2M17A

Ubiquitin-like domain-containing c-terminal domain phosphatase (ublcp1)
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
81
structure length
81
Chain Sequence
MALPIIVKWGGQEYSVTTLSEDDTVLDLKQFLKTLTGVLPERQKLLGLKVKGKPAENDVKLGALKLKPNTKIMMMGTREES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Ubiquitin-like domain-containing CTD phosphatase 1
publication title Solution Structure and Rpn1 Interaction of the UBL Domain of Human RNA Polymerase II C-Terminal Domain Phosphatase.
pubmed doi rcsb
source organism Homo sapiens
total genus 8
structure length 81
sequence length 81
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2012-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2m17A00
3K9OB 1LFDA 2C9WB 2KFKB 2O6VD 1VD2A 2DZKA 3PV1A 1KOTA 4WJNA 2JRHA 1UH6A 3ONSA 1P9DU 4A20A 1L7YA 4GXBA 2IZVB 3KUZA 4KIKA 2YVCA 2GMIC 2LVQA 3ZDMC 3A9JA 3VUYA 2N7DA 4F7ZA 2I1KA 4FULA 2JT4B 1V49A 3JSVB 3A9KB 4HPMB 4BBNC 2LVOA 1SE9A 3CMMB 3BINA 3RYTA 4GIVA 2KOXA 4MGKE 2MQJA 1IPGA 1OTRB 3VTUA 5E6OA 3ZUNA 1OEYA 3PGEA 2KLGA 2JUOA 2BF8B 4YL8A 3QA8A 5GMVA 2K8BA 3VAWA 3SD5A 3L10B 1WX8A 5L83A 4FN2A 1P3QU 1WJ6A 2C5LC 3NHEB 2DX5B 5D2MB 2KQSA 3IHPC 1IP9A 1QZEA 4JL9A 1BT0A 3ZIMA 4B9KA 3NY5A 3L13A 4IWOA 5G2NA 4FLHA 5EDSA 4E3CA 4HLEA 2NPTA 3EC8A 3A33B 4NJ6A 1P1AA 4AOFA 4CHKA 3IFWB 1T0YA 2LGYA 2MRPA 2KLCA 1WM2A 2LJ5A 5DPTA 1YQBA 3JYUA 4HVBA 3ZW3A 1WIAA 4DDGD 2FCNA 2KC1A 3KH0A 4II2B 3V61A 2IO3B 4WJPA 2M17A 1P0RA 1WJ4A 2GOWA 2JY6A 2K8HA 4KVGB 1Y8RC 2DZIA 2N9XA 4MGYE 2R2OA 4KDLB 5D6JB 4GSWA 3PRPB 1E7VA 5J17A 4M8MA 3CF6E 2RD0A 3L16A 2MLBA 3R66C 2KN5A 2KZRA 4RM8A 3ZDTA 2BPSA 3A9JB 1CMXB 3A4RA 2KC2A 1UBQA 4ANXA 3B08A 2JRIB 2N7EA 4NY0A 5CHWA 1RFAA 3UF8A 2J0JA 1WXVA 2J7QB 4GOCA 3ZNID 3M95A 3MHSD 2Z0DB 3UGBB 2KWVB 2KDIA 2AL3A 2LWPA 4WQOB 4FJYA 2D3GA 4DWFA 5D94A 4KV2A 4KZCA 1I35A 2CS4A 3SDLC 4EOYA 1WFYA 2G3QB 5AZGA 3M62B 4B6WA 3L0WB 1WGYA 2LD9A 2MBHA 2KKCA 4MGIE 1ZKHA 2NPTB 4KZ0A 2L0FA 1FXTB 4GDLA 4BOSC 2G4SA 3W1YA 2FAZA 3ENEA 4TQ0A 3RD2A 4LDTB 2XK5A 3JSVA 4IM2A 1ZW7A 2ZZPB 1EUVB 2NVUI 3UIPB 1TBEA 2AYOB 1TGZB 3RCZA 3DBRI 4BFRA 4AWJA 3H9DA 3HHMA 3NZSA 3DVNU 3WANA 2KTFA 4J6IA 4PS7A 3QX1A 1WX9A 1JRUA 2JPHA 4NQKE 5JHBA 5AZHA 1V2YA 1V6EA 4IUMB 2AWTA 2UWQA 5CTRC 4MELA 2C7MB 3DDCB 2JWZA 3B1LX 2ZPYA 2CHXA 4HPLB 4PYZA 2DYBA 2KD0A 2KDEB 3KUDB 4RMAA 1D3ZA 1HE8A 2LASA 2ZVNA 2K1FA 4IM3A 3RZFA 2GBNA 2MBOA 4GMVA 5J2RA 4KSKC 3L54A 2M1MA 1UD7A 2IBIB 4MDKE 3TJPA 1R4NI 5G55A 4GB9A 3R7QA 1WR6E 4EUTA 3UQBA 3ZVVA 4KSLC 1U4AA 2M4NA 4P7IA 2J0KA 1J8CA 2FCMA 4W9LA 4ZRKA 2MCNB 2V3SA 4GDLB 3EHVA 3AXCA 5IA7A 3APDA 5AEKB 3APFA 2C60A 2OJRA 2XK5B 4MSQB 4W9DA 2LXAA 3Q3FA 4WWNA 1ISNA 1UGMA 2KDBA 3R3MA 2WDTB 3V60A 4MEMA 3ZRCA 2LXCA 3MJWA 4ZYNA 2IY0B 3M63B 4PS8A 5D7GA 2AL6A 2AEHA 2BYVE 4MJSA 3ECIA 1S1QB 4HDQA 2CU1A 2N4FA 3DVGX 4AP4C 2PEAA 2L3ZA 4ICVA 3PVLA 1EF1A 2BKFA 2YLMA 1WE6A 2IO0B 3VUWA 5L95C 2DZJA 2DENB 4ZRJA 3VUXA 1C1YB 5J18A 3RULA 1K8RB 2KNBA 2LGXA 4EZLA 3K9PB 4LJOB 1WGDA 3LDZE 2N9EB 3N32A 3P2BA 4GN1A 4HXDA 4XC2A 3A1QA 4HCNB 4K1RB 4W9EA 2MSED 3C0RB 3JW0X 4HWIB 2JXXA 1WX7A 3H7PA 3N30A 2L7RA 4FJZA 2ZCCA 4OVUA 3A4SC 3PRZA 3R7RA 2K8CA 3L08A 4BKSA 3H7SA 2NBWB 3ZNGC 2CHWA 3ML8A 4URKA 4K7SA 3T8MA 3WA0A 2LUEA 4LDTD 1WZ3A 2KWUB 5KHOA 4NAWA 1Q5WB 1UELA 2Z59B 4ANWA 1LXDA 3EECA 4WJQA 1VCBA 4WJOA 3B0AA 1V5OA 1H4RA 2J0MA 2K6QA 2LGDA 3PLVA 3IVFA 4NJ7A 2IY1B 4WWOA 4MH0E 3VXWA 2KDFB 3HK0A 3PZDA 1V9JA 2OOBB 2BKRB 4E71A 5CX3A 3RUIB 3PSEB 4B95A 2O2VA 2QHOA 4I6LB 2I1JA 1WF9A 1GG3A 3UINB 2MBBB 4MJSB 2M0XA 4W9FA 3VFKA 3KYCD 2FIDA 1Z2MA 2PE9A 2KJ6A 3HM3A 2K25A 1E8XA 2DHZA 1V5TA 2A4ZA 2KO3A 2L8JA 2R2QA 2VRRB 3PT2B 1R4MI 3V6CB 4FA6A 2HJ8A 2KJRA 1UZXB 4DK5A 3KYDD 1AARA 3LJ3A 4X57B 1WMHA 4I6NB 2NS5A 2B3AA 3HIZA 2ZEQA 3BY4B 3VQIA 4FADA 1H8CA 4FJVB 2D11A 2IO2B 2K6DB 1V86A 3A1QB 3DOWA 3N3KB 1X1MA 4FHJA 3TBLD 3WIMA 2KX3A 4MSMB 1RAXA 1RLFA 1WXAA 2KTRA 2XEWA 2FCSA 3H6NA 4KDIC 3H7PB 2WYQA 4W9JA 3L17A 4BKTA 3ZNHB 1E8WA 2CKHB 2XBBC 4PYUA 3PREA 1WJUA 2GBRA 1KM7A 3DVGY 4IWQA 2WX1A 3PRMB 4TUUA 3U7DA 1GNUA 2ASQA 2RR9A 3QC8B 4G3XB 1WM3A 4IWPA 3VTWA 3QCAA 4DDID 2HD5B 2DZMA 1E7UA 4NAWB 4BKGA 4DHJB 5CHFA 1J0GA 4NQLB 3M3JA 2FNJB 1YX5B 2BYFA 3AU5A 2KMAA 5C23A 4G50A 2LI5A 5E6PA 4BBNF 3KUCB 5JHAA 2D10A 5BO4B 3ZRFA 3WAPA 2MBQA 4W9CA 1WGHA 1IYFA 3GOEA 1V80A 2CR5A 2O2VB 3DBSA 4DHZE 3X0WA 2LZ6A 2M8SA 2G45B 4MGZE 1YX6B 4ZRIA 4LJPB 2ZCBA 3EFUA 2HTHA 1V81A 2DYOA 3IG3A 1M94A 4IW0A 1SGHA 3I3TB 5C1ZA 2KQ7A 3VVWB 1WMHB 2KVRA 2L0TA 2N9PC 1WGRA 4HDOA 4PS3A 1YJ1A 1L2NA 1F9JA 4EFOA 2KWCA 4W9GA 3TL5A 3S2AA 2LVPA 2WWZA 4K7WA 1OEYJ 2O6VA 2KTRB 3QJZA 1WI0A 3V6EB 1KLVA 1E5WA 2GBKA 4JQWC 1NI2A 1GC6A 4TQ1A 3PLUA 3DCGA 4I6PA 3U8ZA 2NR2A 3SHQA 2KXJA 4ZDVA 1Q1OA 5HKHA 3CSTA 2ZPNA 3CSFA 2NBVB 1S3SG 1LM8B 1OQYA 3VH3B 1NBFC 1E90A 2FUHB 4RM9A 2NCNA 2FIFA 5JH5C 1P98A 1XD3B 2KMCA 3QQ8B 4GU2A 3TMPB 1J19A 3DPDA 3OJ3A 4TV3A 1GC7A 3KVFB 1WXMA 4FHKA 1KJTA 2PPHA 2IO1B 4NPNA 3QIJA 4W9KA 4CO7A 4IG7B 1YD8U 4TKNA 3KW5B 5E6NA 4MM3A 2KHWB 4K7UA 3X23A 3ZO5B 2MWSB 2ZNVB 3WALA 3VHTC 2JZZA 2BWES 2V1YA 3QK0A 1WJNA 3WAMA 3ZNZB 3IBEA 4GDKA 2Z0EB 1GUAB 2A5UA 4WAAA 4CYEA 2ZNVC 2Y5BB 5FR6A 3QWZB 1EO6A 2REXA 3H1UA 2WX0A 1XT9B 3PPAA 2KX0A 1UBIA 3QARA 4BKSD 1WGGA 1WZ0A 5TR5A 1Q0WB 3DVNV 2MP2A 4IM0A 4LCDE 2O6VB 2GBJA 2LRUA 3PS6A 2EMTA 3VTVA 4DHJD 4II3B 3DBHI 2EMSA 3SU8X 1WY8A 3W1SA 4EEWA 2JVCA 1XQQA 4G0NB 2G4DB 2DAFA 2N1VA 4HCPB 4WWPA 5LXIB 2KANA 2JF5A 5DPRA 5IAAC 4JLCA 4DBGA 4DHZB 4F1SA 2PJHA 3QAQA 4AJWA 4KIKB 2V4LA 2K39A 2KJHB 4HK2A 2GBMA 4EZJA 2BGFA 4OVVA 4A3PA 5DPSA 3ZLZA 2LRWA 3PHWB 3HM6X 2L76A 4G11A 2N1WA 3ALBA 4JGHB 2KK8A 2RSUA 1Z5SB 5DPWA 3QHTA 4N9F4 3UIOB 3AU4A 3NS8A 4F8CB 2FCQA 4GDKB 1WYWB 4BOZB 1E8ZA 2MA9B 3VDZA 2L00B 2KFKA 2MW5A 3APCA 2BYEA 3ZTCA 4ANVA 5AZFA 2NBUA 1WE7A 3OJ4B 3GZNI 3UQAA 3Q3JA 3AI5A 4ICUA 2MP2B 5JZEB 2D2QA 4M0WB 4XZ4A 4BVUC 4IC7B 4DXAB 2C7HA 2CHZA 4EZKA 3NZUA 3WAOA 3U30A 4FBJB 3A9KA 1WR1A 3PTFC 2PE6B 1A5RA 1PQSA 3DBLI 3TCAA 1MG8A 2RPQA 1E8YA 1OGWA 1TTNA 4NNJB 3ZKJC 5KHQA 3NOBA 2ZJDA 3D32A 2C7NB 2UYZB 1GJZA 4A3OA 1ZGUB 5LXHA 3ZTDA 1C3TA 2RGFA 3OAWA 3JVZX 2EKEC 3W1SC 4M8NA 1TZ1A 3O65B 2DAJA 4ANUA 3AULA 2D07B 5CHVC 3MTNB 2DYMA 4W9IA 2BWFA 3RZWC 2W9NA 1YIWA 2MX2A 4GGQA 2JZ3B 4K81A 1WRDB 2IYDB 2L05A 5DCNA 1I42A 4E74A 4W9HA 1RRBA 2KFJA 3V62A 2HE7A 4AUQC 1EF5A 4AJYB 4XX5A 3T9LA 1WH3A 4HJKA 4ASWC 3OLMD 2MBEA 3PHXB 3VH4B 3ML9A 1NDDA 4EKUA 1G6JA 3TIXA 1SIFA 4JIOU 5LLIA 3RT3B 1LQBA 1WXSA 2ZVOA 3DQVA
chains in the Genus database with same CATH superfamily
