3ZLZA

Lys6-linked tri-ubiquitin
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
73
structure length
73
Chain Sequence
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGRQLEDGRTLSDYNIQKESTLHLVLRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Assembly, Analysis and Architecture of Atypical Ubiquitin Chains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords UBIQUITIN
total genus 18
structure length 73
sequence length 73
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3zlzA00
1WXMA 1WX8A 3QC8B 2MLBA 4NNJB 1WXVA 4OVUA 3DCGA 1LQBA 3CF6E 2CKHB 1UBQA 4EUTA 1E90A 2Y5BB 2BWES 4FHJA 3S2AA 4CYEA 1RLFA 1WGGA 4DBGA 2XEWA 3WAPA 1D3ZA 4M8NA 3L54A 3AU4A 4ZYNA 3ZIMA 1WYWB 2KJRA 1TTNA 1WFYA 3A1QB 4IWPA 4MELA 4P7IA 3WAMA 4F1SA 2BYFA 1GC7A 4KVGB 2BF8B 2K8CA 4LDTD 4AJWA 2A5UA 4NJ6A 3V61A 1UELA 1OTRB 1YX5B 2IBIB 1V86A 3W1SC 3APDA 2CHWA 3H7PA 3VAWA 2EMSA 2C7MB 3QK0A 1UGMA 2KKCA 3RT3B 3ZNGC 3H1UA 3CSFA 1BT0A 2KDFB 4F7ZA 3EECA 5E6PA 4KDIC 3UIOB 4ICVA 3PT2B 3M3JA 2CR5A 3H7PB 3IBEA 3KH0A 1UBIA 2MBQA 3V62A 1UZXB 4WJPA 4EEWA 4EZJA 5CHVC 3AULA 5L83A 2LVOA 3ZDMC 5JH5C 2PPHA 2L05A 1NDDA 1WGDA 2NR2A 2L7RA 3VFKA 1V80A 3HM3A 1E8ZA 1FXTB 3DDCB 2FCQA 2L76A 2NBVB 2KOXA 4BBNC 5CHFA 4TQ0A 1IPGA 3MTNB 1RFAA 3A33B 1E7UA 2JY6A 1KOTA 4I6LB 3R3MA 1S3SG 2C7NB 1H4RA 4IW0A 5LXHA 1KJTA 4GN1A 1F9JA 1WX9A 4NY0A 2MCNB 5JHBA 3DVGX 5IAAC 1WI0A 4WJNA 1SE9A 3MJWA 4XZ4A 2JZ3B 3GZNI 1TBEA 1GC6A 1P98A 4TKNA 2KN5A 4W9IA 3APFA 3EHVA 2O6VB 2KDBA 4GSWA 3DQVA 4G11A 1L7YA 2ZCBA 3BINA 2B3AA 1RRBA 2KWCA 3SD5A 2FCSA 3DVGY 5DPRA 3JW0X 1YQBA 3C0RB 2LASA 2N1WA 4TQ1A 3PHXB 2HE7A 2KANA 2DZMA 1EUVB 2KWUB 1NBFC 2L0FA 2N9EB 4G3XB 4KDLB 3LJ3A 2WDTB 3L10B 2IZVB 5J18A 3ZUNA 2KC1A 2Z0EB 3DVNU 3N32A 3IHPC 4E71A 3TBLD 2CU1A 4I6PA 4FULA 4FLHA 3TJPA 1CMXB 1E8YA 4BOSC 2KX0A 2MWSB 3NZUA 1RAXA 1C3TA 5AZGA 3A9JA 1V9JA 3VUYA 5HKHA 4HK2A 2KQSA 2AEHA 1YJ1A 1WF9A 4GDLA 2JF5A 4BKSD 1M94A 2M1MA 2N7DA 4HCNB 2D2QA 2DYOA 2G45B 2LGXA 4URKA 2L00B 2V1YA 2XK5B 2KJ6A 4GIVA 4IC7B 2BYVE 3OJ3A 1WMHB 3A1QA 3QHTA 3X0WA 1R4NI 1TGZB 4MGZE 3QWZB 3K9PB 5DPSA 4MGIE 1J8CA 5G55A 1XQQA 4MGYE 1YIWA 4HPLB 2I1KA 3T8MA 3HHMA 1WMHA 3QX1A 4K7UA 2KMCA 3PSEB 2MX2A 2HD5B 2KD0A 3T9LA 3H9DA 3P2BA 4TUUA 4DHJB 3ZNHB 2Z0DB 1WXSA 2JT4B 1V5TA 2LRUA 2O2VB 2DENB 3JSVB 3QA8A 3Q3FA 3A9JB 3ZRCA 2FIFA 4IWQA 5D7GA 3ZRFA 2AWTA 4FN2A 4KSLC 2DZJA 3TMPB 2LGDA 4W9FA 3RD2A 2REXA 3KUDB 4JL9A 2C7HA 4TV3A 4DK5A 4BKSA 3AI5A 4B95A 2L0TA 4GU2A 1OGWA 2J7QB 4W9CA 2RR9A 4W9JA 2FAZA 5TR5A 4A3PA 3KYCD 2K1FA 4NAWA 2KDIA 2ZPNA 4GGQA 5AZHA 1P9DU 5DCNA 2LGYA 3NS8A 3A9KA 3K9OB 3DVNV 2LI5A 4FHKA 3ZTCA 3IG3A 1Y8RC 3RZFA 2JWZA 1H8CA 4NPNA 3PREA 4FA6A 1U4AA 2KLCA 1OEYA 4NAWB 2MBOA 3IVFA 3PGEA 4MM3A 4IG7B 1V5OA 2NVUI 3ZKJC 1WR1A 2KQ7A 1P0RA 3VTUA 3SDLC 2ZNVB 3M95A 1PQSA 1X1MA 2DHZA 3JYUA 4GDLB 4RMAA 5GMVA 4J6IA 3RCZA 4B9KA 5KHQA 2ASQA 4AJYB 2BGFA 2FNJB 2KTFA 4YL8A 3DBRI 1VCBA 3B08A 2DZIA 5DPWA 4KIKA 1SGHA 2WX1A 4FJYA 2KC2A 2GBNA 3R66C 2N4FA 3V6CB 4DDGD 3D32A 2KWVB 1WXAA 3A9KB 4AP4C 4JLCA 3VUXA 4ZRKA 4KZ0A 3PVLA 2RD0A 4RM8A 2AL3A 1WGHA 4IM3A 2ZJDA 3NZSA 2BYEA 1LXDA 2FUHB 4W9LA 4JIOU 4A3OA 2MP2A 4AOFA 2MQJA 4B6WA 4XC2A 3RULA 3I3TB 1WJ4A 2KJHB 4WWPA 2WWZA 1KM7A 2IYDB 4WJQA 1A5RA 4IWOA 2KX3A 4WAAA 2M0XA 3VTVA 2G4SA 3NOBA 5DPTA 3UQAA 3ENEA 1MG8A 1V81A 4IM2A 4KSKC 2UYZB 4K7SA 4E3CA 3WAOA 3L16A 3N30A 2K8BA 4DDID 3JVZX 5CX3A 2V3SA 3APCA 4DHZB 2KFJA 4MDKE 3ALBA 2C9WB 4ZRJA 3KW5B 3QAQA 1KLVA 1XD3B 3UIPB 2ZEQA 1XT9B 2N7EA 1WX7A 2MBBB 2KTRB 2K6QA 1Q1OA 4GMVA 1ZKHA 4W9DA 2OOBB 4WJOA 3TL5A 1VD2A 2MP2B 2LRWA 3ECIA 3KUCB 4LJOB 5D6JB 3WA0A 4ANXA 4DHZE 3ZDTA 2L8JA 3L08A 3ZTDA 3BY4B 2BKFA 2C60A 2M8SA 2MSED 3QCAA 5CHWA 2I1JA 3OLMD 4X57B 2FCNA 3HK0A 4OVVA 3ZVVA 4K1RB 1IYFA 2DZKA 3ZNZB 1S1QB 2L3ZA 4HVBA 1WJ6A 3L0WB 1V49A 3DBLI 4HWIB 4MH0E 3KVFB 3WIMA 2MA9B 4FJZA 4HPMB 3AXCA 2LVQA 3OAWA 2CHXA 4PS8A 1WJUA 2KFKB 4M8MA 4AUQC 3UQBA 2FIDA 4LCDE 2KDEB 2JPHA 4F8CB 2DX5B 2JXXA 1OEYJ 3O65B 3QIJA 1EF5A 1P1AA 3PLUA 2KK8A 1WE7A 3U8ZA 2DAJA 2DYMA 2KLGA 4PS7A 3W1SA 5L95C 3N3KB 3JSVA 3Q3JA 4HCPB 1ZGUB 4W9GA 3TCAA 3VVWB 1Z2MA 2ZZPB 1Q0WB 4BKTA 2JZZA 2R2OA 4XX5A 3EC8A 5IA7A 3AU5A 4GDKA 5E6OA 3DOWA 4E74A 3KYDD 3VQIA 1EO6A 2MBHA 1GG3A 2J0MA 1QZEA 3A4SC 4II2B 3WANA 3WALA 5LLIA 2IO1B 5BO4B 1ZW7A 2NPTA 3DPDA 4EZLA 5J2RA 2BPSA 3QJZA 4WQOB 5JZEB 2C5LC 2EKEC 3RZWC 1LFDA 3HM6X 4CHKA 2MBEA 2K8HA 2PE9A 1J19A 2RPQA 2UWQA 4K81A 3ZW3A 3VDZA 2G3QB 2O6VA 2HTHA 1UD7A 4BFRA 2D10A 4GXBA 2IY1B 3PRZA 3U30A 2WX0A 4IUMB 5J17A 2OJRA 4WWOA 5AEKB 2GBKA 4FADA 5LXIB 2EMTA 4BVUC 2JRHA 2XK5A 2HJ8A 3PZDA 4JGHB 2D11A 1WGRA 2J0KA 2YLMA 2M4NA 3RUIB 3VUWA 4G50A 1T0YA 3UF8A 4DHJD 2PEAA 3DBSA 2LZ6A 3UINB 3V60A 4DXAB 3U7DA 4W9EA 4GDKB 5G2NA 2KVRA 4HLEA 3R7QA 2A4ZA 3LDZE 3TIXA 4EKUA 1GUAB 1WY8A 2R2QA 4WWNA 4MJSB 2QHOA 4KV2A 2N9XA 2N1VA 2G4DB 2Z59B 3ML9A 3PV1A 2KO3A 1P3QU 1Q5WB 1GNUA 4ANUA 4HDQA 3NHEB 1WM2A 2XBBC 3IFWB 3R7RA 2GOWA 4EZKA 3V6EB 3OJ4B 1E8WA 3PPAA 5D2MB 1WGYA 2K6DB 2ZPYA 4MJSA 1WM3A 1L2NA 2ZVOA 4PS3A 2GBMA 5AZFA 1WR6E 5D94A 1UH6A 3SHQA 3UGBB 1E8XA 1C1YB 3A4RA 4HJKA 2GBJA 2V4LA 4EFOA 5C1ZA 4RM9A 1LM8B 4NJ7A 3PRPB 4N9F4 4CO7A 2LVPA 2ZNVC 4BOZB 4PYZA 1K8RB 4ANVA 4BKGA 3MHSD 2JRIB 2JVCA 2KFKA 4KZCA 2KHWB 2FCMA 4KIKB 2O2VA 4MSMB 4A20A 1R4MI 3NY5A 2KNBA 4ZDVA 1IP9A 2NPTB 4ICUA 3CMMB 3KUZA 1AARA 1EF1A 2D3GA 2LD9A 3W1YA 1I35A 4FBJB 2NCNA 5EDSA 2J0JA 2YVCA 4II3B 2CS4A 1E5WA 1WJNA 5E6NA 3VH4B 2RSUA 2KZRA 3VH3B 2NS5A 2JUOA 4K7WA 2IY0B 4EOYA 4AWJA 1J0GA 2IO0B 3H6NA 4M0WB 4PYUA 4HXDA 1WH3A 1YD8U 4ANWA 2WYQA 2BWFA 3ZLZA 2BKRB 2MW5A 3M63B 3B1LX 3PHWB 3VXWA 1YX6B 2NBWB 4MEMA 4LJPB 2IO2B 2VRRB 5CTRC 2PE6B 3SU8X 4DWFA 4HDOA 2LXAA 5C23A 3H7SA 3QQ8B 1E7VA 3PTFC 5JHAA 4GOCA 2AYOB 3M62B 4I6NB 4BBNF 2LWPA 1V2YA 1WRDB 2LUEA 3HIZA 1WE6A 3EFUA 3GOEA 4NQKE 1V6EA 5FR6A 5KHOA 3RYTA 2LJ5A 3VHTC 1HE8A 2PJHA 4FJVB 4NQLB 2ZVNA 2MRPA 4ZRIA 1WZ0A 2DYBA 2KMAA 2KXJA 3CSTA 2N9PC 1NI2A 2M17A 2D07B 2GMIC 2GBRA 2LXCA 2RGFA 3L17A 1WIAA 3X23A 3ZNID 4IM0A 1JRUA 2K39A 2NBUA 4ASWC 4G0NB 4GB9A 1GJZA 3PS6A 2KTRA 2W9NA 3PLVA 2AL6A 4MSQB 1ISNA 3ML8A 2K25A 1WZ3A 3ZO5B 1SIFA 1I42A 1G6JA 4LDTB 3L13A 3ONSA 4JQWC 3QARA 3B0AA 2DAFA 3PRMB 4MGKE 2O6VD 4W9KA 1Z5SB 4W9HA 2ZCCA 2CHZA 3DBHI 2IO3B 1OQYA 1TZ1A 3VTWA
chains in the Genus database with same CATH superfamily
