1YN5A

Crystal structures of eap domains from staphylococcus aureus reveal an unexpected homology to bacterial superantigens
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
103
structure length
103
Chain Sequence
AKEMQNVPYTIAVDGIMAFNQSYLNLPKDSQLSYLDLGNKVKALLYDERGVTPEKIRNAKSAVYTITWKDGSKKEVDLKKDSYTANLFDSNSIKQIDINVKTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EapH2
publication title The Crystal Structures of EAP Domains from Staphylococcus aureus Reveal an Unexpected Homology to Bacterial Superantigens.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Unknown function
total genus 29
structure length 103
sequence length 103
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03642 MAP MAP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1yn5A00
1L0YB 1TY2A 1YN3A 4ZYSA 4RGNA 1B1ZA 3EA6A 1UUPA 1I4HA 4C56C 1M4VA 1STEA 1JCKB 2IPKD 2NTSA 3GP7A 5D3DA 1F77A 2NTTA 1SBBB 1EU4A 1FNUA 3MFGA 1YN4A 1ET9A 5I4DA 3O13A 1V1PB 1I4XA 1EU3A 3MC0B 1V1PA 1SEBD 1FNVA 1TS5A 1KLUD 3BVGA 1JWSD 3BVMA 3R8BA 3W2DA 2XNAC 1ET6A 2SEBD 1SJHD 3R2IA 1JWMD 1DYQA 4RH6A 1YN5A 2R61A 4RGMA 1EWCA 4DXGA 1TS4A 2Z8LA 1I4RA 1D5ZC 3R2TA 4RGOS 2AQ1B 1BXTA 2TSSA 2G9HD 5D3IB 1KLGD 3SEBA 1PYWD 2QEJC 1D5MC 1T5XD 1UNSA 2QILA 2IJ0A 3OWEB 4RCOA 4UDUC 1SXTA 1TS3A 2XN9C 1KTKA 2AQ3B 1HQRD 1CK1A 1AN8A 1SE2A 5FKAC 4OHJA 1L0XB 3BZDB 1LO5D 1TY0A 2ICIA 3BYYB 5FK9C 1ESFA 3KLSX 3BVZA 4RFBA 1TS2A 1JWUD 1SE4A 1CQVA 3TSSA 2AQ2B 1I4PA 1SE3A 1XXGA 1D6EC 3BYTB 3URYA 1V1OA 4DXFA 1I4QA 2J4XA 1QILA 5TSSA 1HA5A 1SJED 2RDGA 1D5XC 3V05A 1AW7A 4TSSA 1ENFA 2RDHA 1FNWA 4RGTA 4NZLB 1GOZA 1HXYD 1I4GA 4O1NA
chains in the Genus database with same CATH superfamily
1TY2A 5AZHA 2AEHA 3L08A 3H7PA 3QC8B 3EUB2 4H2AA 2MP2A 1XD3B 2FCNA 2M4NA 3DDCB 4A20A 1J7BA 2Z59B 3PLUA 1WJ4A 2IZVB 2BYEA 3OJ3A 1VZ7A 4MEMA 2KTRA 3QX1A 2FCMA 4YTMB 4GDKB 1WSPA 5FR6A 1N63A 4P1CC 1QT9A 1IP9A 5DPSA 2GBNA 4BZAA 5DPRA 3VUXA 1E9MA 2BBCA 4JWUC 1V81A 4WQOB 2WXGA 3ZJTA 3AE7B 4KIKA 3RPFC 2GB1A 1EO6A 4RH6A 4IG7B 4EUTA 2VH1A 4PYZA 2L00B 3Q3JA 1QKZA 3Q3NC 4MH0E 4AP4C 2INNE 3N9YC 4C7YA 4C4VB 3P4QB 2KQSA 1C4PA 3RNBC 3AM9A 2INDC 5IO9A 2OJRA 3AN1A 4PT5A 2AQ3B 1KFYB 1I7HA 1SE2A 2N9PC 4IM2A 2QC8A 2WXQA 2FE8A 2D5GA 1SIFA 2ICIA 5G5HA 4K7UA 3Q2AC 3AEGB 5IN7A 2KKCA 3HVZA 1YQ4B 2AQ2B 2KN4A 2D11A 1D3ZA 2MLBA 4A55A 3OLMD 3FILB 3KYCD 3L4PA 2DHZA 4P7IA 3V05A 1IBXB 2KJHB 2KDEB 2LASA 2QJLA 3CIRB 2J53A 2RDHA 2BPSA 2Q5WD 1HXYD 1I4GA 3UGBB 3NOBA 2VZKB 2MW5A 3H7SA 1YN3A 2MHJA 1C4AA 1Z5SB 1F2RC 4MGIE 3NZUA 3TCAA 1ZKHA 2N1WA 4KSLC 1UUPA 2WXRA 1FIQA 4KV2A 4DHJD 4M02A 1QQRA 1ZXHA 5JXVA 5HG2A 4II3B 4TUUA 2IPKD 3JW0X 5DPTA 3L10B 1T3QA 3X0WA 2KWUB 4KZ0A 3VVWB 3MC0B 1L7YA 1SEBD 1FNVA 4HEA1 1U4AA 1AWDA 3OG5A 3QCAA 2W9NA 1WFYA 3TMPB 4C00A 5IOIA 3ZNHB 4US8A 2W55A 1EF1A 2JZPA 2CKHB 1VRAB 2WX0A 2DLBA 4KDLB 2KMAA 1FD6A 2LGDA 4IUMB 4EE2A 3QWZB 2D10A 2YEPF 4RM9A 1UGJA 3L54A 3H1UA 4IWOA 3RYTA 3PHXB 4DXAB 2MWSB 3AE9B 2EMSA 1WM2A 2RR9A 4WJOA 2MQJA 3BY4B 5LLIA 1E7PB 1CZPA 4WJQA 2AX5A 1P1AA 1TS2A 1A70A 3U2SC 2PVOD 1K8RB 3AE8B 4LK0M 1SGHA 1YJIA 2J0MA 3RMKC 1V1OA 3URYA 2BWES 3SFEB 1MHXA 3L16A 3P1MA 1HA5A 3RN9C 5DPWA 1ISNA 3GE8C 4W9CA 1GJZA 2K25A 3JVZX 3W5VB 1IGDA 4US9A 5JZEB 4PYUA 1HZ5A 2O2VB 3PZDA 1OEYA 5HHDG 1MG8A 2HJ8A 4NJ6A 1MPEA 2AL3A 1UWXA 5BYRA 1WYGA 3Q8AA 2WXJA 2KVZA 2NTSA 2PTLA 1VCBA 1WXAA 4YWGG 3NZSA 5L95C 3ML8A 1EM7A 2QSDA 3GS2A 5I4DA 5G55A 3EECA 1I4XA 4BKTA 3ENEA 3L13A 1F0ZA 4C4VA 3ALBA 3UQAA 3NHEB 4IM3A 4F7ZA 2OHFA 2Y3AA 1R4MB 2K5PA 2LGIA 1JWAD 2LJ5A 3QAQA 3P2BA 3ABVB 3N3KB 4EEWA 4UDUC 1WGGA 2ACZB 3QQ8B 1SXTA 3NVZA 4YSYB 1AN8A 2WXHA 3EGRA 2L0TA 4Q2JA 1EUVB 2PW9A 2IO3B 2LXCA 2FBWB 2H89B 2BKFA 2D3AA 5BO4B 1FFVA 2ZPYA 1TT5B 4WIPA 3GOEA 2LGSA 4FA6A 3UINB 1MVKA 1XQQA 1YD8U 5E6NA 1WX8A 1V5TA 4MJSB 1WX9A 4C80A 1E6EB 3M95A 4FBJB 1Q0WB 2GOWA 1UELA 4S17A 4NZLB 4OZBA 5AUKA 4USAA 3Q14C 4MGYE 1HTOA 1K52A 5IP4D 2BB6A 4BBNC 1VLBA 3KQ4A 1Q1OA 2C60A 2RSUA 2AL6A 2FCQA 3ZYYX 1PGBA 3IT6B 1C79A 4DHZB 3UIPB 1FCCC 1MHHE 3EHVA 5E6PA 2QHOA 2GBRA 2WQYB 2BYFA 3BK1A 3V61A 1Q5WB 2N9XA 4E74A 1QZEA 1RFAA 2O6VA 2WXLA 5E6OA 1QLBB 4CHKA 4AQ7A 1BUIC 3BVMA 4HRSA 2WDVB 5G5GA 2KK8A 1F1HA 5D94A 1FM0D 1UBQA 3DBHB 2D07B 4CQNA 3DHIC 4ZRKA 4MT5A 1V5OA 2N7EA 3Q3OC 2D3GA 1FEHA 4M0WB 2L32A 2TSSA 3KWLA 4FHKA 1E7VA 1KLGD 4A6QA 3PO0A 2QEJC 1UNSA 3JSVA 4DBGA 1JW9D 3M62B 3QHTA 3AE2B 2J0KA 3P4PB 3DHHC 4GDLB 2BB5A 5FKAC 4OHJA 1KOTA 3BZDB 5GXGB 2WP9B 1JMLA 2IGGA 2KYWA 2JT4B 4BKSD 1C9FA 1WF9A 1DOXA 4RM8A 4AJYB 3PLVA 4WH4A 2ZNVB 4IW0A 3AEAB 4BOZB 3BWUD 3NRZA 1QOGA 2HE7A 1RM6C 2A4ZA 2M56B 1D5XC 3VTUA 4CO7A 1WI0A 2KC2A 1ZPSA 4J3OD 5CHVC 3Q3MC 2NS5A 3Q8FA 2WXIA 5H92C 4GMVA 3AEBB 4IDIA 2JU6X 3W5UB 4OVUA 2MCNB 2WLBA 1GUAB 4BBNF 4NNJB 4JQWC 3AEEB 4RF0A 1P9DU 3SFDB 4D2KA 4F1SA 3BK2A 3ZO5B 1T0QC 3KUZA 4HPPA 2ON8A 2PIAA 2RPVA 1TGZB 1J19A 4MDKE 2L7RA 3VUYA 1ET9A 2KLGA 4IWQA 4LNOA 2D3CA 2JQRB 2K22A 4P1BC 3ONSA 3ZW3A 4ZRQA 2EELA 2KAJA 3B9JA 4N9F4 1WZ0A 1DGJA 4N59A 4ICVA 1JWMD 1HE8A 1K53A 2PLPA 4JX1C 2YEPB 4EZKA 5MPOA 5JHAA 3NUHB 3ECIA 4FN2A 4FULA 4ANXA 3SEBA 1F9JA 4HPLB 4J6IA 2W3SA 4YTNB 3VR9B 1CK1A 1L0XB 3U7DA 3A33B 2G4DB 1VDVA 4K7WA 4GLSC 3L0WB 2R2QA 2C7NB 2IDYA 5IA7A 2RGFA 4HCPB 2GMIC 2M1MA 2LVPA 4KSKC 4LJPB 4DXFA 1TYGB 3Q69A 4BOSC 1OFFA 4XGAB 5L83A 3A4SC 3APFA 