2M17A

Ubiquitin-like domain-containing c-terminal domain phosphatase (ublcp1)
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
81
structure length
81
Chain Sequence
MALPIIVKWGGQEYSVTTLSEDDTVLDLKQFLKTLTGVLPERQKLLGLKVKGKPAENDVKLGALKLKPNTKIMMMGTREES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin-like domain-containing CTD phosphatase 1
publication title Solution Structure and Rpn1 Interaction of the UBL Domain of Human RNA Polymerase II C-Terminal Domain Phosphatase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 8
structure length 81
sequence length 81
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2012-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2m17A00
4K7WA 3SHQA 3A33B 3A4SC 2D3GA 5D2MB 1WR6E 5JH5C 1WX9A 5JZEB 4FJYA 2N1WA 5LXIB 1UH6A 3DVGY 2BYEA 3EECA 4TUUA 2KFKB 1OTRB 2KHWB 4LCDE 4WJOA 2L7RA 2XEWA 4ICVA 3ZTCA 1ZW7A 3L08A 4RMAA 5L83A 1E90A 3M95A 4KZ0A 4DXAB 1OGWA 2DHZA 1JRUA 3HHMA 1A5RA 2BKFA 4IWOA 1Q1OA 3ZDMC 3QJZA 4HCNB 4XZ4A 4G50A 4BKTA 1WXAA 3QHTA 2KD0A 4W9GA 3AXCA 3L16A 4MJSB 2JXXA 3BINA 2DZKA 4W9KA 2MBHA 4FHKA 3ZNID 2HJ8A 5G55A 2NCNA 4GU2A 4ASWC 5IA7A 4FN2A 3HM6X 1EF1A 3WAPA 4MSQB 3JSVB 1H8CA 2WWZA 3H6NA 4DDID 2KQ7A 2CHZA 2N9EB 1H4RA 4NY0A 4ZRKA 1GJZA 1TTNA 4E74A 2MBEA 1WGDA 1WH3A 2C60A 2L05A 2M8SA 3TL5A 2KC1A 1YJ1A 2V4LA 4DHZE 1GC7A 4EZJA 4IWPA 1OEYA 1P98A 3VH3B 4NJ6A 1LXDA 1YD8U 2K8HA 5J18A 2ZZPB 4DHZB 4IW0A 2LXCA 4TV3A 3AULA 3DDCB 3GOEA 3KUZA 1J0GA 3L54A 3VDZA 1SIFA 2N1VA 2DYMA 3K9OB 4PS8A 1Z5SB 2JRIB 2HE7A 3HIZA 4HK2A 4MGZE 2KMCA 4W9LA 1MG8A 3U8ZA 2DZMA 3VAWA 3ZNHB 2C7HA 3R3MA 4P7IA 2C7MB 1U4AA 4GN1A 4W9DA 1TGZB 5C1ZA 3KW5B 4AJYB 2IZVB 3IHPC 1WE6A 2CHWA 3DVGX 1WE7A 2Y5BB 4FLHA 2NPTA 4IM3A 3IBEA 1WM2A 4ZDVA 1C1YB 2PE9A 3DBLI 1BT0A 2YLMA 2HD5B 3WAOA 3KYDD 4KDLB 4F8CB 1NI2A 3VQIA 4EKUA 3TCAA 2IO0B 2JRHA 2L0FA 2K8CA 3LDZE 2KO3A 2RGFA 4FULA 4NNJB 5CTRC 4DBGA 3ZRCA 2KDIA 1WJUA 2D07B 2I1KA 1J8CA 3NHEB 1ZGUB 2MBBB 4BKGA 1QZEA 1WGRA 3ENEA 3WA0A 1KOTA 1GG3A 2FCNA 2ZCCA 3A4RA 3DBHI 3ZNGC 4F1SA 4WWOA 1UGMA 2WX1A 2EMSA 3N32A 2JPHA 2ZPYA 5L95C 1PQSA 2ZCBA 5G2NA 4IM0A 4JGHB 1ZKHA 1FXTB 1V6EA 2FNJB 2IO3B 4IWQA 2NR2A 2L00B 1E8XA 3VVWB 3BY4B 1X1MA 1WXSA 3X0WA 2CS4A 3PZDA 4BOZB 2LRUA 3CMMB 1IPGA 2K1FA 2O2VA 4M8MA 4GOCA 2LGXA 1YX6B 2NPTB 3APCA 3V6EB 5AZHA 3U7DA 2L0TA 1WY8A 2UYZB 2DAFA 5CHFA 4N9F4 2MBOA 3CF6E 2BKRB 2K39A 1AARA 2AL3A 1E8YA 1GNUA 4K7SA 5LLIA 3UGBB 2L3ZA 1WX8A 2RR9A 4I6PA 3QARA 4NJ7A 2GBMA 2KX0A 3DVNU 4DK5A 5D6JB 4IC7B 3SD5A 2OJRA 2XBBC 4RM8A 4IM2A 2CR5A 3RZFA 2V3SA 3UIPB 4GXBA 2KC2A 4X57B 4II2B 3T8MA 2BGFA 2G4SA 1RRBA 4LJOB 2KJHB 2WDTB 3DQVA 2FCQA 2L76A 3PLVA 3QA8A 4W9JA 3IG3A 1WF9A 2K8BA 3NZUA 5CHWA 2KDFB 3UQBA 5J2RA 4HPMB 4FHJA 3RULA 1E8WA 4NPNA 2KDEB 3W1SA 5JHBA 3DBRI 2WX0A 4B9KA 3AI5A 1E8ZA 2FCMA 2PJHA 1L2NA 4PYUA 3TIXA 2O2VB 1EF5A 2FAZA 2Z0DB 3WIMA 2CKHB 2J7QB 4K7UA 3JYUA 1KJTA 4TKNA 5AEKB 3PGEA 5E6OA 3A1QA 4AJWA 3IFWB 5E6PA 1ISNA 2N7DA 1VD2A 2EKEC 2NS5A 3H1UA 3U30A 2KANA 3B0AA 2KFJA 4GSWA 1VCBA 3RUIB 5CX3A 3WALA 3WAMA 1WX7A 4HVBA 2MX2A 2RSUA 2JY6A 3RCZA 1OEYJ 4GGQA 3PREA 4DHJD 4JQWC 4BOSC 2WYQA 4WJPA 1WZ3A 2IYDB 2K6QA 2L8JA 3DCGA 3ZDTA 4TQ0A 3PHWB 4GDLA 2ZNVB 3OJ4B 4MDKE 1WGGA 1WM3A 4ZRIA 4ANWA 1XD3B 3ALBA 4IG7B 2ZNVC 2KTRA 1WJ4A 2FUHB 2GBJA 3PVLA 1TZ1A 2LWPA 3GZNI 3QIJA 2AEHA 3VUWA 3RD2A 4BKSD 3ZTDA 3OJ3A 4CHKA 4WWPA 2G3QB 2Z59B 3JW0X 4HWIB 1NBFC 2PE6B 3VXWA 4OVVA 3W1SC 3P2BA 3ZUNA 4NQLB 4BKSA 1WJ6A 4WAAA 2DYOA 3A1QB 1IYFA 1YIWA 2LVQA 3ML8A 5GMVA 2MP2A 4LJPB 1V9JA 4EZLA 1XT9B 2JT4B 2C9WB 2JZ3B 2ZVNA 1R4NI 3T9LA 3C0RB 1RFAA 4KIKA 1P0RA 4ANUA 3L17A 5D94A 1V80A 2QHOA 3O65B 4GDLB 3K9PB 4MSMB 2GOWA 4DHJB 2K6DB 3PSEB 3L0WB 2C5LC 4RM9A 3UF8A 3VTVA 3HM3A 5TR5A 2LRWA 2KWVB 2KTRB 2ZVOA 2V1YA 3H9DA 4HJKA 3R7QA 5J17A 3KUDB 4PS7A 2LGDA 1I35A 4OVUA 2O6VD 3KYCD 3L13A 4G3XB 3VHTC 1WZ0A 3CSTA 3QCAA 3MJWA 3PRMB 1K8RB 4EUTA 1HE8A 2KXJA 3QC8B 2GBKA 2KLGA 2R2QA 4GMVA 3Q3JA 4ICUA 3ZVVA 4GIVA 3SDLC 3TJPA 1UBQA 2O6VA 3M3JA 3V6CB 3KVFB 3VUYA 5EDSA 1SE9A 1YQBA 2CHXA 4HPLB 4HCPB 2J0KA 2KNBA 3DOWA 3D32A 4W9FA 3PPAA 2PEAA 3LJ3A 2MP2B 3ML9A 2R2OA 3A9KA 4W9CA 3N3KB 1T0YA 4JLCA 4MGKE 5BO4B 1GC6A 1KLVA 1Z2MA 2FIFA 1E7VA 1V49A 2JWZA 4BBNC 4YL8A 1LQBA 1WIAA 3IVFA 4I6LB 1KM7A 3UIOB 3PHXB 3AU4A 1WR1A 2KJ6A 2KLCA 4G11A 4KSKC 3ZLZA 3JVZX 4MJSA 4BBNF 2XK5A 5CHVC 3NOBA 2LUEA 3QQ8B 4HXDA 2M0XA 4GB9A 4NAWA 5DPWA 2C7NB 4G0NB 3V62A 2LVPA 3PLUA 2MBQA 2Z0EB 1V5TA 4EOYA 4WWNA 1S1QB 3CSFA 4PS3A 5DPRA 1P3QU 2KTFA 4AOFA 3JSVA 4E3CA 4ZYNA 2DZJA 5DPSA 3RT3B 4KV2A 2IY0B 2DENB 3X23A 2DX5B 1NDDA 1WRDB 2LI5A 2O6VB 4GDKA 3S2AA 2GBRA 2D10A 2FIDA 4CYEA 3EHVA 3ZNZB 1R4MI 2MA9B 3QK0A 2REXA 4MM3A 4WQOB 3ZKJC 2A5UA 1L7YA 3VTUA 3ZRFA 3VH4B 5JHAA 3A9KB 1YX5B 2MLBA 3APFA 2W9NA 1UZXB 2LZ6A 2MCNB 3A9JA 4KVGB 3UQAA 2N7EA 2KDBA 2KX3A 4KZCA 4W9EA 3RZWC 3WANA 2D11A 2BF8B 4DWFA 2M4NA 1GUAB 4JIOU 3ZW3A 1RLFA 2BWFA 1V5OA 4MGIE 1S3SG 1RAXA 3I3TB 2YVCA 3NS8A 4EFOA 2KOXA 2MSED 2XK5B 1XQQA 5FR6A 3APDA 2BPSA 4NAWB 2J0JA 1J19A 4WJQA 2FCSA 3W1YA 1V81A 2HTHA 2KWUB 2KJRA 5AZGA 2J0MA 1Q0WB 4FBJB 1OQYA 5DPTA 4B6WA 3PTFC 3PV1A 2AYOB 3EFUA 1E5WA 2LD9A 2NVUI 3QX1A 4PYZA 3N30A 4MELA 4AWJA 4FJZA 2MQJA 2LGYA 1CMXB 4FADA 1SGHA 2MWSB 4ZRJA 4GDKB 1G6JA 3QWZB 1WGHA 3M63B 4M0WB 3L10B 4EEWA 4BFRA 3OAWA 2BYVE 1EUVB 2KQSA 2JVCA 3H7PA 4I6NB 5E6NA 1LFDA 1WGYA 4ANXA 4CO7A 2G45B 2KWCA 1WJNA 3A9JB 4FJVB 3SU8X 2GMIC 4DDGD 1F9JA 4A20A 4W9IA 2DYBA 5LXHA 3AU5A 3V60A 2IY1B 2GBNA 2I1JA 1WXMA 4NQKE 4AP4C 2M17A 3KUCB 2N9XA 3MHSD 3ONSA 4II3B 4KDIC 3M62B 1WMHA 4LDTD 3ZO5B 1C3TA 4B95A 5KHOA 1M94A 2AWTA 4TQ1A 3TBLD 1Q5WB 2KMAA 3R7RA 4K1RB 2MW5A 2BYFA 3H7SA 2N9PC 2LJ5A 3DBSA 3DVNV 3VUXA 4M8NA 2RD0A 2JZZA 2NBVB 3MTNB 4MH0E 1TBEA 2K25A 1WYWB 2CU1A 3PRZA 5AZFA 3KH0A 5IAAC 2BWES 2ZPNA 3NY5A 3R66C 2JF5A 2KN5A 5C23A 1LM8B 1UD7A 4MEMA 4AUQC 1D3ZA 1E7UA 3VTWA 3B08A 2IO1B 3EC8A 3H7PB 1I42A 4F7ZA 3Q3FA 3V61A 1WFYA 4IUMB 2IO2B 3B1LX 2KFKA 3TMPB 1WI0A 2G4DB 2LVOA 2B3AA 2M1MA 3ECIA 3OLMD 2D2QA 4J6IA 4A3PA 4ANVA 3NZSA 1EO6A 3HK0A 3ZIMA 2KKCA 5KHQA 4HDQA 4HLEA 4EZKA 4URKA 4KIKB 2IBIB 2NBWB 1UELA 2N4FA 3PT2B 3UINB 2MRPA 4W9HA 1WMHB 4XC2A 2OOBB 4A3OA 1P9DU 1UBIA 2DZIA 2EMTA 1IP9A 3QAQA 3PRPB 2ZJDA 4HDOA 2ZEQA 5HKHA 4JL9A 2UWQA 3VFKA 2AL6A 4LDTB 4BVUC 2JUOA 4K81A 1WXVA 2KVRA 5DCNA 4WJNA 1P1AA 2LASA 2ASQA 1V2YA 1Y8RC 2LXAA 2RPQA 2PPHA 4MGYE 2DAJA 3DPDA 3PS6A 4FA6A 1V86A 5D7GA 4E71A 2VRRB 4KSLC 2KZRA 4XX5A 3RYTA 2A4ZA 2KK8A 2NBUA
chains in the Genus database with same CATH superfamily
