2KWCA

The nmr structure of the autophagy-related protein atg8
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
116
structure length
116
Chain Sequence
MKSTFKSEYPFEKRKAESERIADRFPNRIPVICEKAEKSDIPEIDKRKYLVPADLTVGQFVYVIRKRIMLPPEKAIFIFVNDTLPPTAALMSAIYQEHKDKDGFLYVTYSGENTFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The NMR structure of the autophagy-related protein Atg8
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
molecule keywords Autophagy-related protein 8
total genus 18
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2010-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2kwcA00
2BPSA 1J8CA 5AZHA 2KZRA 1YIWA 3A4SC 1KOTA 3QHTA 3HIZA 4GN1A 4FULA 2MP2B 2MW5A 3NZSA 5D6JB 3DQVA 4EFOA 4HVBA 3AULA 2KJRA 3RZWC 4GOCA 2AWTA 1XQQA 2KFKA 3NS8A 3R7RA 4HLEA 1V80A 3VFKA 1SGHA 3WANA 3PS6A 5KHOA 2ZVOA 3QARA 4W9EA 4BKGA 1GC6A 2CKHB 1R4MI 2CHXA 1GG3A 4XX5A 1WIAA 3N32A 4I6NB 2C7NB 4II3B 4KIKB 2N7DA 1WM3A 1KLVA 4GSWA 3A33B 5J17A 2OJRA 2KFJA 4ANWA 3KH0A 1WJ4A 2Z0DB 3AXCA 5G55A 1GUAB 4M8NA 1UD7A 3H9DA 4WJNA 2ZNVB 2DYMA 3WA0A 2DX5B 2LJ5A 1E7UA 5EDSA 4AOFA 2KANA 4J6IA 4FA6A 4G11A 3TMPB 2LGXA 4IUMB 4XC2A 2HD5B 2D07B 2D10A 5IA7A 3V6CB 3QA8A 1OEYA 1WGGA 3KUZA 3V60A 3DVNU 3V62A 4W9LA 3UF8A 4LJPB 2B3AA 2ZPNA 3DBSA 4E71A 2KMAA 3ZNZB 3JW0X 4BBNC 1OTRB 3CF6E 1WXMA 2L3ZA 2REXA 2DZJA 2CU1A 1WMHA 4FJVB 4MH0E 1LXDA 4DDGD 3APFA 4KSKC 4W9HA 2N1WA 5CHVC 2KJ6A 3RCZA 2MWSB 2JZ3B 2KDIA 3JSVA 3MHSD 2IBIB 1V5OA 4NJ7A 2O6VA 3ZIMA 4ZRJA 2L76A 2V3SA 1OEYJ 3NOBA 2K1FA 1NDDA 3S2AA 2NPTB 4DHJD 2R2OA 2MP2A 4BOZB 2BWFA 3L13A 4FHJA 1OGWA 2M4NA 2KMCA 5GMVA 1SIFA 2BGFA 2KJHB 4MGKE 3SHQA 3ZO5B 2DAFA 2I1JA 4GIVA 4WQOB 3ZVVA 4IM0A 3B1LX 1WF9A 3M95A 4GDLB 1A5RA 1PQSA 3VUWA 3UGBB 4ZRKA 4KVGB 2G4DB 4W9DA 4II2B 2J0KA 3VH3B 4W9IA 3SU8X 3ZDTA 4FADA 4JL9A 3AI5A 3A4RA 4BKSD 4DXAB 4EZKA 3PVLA 3K9PB 2GOWA 2XK5A 3TBLD 5L83A 1CMXB 1UGMA 1V6EA 3PSEB 1RLFA 2DZMA 3R7QA 3PHWB 3EC8A 2KLGA 2Z0EB 4PYUA 2MBHA 4PS7A 4ASWC 2KO3A 2IZVB 2L05A 2KHWB 4IG7B 1RFAA 1Z5SB 2L7RA 1WGYA 1WX7A 4TUUA 3KYDD 3JVZX 5LXHA 4W9KA 4AUQC 2AYOB 4IM3A 3UQBA 3CSTA 2N9XA 3PGEA 2LI5A 4K7SA 3HM3A 4E3CA 2FNJB 3VTVA 1UH6A 2JVCA 1WMHB 1GJZA 4EZLA 4HXDA 1XD3B 3R3MA 2LZ6A 2A5UA 3V61A 2J0MA 4IWQA 4K1RB 1WE7A 5DPRA 5JZEB 4G3XB 3VXWA 2GBRA 2KQ7A 2O6VB 1WFYA 3H7SA 4AJWA 4DHJB 5IAAC 2NPTA 4K81A 2R2QA 3M63B 3VUXA 1QZEA 3ENEA 4K7UA 4FJYA 3HHMA 2Z59B 3DDCB 2GMIC 1YD8U 1V81A 1YX5B 3VVWB 4OVVA 2A4ZA 3DOWA 2NS5A 4NPNA 1Z2MA 4NJ6A 2RR9A 2LGDA 4I6LB 2NCNA 3RZFA 4TQ0A 1VD2A 1WJ6A 2O2VB 1TZ1A 2KTRB 3PRMB 4HK2A 2MBBB 2RPQA 3B08A 4EKUA 2KVRA 2MA9B 2IO0B 4AWJA 4W9FA 3EECA 4HPMB 4F7ZA 2KWUB 1WXVA 2KK8A 4MDKE 5D7GA 2QHOA 2AEHA 2LVOA 2D2QA 3I3TB 3K9OB 1P98A 3IFWB 3PRZA 4NAWA 4WJPA 3N3KB 3SD5A 2LWPA 2LASA 1WGHA 2HE7A 1MG8A 2WDTB 2BKFA 4KV2A 2EMTA 3DVNV 4ICVA 3OJ3A 1C1YB 4RMAA 2FUHB 3DCGA 3H7PA 2GBJA 1P3QU 4M0WB 1AARA 2AL3A 4WWOA 3X0WA 1RRBA 1NBFC 1WXAA 3WALA 1WE6A 2VRRB 2MCNB 4EEWA 1UBQA 1R4NI 3H6NA 1M94A 2K6DB 4FJZA 5CHFA 1I35A 1Q1OA 4OVUA 5KHQA 3ZRCA 2UYZB 3TCAA 3PLUA 2LRUA 2WYQA 1E8XA 3IG3A 1EUVB 4XZ4A 5D2MB 2LGYA 3ZNGC 4GU2A 5E6PA 2FAZA 4WWNA 1WRDB 3Q3FA 2YVCA 3DBRI 1EO6A 3P2BA 4K7WA 2W9NA 3R66C 3GZNI 3ZNHB 2FCNA 3OAWA 3ZW3A 2CHZA 1L2NA 2ZNVC 1TGZB 4GB9A 2V4LA 1UBIA 3ZTDA 3B0AA 1V86A 1WX8A 1TBEA 2MSED 1WJUA 2D11A 4GMVA 4EOYA 4BBNF 2LXCA 2IY0B 3L16A 4HDQA 4A3PA 1XT9B 3APCA 3H1UA 2KD0A 4BOSC 2WWZA 3D32A 3QWZB 1E8WA 1WYWB 2KDFB 3ZNID 4HCPB 2UWQA 4LJOB 2O2VA 2BF8B 4DHZB 4DWFA 3GOEA 4PS8A 3UIOB 2PJHA 3V6EB 2KX0A 3TIXA 2NVUI 2MLBA 4LCDE 1S3SG 4FHKA 4HPLB 2JY6A 3ZDMC 1IPGA 2L8JA 5DPWA 2IY1B 1E90A 1BT0A 4MELA 5AZGA 2D3GA 4DDID 3L17A 4MSQB 3ZUNA 4EUTA 4GDLA 3A1QB 4KZ0A 4IM2A 4JIOU 3VDZA 4WWPA 3QC8B 3WAOA 4A3OA 2K25A 4MJSA 5DPTA 3PHXB 3HK0A 5BO4B 4RM8A 1ISNA 1UELA 3H7PB 4IW0A 3VQIA 1V9JA 1E7VA 1SE9A 2LXAA 3ALBA 3DPDA 2MRPA 3VUYA 2FCQA 2JUOA 5J18A 4JLCA 3MJWA 4PS3A 2AL6A 2XK5B 4HWIB 2FCSA 4URKA 2GBNA 5LXIB 2MBEA 2MBOA 2KDEB 3AU4A 3NZUA 2WX1A 3DBHI 3PTFC 1P9DU 4NNJB 2K6QA 5AZFA 2XBBC 2LVPA 2NBVB 3A9JB 2KTFA 3Q3JA 2KN5A 1YQBA 5C23A 2NR2A 4IWOA 2ZCCA 3ECIA 1T0YA 4ZRIA 2K39A 4I6PA 2MBQA 5AEKB 2LRWA 2K8BA 1P1AA 4A20A 1LFDA 2N4FA 4KDLB 4MSMB 5JHBA 2V1YA 5FR6A 2EKEC 1WGDA 5CHWA 1RAXA 2JT4B 5CTRC 4NY0A 2J7QB 2JPHA 3BINA 3QX1A 1EF5A 3N30A 3M3JA 4LDTD 2IO3B 4KZCA 3BY4B 3HM6X 1ZW7A 4GXBA 3L08A 2JRHA 3LJ3A 2ZCBA 3U8ZA 2PE6B 2KQSA 4WJOA 1KJTA 3ZKJC 2IO2B 2RSUA 2C60A 3PPAA 3AU5A 1V49A 4X57B 3L10B 2DAJA 2PPHA 5J2RA 1J0GA 4BFRA 1UZXB 1ZKHA 1WGRA 2JXXA 3A9KA 2N1VA 1HE8A 4MEMA 2DYOA 2ZPYA 1VCBA 2FIDA 4HDOA 1F9JA 3T9LA 2BKRB 3KYCD 3QCAA 5TR5A 2BWES 2G45B 1YJ1A 2KXJA 2C7HA 4BVUC 2GBKA 4HCNB 4NQKE 4WAAA 1JRUA 2BYVE 3QK0A 2PE9A 3U30A 1WJNA 4E74A 2KTRA 2N9PC 4B9KA 2JF5A 3A1QA 3VTWA 2K8HA 4IC7B 5G2NA 3APDA 2IYDB 1Q5WB 4KSLC 3QQ8B 2M17A 2MX2A 4MJSB 1V5TA 2NBWB 1YX6B 2ZEQA 4AJYB 3VTUA 4ANVA 2DZKA 4NAWB 3UQAA 5E6NA 3WIMA 1EF1A 4CO7A 2I1KA 4EZJA 3QIJA 2KOXA 3PV1A 4ZDVA 3RT3B 4GDKB 1LM8B 4MGZE 2L0TA 2ZZPB 3OJ4B 3PRPB 3KVFB 3WAMA 2KX3A 2JWZA 4P7IA 4AP4C 2GBMA 3DVGY 1WR1A 3W1YA 3KUCB 5DCNA 1WM2A 3MTNB 3W1SC 3PZDA 2C9WB 2G3QB 4JGHB 5L95C 4F8CB 4LDTB 2HTHA 1H4RA 1E8YA 4G0NB 5CX3A 2FCMA 3L54A 3TJPA 1E5WA 4DHZE 2C5LC 1IYFA 4FN2A 3JSVB 2KNBA 2M1MA 5JH5C 1WZ0A 1KM7A 2PEAA 3O65B 3PLVA 4IWPA 1WI0A 5HKHA 4W9CA 3U7DA 3ML9A 1WR6E 5D94A 2BYEA 2RD0A 5E6OA 3IBEA 3PREA 3VH4B 4B6WA 4FBJB 4N9F4 3UIPB 3A9KB 2M8SA 4ZYNA 3DBLI 1Y8RC 1E8ZA 5C1ZA 2DHZA 3M62B 2KC1A 1GC7A 1NI2A 2KWVB 3ML8A 3PT2B 3EFUA 2JRIB 4RM9A 3W1SA 3IVFA 1OQYA 1C3TA 2N9EB 4JQWC 3VHTC 1G6JA 4F1SA 3RYTA 4WJQA 2YLMA 1Q0WB 2N7EA 2KFKB 4MGYE 2WX0A 3QAQA 2BYFA 2O6VD 2C7MB 4HJKA 4YL8A 1K8RB 2DYBA 2FIFA 4MGIE 4NQLB 2CS4A 4CYEA 2NBUA 3C0RB 5DPSA 3T8MA 1P0RA 3ZLZA 4ANXA 1WH3A 1WZ3A 3L0WB 3CMMB 2KC2A 3RD2A 2KDBA 4BKSA 3VAWA 4ANUA 3TL5A 3DVGX 2Y5BB 2ASQA 1GNUA 1FXTB 1IP9A 4CHKA 3OLMD 3IHPC 2KLCA 1I42A 2DZIA 2DENB 4KIKA 4DK5A 2G4SA 3X23A 2KKCA 2L0FA 2LD9A 3JYUA 4PYZA 3KW5B 4GGQA 2ZJDA 2OOBB 4GDKA 2CHWA 3NHEB 4FLHA 2KWCA 5JHAA 1U4AA 3RUIB 1D3ZA 1WY8A 2ZVNA 2MQJA 2JZZA 4TQ1A 3ZTCA 2CR5A 1X1MA 2RGFA 3WAPA 3ZRFA 4BKTA 3QJZA 1H8CA 3EHVA 1S1QB 1TTNA 3A9JA 3CSFA 3UINB 1ZGUB 2EMSA 3LDZE 3SDLC 4B95A 4G50A 4TV3A 3NY5A 4DBGA 2M0XA 4M8MA 2L00B 2HJ8A 2LUEA 2LVQA 3RULA 1J19A 2XEWA 1V2YA 5LLIA 4KDIC 2IO1B 3ONSA 1LQBA 1WXSA 4W9GA 4MM3A 4TKNA 4ICUA 2K8CA 3KUDB 1WX9A 2J0JA 4W9JA 1L7YA
chains in the Genus database with same CATH superfamily
