1JQ4A

[2fe-2s] domain of methane monooxygenase reductase from methylococcus capsulatus (bath)
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
98
structure length
98
Chain Sequence
MQRVHTITAVTEDGESLRFECRSDEDVITAALRQNIFLMSSCREGGCATCKALCSEGDYDLKGCSVQALPPEEEEEGLVLLCRTYPKTDLEIELPYTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR structure of the [2Fe-2S] ferredoxin domain from soluble methane monooxygenase reductase and interaction with its hydroxylase.
pubmed doi rcsb
source organism Methylococcus capsulatus str. bath
molecule tags Oxidoreductase
molecule keywords METHANE MONOOXYGENASE COMPONENT C
total genus 9
structure length 98
sequence length 98
ec nomenclature ec 1.14.13.25: Methane monooxygenase (soluble).
pdb deposition date 2001-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1jq4A00
2KMMA 4WWMA 3SFDB 2BS2B 3B2FA 3P4SB 1XLNA 4YTNB 3VR8B 4JX1C 1ROEA 1L6VA 1N5XA 3NVYA 3AE4B 3AE3B 1NYQA 1L6UA 3AEGB 3KWLA 3VR9B 3AECB 5G5HA 3L4PA 1JRPA 2BT6A 3AE1B 3FC4A 1VDVA 2FBWB 3NRZA 5AUIA 2PVGC 1JW9D 2PIAA 3W9CB 4A9AA 4YSXB 3W5UB 3ZYYX 3SFEB 2M19A 1N5WA 1RWSA 1E0ZA 2LEKA 2WDQB 3CWIA 4YSYB 1XLOA 5EE1A 4C7YA 1A70A 3AE5B 1KF6B 3NVVA 1FXIA 4HROA 5C2TB 1L0VB 1NYRA 2WLBA 4C7ZA 2K5PA 2W3RA 1TKGA 1QOFA 2EKIA 1ZXIA 2OHFA 2WU2B 3AEEB 1QT9A 4JWUC 4JWSC 4N6EB 1FRDA 2W54A 1FIQA 1JROA 4US8A 5H8YE 1N60A 1QOAA 4P6VF 3AE7B 3AEDB 3ETRA 1NEKB 1VLBA 1SB3C 3AE6B 1YQ3B 1NI3A 5AUKA 1QOBA 5C3JB 2WU5B 4N58A 3NVWA 1B9RA 1E10A 1PFDA 2WQYB 1JALA 1TKYA 2E3TA 2H88B 1OQRA 1ZP0B 1FM0D 2DWQA 1E9MA 1RFKA 2MH7A 3CIRB 4YTPB 3RPFC 3B9JA 2L52A 1QF6A 1R7SA 2PKOA 1QOGA 1FFUA 1KRHA 1IUEA 1KFYB 3P63A 3DWGC 1L5PA 3LB8C 5EE0A 1WGKA 4ZHPA 1YJIA 2W3SA 4ZOHC 3HVZA 3NVZA 5EE3A 2WS3B 1J7AA 1DOIA 3W5VB 4YXDB 1E6EB 1GPXA 3ABVB 5G5GA 2AX5A 2Q5WD 3AEFB 3AMZA 2MJDA 3VRBB 4C80A 1J7CA 3AE8B 2L83A 1NVID 1WWTA 4HRSA 5EE9A 2WDVB 1QLBB 2BS3B 2K22A 1CZPA 3DWMA 3LXFA 2K9XA 3P1MA 4YSZB 1DOYA 3AN1A 3SR6A 1RM6C 4USAA 2WP9B 3AH7A 1T3QA 1V97A 4YTMB 2H89B 5H92C 2CU3A 1AYFA 2CJOA 4LTUA 1CJEA 3FAHA 1F0ZA 3VRAB 1YJJA 2MJ3A 2N0SB 2BS4B 3P4PB 1J7BA 1OQQA 2HTME 3AE9B 1DGJA 2M56B 1JQ4A 1WXQA 1N62A 2DBYA 2MJEA 2PVOD 1WRIA 1XLPA 2B76B 1PUTA 1XLQA 3B2GA 4YT0B 1PDXA 3AE2B 5MPOA 1E7PB 3BIID 1TYGB 2JQRB 3P4RB 3AEAB 1DOXA 3EUB2 3NS1A 1V8CA 3P4QB 1SF0A 2QIEB 4WQMA 4FXCA 1NENB 3AM9A 1UWMA 3HUIA 2KAJA 1ZOYB 1SIJA 1YQ4B 3AV8A 4N59A 2ACZB 2G1EA 1N63A 3AEBB 4ZHOA 2CJNA 4US9A 1JWBD 3WCQA 1FO4A 4KX6B 1I7HA 1JWAD 1OFFA 2QJLA 2WDRB 5GXGB 1AWDA 1VJKA 1XO3A 1FFVA 1WYGA 1FMAD 1EWYC 2Y5CA 3HRDD 3PO0A 4IDIA 4ITKA 2JX5A 1FRRA 3AB5A 2W55A 1ZUD2 1FXAA 1RYJA 1GAQB 1TJEA 1N61A 1TKEA
chains in the Genus database with same CATH superfamily
3W1SA 4J3OD 4FJVB 1NDDA 4C4VB 2KC2A 2INDC 2JSVX 1AARA 1ZPSA 2KTFA 2N9PC 4OW0A 3AU4A 2MBBB 4HDOA 3T9LA 3ZYYX 2V9HA 1RWSA 3URYA 5J18A 4HK2A 2XN9C 4MM3B 5EE1A 3RUIB 3A4SC 1V80A 2J7QB 4AJYB 4C7ZA 2OHFA 2KDIA 4JWUC 2CU1A 3J9CA 3PLUA 3ZIMA 2KN4A 4OVVA 2QC8A 3E56A 1SE4A 1L4DB 2WXJA 3VQIA 2DZJA 1RFKA 3NUHB 4HWIB 1D4BA 5JHBA 3RNEC 4NY0A 3Q3MC 2XNAC 3QQ8B 3QARA 3ABVB 3AE8B 2WNMA 2WDVB 2L32A 4X57B 2WP9B 2V4IB 1V2YA 3KUDB 5H92C 1HA5A 2BS4B 2INCC 1UF0A 2M56B 1SJHD 2MJEA 4RCOA 4WWNA 2JF5A 4ANXA 4MELA 3EGRA 3T3OA 5DPTA 5MPOA 1Q10A 1VZ7A 1L7YA 1YD8U 1XT9B 4FXCA 4W9JA 4NZLB 3HUIA 2X38A 2LRUA 4FBJB 2BYTA 3PHWB 1KJTA 4BBNC 1WYGA 2PMVA 4K81A 2N1WA 1TJEA 2ASQA 2FAZA 3N1ZC 1T0QC 4A20A 3P4SB 3H6NA 3KWVA 4JX1C 1PQSA 2O6VD 3PGEA 4KSKC 4GN1A 2BT6A 3M3JA 3ZKJC 2BWFA 4FADA 3ECIA 1BT0A 2FE8A 3P2BA 4BKTA 4CHKA 4FJYA 4L2YA 2W3RA 1FRDA 1TIFA 3DBRI 2FIFA 2BQQA 3JW0X 1OQRA 1QF6A 3RPFC 3RZWC 1CMXB 3A9JB 3FILA 2LD9A 1VRAB 2AX5A 2MJDA 1WF9A 1KH0A 4WQOB 3UF8A 2QMTA 3AU5A 3L54A 2WXPA 1F0ZA 2LJIA 2PJHA 2QCZA 1MPEA 3X0WA 2CHXA 4LNNA 2L3ZA 1J7BA 1H4RA 2E6XA 3BK1A 2FCMA 2RR9A 2ZNVC 4ZRJA 2M0AA 4M00A 3TUOA 4E3CA 3HVDA 1YX6B 3ML9A 2PTLA 1TTNA 2NBWB 4KZ0A 4JE3B 2GB1A 2G9HD 3KYDD 3DVGX 2CJNA 1BXTA 2IZVB 1I7HA 5CTRC 2VH1A 1AWDA 1XO3A 3PO0A 1FFVA 4IDIA 4C56C 4NJCA 2PEAA 3BZDB 3DPDA 4EZLA 3ZNHB 4YTNB 5CHFA 2I2YA 2L0TA 1ROEA 1L6VA 3AECB 2PLPA 5E6JA 3NG0A 5AUIA 3P42A 3A1QB 4JPSA 1N5WA 3L16A 4NQLB 3WANA 3CWIA 4B0MA 4BAXA 3NVVA 2MQJA 4E71A 1E7UA 1TT5B 3ALBA 3AEEB 2WU2B 1QOFA 4L1BA 2KMCA 1HXYD 2G4SA 3ZXVA 3OJ4B 3OWEB 1TBEA 3ZNGC 2LVQA 2NTSA 2OJRA 2ZNVB 3KLSX 1ZGUB 2LI5A 3R7QA 3U4EG 1ZP0B 2DWQA 1E9MA 3PVLA 2V3SA 3B9JA 1MHHE 4GLSC 4LNKA 4ZHPA 3HVZA 3DBRB 5BYQA 1UBQA 1GNUA 2FCNA 3RD2A 4GGQA 3PREA 1GOZA 3N9YC 4KGSA 5EE9A 1WGDA 3AXCA 1EF5A 4CQNA 2D07B 1V97A 4IUMB 1L0YB 4IM2A 1AYFA 3CSFA 3GOEA 3VRAB 3Q14C 3N1YC 4D2KA 3AE9B 2K25A 2V0GA 5JXVA 4C00A 3V05A 1XLPA 2MLBA 4WWOA 3T8MA 3K9PB 2JQRB 2PE6B 4KVGB 3NS1A 4WH4A 3SDLC 1TS5A 2RDBC 3GS2A 2K0PA 2KAJA 2KFJA 2LUMA 4L23A 2K3UA 1D3ZA 1N63A 1PYWD 3GE3C 3KH0A 4ZRQA 3DOWA 2QEJC 2GLSA 4IG7B 2BYVE 2IY0B 4AJWA 4GB9A 1LM8B 4ACFA 2KHWB 2LZ6A 1NYQA 3FC4A 2FBWB 3ZDMC 1OEYA 5IKCM 4TQ0A 3NOBA 2I1JA 1E0ZA 2ON8A 1WM3A 3GZNI 2KYWA 3BVMA 4OZBA 1QT9A 3PS6A 5JH5C 1ZE3D 4MGYE 4RGOS 3DHHC 3SHQA 1C4CA 2KTRB 5DPWA 1JMLA 3PZ7A 1SB3C 4RGMA 1I4RA 4I6LB 3R2TA 4AQ7A 2H88B 2YEPB 1IPGA 3JYUA 4HCPB 2FUG1 1SE2A 5TR5A 2KK8A 2HJ8A 1CQVA 1SE9A 5DCNA 2MSED 1GPXA 1YN4A 4KGTA 2WXRA 2Z0EB 3BWUD 3BVZA 4YSZB 1LFDA 2LVPA 2FUHB 3LJ3A 4DWFA 2WXFA 3HM3A 3FILB 1WE6A 1IYFA 1YIWA 3UQBA 2OEDA 2DBYA 2HJ1A 2KWDA 4R3DA 1TYGB 4I6NB 3EUB2 4XDDA 4WQMA 2OOBB 3HIZA 4LJPB 4MT5A 2GMIC 4US9A 4KX6B 1OFFA 1JWAD 3HRDD 4ZRKA 3NZ3A 4I6PA 2JX5A 4TUUA 2CHZA 3LYYA 4OVZA 2O2VB 3MJWA 3VUYA 4GDLB 3BVGA 2O6VA 2GI9A 1E8WA 1UELA 3AE1B 3NRZA 3MFGA 3W5UB 1HE8A 2M8SA 1I4QA 2I38A 3KQ4A 1K51A 4LCDE 5L83A 