  4WH4 A;  1C3T A;  2FCS A;  2D5G A;  4FHJ A;  2KK8 A;  3RYT A;  2I38 A;  1VZ8 A;  2R2O A;  3VUW A;  1ZE3 D;  1JWB D;  2NTS A;  5IOI A;  1WYG A;  1BT0 A;  2FNJ B;  1Z5S B;  1PGB A;  1VZ7 A;  1MFW A;  1QOG A;  1H4R A;  4P16 A;  1KM7 A;  3H7P A;  4TUU A;  2L0F A;  3TJP A;  3RNE C;  2HJ1 A;  1WJ6 A;  2O2V A;  2L7R A;  3NOB A;  4MSQ B;  1X1M A;  2NBV B;  2CU1 A;  3ZW3 A;  4CYE A;  1FIQ A;  4GOC A;  1WE6 A;  5L83 A;  1SJH D;  3QHT A;  1E7V A;  1YIW A;  2DEN B;  3VUY A;  1NBF C;  5G5H A;  2IGD A;  3DBH B;  2KKC A;  3SD5 A;  3L10 B;  3AED B;  4KIK A;  4HPM B;  3MTN B;  1QIL A;  3ETR A;  1AYF A;  1HA5 A;  1HTO A;  2PW9 A;  1UNS A;  2BKF A;  4J6I A;  1V9J A;  1T6B X;  3Q2A C;  3RPF C;  3VRB B;  2BT6 A;  4CO7 A;  2YVC A;  4A55 A;  3A9K A;  5CX3 A;  1ENF A;  1ZOY B;  2FCN A;  1TS2 A;  3C8Y A;  3O13 A;  1QT9 A;  2IO2 B;  4P7I A;  3EFC A;  3ZYY X;  3T8M A;  4RF1 A;  2QMT A;  1SIF A;  3H6N A;  3NVV A;  1MHH E;  4C56 C;  3SHQ A;  1B1Z A;  1L0X B;  1YJ1 A;  1NYR A;  5FKA C;  1L4D B;  2C7N B;  2IND C;  3LYY A;  2K6Q A;  4D2K A;  3BYY B;  2Z59 B;  1KJT A;  3PHX B;  2UYZ B;  4REZ A;  1YNT E;  1UH6 A;  2X8X X;  3ZJU A;  2BB5 A;  2BKR B;  3VXW A;  3JW0 X;  2AQ2 B;  3P4P B;  4ANX A;  2Y3A A;  3X23 A;  4GMV A;  2N7D A;  3MC8 A;  2N9E B;  1TZO A;  4XWT A;  3VRA B;  1NEN B;  4ARI A;  1IUE A;  1L6U A;  2C60 A;  2MH7 A;  1TKE A;  2BS3 B;  4WJO A;  4P1B C;  2NVU I;  2PE9 A;  3AE9 B;  2JYE A;  3IVF A;  3KWV A;  3IG3 A;  2JT4 B;  3PRM B;  4ITK A;  2FIF A;  3Q14 C;  4GSW A;  2VRR B;  1YJI A;  3RNC C;  3KUC B;  1K51 A;  4MGI E;  2BVC A;  2PEA A;  1YQ4 B;  4RH6 A;  3U7Z A;  3QIJ A;  2QC8 A;  3T3N A;  1VJK A;  3ZTD A;  4DHJ D;  2RSU A;  3FC4 A;  1ET6 A;  5LNK 1;  4W9F A;  2DZK A;  1WJ4 A;  5CTR C;  4C7Z A;  2AQ3 B;  2H89 B;  4HWI B;  4HRO A;  1GUA B;  2LRW A;  2KC2 A;  2UWQ A;  3W1S C;  4GIV A;  3KLS X;  5HHD G;  2NPT B;  3GP7 A;  1YD8 U;  2WXI A;  1D5Z C;  3ML9 A;  2JU6 X;  4BBN C;  4RCO A;  3VVW B;  3I3T B;  1VD2 