3ZLZA

Lys6-linked tri-ubiquitin
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
73
structure length
73
Chain Sequence
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGRQLEDGRTLSDYNIQKESTLHLVLRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords UBIQUITIN
publication title Assembly, Analysis and Architecture of Atypical Ubiquitin Chains
pubmed doi rcsb
source organism Homo sapiens
total genus 18
structure length 73
sequence length 73
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3zlzA00
2FUHB 2NVUI 1V86A 3VTUA 4EZKA 2MSED 2K39A 1PQSA 5HKHA 2BYEA 2REXA 4BOZB 4DDGD 1WF9A 4BKSA 2N9XA 3H7PB 3R66C 3KYDD 4WJPA 2ZPNA 5JZEB 2K25A 3ZRFA 2JRIB 4I6LB 1WJNA 2KANA 3PLVA 1V5OA 2LASA 4AP4C 2N9EB 4GGQA 4B6WA 3R7QA 4W9LA 4DHZB 5LXIB 2LGDA 3HIZA 2CHZA 4TQ1A 2KWVB 3DCGA 4X57B 5G55A 3S2AA 2GOWA 3GZNI 3X23A 4HXDA 1GJZA 2BKRB 2WX1A 5DPWA 2BF8B 2N7DA 2Y5BB 5DPSA 4BBNF 3PREA 1OTRB 4CO7A 3T9LA 2HE7A 1E8YA 3KW5B 3L16A 4NAWA 1X1MA 2LUEA 4HJKA 4JGHB 1WZ0A 3H7SA 1EF5A 2G4DB 3ZKJC 2HJ8A 4I6NB 1WI0A 3DVNU 1IPGA 1SE9A 1V5TA 2MP2B 4ICUA 3UF8A 3AXCA 2EKEC 1GNUA 2FNJB 3EECA 3KVFB 1LQBA 4GSWA 3SDLC 1WM3A 4ASWC 1I35A 5L95C 3AULA 3DVGX 4ANVA 3NY5A 3QA8A 2M17A 5BO4B 3Q3JA 4G11A 4AJYB 3RUIB 2FCQA 3DVNV 2NPTA 1V49A 1RAXA 1L7YA 5KHQA 4IM2A 3VUYA 2MBOA 2YVCA 1Q5WB 3M62B 4NQKE 4NY0A 2I1JA 3VFKA 3W1SA 4MGZE 1YX5B 3QARA 4WWNA 4F8CB 2KC2A 4LJOB 4FA6A 1SGHA 4W9DA 4HPLB 3JYUA 2O2VA 3P2BA 3WAMA 2NBWB 2XK5B 2LZ6A 5E6PA 4M8MA 4W9FA 3QIJA 1A5RA 2AL6A 4TV3A 2CU1A 3PSEB 2MBQA 2O6VD 2LI5A 4W9EA 4YL8A 2KX3A 2M0XA 1WGGA 4HLEA 3DBLI 4MELA 2JPHA 4LDTB 5CHVC 5CHWA 2N9PC 1WX8A 4WJQA 1F9JA 2KD0A 3NHEB 4DHJD 3V6EB 2G3QB 3ZUNA 2IYDB 4BKTA 4ANUA 3DPDA 1WXVA 3ZTCA 2KQ7A 4FADA 2DAJA 2JY6A 1OQYA 1GUAB 1LM8B 4TUUA 3MTNB 4ZRKA 3HK0A 2RD0A 3QJZA 3VAWA 4FHJA 3PHXB 1WJ4A 3RYTA 3QQ8B 3VUWA 1WMHB 4DWFA 2ZCBA 3VHTC 4W9KA 3WANA 2KQSA 4GXBA 3NOBA 4GU2A 4F1SA 2IO2B 3PTFC 1WX9A 4AWJA 2PJHA 5C1ZA 3EFUA 1WGDA 2KDFB 5AEKB 4G3XB 4WAAA 3ML9A 4P7IA 2ZVNA 4A3OA 2MQJA 2V4LA 4XZ4A 1P1AA 2ZEQA 4KSKC 3I3TB 3HM6X 1UZXB 2KHWB 2KMCA 4EKUA 1WGYA 2KFKA 2K1FA 4GDKB 2D11A 3TMPB 3VXWA 1YQBA 3L08A 2V3SA 1NDDA 3PHWB 2A4ZA 3O65B 3PLUA 3ZDMC 4BBNC 4DXAB 3PZDA 4TQ0A 4EFOA 3AI5A 4WJOA 2K8HA 2LGYA 3UGBB 4W9CA 3DBHI 3QX1A 5DPRA 4BKSD 3UQBA 4KZCA 3HM3A 1UH6A 3DDCB 2BPSA 4K7WA 4BVUC 4HWIB 2C7MB 3M63B 3N32A 4XC2A 3DBSA 3A4RA 2WWZA 4JQWC 3ZW3A 5JHAA 2FCMA 3ENEA 3R7RA 2WYQA 3QC8B 3APFA 2NS5A 2MA9B 4RM8A 3OJ3A 4EZJA 2RSUA 3K9OB 1WX7A 4MEMA 4K7UA 2HD5B 2KJHB 1VD2A 2L76A 3JSVA 2JRHA 3TIXA 1TBEA 2ZNVC 3VH3B 3W1SC 2C60A 2KK8A 2CHWA 1NBFC 2LWPA 1UBIA 3APDA 1H8CA 4TKNA 3M95A 3ZNID 1WMHA 4WJNA 4DDID 2DYBA 3RD2A 2BWES 2N1WA 3SU8X 4PS7A 3RULA 3ZLZA 2KKCA 2AYOB 3ZIMA 5CX3A 2NBVB 1WGHA 3PGEA 1Z5SB 2Z59B 2KDBA 2GBNA 1WFYA 4PS3A 3A1QA 3SD5A 1K8RB 1T0YA 4NJ6A 4WQOB 3UIPB 3ALBA 1ZGUB 4W9HA 1E8WA 3APCA 1Q0WB 1YX6B 4GDKA 3UINB 4MSMB 3DOWA 1P98A 3PS6A 1E8ZA 3OAWA 3KUZA 2KC1A 3A9JB 3B08A 3QAQA 2DHZA 2K8BA 3CMMB 4ANXA 2IY0B 3EC8A 4GDLB 4FBJB 1LFDA 2J7QB 3RCZA 2IZVB 3V62A 1WIAA 1JRUA 2PE6B 3WAOA 1R4NI 2UYZB 4A20A 1SIFA 1Q1OA 3L54A 2KTRA 1NI2A 2DENB 2RGFA 2MLBA 5AZGA 4DBGA 4IM0A 5L83A 2CS4A 2PEAA 1WXSA 2KWUB 2BGFA 4MH0E 2UWQA 5AZFA 2L0TA 2KXJA 1AARA 1U4AA 3GOEA 2KWCA 2KOXA 3PV1A 5LLIA 2CKHB 3NS8A 2O6VB 1E90A 4HK2A 4GIVA 1I42A 2AEHA 3CF6E 2V1YA 5G2NA 1RLFA 4K81A 3H7PA 1V2YA 4MSQB 2BYVE 2MX2A 4IC7B 4DHJB 2QHOA 3BY4B 2LVPA 4HCPB 1GC6A 1UBQA 1WGRA 2BYFA 2Z0DB 3ZNHB 3RZWC 3ZNZB 3DQVA 5J18A 2DAFA 4CHKA 4FJVB 3WAPA 2FIDA 2WX0A 4E3CA 3Q3FA 3ZVVA 5D7GA 2D2QA 5C23A 5CHFA 2W9NA 1E7VA 2IO0B 2JWZA 3KYCD 1OEYA 4DHZE 2FCSA 1WH3A 2D3GA 5D6JB 1WYWB 3ZDTA 3QHTA 1V80A 4M0WB 2J0JA 3R3MA 2JZZA 3N30A 4KIKB 5D94A 2K6DB 2KJ6A 4ICVA 3D32A 4K7SA 4NJ7A 4II2B 2MP2A 1TZ1A 3NZSA 4E74A 1GG3A 3JVZX 4ZDVA 2N4FA 2FCNA 3VDZA 4MDKE 3B0AA 4HDOA 2ASQA 4KDIC 3VH4B 3ZNGC 1XD3B 2M8SA 2N1VA 1OEYJ 1P3QU 2R2QA 3L17A 3MJWA 3C0RB 4KSLC 4IWOA 2DZKA 2EMTA 3U8ZA 3PRPB 2KNBA 3VQIA 1HE8A 3A33B 4NPNA 3ZTDA 2KZRA 1WE7A 3CSFA 2GBRA 1G6JA 3OLMD 2NCNA 5JHBA 3EHVA 2XK5A 4FJYA 2KFJA 1J19A 4CYEA 1WZ3A 3IVFA 2D07B 2DZJA 1E5WA 2LVQA 4MJSB 2J0KA 1EUVB 3IBEA 2JUOA 3ML8A 2JT4B 1WE6A 2ZPYA 5J17A 1KM7A 2FIFA 2J0MA 1WR6E 1ZKHA 3WALA 2KLGA 5TR5A 5GMVA 1V6EA 4FHKA 1XT9B 4EEWA 3VTWA 2XBBC 4ZYNA 1TGZB 4EUTA 1E7UA 4NAWB 3H9DA 4JIOU 2PPHA 4JLCA 2JVCA 4GN1A 2MRPA 1KJTA 1UD7A 1WRDB 3VTVA 2OOBB 3KUCB 1WR1A 1ISNA 2RPQA 4MM3A 4PYUA 2NPTB 2MBHA 5KHOA 4GOCA 3ECIA 4B95A 1RRBA 5DCNA 2XEWA 2IY1B 3U30A 1WXMA 2ZJDA 2NBUA 3UQAA 2ZNVB 3VUXA 3TL5A 2L05A 2R2OA 1S3SG 1TTNA 2MW5A 4FJZA 4LCDE 1WJ6A 3RT3B 1C1YB 1UGMA 4W9GA 2D10A 2O2VB 1EO6A 2KLCA 1J8CA 2C7NB 2KX0A 2LRUA 4J6IA 1MG8A 4W9IA 4HDQA 2C9WB 3KH0A 3MHSD 3LJ3A 4HPMB 1UELA 4ZRIA 1OGWA 2ZZPB 1WXAA 3ZRCA 2DYMA 4KZ0A 4MJSA 4AUQC 2G4SA 2N7EA 3QCAA 3QK0A 3IFWB 1M94A 2LD9A 1IYFA 2CR5A 3A9KB 4HCNB 4MGKE 5JH5C 2MWSB 3NZUA 3OJ4B 2DZIA 1YJ1A 3L10B 2LXAA 3V61A 2JF5A 4HVBA 1J0GA 3W1YA 1LXDA 3TBLD 1VCBA 2CHXA 2GBMA 1BT0A 3ZO5B 3PPAA 4FN2A 4WWOA 4IW0A 1S1QB 2ZVOA 5E6OA 4EOYA 2KDIA 4F7ZA 2YLMA 2K6QA 3A4SC 1EF1A 2HTHA 1E8XA 4LJPB 4ANWA 3PT2B 3H6NA 4FLHA 4GB9A 5LXHA 3JW0X 4II3B 4PS8A 2L00B 4MGIE 4WWPA 3IG3A 3V6CB 4PYZA 4BOSC 4E71A 2G45B 3T8MA 4ZRJA 1IP9A 4IM3A 1C3TA 2KFKB 4IUMB 4AOFA 2AWTA 4OVVA 2FAZA 1WM2A 1QZEA 4IG7B 4RM9A 3VVWB 4G50A 4EZLA 3LDZE 3UIOB 2B3AA 2IO3B 2Z0EB 5AZHA 2LGXA 2KO3A 5EDSA 3A9JA 5IAAC 4BFRA 2ZCCA 4KV2A 2LRWA 4MGYE 4GDLA 2MCNB 3X0WA 2NR2A 1GC7A 4OVUA 1R4MI 1WY8A 4N9F4 4NQLB 4JL9A 1KOTA 3BINA 2GBJA 5CTRC 2KN5A 2JXXA 1CMXB 2EMSA 3A9KA 3AU5A 3JSVB 2DYOA 3IHPC 3PVLA 2KTFA 4K1RB 2JZ3B 1P9DU 5DPTA 1RFAA 4LDTD 4KDLB 3SHQA 4GMVA 1WJUA 2PE9A 1Y8RC 2LJ5A 4A3PA 4XX5A 3RZFA 2KDEB 2O6VA 2C7HA 2C5LC 2BKFA 1YIWA 3DBRI 2L8JA 3PRZA 5J2RA 1L2NA 4I6PA 2LXCA 2L3ZA 4NNJB 3TJPA 3M3JA 2A5UA 1D3ZA 3ONSA 2BWFA 3HHMA 1XQQA 1H4RA 3A1QB 1V9JA 4BKGA 2L7RA 1P0RA 2OJRA 3H1UA 3L0WB 3B1LX 4KVGB 3WA0A 2AL3A 2M4NA 2M1MA 3TCAA 2WDTB 2I1KA 3N3KB 2GBKA 2VRRB 4URKA 1YD8U 2MBBB 4RMAA 5FR6A 4G0NB 4IWPA 4AJWA 2KMAA 3DVGY 2GMIC 3K9PB 2MBEA 3WIMA 3KUDB 4DK5A 1Z2MA 4KIKA 2LVOA 4M8NA 1V81A 1ZW7A 3L13A 2IO1B 2KVRA 5E6NA 4B9KA 1FXTB 5D2MB 3AU4A 1KLVA 2KTRB 5IA7A 3PRMB 4IWQA 2DZMA 2IBIB 2K8CA 3V60A 3U7DA 2DX5B 4W9JA 3CSTA 3QWZB 2RR9A 2L0FA 2KJRA 4FULA
chains in the Genus database with same CATH superfamily
