1WGHA

Solution structure of mouse ubiquitin-like 3 protein
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
116
structure length
116
Chain Sequence
GSSGSSGMSSHVPADMINLRLILVSGKTKEFLFSPNDSASDIAKHVYDNWPMDWEEEQVSSPNILRLIYQGRFLHGNVTLGALKLPFGKTTVMHLVARETLPEPNSQGQRSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords ubiquitin-like 3
publication title Solution Structure of Mouse Ubiquitin-like 3 Protein
rcsb
source organism Mus musculus
total genus 11
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2004-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wghA01
2ZPYA 1XQQA 2BF8B 4MGIE 2GBMA 3UQAA 4KSLC 1I35A 4FJYA 4J6IA 4FHKA 3R7RA 4ZRIA 2DZIA 3DCGA 3QCAA 4MDKE 1CMXB 2FNJB 2D11A 3VFKA 3APCA 4B9KA 3NHEB 2C7HA 1V6EA 2ZVNA 1UZXB 2O6VA 3VAWA 2DZJA 3VUXA 3T9LA 5LXHA 3B1LX 3PV1A 4GXBA 2IBIB 3WAPA 1EF5A 1ZKHA 1WX9A 1EF1A 3DVNU 2AYOB 3VTUA 3IVFA 2FCNA 3MHSD 3DBRI 4W9LA 4FA6A 2Z0DB 4ZDVA 4PS8A 1OQYA 1JRUA 5AZGA 2R2QA 3H6NA 4ANVA 2DZMA 4MJSA 1SIFA 2KANA 2LRUA 3B0AA 3H1UA 4JIOU 3UQBA 2KFJA 1R4NI 1SGHA 3A4SC 1OEYA 3WAOA 3ZTCA 4LDTD 2LXAA 3BY4B 4NAWA 4MM3A 2KKCA 4AJWA 3EFUA 3A1QA 3AULA 4M0WB 4HK2A 4NY0A 1YX6B 5KHOA 3PVLA 5J18A 1J0GA 2NS5A 3KYCD 2I1KA 5E6OA 4BKGA 3TJPA 4G0NB 3APDA 2JUOA 2L0TA 3HK0A 2DAJA 2ZJDA 4G11A 2CU1A 2LGDA 4HDQA 1S1QB 2Z0EB 3HM3A 2G4DB 2L3ZA 1WGHA 2V4LA 2BKFA 4KIKA 3B08A 1E5WA 4PS7A 4ZRJA 2XEWA 3ZIMA 1LM8B 1WIAA 4MH0E 4B6WA 2EMSA 2KC2A 4WQOB 4CYEA 1K8RB 2J7QB 5CHVC 1QZEA 2V3SA 1E7UA 4ICVA 3TIXA 2GBKA 2L76A 3A4RA 3NY5A 1P3QU 2J0KA 4FADA 3KUZA 3H7PA 2M4NA 4WJOA 4NJ7A 3V61A 3ML9A 2JZ3B 2G4SA 3U7DA 1TBEA 4K7UA 4ZYNA 4M8NA 4NQLB 3DBLI 3VHTC 3VVWB 2WX0A 4EZJA 2ZCCA 1WXVA 2LRWA 2CHWA 2O6VB 3OAWA 2DZKA 1KJTA 3X23A 3JSVB 2EMTA 4FLHA 3GZNI 3VH3B 1XT9B 3QJZA 4XX5A 3ZUNA 2MSED 4HLEA 3UGBB 2GOWA 4TUUA 3ZLZA 2KDEB 3PLUA 3PLVA 1VCBA 3KUDB 4HCPB 4DWFA 1WX7A 2NPTB 3QQ8B 4MJSB 5G55A 3VUYA 3VXWA 5G2NA 2RSUA 3R7QA 2PPHA 3ZNID 4XZ4A 4ANWA 3ZDTA 2BYFA 2W9NA 3TCAA 2DAFA 1P9DU 5JH5C 1R4MI 4PYZA 1TTNA 2D10A 3QARA 1LQBA 2CHXA 2OOBB 1H8CA 2IY1B 3N30A 3A1QB 3PGEA 4GMVA 1YD8U 3X0WA 2WDTB 3RYTA 3KYDD 3L16A 3V6CB 2D2QA 4TKNA 2IO0B 4IM2A 3ZNHB 2MLBA 3ZW3A 3U8ZA 2IYDB 2KDIA 1VD2A 1UBIA 2V1YA 3UIPB 4W9HA 3A9JA 2KXJA 4KIKB 1D3ZA 3QWZB 4FN2A 1UD7A 1LFDA 2ZVOA 3IHPC 3QIJA 3TBLD 5J2RA 3OJ4B 3H9DA 1UH6A 1OEYJ 2KTRA 4IG7B 2MW5A 4HVBA 1Q0WB 3H7PB 1WR6E 2FIDA 2EKEC 3CSTA 3IBEA 3JW0X 4IM0A 2BPSA 4NNJB 1WE6A 4OVUA 1WI0A 4RMAA 4RM9A 5D7GA 4W9IA 4G3XB 3ML8A 1RAXA 2VRRB 4EKUA 4GIVA 3A9KB 4FHJA 4KZ0A 4KV2A 2J0MA 3M63B 3ONSA 2LXCA 4DK5A 2MBOA 2MX2A 4BVUC 2HJ8A 4KDLB 2CS4A 3SD5A 1V9JA 2CHZA 2GBNA 3UIOB 3EECA 3ZRFA 2AL3A 2K6QA 3Q3FA 3JSVA 2MA9B 2C7MB 4DXAB 2KDFB 2XK5A 4GU2A 3KH0A 2LZ6A 1V5TA 2BYVE 3DOWA 5AEKB 3M95A 2LI5A 2PE9A 1V80A 2K8BA 3LDZE 4N9F4 3JVZX 1IP9A 3AU4A 3KW5B 3T8MA 1GNUA 2G45B 2NPTA 4LDTB 5AZHA 4W9EA 2IZVB 4BOSC 2MCNB 1RRBA 5J17A 2C60A 2N1VA 2KQ7A 3P2BA 4G50A 4JLCA 4KVGB 1PQSA 3SU8X 3W1YA 5DPSA 4EZLA 2K1FA 3L54A 3C0RB 3MJWA 3A9JB 3M3JA 2JPHA 2KOXA 5L83A 1RLFA 3PHXB 3QA8A 4GB9A 2DENB 4DDID 4E71A 5JZEB 2JRHA 4LJPB 2IY0B 2IO2B 2KTRB 1YX5B 2LVOA 4GDKB 4GSWA 3VTWA 2KNBA 2R2OA 2ZZPB 4E74A 4BOZB 2KWCA 2LGXA 4IW0A 1WZ3A 4ASWC 2Z59B 2C9WB 4TV3A 4W9KA 3AXCA 2MBBB 1NI2A 2HD5B 4II2B 2L00B 3RULA 4DHJD 3NZUA 2DX5B 2ASQA 3PREA 2LGYA 4IWQA 3O65B 5LLIA 5CHFA 2FIFA 5IAAC 3MTNB 5C23A 2ZCBA 4IWPA 1Z5SB 2JVCA 2K25A 2DHZA 1V2YA 3R66C 4EFOA 3A9KA 3SDLC 2LVQA 3JYUA 3ENEA 3BINA 1V49A 3L0WB 2XK5B 4LJOB 3APFA 2O2VA 2YLMA 3L17A 4DHZE 1WRDB 4WAAA 3ZNGC 4WJQA 3N3KB 1ZGUB 4AUQC 4HWIB 4W9CA 3HHMA 1Y8RC 2KTFA 4GDLA 5E6NA 1NBFC 2LD9A 2KLGA 3LJ3A 1ZW7A 1E8XA 4EEWA 3K9PB 2JXXA 3V6EB 4PYUA 3DVNV 1AARA 1WF9A 2KDBA 4GN1A 4A3OA 4DDGD 1ISNA 4JGHB 5C1ZA 1E8WA 3PS6A 2BYEA 2RPQA 4IWOA 4W9DA 1WYWB 3W1SA 4GGQA 4KSKC 3W1SC 4E3CA 2KWVB 2FAZA 2K39A 2LASA 5L95C 3WAMA 1G6JA 3TMPB 4NPNA 1UELA 2OJRA 3DQVA 2BGFA 2BWES 3OLMD 5DCNA 1GC7A 2KD0A 4MSQB 2K8CA 3ZVVA 2RR9A 2GBRA 3U30A 3WALA 5D94A 4TQ0A 3V62A 4CHKA 1KOTA 1WXSA 3OJ3A 4GDKA 2MWSB 1E90A 3RZWC 2ZNVB 4AOFA 4W9FA 4EUTA 2HE7A 2KFKB 1YIWA 4P7IA 2L05A 4I6LB 2MBQA 3CF6E 3PHWB 4AWJA 3Q3JA 2JZZA 4TQ1A 1WMHA 1Z2MA 3IG3A 4JL9A 2M8SA 3UINB 2NBUA 4IC7B 1GJZA 1F9JA 4YL8A 1WJNA 5EDSA 1WJ6A 2UYZB 4HJKA 4OVVA 5CHWA 1FXTB 3PRMB 2BKRB 4W9GA 5E6PA 3SHQA 2ZEQA 2M0XA 2CKHB 3RT3B 2KHWB 2O2VB 4K7SA 1WH3A 2RGFA 3HIZA 4DBGA 2DYMA 4MSMB 3VH4B 4FJZA 3HM6X 3D32A 3L13A 5DPWA 3NOBA 2AL6A 3AI5A 2AEHA 3K9OB 2DYOA 4MGYE 1WJ4A 3QAQA 3DVGX 4GDLB 4F8CB 2J0JA 2K6DB 1J8CA 3DPDA 4AJYB 4HDOA 2MBEA 1WGGA 2WYQA 3A33B 4F7ZA 2KQSA 1IPGA 3QC8B 3PRZA 3ZTDA 1TZ1A 2MQJA 2WWZA 1S3SG 1YJ1A 2QHOA 5AZFA 4M8MA 5HKHA 1A5RA 1KM7A 4BKTA 1WX8A 2AWTA 4NJ6A 3PRPB 2KN5A 3GOEA 1OGWA 3AU5A 4KZCA 4EOYA 2C5LC 2KK8A 4JQWC 1WM2A 3PZDA 3RD2A 1NDDA 2LUEA 1C3TA 1WY8A 2FCQA 3L10B 1V86A 2KX0A 3M62B 4DHZB 2N9PC 3RUIB 2KX3A 5GMVA 4WJPA 4W9JA 2FUHB 3PPAA 2I1JA 4IM3A 4AP4C 2JRIB 1UBQA 3S2AA 2NCNA 3PT2B 4K1RB 1C1YB 1U4AA 4WWNA 2NR2A 4DHJB 4II3B 2N7EA 4MGZE 4MELA 1WMHB 3EHVA 3H7SA 4HXDA 1E8YA 2ZNVC 1M94A 1WGRA 2KFKA 2CR5A 2NVUI 5DPTA 1TGZB 3ZDMC 5IA7A 4I6NB 2JY6A 3ECIA 4K7WA 4BKSD 4FJVB 4FBJB 3NS8A 1V5OA 4ICUA 1SE9A 4PS3A 2MP2A 2LJ5A 3DBSA 4NQKE 2XBBC 1OTRB 3I3TB 1UGMA 1H4RA 2LVPA 4K81A 5KHQA 2N4FA 3EC8A 3VQIA 3IFWB 2KVRA 4WJNA 4GOCA 2GBJA 2REXA 2NBWB 2G3QB 3V60A 4MGKE 1WXAA 3R3MA 4BBNC 2B3AA 1GG3A 3QK0A 1E8ZA 2JT4B 1WGDA 5D6JB 5TR5A 2PE6B 4URKA 1WGYA 1WR1A 2LWPA 4CO7A 1WXMA 2KJ6A 2D07B 1LXDA 2MRPA 4HPLB 3RZFA 3PTFC 2KWUB 2BWFA 5BO4B 3KVFB 4KDIC 3WANA 3ZO5B 4F1SA 2O6VD 1P98A 2M17A 1I42A 2N7DA 1V81A 5FR6A 1WFYA 4RM8A 3WA0A 2JF5A 1EO6A 2HTHA 5CX3A 3DVGY 2IO1B 3DBHI 3DDCB 2JWZA 3CMMB 1HE8A 1L2NA 3ZRCA 2ZPNA 2L7RA 5DPRA 1YQBA 4XC2A 3RCZA 2PJHA 4B95A 2IO3B 1BT0A 1L7YA 2YVCA 3KUCB 4FULA 4WWPA 3VTVA 3ALBA 2FCSA 2KJRA 1X1MA 2KZRA 2M1MA 4NAWB 4MEMA 3TL5A 3PSEB 1EUVB 4ANUA 2MBHA 1Q1OA 1KLVA 4ZRKA 1GC6A 2N9XA 3CSFA 4BBNF 5JHAA 5JHBA 2NBVB 2KLCA 2L8JA 1WZ0A 5CTRC 2GMIC 3QHTA 4HPMB 2RD0A 4A20A 2FCMA 4BKSA 1T0YA 2A4ZA 3VDZA 4ANXA 2Y5BB 3N32A 1WM3A 2PEAA 2UWQA 4LCDE 3ZKJC 2L0FA 2MP2B 1E7VA 2A5UA 5D2MB 3ZNZB 3VUWA 2KJHB 4A3PA 4EZKA 2N9EB 4X57B 1P0RA 2KMAA 1Q5WB 1WJUA 1P1AA 2KMCA 3QX1A 3NZSA 4IUMB 4BFRA 1XD3B 4WWOA 3WIMA 2D3GA 2K8HA 1IYFA 4HCNB 1RFAA 2KC1A 2DYBA 2C7NB 1GUAB 2N1WA 1J19A 5LXIB 1WE7A 2WX1A 4I6PA 2KO3A 3L08A 3UF8A 1MG8A
chains in the Genus database with same CATH superfamily