A;  2KJ6 A;  4C4V B;  4M8N A;  3H9D A;  4PYU A;  1BUI C;  4II2 B;  4C00 A;  1IBX A;  3MC9 A;  4LNK A;  4W9C A;  3ZLZ A;  4DK5 A;  3ZNZ B;  1WXV A;  1WGD A;  1XD3 B;  1VDV A;  3CIR B;  3RNA C;  4DBG A;  5AZH A;  1MJD A;  4W9J A;  1WIA A;  5J18 A;  1HZ5 A;  3MP9 A;  1TGZ B;  4IM2 A;  3DBR B;  4XDD A;  1IGC A;  1KRH A;  2M8S A;  3L16 A;  3TEX A;  4YSX B;  3VUX A;  1ISN A;  1GG3 A;  4M0W B;  3AEA B;  5LXH A;  3U2S C;  2N0S B;  2W55 A;  1FMA D;  2G4S A;  1UGJ A;  4FHK A;  2GB1 A;  5AEK B;  4JE3 B;  2O6V B;  3Q3M C;  3BK2 A;  3AM9 A;  1C78 A;  4N58 A;  2O6V D;  2KNB A;  4P6V F;  3RZF A;  3APC A;  1ZP0 B;  3BZD B;  3VTU A;  2ASQ A;  4KDI C;  1XF5 L;  3ZTC A;  1GC6 A;  4XWW A;  3UQB A;  3L13 A;  1T0Y A;  2C9W B;  2L00 B;  3Q8F A;  4G11 A;  2K5P A;  2WLB A;  2AL3 A;  3IXS A;  4JL9 A;  2CHW A;  5I4D A;  2D07 B;  1V5O A;  1ZXH A;  3SEB A;  3ZDM C;  1JRU A;  3RI7 C;  2W54 A;  3ZRC A;  1KH0 A;  3EFU A;  2MQJ A;  2JRH A;  1OEY J;  2GBJ A;  2BQQ A;  2MJD A;  2ZCB A;  1OEY A;  1YQB A;  2MBQ A;  1YJJ A;  3ZNI D;  3K9O B;  5C2T B;  4YXD B;  2Z8L A;  1E9M A;  1WGR A;  3PHW B;  4AWJ A;  2JQR B;  1NI2 A;  2HD5 B;  1OTR B;  4XX5 A;  4W9D A;  2LXC A;  1AAR A;  3DHI C;  2KHW B;  1TKG A;  1XLQ A;  2CU3 A;  2DBY A;  1FNU A;  3EA6 A;  1SSN A;  3M3J A;  2ACZ B;  1MI0 A;  1ZKH A;  1GJZ A;  4F7Z A;  3PZ7 A;  2M1M A;  4BOS C;  4N6E B;  3P42 A;  2KWV B;  1ZUD 2;  1E8X A;  5H92 C;  1WZ3 A;  5C1Z A;  2LXA A;  2WNM A;  2NBU A;  1T0S C;  2I2Y A;  4NAW B;  3W1S A;  4LCD E;  3ZO5 B;  2MBE A;  3EGR A;  2WGS A;  3Q69 A;  1ZW7 A;  1P9D U;  2LRU A;  3BYT B;  1M4V A;  2KAC A;  2GBR A;  3K9P B;  1L0V B;  2W3R A;  4QAY A;  2WHI A;  1TT5 B;  2DYB A;  2QEJ C;  2KLC A;  1E8Y A;  5IN7 A;  1WI0 A;  1YX5 B;  2WXM A;  2KQ7 A;  2LUE A;  3AH7 A;  4IWQ A;  1NI3 A;  3RUL A;  1WX7 A;  4XDC A;  3A1Q A;  2N9K A;  2KWC A;  1MVK A;  2EMT A;  4B0E A;  3IAS 1;  5BMG A;  3N30 A;  4LDT B;  2KFK B;  4JWU C;  5JH5 C;  1Q5W B;  3APF A;  1LQB A;  1S1Q