3ZLZA

Lys6-linked tri-ubiquitin
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
73
structure length
73
Chain Sequence
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGRQLEDGRTLSDYNIQKESTLHLVLRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUITIN
publication title Assembly, Analysis and Architecture of Atypical Ubiquitin Chains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 18
structure length 73
sequence length 73
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3zlzA00
5D7GA 3PRZA 1S3SG 2A5UA 2NR2A 2IY1B 2G4DB 2KZRA 2AEHA 4EZLA 3DBLI 1GUAB 2VRRB 3SU8X 4HJKA 2DYBA 3PLVA 1VCBA 1L2NA 1GG3A 1YJ1A 2GBNA 2N9PC 2ZNVB 4F8CB 1TGZB 2LI5A 3UQAA 2YVCA 3HM3A 4W9JA 3T8MA 5E6NA 3A4SC 1KM7A 2MBHA 4GIVA 2A4ZA 4HDQA 2KHWB 1V9JA 3IVFA 2UYZB 2AWTA 4BKSA 2MBEA 2XEWA 3V62A 1L7YA 1GJZA 1RLFA 2M8SA 3X23A 3V6EB 2HD5B 4WWNA 3WIMA 5LXIB 4KV2A 2LD9A 4IUMB 4FBJB 3VVWB 1WX9A 2C5LC 2IZVB 2KTRB 4MGIE 4MH0E 3UF8A 2DAJA 2R2QA 4KSKC 1WGDA 3PPAA 4GDLB 3ZO5B 4HCPB 4WJNA 3PGEA 2C7HA 2RPQA 3K9OB 1XD3B 2NBUA 3QWZB 3R3MA 2MP2A 4RM8A 2EKEC 2UWQA 2WX0A 1WYWB 2RR9A 1V5OA 2FCQA 3M95A 4PS3A 2L7RA 3ZNZB 3RCZA 2MBQA 2Z0DB 2KWVB 2L3ZA 4FLHA 4G0NB 4GDKA 1WX7A 2JZZA 4W9LA 2M0XA 4MEMA 5E6OA 5DPTA 3RT3B 2C7NB 2J7QB 5AZGA 2CU1A 3ZRCA 4PS8A 2DX5B 3DVNV 2DZJA 4BKTA 1QZEA 4ICVA 3QJZA 2K6QA 5JZEB 3CSTA 4FHJA 4W9DA 4KIKB 4IWQA 4II3B 5FR6A 2K8CA 1OGWA 2WYQA 2KXJA 2NCNA 3W1YA 2N1VA 3QA8A 2MCNB 4HDOA 4A3PA 1P9DU 4ASWC 3VHTC 1P0RA 5IAAC 4K7UA 2LGXA 3VTVA 2JPHA 3AXCA 1E8YA 4JLCA 4BOSC 3B1LX 4EUTA 4K81A 3A9KA 5D6JB 5JHAA 3EHVA 3ZDMC 4ANUA 3RD2A 1R4MI 1Y8RC 2ZZPB 5CHVC 4FA6A 4KVGB 4ZYNA 2N1WA 2N4FA 4NY0A 3B0AA 4JQWC 1V6EA 1WGGA 3C0RB 1Q0WB 2V3SA 3LJ3A 1OEYJ 4FJYA 3UINB 3GZNI 1H4RA 1Z5SB 3PT2B 1NBFC 1IP9A 4K7SA 2O6VA 4TUUA 3PSEB 3VQIA 2PPHA 3L0WB 4DK5A 1WRDB 4BKGA 2V4LA 3ML8A 4X57B 2M17A 1J0GA 4DHZE 4NJ7A 4XC2A 1YX6B 2ASQA 3QK0A 2FCMA 4NQLB 5CHWA 2XK5B 3APDA 4CYEA 1EUVB 1WH3A 4G11A 2IO0B 4AUQC 2L0TA 3VTUA 2N9XA 4M8NA 4RM9A 2LVPA 4GDLA 1WXSA 1E7UA 3ZTDA 3KW5B 2LRWA 4NJ6A 4GU2A 2DAFA 5LLIA 2KDEB 2LRUA 3H6NA 4NNJB 2NBWB 2D10A 1WFYA 2L76A 4W9HA 3VFKA 5LXHA 3H7PB 5C23A 3Q3FA 3AI5A 1GC7A 5L95C 3DVNU 3PZDA 1WI0A 1XQQA 4LJOB 3CSFA 1WM2A 4TQ1A 2N7EA 4ZRKA 4EKUA 2BYVE 3PRMB 3EECA 4IM3A 1VD2A 2NS5A 2AYOB 2MA9B 3WAMA 1WJUA 4ANWA 2QHOA 3T9LA 1F9JA 3JYUA 3OLMD 4W9KA 2O6VB 3MJWA 3ENEA 4XZ4A 4KIKA 3N30A 3VH4B 3DBSA 2Y5BB 3ZUNA 4IM0A 1IPGA 3LDZE 4TV3A 2EMTA 3NY5A 2HJ8A 2JWZA 4K7WA 5KHQA 1YIWA 3ECIA 3WALA 3DCGA 3OJ4B 4AOFA 1WZ3A 1TZ1A 2YLMA 5C1ZA 4PS7A 4OVUA 3AULA 3L10B 1LXDA 3R7QA 3UQBA 1WF9A 2RD0A 3WAOA 1A5RA 4E71A 2FCSA 2PJHA 3QC8B 4KZ0A 3QARA 4FJZA 2G4SA 4LJPB 4IWOA 5J18A 4XX5A 2K39A 2BGFA 1OEYA 5CX3A 2AL6A 2ZEQA 4FJVB 4I6NB 4BOZB 2KFKB 4IWPA 3APFA 4TQ0A 2FUHB 3HIZA 4WAAA 2C7MB 4MDKE 1XT9B 2KLGA 2N7DA 1RRBA 3VAWA 4PYUA 2CS4A 3IG3A 2GBRA 2CHXA 2LUEA 3N3KB 3QHTA 3RYTA 4AJWA 4DWFA 1ZGUB 1WGYA 3ZTCA 3MHSD 3VDZA 1V86A 1KOTA 2KDBA 3AU4A 3SDLC 2BYEA 1SGHA 3HHMA 4KDIC 4PYZA 5CTRC 3L54A 1ISNA 2MBOA 4IC7B 2BWFA 1U4AA 2KOXA 4DHJD 2BWES 2GBMA 4KZCA 1E5WA 2IBIB 1UD7A 3ZVVA 2V1YA 3ZKJC 3V61A 4B95A 3KVFB 3UIOB 5G55A 4BFRA 4FN2A 2FCNA 2XK5A 3DOWA 5D94A 3R7RA 4A20A 2LZ6A 2CKHB 3V60A 1IYFA 3EFUA 4II2B 1YX5B 2D2QA 3RUIB 4CHKA 1S1QB 3QCAA 3L13A 3DPDA 3PLUA 1MG8A 3IHPC 3PRPB 3ONSA 4JL9A 1I42A 2L00B 1UH6A 3ZW3A 1CMXB 4DHJB 4DHZB 4LDTD 2KFJA 3WANA 2RSUA 1UBIA 2MX2A 2KC1A 2MSED 3H7PA 2MQJA 4WJOA 3L17A 5KHOA 3U30A 3H9DA 4GN1A 5AZHA 2JF5A 2KVRA 4EZJA 4I6PA 3W1SA 1AARA 1V2YA 2KX0A 3VUYA 2REXA 3N32A 4M0WB 4ZRIA 1J8CA 4I6LB 4LDTB 4NAWB 4W9CA 2MBBB 2N9EB 2ZNVC 1LFDA 3KH0A 2JRHA 4YL8A 3A33B 2M1MA 2CR5A 4DDID 1UGMA 4NPNA 2DHZA 2PE6B 3QIJA 1WMHB 4OVVA 4ANVA 1LQBA 3ZNGC 1D3ZA 2BPSA 2M4NA 2W9NA 1JRUA 3P2BA 3QQ8B 4MM3A 4EEWA 2LWPA 3V6CB 1J19A 1ZKHA 1WE6A 2NBVB 3KYCD 3RULA 4URKA 1H8CA 2C9WB 3M63B 3KUZA 2KX3A 2LVOA 1HE8A 3CMMB 1WY8A 4FULA 1Q1OA 1OQYA 1WJ4A 2KJHB 2IYDB 4WQOB 5HKHA 2G45B 2KJRA 2RGFA 3DDCB 3IBEA 4IG7B 5G2NA 2LXCA 3APCA 3PS6A 4GOCA 3DBHI 4WJPA 2KFKA 2MLBA 4J6IA 4IW0A 1P1AA 4EFOA 3IFWB 1P98A 1E7VA 2I1JA 3DQVA 3QAQA 5DCNA 4AJYB 2C60A 4MJSB 5L83A 2CHZA 4BBNF 4CO7A 2FAZA 1WX8A 3SD5A 2LVQA 2WDTB 4DBGA 4E74A 2Z59B 2FIDA 3DVGY 4TKNA 2IY0B 2J0JA 2BKFA 1EO6A 2KN5A 3PREA 3S2AA 4KDLB 2I1KA 1R4NI 2LXAA 3UIPB 4B6WA 1I35A 3ALBA 2ZPNA 4EOYA 4GXBA 2JRIB 2NPTB 4E3CA 3RZWC 1YQBA 3B08A 3SHQA 2DZMA 5DPSA 4MGKE 1V80A 2JT4B 3M3JA 2KLCA 1C1YB 1YD8U 4F7ZA 4P7IA 1SE9A 1TBEA 2K6DB 1GC6A 1K8RB 2B3AA 1WXAA 2G3QB 3NS8A 4M8MA 3K9PB 1UELA 1NDDA 2LGYA 3A9JB 3TBLD 3A1QB 2L0FA 1WJNA 4K1RB 4ANXA 4JGHB 2KJ6A 4HXDA 3BY4B 1GNUA 3JSVA 4GMVA 3JVZX 2KMAA 2XBBC 3VXWA 3M62B 3HK0A 2Z0EB 5DPRA 1LM8B 2L8JA 3JW0X 4A3OA 2KKCA 1WZ0A 4ZRJA 3L16A 2LASA 5D2MB 3U8ZA 4W9GA 2O2VB 1FXTB 3D32A 3O65B 3ZNID 1NI2A 2BKRB 2K8HA 3ZDTA 3ZNHB 5AZFA 3NZSA 5J17A 1WXVA 2IO2B 4HCNB 1T0YA 4NAWA 4W9EA 1E8WA 3OJ3A 1WM3A 2GOWA 2NVUI 2KK8A 2LGDA 3WA0A 4AP4C 5E6PA 1WR1A 1WMHA 4B9KA 4BKSD 4MSQB 5JH5C 3EC8A 2JUOA 2AL3A 4HPMB 4FHKA 1WXMA 5TR5A 1WR6E 2KMCA 4HPLB 2DZKA 3A4RA 2KTFA 3ML9A 3ZRFA 3VUWA 2GBKA 4HWIB 2HTHA 2JVCA 3DVGX 5DPWA 4MELA 3PV1A 5CHFA 4WJQA 2BF8B 3TCAA 4HVBA 2D3GA 3RZFA 1TTNA 4IM2A 1OTRB 1EF5A 3JSVB 4DXAB 2PE9A 2KQ7A 2JY6A 3MTNB 1V81A 2HE7A 4N9F4 3TMPB 3X0WA 4ICUA 5J2RA 3KUCB 2CHWA 2MW5A 2BYFA 3TIXA 4F1SA 2J0KA 2ZJDA 1WJ6A 1Q5WB 3AU5A 4G3XB 1WGHA 3UGBB 2KANA 4MJSA 4MGYE 1G6JA 2ZPYA 1Z2MA 2KDIA 3CF6E 3W1SC 5JHBA 1RAXA 4JIOU 2DZIA 3I3TB 3TJPA 3NHEB 1SIFA 1M94A 2MP2B 2JXXA 4W9IA 4BVUC 1V5TA 3H1UA 2ZCBA 4W9FA 1PQSA 4GSWA 4MSMB 2ZVNA 3HM6X 2NPTA 2FNJB 3H7SA 2KD0A 4MGZE 2K8BA 2PEAA 3NOBA 1WE7A 3BINA 4GDKB 3QX1A 2KC2A 1V49A 2DYMA 4GB9A 4ZDVA 1E8XA 2KWCA 3NZUA 4EZKA 4LCDE 1BT0A 4AWJA 4WWOA 1C3TA 1UBQA 3DBRI 3PHXB 2K1FA 2KDFB 4WWPA 5BO4B 2KQSA 3A9JA 3OAWA 3A1QA 5AEKB 2LJ5A 4KSLC 1ZW7A 2FIFA 1WIAA 2KWUB 2ZCCA 3KUDB 1KLVA 2J0MA 2DYOA 2IO3B 1X1MA 3VH3B 3PVLA 4BBNC 2WX1A 1EF1A 3PTFC 3R66C 5GMVA 4DDGD 2GBJA 1E90A 1WGRA 2ZVOA 5EDSA 1P3QU 3PHWB 3ZIMA 4NQKE 2O2VA 2KTRA 2MWSB 3KYDD 2D07B 3Q3JA 4HK2A 4RMAA 2WWZA 2GMIC 3VTWA 3L08A 2OJRA 2R2OA 2K25A 3A9KB 3VUXA 3WAPA 3ZLZA 4HLEA 3TL5A 1RFAA 2L05A 5IA7A 1UZXB 2IO1B 1E8ZA 2O6VD 4G50A 4GGQA 3U7DA 4FADA 2KNBA 2OOBB 2EMSA 2DENB 1KJTA 2D11A 2MRPA 3GOEA 2KO3A 2JZ3B
chains in the Genus database with same CATH superfamily