1NYRA 3U7DA 1TKGA 4BVUC 5CHWA 1DYQA 4KKJA 3GE8C 4IC7B 2IGHA 2D3BA 3OG5A 4ZRIA 3NVWA 3Q8FA 2IO3B 2WQYB 3KUCB 4DDID 4W9FA 4HPLB 2JU6X 2L05A 2L52A 1C3TA 1UBIA 2KKCA 3LB8C 4IM3A 3Q8BA 4ZOHC 4FULA 1MG4A 3C19A 3L0WB 3H9DA 5C23A 4IWPA 2MHJA 1WRDB 2BYFA 1WJ6A 2K22A 4NNJB 3MHSD 1L2NA 3SR6A 4URKA 4USAA 3DCGA 2O6VB 1QZEA 1CJEA 3SU8X 4F1SA 1KTKA 2INPE 4LNFA 4GU2A 1JQ4A 3VDZA 1P98A 2K6QA 4FHJA 5J2RA 2KD0A 1E7PB 2AQ1B 1QQRA 2X8XX 3AEAB 2RPQA 3P4QB 2CHWA 3DVNU 1K50A 4XYCA 4WJPA 3H1UA 2KVZA 3Q2AC 1SGHA 3PZ8A 2KQSA 1XF5L 4HXDA 3NJTA 1D5MC 1J19A 2FCQA 4P16A 1FXAA 1P7EA 3I63C 1TKEA 1WFYA 4LTUA 2BTEA 2KMAA 1WR1A 1PGAA 3VTUA 1T0YA 1KLVA 4MGKE 2OJWA 2D11A 4WAFA 1WX9A 5JZEB 2AEHA 4TMAB 2SAKA 3ZRFA 4DBGA 2IJ0A 2KQ4X 3W9CB 3ZO5B 2KTRA 4HKQA 3BK2A 3ML8A 1WMHB 3ZTCA 2BB6A 3IT4B 2KJ6A 1UGJA 1WJNA 2JXXA 2WYQA 4GDKB 4HEA1 2L1AA 5C3JB 2NMQA 4N58A 1HEZE 1JALA 2E3TA 1FM0D 2PKOA 1D5ZC 4CYEA 4K3BA 3ZDTA 4IM0A 2ZPYA 2WXMA 3SEBA 1M94A 3W5VB 2L8JA 3L17A 4XWWA 2DX5B 4DQOC 4G3XB 1XEEA 2IO0B 4GXBA 1QLBB 3R8BA 1CZPA 1RM6C 1T3QA 2K6DB 2Z0DB 1YN3A 4K7WA 1C4PA 5CX3A 2MP2B 2RPVA 3MC8A 5FK9C 3UIPB 2KLCA 4A3OA 1EWCA 1XLQA 1TZOA 2ZZPB 3O65B 2DYOA 1FPYA 3W1YA 3L10B 4TQ1A 2KDBA 1WXSA 4RMAA 1KOTA 3AV8A 4DDGD 1XCTL 1HZ6A 2V4LA 3Q8EA 2JWUA 4RFBA 2K39A 1T0RC 3TBLD 2EELA 2RSUA 2LMCA 4GIVA 3QJZA 4NJ6A 4WJNA 2HD5B 5IA7A 2KMMA 4LLGM 5D94A 4BFRA 2N9EB 3RULA 3N1XC 4A8XC 3I57A 3V60A 4UDUC 1TGZB 1MFWA 1V6EA 1WH3A 3ZRCA 2KFKB 4PYUA 4OHJA 3ZNID 2C9WB 4RF1A 1R4NB 1WXMA 2LEKA 2KACA 4HROA 2ZVNA 4FJZA 3ZJTA 3QHTA 4KIKB 2NBVB 4Q2JA 1QOAA 1YMHE 4P6VF 4H2AA 2IO2B 1VLBA 1GC6A 2WGSA 2W9NA 2MH7A 2VZKB 2PW9A 4YTPB 1QOGA 2DAJA 1QILA 3JSVB 4ZYNA 1IUEA 1SSNA 1R4NI 1WYWB 2D2QA 2GRIA 1SEBD 4W9IA 5AEKB 1NBFC 1FCLA 3VRBB 1SIFA 2ZVOA 3APFA 5BMIA 1E8ZA 2NPTA 3P1MA 2K9XA 4EOYA 1PGBA 3AN1A 1C9FA 3TMPB 3KYCD 1F52A 3IG3A 1K52A 2J53A 1YOVB 1WXQA 2KXJA 5KHQA 2LGYA 4MH0E 4II3B 1PDXA 3ZGZA 2Y5BB 3CMMB 3I5JC 1WX8A 1WXVA 4ANVA 1ZOYB 2BB5A 2M4NA 2ACZB 4P1BC 1S1QB 3VXWA 2KLGA 1MG8A 3OLMD 1WXAA 4LK0M 1VZ6A 2KDEB 3X23A 3T3NA 1XLNA 3NVYA 5HFYA 4FLHA 4DHJD 3VTVA 2LWPA 3L08A 4KDLB 2KVRA 4YSXB 4XDCA 5BYRA 4N9F4 3M95A 3SFEB 1P7FA 2K8BA 2N4FA 2PE9A 2KN5A 3EFCA 3M62B 2DLBA 1FXIA 3IFWB 3ZNZB 2EKIA 1V81A 1ZXIA 2XBBC 3A9JA 5BMGA 3U8ZA 1KLUD 3BYTB 1IBXB 1SBBB 3AE7B 3ETRA 4NAWB 2TSSA 2DNFA 2NBUA 1WGGA 5AZFA 4J6IA 1UH6A 3TCAA 3U2SC 4W9LA 3CIRB 2MBEA 1V9JA 1R7SA 1KRHA 1KFYB 3ZTDA 3DHGC 4BBNF 5E6NA 2L00B 1Q0WB 4TV3A 2L83A 1NVID 2BBCA 3CSTA 1I42A 1M4VA 2BS3B 1F77A 2JUOA 1TS4A 2LGIA 3U30A 1YJ1A 3RNGC 2NCNA 1UGMA 3M63B 5D7GA 2KWVB 1WRIA 4IWQA 4YT0B 1ESFA 2WXQA 3TIXA 2JRIB 1SF0A 5D2MB 3ZUNA 1C76A 2MX2A 1G6JA 1V5OA 2DAFA 3RFZB 4E74A 2LRWA 4ITKA 2GBJA 1FMAD 2KJRA 1FRRA 2W55A 2ZPNA 4WWMA 2O2VA 4K1RB 4C4VA 1TS3A 1WGRA 2DYMA 4HKZE 5G55A 3MP9A 3B0AA 2IGDA 1SE3A 2LVOA 4MGZE 1F2RI 3PRMB 1XLOA 1KF6B 2D10A 4ZDVA 2WXLA 5C2TB 4WAAA 1TY2A 2K5PA 2W82A 3R3MA 2L76A 2MBQA 2WXGA 4HVBA 3LDZE 1FCCC 3QC8B 2MA9B 1TS2A 4KDIC 4NAMA 2RD0A 4ZYSA 2KX0A 5KHOA 4DXFA 4ARIA 1B9RA 1H8CA 4TKNA 2G45B 1R4MB 3W1SC 1GB1A 3DVGY 4LDTB 3BY4B 2KOXA 1JWMD 5EE0A 2KJHB 4K7UA 1WZ3A 4YXDB 4DHJB 3HK0A 3VVWB 3NZSA 3UGBB 2AQ2B 3DWMA 3WAOA 3TEXA 2LJ5A 2H89B 4M8NA 2N0SB 3P4PB 1RFAA 2ONQA 1EU4A 4LDTD 2C5LC 2GBKA 2EKEC 1PUTA 3UQAA 3AE2B 2MBHA 3HM6X 3IHPC 2M0XA 3N30A 1SJED 2JXTA 1UWMA 3PSEB 5TSSA 3EHVA 4N59A 1YNTE 3C0RB 3AEBB 1FO4A 2JY6A 1ENFA 5FR6A 4BOZB 3WA0A 2V1YA 1GAQB 1L0VB 4G11A 3VH3B 3TSSA 5HHDG 3IVFA 3ZLZA 1GC7A 4KIKA 1ZDVA 1EF1A 1YX5B 4ANUA 2DZIA 3AEGB 3MTNB 1EM7A 2XEWA 2ZEQA 1T6BX 2BF8B 4RNAA 1K53A 4C7YA 2JZPA 2V3NA 1WI0A 3I3TB 2A4ZA 1UZXB 4JWSC 4FN2A 4HPPA 3RNCC 4MJSB 2QSDA 1ET6A 3QX1A 1B1ZA 2WU5B 1MVKA 4S17A 2D3AA 1WGHA 3ZVVA 3VFKA 1V49A 1WE7A 4XC2A 2RGFA 2I1KA 1ZDXA 2WXNA 5G2NA 2KANA 2D3GA 1V1PA 2IGGA 2VH2A 1N6ZA 5LXIB 2EMSA 4CO7A 2W3SA 1E90A 1J7AA 2CKHB 5E6OA 1WIAA 1ZW7A 3A1QA 4MGIE 3PRZA 3EECA 1DOYA 3O13A 2NR2A 3A9KA 2CU3A 2CJOA 3FAHA 3IT6B 2MP2A 3U7ZA 3DHIC 3PV1A 5IAAC 3SD5A 3BIID 5GMVA 1J0GA 2LFIA 3P4RB 5HI1A 1WMHA 4BOSC 2KDFB 2HDEA 2YEPF 1SXTA 2J0KA 1SIJA 2L7RA 2GBMA 4ICUA 2YLMA 2C60A 2AL6A 3MC9A 5GXGB 1E5WA 1C4AA 1I4PA 4EUTA 1C1YB 1D5XC 4M0WA 1K8RB 1HZ5A 4BZAA 1P3QU 1N61A 2LHEA 1FNVA 1I4XA 4KKIA 1OEYJ 3PRPB 2MW5A 2HTHA 5G5HA 1JRPA 2JYTA 4HJGE 3TEZA 1JW9D 4A9AA 3Q6BA 1GB4A 2LGXA 1A70A 1P0RA 1RAXA 4F8CB 2WLBA 2NTTA 3EA6A 5AZHA 4HCNB 2MRPA 5H8YE 3PT2B 3AEDB 4IW0A 1NEKB 1YQ3B 4S0RA 1QOBA 1A5RA 3Q3NC 1S3SG 1HTOA 3NZUA 4JQWC 1LQBA 3VHTC 1FFUA 5HKHA 4BKSA 2Y3AA 3RI7C 3MC0B 2ZCBA 1FEHA 5EE3A 5G5GA 1Y56A 2VRRB 5IP4D 1WWTA 4M0WB 1VZ8A 5BO4B 3I9V1 1HQRD 4B0EA 2NS5A 4RGTA 3V61A 4RM9A 2HTME 1DGJA 3BYYB 4FHKA 5LLIA 4RGNA 3RMKC 2PVOD 3R66C 2FIDA 4ZRPA 1UNSA 1EO6A 4BKGA 3A9KB 4M02A 4PS8A 3GB1A 4AWJA 2UWQA 2MEKA 4WJQA 1MI0A 4PS7A 2Y5CA 1L4ZB 5I4DA 2N7EA 3SFDB 3DQVA 2IYDB 1IP9A 3D32A 4A90A 2CS4A 3HHMA 4NJ7A 3U52E 4GSWA 1N5XA 1CK1A 4M8MA 1L6UA 3KWLA 2G3QB 3RNAC 4B95A 1MJDA 2BGFA 2ICIA 2YVCA 2RDGA 4HJKA 3B08A 3ZW3A 3ZXRA 2IPKD 2W54A 1FIQA 1NI2A 1JROA 2PPHA 5T8IA 2INNE 1N60A 1D6EC 2Z8LA 2BW2A 1IBXA 5CHVC 4PS3A 3V6EB 2WDTB 1TKYA 1GUAB 5E6PA 2DYBA 2ZW1A 1ZXHA 2L0FA 1EUVB 2M1MA 2A5UA 1DOIA 2D3CA 3TJPA 4F7ZA 4KSLC 3DDCB 2K8CA 3CF6E 3OAWA 1J7CA 2MWSB 4YL8A 1RRBA 3RT3B 3LXFA 4MM3A 2IBIB 2WXHA 1E7VA 4GOCA 2BKRB 3OJ3A 2JPHA 3JSVA 5DPRA 4W9GA 2V3PA 3C8YA 4XE0A 4DK5A 2KWUB 5HG2A 1V86A 4TSSA 4XX5A 1PGXA 3B2GA 2C7HA 4EFOA 1STEA 1E8YA 3DVNV 2JZ3B 2QILA 1V8CA 2JRHA 2NPTB 1NENB 2AQ3B 1I4GA 4OZAA 4LNOA 3E9SA 4NQKE 2J0MA 4KGRA 2BYEA 1YQ4B 2MBOA 2G1EA 3VAWA 3TEWA 3ZQ4A 2ZJDA 2GBNA 4JIOU 1UWXA 4NPNA 3UINB 3DBLB 4W9EA 3B2FA 4GDLA 1VR9A 3V6CB 