3RNGC 3RMKC 1HTQA 5EE3A 3HIZA 3NZSA 4HVBA 1XQQA 1JW9D 4HLEA 1V80A 4ZHPA 1HTOA 1AN8A 3QARA 1C78A 1GC6A 3ZGZA 2CKHB 1R4MI 1STEA 1MG4A 1WIAA 3N32A 4C80A 2FUG1 2N7DA 1GUAB 3H9DA 4WJNA 2ZNVB 2RDBC 4AOFA 4G11A 2PMVA 3LYYA 3V6CB 1BXTA 1WGGA 3V60A 4W9LA 3HRDD 4HRSA 3AN1A 3ZNZB 3RFZB 1YQ3B 1FFUA 1TT5B 4C00A 4FJVB 3DBRB 4RGTA 4DDGD 2NTSA 2KJ6A 4OZCA 2JZ3B 2KDIA 4ARIA 2IBIB 4DXFA 3AE2B 1E9MA 1F2RI 2MJDA 2L76A 2R2OA 1OGWA 2M4NA 1M4VA 1F1HA 3SHQA 4B0EA 2DAFA 3MC0B 1QILA 4IM0A 1A5RA 4P1CC 2E3TA 3UGBB 4KVGB 2G4DB 2GB1A 4II2B 1N5WA 3TEWA 4C4VA 3VH3B 3ZJUA 3ZDTA 3A4RA 3PVLA 3TBLD 1VZ7A 3MHZA 1WWTA 1N60A 4YWGG 1V6EA 3R7QA 4PYUA 2KLGA 3RI7C 4D2KA 2BTEA 3VRAB 2MBHA 4P16A 2KT7A 4M0WA 2KO3A 4ASWC 2KHWB 3I57A 1WGYA 2NTTA 3JVZX 1TIFA 4AUQC 4IM3A 1N62A 4E3CA 2EKIA 1UH6A 2KMMA 3MC8A 4OW0A 3E9SA 4EZLA 1C9FA 2OHFA 4YTMB 4AJWA 1JMLA 1QZEA 3ENEA 4K7UA 4FJYA 3HHMA 2JXTA 4WAFA 3DDCB 1YD8U 1V81A 1YX5B 3VVWB 4OVVA 2A4ZA 5IKCM 2B76B 3PRMB 2KTRB 2KVRA 2MA9B 4W9FA 2WP9B 2QHOA 2AEHA 1GPXA 4LLGM 4NAWA 3PRZA 4WJPA 3SD5A 2D3AA 4YSYB 2HE7A 4A90A 2WDTB 2BKFA 4KV2A 5G5GA 3DCGA 2H89B 2V4IB 1K53A 1JWAD 1NBFC 3U2SC 3RNEC 4WWMA 2MCNB 3H6NA 2K6DB 4FJZA 1I35A 4OVUA 3NZ3A 2EELA 2LRUA 2BYTA 3IG3A 1EUVB 3VR9B 1V1PB 2M56B 1V1OA 1JRPA 3ZNHB 2V9HA 3OAWA 4LNKA 1TGZB 4GB9A 1MHXA 4GMVA 4YTNB 4US9A 1XT9B 3APCA 4FXCA 3RNBC 1RYJA 2KD0A 1D5XC 1QLBB 1TKGA 2O2VA 4DHZB 4DWFA 3UIOB 2PJHA 2XNAC 4LCDE 1L0XB 4XE0A 3TEZA 3L17A 4GDLA 4OZAA 4IM2A 3WAOA 3HK0A 1N6ZA 1TY0A 3W9CB 3VQIA 1V9JA 2MJEA 2FCQA 4PS3A 4HWIB 2FCSA 2GBNA 5AUIA 2MBOA 3DBHI 3PTFC 3SEBA 2K6QA 2XBBC 2KTFA 4ZYSA 1YQBA 5C23A 1T0YA 4I6PA 2MBQA 5AEKB 2K8BA 5I4DA 1KH0A 2BS4B 1RAXA 3QX1A 1EF5A 3N30A 2GI9A 1MVKA 5H92C 1VJKA 4WJOA 3ZKJC 3AU5A 3L10B 1UZXB 1ZKHA 1CK1A 1HE8A 1VCBA 3T9LA 1LGRA 3QCAA 1QT9A 3I5JC 2D3BA 2G45B 1YJ1A 2IJ0A 2C7HA 2K5PA 4NQKE 4RGMA 2BYVE 2AQ1B 2PE9A 3U30A 2KTRA 2N9PC 1AW7A 2K8HA 3APDA 1Q5WB 3UI3A 3QQ8B 3AEDB 2WNMA 2G1EA 2CJNA 4ANVA 1CZPA 5IO9A 4NAWB 3UQAA 5E6NA 4CO7A 1EF1A 2I1KA 4AQ7A 4EZJA 4JWSC 3QIJA 1FRDA 2KOXA 4OVZA 1OQRA 4HJGE 4A8XC 4MGZE 2L0TA 2HDEA 3KVFB 4P6VF 5GXGB 3Q3NC 3BYTB 3Q8AA 3DHGC 4WURA 2BBCA 3KUCB 1JROA 5DCNA 3PZDA 2G3QB 4LDTB 1HEZE 1E8YA 3P4PB 4G0NB 4M02A 2FCMA 2N9KA 1V8CA 1E5WA 2YEPB 2C5LC 2M1MA 5JH5C 1WZ0A 2Y3AA 5HKHA 1WR6E 1YOVB 2BYEA 1XLOA 2VZKD 4ZYNA 3DBLI 1Y8RC 3KLSX 1N63A 1RFKA 1SE4A 2KC1A 2JRIB 1OQYA 1SXTA 1EWYC 3RYTA 2N7EA 4MGYE 2L83A 3QAQA 2WX0A 5FKAC 4HKQA 2C7MB 4YL8A 1K8RB 1ZOYB 2FIFA 2CS4A 4CYEA 1ZP0B 1I4RA 1P7FA 3BK1A 3BVMA 1YNTE 1FRRA 4L2YA 2WXOA 2I38A 3VAWA 4ANUA 3TL5A 1Q10A 2WDRB 4DK5A 3X23A 2KKCA 3KWVA 2LD9A 4AS1A 2I2YA 4GDKA 2WDQB 5JHAA 1D3ZA 1WY8A 2ZW0A 2E6XA 2V3NA 1X1MA 1PGBA 1TTNA 1VLBA 2JQRB 3E56A 4B95A 3NY5A 5EE1A 2M0XA 4M8MA 3N9YC 2L00B 4UDUC 3Q6BA 4KDIC 1SE3A 2PTLA 4W9GA 4TKNA 4ICUA 2K8CA 2J0JA 1L7YA 2BPSA 1YIWA 3R2TA 1KOTA 3NVVA 4EFOA 3RZWC 5FK9C 3VFKA 1PYWD 1SGHA 3WANA 5KHOA 3IT4B 2ZVOA 3WCQA 1I4PA 4I6NB 2C7NB 3NVZA 4II3B 4KIKB 3SFEB 1BUIC 1NVID 2OJRA 3AE6B 3AE7B 3Q3MC 1UD7A 2TSSA 4JX1C 1XLNA 3TMPB 2D10A 2KDMA 4EE2A 3QA8A 1OEYA 3GS2A 3KUZA 2W82A 3DVNU 3AEAB 4IKGA 4E71A 1V1PA 1FXAA 1WSPA 1WYGA 4BBNC 2L1AA 1OTRB 1WXMA 1B1ZA 4RNAA 2REXA 2DZJA 1WMHA 5IP4D 4MH0E 1LXDA 1JWMD 3RCZA 1FO4A 2MWSB 4RGNA 3MHSD 1V5OA 1TKEA 2RDHA 1OEYJ 2K1FA 3S2AA 3PZ7A 2MP2A 4BOZB 3L4PA 5BMIA 4WIPA 2QSDA 2V3PA 2LGIA 4LTUA 3ZO5B 2KWDA 2I1JA 4L23A 4WQOB 5C2TB 1E6EB 3ZVVA 3B1LX 3M95A 4GDLB 1JALA 3Q8EA 4W9DA 1C79A 3FC4A 1YN5A 3AEFB 1ESFA 2LGSA 4EZKA 1UGJA 3N1ZC 4LNOA 1UGMA 2WU2B 3EC8A 4PS7A 2IZVB 3KYDD 2XN9C 4W9KA 2J53A 2Y5CA 4JPSA 3UQBA 3CSTA 2N9XA 2FNJB 3P4QB 1OQQA 1GJZA 1XD3B 2VH1A 2VZKB 2BB5A 3I9V1 4IWQA 4K1RB 1WE7A 1ZDVA 5DPRA 2O6VB 3VUXA 3M63B 2Z59B 2FE8A 3N1YC 4XGAB 4I6LB 3RZFA 2NCNA 4TQ0A 3TEYA 1VD2A 5D3IB 2MBBB 3AE1B 4F7ZA 1EU3A 1JWBD 1T0QC 4MDKE 1F0ZA 5D7GA 2LVOA 2D2QA 1K50A 3K9OB 3IFWB 4USAA 1F77A 2J52A 1WGHA 2INCC 2WXMA 2GBJA 1P3QU 4P1BC 1D5ZC 2AL3A 4WWOA 3IAM1 1WXAA 1WE6A 2VRRB 4EEWA 1T3QA 5CHFA 1F2RC 2V0GA 4XYCA 3ZRCA 3PLUA 2WYQA 1JCKB 4ACFA 3P42A 3ZNGC 1ET6A 4NAMA 3URYA 3Q3FA 3P2BA 4K7WA 3AECB 3P4SB 2FCNA 3I63C 2BB6A 2CHZA 3RN9C 2JX5A 3MJ5A 3ZTDA 4EOYA 4HDQA 4A3PA 3RNFC 1NENB 3H1UA 4BOSC 1E8WA 1WYWB 3ZNID 2UWQA 4LJOB 2BF8B 1TS4A 2K9XA 4PS8A 3AE9B 3GE8C 2KX0A 2NVUI 3AE8B 2MLBA 5C3JB 1T5XD 1TS2A 2IY1B 4MELA 5DPWA 4DDID 2D3GA 4NZLB 2WU5B 3DHIC 4KZ0A 1VRAB 2MH7A 2BVCA 5BO4B 1UELA 3H7PB 4A55A 2GLSA 3DPDA 1PUTA 3U4EG 5J18A 2BQQA 2XK5B 2KDEB 1P9DU 5H8YE 2NBVB 4H2AA 2JU6X 3GZNB 3FKYA 1R4NB 3ECIA 2K39A 2N4FA 5JHBA 5E6JA 1KLUD 2N0SB 5FR3A 1TYGB 5BMHA 3NJTA 2JPHA 3BINA 3HM6X 1YJJA 2PE6B 2IO2B 3PPAA 2C60A 4X57B 1FCLA 1ET9A 5J2RA 4BFRA 2KQ4X 2JXXA 3A9KA 3FILB 2DYOA 2ZPYA 4HDOA 1F9JA 4BVUC 2GBKA 1JRUA 1WJNA 4E74A 4B9KA 3A1QA 3VTWA 2IYDB 4MJSB 1V5TA 2NBWB 3Q2AC 4AJYB 2DZKA 4RGOS 3Q3OC 2J42A 1N61A 1WXQA 4ZDVA 3RT3B 3OJ4B 3HVDA 1T0SC 3PRPB 2JWZA 4P7IA 4AP4C 3DVGY 3EFCA 1PFDA 2BT6A 2HTHA 3PZ8A 5CX3A 2M0AA 2MEKA 3TJPA 3TEXA 2WXRA 1IYFA 4FN2A 4NJCA 1I4GA 1V97A 4IWPA 3O65B 2L32A 3ML9A 2RD0A 4K3CA 3VH4B 4FBJB 4MM3B 3UIPB 3U52E 1WGKA 1IBXB 1E8ZA 2DHZA 3RNCC 3T3NA 3PT2B 4RM9A 2KWVB 3ML8A 4KKIA 4K3BA 3W1SA 1SIJA 3IVFA 1BMLC 4JQWC 4F1SA 1Q0WB 2KFKB 2JSVX 2JYTA 1KLGD 2NBUA 3C0RB 3T8MA 3ZLZA 1WZ3A 2WHIA 3J9CA 1E0ZA 3RD2A 2KDBA 1IGCA 1NI3A 4BKSA 3Q8CA 1FM0D 1T0RC 2LHDA 1L0YB 1GNUA 1C4AA 1IP9A 4CHKA 3OLMD 3IHPC 2G4SA 3JYUA 2ZJDA 4YTPB 3NHEB 4C7ZA 1U4AA 2ONQA 3ZJVA 2JZZA 2CR5A 1DOYA 4DXGA 3WAPA 3ZRFA 4BKTA 2LUMA 3BK2A 1A70A 4C56C 4C7YA 4US8A 4S0RA 2LVQA 5LLIA 3Q8FA 2IO1B 3ONSA 3B9JA 1AYFA 3IAS1 1XLPA 4W9JA 4WWPA 3AE3B 3BIID 3SR6A 1ACCA 1J8CA 5AZHA 1UWXA 4GN1A 4LK0M 5D6JB 3DQVA 2KJRA 4GOCA 2AWTA 1YMHE 1SF0A 1SBBB 2Y5PA 1ZDXA 3PS6A 4W9EA 4BKGA 1MJDA 2CHXA 3NUHB 1GG3A 2D5GA 4XX5A 4YSXB 1HZ5A 1ZUD2 3EGRA 1WM3A 1KLVA 4GSWA 3KH0A 5G55A 2PKOA 2DYMA 5EE0A 1TZOA 2DX5B 2LJ5A 2N7JA 5EDSA 4J6IA 4FA6A 2LGXA 2HD5B 2LJIA 2IGGA 4TMAB 2KVZA 2ZPNA 2KMAA 1T6BX 3JW0X 3LB8C 3Q8BA 1ROEA 1QOAA 3APFA 4W9HA 2N1WA 5CHVC 5HI1A 2MHJA 3P1MA 3NOBA 1NDDA 2NPTB 4DHJD 2BWFA 4FHJA 3MFGA 3RNAC 2KMCA 2BW2A 4GIVA 5EE9A 5BMGA 3LXFA 1WF9A 3PO0A 2G9HD 1SSNA 2J0KA 4M01A 4B0MA 3AEGB 4W9IA 1I7HA 4LNNA 4DXAB 3K9PB 2GOWA 2XK5A 1CMXB 2W55A 1L6VA 3PSEB 2DZMA 2K3UA 5T8IA 2L05A 1RFAA 1Z5SB 2L7RA 1WX7A 2SAKA 5LXHA 5MPOA 3C8YA 2AYOB 3PGEA 2LI5A 4TSSA 1J7BA 3AMZA 4KKJA 1WMHB 4HXDA 3R3MA 2K22A 2LZ6A 2A5UA 1YJIA 2J0MA 4G3XB 3VXWA 2GBRA 4PT5A 1WFYA 3H7SA 5IAAC 2WXPA 1KRHA 1TY2A 1QF6A 3DOWA 4NPNA 4NJ6A 2RR9A 2LGDA 2WLBA 2WXLA 4CQNA 2RPQA 4EKUA 3B08A 4AWJA 2WXJA 2KAJA 4HPMB 2KWUB 1WXVA 1D5MC 4C4VB 3I3TB 2KN4A 1VDVA 5IN7A 2LWPA 2LASA 1UWMA 1ENFA 1MG8A 2EMTA 5BYSA 4ICVA 1SB3C 3OJ3A 5IOIA 2FUHB 2JWUA 4JWUC 1R4MB 4M0WB 3GE3C 1RRBA 3WALA 1UBQA 1R4NI 2AX5A 3CWIA 1UF0A 2UYZB 2DBYA 1E8XA 4DQOC 4XZ4A 3N20C 5D2MB 2LGYA 4J3OD 4GU2A 2FAZA 4WWNA 2LFIA 1EO6A 3GZNI 1FMAD 2ZNVC 2DWQA 3B0AA 1V86A 1WX8A 1XCQL 2LXCA 4ARCA 2WWZA 3D32A 2WDVB 3Q69A 2KDFB 1UUPA 3V6EB 3TIXA 4FHKA 1ZPSA 2ACZB 2QIEB 1BT0A 2H88B 1TKYA 3ZUNA 4BAXA 4EUTA 1E10A 1P7EA 2INNE 3QC8B 3ZXVA 4A3OA 2QJLA 2K25A 1XF5L 5DPTA 3PHXB 1NYQA 4Q2JA 3FAHA 4N58A 1QOFA 1XXGA 2LXAA 3ALBA 2MRPA 3VUYA 2AQ2B 3MJWA 2AL6A 1GB1A 4URKA 1TJEA 2YEPF 5LXIB 3AU4A 1QKZA 2LVPA 2KN5A 3KWLA 4IWOA 1SJED 3AEEB 3BVGA 1P1AA 1LFDA 4KDLB 4MSMB 1XLQA 4R3DA 2V1YA 1WGDA 5CHWA 2JT4B 5CTRC 2J7QB 3WA0A 3BY4B 4GXBA 3L08A 2JRHA 3LJ3A 3U8ZA 2WXGA 3DHHC 2MJ3A 1C4CA 1R7SA 2PPHA 4HKZE 2GRIA 2BKRB 5TR5A 2BWES 2L52A 4WAAA 4HCNB 3AE5B 1UNSA 3ZJTA 3B2FA 4XDDA 1FCCC 4KSLC 2M17A 2MX2A 2N9LA 2ZEQA 3W2DA 1E7PB 1MPEA 4XDCA 4YSZB 3V05A 4HROA 4GDKB 1LM8B 2KX3A 2GBMA 1WR1A 3W5UB 1WM2A 2IGHA 1L4DB 3W1SC 2C9WB 2CU3A 4JGHB 4ZOHC 1H4RA 2RMMA 4ZRPA 3W5VB 4L1BA 3EA6A 2CJOA 1GOZA 3JSVB 4JE3B 1KM7A 1PGXA 5D94A 3IBEA 3TUOA 4N9F4 3A9KB 2M8SA 3M62B 1GC7A 1NI2A 1K51A 1J7CA 3KQ4A 4MH8A 3BZDB 1FNUA 4PK1A 2N9EB 1L6UA 3VHTC 3OG5A 4WH4A 4WJQA 