1JQ4A

[2fe-2s] domain of methane monooxygenase reductase from methylococcus capsulatus (bath)
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
98
structure length
98
Chain Sequence
b'MQRVHTITAVTEDGESLRFECRSDEDVITAALRQNIFLMSSCREGGCATCKALCSEGDYDLKGCSVQALPPEEEEEGLVLLCRTYPKTDLEIELPYTH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHANE MONOOXYGENASE COMPONENT C
molecule tags Oxidoreductase
source organism Methylococcus capsulatus str. bath
publication title NMR structure of the [2Fe-2S] ferredoxin domain from soluble methane monooxygenase reductase and interaction with its hydroxylase.
pubmed doi rcsb
total genus 9
structure length 98
sequence length 98
ec nomenclature ec 1.14.13.25: Methane monooxygenase (soluble).
pdb deposition date 2001-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1jq4A00
3AEFB 2E3TA 3FAHA 3FC4A 1L6UA 1QOBA 3AEAB 2JQRB 3BIID 1FRDA 3EUB2 2W3RA 1V8CA 3P4RB 1WWTA 2WLBA 3B2GA 2DWQA 1N62A 1CJEA 1KRHA 2M56B 3NVZA 3AE2B 4WWMA 2PIAA 4YTMB 4FXCA 3P1MA 1OQQA 2K5PA 2PVOD 4YSYB 3DWMA 1N60A 2WU5B 4JWSC 4JWUC 4YTNB 1TKEA 3AE8B 3L4PA 1XLQA 3AV8A 4JX1C 3AM9A 2L83A 1EWYC 1DGJA 1A70A 1JWBD 1L5PA 1WYGA 2N0SB 3AE7B 1ZP0B 2OHFA 5GXGB 3WCQA 4YSZB 1E0ZA 2QIEB 1YJJA 1TKGA 1DOXA 1JQ4A 2WP9B 1NI3A 1AWDA 1RM6C 1RWSA 1WXQA 2L52A 5EE9A 5C2TB 3VR8B 3NVWA 5G5HA 1J7AA 5MPOA 2PKOA 1PDXA 2JX5A 2PVGC 2BS2B 3AB5A 3AE3B 4C7YA 1XLNA 4YSXB 3HVZA 4US8A 1TKYA 1SIJA 2W54A 3ETRA 1FFUA 5H8YE 3VRBB 1QF6A 1NENB 5C3JB 1E7PB 1OFFA 3SFDB 1N63A 2CJOA 3VRAB 4USAA 1F0ZA 3P4SB 1B9RA 1FXAA 3SR6A 4C7ZA 2Y5CA 2KMMA 3AN1A 1RFKA 4ZHPA 1FO4A 2MH7A 3AEBB 1L0VB 2MJDA 2WQYB 3AE1B 2H88B 2BT6A 1XLOA 2BS4B 5AUIA 4ZHOA 1OQRA 3HRDD 3RPFC 2LEKA 4LTUA 3VR9B 1AYFA 1JW9D 2WDVB 3B9JA 3NS1A 3AEGB 2MJ3A 1TYGB 3AEEB 4IDIA 3AE9B 1YJIA 4YTPB 1JRPA 1QOAA 2K22A 4N59A 1N5WA 1KF6B 1QOGA 3AE5B 3NVVA 3CWIA 2WDRB 3W5UB 1FFVA 1WGKA 2B76B 1GAQB 4N6EB 1E10A 4P6VF 2K9XA 5EE3A 1V97A 2KAJA 3P4PB 3AMZA 1GPXA 5EE1A 1JALA 4N58A 4ZOHC 5H92C 1E6EB 3AEDB 3SFEB 3CIRB 1J7CA 1DOIA 3AE4B 1DOYA 3LB8C 1L6VA 4HROA 1FM0D 3P4QB 1JWAD 1SB3C 1XO3A 3NRZA 2Q5WD 4A9AA 1YQ3B 3AH7A 1FXIA 1WRIA 1ZOYB 1E9MA 3W5VB 1I7HA 1PFDA 3PO0A 1YQ4B 1PUTA 1ZUD2 2FBWB 1KFYB 4YXDB 2MJEA 1XLPA 4YT0B 1SF0A 2WDQB 1R7SA 1ROEA 5EE0A 2M19A 1T3QA 5G5GA 1VLBA 2CJNA 2H89B 3DWGC 3NVYA 2G1EA 2QJLA 3ZYYX 1NVID 1QLBB 1NYQA 3P63A 2W55A 1VJKA 2WU2B 4HRSA 1TJEA 1IUEA 1FRRA 2EKIA 1UWMA 1VDVA 3AECB 1FMAD 1JROA 2AX5A 4ITKA 4C80A 3W9CB 1QOFA 2DBYA 4WQMA 1CZPA 2BS3B 3AE6B 2CU3A 3B2FA 1QT9A 3HUIA 4KX6B 1NYRA 5AUKA 3ABVB 3LXFA 1ZXIA 1N5XA 2WS3B 4US9A 1FIQA 1J7BA 1N61A 2W3SA 3KWLA 2ACZB 1RYJA 1NEKB 2HTME
chains in the Genus database with same CATH superfamily
3T3OA 3A9KB 3KQ4A 3BIID 2IO3B 3B2GA 4WWMA 3NHEB 1OQQA 2IGGA 1ZE3D 1JCKB 4TV3A 4KZCA 4YTNB 3C0RB 2GOWA 1XQQA 1ZP0B 2KDFB 2RDBC 4JIOU 2WX1A 2R2OA 2IY0B 5HKHA 5LXIB 3Q8FA 3HVZA 2D2QA 2L32A 1D5ZC 3SD5A 1QF6A 2Z0EB 2WWZA 3IAS1 3VTUA 1BT0A 3X23A 2BVCA 2HE7A 3AEBB 1FPYA 3CMMB 1TGZB 2KX0A 3TSSA 3AEEB 2KWCA 2M8SA 2V1YA 4NAWA 2B76B 4IWPA 2FCMA 3TJPA 1LGRA 4C56C 5BYQA 5EE1A 4HVBA 2BQQA 4GDLA 1J7CA 3ML8A 1V5TA 1JWAD 1SB3C 4BVUC 3GB1A 1WRIA 3GP7A 2JWUA 4K3CA 2DZJA 2K6DB 2G4SA 3Q8BA 4GDLB 1QILA 2W9NA 4XWWA 2BWFA 1K8RB 3DWGC 3CSFA 1G6JA 3B08A 4ARCA 2MQJA 2BF8B 1IUEA 5JXVA 2WXLA 2KQ7A 1IBXA 4DXFA 3UQBA 1E8WA 1J7BA 3Q14C 1WJ6A 2ACZB 1L0XB 4W9CA 5FKAC 4ZDVA 4A6QA 2DZIA 4XX5A 2WXHA 2K3UA 4KGRA 4P7IA 2K5PA 1SJED 3U4EG 1FNUA 2BB5A 1F2RC 5T8IA 4EEWA 3FKYA 2LASA 5GXGB 2N0SB 1E0ZA 3OWEB 4KDIC 3WALA 2WGSA 2KVZA 2LD9A 1RWSA 1NBFC 1D4BA 2KC2A 1J7AA 4C7YA 3AE3B 4M01A 4B0MA 2XK5A 5C3JB 2Y5BB 3RNBC 4KDLB 1VR9A 3R66C 3ZUNA 1IP9A 2OJRA 1E7UA 5LXHA 4TMAB 4XE0A 3AXCA 4GXBA 4LNNA 1H4RA 1WJNA 1HEZE 1V81A 3PS6A 2K0PA 3U7ZA 1WX7A 3R2IA 3RT3B 3RNEC 4EZLA 1YN3A 3P4QB 2ICIA 3PT2B 4A9AA 3H1UA 3DHHC 1PFDA 4NY0A 2PLPA 2FBWB 4BBNF 5E6OA 2KDIA 3DCGA 2L8JA 3WA0A 2JYTA 1QOFA 4W9GA 1SE3A 4ANUA 3VQIA 2WS3B 4US9A 2J52A 1FIQA 1N61A 1RYJA 4HEA1 1NEKB 2JQRB 1QOBA 1UGJA 2KHWB 1GNUA 2JPHA 3P4RB 3PTFC 2WLBA 3DBRB 1T5XD 2NCNA 3V6CB 3BYTB 4DDID 1D6EC 3AU5A 2JU6X 2O2VA 2X8XX 4MSQB 3AV8A 3ZXRA 3AE7B 4RNAA 4GN1A 4HKZE 3PHWB 3VDZA 4MDKE 5MPOA 2PKOA 1PDXA 5CHWA 1WRDB 3RUIB 2W54A 3I5JC 2WXOA 5KHOA 1BMLC 4ZRJA 3VRAB 2JZPA 4FULA 4Q2JA 2DLBA 4IW0A 4NQKE 4ZHPA 2YLMA 4XWTA 3PGEA 3AE1B 4ZHOA 1P7EA 3R3MA 1V1OA 4GB9A 4MJSA 1QKZA 2WDRB 4A55A 3DPDA 3CF6E 2G45B 2MA9B 5L83A 2MSED 5H92C 4RFBA 3LB8C 3GZNI 4BKSD 4MT5A 3C19A 1ACCA 3NZUA 2N1WA 2FIDA 3N1YC 2MJEA 3Q8AA 3VUXA 2JZZA 1TT5B 4HXDA 3A1QA 3NVYA 3H6NA 2YVCA 4M00A 1IYFA 2OOBB 2KOXA 1WR1A 2BGFA 2J53A 3U8ZA 1FRRA 2SAKA 2BKFA 4ZRPA 3URYA 4MGKE 1TIFA 4PYZA 1ZXIA 4IM3A 3ZDMC 2W3SA 4NAMA 2FE8A 3AEFB 4DWFA 4GSWA 3APDA 2DWQA 4WAFA 1SGHA 3PREA 2WU5B 2Z59B 4NJ6A 4ACFA 3AM9A 2J42A 3ZKJC 1EO6A 3V3XA 3NOBA 1AWDA 1UZXB 1SEBD 3WIMA 4OVVA 1XT9B 2FUHB 5C2TB 3N9YC 2LJ5A 2AQ3B 2NMQA 1EF1A 3DBRI 2M0AA 5J17A 1N63A 4KVGB 2L00B 2Y5CA 1WXMA 3AN1A 4K7WA 2CHWA 5TSSA 3FILA 4M8MA 3ZLZA 2KTFA 1JW9D 3B9JA 3RMKC 4NAWB 4MACA 4KGTA 5IA7A 1GAQB 2MBHA 4S0RA 3TEZA 5AZHA 5DPRA 3VTVA 1Y8RC 1DOIA 3QQ8B 4KIKA 1TY2A 2WXNA 2KFKB 1JMLA 1ZOYB 3U7DA 1I4XA 2ZCCA 2AQ2B 3DVNV 1EUVB 3QC8B 2OJWA 2O6VB 2G1EA 2KK8A 4DHZB 4AJYB 2JUOA 1NYQA 2VRRB 2NVUI 1V80A 3D32A 4HRSA 4OW0A 1WF9A 3MP9A 4GU2A 1VDVA 4EKUA 2LGYA 2UWQA 5TR5A 4IOIE 3RZFA 3TMPB 3QX1A 2I1KA 5GMVA 4WQMA 2BS3B 3VXWA 1QT9A 4P1BC 5AUKA 3L17A 4A3PA 2WXKA 1N5XA 4PYUA 3I9V1 4HPMB 3NG0A 4C4VA 2CS4A 3FC4A 3PRZA 2W3RA 1CMXB 1HA5A 3QA8A 2X38A 4FADA 3B0AA 4BFRA 3IT6B 5FK9C 2PJHA 3Q3JA 4TKNA 3WCQA 2ZPNA 1HQRD 3RI7C 5G55A 1PYWD 4ICVA 3VR8B 