1YN5A

Crystal structures of eap domains from staphylococcus aureus reveal an unexpected homology to bacterial superantigens
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
103
structure length
103
Chain Sequence
AKEMQNVPYTIAVDGIMAFNQSYLNLPKDSQLSYLDLGNKVKALLYDERGVTPEKIRNAKSAVYTITWKDGSKKEVDLKKDSYTANLFDSNSIKQIDINVKTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EapH2
publication title The Crystal Structures of EAP Domains from Staphylococcus aureus Reveal an Unexpected Homology to Bacterial Superantigens.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Unknown function
total genus 29
structure length 103
sequence length 103
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03642 MAP MAP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1yn5A00
2NTSA 2QEJC 1SEBD 3BZDB 2SEBD 2XNAC 1KLUD 2RDGA 4RGOS 1I4XA 1I4HA 1ESFA 4ZYSA 1UNSA 2AQ2B 1PYWD 4RGNA 1GOZA 1SBBB 1AW7A 1YN5A 2R61A 1SE4A 1BXTA 1AN8A 1SJED 1KTKA 1D5MC 1L0XB 5FK9C 2J4XA 4RH6A 2AQ1B 1HXYD 4RCOA 1YN4A 1EU4A 1D5ZC 1TS2A 3SEBA 1UUPA 3OWEB 3GP7A 1ET6A 1SE3A 1TS3A 5I4DA 2TSSA 1JWSD 1LO5D 1FNUA 3BYYB 3EA6A 1I4QA 3R2TA 1TY2A 1DYQA 2AQ3B 1JWMD 1TS4A 2G9HD 3R8BA 1CQVA 3R2IA 3TSSA 1EWCA 1FNVA 1M4VA 1B1ZA 2NTTA 3BVGA 2QILA 1KLGD 4RGMA 3MFGA 4C56C 4DXFA 4UDUC 1SJHD 1HA5A 2IPKD 1D6EC 4RFBA 1FNWA 1XXGA 1STEA 3BVZA 2ICIA 2XN9C 5D3DA 1I4RA 4RGTA 5D3IB 4OHJA 1SE2A 1TY0A 1D5XC 1I4PA 5FKAC 4DXGA 3O13A 1CK1A 1V1PB 4TSSA 2RDHA 3BVMA 1F77A 1V1PA 5TSSA 1TS5A 1I4GA 1T5XD 3MC0B 1V1OA 1JCKB 2IJ0A 1SXTA 4O1NA 1L0YB 2Z8LA 3URYA 1ET9A 3BYTB 1ENFA 3V05A 1YN3A 3KLSX 1HQRD 1JWUD 1QILA 4NZLB 3W2DA 1EU3A
chains in the Genus database with same CATH superfamily
2DLBA 4F7ZA 2RPQA 1E9MA 1TTNA 2XNAC 3KVFB 4YTMB 1GPXA 1TZ1A 2WQYB 2ZNVC 4RGNA 2MJEA 4G50A 2N9PC 4TV3A 2MEKA 3AEDB 1Y56A 2E3TA 1J7CA 1VZ8A 3A4SC 2M0XA 1E7UA 1OGWA 3UIPB 4C7YA 5DPRA 1JW9D 1FFVA 4OZCA 2H89B 4KX6B 1F52A 3EFCA 1T6BX 1Z2MA 4HEA1 3OJ3A 2N0SB 2DNFA 1F2RC 2WDTB 2BGFA 3VH4B 2DAFA 1V5TA 4DXFA 2GMIC 1VD2A 2PPHA 2ICIA 2KN4A 3HHMA 4MEMA 4HKQA 4C80A 2CHXA 2N1VA 5FR3A 4E71A 2ZCBA 3AMZA 4LNOA 4IM0A 2JZZA 3C0RB 4JE3B 4FJZA 1M94A 3AE5B 1QQRA 1L4ZB 3M63B 3P2BA 4MGYE 4DHZE 4KVGB 4YT0B 4HVBA 3RD2A 3EGRA 4PS3A 4WWNA 2DWQA 1TGZB 2KZRA 4US9A 2L83A 1P3QU 3A33B 4W9FA 2BB5A 1V6EA 3ZNZB 2GLSA 2D3BA 3TIXA 3A9JA 2D10A 1WR6E 2KTRB 5C1ZA 1ESFA 2CU1A 4KGRA 4C4VB 2LGIA 4DHJD 4EZKA 1LFDA 2WXOA 1SE4A 5DPSA 1MPEA 3BK2A 1WJNA 2BS4B 3ONSA 1WM2A 2M19A 4HXDA 4OVVA 4EFOA 3B9JA 3ZJTA 4JIOU 4A3PA 3VR8B 3UQBA 3HUIA 2OJRA 1WGDA 3L10B 5AZFA 3N1YC 1D4BA 1MHXA 2TSSA 2D2QA 2KTRA 1JWSD 2WXJA 3EHVA 2BKFA 3I9V1 1I4QA 1N5WA 1PFDA 1LGRA 5H92C 1DYQA 3KUDB 1L6VA 3UINB 2KWUB 1Q10A 2DYOA 2MCNB 3KWLA 4HDOA 3C8YA 5LXHA 1DOXA 4A6QA 1E7VA 3VTUA 3PRZA 2LHDA 3DBRI 2HDEA 2MBEA 4MSMB 1V86A 4A55A 2XN9C 2LWPA 4JX1C 4C7ZA 2A5UA 2WX0A 2KACA 1JWBD 1RWSA 4JPSA 3PLVA 4DXGA 2KYWA 1XO3A 2KX0A 2KLGA 1OQQA 1EWYC 1AARA 1P98A 2BYVE 2JRHA 3DBRB 1OFFA 3LJ3A 4IUMB 3ZTCA 4OW0A 5JXVA 1YQBA 4BAXA 2PMVA 3QAQA 2FUHB 2LMCA 2KDIA 1YN3A 4JWSC 2MBQA 3KLSX 3ENEA 1V49A 1F1HA 1JWUD 4KDLB 3W2DA 1HTOA 4AJWA 5D6JB 1VZ6A 1KLUD 1K52A 4DK5A 4LTUA 1MG4A 4PYUA 1BXTA 1AN8A 4MM3B 3KUZA 4GXBA 3N30A 1TJEA 2GBJA 2Z59B 1FEHA 3RPFC 1XLOA 3WALA 4GOCA 2GRIA 4AJYB 3ABVB 1WYGA 2DZMA 5IOIA 2BYTA 4LK0M 2W54A 3OWEB 4KKJA 2MH7A 3N1ZC 4TUUA 3SR6A 2JQRB 2PTLA 2KO3A 4YTPB 3ZRFA 1TY2A 2LVPA 2AQ3B 3CSTA 2LEKA 3TSSA 4JGHB 4YSZB 1HTQA 3SFEB 2YVCA 1S3SG 3MFGA 2C7HA 1WRDB 1FRDA 2IPKD 1QOFA 3BK1A 2QHOA 3TUOA 1OQYA 3N9YC 5G2NA 4XDDA 1MVKA 2RD0A 1CK1A 2JF5A 3AV8A 1V9JA 3VTWA 1QZEA 3TEZA 2XEWA 1TKGA 2I1JA 3CWIA 4LJPB 4XWWA 1P7EA 2ZPYA 2GBRA 1I35A 2WXMA 3LYYA 2MBOA 2BWFA 3H1UA 2L32A 1ENFA 3OAWA 3HVZA 1YQ3B 3N1XC 4TKNA 2KJHB 2V1YA 4C00A 5LLIA 2Z0DB 2D5GA 2L0TA 2J53A 3AU5A 3Q8FA 2DZJA 2K25A 1KFYB 2PLPA 2CS4A 5MPOA 4MACA 3LB8C 4WJOA 1SJED 3B1LX 1KTKA 1OEYA 3NUHB 2BF8B 2LUEA 5FK9C 4E74A 2MWSB 3DCGA 4IDIA 2WXQA 4HLEA 3VUWA 2RSUA 3J9CA 4EKUA 3WIMA 1T0SC 1WXAA 2IYDB 2N7DA 4GIVA 3A4RA 2N7JA 3LDZE 2KAJA 3Q6BA 1J7AA 3TEWA 1IBXB 2Y5CA 4PK1A 1FNUA 1P7FA 3EA6A 3ZQ4A 3IVFA 4K3BA 2L05A 3RUIB 1UGMA 3IAM1 3RMKC 3O65B 1CQVA 1NYRA 2BVCA 3B2GA 1NENB 2BS2B 2ZW0A 1E10A 2DYMA 5H8YE 4MDKE 1HZ6A 1BMLC 3M62B 4LDTB 1XT9B 2N9KA 2I38A 3RYTA 3ZJUA 3VR9B 1E8YA 3APDA 3P42A 4K7SA 4FA6A 5JH5C 4MGIE 1WRIA 1IBXA 3AEGB 4LNFA 4IOIE 4OHJA 1IGDA 2V3PA 4OVUA 3QCAA 1TKYA 4M0WB 1ZPSA 2OOBB 4BFRA 3SDLC 3IAS1 3Q8EA 2FIDA 1T5XD 4KZ0A 1R7SA 1WZ3A 3MC0B 5C2TB 2XK5A 4BVUC 1G6JA 1MHHE 4KV2A 2PW9A 3DHGC 1UWXA 4RF1A 2IY0B 2BS3B 2WDVB 3M95A 1GJZA 2M0AA 5J2RA 2IZVB 2LRWA 4A9AA 2RDGA 1NYQA 4PT5A 4GLSC 2K5PA 1IUEA 3ETRA 1TKEA 3DBHI 2EMTA 4J3OD 2BT6A 2NBVB 2BYEA 3RNBC 5HKHA 1WFYA 1KM7A 2MSED 3HIZA 1E8WA 1P0RA 5L83A 2CKHB 3IT4B 4NPNA 4RH6A 5AZGA 3IHPC 3N20C 1TS2A 2M4NA 1J8CA 1K51A 5HI1A 4WAAA 3H6NA 4M8NA 3WANA 3DBHB 4HKZE 4BKGA 3AE7B 4AUQC 5D94A 4K3CA 3Q8CA 3Q3OC 3BYYB 2KHWB 1T0RC 2JXXA 3H7PB 4FLHA 2DHZA 3R8BA 3W5VB 2WWZA 5LXIB 3NS8A 1XLPA 3BVGA 2QILA 1Z5SB 4JLCA 1T0YA 4EEWA 4AOFA 1C78A 2QSDA 4XGAB 4LLGM 2AL6A 2NR2A 2L00B 4RFBA 1V8CA 2QCZA 4LDTD 4LCDE 1TY0A 2KVRA 3H7PA 4MGZE 2G1EA 2FE8A 1Q5WB 5J18A 3VUYA 3AEBB 4MT5A 2BYFA 4XWTA 1N62A 3ECIA 4MH0E 4NNJB 4L1BA 1OQRA 3U7ZA 4P6VF 4URKA 1XD3B 2INDC 2KMCA 2M1MA 4PS8A 3BYTB 5BO4B 2KDFB 4EZJA 2YLMA 