1ZDXA 3PRZA 4M02A 4EZLA 2AEHA 3NG0A 3DBLI 1SEBD 1GG3A 2N9PC 4XDDA 4O1NA 1TGZB 2J53A 2LI5A 3UQAA 2YVCA 3T8MA 4W9JA 2A4ZA 4WURA 4YSYB 1ZUD2 2XEWA 1F2RC 3V6EB 3WIMA 5LXIB 4FBJB 3VVWB 2E6XA 1C79A 3PGEA 2C7HA 2RPQA 3K9OB 2K9XA 2EKEC 2UWQA 1WYWB 3RI7C 4DQOC 4PS3A 3ZNZB 2Z0DB 4FLHA 4G0NB 4W9LA 5DPTA 1N61A 1P7FA 5AZGA 2VH1A 3ZRCA 1I4RA 3DVNV 3Q8FA 4BKTA 4ICVA 4H2AA 5JZEB 2K0PA 3CSTA 1IUEA 2YEPB 4LNKA 2WYQA 3AE6B 1QKZA 3QA8A 3W1YA 2JYTA 1T0SC 5IAAC 2LGXA 2JPHA 3AXCA 4BOSC 4K81A 4P6VF 5JHAA 5E6JA 1YNTE 3ZDMC 1JQ4A 4WIPA 3NZ3A 2ZZPB 2WXIA 5CHVC 4FA6A 2N1WA 2G9HD 1C4AA 2RDHA 2W55A 2Y5PA 1NVID 2V3SA 3GB1A 3UINB 3GZNI 1B1ZA 1WYGA 4J3OD 1NBFC 1IP9A 4TUUA 3VQIA 1WRDB 2V4LA 2WU2B 3ML8A 2RDBC 2M17A 3ZGZA 2IGGA 3ZJUA 2V3NA 3QK0A 2XK5B 2WXLA 4G11A 2IO0B 2D3CA 3FILA 2L0TA 3MP9A 3VTUA 4RM9A 2EKIA 2LVPA 1WXSA 2WDVB 3N9YC 2QEJC 2QJLA 4NNJB 3AB5A 5C2TB 3VFKA 5LXHA 2R61A 4REZA 3CWIA 1FIQA 4LJOB 1MFWA 1WM2A 3EECA 5G5GA 1GB1A 2INNE 2CU3A 1WJUA 2W3SA 2W82A 2QHOA 3JYUA 1JW9D 1TS3A 1YN5A 1JWUD 4KIKA 1IPGA 2EMTA 1PFDA 1YIWA 1WZ3A 5C1ZA 4OVUA 3AULA 1A5RA 3WAOA 1I4QA 1HTOA 1FXIA 1L0VB 3QARA 2G4SA 1ZXIA 1OEYA 2Q5WD 4BOZB 2KFKB 1V1PB 4WAAA 3W9CB 3T3NA 1BMLC 4ACFA 1GPXA 1SE2A 3RYTA 1CK1A 4DWFA 1DGJA 2WP9B 2BQQA 2SAKA 3AECB 3SDLC 3L54A 1U4AA 1STEA 1Y56A 4KZCA 4XWTA 3ZVVA 2V1YA 4OZCA 3KVFB 4RF0A 3UIOB 4XWWA 4FN2A 3Q3NC 2CKHB 5D3IB 1YX5B 1S1QB 3L13A 3J9CA 1MG8A 3PRPB 4DHJB 4LDTD 2KFJA 3WANA 1UBIA 2MX2A 4WJOA 3UI3A 3L17A 1XCTL 1JALA 2JF5A 3SFEB 4ZRIA 1J8CA 4I6LB 4W9CA 1LFDA 3KH0A 2JRHA 1ZOYB 3GP7A 1VDVA 4DDID 3HVZA 1UGMA 1ZPSA 1QOBA 1T6BX 2LJIA 1D3ZA 3ZNGC 4B0MA 3V6CB 1WE6A 1SE3A 2C9WB 3KUZA 3CMMB 2LMCA 4FULA 1WJ4A 1MPEA 3V05A 4EE2A 2H88B 3FC4A 1KH0A 1T0QC 2MLBA 1P1AA 4IKGA 3IFWB 5BYRA 4C56C 1E7VA 3H8HA 1F52A 2M0AA 2I1JA 5DCNA 1UWXA 1FEHA 2V4IB 4DBGA 2NTSA 3DVGY 2IY0B 2J0JA 3S2AA 3PREA 4B0EA 3UIPB 3ALBA 1QLBB 4EOYA 2NPTB 3KLSX 4MGKE 2JT4B 2KLCA 3NS8A 4M01A 3K9PB 2X8XX 3DWGC 3A1QB 1L4ZB 2KJ6A 2MHJA 4RNAA 1LO5D 3BY4B 2KMAA 4RH6A 5DPRA 1LM8B 3DBRB 1UNSA 2KKCA 1C78A 2LASA 3U8ZA 1FXTB 2BW2A 2KT7A 3O65B 1NI2A 1VR9A 4M0WA 3ZDTA 5AZFA 1TY0A 1T0YA 1E8WA 1N5WA 2LGDA 4AP4C 1WR1A 1ZDVA 1ESFA 1QF6A 1FXAA 2SEBD 4HPMB 4FHKA 4HPLB 2DZKA 3ZRFA 2L1AA 4KX6B 4USAA 3Q3MC 3DBLB 2JWUA 2KQ7A 2GB1A 1V81A 1F77A 4BZAA 3OWEB 2ZJDA 1Q5WB 1WGHA 4MJSA 3MC9A 2KDIA 2MJ3A 3CF6E 3AEBB 2WXPA 1JWAD 1XO3A 2B76B 3BVMA 3AMZA 4WQMA 3IAS1 2K8BA 3NOBA 4ZDVA 1K53A 2HDEA 4LCDE 4ZRQA 1KFYB 3NS1A 4A55A 3PHXB 4QAYA 1C77A 2L52A 2KWUB 1KLVA 3VH3B 4DDGD 3R66C 1TY2A 1D5XC 1WGRA 2ZVOA 1P3QU 3ZIMA 2O2VA 2KTRA 2XNAC 4YXDB 1AWDA 1YQ4B 3R2TA 3VTWA 4HLEA 3WAPA 2QIEB 3TL5A 3GS2A 5IA7A 5IKCM 2IO1B 3NVVA 2PVOD 4FADA 4PT5A 2JZ3B 1TKEA 1I7HA 1S3SG 2JX5A 2NR2A 1F2RI 2IY1B 2KZRA 2PIAA 2KMMA 1GUAB 4HKQA 4JWSC 4HJKA 3PLVA 1P7EA 3E9SA 2MBHA 3AEEB 2LGIA 1L6UA 3V3XA 1PUTA 2UYZB 4BKSA 2ICIA 1PYWD 3V62A 1GJZA 2M8SA 3X23A 2LD9A 4IUMB 1WX9A 2C5LC 2IZVB 3VR9B 2KVZA 3FILB 4K3CA 4KSKC 1EU3A 1L0XB 3ZJVA 1AN8A 2BS4B 1XD3B 2NBUA 2BB5A 2MP2A 4RM8A 3ABVB 3WCQA 2WX0A 4ZHPA 1FM0D 1V5OA 1V8CA 2L7RA 2MBQA 3NUHB 4GDKA 2M0XA 4AS1A 2CU1A 3BVGA 3BK1A 1QZEA 1TS5A 1FNVA 2K6QA 2DLBA 2MH7A 4KIKB 1YN4A 1OGWA 2KXJA 4ARCA 2NCNA 4TMAB 1PGAA 2AQ2B 4A3PA 3VTVA 3B1LX 1EWCA 2MJDA 3N1ZC 2V0GA 4RGMA 5FR3A 3HRDD 2DBYA 3AEDB 1Y8RC 1CJEA 1HA5A 1MI0A 4NY0A 4JQWC 1V6EA 1WGGA 1YQ3B 3C0RB 4KGRA 1GB4A 1SIJA 3PT2B 3MJ5A 1FFVA 2IGHA 4P1CC 2O6VA 2PPHA 4DK5A 2RDGA 1C4PA 2MJEA 4X57B 4DHZE 1YX6B 2FCMA 3I63C 4LNFA 2D3BA 4M8NA 2WXMA 3ZTDA 1E10A 4NJ6A 5H92C 4CQNA 2LRUA 5BMGA 2NBWB 3RNGC 1XLPA 2L76A 4OHJA 1FCLA 2E3TA 1GC7A 3DVNU 1XQQA 5HHDG 3W5VB 4YTNB 3WAMA 2WXFA 4ANWA 3T9LA 3OLMD 3VR8B 4W9KA 2L83A 4XZ4A 4L1BA 3ZUNA 4IM0A 3N1YC 4HEA1 3RPFC 1TZ1A 4PS7A 3IT6B 3AEAB 2W54A 2WU5B 2RD0A 4E71A 2FCSA 4KZ0A 4FJZA 5J18A 2WXJA 4XX5A 5CX3A 2BGFA 2AL6A 4FJVB 1IBXA 4I6NB 4IWPA 3APFA 3HIZA 2KLGA 4PYUA 2LUEA 3QHTA 1XLQA 2JU6X 1WGYA 3VDZA 5BMIA 5BYQA 1YN3A 1KOTA 1SGHA 5CTRC 2BWFA 3P1MA 2KOXA 2GBMA 2IBIB 4B95A 3V61A 2MEKA 5G55A 1F0ZA 4YTPB 5IO9A 1OQRA 3DOWA 3I9V1 4A20A 2KQ4X 2HTME 1IYFA 1M4VA 2WXKA 4JL9A 3VRBB 2L00B 1UH6A 1CMXB 2JYEA 4XGAB 3H7PA 3U30A 1OFFA 2GI9A 1ET9A 5AZHA 3P4PB 2KVRA 4EZJA 1YMHE 3URYA 1V2YA 2KX0A 4M0WB 4WAFA 1RWSA 2GRIA 2CJNA 2INPE 3QIJA 2PE6B 1LQBA 2WXOA 1PGXA 4DXGA 2IJ0A 2KX3A 1JMLA 3TEZA 5HKHA 2G45B 2RGFA 4IG7B 4GOCA 2FBWB 1TT5B 2VH2A 3AE3B 4WJPA 4J6IA 1L6VA 1JCKB 2VZKB 4AJYB 2C60A 3AH7A 4MJSB 5L83A 1C4CA 1WX8A 3SD5A 2WDTB 2J52A 1XF5L 4RFBA 2I1KA 3U52E 3SHQA 5DPSA 1V80A 5D3DA 4F7ZA 1TBEA 2B3AA 1R4MB 1UELA 2LGYA 3Q8BA 4RGTA 4GLSC 3MC0B 4K1RB 1KLGD 4HXDA 1GNUA 3JSVA 2ACZB 2L32A 2XBBC 2AQ1B 3HK0A 2L8JA 4OW0A 3L16A 2O2VB 5T8IA 3LB8C 4ZHOA 1XEEA 1WXVA 4W9EA 4K3BA 1QILA 2NVUI 5MPOA 2KK8A 3PO0A 3WA0A 4IOIE 1WMHA 4US9A 1E7PB 4MSQB 4PK1A 3EC8A 2AL3A 1WR6E 3Q8AA 4HWIB 4C00A 3FKYA 2JVCA 4XYCA 3PV1A 5CHFA 3TCAA 4HVBA 3RZFA 3LYYA 1NENB 2JY6A 2HE7A 5J2RA 1D5MC 4ICUA 4HRSA 3AE8B 3KUCB 2CHWA 2BYFA 3TIXA 4F1SA 2J0KA 3AU5A 3I57A 4G3XB 4MGYE 3BK2A 1NYQA 3FAHA 2INCC 2N9LA 4JIOU 1HEZE 2DZIA 3I3TB 4YSXB 2MP2B 1TJEA 2JXXA 3W5UB 4LNIA 4MSMB 1DOIA 1UF0A 4HPPA 2PEAA 3LXFA 4GDKB 2DYMA 4GB9A 4IDIA 4AWJA 2V9HA 1SSNA 2KDFB 1FRRA 2DNFA 4LNOA 4KSLC 1ZW7A 2Y5CA 1D5ZC 3KUDB 2DYOA 1X1MA 4C4VA 1EF1A 2GBJA 3AE7B 1E90A 5EDSA 3Q8CA 3AE5B 3Q3JA 2PLPA 4RMAA 1XXGA 3RFZB 3VUXA 2Y3AA 4UDUC 4NJCA 3Q2AC 2L05A 1UZXB 1I4HA 4G50A 4GGQA 1CZPA 2EMSA 2N7JA 2D11A 3GOEA 3IT4B 2KO3A 2A5UA 5HI1A 3SU8X 1RFKA 4RGOS 2DYBA 3B2GA 2GBNA 4F8CB 3TEWA 3A4SC 1KM7A 2LGSA 4HDQA 3GE8C 3IVFA 1K51A 2ZW1A 4RF1A 1ACCA 2HD5B 4WWNA 4MGIE 2DAJA 1WGDA 3PPAA 1IGCA 3ZO5B 2OJWA 2KDMA 2FCQA 3RCZA 2L3ZA 1KF6B 1WX7A 2JZZA 2HJ1A 2PKOA 3RT3B 2J7QB 4HROA 2DZJA 4ITKA 3N1XC 3MFGA 1N62A 4II3B 2WXRA 2MCNB 3VRAB 3TSSA 4JLCA 3A9KA 3EHVA 3RD2A 1R4MI 1IBXB 1HTQA 5EE9A 4KVGB 2N4FA 1Q0WB 2WLBA 2Z8LA 1OEYJ 4DXFA 1Z5SB 2RMMA 1VJKA 4K7SA 3L0WB 3E56A 4BKGA 2KWDA 3W2DA 2JQRB 3MC8A 4NJ7A 1VZ6A 4XC2A 1YJIA 2WQYB 5CHWA 4AQ7A 3U4EG 3APDA 2WHIA 4CYEA 4AUQC 4GDLA 1E7UA 1KLUD 2KYWA 3KW5B 2LRWA 1ZP0B 4KGTA 5LLIA 2KDEB 3ZQ4A 4WWMA 3NRZA 2D10A 1WFYA 1T3QA 4W9HA 4RGNA 2WDRB 3H7PB 3Q3FA 1V1PA 1JWSD 3N20C 3PZDA 1WI0A 3DWMA 3CSFA 4TQ1A 3DHGC 2N7EA 4ZRKA 2BYVE 3PRMB 4IM3A 1VD2A 2JXTA 2QSDA 2MA9B 4A90A 3MJWA 3ENEA 3VH4B 3SR6A 4S17A 1WGKA 2JWZA 4K7WA 1J7BA 4LK0M 2ZW0A 3DCGA 4OZBA 5EE1A 3UQBA 3R7QA 3EUB2 1RM6C 2YEPF 3P42A 4LNNA 4IWOA 2K39A 4MDKE 1XT9B 2N7DA 2DWQA 2CS4A 3ZXRA 1D6EC 3IG3A 2GBRA 2CHXA 3PZ7A 1ZGUB 2OEDA 3ZTCA 5BMHA 3MHSD 3OG5A 1K52A 2BT6A 3ZXVA 1VZ7A 1SJED 2BYEA 2TSSA 4IC7B 4DHJD 2BWES 1C76A 5TSSA 5D94A 2LZ6A 3EFUA 4II2B 2D2QA 2IDYA 4CHKA 3DPDA 1WWTA 3IHPC 2FE8A 3ONSA 1AW7A 3Q6BA 2NMQA 4DHZB 2RSUA 2KC1A 3B9JA 4M00A 4D2KA 3H9DA 4GN1A 1A70A 1F1HA 4I6PA 1MVKA 2KN4A 1AARA 3DHHC 2REXA 3N32A 4LDTB 1I4XA 1QT9A 2ZNVC 3A33B 2CR5A 4A8XC 2PVGC 1WMHB 1JRUA 4MM3A 1N63A 2LWPA 4NZLB 1ZKHA 2NBVB 4JX1C 1E9MA 2M19A 4URKA 2W3RA 2BB6A 4MACA 1HE8A 1Q1OA 1OQYA 1SXTA 4N58A 2KJHB 2KJRA 2XN9C 3IBEA 1JRPA 4JE3B 4N6EB 3GE3C 1VLBA 4P1BC 4IW0A 4EFOA 5FKAC 2GLSA 3SFDB 3CIRB 3DQVA 2CHZA 2EELA 1WXQA 4BBNF 2FAZA 2LVQA 4E74A 2Z59B 2FIDA 4TKNA 2BKFA 3AE4B 2KN5A 2LXAA 5IN7A 4B6WA 4HJGE 4GXBA 2JRIB 3RZWC 2DZMA 3AE9B 5AUIA 1C1YB 1YD8U 1SE9A 1GC6A 1K8RB 4M8MA 1WXAA 3Q8EA 4C7YA 4JPSA 2L0FA 1WJNA 4ANXA 5LNK1 1GOZA 4GMVA 4C4VB 3P63A 3M62B 4A3OA 3JW0X 4WH4A 3D32A 2WXHA 2K8HA 3ZNHB 1I4PA 3NZSA 5J17A 4NAWA 2QC8A 4KKIA 1EU4A 2GOWA 5HG2A 5E6PA 4B9KA 3NVYA 5JH5C 2ONQA 2KMCA 2KTFA 3VUWA 2GBKA 3RN9C 2HTHA 5DPWA 2BF8B 3O13A 1TTNA 1OTRB 3RNCC 4DXAB 3MTNB 1J7AA 3X0WA 2QCZA 1J7CA 3IXSA 4ZYSA 3UGBB 2KANA 2ZPYA 5JHBA 1UWMA 3EFCA 3T3OA 1SIFA 3RNBC 1M94A 4W9IA 4BVUC 3H1UA 2ZCBA 2IPKD 3HM6X 2WDQB 4MGZE 3BINA 1VRAB 2KC2A 1V49A 4FXCA 2KWCA 4EZKA 4Q2JA 1UBQA 2K1FA 5BO4B 4WWPA 3A9JA 3R8BA 1CQVA 1GAQB 5AEKB 1WIAA 1XLOA 1B9RA 2ZCCA 1I4GA 2WX1A 1ET6A 4P16A 4RCOA 3R2IA 3PHWB 1SF0A 2H89B 4NQKE 2D5GA 3P4RB 4BAXA 4KGSA 1FNWA 2WWZA 5H8YE 1KTKA 3L08A 3A9KB 3ZLZA 2K25A 4LLGM 