3ZLZA

Lys6-linked tri-ubiquitin
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
73
structure length
73
Chain Sequence
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGRQLEDGRTLSDYNIQKESTLHLVLRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Assembly, Analysis and Architecture of Atypical Ubiquitin Chains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords UBIQUITIN
total genus 18
structure length 73
sequence length 73
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3zlzA00
2DHZA 4ZRKA 3B1LX 4CYEA 3DPDA 3EECA 1WM3A 4HJKA 3ZNZB 3ZNID 4RM8A 1PQSA 2M1MA 4PS8A 1D3ZA 3WANA 3W1YA 3ZTCA 1E8WA 3UQAA 4BKTA 3RCZA 2GBKA 1P9DU 2LGXA 1WGDA 2DENB 2FCNA 4TQ1A 3H9DA 4IWPA 4MH0E 5J17A 1YD8U 3A9KB 1SGHA 3NZUA 2M8SA 2HJ8A 2UYZB 3R66C 2LWPA 2RR9A 1LXDA 1V6EA 3RD2A 3DDCB 4PYZA 5D7GA 1U4AA 2GBRA 2K6DB 2KJRA 3L08A 5C1ZA 1TTNA 2YVCA 1GG3A 3QWZB 3TCAA 4BBNC 2K39A 1WI0A 3DBLI 3KUCB 4GN1A 4A3OA 3PTFC 3A1QB 2KHWB 2BWFA 4MSQB 4X57B 3WAMA 2DYBA 2O6VD 3RYTA 1Q0WB 4EZKA 2IBIB 4W9LA 4NQLB 3O65B 4JIOU 2KDEB 4IM2A 2L76A 4GDLB 3VHTC 3DBHI 2LI5A 2KJHB 3HHMA 2ZVNA 1GUAB 1V5TA 2K8HA 3Q3FA 2XK5A 2G4SA 2G45B 4URKA 2DYOA 3ENEA 2HE7A 3APDA 3A4RA 3C0RB 2LUEA 2YLMA 2JWZA 4P7IA 1UZXB 2BF8B 4MM3A 4GDLA 4AJYB 3H6NA 2CKHB 4W9FA 1S3SG 3UGBB 1K8RB 1VCBA 2ZPNA 3U7DA 2N9XA 1TZ1A 3A33B 4KZCA 2GOWA 3PRZA 4ZRIA 4OVUA 4W9GA 1L7YA 2DZMA 2NVUI 1VD2A 4JGHB 1UBQA 2D07B 1WJ4A 2NS5A 4NAWA 2LASA 3ZVVA 4IC7B 3IVFA 1OQYA 2KX3A 2KDIA 2JRIB 2FAZA 4MGIE 1WM2A 1RAXA 2N9PC 3DQVA 2MBHA 5E6NA 4GDKB 3ZDTA 4TQ0A 2ZCCA 4CHKA 2GMIC 1UBIA 3APCA 3PV1A 2KDFB 2EMTA 2JF5A 2BYFA 4HPLB 2L0FA 4XX5A 2WWZA 4DWFA 1OGWA 4A20A 3V60A 4W9DA 3L54A 4II3B 4FULA 2LVOA 2CR5A 1MG8A 1WR1A 2DAFA 2FUHB 3IHPC 3QHTA 4GOCA 4WJQA 4HLEA 1S1QB 4NJ7A 3CSTA 4GIVA 2ZPYA 4XZ4A 3X23A 5CTRC 4FJVB 3QIJA 4JQWC 4KDLB 1WE7A 4MEMA 2WX1A 4LDTB 4BKGA 3RULA 4FHJA 2KC2A 2REXA 1XQQA 2RSUA 1LQBA 3IFWB 3L10B 4WJPA 3WAPA 4KSLC 3VDZA 3AXCA 4PS7A 5FR6A 1UD7A 4WJOA 1SIFA 1E90A 3JVZX 2C7HA 4BKSA 3PT2B 1J19A 3K9OB 5G2NA 4E74A 4BOZB 5D94A 4AOFA 2KWVB 5CHWA 2K8BA 3ZTDA 4DDID 2FIDA 2XBBC 4DHZB 4W9CA 5LXHA 2C7MB 2N7EA 4DDGD 1GNUA 2L3ZA 1WF9A 1V2YA 4I6NB 2KJ6A 2KTRA 2PEAA 1J0GA 1AARA 2KTFA 1WRDB 4K1RB 2O6VA 3HM3A 2NR2A 4I6PA 1NI2A 3PS6A 4HVBA 2DAJA 1WZ0A 1Y8RC 3PVLA 2PE6B 5DCNA 4LJPB 2IO2B 5C23A 2FCQA 2KDBA 3ZRCA 5D6JB 2ZJDA 3GZNI 3QA8A 1WYWB 1V81A 1ZW7A 2C7NB 4ANWA 5E6PA 2KD0A 4B6WA 2C60A 4RMAA 2G4DB 4K7SA 4N9F4 4GDKA 4BOSC 2M0XA 4FBJB 4MELA 1XT9B 4OVVA 4ANXA 1P1AA 3VUYA 4DHZE 4FJZA 5L83A 2BYVE 2JUOA 4II2B 3VH4B 1YX6B 4IWOA 3R7QA 2M4NA 1NBFC 2MSED 3I3TB 4GSWA 2GBMA 2OOBB 2L8JA 4W9IA 4ZYNA 2DZJA 2KFKB 3D32A 4K7WA 4WWOA 4W9KA 3NY5A 4IW0A 4F7ZA 1WJNA 3LJ3A 3U30A 2MBQA 3R7RA 3PHXB 4TKNA 2PPHA 4NQKE 2KMAA 1E5WA 4JLCA 3K9PB 2KLCA 2KK8A 2L05A 4WQOB 2MX2A 2NPTB 1IPGA 3P2BA 4TV3A 4G3XB 4PS3A 2AL6A 2D2QA 2I1KA 1H4RA 1EO6A 2ZVOA 4NNJB 3SDLC 3W1SA 1IP9A 1WX9A 1ZGUB 2LGDA 1NDDA 2B3AA 4FN2A 3L13A 2AYOB 3WALA 3ZLZA 1G6JA 4AP4C 1C3TA 3KW5B 4EUTA 5BO4B 4MJSA 2RD0A 4IM0A 1OEYA 2UWQA 3PGEA 1RFAA 1ISNA 2G3QB 1H8CA 3N3KB 1WFYA 1WGYA 2L7RA 3OAWA 2FIFA 1Z5SB 5HKHA 2KNBA 2K8CA 2KZRA 3WIMA 4MJSB 4B9KA 1M94A 2O2VB 4G11A 1WXAA 3EFUA 2XEWA 5KHOA 4EKUA 2KLGA 1WX7A 2NBVB 3APFA 1WMHA 2A4ZA 3AU4A 2I1JA 3ZDMC 2IZVB 4ANVA 5CHFA 4HPMB 1F9JA 3KVFB 1RRBA 1E8XA 4HCPB 1KM7A 4K81A 3TIXA 5JHBA 2KVRA 1RLFA 2JZZA 1P98A 1P3QU 3CMMB 1LFDA 3BY4B 3JSVB 3RZWC 3SHQA 1WZ3A 2ASQA 5JZEB 4DXAB 2KWUB 2O6VB 2XK5B 3ML8A 4GXBA 3PRPB 4NJ6A 1T0YA 4WJNA 3ZNHB 3WA0A 4EFOA 3R3MA 2MBEA 2A5UA 1WJUA 1WY8A 2CHXA 2KMCA 2N1VA 3HK0A 1EF1A 4LJOB 3QCAA 5JH5C 1YJ1A 3A9JB 3EHVA 2GBJA 4DK5A 1WIAA 5DPWA 2PJHA 1GC7A 1YX5B 2J0JA 3SD5A 2J7QB 2WX0A 3L16A 3M63B 3H7SA 2LVQA 2CHZA 4ICVA 1KJTA 2PE9A 4KVGB 3ZW3A 4EZJA 3A9JA 3T9LA 3PPAA 2HTHA 3M95A 4BBNF 5AZHA 3MJWA 1OEYJ 2KX0A 4FLHA 3HM6X 3UQBA 4EZLA 3DBSA 2KFKA 2IY1B 2L0TA 2V3SA 2KQSA 2RPQA 2JT4B 1V5OA 3QC8B 4GGQA 2J0KA 2KANA 3VTWA 4BKSD 1QZEA 4MDKE 3L0WB 3H7PA 4AUQC 3PSEB 3RT3B 2BGFA 2GBNA 2BWES 4HDQA 2DZKA 5LXIB 2JXXA 3GOEA 3AULA 4W9JA 3ZUNA 1IYFA 5LLIA 5E6OA 3NOBA 2ZNVC 2M17A 4MGZE 3TJPA 4FJYA 1C1YB 2D11A 5CHVC 2JY6A 3KYCD 3ZIMA 4MGYE 4J6IA 3A9KA 2V1YA 2K25A 3BINA 3RUIB 2L00B 3QX1A 4EOYA 1UGMA 2LD9A 3HIZA 5EDSA 1E8ZA 3JYUA 3KUZA 2ZZPB 2N1WA 4KZ0A 1V49A 2AWTA 3NS8A 3QK0A 1WGGA 4A3PA 1Q5WB 1KLVA 2D10A 2KKCA 2N7DA 3A1QA 2K1FA 2W9NA 3DOWA 3JSVA 5G55A 3S2AA 5J18A 2BKFA 3DVGY 4TUUA 4M0WB 4BVUC 3V6EB 2LRWA 4LCDE 3PZDA 1WXMA 5J2RA 2Z0EB 2MWSB 2LRUA 2RGFA 3VFKA 2KO3A 1R4NI 4ICUA 4IUMB 3DVGX 2JPHA 1KOTA 3LDZE 4HDOA 2IY0B 3UINB 3SU8X 3VVWB 4K7UA 3ALBA 1J8CA 2C9WB 3A4SC 2DZIA 4ZDVA 4M8NA 2MCNB 4M8MA 4ZRJA 4CO7A 3PHWB 3ONSA 4YL8A 2KXJA 3OJ4B 3CF6E 3ZRFA 3TBLD 3X0WA 1WJ6A 2FCSA 3V62A 2BPSA 2R2OA 3Q3JA 5AZGA 1TGZB 4HWIB 3UIOB 3T8MA 3ZO5B 1WGRA 1I35A 2AEHA 3DVNV 2KC1A 2JVCA 2C5LC 3ECIA 3KYDD 3PREA 4KV2A 3TMPB 3H1UA 3MHSD 5DPTA 2K6QA 4ASWC 5L95C 2MW5A 1WR6E 2VRRB 2Z0DB 2KWCA 1XD3B 2Y5BB 2LXCA 2MBOA 3VAWA 3MTNB 3TL5A 3AI5A 2ZNVB 4HK2A 1Q1OA 2WDTB 2OJRA 5IAAC 1CMXB 1I42A 1EF5A 2IO1B 3VH3B 4IM3A 4DBGA 4F8CB 3DCGA 2MP2B 4XC2A 4KDIC 4DHJB 2N4FA 2IYDB 2JRHA 2NPTA 3PRMB 3VQIA 5KHQA 1YIWA 3UIPB 1BT0A 1WXSA 2CHWA 2J0MA 2QHOA 1L2NA 3QARA 2LXAA 3M3JA 3JW0X 3U8ZA 3VTUA 4W9EA 2MQJA 3H7PB 4AWJA 1A5RA 1P0RA 3W1SC 2HD5B 5TR5A 3VUWA 2CU1A 1HE8A 4FADA 3OJ3A 2MBBB 2NBUA 4HXDA 3OLMD 4KSKC 1WH3A 5DPRA 4E3CA 4PYUA 2LVPA 2NBWB 2DX5B 4IG7B 2MA9B 5D2MB 2IO0B 2KTRB 2O2VA 1LM8B 2KQ7A 4EEWA 2CS4A 4KIKA 3PLUA 3N32A 1JRUA 2MRPA 4MSMB 3NHEB 3VTVA 3KH0A 2KOXA 1V9JA 1WMHB 2EKEC 1R4MI 2MLBA 3KUDB 3VUXA 3DBRI 4GMVA 4MGKE 4RM9A 4NPNA 3IBEA 4KIKB 4GB9A 3IG3A 2Z59B 4ANUA 3CSFA 4NY0A 2BKRB 2ZEQA 3NZSA 4I6LB 4G50A 3QAQA 5AZFA 3N30A 5CX3A 4GU2A 1E7UA 2WYQA 3QJZA 3VXWA 1GJZA 1Z2MA 5GMVA 1V86A 1WXVA 1WX8A 3V6CB 4B95A 1SE9A 1E8YA 2AL3A 2JZ3B 3PLVA 3ZKJC 1X1MA 1GC6A 1OTRB 2NCNA 3EC8A 3B08A 4G0NB 1ZKHA 1WGHA 2FNJB 4WWPA 5AEKB 3V61A 2FCMA 4WAAA 4HCNB 2EMSA 1TBEA 1WE6A 2LGYA 2N9EB 2V4LA 2DYMA 1E7VA 1FXTB 5DPSA 1YQBA 2MP2A 3AU5A 3ML9A 1EUVB 2KN5A 4LDTD 3WAOA 1UELA 4FHKA 4AJWA 1V80A 2LZ6A 2R2QA 3QQ8B 3RZFA 3UF8A 2D3GA 3DVNU 4DHJD 4NAWB 4F1SA 3L17A 4E71A 5JHAA 4IWQA 4FA6A 2ZCBA 3M62B 2LJ5A 2BYEA 4JL9A 2IO3B 3ZNGC 5IA7A 4BFRA 1UH6A 2KFJA 3B0AA 4W9HA 4WWNA
chains in the Genus database with same CATH superfamily