1KH0A 2FUG1 2L8JA 3NG0A 2LVQA 2WU2B 2KWDA 3BZDB 2AX5A 2W55A 1KF6B 3CSFA 4BOSC 1C77A 3EFUA 4USAA 3Q3JA 4M8MA 1C9FA 3FC4A 1WX8A 4JL9A 1SB3C 2KJ6A 4PYZA 1V81A 5EE1A 2BQQA 2RPVA 1C3TA 1R4NB 1YN4A 1NI3A 4HPPA 1QOBA 3SEBA 1JQ4A 3AN1A 1J0GA 4XYCA 3ALBA 2QDFA 4ZHOA 1GUAB 3MTNB 3ZTDA 2KQ7A 2MQJA 1C79A 2RGFA 1WY8A 5HHDG 3W1SC 3ZNHB 2MBHA 2JYEA 3R7RA 2RR9A 4K81A 4YXDB 5CHVC 3HVDA 3MC9A 3ZDMC 1JALA 3BVZA 2J7QB 5CHWA 3KYCD 4REZA 3ZJVA 1ACCA 4YWGG 3RNFC 2GB1A 2JT4B 4RM9A 1JWAD 1K8RB 4W9KA 2KFJA 2RDBC 3RNCC 2KWVB 2RDHA 3GE8C 1RRBA 2BBCA 2JWZA 2QC8A 2V9HA 5C3JB 4WWOA 2LXAA 3AI5A 1SXTA 3L08A 3VAWA 1L0YB 2KVZA 4ACFA 3IXSA 5GXGB 1UELA 3B2FA 1RFAA 3ZXRA 2KOXA 2DZIA 1EU3A 2NTSA 3A9JB 4OZBA 3X23A 4WJQA 3ZW3A 4RGOS 1UNSA 3AM9A 4HPLB 2MRPA 1SBBB 1YN5A 3WAMA 2L1AA 1FIQA 2L52A 2WXNA 1D5MC 1L0XB 2LVOA 1E5WA 4G3XB 1R4MI 1ZDXA 4XX5A 1N6ZA 2KC2A 1EU4A 1C4AA 2VH1A 1D3ZA 2LGXA 3AE4B 3H7SA 3GP7A 1FO4A 4W9GA 2XBBC 1LXDA 3TMPB 5I4DA 1I7HA 1LO5D 1YNTE 4ASWC 1SE9A 1XLNA 2KD0A 1R4MB 4CHKA 5KHOA 2DX5B 5FR6A 4L23A 5CTRC 3U30A 1QT9A 3V3XA 1FMAD 1GAQB 1FRRA 4ZRIA 3UI3A 3I5JC 3CF6E 1IPGA 4AP4C 4P16A 4A90A 1TZOA 1WI0A 1WR1A 1WJ6A 1FCLA 1V97A 1VJKA 3AU4A 3PVLA 1DOIA 4YL8A 3TJPA 3V6CB 2JYTA 2O6VB 3BVMA 2JWUA 1V1PA 2MLBA 2LZ6A 2HTHA 2DBYA 3E9SA 2NBUA 3Q14C 2ASQA 2C60A 3L54A 2G45B 2ON8A 3U4EG 1UGJA 3NS1A 2INCC 2OHFA 2B3AA 3K9OB 3RZWC 4ZRKA 5IN7A 1YJ1A 3S2AA 2J0JA 3ZNID 5DCNA 4DBGA 1SEBD 2O6VA 2D3AA 2JSVX 1B9RA 2BKRB 2K8HA 2IGDA 1QF6A 1WM3A 2AQ2B 2R61A 3HK0A 5E6NA 1HE8A 1P9DU 4TQ0A 5G5GA 3P4SB 3I63C 4KKIA 3W5UB 1MG8A 2IO0B 2KLCA 2INNE 4GDLA 2JVCA 3WAPA 4KGTA 2QIEB 3NZSA 4RF0A 5HFYA 2G9HD 4EE2A 3W1YA 3NJTA 3H8HA 2D11A 1KJTA 4II2B 2NTTA 2J52A 3V62A 2PVGC 3AECB 3V60A 1FXTB 3PGEA 1K50A 2ZNVB 4GDKA 3DDCB 4GB9A 1SF0A 2WU5B 2SAKA 5D3DA 1WXVA 3V61A 1I4RA 4KSKC 1PGAA 2AWTA 5D3IB 1MJDA 1F0ZA 4K7UA 3QQ8B 1D5XC 4FBJB 1F2RI 2ZEQA 2EKIA 1C76A 2ZVNA 2Y3AA 4KIKA 5TSSA 2ZVOA 4N58A 3ZXVA 5EE0A 3VH3B 2HD5B 2A4ZA 1V1OA 4AQ7A 3VTVA 1U4AA 2O6VD 1C1YB 2KDBA 2L0FA 2W82A 3MJWA 2NVUI 1QOGA 1WGHA 2PKOA 2X8XX 3JW0X 2L76A 3W1SA 5LNK1 1ROEA 3ZYYX 3AE6B 2QEJC 4WJNA 2WS3B 3ZDTA 1QLBB 2MW5A 4HJGE 4LNKA 4BBNF 3VUXA 4K7WA 2ZPNA 1E8XA 1PYWD 1IYFA 3VFKA 3T3NA 4YTNB 2CHWA 2YEPB 4B6WA 3A9KA 2LD9A 1YJIA 2CU3A 2V4IB 1YQ4B 1N5XA 5EE3A 4ANWA 3NVYA 1WJ4A 3PHWB 4H2AA 4II3B 3GS2A 1WE7A 2N9LA 2V3SA 1WXQA 3QX1A 4KSLC 2WXFA 1Y8RC 5BMIA 2WXLA 1E6EB 2GBKA 2MJ3A 3PZDA 4ZRQA 1WYWB 3QWZB 1J7BA 4C56C 1N60A 2R2QA 3RFZB 2G4SA 2IDYA 1SJHD 3GE3C 2CJNA 1WGGA 3KUCB 4F8CB 3VHTC 2IY1B 3RCZA 4I6LB 5FKAC 4BOZB 4RNAA 3Q3NC 4WURA 2XK5B 2CR5A 1JCKB 3E56A 4AS1A 2PE9A 3SD5A 2K0PA 1SIJA 4P7IA 1LQBA 2VRRB 1DOYA 1C4PA 4ICVA 3RNAC 1HEZE 3SU8X 3PO0A 1UD7A 1E90A 4B0EA 3PV1A 4JQWC 2JPHA 3U2SC 3TCAA 4B95A 3P4RB 1PUTA 4ANUA 4GGQA 1T3QA 3FILB 1GB1A 2I2YA 3VXWA 1GC6A 1HXYD 2BWES 1L7YA 4A20A 5T8IA 2NMQA 5EDSA 4NJCA 2C9WB 4ANXA 1E7PB 1SE3A 2VZKB 2V4LA 2FIFA 2WXIA 3FILA 2LHEA 1JRUA 1L5PA 3ZGZA 1M4VA 2EMSA 1RFKA 3N32A 4EUTA 4G0NB 1A5RA 1HZ5A 3WAOA 1P1AA 4OZAA 2OJWA 4FJYA 3PT2B 2K9XA 2N4FA 1ZGUB 5AUKA 3UQAA 2DENB 3APCA 4J6IA 1BT0A 1I4PA 4IWOA 4W9JA 4PS7A 4XE0A 2NS5A 2WP9B 4IWQA 1UBIA 2V3NA 4IG7B 1UF0A 4MSQB 1XF5L 1FCCC 1V2YA 3L0WB 1A70A 2Q5WD 4QAYA 3DPDA 1IP9A 1YIWA 3PHXB 3JVZX 4YSYB 2WXGA 2AEHA 4O1NA 4XDCA 3V05A 1WZ0A 3X0WA 2KQSA 1WWTA 1YJJA 2WXRA 1NEKB 2QJLA 3RI7C 1VZ7A 2V0GA 2KWCA 5BYRA 2WX1A 3LXFA 3QARA 2JRIB 1VRAB 1Q1OA 2EELA 4CYEA 2BW2A 2WGSA 2BPSA 3OJ4B 3VDZA 4NAMA 1WF9A 4RCOA 3AXCA 3PSEB 4CQNA 3N3KB 2ZZPB 3VVWB 1R4NI 3P4PB 3MP9A 2C5LC 2NPTA 1TS3A 1EF1A 3NZUA 1XLQA 4X57B 4NJ6A 1BUIC 2KC1A 4NY0A 4FJVB 3MHSD 3RN9C 1JWMD 2GBNA 2JZPA 1RM6C 2LGSA 4NQKE 3SHQA 5D2MB 2OEDA 4B9KA 2VZKD 1E0ZA 1SIFA 3ZKJC 3IBEA 4KDIC 4D2KA 2PE6B 3RULA 3EUB2 3TEYA 4S0RA 4W9LA 1D6EC 1IGCA 4BKTA 3UIOB 2ONQA 1YD8U 1V80A 3AEEB 1XCQL 4BBNC 4W9CA 1VDVA 2G3QB 4GN1A 5DPWA 2PVOD 3VQIA 1L2NA 2GOWA 4DQOC 2JU6X 1N61A 2KK8A 3PS6A 2LRUA 3ZUNA 2IJ0A 3DHHC 3ZO5B 4KGSA 4OVZA 2KDMA 4CO7A 1WMHB 4K1RB 3A1QA 1FPYA 1PQSA 1PGXA 3BINA 2KQ4X 1MFWA 1EM7A 3B08A 3CIRB 5CHFA 2INPE 1VR9A 2WXPA 2CHZA 1GB4A 1GOZA 2MP2B 1AW7A 2IGGA 2LGDA 2LJ5A 1UZXB 2UWQA 1EF5A 5E6PA 2LFIA 3KH0A 3U8ZA 1WMHA 4JWUC 3NHEB 1OEYJ 4HCPB 3ML9A 1YOVB 4HPMB 3RNEC 1KLVA 4MJSB 3DVNU 5C23A 4NAWB 4DWFA 1ET6A 3QK0A 2MP2A 3R2TA 5D7GA 4E3CA 1YX5B 1AWDA 3DBLI 3NVVA 4ICUA 5JHBA 3EECA 3M3JA 2WNMA 1RLFA 2K8BA 1ZUD2 3DOWA 3AE2B 3JSVB 3AB5A 1K53A 4MJSA 4G11A 4NAWA 1STEA 2KDEB 2G4DB 3CMMB 3DBLB 4XC2A 3OLMD 1SGHA 1RYJA 4N6EB 4NQLB 4BKSA 3T8MA 1VCBA 4HWIB 3TEXA 4HRSA 1V1PB 2IO3B 2MX2A 3AE1B 3UGBB 1FM0D 2N9XA 2PJHA 2K8CA 3VRBB 3L16A 1S1QB 3JSVA 2KXJA 2N9EB 2IBIB 1ZOYB 4LJOB 2Z8LA 3QA8A 3NRZA 1E8ZA 4FN2A 2IGHA 3QIJA 1CJEA 4HCNB 1HQRD 1YMHE 2JX5A 5JHAA 4NJ7A 2FBWB 1ZKHA 3L17A 3HM6X 3NVWA 2HJ1A 1I4XA 1I4HA 3R3MA 2WXHA 4C4VA 1ZW7A 1WX7A 2WDQB 3PRMB 1TT5B 2N7EA 4P1CC 1DGJA 2LXCA 1FXIA 3ZVVA 3QJZA 2J4XA 1OTRB 2AQ1B 3KWVA 4GDLB 2DYBA 1D5ZC 2VH2A 2LGYA 1JRPA 3AE8B 3VRAB 1TBEA 1WXSA 2LUMA 1UUPA 4IW0A 4A8XC 1H8CA 3DWGC 3IT6B 1WSPA 1ZXIA 4F1SA 1TS4A 3ZLZA 1WGKA 3R2IA 1FD6A 3BWUD 1ZP0B 4GSWA 4ITKA 4BKSD 3IFWB 1H4RA 2M17A 5EE9A 1NVID 4GDKB 2J0MA 4WAFA 1SSNA 3KYDD 5GMVA 3ML8A 1WGRA 3PREA 3PRPB 2JUOA 2REXA 3T9LA 3HRDD 3R66C 4GMVA 2MA9B 4RGTA 1X1MA 2WDRB 3AE9B 4MH8A 2K39A 3GZNI 3K9PB 4DXAB 3AEFB 4KIKB 1ISNA 