3ZLZA

Lys6-linked tri-ubiquitin
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
73
structure length
73
Chain Sequence
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGRQLEDGRTLSDYNIQKESTLHLVLRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUITIN
publication title Assembly, Analysis and Architecture of Atypical Ubiquitin Chains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 18
structure length 73
sequence length 73
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3zlzA00
3S2AA 4MGKE 1V86A 3GZNI 2FUHB 3N3KB 1H4RA 2K8CA 4ICVA 1E8WA 1WYWB 4KDIC 4WWPA 1H8CA 4DBGA 4MJSA 3EFUA 4JGHB 3A1QA 2MP2A 4DXAB 2MBBB 3EC8A 3PVLA 4PYZA 2VRRB 2PPHA 4FJZA 4AP4C 5JHBA 3V60A 4DWFA 4HPLB 2WWZA 2Z0EB 5CHVC 4DHJD 4E71A 1UBIA 2ZCBA 3DPDA 2L0TA 2HTHA 2KMCA 2LRUA 3JW0X 3QAQA 4GDLA 5J17A 2BPSA 3HIZA 2YLMA 3UF8A 1L2NA 2MWSB 4F8CB 3P2BA 2IO0B 1ISNA 2DYMA 2HJ8A 2IZVB 4CO7A 1WR6E 1IYFA 3NS8A 2C7MB 1M94A 3V6CB 3HM3A 4BOZB 2M4NA 4HVBA 4FADA 1WXAA 2XK5B 3ZTDA 4NY0A 3HHMA 3PTFC 2ASQA 2J0KA 4F7ZA 2A4ZA 2K8BA 3WAMA 3ZDTA 2OOBB 1Z5SB 1E8XA 2K6QA 4AJWA 1GC7A 1WI0A 3N32A 4KIKB 4LCDE 3A1QB 2MP2B 3QC8B 4KSKC 5CHWA 3UQBA 3A33B 3DDCB 1G6JA 2ZPNA 4W9IA 2K8HA 1UBQA 3VFKA 4FBJB 3NZUA 3R7QA 5AEKB 2K1FA 4URKA 2AL3A 4LDTD 1Q0WB 3DBSA 4ANWA 1BT0A 4EOYA 1TZ1A 3SD5A 4CHKA 3KVFB 4MSQB 2C7NB 3Q3FA 2NPTB 1WJ6A 2PE9A 2AYOB 3ZKJC 4BFRA 3A9KB 2NS5A 1WGDA 4HK2A 3UQAA 3BINA 1WXVA 4W9FA 3DBLI 2KFKB 2JRHA 4RMAA 3RULA 2D10A 2M1MA 3KUZA 4G3XB 2KX3A 4WAAA 4HDOA 3R3MA 2KQSA 2JXXA 4G50A 1VD2A 2WX1A 2IO2B 4K1RB 4DDGD 2BYVE 2JZZA 1YX6B 2MA9B 3L17A 2D07B 2FIDA 2KTRA 2LI5A 2KO3A 2N7DA 4KZ0A 3PLUA 2N9PC 1V5OA 1YD8U 5LXHA 5KHQA 2IO1B 3ZIMA 2PE6B 3I3TB 3A4RA 2MQJA 2JRIB 1CMXB 1WM3A 5AZGA 4GOCA 4BKSD 4W9GA 4NQLB 5IA7A 3IVFA 2BYFA 1WE7A 3EECA 3D32A 3C0RB 1PQSA 1WX8A 1R4NI 2XEWA 2KC2A 2NBVB 4KVGB 1KJTA 3VDZA 4JLCA 3PT2B 1WIAA 3QIJA 1WMHB 3VUWA 5C23A 3B1LX 4GDKA 4ICUA 3QHTA 2JPHA 3PRPB 4KV2A 5D2MB 3OJ3A 1C3TA 4JL9A 2LXAA 2Z0DB 3WALA 1NI2A 2CHXA 1AARA 4J6IA 1E90A 4KZCA 3QA8A 2DYOA 4FULA 2IO3B 2MLBA 3DBHI 1XT9B 4BVUC 4FJVB 3VTUA 5AZFA 2UYZB 2ZJDA 1EO6A 3PS6A 3IG3A 4RM8A 3PV1A 2FCQA 2J0JA 2NBUA 4XZ4A 2BKRB 2GBMA 3LDZE 4IG7B 1P3QU 2Y5BB 1LQBA 4RM9A 4IC7B 2XK5A 3EHVA 2ZVNA 1X1MA 3M62B 5JHAA 4HPMB 1GJZA 2LGXA 1Z2MA 1WGYA 2BGFA 3VXWA 3KW5B 2O6VA 2DYBA 2ZNVB 4K7WA 4M0WB 2JZ3B 4ZYNA 4F1SA 5LXIB 1KLVA 2KX0A 3DCGA 1WXSA 4OVVA 4W9KA 4BOSC 2CU1A 4FJYA 4KIKA 2QHOA 3GOEA 3L54A 3ZLZA 4IWQA 4AOFA 3V61A 1YIWA 2FCMA 1KOTA 1RFAA 4PS8A 3IBEA 3W1SA 2KANA 2LVPA 3VUYA 5LLIA 3IFWB 4JQWC 2L3ZA 2KOXA 4GDKB 3O65B 3SU8X 2GBKA 1GUAB 1OGWA 1LXDA 1WH3A 4MH0E 1P1AA 2NR2A 2ZZPB 4HJKA 1Y8RC 5E6NA 1E8YA 3RD2A 4OVUA 3B0AA 2RPQA 3VTWA 3KUCB 5J18A 2LVOA 1J8CA 4N9F4 4ZRJA 3OJ4B 3WA0A 3VQIA 2MCNB 2KK8A 4EEWA 2KKCA 1TBEA 2NPTA 4K7UA 3A9KA 3MJWA 5D7GA 4GIVA 1FXTB 1WJNA 3OAWA 2KFKA 3DVNV 1HE8A 2WYQA 2KC1A 2C5LC 1SGHA 3H7PB 4BBNC 2MSED 3DVGX 4AJYB 4B9KA 1WY8A 1IP9A 2FCNA 2FNJB 4JIOU 1E8ZA 4ZRKA 3A4SC 2KN5A 4DHJB 2O6VB 4X57B 4NQKE 1R4MI 1V2YA 1WF9A 3A9JB 1K8RB 2L00B 3MHSD 2NCNA 4K7SA 4G0NB 2JVCA 1E7UA 3PRZA 3IHPC 2AL6A 2KDBA 5KHOA 4NJ6A 2M8SA 3DBRI 1JRUA 2LXCA 3QX1A 2KJRA 3W1SC 4DK5A 2N1VA 4AWJA 1YJ1A 2MBEA 4YL8A 4ANXA 1XD3B 3KH0A 1OTRB 2G45B 2BF8B 2LVQA 1YQBA 1EUVB 3RZFA 3ML8A 4NJ7A 3VTVA 1WX9A 3ZDMC 2GBNA 1WMHA 1S1QB 1A5RA 1NDDA 1P0RA 3HM6X 3ZO5B 5CHFA 2LGYA 2KDEB 3PHWB 4FN2A 3UIPB 2KZRA 3PRMB 5DPTA 2KLCA 2N7EA 4IUMB 2AWTA 4MDKE 4GSWA 3ZRCA 3ZTCA 3QJZA 4IM0A 4WWNA 3CMMB 4PYUA 3PPAA 2C60A 4GN1A 4NAWA 1TGZB 3M63B 3TL5A 5JH5C 2IY0B 1E7VA 4IWOA 2KHWB 5G2NA 3APDA 2LJ5A 2MBHA 3Q3JA 2G4DB 2IBIB 4LDTB 5D6JB 2MX2A 3ONSA 5IAAC 2FIFA 1E5WA 3U8ZA 1I42A 1F9JA 4DDID 2GMIC 3L13A 3UGBB 4MGYE 4E3CA 2EMSA 4BKTA 3AI5A 4W9JA 3OLMD 2L7RA 3QARA 2BWES 3L0WB 3PZDA 4A3OA 1D3ZA 5J2RA 1GNUA 1WX7A 1WGRA 3BY4B 2YVCA 5BO4B 4TV3A 2L05A 2W9NA 4TQ0A 4ANUA 5E6PA 5CTRC 2LUEA 2CR5A 3AU4A 3ZRFA 2REXA 1C1YB 3ENEA 3WIMA 5HKHA 4EUTA 2R2OA 2V1YA 3H7SA 3H6NA 4EZKA 4II2B 2ZPYA 4NPNA 2L76A 2RGFA 3ALBA 1WFYA 4W9HA 4NAWB 3TBLD 2KJ6A 2B3AA 1V9JA 4BKGA 3QQ8B 2DZKA 2EMTA 4LJOB 3TMPB 1VCBA 3SDLC 2KNBA 4FHKA 3H7PA 2JUOA 1V80A 3CSFA 3DOWA 1V49A 3R7RA 2KXJA 5TR5A 2IY1B 3AU5A 3CF6E 3JVZX 1ZW7A 2KMAA 4GB9A 3T9LA 4MGIE 4LJPB 1XQQA 2DX5B 5FR6A 3L16A 4MM3A 3A9JA 3X23A 1WZ0A 3PHXB 2JWZA 3U7DA 5G55A 2J7QB 3T8MA 3VAWA 4GGQA 5D94A 2K39A 4TQ1A 3PREA 1RLFA 2UWQA 3ZUNA 3TJPA 3AXCA 1SE9A 1IPGA 4WQOB 3KYDD 5DPWA 2O2VB 1WRDB 4W9EA 4P7IA 3V62A 4HCPB 1U4AA 3DVGY 4XC2A 2KWVB 4MELA 2N9EB 5DPRA 2BKFA 4DHZB 3L08A 5EDSA 1V6EA 1GC6A 2K6DB 2NVUI 3DVNU 3KYCD 3ZNHB 1OEYJ 3WANA 3ECIA 3ZNZB 1NBFC 4HLEA 4I6NB 3VH3B 4XX5A 3R66C 2I1KA 2KDIA 4ANVA 2O6VD 1EF5A 1UD7A 4WJQA 1UZXB 5L83A 3VH4B 2PEAA 4EZLA 2RR9A 4PS3A 3JSVB 3HK0A 3PSEB 2MRPA 2N9XA 3APFA 1P9DU 3APCA 1WGGA 3DQVA 4HXDA 2BYEA 2CHZA 1Q1OA 2KTFA 2R2QA 4KDLB 5C1ZA 2MBQA 3RUIB 3QK0A 4IM2A 2WX0A 1P98A 1T0YA 2KDFB 3VHTC 1UH6A 2KWCA 1TTNA 1V5TA 2D2QA 2M0XA 5AZHA 2GOWA 3ZNID 4ASWC 4WJNA 1WJUA 1UELA 4IM3A 2AEHA 4EKUA 4M8MA 2FAZA 3RCZA 3KUDB 2JF5A 3UINB 4MJSB 1WXMA 2DAFA 2DZMA 4WJPA 3RT3B 2I1JA 3NY5A 1J19A 1QZEA 2KD0A 2LRWA 2C9WB 3LJ3A 2CKHB 3RYTA 3PGEA 3U30A 2KWUB 2OJRA 4FLHA 4GMVA 2D3GA 4BKSA 1WGHA 3X0WA 3QWZB 2KJHB 1LM8B 2DZIA 3N30A 1L7YA 4GDLB 3B08A 5E6OA 1SIFA 3JYUA 5DCNA 2KFJA 4I6PA 2XBBC 2N4FA 3ZW3A 4ZDVA 2RSUA 4W9DA 4DHZE 5DPSA 4EZJA 3WAOA 2MW5A 4MEMA 3NZSA 2GBJA 3SHQA 2LZ6A 4W9LA 3K9PB 2LWPA 3VVWB 2D11A 1OEYA 2LASA 1I35A 2BWFA 1ZKHA 1V81A 2IYDB 4TKNA 5GMVA 4A3PA 4K81A 1WM2A 2ZVOA 2KLGA 1UGMA 4CYEA 4B95A 4I6LB 4ZRIA 1S3SG 2JY6A 4HCNB 3ZVVA 2G4SA 2M17A 3AULA 3M95A 3UIOB 2L0FA 4WWOA 3V6EB 2O2VA 4A20A 3CSTA 4IWPA 4EFOA 4IW0A 2FCSA 3NHEB 4HDQA 2JT4B 1LFDA 2LD9A 2RD0A 3M3JA 4PS7A 4WJOA 4BBNF 1RAXA 2ZCCA 2V4LA 3QCAA 5JZEB 4TUUA 2Z59B 1Q5WB 4W9CA 4B6WA 4FA6A 2DZJA 4GU2A 1WJ4A 1WE6A 2KQ7A 4AUQC 3NOBA 1GG3A 1ZGUB 2MBOA 3WAPA 2PJHA 2DAJA 1RRBA 1J0GA 2L8JA 4KSLC 1WR1A 2EKEC 3RZWC 4E74A 2HD5B 3L10B 2V3SA 1OQYA 1MG8A 1YX5B 4NNJB 4HWIB 2KVRA 3JSVA 3ML9A 3TCAA 2G3QB 2KTRB 2ZNVC 2HE7A 3TIXA 4II3B 1WZ3A 4GXBA 3VUXA 5L95C 2CHWA 2DHZA 4FHJA 4G11A 2J0MA 4M8NA 3H9DA 4MSMB 5CX3A 3W1YA 3ZNGC 3H1UA 1KM7A 3PLVA 2ZEQA 2LGDA 2N1WA 2WDTB 2K25A 3MTNB 2NBWB 1EF1A 3K9OB 2C7HA 2A5UA 2CS4A 2GBRA 4MGZE 2DENB
chains in the Genus database with same CATH superfamily