4QAYA 2C9WB 1FO4A 2JRHA 4J3OD 1AYFA 1P9DU 4A20A 4GXBA 1DOXA 3KUZA 4FULA 4HPMB 3MJ5A 1FM0D 3CMMB 3BINA 3RYTA 2MQJA 1KLGD 1IPGA 1OTRB 4P16A 1ET6A 1OEYA 2JUOA 5GMVA 3AN1A 3PO0A 2K8BA 3VAWA 3U4EG 5IKCM 1NEKB 4LNKA 2C5LC 2KQSA 3HUIA 1QZEA 1L0XB 1BT0A 4XE0A 5EDSA 1UGJA 3EC8A 1P7EA 1T0YA 4IKGA 1WM2A 4A55A 2JWUA 2JYEA 3KH0A 2KC1A 4II2B 2IO3B 3HVZA 2K3UA 2K8HA 1N63A 1VZ7A 1FXAA 4MGYE 1XEEA 1RFKA 1MJDA 2BS2B 3CF6E 2JYTA 3L16A 3R66C 4RF0A 2KN5A 2BPSA 1F52A 4ANXA 4YSXB 1RFAA 3UF8A 1HTOA 3GE8C 3HVDA 2SEBD 3MHSD 3ZYYX 2LWPA 2PKOA 3DBLB 4XYCA 2D3GA 5D94A 4KV2A 2V9HA 5AZGA 3M62B 2M56B 2NPTB 3P63A 4KZ0A 2Y3AA 4REZA 2H88B 2INPE 3BYTB 2G4SA 3RD2A 1I7HA 1OFFA 5G5HA 4LDTB 5BYQA 2XK5A 2VH2A 2LJIA 4B0MA 3AE2B 4JE3B 3NZSA 1D4BA 1JRUA 1FNWA 1V2YA 3AE4B 2BTEA 1YQ4B 2UWQA 1T3QA 4MELA 2CJOA 4CQNA 4HPLB 2DYBA 1K53A 4XWTA 2WXFA 3RZFA 1SBBB 4GMVA 3DHHC 3L54A 4XGAB 3FKYA 5G55A 1WR6E 3Q6BA 4KSLC 4ZRKA 3AXCA 4WH4A 3NUHB 5AEKB 1YOVB 3R2IA 2WXNA 4WWNA 2GB1A 4YSYB 2LXCA 3MJWA 2QILA 3M63B 4PS8A 2AL6A 1SIJA 2AEHA 3Q2AC 2BQQA 3ECIA 3VRAB 2CU1A 2N4FA 5BYRA 3Q14C 1MHXA 2PEAA 3VR8B 3C8YA 1EF1A 2YLMA 3PVLA 1WE6A 1RYJA 2DENB 5D3IB 2LGXA 3K9PB 4HXDA 4XC2A 4HCNB 4P1CC 4M02A 1FCCC 2MSED 3P4SB 1YJIA 4HWIB 2L7RA 3PRZA 2K0PA 2WLBA 3L08A 4KGSA 3H7SA 3E56A 3ZNGC 3ML8A 3SFDB 4URKA 3T8MA 1MG4A 2LUEA 3N20C 2E3TA 5KHOA 1Q5WB 1UELA 3E9SA 1VCBA 1V5OA 1UWXA 2J0MA 2RDHA 3P4PB 2LGDA 1L6UA 4BAXA 4MH0E 1XLPA 2KDFB 3P42A 3U2SC 1V9JA 4B95A 2O2VA 1GG3A 3DHGC 3UINB 4MJSB 1A70A 3VFKA 2V3NA 2PE9A 2L8JA 1V5TA 3V6CB 4FA6A 1ACCA 2KJRA 4MT5A 1AARA 2L83A 1IBXA 2NS5A 1E9MA 3VQIA 1H8CA 2K6DB 2W3RA 3IT4B 3WIMA 4MSMB 2WU2B 1WXAA 2XEWA 3DHIC 2FCSA 2WYQA 4BKTA 4XWWA 2CKHB 2Q5WD 2XBBC 4A9AA 2GBRA 1FCLA 1KTKA 2WX1A 3QC8B 2RR9A 1WM3A 4Q2JA 3QCAA 1M4VA 2BS4B 2FNJB 3AU5A 3ZRFA 4M01A 4W9CA 1JALA 2KDMA 1FPYA 2M8SA 1YX6B 1SXTA 3AMZA 4AS1A 1V81A 3IG3A 2KQ7A 1WMHB 2WXOA 1WGRA 4HDOA 2KWCA 2WWZA 4K7WA 1B1ZA 2EKIA 2PMVA 2O6VA 2KTRB 1WI0A 1F2RC 1NI2A 3PLUA 3DCGA 4C56C 2KXJA 1F77A 4C80A 1JRPA 2H89B 2FUHB 1C78A 2NCNA 2FIFA 3TUOA 5JH5C 2KMCA 3TMPB 3NVVA 2PPHA 1NYRA 5IO9A 4IG7B 4TKNA 2FBWB 2KHWB 2WHIA 4IOIE 3AV8A 3ZO5B 2MWSB 2D3CA 3WALA 1L6VA 2BYTA 3R2TA 2N9KA 1WJNA 1YMHE 4GDKA 4CYEA 2ICIA 1R4MB 3PS6A 3GS2A 1KLUD 3DBHI 1XQQA 2DAFA 5IAAC 4DHZB 2JU6X 4AJWA 2K39A 4EZJA 1L4DB 4A3PA 1N5WA 3HM6X 3ALBA 4JGHB 2INDC 2KK8A 2RSUA 1Z5SB 3QHTA 4N9F4 2LGSA 1JWSD 3NS8A 4BOZB 2W3SA 1E8ZA 2MA9B 3RNEC 3KWVA 2L00B 2MW5A 3APCA 3ZTCA 4BZAA 5IOIA 5AZFA 2OEDA 4LNIA 3Q3JA 3UQAA 3AI5A 4JWUC 4M0WB 4XZ4A 4DXAB 1QILA 2C7HA 3R8BA 4FBJB 3A9KA 3TCAA 1MG8A 2RPQA 1E8YA 4NNJB 1P7FA 2Y5PA 3NOBA 3BVZA 1ZE3D 3D32A 2UYZB 2WXHA 3JVZX 3Q8CA 1XO3A 1N6ZA 5HG2A 2D07B 4HROA 5AUKA 1L4ZB 2MX2A 2IYDB 4E74A 4AJYB 5HHDG 4HJKA 4DQOC 1NDDA 2INNE 1VLBA 2IJ0A 2TSSA 3K9OB 1LFDA 2KFKB 1AN8A 3P4RB 4WJNA 4HPPA 2WXPA 4MH8A 2GMIC 4YWGG 4WIPA 3A9JA 3VUYA 2N7DA 2JT4B 1V49A 4BBNC 4GIVA 1L5PA 3ZXRA 1HZ5A 3VTUA 2BF8B 4YL8A 1KRHA 3QA8A 3SD5A 3L10B 3J9CA 1JWMD 2D3BA 1P3QU 3AEBB 3NHEB 2DX5B 4JL9A 4B9KA 4HRSA 3L13A 4FLHA 1EU3A 4E3CA 2VZKD 3A33B 1P1AA 4CHKA 3GE3C 1UUPA 1TKEA 3AEDB 1XLNA 4DDGD 2FCNA 3V61A 1N62A 2M17A 4KGTA 1TYGB 1WJ4A 2GOWA 4P6VF 2AQ1B 1WGKA 1Y8RC 3PZ8A 2N9XA 4KDLB 3LXFA 4KKIA 2WXQA 2MLBA 2KZRA 3I57A 3ZDTA 1TS4A 2KC2A 4C7ZA 5CHWA 2J0JA 3OG5A 3ZNID 4DXFA 2KWVB 2AL3A 1ZDXA 1LGRA 4DWFA 4YTPB 1I4HA 4YTNB 3MFGA 2CS4A 4EOYA 1SB3C 2G3QB 1TKYA 2LD9A 1ZKHA 2L0FA 4P1BC 2I2YA 4BOSC 3ENEA 2DWQA 3B9JA 4NJCA 3UIPB 4ZHPA 2KT7A 1TY0A 3V05A 3H9DA 1SE4A 3HHMA 3WANA 4J6IA 3KQ4A 4PS7A 2J42A 1WX9A 4NQKE 2RDBC 3ZQ4A 5AZHA 4IUMB 3ZJUA 3SFEB 4KX6B 1YQ3B 1T0QC 5CTRC 5FK9C 1XCQL 2C7MB 3P1MA 2LEKA 3B1LX 2ZPYA 2CHXA 2KDEB 1HE8A 2K1FA 2KWDA 2GBNA 2MBOA 2L32A 1UD7A 3NJTA 4D2KA 4MDKE 3TJPA 1R4NI 1JCKB 2W54A 2N0SB 2M4NA 4W9LA 3AEAB 1MHHE 1I4GA 5IA7A 3APDA 3IAS1 4M00A 3GB1A 2XK5B 1ISNA 4ZRQA 3VRBB 5D7GA 1Y56A 4HKQA 4HDQA 4TMAB 4AP4C 4ICVA 2BKFA 2IO0B 4ZRJA 1EWYC 3P2BA 1DOIA 1ET9A 2JXXA 1WX7A 3H7PA 4FJZA 4OVUA 3TEXA 2K8CA 4ITKA 1J7AA 4LNNA 3WA0A 4LDTD 4K3BA 4NAWA 1R7SA 4HKZE 4WJQA 1WSPA 2K6QA 2K22A 4ZYSA 3VXWA 1RM6C 2XNAC 5CX3A 2IGDA 3RUIB 1VJKA 1K50A 3KYCD 1Z2MA 2MJ3A 1SEBD 3HM3A 1ZDVA 1PGAA 2R2QA 2K25A 2A4ZA 1YJJA 2VRRB 1UZXB 4DXGA 3KYDD 4X57B 1YN3A 2ZEQA 2IO2B 1V86A 3H6NA 4L2YA 4W9JA 4XDCA 3L17A 2KACA 5C3JB 1E8WA 4PYUA 3ZJTA 3SR6A 4IWQA 2WQYB 1GNUA 4DDID 4G3XB 3VTWA 4IWPA 2HD5B 4WQMA 2DZMA 3AB5A 1SE2A 1FD6A 4RGMA 2BB5A 5C23A 2MBQA 1E10A 3SEBA 2CJNA 2O2VB 1OQRA 3FC4A 3X0WA 4YXDB 2LZ6A 4MGZE 2YEPF 4LJPB 2ZCBA 1UF0A 2DYOA 4IW0A 1C4CA 2JZPA 3AH7A 1IBXB 2N9PC 1L2NA 3TL5A 1OEYJ 3QJZA 2MH7A 3MC0B 3V6EB 3ABVB 1E5WA 2GBKA 4JQWC 3U52E 1TS3A 4I6PA 5H8YE 1GAQB 2MHJA 3SHQA 4ZDVA 2WXMA 2ZPNA 3CSFA 3LYYA 1OQYA 2L1AA 1TY2A 3N1ZC 1NBFC 3W5UB 3DPDA 4TV3A 4RH6A 4FHKA 3NVWA 3QIJA 2XN9C 3MC8A 5E6NA 2AQ3B 3X23A 1C79A 2ZNVB 1JWAD 2N7JA 4A8XC 2JQRB 2BWES 2V1YA 5GXGB 4WAAA 1C9FA 3DWMA 5FR6A 5BYSA 4MACA 3W5VB 3QWZB 2REXA 1XT9B 2KX0A 4BKSD 1WGGA 2JSVX 2K5PA 1ZP0B 3WCQA 1Q0WB 3DVNV 2MP2A 4IM0A 4LCDE 3RN9C 2O6VB 2QEJC 1N5XA 2LRUA 2PVGC 3VTVA 4II3B 3ETRA 3C19A 2JVCA 2N1VA 1OQQA 2KANA 2X8XX 2JF5A 5DPRA 4JLCA 5EE0A 4F1SA 2AQ2B 1HEZE 2V4LA 4EE2A 3H8HA 4US8A 2L76A 2N1WA 5DPWA 1QOGA 4F8CB 2FCQA 4GDKB 4OZBA 2G1EA 1C4PA 2BVCA 4A90A 3EA6A 3VR9B 4LNFA 1EWCA 3OJ4B 1WE7A 3KWLA 3GZNI 4KGRA 1MVKA 5JZEB 4OZCA 3AE7B 2X38A 4IC7B 3WAOA 2LFIA 1TTNA 3ZKJC 2NTTA 2ZJDA 1GJZA 3AEFB 5LXHA 3ZTDA 2RGFA 4C4VA 4OHJA 2EKEC 3W1SC 4M8NA 1TZ1A 4ANUA 4HEA1 4B0EA 5E6JA 3RZWC 4GGQA 4K81A 1WRDB 2KAJA 2L05A 5DCNA 1VDVA 1IGDA 4AUQC 4FXCA 4ZHOA 4ASWC 2DLBA 3VH4B 3ML9A 1GPXA 4EKUA 3TIXA 3RT3B 1LQBA 2ZVOA 2QJLA 3DQVA 3PV1A 1KOTA 4NZLB 4OZAA 1K51A 1HTQA 1L7YA 2B76B 5EE3A 2LVQA 1AWDA 3A9KB 2M0AA 2LVOA 1VZ8A 4MGKE 4O1NA 1T5XD 3ZUNA 4N6EB 2KLGA 3KLSX 3DBHB 5C2TB 5L83A 4FN2A 1WJ6A 3BK1A 3I63C 3IHPC 4US9A 4IWOA 2J53A 2PVOD 1EU4A 4NJ6A 1I4RA 2LGYA 2MRPA 2LJ5A 3JYUA 4HVBA 3ZW3A 1WIAA 4HJGE 1WRIA 2IDYA 2KVZA 2HTME 2DZIA 1PFDA 1I4PA 5D6JB 3PRPB 1E7VA 5J17A 2WU5B 4M8MA 3BVGA 2J52A 2RD0A 3A9JB 3A4RA 1UBQA 3B08A 4RNAA 2N7EA 1PUTA 1WXVA 4GOCA 2OHFA 2Z0DB 3UGBB 2KDIA 1EM7A 1IUEA 2R61A 1PYWD 2ZW1A 4KZCA 4ACFA 1V8CA 1I35A 3SDLC 5EE9A 5T8IA 4B6WA 3T3NA 1WGYA 4MGIE 3ZGZA 1F1HA 4GDLA 2WXIA 2FAZA 1SJHD 3GP7A 3EGRA 3RI7C 1EUVB 3IT6B 2AYOB 1TGZB 3RCZA 4YTMB 3DBRI 2JPHA 3L4PA 2PLPA 3NRZA 1KF6B 4USAA 3DDCB 1NYQA 3DWGC 5LNK1 1ZXHA 2JWZA 4PYZA 1GB4A 4ARCA 2KD0A 1GOZA 3KUDB 1D3ZA 2LASA 4ARIA 3TEWA 4IM3A 3BYYB 2ZW0A 5AUIA 5J2RA 2WXRA 4KSKC 2M1MA 2IBIB 1LO5D 1HXYD 1BMLC 4H2AA 3R7QA 4EUTA 1U4AA 1XLQA 3BVMA 4JX1C 4RFBA 1I4XA 2C60A 2L52A 4W9DA 2LXAA 2NMQA 3Q3FA 3NVYA 1PDXA 1UGMA 3MHZA 2KDBA 3R3MA 4MEMA 1T6BX 2IY0B 2BYVE 1MFWA 1S1QB 4WURA 2L3ZA 2DZJA 5J18A 3VUXA 1K8RB 4EZLA 4GN1A 4R3DA 3N1YC 3A1QA 2ONQA 4ZOHC 3JW0X 3N30A 1N60A 2CHWA 3RMKC 2WP9B 1WZ3A 2KWUB 4RF1A 1QOBA 3MP9A 2Z59B 4ANWA 3FILB 3EECA 4WJOA 3B0AA 1ZXIA 3PLVA 2E6XA 3IVFA 1V1PA 3HK0A 3FAHA 4E71A 1CQVA 1FRDA 3PSEB 4I6LB 2I1JA 2LHDA 1ZOYB 2JX5A 4W9FA 2GLSA 1E8XA 2DHZA 2I38A 3PT2B 1C76A 1RWSA 3AE9B 3LJ3A 4I6NB 1C4AA 4FJVB 1QOFA 3N3KB 1X1MA 4FHJA 3TBLD 2KX3A 1RAXA 4TSSA 4KDIC 3H7PB 2WXJA 3PREA 1JWBD 3DVGY 2RPVA 3U7DA 1VZ6A 4C7YA 4NAWB 4BKGA 4ZRPA 4DHJB 5CHFA 4NQLB 1YX5B 1R4NB 2BYFA 4BBNF 2LI5A 1Q10A 3KUCB 2D10A 1J7CA 2ON8A 3WAPA 1XF5L 4S17A 3AE5B 3GOEA 4L1BA 1FRRA 1V80A 1D6EC 2CR5A 2IGHA 2G45B 4ZRIA 5IN7A 2HTHA 3NS1A 5D3DA 1SGHA 1SSNA 5C1ZA 3VVWB 2L0TA 1MPEA 4PS3A 3FILA 1YJ1A 1F9JA 4EFOA 2FUG1 4W9GA 4RGOS 4RGNA 1KLVA 3OWEB 1F0ZA 1NVID 1GC6A 4TQ1A 2KQ4X 1Q1OA 5HKHA 3CSTA 2WS3B 4K3CA 2NBVB 1S3SG 1LM8B 1IGCA 4YSZB 4RM9A 1P98A 1XD3B 3AE1B 4LK0M 3OJ3A 2WXKA 1WXMA 2IO1B 4RCOA 1ENFA 4NPNA 4W9KA 4CO7A 3RNCC 1YD8U 4MM3A 1HA5A 3VHTC 5G5GA 3T3OA 3WAMA 4RGTA 1GUAB 2ZNVC 1VR9A 2HJ1A 3H1UA 1UBIA 3AE6B 2GBJA 2D5GA 5I4DA 1TT5B 2EMSA 