2KWCA

The nmr structure of the autophagy-related protein atg8
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
116
structure length
116
Chain Sequence
b'MKSTFKSEYPFEKRKAESERIADRFPNRIPVICEKAEKSDIPEIDKRKYLVPADLTVGQFVYVIRKRIMLPPEKAIFIFVNDTLPPTAALMSAIYQEHKDKDGFLYVTYSGENTFG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Autophagy-related protein 8
molecule tags Protein transport
source organism Saccharomyces cerevisiae
publication title The NMR structure of the autophagy-related protein Atg8
pubmed doi rcsb
total genus 18
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2010-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2kwcA00
3PHXB 3HHMA 2OJRA 3EECA 4MEMA 4BKGA 3MTNB 4BKSA 3VTWA 2BWES 3UF8A 2GBNA 4N9F4 2RD0A 3RCZA 3VXWA 4W9CA 1GG3A 2KVRA 5CTRC 3ZRFA 4ASWC 2G4DB 3CSFA 4PS8A 3SHQA 3ZTDA 1EF1A 2KOXA 1P0RA 1V80A 2KX0A 1YIWA 2JVCA 3WANA 2MP2A 2YVCA 4W9GA 1P3QU 2D10A 3SDLC 2GBRA 2IBIB 2IO0B 3IFWB 3PHWB 4WQOB 4M8NA 1V5TA 2KLCA 2LGYA 2ZEQA 3V6CB 1YJ1A 2N7DA 4GN1A 2DAFA 4LCDE 2M8SA 3TMPB 1KOTA 2ZNVB 4GGQA 2I1KA 3KUDB 2ZVOA 2RR9A 1F9JA 1TBEA 2KFJA 2LRWA 5C23A 4LDTB 4AP4C 3P2BA 2HJ8A 4MJSB 2O6VD 2C9WB 3Q3JA 3TCAA 3NZSA 3WAMA 3CMMB 2ZJDA 4GSWA 4GB9A 1TZ1A 1WXVA 3VAWA 3APDA 3R7QA 5E6OA 1E7UA 3W1SC 4JQWC 1TGZB 1IPGA 2W9NA 2GOWA 2K6QA 2LUEA 4B9KA 3ML9A 4HPLB 3L54A 2LGDA 4IC7B 3VUWA 3QX1A 1Z5SB 2FIFA 3DOWA 3A9KB 2L00B 1J8CA 1V2YA 3QC8B 4II3B 2G45B 3TL5A 1LXDA 2LXAA 3U7DA 2CHXA 4B95A 2NBVB 2FCQA 2IO3B 2WWZA 3RZFA 1WM3A 2Z0EB 4J6IA 2KDIA 2K8BA 2MBOA 1OEYA 2DZJA 3NOBA 4RMAA 4KVGB 4IM0A 5D94A 1UBQA 2N9XA 3R3MA 3QK0A 3H1UA 4KV2A 3VFKA 2DYOA 2KO3A 3TJPA 4K7SA 3W1YA 2M17A 2O2VB 5GMVA 2K8CA 3PLVA 2LWPA 2IO1B 1Q0WB 2JUOA 