B;  4LDT D;  3RMK C;  1D5X C;  1P7F A;  1R7S A;  2ZPN A;  5HG2 A;  3DBH I;  2JSV X;  2YEP B;  1NVI D;  1A5R A;  4H2A A;  4AUQ C;  1WXM A;  3E56 A;  1SEB D;  4A9A A;  3O65 B;  1I4P A;  3ZKJ C;  3BWU D;  5BYS A;  1NDD A;  2EKE C;  2WXG A;  2JZZ A;  3R3M A;  2FUG 1;  3N20 C;  1WX8 A;  5J17 A;  1PFD A;  2BS2 B;  2KFJ A;  4LNI A;  3R2I A;  2PIA A;  4IG7 B;  2Q5W D;  1F0Z A;  2LI5 A;  4K7U A;  2G9H D;  5LLI A;  3DVN V;  3TSS A;  2DWQ A;  1XQQ A;  2BTE A;  3A4S C;  2IO3 B;  4ASW C;  2JWZ A;  3QC8 B;  5D6J B;  1L6V A;  2DAF A;  1OQY A;  1RFK A;  1OFF A;  3T3O A;  4S0R A;  3TEZ A;  2W3S A;  4AJY B;  3QQ8 B;  1GAQ B;  4A3P A;  4NQK E;  1VRA B;  3AV8 A;  4ZOH C;  2LVQ A;  2RDB C;  4RGO S;  1ZDV A;  2HTH A;  1MG8 A;  2ZNV C;  1LXD A;  2WXP A;  3B08 A;  1LFD A;  4OZC A;  1I35 A;  1SF0 A;  1R4M B;  3JSV B;  4KX6 B;  1FO4 A;  1WR6 E;  1M94 A;  1PDX A;  4FJY A;  4WWM A;  2M19 A;  1SE9 A;  1JML A;  1I7H A;  1D5M C;  3QWZ B;  3PLV A;  3N1X C;  1N60 A;  4K7S A;  2CR5 A;  2Z0E B;  4NAM A;  3PGE A;  2IO0 B;  1ZXI A;  2QIE B;  3R66 C;  3QA8 A;  3TUO A;  2M0A A;  5GXG B;  3NZS A;  5L95 C;  2J0K A;  3EHV A;  1NYQ A;  2M0X A;  2V9H A;  2ICI A;  3PVL A;  4OVZ A;  1V6E A;  2G4D B;  2OJW A;  2KTR B;  4MH0 E;  4HJK A;  4MM3 A;  1BML C;  2OJR A;  1J0G A;  2A5U A;  4ANU A;  4BKG A;  3V6C B;  4GU2 A;  4G50 A;  5AZG A;  3Q3F A;  4CHK A;  1Z2M A;  2RPQ A;  3N1Z C;  5D3D A;  4E71 A;  3I63 C;  3JYU A;  1BXT A;  3TEY A;  4G0N B;  3PRZ A;  1MHX A;  4JQW C;  3SU8 X;  5C23 A;  3Q8E A;  2HE7 A;  1XO3 A;  5IO9 A;  1T3Q A;  4WUR A;  1WR1 A;  2ZJD A;  2WXN A;  1F52 A;  4HXD A;  4DXG A;  2KDF B;  4MSM B;  4EUT A;  3LJ3 A;  3OJ3 A;  4HLE A;  4W9I A;  3KWL A;  2J53 A;  3NZ3 A;  1DOY A;  1CZP A;  3DBR I;  1RFA A;  2Y5P A;  3ZXV A;  3QK0 A;  2N9X A;  1SE4 A;  4XC2 A;  2BBC A;  3WA0 A;  1PYW D;  2Z0D B;  2LVO A;  1T5X D;  4FJV B;  4WIP A;  3TMP B;  2MRP A;  3DWM A;  4JPS A;  2K8C A;  2V4L A;  2D3B A;  2PLP A;  1P3Q U;  2INP E;  3V05 