3ZLZA

Lys6-linked tri-ubiquitin
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
73
structure length
73
Chain Sequence
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGRQLEDGRTLSDYNIQKESTLHLVLRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Assembly, Analysis and Architecture of Atypical Ubiquitin Chains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords UBIQUITIN
total genus 18
structure length 73
sequence length 73
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3zlzA00
4II2B 1V86A 1UELA 3AU4A 3AI5A 5KHOA 2M0XA 5DPWA 2W9NA 4BBNF 3VTWA 2RPQA 4FLHA 4MGZE 2XBBC 3NY5A 3HM3A 4M8NA 4KVGB 4WJQA 1I35A 4LDTD 4NPNA 3PHWB 4KDLB 1WE6A 1WMHA 2J7QB 3N32A 2KWVB 1H4RA 4GMVA 4MSMB 4ICUA 5CHVC 3CMMB 1WR6E 2CU1A 1GUAB 3OJ3A 4FHKA 2O6VB 1P98A 3H7SA 1SE9A 3ZW3A 1KJTA 5E6PA 1Q1OA 3ZDTA 3TBLD 4BKSA 2JT4B 3UIOB 4GN1A 1Y8RC 3ECIA 4WWOA 3VAWA 4NQKE 1TTNA 4GSWA 3ZNZB 2J0MA 5D2MB 3H9DA 4PS8A 5AEKB 1FXTB 4IWQA 2DAJA 2ZNVB 2KFKB 1WJ4A 2BGFA 2KVRA 4ZDVA 2LUEA 1S1QB 4M8MA 4W9LA 3BY4B 2N7EA 3VH3B 3VUWA 1WMHB 1IP9A 2AL6A 2DZJA 3RCZA 3GZNI 3DBLI 4DHZB 2L0FA 2LVQA 4MELA 2O6VD 3CSFA 1ISNA 1D3ZA 2WWZA 3IVFA 4GDLB 1YX5B 4MJSA 2M17A 1Q0WB 4LJOB 4KIKB 1VD2A 1YJ1A 3I3TB 4DHJD 4B95A 3UIPB 2O2VA 3X23A 4BOSC 2D3GA 3T9LA 2KLCA 5LXIB 4GGQA 4II3B 3NS8A 4F7ZA 1KM7A 4GB9A 4ICVA 1WZ0A 4AJWA 2KDFB 2MP2A 4ZRJA 2JZZA 3WA0A 2B3AA 3UQBA 1OQYA 2MBHA 4KV2A 4MH0E 2DAFA 3W1SA 2MSED 2KZRA 2O6VA 4AUQC 2EMSA 5KHQA 1V80A 1WY8A 2NBUA 3SU8X 1OEYJ 2JVCA 3UF8A 4MDKE 3JSVA 3VTVA 2DX5B 3L0WB 2N9XA 4XZ4A 3DOWA 3HHMA 3ZDMC 1YQBA 2XK5B 3B1LX 4M0WB 2KX3A 3A9KB 3PLUA 1LM8B 1WFYA 2YVCA 2MBQA 2BYEA 3ENEA 4IWOA 5AZFA 4IUMB 4RM8A 2VRRB 3QWZB 2IY1B 1GC7A 3DVNU 2MX2A 2CS4A 1YIWA 3H7PA 2KJ6A 3ZLZA 2JWZA 3HM6X 4KIKA 3TL5A 3TJPA 3EC8A 3LDZE 4MJSB 5CX3A 2BKRB 2MCNB 2LRWA 2AL3A 1V2YA 1H8CA 1E8WA 2L0TA 1WX7A 1S3SG 5FR6A 1WGRA 2CR5A 1TZ1A 2I1JA 2K8BA 2GBRA 4OVUA 3QK0A 2IYDB 1KOTA 4AP4C 3EFUA 2K6DB 4EZLA 4MGKE 4PS3A 1Q5WB 2M8SA 4FULA 4XX5A 4RMAA 4HK2A 4W9JA 4TQ1A 2KO3A 3DVGY 1V6EA 1WRDB 1GG3A 3L54A 1M94A 3OAWA 1K8RB 4DXAB 1WF9A 2LGXA 1LQBA 3KH0A 3PPAA 2K8HA 2IO0B 4OVVA 2BWES 1WIAA 2REXA 2KNBA 1ZW7A 4LDTB 3UQAA 2CHZA 4XC2A 1ZKHA 3B0AA 3VFKA 4EOYA 3ZNID 4IC7B 4EKUA 3WANA 2HJ8A 3AULA 4MGIE 4EZJA 4EZKA 5IA7A 3VTUA 4HDQA 3HK0A 2C5LC 3VDZA 2LD9A 1AARA 2KTRB 2J0KA 3RUIB 1XT9B 2FUHB 5C1ZA 4PYZA 4IM2A 2NVUI 3Q3FA 1ZGUB 5JHBA 3K9OB 4GIVA 3IG3A 2ZPYA 1WGHA 2ASQA 5HKHA 1T0YA 3AU5A 4CO7A 1JRUA 3TIXA 3N30A 4I6NB 2N1WA 2WX0A 1RLFA 3HIZA 4G50A 1F9JA 2G4SA 4CYEA 3PTFC 4W9HA 3ALBA 1WE7A 3S2AA 2KD0A 3RZWC 2DYOA 2EMTA 3T8MA 3KVFB 1MG8A 1V9JA 2ZJDA 2ZZPB 2RSUA 2IBIB 3PT2B 4KZCA 3RZFA 4MGYE 3V61A 4DBGA 2OJRA 4HWIB 1UZXB 2BKFA 2ZNVC 3M95A 5JZEB 3QARA 2DYBA 2GMIC 3L08A 4NNJB 4TQ0A 2HD5B 3PRZA 4AJYB 3ZNGC 2J0JA 2IO2B 4KZ0A 2DYMA 5CTRC 1WXAA 2HE7A 4JLCA 5L95C 1YD8U 4MEMA 5J17A 2C7HA 2OOBB 3PGEA 2O2VB 1HE8A 4YL8A 3NOBA 2WX1A 3MJWA 1UGMA 5LXHA 1UH6A 2L3ZA 2JUOA 4HLEA 4A3PA 2UWQA 4TUUA 2KTRA 2EKEC 2FCMA 4W9FA 2JXXA 2CHXA 2AWTA 5DPTA 5JH5C 4ANUA 2LGYA 4HPLB 2L8JA 2JF5A 3GOEA 4AWJA 3CF6E 4K7SA 2LI5A 3PLVA 3ZRCA 2G4DB 1X1MA 4HPMB 3SDLC 4WAAA 1WX8A 3TMPB 4FJYA 2LVPA 1WXSA 1YX6B 4WJPA 4KSKC 3KUDB 3QC8B 3TCAA 2KWUB 4I6PA 2DZKA 2MBEA 4W9EA 3QJZA 1E8ZA 2LWPA 4FJZA 2V4LA 2JZ3B 2RR9A 4W9KA 3BINA 3WAOA 2FAZA 1U4AA 2V1YA 3A4SC 2BPSA 2HTHA 5DPRA 3A9JB 5EDSA 2KJHB 2D10A 2N9PC 5BO4B 1G6JA 3PV1A 1EUVB 3U7DA 1EF1A 1J19A 3PZDA 4JIOU 5G2NA 2A5UA 3K9PB 1GJZA 4NAWA 3ZTCA 2C7MB 1NBFC 4FN2A 2KXJA 2BWFA 4W9CA 1TBEA 2UYZB 3APCA 5CHFA 5D7GA 2NCNA 2K39A 1RAXA 4ZRKA 4J6IA 1V49A 4ANWA 3X0WA 2N4FA 2KWCA 2KDEB 3U8ZA 2K25A 1GC6A 3DQVA 4EFOA 1NDDA 4K1RB 2LXCA 4JL9A 2NBWB 3QX1A 5G55A 3ZRFA 3ZTDA 1E7UA 4P7IA 1E7VA 3V60A 1E8XA 2CHWA 1WYWB 4E71A 1EF5A 2NBVB 5AZHA 3W1SC 1J8CA 4JQWC 2D07B 3DVGX 1E5WA 5J18A 1J0GA 4E3CA 2NPTA 4F8CB 3OLMD 3PRPB 3R3MA 4G0NB 3MTNB 2PJHA 4JGHB 2GBJA 2L7RA 4ZRIA 3ZIMA 2MRPA 1TGZB 2DENB 2ZCBA 2GOWA 2N9EB 2GBNA 2WYQA 2PPHA 2D11A 2R2QA 1WXMA 2FIFA 2GBKA 2KK8A 1A5RA 1KLVA 2KMCA 5E6NA 2MBBB 3WAMA 1UBQA 4X57B 2Z59B 3JVZX 4GDLA 1WR1A 4NJ7A 3VVWB 3RT3B 4DWFA 3KYDD 3V6EB 3QQ8B 2MLBA 2KDBA 2ZEQA 5DCNA 1WX9A 4B9KA 4GOCA 2FCQA 4HXDA 3QAQA 4N9F4 2JY6A 2MA9B 3DDCB 5J2RA 3PRMB 2KQSA 4DHZE 3AXCA 1WJ6A 1OGWA 4FBJB 1V5TA 3L10B 4IW0A 1SIFA 1QZEA 3RULA 2JPHA 2C7NB 3R66C 4I6LB 2JRHA 3ZUNA 1VCBA 1WGDA 2MQJA 3IFWB 4TKNA 1SGHA 1WM2A 2KOXA 3NZSA 5DPSA 4DK5A 1Z2MA 2ZPNA 2KLGA 3V6CB 3SD5A 3ML8A 2L00B 3R7QA 2C60A 3Q3JA 2KDIA 4E74A 5D6JB 5E6OA 3A4RA 3ZO5B 4DHJB 1IPGA 1R4NI 2KTFA 4GDKA 2WDTB 3APFA 1LXDA 2C9WB 2LGDA 3VQIA 2KHWB 3D32A 4ANVA 1I42A 4ZYNA 1WH3A 1WI0A 4AOFA 4CHKA 2KJRA 1WJUA 4GXBA 2I1KA 4K7UA 4URKA 1PQSA 3ZNHB 1V81A 2NR2A 4BVUC 3DBSA 2PEAA 3KW5B 2QHOA 2KQ7A 2KFJA 3ZVVA 4ANXA 1WM3A 2K1FA 3QIJA 2ZVOA 2N7DA 2MW5A 5C23A 4K81A 3V62A 4F1SA 5L83A 4WJNA 5D94A 5TR5A 3QA8A 1WXVA 2Z0EB 4WWPA 2MBOA 2Y5BB 2MWSB 4BKTA 2DZIA 2M1MA 2IO3B 2LJ5A 3DPDA 4W9GA 1WJNA 1EO6A 3WALA 4BKGA 1CMXB 3QCAA 1OEYA 3KYCD 3SHQA 2BYVE 3L13A 4NQLB 2FNJB 5GMVA 3WAPA 4BFRA 2N1VA 1P9DU 2BF8B 4G11A 1WGYA 4ASWC 4FA6A 2K6QA 4A20A 1GNUA 4K7WA 2G3QB 2LASA 3H6NA 3DVNV 3ONSA 3W1YA 2JRIB 2L76A 2ZVNA 3IHPC 4KDIC 3PSEB 4IWPA 4IM3A 1V5OA 2DHZA 3NZUA 3M62B 3CSTA 2Z0DB 2PE9A 4PYUA 2NPTB 4GU2A 2R2OA 3VHTC 4WQOB 3A9JA 3A9KA 1P0RA 2XK5A 3A1QB 1XD3B 4MSQB 4EEWA 4W9DA 4WJOA 1WZ3A 4HDOA 3H1UA 2YLMA 3VUYA 3M3JA 2A4ZA 5AZGA 1C1YB 3EHVA 4FHJA 3KUZA 5IAAC 1RFAA 1UD7A 4W9IA 3MHSD 3PHXB 4WWNA 1BT0A 2L05A 3C0RB 1UBIA 3EECA 3N3KB 3A1QA 2DZMA 2K8CA 3JW0X 2CKHB 2KMAA 3H7PB 3PS6A 4HVBA 2ZCCA 3PREA 2IO1B 1WGGA 2KX0A 3IBEA 1LFDA 5JHAA 2IY0B 2GBMA 2KKCA 4BOZB 4DDGD 2AYOB 2FIDA 2FCNA 4TV3A 1Z5SB 2KN5A 4IM0A 3ZKJC 2FCSA 1XQQA 3JYUA 4NAWB 2IZVB 4HJKA 4NY0A 3JSVB 5CHWA 3U30A 3VUXA 2BYFA 1C3TA 2KC1A 4DDID 3DBRI 4LCDE 3RD2A 3KUCB 2AEHA 3VXWA 4FADA 3LJ3A 4IG7B 3UINB 3P2BA 4G3XB 2LVOA 3DCGA 4HCPB 3B08A 1P3QU 3A33B 3O65B 4HCNB 2RD0A 2XEWA 1NI2A 4BKSD 3OJ4B 3DBHI 4GDKB 3UGBB 3R7RA 2M4NA 4FJVB 2KFKA 3M63B 2PE6B 1L7YA 2KANA 2V3SA 2LRUA 3ML9A 1E90A 2G45B 2KC2A 3VH4B 3QHTA 3WIMA 4B6WA 2MP2B 3APDA 1R4MI 3PVLA 4A3OA 4MM3A 2LXAA 1P1AA 2D2QA 3RYTA 3L16A 4RM9A 1IYFA 1RRBA 1L2NA 1E8YA 4KSLC 2RGFA 3L17A 2LZ6A 4LJPB 4PS7A 5LLIA 1OTRB 3NHEB 4EUTA 4NJ6A 4BBNC 2NS5A
chains in the Genus database with same CATH superfamily