2QIEB 4IC7B 4BFRA 1OQRA 4RNAA 2V4IB 4XDDA 2WXPA 2W54A 1GG3A 4W9EA 3J9CA 4C7ZA 3DBSA 5AEKB 2HTHA 3TEYA 2MEKA 5GMVA 2ZNVC 2BKRB 3Q3FA 1SF0A 3A4RA 2LVQA 2KWVB 2LHDA 4FLHA 4ANUA 4JWSC 4WJPA 1YNTE 3W1SA 1S3SG 4OVZA 2K1FA 2UYZB 1V97A 4A8XC 4KDIC 1MG4A 4YXDB 2FAZA 2N9LA 3NZ3A 1WYWB 4NAWB 3ZIMA 1UWMA 2IBIB 3N1ZC 4LNFA 4GDLA 2KTFA 2SEBD 4LCDE 4KKJA 4AWJA 1QOAA 4GU2A 2ZW1A 4HJGE 4K3BA 3AH7A 3HVDA 3DBLI 3NY5A 1YIWA 2LUMA 3OWEB 3GB1A 4MM3A 1HZ6A 1E5WA 2N0SB 2WU2B 1LO5D 2NBUA 1C78A 4ZDVA 2FUHB 5J18A 5CHFA 4ITKA 3A9JB 4RFBA 3ZJVA 3MJ5A 4KX6B 2L1AA 5EDSA 3RI7C 1RWSA 4R3DA 2IO1B 2LI5A 2WXNA 1P98A 1N6ZA 1ZDXA 2N9EB 1E10A 4DQOC 3VRBB 3TIXA 2QCZA 3VRAB 1XT9B 2KLCA 1RRBA 1FXTB 4YSZB 1L2NA 2JZ3B 1WGKA 2JYTA 1TZ1A 4W9LA 1ZDVA 4B95A 2V3SA 4RGTA 4ANVA 4MSMB 1XEEA 3RZWC 2IY1B 3T3OA 1AARA 1WXSA 2ZCBA 2B3AA 3AE6B 1FO4A 2WXOA 2BYVE 2WDTB 4LLGM 1KLVA 4HPMB 3LXFA 3P4SB 5EE0A 3V6CB 1MFWA 1TBEA 2B76B 1BT0A 2C7HA 2KWCA 2KXJA 1V1PB 3C19A 3TJPA 3Q8EA 2C5LC 4WWPA 1FRRA 1UBIA 3WCQA 2KFKA 3PHWB 1KLUD 1L6VA 1LGRA 4DHJB 3PS6A 1F52A 4MACA 1DYQA 3Q8CA 1UGMA 4DXGA 3HM6X 1PQSA 1WE7A 2LGYA 4AUQC 1FXAA 3RZFA 5AUIA 1BXTA 2DBYA 4II2B 2DZMA 1L4ZB 3AE4B 2Y5CA 2GI9A 4W9IA 2XN9C 3OJ4B 3WIMA 3ZNID 5JHBA 2IYDB 2QMTA 3KW5B 3A1QB 3E9SA 2DWQA 2DYMA 3AEFB 1ESFA 3BVZA 3UIOB 4OW0A 3ZLZA 3TSSA 3CF6E 1HTQA 2JWUA 2C7MB 1JROA 3GZNB 3VDZA 4PK1A 4ARCA 2RDGA 4TV3A 4P6VF 2NBVB 4TSSA 3I3TB 3IBEA 1L0VB 3ZKJC 1R4NB 1C4CA 1Y56A 4EFOA 2O6VD 2L76A 4OZCA 1WX7A 4NAWA 2JSVX 3PGEA 4FXCA 4B9KA 3GE3C 1GB1A 2Y5PA 2ZCCA 4W9DA 1P7EA 3N1XC 1V9JA 2W82A 2BTEA 2C9WB 1IYFA 3W9CB 4GDKA 2FNJB 2IO2B 4KZCA 2ZW0A 1LXDA 4AOFA 4W9GA 4LNNA 3NS8A 1KJTA 3LYYA 4PS8A 2AYOB 3TUOA 3WAPA 2WDQB 5BYSA 3BVGA 3RCZA 2KX3A 1ZOYB 3IXSA 5CHWA 2D3BA 1ET6A 4LDTD 2OEDA 3D32A 3RNCC 4F8CB 5G2NA 2DAJA 3I9V1 1XLQA 2VRRB 3Q8BA 3WA0A 1ROEA 4JL9A 3H6NA 2MBEA 1ZUD2 3SU8X 1T5XD 1OQQA 2KX0A 1KTKA 1HQRD 3VR8B 3ZVVA 3N32A 1TJEA 2I1KA 4M01A 4XDCA 2HTME 2XK5B 2NBWB 1V49A 3RULA 2CS4A 2CU3A 1LFDA 2IGHA 4L2YA 4YL8A 3KWVA 1QILA 5TSSA 3FILA 4XWTA 1WGYA 4NQLB 3KVFB 3AB5A 1AW7A 1OTRB 1IBXA 4XWWA 5FR3A 2N7JA 4ZRJA 2PKOA 3QA8A 4TMAB 4M8MA 3P42A 3IHPC 1N60A 2NR2A 1GB4A 2CHWA 1TKGA 1JCKB 4W9FA 2JZZA 4MSQB 3K9PB 1OGWA 4MGKE 2NTTA 2UU7A 3MHZA 4ARIA 4OVVA 1YN4A 2DZKA 3O13A 3APCA 1NEKB 2MBQA 3R7RA 1WIAA 2WDRB 3P4RB 4OZAA 1E8ZA 3APDA 1FXIA 5AZGA 4XX5A 4ZHOA 2LVOA 1WGDA 4HJKA 1SSNA 1JQ4A 4KGSA 4DDID 3A1QA 2V4LA 2LRWA 1PFDA 4NY0A 3AULA 3U8ZA 3AU5A 2MBHA 2KT7A 1C77A 3DBRB 3H9DA 4G50A 2BGFA 4EOYA 1WMHB 4DK5A 1E7UA 5CTRC 4JE3B 3I57A 1V6EA 1WJUA 2QDFA 3U30A 2JPHA 3IVFA 2I1JA 4ZYNA 3JYUA 1C76A 1AYFA 2GLSA 3W1YA 1EWYC 3DCGA 3IAM1 3UF8A 3TEZA 4HKQA 2LRUA 2JVCA 2WXFA 2CHXA 1WRDB 1FNWA 4HK2A 2L05A 4LNKA 3PTFC 3H7PB 2O2VA 1E8WA 1P0RA 2PE9A 2JRHA 3VXWA 2JY6A 3NG0A 1M4VA 2REXA 2KTRB 1KF6B 2JWZA 1YJ1A 3A9KB 3DHGC 5T8IA 1ZXIA 2M19A 4B0MA 3U4EG 4HCNB 4ZOHC 1NYRA 2KVRA 4K1RB 2E3TA 1G6JA 3FKYA 5C2TB 4B6WA 3B08A 2DYOA 1WWTA 2LD9A 4KIKB 1V80A 2WU5B 1N5XA 4ZHPA 1FPYA 4KGRA 4EZLA 3ETRA 4JPSA 1VR9A 1V8CA 3LB8C 4NJ7A 3M3JA 3DVNU 2LJIA 3L17A 1LM8B 1WH3A 2GBJA 2G4SA 4PS7A 3C8YA 4KVGB 2G3QB 3RT3B 4EKUA 2KMMA 3X23A 4JGHB 3NVVA 3PSEB 2V1YA 1MI0A 2BS4B 1TIFA 2JXXA 2KDMA 3TL5A 3ZTDA 4ACFA 1YQ3B 3AE1B 2K39A 2MJ3A 4LNIA 1EF5A 1P7FA 1JWUD 4W9JA 2J52A 1CQVA 1IUEA 4FJVB 3ZNZB 1XXGA 2ZVNA 3U52E 4GB9A 1J8CA 2ZVOA 5LNK1 4MJSA 3B0AA 2MH7A 1KRHA 2IGDA 3O65B 1ENFA 1E8XA 1QOFA 1QOBA 4WWNA 1YQBA 2I38A 1K51A 3VFKA 3ZQ4A 1L0YB 3EFUA 3T8MA 1XLNA 1ZE3D 4ZYSA 1N5WA 1T0SC 1B1ZA 3RNAC 3NVYA 5J17A 4WWMA 1PUTA 2WWZA 4I6PA 2PEAA 2KNBA 4YSXB 4C56C 4JIOU 3HIZA 3GP7A 4ZRIA 2NVUI 2EKIA 1SE9A 2N7DA 1EU4A 1FNUA 5IKCM 1BMLC 4K81A 2J7QB 1OEYJ 3TBLD 3FAHA 2M0XA 3SR6A 2Y5BB 1H8CA 3OAWA 1JWSD 1ZP0B 3SD5A 2WXKA 3R8BA 2KDBA 2XNAC 2ZJDA 1CMXB 2R61A 1OQYA 2JYEA 4A9AA 2NMQA 4RGOS 2BS2B 4DDGD 3AI5A 4M0WA 2KN5A 4GOCA 2JRIB 1D5MC 3AXCA 3QJZA 1UZXB 2BS3B 2WHIA 4FHJA 4W9HA 4G3XB 5D2MB 3B2FA 2GBMA 4MH8A 3IAS1 3PRPB 2ZPNA 2JF5A 3DVGY 1ZGUB 1F2RI 2KZRA 2ONQA 3PVLA 4QAYA 4XYCA 1RYJA 1GPXA 1SJED 4I6LB 4HDQA 3MJWA 3CWIA 1YJJA 3A9KA 2L8JA 1FMAD 3ZRCA 4GGQA 5EE1A 3Q6BA 1XLPA 2V3NA 4RGNA 1JRPA 3WAMA 5E6JA 3ZRFA 3DOWA 2KWDA 4WURA 1RFKA 3K9OB 4HROA 2LFIA 3EC8A 4E3CA 3IG3A 1WRIA 4L23A 5C3JB 5LXHA 4DWFA 2KMCA 1VZ6A 2L52A 3ZDMC 3R66C 2IO0B 3PV1A 5BMGA 2M0AA 5IAAC 3AECB 4P16A 3AEDB 1JRUA 5D6JB 2AWTA 5TR5A 4BAXA 1TS5A 1T0YA 4GSWA 3MP9A 2CR5A 2K8CA 4X57B 1H4RA 3V62A 5BYQA 2VH2A 3N20C 4N6EB 2DNFA 1SJHD 3R2IA 3VH4B 2KC1A 2Z0EB 5BMHA 2JXTA 3LJ3A 4RGMA 3MC9A 1D5ZC 3ZNGC 4WJNA 1C3TA 3V3XA 3KH0A 3MTNB 2YVCA 4GN1A 3ZUNA 2DX5B 4RCOA 1NENB 4FJZA 1L5PA 1J7CA 2YLMA 5EE3A 2K9XA 1C1YB 2KOXA 4A3OA 4EZJA 4IM0A 3BYYB 5FK9C 3KLSX 2LGXA 3AU4A 5AZFA 1QF6A 2VZKD 2WNMA 2EMTA 1CJEA 2BT6A 3VAWA 1NYQA 1RAXA 1JWBD 2M17A 4ICUA 1I4PA 3T9LA 2ZZPB 3RD2A 1D6EC 3BYTB 2L83A 3TEXA 4XC2A 3T3NA 3IT4B 1V86A 2XEWA 1TZOA 1PGAA 2MA9B 1I35A 4BVUC 2KO3A 4MGZE 2A5UA 1GOZA 2BW2A 2CJNA 2KJ6A 4O1NA 2L0FA 2JUOA 3CSFA 3UI3A 3EA6A 1M94A 1J0GA 3ZJUA 3P63A 1WR6E 3I63C 1PGXA 2FUG1 3NS1A 5LXIB 4WAAA 1WM3A 2V3PA 4HKZE 3MFGA 3KUDB 4KGTA 1SIJA 1FCLA 2LHEA 1DOYA 1EU3A 2O6VB 5DCNA 1UF0A 3AE5B 1T6BX 5HKHA 2M8SA 1I42A 2H88B 4RF1A 2KQ7A 1YOVB 1XF5L 2J0JA 2RDBC 5JH5C 2KQ4X 4N58A 2KACA 4NAMA 1ZW7A 2PPHA 3I5JC 2RPQA 5BMIA 3B1LX 2INCC 3AE3B 3JSVB 2MBOA 1PYWD 