1AYFA 3FKYA 2HE7A 1UBQA 3H9DA 4I6NB 4ZRPA 4DDGD 2EKEC 3GZNB 3Q3MC 3RZFA 4IC7B 5BMGA 1EUVB 5E6OA 1CZPA 4AWJA 4FULA 3PZ8A 4MGKE 3DBSA 5HG2A 3NOBA 4LNIA 3PZ7A 5IP4D 3OG5A 4N9F4 2IO2B 3WA0A 3KQ4A 3MC8A 4A3OA 1EO6A 2FAZA 3RT3B 4W9HA 2KTFA 2NCNA 3ZRCA 4DDID 5BMHA 3A9KB 4WQOB 4US8A 4MM3A 3Q2AC 4FXCA 3AEAB 5DPTA 4ZHPA 2HJ8A 3HM3A 4WH4A 1L4DB 3NVZA 3W9CB 1MI0A 1XEEA 4BZAA 2FNJB 4M02A 3BY4B 3JYUA 3DVNV 2RMMA 2IO1B 2K3UA 2E6XA 2K22A 2WLBA 5AUIA 4HDQA 2M8SA 1EWCA 1L6UA 3MHZA 4EOYA 4TQ1A 3ZIMA 2W3RA 2N1WA 3C19A 4RGMA 5J17A 4WWMA 4MELA 3WCQA 2LASA 5TR5A 2B76B 4W9IA 4Q2JA 3AH7A 3P1MA 2GBMA 2ZJDA 4HK2A 2Z0EB 2FCSA 2PIAA 1LM8B 4WJPA 2KMMA 2K6DB 3KW5B 5IKCM 2MJDA 4HROA 2ACZB 1I4GA 2KX3A 4ARCA 1GNUA 4RM8A 1ZE3D 2ZW1A 3U52E 4WQMA 4ZRJA 2O2VB 2JXTA 5AEKB 4L2YA 5IAAC 2UYZB 2K6QA 3V6EB 1QILA 1ZDVA 4WWPA 2BTEA 1L0VB 1XQQA 3L4PA 2YEPF 1KRHA 2FCNA 1PGBA 4R3DA 3Q8AA 3Q3FA 1KOTA 3MJ5A 2O2VA 2R2OA 3SFDB 4WIPA 4IM3A 1WJUA 1PDXA 1C4CA 5BYQA 4M00A 3NY5A 3AE3B 2MHJA 1WGYA 3DVGX 4ZYNA 1NI2A 4FHJA 5G5HA 5AZHA 4S17A 4TMAB 1VLBA 1JROA 1RAXA 2KMAA 3AULA 2L3ZA 2KANA 3Q69A 3UF8A 1FNVA 5L95C 1B1ZA 2AYOB 2LI5A 3DQVA 1TYGB 3DVGY 4FHKA 2DAJA 5IA7A 3L13A 3QHTA 2WXKA 2H88B 3B0AA 1HA5A 2FCMA 1ZXHA 1FNWA 1XXGA 2MBBB 1TIFA 3GOEA 1WH3A 4IM2A 5CX3A 4N59A 4W9EA 4GU2A 1WX9A 3O13A 5E6JA 3BIID 1WIAA 2Y5PA 3PTFC 3U7DA 1F77A 4P1BC 5BYSA 2QMTA 4M0WA 2BB6A 1JMLA 1I42A 3DHIC 3TBLD 5G55A 4I6PA 4LNNA 2LJIA 3URYA 1ET9A 2C7NB 4HJKA 1F9JA 2KT7A 3PLUA 4IKGA 1XCTL 2D3GA 2NBWB 4M01A 1UWMA 3IG3A 2KJRA 2PEAA 2WHIA 3ZNGC 1FXAA 2SEBD 2W3SA 2HTME 3EC8A 2FCQA 2L7RA 4ZYSA 2CJOA 3TL5A 2D07B 1QKZA 2X38A 2KFKB 5JZEB 3FAHA 1NDDA 3I3TB 4IWPA 3RNGC 2KKCA 4FADA 2C7MB 2AL3A 2JY6A 1CMXB 2NPTB 1WE6A 2UU7A 2W9NA 3P63A 4KZCA 3R7QA 1GC7A 2KFKA 4XZ4A 1KLGD 4YSXB 3PPAA 1V5OA 4B0MA 5IO9A 4UDUC 1UH6A 4DHZB 3GB1A 2I1KA 2Y5BB 1Q0WB 2M56B 2JZ3B 5KHQA 3D32A 2DZKA 3DWMA 3I57A 2J0KA 2KNBA 1SE2A 1QOAA 4W9DA 1YX6B 1J19A 4TSSA 2GI9A 1N63A 4ARIA 2KN5A 1FFUA 1NBFC 1TS5A 3NZ3A 3Q8BA 2K1FA 4RMAA 4EZLA 4ZDVA 3A1QB 3QC8B 2WYQA 1GG3A 2D3CA 1T0QC 1WXMA 2ZCCA 2J42A 3T3OA 3APFA 4DHJB 3P4QB 4NZLB 4ANVA 4ZOHC
chains in the Genus database with same CATH topology
3ZYYX 2DLBA 3AE6B 2QEJC 2WS3B 1E9MA 2FBWB 1QLBB 2XNAC 4HJGE 3NVWA 4YTMB 4A9AA 2RDGA 1NYQA 1GPXA 1I4XA 1I4HA 4GLSC 2K5PA 4PT5A 2WQYB 1IUEA 1PYWD 3ETRA 4RGNA 2WXHA 2WDQB 3T3NA 1TKEA 2MJEA 4YTNB 2YEPB 4J3OD 2BT6A 1YJIA 2MEKA 2CU3A 1DGJA 2V4IB 1YQ4B 1FXIA 1N5XA 3AEDB 3IT4B 2J4XA 1Y56A 4RH6A 2E3TA 1J7CA 1VZ8A 2AQ1B 3KWVA 4GDLB 1D5ZC 1JRPA 1TS2A 5EE3A 3AE8B 3VRAB 1K51A 5HI1A 4C7YA 2LUMA 1JW9D 1FFVA 1UUPA 3NVYA 4OZCA 2H89B 4H2AA 4A8XC 4HKZE 4KX6B 3GS2A 3AE7B 1T6BX 2N9LA 3DWGC 4HEA1 3IT6B 3Q8CA 3BYYB 1WXQA 1WSPA 1ZXIA 2N0SB 2WXFA 5BMIA 3R8BA 1TS4A 3W5VB 2WXLA 1E6EB 1F2RC 1WGKA 2MJ3A 3R2IA 1FD6A 4ZRQA 1XLPA 3BWUD 3BVGA 2QILA 1ZP0B 4ITKA 1J7BA 4C56C 1N60A 4DXFA 3RFZB 2IDYA 5EE9A 1SJHD 1NVID 1C78A 4GDKB 2QSDA 4WAFA 4LLGM 2CJNA 1SSNA 4RFBA 1V8CA 2ICIA 2KN4A 3HRDD 4RGTA 3AE9B 2WDRB 4MH8A 4HKQA 4C80A 1TY0A 5FKAC 5FR3A 3AEFB 2G1EA 2FE8A 3AMZA 1AYFA 4RNAA 4JE3B 3AEBB 4MT5A 4XWTA 3AE5B 4WURA 1QQRA 1N62A 4L1BA 4ZRPA 1OQRA 1L4ZB 3U7ZA 1JCKB 4P6VF 3E56A 4AS1A 4YT0B 3EGRA 3BYTB 2DWQA 5BMGA 4US9A 2K0PA 2L83A 1CZPA 1SIJA 3PZ8A 1DOYA 1C4PA 1KH0A 2BB5A 2FUG1 1HEZE 5HG2A 3PO0A 2WU2B 3PZ7A 4B0EA 2KWDA 3BZDB 2AX5A 3KQ4A 2W55A 1KF6B 3U2SC 1C77A 1ESFA 4KGRA 2LGIA 3P4RB 5BMHA 1PUTA 2WXOA 4USAA 1T3QA 3FILB 1SE4A 4US8A 1MPEA 1C9FA 3FC4A 3BK2A 2BS4B 1SB3C 2M19A 4FXCA 3AEAB 1GB1A 5EE1A 4ZHPA 3B9JA 2I2YA 2RPVA 3ZJTA 3VR8B 1HXYD 1YN4A 1L4DB 1NI3A 3NVZA 4WH4A 3W9CB 3HUIA 5T8IA 1MI0A 2NMQA 1XEEA 1QOBA 3SEBA 4NJCA 1JQ4A 3AN1A 1D4BA 1E7PB 1MHXA 1SE3A 2VZKB 2TSSA 4ZHOA 1JWSD 2WXIA 2RMMA 2WXJA 3I9V1 2K3UA 1I4QA 2E6XA 2K22A 1N5WA 1PFDA 2WLBA 5H92C 1DYQA 3FILA 2LHEA 1L6VA 5AUIA 1L5PA 1EWCA 1L6UA 3MHZA 3ZGZA 1C79A 1M4VA 1Q10A 2DYOA 4TQ1A 5HHDG 1RFKA 2W3RA 3KWLA 4RGMA 3C8YA 2JYEA 1DOXA 4A6QA 4YXDB 1HZ5A 4WWMA 2LHDA 3HVDA 4OZAA 2HDEA 3WCQA 4A55A 1JALA 3BVZA 2K9XA 2XN9C 3ZJVA 4REZA 2B76B 4JX1C 4C7ZA 5AUKA 1ACCA 4Q2JA 4YWGG 2KACA 3AH7A 3P1MA 1JWBD 2GB1A 1RWSA 1JWAD 4JPSA 1I4PA 4DXGA 1XO3A 4XE0A 2WP9B 2PIAA 2RDHA 1OQQA 2V3NA 2KMMA 1EWYC 1XF5L 1FCCC 2MJDA 1OFFA 2BBCA 4HROA 1A70A 5C3JB 2ACZB 1I4GA 4ARCA 2Q5WD 4OW0A 1ZE3D 5JXVA 2ZW1A 3U52E 4WQMA 4YSYB 2WXGA 1SXTA 2JXTA 2PMVA 4O1NA 1L0YB 3IXSA 2LMCA 4L2YA 5GXGB 4XDCA 3V05A 1YN3A 4JWSC 3B2FA 1WWTA 1YJJA 3KLSX 2WXRA 1JWUD 1QILA 1NEKB 2QJLA 3W2DA 1EU3A 2NTSA 4OZBA 1VZ7A 1ZDVA 2V0GA 2BTEA 5BYRA 1L0VB 1VZ6A 3L4PA 1KLUD 2YEPF 1KRHA 4RGOS 1K52A 1PGBA 3LXFA 4R3DA 1UNSA 3AM9A 1VRAB 3Q8AA 1SBBB 1YN5A 4LTUA 2EELA 2L1AA 1BXTA 1AN8A 1FIQA 2BW2A 3MJ5A 2L52A 4MM3B 2WXNA 1TJEA 1FEHA 1D5MC 1L0XB 1XLOA 3RPFC 2GRIA 3SFDB 4WIPA 4NAMA 1PDXA 1C4CA 1ZDXA 5BYQA 4RCOA 1EU4A 3AE3B 1C4AA 3ABVB 4CQNA 1WYGA 2BYTA 3AE4B 4LK0M 2W54A 3OWEB 4KKJA 3GP7A 5G5HA 3P4PB 1FO4A 3MP9A 4TMAB 2MH7A 1TS3A 5I4DA 1I7HA 1VLBA 1LO5D 3SR6A 1XLQA 2JQRB 1YNTE 2PTLA 1BUIC 1JROA 1XLNA 4YTPB 1TY2A 2AQ3B 1JWMD 2JZPA 2LEKA 3TSSA 3Q69A 1RM6C 4YSZB 1FNVA 1B1ZA 2OEDA 1E0ZA 2VZKD 4L23A 1TYGB 3SFEB 1QT9A 3V3XA 1FMAD 3MFGA 4D2KA 1GAQB 1FRRA 2WXKA 3EUB2 2H88B 3UI3A 1HA5A 3TEYA 1FRDA 2IPKD 1QOFA 3BK1A 1D6EC 3TUOA 1IGCA 4P16A 1ZXHA 4A90A 1TZOA 1FNWA 1XXGA 2ONQA 3N9YC 1FCLA 1V97A 1VJKA 