2KWCA

The nmr structure of the autophagy-related protein atg8
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
116
structure length
116
Chain Sequence
MKSTFKSEYPFEKRKAESERIADRFPNRIPVICEKAEKSDIPEIDKRKYLVPADLTVGQFVYVIRKRIMLPPEKAIFIFVNDTLPPTAALMSAIYQEHKDKDGFLYVTYSGENTFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The NMR structure of the autophagy-related protein Atg8
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
molecule keywords Autophagy-related protein 8
total genus 18
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2010-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2kwcA00
1V6EA 3SDLC 1ZKHA 4E3CA 2KX3A 5D6JB 5CTRC 2MCNB 2O2VA 2CHZA 4K7SA 1GUAB 3ML8A 5DPSA 1P3QU 2LGDA 4W9CA 1WY8A 2RGFA 3UF8A 4FBJB 2WX1A 4HCNB 4MGYE 1SE9A 4NAWB 1I35A 4NQLB 4RM8A 2ZNVB 2XBBC 3ZNID 4ANUA 1Z2MA 2KZRA 1NDDA 4DDGD 2DYOA 3H7PB 2C9WB 2JT4B 1FXTB 1WIAA 3QHTA 2KLGA 1IPGA 2PE9A 4HDOA 2RR9A 1GC7A 1UBIA 4LJOB 2KFJA 3PSEB 3PTFC 4IM0A 2EMSA 3VUXA 2CR5A 1MG8A 2MW5A 2PJHA 5DPRA 3ZTDA 1UBQA 3TL5A 4ZRJA 1E8ZA 2MBHA 5KHOA 1KOTA 2C60A 4FHJA 1EUVB 1XT9B 2MBQA 3VUWA 1V5TA 4RMAA 4W9LA 4HCPB 1AARA 3WANA 4IWQA 5L83A 5C23A 2JRIB 2ZCBA 3TBLD 2ZZPB 4CHKA 4MEMA 4XX5A 5FR6A 3T9LA 1KLVA 2N1VA 2KFKB 2GBNA 2R2OA 4HDQA 3PRMB 4GU2A 2IO0B 2AYOB 1NBFC 1V81A 5J2RA 4HPLB 3ZNZB 2A5UA 2V3SA 5IAAC 2BGFA 3HK0A 2KTRA 3APFA 3LDZE 4KVGB 3EECA 3H7PA 3R7RA 2MX2A 2K6QA 3DVGY 4LDTB 4K7UA 4E74A 1Q5WB 2LGYA 2FCMA 1X1MA 3BY4B 4IG7B 2O6VD 5J17A 4DXAB 1E90A 1ZW7A 3T8MA 1L2NA 3ZW3A 2N9XA 2NBWB 2KANA 4ZRIA 4AOFA 2L3ZA 4GMVA 4EOYA 1WJ6A 1I42A 2LVQA 3RT3B 3VTVA 1OQYA 1XD3B 1E5WA 3DDCB 5J18A 1WMHB 2W9NA 5CHWA 2KX0A 1WJNA 1U4AA 2Y5BB 3H9DA 2KDIA 2LGXA 2LRUA 3L16A 4M8NA 2LD9A 5CHFA 3WA0A 5DPWA 3R3MA 2D2QA 2NPTA 2LVOA 1WX7A 2FIDA 2IO2B 2N9EB 4TQ0A 3AULA 5GMVA 2DAJA 2KWUB 5D2MB 3TCAA 1E7UA 4WWNA 3WAOA 3ZLZA 3PRZA 1J19A 2JY6A 2BWES 1EF1A 2CU1A 4BBNF 2NR2A 4WQOB 4P7IA 4BBNC 3W1YA 1H4RA 4ANWA 1WFYA 2HE7A 4IUMB 5LXIB 1WGDA 2JRHA 4F8CB 3NOBA 5DPTA 1Q1OA 1VCBA 2DAFA 3B1LX 2WYQA 3QCAA 4OVVA 3N3KB 1V86A 4PS8A 4EEWA 4MELA 2DYBA 1GG3A 1Y8RC 2L0FA 3AXCA 3DBLI 4KIKA 2MP2A 4OVUA 2KDEB 3IFWB 4J6IA 4AWJA 1WXSA 3APCA 3NHEB 4GSWA 3QX1A 2MLBA 2IBIB 1V80A 3ENEA 2BYEA 4I6NB 2M1MA 4HK2A 2C7MB 1P9DU 3NZSA 2MP2B 2ZCCA 3DCGA 2K1FA 3PLVA 4K1RB 4NQKE 4FADA 4GDLB 4WWOA 3PV1A 1E7VA 4EZKA 2RSUA 3VTUA 2JF5A 4A3OA 3L10B 4GB9A 2O6VA 2B3AA 3UGBB 1KJTA 1WI0A 3ZVVA 1J0GA 1WF9A 2MBOA 3O65B 2PEAA 5AEKB 2R2QA 4G50A 4G3XB 1ISNA 5KHQA 2L8JA 2JPHA 3NS8A 3KUZA 2J0MA 2KVRA 2J0JA 1HE8A 5AZHA 3ZO5B 4JIOU 2L00B 5LXHA 4DHZE 2HJ8A 1E8WA 3DVNU 2I1JA 4N9F4 2L7RA 2BYFA 2MQJA 1GC6A 4G0NB 4IWPA 1RRBA 5EDSA 1L7YA 1OTRB 4BVUC 2HTHA 4DHZB 5JH5C 2N7DA 1OEYJ 2NPTB 1WGYA 4WWPA 2Z0DB 4W9HA 4WJPA 2NCNA 2M4NA 2K39A 3C0RB 1OGWA 2N1WA 2O6VB 1SIFA 3DBRI 4NPNA 1R4MI 4NY0A 4BKGA 3DBHI 1TBEA 3AU4A 3QJZA 4M8MA 1WM3A 3ZTCA 4IM2A 1WGGA 4ZYNA 4MSQB 2JZ3B 1YX6B 3U30A 3X23A 4CYEA 3PT2B 3MTNB 4M0WB 4FJVB 4KZCA 4BOSC 4KSKC 3PREA 3PHWB 2KTFA 3IHPC 1JRUA 1WH3A 2V1YA 1G6JA 4II3B 2N4FA 2BKFA 2JZZA 2KHWB 4GDKA 4MH0E 5C1ZA 1EO6A 3S2AA 3HHMA 2PE6B 1YJ1A 2KN5A 2DHZA 2KTRB 3OJ3A 3QWZB 4GOCA 4EFOA 3CSTA 3Q3JA 1LXDA 3VH3B 4NNJB 1WZ0A 3VQIA 4ASWC 1WGHA 2FIFA 4JL9A 2FCNA 4FJYA 4PYZA 5E6PA 1UGMA 4MM3A 3WIMA 4DWFA 1VD2A 2G3QB 4DBGA 3NY5A 4W9GA 4HLEA 2KDBA 2MSED 2LXCA 2WDTB 2KC1A 2YVCA 3LJ3A 4NJ7A 3ML9A 1H8CA 1WZ3A 2KMAA 3L17A 3PRPB 4FJZA 1WE7A 3QA8A 3AI5A 4II2B 4KDIC 2DZJA 3RUIB 3VAWA 1RLFA 2BYVE 2NBVB 4ZDVA 1LM8B 1WR1A 2CKHB 2K8HA 1UELA 4MSMB 1WRDB 1XQQA 3SU8X 1Q0WB 2QHOA 2FCQA 4I6LB 2KOXA 1YX5B 3JYUA 3TMPB 1WMHA 3RCZA 3DVNV 3VVWB 2WX0A 3A1QB 5AZFA 4AUQC 3A9JA 3GZNI 1TTNA 2DYMA 1V5OA 2BKRB 4MGIE 2GBMA 2G4DB 4PS7A 2JWZA 2CHXA 5JZEB 3DQVA 2IYDB 5BO4B 4BFRA 1K8RB 2MA9B 4ANVA 4B95A 1WJUA 4BKSD 5HKHA 2BPSA 2ZPNA 4WJOA 4FLHA 1E8YA 4LJPB 2L76A 2DX5B 5JHBA 2GMIC 2K25A 1C3TA 2M0XA 3KUCB 1YD8U 5CHVC 4X57B 2JUOA 4HVBA 4AP4C 3R7QA 2J7QB 2C7NB 4EZJA 3PZDA 3ZNHB 4A3PA 3DPDA 2G4SA 2MWSB 1LQBA 4MDKE 4FN2A 4LDTD 3TJPA 1C1YB 2KWCA 2L0TA 4WAAA 3V6EB 3VFKA 3ZUNA 2KFKA 3A9JB 1J8CA 3A1QA 4FULA 4HJKA 4W9IA 4ANXA 2O2VB 3SD5A 1UZXB 2G45B 3R66C 3UIOB 4EZLA 2K8CA 2XEWA 3QAQA 3DVGX 3VHTC 2LI5A 3CMMB 4B6WA 2AEHA 3HIZA 2GBRA 1KM7A 3KUDB 4IC7B 3VXWA 3A4RA 3KYCD 2JXXA 2AWTA 4WJNA 1YQBA 2IY0B 3V62A 3A9KB 4PS3A 1WX9A 2HD5B 3PLUA 1UD7A 3A4SC 4EKUA 2LXAA 3P2BA 4HPMB 1P0RA 2BF8B 1WX8A 1F9JA 1LFDA 2D11A 4TV3A 2ZVNA 4TQ1A 1WGRA 1V49A 2LASA 4KZ0A 3WALA 2YLMA 3B0AA 2LWPA 3M3JA 1A5RA 1GJZA 1M94A 3U8ZA 2KQ7A 3QC8B 2AL3A 3QARA 4GDKB 4PYUA 2C7HA 2GBJA 2V4LA 1CMXB 3VTWA 1QZEA 3ZDMC 2KMCA 1V9JA 2LUEA 3QK0A 4JGHB 2N7EA 3I3TB 2ZVOA 4MJSB 2REXA 2CHWA 2KK8A 2FAZA 2GBKA 3ECIA 3L13A 3WAMA 1WM2A 4NAWA 2NBUA 5DCNA 3RZWC 2LVPA 4ICUA 1OEYA 4HWIB 3V60A 2VRRB 3U7DA 4I6PA 2IZVB 3OAWA 3APDA 1BT0A 3PVLA 3SHQA 3ZIMA 4DK5A 2KXJA 4DDID 3EHVA 4FHKA 3ZRCA 2FNJB 4EUTA 3VUYA 1RFAA 4CO7A 3PHXB 3JW0X 2D3GA 2GOWA 3Q3FA 3TIXA 3CSFA 3QQ8B 2JVCA 3MJWA 4JLCA 2KQSA 2KC2A 2Z0EB 3ZKJC 4W9EA 1R4NI 3W1SA 3H7SA 3UINB 2BWFA 1P98A 4GGQA 3RD2A 1P1AA 3WAPA 2FUHB 4MGZE 3HM6X 4A20A 3UQBA 1E8XA 1V2YA 1WXVA 4URKA 1IP9A 3NZUA 4GIVA 3EFUA 3UQAA 1WYWB 1EF5A 2C5LC 3UIPB 4NJ6A 4GDLA 2EKEC 2I1KA 2OJRA 1NI2A 3V6CB 2LZ6A 2OOBB 4AJWA 5E6OA 3GOEA 2RPQA 3RZFA 4K7WA 4IWOA 1YIWA 1D3ZA 1RAXA 5D94A 2DENB 3EC8A 5L95C 2J0KA 4KIKB 3RYTA 4BKTA 2ZNVC 4XC2A 4TKNA 2UYZB 2LJ5A 2KO3A 3DOWA 1WJ4A 2DZKA 4IW0A 3PS6A 4E71A 3KW5B 4DHJD 3ZNGC 2FCSA 5G2NA 2IY1B 3JVZX 2NS5A 3PGEA 3H1UA 2CS4A 3JSVB 2KD0A 5G55A 3B08A 4MGKE 2DZIA 3IG3A 1WXMA 5E6NA 2KJRA 2XK5B 2KLCA 4FA6A 2NVUI 3M62B 2K8BA 3A33B 5D7GA 1Z5SB 2ASQA 2KNBA 2MBBB 3L08A 4KV2A 1S3SG 3V61A 3RULA 2M8SA 3N32A 3OLMD 2XK5A 3KVFB 3M63B 4KSLC 3N30A 2KWVB 5AZGA 2WWZA 1IYFA 2AL6A 4AJYB 3JSVA 4W9KA 5IA7A 2UWQA 4IM3A 2ZEQA 4HXDA 3H6NA 4W9FA 3VH4B 4TUUA 2KDFB 4KDLB 4G11A 2PPHA 1PQSA 3OJ4B 1TZ1A 3D32A 2D10A 2EMTA 1UH6A 4ZRKA 3AU5A 3CF6E 4W9JA 4RM9A 3X0WA 4F1SA 5CX3A 2ZJDA 3K9PB 2LRWA 2MRPA 3ZDTA 2Z59B 3ONSA 4MJSA 4F7ZA 2N9PC 3DBSA 4DHJB 2D07B 2IO1B 2KJ6A 1S1QB 2L05A 2RD0A 2ZPYA 3IBEA 3ALBA 4GN1A 4JQWC 3PPAA 5JHAA 3QIJA 1GNUA 3HM3A 3IVFA 3W1SC 2KKCA 2KJHB 4K81A 1T0YA 2MBEA 3VDZA 4ICVA 3L54A 1WR6E 4WJQA 3M95A 1ZGUB 3KYDD 4YL8A 1WXAA 3MHSD 3ZRFA 2A4ZA 5LLIA 3A9KA 4GXBA 1SGHA 3K9OB 2K6DB 3KH0A 1TGZB 2M17A 5TR5A 2DZMA 3BINA 4BOZB 4XZ4A 4W9DA 4B9KA 4LCDE 3L0WB 4BKSA 1WE6A 2IO3B
chains in the Genus database with same CATH superfamily