5HKHA 3QA8A 1K8RB 2XK5A 4G0NB 4GMVA 4EUTA 4MDKE 1UD7A 2NR2A 5CHVC 4W9DA 4AJYB 2DAJA 3PRZA 4CYEA 3B0AA 1GC6A 2AEHA 2LVPA 2MCNB 2KTFA 4WJOA 2NBUA 3HM6X 3DQVA 2M4NA 4CO7A 1ZKHA 3V61A 4FLHA 3B08A 1C3TA 3L0WB 4WWPA 3ZTCA 3GOEA 1QZEA 1WXAA 2NBWB 2JPHA 1UZXB 4BFRA 1A5RA 2KKCA 2M0XA 4NNJB 4KIKB 1EUVB 2MWSB 1IP9A 2GBKA 2KZRA 1G6JA 2J0KA 1AARA 1P9DU 4ANVA 3QHTA 4DHJB 4FHKA 3ZNID 2PJHA 1V5OA 2BKRB 5JHAA 3QQ8B 3AULA 1S1QB 4EEWA 2MSED 3H7PA 2UYZB 5J18A 2K1FA 3VH4B 3ZO5B 3X23A 2Y5BB 3RZWC 1E8WA 3N3KB 3QARA 1C1YB 1EO6A 2BPSA 3APCA 1YQBA 2KHWB 1YD8U 4IWOA 1WIAA 1I42A 5CHFA 4DBGA 1Y8RC 3L10B 2HD5B 1XT9B 2KQ7A 3QAQA 4AJWA 2PE6B 3T9LA 3UINB 2IYDB 2O6VA 2JRHA 3OLMD 4ANXA 1WJNA 1I35A 2AWTA 4HLEA 5TR5A 2KDBA 4TKNA 4TQ1A 2LJ5A 2K39A 3DBHI 4G11A 2R2OA 5C1ZA 1NBFC 2BKFA 3B1LX 3VQIA 1L7YA 3AXCA 3UIOB 1E7VA 2LXCA 3VH3B 3CSTA 4KSLC 3WA0A 1VD2A 4CHKA 3K9PB 4P7IA 1XQQA 1YX6B 2D07B 3IHPC 3HIZA 1GC7A 2BWFA 2KNBA 3DPDA 4GIVA 1HE8A 1V9JA 2MBQA 2GBJA 4HXDA 1GNUA 2KX3A 4IWPA 3PVLA 1P1AA 2J0MA 4PYZA 1WFYA 3OAWA 1YX5B 4HVBA 1Q5WB 1LFDA 2MRPA 5CX3A 4URKA 1WGYA 2KN5A 4F8CB 3PREA 2V1YA 4GDKB 4M8MA 3DDCB 3QJZA 3IG3A 1LQBA 3PPAA 2KXJA 1WH3A 4FJYA 3PTFC 3RULA 4OVUA 4G3XB 3A1QA 3ALBA 4MM3A 5FR6A 1WE6A 1VCBA 3PRPB 1X1MA 2IO2B 1WZ3A 1S3SG 3PZDA 1J0GA 2JXXA 2A4ZA 2MX2A 4DDID 1GJZA 2NPTB 1XD3B 2KANA 2N9EB 3IVFA 5G55A 1UGMA 3VTVA 2ZVNA 4B6WA 5DPRA 1E8ZA 1BT0A 2N1WA 4BOSC 1UELA 2KQSA 1TTNA 4W9KA 5G2NA 4JGHB 4JIOU 1OTRB 3JSVA 4GDLB 2REXA 5EDSA 4LJPB 2EMTA 4ICUA 4KSKC 3A33B 4MSQB 3VUYA 2R2QA 3A4SC 4FJVB 2LVOA 4WJPA 1WR6E 2ASQA 2C60A 3OJ4B 4IWQA 2KLGA 4NPNA 3VUXA 4AWJA 1FXTB 2HE7A 3H7SA 5D6JB 1SGHA 1RFAA 2JT4B 4BBNF 2EKEC 2N4FA 1RLFA 2AL6A 2C5LC 5AEKB 4PYUA 1V49A 