1JQ4A

[2fe-2s] domain of methane monooxygenase reductase from methylococcus capsulatus (bath)
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
98
structure length
98
Chain Sequence
MQRVHTITAVTEDGESLRFECRSDEDVITAALRQNIFLMSSCREGGCATCKALCSEGDYDLKGCSVQALPPEEEEEGLVLLCRTYPKTDLEIELPYTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHANE MONOOXYGENASE COMPONENT C
publication title NMR structure of the [2Fe-2S] ferredoxin domain from soluble methane monooxygenase reductase and interaction with its hydroxylase.
pubmed doi rcsb
source organism Methylococcus capsulatus str. bath
molecule tags Oxidoreductase
total genus 9
structure length 98
sequence length 98
ec nomenclature ec 1.14.13.25: Methane monooxygenase (soluble).
pdb deposition date 2001-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1jq4A00
1UWMA 3DWMA 3BIID 1DGJA 1J7BA 2L52A 2M56B 2WDQB 3PO0A 1V97A 5C3JB 3AB5A 1NENB 3AE5B 1AYFA 1VJKA 1FO4A 3AN1A 1CZPA 2W3SA 1RM6C 2ACZB 1EWYC 2WU2B 4US8A 2BS2B 2DBYA 4WQMA 2HTME 1AWDA 3AH7A 1DOXA 3W5UB 2WS3B 1TJEA 1YJIA 1T3QA 1J7CA 1ZUD2 2LEKA 1E9MA 1XLPA 2PIAA 5AUKA 3P4QB 1FRRA 3ZYYX 2CJNA 1NYQA 3HUIA 3P4RB 1TKYA 2B76B 5EE0A 3RPFC 2WP9B 2FBWB 4LTUA 2AX5A 1XLOA 1NYRA 1NVID 4JX1C 5GXGB 3AEAB 2H88B 2MH7A 3EUB2 5AUIA 3NVVA 4JWSC 4HROA 4YTMB 3NRZA 1WXQA 1L6UA 1ZP0B 3AE1B 3B9JA 1ROEA 1ZOYB 3W9CB 1DOYA 4C7YA 3HVZA 1DOIA 5EE3A 3VR9B 4ZHPA 1JRPA 1QOFA 3AE8B 3AEFB 3B2FA 1N60A 1E10A 1SIJA 3VR8B 1NI3A 2N0SB 1OFFA 1QOGA 4ZHOA 2WDVB 1L6VA 2KAJA 2E3TA 3ETRA 3ABVB 1N62A 3AEDB 1J7AA 1QT9A 1NEKB 1WWTA 1L5PA 5EE9A 1FFVA 2JQRB 1E0ZA 2QIEB 3L4PA 4WWMA 3AEEB 1YQ4B 3SFEB 1TKGA 2Y5CA 4KX6B 1FMAD 4YTNB 1JQ4A 2OHFA 4N59A 1OQQA 3HRDD 1YJJA 2MJEA 4N58A 1RFKA 4YSXB 1VLBA 1OQRA 2WQYB 5G5HA 2MJDA 1FXIA 1YQ3B 3AE3B 3AV8A 1XO3A 2BS3B 1WRIA 1FRDA 1GAQB 1FM0D 1VDVA 1WYGA 2CJOA 3NS1A 3SFDB 4YSZB 3DWGC 3AE7B 2MJ3A 1KF6B 2M19A 3CIRB 3NVWA 1QOBA 2WDRB 4P6VF 1ZXIA 1QF6A 1JWBD 2DWQA 1QLBB 4YXDB 1FFUA 1JROA 1PUTA 1RWSA 4USAA 1GPXA 1KFYB 3AM9A 3AE6B 1XLQA 1TYGB 1JALA 1F0ZA 1TKEA 3AE2B 3AEBB 4YTPB 5EE1A 1N5XA 1FXAA 4A9AA 3P1MA 4C80A 3W5VB 1RYJA 1A70A 2K22A 1PDXA 1L0VB 1JWAD 4YT0B 3NVZA 3FAHA 1QOAA 3NVYA 2PVGC 2W55A 3AEGB 3VRBB 1JW9D 3AE9B 4HRSA 1N5WA 2W54A 3FC4A 2CU3A 1FIQA 2BS4B 3P4SB 3LXFA 3P4PB 3KWLA 2H89B 1XLNA 2PKOA 4US9A 4ITKA 1E7PB 2L83A 3VRAB 1N61A 1I7HA 4C7ZA 2BT6A 5MPOA 2JX5A 2KMMA 3AMZA 1KRHA 4YSYB 5C2TB 2WLBA 1CJEA 2Q5WD 3LB8C 3B2GA 3SR6A 1PFDA 5H92C 2G1EA 3P63A 1E6EB 1SB3C 3AE4B 4N6EB 4ZOHC 1B9RA 2EKIA 1R7SA 2W3RA 4JWUC 2K9XA 5G5GA 4FXCA 2K5PA 1SF0A 1N63A 1WGKA 1IUEA 2PVOD 3CWIA 3WCQA 4IDIA 5H8YE 2QJLA 3AECB 1V8CA 2WU5B
chains in the Genus database with same CATH superfamily
4K1RB 4KKJA 3AB5A 5IO9A 2L8JA 3MFGA 3UINB 1EWYC 4G0NB 2WU2B 2A4ZA 3PZDA 4FJVB 4MELA 3Q2AC 2DYOA 2KJ6A 1YD8U 5AUKA 3ZYYX 1TKYA 2BTEA 3TJPA 3BINA 4RGTA 3HHMA 1NDDA 4JLCA 3L17A 1ZOYB 5G55A 2Z59B 1JRPA 2KWDA 1ZGUB 3SHQA 2V9HA 4RGMA 1L6VA 2MQJA 1NI2A 2UU7A 1P0RA 3AEDB 4EOYA 2FCNA 1D5ZC 4ASWC 4MM3A 4IM0A 4NAMA 1UGJA 2GBRA 5L95C 1QQRA 1V5OA 1FXIA 1IPGA 2MJ3A 2INDC 2VZKB 3PLUA 1YIWA 2TSSA 2RMMA 3NOBA 1FPYA 2GBJA 2FCMA 4MSQB 4XX5A 3CMMB 1N5XA 1WGGA 1FXAA 3PHWB 1QZEA 3V61A 4BFRA 2FIDA 3NVZA 4HCPB 3Q3OC 1WH3A 2KMAA 4MJSA 1PGAA 1SEBD 1K53A 1WX7A 2KTRA 3KQ4A 4C7ZA 5JHAA 5AZHA 2NCNA 1PGBA 1RLFA 3ZNID 3BK2A 2KACA 1WZ3A 3MC0B 3PLVA 2MP2A 1I4PA 4DQOC 3C0RB 2QC8A 2K5PA 1SF0A 1P98A 2KT7A 2DZKA 1K8RB 2QHOA 1YJ1A 2XEWA 3O13A 3VAWA 4BBNC 3CSTA 1ACCA 2KLCA 1VJKA 2LUMA 2BYVE 4TMAB 2HTME 3VTVA 3I63C 3OJ3A 2CKHB 2RD0A 1KLUD 1RRBA 4RGOS 4HJKA 1L0XB 1MI0A 1STEA 1ZDVA 2VRRB 1NVID 1HEZE 5J2RA 1IBXA 5AUIA 3R7QA 4MT5A 4GDLB 3AE1B 2PLPA 2KLGA 3HVZA 3L13A 2RDGA 3JSVA 5CTRC 1V86A 3HK0A 1J0GA 2J0KA 4F8CB 2L7RA 3U30A 5G2NA 1YQ4B 2JWUA 1FCLA 4YSXB 2WQYB 4LNOA 2MJDA 2PPHA 2BS3B 3B08A 3DVNU 1VDVA 5DPTA 3RUIB 2KN4A 3DWGC 2WXKA 3NVWA 4XDDA 4LLGM 4YXDB 2WX1A 1FFUA 1E8YA 1HXYD 3AM9A 2PE6B 2XN9C 1GOZA 1TS2A 1XD3B 3RFZB 3VFKA 4C80A 1XEEA 1PDXA 5LNK1 4DK5A 2JYEA 2ZW1A 1XLNA 1HA5A 2O6VA 3N1XC 3VRAB 1FNUA 2GBKA 1EM7A 3A4SC 4YSYB 3IG3A 1P7EA 4PS7A 2IGDA 4F1SA 1OEYJ 4A6QA 1MFWA 1C3TA 4IDIA 4RF0A 4HKQA 1EF1A 2M56B 1J7BA 2NPTB 2WDQB 4HLEA 1Q0WB 2N9XA 4WAAA 1V80A 2ACZB 3K9PB 3QA8A 2DHZA 4C56C 2BS2B 4DDGD 2IO1B 1C4PA 5DPSA 1LGRA 3T3NA 4DHJD 1J8CA 2L0TA 3P4RB 5EE0A 4M00A 2AX5A 3RNCC 3SD5A 2ICIA 4GDKA 1YOVB 5E6NA 3ONSA 1E8WA 1A5RA 1ROEA 1P7FA 2WGSA 2GB1A 3W9CB 2DZMA 1DYQA 2OOBB 2I1KA 4HPMB 1N60A 2N0SB 5TR5A 3LJ3A 4KIKB 4XC2A 1FNVA 4MACA 2DAFA 4KDLB 2D3GA 1EU3A 4KX6B 1WXMA 2MJEA 4J3OD 2KDBA 3GZNI 3P4QB 2KYWA 3B1LX 1WYGA 5IA7A 2M4NA 3X0WA 2KTFA 2V4IB 3AE7B 1TIFA 1PGXA 2M19A 1ZXIA 3BY4B 4ANUA 2PW9A 5LLIA 4EFOA 1E8XA 4JGHB 1HTQA 1XLQA 3Q8BA 1WIAA 4LDTB 1GJZA 2KD0A 3P1MA 2CU1A 2WNMA 3PV1A 2PVGC 3VRBB 2KQ7A 3ZIMA 4XWTA 2BB6A 1SBBB 1EUVB 2IDYA 1ET6A 4IWQA 1WGDA 1LXDA 1KRHA 2WLBA 2ZEQA 2D2QA 4W9GA 2ZPNA 2GI9A 2UYZB 4M8MA 4L2YA 1B9RA 5JXVA 1NBFC 4GMVA 3WCQA 3ZKJC 5IP4D 2V3SA 4KSKC 2HE7A 2LGYA 3BIID 5C3JB 4FJYA 4OZAA 1WJUA 2L0FA 1MPEA 2DBYA 3KW5B 1T0RC 3AH7A 3BZDB 2JT4B 2C5LC 2WS3B 1YJIA 1TS3A 2IJ0A 1SJHD 2MSED 2J53A 2WP9B 3DDCB 1T0YA 3WAPA 2M17A 4JX1C 3IFWB 3OJ4B 1YN4A 3KUCB 3A1QA 3NVVA 2RGFA 2J0JA 3C8YA 2FUHB 2ZVOA 3B0AA 2M1MA 3AE8B 4HPPA 2YVCA 1OQYA 2JF5A 4WWNA 1C4CA 1VRAB 1WX9A 2MBOA 4FJZA 2KAJA 1N62A 4OZCA 2BW2A 3NY5A 3TEYA 4ZRJA 4JE3B 4YTNB 1ENFA 1YJJA 3U52E 1YQ3B 4LJPB 1TZ1A 2CJOA 3NS1A 4DXFA 5FR6A 1QKZA 2WDRB 3WANA 2X8XX 2LASA 3AI5A 4USAA 1SXTA 3DCGA 5EE1A 1ESFA 1T0QC 2I1JA 2BF8B 4YT0B 4W9DA 2RR9A 4KKIA 2K1FA 1P1AA 4FHKA 1N5WA 4KVGB 2VZKD 3P4SB 4LNFA 4ZRKA 4MGZE 2QSDA 