1JQ4A

[2fe-2s] domain of methane monooxygenase reductase from methylococcus capsulatus (bath)
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
98
structure length
98
Chain Sequence
MQRVHTITAVTEDGESLRFECRSDEDVITAALRQNIFLMSSCREGGCATCKALCSEGDYDLKGCSVQALPPEEEEEGLVLLCRTYPKTDLEIELPYTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR structure of the [2Fe-2S] ferredoxin domain from soluble methane monooxygenase reductase and interaction with its hydroxylase.
pubmed doi rcsb
source organism Methylococcus capsulatus str. bath
molecule tags Oxidoreductase
molecule keywords METHANE MONOOXYGENASE COMPONENT C
total genus 9
structure length 98
sequence length 98
ec nomenclature ec 1.14.13.25: Methane monooxygenase (soluble).
pdb deposition date 2001-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1jq4A00
4KX6B 3B2FA 3ZYYX 2PVOD 3HVZA 3P1MA 4JWSC 1OQQA 2DWQA 3P4RB 2JQRB 2E3TA 1KF6B 1V97A 3AV8A 2M19A 1ROEA 4A9AA 2L83A 1ZUD2 1FFUA 4FXCA 4HROA 4C80A 1N5WA 1WGKA 3AE7B 4US8A 1OQRA 3RPFC 3AM9A 4YSZB 1E0ZA 2CJOA 1FO4A 1UWMA 2KMMA 4HRSA 1NENB 1AWDA 1L6VA 1QLBB 2EKIA 1R7SA 2WS3B 2WU5B 1FMAD 1N60A 1N62A 3P4SB 1RM6C 2MJDA 1L5PA 4C7YA 1WRIA 1AYFA 1GAQB 2W55A 2W3SA 4P6VF 2WDQB 2BS2B 2QIEB 4ITKA 3VR9B 1N63A 2LEKA 5EE9A 1N5XA 4US9A 1VJKA 1WXQA 3AH7A 1KRHA 4YTNB 1KFYB 1E7PB 2CJNA 3AECB 1FXIA 3SFDB 4USAA 1FRDA 1IUEA 1PUTA 1V8CA 2WP9B 3ABVB 3L4PA 4YXDB 1B9RA 1NVID 1OFFA 2Q5WD 3DWMA 3AMZA 5EE3A 1T3QA 5C2TB 1FFVA 2MJEA 3AEAB 1WYGA 1DOXA 3AE2B 4YSYB 3AEGB 1ZXIA 4N58A 1JWAD 1J7AA 4YT0B 2WQYB 2K22A 2OHFA 4ZOHC 2Y5CA 2L52A 1JALA 1QOAA 1TYGB 2BS4B 1YQ4B 2DBYA 2N0SB 3W9CB 2M56B 1XLOA 2KAJA 3KWLA 1XLNA 4N59A 1JRPA 3AB5A 1XLPA 3NVVA 1JW9D 4WQMA 4LTUA 5G5HA 4YSXB 3B2GA 2JX5A 3PO0A 1RFKA 3HUIA 5GXGB 1QOFA 1QT9A 2WDRB 5EE0A 3P4PB 3ETRA 4C7ZA 1TKEA 5AUKA 1FXAA 3LXFA 4WWMA 2PKOA 3CWIA 5AUIA 3AE1B 2CU3A 1TKGA 1ZP0B 2PIAA 1XLQA 3NVWA 2G1EA 1CZPA 2MJ3A 3AEEB 1NYQA 2PVGC 3AEFB 1QF6A 1RWSA 1FM0D 5C3JB 2W54A 1DOIA 2H88B 1QOBA 1NEKB 2MH7A 4IDIA 1XO3A 1I7HA 3P4QB 1JQ4A 1YJIA 1EWYC 3NVZA 3AEBB 4JX1C 2HTME 2WDVB 3VRBB 1PFDA 3W5VB 3NS1A 3AE8B 1SIJA 2BS3B 3AE9B 1WWTA 1JROA 3B9JA 2FBWB 3NRZA 1JWBD 3AE3B 1NI3A 3AE6B 3P63A 3W5UB 4JWUC 3VR8B 1E6EB 1L0VB 5G5GA 2WU2B 1DOYA 1L6UA 3NVYA 5EE1A 1DGJA 1FRRA 1YJJA 3AE4B 1E10A 4ZHPA 5H8YE 3SR6A 5H92C 2QJLA 3BIID 1TKYA 3DWGC 1QOGA 3AE5B 1CJEA 2W3RA 1F0ZA 1VDVA 4N6EB 1SF0A 3AN1A 1TJEA 1VLBA 2K9XA 1PDXA 3EUB2 2WLBA 1ZOYB 1J7CA 3VRAB 1GPXA 1A70A 5MPOA 1RYJA 2H89B 4YTMB 3FAHA 1FIQA 1YQ3B 3CIRB 3HRDD 3WCQA 1SB3C 1N61A 3FC4A 3SFEB 2BT6A 2B76B 4YTPB 2K5PA 3LB8C 1J7BA 1NYRA 4ZHOA 1E9MA 2AX5A 2ACZB 3AEDB
chains in the Genus database with same CATH superfamily
5DPRA 2O6VA 4G11A 2G4SA 3TEWA 1K50A 3RPFC 3VAWA 1EU4A 3ZNZB 2WU5B 2KOXA 2K0PA 2KHWB 2V9HA 2PPHA 1VD2A 3RNGC 1MJDA 1S3SG 2WDQB 1UBIA 3K9PB 2KJRA 4YTNB 2M0AA 2LHDA 4KZ0A 1ZPSA 2GBNA 5D2MB 3MP9A 4NAMA 2NPTA 4W9CA 2CHWA 2GI9A 1TZ1A 4N58A 3N1XC 4ZRQA 4JLCA 2BF8B 1OGWA 3QA8A 3ZTCA 4W9EA 2K3UA 1FXAA 1YOVB 1IBXB 2PKOA 2HTHA 5J17A 2JWZA 3DVNV 1Q0WB 3ZQ4A 2PVGC 1RWSA 3PHWB 1WMHB 1EO6A 2EMTA 4OVZA 2LXCA 4ANUA 1XF5L 5LNK1 2SEBD 4OZAA 2WDVB 4ICUA 4WQOB 2D3GA 4ZYSA 3IT4B 2BS3B 2JF5A 1E6EB 3A9KB 4KSKC 1ENFA 1BMLC 2L00B 1TS5A 1BUIC 3BIID 2MBHA 4GMVA 1GC6A 2LHEA 2UWQA 3SHQA 1C4PA 1J7CA 3BYTB 1GPXA 3VH4B 1V2YA 3ZW3A 4M0WA 2KQ4X 3W1SC 1N61A 2LWPA 4A90A 2KN5A 4OZCA 4MM3A 2BB6A 4L2YA 3ONSA 3EFCA 2DYBA 2NCNA 3KUCB 4IM3A 2IO2B 4M8MA 5FK9C 4LNNA 4RM9A 3KLSX 4HEA1 4ASWC 2OEDA 4RH6A 1KTKA 4ITKA 3VR9B 2WXQA 1WXQA 3AH7A 1V1OA 2K8CA 3PLVA 5EE3A 1OTRB 2ON8A 4TQ0A 2LZ6A 2K6DB 1TYGB 5BYRA 2DBYA 4S17A 2N7DA 3PV1A 2BW2A 2NBUA 3IAS1 3N3KB 3HM3A 5AUKA 3LXFA 1GOZA 4DXAB 4EE2A 5AUIA 3CWIA 3AE1B 1GNUA 1LQBA 3BY4B 4TV3A 3TSSA 1DOIA 2MH7A 3BWUD 3APFA 3GP7A 4C4VA 4IWPA 1GC7A 3L08A 3Q8CA 2KLCA 2FCMA 2WXIA 4M00A 2FBWB 2XEWA 1WGYA 5LXIB 1Y8RC 1FXTB 3Q6BA 4G50A 3MC9A 2RGFA 1LM8B 2RDGA 2J0MA 2KVRA 3QWZB 1X1MA 5D7GA 4LCDE 5G2NA 4LNFA 3KWVA 1ZOYB 2KLGA 2V3SA 3MHSD 3R8BA 2BYFA 2BT6A 4HKZE 3A33B 1SIFA 2VRRB 1R4NI 1GG3A 4BOZB 1G6JA 2DWQA 2JQRB 1TBEA 3Q8BA 5DCNA 1FPYA 4A9AA 2Z0EB 3Q3FA 1WMHA 1GB1A 3V6EB 1UWXA 1WXSA 3ZJUA 5TR5A 1UWMA 1WH3A 1XQQA 2LGXA 2V3NA 5LLIA 2K1FA 2JSVX 3HM6X 4GB9A 3WAOA 1R4MB 3C0RB 1FXIA 2RDHA 1FRDA 1H8CA 2M17A 2JXXA 2INCC 2VZKD 4XGAB 3AEGB 4ZRPA 2IO1B 3UI3A 4WAFA 4NZLB 2JU6X 4DK5A 1RFKA 1QT9A 2M0XA 2WXNA 3IVFA 4EFOA 3L0WB 1TKGA 2PIAA 1UUPA 2W54A 2BKRB 1MHXA 1QQRA 2J7QB 5IP4D 2JRIB 3QHTA 2DX5B 2KFKB 1L4ZB 4RNAA 4JX1C 3W5VB 2GBMA 1MFWA 1WGHA 3R2TA 2V0GA 3CF6E 2KNBA 2V4LA 1L6UA 3DBLI 1SSNA 3SR6A 2NPTB 2UU7A 3DWGC 3PTFC 4HWIB 3SU8X 3ZO5B 1NBFC 3A4RA 4P1CC 2ZW0A 3H7SA 3MFGA 2WHIA 4JL9A 4CO7A 4FA6A 3HRDD 3T8MA 2FAZA 3WAPA 2JZ3B 2QSDA 3MC0B 2C7NB 4I6NB 4K7WA 2KMCA 2ICIA 2PVOD 3P1MA 2Z0DB 1WRDB 3L13A 3EHVA 2I2YA 1ISNA 3PZ8A 1VZ6A 4UDUC 3B1LX 1WM2A 4WAAA 2ZW1A 1TZOA 2LMCA 1VR9A 2WS3B 4II3B 4IKGA 3W2DA 1JRUA 2KC1A 4AP4C 3RNFC 5L83A 3AU4A 2CJNA 3GZNI 4A8XC 3SFDB 4ICVA 3B08A 4MH0E 4WJPA 4NQLB 5J18A 4OVVA 3Q2AC 1TS4A 1DOXA 1HEZE 1JWAD 3NZ3A 3RD2A 3KUDB 3A1QB 4A3OA 3KWLA 2GMIC 3V3XA 2JZZA 1P0RA 3Q69A 2N4FA 4N9F4 4WJNA 3PHXB 3DVGY 3I57A 3QCAA 4RF0A 5BYSA 1AARA 1E7UA 3DBHI 4ANVA 2CR5A 4LNKA 1KOTA 3K9OB 1EM7A 5GMVA 4GXBA 1HTOA 4XE0A 5HHDG 3OWEB 5BMHA 3I9V1 2KXJA 2MBQA 3VVWB 1R4NB 2KO3A 1E7VA 4E74A 3W5UB 3VXWA 4FJYA 1VCBA 4CHKA 1L0VB 3VH3B 1R4MI 3UIPB 4E3CA 1ET9A 3ZJVA 2YEPB 4BBNF 1FRRA 2Y5PA 1VZ7A 4KKIA 4OW0A 2XN9C 1U4AA 1LFDA 4FULA 2JVCA 2ZCCA 4IWQA 1FCLA 2TSSA 4W9DA 3IG3A 3ZXRA 2JXTA 4AOFA 2K5PA 1UH6A 3AEDB 3Q3MC 3EC8A 4PS8A 2M8SA 5CHWA 2XBBC 1IGDA 1WGRA 