4FN2A 1WY8A 2AYOB 2CKHB 3C0RB 3ZNGC 1OQYA 3DVGX 3RT3B 4NJ7A 1L2NA 1WMHA 1NI2A 2KD0A 4MSMB 4PS3A 1WXMA 3CF6E 4X57B 4ZDVA 3V6EB 3L08A 5J17A 4AUQC 4JL9A 2CU1A 5DPTA 1J19A 1OEYJ 2KWVB 3HK0A 1WGRA 4TQ0A 2CHZA 1KJTA 3M63B 3A4RA 1JRUA 4EOYA 4FHJA 2Z59B 3EC8A 1EF5A 1P98A 5LXIB 2NS5A 4ZRKA 2VRRB 3BINA 2MBEA 3ENEA 3S2AA 3A9JB 4LJOB 2N7EA 2L0TA 4IG7B 2MW5A 3QIJA 4WWNA 2WDTB 5J2RA 3EHVA 4K7UA 3N32A 3KUZA 2LZ6A 2D2QA 1GUAB 3K9OB 2MQJA 2FCMA 3WAPA 4WJNA 4W9EA 1H8CA 1R4MI 3M62B 3M95A 3IBEA 1WE7A 2K25A 4DHJD 3PT2B 3NHEB 4MGZE 1PQSA 2L3ZA 3NY5A 1E8XA 5L83A 2PPHA 3D32A 3UGBB 3TIXA 4DXAB 3DVNU 3UQAA 2JY6A 3KYCD 2FCNA 3EFUA 3L17A 2L05A 4EKUA 3H6NA 3Q3FA 4FJZA 2LI5A 2GMIC 1ZW7A 4EZJA 3DBSA 3SU8X 3ZUNA 3KW5B 1D3ZA 5BO4B 1KLVA 4II2B 1SIFA 3WALA 2UWQA 2KTRB 1WJ4A 3AI5A 2ZCBA 3TBLD 3PRMB 4EZKA 3BY4B 2JZZA 3NS8A 4NAWB 2GBMA 4ANUA 5AZHA 2JWZA 4I6NB 4FBJB 3DCGA 3PSEB 4HDQA 2JZ3B 5E6NA 2FAZA 2J0JA 3PS6A 4WAAA 4ICVA 2BYEA 3VHTC 3VVWB 1E8YA 3ZDMC 2BGFA 1E90A 2L76A 2FUHB 1IYFA 2I1JA 4RM8A 1UH6A 2C7MB 2EMSA 2KC1A 2NCNA 5IA7A 3WAOA 4TV3A 2PE9A 3A9KA 2BYVE 3ZDTA 3I3TB 2RPQA 1OGWA 1WGHA 2J7QB 3GZNI 4GXBA 1WGGA 5KHOA 4EFOA 2KWCA 2DYBA 1H4RA 2NPTA 2FIDA 5AZGA 2XEWA 3ECIA 3ZNZB 2K8HA 4IUMB 4XC2A 4XX5A 4FA6A 1V86A 2L0FA 3ZVVA 4K81A 4FULA 3JSVB 4GDLA 4KIKA 2DZMA 2O2VA 3T8MA 4K1RB 4DDGD 4NQLB 4ZYNA 1RRBA 1LM8B 2JRIB 1T0YA 5D2MB 4ZRIA 4DHZB 1CMXB 2KMAA 3JYUA 4FADA 2RGFA 5DPSA 3X0WA 2KFKB 2KJ6A 3ZIMA 5JZEB 3KYDD 2IY1B 3VTUA 2CHWA 2LASA 4I6LB 3H9DA 3V60A 3NZUA 2MLBA 2JF5A 4MH0E 2K6DB 3JW0X 2B3AA 3V62A 2L7RA 2V4LA 2XBBC 4E3CA 4F7ZA 2WYQA 4EZLA 2M1MA 4PS7A 3L13A 4TUUA 2KJHB 2DX5B 3QWZB 1WF9A 2DHZA 2MP2B 4NY0A 2KMCA 2IY0B 2ZZPB 3DBLI 1WJ6A 3H7PB 3APFA 3KVFB 1U4AA 