1VZ7A 1V86A 1B9RA 3AI5A 1GAQB 3VTWA 5I4DA 1K53A 4WJQA 3PHWB 2J7QB 3NUHB 2CJNA 3CMMB 3OJ3A 2CU1A 1GUAB 4FHKA 2INPE 1N60A 3ECIA 4WWOA 1E10A 4GSWA 3BYYB 1N63A 3RNFC 3H9DA 4OHJA 1WJ4A 2X38A 2N7EA 3VUWA 1XEEA 2DZJA 4WH4A 3GZNI 3DBLI 2LVQA 2V3NA 3KWLA 3Q8EA 5EE9A 1T6BX 5BYRA 1JROA 3IVFA 2M17A 1BMLC 4LJOB 4UDUC 5BMGA 2D3AA 1YJ1A 2V4IB 3I3TB 3UIPB 4BOSC 3MC8A 3U52E 2IJ0A 4II3B 3NS8A 4GB9A 2GI9A 3KLSX 4HKZE 2DAFA 3R8BA 5EE3A 4AUQC 3UF8A 3VTVA 3ZXVA 2N9XA 4BZAA 3PLUA 1LM8B 2YVCA 2MBQA 2BYEA 3ENEA 4IWOA 2V3PA 4IUMB 2KN4A 1YN4A 2AQ3B 1GC7A 3DVNU 2CS4A 2JWZA 3HM6X 2BKRB 3ZYYX 1EM7A 1V2YA 1LO5D 1S3SG 5FR6A 3P63A 2QDFA 2M8SA 4RMAA 1FPYA 4TQ1A 5LNK1 2KO3A 3DVGY 1GG3A 1M94A 4DXAB 2IO0B 4IKGA 4JPSA 4OZCA 3UQAA 3Q2AC 2CHZA 3ZJUA 1VR9A 2HJ8A 4MGIE 4M00A 4EZKA 3VTUA 2J52A 2C5LC 5C1ZA 4PYZA 1CK1A 4IM2A 1YNTE 2WXPA 2NVUI 4HKQA 2W3RA 5BMIA 2WS3B 4L23A 3PTFC 3AEAB 3FC4A 2H89B 3RZWC 2DYOA 4KX6B 1JALA 2WXKA 4DBGA 4HWIB 1HZ5A 2ZNVC 3ZGZA 2GMIC 4AJYB 2DYMA 5CTRC 4JLCA 4DXFA 1YD8U 5J17A 3PGEA 1HE8A 4YL8A 3NOBA 2WX1A 4XDDA 2FCMA 4W9FA 5JH5C 3GOEA 4AWJA 1MHHE 2PTLA 1X1MA 1XXGA 2JXTA 4C4VB 2BS2B 4HJGE 2ZW0A 1XCTL 4KSKC 1A70A 3KUDB 2KWUB 3UI3A 2N0SB 1L0YB 4W9EA 1E8ZA 2WDQB 5IP4D 2FAZA 1U4AA 2V1YA 2BPSA 2HTHA 2RDBC 3A9JB 5EDSA 2KJHB 1P7FA 4A6QA 1ZXHA 1KF6B 1J19A 4JIOU 4LK0M 1NBFC 4FN2A 1RYJA 4W9CA 1TBEA 2UYZB 2NCNA 2K39A 4ANWA 3X0WA 5BYSA 2N4FA 2KWCA 2KDEB 4WWMA 4IDIA 2LXCA 2PKOA 4JL9A 2NBWB 1DOIA 1JMLA 3ZTDA 1E7UA 1HXYD 1E8XA 1ZP0B 2CHWA 1WYWB 4L1BA 2FUG1 3DVGX 2M19A 4JGHB 1SBBB 4Q2JA 1TGZB 2DENB 2GOWA 2GBNA 2HJ1A 4RGMA 2D11A 2R2QA 1WXMA 2GBKA 1A5RA 4HROA 3WAMA 1BUIC 3AE6B 1V8CA 5AUKA 3VVWB 3OG5A 3BWUD 1T0QC 2LJIA 3LYYA 4DWFA 3AB5A 1RFKA 5DCNA 4GOCA 2V0GA 1JWBD 1E0ZA 4NJCA 2IPKD 2KQSA 1F52A 4IW0A 1SIFA 1QZEA 2C7NB 1T0RC 3ZUNA 1VCBA 3IFWB 2MQJA 4TKNA 4P1CC 1SGHA 4A8XC 1EWCA 2KOXA 3NZSA 5DPSA 4CQNA 1Z2MA 2KLGA 3SD5A 5G5GA 2L00B 2C60A 1ZUD2 5D6JB 2PIAA 4JWUC 4DHJB 2N9KA 2KTFA 3FAHA 2KVZA 2WDTB 2C9WB 1J7AA 1K52A 2KHWB 2DBYA 4LTUA 1WH3A 2I1KA 1PQSA 1HQRD 4ARIA 2QHOA 4LNFA 3ZVVA 1WM3A 1R4NB 4YSZB 4F1SA 3VRAB 2L83A 1GB4A 4WWPA 1I4PA 2LJ5A 1KLGD 4OW0A 4W9GA 1WJNA 1RM6C 1EO6A 3WALA 4BKGA 5EE0A 3QCAA 3AE8B 1TZOA 2N1VA 1P9DU 4FA6A 2K6QA 4HRSA 3MFGA 3CIRB 1QOGA 2ZVNA 2L76A 4KDIC 3PSEB 1DOYA 3NZUA 4A55A 2NPTB 1FNWA 2Q5WD 2XK5A 5AZGA 1L6UA 2SAKA 3KUZA 3NS1A 1BT0A 2L05A 2DZMA 2K8CA 3JW0X 3GB1A 1V97A 2KMAA 1WGGA 3PO0A 1QOFA 1CZPA 3RNGC 1Z5SB 4REZA 1N5WA 1HEZE 1XQQA 1KFYB 1NENB 2IZVB 3NVYA 2KC1A 3KUCB 1SF0A 3V3XA 3UINB 4IG7B 4FADA 2KWDA 3DCGA 1P3QU 2QSDA 1NI2A 4GDKB 3UGBB 4WURA 3ZQ4A 1FCLA 2KFKA 3P4SB 2VH2A 2V3SA 2G45B 3VH4B 3QHTA 2MP2B 3APDA 5HFYA 2LXAA 4DXGA 3NVVA 2LZ6A 3FKYA 2NS5A 3MJWA 4II2B 2BB6A 1UELA 3AU4A 2M0XA 2W9NA 4BBNF 4ARCA 2RPQA 1XLQA 3AMZA 4MGZE 3NY5A 1QILA 4YSYB 1WE6A 1WMHA 3N32A 4GMVA 4C80A 1FRDA 1P98A 1KJTA 2IGDA 5E6PA 1Q1OA 4J3OD 4BKSA 2JT4B 4GN1A 3VAWA 2FE8A 5AEKB 2FBWB 2K9XA 4IWQA 4ZDVA 4W9LA 3RCZA 1IBXB 3BVMA 1TKYA 4JX1C 1C76A 1D3ZA 4MJSA 1XCQL 1Q0WB 3FILB 3HRDD 1VD2A 1D4BA 2RDHA 2D3GA 3NVZA 5LXIB 1R4MB 5FK9C 1L5PA 1AN8A 2VZKD 1QOBA 2JZZA 2B3AA 3R2IA 1OQYA 4KV2A 3W1SA 4R3DA 2KT7A 2KZRA 2MSED 4P6VF 5KHQA 2LMCA 2IGHA 3L0WB 1PGBA 2WP9B 3ZDMC 3A9KB 2HTME 1WFYA 1TY2A 1KTKA 5AZFA 4RM8A 2QMTA 1JW9D 2IY1B 3QWZB 2MX2A 3H7PA 2PMVA 2WXRA 4YSXB 4MJSB 1FEHA 1ET9A 2AL3A 3E56A 1H8CA 2CR5A 4IOIE 2GBRA 4OVUA 3QK0A 1KOTA 4AP4C 2K6DB 4S17A 3W9CB 4W9JA 2LGXA 3KH0A 2BWES 2REXA 2WXFA 2VZKB 1PDXA 1ZKHA 3B0AA 2ACZB 1MHXA 3HK0A 2D3CA 3VDZA 1AARA 2J0KA 1XLOA 4NZLB 5TSSA 2OEDA 2M56B 1TS3A 3Q3FA 1ZGUB 2I38A 2GLSA 2WXJA 1WGHA 1WWTA 2ASQA 5HKHA 4CO7A 2WXOA 2LHDA 1N6ZA 2WX0A 2GRIA 3HIZA 2XN9C 2G4SA 4G50A 4W9HA 1C77A 3ALBA 3S2AA 3AV8A 1WXQA 2EMTA 3KVFB 2OJRA 1UZXB 5JZEB 3QARA 4RF0A 2HD5B 2J0JA 2IO2B 1E6EB 3I63C 5L95C 4ZOHC 2O2VB 2LHEA 1P7EA 3NRZA 5LXHA 2L3ZA 2JUOA 4HLEA 1UNSA 4A3PA 2UWQA 4TUUA 2QC8A 2EKEC 5DPTA 1SEBD 2AWTA 1J7BA 2L8JA 3CF6E 4K7SA 2LI5A 2MHJA 4WAAA 2GB1A 1WX8A 2BTEA 3AE3B 3TMPB 1WXSA 3QC8B 1C4PA 4I6PA 3QJZA 1BXTA 2JZ3B 3A4SC 2D10A 2N9PC 1EUVB 3U7DA 3PZDA 2ICIA 3GP7A 3C8YA 1FMAD 3LXFA 3APCA 5CHFA 5D7GA 2BS4B 4AQ7A 3AEDB 3Q6BA 1V49A 2WNMA 3TEYA 3I57A 3VRBB 5G55A 4EE2A 3ZRFA 4RH6A 4E71A 2KACA 1EF5A 3W1SC 1J8CA 4JQWC 1GPXA 1E5WA 2W54A 2BQQA 4E3CA 2GBJA 4ZRIA 3ZIMA 2ZCBA 2K0PA 2WYQA 1KLVA 4RF1A 3P1MA 1I4HA 4YT0B 1PYWD 5E6NA 2MBBB 2WQYB 4X57B 3JVZX 1WR1A 4NJ7A 1UUPA 3EUB2 2MLBA 2JYEA 2ZEQA 1WX9A 4B9KA 4N9F4 5D3DA 2KAJA 3AXCA 4FBJB 2QJLA 3RULA 1NVID 3R66C 4I6LB 1JWSD 2ZPNA 1I4RA 1ENFA 5E6OA 1I4GA 3IT6B 3BVZA 2LGDA 4M02A 3BYTB 2KJRA 1ACCA 4K7UA 3BVGA 3O13A 5FKAC 2PEAA 2KQ7A 2KFJA 3P4QB 2N7DA 2MW5A 5C23A 4K81A 5L83A 5D94A 2WXGA 1DGJA 1FXIA 1FNUA 3LB8C 3RI7C 2LFIA 2Y5BB 1FCCC 2E6XA 1ZDVA 2M1MA 1CMXB 3ZJVA 1OEYA 1NYRA 2JSVX 3L13A 1HZ6A 2FNJB 1VRAB 4BFRA 5T8IA 3DHGC 1GNUA 1PFDA 2G3QB 3ONSA 2K22A 4IM3A 2PVOD 2DHZA 1TJEA 2PE9A 2R2OA 3VHTC 2TSSA 1IGCA 1KH0A 2G9HD 3A9KA 1L4ZB 1AYFA 1P0RA 4EEWA 4WJOA 1F1HA 3H1UA 4ITKA 3VUYA 2A4ZA 1M4VA 1RWSA 1VJKA 1RFAA 1NEKB 3PHXB 2RDGA 1UBIA 2DLBA 3EECA 3SEBA 3N1XC 4HVBA 3PREA 1QOAA 2QCZA 1FRRA 5JHAA 1F2RI 1TT5B 2W3SA 3ZKJC 3Q3MC 3JYUA 4HJKA 1C3TA 4LCDE 3B08A 2WXHA 4LNKA 1OQQA 2M4NA 4XDCA 2KANA 3WIMA 4B6WA 4YTNB 2JYTA 3W5VB 1N61A 1V1OA 3AE7B 2LUMA 3EGRA 3VR8B 1L2NA 1E8YA 4KSLC 3L17A 5LLIA 1PUTA 3DBRB 1C4AA 1DOXA 2XBBC 4LDTD 5IKCM 3AE1B 1WSPA 1WR6E 1JRPA 2O6VB 3H7SA 1CJEA 3ZW3A 2NTTA 3ZDTA 3TBLD 2WXIA 1VZ8A 3UIOB 1TTNA 2J0MA 5D2MB 4PS8A 1EU4A 1QT9A 2DAJA 2KVRA 2LUEA 1S1QB 4M8MA 4N6EB 3VH3B 1IP9A 2AL6A 3PZ7A 4C4VA 4WIPA 1SJED 3CSFA 1ISNA 1FIQA 1GB1A 2K5PA 3DHHC 3MC0B 1D6EC 3T9LA 4FXCA 4GGQA 3RMKC 4F7ZA 4ICVA 1WZ0A 4AJWA 3BZDB 2KDFB 2MP2A 4ZRJA 1JCKB 3WA0A 3UQBA 2MBHA 2YEPF 2OJWA 2EMSA 1V80A 1WY8A 2E3TA 4MDKE 3JSVA 2DX5B 4XZ4A 1IGDA 3DOWA 1YQBA 3B2GA 4M0WB 3B1LX 2I2YA 4ZRQA 2VRRB 2DNFA 2EELA 5EE1A 1JWMD 2KJ6A 3ZLZA 4KIKA 2JQRB 3T3NA 3EC8A 5CX3A 3EFCA 1C9FA 2MCNB 2EKIA 5HI1A 2LRWA 4TMAB 1E8WA 2L0TA 1TZ1A 1TY0A 1NI3A 1UGJA 4YTMB 2IYDB 3IXSA 3EFUA 2Y3AA 3RN9C 4PS3A 1Q5WB 4XX5A 3Q14C 3OAWA 1WRDB 3L54A 1K8RB 1WF9A 4OVVA 3RUIB 1I7HA 3URYA 2K8HA 2KNBA 1ZW7A 4KGRA 1YJJA 4XC2A 1GOZA 3VFKA 1SB3C 3ZNID 4EKUA 3WANA 4HDQA 2LD9A 4C7YA 4C7ZA 5JHBA 1NYQA 3DHIC 3IG3A 2KYWA 3TEZA 3N30A 4I6NB 1RLFA 4A90A 4WQMA 1FM0D 1N62A 1WE7A 5FR3A 2KD0A 3B2FA 2MEKA 4MT5A 3T8MA 1FO4A 2ZJDA 2ZZPB 3V61A 2IBIB 1SSNA 4MGYE 3RZFA 2BKFA 3M95A 3C19A 1WRIA 2DYBA 3TSSA 4NNJB 1I4XA 1WXAA 2N9LA 4LNNA 4M01A 1UGMA 1V1PA 1B1ZA 1UF0A 1XLNA 2JXXA 5H8YE 4ANUA 4HPLB 3ZRCA 2G4DB 4HPMB 1FNVA 2LVPA 2H88B 4ZHPA 1TIFA 2BW2A 4GLSC 2MBEA 2ZW1A 1L4DB 3IAS1 2V4LA 3BINA 4H2AA 5BO4B 1G6JA 1EF1A 2BT6A 1GJZA 2A5UA 3K9PB 3ZTCA 2BWFA 1KLUD 4ZRKA 4J6IA 1Y56A 1L0XB 2K25A 5GXGB 3DQVA 4EFOA 4K1RB 1UWXA 3RPFC 3TUOA 2WXLA 2WDRB 1E7VA 2RPVA 4OZBA 2BVCA 1XLPA 4B0EA 2XNAC 1CQVA 3RNCC 2DWQA 5J18A 1J0GA 4F8CB 2W82A 3PRPB 4G0NB 3NG0A 2PJHA 2L7RA 3I5JC 2N9EB 1MPEA 2PPHA 2FIFA 4GDLA 3W2DA 5C3JB 3OWEB 3KYDD 3V6EB 3QQ8B 4HXDA 3QAQA 2INCC 2MA9B 3B9JA 1TS2A 3DDCB 4WAFA 1WJ6A 2WXNA 2SEBD 2QIEB 2JPHA 2JRHA 1WGDA 1HA5A 3U4EG 1WM2A 3V6CB 3Q3JA 3AECB 4E74A 3MC9A 2Y5PA 4DQOC 1R4NI 1MVKA 2R61A 3APFA 1LXDA 2AQ2B 5C2TB 4KKIA 4ZHOA 3AH7A 3PZ8A 4ANVA 1TS5A 1I42A 1STEA 1D5XC 4CHKA 4GXBA 1QLBB 3BK2A 3ZNHB 4BVUC 4YTPB 3DBSA 4ANXA 2ZVOA 1YQ3B 2OHFA 4WJNA 5TR5A 1C78A 1WXVA 3RNAC 4RGNA 1VDVA 5D3IB 2MBOA 1ESFA 2DZIA 1MJDA 2IO3B 3DPDA 1FD6A 3AE4B 3GE8C 3RFZB 4AS1A 2BYVE 4NQLB 3Q69A 4MH8A 2INDC 1YN5A 3AEGB 1WGYA 2INNE 4ASWC 2PW9A 4K7WA 1F0ZA 3H6NA 3DVNV 3W1YA 1C79A 4ZRPA 1V5OA 1N5XA 2PVGC 2Z0DB 1QKZA 4PYUA 4WQOB 1SE4A 3N1ZC 1XD3B 4MSQB 4HDOA 3EHVA 4P16A 2LGSA 4W9IA 3P4PB 5IOIA 4LNIA 1C4CA 4WWNA 2V9HA 1TYGB 3C0RB 3HVDA 3N3KB 2CKHB 3PS6A 1JWUD 2IO1B 1TKEA 3U2SC 3IBEA 2GBMA 4KKJA 2KKCA 4DDGD 2AYOB 4KGTA 2FCNA 4TV3A 2WGSA 2FCSA 4RCOA 1WGKA 4NAWB 4NY0A 2BYFA 1ZPSA 3RD2A 2AEHA 3VXWA 3Q3NC 3LJ3A 5BYQA 2LVOA 4HCPB 4K3CA 2CU3A 3O65B 4HCNB 4USAA 4BKSD 3DBHI 3R7RA 2W55A 1L7YA 2N7JA 1SIJA 