3ZLZA

Lys6-linked tri-ubiquitin
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
73
structure length
73
Chain Sequence
b'MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGRQLEDGRTLSDYNIQKESTLHLVLRL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUITIN
publication title Assembly, Analysis and Architecture of Atypical Ubiquitin Chains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 18
structure length 73
sequence length 73
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3zlzA00
4IUMB 3PLVA 1A5RA 2MQJA 1E8ZA 2L76A 4MJSA 3N32A 2L8JA 3HK0A 1S3SG 1E8XA 3K9PB 2NBVB 3VVWB 3W1YA 4AOFA 2AYOB 3WAMA 3VTUA 5JH5C 4ZRJA 2BYVE 2NCNA 3A9JB 3PHWB 4NQKE 4BVUC 3TMPB 1V80A 1TZ1A 4GDLB 1S1QB 4HPMB 1WFYA 1WE7A 5TR5A 4DK5A 4NAWB 4TQ0A 2WDTB 3PPAA 3RULA 4HPLB 1E90A 2IBIB 1WXAA 4FN2A 2FAZA 3WAPA 2DENB 2KKCA 5KHQA 3PSEB 3SDLC 1UGMA 4GU2A 4ANVA 4G50A 1WX9A 2DHZA 3QIJA 5D2MB 1D3ZA 4RM9A 3KVFB 5DCNA 3R7RA 3SD5A 3NZSA 4CO7A 1YX5B 2JWZA 4MEMA 4NPNA 4OVVA 3ZLZA 4E74A 1UD7A 5C1ZA 4AJYB 3MTNB 4LJOB 4XZ4A 1G6JA 2LXAA 4K81A 3IHPC 4ANXA 2KTRA 2UYZB 3RT3B 2KD0A 1WXMA 1UBIA 2DAJA 2MBEA 4MJSB 3A1QA 1TTNA 3T9LA 4WWNA 2M1MA 1TGZB 2N9XA 3QWZB 2FCMA 3I3TB 3QAQA 2XBBC 2KDFB 2ZNVC 4MSQB 5D6JB 2DAFA 3W1SC 4ANUA 3IBEA 3KUDB 1VD2A 4EZJA 4G0NB 1XT9B 3EFUA 1GC6A 2MA9B 4W9DA 1OTRB 2LI5A 5DPTA 1Z5SB 2ZZPB 4I6LB 2XK5A 4KIKB 3V6CB 2KHWB 4NQLB 3MHSD 2CHZA 1WJNA 2CS4A 1Y8RC 2ZJDA 1V49A 2IYDB 3P2BA 5CX3A 5J17A 1V6EA 5J18A 3KW5B 4A3OA 2ZVOA 5EDSA 3HIZA 1V5OA 4NNJB 2A5UA 3VTWA 2KDEB 3HM3A 4HCPB 2V3SA 5DPSA 2BYEA 2G4SA 2WX1A 2C7HA 3NHEB 2D2QA 2CHXA 4JL9A 3APDA 4DXAB 3DVNV 5L95C 1ZW7A 3WIMA 4M8NA 3L13A 4DDID 3PZDA 4FHJA 2KTRB 1WMHA 2BYFA 5GMVA 4HDOA 3ALBA 4B95A 1NBFC 4G3XB 3A1QB 3JYUA 2GBJA 1IPGA 1H4RA 2K25A 2PJHA 1C1YB 4YL8A 2M17A 2KK8A 4WWOA 2KNBA 2V4LA 1FXTB 3GOEA 4WWPA 2L0FA 5KHOA 1UBQA 2L3ZA 3EHVA 3PV1A 4FULA 1MG8A 4FADA 3KUZA 1Z2MA 3VUXA 4JIOU 3KH0A 4KSKC 2D10A 2WYQA 1WZ0A 3VH3B 3R3MA 2PEAA 4OVUA 3LJ3A 3N30A 3CSTA 5IAAC 3D32A 2FNJB 4X57B 4K7SA 2BPSA 3UQBA 1KM7A 1LXDA 2L05A 3VAWA 5AEKB 1LM8B 3QCAA 2ASQA 2LUEA 2FIDA 4ZRIA 2FCSA 2JUOA 2LJ5A 2LGDA 1WMHB 4B6WA 1GC7A 2AWTA 2C60A 5HKHA 2Z0DB 2I1JA 2IY1B 2KC2A 2I1KA 3DPDA 1WX8A 3C0RB 3ECIA 1WGHA 4GXBA 3SU8X 4AUQC 4HLEA 3AU5A 4BKTA 4K7UA 2JZ3B 3DQVA 3U30A 4AP4C 5FR6A 2JRIB 2GMIC 2GOWA 4MDKE 3JSVA 1T0YA 1RRBA 1SIFA 3KUCB 3KYDD 3H9DA 3UQAA 1X1MA 5CTRC 1L7YA 3MJWA 4RM8A 4TKNA 1E7VA 2LGXA 1R4NI 3HHMA 2Z59B 1P9DU 2RPQA 2R2OA 2BWES 5AZGA 3VXWA 1YIWA 3V60A 4GIVA 2QHOA 3VUWA 5G55A 2BKRB 1UZXB 3ZUNA 3IFWB 4HXDA 2AL3A 4IWOA 1WGDA 1V81A 2N1WA 4IC7B 4JLCA 2KC1A 4PS3A 2NVUI 1Q1OA 2B3AA 1EF1A 2LD9A 2R2QA 2KMAA 4FJYA 4WAAA 3UIOB 3GZNI 2L7RA 3DCGA 1AARA 3RD2A 2OJRA 4FJZA 4ZDVA 4TV3A 4KZCA 2ZVNA 4WJQA 3M62B 4A3PA 3JSVB 1KJTA 2XEWA 1KLVA 4BBNF 3A4RA 3PTFC 4BFRA 3NY5A 3JW0X 2LXCA 4WJNA 3UF8A 1Q0WB 4WQOB 3R66C 4BBNC 5LLIA 4F7ZA 2OOBB 4J6IA 2MX2A 3S2AA 2DYOA 3OJ3A 4W9KA 4FLHA 4W9LA 2REXA 2Y5BB 1E5WA 3WALA 2KJRA 2G3QB 4W9CA 3RUIB 2KN5A 4IW0A 5G2NA 3QC8B 4KZ0A 1YQBA 2LVPA 4HVBA 1E8WA 2MBQA 1WR1A 2YLMA 2KFJA 3L16A 3ZO5B 3CSFA 5JZEB 2O6VA 1CMXB 2NPTA 1EUVB 1OEYJ 2V1YA 3PLUA 3PREA 1PQSA 1GNUA 1GG3A 3VUYA 4GDKA 4BKSA 2G4DB 4ICUA 4GN1A 1C3TA 4DWFA 3PRZA 3DVGY 3PGEA 4FBJB 1R4MI 2EMSA 4AWJA 1OEYA 1IP9A 2NBWB 2D07B 3ZW3A 2RSUA 2ZEQA 4W9FA 3TBLD 4BKGA 5J2RA 2AL6A 2C7NB 1V86A 3JVZX 4MM3A 2KFKA 4E3CA 1GJZA 1KOTA 5AZHA 2BKFA 1VCBA 1WY8A 1RLFA 1ZGUB 2JZZA 2KJ6A 4G11A 3HM6X 3TIXA 4II3B 1WGYA 3PHXB 1J0GA 3NOBA 3L0WB 1QZEA 1RFAA 2JPHA 5CHVC 4MELA 3VHTC 3UIPB 4DHZB 2MCNB 4IWQA 1EF5A 2PE9A 3UINB 3VFKA 3R7QA 2DZJA 1WGGA 3ZTDA 2XK5B 2KDIA 3U8ZA 4EEWA 4K7WA 2NR2A 2DZIA 2K8CA 3EECA 4ANWA 2EMTA 2N4FA 2C9WB 3AI5A 1V2YA 3ZDMC 2FCNA 3ONSA 2O6VB 1NI2A 2KO3A 2NPTB 3O65B 2IO1B 4I6PA 1WR6E 3B0AA 4XX5A 4GDKB 1YX6B 3IVFA 2CR5A 3QK0A 2IY0B 1JRUA 4II2B 2DYBA 4ZRKA 5E6PA 3ZKJC 1M94A 2GBNA 1WM2A 1P98A 2KANA 1ISNA 3QQ8B 2ZCCA 2KFKB 2KWUB 4KDLB 1XD3B 4GB9A 2K6QA 3V61A 4ZYNA 4NJ6A 4W9EA 4W9HA 4EZLA 3APFA 3ZNID 2KMCA 3DVNU 1WXVA 1IYFA 3ZNHB 4RMAA 1Q5WB 4P7IA 2KX3A 2UWQA 5E6OA 4FA6A 4DHJD 2K8HA 2W9NA 5CHWA 3A33B 1LFDA 2KOXA 4MGYE 1P1AA 3M95A 3QA8A 4A20A 3RCZA 3VQIA 2M0XA 1OGWA 2LZ6A 2MWSB 1L2NA 4N9F4 4NJ7A 4IM0A 4W9JA 4F8CB 2D3GA 2VRRB 4CYEA 3Q3JA 2MW5A 4PYUA 2O6VD 2D11A 2IZVB 2LVOA 2RGFA 4PS7A 1NDDA 4GOCA 2IO2B 4LDTD 3T8MA 4BKSD 4M0WB 3VH4B 2CKHB 4ICVA 2MBHA 4HCNB 2GBKA 5LXIB 4I6NB 2JT4B 3OJ4B 1J8CA 2DZMA 3DBHI 1I42A 4TUUA 2EKEC 2KXJA 1WZ3A 2BWFA 4IWPA 2K1FA 4IM2A 1EO6A 4IM3A 2N9PC 3B1LX 4FJVB 1E7UA 2KTFA 2KQ7A 2JY6A 2KX0A 2NS5A 2K6DB 3X0WA 4EUTA 2BGFA 2KWCA 2C7MB 3RZFA 4MGZE 2N9EB 3QJZA 3Q3FA 3QHTA 3TCAA 3NS8A 3X23A 2CHWA 2MBBB 3V62A 3N3KB 3L10B 4KIKA 3PRPB 3AU4A 2MRPA 1WF9A 2PE6B 2K8BA 1WIAA 2JVCA 2JF5A 3WAOA 2JXXA 4JQWC 2DZKA 1WJ6A 2C5LC 2KZRA 4F1SA 2CU1A 4EZKA 2A4ZA 3DBRI 3WA0A 3U7DA 4LCDE 4M8MA 2J7QB 4FHKA 3LDZE 2KLCA 4KVGB 1WM3A 3A9KA 5IA7A 2G45B 2LWPA 2ZNVB 3ENEA 4MSMB 5D7GA 4B9KA 4DHZE 5D94A 1RAXA 2FUHB 1YJ1A 2HE7A 2K39A 3NZUA 4LJPB 3H7PA 3EC8A 2GBRA 5LXHA 2O2VA 3CF6E 1J19A 2L00B 2PPHA 3PVLA 2J0KA 3ML9A 3ZIMA 3AXCA 1YD8U 1OQYA 3ML8A 2KJHB 4JGHB 2Z0EB 4E71A 2HD5B 2RR9A 2LVQA 4HK2A 3UGBB 4EFOA 2LGYA 2LRWA 4XC2A 2N1VA 3ZDTA 4EOYA 1WI0A 1ZKHA 3DDCB 1UELA 2ZPYA 4MH0E 3V6EB 4DBGA 4W9GA 3ZTCA 3TJPA 3TL5A 3BY4B 2MBOA 3SHQA 4DHJB 2JRHA 2ZPNA 3L54A 2N7EA 5DPRA 2GBMA 3OLMD 2KLGA 4NY0A 4WJOA 3H6NA 2KWVB 1P3QU 3A9KB 3H7SA 2M4NA 2AEHA 3CMMB 2KVRA 4IG7B 4K1RB 1F9JA 3QX1A 5C23A 2YVCA 3QARA 2LASA 1P0RA 2KDBA 4GSWA 1UH6A 3H7PB 2IO3B 1WRDB 4AJWA 2O2VB 1WJ4A 3IG3A 4KV2A 2HTHA 4MGIE 2N7DA 3M63B 4LDTB 4EKUA 3ZRFA 3DVGX 5JHBA 1XQQA 3L08A 4CHKA 3A4SC 3WANA 3DBSA 3VTVA 2WWZA 4W9IA 2ZCBA 2MSED 3KYCD 5BO4B 1WXSA 4KSLC 3ZNGC 4BOZB 5AZFA 2MP2A 1WX7A 2WX0A 1GUAB 5L83A 2IO0B 4WJPA 1I35A 1WH3A 5E6NA 1TBEA 2J0MA 3B08A 2RD0A 2J0JA 2L0TA 1K8RB 1WE6A 4BOSC 2FIFA 2DYMA 4DDGD 5DPWA 1BT0A 3L17A 3A9JA 2LRUA 4GGQA 3RZWC 4ASWC 4GDLA 4PYZA 2MLBA 3M3JA 3ZNZB 1WJUA 2M8SA 1U4AA 1SE9A 2KQSA 3PT2B 4HDQA 3RYTA 1E8YA 3AULA 1SGHA 4HJKA 4NAWA 4TQ1A 3ZVVA 4HWIB 4URKA 1H8CA 3DBLI 3PRMB 1WYWB 4PS8A 4GMVA 3H1UA 3PS6A 5CHFA 3BINA 3OAWA 5JHAA 4KDIC 3APCA 2BF8B 2NBUA 2HJ8A 1HE8A 3VDZA 3K9OB 3W1SA 2DX5B 1WGRA 2MP2B 3DOWA 1V5TA 3ZRCA 2FCQA 1V9JA 4MGKE 1LQBA
chains in the Genus database with same CATH superfamily