A;  2V3N A;  2XK5 A;  2J0M A;  4MJS A;  3SDL C;  1WF9 A;  3ZQ4 A;  3AI5 A;  2DNF A;  2DZM A;  2K39 A;  2WU5 B;  3TIX A;  4PK1 A;  3WCQ A;  3NUH B;  3CSF A;  1EWY C;  4A3O A;  5E6J A;  2QIL A;  2JYT A;  4NJ6 A;  1FPY A;  5FR3 A;  4PYZ A;  2HJ8 A;  1WZ0 A;  2K3U A;  2PKO A;  3LXF A;  4BAX A;  1J8C A;  4KIK B;  1YOV B;  2H88 B;  3L17 A;  3P4R B;  4GGQ A;  4TKN A;  3IHP C;  5DPR A;  3VFK A;  4HJG E;  1K53 A;  3NJT A;  3Q8A A;  5BMH A;  1WXA A;  4WJP A;  3JVZ X;  3AEB B;  3M95 A;  2L8J A;  2L52 A;  2NR2 A;  3KVF B;  3OG5 A;  1FEH A;  4WAF A;  2KQS A;  2KLG A;  2KZR A;  2WXK A;  3R7Q A;  2G3Q B;  1CJE A;  3AEF B;  3A9K B;  3A4R A;  3AE7 B;  3QJZ A;  4AP4 C;  2NCN A;  1HQR D;  1P0R A;  4ACF A;  2KT7 A;  1WX9 A;  5E6N A;  2V4I B;  1JWA D;  3RD2 A;  3AE8 B;  1XEE A;  4WAA A;  1FFV A;  4DHJ B;  2BWF A;  3FIL A;  3R8B A;  4B95 A;  1U4A A;  3B2F A;  2QJL A;  3V6E B;  4XYC A;  2G1E A;  2KJR A;  3TCA A;  2I1K A;  2WXR A;  4I6N B;  1F2R I;  4MGZ E;  3B0A A;  1ET9 A;  3P2B A;  4KV2 A;  3FAH A;  3Q6B A;  4M00 A;  4S17 A;  1KLG D;  2RDG A;  4WWP A;  2LVP A;  1MG4 A;  3D32 A;  2ON8 A;  1CQV A;  2LD9 A;  1WJN A;  4MAC A;  2AQ1 B;  2KD0 A;  4K1R B;  2BWE S;  2MW5 A;  1HXY D;  2DLB A;  1VR9 A;  1KLV A;  2WX0 A;  1KOT A;  2PJH A;  2MJ3 A;  3DBL I;  4PT5 A;  4A8X C;  2ZCC A;  4RFB A;  2J42 A;  1KF6 B;  3U7D A;  5DPW A;  2PVO D;  2BYF A;  2XBB C;  1IP9 A;  3P4Q B;  1SXT A;  1DYQ A;  2KTF A;  1CMX B;  2WDT B;  2BB6 A;  1XT9 B;  1SIJ A;  2MA9 B;  3NG0 A;  5BYQ A;  2KYW A;  5EE0 A;  5IKC M;  3ONS A;  3QAQ A;  1XLP A;  4YL8 A;  5KHO A;  1I4Q A;  1V86 A;  3M62 B;  1TIF A;  2XN9 C;  2RGF A;  4OHJ A;  1UEL A;  2WQY B;  2WU2 B;  3B2G A;  2V3S A;  3VHT C;  1D6E C;  4JX1 C;  1DOI A;  2INN E;  4KKI A;  2RMM A;  2IDY A;  3AEC B;  1FXI A;  1V97 A;  1RYJ A;  2Y5B B;  4JLC A;  1EF5 A;  2LAS A;  1WMH B;  5DPS A;  4GDK A;  2IGH A;  4ZRK A;  1UZX B;  4KGT A;  5JHB A;  2DZJ A;  3DOW A;  2GBN A;  2MP2 A;  2YEP F;  5DCN A;  