1L5PA 4MGKE 2FUHB 2LEKA 1E8WA 4KDIC 2WXKA 1QT9A 3A1QA 4DXAB 3PVLA 2HDEA 2VRRB 4AP4C 5JHBA 3V60A 5CHVC 4C00A 2ZCBA 2LRUA 3QAQA 5J17A 3RNCC 3HIZA 2YLMA 4P16A 3UF8A 4F8CB 1FM0D 3P2BA 1N6ZA 3AMZA 1YOVB 2IZVB 2GRIA 1IYFA 5AUIA 4DQOC 1OQQA 1M94A 1QOFA 3HHMA 3PTFC 3GE3C 2J0KA 1CK1A 2K9XA 1Z5SB 3BZDB 1GC7A 5CHWA 3UQBA 2K5PA 2ZPNA 2M56B 5IKCM 2K8HA 3VFKA 3NZUA 2AL3A 3DBSA 4LK0M 3PZ8A 2V0GA 4MSQB 2INPE 3TEYA 3A9KB 2NS5A 3BIID 3BINA 3RULA 2M1MA 5AUKA 4WAAA 3W5VB 4G50A 2KQSA 2JXXA 1OQRA 1WRIA 1VRAB 2JZZA 1YX6B 2MA9B 1NYRA 2FIDA 2QSDA 1YD8U 5KHQA 2I38A 4WAFA 3ZIMA 5AZGA 2JSVX 1GAQB 1T0SC 3EECA 4YT0B 3D32A 1NENB 3C0RB 1PQSA 1WGKA 1ZOYB 5E6JA 1KJTA 4JLCA 3PT2B 1WIAA 3QIJA 2AQ1B 2WDQB 1C3TA 2QIEB 3PRPB 2W3SA 3OJ3A 4JL9A 2LXAA 2Z0DB 1AARA 1XLNA 4FULA 4K3BA 1NEKB 2IDYA 2MHJA 1OFFA 2BBCA 5IN7A 3PV1A 2NBUA 1P7FA 3R8BA 1P3QU 2JYEA 3URYA 4IC7B 4JWUC 1X1MA 3M62B 5MPOA 4XDCA 3NVWA 2K3UA 4K7WA 1D4BA 2FUG1 1I4RA 2KX0A 3DCGA 3DWMA 4BOSC 4L23A 1ZPSA 2QHOA 4A8XC 3W1SA 4GDKB 2KOXA 3SU8X 2GBKA 1LXDA 4ARCA 1JRPA 5E6NA 3B0AA 3RNGC 2JQRB 3A9KA 4GIVA 3OAWA 2WYQA 3AEBB 2J4XA 1R4NB 4B9KA 2FCNA 1SBBB 4WH4A 4DHJB 2LHEA 1C4CA 1QOGA 3SFEB 2BW2A 3PRZA 3IHPC 2AL6A 1V97A 1HTQA 3ZXVA 1JRUA 2WXFA 4R3DA 5D3DA 2K0PA 2WLBA 1K53A 1WX9A 4L1BA 2LGSA 3BYYB 4YSXB 1UUPA 5CHFA 3EFCA 3PHWB 1RYJA 3PRMB 4N59A 5DPTA 2N7EA 3ZRCA 2WS3B 4PYUA 4NAWA 1YQ3B 4IWOA 1QF6A 4LDTB 2MX2A 1F9JA 4H2AA 3ZJTA 3OLMD 2LGIA 2L7RA 5EE3A 3PZDA 5IOIA 1UNSA 3KLSX 4MH8A 1LO5D 5E6PA 1TT5B 2WXHA 2M19A 2REXA 3WIMA 3H6NA 1Y56A 4W9HA 3RNFC 2KJ6A 1V9JA 3Q6BA 2EMTA 4P6VF 2B76B 3N1ZC 3R7RA 3AB5A 3HVZA 4GB9A 1FNVA 4MGIE 3Q8CA 2DX5B 3L16A 4MM3A 1PGBA 4EE2A 1KLGD 1UF0A 1EM7A 3AE9B 3ZUNA 1TIFA 5DPWA 2O2VB 1ET9A 5FKAC 3V62A 2RMMA 1D6EC 4DHZB 4QAYA 1GC6A 4XWWA 1OEYJ 3ZNZB 1T3QA 3DHGC 4XX5A 2I1KA 2WXJA 4ANVA 2O6VD 2QJLA 1VLBA 4UDUC 2RDBC 2N9XA 1P9DU 1WGGA 3DQVA 1XO3A 1DOIA 4KDLB 3C19A 2KWCA 1TS2A 2M0XA 2GOWA 4ASWC 4LTUA 3TSSA 4EKUA 2ONQA 1SJHD 4S17A 4C7YA 2JF5A 4IKGA 1WXMA 4WJPA 2K22A 1J19A 2KD0A 2LRWA 3U30A 3QWZB 1L7YA 3B08A 5E6OA 1SIFA 3JYUA 5DCNA 3DHIC 4I6PA 1IGCA 1BMLC 2Y5CA 4LNKA 4W9DA 1L6UA 4GLSC 3B2GA 1N5WA 2GBJA 3SHQA 2G9HD 4RH6A 4W9LA 4BZAA 2D11A 2LASA 1ZKHA 2IYDB 4A3PA 2KQ4X 4K81A 2ZVOA 2KLGA 3VR8B 4ZRIA 2JY6A 3I9V1 1F2RI 1UWMA 3LYYA 5BYQA 4HROA 3M95A 3UIOB 2L0FA 2O2VA 5HI1A 4A20A 3NHEB 3FILB 2RD0A 2LD9A 3TEXA 1RAXA 4TMAB 2ZCCA 4P1BC 4JWSC 4B6WA 3NOBA 2L52A 3AEAB 2MBOA 2GLSA 2DAJA 3FC4A 1WR1A 1JWAD 1YX5B 1FFUA 1TKGA 2KTRB 3IT6B 2HE7A 1WZ3A 4GXBA 2IGGA 5L95C 2CHWA 1VDVA 3W1YA 3H1UA 4TSSA 2MH7A 3J9CA 2SAKA 2NBWB 2Z8LA 3K9OB 3AECB 2A5UA 2CS4A 4OW0A 1UGJA 2K8CA 4ICVA 4WURA 1DOYA 1L0VB 1L6VA 1WYWB 4WWPA 1H8CA 1KTKA 3EFUA 4JGHB 2MP2A 3EC8A 5FR3A 2PPHA 4FJZA 1FCCC 3TEZA 2Z0EB 4E71A 3DPDA 2JU6X 2BPSA 4NAMA 2JX5A 2MWSB 2H89B 1ISNA 1JWUD 4M00A 1F2RC 1WR6E 3RI7C 2ZW0A 2C7MB 1PDXA 4CQNA 3AE8B 2W82A 4P1CC 3O13A 1C4AA 3WAMA 1ZE3D 2K6QA 2XN9C 2INDC 4LCDE 3A1QB 3HVDA 2WXMA 2PLPA 2Q5WD 4M01A 4FBJB 2INNE 3RMKC 3R7QA 5AEKB 4OZAA 1WXQA 3FILA 1YN3A 1BT0A 4KGSA 3Q3FA 2PE9A 2AYOB 3ZKJC 1JROA 3DBLI 2JRHA 3R3MA 1K52A 2WX1A 4DDGD 4YSZB 2D07B 1C77A 2KTRA 1ACCA 1T6BX 1V5OA 2IO1B 2WU5B 2BVCA 2JRIB 2OHFA 5IA7A 1TY0A 5GXGB 3BYTB 2WXLA 3Q14C 4KVGB 3VDZA 2FBWB 3W9CB 2JPHA 5D2MB 1HZ5A 1NI2A 4J6IA 3QA8A 2PVGC 3AN1A 2WU2B 2IO3B 2MLBA 3GE8C 5D3IB 4KKJA 5AZFA 2UYZB 1MHHE 4RM8A 1V8CA 4HPPA 2WXQA 4US8A 2BKRB 4IG7B 2WQYB 1ZUD2 3LXFA 2ZVNA 5JHAA 4YTMB 2DYBA 2JZ3B 2IGHA 3VRBB 4W9KA 3GOEA 3L54A 1KOTA 2X8XX 1HTOA 3IBEA 2KANA 3IFWB 4JQWC 2L3ZA 1E0ZA 1GUAB 4XGAB 1WH3A 2NR2A 2ZZPB 2RPQA 4LNIA 3KUCB 3VTWA 2KDMA 4N9F4 1QOBA 3OJ4B 1M4VA 3VQIA 2MCNB 2KKCA 5HHDG 4K7UA 1SE4A 3MJWA 1FXTB 3DVNV 4L2YA 1SJED 1ET6A 1SGHA 2MSED 3DVGX 1AW7A 2ZW1A 4ZRQA 2OJWA 4ZRKA 3A4SC 1R4MI 1V2YA 1WF9A 2V9HA 3A9JB 1ZDVA 2L00B 3MHSD 1HEZE 4KGRA 1MHXA 2CU3A 3P63A 2M8SA 3DBRI 2KJRA 4AWJA 1C78A 2MBEA 4ANXA 1XD3B 3KH0A 2BF8B 1YMHE 1XLPA 4RGTA 3ZDMC 2WXPA 3Q8EA 1XEEA 2VH1A 3BVZA 3UIPB 2KZRA 4IM0A 2L1AA 3CMMB 2D3AA 2QEJC 1E7VA 2E6XA 3RNAC 3Q3JA 1TY2A 2G4DB 2IBIB 4EOYA 3ONSA 3AE5B 3RNBC 1TJEA 3UGBB 4MGYE 4BKTA 3AI5A 2J42A 2BTEA 3C8YA 2EKIA 1D3ZA 1GNUA 4YTPB 4ARIA 4TQ0A 3TUOA 4EUTA 2R2OA 4EZKA 3P4QB 2L76A 4NAWB 3TBLD 2B3AA 2GB1A 4A55A 1PGXA 3U7ZA 4LJOB 2JZPA 1YN5A 2JUOA 1V80A 3BVMA 3CSFA 2V3PA 3DOWA 3L4PA 4A9AA 1JWSD 1VR9A 1FNUA 1SE2A 2KMAA 3T9LA 4LJPB 1XQQA 3A9JA 2ACZB 3AH7A 1WZ0A 3PHXB 3U7DA 5G55A 1JMLA 2J7QB 5EE9A 3T3OA 4ACFA 1KLUD 1FXAA 1TZOA 1IPGA 4WQOB 1WRDB 4HCPB 4MELA 3B9JA 5DPRA 1YJJA 2NVUI 3WANA 3ECIA 1NBFC 4I6NB 1ESFA 3R66C 1UD7A 5L83A 3VH4B 4EZLA 1DYQA 4MM3B 3HK0A 2LHDA 1XCTL 4NJCA 2KTFA 3RUIB 1N63A 3QK0A 4IM2A 4S0RA 1T0YA 1UH6A 1V5TA 2D2QA 3ABVB 2W54A 4WJNA 1E6EB 3KUDB 4DXGA 4LNFA 2DZMA 2JWUA 3BWUD 1QZEA 3PGEA 4B0MA 2KWUB 4GMVA 1WGHA 1AWDA 2KJHB 1T0RC 3N30A 4GDLB 3V3XA 2N4FA 1JALA 4ZDVA 2RSUA 3SEBA 4MEMA 3NZSA 4RCOA 2PTLA 3IT4B 2LWPA 1I35A 2BQQA 5GMVA 1FFVA 1WM2A 3Q2AC 4JPSA 4XWTA 1L4ZB 3ETRA 2YEPF 2KWDA 1YJIA 4OZCA 1WWTA 4YSYB 3ZGZA 4IDIA 3M3JA 4WJOA 3BK1A 3QCAA 4FA6A 5JXVA 2DLBA 2DZJA 4J3OD 1WJ4A 1WE6A 2KAJA 1YN4A 3NVYA 4ZHOA 1GG3A 1FNWA 3HRDD 3W5UB 2KVRA 4II3B 4MSMB 3H9DA 1VZ7A 2BT6A 3R2TA 3PLVA 2WDTB 2PKOA 2C7HA 2GBRA 4MGZE 2CJNA 1L2NA 1V86A 3N3KB 1H4RA 3AEFB 3DBLB 1QKZA 2MBBB 1SE3A 4PYZA 3B2FA 2GI9A 4DWFA 1F52A 1I4GA 2WWZA 4HPLB 2YEPB 2HTHA 4M02A 2KMCA 4GDLA 2VZKB 1MI0A 3I5JC 2HJ8A 3NS8A 3V6CB 1VZ6A 2M4NA 3ZTDA 1AYFA 5EE1A 2ASQA 2A4ZA 2K8BA 2J53A 1YNTE 1E7PB 4AJWA 1IBXB 4KIKB 2KMMA 2MP2B 3AEGB 3FAHA 3QC8B 4KSKC 3A33B 3DDCB 1G6JA 1SB3C 3PO0A 1XLOA 4K3CA 1RM6C 4IOIE 4ANWA 2OEDA 5C2TB 2D5GA 2C7NB 2NPTB 1WJ6A 4BFRA 3UQAA 1FMAD 4HK2A 4KKIA 1WXVA 2WDRB 4W9FA 2KFKB 4RMAA 1QQRA 5I4DA 2KX3A 4K1RB 2IO2B 1WYGA 3U2SC 2LI5A 3PZ7A 2KO3A 3SFDB 2DBYA 3GS2A 4MT5A 2PE6B 1KH0A 2MQJA 1CMXB 1WM3A 2VH2A 4GOCA 4BKSD 3I57A 4NQLB 4ITKA 3MC0B 1WX8A 1R4NI 4A90A 2KC2A 3B1LX 4ICUA 4KV2A 2BS3B 3WALA 1HXYD 1QILA 4KZCA 2DYOA 1R4MB 3DBHI 1XT9B 2MJDA 4FJVB 2ZJDA 3PS6A 5BYSA 1F1HA 2FCQA 1TYGB 2LJIA 2GBMA 4RGOS 4PT5A 2Y5BB 1LQBA 4B0EA 3AEEB 3EHVA 4HPMB 1GJZA 2LGXA 1Z2MA 3KW5B 2O6VA 5LXIB 4XDDA 4ZYNA 4OVVA 1IBXA 2CU1A 4KIKA 3ZLZA 2RPVA 4AOFA 2WXOA 2FCMA 4HKZE 2LVPA 1ROEA 2AQ2B 1P1AA 4HJKA 1E8YA 1D5MC 3Q8FA 5IO9A 3RD2A 3MHZA 2WHIA 4A6QA 3WA0A 4EEWA 4RF1A 2NPTA 1TBEA 3P42A 4KGTA 2WGSA 3N1XC 1FCLA 2KFKA 1HE8A 2C5LC 1WY8A 1YQ4B 1JW9D 3Q8BA 4JIOU 1E8ZA 1SIJA 1B9RA 1SSNA 2KN5A 1FRRA 1IUEA 4X57B 4NQKE 1K8RB 3WCQA 4K7SA 3R2IA 3HUIA 5LNK1 3QX1A 2LXCA 4DK5A 1T5XD 1YJ1A 1OTRB 2H88B 1YQBA 1RFKA 3RZFA 3ML8A 3VTVA 1ZDXA 4OZBA 1A5RA 1NDDA 1P0RA 3ZO5B 1D5XC 2LGYA 5G5GA 2KDEB 4DXFA 1JWBD 3AV8A 4GSWA 3ZTCA 3QJZA 4RNAA 4WWNA 4GN1A 5BMGA 3TL5A 5JH5C 3M63B 1N62A 2KHWB 4N6EB 3APDA 2MBHA 4ZRPA 2N0SB 3U8ZA 5IAAC 1I42A 4DDID 2GMIC 3L13A 4WWMA 4E3CA 4D2KA 4W9JA 1ZP0B 1PGAA 3AE7B 3VR9B 5BYRA 2BWES 1ZXHA 1WSPA 1CZPA 5J2RA 1GOZA 3BY4B 2YVCA 5BO4B 1VJKA 1I4QA 3MC9A 4ANUA 2LUEA 3AU4A 5HKHA 1QOAA 3H7SA 4II2B 2ZPYA 2ICIA 2RGFA 3ALBA 1WFYA 3ZJUA 3UI3A 2JXTA 1E10A 3DHHC 2DZKA 5G5HA 1VCBA 2KNBA 1FIQA 1C76A 2DWQA 1J7CA 2M0AA 2KXJA 5TR5A 2IY1B 3AU5A 5BMIA 4YWGG 5FR6A 2Y3AA 2JWZA 2CJOA 4LLGM 5D94A 1BUIC 2UWQA 3AXCA 1SE9A 3KYDD 3AE2B 3MC8A 1ZXIA 4RGMA 1U4AA 3DVGY 2KWVB 2N9EB 4AQ7A 3L08A 1V6EA 3Q69A 1BXTA 2K6DB 3DVNU 3KYCD 2KN4A 3ZNHB 2KDIA 3I63C 2MJEA 1EF5A 1UZXB 2PEAA 2R61A 2RDHA 2RR9A 4PS3A 3PSEB 3APFA 4HEA1 4HXDA 2CHZA 3CIRB 1Q1OA 3P4RB 2R2QA 2LMCA 2N9LA 5C1ZA 1C79A 2KDFB 1TTNA 1CQVA 5AZHA 3IXSA 1WJUA 4C4VB 2AEHA 4M8MA 3RCZA 3UINB 4MJSB 3AE6B 3RYTA 3LJ3A 2CKHB 1GB1A 4FLHA 3X0WA 5T8IA 3AEDB 1LM8B 2DZIA 1TS4A 1PFDA 4C80A 3ZJVA 1CJEA 2KFJA 2QDFA 3H8HA 5DPSA 3WAOA 2MW5A 5FK9C 1PYWD 3VVWB 4OHJA 2W55A 2Y5PA 1V81A 4TKNA 1SF0A 2WDVB 1S3SG 1I4HA 3ZVVA 3ZQ4A 2KVZA 3AULA 1E9MA 1FRDA 1QLBB 2IGDA 4EFOA 1MPEA 3CWIA 3BK2A 2JT4B 4PS7A 2V4LA 1Q5WB 1N60A 4W9CA 3IAS1 4GU2A 1L4DB 4AUQC 1ZGUB 3NJTA 2PJHA 1RRBA 2L8JA 1D5ZC 2EKEC 3RZWC 3RN9C 1KF6B 2HD5B 3L10B 1FEHA 3Q8AA 3TCAA 2G3QB 3TIXA 1PUTA 