4IUMB 2MQJA 4NZLB 1DOYA 3BVMA 3HK0A 1S3SG 1E8XA 4OZBA 2NBVB 1OFFA 3WAMA 5JH5C 2BYVE 2NCNA 4BVUC 1V80A 1TYGB 4HPMB 4C56C 1HTOA 4NAWB 4TQ0A 3ZGZA 1NI3A 2WDTB 3PPAA 5H92C 2FAZA 3PSEB 1UGMA 1V1PB 3R7RA 2JWZA 4D2KA 4MEMA 1XCQL 3ZLZA 1XEEA 3SFDB 2VZKD 1UD7A 3MTNB 2WDRB 2LUMA 1UBIA 3J9CA 3T3OA 4WWNA 1XLNA 2N9XA 3W1SC 2ZNVC 3FILA 3KUDB 4G0NB 4REZA 2I38A 3EFUA 4W9DA 4I6LB 2IYDB 3P2BA 1XF5L 1E10A 5IN7A 5J17A 2BQQA 4A3OA 3P63A 5EDSA 1V5OA 1K53A 2A5UA 2G9HD 4HCPB 2V3SA 3NVZA 4WQMA 4XDDA 2D2QA 2CHXA 4DXAB 3APDA 4FXCA 4M8NA 3PO0A 3TEXA 3B2GA 1XO3A 3ALBA 5EE1A 3A1QB 4OW0A 1H4RA 2K25A 3SEBA 4WWOA 1FXTB 3GS2A 5KHOA 1UBQA 1L5PA 2L3ZA 3PV1A 4FULA 1MG8A 3VUXA 3VH3B 1ZPSA 3BYTB 1PGAA 4JWUC 4WIPA 1LXDA 3NG0A 3P4RB 2ASQA 3NVWA 2Z0DB 1JWAD 1RM6C 2N9LA 2IY1B 3DPDA 4HLEA 4AP4C 2LJIA 3U30A 3JSVA 5D3IB 1RRBA 2IPKD 1L7YA 3MJWA 2D3CA 3HHMA 1R4NI 1FCLA 4GIVA 2BYTA 3VUWA 5G55A 2RMMA 1K51A 3DHIC 1WGDA 4NJCA 1V81A 2N1WA 4IC7B 2IGHA 3MC9A 4PS3A 1D4BA 3DCGA 3AEBB 1AARA 3RD2A 3LYYA 3AMZA 4HJGE 4KZCA 2KMMA 3A4RA 3NS1A 3NY5A 1Q0WB 1FXIA 3GE8C 1JWSD 1T0RC 4F7ZA 4RGNA 2V9HA 3OJ3A 2Y5BB 3EFCA 2KJRA 1F52A 2B76B 3RUIB 2VH2A 3QC8B 1KFYB 5I4DA 2MBQA 1YN3A 1ROEA 2O6VA 1EUVB 1C77A 1GG3A 3VUYA 3B2FA 3PRZA 2EMSA 4PK1A 3C19A 4BKGA 3TBLD 4ITKA 2IJ0A 1BUIC 1DGJA 4ZRQA 1VCBA 1RLFA 1WGYA 3NOBA 1XLQA 3AN1A 1QZEA 3VHTC 4MELA 2PE9A 1WGGA 3ZTDA 4WAFA 3U8ZA 2H88B 3EGRA 4K7WA 2K5PA 2K8CA 4C80A 3EECA 4ANWA 3ZDMC 2FCNA 1SIJA 1HXYD 3ONSA 2NPTB 3B0AA 4XX5A 3IVFA 1JRUA 2R61A 1M94A 2GBNA 1ISNA 4MM3B 4RH6A 4KDLB 2K6QA 2RPVA 3V61A 4W9HA 1EU3A 1L0YB 1WXVA 1Q5WB 4IDIA 2VH1A 5CHWA 2W9NA 2HDEA 2LHDA 2KOXA 1P1AA 5G5HA 2FBWB 4W9JA 2Y5PA 4F8CB 2W3SA 2D3GA 4N58A 2D11A 2MJEA 2LVOA 4ZHPA 2L83A 1AW7A 3VH4B 1KH0A 4ICVA 1QLBB 4N59A 3VRBB 5LXIB 1FD6A 1FNVA 1I42A 2DZMA 1WZ3A 2BWFA 4IWPA 4N6EB 2N9PC 1IBXB 1JWMD 2KQ7A 2XN9C 4KGSA 3RZFA 2N9EB 3QJZA 2K0PA 3NS8A 3V62A 4KIKA 1MG4A 3PRPB 1E9MA 4YXDB 1KTKA 2E3TA 4UDUC 4B0EA 3WAOA 2JXXA 4RF1A 2D5GA 2J7QB 3ENEA 4MSMB 2BS2B 4B9KA 1RAXA 4TMAB 2FUHB 1YJ1A 3NZUA 2K39A 4LJPB 3EC8A 2BT6A 4LNFA 2O2VA 1J19A 2L00B 5BMHA 5BMIA 1RYJA 1ZOYB 2Z0EB 1UUPA 2LVQA 3W5VB 3UGBB 4EFOA 2J4XA 2LGYA 2NTSA 4JE3B 1ZKHA 3DDCB 1F1HA 3V6EB 3ZTCA 3TL5A 2MBOA 2CJOA 1TY0A 2QDFA 1J7AA 4C4VB 1GB4A 2WXNA 3L54A 2N7EA 2KLGA 1VZ6A 4WJOA 3A9KB 4RNAA 3BVZA 2KVRA 4IG7B 5C23A 3TEWA 1CZPA 3H7PB 1C4AA 1C9FA 1WRDB 1JROA 1WJ4A 3IG3A 2HTHA 4ARIA 5JHBA 4M01A 4CHKA 2IGDA 2ACZB 2ZCBA 1WXSA 4ZRPA 3AEEB 2WX0A 1SBBB 5L83A 1WRIA 3AV8A 2J0MA 3RN9C 1K8RB 1KF6B 3MHZA 2FIFA 2DYMA 1BT0A 3MC0B 2GLSA 5BYSA 2E6XA 4ASWC 3M3JA 5D3DA 3IXSA 1WJUA 1U4AA 2QEJC 2ONQA 4NAWA 2X8XX 3DBLI 3PRMB 1YN4A 4GMVA 5JHAA 3OAWA 2BTEA 1V1PA 3APCA 2HJ8A 1QILA 3DOWA 2M56B 2FCQA 1WXQA 3W2DA 3PLVA 2WXIA 2WP9B 4ZHOA 3A9JB 4NQKE 1TZ1A 4GDLB 4P16A 1MJDA 1WXAA 4NAMA 3AE4B 5EE9A 2DENB 2KKCA 4GU2A 4ANVA 2DHZA 4RM9A 1TKEA 4CO7A 4NPNA 1TS4A 4E74A 4LJOB 2N0SB 2LXAA 1T0QC 2UYZB 2JYEA 1YOVB 1MVKA 2MBEA 3A1QA 1F2RC 1TTNA 3T9LA 2FE8A 3BYYB 2FCMA 3QAQA 4ANUA 2IGGA 2DAFA 2AQ2B 1VD2A 4OVZA 4EZJA 2MA9B 5DPTA 1OTRB 2LI5A 1Z5SB 2ZZPB 4KIKB 2XK5A 3PZ7A 1UWXA 4NQLB 3MHSD 1WGKA 2CS4A 2ZJDA 1FM0D 1SE2A 4C00A 5J18A 3KW5B 2ZVOA 4BZAA 3HIZA 2KDEB 3HM3A 2BYEA 2WX1A 3W9CB 1YQ3B 4LNOA 2KQ4X 4B95A 3P4PB 4G3XB 5IOIA 3VRAB 2GBJA 4YL8A 3GOEA 1TY2A 4BAXA 4JIOU 1CQVA 2BBCA 2D10A 1B9RA 3DHGC 2EELA 1WZ0A 2JSVX 3R3MA 3U7ZA 3CSTA 1B1ZA 3R2TA 4DQOC 2FNJB 2PW9A 3VAWA 4HRSA 2LJ5A 2LGDA 5HFYA 1WMHB 4US9A 1GC7A 4H2AA 1A70A 2C60A 5HKHA 2JYTA 1NYQA 3AEFB 3UI3A 5C3JB 2KVZA 3C0RB 3SU8X 4AUQC 2VZKB 3Q69A 4BKTA 2GMIC 2GOWA 1X1MA 1E7VA 1QOAA 4HKZE 1JMLA 1P9DU 5BYQA 1K52A 3VXWA 3V60A 2Z8LA 4B0MA 2G1EA 3MP9A 3AE2B 4HXDA 1VDVA 3Q2AC 4JLCA 1N63A 2KC1A 5EE3A 3P1MA 2LD9A 1ZUD2 2R2QA 3N9YC 2BW2A 4WAAA 3UIOB 2L7RA 4FJZA 4ZDVA 5FK9C 1KLVA 4BFRA 4WJNA 1YMHE 2OOBB 2MX2A 3N20C 4FLHA 4LNIA 1E5WA 3WALA 2G3QB 2UU7A 2KN5A 4IW0A 1QOBA 4KZ0A 2LHEA 1ZP0B 2KFJA 1DOXA 3L16A 3ZO5B 4A90A 2W3RA 3PLUA 2NPTA 4MGZE 1OQQA 1C4PA 3RNFC 4L2YA 3PGEA 4RCOA 4AWJA 4FBJB 2L52A 2NBWB 2D07B 4Q2JA 2CU3A 2C7NB 2M0AA 4MM3A 1GJZA 4E3CA 1ET6A 5AZHA 1WY8A 1ZGUB 2JZZA 1ESFA 3PZ8A 5CHVC 3UINB 4IWQA 1VR9A 2KN4A 3R7QA 2XK5B 1QKZA 4EEWA 3DBRB 3W5UB 4J3OD 2DZIA 2C9WB 3O65B 2KO3A 2IO1B 4I6PA 1WR6E 5C2TB 1YX6B 2IY0B 4ZRKA 3N1YC 3U52E 3ZKJC 1WM2A 1I4PA 2JWUA 1P98A 3QQ8B 2DBYA 1XCTL 1SE4A 1UNSA 1RFKA 4NJ6A 1SEBD 3APFA 2OEDA 2KMCA 3AEDB 4US8A 4P7IA 1IBXA 1EWCA 4TSSA 4FA6A 2KDMA 4DHJD 5G5GA 4MGYE 3AE3B 1PFDA 2MWSB 1L2NA 4N9F4 4IM0A 2MW5A 1PDXA 4PYUA 2IZVB 4PS7A 1NDDA 4BKSD 2IO2B 3CWIA 1YJJA 2CKHB 4OZAA 1GPXA 2LMCA 3TEYA 2JT4B 4TUUA 3HVZA 1C78A 1WYGA 2TSSA 1NEKB 1E7UA 4HKQA 2JY6A 1D5ZC 2ON8A 5IP4D 5HHDG 1SJHD 1TS3A 2JZPA 2W82A 1AYFA 3U4EG 2CHWA 3L10B 4XWWA 2PE6B 1XLPA 4YTNB 2K8BA 1P7FA 2JF5A 5HG2A 4JQWC 2KZRA 1DOIA 4C4VA 3HVDA 4A8XC 3WA0A 3U7DA 5LNK1 4M8MA 4FHKA 2KLCA 4XWTA 1WM3A 3A9KA 1GB1A 4DHZE 3WCQA 5D94A 1C79A 3H7PA 2WXPA 3ML9A 1F77A 1YD8U 2RDHA 3AM9A 3ML8A 1TKYA 2KJHB 4JGHB 4HK2A 3KQ4A 1UGJA 3ZDTA 1WI0A 5IKCM 1JWBD 1L0XB 3BY4B 2KWVB 2YVCA 3QARA 2LGSA 1P0RA 4GSWA 1UH6A 2QSDA 1N5WA 4IKGA 3M63B 5E6JA 1XQQA 3L08A 3A4SC 1M4VA 3VTVA 2WDVB 2WXKA 4KX6B 3KYCD 5BO4B 2WXFA 4P1CC 3B08A 2L0TA 1C76A 3L17A 2OJWA 3A9JA 1E0ZA 1I7HA 3RZWC 3P4QB 1NYRA 4GDLA 3ZNZB 4HJKA 1E6EB 1T0SC 1F2RI 4URKA 1WYWB 4YTMB 4PS8A 4KDIC 3ZJUA 4C7YA 4RF0A 3W1SA 2DX5B 2MP2B 1V9JA 1LQBA 1E8ZA 1FMAD 2L76A 4RGOS 3K9PB 3VVWB 4AOFA 3FC4A 2AYOB 1XXGA 2I2YA 3PHWB 1I4RA 3ZQ4A 1WFYA 3I5JC 1FFUA 2WDQB 3RULA 4HPLB 2IBIB 4FN2A 3WAPA 3IT6B 4R3DA 5KHQA 1L6VA 1D3ZA 1TT5B 4YSYB 1WX9A 5DCNA 1YX5B 2EKIA 1LGRA 5C1ZA 4AJYB 1ZDVA 1N5XA 1G6JA 1I4XA 1P7EA 3BIID 1N61A 2KD0A 2PTLA 2DAJA 2MHJA 4MJSB 2WXHA 2M1MA 1TGZB 2YEPF 2KDFB 1TZOA 5AUKA 1I4HA 3IBEA 1XT9B 4MT5A 2PIAA 3V6CB 2MH7A 2CHZA 1Y8RC 2BB5A 1V49A 2PKOA 1V6EA 1HQRD 3GZNB 4YTPB 2C7HA 3NHEB 4JL9A 3T3NA 3DVNV 5L95C 3WIMA 1K50A 3PZDA 2KTRB 2PMVA 4S17A 1WMHA 2BYFA 2J42A 2WXOA 1N62A 3JYUA 2Y5CA 1C1YB 2W54A 2WXRA 2KK8A 3RI7C 1FPYA 4M00A 2L0FA 3EHVA 3FAHA 4FADA 3KUZA 2JU6X 1Z2MA 3KH0A 4KSKC 2WYQA 2L32A 1RWSA 2PEAA 4OVUA 4K7SA 2BPSA 2DWQA 1D5XC 1KM7A 4KGTA 5AEKB 1LM8B 3QCAA 3NJTA 2FIDA 4DXGA 2J52A 2J53A 4LK0M 2AWTA 3N1ZC 2V3NA 5FR3A 2V4IB 2KC2A 2I1KA 1WX8A 2CJNA 1WGHA 4GXBA 3AU5A 5FR6A 1T0YA 1I4GA 3H9DA 3UQAA 5CTRC 5IO9A 2K3UA 4TKNA 2LGXA 3AECB 2Z59B 1PGBA 1KRHA 4USAA 2R2OA 2BWES 5AZGA 2QHOA 1XLOA 2BKRB 1L4DB 5T8IA 2AL3A 1TIFA 3EA6A 3HRDD 2NVUI 1Q1OA 2B3AA 1EF1A 2MEKA 2MJ3A 1FRDA 3B9JA 3Q6BA 2ZW0A 2OJRA 1JW9D 1L4ZB 4WJQA 3M62B 1STEA 3VR8B 1KJTA 4BBNF 1EM7A 3SR6A 4WQOB 3UF8A 2GB1A 4BBNC 3AB5A 5LLIA 4J6IA 3BVGA 3S2AA 2DYOA 1FEHA 1SJED 4W9KA 4W9LA 2REXA 1HZ6A 4W9CA 1ZXHA 3DBLB 3GP7A 2WGSA 4XYCA 4HVBA 1E8WA 1WR1A 2YLMA 4RGTA 5JZEB 1GNUA 3DBHB 4BKSA 1F0ZA 4DWFA 3Q8BA 1R4MI 4YSXB 4EE2A 1OEYA 1IP9A 3ZW3A 2RSUA 4W9FA 2INCC 3JVZX 3RNAC 1SXTA 2X38A 1FFVA 2KJ6A 4G11A 3TIXA 2JXTA 3PHXB 1J0GA 2JPHA 3C8YA 1HZ5A 4DHZB 1JCKB 2DZJA 2QC8A 2V0GA 2OHFA 2EMTA 2N4FA 3AI5A 3V05A 1V2YA 3ZJVA 1AN8A 1CK1A 2QIEB 4GDKB 2WU2B 4II2B 2CR5A 2DYBA 2NTTA 5E6PA 2BS3B 2K9XA 2KANA 2KFKB 2KWUB 1QOFA 1AWDA 4EZLA 3ZNID 3ZNHB 1VLBA 2ICIA 5E6OA 3SFEB 3URYA 2N7JA 3A33B 1LFDA 3E9SA 2WHIA 3QA8A 1GOZA 3AEGB 3RCZA 3VQIA 2DNFA 2LEKA 3GE3C 2LZ6A 1D5MC 4NJ7A 2WQYB 3Q3JA 5HI1A 3AE6B 4LDTD 3MC8A 3T8MA 4M0WB 4HCNB 1OQRA 1WWTA 2EKEC 3Q3MC 2KTFA 3TEZA 2KX0A 4WWMA 2NS5A 3Q3OC 2BGFA 3Q3FA 2INPE 3N3KB 1QF6A 1QT9A 3AU4A 1WF9A 1WIAA 2JVCA 4F1SA 2C5LC 2PVGC 2CU1A 4EZKA 2A4ZA 3DBRI 3IT4B 2BVCA 1ET9A 4ZOHC 3LDZE 4KVGB 4HEA1 3TSSA 4S0RA 2WU5B 4P1BC 3CF6E 4K3BA 1SF0A 3ZIMA 3AXCA 4E71A 2HD5B 3Q8EA 1FXAA 3ZYYX 2LRWA 3RNCC 3AEAB 4XC2A 3LXFA 2N1VA 4HPPA 4EOYA 4RGMA 4MH0E 4W9GA 2MJDA 3TJPA 2JX5A 3SHQA 4DHJB 4NY0A 1P3QU 3CMMB 3AE1B 1F9JA 2N9KA 2LASA 2KDBA 5JXVA 1VJKA 1L6UA 4AJWA 4MGIE 3ZRFA 3DVGX 1VRAB 3DBSA 1J7CA 5AUIA 1MI0A 2MSED 4KSLC 3ZNGC 2AQ3B 1VZ8A 4BOZB 2MP2A 1WX7A 3MFGA 2IO0B 1I35A 1WH3A 1TBEA 2J0JA 1WE6A 3MJ5A 4A6QA 1YNTE 2SAKA 4IOIE 4WH4A 2WXQA 