5BMI A;  2L83 A;  1S3S G;  1FCC C;  1N5W A;  3GOE A;  1L0Y B;  3HK0 A;  2MJE A;  4C7Y A;  2ZVO A;  3CST A;  2PVG C;  3W9C B;  2KVR A;  4IKG A;  4NNJ B;  3RCZ A;  3AU4 A;  4JGH B;  2NTT A;  1IBX B;  2LHD A;  5EE1 A;  2ZVN A;  2AYO B;  3UIO B;  2KWD A;  1STE A;  5E6O A;  4L1B A;  4JIO U;  1CK1 A;  3DQV A;  4K7W A;  3RNF C;  4HKQ A;  5GMV A;  3J9C A;  5IA7 A;  4RMA A;  1FXT B;  1QZE A;  1L4Z B;  4US9 A;  2LWP A;  3A33 B;  2KDB A;  2JY6 A;  5TR5 A;  2A4Z A;  1L7Y A;  5JZE B;  1GB4 A;  1R4M I;  1SE3 A;  2AEH A;  2MSE D;  1K50 A;  2WXH A;  3AE6 B;  1XLO A;  2QHO A;  3VAW A;  1DGJ A;  3NHE B;  4IDI A;  1OQR A;  2KMA A;  4X57 B;  3DHH C;  3PRE A;  1WXQ A;  4W9E A;  3APD A;  3KW5 B;  1SBB B;  1V1O A;  4GDL A;  3GB1 A;  1QQR A;  3L0W B;  2LMC A;  3ALB A;  2IY0 B;  3ABV B;  1J7B A;  4MGY E;  1OQQ A;  4AS1 A;  5TSS A;  1IGD A;  1HTQ A;  3DPD A;  1P98 A;  2DYM A;  2KQ4 X;  2E3T A;  2WDR B;  2XEW A;  3RT3 B;  5BYR A; 
#chains in the Genus database with same CATH homology
 3AN1 A;  2M19 A;  2QMT A;  4RF1 A;  1P7E A;  3NVV A;  1MHH E;  2WXQ A;  5T8I A;  2WXF A;  2MEK A;  4C56 C;  4C80 A;  1B1Z A;  1L0X B;  3HRD D;  1NYR A;  3NVW A;  1EU4 A;  5FKA C;  1YN5 A;  1JML A;  1I7H A;  1L4D B;  3W2D A;  1D5M C;  3LYY A;  5D3I B;  4D2K A;  3BYY B;  4RGM A;  2WXO A;  3E9S A;  2FBW B;  4USA A;  4REZ A;  1YNT E;  1QF6 A;  1WSP A;  4WQM A;  1N60 A;  3TEW A;  3ZJU A;  1TS4 A;  2BB5 A;  1YN3 A;  1FRR A;  4NAM A;  1FNV A;  2JX5 A;  3I9V 1;  2AQ2 B;  2DYO A;  3P4P B;  1SE2 A;  5AUK A;  5JXV A;  1ZXI A;  2QIE B;  2Y3A A;  2BS4 B;  2HTM E;  3TUO A;  4DQO C;  2M0A A;  5GXG B;  1TZO A;  2LGI A;  3MHZ A;  1I4G A;  1NYQ A;  4XWT A;  3VRA B;  1NEN B;  4OVZ A;  2ICI A;  2LUM A;  4ARI A;  1IUE A;  1K52 A;  1L6U A;  2MH7 A;  4XE0 A;  1FFU A;  1YQ3 B;  3R2T A;  4KGS A;  3H8H A;  1UWX A;  1BML C;  3BVM A;  5D7G A;  1TKE A;  1V1P A;  2BS3 B;  3PO0 A;  4ZHP A;  3AE9 B;  4R3D A;  2JYE A;  4MT5 A;  3KWV A;  2N9L A;  1EWC A;  2WS3 B;  