1YJIA 2H89B 1DGJA 2K39A 2RMMA 5MPOA 2MEKA 2BYEA 2REXA 5I4DA 4OZCA 3KYDD 5JZEB 1FNVA 2PKOA 2E3TA 4I6LB 2N9EB 1V8CA 4TQ1A 3DCGA 2GOWA 1E0ZA 3GZNI 3RMKC 4HXDA 2WX1A 4PK1A 5DPWA 3EFCA 2Y5BB 3DWGC 1FEHA 4BBNF 4CO7A 3KW5B 1X1MA 4JGHB 1WZ0A 3ZKJC 4I6NB 4ICUA 1GNUA 3IXSA 1CQVA 1N60A 4ARIA 3SDLC 4ZHPA 5L95C 3NY5A 2M17A 1TYGB 1TKGA 1V49A 1K50A 4NQKE 3W1SA 4W9DA 4HPLB 3RFZB 1RFKA 3WAMA 2NBWB 2X38A 5E6PA 1A5RA 3QIJA 3Q8FA 2O6VD 1XLNA 1GB1A 1WX8A 2WXLA 3GS2A 2BB6A 4ANUA 1LGRA 3H8HA 2JY6A 3MTNB 3QJZA 1XCTL 1WJ4A 2WDVB 3QQ8B 3RYTA 3VUWA 2ZCBA 2BS3B 4GXBA 3TEYA 4N59A 4AWJA 1HQRD 5C1ZA 5IN7A 2KDFB 2INCC 5AEKB 1J7CA 4G3XB 1RM6C 3ML9A 4FXCA 2GI9A 1P1AA 3E9SA 3AE1B 3BVZA 2KHWB 3ZYYX 2KFKA 2NMQA 3ZDMC 3O65B 2LFIA 2K8HA 3UGBB 4W9CA 4BKSD 2N7JA 1I4HA 4USAA 3MHZA 4HWIB 1XEEA 3M63B 2W55A 1QQRA 2AX5A 3SFDB 3DBHB 1SB3C 4EZJA 1K53A 1VD2A 4OHJA 2ZNVC 3W1SC 1YQ4B 2ZW0A 3AH7A 2LWPA 1NBFC 4CQNA 3ZNID 3RD2A 3AB5A 4PS7A 4C4VB 1F77A 5JXVA 2NBVB 1WGHA 1ZE3D 3PGEA 3PZ7A 1Z5SB 2I38A 3Q14C 2WNMA 3DHGC 1K8RB 4XDDA 1ZGUB 4W9HA 3IAM1 3QAQA 2K8BA 2IY0B 4GDLB 1EM7A 2UYZB 5D3DA 1NI2A 2DENB 1TS5A 1FNWA 2MLBA 2JYTA 2L0TA 5LLIA 3RPFC 1JWUD 4K81A 1PUTA 1T0QC 2BYVE 4IC7B 3P42A 2LVPA 2XN9C 1YN3A 1UBQA 2BYFA 2Z0DB 1WGKA 3DQVA 4S0RA 3CIRB 3WAPA 3ZVVA 5CHFA 1QILA 2IO0B 1OEYA 5G5HA 5D6JB 1WYWB 4K3CA 5D94A 1ET6A 4N6EB 4NJ7A 3ZGZA 3NZSA 3JVZX 3BZDB 4Q2JA 2NTTA 2K5PA 3B0AA 4HDOA 3ZNGC 1XD3B 3AE3B 1DOXA 1SE2A 1YN4A 4KGSA 2QC8A 2DZKA 3PRPB 2KNBA 1HE8A 4ZRQA 4P1CC 2GBRA 3W9CB 2NCNA 5JHBA 3AE4B 5IKCM 2DZJA 1K52A 4EE2A 1T3QA 1ESFA 2JUOA 2ZPYA 5J17A 2FIFA 1QOFA 5EE9A 1V6EA 2XBBC 3BVGA 1TGZB 1E7UA 3H9DA 4JIOU 3ZXVA 4GN1A 2MRPA 2WDRB 1MG4A 1F0ZA 5BMGA 4WURA 4A9AA 1V97A 2Y3AA 3VTVA 4AS1A 4HEA1 4PYUA 5HHDG 2BQQA 2XEWA 2NBUA 3VUXA 1S3SG 1J7BA 4FJZA 4LCDE 1WJ6A 3RT3B 4WAFA 4W9GA 5BYQA 1EO6A 4RGOS 1J8CA 4TSSA 3TEXA 2WXPA 4ITKA 4J6IA 1MG8A 4HDQA 3FAHA 1HZ5A 3AEFB 4HPMB 4ZRIA 3Q3MC 2KMMA 1FFUA 3QK0A 1M94A 3AEBB 2CR5A 4HCNB 3P1MA 3NZUA 1KFYB 4YWGG 3L10B 2TSSA 2JZPA 4HVBA 2INPE 5IP4D 1LXDA 1BT0A 3W5UB 4IW0A 4JWUC 2YLMA 3AE8B 3A4SC 2K3UA 4S17A 3H6NA 1FMAD 3HVZA 1J7AA 1OQRA 1YN5A 5E6JA 4IDIA 3T8MA 1NVID 3U4EG 4RFBA 1L4DB 4H2AA 4OVVA 1V1PB 1MVKA 4IG7B 2L32A 2IO3B 2LGXA 1B1ZA 5EDSA 2W3SA 3I5JC 2ZCCA 2LRWA 4GDLA 3ETRA 4N9F4 1FFVA 2BB5A 1FPYA 2GBJA 3AU5A 3JSVB 2IGGA 4HKQA 1P9DU 5DPTA 4KDLB 4HJGE 1WJUA 4XGAB 3ABVB 5C3JB 3RZFA 3DBRI 1I4GA 3Q3NC 5J2RA 1P7EA 2DBYA 4MT5A 3HHMA 1V9JA 2DNFA 4KVGB 3L0WB 3B1LX 2M4NA 2JWUA 3TCAA 3N3KB 3HRDD 5AUKA 4URKA 4IWPA 2KMAA 3DVGY 2GMIC 3AEAB 4M8NA 1V81A 1FRRA 1PGAA 1XLOA 5H92C 2KTRB 1QOAA 1SXTA 2IBIB 3V60A 4W9JA 3QWZB 2RR9A 2PPHA 2FUHB 4LNIA 2NVUI 1V86A 4EZKA 1PQSA 5HKHA 1TY2A 4R3DA 2V3PA 2KANA 4PT5A 1V5OA 2LASA 4OZAA 1N5WA 4B6WA 3R7QA 4DHZB 2LGDA 5G55A 2V0GA 1Q10A 1GJZA 2BKRB 2ONQA 2N7DA 4ZYSA 3PREA 1OTRB 1UGJA 2KAJA 1KTKA 4LNFA 2LUEA 4HJKA 1JWSD 2VZKD 2G4DB 2HJ8A 1SE9A 1ACCA 2MP2B 1BMLC 2EKEC 3KVFB 1LQBA 4GSWA 3RNBC 4ARCA 3U2SC 3QA8A 2PTLA 5BO4B 4G11A 1PGXA 3DVNV 1JWAD 1RAXA 1L7YA 3O13A 1AW7A 2K22A 3VUYA 2MBOA 2YVCA 1Q5WB 3VFKA 4NY0A 3R2IA 3QARA 2KC2A 4FA6A 3JYUA 4RH6A 2N9LA 2XK5B 2LZ6A 4M8MA 4W9FA 2AL6A 3PSEB 2KX3A 4HLEA 1STEA 4MELA 2JPHA 1FM0D 4LDTB 5CHVC 5BMIA 5CHWA 4WJQA 1B9RA 4DHJD 2G3QB 3ZUNA 3P4RB 2KQ7A 1GOZA 1OQYA 1LM8B 4TUUA 3DBLB 2D3AA 4XDCA 3VAWA 4FHJA 4GLSC 1QT9A 4W9KA 2KQ4X 1GB4A 3WANA 3LXFA 1XCQL 2PVGC 3NOBA 1D5ZC 2WHIA 4MM3B 3R2TA 2QCZA 2MQJA 1R7SA 4OZBA 3AEGB 1TIFA 2ZW1A 1UUPA 2WXFA 3EUB2 2K1FA 4WIPA 3TMPB 4JPSA 3VXWA 1V1PA 3PHWB 4TQ0A 2A4ZA 2MHJA 4EFOA 2LGYA 1JRPA 2DWQA 3DBHI 3QX1A 2WXOA 4KZCA 3HM3A 1GPXA 4ZRPA 2C7MB 1MHHE 3DBSA 2WWZA 1IUEA 5JHAA 2WYQA 2WDQB 4RM8A 2KJHB 3JSVA 3TIXA 3VH3B 3URYA 2C60A 3APDA 1WMHA 2BT6A 2BWES 2N1WA 3SU8X 2KKCA 2AYOB 3ZIMA 3BWUD 3V05A 4PS3A 4O1NA 5HG2A 1FNUA 2M56B 4WQOB 3NVVA 1JALA 1PGBA 3APCA 1Q0WB 4GDKA 4MSMB 4A90A 3OAWA 2KC1A 3CMMB 2KVZA 3IT6B 2AQ2B 2LHDA 4FBJB 1LFDA 2J7QB 3FKYA 2IZVB 3V62A 3WAOA 1R4NI 3KWLA 4A20A 1Q1OA 2KTRA 1PFDA 4DBGA 2WP9B 2PEAA 2UWQA 5AZFA 2KXJA 1AARA 1U4AA 3PV1A 2CKHB 1E90A 4GIVA 5G2NA 2PMVA 1XF5L 4MSQB 4REZA 3SFEB 1I7HA 2WU5B 3RZWC 1MFWA 2DAFA 1N61A 2WX0A 3Q3FA 2WS3B 4DHZE 3N1ZC 2FCSA 2D3GA 2M19A 1I4PA 2K6DB 2J53A 2KJ6A 3N9YC 1SJED 1T6BX 1NI3A 2MP2A 1GG3A 2N4FA 3VDZA 1XLQA 3VH4B 2M8SA 2N1VA 1TKEA 3N20C 2QMTA 3VQIA 1NENB 3ZJUA 3ZTDA 2KZRA 1WE7A 3CSFA 3EHVA 2XK5A 2KFJA 2D07B 2WGSA 3NRZA 1TS2A 3Q8CA 1KM7A 2IGDA 4IKGA 2KLGA 3BVMA 5TR5A 4FHKA 3RNGC 1OQQA 3NVZA 4YXDB 4UDUC 4JLCA 3DHIC 4J3OD 4MM3A 5KHOA 3AE7B 4GOCA 2IY1B 3U30A 3UQAA 2R2OA 3CWIA 4YTMB 2O2VB 4RF0A 2LRUA 1XXGA 3VR9B 1C9FA 1OGWA 2ZZPB 2B76B 1WXAA 4AUQC 2BW2A 2G4SA 2LD9A 3Q2AC 2LGIA 3OJ4B 1YJ1A 1VZ7A 1J0GA 1R4NB 3TBLD 1VCBA 2E6XA 4US8A 2W82A 4EOYA 2HTME 2D5GA 2K6QA 2JSVX 2HTHA 2RPVA 1HA5A 3NS1A 4B0MA 3IG3A 4BOSC 4HPPA 4E71A 2G45B 1FO4A 1IP9A 1C3TA 4IUMB 4AOFA 1L0XB 2AWTA 3AECB 2IPKD 2BVCA 2IDYA 1ZXIA 2N0SB 1N63A 2KO3A 4LK0M 1JROA 4KV2A 2MCNB 3BYTB 2NR2A 3NZ3A 4OVUA 2J52A 1KOTA 3ZJVA 1CMXB 1OFFA 4JE3B 2VH2A 4M01A 1SBBB 1R4MB 3IAS1 2WXIA 1Y8RC 2LJ5A 4KKIA 4A3PA 2KDEB 3TEWA 3N1XC 2L8JA 3W2DA 1L2NA 4I6PA 2L3ZA 4NNJB 3RN9C 2BWFA 4BKGA 1P0RA 3MP9A 2AL3A 1VRAB 2WDTB 2I1KA 2VRRB 1UWMA 1YD8U 4G0NB 3KQ4A 4LTUA 5BYSA 1Z2MA 1JCKB 2LVOA 3I63C 3L13A 2KVRA 4B9KA 2BS4B 3AE9B 1FXTB 3AU4A 5BYRA 3PRMB 2LGSA 2L0FA 2KJRA 4RGMA 2SAKA 3RNFC 5IO9A 4DDGD 1KH0A 2N9XA 3H7PB 4WJPA 2ZPNA 3ZRFA 4L2YA 2WLBA 4GGQA 1T0SC 4X57B 3S2AA 2CHZA 1C4PA 1CJEA 1EWYC 2BF8B 3KWVA 2JQRB 1C76A 3BK1A 2GB1A 2HE7A 1YNTE 1TKYA 2PIAA 3L16A 4D2KA 1EF5A 1D3ZA 3MC8A 1IPGA 1FD6A 3UF8A 1QF6A 3AXCA 3EECA 2FNJB 3Q6BA 1ENFA 4XE0A 4MACA 1I35A 1YQ3B 2L52A 2MH7A 3FC4A 2ACZB 3Q3JA 4AJYB 2LEKA 3RUIB 2FCQA 3Q8AA 3TEZA 2MJ3A 5KHQA 4B0EA 3NJTA 2I1JA 4YTPB 4MGZE 1YX5B 3C8YA 4WWNA 4LJOB 1SSNA 4K3BA 2ICIA 2O2VA 3P2BA 5HFYA 2CU1A 2MBQA 1TJEA 2M0XA 4HKZE 3DBLI 1D5MC 1F9JA 3LYYA 3NHEB 4BKTA 1WXVA 2FE8A 1I4XA 2DAJA 2RD0A 2X8XX 3PHXB 3AEDB 1WMHB 4DWFA 5HI1A 2KQSA 5LNK1 1HTQA 4GU2A 4F1SA 2WXQA 2IO2B 3PTFC 1WX9A 3J9CA 2G9HD 2PJHA 4ZHOA 3BIID 2FBWB 3VR8B 4WAAA 2ZVNA 2V4LA 1FXAA 1VDVA 3I3TB 2WXJA 4C7YA 4EKUA 1WGYA 4GDKB 4JWSC 3L08A 1NDDA 3PLUA 4BBNC 4WJOA 2YEPF 3UQBA 5DPRA 1UH6A 2MJEA 3Q8EA 4XYCA 4K7WA 3N32A 4XC2A 3U7ZA 2QIEB 1HXYD 3N1YC 3TUOA 3ENEA 3R7RA 3MJ5A 2MA9B 2QJLA 1DOYA 2RSUA 4MEMA 4K7UA 2HD5B 2KK8A 2R61A 1H8CA 4TKNA 4WJNA 4DDID 2DYBA 1C78A 1T0RC 2OJWA 1E7PB 3ZLZA 2KYWA 5CX3A 1WYGA 2Z59B 2KDBA 2GBNA 1WFYA 1N62A 4YSYB 3UIPB 1SE4A 3UINB 3DOWA 1P98A 2EKIA 3PS6A 3RNEC 3KUZA 3B08A 1VLBA 4ANXA 5D3IB 1TY0A 3EC8A 5C2TB 3UI3A 4RGNA 3RCZA 1ZDXA 2GRIA 2PE6B 2AQ1B 4A6QA 3L54A 4A8XC 2RGFA 5AZGA 4IM0A 2CS4A 2KACA 1EWCA 1L0YB 4YT0B 3GOEA 3I9V1 2O6VB 1KF6B 2AEHA 1RLFA 3H7PA 3L4PA 2MX2A 4ZOHC 2QHOA 2INDC 4HCPB 1GC6A 1ZPSA 1KRHA 1WGRA 3ZNZB 5J18A 4FJVB 2FIDA 4E3CA 2Z8LA 2PW9A 1C79A 1UF0A 2D2QA 4KX6B 5C23A 2QSDA 1WXQA 3NG0A 4RGTA 1V80A 2J0JA 4C80A 1AYFA 4WQMA 3D32A 1T5XD 4K7SA 3FILB 4E74A 2AQ3B 4ZDVA 2FCNA 1YMHE 2CJNA 4MDKE 2ASQA 2WU2B 2MJDA 1P3QU 1XO3A 3L17A 3MJWA 4KSLC 3ZXRA 2EMTA 3T3NA 1SF0A 2KDMA 3A33B 4NPNA 1E9MA 2RDGA 1AWDA 1G6JA 2IJ0A 3OLMD 2LUMA 4FJYA 1KLUD 5BMHA 1WZ3A 3IVFA 2WXNA 2LVQA 1EUVB 2DLBA 1E10A 2JT4B 1WE6A 2CU3A 2LHEA 1SIJA 3ZQ4A 1WR6E 1ZKHA 4M00A 5GXGB 5GMVA 4YSXB 4EEWA 3VTWA 5G5GA 4EUTA 5EE1A 4NAWB 1SEBD 1PYWD 2JVCA 2KT7A 4LNOA 1BUIC 1WRDB 2WXKA 2OOBB 2RPQA 1MPEA 1C77A 2NPTB 1KLGD 4B95A 1RRBA 2SEBD 2ZJDA 3GP7A 4IOIE 3GE3C 1L0VB 2KN4A 2W54A 2C7NB 2KX0A 1ROEA 3AE5B 3KH0A 3LJ3A 3NUHB 1UELA 3ZRCA 4KZ0A 4MJSA 3QCAA 4L1BA 4MGKE 5JH5C 2MWSB 2LJIA 2DZIA 4L23A 3V61A 2L83A 2JF5A 1TZOA 2PVOD 3B2GA 4OVZA 3AE6B 2CHXA 1VZ6A 2GBMA 3U52E 3PPAA 4FN2A 3BK2A 5E6OA 2KDIA 4F7ZA 4LJPB 4ANWA 3PT2B 4GB9A 5LXHA 2L00B 2G1EA 4WWPA 3Q69A 5H8YE 1WRIA 2FAZA 4M02A 1QZEA 3PO0A 4EZLA 3LDZE 3RNCC 3UIOB 2J42A 2Z0EB 5AZHA 2BTEA 3GB1A 5IAAC 1TS3A 4MGYE 3X0WA 1GC7A 1R4MI 1VZ8A 1WY8A 4NQLB 5CTRC 2JXXA 2EMSA 3A9KA 2DYOA 3PVLA 2KTFA 2M0AA 2JZ3B 4KGRA 1RFAA 4LDTD 