4ANVA 2L1AA 3LB8C 1WFYA 3TEZA 2KO3A 2SAKA 1E6EB 1WX8A 5FKAC 5D3DA 4CHKA 3OLMD 2ON8A 4W9KA 4WH4A 1WGKA 3QJZA 3CWIA 3M63B 2KQSA 4W9IA 5H8YE 2QJLA 4NAWB 1TZOA 1V8CA 3P2BA 2IO3B 3PO0A 4MGKE 4FHJA 1V97A 3ENEA 2AEHA 2YEPF 2QDFA 4S0RA 3ZUNA 3RZWC 4TQ1A 2ZNVC 2V3NA 1E9MA 3MJWA 4M01A 2CJNA 2B76B 1ZPSA 1UBIA 4LTUA 3HIZA 3QQ8B 2L32A 4HPLB 4ARIA 3T8MA 4ZHPA 2MX2A 1QOFA 2LGXA 2INPE 5BMGA 1F1HA 1QOGA 2D07B 1UBQA 4BOSC 4RM8A 4BVUC 2IYDB 2K8HA 2LGSA 3DVGY 1FFVA 1SGHA 2VH2A 4IG7B 2HD5B 4N59A 3ZRCA 2JYTA 4JIOU 4ICUA 4EZKA 1RFAA 2G9HD 3PRPB 2RSUA 3MC8A 5JHBA 1JRUA 4BKTA 1PUTA 3X23A 3DBHI 1KFYB 3Q3NC 2DYBA 1YNTE 4K3BA 3A9JA 4A9AA 1FNWA 2BKFA 2G45B 2LVOA 2BPSA 3L54A 3GB1A 5D2MB 2G3QB 3BWUD 3R2IA 4G50A 3BVZA 3EFCA 1FIQA 2W82A 3LXFA 1R4NB 3IAM1 2N7EA 3RCZA 2NBVB 1PFDA 1C4AA 5H92C 2LRUA 2XK5A 4N6EB 3JVZX 4QAYA 4H2AA 2Y3AA 3RI7C 2CHWA 1U4AA 2KK8A 3W1SC 2Z0DB 1WR1A 1E7VA 3WAOA 2EMSA 1TGZB 2LHEA 3ZRFA 4AQ7A 2LGIA 1V81A 1TY2A 3EC8A 2LVQA 1T3QA 1ZUD2 2LEKA 3H7SA 4A8XC 3HM3A 1L4DB 3VQIA 2PTLA 1WI0A 1OGWA 1V6EA 3EHVA 4WAFA 2NTSA 3I9V1 1K52A 3KWVA 1JWSD 2MH7A 4NZLB 2KWCA 3DBLB 3JW0X 3L08A 2LRWA 1MG4A 1LQBA 3V60A 1ZE3D 3JYUA 2DAJA 2HDEA 4NQKE 3FILA 2MEKA 3TEWA 2J52A 1ZW7A 1WM2A 3PGEA 4REZA 1FMAD 2KXJA 3VDZA 1OQRA 3Q8AA 3QARA 4KV2A 1K51A 3RT3B 4A90A 1X1MA 2DWQA 3GOEA 1VZ6A 1JWUD 1PYWD 2JY6A 3GZNB 3KUZA 1F0ZA 2NS5A 2O2VB 1BUIC 2RPVA 3FKYA 4WJNA 1YQBA 2KZRA 3I3TB 1WY8A 3VUYA 3W1SA 3RZFA 2WXLA 5T8IA 3BVMA 3ZJTA 1I7HA 2MCNB 2BT6A 1YMHE 5C23A 4LDTD 5D94A 1CJEA 1Q1OA 4W9JA 3AE4B 3Q8EA 3AXCA 4BAXA 1I4XA 1SIFA 4DXGA 2N9KA 1IUEA 1LFDA 4IC7B 2KC1A 4DXAB 1I4RA 4WJOA 4TKNA 3PPAA 2JUOA 1SJED 2RDBC 4B0MA 2WXPA 4MGYE 3RNFC 1YN3A 3RNGC 2WXOA 3R8BA 4G3XB 3N3KB 5L83A 3L0WB 2AQ2B 1SE3A 3ECIA 3PRZA 1J7CA 1V1PB 4II3B 2WWZA 4AP4C 4KGTA 3HUIA 4IUMB 1D3ZA 2KVZA 1Y8RC 5I4DA 2LI5A 5DPWA 3RN9C 1ZP0B 4GDLA 1DOYA 2YEPB 2IZVB 1D5MC 4M0WB 2V1YA 4GB9A 4NJ6A 1BXTA 2CHZA 2QILA 5IAAC 2WDVB 1S1QB 1VZ8A 2LWPA 3QWZB 1NEKB 3PZ7A 4URKA 4IWPA 3I5JC 3EECA 4BOZB 4FA6A 3ZGZA 3PTFC 1D4BA 3NZUA 3PHXB 4RCOA 4YWGG 4ARCA 1D6EC 2DX5B 4OHJA 2HJ1A 2X38A 2DNFA 4IM3A 1C76A 1TBEA 3UIPB 2FNJB 3VUWA 2PJHA 2IPKD 2M8SA 1XQQA 3AU5A 1RWSA 3RNAC 2WXJA 3DHGC 3H7PB 4HWIB 4OZBA 3QC8B 4JL9A 1C77A 2KKCA 2M0AA 4IW0A 4PK1A 1CK1A 4GLSC 1JW9D 1UWXA 3P4PB 2WXGA 4W9EA 3N1ZC 5GMVA 1JCKB 4MSMB 3RMKC 4A55A 4GU2A 3P63A 1SB3C 3AULA 2REXA 2EKIA 1R7SA 2W3RA 2KANA 3SU8X 1C78A 4XGAB 4KGSA 2WU5B 2CHXA 3DWMA 3N1YC 1V9JA 1L0YB 2NPTA 2R2OA 3APFA 1CZPA 3TBLD 4W9CA 4C4VB 2NMQA 4A3OA 1I4HA 5IN7A 1GNUA 5D6JB 2JPHA 4W9FA 4EUTA 3EGRA 3UF8A 4HROA 3NRZA 3B9JA 4LNNA 4LCDE 5D7GA 1GUAB 3U4EG 2K25A 3IVFA 3B2FA 3MTNB 4ZRIA 2DZIA 5BYRA 1NI3A 4WIPA 1LO5D 2D10A 3IT4B 4J6IA 2JWZA 3ZTCA 4O1NA 4KIKA 2NBWB 1E0ZA 2Y5CA 3AE3B 2MBHA 3TL5A 2BGFA 1XCTL 3R3MA 4HDOA 3RNBC 4FULA 4K7UA 2KVRA 2JZPA 1JWAD 3DBHB 3U7DA 2IY1B 5AZGA 4WWPA 2FE8A 3U2SC 2ONQA 2ZCCA 2N4FA 2Y5BB 4DHZB 3DQVA 4ZOHC 1TS4A 3PZ8A 5JZEB 5G5GA 2JXXA 1N63A 3E9SA 2WXNA 1XF5L 3ZDMC 1UWMA 3MJ5A 2L52A 2J4XA 3A9KB 5BMIA 2J0MA 2WXFA 2SEBD 2MHJA 3ALBA 3MP9A 4WJQA 3A4RA 2GRIA 4G11A 5LXHA 2K6QA 3D32A 2LVPA 5IOIA 3W2DA 2PIAA 3TEXA 1V5TA 3RPFC 2IO2B 4ICVA 3MC9A 2GLSA 2XBBC 2D3CA 3VR9B 1B1ZA 2N1VA 4HEA1 2D5GA 4P7IA 3H9DA 1J19A 4RH6A 4K3CA 2ZZPB 4CYEA 4C00A 2LXCA 1L5PA 4E3CA 4WWMA 4KZ0A 1WMHB 4AUQC 2Z8LA 3UQAA 3I57A 1R4MI 3GE3C 4IOIE 5C1ZA 5KHQA 1WRIA 1RAXA 2MWSB 1IYFA 1Y56A 3LDZE 2K8BA 4B0EA 1E8ZA 4A3PA 2AYOB 4RNAA 3Q69A 3Q6BA 3UIOB 2JVCA 2N9EB 3T3OA 3AEGB 1WXSA 3AE9B 3PSEB 3SDLC 1XCQL 2BQQA 1P9DU 4US9A 3VTWA 1M4VA 2KWVB 4B9KA 3V05A 2JX5A 3ZQ4A 1FEHA 1ISNA 2CR5A 3L16A 4BKSD 2WHIA 2INNE 1EWCA 3VH4B 3L10B 1WGRA 4CO7A 4NAWA 3V62A 1AYFA 1FO4A 1RM6C 2EMTA 3DHHC 4KDIC 1WGYA 2KFKB 4A20A 3W5UB 1UUPA 4JQWC 4OW0A 4BZAA 1I42A 4I6NB 1KLGD 4FN2A 3TUOA 1GB4A 2FBWB 1H8CA 4K7SA 4HVBA 3MHZA 4JWSC 3M95A 3OG5A 1WXQA 4EZJA 1TY0A 4KGRA 1DOIA 1WJNA 1TTNA 5DPRA 4NNJB 3VR8B 3ZNZB 2ZVNA 1UD7A 3ABVB 2C7MB 5AZFA 2HJ8A 3VH3B 1TKGA 2ZW0A 3HVDA 4B6WA 2YLMA 1RFKA 1CQVA 2UWQA 4YSZB 4PYUA 4W9LA 1GG3A 2JZZA 1QOBA 4ANWA 1JWBD 4EEWA 3KLSX 4LNKA 2KN5A 4XE0A 2KMCA 3H1UA 3W5VB 3NJTA 1A70A 2M0XA 2QMTA 1GC7A 2BVCA 3ZJUA 1EU4A 1F77A 2N7JA 1P3QU 3KWLA 1HZ6A 4ITKA 1E7PB 4F7ZA 4DWFA 4OVUA 2WDTB 1ZXHA 4ACFA 2MLBA 4FXCA 4NPNA 3ZLZA 2GBMA 3QIJA 4K7WA 2L05A 5CHFA 1GC6A 3Q14C 2V3PA 2NTTA 3A33B 2IBIB 3VTUA 4US8A 3ZNGC 1AWDA 1UGMA 1IGDA 2WXRA 2JU6X 3DBRI 2L00B 1NYQA 3QCAA 1WXAA 2KJHB 1UH6A 1QILA 1VD2A 2H88B 4HK2A 2MRPA 3IAS1 1OEYA 2N1WA 4NJ7A 1E90A 5EE3A 2N7DA 1C1YB 1OFFA 3NG0A 1WJ6A 4ZHOA 2KDEB 4YL8A 2K6DB 2KC2A 2EELA 3W1YA 1CMXB 3QHTA 3L4PA 3AEEB 4N9F4 2OHFA 3HRDD 1D5XC 1VLBA 5G5HA 3TCAA 1XT9B 2ASQA 1FM0D 3SFDB 4BBNF 3V6CB 2INCC 2G4SA 3M3JA 1GPXA 2ZNVB 4GOCA 3Q8CA 1JALA 4YTPB 2O2VA 2BWES 3K9OB 3Q3JA 2A5UA 1BMLC 1QOAA 4BKSA 2W55A 2W9NA 3FC4A 2CU3A 2HTHA 5E6OA 4ZRQA 3U8ZA 2LUEA 2RPQA 2L83A 2CS4A 3Q8FA 2IO0B 5MPOA 4RFBA 2KMMA 3DVNV 2C9WB 2C60A 2PEAA 4MH8A 1WYWB 3ZW3A 3VXWA 4TUUA 2QEJC 4GGQA 1K50A 2WXMA 4HXDA 2LZ6A 3O65B 3ZJVA 3KH0A 1HTOA 1H4RA 1MJDA 2WX0A 2JXTA 1UNSA 1GB1A 1MHHE 3FILB 1WM3A 2LFIA 4HKZE 3RYTA 4LNIA 4PS8A 5LXIB 1KM7A 4ANXA 1V1PA 2PMVA 3IXSA 3EUB2 2R2QA 2OJRA 4L23A 2ZPYA 1SIJA 4M0WA 4B95A 4LJOB 1V2YA 2KX0A 3QX1A 2JRIB 3N30A 4MDKE 4MM3B 4KZCA 4IM2A 5HG2A 4RMAA 1OQQA 4XYCA 2KJRA 4N58A 4NQLB 3URYA 1WXVA 2BBCA 1XO3A 2LJIA 4S17A 4P6VF 4LK0M 4XWWA 1MHXA 1L4ZB 4E74A 1R4MB 2FIFA 5D3IB 2I2YA 3H7PA 3ZVVA 4AWJA 4X57B 3WIMA 1WE7A 2K0PA 2K22A 2GBNA 1L0VB 2LXAA 4MJSB 4IKGA 4PS3A 4HRSA 5J18A 2VH1A 3E56A 4GIVA 2KTRB 3V3XA 1TS5A 1AARA 1SE2A 3SR6A 4DDID 2G1EA 2MP2B 4XZ4A 3DVGX 1F2RC 2PE9A 2K9XA 2E6XA 