2M17A

Ubiquitin-like domain-containing c-terminal domain phosphatase (ublcp1)
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
81
structure length
81
Chain Sequence
MALPIIVKWGGQEYSVTTLSEDDTVLDLKQFLKTLTGVLPERQKLLGLKVKGKPAENDVKLGALKLKPNTKIMMMGTREES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure and Rpn1 Interaction of the UBL Domain of Human RNA Polymerase II C-Terminal Domain Phosphatase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Ubiquitin-like domain-containing CTD phosphatase 1
total genus 8
structure length 81
sequence length 81
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2012-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2m17A00
2MP2A 2OJRA 1LXDA 5J17A 2EMSA 1J8CA 3WIMA 2ZJDA 2ZNVB 3Q3JA 1UZXB 1P1AA 4GDLB 3WAOA 2DYOA 2XEWA 4II3B 2FCSA 2M8SA 3NY5A 4PS7A 3DBRI 3PTFC 4G3XB 4MM3A 3ZKJC 5AZHA 4MSQB 4NAWB 2C60A 2GBJA 4MGIE 1P98A 4CYEA 3L0WB 3QX1A 3LDZE 5KHQA 2JWZA 4IC7B 2KX3A 3HIZA 2L05A 3K9OB 3SU8X 1ZKHA 2JZZA 2UWQA 2MBBB 1XQQA 2DYMA 4TKNA 3ZDTA 4EZLA 2NBVB 3QARA 2IY0B 4MH0E 2KC1A 3AULA 1WR6E 4B9KA 4FJYA 2ASQA 1CMXB 2G45B 2HD5B 1WI0A 1V2YA 5CHVC 4BKSD 2N7DA 1WF9A 1KM7A 1X1MA 2IBIB 2KOXA 5TR5A 3AI5A 5LXIB 2Z0EB 2KHWB 3ECIA 3H9DA 4PS3A 1R4NI 4HDQA 2G3QB 1WIAA 4W9GA 5JHAA 4WWNA 2KWVB 5CX3A 3VQIA 5G2NA 3IHPC 3V6EB 2KFKA 4A20A 2N9EB 4EZKA 1YJ1A 1IP9A 1EO6A 1XD3B 2L8JA 3PT2B 4NQLB 5CHWA 2LRUA 2KC2A 2MWSB 4KIKA 4OVVA 4F7ZA 2NCNA 2DAFA 4GIVA 2LRWA 2V4LA 3EFUA 4LDTB 5AZFA 5G55A 2JUOA 3TBLD 5L95C 1UBIA 2JT4B 3NOBA 4KVGB 4M8NA 4TV3A 1XT9B 4HJKA 2MBEA 3TMPB 4AP4C 4FHKA 1M94A 4GB9A 1GC6A 1WMHA 2RSUA 3ENEA 3OLMD 4GDKB 1AARA 4ZRKA 2LVPA 3VTUA 3ONSA 3TL5A 2MW5A 3L08A 2ZPNA 4WJQA 3RCZA 3BY4B 1U4AA 3MJWA 3B0AA 5JZEB 3VTWA 3PLUA 1HE8A 2WX0A 1JRUA 3GZNI 4GOCA 4NNJB 2Z0DB 3V60A 3L54A 4MSMB 2G4SA 4ZRJA 2GOWA 3ALBA 3GOEA 4PYZA 1WE7A 2MCNB 2FIFA 2FCNA 3V62A 4X57B 3S2AA 2KANA 4W9DA 1SE9A 4BKGA 3R66C 2W9NA 3N30A 1GJZA 1TGZB 5AZGA 3LJ3A 3RYTA 3KW5B 4WJNA 2L76A 4P7IA 2KD0A 5CHFA 3JVZX 3DBHI 3APDA 2JRIB 4K1RB 1TBEA 2UYZB 1P3QU 3A9KB 2HJ8A 2ZCCA 2RPQA 3ZRCA 4MGYE 4DHZB 1WGGA 2LGDA 3IVFA 3T9LA 3RT3B 4IG7B 1KOTA 3A9JB 5LXHA 2KMCA 5DCNA 2HE7A 4KDLB 1MG8A 3ZW3A 2AEHA 3RULA 1GUAB 4IWQA 4WJOA 2K39A 2CHWA 3VH4B 5J18A 3VVWB 3RZWC 3RD2A 2PE6B 4W9FA 2RD0A 2PE9A 3M62B 3EECA 2LZ6A 4WQOB 2K6DB 3HM3A 3RUIB 1E8XA 4WAAA 2KTFA 1P0RA 3C0RB 5DPRA 1E8YA 1H4RA 1BT0A 1LQBA 1S3SG 2OOBB 2KQ7A 2NBUA 3VTVA 3OAWA 3H7PA 3IG3A 2LGYA 2BF8B 1WH3A 3PPAA 1PQSA 3UIOB 4ANXA 3PVLA 5IAAC 4DBGA 1WGRA 3A1QB 3QQ8B 4EUTA 2KNBA 2M4NA 3DBSA 3CMMB 2DYBA 4W9KA 4TUUA 2PEAA 1S1QB 4ANUA 4EEWA 1LFDA 2BWES 5D2MB 4NJ7A 4ZDVA 3KUCB 3JYUA 3KYCD 3JW0X 4MEMA 4EZJA 3JSVA 1WX7A 3CSTA 4K7WA 1Z5SB 5JH5C 2LASA 3X23A 4KSLC 3VHTC 2R2QA 3PS6A 2EMTA 2BGFA 1QZEA 1V9JA 2LXAA 4HK2A 4HWIB 4M0WB 3B1LX 2IY1B 4IM2A 1WXMA 2FAZA 4DDID 1GG3A 2QHOA 2GBRA 2JZ3B 4ASWC 3HK0A 1E7VA 4BKSA 3ZDMC 3ZIMA 1WRDB 2AL3A 2CS4A 2IO1B 3DVGX 4G0NB 4E74A 4KZCA 2L0FA 3PHWB 1V5OA 1P9DU 2DENB 2KDIA 1WJ4A 3T8MA 2BKFA 2CR5A 1WJNA 3PSEB 4NY0A 2IYDB 2IO2B 3KUDB 5LLIA 5DPSA 3ZLZA 3DOWA 4W9CA 1E8WA 4CO7A 2WWZA 2L0TA 2ZEQA 3UIPB 2GBKA 3I3TB 4RM9A 2DX5B 1Z2MA 2KFKB 2MSED 1YX6B 4PYUA 5E6PA 3WALA 3WA0A 4FJVB 3UGBB 3OJ3A 4I6PA 3ZNZB 2GMIC 3DVNV 1WJUA 3DPDA 2KVRA 3M63B 1WM3A 3W1SC 1KLVA 3H6NA 1TTNA 1F9JA 4GDKA 4BVUC 1NBFC 1GNUA 2MBQA 3N3KB 3DDCB 1WY8A 2C7NB 2C5LC 2VRRB 4DK5A 1OTRB 1WZ0A 2D10A 3K9PB 4RMAA 3U8ZA 1SIFA 2NS5A 1OEYJ 4XC2A 2D2QA 2MLBA 2LWPA 5C23A 2G4DB 2LUEA 4ICVA 4HDOA 3OJ4B 2WX1A 4HCPB 4NAWA 3TIXA 3EHVA 1EUVB 3A9KA 3SHQA 4BBNC 1WXVA 4F1SA 3JSVB 4I6NB 5E6OA 2JY6A 4HPMB 2NVUI 1WJ6A 1UD7A 3SDLC 2MBHA 2RGFA 4II2B 2JXXA 2CHXA 2BYEA 5D6JB 2NR2A 1VCBA 2A5UA 2L00B 2MX2A 3HM6X 4EOYA 4J6IA 1ZW7A 2KJHB 3A1QA 2LVOA 2KX0A 2KKCA 3WAMA 3ZTCA 3H7PB 3R7QA 3A33B 2KJ6A 3KH0A 4JQWC 2JF5A 5IA7A 1E8ZA 2N9XA 4ICUA 3DQVA 3A4RA 3MTNB 3PLVA 3ZUNA 2LD9A 3N32A 1WR1A 4XX5A 4AOFA 2KLGA 2ZPYA 1WFYA 1V49A 4LJPB 2EKEC 3L16A 3CSFA 1OQYA 2GBMA 3NHEB 4I6LB 4N9F4 4HVBA 4NPNA 2LJ5A 3AU4A 3IBEA 4IUMB 3ZNHB 1L7YA 3A9JA 2K8HA 4JL9A 3PRZA 1WXAA 2I1KA 3UF8A 4GDLA 4KSKC 1EF1A 2N4FA 2GBNA 2K25A 3V61A 3PRPB 4IM3A 4W9JA 1WMHB 1G6JA 4MGZE 2BYFA 3DCGA 3HHMA 4GXBA 4DXAB 3QWZB 4MDKE 2Y5BB 1UGMA 2N9PC 4AUQC 1GC7A 3NS8A 2KK8A 5KHOA 4G50A 4WWPA 2IZVB 2HTHA 2J0KA 4M8MA 4KZ0A 2V1YA 1T0YA 4KIKB 5DPWA 1V6EA 1ZGUB 1YX5B 3L17A 1Q1OA 4PS8A 5HKHA 3BINA 2RR9A 3VDZA 1RLFA 3ZTDA 2KJRA 3ZO5B 2KXJA 3ML9A 4TQ0A 1V86A 1FXTB 1WE6A 1LM8B 2ZCBA 2XBBC 4BFRA 4XZ4A 3PZDA 1NI2A 4MELA 4FADA 4G11A 3M95A 4GU2A 3R3MA 4B6WA 2D11A 1TZ1A 2NPTB 3IFWB 2KO3A 3KVFB 4FLHA 2ZNVC 4A3OA 3QC8B 2D3GA 4IWPA 2BKRB 1Q0WB 1I35A 2L3ZA 4W9EA 4LCDE 2B3AA 2K8CA 1YQBA 4ANWA 1VD2A 2JRHA 2I1JA 3TJPA 5DPTA 5EDSA 2KN5A 2N1WA 4DWFA 4GSWA 4OVUA 4W9LA 5FR6A 2Z59B 4JGHB 4DHJB 1V81A 2LXCA 3MHSD 4KDIC 4DHJD 2FUHB 4DHZE 2O6VB 1ISNA 4CHKA 2L7RA 4FBJB 3ML8A 4HXDA 3CF6E 5J2RA 3DVNU 2MP2B 3APCA 2KWCA 2FCMA 1J19A 4LDTD 2NBWB 1WGHA 2IO3B 4IW0A 4MJSA 4AJWA 3P2BA 1Q5WB 5AEKB 1UBQA 1WZ3A 3QIJA 3QK0A 2BPSA 2FCQA 2PJHA 4DDGD 2CKHB 4K81A 2ZVOA 3QHTA 3WANA 4EFOA 1H8CA 4KV2A 3VUYA 4IM0A 4HCNB 1K8RB 4W9HA 2JVCA 4IWOA 2AYOB 3VUWA 1C3TA 2BYVE 4GN1A 3APFA 3VAWA 2CHZA 2KDFB 2ZZPB 2XK5B 2DZJA 3UINB 2KDBA 2REXA 2O6VA 3RZFA 2KQSA 3ZRFA 3H1UA 1KJTA 3EC8A 3PV1A 4FJZA 3AU5A 2LGXA 2O2VA 2O2VB 4BBNF 3NZUA 1WM2A 2C9WB 3A4SC 2KDEB 4GGQA 2J0MA 1R4MI 5BO4B 2MBOA 3X0WA 1IPGA 1YIWA 4MGKE 2MA9B 3W1SA 2AWTA 5E6NA 3ZVVA 2YLMA 1I42A 2N1VA 3QJZA 1IYFA 3TCAA 2C7HA 3W1YA 3PRMB 2K6QA 3ZNGC 4EKUA 3B08A 2V3SA 4AWJA 4WJPA 4RM8A 1RAXA 2WDTB 2MRPA 5JHBA 4ANVA 3VXWA 1RRBA 4BOSC 1V80A 2KTRA 1E90A 1WGYA 2KFJA 3WAPA 2KWUB 4URKA 4FULA 2DAJA 1OGWA 2DZKA 2DHZA 2YVCA 2IO0B 3SD5A 2DZIA 4JIOU 1A5RA 2WYQA 2CU1A 3DBLI 4FN2A 2K8BA 3U7DA 3R7RA 4NQKE 2K1FA 3O65B 3AXCA 1EF5A 2FNJB 3QA8A 3M3JA 4JLCA 3VUXA 3H7SA 4BOZB 4W9IA 4NJ6A 2J0JA 4E71A 1L2NA 1C1YB 1WXSA 2ZVNA 3PGEA 2D07B 2PPHA 1SGHA 4TQ1A 5D7GA 5CTRC 1Y8RC 1WYWB 5C1ZA 3VFKA 4LJOB 5D94A 3ZNID 4B95A 3Q3FA 1UELA 2LVQA 2NPTA 4AJYB 1E7UA 3U30A 2KMAA 3KYDD 5GMVA 1WX9A 2N7EA 3L10B 2MQJA 4E3CA 4GMVA 1UH6A 2KZRA 5L83A 4WWOA 2J7QB 2DZMA 1YD8U 3PREA 3PHXB 4K7UA 4ZRIA 1WX8A 3V6CB 4ZYNA 3VH3B 4YL8A 2M0XA 2AL6A 2R2OA 3KUZA 2O6VD 2XK5A 3UQAA 2JPHA 2M17A 3D32A 3UQBA 1NDDA 4F8CB 1D3ZA 3QAQA 1OEYA 2C7MB 2A4ZA 2M1MA 3DVGY 4BKTA 1J0GA 2LI5A 3L13A 2KLCA 3NZSA 2KTRB 4HPLB 4K7SA 4FHJA 1V5TA 4A3PA 1RFAA 4FA6A 1E5WA 4MJSB 1WGDA 3QCAA 2BWFA 2FIDA 4HLEA
chains in the Genus database with same CATH superfamily