1ZE3D 5JH5C 5JZEB 4FJYA 2N1WA 2D3AA 1UH6A 2BYEA 3EECA 2KHWB 2W3SA 3I57A 3ZTCA 1E90A 3NZ3A 4ZHPA 4HCNB 4RCOA 1HA5A 1B9RA 3U4EG 4XE0A 2DZKA 2MBHA 4FHKA 1WXQA 4FN2A 3U7ZA 5GXGB 1VRAB 1YJJA 1SB3C 2WHIA 3ETRA 1IBXB 2MBEA 1WGDA 2C60A 3NRZA 4XDCA 2M8SA 1KFYB 1GB4A 2KC1A 1YJ1A 1GC7A 2QJLA 1BMLC 1OEYA 2VH2A 4WQMA 2QDFA 1LXDA 5JXVA 2J53A 4YTMB 2LXCA 3AULA 3BVGA 2H88B 1R7SA 3L54A 3VDZA 1SIFA 4PS8A 1V97A 4WH4A 4W9LA 3VAWA 4NAMA 1SEBD 2C7HA 2C7MB 1U4AA 4W9DA 5C1ZA 4AJYB 2IZVB 1WE6A 1WE7A 1LO5D 2NPTA 1TY0A 1WM2A 3IBEA 5AUKA 2DWQA 4KDLB 2PIAA 1NI2A 3Q69A 3SR6A 2JRHA 3AE1B 2NMQA 2L0FA 1FD6A 5CTRC 2RGFA 4NNJB 2I1KA 3C8YA 3RNCC 1F2RI 1WGRA 3ENEA 3OG5A 5EE9A 3DBHI 1TYGB 4WWOA 2EMSA 1BUIC 1C4PA 1P7FA 1PQSA 2ZCBA 5G2NA 1RFKA 1FXTB 2NR2A 2V3PA 1E8XA 3BY4B 1X1MA 3X0WA 4YSXB 4BOZB 2HTME 1ZXHA 2O2VA 2K9XA 3NS1A 3BYYB 1K51A 3AN1A 3V6EB 1WY8A 2UYZB 4N9F4 2LJIA 2MBOA 3CF6E 2AL3A 1HEZE 4OW0A 1EU3A 1GPXA 4P16A 4I6PA 4NJ7A 1RYJA 4AS1A 1LGRA 1JCKB 4DK5A 4IC7B 3SD5A 2OJRA 2XBBC 2CR5A 2V3SA 2WXGA 3UIPB 4CQNA 4JWUC 1WRIA 3BK2A 4LJOB 3DQVA 2OEDA 2IJ0A 2WGSA 1F77A 1VJKA 3UQBA 5J2RA 2KACA 3RULA 3W1SA 5JHBA 1E7PB 2WX0A 1TY2A 2PJHA 1L2NA 4PYUA 4PK1A 3JYUA 1KJTA 5AEKB 3MHZA 2ONQA 3A1QA 3IFWB 1ISNA 2NS5A 2KANA 1XLQA 1VCBA 4L1BA 3RUIB 2WS3B 1PUTA 3WAMA 2FUG1 3RCZA 2WXMA 4BOSC 2WYQA 4XWTA 1WZ3A 4TQ0A 3DCGA 4TMAB 3AE8B 3OJ4B 4LNKA 1JRPA 1DOXA 3ALBA 2WDQB 2KTRA 2GBJA 3VUWA 3N1YC 3RD2A 1AW7A 1L6VA 3JW0X 4HWIB 3J9CA 3VXWA 4C4VA 1IYFA 4A55A 3N9YC 4EZLA 1XT9B 3AV8A 1SXTA 2C9WB 4KGTA 3U2SC 3C0RB 1RFAA 4KIKA 1P0RA 1L0XB 3L17A 5HFYA 4GDLB 2YEPF 3K9PB 1ZPSA 4JX1C 2GOWA 2V3NA 4MSMB 3L0WB 3Q8AA 4LK0M 5TR5A 2KWVB 4R3DA 3RPFC 2V1YA 2V9HA 4G3XB 3QCAA 2BVCA 3PRMB 1VZ6A 1HE8A 1TT5B 2GBKA 3ZVVA 3AE4B 2I2YA 3SDLC 2O6VA 1SE9A 4HCPB 3PPAA 4A6QA 1FFVA 2PEAA 3A9KA 1T0YA 5BO4B 1GC6A 3TEZA 1KLVA 4ZRPA 4JE3B 4BBNC 1KM7A 4KSKC 5CHVC 3NOBA 4NAWA 1YQ3B 3RN9C 2Z0EB 4EOYA 1T5XD 1S1QB 3CSFA 3MC9A 1P3QU 1XO3A 2DZJA 1HZ6A 4A8XC 2SEBD 3S2AA 1IBXA 2LMCA 3AEBB 4CYEA 3ZNZB 2MA9B 1RM6C 1L7YA 3VH4B 3ZYYX 2MLBA 2WLBA 3B9JA 2W55A 4A9AA 3A9JA 5D3DA 2N7EA 1C4AA 3L4PA 4DXGA 3ZW3A 3VR9B 3ZXVA 3NS8A 4N59A 1K50A 2KAJA 2X8XX 1XQQA 4DQOC 3HVZA 1BXTA 2BPSA 2HDEA 1J19A 2KWUB 1MFWA 3W5UB 3RNFC 5DPTA 3V05A 1KF6B 1E5WA 2NVUI 4HKQA 3N30A 4MELA 1T0RC 4FADA 1XF5L 1ROEA 3QWZB 3L10B 4EEWA 2W82A 2RPVA 3OAWA 2KQSA 5E6NA 4CO7A 2G45B 1KLGD 3NG0A 3HRDD 4W9IA 1PDXA 5BMGA 3URYA 1TKYA 3HVDA 3BWUD 2M17A 3P42A 4KDIC 4TQ1A 3IXSA 3R7RA 2MW5A 1PYWD 3H7SA 3GS2A 1L0VB 2LUMA 4M00A 1OQRA 1V1OA 2BT6A 2NBVB 2PLPA 1HZ5A 2N0SB 1TBEA 1C76A 2GI9A 1D3ZA 1I4RA 1XCQL 3EC8A 1I42A 1CZPA 3V61A 3B2GA 3B1LX 3ECIA 2D2QA 4ANVA 1EO6A 4KKJA 4WIPA 4URKA 3BIID 1UELA 4W9HA 2OOBB 1UBIA 2DZIA 1IP9A 3IT6B 1FNVA 2ZJDA 2Q5WD 4HRSA 4BVUC 1YN3A 2KVRA 4K81A 5DCNA 1TS3A 2RPQA 2DAJA 3DPDA 2VRRB 2KZRA 4XX5A 3RYTA 1OQQA 4YSZB 3R8BA 3SHQA 2QIEB 3A33B 3A4SC 1FRRA 2QC8A 2J42A 2B76B 4N58A 2XEWA 1ZW7A 1JWAD 4NJCA 5L83A 4KZ0A 1JRUA 1A5RA 2WXHA 4IWOA 1MJDA 4G50A 4BKTA 1WXAA 3TEYA 4W9GA 2JXXA 4C7YA 1D5XC 2WDVB 1C4CA 5G55A 1FNUA 5D3IB 2INCC 3JSVB 1H8CA 2VZKD 2WWZA 3H6NA 4NY0A 1GJZA 1WH3A 2OJWA 1V1PB 2BS4B 2KT7A 3TL5A 2WDRB 4US9A 3VH3B 1YD8U 2K8HA 3PZ8A 4IW0A 1TJEA 3KUZA 1J0GA 2N1VA 3RI7C 1Z5SB 3T3OA 4H2AA 4GN1A 2E6XA 2JQRB 1YN5A 1A70A 3N20C 1J7AA 3Q3OC 4IM3A 2WXPA 4ZDVA 3TUOA 3NUHB 3AE5B 3KYDD 2VZKB 1UNSA 3GE3C 3VQIA 4OZCA 3TCAA 4EKUA 2K8CA 4DBGA 1FIQA 1I4PA 1ZGUB 1GG3A 1DOIA 3ZNGC 1E10A 4F1SA 1UGMA 3N32A 2JPHA 2ZPYA 2GLSA 4HJGE 4JGHB 1ZKHA 2JX5A 1B1ZA 1V6EA 2IO3B 4IWQA 2K5PA 1SSNA 4XYCA 3ZGZA 3RMKC 5HHDG 1KTKA 5AZHA 4BZAA 3RFZB 1L6UA 2DAFA 5CHFA 1I4QA 2X38A 1JALA 1AARA 2JWUA 5LLIA 2L3ZA 1ACCA 3QARA 3BZDB 2DNFA 2WP9B 4RM8A 2FBWB 1CQVA 2JXTA 3BYTB 2KJHB 1CJEA 2M0AA 2K8BA 2INNE 1E8WA 1MI0A 3DBRI 4B9KA 2FE8A 3AI5A 4ARCA 1EF5A 3SFEB 1FPYA 3PO0A 3WIMA 2CKHB 3PGEA 3Q14C 1CK1A 2N7DA 1SBBB 2KFJA 4YSYB 4NZLB 4LNFA 1L4DB 4HVBA 2RSUA 2JY6A 3PREA 2WXQA 4JQWC 4YXDB 4WJPA 2IYDB 1L4ZB 3PHWB 2ZNVB 2WXNA 1WGGA 4ZRIA 3GB1A 4ANWA 1XD3B 3Q6BA 2LFIA 1XEEA 2L1AA 2BBCA 1TZ1A 1VZ7A 3GZNB 4BKSD 3OJ3A 4CHKA 4WWPA 1XXGA 2G3QB 1KLUD 3UI3A 3ZUNA 1MG4A 1WJ6A 4WAAA 1I4XA 5GMVA 4LJPB 3BVMA 2JZ3B 1R4NB 3DWMA 4ANUA 4LNOA 4XWWA 1V80A 2MHJA 1D5ZC 2BTEA 3PSEB 2C5LC 3VTVA 5J17A 4FXCA 3R7QA 3AE3B 3VHTC 2WNMA 3CSTA 2KLGA 4GMVA 3Q3JA 4RGTA 3TJPA 1UBQA 3M3JA 3KVFB 4RF1A 2V4IB 3D32A 4W9FA 4ZOHC 1GB1A 3LJ3A 2MP2B 2R2OA 5G5HA 1TKEA 3FC4A 4JLCA 3KWVA 2EKIA 3WCQA 4I6LB 5IO9A 4G11A 2XK5A 4HXDA 1XLNA 4GB9A 5DPWA 1N5WA 1F52A 4G0NB 1AN8A 1VR9A 1ZOYB 1V5TA 4WWNA 1HXYD 3JSVA 5DPSA 4AQ7A 3RT3B 3X23A 4RGMA 2D10A 4M0WA 2RDHA 3FKYA 3AM9A 5I4DA 3ZJTA 1D5MC 5JHAA 1YX5B 2W9NA 1V8CA 4KZCA 3Q2AC 3IAS1 3RNEC 3I3TB 2YVCA 3T3NA 2IPKD 2MSED 4JWSC 3DHGC 1WGKA 1WWTA 5FR6A 1UGJA 4B0MA 4WJQA 5LNK1 3W1YA 5AZGA 2HTHA 2J0MA 4FBJB 1OQYA 4B6WA 3PTFC 2LD9A 1TKGA 4AWJA 3AE7B 4FJZA 2MQJA 1CMXB 3E56A 2MWSB 4GDKB 1WGHA 1T3QA 4ZRQA 2M56B 3H7PA 1LFDA 3OWEB 5IOIA 2GMIC 1JQ4A 5LXHA 3AU5A 2IY1B 2I1JA 4NQKE 4P1BC 4GLSC 4II3B 1WMHA 2MEKA 4LDTD 3ZO5B 5AUIA 4RF0A 1M94A 1I4HA 4P1CC 2R61A 4K1RB 2BYFA 2AQ2B 1MHXA 4M8NA 2MH7A 4MH0E 5AZFA 3NY5A 2RDBC 1UD7A 4MEMA 3B08A 3PZ7A 4XDDA 2G4DB 1DOYA 2B3AA 3OLMD 4J6IA 2TSSA 3AE9B 1ENFA 3NZSA 3HK0A 1EWYC 2KKCA 4HDQA 2NBWB 3UINB 2MRPA 2WXFA 2INPE 2IGDA 2EMTA 2ZEQA 3KQ4A 4JL9A 3Q8FA 2AL6A 4LDTB 1PGXA 1WXVA 1GOZA 1V2YA 2LXAA 2PPHA 1M4VA 5D7GA 4KSLC 2WXLA 4OZAA 4K7WA 2D3GA 1FFUA 1WR6E 3AEAB 1WX9A 2ICIA 1WSPA 1ET6A 3DVGY 1R4MB 4TUUA 2KFKB 1QOBA 4ICVA 2AQ3B 4RMAA 1PFDA 1VLBA 2D3CA 1TZOA 3HHMA 2I38A 2BKFA 1Q1OA 1PGBA 3ZDMC 1SE4A 2Y3AA 2PMVA 3QHTA 2WU2B 2KD0A 3L16A 3ZNID 1STEA 2NCNA 4GU2A 4ASWC 5IA7A 2HJ1A 3HM6X 4MSQB 3MC8A 4DDID 2CHZA 1H4RA 1JW9D 4ZRKA 1TTNA 4E74A 1NYQA 1D6EC 2OHFA 4MM3B 2V4LA 4DHZE 4IWPA 1FM0D 1P98A 3MP9A 5IKCM 5J18A 4DHZB 4DXFA 1YNTE 2PKOA 3K9OB 2DYMA 2MJEA 3HIZA 2DBYA 5C3JB 3U8ZA 2DZMA 1QKZA 4RNAA 3KW5B 3DVGX 3IT4B 2Y5BB 4FLHA 2PE9A 1BT0A 2YLMA 1XLPA 4US8A 2IO0B 1NVID 1N62A 4FULA 3ZRCA 2KDIA 1C9FA 1JROA 2CU3A 3Q8BA 1KOTA 3WA0A 3DBHB 2FCNA 2ZCCA 3V3XA 1HTOA 1SJHD 3GE8C 4IM0A 3P4RB 1QOFA 3ZQ4A 3AEFB 2FNJB 3Q8EA 5EE0A 1Q10A 1QLBB 1HTQA 1YOVB 1RWSA 2CS4A 1TS5A 1F0ZA 4OHJA 4M8MA 4GOCA 2LGXA 1YX6B 2NPTB 3U7DA 4UDUC 1Y56A 5HI1A 2BKRB 2VH1A 2K39A 1E8YA 1GNUA 3AEDB 2QCZA 2RR9A 2KX0A 1NYRA 4IM2A 5FKAC 4GXBA 2KC2A 4X57B 3T8MA 2BGFA 1RRBA 3BVZA 3ZXRA 2FCQA 2L76A 3QA8A 2K3UA 4W9JA 5BMHA 3IG3A 3W9CB 2KDFB 1N5XA 4HPMB 1DGJA 1KH0A 4KGRA 4B0EA 4NPNA 1QILA 1E8ZA 2O2VB 2Z0DB 1D4BA 2J7QB 4TKNA 4AJWA 5E6PA 3GP7A 2EKEC 3H1UA 4GSWA 2G1EA 5E6JA 4ZHOA 5CX3A 1MHHE 1WX7A 1OEYJ 4ITKA 2L8JA 4OZBA 4GDLA 1FCLA 4IG7B 2J52A 2ZNVC 4YWGG 1WJ4A 4KX6B 2JU6X 2LWPA 3QIJA 2AEHA 3NJTA 3ZTDA 2N9KA 2PE6B 1UUPA 1QOGA 4A90A 2RDGA 3A1QB 1N61A 1YIWA 3AMZA 1V9JA 3DBLB 1C79A 2UU7A 3O65B 2XNAC 1IGDA 3UF8A 3HM3A 2KTRB 3H9DA 4HJKA 2BB6A 3KUDB 4PS7A 2O6VD 1WZ0A 3QC8B 2KXJA 2R2QA 3EFCA 4WURA 3VUYA 4LLGM 5EDSA 3KLSX 4C4VB 3DOWA 3LB8C 1T0QC 1VZ8A 3ML9A 4L23A 4ARIA 3N3KB 1XCTL 1P7EA 1Z2MA 2FIFA 2KYWA 1V49A 2JWZA 1LQBA 1WIAA 3IVFA 3PHXB 2KLCA 3ZLZA 4HROA 1L5PA 3JVZX 2JYTA 3QQ8B 4M01A 2LVPA 3PLUA 4M02A 2MBQA 4OVZA 5DPRA 2KTFA 1JWSD 4ZYNA 4KV2A 2IY0B 1YN4A 1NDDA 1WRDB 2LI5A 2BB5A 2O6VB 2GBRA 2W54A 4YTPB 1R4MI 3AE6B 2REXA 1ZP0B 4MM3A 4WQOB 3VTUA 3ZRFA 1JMLA 2BS3B 3A9KB 4K3BA 1UZXB 2MCNB 3UQAA 2KX3A 3RNAC 3WANA 3RZWC 2BF8B 2M4NA 1GUAB 4JIOU 1RLFA 4MGIE 1S3SG 1RAXA 4EFOA 1WYGA 2ZW0A 4NAWB 2J0JA 4Q2JA 2FCSA 1V81A 1I7HA 5TSSA 1Q0WB 3EFUA 3EGRA 2MJDA 1L0YB 2IGGA 2L83A 4ZRJA 1G6JA 3LXFA 3SEBA 2XN9C 2BYVE 1JWMD 2LEKA 2JVCA 5T8IA 4ANXA 3A9JB 1IUEA 4FJVB 3SU8X 1SE3A 2DYBA 3FILB 2GB1A 3V60A 2GBNA 3MHSD 2N9XA 1FO4A 3ONSA 1E9MA 2KQ4X 5EE3A 2AQ1B 2CJNA 3B2FA 2JYEA 4B95A 5KHOA 3TBLD 1F1HA 2WU5B 2J4XA 2N9PC 3DBSA 2BYTA 2E3TA 2RD0A 2EELA 1WYWB 2D3BA 3PRZA 2ON8A 2BWES 2ZPNA 3ABVB 