4IWOA 3DBLI 3BINA 2EMTA 2WWZA 3AE3B 3DBSA 3Q3JA 1MHXA 3L4PA 1QKZA 1KM7A 1UD7A 1GJZA 3RCZA 1AW7A 2BKFA 3MHZA 4RF0A 4HLEA 1C79A 2FNJB 4N6EB 4YWGG 4US8A 1VCBA 3NHEB 1UUPA 1P9DU 4O1NA 2ZW0A 3H8HA 4AOFA 3PHXB 1ET9A 4MEMA 5DPSA 4DXAB 2AWTA 2JZZA 3V62A 3ZJUA 1YJIA 2J4XA 2WS3B 3RN9C 3QK0A 2K8HA 3NS8A 2Q5WD 3EFUA 1JCKB 2LGDA 3N3KB 4JLCA 4EE2A 4JL9A 5BMHA 2DZKA 4XGAB 2B76B 4ANWA 3UIOB 3FKYA 2BVCA 4OVUA 3L13A 5L95C 2N1VA 3VUXA 4EZKA 4MDKE 2NVUI 5LXHA 3Q3OC 4ZHOA 1T5XD 1BMLC 2QJLA 4LJOB 1VJKA 3KVFB 2KQ7A 1OTRB 3DBHI 1ZUD2 2D5GA 3Q3FA 2R61A 3R7RA 1LXDA 2N7JA 2DHZA 1U4AA 3PLVA 3Q8CA 4GMVA 1ISNA 2JT4B 1WM2A 4PYZA 3AE4B 5D3IB 2IDYA 3Q69A 1F2RC 3APDA 3WAPA 2RMMA 2J42A 3W2DA 4RH6A 2M19A 4JGHB 2WHIA 2RDHA 3H7SA 2WDQB 1R4MI 1TY0A 2C7MB 3PZDA 2UYZB 1XD3B 3DBHB 4MJSA 4B6WA 2WXIA 3VH4B 1FNWA 1C78A 4WURA 2AL3A 3A33B 5AUKA 1L0XB 1LGRA 3UI3A 4G50A 3RNFC 4DHZE 4ICVA 2CR5A 4W9KA 2WXKA 3QCAA 1WJ4A 3P63A 2Y5PA 1L5PA 2DZMA 1X1MA 1EU3A 3IXSA 4WJOA 3PTFC 3GZNB 1YQBA 3WAMA 1E6EB 1WY8A 4AUQC 2IY1B 4C80A 1IGCA 2N9KA 3AH7A 3R2IA 4P1CC 4A3PA 4PT5A 2N7DA 5FKAC 1V5TA 1GG3A 2WX0A 2KDMA 1V1OA 1N62A 1KLGD 4W9DA 1F1HA 2LHDA 4MH8A 1DOXA 2B3AA 3QIJA 3MJ5A 4W9CA 4P7IA 3AM9A 5IO9A 3ONSA 2LASA 4WIPA 2R2OA 4QAYA 1JWBD 3WCQA 5BYSA 2ZCCA 2BS2B 4IKGA 1I35A 1RLFA 1BUIC 4AP4C 3VR9B 4MACA 2KFKA 4M01A 3VUWA 1Y8RC 2PIAA 2PVGC 1XCQL 3RNBC 2REXA 2J52A 1WGYA 2UU7A 3AE5B 3QWZB 3K9OB 2LUEA 1WSPA 3WIMA 5J17A 2WXOA 3S2AA 4B9KA 1XQQA 2XK5B 2JWZA 2R2QA 1FD6A 3GP7A 1JWUD 5AZGA 3N20C 1NI3A 4KZCA 1PFDA 3ENEA 4G0NB 2WX1A 2JVCA 3IAS1 2QHOA 3IAM1 2N9LA 3RYTA 3RZFA 2GBRA 3WALA 1WGKA 2N9XA 3AULA 5D3DA 2KX3A 5IN7A 1WX7A 3QA8A 2LXAA 3AEFB 1T0SC 3AMZA 3NY5A 2MCNB 4HRSA 1Q1OA 4K3CA 1Q5WB 3N32A 2J0JA 5FR3A 4MSQB 1V1PB 1Z2MA 1Z5SB 1WR6E 1XXGA 3KW5B 5EDSA 4PK1A 2AYOB 2DENB 1FXTB 2M17A 4II2B 4HPMB 2QDFA 2JYEA 2HE7A 2KZRA 3B1LX 1WJUA 4FA6A 3H7PB 2WDRB 3H7PA 4EKUA 1EWYC 3AB5A 3PPAA 2IO1B 2Z59B 1RYJA 1P1AA 3AI5A 3JVZX 2KWCA 4WWPA 3VR8B 5C1ZA 1IGDA 1ACCA 2FCSA 2BPSA 4ARCA 2KC1A 3QAQA 1OQYA 1VDVA 4XZ4A 4GDKA 3EC8A 3TL5A 5JHAA 5IOIA 1I4HA 3A4RA 4YSYB 4EZJA 3IBEA 4DXGA 2G4DB 4W9HA 2C7NB 1FNUA 1HTQA 1JWSD 1ZKHA 2VZKD 4A6QA 4RM8A 3AE6B 4NAWA 1E10A 4DHZB 4K7SA 1TZ1A 4KV2A 3NVZA 4IOIE 2K1FA 2XK5A 4OZCA 2BWES 1AN8A 3ZJVA 4EEWA 4A55A 3TEYA 2GOWA 4XWTA 3V3XA 4YTMB 2LGSA 1WZ0A 1YJJA 2MJ3A 2LXCA 3Q8AA 1OQQA 2SEBD 4REZA 1E8XA 4MSMB 4LNIA 2QIEB 1J8CA 2KO3A 4AS1A 4ASWC 5D6JB 3VTWA 4HDQA 1C77A 2KT7A 1VD2A 1F9JA 5LNK1 1LO5D 4BKSD 1JRUA 1OGWA 2KNBA 3KUZA 1YN5A 3APCA 3DWGC
chains in the Genus database with same CATH topology
4WWMA 3W1SA 3B2FA 1VR9A 4J3OD 4GDLB 3BVGA 2GI9A 1TS3A 2DYMA 4HKZE 3AE3B 3MP9A 2JSVX 1MHXA 3L4PA 1QKZA 1ZPSA 2IGDA 1SE3A 3AE1B 3NRZA 4OW0A 3MFGA 3W5UB 3ZYYX 1I4QA 2I38A 3KQ4A 1RWSA 1AW7A 3URYA 3MHZA 1K51A 1F2RI 2XN9C 4MM3B 1XLOA 5EE1A 4RF0A 1KF6B 2WXLA 5C2TB 1C79A 1NYRA 1TY2A 4C7ZA 2K5PA 2W82A 1TKGA 2OHFA 4N6EB 2WXGA 4YWGG 4JWUC 1FCCC 1DYQA 4KKJA 3J9CA 4US8A 1TS2A 2KN4A 4NAMA 2IGHA 3E56A 4ZYSA 1SE4A 1UUPA 4DXFA 3NVWA 4ARIA 1B9RA 3Q8FA 4O1NA 1L4DB 2WQYB 2WXJA 2ZW0A 3H8HA 3VQIA 1RFKA 1GB1A 2JU6X 2L52A 1ET9A 3NUHB 1D4BA 1JWMD 3LB8C 5EE0A 2XNAC 3Q8BA 3ZJUA 1YJIA 4ZOHC 2J4XA 2WS3B 4YXDB 3ABVB 2Q5WD 3AE8B 2WNMA 2AQ2B 1JCKB 2K22A 2WDVB 3DWMA 2L32A 3SR6A 3TEXA 4USAA 4EE2A 2WP9B 2V4IB 2H89B 5H92C 5BMHA 1CJEA 1KTKA 1HA5A 2N0SB 2BS4B 2ONQA 3P4PB 1EU4A 2INPE 1JQ4A 2M56B 1SJHD 2MJEA 4RCOA 2B76B 1PUTA 3AE2B 3EGRA 3T3OA 5MPOA 1Q10A 1E7PB 2AQ1B 1SJED 1QQRA 1VZ7A 3AEAB 3P4QB 2JXTA 4FXCA 1UWMA 4NZLB 3HUIA 1K50A 2X38A 5TSSA 4N59A 1YNTE 3AEBB 4ZHOA 1T5XD 3PZ8A 2BYTA 1XF5L 1BMLC 1FO4A 2QJLA 1ENFA 1VJKA 1WYGA 1D5MC 2PMVA 1ZUD2 2D5GA 1FXAA 2R61A 4P16A 1GAQB 1TJEA 1P7EA 1L0VB 1TKEA 4LTUA 2N7JA 2BTEA 3P4SB 3TSSA 5HHDG 1PGAA 3Q8CA 1ZDVA 3KWVA 4JX1C 3AE4B 4WAFA 5D3IB 2IDYA 3Q69A 3AEGB 1F2RC 1EM7A 4TMAB 2BT6A 2SAKA 2IJ0A 2KQ4X 3W9CB 2RMMA 2J42A 3W2DA 4RH6A 1T6BX 2FE8A 2M19A 4HKQA 4RNAA 2RDHA 2WDQB 1TY0A 1K53A 3BK2A 4C7YA 2JZPA 4L2YA 2BB6A 2V3NA 2W3RA 4JWSC 3IT4B 1FRDA 1IBXB 2WXIA 2QSDA 1FNWA 1C78A 1UGJA 1ET6A 4GDKB 4HEA1 2L1AA 1B1ZA 4WURA 5AUKA 5C3JB 2NMQA 2WU5B 4N58A 1MVKA 1HEZE 1L0XB 1JALA 2E3TA 1OQRA 3UI3A 1FM0D 1ZDXA 2WXNA 1QF6A 3RPFC 1V1PA 2IGGA 2PKOA 1D5ZC 2WXKA 3P63A 2Y5PA 3FILA 1L5PA 1EU3A 3IXSA 2WXMA 2W3SA 3SEBA 1J7AA 1VRAB 3W5VB 1E6EB 2AX5A 4C80A 2MJDA 4XWWA 4DQOC 1XEEA 1KH0A 1QLBB 3R8BA 1IGCA 1CZPA 2QMTA 3O13A 2N9KA 1DOYA 1RM6C 3AH7A 1T3QA 1YN3A 3R2IA 1C4PA 2WXPA 2CU3A 2CJOA 4PT5A 2LJIA 2RPVA 3FAHA 3IT6B 1F0ZA 1MPEA 5FKAC 3U7ZA 5FK9C 1J7BA 2E6XA 2KDMA 1V1OA 1N62A 3BK1A 1EWCA 1KLGD 1XLQA 1TZOA 2M0AA 2LHDA 3BIID 2DYOA 3TUOA 2LFIA 3P4RB 4MH8A 1DOXA 3MJ5A 5HI1A 3HVDA 2PTLA 3AM9A 2HDEA 4TQ1A 2YEPF 1SXTA 4JE3B 1SIJA 4WIPA 3AV8A 1XCTL 1HZ6A 2GB1A 2G9HD 3Q8EA 2CJNA 1BXTA 1JWBD 3WCQA 1I7HA 2JWUA 4RFBA 5BYSA 5GXGB 1AWDA 1XO3A 3PO0A 1FFVA 4IDIA 1C4AA 1I4PA 2EELA 4C56C 2LMCA 1D5XC 4NJCA 4M0WA 1HZ5A 3BZDB 1N61A 2LHEA 2KMMA 4LLGM 2BS2B 4IKGA 4YTNB 4A8XC 3I57A 2I2YA 1FNVA 1ROEA 1I4XA 1L6VA 4KKIA 4UDUC 1BUIC 3VR9B 3AECB 5G5HA 1JRPA 2JYTA 2PLPA 4MACA 5E6JA 5AUIA 4HJGE 3TEZA 2PVGC 1JW9D 2PIAA 3P42A 4OHJA 4A9AA 4JPSA 1GB4A 4RF1A 1N5WA 1XCQL 2J52A 2LEKA 3CWIA 4B0MA 2KACA 1A70A 3AE5B 3NVVA 4HROA 2WLBA 1WSPA 2NTTA 3ZJTA 3AEEB 2WU2B 1QOFA 3EA6A 4L1BA 2WXOA 4Q2JA 1HXYD 5H8YE 1QOAA 1YMHE 4P6VF 3AEDB 3OWEB 4H2AA 1FD6A 3GP7A 1JWUD 1NEKB 1VLBA 2NTSA 1YQ3B 1NI3A 1QOBA 3KLSX 1PFDA 3U4EG 1ZP0B 2DWQA 1E9MA 2MH7A 2VZKB 2PW9A 4YTPB 3IAS1 3B9JA 3IAM1 1MHHE 1QOGA 2N9LA 1FFUA 1QILA 4GLSC 1IUEA 1SSNA 2Y3AA 3MC0B 1WGKA 4ZHPA 1FEHA 3HVZA 5D3DA 2GRIA 1SEBD 5EE3A 5BYQA 5G5GA 1FCLA 3AEFB 3VRBB 