4FHJA 4M8NA 3ZNGC 4C56C 4ZOHC 1L0YB 2K25A 3MTNB 2HJ1A 4BAXA 1JCKB 2E3TA 1V1OA 2DENB 3U52E 3S2AA 2NTTA 2WXNA 1UWXA 2MJ3A 3GZNI 4C4VA 2EELA 4DBGA 2PIAA 1NYQA 4MJSA 1RWSA 3MJ5A 1AN8A 1MFWA 4REZA 4DHJD 1UBIA 2L0TA 2WP9B 3JW0X 1V1PB 4C7ZA 3NS1A 2IO0B 2DYMA 4CO7A 4YTNB 3HM3A 4BOZB 4HVBA 4O1NA 4FADA 1K51A 1WXAA 2XK5B 2J52A 4NY0A 4F7ZA 4ZYSA 3ZDTA 2FE8A 2OOBB 2BS2B 1E8XA 2LFIA 3N32A 1WI0A 3NZ3A 3Q3MC 3GB1A 3IAM1 4W9IA 3MP9A 1NVID 1UBQA 3DBHB 2K1FA 4URKA 1I4PA 4LDTD 1Q0WB 4OVZA 2IJ0A 1XCQL 4HJGE 1TZ1A 3SD5A 4CHKA 3KVFB 1XXGA 4RFBA 1WGDA 2V4IB 2D10A 5EE0A 3KUZA 4G3XB 4HDOA 1A70A 1VD2A 2BYVE 3L17A 2QILA 4NZLB 2N7DA 4FXCA 1SEBD 3PLUA 4KZ0A 2N9PC 5LXHA 3I3TB 3A4RA 1EU3A 1VZ8A 1FXIA 4W9GA 3IVFA 3KQ4A 2BYFA 1WE7A 2LUMA 3NG0A 2XEWA 2NBVB 1NI3A 3N20C 2V3NA 3P1MA 1WMHB 1FD6A 3VUWA 5C23A 4GDKA 2WXGA 3DWGC 3QHTA 1K50A 3E9SA 2CHXA 2N9KA 1E90A 1V1PA 2BYTA 3Q3OC 4BVUC 3VTUA 1EO6A 3NVVA 3IG3A 2QCZA 2J0JA 2QMTA 4XZ4A 1B1ZA 2NMQA 3LDZE 4Q2JA 3TEWA 4N58A 4RM9A 3AE1B 2XK5A 3AE4B 1WGYA 4USAA 1R7SA 2BGFA 2WXRA 3VXWA 2ZNVB 1KLVA 4M0WB 4F1SA 1WXSA 4JE3B 4FJYA 1JQ4A 4IWQA 2L32A 3V61A 1YIWA 2UU7A 1RFAA 4PS8A 3VUYA 5LLIA 3O65B 1OGWA 1DOXA 4MH0E 1STEA 1Y8RC 1IGDA 3ZYYX 4OVUA 2VZKD 1MG4A 5J18A 2LVOA 1J8CA 4ZRJA 3E56A 3RPFC 4XYCA 1EWCA 4ZHPA 2KK8A 2RDGA 4RF0A 3U4EG 5D7GA 1WJNA 2KYWA 2KC1A 3H7PB 4BBNC 4AJYB 1XLQA 1IP9A 2FNJB 1KRHA 4MACA 2O6VB 3KWVA 1MJDA 4LNNA 1TS3A 2NCNA 1GB4A 4G0NB 2JVCA 1E7UA 2KDBA 5KHOA 4NJ6A 4KX6B 3W1SC 2N1VA 3NVZA 1N61A 4YL8A 2G45B 2W3RA 2LVQA 1EUVB 5C3JB 4NJ7A 4HRSA 2GBNA 1WMHA 1S1QB 2I2YA 3HM6X 2KT7A 4FN2A 2INCC 2KLCA 4IUMB 2AWTA 4MDKE 5HFYA 2D3BA 3PPAA 5TSSA 2C60A 1TGZB 1XF5L 3P4SB 2IY0B 3AM9A 5G2NA 2LJ5A 5D6JB 2FIFA 1E5WA 2EMSA 5BMHA 3V05A 3LB8C 1DGJA 3QARA 4M0WA 3L0WB 4A3OA 1WX7A 1WGRA 2QC8A 2HTME 4TV3A 5IP4D 2L05A 2W9NA 3BVGA 5CTRC 2CR5A 3ZRFA 3ENEA 1C1YB 4LNOA 2V1YA 3KWLA 1EWYC 2N7JA 4NPNA 2L83A 2DNFA 4BKGA 3QQ8B 3DBRB 3TMPB 3SDLC 2PW9A 2D3CA 4FHKA 3H7PA 1V49A 2G1EA 3JVZX 3CF6E 1ZW7A 1FPYA 2ON8A 2JYTA 3X23A 3VRAB 3RNEC 2SEBD 3T8MA 3VAWA 4GGQA 3T3NA 2K39A 4TQ1A 3PREA 1RLFA 3TJPA 4RGNA 1ENFA 1N5XA 1KFYB 3Q3NC 3EUB2 4W9EA 4P7IA 1JWMD 4XC2A 5H8YE 2BKFA 5EDSA 3GP7A 2TSSA 4HLEA 4XE0A 3OG5A 3VH3B 4PK1A 1TKYA 1I7HA 3FKYA 4WJQA 1FO4A 3JSVB 3P4PB 1GPXA 2MRPA 3APCA 4WQMA 2BYEA 1TS5A 2BB5A 2MBQA 2PMVA 2WX0A 1P98A 2AQ3B 3VHTC 3ZNID 3N1YC 1UELA 4IM3A 2PVOD 2FAZA 5HG2A 4AS1A 2DAFA 3EA6A 3RT3B 2I1JA 3NY5A 2C9WB 2OJRA 2D3GA 4BKSA 4HKQA 1L0XB 2XNAC 2IPKD 3NUHB 2XBBC 3ZW3A 1T0QC 1SXTA 4DHZE 4EZJA 2BB6A 3RFZB 1C4PA 3GZNB 2LZ6A 3K9PB 2BS4B 1OEYA 2BWFA 3MFGA 1HA5A 1P7EA 1F0ZA 1UGMA 4CYEA 4B95A 4I6LB 2X38A 1Q10A 4HCNB 1HZ6A 2G4SA 1I4XA 2M17A 3W2DA 3N9YC 3EGRA 3V6EB 4WWOA 2KACA 5H92C 3CSTA 4IWPA 1J7AA 4IW0A 2FCSA 4HDQA 4US9A 1LFDA 4BBNF 3AE3B 3SR6A 3OWEB 4TUUA 2WXIA 2Z59B 5JZEB 2AX5A 4JX1C 2KQ7A 3NRZA 4WIPA 1TKEA 3WAPA 1J0GA 4KSLC 4E74A 2V3SA 1OQYA 1MG8A 4NNJB 4HWIB 3JSVA 3ML9A 2MEKA 1EU4A 1HQRD 2ZNVC 3VUXA 4YXDB 2DHZA 4G11A 1F77A 2J0MA 5CX3A 3ZXRA 2WNMA 1KM7A 1LGRA 2ZEQA 2LGDA 1C9FA 2N1WA 1EF1A 1J7BA 2NTSA 1MVKA
chains in the Genus database with same CATH topology
3S2AA 4MGKE 1V86A 3GZNI 2FUHB 3N3KB 1H4RA 2K8CA 4ICVA 1E8WA 1WYWB 4KDIC 4WWPA 1H8CA 4DBGA 4MJSA 3EFUA 4JGHB 3A1QA 2MP2A 4DXAB 2MBBB 3EC8A 3PVLA 4PYZA 2VRRB 2PPHA 4FJZA 4AP4C 5JHBA 3V60A 4DWFA 4HPLB 2WWZA 2Z0EB 5CHVC 4DHJD 4E71A 1UBIA 2ZCBA 3DPDA 2L0TA 2HTHA 2KMCA 2LRUA 3JW0X 3QAQA 4GDLA 5J17A 2BPSA 3HIZA 2YLMA 3UF8A 1L2NA 2MWSB 4F8CB 3P2BA 2IO0B 1ISNA 2DYMA 2HJ8A 2IZVB 4CO7A 1WR6E 1IYFA 3NS8A 2C7MB 1M94A 3V6CB 3HM3A 4BOZB 2M4NA 4HVBA 4FADA 1WXAA 2XK5B 3ZTDA 4NY0A 3HHMA 3PTFC 2ASQA 2J0KA 4F7ZA 2A4ZA 2K8BA 3WAMA 3ZDTA 2OOBB 1Z5SB 1E8XA 2K6QA 4AJWA 1GC7A 1WI0A 3N32A 4KIKB 4LCDE 3A1QB 2MP2B 3QC8B 4KSKC 5CHWA 3UQBA 3A33B 3DDCB 1G6JA 2ZPNA 4W9IA 2K8HA 1UBQA 3VFKA 4FBJB 3NZUA 3R7QA 5AEKB 2K1FA 4URKA 2AL3A 4LDTD 1Q0WB 3DBSA 4ANWA 1BT0A 4EOYA 1TZ1A 3SD5A 4CHKA 3KVFB 4MSQB 2C7NB 3Q3FA 2NPTB 1WJ6A 2PE9A 2AYOB 3ZKJC 4BFRA 3A9KB 2NS5A 1WGDA 4HK2A 3UQAA 3BINA 1WXVA 4W9FA 3DBLI 2KFKB 2JRHA 4RMAA 3RULA 2D10A 2M1MA 3KUZA 4G3XB 2KX3A 4WAAA 4HDOA 3R3MA 2KQSA 2JXXA 4G50A 1VD2A 2WX1A 2IO2B 4K1RB 4DDGD 2BYVE 2JZZA 1YX6B 2MA9B 3L17A 2D07B 2FIDA 2KTRA 2LI5A 2KO3A 2N7DA 4KZ0A 3PLUA 2N9PC 1V5OA 1YD8U 5LXHA 5KHQA 2IO1B 3ZIMA 2PE6B 3I3TB 3A4RA 2MQJA 2JRIB 1CMXB 1WM3A 5AZGA 4GOCA 4BKSD 4W9GA 4NQLB 5IA7A 3IVFA 2BYFA 1WE7A 3EECA 3D32A 3C0RB 1PQSA 1WX8A 1R4NI 2XEWA 2KC2A 2NBVB 4KVGB 1KJTA 3VDZA 4JLCA 3PT2B 1WIAA 3QIJA 1WMHB 3VUWA 5C23A 3B1LX 4GDKA 4ICUA 3QHTA 2JPHA 3PRPB 4KV2A 5D2MB 3OJ3A 1C3TA 4JL9A 2LXAA 2Z0DB 3WALA 1NI2A 2CHXA 1AARA 4J6IA 1E90A 4KZCA 3QA8A 2DYOA 4FULA 2IO3B 2MLBA 3DBHI 1XT9B 4BVUC 4FJVB 3VTUA 5AZFA 2UYZB 2ZJDA 1EO6A 3PS6A 3IG3A 4RM8A 3PV1A 2FCQA 2J0JA 2NBUA 4XZ4A 2BKRB 2GBMA 3LDZE 4IG7B 1P3QU 2Y5BB 1LQBA 4RM9A 4IC7B 2XK5A 3EHVA 2ZVNA 1X1MA 3M62B 5JHAA 4HPMB 1GJZA 2LGXA 1Z2MA 1WGYA 2BGFA 3VXWA 3KW5B 2O6VA 2DYBA 2ZNVB 4K7WA 4M0WB 2JZ3B 4ZYNA 4F1SA 5LXIB 1KLVA 2KX0A 3DCGA 1WXSA 4OVVA 4W9KA 4BOSC 2CU1A 4FJYA 4KIKA 2QHOA 3GOEA 3L54A 3ZLZA 4IWQA 4AOFA 3V61A 1YIWA 2FCMA 1KOTA 1RFAA 4PS8A 3IBEA 3W1SA 2KANA 2LVPA 3VUYA 5LLIA 3IFWB 4JQWC 2L3ZA 2KOXA 4GDKB 3O65B 3SU8X 2GBKA 1GUAB 1OGWA 1LXDA 1WH3A 4MH0E 1P1AA 2NR2A 2ZZPB 4HJKA 1Y8RC 5E6NA 1E8YA 3RD2A 4OVUA 3B0AA 2RPQA 3VTWA 3KUCB 5J18A 2LVOA 1J8CA 4N9F4 4ZRJA 3OJ4B 3WA0A 3VQIA 2MCNB 2KK8A 4EEWA 2KKCA 1TBEA 2NPTA 4K7UA 3A9KA 3MJWA 5D7GA 4GIVA 1FXTB 1WJNA 3OAWA 2KFKA 3DVNV 1HE8A 2WYQA 2KC1A 2C5LC 1SGHA 3H7PB 4BBNC 2MSED 3DVGX 4AJYB 4B9KA 1WY8A 1IP9A 2FCNA 2FNJB 4JIOU 1E8ZA 4ZRKA 3A4SC 2KN5A 4DHJB 2O6VB 4X57B 4NQKE 1R4MI 1V2YA 1WF9A 3A9JB 1K8RB 2L00B 3MHSD 2NCNA 4K7SA 4G0NB 2JVCA 1E7UA 3PRZA 3IHPC 2AL6A 2KDBA 5KHOA 4NJ6A 2M8SA 3DBRI 1JRUA 2LXCA 3QX1A 2KJRA 3W1SC 4DK5A 2N1VA 4AWJA 1YJ1A 2MBEA 4YL8A 4ANXA 1XD3B 3KH0A 1OTRB 2G45B 2BF8B 2LVQA 1YQBA 1EUVB 3RZFA 3ML8A 4NJ7A 3VTVA 1WX9A 3ZDMC 2GBNA 1WMHA 1S1QB 1A5RA 1NDDA 1P0RA 3HM6X 3ZO5B 5CHFA 2LGYA 2KDEB 3PHWB 4FN2A 3UIPB 2KZRA 3PRMB 5DPTA 2KLCA 2N7EA 4IUMB 2AWTA 4MDKE 4GSWA 3ZRCA 3ZTCA 3QJZA 4IM0A 4WWNA 3CMMB 4PYUA 3PPAA 2C60A 4GN1A 4NAWA 1TGZB 3M63B 3TL5A 5JH5C 2IY0B 1E7VA 4IWOA 2KHWB 5G2NA 3APDA 2LJ5A 2MBHA 3Q3JA 2G4DB 2IBIB 4LDTB 5D6JB 2MX2A 3ONSA 5IAAC 2FIFA 1E5WA 3U8ZA 1I42A 1F9JA 4DDID 2GMIC 3L13A 3UGBB 4MGYE 4E3CA 2EMSA 4BKTA 3AI5A 4W9JA 3OLMD 2L7RA 3QARA 2BWES 3L0WB 3PZDA 4A3OA 1D3ZA 5J2RA 1GNUA 1WX7A 1WGRA 3BY4B 2YVCA 5BO4B 4TV3A 2L05A 2W9NA 4TQ0A 4ANUA 5E6PA 5CTRC 2LUEA 2CR5A 3AU4A 3ZRFA 2REXA 1C1YB 3ENEA 3WIMA 5HKHA 4EUTA 2R2OA 2V1YA 3H7SA 3H6NA 4EZKA 4II2B 2ZPYA 4NPNA 2L76A 2RGFA 3ALBA 1WFYA 4W9HA 4NAWB 3TBLD 2KJ6A 2B3AA 1V9JA 4BKGA 3QQ8B 2DZKA 2EMTA 4LJOB 3TMPB 1VCBA 3SDLC 2KNBA 4FHKA 3H7PA 2JUOA 1V80A 3CSFA 3DOWA 1V49A 3R7RA 2KXJA 5TR5A 2IY1B 3AU5A 3CF6E 3JVZX 1ZW7A 2KMAA 4GB9A 3T9LA 4MGIE 4LJPB 1XQQA 2DX5B 5FR6A 3L16A 4MM3A 3A9JA 3X23A 1WZ0A 3PHXB 2JWZA 3U7DA 5G55A 2J7QB 3T8MA 3VAWA 4GGQA 5D94A 2K39A 4TQ1A 3PREA 1RLFA 2UWQA 3ZUNA 3TJPA 3AXCA 1SE9A 1IPGA 4WQOB 3KYDD 5DPWA 2O2VB 1WRDB 4W9EA 4P7IA 3V62A 4HCPB 1U4AA 3DVGY 4XC2A 2KWVB 4MELA 2N9EB 5DPRA 2BKFA 4DHZB 