3AEEB 1XCQL 4XDDA 4N59A 1MVKA 1DOIA 1VDVA 3O13A 1CK1A 5E6JA 3BIID 2PVOD 3VQIA 2JYTA 2Y5PA 3BVMA 1F77A 2JWUA 1V1PA 3AV8A 4DQOC 5BYSA 2JU6X 2QMTA 1N61A 4M0WA 2BB6A 1JMLA 3TEZA 2DBYA 3E9SA 1TKGA 3CWIA 2LJIA 4XWWA 1P7EA 2IJ0A 2WXMA 3LYYA 2ON8A 4KGSA 1ET9A 4OVZA 3URYA 2KDMA 3U4EG 1UGJA 1ENFA 2L32A 3NS1A 2OHFA 3HVZA 1YQ3B 1PGXA 2KQ4X 4IKGA 1XCTL 1EM7A 3CIRB 1UWMA 2D5GA 1SEBD 2J53A 1FXAA 2INPE 2JSVX 2SEBD 3Q8FA 1B9RA 2W3SA 1VR9A 2HTME 2WXPA 1KFYB 4ZYSA 2IGDA 2PLPA 1QF6A 2CJOA 2AQ2B 1GB4A 1GOZA 1AW7A 2R61A 5MPOA 2IGGA 4MACA 1QKZA 2X38A 3LB8C 1SJED 4TQ0A 5G5GA 3P4SB 1KTKA 2LFIA 3FAHA 3NUHB 5FK9C 4KKIA 4JWUC 4IDIA 2WXQA 3W5UB 3J9CA 2INNE 4NAWB 1ET6A 2N7JA 2KAJA 1J7AA 3TEWA 4KGTA 2QIEB 1IBXB 2Y5CA 1FNUA 1P7FA 4RF0A 3EA6A 5HFYA 3P63A 3ZQ4A 3R2TA 5D7GA 2G9HD 3IAM1 4EE2A 1CQVA 1NYRA 1AWDA 3NVVA 3H8HA 2NTTA 2J52A 2WNMA 3B2GA 1KLGD 1NENB 4YSXB 2BS2B 2PVGC 1ZUD2 2ZW0A 3AECB 1E10A 2DYMA 4B0MA 5H8YE 3AE2B 1HZ6A 1K50A 1BMLC 4UDUC 3AB5A 2N9KA 1K53A 2I38A 3ZJUA 3GB1A 3VR9B 3P42A 1STEA 1SF0A 2WU5B 2SAKA 2M56B 5D3DA 1I4RA 3I57A 1PGAA 1RYJA 1WRIA 3DWMA 4N6EB 5D3IB 1IBXA 3AEGB 1F0ZA 4OHJA 4IOIE 1SE2A 1QOAA 1D5XC 1IGDA 2V3PA 3TEXA 4HRSA 1F2RI 2EKIA 1V1PB 4TSSA 1C76A 3AE1B 2GI9A 1FM0D 1N63A 4ARIA 2Y3AA 1TKYA 5TSSA 1FFUA 4N58A 1ZPSA 1TS5A 3IAS1 5EE0A 3NZ3A 3Q8EA 3VRBB 3Q8BA 1T5XD 1R7SA 3MC0B 5C2TB 1V1OA 1MHHE 4AQ7A 1ZOYB 2PW9A 2Z8LA 3NRZA 2IGHA 1UWXA 4NZLB 2W82A 1CJEA 1QOGA 2PKOA 2J42A 3T3OA 1HQRD 4RF1A 1YMHE 3P4QB 3W1SA 2BS3B 2WDVB 2JX5A 1ROEA 5LNK1 2M0AA 4ZOHC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NTS A;  2QEJ C;  1SEB D;  3BZD B;  2SEB D;  2XNA C;  1KLU D;  2RDG A;  4RGO S;  1I4X A;  1I4H A;  1ESF A;  4ZYS A;  1UNS A;  2AQ2 B;  1PYW D;  4RGN A;  1GOZ A;  1SBB B;  1AW7 A;  1YN5 A;  2R61 A;  1SE4 A;  1BXT A;  1AN8 A;  1SJE D;  1KTK A;  1D5M C;  1L0X B;  5FK9 C;  2J4X A;  4RH6 A;  2AQ1 B;  1HXY D;  4RCO A;  1YN4 A;  1EU4 A;  1D5Z C;  1TS2 A;  3SEB A;  1UUP A;  3OWE B;  3GP7 A;  1ET6 A;  1SE3 A;  1TS3 A;  5I4D A;  2TSS A;  1JWS D;  1LO5 D;  1FNU A;  3BYY B;  3EA6 A;  1I4Q A;  3R2T A;  1TY2 A;  1DYQ A;  2AQ3 B;  1JWM D;  1TS4 A;  2G9H D;  3R8B A;  1CQV A;  3R2I A;  3TSS A;  1EWC A;  1FNV A;  1M4V A;  1B1Z A;  2NTT A;  3BVG A;  2QIL A;  1KLG D;  4RGM A;  3MFG A;  4C56 C;  4DXF A;  4UDU C;  1SJH D;  1HA5 A;  2IPK D;  1D6E C;  4RFB A;  1FNW A;  1XXG A;  1STE A;  3BVZ A;  2ICI A;  2XN9 C;  5D3D A;  1I4R A;  4RGT A;  5D3I B;  4OHJ A;  1SE2 A;  1TY0 A;  1D5X C;  1I4P A;  5FKA C;  4DXG A;  3O13 A;  1CK1 A;  1V1P B;  4TSS A;  2RDH A;  3BVM A;  1F77 A;  1V1P A;  5TSS A;  1TS5 A;  1I4G A;  1T5X D;  3MC0 B;  1V1O A;  1JCK B;  2IJ0 A;  1SXT A;  4O1N A;  1L0Y B;  2Z8L A;  3URY A;  1ET9 A;  3BYT B;  1ENF A;  3V05 A;  1YN3 A;  3KLS X;  1HQR D;  1JWU D;  1QIL A;  4NZL B;  3W2D A;  1EU3 A; 
#chains in the Genus database with same CATH topology
 2DLB A;  4F7Z A;  2RPQ A;  1E9M A;  1TTN A;  2XNA C;  3KVF B;  4YTM B;  1GPX A;  1TZ1 A;  2WQY B;  2ZNV C;  4RGN A;  2MJE A;  4G50 A;  2N9P C;  4TV3 A;  2MEK A;  3AED B;  1Y56 A;  2E3T A;  1J7C A;  1VZ8 A;  3A4S C;  2M0X A;  1E7U A;  1OGW A;  3UIP B;  4C7Y A;  5DPR A;  1JW9 D;  1FFV A;  4OZC A;  2H89 B;  4KX6 B;  1F52 A;  3EFC A;  1T6B X;  1Z2M A;  4HEA 1;  3OJ3 A;  2N0S B;  2DNF A;  1F2R C;  2WDT B;  2BGF A;  3VH4 B;  2DAF A;  1V5T A;  4DXF A;  2GMI C;  1VD2 A;  2PPH A;  2ICI A;  2KN4 A;  3HHM A;  4MEM A;  4HKQ A;  4C80 A;  2CHX A;  2N1V A;  5FR3 A;  4E71 A;  2ZCB A;  3AMZ A;  4LNO A;  4IM0 A;  2JZZ A;  3C0R B;  4JE3 B;  4FJZ A;  1M94 A;  3AE5 B;  1QQR A;  1L4Z B;  3M63 B;  3P2B A;  4MGY E;  4DHZ E;  4KVG B;  4YT0 B;  4HVB A;  3RD2 A;  3EGR A;  4PS3 A;  4WWN A;  2DWQ A;  1TGZ B;  2KZR A;  4US9 A;  2L83 A;  1P3Q U;  3A33 B;  4W9F A;  2BB5 A;  1V6E A;  3ZNZ B;  2GLS A;  2D3B A;  3TIX A;  3A9J A;  2D10 A;  1WR6 E;  2KTR B;  5C1Z A;  1ESF A;  2CU1 A;  4KGR A;  4C4V B;  2LGI A;  4DHJ D;  4EZK A;  1LFD A;  2WXO A;  1SE4 A;  5DPS A;  1MPE A;  3BK2 A;  1WJN A;  2BS4 B;  3ONS A;  1WM2 A;  2M19 A;  4HXD A;  4OVV A;  4EFO A;  3B9J A;  3ZJT A;  4JIO U;  4A3P A;  3VR8 B;  3UQB A;  3HUI A;  2OJR A;  1WGD A;  3L10 B;  5AZF A;  3N1Y C;  1D4B A;  1MHX A;  2TSS A;  2D2Q A;  2KTR A;  1JWS D;  2WXJ A;  3EHV A;  2BKF A;  3I9V 1;  1I4Q A;  1N5W A;  1PFD A;  1LGR A;  5H92 C;  1DYQ A;  3KUD B;  1L6V A;  3UIN B;  2KWU B;  1Q10 A;  2DYO A;  2MCN B;  3KWL A;  4HDO A;  3C8Y A;  5LXH A;  1DOX A;  4A6Q A;  1E7V A;  3VTU A;  3PRZ A;  2LHD A;  3DBR I;  2HDE A;  2MBE A;  4MSM B;  1V86 A;  4A55 A;  2XN9 C;  2LWP A;  4JX1 C;  4C7Z A;  2A5U A;  2WX0 A;  2KAC A;  1JWB D;  1RWS A;  4JPS A;  3PLV A;  4DXG A;  2KYW A;  1XO3 A;  2KX0 A;  2KLG A;  1OQQ A;  1EWY C;  1AAR A;  1P98 A;  2BYV E;  2JRH A;  3DBR B;  1OFF A;  3LJ3 A;  4IUM B;  3ZTC A;  4OW0 A;  5JXV A;  1YQB A;  4BAX A;  2PMV A;  3QAQ A;  2FUH B;  2LMC A;  2KDI A;  1YN3 A;  4JWS C;  2MBQ A;  3KLS X;  3ENE A;  1V49 A;  1F1H A;  1JWU D;  4KDL B;  3W2D A;  1HTO A;  4AJW A;  5D6J B;  1VZ6 A;  1KLU D;  1K52 A;  4DK5 A;  4LTU A;  1MG4 A;  4PYU A;  1BXT A;  1AN8 A;  4MM3 B;  3KUZ A;  4GXB A;  3N30 A;  1TJE A;  2GBJ A;  2Z59 B;  1FEH A;  3RPF C;  1XLO A;  3WAL A;  4GOC A;  2GRI A;  4AJY B;  3ABV B;  1WYG A;  2DZM A;  5IOI A;  2BYT A;  4LK0 M;  2W54 