2FUG1 1LGRA 5J17A 3WIMA 2ZJDA 3Q3JA 1P1AA 1XXGA 2IPKD 3WAOA 4BKTA 2XEWA 2FCSA 2M8SA 3DBRI 1HXYD 3PTFC 4G3XB 2Y5CA 5AZHA 2C60A 1ZP0B 2KN4A 3P63A 4MGIE 2LGIA 3QX1A 4C4VA 1VDVA 2K5PA 2KX3A 3HIZA 1ZKHA 2JZZA 4EZLA 4TKNA 3P4SB 2NBVB 3QARA 1XLNA 2L52A 3KLSX 1ZUD2 1MHXA 2N7DA 2V0GA 1X1MA 2KOXA 1JROA 2NMQA 1VJKA 2KHWB 3ECIA 3H9DA 4HDQA 4YT0B 2G3QB 4ZHOA 5JHAA 4WWNA 5CX3A 3VQIA 2BQQA 2KFKA 4LNOA 1YJ1A 2ZW0A 1EU4A 1EO6A 1IP9A 3PT2B 2L8JA 2LRUA 4KIKA 1UF0A 2LRWA 1WWTA 3EFUA 5AZFA 3EFCA 4M8NA 4TV3A 1SSNA 4AP4C 1M94A 4GB9A 3B2FA 2RSUA 3P4PB 2DBYA 1XCQL 4HROA 1AYFA 4A6QA 1L6VA 2ZPNA 3BY4B 2J53A 4RH6A 2QIEB 3B0AA 4FXCA 5JZEB 4GOCA 3SR6A 1YN5A 2N0SB 4MSMB 2GOWA 4OHJA 1MI0A 2FIFA 5IKCM 4OZAA 1K51A 1NVID 3R66C 1J7CA 3VR8B 5D3IB 3R2IA 3LJ3A 3KW5B 3BYYB 3FILB 4S17A 5CHFA 3JVZX 2JRIB 2HJ8A 2JYEA 4OVZA 3IVFA 4IG7B 1KOTA 3ZJVA 3ZW3A 4YXDB 2HJ1A 4W9FA 2FE8A 3M62B 3R8BA 4WQOB 2K6DB 3HM3A 3KQ4A 3MHZA 5DPRA 3VTVA 3OAWA 3BK1A 2KMMA 3UIOB 3A1QB 3KWLA 3QQ8B 2KNBA 2M4NA 1AN8A 3CMMB 4TUUA 3ETRA 1S1QB 4ANUA 3LYYA 4EEWA 4NZLB 4NJ7A 5FK9C 3KYCD 3JW0X 1WX7A 4TSSA 4K7WA 3VHTC 1QZEA 2VH2A 1I4PA 2WGSA 5EE0A 1D5MC 4DDID 1F1HA 3U7ZA 2QHOA 2WXGA 3RN9C 2K0PA 4M0WA 3ZDMC 1WRDB 2CS4A 1MHHE 1N5WA 2DENB 1HZ6A 3T8MA 3AE3B 2MJDA 3KUDB 3ZLZA 1E8WA 3MP9A 1UWMA 1KH0A 1I4GA 3NVVA 3I3TB 3Q3MC 3AV8A 1UWXA 2JXTA 2RDGA 2LMCA 2IJ0A 3V3XA 3H6NA 4C7YA 2VRRB 2JSVX 1PUTA 1ACCA 3K9PB 2WDVB 2NS5A 2W54A 2MLBA 2PTLA 3OJ4B 4HCPB 4NAWA 3TIXA 3N1YC 1OQRA 4F1SA 3SDLC 4II2B 2CHXA 1R4MB 2NR2A 1VCBA 2MX2A 3HM6X 4EOYA 4J6IA 5GXGB 2KJHB 2LVOA 1SXTA 2KJ6A 3KH0A 2GB1A 2N9XA 1TZOA 2QJLA 3PLVA 3AE2B 1WFYA 3CSFA 3NVZA 1OQYA 3NHEB 4I6LB 4N9F4 2D3BA 1SF0A 4P1BC 1QQRA 4RGOS 2GBNA 3V61A 2JYTA 4IM3A 2BYFA 3BVMA 4C7ZA 5H8YE 1ZE3D 2RPVA 1GC7A 1R4NB 2KK8A 5KHOA 4L2YA 4C80A 2Y5PA 3RI7C 4KGTA 5AUIA 2HTHA 2V1YA 3OWEB 1F77A 1SEBD 1YMHE 3LXFA 4P1CC 1ZGUB 3BINA 2X8XX 2KJRA 3DWGC 3ML9A 4O1NA 2WLBA 4M00A 1V86A 4WH4A 1LM8B 4ARCA 3Q14C 5FKAC 3ZJTA 5HI1A 2D11A 1HTQA 2KO3A 1EM7A 3B2GA 2D3GA 4IWPA 2BKRB 4DQOC 1I35A 4A90A 1UNSA 3Q3OC 2KN5A 2N1WA 1RFKA 1L4DB 2HDEA 4KDIC 2FUHB 3AE5B 1HZ5A 3IAM1 2L1AA 2RDBC 4FBJB 1PGAA 3CF6E 2KWCA 2IO3B 4MJSA 2RDHA 1UBQA 2WHIA 2ACZB 3WANA 4KV2A 1HTOA 1I4RA 4IWOA 2AYOB 1L0VB 4RGNA 1RM6C 2BYVE 2ZZPB 2DZJA 2E3TA 3PO0A 3UINB 2REXA 2ONQA 2J42A 3P4QB 4FJZA 2O2VA 2O2VB 4BBNF 4WURA 1WM2A 3GB1A 2KDEB 2DLBA 4OZCA 5BO4B 2MBOA 1IPGA 1AWDA 2XNAC 4LNKA 2YLMA 1MJDA 1IYFA 3U52E 3TCAA 1FNVA 3W1YA 3PRMB 2K6QA 3B08A 4A55A 4US9A 3Q6BA 2DNFA 1F2RC 1V1PA 2DHZA 4JIOU 4LNNA 4FN2A 1DGJA 5IP4D 3O65B 4MT5A 2FNJB 4L23A 4W9IA 2KWDA 4NJ6A 4E71A 3NUHB 3AE9B 2D07B 5D7GA 5CTRC 1WYWB 3VFKA 3Q3FA 3U4EG 4AJYB 3U30A 3DBHB 2MQJA 1MG4A 2X38A 2DZMA 3SFDB 1YD8U 3V6CB 1WX8A 4YL8A 2M0XA 3KUZA 2O6VD 2XK5A 3FKYA 3UQBA 3D32A 1NDDA 4F8CB 3N20C 1OEYA 2M1MA 3DVGY 2KLCA 1YQ4B 4FHJA 2W55A 4A3PA 2WP9B 3L4PA 5IOIA 1E9MA 1E5WA 2MP2A 3I9V1 1F2RI 2EMSA 2DYOA 3NY5A 4MM3A 1SB3C 1TKGA 4CYEA 1IGDA 1TKEA 3LDZE 1HA5A 2L05A 2UWQA 1ZXIA 4RF0A 3AULA 1FRDA 4B9KA 4FJYA 2ASQA 4S0RA 5TR5A 2Z0EB 4PS3A 1WIAA 3FAHA 2WXLA 4YTPB 3IHPC 3V6EB 4EZKA 2PW9A 2OJWA 1XD3B 4NQLB 3FC4A 2MWSB 4F7ZA 2DAFA 4GIVA 2INDC 2JUOA 5L95C 4BAXA 2JT4B 4OZBA 3TMPB 4FHKA 5EE3A 1QT9A 3ENEA 2UU7A 3AE6B 3N1XC 2LVPA 3VTUA 3ONSA 2MW5A 4WJQA 3RCZA 3MJWA 2W3SA 4HKZE 3PLUA 1K53A 2BTEA 1JWBD 4B0EA 1NYRA 3O13A 4HRSA 3V60A 3RNAC 3GOEA 3T3NA 2FCNA 3V62A 2H89B 4W9DA 2MJ3A 2W9NA 3PZ8A 2INPE 1GJZA 5AZGA 3RYTA 3R2TA 4WJNA 4ZYSA 2JX5A 5HFYA 3APDA 4WAFA 1TBEA 2UYZB 1P3QU 4USAA 3DHIC 3T9LA 3RT3B 1TY0A 1JWAD 4YWGG 1YNTE 1FM0D 2K39A 3Q8CA 4BZAA 3VVWB 3RZWC 3RD2A 2RD0A 3H8HA 1ZOYB 4PK1A 4N59A 1TS5A 2B76B 1E8YA 1BT0A 1PDXA 4W9KA 1BUIC 2BYTA 5D2MB 1TS3A 3GS2A 3JSVA 2LFIA 1DOIA 1C76A 5AUKA 4A9AA 3AECB 2WXQA 3CSTA 2R2QA 3PS6A 2H88B 4YSXB 2BGFA 1V9JA 2RMMA 1PFDA 1CQVA 1I4HA 2IY1B 4IM2A 4JE3B 1JWSD 4RF1A 1J7AA 2JZ3B 3DVGX 2IO1B 3DWMA 4KZCA 1TKYA 2L0FA 1P9DU 3EA6A 2KDIA 2J4XA 4NY0A 1KRHA 3DOWA 4W9CA 1D6EC 1Z2MA 4PYUA 3WALA 3WA0A 4HEA1 2KACA 3Q3NC 3P42A 2M19A 4ITKA 1MFWA 1FNWA 1ET9A 3M63B 3W1SC 1KLVA 1F9JA 4BVUC 3N3KB 2C5LC 4Q2JA 1T0SC 3AB5A 1OTRB 1WZ0A 3U8ZA 1WGKA 2LGSA 1JMLA 2G4DB 2LUEA 4ICVA 1HEZE 3N1ZC 3A9KA 5HG2A 4MM3B 4BBNC 2WXIA 3JSVB 4I6NB 3RNBC 1L0YB 1UD7A 2RGFA 1KLUD 2L00B 4H2AA 4CQNA 1ZW7A 4WQMA 2KKCA 3WAMA 2D3CA 3ZTCA 3A33B 2PIAA 2JF5A 3GP7A 1E8ZA 3DQVA 3MTNB 1FIQA 1NENB 3N32A 1WR1A 4AOFA 2KLGA 2QMTA 3TSSA 2EKEC 3L16A 2GBMA 3BIID 5BYRA 4NPNA 3IBEA 4IUMB 3ZNHB 4JL9A 2BVCA 2NTTA 1EF1A 3PRPB 1WMHB 1HQRD 1V8CA 3W5VB 1G6JA 3HHMA 4GXBA 4DXAB 4AUQC 3NS8A 1IGCA 2CJOA 4WWPA 2IZVB 4P6VF 1TJEA 3OG5A 4PS8A 1RLFA 3AEGB 1TIFA 2N9KA 1FXTB 2XBBC 4ZOHC 3M95A 3R3MA 3IFWB 1TZ1A 3TUOA 4JX1C 3NG0A 4W9EA 1FXIA 1WYGA 4IDIA 1V81A 1E0ZA 1B9RA 1YOVB 4CHKA 4JPSA 2WU5B 5J2RA 3DVNU 2WXFA 4IW0A 2BB5A 5AEKB 2BPSA 4DDGD 4ZHPA 2CKHB 2IGHA 4K81A 2ZVOA 2V4IB 3VUYA 4IM0A 3AE1B 1K8RB 3I5JC 2JVCA 2M56B 2LUMA 3VUWA 5TSSA 3VAWA 3APFA 1K52A 2D3AA 3Q8EA 3AU5A 2LGXA 3MJ5A 4MH8A 4HPPA 1C4CA 2J0MA 3AH7A 1YIWA 4LNIA 2MA9B 3W1SA 4C00A 4EKUA 1FO4A 2V3SA 4WJPA 3AE7B 2JU6X 4RM8A 2WDTB 3NVWA 1V80A 1E90A 1RYJA 2KFJA 1NI3A 2DZKA 4XDCA 1XLQA 2IO0B 2CU1A 1QF6A 4NQKE 2K1FA 3MC8A 3QA8A 3M3JA 4M01A 3H7SA 1L2NA 4RNAA 2ON8A 1WXSA 1YJJA 2ZVNA 3ZNID 1ZDVA 1UELA 2NPTA 1T0RC 2INNE 3TEWA 3L10B 5L83A 1UH6A 3U2SC 3PREA 4ZRIA 3VH3B 4XGAB 4ZYNA 2IGDA 3ZGZA 3AEEB 3UQAA 3QAQA 1V1PB 2C7MB 2A4ZA 2BS2B 1J0GA 1WRIA 4HPLB 4XWWA 1V5TA 2AQ2B 1SE4A 1SJED 3VR9B 1TY2A 3IAS1 2VZKB 1QOGA 4R3DA 4FA6A 3KWVA 2FIDA 1QKZA 3GE3C 1R7SA 2ZNVB 1FEHA 1E10A 1UZXB 3RNFC 4GDLB 1GB4A 2W3RA 4NAWB 2GBJA 1P98A 2YEPF 4ARIA 5KHQA 1FFVA 4IC7B 5BYSA 3K9OB 3SU8X 2WS3B 1XQQA 1JW9D 2DYMA 2IY0B 4MH0E 2KC1A 4MACA 1SE3A 3N9YC 1CMXB 2G45B 1WI0A 1FCLA 3NJTA 1V2YA 4BKSD 1WF9A 5LXIB 1N5XA 5C3JB 1PGXA 3AI5A 3C8YA 1ESFA 4W9GA 5G2NA 2QILA 5JXVA 1UGJA 5CHWA 1WXQA 1XCTL 3HRDD 3BYTB 2V4LA 4LDTB 1GB1A 3TEYA 1UBIA 4B0MA 3NOBA 2LJIA 4HJKA 5E6JA 1WMHA 1T0QC 3OLMD 4XE0A 5MPOA 4GDKB 4ZRKA 5H92C 1FD6A 2I38A 5T8IA 3TL5A 3NRZA 1IBXA 1ROEA 3MC0B 2MEKA 3VTWA 4NNJB 1C4PA 1FMAD 4D2KA 4ZRJA 3ALBA 4IOIE 2MCNB 3RNEC 4X57B 4AS1A 3S2AA 2KANA 4BKGA 4KGSA 4TMAB 2L76A 2BS4B 2KD0A 3DBHI 3A9KB 1DYQA 2ZCCA 2RPQA 1YQ3B 1N62A 2KMCA 2HE7A 4KDLB 3RULA 1GUAB 2AX5A 2PE6B 3FILA 3BVZA 2Y3AA 1E8XA 4WAAA 2QCZA 1P0RA 3C0RB 1S3SG 2KQ7A 3I57A 3IG3A 4HKQA 4ANXA 3PPAA 1PQSA 3PVLA 5IAAC 4DBGA 1WGRA 3W5UB 4EUTA 4L1BA 3DBSA 2DYBA 4US8A 2PEAA 2AQ1B 4ZDVA 4YTNB 3KUCB 3JYUA 4MEMA 4EZJA 1Q10A 3IXSA 1Z5SB 2LASA 3X23A 4KSLC 3NS1A 2AQ3B 3AN1A 2EMTA 2KQ4X 2W82A 2NTSA 4HWIB 3B1LX 1J7BA 2TSSA 2FAZA 2K9XA 1QILA 1KTKA 4ACFA 2GBRA 4ASWC 3HK0A 4BKSA 3ZIMA 2AL3A 4E74A 1PYWD 3AEDB 3P1MA 1V5OA 2JQRB 1VZ6A 2BKFA 1YJIA 1WJNA 3PSEB 1L4ZB 2IO2B 1L0XB 4CO7A 5DPSA 2WWZA 1K50A 3UIPB 4RM9A 2PVOD 2KFKB 1YX6B 5E6PA 2ZW1A 3MC9A 3UGBB 2V3NA 3OJ3A 4I6PA 3ZNZB 1C78A 3HVDA 4ZRQA 3DPDA 1WM3A 2CJNA 1TTNA 1NBFC 3NVYA 2WDQB 1BMLC 1WY8A 2C7NB 3DDCB 2IGGA 1C4AA 3GE8C 1SIFA 4XC2A 2D2QA 2LWPA 1FXAA 5C23A 3DHGC 3ZJUA 2WX1A 3EHVA 3SHQA 1WXVA 1RWSA 5E6OA 4HPMB 2NVUI 2VH1A 2BYEA 1KLGD 2A5UA 2I2YA 1IUEA 1BXTA 1QOFA 2K3UA 3A1QA 1VZ8A 2KX0A 4K3BA 2N7JA 1JRPA 1B1ZA 1MPEA 3R7QA 1ENFA 4RCOA 3A4RA 3ZUNA 2LHDA 2ZPYA 2G1EA 4HVBA 1L7YA 3AEFB 2K8HA 3PRZA 5I4DA 2I1KA 3HUIA 2KVZA 5FR3A 4KSKC 2K25A 4W9JA 3AE8B 2KYWA 2BT6A 3DCGA 3QWZB 3P4RB 1OFFA 2Y5BB 1UGMA 2N9PC 4JWSC 3ABVB 1AW7A 1N6ZA 4LK0M 1UUPA 3Q69A 4KZ0A 1T0YA 1V6EA 4WIPA 1YX5B 5HKHA 2RR9A 3VDZA 1T6BX 3TEXA 3ZO5B 1VR9A 4C56C 5IN7A 4WWMA 1XO3A 5D3DA 4XZ4A 3PZDA 4G11A 3UI3A 4GU2A 3KVFB 4XDDA 2ZNVC 3QC8B 1Q0WB 4LCDE 4KGRA 2K8CA 3TEZA 2JRHA 2OEDA 2WXJA 2I1JA 2WU2B 3TJPA 5EDSA 1CZPA 2MJEA 4OVUA 4W9LA 3RNCC 4DHJB 2EELA 3MFGA 2LXCA 3MHSD 4DHZE 1ZDXA 2O6VB 1ISNA 2L7RA 2N9LA 1ZXHA 2MP2B 3APCA 3CIRB 2FCMA 4K3CA 3VRBB 3P2BA 1WZ3A 2FCQA 3QHTA 1H8CA 3T3OA 5BMGA 4W9HA 2KDFB 