4M0WB 1NDDA 3M3JA 5IAAC 2IZVB 4I6PA 2C7NB 2DENB 4GU2A 5JH5C 1Q1OA 3U8ZA 3MHSD 2CS4A 4ZRJA 3VDZA 1RAXA 4YL8A 2WX1A 3AU4A 1R4NI 5E6PA 3ONSA 2BF8B 4LDTD 2ZPNA 2HTHA 1WX8A 3RUIB 3ZNHB 4MELA 2AL3A 2BYFA 2MBHA 3QCAA 4MJSA 3LJ3A 3MJWA 2LRUA 4K7WA 4W9IA 5JHBA 4GOCA 4W9JA 1ISNA 2DZIA 4HPMB 2V3SA 4GDKA 1E5WA 3DBRI 1WGDA 2KC2A 2WX0A 3PGEA 4KDLB 4A20A 2OOBB 2L8JA 3UQBA 4OVVA 2N9PC 4BKSD 2KWUB 1WZ0A 1WX9A 3A1QB 2NVUI 4KDIC 2Z0DB 3PV1A 4W9HA 3W1SA 2ZNVC 4W9LA 4IW0A 1V6EA 4HDOA 3U30A 4ANWA 4W9FA 2KDEB 1WRDB 4DWFA 1MG8A 4HCNB 5CHWA 3ZRCA 4F1SA 1WJUA 4HK2A 4IM2A 4WJQA 4AOFA 1WR1A 1Z2MA 1WYWB 4IM3A 2FNJB 2KTRA 4KZCA 2LGXA 3ML8A 2XK5B 4NAWA 3DVGY 2DZKA 2PEAA 3JVZX 4BOZB 3RYTA 2FCSA 1WX7A 4MGKE 3O65B 4A3OA 4BBNC 3ZKJC 4HJKA 4DK5A 2C7HA 4HCPB 2QHOA 5LLIA 2LD9A 2MA9B 4NJ6A 4HWIB 2D3GA 4KZ0A 3HM3A 4E74A 2KJRA 3UIPB 3RD2A 4XZ4A 3ZW3A 4DHZE 5LXHA 2LVQA 2ZCCA 5AZFA 2YLMA 4G50A 3KUCB 3ZLZA 3PLUA 2ZPYA 3R7RA 1V81A 2A5UA 1WXSA 2KK8A 3N30A 4MGYE 4BKTA 4BVUC 5KHQA 5DPWA 3R66C 3DVNV 2D11A 1KM7A 1WI0A 2G4SA 2MBBB 1ZGUB 4NQKE 1UBIA 5D7GA 1SE9A 1WM2A 3SD5A 4MGIE 3A9JA 4WWOA 2O6VB 3WIMA 2N1VA 2CR5A 2DYMA 3LDZE 2RSUA 3KH0A 2KFKA 1WMHB 2G3QB 3OJ3A 5DCNA 2KDFB 3AU5A 4A3PA 5L95C 3L16A 4RM9A 4JLCA 4E71A 1M94A
chains in the Genus database with same CATH superfamily
2J4XA 3HHMA 4MEMA 1GG3A 2KVRA 5IKCM 2G4DB 3CSFA 4A55A 4PS8A 2CJOA 1EF1A 2KOXA 4YSZB 2KX0A 1YIWA 2JVCA 2MP2A 1HTOA 1P7FA 2LGYA 3V6CB 1KFYB 3W5VB 2N7DA 4GN1A 4LCDE 2M8SA 2I1KA 4ITKA 1F9JA 4MJSB 4OZBA 3ZJUA 2GLSA 3APDA 5E6OA 2AX5A 2K22A 1TGZB 4K3CA 2L83A 3VUWA 1Z5SB 3RN9C 2L32A 5LNK1 1J8CA 3QC8B 4OW0A 4DXGA 3VR8B 1QLBB 1WM3A 2KDIA 3SEBA 3NOBA 4RMAA 3KQ4A 4IM0A 3TEXA 1YN4A 4YXDB 3H1UA 3Q8EA 3DBRB 