2QILA 3H8HA 2DZJA 2KANA 3GZNI 1DOIA 1N62A 1WXMA 2MRPA 4LDTB 2ZEQA 3PT2B 1WJ6A 3WANA 3R3MA 3DQVA 3DWMA 3A9JA 2PJHA 1R4NI 1KH0A 2V9HA 3DVGX 2MJEA 2FIDA 1SE3A 2J4XA 2V0GA 5D7GA 4HVBA 3HK0A 4M00A 2I2YA 3ZXRA 4KKIA 1JALA 3TEWA 3B2GA 3RNEC 1ACCA 1UD7A 1WGHA 4I6NB 2OJWA 4URKA 1STEA 4LTUA 3M63B 5D3DA 1F77A 2WGSA 4LJOB 1SBBB 1GC6A 2HDEA 1Y8RC 3V6EB 2NCNA 1E0ZA 3ZDTA 1V1PA 1GAQB 3EFCA 2GRIA 2GBKA 3HM3A 2NPTB 1WR1A 3PZ8A 3IFWB 3W2DA 4GIVA 2HJ1A 3PZ7A 2HD5B 2K8BA 2K0PA 3NVWA 3WALA 1EWCA 4ASWC 1TS4A 4A3PA 1I4RA 2R2OA 4G11A 2DENB 1R4MI 1FFUA 4G0NB 1WXQA 2AQ1B 3DPDA 3PRZA 2UWQA 3MHSD 4AJWA 1J7AA 2OOBB 4E71A 5J2RA 1TS3A 4WQMA 4WAFA 4IOIE 1L4DB 2LWPA 2K6QA 3MC8A 2PMVA 1IGCA 4IKGA 4K3CA 2SAKA 3DWGC 4YTPB 2WYQA 3AMZA 2JX5A 1SE4A 2MX2A 2LUEA 4AS1A 2WXMA 3PPAA 1I4QA 2KHWB 1NBFC 1YX5B 1YMHE 1L6UA 3N1YC 2X8XX 3V60A 1TTNA 1B9RA 3LDZE 4HXDA 4XE0A 3NJTA 1XO3A 1VJKA 2W3RA 1NVID 1E90A 1I4HA 4HWIB 4BKGA 4DHZE 2BYTA 2FCSA 4M8NA 4PS3A 3VTWA 4MELA 4CYEA 1PDXA 1R7SA 1WZ3A 4YT0B 5H8YE 3FC4A 2WX1A 2MP2B 2WS3B 1YX6B 2LXAA 2MJDA 2N9KA 2X38A 4WWOA 2KJRA 1N61A 1IPGA 1FRDA 4FJYA 1S1QB 2MSED 1RLFA 5KHOA 3ZXVA 3DBRI 1YN5A 2K8HA 3ZGZA 1TKYA 1VD2A 3DBHI 3RFZB 3R2TA 1Z2MA 3WAOA 4ZRPA 2DYBA 2K6DB 1SB3C 2BWFA 2MBBB 3PREA 4MM3B 4A90A 1VZ8A 2BQQA 2D2QA 4NJCA 4RMAA 3S2AA 3VUWA 2EKEC 1NI2A 2LZ6A 2Z0DB 2XK5A 2G45B 4NPNA 1V2YA 5C1ZA 1NDDA 2RMMA 3KYDD 3VTVA 1T0RC 1X1MA 3QARA 1WJNA 2BF8B 2BVCA 2KD0A 3BINA 1WXVA 3CMMB 2RD0A 3SHQA 1WY8A 2J42A 1UH6A 2ASQA 2DZIA 4FADA 3HUIA 2KDFB 1LQBA 2CU1A 3HHMA 2CJOA 4HDOA 4GXBA 4W9KA 2E6XA 3PRMB 2G1EA 2NPTA 4HLEA 1P3QU 3QK0A 3SDLC 4XZ4A 3HRDD 1TKEA 4ANWA 2KFJA 1WGRA 1WE6A 5C23A 2KFKB 3ZTCA 2DAFA 3VH3B 1XCTL 1XLOA 3RNFC 1GNUA 5KHQA 1MJDA 5HFYA 1HEZE 2LEKA 3CSTA 4IWPA 4B0EA 3DVNV 3VQIA 2Z8LA 4TKNA 1GC7A 3E56A 3W1SC 2LMCA 2N4FA 2G9HD 4REZA 5D3IB 1NI3A 3UQBA 2K3UA 3ML9A 1K50A 2IJ0A 3RNGC 2IY0B 4NQKE 3R7QA 2INPE 3AV8A 3C0RB 4TQ0A 2KDIA 1TY0A 2XBBC 1A5RA 1WMHA 1D4BA 3U7ZA 3DBLB 5CX3A 3QIJA 1XCQL 5HI1A 3RUIB 3VHTC 4TQ1A 2FIFA 4K7SA 4S0RA 3N30A 2CHZA 1Q10A 4JLCA 2PVGC 5EE9A 3KUCB 3BIID 4BKSA 1KM7A 2PE6B 1E8YA 2N1VA 4L1BA 2L3ZA
chains in the Genus database with same CATH topology
1TY2A 2PKOA 2WLBA 3UI3A 3EUB2 4H2AA 3AEEB 3EA6A 4TMAB 4RF0A 1J7BA 3P42A 3ZJUA 1N60A 3P63A 1GB4A 3SFDB 1TKGA 4D2KA 3BK2A 1JCKB 1VZ7A 1PGXA 2FUG1 3NS1A 4YTMB 4GDKB 2NTTA 1WSPA 2ON8A 3MHZA 2PIAA 2V3PA 1N63A 2RPVA 4HKZE 4ARIA 3MFGA 4KGTA 1SIJA 1YN4A 1FCLA 1QT9A 1ET9A 2LHEA 3O13A 1DOYA 1EU3A 1E9MA 2JQRB 2BBCA 4JWUC 1NEKB 2K22A 2WXGA 3ZJTA 2WDRB 4ZRQA 3AE5B 1T6BX 3P4RB 2EELA 4OZAA 2KAJA 3B9JA 3AE7B 1FXIA 1DGJA 4N59A 3RPFC 2H88B 4ZHOA 2GB1A 1JWMD 4RF1A 1SSNA 1K53A 4RH6A 2PLPA 4JX1C 1JQ4A 4KGSA 1XF5L 2YEPB 5MPOA 2KQ4X 4N58A 1PFDA 1QKZA 2KACA 2INNE 4NAMA 3N9YC 3NUHB 4C7YA 5BMIA 3P4QB 1C4PA 3AM9A 3AE3B 3SEBA 1PYWD 3AN1A 1C77A 2QILA 3H8HA 4PT5A 2W3SA 2AQ3B 1KFYB 1I7HA 4YTNB 3VR9B 1CK1A 1SE2A 1L0XB 2WXQA 1DOIA 1N62A 2FE8A 2D5GA 2ICIA 5G5HA 1VDVA 3DWMA 4GLSC 4JE3B 3I57A 3AEGB 1KH0A 2IDYA 3HVZA 1YQ4B 2MJEA 2AQ2B 1SE3A 2KN4A 4A55A 3FILB 4DXFA 1C76A 1AYFA 1TYGB 2J4XA 3Q69A 2V0GA 5D7GA 1OFFA 3L4PA 1EWYC 3IAM1 3TEZA 4HKQA 3V05A 1IBXB 2QJLA 2WXFA 2QIEB 2I2YA 3CIRB 2J53A 2RDHA 1OQRA 1FNWA 2Q5WD 1HXYD 1I4GA 4KKIA 1JALA 2V4IB 4RNAA 3TEWA 2VZKB 2WXPA 4XDDA 3B2GA 2W54A 1YN3A 1ACCA 1C4AA 1F2RC 3J9CA 4C7ZA 3TEYA 1UUPA 2WXRA 2MEKA 1FIQA 1QQRA 1M4VA 1ZXHA 1STEA 5HG2A 5JXVA 1KF6B 1SF0A 4LTUA 2IPKD 5D3DA 1F77A 2LHDA 5T8IA 4JWSC 1SBBB 1T3QA 1YNTE 1ZXIA 2M19A 3U4EG 2HDEA 3W1SA 4ZOHC 4B0MA 1NYRA 4OVZA 1V97A 4A8XC 2E3TA 4YXDB 3MC0B 1E0ZA 5C2TB 1V1PA 2N9LA 1GAQB 1FNVA 1SEBD 4HEA1 3NZ3A 2GRIA 2DYOA 1AWDA 4NAWB 1WWTA 1UWMA 2WU5B 1N5XA 3PZ8A 4ZHPA 4US8A 2W55A 3W2DA 4KGRA 2JZPA 3PZ7A 1VRAB 3ETRA 2SEBD 1VR9A 2DLBA 4JPSA 1V8CA 3LB8C 4KKJA 2K0PA 2LJIA 3NVWA 1QOAA 1FD6A 1EWCA 1TS4A 1I4RA 4EE2A 2ZW1A 1FFUA 4HJGE 1WXQA 2AQ1B 2YEPF 3AH7A 3C8YA 3HVDA 2KMMA 1UGJA 1J7AA 2LUMA 3OWEB 3GB1A 1TS3A 4WQMA 4WAFA 1HZ6A 3NVVA 4IOIE 3AE9B 1L4DB 2N0SB 2WU2B 1LO5D 1MI0A 2PMVA 1C78A 1IGCA 2BS4B 4IKGA 2SAKA 1E7PB 2KDMA 4ITKA 1CZPA 1YQ3B 2AX5A 3DWGC 4YTPB 3AE1B 4RFBA 3ZJVA 2MJ3A 3AMZA 1P7FA 1TS2A 1JWUD 3MJ5A 1A70A 2JX5A 1SE4A 4KX6B 2L1AA 2J52A 3U2SC 1CQVA 1RWSA 1IUEA 4R3DA 2PVOD 3AE8B 4LK0M 4AS1A 2WXNA 2WXMA 1XXGA 3U52E 1YJIA 1ZDXA 1V1OA 3URYA 1E10A 1I4QA 4DQOC 3SFEB 1MHXA 3VRBB 3P1MA 5LNK1 1HA5A 3VRAB 1YMHE 4YSZB 1L6UA 3W5VB 1WGKA 2JYTA 1ZDVA 2MH7A 1KRHA 2IGDA 1IGDA 1ENFA 4US9A 1B9RA 1QOFA 1QOBA 4RGTA 1HZ5A 5HHDG 4XE0A 2I38A 1K51A 3ZQ4A 1XEEA 1L0YB 3T3OA 1XO3A 1XLNA 1ZE3D 4ZYSA 1VJKA 1N5WA 3AE6B 1FO4A 1B1ZA 3NVYA 2W3RA 4WWMA 1NVID 1PUTA 1MPEA 1I4HA 1UWXA 5BYRA 2WXOA 1WYGA 3Q8AA 4YSXB 4C56C 4LLGM 2BYTA 3LXFA 3P4SB 2WXJA 5EE0A 2NTSA 2PTLA 3GP7A 2B76B 2EKIA 4YWGG 1PDXA 1EU4A 1EM7A 1FNUA 1R7SA 1BMLC 4YT0B 2QSDA 5H8YE 3FC4A 3GS2A 5I4DA 1V1PB 1I4XA 3FAHA 3Q8EA 3SR6A 1F0ZA 1FRRA 3WCQA 2WS3B 2MJDA 1KLUD 2N9KA 1L6VA 2X38A 1JWSD 1N61A 1FRDA 1ZP0B 2WXKA 3R8BA 2XNAC 2OHFA 2Y3AA 4MACA 1DYQA 3Q8CA 1YN5A 2R61A 4DXGA 1TKYA 3ZGZA 2JYEA 4A9AA 2K5PA 2NMQA 3RFZB 3R2TA 1FXAA 2BS2B 4RGOS 2LGIA 4ZRPA 5AUIA 4M0WA 1BXTA 1JWAD 2DBYA 1SB3C 3ABVB 1L4ZB 3AE4B 4MM3B 1D5MC 2Y5CA 2GI9A 4UDUC 4A90A 2ACZB 1VZ8A 1SXTA 2XN9C 3NVZA 2BS3B 4YSYB 1AN8A 4NJCA 2WXHA 3EGRA 2QMTA 4Q2JA 2PW9A 3B2FA 3E9SA 2DWQA 2DYMA 2FBWB 2H89B 3AEFB 1ESFA 3IAS1 3BVZA 4MH8A 1FFVA 4WIPA 4OW0A 2RMMA 3TSSA 1F2RI 2JWUA 2ONQA 1JROA 1MVKA 1RYJA 1GPXA 4C80A 1SJED 4ARCA 2RDGA 4P6VF 3CWIA 1YJJA 1E6EB 2J42A 4TSSA 1L0VB 4NZLB 4OZBA 5AUKA 1FMAD 1Y56A 1C4CA 3HUIA 4USAA 5EE1A 1XLPA 1K52A 2BB6A 2V3NA 4RGNA 1JRPA 2CJOA 5E6JA 1VLBA 2KWDA 3KQ4A 4OZCA 4WURA 1RFKA 4HROA 2E6XA 2LFIA 2JSVX 2G1EA 4FXCA 3ZYYX 1GB1A 1PGBA 2Y5PA 1WRIA 4L23A 5C3JB 3IT6B 1C79A 1P7EA 1VZ6A 2W82A 2L52A 1FCCC 2BTEA 1MHHE 5BMGA 3HRDD 1TKEA 3W9CB 2WQYB 2ZW0A 2M0AA 3BK1A 3AECB 4P16A 3AEDB 3LYYA 3TUOA 1TS5A 2WDQB 1XCTL 1XLOA 2WXLA 3BVGA 5BYSA 1QLBB 3MP9A 1ZOYB 4AQ7A 1BUIC 3BVMA 3IXSA 2WDVB 4HRSA 5G5GA 5BYQA 1ET6A 4N6EB 5HFYA 1SJHD 2OEDA 1HEZE 2LEKA 1FM0D 3R2IA 4CQNA 5BMHA 4B0EA 2JXTA 4MT5A 4RGMA 3VQIA 2Z8LA 3I9V1 1D5ZC 1FEHA 3E56A 1XLQA 3Q8BA 3V3XA 2L32A 2LMCA 2TSSA 1ROEA 3KWLA 2G9HD 4REZA 5D3IB 1NI3A 1KLGD 2K3UA 4A6QA 3PO0A 1ZUD2 1K50A 2QEJC 1T5XD 1UNSA 2IJ0A 4RCOA 1OQQA 1NENB 1JW9D 1KTKA 3AE2B 1L5PA 1HQRD 3P4PB 4GDLB 2BB5A 1J7CA 3VR8B 5FKAC 4OHJA 2INPE 5EE3A 3AV8A 3BZDB 5GXGB 2K9XA 4TQ0A 1TJEA 2WP9B 4XDCA 1JMLA 1TY0A 2HTME 2IGGA 1C9FA 3BYYB 5FK9C 1D4BA 2CU3A 3KLSX 3U7ZA 1DOXA 1QF6A 2VZKD 2WNMA 4WH4A 2IGHA 1XCQL 1CJEA 5HI1A 3AEAB 2BT6A 1NYQA 1JWBD 1I4PA 4TQ1A 4L2YA 1D6EC 3BYTB 3KWVA 2L83A 3BWUD 1QILA 3NRZA 3TEXA 1QOGA 3FILA 4XWTA 5TSSA 1RM6C 3T3NA 3IT4B 2M56B 1D5XC 1TZOA 3AB5A 1AW7A 1ZPSA 1PGAA 4J3OD 1Q10A 3Q8FA 2PVGC 1IBXA 2WXIA 5H92C 4XWWA 5EE9A 5FR3A 1GOZA 3BIID 2BW2A 2CJNA 4O1NA 3AEBB 4IDIA 2JU6X 4L1BA 2N7JA 3W5UB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L0Y B;  1TY2 A;  1YN3 A;  4ZYS A;  4RGN A;  1B1Z A;  3EA6 A;  1UUP A;  1I4H A;  4C56 C;  1M4V A;  1STE A;  1JCK B;  2IPK D;  2NTS A;  3GP7 A;  5D3D A;  1F77 A;  2NTT A;  1SBB B;  1EU4 A;  1FNU A;  3MFG A;  1YN4 A;  1ET9 A;  5I4D A;  3O13 A;  1V1P B;  1I4X A;  1EU3 A;  3MC0 B;  1V1P A;  1SEB D;  1FNV A;  1TS5 A;  1KLU D;  3BVG A;  1JWS D;  3BVM A;  3R8B A;  3W2D A;  2XNA C;  1ET6 A;  2SEB D;  1SJH D;  3R2I A;  1JWM D;  1DYQ A;  4RH6 A;  1YN5 A;  2R61 A;  4RGM A;  1EWC A;  4DXG A;  1TS4 A;  2Z8L A;  1I4R A;  1D5Z C;  3R2T A;  4RGO S;  2AQ1 B;  1BXT A;  2TSS A;  2G9H D;  5D3I B;  1KLG D;  3SEB A;  1PYW D;  2QEJ C;  1D5M C;  1T5X D;  1UNS A;  2QIL A;  2IJ0 A;  3OWE B;  4RCO A;  4UDU C;  1SXT A;  1TS3 A;  2XN9 C;  1KTK A;  2AQ3 B;  1HQR D;  1CK1 A;  1AN8 A;  1SE2 A;  5FKA C;  4OHJ A;  1L0X B;  3BZD B;  1LO5 D;  1TY0 A;  2ICI A;  3BYY B;  5FK9 C;  1ESF A;  3KLS X;  3BVZ A;  4RFB A;  1TS2 A;  1JWU D;  1SE4 A;  1CQV A;  3TSS A;  2AQ2 B;  1I4P A;  1SE3 A;  1XXG A;  1D6E C;  3BYT B;  3URY A;  1V1O A;  4DXF A;  1I4Q A;  2J4X A;  1QIL A;  5TSS A;  1HA5 A;  1SJE D;  2RDG A;  1D5X C;  3V05 A;  1AW7 A;  4TSS A;  1ENF A;  2RDH A;  1FNW A;  4RGT A;  4NZL B;  1GOZ A;  1HXY D;  1I4G A;  4O1N A; 
#chains in the Genus database with same CATH topology
 1TY2 A;  5AZH A;  2AEH A;  3L08 A;  3H7P A;  3QC8 B;  3EUB 2;  4H2A A;  2MP2 A;  1XD3 B;  2FCN A;  2M4N A;  3DDC B;  4A20 A;  1J7B A;  2Z59 B;  3PLU A;  1WJ4 A;  2IZV B;  2BYE A;  3OJ3 A;  1VZ7 A;  4MEM A;  2KTR A;  3QX1 A;  2FCM A;  4YTM B;  4GDK B;  1WSP A;  5FR6 A;  1N63 A;  4P1C C;  1QT9 A;  1IP9 A;  5DPS A;  2GBN A;  4BZA A;  5DPR A;  3VUX A;  1E9M A;  2BBC A;  4JWU C;  1V81 A;  4WQO B;  2WXG A;  3ZJT A;  3AE7 B;  4KIK A;  3RPF C;  2GB1 A;  1EO6 A;  4RH6 A;  4IG7 B;  4EUT A;  2VH1 A;  4PYZ A;  2L00 B;  3Q3J A;  1QKZ A;  3Q3N C;  4MH0 E;  4AP4 C;  2INN E;  3N9Y C;  4C7Y A;  4C4V B;  3P4Q B;  2KQS A;  1C4P A;  3RNB C;  3AM9 A;  2IND C;  5IO9 A;  2OJR A;  3AN1 A;  4PT5 A;  2AQ3 B;  1KFY B;  1I7H A;  1SE2 A;  2N9P C;  4IM2 A;  2QC8 A;  2WXQ A;  2FE8 A;  2D5G A;  1SIF A;  2ICI A;  5G5H A;  4K7U A;  3Q2A C;  3AEG B;  5IN7 A;  2KKC A;  3HVZ A;  1YQ4 B;  2AQ2 B;  2KN4 A;  2D11 A;  1D3Z A;  2MLB A;  4A55 A;  3OLM D;  3FIL B;  3KYC D;  3L4P A;  2DHZ A;  4P7I A;  3V05 A;  1IBX B;  2KJH B;  2KDE B;  2LAS A;  2QJL A;  3CIR B;  2J53 A;  2RDH A;  2BPS A;  2Q5W D;  1HXY D;  1I4G A;  3UGB B;  3NOB A;  2VZK B;  2MW5 A;  3H7S A;  1YN3 A;  2MHJ A;  1C4A A;  1Z5S B;  1F2R C;  4MGI E;  3NZU A;  3TCA A;  1ZKH A;  2N1W A;  4KSL C;  1UUP A;  2WXR A;  1FIQ A;  4KV2 A;  4DHJ D;  4M02 A;  1QQR A;  1ZXH A;  5JXV A;  5HG2 A;  4II3 B;  4TUU A;  2IPK D;  3JW0 X;  5DPT A;  3L10 B;  1T3Q A;  3X0W A;  2KWU B;  4KZ0 A;  3VVW B;  3MC0 B;  1L7Y A;  1SEB D;  1FNV A;  4HEA 1;  1U4A A;  1AWD A;  3OG5 A;  3QCA A;  2W9N A;  1WFY A;  3TMP B;  4C00 A;  5IOI A;  3ZNH B;  4US8 A;  2W55 A;  1EF1 A;  2JZP A;  2CKH B;  1VRA B;  2WX0 A;  2DLB A;  4KDL B;  2KMA A;  1FD6 A;  2LGD A;  4IUM B;  4EE2 A;  3QWZ B;  2D10 A;  2YEP F;  4RM9 A;  1UGJ A;  3L54 A;  3H1U A;  4IWO A;  3RYT A;  3PHX B;  4DXA B;  2MWS B;  3AE9 B;  2EMS A;  1WM2 A;  2RR9 A;  4WJO A;  2MQJ A;  3BY4 B;  5LLI A;  1E7P B;  1CZP A;  4WJQ A;  2AX5 A;  1P1A A;  1TS2 A;  1A70 A;  3U2S C;  2PVO D;  1K8R B;  3AE8 B;  4LK0 M;  1SGH A;  1YJI A;  2J0M A;  3RMK C;  1V1O A;  3URY A;  2BWE S;  3SFE B;  1MHX A;  3L16 A;  3P1M A;  1HA5 A;  3RN9 C;  5DPW A;  1ISN A;  3GE8 C;  4W9C A;  1GJZ A;  2K25 A;  3JVZ X;  3W5V B;  1IGD A;  4US9 A;  5JZE B;  4PYU A;  1HZ5 A;  2O2V B;  3PZD A;  1OEY A;  5HHD G;  1MG8 A;  2HJ8 A;  4NJ6 A;  1MPE A;  2AL3 A;  1UWX A;  5BYR