1WE6A 3C19A 2PVOD 4OVZA 1PQSA 3KYCD 2B3AA 1JMLA 3M62B 4D2KA 3ZNHB 3V6EB 1V1OA 4C4VA 1DOXA 1Z5SB 4JPSA 2K3UA 2XNAC 3ZXRA 2EKEC 1NYRA 1IBXB 2R61A 5TSSA 3DBSA 4DHZE 2NVUI 3JSVB 1KOTA 4UDUC 2J42A 4II2B 2E3TA 3ETRA 1R4NI 5EE9A 2JQRB 4P16A 1EO6A 2N9PC 2N9LA 1YX5B 2K39A 4TQ0A 2WXQA 2LD9A 2FCSA 2WYQA 3CIRB 2JZ3B 1JROA 3GE8C 4TV3A 1TYGB 2KNBA 1I35A 1L7YA 2GOWA 2KQ4X 2GMIC 3OWEB 1OTRB 4TSSA 2D11A 3VUXA 1F9JA 3T9LA 4K81A 4HJGE 2BYFA 3BYTB 1FXTB 5BYQA 2BS4B 2O6VB 1WF9A 3NUHB 2AQ3B 5KHOA 2J7QB 1IGCA 2OEDA 4EZLA 3R66C 3AMZA 3TIXA 2KWUB 3H8HA 2OJWA 2DENB 4FLHA 1E5WA 2DLBA 3DBLI 4RGNA 2BYEA 1UF0A 2BKRB 2AL3A 3N9YC 1IP9A 1XXGA 3KUDB 3AECB 1WR6E 3H6NA 1NENB 3BVGA 3A9KA 3AN1A 4I6PA 3NHEB 2LMCA 3VHTC 4CQNA 4EE2A 4MGIE 1M94A 1TJEA 1WSPA 3BYYB 2MW5A 3PS6A 4HDQA 4R3DA 3WAMA 5EDSA 4GN1A 2KDFB 3AEAB 4GDKB 1UZXB 3S2AA 2MA9B 3TMPB 3DBRB 3WA0A 2IY0B 2I38A 2ZJDA 4C7YA 1S3SG 3AEFB 4GSWA 5E6PA 1V49A 1ZDXA 3R7RA 2QIEB 2G4DB 3SFEB 1WMHA 1WZ0A 5AEKB 3AV8A 5HHDG 1FRDA 3CSFA 3J9CA 1QLBB 1WGHA 1C79A 4AJWA 1ET9A 2MBQA 4P1CC 5JH5C 2KDMA 1KLVA 1UELA 3P42A 2KFJA 3RNEC 3IBEA 3NVYA 2IGGA 1KH0A 1AW7A 2W54A 3KVFB 2DZJA 3N32A 2MBBB 1N61A 2NBUA 2K8CA 3B2GA 1MG8A 1KTKA 1VZ7A 2WXIA 5HKHA 4AS1A 3Q3FA 3APDA 1Q5WB 4WWOA 1SE9A 5FR3A 2AWTA 5CX3A 1Z2MA 1N6ZA 3AE5B 2D3BA 4WJPA 2W3SA 3UI3A 4ZYSA 2BWFA 4BKGA 2Z0EB 4W9HA 2V0GA 4FBJB 1I4QA 2KFKA 4EKUA 1XLPA 1FRRA 2MBEA 2AQ1B 1XLOA 1FCCC 3A1QB 5GXGB 5IKCM 2NR2A 3ZO5B 4YTMB 2FAZA 4GXBA 5BMHA 3VVWB 2JRHA 3UQBA 5BYSA 1E10A 4ZRPA 4AJYB 1J7AA 5BO4B 1QT9A 1WWTA 2QCZA 4RM9A 3TSSA 1JQ4A 5DCNA 4PT5A 1GAQB 4RF1A 1KF6B 1E7UA 1QF6A 3Q3MC 3NS8A 1YN5A 1VCBA 3AE6B 1ZKHA 2D3AA 3IT6B 3PRMB 1F52A 3RULA 2LHDA 4IWOA 3CF6E 4M8NA 4WQOB 5CHVC 3KYDD 3QK0A 4I6LB 3ML8A 2LGDA 4ZYNA 2H89B 2WXHA 2PKOA 4MH0E 1HZ5A 2IGHA 4NY0A 2V4LA 1FD6A 4ZDVA 3NZSA 4M02A 3HM6X 2AL6A 2DYMA 3PT2B 5FK9C 3OAWA 4L1BA 4WURA 4JWUC 4DBGA 1JWMD 4DHJB 3ML9A 5E6JA 2BYTA 2LJ5A 1DGJA 3ZTDA 2L3ZA 2KHWB 3ZXVA 3NZ3A 3SEBA 3PVLA 4KSLC 4WQMA 3UGBB 1Q10A 4FADA 1WJ4A 4AOFA 4NJCA 3LYYA 1MVKA 3EFUA 5CHWA 5HI1A 3QAQA 2ZCBA 5HFYA 4HCNB 1L6UA 3N20C 1F2RI 3APCA 2KX3A 1YX6B 1HE8A 2Y5PA 2L76A 2KOXA 2FCQA 2RDHA 3DOWA 4P1BC 4Q2JA 3AU4A 1SE4A 3DHIC 4E71A 3BK1A 1LM8B 1VR9A 4XDCA 3RD2A 2BB5A 1L2NA 1G6JA 1WRDB 3A9JB 3GS2A 1TKEA 3AE2B 3AEBB 3R2TA 1KJTA 4MEMA 4OVVA 2C7HA 1T0SC 1RYJA 3PREA 3FAHA 3DPDA 1I4GA 1BT0A 1T5XD 3U7ZA 3EA6A 1SSNA 1C9FA 3MHSD 5C2TB 1EF5A 2Q5WD 3WALA 2C7NB 3GP7A 2XK5B 2JSVX 5J17A 1T6BX 1TT5B 1HQRD 4PYZA 3IHPC 2O6VD 2KDIA 1AN8A 3ZDTA 2FUG1
chains in the Genus database with same CATH topology
1UWMA 3MJ5A 2L52A 3PO0A 1V97A 2J4XA 4KKJA 5BMIA 2WXFA 3AB5A 2SEBD 1JMLA 4D2KA 3MP9A 3MFGA 2YEPF 2GRIA 1EWYC 2WU2B 4TQ1A 1V1OA 1DOXA 2DYOA 2V3NA 4JPSA 2K3UA 2PIAA 3W2DA 1E9MA 5AUKA 3ZYYX 2CJNA 3TEXA 1TKYA 2B76B 2XNAC 1ZPSA 2BTEA 3RPFC 4LTUA 4RGTA 1NYRA 1IBXB 2R61A 5TSSA 2L32A 4ARIA 1ZOYB 3VR9B 4ZHPA 1JRPA 1QOFA 2INPE 2KWDA 1B1ZA 5BMGA 4HEA1 4UDUC 2J42A 1QOGA 2D5GA 4RGMA 1L6VA 4RH6A 2E3TA 3ETRA 3AEDB 1L5PA 1D5ZC 5EE9A 1FFVA 2JQRB 4P16A 4WWMA 2Z8LA 3I57A 2N9LA 4NAMA 1UGJA 4N59A 1QQRA 2JYTA 4IOIE 1FXIA 1WRIA 4TQ0A 2WXQA 2G9HD 2MJ3A 3CIRB 1Y56A 2VZKB 2TSSA 1JROA 1PUTA 4B0EA 2RMMA 1KFYB 1YNTE 1TYGB 4RNAA 3Q69A 1N5XA 1FXAA 2KQ4X 4A9AA 1FNWA 3OWEB 4TSSA 3GB1A 3NVZA 3BWUD 4HJGE 3T3OA 3R2IA 3AEGB 3BYTB 1PGAA 3AE9B 3BVZA 5BYQA 1FIQA 1K53A 1SEBD 1XCQL 2BS4B 2W82A 3LXFA 3NUHB 4US9A 2AQ3B 3KQ4A 1M4VA 2OEDA 1IGCA 3V05A 4C7ZA 2JX5A 3AMZA 3IAM1 1PGBA 3H8HA 3BK2A 1PFDA 1C4AA 5H92C 3ZQ4A 1FEHA 2KACA 3MC0B 4N6EB 2DLBA 1I4PA 4DQOC 4RGNA 4H2AA 2INNE 2Y3AA 2K5PA 1SF0A 1EWCA 3N9YC 1XXGA 3AECB 3O13A 1ACCA 1NENB 3BVGA 1AYFA 1VJKA 2LHEA 2LUMA 3AN1A 1FO4A 1RM6C 2LMCA 4AQ7A 2LGIA 4TMAB 4CQNA 4EE2A 1TY2A 2HTME 3W5UB 1KLUD 1TJEA 1UUPA 1WSPA 3BYYB 4OW0A 1T3QA 1ZUD2 2LEKA 4R3DA 4RGOS 4A8XC 1L4DB 3VQIA 2PTLA 1KLGD 1GB4A 3TUOA 1L0XB 2FBWB 4WAFA 1MI0A 2NTSA 1STEA 1ZDVA 1NVID 3I9V1 1K52A 3AEAB 3KWVA 3MHZA 4GDKB 1HEZE 1JWSD 2MH7A 4NZLB 5AUIA 4JWSC 4MT5A 1IBXA 4GDLB 1WXQA 3AE1B 2PLPA 1TY0A 2I38A 3HVZA 1DOIA 4KGRA 4C7YA 2RDGA 3AEFB 1ZE3D 3VR8B 2HDEA 3FILA 2MEKA 3ABVB 3TEWA 2J52A 1ZDXA 2QIEB 1YQ4B 3SFEB 1TKGA 4REZA 1FMAD 2ZW0A 3HVDA 2JWUA 1FCLA 1RFKA 4YSXB 1CQVA 1OQRA 2WQYB 2MJDA 3Q8AA 3AV8A 5HHDG 2BS3B 1FRDA 1VDVA 4YSZB 2KN4A 1K51A 3DWGC 2WXKA 3J9CA 3NVWA 4A90A 1QOBA 4XDDA 4LLGM 2DWQA 1JWBD 1QLBB 1VZ6A 1C79A 4YXDB 1JWUD 1ET9A 1FFUA 1PYWD 1HXYD 3AM9A 2XN9C 3KLSX 1F0ZA 1GOZA 1TS2A 1BUIC 2KDMA 3RFZB 4XE0A 2RPVA 3P42A 4C80A 3W5VB 1A70A 1XEEA 1PDXA 5LNK1 2QMTA 3NVYA 2IGGA 2JYEA 3ZJUA 1KH0A 1AW7A 3W1SA 1EU4A 2ZW1A 1F77A 2N7JA 2W54A 2WXLA 5T8IA 3KWLA 1HZ6A 1HA5A 1XLNA 4ITKA 1E7PB 3BVMA 3VRAB 3ZJTA 1FNUA 1I7HA 1EM7A 1N61A 2BT6A 1YMHE 4YSYB 1CJEA 1P7EA 3B2GA 2IGDA 1KTKA 1ZXHA 1VZ7A 2WXIA 3AE4B 3Q8EA 4AS1A 1I4XA 4DXGA 4FXCA 2N9KA 4A6QA 1IUEA 4IDIA 4RF0A 1I4RA 4HKQA 2M56B 1J7BA 5FR3A 2WDQB 1SJED 4B0MA 2WXPA 3AE5B 2V3PA 2NTTA 2W3SA 3UI3A 1YN3A 2ACZB 4ZYSA 2WXOA 3R8BA 4C56C 4US8A 2BS2B 1C4PA 1AWDA 2V0GA 1IGDA 2AQ2B 2WXRA 1SE3A 1I4QA 2JU6X 3T3NA 1J7CA 1V1PB 1XLPA 1FRRA 1NYQA 3HUIA 2AQ1B 3P4RB 4KGTA 5EE0A 2AX5A 1XLOA 5I4DA 1FCCC 5GXGB 1QILA 2H88B 2ICIA 4YTMB 5BMHA 1ZP0B 1ROEA 1P7FA 3IAS1 2GB1A 3W9CB 1DOYA 2YEPB 5EE3A 1DYQA 1D5MC 5BYSA 1N60A 1E10A 4ZRPA 1BXTA 2N0SB 1OFFA 2QILA 4ZHOA 2WDVB 1VZ8A 2EELA 1J7AA 1QT9A 1NEKB 1WWTA 1FNVA 3PZ7A 4MACA 3L4PA 3TSSA 3AEEB 3ZGZA 1EU3A 1D4BA 4KX6B 1JQ4A 2OHFA 3HRDD 4RCOA 2MJEA 4YWGG 4PT5A 4ARCA 1D5XC 4J3OD 1VLBA 5G5HA 1D6EC 4OHJA 3P4QB 1WYGA 1GAQB 2X38A 1FM0D 4RF1A 3SFDB 1C76A 2V4IB 3AE7B 1KF6B 1PGXA 2M19A 2IPKD 1ZXIA 1QF6A 2PW9A 1YN5A 1GPXA 1RWSA 2WXJA 