2JX5A 1ZW7A 3PHXB 3ZNHB 1XLNA 2ZVOA 4I6PA 3ETRA 2MW5A 4LLGM 4USAA 2DHZA 2L76A 4W9JA 2REXA 3LDZE 1YX6B 1RFAA 1V86A 1I4PA 3BK2A 4WWOA 4M02A 1FFVA 1BUIC 2NS5A 4EOYA 3Q3NC 3ML9A 2KAJA 1F2RI 1YN5A 5BMHA 1JALA 3A1QB 3MC8A 1WXSA 2DZKA 3IFWB 3N32A 4HROA 1FXIA 3EHVA 1UELA 4HPPA 2GBKA 5D7GA 2YEPF 1KFYB 2ZNVC 4REZA 4RF1A 4G11A 3BVZA 1YMHE 3ZYYX 4NJCA 4M0WA 3A4SC 4DHJB 2IGHA 2JF5A 3SEBA 4MJSB 5E6JA 2KTRB 2WYQA 4DBGA 1UBIA 3X0WA 3ZGZA 3OG5A 2PMVA 4GIVA 2JRHA 2BW2A 3VHTC 3N1ZC 2KT7A 1EF5A 2L0FA 3RPFC 1MFWA 1N62A 3KWVA 1JWUD 4AWJA 4KZ0A 1I4GA 3Q8CA 4FXCA 3P1MA 2C7MB 2N9PC 3DWMA 1N60A 4GOCA 1WSPA 1WMHB 2LHEA 2DYMA 3KUCB 1WM3A 2PE6B 1DGJA 3W5UB 1UF0A 2K25A 2KANA 2PEAA 4IKGA 3RCZA 5EE9A 4E74A 5G5HA 5E6PA 1C4CA 4ZRIA 1GOZA 2BS2B 2LGIA 3T9LA 3TIXA 3TBLD 3VUWA 2VZKD 3N20C 4RGNA 2DYOA 3PPAA 4LNKA 1KH0A 1FXAA 4IWQA 3APCA 3P2BA 1FO4A 3PZ8A 1KLGD 3CSTA 3M3JA 4BOZB 3KVFB 3VR9B 3AULA 1EU4A 2QEJC 2FIFA 5KHQA 2N4FA 4MGYE 1KF6B 3A9JB 1AN8A 1E10A 2K9XA 1NI2A 4HDQA 1FD6A 2KN5A 4ZOHC 1TS2A 3CIRB 2WDTB 4II3B 5E6NA 2INDC 2J0JA 3ZNZB 4B95A 2FNJB 4KIKB 2WDQB 3ZW3A 1ENFA 3UIPB 5G5GA 2JSVX 1SE9A 1TJEA 1OTRB 2BB6A 1GC7A 2JYEA 2QMTA 1IGCA 4HDOA 3KWLA 3RULA 5DPTA 2GI9A 2JZ3B 4WAAA 4YSYB 1WGRA 1WJUA 2CHXA 1TKEA 1FCCC 4TQ1A 1UWXA 4KV2A 1T0YA 1V49A 2L1AA 3QHTA 1UBQA 2EELA 3DHIC 1WGDA 2LHDA 3R7RA 3QWZB 2ZVNA 1I4RA 5H8YE 2CJOA 3ZQ4A 2KLCA 3SR6A 4KKJA 2RMMA 2R2QA 2KQSA 3HM6X 3NS8A 1YNTE 2D11A 3V61A 3EECA 4RF0A 1TYGB 2KNBA 3AE9B 2RDHA 3VUYA 3PRPB 4AP4C 3AMZA 2L7RA 1SE2A 2MEKA 2R61A 1XEEA 4DQOC 1VZ8A 3NRZA 1I4HA 3SDLC 4ARIA 1P1AA 3BWUD 3GOEA 1PGBA 3Q6BA 2MWSB 1PGXA 2PE9A 3LJ3A 2D07B 1TS3A 1EU3A 1UWMA 1FMAD 4ICUA 2FCQA 2QCZA 2XNAC 1R4MI 2WXJA 4W9EA 2V4IB 3KH0A 1MG8A 3KUDB 1UUPA 4HCNB 2HTME 3R8BA 4JGHB 4WURA 1WH3A 4EZJA 4FA6A 1YD8U 1CQVA 4WQOB 5I4DA 3BZDB 3DBLB 1CJEA 1LM8B 1WE7A 2PIAA 4KKIA 2MLBA 4JWSC 2ZEQA 1GG3A 1XLQA 1VD2A 2OHFA 4EFOA 1YJJA 1JQ4A 1ESFA 1NI3A 3PV1A 4B6WA 1D5XC 3PLVA 2L52A 2W82A 1GJZA 2NR2A 3AB5A 1HZ5A 2D10A 4CYEA 4IUMB 1TKYA 2QHOA 4X57B 2JXXA 3QARA 3SFDB 4YWGG 4S17A 2LJIA 4C7ZA 1Q5WB 2GRIA 3C8YA 2LI5A 4RGTA 3PSEB 4WWPA 1WZ0A 3DHGC 4LDTB 3RFZB 2L3ZA 3M63B 2KC1A 2KXJA 2WXPA 4HKQA 4GDKA 2I1JA 3V62A 4N59A 2NTSA 2IO2B 3MJ5A 1MG4A 3N1XC 3JSVA 2VH1A 2GLSA 1GPXA 1WX8A 4CO7A 3L16A 5HFYA 1E6EB 4WJPA 2LUEA 4O1NA 2Q5WD 5DPSA 4UDUC 2NTTA 3MHSD 2RR9A 2KQ4X 4BKSA 1XF5L 4DHZE 3UIOB 3EFUA 2BKRB 2KD0A 2G3QB 1ROEA 2LRUA 3V05A 4K3BA 2KKCA 3PZDA 1I4QA 2EKIA 4FJYA 4XGAB 2B3AA 2HJ8A 1J19A 4H2AA 3ZDTA 3W9CB 4II2B 2MBOA 1MJDA 4C4VB 4HCPB 3M62B 3MJWA 2N9LA 1V6EA 4DXAB 3BK1A 3DVGY 4HPLB 3EUB2 1MPEA 1SIFA 1YIWA 3V6EB 1QZEA 2XK5B 4NQLB 3ONSA 2FAZA 4RM8A 1X1MA 2LXAA 4FHJA 4I6LB 2SEBD 4ZYNA 3IG3A 1EWYC 3L13A 3H7PA 1ZGUB 4BKGA 2D3CA 2Z0DB 1RM6C 3Q2AC 1AW7A 2RSUA 1V1PB 4P1CC 4GMVA 4YSXB 3QJZA 2LRWA 1NENB 1PQSA 1IGDA 2I38A 2INCC 2GBNA 3AI5A 1FCLA 3EC8A 3P4SB 2KMCA 1C4AA 2K8BA 3J9CA 1T0RC 4EUTA 2J0MA 2EMSA 3NS1A 2QILA 1F52A 1YJIA 4LK0M 4B9KA 1C77A 1P9DU 3N30A 3W1YA 4TSSA 1WGKA 3W1SA 2J0KA 4N58A 3KUZA 4OZCA 2IDYA 1L6VA 1WZ3A 3HIZA 2JRIB 3W5VB 1I7HA 4LDTD 1HTQA 1XLPA 2WXMA 1RAXA 5EE0A 2BYFA 3VVWB 1QQRA 4KSLC 3P63A 1ZXHA 3DVGX 5JHAA 2UU7A 5BMIA 1MHHE 5C1ZA 1MHXA 2OEDA 2N9EB 3AE6B 3HUIA 3ABVB 2JY6A 1SBBB 2MP2A 2N7DA 1WX9A 2KZRA 1XCTL 3ZJVA 1YQBA 2LZ6A 3ZNID 1XXGA 3DDCB 4XC2A 2KJRA 1ZDXA 2C9WB 4JPSA 1U4AA 3A4RA 4FLHA 1LO5D 4D2KA 2KWVB 1KM7A 2M4NA 2LUMA 3I57A 4RMAA 1Y56A 1TKGA 1DOXA 4JE3B 4JQWC 1C78A 5IO9A 1MI0A 4XDCA 1AARA 2CKHB 1FNWA 3APFA 1V9JA 2HJ1A 3A9KA 3H9DA 1WGYA 5AEKB 1M4VA 4IC7B 2TSSA 3JW0X 2D5GA 1WYWB 3ZTCA 1K53A 2XN9C 1QOAA 5D94A 1QOGA 1RLFA 1C76A 3A33B 2IZVB 2NPTB 3Q8EA 4WH4A 1L4DB 3RZWC 3TCAA 4AS1A 3SFEB 2LWPA 3N3KB 2KWUB 3RD2A 1XO3A 3IHPC 4HWIB 5HI1A 4I6NB 4ASWC 3ZXVA 1E9MA 3OLMD 2C60A 1Z2MA 1WY8A 3VAWA 2PPHA 2LFIA 1E8YA 2PW9A 2H89B 2ZW1A 4JLCA 4MGZE 5CHFA 1VCBA 2O2VB 1VJKA 2LVQA 4QAYA 1ZKHA 3PZ7A 5IKCM 2V3NA 2Y5PA 2AX5A 1JROA 4NPNA 3EGRA 3PRMB 1E5WA 1TS4A 1TZ1A 2I2YA 3P42A 1STEA 3WANA 4P16A 3NUHB 3KYDD 5IAAC 4A8XC 4WIPA 3H7SA 3L08A 2DX5B 2PVOD 5J2RA 3UI3A 4LNFA 4URKA 4EZKA 3TEXA 1LFDA 5LLIA 3IVFA 3NY5A 2ZZPB 2QDFA 2K6QA 2WP9B 1OEYA 3TEWA 5G2NA 2NBUA 4OVUA 1H8CA 4A20A 5D3DA 2KFKA 1C1YB 3DBSA 1F0ZA 2V9HA 3QCAA 2IY1B 3RNGC 2KJHB 2RDGA 3RNFC 1YX5B 4DDGD 4W9HA 2NPTA 2KDBA 2BT6A 1K52A 1Z5SB 2MCNB 4HJKA 2AQ1B 2WDVB 3V60A 4IM2A 3AEGB 3U30A 2EMTA 3T8MA 1HXYD 2LGDA 2YEPB 1PGAA 2INPE 4N6EB 5BO4B 5EE3A 1L7YA 2KACA 2MX2A 1EM7A 1E8ZA 1L4ZB 1S1QB 4MH0E 1HZ6A 2LMCA 1ZUD2 2LGSA 1OEYJ 1VZ7A 1KLUD 1JWMD 1R7SA 4XYCA 2L05A 3VFKA 2M19A 2QJLA 2LGXA 1NVID 3ZNGC 2FCSA 2W55A 2WU2B 2NBVB 2AEHA 3R2TA 3ZTDA 2MBEA 1TBEA 1FNVA 3TL5A 2HD5B 3U52E 4IM0A 2IYDB 1FXTB 2QC8A 5CX3A 3RYTA 2V3SA 4RCOA 5CHVC 3NVZA 3S2AA 4J6IA 4YTMB 1WI0A 1F1HA 4L2YA 4C00A 3IAM1 3L4PA 4G0NB 2KDMA 2L83A 4WJNA 2E6XA 1L5PA 3K9PB 2KDEB 3HM3A 4W9FA 2CHZA 1P98A 2KO3A 4RGMA 1V5OA 4US8A 3VRBB 1FFUA 3QAQA 4PS7A 3T3NA 2VZKB 1B9RA 2IO0B 1KLVA 2KMMA 2WXQA 3UQAA 1SSNA 4BKTA 1T0QC 3KYCD 2Y3AA 2K8HA 2BS4B 1E8XA 3HRDD 3HVDA 1L0YB 2ZCBA 1KTKA 4RH6A 4BOSC 3CWIA 1V2YA 2QSDA 1P3QU 3Q3OC 3ZVVA 3OJ3A 2RPQA 2KN4A 1OQYA 3DBHB 2O6VA 1C79A 3R7QA 4PT5A 2RPVA 3VH4B 2DZMA 3IBEA 2DNFA 1VRAB 3B1LX 4CHKA 4CQNA 3Q69A 2EKEC 4NJ7A 2CJNA 3H7PB 3IT4B 1P7FA 2AYOB 5D6JB 4AUQC 4FBJB 2DAJA 1P0RA 3UGBB 2JVCA 4LNIA 1GUAB 4AQ7A 1CZPA 1YJ1A 2M17A 3DBHI 3M95A 2MBQA 5IN7A 3W1SC 3ECIA 2Z8LA 1V8CA 3ZJUA 3NZSA 2N7EA 1MVKA 2N9XA 4K7UA 4PK1A 2A5UA 1Q0WB 1M94A 2V3PA 1HE8A 1S3SG 4XDDA 5DPWA 2CR5A 4IWOA 1LQBA 1R4NI 3SHQA 1XD3B 3NVWA 4ZYSA 4FHKA 2XEWA 1GB1A 4NZLB 3DOWA 2V4LA 5IP4D 4OZAA 3QK0A 1Q1OA 2NBWB 3ZRFA 5AUIA 4JL9A 