A;  1WYG A;  3Q8A A;  2WXJ A;  2KVZ A;  2NTS A;  2PTL A;  1VCB A;  1WXA A;  4YWG G;  3NZS A;  5L95 C;  3ML8 A;  1EM7 A;  2QSD A;  3GS2 A;  5I4D A;  5G55 A;  3EEC A;  1I4X A;  4BKT A;  3ENE A;  3L13 A;  1F0Z A;  4C4V A;  3ALB A;  3UQA A;  3NHE B;  4IM3 A;  4F7Z A;  2OHF A;  2Y3A A;  1R4M B;  2K5P A;  2LGI A;  1JWA D;  2LJ5 A;  3QAQ A;  3P2B A;  3ABV B;  3N3K B;  4EEW A;  4UDU C;  1WGG A;  2ACZ B;  3QQ8 B;  1SXT A;  3NVZ A;  4YSY B;  1AN8 A;  2WXH A;  3EGR A;  2L0T A;  4Q2J A;  1EUV B;  2PW9 A;  2IO3 B;  2LXC A;  2FBW B;  2H89 B;  2BKF A;  2D3A A;  5BO4 B;  1FFV A;  2ZPY A;  1TT5 B;  4WIP A;  3GOE A;  2LGS A;  4FA6 A;  3UIN B;  1MVK A;  1XQQ A;  1YD8 U;  5E6N A;  1WX8 A;  1V5T A;  4MJS B;  1WX9 A;  4C80 A;  1E6E B;  3M95 A;  4FBJ B;  1Q0W B;  2GOW A;  1UEL A;  4S17 A;  4NZL B;  4OZB A;  5AUK A;  4USA A;  3Q14 C;  4MGY E;  1HTO A;  1K52 A;  5IP4 D;  2BB6 A;  4BBN C;  1VLB A;  3KQ4 A;  1Q1O A;  2C60 A;  2RSU A;  2AL6 A;  2FCQ A;  3ZYY X;  1PGB A;  3IT6 B;  1C79 A;  4DHZ B;  3UIP B;  1FCC C;  1MHH E;  3EHV A;  5E6P A;  2QHO A;  2GBR A;  2WQY B;  2BYF A;  3BK1 A;  3V61 A;  1Q5W B;  2N9X A;  4E74 A;  1QZE A;  1RFA A;  2O6V A;  2WXL A;  5E6O A;  1QLB B;  4CHK A;  4AQ7 A;  1BUI C;  3BVM A;  4HRS A;  2WDV B;  5G5G A;  2KK8 A;  1F1H A;  5D94 A;  1FM0 D;  1UBQ A;  3DBH B;  2D07 B;  4CQN A;  3DHI C;  4ZRK A;  4MT5 A;  1V5O A;  2N7E A;  3Q3O C;  2D3G A;  1FEH A;  4M0W B;  2L32 A;  2TSS A;  3KWL A;  4FHK A;  1E7V A;  1KLG D;  4A6Q A;  3PO0 A;  2QEJ C;  1UNS A;  3JSV A;  4DBG A;  1JW9 D;  3M62 B;  3QHT A;  3AE2 B;  2J0K A;  3P4P B;  3DHH C;  4GDL B;  2BB5 A;  5FKA C;  4OHJ A;  1KOT A;  3BZD B;  5GXG B;  2WP9 B;  1JML A;  2IGG A;  2KYW A;  2JT4 B;  4BKS D;  1C9F A;  1WF9 A;  1DOX A;  4RM8 A;  4AJY B;  3PLV A;  4WH4 A;  2ZNV B;  4IW0 A;  3AEA B;  4BOZ B;  3BWU D;  3NRZ A;  1QOG A;  2HE7 A;  1RM6 C;  2A4Z A;  2M56 B;  1D5X C;  3VTU A;  4CO7 A;  1WI0 A;  2KC2 A;  1ZPS A;  4J3O D;  5CHV C;  3Q3M C;  2NS5 A;  3Q8F A;  2WXI A;  5H92 C;  4GMV A;  3AEB B;  4IDI A;  2JU6 X;  3W5U B;  4OVU A;  2MCN B;  2WLB A;  1GUA B;  4BBN F;  4NNJ B;  4JQW C;  3AEE B;  4RF0 A;  1P9D U;  3SFD B;  4D2K A;  4F1S A;  3BK2 A;  3ZO5 B;  1T0Q C;  3KUZ A;  4HPP A;  2ON8 A;  2PIA A;  2RPV A;  1TGZ B;  1J19 A;  4MDK E;  2L7R A;  3VUY A;  1ET9 A;  2KLG A;  4IWQ A;  4LNO A;  2D3C A;  2JQR B;  2K22 A;  4P1B C;  3ONS A;  3ZW3 A;  4ZRQ A;  2EEL A;  2KAJ A;  3B9J A;  4N9F 4;  1WZ0 A;  1DGJ A;  4N59 A;  4ICV A;  1JWM D;  1HE8 A;  1K53 A;  2PLP A;  4JX1 C;  2YEP B;  4EZK A;  5MPO A;  5JHA A;  3NUH B;  3ECI A;  4FN2 A;  4FUL A;  4ANX A;  3SEB A;  1F9J A;  4HPL B;  4J6I A;  2W3S A;  4YTN B;  3VR9 B;  1CK1 A;  1L0X B;  3U7D A;  3A33 B;  2G4D B;  1VDV A;  4K7W A;  4GLS C;  3L0W B;  2R2Q A;  2C7N B;  2IDY A;  5IA7 A;  2RGF A;  4HCP B;  2GMI C;  2M1M A;  2LVP A;  4KSK C;  4LJP B;  4DXF A;  1TYG B;  3Q69 A;  4BOS C;  1OFF A;  4XGA B;  5L83 A;  3A4S C;  3APF A;  2QIE B;  4IC7 B;  4BFR A;  1OQR A;  4RNA A;  2V4I B;  4XDD A;  2WXP A;  2W54 A;  1GG3 A;  4W9E A;  3J9C A;  4C7Z A;  3DBS A;  5AEK B;  2HTH A;  3TEY A;  2MEK A;  5GMV A;  2ZNV C;  2BKR B;  3Q3F A;  1SF0 A;  3A4R A;  2LVQ A;  2KWV B;  2LHD A;  4FLH A;  4ANU A;  4JWS C;  4WJP A;  1YNT E;  3W1S A;  1S3S G;  4OVZ A;  2K1F A;  2UYZ B;  1V97 A;  4A8X C;  4KDI C;  1MG4 A;  4YXD B;  2FAZ A;  2N9L A;  3NZ3 A;  1WYW B;  4NAW B;  3ZIM A;  1UWM A;  2IBI B;  3N1Z C;  4LNF A;  4GDL A;  2KTF A;  2SEB D;  4LCD E;  4KKJ A;  4AWJ A;  1QOA A;  4GU2 A;  2ZW1 A;  4HJG E;  4K3B A;  3AH7 A;  3HVD A;  3DBL I;  3NY5 A;  1YIW A;  2LUM A;  3OWE B;  3GB1 A;  4MM3 A;  1HZ6 A;  1E5W A;  2N0S B;  2WU2 B;  1LO5 D;  2NBU A;  1C78 A;  4ZDV A;  2FUH B;  5J18 A;  5CHF A;  4ITK A;  3A9J B;  4RFB A;  3ZJV A;  3MJ5 A;  4KX6 B;  2L1A A;  5EDS A;  3RI7 C;  1RWS A;  4R3D A;  2IO1 B;  2LI5 A;  2WXN A;  1P98 A;  1N6Z A;  1ZDX A;  2N9E B;  1E10 A;  4DQO C;  3VRB B;  3TIX A;  2QCZ A;  3VRA B;  1XT9 B;  2KLC A;  1RRB A;  1FXT B;  4YSZ B;  1L2N A;  2JZ3 B;  1WGK A;  2JYT A;  1TZ1 A;  4W9L A;  1ZDV A;  4B95 A;  2V3S A;  4RGT A;  4ANV A;  4MSM B;  1XEE A;  3RZW C;  2IY1 B;  3T3O A;  1AAR A;  1WXS A;  2ZCB A;  2B3A A;  3AE6 B;  1FO4 A;  2WXO A;  2BYV E;  2WDT B;  4LLG M;  1KLV A;  4HPM B;  3LXF A;  3P4S B;  5EE0 A;  3V6C B;  1MFW A;  1TBE A;  2B76 B;  1BT0 A;  2C7H A;  2KWC A;  2KXJ A;  1V1P B;  3C19 A;  3TJP A;  3Q8E A;  2C5L C;  4WWP A;  1FRR A;  1UBI A;  3WCQ A;  2KFK A;  3PHW B;  1KLU D;  1L6V A;  1LGR A;  4DHJ B;  3PS6 A;  1F52 A;  4MAC A;  1DYQ A;  3Q8C A;  1UGM A;  4DXG A;  3HM6 X;  1PQS A;  1WE7 A;  2LGY A;  4AUQ C;  1FXA A;  3RZF A;  5AUI A;  1BXT A;  2DBY A;  4II2 B;  2DZM A;  1L4Z B;  3AE4 B;  2Y5C A;  2GI9 A;  4W9I A;  2XN9 C;  3OJ4 B;  3WIM A;  3ZNI D;  5JHB A;  2IYD B;  2QMT A;  3KW5 B;  3A1Q B;  3E9S A;  2DWQ A;  2DYM A;  3AEF B;  1ESF A;  3BVZ A;  3UIO B;  4OW0 A;  3ZLZ A;  3TSS A;  3CF6 E;  1HTQ A;  2JWU A;  2C7M B;  1JRO A;  3GZN B;  3VDZ A;  4PK1 A;  4ARC A;  2RDG A;  4TV3 A;  4P6V F;  2NBV B;  4TSS A;  3I3T B;  3IBE A;  1L0V B;  3ZKJ C;  1R4N B;  1C4C A;  1Y56 A;  4EFO A;  2O6V D;  2L76 A;  4OZC A;  1WX7 A;  4NAW A;  2JSV X;  3PGE A;  4FXC A;  4B9K A;  3GE3 C;  1GB1 A;  2Y5P A;  2ZCC A;  4W9D A;  1P7E