3L08A 5EDSA 1V6EA 1GC6A 2K6DB 2NVUI 3DVNU 3KYCD 3ZNHB 1OEYJ 3WANA 3ECIA 3ZNZB 1NBFC 4HLEA 4I6NB 3VH3B 4XX5A 3R66C 2I1KA 2KDIA 4ANVA 2O6VD 1EF5A 1UD7A 4WJQA 1UZXB 5L83A 3VH4B 2PEAA 4EZLA 2RR9A 4PS3A 3JSVB 3HK0A 3PSEB 2MRPA 2N9XA 3APFA 1P9DU 3APCA 1WGGA 3DQVA 4HXDA 2BYEA 2CHZA 1Q1OA 2KTFA 2R2QA 4KDLB 5C1ZA 2MBQA 3RUIB 3QK0A 4IM2A 2WX0A 1P98A 1T0YA 2KDFB 3VHTC 1UH6A 2KWCA 1TTNA 1V5TA 2D2QA 2M0XA 5AZHA 2GOWA 3ZNID 4ASWC 4WJNA 1WJUA 1UELA 4IM3A 2AEHA 4EKUA 4M8MA 2FAZA 3RCZA 3KUDB 2JF5A 3UINB 4MJSB 1WXMA 2DAFA 2DZMA 4WJPA 3RT3B 2I1JA 3NY5A 1J19A 1QZEA 2KD0A 2LRWA 2C9WB 3LJ3A 2CKHB 3RYTA 3PGEA 3U30A 2KWUB 2OJRA 4FLHA 4GMVA 2D3GA 4BKSA 1WGHA 3X0WA 3QWZB 2KJHB 1LM8B 2DZIA 3N30A 1L7YA 4GDLB 3B08A 5E6OA 1SIFA 3JYUA 5DCNA 2KFJA 4I6PA 2XBBC 2N4FA 3ZW3A 4ZDVA 2RSUA 4W9DA 4DHZE 5DPSA 4EZJA 3WAOA 2MW5A 4MEMA 3NZSA 2GBJA 3SHQA 2LZ6A 4W9LA 3K9PB 2LWPA 3VVWB 2D11A 1OEYA 2LASA 1I35A 2BWFA 1ZKHA 1V81A 2IYDB 4TKNA 5GMVA 4A3PA 4K81A 1WM2A 2ZVOA 2KLGA 1UGMA 4CYEA 4B95A 4I6LB 4ZRIA 1S3SG 2JY6A 4HCNB 3ZVVA 2G4SA 2M17A 3AULA 3M95A 3UIOB 2L0FA 4WWOA 3V6EB 2O2VA 4A20A 3CSTA 4IWPA 4EFOA 4IW0A 2FCSA 3NHEB 4HDQA 2JT4B 1LFDA 2LD9A 2RD0A 3M3JA 4PS7A 4WJOA 4BBNF 1RAXA 2ZCCA 2V4LA 3QCAA 5JZEB 4TUUA 2Z59B 1Q5WB 4W9CA 4B6WA 4FA6A 2DZJA 4GU2A 1WJ4A 1WE6A 2KQ7A 4AUQC 3NOBA 1GG3A 1ZGUB 2MBOA 3WAPA 2PJHA 2DAJA 1RRBA 1J0GA 2L8JA 4KSLC 1WR1A 2EKEC 3RZWC 4E74A 2HD5B 3L10B 2V3SA 1OQYA 1MG8A 1YX5B 4NNJB 4HWIB 2KVRA 3JSVA 3ML9A 3TCAA 2G3QB 2KTRB 2ZNVC 2HE7A 3TIXA 4II3B 1WZ3A 4GXBA 3VUXA 5L95C 2CHWA 2DHZA 4FHJA 4G11A 2J0MA 4M8NA 3H9DA 4MSMB 5CX3A 3W1YA 3ZNGC 3H1UA 1KM7A 3PLVA 2ZEQA 2LGDA 2N1WA 2WDTB 2K25A 3MTNB 2NBWB 1EF1A 3K9OB 2C7HA 2A5UA 2CS4A 2GBRA 4MGZE 2DENB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S2A A;  4MGK E;  1V86 A;  3GZN I;  2FUH B;  3N3K B;  1H4R A;  2K8C A;  4ICV A;  1E8W A;  1WYW B;  4KDI C;  4WWP A;  1H8C A;  4DBG A;  4MJS A;  3EFU A;  4JGH B;  3A1Q A;  2MP2 A;  4DXA B;  2MBB B;  3EC8 A;  3PVL A;  4PYZ A;  2VRR B;  2PPH A;  4FJZ A;  4AP4 C;  5JHB A;  3V60 A;  4DWF A;  4HPL B;  2WWZ A;  2Z0E B;  5CHV C;  4DHJ D;  4E71 A;  1UBI A;  2ZCB A;  3DPD A;  2L0T A;  2HTH A;  2KMC A;  2LRU A;  3JW0 X;  3QAQ A;  4GDL A;  5J17 A;  2BPS A;  3HIZ A;  2YLM A;  3UF8 A;  1L2N A;  2MWS B;  4F8C B;  3P2B A;  2IO0 B;  1ISN A;  2DYM A;  2HJ8 A;  2IZV B;  4CO7 A;  1WR6 E;  1IYF A;  3NS8 A;  2C7M B;  1M94 A;  3V6C B;  3HM3 A;  4BOZ B;  2M4N A;  4HVB A;  4FAD A;  1WXA A;  2XK5 B;  3ZTD A;  4NY0 A;  3HHM A;  3PTF C;  2ASQ A;  2J0K A;  4F7Z A;  2A4Z A;  2K8B A;  3WAM A;  3ZDT A;  2OOB B;  1Z5S B;  1E8X A;  2K6Q A;  4AJW A;  1GC7 A;  1WI0 A;  3N32 A;  4KIK B;  4LCD E;  3A1Q B;  2MP2 B;  3QC8 B;  4KSK C;  5CHW A;  3UQB A;  3A33 B;  3DDC B;  1G6J A;  2ZPN A;  4W9I A;  2K8H A;  1UBQ A;  3VFK A;  4FBJ B;  3NZU A;  3R7Q A;  5AEK B;  2K1F A;  4URK A;  2AL3 A;  4LDT D;  1Q0W B;  3DBS A;  4ANW A;  1BT0 A;  4EOY A;  1TZ1 A;  3SD5 A;  4CHK A;  3KVF B;  4MSQ B;  2C7N B;  3Q3F A;  2NPT B;  1WJ6 A;  2PE9 A;  2AYO B;  3ZKJ C;  4BFR A;  3A9K B;  2NS5 A;  1WGD A;  4HK2 A;  3UQA A;  3BIN A;  1WXV A;  4W9F A;  3DBL I;  2KFK B;  2JRH A;  4RMA A;  3RUL A;  2D10 A;  2M1M A;  3KUZ A;  4G3X B;  2KX3 A;  4WAA A;  4HDO A;  3R3M A;  2KQS A;  2JXX A;  4G50 A;  1VD2 A;  2WX1 A;  2IO2 B;  4K1R B;  4DDG D;  2BYV E;  2JZZ A;  1YX6 B;  2MA9 B;  3L17 A;  2D07 B;  2FID A;  2KTR A;  2LI5 A;  2KO3 A;  2N7D A;  4KZ0 A;  3PLU A;  2N9P C;  1V5O A;  1YD8 U;  5LXH A;  5KHQ A;  2IO1 B;  3ZIM A;  2PE6 B;  3I3T B;  3A4R A;  2MQJ A;  2JRI B;  1CMX B;  1WM3 A;  5AZG A;  4GOC A;  4BKS D;  4W9G A;  4NQL B;  5IA7 A;  3IVF A;  2BYF A;  1WE7 A;  3EEC A;  3D32 A;  3C0R B;  1PQS A;  1WX8 A;  1R4N I;  2XEW A;  2KC2 A;  2NBV B;  4KVG B;  1KJT A;  3VDZ A;  4JLC A;  3PT2 B;  1WIA A;  3QIJ A;  1WMH B;  3VUW A;  5C23 A;  3B1L X;  4GDK A;  4ICU A;  3QHT A;  2JPH A;  3PRP B;  4KV2 A;  5D2M B;  3OJ3 A;  1C3T A;  4JL9 A;  2LXA A;  2Z0D B;  3WAL A;  1NI2 A;  2CHX A;  1AAR A;  4J6I A;  1E90 A;  4KZC A;  3QA8 A;  2DYO A;  4FUL A;  2IO3 B;  2MLB A;  3DBH I;  1XT9 B;  4BVU C;  4FJV B;  3VTU A;  5AZF A;  2UYZ B;  2ZJD A;  1EO6 A;  3PS6 A;  3IG3 A;  4RM8 A;  3PV1 A;  2FCQ A;  2J0J A;  2NBU A;  4XZ4 A;  2BKR B;  2GBM A;  3LDZ E;  4IG7 B;  1P3Q U;  2Y5B B;  1LQB A;  4RM9 A;  4IC7 B;  2XK5 A;  3EHV A;  2ZVN A;  1X1M A;  3M62 B;  5JHA A;  4HPM B;  1GJZ A;  2LGX A;  1Z2M A;  1WGY A;  2BGF A;  3VXW A;  3KW5 B;  2O6V A;  2DYB A;  2ZNV B;  4K7W A;  4M0W B;  2JZ3 B;  4ZYN A;  4F1S A;  5LXI B;  1KLV A;  2KX0 A;  3DCG A;  1WXS A;  4OVV A;  4W9K A;  4BOS C;  2CU1 A;  4FJY A;  4KIK A;  2QHO A;  3GOE A;  3L54 A;  3ZLZ A;  4IWQ A;  4AOF A;  3V61 A;  1YIW A;  2FCM A;  1KOT A;  1RFA A;  4PS8 A;  3IBE A;  3W1S A;  2KAN A;  2LVP A;  3VUY A;  5LLI A;  3IFW B;  4JQW C;  2L3Z A;  2KOX A;  4GDK B;  3O65 B;  3SU8 X;  2GBK A;  1GUA B;  1OGW A;  1LXD A;  1WH3 A;  4MH0 E;  1P1A A;  2NR2 A;  2ZZP B;  4HJK A;  1Y8R C;  5E6N A;  1E8Y A;  3RD2 A;  4OVU A;  3B0A A;  2RPQ A;  3VTW A;  3KUC B;  5J18 A;  2LVO A;  1J8C A;  4N9F 4;  4ZRJ A;  3OJ4 B;  3WA0 A;  3VQI A;  2MCN B;  2KK8 A;  4EEW A;  2KKC A;  1TBE A;  2NPT A;  4K7U A;  3A9K A;  3MJW A;  5D7G A;  4GIV A;  1FXT B;  1WJN A;  3OAW A;  2KFK A;  3DVN V;  1HE8 A;  2WYQ A;  2KC1 A;  2C5L C;  1SGH A;  3H7P B;  4BBN C;  2MSE D;  3DVG X;  4AJY B;  4B9K A;  1WY8 A;  1IP9 A;  2FCN A;  2FNJ B;  4JIO U;  1E8Z A;  4ZRK A;  3A4S C;  2KN5 A;  4DHJ B;  2O6V B;  4X57 B;  4NQK E;  1R4M I;  1V2Y A;  1WF9 A;  3A9J B;  1K8R B;  2L00 B;  3MHS D;  2NCN A;  4K7S A;  4G0N B;  2JVC A;  1E7U A;  3PRZ A;  3IHP C;  2AL6 A;  2KDB A;  5KHO A;  4NJ6 A;  2M8S A;  3DBR I;  1JRU A;  2LXC A;  3QX1 A;  2KJR A;  3W1S C;  4DK5 A;  2N1V A;  4AWJ A;  1YJ1 A;  2MBE A;  4YL8 A;  4ANX A;  1XD3 B;  3KH0 A;  1OTR B;  2G45 B;  2BF8 B;  2LVQ A;  1YQB A;  1EUV B;  3RZF A;  3ML8 A;  4NJ7 A;  3VTV A;  1WX9 A;  3ZDM C;  2GBN A;  1WMH A;  1S1Q B;  1A5R A;  1NDD A;  1P0R A;  3HM6 X;  3ZO5 B;  5CHF A;  2LGY A;  2KDE B;  3PHW B;  4FN2 A;  3UIP B;  2KZR A;  3PRM B;  5DPT A;  2KLC A;  2N7E A;  4IUM B;  2AWT A;  4MDK E;  4GSW A;  3ZRC A;  3ZTC A;  3QJZ A;  4IM0 A;  4WWN A;  3CMM B;  4PYU A;  3PPA A;  2C60 A;  4GN1 A;  4NAW A;  1TGZ B;  3M63 B;  3TL5 A;  5JH5 C;  2IY0 B;  1E7V A;  4IWO A;  2KHW B;  5G2N A;  3APD A;  2LJ5 A;  2MBH A;  3Q3J A;  2G4D B;  2IBI B;  4LDT B;  5D6J B;  2MX2 A;  3ONS A;  5IAA C;  2FIF A;  1E5W A;  3U8Z A;  1I42 A;  1F9J A;  4DDI D;  2GMI C;  3L13 A;  3UGB B;  4MGY E;  4E3C A;  2EMS A;  4BKT A;  3AI5 A;  4W9J A;  3OLM D;  2L7R A;  3QAR A;  2BWE S;  3L0W B;  3PZD A;  4A3O A;  1D3Z A;  5J2R A;  1GNU A;  1WX7 A;  1WGR A;  3BY4 B;  2YVC A;  5BO4 B;  4TV3 A;  2L05 A;  2W9N A;  4TQ0 A;  4ANU A;  5E6P A;  5CTR C;  2LUE A;  2CR5 A;  3AU4 A;  3ZRF A;  2REX A;  1C1Y B;  3ENE A;  3WIM A;  5HKH A;  4EUT A;  2R2O A;  2V1Y A;  3H7S A;  3H6N A;  4EZK A;  4II2 B;  2ZPY A;  4NPN A;  2L76 A;  2RGF A;  3ALB A;  1WFY A;  4W9H A;  4NAW B;  3TBL D;  2KJ6 A;  2B3A A;  1V9J A;  4BKG A;  3QQ8 B;  2DZK A;  2EMT A;  4LJO B;  3TMP B;  1VCB A;  3SDL C;  2KNB A;  4FHK A;  3H7P A;  2JUO A;  1V80 A;  3CSF A;  3DOW A;  1V49 A;  3R7R A;  2KXJ A;  5TR5 A;  2IY1 B;  3AU5 A;  3CF6 E;  3JVZ X;  1ZW7 A;  2KMA A;  4GB9 A;  3T9L A;  4MGI E;  4LJP B;  1XQQ A;  2DX5 B;  5FR6 A;  3L16 A;  4MM3 A;  3A9J A;  3X23 A;  1WZ0 A;  3PHX B;  2JWZ A;  3U7D A;  5G55 A;  2J7Q B;  3T8M A;  3VAW A;  4GGQ A;  5D94 A;  2K39 A;  4TQ1 A;  3PRE A;  1RLF A;  2UWQ A;  3ZUN A;  3TJP A;  3AXC A;  1SE9 A;  1IPG A;  4WQO B;  3KYD D;  5DPW A;  2O2V B;  1WRD B;  4W9E A;  4P7I A;  3V62 A;  4HCP B;  1U4A A;  3DVG Y;  4XC2 A;  2KWV B;  4MEL A;  2N9E B;  5DPR A;  2BKF A;  4DHZ B;  3L08 A;  5EDS A;  1V6E A;  1GC6 A;  2K6D B;  2NVU I;  3DVN U;  3KYC D;  3ZNH B;  1OEY J;  3WAN A;  3ECI A;  3ZNZ B;  1NBF C;  4HLE A;  4I6N B;  3VH3 B;  4XX5 A;  3R66 C;  2I1K A;  2KDI A;  4ANV A;  2O6V D;  1EF5 A;  1UD7 A;  4WJQ A;  1UZX B;  5L83 A;  3VH4 B;  2PEA A;  4EZL A;  2RR9 A;  4PS3 A;  3JSV B;  3HK0 A;  3PSE B;  2MRP A;  2N9X A;  3APF A;  1P9D U;  3APC A;  1WGG A;  3DQV A;  4HXD A;  2BYE A;  2CHZ A;  1Q1O A;  2KTF A;  2R2Q A;  4KDL B;  5C1Z A;  2MBQ A;  3RUI B;  3QK0 A;  4IM2 A;  2WX0 A;  1P98 A;  1T0Y A;  2KDF B;  3VHT C;  1UH6 A;  2KWC A;  1TTN A;  1V5T A;  2D2Q A;  2M0X A;  5AZH A;  2GOW A;  3ZNI D;  4ASW C;  4WJN A;  1WJU A;  1UEL A;  4IM3 A;  2AEH A;  4EKU A;  4M8M A;  2FAZ A;  3RCZ A;  3KUD B;  2JF5 A;  3UIN B;  4MJS B;  1WXM A;  2DAF A;  2DZM A;  4WJP A;  3RT3 B;  2I1J A;  3NY5 A;  1J19 A;  1QZE A;  2KD0 A;  2LRW A;  2C9W B;  3LJ3 A;  2CKH B;  3RYT A;  3PGE A;  3U30 A;  2KWU B;  2OJR A;  4FLH A;  4GMV A;  2D3G A;  4BKS A;  1WGH A;  3X0W A;  3QWZ B;  2KJH B;  1LM8 B;  2DZI A;  3N30 A;  1L7Y A;  4GDL B;  3B08 A;  5E6O A;  1SIF A;  3JYU A;  5DCN A;  2KFJ A;  4I6P A;  2XBB C;  2N4F A;  3ZW3 A;  4ZDV A;  2RSU A;  4W9D A;  4DHZ E;  5DPS A;  4EZJ A;  3WAO A;  2MW5 A;  4MEM A;  3NZS A;  2GBJ A;  3SHQ A;  2LZ6 A;  4W9L A;  3K9P B;  2LWP A;  3VVW B;  2D11 A;  1OEY A;  2LAS A;  1I35 A;  2BWF A;  1ZKH A;  1V81 A;  2IYD B;  4TKN A;  5GMV A;  4A3P A;  4K81 A;  1WM2 A;  2ZVO A;  2KLG A;  1UGM A;  4CYE A;  4B95 A;  4I6L B;  4ZRI A;  1S3S G;  2JY6 A;  4HCN B;  3ZVV A;  2G4S A;  2M17 A;  3AUL A;  3M95 A;  3UIO B;  2L0F A;  4WWO A;  3V6E B;  2O2V A;  4A20 A;  3CST A;  4IWP A;  4EFO A;  4IW0 A;  2FCS A;  3NHE B;  4HDQ A;  2JT4 B;  1LFD A;  2LD9 A;  2RD0 A;  3M3J A;  4PS7 A;  4WJO A;  4BBN F;  1RAX A;  2ZCC A;  2V4L A;  3QCA A;  5JZE B;  4TUU A;  2Z59 B;  1Q5W B;  4W9C A;  4B6W A;  4FA6 A;  2DZJ A;  4GU2 A;  1WJ4 A;  1WE6 A;  2KQ7 A;  4AUQ C;  3NOB A;  1GG3 A;  1ZGU B;  2MBO A;  3WAP A;  2PJH A;  2DAJ A;  1RRB A;  1J0G A;  2L8J A;  4KSL C;  1WR1 A;  2EKE C;  3RZW C;  4E74 A;  2HD5 B;  3L10 B;  2V3S A;  1OQY A;  1MG8 A;  1YX5 B;  4NNJ B;  4HWI B;  2KVR A;  3JSV A;  3ML9 A;  3TCA A;  2G3Q B;  2KTR B;  2ZNV C;  2HE7 A;  3TIX A;  4II3 B;  1WZ3 A;  4GXB A;  3VUX A;  5L95 C;  2CHW A;  2DHZ A;  4FHJ A;  4G11 A;  2J0M A;  4M8N A;  3H9D A;  4MSM B;  5CX3 A;  3W1Y A;  3ZNG C;  3H1U A;  1KM7 A;  3PLV A;  2ZEQ A;  2LGD A;  2N1W A;  2WDT B;  2K25 A;  3MTN B;  2NBW B;  1EF1 A;  3K9O B;  2C7H A;  2A5U A;  2CS4 A;  2GBR A;  4MGZ E;  2DEN B; 
#chains in the Genus database with same CATH topology
 1L5P A;  4MGK E;  2FUH B;  2LEK A;  1E8W A;  4KDI C;  2WXK A;  1QT9 A;  3A1Q A;  4DXA B;  3PVL A;  2HDE A;  2VRR B;  4AP4 C;  5JHB A;  3V60 A;  5CHV C;  4C00 A;  2ZCB A;  2LRU A;  3QAQ A;  5J17 A;  3RNC C;  3HIZ A;  2YLM A;  4P16 A;  3UF8 A;  4F8C B;  1FM0 D;  3P2B A;  1N6Z A;  3AMZ A;  1YOV B;  2IZV B;  2GRI A;  1IYF A;  5AUI A;  4DQO C;  1OQQ A;  1M94 A;  1QOF A;  3HHM A;  3PTF C;  3GE3 C;  2J0K A;  1CK1 A;  2K9X A;  1Z5S B;  3BZD B;  1GC7 A;  5CHW A;  3UQB A;  2K5P A;  2ZPN A;  2M56 B;  5IKC M;  2K8H A;  3VFK A;  3NZU A;  2AL3 A;  3DBS A;  4LK0 M;  3PZ8 A;  2V0G A;  4MSQ B;  2INP E;  3TEY A;  3A9K B;  2NS5 A;  3BII D;  3BIN A;  3RUL A;  2M1M A;  5AUK A;  4WAA A;  3W5V B;  4G50 A;  2KQS A;  2JXX A;  1OQR A;  1WRI A;  1VRA B;  2JZZ A;  1YX6 B;  2MA9 B;  1NYR A;  2FID A;  2QSD A;  1YD8 U;  5KHQ A;  2I38 A;  4WAF A;  3ZIM A;  5AZG A;  2JSV X;  1GAQ B;  1T0S C;  3EEC A;  4YT0 B;  3D32 A;  1NEN B;  3C0R B;  1PQS A;  1WGK A;  1ZOY B;  5E6J A;  1KJT A;  4JLC A;  3PT2 B;  1WIA A;  3QIJ A;  2AQ1 B;  2WDQ B;  1C3T A;  2QIE B;  3PRP B;  2W3S A;  3OJ3 A;  4JL9 A;  2LXA A;  2Z0D B;  1AAR A;  1XLN A;  4FUL A;  4K3B A;  1NEK B;  2IDY A;  2MHJ A;  1OFF A;  2BBC A;  5IN7 A;  3PV1 A;  2NBU A;  1P7F A;  3R8B A;  1P3Q U;  2JYE A;  3URY A;  4IC7 B;  4JWU C;  1X1M A;  3M62 B;  5MPO A;  4XDC A;  3NVW A;  2K3U A;  4K7W A;  1D4B A;  2FUG 1;  1I4R A;  2KX0 A;  3DCG A;  3DWM A;  4BOS C;  4L23 A;  1ZPS A;  2QHO A;  4A8X C;  3W1S A;  4GDK B;  2KOX A;  3SU8 X;  2GBK A;  1LXD A;  4ARC A;  1JRP A;  5E6N A;  3B0A A;  3RNG C;  2JQR B;  3A9K A;  4GIV A;  3OAW A;  2WYQ A;  3AEB B;  2J4X A;  1R4N B;  4B9K A;  2FCN A;  1SBB B;  4WH4 A;  4DHJ B;  2LHE A;  1C4C A;  1QOG A;  3SFE B;  2BW2 A;  3PRZ A;  3IHP C;  2AL6 A;  1V97 A;  1HTQ A;  3ZXV A;  1JRU A;  2WXF A;  4R3D A;  5D3D A;  2K0P A;  2WLB A;  1K53 A;  1WX9 A;  4L1B A;  2LGS A;  3BYY B;  4YSX B;  1UUP A;  5CHF A;  3EFC A;  3PHW B;  1RYJ A;  3PRM B;  4N59 A;  5DPT A;  2N7E A;  3ZRC A;  2WS3 B;  4PYU A;  4NAW A;  1YQ3 B;  4IWO A;  1QF6 A;  4LDT B;  2MX2 A;  1F9J A;  4H2A A;  3ZJT A;  3OLM D;  2LGI A;  2L7R A;  5EE3 A;  3PZD A;  5IOI A;  1UNS A;  3KLS X;  4MH8 A;  1LO5 D;  5E6P A;  1TT5 B;  2WXH A;  2M19 A;  2REX A;  3WIM A;  3H6N A;  1Y56 A;  4W9H A;  3RNF C;  2KJ6 A;  1V9J A;  3Q6B A;  2EMT A;  4P6V F;  2B76 B;  3N1Z C;  3R7R A;  3AB5 A;  3HVZ A;  4GB9 A;  1FNV A;  4MGI E;  3Q8C A;  2DX5 B;  3L16 A;  4MM3 A;  1PGB A;  4EE2 A;  1KLG D;  1UF0 A;  1EM7 A;  3AE9 B;  3ZUN A;  1TIF A;  5DPW A;  2O2V B;  1ET9 A;  5FKA C;  3V62 A;  2RMM A;  1D6E C;  4DHZ B;  4QAY A;  1GC6 A;  4XWW A;  1OEY J;  3ZNZ B;  1T3Q A;  3DHG C;  4XX5 A;  2I1K A;  2WXJ A;  4ANV A;  2O6V D;  2QJL A;  1VLB A;  4UDU C;  2RDB C;  2N9X A;  1P9D U;  1WGG A;  3DQV A;  1XO3 A;  1DOI A;  4KDL B;  3C19 A;  2KWC A;  1TS2 A;  2M0X A;  2GOW A;  4ASW C;  4LTU A;  3TSS A;  4EKU A;  2ONQ A;  1SJH D;  4S17 A;  4C7Y A;  2JF5 A;  4IKG A;  1WXM A;  4WJP A;  2K22 A;  1J19 A;  2KD0 A;  2LRW A;  3U30 A;  3QWZ B;  1L7Y A;  3B08 A;  5E6O A;  1SIF A;  3JYU A;  5DCN A;  3DHI C;  4I6P A;  1IGC A;  1BML C;  2Y5C A;  4LNK A;  4W9D A;  1L6U A;  4GLS C;  3B2G A;  1N5W A;  2GBJ A;  3SHQ A;  2G9H D;  4RH6 A;  4W9L A;  4BZA A;  2D11 A;  2LAS A;  1ZKH A;  2IYD B;  4A3P A;  2KQ4 X;  4K81 A;  2ZVO A;  2KLG A;  3VR8 B;  4ZRI A;  2JY6 A;  3I9V 1;  1F2R I;  1UWM A;  3LYY A;  5BYQ A;  4HRO A;  3M95 A;  3UIO B;  2L0F A;  2O2V A;  5HI1 A;  4A20 A;  3NHE B;  3FIL B;  2RD0 A;  2LD9 A;  3TEX A;  1RAX A;  4TMA B;  2ZCC A;  4P1B C;  4JWS C;  4B6W A;  3NOB A;  2L52 A;  3AEA B;  2MBO A;  2GLS A;  2DAJ A;  3FC4 A;  1WR1 A;  1JWA D;  1YX5 B;  1FFU A;  1TKG A;  2KTR B;  3IT6 B;  2HE7 A;  1WZ3 A;  4GXB A;  2IGG A;  5L95 C;  2CHW A;  1VDV A;  3W1Y A;  3H1U A;  4TSS A;  2MH7 