3R66C 2NTSA 2K22A 4RGNA 1LM8B 3NVVA 3VTWA 4F7ZA 4IUMB 3TMPB 4C00A 3NVWA 1ZXIA 4ACFA 4TSSA 1PGAA 5BYQA 4HLEA 4KKIA 3N1XC 4EZKA 3PT2B 4EE2A 4XC2A 3EA6A 4HDOA 2KVZA 5HKHA 2UWQA 2JUOA 4WJNA 2GRIA 4MGYE 1Y8RC 5G5GA 4FA6A 1V86A 2KK8A 2NBUA 4REZA 1ZDXA 2DLBA 5D2MB 1ZUD2 4L2YA 3HUIA 3TEWA 5LXIB 3DHHC 1OTRB 4LCDE 3P4PB 4WJOA 1V1PA 2L7RA 2LGSA 3VRAB 3L08A 2QSDA 4QAYA 3M95A 4DXAB 4JPSA 1OGWA 4MT5A 2DHZA 1NENB 3QJZA 3P4QB 2Y5CA 4XZ4A 5HG2A 2H89B 4P6VF 3AXCA 4MJSB 2BQQA 3BINA 4W9KA 3DHIC 1UWMA 2HJ8A 3Q3NC 4KGSA 1NI3A 1EF1A 3WAPA 2KQ7A 2N9EB 1QQRA 3NVYA 3CIRB 3AH7A 2L05A 1YMHE 3P4SB 4EZJA 3W2DA 2PW9A 4NJ6A 1I4GA 2ZZPB 4TV3A 3DDCB 3GOEA 1T6BX 2RMMA 1FMAD 3TEXA 2JRIB 2HE7A 4HK2A 3RNBC 3DWGC 4MGZE 2KMCA 1N63A 1MG8A 3ZNHB 1JWBD 3R3MA 4P7IA 4USAA 1TGZB 1J7CA 3IHPC 2CHWA 2PTLA 1C1YB 3DBLI 2HD5B 3WAOA 2BS2B 2KDMA 2YEPB 3IAM1 1IGCA 4F8CB 3LDZE 2KO3A 2AX5A 1WJUA 2D07B 1J8CA 3NHEB 2MBBB 4BKGA 1QZEA 2L52A 1VDVA 4HEA1 3A4RA 1F2RC 2KN4A 2INDC 2WX1A 5L95C 5H92C 2ACZB 2L00B 3VVWB 1WXSA 3PZDA 1SIJA 2LRUA 1GAQB 3CMMB 1IPGA 2K1FA 1YQ4B 3APCA 1JWUD 5BYSA 2L0TA 1N60A 1SJED 4K7SA 5MPOA 3UGBB 1WX8A 1AYFA 2GBMA 3DVNU 5D6JB 3H8HA 2QMTA 3RZFA 5H8YE 2BW2A 5IP4D 4II2B 2WXJA 3AB5A 2G4SA 2JSVX 2WDTB 3PLVA 4IOIE 1AWDA 1FEHA 1QOAA 3AEGB 1J7BA 5CHWA 1WF9A 3NZUA 3N1ZC 4FHJA 3P1MA 2KDEB 3DBRB 2FCMA 3TIXA 2FAZA 2WQYB 4K7UA 5E6OA 2L32A 4LNIA 1VD2A 3FILA 3U30A 2PVGC 3B0AA 3NVZA 2IDYA 3WALA 3LYYA 2MX2A 4WAFA 4GGQA 4DHJD 1FNWA 2CJOA 2K6QA 3ZDTA 3TSSA 2KMMA 3U52E 4MDKE 1WM3A 1UF0A 1EU4A 5BYRA 1SE2A 4MH8A 2FUHB 3PVLA 5BMIA 3GZNI 2Z59B 3VRBB 1NBFC 4OVVA 3W1SC 3P2BA 1ZDVA 4NQLB 4BKSA 2DYOA 2LVQA 1KRHA 3ML8A 2WXRA 2MP2A 3CWIA 1XLOA 2JT4B 2ZVNA 1R4NI 1NEKB 3T9LA 3W5VB 4S17A 2PVOD 1HQRD 5D94A 2QHOA 3P63A 1N6ZA 4O1NA 4DHJB 2K6DB 4RM9A 1ET9A 2LRWA 2ZVOA 4YTNB 3I63C 1K53A 2LGDA 1I35A 2ZW1A 4OVUA 3KYCD 3L13A 3O13A 2K0PA 3MJWA 1K8RB 4EUTA 2Y5PA 1YJIA 4ICUA 3AECB 4GIVA 3V6CB 4IKGA 1YQBA 2CHXA 4HPLB 2J0KA 2KNBA 4N6EB 2QEJC 4W9CA 3AEEB 1E6EB 2WXOA 4MGKE 1E7VA 3C19A 2N7JA 3ZJVA 4YT0B 4YL8A 3UIOB 3AU4A 1WR1A 2KJ6A 2N9LA 4MJSA 4BBNF 5FR3A 2LUEA 2M0XA 2C7NB 1OFFA 1MPEA 3V62A 4PS3A 4AOFA 4E3CA 1FXIA 2DENB 1C78A 2DX5B 2QILA 3R2IA 4XGAB 4S0RA 1EM7A 4GDKA 1FCCC 3E9SA 2FIDA 3EHVA 3QK0A 3ZKJC 2NTTA 1TS4A 2A5UA 2W3RA 4WWMA 2LHDA 3APFA 2LZ6A 4KVGB 2KDBA 1C77A 4W9EA 2D5GA 4DWFA 2D11A 1E0ZA 2BWFA 1V5OA 3AE2B 4PT5A 1TS2A 1ESFA 4C7ZA 4LNNA 2KOXA 2IGHA 2XK5B 3APDA 4RH6A 2KJRA 1FXAA 4IDIA 4HPPA 5FK9C 2KWDA 3I9V1 3R2TA 2V0GA 3PV1A 2AYOB 3QX1A 4PYZA 2WXKA 1QT9A 2JZPA 3I5JC 3KWLA 1QF6A 2LGYA 1SGHA 3M63B 4M0WB 4BFRA 1EUVB 5C2TB 4K3CA 4I6NB 1WGYA 2KWCA 1WJNA 3Q8CA 4DDGD 1F9JA 4A20A 4C80A 1T0SC 1WXMA 4AP4C 2MJ3A 3KUCB 1FRDA 1DYQA 2G9HD 3M62B 4C56C 4RFBA 2LGIA 1C3TA 1EWCA 2AWTA 1TIFA 4RGOS 1Q5WB 2KMAA 4D2KA 2LJ5A 3DVNV 3VUXA 3FAHA 4MACA 2JZZA 3MTNB 2SAKA 2K25A 2CU1A 2LHEA 3KH0A 5IAAC 2JF5A 2KN5A 3SFDB 5C23A 4AUQC 1E7UA 2IO1B 3H7PB 3Q3FA 3VR8B 1WFYA 2IO2B 2KFKA 1UWXA 1WI0A 4HKZE 5IN7A 3BK1A 2LVOA 2M1MA 3MJ5A 3MC0B 4A3PA 1MVKA 3ZIMA 4LTUA 5KHQA 3MFGA 5EE1A 4KIKB 2IBIB 2N4FA 3EUB2 2M19A 1WMHB 1SF0A 4A3OA 1P9DU 3QAQA 3PRPB 3Q3MC 4ZYSA 2Z8LA 2WXIA 3RNGC 3VFKA 4BAXA 1P1AA 2LASA 2ASQA 1K52A 3PS6A 3ZJUA 4E71A 2A4ZA 4J3OD
chains in the Genus database with same CATH topology
4K7WA 3SHQA 3A33B 3A4SC 2D3GA 5D2MB 1WR6E 5JH5C 1WX9A 5JZEB 4FJYA 2N1WA 5LXIB 1UH6A 3DVGY 2BYEA 3EECA 4TUUA 2KFKB 1OTRB 2KHWB 4LCDE 4WJOA 2L7RA 2XEWA 4ICVA 3ZTCA 1ZW7A 3L08A 4RMAA 5L83A 1E90A 3M95A 4KZ0A 4DXAB 1OGWA 2DHZA 1JRUA 3HHMA 1A5RA 2BKFA 4IWOA 1Q1OA 3ZDMC 3QJZA 4HCNB 4XZ4A 4G50A 4BKTA 1WXAA 3QHTA 2KD0A 4W9GA 3AXCA 3L16A 4MJSB 2JXXA 3BINA 2DZKA 4W9KA 2MBHA 4FHKA 3ZNID 2HJ8A 5G55A 2NCNA 4GU2A 4ASWC 5IA7A 4FN2A 3HM6X 1EF1A 3WAPA 4MSQB 3JSVB 1H8CA 2WWZA 3H6NA 4DDID 2KQ7A 2CHZA 2N9EB 1H4RA 4NY0A 4ZRKA 1GJZA 1TTNA 4E74A 2MBEA 1WGDA 1WH3A 2C60A 2L05A 2M8SA 3TL5A 2KC1A 1YJ1A 2V4LA 4DHZE 1GC7A 4EZJA 4IWPA 1OEYA 1P98A 3VH3B 4NJ6A 1LXDA 1YD8U 2K8HA 5J18A 2ZZPB 4DHZB 4IW0A 2LXCA 4TV3A 3AULA 3DDCB 3GOEA 3KUZA 1J0GA 3L54A 3VDZA 1SIFA 2N1VA 2DYMA 3K9OB 4PS8A 1Z5SB 2JRIB 2HE7A 3HIZA 4HK2A 4MGZE 2KMCA 4W9LA 1MG8A 3U8ZA 2DZMA 3VAWA 3ZNHB 2C7HA 3R3MA 4P7IA 2C7MB 1U4AA 4GN1A 4W9DA 1TGZB 5C1ZA 3KW5B 4AJYB 2IZVB 3IHPC 1WE6A 2CHWA 3DVGX 1WE7A 2Y5BB 4FLHA 2NPTA 4IM3A 3IBEA 1WM2A 4ZDVA 1C1YB 2PE9A 3DBLI 1BT0A 2YLMA 2HD5B 3WAOA 3KYDD 4KDLB 4F8CB 1NI2A 3VQIA 4EKUA 3TCAA 2IO0B 2JRHA 2L0FA 2K8CA 3LDZE 2KO3A 2RGFA 4FULA 4NNJB 5CTRC 4DBGA 3ZRCA 2KDIA 1WJUA 2D07B 2I1KA 1J8CA 3NHEB 1ZGUB 2MBBB 4BKGA 1QZEA 1WGRA 3ENEA 3WA0A 1KOTA 1GG3A 2FCNA 2ZCCA 3A4RA 3DBHI 3ZNGC 4F1SA 4WWOA 1UGMA 2WX1A 2EMSA 3N32A 2JPHA 2ZPYA 5L95C 1PQSA 2ZCBA 5G2NA 4IM0A 4JGHB 1ZKHA 1FXTB 1V6EA 2FNJB 2IO3B 4IWQA 2NR2A 2L00B 1E8XA 3VVWB 3BY4B 1X1MA 1WXSA 3X0WA 2CS4A 3PZDA 4BOZB 2LRUA 3CMMB 1IPGA 2K1FA 2O2VA 4M8MA 4GOCA 2LGXA 1YX6B 2NPTB 3APCA 3V6EB 5AZHA 3U7DA 2L0TA 1WY8A 2UYZB 2DAFA 5CHFA 4N9F4 2MBOA 3CF6E 2BKRB 2K39A 1AARA 2AL3A 1E8YA 1GNUA 4K7SA 5LLIA 3UGBB 2L3ZA 1WX8A 2RR9A 4I6PA 3QARA 4NJ7A 2GBMA 2KX0A 3DVNU 4DK5A 5D6JB 4IC7B 3SD5A 2OJRA 2XBBC 4RM8A 4IM2A 2CR5A 3RZFA 2V3SA 3UIPB 4GXBA 2KC2A 4X57B 4II2B 3T8MA 2BGFA 2G4SA 1RRBA 4LJOB 2KJHB 2WDTB 3DQVA 2FCQA 2L76A 3PLVA 3QA8A 4W9JA 3IG3A 1WF9A 2K8BA 3NZUA 5CHWA 2KDFB 3UQBA 5J2RA 4HPMB 4FHJA 3RULA 1E8WA 4NPNA 2KDEB 3W1SA 5JHBA 3DBRI 2WX0A 4B9KA 3AI5A 1E8ZA 2FCMA 2PJHA 1L2NA 4PYUA 3TIXA 2O2VB 1EF5A 2FAZA 2Z0DB 3WIMA 2CKHB 2J7QB 4K7UA 3JYUA 1KJTA 4TKNA 5AEKB 3PGEA 5E6OA 3A1QA 4AJWA 3IFWB 5E6PA 1ISNA 2N7DA 1VD2A 2EKEC 2NS5A 3H1UA 3U30A 2KANA 3B0AA 2KFJA 4GSWA 1VCBA 3RUIB 5CX3A 3WALA 3WAMA 1WX7A 4HVBA 2MX2A 2RSUA 2JY6A 3RCZA 1OEYJ 4GGQA 3PREA 4DHJD 4JQWC 4BOSC 2WYQA 4WJPA 1WZ3A 2IYDB 2K6QA 2L8JA 3DCGA 3ZDTA 4TQ0A 3PHWB 4GDLA 2ZNVB 3OJ4B 4MDKE 1WGGA 1WM3A 4ZRIA 4ANWA 1XD3B 3ALBA 4IG7B 2ZNVC 2KTRA 1WJ4A 2FUHB 2GBJA 3PVLA 1TZ1A 2LWPA 3GZNI 3QIJA 2AEHA 3VUWA 3RD2A 4BKSD 3ZTDA 3OJ3A 4CHKA 4WWPA 2G3QB 2Z59B 3JW0X 4HWIB 1NBFC 2PE6B 3VXWA 4OVVA 3W1SC 3P2BA 3ZUNA 4NQLB 4BKSA 1WJ6A 4WAAA 2DYOA 3A1QB 1IYFA 1YIWA 2LVQA 3ML8A 5GMVA 2MP2A 4LJPB 1V9JA 4EZLA 1XT9B 2JT4B 2C9WB 2JZ3B 2ZVNA 1R4NI 3T9LA 3C0RB 1RFAA 4KIKA 1P0RA 4ANUA 3L17A 5D94A 1V80A 2QHOA 3O65B 4GDLB 3K9PB 4MSMB 2GOWA 4DHJB 2K6DB 3PSEB 3L0WB 2C5LC 4RM9A 3UF8A 3VTVA 3HM3A 5TR5A 2LRWA 2KWVB 2KTRB 2ZVOA 2V1YA 3H9DA 4HJKA 3R7QA 5J17A 3KUDB 4PS7A 2LGDA 1I35A 4OVUA 2O6VD 3KYCD 3L13A 4G3XB 3VHTC 1WZ0A 3CSTA 3QCAA 3MJWA 3PRMB 1K8RB 4EUTA 1HE8A 2KXJA 3QC8B 2GBKA 2KLGA 2R2QA 4GMVA 3Q3JA 4ICUA 3ZVVA 4GIVA 3SDLC 3TJPA 1UBQA 2O6VA 3M3JA 3V6CB 3KVFB 3VUYA 5EDSA 1SE9A 1YQBA 2CHXA 4HPLB 4HCPB 2J0KA 2KNBA 3DOWA 3D32A 4W9FA 3PPAA 2PEAA 3LJ3A 2MP2B 3ML9A 2R2OA 3A9KA 4W9CA 3N3KB 1T0YA 4JLCA 4MGKE 5BO4B 1GC6A 1KLVA 1Z2MA 2FIFA 1E7VA 1V49A 2JWZA 4BBNC 4YL8A 1LQBA 1WIAA 3IVFA 4I6LB 1KM7A 3UIOB 3PHXB 3AU4A 1WR1A 2KJ6A 2KLCA 4G11A 4KSKC 3ZLZA 3JVZX 4MJSA 4BBNF 2XK5A 5CHVC 3NOBA 2LUEA 3QQ8B 4HXDA 2M0XA 4GB9A 4NAWA 5DPWA 2C7NB 4G0NB 3V62A 2LVPA 3PLUA 2MBQA 2Z0EB 1V5TA 4EOYA 4WWNA 1S1QB 3CSFA 4PS3A 5DPRA 1P3QU 2KTFA 4AOFA 3JSVA 4E3CA 4ZYNA 2DZJA 5DPSA 3RT3B 4KV2A 2IY0B 2DENB 3X23A 2DX5B 1NDDA 1WRDB 2LI5A 2O6VB 4GDKA 