2XK5B 3RZFA 3AEBB 2Q5WD 3ZRFA 3H1UA 1ZPSA 4RGMA 3NZUA 4GGQA 1E6EB 2YEPB 1R4MI 3X0WA 4MGKE 2AWTA 4YSZB 4HJGE 3V05A 3ZNGC 4RGTA 4AWJA 3VRAB 1RRBA 3W9CB 2KTRA 3WAPA 1QLBB 4URKA 2DAJA 1OGWA 1FPYA 2KT7A 3SFEB 2WXKA 3DBLI 1JALA 2QEJC 1DOYA 2K22A 1MVKA 4JLCA 4BOZB 2J0JA 1CJEA 4A8XC 1SGHA 4TQ1A 1NYQA 1OQQA 1Y8RC 1CK1A 4LJOB 5D94A 1E7UA 3KYDD 2N7EA 4E3CA 2KZRA 4IKGA 3PHXB 5EE1A 2AL6A 4OW0A 1ET6A 2GRIA 2ICIA 2JWUA 2INCC 3ZXRA 2E6XA 1JWUD 2DWQA 4MJSB 1WGDA 2BWFA 2OJRA 1LXDA 2FBWB 2HTME 3Q8BA 4II3B 2CU3A 1WSPA 4PS7A 3ZKJC 4MSQB 3ZQ4A 3NZ3A 3L0WB 3RMKC 1XF5L 1N61A 1XEEA 2JWZA 4ZRPA 2GI9A 1I4XA 2MBBB 3ZDTA 3BVGA 1WR6E 1A70A 1T3QA 2HD5B 5CHVC 1KM7A 2IBIB 1R4NI 2KWVB 2G9HD 4LLGM 2L83A 2OHFA 1GPXA 5C2TB 4A20A 2N9EB 3DHHC 3BWUD 1N63A 2KC2A 4OVVA 2NCNA 1TS2A 2XN9C 3AEAB 3Q8AA 5G55A 1SE2A 3TBLD 1JQ4A 4KVGB 1XT9B 2MBEA 1GC6A 3IT6B 2VZKD 2PVGC 1AARA 5IO9A 3L08A 2WXMA 1U4AA 2BW2A 1E7PB 1EWYC 1HE8A 2WX0A 4KKIA 1JRUA 3GZNI 1TS4A 1FFUA 2Z0DB 2BB6A 3E9SA 3L54A 2G4SA 4PYZA 1WE7A 1I4QA 1SE9A 4REZA 1F52A 3N30A 1TGZB 3BK2A 5LNK1 2WDRB 4P7IA 2QDFA 4K1RB 1DOXA 3ZRCA 4MGYE 4DHZB 1WGGA 2LGDA 3A9JB 2Z8LA 5LXHA 5DCNA 1MG8A 2SEBD 2AEHA 2WXNA 4IWQA 4WJOA 2CHWA 3VH4B 5J18A 1GOZA 2PE9A 3EECA 2LZ6A 2PMVA 3RUIB 2KTFA 5BMHA 1H4RA 2OOBB 1LQBA 2NBUA 3H7PA 1TT5B 2MH7A 2LGYA 2BF8B 1WH3A 1J8CA 1PGBA 1SIJA 3Q8FA 1LFDA 2BWES 3DBRB 1QOBA 2M0AA 1L6UA 3DBLB 5JH5C 3LB8C 2BS3B 4HK2A 2LXAA 4M0WB 1XLPA 1P7FA 1WXMA 1GG3A 3BZDB 4NJCA 1D4BA 1E7VA 4G0NB 1YN4A 3PHWB 4YTMB 2J52A 2L32A 1WJ4A 2CR5A 3RPFC 2IYDB 5LLIA 5HHDG 2MHJA 2L0TA 2ZEQA 2GBKA 4P16A 5G5HA 2DX5B 2MSED 4QAYA 4FJVB 4RFBA 4M02A 2GMIC 3DVNV 1WJUA 1IBXB 4XWTA 2KVRA 1C77A 4GDKA 1GNUA 2MBQA 1KF6B 2WQYB 4DK5A 3Q2AC 2D10A 4RMAA 3URYA 1V1OA 1OEYJ 5G5GA 4HDOA 1EUVB 1SJHD 2WXPA 1P7EA 2JY6A 1WJ6A 2MBHA 2JXXA 3E56A 5D6JB 1SBBB 3ZYYX 3SEBA 3H7PB 4JQWC 5IA7A 4LNFA 4DXFA 4ICUA 4JWUC 2LD9A 4EE2A 3IT4B 4XX5A 1V49A 4LJPB 2WXRA 2KDMA 2LJ5A 3AU4A 3A9JA 1JWMD 1VZ7A 2R61A 1WXAA 1JCKB 3UF8A 1F0ZA 4GDLA 2N4FA 3HVZA 4MGZE 2WXOA 4MDKE 4KX6B 1M4VA 3B9JA 5BYQA 2GLSA 4G50A 2J0KA 4M8MA 4KIKB 5DPWA 3RNGC 3L17A 1Q1OA 1KFYB 3ZTDA 2V9HA 1YN3A 2KXJA 3C19A 4KKJA 4TQ0A 1WE6A 2ZCBA 4UDUC 4BFRA 1NI2A 4MELA 4FADA 1T5XD 1Y56A 2D5GA 4B6WA 4DXGA 2NPTB 4FLHA 4A3OA 5BMIA 2PLPA 4AQ7A 1NEKB 2L3ZA 2B3AA 1YQBA 4ANWA 1VD2A 2QSDA 5DPTA 4DWFA 4C4VB 2PKOA 4GSWA 5FR6A 2Z59B 4JGHB 3EGRA 4DHJD 1XLOA 3WCQA 3ML8A 2IDYA 4HXDA 1J19A 4LDTD 2NBWB 1WGHA 3AE4B 3W2DA 1C79A 4AJWA 4NAMA 1Q5WB 3QIJA 1VLBA 3QK0A 2PJHA 4EFOA 1EU3A 1C9FA 4HCNB 1L5PA 1QOAA 1C3TA 4GN1A 2CHZA 2KAJA 2KDBA 2SAKA 2O6VA 2KQSA 3CWIA 1KJTA 3EC8A 3PV1A 1FRRA 3A4SC 2C9WB 4N6EB 1D5ZC 5E6NA 2LHEA 3ZVVA 1I42A 2N1VA 3QJZA 2C7HA 2LEKA 2QC8A 4XYCA 5EE9A 1RAXA 2MRPA 5JHBA 4ANVA 3VXWA 4YSYB 4BOSC 3AM9A 1WGYA 2KWUB 3GZNB 1EWCA 1N60A 3I63C 4FULA 2V3PA 2YVCA 3SD5A 2DZIA 1GAQB 1A5RA 2WYQA 2K8BA 1FCCC 2EKIA 3U7DA 3AMZA 3R7RA 1VRAB 3AXCA 1EF5A 3VUXA 2WXHA 3ZXVA 1C1YB 4LTUA 3PGEA 2PPHA 5C1ZA 3RFZB 4B95A 2WNMA 4N58A 2LVQA 1TYGB 2KMAA 5GMVA 1WX9A 4GMVA 4WWOA 2J7QB 4K7UA 2BBCA 2R2OA 1LO5D 2JPHA 2M17A 1D3ZA 3PZ7A 2LI5A 3L13A 3NZSA 1D5XC 2KTRB 4K7SA 2JZPA 4PT5A 3J9CA 1I7HA 3EUB2 1V97A 4GLSC 1STEA 1RFAA 1FNUA 3QCAA 4J3OD 4HLEA
chains in the Genus database with same CATH topology
2MP2A 2OJRA 1LXDA 5J17A 2EMSA 1J8CA 3WIMA 2ZJDA 2ZNVB 3Q3JA 1UZXB 1P1AA 4GDLB 3WAOA 2DYOA 2XEWA 4II3B 2FCSA 2M8SA 3NY5A 4PS7A 3DBRI 3PTFC 4G3XB 4MM3A 3ZKJC 5AZHA 4MSQB 4NAWB 2C60A 2GBJA 4MGIE 1P98A 4CYEA 3L0WB 3QX1A 3LDZE 5KHQA 2JWZA 4IC7B 2KX3A 3HIZA 2L05A 3K9OB 3SU8X 1ZKHA 2JZZA 2UWQA 2MBBB 1XQQA 2DYMA 4TKNA 3ZDTA 4EZLA 2NBVB 3QARA 2IY0B 4MH0E 2KC1A 3AULA 1WR6E 4B9KA 4FJYA 2ASQA 1CMXB 2G45B 2HD5B 1WI0A 1V2YA 5CHVC 4BKSD 2N7DA 1WF9A 1KM7A 1X1MA 2IBIB 2KOXA 5TR5A 3AI5A 5LXIB 2Z0EB 2KHWB 3ECIA 3H9DA 4PS3A 1R4NI 4HDQA 2G3QB 1WIAA 4W9GA 5JHAA 4WWNA 2KWVB 5CX3A 3VQIA 5G2NA 3IHPC 3V6EB 2KFKA 4A20A 2N9EB 4EZKA 1YJ1A 1IP9A 1EO6A 1XD3B 2L8JA 3PT2B 4NQLB 5CHWA 2LRUA 2KC2A 2MWSB 4KIKA 4OVVA 4F7ZA 2NCNA 2DAFA 4GIVA 2LRWA 2V4LA 3EFUA 4LDTB 5AZFA 5G55A 2JUOA 3TBLD 5L95C 1UBIA 2JT4B 3NOBA 4KVGB 4M8NA 4TV3A 1XT9B 4HJKA 2MBEA 3TMPB 4AP4C 4FHKA 1M94A 4GB9A 1GC6A 1WMHA 2RSUA 3ENEA 3OLMD 4GDKB 1AARA 4ZRKA 2LVPA 3VTUA 3ONSA 3TL5A 2MW5A 3L08A 2ZPNA 4WJQA 3RCZA 3BY4B 1U4AA 3MJWA 3B0AA 5JZEB 3VTWA 3PLUA 1HE8A 2WX0A 1JRUA 3GZNI 4GOCA 4NNJB 2Z0DB 3V60A 3L54A 4MSMB 2G4SA 4ZRJA 2GOWA 3ALBA 3GOEA 4PYZA 1WE7A 2MCNB 2FIFA 2FCNA 3V62A 4X57B 3S2AA 2KANA 4W9DA 1SE9A 4BKGA 3R66C 2W9NA 3N30A 1GJZA 1TGZB 5AZGA 3LJ3A 3RYTA 3KW5B 4WJNA 2L76A 4P7IA 2KD0A 5CHFA 3JVZX 3DBHI 3APDA 2JRIB 4K1RB 1TBEA 2UYZB 1P3QU 3A9KB 2HJ8A 2ZCCA 2RPQA 3ZRCA 4MGYE 4DHZB 1WGGA 2LGDA 3IVFA 3T9LA 3RT3B 4IG7B 1KOTA 3A9JB 5LXHA 2KMCA 5DCNA 2HE7A 4KDLB 1MG8A 3ZW3A 2AEHA 3RULA 1GUAB 4IWQA 4WJOA 2K39A 2CHWA 3VH4B 5J18A 3VVWB 3RZWC 3RD2A 2PE6B 4W9FA 2RD0A 2PE9A 3M62B 3EECA 2LZ6A 4WQOB 2K6DB 3HM3A 3RUIB 1E8XA 4WAAA 2KTFA 1P0RA 3C0RB 5DPRA 1E8YA 1H4RA 1BT0A 1LQBA 1S3SG 2OOBB 2KQ7A 2NBUA 3VTVA 3OAWA 3H7PA 3IG3A 2LGYA 2BF8B 1WH3A 3PPAA 1PQSA 3UIOB 4ANXA 3PVLA 5IAAC 4DBGA 1WGRA 3A1QB 3QQ8B 4EUTA 2KNBA 2M4NA 3DBSA 3CMMB 2DYBA 4W9KA 4TUUA 2PEAA 1S1QB 4ANUA 4EEWA 1LFDA 2BWES 5D2MB 4NJ7A 4ZDVA 3KUCB 3JYUA 3KYCD 3JW0X 4MEMA 4EZJA 3JSVA 1WX7A 3CSTA 4K7WA 1Z5SB 5JH5C 2LASA 3X23A 4KSLC 3VHTC 2R2QA 3PS6A 2EMTA 2BGFA 1QZEA 1V9JA 2LXAA 4HK2A 4HWIB 4M0WB 3B1LX 2IY1B 4IM2A 1WXMA 2FAZA 4DDID 1GG3A 2QHOA 2GBRA 2JZ3B 4ASWC 3HK0A 1E7VA 4BKSA 3ZDMC 3ZIMA 1WRDB 2AL3A 2CS4A 2IO1B 3DVGX 4G0NB 4E74A 4KZCA 2L0FA 3PHWB 1V5OA 1P9DU 2DENB 2KDIA 1WJ4A 3T8MA 2BKFA 2CR5A 1WJNA 3PSEB 4NY0A 2IYDB 2IO2B 3KUDB 5LLIA 5DPSA 3ZLZA 3DOWA 4W9CA 1E8WA 4CO7A 2WWZA 2L0TA 2ZEQA 3UIPB 2GBKA 3I3TB 4RM9A 2DX5B 1Z2MA 2KFKB 2MSED 1YX6B 4PYUA 5E6PA 3WALA 3WA0A 4FJVB 3UGBB 3OJ3A 4I6PA 3ZNZB 2GMIC 3DVNV 1WJUA 3DPDA 2KVRA 3M63B 1WM3A 3W1SC 1KLVA 3H6NA 1TTNA 1F9JA 4GDKA 4BVUC 1NBFC 1GNUA 2MBQA 3N3KB 3DDCB 1WY8A 2C7NB 2C5LC 2VRRB 4DK5A 1OTRB 1WZ0A 2D10A 3K9PB 4RMAA 3U8ZA 1SIFA 2NS5A 1OEYJ 4XC2A 2D2QA 2MLBA 2LWPA 5C23A 2G4DB 2LUEA 4ICVA 4HDOA 3OJ4B 2WX1A 4HCPB 4NAWA 3TIXA 3EHVA 1EUVB 3A9KA 3SHQA 4BBNC 1WXVA 4F1SA 3JSVB 4I6NB 5E6OA 2JY6A 4HPMB 2NVUI 1WJ6A 1UD7A 3SDLC 2MBHA 2RGFA 4II2B 2JXXA 2CHXA 2BYEA 5D6JB 2NR2A 1VCBA 2A5UA 2L00B 2MX2A 3HM6X 4EOYA 4J6IA 1ZW7A 2KJHB 3A1QA 2LVOA 2KX0A 2KKCA 3WAMA 3ZTCA 3H7PB 3R7QA 3A33B 2KJ6A 3KH0A 4JQWC 2JF5A 5IA7A 1E8ZA 2N9XA 4ICUA 3DQVA 3A4RA 3MTNB 3PLVA 3ZUNA 2LD9A 3N32A 1WR1A 4XX5A 4AOFA 2KLGA 2ZPYA 1WFYA 1V49A 4LJPB 2EKEC 3L16A 3CSFA 1OQYA 2GBMA 3NHEB 4I6LB 4N9F4 4HVBA 4NPNA 2LJ5A 3AU4A 3IBEA 4IUMB 3ZNHB 1L7YA 3A9JA 2K8HA 4JL9A 3PRZA 1WXAA 2I1KA 3UF8A 4GDLA 4KSKC 1EF1A 2N4FA 2GBNA 2K25A 3V61A 3PRPB 4IM3A 4W9JA 1WMHB 1G6JA 4MGZE 2BYFA 3DCGA 3HHMA 4GXBA 4DXAB 3QWZB 4MDKE 2Y5BB 1UGMA 2N9PC 4AUQC 1GC7A 3NS8A 2KK8A 5KHOA 4G50A 4WWPA 2IZVB 2HTHA 2J0KA 4M8MA 4KZ0A 2V1YA 1T0YA 4KIKB 5DPWA 1V6EA 1ZGUB 1YX5B 3L17A 1Q1OA 4PS8A 5HKHA 3BINA 2RR9A 3VDZA 1RLFA 3ZTDA 2KJRA 3ZO5B 2KXJA 3ML9A 4TQ0A 1V86A 1FXTB 1WE6A 1LM8B 2ZCBA 2XBBC 4BFRA 4XZ4A 3PZDA 1NI2A 4MELA 4FADA 4G11A 3M95A 4GU2A 3R3MA 4B6WA 2D11A 1TZ1A 2NPTB 3IFWB 2KO3A 3KVFB 4FLHA 2ZNVC 