3Q3MC 1FIQA 3AEGB 5MPOA 1CK1A 1SE2A 5CTRC 2O2VA 4WWMA 4K3CA 5I4DA 1NYRA 4FBJB 4NAWB 4HCNB 1L0VB 3P1MA 4LNNA 4ANUA 1Z2MA 2KZRA 1NDDA 1UUPA 2C9WB 2JT4B 2JZPA 5E6JA 5EE1A 3HUIA 1GB1A 4LLGM 1UBIA 4LJOB 1C4CA 2KFJA 2EMSA 2CR5A 5DPRA 2PJHA 2WDVB 3TL5A 1E8ZA 3AE9B 1EUVB 3VUWA 3H8HA 1C77A 4RMAA 3U52E 4HCPB 1AARA 3WANA 1RFKA 2VH2A 2M0AA 1ZOYB 1E9MA 1KLVA 1SEBD 5FR6A 3AE3B 3PRMB 1AW7A 5T8IA 1V81A 4LNOA 3AE4B 2RDBC 2BGFA 1SF0A 3APFA 3Q69A 3RN9C 4C00A 2MX2A 2K6QA 1Q5WB 4IG7B 2O6VD 2K3UA 4DXAB 1ZW7A 4O1NA 4OZCA 2J52A 4ZRIA 1RWSA 1VR9A 2LVQA 1LO5D 5J18A 1WJNA 1U4AA 2LGXA 3OWEB 2D2QA 3BK1A 2FIDA 3ETRA 2OEDA 5GMVA 3B2FA 1TY0A 3TEWA 3ZLZA 2JY6A 2BWES 4BBNF 2LGSA 1OQRA 2D3AA 4P7IA 1CQVA 3N1ZC 3W1YA 5LXIB 4XWWA 4RNAA 2JRHA 4RH6A 1E10A 4F8CB 1FXAA 1JWAD 2WYQA 4C4VB 1WYGA 1V86A 3AECB 4KIKA 1GG3A 1T0QC 4OVUA 4J6IA 3ZGZA 1WXSA 3NHEB 3QX1A 2M1MA 2C7MB 3NZSA 2K1FA 2M19A 1ZXHA 2W54A 2O6VA 1WI0A 1C4AA 3ZVVA 3O65B 1JALA 2M56B 3AE8B 5LXHA 1E8WA 2WXHA 3DVNU 1GC6A 4MACA 4IWPA 1L7YA 1ZUD2 4BVUC 5JH5C 1EU3A 2BQQA 2PVOD 4WWPA 4W9HA 3HVZA 1KFYB 1J7AA 2O6VB 5D3IB 3E56A 1R4MI 2WXMA 3AU4A 3QJZA 1WM3A 2SAKA 4IM2A 4ZYNA 3IAS1 3W9CB 1JRPA 2JZ3B 4DXFA 3X23A 2AQ3B 2WXFA 3MTNB 3EUB2 4GLSC 3RNBC 3IHPC 4II3B 5C1ZA 3T3OA 3HHMA 2DHZA 2EELA 1LXDA 4NNJB 1WZ0A 2WGSA 4ASWC 1PYWD 1TJEA 3VRAB 3NY5A 2OHFA 2KDBA 2MSED 2WQYB 1HEZE 1H8CA 3L17A 1C9FA 2BYVE 2INDC 2MHJA 2QHOA 2KOXA 2BS3B 4YTMB 1WMHA 3VVWB 1E0ZA 4AUQC 3A9JA 3GZNI 2BKRB 3Q14C 3RNFC 2JWZA 1TS2A 4ANVA 2R61A 4YWGG 3AM9A 3RNCC 1F1HA 1VZ8A 1ROEA 5IKCM 1YD8U 5CHVC 1R4NB 4HVBA 2J7QB 2C7NB 1HA5A 4EZJA 2MWSB 1LQBA 4FN2A 1FFVA 3TJPA 1YOVB 3V6EB 4A55A 3ZUNA 4ANXA 2O2VB 4ARCA 1UZXB 3R66C 2B76B 3BVMA 2K8CA 3DBLB 3EA6A 1QKZA 3VHTC 4JWUC 3TEXA 4B6WA 3VXWA 2GBRA 2GI9A 3A4RA 3V62A 3A9KB 1WX9A 1UD7A 3A4SC 2LXAA 4N58A 1I4XA 5AUKA 3L4PA 3BK2A 2WNMA 3B0AA 4YSXB 2JYEA 4PYUA 2KACA 1KTKA 1V9JA 2REXA 2CHWA 2FAZA 2GBKA 3ECIA 3AEEB 1WM2A 4NAWA 2V3PA 3RZWC 2LVPA 2N7JA 1OEYA 3V60A 3U7DA 2IZVB 1BT0A 3VRBB 2ACZB 4DDID 1VDVA 1JQ4A 3ZRCA 2FNJB 3VUYA 1RFAA 4TMAB 2D3GA 3Q8BA 2GOWA 1TS5A 3Q3FA 3QQ8B 1F77A 2W3SA 2JVCA 2ON8A 4W9EA 3H7SA 4GGQA 1UWXA 3FILA 4OZAA 5IO9A 1QT9A 3UQAA 1WYWB 2IGGA 3I63C 3W2DA 1D5XC 4GDLA 3Q8FA 1IUEA 1F2RI 2OOBB 2WU2B 4US9A 4HPPA 1TKGA 1XF5L 2PVGC 1YIWA 1D3ZA 5D94A 2DENB 2J0KA 4BKTA 1HZ6A 5H8YE 4XC2A 4DHJD 4DQOC 3ZNGC 3UI3A 5G2NA 3NVVA 3JSVB 2CS4A 4CQNA 2KD0A 2HDEA 1FNWA 4IKGA 3AE5B 4RF1A 4B0EA 2K8BA 3A33B 1Z5SB 2ASQA 1L5PA 4KV2A 1S3SG 2DWQA 2M8SA 3RULA 3OLMD 2XK5A 5HHDG 3M63B 5FKAC 2LJIA 5AZGA 4N59A 4AJYB 1PFDA 5IA7A 3MFGA 3SR6A 1RYJA 2J4XA 4TUUA 2KDFB 4KDLB 2PPHA 1SJHD 2D10A 2VZKD 1M4VA 3ZDTA 4F7ZA 3CWIA 2IO1B 1FRDA 2L05A 2RD0A 3IBEA 2JQRB 3ALBA 3PPAA 1ESFA 1GNUA 3HM3A 2KKCA 2KJHB 1VZ7A 2WXKA 1KRHA 3L54A 1WR6E 1PDXA 3M95A 1ZGUB 3KYDD 5LLIA 1T0SC 1ZP0B 2DZMA 4XZ4A 2GRIA 4BKSA 2IO3B 1V6EA 3NVYA 4S17A 4E3CA 2KX3A 1SE4A 4MH8A 3R2TA 3IT6B 1GUAB 1FD6A 3ML8A 2WXNA 1WY8A 1HZ5A 1SE9A 4RM8A 5GXGB 2UU7A 3ZNID 2ZW1A 4REZA 2DYOA 4USAA 4N6EB 5TSSA 1FXTB 4P6VF 2YEPF 3T3NA 1F2RC 4HDOA 2RR9A 4IM0A 1MHXA 3DBHB 4FXCA 4YT0B 2MBQA 3AV8A 4W9LA 4IWQA 5C23A 2JRIB 2ZCBA 3TBLD 3MHZA 1FPYA 2KDMA 2PMVA 2GBNA 4HDQA 1DOYA 3BYTB 2LMCA 4RGOS 2AYOB 4P1CC 5J2RA 2LHDA 3ZNZB 2V3SA 5IAAC 1F52A 1ZDXA 1GPXA 4K7UA 1L6VA 4E74A 4H2AA 2FCMA 2LGYA 1X1MA 3Q2AC 1E90A 1L2NA 2NBWB 4AOFA 2JWUA 4GMVA 1WJ6A 1I42A 1OQYA 1XD3B 2W9NA 3AE1B 2KX0A 3H9DA 1SE3A 2L32A 4M8NA 2SEBD 2QMTA 4TQ0A 3RNEC 5LNK1 4KKIA 1HTQA 2KWUB 4JX1C 3WAOA 3TUOA 3PRZA 1J19A 3ZJUA 1EF1A 4WQOB 4BBNC 2JXTA 4ANWA 2FE8A 1JMLA 1NENB 4YSZB 3NOBA 1ENFA 1YN5A 5DPTA 2DAFA 4PS8A 4MELA 2L0FA 5EDSA 3BWUD 2IDYA 2KDEB 3IFWB 4GSWA 2IBIB 1VRAB 1V80A 4D2KA 2BYEA 3Q8CA 4HK2A 3NS1A 4FADA 3PV1A 1E7VA 1WGKA 4C4VA 1YJIA 2JF5A 3N1XC 4A3OA 2WXQA 3UGBB 1KJTA 2N0SB 1J0GA 4A8XC 4G3XB 1ISNA 1J7CA 2L8JA 3NS8A 1YMHE 2J0MA 2J0JA 1OQQA 5AZHA 1V1PA 3ZO5B 1FCCC 2HJ8A 3U7ZA 1TZOA 2I1JA 2L7RA 2BYFA 4G0NB 1RRBA 4OVZA 4ACFA 1OEYJ 2M4NA 1OGWA 3DBRI 2GLSA 1QILA 4WAFA 1TY2A 1TBEA 4WH4A 3CIRB 4MSQB 2IPKD 2JSVX 2JX5A 4LTUA 1PGXA 4KSKC 3W5VB 2KTFA 1WH3A 2KHWB 4GDKA 4MH0E 1EO6A 3S2AA 1XCQL 2PE6B 4GOCA 3OJ3A 2WU5B 3CSTA 3Q3JA 3VH3B 3VQIA 4JL9A 4FJYA 1C4PA 4MM3A 4S0RA 4M02A 4DWFA 4DBGA 4WQMA 4HLEA 4A90A 4NJ7A 2BS2B 3QA8A 1DYQA 2DZJA 4L23A 3RUIB 2QIEB 1WR1A 1WSPA 2HJ1A 4YTPB 2BB5A 2LGIA 1Y56A 2KAJA 3RNGC 3JYUA 4MT5A 3TMPB 1TTNA 2DYMA 1V5OA 3P4RB 2GBMA 2G4DB 4ZHPA 1VLBA 5JZEB 5FR3A 1E7PB 1EWYC 2QCZA 2BPSA 1ET6A 4LJPB 2L76A 2DX5B 2WLBA 3KUCB 3PZDA 4A3PA 1JWBD 3DPDA 2G4SA 4MDKE 2KMMA 4WAAA 1XCTL 1J8CA 3C8YA 3A1QA 4FULA 2WDQB 2WXIA 3Q8EA 3NVZA 3GP7A 2XEWA 3HIZA 3KUDB 5BYRA 4RGMA 1DOIA 4WJNA 2IY0B 2Y3AA 3TEYA 3PLUA 4EKUA 4HPMB 1WX8A 3TEZA 2D11A 2JYTA 3WALA 1A5RA 1GJZA 3QC8B 2QEJC 3QARA 4XYCA 4GDKB 2GBJA 1Q10A 3NJTA 4JGHB 2N7EA 3I3TB 1XLOA 3MC0B 3L13A 2MEKA 4ICUA 2DLBA 1PGAA 2J53A 1FRRA 3APDA 3EHVA 4FHKA 3KLSX 1L4ZB 1V1OA 1I4GA 5EE3A 3CSFA 3NVWA 2KQSA 3GS2A 1R4NI 1FCLA 1P98A 4IOIE 3WAPA 2FUHB 1N5WA 4P1BC 3UQBA 4AS1A 1WXVA 1C78A 4URKA 1IP9A 3DHGC 1NEKB 3MJ5A 4US8A 2EKEC 4YSYB 1FM0D 1TKEA 2RPQA 4K7WA 4IWOA 1TT5B 3SEBA 1RAXA 3EC8A 1WJ4A 2CJOA 2DZKA 4E71A 3KW5B 3PGEA 3JVZX 2E3TA 2LFIA 2LUMA 3ZJVA 5G55A 3ZXRA 2VZKB 5E6NA 3M62B 5D7GA 3RNAC 3V61A 4A6QA 4KSLC 2KQ4X 3NUHB 1N63A 4W9FA 3J9CA 3Q8AA 1D6EC 4G11A 1PQSA 3OJ4B 1TZ1A 3D32A 4QAYA 1UH6A 4ZRKA 1ET9A 2TSSA 4RM9A 4F1SA 3AEAB 5CX3A 2QJLA 2LRWA 1AN8A 4KGRA 3ONSA 2N9PC 4DHJB 2D07B 2KJ6A 1S1QB 2ZPYA 4JQWC 5JHAA 1TKYA 3IVFA 3AN1A 3VDZA 4LNFA 3Q6BA 2X8XX 2QC8A 1WXAA 3MHSD 3ZRFA 3IAM1 5EE9A 1SGHA 4PK1A 3FC4A 4IDIA 3V05A 3L0WB 2V9HA 1I4RA 3SDLC 1ZKHA 1XLQA 3AE6B 2MCNB 4K7SA 2RMMA 3BZDB 4W9CA 5G5GA 1QQRA 2BT6A 3UF8A 4MGYE 2EKIA 1I35A 3I9V1 2ZNVB 2XBBC 1XO3A 4ZHOA 4HKZE 3IT4B 4BAXA 3H7PB 2LEKA 1FEHA 1UNSA 3QHTA 2KLGA 1GAQB 1SSNA 1IPGA 2PE9A 3PSEB 4B0MA 1MG8A 2MW5A 3ZTDA 2LHEA 1UBQA 4ZRJA 2MBHA 5KHOA 1KOTA 2C60A 4FHJA 1IGDA 1V5TA 2ICIA 3N20C 2Y5PA 4CHKA 4XX5A 2NMQA 2KFKB 2R2OA 1JROA 4JE3B 1I4HA 4LK0M 4XWTA 1NBFC 1QOFA 2I38A 3U2SC 2WXJA 3Q3NC 4HPLB 1I7HA 2KTRA 3EECA 3BYYB 4LDTB 1K53A 3BY4B 2J42A 4C7YA 3ZW3A 1TYGB 2WXRA 1YQ4B 2KANA 3VTVA 1E5WA 2KDIA 2LRUA 1UF0A 5CHFA 2LD9A 1SB3C 1FNUA 2V3NA 3R3MA 2NPTA 2LVOA 1WX7A 5BMHA 3EGRA 3NZ3A 4KX6B 1XXGA 2DAJA 4WWNA 1K51A 1KF6B 4HEA1 2CU1A 3ZQ4A 2NR2A 2MJ3A 1WFYA 4IUMB 1FFUA 2WXLA 4C7ZA 1QOAA 1Q1OA 3QCAA 4OVVA 1ZE3D 3N3KB 1LGRA 2DYBA 1Y8RC 3DBLI 4AWJA 2MP2A 5HG2A 3R8BA 3APCA 2KVZA 1FXIA 4I6NB 3AEDB 2ZW0A 3PLVA 2RSUA 2B3AA 2W82A 2MBOA 2PEAA 5AEKB 4RF0A 2N9LA 5KHQA 2JPHA 3ZJTA 3KUZA 4EE2A 1J7BA 2KN4A 2L00B 1L6UA 4HRSA 1DOXA 1WRIA 4AQ7A 2MQJA 4LNKA 2AQ2B 4DHZB 3BVGA 3GZNB 4WJPA 2NCNA 2INCC 4HJGE 3RI7C 3FKYA 1SIFA 1MPEA 1D4BA 1XEEA 4NY0A 3ZTCA 1YX6B 3U30A 5BMGA 1T0RC 1QOBA 4FJVB 4KZCA 4BOSC 5AUIA 3PHWB 2G9HD 4UDUC 1JRUA 1G6JA 4ZOHC 3HVDA 2BKFA 2JZZA 1EM7A 1YJ1A 3QWZB 2OJWA 2FIFA 4PYZA 4KKJA 3WIMA 2WDTB 2KC1A 1WE7A 4II2B 3AI5A 3PZ8A 1RLFA 4ZDVA 1UELA 1WRDB 1XQQA 3SU8X 4I6LB 3A1QB 5AZFA 2DBYA 1WXQA 4PS7A 1NYQA 2VH1A 2QILA 4RFBA 3DQVA 1R4MB 3GB1A 3P4SB 2Q5WD 2MA9B 4BKSD 2ZPNA 1EWCA 4WJOA 4FLHA 1E8YA 2IJ0A 2ONQA 1C76A 5JHBA 2GMIC 3KWLA 3N1YC 1JWSD 2L1AA 3P42A 2JUOA 4X57B 2MJEA 4RGTA 4LDTD 1L4DB 4KGSA 2KWCA 2L0TA 3VFKA 1F0ZA 2KFKA 1WWTA 2RDHA 4W9IA 3P4PB 1YN3A 4EZLA 4ZRPA 2QSDA 3LXFA 2LI5A 3CMMB 1V97A 5IN7A 1KM7A 4IC7B 4Q2JA 3KYCD 2JXXA 1YQBA 4A9AA 4PS3A 2HD5B 3E9SA 3GE8C 3P2BA 1R7SA 2BF8B 1F9JA 2ZVNA 4TQ1A 1WGRA 1V49A 2L83A 4C56C 4KZ0A 2LWPA 3M3JA 1M94A 2PLPA 3U8ZA 2KQ7A 2AL3A 2C7HA 1I4QA 2V4LA 1CMXB 3QK0A 2LUEA 4MJSB 2ZVOA 2WXOA 3WAMA 1PUTA 2NBUA 2MJDA 4HWIB 2VRRB 3OAWA 5BYQA 1D5ZC 4HROA 2NTSA 3SFEB 4CO7A 3U4EG 3PHXB 2WHIA 1MG4A 1EU4A 1B9RA 3TIXA 1ACCA 3MJWA 2RPVA 4JLCA 4ZYSA 3GE3C 2PIAA 4C80A 1V1PB 4TSSA 3UINB 3RD2A 2NTTA 4MGZE 3HM6X 4A20A 1MVKA 3I5JC 4GIVA 1EF5A 4NJ6A 2IGHA 1IBXA 2I1KA 3V6CB 4AJWA 3RZFA 1UWMA 2WDRB 1YJJA 4KIKB 4NJCA 2ZNVC 