A;  3N1X C;  1V9J A;  2W82 A;  2BTE A;  2C9W B;  1IYF A;  3W9C B;  4GDK A;  2FNJ B;  2IO2 B;  4KZC A;  2ZW0 A;  1LXD A;  4AOF A;  4W9G A;  4LNN A;  3NS8 A;  1KJT A;  3LYY A;  4PS8 A;  2AYO B;  3TUO A;  3WAP A;  2WDQ B;  5BYS A;  3BVG A;  3RCZ A;  2KX3 A;  1ZOY B;  3IXS A;  5CHW A;  2D3B A;  1ET6 A;  4LDT D;  2OED A;  3D32 A;  3RNC C;  4F8C B;  5G2N A;  2DAJ A;  3I9V 1;  1XLQ A;  2VRR B;  3Q8B A;  3WA0 A;  1ROE A;  4JL9 A;  3H6N A;  2MBE A;  1ZUD 2;  3SU8 X;  1T5X D;  1OQQ A;  2KX0 A;  1KTK A;  1HQR D;  3VR8 B;  3ZVV A;  3N32 A;  1TJE A;  2I1K A;  4M01 A;  4XDC A;  2HTM E;  2XK5 B;  2NBW B;  1V49 A;  3RUL A;  2CS4 A;  2CU3 A;  1LFD A;  2IGH A;  4L2Y A;  4YL8 A;  3KWV A;  1QIL A;  5TSS A;  3FIL A;  4XWT A;  1WGY A;  4NQL B;  3KVF B;  3AB5 A;  1AW7 A;  1OTR B;  1IBX A;  4XWW A;  5FR3 A;  2N7J A;  4ZRJ A;  2PKO A;  3QA8 A;  4TMA B;  4M8M A;  3P42 A;  3IHP C;  1N60 A;  2NR2 A;  1GB4 A;  2CHW A;  1TKG A;  1JCK B;  4W9F A;  2JZZ A;  4MSQ B;  3K9P B;  1OGW A;  4MGK E;  2NTT A;  2UU7 A;  3MHZ A;  4ARI A;  4OVV A;  1YN4 A;  2DZK A;  3O13 A;  3APC A;  1NEK B;  2MBQ A;  3R7R A;  1WIA A;  2WDR B;  3P4R B;  4OZA A;  1E8Z A;  3APD A;  1FXI A;  5AZG A;  4XX5 A;  4ZHO A;  2LVO A;  1WGD A;  4HJK A;  1SSN A;  1JQ4 A;  4KGS A;  4DDI D;  3A1Q A;  2V4L A;  2LRW A;  1PFD A;  4NY0 A;  3AUL A;  3U8Z A;  3AU5 A;  2MBH A;  2KT7 A;  1C77 A;  3DBR B;  3H9D A;  4G50 A;  2BGF A;  4EOY A;  1WMH B;  4DK5 A;  1E7U A;  5CTR C;  4JE3 B;  3I57 A;  1V6E A;  1WJU A;  2QDF A;  3U30 A;  2JPH A;  3IVF A;  2I1J A;  4ZYN A;  3JYU A;  1C76 A;  1AYF A;  2GLS A;  3W1Y A;  1EWY C;  3DCG A;  3IAM 1;  3UF8 A;  3TEZ A;  4HKQ A;  2LRU A;  2JVC A;  2WXF A;  2CHX A;  1WRD B;  1FNW A;  4HK2 A;  2L05 A;  4LNK A;  3PTF C;  3H7P B;  2O2V A;  1E8W A;  1P0R A;  2PE9 A;  2JRH A;  3VXW A;  2JY6 A;  3NG0 A;  1M4V A;  2REX A;  2KTR B;  1KF6 B;  2JWZ A;  1YJ1 A;  3A9K B;  3DHG C;  5T8I A;  1ZXI A;  2M19 A;  4B0M A;  3U4E G;  4HCN B;  4ZOH C;  1NYR A;  2KVR A;  4K1R B;  2E3T A;  1G6J A;  3FKY A;  5C2T B;  4B6W A;  3B08 A;  2DYO A;  1WWT A;  2LD9 A;  4KIK B;  1V80 A;  2WU5 B;  1N5X A;  4ZHP A;  1FPY A;  4KGR A;  4EZL A;  3ETR A;  4JPS A;  1VR9 A;  1V8C A;  3LB8 C;  4NJ7 A;  3M3J A;  3DVN U;  2LJI A;  3L17 A;  1LM8 B;  1WH3 A;  2GBJ A;  2G4S A;  4PS7 A;  3C8Y A;  4KVG B;  2G3Q B;  3RT3 B;  4EKU A;  2KMM A;  3X23 A;  4JGH B;  3NVV A;  3PSE B;  2V1Y A;  1MI0 A;  2BS4 B;  1TIF A;  2JXX A;  2KDM A;  3TL5 A;  3ZTD A;  4ACF A;  1YQ3 B;  3AE1 B;  2K39 A;  2MJ3 A;  4LNI A;  1EF5 A;  1P7F A;  1JWU D;  4W9J A;  2J52 A;  1CQV A;  1IUE A;  4FJV B;  3ZNZ B;  1XXG A;  2ZVN A;  3U52 E;  4GB9 A;  1J8C A;  2ZVO A;  5LNK 1;  4MJS A;  3B0A A;  2MH7 A;  1KRH A;  2IGD A;  3O65 B;  1ENF A;  1E8X A;  1QOF A;  1QOB A;  4WWN A;  1YQB A;  2I38 A;  1K51 A;  3VFK A;  3ZQ4 A;  1L0Y B;  3EFU A;  3T8M A;  1XLN A;  1ZE3 D;  4ZYS A;  1N5W A;  1T0S C;  1B1Z A;  3RNA C;  3NVY A;  5J17 A;  4WWM A;  1PUT A;  2WWZ A;  4I6P A;  2PEA A;  2KNB A;  4YSX B;  4C56 C;  4JIO U;  3HIZ A;  3GP7 A;  4ZRI A;  2NVU I;  2EKI A;  1SE9 A;  2N7D A;  1EU4 A;  1FNU A;  5IKC M;  1BML C;  4K81 A;  2J7Q B;  1OEY J;  3TBL D;  3FAH A;  2M0X A;  3SR6 A;  2Y5B B;  1H8C A;  3OAW A;  1JWS D;  1ZP0 B;  3SD5 A;  2WXK A;  3R8B A;  2KDB A;  2XNA C;  2ZJD A;  1CMX B;  2R61 A;  1OQY A;  2JYE A;  4A9A A;  2NMQ A;  4RGO S;  2BS2 B;  4DDG D;  3AI5 A;  4M0W A;  2KN5 A;  4GOC A;  2JRI B;  1D5M C;  3AXC A;  3QJZ A;  1UZX B;  2BS3 B;  2WHI A;  4FHJ A;  4W9H A;  4G3X B;  5D2M B;  3B2F A;  2GBM A;  4MH8 A;  3IAS 1;  3PRP B;  2ZPN A;  2JF5 A;  3DVG Y;  1ZGU B;  1F2R I;  2KZR A;  2ONQ A;  3PVL A;  4QAY A;  4XYC A;  1RYJ A;  1GPX A;  1SJE D;  4I6L B;  4HDQ A;  3MJW A;  3CWI A;  1YJJ A;  3A9K A;  2L8J A;  1FMA D;  3ZRC A;  4GGQ A;  5EE1 A;  3Q6B A;  1XLP A;  2V3N A;  4RGN A;  1JRP A;  3WAM A;  5E6J A;  3ZRF A;  3DOW A;  2KWD A;  4WUR A;  1RFK A;  3K9O B;  4HRO A;  2LFI A;  3EC8 A;  4E3C A;  3IG3 A;  1WRI A;  4L23 A;  5C3J B;  5LXH A;  4DWF A;  2KMC A;  1VZ6 A;  2L52 A;  3ZDM C;  3R66 C;  2IO0 B;  3PV1 A;  5BMG A;  2M0A A;  5IAA C;  3AEC B;  4P16 A;  3AED B;  1JRU A;  5D6J B;  2AWT A;  5TR5 A;  4BAX A;  1TS5 A;  1T0Y A;  4GSW A;  3MP9 A;  2CR5 A;  2K8C A;  4X57 B;  1H4R A;  3V62 A;  5BYQ A;  2VH2 A;  3N20 C;  4N6E B;  2DNF A;  1SJH D;  3R2I A;  3VH4 B;  2KC1 A;  2Z0E B;  5BMH A;  2JXT A;  3LJ3 A;  4RGM A;  3MC9 A;  1D5Z C;  3ZNG C;  4WJN A;  1C3T A;  3V3X A;  3KH0 A;  3MTN B;  2YVC A;  4GN1 A;  3ZUN A;  2DX5 B;  4RCO A;  1NEN B;  4FJZ A;  1L5P A;  1J7C A;  2YLM A;  5EE3 A;  2K9X A;  1C1Y B;  2KOX A;  4A3O A;  4EZJ A;  4IM0 A;  3BYY B;  5FK9 C;  3KLS X;  2LGX A;  3AU4 A;  5AZF A;  1QF6 A;  2VZK D;  2WNM A;  2EMT A;  1CJE A;  2BT6 A;  3VAW A;  1NYQ A;  1RAX A;  1JWB D;  2M17 A;  4ICU A;  1I4P A;  3T9L A;  2ZZP B;  3RD2 A;  1D6E C;  3BYT B;  2L83 A;  3TEX A;  4XC2 A;  3T3N A;  3IT4 B;  1V86 A;  2XEW A;  1TZO A;  1PGA A;  2MA9 B;  1I35 A;  4BVU C;  2KO3 A;  4MGZ E;  2A5U A;  1GOZ A;  2BW2 A;  2CJN A;  2KJ6 A;  4O1N A;  2L0F A;  2JUO A;  3CSF A;  3UI3 A;  3EA6 A;  1M94 A;  1J0G A;  3ZJU A;  3P63 A;  1WR6 E;  3I63 C;  1PGX A;  2FUG 1;  3NS1 A;  5LXI B;  4WAA A;  1WM3 A;  2V3P A;  4HKZ E;  3MFG A;  3KUD B;  4KGT A;  1SIJ A;  