1YN5A

Crystal structures of eap domains from staphylococcus aureus reveal an unexpected homology to bacterial superantigens
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
103
structure length
103
Chain Sequence
AKEMQNVPYTIAVDGIMAFNQSYLNLPKDSQLSYLDLGNKVKALLYDERGVTPEKIRNAKSAVYTITWKDGSKKEVDLKKDSYTANLFDSNSIKQIDINVKTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords EapH2
publication title The Crystal Structures of EAP Domains from Staphylococcus aureus Reveal an Unexpected Homology to Bacterial Superantigens.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 29
structure length 103
sequence length 103
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03642 MAP MAP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1yn5A00
2IPKD 1AW7A 2QEJC 5D3DA 1BXTA 1D5XC 1TS2A 1TS5A 1ENFA 4TSSA 1EWCA 1SE2A 2R61A 1SBBB 3BYYB 3OWEB 1SEBD 1L0YB 3GP7A 3EA6A 1HQRD 1JWSD 3O13A 4DXGA 3SEBA 3MC0B 1JCKB 1SE3A 4RFBA 1KLUD 3R8BA 1PYWD 1UUPA 1I4QA 1YN5A 2AQ3B 2Z8LA 1TY0A 2NTTA 1TS3A 1ET9A 1KLGD 1I4RA 1D5ZC 1HXYD 4UDUC 3BZDB 1ET6A 2QILA 1UNSA 1TS4A 3TSSA 4ZYSA 2AQ1B 1LO5D 1SJED 2IJ0A 2G9HD 3KLSX 1B1ZA 2SEBD 3BVZA 4DXFA 1V1PB 1I4GA 3BYTB 1JWUD 1CQVA 3R2TA 3MFGA 4RGNA 1D5MC 1D6EC 1XXGA 2RDGA 4RH6A 3URYA 1DYQA 1JWMD 2TSSA 1L0XB 2XN9C 1FNUA 1I4PA 1TY2A 1KTKA 4RCOA 1FNWA 5FK9C 4O1NA 2NTSA 1YN4A 3BVGA 4RGOS 2RDHA 1EU3A 1SE4A 1SXTA 5TSSA 1GOZA 3V05A 2AQ2B 1V1PA 1YN3A 5I4DA 1T5XD 5D3IB 2ICIA 1AN8A 1QILA 4OHJA 1V1OA 1CK1A 1I4XA 3R2IA 5FKAC 1I4HA 3W2DA 1HA5A 4RGTA 1M4VA 1SJHD 1ESFA 1STEA 1F77A 4C56C 2XNAC 1EU4A 2J4XA 4NZLB 3BVMA 1FNVA 4RGMA
chains in the Genus database with same CATH superfamily
4JWSC 2AEHA 3W9CB 2MRPA 1WYGA 3QARA 1D5XC 3EFUA 3TBLD 2LVQA 2DYBA 3ML9A 2IBIB 2KC1A 4HDOA 2MW5A 2EMSA 3IFWB 3H7PB 4ZRIA 4US9A 4BKGA 2ZEQA 3NHEB 5JZEB 3PLVA 4KKJA 4EFOA 3GZNI 1ZDVA 3ZTDA 4H2AA 4HXDA 3MHSD 3W1SA 4GDKA 3T3NA 1K52A 1VRAB 2A4ZA 1FM0D 1ET6A 2UWQA 1ZXIA 3PRMB 2KTRA 1IGDA 4OW0A 2Y5CA 1QQRA 1JRUA 3DBLB 1D3ZA 3H9DA 3QX1A 3ALBA 3N32A 2KO3A 2QIEB 3MFGA 2VZKD 4A8XC 2L0TA 3L17A 3PRPB 4A55A 1I42A 3SU8X 1V2YA 4EZJA 1JWMD 2PLPA 1FRDA 4F7ZA 4KX6B 2MBEA 2JQRB 2L83A 2ZNVC 1CJEA 2ACZB 4AOFA 3P4QB 2JSVX 3RNCC 3BVGA 1HZ6A 3EUB2 4M01A 1FXAA 1X1MA 1CK1A 4WWNA 1I4HA 2MCNB 1WM3A 2L1AA 2K25A 2M56B 2MX2A 4JQWC 4YL8A 1L5PA 2R2OA 2FUHB 3ENEA 3H6NA 3WAMA 5MPOA 4R3DA 3UIOB 2LGXA 3PZ7A 1WGDA 1L6VA 1C4AA 4KIKA 3ZRCA 4WQMA 2IPKD 2J0MA 4JX1C 3AEFB 2Q5WD 1EM7A 3RT3B 2KD0A 4S17A 3DDCB 3BYYB 1ZDXA 2W54A 4Q2JA 1LM8B 2LWPA 3C19A 1CZPA 1BUIC 2K9XA 3ZKJC 1KOTA 1K51A 2CHZA 3W1SC 1FD6A 2LXAA 1N6ZA 1VR9A 1MHHE 2HTHA 3FILA 4RM9A 2V0GA 2L7RA 2GOWA 2KFKA 3VRBB 2RSUA 1V86A 4QAYA 1L0VB 2YEPF 3HM3A 4LNOA 1J7CA 4W9HA 3Q69A 3NVWA 4C7YA 1IPGA 2AL6A 2C5LC 4ZOHC 4BOZB 3Q8AA 4FJYA 2K5PA 2HJ1A 2J42A 3VTWA 1D6EC 1VZ6A 2LEKA 2C9WB 2WXFA 5CHVC 4K7WA 4YTNB 3UIPB 3AE7B 3N1ZC 4US8A 4GB9A 1N5XA 3L16A 1WFYA 3NZUA 1MVKA 4DDID 2K8CA 1SF0A 3SFEB 3QC8B 4GDLB 2WXMA 2FCMA 2GBNA 5IOIA 3AXCA 3ZTCA 2HJ8A 2IY1B 1KH0A 1OQQA 3QHTA 4IKGA 3UGBB 4XDDA 1LXDA 1Z2MA 4W9CA 4X57B 4XGAB 5J17A 1EF5A 4DBGA 2BYVE 1ENFA 3J9CA 2W9NA 3BIID 4XE0A 4K7SA 1NYQA 1N60A 4GXBA 2PMVA 3L10B 1WGHA 2WHIA 5CHFA 3DVNU 3AMZA 3FKYA 2KMMA 3H8HA 1P7EA 1SE9A 4HRSA 4DXGA 2XK5A 3DHIC 5IAAC 3NS1A 1UGMA 2AQ3B 4LNFA 3R7QA 1SB3C 1YQ4B 4J6IA 4PS3A 1JROA 2MSED 2AQ1B 1LO5D 2WGSA 2IJ0A 2WXKA 1WMHB 2DAFA 3AV8A 2N7DA 2VRRB 4FN2A 2J53A 1K8RB 2Y3AA 4A6QA 1RM6C 1ZPSA 2ONQA 4P16A 2GMIC 3P63A 2UYZB 4MEMA 1OGWA 1WF9A 1TY2A 1KTKA 3KYDD 3GS2A 5FR3A 3JSVA 1R7SA 4XC2A 4MGYE 2LGYA 5D6JB 1YN3A 3GE8C 3AULA 2CS4A 1TZOA 3TMPB 2ZVNA 2M0AA 1F2RC 4WJOA 1MHXA 4DHJB 3DVNV 2GBKA 3IBEA 4II2B 2M17A 3NZ3A 4BFRA 5IKCM 4M8NA 4ITKA 1IGCA 1R4NI 3ZJVA 2JXTA 3UI3A 1C1YB 2KJ6A 3CIRB 1HEZE 4MM3B 2GB1A 3BVMA 2Y5PA 2FBWB 4G11A 3Q8CA 3V62A 4HKZE 1GC6A 5C1ZA 4HCPB 3EHVA 5L83A 4GLSC 1WI0A 1EWCA 2JZ3B 5E6PA 4E71A 4A9AA 4DXAB 3SFDB 4WURA 2NBWB 5LNK1 4KDLB 3EA6A 3DWGC 3WAPA 2KT7A 3P1MA 1GG3A 1SE3A 1KLUD 3V60A 5HG2A 5DPRA 2HD5B 4II3B 1NI3A 3T9LA 1GPXA 2I1JA 4S0RA 2K8BA 4AS1A 1YNTE 2D3GA 2WXGA 1OEYJ 4LNKA 2LI5A 1YX5B 4HJGE 1UNSA 1TS4A 2IYDB 1P0RA 1PDXA 2N9LA 4DWFA 2MJDA 4HWIB 3GE3C 1SJED 3KLSX 2WX0A 2DWQA 1BT0A 2OOBB 4PYUA 2QMTA 4XWTA 3CF6E 1PGXA 2WDVB 3OG5A 3OJ3A 4B95A 2DYOA 1J7AA 3IXSA 4LNIA 4LDTB 1MI0A 5D2MB 3URYA 2N9XA 2K8HA 1GC7A 2KJRA 3R7RA 2V9HA 4WWPA 2QHOA 2JY6A 1UZXB 3AH7A 4IOIE 3AU5A 2RDHA 2KDMA 3VUXA 2LD9A 1FXIA 3P4PB 4NY0A 4TQ0A 1WIAA 4FULA 3NVYA 3AU4A 4OHJA 3IT4B 2V4IB 1F2RI 3DWMA 4I6LB 2AL3A 1JALA 4TKNA 4ANXA 3ZGZA 2IDYA 4PS7A 4W9GA 1YMHE 2JXXA 4OZAA 4C56C 4K3CA 1YIWA 2X38A 3UQBA 1AWDA 5E6OA 1V6EA 5BMGA 2LGDA 2MP2B 4TV3A 3FC4A 4G50A 1A70A 5C2TB 5AEKB 1FCCC 4IWOA 4HROA 1G6JA 1MFWA 2EELA 2YEPB 4LCDE 2L32A 4MDKE 4C80A 4M0WB 5BYRA 1FIQA 3NZSA 4W9FA 4YWGG 2N9PC 1UF0A 1MJDA 2MBOA 2GBJA 5E6JA 5DCNA 3IVFA 4EZLA 2M0XA 1YN5A 1XF5L 2QC8A 1JRPA 1ET9A 1KLGD 2IGHA 5JHBA 3N9YC 1S1QB 2ZCCA 3BINA 2KZRA 3ZRFA 1LQBA 3RD2A 2CJNA 3ZNGC 4G0NB 1FXTB 2LHEA 4YSXB 2Z59B 4KVGB 1Y8RC 5IA7A 1I7HA 2LUEA 1XXGA 2K39A 4ICVA 3CSFA 1WR1A 4MACA 3ZJTA 1WM2A 2V3SA 3ZXVA 2KDBA 1V1PA 2MJ3A 5D3IB 3M63B 2DBYA 1I4XA 1HE8A 4F8CB 3WCQA 4LLGM 2GBMA 4N9F4 3D32A 4FJZA 4JIOU 2HTME 3KVFB 2BS3B 2WXPA 1ZW7A 3DBRI 1RFKA 1V5TA 4ZRKA 3MJ5A 1E0ZA 2BW2A 1R4MI 4ANVA 1ZOYB 4OVVA 