3S2AA 2GBRA 2D10A 2FIDA 4CYEA 3EHVA 3ZNZB 1R4MI 2MA9B 3QK0A 2REXA 4MM3A 4WQOB 3ZKJC 2A5UA 1L7YA 3VTUA 3ZRFA 3VH4B 5JHAA 3A9KB 1YX5B 2MLBA 3APFA 2W9NA 1UZXB 2LZ6A 2MCNB 3A9JA 4KVGB 3UQAA 2N7EA 2KDBA 2KX3A 4KZCA 4W9EA 3RZWC 3WANA 2D11A 2BF8B 4DWFA 2M4NA 1GUAB 4JIOU 3ZW3A 1RLFA 2BWFA 1V5OA 4MGIE 1S3SG 1RAXA 3I3TB 2YVCA 3NS8A 4EFOA 2KOXA 2MSED 2XK5B 1XQQA 5FR6A 3APDA 2BPSA 4NAWB 2J0JA 1J19A 4WJQA 2FCSA 3W1YA 1V81A 2HTHA 2KWUB 2KJRA 5AZGA 2J0MA 1Q0WB 4FBJB 1OQYA 5DPTA 4B6WA 3PTFC 3PV1A 2AYOB 3EFUA 1E5WA 2LD9A 2NVUI 3QX1A 4PYZA 3N30A 4MELA 4AWJA 4FJZA 2MQJA 2LGYA 1CMXB 4FADA 1SGHA 2MWSB 4ZRJA 4GDKB 1G6JA 3QWZB 1WGHA 3M63B 4M0WB 3L10B 4EEWA 4BFRA 3OAWA 2BYVE 1EUVB 2KQSA 2JVCA 3H7PA 4I6NB 5E6NA 1LFDA 1WGYA 4ANXA 4CO7A 2G45B 2KWCA 1WJNA 3A9JB 4FJVB 3SU8X 2GMIC 4DDGD 1F9JA 4A20A 4W9IA 2DYBA 5LXHA 3AU5A 3V60A 2IY1B 2GBNA 2I1JA 1WXMA 4NQKE 4AP4C 2M17A 3KUCB 2N9XA 3MHSD 3ONSA 4II3B 4KDIC 3M62B 1WMHA 4LDTD 3ZO5B 1C3TA 4B95A 5KHOA 1M94A 2AWTA 4TQ1A 3TBLD 1Q5WB 2KMAA 3R7RA 4K1RB 2MW5A 2BYFA 3H7SA 2N9PC 2LJ5A 3DBSA 3DVNV 3VUXA 4M8NA 2RD0A 2JZZA 2NBVB 3MTNB 4MH0E 1TBEA 2K25A 1WYWB 2CU1A 3PRZA 5AZFA 3KH0A 5IAAC 2BWES 2ZPNA 3NY5A 3R66C 2JF5A 2KN5A 5C23A 1LM8B 1UD7A 4MEMA 4AUQC 1D3ZA 1E7UA 3VTWA 3B08A 2IO1B 3EC8A 3H7PB 1I42A 4F7ZA 3Q3FA 3V61A 1WFYA 4IUMB 2IO2B 3B1LX 2KFKA 3TMPB 1WI0A 2G4DB 2LVOA 2B3AA 2M1MA 3ECIA 3OLMD 2D2QA 4J6IA 4A3PA 4ANVA 3NZSA 1EO6A 3HK0A 3ZIMA 2KKCA 5KHQA 4HDQA 4HLEA 4EZKA 4URKA 4KIKB 2IBIB 2NBWB 1UELA 2N4FA 3PT2B 3UINB 2MRPA 4W9HA 1WMHB 4XC2A 2OOBB 4A3OA 1P9DU 1UBIA 2DZIA 2EMTA 1IP9A 3QAQA 3PRPB 2ZJDA 4HDOA 2ZEQA 5HKHA 4JL9A 2UWQA 3VFKA 2AL6A 4LDTB 4BVUC 2JUOA 4K81A 1WXVA 2KVRA 5DCNA 4WJNA 1P1AA 2LASA 2ASQA 1V2YA 1Y8RC 2LXAA 2RPQA 2PPHA 4MGYE 2DAJA 3DPDA 3PS6A 4FA6A 1V86A 5D7GA 4E71A 2VRRB 4KSLC 2KZRA 4XX5A 3RYTA 2A4ZA 2KK8A 2NBUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K7W A;  3SHQ A;  3A33 B;  3A4S C;  2D3G A;  5D2M B;  1WR6 E;  5JH5 C;  1WX9 A;  5JZE B;  4FJY A;  2N1W A;  5LXI B;  1UH6 A;  3DVG Y;  2BYE A;  3EEC A;  4TUU A;  2KFK B;  1OTR B;  2KHW B;  4LCD E;  4WJO A;  2L7R A;  2XEW A;  4ICV A;  3ZTC A;  1ZW7 A;  3L08 A;  4RMA A;  5L83 A;  1E90 A;  3M95 A;  4KZ0 A;  4DXA B;  1OGW A;  2DHZ A;  1JRU A;  3HHM A;  1A5R A;  2BKF A;  4IWO A;  1Q1O A;  3ZDM C;  3QJZ A;  4HCN B;  4XZ4 A;  4G50 A;  4BKT A;  1WXA A;  3QHT A;  2KD0 A;  4W9G A;  3AXC A;  3L16 A;  4MJS B;  2JXX A;  3BIN A;  2DZK A;  4W9K A;  2MBH A;  4FHK A;  3ZNI D;  2HJ8 A;  5G55 A;  2NCN A;  4GU2 A;  4ASW C;  5IA7 A;  4FN2 A;  3HM6 X;  1EF1 A;  3WAP A;  4MSQ B;  3JSV B;  1H8C A;  2WWZ A;  3H6N A;  4DDI D;  2KQ7 A;  2CHZ A;  2N9E B;  1H4R A;  4NY0 A;  4ZRK A;  1GJZ A;  1TTN A;  4E74 A;  2MBE A;  1WGD A;  1WH3 A;  2C60 A;  2L05 A;  2M8S A;  3TL5 A;  2KC1 A;  1YJ1 A;  2V4L A;  4DHZ E;  1GC7 A;  4EZJ A;  4IWP A;  1OEY A;  1P98 A;  3VH3 B;  4NJ6 A;  1LXD A;  1YD8 U;  2K8H A;  5J18 A;  2ZZP B;  4DHZ B;  4IW0 A;  2LXC A;  4TV3 A;  3AUL A;  3DDC B;  3GOE A;  3KUZ A;  1J0G A;  3L54 A;  3VDZ A;  1SIF A;  2N1V A;  2DYM A;  3K9O B;  4PS8 A;  1Z5S B;  2JRI B;  2HE7 A;  3HIZ A;  4HK2 A;  4MGZ E;  2KMC A;  4W9L A;  1MG8 A;  3U8Z A;  2DZM A;  3VAW A;  3ZNH B;  2C7H A;  3R3M A;  4P7I A;  2C7M B;  1U4A A;  4GN1 A;  4W9D A;  1TGZ B;  5C1Z A;  3KW5 B;  4AJY B;  2IZV B;  3IHP C;  1WE6 A;  2CHW A;  3DVG X;  1WE7 A;  2Y5B B;  4FLH A;  2NPT A;  4IM3 A;  3IBE A;  1WM2 A;  4ZDV A;  1C1Y B;  2PE9 A;  3DBL I;  1BT0 A;  2YLM A;  2HD5 B;  3WAO A;  3KYD D;  4KDL B;  4F8C B;  1NI2 A;  3VQI A;  4EKU A;  3TCA A;  2IO0 B;  2JRH A;  2L0F A;  2K8C A;  3LDZ E;  2KO3 A;  2RGF A;  4FUL A;  4NNJ B;  5CTR C;  4DBG A;  3ZRC A;  2KDI A;  1WJU A;  2D07 B;  2I1K A;  1J8C A;  3NHE B;  1ZGU B;  2MBB B;  4BKG A;  1QZE A;  1WGR A;  3ENE A;  3WA0 A;  1KOT A;  1GG3 A;  2FCN A;  2ZCC A;  3A4R A;  3DBH I;  3ZNG C;  4F1S A;  4WWO A;  1UGM A;  2WX1 A;  2EMS A;  3N32 A;  2JPH A;  2ZPY A;  5L95 C;  1PQS A;  2ZCB A;  5G2N A;  4IM0 A;  4JGH B;  1ZKH A;  1FXT B;  1V6E A;  2FNJ B;  2IO3 B;  4IWQ A;  2NR2 A;  2L00 B;  1E8X A;  3VVW B;  3BY4 B;  1X1M A;  1WXS A;  3X0W A;  2CS4 A;  3PZD A;  4BOZ B;  2LRU A;  3CMM B;  1IPG A;  2K1F A;  2O2V A;  4M8M A;  4GOC A;  2LGX A;  1YX6 B;  2NPT B;  3APC A;  3V6E B;  5AZH A;  3U7D A;  2L0T A;  1WY8 A;  2UYZ B;  2DAF A;  5CHF A;  4N9F 4;  2MBO A;  3CF6 E;  2BKR B;  2K39 A;  1AAR A;  2AL3 A;  1E8Y A;  1GNU A;  4K7S A;  5LLI A;  3UGB B;  2L3Z A;  1WX8 A;  2RR9 A;  4I6P A;  3QAR A;  4NJ7 A;  2GBM A;  2KX0 A;  3DVN U;  4DK5 A;  5D6J B;  4IC7 B;  3SD5 A;  2OJR A;  2XBB C;  4RM8 A;  4IM2 A;  2CR5 A;  3RZF A;  2V3S A;  3UIP B;  4GXB A;  2KC2 A;  4X57 B;  4II2 B;  3T8M A;  2BGF A;  2G4S A;  1RRB A;  4LJO B;  2KJH B;  2WDT B;  3DQV A;  2FCQ A;  2L76 A;  3PLV A;  3QA8 A;  4W9J A;  3IG3 A;  1WF9 A;  2K8B A;  3NZU A;  5CHW A;  2KDF B;  3UQB A;  5J2R A;  4HPM B;  4FHJ A;  3RUL A;  1E8W A;  4NPN A;  2KDE B;  3W1S A;  5JHB A;  3DBR I;  2WX0 A;  4B9K A;  3AI5 A;  1E8Z A;  2FCM A;  2PJH A;  1L2N A;  4PYU A;  3TIX A;  2O2V B;  1EF5 A;  2FAZ A;  2Z0D B;  3WIM A;  2CKH B;  2J7Q B;  4K7U A;  3JYU A;  1KJT A;  4TKN A;  5AEK B;  3PGE A;  5E6O A;  3A1Q A;  4AJW A;  3IFW B;  5E6P A;  1ISN A;  2N7D A;  1VD2 A;  2EKE C;  2NS5 A;  3H1U A;  3U30 A;  2KAN A;  3B0A A;  2KFJ A;  4GSW A;  1VCB A;  3RUI B;  5CX3 A;  3WAL A;  3WAM A;  1WX7 A;  4HVB A;  2MX2 A;  2RSU A;  2JY6 A;  3RCZ A;  1OEY J;  4GGQ A;  3PRE A;  4DHJ D;  4JQW C;  4BOS C;  2WYQ A;  4WJP A;  1WZ3 A;  2IYD B;  2K6Q A;  2L8J A;  3DCG A;  3ZDT A;  4TQ0 A;  3PHW B;  4GDL A;  2ZNV B;  3OJ4 B;  4MDK E;  1WGG A;  1WM3 A;  4ZRI A;  4ANW A;  1XD3 B;  3ALB A;  4IG7 B;  2ZNV C;  2KTR A;  1WJ4 A;  2FUH B;  2GBJ A;  3PVL A;  1TZ1 A;  2LWP A;  3GZN I;  3QIJ A;  2AEH A;  3VUW A;  3RD2 A;  4BKS D;  3ZTD A;  3OJ3 A;  4CHK A;  4WWP A;  2G3Q B;  2Z59 B;  3JW0 X;  4HWI B;  1NBF C;  2PE6 B;  3VXW A;  4OVV A;  3W1S C;  3P2B A;  3ZUN A;  4NQL B;  4BKS A;  1WJ6 A;  4WAA A;  2DYO A;  3A1Q B;  1IYF A;  1YIW A;  2LVQ A;  3ML8 A;  5GMV A;  2MP2 A;  4LJP B;  1V9J A;  4EZL A;  1XT9 B;  2JT4 B;  2C9W B;  2JZ3 B;  2ZVN A;  1R4N I;  3T9L A;  3C0R B;  1RFA A;  4KIK A;  1P0R A;  4ANU A;  3L17 A;  5D94 A;  1V80 A;  2QHO A;  3O65 B;  4GDL B;  3K9P B;  4MSM B;  2GOW A;  4DHJ B;  2K6D B;  3PSE B;  3L0W B;  2C5L C;  4RM9 A;  3UF8 A;  3VTV A;  3HM3 A;  5TR5 A;  2LRW A;  2KWV B;  2KTR B;  2ZVO A;  2V1Y A;  3H9D A;  4HJK A;  3R7Q A;  5J17 A;  3KUD B;  4PS7 A;  2LGD A;  1I35 A;  4OVU A;  2O6V D;  3KYC D;  3L13 A;  4G3X B;  3VHT C;  1WZ0 A;  3CST A;  3QCA A;  3MJW A;  3PRM B;  1K8R B;  4EUT A;  1HE8 A;  2KXJ A;  3QC8 B;  2GBK A;  2KLG A;  2R2Q A;  4GMV A;  3Q3J A;  4ICU A;  3ZVV A;  4GIV A;  3SDL C;  3TJP A;  1UBQ A;  2O6V A;  3M3J A;  3V6C B;  3KVF B;  3VUY A;  5EDS A;  1SE9 A;  1YQB A;  2CHX A;  4HPL B;  4HCP B;  2J0K A;  2KNB A;  3DOW A;  3D32 A;  4W9F A;  3PPA A;  2PEA A;  3LJ3 A;  2MP2 B;  3ML9 A;  2R2O A;  3A9K A;  4W9C A;  3N3K B;  1T0Y A;  4JLC A;  4MGK E;  5BO4 B;  1GC6 A;  1KLV A;  1Z2M A;  2FIF A;  1E7V A;  1V49 A;  2JWZ A;  4BBN C;  4YL8 A;  1LQB A;  