3SU8X 1WY8A 4N58A 2G4DB 1CZPA 4HCPB 4WWPA 2PIAA 2KYWA 1V1OA 3N1XC 2PJHA 3RFZB 4KIKB 2KJHB 4S0RA 4HK2A 2GBMA 2D3AA 4OVVA 5DPSA 3BIID 1ZUD2 3Q3MC 4G11A 3I9V1 2QC8A 3UIOB 3URYA 3AU4A 3B2GA 2WNMA 1WYWB 4L23A 3VDZA 1YN5A 1DOYA 3AEGB 2BYEA 1I4QA 2GRIA 5BMHA 1QF6A 2PW9A 2NBUA 2JXTA 1ZPSA 2MP2B 4UDUC 2D2QA 1TZOA 3U30A 2V3PA 4NAMA 3PTFC 1PQSA 3DBLI 4A6QA 1OGWA 2WGSA 4A3OA 3HRDD 5EE1A 3O13A 2DYMA 4W9IA 2W9NA 5BMGA 2JZ3B 1JROA 2QMTA 3TSSA 4XX5A 2BS3B 1STEA 5JXVA 3OLMD 1C77A 2MBEA 2LHEA 1ESFA 1G6JA 1SIFA 4JIOU 3Q8EA 2DNFA 1WXSA 3BZDB 1JW9D 1TJEA 2O6VD 5FKAC 1VD2A 2DZKA 1HZ6A 3TEYA 1UH6A 3ONSA 2IZVB 4KIKA 2YVCA 3N9YC 3ZDMC 4F7ZA 2I1KA 1VRAB 3JSVB 1SE9A 5FR3A 4IDIA 2KOXA 2YEPB 5E6OA 1PGXA 3PGEA 5H92C 4C4VB 1JQ4A 4AQ7A 1WX8A 3NG0A 2LMCA 2V0GA 5D2MB 1IP9A 4PK1A 2BB6A 4LNOA 3ZIMA 3NY5A 3RPFC 5G2NA 4HLEA 3CIRB 2NPTA 1SF0A 3IXSA 4AOFA 3UI3A 1XXGA 3IFWB 1TS5A 2LUMA 2KLCA 3MC9A 2Z8LA 5DPTA 1YQBA 2DBYA 1T0SC 2G9HD 4WJPA 1P0RA 2JY6A 4KVGB 1D5XC 1XLOA 3LB8C 5MPOA 2R2OA 4WAFA 3W2DA 4GSWA 2M19A 1BUIC 4RM8A 1CMXB 1JMLA 2OJWA 2JRIB 4NY0A 3GZNB 2J7QB 4XDDA 3M95A 4LLGM 3CWIA 1QQRA 4WQOB 4FJYA 3AEEB 1SJED 2CU3A 1WXQA 1WFYA 3BWUD 3L0WB 3AM9A 2IGGA 2MBHA 2KKCA 1FEHA 2VH1A 1FXTB 3W1YA 4TQ0A 1WWTA 4IM2A 3JSVA 1ZW7A 2ZZPB 2NVUI 5BMIA 2EELA 1TBEA 3Q8BA 1QKZA 4BFRA 2MJDA 2BT6A 3IAM1 4AWJA 3DVNU 2KTFA 3QX1A 3RNFC 5JHBA 1V6EA 2FE8A 2V4IB 2AWTA 2Y5CA 1UWMA 4RMAA 2ZVNA 4OVZA 2AX5A 3NZ3A 2QIEB 4GB9A 3UQBA 3ZVVA 4P7IA 2ACZB 2J0KA 1YN4A 2FCMA 1L0VB 1J8CA 2MCNB 2V3SA 4GDLB 3EHVA 2GI9A 2W82A 3EFCA 3APFA 2OJRA 4MSQB 2RDGA 2WDTB 3V60A 3ZRCA 4ZYNA 4N59A 4MJSA 3DVGX 2BBCA 4GLSC 2WDRB 5L95C 1V97A 3VUWA 2KN4A 1C1YB 3RULA 2IPKD 2KNBA 4LJOB 1HQRD 1WGDA 3LDZE 2N9EB 3N32A 2INCC 4K1RB 4W9EA 3C0RB 1WYGA 2ZCCA 3R7RA 3A4SC 2QSDA 4BKSA 1D5ZC 2NBWB 4K7SA 5IP4D 3Q69A 1LXDA 1H4RA 1TKGA 4NJ7A 1SE3A 2IY1B 4WWOA 3PZDA 2MJEA 2OOBB 2BKRB 1J7BA 2SAKA 1FIQA 2QHOA 1WF9A 2MBBB 2M0XA 2FIDA 3DBRB 1TS2A 2KJ6A 2KO3A 1R4MI 2HJ8A 4DK5A 4JWSC 1WMHA 2B3AA 3HIZA 3Q3OC 3BY4B 4FADA 3W9CB 2WXLA 2D11A 3A1QB 3DOWA 1FFVA 1QOAA 1RLFA 2N9LA 2KTRA 4OW0A 4YT0B 2RMMA 3AE8B 3I5JC 1E6EB 2LGIA 3ZNHB 1WJUA 1KM7A 1YNTE 3PRMB 4TUUA 1E0ZA 2ASQA 1KH0A 1KFYB 1E7UA 1NI3A 1J0GA 3P4QB 3M3JA 2WDVB 1NENB 2KMAA 4G50A 5E6PA 5JHAA 1V1PB 5BO4B 1IYFA 1WGHA 4WWMA 1L0YB 1AW7A 4DHZE 3DBSA 3PZ7A 1FXIA 2UU7A 1JWUD 3EFUA 1MI0A 1B9RA 3EUB2 1M94A 3I3TB 1ROEA 3Q8AA 2KMMA 2KVRA 2W55A 3S2AA 1BXTA 2LVPA 4KKJA 1E7PB 1QLBB 2PTLA 3BK2A 1QT9A 3U8ZA 1CK1A 2NR2A 3VH3B 2MEKA 1E90A 2J4XA 2K9XA 1F2RI 3U7ZA 1FNUA 3Q3NC 3QQ8B 4GU2A 1J19A 1DYQA 1GC7A 3KVFB 1KJTA 2HDEA 3KW5B 4K7UA 3Q8FA 2JZZA 3QK0A 3ZNZB 5TSSA 3IBEA 2Z0EB 2A5UA 2Y5BB 3AECB 1EO6A 2WX0A 2WXGA 3PPAA 3QARA 1WZ0A 5TR5A 1K52A 3ZXVA 4M0WA 2WDQB 3B2FA 2EMTA 3V3XA 4DHJD 1TIFA 3W1SA 4EEWA 1N61A 4G0NB 5HFYA 5LXIB 3ZJVA 4DBGA 3QAQA 1UNSA 2BGFA 3ZLZA 1CJEA 2LRWA 3NVZA 3PHWB 4MM3B 4PT5A 2NTSA 2VZKB 2KFKA 2QCZA 4ANVA 3RNGC 1PGBA 4C00A 1FNVA 1GB1A 4ICUA 1FMAD 1XCTL 4BVUC 4EZKA 2CHZA 1D5MC 3NZUA 4JPSA 1WR1A 2PE6B 1A5RA 2BW2A 5KHQA 2C7NB 1ZGUB 1C3TA 3OAWA 3O65B 2DAJA 3AULA 5CHVC 1T0RC 3MTNB 2BWFA 1FFUA 1YIWA 1I42A 4W9HA 5HI1A 1RRBA 2KFJA 3V62A 2HE7A 1EF5A 3T9LA 1WH3A 3PHXB 3AE3B 3RNAC 3RNBC 5LLIA 2QDFA 3TEZA 1DGJA 4LTUA
chains in the Genus database with same CATH topology
3K9OB 1LFDA 2C9WB 2KFKB 2O6VD 1VD2A 2DZKA 3PV1A 1KOTA 4WJNA 2JRHA 1UH6A 3ONSA 1P9DU 4A20A 1L7YA 4GXBA 2IZVB 3KUZA 4KIKA 2YVCA 2GMIC 2LVQA 3ZDMC 3A9JA 3VUYA 2N7DA 4F7ZA 2I1KA 4FULA 2JT4B 1V49A 3JSVB 3A9KB 4HPMB 4BBNC 2LVOA 1SE9A 3CMMB 3BINA 3RYTA 4GIVA 2KOXA 4MGKE 2MQJA 1IPGA 1OTRB 3VTUA 5E6OA 3ZUNA 1OEYA 3PGEA 2KLGA 2JUOA 2BF8B 4YL8A 3QA8A 5GMVA 2K8BA 3VAWA 3SD5A 3L10B 1WX8A 5L83A 4FN2A 1P3QU 1WJ6A 2C5LC 3NHEB 2DX5B 5D2MB 2KQSA 3IHPC 1IP9A 1QZEA 4JL9A 1BT0A 3ZIMA 4B9KA 3NY5A 3L13A 4IWOA 5G2NA 4FLHA 5EDSA 4E3CA 4HLEA 2NPTA 3EC8A 3A33B 4NJ6A 1P1AA 4AOFA 4CHKA 3IFWB 1T0YA 2LGYA 2MRPA 2KLCA 1WM2A 2LJ5A 5DPTA 1YQBA 3JYUA 4HVBA 3ZW3A 1WIAA 4DDGD 2FCNA 2KC1A 3KH0A 4II2B 3V61A 2IO3B 4WJPA 2M17A 1P0RA 1WJ4A 2GOWA 2JY6A 2K8HA 4KVGB 1Y8RC 2DZIA 2N9XA 4MGYE 2R2OA 4KDLB 5D6JB 4GSWA 3PRPB 1E7VA 5J17A 4M8MA 3CF6E 2RD0A 3L16A 2MLBA 3R66C 2KN5A 2KZRA 4RM8A 3ZDTA 2BPSA 3A9JB 1CMXB 3A4RA 2KC2A 1UBQA 4ANXA 3B08A 2JRIB 2N7EA 4NY0A 5CHWA 1RFAA 3UF8A 2J0JA 1WXVA 2J7QB 4GOCA 3ZNID 3M95A 3MHSD 2Z0DB 3UGBB 2KWVB 2KDIA 2AL3A 2LWPA 4WQOB 4FJYA 2D3GA 4DWFA 5D94A 4KV2A 4KZCA 1I35A 2CS4A 3SDLC 4EOYA 1WFYA 2G3QB 5AZGA 3M62B 4B6WA 3L0WB 1WGYA 2LD9A 2MBHA 2KKCA 4MGIE 1ZKHA 2NPTB 4KZ0A 2L0FA 1FXTB 4GDLA 4BOSC 2G4SA 3W1YA 2FAZA 3ENEA 4TQ0A 3RD2A 4LDTB 2XK5A 3JSVA 4IM2A 1ZW7A 2ZZPB 1EUVB 2NVUI 3UIPB 1TBEA 2AYOB 1TGZB 3RCZA 3DBRI 4BFRA 4AWJA 3H9DA 3HHMA 3NZSA 3DVNU 3WANA 2KTFA 4J6IA 4PS7A 3QX1A 1WX9A 1JRUA 2JPHA 4NQKE 5JHBA 5AZHA 1V2YA 1V6EA 4IUMB 2AWTA 2UWQA 5CTRC 4MELA 2C7MB 3DDCB 2JWZA 3B1LX 2ZPYA 2CHXA 4HPLB 4PYZA 2DYBA 2KD0A 2KDEB 3KUDB 4RMAA 1D3ZA 1HE8A 2LASA 2ZVNA 2K1FA 4IM3A 3RZFA 2GBNA 2MBOA 4GMVA 5J2RA 4KSKC 3L54A 2M1MA 1UD7A 2IBIB 4MDKE 3TJPA 1R4NI 5G55A 4GB9A 3R7QA 1WR6E 4EUTA 3UQBA 3ZVVA 4KSLC 1U4AA 2M4NA 4P7IA 2J0KA 1J8CA 2FCMA 4W9LA 4ZRKA 2MCNB 2V3SA 4GDLB 3EHVA 3AXCA 5IA7A 3APDA 5AEKB 3APFA 2C60A 2OJRA 2XK5B 4MSQB 4W9DA 2LXAA 3Q3FA 4WWNA 1ISNA 1UGMA 2KDBA 3R3MA 2WDTB 3V60A 4MEMA 3ZRCA 2LXCA 3MJWA 4ZYNA 2IY0B 3M63B 4PS8A 5D7GA 2AL6A 2AEHA 2BYVE 4MJSA 3ECIA 1S1QB 4HDQA 2CU1A 2N4FA 3DVGX 4AP4C 2PEAA 2L3ZA 4ICVA 3PVLA 1EF1A 2BKFA 2YLMA 1WE6A 2IO0B 3VUWA 5L95C 2DZJA 2DENB 4ZRJA 3VUXA 1C1YB 5J18A 3RULA 1K8RB 2KNBA 2LGXA 4EZLA 3K9PB 4LJOB 1WGDA 3LDZE 2N9EB 3N32A 3P2BA 4GN1A 4HXDA 4XC2A 3A1QA 4HCNB 4K1RB 4W9EA 2MSED 3C0RB 3JW0X 4HWIB 2JXXA 1WX7A 3H7PA 3N30A 2L7RA 4FJZA 2ZCCA 4OVUA 3A4SC 3PRZA 3R7RA 2K8CA 3L08A 4BKSA 3H7SA 2NBWB 3ZNGC 2CHWA 3ML8A 4URKA 4K7SA 3T8MA 3WA0A 2LUEA 4LDTD 1WZ3A 2KWUB 5KHOA 4NAWA 1Q5WB 1UELA 2Z59B 4ANWA 1LXDA 3EECA 4WJQA 1VCBA 4WJOA 3B0AA 1V5OA 1H4RA 2J0MA 2K6QA 2LGDA 3PLVA 3IVFA 4NJ7A 2IY1B 4WWOA 4MH0E 3VXWA 2KDFB 3HK0A 3PZDA 1V9JA 2OOBB 2BKRB 4E71A 5CX3A 3RUIB 3PSEB 4B95A 2O2VA 2QHOA 4I6LB 2I1JA 1WF9A 1GG3A 3UINB 2MBBB 4MJSB 2M0XA 4W9FA 3VFKA 3KYCD 2FIDA 1Z2MA 2PE9A 2KJ6A 3HM3A 2K25A 1E8XA 2DHZA 1V5TA 2A4ZA 2KO3A 2L8JA 2R2QA 2VRRB 3PT2B 1R4MI 3V6CB 4FA6A 2HJ8A 2KJRA 1UZXB 4DK5A 3KYDD 1AARA 3LJ3A 4X57B 1WMHA 4I6NB 2NS5A 2B3AA 3HIZA 2ZEQA 3BY4B 3VQIA 4FADA 1H8CA 4FJVB 2D11A 2IO2B 2K6DB 1V86A 3A1QB 3DOWA 3N3KB 1X1MA 4FHJA 3TBLD 3WIMA 2KX3A 4MSMB 1RAXA 1RLFA 1WXAA 2KTRA 2XEWA 2FCSA 3H6NA 4KDIC 3H7PB 2WYQA 4W9JA 3L17A 4BKTA 3ZNHB 1E8WA 2CKHB 2XBBC 4PYUA 3PREA 1WJUA 2GBRA 1KM7A 3DVGY 4IWQA 2WX1A 3PRMB 4TUUA 3U7DA 1GNUA 2ASQA 2RR9A 3QC8B 4G3XB 1WM3A 4IWPA 3VTWA 3QCAA 4DDID 2HD5B 2DZMA 1E7UA 4NAWB 4BKGA 4DHJB 5CHFA 1J0GA 4NQLB 3M3JA 2FNJB 1YX5B 2BYFA 3AU5A 2KMAA 5C23A 4G50A 2LI5A 5E6PA 4BBNF 3KUCB 5JHAA 2D10A 5BO4B 3ZRFA 3WAPA 2MBQA 4W9CA 1WGHA 1IYFA 3GOEA 1V80A 2CR5A 2O2VB 3DBSA 4DHZE 3X0WA 2LZ6A 2M8SA 2G45B 4MGZE 1YX6B 4ZRIA 4LJPB 2ZCBA 3EFUA 2HTHA 1V81A 2DYOA 3IG3A 1M94A 4IW0A 1SGHA 3I3TB 5C1ZA 2KQ7A 3VVWB 1WMHB 2KVRA 2L0TA 2N9PC 1WGRA 4HDOA 4PS3A 1YJ1A 1L2NA 1F9JA 4EFOA 2KWCA 4W9GA 3TL5A 3S2AA 2LVPA 2WWZA 4K7WA 1OEYJ 2O6VA 2KTRB 