1GUAB 4RGMA 1XCQL 1AARA 1L4DB 1VJKA 2QEJC 2QCZA 2C60A 3PLUA 2O2VA 2YLMA 3LJ3A 3VH3B 4LJOB 3R66C 1H8CA 1T0RC 1SEBD 1C9FA 2MHJA 2BT6A 3R8BA 1Q1OA 5EE9A 1V9JA 2DYMA 4KDIC 4NJ6A 2FIFA 4OVZA 2LVOA 2KMCA 3RNAC 1EUVB 1Q5WB 2KANA 2INDC 2QILA 4TQ1A 5EDSA 5JHAA 4PT5A 4ZYSA 3JVZX 4XYCA 2WS3B 2KX0A 2KVRA 4DXFA 3P4RB 1RWSA 3QIJA 1YQ3B 4M8MA 4WIPA 1WJ4A 2DHZA 3A4SC 2G1EA 4AWJA 2RDGA 3WAOA 4ICUA 3AE5B 2W55A 3VR8B 1SIFA 2KWDA 3RNFC 2JF5A 3L13A 2PW9A 4MJSA 3PVLA 3DCGA 2WXJA 5KHOA 3JYUA 1AN8A 2W3SA 1HTOA 5G5GA 1RFAA 2IY0B 2FE8A 4OZCA 1OQRA 3U7DA 3GZNB 2ZW0A 2CU1A 1E7PB 1STEA 4M02A 2K1FA 2BS4B 1UBQA 3KWLA 1TKGA 3HVDA 1T0QC 4EEWA 2BTEA 3AEBB 2JWZA 1E9MA 1N62A 4NAWB 2V3PA 2WLBA 1NBFC 4OVUA 5D3DA 2OHFA 3PRZA 3A4RA 3VHTC 4NNJB 5CHWA 1ACCA 4E3CA 1NDDA 1E8ZA 2WXLA 1MG8A 3U8ZA 3VFKA 1E6EB 4A90A 4MT5A 5G5HA 4ZYNA 4M00A 2KWCA 4ARCA 3VR9B 3AE4B 3MHZA 2G4DB 3W5VB 4P7IA 1LFDA 3DVGX 4PYZA 4KZCA 3BZDB 4EKUA 3W1YA 4IWPA 1FFUA 1WXVA 2KMAA 2J7QB 3RULA 1OQYA 3JW0X 1T6BX 4ANWA 1ZUD2 3BVZA 2KTFA 1J7BA 2MBBB 1RLFA 3BYTB 1K50A 2JZZA 2DENB 2N0SB 4MGKE 1P7FA 1D5MC 3ML8A 2WP9B 3N3KB 1EF1A 1WJNA 1NYRA 1V80A 2JRHA 4DHJD 2KDFB 3VAWA 5G55A 4HKQA 1FNWA 1T3QA 1XT9B 4DDGD 2QJLA 3AI5A 1SXTA 4JL9A 2AQ2B 3LB8C 1UELA 2HE7A 2BKFA 2CR5A 3NS8A 2C7MB 1C79A 3W2DA 4K1RB 4IC7B 3M62B 1WY8A 1ESFA 4B9KA 3U30A 2NS5A 2MEKA 3OJ4B 3B2FA 2J4XA 2EKIA 2M19A 2K3UA 2DZIA 1HZ5A 1PGBA 2AWTA 4BZAA 2DNFA 3A9KB 4B0EA 2KHWB 2CHWA 2K6QA 4FADA 4BAXA 3TCAA 5GXGB 1V5OA 2O6VA 2PTLA 2KQ7A 3VUWA 2LMCA 3HVZA 2G45B 2RGFA 3KWVA 2NPTB 3RZFA 2PIAA 2NTTA 3A33B 2MH7A 1E7VA 2ZNVB 3L54A 1P3QU 4BBNF 3ZO5B 3BWUD 4LDTD 1ZP0B 3BK1A 3A9JA 4KGSA 3Q2AC 4HDQA 4DK5A 3BY4B 1EO6A 1YJ1A 3UQAA 4DHZE 4IG7B 2KNBA 1JWUD 2INCC 5H8YE 1KFYB 2JX5A 2E6XA 2GLSA 3NUHB 4MGZE 3SDLC 2BYFA 2INNE 2GRIA 3RI7C 2L00B 1JWBD 4GSWA 1L0XB 1ZGUB 2XBBC 2XN9C 3ZJUA 3AB5A 3C0RB 1QZEA 2MQJA 4C4VB 2HDEA 2FIDA 1C78A 4RF0A 4NJCA 3N20C 1SIJA 2JVCA 3AEGB 1EU3A 1SE4A 2MWSB 3APFA 2VH1A 3PZ8A 1Q10A 1VDVA 4A20A 2V3NA 4EZKA 4W9DA 2CKHB 4HK2A 5LXHA 2L76A 2B3AA 1RYJA 4W9JA 4RGTA 3AE1B 3DPDA 4MSQB 3EC8A 4BKSA 1VZ7A 3QJZA 1WGRA 2RPVA 2ZPNA 2W3RA 4AUQC 3AN1A 3AEAB 3MTNB 2WU5B 2X8XX 4GDKB 4ANUA 2BGFA 2D3BA 2BWFA 5BMIA 3A1QA 1GNUA 3TJPA 1C76A 3ZXRA 1XLPA 2KTRB 4JLCA 1J8CA 3ECIA 3VRAB 3HM6X 2CU3A 2LVPA 4P1BC 5GMVA 3SR6A 1WXSA 2GI9A 4FLHA 2EMTA 3IG3A 4RFBA 2L52A 3K9PB 4XZ4A 1V8CA 1IBXA 2KDIA 3RNGC 1E5WA 2K0PA 3N30A 3M3JA 3B08A 1TS3A 3DBHI 2J52A 5IP4D 3PZDA 1NENB 2FCNA 3WIMA 1U4AA 1TIFA 3H7PA 3B0AA 4J3OD 2D07B 3QWZB 2NBUA 5JH5C 2L0FA 1QOAA 2LZ6A 3R2TA 1D4BA 1TKEA 2WYQA 4RNAA 4BBNC 4YTMB 4RH6A 1R4NB 1M94A 3OLMD 3PS6A 4W9LA 1KJTA 5BMHA 1WXMA 1B9RA 1TT5B 1UWMA 1WRDB 3APCA 3V6CB 4GGQA 2WXHA 2KN4A 2NTSA 4WJQA 2V4LA 4RGOS 3KYCD 2WXQA 4FHJA 3KH0A 1ZXHA 1J0GA 4MSMB 1KM7A 4KIKB 2BB6A 2D10A 3VTVA 1WYWB 3SHQA 2B76B 4N58A 2LRWA 3P2BA 1HA5A 1IYFA 2N9EB 2UU7A 2JPHA 3TUOA 4DQOC 2WX1A 2PJHA 2L8JA 3B9JA 2NR2A 1L6UA 2D3CA 3DVGY 4IM2A 1Y56A 3FILB 2N7EA 2KFKB 3Q3MC 1SBBB 2MJEA 3K9OB 2G3QB 2IO3B 2BKRB 1HQRD 2DZJA 1JWSD 1JCKB 2KKCA 3NG0A 3Q8EA 1YQBA 1I4RA 2ZVOA 3PO0A 4UDUC 2YVCA 2WXIA 3NVVA 2N1VA 3OAWA 5IO9A 1Z5SB 1LGRA 3QCAA 3EFCA 1QLBB 4IUMB 4D2KA 2TSSA 1I4PA 2I2YA 1E90A 3VH4B 3IT6B 1WGKA 1YX6B 2R2QA 2Z0DB 1A5RA 2OEDA 2REXA 4IM0A 2FUG1 4MELA 2BYTA 2NCNA 3ZLZA 3R2IA 5FKAC 2QSDA 1FRRA 2CJOA 4FJVB 5BO4B 3LYYA 3T3OA 3A9JB 3KUCB 5C23A 2LGIA 4KGRA 4MH8A 2XNAC 1WXQA 1EU4A 2N7JA 2PKOA 3N1XC 1WX8A 3DQVA 1QOBA 2XK5B 4MGIE 1XCTL 4NAMA 1F0ZA 4ZRPA 4E74A 1BXTA 1TS2A 4GDLA 4TSSA 2D3AA 4HVBA 1SE2A 3ZIMA 1H4RA 3PGEA 3U4EG 1L7YA 2LRUA 2MBQA 2LJIA 1UBIA 3OWEB 1TYGB 2ZW1A 2IO1B 1V49A 1UGJA 3O65B 1ISNA 4IW0A 3X23A 3QA8A 3ZUNA 1TBEA 4HPMB 1CMXB 5G2NA 2G4SA 2LGSA 1SGHA 3U52E 1E8YA 2DZKA 1P9DU 4B6WA 1XD3B 3JSVB 2J0KA 3AE6B 3UF8A 4XX5A 1DGJA 3RFZB 2PVOD 1PGAA 2KOXA 3S2AA 2FNJB 5DPWA 1QF6A 2BS2B 4BVUC 1GB1A 4GOCA 4N59A 3RPFC 4O1NA 3DBRB 3Q6BA 1R4MB 5TSSA 5BYQA 1OEYA 4GIVA 3FAHA 4CO7A 1WMHA 4IM3A 1OFFA 2ZZPB 3DBLI 2M4NA 3PV1A 1QILA 2RDBC 3B1LX 1DOIA 1VLBA 3LDZE 3PHWB 2IZVB 4DHZB 2K22A 1MPEA 2WQYB 3WALA 2RPQA 5TR5A 4NZLB 2IO0B 1RRBA 3GB1A 1FNVA 1QOFA 2BPSA 1AW7A 1VZ8A 1T0YA 1GJZA 2KX3A 3AE8B 3WA0A 4P6VF 1QT9A 1YJJA 3Q3JA 3ZW3A 2MA9B 2R61A 2BQQA 4K3BA 1TJEA 4WWOA 2OJWA 5JXVA 5EE1A 4RF1A 3W5UB 3NJTA 1E8XA 2MLBA 4EUTA 4HLEA 4MM3A 3V61A 1PYWD 3RYTA 1NI2A 2ON8A 4HPPA 4L23A 5D94A 1L2NA 3WANA 1WX7A 1PFDA 2GBRA 4AQ7A 3TEXA 4AJWA 1I35A 2JRIB 4YSYB 4HEA1 2PPHA 3TIXA 1WWTA 1AYFA 3M95A 1WRIA 5J18A 1EWYC 2KLCA 4WWMA 2C7HA 3RZWC 1XO3A 5CTRC 3KUDB 4JWUC 2IGDA 4WAAA 5BYSA 3HRDD 2FCQA 4LTUA 4BKTA 2H89B 5IN7A 4MH0E 3ETRA 4ZHPA 1UWXA 1VD2A 2WU2B 2FAZA 3ZYYX 2KVZA 4CQNA 1S3SG 4TMAB 4HJKA 3H7SA 3H1UA 4PS8A 1DOYA 2RD0A 4ZRQA 1ZKHA 4EOYA 1M4VA 1ZE3D 3NY5A 3EGRA 3IAM1 3CWIA 2KK8A 3RN9C 3VVWB 4A3OA 2I38A 4WJPA 4ARIA 4GN1A 1C4CA 1GAQB 4CYEA 2KLGA 1WR6E 2AX5A 1TZ1A 1PUTA 4NJ7A 1E10A 2KACA 2N9KA 3PPAA 3Q3NC 2EKEC 3Q14C 3ZNID 4OZBA 3ZNHB 1WGGA 4WQOB 3U7ZA 1JWAD 2MP2A 3O13A 4ZDVA 3MC0B 2BVCA 3P4SB 1TY0A 1V81A 2LXCA 3ONSA 3TEYA 3Q8BA 1F1HA 3L08A 3HUIA 4LJPB 2N1WA 4M0WA 5J2RA 2J0JA 1YOVB 1UH6A 4AJYB 3VXWA 3I9V1 2WNMA 1V1PB 5AZGA 1FO4A 5C3JB 3UINB 2KFJA 3RNEC 2MBHA 4FXCA 1CQVA 2JWUA 5LLIA 4RGNA 1NVID 2D2QA 1Q0WB 3AM9A 4GMVA 3VQIA 4NPNA 5FR6A 1C77A 2BF8B 4RCOA 2JYTA 1OTRB 2JU6X 3HIZA 2VZKB 2RMMA 