1WIA A;  3IVF A;  4I6L B;  1KM7 A;  3UIO B;  3PHX B;  3AU4 A;  1WR1 A;  2KJ6 A;  2KLC A;  4G11 A;  4KSK C;  3ZLZ A;  3JVZ X;  4MJS A;  4BBN F;  2XK5 A;  5CHV C;  3NOB A;  2LUE A;  3QQ8 B;  4HXD A;  2M0X A;  4GB9 A;  4NAW A;  5DPW A;  2C7N B;  4G0N B;  3V62 A;  2LVP A;  3PLU A;  2MBQ A;  2Z0E B;  1V5T A;  4EOY A;  4WWN A;  1S1Q B;  3CSF A;  4PS3 A;  5DPR A;  1P3Q U;  2KTF A;  4AOF A;  3JSV A;  4E3C A;  4ZYN A;  2DZJ A;  5DPS A;  3RT3 B;  4KV2 A;  2IY0 B;  2DEN B;  3X23 A;  2DX5 B;  1NDD A;  1WRD B;  2LI5 A;  2O6V B;  4GDK A;  3S2A A;  2GBR A;  2D10 A;  2FID A;  4CYE A;  3EHV A;  3ZNZ B;  1R4M I;  2MA9 B;  3QK0 A;  2REX A;  4MM3 A;  4WQO B;  3ZKJ C;  2A5U A;  1L7Y A;  3VTU A;  3ZRF A;  3VH4 B;  5JHA A;  3A9K B;  1YX5 B;  2MLB A;  3APF A;  2W9N A;  1UZX B;  2LZ6 A;  2MCN B;  3A9J A;  4KVG B;  3UQA A;  2N7E A;  2KDB A;  2KX3 A;  4KZC A;  4W9E A;  3RZW C;  3WAN A;  2D11 A;  2BF8 B;  4DWF A;  2M4N A;  1GUA B;  4JIO U;  3ZW3 A;  1RLF A;  2BWF A;  1V5O A;  4MGI E;  1S3S G;  1RAX A;  3I3T B;  2YVC A;  3NS8 A;  4EFO A;  2KOX A;  2MSE D;  2XK5 B;  1XQQ A;  5FR6 A;  3APD A;  2BPS A;  4NAW B;  2J0J A;  1J19 A;  4WJQ A;  2FCS A;  3W1Y A;  1V81 A;  2HTH A;  2KWU B;  2KJR A;  5AZG A;  2J0M A;  1Q0W B;  4FBJ B;  1OQY A;  5DPT A;  4B6W A;  3PTF C;  3PV1 A;  2AYO B;  3EFU A;  1E5W A;  2LD9 A;  2NVU I;  3QX1 A;  4PYZ A;  3N30 A;  4MEL A;  4AWJ A;  4FJZ A;  2MQJ A;  2LGY A;  1CMX B;  4FAD A;  1SGH A;  2MWS B;  4ZRJ A;  4GDK B;  1G6J A;  3QWZ B;  1WGH A;  3M63 B;  4M0W B;  3L10 B;  4EEW A;  4BFR A;  3OAW A;  2BYV E;  1EUV B;  2KQS A;  2JVC A;  3H7P A;  4I6N B;  5E6N A;  1LFD A;  1WGY A;  4ANX A;  4CO7 A;  2G45 B;  2KWC A;  1WJN A;  3A9J B;  4FJV B;  3SU8 X;  2GMI C;  4DDG D;  1F9J A;  4A20 A;  4W9I A;  2DYB A;  5LXH A;  3AU5 A;  3V60 A;  2IY1 B;  2GBN A;  2I1J A;  1WXM A;  4NQK E;  4AP4 C;  2M17 A;  3KUC B;  2N9X A;  3MHS D;  3ONS A;  4II3 B;  4KDI C;  3M62 B;  1WMH A;  4LDT D;  3ZO5 B;  1C3T A;  4B95 A;  5KHO A;  1M94 A;  2AWT A;  4TQ1 A;  3TBL D;  1Q5W B;  2KMA A;  3R7R A;  4K1R B;  2MW5 A;  2BYF A;  3H7S A;  2N9P C;  2LJ5 A;  3DBS A;  3DVN V;  3VUX A;  4M8N A;  2RD0 A;  2JZZ A;  2NBV B;  3MTN B;  4MH0 E;  1TBE A;  2K25 A;  1WYW B;  2CU1 A;  3PRZ A;  5AZF A;  3KH0 A;  5IAA C;  2BWE S;  2ZPN A;  3NY5 A;  3R66 C;  2JF5 A;  2KN5 A;  5C23 A;  1LM8 B;  1UD7 A;  4MEM A;  4AUQ C;  1D3Z A;  1E7U A;  3VTW A;  3B08 A;  2IO1 B;  3EC8 A;  3H7P B;  1I42 A;  4F7Z A;  3Q3F A;  3V61 A;  1WFY A;  4IUM B;  2IO2 B;  3B1L X;  2KFK A;  3TMP B;  1WI0 A;  2G4D B;  2LVO A;  2B3A A;  2M1M A;  3ECI A;  3OLM D;  2D2Q A;  4J6I A;  4A3P A;  4ANV A;  3NZS A;  1EO6 A;  3HK0 A;  3ZIM A;  2KKC A;  5KHQ A;  4HDQ A;  4HLE A;  4EZK A;  4URK A;  4KIK B;  2IBI B;  2NBW B;  1UEL A;  2N4F A;  3PT2 B;  3UIN B;  2MRP A;  4W9H A;  1WMH B;  4XC2 A;  2OOB B;  4A3O A;  1P9D U;  1UBI A;  2DZI A;  2EMT A;  1IP9 A;  3QAQ A;  3PRP B;  2ZJD A;  4HDO A;  2ZEQ A;  5HKH A;  4JL9 A;  2UWQ A;  3VFK A;  2AL6 A;  4LDT B;  4BVU C;  2JUO A;  4K81 A;  1WXV A;  2KVR A;  5DCN A;  4WJN A;  1P1A A;  2LAS A;  2ASQ A;  1V2Y A;  1Y8R C;  2LXA A;  2RPQ A;  2PPH A;  4MGY E;  2DAJ A;  3DPD A;  3PS6 A;  4FA6 A;  1V86 A;  5D7G A;  4E71 A;  2VRR B;  4KSL C;  2KZR A;  4XX5 A;  3RYT A;  2A4Z A;  2KK8 A;  2NBU A; 
#chains in the Genus database with same CATH topology
 1ZE3 D;  5JH5 C;  5JZE B;  4FJY A;  2N1W A;  2D3A A;  1UH6 A;  2BYE A;  3EEC A;  2KHW B;  2W3S A;  3I57 A;  3ZTC A;  1E90 A;  3NZ3 A;  4ZHP A;  4HCN B;  4RCO A;  1HA5 A;  1B9R A;  3U4E G;  4XE0 A;  2DZK A;  2MBH A;  4FHK A;  1WXQ A;  4FN2 A;  3U7Z A;  5GXG B;  1VRA B;  1YJJ A;  1SB3 C;  2WHI A;  3ETR A;  1IBX B;  2MBE A;  1WGD A;  2C60 A;  3NRZ A;  4XDC A;  2M8S A;  1KFY B;  1GB4 A;  2KC1 A;  1YJ1 A;  1GC7 A;  2QJL A;  1BML C;  1OEY A;  2VH2 A;  4WQM A;  2QDF A;  1LXD A;  5JXV A;  2J53 A;  4YTM B;  2LXC A;  3AUL A;  3BVG A;  2H88 B;  1R7S A;  3L54 A;  3VDZ A;  1SIF A;  4PS8 A;  1V97 A;  4WH4 A;  4W9L A;  3VAW A;  4NAM A;  1SEB D;  2C7H A;  2C7M B;  1U4A A;  4W9D A;  5C1Z A;  4AJY B;  2IZV B;  1WE6 A;  1WE7 A;  1LO5 D;  2NPT A;  1TY0 A;  1WM2 A;  3IBE A;  5AUK A;  2DWQ A;  4KDL B;  2PIA A;  1NI2 A;  3Q69 A;  3SR6 A;  2JRH A;  3AE1 B;  2NMQ A;  2L0F A;  1FD6 A;  5CTR C;  2RGF A;  4NNJ B;  2I1K A;  3C8Y A;  3RNC C;  1F2R I;  1WGR A;  3ENE A;  3OG5 A;  5EE9 A;  3DBH I;  1TYG B;  4WWO A;  2EMS A;  1BUI C;  1C4P A;  1P7F A;  1PQS A;  2ZCB A;  5G2N A;  1RFK A;  1FXT B;  2NR2 A;  2V3P A;  1E8X A;  3BY4 B;  1X1M A;  3X0W A;  4YSX B;  4BOZ B;  2HTM E;  1ZXH A;  2O2V A;  2K9X A;  3NS1 A;  3BYY B;  1K51 A;  3AN1 A;  3V6E B;  1WY8 A;  2UYZ B;  4N9F 4;  2LJI A;  2MBO A;  3CF6 E;  2AL3 A;  1HEZ E;  4OW0 A;  1EU3 A;  1GPX A;  4P16 A;  4I6P A;  4NJ7 A;  1RYJ A;  4AS1 A;  1LGR A;  1JCK B;  4DK5 A;  4IC7 B;  3SD5 A;  2OJR A;  2XBB C;  2CR5 A;  2V3S A;  2WXG A;  3UIP B;  4CQN A;  4JWU C;  1WRI A;  3BK2 A;  4LJO B;  3DQV A;  2OED A;  2IJ0 A;  2WGS A;  1F77 A;  1VJK A;  3UQB A;  5J2R A;  2KAC A;  3RUL A;  3W1S A;  5JHB A;  1E7P B;  2WX0 A;  1TY2 A;  2PJH A;  1L2N A;  4PYU A;  4PK1 A;  3JYU A;  1KJT A;  5AEK B;  3MHZ A;  2ONQ A;  3A1Q A;  3IFW B;  1ISN A;  2NS5 A;  2KAN A;  1XLQ A;  1VCB A;  4L1B A;  3RUI B;  2WS3 B;  1PUT A;  3WAM A;  2FUG 1;  3RCZ A;  2WXM A;  4BOS C;  2WYQ A;  4XWT A;  1WZ3 A;  4TQ0 A;  3DCG A;  4TMA B;  3AE8 B;  3OJ4 B;  4LNK A;  1JRP A;  1DOX A;  3ALB A;  2WDQ B;  2KTR A;  2GBJ A;  3VUW A;  3N1Y C;  3RD2 A;  1AW7 A;  1L6V A;  3JW0 X;  4HWI B;  3J9C A;  3VXW A;  4C4V A;  1IYF A;  4A55 A;  3N9Y C;  4EZL A;  1XT9 B;  3AV8 A;  1SXT A;  2C9W B;  4KGT A;  3U2S C;  3C0R B;  1RFA A;  4KIK A;  1P0R A;  1L0X B;  3L17 A;  5HFY A;  4GDL B;  2YEP F;  3K9P B;  1ZPS A;  4JX1 C;  2GOW A;  2V3N A;  4MSM B;  3L0W B;  3Q8A A;  4LK0 M;  5TR5 A;  2KWV B;  4R3D A;  3RPF C;  2V1Y A;  2V9H A;  4G3X B;  3QCA A;  2BVC A;  3PRM B;  1VZ6 A;  1HE8 A;  1TT5 B;  2GBK A;  3ZVV A;  3AE4 B;  2I2Y A;  3SDL C;  2O6V A;  1SE9 A;  4HCP B;  3PPA A;  4A6Q A;  1FFV A;  2PEA A;  3A9K A;  1T0Y A;  5BO4 B;  1GC6 A;  3TEZ A;  1KLV A;  4ZRP A;  4JE3 B;  4BBN C;  1KM7 A;  4KSK C;  5CHV C;  3NOB A;  4NAW A;  1YQ3 B;  3RN9 C;  2Z0E B;  4EOY A;  1T5X D;  1S1Q B;  3CSF A;  3MC9 A;  1P3Q U;  1XO3 A;  2DZJ A;  1HZ6 A;  4A8X C;  2SEB D;  3S2A A;  1IBX A;  2LMC A;  3AEB B;  4CYE A;  3ZNZ B;  2MA9 B;  1RM6 C;  1L7Y A;  3VH4 B;  3ZYY X;  2MLB A;  2WLB A;  3B9J A;  2W55 A;  4A9A A;  3A9J A;  5D3D A;  2N7E A;  1C4A A;  3L4P A;  4DXG A;  3ZW3 A;  3VR9 B;  3ZXV A;  3NS8 A;  4N59 A;  1K50 A;  2KAJ A;  2X8X X;  1XQQ A;  4DQO C;  3HVZ A;  1BXT A;  2BPS A;  2HDE A;  1J19 A;  2KWU B;  1MFW A;  3W5U B;  3RNF C;  5DPT A;  3V05 A;  1KF6 B;  1E5W A;  2NVU I;  4HKQ A;  3N30 A;  4MEL A;  1T0R C;  4FAD A;  1XF5 L;  1ROE A;  3QWZ B;  3L10 B;  4EEW A;  2W82 A;  2RPV A;  3OAW A;  2KQS A;  5E6N A;  4CO7 A;  2G45 B;  1KLG D;  3NG0 A;  3HRD D;  4W9I A;  1PDX A;  5BMG A;  3URY A;  1TKY A;  3HVD A;  3BWU D;  2M17 A;  3P42 A;  4KDI C;  4TQ1 A;  3IXS A;  3R7R A;  2MW5 A;  1PYW D;  3H7S A;  3GS2 A;  1L0V B;  2LUM