4A3OA 3QC8B 2D3GA 4IWPA 2BKRB 1Q0WB 1I35A 2L3ZA 4W9EA 4LCDE 2B3AA 2K8CA 1YQBA 4ANWA 1VD2A 2JRHA 2I1JA 3TJPA 5DPTA 5EDSA 2KN5A 2N1WA 4DWFA 4GSWA 4OVUA 4W9LA 5FR6A 2Z59B 4JGHB 4DHJB 1V81A 2LXCA 3MHSD 4KDIC 4DHJD 2FUHB 4DHZE 2O6VB 1ISNA 4CHKA 2L7RA 4FBJB 3ML8A 4HXDA 3CF6E 5J2RA 3DVNU 2MP2B 3APCA 2KWCA 2FCMA 1J19A 4LDTD 2NBWB 1WGHA 2IO3B 4IW0A 4MJSA 4AJWA 3P2BA 1Q5WB 5AEKB 1UBQA 1WZ3A 3QIJA 3QK0A 2BPSA 2FCQA 2PJHA 4DDGD 2CKHB 4K81A 2ZVOA 3QHTA 3WANA 4EFOA 1H8CA 4KV2A 3VUYA 4IM0A 4HCNB 1K8RB 4W9HA 2JVCA 4IWOA 2AYOB 3VUWA 1C3TA 2BYVE 4GN1A 3APFA 3VAWA 2CHZA 2KDFB 2ZZPB 2XK5B 2DZJA 3UINB 2KDBA 2REXA 2O6VA 3RZFA 2KQSA 3ZRFA 3H1UA 1KJTA 3EC8A 3PV1A 4FJZA 3AU5A 2LGXA 2O2VA 2O2VB 4BBNF 3NZUA 1WM2A 2C9WB 3A4SC 2KDEB 4GGQA 2J0MA 1R4MI 5BO4B 2MBOA 3X0WA 1IPGA 1YIWA 4MGKE 2MA9B 3W1SA 2AWTA 5E6NA 3ZVVA 2YLMA 1I42A 2N1VA 3QJZA 1IYFA 3TCAA 2C7HA 3W1YA 3PRMB 2K6QA 3ZNGC 4EKUA 3B08A 2V3SA 4AWJA 4WJPA 4RM8A 1RAXA 2WDTB 2MRPA 5JHBA 4ANVA 3VXWA 1RRBA 4BOSC 1V80A 2KTRA 1E90A 1WGYA 2KFJA 3WAPA 2KWUB 4URKA 4FULA 2DAJA 1OGWA 2DZKA 2DHZA 2YVCA 2IO0B 3SD5A 2DZIA 4JIOU 1A5RA 2WYQA 2CU1A 3DBLI 4FN2A 2K8BA 3U7DA 3R7RA 4NQKE 2K1FA 3O65B 3AXCA 1EF5A 2FNJB 3QA8A 3M3JA 4JLCA 3VUXA 3H7SA 4BOZB 4W9IA 4NJ6A 2J0JA 4E71A 1L2NA 1C1YB 1WXSA 2ZVNA 3PGEA 2D07B 2PPHA 1SGHA 4TQ1A 5D7GA 5CTRC 1Y8RC 1WYWB 5C1ZA 3VFKA 4LJOB 5D94A 3ZNID 4B95A 3Q3FA 1UELA 2LVQA 2NPTA 4AJYB 1E7UA 3U30A 2KMAA 3KYDD 5GMVA 1WX9A 2N7EA 3L10B 2MQJA 4E3CA 4GMVA 1UH6A 2KZRA 5L83A 4WWOA 2J7QB 2DZMA 1YD8U 3PREA 3PHXB 4K7UA 4ZRIA 1WX8A 3V6CB 4ZYNA 3VH3B 4YL8A 2M0XA 2AL6A 2R2OA 3KUZA 2O6VD 2XK5A 3UQAA 2JPHA 2M17A 3D32A 3UQBA 1NDDA 4F8CB 1D3ZA 3QAQA 1OEYA 2C7MB 2A4ZA 2M1MA 3DVGY 4BKTA 1J0GA 2LI5A 3L13A 2KLCA 3NZSA 2KTRB 4HPLB 4K7SA 4FHJA 1V5TA 4A3PA 1RFAA 4FA6A 1E5WA 4MJSB 1WGDA 3QCAA 2BWFA 2FIDA 4HLEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MP2 A;  2OJR A;  1LXD A;  5J17 A;  2EMS A;  1J8C A;  3WIM A;  2ZJD A;  2ZNV B;  3Q3J A;  1UZX B;  1P1A A;  4GDL B;  3WAO A;  2DYO A;  2XEW A;  4II3 B;  2FCS A;  2M8S A;  3NY5 A;  4PS7 A;  3DBR I;  3PTF C;  4G3X B;  4MM3 A;  3ZKJ C;  5AZH A;  4MSQ B;  4NAW B;  2C60 A;  2GBJ A;  4MGI E;  1P98 A;  4CYE A;  3L0W B;  3QX1 A;  3LDZ E;  5KHQ A;  2JWZ A;  4IC7 B;  2KX3 A;  3HIZ A;  2L05 A;  3K9O B;  3SU8 X;  1ZKH A;  2JZZ A;  2UWQ A;  2MBB B;  1XQQ A;  2DYM A;  4TKN A;  3ZDT A;  4EZL A;  2NBV B;  3QAR A;  2IY0 B;  4MH0 E;  2KC1 A;  3AUL A;  1WR6 E;  4B9K A;  4FJY A;  2ASQ A;  1CMX B;  2G45 B;  2HD5 B;  1WI0 A;  1V2Y A;  5CHV C;  4BKS D;  2N7D A;  1WF9 A;  1KM7 A;  1X1M A;  2IBI B;  2KOX A;  5TR5 A;  3AI5 A;  5LXI B;  2Z0E B;  2KHW B;  3ECI A;  3H9D A;  4PS3 A;  1R4N I;  4HDQ A;  2G3Q B;  1WIA A;  4W9G A;  5JHA A;  4WWN A;  2KWV B;  5CX3 A;  3VQI A;  5G2N A;  3IHP C;  3V6E B;  2KFK A;  4A20 A;  2N9E B;  4EZK A;  1YJ1 A;  1IP9 A;  1EO6 A;  1XD3 B;  2L8J A;  3PT2 B;  4NQL B;  5CHW A;  2LRU A;  2KC2 A;  2MWS B;  4KIK A;  4OVV A;  4F7Z A;  2NCN A;  2DAF A;  4GIV A;  2LRW A;  2V4L A;  3EFU A;  4LDT B;  5AZF A;  5G55 A;  2JUO A;  3TBL D;  5L95 C;  1UBI A;  2JT4 B;  3NOB A;  4KVG B;  4M8N A;  4TV3 A;  1XT9 B;  4HJK A;  2MBE A;  3TMP B;  4AP4 C;  4FHK A;  1M94 A;  4GB9 A;  1GC6 A;  1WMH A;  2RSU A;  3ENE A;  3OLM D;  4GDK B;  1AAR A;  4ZRK A;  2LVP A;  3VTU A;  3ONS A;  3TL5 A;  2MW5 A;  3L08 A;  2ZPN A;  4WJQ A;  3RCZ A;  3BY4 B;  1U4A A;  3MJW A;  3B0A A;  5JZE B;  3VTW A;  3PLU A;  1HE8 A;  2WX0 A;  1JRU A;  3GZN I;  4GOC A;  4NNJ B;  2Z0D B;  3V60 A;  3L54 A;  4MSM B;  2G4S A;  4ZRJ A;  2GOW A;  3ALB A;  3GOE A;  4PYZ A;  1WE7 A;  2MCN B;  2FIF A;  2FCN A;  3V62 A;  4X57 B;  3S2A A;  2KAN A;  4W9D A;  1SE9 A;  4BKG A;  3R66 C;  2W9N A;  3N30 A;  1GJZ A;  1TGZ B;  5AZG A;  3LJ3 A;  3RYT A;  3KW5 B;  4WJN A;  2L76 A;  4P7I A;  2KD0 A;  5CHF A;  3JVZ X;  3DBH I;  3APD A;  2JRI B;  4K1R B;  1TBE A;  2UYZ B;  1P3Q U;  3A9K B;  2HJ8 A;  2ZCC A;  2RPQ A;  3ZRC A;  4MGY E;  4DHZ B;  1WGG A;  2LGD A;  3IVF A;  3T9L A;  3RT3 B;  4IG7 B;  1KOT A;  3A9J B;  5LXH A;  2KMC A;  5DCN A;  2HE7 A;  4KDL B;  1MG8 A;  3ZW3 A;  2AEH A;  3RUL A;  1GUA B;  4IWQ A;  4WJO A;  2K39 A;  2CHW A;  3VH4 B;  5J18 A;  3VVW B;  3RZW C;  3RD2 A;  2PE6 B;  4W9F A;  2RD0 A;  2PE9 A;  3M62 B;  3EEC A;  2LZ6 A;  4WQO B;  2K6D B;  3HM3 A;  3RUI B;  1E8X A;  4WAA A;  2KTF A;  1P0R A;  3C0R B;  5DPR A;  1E8Y A;  1H4R A;  1BT0 A;  1LQB A;  1S3S G;  2OOB B;  2KQ7 A;  2NBU A;  3VTV A;  3OAW A;  3H7P A;  3IG3 A;  2LGY A;  2BF8 B;  1WH3 A;  3PPA A;  1PQS A;  3UIO B;  4ANX A;  3PVL A;  5IAA C;  4DBG A;  1WGR A;  3A1Q B;  3QQ8 B;  4EUT A;  2KNB A;  2M4N A;  3DBS A;  3CMM B;  2DYB A;  4W9K A;  4TUU A;  2PEA A;  1S1Q B;  4ANU A;  4EEW A;  1LFD A;  2BWE S;  5D2M B;  4NJ7 A;  4ZDV A;  3KUC B;  3JYU A;  3KYC D;  3JW0 X;  4MEM A;  4EZJ A;  3JSV A;  1WX7 A;  3CST A;  4K7W A;  1Z5S B;  5JH5 C;  2LAS A;  3X23 A;  4KSL C;  3VHT C;  2R2Q A;  3PS6 A;  2EMT A;  2BGF A;  1QZE A;  1V9J A;  2LXA A;  4HK2 A;  4HWI B;  4M0W B;  3B1L X;  2IY1 B;  4IM2 A;  1WXM A;  2FAZ A;  4DDI D;  1GG3 A;  2QHO A;  2GBR A;  2JZ3 B;  4ASW C;  3HK0 A;  1E7V A;  4BKS A;  3ZDM C;  3ZIM A;  1WRD B;  2AL3 A;  2CS4 A;  2IO1 B;  3DVG X;  4G0N B;  4E74 A;  4KZC A;  2L0F A;  3PHW B;  1V5O A;  1P9D U;  2DEN B;  2KDI A;  1WJ4 A;  3T8M A;  2BKF A;  2CR5 A;  1WJN A;  3PSE B;  4NY0 A;  2IYD B;  2IO2 B;  3KUD B;  5LLI A;  5DPS A;  3ZLZ A;  3DOW A;  4W9C A;  1E8W A;  4CO7 A;  2WWZ A;  2L0T A;  2ZEQ A;  3UIP B;  2GBK A;  3I3T B;  4RM9 A;  2DX5 B;  1Z2M A;  2KFK B;  2MSE D;  1YX6 B;  4PYU A;  5E6P A;  3WAL A;  3WA0 A;  4FJV B;  3UGB B;  3OJ3 A;  4I6P A;  3ZNZ B;  2GMI C;  3DVN V;  1WJU A;  3DPD A;  2KVR A;  3M63 B;  1WM3 A;  3W1S C;  1KLV A;  3H6N A;  1TTN A;  1F9J A;  4GDK A;  4BVU C;  1NBF C;  1GNU A;  2MBQ A;  3N3K B;  3DDC B;  1WY8 A;  2C7N B;  2C5L C;  2VRR B;  4DK5 A;  1OTR B;  1WZ0 A;  2D10 A;  3K9P B;  4RMA A;  3U8Z A;  1SIF A;  2NS5 A;  1OEY J;  4XC2 A;  2D2Q A;  2MLB A;  2LWP A;  5C23 A;  2G4D B;  2LUE A;  4ICV A;  4HDO A;  3OJ4 B;  2WX1 A;  4HCP B;  4NAW A;  3TIX A;  3EHV A;  1EUV B;  3A9K A;  3SHQ A;  4BBN C;  1WXV A;  4F1S A;  3JSV B;  4I6N B;  5E6O A;  2JY6 A;  4HPM B;  2NVU I;  1WJ6 A;  1UD7 A;  3SDL C;  2MBH A;  2RGF A;  4II2 B;  2JXX A;  2CHX A;  2BYE A;  5D6J B;  2NR2 A;  1VCB A;  2A5U A;  2L00 B;  2MX2 A;  3HM6 X;  4EOY A;  4J6I A;  1ZW7 A;  2KJH B;  3A1Q A;  2LVO A;  2KX0 A;  2KKC A;  3WAM A;  3ZTC A;  3H7P B;  3R7Q A;  3A33 B;  2KJ6 A;  3KH0 A;  4JQW C;  2JF5 A;  5IA7 A;  1E8Z A;  2N9X A;  4ICU A;  3DQV A;  3A4R A;  3MTN B;  3PLV A;  3ZUN A;  2LD9 A;  3N32 A;  1WR1 A;  4XX5 A;  4AOF A;  2KLG A;  2ZPY A;  1WFY A;  1V49 A;  4LJP B;  2EKE C;  3L16 A;  3CSF A;  1OQY A;  2GBM A;  3NHE B;  4I6L B;  4N9F 4;  4HVB A;  4NPN A;  2LJ5 A;  3AU4 A;  3IBE A;  4IUM B;  3ZNH B;  1L7Y A;  3A9J A;  2K8H A;  4JL9 A;  3PRZ A;  1WXA A;  2I1K A;  3UF8 A;  4GDL A;  4KSK C;  1EF1 A;  2N4F A;  2GBN A;  2K25 A;  3V61 A;  3PRP B;  4IM3 A;  4W9J A;  1WMH B;  1G6J A;  4MGZ E;  2BYF A;  3DCG A;  3HHM A;  4GXB A;  4DXA B;  3QWZ B;  4MDK E;  2Y5B B;  