1WZ0A 3V05A 1T5XD 3AEDB 1WE6A 1WH3A 2LUMA 2WDTB 1WZ3A 4EE2A 4XWWA 2JZPA 2V1YA 1P98A 4LK0M 1QOGA 3Q3FA 3PREA 2O2VB 3RMKC 4BOSC 2DX5B 3Q8FA 5HI1A 2C7NB 2D11A 3RNBC 3AECB 1F77A 2VH2A 4IDIA 1XLOA 1JMLA 3CMMB 2BWES 3DHGC 2NMQA 5EE3A 1K53A 1J19A 2LFIA 1QKZA 5HKHA 2K6DB 4NQLB 4W9EA 5KHQA 2BYEA 2ZCBA 4K7UA 4N6EB 1NEKB 2WWZA 2JYEA 5HFYA 5LXIB 3C8YA 4PK1A 1UUPA 4RMAA 4REZA 3U2SC 2H88B 1SSNA 5AUKA 5H92C 2ASQA 1WGYA 3IAS1 3RCZA 2SAKA 2PEAA 2CHXA 2KWUB 4MJSB 1F9JA 1JW9D 4W9KA 2O6VD 1FPYA 4B0MA 3L0WB 3E56A 1FFVA 1WE7A 2M8SA 3ZQ4A 1L4ZB 1KRHA 2WXOA 1V97A 1YN4A 1P1AA 1FEHA 2DLBA 3DOWA 4WJNA 1YJIA 5I4DA 3MC8A 1RAXA 1KF6B 5AZFA 5D7GA 2ICIA 3HK0A 2OJRA 1V1OA 2AYOB 2JT4B 2KAJA 2WXNA 3I63C 3I3TB 3DBSA 1PQSA 3IHPC 3BK2A 1SJHD 2KDEB 1FCLA 3AE3B 2PVGC 4YSZB 1DOXA 4JE3B 2ZJDA 3DBHB 3AEEB 3I57A 1WJ6A 3P42A 3NRZA 2LHDA 1TS5A 2INPE 2DZMA 4LNNA 4K81A 4I6PA 1FMAD 3KQ4A 4WH4A 4BKSD 1F52A 3AE2B 2NVUI 4TUUA 3I5JC 2XEWA 4NAWA 5AUIA 4A3PA 3APDA 3V6EB 2Z8LA 3AE9B 2KJHB 1D5ZC 2A5UA 1HXYD 5L95C 1WJUA 4WAFA 3KW5B 3T8MA 1VCBA 3SD5A 1JQ4A 4XDCA 5CX3A 3EECA 1E7UA 1B1ZA 2PE6B 3QK0A 3ZNZB 1I4GA 3RUIB 4RM8A 2KQSA 1TKYA 2W82A 1DYQA 2I1KA 1XQQA 3VDZA 4NQKE 4ZRJA 5T8IA 1KLVA 5DPTA 4C7ZA 1MG4A 4KKIA 2WDRB 2ZPYA 4ASWC 2LJ5A 3N1YC 4P1CC 2Y5BB 1TTNA 4FA6A 4KV2A 4USAA 2E3TA 3CSTA 4FHKA 1N5WA 1WX9A 4URKA 5E6NA 1T0SC 1WXAA 2KYWA 2O6VB 3L4PA 3MC9A 3TEWA 2KC2A 2BBCA 4ACFA 3PSEB 1E8WA 3Q3OC 1C4PA 2JUOA 3DHHC 1GB4A 4CHKA 5HHDG 3PTFC 2WDQB 4FBJB 3E9SA 4W9IA 3ZVVA 3GOEA 1XEEA 2KXJA 2IGGA 1ROEA 3QQ8B 4KSKC 1UD7A 5DPSA 4IWQA 3GP7A 1L0YB 4AP4C 3TL5A 3VTUA 4L1BA 1YD8U 2D5GA 3SEBA 1I4QA 3V3XA 2NBVB 4F1SA 4YT0B 4JGHB 3ABVB 3A9KA 2QDFA 4G3XB 2PE9A 5AZHA 2KN5A 1XLNA 1IUEA 3TSSA 3R3MA 4HCNB 2BB5A 2G9HD 2LASA 2SEBD 4KZ0A 2L3ZA 2KQ4X 3LXFA 2FCSA 2DAJA 2Z0EB 3B2GA 2WXRA 4JPSA 2NPTA 4YTPB 4C00A 2N4FA 2L05A 3PHXB 4ZHOA 3VUYA 1FNUA 3NVZA 1TGZB 3NOBA 3ZDMC 5FK9C 4HPLB 1BMLC 3HHMA 4GU2A 2IO2B 1GOZA 1XLQA 5EE0A 1N61A 3KUZA 3X0WA 3ZDTA 3A1QB 4YXDB 3MP9A 4KSLC 3QAQA 3MJWA 1C3TA 1HTQA 1WSPA 4I6NB 4KGTA 4C4VA 3TEZA 1N63A 2KWVB 2RR9A 1IP9A 4L2YA 2M1MA 3PT2B 1IBXB
chains in the Genus database with same CATH topology
4JWSC 2AX5A 1FCCC 3W9CB 1WYGA 4HROA 1PUTA 1D5XC 2EELA 2YEPB 1E10A 2KACA 1C76A 2L32A 2N9KA 1XLPA 4C80A 5BYRA 1FIQA 4YWGG 4US9A 3VRAB 4OZBA 4KKJA 2CU3A 1ZDVA 3SR6A 4H2AA 3U7ZA 1JWAD 2GI9A 3O13A 3W1SA 5E6JA 3MC0B 4RFBA 2L52A 3T3NA 1K52A 3P4SB 1V8CA 1YN5A 1IBXA 1VRAB 1TY0A 2K0PA 1XF5L 1TS3A 1JRPA 1ET9A 3TEYA 1KLGD 2IGHA 3N9YC 1FM0D 2J52A 1ET6A 1ZXIA 3Q8BA 1NENB 3HUIA 4OW0A 1IGDA 4M0WA 2Y5CA 1QQRA 3I9V1 4J3OD 2CJNA 2LHEA 4YSXB 2WNMA 1V1PB 1FO4A 5C3JB 1QOAA 1CQVA 2JWUA 2QIEB 3MFGA 3R2TA 4FXCA 4RGNA 1NVID 2VZKD 4A8XC 1I7HA 4A55A 1D4BA 1TKEA 3AM9A 1XXGA 4RNAA 3VQIA 4YTMB 4RH6A 1JWMD 2PLPA 5BMHA 1FRDA 4KX6B 1B9RA 1UWMA 2JQRB 1C77A 2L83A 4MACA 1CJEA 2ACZB 3P4QB 4RCOA 3ZJTA 2WXHA 2KN4A 2NTSA 2JYTA 2JSVX 3BVGA 4RGOS 2JU6X 2WXQA 1HZ6A 2VZKB 2RMMA 3EUB2 1ZXHA 3V05A 1FXAA 1V1PA 2MJ3A 1T5XD 5D3IB 3AEDB 2LUMA 4EE2A 2DBYA 2JZPA 4XWWA 2BB6A 4LK0M 1CK1A 1I4XA 1QOGA 1I4HA 2B76B 4N58A 2L1AA 3WCQA 1HA5A 2M56B 3Q8FA 5HI1A 4LLGM 3TUOA 4DQOC 1L5PA 3AECB 1F77A 2HTME 3B9JA 4IDIA 2BS3B 2WXPA 4R3DA 1XLOA 1JMLA 1RFKA 3PZ7A 1L6UA 3MJ5A 1E0ZA 2BW2A 1L6VA 1ZOYB 1C4AA 2NMQA 4RGMA 5EE3A 1K53A 1XCQL 2LFIA 1QKZA 2IPKD 1L4DB 1VJKA 2QEJC 4JX1C 4WQMA 3AEFB 1Y56A 3FILB 2Q5WD 1EM7A 1SBBB 2MJEA 3BYYB 4N6EB 1ZDXA 2W54A 1NEKB 4Q2JA 1SEBD 2JYEA 5HFYA 1CZPA 1C9FA 1BUIC 2BT6A 2K9XA 1HQRD 1JWSD 3C8YA 1JCKB 1K51A 3R8BA 1UUPA 4REZA 1FD6A 5EE9A 2DYMA 3U2SC 2H88B 1SSNA 3Q8EA 4OVZA 1VR9A 5AUKA 5H92C 1I4RA 1MHHE 3PO0A 3FILA 4UDUC 2V0GA 2WXIA 3IAS1 2QILA 3NVVA 3VRBB 4TQ1A 2SAKA 4PT5A 4ZYSA 1L0VB 2WS3B 2YEPF 1JW9D 4DXFA 1J7CA 3Q69A 3NVWA 4C7YA 3P4RB 4B0MA 1RWSA 3E56A 1FFVA 1YQ3B 4ZOHC 4WIPA 3ZQ4A 3Q8AA 2K5PA 2G1EA 1QLBB 1D6EC 2J42A 1VZ6A 2LEKA 2RDGA 4D2KA 2TSSA 1L4ZB 3AE5B 1I4PA 2W55A 2I2YA 3VR8B 1KRHA 3IT6B 1WGKA 2WXOA 2WXFA 2KWDA 1V97A 4YTNB 2PW9A 1YN4A 1FEHA 2DLBA 3AE7B 2WXJA 4US8A 1YJIA 5I4DA 1N5XA 2OEDA 1KF6B 5D7GA 2ICIA 1AN8A 2FUG1 2BYTA 1MVKA 1V1OA 2W3SA 3R2IA 1SF0A 2KAJA 5FKAC 5G5GA 3SFEB 4GDLB 2QSDA 2FE8A 1FRRA 2WXMA 4OZCA 2CJOA 2WXNA 1OQRA 3LYYA 3T3OA 3BK2A 1SJHD 2ZW0A 2LGIA 1E7PB 4KGRA 1STEA 4MH8A 1KH0A 1FCLA 2BS4B 3KWLA 2XNAC 1TKGA 1WXQA 3AE3B 1EU4A 3HVDA 1OQQA 2N7JA 2PKOA 4IKGA 2BTEA 3AEBB 2PVGC 4YSZB 1DOXA 1E9MA 4XDDA 1N62A 4JE3B 4NAWB 1QOBA 3AEEB 3I57A 2V3PA 1XCTL 4NAMA 1F0ZA 3P42A 2WLBA 3NRZA 4ZRPA 5D3DA 1BXTA 2LHDA 1TS2A 2OHFA 1TS5A 1ACCA 1ENFA 4TSSA 2WXLA 1SE2A 3J9CA 3BIID 4XE0A 3U4EG 1NYQA 1N60A 2INPE 2PMVA 1E6EB 2LJIA 4A90A 1FMAD 1TYGB 2ZW1A 3KQ4A 3OWEB 4MT5A 4WH4A 5G5HA 3AMZA 1UGJA 3AE2B 2KMMA 3H8HA 1P7EA 3VR9B 4ARCA 4HRSA 4DXGA 3AE4B 5AUIA 3MHZA 3NS1A 2AQ3B 2Z8LA 3W5VB 1SB3C 1YQ4B 3AE9B 3U52E 1D5ZC 1HXYD 3BZDB 1JROA 4WAFA 1FFUA 1JQ4A 4XDCA 2AQ1B 1LO5D 3AE6B 1T6BX 2IJ0A 2WXKA 1ZUD2 1B1ZA 1DGJA 1J7BA 3BVZA 1I4GA 1K50A 2PVOD 2N0SB 3BYTB 3RFZB 1PGAA 1P7FA 1D5MC 3AV8A 2J53A 2Y3AA 1TKYA 4A6QA 2W82A 1RM6C 1ZPSA 1DYQA 2ONQA 2WP9B 4P16A 3P63A 1NYRA 1QF6A 1TY2A 2BS2B 1GB1A 4N59A 5T8IA 1KTKA 3RPFC 4HKQA 1FNWA 4O1NA 3GS2A 4C7ZA 5FR3A 1T3QA 4KKIA 1R7SA 2QJLA 1SXTA 5TSSA 5BYQA 2WDRB 3FAHA 2AQ2B 1YN3A 3LB8C 1OFFA 1TZOA 2M0AA 1F2RC 1MHXA 1QILA 4USAA 2E3TA 1DOIA 1VLBA 1C79A 3W2DA 3NZ3A 