3JSVB 1AYFA 3KW5B 4IDIA 4WWNA 4YTPB 1J8CA 3TUOA 1N5WA 3AE5B 2V0GA 3NVVA 2ON8A 1YN4A 2BWES 4M0WB 3MTNB 1V97A 2WXGA 4MM3B 3LYYA 2DYBA 4AOFA 1DOYA 1ET6A 2DAFA 3IXSA 3AE4B 3O13A 2N7JA 2BTEA 1NDDA 1FM0D 2BYTA 2N9KA 1YQ3B 5L95C 3JVZX 4TUUA 3WAMA 1YQ4B 5BYRA 4YXDB 4HJGE 1WJ4A 2K39A 1T3QA 2GBMA 1VLBA 4MGIE 5J18A 2KVRA 1A5RA 1TY0A 2UYZB 3L54A 1E7VA 3AECB 2GMIC 2XBBC 2AWTA 3KLSX 4C80A 2MHJA 3ZJTA 2CU3A 3SU8X 2WHIA 1HTOA 3K9OB 4KSKC 4W9IA 3AU4A 1F77A 2E3TA 2MP2B 1L6UA 1FRDA 4PS8A 2M56B 1WM2A 4M8NA 2G9HD 3VH3B 4JWUC 5LNK1 1UD7A 1WYGA 2G4DB 4OZBA 2KYWA 1K50A 2INNE 2PVGC 4B0EA 2WX0A 1ZPSA 1R4MB 1SE4A 3MHZA 3GZNB 3MC0B 2MH7A 4WJOA 1L0VB 4ZRKA 2WQYB 3I3TB 4WJQA 1OQRA 4LTUA 3I63C 4RM9A 2KMAA 5AZFA 3NJTA 3HK0A 3RNAC 2HDEA 4DK5A 3OJ4B 5IOIA 3Q3MC 4LJPB 1WGHA 3L0WB 2D3AA 1KJTA 5JHBA 2FUG1 4FJVB 2BYVE 2LXCA 3AH7A 2IJ0A 2WXIA 4K81A 4YL8A 1WFYA 1IPGA 2KWDA 3TEYA 4YT0B 2IGDA 3MC9A 3QIJA 2C7NB 1QLBB 4MH8A 4FJZA 4ANWA 5AZGA 2IO1B 2J4XA 4ITKA 4HLEA 2DBYA 4W9DA 3B2FA 3FILB 2BPSA 1NYRA 5DCNA 1ET9A 3ZO5B 3MFGA 3FAHA 2JWZA 2WNMA 3AEAB 1XCQL 2RGFA 3H8HA 2J7QB 1WWTA 3PVLA 3AE2B 3GE3C 4G3XB 1B1ZA 2D3BA 2O6VD 2LVOA 2N1VA 3AE8B 4JX1C 3WAOA 1UH6A 2ZNVB 1WXQA 1DYQA 1JWSD 4LCDE 4LJOB 1I35A 1SIJA 3DBLI 5C23A 4F1SA 1E7PB 2ZW0A 1N6ZA 1GB4A 3BINA 1RFKA 3ALBA 5EDSA 2ONQA 4J3OD 2H88B 1XLOA 4GGQA 1JRUA 2C5LC 4ANXA 2D3GA 1IBXB 4OHJA 5BMGA 3A9JA 3O65B 1JRPA 1WE6A 4PS3A 4A3OA 4MEMA 2DENB 2KJ6A 1WGGA 4K7SA 4MELA 2IBIB 4P6VF 4BAXA 4ANVA 3P4PB 3BVGA 2WXRA 1WR6E 3AEDB 1OGWA 3DQVA 4L1BA 4W9LA 4KGSA 1GC6A 3PLUA 5CTRC 1PUTA 4A90A 4L23A 1C3TA 1FEHA 2JT4B 3EFCA 4GLSC 4BZAA 1C4PA 4DHJD 4FN2A 5D3IB 3OAWA 2CU1A 2BBCA 1WXAA 2PTLA 1TTNA 3E9SA 1WMHA 4NNJB 3ZIMA 2MBBB 2M0XA 1ISNA 2MRPA 1C9FA 1BXTA 3Q3FA 4BBNC 4KX6B 4RGOS 1UNSA 4E71A 3JYUA 2BYEA 1J0GA 2L0TA 1SJHD 1L2NA 3WAPA 2HTHA 1TS5A 1WXVA 2KLGA 3BVMA 1KRHA 4E3CA 5FR3A 2KTRA 1D5MC 5HHDG 1TZOA 1V1PA 2GBRA 1SXTA 3W2DA 2K8CA 3NZ3A 4ZRQA 1D3ZA 1A70A 1JWBD 3ENEA 1K51A 3UF8A 4YSZB 4XZ4A 2QIEB 4OVZA 3GE8C 2AL6A 3VTWA 1LXDA 2LVPA 2ZJDA 1RRBA 3GS2A 3UINB 5JZEB 2GB1A 3HHMA 1OFFA 2C7HA 4W9KA 4MM3A 3RNCC 2MJDA 2JXTA 5HG2A 3E56A 2LEKA 2ASQA 4TQ0A 5FR6A 4IG7B 2K22A 2RD0A 1I42A 1T6BX 1WIAA 2IPKD 4EE2A 2M1MA 4G50A 4DXGA 4AJWA 2A4ZA 1EWCA 4LNOA 4MSMB 5BYSA 3BY4B 2KFJA 1ZDVA 2AL3A 1R4NB 5D2MB 1KOTA 3ZRCA 4HK2A 1Q10A 1T0SC 2K1FA 4F8CB 3PO0A 4K1RB 1E90A 1SF0A 1CK1A 4F7ZA 3BYYB 2FCNA 3L10B 3RN9C 1F9JA 1UGMA 5JH5C 3EA6A 2KX3A 2ZPYA 4GDKB 4R3DA 1VZ6A 2VH2A 3LXFA 3U2SC 3DVNU 4N9F4 1YOVB 2WXFA 2MJ3A 2GBJA
chains in the Genus database with same CATH topology
3T3OA 2Z8LA 3BK1A 3KQ4A 3FC4A 3BIID 3EUB2 2W3RA 1V8CA 3ZJUA 1MPEA 1HA5A 3B2GA 4WWMA 1MVKA 2X38A 1OQQA 2IGGA 1ZE3D 1JCKB 3IT6B 4YTNB 5FK9C 2V3PA 2SEBD 1EWYC 4XDDA 3WCQA 1HQRD 1ZP0B 1RM6C 1PYWD 1AW7A 1V1PB 3NVWA 3VR8B 4ZYSA 2JX5A 3Q8FA 4YSXB 1XLNA 3HVZA 1GB1A 3ETRA 4NZLB 2L32A 1D5ZC 1QF6A 1NENB 2I38A 1IGDA 1FCLA 4LLGM 4USAA 3P4SB 3IAS1 1C4AA 3J9CA 4OZAA 3AEBB 5AUIA 1AYFA 3NS1A 2QILA 1I4PA 3TSSA 3AEEB 4IDIA 3BK2A 1YJIA 4YTPB 3TUOA 4LK0M 1N5WA 1C77A 3AE5B 2V0GA 3NVVA 2ON8A 4TSSA 1FFVA 1WGKA 1YN4A 2B76B 1BUIC 3W1SA 1V97A 2KAJA 4C56C 1F2RI 1YN5A 5BYQA 5EE1A 1JALA 5BMHA 2WXGA 4N58A 4MM3B 3LYYA 1DOYA 1ET6A 3IXSA 1J7CA 3AE4B 4OZCA 3O13A 2N7JA 2BTEA 2IDYA 1L6VA 4HROA 1FM0D 2BYTA 1JWAD 2N9KA 1SB3C 3GB1A 1YQ3B 1FXIA 1WRIA 3GP7A 3W5VB 2JWUA 1I7HA 1YQ4B 5BYRA 5D7GA 2YEPF 4YXDB 1KFYB 4HJGE 1XLPA 4REZA 3Q8BA 2WXMA 4RF1A 4GDLB 1QILA 5EE0A 4XWWA 1T3QA 1VLBA 3DWGC 3BVZA 1YMHE 3ZYYX 1QQRA 4NJCA 4M0WA 4ARCA 1TY0A 3P63A 1ZXHA 1IUEA 2IGHA 3AECB 5BMIA 5JXVA 1MHHE 3SEBA 1MHXA 5E6JA 3KLSX 2OEDA 2WXLA 4C80A 1IBXA 3ZJTA 3AE6B 4DXFA 2CU3A 3HUIA 3ABVB 1SBBB 3ZGZA 1J7BA 2ACZB 1L0XB 5FKAC 2PMVA 1XCTL 1F77A 2E3TA 3ZJVA 1L6UA 4A6QA 2BW2A 1FRDA 2WXHA 3RPFC 1N62A 2M56B 1XXGA 1JWUD 3KWVA 1I4GA 2K3UA 3Q8CA 3P1MA 4FXCA 2K5PA 4KGRA 1ZDXA 4JPSA 1SJED 2G9HD 3U4EG 1FNUA 3DWMA 1N60A 2BB5A 1F2RC 4JWUC 1LO5D 5T8IA 4D2KA 1WSPA 5LNK1 2LHEA 2DYMA 2LUMA 1DGJA 2N0SB 5GXGB 3W5UB 1WYGA 3I57A 1E0ZA 3OWEB 4OZBA 1K50A 1Y56A 1TKGA 1DOXA 1RWSA 4JE3B 4IKGA 1D4BA 5EE9A 1C78A 5G5HA 1J7AA 2INNE 1C4CA 2PVGC 4C7YA 1GOZA 3AE3B 1MI0A 2BS2B 2LGIA 4B0EA 4B0MA 2VZKD 1ZPSA 4XDCA 4RGNA 1FNWA 5C3JB 2DYOA 1SE4A 3MHZA 1KH0A 1FXAA 1VR9A 3MC0B 1M4VA 1FO4A 2MH7A 3PZ8A 2TSSA 1L0VB 2WQYB 2D5GA 1KLGD 1OQRA 4LTUA 3VR9B 1EU4A 2QEJC 4TMAB 4XE0A 1K53A 2XN9C 1QOAA 1KF6B 1QOGA 1AN8A 2HDEA 1E10A 1C76A 2K9XA 1HEZE 2K0PA 3Q8EA 3U7ZA 4WH4A 1L4DB 3R2IA 1FD6A 4ZOHC 3SFEB 4AS1A 1TS2A 3CIRB 2FUG1 1YN3A 3P4QB 1XO3A 5HI1A 2ICIA 4A9AA 3AH7A 1E9MA 2IJ0A 2WXIA 1PFDA 2PLPA 2FBWB 2KWDA 3TEYA 4YT0B 2WDQB 1ENFA 2LFIA 2IGDA 5G5GA 2PW9A 2H89B 2ZW1A 2JSVX 1QLBB 4MH8A 1VJKA 1TJEA 3PZ7A 2V3NA 2Y5PA 2AX5A 1JROA 2J4XA 4ITKA 3EGRA 2JYTA 2BB6A 1QOFA 2DBYA 1SE3A 2JYEA 3B2FA 2QMTA 3FILB 1NYRA 1IGCA 3VQIA 2WS3B 1ET9A 2J52A 1TS4A 4US9A 1FIQA 1N61A 3KWLA 2I2YA 3P42A 1STEA 1RYJA 4HEA1 2JQRB 1NEKB 3MFGA 3FAHA 3NUHB 2WNMA 4P16A 1QOBA 1UGJA 3AEAB 1XCQL 3H8HA 3P4RB 4A8XC 1WWTA 2WLBA 4WIPA 2GI9A 1T5XD 3AE2B 2PVOD 3BYTB 1B1ZA 4YSYB 3UI3A 1D6EC 2JU6X 1TKEA 3TEXA 1FCCC 4TQ1A 3AE8B 1UWXA 3AV8A 4JX1C 3AE7B 4RNAA 4HKZE 2L1AA 2WP9B 1WXQA 1DYQA 2EELA 3TEWA 1JWSD 2LHDA 5MPOA 2PKOA 1PDXA 5D3DA 1I4RA 1SIJA 5H8YE 2W54A 2WXOA 1E7PB 2ZW0A 2CJOA 3VRAB 1BMLC 3ZQ4A 1F0ZA 2JZPA 4Q2JA 3SR6A 1GB4A 2DLBA 2RDGA 1RFKA 4KKJA 4ZHPA 2RMMA 4XWTA 2ONQA 3AE1B 4J3OD 2H88B 2BT6A 1XLOA 4ZHOA 1YNTE 1K52A 1P7EA 1V1OA 2AQ1B 2WDVB 4RF0A 1IBXB 3AEGB 4OHJA 1TYGB 5BMGA 3AE9B 1JRPA 1HXYD 2YEPB 1QKZA 2RDHA 1PGAA 2INPE 2WDRB 4N6EB 4A55A 4P6VF 5EE3A 3P4PB 3AMZA 3BVGA 2WXRA 1SE2A 5H92C 3AEDB 2MEKA 