4XE0A 1Q10A 1RFAA 1PGBA 1K50A 2KNBA 2DENB 3AE1B 5D7GA 2G4DB 2N0SB 3Q14C 2VRRB 1VCBA 1L2NA 1YJ1A 2WXQA 2ZNVB 3ZJTA 3HM3A 5E6NA 1R7SA 4GIVA 2KHWB 1V9JA 2AWTA 2MBEA 1N6ZA 1L7YA 1PDXA 2I38A 1RLFA 3TUOA 2X38A 1FFUA 4KV2A 2G1EA 3RNEC 2KTRB 4MH0E 3BYYB 3UF8A 1MHHE 2R2QA 1V97A 4GDLB 2WXNA 4HCPB 4WJNA 3QWZB 3R3MA 1LGRA 4TSSA 2RR9A 3P4QB 3M95A 2KWVB 1MG4A 2LUMA 4MEMA 5E6OA 2C7NB 2I2YA 3U7ZA 3DBHB 4PS8A 2DX5B 3P4SB 3QJZA 3U2SC 4FHJA 4W9DA 1L0YB 4IWQA 1SB3C 5FR6A 2K8CA 2LHEA 2N1VA 3BWUD 4HDOA 1P9DU 4ASWC 3VHTC 1P0RA 4K7UA 5EE3A 1E8YA 4EUTA 3SEBA 5D6JB 1R4NB 4ZRPA 1BUIC 4US8A 4ANUA 4ZYNA 3B0AA 1QQRA 3LJ3A 4L2YA 1MJDA 4FJYA 1H4RA 3ETRA 4ZOHC 4ARIA 5BYSA 3PSEB 5C3JB 1T5XD 2WS3B 3AE2B 3EGRA 2J42A 3Q3OC 1T0RC 1J0GA 3RNAC 5HFYA 2ASQA 1TS2A 3MHZA 4NQLB 1RYJA 1EUVB 1WH3A 2V3PA 3HVDA 2N9XA 1QOFA 4C80A 1XCQL 4GU2A 2DAFA 1QOGA 3H6NA 5C23A 3AI5A 5L95C 2OHFA 4EKUA 1DOXA 2NS5A 2AYOB 3IAM1 4OVZA 1F9JA 2O6VB 4N59A 2PTLA 4JWUC 2JZPA 3N30A 3DBSA 2Y5BB 3LDZE 4TV3A 2FUG1 3NY5A 2HJ8A 3KWVA 5KHQA 4MT5A 3ECIA 4LTUA 3WALA 1HQRD 3OJ4B 4MM3B 4AOFA 2BYTA 2YLMA 2PW9A 1NI3A 3ZYYX 3L10B 3Q69A 1LXDA 5GXGB 1WF9A 4XDCA 1IGDA 1E0ZA 1L4DB 1E6EB 2PJHA 3RMKC 3QC8B 3RNFC 4LJPB 2ZEQA 2LEKA 1OQQA 1FO4A 4TQ0A 2QILA 2JSVX 2FUHB 2C7MB 1RRBA 1HXYD 1UGJA 3VAWA 5JXVA 3N3KB 2IGDA 1AYFA 1TKYA 4AJWA 1KRHA 1V86A 2AQ3B 2KDBA 3AU4A 4KDIC 3HHMA 4PYZA 2BTEA 5IOIA 1ISNA 2K3UA 2MBOA 3AN1A 1E5WA 1UD7A 3ZKJC 2D3AA 4BFRA 1SBBB 2FCNA 2XK5A 3R7RA 3V60A 3RUIB 3QCAA 1FNUA 3PLUA 2KAJA 1I42A 3HUIA 3ZW3A 2BS3B 2K22A 2MSED 2MQJA 5KHOA 3C8YA 3BVZA 1WRIA 1SJHD 3W1SA 3VUYA 2LFIA 2UU7A 2K5PA 4NAWB 2WGSA 2MBBB 2N9EB 3DHIC 4YL8A 1ROEA 2M1MA 5AUKA 3AEGB 4HKZE 4NPNA 2BVCA 2DHZA 4OVVA 4ANVA 1XLNA 4KKJA 2BPSA 2M4NA 2W9NA 3P2BA 1EWYC 3QQ8B 4L23A 4EEWA 3KWLA 1J19A 3B2FA 3KYCD 3L4PA 3RULA 5G5HA 1H8CA 3M63B 2LVOA 1WY8A 1HZ6A 2VZKD 4MH8A 2IYDB 2J4XA 4WQOB 2KACA 3DDCB 4R3DA 1TS4A 2LXCA 3APCA 3PS6A 5G2NA 1NEKB 3DBHI 2KFKA 5EE0A 1FD6A 3NJTA 1P98A 3QAQA 2RPVA 3I5JC 4CO7A 1N5XA 1ZXHA 1VZ8A 2WXGA 2WNMA 5I4DA 1EO6A 4KDLB 1R4NI 1I35A 2ZPNA 1BXTA 4E3CA 1YQBA 3B08A 3M3JA 4NAMA 4P7IA 2K6DB 4A6QA 2G3QB 1NDDA 3A9JB 3TBLD 4JGHB 5IP4D 4OZAA 3JVZX 3VXWA 3GZNB 2BS2B 2Z0EB 1TIFA 1WZ0A 4ZRJA 1QOAA 5D2MB 4W9GA 1YOVB 3ZNID 5FK9C 2BKRB 3KQ4A 2IO2B 4HCNB 2INDC 3OJ3A 1NYRA 1WM3A 1FRDA 2NTTA 2CJOA 4YTMB 4BKSD 2JUOA 1SE4A 1WXMA 5TR5A 4YWGG 3A4RA 3ML9A 2PMVA 4C7ZA 3DVGX 4YT0B 1UUPA 4MELA 4WJQA 3AV8A 2D3GA 4IM2A 1EF5A 3JSVB 3BZDB 2PE9A 1N60A 4N9F4 4S0RA 3TMPB 3BIID 2MW5A 2QMTA 3TEYA 1WJ6A 1YJJA 1TKGA 1G6JA 1Z2MA 3W1SC 2AX5A 1RAXA 3NVWA 3TJPA 1EM7A 3NHEB 1V5TA 3NVZA 4YSZB 4W9FA 1DOYA 1PQSA 4GSWA 2ZVNA 2NPTA 2FNJB 2M56B 1ZE3D 3H7SA 2KD0A 3BYTB 1WE7A 1ENFA 3QX1A 1E8XA 3NZUA 1BT0A 1FMAD 4WWOA 1C3TA 3DBRI 2KQSA 2QDFA 3OAWA 3A1QA 2LJ5A 1JWBD 2N9KA 2FIFA 1JWMD 3EA6A 2ON8A 2J0MA 2IO3B 3PVLA 4BBNC 3PTFC 5GMVA 1TZOA 1WSPA 1JROA 3AEFB 1DYQA 1L5PA 4A9AA 1C9FA 2LHDA 2BBCA 1FPYA 2MWSB 3KYDD 2D07B 3PZ8A 4HK2A 2GMIC 3C19A 2OJRA 2R2OA 3AM9A 3TEXA 1FCCC 1HZ5A 1V1OA 1MHXA 1D4BA 1E8ZA 1TYGB 2O6VD 3U7DA 2OOBB 1KJTA 2MRPA
chains in the Genus database with same CATH topology
5D7GA 3PRZA 1S3SG 2A5UA 2NR2A 2IY1B 2G4DB 2KZRA 2AEHA 4EZLA 3DBLI 1GUAB 2VRRB 3SU8X 4HJKA 2DYBA 3PLVA 1VCBA 1L2NA 1GG3A 1YJ1A 2GBNA 2N9PC 2ZNVB 4F8CB 1TGZB 2LI5A 3UQAA 2YVCA 3HM3A 4W9JA 3T8MA 5E6NA 3A4SC 1KM7A 2MBHA 4GIVA 2A4ZA 4HDQA 2KHWB 1V9JA 3IVFA 2UYZB 2AWTA 4BKSA 2MBEA 2XEWA 3V62A 1L7YA 1GJZA 1RLFA 2M8SA 3X23A 3V6EB 2HD5B 4WWNA 3WIMA 5LXIB 4KV2A 2LD9A 4IUMB 4FBJB 3VVWB 1WX9A 2C5LC 2IZVB 2KTRB 4MGIE 4MH0E 3UF8A 2DAJA 2R2QA 4KSKC 1WGDA 3PPAA 4GDLB 3ZO5B 4HCPB 4WJNA 3PGEA 2C7HA 2RPQA 3K9OB 1XD3B 2NBUA 3QWZB 3R3MA 2MP2A 4RM8A 2EKEC 2UWQA 2WX0A 1WYWB 2RR9A 1V5OA 2FCQA 3M95A 4PS3A 2L7RA 3ZNZB 3RCZA 2MBQA 2Z0DB 2KWVB 2L3ZA 4FLHA 4G0NB 4GDKA 1WX7A 2JZZA 4W9LA 2M0XA 4MEMA 5E6OA 5DPTA 3RT3B 2C7NB 2J7QB 5AZGA 2CU1A 3ZRCA 4PS8A 2DX5B 3DVNV 2DZJA 4BKTA 1QZEA 4ICVA 3QJZA 2K6QA 5JZEB 3CSTA 4FHJA 4W9DA 4KIKB 4IWQA 4II3B 5FR6A 2K8CA 1OGWA 2WYQA 2KXJA 2NCNA 3W1YA 2N1VA 3QA8A 2MCNB 4HDOA 4A3PA 1P9DU 4ASWC 3VHTC 1P0RA 5IAAC 4K7UA 2LGXA 3VTVA 2JPHA 3AXCA 1E8YA 4JLCA 4BOSC 3B1LX 4EUTA 4K81A 3A9KA 5D6JB 5JHAA 3EHVA 3ZDMC 4ANUA 3RD2A 1R4MI 1Y8RC 2ZZPB 5CHVC 4FA6A 4KVGB 4ZYNA 2N1WA 2N4FA 4NY0A 3B0AA 4JQWC 1V6EA 1WGGA 3C0RB 1Q0WB 2V3SA 3LJ3A 1OEYJ 4FJYA 3UINB 3GZNI 1H4RA 1Z5SB 3PT2B 1NBFC 1IP9A 4K7SA 2O6VA 4TUUA 3PSEB 3VQIA 2PPHA 3L0WB 4DK5A 1WRDB 4BKGA 2V4LA 3ML8A 4X57B 2M17A 1J0GA 4DHZE 4NJ7A 4XC2A 1YX6B 2ASQA 3QK0A 2FCMA 4NQLB 5CHWA 2XK5B 3APDA 4CYEA 1EUVB 1WH3A 4G11A 2IO0B 4AUQC 2L0TA 3VTUA 2N9XA 4M8NA 4RM9A 2LVPA 4GDLA 1WXSA 1E7UA 3ZTDA 3KW5B 2LRWA 4NJ6A 4GU2A 2DAFA 5LLIA 2KDEB 2LRUA 3H6NA 4NNJB 2NBWB 2D10A 1WFYA 2L76A 4W9HA 3VFKA 5LXHA 3H7PB 5C23A 3Q3FA 3AI5A 1GC7A 5L95C 3DVNU 3PZDA 1WI0A 1XQQA 4LJOB 3CSFA 1WM2A 4TQ1A 2N7EA 4ZRKA 4EKUA 2BYVE 3PRMB 3EECA 4IM3A 1VD2A 2NS5A 2AYOB 2MA9B 3WAMA 1WJUA 4ANWA 2QHOA 3T9LA 1F9JA 3JYUA 3OLMD 4W9KA 2O6VB 3MJWA 3ENEA 4XZ4A 4KIKA 3N30A 3VH4B 3DBSA 2Y5BB 3ZUNA 4IM0A 1IPGA 3LDZE 4TV3A 2EMTA 3NY5A 2HJ8A 2JWZA 4K7WA 5KHQA 1YIWA 3ECIA 3WALA 3DCGA 3OJ4B 4AOFA 1WZ3A 1TZ1A 2YLMA 5C1ZA 4PS7A 4OVUA 3AULA 3L10B 1LXDA 3R7QA 3UQBA 1WF9A 2RD0A 3WAOA 1A5RA 4E71A 2FCSA 2PJHA 3QC8B 4KZ0A 3QARA 4FJZA 2G4SA 4LJPB 4IWOA 5J18A 4XX5A 2K39A 2BGFA 1OEYA 5CX3A 2AL6A 2ZEQA 4FJVB 4I6NB 4BOZB 2KFKB 4IWPA 3APFA 4TQ0A 2FUHB 3HIZA 4WAAA 2C7MB 4MDKE 1XT9B 2KLGA 2N7DA 1RRBA 3VAWA 4PYUA 2CS4A 3IG3A 2GBRA 2CHXA 2LUEA 3N3KB 3QHTA 3RYTA 4AJWA 4DWFA 1ZGUB 1WGYA 3ZTCA 3MHSD 3VDZA 1V86A 1KOTA 2KDBA 3AU4A 3SDLC 2BYEA 1SGHA 3HHMA 4KDIC 4PYZA 5CTRC 3L54A 1ISNA 2MBOA 4IC7B 2BWFA 1U4AA 2KOXA 4DHJD 2BWES 2GBMA 4KZCA 1E5WA 2IBIB 1UD7A 3ZVVA 2V1YA 3ZKJC 3V61A 4B95A 3KVFB 3UIOB 5G55A 4BFRA 4FN2A 2FCNA 2XK5A 3DOWA 5D94A 3R7RA 4A20A 2LZ6A 2CKHB 3V60A 1IYFA 3EFUA 4II2B 1YX5B 2D2QA 3RUIB 4CHKA 1S1QB 3QCAA 3L13A 3DPDA 3PLUA 1MG8A 3IHPC 3PRPB 3ONSA 4JL9A 1I42A 2L00B 1UH6A 3ZW3A 1CMXB 4DHJB 4DHZB 4LDTD 2KFJA 3WANA 2RSUA 1UBIA 2MX2A 2KC1A 2MSED 3H7PA 2MQJA 4WJOA 3L17A 5KHOA 3U30A 3H9DA 4GN1A 5AZHA 2JF5A 2KVRA 4EZJA 4I6PA 3W1SA 1AARA 1V2YA 2KX0A 3VUYA 2REXA 3N32A 4M0WB 4ZRIA 1J8CA 4I6LB 4LDTB 4NAWB 4W9CA 2MBBB 2N9EB 2ZNVC 1LFDA 3KH0A 2JRHA 4YL8A 3A33B 2M1MA 2CR5A 4DDID 1UGMA 4NPNA 2DHZA 2PE6B 3QIJA 1WMHB 4OVVA 4ANVA 1LQBA 3ZNGC 1D3ZA 2BPSA 2M4NA 2W9NA 1JRUA 3P2BA 3QQ8B 4MM3A 4EEWA 2LWPA 3V6CB 1J19A 1ZKHA 1WE6A 2NBVB 3KYCD 3RULA 4URKA 1H8CA 2C9WB 3M63B 3KUZA 2KX3A 2LVOA 1HE8A 3CMMB 1WY8A 4FULA 1Q1OA 1OQYA 1WJ4A 2KJHB 2IYDB 4WQOB 5HKHA 2G45B 2KJRA 2RGFA 3DDCB 3IBEA 4IG7B 5G2NA 2LXCA 3APCA 3PS6A 4GOCA 3DBHI 4WJPA 2KFKA 2MLBA 4J6IA 4IW0A 1P1AA 4EFOA 3IFWB 1P98A 1E7VA 2I1JA 3DQVA 3QAQA 5DCNA 4AJYB 2C60A 4MJSB 5L83A 2CHZA 4BBNF 4CO7A 2FAZA 1WX8A 3SD5A 2LVQA 2WDTB 4DBGA 4E74A 2Z59B 2FIDA 3DVGY 4TKNA 2IY0B 2J0JA 2BKFA 1EO6A 2KN5A 3PREA 3S2AA 4KDLB 2I1KA 1R4NI 2LXAA 3UIPB 4B6WA 1I35A 3ALBA 2ZPNA 4EOYA 4GXBA 2JRIB 2NPTB 4E3CA 3RZWC 1YQBA 3B08A 3SHQA 2DZMA 5DPSA 4MGKE 1V80A 2JT4B 3M3JA 2KLCA 1C1YB 1YD8U 4F7ZA 4P7IA 1SE9A 1TBEA 2K6DB 1GC6A 1K8RB 2B3AA 1WXAA 2G3QB 3NS8A 4M8MA 3K9PB 1UELA 1NDDA 