1Y56A 3AMZA 1GOZA 3N9YC 4KGSA 1WWTA 4HRSA 5BMIA 5EE9A 3P1MA 2K9XA 1VZ8A 1PGBA 3AN1A 4CQNA 5FR3A 3I9V1 1V97A 1C9FA 1HQRD 1L0YB 1V1PB 4B0EA 1AYFA 1XXGA 3VRAB 4RGTA 4D2KA 1K52A 3AE9B 2HTME 1DGJA 2J53A 2V0GA 1WXQA 3BYYB 4RGNA 5JXVA 3V05A 2PVOD 1XLPA 1PDXA 3ZGZA 2JQRB 4ZRPA 1UNSA 4WH4A 3NS1A 1TS5A 3GS2A 2K0PA 2KAJA 1ZOYB 2JYEA 2BB5A 2LUMA 4L23A 2K3UA 2ACZB 3GB1A 1N63A 1PYWD 2MEKA 1MI0A 2WDRB 2Y5CA 1EWYC 4ZRQA 1L4ZB 3AB5A 2QEJC 4LK0M 5I4DA 1VZ6A 1RYJA 3SFDB 3T3NA 1XLNA 3VR8B 1IGDA 1ACCA 4A90A 3U52E 1N5XA 3NVYA 1CK1A 5HFYA 1NYQA 1L6UA 3KWLA 4ARCA 3FC4A 1VDVA 2FBWB 4YSXB 4XDCA 5BYRA 1I4HA 2ICIA 3SFEB 1P7FA 4TQ0A 1E0ZA 4YSYB 2ON8A 2RDGA 2DLBA 1FXIA 4DXGA 3BVMA 4OZBA 2EKIA 1ZXIA 1FNUA 1QT9A 5BMGA 2IPKD 2W54A 1FIQA 1ZE3D 1JROA 4RGOS 1KLUD 5T8IA 2INNE 1N60A 3BYTB 1D6EC 2Z8LA 1JWSD 1SBBB 1C4CA 3AE7B 2VZKD 1JMLA 2BW2A 3ETRA 4NAWB 4A6QA 2TSSA 3PZ7A 1SB3C 3AE6B 1IBXA 4RGMA 1E10A 1I4RA 3R2TA 1TKYA 4AQ7A 2H88B 2YEPB 3U2SC 3CIRB 1R7SA 1SE2A 2FUG1 1KRHA 1KFYB 2ZW1A 1CQVA 1ZXHA 3NVZA 4IOIE 1DOIA 4OZCA 1YN4A 1GPXA 1AN8A 4KGTA 3ZJVA 1J7CA 2WXRA 2L83A 1NVID 2BBCA 3BWUD 1M4VA 2BS3B 3BVZA 3LXFA 4YSZB 1F77A 4A55A 3TEYA 1TS4A 2LGIA 4XWTA 2WXHA 2WXFA 3FILB 3V3XA 4YTMB 2V3PA 1YJJA 3C8YA 2MJ3A 4XE0A 3Q8AA 1OQQA 2SEBD 5D7GA 2OEDA 2DBYA 5HG2A 4TSSA 1WRIA 1PGXA 3B2GA 4YT0B 2KWDA 4REZA 1STEA 4R3DA 1ESFA 1TYGB 2WXQA 2QILA 3EUB2 1V8CA 4XDDA 1SF0A 2QIEB 4WQMA 1C76A 1NENB 1I4GA 2AQ3B 4AS1A 4OZAA 3E9SA 4KGRA 4MT5A 1YQ4B 2G1EA 3RFZB 3TEWA 1C77A 4US9A 4KX6B 1OFFA 1JWAD 3ZQ4A 5LNK1 1LO5D 4ITKA 1FMAD 3HRDD 3NZ3A 1UWXA 2JX5A 1FRRA 2W55A 3LYYA 1YN5A 4OVZA 3DWGC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KMM A;  4WWM A;  3SFD B;  2BS2 B;  3B2F A;  3P4S B;  1XLN A;  4YTN B;  3VR8 B;  4JX1 C;  1ROE A;  1L6V A;  1N5X A;  3NVY A;  3AE4 B;  3AE3 B;  1NYQ A;  1L6U A;  3AEG B;  3KWL A;  3VR9 B;  3AEC B;  5G5H A;  3L4P A;  1JRP A;  2BT6 A;  3AE1 B;  3FC4 A;  1VDV A;  2FBW B;  3NRZ A;  5AUI A;  2PVG C;  1JW9 D;  2PIA A;  3W9C B;  4A9A A;  4YSX B;  3W5U B;  3ZYY X;  3SFE B;  2M19 A;  1N5W A;  1RWS A;  1E0Z A;  2LEK A;  2WDQ B;  3CWI A;  4YSY B;  1XLO A;  5EE1 A;  4C7Y A;  1A70 A;  3AE5 B;  1KF6 B;  3NVV A;  1FXI A;  4HRO A;  5C2T B;  1L0V B;  1NYR A;  2WLB A;  4C7Z A;  2K5P A;  2W3R A;  1TKG A;  1QOF A;  2EKI A;  1ZXI A;  2OHF A;  2WU2 B;  3AEE B;  1QT9 A;  4JWU C;  4JWS C;  4N6E B;  1FRD A;  2W54 A;  1FIQ A;  1JRO A;  4US8 A;  5H8Y E;  1N60 A;  1QOA A;  4P6V F;  3AE7 B;  3AED B;  3ETR A;  1NEK B;  1VLB A;  1SB3 C;  3AE6 B;  1YQ3 B;  1NI3 A;  5AUK A;  1QOB A;  5C3J B;  2WU5 B;  4N58 A;  3NVW A;  1B9R A;  1E10 A;  1PFD A;  2WQY B;  1JAL A;  1TKY A;  2E3T A;  2H88 B;  1OQR A;  1ZP0 B;  1FM0 D;  2DWQ A;  1E9M A;  1RFK A;  2MH7 A;  3CIR B;  4YTP B;  3RPF C;  3B9J A;  2L52 A;  1QF6 A;  1R7S A;  2PKO A;  1QOG A;  1FFU A;  1KRH A;  1IUE A;  1KFY B;  3P63 A;  3DWG C;  1L5P A;  3LB8 C;  5EE0 A;  1WGK A;  4ZHP A;  1YJI A;  2W3S A;  4ZOH C;  3HVZ A;  3NVZ A;  5EE3 A;  2WS3 B;  1J7A A;  1DOI A;  3W5V B;  4YXD B;  1E6E B;  1GPX A;  3ABV B;  5G5G A;  2AX5 A;  2Q5W D;  3AEF B;  3AMZ A;  2MJD A;  3VRB B;  4C80 A;  1J7C A;  3AE8 B;  2L83 A;  1NVI D;  1WWT A;  4HRS A;  5EE9 A;  2WDV B;  1QLB B;  2BS3 B;  2K22 A;  1CZP A;  3DWM A;  3LXF A;  2K9X A;  3P1M A;  4YSZ B;  1DOY A;  3AN1 A;  3SR6 A;  1RM6 C;  4USA A;  2WP9 B;  3AH7 A;  1T3Q A;  1V97 A;  4YTM B;  2H89 B;  5H92 C;  2CU3 A;  1AYF A;  2CJO A;  4LTU A;  1CJE A;  3FAH A;  1F0Z A;  3VRA B;  1YJJ A;  2MJ3 A;  2N0S B;  2BS4 B;  3P4P B;  1J7B A;  1OQQ A;  2HTM E;  3AE9 B;  1DGJ A;  2M56 B;  1JQ4 A;  1WXQ A;  1N62 A;  2DBY A;  2MJE A;  2PVO D;  1WRI A;  1XLP A;  2B76 B;  1PUT A;  1XLQ A;  3B2G A;  4YT0 B;  1PDX A;  3AE2 B;  5MPO A;  1E7P B;  3BII D;  1TYG B;  2JQR B;  3P4R B;  3AEA B;  1DOX A;  3EUB 2;  3NS1 A;  1V8C A;  3P4Q B;  1SF0 A;  2QIE B;  4WQM A;  4FXC A;  1NEN B;  3AM9 A;  1UWM A;  3HUI A;  2KAJ A;  1ZOY B;  1SIJ A;  1YQ4 B;  3AV8 A;  4N59 A;  2ACZ B;  2G1E A;  1N63 A;  3AEB B;  4ZHO A;  2CJN A;  4US9 A;  1JWB D;  3WCQ A;  1FO4 A;  4KX6 B;  1I7H A;  1JWA D;  1OFF A;  2QJL A;  2WDR B;  5GXG B;  1AWD A;  1VJK A;  1XO3 A;  1FFV A;  1WYG A;  1FMA D;  1EWY C;  2Y5C A;  3HRD D;  3PO0 A;  4IDI A;  4ITK A;  2JX5 A;  1FRR A;  3AB5 A;  2W55 A;  1ZUD 2;  1FXA A;  1RYJ A;  1GAQ B;  1TJE A;  1N61 A;  1TKE A; 
#chains in the Genus database with same CATH topology
 3W1S A;  4J3O D;  4FJV B;  1NDD A;  4C4V B;  2KC2 A;  2IND C;  2JSV X;  1AAR A;  1ZPS A;  2KTF A;  2N9P C;  4OW0 A;  3AU4 A;  2MBB B;  4HDO A;  3T9L A;  3ZYY X;  2V9H A;  1RWS A;  3URY A;  5J18 A;  4HK2 A;  2XN9 C;  4MM3 B;  5EE1 A;  3RUI B;  3A4S C;  1V80 A;  2J7Q B;  4AJY B;  4C7Z A;  2OHF A;  2KDI A;  4JWU C;  2CU1 A;  3J9C A;  3PLU A;  3ZIM A;  2KN4 A;  4OVV A;  2QC8 A;  3E56 A;  1SE4 A;  1L4D B;  2WXJ A;  3VQI A;  2DZJ A;  1RFK A;  3NUH B;  4HWI B;  1D4B A;  5JHB A;  3RNE C;  4NY0 A;  3Q3M C;  2XNA C;  3QQ8 B;  3QAR A;  3ABV B;  3AE8 B;  2WNM A;  2WDV B;  2L32 A;  4X57 B;  2WP9 B;  2V4I B;  1V2Y A;  3KUD B;  5H92 C;  1HA5 A;  2BS4 B;  2INC C;  1UF0 A;  2M56 B;  1SJH D;  2MJE A;  4RCO A;  4WWN A;  2JF5 A;  4ANX A;  4MEL A;  3EGR A;  3T3O A;  5DPT A;  5MPO A;  1Q10 A;  1VZ7 A;  1L7Y A;  1YD8 U;  1XT9 B;  4FXC A;  4W9J A;  4NZL B;  3HUI A;  2X38 A;  2LRU A;  4FBJ B;  2BYT A;  3PHW B;  1KJT A;  4BBN C;  1WYG A;  2PMV A;  4K81 A;  2N1W A;  1TJE A;  2ASQ A;  2FAZ A;  3N1Z C;  1T0Q C;  4A20 A;  3P4S B;  3H6N A;  3KWV A;  4JX1 C;  1PQS A;  2O6V D;  3PGE A;  4KSK C;  4GN1 A;  2BT6 A;  3M3J A;  3ZKJ C;  2BWF A;  4FAD