2VH1A 2PE9A 2UU7A 4NJCA 4XX5A 1A70A 2O6VA 3MC9A 4RF1A 1UWXA 3M3JA 3MFGA 1QOBA 2A5UA 3ONSA 5TSSA 1XQQA 1H4RA 3A1QB 3WA0A 5IOIA 2M1MA 5EE0A 3P4QB 1TS4A 2MBBB 5FR6A 3MC0B 4AJWA 2CJOA 4LNNA 3K9PB 3OWEB 4DK5A 4NZLB 2WXGA 3LB8C 3ZJTA 2QEJC 3FILA 4IWQA 2DX5B 1MI0A 3NVWA 2BS2B 4FULA 3VTUA 1F2RC 2MSED 3AE2B 1I4QA 4BOZB 1WF9A 4BKSA 3RI7C 3R66C 3B2FA 4QAYA 3SEBA 4P6VF 2K25A 1ZOYB 3AM9A 2JRIB 4C56C 3AN1A 1WJNA 3PLVA 4AP4C 4W9LA 5LXIB 3HIZA 4XWTA 2KWVB 3WCQA 3X23A 3Q3OC 1ZDVA 5DPSA 3T3OA 3T9LA 1P7FA 1HTOA 1E8YA 4NAWA 3GZNB 3H7SA 1WI0A 3DVNU 1V5TA 1FIQA 1WM3A 4ASWC 3AULA 3DVGX 1VJKA 4ANVA 4ACFA 2NPTA 2LMCA 4N58A 4IM2A 2RDBC 3M62B 4F8CB 1SGHA 2N9KA 2WXHA 4YTNB 1EU4A 4C7ZA 3Q8BA 3B9JA 4TV3A 3EA6A 2LI5A 4W9EA 3W5VB 4YL8A 1WGGA 1MJDA 3GE8C 2I2YA 2N9PC 1PDXA 2KD0A 3V6EB 4P1BC 2IYDB 2J4XA 3DPDA 3BYYB 3ZTCA 4FADA 1GUAB 4ZRKA 3HK0A 3VHTC 1XLPA 1IBXB 3AEEB 1YJJA 1MHXA 3EFUA 1WGDA 4P7IA 4A3OA 2JXTA 4XZ4A 2ZEQA 4KSKC 3HM6X 1UZXB 2KMCA 2D11A 1D5XC 1JQ4A 1YQBA 2V3SA 4DXAB 2D3CA 5AUIA 3PZDA 3AI5A 1L6UA 4LLGM 4KGTA 3DDCB 2BPSA 4BVUC 3OG5A 1JWMD 3A4RA 4JQWC 3AMZA 4HRSA 4NAMA 3ZW3A 1AN8A 2FCMA 4AQ7A 3QC8B 3APFA 2NS5A 3OJ3A 3K9OB 1WX7A 2L76A 4DXFA 2JRHA 1TBEA 3V3XA 1F2RI 3AV8A 2CHWA 2WXMA 1UBIA 3EGRA 3M95A 4A55A 2HJ1A 3RULA 1RWSA 4LNKA 3A1QA 3SD5A 2VZKB 1T0YA 4NJ6A 1V1OA 1K51A 3ALBA 1E8WA 1YX6B 1E8ZA 3A9JB 2DHZA 1NEKB 1WIAA 1JRUA 1SIFA 1FCCC 3E56A 4TMAB 5L83A 1WXSA 4RNAA 4C00A 2KWUB 2BGFA 4MH0E 5FR3A 1SE3A 1YOVB 2KWCA 2KOXA 3HUIA 3NS8A 2OHFA 4HK2A 1I42A 2L1AA 3CF6E 2V1YA 1F1HA 1V2YA 4DHJB 3BY4B 4C4VA 5T8IA 3ZNHB 1N5XA 3VRAB 4CHKA 5D7GA 1JMLA 2W9NA 1E7VA 3KYCD 2JWZA 1NYQA 1WH3A 4XWWA 3ZDTA 3QHTA 4M0WB 1EU3A 3R3MA 1N6ZA 2JZZA 3N30A 4KIKB 3DWMA 2Y5PA 1QOGA 2W3RA 4ICVA 2BYTA 4BZAA 1FCLA 1VR9A 1JW9D 3IT4B 1IGDA 4II2B 3SR6A 1TZ1A 2RDHA 3DHHC 4KDIC 2EELA 2INNE 1HEZE 1OEYJ 2R2QA 3C0RB 1LO5D 1UNSA 4IWOA 5FKAC 3U8ZA 4DXGA 2V3NA 2V4IB 1J19A 4CYEA 1C4AA 3P4PB 1E5WA 4MJSB 2J0KA 3IBEA 3ML8A 2WXRA 1ZXHA 2J0MA 3WALA 1Y56A 1WSPA 1XT9B 4ZYNA 3NVYA 3TSSA 1I4RA 4RCOA 1ET9A 4MH8A 2FUG1 1E6EB 1KJTA 1UD7A 5EE3A 3PZ8A 3KUCB 1IBXA 1WR1A 1ISNA 5FK9C 3P63A 2MBHA 3ECIA 1C4CA 2QILA 5DCNA 1WXMA 2ZNVB 3TL5A 2L05A 2JX5A 4DQOC 2MW5A 1TTNA 1ZP0B 1C1YB 1UGMA 2JU6X 1RYJA 2D10A 2KLCA 4W9IA 2C9WB 2K9XA 3MHSD 3P4SB 3R8BA 4OW0A 1CK1A 4HROA 2DYMA 2Q5WD 2N7EA 4WH4A 3IFWB 1IYFA 1D4BA 3A9KB 4KKJA 2LXAA 1SJHD 1F52A 1DOIA 3W1YA 4US9A 3ZO5B 4WWOA 1S1QB 1DYQA 2Y5CA 2ZVOA 1EF1A 1HZ6A 1E8XA 3KLSX 1ZUD2 2H88B 1GAQB 2XNAC 4FLHA 1M4VA 3JW0X 4II3B 4PS8A 4MGIE 3V6CB 4PYZA 4ZRJA 1IGCA 1L6VA 1JWBD 4IM3A 2KFKB 2NTSA 4YSZB 1WM2A 4RM9A 3C19A 3VVWB 4G50A 1FXIA 2B3AA 2KWDA 2YEPB 3A9JA 4BFRA 2IGHA 4BAXA 1D6EC 2V9HA 1BXTA 4JL9A 3BINA 2KN5A 1L4ZB 1L5PA 2JYEA 3IHPC 4K1RB 3SHQA 4GMVA 4P16A 2ON8A 2GLSA 2C7HA 2HDEA 2C5LC 2BKFA 1YIWA 1TT5B 1FRDA 3PRZA 2BBCA 2LXCA 3VRBB 3TJPA 1QKZA 2PLPA 4WWMA 1QLBB 3DBRB 2L7RA 2OJRA 3H1UA 3RNAC 2D3BA 2GBKA 1CZPA 3HVDA 4RMAA 1WWTA 2WQYB 2MBEA 2QDFA 3KUDB 3WIMA 2K0PA 4M0WA 4KIKA 1ZW7A 5E6NA 2IO1B 2OEDA 5D2MB 1KLVA 5IA7A 2DZMA 2K8CA 3I57A 3U7DA 3CSTA 1NYRA 4JX1C
chains in the Genus database with same CATH topology
2FUHB 2NVUI 1V86A 3VTUA 4EZKA 2MSED 2K39A 1PQSA 5HKHA 2BYEA 2REXA 4BOZB 4DDGD 1WF9A 4BKSA 2N9XA 3H7PB 3R66C 3KYDD 4WJPA 2ZPNA 5JZEB 2K25A 3ZRFA 2JRIB 4I6LB 1WJNA 2KANA 3PLVA 1V5OA 2LASA 4AP4C 2N9EB 4GGQA 4B6WA 3R7QA 4W9LA 4DHZB 5LXIB 2LGDA 3HIZA 2CHZA 4TQ1A 2KWVB 3DCGA 4X57B 5G55A 3S2AA 2GOWA 3GZNI 3X23A 4HXDA 1GJZA 2BKRB 2WX1A 5DPWA 2BF8B 2N7DA 2Y5BB 5DPSA 4BBNF 3PREA 1OTRB 4CO7A 3T9LA 2HE7A 1E8YA 3KW5B 3L16A 4NAWA 1X1MA 2LUEA 4HJKA 4JGHB 1WZ0A 3H7SA 1EF5A 2G4DB 3ZKJC 2HJ8A 4I6NB 1WI0A 3DVNU 1IPGA 1SE9A 1V5TA 2MP2B 4ICUA 3UF8A 3AXCA 2EKEC 1GNUA 2FNJB 3EECA 3KVFB 1LQBA 4GSWA 3SDLC 1WM3A 4ASWC 1I35A 5L95C 3AULA 3DVGX 4ANVA 3NY5A 3QA8A 2M17A 5BO4B 3Q3JA 4G11A 4AJYB 3RUIB 2FCQA 3DVNV 2NPTA 1V49A 1RAXA 1L7YA 5KHQA 4IM2A 3VUYA 2MBOA 2YVCA 1Q5WB 3M62B 4NQKE 4NY0A 2I1JA 3VFKA 3W1SA 4MGZE 1YX5B 3QARA 4WWNA 4F8CB 2KC2A 4LJOB 4FA6A 1SGHA 4W9DA 4HPLB 3JYUA 2O2VA 3P2BA 3WAMA 2NBWB 2XK5B 2LZ6A 5E6PA 4M8MA 4W9FA 3QIJA 1A5RA 2AL6A 4TV3A 2CU1A 3PSEB 2MBQA 2O6VD 2LI5A 4W9EA 4YL8A 2KX3A 2M0XA 1WGGA 4HLEA 3DBLI 4MELA 2JPHA 4LDTB 5CHVC 5CHWA 2N9PC 1WX8A 4WJQA 1F9JA 2KD0A 3NHEB 4DHJD 3V6EB 2G3QB 3ZUNA 2IYDB 4BKTA 4ANUA 3DPDA 1WXVA 3ZTCA 2KQ7A 4FADA 2DAJA 2JY6A 1OQYA 1GUAB 1LM8B 4TUUA 3MTNB 4ZRKA 3HK0A 2RD0A 3QJZA 3VAWA 4FHJA 3PHXB 1WJ4A 3RYTA 3QQ8B 3VUWA 1WMHB 4DWFA 2ZCBA 3VHTC 4W9KA 3WANA 2KQSA 4GXBA 3NOBA 4GU2A 4F1SA 2IO2B 3PTFC 1WX9A 4AWJA 2PJHA 5C1ZA 3EFUA 1WGDA 2KDFB 5AEKB 4G3XB 4WAAA 3ML9A 4P7IA 2ZVNA 4A3OA 2MQJA 2V4LA 4XZ4A 1P1AA 2ZEQA 4KSKC 3I3TB 3HM6X 1UZXB 2KHWB 2KMCA 4EKUA 1WGYA 2KFKA 2K1FA 4GDKB 2D11A 3TMPB 3VXWA 1YQBA 3L08A 2V3SA 1NDDA 3PHWB 2A4ZA 3O65B 3PLUA 3ZDMC 4BBNC 4DXAB 3PZDA 4TQ0A 4EFOA 3AI5A 4WJOA 2K8HA 2LGYA 3UGBB 4W9CA 3DBHI 3QX1A 5DPRA 4BKSD 3UQBA 4KZCA 3HM3A 1UH6A 3DDCB 2BPSA 4K7WA 4BVUC 4HWIB 2C7MB 3M63B 3N32A 4XC2A 3DBSA 3A4RA 2WWZA 4JQWC 3ZW3A 5JHAA 2FCMA 3ENEA 3R7RA 2WYQA 3QC8B 3APFA 2NS5A 2MA9B 4RM8A 3OJ3A 4EZJA 2RSUA 3K9OB 1WX7A 4MEMA 4K7UA 2HD5B 2KJHB 1VD2A 2L76A 3JSVA 2JRHA 3TIXA 1TBEA 2ZNVC 3VH3B 3W1SC 2C60A 2KK8A 2CHWA 1NBFC 2LWPA 1UBIA 3APDA 1H8CA 4TKNA 3M95A 3ZNID 1WMHA 4WJNA 4DDID 2DYBA 3RD2A 2BWES 2N1WA 3SU8X 4PS7A 3RULA 3ZLZA 2KKCA 2AYOB 3ZIMA 5CX3A 2NBVB 1WGHA 3PGEA 1Z5SB 2Z59B 2KDBA 2GBNA 1WFYA 4PS3A 3A1QA 3SD5A 1K8RB 1T0YA 4NJ6A 4WQOB 3UIPB 3ALBA 1ZGUB 4W9HA 1E8WA 3APCA 1Q0WB 1YX6B 4GDKA 3UINB 4MSMB 3DOWA 1P98A 3PS6A 1E8ZA 3OAWA 3KUZA 2KC1A 3A9JB 3B08A 3QAQA 2DHZA 2K8BA 3CMMB 4ANXA 2IY0B 3EC8A 4GDLB 4FBJB 1LFDA 2J7QB 3RCZA 2IZVB 3V62A 1WIAA 1JRUA 2PE6B 3WAOA 1R4NI 2UYZB 4A20A 1SIFA 1Q1OA 3L54A 2KTRA 1NI2A 2DENB 2RGFA 2MLBA 5AZGA 4DBGA 4IM0A 5L83A 2CS4A 2PEAA 1WXSA 2KWUB 2BGFA 4MH0E 2UWQA 5AZFA 2L0TA 2KXJA 1AARA 1U4AA 3GOEA 2KWCA 2KOXA 3PV1A 5LLIA 2CKHB 3NS8A 2O6VB 1E90A 4HK2A 4GIVA 1I42A 2AEHA 3CF6E 2V1YA 5G2NA 1RLFA 4K81A 3H7PA 1V2YA 4MSQB 2BYVE 2MX2A 4IC7B 4DHJB 2QHOA 3BY4B 2LVPA 4HCPB 1GC6A 1UBQA 1WGRA 2BYFA 2Z0DB 3ZNHB 3RZWC 3ZNZB 3DQVA 5J18A 2DAFA 4CHKA 4FJVB 3WAPA 2FIDA 2WX0A 4E3CA 3Q3FA 3ZVVA 5D7GA 2D2QA 5C23A 5CHFA 2W9NA 1E7VA 2IO0B 2JWZA 3KYCD 1OEYA 4DHZE 2FCSA 1WH3A 2D3GA 5D6JB 1WYWB 3ZDTA 3QHTA 1V80A 4M0WB 2J0JA 3R3MA 2JZZA 3N30A 4KIKB 5D94A 2K6DB 2KJ6A 4ICVA 3D32A 4K7SA 4NJ7A 4II2B 2MP2A 1TZ1A 3NZSA 4E74A 1GG3A 3JVZX 4ZDVA 2N4FA 2FCNA 3VDZA 4MDKE 3B0AA 4HDOA 2ASQA 4KDIC 3VH4B 3ZNGC 1XD3B 2M8SA 2N1VA 1OEYJ 1P3QU 2R2QA 3L17A 3MJWA 3C0RB 4KSLC 4IWOA 2DZKA 2EMTA 3U8ZA 3PRPB 2KNBA 3VQIA 1HE8A 3A33B 4NPNA 3ZTDA 2KZRA 1WE7A 3CSFA 2GBRA 1G6JA 3OLMD 2NCNA 5JHBA 3EHVA 2XK5A 4FJYA 2KFJA 1J19A 4CYEA 1WZ3A 3IVFA 2D07B 2DZJA 1E5WA 2LVQA 4MJSB 2J0KA 1EUVB 3IBEA 2JUOA 3ML8A 2JT4B 1WE6A 2ZPYA 5J17A 1KM7A 2FIFA 2J0MA 1WR6E 1ZKHA 3WALA 2KLGA 5TR5A 5GMVA 1V6EA 4FHKA 1XT9B 4EEWA 3VTWA 2XBBC 4ZYNA 1TGZB 4EUTA 1E7UA 4NAWB 3H9DA 4JIOU 2PPHA 4JLCA 2JVCA 4GN1A 2MRPA 1KJTA 1UD7A 1WRDB 3VTVA 2OOBB 3KUCB 1WR1A 1ISNA 2RPQA 4MM3A 4PYUA 2NPTB 2MBHA 5KHOA 4GOCA 3ECIA 4B95A 1RRBA 5DCNA 2XEWA 2IY1B 3U30A 1WXMA 2ZJDA 2NBUA 3UQAA 2ZNVB 3VUXA 