1N5WA 2K22A 1MPEA 2WQYB 4ITKA 1ESFA 1IGCA 3ZJVA 2MEKA 3L4PA 2JXTA 2J4XA 2EKIA 3B2FA 3UI3A 3TEWA 2M19A 4NZLB 2BBCA 2K3UA 3CIRB 1HEZE 4MM3B 2GB1A 3BVMA 1C4PA 2FBWB 1FNVA 1QOFA 2Y5PA 3GB1A 1HZ5A 1PGBA 1GB4A 5HHDG 2WDQB 3Q8CA 3E9SA 1AW7A 4HKZE 4B0EA 1VZ8A 3AE8B 4P6VF 1QT9A 1XEEA 1YJJA 4GLSC 1EWCA 2R61A 2IGGA 4A9AA 1TJEA 1ROEA 3SFDB 5JXVA 5GXGB 3GP7A 1L0YB 4RF1A 2PTLA 4WURA 5EE1A 3W5UB 5LNK1 3EA6A 3DWGC 4L1BA 2D5GA 2LMCA 3P1MA 3HVZA 3SEBA 1SE3A 1KLUD 1PYWD 3KWVA 1I4QA 5HG2A 3V3XA 1NI3A 2PIAA 4YT0B 1GPXA 2ON8A 4L23A 3ABVB 2NTTA 2MH7A 4AS1A 1YNTE 2WXGA 1PFDA 4AQ7A 3TEXA 3BWUD 1ZP0B 3BK1A 1XLNA 2N9LA 1UNSA 1TS4A 1IUEA 1PDXA 4HJGE 4KGSA 4YSYB 3TSSA 4HEA1 2MJDA 2BB5A 1SJED 2G9HD 3KLSX 1WWTA 1AYFA 2DWQA 2SEBD 2QMTA 4XWTA 1WRIA 2KQ4X 3B2GA 3LXFA 1JWUD 1PGXA 1EWYC 2WDVB 4WWMA 5H8YE 1KFYB 2JX5A 2E6XA 2WXRA 4JPSA 1XO3A 3NUHB 2DYOA 2INNE 1J7AA 3IXSA 4YTPB 2GRIA 1MI0A 4JWUC 3URYA 1JWBD 2IGDA 1L0XB 4ZHOA 2XN9C 3ZJUA 1FNUA 3NVZA 3AB5A 5BYSA 3HRDD 4LTUA 2HDEA 3AH7A 4IOIE 2H89B 5FK9C 1BMLC 1C78A 4RF0A 3ETRA 4NJCA 4ZHPA 1UWXA 1SIJA 3AEGB 2RDHA 2KDMA 1EU3A 1SE4A 2WU2B 3ZYYX 1GOZA 4CQNA 3PZ8A 1Q10A 1VDVA 1FXIA 4TMAB 3P4PB 1XLQA 4TQ0A 5EE0A 1N61A 2V3NA 3NVYA 1DOYA 4OHJA 3IT4B 3MP9A 4YXDB 2V4IB 1F2RI 3DWMA 4ZRQA 1RYJA 4RGTA 3AE1B 1M4VA 1ZE3D 1JALA 1WSPA 3EGRA 3IAM1 2IDYA 3ZGZA 1YMHE 4KGTA 4OZAA 1VZ7A 4C56C 2X38A 3TEZA 2RPVA 2W3RA 1AWDA 1N63A 3CWIA 3AN1A 5BMGA 3AEAB 3FC4A 2WU5B 1IBXB 4GDKB 2I38A 4L2YA 4ARIA 1C4CA 1GAQB 5MPOA 1A70A 5BMIA 5C2TB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IPK D;  1AW7 A;  2QEJ C;  5D3D A;  1BXT A;  1D5X C;  1TS2 A;  1TS5 A;  1ENF A;  4TSS A;  1EWC A;  1SE2 A;  2R61 A;  1SBB B;  3BYY B;  3OWE B;  1SEB D;  1L0Y B;  3GP7 A;  3EA6 A;  1HQR D;  1JWS D;  3O13 A;  4DXG A;  3SEB A;  3MC0 B;  1JCK B;  1SE3 A;  4RFB A;  1KLU D;  3R8B A;  1PYW D;  1UUP A;  1I4Q A;  1YN5 A;  2AQ3 B;  2Z8L A;  1TY0 A;  2NTT A;  1TS3 A;  1ET9 A;  1KLG D;  1I4R A;  1D5Z C;  1HXY D;  4UDU C;  3BZD B;  1ET6 A;  2QIL A;  1UNS A;  1TS4 A;  3TSS A;  4ZYS A;  2AQ1 B;  1LO5 D;  1SJE D;  2IJ0 A;  2G9H D;  3KLS X;  1B1Z A;  2SEB D;  3BVZ A;  4DXF A;  1V1P B;  1I4G A;  3BYT B;  1JWU D;  1CQV A;  3R2T A;  3MFG A;  4RGN A;  1D5M C;  1D6E C;  1XXG A;  2RDG A;  4RH6 A;  3URY A;  1DYQ A;  1JWM D;  2TSS A;  1L0X B;  2XN9 C;  1FNU A;  1I4P A;  1TY2 A;  1KTK A;  4RCO A;  1FNW A;  5FK9 C;  4O1N A;  2NTS A;  1YN4 A;  3BVG A;  4RGO S;  2RDH A;  1EU3 A;  1SE4 A;  1SXT A;  5TSS A;  1GOZ A;  3V05 A;  2AQ2 B;  1V1P A;  1YN3 A;  5I4D A;  1T5X D;  5D3I B;  2ICI A;  1AN8 A;  1QIL A;  4OHJ A;  1V1O A;  1CK1 A;  1I4X A;  3R2I A;  5FKA C;  1I4H A;  3W2D A;  1HA5 A;  4RGT A;  1M4V A;  1SJH D;  1ESF A;  1STE A;  1F77 A;  4C56 C;  2XNA C;  1EU4 A;  2J4X A;  4NZL B;  3BVM A;  1FNV A;  4RGM A; 
#chains in the Genus database with same CATH topology
 4JWS C;  2AEH A;  3W9C B;  2MRP A;  1WYG A;  3QAR A;  1D5X C;  3EFU A;  3TBL D;  2LVQ A;  2DYB A;  3ML9 A;  2IBI B;  2KC1 A;  4HDO A;  2MW5 A;  2EMS A;  3IFW B;  3H7P B;  4ZRI A;  4US9 A;  4BKG A;  2ZEQ A;  3NHE B;  5JZE B;  3PLV A;  4KKJ A;  4EFO A;  3GZN I;  1ZDV A;  3ZTD A;  4H2A A;  4HXD A;  3MHS D;  3W1S A;  4GDK A;  3T3N A;  1K52 A;  1VRA B;  2A4Z A;  1FM0 D;  1ET6 A;  2UWQ A;  1ZXI A;  3PRM B;  2KTR A;  1IGD A;  4OW0 A;  2Y5C A;  1QQR A;  1JRU A;  3DBL B;  1D3Z A;  3H9D A;  3QX1 A;  3ALB A;  3N32 A;  2KO3 A;  2QIE B;  3MFG A;  2VZK D;  4A8X C;  2L0T A;  3L17 A;  3PRP B;  4A55 A;  1I42 A;  3SU8 X;  1V2Y A;  4EZJ A;  1JWM D;  2PLP A;  1FRD A;  4F7Z A;  4KX6 B;  2MBE A;  2JQR B;  2L83 A;  2ZNV C;  1CJE A;  2ACZ B;  4AOF A;  3P4Q B;  2JSV X;  3RNC C;  3BVG A;  1HZ6 A;  3EUB 2;  4M01 A;  1FXA A;  1X1M A;  1CK1 A;  4WWN A;  1I4H A;  2MCN B;  1WM3 A;  2L1A A;  2K25 A;  2M56 B;  2MX2 A;  4JQW C;  4YL8 A;  1L5P A;  2R2O A;  2FUH B;  3ENE A;  3H6N A;  3WAM A;  5MPO A;  4R3D A;  3UIO B;  2LGX A;  3PZ7 A;  1WGD A;  1L6V A;  1C4A A;  4KIK A;  3ZRC A;  4WQM A;  2IPK D;  2J0M A;  4JX1 C;  3AEF B;  2Q5W D;  1EM7 A;  3RT3 B;  2KD0 A;  4S17 A;  3DDC B;  3BYY B;  1ZDX A;  2W54 A;  4Q2J A;  1LM8 B;  2LWP A;  3C19 A;  1CZP A;  1BUI C;  2K9X A;  3ZKJ C;  1KOT A;  1K51 A;  2CHZ A;  3W1S C;  1FD6 A;  2LXA A;  1N6Z A;  1VR9 A;  1MHH E;  2HTH A;  3FIL A;  4RM9 A;  2V0G A;  2L7R A;  2GOW A;  2KFK A;  3VRB B;  2RSU A;  1V86 A;  4QAY A;  1L0V B;  2YEP F;  3HM3 A;  4LNO A;  1J7C A;  4W9H A;  3Q69 A;  3NVW A;  4C7Y A;  1IPG A;  2AL6 A;  2C5L C;  4ZOH C;  4BOZ B;  3Q8A A;  4FJY A;  2K5P A;  2HJ1 A;  2J42 A;  3VTW A;  1D6E C;  1VZ6 A;  2LEK A;  2C9W B;  2WXF A;  5CHV C;  4K7W A;  4YTN B;  3UIP B;  3AE7 B;  3N1Z C;  4US8 A;  4GB9 A;  1N5X A;  3L16 A;  1WFY A;  3NZU A;  1MVK A;  4DDI D;  2K8C A;  1SF0 A;  3SFE B;  3QC8 B;  4GDL B;  2WXM A;  2FCM A;  2GBN A;  5IOI A;  3AXC A;  3ZTC A;  2HJ8 A;  2IY1 B;  1KH0 A;  1OQQ A;  3QHT A;  4IKG A;  3UGB B;  4XDD A;  1LXD A;  1Z2M A;  4W9C A;  4X57 B;  4XGA B;  5J17 A;  1EF5 A;  4DBG A;  2BYV E;  1ENF A;  3J9C A;  2W9N A;  3BII D;  4XE0 A;  4K7S A;  1NYQ A;  1N60 A;  4GXB A;  2PMV A;  3L10 B;  1WGH A;  2WHI A;  5CHF A;  3DVN U;  3AMZ A;  3FKY A;  2KMM A;  3H8H A;  1P7E A;  1SE9 A;  4HRS A;  4DXG A;  2XK5 A;  3DHI C;  5IAA C;  3NS1 A;  1UGM A;  2AQ3 B;  4LNF A;  