2LGYA 3A9JB 3TBLD 3A1QB 2L0FA 1WJNA 4K1RB 4ANXA 4JGHB 2KJ6A 4HXDA 3BY4B 1GNUA 3JSVA 4GMVA 3JVZX 2KMAA 2XBBC 3VXWA 3M62B 3HK0A 2Z0EB 5DPRA 1LM8B 2L8JA 3JW0X 4A3OA 2KKCA 1WZ0A 4ZRJA 3L16A 2LASA 5D2MB 3U8ZA 4W9GA 2O2VB 1FXTB 3D32A 3O65B 3ZNID 1NI2A 2BKRB 2K8HA 3ZDTA 3ZNHB 5AZFA 3NZSA 5J17A 1WXVA 2IO2B 4HCNB 1T0YA 4NAWA 4W9EA 1E8WA 3OJ3A 1WM3A 2GOWA 2NVUI 2KK8A 2LGDA 3WA0A 4AP4C 5E6PA 1WR1A 1WMHA 4B9KA 4BKSD 4MSQB 5JH5C 3EC8A 2JUOA 2AL3A 4HPMB 4FHKA 1WXMA 5TR5A 1WR6E 2KMCA 4HPLB 2DZKA 3A4RA 2KTFA 3ML9A 3ZRFA 3VUWA 2GBKA 4HWIB 2HTHA 2JVCA 3DVGX 5DPWA 4MELA 3PV1A 5CHFA 4WJQA 2BF8B 3TCAA 4HVBA 2D3GA 3RZFA 1TTNA 4IM2A 1OTRB 1EF5A 3JSVB 4DXAB 2PE9A 2KQ7A 2JY6A 3MTNB 1V81A 2HE7A 4N9F4 3TMPB 3X0WA 4ICUA 5J2RA 3KUCB 2CHWA 2MW5A 2BYFA 3TIXA 4F1SA 2J0KA 2ZJDA 1WJ6A 1Q5WB 3AU5A 4G3XB 1WGHA 3UGBB 2KANA 4MJSA 4MGYE 1G6JA 2ZPYA 1Z2MA 2KDIA 3CF6E 3W1SC 5JHBA 1RAXA 4JIOU 2DZIA 3I3TB 3TJPA 3NHEB 1SIFA 1M94A 2MP2B 2JXXA 4W9IA 4BVUC 1V5TA 3H1UA 2ZCBA 4W9FA 1PQSA 4GSWA 4MSMB 2ZVNA 3HM6X 2NPTA 2FNJB 3H7SA 2KD0A 4MGZE 2K8BA 2PEAA 3NOBA 1WE7A 3BINA 4GDKB 3QX1A 2KC2A 1V49A 2DYMA 4GB9A 4ZDVA 1E8XA 2KWCA 3NZUA 4EZKA 4LCDE 1BT0A 4AWJA 4WWOA 1C3TA 1UBQA 3DBRI 3PHXB 2K1FA 2KDFB 4WWPA 5BO4B 2KQSA 3A9JA 3OAWA 3A1QA 5AEKB 2LJ5A 4KSLC 1ZW7A 2FIFA 1WIAA 2KWUB 2ZCCA 3KUDB 1KLVA 2J0MA 2DYOA 2IO3B 1X1MA 3VH3B 3PVLA 4BBNC 2WX1A 1EF1A 3PTFC 3R66C 5GMVA 4DDGD 2GBJA 1E90A 1WGRA 2ZVOA 5EDSA 1P3QU 3PHWB 3ZIMA 4NQKE 2O2VA 2KTRA 2MWSB 3KYDD 2D07B 3Q3JA 4HK2A 4RMAA 2WWZA 2GMIC 3VTWA 3L08A 2OJRA 2R2OA 2K25A 3A9KB 3VUXA 3WAPA 3ZLZA 4HLEA 3TL5A 1RFAA 2L05A 5IA7A 1UZXB 2IO1B 1E8ZA 2O6VD 4G50A 4GGQA 3U7DA 4FADA 2KNBA 2OOBB 2EMSA 2DENB 1KJTA 2D11A 2MRPA 3GOEA 2KO3A 2JZ3B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D7G A;  3PRZ A;  1S3S G;  2A5U A;  2NR2 A;  2IY1 B;  2G4D B;  2KZR A;  2AEH A;  4EZL A;  3DBL I;  1GUA B;  2VRR B;  3SU8 X;  4HJK A;  2DYB A;  3PLV A;  1VCB A;  1L2N A;  1GG3 A;  1YJ1 A;  2GBN A;  2N9P C;  2ZNV B;  4F8C B;  1TGZ B;  2LI5 A;  3UQA A;  2YVC A;  3HM3 A;  4W9J A;  3T8M A;  5E6N A;  3A4S C;  1KM7 A;  2MBH A;  4GIV A;  2A4Z A;  4HDQ A;  2KHW B;  1V9J A;  3IVF A;  2UYZ B;  2AWT A;  4BKS A;  2MBE A;  2XEW A;  3V62 A;  1L7Y A;  1GJZ A;  1RLF A;  2M8S A;  3X23 A;  3V6E B;  2HD5 B;  4WWN A;  3WIM A;  5LXI B;  4KV2 A;  2LD9 A;  4IUM B;  4FBJ B;  3VVW B;  1WX9 A;  2C5L C;  2IZV B;  2KTR B;  4MGI E;  4MH0 E;  3UF8 A;  2DAJ A;  2R2Q A;  4KSK C;  1WGD A;  3PPA A;  4GDL B;  3ZO5 B;  4HCP B;  4WJN A;  3PGE A;  2C7H A;  2RPQ A;  3K9O B;  1XD3 B;  2NBU A;  3QWZ B;  3R3M A;  2MP2 A;  4RM8 A;  2EKE C;  2UWQ A;  2WX0 A;  1WYW B;  2RR9 A;  1V5O A;  2FCQ A;  3M95 A;  4PS3 A;  2L7R A;  3ZNZ B;  3RCZ A;  2MBQ A;  2Z0D B;  2KWV B;  2L3Z A;  4FLH A;  4G0N B;  4GDK A;  1WX7 A;  2JZZ A;  4W9L A;  2M0X A;  4MEM A;  5E6O A;  5DPT A;  3RT3 B;  2C7N B;  2J7Q B;  5AZG A;  2CU1 A;  3ZRC A;  4PS8 A;  2DX5 B;  3DVN V;  2DZJ A;  4BKT A;  1QZE A;  4ICV A;  3QJZ A;  2K6Q A;  5JZE B;  3CST A;  4FHJ A;  4W9D A;  4KIK B;  4IWQ A;  4II3 B;  5FR6 A;  2K8C A;  1OGW A;  2WYQ A;  2KXJ A;  2NCN A;  3W1Y A;  2N1V A;  3QA8 A;  2MCN B;  4HDO A;  4A3P A;  1P9D U;  4ASW C;  3VHT C;  1P0R A;  5IAA C;  4K7U A;  2LGX A;  3VTV A;  2JPH A;  3AXC A;  1E8Y A;  4JLC A;  4BOS C;  3B1L X;  4EUT A;  4K81 A;  3A9K A;  5D6J B;  5JHA A;  3EHV A;  3ZDM C;  4ANU A;  3RD2 A;  1R4M I;  1Y8R C;  2ZZP B;  5CHV C;  4FA6 A;  4KVG B;  4ZYN A;  2N1W A;  2N4F A;  4NY0 A;  3B0A A;  4JQW C;  1V6E A;  1WGG A;  3C0R B;  1Q0W B;  2V3S A;  3LJ3 A;  1OEY J;  4FJY A;  3UIN B;  3GZN I;  1H4R A;  1Z5S B;  3PT2 B;  1NBF C;  1IP9 A;  4K7S A;  2O6V A;  4TUU A;  3PSE B;  3VQI A;  2PPH A;  3L0W B;  4DK5 A;  1WRD B;  4BKG A;  2V4L A;  3ML8 A;  4X57 B;  2M17 A;  1J0G A;  4DHZ E;  4NJ7 A;  4XC2 A;  1YX6 B;  2ASQ A;  3QK0 A;  2FCM A;  4NQL B;  5CHW A;  2XK5 B;  3APD A;  4CYE A;  1EUV B;  1WH3 A;  4G11 A;  2IO0 B;  4AUQ C;  2L0T A;  3VTU A;  2N9X A;  4M8N A;  4RM9 A;  2LVP A;  4GDL A;  1WXS A;  1E7U A;  3ZTD A;  3KW5 B;  2LRW A;  4NJ6 A;  4GU2 A;  2DAF A;  5LLI A;  2KDE B;  2LRU A;  3H6N A;  4NNJ B;  2NBW B;  2D10 A;  1WFY A;  2L76 A;  4W9H A;  3VFK A;  5LXH A;  3H7P B;  5C23 A;  3Q3F A;  3AI5 A;  1GC7 A;  5L95 C;  3DVN U;  3PZD A;  1WI0 A;  1XQQ A;  4LJO B;  3CSF A;  1WM2 A;  4TQ1 A;  2N7E A;  4ZRK A;  4EKU A;  2BYV E;  3PRM B;  3EEC A;  4IM3 A;  1VD2 A;  2NS5 A;  2AYO B;  2MA9 B;  3WAM A;  1WJU A;  4ANW A;  2QHO A;  3T9L A;  1F9J A;  3JYU A;  3OLM D;  4W9K A;  2O6V B;  3MJW A;  3ENE A;  4XZ4 A;  4KIK A;  3N30 A;  3VH4 B;  3DBS A;  2Y5B B;  3ZUN A;  4IM0 A;  1IPG A;  3LDZ E;  4TV3 A;  2EMT A;  3NY5 A;  2HJ8 A;  2JWZ A;  4K7W A;  5KHQ A;  1YIW A;  3ECI A;  3WAL A;  3DCG A;  3OJ4 B;  4AOF A;  1WZ3 A;  1TZ1 A;  2YLM A;  5C1Z A;  4PS7 A;  4OVU A;  3AUL A;  3L10 B;  1LXD A;  3R7Q A;  3UQB A;  1WF9 A;  2RD0 A;  3WAO A;  1A5R A;  4E71 A;  2FCS A;  2PJH A;  3QC8 B;  4KZ0 A;  3QAR A;  4FJZ A;  2G4S A;  4LJP B;  4IWO A;  5J18 A;  4XX5 A;  2K39 A;  2BGF A;  1OEY A;  5CX3 A;  2AL6 A;  2ZEQ A;  4FJV B;  4I6N B;  4BOZ B;  2KFK B;  4IWP A;  3APF A;  4TQ0 A;  2FUH B;  3HIZ A;  4WAA A;  2C7M B;  4MDK E;  1XT9 B;  2KLG A;  2N7D A;  1RRB A;  3VAW A;  4PYU A;  2CS4 A;  3IG3 A;  2GBR A;  2CHX A;  2LUE A;  3N3K B;  3QHT A;  3RYT A;  4AJW A;  4DWF A;  1ZGU B;  1WGY A;  3ZTC A;  3MHS D;  3VDZ A;  1V86 A;  1KOT A;  2KDB A;  3AU4 A;  3SDL C;  2BYE A;  1SGH A;  3HHM A;  4KDI C;  4PYZ A;  5CTR C;  3L54 A;  1ISN A;  2MBO A;  4IC7 B;  2BWF A;  1U4A A;  2KOX A;  4DHJ D;  2BWE S;  2GBM A;  4KZC A;  1E5W A;  2IBI B;  1UD7 A;  3ZVV A;  2V1Y A;  3ZKJ C;  3V61 A;  4B95 A;  3KVF B;  3UIO B;  5G55 A;  4BFR A;  4FN2 A;  2FCN A;  2XK5 A;  3DOW A;  5D94 A;  3R7R A;  4A20 A;  2LZ6 A;  2CKH B;  3V60 A;  1IYF A;  3EFU A;  4II2 B;  1YX5 B;  2D2Q A;  3RUI B;  4CHK A;  1S1Q B;  3QCA A;  3L13 A;  3DPD A;  3PLU A;  1MG8 A;  3IHP C;  3PRP B;  3ONS A;  4JL9 A;  1I42 A;  2L00 B;  1UH6 A;  3ZW3 A;  1CMX B;  4DHJ B;  4DHZ B;  4LDT D;  2KFJ A;  3WAN A;  2RSU A;  1UBI A;  2MX2 A;  2KC1 A;  2MSE D;  3H7P A;  2MQJ A;  4WJO A;  3L17 A;  5KHO A;  3U30 A;  3H9D A;  4GN1 A;  5AZH A;  2JF5 A;  2KVR A;  4EZJ A;  4I6P A;  3W1S A;  1AAR A;  1V2Y A;  2KX0 A;  3VUY A;  2REX A;  3N32 A;  4M0W B;  4ZRI A;  1J8C A;  4I6L B;  4LDT B;  4NAW B;  4W9C A;  2MBB B;  2N9E B;  2ZNV C;  1LFD A;  3KH0 A;  2JRH A;  4YL8 A;  3A33 B;  2M1M A;  2CR5 A;  4DDI D;  1UGM A;  4NPN A;  2DHZ A;  2PE6 B;  3QIJ A;  1WMH B;  4OVV A;  4ANV A;  1LQB A;  3ZNG C;  1D3Z A;  2BPS A;  2M4N A;  2W9N A;  1JRU A;  3P2B A;  3QQ8 B;  4MM3 A;  4EEW A;  2LWP A;  3V6C B;  1J19 A;  1ZKH A;  1WE6 A;  2NBV B;  3KYC D;  3RUL A;  4URK A;  1H8C A;  2C9W B;  3M63 B;  3KUZ A;  2KX3 A;  2LVO A;  1HE8 A;  3CMM B;  1WY8 A;  4FUL A;  1Q1O A;  1OQY A;  1WJ4 A;  2KJH B;  2IYD B;  4WQO B;  5HKH A;  2G45 B;  2KJR A;  2RGF A;  3DDC B;  3IBE A;  4IG7 B;  5G2N A;  2LXC A;  3APC A;  3PS6 A;  4GOC A;  3DBH I;  4WJP A;  2KFK A;  2MLB A;  4J6I A;  4IW0 A;  1P1A A;  4EFO A;  3IFW B;  1P98 A;  1E7V A;  2I1J A;  3DQV A;  3QAQ A;  