A;  3ECI A;  1BT0 A;  2FE8 A;  3P2B A;  4BKT A;  4CHK A;  4FJY A;  4L2Y A;  2W3R A;  1FRD A;  1TIF A;  3DBR I;  2FIF A;  2BQQ A;  3JW0 X;  1OQR A;  1QF6 A;  3RPF C;  3RZW C;  1CMX B;  3A9J B;  3FIL A;  2LD9 A;  1VRA B;  2AX5 A;  2MJD A;  1WF9 A;  1KH0 A;  4WQO B;  3UF8 A;  2QMT A;  3AU5 A;  3L54 A;  2WXP A;  1F0Z A;  2LJI A;  2PJH A;  2QCZ A;  1MPE A;  3X0W A;  2CHX A;  4LNN A;  2L3Z A;  1J7B A;  1H4R A;  2E6X A;  3BK1 A;  2FCM A;  2RR9 A;  2ZNV C;  4ZRJ A;  2M0A A;  4M00 A;  3TUO A;  4E3C A;  3HVD A;  1YX6 B;  3ML9 A;  2PTL A;  1TTN A;  2NBW B;  4KZ0 A;  4JE3 B;  2GB1 A;  2G9H D;  3KYD D;  3DVG X;  2CJN A;  1BXT A;  2IZV B;  1I7H A;  5CTR C;  2VH1 A;  1AWD A;  1XO3 A;  3PO0 A;  1FFV A;  4IDI A;  4C56 C;  4NJC A;  2PEA A;  3BZD B;  3DPD A;  4EZL A;  3ZNH B;  4YTN B;  5CHF A;  2I2Y A;  2L0T A;  1ROE A;  1L6V A;  3AEC B;  2PLP A;  5E6J A;  3NG0 A;  5AUI A;  3P42 A;  3A1Q B;  4JPS A;  1N5W A;  3L16 A;  4NQL B;  3WAN A;  3CWI A;  4B0M A;  4BAX A;  3NVV A;  2MQJ A;  4E71 A;  1E7U A;  1TT5 B;  3ALB A;  3AEE B;  2WU2 B;  1QOF A;  4L1B A;  2KMC A;  1HXY D;  2G4S A;  3ZXV A;  3OJ4 B;  3OWE B;  1TBE A;  3ZNG C;  2LVQ A;  2NTS A;  2OJR A;  2ZNV B;  3KLS X;  1ZGU B;  2LI5 A;  3R7Q A;  3U4E G;  1ZP0 B;  2DWQ A;  1E9M A;  3PVL A;  2V3S A;  3B9J A;  1MHH E;  4GLS C;  4LNK A;  4ZHP A;  3HVZ A;  3DBR B;  5BYQ A;  1UBQ A;  1GNU A;  2FCN A;  3RD2 A;  4GGQ A;  3PRE A;  1GOZ A;  3N9Y C;  4KGS A;  5EE9 A;  1WGD A;  3AXC A;  1EF5 A;  4CQN A;  2D07 B;  1V97 A;  4IUM B;  1L0Y B;  4IM2 A;  1AYF A;  3CSF A;  3GOE A;  3VRA B;  3Q14 C;  3N1Y C;  4D2K A;  3AE9 B;  2K25 A;  2V0G A;  5JXV A;  4C00 A;  3V05 A;  1XLP A;  2MLB A;  4WWO A;  3T8M A;  3K9P B;  2JQR B;  2PE6 B;  4KVG B;  3NS1 A;  4WH4 A;  3SDL C;  1TS5 A;  2RDB C;  3GS2 A;  2K0P A;  2KAJ A;  2KFJ A;  2LUM A;  4L23 A;  2K3U A;  1D3Z A;  1N63 A;  1PYW D;  3GE3 C;  3KH0 A;  4ZRQ A;  3DOW A;  2QEJ C;  2GLS A;  4IG7 B;  2BYV E;  2IY0 B;  4AJW A;  4GB9 A;  1LM8 B;  4ACF A;  2KHW B;  2LZ6 A;  1NYQ A;  3FC4 A;  2FBW B;  3ZDM C;  1OEY A;  5IKC M;  4TQ0 A;  3NOB A;  2I1J A;  1E0Z A;  2ON8 A;  1WM3 A;  3GZN I;  2KYW A;  3BVM A;  4OZB A;  1QT9 A;  3PS6 A;  5JH5 C;  1ZE3 D;  4MGY E;  4RGO S;  3DHH C;  3SHQ A;  1C4C A;  2KTR B;  5DPW A;  1JML A;  3PZ7 A;  1SB3 C;  4RGM A;  1I4R A;  4I6L B;  3R2T A;  4AQ7 A;  2H88 B;  2YEP B;  1IPG A;  3JYU A;  4HCP B;  2FUG 1;  1SE2 A;  5TR5 A;  2KK8 A;  2HJ8 A;  1CQV A;  1SE9 A;  5DCN A;  2MSE D;  1GPX A;  1YN4 A;  4KGT A;  2WXR A;  2Z0E B;  3BWU D;  3BVZ A;  4YSZ B;  1LFD A;  2LVP A;  2FUH B;  3LJ3 A;  4DWF A;  2WXF A;  3HM3 A;  3FIL B;  1WE6 A;  1IYF A;  1YIW A;  3UQB A;  2OED A;  2DBY A;  2HJ1 A;  2KWD A;  4R3D A;  1TYG B;  4I6N B;  3EUB 2;  4XDD A;  4WQM A;  2OOB B;  3HIZ A;  4LJP B;  4MT5 A;  2GMI C;  4US9 A;  4KX6 B;  1OFF A;  1JWA D;  3HRD D;  4ZRK A;  3NZ3 A;  4I6P A;  2JX5 A;  4TUU A;  2CHZ A;  3LYY A;  4OVZ A;  2O2V B;  3MJW A;  3VUY A;  4GDL B;  3BVG A;  2O6V A;  2GI9 A;  1E8W A;  1UEL A;  3AE1 B;  3NRZ A;  3MFG A;  3W5U B;  1HE8 A;  2M8S A;  1I4Q A;  2I38 A;  3KQ4 A;  1K51 A;  4LCD E;  5L83 A;  1NYR A;  3U7D A;  1TKG A;  4BVU C;  5CHW A;  1DYQ A;  4KKJ A;  3GE8 C;  4IC7 B;  2IGH A;  2D3B A;  3OG5 A;  4ZRI A;  3NVW A;  3Q8F A;  2IO3 B;  2WQY B;  3KUC B;  4DDI D;  4W9F A;  4HPL B;  2JU6 X;  2L05 A;  2L52 A;  1C3T A;  1UBI A;  2KKC A;  3LB8 C;  4IM3 A;  3Q8B A;  4ZOH C;  4FUL A;  1MG4 A;  3C19 A;  3L0W B;  3H9D A;  5C23 A;  4IWP A;  2MHJ A;  1WRD B;  2BYF A;  1WJ6 A;  2K22 A;  4NNJ B;  3MHS D;  1L2N A;  3SR6 A;  4URK A;  4USA A;  3DCG A;  2O6V B;  1QZE A;  1CJE A;  3SU8 X;  4F1S A;  1KTK A;  2INP E;  4LNF A;  4GU2 A;  1JQ4 A;  3VDZ A;  1P98 A;  2K6Q A;  4FHJ A;  5J2R A;  2KD0 A;  1E7P B;  2AQ1 B;  1QQR A;  2X8X X;  3AEA B;  2RPQ A;  3P4Q B;  2CHW A;  3DVN U;  1K50 A;  4XYC A;  4WJP A;  3H1U A;  2KVZ A;  3Q2A C;  1SGH A;  3PZ8 A;  2KQS A;  1XF5 L;  4HXD A;  3NJT A;  1D5M C;  1J19 A;  2FCQ A;  4P16 A;  1FXA A;  1P7E A;  3I63 C;  1TKE A;  1WFY A;  4LTU A;  2BTE A;  2KMA A;  1WR1 A;  1PGA A;  3VTU A;  1T0Y A;  1KLV A;  4MGK E;  2OJW A;  2D11 A;  4WAF A;  1WX9 A;  5JZE B;  2AEH A;  4TMA B;  2SAK A;  3ZRF A;  4DBG A;  2IJ0 A;  2KQ4 X;  3W9C B;  3ZO5 B;  2KTR A;  4HKQ A;  3BK2 A;  3ML8 A;  1WMH B;  3ZTC A;  2BB6 A;  3IT4 B;  2KJ6 A;  1UGJ A;  1WJN A;  2JXX A;  2WYQ A;  4GDK B;  4HEA 1;  2L1A A;  5C3J B;  2NMQ A;  4N58 A;  1HEZ E;  1JAL A;  2E3T A;  1FM0 D;  2PKO A;  1D5Z C;  4CYE A;  4K3B A;  3ZDT A;  4IM0 A;  2ZPY A;  2WXM A;  3SEB A;  1M94 A;  3W5V B;  2L8J A;  3L17 A;  4XWW A;  2DX5 B;  4DQO C;  4G3X B;  1XEE A;  2IO0 B;  4GXB A;  1QLB B;  3R8B A;  1CZP A;  1RM6 C;  1T3Q A;  2K6D B;  2Z0D B;  1YN3 A;  4K7W A;  1C4P A;  5CX3 A;  2MP2 B;  2RPV A;  3MC8 A;  5FK9 C;  3UIP B;  2KLC A;  4A3O A;  1EWC A;  1XLQ A;  1TZO A;  2ZZP B;  3O65 B;  2DYO A;  1FPY A;  3W1Y A;  3L10 B;  4TQ1 A;  2KDB A;  1WXS A;  4RMA A;  1KOT A;  3AV8 A;  4DDG D;  1XCT L;  1HZ6 A;  2V4L A;  3Q8E A;  2JWU A;  4RFB A;  2K39 A;  1T0R C;  3TBL D;  2EEL A;  2RSU A;  2LMC A;  4GIV A;  3QJZ A;  4NJ6 A;  4WJN A;  2HD5 B;  5IA7 A;  2KMM A;  4LLG M;  5D94 A;  4BFR A;  2N9E B;  3RUL A;  3N1X C;  4A8X C;  3I57 A;  3V60 A;  4UDU C;  1TGZ B;  1MFW A;  1V6E A;  1WH3 A;  3ZRC A;  2KFK B;  4PYU A;  4OHJ A;  3ZNI D;  2C9W B;  4RF1 A;  1R4N B;  1WXM A;  2LEK A;  2KAC A;  4HRO A;  2ZVN A;  4FJZ A;  3ZJT A;  3QHT A;  4KIK B;  2NBV B;  4Q2J A;  1QOA A;  1YMH E;  4P6V F;  4H2A A;  2IO2 B;  1VLB A;  1GC6 A;  2WGS A;  2W9N A;  2MH7 A;  2VZK B;  2PW9 A;  