2PMVA 3DCGA 3CF6E 1E90A 2Y5BB 2WXRA 1WGGA 1CJEA 4DBGA 2IGGA 2J4XA 3AU4A 3ZIMA 1SE2A 1WFYA 4IWPA 5HI1A 3WAMA 1DOIA 5EE3A 1YX5B 1N60A 1UWMA 2IBIB 4NAMA 2CHWA 3VAWA 3DHHC 1UGMA 3H1UA 3GB1A 1BT0A 3EECA 4N59A 3UIOB 1T6BX 2QEJC 3E9SA 1TKEA 2ZW0A 4EEWA 1QF6A 5CHVC 3AULA 3U7ZA 2NR2A 2DBYA 2X38A 3VFKA 3HM3A 1FXTB 3DDCB 1RYJA 2KOXA 1T0QC 2KMMA 3MTNB 2DNFA 1E7UA 4ZHOA 2JY6A 3R3MA 2BW2A 3U4EG 2ONQA 5BYRA 2MCNB 2DWQA 2JZ3B 5C2TB 2WDRB 4TKNA 1KH0A 4YWGG 1HQRD 1ZDXA 1L6VA 2KVZA 4MACA 2UU7A 2LASA 4HKZE 3SR6A 2HE7A 2DZMA 4XWTA 1KFYB 2WDTB 2IZVB 3RI7C 4OZAA 4E71A 3TJPA 1QOFA 1CMXB 1OQRA 4BOSC 1KTKA 3NZUA 5AZGA 1V9JA 1P7EA 4HK2A 1YJ1A 1WF9A 2JF5A 1NVID 5GXGB 4URKA 1JCKB 4IDIA 3KQ4A 5H92C 3ZQ4A 3X0WA 2PVOD 2BTEA 4RH6A 3LYYA 5G55A 2B76B 2WU2B 3HHMA 3QX1A 4K7UA 2KMCA 3PSEB 3N9YC 1YJJA 2PVGC 3T9LA 3H9DA 3P2BA 1ET9A 5D3DA 2Z0DB 2O2VB 3QA8A 3Q3FA 3NUHB 1SXTA 3FILA 4FN2A 1E7PB 2DZJA 1HTOA 4ITKA 4W9FA 2N9KA 2LUMA 2REXA 4JL9A 2WXPA 4B95A 4GU2A 3TUOA 1OGWA 4A3PA 5T8IA 4HROA 2M0AA 1H8CA 4NAWB 3PGEA 4IKGA 4MM3A 4C80A 3ZKJC 1HZ6A 1IUEA 2KQ7A 1P0RA 4P16A 4ZRQA 3VTUA 1DYQA 3SDLC 1I4QA 4RNAA 1X1MA 3RCZA 4B9KA 5GMVA 2H88B 4YL8A 1L0YB 3DBRI 1YQ4B 1FFUA 4ZHPA 3I9V1 3ABVB 4FJYA 3R66C 2N4FA 4H2AA 1SF0A 2KWVB 1WXAA 3A9KB 4JLCA 2RDHA 4RM8A 1WGHA 2WGSA 2ZJDA 3AH7A 1JROA 4W9LA 2FUHB 4JIOU 4A3OA 1CQVA 3AE7B 1JWBD 3RULA 1SJED 1LGRA 1N5WA 2LEKA 1YNTE 3VTVA 2OJWA 4S0RA 3ENEA 4KSKC 2UYZB 1PDXA 3L16A 3Q8BA 3HVZA 3N30A 1TS3A 3JVZX 2KFJA 2CU3A 1SSNA 1T0SC 1Q1OA 2OOBB 4WJOA 1FRDA 4LJOB 3WA0A 1NYQA 2L8JA 3L08A 4B0EA 3BY4B 2C60A 2M8SA 3QCAA 5CHWA 4X57B 3HK0A 3URYA 1S1QB 2L3ZA 1WJ6A 4MH0E 3AE8B 4R3DA 1E10A 3AXCA 3CWIA 2LVQA 4PS8A 2KDEB 1SE4A 2JXXA 4N6EB 3O65B 4REZA 4US8A 3U8ZA 3N3KB 4LNKA 2WXFA 1VZ6A 4BKTA 4YTNB 2CJOA 5E6OA 1PGBA 3BVZA 2K9XA 3WALA 5LLIA 5J2RA 3QJZA 2IJ0A 2MBEA 2RPQA 1J19A 3DHGC 3ZW3A 3VDZA 2K22A 5HG2A 3U30A 2I38A 5J17A 2GBKA 1D5ZC 2JRHA 2HJ8A 3PZDA 2G1EA 1WGRA 4G50A 3U7DA 4W9EA 4GDKB 5G2NA 2AX5A 3TIXA 1GUAB 1SIJA 1L5PA 4KV2A 1P3QU 1TY2A 2ACZB 1WM2A 2XBBC 2GOWA 3OJ4B 4HEA1 1E8WA 4YT0B 1C4AA 1I4XA 2ZVOA 5D94A 3UGBB 3LB8C 2M56B 3RNFC 2GBJA 1HZ5A 2WDVB 3BIID 5C1ZA 4NJ7A 1FO4A 3PRPB 4CO7A 4WH4A 2WXMA 4PYZA 4BKGA 2JRIB 4RFBA 2JX5A 2MJDA 4KZCA 4KIKB 4MSMB 1R4MI 2FE8A 4WQMA 2NPTB 4LNNA 3CMMB 3IT6B 1EF1A 4IOIE 2LD9A 5EDSA 2YVCA 1E5WA 1WJNA 3IAS1 4D2KA 4K7WA 1AW7A 1YD8U 3ZLZA 2BKRB 3M63B 2INCC 3B1LX 3PHWB 2OEDA 1YX6B 4LJPB 2L52A 3SU8X 1MG4A 2LXAA 1E7VA 4C7ZA 4M0WA 2LJIA 1WRDB 3HIZA 1ZXIA 1WE6A 3EFUA 5FR6A 3ETRA 2ZVNA 2MRPA 3AE4B 1IGDA 2GMIC 3ZNID 4ASWC 4G0NB 1GJZA 1I7HA 2KTRA 1TS5A 2W9NA 3PLVA 2K25A 1SIFA 1I42A 3ONSA 1N63A 1LO5D 3RNAC 4MGKE 1AWDA 3BVMA 3E56A 2CHZA 4RF1A 4RF0A 3HUIA 1LQBA 2W55A 4YSYB 3S2AA 2KYWA 3I63C 2XEWA 3WAPA 4ZYNA 2WXNA 4KVGB 4DXFA 4LDTD 4AJWA 2A5UA 4NJ6A 4XDDA 1V97A 3V61A 1VLBA 3GP7A 4JX1C 2C7MB 2LGIA 3QK0A 1HXYD 2BBCA 2W3SA 1L0XB 1YN5A 3SFEB 4KDIC 3AEFB 3PT2B 3R2TA 1FD6A 3H7PB 3IBEA 2WQYB 5L83A 2D5GA 1FPYA 2Y3AA 1NENB 1T5XD 1SJHD 2PPHA 2V3PA 1NDDA 5JH5C 1WYGA 1GAQB 2W3RA 2YEPB 1KOTA 4I6LB 3VRAB 4AS1A 3RNEC 1D5MC 4EE2A 1F9JA 1WX9A 4NY0A 4XZ4A 4MM3B 1QILA 4WIPA 4HJGE 1L0VB 1C76A 1GC6A 1P98A 4W9IA 2KN5A 2MH7A 3O13A 4GSWA 3DQVA 3Q3MC 2RDBC 3GE3C 1RRBA 2FCSA 5DPRA 1YQBA 3B2GA 2L0FA 2KWUB 4KDLB 4G3XB 3VR9B 3C8YA 3LJ3A 5D3IB 3N32A 3IHPC 2MWSB 1PFDA 1YJIA 4OHJA 3I5JC 2WXJA 2K0PA 4GIVA 3OJ3A 3W5VB 2QCZA 1TGZB 4MGZE 3QWZB 1VZ7A 4MGIE 1J8CA 1FIQA 2I1KA 2E6XA 3P1MA 5IP4D 1L6UA 2KD0A 1V5TA 1D6EC 1UGJA 5MPOA 2FIFA 3WCQA 1WWTA 2AWTA 1TJEA 5HFYA 3TMPB 4YSZB 3MJ5A 3RD2A 3KUDB 4HPPA 4BKSA 2L0TA 2YEPF 2FAZA 2PIAA 2K1FA 5FR3A 1FRRA 3K9OB 2LI5A 4MH8A 2N0SB 3IG3A 1Y8RC 4NPNA 2JWUA 4FA6A 1U4AA 3RPFC 1P7FA 1OEYA 2RPVA 1FXAA 1VRAB 2NVUI 1V1OA 1STEA 3M95A 4KGSA 1PQSA 2DHZA 3JYUA 4GDLB 4J6IA 3Q2AC 5BYSA 3B08A 2DZIA 5DPWA 2J53A 4KIKA 4LTUA 3SEBA 1JWMD 3V6CB 4DDGD 4YXDB 2QDFA 4KKJA 5BMIA 2RD0A 3NZSA 2BYEA 1YN4A 1ZUD2 1MHHE 2MQJA 4XC2A 3I3TB 1V1PA 1KM7A 2IYDB 1A5RA 4WAAA 1MG8A 4IM2A 1PGXA 1YQ3B 3MHZA 4USAA 2K8BA 1EM7A 3APCA 3U2SC 2C9WB 2ZEQA 3DHIC 2MBBB 2KTRB 2K6QA 3FC4A 1ZKHA 3TL5A 1VD2A 1MJDA 1KF6B 2QIEB 4NJCA 3ZTDA 2MSED 3OLMD 1IYFA 2FCNA 3ZVVA 2Y5CA 4HVBA 1YOVB 3BYTB 3WIMA 4FJZA 4HPMB 3OAWA 4M8MA 2KFKB 4AUQC 4M00A 2FIDA 2G9HD 4LCDE 2JPHA 1FFVA 1XXGA 1EF5A 1P1AA 3PLUA 4ACFA 3N1YC 4OZCA 5C3JB 2RMMA 2DYMA 4PS7A 5L95C 2INPE 2MJEA 3Q8FA 4HCPB 3UI3A 1Q0WB 4LNIA 4XX5A 1VDVA 4E74A 3KYDD 4MT5A 2J0MA 2MBHA 3BZDB 5BO4B 1ZW7A 2NPTA 4EZLA 4JWSC 5JZEB 1WRIA 3HM6X 4CHKA 3R2IA 2UWQA 2RDGA 3AEEB 4K81A 1UD7A 4YSXB 4BFRA 4DQOC 5LNK1 5AEKB 5LXIB 2XK5A 1F2RI 3RUIB 1T0YA 3UF8A 5IO9A 4DHJD 4AQ7A 1E9MA 4DXAB 2BS3B 2BB5A 1J7BA 4HLEA 2XNAC 3R7QA 2A4ZA 4PK1A 1ROEA 1WY8A 2R2QA 4JE3B 4WWNA 2I2YA 1E0ZA 5AUIA 3ML9A 1Q5WB 2M19A 4EZKA 2IDYA 3AE3B 3V6EB 2VZKB 1TT5B 1WGYA 2ZPYA 4MJSA 4OVZA 2INDC 2WXHA 3P4PB 2BS2B 3P4QB 2TSSA 2LVPA 4ANVA 1K8RB 1QT9A 2JVCA 2FCMA 4A20A 4ZDVA 3KUZA 2D3AA 1AARA 2OHFA 3W1YA 1I35A 4FBJB 1EU3A 2RSUA 5H8YE 2KZRA 2J42A 2JUOA 2V3NA 1UF0A 2IY0B 4NZLB 2IO0B 1WH3A 3Q3OC 2WYQA 2BWFA 2MW5A 3NG0A 2BYTA 3VXWA 2NBWB 2WHIA 4MEMA 5CTRC 3HVDA 3QQ8B 3PTFC 5JHAA 4I6NB 2LWPA 3AB5A 1N5XA 1V2YA 2LUEA 2EELA 4NQKE 3AECB 2JXTA 2LJ5A 4FJVB 5IN7A 1BMLC 3MC0B 2KXJA 1SB3C 2D07B 1R4MB 3L17A 4GLSC 1NEKB 1J7AA 4MSQB 4KKIA 3KWLA 1NYRA 2NMQA 3W9CB 1G6JA 1JQ4A 4JQWC 1FEHA 3QARA 2FBWB 2HJ1A 1Z5SB 4W9HA 2ZCCA 3VTWA 2MEKA 3SHQA 1TZ1A 1WXMA 1WX8A 3QC8B 4JPSA 2MLBA 1WXVA 4LNOA 1FNWA 2IPKD 1UNSA 1L4ZB 1UBQA 4FHJA 4CYEA 5JXVA 2SEBD 4M8NA 3L54A 1WYWB 2KJRA 3A1QB 1ET6A 4MELA 2BYFA 2BF8B 2K8CA 1OTRB 4KGRA 3W1SC 3H7PA 1E6EB 3TEZA 3ZNGC 2W54A 3VR8B 2KDFB 2WXLA 3NRZA 5E6PA 4F7ZA 4OZBA 3DBRB 1UBIA 2MBQA 1ENFA 1AN8A 2VH2A 3OG5A 4WJPA 3NVWA 4EZJA 2KAJA 2LVOA 3ZXVA 3ZDMC 3RN9C 2L05A 1WGDA 1V80A 1E8ZA 2FCQA 2L76A 4FXCA 3TSSA 4TQ0A 1IPGA 4XYCA 1PYWD 3A33B 2AQ3B 1S3SG 1H4RA 4IW0A 2VZKD 3DVGX 5IAAC 1WI0A 1SE9A 3MJWA 4CQNA 2CJNA 4ZYSA 3GZNI 1TBEA 3OWEB 4ZOHC 3APFA 3ZJUA 3EHVA 2KDBA 4G11A 1L7YA 2ZCBA 3BINA 2B3AA 2WXOA 2AQ2B 3JW0X 4TQ1A 3PHXB 2KANA 4J3OD 2N9EB 3L10B 3ZUNA 1MVKA 3NZ3A 2KC1A 2Z0EB 3DVNU 1HTQA 3TBLD 4I6PA 4FULA 4FLHA 1IBXA 1MFWA 1M4VA 1RAXA 4KX6B 3VUYA 5HKHA 3HRDD 2N7DA 2FUG1 2G45B 2L00B 2V1YA 2KJ6A 1WMHB 3QHTA 2PTLA 2KWDA 4XE0A 2L32A 3P4RB 4MGYE 4HPLB 3T8MA 3RFZB 3NJTA 3KLSX 2JYEA 2HD5B 1JW9D 4TUUA 4RGOS 4DHJB 3T3OA 1RFKA 1WXSA 1XLPA 2JT4B 5E6JA 1JWUD 3DWMA 3JSVB 3A9JB 3ZRCA 3ZRFA 3J9CA 2LGDA 1OFFA 3AEBB 1WGKA 2HTME 2C7HA 3GZNB 3ZJTA 4W9JA 1SEBD 3KYCD 2KDIA 1UWXA 4GGQA 1SBBB 1P9DU 5DCNA 5AZHA 2LGYA 3NS8A 3DVNV 4FHKA 1JRPA 3U52E 4JWUC 3EFCA 3Q8EA 3IVFA 4IG7B 1V5OA 4HKQA 4TMAB 2KT7A 5KHQA 2JZPA 4AJYB 2BGFA 2FNJB 3TEYA 1VCBA 2IGDA 5BMGA 2WX1A 1XLNA 5EE1A 1PGAA 1VZ8A 2J52A 4ARCA 1DOXA 4RGMA 4AP4C 1ZOYB 3NVZA 4ZRKA 4KZ0A 3PVLA 3NS1A 4IM3A 1N61A 4M02A 1L4DB 1D5XC 3DBLB 2NTSA 4TSSA 4WWMA 4B6WA 2WWZA 1JALA 3P63A 4WJQA 1KLUD 2KX3A 1TKYA 2G4SA 1RWSA 1V81A 1HA5A 2X8XX 4K7SA 2BB6A 3Q6BA 5I4DA 3AV8A 4N58A 4DHZB 3KW5B 3QAQA 1KLVA 4A6QA 1WX7A 2QC8A 1VJKA 3TEXA 1XO3A 1NI3A 4L23A 2LRWA 4A8XC 3ECIA 3KUCB 4ANXA 4DHZE 5EE9A 1V1PB 2IGHA 1TKGA 2I1JA 4K1RB 3ZNZB 2QSDA 3ZGZA 2V4IB 3L0WB 3ZXRA 3DBLI 1F2RC 3KVFB 1XF5L 3AE5B 4UDUC 1ZPSA 3Q14C 3DBHB 1TZOA 1A70A 4F8CB 2EKIA 2DX5B 4WAFA 3QIJA 4RGTA 5IOIA 4DXGA 2KLGA 3BVGA 3W1SA 3JSVA 3Q3JA 4BZAA 1ZGUB 1XCQL 4W9GA 3VVWB 1Z2MA 1TIFA 2R2OA 4P1BC 3N1XC 3EC8A 5IA7A 4GDKA 3DOWA 3I57A 1EO6A 4II2B 1I4GA 2H89B 2IO1B 3RMKC 1QQRA 2BQQA 3DPDA 1DOYA 4WQOB 2EKEC 1LFDA 1GOZA 4LK0M 1FCLA 3GE8C 3SFDB 2O6VA 4YTPB 3PRZA 4XWWA 2OJRA 4FADA 2EMTA 4BVUC 4JGHB 2D11A 1EWCA 4BAXA 3NVYA 4XDCA 2PEAA 3DBSA 2LZ6A 3UINB 3V60A 1C9FA 4S17A 4M01A 4EKUA 3LDZE 1FMAD 2QHOA 2WXKA 2N9XA 1F1HA 3PV1A 3FAHA 2WDQB 3NHEB 3IFWB 3R7RA 1XCTL 2WNMA 2GI9A 3AMZA 5D2MB 3PPAA 1L2NA 1WM3A 5AZFA 1WR6E 1RM6C 1J7CA 2LHEA 1C1YB 4HJKA 1Y56A 2V4LA 5BMHA 4RM9A 1LM8B 1GB4A 3AE9B 4RCOA 4C7YA 2KFKA 2BS4B 2KHWB 2O2VA 2KNBA 4C56C 1IP9A 4ICUA 2MHJA 1B1ZA 2D3GA 1F0ZA 1QOAA 2NCNA 3PZ8A 2J0JA 