A;  4M00 A;  1OQR A;  1V1O A;  2BT6 A;  2NBV B;  2PLP A;  1HZ5 A;  2N0S B;  1TBE A;  1C76 A;  2GI9 A;  1D3Z A;  1I4R A;  1XCQ L;  3EC8 A;  1I42 A;  1CZP A;  3V61 A;  3B2G A;  3B1L X;  3ECI A;  2D2Q A;  4ANV A;  1EO6 A;  4KKJ A;  4WIP A;  4URK A;  3BII D;  1UEL A;  4W9H A;  2OOB B;  1UBI A;  2DZI A;  1IP9 A;  3IT6 B;  1FNV A;  2ZJD A;  2Q5W D;  4HRS A;  4BVU C;  1YN3 A;  2KVR A;  4K81 A;  5DCN A;  1TS3 A;  2RPQ A;  2DAJ A;  3DPD A;  2VRR B;  2KZR A;  4XX5 A;  3RYT A;  1OQQ A;  4YSZ B;  3R8B A;  3SHQ A;  2QIE B;  3A33 B;  3A4S C;  1FRR A;  2QC8 A;  2J42 A;  2B76 B;  4N58 A;  2XEW A;  1ZW7 A;  1JWA D;  4NJC A;  5L83 A;  4KZ0 A;  1JRU A;  1A5R A;  2WXH A;  4IWO A;  1MJD A;  4G50 A;  4BKT A;  1WXA A;  3TEY A;  4W9G A;  2JXX A;  4C7Y A;  1D5X C;  2WDV B;  1C4C A;  5G55 A;  1FNU A;  5D3I B;  2INC C;  3JSV B;  1H8C A;  2VZK D;  2WWZ A;  3H6N A;  4NY0 A;  1GJZ A;  1WH3 A;  2OJW A;  1V1P B;  2BS4 B;  2KT7 A;  3TL5 A;  2WDR B;  4US9 A;  3VH3 B;  1YD8 U;  2K8H A;  3PZ8 A;  4IW0 A;  1TJE A;  3KUZ A;  1J0G A;  2N1V A;  3RI7 C;  1Z5S B;  3T3O A;  4H2A A;  4GN1 A;  2E6X A;  2JQR B;  1YN5 A;  1A70 A;  3N20 C;  1J7A A;  3Q3O C;  4IM3 A;  2WXP A;  4ZDV A;  3TUO A;  3NUH B;  3AE5 B;  3KYD D;  2VZK B;  1UNS A;  3GE3 C;  3VQI A;  4OZC A;  3TCA A;  4EKU A;  2K8C A;  4DBG A;  1FIQ A;  1I4P A;  1ZGU B;  1GG3 A;  1DOI A;  3ZNG C;  1E10 A;  4F1S A;  1UGM A;  3N32 A;  2JPH A;  2ZPY A;  2GLS A;  4HJG E;  4JGH B;  1ZKH A;  2JX5 A;  1B1Z A;  1V6E A;  2IO3 B;  4IWQ A;  2K5P A;  1SSN A;  4XYC A;  3ZGZ A;  3RMK C;  5HHD G;  1KTK A;  5AZH A;  4BZA A;  3RFZ B;  1L6U A;  2DAF A;  5CHF A;  1I4Q A;  2X38 A;  1JAL A;  1AAR A;  2JWU A;  5LLI A;  2L3Z A;  1ACC A;  3QAR A;  3BZD B;  2DNF A;  2WP9 B;  4RM8 A;  2FBW B;  1CQV A;  2JXT A;  3BYT B;  2KJH B;  1CJE A;  2M0A A;  2K8B A;  2INN E;  1E8W A;  1MI0 A;  3DBR I;  4B9K A;  2FE8 A;  3AI5 A;  4ARC A;  1EF5 A;  3SFE B;  1FPY A;  3PO0 A;  3WIM A;  2CKH B;  3PGE A;  3Q14 C;  1CK1 A;  2N7D A;  1SBB B;  2KFJ A;  4YSY B;  4NZL B;  4LNF A;  1L4D B;  4HVB A;  2RSU A;  2JY6 A;  3PRE A;  2WXQ A;  4JQW C;  4YXD B;  4WJP A;  2IYD B;  1L4Z B;  3PHW B;  2ZNV B;  2WXN A;  1WGG A;  4ZRI A;  3GB1 A;  4ANW A;  1XD3 B;  3Q6B A;  2LFI A;  1XEE A;  2L1A A;  2BBC A;  1TZ1 A;  1VZ7 A;  3GZN B;  4BKS D;  3OJ3 A;  4CHK A;  4WWP A;  1XXG A;  2G3Q B;  1KLU D;  3UI3 A;  3ZUN A;  1MG4 A;  1WJ6 A;  4WAA A;  1I4X A;  5GMV A;  4LJP B;  3BVM A;  2JZ3 B;  1R4N B;  3DWM A;  4ANU A;  4LNO A;  4XWW A;  1V80 A;  2MHJ A;  1D5Z C;  2BTE A;  3PSE B;  2C5L C;  3VTV A;  5J17 A;  4FXC A;  3R7Q A;  3AE3 B;  3VHT C;  2WNM A;  3CST A;  2KLG A;  4GMV A;  3Q3J A;  4RGT A;  3TJP A;  1UBQ A;  3M3J A;  3KVF B;  4RF1 A;  2V4I B;  3D32 A;  4W9F A;  4ZOH C;  1GB1 A;  3LJ3 A;  2MP2 B;  2R2O A;  5G5H A;  1TKE A;  3FC4 A;  4JLC A;  3KWV A;  2EKI A;  3WCQ A;  4I6L B;  5IO9 A;  4G11 A;  2XK5 A;  4HXD A;  1XLN A;  4GB9 A;  5DPW A;  1N5W A;  1F52 A;  4G0N B;  1AN8 A;  1VR9 A;  1ZOY B;  1V5T A;  4WWN A;  1HXY D;  3JSV A;  5DPS A;  4AQ7 A;  3RT3 B;  3X23 A;  4RGM A;  2D10 A;  4M0W A;  2RDH A;  3FKY A;  3AM9 A;  5I4D A;  3ZJT A;  1D5M C;  5JHA A;  1YX5 B;  2W9N A;  1V8C A;  4KZC A;  3Q2A C;  3IAS 1;  3RNE C;  3I3T B;  2YVC A;  3T3N A;  2IPK D;  2MSE D;  4JWS C;  3DHG C;  1WGK A;  1WWT A;  5FR6 A;  1UGJ A;  4B0M A;  4WJQ A;  5LNK 1;  3W1Y A;  5AZG A;  2HTH A;  2J0M A;  4FBJ B;  1OQY A;  4B6W A;  3PTF C;  2LD9 A;  1TKG A;  4AWJ A;  3AE7 B;  4FJZ A;  2MQJ A;  1CMX B;  3E56 A;  2MWS B;  4GDK B;  1WGH A;  1T3Q A;  4ZRQ A;  2M56 B;  3H7P A;  1LFD A;  3OWE B;  5IOI A;  2GMI C;  1JQ4 A;  5LXH A;  3AU5 A;  2IY1 B;  2I1J A;  4NQK E;  4P1B C;  4GLS C;  4II3 B;  1WMH A;  2MEK A;  4LDT D;  3ZO5 B;  5AUI A;  4RF0 A;  1M94 A;  1I4H A;  4P1C C;  2R61 A;  4K1R B;  2BYF A;  2AQ2 B;  1MHX A;  4M8N A;  2MH7 A;  4MH0 E;  5AZF A;  3NY5 A;  2RDB C;  1UD7 A;  4MEM A;  3B08 A;  3PZ7 A;  4XDD A;  2G4D B;  1DOY A;  2B3A A;  3OLM D;  4J6I A;  2TSS A;  3AE9 B;  1ENF A;  3NZS A;  3HK0 A;  1EWY C;  2KKC A;  4HDQ A;  2NBW B;  3UIN B;  2MRP A;  2WXF A;  2INP E;  2IGD A;  2EMT A;  2ZEQ A;  3KQ4 A;  4JL9 A;  3Q8F A;  2AL6 A;  4LDT B;  1PGX A;  1WXV A;  1GOZ A;  1V2Y A;  2LXA A;  2PPH A;  1M4V A;  5D7G A;  4KSL C;  2WXL A;  4OZA A;  4K7W A;  2D3G A;  1FFU A;  1WR6 E;  3AEA B;  1WX9 A;  2ICI A;  1WSP A;  1ET6 A;  3DVG Y;  1R4M B;  4TUU A;  2KFK B;  1QOB A;  4ICV A;  2AQ3 B;  4RMA A;  1PFD A;  1VLB A;  2D3C A;  1TZO A;  3HHM A;  2I38 A;  2BKF A;  1Q1O A;  1PGB A;  3ZDM C;  1SE4 A;  2Y3A A;  2PMV A;  3QHT A;  2WU2 B;  2KD0 A;  3L16 A;  3ZNI D;  1STE A;  2NCN A;  4GU2 A;  4ASW C;  5IA7 A;  2HJ1 A;  3HM6 X;  4MSQ B;  3MC8 A;  4DDI D;  2CHZ A;  1H4R A;  1JW9 D;  4ZRK A;  1TTN A;  4E74 A;  1NYQ A;  1D6E C;  2OHF A;  4MM3 B;  2V4L A;  4DHZ E;  4IWP A;  1FM0 D;  1P98 A;  3MP9 A;  5IKC M;  5J18 A;  4DHZ B;  4DXF A;  1YNT E;  2PKO A;  3K9O B;  2DYM A;  2MJE A;  3HIZ A;  2DBY A;  5C3J B;  3U8Z A;  2DZM A;  1QKZ A;  4RNA A;  3KW5 B;  3DVG X;  3IT4 B;  2Y5B B;  4FLH A;  2PE9 A;  1BT0 A;  2YLM A;  1XLP A;  4US8 A;  2IO0 B;  1NVI D;  1N62 A;  4FUL A;  3ZRC A;  2KDI A;  1C9F A;  1JRO A;  2CU3 A;  3Q8B A;  1KOT A;  3WA0 A;  3DBH B;  2FCN A;  2ZCC A;  3V3X A;  1HTO A;  1SJH D;  3GE8 C;  4IM0 A;  3P4R B;  1QOF A;  3ZQ4 A;  3AEF B;  2FNJ B;  3Q8E A;  5EE0 A;  1Q10 A;  1QLB B;  1HTQ A;  1YOV B;  1RWS A;  2CS4 A;  1TS5 A;  1F0Z A;  4OHJ A;  4M8M A;  4GOC A;  2LGX A;  1YX6 B;  2NPT B;  3U7D A;  4UDU C;  1Y56 A;  5HI1 A;  2BKR B;  2VH1 A;  2K39 A;  1E8Y A;  1GNU A;  3AED B;  2QCZ A;  2RR9 A;  2KX0 A;  1NYR A;  4IM2 A;  5FKA C;  4GXB A;  2KC2 A;  4X57 B;  3T8M A;  2BGF A;  1RRB A;  3BVZ A;  3ZXR A;  2FCQ A;  2L76 A;  3QA8 A;  2K3U A;  4W9J A;  5BMH A;  3IG3 A;  3W9C B;  2KDF B;  1N5X A;  4HPM B;  1DGJ A;  1KH0 A;  4KGR A;  4B0E A;  4NPN A;  1QIL A;  1E8Z A;  2O2V B;  2Z0D B;  1D4B A;  2J7Q B;  4TKN A;  4AJW A;  5E6P A;  3GP7 A;  2EKE C;  3H1U A;  4GSW A;  2G1E A;  5E6J A;  4ZHO A;  5CX3 A;  1MHH E;  1WX7 A;  1OEY J;  4ITK A;  2L8J A;  4OZB A;  4GDL A;  1FCL A;  4IG7 B;  2J52 A;  2ZNV C;  4YWG G;  1WJ4 A;  4KX6 B;  2JU6 X;  2LWP A;  3QIJ A;  2AEH A;  3NJT A;  3ZTD A;  2N9K A;  2PE6 B;  1UUP A;  1QOG A;  4A90 A;  2RDG A;  3A1Q B;  1N61 A;  1YIW A;  3AMZ A;  1V9J A;  3DBL B;  1C79 A;  2UU7 A;  3O65 B;  2XNA C;  1IGD A;  3UF8 A;  3HM3 A;  2KTR B;  3H9D A;  4HJK A;  2BB6 A;  3KUD B;  4PS7 A;  2O6V D;  1WZ0 A;  3QC8 B;  2KXJ A;  2R2Q A;  3EFC A;  4WUR A;  3VUY A;  4LLG M;  5EDS A;  3KLS X;  4C4V B;  3DOW A;  3LB8 C;  1T0Q C;  1VZ8 A;  3ML9 A;  4L23 A;  4ARI A;  3N3K B;  1XCT L;  1P7E A;  1Z2M A;  2FIF A;  2KYW A;  1V49 A;  2JWZ A;  1LQB A;  1WIA A;  3IVF A;  3PHX B;  2KLC A;  3ZLZ A;  4HRO A;  1L5P A;  3JVZ X;  2JYT A;  3QQ8 B;  4M01 A;  2LVP A;  3PLU A;  4M02 A;  2MBQ A;  4OVZ A;  5DPR A;  2KTF A;  1JWS D;  4ZYN A;  4KV2 A;  2IY0 B;  1YN4 A;  1NDD A;  1WRD B;  2LI5 A;  2BB5 A;  2O6V B;  2GBR A;  2W54 A;  4YTP B;  1R4M I;  3AE6 B;  2REX A;  1ZP0 B;  4MM3 A;  4WQO B;  3VTU A;  3ZRF A;  1JML A;  2BS3 B;  3A9K B;  4K3B A;  1UZX