4YTP B;  1QOG A;  2DAJ A;  1QIL A;  3JSV B;  4ZYN A;  1IUE A;  1SSN A;  1R4N I;  1WYW B;  2D2Q A;  2GRI A;  1SEB D;  4W9I A;  5AEK B;  1NBF C;  1FCL A;  3VRB B;  1SIF A;  2ZVO A;  3APF A;  5BMI A;  1E8Z A;  2NPT A;  3P1M A;  2K9X A;  4EOY A;  1PGB A;  3AN1 A;  1C9F A;  3TMP B;  3KYC D;  1F52 A;  3IG3 A;  1K52 A;  2J53 A;  1YOV B;  1WXQ A;  2KXJ A;  5KHQ A;  2LGY A;  4MH0 E;  4II3 B;  1PDX A;  3ZGZ A;  2Y5B B;  3CMM B;  3I5J C;  1WX8 A;  1WXV A;  4ANV A;  1ZOY B;  2BB5 A;  2M4N A;  2ACZ B;  4P1B C;  1S1Q B;  3VXW A;  2KLG A;  1MG8 A;  3OLM D;  1WXA A;  4LK0 M;  1VZ6 A;  2KDE B;  3X23 A;  3T3N A;  1XLN A;  3NVY A;  5HFY A;  4FLH A;  4DHJ D;  3VTV A;  2LWP A;  3L08 A;  4KDL B;  2KVR A;  4YSX B;  4XDC A;  5BYR A;  4N9F 4;  3M95 A;  3SFE B;  1P7F A;  2K8B A;  2N4F A;  2PE9 A;  2KN5 A;  3EFC A;  3M62 B;  2DLB A;  1FXI A;  3IFW B;  3ZNZ B;  2EKI A;  1V81 A;  1ZXI A;  2XBB C;  3A9J A;  5BMG A;  3U8Z A;  1KLU D;  3BYT B;  1IBX B;  1SBB B;  3AE7 B;  3ETR A;  4NAW B;  2TSS A;  2DNF A;  2NBU A;  1WGG A;  5AZF A;  4J6I A;  1UH6 A;  3TCA A;  3U2S C;  4W9L A;  3CIR B;  2MBE A;  1V9J A;  1R7S A;  1KRH A;  1KFY B;  3ZTD A;  3DHG C;  4BBN F;  5E6N A;  2L00 B;  1Q0W B;  4TV3 A;  2L83 A;  1NVI D;  2BBC A;  3CST A;  1I42 A;  1M4V A;  2BS3 B;  1F77 A;  2JUO A;  1TS4 A;  2LGI A;  3U30 A;  1YJ1 A;  3RNG C;  2NCN A;  1UGM A;  3M63 B;  5D7G A;  2KWV B;  1WRI A;  4IWQ A;  4YT0 B;  1ESF A;  2WXQ A;  3TIX A;  2JRI B;  1SF0 A;  5D2M B;  3ZUN A;  1C76 A;  2MX2 A;  1G6J A;  1V5O A;  2DAF A;  3RFZ B;  4E74 A;  2LRW A;  4ITK A;  2GBJ A;  1FMA D;  2KJR A;  1FRR A;  2W55 A;  2ZPN A;  4WWM A;  2O2V A;  4K1R B;  4C4V A;  1TS3 A;  1WGR A;  2DYM A;  4HKZ E;  5G55 A;  3MP9 A;  3B0A A;  2IGD A;  1SE3 A;  2LVO A;  4MGZ E;  1F2R I;  3PRM B;  1XLO A;  1KF6 B;  2D10 A;  4ZDV A;  2WXL A;  5C2T B;  4WAA A;  1TY2 A;  2K5P A;  2W82 A;  3R3M A;  2L76 A;  2MBQ A;  2WXG A;  4HVB A;  3LDZ E;  1FCC C;  3QC8 B;  2MA9 B;  1TS2 A;  4KDI C;  4NAM A;  2RD0 A;  4ZYS A;  2KX0 A;  5KHO A;  4DXF A;  4ARI A;  1B9R A;  1H8C A;  4TKN A;  2G45 B;  1R4M B;  3W1S C;  1GB1 A;  3DVG Y;  4LDT B;  3BY4 B;  2KOX A;  1JWM D;  5EE0 A;  2KJH B;  4K7U A;  1WZ3 A;  4YXD B;  4DHJ B;  3HK0 A;  3VVW B;  3NZS A;  3UGB B;  2AQ2 B;  3DWM A;  3WAO A;  3TEX A;  2LJ5 A;  2H89 B;  4M8N A;  2N0S B;  3P4P B;  1RFA A;  2ONQ A;  1EU4 A;  4LDT D;  2C5L C;  2GBK A;  2EKE C;  1PUT A;  3UQA A;  3AE2 B;  2MBH A;  3HM6 X;  3IHP C;  2M0X A;  3N30 A;  1SJE D;  2JXT A;  1UWM A;  3PSE B;  5TSS A;  3EHV A;  4N59 A;  1YNT E;  3C0R B;  3AEB B;  1FO4 A;  2JY6 A;  1ENF A;  5FR6 A;  4BOZ B;  3WA0 A;  2V1Y A;  1GAQ B;  1L0V B;  4G11 A;  3VH3 B;  3TSS A;  5HHD G;  3IVF A;  3ZLZ A;  1GC7 A;  4KIK A;  1ZDV A;  1EF1 A;  1YX5 B;  4ANU A;  2DZI A;  3AEG B;  3MTN B;  1EM7 A;  2XEW A;  2ZEQ A;  1T6B X;  2BF8 B;  4RNA A;  1K53 A;  4C7Y A;  2JZP A;  2V3N A;  1WI0 A;  3I3T B;  2A4Z A;  1UZX B;  4JWS C;  4FN2 A;  4HPP A;  3RNC C;  4MJS B;  2QSD A;  1ET6 A;  3QX1 A;  1B1Z A;  2WU5 B;  1MVK A;  4S17 A;  2D3A A;  1WGH A;  3ZVV A;  3VFK A;  1V49 A;  1WE7 A;  4XC2 A;  2RGF A;  2I1K A;  1ZDX A;  2WXN A;  5G2N A;  2KAN A;  2D3G A;  1V1P A;  2IGG A;  2VH2 A;  1N6Z A;  5LXI B;  2EMS A;  4CO7 A;  2W3S A;  1E90 A;  1J7A A;  2CKH B;  5E6O A;  1WIA A;  1ZW7 A;  3A1Q A;  4MGI E;  3PRZ A;  3EEC A;  1DOY A;  3O13 A;  2NR2 A;  3A9K A;  2CU3 A;  2CJO A;  3FAH A;  3IT6 B;  2MP2 A;  3U7Z A;  3DHI C;  3PV1 A;  5IAA C;  3SD5 A;  3BII D;  5GMV A;  1J0G A;  2LFI A;  3P4R B;  5HI1 A;  1WMH A;  4BOS C;  2KDF B;  2HDE A;  2YEP F;  1SXT A;  2J0K A;  1SIJ A;  2L7R A;  2GBM A;  4ICU A;  2YLM A;  2C60 A;  2AL6 A;  3MC9 A;  5GXG B;  1E5W A;  1C4A A;  1I4P A;  4EUT A;  1C1Y B;  1D5X C;  4M0W A;  1K8R B;  1HZ5 A;  4BZA A;  1P3Q U;  1N61 A;  2LHE A;  1FNV A;  1I4X A;  4KKI A;  1OEY J;  3PRP B;  2MW5 A;  2HTH A;  5G5H A;  1JRP A;  2JYT A;  4HJG E;  3TEZ A;  1JW9 D;  4A9A A;  3Q6B A;  1GB4 A;  2LGX A;  1A70 A;  1P0R A;  1RAX A;  4F8C B;  2WLB A;  2NTT A;  3EA6 A;  5AZH A;  4HCN B;  2MRP A;  5H8Y E;  3PT2 B;  3AED B;  4IW0 A;  1NEK B;  1YQ3 B;  4S0R A;  1QOB A;  1A5R A;  3Q3N C;  1S3S G;  1HTO A;  3NZU A;  4JQW C;  1LQB A;  3VHT C;  1FFU A;  5HKH A;  4BKS A;  2Y3A A;  3RI7 C;  3MC0 B;  2ZCB A;  1FEH A;  5EE3 A;  5G5G A;  1Y56 A;  2VRR B;  5IP4 D;  1WWT A;  4M0W B;  1VZ8 A;  5BO4 B;  3I9V 1;  1HQR D;  4B0E A;  2NS5 A;  4RGT A;  3V61 A;  4RM9 A;  2HTM E;  1DGJ A;  3BYY B;  4FHK A;  5LLI A;  4RGN A;  3RMK C;  2PVO D;  3R66 C;  2FID A;  4ZRP A;  1UNS A;  1EO6 A;  4BKG A;  3A9K B;  4M02 A;  4PS8 A;  3GB1 A;  4AWJ A;  2UWQ A;  2MEK A;  4WJQ A;  1MI0 A;  4PS7 A;  2Y5C A;  1L4Z B;  5I4D A;  2N7E A;  3SFD B;  3DQV A;  2IYD B;  1IP9 A;  3D32 A;  4A90 A;  2CS4 A;  3HHM A;  4NJ7 A;  3U52 E;  4GSW A;  1N5X A;  1CK1 A;  4M8M A;  1L6U A;  3KWL A;  2G3Q B;  3RNA C;  4B95 A;  1MJD A;  2BGF A;  2ICI A;  2YVC A;  2RDG A;  4HJK A;  3B08 A;  3ZW3 A;  3ZXR A;  2IPK D;  2W54 A;  1FIQ A;  1NI2 A;  1JRO A;  2PPH A;  5T8I A;  2INN E;  1N60 A;  1D6E C;  2Z8L A;  2BW2 A;  1IBX A;  5CHV C;  4PS3 A;  3V6E B;  2WDT B;  1TKY A;  1GUA B;  5E6P A;  2DYB A;  2ZW1 A;  1ZXH A;  2L0F A;  1EUV B;  2M1M A;  2A5U A;  1DOI A;  2D3C A;  3TJP A;  4F7Z A;  4KSL C;  3DDC B;  2K8C A;  3CF6 E;  3OAW A;  1J7C A;  2MWS B;  4YL8 A;  1RRB A;  3RT3 B;  3LXF A;  4MM3 A;  2IBI B;  2WXH A;  1E7V A;  4GOC A;  2BKR B;  3OJ3 A;  2JPH A;  3JSV A;  5DPR A;  4W9G A;  2V3P A;  3C8Y A;  4XE0 A;  4DK5 A;  2KWU B;  5HG2 A;  1V86 A;  4TSS A;  4XX5 A;  1PGX A;  3B2G A;  2C7H A;  