4II3B 4C00A 2L83A 3VH3B 4WURA 4EOYA 3Q69A 1J0GA 4M0WB 4ANWA 2W82A 3Q8CA 2D3BA 2IO2B 2ON8A 2VRRB 2PE6B 3H7SA 2PW9A 2PLPA 3V05A 4GOCA 1I4RA 1VR9A 4BBNF 3NVVA 4US9A 3VHTC 3LXFA 1DGJA 1V6EA 3RYTA 1HE8A 3PO0A 2PJHA 2WU5B 4A55A 3MC9A 4ZRIA 1WZ0A 3CSTA 2DYBA 3CIRB 2NTTA 2M17A 1MPEA 4Q2JA 2GBRA 2LXCA 2RGFA 1WIAA 2LHDA 2NBUA 2WXGA 3PZ7A 1GB1A 3PS6A 1K51A 2INNE 1R7SA 4LDTB 3L13A 2D3CA 3B0AA 4YTMB 3PRMB 2O6VD 3ZYYX 1Q10A 3N1ZC 3DBHI 2IO3B 1OQYA 1IBXB 1UUPA 4NNJB 4OVUA 2CKHB 2JYTA 4EUTA 3EA6A 2BWES 1RLFA 1QKZA 1D3ZA 1PUTA 1TTNA 4P7IA 4F1SA 1GC7A 1K52A 3W5UB 3KWVA 2BT6A 1UELA 1V86A 3APDA 4OW0A 2EMSA 2KKCA 3RT3B 5G5HA 3CSFA 4ICVA 3M3JA 2CR5A 2KDMA 2MJ3A 3KH0A 4C4VB 3V62A 1UZXB 2VH1A 5IKCM 2L7RA 2NBVB 4BBNC 5CHFA 1RFAA 3Q8AA 2C7NB 4LNFA 5HHDG 2K5PA 2KQ4X 5LXHA 1KJTA 4GN1A 3RNBC 1EWYC 5JHBA 4WJNA 1MI0A 2LFIA 1V8CA 1JWSD 2O6VB 2KN4A 3AE2B 2HDEA 3GS2A 1TS2A 1ZE3D 2KWCA 2DLBA 3SD5A 3DVGY 4XGAB 3MC8A 3C0RB 2N1WA 1EUVB 1NBFC 3BK2A 3Q3NC 4RGNA 1C78A 3RNCC 4A9AA 2QJLA 5J18A 2K3UA 2CU1A 1E8YA 2KX0A 3IAM1 1C3TA 3A9JA 1GPXA 2KQSA 2AEHA 2XN9C 4GDLA 4BKSD 4L2YA 1M94A 2M1MA 4HCNB 2D2QA 2DYOA 1KLGD 2JQRB 2LGXA 2JSVX 2XK5B 4IC7B 3TEWA 2BYVE 3A1QA 1FCCC 1QOBA 1R4NI 2Q5WD 3K9PB 5DPSA 2QMTA 1MHXA 1XQQA 1YIWA 1QOGA 2GRIA 1WMHA 2MX2A 1FXIA 3AM9A 3ZNHB 1T3QA 2LRUA 2DENB 1YN3A 4IWQA 5D7GA 2N7JA 4KSLC 3FKYA 3T3NA 1XEEA 2GB1A 4TV3A 3AEGB 4DK5A 3AI5A 2J7QB 5BYQA 4W9CA 2RR9A 5TR5A 1HEZE 4NAWA 2ZPNA 3A9KA 4C4VA 3ZTCA 3RZFA 3BWUD 2JWZA 3MFGA 3PREA 4HRSA 2KLCA 2SAKA 2Z8LA 2MBOA 1WR1A 3BK1A 2ZNVB 2Y5PA 4RMAA 2BVCA 1D4BA 3AE6B 2ASQA 2WXIA 2KTFA 1ZP0B 3H8HA 1KRHA 4QAYA 4K3CA 1SGHA 3MP9A 1I4PA 2GBNA 2KC2A 2LMCA 1TYGB 1TS4A 1CK1A 3RNGC 3D32A 1BXTA 1YMHE 1K50A 3VUXA 2AL3A 3IT4B 3W2DA 1LXDA 3EUB2 1WSPA 2ZW1A 3AN1A 2MP2A 4AOFA 1OQQA 1WJ4A 2KJHB 3FILB 4WWPA 1TY0A 4IWOA 2M0XA 4L1BA 1C4CA 1JWAD 3NOBA 5DPTA 3UQAA 4K3BA 4B0MA 4E3CA 3WAOA 5FKAC 4DDID 5CX3A 2V3SA 2WLBA 1FNVA 3ALBA 4MDKE 4ZRJA 1XD3B 1N6ZA 3UIPB 1XT9B 2N7EA 4LLGM 4GMVA 4W9DA 3R8BA 5FK9C 2MP2B 5D6JB 4ARIA 3ZDTA 2BKFA 2E3TA 4OVVA 2DZKA 2QILA 5G5GA 1V49A 4HWIB 1XLQA 2MA9B 1F77A 2CHXA 1WJUA 3UQBA 1JMLA 1BUIC 1FM0D 1OEYJ 2KK8A 1WE7A 2ICIA 1ZDVA 2DAJA 3P4SB 3TCAA 2GLSA 2ZZPB 1QLBB 2JZZA 3AE1B 3AU5A 1SE3A 3VQIA 1IGCA 1GG3A 3A4SC 1QZEA 2LGSA 3WANA 2JU6X 4KGTA 3V3XA 2BPSA 1AYFA 2C5LC 3RZWC 2K8HA 2PE9A 2G3QB 2HTHA 3AEAB 2D10A 4GXBA 2IY1B 4A90A 2WX0A 4IUMB 4WWOA 1C79A 2YLMA 2J0KA 3VUWA 2M4NA 1F52A 1N62A 3B9JA 2KVRA 4MJSB 1WXQA 2N1VA 2G4DB 2Z59B 1K53A 2KO3A 4ANUA 1GNUA 4HDQA 1R4NB 1XLOA 3IXSA 4O1NA 2K6DB 2KACA 4PS3A 2GBMA 1UH6A 5AUKA 1E8XA 3A4RA 1B9RA 3DWGC 1T0RC 2V9HA 4EFOA 2R61A 3AEDB 4N9F4 4PT5A 2V0GA 2ZNVC 4BOZB 4P6VF 3MHSD 1I4HA 3NY5A 4ZRPA 3P42A 1EU4A 3L4PA 2CS4A 2N9LA 3VH4B 5E6NA 2L1AA 2NS5A 2WXQA 2PKOA 4AWJA 3H6NA 4PYUA 4HXDA 3VRBB 4DWFA 4HDOA 5C23A 1CZPA 2AYOB 3M62B 3C19A 1C4PA 3ZJVA 4P1CC 3GOEA 5KHOA 1ZXHA 4NQLB 1FNUA 2KMAA 3BYYB 2N9PC 1NI2A 2AQ1B 3X23A 2WS3B 2WP9B 1JRUA 4IM0A 2K39A 3B2FA 3N20C 5EE0A 1C77A 4GB9A 1ESFA 2AL6A 1ISNA 3ML8A 1WZ3A 3ZO5B 3EGRA 5TSSA 2DAFA 4W9KA 1ACCA
chains in the Genus database with same CATH topology
1WXMA 1WX8A 3QC8B 2MLBA 4NNJB 1WXVA 4OVUA 3DCGA 1LQBA 3CF6E 2CKHB 1UBQA 4EUTA 1E90A 2Y5BB 2BWES 4FHJA 3S2AA 4CYEA 1RLFA 1WGGA 4DBGA 2XEWA 3WAPA 1D3ZA 4M8NA 3L54A 3AU4A 4ZYNA 3ZIMA 1WYWB 2KJRA 1TTNA 1WFYA 3A1QB 4IWPA 4MELA 4P7IA 3WAMA 4F1SA 2BYFA 1GC7A 4KVGB 2BF8B 2K8CA 4LDTD 4AJWA 2A5UA 4NJ6A 3V61A 1UELA 1OTRB 1YX5B 2IBIB 1V86A 3W1SC 3APDA 2CHWA 3H7PA 3VAWA 2EMSA 2C7MB 3QK0A 1UGMA 2KKCA 3RT3B 3ZNGC 3H1UA 3CSFA 1BT0A 2KDFB 4F7ZA 3EECA 5E6PA 4KDIC 3UIOB 4ICVA 3PT2B 3M3JA 2CR5A 3H7PB 3IBEA 3KH0A 1UBIA 2MBQA 3V62A 1UZXB 4WJPA 4EEWA 4EZJA 5CHVC 3AULA 5L83A 2LVOA 3ZDMC 5JH5C 2PPHA 2L05A 1NDDA 1WGDA 2NR2A 2L7RA 3VFKA 1V80A 3HM3A 1E8ZA 1FXTB 3DDCB 2FCQA 2L76A 2NBVB 2KOXA 4BBNC 5CHFA 4TQ0A 1IPGA 3MTNB 1RFAA 3A33B 1E7UA 2JY6A 1KOTA 4I6LB 3R3MA 1S3SG 2C7NB 1H4RA 4IW0A 5LXHA 1KJTA 4GN1A 1F9JA 1WX9A 4NY0A 2MCNB 5JHBA 3DVGX 5IAAC 1WI0A 4WJNA 1SE9A 3MJWA 4XZ4A 2JZ3B 3GZNI 1TBEA 1GC6A 1P98A 4TKNA 2KN5A 4W9IA 3APFA 3EHVA 2O6VB 2KDBA 4GSWA 3DQVA 4G11A 1L7YA 2ZCBA 3BINA 2B3AA 1RRBA 2KWCA 3SD5A 2FCSA 3DVGY 5DPRA 3JW0X 1YQBA 3C0RB 2LASA 2N1WA 4TQ1A 3PHXB 2HE7A 2KANA 2DZMA 1EUVB 2KWUB 1NBFC 2L0FA 2N9EB 4G3XB 4KDLB 3LJ3A 2WDTB 3L10B 2IZVB 5J18A 3ZUNA 2KC1A 2Z0EB 3DVNU 3N32A 3IHPC 4E71A 3TBLD 2CU1A 4I6PA 4FULA 4FLHA 3TJPA 1CMXB 1E8YA 4BOSC 2KX0A 2MWSB 3NZUA 1RAXA 1C3TA 5AZGA 3A9JA 1V9JA 3VUYA 5HKHA 4HK2A 2KQSA 2AEHA 1YJ1A 1WF9A 4GDLA 2JF5A 4BKSD 1M94A 2M1MA 2N7DA 4HCNB 2D2QA 2DYOA 2G45B 2LGXA 4URKA 2L00B 2V1YA 2XK5B 2KJ6A 4GIVA 4IC7B 2BYVE 3OJ3A 1WMHB 3A1QA 3QHTA 3X0WA 1R4NI 1TGZB 4MGZE 3QWZB 3K9PB 5DPSA 4MGIE 1J8CA 5G55A 1XQQA 4MGYE 1YIWA 4HPLB 2I1KA 3T8MA 3HHMA 1WMHA 3QX1A 4K7UA 2KMCA 3PSEB 2MX2A 2HD5B 2KD0A 3T9LA 3H9DA 3P2BA 4TUUA 4DHJB 3ZNHB 2Z0DB 1WXSA 2JT4B 1V5TA 2LRUA 2O2VB 2DENB 3JSVB 3QA8A 3Q3FA 3A9JB 3ZRCA 2FIFA 4IWQA 5D7GA 3ZRFA 2AWTA 4FN2A 4KSLC 2DZJA 3TMPB 2LGDA 4W9FA 3RD2A 2REXA 3KUDB 4JL9A 2C7HA 4TV3A 4DK5A 4BKSA 3AI5A 4B95A 2L0TA 4GU2A 1OGWA 2J7QB 4W9CA 2RR9A 4W9JA 2FAZA 5TR5A 4A3PA 3KYCD 2K1FA 4NAWA 2KDIA 2ZPNA 4GGQA 5AZHA 1P9DU 5DCNA 2LGYA 3NS8A 3A9KA 3K9OB 3DVNV 2LI5A 4FHKA 3ZTCA 3IG3A 1Y8RC 3RZFA 2JWZA 1H8CA 4NPNA 3PREA 4FA6A 1U4AA 2KLCA 1OEYA 4NAWB 2MBOA 3IVFA 3PGEA 4MM3A 4IG7B 1V5OA 2NVUI 3ZKJC 1WR1A 2KQ7A 1P0RA 3VTUA 3SDLC 2ZNVB 3M95A 1PQSA 1X1MA 2DHZA 3JYUA 4GDLB 4RMAA 5GMVA 4J6IA 3RCZA 4B9KA 5KHQA 2ASQA 4AJYB 2BGFA 2FNJB 2KTFA 4YL8A 3DBRI 1VCBA 3B08A 2DZIA 5DPWA 4KIKA 1SGHA 2WX1A 4FJYA 2KC2A 2GBNA 3R66C 2N4FA 3V6CB 4DDGD 3D32A 2KWVB 1WXAA 3A9KB 4AP4C 4JLCA 3VUXA 4ZRKA 4KZ0A 3PVLA 2RD0A 4RM8A 2AL3A 1WGHA 4IM3A 2ZJDA 3NZSA 2BYEA 1LXDA 2FUHB 4W9LA 4JIOU 4A3OA 2MP2A 4AOFA 2MQJA 4B6WA 4XC2A 3RULA 3I3TB 1WJ4A 2KJHB 4WWPA 2WWZA 1KM7A 2IYDB 4WJQA 1A5RA 4IWOA 2KX3A 4WAAA 2M0XA 3VTVA 2G4SA 3NOBA 5DPTA 3UQAA 3ENEA 1MG8A 1V81A 4IM2A 4KSKC 2UYZB 4K7SA 4E3CA 3WAOA 3L16A 3N30A 2K8BA 4DDID 3JVZX 5CX3A 2V3SA 3APCA 4DHZB 2KFJA 4MDKE 3ALBA 2C9WB 4ZRJA 3KW5B 3QAQA 1KLVA 1XD3B 3UIPB 2ZEQA 1XT9B 2N7EA 1WX7A 2MBBB 2KTRB 2K6QA 1Q1OA 4GMVA 1ZKHA 4W9DA 2OOBB 4WJOA 3TL5A 1VD2A 2MP2B 2LRWA 3ECIA 3KUCB 4LJOB 5D6JB 3WA0A 4ANXA 4DHZE 3ZDTA 2L8JA 3L08A 3ZTDA 3BY4B 2BKFA 2C60A 2M8SA 2MSED 3QCAA 5CHWA 2I1JA 3OLMD 4X57B 2FCNA 3HK0A 4OVVA 3ZVVA 4K1RB 1IYFA 2DZKA 3ZNZB 1S1QB 2L3ZA 4HVBA 1WJ6A 3L0WB 1V49A 3DBLI 4HWIB 4MH0E 3KVFB 3WIMA 2MA9B 4FJZA 4HPMB 3AXCA 2LVQA 3OAWA 2CHXA 4PS8A 1WJUA 2KFKB 4M8MA 4AUQC 3UQBA 2FIDA 4LCDE 2KDEB 2JPHA 4F8CB 2DX5B 2JXXA 1OEYJ 3O65B 3QIJA 1EF5A 1P1AA 3PLUA 2KK8A 1WE7A 3U8ZA 2DAJA 2DYMA 2KLGA 4PS7A 3W1SA 5L95C 3N3KB 3JSVA 3Q3JA 4HCPB 1ZGUB 4W9GA 3TCAA 3VVWB 1Z2MA 2ZZPB 1Q0WB 4BKTA 2JZZA 2R2OA 4XX5A 3EC8A 5IA7A 3AU5A 4GDKA 5E6OA 3DOWA 4E74A 3KYDD 3VQIA 1EO6A 2MBHA 1GG3A 2J0MA 1QZEA 3A4SC 4II2B 3WANA 3WALA 5LLIA 2IO1B 5BO4B 1ZW7A 2NPTA 3DPDA 4EZLA 5J2RA 2BPSA 3QJZA 4WQOB 5JZEB 2C5LC 2EKEC 3RZWC 1LFDA 3HM6X 4CHKA 2MBEA 2K8HA 2PE9A 1J19A 2RPQA 2UWQA 4K81A 3ZW3A 3VDZA 2G3QB 2O6VA 2HTHA 1UD7A 4BFRA 2D10A 4GXBA 2IY1B 3PRZA 3U30A 2WX0A 4IUMB 5J17A 2OJRA 4WWOA 