5DCN A;  4AJY B;  2C60 A;  4MJS B;  5L83 A;  2CHZ A;  4BBN F;  4CO7 A;  2FAZ A;  1WX8 A;  3SD5 A;  2LVQ A;  2WDT B;  4DBG A;  4E74 A;  2Z59 B;  2FID A;  3DVG Y;  4TKN A;  2IY0 B;  2J0J A;  2BKF A;  1EO6 A;  2KN5 A;  3PRE A;  3S2A A;  4KDL B;  2I1K A;  1R4N I;  2LXA A;  3UIP B;  4B6W A;  1I35 A;  3ALB A;  2ZPN A;  4EOY A;  4GXB A;  2JRI B;  2NPT B;  4E3C A;  3RZW C;  1YQB A;  3B08 A;  3SHQ A;  2DZM A;  5DPS A;  4MGK E;  1V80 A;  2JT4 B;  3M3J A;  2KLC A;  1C1Y B;  1YD8 U;  4F7Z A;  4P7I A;  1SE9 A;  1TBE A;  2K6D B;  1GC6 A;  1K8R B;  2B3A A;  1WXA A;  2G3Q B;  3NS8 A;  4M8M A;  3K9P B;  1UEL A;  1NDD A;  2LGY A;  3A9J B;  3TBL D;  3A1Q B;  2L0F A;  1WJN A;  4K1R B;  4ANX A;  4JGH B;  2KJ6 A;  4HXD A;  3BY4 B;  1GNU A;  3JSV A;  4GMV A;  3JVZ X;  2KMA A;  2XBB C;  3VXW A;  3M62 B;  3HK0 A;  2Z0E B;  5DPR A;  1LM8 B;  2L8J A;  3JW0 X;  4A3O A;  2KKC A;  1WZ0 A;  4ZRJ A;  3L16 A;  2LAS A;  5D2M B;  3U8Z A;  4W9G A;  2O2V B;  1FXT B;  3D32 A;  3O65 B;  3ZNI D;  1NI2 A;  2BKR B;  2K8H A;  3ZDT A;  3ZNH B;  5AZF A;  3NZS A;  5J17 A;  1WXV A;  2IO2 B;  4HCN B;  1T0Y A;  4NAW A;  4W9E A;  1E8W A;  3OJ3 A;  1WM3 A;  2GOW A;  2NVU I;  2KK8 A;  2LGD A;  3WA0 A;  4AP4 C;  5E6P A;  1WR1 A;  1WMH A;  4B9K A;  4BKS D;  4MSQ B;  5JH5 C;  3EC8 A;  2JUO A;  2AL3 A;  4HPM B;  4FHK A;  1WXM A;  5TR5 A;  1WR6 E;  2KMC A;  4HPL B;  2DZK A;  3A4R A;  2KTF A;  3ML9 A;  3ZRF A;  3VUW A;  2GBK A;  4HWI B;  2HTH A;  2JVC A;  3DVG X;  5DPW A;  4MEL A;  3PV1 A;  5CHF A;  4WJQ A;  2BF8 B;  3TCA A;  4HVB A;  2D3G A;  3RZF A;  1TTN A;  4IM2 A;  1OTR B;  1EF5 A;  3JSV B;  4DXA B;  2PE9 A;  2KQ7 A;  2JY6 A;  3MTN B;  1V81 A;  2HE7 A;  4N9F 4;  3TMP B;  3X0W A;  4ICU A;  5J2R A;  3KUC B;  2CHW A;  2MW5 A;  2BYF A;  3TIX A;  4F1S A;  2J0K A;  2ZJD A;  1WJ6 A;  1Q5W B;  3AU5 A;  4G3X B;  1WGH A;  3UGB B;  2KAN A;  4MJS A;  4MGY E;  1G6J A;  2ZPY A;  1Z2M A;  2KDI A;  3CF6 E;  3W1S C;  5JHB A;  1RAX A;  4JIO U;  2DZI A;  3I3T B;  3TJP A;  3NHE B;  1SIF A;  1M94 A;  2MP2 B;  2JXX A;  4W9I A;  4BVU C;  1V5T A;  3H1U A;  2ZCB A;  4W9F A;  1PQS A;  4GSW A;  4MSM B;  2ZVN A;  3HM6 X;  2NPT A;  2FNJ B;  3H7S A;  2KD0 A;  4MGZ E;  2K8B A;  2PEA A;  3NOB A;  1WE7 A;  3BIN A;  4GDK B;  3QX1 A;  2KC2 A;  1V49 A;  2DYM A;  4GB9 A;  4ZDV A;  1E8X A;  2KWC A;  3NZU A;  4EZK A;  4LCD E;  1BT0 A;  4AWJ A;  4WWO A;  1C3T A;  1UBQ A;  3DBR I;  3PHX B;  2K1F A;  2KDF B;  4WWP A;  5BO4 B;  2KQS A;  3A9J A;  3OAW A;  3A1Q A;  5AEK B;  2LJ5 A;  4KSL C;  1ZW7 A;  2FIF A;  1WIA A;  2KWU B;  2ZCC A;  3KUD B;  1KLV A;  2J0M A;  2DYO A;  2IO3 B;  1X1M A;  3VH3 B;  3PVL A;  4BBN C;  2WX1 A;  1EF1 A;  3PTF C;  3R66 C;  5GMV A;  4DDG D;  2GBJ A;  1E90 A;  1WGR A;  2ZVO A;  5EDS A;  1P3Q U;  3PHW B;  3ZIM A;  4NQK E;  2O2V A;  2KTR A;  2MWS B;  3KYD D;  2D07 B;  3Q3J A;  4HK2 A;  4RMA A;  2WWZ A;  2GMI C;  3VTW A;  3L08 A;  2OJR A;  2R2O A;  2K25 A;  3A9K B;  3VUX A;  3WAP A;  3ZLZ A;  4HLE A;  3TL5 A;  1RFA A;  2L05 A;  5IA7 A;  1UZX B;  2IO1 B;  1E8Z A;  2O6V D;  4G50 A;  4GGQ A;  3U7D A;  4FAD A;  2KNB A;  2OOB B;  2EMS A;  2DEN B;  1KJT A;  2D11 A;  2MRP A;  3GOE A;  2KO3 A;  2JZ3 B; 
#chains in the Genus database with same CATH topology
 1ZDX A;  3PRZ A;  4M02 A;  4EZL A;  2AEH A;  3NG0 A;  3DBL I;  1SEB D;  1GG3 A;  2N9P C;  4XDD A;  4O1N A;  1TGZ B;  2J53 A;  2LI5 A;  3UQA A;  2YVC A;  3T8M A;  4W9J A;  2A4Z A;  4WUR A;  4YSY B;  1ZUD 2;  2XEW A;  1F2R C;  3V6E B;  3WIM A;  5LXI B;  4FBJ B;  3VVW B;  2E6X A;  1C79 A;  3PGE A;  2C7H A;  2RPQ A;  3K9O B;  2K9X A;  2EKE C;  2UWQ A;  1WYW B;  3RI7 C;  4DQO C;  4PS3 A;  3ZNZ B;  2Z0D B;  4FLH A;  4G0N B;  4W9L A;  5DPT A;  1N61 A;  1P7F A;  5AZG A;  2VH1 A;  3ZRC A;  1I4R A;  3DVN V;  3Q8F A;  4BKT A;  4ICV A;  4H2A A;  5JZE B;  2K0P A;  3CST A;  1IUE A;  2YEP B;  4LNK A;  2WYQ A;  3AE6 B;  1QKZ A;  3QA8 A;  3W1Y A;  2JYT A;  1T0S C;  5IAA C;  2LGX A;  2JPH A;  3AXC A;  4BOS C;  4K81 A;  4P6V F;  5JHA A;  5E6J A;  1YNT E;  3ZDM C;  1JQ4 A;  4WIP A;  3NZ3 A;  2ZZP B;  2WXI A;  5CHV C;  4FA6 A;  2N1W A;  2G9H D;  1C4A A;  2RDH A;  2W55 A;  2Y5P A;  1NVI D;  2V3S A;  3GB1 A;  3UIN B;  3GZN I;  1B1Z A;  1WYG A;  4J3O D;  1NBF C;  1IP9 A;  4TUU A;  3VQI A;  1WRD B;  2V4L A;  2WU2 B;  3ML8 A;  2RDB C;  2M17 A;  3ZGZ A;  2IGG A;  3ZJU A;  2V3N A;  3QK0 A;  2XK5 B;  2WXL A;  4G11 A;  2IO0 B;  2D3C A;  3FIL A;  2L0T A;  3MP9 A;  3VTU A;  4RM9 A;  2EKI A;  2LVP A;  1WXS A;  2WDV B;  3N9Y C;  2QEJ C;  2QJL A;  4NNJ B;  3AB5 A;  5C2T B;  3VFK A;  5LXH A;  2R61 A;  4REZ A;  3CWI A;  1FIQ A;  4LJO B;  1MFW A;  1WM2 A;  3EEC A;  5G5G A;  1GB1 A;  2INN E;  2CU3 A;  1WJU A;  2W3S A;  2W82 A;  2QHO A;  3JYU A;  1JW9 D;  1TS3 A;  1YN5 A;  1JWU D;  4KIK A;  1IPG A;  2EMT A;  1PFD A;  1YIW A;  1WZ3 A;  5C1Z A;  4OVU A;  3AUL A;  1A5R A;  3WAO A;  1I4Q A;  1HTO A;  1FXI A;  1L0V B;  3QAR A;  2G4S A;  1ZXI A;  1OEY A;  2Q5W D;  4BOZ B;  2KFK B;  1V1P B;  4WAA A;  3W9C B;  3T3N A;  1BML C;  4ACF A;  1GPX A;  1SE2 A;  3RYT A;  1CK1 A;  4DWF A;  1DGJ A;  2WP9 B;  2BQQ A;  2SAK A;  3AEC B;  3SDL C;  3L54 A;  1U4A A;  1STE A;  1Y56 A;  4KZC A;  4XWT A;  3ZVV A;  2V1Y A;  4OZC A;  3KVF B;  4RF0 A;  3UIO B;  4XWW A;  4FN2 A;  3Q3N C;  2CKH B;  5D3I B;  1YX5 B;  1S1Q B;  3L13 A;  3J9C A;  1MG8 A;  3PRP B;  4DHJ B;  4LDT D;  2KFJ A;  3WAN A;  1UBI A;  2MX2 A;  4WJO A;  3UI3 A;  3L17 A;  1XCT L;  1JAL A;  2JF5 A;  3SFE B;  4ZRI A;  1J8C A;  4I6L B;  4W9C A;  1LFD A;  3KH0 A;  2JRH A;  1ZOY B;  3GP7 A;  1VDV A;  4DDI D;  3HVZ A;  1UGM A;  1ZPS A;  1QOB A;  1T6B X;  2LJI A;  1D3Z A;  3ZNG C;  4B0M A;  3V6C B;  1WE6 A;  1SE3 A;  2C9W B;  3KUZ A;  3CMM B;  2LMC A;  4FUL A;  1WJ4 A;  1MPE A;  3V05 A;  4EE2 A;  2H88 B;  3FC4 A;  1KH0 A;  1T0Q C;  2MLB A;  1P1A A;  4IKG A;  3IFW B;  5BYR A;  4C56 C;  1E7V A;  3H8H A;  1F52 A;  2M0A A;  2I1J A;  5DCN A;  1UWX A;  1FEH A;  2V4I B;  4DBG A;  2NTS A;  3DVG Y;  2IY0 B;  2J0J A;  3S2A A;  3PRE A;  4B0E A;  3UIP B;  3ALB A;  1QLB B;  4EOY A;  2NPT B;  3KLS X;  4MGK E;  2JT4 B;  2KLC A;  3NS8 A;  4M01 A;  3K9P B;  2X8X X;  3DWG C;  3A1Q B;  1L4Z B;  2KJ6 A;  2MHJ A;  4RNA A;  1LO5 D;  3BY4 B;  2KMA A;  4RH6 A;  5DPR A;  1LM8 B;  3DBR B;  1UNS A;  2KKC A;  1C78 A;  2LAS A;  3U8Z A;  1FXT B;  2BW2 A;  2KT7 A;  3O65 B;  1NI2 A;  1VR9 A;  4M0W A;  3ZDT A;  5AZF A;  1TY0 A;  1T0Y A;  1E8W A;  1N5W A;  2LGD A;  4AP4 C;  1WR1 A;  1ZDV A;  1ESF A;  1QF6 A;  1FXA A;  2SEB D;  4HPM B;  4FHK A;  4HPL B;  2DZK A;  3ZRF A;  2L1A A;  4KX6 B;  4USA A;  3Q3M C;  3DBL B;  2JWU A;  2KQ7 A;  2GB1 A;  1V81 A;  1F77 A;  4BZA A;  3OWE B;  2ZJD A;  1Q5W B;  1WGH A;  4MJS A;  3MC9 A;  2KDI A;  2MJ3 A;  3CF6 E;  3AEB B;  2WXP A;  1JWA D;  1XO3 A;  2B76 B;  3BVM A;  3AMZ A;  4WQM A;  3IAS 1;  2K8B A;  3NOB A;  4ZDV A;  1K53 A;  2HDE A;  4LCD E;  4ZRQ A;  1KFY B;  3NS1 A;  4A55 A;  3PHX B;  4QAY A;  1C77 A;  2L52 A;  2KWU B;  1KLV A;  3VH3 B;  4DDG D;  3R66 C;  1TY2 A;  1D5X C;  1WGR A;  2ZVO A;  1P3Q U;  3ZIM A;  