1UGM A;  2N9P C;  4AUQ C;  1GC7 A;  3NS8 A;  2KK8 A;  5KHO A;  4G50 A;  4WWP A;  2IZV B;  2HTH A;  2J0K A;  4M8M A;  4KZ0 A;  2V1Y A;  1T0Y A;  4KIK B;  5DPW A;  1V6E A;  1ZGU B;  1YX5 B;  3L17 A;  1Q1O A;  4PS8 A;  5HKH A;  3BIN A;  2RR9 A;  3VDZ A;  1RLF A;  3ZTD A;  2KJR A;  3ZO5 B;  2KXJ A;  3ML9 A;  4TQ0 A;  1V86 A;  1FXT B;  1WE6 A;  1LM8 B;  2ZCB A;  2XBB C;  4BFR A;  4XZ4 A;  3PZD A;  1NI2 A;  4MEL A;  4FAD A;  4G11 A;  3M95 A;  4GU2 A;  3R3M A;  4B6W A;  2D11 A;  1TZ1 A;  2NPT B;  3IFW B;  2KO3 A;  3KVF B;  4FLH A;  2ZNV C;  4A3O A;  3QC8 B;  2D3G A;  4IWP A;  2BKR B;  1Q0W B;  1I35 A;  2L3Z A;  4W9E A;  4LCD E;  2B3A A;  2K8C A;  1YQB A;  4ANW A;  1VD2 A;  2JRH A;  2I1J A;  3TJP A;  5DPT A;  5EDS A;  2KN5 A;  2N1W A;  4DWF A;  4GSW A;  4OVU A;  4W9L A;  5FR6 A;  2Z59 B;  4JGH B;  4DHJ B;  1V81 A;  2LXC A;  3MHS D;  4KDI C;  4DHJ D;  2FUH B;  4DHZ E;  2O6V B;  1ISN A;  4CHK A;  2L7R A;  4FBJ B;  3ML8 A;  4HXD A;  3CF6 E;  5J2R A;  3DVN U;  2MP2 B;  3APC A;  2KWC A;  2FCM A;  1J19 A;  4LDT D;  2NBW B;  1WGH A;  2IO3 B;  4IW0 A;  4MJS A;  4AJW A;  3P2B A;  1Q5W B;  5AEK B;  1UBQ A;  1WZ3 A;  3QIJ A;  3QK0 A;  2BPS A;  2FCQ A;  2PJH A;  4DDG D;  2CKH B;  4K81 A;  2ZVO A;  3QHT A;  3WAN A;  4EFO A;  1H8C A;  4KV2 A;  3VUY A;  4IM0 A;  4HCN B;  1K8R B;  4W9H A;  2JVC A;  4IWO A;  2AYO B;  3VUW A;  1C3T A;  2BYV E;  4GN1 A;  3APF A;  3VAW A;  2CHZ A;  2KDF B;  2ZZP B;  2XK5 B;  2DZJ A;  3UIN B;  2KDB A;  2REX A;  2O6V A;  3RZF A;  2KQS A;  3ZRF A;  3H1U A;  1KJT A;  3EC8 A;  3PV1 A;  4FJZ A;  3AU5 A;  2LGX A;  2O2V A;  2O2V B;  4BBN F;  3NZU A;  1WM2 A;  2C9W B;  3A4S C;  2KDE B;  4GGQ A;  2J0M A;  1R4M I;  5BO4 B;  2MBO A;  3X0W A;  1IPG A;  1YIW A;  4MGK E;  2MA9 B;  3W1S A;  2AWT A;  5E6N A;  3ZVV A;  2YLM A;  1I42 A;  2N1V A;  3QJZ A;  1IYF A;  3TCA A;  2C7H A;  3W1Y A;  3PRM B;  2K6Q A;  3ZNG C;  4EKU A;  3B08 A;  2V3S A;  4AWJ A;  4WJP A;  4RM8 A;  1RAX A;  2WDT B;  2MRP A;  5JHB A;  4ANV A;  3VXW A;  1RRB A;  4BOS C;  1V80 A;  2KTR A;  1E90 A;  1WGY A;  2KFJ A;  3WAP A;  2KWU B;  4URK A;  4FUL A;  2DAJ A;  1OGW A;  2DZK A;  2DHZ A;  2YVC A;  2IO0 B;  3SD5 A;  2DZI A;  4JIO U;  1A5R A;  2WYQ A;  2CU1 A;  3DBL I;  4FN2 A;  2K8B A;  3U7D A;  3R7R A;  4NQK E;  2K1F A;  3O65 B;  3AXC A;  1EF5 A;  2FNJ B;  3QA8 A;  3M3J A;  4JLC A;  3VUX A;  3H7S A;  4BOZ B;  4W9I A;  4NJ6 A;  2J0J A;  4E71 A;  1L2N A;  1C1Y B;  1WXS A;  2ZVN A;  3PGE A;  2D07 B;  2PPH A;  1SGH A;  4TQ1 A;  5D7G A;  5CTR C;  1Y8R C;  1WYW B;  5C1Z A;  3VFK A;  4LJO B;  5D94 A;  3ZNI D;  4B95 A;  3Q3F A;  1UEL A;  2LVQ A;  2NPT A;  4AJY B;  1E7U A;  3U30 A;  2KMA A;  3KYD D;  5GMV A;  1WX9 A;  2N7E A;  3L10 B;  2MQJ A;  4E3C A;  4GMV A;  1UH6 A;  2KZR A;  5L83 A;  4WWO A;  2J7Q B;  2DZM A;  1YD8 U;  3PRE A;  3PHX B;  4K7U A;  4ZRI A;  1WX8 A;  3V6C B;  4ZYN A;  3VH3 B;  4YL8 A;  2M0X A;  2AL6 A;  2R2O A;  3KUZ A;  2O6V D;  2XK5 A;  3UQA A;  2JPH A;  2M17 A;  3D32 A;  3UQB A;  1NDD A;  4F8C B;  1D3Z A;  3QAQ A;  1OEY A;  2C7M B;  2A4Z A;  2M1M A;  3DVG Y;  4BKT A;  1J0G A;  2LI5 A;  3L13 A;  2KLC A;  3NZS A;  2KTR B;  4HPL B;  4K7S A;  4FHJ A;  1V5T A;  4A3P A;  1RFA A;  4FA6 A;  1E5W A;  4MJS B;  1WGD A;  3QCA A;  2BWF A;  2FID A;  4HLE A; 
#chains in the Genus database with same CATH topology
 2FUG 1;  1LGR A;  5J17 A;  3WIM A;  2ZJD A;  3Q3J A;  1P1A A;  1XXG A;  2IPK D;  3WAO A;  4BKT A;  2XEW A;  2FCS A;  2M8S A;  3DBR I;  1HXY D;  3PTF C;  4G3X B;  2Y5C A;  5AZH A;  2C60 A;  1ZP0 B;  2KN4 A;  3P63 A;  4MGI E;  2LGI A;  3QX1 A;  4C4V A;  1VDV A;  2K5P A;  2KX3 A;  3HIZ A;  1ZKH A;  2JZZ A;  4EZL A;  4TKN A;  3P4S B;  2NBV B;  3QAR A;  1XLN A;  2L52 A;  3KLS X;  1ZUD 2;  1MHX A;  2N7D A;  2V0G A;  1X1M A;  2KOX A;  1JRO A;  2NMQ A;  1VJK A;  2KHW B;  3ECI A;  3H9D A;  4HDQ A;  4YT0 B;  2G3Q B;  4ZHO A;  5JHA A;  4WWN A;  5CX3 A;  3VQI A;  2BQQ A;  2KFK A;  4LNO A;  1YJ1 A;  2ZW0 A;  1EU4 A;  1EO6 A;  1IP9 A;  3PT2 B;  2L8J A;  2LRU A;  4KIK A;  1UF0 A;  2LRW A;  1WWT A;  3EFU A;  5AZF A;  3EFC A;  4M8N A;  4TV3 A;  1SSN A;  4AP4 C;  1M94 A;  4GB9 A;  3B2F A;  2RSU A;  3P4P B;  2DBY A;  1XCQ L;  4HRO A;  1AYF A;  4A6Q A;  1L6V A;  2ZPN A;  3BY4 B;  2J53 A;  4RH6 A;  2QIE B;  3B0A A;  4FXC A;  5JZE B;  4GOC A;  3SR6 A;  1YN5 A;  2N0S B;  4MSM B;  2GOW A;  4OHJ A;  1MI0 A;  2FIF A;  5IKC M;  4OZA A;  1K51 A;  1NVI D;  3R66 C;  1J7C A;  3VR8 B;  5D3I B;  3R2I A;  3LJ3 A;  3KW5 B;  3BYY B;  3FIL B;  4S17 A;  5CHF A;  3JVZ X;  2JRI B;  2HJ8 A;  2JYE A;  4OVZ A;  3IVF A;  4IG7 B;  1KOT A;  3ZJV A;  3ZW3 A;  4YXD B;  2HJ1 A;  4W9F A;  2FE8 A;  3M62 B;  3R8B A;  4WQO B;  2K6D B;  3HM3 A;  3KQ4 A;  3MHZ A;  5DPR A;  3VTV A;  3OAW A;  3BK1 A;  2KMM A;  3UIO B;  3A1Q B;  3KWL A;  3QQ8 B;  2KNB A;  2M4N A;  1AN8 A;  3CMM B;  4TUU A;  3ETR A;  1S1Q B;  4ANU A;  3LYY A;  4EEW A;  4NZL B;  4NJ7 A;  5FK9 C;  3KYC D;  3JW0 X;  1WX7 A;  4TSS A;  4K7W A;  3VHT C;  1QZE A;  2VH2 A;  1I4P A;  2WGS A;  5EE0 A;  1D5M C;  4DDI D;  1F1H A;  3U7Z A;  2QHO A;  2WXG A;  3RN9 C;  2K0P A;  4M0W A;  3ZDM C;  1WRD B;  2CS4 A;  1MHH E;  1N5W A;  2DEN B;  1HZ6 A;  3T8M A;  3AE3 B;  2MJD A;  3KUD B;  3ZLZ A;  1E8W A;  3MP9 A;  1UWM A;  1KH0 A;  1I4G A;  3NVV A;  3I3T B;  3Q3M C;  3AV8 A;  1UWX A;  2JXT A;  2RDG A;  2LMC A;  2IJ0 A;  3V3X A;  3H6N A;  4C7Y A;  2VRR B;  2JSV X;  1PUT A;  1ACC A;  3K9P B;  2WDV B;  2NS5 A;  2W54 A;  2MLB A;  2PTL A;  3OJ4 B;  4HCP B;  4NAW A;  3TIX A;  3N1Y C;  1OQR A;  4F1S A;  3SDL C;  4II2 B;  2CHX A;  1R4M B;  2NR2 A;  1VCB A;  2MX2 A;  3HM6 X;  4EOY A;  4J6I A;  5GXG B;  2KJH B;  2LVO A;  1SXT A;  2KJ6 A;  3KH0 A;  2GB1 A;  2N9X A;  1TZO A;  2QJL A;  3PLV A;  3AE2 B;  1WFY A;  3CSF A;  3NVZ A;  1OQY A;  3NHE B;  4I6L B;  4N9F 4;  2D3B A;  1SF0 A;  4P1B C;  1QQR A;  4RGO S;  2GBN A;  3V61 A;  2JYT A;  4IM3 A;  2BYF A;  3BVM A;  4C7Z A;  5H8Y E;  1ZE3 D;  2RPV A;  1GC7 A;  1R4N B;  2KK8 A;  5KHO A;  4L2Y A;  4C80 A;  2Y5P A;  3RI7 C;  4KGT A;  5AUI A;  2HTH A;  2V1Y A;  3OWE B;  1F77 A;  1SEB D;  1YMH E;  3LXF A;  4P1C C;  1ZGU B;  3BIN A;  2X8X X;  2KJR A;  3DWG C;  3ML9 A;  4O1N A;  2WLB A;  4M00 A;  1V86 A;  4WH4 A;  1LM8 B;  4ARC A;  3Q14 C;  5FKA C;  3ZJT A;  5HI1 A;  2D11 A;  1HTQ A;  2KO3 A;  1EM7 A;  3B2G A;  2D3G A;  4IWP A;  2BKR B;  4DQO C;  1I35 A;  4A90 A;  1UNS A;  3Q3O C;  2KN5 A;  2N1W A;  1RFK A;  1L4D B;  2HDE A;  4KDI C;  2FUH B;  3AE5 B;  1HZ5 A;  3IAM 1;  2L1A A;  2RDB C;  4FBJ B;  1PGA A;  3CF6 E;  2KWC A;  2IO3 B;  4MJS A;  2RDH A;  1UBQ A;  2WHI A;  2ACZ B;  3WAN A;  4KV2 A;  1HTO A;  1I4R A;  4IWO A;  2AYO B;  1L0V B;  4RGN A;  1RM6 C;  2BYV E;  2ZZP B;  2DZJ A;  2E3T A;  3PO0 A;  3UIN B;  2REX A;  2ONQ A;  2J42 A;  3P4Q B;  4FJZ A;  2O2V A;  2O2V B;  4BBN F;  4WUR A;  1WM2 A;  3GB1 A;  2KDE B;  2DLB A;  4OZC A;  5BO4 B;  2MBO A;  1IPG A;  1AWD A;  2XNA C;  4LNK A;  2YLM A;  1MJD A;  1IYF A;  3U52 E;  3TCA A;  1FNV A;  3W1Y A;  3PRM B;  2K6Q A;  3B08 A;  4A55 A;  4US9 A;  3Q6B A;  2DNF A;  1F2R C;  1V1P