1TJEA 2ZPYA 4MGIE 1I35A 3UQAA 3ZYYX 3VFKA 3NHEB 2EKIA 1DGJA 2ZVNA 3T9LA 1NVID 4GXBA 3P4SB 3WAPA 2HJ1A 1EF5A 4LLGM 3N1ZC 3DVNU 3RI7C 4JPSA 5H92C 3MHSD 3DBRI 4JWUC 4ZDVA 1OQYA 4ANVA 1C4CA 4MJSA 3MP9A 1SIFA 2LRUA 2WXGA 4TSSA 4JIOU 3UQBA 1JRPA 1R4NI 1OEYA 1C4PA 4LDTD 3BY4B 1L4ZB 3TEWA 4HK2A 5KHOA 1FNVA 5E6OA 5FK9C 3U2SC 1NI3A 2L0TA 3HK0A 2ZJDA 4HDQA 1S1QB 2L3ZA 4OVZA 2LFIA 2V4LA 4KIKA 1E5WA 3Q8FA 2XEWA 2LGIA 1TY0A 1WIAA 4MH0E 4B6WA 2EMSA 3EFCA 4WQOB 1QZEA 1VRAB 2GBKA 2L32A 1P3QU 2J0KA 2INCC 3H7PA 4WJOA 4NJ7A 2G4SA 4ZYNA 4NQLB 2LUMA 3VHTC 1JWBD 1NYQA 2WDRB 4O1NA 2DZKA 1KJTA 3BYTB 1FCLA 2EMTA 4FLHA 5BYSA 4NJCA 4XWWA 1I4GA 1CQVA 1E9MA 1HQRD 1WWTA 2MHJA 2GOWA 4TUUA 2WQYB 1V1PA 1QF6A 2M56B 2NPTB 4MJSB 1C9FA 1C78A 3R7QA 2PPHA 1OQRA 5JH5C 2DAFA 1K52A 2PVOD 1R4MI 1SF0A 2D10A 1LQBA 4GMVA 1YD8U 3TEXA 2WDTB 2IO0B 4IM2A 2MLBA 2INNE 2IYDB 2KDIA 1UBIA 2KXJA 4KIKB 1D3ZA 3QWZB 2HTME 3R2IA 4FN2A 2ZVOA 1LFDA 3QIJA 5J2RA 3H9DA 4IG7B 2Z8LA 3H7PB 3MC0B 3CSTA 4OVUA 2PIAA 4W9IA 4YSXB 2VRRB 2FBWB 2BVCA 3BVGA 1SE4A 1MPEA 4FHJA 3M63B 1GB1A 3RNCC 3R2TA 2W55A 2GBNA 3UIOB 3EECA 1TIFA 3Q2AC 4JWSC 1JW9D 3JSVA 2MA9B 1V1PB 2PMVA 2KDFB 4ZHPA 4L2YA 2BYVE 3I5JC 2WDVB 3P4PB 2PE9A 1ET9A 1V80A 1ZOYB 1LGRA 1WXQA 3AE4B 2G45B 2WNMA 4W9EA 4BOSC 2MCNB 1K53A 1TY2A 4YT0B 3W1YA 3P2BA 2K1FA 3HRDD 2BW2A 3W5UB 1ENFA 3EA6A 1HZ6A 4GB9A 3CWIA 1SIJA 2I38A 2IO2B 4JX1C 1TKEA 3VTWA 1QOFA 1QOBA 2WU2B 2J42A 2ZZPB 4BOZB 1V8CA 2KWCA 3BZDB 2DBYA 4TV3A 4W9KA 2WXPA 2ASQA 1UWXA 3O65B 2ZCBA 2K25A 2DHZA 1V2YA 3RFZB 3JYUA 4LJOB 2YLMA 1L0XB 4WAAA 4RCOA 3AE9B 3N3KB 4HWIB 2KTFA 5E6NA 4ZOHC 2LD9A 4HEA1 4RNAA 1K51A 2LEKA 1BXTA 4PYUA 1AARA 5HHDG 4DDGD 4IWOA 2BYEA 2RPQA 3FC4A 2KWVB 2K39A 3WAMA 1G6JA 1T0RC 1UELA 1M4VA 2BWES 4HKZE 3RNFC 2IJ0A 3NVYA 5DCNA 1GC7A 2IPKD 2KD0A 3ZVVA 3WALA 2MWSB 4W9FA 2HE7A 2B76B 2L05A 1PGBA 1B1ZA 3CF6E 3PHWB 3Q3JA 4TQ1A 3E56A 1FM0D 4HJGE 4KKJA 3LB8C 3BK1A 1PUTA 1WJNA 5EDSA 1DYQA 4HJKA 2UYZB 4OVVA 1DOXA 3RT3B 3DHHC 2WXKA 2KHWB 4K7SA 2RGFA 3ZJVA 4NAMA 2DYMA 4MSMB 2SAKA 3WCQA 5DPWA 3K9OB 4MGYE 2DYOA 5G5HA 1WJ4A 3TEZA 3W9CB 3SFEB 4IKGA 2J0JA 3P42A 4IDIA 3TSSA 2QC8A 3DPDA 4HDOA 2WGSA 2MQJA 4YTPB 1YJ1A 3NVWA 3AMZA 1WX8A 3PRPB 3MC8A 2KK8A 2BYTA 1KF6B 3PZDA 2QSDA 1V86A 3M62B 2N9PC 1I4QA 2KX3A 2I1JA 1HEZE 1V1OA 3AEAB 2NCNA 4K1RB 4WWNA 4K3CA 2OJWA 4DXFA 4II3B 4MGZE 4MELA 3EHVA 1WGRA 2KFKA 5DPTA 3T3OA 4I6NB 4BKSD 4MT5A 2N0SB 3NG0A 3DBSA 1WYGA 3I3TB 1FD6A 4XGAB 5KHQA 2N4FA 4PT5A 4GOCA 2KAJA 1WXAA 3ABVB 4BBNC 1E8ZA 1XLNA 3P4QB 3VRAB 1ESFA 2LWPA 1J7AA 1SE2A 2D07B 1XLQA 2KWUB 2BWFA 1I42A 1YMHE 4L23A 3DBHI 3DHGC 2JWZA 1L2NA 2LMCA 2ZPNA 1YQBA 1L7YA 3KUCB 4NAWB 3TL5A 4ANUA 1TKGA 2GMIC 4A9AA 4HPMB 4A20A 1YN5A 5IO9A 1GOZA 1T0YA 2A4ZA 3GZNB 1WM3A 2UWQA 3N32A 4LNOA 3ZKJC 4S17A 5IP4D 2IGGA 1QQRA 2A5UA 4X57B 4IUMB 4BFRA 2GB1A 1V97A 2D3GA 2K8HA 1IYFA 2DYBA 3PZ8A 5HI1A 1J19A 1FPYA 2JQRB 1IUEA 3KUZA 1MG8A 1XQQA 5EE0A 1CZPA 2DZIA 1ET6A 5GXGB 1XF5L 1CMXB 2D11A 1UZXB 2O6VA 3VAWA 3PV1A 2IBIB 3BWUD 1WX9A 2M19A 1JWMD 1SEBD 2Z0DB 3NUHB 1JRUA 2R2QA 3H6NA 1YNTE 3H1UA 3RMKC 3AB5A 2WXIA 1K50A 3I9V1 1FFVA 2LXAA 4NZLB 4KGRA 4MM3A 4AJWA 3EFUA 4N6EB 4NY0A 1YX6B 1J0GA 3PVLA 2H88B 3KYCD 1JALA 2V3PA 3TJPA 2JUOA 2DAJA 2VZKB 4G11A 2LGDA 4L1BA 1JWUD 2G4DB 1WGHA 3B08A 3MHZA 2PW9A 3ZIMA 2J7QB 2V3SA 3TIXA 5BYRA 2L76A 3A4RA 2WHIA 4FADA 2J52A 2WXOA 3ML9A 1P7FA 2JZ3B 3U7DA 1TBEA 2RMMA 4M8NA 2WX0A 4OW0A 2O6VB 3OAWA 3GZNI 1XT9B 3QJZA 4XX5A 3IXSA 2OEDA 4HLEA 2KDEB 3PLUA 4HCPB 4DWFA 3QQ8B 2RSUA 3ZNID 2I2YA 4ANWA 1ZUD2 3IT4B 1I4RA 3RN9C 4PYZA 3ZJTA 4MM3B 3QARA 2CHXA 4Q2JA 4R3DA 3KYDD 2HDEA 1FXAA 5D3DA 3ZW3A 4OZBA 1VD2A 3BYYB 4W9HA 2D3BA 2D5GA 2ACZB 2XN9C 2MJ3A 5TSSA 3IHPC 1F2RI 1TS3A 3T3NA 2KTRA 2D3CA 4HVBA 1CK1A 1Q0WB 2FIDA 3JW0X 1WE6A 3AE7B 4G3XB 1QOAA 1AWDA 3A9KB 4A55A 1EU3A 2LXCA 4YTNB 3RPFC 1J7BA 4DK5A 4USAA 2MBOA 2MX2A 2NTSA 4BVUC 4KDLB 2ZW0A 1TS4A 3P63A 1V9JA 2KYWA 2CHZA 3N1YC 1JWSD 2K3UA 3Q3FA 2K6QA 5T8IA 4M01A 4GU2A 2WXJA 5AEKB 4ZYSA 3M95A 2IDYA 3I63C 3KW5B 3T8MA 2NPTA 4C7YA 2N7JA 3AN1A 4YXDB 4AS1A 3SEBA 2FE8A 5J17A 2E3TA 3N1XC 4KVGB 4EZLA 3L54A 4LK0M 4N58A 1RLFA 5JZEB 1GAQB 2KTRB 2LVOA 4GDKB 1YX5B 4RGOS 4WAFA 2KNBA 2R2OA 4E74A 1I7HA 2C9WB 4LNNA 3AXCA 4KKIA 4II2B 3NZUA 4IWQA 5LLIA 4IWPA 1UGJA 4H2AA 2RDBC 3ENEA 1V49A 5AUKA 1SJED 4GLSC 3APFA 3L17A 3AV8A 1WRDB 5EE9A 3ZNGC 4HKQA 1ZGUB 4HPPA 1ZW7A 2BTEA 1MJDA 1E8XA 2JXXA 3BIID 5C3JB 1WF9A 4GN1A 4A3OA 3LYYA 4PK1A 1ISNA 4JGHB 5C1ZA 1E8WA 3PS6A 4US8A 4WQMA 3W1SA 3CIRB 2FAZA 1TKYA 5L95C 3TMPB 1VZ7A 2OJRA 2BGFA 3OLMD 2GI9A 4MSQB 1JWAD 2JYTA 2K8CA 4ARIA 2PTLA 1L0YB 2QCZA 1MI0A 2WDQB 3OJ3A 3RZWC 1YN4A 2RPVA 3RNEC 4EUTA 1C4AA 1ZXIA 2WU5B 3EGRA 1MHHE 2BT6A 2AQ2B 1NYRA 2MBQA 2YEPB 4OZAA 1WMHA 3IG3A 2OHFA 2NBUA 1GJZA 3B2FA 1N6ZA 1WJ6A 3LXFA 2ZEQA 2CKHB 4DBGA 3HIZA 4KX6B 4FJZA 3NOBA 2AL6A 3AI5A 2W82A 2AEHA 3QAQA 3DVGX 1VLBA 1SXTA 1WGGA 2KQSA 2WXNA 1IPGA 1XCTL 2WWZA 1ZXHA 1S3SG 2QHOA 5AZFA 5HKHA 1FNWA 1A5RA 2AWTA 2WXLA 2KN5A 4M02A 1OGWA 3AU5A 4XWTA 2C5LC 1ZPSA 4ACFA 2LUEA 1WY8A 2KX0A 4DHZB 4YWGG 3RUIB 4WJPA 2FUHB 2VH2A 2N9LA 4IM3A 2JYEA 4BZAA 1UBQA 1R7SA 3KWLA 4C4VA 2NR2A 4DHJB 1AN8A 2N7EA 1WMHB 3H7SA 4HXDA 1M94A 2NVUI 1TGZB 4FBJB 1FO4A 3OWEB 1V5OA 1SE9A 2WP9B 2MP2A 4QAYA 2LVPA 1RM6C 1BUIC 2GBJA 3V60A 4MGKE 3QK0A 5D6JB 5TR5A 1N62A 2PE6B 4P1CC 2JWUA 2IGHA 1WGYA 1WXMA 2KJ6A 5BMHA 3ZO5B 3Q6BA 2M17A 1UWMA 2N7DA 3WA0A 1EO6A 2HTHA 5CX3A 2IO1B 3ZRCA 2X38A 1RFKA 5DPRA 2PJHA 4B95A 4WWPA 4C4VB 1PYWD 4ZHOA 1X1MA 4MACA 3BVMA 1MG4A 1GC6A 1QLBB 3CSFA 1HTOA 2KLCA 5CTRC 1WZ0A 2DLBA 2M0AA 4LTUA 4ANXA 4LCDE 2MP2B 1E7VA 5D2MB 4A3PA 2E6XA 1Q5WB 1P1AA 3NZSA 4WWOA 2JU6X 3WIMA 4HCNB 1RFAA 2KC1A 2C7NB 1GUAB 1HTQA 4ZRPA 4WWMA 2PVGC 1FIQA 2BF8B 4KSLC 4FJYA 4J6IA 4ZRIA 3DCGA 4MDKE 2KWDA 1PFDA 2C7HA 1V6EA 3VR8B 2DZJA 3B1LX 3U4EG 5EE3A 2H89B 1ZKHA 2QIEB 1EF1A 2AYOB 3IVFA 2FCNA 3FAHA 1Q10A 4W9LA 4FA6A 2BBCA 2ZW1A 3L4PA 2DZMA 4RFBA 1L0VB 4A90A 3DWGC 2RDGA 2KANA 4ITKA 5E6JA 3FILA 2KFJA 1SGHA 1T0SC 1VZ8A 3WAOA 4NAWA 3SFDB 3AEEB 3Q3OC 1YQ3B 3A1QA 5J18A 1UF0A 2NS5A 5IOIA 4HRSA 3TEYA 2G9HD 3HM3A 1FXIA 2BKFA 4PS7A 4ZRJA 1LM8B 3R8BA 2QEJC 4CYEA 2KC2A 1TYGB 1K8RB 5CHVC 4D2KA 5D3IB 1E7UA 3NY5A 3VR9B 2M4NA 1MFWA 4K7UA 2PLPA 2CHWA 3I57A 4UDUC 3VH3B 4LNKA 4B0EA 2MSED 3UGBB 2RDHA 3KUDB 1FEHA 5G55A 1JROA 3Q69A 3FILB 3ZXRA 3PZ7A 3ZDTA 3TCAA 1P9DU 1SBBB 1KFYB 1TTNA 2CJNA 1H8CA 3N30A 3A1QB 3BK2A 3PGEA 3L16A 2D2QA 2W3RA 4TKNA 3ZNHB 3U8ZA 3UIPB 1F1HA 1TZOA 1QILA 5HFYA 3OJ4B 4ZRQA 1XLPA 1YJIA 2MW5A 4RF1A 1WR6E 3IBEA 4IM0A 4NNJB 2BPSA 4RMAA 2TSSA 3ML8A 4EKUA 1SSNA 4KZ0A 4KV2A 1DOIA 2QDFA 3ONSA 1VZ6A 2HJ8A 1C79A 1YN3A 2CS4A 1VJKA 2AX5A 3V3XA 2J4XA 1IBXB 1FRDA 4DXAB 2XK5A 3KH0A 1XO3A 2LZ6A 4N9F4 1JMLA 1T5XD 2AQ3B 1QT9A 1IP9A 3HVDA 4LDTB 5AZHA 4K3BA 4AQ7A 3RNGC 2BB6A 2BS2B 2N1VA 4JLCA 1PQSA 3M3JA 1ZDVA 2KOXA 3QA8A 2DENB 4E71A 2JRHA 1D5MC 4LJPB 1A70A 2IY0B 3Q8BA 4GSWA 3RNBC 2V9HA 2WXRA 4IW0A 2LGXA 2Z59B 3DWMA 3NZ3A 4S0RA 1PGXA 3AE5B 4RH6A 2HD5B 3PREA 2LGYA 1YOVB 5CHFA 5IAAC 5C23A 1N5XA 2J53A 3J9CA 3Q8EA 3R66C 4EFOA 3A9KA 4YTMB 4ARCA 1E6EB 3BINA 3L0WB 1C77A 2XK5B 2O2VA 1QKZA 2KQ4X 4WJQA 4AUQC 2KACA 2Q5WD 3C19A 2KLGA 3LJ3A 1ACCA 3V6EB 3DVNV 4XDCA 3AE6B 4JE3B 2L83A 3AECB 4W9DA 1WYWB 4KSKC 2WXMA 1L5PA 1VR9A 3P1MA 2LASA 4NPNA 1OQQA 1EM7A 1KLUD 1AYFA 2EELA 1Y56A 5BMGA 2RR9A 3U30A 5D94A 4TQ0A 3V62A 4CHKA 1WXSA 4GDKA 1E90A 1I4XA 4AOFA 1JCKB 4I6LB 4RGMA 1UNSA 2MH7A 4JL9A 3AEGB 4A6QA 2GRIA 3UINB 4IC7B 3NVZA 1F9JA 4YL8A 1KTKA 5CHWA 1D5ZC 4W9GA 3SHQA 4C80A 2M0XA 4P1BC 2O2VB 3BVZA 4EE2A 3VH4B 2BS3B 3D32A 2BQQA 3KQ4A 2D3AA 2Y5CA 3EUB2 5JXVA 4LNFA 3ZTDA 1TZ1A 1E0ZA 3VRBB 3KLSX 4NJ6A 3GOEA 1ZDXA 2WLBA 4EOYA 4JQWC 1WM2A 3RD2A 3OG5A 1C3TA 2L52A 3L10B 2K22A 5HG2A 2K9XA 4W9JA 4AP4C 2KN4A 4MH8A 3ETRA 1E8YA 2ZNVC 1IGCA 3ECIA 4K7WA 2V4IB 1PDXA 3NS8A 4ICUA 4KGSA 4PS3A 1T6BX 2LJ5A 3AEBB 3W5VB 2XBBC 1HA5A 2VZKD 1LO5D 1L4DB 2WS3B 1L6UA 