1WJNA 2A5UA 3BK2A 4XYCA 1N5WA 1EF5A 4A55A 3Q8FA 3TEYA 4K7UA 2ZCBA 4G3XB 3P4SB 2QDFA 5AZFA 4GOCA 1WRIA 3SDLC 4MJSA 5HKHA 1D5XC 4RGMA 4WJOA 4FJZA 2EELA 1C4AA 4LDTB 2RMMA 1J0GA 1WZ3A 1KLVA 3PZDA 4YSYB 3UQAA 4L1BA 1V1PB 2FUG1 1XLOA 1WJ4A 3RI7C 3NVVA 4WQMA 3FKYA 2JX5A 2K8HA 4FJVB 3T3NA 5IA7A 3PVLA 2G4DB 4KV2A 3P4PB 2D3AA 1ZP0B 1SE4A 4HCPB 4YL8A 2JYTA 1WXVA 3DVGX 4IW0A 2KDMA 2ZVOA 4KIKB 2HTME 3V62A 3AE9B 1K51A 3P63A 2RPQA 3IBEA 4HK2A 5JXVA 1YQBA 4XC2A 2FCQA 1WZ0A 2IY1B 1UBQA 4JIOU 3OJ4B 2AYOB 1H4RA 4EZJA 1I4PA 2O2VB 2INDC 2V3PA 2ZJDA 3U30A 2DZKA 2JPHA 2PTLA 3JW0X 3I3TB 5JHBA 5CHVC 4K1RB 3ZDTA 1FNWA 1P7EA 2E3TA 2L83A 2BQQA 2L1AA 3DBSA 5FKAC 2C7MB 3O65B 2L32A 4TSSA 2KWVB 4K7SA 4MH8A 2N1WA 1V5OA 3VUWA 2KDFB 1T5XD 2MJDA 1T6BX 1UD7A 1MI0A 1Q10A 1CK1A 2LRWA 1KRHA 4HPPA 1E7PB 3AECB 4NAWA 3ZLZA 1V81A 1OEYA 1OFFA 4IOIE 4OHJA 1IYFA 2BGFA 3N1YC 4WIPA 2WXGA 3PRMB 4F8CB 5CX3A 1ACCA 2BKFA 1KLGD 3A1QA 3RUIB 4WWMA 1JWMD 4RCOA 3VTVA 1PYWD 2BYVE 5CHFA 2MJ3A 4LLGM 1FCCC 1HQRD 1HXYD 2WX1A 4HLEA 1HTQA 2FIDA 1SE2A 2C60A 1QOBA 3CSFA 3H1UA 4FHKA 2EMSA 4MELA 3ZDMC 5IOIA 4EKUA 4MJSB 2W82A 4JWUC 1Z5SB 3T3OA 2PEAA 2R61A 1MG4A 3W1YA 1Q1OA 1F2RI 3AN1A 5D3IB 1Q5WB 5IO9A 3DPDA 1HZ6A 5G55A 3GS2A 2KTFA 1ZDVA 1C78A 2C9WB 3PGEA 4JPSA 1HE8A 4W9FA 3LDZE 4RGTA 1D3ZA 3TBLD 4YSZB 3RYTA 1XEEA 3MTNB 1R7SA 4B9KA 1N62A 4KKJA 1RM6C 1XXGA 2AEHA 2W55A 3L16A 1FEHA 4FN2A 4LK0M 1N63A 4IUMB 4JQWC 1MVKA 2WXKA 4FADA 3ZKJC 2BTEA 3U2SC 3ZUNA 1SBBB 3AMZA 5C2TB 4WWOA 2XNAC 4YT0B 4DHJB 3W9CB 4GN1A 1QOAA 3ENEA 4HJGE 1P1AA 3B2GA 3P42A 1WGDA 2O6VB 3AXCA 2LUMA 2L0FA 1L0XB 3HIZA 1L4DB 4NQKE 2WXMA 4WWNA 3M63B 3P4QB 1IBXA 4X57B 3TJPA 4M01A 1S1QB 1UNSA 2KX0A 3B9JA 1FNVA 1WR6E 1EF1A 4HKQA 4LJOB 2IGDA 4MEMA 1C3TA 4AUQC 4DDID 4HPLB 2WXLA 5H92C 2KKCA 2IGGA 2Z8LA 2WLBA 3IHPC 4M02A 1P9DU 4YTMB 3FAHA 5D94A 1YQ3B 3V6CB 4BKTA 1WSPA 3N30A 2J42A 4YTPB 1E8XA 2BWES 3JSVB 3J9CA 4O1NA 4KX6B 2O2VA 1V97A 1K8RB 1ROEA 4K3BA 1SEBD 3AE7B 3ZVVA 4K81A 4MM3B 2LVQA 1NENB 2IJ0A 2CHXA 2MX2A 1V5TA 5BO4B 5JHAA 3Q3JA 2PMVA 2MCNB 4KGSA 2LGSA 3S2AA 1FFVA 3QIJA 5AZGA 3U7DA 1NI2A 2N0SB 3BYYB 3M3JA 2XK5B 1XLPA 1WXAA 2QMTA 3RN9C 2YLMA 2WDRB 3WAMA 4S0RA 4DQOC 2ONQA 5EE0A 4DDGD 2CS4A 5FR6A 2KJHB 2N7JA 2DZJA 1QF6A 4AQ7A 3L10B 2L0TA 2CKHB 1JWSD 3PREA 3LJ3A 1GUAB 4TQ1A 2IZVB 1TGZB 2RR9A 1C9FA 2FCNA 3DBRB 3ZNHB 1PGBA 1AN8A 1JROA 2DHZA 2IBIB 4WURA 2A4ZA 2JRHA 2D3CA 1JMLA 2QCZA 3QAQA 4AJWA 1E10A 2M4NA 2DNFA 2GRIA 1F0ZA 1TJEA 1T0QC 3HHMA 1PDXA 3R7QA 4HDOA 1RYJA 2W9NA 2FE8A 2KVZA 3SFEB 3NS8A 2KWUB 2J0KA 1PGAA 4C80A 1WGKA 5C23A 1RFAA 4IC7B 2ZPYA 3NZSA 2HJ8A 1BT0A 4KGTA 3VTWA 4A3PA 4DHZB 2BS2B 2QIEB 3LYYA 3R66C 3NOBA 2PLPA 1N5XA 1D4BA 4ANWA 1KFYB 1E8ZA 1XCTL 5E6PA 5DPTA 4YXDB 3R7RA 3VDZA 1NVID 1J7AA 2LASA 2L52A 3E9SA 2PE6B 2CU1A 3M95A 3Q8AA 1I4HA 2Y5BB 2C7HA 3AB5A 4KZCA 1ZGUB 2OOBB 4B95A 5BMGA 3EA6A 3ETRA 2K6QA 3H7PB 2V4IB 2MBEA 4RF1A 3GE8C 4IWOA 2N9KA 2NBVB 3IAM1 2DYOA 2ZEQA 1BXTA 5E6OA 2G45B 1JWUD 3QJZA 4W9IA 4IDIA 2I38A 2HDEA 3VRBB 3DHGC 3NS1A 3TEXA 2K39A 1WWTA 4MDKE 4GDKA 3DOWA 4MSMB 3HVDA 1C77A 2WXPA 4MGZE 1E8WA 1QOGA 1TY2A 1VDVA 1WX9A 1XD3B 2NVUI 1VLBA 3KVFB 4Q2JA 4HXDA 3ALBA 3X0WA 4A20A 2XK5A 3ML8A 2ZNVC 4ARCA 2BVCA 3URYA 1Z2MA 2GBJA 3DQVA 1JCKB 1C4CA 3ZRCA 4C00A 4C56C 1OQRA 1WFYA 3DBLB 1SGHA 4PS3A 4IG7B 2G3QB 2KFKA 1FMAD 3B0AA 1F52A 2GLSA 3DVNU 1OEYJ 4GDLB 5JZEB 5T8IA 2DYMA 3KH0A 3GB1A 4NPNA 1B9RA 2VZKB 1T3QA 4DHZE 5BMIA 3MJWA 3SD5A 3U7ZA 2HE7A 2WQYB 2OHFA 3Q3NC 2M56B 2KAJA 3KYCD 2MRPA 1UZXB 2AL3A 2LVPA 3BZDB 4ACFA 3QX1A 4OZBA 1M4VA 2N9EB 4XX5A 4AJYB 3I5JC 2KQSA 4H2AA 4EOYA 3CSTA 2JT4B 2RSUA 2ZVNA 2D5GA 1D5MC 1NEKB 4W9GA 2K8BA 4K3CA 1XT9B 4LNIA 3ZRFA 3VTUA 1VRAB 2WXJA 3VR8B 3MC8A 2GBKA 3BVZA 3KUZA 1I4QA 1YN5A 1DOYA 2V1YA 1RLFA 3L17A 4TMAB 1YN3A 2QJLA 1YIWA 3H9DA 2WDTB 3U4EG 3L54A 5DPWA 4AS1A 4GLSC 3IT6B 1EUVB 3PRPB 5MPOA 1V6EA 3WCQA 2HD5B 3VQIA 2WWZA 3ZJTA 3SEBA 4NNJB 2EKEC 2JZPA 3BVMA 3QQ8B 5HI1A 2KACA 4W9LA 1NDDA 1C79A 3AV8A 3VHTC 3KYDD 1XCQL 1WM3A 2KC2A 3C19A 2WXHA 3GOEA 2KT7A 1TTNA 4HRSA 1IGCA 1WJUA 1AYFA 2W3SA 4P6VF 2RDBC 2X8XX 1FD6A 2D2QA 3R2IA 4KDLB 2LEKA 1WR1A 1ET6A 4BKGA 2RD0A 3APDA 1HZ5A 4GDKB 1MG8A 1E8YA 1TS3A 2WP9B 1IUEA 1PUTA 3IFWB 1GJZA 2MLBA 2VH1A 2MEKA 4ZRKA 4LNOA 4ZOHC 5IN7A 1D5ZC 3ZGZA 1WGGA 1I4GA 1PGXA 4MGYE 2MQJA 3TIXA 2SAKA 4WH4A 4XZ4A 3HUIA 2J53A 3KQ4A 1UF0A 3UF8A 2MWSB 2IYDB 4BZAA 4L23A 2FNJB 5L95C 2KJ6A 5D6JB 1FM0D 5C3JB 4XDCA 3QK0A 3NG0A 3H7PA 4BBNC 2O6VD 3U52E 3RNBC 1SIJA 1I35A 1TIFA 5FR3A 1NI3A 2KDBA 3EECA 3V60A 2DAFA 2OJWA 1YX5B 3PSEB 1UGJA 3MJ5A 1DGJA 3AE4B 3HK0A 4MT5A 4ZHPA 3PZ7A 3TEZA 2B3AA 3PPAA 3VUXA 4BOSC 3W1SA 5TSSA 2DAJA 2D10A 1E90A 2KWCA 3UGBB 1A70A 1T0SC 4J3OD 2C5LC 1FIQA 2AWTA 2MA9B 3FC4A 4WWPA 3DDCB 3LB8C 2AX5A 2ACZB 3MHZA 3B2FA 2WXRA 2AL6A 3RNCC 2M19A 2JYEA 2WXFA 2UYZB 2IO3B 4KVGB 2CJOA 1FO4A 5CTRC 3KW5B 2CHZA 1N60A 4KIKA 2YEPF 4LDTD 1GAQB 4JE3B 4RFBA 2IDYA 3R3MA 3RZFA 2GOWA 5JH5C 2AQ1B 3TL5A 2NBWB 1P7FA 1SE3A 4GIVA 4PYZA 1ZXHA 1ZXIA 1QKZA 4ZDVA 4TUUA 1ESFA 4NAWB 3WALA 1XLNA 3C8YA 4M0WB 2KANA 3Q14C 5GXGB 1K52A 2QILA 1TKEA 4P1BC 2D07B 4B6WA 4PYUA 1LXDA 2RPVA 4C4VB 3NVWA 1XLQA 1CZPA 2WX0A 3DBRI 3FILB 4GGQA 4GSWA 3WIMA 1EU3A 3AU5A 2LRUA 1SJED 3NY5A 3ZIMA 3NVZA 2J4XA 2NTSA 3BK1A 2FIFA 3N32A 3M62B 3AE6B 2JUOA 2N9PC 1YMHE 4DWFA 2JWUA 2LD9A 4WJQA 2MBBB 3ZNGC 1SJHD 3QC8B 3RMKC 2OJRA 5EDSA 2K9XA 2BPSA 2KDEB 1B1ZA 1V80A 2K25A 4HCNB 2B76B 1QZEA 4R3DA 1E5WA 4MGKE 2ASQA 3ML9A 1I4XA 2GB1A 1ZUD2 3OLMD 1WE6A 3I63C 2LGYA 2Z59B 5J2RA 1LO5D 1L6VA 2FCSA 2EKIA 1CQVA 4C7YA 2MP2A 1V86A 3AULA 2KDIA 1TS2A 1LGRA 3TMPB 4M8NA 3RT3B 4OVUA 5EE9A 3RCZA 