A;  3J9C A;  2SAK A;  2NBW B;  2Z8L A;  3K9O B;  3AEC B;  2A5U A;  2CS4 A;  4OW0 A;  1UGJ A;  2K8C A;  4ICV A;  4WUR A;  1DOY A;  1L0V B;  1L6V A;  1WYW B;  4WWP A;  1H8C A;  1KTK A;  3EFU A;  4JGH B;  2MP2 A;  3EC8 A;  5FR3 A;  2PPH A;  4FJZ A;  1FCC C;  3TEZ A;  2Z0E B;  4E71 A;  3DPD A;  2JU6 X;  2BPS A;  4NAM A;  2JX5 A;  2MWS B;  2H89 B;  1ISN A;  1JWU D;  4M00 A;  1F2R C;  1WR6 E;  3RI7 C;  2ZW0 A;  2C7M B;  1PDX A;  4CQN A;  3AE8 B;  2W82 A;  4P1C C;  3O13 A;  1C4A A;  3WAM A;  1ZE3 D;  2K6Q A;  2XN9 C;  2IND C;  4LCD E;  3A1Q B;  3HVD A;  2WXM A;  2PLP A;  2Q5W D;  4M01 A;  4FBJ B;  2INN E;  3RMK C;  3R7Q A;  5AEK B;  4OZA A;  1WXQ A;  3FIL A;  1YN3 A;  1BT0 A;  4KGS A;  3Q3F A;  2PE9 A;  2AYO B;  3ZKJ C;  1JRO A;  3DBL I;  2JRH A;  3R3M A;  1K52 A;  2WX1 A;  4DDG D;  4YSZ B;  2D07 B;  1C77 A;  2KTR A;  1ACC A;  1T6B X;  1V5O A;  2IO1 B;  2WU5 B;  2BVC A;  2JRI B;  2OHF A;  5IA7 A;  1TY0 A;  5GXG B;  3BYT B;  2WXL A;  3Q14 C;  4KVG B;  3VDZ A;  2FBW B;  3W9C B;  2JPH A;  5D2M B;  1HZ5 A;  1NI2 A;  4J6I A;  3QA8 A;  2PVG C;  3AN1 A;  2WU2 B;  2IO3 B;  2MLB A;  3GE8 C;  5D3I B;  4KKJ A;  5AZF A;  2UYZ B;  1MHH E;  4RM8 A;  1V8C A;  4HPP A;  2WXQ A;  4US8 A;  2BKR B;  4IG7 B;  2WQY B;  1ZUD 2;  3LXF A;  2ZVN A;  5JHA A;  4YTM B;  2DYB A;  2JZ3 B;  2IGH A;  3VRB B;  4W9K A;  3GOE A;  3L54 A;  1KOT A;  2X8X X;  1HTO A;  3IBE A;  2KAN A;  3IFW B;  4JQW C;  2L3Z A;  1E0Z A;  1GUA B;  4XGA B;  1WH3 A;  2NR2 A;  2ZZP B;  2RPQ A;  4LNI A;  3KUC B;  3VTW A;  2KDM A;  4N9F 4;  1QOB A;  3OJ4 B;  1M4V A;  3VQI A;  2MCN B;  2KKC A;  5HHD G;  4K7U A;  1SE4 A;  3MJW A;  1FXT B;  3DVN V;  4L2Y A;  1SJE D;  1ET6 A;  1SGH A;  2MSE D;  3DVG X;  1AW7 A;  2ZW1 A;  4ZRQ A;  2OJW A;  4ZRK A;  3A4S C;  1R4M I;  1V2Y A;  1WF9 A;  2V9H A;  3A9J B;  1ZDV A;  2L00 B;  3MHS D;  1HEZ E;  4KGR A;  1MHX A;  2CU3 A;  3P63 A;  2M8S A;  3DBR I;  2KJR A;  4AWJ A;  1C78 A;  2MBE A;  4ANX A;  1XD3 B;  3KH0 A;  2BF8 B;  1YMH E;  1XLP A;  4RGT A;  3ZDM C;  2WXP A;  3Q8E A;  1XEE A;  2VH1 A;  3BVZ A;  3UIP B;  2KZR A;  4IM0 A;  2L1A A;  3CMM B;  2D3A A;  2QEJ C;  1E7V A;  2E6X A;  3RNA C;  3Q3J A;  1TY2 A;  2G4D B;  2IBI B;  4EOY A;  3ONS A;  3AE5 B;  3RNB C;  1TJE A;  3UGB B;  4MGY E;  4BKT A;  3AI5 A;  2J42 A;  2BTE A;  3C8Y A;  2EKI A;  1D3Z A;  1GNU A;  4YTP B;  4ARI A;  4TQ0 A;  3TUO A;  4EUT A;  2R2O A;  4EZK A;  3P4Q B;  2L76 A;  4NAW B;  3TBL D;  2B3A A;  2GB1 A;  4A55 A;  1PGX A;  3U7Z A;  4LJO B;  2JZP A;  1YN5 A;  2JUO A;  1V80 A;  3BVM A;  3CSF A;  2V3P A;  3DOW A;  3L4P A;  4A9A A;  1JWS D;  1VR9 A;  1FNU A;  1SE2 A;  2KMA A;  3T9L A;  4LJP B;  1XQQ A;  3A9J A;  2ACZ B;  3AH7 A;  1WZ0 A;  3PHX B;  3U7D A;  5G55 A;  1JML A;  2J7Q B;  5EE9 A;  3T3O A;  4ACF A;  1KLU D;  1FXA A;  1TZO A;  1IPG A;  4WQO B;  1WRD B;  4HCP B;  4MEL A;  3B9J A;  5DPR A;  1YJJ A;  2NVU I;  3WAN A;  3ECI A;  1NBF C;  4I6N B;  1ESF A;  3R66 C;  1UD7 A;  5L83 A;  3VH4 B;  4EZL A;  1DYQ A;  4MM3 B;  3HK0 A;  2LHD A;  1XCT L;  4NJC A;  2KTF A;  3RUI B;  1N63 A;  3QK0 A;  4IM2 A;  4S0R A;  1T0Y A;  1UH6 A;  1V5T A;  2D2Q A;  3ABV B;  2W54 A;  4WJN A;  1E6E B;  3KUD B;  4DXG A;  4LNF A;  2DZM A;  2JWU A;  3BWU D;  1QZE A;  3PGE A;  4B0M A;  2KWU B;  4GMV A;  1WGH A;  1AWD A;  2KJH B;  1T0R C;  3N30 A;  4GDL B;  3V3X A;  2N4F A;  1JAL A;  4ZDV A;  2RSU A;  3SEB A;  4MEM A;  3NZS A;  4RCO A;  2PTL A;  3IT4 B;  2LWP A;  1I35 A;  2BQQ A;  5GMV A;  1FFV A;  1WM2 A;  3Q2A C;  4JPS A;  4XWT A;  1L4Z B;  3ETR A;  2YEP F;  2KWD A;  1YJI A;  4OZC A;  1WWT A;  4YSY B;  3ZGZ A;  4IDI A;  3M3J A;  4WJO A;  3BK1 A;  3QCA A;  4FA6 A;  5JXV A;  2DLB A;  2DZJ A;  4J3O D;  1WJ4 A;  1WE6 A;  2KAJ A;  1YN4 A;  3NVY A;  4ZHO A;  1GG3 A;  1FNW A;  3HRD D;  3W5U B;  2KVR A;  4II3 B;  4MSM B;  3H9D A;  1VZ7 A;  2BT6 A;  3R2T A;  3PLV A;  2WDT B;  2PKO A;  2C7H A;  2GBR A;  4MGZ E;  2CJN A;  1L2N A;  1V86 A;  3N3K B;  1H4R A;  3AEF B;  3DBL B;  1QKZ A;  2MBB B;  1SE3 A;  4PYZ A;  3B2F A;  2GI9 A;  4DWF A;  1F52 A;  1I4G A;  2WWZ A;  4HPL B;  2YEP B;  2HTH A;  4M02 A;  2KMC A;  4GDL A;  2VZK B;  1MI0 A;  3I5J C;  2HJ8 A;  3NS8 A;  3V6C B;  1VZ6 A;  2M4N A;  3ZTD A;  1AYF A;  5EE1 A;  2ASQ A;  2A4Z A;  2K8B A;  2J53 A;  1YNT E;  1E7P B;  4AJW A;  1IBX B;  4KIK B;  2KMM A;  2MP2 B;  3AEG B;  3FAH A;  3QC8 B;  4KSK C;  3A33 B;  3DDC B;  1G6J A;  1SB3 C;  3PO0 A;  1XLO A;  4K3C A;  1RM6 C;  4IOI E;  4ANW A;  2OED A;  5C2T B;  2D5G A;  2C7N B;  2NPT B;  1WJ6 A;  4BFR A;  3UQA A;  1FMA D;  4HK2 A;  4KKI A;  1WXV A;  2WDR B;  4W9F A;  2KFK B;  4RMA A;  1QQR A;  5I4D A;  2KX3 A;  4K1R B;  2IO2 B;  1WYG A;  3U2S C;  2LI5 A;  3PZ7 A;  2KO3 A;  3SFD B;  2DBY A;  3GS2 A;  4MT5 A;  2PE6 B;  1KH0 A;  2MQJ A;  1CMX B;  1WM3 A;  2VH2 A;  4GOC A;  4BKS D;  3I57 A;  4NQL B;  4ITK A;  3MC0 B;  1WX8 A;  1R4N I;  4A90 A;  2KC2 A;  3B1L X;  4ICU A;  4KV2 A;  2BS3 B;  3WAL A;  1HXY D;  1QIL A;  4KZC A;  2DYO A;  1R4M B;  3DBH I;  1XT9 B;  2MJD A;  4FJV B;  2ZJD A;  3PS6 A;  5BYS A;  1F1H A;  2FCQ A;  1TYG B;  2LJI A;  2GBM A;  4RGO S;  4PT5 A;  2Y5B B;  1LQB A;  4B0E A;  3AEE B;  3EHV A;  4HPM B;  1GJZ A;  2LGX A;  1Z2M A;  3KW5 B;  2O6V A;  5LXI B;  4XDD A;  4ZYN A;  4OVV A;  1IBX A;  2CU1 A;  4KIK A;  3ZLZ A;  2RPV A;  4AOF A;  2WXO A;  2FCM A;  4HKZ E;  2LVP A;  1ROE A;  2AQ2 B;  1P1A A;  4HJK A;  1E8Y A;  1D5M C;  3Q8F A;  5IO9 A;  3RD2 A;  3MHZ A;  2WHI A;  4A6Q A;  3WA0 A;  4EEW A;  4RF1 A;  2NPT A;  1TBE A;  3P42 A;  4KGT A;  2WGS A;  3N1X C;  1FCL A;  2KFK A;  1HE8 A;  2C5L C;  1WY8 A;  1YQ4 B;  1JW9 D;  3Q8B A;  4JIO U;  1E8Z A;  1SIJ A;  1B9R A;  1SSN A;  2KN5 A;  1FRR A;  1IUE A;  4X57 B;  4NQK E;  1K8R B;  3WCQ A;  4K7S A;  3R2I A;  3HUI A;  5LNK 1;  3QX1 A;  2LXC A;  4DK5 A;  1T5X D;  1YJ1 A;  1OTR B;  2H88 B;  1YQB A;  1RFK A;  3RZF A;  3ML8 A;  3VTV A;  1ZDX A;  4OZB A;  1A5R A;  1NDD A;  1P0R A;  3ZO5 B;  1D5X C;  2LGY A;  5G5G A;  2KDE B;  4DXF A;  1JWB D;  3AV8 A;  4GSW A;  3ZTC A;  3QJZ A;  4RNA A;  4WWN A;  4GN1 A;  5BMG A;  3TL5 A;  5JH5 C;  3M63 B;  1N62 A;  2KHW B;  4N6E B;  3APD A;  2MBH A;  4ZRP A;  2N0S B;  3U8Z A;  5IAA C;  1I42 A;  4DDI D;  2GMI C;  3L13 A;  4WWM A;  4E3C A;  4D2K A;  4W9J A;  1ZP0 B;  1PGA A;  3AE7 B;  3VR9 B;  5BYR A;  2BWE S;  1ZXH A;  1WSP A;  1CZP A;  5J2R A;  1GOZ A;  3BY4 B;  2YVC A;  5BO4 B;  1VJK A;  1I4Q A;  3MC9 A;  4ANU A;  2LUE A;  3AU4 A;  5HKH A;  1QOA A;  3H7S A;  4II2 B;  2ZPY A;  2ICI A;  2RGF A;  3ALB A;  1WFY A;  3ZJU A;  3UI3 A;  2JXT A;  1E10 A;  3DHH C;  2DZK A;  5G5H A;  1VCB A;  2KNB A;  1FIQ A;  1C76 A;  2DWQ A;  1J7C A;  2M0A A;  2KXJ A;  5TR5 A;  2IY1 B;  3AU5 A;  5BMI A;  4YWG G;  5FR6 A;  2Y3A A;  2JWZ A;  2CJO A;  4LLG M;  5D94 A;  1BUI C;  2UWQ A;  3AXC A;  1SE9 A;  3KYD D;  3AE2 B;  3MC8 A;  1ZXI A;  4RGM A;  1U4A A;  3DVG Y;  2KWV B;  2N9E B;  4AQ7 A;  3L08 A;  1V6E A;  3Q69 A;  1BXT A;  2K6D B;  3DVN U;  3KYC D;  2KN4 A;  3ZNH B;  2KDI A;  3I63 C;  2MJE A;  1EF5 A;  1UZX B;  2PEA A;  2R61 A;  2RDH