4EFO A;  1STE A;  1E8Y A;  3DVN V;  2JZ3 B;  2QIL A;  1V8C A;  2JRH A;  2NPT B;  1NEN B;  2AQ3 B;  1I4G A;  4OZA A;  4LNO A;  3E9S A;  4NQK E;  2J0M A;  4KGR A;  2BYE A;  1YQ4 B;  2MBO A;  2G1E A;  3VAW A;  3TEW A;  3ZQ4 A;  2ZJD A;  2GBN A;  4JIO U;  1UWX A;  4NPN A;  3UIN B;  3DBL B;  4W9E A;  3B2F A;  4GDL A;  1VR9 A;  3V6C B;  4IWO A;  3DBL I;  3BIN A;  2EMT A;  2WWZ A;  3AE3 B;  3DBS A;  3Q3J A;  1MHX A;  3L4P A;  1QKZ A;  1KM7 A;  1UD7 A;  1GJZ A;  3RCZ A;  1AW7 A;  2BKF A;  3MHZ A;  4RF0 A;  4HLE A;  1C79 A;  2FNJ B;  4N6E B;  4YWG G;  4US8 A;  1VCB A;  3NHE B;  1UUP A;  1P9D U;  4O1N A;  2ZW0 A;  3H8H A;  4AOF A;  3PHX B;  1ET9 A;  4MEM A;  5DPS A;  4DXA B;  2AWT A;  2JZZ A;  3V62 A;  3ZJU A;  1YJI A;  2J4X A;  2WS3 B;  3RN9 C;  3QK0 A;  2K8H A;  3NS8 A;  2Q5W D;  3EFU A;  1JCK B;  2LGD A;  3N3K B;  4JLC A;  4EE2 A;  4JL9 A;  5BMH A;  2DZK A;  4XGA B;  2B76 B;  4ANW A;  3UIO B;  3FKY A;  2BVC A;  4OVU A;  3L13 A;  5L95 C;  2N1V A;  3VUX A;  4EZK A;  4MDK E;  2NVU I;  5LXH A;  3Q3O C;  4ZHO A;  1T5X D;  1BML C;  2QJL A;  4LJO B;  1VJK A;  3KVF B;  2KQ7 A;  1OTR B;  3DBH I;  1ZUD 2;  2D5G A;  3Q3F A;  2R61 A;  3R7R A;  1LXD A;  2N7J A;  2DHZ A;  1U4A A;  3PLV A;  3Q8C A;  4GMV A;  1ISN A;  2JT4 B;  1WM2 A;  4PYZ A;  3AE4 B;  5D3I B;  2IDY A;  3Q69 A;  1F2R C;  3APD A;  3WAP A;  2RMM A;  2J42 A;  3W2D A;  4RH6 A;  2M19 A;  4JGH B;  2WHI A;  2RDH A;  3H7S A;  2WDQ B;  1R4M I;  1TY0 A;  2C7M B;  3PZD A;  2UYZ B;  1XD3 B;  3DBH B;  4MJS A;  4B6W A;  2WXI A;  3VH4 B;  1FNW A;  1C78 A;  4WUR A;  2AL3 A;  3A33 B;  5AUK A;  1L0X B;  1LGR A;  3UI3 A;  4G50 A;  3RNF C;  4DHZ E;  4ICV A;  2CR5 A;  4W9K A;  2WXK A;  3QCA A;  1WJ4 A;  3P63 A;  2Y5P A;  1L5P A;  2DZM A;  1X1M A;  1EU3 A;  3IXS A;  4WJO A;  3PTF C;  3GZN B;  1YQB A;  3WAM A;  1E6E B;  1WY8 A;  4AUQ C;  2IY1 B;  4C80 A;  1IGC A;  2N9K A;  3AH7 A;  3R2I A;  4P1C C;  4A3P A;  4PT5 A;  2N7D A;  5FKA C;  1V5T A;  1GG3 A;  2WX0 A;  2KDM A;  1V1O A;  1N62 A;  1KLG D;  4W9D A;  1F1H A;  2LHD A;  4MH8 A;  1DOX A;  2B3A A;  3QIJ A;  3MJ5 A;  4W9C A;  4P7I A;  3AM9 A;  5IO9 A;  3ONS A;  2LAS A;  4WIP A;  2R2O A;  4QAY A;  1JWB D;  3WCQ A;  5BYS A;  2ZCC A;  2BS2 B;  4IKG A;  1I35 A;  1RLF A;  1BUI C;  4AP4 C;  3VR9 B;  4MAC A;  2KFK A;  4M01 A;  3VUW A;  1Y8R C;  2PIA A;  2PVG C;  1XCQ L;  3RNB C;  2REX A;  2J52 A;  1WGY A;  2UU7 A;  3AE5 B;  3QWZ B;  3K9O B;  2LUE A;  1WSP A;  3WIM A;  5J17 A;  2WXO A;  3S2A A;  4B9K A;  1XQQ A;  2XK5 B;  2JWZ A;  2R2Q A;  1FD6 A;  3GP7 A;  1JWU D;  5AZG A;  3N20 C;  1NI3 A;  4KZC A;  1PFD A;  3ENE A;  4G0N B;  2WX1 A;  2JVC A;  3IAS 1;  2QHO A;  3IAM 1;  2N9L A;  3RYT A;  3RZF A;  2GBR A;  3WAL A;  1WGK A;  2N9X A;  3AUL A;  5D3D A;  2KX3 A;  5IN7 A;  1WX7 A;  3QA8 A;  2LXA A;  3AEF B;  1T0S C;  3AMZ A;  3NY5 A;  2MCN B;  4HRS A;  1Q1O A;  4K3C A;  1Q5W B;  3N32 A;  2J0J A;  5FR3 A;  4MSQ B;  1V1P B;  1Z2M A;  1Z5S B;  1WR6 E;  1XXG A;  3KW5 B;  5EDS A;  4PK1 A;  2AYO B;  2DEN B;  1FXT B;  2M17 A;  4II2 B;  4HPM B;  2QDF A;  2JYE A;  2HE7 A;  2KZR A;  3B1L X;  1WJU A;  4FA6 A;  3H7P B;  2WDR B;  3H7P A;  4EKU A;  1EWY C;  3AB5 A;  3PPA A;  2IO1 B;  2Z59 B;  1RYJ A;  1P1A A;  3AI5 A;  3JVZ X;  2KWC A;  4WWP A;  3VR8 B;  5C1Z A;  1IGD A;  1ACC A;  2FCS A;  2BPS A;  4ARC A;  2KC1 A;  3QAQ A;  1OQY A;  1VDV A;  4XZ4 A;  4GDK A;  3EC8 A;  3TL5 A;  5JHA A;  5IOI A;  1I4H A;  3A4R A;  4YSY B;  4EZJ A;  3IBE A;  4DXG A;  2G4D B;  4W9H A;  2C7N B;  1FNU A;  1HTQ A;  1JWS D;  1ZKH A;  2VZK D;  4A6Q A;  4RM8 A;  3AE6 B;  4NAW A;  1E10 A;  4DHZ B;  4K7S A;  1TZ1 A;  4KV2 A;  3NVZ A;  4IOI E;  2K1F A;  2XK5 A;  4OZC A;  2BWE S;  1AN8 A;  3ZJV A;  4EEW A;  4A55 A;  3TEY A;  2GOW A;  4XWT A;  3V3X A;  4YTM B;  2LGS A;  1WZ0 A;  1YJJ A;  2MJ3 A;  2LXC A;  3Q8A A;  1OQQ A;  2SEB D;  4REZ A;  1E8X A;  4MSM B;  4LNI A;  2QIE B;  1J8C A;  2KO3 A;  4AS1 A;  4ASW C;  5D6J B;  3VTW A;  4HDQ A;  1C77 A;  2KT7 A;  1VD2 A;  1F9J A;  5LNK 1;  1LO5 D;  4BKS D;  1JRU A;  1OGW A;  2KNB A;  3KUZ A;  1YN5 A;  3APC A;  3DWG C; 
#chains in the Genus database with same CATH homology
 4WWM A;  3W1S A;  3B2F A;  1VR9 A;  4J3O D;  4GDL B;  3BVG A;  2GI9 A;  1TS3 A;  2DYM A;  4HKZ E;  3AE3 B;  3MP9 A;  2JSV X;  1MHX A;  3L4P A;  1QKZ A;  1ZPS A;  2IGD A;  1SE3 A;  3AE1 B;  3NRZ A;  4OW0 A;  3MFG A;  3W5U B;  3ZYY X;  1I4Q A;  2I38 A;  3KQ4 A;  1RWS A;  1AW7 A;  3URY A;  3MHZ A;  1K51 A;  1F2R I;  2XN9 C;  4MM3 B;  1XLO A;  5EE1 A;  4RF0 A;  1KF6 B;  2WXL A;  5C2T B;  1C79 A;  1NYR A;  1TY2 A;  4C7Z A;  2K5P A;  2W82 A;  1TKG A;  2OHF A;  4N6E B;  2WXG A;  4YWG G;  4JWU C;  1FCC C;  1DYQ A;  4KKJ A;  3J9C A;  4US8 A;  1TS2 A;  2KN4 A;  4NAM A;  2IGH A;  3E56 A;  4ZYS A;  1SE4 A;  1UUP A;  4DXF A;  3NVW A;  4ARI A;  1B9R A;  3Q8F A;  4O1N A;  1L4D B;  2WQY B;  2WXJ A;  2ZW0 A;  3H8H A;  3VQI A;  1RFK A;  1GB1 A;  2JU6 X;  2L52 A;  1ET9 A;  3NUH B;  1D4B A;  1JWM D;  3LB8 C;  5EE0 A;  2XNA C;  3Q8B A;  3ZJU A;  1YJI A;  4ZOH C;  2J4X A;  2WS3 B;  4YXD B;  3ABV B;  2Q5W D;  3AE8 B;  2WNM A;  2AQ2 B;  1JCK B;  2K22 A;  2WDV B;  3DWM A;  2L32 A;  3SR6 A;  3TEX A;  4USA A;  4EE2 A;  2WP9 B;  2V4I B;  2H89 B;  5H92 C;  5BMH A;  1CJE A;  1KTK A;  1HA5 A;  2N0S B;  2BS4 B;  2ONQ A;  3P4P B;  1EU4 A;  2INP E;  1JQ4 A;  2M56 B;  1SJH D;  2MJE A;  4RCO A;  2B76 B;  1PUT A;  3AE2 B;  3EGR A;  3T3O A;  5MPO A;  1Q10 A;  1E7P B;  2AQ1 B;  1SJE D;  1QQR A;  1VZ7 A;  3AEA B;  3P4Q B;  2JXT A;  4FXC A;  1UWM A;  4NZL B;  3HUI