3TL5A 2L05A 2R2OA 1S3SG 1TTNA 2MW5A 4FJZA 4LCDE 1WJ6A 3RT3B 1C1YB 1UGMA 4W9GA 2D10A 2O2VB 1EO6A 2KLCA 1J8CA 2C7NB 2KX0A 2LRUA 4J6IA 1MG8A 4W9IA 4HDQA 2C9WB 3KH0A 3MHSD 3LJ3A 4HPMB 1UELA 4ZRIA 1OGWA 2ZZPB 1WXAA 3ZRCA 2DYMA 4KZ0A 4MJSA 4AUQC 2G4SA 2N7EA 3QCAA 3QK0A 3IFWB 1M94A 2LD9A 1IYFA 2CR5A 3A9KB 4HCNB 4MGKE 5JH5C 2MWSB 3NZUA 3OJ4B 2DZIA 1YJ1A 3L10B 2LXAA 3V61A 2JF5A 4HVBA 1J0GA 3W1YA 1LXDA 3TBLD 1VCBA 2CHXA 2GBMA 1BT0A 3ZO5B 3PPAA 4FN2A 4WWOA 4IW0A 1S1QB 2ZVOA 5E6OA 4EOYA 2KDIA 4F7ZA 2YLMA 2K6QA 3A4SC 1EF1A 2HTHA 1E8XA 4LJPB 4ANWA 3PT2B 3H6NA 4FLHA 4GB9A 5LXHA 3JW0X 4II3B 4PS8A 2L00B 4MGIE 4WWPA 3IG3A 3V6CB 4PYZA 4BOSC 4E71A 2G45B 3T8MA 4ZRJA 1IP9A 4IM3A 1C3TA 2KFKB 4IUMB 4AOFA 2AWTA 4OVVA 2FAZA 1WM2A 1QZEA 4IG7B 4RM9A 3VVWB 4G50A 4EZLA 3LDZE 3UIOB 2B3AA 2IO3B 2Z0EB 5AZHA 2LGXA 2KO3A 5EDSA 3A9JA 5IAAC 4BFRA 2ZCCA 4KV2A 2LRWA 4MGYE 4GDLA 2MCNB 3X0WA 2NR2A 1GC7A 4OVUA 1R4MI 1WY8A 4N9F4 4NQLB 4JL9A 1KOTA 3BINA 2GBJA 5CTRC 2KN5A 2JXXA 1CMXB 2EMSA 3A9KA 3AU5A 3JSVB 2DYOA 3IHPC 3PVLA 2KTFA 4K1RB 2JZ3B 1P9DU 5DPTA 1RFAA 4LDTD 4KDLB 3SHQA 4GMVA 1WJUA 2PE9A 1Y8RC 2LJ5A 4A3PA 4XX5A 3RZFA 2KDEB 2O6VA 2C7HA 2C5LC 2BKFA 1YIWA 3DBRI 2L8JA 3PRZA 5J2RA 1L2NA 4I6PA 2LXCA 2L3ZA 4NNJB 3TJPA 3M3JA 2A5UA 1D3ZA 3ONSA 2BWFA 3HHMA 1XQQA 1H4RA 3A1QB 1V9JA 4BKGA 2L7RA 1P0RA 2OJRA 3H1UA 3L0WB 3B1LX 4KVGB 3WA0A 2AL3A 2M4NA 2M1MA 3TCAA 2WDTB 2I1KA 3N3KB 2GBKA 2VRRB 4URKA 1YD8U 2MBBB 4RMAA 5FR6A 4G0NB 4IWPA 4AJWA 2KMAA 3DVGY 2GMIC 3K9PB 2MBEA 3WIMA 3KUDB 4DK5A 1Z2MA 4KIKA 2LVOA 4M8NA 1V81A 1ZW7A 3L13A 2IO1B 2KVRA 5E6NA 4B9KA 1FXTB 5D2MB 3AU4A 1KLVA 2KTRB 5IA7A 3PRMB 4IWQA 2DZMA 2IBIB 2K8CA 3V60A 3U7DA 2DX5B 4W9JA 3CSTA 3QWZB 2RR9A 2L0FA 2KJRA 4FULA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FUH B;  2NVU I;  1V86 A;  3VTU A;  4EZK A;  2MSE D;  2K39 A;  1PQS A;  5HKH A;  2BYE A;  2REX A;  4BOZ B;  4DDG D;  1WF9 A;  4BKS A;  2N9X A;  3H7P B;  3R66 C;  3KYD D;  4WJP A;  2ZPN A;  5JZE B;  2K25 A;  3ZRF A;  2JRI B;  4I6L B;  1WJN A;  2KAN A;  3PLV A;  1V5O A;  2LAS A;  4AP4 C;  2N9E B;  4GGQ A;  4B6W A;  3R7Q A;  4W9L A;  4DHZ B;  5LXI B;  2LGD A;  3HIZ A;  2CHZ A;  4TQ1 A;  2KWV B;  3DCG A;  4X57 B;  5G55 A;  3S2A A;  2GOW A;  3GZN I;  3X23 A;  4HXD A;  1GJZ A;  2BKR B;  2WX1 A;  5DPW A;  2BF8 B;  2N7D A;  2Y5B B;  5DPS A;  4BBN F;  3PRE A;  1OTR B;  4CO7 A;  3T9L A;  2HE7 A;  1E8Y A;  3KW5 B;  3L16 A;  4NAW A;  1X1M A;  2LUE A;  4HJK A;  4JGH B;  1WZ0 A;  3H7S A;  1EF5 A;  2G4D B;  3ZKJ C;  2HJ8 A;  4I6N B;  1WI0 A;  3DVN U;  1IPG A;  1SE9 A;  1V5T A;  2MP2 B;  4ICU A;  3UF8 A;  3AXC A;  2EKE C;  1GNU A;  2FNJ B;  3EEC A;  3KVF B;  1LQB A;  4GSW A;  3SDL C;  1WM3 A;  4ASW C;  1I35 A;  5L95 C;  3AUL A;  3DVG X;  4ANV A;  3NY5 A;  3QA8 A;  2M17 A;  5BO4 B;  3Q3J A;  4G11 A;  4AJY B;  3RUI B;  2FCQ A;  3DVN V;  2NPT A;  1V49 A;  1RAX A;  1L7Y A;  5KHQ A;  4IM2 A;  3VUY A;  2MBO A;  2YVC A;  1Q5W B;  3M62 B;  4NQK E;  4NY0 A;  2I1J A;  3VFK A;  3W1S A;  4MGZ E;  1YX5 B;  3QAR A;  4WWN A;  4F8C B;  2KC2 A;  4LJO B;  4FA6 A;  1SGH A;  4W9D A;  4HPL B;  3JYU A;  2O2V A;  3P2B A;  3WAM A;  2NBW B;  2XK5 B;  2LZ6 A;  5E6P A;  4M8M A;  4W9F A;  3QIJ A;  1A5R A;  2AL6 A;  4TV3 A;  2CU1 A;  3PSE B;  2MBQ A;  2O6V D;  2LI5 A;  4W9E A;  4YL8 A;  2KX3 A;  2M0X A;  1WGG A;  4HLE A;  3DBL I;  4MEL A;  2JPH A;  4LDT B;  5CHV C;  5CHW A;  2N9P C;  1WX8 A;  4WJQ A;  1F9J A;  2KD0 A;  3NHE B;  4DHJ D;  3V6E B;  2G3Q B;  3ZUN A;  2IYD B;  4BKT A;  4ANU A;  3DPD A;  1WXV A;  3ZTC A;  2KQ7 A;  4FAD A;  2DAJ A;  2JY6 A;  1OQY A;  1GUA B;  1LM8 B;  4TUU A;  3MTN B;  4ZRK A;  3HK0 A;  2RD0 A;  3QJZ A;  3VAW A;  4FHJ A;  3PHX B;  1WJ4 A;  3RYT A;  3QQ8 B;  3VUW A;  1WMH B;  4DWF A;  2ZCB A;  3VHT C;  4W9K A;  3WAN A;  2KQS A;  4GXB A;  3NOB A;  4GU2 A;  4F1S A;  2IO2 B;  3PTF C;  1WX9 A;  4AWJ A;  2PJH A;  5C1Z A;  3EFU A;  1WGD A;  2KDF B;  5AEK B;  4G3X B;  4WAA A;  3ML9 A;  4P7I A;  2ZVN A;  4A3O A;  2MQJ A;  2V4L A;  4XZ4 A;  1P1A A;  2ZEQ A;  4KSK C;  3I3T B;  3HM6 X;  1UZX B;  2KHW B;  2KMC A;  4EKU A;  1WGY A;  2KFK A;  2K1F A;  4GDK B;  2D11 A;  3TMP B;  3VXW A;  1YQB A;  3L08 A;  2V3S A;  1NDD A;  3PHW B;  2A4Z A;  3O65 B;  3PLU A;  3ZDM C;  4BBN C;  4DXA B;  3PZD A;  4TQ0 A;  4EFO A;  3AI5 A;  4WJO A;  2K8H A;  2LGY A;  3UGB B;  4W9C A;  3DBH I;  3QX1 A;  5DPR A;  4BKS D;  3UQB A;  4KZC A;  3HM3 A;  1UH6 A;  3DDC B;  2BPS A;  4K7W A;  4BVU C;  4HWI B;  2C7M B;  3M63 B;  3N32 A;  4XC2 A;  3DBS A;  3A4R A;  2WWZ A;  4JQW C;  3ZW3 A;  5JHA A;  2FCM A;  3ENE A;  3R7R A;  2WYQ A;  3QC8 B;  3APF A;  2NS5 A;  2MA9 B;  4RM8 A;  3OJ3 A;  4EZJ A;  2RSU A;  3K9O B;  1WX7 A;  4MEM A;  4K7U A;  2HD5 B;  2KJH B;  1VD2 A;  2L76 A;  3JSV A;  2JRH A;  3TIX A;  1TBE A;  2ZNV C;  3VH3 B;  3W1S C;  2C60 A;  2KK8 A;  2CHW A;  1NBF C;  2LWP A;  1UBI A;  3APD A;  1H8C A;  4TKN A;  3M95 A;  3ZNI D;  1WMH A;  4WJN A;  4DDI D;  2DYB A;  3RD2 A;  2BWE S;  2N1W A;  3SU8 X;  4PS7 A;  3RUL A;  3ZLZ A;  2KKC A;  2AYO B;  3ZIM A;  5CX3 A;  2NBV B;  1WGH A;  3PGE A;  1Z5S B;  2Z59 B;  2KDB A;  2GBN A;  1WFY A;  4PS3 A;  3A1Q A;  3SD5 A;  1K8R B;  1T0Y A;  4NJ6 A;  4WQO B;  3UIP B;  3ALB A;  1ZGU B;  4W9H A;  1E8W A;  3APC A;  1Q0W B;  1YX6 B;  4GDK A;  3UIN B;  4MSM B;  3DOW A;  1P98 A;  3PS6 A;  1E8Z A;  3OAW A;  3KUZ A;  2KC1 A;  3A9J B;  3B08 A;  3QAQ A;  2DHZ A;  2K8B A;  3CMM B;  4ANX A;  2IY0 B;  3EC8 A;  4GDL B;  4FBJ B;  1LFD A;  2J7Q B;  3RCZ A;  2IZV B;  3V62 A;  1WIA A;  1JRU A;  2PE6 B;  3WAO A;  1R4N I;  2UYZ B;  4A20 A;  1SIF A;  1Q1O A;  3L54 A;  2KTR A;  1NI2 A;  2DEN B;  2RGF A;  2MLB A;  5AZG A;  4DBG A;  4IM0 A;  5L83 A;  2CS4 A;  2PEA A;  1WXS A;  2KWU B;  2BGF A;  4MH0 E;  2UWQ A;  5AZF A;  2L0T A;  2KXJ A;  1AAR A;  1U4A A;  3GOE A;  2KWC A;  2KOX A;  3PV1 A;  5LLI A;  2CKH B;  3NS8 A;  2O6V B;  1E90 A;  4HK2 A;  4GIV A;  1I42 A;  2AEH A;  3CF6 E;  2V1Y A;  5G2N A;  1RLF A;  4K81 A;  3H7P A;  1V2Y A;  4MSQ B;  2BYV E;  2MX2 A;  4IC7 B;  4DHJ B;  2QHO A;  3BY4 B;  2LVP A;  4HCP B;  1GC6 A;  1UBQ A;  1WGR A;  2BYF A;  2Z0D B;  3ZNH B;  3RZW C;  3ZNZ B;  3DQV A;  5J18 A;  2DAF A;  4CHK A;  4FJV B;  3WAP A;  2FID A;  2WX0 A;  4E3C A;  3Q3F A;  3ZVV A;  5D7G A;  2D2Q A;  5C23 A;  5CHF A;  2W9N A;  1E7V A;  2IO0 B;  2JWZ A;  3KYC D;  1OEY A;  4DHZ E;  2FCS A;  1WH3 A;  2D3G A;  5D6J B;  1WYW B;  3ZDT A;  3QHT A;  1V80 A;  4M0W B;  2J0J A;  3R3M A;  2JZZ A;  3N30 A;  4KIK B;  5D94 A;  2K6D B;  2KJ6 A;  4ICV A;  3D32 A;  4K7S A;  4NJ7 A;  4II2 B;  2MP2 A;  1TZ1 A;  3NZS A;  4E74 A;  1GG3 A;  3JVZ X;  4ZDV A;  2N4F A;  2FCN A;  3VDZ A;  4MDK E;  3B0A A;  4HDO A;  2ASQ A;  4KDI C;  3VH4 B;  3ZNG C;  1XD3 B;  2M8S A;  2N1V A;  1OEY J;  1P3Q U;  2R2Q A;  3L17 A;  3MJW A;  3C0R B;  4KSL C;  4IWO A;  2DZK A;  2EMT A;  3U8Z A;  3PRP B;  2KNB A;  3VQI A;  1HE8 A;  3A33 B;  4NPN A;  3ZTD A;  2KZR A;  1WE7 A;  3CSF A;  2GBR A;  1G6J A;  3OLM D;  2NCN A;  5JHB A;  3EHV A;  2XK5 A;  4FJY A;  2KFJ A;  1J19 A;  4CYE A;  1WZ3 A;  3IVF A;  2D07 B;  