A;  2DHZ A;  4JIO U;  4LNN A;  4FN2 A;  1DGJ A;  5IP4 D;  3O65 B;  4MT5 A;  2FNJ B;  4L23 A;  4W9I A;  2KWD A;  4NJ6 A;  4E71 A;  3NUH B;  3AE9 B;  2D07 B;  5D7G A;  5CTR C;  1WYW B;  3VFK A;  3Q3F A;  3U4E G;  4AJY B;  3U30 A;  3DBH B;  2MQJ A;  1MG4 A;  2X38 A;  2DZM A;  3SFD B;  1YD8 U;  3V6C B;  1WX8 A;  4YL8 A;  2M0X A;  3KUZ A;  2O6V D;  2XK5 A;  3FKY A;  3UQB A;  3D32 A;  1NDD A;  4F8C B;  3N20 C;  1OEY A;  2M1M A;  3DVG Y;  2KLC A;  1YQ4 B;  4FHJ A;  2W55 A;  4A3P A;  2WP9 B;  3L4P A;  5IOI A;  1E9M A;  1E5W A;  2MP2 A;  3I9V 1;  1F2R I;  2EMS A;  2DYO A;  3NY5 A;  4MM3 A;  1SB3 C;  1TKG A;  4CYE A;  1IGD A;  1TKE A;  3LDZ E;  1HA5 A;  2L05 A;  2UWQ A;  1ZXI A;  4RF0 A;  3AUL A;  1FRD A;  4B9K A;  4FJY A;  2ASQ A;  4S0R A;  5TR5 A;  2Z0E B;  4PS3 A;  1WIA A;  3FAH A;  2WXL A;  4YTP B;  3IHP C;  3V6E B;  4EZK A;  2PW9 A;  2OJW A;  1XD3 B;  4NQL B;  3FC4 A;  2MWS B;  4F7Z A;  2DAF A;  4GIV A;  2IND C;  2JUO A;  5L95 C;  4BAX A;  2JT4 B;  4OZB A;  3TMP B;  4FHK A;  5EE3 A;  1QT9 A;  3ENE A;  2UU7 A;  3AE6 B;  3N1X C;  2LVP A;  3VTU A;  3ONS A;  2MW5 A;  4WJQ A;  3RCZ A;  3MJW A;  2W3S A;  4HKZ E;  3PLU A;  1K53 A;  2BTE A;  1JWB D;  4B0E A;  1NYR A;  3O13 A;  4HRS A;  3V60 A;  3RNA C;  3GOE A;  3T3N A;  2FCN A;  3V62 A;  2H89 B;  4W9D A;  2MJ3 A;  2W9N A;  3PZ8 A;  2INP E;  1GJZ A;  5AZG A;  3RYT A;  3R2T A;  4WJN A;  4ZYS A;  2JX5 A;  5HFY A;  3APD A;  4WAF A;  1TBE A;  2UYZ B;  1P3Q U;  4USA A;  3DHI C;  3T9L A;  3RT3 B;  1TY0 A;  1JWA D;  4YWG G;  1YNT E;  1FM0 D;  2K39 A;  3Q8C A;  4BZA A;  3VVW B;  3RZW C;  3RD2 A;  2RD0 A;  3H8H A;  1ZOY B;  4PK1 A;  4N59 A;  1TS5 A;  2B76 B;  1E8Y A;  1BT0 A;  1PDX A;  4W9K A;  1BUI C;  2BYT A;  5D2M B;  1TS3 A;  3GS2 A;  3JSV A;  2LFI A;  1DOI A;  1C76 A;  5AUK A;  4A9A A;  3AEC B;  2WXQ A;  3CST A;  2R2Q A;  3PS6 A;  2H88 B;  4YSX B;  2BGF A;  1V9J A;  2RMM A;  1PFD A;  1CQV A;  1I4H A;  2IY1 B;  4IM2 A;  4JE3 B;  1JWS D;  4RF1 A;  1J7A A;  2JZ3 B;  3DVG X;  2IO1 B;  3DWM A;  4KZC A;  1TKY A;  2L0F A;  1P9D U;  3EA6 A;  2KDI A;  2J4X A;  4NY0 A;  1KRH A;  3DOW A;  4W9C A;  1D6E C;  1Z2M A;  4PYU A;  3WAL A;  3WA0 A;  4HEA 1;  2KAC A;  3Q3N C;  3P42 A;  2M19 A;  4ITK A;  1MFW A;  1FNW A;  1ET9 A;  3M63 B;  3W1S C;  1KLV A;  1F9J A;  4BVU C;  3N3K B;  2C5L C;  4Q2J A;  1T0S C;  3AB5 A;  1OTR B;  1WZ0 A;  3U8Z A;  1WGK A;  2LGS A;  1JML A;  2G4D B;  2LUE A;  4ICV A;  1HEZ E;  3N1Z C;  3A9K A;  5HG2 A;  4MM3 B;  4BBN C;  2WXI A;  3JSV B;  4I6N B;  3RNB C;  1L0Y B;  1UD7 A;  2RGF A;  1KLU D;  2L00 B;  4H2A A;  4CQN A;  1ZW7 A;  4WQM A;  2KKC A;  3WAM A;  2D3C A;  3ZTC A;  3A33 B;  2PIA A;  2JF5 A;  3GP7 A;  1E8Z A;  3DQV A;  3MTN B;  1FIQ A;  1NEN B;  3N32 A;  1WR1 A;  4AOF A;  2KLG A;  2QMT A;  3TSS A;  2EKE C;  3L16 A;  2GBM A;  3BII D;  5BYR A;  4NPN A;  3IBE A;  4IUM B;  3ZNH B;  4JL9 A;  2BVC A;  2NTT A;  1EF1 A;  3PRP B;  1WMH B;  1HQR D;  1V8C A;  3W5V B;  1G6J A;  3HHM A;  4GXB A;  4DXA B;  4AUQ C;  3NS8 A;  1IGC A;  2CJO A;  4WWP A;  2IZV B;  4P6V F;  1TJE A;  3OG5 A;  4PS8 A;  1RLF A;  3AEG B;  1TIF A;  2N9K A;  1FXT B;  2XBB C;  4ZOH C;  3M95 A;  3R3M A;  3IFW B;  1TZ1 A;  3TUO A;  4JX1 C;  3NG0 A;  4W9E A;  1FXI A;  1WYG A;  4IDI A;  1V81 A;  1E0Z A;  1B9R A;  1YOV B;  4CHK A;  4JPS A;  2WU5 B;  5J2R A;  3DVN U;  2WXF A;  4IW0 A;  2BB5 A;  5AEK B;  2BPS A;  4DDG D;  4ZHP A;  2CKH B;  2IGH A;  4K81 A;  2ZVO A;  2V4I B;  3VUY A;  4IM0 A;  3AE1 B;  1K8R B;  3I5J C;  2JVC A;  2M56 B;  2LUM A;  3VUW A;  5TSS A;  3VAW A;  3APF A;  1K52 A;  2D3A A;  3Q8E A;  3AU5 A;  2LGX A;  3MJ5 A;  4MH8 A;  4HPP A;  1C4C A;  2J0M A;  3AH7 A;  1YIW A;  4LNI A;  2MA9 B;  3W1S A;  4C00 A;  4EKU A;  1FO4 A;  2V3S A;  4WJP A;  3AE7 B;  2JU6 X;  4RM8 A;  2WDT B;  3NVW A;  1V80 A;  1E90 A;  1RYJ A;  2KFJ A;  1NI3 A;  2DZK A;  4XDC A;  1XLQ A;  2IO0 B;  2CU1 A;  1QF6 A;  4NQK E;  2K1F A;  3MC8 A;  3QA8 A;  3M3J A;  4M01 A;  3H7S A;  1L2N A;  4RNA A;  2ON8 A;  1WXS A;  1YJJ A;  2ZVN A;  3ZNI D;  1ZDV A;  1UEL A;  2NPT A;  1T0R C;  2INN E;  3TEW A;  3L10 B;  5L83 A;  1UH6 A;  3U2S C;  3PRE A;  4ZRI A;  3VH3 B;  4XGA B;  4ZYN A;  2IGD A;  3ZGZ A;  3AEE B;  3UQA A;  3QAQ A;  1V1P B;  2C7M B;  2A4Z A;  2BS2 B;  1J0G A;  1WRI A;  4HPL B;  4XWW A;  1V5T A;  2AQ2 B;  1SE4 A;  1SJE D;  3VR9 B;  1TY2 A;  3IAS 1;  2VZK B;  1QOG A;  4R3D A;  4FA6 A;  3KWV A;  2FID A;  1QKZ A;  3GE3 C;  1R7S A;  2ZNV B;  1FEH A;  1E10 A;  1UZX B;  3RNF C;  4GDL B;  1GB4 A;  2W3R A;  4NAW B;  2GBJ A;  1P98 A;  2YEP F;  4ARI A;  5KHQ A;  1FFV A;  4IC7 B;  5BYS A;  3K9O B;  3SU8 X;  2WS3 B;  1XQQ A;  1JW9 D;  2DYM A;  2IY0 B;  4MH0 E;  2KC1 A;  4MAC A;  1SE3 A;  3N9Y C;  1CMX B;  2G45 B;  1WI0 A;  1FCL A;  3NJT A;  1V2Y A;  4BKS D;  1WF9 A;  5LXI B;  1N5X A;  5C3J B;  1PGX A;  3AI5 A;  3C8Y A;  1ESF A;  4W9G A;  5G2N A;  2QIL A;  5JXV A;  1UGJ A;  5CHW A;  1WXQ A;  1XCT L;  3HRD D;  3BYT B;  2V4L A;  4LDT B;  1GB1 A;  3TEY A;  1UBI A;  4B0M A;  3NOB A;  2LJI A;  4HJK A;  5E6J A;  1WMH A;  1T0Q C;  3OLM D;  4XE0 A;  5MPO A;  4GDK B;  4ZRK A;  5H92 C;  1FD6 A;  2I38 A;  5T8I A;  3TL5 A;  3NRZ A;  1IBX A;  1ROE A;  3MC0 B;  2MEK A;  3VTW A;  4NNJ B;  1C4P A;  1FMA D;  4D2K A;  4ZRJ A;  3ALB A;  4IOI E;  2MCN B;  3RNE C;  4X57 B;  4AS1 A;  3S2A A;  2KAN A;  4BKG A;  4KGS A;  4TMA B;  2L76 A;  2BS4 B;  2KD0 A;  3DBH I;  3A9K B;  1DYQ A;  2ZCC A;  2RPQ A;  1YQ3 B;  1N62 A;  2KMC A;  2HE7 A;  4KDL B;  3RUL A;  1GUA B;  2AX5 A;  2PE6 B;  3FIL A;  3BVZ A;  2Y3A A;  1E8X A;  4WAA A;  2QCZ A;  1P0R A;  3C0R B;  1S3S G;  2KQ7 A;  3I57 A;  3IG3 A;  4HKQ A;  4ANX A;  3PPA A;  1PQS A;  3PVL A;  5IAA C;  4DBG A;  1WGR A;  3W5U B;  4EUT A;  4L1B A;  3DBS A;  2DYB A;  4US8 A;  2PEA A;  2AQ1 B;  4ZDV A;  4YTN B;  3KUC B;  3JYU A;  4MEM A;  4EZJ A;  1Q10 A;  3IXS A;  1Z5S B;  2LAS A;  3X23 A;  4KSL C;  3NS1 A;  2AQ3 B;  3AN1 A;  2EMT A;  2KQ4 X;  2W82 A;  2NTS A;  4HWI B;  3B1L X;  1J7B A;  2TSS A;  2FAZ A;  2K9X A;  1QIL A;  1KTK A;  4ACF A;  2GBR A;  4ASW C;  3HK0 A;  4BKS A;  3ZIM A;  2AL3 A;  4E74 A;  1PYW D;  3AED B;  3P1M A;  1V5O A;  2JQR B;  1VZ6 A;  2BKF A;  1YJI A;  1WJN A;  3PSE B;  1L4Z B;  2IO2 B;  1L0X B;  4CO7 A;  5DPS A;  2WWZ A;  1K50 A;  3UIP B;  4RM9 A;  2PVO D;  2KFK B;  1YX6 B;  5E6P A;  2ZW1 A;  3MC9 A;  3UGB B;  2V3N A;  3OJ3 A;  4I6P A;  3ZNZ B;  1C78 A;  3HVD A;  4ZRQ A;  3DPD A;  1WM3 A;  2CJN A;  1TTN A;  1NBF C;  3NVY A;  2WDQ B;  1BML C;  1WY8 A;  2C7N B;  3DDC B;  2IGG A;  1C4A A;  3GE8 C;  1SIF A;  4XC2 A;  2D2Q A;  2LWP A;  1FXA A;  5C23 A;  3DHG C;  3ZJU A;  2WX1 A;  3EHV A;  3SHQ A;  1WXV A;  1RWS A;  5E6O A;  4HPM B;  2NVU I;  2VH1 A;  2BYE A;  1KLG D;  2A5U A;  2I2Y A;  1IUE A;  1BXT A;  1QOF A;  2K3U A;  3A1Q A;  1VZ8 A;  2KX0 A;  4K3B A;  2N7J A;  1JRP A;  1B1Z A;  1MPE A;  3R7Q A;  1ENF A;  4RCO A;  3A4R A;  3ZUN A;  2LHD A;  2ZPY A;  2G1E A;  4HVB A;  1L7Y A;  3AEF B;  2K8H A;  3PRZ A;  5I4D A;  2I1K A;  3HUI A;  2KVZ A;  5FR3 A;  4KSK C;  2K25 A;  4W9J A;  3AE8 B;  2KYW A;  2BT6 A;  