5AEKB 2GBKA 4FADA 5LXIB 2EMTA 4BVUC 2JRHA 2XK5A 2HJ8A 3PZDA 4JGHB 2D11A 1WGRA 2J0KA 2YLMA 2M4NA 3RUIB 3VUWA 4G50A 1T0YA 3UF8A 4DHJD 2PEAA 3DBSA 2LZ6A 3UINB 3V60A 4DXAB 3U7DA 4W9EA 4GDKB 5G2NA 2KVRA 4HLEA 3R7QA 2A4ZA 3LDZE 3TIXA 4EKUA 1GUAB 1WY8A 2R2QA 4WWNA 4MJSB 2QHOA 4KV2A 2N9XA 2N1VA 2G4DB 2Z59B 3ML9A 3PV1A 2KO3A 1P3QU 1Q5WB 1GNUA 4ANUA 4HDQA 3NHEB 1WM2A 2XBBC 3IFWB 3R7RA 2GOWA 4EZKA 3V6EB 3OJ4B 1E8WA 3PPAA 5D2MB 1WGYA 2K6DB 2ZPYA 4MJSA 1WM3A 1L2NA 2ZVOA 4PS3A 2GBMA 5AZFA 1WR6E 5D94A 1UH6A 3SHQA 3UGBB 1E8XA 1C1YB 3A4RA 4HJKA 2GBJA 2V4LA 4EFOA 5C1ZA 4RM9A 1LM8B 4NJ7A 3PRPB 4N9F4 4CO7A 2LVPA 2ZNVC 4BOZB 4PYZA 1K8RB 4ANVA 4BKGA 3MHSD 2JRIB 2JVCA 2KFKA 4KZCA 2KHWB 2FCMA 4KIKB 2O2VA 4MSMB 4A20A 1R4MI 3NY5A 2KNBA 4ZDVA 1IP9A 2NPTB 4ICUA 3CMMB 3KUZA 1AARA 1EF1A 2D3GA 2LD9A 3W1YA 1I35A 4FBJB 2NCNA 5EDSA 2J0JA 2YVCA 4II3B 2CS4A 1E5WA 1WJNA 5E6NA 3VH4B 2RSUA 2KZRA 3VH3B 2NS5A 2JUOA 4K7WA 2IY0B 4EOYA 4AWJA 1J0GA 2IO0B 3H6NA 4M0WB 4PYUA 4HXDA 1WH3A 1YD8U 4ANWA 2WYQA 2BWFA 3ZLZA 2BKRB 2MW5A 3M63B 3B1LX 3PHWB 3VXWA 1YX6B 2NBWB 4MEMA 4LJPB 2IO2B 2VRRB 5CTRC 2PE6B 3SU8X 4DWFA 4HDOA 2LXAA 5C23A 3H7SA 3QQ8B 1E7VA 3PTFC 5JHAA 4GOCA 2AYOB 3M62B 4I6NB 4BBNF 2LWPA 1V2YA 1WRDB 2LUEA 3HIZA 1WE6A 3EFUA 3GOEA 4NQKE 1V6EA 5FR6A 5KHOA 3RYTA 2LJ5A 3VHTC 1HE8A 2PJHA 4FJVB 4NQLB 2ZVNA 2MRPA 4ZRIA 1WZ0A 2DYBA 2KMAA 2KXJA 3CSTA 2N9PC 1NI2A 2M17A 2D07B 2GMIC 2GBRA 2LXCA 2RGFA 3L17A 1WIAA 3X23A 3ZNID 4IM0A 1JRUA 2K39A 2NBUA 4ASWC 4G0NB 4GB9A 1GJZA 3PS6A 2KTRA 2W9NA 3PLVA 2AL6A 4MSQB 1ISNA 3ML8A 2K25A 1WZ3A 3ZO5B 1SIFA 1I42A 1G6JA 4LDTB 3L13A 3ONSA 4JQWC 3QARA 3B0AA 2DAFA 3PRMB 4MGKE 2O6VD 4W9KA 1Z5SB 4W9HA 2ZCCA 2CHZA 3DBHI 2IO3B 1OQYA 1TZ1A 3VTWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WXM A;  1WX8 A;  3QC8 B;  2MLB A;  4NNJ B;  1WXV A;  4OVU A;  3DCG A;  1LQB A;  3CF6 E;  2CKH B;  1UBQ A;  4EUT A;  1E90 A;  2Y5B B;  2BWE S;  4FHJ A;  3S2A A;  4CYE A;  1RLF A;  1WGG A;  4DBG A;  2XEW A;  3WAP A;  1D3Z A;  4M8N A;  3L54 A;  3AU4 A;  4ZYN A;  3ZIM A;  1WYW B;  2KJR A;  1TTN A;  1WFY A;  3A1Q B;  4IWP A;  4MEL A;  4P7I A;  3WAM A;  4F1S A;  2BYF A;  1GC7 A;  4KVG B;  2BF8 B;  2K8C A;  4LDT D;  4AJW A;  2A5U A;  4NJ6 A;  3V61 A;  1UEL A;  1OTR B;  1YX5 B;  2IBI B;  1V86 A;  3W1S C;  3APD A;  2CHW A;  3H7P A;  3VAW A;  2EMS A;  2C7M B;  3QK0 A;  1UGM A;  2KKC A;  3RT3 B;  3ZNG C;  3H1U A;  3CSF A;  1BT0 A;  2KDF B;  4F7Z A;  3EEC A;  5E6P A;  4KDI C;  3UIO B;  4ICV A;  3PT2 B;  3M3J A;  2CR5 A;  3H7P B;  3IBE A;  3KH0 A;  1UBI A;  2MBQ A;  3V62 A;  1UZX B;  4WJP A;  4EEW A;  4EZJ A;  5CHV C;  3AUL A;  5L83 A;  2LVO A;  3ZDM C;  5JH5 C;  2PPH A;  2L05 A;  1NDD A;  1WGD A;  2NR2 A;  2L7R A;  3VFK A;  1V80 A;  3HM3 A;  1E8Z A;  1FXT B;  3DDC B;  2FCQ A;  2L76 A;  2NBV B;  2KOX A;  4BBN C;  5CHF A;  4TQ0 A;  1IPG A;  3MTN B;  1RFA A;  3A33 B;  1E7U A;  2JY6 A;  1KOT A;  4I6L B;  3R3M A;  1S3S G;  2C7N B;  1H4R A;  4IW0 A;  5LXH A;  1KJT A;  4GN1 A;  1F9J A;  1WX9 A;  4NY0 A;  2MCN B;  5JHB A;  3DVG X;  5IAA C;  1WI0 A;  4WJN A;  1SE9 A;  3MJW A;  4XZ4 A;  2JZ3 B;  3GZN I;  1TBE A;  1GC6 A;  1P98 A;  4TKN A;  2KN5 A;  4W9I A;  3APF A;  3EHV A;  2O6V B;  2KDB A;  4GSW A;  3DQV A;  4G11 A;  1L7Y A;  2ZCB A;  3BIN A;  2B3A A;  1RRB A;  2KWC A;  3SD5 A;  2FCS A;  3DVG Y;  5DPR A;  3JW0 X;  1YQB A;  3C0R B;  2LAS A;  2N1W A;  4TQ1 A;  3PHX B;  2HE7 A;  2KAN A;  2DZM A;  1EUV B;  2KWU B;  1NBF C;  2L0F A;  2N9E B;  4G3X B;  4KDL B;  3LJ3 A;  2WDT B;  3L10 B;  2IZV B;  5J18 A;  3ZUN A;  2KC1 A;  2Z0E B;  3DVN U;  3N32 A;  3IHP C;  4E71 A;  3TBL D;  2CU1 A;  4I6P A;  4FUL A;  4FLH A;  3TJP A;  1CMX B;  1E8Y A;  4BOS C;  2KX0 A;  2MWS B;  3NZU A;  1RAX A;  1C3T A;  5AZG A;  3A9J A;  1V9J A;  3VUY A;  5HKH A;  4HK2 A;  2KQS A;  2AEH A;  1YJ1 A;  1WF9 A;  4GDL A;  2JF5 A;  4BKS D;  1M94 A;  2M1M A;  2N7D A;  4HCN B;  2D2Q A;  2DYO A;  2G45 B;  2LGX A;  4URK A;  2L00 B;  2V1Y A;  2XK5 B;  2KJ6 A;  4GIV A;  4IC7 B;  2BYV E;  3OJ3 A;  1WMH B;  3A1Q A;  3QHT A;  3X0W A;  1R4N I;  1TGZ B;  4MGZ E;  3QWZ B;  3K9P B;  5DPS A;  4MGI E;  1J8C A;  5G55 A;  1XQQ A;  4MGY E;  1YIW A;  4HPL B;  2I1K A;  3T8M A;  3HHM A;  1WMH A;  3QX1 A;  4K7U A;  2KMC A;  3PSE B;  2MX2 A;  2HD5 B;  2KD0 A;  3T9L A;  3H9D A;  3P2B A;  4TUU A;  4DHJ B;  3ZNH B;  2Z0D B;  1WXS A;  2JT4 B;  1V5T A;  2LRU A;  2O2V B;  2DEN B;  3JSV B;  3QA8 A;  3Q3F A;  3A9J B;  3ZRC A;  2FIF A;  4IWQ A;  5D7G A;  3ZRF A;  2AWT A;  4FN2 A;  4KSL C;  2DZJ A;  3TMP B;  2LGD A;  4W9F A;  3RD2 A;  2REX A;  3KUD B;  4JL9 A;  2C7H A;  4TV3 A;  4DK5 A;  4BKS A;  3AI5 A;  4B95 A;  2L0T A;  4GU2 A;  1OGW A;  2J7Q B;  4W9C A;  2RR9 A;  4W9J A;  2FAZ A;  5TR5 A;  4A3P A;  3KYC D;  2K1F A;  4NAW A;  2KDI A;  2ZPN A;  4GGQ A;  5AZH A;  1P9D U;  5DCN A;  2LGY A;  3NS8 A;  3A9K A;  3K9O B;  3DVN V;  2LI5 A;  4FHK A;  3ZTC A;  3IG3 A;  1Y8R C;  3RZF A;  2JWZ A;  1H8C A;  4NPN A;  3PRE A;  4FA6 A;  1U4A A;  2KLC A;  1OEY A;  4NAW B;  2MBO A;  3IVF A;  3PGE A;  4MM3 A;  4IG7 B;  1V5O A;  2NVU I;  3ZKJ C;  1WR1 A;  2KQ7 A;  1P0R A;  3VTU A;  3SDL C;  2ZNV B;  3M95 A;  1PQS A;  1X1M A;  2DHZ A;  3JYU A;  4GDL B;  4RMA A;  5GMV A;  4J6I A;  3RCZ A;  4B9K A;  5KHQ A;  2ASQ A;  4AJY B;  2BGF A;  2FNJ B;  2KTF A;  4YL8 A;  3DBR I;  1VCB A;  3B08 A;  2DZI A;  5DPW A;  4KIK A;  1SGH A;  2WX1 A;  4FJY A;  2KC2 A;  2GBN A;  3R66 C;  2N4F A;  3V6C B;  4DDG D;  3D32 A;  2KWV B;  1WXA A;  3A9K B;  4AP4 C;  4JLC A;  3VUX A;  4ZRK A;  4KZ0 A;  3PVL A;  2RD0 A;  4RM8 A;  2AL3 A;  1WGH A;  4IM3 A;  2ZJD A;  3NZS A;  2BYE A;  1LXD A;  2FUH B;  4W9L A;  4JIO U;  4A3O A;  2MP2 A;  4AOF A;  2MQJ A;  4B6W A;  4XC2 A;  3RUL A;  3I3T B;  1WJ4 A;  2KJH B;  4WWP A;  2WWZ A;  1KM7 A;  2IYD B;  4WJQ A;  1A5R A;  4IWO A;  2KX3 A;  4WAA A;  2M0X A;  3VTV A;  2G4S A;  3NOB A;  5DPT A;  3UQA A;  3ENE A;  1MG8 A;  1V81 A;  4IM2 A;  4KSK C;  2UYZ B;  4K7S A;  4E3C A;  3WAO A;  3L16 A;  3N30 A;  2K8B A;  4DDI D;  3JVZ X;  5CX3 A;  2V3S A;  3APC A;  4DHZ B;  2KFJ A;  4MDK E;  3ALB A;  2C9W B;  4ZRJ A;  3KW5 B;  3QAQ A;  1KLV A;  1XD3 B;  3UIP B;  2ZEQ A;  1XT9 B;  2N7E A;  1WX7 A;  2MBB B;  2KTR B;  2K6Q A;  1Q1O A;  4GMV A;  1ZKH A;  4W9D A;  2OOB B;  4WJO A;  3TL5 A;  1VD2 A;  2MP2 B;  2LRW A;  3ECI A;  3KUC B;  4LJO B;  5D6J B;  3WA0 A;  4ANX A;  4DHZ E;  3ZDT A;  2L8J A;  3L08 A;  3ZTD A;  3BY4 B;  2BKF A;  2C60 A;  2M8S A;  2MSE D;  3QCA A;  5CHW A;  2I1J A;  3OLM D;  4X57 B;  2FCN A;  3HK0 A;  4OVV A;  3ZVV A;  4K1R B;  1IYF A;  2DZK A;  3ZNZ B;  1S1Q B;  2L3Z A;  4HVB A;  1WJ6 A;  3L0W B;  1V49 A;  3DBL I;  4HWI B;  4MH0 E;  3KVF B;  3WIM A;  2MA9 B;  4FJZ A;  4HPM B;  3AXC A;  2LVQ A;  3OAW A;  2CHX A;  4PS8 A;  1WJU A;  2KFK B;  4M8M A;  4AUQ C;  3UQB A;  2FID A;  4LCD E;  2KDE B;  2JPH A;  4F8C B;  2DX5 B;  2JXX A;  1OEY J;  3O65 B;  3QIJ A;  1EF5 A;  1P1A A;  3PLU A;  2KK8 A;  1WE7 A;  3U8Z A;  2DAJ A;  2DYM A;  2KLG A;  4PS7 A;  3W1S A;  5L95 C;  3N3K B;  3JSV A;  3Q3J A;  4HCP B;  1ZGU B;  4W9G A;  3TCA