A;  1K50 A;  2X38 A;  5TSS A;  4N59 A;  1YNT E;  3AEB B;  4ZHO A;  1T5X D;  3PZ8 A;  2BYT A;  1XF5 L;  1BML C;  1FO4 A;  2QJL A;  1ENF A;  1VJK A;  1WYG A;  1D5M C;  2PMV A;  1ZUD 2;  2D5G A;  1FXA A;  2R61 A;  4P16 A;  1GAQ B;  1TJE A;  1P7E A;  1L0V B;  1TKE A;  4LTU A;  2N7J A;  2BTE A;  3P4S B;  3TSS A;  5HHD G;  1PGA A;  3Q8C A;  1ZDV A;  3KWV A;  4JX1 C;  3AE4 B;  4WAF A;  5D3I B;  2IDY A;  3Q69 A;  3AEG B;  1F2R C;  1EM7 A;  4TMA B;  2BT6 A;  2SAK A;  2IJ0 A;  2KQ4 X;  3W9C B;  2RMM A;  2J42 A;  3W2D A;  4RH6 A;  1T6B X;  2FE8 A;  2M19 A;  4HKQ A;  4RNA A;  2RDH A;  2WDQ B;  1TY0 A;  1K53 A;  3BK2 A;  4C7Y A;  2JZP A;  4L2Y A;  2BB6 A;  2V3N A;  2W3R A;  4JWS C;  3IT4 B;  1FRD A;  1IBX B;  2WXI A;  2QSD A;  1FNW A;  1C78 A;  1UGJ A;  1ET6 A;  4GDK B;  4HEA 1;  2L1A A;  1B1Z A;  4WUR A;  5AUK A;  5C3J B;  2NMQ A;  2WU5 B;  4N58 A;  1MVK A;  1HEZ E;  1L0X B;  1JAL A;  2E3T A;  1OQR A;  3UI3 A;  1FM0 D;  1ZDX A;  2WXN A;  1QF6 A;  3RPF C;  1V1P A;  2IGG A;  2PKO A;  1D5Z C;  2WXK A;  3P63 A;  2Y5P A;  3FIL A;  1L5P A;  1EU3 A;  3IXS A;  2WXM A;  2W3S A;  3SEB A;  1J7A A;  1VRA B;  3W5V B;  1E6E B;  2AX5 A;  4C80 A;  2MJD A;  4XWW A;  4DQO C;  1XEE A;  1KH0 A;  1QLB B;  3R8B A;  1IGC A;  1CZP A;  2QMT A;  3O13 A;  2N9K A;  1DOY A;  1RM6 C;  3AH7 A;  1T3Q A;  1YN3 A;  3R2I A;  1C4P A;  2WXP A;  2CU3 A;  2CJO A;  4PT5 A;  2LJI A;  2RPV A;  3FAH A;  3IT6 B;  1F0Z A;  1MPE A;  5FKA C;  3U7Z A;  5FK9 C;  1J7B A;  2E6X A;  2KDM A;  1V1O A;  1N62 A;  3BK1 A;  1EWC A;  1KLG D;  1XLQ A;  1TZO A;  2M0A A;  2LHD A;  3BII D;  2DYO A;  3TUO A;  2LFI A;  3P4R B;  4MH8 A;  1DOX A;  3MJ5 A;  5HI1 A;  3HVD A;  2PTL A;  3AM9 A;  2HDE A;  4TQ1 A;  2YEP F;  1SXT A;  4JE3 B;  1SIJ A;  4WIP A;  3AV8 A;  1XCT L;  1HZ6 A;  2GB1 A;  2G9H D;  3Q8E A;  2CJN A;  1BXT A;  1JWB D;  3WCQ A;  1I7H A;  2JWU A;  4RFB A;  5BYS A;  5GXG B;  1AWD A;  1XO3 A;  3PO0 A;  1FFV A;  4IDI A;  1C4A A;  1I4P A;  2EEL A;  4C56 C;  2LMC A;  1D5X C;  4NJC A;  4M0W A;  1HZ5 A;  3BZD B;  1N61 A;  2LHE A;  2KMM A;  4LLG M;  2BS2 B;  4IKG A;  4YTN B;  4A8X C;  3I57 A;  2I2Y A;  1FNV A;  1ROE A;  1I4X A;  1L6V A;  4KKI A;  4UDU C;  1BUI C;  3VR9 B;  3AEC B;  5G5H A;  1JRP A;  2JYT A;  2PLP A;  4MAC A;  5E6J A;  5AUI A;  4HJG E;  3TEZ A;  2PVG C;  1JW9 D;  2PIA A;  3P42 A;  4OHJ A;  4A9A A;  4JPS A;  1GB4 A;  4RF1 A;  1N5W A;  1XCQ L;  2J52 A;  2LEK A;  3CWI A;  4B0M A;  2KAC A;  1A70 A;  3AE5 B;  3NVV A;  4HRO A;  2WLB A;  1WSP A;  2NTT A;  3ZJT A;  3AEE B;  2WU2 B;  1QOF A;  3EA6 A;  4L1B A;  2WXO A;  4Q2J A;  1HXY D;  5H8Y E;  1QOA A;  1YMH E;  4P6V F;  3AED B;  3OWE B;  4H2A A;  1FD6 A;  3GP7 A;  1JWU D;  1NEK B;  1VLB A;  2NTS A;  1YQ3 B;  1NI3 A;  1QOB A;  3KLS X;  1PFD A;  3U4E G;  1ZP0 B;  2DWQ A;  1E9M A;  2MH7 A;  2VZK B;  2PW9 A;  4YTP B;  3IAS 1;  3B9J A;  3IAM 1;  1MHH E;  1QOG A;  2N9L A;  1FFU A;  1QIL A;  4GLS C;  1IUE A;  1SSN A;  2Y3A A;  3MC0 B;  1WGK A;  4ZHP A;  1FEH A;  3HVZ A;  5D3D A;  2GRI A;  1SEB D;  5EE3 A;  5BYQ A;  5G5G A;  1FCL A;  3AEF B;  3VRB B;  1Y56 A;  3AMZ A;  1GOZ A;  3N9Y C;  4KGS A;  1WWT A;  4HRS A;  5BMI A;  5EE9 A;  3P1M A;  2K9X A;  1VZ8 A;  1PGB A;  3AN1 A;  4CQN A;  5FR3 A;  3I9V 1;  1V97 A;  1C9F A;  1HQR D;  1L0Y B;  1V1P B;  4B0E A;  1AYF A;  1XXG A;  3VRA B;  4RGT A;  4D2K A;  1K52 A;  3AE9 B;  2HTM E;  1DGJ A;  2J53 A;  2V0G A;  1WXQ A;  3BYY B;  4RGN A;  5JXV A;  3V05 A;  2PVO D;  1XLP A;  1PDX A;  3ZGZ A;  2JQR B;  4ZRP A;  1UNS A;  4WH4 A;  3NS1 A;  1TS5 A;  3GS2 A;  2K0P A;  2KAJ A;  1ZOY B;  2JYE A;  2BB5 A;  2LUM A;  4L23 A;  2K3U A;  2ACZ B;  3GB1 A;  1N63 A;  1PYW D;  2MEK A;  1MI0 A;  2WDR B;  2Y5C A;  1EWY C;  4ZRQ A;  1L4Z B;  3AB5 A;  2QEJ C;  4LK0 M;  5I4D A;  1VZ6 A;  1RYJ A;  3SFD B;  3T3N A;  1XLN A;  3VR8 B;  1IGD A;  1ACC A;  4A90 A;  3U52 E;  1N5X A;  3NVY A;  1CK1 A;  5HFY A;  1NYQ A;  1L6U A;  3KWL A;  4ARC A;  3FC4 A;  1VDV A;  2FBW B;  4YSX B;  4XDC A;  5BYR A;  1I4H A;  2ICI A;  3SFE B;  1P7F A;  4TQ0 A;  1E0Z A;  4YSY B;  2ON8 A;  2RDG A;  2DLB A;  1FXI A;  4DXG A;  3BVM A;  4OZB A;  2EKI A;  1ZXI A;  1FNU A;  1QT9 A;  5BMG A;  2IPK D;  2W54 A;  1FIQ A;  1ZE3 D;  1JRO A;  4RGO S;  1KLU D;  5T8I A;  2INN E;  1N60 A;  3BYT B;  1D6E C;  2Z8L A;  1JWS D;  1SBB B;  1C4C A;  3AE7 B;  2VZK D;  1JML A;  2BW2 A;  3ETR A;  4NAW B;  4A6Q A;  2TSS A;  3PZ7 A;  1SB3 C;  3AE6 B;  1IBX A;  4RGM A;  1E10 A;  1I4R A;  3R2T A;  1TKY A;  4AQ7 A;  2H88 B;  2YEP B;  3U2S C;  3CIR B;  1R7S A;  1SE2 A;  2FUG 1;  1KRH A;  1KFY B;  2ZW1 A;  1CQV A;  1ZXH A;  3NVZ A;  4IOI E;  1DOI A;  4OZC A;  1YN4 A;  1GPX A;  1AN8 A;  4KGT A;  3ZJV A;  1J7C A;  2WXR A;  2L83 A;  1NVI D;  2BBC A;  3BWU D;  1M4V A;  2BS3 B;  3BVZ A;  3LXF A;  4YSZ B;  1F77 A;  4A55 A;  3TEY A;  1TS4 A;  2LGI A;  4XWT A;  2WXH A;  2WXF A;  3FIL B;  3V3X A;  4YTM B;  2V3P A;  1YJJ A;  3C8Y A;  2MJ3 A;  4XE0 A;  3Q8A A;  1OQQ A;  2SEB D;  5D7G A;  2OED A;  2DBY A;  5HG2 A;  4TSS A;  1WRI A;  1PGX A;  3B2G A;  4YT0 B;  2KWD A;  4REZ A;  1STE A;  4R3D A;  1ESF A;  1TYG B;  2WXQ A;  2QIL A;  3EUB 2;  1V8C A;  4XDD A;  1SF0 A;  2QIE B;  4WQM A;  1C76 A;  1NEN B;  1I4G A;  2AQ3 B;  4AS1 A;  4OZA A;  3E9S A;  4KGR A;  4MT5 A;  1YQ4 B;  2G1E A;  3RFZ B;  3TEW A;  1C77 A;  4US9 A;  4KX6 B;  1OFF A;  1JWA D;  3ZQ4 A;  5LNK 1;  1LO5 D;  4ITK A;  1FMA D;  3HRD D;  3NZ3 A;  1UWX A;  2JX5 A;  1FRR A;  2W55 A;  3LYY A;  1YN5 A;  4OVZ A;  3DWG C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...