4TKNA 2UYZB 3AE7B 3I57A 1JCKB 1BXTA 2WP9B 2IY1B 2PKOA 3DHHC 3AH7A 4MGKE 3IG3A 1WXMA 2XK5B 2NVUI 3N32A 1HQRD 3N30A 2QDFA 2KWVB 2WWZA 3V3XA 2AL6A 3JSVA 5IOIA 3B2GA 2UWQA 4IM3A 2ZEQA 3H6NA 1SXTA 3BVZA 2EMTA 1MI0A 2MH7A 3AU5A 1ZXIA 5BYSA 2ZJDA 3AEFB 3K9PB 1E6EB 3MC8A 2Z59B 4MJSA 1N61A 2BTEA 4GN1A 3QIJA 1FMAD 4OZBA 3DHIC 4K81A 3FILB 4YTNB 3NG0A 4WIPA 2H89B 1D5MC 4YL8A 2A4ZA 4GXBA 3K9OB 2K6DB 1C79A 3KH0A 1TGZB 1L0XB 2Z8LA 3AE2B 1TIFA 4W9DA 1WE6A 1SJED 1I4PA 4XGAB 2CU3A 5D6JB 3ZYYX 1CJEA 3P63A 2CHZA 5DPSA 1KLGD 1P3QU 2LGDA 4ARIA 2RGFA 2WX1A 4NQLB 5C3JB 1CZPA 2BB6A 1NVID 1JWUD 4DDGD 2BVCA 4XDDA 1WIAA 3EFCA 1FNVA 1RM6C 3KWVA 1GC7A 2IGDA 3PTFC 2H88B 3VUXA 2K5PA 3SFDB 3C19A 2K0PA 4ZRQA 1XT9B 2KYWA 4BZAA 1T5XD 5L83A 2XNAC 2V0GA 2ZZPB 4MEMA 3T9LA 2N1VA 2XN9C 3OG5A 1T3QA 1MHHE 4GU2A 4MM3B 2IO0B 2BW2A 4WURA 3AMZA 2WS3B 2A5UA 1A70A 3HK0A 3LYYA 4KVGB 3LDZE 1T6BX 3H7PA 2JU6X 3R7RA 3DVGY 3RMKC 5J17A 1QLBB 1MJDA 3T8MA 1TS3A 3FAHA 2N9XA 1IGCA 2L3ZA 4EOYA 3RT3B 1FO4A 3DDCB 1NI3A 1JW9D 1WMHB 5CHWA 2BS4B 2Y5BB 5DPWA 3L16A 3WA0A 3Q3OC 2N9EB 2IO2B 3AULA 4NAMA 4JPSA 2KWDA 5D2MB 3TCAA 1E7UA 1AYFA 2CJNA 1KLUD 2KT7A 1AWDA 4L1BA 1H4RA 2HE7A 2PTLA 2K22A 1WGDA 2WXPA 1ZDVA 1VCBA 3B1LX 2I2YA 4EEWA 3AXCA 1MFWA 2MLBA 2PW9A 4KGTA 3ENEA 1P7EA 1P9DU 2MP2B 2ZCCA 3DCGA 4K1RB 4NQKE 4GDLB 4WWOA 4EZKA 3VTUA 4XE0A 2E6XA 3L10B 4GB9A 3B9JA 4M00A 1WF9A 2R2QA 4G50A 2KVRA 1HE8A 1OFFA 4JIOU 2DNFA 4DHZE 4K3BA 4N9F4 4LNIA 1OTRB 2HTHA 2N7DA 2NPTB 1WGYA 2Z0DB 3DBRB 2K39A 3C0RB 3LB8C 2N1WA 5BMIA 1YN4A 1VJKA 4NPNA 3VR8B 3ZXVA 4BKGA 1JWMD 3DBHI 4M8MA 1WGGA 1SIJA 3O13A 1KH0A 4CYEA 1YNTE 3BIID 3PT2B 4M0WB 4RCOA 1IBXB 3PREA 4OW0A 2V1YA 3N9YC 3AEBB 2N4FA 2KTRB 2KN5A 4EFOA 1L0YB 3RFZB 5HI1A 1WGHA 2FCNA 2N9KA 5E6PA 1UGMA 1VD2A 2G3QB 1GB4A 4W9GA 1V8CA 2LXCA 5G5HA 2YVCA 3LJ3A 3ML9A 1WZ3A 2KMAA 4FJZA 1DGJA 3VAWA 4KDIC 3R2IA 2NBVB 2GB1A 1LM8B 2CKHB 2K8HA 4MSMB 5FK9C 1Q0WB 2FCQA 2L52A 1YX5B 2AQ1B 1QOGA 3DVNV 3RCZA 2WX0A 4MGIE 3PZ7A 1QF6A 1HTOA 2CHXA 4DXGA 2IYDB 5BO4B 1P7FA 4BFRA 4R3DA 1K8RB 4B95A 1WJUA 5HKHA 3DWMA 2K25A 1C3TA 2M0XA 4AP4C 2HTME 3R7QA 1K52A 3ZNHB 3MC9A 1C1YB 3WCQA 3URYA 3A9JB 2INPE 4HJKA 4ITKA 1GOZA 1XLNA 2X38A 3SD5A 2G45B 3UIOB 4L2YA 3QAQA 3DVGX 2AEHA 2AWTA 1PGBA 4OHJA 4XDCA 3AB5A 4YXDB 2D3BA 1P0RA 1N5XA 1LFDA 4TV3A 3W5UB 3MP9A 2LASA 2D5GA 2YLMA 1B1ZA 2WXGA 3VTWA 2Y5CA 1QZEA 3ZDMC 2KMCA 2AX5A 2KK8A 4M0WA 5EE0A 5DCNA 4I6PA 1N62A 3PVLA 3SHQA 3ZIMA 1TS4A 3ABVB 2KXJA 4DK5A 2V4IB 5H92C 4EUTA 2K9XA 3JW0X 1SBBB 2FUG1 2KC2A 2Z0EB 2BBCA 3ZKJC 1BUIC 3W1SA 4M01A 2BWFA 1P1AA 3P4QB 1UGJA 4RGNA 2BYTA 1E8XA 1V2YA 5D3DA 3NZUA 2G1EA 4JWSC 3EFUA 5C2TB 2C5LC 3UIPB 1N6ZA 1YQ3B 2OJRA 1NI2A 3RPFC 2LZ6A 3PO0A 5E6OA 3GOEA 4P16A 3KQ4A 2W55A 5L95C 3RYTA 2LJ5A 2KO3A 3DOWA 4IW0A 3PS6A 2FCSA 3HRDD 2W3RA 2NS5A 3H1UA 2YEPB 3B08A 2DZIA 1K50A 2KJRA 4FA6A 2KLCA 2KNBA 2MBBB 3L08A 4NZLB 3KVFB 1IYFA 5IP4D 4W9KA 1VZ6A 4HXDA 1XLPA 5HFYA 3VH4B 2FBWB 1HXYD 3CF6E 4W9JA 3X0WA 4J3OD 3VR9B 2MRPA 5JXVA 3DBSA 2INNE 2RDGA 3W1SC 1T0YA 2MBEA 1STEA 4ICVA 3TSSA 3DWGC 4WJQA 1N60A 3NRZA 1BMLC 2D3CA 3A9KA 4PT5A 2M17A 3IXSA 5TR5A 3BINA 4BOZB 4HKQA 1ZPSA 4B9KA 4LCDE 3PRPB
chains in the Genus database with same CATH topology
1V6EA 3SDLC 1ZKHA 4E3CA 2KX3A 5D6JB 5CTRC 2MCNB 2O2VA 2CHZA 4K7SA 1GUAB 3ML8A 5DPSA 1P3QU 2LGDA 4W9CA 1WY8A 2RGFA 3UF8A 4FBJB 2WX1A 4HCNB 4MGYE 1SE9A 4NAWB 1I35A 4NQLB 4RM8A 2ZNVB 2XBBC 3ZNID 4ANUA 1Z2MA 2KZRA 1NDDA 4DDGD 2DYOA 3H7PB 2C9WB 2JT4B 1FXTB 1WIAA 3QHTA 2KLGA 1IPGA 2PE9A 4HDOA 2RR9A 1GC7A 1UBIA 4LJOB 2KFJA 3PSEB 3PTFC 4IM0A 2EMSA 3VUXA 2CR5A 1MG8A 2MW5A 2PJHA 5DPRA 3ZTDA 1UBQA 3TL5A 4ZRJA 1E8ZA 2MBHA 5KHOA 1KOTA 2C60A 4FHJA 1EUVB 1XT9B 2MBQA 3VUWA 1V5TA 4RMAA 4W9LA 4HCPB 1AARA 3WANA 4IWQA 5L83A 5C23A 2JRIB 2ZCBA 3TBLD 2ZZPB 4CHKA 4MEMA 4XX5A 5FR6A 3T9LA 1KLVA 2N1VA 2KFKB 2GBNA 2R2OA 4HDQA 3PRMB 4GU2A 2IO0B 2AYOB 1NBFC 1V81A 5J2RA 4HPLB 3ZNZB 2A5UA 2V3SA 5IAAC 2BGFA 3HK0A 2KTRA 3APFA 3LDZE 4KVGB 3EECA 3H7PA 3R7RA 2MX2A 2K6QA 3DVGY 4LDTB 4K7UA 4E74A 1Q5WB 2LGYA 2FCMA 1X1MA 3BY4B 4IG7B 2O6VD 5J17A 4DXAB 1E90A 1ZW7A 3T8MA 1L2NA 3ZW3A 2N9XA 2NBWB 2KANA 4ZRIA 4AOFA 2L3ZA 4GMVA 4EOYA 1WJ6A 1I42A 2LVQA 3RT3B 3VTVA 1OQYA 1XD3B 1E5WA 3DDCB 5J18A 1WMHB 2W9NA 5CHWA 2KX0A 1WJNA 1U4AA 2Y5BB 3H9DA 2KDIA 2LGXA 2LRUA 3L16A 4M8NA 2LD9A 5CHFA 3WA0A 5DPWA 3R3MA 2D2QA 2NPTA 2LVOA 1WX7A 2FIDA 2IO2B 2N9EB 4TQ0A 3AULA 5GMVA 2DAJA 2KWUB 5D2MB 3TCAA 1E7UA 4WWNA 3WAOA 3ZLZA 3PRZA 1J19A 2JY6A 2BWES 1EF1A 2CU1A 4BBNF 2NR2A 4WQOB 4P7IA 4BBNC 3W1YA 1H4RA 4ANWA 1WFYA 2HE7A 4IUMB 5LXIB 1WGDA 2JRHA 4F8CB 3NOBA 5DPTA 1Q1OA 1VCBA 2DAFA 3B1LX 2WYQA 3QCAA 4OVVA 3N3KB 1V86A 4PS8A 4EEWA 4MELA 2DYBA 1GG3A 1Y8RC 2L0FA 3AXCA 3DBLI 4KIKA 2MP2A 4OVUA 2KDEB 3IFWB 4J6IA 4AWJA 1WXSA 3APCA 3NHEB 4GSWA 3QX1A 2MLBA 2IBIB 1V80A 3ENEA 2BYEA 4I6NB 2M1MA 4HK2A 2C7MB 1P9DU 3NZSA 2MP2B 2ZCCA 3DCGA 2K1FA 3PLVA 4K1RB 4NQKE 4FADA 4GDLB 4WWOA 3PV1A 1E7VA 4EZKA 2RSUA 3VTUA 2JF5A 4A3OA 3L10B 4GB9A 2O6VA 2B3AA 3UGBB 1KJTA 1WI0A 3ZVVA 1J0GA 1WF9A 2MBOA 3O65B 2PEAA 5AEKB 2R2QA 4G50A 4G3XB 1ISNA 5KHQA 2L8JA 2JPHA 3NS8A 3KUZA 2J0MA 2KVRA 2J0JA 1HE8A 5AZHA 3ZO5B 4JIOU 2L00B 5LXHA 4DHZE 2HJ8A 1E8WA 3DVNU 2I1JA 4N9F4 2L7RA 2BYFA 2MQJA 1GC6A 4G0NB 4IWPA 1RRBA 5EDSA 1L7YA 1OTRB 4BVUC 2HTHA 4DHZB 5JH5C 2N7DA 1OEYJ 2NPTB 1WGYA 4WWPA 2Z0DB 4W9HA 4WJPA 2NCNA 2M4NA 2K39A 3C0RB 1OGWA 2N1WA 2O6VB 1SIFA 3DBRI 4NPNA 1R4MI 4NY0A 4BKGA 3DBHI 1TBEA 3AU4A 3QJZA 4M8MA 1WM3A 3ZTCA 4IM2A 1WGGA 4ZYNA 4MSQB 2JZ3B 1YX6B 3U30A 3X23A 4CYEA 3PT2B 3MTNB 4M0WB 4FJVB 4KZCA 4BOSC 4KSKC 3PREA 3PHWB 2KTFA 3IHPC 1JRUA 1WH3A 2V1YA 1G6JA 4II3B 2N4FA 2BKFA 2JZZA 2KHWB 4GDKA 4MH0E 5C1ZA 1EO6A 3S2AA 3HHMA 2PE6B 1YJ1A 2KN5A 2DHZA 2KTRB 3OJ3A 3QWZB 4GOCA 4EFOA 3CSTA 3Q3JA 1LXDA 3VH3B 4NNJB 1WZ0A 3VQIA 4ASWC 1WGHA 2FIFA 4JL9A 2FCNA 4FJYA 4PYZA 5E6PA 1UGMA 4MM3A 3WIMA 4DWFA 1VD2A 2G3QB 4DBGA 3NY5A 4W9GA 4HLEA 2KDBA 2MSED 2LXCA 2WDTB 2KC1A 2YVCA 3LJ3A 4NJ7A 3ML9A 1H8CA 1WZ3A 2KMAA 3L17A 3PRPB 4FJZA 1WE7A 3QA8A 3AI5A 4II2B 4KDIC 2DZJA 3RUIB 3VAWA 1RLFA 2BYVE 2NBVB 4ZDVA 1LM8B 1WR1A 2CKHB 2K8HA 1UELA 4MSMB 1WRDB 1XQQA 3SU8X 1Q0WB 2QHOA 2FCQA 4I6LB 2KOXA 1YX5B 3JYUA 3TMPB 1WMHA 3RCZA 3DVNV 3VVWB 2WX0A 3A1QB 5AZFA 4AUQC 3A9JA 3GZNI 1TTNA 2DYMA 1V5OA 2BKRB 4MGIE 2GBMA 2G4DB 4PS7A 2JWZA 2CHXA 5JZEB 3DQVA 2IYDB 5BO4B 4BFRA 1K8RB 2MA9B 4ANVA 4B95A 1WJUA 4BKSD 5HKHA 2BPSA 2ZPNA 4WJOA 4FLHA 1E8YA 4LJPB 2L76A 2DX5B 5JHBA 2GMIC 2K25A 1C3TA 2M0XA 3KUCB 1YD8U 5CHVC 4X57B 2JUOA 4HVBA 4AP4C 3R7QA 2J7QB 2C7NB 4EZJA 3PZDA 3ZNHB 4A3PA 3DPDA 2G4SA 2MWSB 1LQBA 4MDKE 4FN2A 4LDTD 3TJPA 1C1YB 2KWCA 2L0TA 4WAAA 3V6EB 3VFKA 3ZUNA 2KFKA 3A9JB 1J8CA 3A1QA 4FULA 4HJKA 4W9IA 4ANXA 2O2VB 3SD5A 1UZXB 2G45B 3R66C 3UIOB 4EZLA 2K8CA 2XEWA 3QAQA 3DVGX 3VHTC 2LI5A 3CMMB 4B6WA 2AEHA 3HIZA 2GBRA 1KM7A 3KUDB 4IC7B 3VXWA 3A4RA 3KYCD 2JXXA 2AWTA 4WJNA 1YQBA 2IY0B 3V62A 3A9KB 4PS3A 1WX9A 2HD5B 3PLUA 1UD7A 3A4SC 4EKUA 2LXAA 3P2BA 4HPMB 1P0RA 2BF8B 1WX8A 1F9JA 1LFDA 2D11A 4TV3A 2ZVNA 4TQ1A 1WGRA 1V49A 2LASA 4KZ0A 3WALA 2YLMA 3B0AA 2LWPA 3M3JA 1A5RA 1GJZA 1M94A 3U8ZA 2KQ7A 3QC8B 2AL3A 3QARA 4GDKB 4PYUA 2C7HA 2GBJA 2V4LA 1CMXB 