2LRUA 2QCZA 2MLBA 2WLBA 3R2IA 1JRPA 4HDQA 1VZ7A 2GI9A 3AULA 1SGHA 2FUG1 1NVID 3HUIA 4QAYA 4HWIB 2WXGA 4PT5A 1V1OA 1NENB 3AE8B 3H1UA 5CHFA 3BINA 1ENFA 1V8CA 2BF8B 3VDZA 4P6VF 4A9AA 2BB6A 1V5TA 3ZRCA 4L1BA 4MGKE 1WSPA 1JALA 1TJEA 2KAJA 3VR9B 3RNGC 1A5RA 4MJSA 5BMGA 3N32A 2L8JA 2WNMA 3W1YA 4CQNA 4AS1A 3VTUA 4ZRJA 2AX5A 2Y3AA 3TMPB 1CJEA 1S1QB 1JQ4A 3P4SB 1WE7A 5TR5A 4DK5A 2HJ1A 1E90A 3SDLC 4G50A 5D2MB 3QIJA 1BMLC 2DLBA 3KVFB 3SD5A 3NZSA 1QQRA 4OVVA 4XZ4A 1PYWD 3IHPC 4K81A 4ANXA 2KTRA 3RT3B 2KT7A 1WXMA 2H89B 2YEPB 2XNAC 2KACA 3AE9B 1R4NB 3QWZB 3I3TB 5D6JB 5IA7A 2XBBC 4MSQB 1J7BA 1GC6A 4EUTA 2KHWB 2AQ1B 3KWLA 1WJNA 5CX3A 3ZXVA 1I4QA 4NNJB 1LO5D 3O13A 3VTWA 4XE0A 3BWUD 5DPSA 1N60A 2G4SA 2W55A 1ZW7A 2WXLA 3DWGC 4KGRA 3Q8FA 3L13A 4KKJA 4DDID 1EWYC 4FHJA 3V3XA 1SB3C 5GMVA 4HDOA 1NBFC 3AH7A 2LGIA 5FKAC 1IPGA 2PJHA 2M17A 4JWSC 1ZXIA 2RDBC 2KNBA 2V4LA 3FILB 3P42A 4WWPA 3RNBC 1T6BX 4HROA 1SE3A 3L4PA 3LJ3A 3N30A 3IAM1 5IAAC 3D32A 4X57B 5H8YE 3UQBA 2L05A 4LNNA 3AE7B 2LUEA 1IGCA 4ZRIA 2FCSA 2JUOA 2NMQA 3I57A 2D3AA 1FNUA 4B6WA 4ACFA 4A55A 2I1JA 3Q14C 1ACCA 3ABVB 3ECIA 1FRRA 4K7UA 2JZ3B 1FNWA 3DQVA 2JRIB 4MDKE 2QJLA 1SIFA 3KUCB 3KYDD 3EUB2 3KLSX 1HTQA 4RM8A 1YQ4B 2LFIA 2RPQA 1KLUD 3TUOA 3IAS1 1Y56A 1YIWA 1V97A 3CIRB 4LLGM 1UZXB 3Q8CA 3ZUNA 3IFWB 4IWOA 4RFBA 1QOGA 4LTUA 2KMAA 4FJYA 3GZNI 1ZDXA 4TV3A 3RNEC 2ZVNA 3NUHB 4A3PA 3JSVB 2XEWA 3PTFC 3JW0X 2LXCA 2HTME 3R66C 4XDCA 1E7PB 1R7SA 4LNKA 5G2NA 1PGXA 3BZDB 1YQBA 2LVPA 1UWMA 2D3BA 3NZ3A 1BXTA 3CSFA 1CMXB 3PREA 1OEYJ 2V1YA 1PQSA 3OG5A 4GDKA 2G4DB 4ICUA 4GN1A 1C3TA 1ZE3D 3DVGY 4MACA 2ZEQA 5J2RA 2AL6A 1V86A 2KFKA 1KOTA 2BKFA 3HM6X 2WXJA 4II3B 2SEBD 3L0WB 1RFAA 2PLPA 3UIPB 2MCNB 1EF5A 3VFKA 1YJIA 4YWGG 3NVVA 2KDIA 2JQRB 2NR2A 1SSNA 5BYRA 2O6VB 1NI2A 3QK0A 2WS3B 4XGAB 3Q3NC 1IGDA 4GLSC 4K3CA 4M0WA 2ZCCA 1MHXA 3ZXRA 1XD3B 3KWVA 4GB9A 3FKYA 4ZYNA 4W9EA 1T3QA 3DVNU 3ZJTA 4MH8A 1IYFA 4RMAA 2KX3A 2UWQA 2ZW1A 3RMKC 1FCCC 2K8HA 4OZCA 1MHHE 4OHJA 5EE0A 3DWMA 2GRIA 3M95A 4A20A 4ARCA 2M0XA 1OGWA 1JWUD 2VRRB 4CYEA 2O6VD 2Q5WD 2RGFA 2INDC 4GOCA 3NRZA 1N6ZA 2MBHA 4M02A 1YN5A 2GBKA 4I6NB 2QMTA 3OJ4B 2L1AA 1J8CA 3DBHI 2KXJA 4KKIA 2K1FA 4IM2A 1EO6A 4IM3A 4L23A 3B1LX 4FJVB 2K6DB 3X0WA 3LB8C 2KWCA 2C7MB 2KYWA 3QHTA 3TCAA 3OWEB 1MFWA 2MBBB 3X23A 2M19A 5TSSA 2MRPA 1KLGD 2DZKA 1WJ6A 3I63C 5GXGB 4C7ZA 3BK2A 3E56A 4LCDE 2G45B 2LWPA 2ZNVB 5D7GA 1HA5A 4O1NA 2HE7A 2GBRA 2RDGA 3U2SC 1T5XD 5LXHA 3Q8AA 2PPHA 2BS4B 3PVLA 2J0KA 1OQYA 1FIQA 2RR9A 2QILA 1IUEA 4WURA 3ETRA 2K22A 4JPSA 1UELA 2ZPYA 3NVYA 4DBGA 1GAQB 1TS2A 3AE5B 2JRHA 2ZPNA 5DPRA 2GBMA 3OLMD 3H6NA 4AQ7A 2V3PA 3H7SA 2M4NA 2AEHA 4K1RB 3QX1A 2KWDA 4DXFA 1TS5A 1MPEA 2IO3B 3N1XC 2O2VB 4KV2A 1C4CA 4YSZB 2N7DA 4LDTB 4EKUA 4YT0B 3WANA 2WWZA 1PUTA 4JX1C 4W9IA 1D6EC 5AZFA 1GUAB 4WJPA 5MPOA 5E6NA 3BK1A 1HEZE 3DHHC 2RD0A 1Q10A 4BOSC 4ZYSA 4DDGD 3GB1A 5DPWA 4GGQA 1L0VB 1DYQA 3H8HA 4PYZA 1R4MB 2M8SA 3RYTA 1SE9A 2KQSA 3PT2B 1E8YA 1EU4A 2IDYA 3RPFC 4TQ1A 3R8BA 3ZVVA 1H8CA 1UF0A 3PS6A 2WXMA 2NBUA 1FO4A 1HE8A 3RFZB 3K9OB 1WGRA 2INNE 1TKGA 3I9V1 2PVOD
chains in the Genus database with same CATH topology
4IUMB 3PLVA 1A5RA 2MQJA 1E8ZA 2L76A 4MJSA 3N32A 2L8JA 3HK0A 1S3SG 1E8XA 3K9PB 2NBVB 3VVWB 3W1YA 4AOFA 2AYOB 3WAMA 3VTUA 5JH5C 4ZRJA 2BYVE 2NCNA 3A9JB 3PHWB 4NQKE 4BVUC 3TMPB 1V80A 1TZ1A 4GDLB 1S1QB 4HPMB 1WFYA 1WE7A 5TR5A 4DK5A 4NAWB 4TQ0A 2WDTB 3PPAA 3RULA 4HPLB 1E90A 2IBIB 1WXAA 4FN2A 2FAZA 3WAPA 2DENB 2KKCA 5KHQA 3PSEB 3SDLC 1UGMA 4GU2A 4ANVA 4G50A 1WX9A 2DHZA 3QIJA 5D2MB 1D3ZA 4RM9A 3KVFB 5DCNA 3R7RA 3SD5A 3NZSA 4CO7A 1YX5B 2JWZA 4MEMA 4NPNA 4OVVA 3ZLZA 4E74A 1UD7A 5C1ZA 4AJYB 3MTNB 4LJOB 4XZ4A 1G6JA 2LXAA 4K81A 3IHPC 4ANXA 2KTRA 2UYZB 3RT3B 2KD0A 1WXMA 1UBIA 2DAJA 2MBEA 4MJSB 3A1QA 1TTNA 3T9LA 4WWNA 2M1MA 1TGZB 2N9XA 3QWZB 2FCMA 3I3TB 3QAQA 2XBBC 2KDFB 2ZNVC 4MSQB 5D6JB 2DAFA 3W1SC 4ANUA 3IBEA 3KUDB 1VD2A 4EZJA 4G0NB 1XT9B 3EFUA 1GC6A 2MA9B 4W9DA 1OTRB 2LI5A 5DPTA 1Z5SB 2ZZPB 4I6LB 2XK5A 4KIKB 3V6CB 2KHWB 4NQLB 3MHSD 2CHZA 1WJNA 2CS4A 1Y8RC 2ZJDA 1V49A 2IYDB 3P2BA 5CX3A 5J17A 1V6EA 5J18A 3KW5B 4A3OA 2ZVOA 5EDSA 3HIZA 1V5OA 4NNJB 2A5UA 3VTWA 2KDEB 3HM3A 4HCPB 2V3SA 5DPSA 2BYEA 2G4SA 2WX1A 2C7HA 3NHEB 2D2QA 2CHXA 4JL9A 3APDA 4DXAB 3DVNV 5L95C 1ZW7A 3WIMA 4M8NA 3L13A 4DDID 3PZDA 4FHJA 2KTRB 1WMHA 2BYFA 5GMVA 4HDOA 3ALBA 4B95A 1NBFC 4G3XB 3A1QB 3JYUA 2GBJA 1IPGA 1H4RA 2K25A 2PJHA 1C1YB 4YL8A 2M17A 2KK8A 4WWOA 2KNBA 2V4LA 1FXTB 3GOEA 4WWPA 2L0FA 5KHOA 1UBQA 2L3ZA 3EHVA 3PV1A 4FULA 1MG8A 4FADA 3KUZA 1Z2MA 3VUXA 4JIOU 3KH0A 4KSKC 2D10A 2WYQA 1WZ0A 3VH3B 3R3MA 2PEAA 4OVUA 3LJ3A 3N30A 3CSTA 5IAAC 3D32A 2FNJB 4X57B 4K7SA 2BPSA 3UQBA 1KM7A 1LXDA 2L05A 3VAWA 5AEKB 1LM8B 3QCAA 2ASQA 2LUEA 2FIDA 4ZRIA 2FCSA 2JUOA 2LJ5A 2LGDA 1WMHB 4B6WA 1GC7A 2AWTA 2C60A 5HKHA 2Z0DB 2I1JA 2IY1B 2KC2A 2I1KA 3DPDA 1WX8A 3C0RB 3ECIA 1WGHA 4GXBA 3SU8X 4AUQC 4HLEA 3AU5A 4BKTA 4K7UA 2JZ3B 3DQVA 3U30A 4AP4C 5FR6A 2JRIB 2GMIC 2GOWA 4MDKE 3JSVA 1T0YA 1RRBA 1SIFA 3KUCB 3KYDD 3H9DA 3UQAA 1X1MA 5CTRC 1L7YA 3MJWA 4RM8A 4TKNA 1E7VA 2LGXA 1R4NI 3HHMA 2Z59B 1P9DU 2RPQA 2R2OA 2BWES 5AZGA 3VXWA 1YIWA 3V60A 4GIVA 2QHOA 3VUWA 5G55A 2BKRB 1UZXB 3ZUNA 3IFWB 4HXDA 2AL3A 4IWOA 1WGDA 1V81A 2N1WA 4IC7B 4JLCA 2KC1A 4PS3A 2NVUI 1Q1OA 2B3AA 1EF1A 2LD9A 2R2QA 2KMAA 4FJYA 4WAAA 3UIOB 3GZNI 2L7RA 3DCGA 1AARA 3RD2A 2OJRA 4FJZA 4ZDVA 4TV3A 4KZCA 2ZVNA 4WJQA 3M62B 4A3PA 3JSVB 1KJTA 2XEWA 1KLVA 4BBNF 3A4RA 3PTFC 4BFRA 3NY5A 3JW0X 2LXCA 4WJNA 3UF8A 1Q0WB 4WQOB 3R66C 4BBNC 5LLIA 4F7ZA 2OOBB 4J6IA 2MX2A 3S2AA 2DYOA 3OJ3A 4W9KA 4FLHA 4W9LA 2REXA 2Y5BB 1E5WA 3WALA 2KJRA 2G3QB 4W9CA 3RUIB 2KN5A 4IW0A 5G2NA 3QC8B 4KZ0A 1YQBA 2LVPA 4HVBA 1E8WA 2MBQA 1WR1A 2YLMA 2KFJA 3L16A 3ZO5B 3CSFA 5JZEB 2O6VA 1CMXB 2NPTA 1EUVB 1OEYJ 2V1YA 3PLUA 3PREA 1PQSA 1GNUA 1GG3A 3VUYA 4GDKA 4BKSA 2G4DB 4ICUA 4GN1A 1C3TA 4DWFA 3PRZA 3DVGY 3PGEA 4FBJB 1R4MI 2EMSA 4AWJA 1OEYA 1IP9A 2NBWB 2D07B 3ZW3A 2RSUA 2ZEQA 4W9FA 3TBLD 4BKGA 5J2RA 2AL6A 2C7NB 1V86A 3JVZX 4MM3A 2KFKA 4E3CA 1GJZA 1KOTA 5AZHA 2BKFA 1VCBA 1WY8A 1RLFA 1ZGUB 2JZZA 2KJ6A 4G11A 3HM6X 3TIXA 4II3B 1WGYA 3PHXB 1J0GA 3NOBA 3L0WB 1QZEA 1RFAA 2JPHA 5CHVC 4MELA 3VHTC 3UIPB 4DHZB 2MCNB 4IWQA 1EF5A 2PE9A 3UINB 3VFKA 3R7QA 2DZJA 1WGGA 3ZTDA 2XK5B 2KDIA 3U8ZA 4EEWA 4K7WA 2NR2A 2DZIA 2K8CA 3EECA 4ANWA 2EMTA 2N4FA 2C9WB 3AI5A 1V2YA 3ZDMC 2FCNA 3ONSA 2O6VB 1NI2A 2KO3A 2NPTB 3O65B 2IO1B 4I6PA 1WR6E 3B0AA 4XX5A 4GDKB 1YX6B 3IVFA 2CR5A 3QK0A 2IY0B 1JRUA 4II2B 2DYBA 4ZRKA 5E6PA 3ZKJC 1M94A 2GBNA 1WM2A 1P98A 2KANA 1ISNA 3QQ8B 2ZCCA 2KFKB 2KWUB 4KDLB 1XD3B 4GB9A 2K6QA 3V61A 4ZYNA 4NJ6A 4W9EA 4W9HA 4EZLA 3APFA 3ZNID 2KMCA 3DVNU 1WXVA 1IYFA 3ZNHB 4RMAA 1Q5WB 4P7IA 2KX3A 2UWQA 5E6OA 4FA6A 4DHJD 2K8HA 2W9NA 5CHWA 3A33B 1LFDA 2KOXA 4MGYE 1P1AA 3M95A 3QA8A 4A20A 3RCZA 3VQIA 2M0XA 1OGWA 2LZ6A 2MWSB 1L2NA 4N9F4 4NJ7A 4IM0A 4W9JA 4F8CB 2D3GA 2VRRB 4CYEA 3Q3JA 2MW5A 4PYUA 2O6VD 2D11A 2IZVB 2LVOA 2RGFA 4PS7A 1NDDA 4GOCA 2IO2B 4LDTD 3T8MA 4BKSD 4M0WB 3VH4B 2CKHB 4ICVA 2MBHA 4HCNB 2GBKA 5LXIB 4I6NB 2JT4B 3OJ4B 1J8CA 2DZMA 3DBHI 1I42A 4TUUA 2EKEC 2KXJA 1WZ3A 2BWFA 4IWPA 2K1FA 4IM2A 1EO6A 4IM3A 2N9PC 3B1LX 4FJVB 