A;  3OWE B;  4KKJ A;  2MH7 A;  3N1Z C;  4TUU A;  3SR6 A;  2JQR B;  2PTL A;  2KO3 A;  4YTP B;  3ZRF A;  1TY2 A;  2LVP A;  2AQ3 B;  3CST A;  2LEK A;  3TSS A;  4JGH B;  4YSZ B;  1HTQ A;  3SFE B;  2YVC A;  1S3S G;  3MFG A;  2C7H A;  1WRD B;  1FRD A;  2IPK D;  1QOF A;  3BK1 A;  2QHO A;  3TUO A;  1OQY A;  3N9Y C;  5G2N A;  4XDD A;  1MVK A;  2RD0 A;  1CK1 A;  2JF5 A;  3AV8 A;  1V9J A;  3VTW A;  1QZE A;  3TEZ A;  2XEW A;  1TKG A;  2I1J A;  3CWI A;  4LJP B;  4XWW A;  1P7E A;  2ZPY A;  2GBR A;  1I35 A;  2WXM A;  3LYY A;  2MBO A;  2BWF A;  3H1U A;  2L32 A;  1ENF A;  3OAW A;  3HVZ A;  1YQ3 B;  3N1X C;  4TKN A;  2KJH B;  2V1Y A;  4C00 A;  5LLI A;  2Z0D B;  2D5G A;  2L0T A;  2J53 A;  3AU5 A;  3Q8F A;  2DZJ A;  2K25 A;  1KFY B;  2PLP A;  2CS4 A;  5MPO A;  4MAC A;  3LB8 C;  4WJO A;  1SJE D;  3B1L X;  1KTK A;  1OEY A;  3NUH B;  2BF8 B;  2LUE A;  5FK9 C;  4E74 A;  2MWS B;  3DCG A;  4IDI A;  2WXQ A;  4HLE A;  3VUW A;  2RSU A;  3J9C A;  4EKU A;  3WIM A;  1T0S C;  1WXA A;  2IYD B;  2N7D A;  4GIV A;  3A4R A;  2N7J A;  3LDZ E;  2KAJ A;  3Q6B A;  1J7A A;  3TEW A;  1IBX B;  2Y5C A;  4PK1 A;  1FNU A;  1P7F A;  3EA6 A;  3ZQ4 A;  3IVF A;  4K3B A;  2L05 A;  3RUI B;  1UGM A;  3IAM 1;  3RMK C;  3O65 B;  1CQV A;  1NYR A;  2BVC A;  3B2G A;  1NEN B;  2BS2 B;  2ZW0 A;  1E10 A;  2DYM A;  5H8Y E;  4MDK E;  1HZ6 A;  1BML C;  3M62 B;  4LDT B;  1XT9 B;  2N9K A;  2I38 A;  3RYT A;  3ZJU A;  3VR9 B;  1E8Y A;  3APD A;  3P42 A;  4K7S A;  4FA6 A;  5JH5 C;  4MGI E;  1WRI A;  1IBX A;  3AEG B;  4LNF A;  4IOI E;  4OHJ A;  1IGD A;  2V3P A;  4OVU A;  3QCA A;  1TKY A;  4M0W B;  1ZPS A;  2OOB B;  4BFR A;  3SDL C;  3IAS 1;  3Q8E A;  2FID A;  1T5X D;  4KZ0 A;  1R7S A;  1WZ3 A;  3MC0 B;  5C2T B;  2XK5 A;  4BVU C;  1G6J A;  1MHH E;  4KV2 A;  2PW9 A;  3DHG C;  1UWX A;  4RF1 A;  2IY0 B;  2BS3 B;  2WDV B;  3M95 A;  1GJZ A;  2M0A A;  5J2R A;  2IZV B;  2LRW A;  4A9A A;  2RDG A;  1NYQ A;  4PT5 A;  4GLS C;  2K5P A;  1IUE A;  3ETR A;  1TKE A;  3DBH I;  2EMT A;  4J3O D;  2BT6 A;  2NBV B;  2BYE A;  3RNB C;  5HKH A;  1WFY A;  1KM7 A;  2MSE D;  3HIZ A;  1E8W A;  1P0R A;  5L83 A;  2CKH B;  3IT4 B;  4NPN A;  4RH6 A;  5AZG A;  3IHP C;  3N20 C;  1TS2 A;  2M4N A;  1J8C A;  1K51 A;  5HI1 A;  4WAA A;  3H6N A;  4M8N A;  3WAN A;  3DBH B;  4HKZ E;  4BKG A;  3AE7 B;  4AUQ C;  5D94 A;  4K3C A;  3Q8C A;  3Q3O C;  3BYY B;  2KHW B;  1T0R C;  2JXX A;  3H7P B;  4FLH A;  2DHZ A;  3R8B A;  3W5V B;  2WWZ A;  5LXI B;  3NS8 A;  1XLP A;  3BVG A;  2QIL A;  1Z5S B;  4JLC A;  1T0Y A;  4EEW A;  4AOF A;  1C78 A;  2QSD A;  4XGA B;  4LLG M;  2AL6 A;  2NR2 A;  2L00 B;  4RFB A;  1V8C A;  2QCZ A;  4LDT D;  4LCD E;  1TY0 A;  2KVR A;  3H7P A;  4MGZ E;  2G1E A;  2FE8 A;  1Q5W B;  5J18 A;  3VUY A;  3AEB B;  4MT5 A;  2BYF A;  4XWT A;  1N62 A;  3ECI A;  4MH0 E;  4NNJ B;  4L1B A;  1OQR A;  3U7Z A;  4P6V F;  4URK A;  1XD3 B;  2IND C;  2KMC A;  2M1M A;  4PS8 A;  3BYT B;  5BO4 B;  2KDF B;  4EZJ A;  2YLM A;  1KH0 A;  2FUG 1;  2L8J A;  3NG0 A;  2LVQ A;  2WU2 B;  2KWD A;  3BZD B;  2AX5 A;  2W55 A;  1KF6 B;  3CSF A;  4BOS C;  1C77 A;  3EFU A;  4USA A;  3Q3J A;  4M8M A;  1C9F A;  3FC4 A;  1WX8 A;  4JL9 A;  1SB3 C;  2KJ6 A;  4PYZ A;  1V81 A;  5EE1 A;  2BQQ A;  2RPV A;  1C3T A;  1R4N B;  1YN4 A;  1NI3 A;  4HPP A;  1QOB A;  3SEB A;  1JQ4 A;  3AN1 A;  1J0G A;  4XYC A;  3ALB A;  2QDF A;  4ZHO A;  1GUA B;  3MTN B;  3ZTD A;  2KQ7 A;  2MQJ A;  1C79 A;  2RGF A;  1WY8 A;  5HHD G;  3W1S C;  3ZNH B;  2MBH A;  2JYE A;  3R7R A;  2RR9 A;  4K81 A;  4YXD B;  5CHV C;  3HVD A;  3MC9 A;  3ZDM C;  1JAL A;  3BVZ A;  2J7Q B;  5CHW A;  3KYC D;  4REZ A;  3ZJV A;  1ACC A;  4YWG G;  3RNF C;  2GB1 A;  2JT4 B;  4RM9 A;  1JWA D;  1K8R B;  4W9K A;  2KFJ A;  2RDB C;  3RNC C;  2KWV B;  2RDH A;  3GE8 C;  1RRB A;  2BBC A;  2JWZ A;  2QC8 A;  2V9H A;  5C3J B;  4WWO A;  2LXA A;  3AI5 A;  1SXT A;  3L08 A;  3VAW A;  1L0Y B;  2KVZ A;  4ACF A;  3IXS A;  5GXG B;  1UEL A;  3B2F A;  1RFA A;  3ZXR A;  2KOX A;  2DZI A;  1EU3 A;  2NTS A;  3A9J B;  4OZB A;  3X23 A;  4WJQ A;  3ZW3 A;  4RGO S;  1UNS A;  3AM9 A;  4HPL B;  2MRP A;  1SBB B;  1YN5 A;  3WAM A;  2L1A A;  1FIQ A;  2L52 A;  2WXN A;  1D5M C;  1L0X B;  2LVO A;  1E5W A;  4G3X B;  1R4M I;  1ZDX A;  4XX5 A;  1N6Z A;  2KC2 A;  1EU4 A;  1C4A A;  2VH1 A;  1D3Z A;  2LGX A;  3AE4 B;  3H7S A;  3GP7 A;  1FO4 A;  4W9G A;  2XBB C;  1LXD A;  3TMP B;  5I4D A;  1I7H A;  1LO5 D;  1YNT E;  4ASW C;  1SE9 A;  1XLN A;  2KD0 A;  1R4M B;  4CHK A;  5KHO A;  2DX5 B;  5FR6 A;  4L23 A;  5CTR C;  3U30 A;  1QT9 A;  3V3X A;  1FMA D;  1GAQ B;  1FRR A;  4ZRI A;  3UI3 A;  3I5J C;  3CF6 E;  1IPG A;  4AP4 C;  4P16 A;  4A90 A;  1TZO A;  1WI0 A;  1WR1 A;  1WJ6 A;  1FCL A;  1V97 A;  1VJK A;  3AU4 A;  3PVL A;  1DOI A;  4YL8 A;  3TJP A;  3V6C B;  2JYT A;  2O6V B;  3BVM A;  2JWU A;  1V1P A;  2MLB A;  2LZ6 A;  2HTH A;  2DBY A;  3E9S A;  2NBU A;  3Q14 C;  2ASQ A;  2C60 A;  3L54 A;  2G45 B;  2ON8 A;  3U4E G;  1UGJ A;  3NS1 A;  2INC C;  2OHF A;  2B3A A;  3K9O B;  3RZW C;  4ZRK A;  5IN7 A;  1YJ1 A;  3S2A A;  2J0J A;  3ZNI D;  5DCN A;  4DBG A;  1SEB D;  2O6V A;  2D3A A;  2JSV X;  1B9R A;  2BKR B;  2K8H A;  2IGD A;  1QF6 A;  1WM3 A;  2AQ2 B;  2R61 A;  3HK0 A;  5E6N A;  1HE8 A;  1P9D U;  4TQ0 A;  5G5G A;  3P4S B;  3I63 