A;  3VVW B;  1Z2M A;  2ZZP B;  1Q0W B;  4BKT A;  2JZZ A;  2R2O A;  4XX5 A;  3EC8 A;  5IA7 A;  3AU5 A;  4GDK A;  5E6O A;  3DOW A;  4E74 A;  3KYD D;  3VQI A;  1EO6 A;  2MBH A;  1GG3 A;  2J0M A;  1QZE A;  3A4S C;  4II2 B;  3WAN A;  3WAL A;  5LLI A;  2IO1 B;  5BO4 B;  1ZW7 A;  2NPT A;  3DPD A;  4EZL A;  5J2R A;  2BPS A;  3QJZ A;  4WQO B;  5JZE B;  2C5L C;  2EKE C;  3RZW C;  1LFD A;  3HM6 X;  4CHK A;  2MBE A;  2K8H A;  2PE9 A;  1J19 A;  2RPQ A;  2UWQ A;  4K81 A;  3ZW3 A;  3VDZ A;  2G3Q B;  2O6V A;  2HTH A;  1UD7 A;  4BFR A;  2D10 A;  4GXB A;  2IY1 B;  3PRZ A;  3U30 A;  2WX0 A;  4IUM B;  5J17 A;  2OJR A;  4WWO A;  5AEK B;  2GBK A;  4FAD A;  5LXI B;  2EMT A;  4BVU C;  2JRH A;  2XK5 A;  2HJ8 A;  3PZD A;  4JGH B;  2D11 A;  1WGR A;  2J0K A;  2YLM A;  2M4N A;  3RUI B;  3VUW A;  4G50 A;  1T0Y A;  3UF8 A;  4DHJ D;  2PEA A;  3DBS A;  2LZ6 A;  3UIN B;  3V60 A;  4DXA B;  3U7D A;  4W9E A;  4GDK B;  5G2N A;  2KVR A;  4HLE A;  3R7Q A;  2A4Z A;  3LDZ E;  3TIX A;  4EKU A;  1GUA B;  1WY8 A;  2R2Q A;  4WWN A;  4MJS B;  2QHO A;  4KV2 A;  2N9X A;  2N1V A;  2G4D B;  2Z59 B;  3ML9 A;  3PV1 A;  2KO3 A;  1P3Q U;  1Q5W B;  1GNU A;  4ANU A;  4HDQ A;  3NHE B;  1WM2 A;  2XBB C;  3IFW B;  3R7R A;  2GOW A;  4EZK A;  3V6E B;  3OJ4 B;  1E8W A;  3PPA A;  5D2M B;  1WGY A;  2K6D B;  2ZPY A;  4MJS A;  1WM3 A;  1L2N A;  2ZVO A;  4PS3 A;  2GBM A;  5AZF A;  1WR6 E;  5D94 A;  1UH6 A;  3SHQ A;  3UGB B;  1E8X A;  1C1Y B;  3A4R A;  4HJK A;  2GBJ A;  2V4L A;  4EFO A;  5C1Z A;  4RM9 A;  1LM8 B;  4NJ7 A;  3PRP B;  4N9F 4;  4CO7 A;  2LVP A;  2ZNV C;  4BOZ B;  4PYZ A;  1K8R B;  4ANV A;  4BKG A;  3MHS D;  2JRI B;  2JVC A;  2KFK A;  4KZC A;  2KHW B;  2FCM A;  4KIK B;  2O2V A;  4MSM B;  4A20 A;  1R4M I;  3NY5 A;  2KNB A;  4ZDV A;  1IP9 A;  2NPT B;  4ICU A;  3CMM B;  3KUZ A;  1AAR A;  1EF1 A;  2D3G A;  2LD9 A;  3W1Y A;  1I35 A;  4FBJ B;  2NCN A;  5EDS A;  2J0J A;  2YVC A;  4II3 B;  2CS4 A;  1E5W A;  1WJN A;  5E6N A;  3VH4 B;  2RSU A;  2KZR A;  3VH3 B;  2NS5 A;  2JUO A;  4K7W A;  2IY0 B;  4EOY A;  4AWJ A;  1J0G A;  2IO0 B;  3H6N A;  4M0W B;  4PYU A;  4HXD A;  1WH3 A;  1YD8 U;  4ANW A;  2WYQ A;  2BWF A;  3ZLZ A;  2BKR B;  2MW5 A;  3M63 B;  3B1L X;  3PHW B;  3VXW A;  1YX6 B;  2NBW B;  4MEM A;  4LJP B;  2IO2 B;  2VRR B;  5CTR C;  2PE6 B;  3SU8 X;  4DWF A;  4HDO A;  2LXA A;  5C23 A;  3H7S A;  3QQ8 B;  1E7V A;  3PTF C;  5JHA A;  4GOC A;  2AYO B;  3M62 B;  4I6N B;  4BBN F;  2LWP A;  1V2Y A;  1WRD B;  2LUE A;  3HIZ A;  1WE6 A;  3EFU A;  3GOE A;  4NQK E;  1V6E A;  5FR6 A;  5KHO A;  3RYT A;  2LJ5 A;  3VHT C;  1HE8 A;  2PJH A;  4FJV B;  4NQL B;  2ZVN A;  2MRP A;  4ZRI A;  1WZ0 A;  2DYB A;  2KMA A;  2KXJ A;  3CST A;  2N9P C;  1NI2 A;  2M17 A;  2D07 B;  2GMI C;  2GBR A;  2LXC A;  2RGF A;  3L17 A;  1WIA A;  3X23 A;  3ZNI D;  4IM0 A;  1JRU A;  2K39 A;  2NBU A;  4ASW C;  4G0N B;  4GB9 A;  1GJZ A;  3PS6 A;  2KTR A;  2W9N A;  3PLV A;  2AL6 A;  4MSQ B;  1ISN A;  3ML8 A;  2K25 A;  1WZ3 A;  3ZO5 B;  1SIF A;  1I42 A;  1G6J A;  4LDT B;  3L13 A;  3ONS A;  4JQW C;  3QAR A;  3B0A A;  2DAF A;  3PRM B;  4MGK E;  2O6V D;  4W9K A;  1Z5S B;  4W9H A;  2ZCC A;  2CHZ A;  3DBH I;  2IO3 B;  1OQY A;  1TZ1 A;  3VTW A; 
#chains in the Genus database with same CATH topology
 2PMV A;  3DCG A;  3CF6 E;  1E90 A;  2Y5B B;  2WXR A;  1WGG A;  1CJE A;  4DBG A;  2IGG A;  2J4X A;  3AU4 A;  3ZIM A;  1SE2 A;  1WFY A;  4IWP A;  5HI1 A;  3WAM A;  1DOI A;  5EE3 A;  1YX5 B;  1N60 A;  1UWM A;  2IBI B;  4NAM A;  2CHW A;  3VAW A;  3DHH C;  1UGM A;  3H1U A;  3GB1 A;  1BT0 A;  3EEC A;  4N59 A;  3UIO B;  1T6B X;  2QEJ C;  3E9S A;  1TKE A;  2ZW0 A;  4EEW A;  1QF6 A;  5CHV C;  3AUL A;  3U7Z A;  2NR2 A;  2DBY A;  2X38 A;  3VFK A;  3HM3 A;  1FXT B;  3DDC B;  1RYJ A;  2KOX A;  1T0Q C;  2KMM A;  3MTN B;  2DNF A;  1E7U A;  4ZHO A;  2JY6 A;  3R3M A;  2BW2 A;  3U4E G;  2ONQ A;  5BYR A;  2MCN B;  2DWQ A;  2JZ3 B;  5C2T B;  2WDR B;  4TKN A;  1KH0 A;  4YWG G;  1HQR D;  1ZDX A;  1L6V A;  2KVZ A;  4MAC A;  2UU7 A;  2LAS A;  4HKZ E;  3SR6 A;  2HE7 A;  2DZM A;  4XWT A;  1KFY B;  2WDT B;  2IZV B;  3RI7 C;  4OZA A;  4E71 A;  3TJP A;  1QOF A;  1CMX B;  1OQR A;  4BOS C;  1KTK A;  3NZU A;  5AZG A;  1V9J A;  1P7E A;  4HK2 A;  1YJ1 A;  1WF9 A;  2JF5 A;  1NVI D;  5GXG B;  4URK A;  1JCK B;  4IDI A;  3KQ4 A;  5H92 C;  3ZQ4 A;  3X0W A;  2PVO D;  2BTE A;  4RH6 A;  3LYY A;  5G55 A;  2B76 B;  2WU2 B;  3HHM A;  3QX1 A;  4K7U A;  2KMC A;  3PSE B;  3N9Y C;  1YJJ A;  2PVG C;  3T9L A;  3H9D A;  3P2B A;  1ET9 A;  5D3D A;  2Z0D B;  2O2V B;  3QA8 A;  3Q3F A;  3NUH B;  1SXT A;  3FIL A;  4FN2 A;  1E7P B;  2DZJ A;  1HTO A;  4ITK A;  4W9F A;  2N9K A;  2LUM A;  2REX A;  4JL9 A;  2WXP A;  4B95 A;  4GU2 A;  3TUO A;  1OGW A;  4A3P A;  5T8I A;  4HRO A;  2M0A A;  1H8C A;  4NAW B;  3PGE A;  4IKG A;  4MM3 A;  4C80 A;  3ZKJ C;  1HZ6 A;  1IUE A;  2KQ7 A;  1P0R A;  4P16 A;  4ZRQ A;  3VTU A;  1DYQ A;  3SDL C;  1I4Q A;  4RNA A;  1X1M A;  3RCZ A;  4B9K A;  5GMV A;  2H88 B;  4YL8 A;  1L0Y B;  3DBR I;  1YQ4 B;  1FFU A;  4ZHP A;  3I9V 1;  3ABV B;  4FJY A;  3R66 C;  2N4F A;  4H2A A;  1SF0 A;  2KWV B;  1WXA A;  3A9K B;  4JLC A;  2RDH A;  4RM8 A;  1WGH A;  2WGS A;  2ZJD A;  3AH7 A;  1JRO A;  4W9L A;  2FUH B;  4JIO U;  4A3O A;  1CQV A;  3AE7 B;  1JWB D;  3RUL A;  1SJE D;  1LGR A;  1N5W A;  2LEK A;  1YNT E;  3VTV A;  2OJW A;  4S0R A;  3ENE A;  4KSK C;  2UYZ B;  1PDX A;  3L16 A;  3Q8B A;  3HVZ A;  3N30 A;  1TS3 A;  3JVZ X;  2KFJ A;  2CU3 A;  1SSN A;  1T0S C;  1Q1O A;  2OOB B;  4WJO A;  1FRD A;  4LJO B;  3WA0 A;  1NYQ A;  2L8J A;  3L08 A;  4B0E A;  3BY4 B;  2C60 A;  2M8S A;  3QCA A;  5CHW A;  4X57 B;  3HK0 A;  3URY A;  1S1Q B;  2L3Z A;  1WJ6 A;  4MH0 E;  3AE8 B;  4R3D A;  1E10 A;  3AXC A;  3CWI A;  2LVQ A;  4PS8 A;  2KDE B;  1SE4 A;  2JXX A;  4N6E B;  3O65 B;  4REZ A;  4US8 A;  3U8Z A;  3N3K B;  4LNK A;  2WXF A;  1VZ6 A;  4BKT A;  4YTN B;  2CJO A;  5E6O A;  1PGB A;  3BVZ A;  2K9X A;  3WAL A;  5LLI A;  5J2R A;  3QJZ A;  2IJ0 A;  2MBE A;  2RPQ A;  1J19 A;  3DHG C;  3ZW3 A;  3VDZ A;  2K22 A;  5HG2 A;  3U30 A;  2I38 A;  5J17 A;  2GBK A;  1D5Z C;  2JRH A;  2HJ8 A;  3PZD A;  2G1E A;  1WGR A;  4G50 A;  3U7D A;  4W9E A;  4GDK B;  5G2N A;  2AX5 A;  3TIX A;  1GUA B;  1SIJ A;  1L5P A;  4KV2 A;  1P3Q U;  1TY2 A;  2ACZ B;  1WM2 A;  2XBB C;  2GOW A;  3OJ4 B;  4HEA 1;  1E8W A;  4YT0 B;  1C4A A;  1I4X A;  2ZVO A;  5D94 A;  3UGB B;  3LB8 C;  2M56 B;  3RNF C;  2GBJ A;  1HZ5 A;  2WDV B;  3BII D;  5C1Z A;  4NJ7 A;  1FO4 A;  3PRP B;  4CO7 A;  4WH4 A;  2WXM A;  4PYZ A;  4BKG A;  2JRI B;  4RFB A;  2JX5 A;  2MJD A;  4KZC A;  4KIK B;  4MSM B;  1R4M I;  2FE8 A;  4WQM A;  2NPT B;  4LNN A;  3CMM B;  3IT6 B;  1EF1 A;  4IOI E;  2LD9 A;  5EDS A;  2YVC A;  1E5W A;  1WJN A;  3IAS 1;  4D2K A;  4K7W A;  1AW7 A;  1YD8 U;  3ZLZ A;  2BKR B;  3M63 B;  2INC C;  3B1L X;  3PHW B;  2OED A;  1YX6 B;  4LJP B;  2L52 A;  3SU8 X;  1MG4 A;  2LXA A;  1E7V A;  4C7Z A;  4M0W A;  2LJI A;  1WRD B;  3HIZ A;  1ZXI A;  1WE6 A;  3EFU A;  5FR6 A;  3ETR A;  2ZVN A;  2MRP A;  3AE4 B;  1IGD A;  2GMI C;  3ZNI D;  4ASW