2R61A 4RFBA 2KACA 3LB8C 1XEEA 4DQOC 1VZ8A 3NRZA 1I4HA 1EM7A 4MT5A 4L1BA 1L4ZB 4ARIA 1ACCA 3BWUD 4KGSA 1PGBA 1HZ6A 2LMCA 1PUTA 1ZUD2 4A90A 2MJEA 1VZ7A 4L23A 1KLUD 3Q8AA 1FEHA 1JWMD 4GLSC 1R7SA 1C4PA 1PGXA 2M19A 3NVYA 2QJLA 5D3IB 2BBCA 1NVID 2PTLA 1TS3A 3E9SA 2W55A 1EU3A 2WU2B 2J53A 1FRRA 1UWMA 1FMAD 3R2TA 2SAKA 4ZRPA 1C9FA 2XNAC 1FNVA 2WXJA 2V4IB 3URYA 1BXTA 3U52E 4KX6B 4RGOS 1UNSA 1ZXIA 2W3SA 4NAMA 1UUPA 2HTME 2FE8A 3R8BA 3AEFB 1SJHD 4WURA 4RCOA 1CQVA 5I4DA 3BZDB 3NVZA 1TS5A 2DWQA 3BVMA 1CJEA 1KRHA 4WAFA 5FR3A 2PIAA 4YTMB 4KKIA 1D5MC 5HHDG 1TZOA 1V1PA 4L2YA 2WU5B 1SXTA 4JWSC 3IAM1 3W2DA 3L4PA 1XLQA 2KDMA 3AM9A 2L83A 2J42A 3NZ3A 4ZRQA 1A70A 1JWBD 1L5PA 2E6XA 1K51A 2OHFA 3V3XA 4YSZB 2QIEB 1YJJA 4OVZA 1JQ4A 1ESFA 1NI3A 1AWDA 1SEBD 1D5XC 2L52A 2W82A 5C2TB 3N9YC 2AQ3B 4RGMA 3AB5A 1HZ5A 2NMQA 4US8A 1TKYA 3VRBB 3GS2A 1FFUA 2GB1A 2M0AA 1OFFA 3SFDB 1N63A 3T3NA 2VZKB 4YWGG 1B9RA 2LJIA 4C7ZA 2GRIA 2Y5CA 2KMMA 2WXQA 3C8YA 3AN1A 4RGTA 3RFZB 1SSNA 2MJDA 5TSSA 2JXTA 2Y3AA 2BS4B 3FILA 5HG2A 3E56A 3HRDD 2LEKA 3HVDA 2WXPA 1JW9D 1L0YB 3B9JA 4NAWB 4TQ0A 4HKQA 1KTKA 4MACA 4KGTA 2K22A 2NTSA 4N59A 1T6BX 4RH6A 3MJ5A 2IPKD 4EE2A 3CWIA 4DXGA 1GAQB 2QSDA 1EWCA 1GPXA 3TEZA 2KN4A 5BYSA 5HFYA 1C79A 1E6EB 1DOIA 4PT5A 1ZDVA 2RPVA 1TY2A 2WXNA 4O1NA 1JMLA 2Q5WD 1Q10A 1ZOYB 1I4XA 2AQ2B 4UDUC 1VRAB 2NTTA 3PO0A 2KQ4X 1XF5L 1SF0A 4CQNA 1CK1A 3Q69A 1ROEA 3BYYB 3V05A 2CJNA 2G1EA 3IT4B 1P7FA 1NYQA 4HRSA 4OW0A 3MP9A 1I4QA 2EKIA 1VDVA 3EA6A 4IOIE 4AQ7A 4GDKB 4H2AA 4R3DA 3W9CB 4WQMA 1VZ6A 1CZPA 2BS3B 1QT9A 5AUKA 3LXFA 2WXKA 1N5XA 3U2SC 3I9V1 2WXFA 2N9LA 2MJ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AEF B;  2E3T A;  3FAH A;  3FC4 A;  1L6U A;  1QOB A;  3AEA B;  2JQR B;  3BII D;  1FRD A;  3EUB 2;  2W3R A;  1V8C A;  3P4R B;  1WWT A;  2WLB A;  3B2G A;  2DWQ A;  1N62 A;  1CJE A;  1KRH A;  2M56 B;  3NVZ A;  3AE2 B;  4WWM A;  2PIA A;  4YTM B;  4FXC A;  3P1M A;  1OQQ A;  2K5P A;  2PVO D;  4YSY B;  3DWM A;  1N60 A;  2WU5 B;  4JWS C;  4JWU C;  4YTN B;  1TKE A;  3AE8 B;  3L4P A;  1XLQ A;  3AV8 A;  4JX1 C;  3AM9 A;  2L83 A;  1EWY C;  1DGJ A;  1A70 A;  1JWB D;  1L5P A;  1WYG A;  2N0S B;  3AE7 B;  1ZP0 B;  2OHF A;  5GXG B;  3WCQ A;  4YSZ B;  1E0Z A;  2QIE B;  1YJJ A;  1TKG A;  1DOX A;  1JQ4 A;  2WP9 B;  1NI3 A;  1AWD A;  1RM6 C;  1RWS A;  1WXQ A;  2L52 A;  5EE9 A;  5C2T B;  3VR8 B;  3NVW A;  5G5H A;  1J7A A;  5MPO A;  2PKO A;  1PDX A;  2JX5 A;  2PVG C;  2BS2 B;  3AB5 A;  3AE3 B;  4C7Y A;  1XLN A;  4YSX B;  3HVZ A;  4US8 A;  1TKY A;  1SIJ A;  2W54 A;  3ETR A;  1FFU A;  5H8Y E;  3VRB B;  1QF6 A;  1NEN B;  5C3J B;  1E7P B;  1OFF A;  3SFD B;  1N63 A;  2CJO A;  3VRA B;  4USA A;  1F0Z A;  3P4S B;  1B9R A;  1FXA A;  3SR6 A;  4C7Z A;  2Y5C A;  2KMM A;  3AN1 A;  1RFK A;  4ZHP A;  1FO4 A;  2MH7 A;  3AEB B;  1L0V B;  2MJD A;  2WQY B;  3AE1 B;  2H88 B;  2BT6 A;  1XLO A;  2BS4 B;  5AUI A;  4ZHO A;  1OQR A;  3HRD D;  3RPF C;  2LEK A;  4LTU A;  3VR9 B;  1AYF A;  1JW9 D;  2WDV B;  3B9J A;  3NS1 A;  3AEG B;  2MJ3 A;  1TYG B;  3AEE B;  4IDI A;  3AE9 B;  1YJI A;  4YTP B;  1JRP A;  1QOA A;  2K22 A;  4N59 A;  1N5W A;  1KF6 B;  1QOG A;  3AE5 B;  3NVV A;  3CWI A;  2WDR B;  3W5U B;  1FFV A;  1WGK A;  2B76 B;  1GAQ B;  4N6E B;  1E10 A;  4P6V F;  2K9X A;  5EE3 A;  1V97 A;  2KAJ A;  3P4P B;  3AMZ A;  1GPX A;  5EE1 A;  1JAL A;  4N58 A;  4ZOH C;  5H92 C;  1E6E B;  3AED B;  3SFE B;  3CIR B;  1J7C A;  1DOI A;  3AE4 B;  1DOY A;  3LB8 C;  1L6V A;  4HRO A;  1FM0 D;  3P4Q B;  1JWA D;  1SB3 C;  1XO3 A;  3NRZ A;  2Q5W D;  4A9A A;  1YQ3 B;  3AH7 A;  1FXI A;  1WRI A;  1ZOY B;  1E9M A;  3W5V B;  1I7H A;  1PFD A;  3PO0 A;  1YQ4 B;  1PUT A;  1ZUD 2;  2FBW B;  1KFY B;  4YXD B;  2MJE A;  1XLP A;  4YT0 B;  1SF0 A;  2WDQ B;  1R7S A;  1ROE A;  5EE0 A;  2M19 A;  1T3Q A;  5G5G A;  1VLB A;  2CJN A;  2H89 B;  3DWG C;  3NVY A;  2G1E A;  2QJL A;  3ZYY X;  1NVI D;  1QLB B;  1NYQ A;  3P63 A;  2W55 A;  1VJK A;  2WU2 B;  4HRS A;  1TJE A;  1IUE A;  1FRR A;  2EKI A;  1UWM A;  1VDV A;  3AEC B;  1FMA D;  1JRO A;  2AX5 A;  4ITK A;  4C80 A;  3W9C B;  1QOF A;  2DBY A;  4WQM A;  1CZP A;  2BS3 B;  3AE6 B;  2CU3 A;  3B2F A;  1QT9 A;  3HUI A;  4KX6 B;  1NYR A;  5AUK A;  3ABV B;  3LXF A;  1ZXI A;  1N5X A;  2WS3 B;  4US9 A;  1FIQ A;  1J7B A;  1N61 A;  2W3S A;  3KWL A;  2ACZ B;  1RYJ A;  1NEK B;  2HTM E; 
#chains in the Genus database with same CATH topology
 3T3O A;  3A9K B;  3KQ4 A;  3BII D;  2IO3 B;  3B2G A;  4WWM A;  3NHE B;  1OQQ A;  2IGG A;  1ZE3 D;  1JCK B;  4TV3 A;  4KZC A;  4YTN B;  3C0R B;  2GOW A;  1XQQ A;  1ZP0 B;  2KDF B;  2RDB C;  4JIO U;  2WX1 A;  2R2O A;  2IY0 B;  5HKH A;  5LXI B;  3Q8F A;  3HVZ A;  2D2Q A;  2L32 A;  1D5Z C;  3SD5 A;  1QF6 A;  2Z0E B;  2WWZ A;  3IAS 1;  3VTU A;  1BT0 A;  3X23 A;  2BVC A;  2HE7 A;  3AEB B;  1FPY A;  3CMM B;  1TGZ B;  2KX0 A;  3TSS A;  3AEE B;  2KWC A;  2M8S A;  2V1Y A;  4NAW A;  2B76 B;  4IWP A;  2FCM A;  3TJP A;  1LGR A;  4C56 C;  5BYQ A;  5EE1 A;  4HVB A;  2BQQ A;  4GDL A;  1J7C A;  3ML8 A;  1V5T A;  1JWA D;  1SB3 C;  4BVU C;  3GB1 A;  1WRI A;  3GP7 A;  2JWU A;  4K3C A;  2DZJ A;  2K6D B;  2G4S A;  3Q8B A;  4GDL B;  1QIL A;  2W9N A;  4XWW A;  2BWF A;  1K8R B;  3DWG C;  3CSF A;  1G6J A;  3B08 A;  4ARC A;  2MQJ A;  2BF8 B;  1IUE A;  5JXV A;  2WXL A;  2KQ7 A;  1IBX A;  4DXF A;  3UQB A;  1E8W A;  1J7B A;  3Q14 C;  1WJ6 A;  2ACZ B;  1L0X B;  4W9C A;  5FKA C;  4ZDV A;  4A6Q A;  2DZI A;  4XX5 A;  2WXH A;  2K3U A;  4KGR A;  4P7I A;  2K5P A;  1SJE D;  3U4E G;  1FNU A;  2BB5 A;  1F2R C;  5T8I A;  4EEW A;  3FKY A;  2LAS A;  5GXG