4RGNA 4K81A 2GLSA 3EC8A 2KVRA 2LHEA 1F52A 2REXA 1D5XC 4REZA 3R3MA 2LJIA 1GG3A 4URKA 2JZPA 4CO7A 2WXHA 1LXDA 4HPLB 3PTFC 2N9KA 5BO4B 1T0QC 1P7EA 4F1SA 2O6VD 1XCQL 1V81A 5FR6A 1WFYA 2JF5A 4WIPA 3DDCB 1MVKA 3AM9A 2IO3B 1F2RC 2YVCA 1FCCC 2KZRA 2LGSA 2M1MA 4HROA 1BMLC 2MBHA 1Q1OA 3NJTA 1KLVA 2N9XA 3DBLB 5JHBA 2NBVB 3B2GA 4BKSA 3VDZA 2MEKA 2Y5BB 2PEAA 4M0WA 2L0FA 4J3OD 1N60A 3ZNZB 3HUIA 2SEBD 2N9EB 1P0RA 1WJUA 4YSYB 3QX1A 2N1WA 3IAM1 1NEKB 2Y3AA 2X8XX 4I6PA 1L6VA 2CJOA 3L08A 3UF8A 2GBMA 4FHKA 3R7RA 1T3QA 2CU3A 3QCAA 2QJLA 2FNJB 2INDC 3APCA 4B9KA 1N5WA 5C2TB 3IAS1 3VUXA 5LXHA 4FXCA 3ZXVA 2V0GA 3VTUA 4RF0A 4PS8A 5AZGA 4OHJA 2XNAC 3B0AA 2KMMA 3A4SC 3ZTCA 2KDMA 2KKCA 1TS2A 2FUG1 3AULA 4M0WB 1N63A 4CQNA 2I1KA 4BKGA 2AQ1B 1TT5B 4G0NB 3APDA 4N59A 2CU1A 1GB4A 1CJEA 1HXYD 2Z0EB 3N20C 3P4RB 5IKCM 3IT6B 4C00A 5FR3A 3Q8AA 1WGKA 4TMAB 4ICVA 4C56C 3V61A 1AW7A 4P6VF 2L1AA 3O13A 1E7PB 3DBLI 3VVWB 2DWQA 4EZJA 2ZCCA 1WXVA 2LRWA 3X23A 3JSVB 1STEA 3GE3C 4RGTA 3Q8CA 2NTTA 3ZUNA 4M00A 3ZLZA 2BB5A 3PLVA 1VCBA 1WX7A 3VXWA 1J7CA 3VUYA 5G2NA 1XXGA 4XZ4A 2BYFA 2W9NA 3AE1B 1F0ZA 1FMAD 2OOBB 1WRIA 5FKAC 2IY1B 3X0WA 3RYTA 2MJEA 3RNAC 3V6CB 1GPXA 2V1YA 3A9JA 4KGTA 3ZGZA 1YQ4B 1UD7A 3TBLD 4DXGA 1UH6A 1OEYJ 4P16A 2EKEC 4RM9A 1WI0A 5D7GA 1RAXA 1KH0A 4GIVA 2J0MA 1YJJA 3PO0A 3SD5A 3DBHB 3Q3MC 3ZRFA 1FFUA 2AL3A 5G5GA 2C7MB 1SB3C 3Q3NC 1V5TA 1PGAA 3DOWA 2LI5A 1ZP0B 2K8BA 3LDZE 2WXQA 1ZE3D 3JVZX 3AU4A 1SE3A 1GNUA 2JX5A 2IZVB 3GS2A 1RRBA 1I4HA 2C60A 2KQ7A 4G50A 3SU8X 3ZQ4A 5DPSA 3C0RB 3MJWA 3A9JB 5AUIA 2JPHA 5L83A 3PHXB 4DDID 1EU4A 4WURA 1SJHD 1WZ3A 4ASWC 1JQ4A 5MPOA 2MBBB 1NI2A 2L00B 3RULA 4DHJD 2DX5B 2INPE 2DNFA 4IOIE 2JXTA 2FIFA 3MTNB 2R61A 1RWSA 1Z5SB 2JVCA 3SDLC 2LVQA 3ZJUA 3KWVA 4DHZE 1C76A 1IBXA 3U7ZA 4W9CA 3HHMA 1Y8RC 4GDLA 3AH7A 1NBFC 1MHXA 2KT7A 3MFGA 2K5PA 3NS1A 3K9PB 4EEWA 1D4BA 2V3NA 2KDBA 3AE2B 1N61A 4GGQA 3W1SC 4E3CA 1DOYA 1D6EC 2MJDA 1HZ5A 3DQVA 3DHIC 1RYJA 3MJ5A 4DQOC 2QILA 2WXFA 3N9YC 2GBRA 3Q14C 2NMQA 2ICIA 1KOTA 5IN7A 2ZNVB 5H8YE 1EWCA 2KFKB 2UU7A 1YIWA 3MC9A 4P7IA 4AWJA 2JZZA 1Z2MA 5LNK1 2M8SA 2LHDA 4B0MA 5E6PA 1FXTB 3PRMB 2BKRB 2PKOA 1WH3A 3HM6X 3L13A 3E9SA 4GDLB 4F8CB 2KVZA 2K6DB 1J8CA 5I4DA 4AJYB 2MBEA 2QMTA 3TUOA 2WYQA 3A33B 3AE3B 4F7ZA 3QC8B 3PRZA 1QOGA 4M8MA 3W2DA 2JSVX 1KM7A 1VDVA 4BKTA 1ROEA 1B9RA 4C7ZA 4KZCA 4XE0A 3AEFB 3GE8C 5BMIA 1NDDA 2K0PA 1OFFA 2FCQA 5GMVA 1KRHA 5EE1A 3PPAA 2W3SA 2JRIB 1KLGD 3S2AA 3PT2B 1C1YB 1U4AA 1FNUA 1XEEA 4XDDA 4OZCA 3C8YA 1UUPA 4XYCA 2CR5A 3ZDMC 5IA7A 2JY6A 3FKYA 4FJVB 1WSPA 2IGDA 1IGDA 4NQKE 1XLOA 1OTRB 1UGMA 1H4RA 3DBRB 3VQIA 3IFWB 1NENB 4WJNA 2NBWB 2G3QB 5BYQA 1EWYC 2B3AA 1TS5A 3V05A 4A8XC 2JT4B 1WGDA 1R4NB 1WR1A 2MRPA 3RZFA 3NRZA 3KVFB 4KDIC 3GP7A 3WANA 1P98A 4RM8A 3DVGY 2YEPF 2BS4B 1HE8A 3CMMB 2ON8A 3UI3A 2L7RA 4XC2A 3RCZA 4WH4A 1BT0A 4FULA 3VTVA 3ALBA 2FCSA 2KJRA 1F77A 2VH1A 4US9A 4MEMA 1FRRA 3PSEB 1EUVB 4ZRKA 3HVZA 4BBNF 5JHAA 3AE8B 2L8JA 3U52E 2Y5PA 3QHTA 2RD0A 2FCMA 4YSZB 2ONQA 3NVVA 3URYA 3H8HA 2G1EA 2W54A 3VUWA 2KJHB 3AEDB 4BAXA 4EZKA 1E10A 2KMAA 3GB1A 2KMCA 1XD3B 3B9JA 3SR6A 1I4PA 5LXIB 1WE7A 2WX1A 4LNIA 2KO3A 1R4MB
chains in the Genus database with same CATH topology
2ZPYA 1XQQA 2BF8B 4MGIE 2GBMA 3UQAA 4KSLC 1I35A 4FJYA 4J6IA 4FHKA 3R7RA 4ZRIA 2DZIA 3DCGA 3QCAA 4MDKE 1CMXB 2FNJB 2D11A 3VFKA 3APCA 4B9KA 3NHEB 2C7HA 1V6EA 2ZVNA 1UZXB 2O6VA 3VAWA 2DZJA 3VUXA 3T9LA 5LXHA 3B1LX 3PV1A 4GXBA 2IBIB 3WAPA 1EF5A 1ZKHA 1WX9A 1EF1A 3DVNU 2AYOB 3VTUA 3IVFA 2FCNA 3MHSD 3DBRI 4W9LA 4FA6A 2Z0DB 4ZDVA 4PS8A 1OQYA 1JRUA 5AZGA 2R2QA 3H6NA 4ANVA 2DZMA 4MJSA 1SIFA 2KANA 2LRUA 3B0AA 3H1UA 4JIOU 3UQBA 2KFJA 1R4NI 1SGHA 3A4SC 1OEYA 3WAOA 3ZTCA 4LDTD 2LXAA 3BY4B 4NAWA 4MM3A 2KKCA 4AJWA 3EFUA 3A1QA 3AULA 4M0WB 4HK2A 4NY0A 1YX6B 5KHOA 3PVLA 5J18A 1J0GA 2NS5A 3KYCD 2I1KA 5E6OA 4BKGA 3TJPA 4G0NB 3APDA 2JUOA 2L0TA 3HK0A 2DAJA 2ZJDA 4G11A 2CU1A 2LGDA 4HDQA 1S1QB 2Z0EB 3HM3A 2G4DB 2L3ZA 1WGHA 2V4LA 2BKFA 4KIKA 3B08A 1E5WA 4PS7A 4ZRJA 2XEWA 3ZIMA 1LM8B 1WIAA 4MH0E 4B6WA 2EMSA 2KC2A 4WQOB 4CYEA 1K8RB 2J7QB 5CHVC 1QZEA 2V3SA 1E7UA 4ICVA 3TIXA 2GBKA 2L76A 3A4RA 3NY5A 1P3QU 2J0KA 4FADA 3KUZA 3H7PA 2M4NA 4WJOA 4NJ7A 3V61A 3ML9A 2JZ3B 2G4SA 3U7DA 1TBEA 4K7UA 4ZYNA 4M8NA 4NQLB 3DBLI 3VHTC 3VVWB 2WX0A 4EZJA 2ZCCA 1WXVA 2LRWA 2CHWA 2O6VB 3OAWA 2DZKA 1KJTA 3X23A 3JSVB 2EMTA 4FLHA 3GZNI 3VH3B 1XT9B 3QJZA 4XX5A 3ZUNA 2MSED 4HLEA 3UGBB 2GOWA 4TUUA 3ZLZA 2KDEB 3PLUA 3PLVA 1VCBA 3KUDB 4HCPB 4DWFA 1WX7A 2NPTB 3QQ8B 4MJSB 5G55A 3VUYA 3VXWA 5G2NA 2RSUA 3R7QA 2PPHA 3ZNID 4XZ4A 4ANWA 3ZDTA 2BYFA 2W9NA 3TCAA 2DAFA 1P9DU 5JH5C 1R4MI 4PYZA 1TTNA 2D10A 3QARA 1LQBA 2CHXA 2OOBB 1H8CA 2IY1B 3N30A 3A1QB 3PGEA 4GMVA 1YD8U 3X0WA 2WDTB 3RYTA 3KYDD 3L16A 3V6CB 2D2QA 4TKNA 2IO0B 4IM2A 3ZNHB 2MLBA 3ZW3A 3U8ZA 2IYDB 2KDIA 1VD2A 1UBIA 2V1YA 3UIPB 4W9HA 3A9JA 2KXJA 4KIKB 1D3ZA 3QWZB 4FN2A 1UD7A 1LFDA 2ZVOA 3IHPC 3QIJA 3TBLD 5J2RA 3OJ4B 3H9DA 1UH6A 1OEYJ 2KTRA 4IG7B 2MW5A 4HVBA 1Q0WB 3H7PB 1WR6E 2FIDA 2EKEC 3CSTA 3IBEA 3JW0X 4IM0A 2BPSA 4NNJB 1WE6A 4OVUA 1WI0A 4RMAA 4RM9A 5D7GA 4W9IA 4G3XB 3ML8A 1RAXA 2VRRB 4EKUA 4GIVA 3A9KB 4FHJA 4KZ0A 4KV2A 2J0MA 3M63B 3ONSA 2LXCA 4DK5A 2MBOA 2MX2A 4BVUC 2HJ8A 4KDLB 2CS4A 3SD5A 1V9JA 2CHZA 2GBNA 3UIOB 3EECA 3ZRFA 2AL3A 2K6QA 3Q3FA 3JSVA 2MA9B 2C7MB 4DXAB 2KDFB 2XK5A 4GU2A 3KH0A 2LZ6A 1V5TA 2BYVE 3DOWA 5AEKB 3M95A 2LI5A 2PE9A 1V80A 2K8BA 3LDZE 4N9F4 3JVZX 1IP9A 3AU4A 3KW5B 3T8MA 1GNUA 2G45B 2NPTA 4LDTB 5AZHA 4W9EA 2IZVB 4BOSC 2MCNB 1RRBA 5J17A 2C60A 2N1VA 2KQ7A 3P2BA 4G50A 4JLCA 4KVGB 1PQSA 3SU8X 3W1YA 5DPSA 4EZLA 2K1FA 3L54A 3C0RB 3MJWA 3A9JB 3M3JA 2JPHA 2KOXA 5L83A 1RLFA 3PHXB 3QA8A 4GB9A 2DENB 4DDID 4E71A 5JZEB 2JRHA 4LJPB 2IY0B 2IO2B 2KTRB 1YX5B 2LVOA 4GDKB 4GSWA 3VTWA 2KNBA 2R2OA 2ZZPB 4E74A 4BOZB 2KWCA 2LGXA 4IW0A 1WZ3A 4ASWC 2Z59B 2C9WB 4TV3A 4W9KA 3AXCA 2MBBB 1NI2A 2HD5B 4II2B 2L00B 3RULA 4DHJD 3NZUA 2DX5B 2ASQA 3PREA 2LGYA 4IWQA 3O65B 5LLIA 5CHFA 2FIFA 5IAAC 3MTNB 5C23A 2ZCBA 4IWPA 1Z5SB 2JVCA 2K25A 2DHZA 1V2YA 3R66C 4EFOA 3A9KA 3SDLC 2LVQA 3JYUA 3ENEA 3BINA 1V49A 3L0WB 2XK5B 4LJOB 3APFA 2O2VA 2YLMA 3L17A 4DHZE 1WRDB 4WAAA 3ZNGC 4WJQA 3N3KB 1ZGUB 4AUQC 4HWIB 4W9CA 3HHMA 1Y8RC 2KTFA 4GDLA 5E6NA 1NBFC 2LD9A 2KLGA 3LJ3A 1ZW7A 1E8XA 4EEWA 3K9PB 2JXXA 3V6EB 4PYUA 3DVNV 1AARA 1WF9A 2KDBA 4GN1A 4A3OA 4DDGD 1ISNA 4JGHB 5C1ZA 1E8WA 3PS6A 2BYEA 2RPQA 4IWOA 4W9DA 1WYWB 3W1SA 4GGQA 4KSKC 3W1SC 4E3CA 2KWVB 2FAZA 2K39A 2LASA 5L95C 3WAMA 1G6JA 3TMPB 4NPNA 1UELA 2OJRA 3DQVA 2BGFA 2BWES 3OLMD 5DCNA 1GC7A 2KD0A 4MSQB 2K8CA 3ZVVA 2RR9A 2GBRA 3U30A 3WALA 5D94A 4TQ0A 3V62A 4CHKA 1KOTA 1WXSA 3OJ3A 4GDKA 2MWSB 1E90A 3RZWC 2ZNVB 4AOFA 4W9FA 4EUTA 2HE7A 2KFKB 1YIWA 4P7IA 2L05A 4I6LB 2MBQA 3CF6E 3PHWB 4AWJA 3Q3JA 2JZZA 4TQ1A 1WMHA 1Z2MA 3IG3A 4JL9A 2M8SA 3UINB 2NBUA 4IC7B 1GJZA 1F9JA 4YL8A 1WJNA 5EDSA 1WJ6A 2UYZB 4HJKA 4OVVA 5CHWA 1FXTB 3PRMB 2BKRB 4W9GA 5E6PA 3SHQA 2ZEQA 2M0XA 2CKHB 3RT3B 2KHWB 2O2VB 4K7SA 1WH3A 2RGFA 3HIZA 4DBGA 2DYMA 4MSMB 3VH4B 4FJZA 3HM6X 3D32A 3L13A 5DPWA 3NOBA 2AL6A 3AI5A 2AEHA 3K9OB 2DYOA 4MGYE 1WJ4A 3QAQA 3DVGX 4GDLB 4F8CB 2J0JA 2K6DB 1J8CA 3DPDA 4AJYB 4HDOA 2MBEA 1WGGA 2WYQA 3A33B 4F7ZA 