1EU3 A;  2K22 A;  4ITK A;  1A70 A;  1FXA A;  1WWT A;  1YJI A;  1MPE A;  1K51 A;  5D3D A;  1JCK B;  2LFI A;  1TKY A;  1YQ4 B;  1BXT A;  4RH6 A;  3TEY A;  1HZ6 A;  3U7Z A;  2WDV B;  3T3N A;  2X38 A;  1E0Z A;  1MHX A;  3IAM 1;  4HKZ E;  1VJK A;  2V0G A;  3HVD A;  2IJ0 A;  1RM6 C;  1JWM D;  2OHF A;  3Q8E A;  1Q10 A;  1XO3 A;  1AWD A;  1T3Q A;  4WUR A;  3FC4 A;  1ET6 A;  3BVG A;  5LNK 1;  4J3O D;  3DWG C;  1XXG A;  2WXN A;  3EUB 2;  1KLU D;  3P1M A;  4C7Z A;  2BW2 A;  2XNA C;  4DXG A;  1N5X A;  2AQ3 B;  2H89 B;  4GDK B;  4TMA B;  4HRO A;  1N63 A;  2N7J A;  2AX5 A;  2WP9 B;  2J52 A;  2GRI A;  3KWL A;  4KGR A;  1XCT L;  2J53 A;  3KLS X;  3NZ3 A;  1DOY A;  3Q8C A;  1CZP A;  5HHD G;  2Y5P A;  3GP7 A;  1D4B A;  1SB3 C;  2WXI A;  1SE4 A;  1D5Z C;  2WXL A;  2JU6 X;  4RCO A;  2BBC A;  2LHE A;  1PYW D;  1T5X D;  4WIP A;  4A6Q A;  1J7A A;  3DWM A;  5G5G A;  4JPS A;  4RGT A;  3AE4 B;  5HI1 A;  2PLP A;  2INP E;  1BUI C;  3V05 A;  3AE3 B;  1I4X A;  2V3N A;  1QOF A;  1IBX A;  1JWU D;  2KAJ A;  3NS1 A;  2L1A A;  3AE5 B;  5FK9 C;  2R61 A;  3ZQ4 A;  2WXJ A;  2EKI A;  1L5P A;  4EE2 A;  3P4S B;  1VDV A;  3CIR B;  3NVY A;  2WU5 B;  4TQ0 A;  3ZGZ A;  2LEK A;  2ONQ A;  3WCQ A;  1C4P A;  3NUH B;  2SEB D;  4YWG G;  3UI3 A;  3VR9 B;  1HZ5 A;  3MP9 A;  1EWY C;  2TSS A;  5E6J A;  2QIL A;  2JYT A;  4XDD A;  1TS3 A;  4YT0 B;  1IGC A;  3NRZ A;  1KRH A;  4ZRQ A;  4YTM B;  5FR3 A;  3MFG A;  3MC0 B;  1PGA A;  3TEX A;  4YSX B;  3ZJT A;  2K3U A;  1C77 A;  2CJN A;  3AEE B;  1AN8 A;  1TY2 A;  3KQ4 A;  2PKO A;  1N62 A;  5H8Y E;  3LXF A;  2RDH A;  3AEA B;  3N9Y C;  3U2S C;  2B76 B;  2H88 B;  3AEG B;  3P4R B;  2N0S B;  4YSZ B;  2PTL A;  4HJG E;  1K53 A;  2W55 A;  1FMA D;  1GPX A;  1C76 A;  4ZRP A;  3Q8A A;  3P63 A;  4GDL B;  1UGJ A;  4HRS A;  3L4P A;  4HEA 1;  2GB1 A;  2KMM A;  4O1N A;  4JE3 B;  1QOB A;  3AEB B;  3BK2 A;  3AM9 A;  1C78 A;  2L52 A;  1FEH A;  4N58 A;  4WAF A;  4P6V F;  2JWU A;  2WXK A;  1CJE A;  1PUT A;  3U4E G;  