B;  2N0S B;  1E0Z A;  3OWE B;  4KDI C;  3WAL A;  2WGS A;  2KVZ A;  2LD9 A;  1RWS A;  1NBF C;  1D4B A;  2KC2 A;  1J7A A;  4C7Y A;  3AE3 B;  4M01 A;  4B0M A;  2XK5 A;  5C3J B;  2Y5B B;  3RNB C;  4KDL B;  1VR9 A;  3R66 C;  3ZUN A;  1IP9 A;  2OJR A;  1E7U A;  5LXH A;  4TMA B;  4XE0 A;  3AXC A;  4GXB A;  4LNN A;  1H4R A;  1WJN A;  1HEZ E;  1V81 A;  3PS6 A;  2K0P A;  3U7Z A;  1WX7 A;  3R2I A;  3RT3 B;  3RNE C;  4EZL A;  1YN3 A;  3P4Q B;  2ICI A;  3PT2 B;  4A9A A;  3H1U A;  3DHH C;  1PFD A;  4NY0 A;  2PLP A;  2FBW B;  4BBN F;  5E6O A;  2KDI A;  3DCG A;  2L8J A;  3WA0 A;  2JYT A;  1QOF A;  4W9G A;  1SE3 A;  4ANU A;  3VQI A;  2WS3 B;  4US9 A;  2J52 A;  1FIQ A;  1N61 A;  1RYJ A;  4HEA 1;  1NEK B;  2JQR B;  1QOB A;  1UGJ A;  2KHW B;  1GNU A;  2JPH A;  3P4R B;  3PTF C;  2WLB A;  3DBR B;  1T5X D;  2NCN A;  3V6C B;  3BYT B;  4DDI D;  1D6E C;  3AU5 A;  2JU6 X;  2O2V A;  2X8X X;  4MSQ B;  3AV8 A;  3ZXR A;  3AE7 B;  4RNA A;  4GN1 A;  4HKZ E;  3PHW B;  3VDZ A;  4MDK E;  5MPO A;  2PKO A;  1PDX A;  5CHW A;  1WRD B;  3RUI B;  2W54 A;  3I5J C;  2WXO A;  5KHO A;  1BML C;  4ZRJ A;  3VRA B;  2JZP A;  4FUL A;  4Q2J A;  2DLB A;  4IW0 A;  4NQK E;  4ZHP A;  2YLM A;  4XWT A;  3PGE A;  3AE1 B;  4ZHO A;  1P7E A;  3R3M A;  1V1O A;  4GB9 A;  4MJS A;  1QKZ A;  2WDR B;  4A55 A;  3DPD A;  3CF6 E;  2G45 B;  2MA9 B;  5L83 A;  2MSE D;  5H92 C;  4RFB A;  3LB8 C;  3GZN I;  4BKS D;  4MT5 A;  3C19 A;  1ACC A;  3NZU A;  2N1W A;  2FID A;  3N1Y C;  2MJE A;  3Q8A A;  3VUX A;  2JZZ A;  1TT5 B;  4HXD A;  3A1Q A;  3NVY A;  3H6N A;  2YVC A;  4M00 A;  1IYF A;  2OOB B;  2KOX A;  1WR1 A;  2BGF A;  2J53 A;  3U8Z A;  1FRR A;  2SAK A;  2BKF A;  4ZRP A;  3URY A;  4MGK E;  1TIF A;  4PYZ A;  1ZXI A;  4IM3 A;  3ZDM C;  2W3S A;  4NAM A;  2FE8 A;  3AEF B;  4DWF A;  4GSW A;  3APD A;  2DWQ A;  4WAF A;  1SGH A;  3PRE A;  2WU5 B;  2Z59 B;  4NJ6 A;  4ACF A;  3AM9 A;  2J42 A;  3ZKJ C;  1EO6 A;  3V3X A;  3NOB A;  1AWD A;  1UZX B;  1SEB D;  3WIM A;  4OVV A;  1XT9 B;  2FUH B;  5C2T B;  3N9Y C;  2LJ5 A;  2AQ3 B;  2NMQ A;  1EF1 A;  3DBR I;  2M0A A;  5J17 A;  1N63 A;  4KVG B;  2L00 B;  2Y5C A;  1WXM A;  3AN1 A;  4K7W A;  2CHW A;  5TSS A;  3FIL A;  4M8M A;  3ZLZ A;  2KTF A;  1JW9 D;  3B9J A;  3RMK C;  4NAW B;  4MAC A;  4KGT A;  5IA7 A;  1GAQ B;  2MBH A;  4S0R A;  3TEZ A;  5AZH A;  5DPR A;  3VTV A;  1Y8R C;  1DOI A;  3QQ8 B;  4KIK A;  1TY2 A;  2WXN A;  2KFK B;  1JML A;  1ZOY B;  3U7D A;  1I4X A;  2ZCC A;  2AQ2 B;  3DVN V;  1EUV B;  3QC8 B;  2OJW A;  2O6V B;  2G1E A;  2KK8 A;  4DHZ B;  4AJY B;  2JUO A;  1NYQ A;  2VRR B;  2NVU I;  1V80 A;  3D32 A;  4HRS A;  4OW0 A;  1WF9 A;  3MP9 A;  4GU2 A;  1VDV A;  4EKU A;  2LGY A;  2UWQ A;  5TR5 A;  4IOI E;  3RZF A;  3TMP B;  3QX1 A;  2I1K A;  5GMV A;  4WQM A;  2BS3 B;  3VXW A;  1QT9 A;  4P1B C;  5AUK A;  3L17 A;  4A3P A;  2WXK A;  1N5X A;  4PYU A;  3I9V 1;  4HPM B;  3NG0 A;  4C4V A;  2CS4 A;  3FC4 A;  3PRZ A;  2W3R A;  1CMX B;  1HA5 A;  3QA8 A;  2X38 A;  4FAD A;  3B0A A;  4BFR A;  3IT6 B;  5FK9 C;  2PJH A;  3Q3J A;  4TKN A;  3WCQ A;  2ZPN A;  1HQR D;  3RI7 C;  5G55 A;  1PYW D;  4ICV A;  3VR8 B;  2JX5 A;  1ZW7 A;  3PHX B;  3ZNH B;  1XLN A;  2ZVO A;  4I6P A;  3ETR A;  2MW5 A;  4LLG M;  4USA A;  2DHZ A;  2L76 A;  4W9J A;  2REX A;  3LDZ E;  1YX6 B;  1RFA A;  1V86 A;  1I4P A;  3BK2 A;  4WWO A;  4M02 A;  1FFV A;  1BUI C;  2NS5 A;  4EOY A;  3Q3N C;  3ML9 A;  2KAJ A;  1F2R I;  1YN5 A;  5BMH A;  1JAL A;  3A1Q B;  3MC8 A;  1WXS A;  2DZK A;  3IFW B;  3N32 A;  4HRO A;  1FXI A;  3EHV A;  1UEL A;  4HPP A;  2GBK A;  5D7G A;  2YEP F;  1KFY B;  2ZNV C;  4REZ A;  4RF1 A;  4G11 A;  3BVZ A;  1YMH E;  3ZYY X;  4NJC A;  4M0W A;  3A4S C;  4DHJ B;  2IGH A;  2JF5 A;  3SEB A;  4MJS B;  5E6J A;  2KTR B;  2WYQ A;  4DBG A;  1UBI A;  3X0W A;  3ZGZ A;  3OG5 A;  2PMV A;  4GIV A;  2JRH A;  2BW2 A;  3VHT C;  3N1Z C;  2KT7 A;  1EF5 A;  2L0F A;  3RPF C;  1MFW A;  1N62 A;  3KWV A;  1JWU D;  4AWJ A;  4KZ0 A;  1I4G A;  3Q8C A;  4FXC A;  3P1M A;  2C7M B;  2N9P C;  3DWM A;  1N60 A;  4GOC A;  1WSP A;  1WMH B;  2LHE A;  2DYM A;  3KUC B;  1WM3 A;  2PE6 B;  1DGJ A;  3W5U B;  1UF0 A;  2K25 A;  2KAN A;  2PEA A;  4IKG A;  3RCZ A;  5EE9 A;  4E74 A;  5G5H A;  5E6P A;  1C4C A;  4ZRI A;  1GOZ A;  2BS2 B;  2LGI A;  3T9L A;  3TIX A;  3TBL D;  3VUW A;  2VZK D;  3N20 C;  4RGN A;  2DYO A;  3PPA A;  4LNK A;  1KH0 A;  1FXA A;  4IWQ A;  3APC A;  3P2B A;  1FO4 A;  3PZ8 A;  1KLG D;  3CST A;  3M3J A;  4BOZ B;  3KVF B;  3VR9 B;  3AUL A;  1EU4 A;  2QEJ C;  2FIF A;  5KHQ A;  2N4F A;  4MGY E;  1KF6 B;  3A9J B;  1AN8 A;  1E10 A;  2K9X A;  1NI2 A;  4HDQ A;  1FD6 A;  2KN5 A;  4ZOH C;  1TS2 A;  3CIR B;  2WDT B;  4II3 B;  5E6N A;  2IND C;  2J0J A;  3ZNZ B;  4B95 A;  2FNJ B;  4KIK B;  2WDQ B;  3ZW3 A;  1ENF A;  3UIP B;  5G5G A;  2JSV X;  1SE9 A;  1TJE A;  1OTR B;  2BB6 A;  1GC7 A;  2JYE A;  2QMT A;  1IGC A;  4HDO A;  3KWL A;  3RUL A;  5DPT A;  2GI9 A;  2JZ3 B;  4WAA A;  4YSY B;  1WGR A;  1WJU A;  2CHX A;  1TKE A;  1FCC C;  4TQ1 A;  1UWX A;  4KV2 A;  1T0Y A;  1V49 A;  2L1A A;  3QHT A;  1UBQ A;  2EEL A;  3DHI C;  1WGD A;  2LHD A;  3R7R A;  3QWZ B;  2ZVN A;  1I4R A;  5H8Y E;  2CJO A;  3ZQ4 A;  2KLC A;  3SR6 A;  4KKJ A;  2RMM A;  2R2Q A;  2KQS A;  3HM6 X;  3NS8 A;  1YNT E;  2D11 A;  3V61 A;  3EEC A;  4RF0 A;  1TYG B;  2KNB A;  3AE9 B;  2RDH A;  3VUY A;  3PRP B;  4AP4 C;  3AMZ A;  2L7R A;  1SE2 A;  2MEK A;  2R61 A;  1XEE A;  4DQO C;  1VZ8 A;  3NRZ A;  1I4H A;  3SDL C;  4ARI A;  1P1A A;  3BWU D;  3GOE A;  1PGB A;  3Q6B A;  2MWS B;  1PGX A;  2PE9 A;  3LJ3 A;  2D07 B;  