1E7UA 2KTFA 2KQ7A 2JY6A 2KX0A 2NS5A 2K6DB 3X0WA 4EUTA 2BGFA 2KWCA 2C7MB 3RZFA 4MGZE 2N9EB 3QJZA 3Q3FA 3QHTA 3TCAA 3NS8A 3X23A 2CHWA 2MBBB 3V62A 3N3KB 3L10B 4KIKA 3PRPB 3AU4A 2MRPA 1WF9A 2PE6B 2K8BA 1WIAA 2JVCA 2JF5A 3WAOA 2JXXA 4JQWC 2DZKA 1WJ6A 2C5LC 2KZRA 4F1SA 2CU1A 4EZKA 2A4ZA 3DBRI 3WA0A 3U7DA 4LCDE 4M8MA 2J7QB 4FHKA 3LDZE 2KLCA 4KVGB 1WM3A 3A9KA 5IA7A 2G45B 2LWPA 2ZNVB 3ENEA 4MSMB 5D7GA 4B9KA 4DHZE 5D94A 1RAXA 2FUHB 1YJ1A 2HE7A 2K39A 3NZUA 4LJPB 3H7PA 3EC8A 2GBRA 5LXHA 2O2VA 3CF6E 1J19A 2L00B 2PPHA 3PVLA 2J0KA 3ML9A 3ZIMA 3AXCA 1YD8U 1OQYA 3ML8A 2KJHB 4JGHB 2Z0EB 4E71A 2HD5B 2RR9A 2LVQA 4HK2A 3UGBB 4EFOA 2LGYA 2LRWA 4XC2A 2N1VA 3ZDTA 4EOYA 1WI0A 1ZKHA 3DDCB 1UELA 2ZPYA 4MH0E 3V6EB 4DBGA 4W9GA 3ZTCA 3TJPA 3TL5A 3BY4B 2MBOA 3SHQA 4DHJB 2JRHA 2ZPNA 3L54A 2N7EA 5DPRA 2GBMA 3OLMD 2KLGA 4NY0A 4WJOA 3H6NA 2KWVB 1P3QU 3A9KB 3H7SA 2M4NA 2AEHA 3CMMB 2KVRA 4IG7B 4K1RB 1F9JA 3QX1A 5C23A 2YVCA 3QARA 2LASA 1P0RA 2KDBA 4GSWA 1UH6A 3H7PB 2IO3B 1WRDB 4AJWA 2O2VB 1WJ4A 3IG3A 4KV2A 2HTHA 4MGIE 2N7DA 3M63B 4LDTB 4EKUA 3ZRFA 3DVGX 5JHBA 1XQQA 3L08A 4CHKA 3A4SC 3WANA 3DBSA 3VTVA 2WWZA 4W9IA 2ZCBA 2MSED 3KYCD 5BO4B 1WXSA 4KSLC 3ZNGC 4BOZB 5AZFA 2MP2A 1WX7A 2WX0A 1GUAB 5L83A 2IO0B 4WJPA 1I35A 1WH3A 5E6NA 1TBEA 2J0MA 3B08A 2RD0A 2J0JA 2L0TA 1K8RB 1WE6A 4BOSC 2FIFA 2DYMA 4DDGD 5DPWA 1BT0A 3L17A 3A9JA 2LRUA 4GGQA 3RZWC 4ASWC 4GDLA 4PYZA 2MLBA 3M3JA 3ZNZB 1WJUA 2M8SA 1U4AA 1SE9A 2KQSA 3PT2B 4HDQA 3RYTA 1E8YA 3AULA 1SGHA 4HJKA 4NAWA 4TQ1A 3ZVVA 4HWIB 4URKA 1H8CA 3DBLI 3PRMB 1WYWB 4PS8A 4GMVA 3H1UA 3PS6A 5CHFA 3BINA 3OAWA 5JHAA 4KDIC 3APCA 2BF8B 2NBUA 2HJ8A 1HE8A 3VDZA 3K9OB 3W1SA 2DX5B 1WGRA 2MP2B 3DOWA 1V5TA 3ZRCA 2FCQA 1V9JA 4MGKE 1LQBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IUM B;  3PLV A;  1A5R A;  2MQJ A;  1E8Z A;  2L76 A;  4MJS A;  3N32 A;  2L8J A;  3HK0 A;  1S3S G;  1E8X A;  3K9P B;  2NBV B;  3VVW B;  3W1Y A;  4AOF A;  2AYO B;  3WAM A;  3VTU A;  5JH5 C;  4ZRJ A;  2BYV E;  2NCN A;  3A9J B;  3PHW B;  4NQK E;  4BVU C;  3TMP B;  1V80 A;  1TZ1 A;  4GDL B;  1S1Q B;  4HPM B;  1WFY A;  1WE7 A;  5TR5 A;  4DK5 A;  4NAW B;  4TQ0 A;  2WDT B;  3PPA A;  3RUL A;  4HPL B;  1E90 A;  2IBI B;  1WXA A;  4FN2 A;  2FAZ A;  3WAP A;  2DEN B;  2KKC A;  5KHQ A;  3PSE B;  3SDL C;  1UGM A;  4GU2 A;  4ANV A;  4G50 A;  1WX9 A;  2DHZ A;  3QIJ A;  5D2M B;  1D3Z A;  4RM9 A;  3KVF B;  5DCN A;  3R7R A;  3SD5 A;  3NZS A;  4CO7 A;  1YX5 B;  2JWZ A;  4MEM A;  4NPN A;  4OVV A;  3ZLZ A;  4E74 A;  1UD7 A;  5C1Z A;  4AJY B;  3MTN B;  4LJO B;  4XZ4 A;  1G6J A;  2LXA A;  4K81 A;  3IHP C;  4ANX A;  2KTR A;  2UYZ B;  3RT3 B;  2KD0 A;  1WXM A;  1UBI A;  2DAJ A;  2MBE A;  4MJS B;  3A1Q A;  1TTN A;  3T9L A;  4WWN A;  2M1M A;  1TGZ B;  2N9X A;  3QWZ B;  2FCM A;  3I3T B;  3QAQ A;  2XBB C;  2KDF B;  2ZNV C;  4MSQ B;  5D6J B;  2DAF A;  3W1S C;  4ANU A;  3IBE A;  3KUD B;  1VD2 A;  4EZJ A;  4G0N B;  1XT9 B;  3EFU A;  1GC6 A;  2MA9 B;  4W9D A;  1OTR B;  2LI5 A;  5DPT A;  1Z5S B;  2ZZP B;  4I6L B;  2XK5 A;  4KIK B;  3V6C B;  2KHW B;  4NQL B;  3MHS D;  2CHZ A;  1WJN A;  2CS4 A;  1Y8R C;  2ZJD A;  1V49 A;  2IYD B;  3P2B A;  5CX3 A;  5J17 A;  1V6E A;  5J18 A;  3KW5 B;  4A3O A;  2ZVO A;  5EDS A;  3HIZ A;  1V5O A;  4NNJ B;  2A5U A;  3VTW A;  2KDE B;  3HM3 A;  4HCP B;  2V3S A;  5DPS A;  2BYE A;  2G4S A;  2WX1 A;  2C7H A;  3NHE B;  2D2Q A;  2CHX A;  4JL9 A;  3APD A;  4DXA B;  3DVN V;  5L95 C;  1ZW7 A;  3WIM A;  4M8N A;  3L13 A;  4DDI D;  3PZD A;  4FHJ A;  2KTR B;  1WMH A;  2BYF A;  5GMV A;  4HDO A;  3ALB A;  4B95 A;  1NBF C;  4G3X B;  3A1Q B;  3JYU A;  2GBJ A;  1IPG A;  1H4R A;  2K25 A;  2PJH A;  1C1Y B;  4YL8 A;  2M17 A;  2KK8 A;  4WWO A;  2KNB A;  2V4L A;  1FXT B;  3GOE A;  4WWP A;  2L0F A;  5KHO A;  1UBQ A;  2L3Z A;  3EHV A;  3PV1 A;  4FUL A;  1MG8 A;  4FAD A;  3KUZ A;  1Z2M A;  3VUX A;  4JIO U;  3KH0 A;  4KSK C;  2D10 A;  2WYQ A;  1WZ0 A;  3VH3 B;  3R3M A;  2PEA A;  4OVU A;  3LJ3 A;  3N30 A;  3CST A;  5IAA C;  3D32 A;  2FNJ B;  4X57 B;  4K7S A;  2BPS A;  3UQB A;  1KM7 A;  1LXD A;  2L05 A;  3VAW A;  5AEK B;  1LM8 B;  3QCA A;  2ASQ A;  2LUE A;  2FID A;  4ZRI A;  2FCS A;  2JUO A;  2LJ5 A;  2LGD A;  1WMH B;  4B6W A;  1GC7 A;  2AWT A;  2C60 A;  5HKH A;  2Z0D B;  2I1J A;  2IY1 B;  2KC2 A;  2I1K A;  3DPD A;  1WX8 A;  3C0R B;  3ECI A;  1WGH A;  4GXB A;  3SU8 X;  4AUQ C;  4HLE A;  3AU5 A;  4BKT A;  4K7U A;  2JZ3 B;  3DQV A;  3U30 A;  4AP4 C;  5FR6 A;  2JRI B;  2GMI C;  2GOW A;  4MDK E;  3JSV A;  1T0Y A;  1RRB A;  1SIF A;  3KUC B;  3KYD D;  3H9D A;  3UQA A;  1X1M A;  5CTR C;  1L7Y A;  3MJW A;  4RM8 A;  4TKN A;  1E7V A;  2LGX A;  1R4N I;  3HHM A;  2Z59 B;  1P9D U;  2RPQ A;  2R2O A;  2BWE S;  5AZG A;  3VXW A;  1YIW A;  3V60 A;  4GIV A;  2QHO A;  3VUW A;  5G55 A;  2BKR B;  1UZX B;  3ZUN A;  3IFW B;  4HXD A;  2AL3 A;  4IWO A;  1WGD A;  1V81 A;  2N1W A;  4IC7 B;  4JLC A;  2KC1 A;  4PS3 A;  2NVU I;  1Q1O A;  2B3A A;  1EF1 A;  2LD9 A;  2R2Q A;  2KMA A;  4FJY A;  4WAA A;  3UIO B;  3GZN I;  2L7R A;  3DCG A;  1AAR A;  3RD2 A;  2OJR A;  4FJZ A;  4ZDV A;  4TV3 A;  4KZC A;  2ZVN A;  4WJQ A;  3M62 B;  4A3P A;  3JSV B;  1KJT A;  2XEW A;  1KLV A;  4BBN F;  3A4R A;  3PTF C;  4BFR A;  3NY5 A;  3JW0 X;  2LXC A;  4WJN A;  3UF8 A;  1Q0W B;  4WQO B;  3R66 C;  4BBN C;  5LLI A;  4F7Z A;  2OOB B;  4J6I A;  2MX2 A;  3S2A A;  2DYO A;  3OJ3 A;  4W9K A;  4FLH A;  4W9L A;  2REX A;  2Y5B B;  1E5W A;  3WAL A;  2KJR A;  2G3Q B;  4W9C A;  3RUI B;  2KN5 A;  4IW0 A;  5G2N A;  3QC8 B;  4KZ0 A;  1YQB A;  2LVP A;  4HVB A;  1E8W A;  2MBQ A;  1WR1 A;  2YLM A;  2KFJ A;  3L16 A;  3ZO5 B;  3CSF A;  5JZE B;  2O6V A;  1CMX B;  2NPT A;  1EUV B;  1OEY J;  2V1Y A;  3PLU A;  3PRE A;  1PQS A;  1GNU A;  1GG3 A;  3VUY A;  4GDK A;  4BKS A;  2G4D B;  4ICU A;  4GN1 A;  1C3T A;  4DWF A;  3PRZ A;  3DVG Y;  3PGE A;  4FBJ B;  1R4M I;  2EMS A;  4AWJ A;  1OEY A;  1IP9 A;  2NBW B;  2D07 B;  3ZW3 A;  2RSU A;  2ZEQ A;  4W9F A;  3TBL D;  4BKG A;  5J2R A;  2AL6 A;  2C7N B;  1V86 A;  3JVZ X;  4MM3 A;  2KFK A;  4E3C A;  1GJZ A;  1KOT A;  5AZH A;  2BKF A;  1VCB A;  1WY8 A;  1RLF A;  1ZGU B;  2JZZ A;  2KJ6 A;  4G11 A;  3HM6 X;  3TIX A;  4II3 B;  1WGY A;  3PHX B;  1J0G A;  3NOB A;  3L0W B;  1QZE A;  1RFA A;  2JPH A;  5CHV C;  4MEL A;  3VHT C;  3UIP B;  4DHZ B;  2MCN B;  4IWQ A;  1EF5 A;  2PE9 A;  3UIN B;  3VFK A;  3R7Q A;  2DZJ A;  1WGG A;  3ZTD A;  2XK5 B;  2KDI A;  3U8Z A;  4EEW A;  4K7W A;  2NR2 A;  2DZI A;  2K8C A;  3EEC A;  4ANW A;  2EMT A;  2N4F A;  2C9W B;  3AI5 A;  1V2Y A;  3ZDM C;  2FCN A;  3ONS A;  2O6V B;  1NI2 A;  2KO3 A;  2NPT B;  3O65 B;  2IO1 B;  4I6P A;  1WR6 E;  3B0A A;  4XX5 A;  4GDK B;  1YX6 B;  3IVF A;  2CR5 A;  3QK0 A;  2IY0 B;  1JRU A;  4II2 B;  2DYB A;  4ZRK A;  5E6P A;  3ZKJ C;  1M94 A;  2GBN A;  1WM2 A;  1P98 A;  2KAN A;  1ISN A;  3QQ8 B;  2ZCC A;  2KFK B;  2KWU B;  4KDL B;  1XD3 B;  4GB9 A;  2K6Q A;  3V61 A;  4ZYN A;  4NJ6 A;  4W9E A;  4W9H A;  4EZL A;  3APF A;  3ZNI D;  2KMC A;  3DVN U;  1WXV A;  1IYF A;  3ZNH B;  4RMA A;  1Q5W B;  4P7I A;  2KX3 A;  2UWQ A;  5E6O A;  4FA6 A;  4DHJ D;  2K8H