3R7Q A;  1SB3 C;  1YQ4 B;  4J6I A;  4PS3 A;  1JRO A;  2MSE D;  2AQ1 B;  1LO5 D;  2WGS A;  2IJ0 A;  2WXK A;  1WMH B;  2DAF A;  3AV8 A;  2N7D A;  2VRR B;  4FN2 A;  2J53 A;  1K8R B;  2Y3A A;  4A6Q A;  1RM6 C;  1ZPS A;  2ONQ A;  4P16 A;  2GMI C;  3P63 A;  2UYZ B;  4MEM A;  1OGW A;  1WF9 A;  1TY2 A;  1KTK A;  3KYD D;  3GS2 A;  5FR3 A;  3JSV A;  1R7S A;  4XC2 A;  4MGY E;  2LGY A;  5D6J B;  1YN3 A;  3GE8 C;  3AUL A;  2CS4 A;  1TZO A;  3TMP B;  2ZVN A;  2M0A A;  1F2R C;  4WJO A;  1MHX A;  4DHJ B;  3DVN V;  2GBK A;  3IBE A;  4II2 B;  2M17 A;  3NZ3 A;  4BFR A;  5IKC M;  4M8N A;  4ITK A;  1IGC A;  1R4N I;  3ZJV A;  2JXT A;  3UI3 A;  1C1Y B;  2KJ6 A;  3CIR B;  1HEZ E;  4MM3 B;  2GB1 A;  3BVM A;  2Y5P A;  2FBW B;  4G11 A;  3Q8C A;  3V62 A;  4HKZ E;  1GC6 A;  5C1Z A;  4HCP B;  3EHV A;  5L83 A;  4GLS C;  1WI0 A;  1EWC A;  2JZ3 B;  5E6P A;  4E71 A;  4A9A A;  4DXA B;  3SFD B;  4WUR A;  2NBW B;  5LNK 1;  4KDL B;  3EA6 A;  3DWG C;  3WAP A;  2KT7 A;  3P1M A;  1GG3 A;  1SE3 A;  1KLU D;  3V60 A;  5HG2 A;  5DPR A;  2HD5 B;  4II3 B;  1NI3 A;  3T9L A;  1GPX A;  2I1J A;  4S0R A;  2K8B A;  4AS1 A;  1YNT E;  2D3G A;  2WXG A;  1OEY J;  4LNK A;  2LI5 A;  1YX5 B;  4HJG E;  1UNS A;  1TS4 A;  2IYD B;  1P0R A;  1PDX A;  2N9L A;  4DWF A;  2MJD A;  4HWI B;  3GE3 C;  1SJE D;  3KLS X;  2WX0 A;  2DWQ A;  1BT0 A;  2OOB B;  4PYU A;  2QMT A;  4XWT A;  3CF6 E;  1PGX A;  2WDV B;  3OG5 A;  3OJ3 A;  4B95 A;  2DYO A;  1J7A A;  3IXS A;  4LNI A;  4LDT B;  1MI0 A;  5D2M B;  3URY A;  2N9X A;  2K8H A;  1GC7 A;  2KJR A;  3R7R A;  2V9H A;  4WWP A;  2QHO A;  2JY6 A;  1UZX B;  3AH7 A;  4IOI E;  3AU5 A;  2RDH A;  2KDM A;  3VUX A;  2LD9 A;  1FXI A;  3P4P B;  4NY0 A;  4TQ0 A;  1WIA A;  4FUL A;  3NVY A;  3AU4 A;  4OHJ A;  3IT4 B;  2V4I B;  1F2R I;  3DWM A;  4I6L B;  2AL3 A;  1JAL A;  4TKN A;  4ANX A;  3ZGZ A;  2IDY A;  4PS7 A;  4W9G A;  1YMH E;  2JXX A;  4OZA A;  4C56 C;  4K3C A;  1YIW A;  2X38 A;  3UQB A;  1AWD A;  5E6O A;  1V6E A;  5BMG A;  2LGD A;  2MP2 B;  4TV3 A;  3FC4 A;  4G50 A;  1A70 A;  5C2T B;  5AEK B;  1FCC C;  4IWO A;  4HRO A;  1G6J A;  1MFW A;  2EEL A;  2YEP B;  4LCD E;  2L32 A;  4MDK E;  4C80 A;  4M0W B;  5BYR A;  1FIQ A;  3NZS A;  4W9F A;  4YWG G;  2N9P C;  1UF0 A;  1MJD A;  2MBO A;  2GBJ A;  5E6J A;  5DCN A;  3IVF A;  4EZL A;  2M0X A;  1YN5 A;  1XF5 L;  2QC8 A;  1JRP A;  1ET9 A;  1KLG D;  2IGH A;  5JHB A;  3N9Y C;  1S1Q B;  2ZCC A;  3BIN A;  2KZR A;  3ZRF A;  1LQB A;  3RD2 A;  2CJN A;  3ZNG C;  4G0N B;  1FXT B;  2LHE A;  4YSX B;  2Z59 B;  4KVG B;  1Y8R C;  5IA7 A;  1I7H A;  2LUE A;  1XXG A;  2K39 A;  4ICV A;  3CSF A;  1WR1 A;  4MAC A;  3ZJT A;  1WM2 A;  2V3S A;  3ZXV A;  2KDB A;  1V1P A;  2MJ3 A;  5D3I B;  3M63 B;  2DBY A;  1I4X A;  1HE8 A;  4F8C B;  3WCQ A;  4LLG M;  2GBM A;  4N9F 4;  3D32 A;  4FJZ A;  4JIO U;  2HTM E;  3KVF B;  2BS3 B;  2WXP A;  1ZW7 A;  3DBR I;  1RFK A;  1V5T A;  4ZRK A;  3MJ5 A;  1E0Z A;  2BW2 A;  1R4M I;  4ANV A;  1ZOY B;  4OVV A;  1GUA B;  4RGM A;  1XCQ L;  1AAR A;  1L4D B;  1VJK A;  2QEJ C;  2QCZ A;  2C60 A;  3PLU A;  2O2V A;  2YLM A;  3LJ3 A;  3VH3 B;  4LJO B;  3R66 C;  1H8C A;  1T0R C;  1SEB D;  1C9F A;  2MHJ A;  2BT6 A;  3R8B A;  1Q1O A;  5EE9 A;  1V9J A;  2DYM A;  4KDI C;  4NJ6 A;  2FIF A;  4OVZ A;  2LVO A;  2KMC A;  3RNA C;  1EUV B;  1Q5W B;  2KAN A;  2IND C;  2QIL A;  4TQ1 A;  5EDS A;  5JHA A;  4PT5 A;  4ZYS A;  3JVZ X;  4XYC A;  2WS3 B;  2KX0 A;  2KVR A;  4DXF A;  3P4R B;  1RWS A;  3QIJ A;  1YQ3 B;  4M8M A;  4WIP A;  1WJ4 A;  2DHZ A;  3A4S C;  2G1E A;  4AWJ A;  2RDG A;  3WAO A;  4ICU A;  3AE5 B;  2W55 A;  3VR8 B;  1SIF A;  2KWD A;  3RNF C;  2JF5 A;  3L13 A;  2PW9 A;  4MJS A;  3PVL A;  3DCG A;  2WXJ A;  5KHO A;  3JYU A;  1AN8 A;  2W3S A;  1HTO A;  5G5G A;  1RFA A;  2IY0 B;  2FE8 A;  4OZC A;  1OQR A;  3U7D A;  3GZN B;  2ZW0 A;  2CU1 A;  1E7P B;  1STE A;  4M02 A;  2K1F A;  2BS4 B;  1UBQ A;  3KWL A;  1TKG A;  3HVD A;  1T0Q C;  4EEW A;  2BTE A;  3AEB B;  2JWZ A;  1E9M A;  1N62 A;  4NAW B;  2V3P A;  2WLB A;  1NBF C;  4OVU A;  5D3D A;  2OHF A;  3PRZ A;  3A4R A;  3VHT C;  4NNJ B;  5CHW A;  1ACC A;  4E3C A;  1NDD A;  1E8Z A;  2WXL A;  1MG8 A;  3U8Z A;  3VFK A;  1E6E B;  4A90 A;  4MT5 A;  5G5H A;  4ZYN A;  4M00 A;  2KWC A;  4ARC A;  3VR9 B;  3AE4 B;  3MHZ A;  2G4D B;  3W5V B;  4P7I A;  1LFD A;  3DVG X;  4PYZ A;  4KZC A;  3BZD B;  4EKU A;  3W1Y A;  4IWP A;  1FFU A;  1WXV A;  2KMA A;  2J7Q B;  3RUL A;  1OQY A;  3JW0 X;  1T6B X;  4ANW A;  1ZUD 2;  3BVZ A;  2KTF A;  1J7B A;  2MBB B;  1RLF A;  3BYT B;  1K50 A;  2JZZ A;  2DEN B;  2N0S B;  4MGK E;  1P7F A;  1D5M C;  3ML8 A;  2WP9 B;  3N3K B;  1EF1 A;  1WJN A;  1NYR A;  1V80 A;  2JRH A;  4DHJ D;  2KDF B;  3VAW A;  5G55 A;  4HKQ A;  1FNW A;  1T3Q A;  1XT9 B;  4DDG D;  2QJL A;  3AI5 A;  1SXT A;  4JL9 A;  2AQ2 B;  3LB8 C;  1UEL A;  2HE7 A;  2BKF A;  2CR5 A;  3NS8 A;  2C7M B;  1C79 A;  3W2D A;  4K1R B;  4IC7 B;  3M62 B;  1WY8 A;  1ESF A;  4B9K A;  3U30 A;  2NS5 A;  2MEK A;  3OJ4 B;  3B2F A;  2J4X A;  2EKI A;  2M19 A;  2K3U A;  2DZI A;  1HZ5 A;  1PGB A;  2AWT A;  4BZA A;  2DNF A;  3A9K B;  4B0E A;  2KHW B;  2CHW A;  2K6Q A;  4FAD A;  4BAX A;  3TCA A;  5GXG B;  1V5O A;  2O6V A;  2PTL A;  2KQ7 A;  3VUW A;  2LMC A;  3HVZ A;  2G45 B;  2RGF A;  3KWV