2YLMA 2RPVA 2UU7A 2BYFA 2O6VD 4N6EB 2AQ3B 1XEEA 2SEBD 4NQLB 5LNK1 1MFWA 5DPSA 1P0RA 2LHEA 1WH3A 3L0WB 2KC2A 2BS2B 3N1XC 3DVGX 1F52A 2Y5BB 4A6QA 3T3OA 2KLCA 2DZIA 4KIKA 2QCZA 4PYZA 3KW5B 1N5XA 2CHWA 2KWCA 4KGRA 2MQJA 2IPKD 4RH6A 1S1QB 1TS5A 3A9JA 3UINB 2EMSA 4HEA1 4ITKA 4XWWA 3DBHB 2JZPA 1J19A 2XEWA 1FFVA 1GB4A 5G5HA 1PDXA 4KGSA 1WXSA 3AV8A 1DOXA 1WX9A 3AH7A 1RWSA 1YN3A 4BZAA 2KZRA 3A4SC 2WXFA 3QHTA 4FULA 2INDC 2MP2B 2MW5A 3AULA 3R7RA 2KFKA 3NS8A 1FD6A 1CQVA 1VR9A 1NEKB 3DWMA 3R8BA 3H8HA 5AUKA 1LO5D 3A33B 5J17A 2KFJA 4ANWA 2OEDA 1WJ4A 2RDGA 2Z0DB 3AXCA 4M8NA 1IGDA 1L0VB 3HUIA 2PLPA 1L4ZB 1E7UA 2WGSA 2KANA 4IUMB 4XC2A 2D07B 2LMCA 5IA7A 1L5PA 2INPE 3V62A 3UF8A 4LJPB 2B3AA 3DBSA 1D4BA 5BYQA 3CF6E 2L3ZA 4S17A 2LEKA 2CU1A 4KSKC 3NVYA 3JSVA 2PVOD 2QMTA 4NJ7A 2O6VA 3ZIMA 4ZRJA 2V3SA 1NYRA 1I4HA 3L13A 4ZHOA 5GMVA 1SIFA 2BGFA 2KJHB 4MGKE 4OHJA 4XWTA 1AWDA 1OFFA 2D3CA 3DBLB 1PQSA 3VUWA 2NMQA 4ZRKA 3DWGC 2QC8A 3ZYYX 2IDYA 2QEJC 3SU8X 4FADA 4JL9A 3AI5A 1C77A 4BKSD 1QOBA 1YN4A 5L83A 3MC9A 4GLSC 1GAQB 2WXKA 1RLFA 3PHWB 2Z0EB 1C76A 1FPYA 4IG7B 2ZW1A 2WS3B 4TUUA 2FBWB 1DGJA 4K7SA 1KTKA 3HM3A 3VTVA 3V3XA 3HVZA 1K52A 2JVCA 3GB1A 1JWUD 1QOGA 3V61A 5JZEB 1PGAA 2KQ7A 4DHJB 2ICIA 2KACA 3RPFC 2NPTA 4K81A 2R2QA 3VR8B 2WXQA 2GMIC 5HG2A 2NS5A 1Z2MA 3CIRB 1WJ6A 2O2VB 1TZ1A 4HK2A 2IO0B 3ABVB 2WXIA 3EECA 1C4PA 1VZ6A 3GP7A 2KK8A 1VZ8A 1P98A 3N3KB 3OWEB 1I4QA 3ZQ4A 3DVNV 1C1YB 4RMAA 5BYRA 4RF0A 4KGTA 3H7PA 3NRZA 1AARA 2K0PA 1FNVA 3P4RB 3X0WA 2PVGC 5HHDG 3ETRA 1M94A 1J7AA 2KYWA 1Q1OA 5KHQA 4YXDB 1DYQA 3TCAA 3AE4B 1FNWA 5E6PA 1WRDB 2YVCA 3DBRI 4LNFA 1SJHD 2W9NA 3R66C 3ZW3A 4MT5A 1L2NA 2V4LA 1UBIA 2QDFA 1TS3A 1TBEA 2MSED 1WJUA 2D11A 5D3DA 4BBNF 3BVZA 2IY0B 3L16A 4M00A 2VH2A 3QWZB 4HCPB 3GOEA 2PIAA 3FILA 2WXHA 2W54A 2HJ1A 3Q14C 1S3SG 2DNFA 2WQYB 4HPLB 1Y56A 4IDIA 1HXYD 2JY6A 1IPGA 2L8JA 3AEBB 3ZDMC 1E90A 5AZGA 4LNIA 4MSQB 1EM7A 3A1QB 3VDZA 4JIOU 2W3SA 1B9RA 4MJSA 2W3RA 3U7ZA 1HZ6A 4RM8A 1ISNA 4IW0A 1E7VA 1SE9A 2JUOA 4JLCA 5TSSA 2J4XA 2MBEA 3NZUA 2WX1A 3R2IA 4QAYA 4NNJB 5AZFA 3A9JB 3Q3JA 2X8XX 1XO3A 2NR2A 2ZCCA 4ZRIA 2LRWA 3AB5A 4A20A 5FR6A 2EKEC 4ZRQA 4NY0A 3M3JA 4LDTD 1EWCA 2IO3B 4KZCA 2R61A 1ZW7A 2OJWA 2ZCBA 3SFDB 2KQSA 1KJTA 2RSUA 1V49A 1FIQA 2DAJA 2PW9A 1J0GA 4RCOA 1WGRA 4MEMA 1MHHE 2N1VA 2FIDA 1IBXA 3NS1A 3KYCD 2JYEA 3EUB2 2KXJA 2X38A 4HPPA 3QK0A 3C19A 2JF5A 4YT0B 4IC7B 4REZA 5G2NA 1ZXHA 1KFYB 4RFBA 1SEBD 1YX6B 3VTUA 1JWSD 3WIMA 1EU4A 1YQ4B 3IT6B 2BS3B 4A9AA 3PV1A 2Z8LA 4MACA 2WXNA 2ZZPB 1IUEA 3WAMA 1SE2A 3BYYB 3W1YA 1HQRD 2DLBA 3MTNB 3ZXRA 3BWUD 5L95C 4F8CB 5JXVA 3L54A 1FXIA 2IGDA 4DHZE 1KF6B 2KNBA 1CJEA 2PEAA 3PLVA 1WI0A 4N59A 4W9CA 3U7DA 5E6OA 3PREA 4B6WA 5C1ZA 3P63A 3AM9A 3EFUA 2Q5WD 3B2GA 1C3TA 4KX6B 1G6JA 1ZXIA 1QQRA 1RM6C 3O13A 1D6EC 4OZBA 3NG0A 2M19A 4HJKA 2DYBA 4MGIE 3TSSA 4ANXA 3MP9A 3IXSA 3CMMB 2ON8A 2ASQA 1ZE3D 1FXTB 1I42A 1WRIA 2DENB 2L0FA 4O1NA 4GGQA 2OOBB 4FLHA 4IOIE 3RUIB 4WQMA 2ZVNA 4TQ1A 3ZTCA 5HFYA 2RGFA 4RF1A 3QJZA 1H8CA 1XCTL 3EHVA 3CSFA 1HA5A 1ZGUB 3LDZE 3SDLC 2HTME 1I4XA 4G50A 3VRBB 4TV3A 4DBGA 1MI0A 2QILA 1JQ4A 1FEHA 3NVWA 2HJ8A 2LUEA 3RULA 1DOIA 1V2YA 1LQBA 4MM3A 3KUDB
chains in the Genus database with same CATH topology
2BPSA 1J8CA 5AZHA 2KZRA 1YIWA 3A4SC 1KOTA 3QHTA 3HIZA 4GN1A 4FULA 2MP2B 2MW5A 3NZSA 5D6JB 3DQVA 4EFOA 4HVBA 3AULA 2KJRA 3RZWC 4GOCA 2AWTA 1XQQA 2KFKA 3NS8A 3R7RA 4HLEA 1V80A 3VFKA 1SGHA 3WANA 3PS6A 5KHOA 2ZVOA 3QARA 4W9EA 4BKGA 1GC6A 2CKHB 1R4MI 2CHXA 1GG3A 4XX5A 1WIAA 3N32A 4I6NB 2C7NB 4II3B 4KIKB 2N7DA 1WM3A 1KLVA 4GSWA 3A33B 5J17A 2OJRA 2KFJA 4ANWA 3KH0A 1WJ4A 2Z0DB 3AXCA 5G55A 1GUAB 4M8NA 1UD7A 3H9DA 4WJNA 2ZNVB 2DYMA 3WA0A 2DX5B 2LJ5A 1E7UA 5EDSA 4AOFA 2KANA 4J6IA 4FA6A 4G11A 3TMPB 2LGXA 4IUMB 4XC2A 2HD5B 2D07B 2D10A 5IA7A 3V6CB 3QA8A 1OEYA 1WGGA 3KUZA 3V60A 3DVNU 3V62A 4W9LA 3UF8A 4LJPB 2B3AA 2ZPNA 3DBSA 4E71A 2KMAA 3ZNZB 3JW0X 4BBNC 1OTRB 3CF6E 1WXMA 2L3ZA 2REXA 2DZJA 2CU1A 1WMHA 4FJVB 4MH0E 1LXDA 4DDGD 3APFA 4KSKC 4W9HA 2N1WA 5CHVC 2KJ6A 3RCZA 2MWSB 2JZ3B 2KDIA 3JSVA 3MHSD 2IBIB 1V5OA 4NJ7A 2O6VA 3ZIMA 4ZRJA 2L76A 2V3SA 1OEYJ 3NOBA 2K1FA 1NDDA 3S2AA 2NPTB 4DHJD 2R2OA 2MP2A 4BOZB 2BWFA 3L13A 4FHJA 1OGWA 2M4NA 2KMCA 5GMVA 1SIFA 2BGFA 2KJHB 4MGKE 3SHQA 3ZO5B 2DAFA 2I1JA 4GIVA 4WQOB 3ZVVA 4IM0A 3B1LX 1WF9A 3M95A 4GDLB 1A5RA 1PQSA 3VUWA 3UGBB 4ZRKA 4KVGB 2G4DB 4W9DA 4II2B 2J0KA 3VH3B 4W9IA 3SU8X 3ZDTA 4FADA 4JL9A 3AI5A 3A4RA 4BKSD 4DXAB 4EZKA 3PVLA 3K9PB 2GOWA 2XK5A 3TBLD 5L83A 1CMXB 1UGMA 1V6EA 3PSEB 1RLFA 2DZMA 3R7QA 3PHWB 3EC8A 2KLGA 2Z0EB 4PYUA 2MBHA 4PS7A 4ASWC 2KO3A 2IZVB 2L05A 2KHWB 4IG7B 1RFAA 1Z5SB 2L7RA 1WGYA 1WX7A 4TUUA 3KYDD 3JVZX 5LXHA 4W9KA 4AUQC 2AYOB 4IM3A 3UQBA 3CSTA 2N9XA 3PGEA 2LI5A 4K7SA 3HM3A 4E3CA 2FNJB 3VTVA 1UH6A 2JVCA 1WMHB 1GJZA 4EZLA 4HXDA 1XD3B 3R3MA 2LZ6A 2A5UA 3V61A 2J0MA 4IWQA 4K1RB 1WE7A 5DPRA 5JZEB 4G3XB 3VXWA 2GBRA 2KQ7A 2O6VB 1WFYA 3H7SA 4AJWA 4DHJB 5IAAC 2NPTA 4K81A 2R2QA 3M63B 3VUXA 1QZEA 3ENEA 4K7UA 4FJYA 3HHMA 2Z59B 3DDCB 2GMIC 1YD8U 1V81A 1YX5B 3VVWB 4OVVA 2A4ZA 3DOWA 2NS5A 4NPNA 1Z2MA 4NJ6A 2RR9A 2LGDA 4I6LB 2NCNA 3RZFA 4TQ0A 1VD2A 1WJ6A 2O2VB 1TZ1A 2KTRB 3PRMB 4HK2A 2MBBB 2RPQA 3B08A 4EKUA 2KVRA 2MA9B 2IO0B 4AWJA 4W9FA 3EECA 4HPMB 4F7ZA 2KWUB 1WXVA 2KK8A 4MDKE 5D7GA 2QHOA 2AEHA 2LVOA 2D2QA 3I3TB 3K9OB 1P98A 3IFWB 3PRZA 4NAWA 4WJPA 3N3KB 3SD5A 2LWPA 2LASA 1WGHA 2HE7A 1MG8A 2WDTB 2BKFA 4KV2A 2EMTA 3DVNV 4ICVA 3OJ3A 1C1YB 4RMAA 2FUHB 3DCGA 3H7PA 2GBJA 1P3QU 4M0WB 1AARA 2AL3A 4WWOA 3X0WA 1RRBA 1NBFC 1WXAA 3WALA 1WE6A 2VRRB 2MCNB 4EEWA 1UBQA 1R4NI 3H6NA 1M94A 2K6DB 4FJZA 5CHFA 1I35A 1Q1OA 4OVUA 5KHQA 3ZRCA 2UYZB 3TCAA 3PLUA 2LRUA 2WYQA 1E8XA 3IG3A 1EUVB 4XZ4A 5D2MB 2LGYA 3ZNGC 4GU2A 5E6PA 2FAZA 4WWNA 1WRDB 3Q3FA 2YVCA 3DBRI 1EO6A 3P2BA 4K7WA 2W9NA 3R66C 3GZNI 3ZNHB 2FCNA 3OAWA 3ZW3A 2CHZA 1L2NA 2ZNVC 1TGZB 4GB9A 2V4LA 1UBIA 3ZTDA 3B0AA 1V86A 1WX8A 1TBEA 2MSED 1WJUA 2D11A 4GMVA 4EOYA 4BBNF 2LXCA 2IY0B 3L16A 4HDQA 4A3PA 1XT9B 3APCA 3H1UA 2KD0A 4BOSC 2WWZA 3D32A 3QWZB 1E8WA 1WYWB 2KDFB 3ZNID 4HCPB 2UWQA 4LJOB 2O2VA 2BF8B 4DHZB 4DWFA 3GOEA 4PS8A 3UIOB 2PJHA 3V6EB 2KX0A 3TIXA 2NVUI 2MLBA 4LCDE 1S3SG 4FHKA 4HPLB 2JY6A 3ZDMC 1IPGA 2L8JA 5DPWA 2IY1B 1E90A 1BT0A 4MELA 5AZGA 2D3GA 4DDID 3L17A 4MSQB 3ZUNA 4EUTA 4GDLA 3A1QB 4KZ0A 4IM2A 4JIOU 3VDZA 4WWPA 3QC8B 3WAOA 4A3OA 2K25A 4MJSA 5DPTA 3PHXB 3HK0A 5BO4B 4RM8A 1ISNA 1UELA 3H7PB 4IW0A 3VQIA 1V9JA 1E7VA 1SE9A 2LXAA 3ALBA 3DPDA 2MRPA 3VUYA 2FCQA 2JUOA 5J18A 4JLCA 3MJWA 4PS3A 2AL6A 2XK5B 4HWIB 2FCSA 4URKA 2GBNA 5LXIB 2MBEA 2MBOA 2KDEB 3AU4A 3NZUA 2WX1A 3DBHI 3PTFC 1P9DU 4NNJB 2K6QA 5AZFA 2XBBC 2LVPA 2NBVB 3A9JB 2KTFA 3Q3JA 2KN5A 1YQBA 5C23A 2NR2A 4IWOA 2ZCCA 3ECIA 1T0YA 4ZRIA 2K39A 4I6PA 2MBQA 5AEKB 2LRWA 2K8BA 1P1AA 4A20A 1LFDA 2N4FA 4KDLB 4MSMB 5JHBA 2V1YA 5FR6A 2EKEC 1WGDA 5CHWA 1RAXA 2JT4B 5CTRC 4NY0A 2J7QB 2JPHA 3BINA 3QX1A 1EF5A 3N30A 3M3JA 4LDTD 2IO3B 4KZCA 3BY4B 3HM6X 1ZW7A 4GXBA 3L08A 2JRHA 3LJ3A 2ZCBA 3U8ZA 2PE6B 2KQSA 4WJOA 1KJTA 3ZKJC 2IO2B 2RSUA 2C60A 3PPAA 3AU5A 1V49A 4X57B 3L10B 2DAJA 2PPHA 5J2RA 1J0GA 4BFRA 1UZXB 1ZKHA 1WGRA 2JXXA 3A9KA 2N1VA 1HE8A 4MEMA 2DYOA 2ZPYA 1VCBA 2FIDA 4HDOA 