3QJZA 1WI0A 3V6EB 1KLVA 1E5WA 2GBKA 4JQWC 1NI2A 1GC6A 4TQ1A 3PLUA 3DCGA 4I6PA 3U8ZA 2NR2A 3SHQA 2KXJA 4ZDVA 1Q1OA 5HKHA 3CSTA 2ZPNA 3CSFA 2NBVB 1S3SG 1LM8B 1OQYA 3VH3B 1NBFC 1E90A 2FUHB 4RM9A 2NCNA 2FIFA 5JH5C 1P98A 1XD3B 2KMCA 3QQ8B 4GU2A 3TMPB 1J19A 3DPDA 3OJ3A 4TV3A 1GC7A 3KVFB 1WXMA 4FHKA 1KJTA 2PPHA 2IO1B 4NPNA 3QIJA 4W9KA 4CO7A 4IG7B 1YD8U 4TKNA 3KW5B 5E6NA 4MM3A 2KHWB 4K7UA 3X23A 3ZO5B 2MWSB 2ZNVB 3WALA 3VHTC 2JZZA 2BWES 2V1YA 3QK0A 1WJNA 3WAMA 3ZNZB 3IBEA 4GDKA 2Z0EB 1GUAB 2A5UA 4WAAA 4CYEA 2ZNVC 2Y5BB 5FR6A 3QWZB 1EO6A 2REXA 3H1UA 2WX0A 1XT9B 3PPAA 2KX0A 1UBIA 3QARA 4BKSD 1WGGA 1WZ0A 5TR5A 1Q0WB 3DVNV 2MP2A 4IM0A 4LCDE 2O6VB 2GBJA 2LRUA 3PS6A 2EMTA 3VTVA 4DHJD 4II3B 3DBHI 2EMSA 3SU8X 1WY8A 3W1SA 4EEWA 2JVCA 1XQQA 4G0NB 2G4DB 2DAFA 2N1VA 4HCPB 4WWPA 5LXIB 2KANA 2JF5A 5DPRA 5IAAC 4JLCA 4DBGA 4DHZB 4F1SA 2PJHA 3QAQA 4AJWA 4KIKB 2V4LA 2K39A 2KJHB 4HK2A 2GBMA 4EZJA 2BGFA 4OVVA 4A3PA 5DPSA 3ZLZA 2LRWA 3PHWB 3HM6X 2L76A 4G11A 2N1WA 3ALBA 4JGHB 2KK8A 2RSUA 1Z5SB 5DPWA 3QHTA 4N9F4 3UIOB 3AU4A 3NS8A 4F8CB 2FCQA 4GDKB 1WYWB 4BOZB 1E8ZA 2MA9B 3VDZA 2L00B 2KFKA 2MW5A 3APCA 2BYEA 3ZTCA 4ANVA 5AZFA 2NBUA 1WE7A 3OJ4B 3GZNI 3UQAA 3Q3JA 3AI5A 4ICUA 2MP2B 5JZEB 2D2QA 4M0WB 4XZ4A 4BVUC 4IC7B 4DXAB 2C7HA 2CHZA 4EZKA 3NZUA 3WAOA 3U30A 4FBJB 3A9KA 1WR1A 3PTFC 2PE6B 1A5RA 1PQSA 3DBLI 3TCAA 1MG8A 2RPQA 1E8YA 1OGWA 1TTNA 4NNJB 3ZKJC 5KHQA 3NOBA 2ZJDA 3D32A 2C7NB 2UYZB 1GJZA 4A3OA 1ZGUB 5LXHA 3ZTDA 1C3TA 2RGFA 3OAWA 3JVZX 2EKEC 3W1SC 4M8NA 1TZ1A 3O65B 2DAJA 4ANUA 3AULA 2D07B 5CHVC 3MTNB 2DYMA 4W9IA 2BWFA 3RZWC 2W9NA 1YIWA 2MX2A 4GGQA 2JZ3B 4K81A 1WRDB 2IYDB 2L05A 5DCNA 1I42A 4E74A 4W9HA 1RRBA 2KFJA 3V62A 2HE7A 4AUQC 1EF5A 4AJYB 4XX5A 3T9LA 1WH3A 4HJKA 4ASWC 3OLMD 2MBEA 3PHXB 3VH4B 3ML9A 1NDDA 4EKUA 1G6JA 3TIXA 1SIFA 4JIOU 5LLIA 3RT3B 1LQBA 1WXSA 2ZVOA 3DQVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K9O B;  1LFD A;  2C9W B;  2KFK B;  2O6V D;  1VD2 A;  2DZK A;  3PV1 A;  1KOT A;  4WJN A;  2JRH A;  1UH6 A;  3ONS A;  1P9D U;  4A20 A;  1L7Y A;  4GXB A;  2IZV B;  3KUZ A;  4KIK A;  2YVC A;  2GMI C;  2LVQ A;  3ZDM C;  3A9J A;  3VUY A;  2N7D A;  4F7Z A;  2I1K A;  4FUL A;  2JT4 B;  1V49 A;  3JSV B;  3A9K B;  4HPM B;  4BBN C;  2LVO A;  1SE9 A;  3CMM B;  3BIN A;  3RYT A;  4GIV A;  2KOX A;  4MGK E;  2MQJ A;  1IPG A;  1OTR B;  3VTU A;  5E6O A;  3ZUN A;  1OEY A;  3PGE A;  2KLG A;  2JUO A;  2BF8 B;  4YL8 A;  3QA8 A;  5GMV A;  2K8B A;  3VAW A;  3SD5 A;  3L10 B;  1WX8 A;  5L83 A;  4FN2 A;  1P3Q U;  1WJ6 A;  2C5L C;  3NHE B;  2DX5 B;  5D2M B;  2KQS A;  3IHP C;  1IP9 A;  1QZE A;  4JL9 A;  1BT0 A;  3ZIM A;  4B9K A;  3NY5 A;  3L13 A;  4IWO A;  5G2N A;  4FLH A;  5EDS A;  4E3C A;  4HLE A;  2NPT A;  3EC8 A;  3A33 B;  4NJ6 A;  1P1A A;  4AOF A;  4CHK A;  3IFW B;  1T0Y A;  2LGY A;  2MRP A;  2KLC A;  1WM2 A;  2LJ5 A;  5DPT A;  1YQB A;  3JYU A;  4HVB A;  3ZW3 A;  1WIA A;  4DDG D;  2FCN A;  2KC1 A;  3KH0 A;  4II2 B;  3V61 A;  2IO3 B;  4WJP A;  2M17 A;  1P0R A;  1WJ4 A;  2GOW A;  2JY6 A;  2K8H A;  4KVG B;  1Y8R C;  2DZI A;  2N9X A;  4MGY E;  2R2O A;  4KDL B;  5D6J B;  4GSW A;  3PRP B;  1E7V A;  5J17 A;  4M8M A;  3CF6 E;  2RD0 A;  3L16 A;  2MLB A;  3R66 C;  2KN5 A;  2KZR A;  4RM8 A;  3ZDT A;  2BPS A;  3A9J B;  1CMX B;  3A4R A;  2KC2 A;  1UBQ A;  4ANX A;  3B08 A;  2JRI B;  2N7E A;  4NY0 A;  5CHW A;  1RFA A;  3UF8 A;  2J0J A;  1WXV A;  2J7Q B;  4GOC A;  3ZNI D;  3M95 A;  3MHS D;  2Z0D B;  3UGB B;  2KWV B;  2KDI A;  2AL3 A;  2LWP A;  4WQO B;  4FJY A;  2D3G A;  4DWF A;  5D94 A;  4KV2 A;  4KZC A;  1I35 A;  2CS4 A;  3SDL C;  4EOY A;  1WFY A;  2G3Q B;  5AZG A;  3M62 B;  4B6W A;  3L0W B;  1WGY A;  2LD9 A;  2MBH A;  2KKC A;  4MGI E;  1ZKH A;  2NPT B;  4KZ0 A;  2L0F A;  1FXT B;  4GDL A;  4BOS C;  2G4S A;  3W1Y A;  2FAZ A;  3ENE A;  4TQ0 A;  3RD2 A;  4LDT B;  2XK5 A;  3JSV A;  4IM2 A;  1ZW7 A;  2ZZP B;  1EUV B;  2NVU I;  3UIP B;  1TBE A;  2AYO B;  1TGZ B;  3RCZ A;  3DBR I;  4BFR A;  4AWJ A;  3H9D A;  3HHM A;  3NZS A;  3DVN U;  3WAN A;  2KTF A;  4J6I A;  4PS7 A;  3QX1 A;  1WX9 A;  1JRU A;  2JPH A;  4NQK E;  5JHB A;  5AZH A;  1V2Y A;  1V6E A;  4IUM B;  2AWT A;  2UWQ A;  5CTR C;  4MEL A;  2C7M B;  3DDC B;  2JWZ A;  3B1L X;  2ZPY A;  2CHX A;  4HPL B;  4PYZ A;  2DYB A;  2KD0 A;  2KDE B;  3KUD B;  4RMA A;  1D3Z A;  1HE8 A;  2LAS A;  2ZVN A;  2K1F A;  4IM3 A;  3RZF A;  2GBN A;  2MBO A;  4GMV A;  5J2R A;  4KSK C;  3L54 A;  2M1M A;  1UD7 A;  2IBI B;  4MDK E;  3TJP A;  1R4N I;  5G55 A;  4GB9 A;  3R7Q A;  1WR6 E;  4EUT A;  3UQB A;  3ZVV A;  4KSL C;  1U4A A;  2M4N A;  4P7I A;  2J0K A;  1J8C A;  2FCM A;  4W9L A;  4ZRK A;  2MCN B;  2V3S A;  4GDL B;  3EHV A;  3AXC A;  5IA7 A;  3APD A;  5AEK B;  3APF A;  2C60 A;  2OJR A;  2XK5 B;  4MSQ B;  4W9D A;  2LXA A;  3Q3F A;  4WWN A;  1ISN A;  1UGM A;  2KDB A;  3R3M A;  2WDT B;  3V60 A;  4MEM A;  3ZRC A;  2LXC A;  3MJW A;  4ZYN A;  2IY0 B;  3M63 B;  4PS8 A;  5D7G A;  2AL6 A;  2AEH A;  2BYV E;  4MJS A;  3ECI A;  1S1Q B;  4HDQ A;  2CU1 A;  2N4F A;  3DVG X;  4AP4 C;  2PEA A;  2L3Z A;  4ICV A;  3PVL A;  1EF1 A;  2BKF A;  2YLM A;  1WE6 A;  2IO0 B;  3VUW A;  5L95 C;  2DZJ A;  2DEN B;  4ZRJ A;  3VUX A;  1C1Y B;  5J18 A;  3RUL A;  1K8R B;  2KNB A;  2LGX A;  4EZL A;  3K9P B;  4LJO B;  1WGD A;  3LDZ E;  2N9E B;  3N32 A;  3P2B A;  4GN1 A;  4HXD A;  4XC2 A;  3A1Q A;  4HCN B;  4K1R B;  4W9E A;  2MSE D;  3C0R B;  3JW0 X;  4HWI B;  2JXX A;  1WX7 A;  3H7P A;  3N30 A;  2L7R A;  4FJZ A;  2ZCC A;  4OVU A;  3A4S C;  3PRZ A;  3R7R A;  2K8C A;  3L08 A;  4BKS A;  3H7S A;  2NBW B;  3ZNG C;  2CHW A;  3ML8 A;  4URK A;  4K7S A;  3T8M A;  3WA0 A;  2LUE A;  4LDT D;  1WZ3 A;  2KWU B;  5KHO A;  4NAW A;  1Q5W B;  1UEL A;  2Z59 B;  4ANW A;  1LXD A;  3EEC A;  4WJQ A;  1VCB A;  4WJO A;  3B0A A;  1V5O A;  1H4R A;  2J0M A;  2K6Q A;  2LGD A;  3PLV A;  3IVF A;  4NJ7 A;  2IY1 B;  4WWO A;  4MH0 E;  3VXW A;  2KDF B;  3HK0 A;  3PZD A;  1V9J A;  2OOB B;  2BKR B;  4E71 A;  5CX3 A;  3RUI B;  3PSE B;  4B95 A;  2O2V A;  2QHO A;  4I6L B;  2I1J A;  1WF9 A;  1GG3 A;  3UIN B;  2MBB B;  4MJS B;  2M0X A;  4W9F A;  3VFK A;  3KYC D;  2FID A;  1Z2M A;  2PE9 A;  2KJ6 A;  3HM3 A;  2K25 A;  1E8X A;  2DHZ A;  1V5T A;  2A4Z A;  2KO3 A;  2L8J A;  2R2Q A;  2VRR B;  3PT2 B;  1R4M I;  3V6C B;  4FA6 A;  2HJ8 A;  2KJR A;  1UZX B;  4DK5 A;  3KYD D;  1AAR A;  3LJ3 A;  4X57 B;  1WMH A;  4I6N B;  2NS5 A;  2B3A A;  3HIZ A;  2ZEQ A;  3BY4 B;  3VQI A;  4FAD A;  1H8C A;  4FJV B;  2D11 A;  2IO2 B;  2K6D B;  1V86 A;  3A1Q B;  3DOW A;  3N3K B;  1X1M A;  4FHJ A;  3TBL D;  3WIM A;  2KX3 A;  4MSM B;  1RAX A;  1RLF A;  1WXA A;  2KTR A;  2XEW A;  2FCS A;  3H6N A;  4KDI C;  3H7P B;  2WYQ A;  4W9J A;  3L17 A;  4BKT A;  3ZNH B;  1E8W A;  2CKH B;  2XBB C;  4PYU A;  3PRE A;  1WJU A;  2GBR A;  1KM7 A;  3DVG Y;  4IWQ A;  2WX1 A;  3PRM B;  4TUU A;  3U7D A;  1GNU A;  2ASQ A;  2RR9 A;  3QC8 B;  4G3X B;  1WM3 A;  4IWP A;  3VTW A;  3QCA A;  4DDI D;  2HD5 B;  2DZM A;  1E7U A;  4NAW B;  4BKG A;  4DHJ B;  5CHF A;  1J0G A;  4NQL B;  3M3J A;  2FNJ B;  1YX5 B;  2BYF A;  3AU5 A;  2KMA A;  5C23 A;  4G50 A;  2LI5 A;  5E6P A;  4BBN