1R7SA 3PVLA 4A3OA 3VR9B 1P1AA 4RM9A 2YEPB 1RRBA 5AUIA 4NJ6A 4BBNC 4RGOS 3P4RB 1PGAA 5KHOA 5DPWA 2D5GA 4FLHA 3HM3A 4M8NA 4KVGB 4ACFA 1I35A 4NPNA 1AWDA 4KDLB 2KWVB 1H4RA 4MSMB 5G5HA 4ICUA 5CHVC 1YN3A 2QEJC 3AE2B 1SE9A 3H8HA 1T0SC 4N58A 4PK1A 3MP9A 1Y8RC 3HUIA 4XE0A 3IT4B 4NQKE 3DWMA 3ZNZB 4D2KA 1FXTB 2ONQA 1TKGA 2KFKB 2ZNVB 2BGFA 2Z8LA 1MFWA 1SJHD 3BY4B 3MJ5A 1WMHB 4DHZB 2L0FA 4MELA 2WU2B 2O6VD 2KQ4X 2WWZA 4GDLB 1YX5B 1MG4A 3DBHB 4KIKB 1SE3A 1YJIA 1J7CA 4DHJD 4B95A 4XWWA 2BS3B 2O2VA 3X23A 3ABVB 2KLCA 4N59A 4XWTA 1T3QA 1KM7A 1IBXA 1YQ4B 1D5ZC 4MH0E 3T3OA 2O6VA 2JU6X 2NBUA 3SU8X 1FFVA 1OEYJ 1AW7A 1YOVB 2JVCA 3I9V1 3DBLB 3L4PA 2MJDA 3HHMA 1MI0A 2XK5B 2KX3A 2L1AA 4LLGM 4PT5A 2UU7A 4XGAB 1YIWA 2PLPA 1K50A 2VH1A 3TJPA 3LDZE 3TL5A 4RGTA 2K3UA 4YXDB 1WX7A 2IGGA 1WGRA 2G1EA 2I1JA 2K8BA 4KGSA 1K51A 4EZLA 4MGKE 4FULA 4HK2A 1V6EA 3KWVA 3PPAA 1LQBA 2AQ1B 2LGIA 1WIAA 3NZ3A 4LDTB 1Q10A 4EOYA 4IC7B 3N20C 3AULA 4EZJA 2BB5A 5IA7A 2WLBA 2KTRB 1V1PB 1OQRA 1XT9B 2FUHB 3MHZA 4YWGG 3K9OB 4GIVA 1ZOYB 2ZPYA 1T0YA 3AU5A 3Q8BA 4QAYA 1JRUA 3TIXA 2N1WA 1F9JA 2WDVB 4CYEA 1XO3A 3Q8AA 2RMMA 1JWAD 3TEWA 4NAMA 1MG8A 1V9JA 2JZPA 3PT2B 2RSUA 4KZCA 3AEBB 3NVWA 2J53A 2WXMA 2KMMA 3L08A 4TQ0A 3PRZA 3ZNGC 1E7PB 4KZ0A 1IUEA 2HE7A 3AEEB 4MEMA 4A9AA 2C7HA 2D3BA 2OOBB 1UH6A 1KRHA 4S0RA 2KTRA 2JX5A 2CHXA 2LGYA 2X8XX 2JF5A 4L2YA 1JQ4A 3PLVA 3KQ4A 4US9A 1XF5L 2M0AA 3E9SA 3SDLC 1SXTA 1DYQA 3BK1A 5E6JA 4FJYA 1YX6B 4WJPA 3R2TA 3TCAA 2LEKA 2DZKA 4HEA1 2LWPA 4FJZA 4W9KA 2HDEA 3AM9A 1FFUA 2RR9A 3WAOA 5H92C 1ZXIA 2KDMA 1L0VB 5DPRA 4HPPA 2ON8A 3PV1A 4ZYSA 3DWGC 4TSSA 5G2NA 4NAWA 2C7MB 1L6VA 3Q8FA 2KXJA 4JE3B 2J42A 1RAXA 1SE2A 5MPOA 3U8ZA 3GZNB 1GC6A 1NDDA 3QX1A 1YMHE 4K3BA 1T5XD 4LNOA 4P7IA 1LGRA 3AE5B 3V60A 2Y5CA 2NBVB 3GS2A 3ZJTA 5AZHA 3Q8CA 2D07B 3CWIA 2QILA 2NPTA 2IDYA 3OLMD 3R3MA 3MTNB 2MRPA 3Q3OC 3BIID 4US8A 1VZ6A 2KK8A 2KMCA 1UBQA 2Z59B 3RT3B 3WCQA 2KDBA 2FCQA 1QQRA 2JY6A 5J2RA 3PRMB 4DHZE 1OGWA 1HTOA 1V5TA 3L10B 3ZXRA 4DK5A 3ML8A 3R7QA 2WU5B 2KDIA 3A4RA 3ZO5B 2WHIA 1IPGA 4C00A 4GDKA 3RNBC 5HG2A 3VQIA 3D32A 4JWSC 4ZYNA 1WI0A 4AOFA 1WJUA 2L52A 1OFFA 4URKA 1QF6A 1V81A 2NR2A 1FXAA 5IN7A 3KW5B 2WXQA 2K1FA 3QIJA 4OZAA 3V62A 3N1YC 5JXVA 5HHDG 1F77A 3QA8A 5BMHA 2Z0EB 1TS4A 3SFEB 2MWSB 1E9MA 4BKTA 1PGXA 3EA6A 3KYCD 3HVZA 3SHQA 3J9CA 5GMVA 3WAPA 3U7ZA 1WYGA 2BF8B 4G11A 4A20A 4C56C 2BYTA 2LASA 3AEFB 1ZE3D 1ZDXA 3AN1A 2JRIB 3IHPC 4IWPA 2CJOA 3M62B 3CSTA 4GU2A 3A9JA 2NTSA 2AX5A 2L32A 3N9YC 1UWMA 3IAM1 4M0WA 3A1QB 4W9DA 3TEXA 1WZ3A 2YLMA 3M3JA 4MACA 3SR6A 1C1YB 2NMQA 4FHJA 5IAAC 1UD7A 3MHSD 2JWUA 4MM3B 1ROEA 3SFDB 3W5UB 4XYCA 3A1QA 1F2RC 3H7PB 2ZCCA 2KX0A 1LFDA 2IY0B 2BBCA 4BOZB 2MH7A 2FIDA 4RFBA 2KN5A 4IM0A 5CHWA 2B76B 3VUXA 3JSVB 3U30A 4P1BC 4DDID 3DBRI 3P2BA 4G3XB 2J4XA 4OVZA 3P42A 3A33B 3V05A 2RD0A 2XEWA 3OJ4B 4BAXA 1ET6A 4FJVB 4B0MA 3M63B 3ETRA 2PE6B 2MJ3A 1EU3A 3ML9A 1E90A 2KC2A 2LRUA 3AE9B 1VLBA 1R4MI 2MJEA 4MM3A 1I4QA 2D2QA 3RYTA 3RNEC 3L16A 1HTQA 1IYFA 4O1NA 3NJTA 1D5MC 4RNAA 5IO9A 2RGFA 4LJPB 4PS7A 1OTRB 3GE3C 3NHEB 4EUTA 1EWYC 3FILA
chains in the Genus database with same CATH topology
4II2B 1V86A 1UELA 3AU4A 3AI5A 5KHOA 2M0XA 5DPWA 2W9NA 4BBNF 3VTWA 2RPQA 4FLHA 4MGZE 2XBBC 3NY5A 3HM3A 4M8NA 4KVGB 4WJQA 1I35A 4LDTD 4NPNA 3PHWB 4KDLB 1WE6A 1WMHA 2J7QB 3N32A 2KWVB 1H4RA 4GMVA 4MSMB 4ICUA 5CHVC 3CMMB 1WR6E 2CU1A 1GUAB 3OJ3A 4FHKA 2O6VB 1P98A 3H7SA 1SE9A 3ZW3A 1KJTA 5E6PA 1Q1OA 3ZDTA 3TBLD 4BKSA 2JT4B 3UIOB 4GN1A 1Y8RC 3ECIA 4WWOA 3VAWA 4NQKE 1TTNA 4GSWA 3ZNZB 2J0MA 5D2MB 3H9DA 4PS8A 5AEKB 1FXTB 4IWQA 2DAJA 2ZNVB 2KFKB 1WJ4A 2BGFA 2KVRA 4ZDVA 2LUEA 1S1QB 4M8MA 4W9LA 3BY4B 2N7EA 3VH3B 3VUWA 1WMHB 1IP9A 2AL6A 2DZJA 3RCZA 3GZNI 3DBLI 4DHZB 2L0FA 2LVQA 4MELA 2O6VD 3CSFA 1ISNA 1D3ZA 2WWZA 3IVFA 4GDLB 1YX5B 4MJSA 2M17A 1Q0WB 4LJOB 4KIKB 1VD2A 1YJ1A 3I3TB 4DHJD 4B95A 3UIPB 2O2VA 3X23A 4BOSC 2D3GA 3T9LA 2KLCA 5LXIB 4GGQA 4II3B 3NS8A 4F7ZA 1KM7A 4GB9A 4ICVA 1WZ0A 4AJWA 2KDFB 2MP2A 4ZRJA 2JZZA 3WA0A 2B3AA 3UQBA 1OQYA 2MBHA 4KV2A 4MH0E 2DAFA 3W1SA 2MSED 2KZRA 2O6VA 4AUQC 2EMSA 5KHQA 1V80A 1WY8A 2NBUA 3SU8X 1OEYJ 2JVCA 3UF8A 4MDKE 3JSVA 3VTVA 2DX5B 3L0WB 2N9XA 4XZ4A 3DOWA 3HHMA 3ZDMC 1YQBA 2XK5B 3B1LX 4M0WB 2KX3A 3A9KB 3PLUA 1LM8B 1WFYA 2YVCA 2MBQA 2BYEA 3ENEA 4IWOA 5AZFA 4IUMB 4RM8A 2VRRB 3QWZB 2IY1B 1GC7A 3DVNU 2MX2A 2CS4A 1YIWA 3H7PA 2KJ6A 3ZLZA 2JWZA 3HM6X 4KIKA 3TL5A 3TJPA 3EC8A 3LDZE 4MJSB 5CX3A 2BKRB 2MCNB 2LRWA 2AL3A 1V2YA 1H8CA 1E8WA 2L0TA 1WX7A 1S3SG 5FR6A 1WGRA 2CR5A 1TZ1A 2I1JA 2K8BA 2GBRA 4OVUA 3QK0A 2IYDB 1KOTA 4AP4C 3EFUA 2K6DB 4EZLA 4MGKE 4PS3A 1Q5WB 2M8SA 4FULA 4XX5A 4RMAA 4HK2A 4W9JA 4TQ1A 2KO3A 3DVGY 1V6EA 1WRDB 1GG3A 3L54A 1M94A 3OAWA 1K8RB 4DXAB 1WF9A 2LGXA 1LQBA 3KH0A 3PPAA 2K8HA 2IO0B 4OVVA 2BWES 1WIAA 2REXA 2KNBA 1ZW7A 4LDTB 3UQAA 2CHZA 4XC2A 1ZKHA 3B0AA 3VFKA 4EOYA 3ZNID 4IC7B 4EKUA 3WANA 2HJ8A 3AULA 4MGIE 4EZJA 4EZKA 5IA7A 3VTUA 4HDQA 3HK0A 2C5LC 3VDZA 2LD9A 1AARA 2KTRB 2J0KA 3RUIB 1XT9B 2FUHB 5C1ZA 4PYZA 4IM2A 2NVUI 3Q3FA 1ZGUB 5JHBA 3K9OB 4GIVA 3IG3A 2ZPYA 1WGHA 2ASQA 5HKHA 1T0YA 3AU5A 4CO7A 1JRUA 3TIXA 3N30A 4I6NB 2N1WA 2WX0A 1RLFA 3HIZA 4G50A 1F9JA 2G4SA 4CYEA 3PTFC 4W9HA 3ALBA 1WE7A 3S2AA 2KD0A 3RZWC 2DYOA 2EMTA 3T8MA 3KVFB 1MG8A 1V9JA 2ZJDA 2ZZPB 2RSUA 2IBIB 3PT2B 4KZCA 3RZFA 4MGYE 3V61A 4DBGA 2OJRA 4HWIB 1UZXB 2BKFA 2ZNVC 3M95A 5JZEB 3QARA 2DYBA 2GMIC 3L08A 4NNJB 4TQ0A 2HD5B 3PRZA 4AJYB 3ZNGC 2J0JA 2IO2B 4KZ0A 2DYMA 5CTRC 1WXAA 2HE7A 4JLCA 5L95C 1YD8U 4MEMA 5J17A 2C7HA 2OOBB 3PGEA 2O2VB 1HE8A 4YL8A 3NOBA 2WX1A 3MJWA 1UGMA 5LXHA 1UH6A 2L3ZA 2JUOA 4HLEA 4A3PA 2UWQA 4TUUA 2KTRA 2EKEC 2FCMA 4W9FA 2JXXA 2CHXA 2AWTA 5DPTA 5JH5C 4ANUA 2LGYA 4HPLB 2L8JA 2JF5A 3GOEA 4AWJA 3CF6E 4K7SA 2LI5A 3PLVA 3ZRCA 2G4DB 1X1MA 4HPMB 3SDLC 4WAAA 1WX8A 3TMPB 4FJYA 2LVPA 1WXSA 1YX6B 4WJPA 4KSKC 3KUDB 3QC8B 3TCAA 2KWUB 4I6PA 2DZKA 2MBEA 4W9EA 3QJZA 1E8ZA 2LWPA 4FJZA 2V4LA 2JZ3B 2RR9A 4W9KA 3BINA 3WAOA 2FAZA 1U4AA 2V1YA 3A4SC 2BPSA 2HTHA 5DPRA 3A9JB 5EDSA 2KJHB 2D10A 2N9PC 5BO4B 1G6JA 3PV1A 1EUVB 3U7DA 1EF1A 1J19A 3PZDA 4JIOU 5G2NA 2A5UA 3K9PB 1GJZA 4NAWA 3ZTCA 2C7MB 1NBFC 4FN2A 2KXJA 2BWFA 4W9CA 1TBEA 2UYZB 3APCA 5CHFA 5D7GA 2NCNA 2K39A 1RAXA 4ZRKA 4J6IA 1V49A 4ANWA 3X0WA 2N4FA 2KWCA 2KDEB 3U8ZA 2K25A 1GC6A 3DQVA 4EFOA 1NDDA 4K1RB 2LXCA 4JL9A 2NBWB 3QX1A 5G55A 3ZRFA 3ZTDA 1E7UA 4P7IA 1E7VA 3V60A 1E8XA 2CHWA 1WYWB 4E71A 1EF5A 2NBVB 5AZHA 3W1SC 1J8CA 4JQWC 2D07B 3DVGX 1E5WA 5J18A 1J0GA 4E3CA 2NPTA 4F8CB 3OLMD 3PRPB 3R3MA 4G0NB 3MTNB 2PJHA 4JGHB 2GBJA 2L7RA 4ZRIA 3ZIMA 2MRPA 1TGZB 2DENB 2ZCBA 2GOWA 2N9EB 2GBNA 2WYQA 2PPHA 2D11A 2R2QA 1WXMA 2FIFA 2GBKA 2KK8A 1A5RA 1KLVA 2KMCA 5E6NA 2MBBB 3WAMA 1UBQA 4X57B 2Z59B 3JVZX 4GDLA 1WR1A 4NJ7A 3VVWB 3RT3B 4DWFA 3KYDD 3V6EB 3QQ8B 2MLBA 2KDBA 2ZEQA 5DCNA 1WX9A 4B9KA 4GOCA 2FCQA 4HXDA 3QAQA 4N9F4 2JY6A 2MA9B 3DDCB 5J2RA 3PRMB 2KQSA 4DHZE 3AXCA 1WJ6A 1OGWA 4FBJB 1V5TA 3L10B 4IW0A 1SIFA 1QZEA 3RULA 2JPHA 2C7NB 3R66C 4I6LB 2JRHA 3ZUNA 1VCBA 1WGDA 2MQJA 3IFWB 4TKNA 1SGHA 1WM2A 2KOXA 3NZSA 5DPSA 4DK5A 1Z2MA 2ZPNA 2KLGA 3V6CB 3SD5A 3ML8A 2L00B 3R7QA 2C60A 3Q3JA 2KDIA 4E74A 5D6JB 5E6OA 3A4RA 3ZO5B 4DHJB 1IPGA 