1DOYA 1ZXIA 5GXGB 1WM3A 4RM8A 2M1MA 3KQ4A 4BKTA 2DENB 1F77A 1M4VA 3FAHA 3H9DA 4MH0E 1SGHA 2PKOA 2HJ8A 2UYZB 2JX5A 2LWPA 2RR9A 2GB1A 1UWXA 1HZ6A 5D7GA 1D6EC 2K6DB 1TTNA 4YSZB 2VH1A 3PZ7A 3TCAA 3A1QB 2KHWB 4X57B 2DYBA 2O6VD 3RYTA 4EZKA 3ABVB 3AECB 4W9LA 4YTNB 4NQLB 2WDVB 2QC8A 3B2FA 3DBHI 1I4XA 4US8A 2XK5A 2G4SA 4IDIA 2N9LA 3APDA 3A4RA 3C0RB 2LUEA 2WU5B 2YLMA 4OZBA 4GDLA 4YXDB 2ZPNA 2GOWA 2OJWA 2J42A 3PRZA 1L7YA 4KKIA 1K51A 1EU4A 2NVUI 1UBQA 1JWBD 1XCQL 1Y56A 2JRIB 4MGIE 1WM2A 2J53A 3W9CB 2MBHA 1FXIA 4QAYA 3ZDTA 4XWTA 3Q3NC 1QQRA 2BYFA 2WWZA 3DHHC 1OGWA 4RGTA 3OG5A 2LVOA 1WR1A 2DAFA 4WJQA 3IHPC 4GOCA 2PW9A 4FJVB 3QIJA 4JQWC 1XO3A 4C7YA 3Q6BA 1XQQA 3IFWB 3WAPA 3VDZA 3AXCA 1UD7A 1T0SC 3DBLB 3JVZX 3K9OB 5D94A 2KWVB 4DDID 4I6NB 1JWSD 2L3ZA 3AMZA 2O6VA 3HM3A 3MC9A 1Y8RC 3PVLA 1HEZE 1C4PA 2WXRA 1FNVA 2WXMA 3AE2B 3N1XC 4ANWA 1TKEA 5E6PA 2QJLA 2C60A 4RMAA 1C77A 1VJKA 2M0XA 2B76B 2PVOD 1CK1A 4XWWA 4ANXA 4P6VF 5L83A 2UU7A 2V9HA 2MSED 1NBFC 4GSWA 2E3TA 1ZUD2 4ZYNA 1SSNA 4W9KA 3PHXB 2MEKA 4NQKE 2BBCA 2BYTA 4JLCA 2BT6A 4HPPA 3Q8FA 1VR9A 1IPGA 2NPTB 2VH2A 4PS3A 1DGJA 1PGXA 2AL6A 3BYYB 4JX1C 1H4RA 4WQMA 3RFZB 1QOGA 2I38A 2R61A 1R4NB 3L13A 4IKGA 5FK9C 1VRAB 4AP4C 2INCC 5HHDG 2WXQA 3KW5B 1YOVB 4EUTA 3GZNB 1RFAA 1ISNA 2G3QB 4ARCA 2AQ3B 2L7RA 3OAWA 3WIMA 4ACFA 1SE3A 1FEHA 3EFUA 2N7JA 1Q10A 1CZPA 2KLGA 1WMHA 2I1JA 1F9JA 3KVFB 2WXJA 2GRIA 4K81A 2JZZA 5BYQA 4L1BA 3CMMB 2H88B 1LFDA 2INNE 1WZ3A 2ASQA 5JZEB 4DXAB 5I4DA 2XK5B 1T0YA 4WJNA 3NJTA 2MBEA 2AX5A 2A5UA 3HVZA 3GP7A 3EHVA 1I4PA 4DK5A 1GC7A 2J0JA 3SD5A 2J7QB 3L16A 3M63B 3H7SA 2JZPA 2Q5WD 3I63C 3R2TA 3MJWA 4RF0A 2M19A 3DBSA 3SFDB 2KFKA 2L0TA 2V3SA 2J0KA 3VTWA 4OZAA 4AUQC 3V3XA 2GBNA 2DWQA 4HDQA 1PFDA 5LXIB 4W9JA 1IYFA 5LLIA 1EM7A 4PK1A 1C76A 2D11A 5CHVC 1J7AA 2WDQB 4J6IA 3A9KA 5C3JB 2L00B 4EOYA 1E8ZA 3KUZA 2N1WA 3NZ3A 1TZOA 2G1EA 3NS8A 1WGGA 2KKCA 2HJ1A 1N62A 3DOWA 2BKFA 5IP4D 2LRWA 1L4ZB 4B0EA 2KO3A 1K52A 2JPHA 1XCTL 3LDZE 2IY0B 3SU8X 3VVWB 1L0VB 4M8NA 4ZRJA 5HFYA 1I4RA 2NTTA 3CF6E 1SXTA 3TBLD 3X0WA 1WJ6A 5JXVA 3AE4B 2BPSA 2CJNA 2MJEA 3DBHB 1TGZB 1N63A 1TY2A 2KC1A 2JVCA 3ECIA 1J7CA 3B2GA 1PGAA 2GI9A 3P1MA 4M00A 4LNKA 2LXCA 2MBOA 2EELA 2ZNVB 1FM0D 2ON8A 3H8HA 4DBGA 3DCGA 2MP2B 4LNOA 2NPTA 2JRHA 3ZJUA 2CHWA 2J0MA 3FILA 3QARA 1QT9A 3VTUA 1FCCC 4W9EA 3H7PB 1LO5D 2GLSA 1WWTA 3R2IA 5TR5A 3VUWA 3E56A 4IOIE 2CU1A 2MBBB 2JSVX 2MJ3A 4P1CC 3ZXRA 4E3CA 1JQ4A 1L6VA 2DX5B 3W2DA 4WH4A 2IO0B 1K50A 2CS4A 4KIKA 3PLUA 3HRDD 2FUG1 4MSMB 3KH0A 1WMHB 2ONQA 3VUXA 3DBRI 4GMVA 4MGKE 4RM9A 4TSSA 4O1NA 4GB9A 4ANUA 3MHZA 1A70A 2IDYA 1C4CA 1WXVA 1WX8A 3V6CB 4B95A 1E8YA 2AL3A 3P4SB 3ZKJC 4G0NB 1X1MA 1OTRB 1VZ8A 2BB5A 2MJDA 3V61A 2Z8LA 2W54A 2N9EB 1E7VA 3MFGA 1FXTB 2BS2B 2RDGA 2ZW1A 3WAOA 1UGJA 1UELA 4RGMA 5T8IA 5EE9A 4C80A 2CJOA 4DHJD 3L17A 4IWQA 2ZCBA 2LJ5A 3PO0A 1WGKA 1TT5B 1V1PA 2IO3B 4NJCA 2ZW0A 4PS8A 2KFJA 3ZTCA 1XXGA 2DHZA 4CYEA 3ZNZB 5IO9A 3ZNID 4BAXA 3WANA 3UQAA 3NRZA 2KVZA 4DQOC 2LEKA 1WGDA 2FCNA 4TQ1A 3NVZA 4IWPA 4B0MA 3A9KB 4NAMA 2M8SA 1UWMA 1LXDA 4PYZA 1U4AA 2GBRA 2IGGA 2LMCA 2YVCA 1GG3A 4BBNC 2K39A 1TS3A 1WI0A 3PTFC 2WHIA 2BWFA 4MSQB 3WAMA 1RFKA 3ZXVA 2IBIB 1FXAA 1FRDA 3O65B 3FC4A 2KDEB 4IM2A 2L76A 3TSSA 2LI5A 3HHMA 2ZVNA 1V5TA 1WXQA 3ENEA 1MPEA 1KRHA 1T5XD 4MM3A 4AJYB 2CKHB 1QLBB 4HJGE 3U7DA 4KZCA 2JQRB 1I7HA 2L32A 3LYYA 4OVUA 2DZMA 4JGHB 2D07B 1J7BA 2NS5A 4NAWA 2LASA 4S0RA 5BYSA 2KX3A 4RFBA 1HTQA 3U52E 2N9PC 3DQVA 4GDKB 2X8XX 4CHKA 2GMIC 1UBIA 1CJEA 3NG0A 2EMTA 2JF5A 4HKZE 2KQ4X 2L0FA 3J9CA 3V60A 5LNK1 3Q8AA 4FULA 3BVGA 1MG8A 2FUHB 3QHTA 1ET9A 3GE8C 2MHJA 2ZPYA 4ZRPA 1TJEA 2KC2A 2Y5CA 2VZKD 1LQBA 3L10B 4MT5A 2C7HA 4BKSA 4P1BC 5G2NA 2BVCA 3RNCC 2FIDA 1FFVA 2XBBC 4DHZB 1UNSA 2KJ6A 2KAJA 2HDEA 4ARIA 1J0GA 4C56C 1WRDB 2WXKA 1NI2A 2QCZA 1WZ0A 2PE6B 4LJPB 2IO2B 5G5GA 2ZJDA 3BWUD 1ZW7A 4YTPB 5D3DA 1KTKA 4K7SA 1AN8A 3RNFC 3IT4B 4OVVA 1L5PA 1P1AA 3Q3MC 3N1YC 2BYVE 2JUOA 1YX6B 3R7QA 3I3TB 2OOBB 1NI3A 2L8JA 2IPKD 4W9IA 4K7WA 3NY5A 1WJNA 4TKNA 2PPHA 2KMAA 2D3BA 1E5WA 3MC0B 3K9PB 2MX2A 3FKYA 2JU6X 4G3XB 1OFFA 4HROA 1PGBA 4K3BA 3W1SA 1IP9A 1ZGUB 2LGDA 1NDDA 2B3AA 4FN2A 2AYOB 4C4VB 1C3TA 1GOZA 5E6JA 1VZ7A 1JWAD 4P16A 3N3KB 1WGYA 3KWVA 1Z5SB 5HKHA 1M94A 1B1ZA 1P7FA 1MJDA 4G11A 2JWUA 2XEWA 5KHOA 2BTEA 1WX7A 2NBVB 3APFA 1P7EA 1C78A 4ANVA 5CHFA 4HPMB 1RRBA 1E8XA 4HCPB 1KM7A 3TIXA 5JHBA 1RLFA 2RPVA 1JCKB 1P3QU 2WLBA 3JSVB 3RZWC 3SHQA 3IXSA 2KWUB 3ML8A 2W3RA 4GXBA 3PRPB 3ZNHB 3WA0A 1NYRA 1XEEA 2N1VA 4LJOB 1EF1A 1YJ1A 3A9JB 4AQ7A 2PJHA 1YX5B 1F52A 2ACZB 3U7ZA 1WYGA 4N59A 2LVQA 3B9JA 1AW7A 1KJTA 2IJ0A 2PE9A 4KVGB 4EZJA 5IN7A 3T9LA 3PPAA 2HTHA 3M95A 1OEYJ 2WXHA 3UQBA 5EE3A 2IY1B 1E10A 2KQSA 1I4GA 1V5OA 3I5JC 1UUPA 1QZEA 4S17A 1FNWA 2WXGA 1V1OA 3PSEB 1IBXB 1ENFA 2BS4B 2BWES 2ICIA 3P63A 2ZNVC 4MGZE 1C1YB 4UDUC 3RNBC 1IGDA 2JY6A 2CU3A 2V1YA 2K25A 1ZE3D 2K22A 3BINA 3RUIB 5EDSA 2PTLA 1T6BX 1YJJA 1V49A 2SAKA 1Q5WB 1KLVA 2N7DA 4EE2A 2BQQA 2XNAC 5G55A 4JWSC 3S2AA 5C2TB 4BVUC 3V6EB 1K53A 4LCDE 3PZDA 1WXMA 5J2RA 2MWSB 1SEBD 2LRUA 2RGFA 2YEPF 4HDOA 3UINB 4K7UA 1PYWD 3ALBA 4CO7A 1T0RC 3ONSA 4YL8A 4OW0A 3OJ4B 3DHGC 2L52A 3ZRFA 3URYA 1VDVA 3P4PB 2LFIA 5AZGA 3UIOB 3ZO5B 1I35A 4REZA 1FIQA 2N9KA 5L95C 2Z0DB 2PVGC 1XD3B 2Y5BB 1C79A 3MTNB 3ZJVA 3RMKC 3R8BA 1CMXB 2IO1B 3IT6B 3VH3B 4USAA 1NEKB 2IYDB 4RH6A 1YIWA 5AUIA 3UIPB 1BT0A 2FE8A 4LNFA 5MPOA 3M3JA 3JW0X 3AE5B 1FRRA 4LLGM 1P0RA 2HD5B 2WXPA 1TKGA 4KSKC 2LVPA 2NBWB 3MJ5A 1E0ZA 2MA9B 1MI0A 2KTRB 4MH8A 1E6EB 3VTVA 2KOXA 1V9JA 3LXFA 5BMGA 4M0WA 4KIKB 2LGIA 3IG3A 3CSFA 2K0PA 2ZEQA 1F0ZA 3NZSA 4I6LB 4G50A 3QAQA 5AZFA 1STEA 5IOIA 2FBWB 3QJZA 3VR8B 1Z2MA 5GMVA 2WNMA 3PLVA 1YQ3B 2NCNA 1EWYC 1WGHA 3RNEC 4HCNB 2J52A 1YQ4B 2V4LA 2MP2A 3ML9A 4LDTD 1ACCA 5FKAC 4AJWA 4YSXB 1DYQA 3V05A 1NYQA 1N6ZA 3RZFA 2D3GA 3DVNU 3DWMA 4E71A 4FA6A 4TMAB 2K9XA 4JL9A 4BFRA 4WWNA 1RM6C 3EECA 2D3CA 1IBXA 1D3ZA 3W1YA 1XLNA 3RCZA 2GBKA 1T3QA 2LGXA 2OHFA 1YD8U 3NZUA 1ZDVA 3R66C 2KT7A 1V6EA 3RD2A 2KJRA 3EUB2 2BW2A 2JYTA 1XLQA 3KUCB 1MHXA 1Q0WB 3Q8CA 4JIOU 3VHTC 4N58A 3VRAB 2KJHB 1LGRA 1GUAB 3Q3FA 2DYOA 3LB8C 2HTME 4W9FA 1S3SG 2QSDA 3UGBB 1TZ1A 1JMLA 4ZRIA 4WURA 1JRPA 3RPFC 1VD2A 1WJ4A 3ZVVA 4IC7B 3IVFA 3O13A 3RN9C 1V1PB 2FAZA 1RAXA 1FPYA 4YT0B 5H8YE 3W5UB 4PT5A 1R4MB 2QEJC 2ZCCA 3APCA 3AE8B 2KDFB 2LHDA 4XX5A 4OVZA 2J4XA 4DWFA 4W9DA 3L54A 4II3B 1MFWA 3TEZA 1B9RA 2MH7A 3X23A 4KDLB 1WE7A 4LDTB 4BKGA 3T3NA 4A90A 3P4RB 3ETRA 4PS7A 5FR6A 4A9AA 1RYJA 3AE3B 1E90A 3NVYA 1J19A 4E74A 4BOZB 1SIJA 2K8BA 3ZTDA 4W9CA 2C7MB 2AQ2B 1GNUA 1D5ZC 1V2YA 2KTRA 4NZLB 2KTFA 4L2YA 4K1RB 1PDXA 2NR2A 4I6PA 3ZGZA 3PS6A 4HVBA 2DAJA 2PMVA 5C23A 4RCOA 3N20C 3QA8A 3E9SA 2C7NB 4KKJA 2RDBC 4B6WA 2E6XA 2G4DB 4N9F4 4GDKA 4HEA1 4FBJB 4MELA 1XT9B 4DHZE 2M4NA 2K5PA 2GBMA 4AS1A 2KFKB 1ZDXA 4WWOA 3RNGC 3LJ3A 1FFUA 3R7RA 4WQOB 3P2BA 1L0YB 2V3NA 4K3CA 2D2QA 2ZVOA 4NNJB 1TIFA 3AE1B 3SFEB 3ZLZA 1G6JA 1YMHE 4MJSA 4IM0A 2UWQA 1MHHE 3PGEA 3ZYYX 1WFYA 2FIFA 2WXNA 2KNBA 2K8CA 2KZRA 5HG2A 4RNAA 4B9KA 4LNIA 3BVZA 2BS3B 1N60A 1SE4A 3U2SC 4EKUA 4JWUC 5BYRA 2A4ZA 3AU4A 1I4HA 3ZDMC 2PLPA 2KVRA 2IGDA 5IKCM 1ZPSA 1P98A 3T3OA 2SEBD 4OHJA 3DHIC 2O6VB 1KLGD 4NJ6A 2WQYB 1WJUA 1DOXA 1JROA 5DPWA 3KWLA 2WX0A 2EKIA 1QOBA 1QILA 2CHZA 4ICVA 3A9JA 3MP9A 2V0GA 3RI7C 2KX0A 3P42A 4FLHA 4C4VA 3U4EG 4EZLA 3QC8B 1TS4A 2RPQA 2M56B 4BKSD 4MDKE 3L0WB 3H7PA 4WAFA 1GB1A 4KGRA 3RT3B 2DZKA 2JXXA 1NENB 1T0QC 3EA6A 3AULA 5E6OA 2M17A 3TJPA 4FJYA 1HTOA 2QDFA 3KYCD 3AM9A 1F1HA 4DXGA 1UGMA 3HIZA 1AWDA 3AE7B 2AWTA 2W9NA 3JSVA 3N1ZC 5J18A 3IAM1 4J3OD 1HQRD 1L4DB 3L4PA 1VLBA 2XN9C 2DNFA 1IUEA 4IUMB 1R4NI 3DVGX 1N5WA 1KOTA 2C9WB 3A4SC 2DZIA 4ZDVA 3KLSX 3TUOA 2IGHA 3PHWB 2KXJA 1GPXA 3AE6B 2WS3B 2FCSA 2LJIA 3V62A 1UH6A 3Q3OC 3Q3JA 4C00A 3T8MA 2KWDA 1WGRA 3AEBB 4KV2A 3ZQ4A 3H1UA 5DPTA 2K3UA 2K6QA 2LHEA 2W82A 2L83A 2BB6A 2NMQA 1WR6E 2VRRB 2QMTA 1ZP0B 3VAWA 4CQNA 3EFCA 3TL5A 4HK2A 1Q1OA 2WDTB 1MG4A 1XLPA 5G5HA 4KDIC 4DHJB 2N4FA 3PRMB 3VQIA 5KHQA 1WXSA 2QHOA 