4C80A 5HKHA 2XK5A 4GMVA 2RPVA 1TS2A 1TKGA 3PRZA 3B0AA 2LVPA 3DQVA 1B1ZA 3ABVB 3L0WB 2LHEA 3E56A 2JSVX 1E6EB 1JMLA 2KKCA 4NNJB 4M01A 1EUVB 1AW7A 3HVDA 1IP9A 3SFDB 1AARA 4DHJB 2OHFA 3IT4B 3Q3OC 4JX1C 2PJHA 3QQ8B 1S1QB 3H7PA 2K9XA 3J9CA 3VH4B 3N3KB 3N1YC 3PZ8A 1IGCA 2KQ7A 2L52A 4AJWA 1KLGD 4ANXA 2AWTA 4HLEA 1C9FA 4TQ1A 2N9KA 3FKYA 2K0PA 4G11A 5C1ZA 2BYTA 1R4MB 1N61A 1EU3A 3AXCA 2LXCA 3AEEB 3WA0A 1VD2A 4KX6B 4P7IA 1XQQA 4GIVA 2BWFA 3TCAA 1V9JA 2J0MA 1T0RC 1WFYA 3OAWA 2WHIA 4KGSA 4AS1A 4ZRQA 4FJYA 1ACCA 3PTFC 4G3XB 4XYCA 2HDEA 4IDIA 2IO2B 3PZDA 1J0GA 3KWLA 2N9EB 4N58A 4BOSC 2I2YA 1L4ZB 2KQSA 1TTNA 4JGHB 1YNTE 5EDSA 4LJPB 4ICUA 2LHDA 4D2KA 2ASQA 4IWQA 2BQQA 1N62A 1IBXB 1VR9A 1RFAA 3AV8A 2EKEC 2N4FA 4B0MA 1TKYA 3N1ZC 1YMHE 3FILB 2CJNA 1E9MA 4MH8A 4NJ7A 2KD0A 1VRAB 3AEAB 4ZDVA 3V6EB 3L08A 2JYEA 2WXIA 3RPFC 5J17A 3LYYA 4M0WA 1OEYJ 2KWVB 1WGRA 4ACFA 3A4RA 1HQRD 5LXIB 4ZRKA 4NZLB 3BINA 5EE1A 3A9JB 3N20C 1WRIA 4TMAB 3ZJVA 3QIJA 4WWNA 4C7YA 3EHVA 4K7UA 2WXNA 4C7ZA 2WS3B 2D2QA 1J7AA 3AE4B 4W9EA 1H8CA 1R4MI 3M95A 3EA6A 3PT2B 2WXMA 2RDBC 2L3ZA 1PGXA 2PPHA 3TIXA 3ETRA 2JY6A 2WDVB 2FCNA 1TS5A 2L05A 3H6NA 3ZUNA 4S17A 1SIFA 2KVZA 3WALA 2UWQA 2ZCBA 3AE3B 5AZHA 4I6NB 4HDQA 2FAZA 1T3QA 2HTME 2J0JA 1SE4A 3VVWB 3VHTC 1ET6A 3AEDB 1E90A 4RCOA 2L76A 1A70A 1I7HA 1XEEA 2NCNA 5IA7A 2M19A 3I3TB 4RGMA 2INDC 2KWCA 1H4RA 2NPTA 5AZGA 3ECIA 4IUMB 4YT0B 2L0FA 2EKIA 1I4XA 2PTLA 2O2VA 4ZYNA 1LM8B 1T0YA 1DGJA 4OZCA 2KYWA 2RDHA 2KJ6A 2WU2B 3VTUA 2CHWA 4ARCA 2LASA 4I6LB 2MEKA 4US8A 1GAQB 1SE2A 1F0ZA 2Y3AA 3V62A 2B3AA 2L7RA 2V4LA 2WXOA 4REZA 3NS1A 4F7ZA 3L13A 4RH6A 3W2DA 3NVWA 2DHZA 2MP2B 2KMCA 4O1NA 1WJ6A 4M02A 3Q69A 1PUTA 2DENB 1Q1OA 3U8ZA 4LNFA 1RAXA 4YL8A 