1R4NI 2KTFA 4GDKA 2WDTB 3APFA 1LXDA 2C9WB 2LGDA 3VQIA 2KHWB 3D32A 4ANVA 1I42A 4ZYNA 1WH3A 1WI0A 4AOFA 4CHKA 2KJRA 1WJUA 4GXBA 2I1KA 4K7UA 4URKA 1PQSA 3ZNHB 1V81A 2NR2A 4BVUC 3DBSA 2PEAA 3KW5B 2QHOA 2KQ7A 2KFJA 3ZVVA 4ANXA 1WM3A 2K1FA 3QIJA 2ZVOA 2N7DA 2MW5A 5C23A 4K81A 3V62A 4F1SA 5L83A 4WJNA 5D94A 5TR5A 3QA8A 1WXVA 2Z0EB 4WWPA 2MBOA 2Y5BB 2MWSB 4BKTA 2DZIA 2M1MA 2IO3B 2LJ5A 3DPDA 4W9GA 1WJNA 1EO6A 3WALA 4BKGA 1CMXB 3QCAA 1OEYA 3KYCD 3SHQA 2BYVE 3L13A 4NQLB 2FNJB 5GMVA 3WAPA 4BFRA 2N1VA 1P9DU 2BF8B 4G11A 1WGYA 4ASWC 4FA6A 2K6QA 4A20A 1GNUA 4K7WA 2G3QB 2LASA 3H6NA 3DVNV 3ONSA 3W1YA 2JRIB 2L76A 2ZVNA 3IHPC 4KDIC 3PSEB 4IWPA 4IM3A 1V5OA 2DHZA 3NZUA 3M62B 3CSTA 2Z0DB 2PE9A 4PYUA 2NPTB 4GU2A 2R2OA 3VHTC 4WQOB 3A9JA 3A9KA 1P0RA 2XK5A 3A1QB 1XD3B 4MSQB 4EEWA 4W9DA 4WJOA 1WZ3A 4HDOA 3H1UA 2YLMA 3VUYA 3M3JA 2A4ZA 5AZGA 1C1YB 3EHVA 4FHJA 3KUZA 5IAAC 1RFAA 1UD7A 4W9IA 3MHSD 3PHXB 4WWNA 1BT0A 2L05A 3C0RB 1UBIA 3EECA 3N3KB 3A1QA 2DZMA 2K8CA 3JW0X 2CKHB 2KMAA 3H7PB 3PS6A 4HVBA 2ZCCA 3PREA 2IO1B 1WGGA 2KX0A 3IBEA 1LFDA 5JHAA 2IY0B 2GBMA 2KKCA 4BOZB 4DDGD 2AYOB 2FIDA 2FCNA 4TV3A 1Z5SB 2KN5A 4IM0A 3ZKJC 2FCSA 1XQQA 3JYUA 4NAWB 2IZVB 4HJKA 4NY0A 3JSVB 5CHWA 3U30A 3VUXA 2BYFA 1C3TA 2KC1A 4DDID 3DBRI 4LCDE 3RD2A 3KUCB 2AEHA 3VXWA 4FADA 3LJ3A 4IG7B 3UINB 3P2BA 4G3XB 2LVOA 3DCGA 4HCPB 3B08A 1P3QU 3A33B 3O65B 4HCNB 2RD0A 2XEWA 1NI2A 4BKSD 3OJ4B 3DBHI 4GDKB 3UGBB 3R7RA 2M4NA 4FJVB 2KFKA 3M63B 2PE6B 1L7YA 2KANA 2V3SA 2LRUA 3ML9A 1E90A 2G45B 2KC2A 3VH4B 3QHTA 3WIMA 4B6WA 2MP2B 3APDA 1R4MI 3PVLA 4A3OA 4MM3A 2LXAA 1P1AA 2D2QA 3RYTA 3L16A 4RM9A 1IYFA 1RRBA 1L2NA 1E8YA 4KSLC 2RGFA 3L17A 2LZ6A 4LJPB 4PS7A 5LLIA 1OTRB 3NHEB 4EUTA 4NJ6A 4BBNC 2NS5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4II2 B;  1V86 A;  1UEL A;  3AU4 A;  3AI5 A;  5KHO A;  2M0X A;  5DPW A;  2W9N A;  4BBN F;  3VTW A;  2RPQ A;  4FLH A;  4MGZ E;  2XBB C;  3NY5 A;  3HM3 A;  4M8N A;  4KVG B;  4WJQ A;  1I35 A;  4LDT D;  4NPN A;  3PHW B;  4KDL B;  1WE6 A;  1WMH A;  2J7Q B;  3N32 A;  2KWV B;  1H4R A;  4GMV A;  4MSM B;  4ICU A;  5CHV C;  3CMM B;  1WR6 E;  2CU1 A;  1GUA B;  3OJ3 A;  4FHK A;  2O6V B;  1P98 A;  3H7S A;  1SE9 A;  3ZW3 A;  1KJT A;  5E6P A;  1Q1O A;  3ZDT A;  3TBL D;  4BKS A;  2JT4 B;  3UIO B;  4GN1 A;  1Y8R C;  3ECI A;  4WWO A;  3VAW A;  4NQK E;  1TTN A;  4GSW A;  3ZNZ B;  2J0M A;  5D2M B;  3H9D A;  4PS8 A;  5AEK B;  1FXT B;  4IWQ A;  2DAJ A;  2ZNV B;  2KFK B;  1WJ4 A;  2BGF A;  2KVR A;  4ZDV A;  2LUE A;  1S1Q B;  4M8M A;  4W9L A;  3BY4 B;  2N7E A;  3VH3 B;  3VUW A;  1WMH B;  1IP9 A;  2AL6 A;  2DZJ A;  3RCZ A;  3GZN I;  3DBL I;  4DHZ B;  2L0F A;  2LVQ A;  4MEL A;  2O6V D;  3CSF A;  1ISN A;  1D3Z A;  2WWZ A;  3IVF A;  4GDL B;  1YX5 B;  4MJS A;  2M17 A;  1Q0W B;  4LJO B;  4KIK B;  1VD2 A;  1YJ1 A;  3I3T B;  4DHJ D;  4B95 A;  3UIP B;  2O2V A;  3X23 A;  4BOS C;  2D3G A;  3T9L A;  2KLC A;  5LXI B;  4GGQ A;  4II3 B;  3NS8 A;  4F7Z A;  1KM7 A;  4GB9 A;  4ICV A;  1WZ0 A;  4AJW A;  2KDF B;  2MP2 A;  4ZRJ A;  2JZZ A;  3WA0 A;  2B3A A;  3UQB A;  1OQY A;  2MBH A;  4KV2 A;  4MH0 E;  2DAF A;  3W1S A;  2MSE D;  2KZR A;  2O6V A;  4AUQ C;  2EMS A;  5KHQ A;  1V80 A;  1WY8 A;  2NBU A;  3SU8 X;  1OEY J;  2JVC A;  3UF8 A;  4MDK E;  3JSV A;  3VTV A;  2DX5 B;  3L0W B;  2N9X A;  4XZ4 A;  3DOW A;  3HHM A;  3ZDM C;  1YQB A;  2XK5 B;  3B1L X;  4M0W B;  2KX3 A;  3A9K B;  3PLU A;  1LM8 B;  1WFY A;  2YVC A;  2MBQ A;  2BYE A;  3ENE A;  4IWO A;  5AZF A;  4IUM B;  4RM8 A;  2VRR B;  3QWZ B;  2IY1 B;  1GC7 A;  3DVN U;  2MX2 A;  2CS4 A;  1YIW A;  3H7P A;  2KJ6 A;  3ZLZ A;  2JWZ A;  3HM6 X;  4KIK A;  3TL5 A;  3TJP A;  3EC8 A;  3LDZ E;  4MJS B;  5CX3 A;  2BKR B;  2MCN B;  2LRW A;  2AL3 A;  1V2Y A;  1H8C A;  1E8W A;  2L0T A;  1WX7 A;  1S3S G;  5FR6 A;  1WGR A;  2CR5 A;  1TZ1 A;  2I1J A;  2K8B A;  2GBR A;  4OVU A;  3QK0 A;  2IYD B;  1KOT A;  4AP4 C;  3EFU A;  2K6D B;  4EZL A;  4MGK E;  4PS3 A;  1Q5W B;  2M8S A;  4FUL A;  4XX5 A;  4RMA A;  4HK2 A;  4W9J A;  4TQ1 A;  2KO3 A;  3DVG Y;  1V6E A;  1WRD B;  1GG3 A;  3L54 A;  1M94 A;  3OAW A;  1K8R B;  4DXA B;  1WF9 A;  2LGX A;  1LQB A;  3KH0 A;  3PPA A;  2K8H A;  2IO0 B;  4OVV A;  2BWE S;  1WIA A;  2REX A;  2KNB A;  1ZW7 A;  4LDT B;  3UQA A;  2CHZ A;  4XC2 A;  1ZKH A;  3B0A A;  3VFK A;  4EOY A;  3ZNI D;  4IC7 B;  4EKU A;  3WAN A;  2HJ8 A;  3AUL A;  4MGI E;  4EZJ A;  4EZK A;  5IA7 A;  3VTU A;  4HDQ A;  3HK0 A;  2C5L C;  3VDZ A;  2LD9 A;  1AAR A;  2KTR B;  2J0K A;  3RUI B;  1XT9 B;  2FUH B;  5C1Z A;  4PYZ A;  4IM2 A;  2NVU I;  3Q3F A;  1ZGU B;  5JHB A;  3K9O B;  4GIV A;  3IG3 A;  2ZPY A;  1WGH A;  2ASQ A;  5HKH A;  1T0Y A;  3AU5 A;  4CO7 A;  1JRU A;  3TIX A;  3N30 A;  4I6N B;  2N1W A;  2WX0 A;  1RLF A;  3HIZ A;  4G50 A;  1F9J A;  2G4S A;  4CYE A;  3PTF C;  4W9H A;  3ALB A;  1WE7 A;  3S2A A;  2KD0 A;  3RZW C;  2DYO A;  2EMT A;  3T8M A;  3KVF B;  1MG8 A;  1V9J A;  2ZJD A;  2ZZP B;  2RSU A;  2IBI B;  3PT2 B;  4KZC A;  3RZF A;  4MGY E;  3V61 A;  4DBG A;  2OJR A;  4HWI B;  1UZX B;  2BKF A;  2ZNV C;  3M95 A;  5JZE B;  3QAR A;  2DYB A;  2GMI C;  3L08 A;  4NNJ B;  4TQ0 A;  2HD5 B;  3PRZ A;  4AJY B;  3ZNG C;  2J0J A;  2IO2 B;  4KZ0 A;  2DYM A;  5CTR C;  1WXA A;  2HE7 A;  4JLC A;  5L95 C;  1YD8 U;  4MEM A;  5J17 A;  2C7H A;  2OOB B;  3PGE A;  2O2V B;  1HE8 A;  4YL8 A;  3NOB A;  2WX1 A;  3MJW A;  1UGM A;  5LXH A;  1UH6 A;  2L3Z A;  2JUO A;  4HLE A;  4A3P A;  2UWQ A;  4TUU A;  2KTR A;  2EKE C;  2FCM A;  4W9F A;  2JXX A;  2CHX A;  2AWT A;  5DPT A;  5JH5 C;  4ANU A;  2LGY A;  4HPL B;  2L8J A;  2JF5 A;  3GOE A;  4AWJ A;  3CF6 E;  4K7S A;  2LI5 A;  3PLV A;  3ZRC A;  2G4D B;  1X1M A;  4HPM B;  3SDL C;  4WAA A;  1WX8 A;  3TMP B;  4FJY A;  2LVP A;  1WXS A;  1YX6 B;  4WJP A;  4KSK C;  3KUD B;  3QC8 B;  3TCA A;  2KWU B;  4I6P A;  2DZK A;  2MBE A;  4W9E A;  3QJZ A;  1E8Z A;  2LWP A;  4FJZ A;  2V4L A;  2JZ3 B;  2RR9 A;  4W9K A;  3BIN A;  3WAO A;  2FAZ A;  1U4A A;  2V1Y A;  3A4S C;  2BPS A;  2HTH A;  5DPR A;  3A9J B;  5EDS A;  2KJH B;  2D10 A;  2N9P C;  5BO4 B;  1G6J A;  3PV1 A;  1EUV B;  3U7D A;  1EF1 A;  1J19 A;  3PZD A;  4JIO U;  5G2N A;  2A5U A;  3K9P B;  1GJZ A;  4NAW A;  3ZTC A;  2C7M B;  1NBF C;  4FN2 A;  2KXJ A;  2BWF A;  4W9C A;  1TBE A;  2UYZ B;  3APC A;  5CHF A;  5D7G A;  2NCN A;  2K39 A;  1RAX A;  4ZRK A;  4J6I A;  1V49 A;  4ANW A;  3X0W A;  2N4F A;  2KWC A;  2KDE B;  3U8Z A;  2K25 A;  1GC6 A;  3DQV A;  4EFO A;  1NDD A;  4K1R B;  2LXC A;  4JL9 A;  2NBW B;  3QX1 A;  5G55 A;  3ZRF A;  3ZTD A;  1E7U A;  4P7I A;  1E7V A;  3V60 A;  1E8X A;  2CHW A;  1WYW B;  4E71 A;  1EF5 A;  2NBV B;  5AZH A;  3W1S C;  1J8C A;  4JQW C;  2D07 B;  3DVG X;  1E5W A;  5J18 A;  1J0G A;  4E3C A;  2NPT A;  4F8C B;  3OLM D;  3PRP B;  3R3M A;  4G0N B;  3MTN B;  2PJH A;  4JGH B;  2GBJ A;  2L7R A;  4ZRI A;  3ZIM A;  2MRP A;  1TGZ B;  2DEN B;  2ZCB A;  2GOW A;  2N9E B;  2GBN A;  2WYQ A;  2PPH A;  2D11 A;  2R2Q A;  1WXM A;  2FIF A;  2GBK A;  2KK8 A;  1A5R A;  1KLV A;  2KMC A;  5E6N A;  2MBB B;  3WAM A;  1UBQ A;  4X57 B;  2Z59 B;  3JVZ X;  4GDL A;  1WR1 A;  4NJ7 A;  3VVW