3AE6B 3IT6B 1XLQA 3Q8BA 3Q8CA 1JALA 2LHDA 4YTPB 4OZBA 3P1MA 1C77A 1BMLC 2M0AA 2WNMA 1QOAA 1CK1A 2PVGC 2W55A 3VRBB 4GLSC 1JW9D 3FC4A 2CU3A 1UWXA 3P4PB 2WXGA 2BB6A 4XWTA 2H89B 2WXHA 1SBBB 2PKOA 4ZRQA 2IDYA 1ET6A 2L83A 1HZ5A 2IGHA 3Q8FA 1FD6A 5MPOA 4RFBA 2KMMA 1KRHA 2WLBA 1JCKB 4MH8A 4A55A 2GI9A 2DYMA 3P63A 5FK9C 1SB3C 4L1BA 4L2YA 2EKIA 1R7SA 2W3RA 4WURA 4JWUC 5JXVA 1B9RA 2QEJC 1JWMD 1K50A 3WCQA 1C78A 2WXMA 3ZJVA 2BYTA 5E6JA 4KGSA 2WU5B 3DWMA 3BIID 1DGJA 5C3JB 4OZAA 1L0YB 1CZPA 2JXTA 1UNSA 1MPEA 3NZ3A 3SEBA 2DBYA 1GB1A 1MHHE 3FILB 4WQMA 2NMQA 1Q10A 2LFIA 1I4HA 3AH7A 4HKZE 3BZDB 2WS3B 1YJIA 4NJCA 1TS3A 2IJ0A 3LYYA 1V1PA 2PMVA 1SJHD 1MVKA 2J53A 2WP9B 5HI1A 3EGRA 3IXSA 4JX1C 1YN4A 5HFYA 3EUB2 3NVVA 4HROA 3NRZA 3B9JA 1L6UA 3C8YA 5D7GA 1F2RI 3AE8B 3U4EG 4L23A 3B2FA 1SIJA 4M0WA 5BYRA 1NI3A 4WIPA 1C4CA 1VRAB 1LO5D 2Y5PA 2KAJA 1N62A 3IT4B 4OZCA 4O1NA 2BW2A 2RDHA 4MM3B 1E0ZA 3TEYA 4Q2JA 5HG2A 4JE3B 2Y5CA 4YTNB 1ENFA 1OQQA 1YJJA 4N58A 1SE4A 3URYA 2BBCA 3U52E 3AE3B 1YQ3B 1XO3A 3BK1A 2CJOA 3NS1A 1VR9A 4XDCA 4DXFA 2LJIA 4P6VF 1QKZA 2WDRB 2BB5A 4LK0M 4XWWA 1MHXA 1XCTL 1L4ZB 4USAA 1SXTA 3GS2A 5D3IB 1TKEA 3AE2B 3AEBB 3R2TA 5EE1A 2I2YA 1ESFA 2K0PA 1RYJA 2K22A 2JZPA 1L0VB 1JWAD 4YT0B 3FAHA 1I4GA 4KKIA 4IKGA 2FE8A 4HRSA 1T5XD 3U2SC 1N5WA 2ONQA 3E56A 2VZKD 3EA6A 3U7ZA 1SSNA 3P4SB 3V3XA 1C9FA 1TS5A 2QSDA 5C2TB 2L1AA 1SE2A 2Q5WD 3LB8C 3SR6A 3GP7A 2G1EA 2JSVX 3TEZA 2SAKA 1T6BX 1E6EB 4ZOHC 1TS4A 1F2RC 3PZ8A 1HQRD 5D3DA 5FKAC 5G5GA 2K9XA 2ON8A 2E6XA 4WH4A 1N63A 1WGKA 3E9SA 2PVOD 2WXNA 3CWIA 4OVZA 5H8YE 1XF5L 2QJLA 1AN8A 4NAWB 2FUG1 1TZOA 1V8CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UWM A;  3DWM A;  3BII D;  1DGJ A;  1J7B A;  2L52 A;  2M56 B;  2WDQ B;  3PO0 A;  1V97 A;  5C3J B;  3AB5 A;  1NEN B;  3AE5 B;  1AYF A;  1VJK A;  1FO4 A;  3AN1 A;  1CZP A;  2W3S A;  1RM6 C;  2ACZ B;  1EWY C;  2WU2 B;  4US8 A;  2BS2 B;  2DBY A;  4WQM A;  2HTM E;  1AWD A;  3AH7 A;  1DOX A;  3W5U B;  2WS3 B;  1TJE A;  1YJI A;  1T3Q A;  1J7C A;  1ZUD 2;  2LEK A;  1E9M A;  1XLP A;  2PIA A;  5AUK A;  3P4Q B;  1FRR A;  3ZYY X;  2CJN A;  1NYQ A;  3HUI A;  3P4R B;  1TKY A;  2B76 B;  5EE0 A;  3RPF C;  2WP9 B;  2FBW B;  4LTU A;  2AX5 A;  1XLO A;  1NYR A;  1NVI D;  4JX1 C;  5GXG B;  3AEA B;  2H88 B;  2MH7 A;  3EUB 2;  5AUI A;  3NVV A;  4JWS C;  4HRO A;  4YTM B;  3NRZ A;  1WXQ A;  1L6U A;  1ZP0 B;  3AE1 B;  3B9J A;  1ROE A;  1ZOY B;  3W9C B;  1DOY A;  4C7Y A;  3HVZ A;  1DOI A;  5EE3 A;  3VR9 B;  4ZHP A;  1JRP A;  1QOF A;  3AE8 B;  3AEF B;  3B2F A;  1N60 A;  1E10 A;  1SIJ A;  3VR8 B;  1NI3 A;  2N0S B;  1OFF A;  1QOG A;  4ZHO A;  2WDV B;  1L6V A;  2KAJ A;  2E3T A;  3ETR A;  3ABV B;  1N62 A;  3AED B;  1J7A A;  1QT9 A;  1NEK B;  1WWT A;  1L5P A;  5EE9 A;  1FFV A;  2JQR B;  1E0Z A;  2QIE B;  3L4P A;  4WWM A;  3AEE B;  1YQ4 B;  3SFE B;  1TKG A;  2Y5C A;  4KX6 B;  1FMA D;  4YTN B;  1JQ4 A;  2OHF A;  4N59 A;  1OQQ A;  3HRD D;  1YJJ A;  2MJE A;  4N58 A;  1RFK A;  4YSX B;  1VLB A;  1OQR A;  2WQY B;  5G5H A;  2MJD A;  1FXI A;  1YQ3 B;  3AE3 B;  3AV8 A;  1XO3 A;  2BS3 B;  1WRI A;  1FRD A;  1GAQ B;  1FM0 D;  1VDV A;  1WYG A;  2CJO A;  3NS1 A;  3SFD B;  4YSZ B;  3DWG C;  3AE7 B;  2MJ3 A;  1KF6 B;  2M19 A;  3CIR B;  3NVW A;  1QOB A;  2WDR B;  4P6V F;  1ZXI A;  1QF6 A;  1JWB D;  2DWQ A;  1QLB B;  4YXD B;  1FFU A;  1JRO A;  1PUT A;  1RWS A;  4USA A;  1GPX A;  1KFY B;  3AM9 A;  3AE6 B;  1XLQ A;  1TYG B;  1JAL A;  1F0Z A;  1TKE A;  3AE2 B;  3AEB B;  4YTP B;  5EE1 A;  1N5X A;  1FXA A;  4A9A A;  3P1M A;  4C80 A;  3W5V B;  1RYJ A;  1A70 A;  2K22 A;  1PDX A;  1L0V B;  1JWA D;  4YT0 B;  3NVZ A;  3FAH A;  1QOA A;  3NVY A;  2PVG C;  2W55 A;  3AEG B;  3VRB B;  1JW9 D;  3AE9 B;  4HRS A;  1N5W A;  2W54 A;  3FC4 A;  2CU3 A;  1FIQ A;  2BS4 B;  3P4S B;  3LXF A;  3P4P B;  3KWL A;  2H89 B;  1XLN A;  2PKO A;  4US9 A;  4ITK A;  1E7P B;  2L83 A;  3VRA B;  1N61 A;  1I7H A;  4C7Z A;  2BT6 A;  5MPO A;  2JX5 A;  2KMM A;  3AMZ A;  1KRH A;  4YSY B;  5C2T B;  2WLB A;  1CJE A;  2Q5W D;  3LB8 C;  3B2G A;  3SR6 A;  1PFD A;  5H92 C;  2G1E A;  3P63 A;  1E6E B;  1SB3 C;  3AE4 B;  4N6E B;  4ZOH C;  1B9R A;  2EKI A;  1R7S A;  2W3R A;  4JWU C;  2K9X A;  5G5G A;  4FXC A;  2K5P A;  1SF0 A;  1N63 A;  1WGK A;  1IUE A;  2PVO D;  3CWI A;  3WCQ A;  4IDI A;  5H8Y E;  2QJL A;  3AEC B;  1V8C A;  2WU5 B; 
#chains in the Genus database with same CATH topology
 4K1R B;  4KKJ A;  3AB5 A;  5IO9 A;  2L8J A;  3MFG A;  3UIN B;  1EWY C;  4G0N B;  2WU2 B;  2A4Z A;  3PZD A;  4FJV B;  4MEL A;  3Q2A C;  2DYO A;  2KJ6 A;  1YD8 U;  5AUK A;  3ZYY X;  1TKY A;  2BTE A;  3TJP A;  3BIN A;  4RGT A;  3HHM A;  1NDD A;  4JLC A;  3L17 A;  1ZOY B;  5G55 A;  2Z59 B;  1JRP A;  2KWD A;  1ZGU B;  3SHQ A;  2V9H A;  4RGM A;  1L6V A;  2MQJ A;  1NI2 A;  2UU7 A;  1P0R A;  3AED B;  4EOY A;  2FCN A;  1D5Z C;  4ASW C;  4MM3 A;  4IM0 A;  4NAM A;  1UGJ A;  2GBR A;  5L95 C;  1QQR A;  1V5O A;  1FXI A;  1IPG A;  2MJ3 A;  2IND C;  2VZK B;  3PLU A;  1YIW A;  2TSS A;  2RMM A;  3NOB A;  1FPY A;  2GBJ A;  2FCM A;  4MSQ B;  4XX5 A;  3CMM B;  1N5X A;  1WGG A;  1FXA A;  3PHW B;  1QZE A;  3V61 A;  4BFR A;  2FID A;  3NVZ A;  4HCP B;  3Q3O C;  1WH3 A;  2KMA A;  4MJS A;  1PGA A;  1SEB D;  1K53 A;  1WX7 A;  2KTR A;  3KQ4 A;  4C7Z A;  5JHA A;  5AZH A;  2NCN A;  1PGB A;  1RLF A;  3ZNI D;  3BK2 A;  2KAC A;  1WZ3 A;  3MC0 B;  3PLV A;  2MP2 A;  1I4P A;  4DQO C;  3C0R B;  2QC8 A;  2K5P A;  1SF0 A;  1P98 A;  2KT7 A;  2DZK A;  1K8R B;  2QHO A;  1YJ1 A;  2XEW A;  3O13 A;  3VAW A;  4BBN C;  3CST A;  1ACC A;  2KLC A;  1VJK A;  2LUM