4QAYA 4F7ZA 3NJTA 4USAA 1V8CA 1STEA 4G0NB 2Q5WD 3CMMB 1YX6B 1WYGA 4HDQA 3V61A 4HJKA 1JALA 3OG5A 2GBRA 1VZ8A 1GB4A 4N59A 2AQ3B 4LTUA 2R2QA 3BVGA 1EWCA 1TT5B 2M1MA 4RGNA 2DENB 1L0YB 2N9LA 3ECIA 3AEEB 2KWDA 3JYUA 4CYEA 2H88B 4LJPB 1L2NA 1AW7A 1XO3A 1WXMA 1I7HA 1EWYC 2D11A 2LGDA 2LUEA 1I4RA 2DZIA 3AE8B 2L7RA 1JWBD 3AE3B 3PT2B 1F9JA 3U8ZA 2LVOA 2WU2B 1YJ1A 3NVYA 2KQ7A 3NUHB 2QHOA 4EZKA 3AI5A 1C1YB 2G9HD 2LJ5A 4N6EB 3JSVA 3P2BA 1D6EC 3VRAB 2BB5A 2DLBA 2KTRA 2J52A 3H6NA 1E9MA 4W9HA 3UIOB 1FNUA 3ZYYX 4JWSC 4DXGA 3P4RB 4PT5A 3TUOA 2KFJA 2N1VA 4BKSD 3N1ZC 3AM9A 1KM7A 3APCA 2KMMA 1IPGA 1UELA 3RULA 1L5PA 1ZE3D 4YWGG 1ZW7A 4US9A 4JGHB 1OQYA 3L4PA 1T0RC 1I42A 2LXAA 2WYQA 2KK8A 4F1SA 4DHJD 2LJIA 2ZNVB 3ZNID 2L76A 4ZYNA 4RM8A 1YQ4B 2ZPNA 3JVZX 1JW9D 1KH0A 4EEWA 4C7ZA 1C76A 3WA0A 1WI0A 2WNMA 4URKA 2CU3A 3N20C 2G1EA 4REZA 3AEFB 2KD0A 4RGOS 1K53A 1J8CA 2MSED 1JQ4A 5KHQA 1F2RC 5HG2A 2WXOA 1WX8A 3DCGA 5E6NA 4E71A 3NZUA 2REXA 3FILA 4ZHOA 5I4DA 4ARIA 1J19A 1T0YA 2IY0B 3O13A 2I1KA 1MPEA 1TY0A 1RRBA 3UINB 4B0EA 3AE5B 1CJEA 2W3RA 1V1PA 3A9JA 3EUB2 4DXFA 2L05A 2INNE 2KYWA 1P3QU 2HJ1A 4XDDA 2KMAA 1UGMA 2YVCA 1WX7A 1OQQA 5KHOA 1KF6B 1FFUA 2NR2A 4FXCA 3ZXVA 3N9YC 1E0ZA 2MW5A 2KX3A 1F77A 3QARA 3Q3OC 4BAXA 4P7IA 1AWDA 3ZTDA 1CMXB 4AWJA 2PW9A 2ZZPB 5C1ZA 1VJKA 4GU2A 3VUYA 2D3BA 3A4SC 2LFIA 2MP2B 1WF9A 3PLUA 4EZLA 3BINA 2MJEA 4TKNA 3AEAB 1WIAA 4NJ7A 2L3ZA 3VFKA 4BFRA 2R2OA 1V49A 3DBHB 1JRPA 5LXHA 3DHHC 2E6XA 4P16A 5E6JA 1QOFA 3E56A 4XWWA 3OJ3A 1WY8A 3IXSA 3PRZA 5BYQA 2Y3AA 1RAXA 2BYTA 1NYQA 1F1HA 2IGHA 1ZDXA 2N9XA 2BWFA 2BYEA 2QC8A 3AEBB 3WANA 3TCAA 1PFDA 3RZWC 1ZKHA 4ZRJA 4NJ6A 1N6ZA 1PQSA 3Q8EA 1YJJA 5H8YE 1HA5A 1M94A 5HFYA 1TKYA 5DPSA 2VH2A 4BKSA 3A9KA 1SF0A 2DZMA 4B0MA 1Y56A 4A6QA 3EGRA 2H89B 4KSLC 3CIRB 1SB3C 1IP9A 4IM0A 1J7BA 2PJHA 2BS4B 4PK1A 3T9LA 1KJTA 1DYQA 4W9JA 5D3DA 4HPMB 3HVZA 2KTRB 1L7YA 2LI5A 3PS6A 1MHHE 1YNTE 2MBOA 4HROA 1SE9A 4US8A 4FLHA 3D32A 1QLBB 2BBCA 4W9KA 4DBGA 4KGRA 2FUHB 3H8HA 4CQNA 3EFUA 1WYWB 2KN4A 3GE3C 3RFZB 1YD8U 3ABVB 4I6LB 1SXTA 2KZRA 3DWMA 2IPKD 3OAWA 4KDIC 3AE2B 2QEJC 4GDLA 2X38A 4D2KA 2I1JA 2K22A 2Y5CA 2IO0B 3A9JB 1WE7A 1A5RA 5G5HA 4YSXB 3PO0A 4I6PA 4MSQB 4NY0A 4MGIE 3DHIC 2NTTA 4FHJA 1QILA 3NHEB 5IAAC 4PS7A 3RNEC 2MHJA 2INPE 4RMAA 1P98A 5AEKB 1YN4A 1YJIA 3V05A 1KLUD 3RNAC 2N7EA 5IKCM 2L8JA 2PE9A 3NRZA 5AZHA 3X23A 5G5GA 2NMQA 4FBJB 5EE1A 2AQ2B 4XWTA 4EUTA 4ANXA 4HVBA 4ZRIA 2WGSA 2JY6A 3UQBA 1WJ6A 4MACA 4NJCA 2LGIA 3GZNB 4IM2A 2J0JA 1NYRA 4II2B 1V9JA 4BVUC 2NS5A 4J6IA
chains in the Genus database with same CATH topology
1IGDA 1I4XA 2GB1A 1PGAA 1ZUD2 3BK2A 3TEWA 4C80A 1N5WA 1WGKA 4A55A 1K50A 3RPFC 3Q8FA 3TEYA 1EU4A 1LO5D 1L6VA 3P4SB 2EKIA 1CQVA 2WU5B 4C7YA 2K0PA 4KGTA 1WRIA 1TS2A 2WDQB 2BS2B 2QIEB 3LYYA 1D5XC 2PLPA 4RGMA 1N5XA 5EE9A 4YTNB 1D4BA 2M0AA 1KFYB 2EELA 2LHDA 1XCTL 1ZPSA 4USAA 1C4AA 1V8CA 3MP9A 4NAMA 4YXDB 2RMMA 1STEA 1NVID 2Q5WD 2GI9A 1WYGA 4YSYB 4N58A 1J7AA 4L1BA 1V1PB 2L52A 1JALA 2FUG1 3E9SA 4ZRQA 1XLOA 3Q8AA 1I4HA 1VZ8A 1GB4A 4N59A 3AB5A 3NVVA 2AQ3B 4WQMA 4LTUA 2JX5A 3T3NA 5BMGA 3BVGA 3EA6A 1EWCA 2K3UA 3P4PB 3ETRA 4RGNA 1FXAA 2V4IB 1IBXB 1L0YB 2PKOA 4RF1A 1ZP0B 2N9LA 2N9KA 3ZQ4A 3AEEB 1SE4A 2KWDA 2PVGC 1RWSA 3IAM1 2DYOA 1BXTA 4OVZA 1JWUD 2H88B 2JYTA 1AW7A 1XO3A 2I38A 4IDIA 1I7HA 1XF5L 1EWYC 2KDMA 5LNK1 2HDEA 2SEBD 4OZAA 1I4RA 2HTME 2WDVB 3VRBB 4ZYSA 3NS1A 3AE8B 3TEXA 3IT4B 2BS3B 3AE9B 1WWTA 1K51A 1JWBD 3AE3B 3P63A 1E6EB 2WU2B 1ENFA 3NVYA 1BMLC 1TS5A 3HVDA 1C77A 5JXVA 1BUIC 2WXPA 3NUHB 3BIID 2G9HD 1QOGA 1TY2A 2LHEA 1VDVA 4N6EB 1VLBA 1C4PA 1D6EC 1J7CA 3BYTB 4Q2JA 2BB5A 3VRAB 2DLBA 1GPXA 1I4PA 2V3PA 4M0WA 2KQ4X 1N61A 2J52A 2PTLA 4ARCA 4A90A 3URYA 4OZCA 1E9MA 2BB6A 4L2YA 1FNUA 3ZYYX 1FNWA 4JWSC 4DXGA 1P7EA 3P4RB 2E3TA 4PT5A 3TUOA 1JCKB 1C4CA 2L83A 4C56C 2L1AA 1OQRA 3AM9A 5FKAC 2L32A 2KMMA 4TSSA 5FK9C 4MH8A 1FMAD 3KLSX 4HEA1 1T5XD 2MJDA 1L5PA 2OEDA 1T6BX 4RH6A 1ZE3D 4YWGG 1KTKA 4ITKA 3VR9B 1MI0A 4US9A 1Q10A 4GDLB 1CK1A 2WXQA 1WXQA 3AH7A 1KRHA 1V1OA 1E7PB 5T8IA 3AECB 2DYMA 3L4PA 3GB1A 1B9RA 1OFFA 2VZKB 4IOIE 5EE3A 1T3QA 4OHJA 2ON8A 4TQ0A 2LJIA 5BMIA 3U7ZA 2WQYB 2OHFA 4WIPA 1TYGB 5BYRA 1YQ4B 2DBYA 2WXGA 2M56B 2KAJA 2BW2A 3IAS1 1JW9D 1KH0A 1ACCA 1KLGD 4C7ZA 1C76A 5AUKA 3LXFA 1GOZA 4EE2A 3BZDB 4WWMA 3CWIA 4OZBA 5AUIA 1JWMD 1M4VA 3AE1B 4RCOA 2WNMA 2CU3A 4H2AA 1PYWD 2G1EA 2MJ3A 4LLGM 4REZA 3AEFB 1FCCC 3TSSA 4RGOS 1HQRD 1HXYD 1DOIA 1K53A 1SE2A 2D5GA 1QOBA 1D5MC 1NEKB 2MH7A 3BWUD 1JQ4A 3GP7A 1F2RC 5HG2A 2WXOA 3Q8CA 2WXIA 2W82A 2FBWB 4ZHOA 3FILA 1VRAB 2WXJA 5I4DA 4ARIA 4JWUC 3VR8B 3BVZA 3T3OA 3O13A 1I4QA 1MPEA 1YN5A 1DOYA 2R61A 4TMAB 1TY0A 1YN3A 1F2RI 2RDGA 2QJLA 4B0EA 3U4EG 3AE5B 5D7GA 1CJEA 2W3RA 4AS1A 4GLSC 3AN1A 3IT6B 1V1PA 5D3IB 3EUB2 4DXFA 3KWVA 1ZOYB 5MPOA 3WCQA 1HZ6A 3R8BA 3VQIA 2BT6A 2INNE 3ZJTA 3SEBA 4HKZE 3GS2A 4XDDA 1ZDVA 2JZPA 3BVMA 5HI1A 1C78A 2KACA 1OQQA 2DWQA 2JQRB 3Q8BA 1C79A 1KF6B 3AV8A 1XCQL 4A9AA 4JPSA 1GB1A 1FFUA 4RGTA 2WXHA 4FXCA 1UWXA 3ZJUA 3N9YC 4YSZB 1E0ZA 1F77A 1UWMA 1XEEA 4HRSA 1AWDA 1IGCA 1R7SA 1N62A 2V3NA 4KKJA 1RM6C 1XXGA 2PW9A 1AYFA 2W55A 2W3SA 4P6VF 1FEHA 1FD6A 3R2IA 2JSVX 4LK0M 1N63A 2LEKA 1MVKA 1VJKA 1ET6A 2WXKA 2BTEA 3U2SC 1HZ5A 1FXIA 4GDKB 2RDHA 1TS3A 2LFIA 1FRDA 1IUEA 1PUTA 2WP9B 1SBBB 3AMZA 5C2TB 2MJEA 2XNAC 2MEKA 3AEAB 2VZKD 3AEGB 4YT0B 4ZRPA 4ZOHC 3W9CB 1D5ZC 1QOAA 3UI3A 4WAFA 3ZGZA 4HJGE 4NZLB 2JU6X 1I4GA 1PGXA 1JRPA 2SAKA 4WH4A 2E6XA 3B2GA 4P16A 1RFKA 2J53A 3HUIA 3P42A 1QOFA 5E6JA 3KQ4A 3E56A 1QT9A 4XWWA 3IXSA 4L23A 5BYQA 2WXNA 2Y3AA 2BYTA 1TKGA 2PIAA 2LUMA 1L0XB 1NYQA 1UUPA 1FM0D 5C3JB 2IGHA 2W54A 4XDCA 1L4DB 