A;  2NPT B;  3RZF A;  2PIA A;  2NTT A;  3A33 B;  2MH7 A;  1E7V A;  2ZNV B;  3L54 A;  1P3Q U;  4BBN F;  3ZO5 B;  3BWU D;  4LDT D;  1ZP0 B;  3BK1 A;  3A9J A;  4KGS A;  3Q2A C;  4HDQ A;  4DK5 A;  3BY4 B;  1EO6 A;  1YJ1 A;  3UQA A;  4DHZ E;  4IG7 B;  2KNB A;  1JWU D;  2INC C;  5H8Y E;  1KFY B;  2JX5 A;  2E6X A;  2GLS A;  3NUH B;  4MGZ E;  3SDL C;  2BYF A;  2INN E;  2GRI A;  3RI7 C;  2L00 B;  1JWB D;  4GSW A;  1L0X B;  1ZGU B;  2XBB C;  2XN9 C;  3ZJU A;  3AB5 A;  3C0R B;  1QZE A;  2MQJ A;  4C4V B;  2HDE A;  2FID A;  1C78 A;  4RF0 A;  4NJC A;  3N20 C;  1SIJ A;  2JVC A;  3AEG B;  1EU3 A;  1SE4 A;  2MWS B;  3APF A;  2VH1 A;  3PZ8 A;  1Q10 A;  1VDV A;  4A20 A;  2V3N A;  4EZK A;  4W9D A;  2CKH B;  4HK2 A;  5LXH A;  2L76 A;  2B3A A;  1RYJ A;  4W9J A;  4RGT A;  3AE1 B;  3DPD A;  4MSQ B;  3EC8 A;  4BKS A;  1VZ7 A;  3QJZ A;  1WGR A;  2RPV A;  2ZPN A;  2W3R A;  4AUQ C;  3AN1 A;  3AEA B;  3MTN B;  2WU5 B;  2X8X X;  4GDK B;  4ANU A;  2BGF A;  2D3B A;  2BWF A;  5BMI A;  3A1Q A;  1GNU A;  3TJP A;  1C76 A;  3ZXR A;  1XLP A;  2KTR B;  4JLC A;  1J8C A;  3ECI A;  3VRA B;  3HM6 X;  2CU3 A;  2LVP A;  4P1B C;  5GMV A;  3SR6 A;  1WXS A;  2GI9 A;  4FLH A;  2EMT A;  3IG3 A;  4RFB A;  2L52 A;  3K9P B;  4XZ4 A;  1V8C A;  1IBX A;  2KDI A;  3RNG C;  1E5W A;  2K0P A;  3N30 A;  3M3J A;  3B08 A;  1TS3 A;  3DBH I;  2J52 A;  5IP4 D;  3PZD A;  1NEN B;  2FCN A;  3WIM A;  1U4A A;  1TIF A;  3H7P A;  3B0A A;  4J3O D;  2D07 B;  3QWZ B;  2NBU A;  5JH5 C;  2L0F A;  1QOA A;  2LZ6 A;  3R2T A;  1D4B A;  1TKE A;  2WYQ A;  4RNA A;  4BBN C;  4YTM B;  4RH6 A;  1R4N B;  1M94 A;  3OLM D;  3PS6 A;  4W9L A;  1KJT A;  5BMH A;  1WXM A;  1B9R A;  1TT5 B;  1UWM A;  1WRD B;  3APC A;  3V6C B;  4GGQ A;  2WXH A;  2KN4 A;  2NTS A;  4WJQ A;  2V4L A;  4RGO S;  3KYC D;  2WXQ A;  4FHJ A;  3KH0 A;  1ZXH A;  1J0G A;  4MSM B;  1KM7 A;  4KIK B;  2BB6 A;  2D10 A;  3VTV A;  1WYW B;  3SHQ A;  2B76 B;  4N58 A;  2LRW A;  3P2B A;  1HA5 A;  1IYF A;  2N9E B;  2UU7 A;  2JPH A;  3TUO A;  4DQO C;  2WX1 A;  2PJH A;  2L8J A;  3B9J A;  2NR2 A;  1L6U A;  2D3C A;  3DVG Y;  4IM2 A;  1Y56 A;  3FIL B;  2N7E A;  2KFK B;  3Q3M C;  1SBB B;  2MJE A;  3K9O B;  2G3Q B;  2IO3 B;  2BKR B;  1HQR D;  2DZJ A;  1JWS D;  1JCK B;  2KKC A;  3NG0 A;  3Q8E A;  1YQB A;  1I4R A;  2ZVO A;  3PO0 A;  4UDU C;  2YVC A;  2WXI A;  3NVV A;  2N1V A;  3OAW A;  5IO9 A;  1Z5S B;  1LGR A;  3QCA A;  3EFC A;  1QLB B;  4IUM B;  4D2K A;  2TSS A;  1I4P A;  2I2Y A;  1E90 A;  3VH4 B;  3IT6 B;  1WGK A;  1YX6 B;  2R2Q A;  2Z0D B;  1A5R A;  2OED A;  2REX A;  4IM0 A;  2FUG 1;  4MEL A;  2BYT A;  2NCN A;  3ZLZ A;  3R2I A;  5FKA C;  2QSD A;  1FRR A;  2CJO A;  4FJV B;  5BO4 B;  3LYY A;  3T3O A;  3A9J B;  3KUC B;  5C23 A;  2LGI A;  4KGR A;  4MH8 A;  2XNA C;  1WXQ A;  1EU4 A;  2N7J A;  2PKO A;  3N1X C;  1WX8 A;  3DQV A;  1QOB A;  2XK5 B;  4MGI E;  1XCT L;  4NAM A;  1F0Z A;  4ZRP A;  4E74 A;  1BXT A;  1TS2 A;  4GDL A;  4TSS A;  2D3A A;  4HVB A;  1SE2 A;  3ZIM A;  1H4R A;  3PGE A;  3U4E G;  1L7Y A;  2LRU A;  2MBQ A;  2LJI A;  1UBI A;  3OWE B;  1TYG B;  2ZW1 A;  2IO1 B;  1V49 A;  1UGJ A;  3O65 B;  1ISN A;  4IW0 A;  3X23 A;  3QA8 A;  3ZUN A;  1TBE A;  4HPM B;  1CMX B;  5G2N A;  2G4S A;  2LGS A;  1SGH A;  3U52 E;  1E8Y A;  2DZK A;  1P9D U;  4B6W A;  1XD3 B;  3JSV B;  2J0K A;  3AE6 B;  3UF8 A;  4XX5 A;  1DGJ A;  3RFZ B;  2PVO D;  1PGA A;  2KOX A;  3S2A A;  2FNJ B;  5DPW A;  1QF6 A;  2BS2 B;  4BVU C;  1GB1 A;  4GOC A;  4N59 A;  3RPF C;  4O1N A;  3DBR B;  3Q6B A;  1R4M B;  5TSS A;  5BYQ A;  1OEY A;  4GIV A;  3FAH A;  4CO7 A;  1WMH A;  4IM3 A;  1OFF A;  2ZZP B;  3DBL I;  2M4N A;  3PV1 A;  1QIL A;  2RDB C;  3B1L X;  1DOI A;  1VLB A;  3LDZ E;  3PHW B;  2IZV B;  4DHZ B;  2K22 A;  1MPE A;  2WQY B;  3WAL A;  2RPQ A;  5TR5 A;  4NZL B;  2IO0 B;  1RRB A;  3GB1 A;  1FNV A;  1QOF A;  2BPS A;  1AW7 A;  1VZ8 A;  1T0Y A;  1GJZ A;  2KX3 A;  3AE8 B;  3WA0 A;  4P6V F;  1QT9 A;  1YJJ A;  3Q3J A;  3ZW3 A;  2MA9 B;  2R61 A;  2BQQ A;  4K3B A;  1TJE A;  4WWO A;  2OJW A;  5JXV A;  5EE1 A;  4RF1 A;  3W5U B;  3NJT A;  1E8X A;  2MLB A;  4EUT A;  4HLE A;  4MM3 A;  3V61 A;  1PYW D;  3RYT A;  1NI2 A;  2ON8 A;  4HPP A;  4L23 A;  5D94 A;  1L2N A;  3WAN A;  1WX7 A;  1PFD A;  2GBR A;  4AQ7 A;  3TEX A;  4AJW A;  1I35 A;  2JRI B;  4YSY B;  4HEA 1;  2PPH A;  3TIX A;  1WWT A;  1AYF A;  3M95 A;  1WRI A;  5J18 A;  1EWY C;  2KLC A;  4WWM A;  2C7H A;  3RZW C;  1XO3 A;  5CTR C;  3KUD B;  4JWU C;  2IGD A;  4WAA A;  5BYS A;  3HRD D;  2FCQ A;  4LTU A;  4BKT A;  2H89 B;  5IN7 A;  4MH0 E;  3ETR A;  4ZHP A;  1UWX A;  1VD2 A;  2WU2 B;  2FAZ A;  3ZYY X;  2KVZ A;  4CQN A;  1S3S G;  4TMA B;  4HJK A;  3H7S A;  3H1U A;  4PS8 A;  1DOY A;  2RD0 A;  4ZRQ A;  1ZKH A;  4EOY A;  1M4V A;  1ZE3 D;  3NY5 A;  3EGR A;  3IAM 1;  3CWI A;  2KK8 A;  3RN9 C;  3VVW B;  4A3O A;  2I38 A;  4WJP A;  4ARI A;  4GN1 A;  1C4C A;  1GAQ B;  4CYE A;  2KLG A;  1WR6 E;  2AX5 A;  1TZ1 A;  1PUT A;  4NJ7 A;  1E10 A;  2KAC A;  2N9K A;  3PPA A;  3Q3N C;  2EKE C;  3Q14 C;  3ZNI D;  4OZB A;  3ZNH B;  1WGG A;  4WQO B;  3U7Z A;  1JWA D;  2MP2 A;  3O13 A;  4ZDV A;  3MC0 B;  2BVC A;  3P4S B;  1TY0 A;  1V81 A;  2LXC A;  3ONS A;  3TEY A;  3Q8B A;  1F1H A;  3L08 A;  3HUI A;  4LJP B;  2N1W A;  4M0W A;  5J2R