3DCG A;  3QWZ B;  3P4R B;  1OFF A;  2Y5B B;  1UGM A;  2N9P C;  4JWS C;  3ABV B;  1AW7 A;  1N6Z A;  4LK0 M;  1UUP A;  3Q69 A;  4KZ0 A;  1T0Y A;  1V6E A;  4WIP A;  1YX5 B;  5HKH A;  2RR9 A;  3VDZ A;  1T6B X;  3TEX A;  3ZO5 B;  1VR9 A;  4C56 C;  5IN7 A;  4WWM A;  1XO3 A;  5D3D A;  4XZ4 A;  3PZD A;  4G11 A;  3UI3 A;  4GU2 A;  3KVF B;  4XDD A;  2ZNV C;  3QC8 B;  1Q0W B;  4LCD E;  4KGR A;  2K8C A;  3TEZ A;  2JRH A;  2OED A;  2WXJ A;  2I1J A;  2WU2 B;  3TJP A;  5EDS A;  1CZP A;  2MJE A;  4OVU A;  4W9L A;  3RNC C;  4DHJ B;  2EEL A;  3MFG A;  2LXC A;  3MHS D;  4DHZ E;  1ZDX A;  2O6V B;  1ISN A;  2L7R A;  2N9L A;  1ZXH A;  2MP2 B;  3APC A;  3CIR B;  2FCM A;  4K3C A;  3VRB B;  3P2B A;  1WZ3 A;  2FCQ A;  3QHT A;  1H8C A;  3T3O A;  5BMG A;  4W9H A;  2KDF B;  2XK5 B;  3RZF A;  3AEB B;  2Q5W D;  3ZRF A;  3H1U A;  1ZPS A;  4RGM A;  3NZU A;  4GGQ A;  1E6E B;  2YEP B;  1R4M I;  3X0W A;  4MGK E;  2AWT A;  4YSZ B;  4HJG E;  3V05 A;  3ZNG C;  4RGT A;  4AWJ A;  3VRA B;  1RRB A;  3W9C B;  2KTR A;  3WAP A;  1QLB B;  4URK A;  2DAJ A;  1OGW A;  1FPY A;  2KT7 A;  3SFE B;  2WXK A;  3DBL I;  1JAL A;  2QEJ C;  1DOY A;  2K22 A;  1MVK A;  4JLC A;  4BOZ B;  2J0J A;  1CJE A;  4A8X C;  1SGH A;  4TQ1 A;  1NYQ A;  1OQQ A;  1Y8R C;  1CK1 A;  4LJO B;  5D94 A;  1E7U A;  3KYD D;  2N7E A;  4E3C A;  2KZR A;  4IKG A;  3PHX B;  5EE1 A;  2AL6 A;  4OW0 A;  1ET6 A;  2GRI A;  2ICI A;  2JWU A;  2INC C;  3ZXR A;  2E6X A;  1JWU D;  2DWQ A;  4MJS B;  1WGD A;  2BWF A;  2OJR A;  1LXD A;  2FBW B;  2HTM E;  3Q8B A;  4II3 B;  2CU3 A;  1WSP A;  4PS7 A;  3ZKJ C;  4MSQ B;  3ZQ4 A;  3NZ3 A;  3L0W B;  3RMK C;  1XF5 L;  1N61 A;  1XEE A;  2JWZ A;  4ZRP A;  2GI9 A;  1I4X A;  2MBB B;  3ZDT A;  3BVG A;  1WR6 E;  1A70 A;  1T3Q A;  2HD5 B;  5CHV C;  1KM7 A;  2IBI B;  1R4N I;  2KWV B;  2G9H D;  4LLG M;  2L83 A;  2OHF A;  1GPX A;  5C2T B;  4A20 A;  2N9E B;  3DHH C;  3BWU D;  1N63 A;  2KC2 A;  4OVV A;  2NCN A;  1TS2 A;  2XN9 C;  3AEA B;  3Q8A A;  5G55 A;  1SE2 A;  3TBL D;  1JQ4 A;  4KVG B;  1XT9 B;  2MBE A;  1GC6 A;  3IT6 B;  2VZK D;  2PVG C;  1AAR A;  5IO9 A;  3L08 A;  2WXM A;  1U4A A;  2BW2 A;  1E7P B;  1EWY C;  1HE8 A;  2WX0 A;  4KKI A;  1JRU A;  3GZN I;  1TS4 A;  1FFU A;  2Z0D B;  2BB6 A;  3E9S A;  3L54 A;  2G4S A;  4PYZ A;  1WE7 A;  1I4Q A;  1SE9 A;  4REZ A;  1F52 A;  3N30 A;  1TGZ B;  3BK2 A;  5LNK 1;  2WDR B;  4P7I A;  2QDF A;  4K1R B;  1DOX A;  3ZRC A;  4MGY E;  4DHZ B;  1WGG A;  2LGD A;  3A9J B;  2Z8L A;  5LXH A;  5DCN A;  1MG8 A;  2SEB D;  2AEH A;  2WXN A;  4IWQ A;  4WJO A;  2CHW A;  3VH4 B;  5J18 A;  1GOZ A;  2PE9 A;  3EEC A;  2LZ6 A;  2PMV A;  3RUI B;  2KTF A;  5BMH A;  1H4R A;  2OOB B;  1LQB A;  2NBU A;  3H7P A;  1TT5 B;  2MH7 A;  2LGY A;  2BF8 B;  1WH3 A;  1J8C A;  1PGB A;  1SIJ A;  3Q8F A;  1LFD A;  2BWE S;  3DBR B;  1QOB A;  2M0A A;  1L6U A;  3DBL B;  5JH5 C;  3LB8 C;  2BS3 B;  4HK2 A;  2LXA A;  4M0W B;  1XLP A;  1P7F A;  1WXM A;  1GG3 A;  3BZD B;  4NJC A;  1D4B A;  1E7V A;  4G0N B;  1YN4 A;  3PHW B;  4YTM B;  2J52 A;  2L32 A;  1WJ4 A;  2CR5 A;  3RPF C;  2IYD B;  5LLI A;  5HHD G;  2MHJ A;  2L0T A;  2ZEQ A;  2GBK A;  4P16 A;  5G5H A;  2DX5 B;  2MSE D;  4QAY A;  4FJV B;  4RFB A;  4M02 A;  2GMI C;  3DVN V;  1WJU A;  1IBX B;  4XWT A;  2KVR A;  1C77 A;  4GDK A;  1GNU A;  2MBQ A;  1KF6 B;  2WQY B;  4DK5 A;  3Q2A C;  2D10 A;  4RMA A;  3URY A;  1V1O A;  1OEY J;  5G5G A;  4HDO A;  1EUV B;  1SJH D;  2WXP A;  1P7E A;  2JY6 A;  1WJ6 A;  2MBH A;  2JXX A;  3E56 A;  5D6J B;  1SBB B;  3ZYY X;  3SEB A;  3H7P B;  4JQW C;  5IA7 A;  4LNF A;  4DXF A;  4ICU A;  4JWU C;  2LD9 A;  4EE2 A;  3IT4 B;  4XX5 A;  1V49 A;  4LJP B;  2WXR A;  2KDM A;  2LJ5 A;  3AU4 A;  3A9J A;  1JWM D;  1VZ7 A;  2R61 A;  1WXA A;  1JCK B;  3UF8 A;  1F0Z A;  4GDL A;  2N4F A;  3HVZ A;  4MGZ E;  2WXO A;  4MDK E;  4KX6 B;  1M4V A;  3B9J A;  5BYQ A;  2GLS A;  4G50 A;  2J0K A;  4M8M A;  4KIK B;  5DPW A;  3RNG C;  3L17 A;  1Q1O A;  1KFY B;  3ZTD A;  2V9H A;  1YN3 A;  2KXJ A;  3C19 A;  4KKJ A;  4TQ0 A;  1WE6 A;  2ZCB A;  4UDU C;  4BFR A;  1NI2 A;  4MEL A;  4FAD A;  1T5X D;  1Y56 A;  2D5G A;  4B6W A;  4DXG A;  2NPT B;  4FLH A;  4A3O A;  5BMI A;  2PLP A;  4AQ7 A;  1NEK B;  2L3Z A;  2B3A A;  1YQB A;  4ANW A;  1VD2 A;  2QSD A;  5DPT A;  4DWF A;  4C4V B;  2PKO A;  4GSW A;  5FR6 A;  2Z59 B;  4JGH B;  3EGR A;  4DHJ D;  1XLO A;  3WCQ A;  3ML8 A;  2IDY A;  4HXD A;  1J19 A;  4LDT D;  2NBW B;  1WGH A;  3AE4 B;  3W2D A;  1C79 A;  4AJW A;  4NAM A;  1Q5W B;  3QIJ A;  1VLB A;  3QK0 A;  2PJH A;  4EFO A;  1EU3 A;  1C9F A;  4HCN B;  1L5P A;  1QOA A;  1C3T A;  4GN1 A;  2CHZ A;  2KAJ A;  2KDB A;  2SAK A;  2O6V A;  2KQS A;  3CWI A;  1KJT A;  3EC8 A;  3PV1 A;  1FRR A;  3A4S C;  2C9W B;  4N6E B;  1D5Z C;  5E6N A;  2LHE A;  3ZVV A;  1I42 A;  2N1V A;  3QJZ A;  2C7H A;  2LEK A;  2QC8 A;  4XYC A;  5EE9 A;  1RAX A;  2MRP A;  5JHB A;  4ANV A;  3VXW A;  4YSY B;  4BOS C;  3AM9 A;  1WGY A;  2KWU B;  3GZN B;  1EWC A;  1N60 A;  3I63 C;  4FUL A;  2V3P A;  2YVC A;  3SD5 A;  2DZI A;  1GAQ B;  1A5R A;  2WYQ A;  2K8B A;  1FCC C;  2EKI A;  3U7D A;  3AMZ A;  3R7R A;  1VRA B;  3AXC A;  1EF5 A;  3VUX A;  2WXH A;  3ZXV A;  1C1Y B;  4LTU A;  3PGE A;  2PPH A;  5C1Z A;  3RFZ B;  4B95 A;  2WNM A;  4N58 A;  2LVQ A;  1TYG B;  2KMA A;  5GMV A;  1WX9 A;  4GMV A;  4WWO A;  2J7Q B;  4K7U A;  2BBC A;  2R2O A;  1LO5 D;  2JPH A;  2M17 A;  1D3Z A;  3PZ7 A;  2LI5 A;  3L13 A;  3NZS A;  1D5X C;  2KTR B;  4K7S A;  2JZP A;  4PT5 A;  3J9C A;  1I7H A;  3EUB 2;  1V97 A;  4GLS C;  1STE A;  1RFA A;  1FNU A;  3QCA A;  4J3O D;  4HLE A; 
#chains in the Genus database with same CATH homology
 2MP2 A;  2OJR A;  1LXD A;  5J17 A;  2EMS A;  1J8C A;  3WIM A;  2ZJD A;  2ZNV B;  3Q3J A;  1UZX B;  1P1A A;  4GDL B;  3WAO A;  2DYO A;  2XEW A;  4II3 B;  2FCS A;  2M8S A;  3NY5 A;  4PS7 A;  3DBR I;  3PTF C;  4G3X B;  4MM3 A;  3ZKJ C;  5AZH A;  4MSQ B;  4NAW B;  2C60 A;  2GBJ A;  4MGI E;  1P98 A;  4CYE A;  3L0W B;  3QX1 A;  3LDZ E;  5KHQ A;  2JWZ A;  4IC7 B;  2KX3 A;  3HIZ A;  2L05 A;  3K9O B;  3SU8 X;  1ZKH A;  2JZZ A;  2UWQ A;  2MBB B;  1XQQ A;  2DYM A;  4TKN A;  3ZDT A;  4EZL A;  2NBV B;  3QAR A;  2IY0 B;  4MH0 E;  2KC1 A;  3AUL A;  1WR6 E;  4B9K A;  4FJY A;  2ASQ A;  1CMX B;  2G45 B;  2HD5 B;  1WI0 A;  1V2Y A;  5CHV C;  4BKS D;  2N7D A;  1WF9 A;  1KM7 A;  1X1M A;  2IBI B;  2KOX A;  5TR5 A;  3AI5 A;  5LXI B;  2Z0E B;  2KHW B;  3ECI A;  3H9D A;  4PS3 A;  1R4N I;  4HDQ A;  2G3Q B;  1WIA A;  4W9G A;  5JHA A;  4WWN A;  2KWV B;  5CX3 A;  3VQI A;  5G2N A;  3IHP C;  3V6E B;  2KFK A;  4A20 A;  2N9E B;  4EZK A;  1YJ1 A;  1IP9 A;  1EO6 A;  1XD3 B;  2L8J A;  3PT2 B;  4NQL B;  5CHW A;  2LRU A;  2KC2 A;  2MWS B;  4KIK A;  4OVV A;  4F7Z A;  2NCN A;  2DAF A;  4GIV A;  2LRW A;  2V4L A;  3EFU A;  4LDT B;  5AZF A;  5G55 A;  2JUO A;  3TBL D;  5L95 C;  1UBI A;  2JT4 B;  3NOB A;  4KVG B;  4M8N A;  4TV3 A;  1XT9 B;  4HJK A;  2MBE A;  3TMP B;  4AP4 C;  4FHK A;  1M94 A;  4GB9 A;  1GC6 A;  1WMH A;  2RSU A;  3ENE A;  3OLM D;  4GDK B;  1AAR A;  4ZRK A;  2LVP A;  3VTU A;  3ONS A;  3TL5 A;  2MW5 A;  3L08 A;  2ZPN A;  