A;  2BYV E;  4TMA B;  2HTM E;  3VTV A;  3I63 C;  3OJ3 A;  2CKH B;  2RD0 A;  1KLU D;  1RRB A;  4RGO S;  4HJK A;  1L0X B;  1MI0 A;  1STE A;  1ZDV A;  2VRR B;  1NVI D;  1HEZ E;  5J2R A;  1IBX A;  5AUI A;  3R7Q A;  4MT5 A;  4GDL B;  3AE1 B;  2PLP A;  2KLG A;  3HVZ A;  3L13 A;  2RDG A;  3JSV A;  5CTR C;  1V86 A;  3HK0 A;  1J0G A;  2J0K A;  4F8C B;  2L7R A;  3U30 A;  5G2N A;  1YQ4 B;  2JWU A;  1FCL A;  4YSX B;  2WQY B;  4LNO A;  2MJD A;  2PPH A;  2BS3 B;  3B08 A;  3DVN U;  1VDV A;  5DPT A;  3RUI B;  2KN4 A;  3DWG C;  2WXK A;  3NVW A;  4XDD A;  4LLG M;  4YXD B;  2WX1 A;  1FFU A;  1E8Y A;  1HXY D;  3AM9 A;  2PE6 B;  2XN9 C;  1GOZ A;  1TS2 A;  1XD3 B;  3RFZ B;  3VFK A;  4C80 A;  1XEE A;  1PDX A;  5LNK 1;  4DK5 A;  2JYE A;  2ZW1 A;  1XLN A;  1HA5 A;  2O6V A;  3N1X C;  3VRA B;  1FNU A;  2GBK A;  1EM7 A;  3A4S C;  4YSY B;  3IG3 A;  1P7E A;  4PS7 A;  2IGD A;  4F1S A;  1OEY J;  4A6Q A;  1MFW A;  1C3T A;  4IDI A;  4RF0 A;  4HKQ A;  1EF1 A;  2M56 B;  1J7B A;  2NPT B;  2WDQ B;  4HLE A;  1Q0W B;  2N9X A;  4WAA A;  1V80 A;  2ACZ B;  3K9P B;  3QA8 A;  2DHZ A;  4C56 C;  2BS2 B;  4DDG D;  2IO1 B;  1C4P A;  5DPS A;  1LGR A;  3T3N A;  4DHJ D;  1J8C A;  2L0T A;  3P4R B;  5EE0 A;  4M00 A;  2AX5 A;  3RNC C;  3SD5 A;  2ICI A;  4GDK A;  1YOV B;  5E6N A;  3ONS A;  1E8W A;  1A5R A;  1ROE A;  1P7F A;  2WGS A;  2GB1 A;  3W9C B;  2DZM A;  1DYQ A;  2OOB B;  2I1K A;  4HPM B;  1N60 A;  2N0S B;  5TR5 A;  3LJ3 A;  4KIK B;  4XC2 A;  1FNV A;  4MAC A;  2DAF A;  4KDL B;  2D3G A;  1EU3 A;  4KX6 B;  1WXM A;  2MJE A;  4J3O D;  2KDB A;  3GZN I;  3P4Q B;  2KYW A;  3B1L X;  1WYG A;  5IA7 A;  2M4N A;  3X0W A;  2KTF A;  2V4I B;  3AE7 B;  1TIF A;  1PGX A;  2M19 A;  1ZXI A;  3BY4 B;  4ANU A;  2PW9 A;  5LLI A;  4EFO A;  1E8X A;  4JGH B;  1HTQ A;  1XLQ A;  3Q8B A;  1WIA A;  4LDT B;  1GJZ A;  2KD0 A;  3P1M A;  2CU1 A;  2WNM A;  3PV1 A;  2PVG C;  3VRB B;  2KQ7 A;  3ZIM A;  4XWT A;  2BB6 A;  1SBB B;  1EUV B;  2IDY A;  1ET6 A;  4IWQ A;  1WGD A;  1LXD A;  1KRH A;  2WLB A;  2ZEQ A;  2D2Q A;  4W9G A;  2ZPN A;  2GI9 A;  2UYZ B;  4M8M A;  4L2Y A;  1B9R A;  5JXV A;  1NBF C;  4GMV A;  3WCQ A;  3ZKJ C;  5IP4 D;  2V3S A;  4KSK C;  2HE7 A;  2LGY A;  3BII D;  5C3J B;  4FJY A;  4OZA A;  1WJU A;  2L0F A;  1MPE A;  2DBY A;  3KW5 B;  1T0R C;  3AH7 A;  3BZD B;  2JT4 B;  2C5L C;  2WS3 B;  1YJI A;  1TS3 A;  2IJ0 A;  1SJH D;  2MSE D;  2J53 A;  2WP9 B;  3DDC B;  1T0Y A;  3WAP A;  2M17 A;  4JX1 C;  3IFW B;  3OJ4 B;  1YN4 A;  3KUC B;  3A1Q A;  3NVV A;  2RGF A;  2J0J A;  3C8Y A;  2FUH B;  2ZVO A;  3B0A A;  2M1M A;  3AE8 B;  4HPP A;  2YVC A;  1OQY A;  2JF5 A;  4WWN A;  1C4C A;  1VRA B;  1WX9 A;  2MBO A;  4FJZ A;  2KAJ A;  1N62 A;  4OZC A;  2BW2 A;  3NY5 A;  3TEY A;  4ZRJ A;  4JE3 B;  4YTN B;  1ENF A;  1YJJ A;  3U52 E;  1YQ3 B;  4LJP B;  1TZ1 A;  2CJO A;  3NS1 A;  4DXF A;  5FR6 A;  1QKZ A;  2WDR B;  3WAN A;  2X8X X;  2LAS A;  3AI5 A;  4USA A;  1SXT A;  3DCG A;  5EE1 A;  1ESF A;  1T0Q C;  2I1J A;  2BF8 B;  4YT0 B;  4W9D A;  2RR9 A;  4KKI A;  2K1F A;  1P1A A;  4FHK A;  1N5W A;  4KVG B;  2VZK D;  3P4S B;  4LNF A;  4ZRK A;  4MGZ E;  2QSD A;  4ANV A;  2L1A A;  3LB8 C;  1WFY A;  3TEZ A;  2KO3 A;  2SAK A;  1E6E B;  1WX8 A;  5FKA C;  5D3D A;  4CHK A;  3OLM D;  2ON8 A;  4W9K A;  4WH4 A;  1WGK A;  3QJZ A;  3CWI A;  3M63 B;  2KQS A;  4W9I A;  5H8Y E;  2QJL A;  4NAW B;  1TZO A;  1V8C A;  3P2B A;  2IO3 B;  3PO0 A;  4MGK E;  4FHJ A;  1V97 A;  3ENE A;  2AEH A;  2YEP F;  2QDF A;  4S0R A;  3ZUN A;  3RZW C;  4TQ1 A;  2ZNV C;  2V3N A;  1E9M A;  3MJW A;  4M01 A;  2CJN A;  2B76 B;  1ZPS A;  1UBI A;  4LTU A;  3HIZ A;  3QQ8 B;  2L32 A;  4HPL B;  4ARI A;  3T8M A;  4ZHP A;  2MX2 A;  1QOF A;  2LGX A;  2INP E;  5BMG A;  1F1H A;  1QOG A;  2D07 B;  1UBQ A;  4BOS C;  4RM8 A;  4BVU C;  2IYD B;  2K8H A;  2LGS A;  3DVG Y;  1FFV A;  1SGH A;  2VH2 A;  4IG7 B;  2HD5 B;  4N59 A;  3ZRC A;  2JYT A;  4JIO U;  4ICU A;  4EZK A;  1RFA A;  2G9H D;  3PRP B;  2RSU A;  3MC8 A;  5JHB A;  1JRU A;  4BKT A;  1PUT A;  3X23 A;  3DBH I;  1KFY B;  3Q3N C;  2DYB A;  1YNT E;  4K3B A;  3A9J A;  4A9A A;  1FNW A;  2BKF A;  2G45 B;  2LVO A;  2BPS A;  3L54 A;  3GB1 A;  5D2M B;  2G3Q B;  3BWU D;  3R2I A;  4G50 A;  3BVZ A;  3EFC A;  1FIQ A;  2W82 A;  3LXF A;  1R4N B;  3IAM 1;  2N7E A;  3RCZ A;  2NBV B;  1PFD A;  1C4A A;  5H92 C;  2LRU A;  2XK5 A;  4N6E B;  3JVZ X;  4QAY A;  4H2A A;  2Y3A A;  3RI7 C;  2CHW A;  1U4A A;  2KK8 A;  3W1S C;  2Z0D B;  1WR1 A;  1E7V A;  3WAO A;  2EMS A;  1TGZ B;  2LHE A;  3ZRF A;  4AQ7 A;  2LGI A;  1V81 A;  1TY2 A;  3EC8 A;  2LVQ A;  1T3Q A;  1ZUD 2;  2LEK A;  3H7S A;  4A8X C;  3HM3 A;  1L4D B;  3VQI A;  2PTL A;  1WI0 A;  1OGW A;  1V6E A;  3EHV A;  4WAF A;  2NTS A;  3I9V 1;  1K52 A;  3KWV A;  1JWS D;  2MH7 A;  4NZL B;  2KWC A;  3DBL B;  3JW0 X;  3L08 A;  2LRW A;  1MG4 A;  1LQB A;  3V60 A;  1ZE3 D;  3JYU A;  2DAJ A;  2HDE A;  4NQK E;  3FIL A;  2MEK A;  3TEW A;  2J52 A;  1ZW7 A;  1WM2 A;  3PGE A;  4REZ A;  1FMA D;  2KXJ A;  3VDZ A;  1OQR A;  3Q8A A;  3QAR A;  4KV2 A;  1K51 A;  3RT3 B;  4A90 A;  1X1M A;  2DWQ A;  3GOE A;  1VZ6 A;  1JWU D;  1PYW D;  2JY6 A;  3GZN B;  3KUZ A;  1F0Z A;  2NS5 A;  2O2V B;  1BUI C;  2RPV A;  3FKY A;  4WJN A;  1YQB A;  2KZR A;  3I3T B;  1WY8 A;  3VUY A;  3W1S A;  3RZF A;  2WXL A;  5T8I A;  3BVM A;  3ZJT A;  1I7H A;  2MCN B;  2BT6 A;  1YMH E;  5C23 A;  4LDT D;  5D94 A;  1CJE A;  1Q1O A;  4W9J A;  3AE4 B;  3Q8E A;  3AXC A;  4BAX A;  1I4X A;  1SIF A;  4DXG A;  2N9K A;  1IUE A;  1LFD A;  4IC7 B;  2KC1 A;  4DXA B;  1I4R A;  4WJO A;  4TKN A;  3PPA A;  