C;  4KKI A;  3W5U B;  1MG8 A;  2IO0 B;  2KLC A;  2INN E;  4GDL A;  2JVC A;  3WAP A;  4KGT A;  2QIE B;  3NZS A;  4RF0 A;  5HFY A;  2G9H D;  4EE2 A;  3W1Y A;  3NJT A;  3H8H A;  2D11 A;  1KJT A;  4II2 B;  2NTT A;  2J52 A;  3V62 A;  2PVG C;  3AEC B;  3V60 A;  1FXT B;  3PGE A;  1K50 A;  2ZNV B;  4GDK A;  3DDC B;  4GB9 A;  1SF0 A;  2WU5 B;  2SAK A;  5D3D A;  1WXV A;  3V61 A;  1I4R A;  4KSK C;  1PGA A;  2AWT A;  5D3I B;  1MJD A;  1F0Z A;  4K7U A;  3QQ8 B;  1D5X C;  4FBJ B;  1F2R I;  2ZEQ A;  2EKI A;  1C76 A;  2ZVN A;  2Y3A A;  4KIK A;  5TSS A;  2ZVO A;  4N58 A;  3ZXV A;  5EE0 A;  3VH3 B;  2HD5 B;  2A4Z A;  1V1O A;  4AQ7 A;  3VTV A;  1U4A A;  2O6V D;  1C1Y B;  2KDB A;  2L0F A;  2W82 A;  3MJW A;  2NVU I;  1QOG A;  1WGH A;  2PKO A;  2X8X X;  3JW0 X;  2L76 A;  3W1S A;  5LNK 1;  1ROE A;  3ZYY X;  3AE6 B;  2QEJ C;  4WJN A;  2WS3 B;  3ZDT A;  1QLB B;  2MW5 A;  4HJG E;  4LNK A;  4BBN F;  3VUX A;  4K7W A;  2ZPN A;  1E8X A;  1PYW D;  1IYF A;  3VFK A;  3T3N A;  4YTN B;  2CHW A;  2YEP B;  4B6W A;  3A9K A;  2LD9 A;  1YJI A;  2CU3 A;  2V4I B;  1YQ4 B;  1N5X A;  5EE3 A;  4ANW A;  3NVY A;  1WJ4 A;  3PHW B;  4H2A A;  4II3 B;  3GS2 A;  1WE7 A;  2N9L A;  2V3S A;  1WXQ A;  3QX1 A;  4KSL C;  2WXF A;  1Y8R C;  5BMI A;  2WXL A;  1E6E B;  2GBK A;  2MJ3 A;  3PZD A;  4ZRQ A;  1WYW B;  3QWZ B;  1J7B A;  4C56 C;  1N60 A;  2R2Q A;  3RFZ B;  2G4S A;  2IDY A;  1SJH D;  3GE3 C;  2CJN A;  1WGG A;  3KUC B;  4F8C B;  3VHT C;  2IY1 B;  3RCZ A;  4I6L B;  5FKA C;  4BOZ B;  4RNA A;  3Q3N C;  4WUR A;  2XK5 B;  2CR5 A;  1JCK B;  3E56 A;  4AS1 A;  2PE9 A;  3SD5 A;  2K0P A;  1SIJ A;  4P7I A;  1LQB A;  2VRR B;  1DOY A;  1C4P A;  4ICV A;  3RNA C;  1HEZ E;  3SU8 X;  3PO0 A;  1UD7 A;  1E90 A;  4B0E A;  3PV1 A;  4JQW C;  2JPH A;  3U2S C;  3TCA A;  4B95 A;  3P4R B;  1PUT A;  4ANU A;  4GGQ A;  1T3Q A;  3FIL B;  1GB1 A;  2I2Y A;  3VXW A;  1GC6 A;  1HXY D;  2BWE S;  1L7Y A;  4A20 A;  5T8I A;  2NMQ A;  5EDS A;  4NJC A;  2C9W B;  4ANX A;  1E7P B;  1SE3 A;  2VZK B;  2V4L A;  2FIF A;  2WXI A;  3FIL A;  2LHE A;  1JRU A;  1L5P A;  3ZGZ A;  1M4V A;  2EMS A;  1RFK A;  3N32 A;  4EUT A;  4G0N B;  1A5R A;  1HZ5 A;  3WAO A;  1P1A A;  4OZA A;  2OJW A;  4FJY A;  3PT2 B;  2K9X A;  2N4F A;  1ZGU B;  5AUK A;  3UQA A;  2DEN B;  3APC A;  4J6I A;  1BT0 A;  1I4P A;  4IWO A;  4W9J A;  4PS7 A;  4XE0 A;  2NS5 A;  2WP9 B;  4IWQ A;  1UBI A;  2V3N A;  4IG7 B;  1UF0 A;  4MSQ B;  1XF5 L;  1FCC C;  1V2Y A;  3L0W B;  1A70 A;  2Q5W D;  4QAY A;  3DPD A;  1IP9 A;  1YIW A;  3PHX B;  3JVZ X;  4YSY B;  2WXG A;  2AEH A;  4O1N A;  4XDC A;  3V05 A;  1WZ0 A;  3X0W A;  2KQS A;  1WWT A;  1YJJ A;  2WXR A;  1NEK B;  2QJL A;  3RI7 C;  1VZ7 A;  2V0G A;  2KWC A;  5BYR A;  2WX1 A;  3LXF A;  3QAR A;  2JRI B;  1VRA B;  1Q1O A;  2EEL A;  4CYE A;  2BW2 A;  2WGS A;  2BPS A;  3OJ4 B;  3VDZ A;  4NAM A;  1WF9 A;  4RCO A;  3AXC A;  3PSE B;  4CQN A;  3N3K B;  2ZZP B;  3VVW B;  1R4N I;  3P4P B;  3MP9 A;  2C5L C;  2NPT A;  1TS3 A;  1EF1 A;  3NZU A;  1XLQ A;  4X57 B;  4NJ6 A;  1BUI C;  2KC1 A;  4NY0 A;  4FJV B;  3MHS D;  3RN9 C;  1JWM D;  2GBN A;  2JZP A;  1RM6 C;  2LGS A;  4NQK E;  3SHQ A;  5D2M B;  2OED A;  4B9K A;  2VZK D;  1E0Z A;  1SIF A;  3ZKJ C;  3IBE A;  4KDI C;  4D2K A;  2PE6 B;  3RUL A;  3EUB 2;  3TEY A;  4S0R A;  4W9L A;  1D6E C;  1IGC A;  4BKT A;  3UIO B;  2ONQ A;  1YD8 U;  1V80 A;  3AEE B;  1XCQ L;  4BBN C;  4W9C A;  1VDV A;  2G3Q B;  4GN1 A;  5DPW A;  2PVO D;  3VQI A;  1L2N A;  2GOW A;  4DQO C;  2JU6 X;  1N61 A;  2KK8 A;  3PS6 A;  2LRU A;  3ZUN A;  2IJ0 A;  3DHH C;  3ZO5 B;  4KGS A;  4OVZ A;  2KDM A;  4CO7 A;  1WMH B;  4K1R B;  3A1Q A;  1FPY A;  1PQS A;  1PGX A;  3BIN A;  2KQ4 X;  1MFW A;  1EM7 A;  3B08 A;  3CIR B;  5CHF A;  2INP E;  1VR9 A;  2WXP A;  2CHZ A;  1GB4 A;  1GOZ A;  2MP2 B;  1AW7 A;  2IGG A;  2LGD A;  2LJ5 A;  1UZX B;  2UWQ A;  1EF5 A;  5E6P A;  2LFI A;  3KH0 A;  3U8Z A;  1WMH A;  4JWU C;  3NHE B;  1OEY J;  4HCP B;  3ML9 A;  1YOV B;  4HPM B;  3RNE C;  1KLV A;  4MJS B;  3DVN U;  5C23 A;  4NAW B;  4DWF A;  1ET6 A;  3QK0 A;  2MP2 A;  3R2T A;  5D7G A;  4E3C A;  1YX5 B;  1AWD A;  3DBL I;  3NVV A;  4ICU A;  5JHB A;  3EEC A;  3M3J A;  2WNM A;  1RLF A;  2K8B A;  1ZUD 2;  3DOW A;  3AE2 B;  3JSV B;  3AB5 A;  1K53 A;  4MJS A;  4G11 A;  4NAW A;  1STE A;  2KDE B;  2G4D B;  3CMM B;  3DBL B;  4XC2 A;  3OLM D;  1SGH A;  1RYJ A;  4N6E B;  4NQL B;  4BKS A;  3T8M A;  1VCB A;  4HWI B;  3TEX A;  4HRS A;  1V1P B;  2IO3 B;  2MX2 A;  3AE1 B;  3UGB B;  1FM0 D;  2N9X A;  2PJH A;  2K8C A;  3VRB B;  3L16 A;  1S1Q B;  3JSV A;  2KXJ A;  2N9E B;  2IBI B;  1ZOY B;  4LJO B;  2Z8L A;  3QA8 A;  3NRZ A;  1E8Z A;  4FN2 A;  2IGH A;  3QIJ A;  1CJE A;  4HCN B;  1HQR D;  1YMH E;  2JX5 A;  5JHA A;  4NJ7 A;  2FBW B;  1ZKH A;  3L17 A;  3HM6 X;  3NVW A;  2HJ1 A;  1I4X A;  1I4H A;  3R3M A;  2WXH A;  4C4V A;  1ZW7 A;  1WX7 A;  2WDQ B;  3PRM B;  1TT5 B;  2N7E A;  4P1C C;  1DGJ A;  2LXC A;  1FXI A;  3ZVV A;  3QJZ A;  2J4X A;  1OTR B;  2AQ1 B;  3KWV A;  4GDL B;  2DYB A;  1D5Z C;  2VH2 A;  2LGY A;  1JRP A;  3AE8 B;  3VRA B;  1TBE A;  1WXS A;  2LUM A;  1UUP A;  4IW0 A;  4A8X C;  1H8C A;  3DWG C;  3IT6 B;  1WSP A;  1ZXI A;  4F1S A;  1TS4 A;  3ZLZ A;  1WGK A;  3R2I A;  1FD6 A;  3BWU D;  1ZP0 B;  4GSW A;  4ITK A;  