1F9JA 3T9LA 2BKRB 3KYCD 3QCAA 5TR5A 2BWES 2G45B 1YJ1A 2KXJA 2C7HA 4BVUC 2GBKA 4HCNB 4NQKE 4WAAA 1JRUA 2BYVE 3QK0A 2PE9A 3U30A 1WJNA 4E74A 2KTRA 2N9PC 4B9KA 2JF5A 3A1QA 3VTWA 2K8HA 4IC7B 5G2NA 3APDA 2IYDB 1Q5WB 4KSLC 3QQ8B 2M17A 2MX2A 4MJSB 1V5TA 2NBWB 1YX6B 2ZEQA 4AJYB 3VTUA 4ANVA 2DZKA 4NAWB 3UQAA 5E6NA 3WIMA 1EF1A 4CO7A 2I1KA 4EZJA 3QIJA 2KOXA 3PV1A 4ZDVA 3RT3B 4GDKB 1LM8B 4MGZE 2L0TA 2ZZPB 3OJ4B 3PRPB 3KVFB 3WAMA 2KX3A 2JWZA 4P7IA 4AP4C 2GBMA 3DVGY 1WR1A 3W1YA 3KUCB 5DCNA 1WM2A 3MTNB 3W1SC 3PZDA 2C9WB 2G3QB 4JGHB 5L95C 4F8CB 4LDTB 2HTHA 1H4RA 1E8YA 4G0NB 5CX3A 2FCMA 3L54A 3TJPA 1E5WA 4DHZE 2C5LC 1IYFA 4FN2A 3JSVB 2KNBA 2M1MA 5JH5C 1WZ0A 1KM7A 2PEAA 3O65B 3PLVA 4IWPA 1WI0A 5HKHA 4W9CA 3U7DA 3ML9A 1WR6E 5D94A 2BYEA 2RD0A 5E6OA 3IBEA 3PREA 3VH4B 4B6WA 4FBJB 4N9F4 3UIPB 3A9KB 2M8SA 4ZYNA 3DBLI 1Y8RC 1E8ZA 5C1ZA 2DHZA 3M62B 2KC1A 1GC7A 1NI2A 2KWVB 3ML8A 3PT2B 3EFUA 2JRIB 4RM9A 3W1SA 3IVFA 1OQYA 1C3TA 2N9EB 4JQWC 3VHTC 1G6JA 4F1SA 3RYTA 4WJQA 2YLMA 1Q0WB 2N7EA 2KFKB 4MGYE 2WX0A 3QAQA 2BYFA 2O6VD 2C7MB 4HJKA 4YL8A 1K8RB 2DYBA 2FIFA 4MGIE 4NQLB 2CS4A 4CYEA 2NBUA 3C0RB 5DPSA 3T8MA 1P0RA 3ZLZA 4ANXA 1WH3A 1WZ3A 3L0WB 3CMMB 2KC2A 3RD2A 2KDBA 4BKSA 3VAWA 4ANUA 3TL5A 3DVGX 2Y5BB 2ASQA 1GNUA 1FXTB 1IP9A 4CHKA 3OLMD 3IHPC 2KLCA 1I42A 2DZIA 2DENB 4KIKA 4DK5A 2G4SA 3X23A 2KKCA 2L0FA 2LD9A 3JYUA 4PYZA 3KW5B 4GGQA 2ZJDA 2OOBB 4GDKA 2CHWA 3NHEB 4FLHA 2KWCA 5JHAA 1U4AA 3RUIB 1D3ZA 1WY8A 2ZVNA 2MQJA 2JZZA 4TQ1A 3ZTCA 2CR5A 1X1MA 2RGFA 3WAPA 3ZRFA 4BKTA 3QJZA 1H8CA 3EHVA 1S1QB 1TTNA 3A9JA 3CSFA 3UINB 1ZGUB 2EMSA 3LDZE 3SDLC 4B95A 4G50A 4TV3A 3NY5A 4DBGA 2M0XA 4M8MA 2L00B 2HJ8A 2LUEA 2LVQA 3RULA 1J19A 2XEWA 1V2YA 5LLIA 4KDIC 2IO1B 3ONSA 1LQBA 1WXSA 4W9GA 4MM3A 4TKNA 4ICUA 2K8CA 3KUDB 1WX9A 2J0JA 4W9JA 1L7YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BPS A;  1J8C A;  5AZH A;  2KZR A;  1YIW A;  3A4S C;  1KOT A;  3QHT A;  3HIZ A;  4GN1 A;  4FUL A;  2MP2 B;  2MW5 A;  3NZS A;  5D6J B;  3DQV A;  4EFO A;  4HVB A;  3AUL A;  2KJR A;  3RZW C;  4GOC A;  2AWT A;  1XQQ A;  2KFK A;  3NS8 A;  3R7R A;  4HLE A;  1V80 A;  3VFK A;  1SGH A;  3WAN A;  3PS6 A;  5KHO A;  2ZVO A;  3QAR A;  4W9E A;  4BKG A;  1GC6 A;  2CKH B;  1R4M I;  2CHX A;  1GG3 A;  4XX5 A;  1WIA A;  3N32 A;  4I6N B;  2C7N B;  4II3 B;  4KIK B;  2N7D A;  1WM3 A;  1KLV A;  4GSW A;  3A33 B;  5J17 A;  2OJR A;  2KFJ A;  4ANW A;  3KH0 A;  1WJ4 A;  2Z0D B;  3AXC A;  5G55 A;  1GUA B;  4M8N A;  1UD7 A;  3H9D A;  4WJN A;  2ZNV B;  2DYM A;  3WA0 A;  2DX5 B;  2LJ5 A;  1E7U A;  5EDS A;  4AOF A;  2KAN A;  4J6I A;  4FA6 A;  4G11 A;  3TMP B;  2LGX A;  4IUM B;  4XC2 A;  2HD5 B;  2D07 B;  2D10 A;  5IA7 A;  3V6C B;  3QA8 A;  1OEY A;  1WGG A;  3KUZ A;  3V60 A;  3DVN U;  3V62 A;  4W9L A;  3UF8 A;  4LJP B;  2B3A A;  2ZPN A;  3DBS A;  4E71 A;  2KMA A;  3ZNZ B;  3JW0 X;  4BBN C;  1OTR B;  3CF6 E;  1WXM A;  2L3Z A;  2REX A;  2DZJ A;  2CU1 A;  1WMH A;  4FJV B;  4MH0 E;  1LXD A;  4DDG D;  3APF A;  4KSK C;  4W9H A;  2N1W A;  5CHV C;  2KJ6 A;  3RCZ A;  2MWS B;  2JZ3 B;  2KDI A;  3JSV A;  3MHS D;  2IBI B;  1V5O A;  4NJ7 A;  2O6V A;  3ZIM A;  4ZRJ A;  2L76 A;  2V3S A;  1OEY J;  3NOB A;  2K1F A;  1NDD A;  3S2A A;  2NPT B;  4DHJ D;  2R2O A;  2MP2 A;  4BOZ B;  2BWF A;  3L13 A;  4FHJ A;  1OGW A;  2M4N A;  2KMC A;  5GMV A;  1SIF A;  2BGF A;  2KJH B;  4MGK E;  3SHQ A;  3ZO5 B;  2DAF A;  2I1J A;  4GIV A;  4WQO B;  3ZVV A;  4IM0 A;  3B1L X;  1WF9 A;  3M95 A;  4GDL B;  1A5R A;  1PQS A;  3VUW A;  3UGB B;  4ZRK A;  4KVG B;  2G4D B;  4W9D A;  4II2 B;  2J0K A;  3VH3 B;  4W9I A;  3SU8 X;  3ZDT A;  4FAD A;  4JL9 A;  3AI5 A;  3A4R A;  4BKS D;  4DXA B;  4EZK A;  3PVL A;  3K9P B;  2GOW A;  2XK5 A;  3TBL D;  5L83 A;  1CMX B;  1UGM A;  1V6E A;  3PSE B;  1RLF A;  2DZM A;  3R7Q A;  3PHW B;  3EC8 A;  2KLG A;  2Z0E B;  4PYU A;  2MBH A;  4PS7 A;  4ASW C;  2KO3 A;  2IZV B;  2L05 A;  2KHW B;  4IG7 B;  1RFA A;  1Z5S B;  2L7R A;  1WGY A;  1WX7 A;  4TUU A;  3KYD D;  3JVZ X;  5LXH A;  4W9K A;  4AUQ C;  2AYO B;  4IM3 A;  3UQB A;  3CST A;  2N9X A;  3PGE A;  2LI5 A;  4K7S A;  3HM3 A;  4E3C A;  2FNJ B;  3VTV A;  1UH6 A;  2JVC A;  1WMH B;  1GJZ A;  4EZL A;  4HXD A;  1XD3 B;  3R3M A;  2LZ6 A;  2A5U A;  3V61 A;  2J0M A;  4IWQ A;  4K1R B;  1WE7 A;  5DPR A;  5JZE B;  4G3X B;  3VXW A;  2GBR A;  2KQ7 A;  2O6V B;  1WFY A;  3H7S A;  4AJW A;  4DHJ B;  5IAA C;  2NPT A;  4K81 A;  2R2Q A;  3M63 B;  3VUX A;  1QZE A;  3ENE A;  4K7U A;  4FJY A;  3HHM A;  2Z59 B;  3DDC B;  2GMI C;  1YD8 U;  1V81 A;  1YX5 B;  3VVW B;  4OVV A;  2A4Z A;  3DOW A;  2NS5 A;  4NPN A;  1Z2M A;  4NJ6 A;  2RR9 A;  2LGD A;  4I6L B;  2NCN A;  3RZF A;  4TQ0 A;  1VD2 A;  1WJ6 A;  2O2V B;  1TZ1 A;  2KTR B;  3PRM B;  4HK2 A;  2MBB B;  2RPQ A;  3B08 A;  4EKU A;  2KVR A;  2MA9 B;  2IO0 B;  4AWJ A;  4W9F A;  3EEC A;  4HPM B;  4F7Z A;  2KWU B;  1WXV A;  2KK8 A;  4MDK E;  5D7G A;  2QHO A;  2AEH A;  2LVO A;  2D2Q A;  3I3T B;  3K9O B;  1P98 A;  3IFW B;  3PRZ A;  4NAW A;  4WJP A;  3N3K B;  3SD5 A;  2LWP A;  2LAS A;  1WGH A;  2HE7 A;  1MG8 A;  2WDT B;  2BKF A;  4KV2 A;  2EMT A;  3DVN V;  4ICV A;  3OJ3 A;  1C1Y B;  4RMA A;  2FUH B;  3DCG A;  3H7P A;  2GBJ A;  1P3Q U;  4M0W B;  1AAR A;  2AL3 A;  4WWO A;  3X0W A;  1RRB A;  1NBF C;  1WXA A;  3WAL A;  1WE6 A;  2VRR B;  2MCN B;  4EEW A;  1UBQ A;  1R4N I;  3H6N A;  1M94 A;  2K6D B;  4FJZ A;  5CHF A;  1I35 A;  1Q1O A;  4OVU A;  5KHQ A;  3ZRC A;  2UYZ B;  3TCA A;  3PLU A;  2LRU A;  2WYQ A;  1E8X A;  3IG3 A;  1EUV B;  4XZ4 A;  5D2M B;  2LGY A;  3ZNG C;  4GU2 A;  5E6P A;  2FAZ A;  4WWN A;  1WRD B;  3Q3F A;  2YVC A;  3DBR I;  1EO6 A;  3P2B A;  4K7W A;  2W9N A;  3R66 C;  3GZN I;  3ZNH B;  2FCN A;  3OAW A;  3ZW3 A;  2CHZ A;  1L2N A;  2ZNV C;  1TGZ B;  4GB9 A;  2V4L A;  1UBI A;  3ZTD A;  3B0A A;  1V86 A;  1WX8 A;  1TBE A;  2MSE D;  1WJU A;  2D11 A;  4GMV A;  4EOY A;  4BBN F;  2LXC A;  2IY0 B;  3L16 A;  4HDQ A;  4A3P A;  1XT9 B;  3APC A;  3H1U A;  2KD0 A;  4BOS C;  2WWZ A;  3D32 A;  3QWZ B;  1E8W A;  1WYW B;  2KDF B;  3ZNI D;  4HCP B;  2UWQ A;  4LJO B;  2O2V A;  2BF8 B;  4DHZ B;  4DWF A;  3GOE A;  4PS8 A;  3UIO B;  2PJH A;  3V6E B;  2KX0 A;  3TIX A;  2NVU I;  2MLB A;  4LCD E;  1S3S G;  4FHK A;  4HPL B;  2JY6 A;  3ZDM C;  1IPG A;  2L8J A;  5DPW A;  2IY1 B;  1E90 A;  1BT0 A;  4MEL A;  5AZG A;  2D3G A;  4DDI D;  3L17 A;  4MSQ B;  3ZUN A;  4EUT A;  4GDL A;  3A1Q B;  4KZ0 A;  4IM2 A;  4JIO U;  3VDZ A;  4WWP A;  3QC8 B;  3WAO A;  4A3O A;  2K25 A;  4MJS A;  5DPT A;  3PHX B;  3HK0 A;  5BO4 B;  4RM8 A;  1ISN A;  1UEL A;  3H7P B;  4IW0 A;  3VQI A;  1V9J A;  1E7V A;  1SE9 A;  2LXA A;  3ALB A;  3DPD A;  2MRP A;  3VUY A;  2FCQ A;  2JUO A;  5J18 A;  4JLC A;  3MJW A;  4PS3 A;  2AL6 A;  2XK5 B;  4HWI B;  2FCS A;  4URK A;  2GBN A;  5LXI B;  2MBE A;  2MBO A;  2KDE B;  3AU4 A;  3NZU A;  2WX1 A;  3DBH I;  3PTF C;  1P9D U;  4NNJ B;  2K6Q A;  5AZF A;  2XBB C;  2LVP A;  2NBV B;  3A9J B;  2KTF A;  3Q3J A;  2KN5 A;  1YQB A;  5C23 A;  2NR2 A;  4IWO A;  2ZCC A;  3ECI A;  1T0Y A;  4ZRI A;  2K39 A;  4I6P A;  2MBQ A;  5AEK B;  2LRW A;  2K8B A;  1P1A A;  4A20 A;  1LFD A;  2N4F