3AU4A 3ZXVA 3NG0A 1R4NI 1I4GA 2BF8B 4LDTD 2ZPNA 1GB4A 2BVCA 3RUIB 4MJSA 2AL3A 4MELA 3MJWA 1ISNA 2DZIA 1OQRA 2SAKA 5HI1A 2DNFA 1XLNA 2WXKA 2QCZA 2OOBB 3UQBA 4LNIA 1RFKA 5HFYA 3W1SA 2ZNVC 3BVZA 4W9LA 4WH4A 3AMZA 2DLBA 4DWFA 3WCQA 1FFUA 2GRIA 2XN9C 3PZ7A 5CHWA 1WJUA 4WJQA 4IM3A 2XK5B 4NAWA 1SB3C 1VLBA 2PEAA 2ONQA 3ZXRA 4A3OA 1CZPA 2IGGA 3O65B 3ZKJC 2VH1A 5JXVA 1F77A 5LLIA 2WGSA 1VZ8A 1WYGA 3URYA 3ZGZA 1KLUD 4G50A 2AQ2B 2ZPYA 3R7RA 1WXSA 3N30A 3DVNV 2D11A 1KM7A 2G4SA 1ZGUB 5D7GA 2V0GA 2QC8A 2LFIA 2MJ3A 3OJ3A 3AB5A 2JYTA 4JLCA 3TJPA 3CIRB 1FEHA 3PHXB 3NVZA 4BKSA 2BWES 2GBNA 1CJEA 4N9F4 2RD0A 1XLOA 5CTRC 3ZRFA 4HJGE 1TYGB 1QKZA 3AEGB 3WANA 2YVCA 4W9GA 1P3QU 2D10A 3SFEB 2GBRA 3Q6BA 3IFWB 3MFGA 2BB5A 2HJ1A 4M8NA 2KLCA 2ZNVB 1D5ZC 2ZVOA 2LRWA 2AQ1B 4AP4C 3P2BA 3BK2A 2JWUA 5T8IA 1WXVA 1IPGA 4HPLB 2EELA 5H8YE 1AYFA 1L5PA 2L00B 3DOWA 3U7DA 4II3B 5D3DA 2G45B 1LXDA 2WXHA 4B95A 2WWZA 2Z0EB 2GI9A 4A9AA 2MBOA 1OEYA 2DZJA 1UBQA 3DHHC 3QK0A 4KV2A 1F2RC 2KO3A 1VZ7A 1IBXA 1BMLC 2K8CA 2LWPA 2IO1B 2JUOA 2JQRB 4LNKA 2TSSA 4EUTA 2N9LA 5CHVC 5BYRA 3LXFA 2AEHA 2KTFA 3V61A 3B08A 5I4DA 1IUEA 3GOEA 1QZEA 2NBWB 2JPHA 2M56B 4KIKB 4FXCA 1EU4A 2KZRA 1FXAA 4FHKA 3ZNID 1V5OA 1QILA 1FD6A 3VRAB 3X23A 4JPSA 1E8WA 1C1YB 1EO6A 3AE6B 1YQBA 2KHWB 1I42A 1WIAA 5CHFA 1Y8RC 3L10B 2PE6B 3UINB 4US9A 1VZ6A 4A8XC 1I35A 1SEBD 2V3NA 1N5WA 5TR5A 2KDBA 2J42A 4TKNA 1UGJA 1FNUA 4ARIA 1MFWA 1T6BX 2WNMA 2R2OA 2BKFA 3VQIA 3VH3B 3N9YC 4RGOS 5E6JA 1YX6B 4QAYA 3RNFC 4HPPA 3C19A 4URKA 1WGYA 5BYSA 4A6QA 4GDKB 4M8MA 3QJZA 1LQBA 5IN7A 3PPAA 1RM6C 3A1QA 3ALBA 4JWSC 5FR6A 2KWDA 2JXXA 4TSSA 2NPTB 2KANA 1UGMA 2ZVNA 1E8ZA 2ZW0A 2N1WA 1J7BA 5G2NA 1MG4A 4KSKC 3VUYA 4FJVB 1WR6E 1CQVA 