2KQSA 1IPGA 3QC8B 3PRZA 3ZTDA 1TZ1A 2MQJA 2WWZA 1S3SG 1YJ1A 2QHOA 5AZFA 4M8MA 5HKHA 1A5RA 1KM7A 4BKTA 1WX8A 2AWTA 4NJ6A 3PRPB 2KN5A 3GOEA 1OGWA 3AU5A 4KZCA 4EOYA 2C5LC 2KK8A 4JQWC 1WM2A 3PZDA 3RD2A 1NDDA 2LUEA 1C3TA 1WY8A 2FCQA 3L10B 1V86A 2KX0A 3M62B 4DHZB 2N9PC 3RUIB 2KX3A 5GMVA 4WJPA 4W9JA 2FUHB 3PPAA 2I1JA 4IM3A 4AP4C 2JRIB 1UBQA 3S2AA 2NCNA 3PT2B 4K1RB 1C1YB 1U4AA 4WWNA 2NR2A 4DHJB 4II3B 2N7EA 4MGZE 4MELA 1WMHB 3EHVA 3H7SA 4HXDA 1E8YA 2ZNVC 1M94A 1WGRA 2KFKA 2CR5A 2NVUI 5DPTA 1TGZB 3ZDMC 5IA7A 4I6NB 2JY6A 3ECIA 4K7WA 4BKSD 4FJVB 4FBJB 3NS8A 1V5OA 4ICUA 1SE9A 4PS3A 2MP2A 2LJ5A 3DBSA 4NQKE 2XBBC 1OTRB 3I3TB 1UGMA 1H4RA 2LVPA 4K81A 5KHQA 2N4FA 3EC8A 3VQIA 3IFWB 2KVRA 4WJNA 4GOCA 2GBJA 2REXA 2NBWB 2G3QB 3V60A 4MGKE 1WXAA 3R3MA 4BBNC 2B3AA 1GG3A 3QK0A 1E8ZA 2JT4B 1WGDA 5D6JB 5TR5A 2PE6B 4URKA 1WGYA 1WR1A 2LWPA 4CO7A 1WXMA 2KJ6A 2D07B 1LXDA 2MRPA 4HPLB 3RZFA 3PTFC 2KWUB 2BWFA 5BO4B 3KVFB 4KDIC 3WANA 3ZO5B 4F1SA 2O6VD 1P98A 2M17A 1I42A 2N7DA 1V81A 5FR6A 1WFYA 4RM8A 3WA0A 2JF5A 1EO6A 2HTHA 5CX3A 3DVGY 2IO1B 3DBHI 3DDCB 2JWZA 3CMMB 1HE8A 1L2NA 3ZRCA 2ZPNA 2L7RA 5DPRA 1YQBA 4XC2A 3RCZA 2PJHA 4B95A 2IO3B 1BT0A 1L7YA 2YVCA 3KUCB 4FULA 4WWPA 3VTVA 3ALBA 2FCSA 2KJRA 1X1MA 2KZRA 2M1MA 4NAWB 4MEMA 3TL5A 3PSEB 1EUVB 4ANUA 2MBHA 1Q1OA 1KLVA 4ZRKA 1GC6A 2N9XA 3CSFA 4BBNF 5JHAA 5JHBA 2NBVB 2KLCA 2L8JA 1WZ0A 5CTRC 2GMIC 3QHTA 4HPMB 2RD0A 4A20A 2FCMA 4BKSA 1T0YA 2A4ZA 3VDZA 4ANXA 2Y5BB 3N32A 1WM3A 2PEAA 2UWQA 4LCDE 3ZKJC 2L0FA 2MP2B 1E7VA 2A5UA 5D2MB 3ZNZB 3VUWA 2KJHB 4A3PA 4EZKA 2N9EB 4X57B 1P0RA 2KMAA 1Q5WB 1WJUA 1P1AA 2KMCA 3QX1A 3NZSA 4IUMB 4BFRA 1XD3B 4WWOA 3WIMA 2D3GA 2K8HA 1IYFA 4HCNB 1RFAA 2KC1A 2DYBA 2C7NB 1GUAB 2N1WA 1J19A 5LXIB 1WE7A 2WX1A 4I6PA 2KO3A 3L08A 3UF8A 1MG8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZPY A;  1XQQ A;  2BF8 B;  4MGI E;  2GBM A;  3UQA A;  4KSL C;  1I35 A;  4FJY A;  4J6I A;  4FHK A;  3R7R A;  4ZRI A;  2DZI A;  3DCG A;  3QCA A;  4MDK E;  1CMX B;  2FNJ B;  2D11 A;  3VFK A;  3APC A;  4B9K A;  3NHE B;  2C7H A;  1V6E A;  2ZVN A;  1UZX B;  2O6V A;  3VAW A;  2DZJ A;  3VUX A;  3T9L A;  5LXH A;  3B1L X;  3PV1 A;  4GXB A;  2IBI B;  3WAP A;  1EF5 A;  1ZKH A;  1WX9 A;  1EF1 A;  3DVN U;  2AYO B;  3VTU A;  3IVF A;  2FCN A;  3MHS D;  3DBR I;  4W9L A;  4FA6 A;  2Z0D B;  4ZDV A;  4PS8 A;  1OQY A;  1JRU A;  5AZG A;  2R2Q A;  3H6N A;  4ANV A;  2DZM A;  4MJS A;  1SIF A;  2KAN A;  2LRU A;  3B0A A;  3H1U A;  4JIO U;  3UQB A;  2KFJ A;  1R4N I;  1SGH A;  3A4S C;  1OEY A;  3WAO A;  3ZTC A;  4LDT D;  2LXA A;  3BY4 B;  4NAW A;  4MM3 A;  2KKC A;  4AJW A;  3EFU A;  3A1Q A;  3AUL A;  4M0W B;  4HK2 A;  4NY0 A;  1YX6 B;  5KHO A;  3PVL A;  5J18 A;  1J0G A;  2NS5 A;  3KYC D;  2I1K A;  5E6O A;  4BKG A;  3TJP A;  4G0N B;  3APD A;  2JUO A;  2L0T A;  3HK0 A;  2DAJ A;  2ZJD A;  4G11 A;  2CU1 A;  2LGD A;  4HDQ A;  1S1Q B;  2Z0E B;  3HM3 A;  2G4D B;  2L3Z A;  1WGH A;  2V4L A;  2BKF A;  4KIK A;  3B08 A;  1E5W A;  4PS7 A;  4ZRJ A;  2XEW A;  3ZIM A;  1LM8 B;  1WIA A;  4MH0 E;  4B6W A;  2EMS A;  2KC2 A;  4WQO B;  4CYE A;  1K8R B;  2J7Q B;  5CHV C;  1QZE A;  2V3S A;  1E7U A;  4ICV A;  3TIX A;  2GBK A;  2L76 A;  3A4R A;  3NY5 A;  1P3Q U;  2J0K A;  4FAD A;  3KUZ A;  3H7P A;  2M4N A;  4WJO A;  4NJ7 A;  3V61 A;  3ML9 A;  2JZ3 B;  2G4S A;  3U7D A;  1TBE A;  4K7U A;  4ZYN A;  4M8N A;  4NQL B;  3DBL I;  3VHT C;  3VVW B;  2WX0 A;  4EZJ A;  2ZCC A;  1WXV A;  2LRW A;  2CHW A;  2O6V B;  3OAW A;  2DZK A;  1KJT A;  3X23 A;  3JSV B;  2EMT A;  4FLH A;  3GZN I;  3VH3 B;  1XT9 B;  3QJZ A;  4XX5 A;  3ZUN A;  2MSE D;  4HLE A;  3UGB B;  2GOW A;  4TUU A;  3ZLZ A;  2KDE B;  3PLU A;  3PLV A;  1VCB A;  3KUD B;  4HCP B;  4DWF A;  1WX7 A;  2NPT B;  3QQ8 B;  4MJS B;  5G55 A;  3VUY A;  3VXW A;  5G2N A;  2RSU A;  3R7Q A;  2PPH A;  3ZNI D;  4XZ4 A;  4ANW A;  3ZDT A;  2BYF A;  2W9N A;  3TCA A;  2DAF A;  1P9D U;  5JH5 C;  1R4M I;  4PYZ A;  1TTN A;  2D10 A;  3QAR A;  1LQB A;  2CHX A;  2OOB B;  1H8C A;  2IY1 B;  3N30 A;  3A1Q B;  3PGE A;  4GMV A;  1YD8 U;  3X0W A;  2WDT B;  3RYT A;  3KYD D;  3L16 A;  3V6C B;  2D2Q A;  4TKN A;  2IO0 B;  4IM2 A;  3ZNH B;  2MLB A;  3ZW3 A;  3U8Z A;  2IYD B;  2KDI A;  1VD2 A;  1UBI A;  2V1Y A;  3UIP B;  4W9H A;  3A9J A;  2KXJ A;  4KIK B;  1D3Z A;  3QWZ B;  4FN2 A;  1UD7 A;  1LFD A;  2ZVO A;  3IHP C;  3QIJ A;  3TBL D;  5J2R A;  3OJ4 B;  3H9D A;  1UH6 A;  1OEY J;  2KTR A;  4IG7 B;  2MW5 A;  4HVB A;  1Q0W B;  3H7P B;  1WR6 E;  2FID A;  2EKE C;  3CST A;  3IBE A;  3JW0 X;  4IM0 A;  2BPS A;  4NNJ B;  1WE6 A;  4OVU A;  1WI0 A;  4RMA A;  4RM9 A;  5D7G A;  4W9I A;  4G3X B;  3ML8 A;  1RAX A;  2VRR B;  4EKU A;  4GIV A;  3A9K B;  4FHJ A;  4KZ0 A;  4KV2 A;  2J0M A;  3M63 B;  3ONS A;  2LXC A;  4DK5 A;  2MBO A;  2MX2 A;  4BVU C;  2HJ8 A;  4KDL B;  2CS4 A;  3SD5 A;  1V9J A;  2CHZ A;  2GBN A;  3UIO B;  3EEC A;  3ZRF A;  2AL3 A;  2K6Q A;  3Q3F A;  3JSV A;  2MA9 B;  2C7M B;  4DXA B;  2KDF B;  2XK5 A;  4GU2 A;  3KH0 A;  2LZ6 A;  1V5T A;  2BYV E;  3DOW A;  5AEK B;  3M95 A;  2LI5 A;  2PE9 A;  1V80 A;  2K8B A;  3LDZ E;  4N9F 4;  3JVZ X;  1IP9 A;  3AU4 A;  3KW5 B;  3T8M A;  1GNU A;  2G45 B;  2NPT A;  4LDT B;  5AZH A;  4W9E A;  2IZV B;  4BOS C;  2MCN B;  1RRB A;  5J17 A;  2C60 A;  2N1V A;  2KQ7 A;  3P2B A;  4G50 A;  4JLC A;  4KVG B;  1PQS A;  3SU8 X;  3W1Y A;  5DPS A;  4EZL A;  2K1F A;  3L54 A;  3C0R B;  3MJW A;  3A9J B;  3M3J A;  2JPH A;  2KOX A;  5L83 A;  1RLF A;  3PHX B;  3QA8 A;  4GB9 A;  2DEN B;  4DDI D;  4E71 A;  5JZE B;  2JRH A;  4LJP B;  2IY0 B;  2IO2 B;  2KTR B;  1YX5 B;  2LVO A;  4GDK B;  4GSW A;  3VTW A;  2KNB A;  2R2O A;  2ZZP B;  4E74 A;  4BOZ B;  2KWC A;  2LGX A;  4IW0 A;  1WZ3 A;  4ASW C;  2Z59 B;  2C9W B;  4TV3 A;  4W9K A;  3AXC A;  2MBB B;  1NI2 A;  2HD5 B;  4II2 B;  2L00 B;  3RUL A;  4DHJ D;  3NZU A;  2DX5 B;  2ASQ A;  3PRE A;  2LGY A;  4IWQ A;  3O65 B;  5LLI A;  5CHF A;  2FIF A;  5IAA C;  3MTN B;  5C23 A;  2ZCB A;  4IWP A;  1Z5S B;  2JVC A;  2K25 A;  2DHZ A;  1V2Y A;  3R66 C;  4EFO A;  3A9K A;  3SDL C;  2LVQ A;  3JYU A;  3ENE A;  3BIN A;  1V49 A;  3L0W B;  2XK5 B;  4LJO B;  3APF A;  2O2V A;  2YLM A;  3L17 A;  4DHZ E;  1WRD B;  4WAA A;  3ZNG C;  4WJQ A;  3N3K B;  1ZGU B;  4AUQ C;  4HWI B;  4W9C A;  3HHM A;  1Y8R C;  2KTF A;  4GDL A;  5E6N A;  1NBF C;  2LD9 A;  2KLG A;  3LJ3 A;  1ZW7 A;  1E8X A;  4EEW A;  3K9P B;  2JXX A;  3V6E B;  4PYU A;  3DVN V;  1AAR A;  1WF9 A;  2KDB A;  4GN1 A;  4A3O A;  4DDG D;  1ISN A;  4JGH B;  5C1Z A;  1E8W A;  3PS6 A;  2BYE A;  2RPQ A;  4IWO A;  4W9D A;  1WYW B;  3W1S A;  4GGQ A;  4KSK C;  3W1S C;  4E3C A;  2KWV B;  2FAZ A;  2K39 A;  2LAS A;  5L95 C;  3WAM A;  1G6J A;  3TMP B;  4NPN A;  1UEL A;  2OJR A;  3DQV A;  2BGF A;  2BWE S;  3OLM D;  5DCN A;  1GC7 A;  2KD0 A;  4MSQ B;  2K8C A;  3ZVV A;  2RR9 A;  2GBR A;  3U30 A;  3WAL A;  5D94 A;  4TQ0 A;  3V62 A;  4CHK A;  1KOT A;  1WXS A;  3OJ3 A;  4GDK A;  2MWS B;  1E90 A;  3RZW C;  2ZNV B;  4AOF A;  4W9F A;  4EUT A;  2HE7 A;  2KFK B;  1YIW A;  4P7I A;  2L05 A;  4I6L B;  2MBQ A;  3CF6 E;  3PHW B;  4AWJ A;  3Q3J A;  2JZZ A;  4TQ1 A;  1WMH A;  1Z2M