A;  2RR9 A;  4PS3 A;  3PSE B;  3APF A;  4HEA 1;  4HXD A;  2CHZ A;  3CIR B;  1Q1O A;  3P4R B;  2R2Q A;  2LMC A;  2N9L A;  5C1Z A;  1C79 A;  2KDF B;  1TTN A;  1CQV A;  5AZH A;  3IXS A;  1WJU A;  4C4V B;  2AEH A;  4M8M A;  3RCZ A;  3UIN B;  4MJS B;  3AE6 B;  3RYT A;  3LJ3 A;  2CKH B;  1GB1 A;  4FLH A;  3X0W A;  5T8I A;  3AED B;  1LM8 B;  2DZI A;  1TS4 A;  1PFD A;  4C80 A;  3ZJV A;  1CJE A;  2KFJ A;  2QDF A;  3H8H A;  5DPS A;  3WAO A;  2MW5 A;  5FK9 C;  1PYW D;  3VVW B;  4OHJ A;  2W55 A;  2Y5P A;  1V81 A;  4TKN A;  1SF0 A;  2WDV B;  1S3S G;  1I4H A;  3ZVV A;  3ZQ4 A;  2KVZ A;  3AUL A;  1E9M A;  1FRD A;  1QLB B;  2IGD A;  4EFO A;  1MPE A;  3CWI A;  3BK2 A;  2JT4 B;  4PS7 A;  2V4L A;  1Q5W B;  1N60 A;  4W9C A;  3IAS 1;  4GU2 A;  1L4D B;  4AUQ C;  1ZGU B;  3NJT A;  2PJH A;  1RRB A;  2L8J A;  1D5Z C;  2EKE C;  3RZW C;  3RN9 C;  1KF6 B;  2HD5 B;  3L10 B;  1FEH A;  3Q8A A;  3TCA A;  2G3Q B;  3TIX A;  1PUT A;  4FHJ A;  4M8N A;  3ZNG C;  4C56 C;  4ZOH C;  1L0Y B;  2K25 A;  3MTN B;  2HJ1 A;  4BAX A;  1JCK B;  2E3T A;  1V1O A;  2DEN B;  3U52 E;  3S2A A;  2NTT A;  2WXN A;  1UWX A;  2MJ3 A;  3GZN I;  4C4V A;  2EEL A;  4DBG A;  2PIA A;  1NYQ A;  4MJS A;  1RWS A;  3MJ5 A;  1AN8 A;  1MFW A;  4REZ A;  4DHJ D;  1UBI A;  2L0T A;  2WP9 B;  3JW0 X;  1V1P B;  4C7Z A;  3NS1 A;  2IO0 B;  2DYM A;  4CO7 A;  4YTN B;  3HM3 A;  4BOZ B;  4HVB A;  4O1N A;  4FAD A;  1K51 A;  1WXA A;  2XK5 B;  2J52 A;  4NY0 A;  4F7Z A;  4ZYS A;  3ZDT A;  2FE8 A;  2OOB B;  2BS2 B;  1E8X A;  2LFI A;  3N32 A;  1WI0 A;  3NZ3 A;  3Q3M C;  3GB1 A;  3IAM 1;  4W9I A;  3MP9 A;  1NVI D;  1UBQ A;  3DBH B;  2K1F A;  4URK A;  1I4P A;  4LDT D;  1Q0W B;  4OVZ A;  2IJ0 A;  1XCQ L;  4HJG E;  1TZ1 A;  3SD5 A;  4CHK A;  3KVF B;  1XXG A;  4RFB A;  1WGD A;  2V4I B;  2D10 A;  5EE0 A;  3KUZ A;  4G3X B;  4HDO A;  1A70 A;  1VD2 A;  2BYV E;  3L17 A;  2QIL A;  4NZL B;  2N7D A;  4FXC A;  1SEB D;  3PLU A;  4KZ0 A;  2N9P C;  5LXH A;  3I3T B;  3A4R A;  1EU3 A;  1VZ8 A;  1FXI A;  4W9G A;  3IVF A;  3KQ4 A;  2BYF A;  1WE7 A;  2LUM A;  3NG0 A;  2XEW A;  2NBV B;  1NI3 A;  3N20 C;  2V3N A;  3P1M A;  1WMH B;  1FD6 A;  3VUW A;  5C23 A;  4GDK A;  2WXG A;  3DWG C;  3QHT A;  1K50 A;  3E9S A;  2CHX A;  2N9K A;  1E90 A;  1V1P A;  2BYT A;  3Q3O C;  4BVU C;  3VTU A;  1EO6 A;  3NVV A;  3IG3 A;  2QCZ A;  2J0J A;  2QMT A;  4XZ4 A;  1B1Z A;  2NMQ A;  3LDZ E;  4Q2J A;  3TEW A;  4N58 A;  4RM9 A;  3AE1 B;  2XK5 A;  3AE4 B;  1WGY A;  4USA A;  1R7S A;  2BGF A;  2WXR A;  3VXW A;  2ZNV B;  1KLV A;  4M0W B;  4F1S A;  1WXS A;  4JE3 B;  4FJY A;  1JQ4 A;  4IWQ A;  2L32 A;  3V61 A;  1YIW A;  2UU7 A;  1RFA A;  4PS8 A;  3VUY A;  5LLI A;  3O65 B;  1OGW A;  1DOX A;  4MH0 E;  1STE A;  1Y8R C;  1IGD A;  3ZYY X;  4OVU A;  2VZK D;  1MG4 A;  5J18 A;  2LVO A;  1J8C A;  4ZRJ A;  3E56 A;  3RPF C;  4XYC A;  1EWC A;  4ZHP A;  2KK8 A;  2RDG A;  4RF0 A;  3U4E G;  5D7G A;  1WJN A;  2KYW A;  2KC1 A;  3H7P B;  4BBN C;  4AJY B;  1XLQ A;  1IP9 A;  2FNJ B;  1KRH A;  4MAC A;  2O6V B;  3KWV A;  1MJD A;  4LNN A;  1TS3 A;  2NCN A;  1GB4 A;  4G0N B;  2JVC A;  1E7U A;  2KDB A;  5KHO A;  4NJ6 A;  4KX6 B;  3W1S C;  2N1V A;  3NVZ A;  1N61 A;  4YL8 A;  2G45 B;  2W3R A;  2LVQ A;  1EUV B;  5C3J B;  4NJ7 A;  4HRS A;  2GBN A;  1WMH A;  1S1Q B;  2I2Y A;  3HM6 X;  2KT7 A;  4FN2 A;  2INC C;  2KLC A;  4IUM B;  2AWT A;  4MDK E;  5HFY A;  2D3B A;  3PPA A;  5TSS A;  2C60 A;  1TGZ B;  1XF5 L;  3P4S B;  2IY0 B;  3AM9 A;  5G2N A;  2LJ5 A;  5D6J B;  2FIF A;  1E5W A;  2EMS A;  5BMH A;  3V05 A;  3LB8 C;  1DGJ A;  3QAR A;  4M0W A;  3L0W B;  4A3O A;  1WX7 A;  1WGR A;  2QC8 A;  2HTM E;  4TV3 A;  5IP4 D;  2L05 A;  2W9N A;  3BVG A;  5CTR C;  2CR5 A;  3ZRF A;  3ENE A;  1C1Y B;  4LNO A;  2V1Y A;  3KWL A;  1EWY C;  2N7J A;  4NPN A;  2L83 A;  2DNF A;  4BKG A;  3QQ8 B;  3DBR B;  3TMP B;  3SDL C;  2PW9 A;  2D3C A;  4FHK A;  3H7P A;  1V49 A;  2G1E A;  3JVZ X;  3CF6 E;  1ZW7 A;  1FPY A;  2ON8 A;  2JYT A;  3X23 A;  3VRA B;  3RNE C;  2SEB D;  3T8M A;  3VAW A;  4GGQ A;  3T3N A;  2K39 A;  4TQ1 A;  3PRE A;  1RLF A;  3TJP A;  4RGN A;  1ENF A;  1N5X A;  1KFY B;  3Q3N C;  3EUB 2;  4W9E A;  4P7I A;  1JWM D;  4XC2 A;  5H8Y E;  2BKF A;  5EDS A;  3GP7 A;  2TSS A;  4HLE A;  4XE0 A;  3OG5 A;  3VH3 B;  4PK1 A;  1TKY A;  1I7H A;  3FKY A;  4WJQ A;  1FO4 A;  3JSV B;  3P4P B;  1GPX A;  2MRP A;  3APC A;  4WQM A;  2BYE A;  1TS5 A;  2BB5 A;  2MBQ A;  2PMV A;  2WX0 A;  1P98 A;  2AQ3 B;  3VHT C;  3ZNI D;  3N1Y C;  1UEL A;  4IM3 A;  2PVO D;  2FAZ A;  5HG2 A;  4AS1 A;  2DAF A;  3EA6 A;  3RT3 B;  2I1J A;  3NY5 A;  2C9W B;  2OJR A;  2D3G A;  4BKS A;  4HKQ A;  1L0X B;  2XNA C;  2IPK D;  3NUH B;  2XBB C;  3ZW3 A;  1T0Q C;  1SXT A;  4DHZ E;  4EZJ A;  2BB6 A;  3RFZ B;  1C4P A;  3GZN B;  2LZ6 A;  3K9P B;  2BS4 B;  1OEY A;  2BWF A;  3MFG A;  1HA5 A;  1P7E A;  1F0Z A;  1UGM A;  4CYE A;  4B95 A;  4I6L B;  2X38 A;  1Q10 A;  4HCN B;  1HZ6 A;  2G4S A;  1I4X A;  2M17 A;  3W2D A;  3N9Y C;  3EGR A;  3V6E B;  4WWO A;  2KAC A;  5H92 C;  3CST A;  4IWP A;  1J7A A;  4IW0 A;  2FCS A;  4HDQ A;  4US9 A;  1LFD A;  4BBN F;  3AE3 B;  3SR6 A;  3OWE B;  4TUU A;  2WXI A;  2Z59 B;  5JZE B;  2AX5 A;  4JX1 C;  2KQ7 A;  3NRZ A;  4WIP A;  1TKE A;  3WAP A;  1J0G A;  4KSL C;  4E74 A;  2V3S A;  1OQY A;  1MG8 A;  4NNJ B;  4HWI B;  3JSV A;  3ML9 A;  2MEK A;  1EU4 A;  1HQR D;  2ZNV C;  3VUX A;  4YXD B;  2DHZ A;  4G11 A;  1F77 A;  2J0M A;  5CX3 A;  3ZXR A;  2WNM A;  1KM7 A;  1LGR A;  2ZEQ A;  2LGD A;  1C9F A;  2N1W A;  1EF1 A;  1J7B A;  2NTS A;  1MVK A; 
#chains in the Genus database with same CATH homology
 3S2A A;  4MGK E;  1V86 A;  3GZN I;  2FUH B;  3N3K B;  1H4R A;  2K8C A;  4ICV A;  1E8W A;  1WYW B;  4KDI C;  4WWP A;  1H8C A;  4DBG A;  4MJS A;  3EFU A;  4JGH B;  3A1Q A;  2MP2 A;  4DXA B;  2MBB B;  3EC8 A;  3PVL A;  4PYZ A;  2VRR B;  2PPH A;  4FJZ A;  4AP4 C;  5JHB A;  3V60 A;  4DWF A;  4HPL B;  2WWZ A;  2Z0E B;  5CHV C;  4DHJ D;  4E71 A;  1UBI A;  2ZCB A;  3DPD A;  2L0T A;  2HTH A;  2KMC A;  2LRU A;  3JW0 X;  3QAQ A;  4GDL A;  5J17 A;  2BPS A;  3HIZ A;  2YLM A;  3UF8 A;  1L2N A;  2MWS B;  4F8C B;  3P2B A;  2IO0 B;  1ISN A;  2DYM A;  2HJ8 A;  2IZV B;  4CO7 A;  1WR6 E;  1IYF A;  3NS8 A;  2C7M B;  1M94 A;  3V6C B;  3HM3 A;  4BOZ B;  2M4N A;  4HVB A;  4FAD A;  1WXA A;  2XK5 B;  3ZTD A;  4NY0 A;  3HHM A;  3PTF C;  2ASQ A;  2J0K A;  4F7Z A;  2A4Z A;  2K8B A;  3WAM A;  3ZDT A;  2OOB B;  1Z5S B;  1E8X A;  2K6Q A;  4AJW A;  1GC7 A;  1WI0 A;  3N32 A;  4KIK B;  4LCD E;  3A1Q B;  2MP2 B;  3QC8 B;  4KSK C;  5CHW A;  3UQB A;  3A33 B;  3DDC B;  1G6J A;  2ZPN A;  4W9I A;  2K8H A;  1UBQ A;  3VFK A;  4FBJ B;  3NZU A;  3R7Q A;  5AEK B;  2K1F A;  4URK A;  2AL3 A;  4LDT D;  1Q0W B;  3DBS A;  4ANW A;  1BT0 A;  4EOY A;  1TZ1 A;  3SD5 A;  4CHK A;  3KVF B;  4MSQ B;  2C7N B;  3Q3F A;  2NPT B;  1WJ6 A;  2PE9 A;  2AYO B;  3ZKJ C;  4BFR A;  3A9K B;  2NS5 A;  1WGD A;  4HK2 A;  3UQA A;  3BIN A;  1WXV A;  4W9F A;  3DBL I;  2KFK B;  2JRH A;  4RMA A;  3RUL A;  2D10 A;  2M1M A;  3KUZ A;  4G3X B;  2KX3 A;  4WAA A;  4HDO A;  3R3M A;  2KQS A;  2JXX