A;  2W9N A;  5CHW A;  3A33 B;  1LFD A;  2KOX A;  4MGY E;  1P1A A;  3M95 A;  3QA8 A;  4A20 A;  3RCZ A;  3VQI A;  2M0X A;  1OGW A;  2LZ6 A;  2MWS B;  1L2N A;  4N9F 4;  4NJ7 A;  4IM0 A;  4W9J A;  4F8C B;  2D3G A;  2VRR B;  4CYE A;  3Q3J A;  2MW5 A;  4PYU A;  2O6V D;  2D11 A;  2IZV B;  2LVO A;  2RGF A;  4PS7 A;  1NDD A;  4GOC A;  2IO2 B;  4LDT D;  3T8M A;  4BKS D;  4M0W B;  3VH4 B;  2CKH B;  4ICV A;  2MBH A;  4HCN B;  2GBK A;  5LXI B;  4I6N B;  2JT4 B;  3OJ4 B;  1J8C A;  2DZM A;  3DBH I;  1I42 A;  4TUU A;  2EKE C;  2KXJ A;  1WZ3 A;  2BWF A;  4IWP A;  2K1F A;  4IM2 A;  1EO6 A;  4IM3 A;  2N9P C;  3B1L X;  4FJV B;  1E7U A;  2KTF A;  2KQ7 A;  2JY6 A;  2KX0 A;  2NS5 A;  2K6D B;  3X0W A;  4EUT A;  2BGF A;  2KWC A;  2C7M B;  3RZF A;  4MGZ E;  2N9E B;  3QJZ A;  3Q3F A;  3QHT A;  3TCA A;  3NS8 A;  3X23 A;  2CHW A;  2MBB B;  3V62 A;  3N3K B;  3L10 B;  4KIK A;  3PRP B;  3AU4 A;  2MRP A;  1WF9 A;  2PE6 B;  2K8B A;  1WIA A;  2JVC A;  2JF5 A;  3WAO A;  2JXX A;  4JQW C;  2DZK A;  1WJ6 A;  2C5L C;  2KZR A;  4F1S A;  2CU1 A;  4EZK A;  2A4Z A;  3DBR I;  3WA0 A;  3U7D A;  4LCD E;  4M8M A;  2J7Q B;  4FHK A;  3LDZ E;  2KLC A;  4KVG B;  1WM3 A;  3A9K A;  5IA7 A;  2G45 B;  2LWP A;  2ZNV B;  3ENE A;  4MSM B;  5D7G A;  4B9K A;  4DHZ E;  5D94 A;  1RAX A;  2FUH B;  1YJ1 A;  2HE7 A;  2K39 A;  3NZU A;  4LJP B;  3H7P A;  3EC8 A;  2GBR A;  5LXH A;  2O2V A;  3CF6 E;  1J19 A;  2L00 B;  2PPH A;  3PVL A;  2J0K A;  3ML9 A;  3ZIM A;  3AXC A;  1YD8 U;  1OQY A;  3ML8 A;  2KJH B;  4JGH B;  2Z0E B;  4E71 A;  2HD5 B;  2RR9 A;  2LVQ A;  4HK2 A;  3UGB B;  4EFO A;  2LGY A;  2LRW A;  4XC2 A;  2N1V A;  3ZDT A;  4EOY A;  1WI0 A;  1ZKH A;  3DDC B;  1UEL A;  2ZPY A;  4MH0 E;  3V6E B;  4DBG A;  4W9G A;  3ZTC A;  3TJP A;  3TL5 A;  3BY4 B;  2MBO A;  3SHQ A;  4DHJ B;  2JRH A;  2ZPN A;  3L54 A;  2N7E A;  5DPR A;  2GBM A;  3OLM D;  2KLG A;  4NY0 A;  4WJO A;  3H6N A;  2KWV B;  1P3Q U;  3A9K B;  3H7S A;  2M4N A;  2AEH A;  3CMM B;  2KVR A;  4IG7 B;  4K1R B;  1F9J A;  3QX1 A;  5C23 A;  2YVC A;  3QAR A;  2LAS A;  1P0R A;  2KDB A;  4GSW A;  1UH6 A;  3H7P B;  2IO3 B;  1WRD B;  4AJW A;  2O2V B;  1WJ4 A;  3IG3 A;  4KV2 A;  2HTH A;  4MGI E;  2N7D A;  3M63 B;  4LDT B;  4EKU A;  3ZRF A;  3DVG X;  5JHB A;  1XQQ A;  3L08 A;  4CHK A;  3A4S C;  3WAN A;  3DBS A;  3VTV A;  2WWZ A;  4W9I A;  2ZCB A;  2MSE D;  3KYC D;  5BO4 B;  1WXS A;  4KSL C;  3ZNG C;  4BOZ B;  5AZF A;  2MP2 A;  1WX7 A;  2WX0 A;  1GUA B;  5L83 A;  2IO0 B;  4WJP A;  1I35 A;  1WH3 A;  5E6N A;  1TBE A;  2J0M A;  3B08 A;  2RD0 A;  2J0J A;  2L0T A;  1K8R B;  1WE6 A;  4BOS C;  2FIF A;  2DYM A;  4DDG D;  5DPW A;  1BT0 A;  3L17 A;  3A9J A;  2LRU A;  4GGQ A;  3RZW C;  4ASW C;  4GDL A;  4PYZ A;  2MLB A;  3M3J A;  3ZNZ B;  1WJU A;  2M8S A;  1U4A A;  1SE9 A;  2KQS A;  3PT2 B;  4HDQ A;  3RYT A;  1E8Y A;  3AUL A;  1SGH A;  4HJK A;  4NAW A;  4TQ1 A;  3ZVV A;  4HWI B;  4URK A;  1H8C A;  3DBL I;  3PRM B;  1WYW B;  4PS8 A;  4GMV A;  3H1U A;  3PS6 A;  5CHF A;  3BIN A;  3OAW A;  5JHA A;  4KDI C;  3APC A;  2BF8 B;  2NBU A;  2HJ8 A;  1HE8 A;  3VDZ A;  3K9O B;  3W1S A;  2DX5 B;  1WGR A;  2MP2 B;  3DOW A;  1V5T A;  3ZRC A;  2FCQ A;  1V9J A;  4MGK E;  1LQB A; 
#chains in the Genus database with same CATH topology
 4IUM B;  2MQJ A;  4NZL B;  1DOY A;  3BVM A;  3HK0 A;  1S3S G;  1E8X A;  4OZB A;  2NBV B;  1OFF A;  3WAM A;  5JH5 C;  2BYV E;  2NCN A;  4BVU C;  1V80 A;  1TYG B;  4HPM B;  4C56 C;  1HTO A;  4NAW B;  4TQ0 A;  3ZGZ A;  1NI3 A;  2WDT B;  3PPA A;  5H92 C;  2FAZ A;  3PSE B;  1UGM A;  1V1P B;  3R7R A;  2JWZ A;  4D2K A;  4MEM A;  1XCQ L;  3ZLZ A;  1XEE A;  3SFD B;  2VZK D;  1UD7 A;  3MTN B;  2WDR B;  2LUM A;  1UBI A;  3J9C A;  3T3O A;  4WWN A;  1XLN A;  2N9X A;  3W1S C;  2ZNV C;  3FIL A;  3KUD B;  4G0N B;  4REZ A;  2I38 A;  3EFU A;  4W9D A;  4I6L B;  2IYD B;  3P2B A;  1XF5 L;  1E10 A;  5IN7 A;  5J17 A;  2BQQ A;  4A3O A;  3P63 A;  5EDS A;  1V5O A;  1K53 A;  2A5U A;  2G9H D;  4HCP B;  2V3S A;  3NVZ A;  4WQM A;  4XDD A;  2D2Q A;  2CHX A;  4DXA B;  3APD A;  4FXC A;  4M8N A;  3PO0 A;  3TEX A;  3B2G A;  1XO3 A;  3ALB A;  5EE1 A;  3A1Q B;  4OW0 A;  1H4R A;  2K25 A;  3SEB A;  4WWO A;  1FXT B;  3GS2 A;  5KHO A;  1UBQ A;  1L5P A;  2L3Z A;  3PV1 A;  4FUL A;  1MG8 A;  3VUX A;  3VH3 B;  1ZPS A;  3BYT B;  1PGA A;  4JWU C;  4WIP A;  1LXD A;  3NG0 A;  3P4R B;  2ASQ A;  3NVW A;  2Z0D B;  1JWA D;  1RM6 C;  2N9L A;  2IY1 B;  3DPD A;  4HLE A;  4AP4 C;  2LJI A;  3U30 A;  3JSV A;  5D3I B;  1RRB A;  2IPK D;  1L7Y A;  3MJW A;  2D3C A;  3HHM A;  1R4N I;  1FCL A;  4GIV A;  2BYT A;  3VUW A;  5G55 A;  2RMM A;  1K51 A;  3DHI C;  1WGD A;  4NJC A;  1V81 A;  2N1W A;  4IC7 B;  2IGH A;  3MC9 A;  4PS3 A;  1D4B A;  3DCG A;  3AEB B;  1AAR A;  3RD2 A;  3LYY A;  3AMZ A;  4HJG E;  4KZC A;  2KMM A;  3A4R A;  3NS1 A;  3NY5 A;  1Q0W B;  1FXI A;  3GE8 C;  1JWS D;  1T0R C;  4F7Z A;  4RGN A;  2V9H A;  3OJ3 A;  2Y5B B;  3EFC A;  2KJR A;  1F52 A;  2B76 B;  3RUI B;  2VH2 A;  3QC8 B;  1KFY B;  5I4D A;  2MBQ A;  1YN3 A;  1ROE A;  2O6V A;  1EUV B;  1C77 A;  1GG3 A;  3VUY A;  3B2F A;  3PRZ A;  2EMS A;  4PK1 A;  3C19 A;  4BKG A;  3TBL D;  4ITK A;  2IJ0 A;  1BUI C;  1DGJ A;  4ZRQ A;  1VCB A;  1RLF A;  1WGY A;  3NOB A;  1XLQ A;  3AN1 A;  1QZE A;  3VHT C;  4MEL A;  2PE9 A;  1WGG A;  3ZTD A;  4WAF A;  3U8Z A;  2H88 B;  3EGR A;  4K7W A;  2K5P A;  2K8C A;  4C80 A;  3EEC A;  4ANW A;  3ZDM C;  2FCN A;  1SIJ A;  1HXY D;  3ONS A;  2NPT B;  3B0A A;  4XX5 A;  3IVF A;  1JRU A;  2R61 A;  1M94 A;  2GBN A;  1ISN A;  4MM3 B;  4RH6 A;  4KDL B;  2K6Q A;  2RPV A;  3V61 A;  4W9H A;  1EU3 A;  1L0Y B;  1WXV A;  1Q5W B;  4IDI A;  2VH1 A;  5CHW A;  2W9N A;  2HDE A;  2LHD A;  2KOX A;  1P1A A;  5G5H A;  2FBW B;  4W9J A;  2Y5P A;  4F8C B;  2W3S A;  2D3G A;  4N58 A;  2D11 A;  2MJE A;  2LVO A;  4ZHP A;  2L83 A;  1AW7 A;  3VH4 B;  1KH0 A;  4ICV A;  1QLB B;  4N59 A;  3VRB B;  5LXI B;  1FD6 A;  1FNV A;  1I42 A;  2DZM A;  1WZ3 A;  2BWF A;  4IWP A;  4N6E B;  2N9P C;  1IBX B;  1JWM D;  2KQ7 A;  2XN9 C;  4KGS A;  3RZF A;  2N9E B;  3QJZ A;  2K0P A;  3NS8 A;  3V62 A;  4KIK A;  1MG4 A;  3PRP B;  1E9M A;  4YXD B;  1KTK A;  2E3T A;  4UDU C;  4B0E A;  3WAO A;  2JXX A;  4RF1 A;  2D5G A;  2J7Q B;  3ENE A;  4MSM B;  2BS2 B;  4B9K A;  1RAX A;  4TMA B;  2FUH B;  1YJ1 A;  3NZU A;  2K39 A;  4LJP B;  3EC8 A;  2BT6 A;  4LNF A;  2O2V A;  1J19 A;  2L00 B;  5BMH A;  5BMI A;  1RYJ A;  1ZOY B;  2Z0E B;  1UUP A;  2LVQ A;  3W5V B;  3UGB B;  4EFO A;  2J4X A;  2LGY A;  2NTS A;  4JE3 B;  1ZKH A;  3DDC B;  1F1H A;  3V6E B;  3ZTC A;  3TL5 A;  2MBO A;  2CJO A;  1TY0 A;  2QDF A;  1J7A A;  4C4V B;  1GB4 A;  2WXN A;  3L54 A;  2N7E A;  2KLG A;  1VZ6 A;  4WJO A;  3A9K B;  4RNA A;  3BVZ A;  2KVR A;  4IG7 B;  5C23 A;  3TEW A;  1CZP A;  3H7P B;  1C4A A;  1C9F A;  1WRD B;  1JRO A;  1WJ4 A;  3IG3 A;  2HTH A;  4ARI A;  5JHB A;  4M01 A;  4CHK A;  2IGD A;  2ACZ B;  2ZCB A;  1WXS A;  4ZRP A;  3AEE B;  2WX0 A;  1SBB B;  5L83 A;  1WRI A;  3AV8 A;  2J0M A;  3RN9 C;  1K8R B;  1KF6 B;  3MHZ A;  2FIF A;  2DYM A;  1BT0 A;  3MC0 B;  2GLS A;  5BYS