2DZJ A;  1E5W A;  2LVQ A;  4MJS B;  2J0K A;  1EUV B;  3IBE A;  2JUO A;  3ML8 A;  2JT4 B;  1WE6 A;  2ZPY A;  5J17 A;  1KM7 A;  2FIF A;  2J0M A;  1WR6 E;  1ZKH A;  3WAL A;  2KLG A;  5TR5 A;  5GMV A;  1V6E A;  4FHK A;  1XT9 B;  4EEW A;  3VTW A;  2XBB C;  4ZYN A;  1TGZ B;  4EUT A;  1E7U A;  4NAW B;  3H9D A;  4JIO U;  2PPH A;  4JLC A;  2JVC A;  4GN1 A;  2MRP A;  1KJT A;  1UD7 A;  1WRD B;  3VTV A;  2OOB B;  3KUC B;  1WR1 A;  1ISN A;  2RPQ A;  4MM3 A;  4PYU A;  2NPT B;  2MBH A;  5KHO A;  4GOC A;  3ECI A;  4B95 A;  1RRB A;  5DCN A;  2XEW A;  2IY1 B;  3U30 A;  1WXM A;  2ZJD A;  2NBU A;  3UQA A;  2ZNV B;  3VUX A;  3TL5 A;  2L05 A;  2R2O A;  1S3S G;  1TTN A;  2MW5 A;  4FJZ A;  4LCD E;  1WJ6 A;  3RT3 B;  1C1Y B;  1UGM A;  4W9G A;  2D10 A;  2O2V B;  1EO6 A;  2KLC A;  1J8C A;  2C7N B;  2KX0 A;  2LRU A;  4J6I A;  1MG8 A;  4W9I A;  4HDQ A;  2C9W B;  3KH0 A;  3MHS D;  3LJ3 A;  4HPM B;  1UEL A;  4ZRI A;  1OGW A;  2ZZP B;  1WXA A;  3ZRC A;  2DYM A;  4KZ0 A;  4MJS A;  4AUQ C;  2G4S A;  2N7E A;  3QCA A;  3QK0 A;  3IFW B;  1M94 A;  2LD9 A;  1IYF A;  2CR5 A;  3A9K B;  4HCN B;  4MGK E;  5JH5 C;  2MWS B;  3NZU A;  3OJ4 B;  2DZI A;  1YJ1 A;  3L10 B;  2LXA A;  3V61 A;  2JF5 A;  4HVB A;  1J0G A;  3W1Y A;  1LXD A;  3TBL D;  1VCB A;  2CHX A;  2GBM A;  1BT0 A;  3ZO5 B;  3PPA A;  4FN2 A;  4WWO A;  4IW0 A;  1S1Q B;  2ZVO A;  5E6O A;  4EOY A;  2KDI A;  4F7Z A;  2YLM A;  2K6Q A;  3A4S C;  1EF1 A;  2HTH A;  1E8X A;  4LJP B;  4ANW A;  3PT2 B;  3H6N A;  4FLH A;  4GB9 A;  5LXH A;  3JW0 X;  4II3 B;  4PS8 A;  2L00 B;  4MGI E;  4WWP A;  3IG3 A;  3V6C B;  4PYZ A;  4BOS C;  4E71 A;  2G45 B;  3T8M A;  4ZRJ A;  1IP9 A;  4IM3 A;  1C3T A;  2KFK B;  4IUM B;  4AOF A;  2AWT A;  4OVV A;  2FAZ A;  1WM2 A;  1QZE A;  4IG7 B;  4RM9 A;  3VVW B;  4G50 A;  4EZL A;  3LDZ E;  3UIO B;  2B3A A;  2IO3 B;  2Z0E B;  5AZH A;  2LGX A;  2KO3 A;  5EDS A;  3A9J A;  5IAA C;  4BFR A;  2ZCC A;  4KV2 A;  2LRW A;  4MGY E;  4GDL A;  2MCN B;  3X0W A;  2NR2 A;  1GC7 A;  4OVU A;  1R4M I;  1WY8 A;  4N9F 4;  4NQL B;  4JL9 A;  1KOT A;  3BIN A;  2GBJ A;  5CTR C;  2KN5 A;  2JXX A;  1CMX B;  2EMS A;  3A9K A;  3AU5 A;  3JSV B;  2DYO A;  3IHP C;  3PVL A;  2KTF A;  4K1R B;  2JZ3 B;  1P9D U;  5DPT A;  1RFA A;  4LDT D;  4KDL B;  3SHQ A;  4GMV A;  1WJU A;  2PE9 A;  1Y8R C;  2LJ5 A;  4A3P A;  4XX5 A;  3RZF A;  2KDE B;  2O6V A;  2C7H A;  2C5L C;  2BKF A;  1YIW A;  3DBR I;  2L8J A;  3PRZ A;  5J2R A;  1L2N A;  4I6P A;  2LXC A;  2L3Z A;  4NNJ B;  3TJP A;  3M3J A;  2A5U A;  1D3Z A;  3ONS A;  2BWF A;  3HHM A;  1XQQ A;  1H4R A;  3A1Q B;  1V9J A;  4BKG A;  2L7R A;  1P0R A;  2OJR A;  3H1U A;  3L0W B;  3B1L X;  4KVG B;  3WA0 A;  2AL3 A;  2M4N A;  2M1M A;  3TCA A;  2WDT B;  2I1K A;  3N3K B;  2GBK A;  2VRR B;  4URK A;  1YD8 U;  2MBB B;  4RMA A;  5FR6 A;  4G0N B;  4IWP A;  4AJW A;  2KMA A;  3DVG Y;  2GMI C;  3K9P B;  2MBE A;  3WIM A;  3KUD B;  4DK5 A;  1Z2M A;  4KIK A;  2LVO A;  4M8N A;  1V81 A;  1ZW7 A;  3L13 A;  2IO1 B;  2KVR A;  5E6N A;  4B9K A;  1FXT B;  5D2M B;  3AU4 A;  1KLV A;  2KTR B;  5IA7 A;  3PRM B;  4IWQ A;  2DZM A;  2IBI B;  2K8C A;  3V60 A;  3U7D A;  2DX5 B;  4W9J A;  3CST A;  3QWZ B;  2RR9 A;  2L0F A;  2KJR A;  4FUL A; 
#chains in the Genus database with same CATH topology
 1YJI A;  2H89 B;  1DGJ A;  2K39 A;  2RMM A;  5MPO A;  2MEK A;  2BYE A;  2REX A;  5I4D A;  4OZC A;  3KYD D;  5JZE B;  1FNV A;  2PKO A;  2E3T A;  4I6L B;  2N9E B;  1V8C A;  4TQ1 A;  3DCG A;  2GOW A;  1E0Z A;  3GZN I;  3RMK C;  4HXD A;  2WX1 A;  4PK1 A;  5DPW A;  3EFC A;  2Y5B B;  3DWG C;  1FEH A;  4BBN F;  4CO7 A;  3KW5 B;  1X1M A;  4JGH B;  1WZ0 A;  3ZKJ C;  4I6N B;  4ICU A;  1GNU A;  3IXS A;  1CQV A;  1N60 A;  4ARI A;  3SDL C;  4ZHP A;  5L95 C;  3NY5 A;  2M17 A;  1TYG B;  1TKG A;  1V49 A;  1K50 A;  4NQK E;  3W1S A;  4W9D A;  4HPL B;  3RFZ B;  1RFK A;  3WAM A;  2NBW B;  2X38 A;  5E6P A;  1A5R A;  3QIJ A;  3Q8F A;  2O6V D;  1XLN A;  1GB1 A;  1WX8 A;  2WXL A;  3GS2 A;  2BB6 A;  4ANU A;  1LGR A;  3H8H A;  2JY6 A;  3MTN B;  3QJZ A;  1XCT L;  1WJ4 A;  2WDV B;  3QQ8 B;  3RYT A;  3VUW A;  2ZCB A;  2BS3 B;  4GXB A;  3TEY A;  4N59 A;  4AWJ A;  1HQR D;  5C1Z A;  5IN7 A;  2KDF B;  2INC C;  5AEK B;  1J7C A;  4G3X B;  1RM6 C;  3ML9 A;  4FXC A;  2GI9 A;  1P1A A;  3E9S A;  3AE1 B;  3BVZ A;  2KHW B;  3ZYY X;  2KFK A;  2NMQ A;  3ZDM C;  3O65 B;  2LFI A;  2K8H A;  3UGB B;  4W9C A;  4BKS D;  2N7J A;  1I4H A;  4USA A;  3MHZ A;  4HWI B;  1XEE A;  3M63 B;  2W55 A;  1QQR A;  2AX5 A;  3SFD B;  3DBH B;  1SB3 C;  4EZJ A;  1K53 A;  1VD2 A;  4OHJ A;  2ZNV C;  3W1S C;  1YQ4 B;  2ZW0 A;  3AH7 A;  2LWP A;  1NBF C;  4CQN A;  3ZNI D;  3RD2 A;  3AB5 A;  4PS7 A;  4C4V B;  1F77 A;  5JXV A;  2NBV B;  1WGH A;  1ZE3 D;  3PGE A;  3PZ7 A;  1Z5S B;  2I38 A;  3Q14 C;  2WNM A;  3DHG C;  1K8R B;  4XDD A;  1ZGU B;  4W9H A;  3IAM 1;  3QAQ A;  2K8B A;  2IY0 B;  4GDL B;  1EM7 A;  2UYZ B;  5D3D A;  1NI2 A;  2DEN B;  1TS5 A;  1FNW A;  2MLB A;  2JYT A;  2L0T A;  5LLI A;  3RPF C;  1JWU D;  4K81 A;  1PUT A;  1T0Q C;  2BYV E;  4IC7 B;  3P42 A;  2LVP A;  2XN9 C;  1YN3 A;  1UBQ A;  2BYF A;  2Z0D B;  1WGK A;  3DQV A;  4S0R A;  3CIR B;  3WAP A;  3ZVV A;  5CHF A;  1QIL A;  2IO0 B;  1OEY A;  5G5H A;  5D6J B;  1WYW B;  4K3C A;  5D94 A;  1ET6 A;  4N6E B;  4NJ7 A;  3ZGZ A;  3NZS A;  3JVZ X;  3BZD B;  4Q2J A;  2NTT A;  2K5P A;  3B0A A;  4HDO A;  3ZNG C;  1XD3 B;  3AE3 B;  1DOX A;  1SE2 A;  1YN4 A;  4KGS A;  2QC8 A;  2DZK A;  3PRP B;  2KNB A;  1HE8 A;  4ZRQ A;  4P1C C;  2GBR A;  3W9C B;  2NCN A;  5JHB A;  3AE4 B;  5IKC M;  2DZJ A;  1K52 A;  4EE2 A;  1T3Q A;  1ESF A;  2JUO A;  2ZPY A;  5J17 A;  2FIF A;  1QOF A;  5EE9 A;  1V6E A;  2XBB C;  3BVG A;  1TGZ B;  1E7U A;  3H9D A;  4JIO U;  3ZXV A;  4GN1 A;  2MRP A;  2WDR B;  1MG4 A;  1F0Z A;  5BMG A;  4WUR A;  4A9A A;  1V97 A;  2Y3A A;  3VTV A;  4AS1 A;  4HEA 1;  4PYU A;  5HHD G;  2BQQ A;  2XEW A;  2NBU A;  3VUX A;  1S3S G;  1J7B A;  4FJZ A;  4LCD E;  1WJ6 A;  3RT3 B;  4WAF A;  4W9G A;  5BYQ A;  1EO6 A;  4RGO S;  1J8C A;  4TSS A;  3TEX A;  2WXP A;  4ITK A;  4J6I A;  1MG8 A;  4HDQ A;  3FAH A;  1HZ5 A;  3AEF B;  4HPM B;  4ZRI A;  3Q3M C;  2KMM A;  1FFU A;  3QK0 A;  1M94 A;  3AEB B;  2CR5 A;  4HCN B;  3P1M A;  3NZU A;  1KFY B;  4YWG G;  3L10 B;  2TSS A;  2JZP A;  4HVB A;  2INP E;  5IP4 D;  1LXD A;  1BT0 A;  3W5U B;  4IW0 A;  4JWU C;  2YLM A;  3AE8 B;  3A4S C;  2K3U A;  4S17 A;  3H6N A;  1FMA D;  3HVZ A;  1J7A A;  1OQR A;  1YN5 A;  5E6J A;  4IDI A;  3T8M A;  1NVI D;  3U4E G;  4RFB A;  1L4D B;  4H2A A;  4OVV A;  1V1P B;  1MVK A;  4IG7 B;  2L32 A;  2IO3 B;  2LGX A;  1B1Z A;  5EDS A;  2W3S A;  3I5J C;  2ZCC A;  2LRW A;  4GDL A;  3ETR A;  4N9F 4;  1FFV A;  2BB5 A;  1FPY A;  2GBJ A;  3AU5 A;  3JSV B;  2IGG A;  4HKQ A;  1P9D U;  5DPT A;  4KDL B;  4HJG E;  1WJU A;  4XGA B;  3ABV B;  5C3J B;  3RZF A;  3DBR I;  1I4G A;  3Q3N C;  5J2R A;  1P7E A;  2DBY A;  4MT5 A;  3HHM A;  1V9J A;  2DNF A;  4KVG B;  3L0W B;  3B1L X;  2M4N A;  2JWU A;  3TCA A;  3N3K B;  3HRD D;  5AUK A;  4URK A;  4IWP A;  2KMA A;  3DVG Y;  2GMI C;  3AEA B;  4M8N A;  