1FCL A;  2LHE A;  1DOY A;  1EU3 A;  2O6V B;  5DCN A;  1UF0 A;  3AE5 B;  1T6B X;  5HKH A;  2M8S A;  1I42 A;  2H88 B;  4RF1 A;  2KQ7 A;  1YOV B;  1XF5 L;  2J0J A;  2RDB C;  5JH5 C;  2KQ4 X;  4N58 A;  2KAC A;  4NAM A;  1ZW7 A;  2PPH A;  3I5J C;  2RPQ A;  5BMI A;  3B1L X;  2INC C;  3AE3 B;  3JSV B;  2MBO A;  1PYW D;  2QIL A;  3H8H A;  2DZJ A;  2KAN A;  3GZN I;  1DOI A;  1N62 A;  1WXM A;  2MRP A;  4LDT B;  2ZEQ A;  3PT2 B;  1WJ6 A;  3WAN A;  3R3M A;  3DQV A;  3DWM A;  3A9J A;  2PJH A;  1R4N I;  1KH0 A;  2V9H A;  3DVG X;  2MJE A;  2FID A;  1SE3 A;  2J4X A;  2V0G A;  5D7G A;  4HVB A;  3HK0 A;  4M00 A;  2I2Y A;  3ZXR A;  4KKI A;  1JAL A;  3TEW A;  3B2G A;  3RNE C;  1ACC A;  1UD7 A;  1WGH A;  4I6N B;  2OJW A;  4URK A;  1STE A;  4LTU A;  3M63 B;  5D3D A;  1F77 A;  2WGS A;  4LJO B;  1SBB B;  1GC6 A;  2HDE A;  1Y8R C;  3V6E B;  2NCN A;  1E0Z A;  3ZDT A;  1V1P A;  1GAQ B;  3EFC A;  2GRI A;  2GBK A;  3HM3 A;  2NPT B;  1WR1 A;  3PZ8 A;  3IFW B;  3W2D A;  4GIV A;  2HJ1 A;  3PZ7 A;  2HD5 B;  2K8B A;  2K0P A;  3NVW A;  3WAL A;  1EWC A;  4ASW C;  1TS4 A;  4A3P A;  1I4R A;  2R2O A;  4G11 A;  2DEN B;  1R4M I;  1FFU A;  4G0N B;  1WXQ A;  2AQ1 B;  3DPD A;  3PRZ A;  2UWQ A;  3MHS D;  4AJW A;  1J7A A;  2OOB B;  4E71 A;  5J2R A;  1TS3 A;  4WQM A;  4WAF A;  4IOI E;  1L4D B;  2LWP A;  2K6Q A;  3MC8 A;  2PMV A;  1IGC A;  4IKG A;  4K3C A;  2SAK A;  3DWG C;  4YTP B;  2WYQ A;  3AMZ A;  2JX5 A;  1SE4 A;  2MX2 A;  2LUE A;  4AS1 A;  2WXM A;  3PPA A;  1I4Q A;  2KHW B;  1NBF C;  1YX5 B;  1YMH E;  1L6U A;  3N1Y C;  2X8X X;  3V60 A;  1TTN A;  1B9R A;  3LDZ E;  4HXD A;  4XE0 A;  3NJT A;  1XO3 A;  1VJK A;  2W3R A;  1NVI D;  1E90 A;  1I4H A;  4HWI B;  4BKG A;  4DHZ E;  2BYT A;  2FCS A;  4M8N A;  4PS3 A;  3VTW A;  4MEL A;  4CYE A;  1PDX A;  1R7S A;  1WZ3 A;  4YT0 B;  5H8Y E;  3FC4 A;  2WX1 A;  2MP2 B;  2WS3 B;  1YX6 B;  2LXA A;  2MJD A;  2N9K A;  2X38 A;  4WWO A;  2KJR A;  1N61 A;  1IPG A;  1FRD A;  4FJY A;  1S1Q B;  2MSE D;  1RLF A;  5KHO A;  3ZXV A;  3DBR I;  1YN5 A;  2K8H A;  3ZGZ A;  1TKY A;  1VD2 A;  3DBH I;  3RFZ B;  3R2T A;  1Z2M A;  3WAO A;  4ZRP A;  2DYB A;  2K6D B;  1SB3 C;  2BWF A;  2MBB B;  3PRE A;  4MM3 B;  4A90 A;  1VZ8 A;  2BQQ A;  2D2Q A;  4NJC A;  4RMA A;  3S2A A;  3VUW A;  2EKE C;  1NI2 A;  2LZ6 A;  2Z0D B;  2XK5 A;  2G45 B;  4NPN A;  1V2Y A;  5C1Z A;  1NDD A;  2RMM A;  3KYD D;  3VTV A;  1T0R C;  1X1M A;  3QAR A;  1WJN A;  2BF8 B;  2BVC A;  2KD0 A;  3BIN A;  1WXV A;  3CMM B;  2RD0 A;  3SHQ A;  1WY8 A;  2J42 A;  1UH6 A;  2ASQ A;  2DZI A;  4FAD A;  3HUI A;  2KDF B;  1LQB A;  2CU1 A;  3HHM A;  2CJO A;  4HDO A;  4GXB A;  4W9K A;  2E6X A;  3PRM B;  2G1E A;  2NPT A;  4HLE A;  1P3Q U;  3QK0 A;  3SDL C;  4XZ4 A;  3HRD D;  1TKE A;  4ANW A;  2KFJ A;  1WGR A;  1WE6 A;  5C23 A;  2KFK B;  3ZTC A;  2DAF A;  3VH3 B;  1XCT L;  1XLO A;  3RNF C;  1GNU A;  5KHQ A;  1MJD A;  5HFY A;  1HEZ E;  2LEK A;  3CST A;  4IWP A;  4B0E A;  3DVN V;  3VQI A;  2Z8L A;  4TKN A;  1GC7 A;  3E56 A;  3W1S C;  2LMC A;  2N4F A;  2G9H D;  4REZ A;  5D3I B;  1NI3 A;  3UQB A;  2K3U A;  3ML9 A;  1K50 A;  2IJ0 A;  3RNG C;  2IY0 B;  4NQK E;  3R7Q A;  2INP E;  3AV8 A;  3C0R B;  4TQ0 A;  2KDI A;  1TY0 A;  2XBB C;  1A5R A;  1WMH A;  1D4B A;  3U7Z A;  3DBL B;  5CX3 A;  3QIJ A;  1XCQ L;  5HI1 A;  3RUI B;  3VHT C;  4TQ1 A;  2FIF A;  4K7S A;  4S0R A;  3N30 A;  2CHZ A;  1Q10 A;  4JLC A;  2PVG C;  5EE9 A;  3KUC B;  3BII D;  4BKS A;  1KM7 A;  2PE6 B;  1E8Y A;  2N1V A;  4L1B A;  2L3Z A; 
#chains in the Genus database with same CATH homology
 1TY2 A;  2PKO A;  2WLB A;  3UI3 A;  3EUB 2;  4H2A A;  3AEE B;  3EA6 A;  4TMA B;  4RF0 A;  1J7B A;  3P42 A;  3ZJU A;  1N60 A;  3P63 A;  1GB4 A;  3SFD B;  1TKG A;  4D2K A;  3BK2 A;  1JCK B;  1VZ7 A;  1PGX A;  2FUG 1;  3NS1 A;  4YTM B;  4GDK B;  2NTT A;  1WSP A;  2ON8 A;  3MHZ A;  2PIA A;  2V3P A;  1N63 A;  2RPV A;  4HKZ E;  4ARI A;  3MFG A;  4KGT A;  1SIJ A;  1YN4 A;  1FCL A;  1QT9 A;  1ET9 A;  2LHE A;  3O13 A;  1DOY A;  1EU3 A;  1E9M A;  2JQR B;  2BBC A;  4JWU C;  1NEK B;  2K22 A;  2WXG A;  3ZJT A;  2WDR B;  4ZRQ A;  3AE5 B;  1T6B X;  3P4R B;  2EEL A;  4OZA A;  2KAJ A;  3B9J A;  3AE7 B;  1FXI A;  1DGJ A;  4N59 A;  3RPF C;  2H88 B;  4ZHO A;  2GB1 A;  1JWM D;  4RF1 A;  1SSN A;  1K53 A;  4RH6 A;  2PLP A;  4JX1 C;  1JQ4 A;  4KGS A;  1XF5 L;  2YEP B;  5MPO A;  2KQ4 X;  4N58 A;  1PFD A;  1QKZ A;  2KAC A;  2INN E;  4NAM A;  3N9Y C;  3NUH B;  4C7Y A;  5BMI A;  3P4Q B;  1C4P A;  3AM9 A;  3AE3 B;  3SEB A;  1PYW D;  3AN1 A;  1C77 A;  2QIL A;  3H8H A;  4PT5 A;  2W3S A;  2AQ3 B;  1KFY B;  1I7H A;  4YTN B;  3VR9 B;  1CK1 A;  1SE2 A;  1L0X B;  2WXQ A;  1DOI A;  1N62 A;  2FE8 A;  2D5G A;  2ICI A;  5G5H A;  1VDV A;  3DWM A;  4GLS C;  4JE3 B;  3I57 A;  3AEG B;  1KH0 A;  2IDY A;  3HVZ A;  1YQ4 B;  2MJE A;  2AQ2 B;  1SE3 A;  2KN4 A;  4A55 A;  3FIL B;  4DXF A;  1C76 A;  1AYF A;  1TYG B;  2J4X A;  3Q69 A;  2V0G A;  5D7G A;  1OFF A;  3L4P A;  1EWY C;  3IAM 1;  3TEZ A;  4HKQ A;  3V05 A;  1IBX B;  2QJL A;  2WXF A;  2QIE B;  2I2Y A;  3CIR B;  2J53 A;  2RDH A;  1OQR A;  1FNW A;  2Q5W D;  1HXY D;  1I4G A;  4KKI A;  1JAL A;  2V4I B;  4RNA A;  3TEW A;  2VZK B;  2WXP A;  4XDD A;  3B2G A;  2W54 A;  1YN3 A;  1ACC A;  1C4A A;  1F2R C;  3J9C A;  