1TS3 A;  1EU3 A;  1UWM A;  1FMA D;  4ICU A;  2FCQ A;  2QCZ A;  2XNA C;  1R4M I;  2WXJ A;  4W9E A;  2V4I B;  3KH0 A;  1MG8 A;  3KUD B;  1UUP A;  4HCN B;  2HTM E;  3R8B A;  4JGH B;  4WUR A;  1WH3 A;  4EZJ A;  4FA6 A;  1YD8 U;  1CQV A;  4WQO B;  5I4D A;  3BZD B;  3DBL B;  1CJE A;  1LM8 B;  1WE7 A;  2PIA A;  4KKI A;  2MLB A;  4JWS C;  2ZEQ A;  1GG3 A;  1XLQ A;  1VD2 A;  2OHF A;  4EFO A;  1YJJ A;  1JQ4 A;  1ESF A;  1NI3 A;  3PV1 A;  4B6W A;  1D5X C;  3PLV A;  2L52 A;  2W82 A;  1GJZ A;  2NR2 A;  3AB5 A;  1HZ5 A;  2D10 A;  4CYE A;  4IUM B;  1TKY A;  2QHO A;  4X57 B;  2JXX A;  3QAR A;  3SFD B;  4YWG G;  4S17 A;  2LJI A;  4C7Z A;  1Q5W B;  2GRI A;  3C8Y A;  2LI5 A;  4RGT A;  3PSE B;  4WWP A;  1WZ0 A;  3DHG C;  4LDT B;  3RFZ B;  2L3Z A;  3M63 B;  2KC1 A;  2KXJ A;  2WXP A;  4HKQ A;  4GDK A;  2I1J A;  3V62 A;  4N59 A;  2NTS A;  2IO2 B;  3MJ5 A;  1MG4 A;  3N1X C;  3JSV A;  2VH1 A;  2GLS A;  1GPX A;  1WX8 A;  4CO7 A;  3L16 A;  5HFY A;  1E6E B;  4WJP A;  2LUE A;  4O1N A;  2Q5W D;  5DPS A;  4UDU C;  2NTT A;  3MHS D;  2RR9 A;  2KQ4 X;  4BKS A;  1XF5 L;  4DHZ E;  3UIO B;  3EFU A;  2BKR B;  2KD0 A;  2G3Q B;  1ROE A;  2LRU A;  3V05 A;  4K3B A;  2KKC A;  3PZD A;  1I4Q A;  2EKI A;  4FJY A;  4XGA B;  2B3A A;  2HJ8 A;  1J19 A;  4H2A A;  3ZDT A;  3W9C B;  4II2 B;  2MBO A;  1MJD A;  4C4V B;  4HCP B;  3M62 B;  3MJW A;  2N9L A;  1V6E A;  4DXA B;  3BK1 A;  3DVG Y;  4HPL B;  3EUB 2;  1MPE A;  1SIF A;  1YIW A;  3V6E B;  1QZE A;  2XK5 B;  4NQL B;  3ONS A;  2FAZ A;  4RM8 A;  1X1M A;  2LXA A;  4FHJ A;  4I6L B;  2SEB D;  4ZYN A;  3IG3 A;  1EWY C;  3L13 A;  3H7P A;  1ZGU B;  4BKG A;  2D3C A;  2Z0D B;  1RM6 C;  3Q2A C;  1AW7 A;  2RSU A;  1V1P B;  4P1C C;  4GMV A;  4YSX B;  3QJZ A;  2LRW A;  1NEN B;  1PQS A;  1IGD A;  2I38 A;  2INC C;  2GBN A;  3AI5 A;  1FCL A;  3EC8 A;  3P4S B;  2KMC A;  1C4A A;  2K8B A;  3J9C A;  1T0R C;  4EUT A;  2J0M A;  2EMS A;  3NS1 A;  2QIL A;  1F52 A;  1YJI A;  4LK0 M;  4B9K A;  1C77 A;  1P9D U;  3N30 A;  3W1Y A;  4TSS A;  1WGK A;  3W1S A;  2J0K A;  4N58 A;  3KUZ A;  4OZC A;  2IDY A;  1L6V A;  1WZ3 A;  3HIZ A;  2JRI B;  3W5V B;  1I7H A;  4LDT D;  1HTQ A;  1XLP A;  2WXM A;  1RAX A;  5EE0 A;  2BYF A;  3VVW B;  1QQR A;  4KSL C;  3P63 A;  1ZXH A;  3DVG X;  5JHA A;  2UU7 A;  5BMI A;  1MHH E;  5C1Z A;  1MHX A;  2OED A;  2N9E B;  3AE6 B;  3HUI A;  3ABV B;  2JY6 A;  1SBB B;  2MP2 A;  2N7D A;  1WX9 A;  2KZR A;  1XCT L;  3ZJV A;  1YQB A;  2LZ6 A;  3ZNI D;  1XXG A;  3DDC B;  4XC2 A;  2KJR A;  1ZDX A;  2C9W B;  4JPS A;  1U4A A;  3A4R A;  4FLH A;  1LO5 D;  4D2K A;  2KWV B;  1KM7 A;  2M4N A;  2LUM A;  3I57 A;  4RMA A;  1Y56 A;  1TKG A;  1DOX A;  4JE3 B;  4JQW C;  1C78 A;  5IO9 A;  1MI0 A;  4XDC A;  1AAR A;  2CKH B;  1FNW A;  3APF A;  1V9J A;  2HJ1 A;  3A9K A;  3H9D A;  1WGY A;  5AEK B;  1M4V A;  4IC7 B;  2TSS A;  3JW0 X;  2D5G A;  1WYW B;  3ZTC A;  1K53 A;  2XN9 C;  1QOA A;  5D94 A;  1QOG A;  1RLF A;  1C76 A;  3A33 B;  2IZV B;  2NPT B;  3Q8E A;  4WH4 A;  1L4D B;  3RZW C;  3TCA A;  4AS1 A;  3SFE B;  2LWP A;  3N3K B;  2KWU B;  3RD2 A;  1XO3 A;  3IHP C;  4HWI B;  5HI1 A;  4I6N B;  4ASW C;  3ZXV A;  1E9M A;  3OLM D;  2C60 A;  1Z2M A;  1WY8 A;  3VAW A;  2PPH A;  2LFI A;  1E8Y A;  2PW9 A;  2H89 B;  2ZW1 A;  4JLC A;  4MGZ E;  5CHF A;  1VCB A;  2O2V B;  1VJK A;  2LVQ A;  4QAY A;  1ZKH A;  3PZ7 A;  5IKC M;  2V3N A;  2Y5P A;  2AX5 A;  1JRO A;  4NPN A;  3EGR A;  3PRM B;  1E5W A;  1TS4 A;  1TZ1 A;  2I2Y A;  3P42 A;  1STE A;  3WAN A;  4P16 A;  3NUH B;  3KYD D;  5IAA C;  4A8X C;  4WIP A;  3H7S A;  3L08 A;  2DX5 B;  2PVO D;  5J2R A;  3UI3 A;  4LNF A;  4URK A;  4EZK A;  3TEX A;  1LFD A;  5LLI A;  3IVF A;  3NY5 A;  2ZZP B;  2QDF A;  2K6Q A;  2WP9 B;  1OEY A;  3TEW A;  5G2N A;  2NBU A;  4OVU A;  1H8C A;  4A20 A;  5D3D A;  2KFK A;  1C1Y B;  3DBS A;  1F0Z A;  2V9H A;  3QCA A;  2IY1 B;  3RNG C;  2KJH B;  2RDG A;  3RNF C;  1YX5 B;  4DDG D;  4W9H A;  2NPT A;  2KDB A;  2BT6 A;  1K52 A;  1Z5S B;  2MCN B;  4HJK A;  2AQ1 B;  2WDV B;  3V60 A;  4IM2 A;  3AEG B;  3U30 A;  2EMT A;  3T8M A;  1HXY D;  2LGD A;  2YEP B;  1PGA A;  2INP E;  4N6E B;  5BO4 B;  5EE3 A;  1L7Y A;  2KAC A;  2MX2 A;  1EM7 A;  1E8Z A;  1L4Z B;  1S1Q B;  4MH0 E;  1HZ6 A;  2LMC A;  1ZUD 2;  2LGS A;  1OEY J;  1VZ7 A;  1KLU D;  1JWM D;  1R7S A;  4XYC A;  2L05 A;  3VFK A;  2M19 A;  2QJL A;  2LGX A;  1NVI D;  3ZNG C;  2FCS A;  2W55 A;  2WU2 B;  2NBV B;  2AEH A;  3R2T A;  3ZTD A;  2MBE A;  1TBE A;  1FNV A;  3TL5 A;  2HD5 B;  3U52 E;  4IM0 A;  2IYD B;  1FXT B;  2QC8 A;  5CX3 A;  3RYT A;  2V3S A;  4RCO A;  5CHV C;  3NVZ A;  3S2A A;  4J6I A;  4YTM B;  1WI0 A;  1F1H A;  4L2Y A;  4C00 A;  3IAM 1;  3L4P A;  4G0N B;  2KDM A;  2L83 A;  4WJN A;  2E6X A;  1L5P A;  3K9P B;  2KDE B;  3HM3 A;  4W9F A;  2CHZ A;  1P98 A;  2KO3 A;  4RGM A;  1V5O A;  4US8 A;  3VRB B;  1FFU A;  3QAQ A;  4PS7 A;  3T3N A;  2VZK B;  1B9R A;  2IO0 B;  1KLV A;  2KMM A;  2WXQ A;  3UQA A;  1SSN A;  4BKT A;  1T0Q C;  3KYC D;  2Y3A A;  2K8H A;  2BS4 B;  1E8X A;  3HRD D;  3HVD A;  1L0Y B;  2ZCB A;  1KTK A;  4RH6 A;  4BOS C;  3CWI A;  1V2Y A;  2QSD A;  1P3Q U;  3Q3O C;  3ZVV A;  3OJ3 A;  2RPQ A;  2KN4 A;  1OQY A;  3DBH B;  2O6V A;  1C79 A;  3R7Q A;  4PT5 A;  2RPV A;  3VH4 B;  2DZM A;  3IBE A;  2DNF A;  1VRA B;  3B1L X;  4CHK A;  4CQN A;  3Q69 A;  2EKE C;  4NJ7 A;  2CJN A;  3H7P B;  3IT4 B;  1P7F A;  2AYO B;  5D6J B;  4AUQ C;  4FBJ B;  2DAJ A;  1P0R A;  3UGB B;  2JVC A;  4LNI A;  1GUA B;  4AQ7 A;  1CZP A;  1YJ1 A;  2M17 A;  3DBH I;  3M95 A;  2MBQ A;  5IN7 A;  3W1S C;  3ECI A;  2Z8L A;  1V8C