1BUIC 4AWJA 4NPNA 3H7SA 4HEA1 3HVZA 2KT7A 2AL6A 2N0SB 2C5LC 5AEKB 4PT5A 4FN2A 1C4PA 2AYOB 3BYTB 3ZNGC 1OQYA 4PS3A 5IOIA 4JL9A 3P4PB 4N59A 4TQ0A 2CHZA 4EOYA 4FHJA 3EC8A 1EF5A 2KACA 4C4VA 1JRPA 3EUB2 2VRRB 2MBEA 3BWUD 4LJOB 4N6EB 1FMAD 2RMMA 2LZ6A 4P16A 1FXIA 3RMKC 2MQJA 5C3JB 2IPKD 4WJNA 2W3RA 4YTPB 2K25A 4DHJD 1F52A 3AE1B 3NY5A 1E8XA 3D32A 2D3AA 1UNSA 3GP7A 4XGAB 4EKUA 2WXQA 3AE5B 2JZPA 2GMIC 1GOZA 2LI5A 3RNAC 4EZJA 3SU8X 3Q8BA 3KW5B 3OG5A 1WJ4A 4EZKA 3NS8A 4NAWB 1TJEA 4OHJA 2JWZA 4P1BC 3PSEB 4ICVA 2K3UA 3OWEB 1VJKA 2W3SA 1IYFA 2I1JA 2C7MB 3DHIC 2EMSA 4RGNA 3WAOA 1C4CA 2WQYB 2PE9A 3A9KA 2RPQA 5EE0A 2DYBA 3ZVVA 5FKAC 4GDLA 3BVMA 3T8MA 4DDGD 1RRBA 2JRIB 1WWTA 1CMXB 2KMAA 2RGFA 1ZUD2 4KKJA 3ZIMA 2J52A 1MPEA 1ROEA 1FCCC 2MLBA 3NRZA 4A90A 2XBBC 3RNCC 2M1MA 2VH2A 2KJHB 1E10A 2DX5B 1WF9A 1T5XD 1STEA 4I6PA 3I57A 1HA5A 4GU2A 5JH5C 3ONSA 1QT9A 3DHGC 4YTMB 3ZNHB 1R7SA 3HUIA 3LJ3A 4GOCA 3R2TA 2RDGA 2KMMA 2KC2A 2WX0A 3PGEA 2I38A 2L8JA 4OVVA 2N9PC 4BKSD 3T3OA 2KWUB 1WZ0A 4IW0A 4HDOA 3RNGC 4LK0M 2PKOA 3AH7A 1JWSD 1YQ4B 1DOXA 4F1SA 2OJWA 2WDRB 4LTUA 1WYWB 4KZCA 5IO9A 2BB6A 3DVGY 3JVZX 3B2FA 4DK5A 3TEYA 1CK1A 1I4QA 3U7ZA 1PGAA 4BAXA 3HM3A 1AWDA 2WXLA 3UIPB 3RD2A 3L4PA 4DHZE 5LXHA 2ZCCA 4RF0A 3KUCB 3ZLZA 3PLUA 3AE7B 2A5UA 1TT5B 4MGYE 4BVUC 4BKTA 1V8CA 3E9SA 4WAFA 1UBIA 2LGIA 3IAS1 3P63A 1SE9A 1WM2A 3SD5A 4MGIE 3A9JA 4WWOA 3WIMA 1ZP0B 1WMHB 3Q8CA 4RM9A 2OJRA 1YJJA 2YEPF 3VTWA 3Q2AC 3UF8A 3RCZA 4W9CA 4ASWC 3ZJTA 1V1PA 2PIAA 1YJIA 1KH0A 1P0RA 3SDLC 2IBIB 2IO0B 1TIFA 4C56C 1V5TA 5BYQA 2ZEQA 1YJ1A 4MACA 1KOTA 2DAFA 2PVGC 4GGQA 3KUDB 1QQRA 1TBEA 2KFJA 2QMTA 2ZW1A 3WAMA 3NZSA 3CMMB 4GSWA 4GB9A 1TZ1A 5G5HA 3VAWA 3R7QA 3GE8C 2PW9A 4JQWC 2W9NA 