4FXCA 2LXAA 3ZJTA 2L1AA 5D3IB 2MQJA 5H92C 4AWJA 1A5RA 1SB3C 1D5MC 1KF6B 1RWSA 1HE8A 3OJ3A 2NBUA 1JWUD 5DPRA 4PYUA 5D2MB 2INDC 1YNTE 1LM8B 3N32A 1JRUA 1F2RC 2QILA 4MACA 1KFYB 5EE1A 3C8YA 4HKQA 1VZ6A 2Z59B 2BKRB 1UF0A 2V4IB 4C7ZA 3N30A 4GU2A 2KMMA 2WYQA 3VXWA 1V86A 3AE9B 2JZ3B 5IA7A 4WWPA 3B08A 5AEKB 2FNJB 2EMSA 4KX6B 1NVID 1TBEA 1BXTA 4M02A 2DYMA 1YQBA 1YN5A 3AU5A 1EUVB 2KN5A 2Y5PA 3NVVA 3UI3A 4FHKA 1V80A 4F1SA 5JHAA 5AUKA 3M62B 3ZNGC 3BZDB 2PIAA 3I57A 4W9HA 3Q69A 4ZRKA 1KH0A 3B1LX 3DPDA 4HJKA 3AEAB 1PQSA 2AQ1B 1ET6A 1E8WA 4ZYSA 2Y3AA 1FO4A 1P9DU 3EGRA 2TSSA 3BK1A 5J17A 3N9YC 5BMHA 4N6EB 3DDCB 4YSYB 3C19A 3Q14C 3L08A 5C1ZA 3QWZB 3DBLI 4GN1A 4A3OA 1SBBB 1N61A 4GDLB 4M01A 2K8HA 2G45B 4URKA 2HE7A 4DXFA 1XLOA 2JWZA 4P7IA 1UZXB 2BF8B 3H6NA 1SJHD 1K8RB 1VCBA 2N9XA 3A33B 3GS2A 4W9GA 3NUHB 1BUIC 1OQYA 2KDIA 5E6NA 4TQ0A 2DLBA 3PV1A 1EU3A 4HPLB 1FNUA 4A20A 2NTSA 4A6QA 3PZ8A 2WXOA 2CR5A 4HLEA 1JALA 1S1QB 2KYWA 3BVMA 4NJ7A 4KGTA 3CSTA 4GIVA 4XZ4A 2LUMA 5CTRC 2KN4A 4MEMA 2WX1A 2N0SB 3RULA 4FHJA 3BYTB 2REXA 2RSUA 1D4BA 3DWGC 4WJPA 4KSLC 4WJOA 1SIFA 3VRBB 3PT2B 3AB5A 4AOFA 5CHWA 4H2AA 5LXHA 4DDGD 2N7EA 1YN3A 2INPE 1WF9A 4RGOS 1PUTA 4ZHOA 2PEAA 3WCQA 1AARA 2RDHA 2W3SA 1QKZA 3GB1A 5DCNA 1SE2A 5EE0A 2KACA 1C9FA 3ZRCA 2FCQA 1TYGB 2KDBA 3Q8EA 5D6JB 4LK0M 3GZNI 1WYWB 1V81A 2DBYA 2KD0A 4BOSC 1IGCA 1OQRA 5FR3A 2JYEA 3VUYA 4FJZA 1BMLC 3NVWA 4II2B 3VH4B 4IWOA 2X38A 2DZJA 4XDDA 3D32A 4IW0A 4YTMB 4F7ZA 3U30A 2MBQA 1I4QA 1V8CA 3MC8A 2KLCA 1QOFA 2KK8A 2L05A 4TV3A 1ZOYB 2I1KA 1EO6A 2V3PA 3SDLC 1WX9A 2YEPB 2VZKB 3WALA 1HA5A 1YJIA 5BO4B 2RD0A 1OEYA 2WGSA 1H8CA 1WRIA 5TSSA 4MJSB 3HVDA 1ROEA 2O2VB 1HZ5A 1WXAA 3Q8BA 1HXYD 1R7SA 2I2YA 2IZVB 4JE3B 2M0AA 2KDMA 2JXTA 4GLSC 4ZRQA 3TEXA 1AYFA 4XGAB 2WP9B 2WXFA 3BY4B 1SF0A 2H89B 1TS5A 2G9HD 4EFOA 3R3MA 1WY8A 1D5XC 2CHXA 2KMCA 3HK0A 3QCAA 5JH5C 4ZOHC 2GBJA 1WIAA 4L23A 3TEYA 3AV8A 1XF5L 4RF1A 3ZW3A 1GB4A 2QIEB 3AN1A 4BBNF 5AZHA 3HM6X 2WU2B 4ITKA 4OZCA 4XDCA 4R3DA 2JT4B 4GGQA 2KANA 1ESFA 2BGFA 3GOEA 3ZUNA 3NOBA 3ZIMA 4MGYE 1ZXHA 1DOIA 3QX1A 2LD9A 1CQVA 3JYUA 2ZZPB 3FILB 4KZ0A 3QK0A 4LTUA 4A3PA 2D10A 3A1QA 2K1FA 1TKYA 3DVGY 1TS2A 4TUUA 4M0WB 4WWMA 2Z0EB 4Q2JA 3VFKA 4ICUA 2RMMA 1J8CA 1FD6A 3DBRB 4D2KA 3HUIA 2MCNB 4M8MA 4HRSA 1KLUD 3SEBA 3AEFB 4XE0A 2W55A 2R2OA 4XYCA 2D5GA 4HWIB 4WIPA 3CWIA 3I9V1 5HI1A 3TEWA 3Q2AC 2AEHA 3DVNV 2C5LC 3KYDD 3PREA 3TMPB 4JPSA 3MHSD 3P4QB 4KGSA 4ASWC 1MVKA 1TY0A 2MW5A 3BK2A 2KWCA 4RGNA 4A8XC 3AI5A 2OJRA 5IAAC 1I42A 3OWEB 1EF5A 4IM3A 4F8CB 4XC2A 1YN4A 4BZAA 1QOAA 2D3AA 3GE3C 1L2NA 3U8ZA 1V97A 4A55A 5BMIA 3W1SC 3RNAC 4FADA 4HXDA 1FCLA 3OLMD 1WH3A 1GAQB 4IG7B 2OEDA 2WDRB 2O2VA 1QF6A 2KQ7A 4EEWA 1JWMD 2LGSA 2MRPA 3NHEB 2WXIA 4ZHPA 3SR6A 1JW9D 3AEEB 2EKEC 1R4MI 2MLBA 3KUDB 4NPNA 3IBEA 4NY0A 3AEDB 2WXLA 3AEGB 1L0XB 5CX3A 3VR9B 1E7UA 1GJZA 1OQQA 1SE9A 1SJED 1GC6A 3EC8A 1F2RI 1ZKHA 3W5VB 4YWGG 2FCMA 4WAAA 1WE6A 2LGYA 1FMAD 4MM3B 5DPSA 4US9A 2LZ6A 2R2QA 3IAS1 3QQ8B 3UF8A 1C4AA 4NAWB 3NS1A 4LNNA 1E9MA 1E7PB 1L6UA 1N5XA 1WSPA 1EWCA 2BYEA 3AH7A 3BIID 3CIRB 3B0AA
chains in the Genus database with same CATH topology
2DHZA 4ZRKA 3B1LX 4CYEA 3DPDA 3EECA 1WM3A 4HJKA 3ZNZB 3ZNID 4RM8A 1PQSA 2M1MA 4PS8A 1D3ZA 3WANA 3W1YA 3ZTCA 1E8WA 3UQAA 4BKTA 3RCZA 2GBKA 1P9DU 2LGXA 1WGDA 2DENB 2FCNA 4TQ1A 3H9DA 4IWPA 4MH0E 5J17A 1YD8U 3A9KB 1SGHA 3NZUA 2M8SA 2HJ8A 2UYZB 3R66C 2LWPA 2RR9A 1LXDA 1V6EA 3RD2A 3DDCB 4PYZA 5D7GA 1U4AA 2GBRA 2K6DB 2KJRA 3L08A 5C1ZA 1TTNA 2YVCA 1GG3A 3QWZB 3TCAA 4BBNC 2K39A 1WI0A 3DBLI 3KUCB 4GN1A 4A3OA 3PTFC 3A1QB 2KHWB 2BWFA 4MSQB 4X57B 3WAMA 2DYBA 2O6VD 3RYTA 1Q0WB 4EZKA 2IBIB 4W9LA 4NQLB 3O65B 4JIOU 2KDEB 4IM2A 2L76A 4GDLB 3VHTC 3DBHI 2LI5A 2KJHB 3HHMA 2ZVNA 1GUAB 1V5TA 2K8HA 3Q3FA 2XK5A 2G4SA 2G45B 4URKA 2DYOA 3ENEA 2HE7A 3APDA 3A4RA 3C0RB 2LUEA 2YLMA 2JWZA 4P7IA 1UZXB 2BF8B 4MM3A 4GDLA 4AJYB 3H6NA 2CKHB 4W9FA 1S3SG 3UGBB 1K8RB 1VCBA 2ZPNA 3U7DA 2N9XA 1TZ1A 3A33B 4KZCA 2GOWA 3PRZA 4ZRIA 4OVUA 4W9GA 1L7YA 2DZMA 2NVUI 1VD2A 4JGHB 1UBQA 2D07B 1WJ4A 2NS5A 4NAWA 2LASA 3ZVVA 4IC7B 3IVFA 1OQYA 2KX3A 2KDIA 2JRIB 2FAZA 4MGIE 1WM2A 1RAXA 2N9PC 3DQVA 2MBHA 5E6NA 4GDKB 3ZDTA 4TQ0A 2ZCCA 4CHKA 2GMIC 1UBIA 3APCA 3PV1A 2KDFB 2EMTA 2JF5A 2BYFA 4HPLB 2L0FA 4XX5A 2WWZA 4DWFA 1OGWA 4A20A 3V60A 4W9DA 3L54A 4II3B 4FULA 2LVOA 2CR5A 1MG8A 1WR1A 2DAFA 2FUHB 3IHPC 3QHTA 4GOCA 4WJQA 4HLEA 1S1QB 4NJ7A 3CSTA 4GIVA 2ZPYA 4XZ4A 3X23A 5CTRC 4FJVB 3QIJA 4JQWC 4KDLB 1WE7A 4MEMA 2WX1A 4LDTB 4BKGA 3RULA 4FHJA 2KC2A 2REXA 1XQQA 2RSUA 1LQBA 3IFWB 3L10B 4WJPA 3WAPA 4KSLC 3VDZA 3AXCA 4PS7A 5FR6A 1UD7A 4WJOA 1SIFA 1E90A 3JVZX 2C7HA 4BKSA 3PT2B 1J19A 3K9OB 5G2NA 4E74A 4BOZB 5D94A 4AOFA 2KWVB 5CHWA 2K8BA 3ZTDA 4DDID 2FIDA 2XBBC 4DHZB 4W9CA 5LXHA 2C7MB 2N7EA 4DDGD 1GNUA 2L3ZA 1WF9A 1V2YA 4I6NB 2KJ6A 2KTRA 2PEAA 1J0GA 1AARA 2KTFA 1WRDB 4K1RB 2O6VA 3HM3A 2NR2A 4I6PA 1NI2A 3PS6A 4HVBA 2DAJA 1WZ0A 1Y8RC 3PVLA 2PE6B 5DCNA 4LJPB 2IO2B 5C23A 2FCQA 2KDBA 3ZRCA 5D6JB 2ZJDA 3GZNI 3QA8A 1WYWB 1V81A 1ZW7A 2C7NB 4ANWA 5E6PA 2KD0A 4B6WA 2C60A 4RMAA 2G4DB 4K7SA 4N9F4 4GDKA 4BOSC 2M0XA 4FBJB 4MELA 1XT9B 4OVVA 4ANXA 1P1AA 3VUYA 4DHZE 4FJZA 5L83A 2BYVE 2JUOA 4II2B 3VH4B 1YX6B 4IWOA 3R7QA 2M4NA 1NBFC 2MSED 3I3TB 4GSWA 2GBMA 2OOBB 2L8JA 4W9IA 4ZYNA 2DZJA 2KFKB 3D32A 4K7WA 4WWOA 4W9KA 3NY5A 4IW0A 4F7ZA 1WJNA 3LJ3A 3U30A 2MBQA 3R7RA 3PHXB 4TKNA 2PPHA 4NQKE 2KMAA 1E5WA 4JLCA 3K9PB 2KLCA 2KK8A 2L05A 4WQOB 2MX2A 2NPTB 1IPGA 3P2BA 4TV3A 4G3XB 4PS3A 2AL6A 2D2QA 2I1KA 1H4RA 1EO6A 2ZVOA 4NNJB 3SDLC 3W1SA 1IP9A 1WX9A 1ZGUB 2LGDA 1NDDA 2B3AA 4FN2A 3L13A 2AYOB 3WALA 3ZLZA 1G6JA 4AP4C 1C3TA 3KW5B 4EUTA 5BO4B 4MJSA 2RD0A 4IM0A 1OEYA 2UWQA 3PGEA 1RFAA 1ISNA 2G3QB 1H8CA 3N3KB 1WFYA 1WGYA 2L7RA 3OAWA 2FIFA 1Z5SB 5HKHA 2KNBA 2K8CA 2KZRA 3WIMA 4MJSB 4B9KA 1M94A 2O2VB 4G11A 1WXAA 3EFUA 2XEWA 5KHOA 4EKUA 2KLGA 1WX7A 2NBVB 3APFA 1WMHA 2A4ZA 3AU4A 2I1JA 3ZDMC 2IZVB 4ANVA 5CHFA 4HPMB 1F9JA 3KVFB 1RRBA 1E8XA 4HCPB 1KM7A 4K81A 3TIXA 5JHBA 2KVRA 1RLFA 2JZZA 1P98A 1P3QU 3CMMB 1LFDA 3BY4B 3JSVB 3RZWC 3SHQA 1WZ3A 2ASQA 5JZEB 4DXAB 2KWUB 2O6VB 2XK5B 3ML8A 4GXBA 3PRPB 4NJ6A 1T0YA 4WJNA 3ZNHB 3WA0A 4EFOA 3R3MA 2MBEA 2A5UA 1WJUA 1WY8A 2CHXA 2KMCA 2N1VA 3HK0A 1EF1A 4LJOB 3QCAA 5JH5C 1YJ1A 3A9JB 3EHVA 2GBJA 4DK5A 1WIAA 5DPWA 2PJHA 1GC7A 1YX5B 2J0JA 3SD5A 2J7QB 2WX0A 3L16A 3M63B 3H7SA 2LVQA 2CHZA 4ICVA 1KJTA 2PE9A 4KVGB 3ZW3A 4EZJA 3A9JA 3T9LA 3PPAA 2HTHA 3M95A 4BBNF 5AZHA 3MJWA 1OEYJ 2KX0A 4FLHA 3HM6X 3UQBA 4EZLA 3DBSA 2KFKA 2IY1B 2L0TA 2V3SA 2KQSA 2RPQA 2JT4B 1V5OA 3QC8B 4GGQA 2J0KA 2KANA 3VTWA 4BKSD 1QZEA 4MDKE 3L0WB 3H7PA 4AUQC 3PSEB 3RT3B 2BGFA 2GBNA 2BWES 4HDQA 2DZKA 5LXIB 2JXXA 3GOEA 3AULA 4W9JA 3ZUNA 1IYFA 5LLIA 5E6OA 3NOBA 2ZNVC 2M17A 4MGZE 3TJPA 4FJYA 1C1YB 2D11A 5CHVC 2JY6A 3KYCD 3ZIMA 4MGYE 4J6IA 3A9KA 2V1YA 2K25A 3BINA 3RUIB 2L00B 3QX1A 4EOYA 1UGMA 2LD9A 3HIZA 5EDSA 1E8ZA 3JYUA 3KUZA 2ZZPB 2N1WA 4KZ0A 1V49A 2AWTA 3NS8A 3QK0A 1WGGA 4A3PA 1Q5WB 1KLVA 2D10A 2KKCA 2N7DA 3A1QA 2K1FA 2W9NA 3DOWA 3JSVA 5G55A 3S2AA 5J18A 2BKFA 3DVGY 4TUUA 4M0WB 4BVUC 3V6EB 2LRWA 4LCDE 3PZDA 1WXMA 5J2RA 2Z0EB 2MWSB 2LRUA 2RGFA 3VFKA 2KO3A 1R4NI 4ICUA 4IUMB 