F;  3KUC B;  5JHA A;  2D10 A;  5BO4 B;  3ZRF A;  3WAP A;  2MBQ A;  4W9C A;  1WGH A;  1IYF A;  3GOE A;  1V80 A;  2CR5 A;  2O2V B;  3DBS A;  4DHZ E;  3X0W A;  2LZ6 A;  2M8S A;  2G45 B;  4MGZ E;  1YX6 B;  4ZRI A;  4LJP B;  2ZCB A;  3EFU A;  2HTH A;  1V81 A;  2DYO A;  3IG3 A;  1M94 A;  4IW0 A;  1SGH A;  3I3T B;  5C1Z A;  2KQ7 A;  3VVW B;  1WMH B;  2KVR A;  2L0T A;  2N9P C;  1WGR A;  4HDO A;  4PS3 A;  1YJ1 A;  1L2N A;  1F9J A;  4EFO A;  2KWC A;  4W9G A;  3TL5 A;  3S2A A;  2LVP A;  2WWZ A;  4K7W A;  1OEY J;  2O6V A;  2KTR B;  3QJZ A;  1WI0 A;  3V6E B;  1KLV A;  1E5W A;  2GBK A;  4JQW C;  1NI2 A;  1GC6 A;  4TQ1 A;  3PLU A;  3DCG A;  4I6P A;  3U8Z A;  2NR2 A;  3SHQ A;  2KXJ A;  4ZDV A;  1Q1O A;  5HKH A;  3CST A;  2ZPN A;  3CSF A;  2NBV B;  1S3S G;  1LM8 B;  1OQY A;  3VH3 B;  1NBF C;  1E90 A;  2FUH B;  4RM9 A;  2NCN A;  2FIF A;  5JH5 C;  1P98 A;  1XD3 B;  2KMC A;  3QQ8 B;  4GU2 A;  3TMP B;  1J19 A;  3DPD A;  3OJ3 A;  4TV3 A;  1GC7 A;  3KVF B;  1WXM A;  4FHK A;  1KJT A;  2PPH A;  2IO1 B;  4NPN A;  3QIJ A;  4W9K A;  4CO7 A;  4IG7 B;  1YD8 U;  4TKN A;  3KW5 B;  5E6N A;  4MM3 A;  2KHW B;  4K7U A;  3X23 A;  3ZO5 B;  2MWS B;  2ZNV B;  3WAL A;  3VHT C;  2JZZ A;  2BWE S;  2V1Y A;  3QK0 A;  1WJN A;  3WAM A;  3ZNZ B;  3IBE A;  4GDK A;  2Z0E B;  1GUA B;  2A5U A;  4WAA A;  4CYE A;  2ZNV C;  2Y5B B;  5FR6 A;  3QWZ B;  1EO6 A;  2REX A;  3H1U A;  2WX0 A;  1XT9 B;  3PPA A;  2KX0 A;  1UBI A;  3QAR A;  4BKS D;  1WGG A;  1WZ0 A;  5TR5 A;  1Q0W B;  3DVN V;  2MP2 A;  4IM0 A;  4LCD E;  2O6V B;  2GBJ A;  2LRU A;  3PS6 A;  2EMT A;  3VTV A;  4DHJ D;  4II3 B;  3DBH I;  2EMS A;  3SU8 X;  1WY8 A;  3W1S A;  4EEW A;  2JVC A;  1XQQ A;  4G0N B;  2G4D B;  2DAF A;  2N1V A;  4HCP B;  4WWP A;  5LXI B;  2KAN A;  2JF5 A;  5DPR A;  5IAA C;  4JLC A;  4DBG A;  4DHZ B;  4F1S A;  2PJH A;  3QAQ A;  4AJW A;  4KIK B;  2V4L A;  2K39 A;  2KJH B;  4HK2 A;  2GBM A;  4EZJ A;  2BGF A;  4OVV A;  4A3P A;  5DPS A;  3ZLZ A;  2LRW A;  3PHW B;  3HM6 X;  2L76 A;  4G11 A;  2N1W A;  3ALB A;  4JGH B;  2KK8 A;  2RSU A;  1Z5S B;  5DPW A;  3QHT A;  4N9F 4;  3UIO B;  3AU4 A;  3NS8 A;  4F8C B;  2FCQ A;  4GDK B;  1WYW B;  4BOZ B;  1E8Z A;  2MA9 B;  3VDZ A;  2L00 B;  2KFK A;  2MW5 A;  3APC A;  2BYE A;  3ZTC A;  4ANV A;  5AZF A;  2NBU A;  1WE7 A;  3OJ4 B;  3GZN I;  3UQA A;  3Q3J A;  3AI5 A;  4ICU A;  2MP2 B;  5JZE B;  2D2Q A;  4M0W B;  4XZ4 A;  4BVU C;  4IC7 B;  4DXA B;  2C7H A;  2CHZ A;  4EZK A;  3NZU A;  3WAO A;  3U30 A;  4FBJ B;  3A9K A;  1WR1 A;  3PTF C;  2PE6 B;  1A5R A;  1PQS A;  3DBL I;  3TCA A;  1MG8 A;  2RPQ A;  1E8Y A;  1OGW A;  1TTN A;  4NNJ B;  3ZKJ C;  5KHQ A;  3NOB A;  2ZJD A;  3D32 A;  2C7N B;  2UYZ B;  1GJZ A;  4A3O A;  1ZGU B;  5LXH A;  3ZTD A;  1C3T A;  2RGF A;  3OAW A;  3JVZ X;  2EKE C;  3W1S C;  4M8N A;  1TZ1 A;  3O65 B;  2DAJ A;  4ANU A;  3AUL A;  2D07 B;  5CHV C;  3MTN B;  2DYM A;  4W9I A;  2BWF A;  3RZW C;  2W9N A;  1YIW A;  2MX2 A;  4GGQ A;  2JZ3 B;  4K81 A;  1WRD B;  2IYD B;  2L05 A;  5DCN A;  1I42 A;  4E74 A;  4W9H A;  1RRB A;  2KFJ A;  3V62 A;  2HE7 A;  4AUQ C;  1EF5 A;  4AJY B;  4XX5 A;  3T9L A;  1WH3 A;  4HJK A;  4ASW C;  3OLM D;  2MBE A;  3PHX B;  3VH4 B;  3ML9 A;  1NDD A;  4EKU A;  1G6J A;  3TIX A;  1SIF A;  4JIO U;  5LLI A;  3RT3 B;  1LQB A;  1WXS A;  2ZVO A;  3DQV A; 
#chains in the Genus database with same CATH topology
 4QAY A;  2C9W B;  1FO4 A;  2JRH A;  4J3O D;  1AYF A;  1P9D U;  4A20 A;  4GXB A;  1DOX A;  3KUZ A;  4FUL A;  4HPM B;  3MJ5 A;  1FM0 D;  3CMM B;  3BIN A;  3RYT A;  2MQJ A;  1KLG D;  1IPG A;  1OTR B;  4P16 A;  1ET6 A;  1OEY A;  2JUO A;  5GMV A;  3AN1 A;  3PO0 A;  2K8B A;  3VAW A;  3U4E G;  5IKC M;  1NEK B;  4LNK A;  2C5L C;  2KQS A;  3HUI A;  1QZE A;  1L0X B;  1BT0 A;  4XE0 A;  5EDS A;  1UGJ A;  3EC8 A;  1P7E A;  1T0Y A;  4IKG A;  1WM2 A;  4A55 A;  2JWU A;  2JYE A;  3KH0 A;  2KC1 A;  4II2 B;  2IO3 B;  3HVZ A;  2K3U A;  2K8H A;  1N63 A;  1VZ7 A;  1FXA A;  4MGY E;  1XEE A;  1RFK A;  1MJD A;  2BS2 B;  3CF6 E;  2JYT A;  3L16 A;  3R66 C;  4RF0 A;  2KN5 A;  2BPS A;  1F52 A;  4ANX A;  4YSX B;  1RFA A;  3UF8 A;  1HTO A;  3GE8 C;  3HVD A;  2SEB D;  3MHS D;  3ZYY X;  2LWP A;  2PKO A;  3DBL B;  4XYC A;  2D3G A;  5D94 A;  4KV2 A;  2V9H A;  5AZG A;  3M62 B;  2M56 B;  2NPT B;  3P63 A;  4KZ0 A;  2Y3A A;  4REZ A;  2H88 B;  2INP E;  3BYT B;  2G4S A;  3RD2 A;  1I7H A;  1OFF A;  5G5H A;  4LDT B;  5BYQ A;  2XK5 A;  2VH2 A;  2LJI A;  4B0M A;  3AE2 B;  4JE3 B;  3NZS A;  1D4B A;  1JRU A;  1FNW A;  1V2Y A;  3AE4 B;  2BTE A;  1YQ4 B;  2UWQ A;  1T3Q A;  4MEL A;  2CJO A;  4CQN A;  4HPL B;  2DYB A;  1K53 A;  4XWT A;  2WXF A;  3RZF A;  1SBB B;  4GMV A;  3DHH C;  3L54 A;  4XGA B;  3FKY A;  5G55 A;  1WR6 E;  3Q6B A;  4KSL C;  4ZRK A;  3AXC A;  4WH4 A;  3NUH B;  5AEK B;  1YOV B;  3R2I A;  2WXN A;  4WWN A;  2GB1 A;  4YSY B;  2LXC A;  3MJW A;  2QIL A;  3M63 B;  4PS8 A;  2AL6 A;  1SIJ A;  2AEH A;  3Q2A C;  2BQQ A;  3ECI A;  3VRA B;  2CU1 A;  2N4F A;  5BYR A;  3Q14 C;  1MHX A;  2PEA A;  3VR8 B;  3C8Y A;  1EF1 A;  2YLM A;  3PVL A;  1WE6 A;  1RYJ A;  2DEN B;  5D3I B;  2LGX A;  3K9P B;  4HXD A;  4XC2 A;  4HCN B;  4P1C C;  4M02 A;  1FCC C;  2MSE D;  3P4S B;  1YJI A;  4HWI B;  2L7R A;  3PRZ A;  2K0P A;  2WLB A;  3L08 A;  4KGS A;  3H7S A;  3E56 A;  3ZNG C;  3ML8 A;  3SFD B;  4URK A;  3T8M A;  1MG4 A;  2LUE A;  3N20 C;  2E3T A;  5KHO A;  1Q5W B;  1UEL A;  3E9S A;  1VCB A;  1V5O A;  1UWX A;  2J0M A;  2RDH A;  3P4P B;  2LGD A;  1L6U A;  4BAX A;  4MH0 E;  1XLP A;  2KDF B;  3P42 A;  3U2S C;  1V9J A;  4B95 A;  2O2V A;  1GG3 A;  3DHG C;  3UIN B;  4MJS B;  1A70 A;  3VFK A;  2V3N A;  2PE9 A;  2L8J A;  1V5T A;  3V6C B;  4FA6 A;  1ACC A;  2KJR A;  4MT5 A;  1AAR A;  2L83 A;  1IBX A;  2NS5 A;  1E9M A;  3VQI A;  1H8C A;  2K6D B;  2W3R A;  3IT4 B;  3WIM A;  4MSM B;  2WU2 B;  1WXA A;  2XEW A;  3DHI C;  2FCS A;  2WYQ A;  4BKT A;  4XWW A;  2CKH B;  2Q5W D;  2XBB C;  4A9A A;  2GBR A;  1FCL A;  1KTK A;  2WX1 A;  3QC8 B;  2RR9 A;  1WM3 A;  4Q2J A;  3QCA A;  1M4V A;  2BS4 B;  2FNJ B;  3AU5 A;  3ZRF A;  4M01 A;  4W9C A;  1JAL A;  2KDM A;  1FPY A;  2M8S A;  1YX6 B;  1SXT A;  3AMZ A;  4AS1 A;  1V81 A;  3IG3 A;  2KQ7 A;  1WMH B;  2WXO A;  1WGR A;  4HDO A;  2KWC A;  2WWZ A;  4K7W A;  1B1Z A;  2EKI A;  2PMV A;  2O6V A;  2KTR B;  1WI0 A;  1F2R C;  1NI2 A;  3PLU A;  3DCG A;  4C56 C;  2KXJ A;  1F77 A;  4C80 A;  1JRP A;  2H89 B;  2FUH B;  1C78 A;  2NCN A;  2FIF A;  3TUO A;  5JH5 C;  2KMC A;  3TMP B;  3NVV A;  2PPH A;  1NYR A;  5IO9 A;  4IG7 B;  4TKN A;  2FBW B;  2KHW B;  2WHI A;  4IOI E;  3AV8 A;  3ZO5 B;  2MWS B;  2D3C A;  3WAL A;  1L6V A;  2BYT A;  3R2T A;  2N9K A;  1WJN A;  1YMH E;  4GDK A;  4CYE A;  2ICI A;  1R4M B;  3PS6 A;  3GS2 A;  1KLU D;  3DBH I;  1XQQ A;  2DAF A;  5IAA C;  4DHZ B;  2JU6 X;  4AJW A;  2K39 A;  4EZJ A;  1L4D B;  4A3P A;  1N5W A;  3HM6 X;  3ALB A;  4JGH B;  2IND C;  2KK8 A;  2RSU A;  1Z5S B;  3QHT A;  4N9F 4;  2LGS A;  1JWS D;  3NS8 A;  4BOZ B;  2W3S A;  1E8Z A;  2MA9 B;  3RNE C;  3KWV A;  2L00 B;  2MW5 A;  3APC A;  3ZTC A;  4BZA A;  5IOI A;  5AZF A;  2OED A;  4LNI A;  3Q3J A;  