4C7Z A;  3TEY A;  1UUP A;  2WXR A;  2MEK A;  1FIQ A;  1QQR A;  1M4V A;  1ZXH A;  1STE A;  5HG2 A;  5JXV A;  1KF6 B;  1SF0 A;  4LTU A;  2IPK D;  5D3D A;  1F77 A;  2LHD A;  5T8I A;  4JWS C;  1SBB B;  1T3Q A;  1YNT E;  1ZXI A;  2M19 A;  3U4E G;  2HDE A;  3W1S A;  4ZOH C;  4B0M A;  1NYR A;  4OVZ A;  1V97 A;  4A8X C;  2E3T A;  4YXD B;  3MC0 B;  1E0Z A;  5C2T B;  1V1P A;  2N9L A;  1GAQ B;  1FNV A;  1SEB D;  4HEA 1;  3NZ3 A;  2GRI A;  2DYO A;  1AWD A;  4NAW B;  1WWT A;  1UWM A;  2WU5 B;  1N5X A;  3PZ8 A;  4ZHP A;  4US8 A;  2W55 A;  3W2D A;  4KGR A;  2JZP A;  3PZ7 A;  1VRA B;  3ETR A;  2SEB D;  1VR9 A;  2DLB A;  4JPS A;  1V8C A;  3LB8 C;  4KKJ A;  2K0P A;  2LJI A;  3NVW A;  1QOA A;  1FD6 A;  1EWC A;  1TS4 A;  1I4R A;  4EE2 A;  2ZW1 A;  1FFU A;  4HJG E;  1WXQ A;  2AQ1 B;  2YEP F;  3AH7 A;  3C8Y A;  3HVD A;  2KMM A;  1UGJ A;  1J7A A;  2LUM A;  3OWE B;  3GB1 A;  1TS3 A;  4WQM A;  4WAF A;  1HZ6 A;  3NVV A;  4IOI E;  3AE9 B;  1L4D B;  2N0S B;  2WU2 B;  1LO5 D;  1MI0 A;  2PMV A;  1C78 A;  1IGC A;  2BS4 B;  4IKG A;  2SAK A;  1E7P B;  2KDM A;  4ITK A;  1CZP A;  1YQ3 B;  2AX5 A;  3DWG C;  4YTP B;  3AE1 B;  4RFB A;  3ZJV A;  2MJ3 A;  3AMZ A;  1P7F A;  1TS2 A;  1JWU D;  3MJ5 A;  1A70 A;  2JX5 A;  1SE4 A;  4KX6 B;  2L1A A;  2J52 A;  3U2S C;  1CQV A;  1RWS A;  1IUE A;  4R3D A;  2PVO D;  3AE8 B;  4LK0 M;  4AS1 A;  2WXN A;  2WXM A;  1XXG A;  3U52 E;  1YJI A;  1ZDX A;  1V1O A;  3URY A;  1E10 A;  1I4Q A;  4DQO C;  3SFE B;  1MHX A;  3VRB B;  3P1M A;  5LNK 1;  1HA5 A;  3VRA B;  1YMH E;  4YSZ B;  1L6U A;  3W5V B;  1WGK A;  2JYT A;  1ZDV A;  2MH7 A;  1KRH A;  2IGD A;  1IGD A;  1ENF A;  4US9 A;  1B9R A;  1QOF A;  1QOB A;  4RGT A;  1HZ5 A;  5HHD G;  4XE0 A;  2I38 A;  1K51 A;  3ZQ4 A;  1XEE A;  1L0Y B;  3T3O A;  1XO3 A;  1XLN A;  1ZE3 D;  4ZYS A;  1VJK A;  1N5W A;  3AE6 B;  1FO4 A;  1B1Z A;  3NVY A;  2W3R A;  4WWM A;  1NVI D;  1PUT A;  1MPE A;  1I4H A;  1UWX A;  5BYR A;  2WXO A;  1WYG A;  3Q8A A;  4YSX B;  4C56 C;  4LLG M;  2BYT A;  3LXF A;  3P4S B;  2WXJ A;  5EE0 A;  2NTS A;  2PTL A;  3GP7 A;  2B76 B;  2EKI A;  4YWG G;  1PDX A;  1EU4 A;  1EM7 A;  1FNU A;  1R7S A;  1BML C;  4YT0 B;  2QSD A;  5H8Y E;  3FC4 A;  3GS2 A;  5I4D A;  1V1P B;  1I4X A;  3FAH A;  3Q8E A;  3SR6 A;  1F0Z A;  1FRR A;  3WCQ A;  2WS3 B;  2MJD A;  1KLU D;  2N9K A;  1L6V A;  2X38 A;  1JWS D;  1N61 A;  1FRD A;  1ZP0 B;  2WXK A;  3R8B A;  2XNA C;  2OHF A;  2Y3A A;  4MAC A;  1DYQ A;  3Q8C A;  1YN5 A;  2R61 A;  4DXG A;  1TKY A;  3ZGZ A;  2JYE A;  4A9A A;  2K5P A;  2NMQ A;  3RFZ B;  3R2T A;  1FXA A;  2BS2 B;  4RGO S;  2LGI A;  4ZRP A;  5AUI A;  4M0W A;  1BXT A;  1JWA D;  2DBY A;  1SB3 C;  3ABV B;  1L4Z B;  3AE4 B;  4MM3 B;  1D5M C;  2Y5C A;  2GI9 A;  4UDU C;  4A90 A;  2ACZ B;  1VZ8 A;  1SXT A;  2XN9 C;  3NVZ A;  2BS3 B;  4YSY B;  1AN8 A;  4NJC A;  2WXH A;  3EGR A;  2QMT A;  4Q2J A;  2PW9 A;  3B2F A;  3E9S A;  2DWQ A;  2DYM A;  2FBW B;  2H89 B;  3AEF B;  1ESF A;  3IAS 1;  3BVZ A;  4MH8 A;  1FFV A;  4WIP A;  4OW0 A;  2RMM A;  3TSS A;  1F2R I;  2JWU A;  2ONQ A;  1JRO A;  1MVK A;  1RYJ A;  1GPX A;  4C80 A;  1SJE D;  4ARC A;  2RDG A;  4P6V F;  3CWI A;  1YJJ A;  1E6E B;  2J42 A;  4TSS A;  1L0V B;  4NZL B;  4OZB A;  5AUK A;  1FMA D;  1Y56 A;  1C4C A;  3HUI A;  4USA A;  5EE1 A;  1XLP A;  1K52 A;  2BB6 A;  2V3N A;  4RGN A;  1JRP A;  2CJO A;  5E6J A;  1VLB A;  2KWD A;  3KQ4 A;  4OZC A;  4WUR A;  1RFK A;  4HRO A;  2E6X A;  2LFI A;  2JSV X;  2G1E A;  4FXC A;  3ZYY X;  1GB1 A;  1PGB A;  2Y5P A;  1WRI A;  4L23 A;  5C3J B;  3IT6 B;  1C79 A;  1P7E A;  1VZ6 A;  2W82 A;  2L52 A;  1FCC C;  2BTE A;  1MHH E;  5BMG A;  3HRD D;  1TKE A;  3W9C B;  2WQY B;  2ZW0 A;  2M0A A;  3BK1 A;  3AEC B;  4P16 A;  3AED B;  3LYY A;  3TUO A;  1TS5 A;  2WDQ B;  1XCT L;  1XLO A;  2WXL A;  3BVG A;  5BYS A;  1QLB B;  3MP9 A;  1ZOY B;  4AQ7 A;  1BUI C;  3BVM A;  3IXS A;  2WDV B;  4HRS A;  5G5G A;  5BYQ A;  1ET6 A;  4N6E B;  5HFY A;  1SJH D;  2OED A;  1HEZ E;  2LEK A;  1FM0 D;  3R2I A;  4CQN A;  5BMH A;  4B0E A;  2JXT A;  4MT5 A;  4RGM A;  3VQI A;  2Z8L A;  3I9V 1;  1D5Z C;  1FEH A;  3E56 A;  1XLQ A;  3Q8B A;  3V3X A;  2L32 A;  2LMC A;  2TSS A;  1ROE A;  3KWL A;  2G9H D;  4REZ A;  5D3I B;  1NI3 A;  1KLG D;  2K3U A;  4A6Q A;  3PO0 A;  1ZUD 2;  1K50 A;  2QEJ C;  1T5X D;  1UNS A;  2IJ0 A;  4RCO A;  1OQQ A;  1NEN B;  1JW9 D;  1KTK A;  3AE2 B;  1L5P A;  1HQR D;  3P4P B;  4GDL B;  2BB5 A;  1J7C A;  3VR8 B;  5FKA C;  4OHJ A;  2INP E;  5EE3 A;  3AV8 A;  3BZD B;  5GXG B;  2K9X A;  4TQ0 A;  1TJE A;  2WP9 B;  4XDC A;  1JML A;  1TY0 A;  2HTM E;  2IGG A;  1C9F A;  3BYY B;  5FK9 C;  1D4B A;  2CU3 A;  3KLS X;  3U7Z A;  1DOX A;  1QF6 A;  2VZK D;  2WNM A;  4WH4 A;  2IGH A;  1XCQ L;  1CJE A;  5HI1 A;  3AEA B;  2BT6 A;  1NYQ A;  1JWB D;  1I4P A;  4TQ1 A;  4L2Y A;  1D6E C;  3BYT B;  3KWV A;  2L83 A;  3BWU D;  1QIL A;  3NRZ A;  3TEX A;  1QOG A;  3FIL A;  4XWT A;  5TSS A;  1RM6 C;  3T3N A;  3IT4 B;  2M56 B;  1D5X C;  1TZO A;  3AB5 A;  1AW7 A;  1ZPS A;  1PGA A;  4J3O D;  1Q10 A;  3Q8F A;  2PVG C;  1IBX A;  2WXI A;  5H92 C;  4XWW A;  5EE9 A;  5FR3 A;  1GOZ A;  3BII D;  2BW2 A;  2CJN A;  4O1N A;  3AEB B;  4IDI A;  2JU6 X;  4L1B A;  2N7J A;  3W5U B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...