1MHXA 1QQRA 2WXMA 1ZDXA 3P4QB 1IBXA 1L4ZB 4RNAA 1UNSA 3AEBB 4JX1C 3U52E 1PFDA 3W5VB 1SIJA 3R2TA 2V0GA 3B9JA 5FR3A 1NI3A 1FNVA 4HKQA 2IGDA 1L6UA 1UGJA 1SSNA 1DGJA 3AE4B 1YJJA 3MJ5A 3Q8EA 4MT5A 3PZ7A 5H8YE 3SR6A 1HA5A 2WXLA 4ZHPA 5H92C 3TEZA 5HFYA 1TKYA 3DWGC 3W1SA 5TSSA 2IGGA 2Z8LA 1SF0A 2ZW0A 4B0MA 1Y56A 2WLBA 3MFGA 4A6QA 1A70A 3EGRA 2H89B 4J3OD 4YTMB 3FAHA 1FIQA 1YQ3B 3CIRB 3HRDD 1SB3C 3FC4A 1WSPA 2J42A 2QSDA 3MC0B 3LB8C 4YTPB 1J7BA 2AX5A 2BS4B 2ACZB 3J9CA 3MHZA 4O1NA 4KX6B 1DYQA 3B2FA 2ICIA 2PVOD 2WXRA 5D3DA 3HVZA 3P1MA 1V97A 2M19A 2I2YA 2JYEA 1ROEA 2WXFA 1SEBD 3PZ8A 1MHHE 1VZ6A 4UDUC 1YNTE 4HROA 3AE7B 4US8A 4MM3B 2ZW1A 2CJOA 1FO4A 1TZOA 2LMCA 1NENB 1VR9A 2IJ0A 1QLBB 2BBCA 2WS3B 4IKGA 3W2DA 1N60A 2YEPF 1GAQB 4JE3B 4RFBA 2IDYA 4KGRA 3H8HA 4CQNA 2AQ1B 2KN4A 3RFZB 2CJNA 2PMVA 4A8XC 3SFDB 1P7FA 4KGSA 1SE3A 3ABVB 1SXTA 3DWMA 2IPKD 1FFVA 1TS4A 1DOXA 3AE2B 1ZXHA 2QEJC 1HEZE 1ZXIA 1JWAD 1QKZA 2X38A 4D2KA 2K22A 3NZ3A 2Y5CA 2N0SB 3BYYB 1ESFA 4NAWB 3KWLA 1XLNA 3C8YA 1XLPA 3V3XA 5G5HA 4YSXB 2QMTA 3PO0A 5GXGB 3Q69A 1K52A 2WDRB 2QILA 4DQOC 2ONQA 5EE0A 1TKEA 2N7JA 2NTTA 1QILA 2RPVA 3NVWA 3I57A 4RF0A 1XLQA 5BYSA 1CZPA 1QF6A 4AQ7A 2INPE 3FILB 1JWSD 1EM7A 1EU3A 1YN4A 4XE0A 1YJIA 5HHDG 4TQ1A 1SJED 3V05A 3OWEB 1KLUD 5BMHA 3NVZA 1C9FA 3I9V1 2J4XA 2NTSA 3BK1A 1PGBA 1AN8A 1JROA 3W5UB 3NRZA 4WURA 3AE6B 1JMLA 1L0VB 1YMHE 5G5GA 2NMQA 1ET9A 3ZJVA 2YEPB 5EE1A 1FRRA 2JWUA 1VZ7A 2Y5PA 4KKIA 1E10A 4OW0A 2AQ2B 2GRIA 2XN9C 4XWTA 1SJHD 1F0ZA 1TJEA 2K9XA 1PDXA 1B1ZA 1RYJA 4MACA 1FCLA 2TSSA 2FE8A 4NJCA 2LGIA 2JXTA 3SFEB 2B76B 2K5PA 4R3DA 1NYRA 3AEDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KX6 B;  3B2F A;  3ZYY X;  2PVO D;  3HVZ A;  3P1M A;  4JWS C;  1OQQ A;  2DWQ A;  3P4R B;  2JQR B;  2E3T A;  1KF6 B;  1V97 A;  3AV8 A;  2M19 A;  1ROE A;  4A9A A;  2L83 A;  1ZUD 2;  1FFU A;  4FXC A;  4HRO A;  4C80 A;  1N5W A;  1WGK A;  3AE7 B;  4US8 A;  1OQR A;  3RPF C;  3AM9 A;  4YSZ B;  1E0Z A;  2CJO A;  1FO4 A;  1UWM A;  2KMM A;  4HRS A;  1NEN B;  1AWD A;  1L6V A;  1QLB B;  2EKI A;  1R7S A;  2WS3 B;  2WU5 B;  1FMA D;  1N60 A;  1N62 A;  3P4S B;  1RM6 C;  2MJD A;  1L5P A;  4C7Y A;  1WRI A;  1AYF A;  1GAQ B;  2W55 A;  2W3S A;  4P6V F;  2WDQ B;  2BS2 B;  2QIE B;  4ITK A;  3VR9 B;  1N63 A;  2LEK A;  5EE9 A;  1N5X A;  4US9 A;  1VJK A;  1WXQ A;  3AH7 A;  1KRH A;  4YTN B;  1KFY B;  1E7P B;  2CJN A;  3AEC B;  1FXI A;  3SFD B;  4USA A;  1FRD A;  1IUE A;  1PUT A;  1V8C A;  2WP9 B;  3ABV B;  3L4P A;  4YXD B;  1B9R A;  1NVI D;  1OFF A;  2Q5W D;  3DWM A;  3AMZ A;  5EE3 A;  1T3Q A;  5C2T B;  1FFV A;  2MJE A;  3AEA B;  1WYG A;  1DOX A;  3AE2 B;  4YSY B;  3AEG B;  1ZXI A;  4N58 A;  1JWA D;  1J7A A;  4YT0 B;  2WQY B;  2K22 A;  2OHF A;  4ZOH C;  2Y5C A;  2L52 A;  1JAL A;  1QOA A;  1TYG B;  2BS4 B;  1YQ4 B;  2DBY A;  2N0S B;  3W9C B;  2M56 B;  1XLO A;  2KAJ A;  3KWL A;  1XLN A;  4N59 A;  1JRP A;  3AB5 A;  1XLP A;  3NVV A;  1JW9 D;  4WQM A;  4LTU A;  5G5H A;  4YSX B;  3B2G A;  2JX5 A;  3PO0 A;  1RFK A;  3HUI A;  5GXG B;  1QOF A;  1QT9 A;  2WDR B;  5EE0 A;  3P4P B;  3ETR A;  4C7Z A;  1TKE A;  5AUK A;  1FXA A;  3LXF A;  4WWM A;  2PKO A;  3CWI A;  5AUI A;  3AE1 B;  2CU3 A;  1TKG A;  1ZP0 B;  2PIA A;  1XLQ A;  3NVW A;  2G1E A;  1CZP A;  2MJ3 A;  3AEE B;  1NYQ A;  2PVG C;  3AEF B;  1QF6 A;  1RWS A;  1FM0 D;  5C3J B;  2W54 A;  1DOI A;  2H88 B;  1QOB A;  1NEK B;  2MH7 A;  4IDI A;  1XO3 A;  1I7H A;  3P4Q B;  1JQ4 A;  1YJI A;  1EWY C;  3NVZ A;  3AEB B;  4JX1 C;  2HTM E;  2WDV B;  3VRB B;  1PFD A;  3W5V B;  3NS1 A;  3AE8 B;  1SIJ A;  2BS3 B;  3AE9 B;  1WWT A;  1JRO A;  3B9J A;  2FBW B;  3NRZ A;  1JWB D;  3AE3 B;  1NI3 A;  3AE6 B;  3P63 A;  3W5U B;  4JWU C;  3VR8 B;  1E6E B;  1L0V B;  5G5G A;  2WU2 B;  1DOY A;  1L6U A;  3NVY A;  5EE1 A;  1DGJ A;  1FRR A;  1YJJ A;  3AE4 B;  1E10 A;  4ZHP A;  5H8Y E;  3SR6 A;  5H92 C;  2QJL A;  3BII D;  1TKY A;  3DWG C;  1QOG A;  3AE5 B;  1CJE A;  2W3R A;  1F0Z A;  1VDV A;  4N6E B;  1SF0 A;  3AN1 A;  1TJE A;  1VLB A;  2K9X A;  1PDX A;  3EUB 2;  2WLB A;  1ZOY B;  1J7C A;  3VRA B;  1GPX A;  1A70 A;  5MPO A;  1RYJ A;  2H89 B;  4YTM B;  3FAH A;  1FIQ A;  1YQ3 B;  3CIR B;  3HRD D;  3WCQ A;  1SB3 C;  1N61 A;  3FC4 A;  3SFE B;  2BT6 A;  2B76 B;  4YTP B;  2K5P A;  3LB8 C;  1J7B A;  1NYR A;  4ZHO A;  1E9M A;  2AX5 A;  2ACZ B;  3AED B; 
#chains in the Genus database with same CATH topology
 5DPR A;  2O6V A;  4G11 A;  2G4S A;  3TEW A;  1K50 A;  3RPF C;  3VAW A;  1EU4 A;  3ZNZ B;  2WU5 B;  2KOX A;  2K0P A;  2KHW B;  2V9H A;  2PPH A;  1VD2 A;  3RNG C;  1MJD A;  1S3S G;  2WDQ B;  1UBI A;  3K9P B;  2KJR A;  4YTN B;  2M0A A;  2LHD A;  4KZ0 A;  1ZPS A;  2GBN A;  5D2M B;  3MP9 A;  4NAM A;  2NPT A;  4W9C A;  2CHW A;  2GI9 A;  1TZ1 A;  4N58 A;  3N1X C;  4ZRQ A;  4JLC A;  2BF8 B;  1OGW A;  3QA8 A;  3ZTC A;  4W9E A;  2K3U A;  1FXA A;  1YOV B;  1IBX B;  2PKO A;  2HTH A;  5J17 A;  2JWZ A;  3DVN V;  1Q0W B;  3ZQ4 A;  2PVG C;  1RWS A;  3PHW B;  1WMH B;  1EO6 A;  2EMT A;  4OVZ A;  2LXC A;  4ANU A;  1XF5 L;  5LNK 1;  2SEB D;  4OZA A;  2WDV B;  4ICU A;  4WQO B;  2D3G A;  4ZYS A;  3IT4 B;  2BS3 B;  2JF5 A;  1E6E B;  3A9K B;  4KSK C;  1ENF A;  1BML C;  2L00 B;  1TS5 A;  1BUI C;  3BII D;  2MBH A;  4GMV A;  1GC6 A;  2LHE A;  2UWQ A;  3SHQ A;  1C4P A;  1J7C A;  3BYT B;  1GPX A;  3VH4 B;  1V2Y A;  3ZW3 A;  4M0W A;  2KQ4 X;  3W1S C;  1N61 A;  2LWP A;  4A90 A;  2KN5 A;  4OZC A;  4MM3 A;  2BB6 A;  4L2Y A;  3ONS A;  3EFC A;  2DYB A;  2NCN A;  3KUC B;  4IM3 A;  2IO2 B;  4M8M A;  5FK9 C;  4LNN A;  4RM9 A;  3KLS X;  4HEA 1;  4ASW