3DVGX 2JPHA 1KOTA 3LDZE 4HDOA 2IY0B 3UINB 3SU8X 3VVWB 4K7UA 3ALBA 1J8CA 2C9WB 3A4SC 2DZIA 4ZDVA 4M8NA 2MCNB 4M8MA 4ZRJA 4CO7A 3PHWB 3ONSA 4YL8A 2KXJA 3OJ4B 3CF6E 3ZRFA 3TBLD 3X0WA 1WJ6A 2FCSA 3V62A 2BPSA 2R2OA 3Q3JA 5AZGA 1TGZB 4HWIB 3UIOB 3T8MA 3ZO5B 1WGRA 1I35A 2AEHA 3DVNV 2KC1A 2JVCA 2C5LC 3ECIA 3KYDD 3PREA 4KV2A 3TMPB 3H1UA 3MHSD 5DPTA 2K6QA 4ASWC 5L95C 2MW5A 1WR6E 2VRRB 2Z0DB 2KWCA 1XD3B 2Y5BB 2LXCA 2MBOA 3VAWA 3MTNB 3TL5A 3AI5A 2ZNVB 4HK2A 1Q1OA 2WDTB 2OJRA 5IAAC 1CMXB 1I42A 1EF5A 2IO1B 3VH3B 4IM3A 4DBGA 4F8CB 3DCGA 2MP2B 4XC2A 4KDIC 4DHJB 2N4FA 2IYDB 2JRHA 2NPTA 3PRMB 3VQIA 5KHQA 1YIWA 3UIPB 1BT0A 1WXSA 2CHWA 2J0MA 2QHOA 1L2NA 3QARA 2LXAA 3M3JA 3JW0X 3U8ZA 3VTUA 4W9EA 2MQJA 3H7PB 4AWJA 1A5RA 1P0RA 3W1SC 2HD5B 5TR5A 3VUWA 2CU1A 1HE8A 4FADA 3OJ3A 2MBBB 2NBUA 4HXDA 3OLMD 4KSKC 1WH3A 5DPRA 4E3CA 4PYUA 2LVPA 2NBWB 2DX5B 4IG7B 2MA9B 5D2MB 2IO0B 2KTRB 2O2VA 1LM8B 2KQ7A 4EEWA 2CS4A 4KIKA 3PLUA 3N32A 1JRUA 2MRPA 4MSMB 3NHEB 3VTVA 3KH0A 2KOXA 1V9JA 1WMHB 2EKEC 1R4MI 2MLBA 3KUDB 3VUXA 3DBRI 4GMVA 4MGKE 4RM9A 4NPNA 3IBEA 4KIKB 4GB9A 3IG3A 2Z59B 4ANUA 3CSFA 4NY0A 2BKRB 2ZEQA 3NZSA 4I6LB 4G50A 3QAQA 5AZFA 3N30A 5CX3A 4GU2A 1E7UA 2WYQA 3QJZA 3VXWA 1GJZA 1Z2MA 5GMVA 1V86A 1WXVA 1WX8A 3V6CB 4B95A 1SE9A 1E8YA 2AL3A 2JZ3B 3PLVA 3ZKJC 1X1MA 1GC6A 1OTRB 2NCNA 3EC8A 3B08A 4G0NB 1ZKHA 1WGHA 2FNJB 4WWPA 5AEKB 3V61A 2FCMA 4WAAA 4HCNB 2EMSA 1TBEA 1WE6A 2LGYA 2N9EB 2V4LA 2DYMA 1E7VA 1FXTB 5DPSA 1YQBA 2MP2A 3AU5A 3ML9A 1EUVB 2KN5A 4LDTD 3WAOA 1UELA 4FHKA 4AJWA 1V80A 2LZ6A 2R2QA 3QQ8B 3RZFA 3UF8A 2D3GA 3DVNU 4DHJD 4NAWB 4F1SA 3L17A 4E71A 5JHAA 4IWQA 4FA6A 2ZCBA 3M62B 2LJ5A 2BYEA 4JL9A 2IO3B 3ZNGC 5IA7A 4BFRA 1UH6A 2KFJA 3B0AA 4W9HA 4WWNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DHZ A;  4ZRK A;  3B1L X;  4CYE A;  3DPD A;  3EEC A;  1WM3 A;  4HJK A;  3ZNZ B;  3ZNI D;  4RM8 A;  1PQS A;  2M1M A;  4PS8 A;  1D3Z A;  3WAN A;  3W1Y A;  3ZTC A;  1E8W A;  3UQA A;  4BKT A;  3RCZ A;  2GBK A;  1P9D U;  2LGX A;  1WGD A;  2DEN B;  2FCN A;  4TQ1 A;  3H9D A;  4IWP A;  4MH0 E;  5J17 A;  1YD8 U;  3A9K B;  1SGH A;  3NZU A;  2M8S A;  2HJ8 A;  2UYZ B;  3R66 C;  2LWP A;  2RR9 A;  1LXD A;  1V6E A;  3RD2 A;  3DDC B;  4PYZ A;  5D7G A;  1U4A A;  2GBR A;  2K6D B;  2KJR A;  3L08 A;  5C1Z A;  1TTN A;  2YVC A;  1GG3 A;  3QWZ B;  3TCA A;  4BBN C;  2K39 A;  1WI0 A;  3DBL I;  3KUC B;  4GN1 A;  4A3O A;  3PTF C;  3A1Q B;  2KHW B;  2BWF A;  4MSQ B;  4X57 B;  3WAM A;  2DYB A;  2O6V D;  3RYT A;  1Q0W B;  4EZK A;  2IBI B;  4W9L A;  4NQL B;  3O65 B;  4JIO U;  2KDE B;  4IM2 A;  2L76 A;  4GDL B;  3VHT C;  3DBH I;  2LI5 A;  2KJH B;  3HHM A;  2ZVN A;  1GUA B;  1V5T A;  2K8H A;  3Q3F A;  2XK5 A;  2G4S A;  2G45 B;  4URK A;  2DYO A;  3ENE A;  2HE7 A;  3APD A;  3A4R A;  3C0R B;  2LUE A;  2YLM A;  2JWZ A;  4P7I A;  1UZX B;  2BF8 B;  4MM3 A;  4GDL A;  4AJY B;  3H6N A;  2CKH B;  4W9F A;  1S3S G;  3UGB B;  1K8R B;  1VCB A;  2ZPN A;  3U7D A;  2N9X A;  1TZ1 A;  3A33 B;  4KZC A;  2GOW A;  3PRZ A;  4ZRI A;  4OVU A;  4W9G A;  1L7Y A;  2DZM A;  2NVU I;  1VD2 A;  4JGH B;  1UBQ A;  2D07 B;  1WJ4 A;  2NS5 A;  4NAW A;  2LAS A;  3ZVV A;  4IC7 B;  3IVF A;  1OQY A;  2KX3 A;  2KDI A;  2JRI B;  2FAZ A;  4MGI E;  1WM2 A;  1RAX A;  2N9P C;  3DQV A;  2MBH A;  5E6N A;  4GDK B;  3ZDT A;  4TQ0 A;  2ZCC A;  4CHK A;  2GMI C;  1UBI A;  3APC A;  3PV1 A;  2KDF B;  2EMT A;  2JF5 A;  2BYF A;  4HPL B;  2L0F A;  4XX5 A;  2WWZ A;  4DWF A;  1OGW A;  4A20 A;  3V60 A;  4W9D A;  3L54 A;  4II3 B;  4FUL A;  2LVO A;  2CR5 A;  1MG8 A;  1WR1 A;  2DAF A;  2FUH B;  3IHP C;  3QHT A;  4GOC A;  4WJQ A;  4HLE A;  1S1Q B;  4NJ7 A;  3CST A;  4GIV A;  2ZPY A;  4XZ4 A;  3X23 A;  5CTR C;  4FJV B;  3QIJ A;  4JQW C;  4KDL B;  1WE7 A;  4MEM A;  2WX1 A;  4LDT B;  4BKG A;  3RUL A;  4FHJ A;  2KC2 A;  2REX A;  1XQQ A;  2RSU A;  1LQB A;  3IFW B;  3L10 B;  4WJP A;  3WAP A;  4KSL C;  3VDZ A;  3AXC A;  4PS7 A;  5FR6 A;  1UD7 A;  4WJO A;  1SIF A;  1E90 A;  3JVZ X;  2C7H A;  4BKS A;  3PT2 B;  1J19 A;  3K9O B;  5G2N A;  4E74 A;  4BOZ B;  5D94 A;  4AOF A;  2KWV B;  5CHW A;  2K8B A;  3ZTD A;  4DDI D;  2FID A;  2XBB C;  4DHZ B;  4W9C A;  5LXH A;  2C7M B;  2N7E A;  4DDG D;  1GNU A;  2L3Z A;  1WF9 A;  1V2Y A;  4I6N B;  2KJ6 A;  2KTR A;  2PEA A;  1J0G A;  1AAR A;  2KTF A;  1WRD B;  4K1R B;  2O6V A;  3HM3 A;  2NR2 A;  4I6P A;  1NI2 A;  3PS6 A;  4HVB A;  2DAJ A;  1WZ0 A;  1Y8R C;  3PVL A;  2PE6 B;  5DCN A;  4LJP B;  2IO2 B;  5C23 A;  2FCQ A;  2KDB A;  3ZRC A;  5D6J B;  2ZJD A;  3GZN I;  3QA8 A;  1WYW B;  1V81 A;  1ZW7 A;  2C7N B;  4ANW A;  5E6P A;  2KD0 A;  4B6W A;  2C60 A;  4RMA A;  2G4D B;  4K7S A;  4N9F 4;  4GDK A;  4BOS C;  2M0X A;  4FBJ B;  4MEL A;  1XT9 B;  4OVV A;  4ANX A;  1P1A A;  3VUY A;  4DHZ E;  4FJZ A;  5L83 A;  2BYV E;  2JUO A;  4II2 B;  3VH4 B;  1YX6 B;  4IWO A;  3R7Q A;  2M4N A;  1NBF C;  2MSE D;  3I3T B;  4GSW A;  2GBM A;  2OOB B;  2L8J A;  4W9I A;  4ZYN A;  2DZJ A;  2KFK B;  3D32 A;  4K7W A;  4WWO A;  4W9K A;  3NY5 A;  4IW0 A;  4F7Z A;  1WJN A;  3LJ3 A;  3U30 A;  2MBQ A;  3R7R A;  3PHX B;  4TKN A;  2PPH A;  4NQK E;  2KMA A;  1E5W A;  4JLC A;  3K9P B;  2KLC A;  2KK8 A;  2L05 A;  4WQO B;  2MX2 A;  2NPT B;  1IPG A;  3P2B A;  4TV3 A;  4G3X B;  4PS3 A;  2AL6 A;  2D2Q A;  2I1K A;  1H4R A;  1EO6 A;  2ZVO A;  4NNJ B;  3SDL C;  3W1S A;  1IP9 A;  1WX9 A;  1ZGU B;  2LGD A;  1NDD A;  2B3A A;  4FN2 A;  3L13 A;  2AYO B;  3WAL A;  3ZLZ A;  1G6J A;  4AP4 C;  1C3T A;  3KW5 B;  4EUT A;  5BO4 B;  4MJS A;  2RD0 A;  4IM0 A;  1OEY A;  2UWQ A;  3PGE A;  1RFA A;  1ISN A;  2G3Q B;  1H8C A;  3N3K B;  1WFY A;  1WGY A;  2L7R A;  3OAW A;  2FIF A;  1Z5S B;  5HKH A;  2KNB A;  2K8C A;  2KZR A;  3WIM A;  4MJS B;  4B9K A;  1M94 A;  2O2V B;  4G11 A;  1WXA A;  3EFU A;  2XEW A;  5KHO A;  4EKU A;  2KLG A;  1WX7 A;  2NBV B;  3APF A;  1WMH A;  2A4Z A;  3AU4 A;  2I1J A;  3ZDM C;  2IZV B;  4ANV A;  5CHF A;  4HPM B;  1F9J A;  3KVF B;  1RRB A;  1E8X A;  4HCP B;  1KM7 A;  4K81 A;  3TIX A;  5JHB A;  2KVR A;  1RLF A;  2JZZ A;  1P98 A;  1P3Q U;  3CMM B;  1LFD A;  3BY4 B;  3JSV B;  3RZW C;  3SHQ A;  1WZ3 A;  2ASQ A;  5JZE B;  4DXA B;  2KWU B;  2O6V B;  2XK5 B;  3ML8 A;  4GXB A;  3PRP B;  4NJ6 A;  1T0Y A;  4WJN A;  3ZNH B;  3WA0 A;  4EFO A;  3R3M A;  2MBE A;  2A5U A;  1WJU A;  1WY8 A;  2CHX A;  2KMC A;  2N1V A;  3HK0 A;  1EF1 A;  4LJO B;  3QCA A;  5JH5 C;  1YJ1 A;  3A9J B;  3EHV A;  2GBJ A;  4DK5 A;  1WIA A;  5DPW A;  2PJH A;  1GC7 A;  1YX5 B;  2J0J A;  3SD5 A;  2J7Q B;  2WX0 A;  3L16 A;  3M63 B;  3H7S A;  2LVQ A;  2CHZ A;  4ICV A;  1KJT A;  2PE9 A;  4KVG B;  3ZW3 A;  4EZJ A;  3A9J A;  3T9L A;  3PPA A;  2HTH A;  3M95 A;  4BBN F;  5AZH A;  3MJW A;  1OEY J;  2KX0 A;  4FLH A;  3HM6 X;  3UQB A;  4EZL A;  3DBS A;  2KFK A;  2IY1 B;  2L0T A;  2V3S A;  2KQS A;  2RPQ A;  2JT4 B;  1V5O A;  3QC8 B;  4GGQ A;  2J0K A;  2KAN A;  3VTW A;  4BKS D;  1QZE A;  4MDK E;  3L0W B;  3H7P A;  4AUQ C;  3PSE B;  3RT3 B;  2BGF A;  2GBN A;  2BWE S;  4HDQ A;  2DZK A;  5LXI B;  2JXX A;  3GOE A;  3AUL A;  4W9J A;  3ZUN A;  1IYF A;  5LLI A;  5E6O A;  3NOB A;  2ZNV C;  2M17 