A;  3ZJU A;  3NZS A;  2N7E A;  1MVK A;  2N9X A;  4K7U A;  4PK1 A;  2A5U A;  1Q0W B;  1M94 A;  2V3P A;  1HE8 A;  1S3S G;  4XDD A;  5DPW A;  2CR5 A;  4IWO A;  1LQB A;  1R4N I;  3SHQ A;  1XD3 B;  3NVW A;  4ZYS A;  4FHK A;  2XEW A;  1GB1 A;  4NZL B;  3DOW A;  2V4L A;  5IP4 D;  4OZA A;  3QK0 A;  1Q1O A;  2NBW B;  3ZRF A;  5AUI A;  4JL9 A;  3JSV B;  1AYF A;  3KW5 B;  4IDI A;  4WWN A;  4YTP B;  1J8C A;  3TUO A;  1N5W A;  3AE5 B;  2V0G A;  3NVV A;  2ON8 A;  1YN4 A;  2BWE S;  4M0W B;  3MTN B;  1V97 A;  2WXG A;  4MM3 B;  3LYY A;  2DYB A;  4AOF A;  1DOY A;  1ET6 A;  2DAF A;  3IXS A;  3AE4 B;  3O13 A;  2N7J A;  2BTE A;  1NDD A;  1FM0 D;  2BYT A;  2N9K A;  1YQ3 B;  5L95 C;  3JVZ X;  4TUU A;  3WAM A;  1YQ4 B;  5BYR A;  4YXD B;  4HJG E;  1WJ4 A;  2K39 A;  1T3Q A;  2GBM A;  1VLB A;  4MGI E;  5J18 A;  2KVR A;  1A5R A;  1TY0 A;  2UYZ B;  3L54 A;  1E7V A;  3AEC B;  2GMI C;  2XBB C;  2AWT A;  3KLS X;  4C80 A;  2MHJ A;  3ZJT A;  2CU3 A;  3SU8 X;  2WHI A;  1HTO A;  3K9O B;  4KSK C;  4W9I A;  3AU4 A;  1F77 A;  2E3T A;  2MP2 B;  1L6U A;  1FRD A;  4PS8 A;  2M56 B;  1WM2 A;  4M8N A;  2G9H D;  3VH3 B;  4JWU C;  5LNK 1;  1UD7 A;  1WYG A;  2G4D B;  4OZB A;  2KYW A;  1K50 A;  2INN E;  2PVG C;  4B0E A;  2WX0 A;  1ZPS A;  1R4M B;  1SE4 A;  3MHZ A;  3GZN B;  3MC0 B;  2MH7 A;  4WJO A;  1L0V B;  4ZRK A;  2WQY B;  3I3T B;  4WJQ A;  1OQR A;  4LTU A;  3I63 C;  4RM9 A;  2KMA A;  5AZF A;  3NJT A;  3HK0 A;  3RNA C;  2HDE A;  4DK5 A;  3OJ4 B;  5IOI A;  3Q3M C;  4LJP B;  1WGH A;  3L0W B;  2D3A A;  1KJT A;  5JHB A;  2FUG 1;  4FJV B;  2BYV E;  2LXC A;  3AH7 A;  2IJ0 A;  2WXI A;  4K81 A;  4YL8 A;  1WFY A;  1IPG A;  2KWD A;  3TEY A;  4YT0 B;  2IGD A;  3MC9 A;  3QIJ A;  2C7N B;  1QLB B;  4MH8 A;  4FJZ A;  4ANW A;  5AZG A;  2IO1 B;  2J4X A;  4ITK A;  4HLE A;  2DBY A;  4W9D A;  3B2F A;  3FIL B;  2BPS A;  1NYR A;  5DCN A;  1ET9 A;  3ZO5 B;  3MFG A;  3FAH A;  2JWZ A;  2WNM A;  3AEA B;  1XCQ L;  2RGF A;  3H8H A;  2J7Q B;  1WWT A;  3PVL A;  3AE2 B;  3GE3 C;  4G3X B;  1B1Z A;  2D3B A;  2O6V D;  2LVO A;  2N1V A;  3AE8 B;  4JX1 C;  3WAO A;  1UH6 A;  2ZNV B;  1WXQ A;  1DYQ A;  1JWS D;  4LCD E;  4LJO B;  1I35 A;  1SIJ A;  3DBL I;  5C23 A;  4F1S A;  1E7P B;  2ZW0 A;  1N6Z A;  1GB4 A;  3BIN A;  1RFK A;  3ALB A;  5EDS A;  2ONQ A;  4J3O D;  2H88 B;  1XLO A;  4GGQ A;  1JRU A;  2C5L C;  4ANX A;  2D3G A;  1IBX B;  4OHJ A;  5BMG A;  3A9J A;  3O65 B;  1JRP A;  1WE6 A;  4PS3 A;  4A3O A;  4MEM A;  2DEN B;  2KJ6 A;  1WGG A;  4K7S A;  4MEL A;  2IBI B;  4P6V F;  4BAX A;  4ANV A;  3P4P B;  3BVG A;  2WXR A;  1WR6 E;  3AED B;  1OGW A;  3DQV A;  4L1B A;  4W9L A;  4KGS A;  1GC6 A;  3PLU A;  5CTR C;  1PUT A;  4A90 A;  4L23 A;  1C3T A;  1FEH A;  2JT4 B;  3EFC A;  4GLS C;  4BZA A;  1C4P A;  4DHJ D;  4FN2 A;  5D3I B;  3OAW A;  2CU1 A;  2BBC A;  1WXA A;  2PTL A;  1TTN A;  3E9S A;  1WMH A;  4NNJ B;  3ZIM A;  2MBB B;  2M0X A;  1ISN A;  2MRP A;  1C9F A;  1BXT A;  3Q3F A;  4BBN C;  4KX6 B;  4RGO S;  1UNS A;  4E71 A;  3JYU A;  2BYE A;  1J0G A;  2L0T A;  1SJH D;  1L2N A;  3WAP A;  2HTH A;  1TS5 A;  1WXV A;  2KLG A;  3BVM A;  1KRH A;  4E3C A;  5FR3 A;  2KTR A;  1D5M C;  5HHD G;  1TZO A;  1V1P A;  2GBR A;  1SXT A;  3W2D A;  2K8C A;  3NZ3 A;  4ZRQ A;  1D3Z A;  1A70 A;  1JWB D;  3ENE A;  1K51 A;  3UF8 A;  4YSZ B;  4XZ4 A;  2QIE B;  4OVZ A;  3GE8 C;  2AL6 A;  3VTW A;  1LXD A;  2LVP A;  2ZJD A;  1RRB A;  3GS2 A;  3UIN B;  5JZE B;  2GB1 A;  3HHM A;  1OFF A;  2C7H A;  4W9K A;  4MM3 A;  3RNC C;  2MJD A;  2JXT A;  5HG2 A;  3E56 A;  2LEK A;  2ASQ A;  4TQ0 A;  5FR6 A;  4IG7 B;  2K22 A;  2RD0 A;  1I42 A;  1T6B X;  1WIA A;  2IPK D;  4EE2 A;  2M1M A;  4G50 A;  4DXG A;  4AJW A;  2A4Z A;  1EWC A;  4LNO A;  4MSM B;  5BYS A;  3BY4 B;  2KFJ A;  1ZDV A;  2AL3 A;  1R4N B;  5D2M B;  1KOT A;  3ZRC A;  4HK2 A;  1Q10 A;  1T0S C;  2K1F A;  4F8C B;  3PO0 A;  4K1R B;  1E90 A;  1SF0 A;  1CK1 A;  4F7Z A;  3BYY B;  2FCN A;  3L10 B;  3RN9 C;  1F9J A;  1UGM A;  5JH5 C;  3EA6 A;  2KX3 A;  2ZPY A;  4GDK B;  4R3D A;  1VZ6 A;  2VH2 A;  3LXF A;  3U2S C;  3DVN U;  4N9F 4;  1YOV B;  2WXF A;  2MJ3 A;  2GBJ A; 
#chains in the Genus database with same CATH homology
 3T3O A;  2Z8L A;  3BK1 A;  3KQ4 A;  3FC4 A;  3BII D;  3EUB 2;  2W3R A;  1V8C A;  3ZJU A;  1MPE A;  1HA5 A;  3B2G A;  4WWM A;  1MVK A;  2X38 A;  1OQQ A;  2IGG A;  1ZE3 D;  1JCK B;  3IT6 B;  4YTN B;  5FK9 C;  2V3P A;  2SEB D;  1EWY C;  4XDD A;  3WCQ A;  1HQR D;  1ZP0 B;  1RM6 C;  1PYW D;  1AW7 A;  1V1P B;  3NVW A;  3VR8 B;  4ZYS A;  2JX5 A;  3Q8F A;  4YSX B;  1XLN A;  3HVZ A;  1GB1 A;  3ETR A;  4NZL B;  2L32 A;  1D5Z C;  1QF6 A;  1NEN B;  2I38 A;  1IGD A;  1FCL A;  4LLG M;  4USA A;  3P4S B;  3IAS 1;  1C4A A;  3J9C A;  4OZA A;  3AEB B;  5AUI A;  1AYF A;  3NS1 A;  2QIL A;  1I4P A;  3TSS A;  3AEE B;  4IDI A;  3BK2 A;  1YJI A;  4YTP B;  3TUO A;  4LK0 M;  1N5W A;  1C77 A;  3AE5 B;  2V0G A;  3NVV A;  2ON8 A;  4TSS A;  1FFV A;  1WGK A;  1YN4 A;  2B76 B;  1BUI C;  3W1S A;  1V97 A;  2KAJ A;  4C56 C;  1F2R I;  1YN5 A;  5BYQ A;  5EE1 A;  1JAL A;  5BMH A;  2WXG A;  4N58 A;  4MM3 B;  3LYY A;  1DOY A;  1ET6 A;  3IXS A;  1J7C A;  3AE4 B;  4OZC A;  3O13 A;  2N7J A;  2BTE A;  2IDY A;  1L6V A;  4HRO A;  1FM0 D;  2BYT A;  1JWA D;  2N9K A;  1SB3 C;  3GB1 A;  1YQ3 B;  1FXI A;  1WRI A;  3GP7 A;  3W5V B;  2JWU A;  1I7H A;  1YQ4 B;  5BYR A;  5D7G A;  2YEP F;  4YXD B;  1KFY B;  4HJG E;  1XLP A;  4REZ A;  3Q8B A;  2WXM A;  4RF1 A;  4GDL B;  1QIL A;  5EE0 A;  4XWW A;  1T3Q A;  1VLB A;  3DWG C;  3BVZ A;  1YMH E;  3ZYY X;  1QQR A;  4NJC A;  4M0W A;  