2JUO A;  1SJE D;  2RDB C;  4B0M A;  2WXP A;  4MGY E;  3RNF C;  1YN3 A;  3RNG C;  2WXO A;  3R8B A;  4G3X B;  3N3K B;  5L83 A;  3L0W B;  2AQ2 B;  1SE3 A;  3ECI A;  3PRZ A;  1J7C A;  1V1P B;  4II3 B;  2WWZ A;  4AP4 C;  4KGT A;  3HUI A;  4IUM B;  1D3Z A;  2KVZ A;  1Y8R C;  5I4D A;  2LI5 A;  5DPW A;  3RN9 C;  1ZP0 B;  4GDL A;  1DOY A;  2YEP B;  2IZV B;  1D5M C;  4M0W B;  2V1Y A;  4GB9 A;  4NJ6 A;  1BXT A;  2CHZ A;  2QIL A;  5IAA C;  2WDV B;  1S1Q B;  1VZ8 A;  2LWP A;  3QWZ B;  1NEK B;  3PZ7 A;  4URK A;  4IWP A;  3I5J C;  3EEC A;  4BOZ B;  4FA6 A;  3ZGZ A;  3PTF C;  1D4B A;  3NZU A;  3PHX B;  4RCO A;  4YWG G;  4ARC A;  1D6E C;  2DX5 B;  4OHJ A;  2HJ1 A;  2X38 A;  2DNF A;  4IM3 A;  1C76 A;  1TBE A;  3UIP B;  2FNJ B;  3VUW A;  2PJH A;  2IPK D;  2M8S A;  1XQQ A;  3AU5 A;  1RWS A;  3RNA C;  2WXJ A;  3DHG C;  3H7P B;  4HWI B;  4OZB A;  3QC8 B;  4JL9 A;  1C77 A;  2KKC A;  2M0A A;  4IW0 A;  4PK1 A;  1CK1 A;  4GLS C;  1JW9 D;  1UWX A;  3P4P B;  2WXG A;  4W9E A;  3N1Z C;  5GMV A;  1JCK B;  4MSM B;  3RMK C;  4A55 A;  4GU2 A;  3P63 A;  1SB3 C;  3AUL A;  2REX A;  2EKI A;  1R7S A;  2W3R A;  2KAN A;  3SU8 X;  1C78 A;  4XGA B;  4KGS A;  2WU5 B;  2CHX A;  3DWM A;  3N1Y C;  1V9J A;  1L0Y B;  2NPT A;  2R2O A;  3APF A;  1CZP A;  3TBL D;  4W9C A;  4C4V B;  2NMQ A;  4A3O A;  1I4H A;  5IN7 A;  1GNU A;  5D6J B;  2JPH A;  4W9F A;  4EUT A;  3EGR A;  3UF8 A;  4HRO A;  3NRZ A;  3B9J A;  4LNN A;  4LCD E;  5D7G A;  1GUA B;  3U4E G;  2K25 A;  3IVF A;  3B2F A;  3MTN B;  4ZRI A;  2DZI A;  5BYR A;  1NI3 A;  4WIP A;  1LO5 D;  2D10 A;  3IT4 B;  4J6I A;  2JWZ A;  3ZTC A;  4O1N A;  4KIK A;  2NBW B;  1E0Z A;  2Y5C A;  3AE3 B;  2MBH A;  3TL5 A;  2BGF A;  1XCT L;  3R3M A;  4HDO A;  3RNB C;  4FUL A;  4K7U A;  2KVR A;  2JZP A;  1JWA D;  3DBH B;  3U7D A;  2IY1 B;  5AZG A;  4WWP A;  2FE8 A;  3U2S C;  2ONQ A;  2ZCC A;  2N4F A;  2Y5B B;  4DHZ B;  3DQV A;  4ZOH C;  1TS4 A;  3PZ8 A;  5JZE B;  5G5G A;  2JXX A;  1N63 A;  3E9S A;  2WXN A;  1XF5 L;  3ZDM C;  1UWM A;  3MJ5 A;  2L52 A;  2J4X A;  3A9K B;  5BMI A;  2J0M A;  2WXF A;  2SEB D;  2MHJ A;  3ALB A;  3MP9 A;  4WJQ A;  3A4R A;  2GRI A;  4G11 A;  5LXH A;  2K6Q A;  3D32 A;  2LVP A;  5IOI A;  3W2D A;  2PIA A;  3TEX A;  1V5T A;  3RPF C;  2IO2 B;  4ICV A;  3MC9 A;  2GLS A;  2XBB C;  2D3C A;  3VR9 B;  1B1Z A;  2N1V A;  4HEA 1;  2D5G A;  4P7I A;  3H9D A;  1J19 A;  4RH6 A;  4K3C A;  2ZZP B;  4CYE A;  4C00 A;  2LXC A;  1L5P A;  4E3C A;  4WWM A;  4KZ0 A;  1WMH B;  4AUQ C;  2Z8L A;  3UQA A;  3I57 A;  1R4M I;  3GE3 C;  4IOI E;  5C1Z A;  5KHQ A;  1WRI A;  1RAX A;  2MWS B;  1IYF A;  1Y56 A;  3LDZ E;  2K8B A;  4B0E A;  1E8Z A;  4A3P A;  2AYO B;  4RNA A;  3Q69 A;  3Q6B A;  3UIO B;  2JVC A;  2N9E B;  3T3O A;  3AEG B;  1WXS A;  3AE9 B;  3PSE B;  3SDL C;  1XCQ L;  2BQQ A;  1P9D U;  4US9 A;  3VTW A;  1M4V A;  2KWV B;  4B9K A;  3V05 A;  2JX5 A;  3ZQ4 A;  1FEH A;  1ISN A;  2CR5 A;  3L16 A;  4BKS D;  2WHI A;  2INN E;  1EWC A;  3VH4 B;  3L10 B;  1WGR A;  4CO7 A;  4NAW A;  3V62 A;  1AYF A;  1FO4 A;  1RM6 C;  2EMT A;  3DHH C;  4KDI C;  1WGY A;  2KFK B;  4A20 A;  3W5U B;  1UUP A;  4JQW C;  4OW0 A;  4BZA A;  1I42 A;  4I6N B;  1KLG D;  4FN2 A;  3TUO A;  1GB4 A;  2FBW B;  1H8C A;  4K7S A;  4HVB A;  3MHZ A;  4JWS C;  3M95 A;  3OG5 A;  1WXQ A;  4EZJ A;  1TY0 A;  4KGR A;  1DOI A;  1WJN A;  1TTN A;  5DPR A;  4NNJ B;  3VR8 B;  3ZNZ B;  2ZVN A;  1UD7 A;  3ABV B;  2C7M B;  5AZF A;  2HJ8 A;  3VH3 B;  1TKG A;  2ZW0 A;  3HVD A;  4B6W A;  2YLM A;  1RFK A;  1CQV A;  2UWQ A;  4YSZ B;  4PYU A;  4W9L A;  1GG3 A;  2JZZ A;  1QOB A;  4ANW A;  1JWB D;  4EEW A;  3KLS X;  4LNK A;  2KN5 A;  4XE0 A;  2KMC A;  3H1U A;  3W5V B;  3NJT A;  1A70 A;  2M0X A;  2QMT A;  1GC7 A;  2BVC A;  3ZJU A;  1EU4 A;  1F77 A;  2N7J A;  1P3Q U;  3KWL A;  1HZ6 A;  4ITK A;  1E7P B;  4F7Z A;  4DWF A;  4OVU A;  2WDT B;  1ZXH A;  4ACF A;  2MLB A;  4FXC A;  4NPN A;  3ZLZ A;  2GBM A;  3QIJ A;  4K7W A;  2L05 A;  5CHF A;  1GC6 A;  3Q14 C;  2V3P A;  2NTT A;  3A33 B;  2IBI B;  3VTU A;  4US8 A;  3ZNG C;  1AWD A;  1UGM A;  1IGD A;  2WXR A;  2JU6 X;  3DBR I;  2L00 B;  1NYQ A;  3QCA A;  1WXA A;  2KJH B;  1UH6 A;  1QIL A;  1VD2 A;  2H88 B;  4HK2 A;  2MRP A;  3IAS 1;  1OEY A;  2N1W A;  4NJ7 A;  1E90 A;  5EE3 A;  2N7D A;  1C1Y B;  1OFF A;  3NG0 A;  1WJ6 A;  4ZHO A;  2KDE B;  4YL8 A;  2K6D B;  2KC2 A;  2EEL A;  3W1Y A;  1CMX B;  3QHT A;  3L4P A;  3AEE B;  4N9F 4;  2OHF A;  3HRD D;  1D5X C;  1VLB A;  5G5H A;  3TCA A;  1XT9 B;  2ASQ A;  1FM0 D;  3SFD B;  4BBN F;  3V6C B;  2INC C;  2G4S A;  3M3J A;  1GPX A;  2ZNV B;  4GOC A;  3Q8C A;  1JAL A;  4YTP B;  2O2V A;  2BWE S;  3K9O B;  3Q3J A;  2A5U A;  1BML C;  1QOA A;  4BKS A;  2W55 A;  2W9N A;  3FC4 A;  2CU3 A;  2HTH A;  5E6O A;  4ZRQ A;  3U8Z A;  2LUE A;  2RPQ A;  2L83 A;  2CS4 A;  3Q8F A;  2IO0 B;  5MPO A;  4RFB A;  2KMM A;  3DVN V;  2C9W B;  2C60 A;  2PEA A;  4MH8 A;  1WYW B;  3ZW3 A;  3VXW A;  4TUU A;  2QEJ C;  4GGQ A;  1K50 A;  2WXM A;  4HXD A;  2LZ6 A;  3O65 B;  3ZJV A;  3KH0 A;  1HTO A;  1H4R A;  1MJD A;  2WX0 A;  2JXT A;  1UNS A;  1GB1 A;  1MHH E;  3FIL B;  1WM3 A;  2LFI A;  4HKZ E;  3RYT A;  4LNI A;  4PS8 A;  5LXI B;  1KM7 A;  4ANX A;  1V1P A;  2PMV A;  3IXS A;  3EUB 2;  2R2Q A;  2OJR A;  4L23 A;  2ZPY A;  1SIJ A;  4M0W A;  4B95 A;  4LJO B;  1V2Y A;  2KX0 A;  3QX1 A;  2JRI B;  3N30 A;  4MDK E;  4MM3 B;  4KZC A;  4IM2 A;  5HG2 A;  4RMA A;  1OQQ A;  4XYC A;  2KJR A;  4N58 A;  4NQL B;  3URY A;  1WXV A;  2BBC A;  1XO3 A;  2LJI A;  4S17 A;  4P6V F;  4LK0 M;  4XWW A;  1MHX A;  1L4Z B;  4E74 A;  1R4M