4WJQ A;  3RCZ A;  3BY4 B;  1U4A A;  3MJW A;  3B0A A;  5JZE B;  3VTW A;  3PLU A;  1HE8 A;  2WX0 A;  1JRU A;  3GZN I;  4GOC A;  4NNJ B;  2Z0D B;  3V60 A;  3L54 A;  4MSM B;  2G4S A;  4ZRJ A;  2GOW A;  3ALB A;  3GOE A;  4PYZ A;  1WE7 A;  2MCN B;  2FIF A;  2FCN A;  3V62 A;  4X57 B;  3S2A A;  2KAN A;  4W9D A;  1SE9 A;  4BKG A;  3R66 C;  2W9N A;  3N30 A;  1GJZ A;  1TGZ B;  5AZG A;  3LJ3 A;  3RYT A;  3KW5 B;  4WJN A;  2L76 A;  4P7I A;  2KD0 A;  5CHF A;  3JVZ X;  3DBH I;  3APD A;  2JRI B;  4K1R B;  1TBE A;  2UYZ B;  1P3Q U;  3A9K B;  2HJ8 A;  2ZCC A;  2RPQ A;  3ZRC A;  4MGY E;  4DHZ B;  1WGG A;  2LGD A;  3IVF A;  3T9L A;  3RT3 B;  4IG7 B;  1KOT A;  3A9J B;  5LXH A;  2KMC A;  5DCN A;  2HE7 A;  4KDL B;  1MG8 A;  3ZW3 A;  2AEH A;  3RUL A;  1GUA B;  4IWQ A;  4WJO A;  2K39 A;  2CHW A;  3VH4 B;  5J18 A;  3VVW B;  3RZW C;  3RD2 A;  2PE6 B;  4W9F A;  2RD0 A;  2PE9 A;  3M62 B;  3EEC A;  2LZ6 A;  4WQO B;  2K6D B;  3HM3 A;  3RUI B;  1E8X A;  4WAA A;  2KTF A;  1P0R A;  3C0R B;  5DPR A;  1E8Y A;  1H4R A;  1BT0 A;  1LQB A;  1S3S G;  2OOB B;  2KQ7 A;  2NBU A;  3VTV A;  3OAW A;  3H7P A;  3IG3 A;  2LGY A;  2BF8 B;  1WH3 A;  3PPA A;  1PQS A;  3UIO B;  4ANX A;  3PVL A;  5IAA C;  4DBG A;  1WGR A;  3A1Q B;  3QQ8 B;  4EUT A;  2KNB A;  2M4N A;  3DBS A;  3CMM B;  2DYB A;  4W9K A;  4TUU A;  2PEA A;  1S1Q B;  4ANU A;  4EEW A;  1LFD A;  2BWE S;  5D2M B;  4NJ7 A;  4ZDV A;  3KUC B;  3JYU A;  3KYC D;  3JW0 X;  4MEM A;  4EZJ A;  3JSV A;  1WX7 A;  3CST A;  4K7W A;  1Z5S B;  5JH5 C;  2LAS A;  3X23 A;  4KSL C;  3VHT C;  2R2Q A;  3PS6 A;  2EMT A;  2BGF A;  1QZE A;  1V9J A;  2LXA A;  4HK2 A;  4HWI B;  4M0W B;  3B1L X;  2IY1 B;  4IM2 A;  1WXM A;  2FAZ A;  4DDI D;  1GG3 A;  2QHO A;  2GBR A;  2JZ3 B;  4ASW C;  3HK0 A;  1E7V A;  4BKS A;  3ZDM C;  3ZIM A;  1WRD B;  2AL3 A;  2CS4 A;  2IO1 B;  3DVG X;  4G0N B;  4E74 A;  4KZC A;  2L0F A;  3PHW B;  1V5O A;  1P9D U;  2DEN B;  2KDI A;  1WJ4 A;  3T8M A;  2BKF A;  2CR5 A;  1WJN A;  3PSE B;  4NY0 A;  2IYD B;  2IO2 B;  3KUD B;  5LLI A;  5DPS A;  3ZLZ A;  3DOW A;  4W9C A;  1E8W A;  4CO7 A;  2WWZ A;  2L0T A;  2ZEQ A;  3UIP B;  2GBK A;  3I3T B;  4RM9 A;  2DX5 B;  1Z2M A;  2KFK B;  2MSE D;  1YX6 B;  4PYU A;  5E6P A;  3WAL A;  3WA0 A;  4FJV B;  3UGB B;  3OJ3 A;  4I6P A;  3ZNZ B;  2GMI C;  3DVN V;  1WJU A;  3DPD A;  2KVR A;  3M63 B;  1WM3 A;  3W1S C;  1KLV A;  3H6N A;  1TTN A;  1F9J A;  4GDK A;  4BVU C;  1NBF C;  1GNU A;  2MBQ A;  3N3K B;  3DDC B;  1WY8 A;  2C7N B;  2C5L C;  2VRR B;  4DK5 A;  1OTR B;  1WZ0 A;  2D10 A;  3K9P B;  4RMA A;  3U8Z A;  1SIF A;  2NS5 A;  1OEY J;  4XC2 A;  2D2Q A;  2MLB A;  2LWP A;  5C23 A;  2G4D B;  2LUE A;  4ICV A;  4HDO A;  3OJ4 B;  2WX1 A;  4HCP B;  4NAW A;  3TIX A;  3EHV A;  1EUV B;  3A9K A;  3SHQ A;  4BBN C;  1WXV A;  4F1S A;  3JSV B;  4I6N B;  5E6O A;  2JY6 A;  4HPM B;  2NVU I;  1WJ6 A;  1UD7 A;  3SDL C;  2MBH A;  2RGF A;  4II2 B;  2JXX A;  2CHX A;  2BYE A;  5D6J B;  2NR2 A;  1VCB A;  2A5U A;  2L00 B;  2MX2 A;  3HM6 X;  4EOY A;  4J6I A;  1ZW7 A;  2KJH B;  3A1Q A;  2LVO A;  2KX0 A;  2KKC A;  3WAM A;  3ZTC A;  3H7P B;  3R7Q A;  3A33 B;  2KJ6 A;  3KH0 A;  4JQW C;  2JF5 A;  5IA7 A;  1E8Z A;  2N9X A;  4ICU A;  3DQV A;  3A4R A;  3MTN B;  3PLV A;  3ZUN A;  2LD9 A;  3N32 A;  1WR1 A;  4XX5 A;  4AOF A;  2KLG A;  2ZPY A;  1WFY A;  1V49 A;  4LJP B;  2EKE C;  3L16 A;  3CSF A;  1OQY A;  2GBM A;  3NHE B;  4I6L B;  4N9F 4;  4HVB A;  4NPN A;  2LJ5 A;  3AU4 A;  3IBE A;  4IUM B;  3ZNH B;  1L7Y A;  3A9J A;  2K8H A;  4JL9 A;  3PRZ A;  1WXA A;  2I1K A;  3UF8 A;  4GDL A;  4KSK C;  1EF1 A;  2N4F A;  2GBN A;  2K25 A;  3V61 A;  3PRP B;  4IM3 A;  4W9J A;  1WMH B;  1G6J A;  4MGZ E;  2BYF A;  3DCG A;  3HHM A;  4GXB A;  4DXA B;  3QWZ B;  4MDK E;  2Y5B B;  1UGM A;  2N9P C;  4AUQ C;  1GC7 A;  3NS8 A;  2KK8 A;  5KHO A;  4G50 A;  4WWP A;  2IZV B;  2HTH A;  2J0K A;  4M8M A;  4KZ0 A;  2V1Y A;  1T0Y A;  4KIK B;  5DPW A;  1V6E A;  1ZGU B;  1YX5 B;  3L17 A;  1Q1O A;  4PS8 A;  5HKH A;  3BIN A;  2RR9 A;  3VDZ A;  1RLF A;  3ZTD A;  2KJR A;  3ZO5 B;  2KXJ A;  3ML9 A;  4TQ0 A;  1V86 A;  1FXT B;  1WE6 A;  1LM8 B;  2ZCB A;  2XBB C;  4BFR A;  4XZ4 A;  3PZD A;  1NI2 A;  4MEL A;  4FAD A;  4G11 A;  3M95 A;  4GU2 A;  3R3M A;  4B6W A;  2D11 A;  1TZ1 A;  2NPT B;  3IFW B;  2KO3 A;  3KVF B;  4FLH A;  2ZNV C;  4A3O A;  3QC8 B;  2D3G A;  4IWP A;  2BKR B;  1Q0W B;  1I35 A;  2L3Z A;  4W9E A;  4LCD E;  2B3A A;  2K8C A;  1YQB A;  4ANW A;  1VD2 A;  2JRH A;  2I1J A;  3TJP A;  5DPT A;  5EDS A;  2KN5 A;  2N1W A;  4DWF A;  4GSW A;  4OVU A;  4W9L A;  5FR6 A;  2Z59 B;  4JGH B;  4DHJ B;  1V81 A;  2LXC A;  3MHS D;  4KDI C;  4DHJ D;  2FUH B;  4DHZ E;  2O6V B;  1ISN A;  4CHK A;  2L7R A;  4FBJ B;  3ML8 A;  4HXD A;  3CF6 E;  5J2R A;  3DVN U;  2MP2 B;  3APC A;  2KWC A;  2FCM A;  1J19 A;  4LDT D;  2NBW B;  1WGH A;  2IO3 B;  4IW0 A;  4MJS A;  4AJW A;  3P2B A;  1Q5W B;  5AEK B;  1UBQ A;  1WZ3 A;  3QIJ A;  3QK0 A;  2BPS A;  2FCQ A;  2PJH A;  4DDG D;  2CKH B;  4K81 A;  2ZVO A;  3QHT A;  3WAN A;  4EFO A;  1H8C A;  4KV2 A;  3VUY A;  4IM0 A;  4HCN B;  1K8R B;  4W9H A;  2JVC A;  4IWO A;  2AYO B;  3VUW A;  1C3T A;  2BYV E;  4GN1 A;  3APF A;  3VAW A;  2CHZ A;  2KDF B;  2ZZP B;  2XK5 B;  2DZJ A;  3UIN B;  2KDB A;  2REX A;  2O6V A;  3RZF A;  2KQS A;  3ZRF A;  3H1U A;  1KJT A;  3EC8 A;  3PV1 A;  4FJZ A;  3AU5 A;  2LGX A;  2O2V A;  2O2V B;  4BBN F;  3NZU A;  1WM2 A;  2C9W B;  3A4S C;  2KDE B;  4GGQ A;  2J0M A;  1R4M I;  5BO4 B;  2MBO A;  3X0W A;  1IPG A;  1YIW A;  4MGK E;  2MA9 B;  3W1S A;  2AWT A;  5E6N A;  3ZVV A;  2YLM A;  1I42 A;  2N1V A;  3QJZ A;  1IYF A;  3TCA A;  2C7H A;  3W1Y A;  3PRM B;  2K6Q A;  3ZNG C;  4EKU A;  3B08 A;  2V3S A;  4AWJ A;  4WJP A;  4RM8 A;  1RAX A;  2WDT B;  2MRP A;  5JHB A;  4ANV A;  3VXW A;  1RRB A;  4BOS C;  1V80 A;  2KTR A;  1E90 A;  1WGY A;  2KFJ A;  3WAP A;  2KWU B;  4URK A;  4FUL A;  2DAJ A;  1OGW A;  2DZK A;  2DHZ A;  2YVC A;  2IO0 B;  3SD5 A;  2DZI A;  4JIO U;  1A5R A;  2WYQ A;  2CU1 A;  3DBL I;  4FN2 A;  2K8B A;  3U7D A;  3R7R A;  4NQK E;  2K1F A;  3O65 B;  3AXC A;  1EF5 A;  2FNJ B;  3QA8 A;  3M3J A;  4JLC A;  3VUX A;  3H7S A;  4BOZ B;  4W9I A;  4NJ6 A;  2J0J A;  4E71 A;  1L2N A;  1C1Y B;  1WXS A;  2ZVN A;  3PGE A;  2D07 B;  2PPH A;  1SGH A;  4TQ1 A;  5D7G A;  5CTR C;  1Y8R C;  1WYW B;  5C1Z A;  3VFK A;  4LJO B;  5D94 A;  3ZNI D;  4B95 A;  3Q3F A;  1UEL A;  2LVQ A;  2NPT A;  4AJY B;  1E7U A;  3U30 A;  2KMA A;  3KYD D;  5GMV A;  1WX9 A;  2N7E A;  3L10 B;  2MQJ A;  4E3C A;  4GMV A;  1UH6 A;  2KZR A;  5L83 A;  4WWO A;  2J7Q B;  2DZM A;  1YD8 U;  3PRE A;  3PHX B;  4K7U A;  4ZRI A;  1WX8 A;  3V6C B;  4ZYN A;  3VH3 B;  4YL8 A;  2M0X A;  2AL6 A;  2R2O A;  3KUZ A;  2O6V D;  2XK5 A;  3UQA A;  2JPH A;  2M17 A;  3D32 A;  3UQB A;  1NDD A;  4F8C B;  1D3Z A;  3QAQ A;  1OEY A;  2C7M B;  2A4Z A;  2M1M A;  3DVG Y;  4BKT A;  1J0G A;  2LI5 A;  3L13 A;  2KLC A;  3NZS A;  2KTR B;  4HPL B;  4K7S A;  4FHJ A;  1V5T A;  4A3P A;  1RFA A;  4FA6 A;  1E5W A;  4MJS B;  1WGD A;  3QCA A;  2BWF A;  2FID A;  4HLE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...