1V81 A;  1FRR A;  1PGA A;  1XLO A;  5H92 C;  2KTR B;  1QOA A;  1SXT A;  2IBI B;  3V60 A;  4W9J A;  3QWZ B;  2RR9 A;  2PPH A;  2FUH B;  4LNI A;  2NVU I;  1V86 A;  4EZK A;  1PQS A;  5HKH A;  1TY2 A;  4R3D A;  2V3P A;  2KAN A;  4PT5 A;  1V5O A;  2LAS A;  4OZA A;  1N5W A;  4B6W A;  3R7Q A;  4DHZ B;  2LGD A;  5G55 A;  2V0G A;  1Q10 A;  1GJZ A;  2BKR B;  2ONQ A;  2N7D A;  4ZYS A;  3PRE A;  1OTR B;  1UGJ A;  2KAJ A;  1KTK A;  4LNF A;  2LUE A;  4HJK A;  1JWS D;  2VZK D;  2G4D B;  2HJ8 A;  1SE9 A;  1ACC A;  2MP2 B;  1BML C;  2EKE C;  3KVF B;  1LQB A;  4GSW A;  3RNB C;  4ARC A;  3U2S C;  3QA8 A;  2PTL A;  5BO4 B;  4G11 A;  1PGX A;  3DVN V;  1JWA D;  1RAX A;  1L7Y A;  3O13 A;  1AW7 A;  2K22 A;  3VUY A;  2MBO A;  2YVC A;  1Q5W B;  3VFK A;  4NY0 A;  3R2I A;  3QAR A;  2KC2 A;  4FA6 A;  3JYU A;  4RH6 A;  2N9L A;  2XK5 B;  2LZ6 A;  4M8M A;  4W9F A;  2AL6 A;  3PSE B;  2KX3 A;  4HLE A;  1STE A;  4MEL A;  2JPH A;  1FM0 D;  4LDT B;  5CHV C;  5BMI A;  5CHW A;  4WJQ A;  1B9R A;  4DHJ D;  2G3Q B;  3ZUN A;  3P4R B;  2KQ7 A;  1GOZ A;  1OQY A;  1LM8 B;  4TUU A;  3DBL B;  2D3A A;  4XDC A;  3VAW A;  4FHJ A;  4GLS C;  1QT9 A;  4W9K A;  2KQ4 X;  1GB4 A;  3WAN A;  3LXF A;  1XCQ L;  2PVG C;  3NOB A;  1D5Z C;  2WHI A;  4MM3 B;  3R2T A;  2QCZ A;  2MQJ A;  1R7S A;  4OZB A;  3AEG B;  1TIF A;  2ZW1 A;  1UUP A;  2WXF A;  3EUB 2;  2K1F A;  4WIP A;  3TMP B;  4JPS A;  3VXW A;  1V1P A;  3PHW B;  4TQ0 A;  2A4Z A;  2MHJ A;  4EFO A;  2LGY A;  1JRP A;  2DWQ A;  3DBH I;  3QX1 A;  2WXO A;  4KZC A;  3HM3 A;  1GPX A;  4ZRP A;  2C7M B;  1MHH E;  3DBS A;  2WWZ A;  1IUE A;  5JHA A;  2WYQ A;  2WDQ B;  4RM8 A;  2KJH B;  3JSV A;  3TIX A;  3VH3 B;  3URY A;  2C60 A;  3APD A;  1WMH A;  2BT6 A;  2BWE S;  2N1W A;  3SU8 X;  2KKC A;  2AYO B;  3ZIM A;  3BWU D;  3V05 A;  4PS3 A;  4O1N A;  5HG2 A;  1FNU A;  2M56 B;  4WQO B;  3NVV A;  1JAL A;  1PGB A;  3APC A;  1Q0W B;  4GDK A;  4MSM B;  4A90 A;  3OAW A;  2KC1 A;  3CMM B;  2KVZ A;  3IT6 B;  2AQ2 B;  2LHD A;  4FBJ B;  1LFD A;  2J7Q B;  3FKY A;  2IZV B;  3V62 A;  3WAO A;  1R4N I;  3KWL A;  4A20 A;  1Q1O A;  2KTR A;  1PFD A;  4DBG A;  2WP9 B;  2PEA A;  2UWQ A;  5AZF A;  2KXJ A;  1AAR A;  1U4A A;  3PV1 A;  2CKH B;  1E90 A;  4GIV A;  5G2N A;  2PMV A;  1XF5 L;  4MSQ B;  4REZ A;  3SFE B;  1I7H A;  2WU5 B;  3RZW C;  1MFW A;  2DAF A;  1N61 A;  2WX0 A;  3Q3F A;  2WS3 B;  4DHZ E;  3N1Z C;  2FCS A;  2D3G A;  2M19 A;  1I4P A;  2K6D B;  2J53 A;  2KJ6 A;  3N9Y C;  1SJE D;  1T6B X;  1NI3 A;  2MP2 A;  1GG3 A;  2N4F A;  3VDZ A;  1XLQ A;  3VH4 B;  2M8S A;  2N1V A;  1TKE A;  3N20 C;  2QMT A;  3VQI A;  1NEN B;  3ZJU A;  3ZTD A;  2KZR A;  1WE7 A;  3CSF A;  3EHV A;  2XK5 A;  2KFJ A;  2D07 B;  2WGS A;  3NRZ A;  1TS2 A;  3Q8C A;  1KM7 A;  2IGD A;  4IKG A;  2KLG A;  3BVM A;  5TR5 A;  4FHK A;  3RNG C;  1OQQ A;  3NVZ A;  4YXD B;  4UDU C;  4JLC A;  3DHI C;  4J3O D;  4MM3 A;  5KHO A;  3AE7 B;  4GOC A;  2IY1 B;  3U30 A;  3UQA A;  2R2O A;  3CWI A;  4YTM B;  2O2V B;  4RF0 A;  2LRU A;  1XXG A;  3VR9 B;  1C9F A;  1OGW A;  2ZZP B;  2B76 B;  1WXA A;  4AUQ C;  2BW2 A;  2G4S A;  2LD9 A;  3Q2A C;  2LGI A;  3OJ4 B;  1YJ1 A;  1VZ7 A;  1J0G A;  1R4N B;  3TBL D;  1VCB A;  2E6X A;  4US8 A;  2W82 A;  4EOY A;  2HTM E;  2D5G A;  2K6Q A;  2JSV X;  2HTH A;  2RPV A;  1HA5 A;  3NS1 A;  4B0M A;  3IG3 A;  4BOS C;  4HPP A;  4E71 A;  2G45 B;  1FO4 A;  1IP9 A;  1C3T A;  4IUM B;  4AOF A;  1L0X B;  2AWT A;  3AEC B;  2IPK D;  2BVC A;  2IDY A;  1ZXI A;  2N0S B;  1N63 A;  2KO3 A;  4LK0 M;  1JRO A;  4KV2 A;  2MCN B;  3BYT B;  2NR2 A;  3NZ3 A;  4OVU A;  2J52 A;  1KOT A;  3ZJV A;  1CMX B;  1OFF A;  4JE3 B;  2VH2 A;  4M01 A;  1SBB B;  1R4M B;  3IAS 1;  2WXI A;  1Y8R C;  2LJ5 A;  4KKI A;  4A3P A;  2KDE B;  3TEW A;  3N1X C;  2L8J A;  3W2D A;  1L2N A;  4I6P A;  2L3Z A;  4NNJ B;  3RN9 C;  2BWF A;  4BKG A;  1P0R A;  3MP9 A;  2AL3 A;  1VRA B;  2WDT B;  2I1K A;  2VRR B;  1UWM A;  1YD8 U;  4G0N B;  3KQ4 A;  4LTU A;  5BYS A;  1Z2M A;  1JCK B;  2LVO A;  3I63 C;  3L13 A;  2KVR A;  4B9K A;  2BS4 B;  3AE9 B;  1FXT B;  3AU4 A;  5BYR A;  3PRM B;  2LGS A;  2L0F A;  2KJR A;  4RGM A;  2SAK A;  3RNF C;  5IO9 A;  4DDG D;  1KH0 A;  2N9X A;  3H7P B;  4WJP A;  2ZPN A;  3ZRF A;  4L2Y A;  2WLB A;  4GGQ A;  1T0S C;  4X57 B;  3S2A A;  2CHZ A;  1C4P A;  1CJE A;  1EWY C;  2BF8 B;  3KWV A;  2JQR B;  1C76 A;  3BK1 A;  2GB1 A;  2HE7 A;  1YNT E;  1TKY A;  2PIA A;  3L16 A;  4D2K A;  1EF5 A;  1D3Z A;  3MC8 A;  1IPG A;  1FD6 A;  3UF8 A;  1QF6 A;  3AXC A;  3EEC A;  2FNJ B;  3Q6B A;  1ENF A;  4XE0 A;  4MAC A;  1I35 A;  1YQ3 B;  2L52 A;  2MH7 A;  3FC4 A;  2ACZ B;  3Q3J A;  4AJY B;  2LEK A;  3RUI B;  2FCQ A;  3Q8A A;  3TEZ A;  2MJ3 A;  5KHQ A;  4B0E A;  3NJT A;  2I1J A;  4YTP B;  4MGZ E;  1YX5 B;  3C8Y A;  4WWN A;  4LJO B;  1SSN A;  4K3B A;  2ICI A;  2O2V A;  3P2B A;  5HFY A;  2CU1 A;  2MBQ A;  1TJE A;  2M0X A;  4HKZ E;  3DBL I;  1D5M C;  1F9J A;  3LYY A;  3NHE B;  4BKT A;  1WXV A;  2FE8 A;  1I4X A;  2DAJ A;  2RD0 A;  2X8X X;  3PHX B;  3AED B;  1WMH B;  4DWF A;  5HI1 A;  2KQS A;  5LNK 1;  1HTQ A;  4GU2 A;  4F1S A;  2WXQ A;  2IO2 B;  3PTF C;  1WX9 A;  3J9C A;  2G9H D;  2PJH A;  4ZHO A;  3BII D;  2FBW B;  3VR8 B;  4WAA A;  2ZVN A;  2V4L A;  1FXA A;  1VDV A;  3I3T B;  2WXJ A;  4C7Y A;  4EKU A;  1WGY A;  4GDK B;  4JWS C;  3L08 A;  1NDD A;  3PLU A;  4BBN C;  4WJO A;  2YEP F;  3UQB A;  5DPR A;  1UH6 A;  2MJE A;  3Q8E A;  4XYC A;  4K7W A;  3N32 A;  4XC2 A;  3U7Z A;  2QIE B;  1HXY D;  3N1Y C;  3TUO A;  3ENE A;  3R7R A;  3MJ5 A;  2MA9 B;  2QJL A;  1DOY A;  2RSU A;  4MEM A;  4K7U A;  2HD5 B;  2KK8 A;  2R61 A;  1H8C A;  4TKN A;  4WJN A;  4DDI D;  2DYB A;  1C78 A;  1T0R C;  2OJW A;  1E7P B;  3ZLZ A;  2KYW A;  5CX3 A;  1WYG A;  2Z59 B;  2KDB A;  2GBN A;  1WFY A;  1N62 A;  4YSY B;  3UIP B;  1SE4 A;  3UIN B;  3DOW A;  1P98 A;  2EKI A;  3PS6 A;  3RNE C;  3KUZ A;  3B08 A;  1VLB A;  4ANX A;  5D3I B;  1TY0 A;  3EC8 A;  5C2T B;  3UI3 A;  4RGN A;  3RCZ A;  1ZDX A;  2GRI A;  2PE6 B;  2AQ1 B;  4A6Q A;  3L54 A;  4A8X C;  2RGF A;  5AZG A;  4IM0 A;  2CS4 A;  2KAC A;  1EWC A;  1L0Y B;  4YT0 B;  3GOE A;  3I9V 1;  2O6V B;  1KF6 B;  2AEH A;  1RLF A;  3H7P A;  3L4P A;  2MX2 A;  4ZOH C;  2QHO A;  2IND C;  4HCP B;  1GC6 A;  1ZPS A;  1KRH A;  1WGR A;  3ZNZ B;  5J18 A;  4FJV B;  2FID A;  4E3C A;  2Z8L A;  2PW9 A;  1C79 A;  1UF0 A;  2D2Q A;  4KX6 B;  5C23 A;  2QSD A;  1WXQ A;  3NG0 A;  4RGT A;  1V80 A;  2J0J A;  4C80 A;  1AYF A;  4WQM A;  3D32 A;  1T5X D;  4K7S A;  3FIL B;  4E74 A;  2AQ3 B;  4ZDV A;  2FCN A;  1YMH E;  2CJN A;  4MDK E;  2ASQ A;  2WU2 B;  2MJD A;  1P3Q U;  1XO3 A;  3L17 A;  3MJW A;  4KSL C;  3ZXR A;  2EMT A;  3T3N A;  1SF0 A;  2KDM A;  3A33 B;  4NPN A;  1E9M A;  2RDG A;  1AWD A;  1G6J A;  2IJ0 A;  3OLM D;  2LUM A;  4FJY A;  1KLU D;  5BMH A;  1WZ3 A;  3IVF A;  2WXN A;  2LVQ A;  1EUV B;  2DLB A;  1E10 A;  2JT4 B;  1WE6 A;  2CU3 A;  2LHE A;  1SIJ A;  3ZQ4 A;  1WR6 E;  1ZKH A;  4M00 A;  5GXG B;  5GMV A;  4YSX B;  4EEW A;  3VTW A;  5G5G A;  4EUT A;  5EE1 A;  4NAW B;  1SEB D;  1PYW D;  2JVC A;  2KT7 A;  4LNO A;  1BUI C;  1WRD