C;  2OED A;  4RH6 A;  1KTK A;  4ITK A;  3VR9 B;  2WXQ A;  1WXQ A;  3AH7 A;  1V1O A;  2K8C A;  3PLV A;  5EE3 A;  1OTR B;  2ON8 A;  4TQ0 A;  2LZ6 A;  2K6D B;  1TYG B;  5BYR A;  2DBY A;  4S17 A;  2N7D A;  3PV1 A;  2BW2 A;  2NBU A;  3IAS 1;  3N3K B;  3HM3 A;  5AUK A;  3LXF A;  1GOZ A;  4DXA B;  4EE2 A;  5AUI A;  3CWI A;  3AE1 B;  1GNU A;  1LQB A;  3BY4 B;  4TV3 A;  3TSS A;  1DOI A;  2MH7 A;  3BWU D;  3APF A;  3GP7 A;  4C4V A;  4IWP A;  1GC7 A;  3L08 A;  3Q8C A;  2KLC A;  2FCM A;  2WXI A;  4M00 A;  2FBW B;  2XEW A;  1WGY A;  5LXI B;  1Y8R C;  1FXT B;  3Q6B A;  4G50 A;  3MC9 A;  2RGF A;  1LM8 B;  2RDG A;  2J0M A;  2KVR A;  3QWZ B;  1X1M A;  5D7G A;  4LCD E;  5G2N A;  4LNF A;  3KWV A;  1ZOY B;  2KLG A;  2V3S A;  3MHS D;  3R8B A;  2BYF A;  2BT6 A;  4HKZ E;  3A33 B;  1SIF A;  2VRR B;  1R4N I;  1GG3 A;  4BOZ B;  1G6J A;  2DWQ A;  2JQR B;  1TBE A;  3Q8B A;  5DCN A;  1FPY A;  4A9A A;  2Z0E B;  3Q3F A;  1WMH A;  1GB1 A;  3V6E B;  1UWX A;  1WXS A;  3ZJU A;  5TR5 A;  1UWM A;  1WH3 A;  1XQQ A;  2LGX A;  2V3N A;  5LLI A;  2K1F A;  2JSV X;  3HM6 X;  4GB9 A;  3WAO A;  1R4M B;  3C0R B;  1FXI A;  2RDH A;  1FRD A;  1H8C A;  2M17 A;  2JXX A;  2INC C;  2VZK D;  4XGA B;  3AEG B;  4ZRP A;  2IO1 B;  3UI3 A;  4WAF A;  4NZL B;  2JU6 X;  4DK5 A;  1RFK A;  1QT9 A;  2M0X A;  2WXN A;  3IVF A;  4EFO A;  3L0W B;  1TKG A;  2PIA A;  1UUP A;  2W54 A;  2BKR B;  1MHX A;  1QQR A;  2J7Q B;  5IP4 D;  2JRI B;  3QHT A;  2DX5 B;  2KFK B;  1L4Z B;  4RNA A;  4JX1 C;  3W5V B;  2GBM A;  1MFW A;  1WGH A;  3R2T A;  2V0G A;  3CF6 E;  2KNB A;  2V4L A;  1L6U A;  3DBL I;  1SSN A;  3SR6 A;  2NPT B;  2UU7 A;  3DWG C;  3PTF C;  4HWI B;  3SU8 X;  3ZO5 B;  1NBF C;  3A4R A;  4P1C C;  2ZW0 A;  3H7S A;  3MFG A;  2WHI A;  4JL9 A;  4CO7 A;  4FA6 A;  3HRD D;  3T8M A;  2FAZ A;  3WAP A;  2JZ3 B;  2QSD A;  3MC0 B;  2C7N B;  4I6N B;  4K7W A;  2KMC A;  2ICI A;  2PVO D;  3P1M A;  2Z0D B;  1WRD B;  3L13 A;  3EHV A;  2I2Y A;  1ISN A;  3PZ8 A;  1VZ6 A;  4UDU C;  3B1L X;  1WM2 A;  4WAA A;  2ZW1 A;  1TZO A;  2LMC A;  1VR9 A;  2WS3 B;  4II3 B;  4IKG A;  3W2D A;  1JRU A;  2KC1 A;  4AP4 C;  3RNF C;  5L83 A;  3AU4 A;  2CJN A;  3GZN I;  4A8X C;  3SFD B;  4ICV A;  3B08 A;  4MH0 E;  4WJP A;  4NQL B;  5J18 A;  4OVV A;  3Q2A C;  1TS4 A;  1DOX A;  1HEZ E;  1JWA D;  3NZ3 A;  3RD2 A;  3KUD B;  3A1Q B;  4A3O A;  3KWL A;  2GMI C;  3V3X A;  2JZZ A;  1P0R A;  3Q69 A;  2N4F A;  4N9F 4;  4WJN A;  3PHX B;  3DVG Y;  3I57 A;  3QCA A;  4RF0 A;  5BYS A;  1AAR A;  1E7U A;  3DBH I;  4ANV A;  2CR5 A;  4LNK A;  1KOT A;  3K9O B;  1EM7 A;  5GMV A;  4GXB A;  1HTO A;  4XE0 A;  5HHD G;  3OWE B;  5BMH A;  3I9V 1;  2KXJ A;  2MBQ A;  3VVW B;  1R4N B;  2KO3 A;  1E7V A;  4E74 A;  3W5U B;  3VXW A;  4FJY A;  1VCB A;  4CHK A;  1L0V B;  3VH3 B;  1R4M I;  3UIP B;  4E3C A;  1ET9 A;  3ZJV A;  2YEP B;  4BBN F;  1FRR A;  2Y5P A;  1VZ7 A;  4KKI A;  4OW0 A;  2XN9 C;  1U4A A;  1LFD A;  4FUL A;  2JVC A;  2ZCC A;  4IWQ A;  1FCL A;  2TSS A;  4W9D A;  3IG3 A;  3ZXR A;  2JXT A;  4AOF A;  2K5P A;  1UH6 A;  3AED B;  3Q3M C;  3EC8 A;  4PS8 A;  2M8S A;  5CHW A;  2XBB C;  1IGD A;  1WGR A;  1WJN A;  2A5U A;  3BK2 A;  4XYC A;  1N5W A;  1EF5 A;  4A55 A;  3Q8F A;  3TEY A;  4K7U A;  2ZCB A;  4G3X B;  3P4S B;  2QDF A;  5AZF A;  4GOC A;  1WRI A;  3SDL C;  4MJS A;  5HKH A;  1D5X C;  4RGM A;  4WJO A;  4FJZ A;  2EEL A;  1C4A A;  4LDT B;  2RMM A;  1J0G A;  1WZ3 A;  1KLV A;  3PZD A;  4YSY B;  3UQA A;  4L1B A;  1V1P B;  2FUG 1;  1XLO A;  1WJ4 A;  3RI7 C;  3NVV A;  4WQM A;  3FKY A;  2JX5 A;  2K8H A;  4FJV B;  3T3N A;  5IA7 A;  3PVL A;  2G4D B;  4KV2 A;  3P4P B;  2D3A A;  1ZP0 B;  1SE4 A;  4HCP B;  4YL8 A;  2JYT A;  1WXV A;  3DVG X;  4IW0 A;  2KDM A;  2ZVO A;  4KIK B;  2HTM E;  3V62 A;  3AE9 B;  1K51 A;  3P63 A;  2RPQ A;  3IBE A;  4HK2 A;  5JXV A;  1YQB A;  4XC2 A;  2FCQ A;  1WZ0 A;  2IY1 B;  1UBQ A;  4JIO U;  3OJ4 B;  2AYO B;  1H4R A;  4EZJ A;  1I4P A;  2O2V B;  2IND C;  2V3P A;  2ZJD A;  3U30 A;  2DZK A;  2JPH A;  2PTL A;  3JW0 X;  3I3T B;  5JHB A;  5CHV C;  4K1R B;  3ZDT A;  1FNW A;  1P7E A;  2E3T A;  2L83 A;  2BQQ A;  2L1A A;  3DBS A;  5FKA C;  2C7M B;  3O65 B;  2L32 A;  4TSS A;  2KWV B;  4K7S A;  4MH8 A;  2N1W A;  1V5O A;  3VUW A;  2KDF B;  1T5X D;  2MJD A;  1T6B X;  1UD7 A;  1MI0 A;  1Q10 A;  1CK1 A;  2LRW A;  1KRH A;  4HPP A;  1E7P B;  3AEC B;  4NAW A;  3ZLZ A;  1V81 A;  1OEY A;  1OFF A;  4IOI E;  4OHJ A;  1IYF A;  2BGF A;  3N1Y C;  4WIP A;  2WXG A;  3PRM B;  4F8C B;  5CX3 A;  1ACC A;  2BKF A;  1KLG D;  3A1Q A;  3RUI B;  4WWM A;  1JWM D;  4RCO A;  3VTV A;  1PYW D;  2BYV E;  5CHF A;  2MJ3 A;  4LLG M;  1FCC C;  1HQR D;  1HXY D;  2WX1 A;  4HLE A;  1HTQ A;  2FID A;  1SE2 A;  2C60 A;  1QOB A;  3CSF A;  3H1U A;  4FHK A;  2EMS A;  4MEL A;  3ZDM C;  5IOI A;  4EKU A;  4MJS B;  2W82 A;  4JWU C;  1Z5S B;  3T3O A;  2PEA A;  2R61 A;  1MG4 A;  3W1Y A;  1Q1O A;  1F2R I;  3AN1 A;  5D3I B;  1Q5W B;  5IO9 A;  3DPD A;  1HZ6 A;  5G55 A;  3GS2 A;  2KTF A;  1ZDV A;  1C78 A;  2C9W B;  3PGE A;  4JPS A;  1HE8 A;  4W9F A;  3LDZ E;  4RGT A;  1D3Z A;  3TBL D;  4YSZ B;  3RYT A;  1XEE A;  3MTN B;  1R7S A;  4B9K A;  1N62 A;  4KKJ A;  1RM6 C;  1XXG A;  2AEH A;  2W55 A;  3L16 A;  1FEH A;  4FN2 A;  4LK0 M;  1N63 A;  4IUM B;  4JQW C;  1MVK A;  2WXK A;  4FAD A;  3ZKJ C;  2BTE A;  3U2S C;  3ZUN A;  1SBB B;  3AMZ A;  5C2T B;  4WWO A;  2XNA C;  4YT0 B;  4DHJ B;  3W9C B;  4GN1 A;  1QOA A;  3ENE A;  4HJG E;  1P1A A;  3B2G A;  3P42 A;  1WGD A;  2O6V B;  3AXC A;  2LUM A;  2L0F A;  1L0X B;  3HIZ A;  1L4D B;  4NQK E;  2WXM A;  4WWN A;  3M63 