A;  4KDL B;  4MSM B;  5JHB A;  2V1Y A;  5FR6 A;  2EKE C;  1WGD A;  5CHW A;  1RAX A;  2JT4 B;  5CTR C;  4NY0 A;  2J7Q B;  2JPH A;  3BIN A;  3QX1 A;  1EF5 A;  3N30 A;  3M3J A;  4LDT D;  2IO3 B;  4KZC A;  3BY4 B;  3HM6 X;  1ZW7 A;  4GXB A;  3L08 A;  2JRH A;  3LJ3 A;  2ZCB A;  3U8Z A;  2PE6 B;  2KQS A;  4WJO A;  1KJT A;  3ZKJ C;  2IO2 B;  2RSU A;  2C60 A;  3PPA A;  3AU5 A;  1V49 A;  4X57 B;  3L10 B;  2DAJ A;  2PPH A;  5J2R A;  1J0G A;  4BFR A;  1UZX B;  1ZKH A;  1WGR A;  2JXX A;  3A9K A;  2N1V A;  1HE8 A;  4MEM A;  2DYO A;  2ZPY A;  1VCB A;  2FID A;  4HDO A;  1F9J A;  3T9L A;  2BKR B;  3KYC D;  3QCA A;  5TR5 A;  2BWE S;  2G45 B;  1YJ1 A;  2KXJ A;  2C7H A;  4BVU C;  2GBK A;  4HCN B;  4NQK E;  4WAA A;  1JRU A;  2BYV E;  3QK0 A;  2PE9 A;  3U30 A;  1WJN A;  4E74 A;  2KTR A;  2N9P C;  4B9K A;  2JF5 A;  3A1Q A;  3VTW A;  2K8H A;  4IC7 B;  5G2N A;  3APD A;  2IYD B;  1Q5W B;  4KSL C;  3QQ8 B;  2M17 A;  2MX2 A;  4MJS B;  1V5T A;  2NBW B;  1YX6 B;  2ZEQ A;  4AJY B;  3VTU A;  4ANV A;  2DZK A;  4NAW B;  3UQA A;  5E6N A;  3WIM A;  1EF1 A;  4CO7 A;  2I1K A;  4EZJ A;  3QIJ A;  2KOX A;  3PV1 A;  4ZDV A;  3RT3 B;  4GDK B;  1LM8 B;  4MGZ E;  2L0T A;  2ZZP B;  3OJ4 B;  3PRP B;  3KVF B;  3WAM A;  2KX3 A;  2JWZ A;  4P7I A;  4AP4 C;  2GBM A;  3DVG Y;  1WR1 A;  3W1Y A;  3KUC B;  5DCN A;  1WM2 A;  3MTN B;  3W1S C;  3PZD A;  2C9W B;  2G3Q B;  4JGH B;  5L95 C;  4F8C B;  4LDT B;  2HTH A;  1H4R A;  1E8Y A;  4G0N B;  5CX3 A;  2FCM A;  3L54 A;  3TJP A;  1E5W A;  4DHZ E;  2C5L C;  1IYF A;  4FN2 A;  3JSV B;  2KNB A;  2M1M A;  5JH5 C;  1WZ0 A;  1KM7 A;  2PEA A;  3O65 B;  3PLV A;  4IWP A;  1WI0 A;  5HKH A;  4W9C A;  3U7D A;  3ML9 A;  1WR6 E;  5D94 A;  2BYE A;  2RD0 A;  5E6O A;  3IBE A;  3PRE A;  3VH4 B;  4B6W A;  4FBJ B;  4N9F 4;  3UIP B;  3A9K B;  2M8S A;  4ZYN A;  3DBL I;  1Y8R C;  1E8Z A;  5C1Z A;  2DHZ A;  3M62 B;  2KC1 A;  1GC7 A;  1NI2 A;  2KWV B;  3ML8 A;  3PT2 B;  3EFU A;  2JRI B;  4RM9 A;  3W1S A;  3IVF A;  1OQY A;  1C3T A;  2N9E B;  4JQW C;  3VHT C;  1G6J A;  4F1S A;  3RYT A;  4WJQ A;  2YLM A;  1Q0W B;  2N7E A;  2KFK B;  4MGY E;  2WX0 A;  3QAQ A;  2BYF A;  2O6V D;  2C7M B;  4HJK A;  4YL8 A;  1K8R B;  2DYB A;  2FIF A;  4MGI E;  4NQL B;  2CS4 A;  4CYE A;  2NBU A;  3C0R B;  5DPS A;  3T8M A;  1P0R A;  3ZLZ A;  4ANX A;  1WH3 A;  1WZ3 A;  3L0W B;  3CMM B;  2KC2 A;  3RD2 A;  2KDB A;  4BKS A;  3VAW A;  4ANU A;  3TL5 A;  3DVG X;  2Y5B B;  2ASQ A;  1GNU A;  1FXT B;  1IP9 A;  4CHK A;  3OLM D;  3IHP C;  2KLC A;  1I42 A;  2DZI A;  2DEN B;  4KIK A;  4DK5 A;  2G4S A;  3X23 A;  2KKC A;  2L0F A;  2LD9 A;  3JYU A;  4PYZ A;  3KW5 B;  4GGQ A;  2ZJD A;  2OOB B;  4GDK A;  2CHW A;  3NHE B;  4FLH A;  2KWC A;  5JHA A;  1U4A A;  3RUI B;  1D3Z A;  1WY8 A;  2ZVN A;  2MQJ A;  2JZZ A;  4TQ1 A;  3ZTC A;  2CR5 A;  1X1M A;  2RGF A;  3WAP A;  3ZRF A;  4BKT A;  3QJZ A;  1H8C A;  3EHV A;  1S1Q B;  1TTN A;  3A9J A;  3CSF A;  3UIN B;  1ZGU B;  2EMS A;  3LDZ E;  3SDL C;  4B95 A;  4G50 A;  4TV3 A;  3NY5 A;  4DBG A;  2M0X A;  4M8M A;  2L00 B;  2HJ8 A;  2LUE A;  2LVQ A;  3RUL A;  1J19 A;  2XEW A;  1V2Y A;  5LLI A;  4KDI C;  2IO1 B;  3ONS A;  1LQB A;  1WXS A;  4W9G A;  4MM3 A;  4TKN A;  4ICU A;  2K8C A;  3KUD B;  1WX9 A;  2J0J A;  4W9J A;  1L7Y A; 
#chains in the Genus database with same CATH topology
 3RNG C;  3RMK C;  1HTQ A;  5EE3 A;  3HIZ A;  3NZS A;  4HVB A;  1XQQ A;  1JW9 D;  4HLE A;  1V80 A;  4ZHP A;  1HTO A;  1AN8 A;  3QAR A;  1C78 A;  1GC6 A;  3ZGZ A;  2CKH B;  1R4M I;  1STE A;  1MG4 A;  1WIA A;  3N32 A;  4C80 A;  2FUG 1;  2N7D A;  1GUA B;  3H9D A;  4WJN A;  2ZNV B;  2RDB C;  4AOF A;  4G11 A;  2PMV A;  3LYY A;  3V6C B;  1BXT A;  1WGG A;  3V60 A;  4W9L A;  3HRD D;  4HRS A;  3AN1 A;  3ZNZ B;  3RFZ B;  1YQ3 B;  1FFU A;  1TT5 B;  4C00 A;  4FJV B;  3DBR B;  4RGT A;  4DDG D;  2NTS A;  2KJ6 A;  4OZC A;  2JZ3 B;  2KDI A;  4ARI A;  2IBI B;  4DXF A;  3AE2 B;  1E9M A;  1F2R I;  2MJD A;  2L76 A;  2R2O A;  1OGW A;  2M4N A;  1M4V A;  1F1H A;  3SHQ A;  4B0E A;  2DAF A;  3MC0 B;  1QIL A;  4IM0 A;  1A5R A;  4P1C C;  2E3T A;  3UGB B;  4KVG B;  2G4D B;  2GB1 A;  4II2 B;  1N5W A;  3TEW A;  4C4V A;  3VH3 B;  3ZJU A;  3ZDT A;  3A4R A;  3PVL A;  3TBL D;  1VZ7 A;  3MHZ A;  1WWT A;  1N60 A;  4YWG G;  1V6E A;  3R7Q A;  4PYU A;  2KLG A;  3RI7 C;  4D2K A;  2BTE A;  3VRA B;  2MBH A;  4P16 A;  2KT7 A;  4M0W A;  2KO3 A;  4ASW C;  2KHW B;  3I57 A;  1WGY A;  2NTT A;  3JVZ X;  1TIF A;  4AUQ C;  4IM3 A;  1N62 A;  4E3C A;  2EKI A;  1UH6 A;  2KMM A;  3MC8 A;  4OW0 A;  3E9S A;  4EZL A;  1C9F A;  2OHF A;  4YTM B;  4AJW A;  1JML A;  1QZE A;  3ENE A;  4K7U A;  4FJY A;  3HHM A;  2JXT A;  4WAF A;  3DDC B;  1YD8 U;  1V81 A;  1YX5 B;  3VVW B;  4OVV A;  2A4Z A;  5IKC M;  2B76 B;  3PRM B;  2KTR B;  2KVR A;  2MA9 B;  4W9F A;  2WP9 B;  2QHO A;  2AEH A;  1GPX A;  4LLG M;  4NAW A;  3PRZ A;  4WJP A;  3SD5 A;  2D3A A;  4YSY B;  2HE7 A;  4A90 A;  2WDT B;  2BKF A;  4KV2 A;  5G5G A;  3DCG A;  2H89 B;  2V4I B;  1K53 A;  1JWA D;  1NBF C;  3U2S C;  3RNE C;  4WWM A;  2MCN B;  3H6N A;  2K6D B;  4FJZ A;  1I35 A;  4OVU A;  3NZ3 A;  2EEL A;  2LRU A;  2BYT A;  3IG3 A;  1EUV B;  3VR9 B;  1V1P B;  2M56 B;  1V1O A;  1JRP A;  3ZNH B;  2V9H A;  3OAW A;  4LNK A;  1TGZ B;  4GB9 A;  1MHX A;  4GMV A;  4YTN B;  4US9 A;  1XT9 B;  3APC A;  4FXC A;  3RNB C;  1RYJ A;  2KD0 A;  1D5X C;  1QLB B;  1TKG A;  2O2V A;  4DHZ B;  4DWF A;  3UIO B;  2PJH A;  2XNA C;  4LCD E;  1L0X B;  4XE0 A;  3TEZ A;  3L17 A;  4GDL A;  4OZA A;  4IM2 A;  3WAO A;  3HK0 A;  1N6Z A;  1TY0 A;  3W9C B;  3VQI A;  1V9J A;  2MJE A;  2FCQ A;  4PS3 A;  4HWI B;  2FCS A;  2GBN A;  5AUI A;  2MBO A;  3DBH I;  3PTF C;  3SEB A;  2K6Q A;  2XBB C;  2KTF A;  4ZYS A;  1YQB A;  5C23 A;  1T0Y A;  4I6P A;  2MBQ A;  5AEK B;  2K8B A;  5I4D A;  1KH0 A;  2BS4 B;  1RAX A;  3QX1 A;  1EF5 A;  3N30 A;  2GI9 A;  1MVK A;  5H92 C;  1VJK A;  4WJO A;  3ZKJ C;  3AU5 A;  3L10 B;  1UZX B;  1ZKH A;  1CK1 A;  1HE8 A;  1VCB A;  3T9L A;  1LGR A;  3QCA A;  1QT9 A;  3I5J C;  2D3B A;  2G45 B;  1YJ1 A;  2IJ0 A;  2C7H A;  2K5P A;  4NQK E;  4RGM A;  2BYV E;  2AQ1 B;  2PE9 A;  3U30 A;  2KTR A;  2N9P C;  1AW7 A;  2K8H A;  3APD A;  1Q5W B;  3UI3 A;  3QQ8 B;  3AED B;  2WNM A;  2G1E A;  2CJN A;  4ANV A;  1CZP A;  5IO9 A;  4NAW B;  3UQA A;  5E6N A;  4CO7 A;  1EF1 A;  2I1K A;  4AQ7 A;  4EZJ A;  4JWS C;  3QIJ A;  1FRD A;  2KOX A;  4OVZ A;  1OQR A;  4HJG E;  4A8X C;  4MGZ E;  2L0T A;  2HDE A;  3KVF B;  4P6V F;  5GXG B;  3Q3N C;  3BYT B;  3Q8A A;  3DHG C;  4WUR A;  2BBC A;  3KUC B;  1JRO A;  5DCN A;  3PZD A;  2G3Q B;  4LDT B;  1HEZ E;  1E8Y A;  3P4P B;  4G0N B;  4M02 A;  2FCM A;  2N9K A;  1V8C A;  1E5W A;  2YEP B;  2C5L C;  2M1M A;  5JH5 C;  1WZ0 A;  2Y3A A;  5HKH A;  1WR6 E;  1YOV B;  2BYE A;  1XLO A;  2VZK D;  4ZYN A;  3DBL I;  1Y8R C;  3KLS X;  1N63 A;  1RFK A;  1SE4 A;  2KC1 A;  2JRI B;  1OQY A;  1SXT A;  1EWY C;  3RYT A;  2N7E A;  4MGY E;  2L83 A;  3QAQ A;  2WX0 A;  5FKA C;  4HKQ A;  2C7M B;  4YL8 A;  1K8R B;  1ZOY B;  2FIF A;  2CS4 A;  4CYE A;  1ZP0 B;  1I4R A;  1P7F A;  3BK1 A;  3BVM A;  1YNT E;  1FRR A;  