3VTWA 1QZEA 3ZDMC 2KMCA 1V9JA 2LUEA 3QK0A 4JGHB 2N7EA 3I3TB 2ZVOA 4MJSB 2REXA 2CHWA 2KK8A 2FAZA 2GBKA 3ECIA 3L13A 3WAMA 1WM2A 4NAWA 2NBUA 5DCNA 3RZWC 2LVPA 4ICUA 1OEYA 4HWIB 3V60A 2VRRB 3U7DA 4I6PA 2IZVB 3OAWA 3APDA 1BT0A 3PVLA 3SHQA 3ZIMA 4DK5A 2KXJA 4DDID 3EHVA 4FHKA 3ZRCA 2FNJB 4EUTA 3VUYA 1RFAA 4CO7A 3PHXB 3JW0X 2D3GA 2GOWA 3Q3FA 3TIXA 3CSFA 3QQ8B 2JVCA 3MJWA 4JLCA 2KQSA 2KC2A 2Z0EB 3ZKJC 4W9EA 1R4NI 3W1SA 3H7SA 3UINB 2BWFA 1P98A 4GGQA 3RD2A 1P1AA 3WAPA 2FUHB 4MGZE 3HM6X 4A20A 3UQBA 1E8XA 1V2YA 1WXVA 4URKA 1IP9A 3NZUA 4GIVA 3EFUA 3UQAA 1WYWB 1EF5A 2C5LC 3UIPB 4NJ6A 4GDLA 2EKEC 2I1KA 2OJRA 1NI2A 3V6CB 2LZ6A 2OOBB 4AJWA 5E6OA 3GOEA 2RPQA 3RZFA 4K7WA 4IWOA 1YIWA 1D3ZA 1RAXA 5D94A 2DENB 3EC8A 5L95C 2J0KA 4KIKB 3RYTA 4BKTA 2ZNVC 4XC2A 4TKNA 2UYZB 2LJ5A 2KO3A 3DOWA 1WJ4A 2DZKA 4IW0A 3PS6A 4E71A 3KW5B 4DHJD 3ZNGC 2FCSA 5G2NA 2IY1B 3JVZX 2NS5A 3PGEA 3H1UA 2CS4A 3JSVB 2KD0A 5G55A 3B08A 4MGKE 2DZIA 3IG3A 1WXMA 5E6NA 2KJRA 2XK5B 2KLCA 4FA6A 2NVUI 3M62B 2K8BA 3A33B 5D7GA 1Z5SB 2ASQA 2KNBA 2MBBB 3L08A 4KV2A 1S3SG 3V61A 3RULA 2M8SA 3N32A 3OLMD 2XK5A 3KVFB 3M63B 4KSLC 3N30A 2KWVB 5AZGA 2WWZA 1IYFA 2AL6A 4AJYB 3JSVA 4W9KA 5IA7A 2UWQA 4IM3A 2ZEQA 4HXDA 3H6NA 4W9FA 3VH4B 4TUUA 2KDFB 4KDLB 4G11A 2PPHA 1PQSA 3OJ4B 1TZ1A 3D32A 2D10A 2EMTA 1UH6A 4ZRKA 3AU5A 3CF6E 4W9JA 4RM9A 3X0WA 4F1SA 5CX3A 2ZJDA 3K9PB 2LRWA 2MRPA 3ZDTA 2Z59B 3ONSA 4MJSA 4F7ZA 2N9PC 3DBSA 4DHJB 2D07B 2IO1B 2KJ6A 1S1QB 2L05A 2RD0A 2ZPYA 3IBEA 3ALBA 4GN1A 4JQWC 3PPAA 5JHAA 3QIJA 1GNUA 3HM3A 3IVFA 3W1SC 2KKCA 2KJHB 4K81A 1T0YA 2MBEA 3VDZA 4ICVA 3L54A 1WR6E 4WJQA 3M95A 1ZGUB 3KYDD 4YL8A 1WXAA 3MHSD 3ZRFA 2A4ZA 5LLIA 3A9KA 4GXBA 1SGHA 3K9OB 2K6DB 3KH0A 1TGZB 2M17A 5TR5A 2DZMA 3BINA 4BOZB 4XZ4A 4W9DA 4B9KA 4LCDE 3L0WB 4BKSA 1WE6A 2IO3B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V6E A;  3SDL C;  1ZKH A;  4E3C A;  2KX3 A;  5D6J B;  5CTR C;  2MCN B;  2O2V A;  2CHZ A;  4K7S A;  1GUA B;  3ML8 A;  5DPS A;  1P3Q U;  2LGD A;  4W9C A;  1WY8 A;  2RGF A;  3UF8 A;  4FBJ B;  2WX1 A;  4HCN B;  4MGY E;  1SE9 A;  4NAW B;  1I35 A;  4NQL B;  4RM8 A;  2ZNV B;  2XBB C;  3ZNI D;  4ANU A;  1Z2M A;  2KZR A;  1NDD A;  4DDG D;  2DYO A;  3H7P B;  2C9W B;  2JT4 B;  1FXT B;  1WIA A;  3QHT A;  2KLG A;  1IPG A;  2PE9 A;  4HDO A;  2RR9 A;  1GC7 A;  1UBI A;  4LJO B;  2KFJ A;  3PSE B;  3PTF C;  4IM0 A;  2EMS A;  3VUX A;  2CR5 A;  1MG8 A;  2MW5 A;  2PJH A;  5DPR A;  3ZTD A;  1UBQ A;  3TL5 A;  4ZRJ A;  1E8Z A;  2MBH A;  5KHO A;  1KOT A;  2C60 A;  4FHJ A;  1EUV B;  1XT9 B;  2MBQ A;  3VUW A;  1V5T A;  4RMA A;  4W9L A;  4HCP B;  1AAR A;  3WAN A;  4IWQ A;  5L83 A;  5C23 A;  2JRI B;  2ZCB A;  3TBL D;  2ZZP B;  4CHK A;  4MEM A;  4XX5 A;  5FR6 A;  3T9L A;  1KLV A;  2N1V A;  2KFK B;  2GBN A;  2R2O A;  4HDQ A;  3PRM B;  4GU2 A;  2IO0 B;  2AYO B;  1NBF C;  1V81 A;  5J2R A;  4HPL B;  3ZNZ B;  2A5U A;  2V3S A;  5IAA C;  2BGF A;  3HK0 A;  2KTR A;  3APF A;  3LDZ E;  4KVG B;  3EEC A;  3H7P A;  3R7R A;  2MX2 A;  2K6Q A;  3DVG Y;  4LDT B;  4K7U A;  4E74 A;  1Q5W B;  2LGY A;  2FCM A;  1X1M A;  3BY4 B;  4IG7 B;  2O6V D;  5J17 A;  4DXA B;  1E90 A;  1ZW7 A;  3T8M A;  1L2N A;  3ZW3 A;  2N9X A;  2NBW B;  2KAN A;  4ZRI A;  4AOF A;  2L3Z A;  4GMV A;  4EOY A;  1WJ6 A;  1I42 A;  2LVQ A;  3RT3 B;  3VTV A;  1OQY A;  1XD3 B;  1E5W A;  3DDC B;  5J18 A;  1WMH B;  2W9N A;  5CHW A;  2KX0 A;  1WJN A;  1U4A A;  2Y5B B;  3H9D A;  2KDI A;  2LGX A;  2LRU A;  3L16 A;  4M8N A;  2LD9 A;  5CHF A;  3WA0 A;  5DPW A;  3R3M A;  2D2Q A;  2NPT A;  2LVO A;  1WX7 A;  2FID A;  2IO2 B;  2N9E B;  4TQ0 A;  3AUL A;  5GMV A;  2DAJ A;  2KWU B;  5D2M B;  3TCA A;  1E7U A;  4WWN A;  3WAO A;  3ZLZ A;  3PRZ A;  1J19 A;  2JY6 A;  2BWE S;  1EF1 A;  2CU1 A;  4BBN F;  2NR2 A;  4WQO B;  4P7I A;  4BBN C;  3W1Y A;  1H4R A;  4ANW A;  1WFY A;  2HE7 A;  4IUM B;  5LXI B;  1WGD A;  2JRH A;  4F8C B;  3NOB A;  5DPT A;  1Q1O A;  1VCB A;  2DAF A;  3B1L X;  2WYQ A;  3QCA A;  4OVV A;  3N3K B;  1V86 A;  4PS8 A;  4EEW A;  4MEL A;  2DYB A;  1GG3 A;  1Y8R C;  2L0F A;  3AXC A;  3DBL I;  4KIK A;  2MP2 A;  4OVU A;  2KDE B;  3IFW B;  4J6I A;  4AWJ A;  1WXS A;  3APC A;  3NHE B;  4GSW A;  3QX1 A;  2MLB A;  2IBI B;  1V80 A;  3ENE A;  2BYE A;  4I6N B;  2M1M A;  4HK2 A;  2C7M B;  1P9D U;  3NZS A;  2MP2 B;  2ZCC A;  3DCG A;  2K1F A;  3PLV A;  4K1R B;  4NQK E;  4FAD A;  4GDL B;  4WWO A;  3PV1 A;  1E7V A;  4EZK A;  2RSU A;  3VTU A;  2JF5 A;  4A3O A;  3L10 B;  4GB9 A;  2O6V A;  2B3A A;  3UGB B;  1KJT A;  1WI0 A;  3ZVV A;  1J0G A;  1WF9 A;  2MBO A;  3O65 B;  2PEA A;  5AEK B;  2R2Q A;  4G50 A;  4G3X B;  1ISN A;  5KHQ A;  2L8J A;  2JPH A;  3NS8 A;  3KUZ A;  2J0M A;  2KVR A;  2J0J A;  1HE8 A;  5AZH A;  3ZO5 B;  4JIO U;  2L00 B;  5LXH A;  4DHZ E;  2HJ8 A;  1E8W A;  3DVN U;  2I1J A;  4N9F 4;  2L7R A;  2BYF A;  2MQJ A;  1GC6 A;  4G0N B;  4IWP A;  1RRB A;  5EDS A;  1L7Y A;  1OTR B;  4BVU C;  2HTH A;  4DHZ B;  5JH5 C;  2N7D A;  1OEY J;  2NPT B;  1WGY A;  4WWP A;  2Z0D B;  4W9H A;  4WJP A;  2NCN A;  2M4N A;  2K39 A;  3C0R B;  1OGW A;  2N1W A;  2O6V B;  1SIF A;  3DBR I;  4NPN A;  1R4M I;  4NY0 A;  4BKG A;  3DBH I;  1TBE A;  3AU4 A;  3QJZ A;  4M8M A;  1WM3 A;  3ZTC A;  4IM2 A;  1WGG A;  4ZYN A;  4MSQ B;  2JZ3 B;  1YX6 B;  3U30 A;  3X23 A;  4CYE A;  3PT2 B;  3MTN B;  4M0W B;  4FJV B;  4KZC A;  4BOS C;  4KSK C;  3PRE A;  3PHW B;  2KTF A;  3IHP C;  1JRU A;  1WH3 A;  2V1Y A;  1G6J A;  4II3 B;  2N4F A;  2BKF A;  2JZZ A;  2KHW B;  4GDK A;  4MH0 E;  5C1Z A;  1EO6 A;  3S2A A;  3HHM A;  2PE6 B;  1YJ1 A;  2KN5 A;  2DHZ A;  2KTR B;  3OJ3 A;  3QWZ B;  4GOC A;  4EFO A;  3CST A;  3Q3J A;  1LXD A;  3VH3 B;  4NNJ B;  1WZ0 A;  3VQI A;  4ASW C;  1WGH A;  2FIF A;  4JL9 A;  2FCN A;  4FJY A;  4PYZ A;  5E6P A;  1UGM A;  4MM3 A;  3WIM A;  4DWF A;  1VD2 A;  2G3Q B;  4DBG A;  3NY5 A;  4W9G A;  4HLE A;  2KDB A;  2MSE D;  2LXC A;  2WDT B;  2KC1 A;  2YVC A;  3LJ3 A;  4NJ7 A;  3ML9 A;  1H8C A;  1WZ3 A;  2KMA A;  3L17 A;  3PRP B;  4FJZ A;  1WE7 A;  3QA8 A;  3AI5 A;  4II2 B;  4KDI C;  2DZJ A;  3RUI B;  3VAW A;  1RLF A;  2BYV E;  2NBV B;  4ZDV A;  1LM8 B;  1WR1 A;  2CKH B;  2K8H A;  1UEL A;  4MSM B;  1WRD B;  1XQQ A;  3SU8 X;  1Q0W B;  2QHO A;  2FCQ A;  4I6L B;  2KOX A;  1YX5 B;  3JYU A;  3TMP B;  1WMH A;  3RCZ A;  3DVN V;  3VVW B;  2WX0 A;  3A1Q B;  5AZF A;  4AUQ C;  3A9J A;  3GZN I;  1TTN A;  2DYM A;  1V5O A;  2BKR B;  4MGI E;  2GBM A;  2G4D B;  4PS7 A;  2JWZ A;  2CHX A;  5JZE B;  3DQV A;  2IYD B;  5BO4 B;  4BFR A;  1K8R B;  2MA9 B;  4ANV A;  4B95 A;  1WJU A;  4BKS D;  5HKH A;  2BPS A;  2ZPN A;  4WJO A;  4FLH A;  1E8Y A;  4LJP B;  2L76 A;  2DX5 B;  5JHB A;  2GMI C;  2K25 A;  1C3T A;  2M0X A;  3KUC B;  1YD8 U;  5CHV C;  4X57 B;  2JUO A;  4HVB A;  4AP4 C;  3R7Q A;  2J7Q B;  2C7N B;  4EZJ A;  3PZD A;  3ZNH B;  4A3P A;  3DPD A;  2G4S A;  2MWS B;  1LQB A;  4MDK E;  4FN2 A;  4LDT D;  3TJP A;  1C1Y B;  2KWC A;  2L0T A;  4WAA A;  3V6E B;  3VFK A;  3ZUN A;  2KFK A;  3A9J B;  1J8C A;  3A1Q A;  4FUL A;  4HJK A;  4W9I A;  4ANX A;  2O2V B;  3SD5 A;  1UZX B;  2G45 B;  3R66 C;  3UIO B;  4EZL A;  2K8C A;  2XEW A;  3QAQ A;  3DVG X;  3VHT C;  2LI5 A;  3CMM B;  4B6W A;  2AEH A;  3HIZ A;  2GBR A;  1KM7 A;  3KUD B;  4IC7 B;  3VXW A;  3A4R A;  3KYC D;  2JXX A;  2AWT A;  4WJN A;  1YQB A;  2IY0 B;  3V62 A;  3A9K B;  4PS3 A;  1WX9 A;  2HD5 B;  3PLU A;  1UD7 A;  3A4S C;  4EKU A;  2LXA A;  3P2B A;  4HPM B;  1P0R A;  2BF8 B;  1WX8 A;  1F9J A;  1LFD A;  2D11 A;  4TV3 A;  2ZVN A;  4TQ1 A;  1WGR A;  1V49 A;  2LAS A;  4KZ0 A;  3WAL A;  2YLM A;  3B0A A;  2LWP A;  3M3J A;  1A5R A;  1GJZ A;  1M94 A;  3U8Z A;  2KQ7 A;  3QC8 B;  2AL3 A;  3QAR A;  4GDK B;  4PYU A;  2C7H A;  2GBJ A;  2V4L A;  1CMX B;  3VTW A;  1QZE A;  3ZDM C;  2KMC A;  1V9J A;  2LUE A;  3QK0 A;  4JGH B;  2N7E A;  3I3T B;  2ZVO A;  4MJS B;  2REX A;  2CHW A;  2KK8 A;  2FAZ A;  2GBK A;  3ECI A;  3L13 A;  3WAM A;  1WM2 A;  4NAW A;  2NBU A;  5DCN A;  3RZW C;  2LVP A;  4ICU A;  1OEY A;  4HWI B;  3V60 A;  2VRR B;  3U7D A;  4I6P A;  2IZV B;  3OAW A;  3APD A;  1BT0 A;  3PVL A;  3SHQ A;  3ZIM A;  4DK5 A;  2KXJ A;  4DDI D;  3EHV A;  4FHK A;  3ZRC A;  2FNJ B;  4EUT A;  3VUY A;  1RFA A;  4CO7 A;  3PHX B;  3JW0 X;  2D3G A;  2GOW A;  3Q3F A;  3TIX A;  3CSF A;  3QQ8 B;  2JVC A;  3MJW A;  4JLC A;  2KQS A;  2KC2 A;  2Z0E B;  3ZKJ C;  4W9E A;  1R4N I;  3W1S A;  3H7S A;  3UIN B;  2BWF A;  1P98 A;  4GGQ A;  3RD2 A;  1P1A A;  3WAP A;  2FUH B;  4MGZ E;  3HM6 X;  4A20 A;  3UQB A;  1E8X A;  1V2Y A;  1WXV A;  4URK A;  1IP9 A;  3NZU A;  4GIV A;  3EFU A;  3UQA A;  1WYW B;  1EF5 A;  2C5L C;  3UIP B;  4NJ6 A;  4GDL A;  2EKE C;  2I1K A;  2OJR A;  1NI2 A;  3V6C B;  2LZ6 A;  2OOB B;  4AJW A;  5E6O A;  3GOE A;  2RPQ A;  3RZF A;  4K7W A;  4IWO A;  1YIW A;  1D3Z A;  1RAX A;  5D94 A;  2DEN B;  3EC8 A;  5L95 C;  2J0K A;  4KIK B;  3RYT A;  4BKT A;  2ZNV C;  4XC2 A;  4TKN A;  2UYZ B;  2LJ5 A;  2KO3 A;  3DOW A;  1WJ4 A;  2DZK A;  4IW0 A;  3PS6 A;  4E71 A;  3KW5 B;  4DHJ D;  3ZNG C;  2FCS A;  5G2N A;  2IY1 B;  3JVZ X;  2NS5 A;  3PGE A;  3H1U A;  2CS4 A;  3JSV B;  2KD0 A;  5G55 A;  3B08 A;  4MGK E;  2DZI A;  3IG3 A;  1WXM A;  5E6N A;  2KJR A;  2XK5 B;  2KLC A;  4FA6 A;  2NVU I;  3M62 B;  2K8B A;  3A33 B;  5D7G A;  1Z5S B;  2ASQ A;  2KNB A;  2MBB B;  3L08 A;  4KV2 A;  1S3S G;  3V61 A;  3RUL A;  2M8S A;  3N32 A;  3OLM D;  2XK5 A;  3KVF B;  3M63 B;  4KSL C;  3N30 A;  2KWV B;  5AZG A;  2WWZ A;  1IYF A;  2AL6 A;  4AJY B;  3JSV A;  4W9K A;  5IA7 A;  2UWQ A;  4IM3 A;  2ZEQ A;  4HXD A;  3H6N A;  4W9F A;  3VH4 B;  4TUU A;  2KDF B;  4KDL B;  4G11 A;  2PPH A;  1PQS A;  3OJ4 B;  1TZ1 A;  3D32 A;  2D10 A;  2EMT A;  1UH6 A;  4ZRK A;  3AU5 A;  3CF6 E;  4W9J A;  4RM9 A;  3X0W A;  4F1S A;  5CX3 A;  2ZJD A;  3K9P B;  2LRW A;  2MRP A;  3ZDT A;  2Z59 B;  3ONS A;  4MJS A;  4F7Z A;  2N9P C;  3DBS A;  4DHJ B;  2D07 B;  2IO1 B;  2KJ6 A;  1S1Q B;  2L05 A;  2RD0 A;  2ZPY A;  3IBE A;  3ALB A;  4GN1 A;  4JQW C;  3PPA A;  5JHA A;  3QIJ A;  1GNU A;  3HM3 A;  3IVF A;  3W1S C;  2KKC A;  2KJH B;  4K81 A;  1T0Y A;  2MBE A;  3VDZ A;  4ICV A;  3L54 A;  1WR6 E;  4WJQ A;  3M95 A;  1ZGU B;  3KYD D;  4YL8 A;  1WXA A;  3MHS D;  3ZRF A;  2A4Z A;  5LLI A;  3A9K A;  4GXB A;  1SGH A;  3K9O B;  2K6D B;  3KH0 A;  1TGZ B;  2M17 A;  5TR5 A;  2DZM A;  3BIN A;  4BOZ B;  4XZ4 A;  4W9D A;  4B9K A;  4LCD E;  3L0W B;  4BKS A;  1WE6 A;  2IO3 B; 
#chains in the Genus database with same CATH topology
 3Q3M C;  1FIQ A;  3AEG B;  5MPO A;  1CK1 A;  1SE2 A;  5CTR C;  2O2V A;  4WWM A;  4K3C A;  5I4D A;  1NYR A;  4FBJ B;  4NAW B;  4HCN B;  1L0V B;  3P1M A;  4LNN A;  4ANU A;  1Z2M A;  2KZR A;  1NDD A;  1UUP A;  2C9W B;  2JT4 B;  2JZP A;  5E6J A;  5EE1 A;  3HUI A;  1GB1 A;  4LLG M;  1UBI A;  4LJO B;  1C4C A;  2KFJ A;  2EMS A;  2CR5 A;  5DPR A;  2PJH A;  2WDV B;  3TL5 A;  1E8Z A;  3AE9 B;  1EUV B;  3VUW A;  3H8H A;  1C77 A;  4RMA A;  3U52 E;  4HCP B;  1AAR A;  3WAN A;  1RFK A;  2VH2 A;  2M0A A;  1ZOY B;  1E9M A;  1KLV A;  1SEB D;  5FR6 A;  3AE3 B;  3PRM B;  1AW7 A;  5T8I A;  1V81 A;  4LNO A;  3AE4 B;  2RDB C;  2BGF A;  1SF0 A;  3APF A;  3Q69 A;  3RN9 C;  4C00 A;  2MX2 A;  2K6Q A;  1Q5W B;  4IG7 B;  2O6V D;  2K3U A;  4DXA B;  1ZW7 A;  4O1N A;  4OZC A;  2J52 A;  4ZRI A;  1RWS A;  1VR9 A;  2LVQ A;  1LO5 D;  5J18 A;  1WJN A;  1U4A A;  2LGX A;  3OWE B;  2D2Q A;  3BK1 A;  2FID A;  3ETR A;  2OED A;  5GMV A;  3B2F A;  1TY0 A;  3TEW A;  3ZLZ A;  2JY6 A;  2BWE S;  4BBN F;  2LGS A;  1OQR A;  2D3A A;  4P7I A;  1CQV A;  3N1Z C;  3W1Y A;  5LXI B;  4XWW A;  4RNA A;  2JRH A;  4RH6 A;  1E10 A;  4F8C B;  1FXA A;  1JWA D;  2WYQ A;  4C4V B;  1WYG A;  1V86 A;  3AEC B;  4KIK A;  1GG3 A;  1T0Q C;  4OVU A;  4J6I A;  3ZGZ A;  1WXS A;  3NHE B;  3QX1 A;  2M1M A;  2C7M B;  3NZS A;  2K1F A;  2M19 A;  1ZXH A;  2W54 A;  2O6V A;  1WI0 A;  1C4A A;  3ZVV A;  3O65 B;  1JAL A;  2M56 B;  3AE8 B;  5LXH A;  1E8W A;  2WXH A;  3DVN U;  1GC6 A;  4MAC A;  4IWP A;  1L7Y A;  1ZUD 2;  4BVU C;  5JH5 C;  1EU3 A;  2BQQ A;  2PVO D;  4WWP A;  4W9H A;  3HVZ A;  1KFY B;  1J7A A;  2O6V B;  5D3I B;  3E56 A;  1R4M I;  2WXM A;  3AU4 A;  3QJZ A;  1WM3 A;  2SAK A;  4IM2 A;  4ZYN A;  3IAS 1;  3W9C B;  1JRP A;  2JZ3 B;  4DXF A;  3X23 A;  2AQ3 B;  2WXF A;  3MTN B;  3EUB 2;  4GLS C;  3RNB C;  3IHP C;  4II3 B;  5C1Z A;  3T3O A;  3HHM A;  2DHZ A;  2EEL A;  1LXD A;  4NNJ B;  1WZ0 A;  2WGS A;  4ASW C;  1PYW D;  1TJE A;  3VRA B;  3NY5 A;  2OHF A;  2KDB A;  2MSE D;  2WQY B;  1HEZ E;  1H8C A;  3L17 A;  1C9F A;  2BYV E;  2IND C;  2MHJ A;  2QHO A;  2KOX A;  2BS3 B;  4YTM B;  1WMH A;  3VVW B;  1E0Z A;  4AUQ C;  3A9J A;  3GZN I;  2BKR B;  3Q14 C;  3RNF C;  2JWZ A;  1TS2 A;  4ANV A;  2R61 A;  4YWG G;  3AM9 A;  3RNC C;  1F1H A;  1VZ8 A;  1ROE A;  5IKC M;  1YD8 U;  5CHV C;  1R4N B;  4HVB A;  2J7Q B;  2C7N B;  1HA5 A;  4EZJ A;  2MWS B;  1LQB A;  4FN2 A;  1FFV A;  3TJP A;  1YOV B;  3V6E B;  4A55 A;  3ZUN A;  4ANX A;  2O2V B;  4ARC A;  1UZX B;  3R66 C;  2B76 B;  3BVM A;  2K8C A;  3DBL B;  3EA6 A;  1QKZ A;  3VHT C;  4JWU C;  3TEX A;  4B6W A;  3VXW A;  2GBR A;  2GI9 A;  3A4R A;  3V62 A;  3A9K B;  1WX9 A;  1UD7 A;  3A4S C;  2LXA A;  4N58 A;  1I4X A;  5AUK A;  3L4P A;  3BK2 A;  2WNM A;  3B0A A;  4YSX B;  2JYE A;  4PYU A;  2KAC A;  1KTK A;  1V9J A;  2REX A;  2CHW A;  2FAZ A;  2GBK A;  3ECI A;  3AEE B;  1WM2 A;  4NAW A;  2V3P A;  3RZW C;  2LVP A;  2N7J A;  1OEY A;  3V60 A;  3U7D A;  2IZV B;  1BT0 A;  3VRB B;  2ACZ B;  4DDI D;  1VDV A;  1JQ4 A;  3ZRC A;  2FNJ B;  3VUY A;  1RFA A;  4TMA B;  2D3G A;  3Q8B A;  2GOW A;  1TS5 A;  3Q3F A;  3QQ8 B;  1F77 A;  2W3S A;  2JVC A;  2ON8 A;  4W9E A;  3H7S A;  4GGQ A;  1UWX A;  3FIL A;  4OZA A;  5IO9 A;  1QT9 A;  3UQA A;  1WYW B;  2IGG A;  3I63 C;  3W2D A;  1D5X C;  4GDL A;  3Q8F A;  1IUE A;  1F2R I;  2OOB B;  2WU2 B;  4US9 A;  4HPP A;  1TKG A;  1XF5 L;  2PVG C;  1YIW A;  1D3Z A;  5D94 A;  2DEN B;  2J0K A;  4BKT A;  1HZ6 A;  5H8Y E;  4XC2 A;  4DHJ D;  4DQO C;  3ZNG C;  3UI3 A;  5G2N A;  3NVV A;  3JSV B;  2CS4 A;  4CQN A;  2KD0 A;  2HDE A;  1FNW A;  4IKG A;  3AE5 B;  4RF1 A;  4B0E A;  2K8B A;  3A33 B;  1Z5S B;  2ASQ A;  1L5P A;  4KV2 A;  1S3S G;  2DWQ A;  2M8S A;  3RUL A;  3OLM D;  2XK5 A;  5HHD G;  3M63 B;  5FKA C;  