B;  3P4Q B;  1IBX A;  4X57 B;  3TJP A;  4M01 A;  1S1Q B;  1UNS A;  2KX0 A;  3B9J A;  1FNV A;  1WR6 E;  1EF1 A;  4HKQ A;  4LJO B;  2IGD A;  4MEM A;  1C3T A;  4AUQ C;  4DDI D;  4HPL B;  2WXL A;  5H92 C;  2KKC A;  2IGG A;  2Z8L A;  2WLB A;  3IHP C;  4M02 A;  1P9D U;  4YTM B;  3FAH A;  5D94 A;  1YQ3 B;  3V6C B;  4BKT A;  1WSP A;  3N30 A;  2J42 A;  4YTP B;  1E8X A;  2BWE S;  3JSV B;  3J9C A;  4O1N A;  4KX6 B;  2O2V A;  1V97 A;  1K8R B;  1ROE A;  4K3B A;  1SEB D;  3AE7 B;  3ZVV A;  4K81 A;  4MM3 B;  2LVQ A;  1NEN B;  2IJ0 A;  2CHX A;  2MX2 A;  1V5T A;  5BO4 B;  5JHA A;  3Q3J A;  2PMV A;  2MCN B;  4KGS A;  2LGS A;  3S2A A;  1FFV A;  3QIJ A;  5AZG A;  3U7D A;  1NI2 A;  2N0S B;  3BYY B;  3M3J A;  2XK5 B;  1XLP A;  1WXA A;  2QMT A;  3RN9 C;  2YLM A;  2WDR B;  3WAM A;  4S0R A;  4DQO C;  2ONQ A;  5EE0 A;  4DDG D;  2CS4 A;  5FR6 A;  2KJH B;  2N7J A;  2DZJ A;  1QF6 A;  4AQ7 A;  3L10 B;  2L0T A;  2CKH B;  1JWS D;  3PRE A;  3LJ3 A;  1GUA B;  4TQ1 A;  2IZV B;  1TGZ B;  2RR9 A;  1C9F A;  2FCN A;  3DBR B;  3ZNH B;  1PGB A;  1AN8 A;  1JRO A;  2DHZ A;  2IBI B;  4WUR A;  2A4Z A;  2JRH A;  2D3C A;  1JML A;  2QCZ A;  3QAQ A;  4AJW A;  1E10 A;  2M4N A;  2DNF A;  2GRI A;  1F0Z A;  1TJE A;  1T0Q C;  3HHM A;  1PDX A;  3R7Q A;  4HDO A;  1RYJ A;  2W9N A;  2FE8 A;  2KVZ A;  3SFE B;  3NS8 A;  2KWU B;  2J0K A;  1PGA A;  4C80 A;  1WGK A;  5C23 A;  1RFA A;  4IC7 B;  2ZPY A;  3NZS A;  2HJ8 A;  1BT0 A;  4KGT A;  3VTW A;  4A3P A;  4DHZ B;  2BS2 B;  2QIE B;  3LYY A;  3R66 C;  3NOB A;  2PLP A;  1N5X A;  1D4B A;  4ANW A;  1KFY B;  1E8Z A;  1XCT L;  5E6P A;  5DPT A;  4YXD B;  3R7R A;  3VDZ A;  1NVI D;  1J7A A;  2LAS A;  2L52 A;  3E9S A;  2PE6 B;  2CU1 A;  3M95 A;  3Q8A A;  1I4H A;  2Y5B B;  2C7H A;  3AB5 A;  4KZC A;  1ZGU B;  2OOB B;  4B95 A;  5BMG A;  3EA6 A;  3ETR A;  2K6Q A;  3H7P B;  2V4I B;  2MBE A;  4RF1 A;  3GE8 C;  4IWO A;  2N9K A;  2NBV B;  3IAM 1;  2DYO A;  2ZEQ A;  1BXT A;  5E6O A;  2G45 B;  1JWU D;  3QJZ A;  4W9I A;  4IDI A;  2I38 A;  2HDE A;  3VRB B;  3DHG C;  3NS1 A;  3TEX A;  2K39 A;  1WWT A;  4MDK E;  4GDK A;  3DOW A;  4MSM B;  3HVD A;  1C77 A;  2WXP A;  4MGZ E;  1E8W A;  1QOG A;  1TY2 A;  1VDV A;  1WX9 A;  1XD3 B;  2NVU I;  1VLB A;  3KVF B;  4Q2J A;  4HXD A;  3ALB A;  3X0W A;  4A20 A;  2XK5 A;  3ML8 A;  2ZNV C;  4ARC A;  2BVC A;  3URY A;  1Z2M A;  2GBJ A;  3DQV A;  1JCK B;  1C4C A;  3ZRC A;  4C00 A;  4C56 C;  1OQR A;  1WFY A;  3DBL B;  1SGH A;  4PS3 A;  4IG7 B;  2G3Q B;  2KFK A;  1FMA D;  3B0A A;  1F52 A;  2GLS A;  3DVN U;  1OEY J;  4GDL B;  5JZE B;  5T8I A;  2DYM A;  3KH0 A;  3GB1 A;  4NPN A;  1B9R A;  2VZK B;  1T3Q A;  4DHZ E;  5BMI A;  3MJW A;  3SD5 A;  3U7Z A;  2HE7 A;  2WQY B;  2OHF A;  3Q3N C;  2M56 B;  2KAJ A;  3KYC D;  2MRP A;  1UZX B;  2AL3 A;  2LVP A;  3BZD B;  4ACF A;  3QX1 A;  4OZB A;  1M4V A;  2N9E B;  4XX5 A;  4AJY B;  3I5J C;  2KQS A;  4H2A A;  4EOY A;  3CST A;  2JT4 B;  2RSU A;  2ZVN A;  2D5G A;  1D5M C;  1NEK B;  4W9G A;  2K8B A;  4K3C A;  1XT9 B;  4LNI A;  3ZRF A;  3VTU A;  1VRA B;  2WXJ A;  3VR8 B;  3MC8 A;  2GBK A;  3BVZ A;  3KUZ A;  1I4Q A;  1YN5 A;  1DOY A;  2V1Y A;  1RLF A;  3L17 A;  4TMA B;  1YN3 A;  2QJL A;  1YIW A;  3H9D A;  2WDT B;  3U4E G;  3L54 A;  5DPW A;  4AS1 A;  4GLS C;  3IT6 B;  1EUV B;  3PRP B;  5MPO A;  1V6E A;  3WCQ A;  2HD5 B;  3VQI A;  2WWZ A;  3ZJT A;  3SEB A;  4NNJ B;  2EKE C;  2JZP A;  3BVM A;  3QQ8 B;  5HI1 A;  2KAC A;  4W9L A;  1NDD A;  1C79 A;  3AV8 A;  3VHT C;  3KYD D;  1XCQ L;  1WM3 A;  2KC2 A;  3C19 A;  2WXH A;  3GOE A;  2KT7 A;  1TTN A;  4HRS A;  1IGC A;  1WJU A;  1AYF A;  2W3S A;  4P6V F;  2RDB C;  2X8X X;  1FD6 A;  2D2Q A;  3R2I A;  4KDL B;  2LEK A;  1WR1 A;  1ET6 A;  4BKG A;  2RD0 A;  3APD A;  1HZ5 A;  4GDK B;  1MG8 A;  1E8Y A;  1TS3 A;  2WP9 B;  1IUE A;  1PUT A;  3IFW B;  1GJZ A;  2MLB A;  2VH1 A;  2MEK A;  4ZRK A;  4LNO A;  4ZOH C;  5IN7 A;  1D5Z C;  3ZGZ A;  1WGG A;  1I4G A;  1PGX A;  4MGY E;  2MQJ A;  3TIX A;  2SAK A;  4WH4 A;  4XZ4 A;  3HUI A;  2J53 A;  3KQ4 A;  1UF0 A;  3UF8 A;  2MWS B;  2IYD B;  4BZA A;  4L23 A;  2FNJ B;  5L95 C;  2KJ6 A;  5D6J B;  1FM0 D;  5C3J B;  4XDC A;  3QK0 A;  3NG0 A;  3H7P A;  4BBN C;  2O6V D;  3U52 E;  3RNB C;  1SIJ A;  1I35 A;  1TIF A;  5FR3 A;  1NI3 A;  2KDB A;  3EEC A;  3V60 A;  2DAF A;  2OJW A;  1YX5 B;  3PSE B;  1UGJ A;  3MJ5 A;  1DGJ A;  3AE4 B;  3HK0 A;  4MT5 A;  4ZHP A;  3PZ7 A;  3TEZ A;  2B3A A;  3PPA A;  3VUX A;  4BOS C;  3W1S A;  5TSS A;  2DAJ A;  2D10 A;  1E90 A;  2KWC A;  3UGB B;  1A70 A;  1T0S C;  4J3O D;  2C5L C;  1FIQ A;  2AWT A;  2MA9 B;  3FC4 A;  4WWP A;  3DDC B;  3LB8 C;  2AX5 A;  2ACZ B;  3MHZ A;  3B2F A;  2WXR A;  2AL6 A;  3RNC C;  2M19 A;  2JYE A;  2WXF A;  2UYZ B;  2IO3 B;  4KVG B;  2CJO A;  1FO4 A;  5CTR C;  3KW5 B;  2CHZ A;  1N60 A;  4KIK A;  2YEP F;  4LDT D;  1GAQ B;  4JE3 B;  4RFB A;  2IDY A;  3R3M A;  3RZF A;  2GOW A;  5JH5 C;  2AQ1 B;  3TL5 A;  2NBW B;  1P7F A;  1SE3 A;  4GIV A;  4PYZ A;  1ZXH A;  1ZXI A;  1QKZ A;  4ZDV A;  4TUU A;  1ESF A;  4NAW B;  3WAL A;  1XLN A;  3C8Y A;  4M0W B;  2KAN A;  3Q14 C;  5GXG B;  1K52 A;  2QIL A;  1TKE A;  4P1B C;  2D07 B;  4B6W A;  4PYU A;  1LXD A;  2RPV A;  4C4V B;  3NVW A;  1XLQ A;  1CZP A;  2WX0 A;  3DBR I;  3FIL B;  4GGQ A;  4GSW A;  3WIM A;  1EU3 A;  3AU5 A;  2LRU A;  1SJE D;  3NY5 A;  3ZIM A;  3NVZ A;  2J4X A;  2NTS A;  3BK1 A;  2FIF A;  3N32 A;  3M62 B;  3AE6 B;  2JUO A;  2N9P C;  1YMH E;  4DWF A;  2JWU A;  2LD9 A;  4WJQ A;  2MBB B;  3ZNG C;  1SJH D;  3QC8 B;  3RMK C;  2OJR A;  5EDS A;  2K9X A;  2BPS A;  2KDE B;  1B1Z A;  