2O2V A;  2KTR A;  2XNA C;  4YXD B;  1AWD A;  1YQ4 B;  3R2T A;  3VTW A;  4HLE A;  3WAP A;  2QIE B;  3TL5 A;  3GS2 A;  5IA7 A;  5IKC M;  2IO1 B;  3NVV A;  2PVO D;  4FAD A;  4PT5 A;  2JZ3 B;  1TKE A;  1I7H A;  1S3S G;  2JX5 A;  2NR2 A;  1F2R I;  2IY1 B;  2KZR A;  2PIA A;  2KMM A;  1GUA B;  4HKQ A;  4JWS C;  4HJK A;  3PLV A;  1P7E A;  3E9S A;  2MBH A;  3AEE B;  2LGI A;  1L6U A;  3V3X A;  1PUT A;  2UYZ B;  4BKS A;  2ICI A;  1PYW D;  3V62 A;  1GJZ A;  2M8S A;  3X23 A;  2LD9 A;  4IUM B;  1WX9 A;  2C5L C;  2IZV B;  3VR9 B;  2KVZ A;  3FIL B;  4K3C A;  4KSK C;  1EU3 A;  1L0X B;  3ZJV A;  1AN8 A;  2BS4 B;  1XD3 B;  2NBU A;  2BB5 A;  2MP2 A;  4RM8 A;  3ABV B;  3WCQ A;  2WX0 A;  4ZHP A;  1FM0 D;  1V5O A;  1V8C A;  2L7R A;  2MBQ A;  3NUH B;  4GDK A;  2M0X A;  4AS1 A;  2CU1 A;  3BVG A;  3BK1 A;  1QZE A;  1TS5 A;  1FNV A;  2K6Q A;  2DLB A;  2MH7 A;  4KIK B;  1YN4 A;  1OGW A;  2KXJ A;  4ARC A;  2NCN A;  4TMA B;  1PGA A;  2AQ2 B;  4A3P A;  3VTV A;  3B1L X;  1EWC A;  2MJD A;  3N1Z C;  2V0G A;  4RGM A;  5FR3 A;  3HRD D;  2DBY A;  3AED B;  1Y8R C;  1CJE A;  1HA5 A;  1MI0 A;  4NY0 A;  4JQW C;  1V6E A;  1WGG A;  1YQ3 B;  3C0R B;  4KGR A;  1GB4 A;  1SIJ A;  3PT2 B;  3MJ5 A;  1FFV A;  2IGH A;  4P1C C;  2O6V A;  2PPH A;  4DK5 A;  2RDG A;  1C4P A;  2MJE A;  4X57 B;  4DHZ E;  1YX6 B;  2FCM A;  3I63 C;  4LNF A;  2D3B A;  4M8N A;  2WXM A;  3ZTD A;  1E10 A;  4NJ6 A;  5H92 C;  4CQN A;  2LRU A;  5BMG A;  2NBW B;  3RNG C;  1XLP A;  2L76 A;  4OHJ A;  1FCL A;  2E3T A;  1GC7 A;  3DVN U;  1XQQ A;  5HHD G;  3W5V B;  4YTN B;  3WAM A;  2WXF A;  4ANW A;  3T9L A;  3OLM D;  3VR8 B;  4W9K A;  2L83 A;  4XZ4 A;  4L1B A;  3ZUN A;  4IM0 A;  3N1Y C;  4HEA 1;  3RPF C;  1TZ1 A;  4PS7 A;  3IT6 B;  3AEA B;  2W54 A;  2WU5 B;  2RD0 A;  4E71 A;  2FCS A;  4KZ0 A;  4FJZ A;  5J18 A;  2WXJ A;  4XX5 A;  5CX3 A;  2BGF A;  2AL6 A;  4FJV B;  1IBX A;  4I6N B;  4IWP A;  3APF A;  3HIZ A;  2KLG A;  4PYU A;  2LUE A;  3QHT A;  1XLQ A;  2JU6 X;  1WGY A;  3VDZ A;  5BMI A;  5BYQ A;  1YN3 A;  1KOT A;  1SGH A;  5CTR C;  2BWF A;  3P1M A;  2KOX A;  2GBM A;  2IBI B;  4B95 A;  3V61 A;  2MEK A;  5G55 A;  1F0Z A;  4YTP B;  5IO9 A;  1OQR A;  3DOW A;  3I9V 1;  4A20 A;  2KQ4 X;  2HTM E;  1IYF A;  1M4V A;  2WXK A;  4JL9 A;  3VRB B;  2L00 B;  1UH6 A;  1CMX B;  2JYE A;  4XGA B;  3H7P A;  3U30 A;  1OFF A;  2GI9 A;  1ET9 A;  5AZH A;  3P4P B;  2KVR A;  4EZJ A;  1YMH E;  3URY A;  1V2Y A;  2KX0 A;  4M0W B;  4WAF A;  1RWS A;  2GRI A;  2CJN A;  2INP E;  3QIJ A;  2PE6 B;  1LQB A;  2WXO A;  1PGX A;  4DXG A;  2IJ0 A;  2KX3 A;  1JML A;  3TEZ A;  5HKH A;  2G45 B;  2RGF A;  4IG7 B;  4GOC A;  2FBW B;  1TT5 B;  2VH2 A;  3AE3 B;  4WJP A;  4J6I A;  1L6V A;  1JCK B;  2VZK B;  4AJY B;  2C60 A;  3AH7 A;  4MJS B;  5L83 A;  1C4C A;  1WX8 A;  3SD5 A;  2WDT B;  2J52 A;  1XF5 L;  4RFB A;  2I1K A;  3U52 E;  3SHQ A;  5DPS A;  1V80 A;  5D3D A;  4F7Z A;  1TBE A;  2B3A A;  1R4M B;  1UEL A;  2LGY A;  3Q8B A;  4RGT A;  4GLS C;  3MC0 B;  4K1R B;  1KLG D;  4HXD A;  1GNU A;  3JSV A;  2ACZ B;  2L32 A;  2XBB C;  2AQ1 B;  3HK0 A;  2L8J A;  4OW0 A;  3L16 A;  2O2V B;  5T8I A;  3LB8 C;  4ZHO A;  1XEE A;  1WXV A;  4W9E A;  4K3B A;  1QIL A;  2NVU I;  5MPO A;  2KK8 A;  3PO0 A;  3WA0 A;  4IOI E;  1WMH A;  4US9 A;  1E7P B;  4MSQ B;  4PK1 A;  3EC8 A;  2AL3 A;  1WR6 E;  3Q8A A;  4HWI B;  4C00 A;  3FKY A;  2JVC A;  4XYC A;  3PV1 A;  5CHF A;  3TCA A;  4HVB A;  3RZF A;  3LYY A;  1NEN B;  2JY6 A;  2HE7 A;  5J2R A;  1D5M C;  4ICU A;  4HRS A;  3AE8 B;  3KUC B;  2CHW A;  2BYF A;  3TIX A;  4F1S A;  2J0K A;  3AU5 A;  3I57 A;  4G3X B;  4MGY E;  3BK2 A;  1NYQ A;  3FAH A;  2INC C;  2N9L A;  4JIO U;  1HEZ E;  2DZI A;  3I3T B;  4YSX B;  2MP2 B;  1TJE A;  2JXX A;  3W5U B;  4LNI A;  4MSM B;  1DOI A;  1UF0 A;  4HPP A;  2PEA A;  3LXF A;  4GDK B;  2DYM A;  4GB9 A;  4IDI A;  4AWJ A;  2V9H A;  1SSN A;  2KDF B;  1FRR A;  2DNF A;  4LNO A;  4KSL C;  1ZW7 A;  2Y5C A;  1D5Z C;  3KUD B;  2DYO A;  1X1M A;  4C4V A;  1EF1 A;  2GBJ A;  3AE7 B;  1E90 A;  5EDS A;  3Q8C A;  3AE5 B;  3Q3J A;  2PLP A;  4RMA A;  1XXG A;  3RFZ B;  3VUX A;  2Y3A A;  4UDU C;  4NJC A;  3Q2A C;  2L05 A;  1UZX B;  1I4H A;  4G50 A;  4GGQ A;  1CZP A;  2EMS A;  2N7J A;  2D11 A;  3GOE A;  3IT4 B;  2KO3 A;  2A5U A;  5HI1 A;  3SU8 X;  1RFK A;  4RGO S;  2DYB A;  3B2G A;  2GBN A;  4F8C B;  3TEW A;  3A4S C;  1KM7 A;  2LGS A;  4HDQ A;  3GE8 C;  3IVF A;  1K51 A;  2ZW1 A;  4RF1 A;  1ACC A;  2HD5 B;  4WWN A;  4MGI E;  2DAJ A;  1WGD A;  3PPA A;  1IGC A;  3ZO5 B;  2OJW A;  2KDM A;  2FCQ A;  3RCZ A;  2L3Z A;  1KF6 B;  1WX7 A;  2JZZ A;  2HJ1 A;  2PKO A;  3RT3 B;  2J7Q B;  4HRO A;  2DZJ A;  4ITK A;  3N1X C;  3MFG A;  1N62 A;  4II3 B;  2WXR A;  2MCN B;  3VRA B;  3TSS A;  4JLC A;  3A9K A;  3EHV A;  3RD2 A;  1R4M I;  1IBX B;  1HTQ A;  5EE9 A;  4KVG B;  2N4F A;  1Q0W B;  2WLB A;  2Z8L A;  1OEY J;  4DXF A;  1Z5S B;  2RMM A;  1VJK A;  4K7S A;  3L0W B;  3E56 A;  4BKG A;  2KWD A;  3W2D A;  2JQR B;  3MC8 A;  4NJ7 A;  1VZ6 A;  4XC2 A;  1YJI A;  2WQY B;  5CHW A;  4AQ7 A;  3U4E G;  3APD A;  2WHI A;  4CYE A;  4AUQ C;  4GDL A;  1E7U A;  1KLU D;  2KYW A;  3KW5 B;  2LRW A;  1ZP0 B;  4KGT A;  5LLI A;  2KDE B;  3ZQ4 A;  4WWM A;  3NRZ A;  2D10 A;  1WFY A;  1T3Q A;  4W9H A;  4RGN A;  2WDR B;  3H7P B;  3Q3F A;  1V1P A;  1JWS D;  3N20 C;  3PZD A;  1WI0 A;  3DWM A;  3CSF A;  4TQ1 A;  3DHG C;  2N7E A;  4ZRK A;  2BYV E;  3PRM B;  4IM3 A;  1VD2 A;  2JXT A;  2QSD A;  2MA9 B;  4A90 A;  3MJW A;  3ENE A;  3VH4 B;  3SR6 A;  4S17 A;  1WGK A;  2JWZ A;  4K7W A;  1J7B A;  4LK0 M;  2ZW0 A;  3DCG A;  4OZB A;  5EE1 A;  3UQB A;  3R7Q A;  3EUB 2;  1RM6 C;  2YEP F;  3P42 A;  4LNN A;  4IWO A;  2K39 A;  4MDK E;  1XT9 B;  2N7D A;  2DWQ A;  2CS4 A;  3ZXR A;  1D6E C;  3IG3 A;  2GBR A;  2CHX A;  3PZ7 A;  1ZGU B;  2OED A;  3ZTC A;  5BMH A;  3MHS D;  3OG5 A;  1K52 A;  2BT6 A;  3ZXV A;  1VZ7 A;  1SJE D;  2BYE A;  2TSS A;  4IC7 B;  4DHJ D;  2BWE S;  1C76 A;  5TSS A;  5D94 A;  2LZ6 A;  3EFU A;  4II2 B;  2D2Q A;  2IDY A;  4CHK A;  3DPD A;  1WWT A;  3IHP C;  2FE8 A;  3ONS A;  1AW7 A;  3Q6B A;  2NMQ A;  4DHZ B;  2RSU A;  2KC1 A;  3B9J A;  4M00 A;  4D2K A;  3H9D A;  4GN1 A;  1A70 A;  1F1H A;  4I6P A;  1MVK A;  2KN4 A;  1AAR A;  3DHH C;  2REX A;  3N32 A;  4LDT B;  1I4X A;  1QT9 A;  2ZNV C;  3A33 B;  2CR5 A;  4A8X C;  2PVG C;  1WMH B;  1JRU A;  4MM3 A;  1N63 A;  2LWP A;  4NZL B;  1ZKH A;  2NBV B;  4JX1 C;  1E9M A;  2M19 A;  4URK A;  2W3R A;  2BB6 A;  4MAC A;  1HE8 A;  1Q1O A;  1OQY A;  1SXT A;  4N58 A;  2KJH B;  2KJR A;  2XN9 C;  3IBE A;  1JRP A;  4JE3 B;  4N6E B;  3GE3 C;  1VLB A;  4P1B C;  4IW0 A;  4EFO A;  5FKA C;  2GLS A;  3SFD B;  3CIR B;  3DQV A;  2CHZ A;  2EEL A;  1WXQ A;  4BBN F;  2FAZ A;  2LVQ A;  4E74 A;  2Z59 B;  2FID A;  4TKN A;  2BKF A;  3AE4 B;  2KN5 A;  2LXA A;  5IN7 A;  4B6W A;  4HJG E;  4GXB A;  2JRI B;  3RZW C;  2DZM A;  3AE9 B;  5AUI A;  1C1Y B;  1YD8 U;  1SE9 A;  1GC6 A;  1K8R B;  4M8M A;  1WXA A;  3Q8E A;  4C7Y A;  4JPS A;  2L0F A;  1WJN A;  4ANX A;  5LNK 1;  1GOZ A;  4GMV A;  4C4V B;  3P63 A;  3M62 B;  4A3O A;  3JW0 X;  