2LJI A;  5AZG A;  4N59 A;  4AJY B;  1PFD A;  5IA7 A;  3MFG A;  3SR6 A;  1RYJ A;  2J4X A;  4TUU A;  2KDF B;  4KDL B;  2PPH A;  1SJH D;  2D10 A;  2VZK D;  1M4V A;  3ZDT A;  4F7Z A;  3CWI A;  2IO1 B;  1FRD A;  2L05 A;  2RD0 A;  3IBE A;  2JQR B;  3ALB A;  3PPA A;  1ESF A;  1GNU A;  3HM3 A;  2KKC A;  2KJH B;  1VZ7 A;  2WXK A;  1KRH A;  3L54 A;  1WR6 E;  1PDX A;  3M95 A;  1ZGU B;  3KYD D;  5LLI A;  1T0S C;  1ZP0 B;  2DZM A;  4XZ4 A;  2GRI A;  4BKS A;  2IO3 B;  1V6E A;  3NVY A;  4S17 A;  4E3C A;  2KX3 A;  1SE4 A;  4MH8 A;  3R2T A;  3IT6 B;  1GUA B;  1FD6 A;  3ML8 A;  2WXN A;  1WY8 A;  1HZ5 A;  1SE9 A;  4RM8 A;  5GXG B;  2UU7 A;  3ZNI D;  2ZW1 A;  4REZ A;  2DYO A;  4USA A;  4N6E B;  5TSS A;  1FXT B;  4P6V F;  2YEP F;  3T3N A;  1F2R C;  4HDO A;  2RR9 A;  4IM0 A;  1MHX A;  3DBH B;  4FXC A;  4YT0 B;  2MBQ A;  3AV8 A;  4W9L A;  4IWQ A;  5C23 A;  2JRI B;  2ZCB A;  3TBL D;  3MHZ A;  1FPY A;  2KDM A;  2PMV A;  2GBN A;  4HDQ A;  1DOY A;  3BYT B;  2LMC A;  4RGO S;  2AYO B;  4P1C C;  5J2R A;  2LHD A;  3ZNZ B;  2V3S A;  5IAA C;  1F52 A;  1ZDX A;  1GPX A;  4K7U A;  1L6V A;  4E74 A;  4H2A A;  2FCM A;  2LGY A;  1X1M A;  3Q2A C;  1E90 A;  1L2N A;  2NBW B;  4AOF A;  2JWU A;  4GMV A;  1WJ6 A;  1I42 A;  1OQY A;  1XD3 B;  2W9N A;  3AE1 B;  2KX0 A;  3H9D A;  1SE3 A;  2L32 A;  4M8N A;  2SEB D;  2QMT A;  4TQ0 A;  3RNE C;  5LNK 1;  4KKI A;  1HTQ A;  2KWU B;  4JX1 C;  3WAO A;  3TUO A;  3PRZ A;  1J19 A;  3ZJU A;  1EF1 A;  4WQO B;  4BBN C;  2JXT A;  4ANW A;  2FE8 A;  1JML A;  1NEN B;  4YSZ B;  3NOB A;  1ENF A;  1YN5 A;  5DPT A;  2DAF A;  4PS8 A;  4MEL A;  2L0F A;  5EDS A;  3BWU D;  2IDY A;  2KDE B;  3IFW B;  4GSW A;  2IBI B;  1VRA B;  1V80 A;  4D2K A;  2BYE A;  3Q8C A;  4HK2 A;  3NS1 A;  4FAD A;  3PV1 A;  1E7V A;  1WGK A;  4C4V A;  1YJI A;  2JF5 A;  3N1X C;  4A3O A;  2WXQ A;  3UGB B;  1KJT A;  2N0S B;  1J0G A;  4A8X C;  4G3X B;  1ISN A;  1J7C A;  2L8J A;  3NS8 A;  1YMH E;  2J0M A;  2J0J A;  1OQQ A;  5AZH A;  1V1P A;  3ZO5 B;  1FCC C;  2HJ8 A;  3U7Z A;  1TZO A;  2I1J A;  2L7R A;  2BYF A;  4G0N B;  1RRB A;  4OVZ A;  4ACF A;  1OEY J;  2M4N A;  1OGW A;  3DBR I;  2GLS A;  1QIL A;  4WAF A;  1TY2 A;  1TBE A;  4WH4 A;  3CIR B;  4MSQ B;  2IPK D;  2JSV X;  2JX5 A;  4LTU A;  1PGX A;  4KSK C;  3W5V B;  2KTF A;  1WH3 A;  2KHW B;  4GDK A;  4MH0 E;  1EO6 A;  3S2A A;  1XCQ L;  2PE6 B;  4GOC A;  3OJ3 A;  2WU5 B;  3CST A;  3Q3J A;  3VH3 B;  3VQI A;  4JL9 A;  4FJY A;  1C4P A;  4MM3 A;  4S0R A;  4M02 A;  4DWF A;  4DBG A;  4WQM A;  4HLE A;  4A90 A;  4NJ7 A;  2BS2 B;  3QA8 A;  1DYQ A;  2DZJ A;  4L23 A;  3RUI B;  2QIE B;  1WR1 A;  1WSP A;  2HJ1 A;  4YTP B;  2BB5 A;  2LGI A;  1Y56 A;  2KAJ A;  3RNG C;  3JYU A;  4MT5 A;  3TMP B;  1TTN A;  2DYM A;  1V5O A;  3P4R B;  2GBM A;  2G4D B;  4ZHP A;  1VLB A;  5JZE B;  5FR3 A;  1E7P B;  1EWY C;  2QCZ A;  2BPS A;  1ET6 A;  4LJP B;  2L76 A;  2DX5 B;  2WLB A;  3KUC B;  3PZD A;  4A3P A;  1JWB D;  3DPD A;  2G4S A;  4MDK E;  2KMM A;  4WAA A;  1XCT L;  1J8C A;  3C8Y A;  3A1Q A;  4FUL A;  2WDQ B;  2WXI A;  3Q8E A;  3NVZ A;  3GP7 A;  2XEW A;  3HIZ A;  3KUD B;  5BYR A;  4RGM A;  1DOI A;  4WJN A;  2IY0 B;  2Y3A A;  3TEY A;  3PLU A;  4EKU A;  4HPM B;  1WX8 A;  3TEZ A;  2D11 A;  2JYT A;  3WAL A;  1A5R A;  1GJZ A;  3QC8 B;  2QEJ C;  3QAR A;  4XYC A;  4GDK B;  2GBJ A;  1Q10 A;  3NJT A;  4JGH B;  2N7E A;  3I3T B;  1XLO A;  3MC0 B;  3L13 A;  2MEK A;  4ICU A;  2DLB A;  1PGA A;  2J53 A;  1FRR A;  3APD A;  3EHV A;  4FHK A;  3KLS X;  1L4Z B;  1V1O A;  1I4G A;  5EE3 A;  3CSF A;  3NVW A;  2KQS A;  3GS2 A;  1R4N I;  1FCL A;  1P98 A;  4IOI E;  3WAP A;  2FUH B;  1N5W A;  4P1B C;  3UQB A;  4AS1 A;  1WXV A;  1C78 A;  4URK A;  1IP9 A;  3DHG C;  1NEK B;  3MJ5 A;  4US8 A;  2EKE C;  4YSY B;  1FM0 D;  1TKE A;  2RPQ A;  4K7W A;  4IWO A;  1TT5 B;  3SEB A;  1RAX A;  3EC8 A;  1WJ4 A;  2CJO A;  2DZK A;  4E71 A;  3KW5 B;  3PGE A;  3JVZ X;  2E3T A;  2LFI A;  2LUM A;  3ZJV A;  5G55 A;  3ZXR A;  2VZK B;  5E6N A;  3M62 B;  5D7G A;  3RNA C;  3V61 A;  4A6Q A;  4KSL C;  2KQ4 X;  3NUH B;  1N63 A;  4W9F A;  3J9C A;  3Q8A A;  1D6E C;  4G11 A;  1PQS A;  3OJ4 B;  1TZ1 A;  3D32 A;  4QAY A;  1UH6 A;  4ZRK A;  1ET9 A;  2TSS A;  4RM9 A;  4F1S A;  3AEA B;  5CX3 A;  2QJL A;  2LRW A;  1AN8 A;  4KGR A;  3ONS A;  2N9P C;  4DHJ B;  2D07 B;  2KJ6 A;  1S1Q B;  2ZPY A;  4JQW C;  5JHA A;  1TKY A;  3IVF A;  3AN1 A;  3VDZ A;  4LNF A;  3Q6B A;  2X8X X;  2QC8 A;  1WXA A;  3MHS D;  3ZRF A;  3IAM 1;  5EE9 A;  1SGH A;  4PK1 A;  3FC4 A;  4IDI A;  3V05 A;  3L0W B;  2V9H A;  1I4R A;  3SDL C;  1ZKH A;  1XLQ A;  3AE6 B;  2MCN B;  4K7S A;  2RMM A;  3BZD B;  4W9C A;  5G5G A;  1QQR A;  2BT6 A;  3UF8 A;  4MGY E;  2EKI A;  1I35 A;  3I9V 1;  2ZNV B;  2XBB C;  1XO3 A;  4ZHO A;  4HKZ E;  3IT4 B;  4BAX A;  3H7P B;  2LEK A;  1FEH A;  1UNS A;  3QHT A;  2KLG A;  1GAQ B;  1SSN A;  1IPG A;  2PE9 A;  3PSE B;  4B0M A;  1MG8 A;  2MW5 A;  3ZTD A;  2LHE A;  1UBQ A;  4ZRJ A;  2MBH A;  5KHO A;  1KOT A;  2C60 A;  4FHJ A;  1IGD A;  1V5T A;  2ICI A;  3N20 C;  2Y5P A;  4CHK A;  4XX5 A;  2NMQ A;  2KFK B;  2R2O A;  1JRO A;  4JE3 B;  1I4H A;  4LK0 M;  4XWT A;  1NBF C;  1QOF A;  2I38 A;  3U2S C;  2WXJ A;  3Q3N C;  4HPL B;  1I7H A;  2KTR A;  3EEC A;  3BYY B;  4LDT B;  1K53 A;  3BY4 B;  2J42 A;  4C7Y A;  3ZW3 A;  1TYG B;  2WXR A;  1YQ4 B;  2KAN A;  3VTV A;  1E5W A;  2KDI A;  2LRU A;  1UF0 A;  5CHF A;  2LD9 A;  1SB3 C;  1FNU A;  2V3N A;  3R3M A;  2NPT A;  2LVO A;  1WX7 A;  5BMH A;  3EGR A;  3NZ3 A;  4KX6 B;  1XXG A;  2DAJ A;  4WWN A;  1K51 A;  1KF6 B;  4HEA 1;  2CU1 A;  3ZQ4 A;  2NR2 A;  2MJ3 A;  1WFY A;  4IUM B;  1FFU A;  2WXL A;  4C7Z A;  1QOA A;  1Q1O A;  3QCA A;  4OVV A;  1ZE3 D;  3N3K B;  1LGR A;  2DYB A;  1Y8R C;  3DBL I;  4AWJ A;  2MP2 A;  5HG2 A;  3R8B A;  3APC A;  2KVZ A;  1FXI A;  4I6N B;  3AED B;  2ZW0 A;  3PLV A;  2RSU A;  2B3A A;  2W82 A;  2MBO A;  2PEA A;  5AEK B;  4RF0 A;  2N9L A;  5KHQ A;  2JPH A;  3ZJT A;  3KUZ A;  4EE2 A;  1J7B A;  2KN4 A;  2L00 B;  1L6U A;  4HRS A;  1DOX A;  1WRI A;  4AQ7 A;  2MQJ A;  4LNK A;  2AQ2 B;  4DHZ B;  3BVG A;  3GZN B;  4WJP A;  2NCN A;  2INC C;  4HJG E;  3RI7 C;  3FKY A;  1SIF A;  1MPE A;  1D4B A;  1XEE A;  4NY0 A;  3ZTC A;  1YX6 B;  3U30 A;  5BMG A;  1T0R C;  1QOB A;  4FJV B;  4KZC A;  4BOS C;  5AUI A;  3PHW B;  2G9H D;  4UDU C;  1JRU A;  1G6J A;  4ZOH C;  3HVD A;  2BKF A;  2JZZ A;  1EM7 A;  1YJ1 A;  3QWZ B;  2OJW A;  2FIF A;  4PYZ A;  4KKJ A;  3WIM A;  2WDT B;  2KC1 A;  1WE7 A;  4II2 B;  3AI5 A;  3PZ8 A;  1RLF A;  4ZDV A;  1UEL A;  1WRD B;  1XQQ A;  3SU8 X;  4I6L B;  3A1Q B;  5AZF A;  2DBY A;  1WXQ A;  4PS7 A;  1NYQ A;  2VH1 A;  2QIL A;  4RFB A;  3DQV A;  1R4M B;  3GB1 A;  3P4S B;  2Q5W D;  2MA9 B;  4BKS D;  2ZPN A;  1EWC A;  4WJO A;  4FLH A;  1E8Y A;  2IJ0 A;  2ONQ A;  1C76 A;  5JHB A;  2GMI C;  3KWL A;  3N1Y C;  1JWS D;  2L1A A;  3P42 A;  2JUO A;  4X57 B;  2MJE A;  4RGT A;  4LDT D;  1L4D B;  4KGS A;  2KWC A;  2L0T A;  3VFK A;  1F0Z A;  2KFK A;  1WWT A;  2RDH A;  4W9I A;  3P4P B;  1YN3 A;  4EZL A;  4ZRP A;  2QSD A;  3LXF A;  2LI5 A;  3CMM B;  1V97 A;  5IN7 A;  1KM7 