B;  2WXK A;  2OOB B;  2RPQ A;  1MPE A;  1C77 A;  2NPT B;  1KLG D;  4B95 A;  1RRB A;  2SEB D;  2ZJD A;  3GP7 A;  4IOI E;  3GE3 C;  1L0V B;  2KN4 A;  2W54 A;  2C7N B;  2KX0 A;  1ROE A;  3AE5 B;  3KH0 A;  3LJ3 A;  3NUH B;  1UEL A;  3ZRC A;  4KZ0 A;  4MJS A;  3QCA A;  4L1B A;  4MGK E;  5JH5 C;  2MWS B;  2LJI A;  2DZI A;  4L23 A;  3V61 A;  2L83 A;  2JF5 A;  1TZO A;  2PVO D;  3B2G A;  4OVZ A;  3AE6 B;  2CHX A;  1VZ6 A;  2GBM A;  3U52 E;  3PPA A;  4FN2 A;  3BK2 A;  5E6O A;  2KDI A;  4F7Z A;  4LJP B;  4ANW A;  3PT2 B;  4GB9 A;  5LXH A;  2L00 B;  2G1E A;  4WWP A;  3Q69 A;  5H8Y E;  1WRI A;  2FAZ A;  4M02 A;  1QZE A;  3PO0 A;  4EZL A;  3LDZ E;  3RNC C;  3UIO B;  2J42 A;  2Z0E B;  5AZH A;  2BTE A;  3GB1 A;  5IAA C;  1TS3 A;  4MGY E;  3X0W A;  1GC7 A;  1R4M I;  1VZ8 A;  1WY8 A;  4NQL B;  5CTR C;  2JXX A;  2EMS A;  3A9K A;  2DYO A;  3PVL A;  2KTF A;  2M0A A;  2JZ3 B;  4KGR A;  1RFA A;  4LDT D;  2VH1 A;  2PE9 A;  2UU7 A;  4NJC A;  4XX5 A;  1A70 A;  2O6V A;  3MC9 A;  4RF1 A;  1UWX A;  3M3J A;  3MFG A;  1QOB A;  2A5U A;  3ONS A;  5TSS A;  1XQQ A;  1H4R A;  3A1Q B;  3WA0 A;  5IOI A;  2M1M A;  5EE0 A;  3P4Q B;  1TS4 A;  2MBB B;  5FR6 A;  3MC0 B;  4AJW A;  2CJO A;  4LNN A;  3K9P B;  3OWE B;  4DK5 A;  4NZL B;  2WXG A;  3LB8 C;  3ZJT A;  2QEJ C;  3FIL A;  4IWQ A;  2DX5 B;  1MI0 A;  3NVW A;  2BS2 B;  4FUL A;  3VTU A;  1F2R C;  2MSE D;  3AE2 B;  1I4Q A;  4BOZ B;  1WF9 A;  4BKS A;  3RI7 C;  3R66 C;  3B2F A;  4QAY A;  3SEB A;  4P6V F;  2K25 A;  1ZOY B;  3AM9 A;  2JRI B;  4C56 C;  3AN1 A;  1WJN A;  3PLV A;  4AP4 C;  4W9L A;  5LXI B;  3HIZ A;  4XWT A;  2KWV B;  3WCQ A;  3X23 A;  3Q3O C;  1ZDV A;  5DPS A;  3T3O A;  3T9L A;  1P7F A;  1HTO A;  1E8Y A;  4NAW A;  3GZN B;  3H7S A;  1WI0 A;  3DVN U;  1V5T A;  1FIQ A;  1WM3 A;  4ASW C;  3AUL A;  3DVG X;  1VJK A;  4ANV A;  4ACF A;  2NPT A;  2LMC A;  4N58 A;  4IM2 A;  2RDB C;  3M62 B;  4F8C B;  1SGH A;  2N9K A;  2WXH A;  4YTN B;  1EU4 A;  4C7Z A;  3Q8B A;  3B9J A;  4TV3 A;  3EA6 A;  2LI5 A;  4W9E A;  3W5V B;  4YL8 A;  1WGG A;  1MJD A;  3GE8 C;  2I2Y A;  2N9P C;  1PDX A;  2KD0 A;  3V6E B;  4P1B C;  2IYD B;  2J4X A;  3DPD A;  3BYY B;  3ZTC A;  4FAD A;  1GUA B;  4ZRK A;  3HK0 A;  3VHT C;  1XLP A;  1IBX B;  3AEE B;  1YJJ A;  1MHX A;  3EFU A;  1WGD A;  4P7I A;  4A3O A;  2JXT A;  4XZ4 A;  2ZEQ A;  4KSK C;  3HM6 X;  1UZX B;  2KMC A;  2D11 A;  1D5X C;  1JQ4 A;  1YQB A;  2V3S A;  4DXA B;  2D3C A;  5AUI A;  3PZD A;  3AI5 A;  1L6U A;  4LLG M;  4KGT A;  3DDC B;  2BPS A;  4BVU C;  3OG5 A;  1JWM D;  3A4R A;  4JQW C;  3AMZ A;  4HRS A;  4NAM A;  3ZW3 A;  1AN8 A;  2FCM A;  4AQ7 A;  3QC8 B;  3APF A;  2NS5 A;  3OJ3 A;  3K9O B;  1WX7 A;  2L76 A;  4DXF A;  2JRH A;  1TBE A;  3V3X A;  1F2R I;  3AV8 A;  2CHW A;  2WXM A;  1UBI A;  3EGR A;  3M95 A;  4A55 A;  2HJ1 A;  3RUL A;  1RWS A;  4LNK A;  3A1Q A;  3SD5 A;  2VZK B;  1T0Y A;  4NJ6 A;  1V1O A;  1K51 A;  3ALB A;  1E8W A;  1YX6 B;  1E8Z A;  3A9J B;  2DHZ A;  1NEK B;  1WIA A;  1JRU A;  1SIF A;  1FCC C;  3E56 A;  4TMA B;  5L83 A;  1WXS A;  4RNA A;  4C00 A;  2KWU B;  2BGF A;  4MH0 E;  5FR3 A;  1SE3 A;  1YOV B;  2KWC A;  2KOX A;  3HUI A;  3NS8 A;  2OHF A;  4HK2 A;  1I42 A;  2L1A A;  3CF6 E;  2V1Y A;  1F1H A;  1V2Y A;  4DHJ B;  3BY4 B;  4C4V A;  5T8I A;  3ZNH B;  1N5X A;  3VRA B;  4CHK A;  5D7G A;  1JML A;  2W9N A;  1E7V A;  3KYC D;  2JWZ A;  1NYQ A;  1WH3 A;  4XWW A;  3ZDT A;  3QHT A;  4M0W B;  1EU3 A;  3R3M A;  1N6Z A;  2JZZ A;  3N30 A;  4KIK B;  3DWM A;  2Y5P A;  1QOG A;  2W3R A;  4ICV A;  2BYT A;  4BZA A;  1FCL A;  1VR9 A;  1JW9 D;  3IT4 B;  1IGD A;  4II2 B;  3SR6 A;  1TZ1 A;  2RDH A;  3DHH C;  4KDI C;  2EEL A;  2INN E;  1HEZ E;  1OEY J;  2R2Q A;  3C0R B;  1LO5 D;  1UNS A;  4IWO A;  5FKA C;  3U8Z A;  4DXG A;  2V3N A;  2V4I B;  1J19 A;  4CYE A;  1C4A A;  3P4P B;  1E5W A;  4MJS B;  2J0K A;  3IBE A;  3ML8 A;  2WXR A;  1ZXH A;  2J0M A;  3WAL A;  1Y56 A;  1WSP A;  1XT9 B;  4ZYN A;  3NVY A;  3TSS A;  1I4R A;  4RCO A;  1ET9 A;  4MH8 A;  2FUG 1;  1E6E B;  1KJT A;  1UD7 A;  5EE3 A;  3PZ8 A;  3KUC B;  1IBX A;  1WR1 A;  1ISN A;  5FK9 C;  3P63 A;  2MBH A;  3ECI A;  1C4C A;  2QIL A;  5DCN A;  1WXM A;  2ZNV B;  3TL5 A;  2L05 A;  2JX5 A;  4DQO C;  2MW5 A;  1TTN A;  1ZP0 B;  1C1Y B;  1UGM A;  2JU6 X;  1RYJ A;  2D10 A;  2KLC A;  4W9I A;  2C9W B;  2K9X A;  3MHS D;  3P4S B;  3R8B A;  4OW0 A;  1CK1 A;  4HRO A;  2DYM A;  2Q5W D;  2N7E A;  4WH4 A;  3IFW B;  1IYF A;  1D4B A;  3A9K B;  4KKJ A;  2LXA A;  1SJH D;  1F52 A;  1DOI A;  3W1Y A;  4US9 A;  3ZO5 B;  4WWO A;  1S1Q B;  1DYQ A;  2Y5C A;  2ZVO A;  1EF1 A;  1HZ6 A;  1E8X A;  3KLS X;  1ZUD 2;  2H88 B;  1GAQ B;  2XNA C;  4FLH A;  1M4V A;  3JW0 X;  4II3 B;  4PS8 A;  4MGI E;  3V6C B;  4PYZ A;  4ZRJ A;  1IGC A;  1L6V A;  1JWB D;  4IM3 A;  2KFK B;  2NTS A;  4YSZ B;  1WM2 A;  4RM9 A;  3C19 A;  3VVW B;  4G50 A;  1FXI A;  2B3A A;  2KWD A;  2YEP B;  3A9J A;  4BFR A;  2IGH A;  4BAX A;  1D6E C;  2V9H A;  1BXT A;  4JL9 A;  3BIN A;  2KN5 A;  1L4Z B;  1L5P A;  2JYE A;  3IHP C;  4K1R B;  3SHQ A;  4GMV A;  4P16 A;  2ON8 A;  2GLS A;  2C7H A;  2HDE A;  2C5L C;  2BKF A;  1YIW A;  1TT5 B;  1FRD A;  3PRZ A;  2BBC A;  2LXC A;  3VRB B;  3TJP A;  1QKZ A;  2PLP A;  4WWM A;  1QLB B;  3DBR B;  2L7R A;  2OJR A;  3H1U A;  3RNA C;  2D3B A;  2GBK A;  1CZP A;  3HVD A;  4RMA A;  1WWT A;  2WQY B;  2MBE A;  2QDF A;  3KUD B;  3WIM A;  2K0P A;  4M0W A;  4KIK A;  1ZW7 A;  5E6N A;  2IO1 B;  2OED A;  5D2M B;  1KLV A;  5IA7 A;  2DZM A;  2K8C A;  3I57 A;  3U7D A;  3CST A;  1NYR A;  4JX1 C; 
#chains in the Genus database with same CATH homology
 2FUH B;  2NVU I;  1V86 A;  3VTU A;  4EZK A;  2MSE D;  2K39 A;  1PQS A;  5HKH A;  2BYE A;  2REX A;  4BOZ B;  4DDG D;  1WF9 A;  4BKS A;  2N9X A;  3H7P B;  3R66 C;  3KYD D;  4WJP A;  2ZPN A;  5JZE B;  2K25 A;  3ZRF A;  2JRI B;  4I6L B;  1WJN A;  2KAN A;  3PLV A;  1V5O A;  2LAS A;  4AP4 C;  2N9E B;  4GGQ A;  4B6W A;  3R7Q A;  4W9L A;  4DHZ B;  5LXI B;  2LGD A;  3HIZ A;  2CHZ A;  4TQ1 A;  2KWV B;  3DCG A;  4X57 B;  5G55 A;  3S2A A;  2GOW A;  3GZN I;  3X23 A;  4HXD A;  1GJZ A;  2BKR B;  2WX1 A;  5DPW A;  2BF8 B;  2N7D A;  2Y5B B;  5DPS A;  4BBN F;  3PRE A;  1OTR B;  4CO7 A;  3T9L A;  2HE7 A;  1E8Y A;  3KW5 B;  3L16 A;  4NAW A;  1X1M A;  2LUE A;  4HJK A;  4JGH B;  1WZ0 A;  3H7S A;  1EF5 A;  2G4D B;  3ZKJ C;  2HJ8 A;  4I6N B;  1WI0 A;  3DVN U;  1IPG A;  1SE9 A;  1V5T A;  2MP2 B;  4ICU A;  3UF8 A;  3AXC A;  2EKE C;  1GNU A;  2FNJ B;  3EEC A;  3KVF B;  1LQB A;  4GSW A;  3SDL C;  1WM3 A;  4ASW C;  1I35 A;  5L95 C;  3AUL A;  3DVG X;  4ANV A;  3NY5 A;  3QA8 A;  2M17 A;  5BO4 B;  3Q3J A;  4G11 A;  4AJY B;  3RUI B;  2FCQ A;  3DVN V;  2NPT A;  1V49 A;  1RAX A;  1L7Y A;  5KHQ A;  4IM2 A;  3VUY A;  2MBO A;  2YVC A;  1Q5W B;  3M62 B;  4NQK E;  4NY0 A;  2I1J A;  3VFK A;  3W1S A;  4MGZ E;  1YX5 B;  3QAR A;  4WWN A;  4F8C B;  2KC2 A;  4LJO B;  4FA6 A;  1SGH A;  4W9D A;  4HPL B;  3JYU A;  2O2V A;  3P2B A;  3WAM A;  2NBW B;  2XK5 B;  2LZ6 A;  5E6P A;  4M8M A;  4W9F A;  3QIJ A;  1A5R A;  2AL6 A;  4TV3 A;  2CU1 A;  3PSE B;  2MBQ A;  2O6V