1V80 A;  2K25 A;  4HCN B;  2B76 B;  1QZE A;  4R3D A;  1E5W A;  4MGK E;  2ASQ A;  3ML9 A;  1I4X A;  2GB1 A;  1ZUD 2;  3OLM D;  1WE6 A;  3I63 C;  2LGY A;  2Z59 B;  5J2R A;  1LO5 D;  1L6V A;  2FCS A;  2EKI A;  1CQV A;  4C7Y A;  2MP2 A;  1V86 A;  3AUL A;  2KDI A;  1TS2 A;  1LGR A;  3TMP B;  4M8N A;  3RT3 B;  4OVU A;  5EE9 A;  3RCZ A;  4QAY A;  4F7Z A;  3NJT A;  4USA A;  1V8C A;  1STE A;  4G0N B;  2Q5W D;  3CMM B;  1YX6 B;  1WYG A;  4HDQ A;  3V61 A;  4HJK A;  1JAL A;  3OG5 A;  2GBR A;  1VZ8 A;  1GB4 A;  4N59 A;  2AQ3 B;  4LTU A;  2R2Q A;  3BVG A;  1EWC A;  1TT5 B;  2M1M A;  4RGN A;  2DEN B;  1L0Y B;  2N9L A;  3ECI A;  3AEE B;  2KWD A;  3JYU A;  4CYE A;  2H88 B;  4LJP B;  1L2N A;  1AW7 A;  1XO3 A;  1WXM A;  1I7H A;  1EWY C;  2D11 A;  2LGD A;  2LUE A;  1I4R A;  2DZI A;  3AE8 B;  2L7R A;  1JWB D;  3AE3 B;  3PT2 B;  1F9J A;  3U8Z A;  2LVO A;  2WU2 B;  1YJ1 A;  3NVY A;  2KQ7 A;  3NUH B;  2QHO A;  4EZK A;  3AI5 A;  1C1Y B;  2G9H D;  2LJ5 A;  4N6E B;  3JSV A;  3P2B A;  1D6E C;  3VRA B;  2BB5 A;  2DLB A;  2KTR A;  2J52 A;  3H6N A;  1E9M A;  4W9H A;  3UIO B;  1FNU A;  3ZYY X;  4JWS C;  4DXG A;  3P4R B;  4PT5 A;  3TUO A;  2KFJ A;  2N1V A;  4BKS D;  3N1Z C;  3AM9 A;  1KM7 A;  3APC A;  2KMM A;  1IPG A;  1UEL A;  3RUL A;  1L5P A;  1ZE3 D;  4YWG G;  1ZW7 A;  4US9 A;  4JGH B;  1OQY A;  3L4P A;  1T0R C;  1I42 A;  2LXA A;  2WYQ A;  2KK8 A;  4F1S A;  4DHJ D;  2LJI A;  2ZNV B;  3ZNI D;  2L76 A;  4ZYN A;  4RM8 A;  1YQ4 B;  2ZPN A;  3JVZ X;  1JW9 D;  1KH0 A;  4EEW A;  4C7Z A;  1C76 A;  3WA0 A;  1WI0 A;  2WNM A;  4URK A;  2CU3 A;  3N20 C;  2G1E A;  4REZ A;  3AEF B;  2KD0 A;  4RGO S;  1K53 A;  1J8C A;  2MSE D;  1JQ4 A;  5KHQ A;  1F2R C;  5HG2 A;  2WXO A;  1WX8 A;  3DCG A;  5E6N A;  4E71 A;  3NZU A;  2REX A;  3FIL A;  4ZHO A;  5I4D A;  4ARI A;  1J19 A;  1T0Y A;  2IY0 B;  3O13 A;  2I1K A;  1MPE A;  1TY0 A;  1RRB A;  3UIN B;  4B0E A;  3AE5 B;  1CJE A;  2W3R A;  1V1P A;  3A9J A;  3EUB 2;  4DXF A;  2L05 A;  2INN E;  2KYW A;  1P3Q U;  2HJ1 A;  4XDD A;  2KMA A;  1UGM A;  2YVC A;  1WX7 A;  1OQQ A;  5KHO A;  1KF6 B;  1FFU A;  2NR2 A;  4FXC A;  3ZXV A;  3N9Y C;  1E0Z A;  2MW5 A;  2KX3 A;  1F77 A;  3QAR A;  3Q3O C;  4BAX A;  4P7I A;  1AWD A;  3ZTD A;  1CMX B;  4AWJ A;  2PW9 A;  2ZZP B;  5C1Z A;  1VJK A;  4GU2 A;  3VUY A;  2D3B A;  3A4S C;  2LFI A;  2MP2 B;  1WF9 A;  3PLU A;  4EZL A;  3BIN A;  2MJE A;  4TKN A;  3AEA B;  1WIA A;  4NJ7 A;  2L3Z A;  3VFK A;  4BFR A;  2R2O A;  1V49 A;  3DBH B;  1JRP A;  5LXH A;  3DHH C;  2E6X A;  4P16 A;  5E6J A;  1QOF A;  3E56 A;  4XWW A;  3OJ3 A;  1WY8 A;  3IXS A;  3PRZ A;  5BYQ A;  2Y3A A;  1RAX A;  2BYT A;  1NYQ A;  1F1H A;  2IGH A;  1ZDX A;  2N9X A;  2BWF A;  2BYE A;  2QC8 A;  3AEB B;  3WAN A;  3TCA A;  1PFD A;  3RZW C;  1ZKH A;  4ZRJ A;  4NJ6 A;  1N6Z A;  1PQS A;  3Q8E A;  1YJJ A;  5H8Y E;  1HA5 A;  1M94 A;  5HFY A;  1TKY A;  5DPS A;  2VH2 A;  4BKS A;  3A9K A;  1SF0 A;  2DZM A;  4B0M A;  1Y56 A;  4A6Q A;  3EGR A;  2H89 B;  4KSL C;  3CIR B;  1SB3 C;  1IP9 A;  4IM0 A;  1J7B A;  2PJH A;  2BS4 B;  4PK1 A;  3T9L A;  1KJT A;  1DYQ A;  4W9J A;  5D3D A;  4HPM B;  3HVZ A;  2KTR B;  1L7Y A;  2LI5 A;  3PS6 A;  1MHH E;  1YNT E;  2MBO A;  4HRO A;  1SE9 A;  4US8 A;  4FLH A;  3D32 A;  1QLB B;  2BBC A;  4W9K A;  4DBG A;  4KGR A;  2FUH B;  3H8H A;  4CQN A;  3EFU A;  1WYW B;  2KN4 A;  3GE3 C;  3RFZ B;  1YD8 U;  3ABV B;  4I6L B;  1SXT A;  2KZR A;  3DWM A;  2IPK D;  3OAW A;  4KDI C;  3AE2 B;  2QEJ C;  4GDL A;  2X38 A;  4D2K A;  2I1J A;  2K22 A;  2Y5C A;  2IO0 B;  3A9J B;  1WE7 A;  1A5R A;  5G5H A;  4YSX B;  3PO0 A;  4I6P A;  4MSQ B;  4NY0 A;  4MGI E;  3DHI C;  2NTT A;  4FHJ A;  1QIL A;  3NHE B;  5IAA C;  4PS7 A;  3RNE C;  2MHJ A;  2INP E;  4RMA A;  1P98 A;  5AEK B;  1YN4 A;  1YJI A;  3V05 A;  1KLU D;  3RNA C;  2N7E A;  5IKC M;  2L8J A;  2PE9 A;  3NRZ A;  5AZH A;  3X23 A;  5G5G A;  2NMQ A;  4FBJ B;  5EE1 A;  2AQ2 B;  4XWT A;  4EUT A;  4ANX A;  4HVB A;  4ZRI A;  2WGS A;  2JY6 A;  3UQB A;  1WJ6 A;  4MAC A;  4NJC A;  2LGI A;  3GZN B;  4IM2 A;  2J0J A;  1NYR A;  4II2 B;  1V9J A;  4BVU C;  2NS5 A;  4J6I A; 
#chains in the Genus database with same CATH homology
 1IGD A;  1I4X A;  2GB1 A;  1PGA A;  1ZUD 2;  3BK2 A;  3TEW A;  4C80 A;  1N5W A;  1WGK A;  4A55 A;  1K50 A;  3RPF C;  3Q8F A;  3TEY A;  1EU4 A;  1LO5 D;  1L6V A;  3P4S B;  2EKI A;  1CQV A;  2WU5 B;  4C7Y A;  2K0P A;  4KGT A;  1WRI A;  1TS2 A;  2WDQ B;  2BS2 B;  2QIE B;  3LYY A;  1D5X C;  2PLP A;  4RGM A;  1N5X A;  5EE9 A;  4YTN B;  1D4B A;  2M0A A;  1KFY B;  2EEL A;  2LHD A;  1XCT L;  1ZPS A;  4USA A;  1C4A A;  1V8C A;  3MP9 A;  4NAM A;  4YXD B;  2RMM A;  1STE A;  1NVI D;  2Q5W D;  2GI9 A;  1WYG A;  4YSY B;  4N58 A;  1J7A A;  4L1B A;  1V1P B;  2L52 A;  1JAL A;  2FUG 1;  3E9S A;  4ZRQ A;  1XLO A;  3Q8A A;  1I4H A;  1VZ8 A;  1GB4 A;  4N59 A;  3AB5 A;  3NVV A;  2AQ3 B;  4WQM A;  4LTU A;  2JX5 A;  3T3N A;  5BMG A;  3BVG A;  3EA6 A;  1EWC A;  2K3U A;  3P4P B;  3ETR A;  4RGN A;  1FXA A;  2V4I B;  1IBX B;  1L0Y B;  2PKO A;  4RF1 A;  1ZP0 B;  2N9L A;  2N9K A;  3ZQ4 A;  3AEE B;  1SE4 A;  2KWD A;  2PVG C;  1RWS A;  3IAM 1;  2DYO A;  1BXT A;  4OVZ A;  1JWU D;  2H88 B;  2JYT A;  1AW7 A;  1XO3 A;  2I38 A;  4IDI A;  1I7H A;  1XF5 L;  1EWY C;  2KDM A;  5LNK 1;  2HDE A;  2SEB D;  4OZA A;  1I4R A;  2HTM E;  2WDV B;  3VRB B;  4ZYS A;  3NS1 A;  3AE8 B;  3TEX A;  3IT4 B;  2BS3 B;  3AE9 B;  1WWT A;  1K51 A;  1JWB D;  3AE3 B;  3P63 A;  1E6E B;  2WU2 B;  1ENF A;  3NVY A;  1BML C;  1TS5 A;  3HVD A;  1C77 A;  5JXV A;  1BUI C;  2WXP A;  3NUH B;  3BII