4WH4 A;  3D32 A;  2WXH A;  2K8H A;  3ZNH B;  1I4P A;  3NZS A;  5J17 A;  4NAW A;  2QC8 A;  4KKI A;  1EU4 A;  2GOW A;  5HG2 A;  5E6P A;  4B9K A;  3NVY A;  5JH5 C;  2ONQ A;  2KMC A;  2KTF A;  3VUW A;  2GBK A;  3RN9 C;  2HTH A;  5DPW A;  2BF8 B;  3O13 A;  1TTN A;  1OTR B;  3RNC C;  4DXA B;  3MTN B;  1J7A A;  3X0W A;  2QCZ A;  1J7C A;  3IXS A;  4ZYS A;  3UGB B;  2KAN A;  2ZPY A;  5JHB A;  1UWM A;  3EFC A;  3T3O A;  1SIF A;  3RNB C;  1M94 A;  4W9I A;  4BVU C;  3H1U A;  2ZCB A;  2IPK D;  3HM6 X;  2WDQ B;  4MGZ E;  3BIN A;  1VRA B;  2KC2 A;  1V49 A;  4FXC A;  2KWC A;  4EZK A;  4Q2J A;  1UBQ A;  2K1F A;  5BO4 B;  4WWP A;  3A9J A;  3R8B A;  1CQV A;  1GAQ B;  5AEK B;  1WIA A;  1XLO A;  1B9R A;  2ZCC A;  1I4G A;  2WX1 A;  1ET6 A;  4P16 A;  4RCO A;  3R2I A;  3PHW B;  1SF0 A;  2H89 B;  4NQK E;  2D5G A;  3P4R B;  4BAX A;  4KGS A;  1FNW A;  2WWZ A;  5H8Y E;  1KTK A;  3L08 A;  3A9K B;  3ZLZ A;  2K25 A;  4LLG M;  4XE0 A;  1Q10 A;  1RFA A;  1PGB A;  1K50 A;  2KNB A;  2DEN B;  3AE1 B;  5D7G A;  2G4D B;  2N0S B;  3Q14 C;  2VRR B;  1VCB A;  1L2N A;  1YJ1 A;  2WXQ A;  2ZNV B;  3ZJT A;  3HM3 A;  5E6N A;  1R7S A;  4GIV A;  2KHW B;  1V9J A;  2AWT A;  2MBE A;  1N6Z A;  1L7Y A;  1PDX A;  2I38 A;  1RLF A;  3TUO A;  2X38 A;  1FFU A;  4KV2 A;  2G1E A;  3RNE C;  2KTR B;  4MH0 E;  3BYY B;  3UF8 A;  1MHH E;  2R2Q A;  1V97 A;  4GDL B;  2WXN A;  4HCP B;  4WJN A;  3QWZ B;  3R3M A;  1LGR A;  4TSS A;  2RR9 A;  3P4Q B;  3M95 A;  2KWV B;  1MG4 A;  2LUM A;  4MEM A;  5E6O A;  2C7N B;  2I2Y A;  3U7Z A;  3DBH B;  4PS8 A;  2DX5 B;  3P4S B;  3QJZ A;  3U2S C;  4FHJ A;  4W9D A;  1L0Y B;  4IWQ A;  1SB3 C;  5FR6 A;  2K8C A;  2LHE A;  2N1V A;  3BWU D;  4HDO A;  1P9D U;  4ASW C;  3VHT C;  1P0R A;  4K7U A;  5EE3 A;  1E8Y A;  4EUT A;  3SEB A;  5D6J B;  1R4N B;  4ZRP A;  1BUI C;  4US8 A;  4ANU A;  4ZYN A;  3B0A A;  1QQR A;  3LJ3 A;  4L2Y A;  1MJD A;  4FJY A;  1H4R A;  3ETR A;  4ZOH C;  4ARI A;  5BYS A;  3PSE B;  5C3J B;  1T5X D;  2WS3 B;  3AE2 B;  3EGR A;  2J42 A;  3Q3O C;  1T0R C;  1J0G A;  3RNA C;  5HFY A;  2ASQ A;  1TS2 A;  3MHZ A;  4NQL B;  1RYJ A;  1EUV B;  1WH3 A;  2V3P A;  3HVD A;  2N9X A;  1QOF A;  4C80 A;  1XCQ L;  4GU2 A;  2DAF A;  1QOG A;  3H6N A;  5C23 A;  3AI5 A;  5L95 C;  2OHF A;  4EKU A;  1DOX A;  2NS5 A;  2AYO B;  3IAM 1;  4OVZ A;  1F9J A;  2O6V B;  4N59 A;  2PTL A;  4JWU C;  2JZP A;  3N30 A;  3DBS A;  2Y5B B;  3LDZ E;  4TV3 A;  2FUG 1;  3NY5 A;  2HJ8 A;  3KWV A;  5KHQ A;  4MT5 A;  3ECI A;  4LTU A;  3WAL A;  1HQR D;  3OJ4 B;  4MM3 B;  4AOF A;  2BYT A;  2YLM A;  2PW9 A;  1NI3 A;  3ZYY X;  3L10 B;  3Q69 A;  1LXD A;  5GXG B;  1WF9 A;  4XDC A;  1IGD A;  1E0Z A;  1L4D B;  1E6E B;  2PJH A;  3RMK C;  3QC8 B;  3RNF C;  4LJP B;  2ZEQ A;  2LEK A;  1OQQ A;  1FO4 A;  4TQ0 A;  2QIL A;  2JSV X;  2FUH B;  2C7M B;  1RRB A;  1HXY D;  1UGJ A;  3VAW A;  5JXV A;  3N3K B;  2IGD A;  1AYF A;  1TKY A;  4AJW A;  1KRH A;  1V86 A;  2AQ3 B;  2KDB A;  3AU4 A;  4KDI C;  3HHM A;  4PYZ A;  2BTE A;  5IOI A;  1ISN A;  2K3U A;  2MBO A;  3AN1 A;  1E5W A;  1UD7 A;  3ZKJ C;  2D3A A;  4BFR A;  1SBB B;  2FCN A;  2XK5 A;  3R7R A;  3V60 A;  3RUI B;  3QCA A;  1FNU A;  3PLU A;  2KAJ A;  1I42 A;  3HUI A;  3ZW3 A;  2BS3 B;  2K22 A;  2MSE D;  2MQJ A;  5KHO A;  3C8Y A;  3BVZ A;  1WRI A;  1SJH D;  3W1S A;  3VUY A;  2LFI A;  2UU7 A;  2K5P A;  4NAW B;  2WGS A;  2MBB B;  2N9E B;  3DHI C;  4YL8 A;  1ROE A;  2M1M A;  5AUK A;  3AEG B;  4HKZ E;  4NPN A;  2BVC A;  2DHZ A;  4OVV A;  4ANV A;  1XLN A;  4KKJ A;  2BPS A;  2M4N A;  2W9N A;  3P2B A;  1EWY C;  3QQ8 B;  4L23 A;  4EEW A;  3KWL A;  1J19 A;  3B2F A;  3KYC D;  3L4P A;  3RUL A;  5G5H A;  1H8C A;  3M63 B;  2LVO A;  1WY8 A;  1HZ6 A;  2VZK D;  4MH8 A;  2IYD B;  2J4X A;  4WQO B;  2KAC A;  3DDC B;  4R3D A;  1TS4 A;  2LXC A;  3APC A;  3PS6 A;  5G2N A;  1NEK B;  3DBH I;  2KFK A;  5EE0 A;  1FD6 A;  3NJT A;  1P98 A;  3QAQ A;  2RPV A;  3I5J C;  4CO7 A;  1N5X A;  1ZXH A;  1VZ8 A;  2WXG A;  2WNM A;  5I4D A;  1EO6 A;  4KDL B;  1R4N I;  1I35 A;  2ZPN A;  1BXT A;  4E3C A;  1YQB A;  3B08 A;  3M3J A;  4NAM A;  4P7I A;  2K6D B;  4A6Q A;  2G3Q B;  1NDD A;  3A9J B;  3TBL D;  4JGH B;  5IP4 D;  4OZA A;  3JVZ X;  3VXW A;  3GZN B;  2BS2 B;  2Z0E B;  1TIF A;  1WZ0 A;  4ZRJ A;  1QOA A;  5D2M B;  4W9G A;  1YOV B;  3ZNI D;  5FK9 C;  2BKR B;  3KQ4 A;  2IO2 B;  4HCN B;  2IND C;  3OJ3 A;  1NYR A;  1WM3 A;  1FRD A;  2NTT A;  2CJO A;  4YTM B;  4BKS D;  2JUO A;  1SE4 A;  1WXM A;  5TR5 A;  4YWG G;  3A4R A;  3ML9 A;  2PMV A;  4C7Z A;  3DVG X;  4YT0 B;  1UUP A;  4MEL A;  4WJQ A;  3AV8 A;  2D3G A;  4IM2 A;  1EF5 A;  3JSV B;  3BZD B;  2PE9 A;  1N60 A;  4N9F 4;  4S0R A;  3TMP B;  3BII D;  2MW5 A;  2QMT A;  3TEY A;  1WJ6 A;  1YJJ A;  1TKG A;  1G6J A;  1Z2M A;  3W1S C;  2AX5 A;  1RAX A;  3NVW A;  3TJP A;  1EM7 A;  3NHE B;  1V5T A;  3NVZ A;  4YSZ B;  4W9F A;  1DOY A;  1PQS A;  4GSW A;  2ZVN A;  2NPT A;  2FNJ B;  2M56 B;  1ZE3 D;  3H7S A;  2KD0 A;  3BYT B;  1WE7 A;  1ENF A;  3QX1 A;  1E8X A;  3NZU A;  1BT0 A;  1FMA D;  4WWO A;  1C3T A;  3DBR I;  2KQS A;  2QDF A;  3OAW A;  3A1Q A;  2LJ5 A;  1JWB D;  2N9K A;  2FIF A;  1JWM D;  3EA6 A;  2ON8 A;  2J0M A;  2IO3 B;  3PVL A;  4BBN C;  3PTF C;  5GMV A;  1TZO A;  1WSP A;  1JRO A;  3AEF B;  1DYQ A;  1L5P A;  4A9A A;  1C9F A;  2LHD A;  2BBC A;  1FPY A;  2MWS B;  3KYD D;  2D07 B;  3PZ8 A;  4HK2 A;  2GMI C;  3C19 A;  2OJR A;  2R2O A;  3AM9 A;  3TEX A;  1FCC C;  1HZ5 A;  1V1O A;  1MHX A;  1D4B A;  1E8Z A;  1TYG B;  2O6V D;  3U7D A;  2OOB B;  1KJT A;  2MRP A; 
#chains in the Genus database with same CATH homology
 5D7G A;  3PRZ A;  1S3S G;  2A5U A;  2NR2 A;  2IY1 B;  2G4D B;  2KZR A;  2AEH A;  4EZL A;  3DBL I;  1GUA B;  2VRR B;  3SU8 X;  4HJK A;  2DYB A;  3PLV A;  1VCB A;  1L2N A;  1GG3 A;  1YJ1 A;  2GBN A;  2N9P C;  2ZNV B;  4F8C B;  1TGZ B;  2LI5 A;  3UQA A;  2YVC A;  3HM3 A;  4W9J A;  3T8M A;  5E6N A;  3A4S C;  1KM7 A;  2MBH A;  4GIV A;  2A4Z A;  4HDQ A;  2KHW B;  1V9J A;  3IVF A;  2UYZ B;  2AWT A;  4BKS A;  2MBE A;  2XEW A;  3V62 A;  1L7Y A;  1GJZ A;  1RLF A;  2M8S A;  3X23 A;  3V6E B;  2HD5 B;  4WWN A;  3WIM A;  5LXI B;  4KV2 A;  2LD9 A;  4IUM B;  4FBJ B;  3VVW B;  1WX9 A;  2C5L C;  2IZV B;  2KTR B;  4MGI E;  4MH0 E;  3UF8 A;  2DAJ A;  2R2Q A;  4KSK C;  1WGD A;  3PPA A;  4GDL B;  3ZO5 B;  4HCP B;  4WJN A;  3PGE A;  2C7H A;  2RPQ A;  3K9O B;  1XD3 B;  2NBU A;  3QWZ B;  3R3M A;  2MP2 A;  4RM8 A;  2EKE C;  2UWQ A;  2WX0 A;  1WYW B;  2RR9 A;  1V5O A;  2FCQ A;  3M95 A;  4PS3 A;  2L7R A;  3ZNZ B;  3RCZ A;  2MBQ A;  2Z0D B;  2KWV B;  2L3Z A;  4FLH A;  4G0N B;  4GDK A;  1WX7 A;  2JZZ A;  4W9L A;  2M0X A;  4MEM A;  5E6O A;  5DPT A;  3RT3 B;  2C7N B;  2J7Q B;  5AZG A;  2CU1 A;  3ZRC A;  4PS8 A;  2DX5 B;  3DVN V;  2DZJ A;  4BKT A;  1QZE A;  4ICV A;  3QJZ A;  2K6Q A;  5JZE B;  3CST A;  4FHJ A;  4W9D A;  4KIK B;  4IWQ A;  4II3 B;  5FR6 A;  2K8C A;  1OGW A;  2WYQ A;  2KXJ A;  2NCN A;  3W1Y A;  2N1V A;  3QA8 A;  2MCN B;  4HDO A;  4A3P A;  1P9D U;  4ASW C;  3VHT C;  1P0R A;  5IAA C;  4K7U A;  2LGX A;  3VTV A;  2JPH A;  3AXC A;  1E8Y