A;  4IC7 B;  4Q2J A;  3KYC D;  2JXX A;  1YQB A;  4A9A A;  4PS3 A;  2HD5 B;  3E9S A;  3GE8 C;  3P2B A;  1R7S A;  2BF8 B;  1F9J A;  2ZVN A;  4TQ1 A;  1WGR A;  1V49 A;  2L83 A;  4C56 C;  4KZ0 A;  2LWP A;  3M3J A;  1M94 A;  2PLP A;  3U8Z A;  2KQ7 A;  2AL3 A;  2C7H A;  1I4Q A;  2V4L A;  1CMX B;  3QK0 A;  2LUE A;  4MJS B;  2ZVO A;  2WXO A;  3WAM A;  1PUT A;  2NBU A;  2MJD A;  4HWI B;  2VRR B;  3OAW A;  5BYQ A;  1D5Z C;  4HRO A;  2NTS A;  3SFE B;  4CO7 A;  3U4E G;  3PHX B;  2WHI A;  1MG4 A;  1EU4 A;  1B9R A;  3TIX A;  1ACC A;  3MJW A;  2RPV A;  4JLC A;  4ZYS A;  3GE3 C;  2PIA A;  4C80 A;  1V1P B;  4TSS A;  3UIN B;  3RD2 A;  2NTT A;  4MGZ E;  3HM6 X;  4A20 A;  1MVK A;  3I5J C;  4GIV A;  1EF5 A;  4NJ6 A;  2IGH A;  1IBX A;  2I1K A;  3V6C B;  4AJW A;  3RZF A;  1UWM A;  2WDR B;  1YJJ A;  4KIK B;  4NJC A;  2ZNV C;  4TKN A;  2UYZ B;  3AE7 B;  3I57 A;  1JCK B;  1BXT A;  2WP9 B;  2IY1 B;  2PKO A;  3DHH C;  3AH7 A;  4MGK E;  3IG3 A;  1WXM A;  2XK5 B;  2NVU I;  3N32 A;  1HQR D;  3N30 A;  2QDF A;  2KWV B;  2WWZ A;  3V3X A;  2AL6 A;  3JSV A;  5IOI A;  3B2G A;  2UWQ A;  4IM3 A;  2ZEQ A;  3H6N A;  1SXT A;  3BVZ A;  2EMT A;  1MI0 A;  2MH7 A;  3AU5 A;  1ZXI A;  5BYS A;  2ZJD A;  3AEF B;  3K9P B;  1E6E B;  3MC8 A;  2Z59 B;  4MJS A;  1N61 A;  2BTE A;  4GN1 A;  3QIJ A;  1FMA D;  4OZB A;  3DHI C;  4K81 A;  3FIL B;  4YTN B;  3NG0 A;  4WIP A;  2H89 B;  1D5M C;  4YL8 A;  2A4Z A;  4GXB A;  3K9O B;  2K6D B;  1C79 A;  3KH0 A;  1TGZ B;  1L0X B;  2Z8L A;  3AE2 B;  1TIF A;  4W9D A;  1WE6 A;  1SJE D;  1I4P A;  4XGA B;  2CU3 A;  5D6J B;  3ZYY X;  1CJE A;  3P63 A;  2CHZ A;  5DPS A;  1KLG D;  1P3Q U;  2LGD A;  4ARI A;  2RGF A;  2WX1 A;  4NQL B;  5C3J B;  1CZP A;  2BB6 A;  1NVI D;  1JWU D;  4DDG D;  2BVC A;  4XDD A;  1WIA A;  3EFC A;  1FNV A;  1RM6 C;  3KWV A;  1GC7 A;  2IGD A;  3PTF C;  2H88 B;  3VUX A;  2K5P A;  3SFD B;  3C19 A;  2K0P A;  4ZRQ A;  1XT9 B;  2KYW A;  4BZA A;  1T5X D;  5L83 A;  2XNA C;  2V0G A;  2ZZP B;  4MEM A;  3T9L A;  2N1V A;  2XN9 C;  3OG5 A;  1T3Q A;  1MHH E;  4GU2 A;  4MM3 B;  2IO0 B;  2BW2 A;  4WUR A;  3AMZ A;  2WS3 B;  2A5U A;  1A70 A;  3HK0 A;  3LYY A;  4KVG B;  3LDZ E;  1T6B X;  3H7P A;  2JU6 X;  3R7R A;  3DVG Y;  3RMK C;  5J17 A;  1QLB B;  1MJD A;  3T8M A;  1TS3 A;  3FAH A;  2N9X A;  1IGC A;  2L3Z A;  4EOY A;  3RT3 B;  1FO4 A;  3DDC B;  1NI3 A;  1JW9 D;  1WMH B;  5CHW A;  2BS4 B;  2Y5B B;  5DPW A;  3L16 A;  3WA0 A;  3Q3O C;  2N9E B;  2IO2 B;  3AUL A;  4NAM A;  4JPS A;  2KWD A;  5D2M B;  3TCA A;  1E7U A;  1AYF A;  2CJN A;  1KLU D;  2KT7 A;  1AWD A;  4L1B A;  1H4R A;  2HE7 A;  2PTL A;  2K22 A;  1WGD A;  2WXP A;  1ZDV A;  1VCB A;  3B1L X;  2I2Y A;  4EEW A;  3AXC A;  1MFW A;  2MLB A;  2PW9 A;  4KGT A;  3ENE A;  1P7E A;  1P9D U;  2MP2 B;  2ZCC A;  3DCG A;  4K1R B;  4NQK E;  4GDL B;  4WWO A;  4EZK A;  3VTU A;  4XE0 A;  2E6X A;  3L10 B;  4GB9 A;  3B9J A;  4M00 A;  1WF9 A;  2R2Q A;  4G50 A;  2KVR A;  1HE8 A;  1OFF A;  4JIO U;  2DNF A;  4DHZ E;  4K3B A;  4N9F 4;  4LNI A;  1OTR B;  2HTH A;  2N7D A;  2NPT B;  1WGY A;  2Z0D B;  3DBR B;  2K39 A;  3C0R B;  3LB8 C;  2N1W A;  5BMI A;  1YN4 A;  1VJK A;  4NPN A;  3VR8 B;  3ZXV A;  4BKG A;  1JWM D;  3DBH I;  4M8M A;  1WGG A;  1SIJ A;  3O13 A;  1KH0 A;  4CYE A;  1YNT E;  3BII D;  3PT2 B;  4M0W B;  4RCO A;  1IBX B;  3PRE A;  4OW0 A;  2V1Y A;  3N9Y C;  3AEB B;  2N4F A;  2KTR B;  2KN5 A;  4EFO A;  1L0Y B;  3RFZ B;  5HI1 A;  1WGH A;  2FCN A;  2N9K A;  5E6P A;  1UGM A;  1VD2 A;  2G3Q B;  1GB4 A;  4W9G A;  1V8C A;  2LXC A;  5G5H A;  2YVC A;  3LJ3 A;  3ML9 A;  1WZ3 A;  2KMA A;  4FJZ A;  1DGJ A;  3VAW A;  4KDI C;  3R2I A;  2NBV B;  2GB1 A;  1LM8 B;  2CKH B;  2K8H A;  4MSM B;  5FK9 C;  1Q0W B;  2FCQ A;  2L52 A;  1YX5 B;  2AQ1 B;  1QOG A;  3DVN V;  3RCZ A;  2WX0 A;  4MGI E;  3PZ7 A;  1QF6 A;  1HTO A;  2CHX A;  4DXG A;  2IYD B;  5BO4 B;  1P7F A;  4BFR A;  4R3D A;  1K8R B;  4B95 A;  1WJU A;  5HKH A;  3DWM A;  2K25 A;  1C3T A;  2M0X A;  4AP4 C;  2HTM E;  3R7Q A;  1K52 A;  3ZNH B;  3MC9 A;  1C1Y B;  3WCQ A;  3URY A;  3A9J B;  2INP E;  4HJK A;  4ITK A;  1GOZ A;  1XLN A;  2X38 A;  3SD5 A;  2G45 B;  3UIO B;  4L2Y A;  3QAQ A;  3DVG X;  2AEH A;  2AWT A;  1PGB A;  4OHJ A;  4XDC A;  3AB5 A;  4YXD B;  2D3B A;  1P0R A;  1N5X A;  1LFD A;  4TV3 A;  3W5U B;  3MP9 A;  2LAS A;  2D5G A;  2YLM A;  1B1Z A;  2WXG A;  3VTW A;  2Y5C A;  1QZE A;  3ZDM C;  2KMC A;  2AX5 A;  2KK8 A;  4M0W A;  5EE0 A;  5DCN A;  4I6P A;  1N62 A;  3PVL A;  3SHQ A;  3ZIM A;  1TS4 A;  3ABV B;  2KXJ A;  4DK5 A;  2V4I B;  5H92 C;  4EUT A;  2K9X A;  3JW0 X;  1SBB B;  2FUG 1;  2KC2 A;  2Z0E B;  2BBC A;  3ZKJ C;  1BUI C;  3W1S A;  4M01 A;  2BWF A;  1P1A A;  3P4Q B;  1UGJ A;  4RGN A;  2BYT A;  1E8X A;  1V2Y A;  5D3D A;  3NZU A;  2G1E A;  4JWS C;  3EFU A;  5C2T B;  2C5L C;  3UIP B;  1N6Z A;  1YQ3 B;  2OJR A;  1NI2 A;  3RPF C;  2LZ6 A;  3PO0 A;  5E6O A;  3GOE A;  4P16 A;  3KQ4 A;  2W55 A;  5L95 C;  3RYT A;  2LJ5 A;  2KO3 A;  3DOW A;  4IW0 A;  3PS6 A;  2FCS A;  3HRD D;  2W3R A;  2NS5 A;  3H1U A;  2YEP B;  3B08 A;  2DZI A;  1K50 A;  2KJR A;  4FA6 A;  2KLC A;  2KNB A;  2MBB B;  3L08 A;  4NZL B;  3KVF B;  1IYF A;  5IP4 D;  4W9K A;  1VZ6 A;  4HXD A;  1XLP A;  5HFY A;  3VH4 B;  2FBW B;  1HXY D;  3CF6 E;  4W9J A;  3X0W A;  4J3O D;  3VR9 B;  2MRP A;  5JXV A;  3DBS A;  2INN E;  2RDG A;  3W1S C;  1T0Y A;  2MBE A;  1STE A;  4ICV A;  3TSS A;  3DWG C;  4WJQ A;  1N60 A;  3NRZ A;  1BML C;  2D3C A;  3A9K A;  4PT5 A;  2M17 A;  3IXS A;  5TR5 A;  3BIN A;  4BOZ B;  4HKQ A;  1ZPS A;  4B9K A;  4LCD E;  3PRP B; 
#chains in the Genus database with same CATH homology
 1V6E A;  3SDL C;  1ZKH A;  4E3C A;  2KX3 A;  5D6J B;  5CTR C;  2MCN B;  2O2V A;  2CHZ A;  4K7S A;  1GUA B;  3ML8 A;  5DPS A;  1P3Q U;  2LGD A;  4W9C A;  1WY8 A;  2RGF A;  3UF8 A;  4FBJ B;  2WX1 A;  4HCN B;  4MGY E;  1SE9 A;  4NAW B;  1I35 A;  4NQL B;  4RM8 A;  2ZNV B;  2XBB C;  3ZNI D;  4ANU A;  1Z2M A;  2KZR A;  1NDD A;  4DDG D;  2DYO A;  3H7P B;  2C9W B;  2JT4 B;  1FXT B;  1WIA A;  3QHT A;  2KLG A;  1IPG A;  2PE9 A;  4HDO A;  2RR9 A;  1GC7 A;  1UBI A;  4LJO B;  2KFJ A;  3PSE B;  3PTF C;  4IM0 A;  2EMS A;  3VUX A;  2CR5 A;  1MG8 A;  2MW5 A;  2PJH A;  5DPR A;  3ZTD A;  1UBQ A;  3TL5 A;  4ZRJ A;  1E8Z A;  2MBH A;  5KHO A;  1KOT A;  2C60 A;  4FHJ A;  1EUV B;  1XT9 B;  2MBQ A;  3VUW A;  1V5T A;  4RMA A;  4W9L A;  4HCP B;  1AAR A;  3WAN A;  4IWQ A;  5L83 A;  5C23 A;  2JRI B;  2ZCB A;  3TBL D;  2ZZP B;  4CHK A;  4MEM A;  4XX5 A;  5FR6 A;  3T9L A;  1KLV A;  2N1V A;  2KFK B;  2GBN A;  2R2O A;  4HDQ A;  3PRM B;  4GU2 A;  2IO0 B;  2AYO B;  1NBF C;  1V81 A;  5J2R A;  4HPL B;  3ZNZ B;  2A5U A;  2V3S A;  5IAA C;  2BGF A;  3HK0 A;  2KTR A;  3APF A;  3LDZ E;  4KVG B;  3EEC A;  3H7P A;  3R7R A;  2MX2 A;  2K6Q A;  3DVG Y;  4LDT B;  4K7U A;  4E74 A;  1Q5W B;  2LGY A;  2FCM A;  1X1M A;  3BY4 B;  4IG7 B;  2O6V D;  5J17 A;  4DXA B;  1E90 A;  1ZW7 A;  3T8M A;  1L2N A;  3ZW3 A;  2N9X A;  2NBW B;  2KAN A;  4ZRI A;  4AOF A;  2L3Z A;  4GMV A;  4EOY A;  1WJ6 A;  1I42 A;  2LVQ A;  3RT3 B;  3VTV A;  1OQY A;  1XD3 B;  1E5W A;  