A;  4MGZ E;  3TJP A;  4FJY A;  1C1Y B;  2D11 A;  5CHV C;  2JY6 A;  3KYC D;  3ZIM A;  4MGY E;  4J6I A;  3A9K A;  2V1Y A;  2K25 A;  3BIN A;  3RUI B;  2L00 B;  3QX1 A;  4EOY A;  1UGM A;  2LD9 A;  3HIZ A;  5EDS A;  1E8Z A;  3JYU A;  3KUZ A;  2ZZP B;  2N1W A;  4KZ0 A;  1V49 A;  2AWT A;  3NS8 A;  3QK0 A;  1WGG A;  4A3P A;  1Q5W B;  1KLV A;  2D10 A;  2KKC A;  2N7D A;  3A1Q A;  2K1F A;  2W9N A;  3DOW A;  3JSV A;  5G55 A;  3S2A A;  5J18 A;  2BKF A;  3DVG Y;  4TUU A;  4M0W B;  4BVU C;  3V6E B;  2LRW A;  4LCD E;  3PZD A;  1WXM A;  5J2R A;  2Z0E B;  2MWS B;  2LRU A;  2RGF A;  3VFK A;  2KO3 A;  1R4N I;  4ICU A;  4IUM B;  3DVG X;  2JPH A;  1KOT A;  3LDZ E;  4HDO A;  2IY0 B;  3UIN B;  3SU8 X;  3VVW B;  4K7U A;  3ALB A;  1J8C A;  2C9W B;  3A4S C;  2DZI A;  4ZDV A;  4M8N A;  2MCN B;  4M8M A;  4ZRJ A;  4CO7 A;  3PHW B;  3ONS A;  4YL8 A;  2KXJ A;  3OJ4 B;  3CF6 E;  3ZRF A;  3TBL D;  3X0W A;  1WJ6 A;  2FCS A;  3V62 A;  2BPS A;  2R2O A;  3Q3J A;  5AZG A;  1TGZ B;  4HWI B;  3UIO B;  3T8M A;  3ZO5 B;  1WGR A;  1I35 A;  2AEH A;  3DVN V;  2KC1 A;  2JVC A;  2C5L C;  3ECI A;  3KYD D;  3PRE A;  4KV2 A;  3TMP B;  3H1U A;  3MHS D;  5DPT A;  2K6Q A;  4ASW C;  5L95 C;  2MW5 A;  1WR6 E;  2VRR B;  2Z0D B;  2KWC A;  1XD3 B;  2Y5B B;  2LXC A;  2MBO A;  3VAW A;  3MTN B;  3TL5 A;  3AI5 A;  2ZNV B;  4HK2 A;  1Q1O A;  2WDT B;  2OJR A;  5IAA C;  1CMX B;  1I42 A;  1EF5 A;  2IO1 B;  3VH3 B;  4IM3 A;  4DBG A;  4F8C B;  3DCG A;  2MP2 B;  4XC2 A;  4KDI C;  4DHJ B;  2N4F A;  2IYD B;  2JRH A;  2NPT A;  3PRM B;  3VQI A;  5KHQ A;  1YIW A;  3UIP B;  1BT0 A;  1WXS A;  2CHW A;  2J0M A;  2QHO A;  1L2N A;  3QAR A;  2LXA A;  3M3J A;  3JW0 X;  3U8Z A;  3VTU A;  4W9E A;  2MQJ A;  3H7P B;  4AWJ A;  1A5R A;  1P0R A;  3W1S C;  2HD5 B;  5TR5 A;  3VUW A;  2CU1 A;  1HE8 A;  4FAD A;  3OJ3 A;  2MBB B;  2NBU A;  4HXD A;  3OLM D;  4KSK C;  1WH3 A;  5DPR A;  4E3C A;  4PYU A;  2LVP A;  2NBW B;  2DX5 B;  4IG7 B;  2MA9 B;  5D2M B;  2IO0 B;  2KTR B;  2O2V A;  1LM8 B;  2KQ7 A;  4EEW A;  2CS4 A;  4KIK A;  3PLU A;  3N32 A;  1JRU A;  2MRP A;  4MSM B;  3NHE B;  3VTV A;  3KH0 A;  2KOX A;  1V9J A;  1WMH B;  2EKE C;  1R4M I;  2MLB A;  3KUD B;  3VUX A;  3DBR I;  4GMV A;  4MGK E;  4RM9 A;  4NPN A;  3IBE A;  4KIK B;  4GB9 A;  3IG3 A;  2Z59 B;  4ANU A;  3CSF A;  4NY0 A;  2BKR B;  2ZEQ A;  3NZS A;  4I6L B;  4G50 A;  3QAQ A;  5AZF A;  3N30 A;  5CX3 A;  4GU2 A;  1E7U A;  2WYQ A;  3QJZ A;  3VXW A;  1GJZ A;  1Z2M A;  5GMV A;  1V86 A;  1WXV A;  1WX8 A;  3V6C B;  4B95 A;  1SE9 A;  1E8Y A;  2AL3 A;  2JZ3 B;  3PLV A;  3ZKJ C;  1X1M A;  1GC6 A;  1OTR B;  2NCN A;  3EC8 A;  3B08 A;  4G0N B;  1ZKH A;  1WGH A;  2FNJ B;  4WWP A;  5AEK B;  3V61 A;  2FCM A;  4WAA A;  4HCN B;  2EMS A;  1TBE A;  1WE6 A;  2LGY A;  2N9E B;  2V4L A;  2DYM A;  1E7V A;  1FXT B;  5DPS A;  1YQB A;  2MP2 A;  3AU5 A;  3ML9 A;  1EUV B;  2KN5 A;  4LDT D;  3WAO A;  1UEL A;  4FHK A;  4AJW A;  1V80 A;  2LZ6 A;  2R2Q A;  3QQ8 B;  3RZF A;  3UF8 A;  2D3G A;  3DVN U;  4DHJ D;  4NAW B;  4F1S A;  3L17 A;  4E71 A;  5JHA A;  4IWQ A;  4FA6 A;  2ZCB A;  3M62 B;  2LJ5 A;  2BYE A;  4JL9 A;  2IO3 B;  3ZNG C;  5IA7 A;  4BFR A;  1UH6 A;  2KFJ A;  3B0A A;  4W9H A;  4WWN A; 
#chains in the Genus database with same CATH topology
 1DOY A;  1ZXI A;  5GXG B;  1WM3 A;  4RM8 A;  2M1M A;  3KQ4 A;  4BKT A;  2DEN B;  1F77 A;  1M4V A;  3FAH A;  3H9D A;  4MH0 E;  1SGH A;  2PKO A;  2HJ8 A;  2UYZ B;  2JX5 A;  2LWP A;  2RR9 A;  2GB1 A;  1UWX A;  1HZ6 A;  5D7G A;  1D6E C;  2K6D B;  1TTN A;  4YSZ B;  2VH1 A;  3PZ7 A;  3TCA A;  3A1Q B;  2KHW B;  4X57 B;  2DYB A;  2O6V D;  3RYT A;  4EZK A;  3ABV B;  3AEC B;  4W9L A;  4YTN B;  4NQL B;  2WDV B;  2QC8 A;  3B2F A;  3DBH I;  1I4X A;  4US8 A;  2XK5 A;  2G4S A;  4IDI A;  2N9L A;  3APD A;  3A4R A;  3C0R B;  2LUE A;  2WU5 B;  2YLM A;  4OZB A;  4GDL A;  4YXD B;  2ZPN A;  2GOW A;  2OJW A;  2J42 A;  3PRZ A;  1L7Y A;  4KKI A;  1K51 A;  1EU4 A;  2NVU I;  1UBQ A;  1JWB D;  1XCQ L;  1Y56 A;  2JRI B;  4MGI E;  1WM2 A;  2J53 A;  3W9C B;  2MBH A;  1FXI A;  4QAY A;  3ZDT A;  4XWT A;  3Q3N C;  1QQR A;  2BYF A;  2WWZ A;  3DHH C;  1OGW A;  4RGT A;  3OG5 A;  2LVO A;  1WR1 A;  2DAF A;  4WJQ A;  3IHP C;  4GOC A;  2PW9 A;  4FJV B;  3QIJ A;  4JQW C;  1XO3 A;  4C7Y A;  3Q6B A;  1XQQ A;  3IFW B;  3WAP A;  3VDZ A;  3AXC A;  1UD7 A;  1T0S C;  3DBL B;  3JVZ X;  3K9O B;  5D94 A;  2KWV B;  4DDI D;  4I6N B;  1JWS D;  2L3Z A;  3AMZ A;  2O6V A;  3HM3 A;  3MC9 A;  1Y8R C;  3PVL A;  1HEZ E;  1C4P A;  2WXR A;  1FNV A;  2WXM A;  3AE2 B;  3N1X C;  4ANW A;  1TKE A;  5E6P A;  2QJL A;  2C60 A;  4RMA A;  1C77 A;  1VJK A;  2M0X A;  2B76 B;  2PVO D;  1CK1 A;  4XWW A;  4ANX A;  4P6V F;  5L83 A;  2UU7 A;  2V9H A;  2MSE D;  1NBF C;  4GSW A;  2E3T A;  1ZUD 2;  4ZYN A;  1SSN A;  4W9K A;  3PHX B;  2MEK A;  4NQK E;  2BBC A;  2BYT A;  4JLC A;  2BT6 A;  4HPP A;  3Q8F A;  1VR9 A;  1IPG A;  2NPT B;  2VH2 A;  4PS3 A;  1DGJ A;  1PGX A;  2AL6 A;  3BYY B;  4JX1 C;  1H4R A;  4WQM A;  3RFZ B;  1QOG A;  2I38 A;  2R61 A;  1R4N B;  3L13 A;  4IKG A;  5FK9 C;  1VRA B;  4AP4 C;  2INC C;  5HHD G;  2WXQ A;  3KW5 B;  1YOV B;  4EUT A;  3GZN B;  1RFA A;  1ISN A;  2G3Q B;  4ARC A;  2AQ3 B;  2L7R A;  3OAW A;  3WIM A;  4ACF A;  1SE3 A;  1FEH A;  3EFU A;  2N7J A;  1Q10 A;  1CZP A;  2KLG A;  1WMH A;  2I1J A;  1F9J A;  3KVF B;  2WXJ A;  2GRI A;  4K81 A;  2JZZ A;  5BYQ A;  4L1B A;  3CMM B;  2H88 B;  1LFD A;  2INN E;  1WZ3 A;  2ASQ A;  5JZE B;  4DXA B;  5I4D A;  2XK5 B;  1T0Y A;  4WJN A;  3NJT A;  2MBE A;  2AX5 A;  2A5U A;  3HVZ A;  3GP7 A;  3EHV A;  1I4P A;  4DK5 A;  1GC7 A;  2J0J A;  3SD5 A;  2J7Q B;  3L16 A;  3M63 B;  3H7S A;  2JZP A;  2Q5W D;  3I63 C;  3R2T A;  3MJW A;  4RF0 A;  2M19 A;  3DBS A;  3SFD B;  2KFK A;  2L0T A;  2V3S A;  2J0K A;  3VTW A;  4OZA A;  4AUQ C;  3V3X A;  2GBN A;  2DWQ A;  4HDQ A;  1PFD A;  5LXI B;  4W9J A;  1IYF A;  5LLI A;  1EM7 A;  4PK1 A;  1C76 A;  2D11 A;  5CHV C;  1J7A A;  2WDQ B;  4J6I A;  3A9K A;  5C3J B;  2L00 B;  4EOY A;  1E8Z A;  3KUZ A;  2N1W A;  3NZ3 A;  1TZO A;  2G1E A;  3NS8 A;  1WGG A;  2KKC A;  2HJ1 A;  1N62 A;  3DOW A;  2BKF A;  5IP4 D;  2LRW A;  1L4Z B;  4B0E A;  2KO3 A;  1K52 A;  2JPH A;  1XCT L;  3LDZ E;  2IY0 B;  3SU8 X;  3VVW B;  1L0V B;  4M8N A;  4ZRJ A;  5HFY A;  1I4R A;  2NTT A;  3CF6 E;  1SXT A;  3TBL D;  3X0W A;  1WJ6 A;  5JXV A;  3AE4 B;  2BPS A;  2CJN A;  2MJE A;  3DBH B;  1TGZ B;  1N63 A;  1TY2 A;  2KC1 A;  2JVC A;  3ECI A;  1J7C A;  3B2G A;  1PGA A;  2GI9 A;  3P1M A;  4M00 A;  4LNK A;  2LXC A;  2MBO A;  2EEL A;  2ZNV B;  1FM0 D;  2ON8 A;  3H8H A;  4DBG A;  3DCG A;  2MP2 B;  4LNO A;  2NPT A;  2JRH A;  3ZJU A;  2CHW A;  2J0M A;  3FIL A;  3QAR A;  1QT9 A;  3VTU A;  1FCC C;  4W9E A;  3H7P B;  1LO5 D;  2GLS A;  1WWT A;  3R2I A;  5TR5 A;  3VUW A;  3E56 A;  4IOI E;  2CU1 A;  2MBB B;  2JSV X;  2MJ3 A;  4P1C C;  3ZXR A;  4E3C A;  1JQ4 A;  1L6V A;  2DX5 B;  3W2D A;  4WH4 A;  2IO0 B;  1K50 A;  2CS4 A;  4KIK A;  3PLU A;  3HRD D;  2FUG 1;  4MSM B;  3KH0 A;  1WMH B;  2ONQ A;  3VUX A;  3DBR I;  4GMV A;  4MGK E;  4RM9 A;  4TSS A;  4O1N