4BKS D;  3IFW B;  1H4R A;  2M17 A;  5EE9 A;  1NVI D;  4GDK B;  2J0M A;  4WAF A;  1SSN A;  3KYD D;  5GMV A;  3ML8 A;  1WGR A;  3PRE A;  3PRP B;  2JUO A;  2REX A;  3T9L A;  3HRD D;  3R66 C;  4GMV A;  2MA9 B;  4RGT A;  1X1M A;  2WDR B;  3AE9 B;  4MH8 A;  2K39 A;  3GZN I;  3K9P B;  4DXA B;  3AEF B;  4KIK B;  1ISN A;  1AYF A;  3FKY A;  2HE7 A;  1UBQ A;  3H9D A;  4I6N B;  4ZRP A;  4DDG D;  2EKE C;  3GZN B;  3Q3M C;  3RZF A;  4IC7 B;  5BMG A;  1EUV B;  5E6O A;  1CZP A;  4AWJ A;  4FUL A;  3PZ8 A;  4MGK E;  3DBS A;  5HG2 A;  3NOB A;  4LNI A;  3PZ7 A;  5IP4 D;  3OG5 A;  4N9F 4;  2IO2 B;  3WA0 A;  3KQ4 A;  3MC8 A;  4A3O A;  1EO6 A;  2FAZ A;  3RT3 B;  4W9H A;  2KTF A;  2NCN A;  3ZRC A;  4DDI D;  5BMH A;  3A9K B;  4WQO B;  4US8 A;  4MM3 A;  3Q2A C;  4FXC A;  3AEA B;  5DPT A;  4ZHP A;  2HJ8 A;  3HM3 A;  4WH4 A;  1L4D B;  3NVZ A;  3W9C B;  1MI0 A;  1XEE A;  4BZA A;  2FNJ B;  4M02 A;  3BY4 B;  3JYU A;  3DVN V;  2RMM A;  2IO1 B;  2K3U A;  2E6X A;  2K22 A;  2WLB A;  5AUI A;  4HDQ A;  2M8S A;  1EWC A;  1L6U A;  3MHZ A;  4EOY A;  4TQ1 A;  3ZIM A;  2W3R A;  2N1W A;  3C19 A;  4RGM A;  5J17 A;  4WWM A;  4MEL A;  3WCQ A;  2LAS A;  5TR5 A;  2B76 B;  4W9I A;  4Q2J A;  3AH7 A;  3P1M A;  2GBM A;  2ZJD A;  4HK2 A;  2Z0E B;  2FCS A;  2PIA A;  1LM8 B;  4WJP A;  2KMM A;  2K6D B;  3KW5 B;  5IKC M;  2MJD A;  4HRO A;  2ACZ B;  1I4G A;  2KX3 A;  4ARC A;  1GNU A;  4RM8 A;  1ZE3 D;  2ZW1 A;  3U52 E;  4WQM A;  4ZRJ A;  2O2V B;  2JXT A;  5AEK B;  4L2Y A;  5IAA C;  2UYZ B;  2K6Q A;  3V6E B;  1QIL A;  1ZDV A;  4WWP A;  2BTE A;  1L0V B;  1XQQ A;  3L4P A;  2YEP F;  1KRH A;  2FCN A;  1PGB A;  4R3D A;  3Q8A A;  3Q3F A;  1KOT A;  3MJ5 A;  2O2V A;  2R2O A;  3SFD B;  4WIP A;  4IM3 A;  1WJU A;  1PDX A;  1C4C A;  5BYQ A;  4M00 A;  3NY5 A;  3AE3 B;  2MHJ A;  1WGY A;  3DVG X;  4ZYN A;  1NI2 A;  4FHJ A;  5G5H A;  5AZH A;  4S17 A;  4TMA B;  1VLB A;  1JRO A;  1RAX A;  2KMA A;  3AUL A;  2L3Z A;  2KAN A;  3Q69 A;  3UF8 A;  1FNV A;  5L95 C;  1B1Z A;  2AYO B;  2LI5 A;  3DQV A;  1TYG B;  3DVG Y;  4FHK A;  2DAJ A;  5IA7 A;  3L13 A;  3QHT A;  2WXK A;  2H88 B;  3B0A A;  1HA5 A;  2FCM A;  1ZXH A;  1FNW A;  1XXG A;  2MBB B;  1TIF A;  3GOE A;  1WH3 A;  4IM2 A;  5CX3 A;  4N59 A;  4W9E A;  4GU2 A;  1WX9 A;  3O13 A;  5E6J A;  3BII D;  1WIA A;  2Y5P A;  3PTF C;  3U7D A;  1F77 A;  4P1B C;  5BYS A;  2QMT A;  4M0W A;  2BB6 A;  1JML A;  1I42 A;  3DHI C;  3TBL D;  5G55 A;  4I6P A;  4LNN A;  2LJI A;  3URY A;  1ET9 A;  2C7N B;  4HJK A;  1F9J A;  2KT7 A;  3PLU A;  4IKG A;  1XCT L;  2D3G A;  2NBW B;  4M01 A;  1UWM A;  3IG3 A;  2KJR A;  2PEA A;  2WHI A;  3ZNG C;  1FXA A;  2SEB D;  2W3S A;  2HTM E;  3EC8 A;  2FCQ A;  2L7R A;  4ZYS A;  2CJO A;  3TL5 A;  2D07 B;  1QKZ A;  2X38 A;  2KFK B;  5JZE B;  3FAH A;  1NDD A;  3I3T B;  4IWP A;  3RNG C;  2KKC A;  4FAD A;  2C7M B;  2AL3 A;  2JY6 A;  1CMX B;  2NPT B;  1WE6 A;  2UU7 A;  2W9N A;  3P63 A;  4KZC A;  3R7Q A;  1GC7 A;  2KFK A;  4XZ4 A;  1KLG D;  4YSX B;  3PPA A;  1V5O A;  4B0M A;  5IO9 A;  4UDU C;  1UH6 A;  4DHZ B;  3GB1 A;  2I1K A;  2Y5B B;  1Q0W B;  2M56 B;  2JZ3 B;  5KHQ A;  3D32 A;  2DZK A;  3DWM A;  3I57 A;  2J0K A;  2KNB A;  1SE2 A;  1QOA A;  4W9D A;  1YX6 B;  1J19 A;  4TSS A;  2GI9 A;  1N63 A;  4ARI A;  2KN5 A;  1FFU A;  1NBF C;  1TS5 A;  3NZ3 A;  3Q8B A;  2K1F A;  4RMA A;  4EZL A;  4ZDV A;  3A1Q B;  3QC8 B;  2WYQ A;  1GG3 A;  2D3C A;  1T0Q C;  1WXM A;  2ZCC A;  2J42 A;  3T3O A;  3APF A;  4DHJ B;  3P4Q B;  4NZL B;  4ANV A;  4ZOH C; 
#chains in the Genus database with same CATH homology
 3ZYY X;  2DLB A;  3AE6 B;  2QEJ C;  2WS3 B;  1E9M A;  2FBW B;  1QLB B;  2XNA C;  4HJG E;  3NVW A;  4YTM B;  4A9A A;  2RDG A;  1NYQ A;  1GPX A;  1I4X A;  1I4H A;  4GLS C;  2K5P A;  4PT5 A;  2WQY B;  1IUE A;  1PYW D;  3ETR A;  4RGN A;  2WXH A;  2WDQ B;  3T3N A;  1TKE A;  2MJE A;  4YTN B;  2YEP B;  4J3O D;  2BT6 A;  1YJI A;  2MEK A;  2CU3 A;  1DGJ A;  2V4I B;  1YQ4 B;  1FXI A;  1N5X A;  3AED B;  3IT4 B;  2J4X A;  1Y56 A;  4RH6 A;  2E3T A;  1J7C A;  1VZ8 A;  2AQ1 B;  3KWV A;  4GDL B;  1D5Z C;  1JRP A;  1TS2 A;  5EE3 A;  3AE8 B;  3VRA B;  1K51 A;  5HI1 A;  4C7Y A;  2LUM A;  1JW9 D;  1FFV A;  1UUP A;  3NVY A;  4OZC A;  2H89 B;  4H2A A;  4A8X C;  4HKZ E;  4KX6 B;  3GS2 A;  3AE7 B;  1T6B X;  2N9L A;  3DWG C;  4HEA 1;  3IT6 B;  3Q8C A;  3BYY B;  1WXQ A;  1WSP A;  1ZXI A;  2N0S B;  2WXF A;  5BMI A;  3R8B A;  1TS4 A;  3W5V B;  2WXL A;  1E6E B;  1F2R C;  1WGK A;  2MJ3 A;  3R2I A;  1FD6 A;  4ZRQ A;  1XLP A;  3BWU D;  3BVG A;  2QIL A;  1ZP0 B;  4ITK A;  1J7B A;  4C56 C;  1N60 A;  4DXF A;  3RFZ B;  2IDY A;  5EE9 A;  1SJH D;  1NVI D;  1C78 A;  4GDK B;  2QSD A;  4WAF A;  4LLG M;  2CJN A;  1SSN A;  4RFB A;  1V8C A;  2ICI A;  2KN4 A;  3HRD D;  4RGT A;  3AE9 B;  2WDR B;  4MH8 A;  4HKQ A;  4C80 A;  1TY0 A;  5FKA C;  5FR3 A;  3AEF B;  2G1E A;  2FE8 A;  3AMZ A;  1AYF A;  4RNA A;  4JE3 B;  3AEB B;  4MT5 A;  4XWT A;  3AE5 B;  4WUR A;  1QQR A;  1N62 A;  4L1B A;  4ZRP A;  1OQR A;  1L4Z B;  3U7Z A;  1JCK B;  4P6V F;  3E56 A;  4AS1 A;  4YT0 B;  3EGR A;  3BYT B;  2DWQ A;  5BMG A;  4US9 A;  2K0P A;  2L83 A;  1CZP A;  1SIJ A;  3PZ8 A;  1DOY A;  1C4P A;  1KH0 A;  2BB5 A;  2FUG 1;  1HEZ E;  5HG2 A;  3PO0 A;  2WU2 B;  3PZ7 A;  4B0E A;  2KWD A;  