4L2Y A;  2WXO A;  2I38 A;  3VAW A;  4ANU A;  3TL5 A;  1Q10 A;  2WDR B;  4DK5 A;  3X23 A;  2KKC A;  3KWV A;  2LD9 A;  4AS1 A;  2I2Y A;  4GDK A;  2WDQ B;  5JHA A;  1D3Z A;  1WY8 A;  2ZW0 A;  2E6X A;  2V3N A;  1X1M A;  1PGB A;  1TTN A;  1VLB A;  2JQR B;  3E56 A;  4B95 A;  3NY5 A;  5EE1 A;  2M0X A;  4M8M A;  3N9Y C;  2L00 B;  4UDU C;  3Q6B A;  4KDI C;  1SE3 A;  2PTL A;  4W9G A;  4TKN A;  4ICU A;  2K8C A;  2J0J A;  1L7Y A;  2BPS A;  1YIW A;  3R2T A;  1KOT A;  3NVV A;  4EFO A;  3RZW C;  5FK9 C;  3VFK A;  1PYW D;  1SGH A;  3WAN A;  5KHO A;  3IT4 B;  2ZVO A;  3WCQ A;  1I4P A;  4I6N B;  2C7N B;  3NVZ A;  4II3 B;  4KIK B;  3SFE B;  1BUI C;  1NVI D;  2OJR A;  3AE6 B;  3AE7 B;  3Q3M C;  1UD7 A;  2TSS A;  4JX1 C;  1XLN A;  3TMP B;  2D10 A;  2KDM A;  4EE2 A;  3QA8 A;  1OEY A;  3GS2 A;  3KUZ A;  2W82 A;  3DVN U;  3AEA B;  4IKG A;  4E71 A;  1V1P A;  1FXA A;  1WSP A;  1WYG A;  4BBN C;  2L1A A;  1OTR B;  1WXM A;  1B1Z A;  4RNA A;  2REX A;  2DZJ A;  1WMH A;  5IP4 D;  4MH0 E;  1LXD A;  1JWM D;  3RCZ A;  1FO4 A;  2MWS B;  4RGN A;  3MHS D;  1V5O A;  1TKE A;  2RDH A;  1OEY J;  2K1F A;  3S2A A;  3PZ7 A;  2MP2 A;  4BOZ B;  3L4P A;  5BMI A;  4WIP A;  2QSD A;  2V3P A;  2LGI A;  4LTU A;  3ZO5 B;  2KWD A;  2I1J A;  4L23 A;  4WQO B;  5C2T B;  1E6E B;  3ZVV A;  3B1L X;  3M95 A;  4GDL B;  1JAL A;  3Q8E A;  4W9D A;  1C79 A;  3FC4 A;  1YN5 A;  3AEF B;  1ESF A;  2LGS A;  4EZK A;  1UGJ A;  3N1Z C;  4LNO A;  1UGM A;  2WU2 B;  3EC8 A;  4PS7 A;  2IZV B;  3KYD D;  2XN9 C;  4W9K A;  2J53 A;  2Y5C A;  4JPS A;  3UQB A;  3CST A;  2N9X A;  2FNJ B;  3P4Q B;  1OQQ A;  1GJZ A;  1XD3 B;  2VH1 A;  2VZK B;  2BB5 A;  3I9V 1;  4IWQ A;  4K1R B;  1WE7 A;  1ZDV A;  5DPR A;  2O6V B;  3VUX A;  3M63 B;  2Z59 B;  2FE8 A;  3N1Y C;  4XGA B;  4I6L B;  3RZF A;  2NCN A;  4TQ0 A;  3TEY A;  1VD2 A;  5D3I B;  2MBB B;  3AE1 B;  4F7Z A;  1EU3 A;  1JWB D;  1T0Q C;  4MDK E;  1F0Z A;  5D7G A;  2LVO A;  2D2Q A;  1K50 A;  3K9O B;  3IFW B;  4USA A;  1F77 A;  2J52 A;  1WGH A;  2INC C;  2WXM A;  2GBJ A;  1P3Q U;  4P1B C;  1D5Z C;  2AL3 A;  4WWO A;  3IAM 1;  1WXA A;  1WE6 A;  2VRR B;  4EEW A;  1T3Q A;  5CHF A;  1F2R C;  2V0G A;  4XYC A;  3ZRC A;  3PLU A;  2WYQ A;  1JCK B;  4ACF A;  3P42 A;  3ZNG C;  1ET6 A;  4NAM A;  3URY A;  3Q3F A;  3P2B A;  4K7W A;  3AEC B;  3P4S B;  2FCN A;  3I63 C;  2BB6 A;  2CHZ A;  3RN9 C;  2JX5 A;  3MJ5 A;  3ZTD A;  4EOY A;  4HDQ A;  4A3P A;  3RNF C;  1NEN B;  3H1U A;  4BOS C;  1E8W A;  1WYW B;  3ZNI D;  2UWQ A;  4LJO B;  2BF8 B;  1TS4 A;  2K9X A;  4PS8 A;  3AE9 B;  3GE8 C;  2KX0 A;  2NVU I;  3AE8 B;  2MLB A;  5C3J B;  1T5X D;  1TS2 A;  2IY1 B;  4MEL A;  5DPW A;  4DDI D;  2D3G A;  4NZL B;  2WU5 B;  3DHI C;  4KZ0 A;  1VRA B;  2MH7 A;  2BVC A;  5BO4 B;  1UEL A;  3H7P B;  4A55 A;  2GLS A;  3DPD A;  1PUT A;  3U4E G;  5J18 A;  2BQQ A;  2XK5 B;  2KDE B;  1P9D U;  5H8Y E;  2NBV B;  4H2A A;  2JU6 X;  3GZN B;  3FKY A;  1R4N B;  3ECI A;  2K39 A;  2N4F A;  5JHB A;  5E6J A;  1KLU D;  2N0S B;  5FR3 A;  1TYG B;  5BMH A;  3NJT A;  2JPH A;  3BIN A;  3HM6 X;  1YJJ A;  2PE6 B;  2IO2 B;  3PPA A;  2C60 A;  4X57 B;  1FCL A;  1ET9 A;  5J2R A;  4BFR A;  2KQ4 X;  2JXX A;  3A9K A;  3FIL B;  2DYO A;  2ZPY A;  4HDO A;  1F9J A;  4BVU C;  2GBK A;  1JRU A;  1WJN A;  4E74 A;  4B9K A;  3A1Q A;  3VTW A;  2IYD B;  4MJS B;  1V5T A;  2NBW B;  3Q2A C;  4AJY B;  2DZK A;  4RGO S;  3Q3O C;  2J42 A;  1N61 A;  1WXQ A;  4ZDV A;  3RT3 B;  3OJ4 B;  3HVD A;  1T0S C;  3PRP B;  2JWZ A;  4P7I A;  4AP4 C;  3DVG Y;  3EFC A;  1PFD A;  2BT6 A;  2HTH A;  3PZ8 A;  5CX3 A;  2M0A A;  2MEK A;  3TJP A;  3TEX A;  2WXR A;  1IYF A;  4FN2 A;  4NJC A;  1I4G A;  1V97 A;  4IWP A;  3O65 B;  2L32 A;  3ML9 A;  2RD0 A;  4K3C A;  3VH4 B;  4FBJ B;  4MM3 B;  3UIP B;  3U52 E;  1WGK A;  1IBX B;  1E8Z A;  2DHZ A;  3RNC C;  3T3N A;  3PT2 B;  4RM9 A;  2KWV B;  3ML8 A;  4KKI A;  4K3B A;  3W1S A;  1SIJ A;  3IVF A;  1BML C;  4JQW C;  4F1S A;  1Q0W B;  2KFK B;  2JSV X;  2JYT A;  1KLG D;  2NBU A;  3C0R B;  3T8M A;  3ZLZ A;  1WZ3 A;  2WHI A;  3J9C A;  1E0Z A;  3RD2 A;  2KDB A;  1IGC A;  1NI3 A;  4BKS A;  3Q8C A;  1FM0 D;  1T0R C;  2LHD A;  1L0Y B;  1GNU A;  1C4A A;  1IP9 A;  4CHK A;  3OLM D;  3IHP C;  2G4S A;  3JYU A;  2ZJD A;  4YTP B;  3NHE B;  4C7Z A;  1U4A A;  2ONQ A;  3ZJV A;  2JZZ A;  2CR5 A;  1DOY A;  4DXG A;  3WAP A;  3ZRF A;  4BKT A;  2LUM A;  3BK2 A;  1A70 A;  4C56 C;  4C7Y A;  4US8 A;  4S0R A;  2LVQ A;  5LLI A;  3Q8F A;  2IO1 B;  3ONS A;  3B9J A;  1AYF A;  3IAS 1;  1XLP A;  4W9J A;  4WWP A;  3AE3 B;  3BII D;  3SR6 A;  1ACC A;  1J8C A;  5AZH A;  1UWX A;  4GN1 A;  4LK0 M;  5D6J B;  3DQV A;  2KJR A;  4GOC A;  2AWT A;  1YMH E;  1SF0 A;  1SBB B;  2Y5P A;  1ZDX A;  3PS6 A;  4W9E A;  4BKG A;  1MJD A;  2CHX A;  3NUH B;  1GG3 A;  2D5G A;  4XX5 A;  4YSX B;  1HZ5 A;  1ZUD 2;  3EGR A;  1WM3 A;  1KLV A;  4GSW A;  3KH0 A;  5G55 A;  2PKO A;  2DYM A;  5EE0 A;  1TZO A;  2DX5 B;  2LJ5 A;  2N7J A;  5EDS A;  4J6I A;  4FA6 A;  2LGX A;  2HD5 B;  2LJI A;  2IGG A;  4TMA B;  2KVZ A;  2ZPN A;  2KMA A;  1T6B X;  3JW0 X;  3LB8 C;  3Q8B A;  1ROE A;  1QOA A;  3APF A;  4W9H A;  2N1W A;  5CHV C;  5HI1 A;  2MHJ A;  3P1M A;  3NOB A;  1NDD A;  2NPT B;  4DHJ D;  2BWF A;  4FHJ A;  3MFG A;  3RNA C;  2KMC A;  2BW2 A;  4GIV A;  5EE9 A;  5BMG A;  3LXF A;  1WF9 A;  3PO0 A;  2G9H D;  1SSN A;  2J0K A;  4M01 A;  4B0M A;  3AEG B;  4W9I A;  1I7H A;  4LNN A;  4DXA B;  3K9P B;  2GOW A;  2XK5 A;  1CMX B;  2W55 A;  1L6V A;  3PSE B;  2DZM A;  2K3U A;  5T8I A;  2L05 A;  1RFA A;  1Z5S B;  2L7R A;  1WX7 A;  2SAK A;  5LXH A;  5MPO A;  3C8Y A;  2AYO B;  3PGE A;  2LI5 A;  4TSS A;  1J7B A;  3AMZ A;  4KKJ A;  1WMH B;  4HXD A;  3R3M A;  2K22 A;  2LZ6 A;  2A5U A;  1YJI A;  2J0M A;  4G3X B;  3VXW A;  2GBR A;  4PT5 A;  1WFY A;  3H7S A;  5IAA C;  2WXP A;  1KRH A;  1TY2 A;  1QF6 A;  3DOW A;  4NPN A;  4NJ6 A;  2RR9 A;  2LGD A;  2WLB A;  2WXL A;  4CQN A;  2RPQ A;  4EKU A;  3B08 A;  4AWJ A;  2WXJ A;  2KAJ A;  4HPM B;  2KWU B;  1WXV A;  1D5M C;  4C4V B;  3I3T B;  2KN4 A;  1VDV A;  5IN7 A;  2LWP A;  2LAS A;  1UWM A;  1ENF A;  1MG8 A;  2EMT A;  5BYS A;  4ICV A;  1SB3 C;  3OJ3 A;  5IOI A;  2FUH B;  2JWU A;  4JWU C;  1R4M B;  4M0W B;  3GE3 C;  1RRB A;  3WAL A;  1UBQ A;  1R4N I;  2AX5 A;  3CWI A;  1UF0 A;  2UYZ B;  2DBY A;  1E8X A;  4DQO C;  4XZ4 A;  3N20 C;  5D2M B;  2LGY A;  4J3O D;  4GU2 A;  2FAZ A;  4WWN A;  2LFI A;  1EO6 A;  3GZN I;  1FMA D;  2ZNV C;  2DWQ A;  3B0A A;  1V86 A;  1WX8 A;  1XCQ L;  2LXC A;  4ARC A;  2WWZ A;  3D32 A;  2WDV B;  3Q69 A;  2KDF B;  1UUP A;  3V6E B;  3TIX A;  4FHK A;  1ZPS A;  2ACZ B;  2QIE B;  1BT0 A;  2H88 B;  1TKY A;  3ZUN A;  4BAX A;  4EUT A;  1E10 A;  1P7E A;  2INN E;  3QC8 B;  3ZXV A;  4A3O A;  2QJL A;  2K25 A;  1XF5 L;  5DPT A;  3PHX B;  1NYQ A;  4Q2J A;  3FAH A;  4N58 A;  1QOF A;  1XXG A;  2LXA A;  3ALB A;  2MRP A;  3VUY A;  2AQ2 B;  3MJW A;  2AL6 A;  1GB1 A;  4URK A;  1TJE A;  2YEP F;  5LXI B;  3AU4 A;  1QKZ A;  2LVP A;  2KN5 A;  3KWL A;  4IWO A;  1SJE D;  3AEE B;  3BVG A;  1P1A A;  1LFD A;  4KDL B;  4MSM B;  1XLQ A;  4R3D A;  2V1Y A;  1WGD A;  5CHW