A;  4GB9 A;  4ANU A;  3MHZ A;  1A70 A;  2IDY A;  1C4C A;  1WXV A;  1WX8 A;  3V6C B;  4B95 A;  1E8Y A;  2AL3 A;  3P4S B;  3ZKJ C;  4G0N B;  1X1M A;  1OTR B;  1VZ8 A;  2BB5 A;  2MJD A;  3V61 A;  2Z8L A;  2W54 A;  2N9E B;  1E7V A;  3MFG A;  1FXT B;  2BS2 B;  2RDG A;  2ZW1 A;  3WAO A;  1UGJ A;  1UEL A;  4RGM A;  5T8I A;  5EE9 A;  4C80 A;  2CJO A;  4DHJ D;  3L17 A;  4IWQ A;  2ZCB A;  2LJ5 A;  3PO0 A;  1WGK A;  1TT5 B;  1V1P A;  2IO3 B;  4NJC A;  2ZW0 A;  4PS8 A;  2KFJ A;  3ZTC A;  1XXG A;  2DHZ A;  4CYE A;  3ZNZ B;  5IO9 A;  3ZNI D;  4BAX A;  3WAN A;  3UQA A;  3NRZ A;  2KVZ A;  4DQO C;  2LEK A;  1WGD A;  2FCN A;  4TQ1 A;  3NVZ A;  4IWP A;  4B0M A;  3A9K B;  4NAM A;  2M8S A;  1UWM A;  1LXD A;  4PYZ A;  1U4A A;  2GBR A;  2IGG A;  2LMC A;  2YVC A;  1GG3 A;  4BBN C;  2K39 A;  1TS3 A;  1WI0 A;  3PTF C;  2WHI A;  2BWF A;  4MSQ B;  3WAM A;  1RFK A;  3ZXV A;  2IBI B;  1FXA A;  1FRD A;  3O65 B;  3FC4 A;  2KDE B;  4IM2 A;  2L76 A;  3TSS A;  2LI5 A;  3HHM A;  2ZVN A;  1V5T A;  1WXQ A;  3ENE A;  1MPE A;  1KRH A;  1T5X D;  4MM3 A;  4AJY B;  2CKH B;  1QLB B;  4HJG E;  3U7D A;  4KZC A;  2JQR B;  1I7H A;  2L32 A;  3LYY A;  4OVU A;  2DZM A;  4JGH B;  2D07 B;  1J7B A;  2NS5 A;  4NAW A;  2LAS A;  4S0R A;  5BYS A;  2KX3 A;  4RFB A;  1HTQ A;  3U52 E;  2N9P C;  3DQV A;  4GDK B;  2X8X X;  4CHK A;  2GMI C;  1UBI A;  1CJE A;  3NG0 A;  2EMT A;  2JF5 A;  4HKZ E;  2KQ4 X;  2L0F A;  3J9C A;  3V60 A;  5LNK 1;  3Q8A A;  4FUL A;  3BVG A;  1MG8 A;  2FUH B;  3QHT A;  1ET9 A;  3GE8 C;  2MHJ A;  2ZPY A;  4ZRP A;  1TJE A;  2KC2 A;  2Y5C A;  2VZK D;  1LQB A;  3L10 B;  4MT5 A;  2C7H A;  4BKS A;  4P1B C;  5G2N A;  2BVC A;  3RNC C;  2FID A;  1FFV A;  2XBB C;  4DHZ B;  1UNS A;  2KJ6 A;  2KAJ A;  2HDE A;  4ARI A;  1J0G A;  4C56 C;  1WRD B;  2WXK A;  1NI2 A;  2QCZ A;  1WZ0 A;  2PE6 B;  4LJP B;  2IO2 B;  5G5G A;  2ZJD A;  3BWU D;  1ZW7 A;  4YTP B;  5D3D A;  1KTK A;  4K7S A;  1AN8 A;  3RNF C;  3IT4 B;  4OVV A;  1L5P A;  1P1A A;  3Q3M C;  3N1Y C;  2BYV E;  2JUO A;  1YX6 B;  3R7Q A;  3I3T B;  2OOB B;  1NI3 A;  2L8J A;  2IPK D;  4W9I A;  4K7W A;  3NY5 A;  1WJN A;  4TKN A;  2PPH A;  2KMA A;  2D3B A;  1E5W A;  3MC0 B;  3K9P B;  2MX2 A;  3FKY A;  2JU6 X;  4G3X B;  1OFF A;  4HRO A;  1PGB A;  4K3B A;  3W1S A;  1IP9 A;  1ZGU B;  2LGD A;  1NDD A;  2B3A A;  4FN2 A;  2AYO B;  4C4V B;  1C3T A;  1GOZ A;  5E6J A;  1VZ7 A;  1JWA D;  4P16 A;  3N3K B;  1WGY A;  3KWV A;  1Z5S B;  5HKH A;  1M94 A;  1B1Z A;  1P7F A;  1MJD A;  4G11 A;  2JWU A;  2XEW A;  5KHO A;  2BTE A;  1WX7 A;  2NBV B;  3APF A;  1P7E A;  1C78 A;  4ANV A;  5CHF A;  4HPM B;  1RRB A;  1E8X A;  4HCP B;  1KM7 A;  3TIX A;  5JHB A;  1RLF A;  2RPV A;  1JCK B;  1P3Q U;  2WLB A;  3JSV B;  3RZW C;  3SHQ A;  3IXS A;  2KWU B;  3ML8 A;  2W3R A;  4GXB A;  3PRP B;  3ZNH B;  3WA0 A;  1NYR A;  1XEE A;  2N1V A;  4LJO B;  1EF1 A;  1YJ1 A;  3A9J B;  4AQ7 A;  2PJH A;  1YX5 B;  1F52 A;  2ACZ B;  3U7Z A;  1WYG A;  4N59 A;  2LVQ A;  3B9J A;  1AW7 A;  1KJT A;  2IJ0 A;  2PE9 A;  4KVG B;  4EZJ A;  5IN7 A;  3T9L A;  3PPA A;  2HTH A;  3M95 A;  1OEY J;  2WXH A;  3UQB A;  5EE3 A;  2IY1 B;  1E10 A;  2KQS A;  1I4G A;  1V5O A;  3I5J C;  1UUP A;  1QZE A;  4S17 A;  1FNW A;  2WXG A;  1V1O A;  3PSE B;  1IBX B;  1ENF A;  2BS4 B;  2BWE S;  2ICI A;  3P63 A;  2ZNV C;  4MGZ E;  1C1Y B;  4UDU C;  3RNB C;  1IGD A;  2JY6 A;  2CU3 A;  2V1Y A;  2K25 A;  1ZE3 D;  2K22 A;  3BIN A;  3RUI B;  5EDS A;  2PTL A;  1T6B X;  1YJJ A;  1V49 A;  2SAK A;  1Q5W B;  1KLV A;  2N7D A;  4EE2 A;  2BQQ A;  2XNA C;  5G55 A;  4JWS C;  3S2A A;  5C2T B;  4BVU C;  3V6E B;  1K53 A;  4LCD E;  3PZD A;  1WXM A;  5J2R A;  2MWS B;  1SEB D;  2LRU A;  2RGF A;  2YEP F;  4HDO A;  3UIN B;  4K7U A;  1PYW D;  3ALB A;  4CO7 A;  1T0R C;  3ONS A;  4YL8 A;  4OW0 A;  3OJ4 B;  3DHG C;  2L52 A;  3ZRF A;  3URY A;  1VDV A;  3P4P B;  2LFI A;  5AZG A;  3UIO B;  3ZO5 B;  1I35 A;  4REZ A;  1FIQ A;  2N9K A;  5L95 C;  2Z0D B;  2PVG C;  1XD3 B;  2Y5B B;  1C79 A;  3MTN B;  3ZJV A;  3RMK C;  3R8B A;  1CMX B;  2IO1 B;  3IT6 B;  3VH3 B;  4USA A;  1NEK B;  2IYD B;  4RH6 A;  1YIW A;  5AUI A;  3UIP B;  1BT0 A;  2FE8 A;  4LNF A;  5MPO A;  3M3J A;  3JW0 X;  3AE5 B;  1FRR A;  4LLG M;  1P0R A;  2HD5 B;  2WXP A;  1TKG A;  4KSK C;  2LVP A;  2NBW B;  3MJ5 A;  1E0Z A;  2MA9 B;  1MI0 A;  2KTR B;  4MH8 A;  1E6E B;  3VTV A;  2KOX A;  1V9J A;  3LXF A;  5BMG A;  4M0W A;  4KIK B;  2LGI A;  3IG3 A;  3CSF A;  2K0P A;  2ZEQ A;  1F0Z A;  3NZS A;  4I6L B;  4G50 A;  3QAQ A;  5AZF A;  1STE A;  5IOI A;  2FBW B;  3QJZ A;  3VR8 B;  1Z2M A;  5GMV A;  2WNM A;  3PLV A;  1YQ3 B;  2NCN A;  1EWY C;  1WGH A;  3RNE C;  4HCN B;  2J52 A;  1YQ4 B;  2V4L A;  2MP2 A;  3ML9 A;  4LDT D;  1ACC A;  5FKA C;  4AJW A;  4YSX B;  1DYQ A;  3V05 A;  1NYQ A;  1N6Z A;  3RZF A;  2D3G A;  3DVN U;  3DWM A;  4E71 A;  4FA6 A;  4TMA B;  2K9X A;  4JL9 A;  4BFR A;  4WWN A;  1RM6 C;  3EEC A;  2D3C A;  1IBX A;  1D3Z A;  3W1Y A;  1XLN A;  3RCZ A;  2GBK A;  1T3Q A;  2LGX A;  2OHF A;  1YD8 U;  3NZU A;  1ZDV A;  3R66 C;  2KT7 A;  1V6E A;  3RD2 A;  2KJR A;  3EUB 2;  2BW2 A;  2JYT A;  1XLQ A;  3KUC B;  1MHX A;  1Q0W B;  3Q8C A;  4JIO U;  3VHT C;  4N58 A;  3VRA B;  2KJH B;  1LGR A;  1GUA B;  3Q3F A;  2DYO A;  3LB8 C;  2HTM E;  4W9F A;  1S3S G;  2QSD A;  3UGB B;  1TZ1 A;  1JML A;  4ZRI A;  4WUR A;  1JRP A;  3RPF C;  1VD2 A;  1WJ4 A;  3ZVV A;  4IC7 B;  3IVF A;  3O13 A;  3RN9 C;  1V1P B;  2FAZ A;  1RAX A;  1FPY A;  4YT0 B;  5H8Y E;  3W5U B;  4PT5 A;  1R4M B;  2QEJ C;  2ZCC A;  3APC A;  3AE8 B;  2KDF B;  2LHD A;  4XX5 A;  4OVZ A;  2J4X A;  4DWF A;  4W9D A;  3L54 A;  4II3 B;  1MFW A;  3TEZ A;  1B9R A;  2MH7 A;  3X23 A;  4KDL B;  1WE7 A;  4LDT B;  4BKG A;  3T3N A;  4A90 A;  3P4R B;  3ETR A;  4PS7 A;  5FR6 A;  4A9A A;  1RYJ A;  3AE3 B;  1E90 A;  3NVY A;  1J19 A;  4E74 A;  4BOZ B;  1SIJ A;  2K8B A;  3ZTD A;  4W9C A;  2C7M B;  2AQ2 B;  1GNU A;  1D5Z C;  1V2Y A;  2KTR A;  4NZL B;  2KTF A;  4L2Y A;  4K1R B;  1PDX A;  2NR2 A;  4I6P A;  3ZGZ A;  3PS6 A;  4HVB A;  2DAJ A;  2PMV A;  5C23 A;  4RCO A;  3N20 C;  3QA8 A;  3E9S A;  2C7N B;  4KKJ A;  2RDB C;  4B6W A;  2E6X A;  2G4D B;  4N9F 4;  4GDK A;  4HEA 1;  4FBJ B;  4MEL A;  1XT9 B;  4DHZ E;  2M4N A;  2K5P A;  2GBM A;  4AS1 A;  2KFK B;  1ZDX A;  4WWO A;  3RNG C;  3LJ3 A;  1FFU A;  3R7R A;  4WQO B;  3P2B A;  1L0Y B;  2V3N A;  4K3C A;  2D2Q A;  2ZVO A;  4NNJ B;  1TIF A;  3AE1 B;  3SFE B;  3ZLZ A;  1G6J A;  1YMH E;  4MJS A;  4IM0 A;  2UWQ A;  1MHH E;  3PGE A;  3ZYY X;  1WFY A;  2FIF A;  2WXN A;  2KNB A;  2K8C A;  2KZR A;  5HG2 A;  4RNA A;  4B9K A;  4LNI A;  3BVZ A;  2BS3 B;  1N60 A;  1SE4 A;  3U2S C;  4EKU A;  4JWU C;  5BYR A;  2A4Z A;  3AU4 A;  1I4H A;  3ZDM C;  2PLP A;  2KVR A;  2IGD A;  5IKC M;  1ZPS A;  1P98 A;  3T3O A;  2SEB D;  4OHJ A;  3DHI C;  2O6V B;  1KLG D;  4NJ6 A;  2WQY B;  1WJU A;  1DOX A;  1JRO A;  5DPW A;  3KWL A;  2WX0 A;  2EKI A;  1QOB A;  1QIL A;  2CHZ A;  4ICV A;  3A9J A;  3MP9 A;  2V0G A;  3RI7 C;  2KX0 A;  3P42 A;  4FLH A;  4C4V A;  3U4E G;  4EZL A;  3QC8 B;  1TS4 A;  2RPQ A;  2M56 B;  4BKS D;  4MDK