4ARC A;  1TY0 A;  3P63 A;  1ZXH A;  1IUE A;  2IGH A;  3AEC B;  5BMI A;  5JXV A;  1MHH E;  3SEB A;  1MHX A;  5E6J A;  3KLS X;  2OED A;  2WXL A;  4C80 A;  1IBX A;  3ZJT A;  3AE6 B;  4DXF A;  2CU3 A;  3HUI A;  3ABV B;  1SBB B;  3ZGZ A;  1J7B A;  2ACZ B;  1L0X B;  5FKA C;  2PMV A;  1XCT L;  1F77 A;  2E3T A;  3ZJV A;  1L6U A;  4A6Q A;  2BW2 A;  1FRD A;  2WXH A;  3RPF C;  1N62 A;  2M56 B;  1XXG A;  1JWU D;  3KWV A;  1I4G A;  2K3U A;  3Q8C A;  3P1M A;  4FXC A;  2K5P A;  4KGR A;  1ZDX A;  4JPS A;  1SJE D;  2G9H D;  3U4E G;  1FNU A;  3DWM A;  1N60 A;  2BB5 A;  1F2R C;  4JWU C;  1LO5 D;  5T8I A;  4D2K A;  1WSP A;  5LNK 1;  2LHE A;  2DYM A;  2LUM A;  1DGJ A;  2N0S B;  5GXG B;  3W5U B;  1WYG A;  3I57 A;  1E0Z A;  3OWE B;  4OZB A;  1K50 A;  1Y56 A;  1TKG A;  1DOX A;  1RWS A;  4JE3 B;  4IKG A;  1D4B A;  5EE9 A;  1C78 A;  5G5H A;  1J7A A;  2INN E;  1C4C A;  2PVG C;  4C7Y A;  1GOZ A;  3AE3 B;  1MI0 A;  2BS2 B;  2LGI A;  4B0E A;  4B0M A;  2VZK D;  1ZPS A;  4XDC A;  4RGN A;  1FNW A;  5C3J B;  2DYO A;  1SE4 A;  3MHZ A;  1KH0 A;  1FXA A;  1VR9 A;  3MC0 B;  1M4V A;  1FO4 A;  2MH7 A;  3PZ8 A;  2TSS A;  1L0V B;  2WQY B;  2D5G A;  1KLG D;  1OQR A;  4LTU A;  3VR9 B;  1EU4 A;  2QEJ C;  4TMA B;  4XE0 A;  1K53 A;  2XN9 C;  1QOA A;  1KF6 B;  1QOG A;  1AN8 A;  2HDE A;  1E10 A;  1C76 A;  2K9X A;  1HEZ E;  2K0P A;  3Q8E A;  3U7Z A;  4WH4 A;  1L4D B;  3R2I A;  1FD6 A;  4ZOH C;  3SFE B;  4AS1 A;  1TS2 A;  3CIR B;  2FUG 1;  1YN3 A;  3P4Q B;  1XO3 A;  5HI1 A;  2ICI A;  4A9A A;  3AH7 A;  1E9M A;  2IJ0 A;  2WXI A;  1PFD A;  2PLP A;  2FBW B;  2KWD A;  3TEY A;  4YT0 B;  2WDQ B;  1ENF A;  2LFI A;  2IGD A;  5G5G A;  2PW9 A;  2H89 B;  2ZW1 A;  2JSV X;  1QLB B;  4MH8 A;  1VJK A;  1TJE A;  3PZ7 A;  2V3N A;  2Y5P A;  2AX5 A;  1JRO A;  2J4X A;  4ITK A;  3EGR A;  2JYT A;  2BB6 A;  1QOF A;  2DBY A;  1SE3 A;  2JYE A;  3B2F A;  2QMT A;  3FIL B;  1NYR A;  1IGC A;  3VQI A;  2WS3 B;  1ET9 A;  2J52 A;  1TS4 A;  4US9 A;  1FIQ A;  1N61 A;  3KWL A;  2I2Y A;  3P42 A;  1STE A;  1RYJ A;  4HEA 1;  2JQR B;  1NEK B;  3MFG A;  3FAH A;  3NUH B;  2WNM A;  4P16 A;  1QOB A;  1UGJ A;  3AEA B;  1XCQ L;  3H8H A;  3P4R B;  4A8X C;  1WWT A;  2WLB A;  4WIP A;  2GI9 A;  1T5X D;  3AE2 B;  2PVO D;  3BYT B;  1B1Z A;  4YSY B;  3UI3 A;  1D6E C;  2JU6 X;  1TKE A;  3TEX A;  1FCC C;  4TQ1 A;  3AE8 B;  1UWX A;  3AV8 A;  4JX1 C;  3AE7 B;  4RNA A;  4HKZ E;  2L1A A;  2WP9 B;  1WXQ A;  1DYQ A;  2EEL A;  3TEW A;  1JWS D;  2LHD A;  5MPO A;  2PKO A;  1PDX A;  5D3D A;  1I4R A;  1SIJ A;  5H8Y E;  2W54 A;  2WXO A;  1E7P B;  2ZW0 A;  2CJO A;  3VRA B;  1BML C;  3ZQ4 A;  1F0Z A;  2JZP A;  4Q2J A;  3SR6 A;  1GB4 A;  2DLB A;  2RDG A;  1RFK A;  4KKJ A;  4ZHP A;  2RMM A;  4XWT A;  2ONQ A;  3AE1 B;  4J3O D;  2H88 B;  2BT6 A;  1XLO A;  4ZHO A;  1YNT E;  1K52 A;  1P7E A;  1V1O A;  2AQ1 B;  2WDV B;  4RF0 A;  1IBX B;  3AEG B;  4OHJ A;  1TYG B;  5BMG A;  3AE9 B;  1JRP A;  1HXY D;  2YEP B;  1QKZ A;  2RDH A;  1PGA A;  2INP E;  2WDR B;  4N6E B;  4A55 A;  4P6V F;  5EE3 A;  3P4P B;  3AMZ A;  3BVG A;  2WXR A;  1SE2 A;  5H92 C;  3AED B;  2MEK A;  2R61 A;  4RFB A;  2KAC A;  3LB8 C;  1XEE A;  4DQO C;  1VZ8 A;  3NRZ A;  1I4H A;  1EM7 A;  4MT5 A;  4L1B A;  1L4Z B;  4ARI A;  1ACC A;  3BWU D;  4KGS A;  1PGB A;  1HZ6 A;  2LMC A;  1PUT A;  1ZUD 2;  4A90 A;  2MJE A;  1VZ7 A;  4L23 A;  1KLU D;  3Q8A A;  1FEH A;  1JWM D;  4GLS C;  1R7S A;  1C4P A;  1PGX A;  2M19 A;  3NVY A;  2QJL A;  5D3I B;  2BBC A;  1NVI D;  2PTL A;  1TS3 A;  3E9S A;  2W55 A;  1EU3 A;  2WU2 B;  2J53 A;  1FRR A;  1UWM A;  1FMA D;  3R2T A;  2SAK A;  4ZRP A;  1C9F A;  2XNA C;  1FNV A;  2WXJ A;  2V4I B;  3URY A;  1BXT A;  3U52 E;  4KX6 B;  4RGO S;  1UNS A;  1ZXI A;  2W3S A;  4NAM A;  1UUP A;  2HTM E;  2FE8 A;  3R8B A;  3AEF B;  1SJH D;  4WUR A;  4RCO A;  1CQV A;  5I4D A;  3BZD B;  3NVZ A;  1TS5 A;  2DWQ A;  3BVM A;  1CJE A;  1KRH A;  4WAF A;  5FR3 A;  2PIA A;  4YTM B;  4KKI A;  1D5M C;  5HHD G;  1TZO A;  1V1P A;  4L2Y A;  2WU5 B;  1SXT A;  4JWS C;  3IAM 1;  3W2D A;  3L4P A;  1XLQ A;  2KDM A;  3AM9 A;  2L83 A;  2J42 A;  3NZ3 A;  4ZRQ A;  1A70 A;  1JWB D;  1L5P A;  2E6X A;  1K51 A;  2OHF A;  3V3X A;  4YSZ B;  2QIE B;  1YJJ A;  4OVZ A;  1JQ4 A;  1ESF A;  1NI3 A;  1AWD A;  1SEB D;  1D5X C;  2L52 A;  2W82 A;  5C2T B;  3N9Y C;  2AQ3 B;  4RGM A;  3AB5 A;  1HZ5 A;  2NMQ A;  4US8 A;  1TKY A;  3VRB B;  3GS2 A;  1FFU A;  2GB1 A;  2M0A A;  1OFF A;  3SFD B;  1N63 A;  3T3N A;  2VZK B;  4YWG G;  1B9R A;  2LJI A;  4C7Z A;  2GRI A;  2Y5C A;  2KMM A;  2WXQ A;  3C8Y A;  3AN1 A;  4RGT A;  3RFZ B;  1SSN A;  2MJD A;  5TSS A;  2JXT A;  2Y3A A;  2BS4 B;  3FIL A;  5HG2 A;  3E56 A;  3HRD D;  2LEK A;  3HVD A;  2WXP A;  1JW9 D;  1L0Y B;  3B9J A;  4NAW B;  4TQ0 A;  4HKQ A;  1KTK A;  4MAC A;  4KGT A;  2K22 A;  2NTS A;  4N59 A;  1T6B X;  4RH6 A;  3MJ5 A;  2IPK D;  4EE2 A;  3CWI A;  4DXG A;  1GAQ B;  2QSD A;  1EWC A;  1GPX A;  3TEZ A;  2KN4 A;  5BYS A;  5HFY A;  1C79 A;  1E6E B;  1DOI A;  4PT5 A;  1ZDV A;  2RPV A;  1TY2 A;  2WXN A;  4O1N A;  1JML A;  2Q5W D;  1Q10 A;  1ZOY B;  1I4X A;  2AQ2 B;  4UDU C;  1VRA B;  2NTT A;  3PO0 A;  2KQ4 X;  1XF5 L;  1SF0 A;  4CQN A;  1CK1 A;  3Q69 A;  1ROE A;  3BYY B;  3V05 A;  2CJN A;  2G1E A;  3IT4 B;  1P7F A;  1NYQ A;  4HRS A;  4OW0 A;  3MP9 A;  1I4Q A;  2EKI A;  1VDV A;  3EA6 A;  4IOI E;  4AQ7 A;  4GDK B;  4H2A A;  4R3D A;  3W9C B;  4WQM A;  1VZ6 A;  1CZP A;  2BS3 B;  1QT9 A;  5AUK A;  3LXF A;  2WXK A;  1N5X A;  3U2S C;  3I9V 1;  2WXF A;  2N9L A;  2MJ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...