D;  2G9H D;  1QOG A;  1TY2 A;  2LHE A;  1VDV A;  4N6E B;  1VLB A;  1C4P A;  1D6E C;  1J7C A;  3BYT B;  4Q2J A;  2BB5 A;  3VRA B;  2DLB A;  1GPX A;  1I4P A;  2V3P A;  4M0W A;  2KQ4 X;  1N61 A;  2J52 A;  2PTL A;  4ARC A;  4A90 A;  3URY A;  4OZC A;  1E9M A;  2BB6 A;  4L2Y A;  1FNU A;  3ZYY X;  1FNW A;  4JWS C;  4DXG A;  1P7E A;  3P4R B;  2E3T A;  4PT5 A;  3TUO A;  1JCK B;  1C4C A;  2L83 A;  4C56 C;  2L1A A;  1OQR A;  3AM9 A;  5FKA C;  2L32 A;  2KMM A;  4TSS A;  5FK9 C;  4MH8 A;  1FMA D;  3KLS X;  4HEA 1;  1T5X D;  2MJD A;  1L5P A;  2OED A;  1T6B X;  4RH6 A;  1ZE3 D;  4YWG G;  1KTK A;  4ITK A;  3VR9 B;  1MI0 A;  4US9 A;  1Q10 A;  4GDL B;  1CK1 A;  2WXQ A;  1WXQ A;  3AH7 A;  1KRH A;  1V1O A;  1E7P B;  5T8I A;  3AEC B;  2DYM A;  3L4P A;  3GB1 A;  1B9R A;  1OFF A;  2VZK B;  4IOI E;  5EE3 A;  1T3Q A;  4OHJ A;  2ON8 A;  4TQ0 A;  2LJI A;  5BMI A;  3U7Z A;  2WQY B;  2OHF A;  4WIP A;  1TYG B;  5BYR A;  1YQ4 B;  2DBY A;  2WXG A;  2M56 B;  2KAJ A;  2BW2 A;  3IAS 1;  1JW9 D;  1KH0 A;  1ACC A;  1KLG D;  4C7Z A;  1C76 A;  5AUK A;  3LXF A;  1GOZ A;  4EE2 A;  3BZD B;  4WWM A;  3CWI A;  4OZB A;  5AUI A;  1JWM D;  1M4V A;  3AE1 B;  4RCO A;  2WNM A;  2CU3 A;  4H2A A;  1PYW D;  2G1E A;  2MJ3 A;  4LLG M;  4REZ A;  3AEF B;  1FCC C;  3TSS A;  4RGO S;  1HQR D;  1HXY D;  1DOI A;  1K53 A;  1SE2 A;  2D5G A;  1QOB A;  1D5M C;  1NEK B;  2MH7 A;  3BWU D;  1JQ4 A;  3GP7 A;  1F2R C;  5HG2 A;  2WXO A;  3Q8C A;  2WXI A;  2W82 A;  2FBW B;  4ZHO A;  3FIL A;  1VRA B;  2WXJ A;  5I4D A;  4ARI A;  4JWU C;  3VR8 B;  3BVZ A;  3T3O A;  3O13 A;  1I4Q A;  1MPE A;  1YN5 A;  1DOY A;  2R61 A;  4TMA B;  1TY0 A;  1YN3 A;  1F2R I;  2RDG A;  2QJL A;  4B0E A;  3U4E G;  3AE5 B;  5D7G A;  1CJE A;  2W3R A;  4AS1 A;  4GLS C;  3AN1 A;  3IT6 B;  1V1P A;  5D3I B;  3EUB 2;  4DXF A;  3KWV A;  1ZOY B;  5MPO A;  3WCQ A;  1HZ6 A;  3R8B A;  3VQI A;  2BT6 A;  2INN E;  3ZJT A;  3SEB A;  4HKZ E;  3GS2 A;  4XDD A;  1ZDV A;  2JZP A;  3BVM A;  5HI1 A;  1C78 A;  2KAC A;  1OQQ A;  2DWQ A;  2JQR B;  3Q8B A;  1C79 A;  1KF6 B;  3AV8 A;  1XCQ L;  4A9A A;  4JPS A;  1GB1 A;  1FFU A;  4RGT A;  2WXH A;  4FXC A;  1UWX A;  3ZJU A;  3N9Y C;  4YSZ B;  1E0Z A;  1F77 A;  1UWM A;  1XEE A;  4HRS A;  1AWD A;  1IGC A;  1R7S A;  1N62 A;  2V3N A;  4KKJ A;  1RM6 C;  1XXG A;  2PW9 A;  1AYF A;  2W55 A;  2W3S A;  4P6V F;  1FEH A;  1FD6 A;  3R2I A;  2JSV X;  4LK0 M;  1N63 A;  2LEK A;  1MVK A;  1VJK A;  1ET6 A;  2WXK A;  2BTE A;  3U2S C;  1HZ5 A;  1FXI A;  4GDK B;  2RDH A;  1TS3 A;  2LFI A;  1FRD A;  1IUE A;  1PUT A;  2WP9 B;  1SBB B;  3AMZ A;  5C2T B;  2MJE A;  2XNA C;  2MEK A;  3AEA B;  2VZK D;  3AEG B;  4YT0 B;  4ZRP A;  4ZOH C;  3W9C B;  1D5Z C;  1QOA A;  3UI3 A;  4WAF A;  3ZGZ A;  4HJG E;  4NZL B;  2JU6 X;  1I4G A;  1PGX A;  1JRP A;  2SAK A;  4WH4 A;  2E6X A;  3B2G A;  4P16 A;  1RFK A;  2J53 A;  3HUI A;  3P42 A;  1QOF A;  5E6J A;  3KQ4 A;  3E56 A;  1QT9 A;  4XWW A;  3IXS A;  4L23 A;  5BYQ A;  2WXN A;  2Y3A A;  2BYT A;  1TKG A;  2PIA A;  2LUM A;  1L0X B;  1NYQ A;  1UUP A;  1FM0 D;  5C3J B;  2IGH A;  2W54 A;  4XDC A;  1L4D B;  1MHX A;  1QQR A;  2WXM A;  1ZDX A;  3P4Q B;  1IBX A;  1L4Z B;  4RNA A;  1UNS A;  3AEB B;  4JX1 C;  3U52 E;  1PFD A;  3W5V B;  1SIJ A;  3R2T A;  2V0G A;  3B9J A;  5FR3 A;  1NI3 A;  1FNV A;  4HKQ A;  2IGD A;  1L6U A;  1UGJ A;  1SSN A;  1DGJ A;  3AE4 B;  1YJJ A;  3MJ5 A;  3Q8E A;  4MT5 A;  3PZ7 A;  5H8Y E;  3SR6 A;  1HA5 A;  2WXL A;  4ZHP A;  5H92 C;  3TEZ A;  5HFY A;  1TKY A;  3DWG C;  3W1S A;  5TSS A;  2IGG A;  2Z8L A;  1SF0 A;  2ZW0 A;  4B0M A;  1Y56 A;  2WLB A;  3MFG A;  4A6Q A;  1A70 A;  3EGR A;  2H89 B;  4J3O D;  4YTM B;  3FAH A;  1FIQ A;  1YQ3 B;  3CIR B;  3HRD D;  1SB3 C;  3FC4 A;  1WSP A;  2J42 A;  2QSD A;  3MC0 B;  3LB8 C;  4YTP B;  1J7B A;  2AX5 A;  2BS4 B;  2ACZ B;  3J9C A;  3MHZ A;  4O1N A;  4KX6 B;  1DYQ A;  3B2F A;  2ICI A;  2PVO D;  2WXR A;  5D3D A;  3HVZ A;  3P1M A;  1V97 A;  2M19 A;  2I2Y A;  2JYE A;  1ROE A;  2WXF A;  1SEB D;  3PZ8 A;  1MHH E;  1VZ6 A;  4UDU C;  1YNT E;  4HRO A;  3AE7 B;  4US8 A;  4MM3 B;  2ZW1 A;  2CJO A;  1FO4 A;  1TZO A;  2LMC A;  1NEN B;  1VR9 A;  2IJ0 A;  1QLB B;  2BBC A;  2WS3 B;  4IKG A;  3W2D A;  1N60 A;  2YEP F;  1GAQ B;  4JE3 B;  4RFB A;  2IDY A;  4KGR A;  3H8H A;  4CQN A;  2AQ1 B;  2KN4 A;  3RFZ B;  2CJN A;  2PMV A;  4A8X C;  3SFD B;  1P7F A;  4KGS A;  1SE3 A;  3ABV B;  1SXT A;  3DWM A;  2IPK D;  1FFV A;  1TS4 A;  1DOX A;  3AE2 B;  1ZXH A;  2QEJ C;  1HEZ E;  1ZXI A;  1JWA D;  1QKZ A;  2X38 A;  4D2K A;  2K22 A;  3NZ3 A;  2Y5C A;  2N0S B;  3BYY B;  1ESF A;  4NAW B;  3KWL A;  1XLN A;  3C8Y A;  1XLP A;  3V3X A;  5G5H A;  4YSX B;  2QMT A;  3PO0 A;  5GXG B;  3Q69 A;  1K52 A;  2WDR B;  2QIL A;  4DQO C;  2ONQ A;  5EE0 A;  1TKE A;  2N7J A;  2NTT A;  1QIL A;  2RPV A;  3NVW A;  3I57 A;  4RF0 A;  1XLQ A;  5BYS A;  1CZP A;  1QF6 A;  4AQ7 A;  2INP E;  3FIL B;  1JWS D;  1EM7 A;  1EU3 A;  1YN4 A;  4XE0 A;  1YJI A;  5HHD G;  4TQ1 A;  1SJE D;  3V05 A;  3OWE B;  1KLU D;  5BMH A;  3NVZ A;  1C9F A;  3I9V 1;  2J4X A;  2NTS A;  3BK1 A;  1PGB A;  1AN8 A;  1JRO A;  3W5U B;  3NRZ A;  4WUR A;  3AE6 B;  1JML A;  1L0V B;  1YMH E;  5G5G A;  2NMQ A;  1ET9 A;  3ZJV A;  2YEP B;  5EE1 A;  1FRR A;  2JWU A;  1VZ7 A;  2Y5P A;  4KKI A;  1E10 A;  4OW0 A;  2AQ2 B;  2GRI A;  2XN9 C;  4XWT A;  1SJH D;  1F0Z A;  1TJE A;  2K9X A;  1PDX A;  1B1Z A;  1RYJ A;  4MAC A;  1FCL A;  2TSS A;  2FE8 A;  4NJC A;  2LGI A;  2JXT A;  3SFE B;  2B76 B;  2K5P A;  4R3D A;  1NYR A;  3AED B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...