3UQA A;  3AI5 A;  4JWU C;  4M0W B;  4XZ4 A;  4DXA B;  1QIL A;  2C7H A;  3R8B A;  4FBJ B;  3A9K A;  3TCA A;  1MG8 A;  2RPQ A;  1E8Y A;  4NNJ B;  1P7F A;  2Y5P A;  3NOB A;  3BVZ A;  1ZE3 D;  3D32 A;  2UYZ B;  2WXH A;  3JVZ X;  3Q8C A;  1XO3 A;  1N6Z A;  5HG2 A;  2D07 B;  4HRO A;  5AUK A;  1L4Z B;  2MX2 A;  2IYD B;  4E74 A;  4AJY B;  5HHD G;  4HJK A;  4DQO C;  1NDD A;  2INN E;  1VLB A;  2IJ0 A;  2TSS A;  3K9O B;  1LFD A;  2KFK B;  1AN8 A;  3P4R B;  4WJN A;  4HPP A;  2WXP A;  4MH8 A;  2GMI C;  4YWG G;  4WIP A;  3A9J A;  3VUY A;  2N7D A;  2JT4 B;  1V49 A;  4BBN C;  4GIV A;  1L5P A;  3ZXR A;  1HZ5 A;  3VTU A;  2BF8 B;  4YL8 A;  1KRH A;  3QA8 A;  3SD5 A;  3L10 B;  3J9C A;  1JWM D;  2D3B A;  1P3Q U;  3AEB B;  3NHE B;  2DX5 B;  4JL9 A;  4B9K A;  4HRS A;  3L13 A;  4FLH A;  1EU3 A;  4E3C A;  2VZK D;  3A33 B;  1P1A A;  4CHK A;  3GE3 C;  1UUP A;  1TKE A;  3AED B;  1XLN A;  4DDG D;  2FCN A;  3V61 A;  1N62 A;  2M17 A;  4KGT A;  1TYG B;  1WJ4 A;  2GOW A;  4P6V F;  2AQ1 B;  1WGK A;  1Y8R C;  3PZ8 A;  2N9X A;  4KDL B;  3LXF A;  4KKI A;  2WXQ A;  2MLB A;  2KZR A;  3I57 A;  3ZDT A;  1TS4 A;  2KC2 A;  4C7Z A;  5CHW A;  2J0J A;  3OG5 A;  3ZNI D;  4DXF A;  2KWV B;  2AL3 A;  1ZDX A;  1LGR A;  4DWF A;  4YTP B;  1I4H A;  4YTN B;  3MFG A;  2CS4 A;  4EOY A;  1SB3 C;  2G3Q B;  1TKY A;  2LD9 A;  1ZKH A;  2L0F A;  4P1B C;  2I2Y A;  4BOS C;  3ENE A;  2DWQ A;  3B9J A;  4NJC A;  3UIP B;  4ZHP A;  2KT7 A;  1TY0 A;  3V05 A;  3H9D A;  1SE4 A;  3HHM A;  3WAN A;  4J6I A;  3KQ4 A;  4PS7 A;  2J42 A;  1WX9 A;  4NQK E;  2RDB C;  3ZQ4 A;  5AZH A;  4IUM B;  3ZJU A;  3SFE B;  4KX6 B;  1YQ3 B;  1T0Q C;  5CTR C;  5FK9 C;  1XCQ L;  2C7M B;  3P1M A;  2LEK A;  3B1L X;  2ZPY A;  2CHX A;  2KDE B;  1HE8 A;  2K1F A;  2KWD A;  2GBN A;  2MBO A;  2L32 A;  1UD7 A;  3NJT A;  4D2K A;  4MDK E;  3TJP A;  1R4N I;  1JCK B;  2W54 A;  2N0S B;  2M4N A;  4W9L A;  3AEA B;  1MHH E;  1I4G A;  5IA7 A;  3APD A;  3IAS 1;  4M00 A;  3GB1 A;  2XK5 B;  1ISN A;  4ZRQ A;  3VRB B;  5D7G A;  1Y56 A;  4HKQ A;  4HDQ A;  4TMA B;  4AP4 C;  4ICV A;  2BKF A;  2IO0 B;  4ZRJ A;  1EWY C;  3P2B A;  1DOI A;  1ET9 A;  2JXX A;  1WX7 A;  3H7P A;  4FJZ A;  4OVU A;  3TEX A;  2K8C A;  4ITK A;  1J7A A;  4LNN A;  3WA0 A;  4LDT D;  4K3B A;  4NAW A;  1R7S A;  4HKZ E;  4WJQ A;  1WSP A;  2K6Q A;  2K22 A;  4ZYS A;  3VXW A;  1RM6 C;  2XNA C;  5CX3 A;  2IGD A;  3RUI B;  1VJK A;  1K50 A;  3KYC D;  1Z2M A;  2MJ3 A;  1SEB D;  3HM3 A;  1ZDV A;  1PGA A;  2R2Q A;  2K25 A;  2A4Z A;  1YJJ A;  2VRR B;  1UZX B;  4DXG A;  3KYD D;  4X57 B;  1YN3 A;  2ZEQ A;  2IO2 B;  1V86 A;  3H6N A;  4L2Y A;  4W9J A;  4XDC A;  3L17 A;  2KAC A;  5C3J B;  1E8W A;  4PYU A;  3ZJT A;  3SR6 A;  4IWQ A;  2WQY B;  1GNU A;  4DDI D;  4G3X B;  3VTW A;  4IWP A;  2HD5 B;  4WQM A;  2DZM A;  3AB5 A;  1SE2 A;  1FD6 A;  4RGM A;  2BB5 A;  5C23 A;  2MBQ A;  1E10 A;  3SEB A;  2CJN A;  2O2V B;  1OQR A;  3FC4 A;  3X0W A;  4YXD B;  2LZ6 A;  4MGZ E;  2YEP F;  4LJP B;  2ZCB A;  1UF0 A;  2DYO A;  4IW0 A;  1C4C A;  2JZP A;  3AH7 A;  1IBX B;  2N9P C;  1L2N A;  3TL5 A;  1OEY J;  3QJZ A;  2MH7 A;  3MC0 B;  3V6E B;  3ABV B;  1E5W A;  2GBK A;  4JQW C;  3U52 E;  1TS3 A;  4I6P A;  5H8Y E;  1GAQ B;  2MHJ A;  3SHQ A;  4ZDV A;  2WXM A;  2ZPN A;  3CSF A;  3LYY A;  1OQY A;  2L1A A;  1TY2 A;  3N1Z C;  1NBF C;  3W5U B;  3DPD A;  4TV3 A;  4RH6 A;  4FHK A;  3NVW A;  3QIJ A;  2XN9 C;  3MC8 A;  5E6N A;  2AQ3 B;  3X23 A;  1C79 A;  2ZNV B;  1JWA D;  2N7J A;  4A8X C;  2JQR B;  2BWE S;  2V1Y A;  5GXG B;  4WAA A;  1C9F A;  3DWM A;  5FR6 A;  5BYS A;  4MAC A;  3W5V B;  3QWZ B;  2REX A;  1XT9 B;  2KX0 A;  4BKS D;  1WGG A;  2JSV X;  2K5P A;  1ZP0 B;  3WCQ A;  1Q0W B;  3DVN V;  2MP2 A;  4IM0 A;  4LCD E;  3RN9 C;  2O6V B;  2QEJ C;  1N5X A;  2LRU A;  2PVG C;  3VTV A;  4II3 B;  3ETR A;  3C19 A;  2JVC A;  2N1V A;  1OQQ A;  2KAN A;  2X8X X;  2JF5 A;  5DPR A;  4JLC A;  5EE0 A;  4F1S A;  2AQ2 B;  1HEZ E;  2V4L A;  4EE2 A;  3H8H A;  4US8 A;  2L76 A;  2N1W A;  5DPW A;  1QOG A;  4F8C B;  2FCQ A;  4GDK B;  4OZB A;  2G1E A;  1C4P A;  2BVC A;  4A90 A;  3EA6 A;  3VR9 B;  4LNF A;  1EWC A;  3OJ4 B;  1WE7 A;  3KWL A;  3GZN I;  4KGR A;  1MVK A;  5JZE B;  4OZC A;  3AE7 B;  2X38 A;  4IC7 B;  3WAO A;  2LFI A;  1TTN A;  3ZKJ C;  2NTT A;  2ZJD A;  1GJZ A;  3AEF B;  5LXH A;  3ZTD A;  2RGF A;  4C4V A;  4OHJ A;  2EKE C;  3W1S C;  4M8N A;  1TZ1 A;  4ANU A;  4HEA 1;  4B0E A;  5E6J A;  3RZW C;  4GGQ A;  4K81 A;  1WRD B;  2KAJ A;  2L05 A;  5DCN A;  1VDV A;  1IGD A;  4AUQ C;  4FXC A;  4ZHO A;  4ASW C;  2DLB A;  3VH4 B;  3ML9 A;  1GPX A;  4EKU A;  3TIX A;  3RT3 B;  1LQB A;  2ZVO A;  2QJL A;  3DQV A;  3PV1 A;  1KOT A;  4NZL B;  4OZA A;  1K51 A;  1HTQ A;  1L7Y A;  2B76 B;  5EE3 A;  2LVQ A;  1AWD A;  3A9K B;  2M0A A;  2LVO A;  1VZ8 A;  4MGK E;  4O1N A;  1T5X D;  3ZUN A;  4N6E B;  2KLG A;  3KLS X;  3DBH B;  5C2T B;  5L83 A;  4FN2 A;  1WJ6 A;  3BK1 A;  3I63 C;  3IHP C;  4US9 A;  4IWO A;  2J53 A;  2PVO D;  1EU4 A;  4NJ6 A;  1I4R A;  2LGY A;  2MRP A;  2LJ5 A;  3JYU A;  4HVB A;  3ZW3 A;  1WIA A;  4HJG E;  1WRI A;  2IDY A;  2KVZ A;  2HTM E;  2DZI A;  1PFD A;  1I4P A;  5D6J B;  3PRP B;  1E7V A;  5J17 A;  2WU5 B;  4M8M A;  3BVG A;  2J52 A;  2RD0 A;  3A9J B;  3A4R A;  1UBQ A;  3B08 A;  4RNA A;  2N7E A;  1PUT A;  1WXV A;  4GOC A;  2OHF A;  2Z0D B;  3UGB B;  2KDI A;  1EM7 A;  1IUE A;  2R61 A;  1PYW D;  2ZW1 A;  4KZC A;  4ACF A;  1V8C A;  1I35 A;  3SDL C;  5EE9 A;  5T8I A;  4B6W A;  3T3N A;  1WGY A;  4MGI E;  3ZGZ A;  1F1H A;  4GDL A;  2WXI A;  2FAZ A;  1SJH D;  3GP7 A;  3EGR A;  3RI7 C;  1EUV B;  3IT6 B;  2AYO B;  1TGZ B;  3RCZ A;  4YTM B;  3DBR I;  2JPH A;  3L4P A;  2PLP A;  3NRZ A;  1KF6 B;  4USA A;  3DDC B;  1NYQ A;  3DWG C;  5LNK 1;  1ZXH A;  2JWZ A;  4PYZ A;  1GB4 A;  4ARC A;  2KD0 A;  1GOZ A;  3KUD B;  1D3Z A;  2LAS A;  4ARI A;  3TEW A;  4IM3 A;  3BYY B;  2ZW0 A;  5AUI A;  5J2R A;  2WXR A;  4KSK C;  2M1M A;  2IBI B;  1LO5 D;  1HXY D;  1BML C;  4H2A A;  3R7Q A;  4EUT A;  1U4A A;  1XLQ A;  3BVM A;  4JX1 C;  4RFB A;  1I4X A;  2C60 A;  2L52 A;  4W9D A;  2LXA A;  2NMQ A;  3Q3F A;  3NVY A;  1PDX A;  1UGM A;  3MHZ A;  2KDB A;  3R3M A;  4MEM A;  1T6B X;  2IY0 B;  2BYV E;  1MFW A;  1S1Q B;  4WUR A;  2L3Z A;  2DZJ A;  5J18 A;  3VUX A;  1K8R B;  4EZL A;  4GN1 A;  4R3D A;  3N1Y C;  3A1Q A;  2ONQ A;  4ZOH C;  3JW0 X;  3N30 A;  1N60 A;  2CHW A;  3RMK C;  2WP9 B;  1WZ3 A;  2KWU B;  4RF1 A;  1QOB A;  3MP9 A;  2Z59 B;  4ANW A;  3FIL B;  3EEC A;  4WJO A;  3B0A A;  1ZXI A;  3PLV A;  2E6X A;  3IVF A;  1V1P A;  3HK0 A;  3FAH A;  4E71 A;  1CQV A;  1FRD A;  3PSE B;  4I6L B;  2I1J A;  2LHD A;  1ZOY B;  2JX5 A;  4W9F A;  2GLS A;  1E8X A;  2DHZ A;  2I38 A;  3PT2 B;  1C76 A;  1RWS A;  3AE9 B;  3LJ3 A;  4I6N B;  1C4A A;  4FJV B;  1QOF A;  3N3K B;  1X1M A;  4FHJ A;  3TBL D;  2KX3 A;  1RAX A;  4TSS A;  4KDI C;  3H7P B;  2WXJ A;  3PRE A;  1JWB D;  3DVG Y;  2RPV A;  3U7D A;  1VZ6 A;  4C7Y A;  4NAW B;  4BKG A;  4ZRP A;  4DHJ B;  5CHF A;  4NQL B;  1YX5 B;  1R4N B;  2BYF A;  4BBN F;  2LI5 A;  1Q10 A;  3KUC B;  2D10 A;  1J7C A;  2ON8 A;  3WAP A;  1XF5 L;  4S17 A;  