A;  2JT4 B;  5CTR C;  2J7Q B;  3WA0 A;  3BY4 B;  4GXB A;  3L08 A;  2JRH A;  3LJ3 A;  3U8Z A;  2WXG A;  3DHH C;  2MJ3 A;  1C4C A;  1R7S A;  2PPH A;  4HKZ E;  2GRI A;  2BKR B;  5TR5 A;  2BWE S;  2L52 A;  4WAA A;  4HCN B;  3AE5 B;  1UNS A;  3ZJT A;  3B2F A;  4XDD A;  1FCC C;  4KSL C;  2M17 A;  2MX2 A;  2N9L A;  2ZEQ A;  3W2D A;  1E7P B;  1MPE A;  4XDC A;  4YSZ B;  3V05 A;  4HRO A;  4GDK B;  1LM8 B;  2KX3 A;  2GBM A;  1WR1 A;  3W5U B;  1WM2 A;  2IGH A;  1L4D B;  3W1S C;  2C9W B;  2CU3 A;  4JGH B;  4ZOH C;  1H4R A;  2RMM A;  4ZRP A;  3W5V B;  4L1B A;  3EA6 A;  2CJO A;  1GOZ A;  3JSV B;  4JE3 B;  1KM7 A;  1PGX A;  5D94 A;  3IBE A;  3TUO A;  4N9F 4;  3A9K B;  2M8S A;  3M62 B;  1GC7 A;  1NI2 A;  1K51 A;  1J7C A;  3KQ4 A;  4MH8 A;  3BZD B;  1FNU A;  4PK1 A;  2N9E B;  1L6U A;  3VHT C;  3OG5 A;  4WH4 A;  4WJQ A;  2YLM A;  2RPV A;  2UU7 A;  2BYF A;  2O6V D;  4N6E B;  2AQ3 B;  1XEE A;  2SEB D;  4NQL B;  5LNK 1;  1MFW A;  5DPS A;  1P0R A;  2LHE A;  1WH3 A;  3L0W B;  2KC2 A;  2BS2 B;  3N1X C;  3DVG X;  1F52 A;  2Y5B B;  4A6Q A;  3T3O A;  2KLC A;  2DZI A;  4KIK A;  2QCZ A;  4PYZ A;  3KW5 B;  1N5X A;  2CHW A;  2KWC A;  4KGR A;  2MQJ A;  2IPK D;  4RH6 A;  1S1Q B;  1TS5 A;  3A9J A;  3UIN B;  2EMS A;  4HEA 1;  4ITK A;  4XWW A;  3DBH B;  2JZP A;  1J19 A;  2XEW A;  1FFV A;  1GB4 A;  5G5H A;  1PDX A;  4KGS A;  1WXS A;  3AV8 A;  1DOX A;  1WX9 A;  3AH7 A;  1RWS A;  1YN3 A;  4BZA A;  2KZR A;  3A4S C;  2WXF A;  3QHT A;  4FUL A;  2IND C;  2MP2 B;  2MW5 A;  3AUL A;  3R7R A;  2KFK A;  3NS8 A;  1FD6 A;  1CQV A;  1VR9 A;  1NEK B;  3DWM A;  3R8B A;  3H8H A;  5AUK A;  1LO5 D;  3A33 B;  5J17 A;  2KFJ A;  4ANW A;  2OED A;  1WJ4 A;  2RDG A;  2Z0D B;  3AXC A;  4M8N A;  1IGD A;  1L0V B;  3HUI A;  2PLP A;  1L4Z B;  1E7U A;  2WGS A;  2KAN A;  4IUM B;  4XC2 A;  2D07 B;  2LMC A;  5IA7 A;  1L5P A;  2INP E;  3V62 A;  3UF8 A;  4LJP B;  2B3A A;  3DBS A;  1D4B A;  5BYQ A;  3CF6 E;  2L3Z A;  4S17 A;  2LEK A;  2CU1 A;  4KSK C;  3NVY A;  3JSV A;  2PVO D;  2QMT A;  4NJ7 A;  2O6V A;  3ZIM A;  4ZRJ A;  2V3S A;  1NYR A;  1I4H A;  3L13 A;  4ZHO A;  5GMV A;  1SIF A;  2BGF A;  2KJH B;  4MGK E;  4OHJ A;  4XWT A;  1AWD A;  1OFF A;  2D3C A;  3DBL B;  1PQS A;  3VUW A;  2NMQ A;  4ZRK A;  3DWG C;  2QC8 A;  3ZYY X;  2IDY A;  2QEJ C;  3SU8 X;  4FAD A;  4JL9 A;  3AI5 A;  1C77 A;  4BKS D;  1QOB A;  1YN4 A;  5L83 A;  3MC9 A;  4GLS C;  1GAQ B;  2WXK A;  1RLF A;  3PHW B;  2Z0E B;  1C76 A;  1FPY A;  4IG7 B;  2ZW1 A;  2WS3 B;  4TUU A;  2FBW B;  1DGJ A;  4K7S A;  1KTK A;  3HM3 A;  3VTV A;  3V3X A;  3HVZ A;  1K52 A;  2JVC A;  3GB1 A;  1JWU D;  1QOG A;  3V61 A;  5JZE B;  1PGA A;  2KQ7 A;  4DHJ B;  2ICI A;  2KAC A;  3RPF C;  2NPT A;  4K81 A;  2R2Q A;  3VR8 B;  2WXQ A;  2GMI C;  5HG2 A;  2NS5 A;  1Z2M A;  3CIR B;  1WJ6 A;  2O2V B;  1TZ1 A;  4HK2 A;  2IO0 B;  3ABV B;  2WXI A;  3EEC A;  1C4P A;  1VZ6 A;  3GP7 A;  2KK8 A;  1VZ8 A;  1P98 A;  3N3K B;  3OWE B;  1I4Q A;  3ZQ4 A;  3DVN V;  1C1Y B;  4RMA A;  5BYR A;  4RF0 A;  4KGT A;  3H7P A;  3NRZ A;  1AAR A;  2K0P A;  1FNV A;  3P4R B;  3X0W A;  2PVG C;  5HHD G;  3ETR A;  1M94 A;  1J7A A;  2KYW A;  1Q1O A;  5KHQ A;  4YXD B;  1DYQ A;  3TCA A;  3AE4 B;  1FNW A;  5E6P A;  1WRD B;  2YVC A;  3DBR I;  4LNF A;  1SJH D;  2W9N A;  3R66 C;  3ZW3 A;  4MT5 A;  1L2N A;  2V4L A;  1UBI A;  2QDF A;  1TS3 A;  1TBE A;  2MSE D;  1WJU A;  2D11 A;  5D3D A;  4BBN F;  3BVZ A;  2IY0 B;  3L16 A;  4M00 A;  2VH2 A;  3QWZ B;  4HCP B;  3GOE A;  2PIA A;  3FIL A;  2WXH A;  2W54 A;  2HJ1 A;  3Q14 C;  1S3S G;  2DNF A;  2WQY B;  4HPL B;  1Y56 A;  4IDI A;  1HXY D;  2JY6 A;  1IPG A;  2L8J A;  3AEB B;  3ZDM C;  1E90 A;  5AZG A;  4LNI A;  4MSQ B;  1EM7 A;  3A1Q B;  3VDZ A;  4JIO U;  2W3S A;  1B9R A;  4MJS A;  2W3R A;  3U7Z A;  1HZ6 A;  4RM8 A;  1ISN A;  4IW0 A;  1E7V A;  1SE9 A;  2JUO A;  4JLC A;  5TSS A;  2J4X A;  2MBE A;  3NZU A;  2WX1 A;  3R2I A;  4QAY A;  4NNJ B;  5AZF A;  3A9J B;  3Q3J A;  2X8X X;  1XO3 A;  2NR2 A;  2ZCC A;  4ZRI A;  2LRW A;  3AB5 A;  4A20 A;  5FR6 A;  2EKE C;  4ZRQ A;  4NY0 A;  3M3J A;  4LDT D;  1EWC A;  2IO3 B;  4KZC A;  2R61 A;  1ZW7 A;  2OJW A;  2ZCB A;  3SFD B;  2KQS A;  1KJT A;  2RSU A;  1V49 A;  1FIQ A;  2DAJ A;  2PW9 A;  1J0G A;  4RCO A;  1WGR A;  4MEM A;  1MHH E;  2N1V A;  2FID A;  1IBX A;  3NS1 A;  3KYC D;  2JYE A;  3EUB 2;  2KXJ A;  2X38 A;  4HPP A;  3QK0 A;  3C19 A;  2JF5 A;  4YT0 B;  4IC7 B;  4REZ A;  5G2N A;  1ZXH A;  1KFY B;  4RFB A;  1SEB D;  1YX6 B;  3VTU A;  1JWS D;  3WIM A;  1EU4 A;  1YQ4 B;  3IT6 B;  2BS3 B;  4A9A A;  3PV1 A;  2Z8L A;  4MAC A;  2WXN A;  2ZZP B;  1IUE A;  3WAM A;  1SE2 A;  3BYY B;  3W1Y A;  1HQR D;  2DLB A;  3MTN B;  3ZXR A;  3BWU D;  5L95 C;  4F8C B;  5JXV A;  3L54 A;  1FXI A;  2IGD A;  4DHZ E;  1KF6 B;  2KNB A;  1CJE A;  2PEA A;  3PLV A;  1WI0 A;  4N59 A;  4W9C A;  3U7D A;  5E6O A;  3PRE A;  4B6W A;  5C1Z A;  3P63 A;  3AM9 A;  3EFU A;  2Q5W D;  3B2G A;  1C3T A;  4KX6 B;  1G6J A;  1ZXI A;  1QQR A;  1RM6 C;  3O13 A;  1D6E C;  4OZB A;  3NG0 A;  2M19 A;  4HJK A;  2DYB A;  4MGI E;  3TSS A;  4ANX A;  3MP9 A;  3IXS A;  3CMM B;  2ON8 A;  2ASQ A;  1ZE3 D;  1FXT B;  1I42 A;  1WRI A;  2DEN B;  2L0F A;  4O1N A;  4GGQ A;  2OOB B;  4FLH A;  4IOI E;  3RUI B;  4WQM A;  2ZVN A;  4TQ1 A;  3ZTC A;  5HFY A;  2RGF A;  4RF1 A;  3QJZ A;  1H8C A;  1XCT L;  3EHV A;  3CSF A;  1HA5 A;  1ZGU B;  3LDZ E;  3SDL C;  2HTM E;  1I4X A;  4G50 A;  3VRB B;  4TV3 A;  4DBG A;  1MI0 A;  2QIL A;  1JQ4 A;  1FEH A;  3NVW A;  2HJ8 A;  2LUE A;  3RUL A;  1DOI A;  1V2Y A;  1LQB A;  4MM3 A;  3KUD B; 
#chains in the Genus database with same CATH homology
 2BPS A;  1J8C A;  5AZH A;  2KZR A;  1YIW A;  3A4S C;  1KOT A;  3QHT A;  3HIZ A;  4GN1 A;  4FUL A;  2MP2 B;  2MW5 A;  3NZS A;  5D6J B;  3DQV A;  4EFO A;  4HVB A;  3AUL A;  2KJR A;  3RZW C;  4GOC A;  2AWT A;  1XQQ A;  2KFK A;  3NS8 A;  3R7R A;  4HLE A;  1V80 A;  3VFK A;  1SGH A;  3WAN A;  3PS6 A;  5KHO A;  2ZVO A;  3QAR A;  4W9E A;  4BKG A;  1GC6 A;  2CKH B;  1R4M I;  2CHX A;  1GG3 A;  4XX5 A;  1WIA A;  3N32 A;  4I6N B;  2C7N B;  4II3 B;  4KIK B;  2N7D A;  1WM3 A;  1KLV A;  4GSW A;  3A33 B;  5J17 A;  2OJR A;  2KFJ A;  4ANW A;  3KH0 A;  1WJ4 A;  2Z0D B;  3AXC A;  5G55 A;  1GUA B;  4M8N A;  1UD7 A;  3H9D A;  4WJN A;  2ZNV B;  2DYM A;  3WA0 A;  2DX5 B;  2LJ5 A;  1E7U A;  5EDS A;  4AOF A;  2KAN A;  4J6I A;  4FA6 A;  4G11 A;  3TMP B;  2LGX A;  4IUM B;  4XC2 A;  2HD5 B;  2D07 B;  2D10 A;  5IA7 A;  3V6C B;  3QA8 A;  1OEY A;  1WGG A;  3KUZ A;  3V60 A;  3DVN U;  3V62 A;  4W9L A;  3UF8 A;  4LJP B;  2B3A A;  2ZPN A;  3DBS A;  4E71 A;  2KMA A;  3ZNZ B;  3JW0 X;  4BBN C;  1OTR B;  3CF6 E;  1WXM A;  2L3Z A;  2REX A;  2DZJ A;  2CU1 A;  1WMH A;  4FJV B;  4MH0 E;  1LXD A;  4DDG D;  3APF A;  4KSK C;  4W9H A;  2N1W A;  5CHV C;  2KJ6 A;  3RCZ A;  2MWS B;  2JZ3 B;  2KDI A;  3JSV A;  3MHS D;  2IBI B;  1V5O A;  4NJ7 A;  2O6V A;  3ZIM A;  4ZRJ A;  2L76 A;  2V3S A;  1OEY J;  3NOB A;  2K1F A;  1NDD A;  3S2A A;  2NPT B;  4DHJ D;  2R2O A;  2MP2 A;  4BOZ B;  2BWF A;  3L13 A;  4FHJ A;  1OGW A;  2M4N A;  2KMC A;  5GMV A;  1SIF A;  