E;  3L0W B;  3H7P A;  4WAF A;  1GB1 A;  4KGR A;  3RT3 B;  2DZK A;  2JXX A;  1NEN B;  1T0Q C;  3EA6 A;  3AUL A;  5E6O A;  2M17 A;  3TJP A;  4FJY A;  1HTO A;  2QDF A;  3KYC D;  3AM9 A;  1F1H A;  4DXG A;  1UGM A;  3HIZ A;  1AWD A;  3AE7 B;  2AWT A;  2W9N A;  3JSV A;  3N1Z C;  5J18 A;  3IAM 1;  4J3O D;  1HQR D;  1L4D B;  3L4P A;  1VLB A;  2XN9 C;  2DNF A;  1IUE A;  4IUM B;  1R4N I;  3DVG X;  1N5W A;  1KOT A;  2C9W B;  3A4S C;  2DZI A;  4ZDV A;  3KLS X;  3TUO A;  2IGH A;  3PHW B;  2KXJ A;  1GPX A;  3AE6 B;  2WS3 B;  2FCS A;  2LJI A;  3V62 A;  1UH6 A;  3Q3O C;  3Q3J A;  4C00 A;  3T8M A;  2KWD A;  1WGR A;  3AEB B;  4KV2 A;  3ZQ4 A;  3H1U A;  5DPT A;  2K3U A;  2K6Q A;  2LHE A;  2W82 A;  2L83 A;  2BB6 A;  2NMQ A;  1WR6 E;  2VRR B;  2QMT A;  1ZP0 B;  3VAW A;  4CQN A;  3EFC A;  3TL5 A;  4HK2 A;  1Q1O A;  2WDT B;  1MG4 A;  1XLP A;  5G5H A;  4KDI C;  4DHJ B;  2N4F A;  3PRM B;  3VQI A;  5KHQ A;  1WXS A;  2QHO A;  4FXC A;  2LXA A;  3ZJT A;  2L1A A;  5D3I B;  2MQJ A;  5H92 C;  4AWJ A;  1A5R A;  1SB3 C;  1D5M C;  1KF6 B;  1RWS A;  1HE8 A;  3OJ3 A;  2NBU A;  1JWU D;  5DPR A;  4PYU A;  5D2M B;  2IND C;  1YNT E;  1LM8 B;  3N32 A;  1JRU A;  1F2R C;  2QIL A;  4MAC A;  1KFY B;  5EE1 A;  3C8Y A;  4HKQ A;  1VZ6 A;  2Z59 B;  2BKR B;  1UF0 A;  2V4I B;  4C7Z A;  3N30 A;  4GU2 A;  2KMM A;  2WYQ A;  3VXW A;  1V86 A;  3AE9 B;  2JZ3 B;  5IA7 A;  4WWP A;  3B08 A;  5AEK B;  2FNJ B;  2EMS A;  4KX6 B;  1NVI D;  1TBE A;  1BXT A;  4M02 A;  2DYM A;  1YQB A;  1YN5 A;  3AU5 A;  1EUV B;  2KN5 A;  2Y5P A;  3NVV A;  3UI3 A;  4FHK A;  1V80 A;  4F1S A;  5JHA A;  5AUK A;  3M62 B;  3ZNG C;  3BZD B;  2PIA A;  3I57 A;  4W9H A;  3Q69 A;  4ZRK A;  1KH0 A;  3B1L X;  3DPD A;  4HJK A;  3AEA B;  1PQS A;  2AQ1 B;  1ET6 A;  1E8W A;  4ZYS A;  2Y3A A;  1FO4 A;  1P9D U;  3EGR A;  2TSS A;  3BK1 A;  5J17 A;  3N9Y C;  5BMH A;  4N6E B;  3DDC B;  4YSY B;  3C19 A;  3Q14 C;  3L08 A;  5C1Z A;  3QWZ B;  3DBL I;  4GN1 A;  4A3O A;  1SBB B;  1N61 A;  4GDL B;  4M01 A;  2K8H A;  2G45 B;  4URK A;  2HE7 A;  4DXF A;  1XLO A;  2JWZ A;  4P7I A;  1UZX B;  2BF8 B;  3H6N A;  1SJH D;  1K8R B;  1VCB A;  2N9X A;  3A33 B;  3GS2 A;  4W9G A;  3NUH B;  1BUI C;  1OQY A;  2KDI A;  5E6N A;  4TQ0 A;  2DLB A;  3PV1 A;  1EU3 A;  4HPL B;  1FNU A;  4A20 A;  2NTS A;  4A6Q A;  3PZ8 A;  2WXO A;  2CR5 A;  4HLE A;  1JAL A;  1S1Q B;  2KYW A;  3BVM A;  4NJ7 A;  4KGT A;  3CST A;  4GIV A;  4XZ4 A;  2LUM A;  5CTR C;  2KN4 A;  4MEM A;  2WX1 A;  2N0S B;  3RUL A;  4FHJ A;  3BYT B;  2REX A;  2RSU A;  1D4B A;  3DWG C;  4WJP A;  4KSL C;  4WJO A;  1SIF A;  3VRB B;  3PT2 B;  3AB5 A;  4AOF A;  5CHW A;  4H2A A;  5LXH A;  4DDG D;  2N7E A;  1YN3 A;  2INP E;  1WF9 A;  4RGO S;  1PUT A;  4ZHO A;  2PEA A;  3WCQ A;  1AAR A;  2RDH A;  2W3S A;  1QKZ A;  3GB1 A;  5DCN A;  1SE2 A;  5EE0 A;  2KAC A;  1C9F A;  3ZRC A;  2FCQ A;  1TYG B;  2KDB A;  3Q8E A;  5D6J B;  4LK0 M;  3GZN I;  1WYW B;  1V81 A;  2DBY A;  2KD0 A;  4BOS C;  1IGC A;  1OQR A;  5FR3 A;  2JYE A;  3VUY A;  4FJZ A;  1BML C;  3NVW A;  4II2 B;  3VH4 B;  4IWO A;  2X38 A;  2DZJ A;  4XDD A;  3D32 A;  4IW0 A;  4YTM B;  4F7Z A;  3U30 A;  2MBQ A;  1I4Q A;  1V8C A;  3MC8 A;  2KLC A;  1QOF A;  2KK8 A;  2L05 A;  4TV3 A;  1ZOY B;  2I1K A;  1EO6 A;  2V3P A;  3SDL C;  1WX9 A;  2YEP B;  2VZK B;  3WAL A;  1HA5 A;  1YJI A;  5BO4 B;  2RD0 A;  1OEY A;  2WGS A;  1H8C A;  1WRI A;  5TSS A;  4MJS B;  3HVD A;  1ROE A;  2O2V B;  1HZ5 A;  1WXA A;  3Q8B A;  1HXY D;  1R7S A;  2I2Y A;  2IZV B;  4JE3 B;  2M0A A;  2KDM A;  2JXT A;  4GLS C;  4ZRQ A;  3TEX A;  1AYF A;  4XGA B;  2WP9 B;  2WXF A;  3BY4 B;  1SF0 A;  2H89 B;  1TS5 A;  2G9H D;  4EFO A;  3R3M A;  1WY8 A;  1D5X C;  2CHX A;  2KMC A;  3HK0 A;  3QCA A;  5JH5 C;  4ZOH C;  2GBJ A;  1WIA A;  4L23 A;  3TEY A;  3AV8 A;  1XF5 L;  4RF1 A;  3ZW3 A;  1GB4 A;  2QIE B;  3AN1 A;  4BBN F;  5AZH A;  3HM6 X;  2WU2 B;  4ITK A;  4OZC A;  4XDC A;  4R3D A;  2JT4 B;  4GGQ A;  2KAN A;  1ESF A;  2BGF A;  3GOE A;  3ZUN A;  3NOB A;  3ZIM A;  4MGY E;  1ZXH A;  1DOI A;  3QX1 A;  2LD9 A;  1CQV A;  3JYU A;  2ZZP B;  3FIL B;  4KZ0 A;  3QK0 A;  4LTU A;  4A3P A;  2D10 A;  3A1Q A;  2K1F A;  1TKY A;  3DVG Y;  1TS2 A;  4TUU A;  4M0W B;  4WWM A;  2Z0E B;  4Q2J A;  3VFK A;  4ICU A;  2RMM A;  1J8C A;  1FD6 A;  3DBR B;  4D2K A;  3HUI A;  2MCN B;  4M8M A;  4HRS A;  1KLU D;  3SEB A;  3AEF B;  4XE0 A;  2W55 A;  2R2O A;  4XYC A;  2D5G A;  4HWI B;  4WIP A;  3CWI A;  3I9V 1;  5HI1 A;  3TEW A;  3Q2A C;  2AEH A;  3DVN V;  2C5L C;  3KYD D;  3PRE A;  3TMP B;  4JPS A;  3MHS D;  3P4Q B;  4KGS A;  4ASW C;  1MVK A;  1TY0 A;  2MW5 A;  3BK2 A;  2KWC A;  4RGN A;  4A8X C;  3AI5 A;  2OJR A;  5IAA C;  1I42 A;  3OWE B;  1EF5 A;  4IM3 A;  4F8C B;  4XC2 A;  1YN4 A;  4BZA A;  1QOA A;  2D3A A;  3GE3 C;  1L2N A;  3U8Z A;  1V97 A;  4A55 A;  5BMI A;  3W1S C;  3RNA C;  4FAD A;  4HXD A;  1FCL A;  3OLM D;  1WH3 A;  1GAQ B;  4IG7 B;  2OED A;  2WDR B;  2O2V A;  1QF6 A;  2KQ7 A;  4EEW A;  1JWM D;  2LGS A;  2MRP A;  3NHE B;  2WXI A;  4ZHP A;  3SR6 A;  1JW9 D;  3AEE B;  2EKE C;  1R4M I;  2MLB A;  3KUD B;  4NPN A;  3IBE A;  4NY0 A;  3AED B;  2WXL A;  3AEG B;  1L0X B;  5CX3 A;  3VR9 B;  1E7U A;  1GJZ A;  1OQQ A;  1SE9 A;  1SJE D;  1GC6 A;  3EC8 A;  1F2R I;  1ZKH A;  3W5V B;  4YWG G;  2FCM A;  4WAA A;  1WE6 A;  2LGY A;  1FMA D;  4MM3 B;  5DPS A;  4US9 A;  2LZ6 A;  2R2Q A;  3IAS 1;  3QQ8 B;  3UF8 A;  1C4A A;  4NAW B;  3NS1 A;  4LNN A;  1E9M A;  1E7P B;  1L6U A;  1N5X A;  1WSP A;  1EWC A;  2BYE A;  3AH7 A;  3BII D;  3CIR B;  3B0A A; 
#chains in the Genus database with same CATH homology
 2DHZ A;  4ZRK A;  3B1L X;  4CYE A;  3DPD A;  3EEC A;  1WM3 A;  4HJK A;  3ZNZ B;  3ZNI D;  4RM8 A;  1PQS A;  2M1M A;  4PS8 A;  1D3Z A;  3WAN A;  3W1Y A;  3ZTC A;  1E8W A;  3UQA A;  4BKT A;  3RCZ A;  2GBK A;  1P9D U;  2LGX A;  1WGD A;  2DEN B;  2FCN A;  4TQ1 A;  3H9D A;  4IWP A;  4MH0 E;  5J17 A;  1YD8 U;  3A9K B;  1SGH A;  3NZU A;  2M8S A;  2HJ8 A;  2UYZ B;  3R66 C;  2LWP A;  2RR9 A;  1LXD A;  1V6E A;  3RD2 A;  3DDC B;  4PYZ A;  5D7G A;  1U4A A;  2GBR A;  2K6D B;  2KJR A;  3L08 A;  5C1Z A;  1TTN A;  2YVC A;  1GG3 A;  3QWZ B;  3TCA A;  4BBN C;  2K39 A;  1WI0 A;  3DBL I;  3KUC B;  4GN1 A;  4A3O A;  3PTF C;  3A1Q B;  2KHW B;  2BWF A;  4MSQ B;  4X57 B;  3WAM A;  2DYB A;  2O6V D;  3RYT A;  1Q0W B;  4EZK A;  2IBI B;  4W9L A;  4NQL B;  3O65 B;  4JIO U;  2KDE B;  4IM2 A;  2L76 A;  4GDL B;  3VHT C;  3DBH I;  2LI5 A;  2KJH B;  3HHM A;  2ZVN A;  1GUA B;  1V5T A;  2K8H A;  3Q3F A;  2XK5 A;  2G4S A;  2G45 B;  4URK A;  2DYO A;  3ENE A;  2HE7 A;  3APD A;  3A4R A;  3C0R B;  2LUE A;  2YLM A;  2JWZ A;  4P7I A;  1UZX B;  2BF8 B;  4MM3 A;  4GDL A;  4AJY B;  3H6N A;  2CKH B;  4W9F A;  1S3S G;  3UGB B;  1K8R B;  1VCB A;  2ZPN A;  3U7D A;  2N9X A;  1TZ1 A;  3A33 B;  4KZC A;  2GOW A;  3PRZ A;  4ZRI A;  4OVU A;  4W9G A;  1L7Y A;  2DZM A;  2NVU I;  1VD2 A;  4JGH B;  1UBQ A;  2D07 B;  1WJ4 A;  2NS5 A;  4NAW A;  2LAS A;  3ZVV A;  4IC7 B;  3IVF A;  1OQY A;  2KX3 A;  2KDI A;  2JRI B;  2FAZ A;  4MGI E;  1WM2 A;  1RAX A;  2N9P C;  3DQV A;  2MBH