B;  3RT3 B;  4DWF A;  3KYD D;  3V6E B;  3QQ8 B;  2MLB A;  2KDB A;  2ZEQ A;  5DCN A;  1WX9 A;  4B9K A;  4GOC A;  2FCQ A;  4HXD A;  3QAQ A;  4N9F 4;  2JY6 A;  2MA9 B;  3DDC B;  5J2R A;  3PRM B;  2KQS A;  4DHZ E;  3AXC A;  1WJ6 A;  1OGW A;  4FBJ B;  1V5T A;  3L10 B;  4IW0 A;  1SIF A;  1QZE A;  3RUL A;  2JPH A;  2C7N B;  3R66 C;  4I6L B;  2JRH A;  3ZUN A;  1VCB A;  1WGD A;  2MQJ A;  3IFW B;  4TKN A;  1SGH A;  1WM2 A;  2KOX A;  3NZS A;  5DPS A;  4DK5 A;  1Z2M A;  2ZPN A;  2KLG A;  3V6C B;  3SD5 A;  3ML8 A;  2L00 B;  3R7Q A;  2C60 A;  3Q3J A;  2KDI A;  4E74 A;  5D6J B;  5E6O A;  3A4R A;  3ZO5 B;  4DHJ B;  1IPG A;  1R4N I;  2KTF A;  4GDK A;  2WDT B;  3APF A;  1LXD A;  2C9W B;  2LGD A;  3VQI A;  2KHW B;  3D32 A;  4ANV A;  1I42 A;  4ZYN A;  1WH3 A;  1WI0 A;  4AOF A;  4CHK A;  2KJR A;  1WJU A;  4GXB A;  2I1K A;  4K7U A;  4URK A;  1PQS A;  3ZNH B;  1V81 A;  2NR2 A;  4BVU C;  3DBS A;  2PEA A;  3KW5 B;  2QHO A;  2KQ7 A;  2KFJ A;  3ZVV A;  4ANX A;  1WM3 A;  2K1F A;  3QIJ A;  2ZVO A;  2N7D A;  2MW5 A;  5C23 A;  4K81 A;  3V62 A;  4F1S A;  5L83 A;  4WJN A;  5D94 A;  5TR5 A;  3QA8 A;  1WXV A;  2Z0E B;  4WWP A;  2MBO A;  2Y5B B;  2MWS B;  4BKT A;  2DZI A;  2M1M A;  2IO3 B;  2LJ5 A;  3DPD A;  4W9G A;  1WJN A;  1EO6 A;  3WAL A;  4BKG A;  1CMX B;  3QCA A;  1OEY A;  3KYC D;  3SHQ A;  2BYV E;  3L13 A;  4NQL B;  2FNJ B;  5GMV A;  3WAP A;  4BFR A;  2N1V A;  1P9D U;  2BF8 B;  4G11 A;  1WGY A;  4ASW C;  4FA6 A;  2K6Q A;  4A20 A;  1GNU A;  4K7W A;  2G3Q B;  2LAS A;  3H6N A;  3DVN V;  3ONS A;  3W1Y A;  2JRI B;  2L76 A;  2ZVN A;  3IHP C;  4KDI C;  3PSE B;  4IWP A;  4IM3 A;  1V5O A;  2DHZ A;  3NZU A;  3M62 B;  3CST A;  2Z0D B;  2PE9 A;  4PYU A;  2NPT B;  4GU2 A;  2R2O A;  3VHT C;  4WQO B;  3A9J A;  3A9K A;  1P0R A;  2XK5 A;  3A1Q B;  1XD3 B;  4MSQ B;  4EEW A;  4W9D A;  4WJO A;  1WZ3 A;  4HDO A;  3H1U A;  2YLM A;  3VUY A;  3M3J A;  2A4Z A;  5AZG A;  1C1Y B;  3EHV A;  4FHJ A;  3KUZ A;  5IAA C;  1RFA A;  1UD7 A;  4W9I A;  3MHS D;  3PHX B;  4WWN A;  1BT0 A;  2L05 A;  3C0R B;  1UBI A;  3EEC A;  3N3K B;  3A1Q A;  2DZM A;  2K8C A;  3JW0 X;  2CKH B;  2KMA A;  3H7P B;  3PS6 A;  4HVB A;  2ZCC A;  3PRE A;  2IO1 B;  1WGG A;  2KX0 A;  3IBE A;  1LFD A;  5JHA A;  2IY0 B;  2GBM A;  2KKC A;  4BOZ B;  4DDG D;  2AYO B;  2FID A;  2FCN A;  4TV3 A;  1Z5S B;  2KN5 A;  4IM0 A;  3ZKJ C;  2FCS A;  1XQQ A;  3JYU A;  4NAW B;  2IZV B;  4HJK A;  4NY0 A;  3JSV B;  5CHW A;  3U30 A;  3VUX A;  2BYF A;  1C3T A;  2KC1 A;  4DDI D;  3DBR I;  4LCD E;  3RD2 A;  3KUC B;  2AEH A;  3VXW A;  4FAD A;  3LJ3 A;  4IG7 B;  3UIN B;  3P2B A;  4G3X B;  2LVO A;  3DCG A;  4HCP B;  3B08 A;  1P3Q U;  3A33 B;  3O65 B;  4HCN B;  2RD0 A;  2XEW A;  1NI2 A;  4BKS D;  3OJ4 B;  3DBH I;  4GDK B;  3UGB B;  3R7R A;  2M4N A;  4FJV B;  2KFK A;  3M63 B;  2PE6 B;  1L7Y A;  2KAN A;  2V3S A;  2LRU A;  3ML9 A;  1E90 A;  2G45 B;  2KC2 A;  3VH4 B;  3QHT A;  3WIM A;  4B6W A;  2MP2 B;  3APD A;  1R4M I;  3PVL A;  4A3O A;  4MM3 A;  2LXA A;  1P1A A;  2D2Q A;  3RYT A;  3L16 A;  4RM9 A;  1IYF A;  1RRB A;  1L2N A;  1E8Y A;  4KSL C;  2RGF A;  3L17 A;  2LZ6 A;  4LJP B;  4PS7 A;  5LLI A;  1OTR B;  3NHE B;  4EUT A;  4NJ6 A;  4BBN C;  2NS5 A; 
#chains in the Genus database with same CATH topology
 1VZ7 A;  1V86 A;  1B9R A;  3AI5 A;  1GAQ B;  3VTW A;  5I4D A;  1K53 A;  4WJQ A;  3PHW B;  2J7Q B;  3NUH B;  2CJN A;  3CMM B;  3OJ3 A;  2CU1 A;  1GUA B;  4FHK A;  2INP E;  1N60 A;  3ECI A;  4WWO A;  1E10 A;  4GSW A;  3BYY B;  1N63 A;  3RNF C;  3H9D A;  4OHJ A;  1WJ4 A;  2X38 A;  2N7E A;  3VUW A;  1XEE A;  2DZJ A;  4WH4 A;  3GZN I;  3DBL I;  2LVQ A;  2V3N A;  3KWL A;  3Q8E A;  5EE9 A;  1T6B X;  5BYR A;  1JRO A;  3IVF A;  2M17 A;  1BML C;  4LJO B;  4UDU C;  5BMG A;  2D3A A;  1YJ1 A;  2V4I B;  3I3T B;  3UIP B;  4BOS C;  3MC8 A;  3U52 E;  2IJ0 A;  4II3 B;  3NS8 A;  4GB9 A;  2GI9 A;  3KLS X;  4HKZ E;  2DAF A;  3R8B A;  5EE3 A;  4AUQ C;  3UF8 A;  3VTV A;  3ZXV A;  2N9X A;  4BZA A;  3PLU A;  1LM8 B;  2YVC A;  2MBQ A;  2BYE A;  3ENE A;  4IWO A;  2V3P A;  4IUM B;  2KN4 A;  1YN4 A;  2AQ3 B;  1GC7 A;  3DVN U;  2CS4 A;  2JWZ A;  3HM6 X;  2BKR B;  3ZYY X;  1EM7 A;  1V2Y A;  1LO5 D;  1S3S G;  5FR6 A;  3P63 A;  2QDF A;  2M8S A;  4RMA A;  1FPY A;  4TQ1 A;  5LNK 1;  2KO3 A;  3DVG Y;  1GG3 A;  1M94 A;  4DXA B;  2IO0 B;  4IKG A;  4JPS A;  4OZC A;  3UQA A;  3Q2A C;  2CHZ A;  3ZJU A;  1VR9 A;  2HJ8 A;  4MGI E;  4M00 A;  4EZK A;  3VTU A;  2J52 A;  2C5L C;  5C1Z A;  4PYZ A;  1CK1 A;  4IM2 A;  1YNT E;  2WXP A;  2NVU I;  4HKQ A;  2W3R A;  5BMI A;  2WS3 B;  4L23 A;  3PTF C;  3AEA B;  3FC4 A;  2H89 B;  3RZW C;  2DYO A;  4KX6 B;  1JAL A;  2WXK A;  4DBG A;  4HWI B;  1HZ5 A;  2ZNV C;  3ZGZ A;  2GMI C;  4AJY B;  2DYM A;  5CTR C;  4JLC A;  4DXF A;  1YD8 U;  5J17 A;  3PGE A;  1HE8 A;  4YL8 A;  3NOB A;  2WX1 A;  4XDD A;  2FCM A;  4W9F A;  5JH5 C;  3GOE A;  4AWJ A;  1MHH E;  2PTL A;  1X1M A;  1XXG A;  2JXT A;  4C4V B;  2BS2 B;  4HJG E;  2ZW0 A;  1XCT L;  4KSK C;  1A70 A;  3KUD B;  2KWU B;  3UI3 A;  2N0S B;  1L0Y B;  4W9E A;  1E8Z A;  2WDQ B;  5IP4 D;  2FAZ A;  1U4A A;  2V1Y A;  2BPS A;  2HTH A;  2RDB C;  3A9J B;  5EDS A;  2KJH B;  1P7F A;  4A6Q A;  1ZXH A;  1KF6 B;  1J19 A;  4JIO U;  4LK0 M;  1NBF C;  4FN2 A;  1RYJ A;  4W9C A;  1TBE A;  2UYZ B;  2NCN A;  2K39 A;  4ANW A;  3X0W A;  5BYS A;  2N4F A;  2KWC A;  2KDE B;  4WWM A;  4IDI A;  2LXC A;  2PKO A;  4JL9 A;  2NBW B;  1DOI A;  1JML A;  3ZTD A;  1E7U A;  1HXY D;  1E8X A;  1ZP0 B;  2CHW A;  1WYW B;  4L1B A;  2FUG 1;  3DVG X;  2M19 A;  4JGH B;  1SBB B;  4Q2J A;  1TGZ B;  2DEN B;  2GOW A;  2GBN A;  2HJ1 A;  4RGM A;  2D11 A;  2R2Q A;  1WXM A;  2GBK A;  1A5R A;  4HRO A;  3WAM A;  1BUI C;  3AE6 B;  1V8C A;  5AUK A;  3VVW B;  3OG5 A;  3BWU D;  1T0Q C;  2LJI A;  3LYY A;  4DWF A;  3AB5 A;  1RFK A;  5DCN A;  4GOC A;  2V0G A;  1JWB D;  1E0Z A;  4NJC A;  2IPK D;  2KQS A;  1F52 A;  4IW0 A;  1SIF A;  1QZE A;  2C7N B;  1T0R C;  3ZUN A;  1VCB A;  3IFW B;  2MQJ A;  4TKN A;  4P1C C;  1SGH A;  4A8X C;  1EWC A;  2KOX A;  3NZS A;  5DPS A;  4CQN A;  1Z2M A;  2KLG A;  3SD5 A;  5G5G A;  2L00 B;  2C60 A;  1ZUD 2;  5D6J B;  2PIA A;  4JWU C;  4DHJ B;  2N9K A;  2KTF A;  3FAH A;  2KVZ A;  2WDT B;  2C9W B;  1J7A A;  1K52 A;  2KHW B;  2DBY A;  4LTU A;  1WH3 A;  2I1K A;  1PQS A;  1HQR D;  4ARI A;  2QHO A;  4LNF A;  3ZVV A;  1WM3 A;  1R4N B;  4YSZ B;  4F1S A;  3VRA B;  2L83 A;  1GB4 A;  4WWP A;  1I4P A;  2LJ5 A;  1KLG D;  4OW0 A;  4W9G A;  1WJN A;  1RM6 C;  1EO6 A;  3WAL A;  4BKG A;  5EE0 A;  3QCA A;  3AE8 B;  1TZO A;  2N1V A;  1P9D U;  4FA6 A;  2K6Q A;  4HRS A;  3MFG A;  3CIR B;  1QOG A;  2ZVN A;  2L76 A;  4KDI C;  3PSE B;  1DOY A;  3NZU A;  4A55 A;  2NPT B;  1FNW A;  2Q5W D;  2XK5 A;  5AZG A;  1L6U A;  2SAK A;  3KUZ A;  3NS1 A;  1BT0 A;  2L05 A;  2DZM A;  2K8C A;  3JW0 X;  3GB1 A;  1V97 A;  2KMA A;  1WGG A;  3PO0 A;  1QOF A;  1CZP A;  3RNG C;  1Z5S B;  4REZ A;  1N5W A;  1HEZ E;  1XQQ A;  1KFY B;  1NEN B;  2IZV B;  3NVY A;  2KC1 A;  3KUC B;  1SF0 A;  3V3X A;  3UIN B;  4IG7 B;  4FAD A;  2KWD A;  3DCG A;  1P3Q U;  2QSD