A;  3IG3 A;  4JL9 A;  2M8S A;  3UIN B;  2NBU A;  4IC7 B;  1GJZ A;  1F9J A;  4YL8 A;  1WJN A;  5EDS A;  1WJ6 A;  2UYZ B;  4HJK A;  4OVV A;  5CHW A;  1FXT B;  3PRM B;  2BKR B;  4W9G A;  5E6P A;  3SHQ A;  2ZEQ A;  2M0X A;  2CKH B;  3RT3 B;  2KHW B;  2O2V B;  4K7S A;  1WH3 A;  2RGF A;  3HIZ A;  4DBG A;  2DYM A;  4MSM B;  3VH4 B;  4FJZ A;  3HM6 X;  3D32 A;  3L13 A;  5DPW A;  3NOB A;  2AL6 A;  3AI5 A;  2AEH A;  3K9O B;  2DYO A;  4MGY E;  1WJ4 A;  3QAQ A;  3DVG X;  4GDL B;  4F8C B;  2J0J A;  2K6D B;  1J8C A;  3DPD A;  4AJY B;  4HDO A;  2MBE A;  1WGG A;  2WYQ A;  3A33 B;  4F7Z A;  2KQS A;  1IPG A;  3QC8 B;  3PRZ A;  3ZTD A;  1TZ1 A;  2MQJ A;  2WWZ A;  1S3S G;  1YJ1 A;  2QHO A;  5AZF A;  4M8M A;  5HKH A;  1A5R A;  1KM7 A;  4BKT A;  1WX8 A;  2AWT A;  4NJ6 A;  3PRP B;  2KN5 A;  3GOE A;  1OGW A;  3AU5 A;  4KZC A;  4EOY A;  2C5L C;  2KK8 A;  4JQW C;  1WM2 A;  3PZD A;  3RD2 A;  1NDD A;  2LUE A;  1C3T A;  1WY8 A;  2FCQ A;  3L10 B;  1V86 A;  2KX0 A;  3M62 B;  4DHZ B;  2N9P C;  3RUI B;  2KX3 A;  5GMV A;  4WJP A;  4W9J A;  2FUH B;  3PPA A;  2I1J A;  4IM3 A;  4AP4 C;  2JRI B;  1UBQ A;  3S2A A;  2NCN A;  3PT2 B;  4K1R B;  1C1Y B;  1U4A A;  4WWN A;  2NR2 A;  4DHJ B;  4II3 B;  2N7E A;  4MGZ E;  4MEL A;  1WMH B;  3EHV A;  3H7S A;  4HXD A;  1E8Y A;  2ZNV C;  1M94 A;  1WGR A;  2KFK A;  2CR5 A;  2NVU I;  5DPT A;  1TGZ B;  3ZDM C;  5IA7 A;  4I6N B;  2JY6 A;  3ECI A;  4K7W A;  4BKS D;  4FJV B;  4FBJ B;  3NS8 A;  1V5O A;  4ICU A;  1SE9 A;  4PS3 A;  2MP2 A;  2LJ5 A;  3DBS A;  4NQK E;  2XBB C;  1OTR B;  3I3T B;  1UGM A;  1H4R A;  2LVP A;  4K81 A;  5KHQ A;  2N4F A;  3EC8 A;  3VQI A;  3IFW B;  2KVR A;  4WJN A;  4GOC A;  2GBJ A;  2REX A;  2NBW B;  2G3Q B;  3V60 A;  4MGK E;  1WXA A;  3R3M A;  4BBN C;  2B3A A;  1GG3 A;  3QK0 A;  1E8Z A;  2JT4 B;  1WGD A;  5D6J B;  5TR5 A;  2PE6 B;  4URK A;  1WGY A;  1WR1 A;  2LWP A;  4CO7 A;  1WXM A;  2KJ6 A;  2D07 B;  1LXD A;  2MRP A;  4HPL B;  3RZF A;  3PTF C;  2KWU B;  2BWF A;  5BO4 B;  3KVF B;  4KDI C;  3WAN A;  3ZO5 B;  4F1S A;  2O6V D;  1P98 A;  2M17 A;  1I42 A;  2N7D A;  1V81 A;  5FR6 A;  1WFY A;  4RM8 A;  3WA0 A;  2JF5 A;  1EO6 A;  2HTH A;  5CX3 A;  3DVG Y;  2IO1 B;  3DBH I;  3DDC B;  2JWZ A;  3CMM B;  1HE8 A;  1L2N A;  3ZRC A;  2ZPN A;  2L7R A;  5DPR A;  1YQB A;  4XC2 A;  3RCZ A;  2PJH A;  4B95 A;  2IO3 B;  1BT0 A;  1L7Y A;  2YVC A;  3KUC B;  4FUL A;  4WWP A;  3VTV A;  3ALB A;  2FCS A;  2KJR A;  1X1M A;  2KZR A;  2M1M A;  4NAW B;  4MEM A;  3TL5 A;  3PSE B;  1EUV B;  4ANU A;  2MBH A;  1Q1O A;  1KLV A;  4ZRK A;  1GC6 A;  2N9X A;  3CSF A;  4BBN F;  5JHA A;  5JHB A;  2NBV B;  2KLC A;  2L8J A;  1WZ0 A;  5CTR C;  2GMI C;  3QHT A;  4HPM B;  2RD0 A;  4A20 A;  2FCM A;  4BKS A;  1T0Y A;  2A4Z A;  3VDZ A;  4ANX A;  2Y5B B;  3N32 A;  1WM3 A;  2PEA A;  2UWQ A;  4LCD E;  3ZKJ C;  2L0F A;  2MP2 B;  1E7V A;  2A5U A;  5D2M B;  3ZNZ B;  3VUW A;  2KJH B;  4A3P A;  4EZK A;  2N9E B;  4X57 B;  1P0R A;  2KMA A;  1Q5W B;  1WJU A;  1P1A A;  2KMC A;  3QX1 A;  3NZS A;  4IUM B;  4BFR A;  1XD3 B;  4WWO A;  3WIM A;  2D3G A;  2K8H A;  1IYF A;  4HCN B;  1RFA A;  2KC1 A;  2DYB A;  2C7N B;  1GUA B;  2N1W A;  1J19 A;  5LXI B;  1WE7 A;  2WX1 A;  4I6P A;  2KO3 A;  3L08 A;  3UF8 A;  1MG8 A; 
#chains in the Genus database with same CATH topology
 1TJE A;  2ZPY A;  4MGI E;  1I35 A;  3UQA A;  3ZYY X;  3VFK A;  3NHE B;  2EKI A;  1DGJ A;  2ZVN A;  3T9L A;  1NVI D;  4GXB A;  3P4S B;  3WAP A;  2HJ1 A;  1EF5 A;  4LLG M;  3N1Z C;  3DVN U;  3RI7 C;  4JPS A;  5H92 C;  3MHS D;  3DBR I;  4JWU C;  4ZDV A;  1OQY A;  4ANV A;  1C4C A;  4MJS A;  3MP9 A;  1SIF A;  2LRU A;  2WXG A;  4TSS A;  4JIO U;  3UQB A;  1JRP A;  1R4N I;  1OEY A;  1C4P A;  4LDT D;  3BY4 B;  1L4Z B;  3TEW A;  4HK2 A;  5KHO A;  1FNV A;  5E6O A;  5FK9 C;  3U2S C;  1NI3 A;  2L0T A;  3HK0 A;  2ZJD A;  4HDQ A;  1S1Q B;  2L3Z A;  4OVZ A;  2LFI A;  2V4L A;  4KIK A;  1E5W A;  3Q8F A;  2XEW A;  2LGI A;  1TY0 A;  1WIA A;  4MH0 E;  4B6W A;  2EMS A;  3EFC A;  4WQO B;  1QZE A;  1VRA B;  2GBK A;  2L32 A;  1P3Q U;  2J0K A;  2INC C;  3H7P A;  4WJO A;  4NJ7 A;  2G4S A;  4ZYN A;  4NQL B;  2LUM A;  3VHT C;  1JWB D;  1NYQ A;  2WDR B;  4O1N A;  2DZK A;  1KJT A;  3BYT B;  1FCL A;  2EMT A;  4FLH A;  5BYS A;  4NJC A;  4XWW A;  1I4G A;  1CQV A;  1E9M A;  1HQR D;  1WWT A;  2MHJ A;  2GOW A;  4TUU A;  2WQY B;  1V1P A;  1QF6 A;  2M56 B;  2NPT B;  4MJS B;  1C9F A;  1C78 A;  3R7Q A;  2PPH A;  1OQR A;  5JH5 C;  2DAF A;  1K52 A;  2PVO D;  1R4M I;  1SF0 A;  2D10 A;  1LQB A;  4GMV A;  1YD8 U;  3TEX A;  2WDT B;  2IO0 B;  4IM2 A;  2MLB A;  2INN E;  2IYD B;  2KDI A;  1UBI A;  2KXJ A;  4KIK B;  1D3Z A;  3QWZ B;  2HTM E;  3R2I A;  4FN2 A;  2ZVO A;  1LFD A;  3QIJ A;  5J2R A;  3H9D A;  4IG7 B;  2Z8L A;  3H7P B;  3MC0 B;  3CST A;  4OVU A;  2PIA A;  4W9I A;  4YSX B;  2VRR B;  2FBW B;  2BVC A;  3BVG A;  1SE4 A;  1MPE A;  4FHJ A;  3M63 B;  1GB1 A;  3RNC C;  3R2T A;  2W55 A;  2GBN A;  3UIO B;  3EEC A;  1TIF A;  3Q2A C;  4JWS C;  1JW9 D;  3JSV A;  2MA9 B;  1V1P B;  2PMV A;  2KDF B;  4ZHP A;  4L2Y A;  2BYV E;  3I5J C;  2WDV B;  3P4P B;  2PE9 A;  1ET9 A;  1V80 A;  1ZOY B;  1LGR A;  1WXQ A;  3AE4 B;  2G45 B;  2WNM A;  4W9E A;  4BOS C;  2MCN B;  1K53 A;  1TY2 A;  4YT0 B;  3W1Y A;  3P2B A;  2K1F A;  3HRD D;  2BW2 A;  3W5U B;  1ENF A;  3EA6 A;  1HZ6 A;  4GB9 A;  3CWI A;  1SIJ A;  2I38 A;  2IO2 B;  4JX1 C;  1TKE A;  3VTW A;  1QOF A;  1QOB A;  2WU2 B;  2J42 A;  2ZZP B;  4BOZ B;  1V8C A;  2KWC A;  3BZD B;  2DBY A;  4TV3 A;  4W9K A;  2WXP A;  2ASQ A;  1UWX A;  3O65 B;  2ZCB A;  2K25 A;  2DHZ A;  1V2Y A;  3RFZ B;  3JYU A;  4LJO B;  2YLM A;  1L0X B;  4WAA A;  4RCO A;  3AE9 B;  3N3K B;  4HWI B;  2KTF A;  5E6N A;  4ZOH C;  2LD9 A;  4HEA 1;  4RNA A;  1K51 A;  2LEK A;  1BXT A;  4PYU A;  1AAR A;  5HHD G;  4DDG D;  4IWO A;  2BYE A;  2RPQ A;  3FC4 A;  2KWV B;  2K39 A;  3WAM A;  1G6J A;  1T0R C;  1UEL A;  1M4V A;  2BWE S;  4HKZ E;  3RNF C;  2IJ0 A;  3NVY A;  5DCN A;  1GC7 A;  2IPK D;  2KD0 A;  3ZVV A;  3WAL A;  2MWS B;  4W9F A;  2HE7 A;  2B76 B;  2L05 A;  1PGB A;  1B1Z A;  3CF6 E;  3PHW B;  3Q3J A;  4TQ1 A;  3E56 A;  1FM0 D;  4HJG E;  4KKJ A;  3LB8 C;  3BK1 A;  1PUT A;  1WJN A;  5EDS A;  1DYQ A;  4HJK A;  2UYZ B;  4OVV A;  1DOX A;  3RT3 B;  3DHH C;  2WXK A;  2KHW B;  4K7S A;  2RGF A;  3ZJV A;  4NAM A;  2DYM A;  4MSM B;  2SAK A;  3WCQ A;  5DPW A;  3K9O B;  4MGY E;  2DYO A;  5G5H A;  1WJ4 A;  3TEZ A;  3W9C B;  3SFE B;  4IKG A;  2J0J A;  3P42 A;  4IDI A;  3TSS A;  2QC8 A;  3DPD A;  4HDO A;  2WGS A;  2MQJ A;  4YTP B;  1YJ1 A;  3NVW A;  3AMZ A;  1WX8 A;  3PRP B;  3MC8 A;  2KK8 A;  2BYT A;  1KF6 B;  3PZD A;  2QSD A;  1V86 A;  3M62 B;  2N9P C;  1I4Q A;  2KX3 A;  2I1J A;  1HEZ E;  1V1O A;  3AEA B;  2NCN A;  4K1R B;  4WWN A;  4K3C A;  2OJW A;  4DXF A;  4II3 B;  4MGZ E;  4MEL A;  3EHV A;  1WGR A;  2KFK A;  5DPT A;  3T3O A;  4I6N B;  4BKS D;  4MT5 A;  2N0S B;  3NG0 A;  3DBS A;  1WYG A;  3I3T B;  1FD6 A;  4XGA B;  5KHQ A;  2N4F A;  4PT5 A;  4GOC A;  2KAJ A;  1WXA A;  3ABV B;  4BBN C;  1E8Z A;  1XLN A;  3P4Q B;  3VRA B;  1ESF A;  2LWP A;  1J7A