3AE5 B;  3GOE A;  4L1B A;  1FRR A;  1V80 A;  1D6E C;  2CR5 A;  2IGH A;  2G45 B;  4ZRI A;  5IN7 A;  2HTH A;  3NS1 A;  5D3D A;  1SGH A;  1SSN A;  5C1Z A;  3VVW B;  2L0T A;  1MPE A;  4PS3 A;  3FIL A;  1YJ1 A;  1F9J A;  4EFO A;  2FUG 1;  4W9G A;  4RGO S;  4RGN A;  1KLV A;  3OWE B;  1F0Z A;  1NVI D;  1GC6 A;  4TQ1 A;  2KQ4 X;  1Q1O A;  5HKH A;  3CST A;  2WS3 B;  4K3C A;  2NBV B;  1S3S G;  1LM8 B;  1IGC A;  4YSZ B;  4RM9 A;  1P98 A;  1XD3 B;  3AE1 B;  4LK0 M;  3OJ3 A;  2WXK A;  1WXM A;  2IO1 B;  4RCO A;  1ENF A;  4NPN A;  4W9K A;  4CO7 A;  3RNC C;  1YD8 U;  4MM3 A;  1HA5 A;  3VHT C;  5G5G A;  3T3O A;  3WAM A;  4RGT A;  1GUA B;  2ZNV C;  1VR9 A;  2HJ1 A;  3H1U A;  1UBI A;  3AE6 B;  2GBJ A;  2D5G A;  5I4D A;  1TT5 B;  2EMS A;  3SU8 X;  1WY8 A;  4N58 A;  2G4D B;  1CZP A;  4HCP B;  4WWP A;  2PIA A;  2KYW A;  1V1O A;  3N1X C;  2PJH A;  3RFZ B;  4KIK B;  2KJH B;  4S0R A;  4HK2 A;  2GBM A;  2D3A A;  4OVV A;  5DPS A;  3BII D;  1ZUD 2;  3Q3M C;  4G11 A;  3I9V 1;  2QC8 A;  3UIO B;  3URY A;  3AU4 A;  3B2G A;  2WNM A;  1WYW B;  4L23 A;  3VDZ A;  1YN5 A;  1DOY A;  3AEG B;  2BYE A;  1I4Q A;  2GRI A;  5BMH A;  1QF6 A;  2PW9 A;  2NBU A;  2JXT A;  1ZPS A;  2MP2 B;  4UDU C;  2D2Q A;  1TZO A;  3U30 A;  2V3P A;  4NAM A;  3PTF C;  1PQS A;  3DBL I;  4A6Q A;  1OGW A;  2WGS A;  4A3O A;  3HRD D;  5EE1 A;  3O13 A;  2DYM A;  4W9I A;  2W9N A;  5BMG A;  2JZ3 B;  1JRO A;  2QMT A;  3TSS A;  4XX5 A;  2BS3 B;  1STE A;  5JXV A;  3OLM D;  1C77 A;  2MBE A;  2LHE A;  1ESF A;  1G6J A;  1SIF A;  4JIO U;  3Q8E A;  2DNF A;  1WXS A;  3BZD B;  1JW9 D;  1TJE A;  2O6V D;  5FKA C;  1VD2 A;  2DZK A;  1HZ6 A;  3TEY A;  1UH6 A;  3ONS A;  2IZV B;  4KIK A;  2YVC A;  3N9Y C;  3ZDM C;  4F7Z A;  2I1K A;  1VRA B;  3JSV B;  1SE9 A;  5FR3 A;  4IDI A;  2KOX A;  2YEP B;  5E6O A;  1PGX A;  3PGE A;  5H92 C;  4C4V B;  1JQ4 A;  4AQ7 A;  1WX8 A;  3NG0 A;  2LMC A;  2V0G A;  5D2M B;  1IP9 A;  4PK1 A;  2BB6 A;  4LNO A;  3ZIM A;  3NY5 A;  3RPF C;  5G2N A;  4HLE A;  3CIR B;  2NPT A;  1SF0 A;  3IXS A;  4AOF A;  3UI3 A;  1XXG A;  3IFW B;  1TS5 A;  2LUM A;  2KLC A;  3MC9 A;  2Z8L A;  5DPT A;  1YQB A;  2DBY A;  1T0S C;  2G9H D;  4WJP A;  1P0R A;  2JY6 A;  4KVG B;  1D5X C;  1XLO A;  3LB8 C;  5MPO A;  2R2O A;  4WAF A;  3W2D A;  4GSW A;  2M19 A;  1BUI C;  4RM8 A;  1CMX B;  1JML A;  2OJW A;  2JRI B;  4NY0 A;  3GZN B;  2J7Q B;  4XDD A;  3M95 A;  4LLG M;  3CWI A;  1QQR A;  4WQO B;  4FJY A;  3AEE B;  1SJE D;  2CU3 A;  1WXQ A;  1WFY A;  3BWU D;  3L0W B;  3AM9 A;  2IGG A;  2MBH A;  2KKC A;  1FEH A;  2VH1 A;  1FXT B;  3W1Y A;  4TQ0 A;  1WWT A;  4IM2 A;  3JSV A;  1ZW7 A;  2ZZP B;  2NVU I;  5BMI A;  2EEL A;  1TBE A;  3Q8B A;  1QKZ A;  4BFR A;  2MJD A;  2BT6 A;  3IAM 1;  4AWJ A;  3DVN U;  2KTF A;  3QX1 A;  3RNF C;  5JHB A;  1V6E A;  2FE8 A;  2V4I B;  2AWT A;  2Y5C A;  1UWM A;  4RMA A;  2ZVN A;  4OVZ A;  2AX5 A;  3NZ3 A;  2QIE B;  4GB9 A;  3UQB A;  3ZVV A;  4P7I A;  2ACZ B;  2J0K A;  1YN4 A;  2FCM A;  1L0V B;  1J8C A;  2MCN B;  2V3S A;  4GDL B;  3EHV A;  2GI9 A;  2W82 A;  3EFC A;  3APF A;  2OJR A;  4MSQ B;  2RDG A;  2WDT B;  3V60 A;  3ZRC A;  4ZYN A;  4N59 A;  4MJS A;  3DVG X;  2BBC A;  4GLS C;  2WDR B;  5L95 C;  1V97 A;  3VUW A;  2KN4 A;  1C1Y B;  3RUL A;  2IPK D;  2KNB A;  4LJO B;  1HQR D;  1WGD A;  3LDZ E;  2N9E B;  3N32 A;  2INC C;  4K1R B;  4W9E A;  3C0R B;  1WYG A;  2ZCC A;  3R7R A;  3A4S C;  2QSD A;  4BKS A;  1D5Z C;  2NBW B;  4K7S A;  5IP4 D;  3Q69 A;  1LXD A;  1H4R A;  1TKG A;  4NJ7 A;  1SE3 A;  2IY1 B;  4WWO A;  3PZD A;  2MJE A;  2OOB B;  2BKR B;  1J7B A;  2SAK A;  1FIQ A;  2QHO A;  1WF9 A;  2MBB B;  2M0X A;  2FID A;  3DBR B;  1TS2 A;  2KJ6 A;  2KO3 A;  1R4M I;  2HJ8 A;  4DK5 A;  4JWS C;  1WMH A;  2B3A A;  3HIZ A;  3Q3O C;  3BY4 B;  4FAD A;  3W9C B;  2WXL A;  2D11 A;  3A1Q B;  3DOW A;  1FFV A;  1QOA A;  1RLF A;  2N9L A;  2KTR A;  4OW0 A;  4YT0 B;  2RMM A;  3AE8 B;  3I5J C;  1E6E B;  2LGI A;  3ZNH B;  1WJU A;  1KM7 A;  1YNT E;  3PRM B;  4TUU A;  1E0Z A;  2ASQ A;  1KH0 A;  1KFY B;  1E7U A;  1NI3 A;  1J0G A;  3P4Q B;  3M3J A;  2WDV B;  1NEN B;  2KMA A;  4G50 A;  5E6P A;  5JHA A;  1V1P B;  5BO4 B;  1IYF A;  1WGH A;  4WWM A;  1L0Y B;  1AW7 A;  4DHZ E;  3DBS A;  3PZ7 A;  1FXI A;  2UU7 A;  1JWU D;  3EFU A;  1MI0 A;  1B9R A;  3EUB 2;  1M94 A;  3I3T B;  1ROE A;  3Q8A A;  2KMM A;  2KVR A;  2W55 A;  3S2A A;  1BXT A;  2LVP A;  4KKJ A;  1E7P B;  1QLB B;  2PTL A;  3BK2 A;  1QT9 A;  3U8Z A;  1CK1 A;  2NR2 A;  3VH3 B;  2MEK A;  1E90 A;  2J4X A;  2K9X A;  1F2R I;  3U7Z A;  1FNU A;  3Q3N C;  3QQ8 B;  4GU2 A;  1J19 A;  1DYQ A;  1GC7 A;  3KVF B;  1KJT A;  2HDE A;  3KW5 B;  4K7U A;  3Q8F A;  2JZZ A;  3QK0 A;  3ZNZ B;  5TSS A;  3IBE A;  2Z0E B;  2A5U A;  2Y5B B;  3AEC B;  1EO6 A;  2WX0 A;  2WXG A;  3PPA A;  3QAR A;  1WZ0 A;  5TR5 A;  1K52 A;  3ZXV A;  4M0W A;  2WDQ B;  3B2F A;  2EMT A;  3V3X A;  4DHJ D;  1TIF A;  3W1S A;  4EEW A;  1N61 A;  4G0N B;  5HFY A;  5LXI B;  3ZJV A;  4DBG A;  3QAQ A;  1UNS A;  2BGF A;  3ZLZ A;  1CJE A;  2LRW A;  3NVZ A;  3PHW B;  4MM3 B;  4PT5 A;  2NTS A;  2VZK B;  2KFK A;  2QCZ A;  4ANV A;  3RNG C;  1PGB A;  4C00 A;  1FNV A;  1GB1 A;  4ICU A;  1FMA D;  1XCT L;  4BVU C;  4EZK A;  2CHZ A;  1D5M C;  3NZU A;  4JPS A;  1WR1 A;  2PE6 B;  1A5R A;  2BW2 A;  5KHQ A;  2C7N B;  1ZGU B;  1C3T A;  3OAW A;  3O65 B;  2DAJ A;  3AUL A;  5CHV C;  1T0R C;  3MTN B;  2BWF A;  1FFU A;  1YIW A;  1I42 A;  4W9H A;  5HI1 A;  1RRB A;  2KFJ A;  3V62 A;  2HE7 A;  1EF5 A;  3T9L A;  1WH3 A;  3PHX B;  3AE3 B;  3RNA C;  3RNB C;  5LLI A;  2QDF A;  3TEZ A;  1DGJ A;  4LTU A; 
#chains in the Genus database with same CATH homology
 3K9O B;  1LFD A;  2C9W B;  2KFK B;  2O6V D;  1VD2 A;  2DZK A;  3PV1 A;  1KOT A;  4WJN A;  2JRH A;  1UH6 A;  3ONS A;  1P9D U;  4A20 A;  1L7Y A;  4GXB A;  2IZV B;  3KUZ A;  4KIK A;  2YVC A;  2GMI C;  2LVQ A;  3ZDM C;  3A9J A;  3VUY A;  2N7D A;  4F7Z A;  2I1K A;  4FUL A;  2JT4 B;  1V49 A;  3JSV B;  3A9K B;  4HPM B;  4BBN C;  2LVO A;  1SE9 A;  3CMM B;  3BIN A;  3RYT A;  4GIV A;  2KOX A;  4MGK E;  2MQJ A;  1IPG A;  1OTR B;  3VTU A;  5E6O A;  3ZUN A;  1OEY A;  3PGE A;  2KLG A;  2JUO A;  2BF8 B;  4YL8 A;  3QA8 A;  5GMV A;  2K8B A;  3VAW A;  3SD5 A;  3L10 B;  1WX8 A;  5L83 A;  4FN2 A;  1P3Q U;  1WJ6 A;  2C5L C;  3NHE B;  2DX5 B;  5D2M B;  2KQS A;  3IHP C;  1IP9 A;  1QZE A;  4JL9 A;  1BT0 A;  3ZIM A;  4B9K A;  3NY5 A;  3L13 A;  4IWO A;  5G2N A;  4FLH A;  5EDS A;  4E3C A;  4HLE A;  2NPT A;  3EC8 A;  3A33 B;  4NJ6 A;  1P1A A;  4AOF A;  4CHK A;  3IFW B;  1T0Y A;  2LGY A;  2MRP A;  2KLC A;  1WM2 A;  2LJ5 A;  5DPT A;  1YQB A;  3JYU A;  4HVB A;  3ZW3 A;  1WIA A;  4DDG D;  2FCN A;  2KC1 A;  3KH0 A;  4II2 B;  3V61 A;  2IO3 B;  4WJP A;  2M17 A;  1P0R A;  1WJ4 A;  2GOW A;  2JY6 A;  2K8H A;  4KVG B;  1Y8R C;  2DZI A;  2N9X A;  4MGY E;  2R2O A;  4KDL B;  5D6J B;  4GSW A;  3PRP B;  1E7V A;  5J17 A;  4M8M A;  3CF6 E;  2RD0 A;  3L16 A;  2MLB A;  3R66 C;  2KN5 A;  2KZR A;  4RM8 A;  3ZDT A;  2BPS A;  3A9J B;  1CMX B;  3A4R A;  2KC2 A;  1UBQ A;  4ANX A;  3B08 A;  2JRI B;  2N7E A;  4NY0 A;  5CHW A;  1RFA A;  3UF8 A;  