D;  2LI5 A;  4W9E A;  4YL8 A;  2KX3 A;  2M0X A;  1WGG A;  4HLE A;  3DBL I;  4MEL A;  2JPH A;  4LDT B;  5CHV C;  5CHW A;  2N9P C;  1WX8 A;  4WJQ A;  1F9J A;  2KD0 A;  3NHE B;  4DHJ D;  3V6E B;  2G3Q B;  3ZUN A;  2IYD B;  4BKT A;  4ANU A;  3DPD A;  1WXV A;  3ZTC A;  2KQ7 A;  4FAD A;  2DAJ A;  2JY6 A;  1OQY A;  1GUA B;  1LM8 B;  4TUU A;  3MTN B;  4ZRK A;  3HK0 A;  2RD0 A;  3QJZ A;  3VAW A;  4FHJ A;  3PHX B;  1WJ4 A;  3RYT A;  3QQ8 B;  3VUW A;  1WMH B;  4DWF A;  2ZCB A;  3VHT C;  4W9K A;  3WAN A;  2KQS A;  4GXB A;  3NOB A;  4GU2 A;  4F1S A;  2IO2 B;  3PTF C;  1WX9 A;  4AWJ A;  2PJH A;  5C1Z A;  3EFU A;  1WGD A;  2KDF B;  5AEK B;  4G3X B;  4WAA A;  3ML9 A;  4P7I A;  2ZVN A;  4A3O A;  2MQJ A;  2V4L A;  4XZ4 A;  1P1A A;  2ZEQ A;  4KSK C;  3I3T B;  3HM6 X;  1UZX B;  2KHW B;  2KMC A;  4EKU A;  1WGY A;  2KFK A;  2K1F A;  4GDK B;  2D11 A;  3TMP B;  3VXW A;  1YQB A;  3L08 A;  2V3S A;  1NDD A;  3PHW B;  2A4Z A;  3O65 B;  3PLU A;  3ZDM C;  4BBN C;  4DXA B;  3PZD A;  4TQ0 A;  4EFO A;  3AI5 A;  4WJO A;  2K8H A;  2LGY A;  3UGB B;  4W9C A;  3DBH I;  3QX1 A;  5DPR A;  4BKS D;  3UQB A;  4KZC A;  3HM3 A;  1UH6 A;  3DDC B;  2BPS A;  4K7W A;  4BVU C;  4HWI B;  2C7M B;  3M63 B;  3N32 A;  4XC2 A;  3DBS A;  3A4R A;  2WWZ A;  4JQW C;  3ZW3 A;  5JHA A;  2FCM A;  3ENE A;  3R7R A;  2WYQ A;  3QC8 B;  3APF A;  2NS5 A;  2MA9 B;  4RM8 A;  3OJ3 A;  4EZJ A;  2RSU A;  3K9O B;  1WX7 A;  4MEM A;  4K7U A;  2HD5 B;  2KJH B;  1VD2 A;  2L76 A;  3JSV A;  2JRH A;  3TIX A;  1TBE A;  2ZNV C;  3VH3 B;  3W1S C;  2C60 A;  2KK8 A;  2CHW A;  1NBF C;  2LWP A;  1UBI A;  3APD A;  1H8C A;  4TKN A;  3M95 A;  3ZNI D;  1WMH A;  4WJN A;  4DDI D;  2DYB A;  3RD2 A;  2BWE S;  2N1W A;  3SU8 X;  4PS7 A;  3RUL A;  3ZLZ A;  2KKC A;  2AYO B;  3ZIM A;  5CX3 A;  2NBV B;  1WGH A;  3PGE A;  1Z5S B;  2Z59 B;  2KDB A;  2GBN A;  1WFY A;  4PS3 A;  3A1Q A;  3SD5 A;  1K8R B;  1T0Y A;  4NJ6 A;  4WQO B;  3UIP B;  3ALB A;  1ZGU B;  4W9H A;  1E8W A;  3APC A;  1Q0W B;  1YX6 B;  4GDK A;  3UIN B;  4MSM B;  3DOW A;  1P98 A;  3PS6 A;  1E8Z A;  3OAW A;  3KUZ A;  2KC1 A;  3A9J B;  3B08 A;  3QAQ A;  2DHZ A;  2K8B A;  3CMM B;  4ANX A;  2IY0 B;  3EC8 A;  4GDL B;  4FBJ B;  1LFD A;  2J7Q B;  3RCZ A;  2IZV B;  3V62 A;  1WIA A;  1JRU A;  2PE6 B;  3WAO A;  1R4N I;  2UYZ B;  4A20 A;  1SIF A;  1Q1O A;  3L54 A;  2KTR A;  1NI2 A;  2DEN B;  2RGF A;  2MLB A;  5AZG A;  4DBG A;  4IM0 A;  5L83 A;  2CS4 A;  2PEA A;  1WXS A;  2KWU B;  2BGF A;  4MH0 E;  2UWQ A;  5AZF A;  2L0T A;  2KXJ A;  1AAR A;  1U4A A;  3GOE A;  2KWC A;  2KOX A;  3PV1 A;  5LLI A;  2CKH B;  3NS8 A;  2O6V B;  1E90 A;  4HK2 A;  4GIV A;  1I42 A;  2AEH A;  3CF6 E;  2V1Y A;  5G2N A;  1RLF A;  4K81 A;  3H7P A;  1V2Y A;  4MSQ B;  2BYV E;  2MX2 A;  4IC7 B;  4DHJ B;  2QHO A;  3BY4 B;  2LVP A;  4HCP B;  1GC6 A;  1UBQ A;  1WGR A;  2BYF A;  2Z0D B;  3ZNH B;  3RZW C;  3ZNZ B;  3DQV A;  5J18 A;  2DAF A;  4CHK A;  4FJV B;  3WAP A;  2FID A;  2WX0 A;  4E3C A;  3Q3F A;  3ZVV A;  5D7G A;  2D2Q A;  5C23 A;  5CHF A;  2W9N A;  1E7V A;  2IO0 B;  2JWZ A;  3KYC D;  1OEY A;  4DHZ E;  2FCS A;  1WH3 A;  2D3G A;  5D6J B;  1WYW B;  3ZDT A;  3QHT A;  1V80 A;  4M0W B;  2J0J A;  3R3M A;  2JZZ A;  3N30 A;  4KIK B;  5D94 A;  2K6D B;  2KJ6 A;  4ICV A;  3D32 A;  4K7S A;  4NJ7 A;  4II2 B;  2MP2 A;  1TZ1 A;  3NZS A;  4E74 A;  1GG3 A;  3JVZ X;  4ZDV A;  2N4F A;  2FCN A;  3VDZ A;  4MDK E;  3B0A A;  4HDO A;  2ASQ A;  4KDI C;  3VH4 B;  3ZNG C;  1XD3 B;  2M8S A;  2N1V A;  1OEY J;  1P3Q U;  2R2Q A;  3L17 A;  3MJW A;  3C0R B;  4KSL C;  4IWO A;  2DZK A;  2EMT A;  3U8Z A;  3PRP B;  2KNB A;  3VQI A;  1HE8 A;  3A33 B;  4NPN A;  3ZTD A;  2KZR A;  1WE7 A;  3CSF A;  2GBR A;  1G6J A;  3OLM D;  2NCN A;  5JHB A;  3EHV A;  2XK5 A;  4FJY A;  2KFJ A;  1J19 A;  4CYE A;  1WZ3 A;  3IVF A;  2D07 B;  2DZJ A;  1E5W A;  2LVQ A;  4MJS B;  2J0K A;  1EUV B;  3IBE A;  2JUO A;  3ML8 A;  2JT4 B;  1WE6 A;  2ZPY A;  5J17 A;  1KM7 A;  2FIF A;  2J0M A;  1WR6 E;  1ZKH A;  3WAL A;  2KLG A;  5TR5 A;  5GMV A;  1V6E A;  4FHK A;  1XT9 B;  4EEW A;  3VTW A;  2XBB C;  4ZYN A;  1TGZ B;  4EUT A;  1E7U A;  4NAW B;  3H9D A;  4JIO U;  2PPH A;  4JLC A;  2JVC A;  4GN1 A;  2MRP A;  1KJT A;  1UD7 A;  1WRD B;  3VTV A;  2OOB B;  3KUC B;  1WR1 A;  1ISN A;  2RPQ A;  4MM3 A;  4PYU A;  2NPT B;  2MBH A;  5KHO A;  4GOC A;  3ECI A;  4B95 A;  1RRB A;  5DCN A;  2XEW A;  2IY1 B;  3U30 A;  1WXM A;  2ZJD A;  2NBU A;  3UQA A;  2ZNV B;  3VUX A;  3TL5 A;  2L05 A;  2R2O A;  1S3S G;  1TTN A;  2MW5 A;  4FJZ A;  4LCD E;  1WJ6 A;  3RT3 B;  1C1Y B;  1UGM A;  4W9G A;  2D10 A;  2O2V B;  1EO6 A;  2KLC A;  1J8C A;  2C7N B;  2KX0 A;  2LRU A;  4J6I A;  1MG8 A;  4W9I A;  4HDQ A;  2C9W B;  3KH0 A;  3MHS D;  3LJ3 A;  4HPM B;  1UEL A;  4ZRI A;  1OGW A;  2ZZP B;  1WXA A;  3ZRC A;  2DYM A;  4KZ0 A;  4MJS A;  4AUQ C;  2G4S A;  2N7E A;  3QCA A;  3QK0 A;  3IFW B;  1M94 A;  2LD9 A;  1IYF A;  2CR5 A;  3A9K B;  4HCN B;  4MGK E;  5JH5 C;  2MWS B;  3NZU A;  3OJ4 B;  2DZI A;  1YJ1 A;  3L10 B;  2LXA A;  3V61 A;  2JF5 A;  4HVB A;  1J0G A;  3W1Y A;  1LXD A;  3TBL D;  1VCB A;  2CHX A;  2GBM A;  1BT0 A;  3ZO5 B;  3PPA A;  4FN2 A;  4WWO A;  4IW0 A;  1S1Q B;  2ZVO A;  5E6O A;  4EOY A;  2KDI A;  4F7Z A;  2YLM A;  2K6Q A;  3A4S C;  1EF1 A;  2HTH A;  1E8X A;  4LJP B;  4ANW A;  3PT2 B;  3H6N A;  4FLH A;  4GB9 A;  5LXH A;  3JW0 X;  4II3 B;  4PS8 A;  2L00 B;  4MGI E;  4WWP A;  3IG3 A;  3V6C B;  4PYZ A;  4BOS C;  4E71 A;  2G45 B;  3T8M A;  4ZRJ A;  1IP9 A;  4IM3 A;  1C3T A;  2KFK B;  4IUM B;  4AOF A;  2AWT A;  4OVV A;  2FAZ A;  1WM2 A;  1QZE A;  4IG7 B;  4RM9 A;  3VVW B;  4G50 A;  4EZL A;  3LDZ E;  3UIO B;  2B3A A;  2IO3 B;  2Z0E B;  5AZH A;  2LGX A;  2KO3 A;  5EDS A;  3A9J A;  5IAA C;  4BFR A;  2ZCC A;  4KV2 A;  2LRW A;  4MGY E;  4GDL A;  2MCN B;  3X0W A;  2NR2 A;  1GC7 A;  4OVU A;  1R4M I;  1WY8 A;  4N9F 4;  4NQL B;  4JL9 A;  1KOT A;  3BIN A;  2GBJ A;  5CTR C;  2KN5 A;  2JXX A;  1CMX B;  2EMS A;  3A9K A;  3AU5 A;  3JSV B;  2DYO A;  3IHP C;  3PVL A;  2KTF A;  4K1R B;  2JZ3 B;  1P9D U;  5DPT A;  1RFA A;  4LDT D;  4KDL B;  3SHQ A;  4GMV A;  1WJU A;  2PE9 A;  1Y8R C;  2LJ5 A;  4A3P A;  4XX5 A;  3RZF A;  2KDE B;  2O6V A;  2C7H A;  2C5L C;  2BKF A;  1YIW A;  3DBR I;  2L8J A;  3PRZ A;  5J2R A;  1L2N A;  4I6P A;  2LXC A;  2L3Z A;  4NNJ B;  3TJP A;  3M3J A;  2A5U A;  1D3Z A;  3ONS A;  2BWF A;  3HHM A;  1XQQ A;  1H4R A;  3A1Q B;  1V9J A;  4BKG A;  2L7R A;  1P0R A;  2OJR A;  3H1U A;  3L0W B;  3B1L X;  4KVG B;  3WA0 A;  2AL3 A;  2M4N A;  2M1M A;  3TCA A;  2WDT B;  2I1K A;  3N3K B;  2GBK A;  2VRR B;  4URK A;  1YD8 U;  2MBB B;  4RMA A;  5FR6 A;  4G0N B;  4IWP A;  4AJW A;  2KMA A;  3DVG Y;  2GMI C;  3K9P B;  2MBE A;  3WIM A;  3KUD B;  4DK5 A;  1Z2M A;  4KIK A;  2LVO A;  4M8N A;  1V81 A;  1ZW7 A;  3L13 A;  2IO1 B;  2KVR A;  5E6N A;  4B9K A;  1FXT B;  5D2M B;  3AU4 A;  1KLV A;  2KTR B;  5IA7 A;  3PRM B;  4IWQ A;  2DZM A;  2IBI B;  2K8C A;  3V60 A;  3U7D A;  2DX5 B;  4W9J A;  3CST A;  3QWZ B;  2RR9 A;  2L0F A;  2KJR A;  4FUL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...