A;  1SE2 A;  2D07 B;  1XLQ A;  2KWU B;  2BWF A;  1I42 A;  1YMH E;  4L23 A;  3DBH I;  3DHG C;  2JWZ A;  1L2N A;  2LMC A;  2ZPN A;  1YQB A;  1L7Y A;  3KUC B;  4NAW B;  3TL5 A;  4ANU A;  1TKG A;  2GMI C;  4A9A A;  4HPM B;  4A20 A;  1YN5 A;  5IO9 A;  1GOZ A;  1T0Y A;  2A4Z A;  3GZN B;  1WM3 A;  2UWQ A;  3N32 A;  4LNO A;  3ZKJ C;  4S17 A;  5IP4 D;  2IGG A;  1QQR A;  2A5U A;  4X57 B;  4IUM B;  4BFR A;  2GB1 A;  1V97 A;  2D3G A;  2K8H A;  1IYF A;  2DYB A;  3PZ8 A;  5HI1 A;  1J19 A;  1FPY A;  2JQR B;  1IUE A;  3KUZ A;  1MG8 A;  1XQQ A;  5EE0 A;  1CZP A;  2DZI A;  1ET6 A;  5GXG B;  1XF5 L;  1CMX B;  2D11 A;  1UZX B;  2O6V A;  3VAW A;  3PV1 A;  2IBI B;  3BWU D;  1WX9 A;  2M19 A;  1JWM D;  1SEB D;  2Z0D B;  3NUH B;  1JRU A;  2R2Q A;  3H6N A;  1YNT E;  3H1U A;  3RMK C;  3AB5 A;  2WXI A;  1K50 A;  3I9V 1;  1FFV A;  2LXA A;  4NZL B;  4KGR A;  4MM3 A;  4AJW A;  3EFU A;  4N6E B;  4NY0 A;  1YX6 B;  1J0G A;  3PVL A;  2H88 B;  3KYC D;  1JAL A;  2V3P A;  3TJP A;  2JUO A;  2DAJ A;  2VZK B;  4G11 A;  2LGD A;  4L1B A;  1JWU D;  2G4D B;  1WGH A;  3B08 A;  3MHZ A;  2PW9 A;  3ZIM A;  2J7Q B;  2V3S A;  3TIX A;  5BYR A;  2L76 A;  3A4R A;  2WHI A;  4FAD A;  2J52 A;  2WXO A;  3ML9 A;  1P7F A;  2JZ3 B;  3U7D A;  1TBE A;  2RMM A;  4M8N A;  2WX0 A;  4OW0 A;  2O6V B;  3OAW A;  3GZN I;  1XT9 B;  3QJZ A;  4XX5 A;  3IXS A;  2OED A;  4HLE A;  2KDE B;  3PLU A;  4HCP B;  4DWF A;  3QQ8 B;  2RSU A;  3ZNI D;  2I2Y A;  4ANW A;  1ZUD 2;  3IT4 B;  1I4R A;  3RN9 C;  4PYZ A;  3ZJT A;  4MM3 B;  3QAR A;  2CHX A;  4Q2J A;  4R3D A;  3KYD D;  2HDE A;  1FXA A;  5D3D A;  3ZW3 A;  4OZB A;  1VD2 A;  3BYY B;  4W9H A;  2D3B A;  2D5G A;  2ACZ B;  2XN9 C;  2MJ3 A;  5TSS A;  3IHP C;  1F2R I;  1TS3 A;  3T3N A;  2KTR A;  2D3C A;  4HVB A;  1CK1 A;  1Q0W B;  2FID A;  3JW0 X;  1WE6 A;  3AE7 B;  4G3X B;  1QOA A;  1AWD A;  3A9K B;  4A55 A;  1EU3 A;  2LXC A;  4YTN B;  3RPF C;  1J7B A;  4DK5 A;  4USA A;  2MBO A;  2MX2 A;  2NTS A;  4BVU C;  4KDL B;  2ZW0 A;  1TS4 A;  3P63 A;  1V9J A;  2KYW A;  2CHZ A;  3N1Y C;  1JWS D;  2K3U A;  3Q3F A;  2K6Q A;  5T8I A;  4M01 A;  4GU2 A;  2WXJ A;  5AEK B;  4ZYS A;  3M95 A;  2IDY A;  3I63 C;  3KW5 B;  3T8M A;  2NPT A;  4C7Y A;  2N7J A;  3AN1 A;  4YXD B;  4AS1 A;  3SEB A;  2FE8 A;  5J17 A;  2E3T A;  3N1X C;  4KVG B;  4EZL A;  3L54 A;  4LK0 M;  4N58 A;  1RLF A;  5JZE B;  1GAQ B;  2KTR B;  2LVO A;  4GDK B;  1YX5 B;  4RGO S;  4WAF A;  2KNB A;  2R2O A;  4E74 A;  1I7H A;  2C9W B;  4LNN A;  3AXC A;  4KKI A;  4II2 B;  3NZU A;  4IWQ A;  5LLI A;  4IWP A;  1UGJ A;  4H2A A;  2RDB C;  3ENE A;  1V49 A;  5AUK A;  1SJE D;  4GLS C;  3APF A;  3L17 A;  3AV8 A;  1WRD B;  5EE9 A;  3ZNG C;  4HKQ A;  1ZGU B;  4HPP A;  1ZW7 A;  2BTE A;  1MJD A;  1E8X A;  2JXX A;  3BII D;  5C3J B;  1WF9 A;  4GN1 A;  4A3O A;  3LYY A;  4PK1 A;  1ISN A;  4JGH B;  5C1Z A;  1E8W A;  3PS6 A;  4US8 A;  4WQM A;  3W1S A;  3CIR B;  2FAZ A;  1TKY A;  5L95 C;  3TMP B;  1VZ7 A;  2OJR A;  2BGF A;  3OLM D;  2GI9 A;  4MSQ B;  1JWA D;  2JYT A;  2K8C A;  4ARI A;  2PTL A;  1L0Y B;  2QCZ A;  1MI0 A;  2WDQ B;  3OJ3 A;  3RZW C;  1YN4 A;  2RPV A;  3RNE C;  4EUT A;  1C4A A;  1ZXI A;  2WU5 B;  3EGR A;  1MHH E;  2BT6 A;  2AQ2 B;  1NYR A;  2MBQ A;  2YEP B;  4OZA A;  1WMH A;  3IG3 A;  2OHF A;  2NBU A;  1GJZ A;  3B2F A;  1N6Z A;  1WJ6 A;  3LXF A;  2ZEQ A;  2CKH B;  4DBG A;  3HIZ A;  4KX6 B;  4FJZ A;  3NOB A;  2AL6 A;  3AI5 A;  2W82 A;  2AEH A;  3QAQ A;  3DVG X;  1VLB A;  1SXT A;  1WGG A;  2KQS A;  2WXN A;  1IPG A;  1XCT L;  2WWZ A;  1ZXH A;  1S3S G;  2QHO A;  5AZF A;  5HKH A;  1FNW A;  1A5R A;  2AWT A;  2WXL A;  2KN5 A;  4M02 A;  1OGW A;  3AU5 A;  4XWT A;  2C5L C;  1ZPS A;  4ACF A;  2LUE A;  1WY8 A;  2KX0 A;  4DHZ B;  4YWG G;  3RUI B;  4WJP A;  2FUH B;  2VH2 A;  2N9L A;  4IM3 A;  2JYE A;  4BZA A;  1UBQ A;  1R7S A;  3KWL A;  4C4V A;  2NR2 A;  4DHJ B;  1AN8 A;  2N7E A;  1WMH B;  3H7S A;  4HXD A;  1M94 A;  2NVU I;  1TGZ B;  4FBJ B;  1FO4 A;  3OWE B;  1V5O A;  1SE9 A;  2WP9 B;  2MP2 A;  4QAY A;  2LVP A;  1RM6 C;  1BUI C;  2GBJ A;  3V60 A;  4MGK E;  3QK0 A;  5D6J B;  5TR5 A;  1N62 A;  2PE6 B;  4P1C C;  2JWU A;  2IGH A;  1WGY A;  1WXM A;  2KJ6 A;  5BMH A;  3ZO5 B;  3Q6B A;  2M17 A;  1UWM A;  2N7D A;  3WA0 A;  1EO6 A;  2HTH A;  5CX3 A;  2IO1 B;  3ZRC A;  2X38 A;  1RFK A;  5DPR A;  2PJH A;  4B95 A;  4WWP A;  4C4V B;  1PYW D;  4ZHO A;  1X1M A;  4MAC A;  3BVM A;  1MG4 A;  1GC6 A;  1QLB B;  3CSF A;  1HTO A;  2KLC A;  5CTR C;  1WZ0 A;  2DLB A;  2M0A A;  4LTU A;  4ANX A;  4LCD E;  2MP2 B;  1E7V A;  5D2M B;  4A3P A;  2E6X A;  1Q5W B;  1P1A A;  3NZS A;  4WWO A;  2JU6 X;  3WIM A;  4HCN B;  1RFA A;  2KC1 A;  2C7N B;  1GUA B;  1HTQ A;  4ZRP A;  4WWM A;  2PVG C;  1FIQ A;  2BF8 B;  4KSL C;  4FJY A;  4J6I A;  4ZRI A;  3DCG A;  4MDK E;  2KWD A;  1PFD A;  2C7H A;  1V6E A;  3VR8 B;  2DZJ A;  3B1L X;  3U4E G;  5EE3 A;  2H89 B;  1ZKH A;  2QIE B;  1EF1 A;  2AYO B;  3IVF A;  2FCN A;  3FAH A;  1Q10 A;  4W9L A;  4FA6 A;  2BBC A;  2ZW1 A;  3L4P A;  2DZM A;  4RFB A;  1L0V B;  4A90 A;  3DWG C;  2RDG A;  2KAN A;  4ITK A;  5E6J A;  3FIL A;  2KFJ A;  1SGH A;  1T0S C;  1VZ8 A;  3WAO A;  4NAW A;  3SFD B;  3AEE B;  3Q3O C;  1YQ3 B;  3A1Q A;  5J18 A;  1UF0 A;  2NS5 A;  5IOI A;  4HRS A;  3TEY A;  2G9H D;  3HM3 A;  1FXI A;  2BKF A;  4PS7 A;  4ZRJ A;  1LM8 B;  3R8B A;  2QEJ C;  4CYE A;  2KC2 A;  1TYG B;  1K8R B;  5CHV C;  4D2K A;  5D3I B;  1E7U A;  3NY5 A;  3VR9 B;  2M4N A;  1MFW A;  4K7U A;  2PLP A;  2CHW A;  3I57 A;  4UDU C;  3VH3 B;  4LNK A;  4B0E A;  2MSE D;  3UGB B;  2RDH A;  3KUD B;  1FEH A;  5G55 A;  1JRO A;  3Q69 A;  3FIL B;  3ZXR A;  3PZ7 A;  3ZDT A;  3TCA A;  1P9D U;  1SBB B;  1KFY B;  1TTN A;  2CJN A;  1H8C A;  3N30 A;  3A1Q B;  3BK2 A;  3PGE A;  3L16 A;  2D2Q A;  2W3R A;  4TKN A;  3ZNH B;  3U8Z A;  3UIP B;  1F1H A;  1TZO A;  1QIL A;  5HFY A;  3OJ4 B;  4ZRQ A;  1XLP A;  1YJI A;  2MW5 A;  4RF1 A;  1WR6 E;  3IBE A;  4IM0 A;  4NNJ B;  2BPS A;  4RMA A;  2TSS A;  3ML8 A;  4EKU A;  1SSN A;  4KZ0 A;  4KV2 A;  1DOI A;  2QDF A;  3ONS A;  1VZ6 A;  2HJ8 A;  1C79 A;  1YN3 A;  2CS4 A;  1VJK A;  2AX5 A;  3V3X A;  2J4X A;  1IBX B;  1FRD A;  4DXA B;  2XK5 A;  3KH0 A;  1XO3 A;  2LZ6 A;  4N9F 4;  1JML A;  1T5X D;  2AQ3 B;  1QT9 A;  1IP9 A;  3HVD A;  4LDT B;  5AZH A;  4K3B A;  4AQ7 A;  3RNG C;  2BB6 A;  2BS2 B;  2N1V A;  4JLC A;  1PQS A;  3M3J A;  1ZDV A;  2KOX A;  3QA8 A;  2DEN B;  4E71 A;  2JRH A;  1D5M C;  4LJP B;  1A70 A;  2IY0 B;  3Q8B A;  4GSW A;  3RNB C;  2V9H A;  2WXR A;  4IW0 A;  2LGX A;  2Z59 B;  3DWM A;  3NZ3 A;  4S0R A;  1PGX A;  3AE5 B;  4RH6 A;  2HD5 B;  3PRE A;  2LGY A;  1YOV B;  5CHF A;  5IAA C;  5C23 A;  1N5X A;  2J53 A;  3J9C A;  3Q8E A;  3R66 C;  4EFO A;  3A9K A;  4YTM B;  4ARC A;  1E6E B;  3BIN A;  3L0W B;  1C77 A;  2XK5 B;  2O2V A;  1QKZ A;  2KQ4 X;  4WJQ A;  4AUQ C;  2KAC A;  2Q5W D;  3C19 A;  2KLG A;  3LJ3 A;  1ACC A;  3V6E B;  3DVN V;  4XDC A;  3AE6 B;  4JE3 B;  2L83 A;  3AEC B;  4W9D A;  1WYW B;  4KSK C;  2WXM A;  1L5P A;  1VR9 A;  3P1M A;  2LAS A;  4NPN A;  1OQQ A;  1EM7 A;  1KLU D;  1AYF A;  2EEL A;  1Y56 A;  5BMG