A;  4JLC A;  4BOS C;  3B1L X;  4EUT A;  4K81 A;  3A9K A;  5D6J B;  5JHA A;  3EHV A;  3ZDM C;  4ANU A;  3RD2 A;  1R4M I;  1Y8R C;  2ZZP B;  5CHV C;  4FA6 A;  4KVG B;  4ZYN A;  2N1W A;  2N4F A;  4NY0 A;  3B0A A;  4JQW C;  1V6E A;  1WGG A;  3C0R B;  1Q0W B;  2V3S A;  3LJ3 A;  1OEY J;  4FJY A;  3UIN B;  3GZN I;  1H4R A;  1Z5S B;  3PT2 B;  1NBF C;  1IP9 A;  4K7S A;  2O6V A;  4TUU A;  3PSE B;  3VQI A;  2PPH A;  3L0W B;  4DK5 A;  1WRD B;  4BKG A;  2V4L A;  3ML8 A;  4X57 B;  2M17 A;  1J0G A;  4DHZ E;  4NJ7 A;  4XC2 A;  1YX6 B;  2ASQ A;  3QK0 A;  2FCM A;  4NQL B;  5CHW A;  2XK5 B;  3APD A;  4CYE A;  1EUV B;  1WH3 A;  4G11 A;  2IO0 B;  4AUQ C;  2L0T A;  3VTU A;  2N9X A;  4M8N A;  4RM9 A;  2LVP A;  4GDL A;  1WXS A;  1E7U A;  3ZTD A;  3KW5 B;  2LRW A;  4NJ6 A;  4GU2 A;  2DAF A;  5LLI A;  2KDE B;  2LRU A;  3H6N A;  4NNJ B;  2NBW B;  2D10 A;  1WFY A;  2L76 A;  4W9H A;  3VFK A;  5LXH A;  3H7P B;  5C23 A;  3Q3F A;  3AI5 A;  1GC7 A;  5L95 C;  3DVN U;  3PZD A;  1WI0 A;  1XQQ A;  4LJO B;  3CSF A;  1WM2 A;  4TQ1 A;  2N7E A;  4ZRK A;  4EKU A;  2BYV E;  3PRM B;  3EEC A;  4IM3 A;  1VD2 A;  2NS5 A;  2AYO B;  2MA9 B;  3WAM A;  1WJU A;  4ANW A;  2QHO A;  3T9L A;  1F9J A;  3JYU A;  3OLM D;  4W9K A;  2O6V B;  3MJW A;  3ENE A;  4XZ4 A;  4KIK A;  3N30 A;  3VH4 B;  3DBS A;  2Y5B B;  3ZUN A;  4IM0 A;  1IPG A;  3LDZ E;  4TV3 A;  2EMT A;  3NY5 A;  2HJ8 A;  2JWZ A;  4K7W A;  5KHQ A;  1YIW A;  3ECI A;  3WAL A;  3DCG A;  3OJ4 B;  4AOF A;  1WZ3 A;  1TZ1 A;  2YLM A;  5C1Z A;  4PS7 A;  4OVU A;  3AUL A;  3L10 B;  1LXD A;  3R7Q A;  3UQB A;  1WF9 A;  2RD0 A;  3WAO A;  1A5R A;  4E71 A;  2FCS A;  2PJH A;  3QC8 B;  4KZ0 A;  3QAR A;  4FJZ A;  2G4S A;  4LJP B;  4IWO A;  5J18 A;  4XX5 A;  2K39 A;  2BGF A;  1OEY A;  5CX3 A;  2AL6 A;  2ZEQ A;  4FJV B;  4I6N B;  4BOZ B;  2KFK B;  4IWP A;  3APF A;  4TQ0 A;  2FUH B;  3HIZ A;  4WAA A;  2C7M B;  4MDK E;  1XT9 B;  2KLG A;  2N7D A;  1RRB A;  3VAW A;  4PYU A;  2CS4 A;  3IG3 A;  2GBR A;  2CHX A;  2LUE A;  3N3K B;  3QHT A;  3RYT A;  4AJW A;  4DWF A;  1ZGU B;  1WGY A;  3ZTC A;  3MHS D;  3VDZ A;  1V86 A;  1KOT A;  2KDB A;  3AU4 A;  3SDL C;  2BYE A;  1SGH A;  3HHM A;  4KDI C;  4PYZ A;  5CTR C;  3L54 A;  1ISN A;  2MBO A;  4IC7 B;  2BWF A;  1U4A A;  2KOX A;  4DHJ D;  2BWE S;  2GBM A;  4KZC A;  1E5W A;  2IBI B;  1UD7 A;  3ZVV A;  2V1Y A;  3ZKJ C;  3V61 A;  4B95 A;  3KVF B;  3UIO B;  5G55 A;  4BFR A;  4FN2 A;  2FCN A;  2XK5 A;  3DOW A;  5D94 A;  3R7R A;  4A20 A;  2LZ6 A;  2CKH B;  3V60 A;  1IYF A;  3EFU A;  4II2 B;  1YX5 B;  2D2Q A;  3RUI B;  4CHK A;  1S1Q B;  3QCA A;  3L13 A;  3DPD A;  3PLU A;  1MG8 A;  3IHP C;  3PRP B;  3ONS A;  4JL9 A;  1I42 A;  2L00 B;  1UH6 A;  3ZW3 A;  1CMX B;  4DHJ B;  4DHZ B;  4LDT D;  2KFJ A;  3WAN A;  2RSU A;  1UBI A;  2MX2 A;  2KC1 A;  2MSE D;  3H7P A;  2MQJ A;  4WJO A;  3L17 A;  5KHO A;  3U30 A;  3H9D A;  4GN1 A;  5AZH A;  2JF5 A;  2KVR A;  4EZJ A;  4I6P A;  3W1S A;  1AAR A;  1V2Y A;  2KX0 A;  3VUY A;  2REX A;  3N32 A;  4M0W B;  4ZRI A;  1J8C A;  4I6L B;  4LDT B;  4NAW B;  4W9C A;  2MBB B;  2N9E B;  2ZNV C;  1LFD A;  3KH0 A;  2JRH A;  4YL8 A;  3A33 B;  2M1M A;  2CR5 A;  4DDI D;  1UGM A;  4NPN A;  2DHZ A;  2PE6 B;  3QIJ A;  1WMH B;  4OVV A;  4ANV A;  1LQB A;  3ZNG C;  1D3Z A;  2BPS A;  2M4N A;  2W9N A;  1JRU A;  3P2B A;  3QQ8 B;  4MM3 A;  4EEW A;  2LWP A;  3V6C B;  1J19 A;  1ZKH A;  1WE6 A;  2NBV B;  3KYC D;  3RUL A;  4URK A;  1H8C A;  2C9W B;  3M63 B;  3KUZ A;  2KX3 A;  2LVO A;  1HE8 A;  3CMM B;  1WY8 A;  4FUL A;  1Q1O A;  1OQY A;  1WJ4 A;  2KJH B;  2IYD B;  4WQO B;  5HKH A;  2G45 B;  2KJR A;  2RGF A;  3DDC B;  3IBE A;  4IG7 B;  5G2N A;  2LXC A;  3APC A;  3PS6 A;  4GOC A;  3DBH I;  4WJP A;  2KFK A;  2MLB A;  4J6I A;  4IW0 A;  1P1A A;  4EFO A;  3IFW B;  1P98 A;  1E7V A;  2I1J A;  3DQV A;  3QAQ A;  5DCN A;  4AJY B;  2C60 A;  4MJS B;  5L83 A;  2CHZ A;  4BBN F;  4CO7 A;  2FAZ A;  1WX8 A;  3SD5 A;  2LVQ A;  2WDT B;  4DBG A;  4E74 A;  2Z59 B;  2FID A;  3DVG Y;  4TKN A;  2IY0 B;  2J0J A;  2BKF A;  1EO6 A;  2KN5 A;  3PRE A;  3S2A A;  4KDL B;  2I1K A;  1R4N I;  2LXA A;  3UIP B;  4B6W A;  1I35 A;  3ALB A;  2ZPN A;  4EOY A;  4GXB A;  2JRI B;  2NPT B;  4E3C A;  3RZW C;  1YQB A;  3B08 A;  3SHQ A;  2DZM A;  5DPS A;  4MGK E;  1V80 A;  2JT4 B;  3M3J A;  2KLC A;  1C1Y B;  1YD8 U;  4F7Z A;  4P7I A;  1SE9 A;  1TBE A;  2K6D B;  1GC6 A;  1K8R B;  2B3A A;  1WXA A;  2G3Q B;  3NS8 A;  4M8M A;  3K9P B;  1UEL A;  1NDD A;  2LGY A;  3A9J B;  3TBL D;  3A1Q B;  2L0F A;  1WJN A;  4K1R B;  4ANX A;  4JGH B;  2KJ6 A;  4HXD A;  3BY4 B;  1GNU A;  3JSV A;  4GMV A;  3JVZ X;  2KMA A;  2XBB C;  3VXW A;  3M62 B;  3HK0 A;  2Z0E B;  5DPR A;  1LM8 B;  2L8J A;  3JW0 X;  4A3O A;  2KKC A;  1WZ0 A;  4ZRJ A;  3L16 A;  2LAS A;  5D2M B;  3U8Z A;  4W9G A;  2O2V B;  1FXT B;  3D32 A;  3O65 B;  3ZNI D;  1NI2 A;  2BKR B;  2K8H A;  3ZDT A;  3ZNH B;  5AZF A;  3NZS A;  5J17 A;  1WXV A;  2IO2 B;  4HCN B;  1T0Y A;  4NAW A;  4W9E A;  1E8W A;  3OJ3 A;  1WM3 A;  2GOW A;  2NVU I;  2KK8 A;  2LGD A;  3WA0 A;  4AP4 C;  5E6P A;  1WR1 A;  1WMH A;  4B9K A;  4BKS D;  4MSQ B;  5JH5 C;  3EC8 A;  2JUO A;  2AL3 A;  4HPM B;  4FHK A;  1WXM A;  5TR5 A;  1WR6 E;  2KMC A;  4HPL B;  2DZK A;  3A4R A;  2KTF A;  3ML9 A;  3ZRF A;  3VUW A;  2GBK A;  4HWI B;  2HTH A;  2JVC A;  3DVG X;  5DPW A;  4MEL A;  3PV1 A;  5CHF A;  4WJQ A;  2BF8 B;  3TCA A;  4HVB A;  2D3G A;  3RZF A;  1TTN A;  4IM2 A;  1OTR B;  1EF5 A;  3JSV B;  4DXA B;  2PE9 A;  2KQ7 A;  2JY6 A;  3MTN B;  1V81 A;  2HE7 A;  4N9F 4;  3TMP B;  3X0W A;  4ICU A;  5J2R A;  3KUC B;  2CHW A;  2MW5 A;  2BYF A;  3TIX A;  4F1S A;  2J0K A;  2ZJD A;  1WJ6 A;  1Q5W B;  3AU5 A;  4G3X B;  1WGH A;  3UGB B;  2KAN A;  4MJS A;  4MGY E;  1G6J A;  2ZPY A;  1Z2M A;  2KDI A;  3CF6 E;  3W1S C;  5JHB A;  1RAX A;  4JIO U;  2DZI A;  3I3T B;  3TJP A;  3NHE B;  1SIF A;  1M94 A;  2MP2 B;  2JXX A;  4W9I A;  4BVU C;  1V5T A;  3H1U A;  2ZCB A;  4W9F A;  1PQS A;  4GSW A;  4MSM B;  2ZVN A;  3HM6 X;  2NPT A;  2FNJ B;  3H7S A;  2KD0 A;  4MGZ E;  2K8B A;  2PEA A;  3NOB A;  1WE7 A;  3BIN A;  4GDK B;  3QX1 A;  2KC2 A;  1V49 A;  2DYM A;  4GB9 A;  4ZDV A;  1E8X A;  2KWC A;  3NZU A;  4EZK A;  4LCD E;  1BT0 A;  4AWJ A;  4WWO A;  1C3T A;  1UBQ A;  3DBR I;  3PHX B;  2K1F A;  2KDF B;  4WWP A;  5BO4 B;  2KQS A;  3A9J A;  3OAW A;  3A1Q A;  5AEK B;  2LJ5 A;  4KSL C;  1ZW7 A;  2FIF A;  1WIA A;  2KWU B;  2ZCC A;  3KUD B;  1KLV A;  2J0M A;  2DYO A;  2IO3 B;  1X1M A;  3VH3 B;  3PVL A;  4BBN C;  2WX1 A;  1EF1 A;  3PTF C;  3R66 C;  5GMV A;  4DDG D;  2GBJ A;  1E90 A;  1WGR A;  2ZVO A;  5EDS A;  1P3Q U;  3PHW B;  3ZIM A;  4NQK E;  2O2V A;  2KTR A;  2MWS B;  3KYD D;  2D07 B;  3Q3J A;  4HK2 A;  4RMA A;  2WWZ A;  2GMI C;  3VTW A;  3L08 A;  2OJR A;  2R2O A;  2K25 A;  3A9K B;  3VUX A;  3WAP A;  3ZLZ A;  4HLE A;  3TL5 A;  1RFA A;  2L05 A;  5IA7 A;  1UZX B;  2IO1 B;  1E8Z A;  2O6V D;  4G50 A;  4GGQ A;  3U7D A;  4FAD A;  2KNB A;  2OOB B;  2EMS A;  2DEN B;  1KJT A;  2D11 A;  2MRP A;  3GOE A;  2KO3 A;  2JZ3 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...