B;  2MCN B;  3UQA A;  2KX3 A;  3RNA C;  3WAN A;  3RZW C;  2BF8 B;  2M4N A;  1GUA B;  4JIO U;  1RLF A;  4MGI E;  1S3S G;  1RAX A;  4EFO A;  1WYG A;  2ZW0 A;  4NAW B;  2J0J A;  4Q2J A;  2FCS A;  1V81 A;  1I7H A;  5TSS A;  1Q0W B;  3EFU A;  3EGR A;  2MJD A;  1L0Y B;  2IGG A;  2L83 A;  4ZRJ A;  1G6J A;  3LXF A;  3SEB A;  2XN9 C;  2BYV E;  1JWM D;  2LEK A;  2JVC A;  5T8I A;  4ANX A;  3A9J B;  1IUE A;  4FJV B;  3SU8 X;  1SE3 A;  2DYB A;  3FIL B;  2GB1 A;  3V60 A;  2GBN A;  3MHS D;  2N9X A;  1FO4 A;  3ONS A;  1E9M A;  2KQ4 X;  5EE3 A;  2AQ1 B;  2CJN A;  3B2F A;  2JYE A;  4B95 A;  5KHO A;  3TBL D;  1F1H A;  2WU5 B;  2J4X A;  2N9P C;  3DBS A;  2BYT A;  2E3T A;  2RD0 A;  2EEL A;  1WYW B;  2D3B A;  3PRZ A;  2ON8 A;  2BWE S;  2ZPN A;  3ABV B;  3R66 C;  2NTS A;  2K22 A;  4RGN A;  1LM8 B;  3NVV A;  3VTW A;  4F7Z A;  4IUM B;  3TMP B;  4C00 A;  3NVW A;  1ZXI A;  4ACF A;  4TSS A;  1PGA A;  5BYQ A;  4HLE A;  4KKI A;  3N1X C;  4EZK A;  3PT2 B;  4EE2 A;  4XC2 A;  3EA6 A;  4HDO A;  2KVZ A;  5HKH A;  2UWQ A;  2JUO A;  4WJN A;  2GRI A;  4MGY E;  1Y8R C;  5G5G A;  4FA6 A;  1V86 A;  2KK8 A;  2NBU A;  4REZ A;  1ZDX A;  2DLB A;  5D2M B;  1ZUD 2;  4L2Y A;  3HUI A;  3TEW A;  5LXI B;  3DHH C;  1OTR B;  4LCD E;  3P4P B;  4WJO A;  1V1P A;  2L7R A;  2LGS A;  3VRA B;  3L08 A;  2QSD A;  4QAY A;  3M95 A;  4DXA B;  4JPS A;  1OGW A;  4MT5 A;  2DHZ A;  1NEN B;  3QJZ A;  3P4Q B;  2Y5C A;  4XZ4 A;  5HG2 A;  2H89 B;  4P6V F;  3AXC A;  4MJS B;  2BQQ A;  3BIN A;  4W9K A;  3DHI C;  1UWM A;  2HJ8 A;  3Q3N C;  4KGS A;  1NI3 A;  1EF1 A;  3WAP A;  2KQ7 A;  2N9E B;  1QQR A;  3NVY A;  3CIR B;  3AH7 A;  2L05 A;  1YMH E;  3P4S B;  4EZJ A;  3W2D A;  2PW9 A;  4NJ6 A;  1I4G A;  2ZZP B;  4TV3 A;  3DDC B;  3GOE A;  1T6B X;  2RMM A;  1FMA D;  3TEX A;  2JRI B;  2HE7 A;  4HK2 A;  3RNB C;  3DWG C;  4MGZ E;  2KMC A;  1N63 A;  1MG8 A;  3ZNH B;  1JWB D;  3R3M A;  4P7I A;  4USA A;  1TGZ B;  1J7C A;  3IHP C;  2CHW A;  2PTL A;  1C1Y B;  3DBL I;  2HD5 B;  3WAO A;  2BS2 B;  2KDM A;  2YEP B;  3IAM 1;  1IGC A;  4F8C B;  3LDZ E;  2KO3 A;  2AX5 A;  1WJU A;  2D07 B;  1J8C A;  3NHE B;  2MBB B;  4BKG A;  1QZE A;  2L52 A;  1VDV A;  4HEA 1;  3A4R A;  1F2R C;  2KN4 A;  2IND C;  2WX1 A;  5L95 C;  5H92 C;  2ACZ B;  2L00 B;  3VVW B;  1WXS A;  3PZD A;  1SIJ A;  2LRU A;  1GAQ B;  3CMM B;  1IPG A;  2K1F A;  1YQ4 B;  3APC A;  1JWU D;  5BYS A;  2L0T A;  1N60 A;  1SJE D;  4K7S A;  5MPO A;  3UGB B;  1WX8 A;  1AYF A;  2GBM A;  3DVN U;  5D6J B;  3H8H A;  2QMT A;  3RZF A;  5H8Y E;  2BW2 A;  5IP4 D;  4II2 B;  2WXJ A;  3AB5 A;  2G4S A;  2JSV X;  2WDT B;  3PLV A;  4IOI E;  1AWD A;  1FEH A;  1QOA A;  3AEG B;  1J7B A;  5CHW A;  1WF9 A;  3NZU A;  3N1Z C;  4FHJ A;  3P1M A;  2KDE B;  3DBR B;  2FCM A;  3TIX A;  2FAZ A;  2WQY B;  4K7U A;  5E6O A;  2L32 A;  4LNI A;  1VD2 A;  3FIL A;  3U30 A;  2PVG C;  3B0A A;  3NVZ A;  2IDY A;  3WAL A;  3LYY A;  2MX2 A;  4WAF A;  4GGQ A;  4DHJ D;  1FNW A;  2CJO A;  2K6Q A;  3ZDT A;  3TSS A;  2KMM A;  3U52 E;  4MDK E;  1WM3 A;  1UF0 A;  1EU4 A;  5BYR A;  1SE2 A;  4MH8 A;  2FUH B;  3PVL A;  5BMI A;  3GZN I;  2Z59 B;  3VRB B;  1NBF C;  4OVV A;  3W1S C;  3P2B A;  1ZDV A;  4NQL B;  4BKS A;  2DYO A;  2LVQ A;  1KRH A;  3ML8 A;  2WXR A;  2MP2 A;  3CWI A;  1XLO A;  2JT4 B;  2ZVN A;  1R4N I;  1NEK B;  3T9L A;  3W5V B;  4S17 A;  2PVO D;  1HQR D;  5D94 A;  2QHO A;  3P63 A;  1N6Z A;  4O1N A;  4DHJ B;  2K6D B;  4RM9 A;  1ET9 A;  2LRW A;  2ZVO A;  4YTN B;  3I63 C;  1K53 A;  2LGD A;  1I35 A;  2ZW1 A;  4OVU A;  3KYC D;  3L13 A;  3O13 A;  2K0P A;  3MJW A;  1K8R B;  4EUT A;  2Y5P A;  1YJI A;  4ICU A;  3AEC B;  4GIV A;  3V6C B;  4IKG A;  1YQB A;  2CHX A;  4HPL B;  2J0K A;  2KNB A;  4N6E B;  2QEJ C;  4W9C A;  3AEE B;  1E6E B;  2WXO A;  4MGK E;  1E7V A;  3C19 A;  2N7J A;  3ZJV A;  4YT0 B;  4YL8 A;  3UIO B;  3AU4 A;  1WR1 A;  2KJ6 A;  2N9L A;  4MJS A;  4BBN F;  5FR3 A;  2LUE A;  2M0X A;  2C7N B;  1OFF A;  1MPE A;  3V62 A;  4PS3 A;  4AOF A;  4E3C A;  1FXI A;  2DEN B;  1C78 A;  2DX5 B;  2QIL A;  3R2I A;  4XGA B;  4S0R A;  1EM7 A;  4GDK A;  1FCC C;  3E9S A;  2FID A;  3EHV A;  3QK0 A;  3ZKJ C;  2NTT A;  1TS4 A;  2A5U A;  2W3R A;  4WWM A;  2LHD A;  3APF A;  2LZ6 A;  4KVG B;  2KDB A;  1C77 A;  4W9E A;  2D5G A;  4DWF A;  2D11 A;  1E0Z A;  2BWF A;  1V5O A;  3AE2 B;  4PT5 A;  1TS2 A;  1ESF A;  4C7Z A;  4LNN A;  2KOX A;  2IGH A;  2XK5 B;  3APD A;  4RH6 A;  2KJR A;  1FXA A;  4IDI A;  4HPP A;  5FK9 C;  2KWD A;  3I9V 1;  3R2T A;  2V0G A;  3PV1 A;  2AYO B;  3QX1 A;  4PYZ A;  2WXK A;  1QT9 A;  2JZP A;  3I5J C;  3KWL A;  1QF6 A;  2LGY A;  1SGH A;  3M63 B;  4M0W B;  4BFR A;  1EUV B;  5C2T B;  4K3C A;  4I6N B;  1WGY A;  2KWC A;  1WJN A;  3Q8C A;  4DDG D;  1F9J A;  4A20 A;  4C80 A;  1T0S C;  1WXM A;  4AP4 C;  2MJ3 A;  3KUC B;  1FRD A;  1DYQ A;  2G9H D;  3M62 B;  4C56 C;  4RFB A;  2LGI A;  1C3T A;  1EWC A;  2AWT A;  1TIF A;  4RGO S;  1Q5W B;  2KMA A;  4D2K A;  2LJ5 A;  3DVN V;  3VUX A;  3FAH A;  4MAC A;  2JZZ A;  3MTN B;  2SAK A;  2K25 A;  2CU1 A;  2LHE A;  3KH0 A;  5IAA C;  2JF5 A;  2KN5 A;  3SFD B;  5C23 A;  4AUQ C;  1E7U A;  2IO1 B;  3H7P B;  3Q3F A;  3VR8 B;  1WFY A;  2IO2 B;  2KFK A;  1UWX A;  1WI0 A;  4HKZ E;  5IN7 A;  3BK1 A;  2LVO A;  2M1M A;  3MJ5 A;  3MC0 B;  4A3P A;  1MVK A;  3ZIM A;  4LTU A;  5KHQ A;  3MFG A;  5EE1 A;  4KIK B;  2IBI B;  2N4F A;  3EUB 2;  2M19 A;  1WMH B;  1SF0 A;  4A3O A;  1P9D U;  3QAQ A;  3PRP B;  3Q3M C;  4ZYS A;  2Z8L A;  2WXI A;  3RNG C;  3VFK A;  4BAX A;  1P1A A;  2LAS A;  2ASQ A;  1K52 A;  3PS6 A;  3ZJU A;  4E71 A;  2A4Z A;  4J3O D; 
#chains in the Genus database with same CATH homology
 4K7W A;  3SHQ A;  3A33 B;  3A4S C;  2D3G A;  5D2M B;  1WR6 E;  5JH5 C;  1WX9 A;  5JZE B;  4FJY A;  2N1W A;  5LXI B;  1UH6 A;  3DVG Y;  2BYE A;  3EEC A;  4TUU A;  2KFK B;  1OTR B;  2KHW B;  4LCD E;  4WJO A;  2L7R A;  2XEW A;  4ICV A;  3ZTC A;  1ZW7 A;  3L08 A;  4RMA A;  5L83 A;  1E90 A;  3M95 A;  4KZ0 A;  4DXA B;  1OGW A;  2DHZ A;  1JRU A;  3HHM A;  1A5R A;  2BKF A;  4IWO A;  1Q1O A;  3ZDM C;  3QJZ A;  4HCN B;  4XZ4 A;  4G50 A;  4BKT A;  1WXA A;  3QHT A;  2KD0 A;  4W9G A;  3AXC A;  3L16 A;  4MJS B;  2JXX A;  3BIN A;  2DZK A;  4W9K A;  2MBH A;  4FHK A;  3ZNI D;  2HJ8 A;  5G55 A;  2NCN A;  4GU2 A;  4ASW C;  5IA7 A;  4FN2 A;  3HM6 X;  1EF1 A;  3WAP A;  4MSQ B;  3JSV B;  1H8C A;  2WWZ A;  3H6N A;  4DDI D;  2KQ7 A;  2CHZ A;  2N9E B;  1H4R A;  4NY0 A;  4ZRK A;  1GJZ A;  1TTN A;  4E74 A;  2MBE A;  1WGD A;  1WH3 A;  2C60 A;  2L05 A;  2M8S A;  3TL5 A;  2KC1 A;  1YJ1 A;  2V4L A;  4DHZ E;  1GC7 A;  4EZJ A;  4IWP A;  1OEY A;  1P98 A;  3VH3 B;  4NJ6 A;  1LXD A;  1YD8 U;  2K8H A;  5J18 A;  2ZZP B;  4DHZ B;  4IW0 A;  2LXC A;  4TV3 A;  3AUL A;  3DDC B;  3GOE A;  3KUZ A;  1J0G A;  3L54 A;  3VDZ A;  1SIF A;  2N1V A;  2DYM A;  3K9O B;  4PS8 A;  1Z5S B;  2JRI B;  2HE7 A;  3HIZ A;  4HK2 A;  4MGZ E;  2KMC A;  4W9L A;  1MG8 A;  3U8Z A;  2DZM A;  3VAW A;  3ZNH B;  2C7H A;  3R3M A;  4P7I A;  2C7M B;  1U4A A;  4GN1 A;  4W9D A;  1TGZ B;  5C1Z A;  3KW5 B;  4AJY B;  2IZV B;  3IHP C;  1WE6 A;  2CHW A;  3DVG X;  1WE7 A;  