C;  4G0N B;  1GJZ A;  1I7H A;  2KTR A;  1TS5 A;  2W9N A;  3PLV A;  2K25 A;  1SIF A;  1I42 A;  3ONS A;  1N63 A;  1LO5 D;  3RNA C;  4MGK E;  1AWD A;  3BVM A;  3E56 A;  2CHZ A;  4RF1 A;  4RF0 A;  3HUI A;  1LQB A;  2W55 A;  4YSY B;  3S2A A;  2KYW A;  3I63 C;  2XEW A;  3WAP A;  4ZYN A;  2WXN A;  4KVG B;  4DXF A;  4LDT D;  4AJW A;  2A5U A;  4NJ6 A;  4XDD A;  1V97 A;  3V61 A;  1VLB A;  3GP7 A;  4JX1 C;  2C7M B;  2LGI A;  3QK0 A;  1HXY D;  2BBC A;  2W3S A;  1L0X B;  1YN5 A;  3SFE B;  4KDI C;  3AEF B;  3PT2 B;  3R2T A;  1FD6 A;  3H7P B;  3IBE A;  2WQY B;  5L83 A;  2D5G A;  1FPY A;  2Y3A A;  1NEN B;  1T5X D;  1SJH D;  2PPH A;  2V3P A;  1NDD A;  5JH5 C;  1WYG A;  1GAQ B;  2W3R A;  2YEP B;  1KOT A;  4I6L B;  3VRA B;  4AS1 A;  3RNE C;  1D5M C;  4EE2 A;  1F9J A;  1WX9 A;  4NY0 A;  4XZ4 A;  4MM3 B;  1QIL A;  4WIP A;  4HJG E;  1L0V B;  1C76 A;  1GC6 A;  1P98 A;  4W9I A;  2KN5 A;  2MH7 A;  3O13 A;  4GSW A;  3DQV A;  3Q3M C;  2RDB C;  3GE3 C;  1RRB A;  2FCS A;  5DPR A;  1YQB A;  3B2G A;  2L0F A;  2KWU B;  4KDL B;  4G3X B;  3VR9 B;  3C8Y A;  3LJ3 A;  5D3I B;  3N32 A;  3IHP C;  2MWS B;  1PFD A;  1YJI A;  4OHJ A;  3I5J C;  2WXJ A;  2K0P A;  4GIV A;  3OJ3 A;  3W5V B;  2QCZ A;  1TGZ B;  4MGZ E;  3QWZ B;  1VZ7 A;  4MGI E;  1J8C A;  1FIQ A;  2I1K A;  2E6X A;  3P1M A;  5IP4 D;  1L6U A;  2KD0 A;  1V5T A;  1D6E C;  1UGJ A;  5MPO A;  2FIF A;  3WCQ A;  1WWT A;  2AWT A;  1TJE A;  5HFY A;  3TMP B;  4YSZ B;  3MJ5 A;  3RD2 A;  3KUD B;  4HPP A;  4BKS A;  2L0T A;  2YEP F;  2FAZ A;  2PIA A;  2K1F A;  5FR3 A;  1FRR A;  3K9O B;  2LI5 A;  4MH8 A;  2N0S B;  3IG3 A;  1Y8R C;  4NPN A;  2JWU A;  4FA6 A;  1U4A A;  3RPF C;  1P7F A;  1OEY A;  2RPV A;  1FXA A;  1VRA B;  2NVU I;  1V1O A;  1STE A;  3M95 A;  4KGS A;  1PQS A;  2DHZ A;  3JYU A;  4GDL B;  4J6I A;  3Q2A C;  5BYS A;  3B08 A;  2DZI A;  5DPW A;  2J53 A;  4KIK A;  4LTU A;  3SEB A;  1JWM D;  3V6C B;  4DDG D;  4YXD B;  2QDF A;  4KKJ A;  5BMI A;  2RD0 A;  3NZS A;  2BYE A;  1YN4 A;  1ZUD 2;  1MHH E;  2MQJ A;  4XC2 A;  3I3T B;  1V1P A;  1KM7 A;  2IYD B;  1A5R A;  4WAA A;  1MG8 A;  4IM2 A;  1PGX A;  1YQ3 B;  3MHZ A;  4USA A;  2K8B A;  1EM7 A;  3APC A;  3U2S C;  2C9W B;  2ZEQ A;  3DHI C;  2MBB B;  2KTR B;  2K6Q A;  3FC4 A;  1ZKH A;  3TL5 A;  1VD2 A;  1MJD A;  1KF6 B;  2QIE B;  4NJC A;  3ZTD A;  2MSE D;  3OLM D;  1IYF A;  2FCN A;  3ZVV A;  2Y5C A;  4HVB A;  1YOV B;  3BYT B;  3WIM A;  4FJZ A;  4HPM B;  3OAW A;  4M8M A;  2KFK B;  4AUQ C;  4M00 A;  2FID A;  2G9H D;  4LCD E;  2JPH A;  1FFV A;  1XXG A;  1EF5 A;  1P1A A;  3PLU A;  4ACF A;  3N1Y C;  4OZC A;  5C3J B;  2RMM A;  2DYM A;  4PS7 A;  5L95 C;  2INP E;  2MJE A;  3Q8F A;  4HCP B;  3UI3 A;  1Q0W B;  4LNI A;  4XX5 A;  1VDV A;  4E74 A;  3KYD D;  4MT5 A;  2J0M A;  2MBH A;  3BZD B;  5BO4 B;  1ZW7 A;  2NPT A;  4EZL A;  4JWS C;  5JZE B;  1WRI A;  3HM6 X;  4CHK A;  3R2I A;  2UWQ A;  2RDG A;  3AEE B;  4K81 A;  1UD7 A;  4YSX B;  4BFR A;  4DQO C;  5LNK 1;  5AEK B;  5LXI B;  2XK5 A;  1F2R I;  3RUI B;  1T0Y A;  3UF8 A;  5IO9 A;  4DHJ D;  4AQ7 A;  1E9M A;  4DXA B;  2BS3 B;  2BB5 A;  1J7B A;  4HLE A;  2XNA C;  3R7Q A;  2A4Z A;  4PK1 A;  1ROE A;  1WY8 A;  2R2Q A;  4JE3 B;  4WWN A;  2I2Y A;  1E0Z A;  5AUI A;  3ML9 A;  1Q5W B;  2M19 A;  4EZK A;  2IDY A;  3AE3 B;  3V6E B;  2VZK B;  1TT5 B;  1WGY A;  2ZPY A;  4MJS A;  4OVZ A;  2IND C;  2WXH A;  3P4P B;  2BS2 B;  3P4Q B;  2TSS A;  2LVP A;  4ANV A;  1K8R B;  1QT9 A;  2JVC A;  2FCM A;  4A20 A;  4ZDV A;  3KUZ A;  2D3A A;  1AAR A;  2OHF A;  3W1Y A;  1I35 A;  4FBJ B;  1EU3 A;  2RSU A;  5H8Y E;  2KZR A;  2J42 A;  2JUO A;  2V3N A;  1UF0 A;  2IY0 B;  4NZL B;  2IO0 B;  1WH3 A;  3Q3O C;  2WYQ A;  2BWF A;  2MW5 A;  3NG0 A;  2BYT A;  3VXW A;  2NBW B;  2WHI A;  4MEM A;  5CTR C;  3HVD A;  3QQ8 B;  3PTF C;  5JHA A;  4I6N B;  2LWP A;  3AB5 A;  1N5X A;  1V2Y A;  2LUE A;  2EEL A;  4NQK E;  3AEC B;  2JXT A;  2LJ5 A;  4FJV B;  5IN7 A;  1BML C;  3MC0 B;  2KXJ A;  1SB3 C;  2D07 B;  1R4M B;  3L17 A;  4GLS C;  1NEK B;  1J7A A;  4MSQ B;  4KKI A;  3KWL A;  1NYR A;  2NMQ A;  3W9C B;  1G6J A;  1JQ4 A;  4JQW C;  1FEH A;  3QAR A;  2FBW B;  2HJ1 A;  1Z5S B;  4W9H A;  2ZCC A;  3VTW A;  2MEK A;  3SHQ A;  1TZ1 A;  1WXM A;  1WX8 A;  3QC8 B;  4JPS A;  2MLB A;  1WXV A;  4LNO A;  1FNW A;  2IPK D;  1UNS A;  1L4Z B;  1UBQ A;  4FHJ A;  4CYE A;  5JXV A;  2SEB D;  4M8N A;  3L54 A;  1WYW B;  2KJR A;  3A1Q B;  1ET6 A;  4MEL A;  2BYF A;  2BF8 B;  2K8C A;  1OTR B;  4KGR A;  3W1S C;  3H7P A;  1E6E B;  3TEZ A;  3ZNG C;  2W54 A;  3VR8 B;  2KDF B;  2WXL A;  3NRZ A;  5E6P A;  4F7Z A;  4OZB A;  3DBR B;  1UBI A;  2MBQ A;  1ENF A;  1AN8 A;  2VH2 A;  3OG5 A;  4WJP A;  3NVW A;  4EZJ A;  2KAJ A;  2LVO A;  3ZXV A;  3ZDM C;  3RN9 C;  2L05 A;  1WGD A;  1V80 A;  1E8Z A;  2FCQ A;  2L76 A;  4FXC A;  3TSS A;  4TQ0 A;  1IPG A;  4XYC A;  1PYW D;  3A33 B;  2AQ3 B;  1S3S G;  1H4R A;  4IW0 A;  2VZK D;  3DVG X;  5IAA C;  1WI0 A;  1SE9 A;  3MJW A;  4CQN A;  2CJN A;  4ZYS A;  3GZN I;  1TBE A;  3OWE B;  4ZOH C;  3APF A;  3ZJU A;  3EHV A;  2KDB A;  4G11 A;  1L7Y A;  2ZCB A;  3BIN A;  2B3A A;  2WXO A;  2AQ2 B;  3JW0 X;  4TQ1 A;  3PHX B;  2KAN A;  4J3O D;  2N9E B;  3L10 B;  3ZUN A;  1MVK A;  3NZ3 A;  2KC1 A;  2Z0E B;  3DVN U;  1HTQ A;  3TBL D;  4I6P A;  4FUL A;  4FLH A;  1IBX A;  1MFW A;  1M4V A;  1RAX A;  4KX6 B;  3VUY A;  5HKH A;  3HRD D;  2N7D A;  2FUG 1;  2G45 B;  2L00 B;  2V1Y A;  2KJ6 A;  1WMH B;  3QHT A;  2PTL A;  2KWD A;  4XE0 A;  2L32 A;  3P4R B;  4MGY E;  4HPL B;  3T8M A;  3RFZ B;  3NJT A;  3KLS X;  2JYE A;  2HD5 B;  1JW9 D;  4TUU A;  4RGO S;  4DHJ B;  3T3O A;  1RFK A;  1WXS A;  1XLP A;  2JT4 B;  5E6J A;  1JWU D;  3DWM A;  3JSV B;  3A9J B;  3ZRC A;  3ZRF A;  3J9C A;  2LGD A;  1OFF A;  3AEB B;  1WGK A;  2HTM E;  2C7H A;  3GZN B;  3ZJT A;  4W9J A;  1SEB D;  3KYC D;  2KDI A;  1UWX A;  4GGQ A;  1SBB B;  1P9D U;  5DCN A;  5AZH A;  2LGY A;  3NS8 A;  3DVN V;  4FHK A;  1JRP A;  3U52 E;  4JWU C;  3EFC A;  3Q8E A;  3IVF A;  4IG7 B;  1V5O A;  4HKQ A;  4TMA B;  2KT7 A;  5KHQ A;  2JZP A;  4AJY B;  2BGF A;  2FNJ B;  3TEY A;  1VCB A;  2IGD A;  5BMG A;  2WX1 A;  1XLN A;  5EE1 A;  1PGA A;  1VZ8 A;  2J52 A;  4ARC A;  1DOX A;  4RGM A;  4AP4 C;  1ZOY B;  3NVZ A;  4ZRK A;  4KZ0 A;  3PVL A;  3NS1 A;  4IM3 A;  1N61 A;  4M02 A;  1L4D B;  1D5X C;  3DBL B;  2NTS A;  4TSS A;  4WWM A;  4B6W A;  2WWZ A;  1JAL A;  3P63 A;  4WJQ A;  1KLU D;  2KX3 A;  1TKY A;  2G4S A;  1RWS A;  1V81 A;  1HA5 A;  2X8X X;  4K7S A;  2BB6 A;  3Q6B A;  5I4D A;  3AV8 A;  4N58 A;  4DHZ B;  3KW5 B;  3QAQ A;  1KLV A;  4A6Q A;  1WX7 A;  2QC8 A;  1VJK A;  3TEX A;  1XO3 A;  1NI3 A;  4L23 A;  2LRW A;  4A8X C;  3ECI A;  3KUC B;  4ANX A;  4DHZ E;  5EE9 A;  1V1P B;  2IGH A;  1TKG A;  2I1J A;  4K1R B;  3ZNZ B;  2QSD A;  3ZGZ A;  2V4I B;  3L0W B;  3ZXR A;  3DBL I;  1F2R C;  3KVF B;  1XF5 L;  3AE5 B;  4UDU C;  1ZPS A;  3Q14 C;  3DBH B;  1TZO A;  1A70 A;  4F8C B;  2EKI A;  2DX5 B;  4WAF A;  3QIJ A;  4RGT A;  5IOI A;  4DXG A;  2KLG A;  3BVG A;  3W1S A;  3JSV A;  3Q3J A;  4BZA A;  1ZGU B;  1XCQ L;  4W9G A;  3VVW B;  1Z2M A;  1TIF