A;  1NI2 A;  4GDK B;  3UGB B;  4WUR A;  3ZQ4 A;  1FCL A;  2KFK A;  3P4S B;  2VH2 A;  2V3S A;  2G45 B;  3VH4 B;  3QHT A;  2MP2 B;  3APD A;  5HFY A;  2LXA A;  4DXG A;  3NVV A;  2LZ6 A;  3FKY A;  2NS5 A;  3MJW A;  4II2 B;  2BB6 A;  1UEL A;  3AU4 A;  2M0X A;  2W9N A;  4BBN F;  4ARC A;  2RPQ A;  1XLQ A;  3AMZ A;  4MGZ E;  3NY5 A;  1QIL A;  4YSY B;  1WE6 A;  1WMH A;  3N32 A;  4GMV A;  4C80 A;  1FRD A;  1P98 A;  1KJT A;  2IGD A;  5E6P A;  1Q1O A;  4J3O D;  4BKS A;  2JT4 B;  4GN1 A;  3VAW A;  2FE8 A;  5AEK B;  2FBW B;  2K9X A;  4IWQ A;  4ZDV A;  4W9L A;  3RCZ A;  1IBX B;  3BVM A;  1TKY A;  4JX1 C;  1C76 A;  1D3Z A;  4MJS A;  1XCQ L;  1Q0W B;  3FIL B;  3HRD D;  1VD2 A;  1D4B A;  2RDH A;  2D3G A;  3NVZ A;  5LXI B;  1R4M B;  5FK9 C;  1L5P A;  1AN8 A;  2VZK D;  1QOB A;  2JZZ A;  2B3A A;  3R2I A;  1OQY A;  4KV2 A;  3W1S A;  4R3D A;  2KT7 A;  2KZR A;  2MSE D;  4P6V F;  5KHQ A;  2LMC A;  2IGH A;  3L0W B;  1PGB A;  2WP9 B;  3ZDM C;  3A9K B;  2HTM E;  1WFY A;  1TY2 A;  1KTK A;  5AZF A;  4RM8 A;  2QMT A;  1JW9 D;  2IY1 B;  3QWZ B;  2MX2 A;  3H7P A;  2PMV A;  2WXR A;  4YSX B;  4MJS B;  1FEH A;  1ET9 A;  2AL3 A;  3E56 A;  1H8C A;  2CR5 A;  4IOI E;  2GBR A;  4OVU A;  3QK0 A;  1KOT A;  4AP4 C;  2K6D B;  4S17 A;  3W9C B;  4W9J A;  2LGX A;  3KH0 A;  2BWE S;  2REX A;  2WXF A;  2VZK B;  1PDX A;  1ZKH A;  3B0A A;  2ACZ B;  1MHX A;  3HK0 A;  2D3C A;  3VDZ A;  1AAR A;  2J0K A;  1XLO A;  4NZL B;  5TSS A;  2OED A;  2M56 B;  1TS3 A;  3Q3F A;  1ZGU B;  2I38 A;  2GLS A;  2WXJ A;  1WGH A;  1WWT A;  2ASQ A;  5HKH A;  4CO7 A;  2WXO A;  2LHD A;  1N6Z A;  2WX0 A;  2GRI A;  3HIZ A;  2XN9 C;  2G4S A;  4G50 A;  4W9H A;  1C77 A;  3ALB A;  3S2A A;  3AV8 A;  1WXQ A;  2EMT A;  3KVF B;  2OJR A;  1UZX B;  5JZE B;  3QAR A;  4RF0 A;  2HD5 B;  2J0J A;  2IO2 B;  1E6E B;  3I63 C;  5L95 C;  4ZOH C;  2O2V B;  2LHE A;  1P7E A;  3NRZ A;  5LXH A;  2L3Z A;  2JUO A;  4HLE A;  1UNS A;  4A3P A;  2UWQ A;  4TUU A;  2QC8 A;  2EKE C;  5DPT A;  1SEB D;  2AWT A;  1J7B A;  2L8J A;  3CF6 E;  4K7S A;  2LI5 A;  2MHJ A;  4WAA A;  2GB1 A;  1WX8 A;  2BTE A;  3AE3 B;  3TMP B;  1WXS A;  3QC8 B;  1C4P A;  4I6P A;  3QJZ A;  1BXT A;  2JZ3 B;  3A4S C;  2D10 A;  2N9P C;  1EUV B;  3U7D A;  3PZD A;  2ICI A;  3GP7 A;  3C8Y A;  1FMA D;  3LXF A;  3APC A;  5CHF A;  5D7G A;  2BS4 B;  4AQ7 A;  3AED B;  3Q6B A;  1V49 A;  2WNM A;  3TEY A;  3I57 A;  3VRB B;  5G55 A;  4EE2 A;  3ZRF A;  4RH6 A;  4E71 A;  2KAC A;  1EF5 A;  3W1S C;  1J8C A;  4JQW C;  1GPX A;  1E5W A;  2W54 A;  2BQQ A;  4E3C A;  2GBJ A;  4ZRI A;  3ZIM A;  2ZCB A;  2K0P A;  2WYQ A;  1KLV A;  4RF1 A;  3P1M A;  1I4H A;  4YT0 B;  1PYW D;  5E6N A;  2MBB B;  2WQY B;  4X57 B;  3JVZ X;  1WR1 A;  4NJ7 A;  1UUP A;  3EUB 2;  2MLB A;  2JYE A;  2ZEQ A;  1WX9 A;  4B9K A;  4N9F 4;  5D3D A;  2KAJ A;  3AXC A;  4FBJ B;  2QJL A;  3RUL A;  1NVI D;  3R66 C;  4I6L B;  1JWS D;  2ZPN A;  1I4R A;  1ENF A;  5E6O A;  1I4G A;  3IT6 B;  3BVZ A;  2LGD A;  4M02 A;  3BYT B;  2KJR A;  1ACC A;  4K7U A;  3BVG A;  3O13 A;  5FKA C;  2PEA A;  2KQ7 A;  2KFJ A;  3P4Q B;  2N7D A;  2MW5 A;  5C23 A;  4K81 A;  5L83 A;  5D94 A;  2WXG A;  1DGJ A;  1FXI A;  1FNU A;  3LB8 C;  3RI7 C;  2LFI A;  2Y5B B;  1FCC C;  2E6X A;  1ZDV A;  2M1M A;  1CMX B;  3ZJV A;  1OEY A;  1NYR A;  2JSV X;  3L13 A;  1HZ6 A;  2FNJ B;  1VRA B;  4BFR A;  5T8I A;  3DHG C;  1GNU A;  1PFD A;  2G3Q B;  3ONS A;  2K22 A;  4IM3 A;  2PVO D;  2DHZ A;  1TJE A;  2PE9 A;  2R2O A;  3VHT C;  2TSS A;  1IGC A;  1KH0 A;  2G9H D;  3A9K A;  1L4Z B;  1AYF A;  1P0R A;  4EEW A;  4WJO A;  1F1H A;  3H1U A;  4ITK A;  3VUY A;  2A4Z A;  1M4V A;  1RWS A;  1VJK A;  1RFA A;  1NEK B;  3PHX B;  2RDG A;  1UBI A;  2DLB A;  3EEC A;  3SEB A;  3N1X C;  4HVB A;  3PRE A;  1QOA A;  2QCZ A;  1FRR A;  5JHA A;  1F2R I;  1TT5 B;  2W3S A;  3ZKJ C;  3Q3M C;  3JYU A;  4HJK A;  1C3T A;  4LCD E;  3B08 A;  2WXH A;  4LNK A;  1OQQ A;  2M4N A;  4XDC A;  2KAN A;  3WIM A;  4B6W A;  4YTN B;  2JYT A;  3W5V B;  1N61 A;  1V1O A;  3AE7 B;  2LUM A;  3EGR A;  3VR8 B;  1L2N A;  1E8Y A;  4KSL C;  3L17 A;  5LLI A;  1PUT A;  3DBR B;  1C4A A;  1DOX A;  2XBB C;  4LDT D;  5IKC M;  3AE1 B;  1WSP A;  1WR6 E;  1JRP A;  2O6V B;  3H7S A;  1CJE A;  3ZW3 A;  2NTT A;  3ZDT A;  3TBL D;  2WXI A;  1VZ8 A;  3UIO B;  1TTN A;  2J0M A;  5D2M B;  4PS8 A;  1EU4 A;  1QT9 A;  2DAJ A;  2KVR A;  2LUE A;  1S1Q B;  4M8M A;  4N6E B;  3VH3 B;  1IP9 A;  2AL6 A;  3PZ7 A;  4C4V A;  4WIP A;  1SJE D;  3CSF A;  1ISN A;  1FIQ A;  1GB1 A;  2K5P A;  3DHH C;  3MC0 B;  1D6E C;  3T9L A;  4FXC A;  4GGQ A;  3RMK C;  4F7Z A;  4ICV A;  1WZ0 A;  4AJW A;  3BZD B;  2KDF B;  2MP2 A;  4ZRJ A;  1JCK B;  3WA0 A;  3UQB A;  2MBH A;  2YEP F;  2OJW A;  2EMS A;  1V80 A;  1WY8 A;  2E3T A;  4MDK E;  3JSV A;  2DX5 B;  4XZ4 A;  1IGD A;  3DOW A;  1YQB A;  3B2G A;  4M0W B;  3B1L X;  2I2Y A;  4ZRQ A;  2VRR B;  2DNF A;  2EEL A;  5EE1 A;  1JWM D;  2KJ6 A;  3ZLZ A;  4KIK A;  2JQR B;  3T3N A;  3EC8 A;  5CX3 A;  3EFC A;  1C9F A;  2MCN B;  2EKI A;  5HI1 A;  2LRW A;  4TMA B;  1E8W A;  2L0T A;  1TZ1 A;  1TY0 A;  1NI3 A;  1UGJ A;  4YTM B;  2IYD B;  3IXS A;  3EFU A;  2Y3A A;  3RN9 C;  4PS3 A;  1Q5W B;  4XX5 A;  3Q14 C;  3OAW A;  1WRD B;  3L54 A;  1K8R B;  1WF9 A;  4OVV A;  3RUI B;  1I7H A;  3URY A;  2K8H A;  2KNB A;  1ZW7 A;  4KGR A;  1YJJ A;  4XC2 A;  1GOZ A;  3VFK A;  1SB3 C;  3ZNI D;  4EKU A;  3WAN A;  4HDQ A;  2LD9 A;  4C7Y A;  4C7Z A;  5JHB A;  1NYQ A;  3DHI C;  3IG3 A;  2KYW A;  3TEZ A;  3N30 A;  4I6N B;  1RLF A;  4A90 A;  4WQM A;  1FM0 D;  1N62 A;  1WE7 A;  5FR3 A;  2KD0 A;  3B2F A;  2MEK A;  4MT5 A;  3T8M A;  1FO4 A;  2ZJD A;  2ZZP B;  3V61 A;  2IBI B;  1SSN A;  4MGY E;  3RZF A;  2BKF A;  3M95 A;  3C19 A;  1WRI A;  2DYB A;  3TSS A;  4NNJ B;  1I4X A;  1WXA A;  2N9L A;  4LNN A;  4M01 A;  1UGM A;  1V1P A;  1B1Z A;  1UF0 A;  1XLN A;  2JXX A;  5H8Y E;  4ANU A;  4HPL B;  3ZRC A;  2G4D B;  4HPM B;  1FNV A;  2LVP A;  2H88 B;  4ZHP A;  1TIF A;  2BW2 A;  4GLS C;  2MBE A;  2ZW1 A;  1L4D B;  3IAS 1;  2V4L A;  3BIN A;  4H2A A;  5BO4 B;  1G6J A;  1EF1 A;  2BT6 A;  1GJZ A;  2A5U A;  3K9P B;  3ZTC A;  2BWF A;  1KLU D;  4ZRK A;  4J6I A;  1Y56 A;  1L0X B;  2K25 A;  5GXG B;  3DQV A;  4EFO A;  4K1R B;  1UWX A;  3RPF C;  3TUO A;  2WXL A;  2WDR B;  1E7V A;  2RPV A;  4OZB A;  2BVC A;  1XLP A;  4B0E A;  2XNA C;  1CQV A;  3RNC C;  2DWQ A;  5J18 A;  1J0G A;  4F8C B;  2W82 A;  3PRP B;  4G0N B;  3NG0 A;  2PJH A;  2L7R A;  3I5J C;  2N9E B;  1MPE A;  2PPH A;  2FIF A;  4GDL A;  3W2D A;  5C3J B;  3OWE B;  3KYD D;  3V6E B;  3QQ8 B;  4HXD A;  3QAQ A;  2INC C;  2MA9 B;  3B9J A;  1TS2 A;  3DDC B;  4WAF A;  1WJ6 A;  2WXN A;  2SEB D;  2QIE B;  2JPH A;  2JRH A;  1WGD A;  1HA5 A;  3U4E G;  1WM2 A;  3V6C B;  3Q3J A;  3AEC B;  4E74 A;  3MC9 A;  2Y5P A;  4DQO C;  1R4N I;  1MVK A;  2R61 A;  3APF A;  1LXD A;  2AQ2 B;  5C2T B;  4KKI A;  4ZHO A;  3AH7 A;  3PZ8 A;  4ANV A;  1TS5 A;  1I42 A;  1STE A;  1D5X C;  4CHK A;  4GXB A;  1QLB B;  3BK2 A;  3ZNH B;  4BVU C;  4YTP B;  3DBS A;  4ANX A;  2ZVO A;  1YQ3 B;  2OHF A;  4WJN A;  5TR5 A;  1C78 A;  1WXV A;  3RNA