A;  2RR9 A;  3U30 A;  5D94 A;  4TQ0 A;  3V62 A;  4CHK A;  1WXS A;  4GDK A;  1E90 A;  1I4X A;  4AOF A;  1JCK B;  4I6L B;  4RGM A;  1UNS A;  2MH7 A;  4JL9 A;  3AEG B;  4A6Q A;  2GRI A;  3UIN B;  4IC7 B;  3NVZ A;  1F9J A;  4YL8 A;  1KTK A;  5CHW A;  1D5Z C;  4W9G A;  3SHQ A;  4C80 A;  2M0X A;  4P1B C;  2O2V B;  3BVZ A;  4EE2 A;  3VH4 B;  2BS3 B;  3D32 A;  2BQQ A;  3KQ4 A;  2D3A A;  2Y5C A;  3EUB 2;  5JXV A;  4LNF A;  3ZTD A;  1TZ1 A;  1E0Z A;  3VRB B;  3KLS X;  4NJ6 A;  3GOE A;  1ZDX A;  2WLB A;  4EOY A;  4JQW C;  1WM2 A;  3RD2 A;  3OG5 A;  1C3T A;  2L52 A;  3L10 B;  2K22 A;  5HG2 A;  2K9X A;  4W9J A;  4AP4 C;  2KN4 A;  4MH8 A;  3ETR A;  1E8Y A;  2ZNV C;  1IGC A;  3ECI A;  4K7W A;  2V4I B;  1PDX A;  3NS8 A;  4ICU A;  4KGS A;  4PS3 A;  1T6B X;  2LJ5 A;  3AEB B;  3W5V B;  2XBB C;  1HA5 A;  2VZK D;  1LO5 D;  1L4D B;  2WS3 B;  1L6U A;  4RGN A;  4K81 A;  2GLS A;  3EC8 A;  2KVR A;  2LHE A;  1F52 A;  2REX A;  1D5X C;  4REZ A;  3R3M A;  2LJI A;  1GG3 A;  4URK A;  2JZP A;  4CO7 A;  2WXH A;  1LXD A;  4HPL B;  3PTF C;  2N9K A;  5BO4 B;  1T0Q C;  1P7E A;  4F1S A;  2O6V D;  1XCQ L;  1V81 A;  5FR6 A;  1WFY A;  2JF5 A;  4WIP A;  3DDC B;  1MVK A;  3AM9 A;  2IO3 B;  1F2R C;  2YVC A;  1FCC C;  2KZR A;  2LGS A;  2M1M A;  4HRO A;  1BML C;  2MBH A;  1Q1O A;  3NJT A;  1KLV A;  2N9X A;  3DBL B;  5JHB A;  2NBV B;  3B2G A;  4BKS A;  3VDZ A;  2MEK A;  2Y5B B;  2PEA A;  4M0W A;  2L0F A;  4J3O D;  1N60 A;  3ZNZ B;  3HUI A;  2SEB D;  2N9E B;  1P0R A;  1WJU A;  4YSY B;  3QX1 A;  2N1W A;  3IAM 1;  1NEK B;  2Y3A A;  2X8X X;  4I6P A;  1L6V A;  2CJO A;  3L08 A;  3UF8 A;  2GBM A;  4FHK A;  3R7R A;  1T3Q A;  2CU3 A;  3QCA A;  2QJL A;  2FNJ B;  2IND C;  3APC A;  4B9K A;  1N5W A;  5C2T B;  3IAS 1;  3VUX A;  5LXH A;  4FXC A;  3ZXV A;  2V0G A;  3VTU A;  4RF0 A;  4PS8 A;  5AZG A;  4OHJ A;  2XNA C;  3B0A A;  2KMM A;  3A4S C;  3ZTC A;  2KDM A;  2KKC A;  1TS2 A;  2FUG 1;  3AUL A;  4M0W B;  1N63 A;  4CQN A;  2I1K A;  4BKG A;  2AQ1 B;  1TT5 B;  4G0N B;  3APD A;  4N59 A;  2CU1 A;  1GB4 A;  1CJE A;  1HXY D;  2Z0E B;  3N20 C;  3P4R B;  5IKC M;  3IT6 B;  4C00 A;  5FR3 A;  3Q8A A;  1WGK A;  4TMA B;  4ICV A;  4C56 C;  3V61 A;  1AW7 A;  4P6V F;  2L1A A;  3O13 A;  1E7P B;  3DBL I;  3VVW B;  2DWQ A;  4EZJ A;  2ZCC A;  1WXV A;  2LRW A;  3X23 A;  3JSV B;  1STE A;  3GE3 C;  4RGT A;  3Q8C A;  2NTT A;  3ZUN A;  4M00 A;  3ZLZ A;  2BB5 A;  3PLV A;  1VCB A;  1WX7 A;  3VXW A;  1J7C A;  3VUY A;  5G2N A;  1XXG A;  4XZ4 A;  2BYF A;  2W9N A;  3AE1 B;  1F0Z A;  1FMA D;  2OOB B;  1WRI A;  5FKA C;  2IY1 B;  3X0W A;  3RYT A;  2MJE A;  3RNA C;  3V6C B;  1GPX A;  2V1Y A;  3A9J A;  4KGT A;  3ZGZ A;  1YQ4 B;  1UD7 A;  3TBL D;  4DXG A;  1UH6 A;  1OEY J;  4P16 A;  2EKE C;  4RM9 A;  1WI0 A;  5D7G A;  1RAX A;  1KH0 A;  4GIV A;  2J0M A;  1YJJ A;  3PO0 A;  3SD5 A;  3DBH B;  3Q3M C;  3ZRF A;  1FFU A;  2AL3 A;  5G5G A;  2C7M B;  1SB3 C;  3Q3N C;  1V5T A;  1PGA A;  3DOW A;  2LI5 A;  1ZP0 B;  2K8B A;  3LDZ E;  2WXQ A;  1ZE3 D;  3JVZ X;  3AU4 A;  1SE3 A;  1GNU A;  2JX5 A;  2IZV B;  3GS2 A;  1RRB A;  1I4H A;  2C60 A;  2KQ7 A;  4G50 A;  3SU8 X;  3ZQ4 A;  5DPS A;  3C0R B;  3MJW A;  3A9J B;  5AUI A;  2JPH A;  5L83 A;  3PHX B;  4DDI D;  1EU4 A;  4WUR A;  1SJH D;  1WZ3 A;  4ASW C;  1JQ4 A;  5MPO A;  2MBB B;  1NI2 A;  2L00 B;  3RUL A;  4DHJ D;  2DX5 B;  2INP E;  2DNF A;  4IOI E;  2JXT A;  2FIF A;  3MTN B;  2R61 A;  1RWS A;  1Z5S B;  2JVC A;  3SDL C;  2LVQ A;  3ZJU A;  3KWV A;  4DHZ E;  1C76 A;  1IBX A;  3U7Z A;  4W9C A;  3HHM A;  1Y8R C;  4GDL A;  3AH7 A;  1NBF C;  1MHX A;  2KT7 A;  3MFG A;  2K5P A;  3NS1 A;  3K9P B;  4EEW A;  1D4B A;  2V3N A;  2KDB A;  3AE2 B;  1N61 A;  4GGQ A;  3W1S C;  4E3C A;  1DOY A;  1D6E C;  2MJD A;  1HZ5 A;  3DQV A;  3DHI C;  1RYJ A;  3MJ5 A;  4DQO C;  2QIL A;  2WXF A;  3N9Y C;  2GBR A;  3Q14 C;  2NMQ A;  2ICI A;  1KOT A;  5IN7 A;  2ZNV B;  5H8Y E;  1EWC A;  2KFK B;  2UU7 A;  1YIW A;  3MC9 A;  4P7I A;  4AWJ A;  2JZZ A;  1Z2M A;  5LNK 1;  2M8S A;  2LHD A;  4B0M A;  5E6P A;  1FXT B;  3PRM B;  2BKR B;  2PKO A;  1WH3 A;  3HM6 X;  3L13 A;  3E9S A;  4GDL B;  4F8C B;  2KVZ A;  2K6D B;  1J8C A;  5I4D A;  4AJY B;  2MBE A;  2QMT A;  3TUO A;  2WYQ A;  3A33 B;  3AE3 B;  4F7Z A;  3QC8 B;  3PRZ A;  1QOG A;  4M8M A;  3W2D A;  2JSV X;  1KM7 A;  1VDV A;  4BKT A;  1ROE A;  1B9R A;  4C7Z A;  4KZC A;  4XE0 A;  3AEF B;  3GE8 C;  5BMI A;  1NDD A;  2K0P A;  1OFF A;  2FCQ A;  5GMV A;  1KRH A;  5EE1 A;  3PPA A;  2W3S A;  2JRI B;  1KLG D;  3S2A A;  3PT2 B;  1C1Y B;  1U4A A;  1FNU A;  1XEE A;  4XDD A;  4OZC A;  3C8Y A;  1UUP A;  4XYC A;  2CR5 A;  3ZDM C;  5IA7 A;  2JY6 A;  3FKY A;  4FJV B;  1WSP A;  2IGD A;  1IGD A;  4NQK E;  1XLO A;  1OTR B;  1UGM A;  1H4R A;  3DBR B;  3VQI A;  3IFW B;  1NEN B;  4WJN A;  2NBW B;  2G3Q B;  5BYQ A;  1EWY C;  2B3A A;  1TS5 A;  3V05 A;  4A8X C;  2JT4 B;  1WGD A;  1R4N B;  1WR1 A;  2MRP A;  3RZF A;  3NRZ A;  3KVF B;  4KDI C;  3GP7 A;  3WAN A;  1P98 A;  4RM8 A;  3DVG Y;  2YEP F;  2BS4 B;  1HE8 A;  3CMM B;  2ON8 A;  3UI3 A;  2L7R A;  4XC2 A;  3RCZ A;  4WH4 A;  1BT0 A;  4FUL A;  3VTV A;  3ALB A;  2FCS A;  2KJR A;  1F77 A;  2VH1 A;  4US9 A;  4MEM A;  1FRR A;  3PSE B;  1EUV B;  4ZRK A;  3HVZ A;  4BBN F;  5JHA A;  3AE8 B;  2L8J A;  3U52 E;  2Y5P A;  3QHT A;  2RD0 A;  2FCM A;  4YSZ B;  2ONQ A;  3NVV A;  3URY A;  3H8H A;  2G1E A;  2W54 A;  3VUW A;  2KJH B;  3AED B;  4BAX A;  4EZK A;  1E10 A;  2KMA A;  3GB1 A;  2KMC A;  1XD3 B;  3B9J A;  3SR6 A;  1I4P A;  5LXI B;  1WE7 A;  2WX1 A;  4LNI A;  2KO3 A;  1R4M B; 
#chains in the Genus database with same CATH homology
 2ZPY A;  1XQQ A;  2BF8 B;  4MGI E;  2GBM A;  3UQA A;  4KSL C;  1I35 A;  4FJY A;  4J6I A;  4FHK A;  3R7R A;  4ZRI A;  2DZI A;  3DCG A;  3QCA A;  4MDK E;  1CMX B;  2FNJ B;  2D11 A;  3VFK A;  3APC A;  4B9K A;  3NHE B;  2C7H A;  1V6E A;  2ZVN A;  1UZX B;  2O6V A;  3VAW A;  2DZJ A;  3VUX A;  3T9L A;  5LXH A;  3B1L X;  3PV1 A;  4GXB A;  2IBI B;  3WAP A;  1EF5 A;  1ZKH A;  1WX9 A;  1EF1 A;  3DVN U;  2AYO B;  3VTU A;  3IVF A;  2FCN A;  3MHS D;  3DBR I;  4W9L A;  4FA6 A;  2Z0D B;  4ZDV A;  4PS8 A;  1OQY A;  1JRU A;  5AZG A;  2R2Q A;  3H6N A;  4ANV A;  2DZM A;  4MJS A;  1SIF A;  2KAN A;  2LRU A;  3B0A A;  3H1U A;  4JIO U;  3UQB A;  2KFJ A;  1R4N I;  1SGH A;  3A4S C;  1OEY A;  3WAO A;  3ZTC A;  4LDT D;  2LXA A;  3BY4 B;  4NAW A;  4MM3 A;  2KKC A;  4AJW A;  3EFU A;  3A1Q A;  3AUL A;  4M0W B;  4HK2 A;  4NY0 A;  1YX6 B;  5KHO A;  3PVL A;  5J18 A;  1J0G A;  2NS5 A;  3KYC D;  2I1K A;  5E6O A;  4BKG A;  3TJP A;  4G0N B;  3APD A;  2JUO A;  2L0T A;  3HK0 A;  2DAJ A;  2ZJD A;  4G11 A;  2CU1 A;  2LGD A;  4HDQ A;  1S1Q B;  2Z0E B;  3HM3 A;  2G4D B;  2L3Z A;  1WGH A;  2V4L A;  2BKF A;  4KIK A;  3B08 A;  1E5W A;  4PS7 A;  4ZRJ A;  2XEW A;  3ZIM A;  1LM8 B;  1WIA A;  4MH0 E;  4B6W A;  2EMS A;  2KC2 A;  4WQO B;  4CYE A;  1K8R B;  2J7Q B;  5CHV C;  1QZE A;  2V3S A;  1E7U A;  4ICV A;  3TIX A;  2GBK A;  2L76 A;  3A4R A;  3NY5 A;  1P3Q U;  2J0K A;  4FAD A;  3KUZ A;  3H7P A;  2M4N A;  4WJO A;  4NJ7 A;  3V61 A;  3ML9 A;  2JZ3 B;  2G4S