B;  2FIF A;  5D3I B;  2I2Y A;  3H7P A;  3ZVV A;  4AWJ A;  4X57 B;  3WIM A;  1WE7 A;  2K0P A;  2K22 A;  2GBN A;  1L0V B;  2LXA A;  4MJS B;  4IKG A;  4PS3 A;  4HRS A;  5J18 A;  2VH1 A;  3E56 A;  4GIV A;  2KTR B;  3V3X A;  1TS5 A;  1AAR A;  1SE2 A;  3SR6 A;  4DDI D;  2G1E A;  2MP2 B;  4XZ4 A;  3DVG X;  1F2R C;  2PE9 A;  2K9X A;  2E6X A;  1WE6 A;  3C19 A;  2PVO D;  4OVZ A;  1PQS A;  3KYC D;  2B3A A;  1JML A;  3M62 B;  4D2K A;  3ZNH B;  3V6E B;  1V1O A;  4C4V A;  1DOX A;  1Z5S B;  4JPS A;  2K3U A;  2XNA C;  3ZXR A;  2EKE C;  1NYR A;  1IBX B;  2R61 A;  5TSS A;  3DBS A;  4DHZ E;  2NVU I;  3JSV B;  1KOT A;  4UDU C;  2J42 A;  4II2 B;  2E3T A;  3ETR A;  1R4N I;  5EE9 A;  2JQR B;  4P16 A;  1EO6 A;  2N9P C;  2N9L A;  1YX5 B;  2K39 A;  4TQ0 A;  2WXQ A;  2LD9 A;  2FCS A;  2WYQ A;  3CIR B;  2JZ3 B;  1JRO A;  3GE8 C;  4TV3 A;  1TYG B;  2KNB A;  1I35 A;  1L7Y A;  2GOW A;  2KQ4 X;  2GMI C;  3OWE B;  1OTR B;  4TSS A;  2D11 A;  3VUX A;  1F9J A;  3T9L A;  4K81 A;  4HJG E;  2BYF A;  3BYT B;  1FXT B;  5BYQ A;  2BS4 B;  2O6V B;  1WF9 A;  3NUH B;  2AQ3 B;  5KHO A;  2J7Q B;  1IGC A;  2OED A;  4EZL A;  3R66 C;  3AMZ A;  3TIX A;  2KWU B;  3H8H A;  2OJW A;  2DEN B;  4FLH A;  1E5W A;  2DLB A;  3DBL I;  4RGN A;  2BYE A;  1UF0 A;  2BKR B;  2AL3 A;  3N9Y C;  1IP9 A;  1XXG A;  3KUD B;  3AEC B;  1WR6 E;  3H6N A;  1NEN B;  3BVG A;  3A9K A;  3AN1 A;  4I6P A;  3NHE B;  2LMC A;  3VHT C;  4CQN A;  4EE2 A;  4MGI E;  1M94 A;  1TJE A;  1WSP A;  3BYY B;  2MW5 A;  3PS6 A;  4HDQ A;  4R3D A;  3WAM A;  5EDS A;  4GN1 A;  2KDF B;  3AEA B;  4GDK B;  1UZX B;  3S2A A;  2MA9 B;  3TMP B;  3DBR B;  3WA0 A;  2IY0 B;  2I38 A;  2ZJD A;  4C7Y A;  1S3S G;  3AEF B;  4GSW A;  5E6P A;  1V49 A;  1ZDX A;  3R7R A;  2QIE B;  2G4D B;  3SFE B;  1WMH A;  1WZ0 A;  5AEK B;  3AV8 A;  5HHD G;  1FRD A;  3CSF A;  3J9C A;  1QLB B;  1WGH A;  1C79 A;  4AJW A;  1ET9 A;  2MBQ A;  4P1C C;  5JH5 C;  2KDM A;  1KLV A;  1UEL A;  3P42 A;  2KFJ A;  3RNE C;  3IBE A;  3NVY A;  2IGG A;  1KH0 A;  1AW7 A;  2W54 A;  3KVF B;  2DZJ A;  3N32 A;  2MBB B;  1N61 A;  2NBU A;  2K8C A;  3B2G A;  1MG8 A;  1KTK A;  1VZ7 A;  2WXI A;  5HKH A;  4AS1 A;  3Q3F A;  3APD A;  1Q5W B;  4WWO A;  1SE9 A;  5FR3 A;  2AWT A;  5CX3 A;  1Z2M A;  1N6Z A;  3AE5 B;  2D3B A;  4WJP A;  2W3S A;  3UI3 A;  4ZYS A;  2BWF A;  4BKG A;  2Z0E B;  4W9H A;  2V0G A;  4FBJ B;  1I4Q A;  2KFK A;  4EKU A;  1XLP A;  1FRR A;  2MBE A;  2AQ1 B;  1XLO A;  1FCC C;  3A1Q B;  5GXG B;  5IKC M;  2NR2 A;  3ZO5 B;  4YTM B;  2FAZ A;  4GXB A;  5BMH A;  3VVW B;  2JRH A;  3UQB A;  5BYS A;  1E10 A;  4ZRP A;  4AJY B;  1J7A A;  5BO4 B;  1QT9 A;  1WWT A;  2QCZ A;  4RM9 A;  3TSS A;  1JQ4 A;  5DCN A;  4PT5 A;  1GAQ B;  4RF1 A;  1KF6 B;  1E7U A;  1QF6 A;  3Q3M C;  3NS8 A;  1YN5 A;  1VCB A;  3AE6 B;  1ZKH A;  2D3A A;  3IT6 B;  3PRM B;  1F52 A;  3RUL A;  2LHD A;  4IWO A;  3CF6 E;  4M8N A;  4WQO B;  5CHV C;  3KYD D;  3QK0 A;  4I6L B;  3ML8 A;  2LGD A;  4ZYN A;  2H89 B;  2WXH A;  2PKO A;  4MH0 E;  1HZ5 A;  2IGH A;  4NY0 A;  2V4L A;  1FD6 A;  4ZDV A;  3NZS A;  4M02 A;  3HM6 X;  2AL6 A;  2DYM A;  3PT2 B;  5FK9 C;  3OAW A;  4L1B A;  4WUR A;  4JWU C;  4DBG A;  1JWM D;  4DHJ B;  3ML9 A;  5E6J A;  2BYT A;  2LJ5 A;  1DGJ A;  3ZTD A;  2L3Z A;  2KHW B;  3ZXV A;  3NZ3 A;  3SEB A;  3PVL A;  4KSL C;  4WQM A;  3UGB B;  1Q10 A;  4FAD A;  1WJ4 A;  4AOF A;  4NJC A;  3LYY A;  1MVK A;  3EFU A;  5CHW A;  5HI1 A;  3QAQ A;  2ZCB A;  5HFY A;  4HCN B;  1L6U A;  3N20 C;  1F2R I;  3APC A;  2KX3 A;  1YX6 B;  1HE8 A;  2Y5P A;  2L76 A;  2KOX A;  2FCQ A;  2RDH A;  3DOW A;  4P1B C;  4Q2J A;  3AU4 A;  1SE4 A;  3DHI C;  4E71 A;  3BK1 A;  1LM8 B;  1VR9 A;  4XDC A;  3RD2 A;  2BB5 A;  1L2N A;  1G6J A;  1WRD B;  3A9J B;  3GS2 A;  1TKE A;  3AE2 B;  3AEB B;  3R2T A;  1KJT A;  4MEM A;  4OVV A;  2C7H A;  1T0S C;  1RYJ A;  3PRE A;  3FAH A;  3DPD A;  1I4G A;  1BT0 A;  1T5X D;  3U7Z A;  3EA6 A;  1SSN A;  1C9F A;  3MHS D;  5C2T B;  1EF5 A;  2Q5W D;  3WAL A;  2C7N B;  3GP7 A;  2XK5 B;  2JSV X;  5J17 A;  1T6B X;  1TT5 B;  1HQR D;  4PYZ A;  3IHP C;  2O6V D;  2KDI A;  1AN8 A;  3ZDT A;  2FUG 1; 
#chains in the Genus database with same CATH homology
 1UWM A;  3MJ5 A;  2L52 A;  3PO0 A;  1V97 A;  2J4X A;  4KKJ A;  5BMI A;  2WXF A;  3AB5 A;  2SEB D;  1JML A;  4D2K A;  3MP9 A;  3MFG A;  2YEP F;  2GRI A;  1EWY C;  2WU2 B;  4TQ1 A;  1V1O A;  1DOX A;  2DYO A;  2V3N A;  4JPS A;  2K3U A;  2PIA A;  3W2D A;  1E9M A;  5AUK A;  3ZYY X;  2CJN A;  3TEX A;  1TKY A;  2B76 B;  2XNA C;  1ZPS A;  2BTE A;  3RPF C;  4LTU A;  4RGT A;  1NYR A;  1IBX B;  2R61 A;  5TSS A;  2L32 A;  4ARI A;  1ZOY B;  3VR9 B;  4ZHP A;  1JRP A;  1QOF A;  2INP E;  2KWD A;  1B1Z A;  5BMG A;  4HEA 1;  4UDU C;  2J42 A;  1QOG A;  2D5G A;  4RGM A;  1L6V A;  4RH6 A;  2E3T A;  3ETR A;  3AED B;  1L5P A;  1D5Z C;  5EE9 A;  1FFV A;  2JQR B;  4P16 A;  4WWM A;  2Z8L A;  3I57 A;  2N9L A;  4NAM A;  1UGJ A;  4N59 A;  1QQR A;  2JYT A;  4IOI E;  1FXI A;  1WRI A;  4TQ0 A;  2WXQ A;  2G9H D;  2MJ3 A;  3CIR B;  1Y56 A;  2VZK B;  2TSS A;  1JRO A;  1PUT A;  4B0E A;  2RMM A;  1KFY B;  1YNT E;  1TYG B;  4RNA A;  3Q69 A;  1N5X A;  1FXA A;  2KQ4 X;  4A9A A;  1FNW A;  3OWE B;  4TSS A;  3GB1 A;  3NVZ A;  3BWU D;  4HJG E;  3T3O A;  3R2I A;  3AEG B;  3BYT B;  1PGA A;  3AE9 B;  3BVZ A;  5BYQ A;  1FIQ A;  1K53 A;  1SEB D;  1XCQ L;  2BS4 B;  2W82 A;  3LXF A;  3NUH B;  4US9 A;  2AQ3 B;  3KQ4 A;  1M4V A;  2OED A;  1IGC A;  3V05 A;  4C7Z A;  2JX5 A;  3AMZ A;  3IAM 1;  1PGB A;  3H8H A;  3BK2 A;  1PFD A;  1C4A A;  5H92 C;  3ZQ4 A;  1FEH A;  2KAC A;  