2BGF A;  2KJH B;  4MGK E;  3SHQ A;  3ZO5 B;  2DAF A;  2I1J A;  4GIV A;  4WQO B;  3ZVV A;  4IM0 A;  3B1L X;  1WF9 A;  3M95 A;  4GDL B;  1A5R A;  1PQS A;  3VUW A;  3UGB B;  4ZRK A;  4KVG B;  2G4D B;  4W9D A;  4II2 B;  2J0K A;  3VH3 B;  4W9I A;  3SU8 X;  3ZDT A;  4FAD A;  4JL9 A;  3AI5 A;  3A4R A;  4BKS D;  4DXA B;  4EZK A;  3PVL A;  3K9P B;  2GOW A;  2XK5 A;  3TBL D;  5L83 A;  1CMX B;  1UGM A;  1V6E A;  3PSE B;  1RLF A;  2DZM A;  3R7Q A;  3PHW B;  3EC8 A;  2KLG A;  2Z0E B;  4PYU A;  2MBH A;  4PS7 A;  4ASW C;  2KO3 A;  2IZV B;  2L05 A;  2KHW B;  4IG7 B;  1RFA A;  1Z5S B;  2L7R A;  1WGY A;  1WX7 A;  4TUU A;  3KYD D;  3JVZ X;  5LXH A;  4W9K A;  4AUQ C;  2AYO B;  4IM3 A;  3UQB A;  3CST A;  2N9X A;  3PGE A;  2LI5 A;  4K7S A;  3HM3 A;  4E3C A;  2FNJ B;  3VTV A;  1UH6 A;  2JVC A;  1WMH B;  1GJZ A;  4EZL A;  4HXD A;  1XD3 B;  3R3M A;  2LZ6 A;  2A5U A;  3V61 A;  2J0M A;  4IWQ A;  4K1R B;  1WE7 A;  5DPR A;  5JZE B;  4G3X B;  3VXW A;  2GBR A;  2KQ7 A;  2O6V B;  1WFY A;  3H7S A;  4AJW A;  4DHJ B;  5IAA C;  2NPT A;  4K81 A;  2R2Q A;  3M63 B;  3VUX A;  1QZE A;  3ENE A;  4K7U A;  4FJY A;  3HHM A;  2Z59 B;  3DDC B;  2GMI C;  1YD8 U;  1V81 A;  1YX5 B;  3VVW B;  4OVV A;  2A4Z A;  3DOW A;  2NS5 A;  4NPN A;  1Z2M A;  4NJ6 A;  2RR9 A;  2LGD A;  4I6L B;  2NCN A;  3RZF A;  4TQ0 A;  1VD2 A;  1WJ6 A;  2O2V B;  1TZ1 A;  2KTR B;  3PRM B;  4HK2 A;  2MBB B;  2RPQ A;  3B08 A;  4EKU A;  2KVR A;  2MA9 B;  2IO0 B;  4AWJ A;  4W9F A;  3EEC A;  4HPM B;  4F7Z A;  2KWU B;  1WXV A;  2KK8 A;  4MDK E;  5D7G A;  2QHO A;  2AEH A;  2LVO A;  2D2Q A;  3I3T B;  3K9O B;  1P98 A;  3IFW B;  3PRZ A;  4NAW A;  4WJP A;  3N3K B;  3SD5 A;  2LWP A;  2LAS A;  1WGH A;  2HE7 A;  1MG8 A;  2WDT B;  2BKF A;  4KV2 A;  2EMT A;  3DVN V;  4ICV A;  3OJ3 A;  1C1Y B;  4RMA A;  2FUH B;  3DCG A;  3H7P A;  2GBJ A;  1P3Q U;  4M0W B;  1AAR A;  2AL3 A;  4WWO A;  3X0W A;  1RRB A;  1NBF C;  1WXA A;  3WAL A;  1WE6 A;  2VRR B;  2MCN B;  4EEW A;  1UBQ A;  1R4N I;  3H6N A;  1M94 A;  2K6D B;  4FJZ A;  5CHF A;  1I35 A;  1Q1O A;  4OVU A;  5KHQ A;  3ZRC A;  2UYZ B;  3TCA A;  3PLU A;  2LRU A;  2WYQ A;  1E8X A;  3IG3 A;  1EUV B;  4XZ4 A;  5D2M B;  2LGY A;  3ZNG C;  4GU2 A;  5E6P A;  2FAZ A;  4WWN A;  1WRD B;  3Q3F A;  2YVC A;  3DBR I;  1EO6 A;  3P2B A;  4K7W A;  2W9N A;  3R66 C;  3GZN I;  3ZNH B;  2FCN A;  3OAW A;  3ZW3 A;  2CHZ A;  1L2N A;  2ZNV C;  1TGZ B;  4GB9 A;  2V4L A;  1UBI A;  3ZTD A;  3B0A A;  1V86 A;  1WX8 A;  1TBE A;  2MSE D;  1WJU A;  2D11 A;  4GMV A;  4EOY A;  4BBN F;  2LXC A;  2IY0 B;  3L16 A;  4HDQ A;  4A3P A;  1XT9 B;  3APC A;  3H1U A;  2KD0 A;  4BOS C;  2WWZ A;  3D32 A;  3QWZ B;  1E8W A;  1WYW B;  2KDF B;  3ZNI D;  4HCP B;  2UWQ A;  4LJO B;  2O2V A;  2BF8 B;  4DHZ B;  4DWF A;  3GOE A;  4PS8 A;  3UIO B;  2PJH A;  3V6E B;  2KX0 A;  3TIX A;  2NVU I;  2MLB A;  4LCD E;  1S3S G;  4FHK A;  4HPL B;  2JY6 A;  3ZDM C;  1IPG A;  2L8J A;  5DPW A;  2IY1 B;  1E90 A;  1BT0 A;  4MEL A;  5AZG A;  2D3G A;  4DDI D;  3L17 A;  4MSQ B;  3ZUN A;  4EUT A;  4GDL A;  3A1Q B;  4KZ0 A;  4IM2 A;  4JIO U;  3VDZ A;  4WWP A;  3QC8 B;  3WAO A;  4A3O A;  2K25 A;  4MJS A;  5DPT A;  3PHX B;  3HK0 A;  5BO4 B;  4RM8 A;  1ISN A;  1UEL A;  3H7P B;  4IW0 A;  3VQI A;  1V9J A;  1E7V A;  1SE9 A;  2LXA A;  3ALB A;  3DPD A;  2MRP A;  3VUY A;  2FCQ A;  2JUO A;  5J18 A;  4JLC A;  3MJW A;  4PS3 A;  2AL6 A;  2XK5 B;  4HWI B;  2FCS A;  4URK A;  2GBN A;  5LXI B;  2MBE A;  2MBO A;  2KDE B;  3AU4 A;  3NZU A;  2WX1 A;  3DBH I;  3PTF C;  1P9D U;  4NNJ B;  2K6Q A;  5AZF A;  2XBB C;  2LVP A;  2NBV B;  3A9J B;  2KTF A;  3Q3J A;  2KN5 A;  1YQB A;  5C23 A;  2NR2 A;  4IWO A;  2ZCC A;  3ECI A;  1T0Y A;  4ZRI A;  2K39 A;  4I6P A;  2MBQ A;  5AEK B;  2LRW A;  2K8B A;  1P1A A;  4A20 A;  1LFD A;  2N4F A;  4KDL B;  4MSM B;  5JHB A;  2V1Y A;  5FR6 A;  2EKE C;  1WGD A;  5CHW A;  1RAX A;  2JT4 B;  5CTR C;  4NY0 A;  2J7Q B;  2JPH A;  3BIN A;  3QX1 A;  1EF5 A;  3N30 A;  3M3J A;  4LDT D;  2IO3 B;  4KZC A;  3BY4 B;  3HM6 X;  1ZW7 A;  4GXB A;  3L08 A;  2JRH A;  3LJ3 A;  2ZCB A;  3U8Z A;  2PE6 B;  2KQS A;  4WJO A;  1KJT A;  3ZKJ C;  2IO2 B;  2RSU A;  2C60 A;  3PPA A;  3AU5 A;  1V49 A;  4X57 B;  3L10 B;  2DAJ A;  2PPH A;  5J2R A;  1J0G A;  4BFR A;  1UZX B;  1ZKH A;  1WGR A;  2JXX A;  3A9K A;  2N1V A;  1HE8 A;  4MEM A;  2DYO A;  2ZPY A;  1VCB A;  2FID A;  4HDO A;  1F9J A;  3T9L A;  2BKR B;  3KYC D;  3QCA A;  5TR5 A;  2BWE S;  2G45 B;  1YJ1 A;  2KXJ A;  2C7H A;  4BVU C;  2GBK A;  4HCN B;  4NQK E;  4WAA A;  1JRU A;  2BYV E;  3QK0 A;  2PE9 A;  3U30 A;  1WJN A;  4E74 A;  2KTR A;  2N9P C;  4B9K A;  2JF5 A;  3A1Q A;  3VTW A;  2K8H A;  4IC7 B;  5G2N A;  3APD A;  2IYD B;  1Q5W B;  4KSL C;  3QQ8 B;  2M17 A;  2MX2 A;  4MJS B;  1V5T A;  2NBW B;  1YX6 B;  2ZEQ A;  4AJY B;  3VTU A;  4ANV A;  2DZK A;  4NAW B;  3UQA A;  5E6N A;  3WIM A;  1EF1 A;  4CO7 A;  2I1K A;  4EZJ A;  3QIJ A;  2KOX A;  3PV1 A;  4ZDV A;  3RT3 B;  4GDK B;  1LM8 B;  4MGZ E;  2L0T A;  2ZZP B;  3OJ4 B;  3PRP B;  3KVF B;  3WAM A;  2KX3 A;  2JWZ A;  4P7I A;  4AP4 C;  2GBM A;  3DVG Y;  1WR1 A;  3W1Y A;  3KUC B;  5DCN A;  1WM2 A;  3MTN B;  3W1S C;  3PZD A;  2C9W B;  2G3Q B;  4JGH B;  5L95 C;  4F8C B;  4LDT B;  2HTH A;  1H4R A;  1E8Y A;  4G0N B;  5CX3 A;  2FCM A;  3L54 A;  3TJP A;  1E5W A;  4DHZ E;  2C5L C;  1IYF A;  4FN2 A;  3JSV B;  2KNB A;  2M1M A;  5JH5 C;  1WZ0 A;  1KM7 A;  2PEA A;  3O65 B;  3PLV A;  4IWP A;  1WI0 A;  5HKH A;  4W9C A;  3U7D A;  3ML9 A;  1WR6 E;  5D94 A;  2BYE A;  2RD0 A;  5E6O A;  3IBE A;  3PRE A;  3VH4 B;  4B6W A;  4FBJ B;  4N9F 4;  3UIP B;  3A9K B;  2M8S A;  4ZYN A;  3DBL I;  1Y8R C;  1E8Z A;  5C1Z A;  2DHZ A;  3M62 B;  2KC1 A;  1GC7 A;  1NI2 A;  2KWV B;  3ML8 A;  3PT2 B;  3EFU A;  2JRI B;  4RM9 A;  3W1S A;  3IVF A;  1OQY A;  1C3T A;  2N9E B;  4JQW C;  3VHT C;  1G6J A;  4F1S A;  3RYT A;  4WJQ A;  2YLM A;  1Q0W B;  2N7E A;  2KFK B;  4MGY E;  2WX0 A;  3QAQ A;  2BYF A;  2O6V D;  2C7M B;  4HJK A;  4YL8 A;  1K8R B;  2DYB A;  2FIF A;  4MGI E;  4NQL B;  2CS4 A;  4CYE A;  2NBU A;  3C0R B;  5DPS A;  3T8M A;  1P0R A;  3ZLZ A;  4ANX A;  1WH3 A;  1WZ3 A;  3L0W B;  3CMM B;  2KC2 A;  3RD2 A;  2KDB A;  4BKS A;  3VAW A;  4ANU A;  3TL5 A;  3DVG X;  2Y5B B;  2ASQ A;  1GNU A;  1FXT B;  1IP9 A;  4CHK A;  3OLM D;  3IHP C;  2KLC A;  1I42 A;  2DZI A;  2DEN B;  4KIK A;  4DK5 A;  2G4S A;  3X23 A;  2KKC A;  2L0F A;  2LD9 A;  3JYU A;  4PYZ A;  3KW5 B;  4GGQ A;  2ZJD A;  2OOB B;  4GDK A;  2CHW A;  3NHE B;  4FLH A;  2KWC A;  5JHA A;  1U4A A;  3RUI B;  1D3Z A;  1WY8 A;  2ZVN A;  2MQJ A;  2JZZ A;  4TQ1 A;  3ZTC A;  2CR5 A;  1X1M A;  2RGF A;  3WAP A;  3ZRF A;  4BKT A;  3QJZ A;  1H8C A;  3EHV A;  1S1Q B;  1TTN A;  3A9J A;  3CSF A;  3UIN B;  1ZGU B;  2EMS A;  3LDZ E;  3SDL C;  4B95 A;  4G50 A;  4TV3 A;  3NY5 A;  4DBG A;  2M0X A;  4M8M A;  2L00 B;  2HJ8 A;  2LUE A;  2LVQ A;  3RUL A;  1J19 A;  2XEW A;  1V2Y A;  5LLI A;  4KDI C;  2IO1 B;  3ONS A;  1LQB A;  1WXS A;  4W9G A;  4MM3 A;  4TKN A;  4ICU A;  2K8C A;  3KUD B;  1WX9 A;  2J0J A;  4W9J A;  1L7Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...