3DDC B;  5J18 A;  1WMH B;  2W9N A;  5CHW A;  2KX0 A;  1WJN A;  1U4A A;  2Y5B B;  3H9D A;  2KDI A;  2LGX A;  2LRU A;  3L16 A;  4M8N A;  2LD9 A;  5CHF A;  3WA0 A;  5DPW A;  3R3M A;  2D2Q A;  2NPT A;  2LVO A;  1WX7 A;  2FID A;  2IO2 B;  2N9E B;  4TQ0 A;  3AUL A;  5GMV A;  2DAJ A;  2KWU B;  5D2M B;  3TCA A;  1E7U A;  4WWN A;  3WAO A;  3ZLZ A;  3PRZ A;  1J19 A;  2JY6 A;  2BWE S;  1EF1 A;  2CU1 A;  4BBN F;  2NR2 A;  4WQO B;  4P7I A;  4BBN C;  3W1Y A;  1H4R A;  4ANW A;  1WFY A;  2HE7 A;  4IUM B;  5LXI B;  1WGD A;  2JRH A;  4F8C B;  3NOB A;  5DPT A;  1Q1O A;  1VCB A;  2DAF A;  3B1L X;  2WYQ A;  3QCA A;  4OVV A;  3N3K B;  1V86 A;  4PS8 A;  4EEW A;  4MEL A;  2DYB A;  1GG3 A;  1Y8R C;  2L0F A;  3AXC A;  3DBL I;  4KIK A;  2MP2 A;  4OVU A;  2KDE B;  3IFW B;  4J6I A;  4AWJ A;  1WXS A;  3APC A;  3NHE B;  4GSW A;  3QX1 A;  2MLB A;  2IBI B;  1V80 A;  3ENE A;  2BYE A;  4I6N B;  2M1M A;  4HK2 A;  2C7M B;  1P9D U;  3NZS A;  2MP2 B;  2ZCC A;  3DCG A;  2K1F A;  3PLV A;  4K1R B;  4NQK E;  4FAD A;  4GDL B;  4WWO A;  3PV1 A;  1E7V A;  4EZK A;  2RSU A;  3VTU A;  2JF5 A;  4A3O A;  3L10 B;  4GB9 A;  2O6V A;  2B3A A;  3UGB B;  1KJT A;  1WI0 A;  3ZVV A;  1J0G A;  1WF9 A;  2MBO A;  3O65 B;  2PEA A;  5AEK B;  2R2Q A;  4G50 A;  4G3X B;  1ISN A;  5KHQ A;  2L8J A;  2JPH A;  3NS8 A;  3KUZ A;  2J0M A;  2KVR A;  2J0J A;  1HE8 A;  5AZH A;  3ZO5 B;  4JIO U;  2L00 B;  5LXH A;  4DHZ E;  2HJ8 A;  1E8W A;  3DVN U;  2I1J A;  4N9F 4;  2L7R A;  2BYF A;  2MQJ A;  1GC6 A;  4G0N B;  4IWP A;  1RRB A;  5EDS A;  1L7Y A;  1OTR B;  4BVU C;  2HTH A;  4DHZ B;  5JH5 C;  2N7D A;  1OEY J;  2NPT B;  1WGY A;  4WWP A;  2Z0D B;  4W9H A;  4WJP A;  2NCN A;  2M4N A;  2K39 A;  3C0R B;  1OGW A;  2N1W A;  2O6V B;  1SIF A;  3DBR I;  4NPN A;  1R4M I;  4NY0 A;  4BKG A;  3DBH I;  1TBE A;  3AU4 A;  3QJZ A;  4M8M A;  1WM3 A;  3ZTC A;  4IM2 A;  1WGG A;  4ZYN A;  4MSQ B;  2JZ3 B;  1YX6 B;  3U30 A;  3X23 A;  4CYE A;  3PT2 B;  3MTN B;  4M0W B;  4FJV B;  4KZC A;  4BOS C;  4KSK C;  3PRE A;  3PHW B;  2KTF A;  3IHP C;  1JRU A;  1WH3 A;  2V1Y A;  1G6J A;  4II3 B;  2N4F A;  2BKF A;  2JZZ A;  2KHW B;  4GDK A;  4MH0 E;  5C1Z A;  1EO6 A;  3S2A A;  3HHM A;  2PE6 B;  1YJ1 A;  2KN5 A;  2DHZ A;  2KTR B;  3OJ3 A;  3QWZ B;  4GOC A;  4EFO A;  3CST A;  3Q3J A;  1LXD A;  3VH3 B;  4NNJ B;  1WZ0 A;  3VQI A;  4ASW C;  1WGH A;  2FIF A;  4JL9 A;  2FCN A;  4FJY A;  4PYZ A;  5E6P A;  1UGM A;  4MM3 A;  3WIM A;  4DWF A;  1VD2 A;  2G3Q B;  4DBG A;  3NY5 A;  4W9G A;  4HLE A;  2KDB A;  2MSE D;  2LXC A;  2WDT B;  2KC1 A;  2YVC A;  3LJ3 A;  4NJ7 A;  3ML9 A;  1H8C A;  1WZ3 A;  2KMA A;  3L17 A;  3PRP B;  4FJZ A;  1WE7 A;  3QA8 A;  3AI5 A;  4II2 B;  4KDI C;  2DZJ A;  3RUI B;  3VAW A;  1RLF A;  2BYV E;  2NBV B;  4ZDV A;  1LM8 B;  1WR1 A;  2CKH B;  2K8H A;  1UEL A;  4MSM B;  1WRD B;  1XQQ A;  3SU8 X;  1Q0W B;  2QHO A;  2FCQ A;  4I6L B;  2KOX A;  1YX5 B;  3JYU A;  3TMP B;  1WMH A;  3RCZ A;  3DVN V;  3VVW B;  2WX0 A;  3A1Q B;  5AZF A;  4AUQ C;  3A9J A;  3GZN I;  1TTN A;  2DYM A;  1V5O A;  2BKR B;  4MGI E;  2GBM A;  2G4D B;  4PS7 A;  2JWZ A;  2CHX A;  5JZE B;  3DQV A;  2IYD B;  5BO4 B;  4BFR A;  1K8R B;  2MA9 B;  4ANV A;  4B95 A;  1WJU A;  4BKS D;  5HKH A;  2BPS A;  2ZPN A;  4WJO A;  4FLH A;  1E8Y A;  4LJP B;  2L76 A;  2DX5 B;  5JHB A;  2GMI C;  2K25 A;  1C3T A;  2M0X A;  3KUC B;  1YD8 U;  5CHV C;  4X57 B;  2JUO A;  4HVB A;  4AP4 C;  3R7Q A;  2J7Q B;  2C7N B;  4EZJ A;  3PZD A;  3ZNH B;  4A3P A;  3DPD A;  2G4S A;  2MWS B;  1LQB A;  4MDK E;  4FN2 A;  4LDT D;  3TJP A;  1C1Y B;  2KWC A;  2L0T A;  4WAA A;  3V6E B;  3VFK A;  3ZUN A;  2KFK A;  3A9J B;  1J8C A;  3A1Q A;  4FUL A;  4HJK A;  4W9I A;  4ANX A;  2O2V B;  3SD5 A;  1UZX B;  2G45 B;  3R66 C;  3UIO B;  4EZL A;  2K8C A;  2XEW A;  3QAQ A;  3DVG X;  3VHT C;  2LI5 A;  3CMM B;  4B6W A;  2AEH A;  3HIZ A;  2GBR A;  1KM7 A;  3KUD B;  4IC7 B;  3VXW A;  3A4R A;  3KYC D;  2JXX A;  2AWT A;  4WJN A;  1YQB A;  2IY0 B;  3V62 A;  3A9K B;  4PS3 A;  1WX9 A;  2HD5 B;  3PLU A;  1UD7 A;  3A4S C;  4EKU A;  2LXA A;  3P2B A;  4HPM B;  1P0R A;  2BF8 B;  1WX8 A;  1F9J A;  1LFD A;  2D11 A;  4TV3 A;  2ZVN A;  4TQ1 A;  1WGR A;  1V49 A;  2LAS A;  4KZ0 A;  3WAL A;  2YLM A;  3B0A A;  2LWP A;  3M3J A;  1A5R A;  1GJZ A;  1M94 A;  3U8Z A;  2KQ7 A;  3QC8 B;  2AL3 A;  3QAR A;  4GDK B;  4PYU A;  2C7H A;  2GBJ A;  2V4L A;  1CMX B;  3VTW A;  1QZE A;  3ZDM C;  2KMC A;  1V9J A;  2LUE A;  3QK0 A;  4JGH B;  2N7E A;  3I3T B;  2ZVO A;  4MJS B;  2REX A;  2CHW A;  2KK8 A;  2FAZ A;  2GBK A;  3ECI A;  3L13 A;  3WAM A;  1WM2 A;  4NAW A;  2NBU A;  5DCN A;  3RZW C;  2LVP A;  4ICU A;  1OEY A;  4HWI B;  3V60 A;  2VRR B;  3U7D A;  4I6P A;  2IZV B;  3OAW A;  3APD A;  1BT0 A;  3PVL A;  3SHQ A;  3ZIM A;  4DK5 A;  2KXJ A;  4DDI D;  3EHV A;  4FHK A;  3ZRC A;  2FNJ B;  4EUT A;  3VUY A;  1RFA A;  4CO7 A;  3PHX B;  3JW0 X;  2D3G A;  2GOW A;  3Q3F A;  3TIX A;  3CSF A;  3QQ8 B;  2JVC A;  3MJW A;  4JLC A;  2KQS A;  2KC2 A;  2Z0E B;  3ZKJ C;  4W9E A;  1R4N I;  3W1S A;  3H7S A;  3UIN B;  2BWF A;  1P98 A;  4GGQ A;  3RD2 A;  1P1A A;  3WAP A;  2FUH B;  4MGZ E;  3HM6 X;  4A20 A;  3UQB A;  1E8X A;  1V2Y A;  1WXV A;  4URK A;  1IP9 A;  3NZU A;  4GIV A;  3EFU A;  3UQA A;  1WYW B;  1EF5 A;  2C5L C;  3UIP B;  4NJ6 A;  4GDL A;  2EKE C;  2I1K A;  2OJR A;  1NI2 A;  3V6C B;  2LZ6 A;  2OOB B;  4AJW A;  5E6O A;  3GOE A;  2RPQ A;  3RZF A;  4K7W A;  4IWO A;  1YIW A;  1D3Z A;  1RAX A;  5D94 A;  2DEN B;  3EC8 A;  5L95 C;  2J0K A;  4KIK B;  3RYT A;  4BKT A;  2ZNV C;  4XC2 A;  4TKN A;  2UYZ B;  2LJ5 A;  2KO3 A;  3DOW A;  1WJ4 A;  2DZK A;  4IW0 A;  3PS6 A;  4E71 A;  3KW5 B;  4DHJ D;  3ZNG C;  2FCS A;  5G2N A;  2IY1 B;  3JVZ X;  2NS5 A;  3PGE A;  3H1U A;  2CS4 A;  3JSV B;  2KD0 A;  5G55 A;  3B08 A;  4MGK E;  2DZI A;  3IG3 A;  1WXM A;  5E6N A;  2KJR A;  2XK5 B;  2KLC A;  4FA6 A;  2NVU I;  3M62 B;  2K8B A;  3A33 B;  5D7G A;  1Z5S B;  2ASQ A;  2KNB A;  2MBB B;  3L08 A;  4KV2 A;  1S3S G;  3V61 A;  3RUL A;  2M8S A;  3N32 A;  3OLM D;  2XK5 A;  3KVF B;  3M63 B;  4KSL C;  3N30 A;  2KWV B;  5AZG A;  2WWZ A;  1IYF A;  2AL6 A;  4AJY B;  3JSV A;  4W9K A;  5IA7 A;  2UWQ A;  4IM3 A;  2ZEQ A;  4HXD A;  3H6N A;  4W9F A;  3VH4 B;  4TUU A;  2KDF B;  4KDL B;  4G11 A;  2PPH A;  1PQS A;  3OJ4 B;  1TZ1 A;  3D32 A;  2D10 A;  2EMT A;  1UH6 A;  4ZRK A;  3AU5 A;  3CF6 E;  4W9J A;  4RM9 A;  3X0W A;  4F1S A;  5CX3 A;  2ZJD A;  3K9P B;  2LRW A;  2MRP A;  3ZDT A;  2Z59 B;  3ONS A;  4MJS A;  4F7Z A;  2N9P C;  3DBS A;  4DHJ B;  2D07 B;  2IO1 B;  2KJ6 A;  1S1Q B;  2L05 A;  2RD0 A;  2ZPY A;  3IBE A;  3ALB A;  4GN1 A;  4JQW C;  3PPA A;  5JHA A;  3QIJ A;  1GNU A;  3HM3 A;  3IVF A;  3W1S C;  2KKC A;  2KJH B;  4K81 A;  1T0Y A;  2MBE A;  3VDZ A;  4ICV A;  3L54 A;  1WR6 E;  4WJQ A;  3M95 A;  1ZGU B;  3KYD D;  4YL8 A;  1WXA A;  3MHS D;  3ZRF A;  2A4Z A;  5LLI A;  3A9K A;  4GXB A;  1SGH A;  3K9O B;  2K6D B;  3KH0 A;  1TGZ B;  2M17 A;  5TR5 A;  2DZM A;  3BIN A;  4BOZ B;  4XZ4 A;  4W9D A;  4B9K A;  4LCD E;  3L0W B;  4BKS A;  1WE6 A;  2IO3 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...