A;  2R2O A;  4P1B C;  3N1X C;  3EC8 A;  5IA7 A;  4GDK A;  3DOW A;  3I57 A;  1EO6 A;  4II2 B;  1I4G A;  2H89 B;  2IO1 B;  3RMK C;  1QQR A;  2BQQ A;  3DPD A;  1DOY A;  4WQO B;  2EKE C;  1LFD A;  1GOZ A;  4LK0 M;  1FCL A;  3GE8 C;  3SFD B;  2O6V A;  4YTP B;  3PRZ A;  4XWW A;  2OJR A;  4FAD A;  2EMT A;  4BVU C;  4JGH B;  2D11 A;  1EWC A;  4BAX A;  3NVY A;  4XDC A;  2PEA A;  3DBS A;  2LZ6 A;  3UIN B;  3V60 A;  1C9F A;  4S17 A;  4M01 A;  4EKU A;  3LDZ E;  1FMA D;  2QHO A;  2WXK A;  2N9X A;  1F1H A;  3PV1 A;  3FAH A;  2WDQ B;  3NHE B;  3IFW B;  3R7R A;  1XCT L;  2WNM A;  2GI9 A;  3AMZ A;  5D2M B;  3PPA A;  1L2N A;  1WM3 A;  5AZF A;  1WR6 E;  1RM6 C;  1J7C A;  2LHE A;  1C1Y B;  4HJK A;  1Y56 A;  2V4L A;  5BMH A;  4RM9 A;  1LM8 B;  1GB4 A;  3AE9 B;  4RCO A;  4C7Y A;  2KFK A;  2BS4 B;  2KHW B;  2O2V A;  2KNB A;  4C56 C;  1IP9 A;  4ICU A;  2MHJ A;  1B1Z A;  2D3G A;  1F0Z A;  1QOA A;  2NCN A;  3PZ8 A;  2J0J A;  4II3 B;  4C00 A;  2L83 A;  3VH3 B;  4WUR A;  4EOY A;  3Q69 A;  1J0G A;  4M0W B;  4ANW A;  2W82 A;  3Q8C A;  2D3B A;  2IO2 B;  2ON8 A;  2VRR B;  2PE6 B;  3H7S A;  2PW9 A;  2PLP A;  3V05 A;  4GOC A;  1I4R A;  1VR9 A;  4BBN F;  3NVV A;  4US9 A;  3VHT C;  3LXF A;  1DGJ A;  1V6E A;  3RYT A;  1HE8 A;  3PO0 A;  2PJH A;  2WU5 B;  4A55 A;  3MC9 A;  4ZRI A;  1WZ0 A;  3CST A;  2DYB A;  3CIR B;  2NTT A;  2M17 A;  1MPE A;  4Q2J A;  2GBR A;  2LXC A;  2RGF A;  1WIA A;  2LHD A;  2NBU A;  2WXG A;  3PZ7 A;  1GB1 A;  3PS6 A;  1K51 A;  2INN E;  1R7S A;  4LDT B;  3L13 A;  2D3C A;  3B0A A;  4YTM B;  3PRM B;  2O6V D;  3ZYY X;  1Q10 A;  3N1Z C;  3DBH I;  2IO3 B;  1OQY A;  1IBX B;  1UUP A;  4NNJ B;  4OVU A;  2CKH B;  2JYT A;  4EUT A;  3EA6 A;  2BWE S;  1RLF A;  1QKZ A;  1D3Z A;  1PUT A;  1TTN A;  4P7I A;  4F1S A;  1GC7 A;  1K52 A;  3W5U B;  3KWV A;  2BT6 A;  1UEL A;  1V86 A;  3APD A;  4OW0 A;  2EMS A;  2KKC A;  3RT3 B;  5G5H A;  3CSF A;  4ICV A;  3M3J A;  2CR5 A;  2KDM A;  2MJ3 A;  3KH0 A;  4C4V B;  3V62 A;  1UZX B;  2VH1 A;  5IKC M;  2L7R A;  2NBV B;  4BBN C;  5CHF A;  1RFA A;  3Q8A A;  2C7N B;  4LNF A;  5HHD G;  2K5P A;  2KQ4 X;  5LXH A;  1KJT A;  4GN1 A;  3RNB C;  1EWY C;  5JHB A;  4WJN A;  1MI0 A;  2LFI A;  1V8C A;  1JWS D;  2O6V B;  2KN4 A;  3AE2 B;  2HDE A;  3GS2 A;  1TS2 A;  1ZE3 D;  2KWC A;  2DLB A;  3SD5 A;  3DVG Y;  4XGA B;  3MC8 A;  3C0R B;  2N1W A;  1EUV B;  1NBF C;  3BK2 A;  3Q3N C;  4RGN A;  1C78 A;  3RNC C;  4A9A A;  2QJL A;  5J18 A;  2K3U A;  2CU1 A;  1E8Y A;  2KX0 A;  3IAM 1;  1C3T A;  3A9J A;  1GPX A;  2KQS A;  2AEH A;  2XN9 C;  4GDL A;  4BKS D;  4L2Y A;  1M94 A;  2M1M A;  4HCN B;  2D2Q A;  2DYO A;  1KLG D;  2JQR B;  2LGX A;  2JSV X;  2XK5 B;  4IC7 B;  3TEW A;  2BYV E;  3A1Q A;  1FCC C;  1QOB A;  1R4N I;  2Q5W D;  3K9P B;  5DPS A;  2QMT A;  1MHX A;  1XQQ A;  1YIW A;  1QOG A;  2GRI A;  1WMH A;  2MX2 A;  1FXI A;  3AM9 A;  3ZNH B;  1T3Q A;  2LRU A;  2DEN B;  1YN3 A;  4IWQ A;  5D7G A;  2N7J A;  4KSL C;  3FKY A;  3T3N A;  1XEE A;  2GB1 A;  4TV3 A;  3AEG B;  4DK5 A;  3AI5 A;  2J7Q B;  5BYQ A;  4W9C A;  2RR9 A;  5TR5 A;  1HEZ E;  4NAW A;  2ZPN A;  3A9K A;  4C4V A;  3ZTC A;  3RZF A;  3BWU D;  2JWZ A;  3MFG A;  3PRE A;  4HRS A;  2KLC A;  2SAK A;  2Z8L A;  2MBO A;  1WR1 A;  3BK1 A;  2ZNV B;  2Y5P A;  4RMA A;  2BVC A;  1D4B A;  3AE6 B;  2ASQ A;  2WXI A;  2KTF A;  1ZP0 B;  3H8H A;  1KRH A;  4QAY A;  4K3C A;  1SGH A;  3MP9 A;  1I4P A;  2GBN A;  2KC2 A;  2LMC A;  1TYG B;  1TS4 A;  1CK1 A;  3RNG C;  3D32 A;  1BXT A;  1YMH E;  1K50 A;  3VUX A;  2AL3 A;  3IT4 B;  3W2D A;  1LXD A;  3EUB 2;  1WSP A;  2ZW1 A;  3AN1 A;  2MP2 A;  4AOF A;  1OQQ A;  1WJ4 A;  2KJH B;  3FIL B;  4WWP A;  1TY0 A;  4IWO A;  2M0X A;  4L1B A;  1C4C A;  1JWA D;  3NOB A;  5DPT A;  3UQA A;  4K3B A;  4B0M A;  4E3C A;  3WAO A;  5FKA C;  4DDI D;  5CX3 A;  2V3S A;  2WLB A;  1FNV A;  3ALB A;  4MDK E;  4ZRJ A;  1XD3 B;  1N6Z A;  3UIP B;  1XT9 B;  2N7E A;  4LLG M;  4GMV A;  4W9D A;  3R8B A;  5FK9 C;  2MP2 B;  5D6J B;  4ARI A;  3ZDT A;  2BKF A;  2E3T A;  4OVV A;  2DZK A;  2QIL A;  5G5G A;  1V49 A;  4HWI B;  1XLQ A;  2MA9 B;  1F77 A;  2CHX A;  1WJU A;  3UQB A;  1JML A;  1BUI C;  1FM0 D;  1OEY J;  2KK8 A;  1WE7 A;  2ICI A;  1ZDV A;  2DAJ A;  3P4S B;  3TCA A;  2GLS A;  2ZZP B;  1QLB B;  2JZZ A;  3AE1 B;  3AU5 A;  1SE3 A;  3VQI A;  1IGC A;  1GG3 A;  3A4S C;  1QZE A;  2LGS A;  3WAN A;  2JU6 X;  4KGT A;  3V3X A;  2BPS A;  1AYF A;  2C5L C;  3RZW C;  2K8H A;  2PE9 A;  2G3Q B;  2HTH A;  3AEA B;  2D10 A;  4GXB A;  2IY1 B;  4A90 A;  2WX0 A;  4IUM B;  4WWO A;  1C79 A;  2YLM A;  2J0K A;  3VUW A;  2M4N A;  1F52 A;  1N62 A;  3B9J A;  2KVR A;  4MJS B;  1WXQ A;  2N1V A;  2G4D B;  2Z59 B;  1K53 A;  2KO3 A;  4ANU A;  1GNU A;  4HDQ A;  1R4N B;  1XLO A;  3IXS A;  4O1N A;  2K6D B;  2KAC A;  4PS3 A;  2GBM A;  1UH6 A;  5AUK A;  1E8X A;  3A4R A;  1B9R A;  3DWG C;  1T0R C;  2V9H A;  4EFO A;  2R61 A;  3AED B;  4N9F 4;  4PT5 A;  2V0G A;  2ZNV C;  4BOZ B;  4P6V F;  3MHS D;  1I4H A;  3NY5 A;  4ZRP A;  3P42 A;  1EU4 A;  3L4P A;  2CS4 A;  2N9L A;  3VH4 B;  5E6N A;  2L1A A;  2NS5 A;  2WXQ A;  2PKO A;  4AWJ A;  3H6N A;  4PYU A;  4HXD A;  3VRB B;  4DWF A;  4HDO A;  5C23 A;  1CZP A;  2AYO B;  3M62 B;  3C19 A;  1C4P A;  3ZJV A;  4P1C C;  3GOE A;  5KHO A;  1ZXH A;  4NQL B;  1FNU A;  2KMA A;  3BYY B;  2N9P C;  1NI2 A;  2AQ1 B;  3X23 A;  2WS3 B;  2WP9 B;  1JRU A;  4IM0 A;  2K39 A;  3B2F A;  3N20 C;  5EE0 A;  1C77 A;  4GB9 A;  1ESF A;  2AL6 A;  1ISN A;  3ML8 A;  1WZ3 A;  3ZO5 B;  3EGR A;  5TSS A;  2DAF A;  4W9K A;  1ACC A; 
#chains in the Genus database with same CATH homology
 1WXM A;  1WX8 A;  3QC8 B;  2MLB A;  4NNJ B;  1WXV A;  4OVU A;  3DCG A;  1LQB A;  3CF6 E;  2CKH B;  1UBQ A;  4EUT A;  1E90 A;  2Y5B B;  2BWE S;  4FHJ A;  3S2A A;  4CYE A;  1RLF A;  1WGG A;  4DBG A;  2XEW A;  3WAP A;  1D3Z A;  4M8N A;  3L54 A;  3AU4 A;  4ZYN A;  3ZIM A;  1WYW B;  2KJR A;  1TTN A;  1WFY A;  3A1Q B;  4IWP A;  4MEL A;  4P7I A;  3WAM A;  4F1S A;  2BYF A;  1GC7 A;  4KVG B;  2BF8 B;  2K8C A;  4LDT D;  4AJW A;  2A5U A;  4NJ6 A;  3V61 A;  1UEL A;  1OTR B;  1YX5 B;  2IBI B;  1V86 A;  3W1S C;  3APD A;  2CHW A;  3H7P A;  3VAW A;  2EMS A;  2C7M B;  3QK0 A;  1UGM A;  2KKC A;  3RT3 B;  3ZNG C;  3H1U A;  3CSF A;  1BT0 A;  2KDF B;  4F7Z A;  3EEC A;  5E6P A;  4KDI C;  3UIO B;  4ICV A;  3PT2 B;  3M3J A;  2CR5 A;  3H7P B;  3IBE A;  3KH0 A;  1UBI A;  2MBQ A;  3V62 A;  1UZX B;  4WJP A;  4EEW A;  4EZJ A;  5CHV C;  3AUL A;  5L83 A;  2LVO A;  3ZDM C;  5JH5 C;  2PPH A;  2L05 A;  1NDD A;  1WGD A;  2NR2 A;  2L7R A;  3VFK A;  1V80 A;  3HM3 A;  1E8Z A;  1FXT B;  3DDC B;  2FCQ A;  2L76 A;  2NBV B;  2KOX A;  4BBN C;  5CHF A;  4TQ0 A;  1IPG A;  3MTN B;  1RFA A;  3A33 B;  1E7U A;  2JY6 A;  1KOT A;  4I6L B;  3R3M A;  1S3S G;  2C7N B;  1H4R A;  4IW0 A;  5LXH A;  1KJT A;  4GN1 A;  1F9J A;  1WX9 A;  4NY0 A;  2MCN B;  5JHB A;  3DVG X;  5IAA C;  1WI0 A;  4WJN A;  1SE9 A;  3MJW A;  4XZ4 A;  2JZ3 B;  3GZN I;  1TBE A;  1GC6 A;  1P98 A;  4TKN A;  2KN5 A;  4W9I A;  3APF A;  3EHV A;  2O6V B;  2KDB A;  4GSW A;  3DQV A;  4G11 A;  1L7Y A;  2ZCB