3AEF B;  3RFZ B;  3MJ5 A;  4OZA A;  3AE7 B;  2Y5C A;  4NZL B;  1ZP0 B;  3BZD B;  3SR6 A;  2IPK D;  1HQR D;  1C9F A;  1XF5 L;  1VLB A;  4LLG M;  3VQI A;  2V4I B;  4XWW A;  3SFE B;  5BMH A;  1JWA D;  4JWS C;  1UUP A;  4N59 A;  3AE8 B;  3IT6 B;  5BYR A;  4YSY B;  2ZW0 A;  3AE1 B;  1XEE A;  4L23 A;  1FFV A;  3Q8F A;  1HEZ E;  2SAK A;  1FCL A;  3FIL A;  2K5P A;  2WLB A;  2IGG A;  3IXS A;  3R8B A;  1FRD A;  1FD6 A;  3B2F A;  5I4D A;  2QJL A;  3BII D;  1ZXH A;  3SEB A;  1I4H A;  2W54 A;  2KN4 A;  4TSS A;  1KH0 A;  2G1E A;  1PGX A;  1E10 A;  2MJD A;  2WXR A;  1YJJ A;  2BYT A;  3HVZ A;  1F2R I;  3LB8 C;  1C4C A;  5C2T B;  1ET9 A;  4YXD B;  3IT4 B;  3BK1 A;  2Z8L A;  2QSD A;  3FAH A;  1E9M A;  1KLG D;  2RDG A;  5MPO A;  1UWM A;  1FNW A;  1E6E B;  2ON8 A;  2JQR B;  1CQV A;  3URY A;  3W5V B;  4A90 A;  1ZDX A;  3SFD B;  1XCQ L;  1GB1 A;  4YTN B;  4MAC A;  1QOA A;  2AQ1 B;  1TKG A;  1XLQ A;  2V3P A;  2CU3 A;  2DBY A;  1FNU A;  1HXY D;  2DLB A;  1VR9 A;  3EA6 A;  1SSN A;  1SJE D;  2ACZ B;  1V8C A;  2E6X A;  2MJ3 A;  4MM3 B;  4PT5 A;  4A8X C;  1MI0 A;  2K9X A;  1V1P B;  1ZPS A;  4RFB A;  3HUI A;  2J42 A;  3Q8B A;  1KF6 B;  2PVO D;  3P4Q B;  1SXT A;  1DYQ A;  2JZP A;  4GLS C;  2VZK B;  3PZ7 A;  1VZ6 A;  2J4X A;  5AUI A;  1JWS D;  4NJC A;  4N6E B;  3P42 A;  1JQ4 A;  1EM7 A;  2BB6 A;  2GI9 A;  3BVZ A;  2VZK D;  1ZUD 2;  1SIJ A;  3U52 E;  3PZ8 A;  4ZYS A;  4AQ7 A;  5H92 C;  2L32 A;  5BYQ A;  5EE0 A;  2WNM A;  1ACC A;  3AB5 A;  1KFY B;  2KDM A;  1JRO A;  1DOX A;  1XLP A;  1LO5 D;  3OWE B;  2I2Y A;  4NAW B;  1I4Q A;  3W1S A;  3V3X A;  2RPV A;  2XN9 C;  3EGR A;  4FXC A;  4OHJ A;  3Q69 A;  2WQY B;  1AW7 A;  3BYT B;  1M4V A;  2KAC A;  1KTK A;  4RGN A;  2WU2 B;  2HDE A;  2W82 A;  1L0V B;  2W3R A;  3B2G A;  4RF0 A;  4UDU C;  3NVZ A;  1D6E C;  2QEJ C;  4JX1 C;  1DOI A;  1XLN A;  2INN E;  2LJI A;  2RMM A;  4KKI A;  4MH8 A;  2IDY A;  3AEC B;  3VR8 B;  5EE3 A;  1FXI A;  1V97 A;  4B0M A;  1Y56 A;  1E7P B;  1RYJ A;  