2J0J A;  1WXV A;  2J7Q B;  4GOC A;  3ZNI D;  3M95 A;  3MHS D;  2Z0D B;  3UGB B;  2KWV B;  2KDI A;  2AL3 A;  2LWP A;  4WQO B;  4FJY A;  2D3G A;  4DWF A;  5D94 A;  4KV2 A;  4KZC A;  1I35 A;  2CS4 A;  3SDL C;  4EOY A;  1WFY A;  2G3Q B;  5AZG A;  3M62 B;  4B6W A;  3L0W B;  1WGY A;  2LD9 A;  2MBH A;  2KKC A;  4MGI E;  1ZKH A;  2NPT B;  4KZ0 A;  2L0F A;  1FXT B;  4GDL A;  4BOS C;  2G4S A;  3W1Y A;  2FAZ A;  3ENE A;  4TQ0 A;  3RD2 A;  4LDT B;  2XK5 A;  3JSV A;  4IM2 A;  1ZW7 A;  2ZZP B;  1EUV B;  2NVU I;  3UIP B;  1TBE A;  2AYO B;  1TGZ B;  3RCZ A;  3DBR I;  4BFR A;  4AWJ A;  3H9D A;  3HHM A;  3NZS A;  3DVN U;  3WAN A;  2KTF A;  4J6I A;  4PS7 A;  3QX1 A;  1WX9 A;  1JRU A;  2JPH A;  4NQK E;  5JHB A;  5AZH A;  1V2Y A;  1V6E A;  4IUM B;  2AWT A;  2UWQ A;  5CTR C;  4MEL A;  2C7M B;  3DDC B;  2JWZ A;  3B1L X;  2ZPY A;  2CHX A;  4HPL B;  4PYZ A;  2DYB A;  2KD0 A;  2KDE B;  3KUD B;  4RMA A;  1D3Z A;  1HE8 A;  2LAS A;  2ZVN A;  2K1F A;  4IM3 A;  3RZF A;  2GBN A;  2MBO A;  4GMV A;  5J2R A;  4KSK C;  3L54 A;  2M1M A;  1UD7 A;  2IBI B;  4MDK E;  3TJP A;  1R4N I;  5G55 A;  4GB9 A;  3R7Q A;  1WR6 E;  4EUT A;  3UQB A;  3ZVV A;  4KSL C;  1U4A A;  2M4N A;  4P7I A;  2J0K A;  1J8C A;  2FCM A;  4W9L A;  4ZRK A;  2MCN B;  2V3S A;  4GDL B;  3EHV A;  3AXC A;  5IA7 A;  3APD A;  5AEK B;  3APF A;  2C60 A;  2OJR A;  2XK5 B;  4MSQ B;  4W9D A;  2LXA A;  3Q3F A;  4WWN A;  1ISN A;  1UGM A;  2KDB A;  3R3M A;  2WDT B;  3V60 A;  4MEM A;  3ZRC A;  2LXC A;  3MJW A;  4ZYN A;  2IY0 B;  3M63 B;  4PS8 A;  5D7G A;  2AL6 A;  2AEH A;  2BYV E;  4MJS A;  3ECI A;  1S1Q B;  4HDQ A;  2CU1 A;  2N4F A;  3DVG X;  4AP4 C;  2PEA A;  2L3Z A;  4ICV A;  3PVL A;  1EF1 A;  2BKF A;  2YLM A;  1WE6 A;  2IO0 B;  3VUW A;  5L95 C;  2DZJ A;  2DEN B;  4ZRJ A;  3VUX A;  1C1Y B;  5J18 A;  3RUL A;  1K8R B;  2KNB A;  2LGX A;  4EZL A;  3K9P B;  4LJO B;  1WGD A;  3LDZ E;  2N9E B;  3N32 A;  3P2B A;  4GN1 A;  4HXD A;  4XC2 A;  3A1Q A;  4HCN B;  4K1R B;  4W9E A;  2MSE D;  3C0R B;  3JW0 X;  4HWI B;  2JXX A;  1WX7 A;  3H7P A;  3N30 A;  2L7R A;  4FJZ A;  2ZCC A;  4OVU A;  3A4S C;  3PRZ A;  3R7R A;  2K8C A;  3L08 A;  4BKS A;  3H7S A;  2NBW B;  3ZNG C;  2CHW A;  3ML8 A;  4URK A;  4K7S A;  3T8M A;  3WA0 A;  2LUE A;  4LDT D;  1WZ3 A;  2KWU B;  5KHO A;  4NAW A;  1Q5W B;  1UEL A;  2Z59 B;  4ANW A;  1LXD A;  3EEC A;  4WJQ A;  1VCB A;  4WJO A;  3B0A A;  1V5O A;  1H4R A;  2J0M A;  2K6Q A;  2LGD A;  3PLV A;  3IVF A;  4NJ7 A;  2IY1 B;  4WWO A;  4MH0 E;  3VXW A;  2KDF B;  3HK0 A;  3PZD A;  1V9J A;  2OOB B;  2BKR B;  4E71 A;  5CX3 A;  3RUI B;  3PSE B;  4B95 A;  2O2V A;  2QHO A;  4I6L B;  2I1J A;  1WF9 A;  1GG3 A;  3UIN B;  2MBB B;  4MJS B;  2M0X A;  4W9F A;  3VFK A;  3KYC D;  2FID A;  1Z2M A;  2PE9 A;  2KJ6 A;  3HM3 A;  2K25 A;  1E8X A;  2DHZ A;  1V5T A;  2A4Z A;  2KO3 A;  2L8J A;  2R2Q A;  2VRR B;  3PT2 B;  1R4M I;  3V6C B;  4FA6 A;  2HJ8 A;  2KJR A;  1UZX B;  4DK5 A;  3KYD D;  1AAR A;  3LJ3 A;  4X57 B;  1WMH A;  4I6N B;  2NS5 A;  2B3A A;  3HIZ A;  2ZEQ A;  3BY4 B;  3VQI A;  4FAD A;  1H8C A;  4FJV B;  2D11 A;  2IO2 B;  2K6D B;  1V86 A;  3A1Q B;  3DOW A;  3N3K B;  1X1M A;  4FHJ A;  3TBL D;  3WIM A;  2KX3 A;  4MSM B;  1RAX A;  1RLF A;  1WXA A;  2KTR A;  2XEW A;  2FCS A;  3H6N A;  4KDI C;  3H7P B;  2WYQ A;  4W9J A;  3L17 A;  4BKT A;  3ZNH B;  1E8W A;  2CKH B;  2XBB C;  4PYU A;  3PRE A;  1WJU A;  2GBR A;  1KM7 A;  3DVG Y;  4IWQ A;  2WX1 A;  3PRM B;  4TUU A;  3U7D A;  1GNU A;  2ASQ A;  2RR9 A;  3QC8 B;  4G3X B;  1WM3 A;  4IWP A;  3VTW A;  3QCA A;  4DDI D;  2HD5 B;  2DZM A;  1E7U A;  4NAW B;  4BKG A;  4DHJ B;  5CHF A;  1J0G A;  4NQL B;  3M3J A;  2FNJ B;  1YX5 B;  2BYF A;  3AU5 A;  2KMA A;  5C23 A;  4G50 A;  2LI5 A;  5E6P A;  4BBN F;  3KUC B;  5JHA A;  2D10 A;  5BO4 B;  3ZRF A;  3WAP A;  2MBQ A;  4W9C A;  1WGH A;  1IYF A;  3GOE A;  1V80 A;  2CR5 A;  2O2V B;  3DBS A;  4DHZ E;  3X0W A;  2LZ6 A;  2M8S A;  2G45 B;  4MGZ E;  1YX6 B;  4ZRI A;  4LJP B;  2ZCB A;  3EFU A;  2HTH A;  1V81 A;  2DYO A;  3IG3 A;  1M94 A;  4IW0 A;  1SGH A;  3I3T B;  5C1Z A;  2KQ7 A;  3VVW B;  1WMH B;  2KVR A;  2L0T A;  2N9P C;  1WGR A;  4HDO A;  4PS3 A;  1YJ1 A;  1L2N A;  1F9J A;  4EFO A;  2KWC A;  4W9G A;  3TL5 A;  3S2A A;  2LVP A;  2WWZ A;  4K7W A;  1OEY J;  2O6V A;  2KTR B;  3QJZ A;  1WI0 A;  3V6E B;  1KLV A;  1E5W A;  2GBK A;  4JQW C;  1NI2 A;  1GC6 A;  4TQ1 A;  3PLU A;  3DCG A;  4I6P A;  3U8Z A;  2NR2 A;  3SHQ A;  2KXJ A;  4ZDV A;  1Q1O A;  5HKH A;  3CST A;  2ZPN A;  3CSF A;  2NBV B;  1S3S G;  1LM8 B;  1OQY A;  3VH3 B;  1NBF C;  1E90 A;  2FUH B;  4RM9 A;  2NCN A;  2FIF A;  5JH5 C;  1P98 A;  1XD3 B;  2KMC A;  3QQ8 B;  4GU2 A;  3TMP B;  1J19 A;  3DPD A;  3OJ3 A;  4TV3 A;  1GC7 A;  3KVF B;  1WXM A;  4FHK A;  1KJT A;  2PPH A;  2IO1 B;  4NPN A;  3QIJ A;  4W9K A;  4CO7 A;  4IG7 B;  1YD8 U;  4TKN A;  3KW5 B;  5E6N A;  4MM3 A;  2KHW B;  4K7U A;  3X23 A;  3ZO5 B;  2MWS B;  2ZNV B;  3WAL A;  3VHT C;  2JZZ A;  2BWE S;  2V1Y A;  3QK0 A;  1WJN A;  3WAM A;  3ZNZ B;  3IBE A;  4GDK A;  2Z0E B;  1GUA B;  2A5U A;  4WAA A;  4CYE A;  2ZNV C;  2Y5B B;  5FR6 A;  3QWZ B;  1EO6 A;  2REX A;  3H1U A;  2WX0 A;  1XT9 B;  3PPA A;  2KX0 A;  1UBI A;  3QAR A;  4BKS D;  1WGG A;  1WZ0 A;  5TR5 A;  1Q0W B;  3DVN V;  2MP2 A;  4IM0 A;  4LCD E;  2O6V B;  2GBJ A;  2LRU A;  3PS6 A;  2EMT A;  3VTV A;  4DHJ D;  4II3 B;  3DBH I;  2EMS A;  3SU8 X;  1WY8 A;  3W1S A;  4EEW A;  2JVC A;  1XQQ A;  4G0N B;  2G4D B;  2DAF A;  2N1V A;  4HCP B;  4WWP A;  5LXI B;  2KAN A;  2JF5 A;  5DPR A;  5IAA C;  4JLC A;  4DBG A;  4DHZ B;  4F1S A;  2PJH A;  3QAQ A;  4AJW A;  4KIK B;  2V4L A;  2K39 A;  2KJH B;  4HK2 A;  2GBM A;  4EZJ A;  2BGF A;  4OVV A;  4A3P A;  5DPS A;  3ZLZ A;  2LRW A;  3PHW B;  3HM6 X;  2L76 A;  4G11 A;  2N1W A;  3ALB A;  4JGH B;  2KK8 A;  2RSU A;  1Z5S B;  5DPW A;  3QHT A;  4N9F 4;  3UIO B;  3AU4 A;  3NS8 A;  4F8C B;  2FCQ A;  4GDK B;  1WYW B;  4BOZ B;  1E8Z A;  2MA9 B;  3VDZ A;  2L00 B;  2KFK A;  2MW5 A;  3APC A;  2BYE A;  3ZTC A;  4ANV A;  5AZF A;  2NBU A;  1WE7 A;  3OJ4 B;  3GZN I;  3UQA A;  3Q3J A;  3AI5 A;  4ICU A;  2MP2 B;  5JZE B;  2D2Q A;  4M0W B;  4XZ4 A;  4BVU C;  4IC7 B;  4DXA B;  2C7H A;  2CHZ A;  4EZK A;  3NZU A;  3WAO A;  3U30 A;  4FBJ B;  3A9K A;  1WR1 A;  3PTF C;  2PE6 B;  1A5R A;  1PQS A;  3DBL I;  3TCA A;  1MG8 A;  2RPQ A;  1E8Y A;  1OGW A;  1TTN A;  4NNJ B;  3ZKJ C;  5KHQ A;  3NOB A;  2ZJD A;  3D32 A;  2C7N B;  2UYZ B;  1GJZ A;  4A3O A;  1ZGU B;  5LXH A;  3ZTD A;  1C3T A;  2RGF A;  3OAW A;  3JVZ X;  2EKE C;  3W1S C;  4M8N A;  1TZ1 A;  3O65 B;  2DAJ A;  4ANU A;  3AUL A;  2D07 B;  5CHV C;  3MTN B;  2DYM A;  4W9I A;  2BWF A;  3RZW C;  2W9N A;  1YIW A;  2MX2 A;  4GGQ A;  2JZ3 B;  4K81 A;  1WRD B;  2IYD B;  2L05 A;  5DCN A;  1I42 A;  4E74 A;  4W9H A;  1RRB A;  2KFJ A;  3V62 A;  2HE7 A;  4AUQ C;  1EF5 A;  4AJY B;  4XX5 A;  3T9L A;  1WH3 A;  4HJK A;  4ASW C;  3OLM D;  2MBE A;  3PHX B;  3VH4 B;  3ML9 A;  1NDD A;  4EKU A;  1G6J A;  3TIX A;  1SIF A;  4JIO U;  5LLI A;  3RT3 B;  1LQB A;  1WXS A;  2ZVO A;  3DQV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...