A;  2E6X A;  4ASW C;  3M3J A;  5D3D A;  3IXS A;  1WJU A;  1U4A A;  2QEJ C;  2ONQ A;  4NAW A;  2X8X X;  3DBL I;  3PRM B;  1YN4 A;  4GMV A;  5JHA A;  3OAW A;  2BTE A;  1V1P A;  3APC A;  2HJ8 A;  1QIL A;  3DOW A;  2M56 B;  2FCQ A;  1WXQ A;  3W2D A;  3PLV A;  2WXI A;  2WP9 B;  4ZHO A;  3A9J B;  4NQK E;  1TZ1 A;  4GDL B;  4P16 A;  1MJD A;  1WXA A;  4NAM A;  3AE4 B;  5EE9 A;  2DEN B;  2KKC A;  4GU2 A;  4ANV A;  2DHZ A;  4RM9 A;  1TKE A;  4CO7 A;  4NPN A;  1TS4 A;  4E74 A;  4LJO B;  2N0S B;  2LXA A;  1T0Q C;  2UYZ B;  2JYE A;  1YOV B;  1MVK A;  2MBE A;  3A1Q A;  1F2R C;  1TTN A;  3T9L A;  2FE8 A;  3BYY B;  2FCM A;  3QAQ A;  4ANU A;  2IGG A;  2DAF A;  2AQ2 B;  1VD2 A;  4OVZ A;  4EZJ A;  2MA9 B;  5DPT A;  1OTR B;  2LI5 A;  1Z5S B;  2ZZP B;  4KIK B;  2XK5 A;  3PZ7 A;  1UWX A;  4NQL B;  3MHS D;  1WGK A;  2CS4 A;  2ZJD A;  1FM0 D;  1SE2 A;  4C00 A;  5J18 A;  3KW5 B;  2ZVO A;  4BZA A;  3HIZ A;  2KDE B;  3HM3 A;  2BYE A;  2WX1 A;  3W9C B;  1YQ3 B;  4LNO A;  2KQ4 X;  4B95 A;  3P4P B;  4G3X B;  5IOI A;  3VRA B;  2GBJ A;  4YL8 A;  3GOE A;  1TY2 A;  4BAX A;  4JIO U;  1CQV A;  2BBC A;  2D10 A;  1B9R A;  3DHG C;  2EEL A;  1WZ0 A;  2JSV X;  3R3M A;  3U7Z A;  3CST A;  1B1Z A;  3R2T A;  4DQO C;  2FNJ B;  2PW9 A;  3VAW A;  4HRS A;  2LJ5 A;  2LGD A;  5HFY A;  1WMH B;  4US9 A;  1GC7 A;  4H2A A;  1A70 A;  2C60 A;  5HKH A;  2JYT A;  1NYQ A;  3AEF B;  3UI3 A;  5C3J B;  2KVZ A;  3C0R B;  3SU8 X;  4AUQ C;  2VZK B;  3Q69 A;  4BKT A;  2GMI C;  2GOW A;  1X1M A;  1E7V A;  1QOA A;  4HKZ E;  1JML A;  1P9D U;  5BYQ A;  1K52 A;  3VXW A;  3V60 A;  2Z8L A;  4B0M A;  2G1E A;  3MP9 A;  3AE2 B;  4HXD A;  1VDV A;  3Q2A C;  4JLC A;  1N63 A;  2KC1 A;  5EE3 A;  3P1M A;  2LD9 A;  1ZUD 2;  2R2Q A;  3N9Y C;  2BW2 A;  4WAA A;  3UIO B;  2L7R A;  4FJZ A;  4ZDV A;  5FK9 C;  1KLV A;  4BFR A;  4WJN A;  1YMH E;  2OOB B;  2MX2 A;  3N20 C;  4FLH A;  4LNI A;  1E5W A;  3WAL A;  2G3Q B;  2UU7 A;  2KN5 A;  4IW0 A;  1QOB A;  4KZ0 A;  2LHE A;  1ZP0 B;  2KFJ A;  1DOX A;  3L16 A;  3ZO5 B;  4A90 A;  2W3R A;  3PLU A;  2NPT A;  4MGZ E;  1OQQ A;  1C4P A;  3RNF C;  4L2Y A;  3PGE A;  4RCO A;  4AWJ A;  4FBJ B;  2L52 A;  2NBW B;  2D07 B;  4Q2J A;  2CU3 A;  2C7N B;  2M0A A;  4MM3 A;  1GJZ A;  4E3C A;  1ET6 A;  5AZH A;  1WY8 A;  1ZGU B;  2JZZ A;  1ESF A;  3PZ8 A;  5CHV C;  3UIN B;  4IWQ A;  1VR9 A;  2KN4 A;  3R7Q A;  2XK5 B;  1QKZ A;  4EEW A;  3DBR B;  3W5U B;  4J3O D;  2DZI A;  2C9W B;  3O65 B;  2KO3 A;  2IO1 B;  4I6P A;  1WR6 E;  5C2T B;  1YX6 B;  2IY0 B;  4ZRK A;  3N1Y C;  3U52 E;  3ZKJ C;  1WM2 A;  1I4P A;  2JWU A;  1P98 A;  3QQ8 B;  2DBY A;  1XCT L;  1SE4 A;  1UNS A;  1RFK A;  4NJ6 A;  1SEB D;  3APF A;  2OED A;  2KMC A;  3AED B;  4US8 A;  4P7I A;  1IBX A;  1EWC A;  4TSS A;  4FA6 A;  2KDM A;  4DHJ D;  5G5G A;  4MGY E;  3AE3 B;  1PFD A;  2MWS B;  1L2N A;  4N9F 4;  4IM0 A;  2MW5 A;  1PDX A;  4PYU A;  2IZV B;  4PS7 A;  1NDD A;  4BKS D;  2IO2 B;  3CWI A;  1YJJ A;  2CKH B;  4OZA A;  1GPX A;  2LMC A;  3TEY A;  2JT4 B;  4TUU A;  3HVZ A;  1C78 A;  1WYG A;  2TSS A;  1NEK B;  1E7U A;  4HKQ A;  2JY6 A;  1D5Z C;  2ON8 A;  5IP4 D;  5HHD G;  1SJH D;  1TS3 A;  2JZP A;  2W82 A;  1AYF A;  3U4E G;  2CHW A;  3L10 B;  4XWW A;  2PE6 B;  1XLP A;  4YTN B;  2K8B A;  1P7F A;  2JF5 A;  5HG2 A;  4JQW C;  2KZR A;  1DOI A;  4C4V A;  3HVD A;  4A8X C;  3WA0 A;  3U7D A;  5LNK 1;  4M8M A;  4FHK A;  2KLC A;  4XWT A;  1WM3 A;  3A9K A;  1GB1 A;  4DHZ E;  3WCQ A;  5D94 A;  1C79 A;  3H7P A;  2WXP A;  3ML9 A;  1F77 A;  1YD8 U;  2RDH A;  3AM9 A;  3ML8 A;  1TKY A;  2KJH B;  4JGH B;  4HK2 A;  3KQ4 A;  1UGJ A;  3ZDT A;  1WI0 A;  5IKC M;  1JWB D;  1L0X B;  3BY4 B;  2KWV B;  2YVC A;  3QAR A;  2LGS A;  1P0R A;  4GSW A;  1UH6 A;  2QSD A;  1N5W A;  4IKG A;  3M63 B;  5E6J A;  1XQQ A;  3L08 A;  3A4S C;  1M4V A;  3VTV A;  2WDV B;  2WXK A;  4KX6 B;  3KYC D;  5BO4 B;  2WXF A;  4P1C C;  3B08 A;  2L0T A;  1C76 A;  3L17 A;  2OJW A;  3A9J A;  1E0Z A;  1I7H A;  3RZW C;  3P4Q B;  1NYR A;  4GDL A;  3ZNZ B;  4HJK A;  1E6E B;  1T0S C;  1F2R I;  4URK A;  1WYW B;  4YTM B;  4PS8 A;  4KDI C;  3ZJU A;  4C7Y A;  4RF0 A;  3W1S A;  2DX5 B;  2MP2 B;  1V9J A;  1LQB A;  1E8Z A;  1FMA D;  2L76 A;  4RGO S;  3K9P B;  3VVW B;  4AOF A;  3FC4 A;  2AYO B;  1XXG A;  2I2Y A;  3PHW B;  1I4R A;  3ZQ4 A;  1WFY A;  3I5J C;  1FFU A;  2WDQ B;  3RUL A;  4HPL B;  2IBI B;  4FN2 A;  3WAP A;  3IT6 B;  4R3D A;  5KHQ A;  1L6V A;  1D3Z A;  1TT5 B;  4YSY B;  1WX9 A;  5DCN A;  1YX5 B;  2EKI A;  1LGR A;  5C1Z A;  4AJY B;  1ZDV A;  1N5X A;  1G6J A;  1I4X A;  1P7E A;  3BII D;  1N61 A;  2KD0 A;  2PTL A;  2DAJ A;  2MHJ A;  4MJS B;  2WXH A;  2M1M A;  1TGZ B;  2YEP F;  2KDF B;  1TZO A;  5AUK A;  1I4H A;  3IBE A;  1XT9 B;  4MT5 A;  2PIA A;  3V6C B;  2MH7 A;  2CHZ A;  1Y8R C;  2BB5 A;  1V49 A;  2PKO A;  1V6E A;  1HQR D;  3GZN B;  4YTP B;  2C7H A;  3NHE B;  4JL9 A;  3T3N A;  3DVN V;  5L95 C;  3WIM A;  1K50 A;  3PZD A;  2KTR B;  2PMV A;  4S17 A;  1WMH A;  2BYF A;  2J42 A;  2WXO A;  1N62 A;  3JYU A;  2Y5C A;  1C1Y B;  2W54 A;  2WXR A;  2KK8 A;  3RI7 C;  1FPY A;  4M00 A;  2L0F A;  3EHV A;  3FAH A;  4FAD A;  3KUZ A;  2JU6 X;  1Z2M A;  3KH0 A;  4KSK C;  2WYQ A;  2L32 A;  1RWS A;  2PEA A;  4OVU A;  4K7S A;  2BPS A;  2DWQ A;  1D5X C;  1KM7 A;  4KGT A;  5AEK B;  1LM8 B;  3QCA A;  3NJT A;  2FID A;  4DXG A;  2J52 A;  2J53 A;  4LK0 M;  2AWT A;  3N1Z C;  2V3N A;  5FR3 A;  2V4I B;  2KC2 A;  2I1K A;  1WX8 A;  2CJN A;  1WGH A;  4GXB A;  3AU5 A;  5FR6 A;  1T0Y A;  1I4G A;  3H9D A;  3UQA A;  5CTR C;  5IO9 A;  2K3U A;  4TKN A;  2LGX A;  3AEC B;  2Z59 B;  1PGB A;  1KRH A;  4USA A;  2R2O A;  2BWE S;  5AZG A;  2QHO A;  1XLO A;  2BKR B;  1L4D B;  5T8I A;  2AL3 A;  1TIF A;  3EA6 A;  3HRD D;  2NVU I;  1Q1O A;  2B3A A;  1EF1 A;  2MEK A;  2MJ3 A;  1FRD A;  3B9J A;  3Q6B A;  2ZW0 A;  2OJR A;  1JW9 D;  1L4Z B;  4WJQ A;  3M62 B;  1STE A;  3VR8 B;  1KJT A;  4BBN F;  1EM7 A;  3SR6 A;  4WQO B;  3UF8 A;  2GB1 A;  4BBN C;  3AB5 A;  5LLI A;  4J6I A;  3BVG A;  3S2A A;  2DYO A;  1FEH A;  1SJE D;  4W9K A;  4W9L A;  2REX A;  1HZ6 A;  4W9C A;  1ZXH A;  3DBL B;  3GP7 A;  2WGS A;  4XYC A;  4HVB A;  1E8W A;  1WR1 A;  2YLM A;  4RGT A;  5JZE B;  1GNU A;  3DBH B;  4BKS A;  1F0Z A;  4DWF A;  3Q8B A;  1R4M I;  4YSX B;  4EE2 A;  1OEY A;  1IP9 A;  3ZW3 A;  2RSU A;  4W9F A;  2INC C;  3JVZ X;  3RNA C;  1SXT A;  2X38 A;  1FFV A;  2KJ6 A;  4G11 A;  3TIX A;  2JXT A;  3PHX B;  1J0G A;  2JPH A;  3C8Y A;  1HZ5 A;  4DHZ B;  1JCK B;  2DZJ A;  2QC8 A;  2V0G A;  2OHF A;  2EMT A;  2N4F A;  3AI5 A;  3V05 A;  1V2Y A;  3ZJV A;  1AN8 A;  1CK1 A;  2QIE B;  4GDK B;  2WU2 B;  4II2 B;  2CR5 A;  2DYB A;  2NTT A;  5E6P A;  2BS3 B;  2K9X A;  2KAN A;  2KFK B;  2KWU B;  1QOF A;  1AWD A;  4EZL A;  3ZNI D;  3ZNH B;  1VLB A;  2ICI A;  5E6O A;  3SFE B;  3URY A;  2N7J A;  3A33 B;  1LFD A;  3E9S A;  2WHI A;  3QA8 A;  1GOZ A;  3AEG B;  3RCZ A;  3VQI A;  2DNF A;  2LEK A;  3GE3 C;  2LZ6 A;  1D5M C;  4NJ7 A;  2WQY B;  3Q3J A;  5HI1 A;  3AE6 B;  4LDT D;  3MC8 A;  3T8M A;  4M0W B;  4HCN B;  1OQR A;  1WWT A;  2EKE C;  3Q3M C;  2KTF A;  3TEZ A;  2KX0 A;  4WWM A;  2NS5 A;  3Q3O C;  2BGF A;  3Q3F A;  2INP E;  3N3K B;  1QF6 A;  1QT9 A;  3AU4 A;  1WF9 A;  1WIA A;  2JVC A;  4F1S A;  2C5L C;  2PVG C;  2CU1 A;  4EZK A;  2A4Z A;  3DBR I;  3IT4 B;  2BVC A;  1ET9 A;  4ZOH C;  3LDZ E;  4KVG B;  4HEA 1;  3TSS A;  4S0R A;  2WU5 B;  4P1B C;  3CF6 E;  4K3B A;  1SF0 A;  3ZIM A;  3AXC A;  4E71 A;  2HD5 B;  3Q8E A;  1FXA A;  3ZYY X;  2LRW A;  3RNC C;  3AEA B;  4XC2 A;  3LXF A;  2N1V A;  4HPP A;  4EOY A;  4RGM A;  4MH0 E;  4W9G A;  2MJD A;  3TJP A;  2JX5 A;  3SHQ A;  4DHJ B;  4NY0 A;  1P3Q U;  3CMM B;  3AE1 B;  1F9J A;  2N9K A;  2LAS A;  2KDB A;  5JXV A;  1VJK A;  1L6U A;  4AJW A;  4MGI E;  3ZRF A;  3DVG X;  1VRA B;  3DBS A;  1J7C A;  5AUI A;  1MI0 A;  2MSE D;  4KSL C;  3ZNG C;  2AQ3 B;  1VZ8 A;  4BOZ B;  2MP2 A;  1WX7 A;  3MFG A;  2IO0 B;  1I35 A;  1WH3 A;  1TBE A;  2J0J A;  1WE6 A;  3MJ5 A;  4A6Q A;  1YNT E;  2SAK A;  4IOI E;  4WH4 A;  2WXQ A;  2LRU A;  2QCZ A;  2MLB A;  2WLB A;  3R2I A;  1JRP A;  4HDQ A;  1VZ7 A;  2GI9 A;  3AUL A;  1SGH A;  2FUG 1;  1NVI D;  3HUI A;  4QAY A;  4HWI B;  2WXG A;  4PT5 A;  1V1O A;  1NEN B;  3AE8 B;  3H1U A;  5CHF A;  3BIN A;  1ENF A;  1V8C A;  2BF8 B;  3VDZ A;  4P6V F;  4A9A A;  2BB6 A;  1V5T A;  3ZRC A;  4L1B A;  4MGK E;  1WSP A;  1JAL A;  1TJE A;  2KAJ A;  3VR9 B;  3RNG C;  1A5R A;  4MJS A;  5BMG A;  3N32 A;  2L8J A;  2WNM A;  3W1Y A;  4CQN A;  4AS1 A;  3VTU A;  4ZRJ A;  2AX5 A;  2Y3A A;  3TMP B;  1CJE A;  1S1Q B;  1JQ4 A;  3P4S B;  1WE7 A;  5TR5 A;  4DK5 A;  2HJ1 A;  1E90 A;  3SDL C;  4G50 A;  5D2M B;  3QIJ A;  1BML C;  2DLB A;  3KVF B;  3SD5 A;  3NZS A;  1QQR A;  4OVV A;  4XZ4 A;  1PYW D;  3IHP C;  4K81 A;  4ANX A;  2KTR A;  3RT3 B;  2KT7 A;  1WXM A;  2H89 B;  2YEP B;  2XNA C;  2KAC A;  3AE9 B;  1R4N B;  3QWZ B;  3I3T B;  5D6J B;  5IA7 A;  2XBB C;  4MSQ B;  1J7B A;  1GC6 A;  4EUT A;  2KHW B;  2AQ1 B;  3KWL A;  1WJN A;  5CX3 A;  3ZXV A;  1I4Q A;  4NNJ B;  1LO5 D;  3O13 A;  3VTW A;  4XE0 A;  3BWU D;  5DPS A;  1N60 A;  2G4S A;  2W55 A;  1ZW7 A;  2WXL A;  3DWG C;  4KGR A;  3Q8F A;  3L13 A;  4KKJ A;  4DDI D;  1EWY C;  4FHJ A;  3V3X A;  1SB3 C;  5GMV A;  4HDO A;  1NBF C;  3AH7 A;  2LGI A;  5FKA C;  1IPG A;  2PJH A;  2M17 A;  4JWS C;  1ZXI A;  2RDB C;  2KNB A;  2V4L A;  3FIL B;  3P42 A;  4WWP A;  3RNB C;  1T6B X;  4HRO A;  1SE3 A;  3L4P A;  3LJ3 A;  3N30 A;  3IAM 1;  5IAA C;  3D32 A;  4X57 B;  5H8Y E;  3UQB A;  2L05 A;  4LNN A;  3AE7 B;  2LUE A;  1IGC A;  4ZRI A;  2FCS A;  2JUO A;  2NMQ A;  3I57 A;  2D3A A;  1FNU A;  4B6W A;  4ACF A;  4A55 A;  2I1J A;  3Q14 C;  1ACC A;  3ABV B;  3ECI A;  1FRR A;  4K7U A;  2JZ3 B;  1FNW A;  3DQV A;  2JRI B;  4MDK E;  2QJL A;  1SIF A;  3KUC B;  3KYD D;  3EUB 2;  3KLS X;  1HTQ A;  4RM8 A;  1YQ4 B;  2LFI A;  2RPQ A;  1KLU D;  3TUO A;  3IAS 1;  1Y56 A;  1YIW A;  1V97 A;  3CIR B;  4LLG M;  1UZX B;  3Q8C A;  3ZUN A;  3IFW B;  4IWO A;  4RFB A;  1QOG A;  4LTU A;  2KMA A;  4FJY A;  3GZN I;  1ZDX A;  4TV3 A;  3RNE C;  2ZVN A;  3NUH B;  4A3P A;  3JSV B;  2XEW A;  3PTF C;  3JW0 X;  2LXC A;  2HTM E;  3R66 C;  4XDC A;  1E7P B;  1R7S A;  4LNK A;  5G2N A;  1PGX A;  3BZD B;  1YQB A;  2LVP A;  1UWM A;  2D3B A;  3NZ3 A;  1BXT A;  3CSF A;  1CMX B;  3PRE A;  1OEY J;  2V1Y A;  1PQS A;  3OG5 A;  4GDK A;  2G4D B;  4ICU A;  4GN1 A;  1C3T A;  1ZE3 D;  3DVG Y;  4MAC A;  2ZEQ A;  5J2R A;  2AL6 A;  1V86 A;  2KFK A;  1KOT A;  2BKF A;  3HM6 X;  2WXJ A;  4II3 B;  2SEB D;  3L0W B;  1RFA A;  2PLP A;  3UIP B;  2MCN B;  1EF5 A;  3VFK A;  1YJI A;  4YWG G;  3NVV A;  2KDI A;  2JQR B;  2NR2 A;  1SSN A;  5BYR A;  2O6V B;  1NI2 A;  3QK0 A;  2WS3 B;  4XGA B;  3Q3N C;  1IGD A;  4GLS C;  4K3C A;  4M0W A;  2ZCC A;  1MHX A;  3ZXR A;  1XD3 B;  3KWV A;  4GB9 A;  3FKY A;  4ZYN A;  4W9E A;  1T3Q A;  3DVN U;  3ZJT A;  4MH8 A;  1IYF A;  4RMA A;  2KX3 A;  2UWQ A;  2ZW1 A;  3RMK C;  1FCC C;  2K8H A;  4OZC A;  1MHH E;  4OHJ A;  5EE0 A;  3DWM A;  2GRI A;  3M95 A;  4A20 A;  4ARC A;  2M0X A;  1OGW A;  1JWU D;  2VRR B;  4CYE A;  2O6V D;  2Q5W D;  2RGF A;  2IND C;  4GOC A;  3NRZ A;  1N6Z A;  2MBH A;  4M02 A;  1YN5 A;  2GBK A;  4I6N B;  2QMT A;  3OJ4 B;  2L1A A;  1J8C A;  3DBH I;  2KXJ A;  4KKI A;  2K1F A;  4IM2 A;  1EO6 A;  4IM3 A;  4L23 A;  3B1L X;  4FJV B;  2K6D B;  3X0W A;  3LB8 C;  2KWC A;  2C7M B;  2KYW A;  3QHT A;  3TCA A;  3OWE B;  1MFW A;  2MBB B;  3X23 A;  2M19 A;  5TSS A;  2MRP A;  1KLG D;  2DZK A;  1WJ6 A;  3I63 C;  5GXG B;  4C7Z A;  3BK2 A;  3E56 A;  4LCD E;  2G45 B;  2LWP A;  2ZNV B;  5D7G A;  1HA5 A;  4O1N A;  2HE7 A;  2GBR A;  2RDG A;  3U2S C;  1T5X D;  5LXH A;  3Q8A A;  2PPH A;  2BS4 B;  3PVL A;  2J0K A;  1OQY A;  1FIQ A;  2RR9 A;  2QIL A;  1IUE A;  4WUR A;  3ETR A;  2K22 A;  4JPS A;  1UEL A;  2ZPY A;  3NVY A;  4DBG A;  1GAQ B;  1TS2 A;  3AE5 B;  2JRH A;  2ZPN A;  5DPR A;  2GBM A;  3OLM D;  3H6N A;  4AQ7 A;  2V3P A;  3H7S A;  2M4N A;  2AEH A;  4K1R B;  3QX1 A;  2KWD A;  4DXF A;  1TS5 A;  1MPE A;  2IO3 B;  3N1X C;  2O2V B;  4KV2 A;  1C4C A;  4YSZ B;  2N7D A;  4LDT B;  4EKU A;  4YT0 B;  3WAN A;  2WWZ A;  1PUT A;  4JX1 C;  4W9I A;  1D6E C;  5AZF A;  1GUA B;  4WJP A;  5MPO A;  5E6N A;  3BK1 A;  1HEZ E;  3DHH C;  2RD0 A;  1Q10 A;  4BOS C;  4ZYS A;  4DDG D;  3GB1 A;  5DPW A;  4GGQ A;  1L0V B;  1DYQ A;  3H8H A;  4PYZ A;  1R4M B;  2M8S A;  3RYT A;  1SE9 A;  2KQS A;  3PT2 B;  1E8Y A;  1EU4 A;  2IDY A;  3RPF C;  4TQ1 A;  3R8B A;  3ZVV A;  1H8C A;  1UF0 A;  3PS6 A;  2WXM A;  2NBU A;  1FO4 A;  1HE8 A;  3RFZ B;  3K9O B;  1WGR A;  2INN E;  1TKG A;  3I9V 1;  2PVO D; 
#chains in the Genus database with same CATH homology
 4IUM B;  3PLV A;  1A5R A;  2MQJ A;  1E8Z A;  2L76 A;  4MJS A;  3N32 A;  2L8J A;  3HK0 A;  1S3S G;  1E8X A;  3K9P B;  2NBV B;  3VVW B;  3W1Y A;  4AOF A;  2AYO B;  3WAM A;  3VTU A;  5JH5 C;  4ZRJ A;  2BYV E;  2NCN A;  3A9J B;  3PHW B;  4NQK E;  4BVU C;  3TMP B;  1V80 A;  1TZ1 A;  4GDL B;  1S1Q B;  4HPM B;  1WFY A;  1WE7 A;  5TR5 A;  4DK5 A;  4NAW B;  4TQ0 A;  2WDT B;  3PPA A;  3RUL A;  4HPL B;  1E90 A;  2IBI B;  1WXA A;  4FN2 A;  2FAZ A;  3WAP A;  2DEN B;  2KKC A;  5KHQ A;  3PSE B;  3SDL C;  1UGM A;  4GU2 A;  4ANV A;  4G50 A;  1WX9 A;  2DHZ A;  3QIJ A;  5D2M B;  1D3Z A;  4RM9 A;  3KVF B;  5DCN A;  3R7R A;  3SD5 A;  3NZS A;  4CO7 A;  1YX5 B;  2JWZ A;  4MEM A;  4NPN A;  4OVV A;  3ZLZ A;  4E74 A;  1UD7 A;  5C1Z A;  4AJY B;  3MTN B;  4LJO B;  4XZ4 A;  1G6J A;  2LXA A;  4K81 A;  3IHP C;  4ANX A;  2KTR A;  2UYZ B;  3RT3 B;  2KD0 A;  1WXM A;  1UBI A;  2DAJ A;  2MBE A;  4MJS B;  3A1Q A;  1TTN A;  3T9L A;  4WWN A;  2M1M A;  1TGZ B;  2N9X A;  3QWZ B;  2FCM A;  3I3T B;  3QAQ A;  2XBB C;  2KDF B;  2ZNV C;  4MSQ B;  5D6J B;  2DAF A;  3W1S C;  4ANU A;  3IBE A;  3KUD B;  1VD2 A;  4EZJ A;  4G0N B;  1XT9 B;  3EFU A;  1GC6 A;  2MA9 B;  4W9D A;  1OTR B;  2LI5 A;  5DPT A;  1Z5S B;  2ZZP B;  4I6L B;  2XK5 A;  4KIK B;  3V6C B;  2KHW B;  4NQL B;  3MHS D;  2CHZ A;  1WJN A;  2CS4 A;  1Y8R C;  2ZJD A;  1V49 A;  2IYD B;  3P2B A;  5CX3 A;  5J17 A;  1V6E A;  5J18 A;  3KW5 B;  4A3O A;  2ZVO A;  5EDS A;  3HIZ A;  1V5O A;  4NNJ B;  2A5U A;  3VTW