1TYG B;  2WXM A;  3AH7 A;  4OW0 A;  1TJE A;  1TY0 A;  1NI3 A;  2IGH A;  4KGT A;  3I57 A;  5BMI A;  1F2R C;  2YEP F;  2L83 A;  4XDC A;  1FCC C;  1N5W A;  2JXT A;  3CWI A;  2N9K A;  3GS2 A;  4YTP B;  5EE9 A;  1JW9 D;  1MVK A;  1L0Y B;  2M56 B;  4B0E A;  3IAS 1;  5BMG A;  2MJE A;  3AE2 B;  2FE8 A;  4C7Y A;  4JWU C;  2PVG C;  3W9C B;  4IKG A;  1D5X C;  1P7F A;  4KKJ A;  4WH4 A;  1WGK A;  1C4A A;  2D5G A;  1R7S A;  5HG2 A;  1IBX B;  2NTT A;  1WRI A;  2NMQ A;  2JSV X;  2YEP B;  1NVI D;  2I38 A;  2LHD A;  4TQ1 A;  1VZ8 A;  2K0P A;  5EE1 A;  1ZE3 D;  1STE A;  2KWD A;  4H2A A;  4L1B A;  1JWB D;  3E56 A;  2NTS A;  1CK1 A;  1WYG A;  1SEB D;  1J7C A;  4A9A A;  1I4P A;  1B9R A;  1PGB A;  2OED A;  1VZ7 A;  4LTU A;  4DXF A;  3BWU D;  1QOG A;  2PMV A;  4HKQ A;  4P16 A;  5BYS A;  2WXG A;  3J9C A;  1ROE A;  2FUG 1;  1L4Z B;  4US9 A;  1PFD A;  2BS2 B;  1N61 A;  3R2I A;  4IOI E;  1ESF A;  3W5U B;  1GB4 A;  2PIA A;  2Q5W D;  1F0Z A;  1SE3 A;  2WDQ B;  1F77 A;  1K50 A;  1FIQ A;  2WXH A;  2G9H D;  3AE6 B;  2EEL A;  4L2Y A;  4OZB A;  1XLO A;  3TSS A;  1DGJ A;  2DWQ A;  1NEK B;  3ZJV A;  1YN4 A;  3AMZ A;  2BTE A;  1QKZ A;  1SJH D;  2CJO A;  4IDI A;  1OQR A;  1QLB B;  4RNA A;  1L6V A;  5HFY A;  1TS5 A;  1I4R A;  5G5H A;  2IGD A;  1WXQ A;  1RFK A;  1OFF A;  4M0W A;  3T3O A;  4CQN A;  3AED B;  4ZHO A;  1SBB B;  4ARC A;  1YMH E;  1GOZ A;  1QIL A;  3ETR A;  3TEZ A;  1V1O A;  2W3S A;  1AYF A;  3B9J A;  1HA5 A;  1GAQ B;  2PW9 A;  1JAL A;  1VRA B;  3AV8 A;  3GB1 A;  4ZOH C;  1QQR A;  1UNS A;  2LMC A;  3ABV B;  4RGO S;  1ZDV A;  2ZW1 A;  1RWS A;  1T6B X;  3RPF C;  3VRB B;  1J7B A;  2WXP A;  2BT6 A;  4LK0 M;  4OZC A;  1FM0 D;  1OQQ A;  4A55 A;  1SF0 A;  5TSS A;  1IGD A;  1C79 A;  4AS1 A;  1ENF A;  1JRP A;  1ZOY B;  2DYM A;  1TS2 A;  3C8Y A;  3O13 A;  4Q2J A;  1QT9 A;  4KX6 B;  4US8 A;  2KQ4 X;  1FO4 A;  3FIL B;  2E3T A;  2WDR B;  5C3J B;  1PDX A;  3ZYY X;  4WWM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...