A;  2J0J A;  1YOV B;  1UH6 A;  4AJY B;  3VXW A;  3I9V 1;  2WNM A;  1V1P B;  5AZG A;  1FO4 A;  5C3J B;  3UIN B;  2KFJ A;  3RNE C;  2MBH A;  4FXC A;  1CQV A;  2JWU A;  5LLI A;  4RGN A;  1NVI D;  2D2Q A;  1Q0W B;  3AM9 A;  4GMV A;  3VQI A;  4NPN A;  5FR6 A;  1C77 A;  2BF8 B;  4RCO A;  2JYT A;  1OTR B;  2JU6 X;  3HIZ A;  2VZK B;  2RMM A;  1WZ0 A;  3V05 A;  1T5X D;  3AED B;  1WE6 A;  1WH3 A;  2LUM A;  2WDT B;  1WZ3 A;  4EE2 A;  4XWW A;  2JZP A;  2V1Y A;  1P98 A;  4LK0 M;  1QOG A;  3Q3F A;  3PRE A;  2O2V B;  3RMK C;  4BOS C;  2DX5 B;  3Q8F A;  5HI1 A;  2C7N B;  2D11 A;  3RNB C;  3AEC B;  1F77 A;  2VH2 A;  4IDI A;  1XLO A;  1JML A;  3CMM B;  2BWE S;  3DHG C;  2NMQ A;  5EE3 A;  1K53 A;  1J19 A;  2LFI A;  1QKZ A;  5HKH A;  2K6D B;  4NQL B;  4W9E A;  5KHQ A;  2BYE A;  2ZCB A;  4K7U A;  4N6E B;  1NEK B;  2WWZ A;  2JYE A;  5HFY A;  5LXI B;  3C8Y A;  4PK1 A;  1UUP A;  4RMA A;  4REZ A;  3U2S C;  2H88 B;  1SSN A;  5AUK A;  5H92 C;  2ASQ A;  1WGY A;  3IAS 1;  3RCZ A;  2SAK A;  2PEA A;  2CHX A;  2KWU B;  4MJS B;  1F9J A;  1JW9 D;  4W9K A;  2O6V D;  1FPY A;  4B0M A;  3L0W B;  3E56 A;  1FFV A;  1WE7 A;  2M8S A;  3ZQ4 A;  1L4Z B;  1KRH A;  2WXO A;  1V97 A;  1YN4 A;  1P1A A;  1FEH A;  2DLB A;  3DOW A;  4WJN A;  1YJI A;  5I4D A;  3MC8 A;  1RAX A;  1KF6 B;  5AZF A;  5D7G A;  2ICI A;  3HK0 A;  2OJR A;  1V1O A;  2AYO B;  2JT4 B;  2KAJ A;  2WXN A;  3I63 C;  3I3T B;  3DBS A;  1PQS A;  3IHP C;  3BK2 A;  1SJH D;  2KDE B;  1FCL A;  3AE3 B;  2PVG C;  4YSZ B;  1DOX A;  4JE3 B;  2ZJD A;  3DBH B;  3AEE B;  3I57 A;  1WJ6 A;  3P42 A;  3NRZ A;  2LHD A;  1TS5 A;  2INP E;  2DZM A;  4LNN A;  4K81 A;  4I6P A;  1FMA D;  3KQ4 A;  4WH4 A;  4BKS D;  1F52 A;  3AE2 B;  2NVU I;  4TUU A;  3I5J C;  2XEW A;  4NAW A;  5AUI A;  4A3P A;  3APD A;  3V6E B;  2Z8L A;  3AE9 B;  2KJH B;  1D5Z C;  2A5U A;  1HXY D;  5L95 C;  1WJU A;  4WAF A;  3KW5 B;  3T8M A;  1VCB A;  3SD5 A;  1JQ4 A;  4XDC A;  5CX3 A;  3EEC A;  1E7U A;  1B1Z A;  2PE6 B;  3QK0 A;  3ZNZ B;  1I4G A;  3RUI B;  4RM8 A;  2KQS A;  1TKY A;  2W82 A;  1DYQ A;  2I1K A;  1XQQ A;  3VDZ A;  4NQK E;  4ZRJ A;  5T8I A;  1KLV A;  5DPT A;  4C7Z A;  1MG4 A;  4KKI A;  2WDR B;  2ZPY A;  4ASW C;  2LJ5 A;  3N1Y C;  4P1C C;  2Y5B B;  1TTN A;  4FA6 A;  4KV2 A;  4USA A;  2E3T A;  3CST A;  4FHK A;  1N5W A;  1WX9 A;  4URK A;  5E6N A;  1T0S C;  1WXA A;  2KYW A;  2O6V B;  3L4P A;  3MC9 A;  3TEW A;  2KC2 A;  2BBC A;  4ACF A;  3PSE B;  1E8W A;  3Q3O C;  1C4P A;  2JUO A;  3DHH C;  1GB4 A;  4CHK A;  5HHD G;  3PTF C;  2WDQ B;  4FBJ B;  3E9S A;  4W9I A;  3ZVV A;  3GOE A;  1XEE A;  2KXJ A;  2IGG A;  1ROE A;  3QQ8 B;  4KSK C;  1UD7 A;  5DPS A;  4IWQ A;  3GP7 A;  1L0Y B;  4AP4 C;  3TL5 A;  3VTU A;  4L1B A;  1YD8 U;  2D5G A;  3SEB A;  1I4Q A;  3V3X A;  2NBV B;  4F1S A;  4YT0 B;  4JGH B;  3ABV B;  3A9K A;  2QDF A;  4G3X B;  2PE9 A;  5AZH A;  2KN5 A;  1XLN A;  1IUE A;  3TSS A;  3R3M A;  4HCN B;  2BB5 A;  2G9H D;  2LAS A;  2SEB D;  4KZ0 A;  2L3Z A;  2KQ4 X;  3LXF A;  2FCS A;  2DAJ A;  2Z0E B;  3B2G A;  2WXR A;  4JPS A;  2NPT A;  4YTP B;  4C00 A;  2N4F A;  2L05 A;  3PHX B;  4ZHO A;  3VUY A;  1FNU A;  3NVZ A;  1TGZ B;  3NOB A;  3ZDM C;  5FK9 C;  4HPL B;  1BML C;  3HHM A;  4GU2 A;  2IO2 B;  1GOZ A;  1XLQ A;  5EE0 A;  1N61 A;  3KUZ A;  3X0W A;  3ZDT A;  3A1Q B;  4YXD B;  3MP9 A;  4KSL C;  3QAQ A;  3MJW A;  1C3T A;  1HTQ A;  1WSP A;  4I6N B;  4KGT A;  4C4V A;  3TEZ A;  1N63 A;  2KWV B;  2RR9 A;  1IP9 A;  4L2Y A;  2M1M A;  3PT2 B;  1IBX B; 
#chains in the Genus database with same CATH homology
 4JWS C;  2AX5 A;  1FCC C;  3W9C B;  1WYG A;  4HRO A;  1PUT A;  1D5X C;  2EEL A;  2YEP B;  1E10 A;  2KAC A;  1C76 A;  2L32 A;  2N9K A;  1XLP A;  4C80 A;  5BYR A;  1FIQ A;  4YWG G;  4US9 A;  3VRA B;  4OZB A;  4KKJ A;  2CU3 A;  1ZDV A;  3SR6 A;  4H2A A;  3U7Z A;  1JWA D;  2GI9 A;  3O13 A;  3W1S A;  5E6J A;  3MC0 B;  4RFB A;  2L52 A;  3T3N A;  1K52 A;  3P4S B;  1V8C A;  1YN5 A;  1IBX A;  1VRA B;  1TY0 A;  2K0P A;  1XF5 L;  1TS3 A;  1JRP A;  1ET9 A;  3TEY A;  1KLG D;  2IGH A;  3N9Y C;  1FM0 D;  2J52 A;  1ET6 A;  1ZXI A;  3Q8B A;  1NEN B;  3HUI A;  4OW0 A;  1IGD A;  4M0W A;  2Y5C A;  1QQR A;  3I9V 1;  4J3O D;  2CJN A;  2LHE A;  4YSX B;  2WNM A;  1V1P B;  1FO4 A;  5C3J B;  1QOA A;  1CQV A;  2JWU A;  2QIE B;  3MFG A;  3R2T A;  4FXC A;  4RGN A;  1NVI D;  2VZK D;  4A8X C;  1I7H A;  4A55 A;  1D4B A;  1TKE A;  3AM9 A;  1XXG A;  4RNA A;  3VQI A;  4YTM B;  4RH6 A;  1JWM D;  2PLP A;  5BMH A;  1FRD A;  4KX6 B;  1B9R A;  1UWM A;  2JQR B;  1C77 A;  2L83 A;  4MAC A;  1CJE A;  2ACZ B;  3P4Q B;  4RCO A;  3ZJT A;  2WXH A;  2KN4 A;  2NTS A;  2JYT A;  2JSV X;  3BVG A;  4RGO S;  2JU6 X;  2WXQ A;  1HZ6 A;  2VZK B;  2RMM A;  3EUB 2;  1ZXH A;  3V05 A;  1FXA A;  1V1P A;  2MJ3 A;  1T5X D;  5D3I B;  3AED B;  2LUM A;  4EE2 A;  2DBY A;  2JZP A;  4XWW A;  2BB6 A;  4LK0 M;  1CK1 A;  1I4X A;  1QOG A;  1I4H A;  2B76 B;  4N58 A;  2L1A A;  3WCQ A;  1HA5 A;  2M56 B;  3Q8F A;  5HI1 A;  4LLG M;  3TUO A;  4DQO C;  1L5P A;  3AEC B;  1F77 A;  2HTM E;  3B9J A;  4IDI A;  2BS3 B;  2WXP A;  4R3D A;  1XLO A;  1JML A;  1RFK A;  3PZ7 A;  1L6U A;  3MJ5 A;  1E0Z A;  2BW2 A;  1L6V A;  1ZOY B;  1C4A A;  2NMQ A;  4RGM A;  5EE3 A;  1K53 A;  1XCQ L;  2LFI A;  1QKZ A;  