A;  2KDE B;  3HM3 A;  4HCP B;  2V3S A;  5DPS A;  2BYE A;  2G4S A;  2WX1 A;  2C7H A;  3NHE B;  2D2Q A;  2CHX A;  4JL9 A;  3APD A;  4DXA B;  3DVN V;  5L95 C;  1ZW7 A;  3WIM A;  4M8N A;  3L13 A;  4DDI D;  3PZD A;  4FHJ A;  2KTR B;  1WMH A;  2BYF A;  5GMV A;  4HDO A;  3ALB A;  4B95 A;  1NBF C;  4G3X B;  3A1Q B;  3JYU A;  2GBJ A;  1IPG A;  1H4R A;  2K25 A;  2PJH A;  1C1Y B;  4YL8 A;  2M17 A;  2KK8 A;  4WWO A;  2KNB A;  2V4L A;  1FXT B;  3GOE A;  4WWP A;  2L0F A;  5KHO A;  1UBQ A;  2L3Z A;  3EHV A;  3PV1 A;  4FUL A;  1MG8 A;  4FAD A;  3KUZ A;  1Z2M A;  3VUX A;  4JIO U;  3KH0 A;  4KSK C;  2D10 A;  2WYQ A;  1WZ0 A;  3VH3 B;  3R3M A;  2PEA A;  4OVU A;  3LJ3 A;  3N30 A;  3CST A;  5IAA C;  3D32 A;  2FNJ B;  4X57 B;  4K7S A;  2BPS A;  3UQB A;  1KM7 A;  1LXD A;  2L05 A;  3VAW A;  5AEK B;  1LM8 B;  3QCA A;  2ASQ A;  2LUE A;  2FID A;  4ZRI A;  2FCS A;  2JUO A;  2LJ5 A;  2LGD A;  1WMH B;  4B6W A;  1GC7 A;  2AWT A;  2C60 A;  5HKH A;  2Z0D B;  2I1J A;  2IY1 B;  2KC2 A;  2I1K A;  3DPD A;  1WX8 A;  3C0R B;  3ECI A;  1WGH A;  4GXB A;  3SU8 X;  4AUQ C;  4HLE A;  3AU5 A;  4BKT A;  4K7U A;  2JZ3 B;  3DQV A;  3U30 A;  4AP4 C;  5FR6 A;  2JRI B;  2GMI C;  2GOW A;  4MDK E;  3JSV A;  1T0Y A;  1RRB A;  1SIF A;  3KUC B;  3KYD D;  3H9D A;  3UQA A;  1X1M A;  5CTR C;  1L7Y A;  3MJW A;  4RM8 A;  4TKN A;  1E7V A;  2LGX A;  1R4N I;  3HHM A;  2Z59 B;  1P9D U;  2RPQ A;  2R2O A;  2BWE S;  5AZG A;  3VXW A;  1YIW A;  3V60 A;  4GIV A;  2QHO A;  3VUW A;  5G55 A;  2BKR B;  1UZX B;  3ZUN A;  3IFW B;  4HXD A;  2AL3 A;  4IWO A;  1WGD A;  1V81 A;  2N1W A;  4IC7 B;  4JLC A;  2KC1 A;  4PS3 A;  2NVU I;  1Q1O A;  2B3A A;  1EF1 A;  2LD9 A;  2R2Q A;  2KMA A;  4FJY A;  4WAA A;  3UIO B;  3GZN I;  2L7R A;  3DCG A;  1AAR A;  3RD2 A;  2OJR A;  4FJZ A;  4ZDV A;  4TV3 A;  4KZC A;  2ZVN A;  4WJQ A;  3M62 B;  4A3P A;  3JSV B;  1KJT A;  2XEW A;  1KLV A;  4BBN F;  3A4R A;  3PTF C;  4BFR A;  3NY5 A;  3JW0 X;  2LXC A;  4WJN A;  3UF8 A;  1Q0W B;  4WQO B;  3R66 C;  4BBN C;  5LLI A;  4F7Z A;  2OOB B;  4J6I A;  2MX2 A;  3S2A A;  2DYO A;  3OJ3 A;  4W9K A;  4FLH A;  4W9L A;  2REX A;  2Y5B B;  1E5W A;  3WAL A;  2KJR A;  2G3Q B;  4W9C A;  3RUI B;  2KN5 A;  4IW0 A;  5G2N A;  3QC8 B;  4KZ0 A;  1YQB A;  2LVP A;  4HVB A;  1E8W A;  2MBQ A;  1WR1 A;  2YLM A;  2KFJ A;  3L16 A;  3ZO5 B;  3CSF A;  5JZE B;  2O6V A;  1CMX B;  2NPT A;  1EUV B;  1OEY J;  2V1Y A;  3PLU A;  3PRE A;  1PQS A;  1GNU A;  1GG3 A;  3VUY A;  4GDK A;  4BKS A;  2G4D B;  4ICU A;  4GN1 A;  1C3T A;  4DWF A;  3PRZ A;  3DVG Y;  3PGE A;  4FBJ B;  1R4M I;  2EMS A;  4AWJ A;  1OEY A;  1IP9 A;  2NBW B;  2D07 B;  3ZW3 A;  2RSU A;  2ZEQ A;  4W9F A;  3TBL D;  4BKG A;  5J2R A;  2AL6 A;  2C7N B;  1V86 A;  3JVZ X;  4MM3 A;  2KFK A;  4E3C A;  1GJZ A;  1KOT A;  5AZH A;  2BKF A;  1VCB A;  1WY8 A;  1RLF A;  1ZGU B;  2JZZ A;  2KJ6 A;  4G11 A;  3HM6 X;  3TIX A;  4II3 B;  1WGY A;  3PHX B;  1J0G A;  3NOB A;  3L0W B;  1QZE A;  1RFA A;  2JPH A;  5CHV C;  4MEL A;  3VHT C;  3UIP B;  4DHZ B;  2MCN B;  4IWQ A;  1EF5 A;  2PE9 A;  3UIN B;  3VFK A;  3R7Q A;  2DZJ A;  1WGG A;  3ZTD A;  2XK5 B;  2KDI A;  3U8Z A;  4EEW A;  4K7W A;  2NR2 A;  2DZI A;  2K8C A;  3EEC A;  4ANW A;  2EMT A;  2N4F A;  2C9W B;  3AI5 A;  1V2Y A;  3ZDM C;  2FCN A;  3ONS A;  2O6V B;  1NI2 A;  2KO3 A;  2NPT B;  3O65 B;  2IO1 B;  4I6P A;  1WR6 E;  3B0A A;  4XX5 A;  4GDK B;  1YX6 B;  3IVF A;  2CR5 A;  3QK0 A;  2IY0 B;  1JRU A;  4II2 B;  2DYB A;  4ZRK A;  5E6P A;  3ZKJ C;  1M94 A;  2GBN A;  1WM2 A;  1P98 A;  2KAN A;  1ISN A;  3QQ8 B;  2ZCC A;  2KFK B;  2KWU B;  4KDL B;  1XD3 B;  4GB9 A;  2K6Q A;  3V61 A;  4ZYN A;  4NJ6 A;  4W9E A;  4W9H A;  4EZL A;  3APF A;  3ZNI D;  2KMC A;  3DVN U;  1WXV A;  1IYF A;  3ZNH B;  4RMA A;  1Q5W B;  4P7I A;  2KX3 A;  2UWQ A;  5E6O A;  4FA6 A;  4DHJ D;  2K8H A;  2W9N A;  5CHW A;  3A33 B;  1LFD A;  2KOX A;  4MGY E;  1P1A A;  3M95 A;  3QA8 A;  4A20 A;  3RCZ A;  3VQI A;  2M0X A;  1OGW A;  2LZ6 A;  2MWS B;  1L2N A;  4N9F 4;  4NJ7 A;  4IM0 A;  4W9J A;  4F8C B;  2D3G A;  2VRR B;  4CYE A;  3Q3J A;  2MW5 A;  4PYU A;  2O6V D;  2D11 A;  2IZV B;  2LVO A;  2RGF A;  4PS7 A;  1NDD A;  4GOC A;  2IO2 B;  4LDT D;  3T8M A;  4BKS D;  4M0W B;  3VH4 B;  2CKH B;  4ICV A;  2MBH A;  4HCN B;  2GBK A;  5LXI B;  4I6N B;  2JT4 B;  3OJ4 B;  1J8C A;  2DZM A;  3DBH I;  1I42 A;  4TUU A;  2EKE C;  2KXJ A;  1WZ3 A;  2BWF A;  4IWP A;  2K1F A;  4IM2 A;  1EO6 A;  4IM3 A;  2N9P C;  3B1L X;  4FJV B;  1E7U A;  2KTF A;  2KQ7 A;  2JY6 A;  2KX0 A;  2NS5 A;  2K6D B;  3X0W A;  4EUT A;  2BGF A;  2KWC A;  2C7M B;  3RZF A;  4MGZ E;  2N9E B;  3QJZ A;  3Q3F A;  3QHT A;  3TCA A;  3NS8 A;  3X23 A;  2CHW A;  2MBB B;  3V62 A;  3N3K B;  3L10 B;  4KIK A;  3PRP B;  3AU4 A;  2MRP A;  1WF9 A;  2PE6 B;  2K8B A;  1WIA A;  2JVC A;  2JF5 A;  3WAO A;  2JXX A;  4JQW C;  2DZK A;  1WJ6 A;  2C5L C;  2KZR A;  4F1S A;  2CU1 A;  4EZK A;  2A4Z A;  3DBR I;  3WA0 A;  3U7D A;  4LCD E;  4M8M A;  2J7Q B;  4FHK A;  3LDZ E;  2KLC A;  4KVG B;  1WM3 A;  3A9K A;  5IA7 A;  2G45 B;  2LWP A;  2ZNV B;  3ENE A;  4MSM B;  5D7G A;  4B9K A;  4DHZ E;  5D94 A;  1RAX A;  2FUH B;  1YJ1 A;  2HE7 A;  2K39 A;  3NZU A;  4LJP B;  3H7P A;  3EC8 A;  2GBR A;  5LXH A;  2O2V A;  3CF6 E;  1J19 A;  2L00 B;  2PPH A;  3PVL A;  2J0K A;  3ML9 A;  3ZIM A;  3AXC A;  1YD8 U;  1OQY A;  3ML8 A;  2KJH B;  4JGH B;  2Z0E B;  4E71 A;  2HD5 B;  2RR9 A;  2LVQ A;  4HK2 A;  3UGB B;  4EFO A;  2LGY A;  2LRW A;  4XC2 A;  2N1V A;  3ZDT A;  4EOY A;  1WI0 A;  1ZKH A;  3DDC B;  1UEL A;  2ZPY A;  4MH0 E;  3V6E B;  4DBG A;  4W9G A;  3ZTC A;  3TJP A;  3TL5 A;  3BY4 B;  2MBO A;  3SHQ A;  4DHJ B;  2JRH A;  2ZPN A;  3L54 A;  2N7E A;  5DPR A;  2GBM A;  3OLM D;  2KLG A;  4NY0 A;  4WJO A;  3H6N A;  2KWV B;  1P3Q U;  3A9K B;  3H7S A;  2M4N A;  2AEH A;  3CMM B;  2KVR A;  4IG7 B;  4K1R B;  1F9J A;  3QX1 A;  5C23 A;  2YVC A;  3QAR A;  2LAS A;  1P0R A;  2KDB A;  4GSW A;  1UH6 A;  3H7P B;  2IO3 B;  1WRD B;  4AJW A;  2O2V B;  1WJ4 A;  3IG3 A;  4KV2 A;  2HTH A;  4MGI E;  2N7D A;  3M63 B;  4LDT B;  4EKU A;  3ZRF A;  3DVG X;  5JHB A;  1XQQ A;  3L08 A;  4CHK A;  3A4S C;  3WAN A;  3DBS A;  3VTV A;  2WWZ A;  4W9I A;  2ZCB A;  2MSE D;  3KYC D;  5BO4 B;  1WXS A;  4KSL C;  3ZNG C;  4BOZ B;  5AZF A;  2MP2 A;  1WX7 A;  2WX0 A;  1GUA B;  5L83 A;  2IO0 B;  4WJP A;  1I35 A;  1WH3 A;  5E6N A;  1TBE A;  2J0M A;  3B08 A;  2RD0 A;  2J0J A;  2L0T A;  1K8R B;  1WE6 A;  4BOS C;  2FIF A;  2DYM A;  4DDG D;  5DPW A;  1BT0 A;  3L17 A;  3A9J A;  2LRU A;  4GGQ A;  3RZW C;  4ASW C;  4GDL A;  4PYZ A;  2MLB A;  3M3J A;  3ZNZ B;  1WJU A;  2M8S A;  1U4A A;  1SE9 A;  2KQS A;  3PT2 B;  4HDQ A;  3RYT A;  1E8Y A;  3AUL A;  1SGH A;  4HJK A;  4NAW A;  4TQ1 A;  3ZVV A;  4HWI B;  4URK A;  1H8C A;  3DBL I;  3PRM B;  1WYW B;  4PS8 A;  4GMV A;  3H1U A;  3PS6 A;  5CHF A;  3BIN A;  3OAW A;  5JHA A;  4KDI C;  3APC A;  2BF8 B;  2NBU A;  2HJ8 A;  1HE8 A;  3VDZ A;  3K9O B;  3W1S A;  2DX5 B;  1WGR A;  2MP2 B;  3DOW A;  1V5T A;  3ZRC A;  2FCQ A;  1V9J A;  4MGK E;  1LQB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...