A;  3U7D A;  1TBE A;  4K7U A;  4ZYN A;  4M8N A;  4NQL B;  3DBL I;  3VHT C;  3VVW B;  2WX0 A;  4EZJ A;  2ZCC A;  1WXV A;  2LRW A;  2CHW A;  2O6V B;  3OAW A;  2DZK A;  1KJT A;  3X23 A;  3JSV B;  2EMT A;  4FLH A;  3GZN I;  3VH3 B;  1XT9 B;  3QJZ A;  4XX5 A;  3ZUN A;  2MSE D;  4HLE A;  3UGB B;  2GOW A;  4TUU A;  3ZLZ A;  2KDE B;  3PLU A;  3PLV A;  1VCB A;  3KUD B;  4HCP B;  4DWF A;  1WX7 A;  2NPT B;  3QQ8 B;  4MJS B;  5G55 A;  3VUY A;  3VXW A;  5G2N A;  2RSU A;  3R7Q A;  2PPH A;  3ZNI D;  4XZ4 A;  4ANW A;  3ZDT A;  2BYF A;  2W9N A;  3TCA A;  2DAF A;  1P9D U;  5JH5 C;  1R4M I;  4PYZ A;  1TTN A;  2D10 A;  3QAR A;  1LQB A;  2CHX A;  2OOB B;  1H8C A;  2IY1 B;  3N30 A;  3A1Q B;  3PGE A;  4GMV A;  1YD8 U;  3X0W A;  2WDT B;  3RYT A;  3KYD D;  3L16 A;  3V6C B;  2D2Q A;  4TKN A;  2IO0 B;  4IM2 A;  3ZNH B;  2MLB A;  3ZW3 A;  3U8Z A;  2IYD B;  2KDI A;  1VD2 A;  1UBI A;  2V1Y A;  3UIP B;  4W9H A;  3A9J A;  2KXJ A;  4KIK B;  1D3Z A;  3QWZ B;  4FN2 A;  1UD7 A;  1LFD A;  2ZVO A;  3IHP C;  3QIJ A;  3TBL D;  5J2R A;  3OJ4 B;  3H9D A;  1UH6 A;  1OEY J;  2KTR A;  4IG7 B;  2MW5 A;  4HVB A;  1Q0W B;  3H7P B;  1WR6 E;  2FID A;  2EKE C;  3CST A;  3IBE A;  3JW0 X;  4IM0 A;  2BPS A;  4NNJ B;  1WE6 A;  4OVU A;  1WI0 A;  4RMA A;  4RM9 A;  5D7G A;  4W9I A;  4G3X B;  3ML8 A;  1RAX A;  2VRR B;  4EKU A;  4GIV A;  3A9K B;  4FHJ A;  4KZ0 A;  4KV2 A;  2J0M A;  3M63 B;  3ONS A;  2LXC A;  4DK5 A;  2MBO A;  2MX2 A;  4BVU C;  2HJ8 A;  4KDL B;  2CS4 A;  3SD5 A;  1V9J A;  2CHZ A;  2GBN A;  3UIO B;  3EEC A;  3ZRF A;  2AL3 A;  2K6Q A;  3Q3F A;  3JSV A;  2MA9 B;  2C7M B;  4DXA B;  2KDF B;  2XK5 A;  4GU2 A;  3KH0 A;  2LZ6 A;  1V5T A;  2BYV E;  3DOW A;  5AEK B;  3M95 A;  2LI5 A;  2PE9 A;  1V80 A;  2K8B A;  3LDZ E;  4N9F 4;  3JVZ X;  1IP9 A;  3AU4 A;  3KW5 B;  3T8M A;  1GNU A;  2G45 B;  2NPT A;  4LDT B;  5AZH A;  4W9E A;  2IZV B;  4BOS C;  2MCN B;  1RRB A;  5J17 A;  2C60 A;  2N1V A;  2KQ7 A;  3P2B A;  4G50 A;  4JLC A;  4KVG B;  1PQS A;  3SU8 X;  3W1Y A;  5DPS A;  4EZL A;  2K1F A;  3L54 A;  3C0R B;  3MJW A;  3A9J B;  3M3J A;  2JPH A;  2KOX A;  5L83 A;  1RLF A;  3PHX B;  3QA8 A;  4GB9 A;  2DEN B;  4DDI D;  4E71 A;  5JZE B;  2JRH A;  4LJP B;  2IY0 B;  2IO2 B;  2KTR B;  1YX5 B;  2LVO A;  4GDK B;  4GSW A;  3VTW A;  2KNB A;  2R2O A;  2ZZP B;  4E74 A;  4BOZ B;  2KWC A;  2LGX A;  4IW0 A;  1WZ3 A;  4ASW C;  2Z59 B;  2C9W B;  4TV3 A;  4W9K A;  3AXC A;  2MBB B;  1NI2 A;  2HD5 B;  4II2 B;  2L00 B;  3RUL A;  4DHJ D;  3NZU A;  2DX5 B;  2ASQ A;  3PRE A;  2LGY A;  4IWQ A;  3O65 B;  5LLI A;  5CHF A;  2FIF A;  5IAA C;  3MTN B;  5C23 A;  2ZCB A;  4IWP A;  1Z5S B;  2JVC A;  2K25 A;  2DHZ A;  1V2Y A;  3R66 C;  4EFO A;  3A9K A;  3SDL C;  2LVQ A;  3JYU A;  3ENE A;  3BIN A;  1V49 A;  3L0W B;  2XK5 B;  4LJO B;  3APF A;  2O2V A;  2YLM A;  3L17 A;  4DHZ E;  1WRD B;  4WAA A;  3ZNG C;  4WJQ A;  3N3K B;  1ZGU B;  4AUQ C;  4HWI B;  4W9C A;  3HHM A;  1Y8R C;  2KTF A;  4GDL A;  5E6N A;  1NBF C;  2LD9 A;  2KLG A;  3LJ3 A;  1ZW7 A;  1E8X A;  4EEW A;  3K9P B;  2JXX A;  3V6E B;  4PYU A;  3DVN V;  1AAR A;  1WF9 A;  2KDB A;  4GN1 A;  4A3O A;  4DDG D;  1ISN A;  4JGH B;  5C1Z A;  1E8W A;  3PS6 A;  2BYE A;  2RPQ A;  4IWO A;  4W9D A;  1WYW B;  3W1S A;  4GGQ A;  4KSK C;  3W1S C;  4E3C A;  2KWV B;  2FAZ A;  2K39 A;  2LAS A;  5L95 C;  3WAM A;  1G6J A;  3TMP B;  4NPN A;  1UEL A;  2OJR A;  3DQV A;  2BGF A;  2BWE S;  3OLM D;  5DCN A;  1GC7 A;  2KD0 A;  4MSQ B;  2K8C A;  3ZVV A;  2RR9 A;  2GBR A;  3U30 A;  3WAL A;  5D94 A;  4TQ0 A;  3V62 A;  4CHK A;  1KOT A;  1WXS A;  3OJ3 A;  4GDK A;  2MWS B;  1E90 A;  3RZW C;  2ZNV B;  4AOF A;  4W9F A;  4EUT A;  2HE7 A;  2KFK B;  1YIW A;  4P7I A;  2L05 A;  4I6L B;  2MBQ A;  3CF6 E;  3PHW B;  4AWJ A;  3Q3J A;  2JZZ A;  4TQ1 A;  1WMH A;  1Z2M A;  3IG3 A;  4JL9 A;  2M8S A;  3UIN B;  2NBU A;  4IC7 B;  1GJZ A;  1F9J A;  4YL8 A;  1WJN A;  5EDS A;  1WJ6 A;  2UYZ B;  4HJK A;  4OVV A;  5CHW A;  1FXT B;  3PRM B;  2BKR B;  4W9G A;  5E6P A;  3SHQ A;  2ZEQ A;  2M0X A;  2CKH B;  3RT3 B;  2KHW B;  2O2V B;  4K7S A;  1WH3 A;  2RGF A;  3HIZ A;  4DBG A;  2DYM A;  4MSM B;  3VH4 B;  4FJZ A;  3HM6 X;  3D32 A;  3L13 A;  5DPW A;  3NOB A;  2AL6 A;  3AI5 A;  2AEH A;  3K9O B;  2DYO A;  4MGY E;  1WJ4 A;  3QAQ A;  3DVG X;  4GDL B;  4F8C B;  2J0J A;  2K6D B;  1J8C A;  3DPD A;  4AJY B;  4HDO A;  2MBE A;  1WGG A;  2WYQ A;  3A33 B;  4F7Z A;  2KQS A;  1IPG A;  3QC8 B;  3PRZ A;  3ZTD A;  1TZ1 A;  2MQJ A;  2WWZ A;  1S3S G;  1YJ1 A;  2QHO A;  5AZF A;  4M8M A;  5HKH A;  1A5R A;  1KM7 A;  4BKT A;  1WX8 A;  2AWT A;  4NJ6 A;  3PRP B;  2KN5 A;  3GOE A;  1OGW A;  3AU5 A;  4KZC A;  4EOY A;  2C5L C;  2KK8 A;  4JQW C;  1WM2 A;  3PZD A;  3RD2 A;  1NDD A;  2LUE A;  1C3T A;  1WY8 A;  2FCQ A;  3L10 B;  1V86 A;  2KX0 A;  3M62 B;  4DHZ B;  2N9P C;  3RUI B;  2KX3 A;  5GMV A;  4WJP A;  4W9J A;  2FUH B;  3PPA A;  2I1J A;  4IM3 A;  4AP4 C;  2JRI B;  1UBQ A;  3S2A A;  2NCN A;  3PT2 B;  4K1R B;  1C1Y B;  1U4A A;  4WWN A;  2NR2 A;  4DHJ B;  4II3 B;  2N7E A;  4MGZ E;  4MEL A;  1WMH B;  3EHV A;  3H7S A;  4HXD A;  1E8Y A;  2ZNV C;  1M94 A;  1WGR A;  2KFK A;  2CR5 A;  2NVU I;  5DPT A;  1TGZ B;  3ZDM C;  5IA7 A;  4I6N B;  2JY6 A;  3ECI A;  4K7W A;  4BKS D;  4FJV B;  4FBJ B;  3NS8 A;  1V5O A;  4ICU A;  1SE9 A;  4PS3 A;  2MP2 A;  2LJ5 A;  3DBS A;  4NQK E;  2XBB C;  1OTR B;  3I3T B;  1UGM A;  1H4R A;  2LVP A;  4K81 A;  5KHQ A;  2N4F A;  3EC8 A;  3VQI A;  3IFW B;  2KVR A;  4WJN A;  4GOC A;  2GBJ A;  2REX A;  2NBW B;  2G3Q B;  3V60 A;  4MGK E;  1WXA A;  3R3M A;  4BBN C;  2B3A A;  1GG3 A;  3QK0 A;  1E8Z A;  2JT4 B;  1WGD A;  5D6J B;  5TR5 A;  2PE6 B;  4URK A;  1WGY A;  1WR1 A;  2LWP A;  4CO7 A;  1WXM A;  2KJ6 A;  2D07 B;  1LXD A;  2MRP A;  4HPL B;  3RZF A;  3PTF C;  2KWU B;  2BWF A;  5BO4 B;  3KVF B;  4KDI C;  3WAN A;  3ZO5 B;  4F1S A;  2O6V D;  1P98 A;  2M17 A;  1I42 A;  2N7D A;  1V81 A;  5FR6 A;  1WFY A;  4RM8 A;  3WA0 A;  2JF5 A;  1EO6 A;  2HTH A;  5CX3 A;  3DVG Y;  2IO1 B;  3DBH I;  3DDC B;  2JWZ A;  3CMM B;  1HE8 A;  1L2N A;  3ZRC A;  2ZPN A;  2L7R A;  5DPR A;  1YQB A;  4XC2 A;  3RCZ A;  2PJH A;  4B95 A;  2IO3 B;  1BT0 A;  1L7Y A;  2YVC A;  3KUC B;  4FUL A;  4WWP A;  3VTV A;  3ALB A;  2FCS A;  2KJR A;  1X1M A;  2KZR A;  2M1M A;  4NAW B;  4MEM A;  3TL5 A;  3PSE B;  1EUV B;  4ANU A;  2MBH A;  1Q1O A;  1KLV A;  4ZRK A;  1GC6 A;  2N9X A;  3CSF A;  4BBN F;  5JHA A;  5JHB A;  2NBV B;  2KLC A;  2L8J A;  1WZ0 A;  5CTR C;  2GMI C;  3QHT A;  4HPM B;  2RD0 A;  4A20 A;  2FCM A;  4BKS A;  1T0Y A;  2A4Z A;  3VDZ A;  4ANX A;  2Y5B B;  3N32 A;  1WM3 A;  2PEA A;  2UWQ A;  4LCD E;  3ZKJ C;  2L0F A;  2MP2 B;  1E7V A;  2A5U A;  5D2M B;  3ZNZ B;  3VUW A;  2KJH B;  4A3P A;  4EZK A;  2N9E B;  4X57 B;  1P0R A;  2KMA A;  1Q5W B;  1WJU A;  1P1A A;  2KMC A;  3QX1 A;  3NZS A;  4IUM B;  4BFR A;  1XD3 B;  4WWO A;  3WIM A;  2D3G A;  2K8H A;  1IYF A;  4HCN B;  1RFA A;  2KC1 A;  2DYB A;  2C7N B;  1GUA B;  2N1W A;  1J19 A;  5LXI B;  1WE7 A;  2WX1 A;  4I6P A;  2KO3 A;  3L08 A;  3UF8 A;  1MG8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...