3MC0 B;  4N6E B;  2DLB A;  1I4P A;  4DQO C;  4RGN A;  4H2A A;  2INN E;  2Y3A A;  2K5P A;  1SF0 A;  1EWC A;  3N9Y C;  1XXG A;  3AEC B;  3O13 A;  1ACC A;  1NEN B;  3BVG A;  1AYF A;  1VJK A;  2LHE A;  2LUM A;  3AN1 A;  1FO4 A;  1RM6 C;  2LMC A;  4AQ7 A;  2LGI A;  4TMA B;  4CQN A;  4EE2 A;  1TY2 A;  2HTM E;  3W5U B;  1KLU D;  1TJE A;  1UUP A;  1WSP A;  3BYY B;  4OW0 A;  1T3Q A;  1ZUD 2;  2LEK A;  4R3D A;  4RGO S;  4A8X C;  1L4D B;  3VQI A;  2PTL A;  1KLG D;  1GB4 A;  3TUO A;  1L0X B;  2FBW B;  4WAF A;  1MI0 A;  2NTS A;  1STE A;  1ZDV A;  1NVI D;  3I9V 1;  1K52 A;  3AEA B;  3KWV A;  3MHZ A;  4GDK B;  1HEZ E;  1JWS D;  2MH7 A;  4NZL B;  5AUI A;  4JWS C;  4MT5 A;  1IBX A;  4GDL B;  1WXQ A;  3AE1 B;  2PLP A;  1TY0 A;  2I38 A;  3HVZ A;  1DOI A;  4KGR A;  4C7Y A;  2RDG A;  3AEF B;  1ZE3 D;  3VR8 B;  2HDE A;  3FIL A;  2MEK A;  3ABV B;  3TEW A;  2J52 A;  1ZDX A;  2QIE B;  1YQ4 B;  3SFE B;  1TKG A;  4REZ A;  1FMA D;  2ZW0 A;  3HVD A;  2JWU A;  1FCL A;  1RFK A;  4YSX B;  1CQV A;  1OQR A;  2WQY B;  2MJD A;  3Q8A A;  3AV8 A;  5HHD G;  2BS3 B;  1FRD A;  1VDV A;  4YSZ B;  2KN4 A;  1K51 A;  3DWG C;  2WXK A;  3J9C A;  3NVW A;  4A90 A;  1QOB A;  4XDD A;  4LLG M;  2DWQ A;  1JWB D;  1QLB B;  1VZ6 A;  1C79 A;  4YXD B;  1JWU D;  1ET9 A;  1FFU A;  1PYW D;  1HXY D;  3AM9 A;  2XN9 C;  3KLS X;  1F0Z A;  1GOZ A;  1TS2 A;  1BUI C;  2KDM A;  3RFZ B;  4XE0 A;  2RPV A;  3P42 A;  4C80 A;  3W5V B;  1A70 A;  1XEE A;  1PDX A;  5LNK 1;  2QMT A;  3NVY A;  2IGG A;  2JYE A;  3ZJU A;  1KH0 A;  1AW7 A;  3W1S A;  1EU4 A;  2ZW1 A;  1F77 A;  2N7J A;  2W54 A;  2WXL A;  5T8I A;  3KWL A;  1HZ6 A;  1HA5 A;  1XLN A;  4ITK A;  1E7P B;  3BVM A;  3VRA B;  3ZJT A;  1FNU A;  1I7H A;  1EM7 A;  1N61 A;  2BT6 A;  1YMH E;  4YSY B;  1CJE A;  1P7E A;  3B2G A;  2IGD A;  1KTK A;  1ZXH A;  1VZ7 A;  2WXI A;  3AE4 B;  3Q8E A;  4AS1 A;  1I4X A;  4DXG A;  4FXC A;  2N9K A;  4A6Q A;  1IUE A;  4IDI A;  4RF0 A;  1I4R A;  4HKQ A;  2M56 B;  1J7B A;  5FR3 A;  2WDQ B;  1SJE D;  4B0M A;  2WXP A;  3AE5 B;  2V3P A;  2NTT A;  2W3S A;  3UI3 A;  1YN3 A;  2ACZ B;  4ZYS A;  2WXO A;  3R8B A;  4C56 C;  4US8 A;  2BS2 B;  1C4P A;  1AWD A;  2V0G A;  1IGD A;  2AQ2 B;  2WXR A;  1SE3 A;  1I4Q A;  2JU6 X;  3T3N A;  1J7C A;  1V1P B;  1XLP A;  1FRR A;  1NYQ A;  3HUI A;  2AQ1 B;  3P4R B;  4KGT A;  5EE0 A;  2AX5 A;  1XLO A;  5I4D A;  1FCC C;  5GXG B;  1QIL A;  2H88 B;  2ICI A;  4YTM B;  5BMH A;  1ZP0 B;  1ROE A;  1P7F A;  3IAS 1;  2GB1 A;  3W9C B;  1DOY A;  2YEP B;  5EE3 A;  1DYQ A;  1D5M C;  5BYS A;  1N60 A;  1E10 A;  4ZRP A;  1BXT A;  2N0S B;  1OFF A;  2QIL A;  4ZHO A;  2WDV B;  1VZ8 A;  2EEL A;  1J7A A;  1QT9 A;  1NEK B;  1WWT A;  1FNV A;  3PZ7 A;  4MAC A;  3L4P A;  3TSS A;  3AEE B;  3ZGZ A;  1EU3 A;  1D4B A;  4KX6 B;  1JQ4 A;  2OHF A;  3HRD D;  4RCO A;  2MJE A;  4YWG G;  4PT5 A;  4ARC A;  1D5X C;  4J3O D;  1VLB A;  5G5H A;  1D6E C;  4OHJ A;  3P4Q B;  1WYG A;  1GAQ B;  2X38 A;  1FM0 D;  4RF1 A;  3SFD B;  1C76 A;  2V4I B;  3AE7 B;  1KF6 B;  1PGX A;  2M19 A;  2IPK D;  1ZXI A;  1QF6 A;  2PW9 A;  1YN5 A;  1GPX A;  1RWS A;  2WXJ A;  3AE6 B;  3IT6 B;  1XLQ A;  3Q8B A;  3Q8C A;  1JAL A;  2LHD A;  4YTP B;  4OZB A;  3P1M A;  1C77 A;  1BML C;  2M0A A;  2WNM A;  1QOA A;  1CK1 A;  2PVG C;  2W55 A;  3VRB B;  4GLS C;  1JW9 D;  3FC4 A;  2CU3 A;  1UWX A;  3P4P B;  2WXG A;  2BB6 A;  4XWT A;  2H89 B;  2WXH A;  1SBB B;  2PKO A;  4ZRQ A;  2IDY A;  1ET6 A;  2L83 A;  1HZ5 A;  2IGH A;  3Q8F A;  1FD6 A;  5MPO A;  4RFB A;  2KMM A;  1KRH A;  2WLB A;  1JCK B;  4MH8 A;  4A55 A;  2GI9 A;  2DYM A;  3P63 A;  5FK9 C;  1SB3 C;  4L1B A;  4L2Y A;  2EKI A;  1R7S A;  2W3R A;  4WUR A;  4JWU C;  5JXV A;  1B9R A;  2QEJ C;  1JWM D;  1K50 A;  3WCQ A;  1C78 A;  2WXM A;  3ZJV A;  2BYT A;  5E6J A;  4KGS A;  2WU5 B;  3DWM A;  3BII D;  1DGJ A;  5C3J B;  4OZA A;  1L0Y B;  1CZP A;  2JXT A;  1UNS A;  1MPE A;  3NZ3 A;  3SEB A;  2DBY A;  1GB1 A;  1MHH E;  3FIL B;  4WQM A;  2NMQ A;  1Q10 A;  2LFI A;  1I4H A;  3AH7 A;  4HKZ E;  3BZD B;  2WS3 B;  1YJI A;  4NJC A;  1TS3 A;  2IJ0 A;  3LYY A;  1V1P A;  2PMV A;  1SJH D;  1MVK A;  2J53 A;  2WP9 B;  5HI1 A;  3EGR A;  3IXS A;  4JX1 C;  1YN4 A;  5HFY A;  3EUB 2;  3NVV A;  4HRO A;  3NRZ A;  3B9J A;  1L6U A;  3C8Y A;  5D7G A;  1F2R I;  3AE8 B;  3U4E G;  4L23 A;  3B2F A;  1SIJ A;  4M0W A;  5BYR A;  1NI3 A;  4WIP A;  1C4C A;  1VRA B;  1LO5 D;  2Y5P A;  2KAJ A;  1N62 A;  3IT4 B;  4OZC A;  4O1N A;  2BW2 A;  2RDH A;  4MM3 B;  1E0Z A;  3TEY A;  4Q2J A;  5HG2 A;  4JE3 B;  2Y5C A;  4YTN B;  1ENF A;  1OQQ A;  1YJJ A;  4N58 A;  1SE4 A;  3URY A;  2BBC A;  3U52 E;  3AE3 B;  1YQ3 B;  1XO3 A;  3BK1 A;  2CJO A;  3NS1 A;  1VR9 A;  4XDC A;  4DXF A;  2LJI A;  4P6V F;  1QKZ A;  2WDR B;  2BB5 A;  4LK0 M;  4XWW A;  1MHX A;  1XCT L;  1L4Z B;  4USA A;  1SXT A;  3GS2 A;  5D3I B;  1TKE A;  3AE2 B;  3AEB B;  3R2T A;  5EE1 A;  2I2Y A;  1ESF A;  2K0P A;  1RYJ A;  2K22 A;  2JZP A;  1L0V B;  1JWA D;  4YT0 B;  3FAH A;  1I4G A;  4KKI A;  4IKG A;  2FE8 A;  4HRS A;  1T5X D;  3U2S C;  1N5W A;  2ONQ A;  3E56 A;  2VZK D;  3EA6 A;  3U7Z A;  1SSN A;  3P4S B;  3V3X A;  1C9F A;  1TS5 A;  2QSD A;  5C2T B;  2L1A A;  1SE2 A;  2Q5W D;  3LB8 C;  3SR6 A;  3GP7 A;  2G1E A;  2JSV X;  3TEZ A;  2SAK A;  1T6B X;  1E6E B;  4ZOH C;  1TS4 A;  1F2R C;  3PZ8 A;  1HQR D;  5D3D A;  5FKA C;  5G5G A;  2K9X A;  2ON8 A;  2E6X A;  4WH4 A;  1N63 A;  1WGK A;  3E9S A;  2PVO D;  2WXN A;  3CWI A;  4OVZ A;  5H8Y E;  1XF5 L;  2QJL A;  1AN8 A;  4NAW B;  2FUG 1;  1TZO A;  1V8C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...