2IPK D;  1L4D B;  1VJK A;  2QEJ C;  4JX1 C;  4WQM A;  3AEF B;  1Y56 A;  3FIL B;  2Q5W D;  1EM7 A;  1SBB B;  2MJE A;  3BYY B;  4N6E B;  1ZDX A;  2W54 A;  1NEK B;  4Q2J A;  1SEB D;  2JYE A;  5HFY A;  1CZP A;  1C9F A;  1BUI C;  2BT6 A;  2K9X A;  1HQR D;  1JWS D;  3C8Y A;  1JCK B;  1K51 A;  3R8B A;  1UUP A;  4REZ A;  1FD6 A;  5EE9 A;  2DYM A;  3U2S C;  2H88 B;  1SSN A;  3Q8E A;  4OVZ A;  1VR9 A;  5AUK A;  5H92 C;  1I4R A;  1MHH E;  3PO0 A;  3FIL A;  4UDU C;  2V0G A;  2WXI A;  3IAS 1;  2QIL A;  3NVV A;  3VRB B;  4TQ1 A;  2SAK A;  4PT5 A;  4ZYS A;  1L0V B;  2WS3 B;  2YEP F;  1JW9 D;  4DXF A;  1J7C A;  3Q69 A;  3NVW A;  4C7Y A;  3P4R B;  4B0M A;  1RWS A;  3E56 A;  1FFV A;  1YQ3 B;  4ZOH C;  4WIP A;  3ZQ4 A;  3Q8A A;  2K5P A;  2G1E A;  1QLB B;  1D6E C;  2J42 A;  1VZ6 A;  2LEK A;  2RDG A;  4D2K A;  2TSS A;  1L4Z B;  3AE5 B;  1I4P A;  2W55 A;  2I2Y A;  3VR8 B;  1KRH A;  3IT6 B;  1WGK A;  2WXO A;  2WXF A;  2KWD A;  1V97 A;  4YTN B;  2PW9 A;  1YN4 A;  1FEH A;  2DLB A;  3AE7 B;  2WXJ A;  4US8 A;  1YJI A;  5I4D A;  1N5X A;  2OED A;  1KF6 B;  5D7G A;  2ICI A;  1AN8 A;  2FUG 1;  2BYT A;  1MVK A;  1V1O A;  2W3S A;  3R2I A;  1SF0 A;  2KAJ A;  5FKA C;  5G5G A;  3SFE B;  4GDL B;  2QSD A;  2FE8 A;  1FRR A;  2WXM A;  4OZC A;  2CJO A;  2WXN A;  1OQR A;  3LYY A;  3T3O A;  3BK2 A;  1SJH D;  2ZW0 A;  2LGI A;  1E7P B;  4KGR A;  1STE A;  4MH8 A;  1KH0 A;  1FCL A;  2BS4 B;  3KWL A;  2XNA C;  1TKG A;  1WXQ A;  3AE3 B;  1EU4 A;  3HVD A;  1OQQ A;  2N7J A;  2PKO A;  4IKG A;  2BTE A;  3AEB B;  2PVG C;  4YSZ B;  1DOX A;  1E9M A;  4XDD A;  1N62 A;  4JE3 B;  4NAW B;  1QOB A;  3AEE B;  3I57 A;  2V3P A;  1XCT L;  4NAM A;  1F0Z A;  3P42 A;  2WLB A;  3NRZ A;  4ZRP A;  5D3D A;  1BXT A;  2LHD A;  1TS2 A;  2OHF A;  1TS5 A;  1ACC A;  1ENF A;  4TSS A;  2WXL A;  1SE2 A;  3J9C A;  3BII D;  4XE0 A;  3U4E G;  1NYQ A;  1N60 A;  2INP E;  2PMV A;  1E6E B;  2LJI A;  4A90 A;  1FMA D;  1TYG B;  2ZW1 A;  3KQ4 A;  3OWE B;  4MT5 A;  4WH4 A;  5G5H A;  3AMZ A;  1UGJ A;  3AE2 B;  2KMM A;  3H8H A;  1P7E A;  3VR9 B;  4ARC A;  4HRS A;  4DXG A;  3AE4 B;  5AUI A;  3MHZ A;  3NS1 A;  2AQ3 B;  2Z8L A;  3W5V B;  1SB3 C;  1YQ4 B;  3AE9 B;  3U52 E;  1D5Z C;  1HXY D;  3BZD B;  1JRO A;  4WAF A;  1FFU A;  1JQ4 A;  4XDC A;  2AQ1 B;  1LO5 D;  3AE6 B;  1T6B X;  2IJ0 A;  2WXK A;  1ZUD 2;  1B1Z A;  1DGJ A;  1J7B A;  3BVZ A;  1I4G A;  1K50 A;  2PVO D;  2N0S B;  3BYT B;  3RFZ B;  1PGA A;  1P7F A;  1D5M C;  3AV8 A;  2J53 A;  2Y3A A;  1TKY A;  4A6Q A;  2W82 A;  1RM6 C;  1ZPS A;  1DYQ A;  2ONQ A;  2WP9 B;  4P16 A;  3P63 A;  1NYR A;  1QF6 A;  1TY2 A;  2BS2 B;  1GB1 A;  4N59 A;  5T8I A;  1KTK A;  3RPF C;  4HKQ A;  1FNW A;  4O1N A;  3GS2 A;  4C7Z A;  5FR3 A;  1T3Q A;  4KKI A;  1R7S A;  2QJL A;  1SXT A;  5TSS A;  5BYQ A;  2WDR B;  3FAH A;  2AQ2 B;  1YN3 A;  3LB8 C;  1OFF A;  1TZO A;  2M0A A;  1F2R C;  1MHX A;  1QIL A;  4USA A;  2E3T A;  1DOI A;  1VLB A;  1C79 A;  3W2D A;  3NZ3 A;  1N5W A;  2K22 A;  1MPE A;  2WQY B;  4ITK A;  1ESF A;  1IGC A;  3ZJV A;  2MEK A;  3L4P A;  2JXT A;  2J4X A;  2EKI A;  3B2F A;  3UI3 A;  3TEW A;  2M19 A;  4NZL B;  2BBC A;  2K3U A;  3CIR B;  1HEZ E;  4MM3 B;  2GB1 A;  3BVM A;  1C4P A;  2FBW B;  1FNV A;  1QOF A;  2Y5P A;  3GB1 A;  1HZ5 A;  1PGB A;  1GB4 A;  5HHD G;  2WDQ B;  3Q8C A;  3E9S A;  1AW7 A;  4HKZ E;  4B0E A;  1VZ8 A;  3AE8 B;  4P6V F;  1QT9 A;  1XEE A;  1YJJ A;  4GLS C;  1EWC A;  2R61 A;  2IGG A;  4A9A A;  1TJE A;  1ROE A;  3SFD B;  5JXV A;  5GXG B;  3GP7 A;  1L0Y B;  4RF1 A;  2PTL A;  4WUR A;  5EE1 A;  3W5U B;  5LNK 1;  3EA6 A;  3DWG C;  4L1B A;  2D5G A;  2LMC A;  3P1M A;  3HVZ A;  3SEB A;  1SE3 A;  1KLU D;  1PYW D;  3KWV A;  1I4Q A;  5HG2 A;  3V3X A;  1NI3 A;  2PIA A;  4YT0 B;  1GPX A;  2ON8 A;  4L23 A;  3ABV B;  2NTT A;  2MH7 A;  4AS1 A;  1YNT E;  2WXG A;  1PFD A;  4AQ7 A;  3TEX A;  3BWU D;  1ZP0 B;  3BK1 A;  1XLN A;  2N9L A;  1UNS A;  1TS4 A;  1IUE A;  1PDX A;  4HJG E;  4KGS A;  4YSY B;  3TSS A;  4HEA 1;  2MJD A;  2BB5 A;  1SJE D;  2G9H D;  3KLS X;  1WWT A;  1AYF A;  2DWQ A;  2SEB D;  2QMT A;  4XWT A;  1WRI A;  2KQ4 X;  3B2G A;  3LXF A;  1JWU D;  1PGX A;  1EWY C;  2WDV B;  4WWM A;  5H8Y E;  1KFY B;  2JX5 A;  2E6X A;  2WXR A;  4JPS A;  1XO3 A;  3NUH B;  2DYO A;  2INN E;  1J7A A;  3IXS A;  4YTP B;  2GRI A;  1MI0 A;  4JWU C;  3URY A;  1JWB D;  2IGD A;  1L0X B;  4ZHO A;  2XN9 C;  3ZJU A;  1FNU A;  3NVZ A;  3AB5 A;  5BYS A;  3HRD D;  4LTU A;  2HDE A;  3AH7 A;  4IOI E;  2H89 B;  5FK9 C;  1BML C;  1C78 A;  4RF0 A;  3ETR A;  4NJC A;  4ZHP A;  1UWX A;  1SIJ A;  3AEG B;  2RDH A;  2KDM A;  1EU3 A;  1SE4 A;  2WU2 B;  3ZYY X;  1GOZ A;  4CQN A;  3PZ8 A;  1Q10 A;  1VDV A;  1FXI A;  4TMA B;  3P4P B;  1XLQ A;  4TQ0 A;  5EE0 A;  1N61 A;  2V3N A;  3NVY A;  1DOY A;  4OHJ A;  3IT4 B;  3MP9 A;  4YXD B;  2V4I B;  1F2R I;  3DWM A;  4ZRQ A;  1RYJ A;  4RGT A;  3AE1 B;  1M4V A;  1ZE3 D;  1JAL A;  1WSP A;  3EGR A;  3IAM 1;  2IDY A;  3ZGZ A;  1YMH E;  4KGT A;  4OZA A;  1VZ7 A;  4C56 C;  2X38 A;  3TEZ A;  2RPV A;  2W3R A;  1AWD A;  1N63 A;  3CWI A;  3AN1 A;  5BMG A;  3AEA B;  3FC4 A;  2WU5 B;  1IBX B;  4GDK B;  2I38 A;  4L2Y A;  4ARI A;  1C4C A;  1GAQ B;  5MPO A;  1A70 A;  5BMI A;  5C2T B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...