A;  5E6N A;  4GDK B;  3ZDT A;  4TQ0 A;  2ZCC A;  4CHK A;  2GMI C;  1UBI A;  3APC A;  3PV1 A;  2KDF B;  2EMT A;  2JF5 A;  2BYF A;  4HPL B;  2L0F A;  4XX5 A;  2WWZ A;  4DWF A;  1OGW A;  4A20 A;  3V60 A;  4W9D A;  3L54 A;  4II3 B;  4FUL A;  2LVO A;  2CR5 A;  1MG8 A;  1WR1 A;  2DAF A;  2FUH B;  3IHP C;  3QHT A;  4GOC A;  4WJQ A;  4HLE A;  1S1Q B;  4NJ7 A;  3CST A;  4GIV A;  2ZPY A;  4XZ4 A;  3X23 A;  5CTR C;  4FJV B;  3QIJ A;  4JQW C;  4KDL B;  1WE7 A;  4MEM A;  2WX1 A;  4LDT B;  4BKG A;  3RUL A;  4FHJ A;  2KC2 A;  2REX A;  1XQQ A;  2RSU A;  1LQB A;  3IFW B;  3L10 B;  4WJP A;  3WAP A;  4KSL C;  3VDZ A;  3AXC A;  4PS7 A;  5FR6 A;  1UD7 A;  4WJO A;  1SIF A;  1E90 A;  3JVZ X;  2C7H A;  4BKS A;  3PT2 B;  1J19 A;  3K9O B;  5G2N A;  4E74 A;  4BOZ B;  5D94 A;  4AOF A;  2KWV B;  5CHW A;  2K8B A;  3ZTD A;  4DDI D;  2FID A;  2XBB C;  4DHZ B;  4W9C A;  5LXH A;  2C7M B;  2N7E A;  4DDG D;  1GNU A;  2L3Z A;  1WF9 A;  1V2Y A;  4I6N B;  2KJ6 A;  2KTR A;  2PEA A;  1J0G A;  1AAR A;  2KTF A;  1WRD B;  4K1R B;  2O6V A;  3HM3 A;  2NR2 A;  4I6P A;  1NI2 A;  3PS6 A;  4HVB A;  2DAJ A;  1WZ0 A;  1Y8R C;  3PVL A;  2PE6 B;  5DCN A;  4LJP B;  2IO2 B;  5C23 A;  2FCQ A;  2KDB A;  3ZRC A;  5D6J B;  2ZJD A;  3GZN I;  3QA8 A;  1WYW B;  1V81 A;  1ZW7 A;  2C7N B;  4ANW A;  5E6P A;  2KD0 A;  4B6W A;  2C60 A;  4RMA A;  2G4D B;  4K7S A;  4N9F 4;  4GDK A;  4BOS C;  2M0X A;  4FBJ B;  4MEL A;  1XT9 B;  4OVV A;  4ANX A;  1P1A A;  3VUY A;  4DHZ E;  4FJZ A;  5L83 A;  2BYV E;  2JUO A;  4II2 B;  3VH4 B;  1YX6 B;  4IWO A;  3R7Q A;  2M4N A;  1NBF C;  2MSE D;  3I3T B;  4GSW A;  2GBM A;  2OOB B;  2L8J A;  4W9I A;  4ZYN A;  2DZJ A;  2KFK B;  3D32 A;  4K7W A;  4WWO A;  4W9K A;  3NY5 A;  4IW0 A;  4F7Z A;  1WJN A;  3LJ3 A;  3U30 A;  2MBQ A;  3R7R A;  3PHX B;  4TKN A;  2PPH A;  4NQK E;  2KMA A;  1E5W A;  4JLC A;  3K9P B;  2KLC A;  2KK8 A;  2L05 A;  4WQO B;  2MX2 A;  2NPT B;  1IPG A;  3P2B A;  4TV3 A;  4G3X B;  4PS3 A;  2AL6 A;  2D2Q A;  2I1K A;  1H4R A;  1EO6 A;  2ZVO A;  4NNJ B;  3SDL C;  3W1S A;  1IP9 A;  1WX9 A;  1ZGU B;  2LGD A;  1NDD A;  2B3A A;  4FN2 A;  3L13 A;  2AYO B;  3WAL A;  3ZLZ A;  1G6J A;  4AP4 C;  1C3T A;  3KW5 B;  4EUT A;  5BO4 B;  4MJS A;  2RD0 A;  4IM0 A;  1OEY A;  2UWQ A;  3PGE A;  1RFA A;  1ISN A;  2G3Q B;  1H8C A;  3N3K B;  1WFY A;  1WGY A;  2L7R A;  3OAW A;  2FIF A;  1Z5S B;  5HKH A;  2KNB A;  2K8C A;  2KZR A;  3WIM A;  4MJS B;  4B9K A;  1M94 A;  2O2V B;  4G11 A;  1WXA A;  3EFU A;  2XEW A;  5KHO A;  4EKU A;  2KLG A;  1WX7 A;  2NBV B;  3APF A;  1WMH A;  2A4Z A;  3AU4 A;  2I1J A;  3ZDM C;  2IZV B;  4ANV A;  5CHF A;  4HPM B;  1F9J A;  3KVF B;  1RRB A;  1E8X A;  4HCP B;  1KM7 A;  4K81 A;  3TIX A;  5JHB A;  2KVR A;  1RLF A;  2JZZ A;  1P98 A;  1P3Q U;  3CMM B;  1LFD A;  3BY4 B;  3JSV B;  3RZW C;  3SHQ A;  1WZ3 A;  2ASQ A;  5JZE B;  4DXA B;  2KWU B;  2O6V B;  2XK5 B;  3ML8 A;  4GXB A;  3PRP B;  4NJ6 A;  1T0Y A;  4WJN A;  3ZNH B;  3WA0 A;  4EFO A;  3R3M A;  2MBE A;  2A5U A;  1WJU A;  1WY8 A;  2CHX A;  2KMC A;  2N1V A;  3HK0 A;  1EF1 A;  4LJO B;  3QCA A;  5JH5 C;  1YJ1 A;  3A9J B;  3EHV A;  2GBJ A;  4DK5 A;  1WIA A;  5DPW A;  2PJH A;  1GC7 A;  1YX5 B;  2J0J A;  3SD5 A;  2J7Q B;  2WX0 A;  3L16 A;  3M63 B;  3H7S A;  2LVQ A;  2CHZ A;  4ICV A;  1KJT A;  2PE9 A;  4KVG B;  3ZW3 A;  4EZJ A;  3A9J A;  3T9L A;  3PPA A;  2HTH A;  3M95 A;  4BBN F;  5AZH A;  3MJW A;  1OEY J;  2KX0 A;  4FLH A;  3HM6 X;  3UQB A;  4EZL A;  3DBS A;  2KFK A;  2IY1 B;  2L0T A;  2V3S A;  2KQS A;  2RPQ A;  2JT4 B;  1V5O A;  3QC8 B;  4GGQ A;  2J0K A;  2KAN A;  3VTW A;  4BKS D;  1QZE A;  4MDK E;  3L0W B;  3H7P A;  4AUQ C;  3PSE B;  3RT3 B;  2BGF A;  2GBN A;  2BWE S;  4HDQ A;  2DZK A;  5LXI B;  2JXX A;  3GOE A;  3AUL A;  4W9J A;  3ZUN A;  1IYF A;  5LLI A;  5E6O A;  3NOB A;  2ZNV C;  2M17 A;  4MGZ E;  3TJP A;  4FJY A;  1C1Y B;  2D11 A;  5CHV C;  2JY6 A;  3KYC D;  3ZIM A;  4MGY E;  4J6I A;  3A9K A;  2V1Y A;  2K25 A;  3BIN A;  3RUI B;  2L00 B;  3QX1 A;  4EOY A;  1UGM A;  2LD9 A;  3HIZ A;  5EDS A;  1E8Z A;  3JYU A;  3KUZ A;  2ZZP B;  2N1W A;  4KZ0 A;  1V49 A;  2AWT A;  3NS8 A;  3QK0 A;  1WGG A;  4A3P A;  1Q5W B;  1KLV A;  2D10 A;  2KKC A;  2N7D A;  3A1Q A;  2K1F A;  2W9N A;  3DOW A;  3JSV A;  5G55 A;  3S2A A;  5J18 A;  2BKF A;  3DVG Y;  4TUU A;  4M0W B;  4BVU C;  3V6E B;  2LRW A;  4LCD E;  3PZD A;  1WXM A;  5J2R A;  2Z0E B;  2MWS B;  2LRU A;  2RGF A;  3VFK A;  2KO3 A;  1R4N I;  4ICU A;  4IUM B;  3DVG X;  2JPH A;  1KOT A;  3LDZ E;  4HDO A;  2IY0 B;  3UIN B;  3SU8 X;  3VVW B;  4K7U A;  3ALB A;  1J8C A;  2C9W B;  3A4S C;  2DZI A;  4ZDV A;  4M8N A;  2MCN B;  4M8M A;  4ZRJ A;  4CO7 A;  3PHW B;  3ONS A;  4YL8 A;  2KXJ A;  3OJ4 B;  3CF6 E;  3ZRF A;  3TBL D;  3X0W A;  1WJ6 A;  2FCS A;  3V62 A;  2BPS A;  2R2O A;  3Q3J A;  5AZG A;  1TGZ B;  4HWI B;  3UIO B;  3T8M A;  3ZO5 B;  1WGR A;  1I35 A;  2AEH A;  3DVN V;  2KC1 A;  2JVC A;  2C5L C;  3ECI A;  3KYD D;  3PRE A;  4KV2 A;  3TMP B;  3H1U A;  3MHS D;  5DPT A;  2K6Q A;  4ASW C;  5L95 C;  2MW5 A;  1WR6 E;  2VRR B;  2Z0D B;  2KWC A;  1XD3 B;  2Y5B B;  2LXC A;  2MBO A;  3VAW A;  3MTN B;  3TL5 A;  3AI5 A;  2ZNV B;  4HK2 A;  1Q1O A;  2WDT B;  2OJR A;  5IAA C;  1CMX B;  1I42 A;  1EF5 A;  2IO1 B;  3VH3 B;  4IM3 A;  4DBG A;  4F8C B;  3DCG A;  2MP2 B;  4XC2 A;  4KDI C;  4DHJ B;  2N4F A;  2IYD B;  2JRH A;  2NPT A;  3PRM B;  3VQI A;  5KHQ A;  1YIW A;  3UIP B;  1BT0 A;  1WXS A;  2CHW A;  2J0M A;  2QHO A;  1L2N A;  3QAR A;  2LXA A;  3M3J A;  3JW0 X;  3U8Z A;  3VTU A;  4W9E A;  2MQJ A;  3H7P B;  4AWJ A;  1A5R A;  1P0R A;  3W1S C;  2HD5 B;  5TR5 A;  3VUW A;  2CU1 A;  1HE8 A;  4FAD A;  3OJ3 A;  2MBB B;  2NBU A;  4HXD A;  3OLM D;  4KSK C;  1WH3 A;  5DPR A;  4E3C A;  4PYU A;  2LVP A;  2NBW B;  2DX5 B;  4IG7 B;  2MA9 B;  5D2M B;  2IO0 B;  2KTR B;  2O2V A;  1LM8 B;  2KQ7 A;  4EEW A;  2CS4 A;  4KIK A;  3PLU A;  3N32 A;  1JRU A;  2MRP A;  4MSM B;  3NHE B;  3VTV A;  3KH0 A;  2KOX A;  1V9J A;  1WMH B;  2EKE C;  1R4M I;  2MLB A;  3KUD B;  3VUX A;  3DBR I;  4GMV A;  4MGK E;  4RM9 A;  4NPN A;  3IBE A;  4KIK B;  4GB9 A;  3IG3 A;  2Z59 B;  4ANU A;  3CSF A;  4NY0 A;  2BKR B;  2ZEQ A;  3NZS A;  4I6L B;  4G50 A;  3QAQ A;  5AZF A;  3N30 A;  5CX3 A;  4GU2 A;  1E7U A;  2WYQ A;  3QJZ A;  3VXW A;  1GJZ A;  1Z2M A;  5GMV A;  1V86 A;  1WXV A;  1WX8 A;  3V6C B;  4B95 A;  1SE9 A;  1E8Y A;  2AL3 A;  2JZ3 B;  3PLV A;  3ZKJ C;  1X1M A;  1GC6 A;  1OTR B;  2NCN A;  3EC8 A;  3B08 A;  4G0N B;  1ZKH A;  1WGH A;  2FNJ B;  4WWP A;  5AEK B;  3V61 A;  2FCM A;  4WAA A;  4HCN B;  2EMS A;  1TBE A;  1WE6 A;  2LGY A;  2N9E B;  2V4L A;  2DYM A;  1E7V A;  1FXT B;  5DPS A;  1YQB A;  2MP2 A;  3AU5 A;  3ML9 A;  1EUV B;  2KN5 A;  4LDT D;  3WAO A;  1UEL A;  4FHK A;  4AJW A;  1V80 A;  2LZ6 A;  2R2Q A;  3QQ8 B;  3RZF A;  3UF8 A;  2D3G A;  3DVN U;  4DHJ D;  4NAW B;  4F1S A;  3L17 A;  4E71 A;  5JHA A;  4IWQ A;  4FA6 A;  2ZCB A;  3M62 B;  2LJ5 A;  2BYE A;  4JL9 A;  2IO3 B;  3ZNG C;  5IA7 A;  4BFR A;  1UH6 A;  2KFJ A;  3B0A A;  4W9H A;  4WWN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...