A;  3BIN A;  2B3A A;  1RRB A;  2KWC A;  3SD5 A;  2FCS A;  3DVG Y;  5DPR A;  3JW0 X;  1YQB A;  3C0R B;  2LAS A;  2N1W A;  4TQ1 A;  3PHX B;  2HE7 A;  2KAN A;  2DZM A;  1EUV B;  2KWU B;  1NBF C;  2L0F A;  2N9E B;  4G3X B;  4KDL B;  3LJ3 A;  2WDT B;  3L10 B;  2IZV B;  5J18 A;  3ZUN A;  2KC1 A;  2Z0E B;  3DVN U;  3N32 A;  3IHP C;  4E71 A;  3TBL D;  2CU1 A;  4I6P A;  4FUL A;  4FLH A;  3TJP A;  1CMX B;  1E8Y A;  4BOS C;  2KX0 A;  2MWS B;  3NZU A;  1RAX A;  1C3T A;  5AZG A;  3A9J A;  1V9J A;  3VUY A;  5HKH A;  4HK2 A;  2KQS A;  2AEH A;  1YJ1 A;  1WF9 A;  4GDL A;  2JF5 A;  4BKS D;  1M94 A;  2M1M A;  2N7D A;  4HCN B;  2D2Q A;  2DYO A;  2G45 B;  2LGX A;  4URK A;  2L00 B;  2V1Y A;  2XK5 B;  2KJ6 A;  4GIV A;  4IC7 B;  2BYV E;  3OJ3 A;  1WMH B;  3A1Q A;  3QHT A;  3X0W A;  1R4N I;  1TGZ B;  4MGZ E;  3QWZ B;  3K9P B;  5DPS A;  4MGI E;  1J8C A;  5G55 A;  1XQQ A;  4MGY E;  1YIW A;  4HPL B;  2I1K A;  3T8M A;  3HHM A;  1WMH A;  3QX1 A;  4K7U A;  2KMC A;  3PSE B;  2MX2 A;  2HD5 B;  2KD0 A;  3T9L A;  3H9D A;  3P2B A;  4TUU A;  4DHJ B;  3ZNH B;  2Z0D B;  1WXS A;  2JT4 B;  1V5T A;  2LRU A;  2O2V B;  2DEN B;  3JSV B;  3QA8 A;  3Q3F A;  3A9J B;  3ZRC A;  2FIF A;  4IWQ A;  5D7G A;  3ZRF A;  2AWT A;  4FN2 A;  4KSL C;  2DZJ A;  3TMP B;  2LGD A;  4W9F A;  3RD2 A;  2REX A;  3KUD B;  4JL9 A;  2C7H A;  4TV3 A;  4DK5 A;  4BKS A;  3AI5 A;  4B95 A;  2L0T A;  4GU2 A;  1OGW A;  2J7Q B;  4W9C A;  2RR9 A;  4W9J A;  2FAZ A;  5TR5 A;  4A3P A;  3KYC D;  2K1F A;  4NAW A;  2KDI A;  2ZPN A;  4GGQ A;  5AZH A;  1P9D U;  5DCN A;  2LGY A;  3NS8 A;  3A9K A;  3K9O B;  3DVN V;  2LI5 A;  4FHK A;  3ZTC A;  3IG3 A;  1Y8R C;  3RZF A;  2JWZ A;  1H8C A;  4NPN A;  3PRE A;  4FA6 A;  1U4A A;  2KLC A;  1OEY A;  4NAW B;  2MBO A;  3IVF A;  3PGE A;  4MM3 A;  4IG7 B;  1V5O A;  2NVU I;  3ZKJ C;  1WR1 A;  2KQ7 A;  1P0R A;  3VTU A;  3SDL C;  2ZNV B;  3M95 A;  1PQS A;  1X1M A;  2DHZ A;  3JYU A;  4GDL B;  4RMA A;  5GMV A;  4J6I A;  3RCZ A;  4B9K A;  5KHQ A;  2ASQ A;  4AJY B;  2BGF A;  2FNJ B;  2KTF A;  4YL8 A;  3DBR I;  1VCB A;  3B08 A;  2DZI A;  5DPW A;  4KIK A;  1SGH A;  2WX1 A;  4FJY A;  2KC2 A;  2GBN A;  3R66 C;  2N4F A;  3V6C B;  4DDG D;  3D32 A;  2KWV B;  1WXA A;  3A9K B;  4AP4 C;  4JLC A;  3VUX A;  4ZRK A;  4KZ0 A;  3PVL A;  2RD0 A;  4RM8 A;  2AL3 A;  1WGH A;  4IM3 A;  2ZJD A;  3NZS A;  2BYE A;  1LXD A;  2FUH B;  4W9L A;  4JIO U;  4A3O A;  2MP2 A;  4AOF A;  2MQJ A;  4B6W A;  4XC2 A;  3RUL A;  3I3T B;  1WJ4 A;  2KJH B;  4WWP A;  2WWZ A;  1KM7 A;  2IYD B;  4WJQ A;  1A5R A;  4IWO A;  2KX3 A;  4WAA A;  2M0X A;  3VTV A;  2G4S A;  3NOB A;  5DPT A;  3UQA A;  3ENE A;  1MG8 A;  1V81 A;  4IM2 A;  4KSK C;  2UYZ B;  4K7S A;  4E3C A;  3WAO A;  3L16 A;  3N30 A;  2K8B A;  4DDI D;  3JVZ X;  5CX3 A;  2V3S A;  3APC A;  4DHZ B;  2KFJ A;  4MDK E;  3ALB A;  2C9W B;  4ZRJ A;  3KW5 B;  3QAQ A;  1KLV A;  1XD3 B;  3UIP B;  2ZEQ A;  1XT9 B;  2N7E A;  1WX7 A;  2MBB B;  2KTR B;  2K6Q A;  1Q1O A;  4GMV A;  1ZKH A;  4W9D A;  2OOB B;  4WJO A;  3TL5 A;  1VD2 A;  2MP2 B;  2LRW A;  3ECI A;  3KUC B;  4LJO B;  5D6J B;  3WA0 A;  4ANX A;  4DHZ E;  3ZDT A;  2L8J A;  3L08 A;  3ZTD A;  3BY4 B;  2BKF A;  2C60 A;  2M8S A;  2MSE D;  3QCA A;  5CHW A;  2I1J A;  3OLM D;  4X57 B;  2FCN A;  3HK0 A;  4OVV A;  3ZVV A;  4K1R B;  1IYF A;  2DZK A;  3ZNZ B;  1S1Q B;  2L3Z A;  4HVB A;  1WJ6 A;  3L0W B;  1V49 A;  3DBL I;  4HWI B;  4MH0 E;  3KVF B;  3WIM A;  2MA9 B;  4FJZ A;  4HPM B;  3AXC A;  2LVQ A;  3OAW A;  2CHX A;  4PS8 A;  1WJU A;  2KFK B;  4M8M A;  4AUQ C;  3UQB A;  2FID A;  4LCD E;  2KDE B;  2JPH A;  4F8C B;  2DX5 B;  2JXX A;  1OEY J;  3O65 B;  3QIJ A;  1EF5 A;  1P1A A;  3PLU A;  2KK8 A;  1WE7 A;  3U8Z A;  2DAJ A;  2DYM A;  2KLG A;  4PS7 A;  3W1S A;  5L95 C;  3N3K B;  3JSV A;  3Q3J A;  4HCP B;  1ZGU B;  4W9G A;  3TCA A;  3VVW B;  1Z2M A;  2ZZP B;  1Q0W B;  4BKT A;  2JZZ A;  2R2O A;  4XX5 A;  3EC8 A;  5IA7 A;  3AU5 A;  4GDK A;  5E6O A;  3DOW A;  4E74 A;  3KYD D;  3VQI A;  1EO6 A;  2MBH A;  1GG3 A;  2J0M A;  1QZE A;  3A4S C;  4II2 B;  3WAN A;  3WAL A;  5LLI A;  2IO1 B;  5BO4 B;  1ZW7 A;  2NPT A;  3DPD A;  4EZL A;  5J2R A;  2BPS A;  3QJZ A;  4WQO B;  5JZE B;  2C5L C;  2EKE C;  3RZW C;  1LFD A;  3HM6 X;  4CHK A;  2MBE A;  2K8H A;  2PE9 A;  1J19 A;  2RPQ A;  2UWQ A;  4K81 A;  3ZW3 A;  3VDZ A;  2G3Q B;  2O6V A;  2HTH A;  1UD7 A;  4BFR A;  2D10 A;  4GXB A;  2IY1 B;  3PRZ A;  3U30 A;  2WX0 A;  4IUM B;  5J17 A;  2OJR A;  4WWO A;  5AEK B;  2GBK A;  4FAD A;  5LXI B;  2EMT A;  4BVU C;  2JRH A;  2XK5 A;  2HJ8 A;  3PZD A;  4JGH B;  2D11 A;  1WGR A;  2J0K A;  2YLM A;  2M4N A;  3RUI B;  3VUW A;  4G50 A;  1T0Y A;  3UF8 A;  4DHJ D;  2PEA A;  3DBS A;  2LZ6 A;  3UIN B;  3V60 A;  4DXA B;  3U7D A;  4W9E A;  4GDK B;  5G2N A;  2KVR A;  4HLE A;  3R7Q A;  2A4Z A;  3LDZ E;  3TIX A;  4EKU A;  1GUA B;  1WY8 A;  2R2Q A;  4WWN A;  4MJS B;  2QHO A;  4KV2 A;  2N9X A;  2N1V A;  2G4D B;  2Z59 B;  3ML9 A;  3PV1 A;  2KO3 A;  1P3Q U;  1Q5W B;  1GNU A;  4ANU A;  4HDQ A;  3NHE B;  1WM2 A;  2XBB C;  3IFW B;  3R7R A;  2GOW A;  4EZK A;  3V6E B;  3OJ4 B;  1E8W A;  3PPA A;  5D2M B;  1WGY A;  2K6D B;  2ZPY A;  4MJS A;  1WM3 A;  1L2N A;  2ZVO A;  4PS3 A;  2GBM A;  5AZF A;  1WR6 E;  5D94 A;  1UH6 A;  3SHQ A;  3UGB B;  1E8X A;  1C1Y B;  3A4R A;  4HJK A;  2GBJ A;  2V4L A;  4EFO A;  5C1Z A;  4RM9 A;  1LM8 B;  4NJ7 A;  3PRP B;  4N9F 4;  4CO7 A;  2LVP A;  2ZNV C;  4BOZ B;  4PYZ A;  1K8R B;  4ANV A;  4BKG A;  3MHS D;  2JRI B;  2JVC A;  2KFK A;  4KZC A;  2KHW B;  2FCM A;  4KIK B;  2O2V A;  4MSM B;  4A20 A;  1R4M I;  3NY5 A;  2KNB A;  4ZDV A;  1IP9 A;  2NPT B;  4ICU A;  3CMM B;  3KUZ A;  1AAR A;  1EF1 A;  2D3G A;  2LD9 A;  3W1Y A;  1I35 A;  4FBJ B;  2NCN A;  5EDS A;  2J0J A;  2YVC A;  4II3 B;  2CS4 A;  1E5W A;  1WJN A;  5E6N A;  3VH4 B;  2RSU A;  2KZR A;  3VH3 B;  2NS5 A;  2JUO A;  4K7W A;  2IY0 B;  4EOY A;  4AWJ A;  1J0G A;  2IO0 B;  3H6N A;  4M0W B;  4PYU A;  4HXD A;  1WH3 A;  1YD8 U;  4ANW A;  2WYQ A;  2BWF A;  3ZLZ A;  2BKR B;  2MW5 A;  3M63 B;  3B1L X;  3PHW B;  3VXW A;  1YX6 B;  2NBW B;  4MEM A;  4LJP B;  2IO2 B;  2VRR B;  5CTR C;  2PE6 B;  3SU8 X;  4DWF A;  4HDO A;  2LXA A;  5C23 A;  3H7S A;  3QQ8 B;  1E7V A;  3PTF C;  5JHA A;  4GOC A;  2AYO B;  3M62 B;  4I6N B;  4BBN F;  2LWP A;  1V2Y A;  1WRD B;  2LUE A;  3HIZ A;  1WE6 A;  3EFU A;  3GOE A;  4NQK E;  1V6E A;  5FR6 A;  5KHO A;  3RYT A;  2LJ5 A;  3VHT C;  1HE8 A;  2PJH A;  4FJV B;  4NQL B;  2ZVN A;  2MRP A;  4ZRI A;  1WZ0 A;  2DYB A;  2KMA A;  2KXJ A;  3CST A;  2N9P C;  1NI2 A;  2M17 A;  2D07 B;  2GMI C;  2GBR A;  2LXC A;  2RGF A;  3L17 A;  1WIA A;  3X23 A;  3ZNI D;  4IM0 A;  1JRU A;  2K39 A;  2NBU A;  4ASW C;  4G0N B;  4GB9 A;  1GJZ A;  3PS6 A;  2KTR A;  2W9N A;  3PLV A;  2AL6 A;  4MSQ B;  1ISN A;  3ML8 A;  2K25 A;  1WZ3 A;  3ZO5 B;  1SIF A;  1I42 A;  1G6J A;  4LDT B;  3L13 A;  3ONS A;  4JQW C;  3QAR A;  3B0A A;  2DAF A;  3PRM B;  4MGK E;  2O6V D;  4W9K A;  1Z5S B;  4W9H A;  2ZCC A;  2CHZ A;  3DBH I;  2IO3 B;  1OQY A;  1TZ1 A;  3VTW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...