C;  4RGN A;  1VDV A;  5D3I B;  2MBO A;  1ESF A;  2DZI A;  1MJD A;  2IO3 B;  3DPD A;  1FD6 A;  3AE4 B;  3GE8 C;  3RFZ B;  4AS1 A;  2BYV E;  4NQL B;  3Q69 A;  4MH8 A;  2IND C;  1YN5 A;  3AEG B;  1WGY A;  2INN E;  4ASW C;  2PW9 A;  4K7W A;  1F0Z A;  3H6N A;  3DVN V;  3W1Y A;  1C79 A;  4ZRP A;  1V5O A;  1N5X A;  2PVG C;  2Z0D B;  1QKZ A;  4PYU A;  4WQO B;  1SE4 A;  3N1Z C;  1XD3 B;  4MSQ B;  4HDO A;  3EHV A;  4P16 A;  2LGS A;  4W9I A;  3P4P B;  5IOI A;  4LNI A;  1C4C A;  4WWN A;  2V9H A;  1TYG B;  3C0R B;  3HVD A;  3N3K B;  2CKH B;  3PS6 A;  1JWU D;  2IO1 B;  1TKE A;  3U2S C;  3IBE A;  2GBM A;  4KKJ A;  2KKC A;  4DDG D;  2AYO B;  4KGT A;  2FCN A;  4TV3 A;  2WGS A;  2FCS A;  4RCO A;  1WGK A;  4NAW B;  4NY0 A;  2BYF A;  1ZPS A;  3RD2 A;  2AEH A;  3VXW A;  3Q3N C;  3LJ3 A;  5BYQ A;  2LVO A;  4HCP B;  4K3C A;  2CU3 A;  3O65 B;  4HCN B;  4USA A;  4BKS D;  3DBH I;  3R7R A;  2W55 A;  1L7Y A;  2N7J A;  1SIJ A;  1R7S A;  3PVL A;  4A3O A;  3VR9 B;  1P1A A;  4RM9 A;  2YEP B;  1RRB A;  5AUI A;  4NJ6 A;  4BBN C;  4RGO S;  3P4R B;  1PGA A;  5KHO A;  5DPW A;  2D5G A;  4FLH A;  3HM3 A;  4M8N A;  4KVG B;  4ACF A;  1I35 A;  4NPN A;  1AWD A;  4KDL B;  2KWV B;  1H4R A;  4MSM B;  5G5H A;  4ICU A;  5CHV C;  1YN3 A;  2QEJ C;  3AE2 B;  1SE9 A;  3H8H A;  1T0S C;  4N58 A;  4PK1 A;  3MP9 A;  1Y8R C;  3HUI A;  4XE0 A;  3IT4 B;  4NQK E;  3DWM A;  3ZNZ B;  4D2K A;  1FXT B;  2ONQ A;  1TKG A;  2KFK B;  2ZNV B;  2BGF A;  2Z8L A;  1MFW A;  1SJH D;  3BY4 B;  3MJ5 A;  1WMH B;  4DHZ B;  2L0F A;  4MEL A;  2WU2 B;  2O6V D;  2KQ4 X;  2WWZ A;  4GDL B;  1YX5 B;  1MG4 A;  3DBH B;  4KIK B;  1SE3 A;  1YJI A;  1J7C A;  4DHJ D;  4B95 A;  4XWW A;  2BS3 B;  2O2V A;  3X23 A;  3ABV B;  2KLC A;  4N59 A;  4XWT A;  1T3Q A;  1KM7 A;  1IBX A;  1YQ4 B;  1D5Z C;  4MH0 E;  3T3O A;  2O6V A;  2JU6 X;  2NBU A;  3SU8 X;  1FFV A;  1OEY J;  1AW7 A;  1YOV B;  2JVC A;  3I9V 1;  3DBL B;  3L4P A;  2MJD A;  3HHM A;  1MI0 A;  2XK5 B;  2KX3 A;  2L1A A;  4LLG M;  4PT5 A;  2UU7 A;  4XGA B;  1YIW A;  2PLP A;  1K50 A;  2VH1 A;  3TJP A;  3LDZ E;  3TL5 A;  4RGT A;  2K3U A;  4YXD B;  1WX7 A;  2IGG A;  1WGR A;  2G1E A;  2I1J A;  2K8B A;  4KGS A;  1K51 A;  4EZL A;  4MGK E;  4FUL A;  4HK2 A;  1V6E A;  3KWV A;  3PPA A;  1LQB A;  2AQ1 B;  2LGI A;  1WIA A;  3NZ3 A;  4LDT B;  1Q10 A;  4EOY A;  4IC7 B;  3N20 C;  3AUL A;  4EZJ A;  2BB5 A;  5IA7 A;  2WLB A;  2KTR B;  1V1P B;  1OQR A;  1XT9 B;  2FUH B;  3MHZ A;  4YWG G;  3K9O B;  4GIV A;  1ZOY B;  2ZPY A;  1T0Y A;  3AU5 A;  3Q8B A;  4QAY A;  1JRU A;  3TIX A;  2N1W A;  1F9J A;  2WDV B;  4CYE A;  1XO3 A;  3Q8A A;  2RMM A;  1JWA D;  3TEW A;  4NAM A;  1MG8 A;  1V9J A;  2JZP A;  3PT2 B;  2RSU A;  4KZC A;  3AEB B;  3NVW A;  2J53 A;  2WXM A;  2KMM A;  3L08 A;  4TQ0 A;  3PRZ A;  3ZNG C;  1E7P B;  4KZ0 A;  1IUE A;  2HE7 A;  3AEE B;  4MEM A;  4A9A A;  2C7H A;  2D3B A;  2OOB B;  1UH6 A;  1KRH A;  4S0R A;  2KTR A;  2JX5 A;  2CHX A;  2LGY A;  2X8X X;  2JF5 A;  4L2Y A;  1JQ4 A;  3PLV A;  3KQ4 A;  4US9 A;  1XF5 L;  2M0A A;  3E9S A;  3SDL C;  1SXT A;  1DYQ A;  3BK1 A;  5E6J A;  4FJY A;  1YX6 B;  4WJP A;  3R2T A;  3TCA A;  2LEK A;  2DZK A;  4HEA 1;  2LWP A;  4FJZ A;  4W9K A;  2HDE A;  3AM9 A;  1FFU A;  2RR9 A;  3WAO A;  5H92 C;  1ZXI A;  2KDM A;  1L0V B;  5DPR A;  4HPP A;  2ON8 A;  3PV1 A;  4ZYS A;  3DWG C;  4TSS A;  5G2N A;  4NAW A;  2C7M B;  1L6V A;  3Q8F A;  2KXJ A;  4JE3 B;  2J42 A;  1RAX A;  1SE2 A;  5MPO A;  3U8Z A;  3GZN B;  1GC6 A;  1NDD A;  3QX1 A;  1YMH E;  4K3B A;  1T5X D;  4LNO A;  4P7I A;  1LGR A;  3AE5 B;  3V60 A;  2Y5C A;  2NBV B;  3GS2 A;  3ZJT A;  5AZH A;  3Q8C A;  2D07 B;  3CWI A;  2QIL A;  2NPT A;  2IDY A;  3OLM D;  3R3M A;  3MTN B;  2MRP A;  3Q3O C;  3BII D;  4US8 A;  1VZ6 A;  2KK8 A;  2KMC A;  1UBQ A;  2Z59 B;  3RT3 B;  3WCQ A;  2KDB A;  2FCQ A;  1QQR A;  2JY6 A;  5J2R A;  3PRM B;  4DHZ E;  1OGW A;  1HTO A;  1V5T A;  3L10 B;  3ZXR A;  4DK5 A;  3ML8 A;  3R7Q A;  2WU5 B;  2KDI A;  3A4R A;  3ZO5 B;  2WHI A;  1IPG A;  4C00 A;  4GDK A;  3RNB C;  5HG2 A;  3VQI A;  3D32 A;  4JWS C;  4ZYN A;  1WI0 A;  4AOF A;  1WJU A;  2L52 A;  1OFF A;  4URK A;  1QF6 A;  1V81 A;  2NR2 A;  1FXA A;  5IN7 A;  3KW5 B;  2WXQ A;  2K1F A;  3QIJ A;  4OZA A;  3V62 A;  3N1Y C;  5JXV A;  5HHD G;  1F77 A;  3QA8 A;  5BMH A;  2Z0E B;  1TS4 A;  3SFE B;  2MWS B;  1E9M A;  4BKT A;  1PGX A;  3EA6 A;  3KYC D;  3HVZ A;  3SHQ A;  3J9C A;  5GMV A;  3WAP A;  3U7Z A;  1WYG A;  2BF8 B;  4G11 A;  4A20 A;  4C56 C;  2BYT A;  2LAS A;  3AEF B;  1ZE3 D;  1ZDX A;  3AN1 A;  2JRI B;  3IHP C;  4IWP A;  2CJO A;  3M62 B;  3CST A;  4GU2 A;  3A9J A;  2NTS A;  2AX5 A;  2L32 A;  3N9Y C;  1UWM A;  3IAM 1;  4M0W A;  3A1Q B;  4W9D A;  3TEX A;  1WZ3 A;  2YLM A;  3M3J A;  4MAC A;  3SR6 A;  1C1Y B;  2NMQ A;  4FHJ A;  5IAA C;  1UD7 A;  3MHS D;  2JWU A;  4MM3 B;  1ROE A;  3SFD B;  3W5U B;  4XYC A;  3A1Q A;  1F2R C;  3H7P B;  2ZCC A;  2KX0 A;  1LFD A;  2IY0 B;  2BBC A;  4BOZ B;  2MH7 A;  2FID A;  4RFB A;  2KN5 A;  4IM0 A;  5CHW A;  2B76 B;  3VUX A;  3JSV B;  3U30 A;  4P1B C;  4DDI D;  3DBR I;  3P2B A;  4G3X B;  2J4X A;  4OVZ A;  3P42 A;  3A33 B;  3V05 A;  2RD0 A;  2XEW A;  3OJ4 B;  4BAX A;  1ET6 A;  4FJV B;  4B0M A;  3M63 B;  3ETR A;  2PE6 B;  2MJ3 A;  1EU3 A;  3ML9 A;  1E90 A;  2KC2 A;  2LRU A;  3AE9 B;  1VLB A;  1R4M I;  2MJE A;  4MM3 A;  1I4Q A;  2D2Q A;  3RYT A;  3RNE C;  3L16 A;  1HTQ A;  1IYF A;  4O1N A;  3NJT A;  1D5M C;  4RNA A;  5IO9 A;  2RGF A;  4LJP B;  4PS7 A;  1OTR B;  3GE3 C;  3NHE B;  4EUT A;  1EWY C;  3FIL A; 
#chains in the Genus database with same CATH homology
 4II2 B;  1V86 A;  1UEL A;  3AU4 A;  3AI5 A;  5KHO A;  2M0X A;  5DPW A;  2W9N A;  4BBN F;  3VTW A;  2RPQ A;  4FLH A;  4MGZ E;  2XBB C;  3NY5 A;  3HM3 A;  4M8N A;  4KVG B;  4WJQ A;  1I35 A;  4LDT D;  4NPN A;  3PHW B;  4KDL B;  1WE6 A;  1WMH A;  2J7Q B;  3N32 A;  2KWV B;  1H4R A;  4GMV A;  4MSM B;  4ICU A;  5CHV C;  3CMM B;  1WR6 E;  2CU1 A;  1GUA B;  3OJ3 A;  4FHK A;  2O6V B;  1P98 A;  3H7S A;  1SE9 A;  3ZW3 A;  1KJT A;  5E6P A;  1Q1O A;  3ZDT A;  3TBL D;  4BKS A;  2JT4 B;  3UIO B;  4GN1 A;  1Y8R C;  3ECI A;  4WWO A;  3VAW A;  4NQK E;  1TTN A;  4GSW A;  3ZNZ B;  2J0M A;  5D2M B;  3H9D A;  4PS8 A;  5AEK B;  1FXT B;  4IWQ A;  2DAJ A;  2ZNV B;  2KFK B;  1WJ4 A;  2BGF A;  2KVR A;  4ZDV A;  2LUE A;  1S1Q B;  4M8M A;  4W9L A;  3BY4 B;  2N7E A;  3VH3 B;  3VUW A;  1WMH B;  1IP9 A;  2AL6 A;  2DZJ A;  3RCZ A;  3GZN I;  3DBL I;  4DHZ B;  2L0F A;  2LVQ A;  4MEL A;  2O6V D;  3CSF A;  1ISN A;  1D3Z A;  2WWZ A;  3IVF A;  4GDL B;  1YX5 B;  4MJS A;  2M17 A;  1Q0W B;  4LJO B;  4KIK B;  1VD2 A;  1YJ1 A;  3I3T B;  4DHJ D;  4B95 A;  3UIP B;  2O2V A;  3X23 A;  4BOS C;  2D3G A;  3T9L A;  2KLC A;  5LXI B;  4GGQ A;  4II3 B;  3NS8 A;  4F7Z A;  1KM7 A;  4GB9 A;  4ICV A;  1WZ0 A;  4AJW A;  2KDF B;  2MP2 A;  4ZRJ A;  2JZZ A;  3WA0 A;  2B3A A;  3UQB A;  1OQY A;  2MBH A;  4KV2 A;  4MH0 E;  2DAF A;  3W1S A;  2MSE D;  2KZR A;  2O6V A;  4AUQ C;  2EMS A;  5KHQ A;  1V80 A;  1WY8 A;  2NBU A;  3SU8 X;  1OEY J;  2JVC A;  3UF8 A;  4MDK E;  3JSV A;  3VTV