3BZD B;  2AX5 A;  3KQ4 A;  2W55 A;  1KF6 B;  3U2S C;  1C77 A;  1ESF A;  4KGR A;  2LGI A;  3P4R B;  5BMH A;  1PUT A;  2WXO A;  4USA A;  1T3Q A;  3FIL B;  1SE4 A;  4US8 A;  1MPE A;  1C9F A;  3FC4 A;  3BK2 A;  2BS4 B;  1SB3 C;  2M19 A;  4FXC A;  3AEA B;  1GB1 A;  5EE1 A;  4ZHP A;  3B9J A;  2I2Y A;  2RPV A;  3ZJT A;  3VR8 B;  1HXY D;  1YN4 A;  1L4D B;  1NI3 A;  3NVZ A;  4WH4 A;  3W9C B;  3HUI A;  5T8I A;  1MI0 A;  2NMQ A;  1XEE A;  1QOB A;  3SEB A;  4NJC A;  1JQ4 A;  3AN1 A;  1D4B A;  1E7P B;  1MHX A;  1SE3 A;  2VZK B;  2TSS A;  4ZHO A;  1JWS D;  2WXI A;  2RMM A;  2WXJ A;  3I9V 1;  2K3U A;  1I4Q A;  2E6X A;  2K22 A;  1N5W A;  1PFD A;  2WLB A;  5H92 C;  1DYQ A;  3FIL A;  2LHE A;  1L6V A;  5AUI A;  1L5P A;  1EWC A;  1L6U A;  3MHZ A;  3ZGZ A;  1C79 A;  1M4V A;  1Q10 A;  2DYO A;  4TQ1 A;  5HHD G;  1RFK A;  2W3R A;  3KWL A;  4RGM A;  3C8Y A;  2JYE A;  1DOX A;  4A6Q A;  4YXD B;  1HZ5 A;  4WWM A;  2LHD A;  3HVD A;  4OZA A;  2HDE A;  3WCQ A;  4A55 A;  1JAL A;  3BVZ A;  2K9X A;  2XN9 C;  3ZJV A;  4REZ A;  2B76 B;  4JX1 C;  4C7Z A;  5AUK A;  1ACC A;  4Q2J A;  4YWG G;  2KAC A;  3AH7 A;  3P1M A;  1JWB D;  2GB1 A;  1RWS A;  1JWA D;  4JPS A;  1I4P A;  4DXG A;  1XO3 A;  4XE0 A;  2WP9 B;  2PIA A;  2RDH A;  1OQQ A;  2V3N A;  2KMM A;  1EWY C;  1XF5 L;  1FCC C;  2MJD A;  1OFF A;  2BBC A;  4HRO A;  1A70 A;  5C3J B;  2ACZ B;  1I4G A;  4ARC A;  2Q5W D;  4OW0 A;  1ZE3 D;  5JXV A;  2ZW1 A;  3U52 E;  4WQM A;  4YSY B;  2WXG A;  1SXT A;  2JXT A;  2PMV A;  4O1N A;  1L0Y B;  3IXS A;  2LMC A;  4L2Y A;  5GXG B;  4XDC A;  3V05 A;  1YN3 A;  4JWS C;  3B2F A;  1WWT A;  1YJJ A;  3KLS X;  2WXR A;  1JWU D;  1QIL A;  1NEK B;  2QJL A;  3W2D A;  1EU3 A;  2NTS A;  4OZB A;  1VZ7 A;  1ZDV A;  2V0G A;  2BTE A;  5BYR A;  1L0V B;  1VZ6 A;  3L4P A;  1KLU D;  2YEP F;  1KRH A;  4RGO S;  1K52 A;  1PGB A;  3LXF A;  4R3D A;  1UNS A;  3AM9 A;  1VRA B;  3Q8A A;  1SBB B;  1YN5 A;  4LTU A;  2EEL A;  2L1A A;  1BXT A;  1AN8 A;  1FIQ A;  2BW2 A;  3MJ5 A;  2L52 A;  4MM3 B;  2WXN A;  1TJE A;  1FEH A;  1D5M C;  1L0X B;  1XLO A;  3RPF C;  2GRI A;  3SFD B;  4WIP A;  4NAM A;  1PDX A;  1C4C A;  1ZDX A;  5BYQ A;  4RCO A;  1EU4 A;  3AE3 B;  1C4A A;  3ABV B;  4CQN A;  1WYG A;  2BYT A;  3AE4 B;  4LK0 M;  2W54 A;  3OWE B;  4KKJ A;  3GP7 A;  5G5H A;  3P4P B;  1FO4 A;  3MP9 A;  4TMA B;  2MH7 A;  1TS3 A;  5I4D A;  1I7H A;  1VLB A;  1LO5 D;  3SR6 A;  1XLQ A;  2JQR B;  1YNT E;  2PTL A;  1BUI C;  1JRO A;  1XLN A;  4YTP B;  1TY2 A;  2AQ3 B;  1JWM D;  2JZP A;  2LEK A;  3TSS A;  3Q69 A;  1RM6 C;  4YSZ B;  1FNV A;  1B1Z A;  2OED A;  1E0Z A;  2VZK D;  4L23 A;  1TYG B;  3SFE B;  1QT9 A;  3V3X A;  1FMA D;  3MFG A;  4D2K A;  1GAQ B;  1FRR A;  2WXK A;  3EUB 2;  2H88 B;  3UI3 A;  1HA5 A;  3TEY A;  1FRD A;  2IPK D;  1QOF A;  3BK1 A;  1D6E C;  3TUO A;  1IGC A;  4P16 A;  1ZXH A;  4A90 A;  1TZO A;  1FNW A;  1XXG A;  2ONQ A;  3N9Y C;  1FCL A;  1V97 A;  1VJK A;  3AEE B;  1XCQ L;  4XDD A;  4N59 A;  1MVK A;  1DOI A;  1VDV A;  3O13 A;  1CK1 A;  5E6J A;  3BII D;  2PVO D;  3VQI A;  2JYT A;  2Y5P A;  3BVM A;  1F77 A;  2JWU A;  1V1P A;  3AV8 A;  4DQO C;  5BYS A;  2JU6 X;  2QMT A;  1N61 A;  4M0W A;  2BB6 A;  1JML A;  3TEZ A;  2DBY A;  3E9S A;  1TKG A;  3CWI A;  2LJI A;  4XWW A;  1P7E A;  2IJ0 A;  2WXM A;  3LYY A;  2ON8 A;  4KGS A;  1ET9 A;  4OVZ A;  3URY A;  2KDM A;  3U4E G;  1UGJ A;  1ENF A;  2L32 A;  3NS1 A;  2OHF A;  3HVZ A;  1YQ3 B;  1PGX A;  2KQ4 X;  4IKG A;  1XCT L;  1EM7 A;  3CIR B;  1UWM A;  2D5G A;  1SEB D;  2J53 A;  1FXA A;  2INP E;  2JSV X;  2SEB D;  3Q8F A;  1B9R A;  2W3S A;  1VR9 A;  2HTM E;  2WXP A;  1KFY B;  4ZYS A;  2IGD A;  2PLP A;  1QF6 A;  2CJO A;  2AQ2 B;  1GB4 A;  1GOZ A;  1AW7 A;  2R61 A;  5MPO A;  2IGG A;  4MAC A;  1QKZ A;  2X38 A;  3LB8 C;  1SJE D;  4TQ0 A;  5G5G A;  3P4S B;  1KTK A;  2LFI A;  3FAH A;  3NUH B;  5FK9 C;  4KKI A;  4JWU C;  4IDI A;  2WXQ A;  3W5U B;  3J9C A;  2INN E;  4NAW B;  1ET6 A;  2N7J A;  2KAJ A;  1J7A A;  3TEW A;  4KGT A;  2QIE B;  1IBX B;  2Y5C A;  1FNU A;  1P7F A;  4RF0 A;  3EA6 A;  5HFY A;  3P63 A;  3ZQ4 A;  3R2T A;  5D7G A;  2G9H D;  3IAM 1;  4EE2 A;  1CQV A;  1NYR A;  1AWD A;  3NVV A;  3H8H A;  2NTT A;  2J52 A;  2WNM A;  3B2G A;  1KLG D;  1NEN B;  4YSX B;  2BS2 B;  2PVG C;  1ZUD 2;  2ZW0 A;  3AEC B;  1E10 A;  2DYM A;  4B0M A;  5H8Y E;  3AE2 B;  1HZ6 A;  1K50 A;  1BML C;  4UDU C;  3AB5 A;  2N9K A;  1K53 A;  2I38 A;  3ZJU A;  3GB1 A;  3VR9 B;  3P42 A;  1STE A;  1SF0 A;  2WU5 B;  2SAK A;  2M56 B;  5D3D A;  1I4R A;  3I57 A;  1PGA A;  1RYJ A;  1WRI A;  3DWM A;  4N6E B;  5D3I B;  1IBX A;  3AEG B;  1F0Z A;  4OHJ A;  4IOI E;  1SE2 A;  1QOA A;  1D5X C;  1IGD A;  2V3P A;  3TEX A;  4HRS A;  1F2R I;  2EKI A;  1V1P B;  4TSS A;  1C76 A;  3AE1 B;  2GI9 A;  1FM0 D;  1N63 A;  4ARI A;  2Y3A A;  1TKY A;  5TSS A;  1FFU A;  4N58 A;  1ZPS A;  1TS5 A;  3IAS 1;  5EE0 A;  3NZ3 A;  3Q8E A;  3VRB B;  3Q8B A;  1T5X D;  1R7S A;  3MC0 B;  5C2T B;  1V1O A;  1MHH E;  4AQ7 A;  1ZOY B;  2PW9 A;  2Z8L A;  3NRZ A;  2IGH A;  1UWX A;  4NZL B;  2W82 A;  1CJE A;  1QOG A;  2PKO A;  2J42 A;  3T3O A;  1HQR D;  4RF1 A;  1YMH E;  3P4Q B;  3W1S A;  2BS3 B;  2WDV B;  2JX5 A;  1ROE A;  5LNK 1;  2M0A A;  4ZOH C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...