A;  4G50 A;  1VD2 A;  2WX1 A;  2IO2 B;  4K1R B;  4DDG D;  2BYV E;  2JZZ A;  1YX6 B;  2MA9 B;  3L17 A;  2D07 B;  2FID A;  2KTR A;  2LI5 A;  2KO3 A;  2N7D A;  4KZ0 A;  3PLU A;  2N9P C;  1V5O A;  1YD8 U;  5LXH A;  5KHQ A;  2IO1 B;  3ZIM A;  2PE6 B;  3I3T B;  3A4R A;  2MQJ A;  2JRI B;  1CMX B;  1WM3 A;  5AZG A;  4GOC A;  4BKS D;  4W9G A;  4NQL B;  5IA7 A;  3IVF A;  2BYF A;  1WE7 A;  3EEC A;  3D32 A;  3C0R B;  1PQS A;  1WX8 A;  1R4N I;  2XEW A;  2KC2 A;  2NBV B;  4KVG B;  1KJT A;  3VDZ A;  4JLC A;  3PT2 B;  1WIA A;  3QIJ A;  1WMH B;  3VUW A;  5C23 A;  3B1L X;  4GDK A;  4ICU A;  3QHT A;  2JPH A;  3PRP B;  4KV2 A;  5D2M B;  3OJ3 A;  1C3T A;  4JL9 A;  2LXA A;  2Z0D B;  3WAL A;  1NI2 A;  2CHX A;  1AAR A;  4J6I A;  1E90 A;  4KZC A;  3QA8 A;  2DYO A;  4FUL A;  2IO3 B;  2MLB A;  3DBH I;  1XT9 B;  4BVU C;  4FJV B;  3VTU A;  5AZF A;  2UYZ B;  2ZJD A;  1EO6 A;  3PS6 A;  3IG3 A;  4RM8 A;  3PV1 A;  2FCQ A;  2J0J A;  2NBU A;  4XZ4 A;  2BKR B;  2GBM A;  3LDZ E;  4IG7 B;  1P3Q U;  2Y5B B;  1LQB A;  4RM9 A;  4IC7 B;  2XK5 A;  3EHV A;  2ZVN A;  1X1M A;  3M62 B;  5JHA A;  4HPM B;  1GJZ A;  2LGX A;  1Z2M A;  1WGY A;  2BGF A;  3VXW A;  3KW5 B;  2O6V A;  2DYB A;  2ZNV B;  4K7W A;  4M0W B;  2JZ3 B;  4ZYN A;  4F1S A;  5LXI B;  1KLV A;  2KX0 A;  3DCG A;  1WXS A;  4OVV A;  4W9K A;  4BOS C;  2CU1 A;  4FJY A;  4KIK A;  2QHO A;  3GOE A;  3L54 A;  3ZLZ A;  4IWQ A;  4AOF A;  3V61 A;  1YIW A;  2FCM A;  1KOT A;  1RFA A;  4PS8 A;  3IBE A;  3W1S A;  2KAN A;  2LVP A;  3VUY A;  5LLI A;  3IFW B;  4JQW C;  2L3Z A;  2KOX A;  4GDK B;  3O65 B;  3SU8 X;  2GBK A;  1GUA B;  1OGW A;  1LXD A;  1WH3 A;  4MH0 E;  1P1A A;  2NR2 A;  2ZZP B;  4HJK A;  1Y8R C;  5E6N A;  1E8Y A;  3RD2 A;  4OVU A;  3B0A A;  2RPQ A;  3VTW A;  3KUC B;  5J18 A;  2LVO A;  1J8C A;  4N9F 4;  4ZRJ A;  3OJ4 B;  3WA0 A;  3VQI A;  2MCN B;  2KK8 A;  4EEW A;  2KKC A;  1TBE A;  2NPT A;  4K7U A;  3A9K A;  3MJW A;  5D7G A;  4GIV A;  1FXT B;  1WJN A;  3OAW A;  2KFK A;  3DVN V;  1HE8 A;  2WYQ A;  2KC1 A;  2C5L C;  1SGH A;  3H7P B;  4BBN C;  2MSE D;  3DVG X;  4AJY B;  4B9K A;  1WY8 A;  1IP9 A;  2FCN A;  2FNJ B;  4JIO U;  1E8Z A;  4ZRK A;  3A4S C;  2KN5 A;  4DHJ B;  2O6V B;  4X57 B;  4NQK E;  1R4M I;  1V2Y A;  1WF9 A;  3A9J B;  1K8R B;  2L00 B;  3MHS D;  2NCN A;  4K7S A;  4G0N B;  2JVC A;  1E7U A;  3PRZ A;  3IHP C;  2AL6 A;  2KDB A;  5KHO A;  4NJ6 A;  2M8S A;  3DBR I;  1JRU A;  2LXC A;  3QX1 A;  2KJR A;  3W1S C;  4DK5 A;  2N1V A;  4AWJ A;  1YJ1 A;  2MBE A;  4YL8 A;  4ANX A;  1XD3 B;  3KH0 A;  1OTR B;  2G45 B;  2BF8 B;  2LVQ A;  1YQB A;  1EUV B;  3RZF A;  3ML8 A;  4NJ7 A;  3VTV A;  1WX9 A;  3ZDM C;  2GBN A;  1WMH A;  1S1Q B;  1A5R A;  1NDD A;  1P0R A;  3HM6 X;  3ZO5 B;  5CHF A;  2LGY A;  2KDE B;  3PHW B;  4FN2 A;  3UIP B;  2KZR A;  3PRM B;  5DPT A;  2KLC A;  2N7E A;  4IUM B;  2AWT A;  4MDK E;  4GSW A;  3ZRC A;  3ZTC A;  3QJZ A;  4IM0 A;  4WWN A;  3CMM B;  4PYU A;  3PPA A;  2C60 A;  4GN1 A;  4NAW A;  1TGZ B;  3M63 B;  3TL5 A;  5JH5 C;  2IY0 B;  1E7V A;  4IWO A;  2KHW B;  5G2N A;  3APD A;  2LJ5 A;  2MBH A;  3Q3J A;  2G4D B;  2IBI B;  4LDT B;  5D6J B;  2MX2 A;  3ONS A;  5IAA C;  2FIF A;  1E5W A;  3U8Z A;  1I42 A;  1F9J A;  4DDI D;  2GMI C;  3L13 A;  3UGB B;  4MGY E;  4E3C A;  2EMS A;  4BKT A;  3AI5 A;  4W9J A;  3OLM D;  2L7R A;  3QAR A;  2BWE S;  3L0W B;  3PZD A;  4A3O A;  1D3Z A;  5J2R A;  1GNU A;  1WX7 A;  1WGR A;  3BY4 B;  2YVC A;  5BO4 B;  4TV3 A;  2L05 A;  2W9N A;  4TQ0 A;  4ANU A;  5E6P A;  5CTR C;  2LUE A;  2CR5 A;  3AU4 A;  3ZRF A;  2REX A;  1C1Y B;  3ENE A;  3WIM A;  5HKH A;  4EUT A;  2R2O A;  2V1Y A;  3H7S A;  3H6N A;  4EZK A;  4II2 B;  2ZPY A;  4NPN A;  2L76 A;  2RGF A;  3ALB A;  1WFY A;  4W9H A;  4NAW B;  3TBL D;  2KJ6 A;  2B3A A;  1V9J A;  4BKG A;  3QQ8 B;  2DZK A;  2EMT A;  4LJO B;  3TMP B;  1VCB A;  3SDL C;  2KNB A;  4FHK A;  3H7P A;  2JUO A;  1V80 A;  3CSF A;  3DOW A;  1V49 A;  3R7R A;  2KXJ A;  5TR5 A;  2IY1 B;  3AU5 A;  3CF6 E;  3JVZ X;  1ZW7 A;  2KMA A;  4GB9 A;  3T9L A;  4MGI E;  4LJP B;  1XQQ A;  2DX5 B;  5FR6 A;  3L16 A;  4MM3 A;  3A9J A;  3X23 A;  1WZ0 A;  3PHX B;  2JWZ A;  3U7D A;  5G55 A;  2J7Q B;  3T8M A;  3VAW A;  4GGQ A;  5D94 A;  2K39 A;  4TQ1 A;  3PRE A;  1RLF A;  2UWQ A;  3ZUN A;  3TJP A;  3AXC A;  1SE9 A;  1IPG A;  4WQO B;  3KYD D;  5DPW A;  2O2V B;  1WRD B;  4W9E A;  4P7I A;  3V62 A;  4HCP B;  1U4A A;  3DVG Y;  4XC2 A;  2KWV B;  4MEL A;  2N9E B;  5DPR A;  2BKF A;  4DHZ B;  3L08 A;  5EDS A;  1V6E A;  1GC6 A;  2K6D B;  2NVU I;  3DVN U;  3KYC D;  3ZNH B;  1OEY J;  3WAN A;  3ECI A;  3ZNZ B;  1NBF C;  4HLE A;  4I6N B;  3VH3 B;  4XX5 A;  3R66 C;  2I1K A;  2KDI A;  4ANV A;  2O6V D;  1EF5 A;  1UD7 A;  4WJQ A;  1UZX B;  5L83 A;  3VH4 B;  2PEA A;  4EZL A;  2RR9 A;  4PS3 A;  3JSV B;  3HK0 A;  3PSE B;  2MRP A;  2N9X A;  3APF A;  1P9D U;  3APC A;  1WGG A;  3DQV A;  4HXD A;  2BYE A;  2CHZ A;  1Q1O A;  2KTF A;  2R2Q A;  4KDL B;  5C1Z A;  2MBQ A;  3RUI B;  3QK0 A;  4IM2 A;  2WX0 A;  1P98 A;  1T0Y A;  2KDF B;  3VHT C;  1UH6 A;  2KWC A;  1TTN A;  1V5T A;  2D2Q A;  2M0X A;  5AZH A;  2GOW A;  3ZNI D;  4ASW C;  4WJN A;  1WJU A;  1UEL A;  4IM3 A;  2AEH A;  4EKU A;  4M8M A;  2FAZ A;  3RCZ A;  3KUD B;  2JF5 A;  3UIN B;  4MJS B;  1WXM A;  2DAF A;  2DZM A;  4WJP A;  3RT3 B;  2I1J A;  3NY5 A;  1J19 A;  1QZE A;  2KD0 A;  2LRW A;  2C9W B;  3LJ3 A;  2CKH B;  3RYT A;  3PGE A;  3U30 A;  2KWU B;  2OJR A;  4FLH A;  4GMV A;  2D3G A;  4BKS A;  1WGH A;  3X0W A;  3QWZ B;  2KJH B;  1LM8 B;  2DZI A;  3N30 A;  1L7Y A;  4GDL B;  3B08 A;  5E6O A;  1SIF A;  3JYU A;  5DCN A;  2KFJ A;  4I6P A;  2XBB C;  2N4F A;  3ZW3 A;  4ZDV A;  2RSU A;  4W9D A;  4DHZ E;  5DPS A;  4EZJ A;  3WAO A;  2MW5 A;  4MEM A;  3NZS A;  2GBJ A;  3SHQ A;  2LZ6 A;  4W9L A;  3K9P B;  2LWP A;  3VVW B;  2D11 A;  1OEY A;  2LAS A;  1I35 A;  2BWF A;  1ZKH A;  1V81 A;  2IYD B;  4TKN A;  5GMV A;  4A3P A;  4K81 A;  1WM2 A;  2ZVO A;  2KLG A;  1UGM A;  4CYE A;  4B95 A;  4I6L B;  4ZRI A;  1S3S G;  2JY6 A;  4HCN B;  3ZVV A;  2G4S A;  2M17 A;  3AUL A;  3M95 A;  3UIO B;  2L0F A;  4WWO A;  3V6E B;  2O2V A;  4A20 A;  3CST A;  4IWP A;  4EFO A;  4IW0 A;  2FCS A;  3NHE B;  4HDQ A;  2JT4 B;  1LFD A;  2LD9 A;  2RD0 A;  3M3J A;  4PS7 A;  4WJO A;  4BBN F;  1RAX A;  2ZCC A;  2V4L A;  3QCA A;  5JZE B;  4TUU A;  2Z59 B;  1Q5W B;  4W9C A;  4B6W A;  4FA6 A;  2DZJ A;  4GU2 A;  1WJ4 A;  1WE6 A;  2KQ7 A;  4AUQ C;  3NOB A;  1GG3 A;  1ZGU B;  2MBO A;  3WAP A;  2PJH A;  2DAJ A;  1RRB A;  1J0G A;  2L8J A;  4KSL C;  1WR1 A;  2EKE C;  3RZW C;  4E74 A;  2HD5 B;  3L10 B;  2V3S A;  1OQY A;  1MG8 A;  1YX5 B;  4NNJ B;  4HWI B;  2KVR A;  3JSV A;  3ML9 A;  3TCA A;  2G3Q B;  2KTR B;  2ZNV C;  2HE7 A;  3TIX A;  4II3 B;  1WZ3 A;  4GXB A;  3VUX A;  5L95 C;  2CHW A;  2DHZ A;  4FHJ A;  4G11 A;  2J0M A;  4M8N A;  3H9D A;  4MSM B;  5CX3 A;  3W1Y A;  3ZNG C;  3H1U A;  1KM7 A;  3PLV A;  2ZEQ A;  2LGD A;  2N1W A;  2WDT B;  2K25 A;  3MTN B;  2NBW B;  1EF1 A;  3K9O B;  2C7H A;  2A5U A;  2CS4 A;  2GBR A;  4MGZ E;  2DEN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...