2Y5B B;  4FLH A;  2NPT A;  4IM3 A;  3IBE A;  1WM2 A;  4ZDV A;  1C1Y B;  2PE9 A;  3DBL I;  1BT0 A;  2YLM A;  2HD5 B;  3WAO A;  3KYD D;  4KDL B;  4F8C B;  1NI2 A;  3VQI A;  4EKU A;  3TCA A;  2IO0 B;  2JRH A;  2L0F A;  2K8C A;  3LDZ E;  2KO3 A;  2RGF A;  4FUL A;  4NNJ B;  5CTR C;  4DBG A;  3ZRC A;  2KDI A;  1WJU A;  2D07 B;  2I1K A;  1J8C A;  3NHE B;  1ZGU B;  2MBB B;  4BKG A;  1QZE A;  1WGR A;  3ENE A;  3WA0 A;  1KOT A;  1GG3 A;  2FCN A;  2ZCC A;  3A4R A;  3DBH I;  3ZNG C;  4F1S A;  4WWO A;  1UGM A;  2WX1 A;  2EMS A;  3N32 A;  2JPH A;  2ZPY A;  5L95 C;  1PQS A;  2ZCB A;  5G2N A;  4IM0 A;  4JGH B;  1ZKH A;  1FXT B;  1V6E A;  2FNJ B;  2IO3 B;  4IWQ A;  2NR2 A;  2L00 B;  1E8X A;  3VVW B;  3BY4 B;  1X1M A;  1WXS A;  3X0W A;  2CS4 A;  3PZD A;  4BOZ B;  2LRU A;  3CMM B;  1IPG A;  2K1F A;  2O2V A;  4M8M A;  4GOC A;  2LGX A;  1YX6 B;  2NPT B;  3APC A;  3V6E B;  5AZH A;  3U7D A;  2L0T A;  1WY8 A;  2UYZ B;  2DAF A;  5CHF A;  4N9F 4;  2MBO A;  3CF6 E;  2BKR B;  2K39 A;  1AAR A;  2AL3 A;  1E8Y A;  1GNU A;  4K7S A;  5LLI A;  3UGB B;  2L3Z A;  1WX8 A;  2RR9 A;  4I6P A;  3QAR A;  4NJ7 A;  2GBM A;  2KX0 A;  3DVN U;  4DK5 A;  5D6J B;  4IC7 B;  3SD5 A;  2OJR A;  2XBB C;  4RM8 A;  4IM2 A;  2CR5 A;  3RZF A;  2V3S A;  3UIP B;  4GXB A;  2KC2 A;  4X57 B;  4II2 B;  3T8M A;  2BGF A;  2G4S A;  1RRB A;  4LJO B;  2KJH B;  2WDT B;  3DQV A;  2FCQ A;  2L76 A;  3PLV A;  3QA8 A;  4W9J A;  3IG3 A;  1WF9 A;  2K8B A;  3NZU A;  5CHW A;  2KDF B;  3UQB A;  5J2R A;  4HPM B;  4FHJ A;  3RUL A;  1E8W A;  4NPN A;  2KDE B;  3W1S A;  5JHB A;  3DBR I;  2WX0 A;  4B9K A;  3AI5 A;  1E8Z A;  2FCM A;  2PJH A;  1L2N A;  4PYU A;  3TIX A;  2O2V B;  1EF5 A;  2FAZ A;  2Z0D B;  3WIM A;  2CKH B;  2J7Q B;  4K7U A;  3JYU A;  1KJT A;  4TKN A;  5AEK B;  3PGE A;  5E6O A;  3A1Q A;  4AJW A;  3IFW B;  5E6P A;  1ISN A;  2N7D A;  1VD2 A;  2EKE C;  2NS5 A;  3H1U A;  3U30 A;  2KAN A;  3B0A A;  2KFJ A;  4GSW A;  1VCB A;  3RUI B;  5CX3 A;  3WAL A;  3WAM A;  1WX7 A;  4HVB A;  2MX2 A;  2RSU A;  2JY6 A;  3RCZ A;  1OEY J;  4GGQ A;  3PRE A;  4DHJ D;  4JQW C;  4BOS C;  2WYQ A;  4WJP A;  1WZ3 A;  2IYD B;  2K6Q A;  2L8J A;  3DCG A;  3ZDT A;  4TQ0 A;  3PHW B;  4GDL A;  2ZNV B;  3OJ4 B;  4MDK E;  1WGG A;  1WM3 A;  4ZRI A;  4ANW A;  1XD3 B;  3ALB A;  4IG7 B;  2ZNV C;  2KTR A;  1WJ4 A;  2FUH B;  2GBJ A;  3PVL A;  1TZ1 A;  2LWP A;  3GZN I;  3QIJ A;  2AEH A;  3VUW A;  3RD2 A;  4BKS D;  3ZTD A;  3OJ3 A;  4CHK A;  4WWP A;  2G3Q B;  2Z59 B;  3JW0 X;  4HWI B;  1NBF C;  2PE6 B;  3VXW A;  4OVV A;  3W1S C;  3P2B A;  3ZUN A;  4NQL B;  4BKS A;  1WJ6 A;  4WAA A;  2DYO A;  3A1Q B;  1IYF A;  1YIW A;  2LVQ A;  3ML8 A;  5GMV A;  2MP2 A;  4LJP B;  1V9J A;  4EZL A;  1XT9 B;  2JT4 B;  2C9W B;  2JZ3 B;  2ZVN A;  1R4N I;  3T9L A;  3C0R B;  1RFA A;  4KIK A;  1P0R A;  4ANU A;  3L17 A;  5D94 A;  1V80 A;  2QHO A;  3O65 B;  4GDL B;  3K9P B;  4MSM B;  2GOW A;  4DHJ B;  2K6D B;  3PSE B;  3L0W B;  2C5L C;  4RM9 A;  3UF8 A;  3VTV A;  3HM3 A;  5TR5 A;  2LRW A;  2KWV B;  2KTR B;  2ZVO A;  2V1Y A;  3H9D A;  4HJK A;  3R7Q A;  5J17 A;  3KUD B;  4PS7 A;  2LGD A;  1I35 A;  4OVU A;  2O6V D;  3KYC D;  3L13 A;  4G3X B;  3VHT C;  1WZ0 A;  3CST A;  3QCA A;  3MJW A;  3PRM B;  1K8R B;  4EUT A;  1HE8 A;  2KXJ A;  3QC8 B;  2GBK A;  2KLG A;  2R2Q A;  4GMV A;  3Q3J A;  4ICU A;  3ZVV A;  4GIV A;  3SDL C;  3TJP A;  1UBQ A;  2O6V A;  3M3J A;  3V6C B;  3KVF B;  3VUY A;  5EDS A;  1SE9 A;  1YQB A;  2CHX A;  4HPL B;  4HCP B;  2J0K A;  2KNB A;  3DOW A;  3D32 A;  4W9F A;  3PPA A;  2PEA A;  3LJ3 A;  2MP2 B;  3ML9 A;  2R2O A;  3A9K A;  4W9C A;  3N3K B;  1T0Y A;  4JLC A;  4MGK E;  5BO4 B;  1GC6 A;  1KLV A;  1Z2M A;  2FIF A;  1E7V A;  1V49 A;  2JWZ A;  4BBN C;  4YL8 A;  1LQB A;  1WIA A;  3IVF A;  4I6L B;  1KM7 A;  3UIO B;  3PHX B;  3AU4 A;  1WR1 A;  2KJ6 A;  2KLC A;  4G11 A;  4KSK C;  3ZLZ A;  3JVZ X;  4MJS A;  4BBN F;  2XK5 A;  5CHV C;  3NOB A;  2LUE A;  3QQ8 B;  4HXD A;  2M0X A;  4GB9 A;  4NAW A;  5DPW A;  2C7N B;  4G0N B;  3V62 A;  2LVP A;  3PLU A;  2MBQ A;  2Z0E B;  1V5T A;  4EOY A;  4WWN A;  1S1Q B;  3CSF A;  4PS3 A;  5DPR A;  1P3Q U;  2KTF A;  4AOF A;  3JSV A;  4E3C A;  4ZYN A;  2DZJ A;  5DPS A;  3RT3 B;  4KV2 A;  2IY0 B;  2DEN B;  3X23 A;  2DX5 B;  1NDD A;  1WRD B;  2LI5 A;  2O6V B;  4GDK A;  3S2A A;  2GBR A;  2D10 A;  2FID A;  4CYE A;  3EHV A;  3ZNZ B;  1R4M I;  2MA9 B;  3QK0 A;  2REX A;  4MM3 A;  4WQO B;  3ZKJ C;  2A5U A;  1L7Y A;  3VTU A;  3ZRF A;  3VH4 B;  5JHA A;  3A9K B;  1YX5 B;  2MLB A;  3APF A;  2W9N A;  1UZX B;  2LZ6 A;  2MCN B;  3A9J A;  4KVG B;  3UQA A;  2N7E A;  2KDB A;  2KX3 A;  4KZC A;  4W9E A;  3RZW C;  3WAN A;  2D11 A;  2BF8 B;  4DWF A;  2M4N A;  1GUA B;  4JIO U;  3ZW3 A;  1RLF A;  2BWF A;  1V5O A;  4MGI E;  1S3S G;  1RAX A;  3I3T B;  2YVC A;  3NS8 A;  4EFO A;  2KOX A;  2MSE D;  2XK5 B;  1XQQ A;  5FR6 A;  3APD A;  2BPS A;  4NAW B;  2J0J A;  1J19 A;  4WJQ A;  2FCS A;  3W1Y A;  1V81 A;  2HTH A;  2KWU B;  2KJR A;  5AZG A;  2J0M A;  1Q0W B;  4FBJ B;  1OQY A;  5DPT A;  4B6W A;  3PTF C;  3PV1 A;  2AYO B;  3EFU A;  1E5W A;  2LD9 A;  2NVU I;  3QX1 A;  4PYZ A;  3N30 A;  4MEL A;  4AWJ A;  4FJZ A;  2MQJ A;  2LGY A;  1CMX B;  4FAD A;  1SGH A;  2MWS B;  4ZRJ A;  4GDK B;  1G6J A;  3QWZ B;  1WGH A;  3M63 B;  4M0W B;  3L10 B;  4EEW A;  4BFR A;  3OAW A;  2BYV E;  1EUV B;  2KQS A;  2JVC A;  3H7P A;  4I6N B;  5E6N A;  1LFD A;  1WGY A;  4ANX A;  4CO7 A;  2G45 B;  2KWC A;  1WJN A;  3A9J B;  4FJV B;  3SU8 X;  2GMI C;  4DDG D;  1F9J A;  4A20 A;  4W9I A;  2DYB A;  5LXH A;  3AU5 A;  3V60 A;  2IY1 B;  2GBN A;  2I1J A;  1WXM A;  4NQK E;  4AP4 C;  2M17 A;  3KUC B;  2N9X A;  3MHS D;  3ONS A;  4II3 B;  4KDI C;  3M62 B;  1WMH A;  4LDT D;  3ZO5 B;  1C3T A;  4B95 A;  5KHO A;  1M94 A;  2AWT A;  4TQ1 A;  3TBL D;  1Q5W B;  2KMA A;  3R7R A;  4K1R B;  2MW5 A;  2BYF A;  3H7S A;  2N9P C;  2LJ5 A;  3DBS A;  3DVN V;  3VUX A;  4M8N A;  2RD0 A;  2JZZ A;  2NBV B;  3MTN B;  4MH0 E;  1TBE A;  2K25 A;  1WYW B;  2CU1 A;  3PRZ A;  5AZF A;  3KH0 A;  5IAA C;  2BWE S;  2ZPN A;  3NY5 A;  3R66 C;  2JF5 A;  2KN5 A;  5C23 A;  1LM8 B;  1UD7 A;  4MEM A;  4AUQ C;  1D3Z A;  1E7U A;  3VTW A;  3B08 A;  2IO1 B;  3EC8 A;  3H7P B;  1I42 A;  4F7Z A;  3Q3F A;  3V61 A;  1WFY A;  4IUM B;  2IO2 B;  3B1L X;  2KFK A;  3TMP B;  1WI0 A;  2G4D B;  2LVO A;  2B3A A;  2M1M A;  3ECI A;  3OLM D;  2D2Q A;  4J6I A;  4A3P A;  4ANV A;  3NZS A;  1EO6 A;  3HK0 A;  3ZIM A;  2KKC A;  5KHQ A;  4HDQ A;  4HLE A;  4EZK A;  4URK A;  4KIK B;  2IBI B;  2NBW B;  1UEL A;  2N4F A;  3PT2 B;  3UIN B;  2MRP A;  4W9H A;  1WMH B;  4XC2 A;  2OOB B;  4A3O A;  1P9D U;  1UBI A;  2DZI A;  2EMT A;  1IP9 A;  3QAQ A;  3PRP B;  2ZJD A;  4HDO A;  2ZEQ A;  5HKH A;  4JL9 A;  2UWQ A;  3VFK A;  2AL6 A;  4LDT B;  4BVU C;  2JUO A;  4K81 A;  1WXV A;  2KVR A;  5DCN A;  4WJN A;  1P1A A;  2LAS A;  2ASQ A;  1V2Y A;  1Y8R C;  2LXA A;  2RPQ A;  2PPH A;  4MGY E;  2DAJ A;  3DPD A;  3PS6 A;  4FA6 A;  1V86 A;  5D7G A;  4E71 A;  2VRR B;  4KSL C;  2KZR A;  4XX5 A;  3RYT A;  2A4Z A;  2KK8 A;  2NBU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...