A;  2DX5 B;  3L0W B;  2N9X A;  4XZ4 A;  3DOW A;  3HHM A;  3ZDM C;  1YQB A;  2XK5 B;  3B1L X;  4M0W B;  2KX3 A;  3A9K B;  3PLU A;  1LM8 B;  1WFY A;  2YVC A;  2MBQ A;  2BYE A;  3ENE A;  4IWO A;  5AZF A;  4IUM B;  4RM8 A;  2VRR B;  3QWZ B;  2IY1 B;  1GC7 A;  3DVN U;  2MX2 A;  2CS4 A;  1YIW A;  3H7P A;  2KJ6 A;  3ZLZ A;  2JWZ A;  3HM6 X;  4KIK A;  3TL5 A;  3TJP A;  3EC8 A;  3LDZ E;  4MJS B;  5CX3 A;  2BKR B;  2MCN B;  2LRW A;  2AL3 A;  1V2Y A;  1H8C A;  1E8W A;  2L0T A;  1WX7 A;  1S3S G;  5FR6 A;  1WGR A;  2CR5 A;  1TZ1 A;  2I1J A;  2K8B A;  2GBR A;  4OVU A;  3QK0 A;  2IYD B;  1KOT A;  4AP4 C;  3EFU A;  2K6D B;  4EZL A;  4MGK E;  4PS3 A;  1Q5W B;  2M8S A;  4FUL A;  4XX5 A;  4RMA A;  4HK2 A;  4W9J A;  4TQ1 A;  2KO3 A;  3DVG Y;  1V6E A;  1WRD B;  1GG3 A;  3L54 A;  1M94 A;  3OAW A;  1K8R B;  4DXA B;  1WF9 A;  2LGX A;  1LQB A;  3KH0 A;  3PPA A;  2K8H A;  2IO0 B;  4OVV A;  2BWE S;  1WIA A;  2REX A;  2KNB A;  1ZW7 A;  4LDT B;  3UQA A;  2CHZ A;  4XC2 A;  1ZKH A;  3B0A A;  3VFK A;  4EOY A;  3ZNI D;  4IC7 B;  4EKU A;  3WAN A;  2HJ8 A;  3AUL A;  4MGI E;  4EZJ A;  4EZK A;  5IA7 A;  3VTU A;  4HDQ A;  3HK0 A;  2C5L C;  3VDZ A;  2LD9 A;  1AAR A;  2KTR B;  2J0K A;  3RUI B;  1XT9 B;  2FUH B;  5C1Z A;  4PYZ A;  4IM2 A;  2NVU I;  3Q3F A;  1ZGU B;  5JHB A;  3K9O B;  4GIV A;  3IG3 A;  2ZPY A;  1WGH A;  2ASQ A;  5HKH A;  1T0Y A;  3AU5 A;  4CO7 A;  1JRU A;  3TIX A;  3N30 A;  4I6N B;  2N1W A;  2WX0 A;  1RLF A;  3HIZ A;  4G50 A;  1F9J A;  2G4S A;  4CYE A;  3PTF C;  4W9H A;  3ALB A;  1WE7 A;  3S2A A;  2KD0 A;  3RZW C;  2DYO A;  2EMT A;  3T8M A;  3KVF B;  1MG8 A;  1V9J A;  2ZJD A;  2ZZP B;  2RSU A;  2IBI B;  3PT2 B;  4KZC A;  3RZF A;  4MGY E;  3V61 A;  4DBG A;  2OJR A;  4HWI B;  1UZX B;  2BKF A;  2ZNV C;  3M95 A;  5JZE B;  3QAR A;  2DYB A;  2GMI C;  3L08 A;  4NNJ B;  4TQ0 A;  2HD5 B;  3PRZ A;  4AJY B;  3ZNG C;  2J0J A;  2IO2 B;  4KZ0 A;  2DYM A;  5CTR C;  1WXA A;  2HE7 A;  4JLC A;  5L95 C;  1YD8 U;  4MEM A;  5J17 A;  2C7H A;  2OOB B;  3PGE A;  2O2V B;  1HE8 A;  4YL8 A;  3NOB A;  2WX1 A;  3MJW A;  1UGM A;  5LXH A;  1UH6 A;  2L3Z A;  2JUO A;  4HLE A;  4A3P A;  2UWQ A;  4TUU A;  2KTR A;  2EKE C;  2FCM A;  4W9F A;  2JXX A;  2CHX A;  2AWT A;  5DPT A;  5JH5 C;  4ANU A;  2LGY A;  4HPL B;  2L8J A;  2JF5 A;  3GOE A;  4AWJ A;  3CF6 E;  4K7S A;  2LI5 A;  3PLV A;  3ZRC A;  2G4D B;  1X1M A;  4HPM B;  3SDL C;  4WAA A;  1WX8 A;  3TMP B;  4FJY A;  2LVP A;  1WXS A;  1YX6 B;  4WJP A;  4KSK C;  3KUD B;  3QC8 B;  3TCA A;  2KWU B;  4I6P A;  2DZK A;  2MBE A;  4W9E A;  3QJZ A;  1E8Z A;  2LWP A;  4FJZ A;  2V4L A;  2JZ3 B;  2RR9 A;  4W9K A;  3BIN A;  3WAO A;  2FAZ A;  1U4A A;  2V1Y A;  3A4S C;  2BPS A;  2HTH A;  5DPR A;  3A9J B;  5EDS A;  2KJH B;  2D10 A;  2N9P C;  5BO4 B;  1G6J A;  3PV1 A;  1EUV B;  3U7D A;  1EF1 A;  1J19 A;  3PZD A;  4JIO U;  5G2N A;  2A5U A;  3K9P B;  1GJZ A;  4NAW A;  3ZTC A;  2C7M B;  1NBF C;  4FN2 A;  2KXJ A;  2BWF A;  4W9C A;  1TBE A;  2UYZ B;  3APC A;  5CHF A;  5D7G A;  2NCN A;  2K39 A;  1RAX A;  4ZRK A;  4J6I A;  1V49 A;  4ANW A;  3X0W A;  2N4F A;  2KWC A;  2KDE B;  3U8Z A;  2K25 A;  1GC6 A;  3DQV A;  4EFO A;  1NDD A;  4K1R B;  2LXC A;  4JL9 A;  2NBW B;  3QX1 A;  5G55 A;  3ZRF A;  3ZTD A;  1E7U A;  4P7I A;  1E7V A;  3V60 A;  1E8X A;  2CHW A;  1WYW B;  4E71 A;  1EF5 A;  2NBV B;  5AZH A;  3W1S C;  1J8C A;  4JQW C;  2D07 B;  3DVG X;  1E5W A;  5J18 A;  1J0G A;  4E3C A;  2NPT A;  4F8C B;  3OLM D;  3PRP B;  3R3M A;  4G0N B;  3MTN B;  2PJH A;  4JGH B;  2GBJ A;  2L7R A;  4ZRI A;  3ZIM A;  2MRP A;  1TGZ B;  2DEN B;  2ZCB A;  2GOW A;  2N9E B;  2GBN A;  2WYQ A;  2PPH A;  2D11 A;  2R2Q A;  1WXM A;  2FIF A;  2GBK A;  2KK8 A;  1A5R A;  1KLV A;  2KMC A;  5E6N A;  2MBB B;  3WAM A;  1UBQ A;  4X57 B;  2Z59 B;  3JVZ X;  4GDL A;  1WR1 A;  4NJ7 A;  3VVW B;  3RT3 B;  4DWF A;  3KYD D;  3V6E B;  3QQ8 B;  2MLB A;  2KDB A;  2ZEQ A;  5DCN A;  1WX9 A;  4B9K A;  4GOC A;  2FCQ A;  4HXD A;  3QAQ A;  4N9F 4;  2JY6 A;  2MA9 B;  3DDC B;  5J2R A;  3PRM B;  2KQS A;  4DHZ E;  3AXC A;  1WJ6 A;  1OGW A;  4FBJ B;  1V5T A;  3L10 B;  4IW0 A;  1SIF A;  1QZE A;  3RUL A;  2JPH A;  2C7N B;  3R66 C;  4I6L B;  2JRH A;  3ZUN A;  1VCB A;  1WGD A;  2MQJ A;  3IFW B;  4TKN A;  1SGH A;  1WM2 A;  2KOX A;  3NZS A;  5DPS A;  4DK5 A;  1Z2M A;  2ZPN A;  2KLG A;  3V6C B;  3SD5 A;  3ML8 A;  2L00 B;  3R7Q A;  2C60 A;  3Q3J A;  2KDI A;  4E74 A;  5D6J B;  5E6O A;  3A4R A;  3ZO5 B;  4DHJ B;  1IPG A;  1R4N I;  2KTF A;  4GDK A;  2WDT B;  3APF A;  1LXD A;  2C9W B;  2LGD A;  3VQI A;  2KHW B;  3D32 A;  4ANV A;  1I42 A;  4ZYN A;  1WH3 A;  1WI0 A;  4AOF A;  4CHK A;  2KJR A;  1WJU A;  4GXB A;  2I1K A;  4K7U A;  4URK A;  1PQS A;  3ZNH B;  1V81 A;  2NR2 A;  4BVU C;  3DBS A;  2PEA A;  3KW5 B;  2QHO A;  2KQ7 A;  2KFJ A;  3ZVV A;  4ANX A;  1WM3 A;  2K1F A;  3QIJ A;  2ZVO A;  2N7D A;  2MW5 A;  5C23 A;  4K81 A;  3V62 A;  4F1S A;  5L83 A;  4WJN A;  5D94 A;  5TR5 A;  3QA8 A;  1WXV A;  2Z0E B;  4WWP A;  2MBO A;  2Y5B B;  2MWS B;  4BKT A;  2DZI A;  2M1M A;  2IO3 B;  2LJ5 A;  3DPD A;  4W9G A;  1WJN A;  1EO6 A;  3WAL A;  4BKG A;  1CMX B;  3QCA A;  1OEY A;  3KYC D;  3SHQ A;  2BYV E;  3L13 A;  4NQL B;  2FNJ B;  5GMV A;  3WAP A;  4BFR A;  2N1V A;  1P9D U;  2BF8 B;  4G11 A;  1WGY A;  4ASW C;  4FA6 A;  2K6Q A;  4A20 A;  1GNU A;  4K7W A;  2G3Q B;  2LAS A;  3H6N A;  3DVN V;  3ONS A;  3W1Y A;  2JRI B;  2L76 A;  2ZVN A;  3IHP C;  4KDI C;  3PSE B;  4IWP A;  4IM3 A;  1V5O A;  2DHZ A;  3NZU A;  3M62 B;  3CST A;  2Z0D B;  2PE9 A;  4PYU A;  2NPT B;  4GU2 A;  2R2O A;  3VHT C;  4WQO B;  3A9J A;  3A9K A;  1P0R A;  2XK5 A;  3A1Q B;  1XD3 B;  4MSQ B;  4EEW A;  4W9D A;  4WJO A;  1WZ3 A;  4HDO A;  3H1U A;  2YLM A;  3VUY A;  3M3J A;  2A4Z A;  5AZG A;  1C1Y B;  3EHV A;  4FHJ A;  3KUZ A;  5IAA C;  1RFA A;  1UD7 A;  4W9I A;  3MHS D;  3PHX B;  4WWN A;  1BT0 A;  2L05 A;  3C0R B;  1UBI A;  3EEC A;  3N3K B;  3A1Q A;  2DZM A;  2K8C A;  3JW0 X;  2CKH B;  2KMA A;  3H7P B;  3PS6 A;  4HVB A;  2ZCC A;  3PRE A;  2IO1 B;  1WGG A;  2KX0 A;  3IBE A;  1LFD A;  5JHA A;  2IY0 B;  2GBM A;  2KKC A;  4BOZ B;  4DDG D;  2AYO B;  2FID A;  2FCN A;  4TV3 A;  1Z5S B;  2KN5 A;  4IM0 A;  3ZKJ C;  2FCS A;  1XQQ A;  3JYU A;  4NAW B;  2IZV B;  4HJK A;  4NY0 A;  3JSV B;  5CHW A;  3U30 A;  3VUX A;  2BYF A;  1C3T A;  2KC1 A;  4DDI D;  3DBR I;  4LCD E;  3RD2 A;  3KUC B;  2AEH A;  3VXW A;  4FAD A;  3LJ3 A;  4IG7 B;  3UIN B;  3P2B A;  4G3X B;  2LVO A;  3DCG A;  4HCP B;  3B08 A;  1P3Q U;  3A33 B;  3O65 B;  4HCN B;  2RD0 A;  2XEW A;  1NI2 A;  4BKS D;  3OJ4 B;  3DBH I;  4GDK B;  3UGB B;  3R7R A;  2M4N A;  4FJV B;  2KFK A;  3M63 B;  2PE6 B;  1L7Y A;  2KAN A;  2V3S A;  2LRU A;  3ML9 A;  1E90 A;  2G45 B;  2KC2 A;  3VH4 B;  3QHT A;  3WIM A;  4B6W A;  2MP2 B;  3APD A;  1R4M I;  3PVL A;  4A3O A;  4MM3 A;  2LXA A;  1P1A A;  2D2Q A;  3RYT A;  3L16 A;  4RM9 A;  1IYF A;  1RRB A;  1L2N A;  1E8Y A;  4KSL C;  2RGF A;  3L17 A;  2LZ6 A;  4LJP B;  4PS7 A;  5LLI A;  1OTR B;  3NHE B;  4EUT A;  4NJ6 A;  4BBN C;  2NS5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...