4B9KA 1FPYA 1K50A 3QX1A 5EE9A 3PO0A 1V2YA 2PLPA 3TL5A 2CHXA 4WQMA 4XDCA 4YTNB 1T0SC 1GPXA 2K8BA 2FBWB 4KVGB 2N9XA 4K3BA 3IXSA 4K7SA 3W1YA 2M17A 2O2VB 3TSSA 1Q0WB 2AQ3B 3QA8A 3BZDB 1SJED 4G0NB 1BXTA 4WURA 4AJYB 3V3XA 2QDFA 1GC6A 2MCNB 1M4VA 2NBUA 3BYYB 4FLHA 3Q8FA 1PDXA 4WWPA 3ZTCA 2CU3A 1WXAA 1DOYA 1FIQA 1UZXB 1I4PA 2MWSB 2GBKA 1YOVB 2QIEB 2J0KA 2BKRB 2LUMA 3DBHB 5J18A 4EEWA 2UYZB 4GLSC 2K1FA 3ZO5B 3QARA 1I4HA 1RYJA 3W9CB 1QOAA 3APCA 2D3BA 1MHHE 2HD5B 1XT9B 1C77A 2ICIA 3T9LA 2IYDB 2O6VA 3TEWA 3OLMD 1HXYD 3SR6A 1C79A 2LJ5A 2K39A 3DBHI 1NBFC 2V9HA 3B1LX 1N5XA 4M00A 1SIJA 4KSLC 4CHKA 2NMQA 3K9PB 2Q5WD 3IHPC 1GC7A 4HXDA 1HE8A 2GBJA 2MBQA 2KX3A 1MJDA 1FM0D 3HRDD 4PYZA 2BS2B 4HVBA 3U4EG 5CX3A 2KN5A 3PREA 3DDCB 4JE3B 3RULA 5AUIA 2NTTA 4MM3A 1D6EC 1WE6A 3EFCA 1VCBA 3PRPB 1WZ3A 1S3SG 1GJZA 1IGDA 2A4ZA 2ACZB 1GB1A 3MC0B 4B6WA 1F1HA 5DPRA 1BT0A 1UELA 2H88B 4W9KA 1OTRB 4GDLB 2REXA 2EMTA 4IKGA 4MSQB 3A4SC 4WJPA 2C60A 3OJ4B 3VUXA 1FXTB 5D6JB 1SGHA 1V49A 1WY8A 3RT3B 1P7EA 2WP9B 1FFVA 4X57B 2G1EA 1FO4A 5DPTA 1J19A 3HK0A 1NVID 1KJTA 5IP4D 2LMCA 1JRUA 2Z59B 1R4NB 1P98A 2NS5A 3KLSX 3ENEA 3S2AA 2DBYA 2MW5A 2WXFA 2WDTB 5BMGA 2XNAC 1GUAB 3K9OB 2G9HD 2FCMA 1JWMD 2DWQA 3LB8C 2M0AA 1WE7A 2PVOD 2E6XA 3MP9A 2MHJA 2FUG1 3DVNU 3P1MA 2W54A 3B9JA 4FJZA 3Q3FA 1UUPA 1DYQA 3P4SB 2YEPB 2QSDA 2WDQB 3TBLD 2JZZA 1OFFA 2X8XX 2FE8A 3AE9B 2INPE 4ANUA 4XE0A 4FBJB 3DCGA 5E6NA 1SJHD 3PS6A 1WXQA 4WAAA 3ZYYX 1E8YA 1PYWD 5G5GA 4RM8A 3AECB 3NZ3A 1UH6A 4TV3A 4AQ7A 3GZNI 2J7QB 4GXBA 1WGGA 5KHOA 2FIDA 3MC8A 2XEWA 1N63A 3ZNZB 2K8HA 4XX5A 4XC2A 1V86A 4K81A 4FULA 3JSVB 3MC9A 4KIKA 5D2MB 4DHZB 3EGRA 5H92C 5HHDG 3JYUA 4FADA 3B2GA 5DPSA 3X0WA 2Y5PA 2W82A 2IY1B 3U52E 2KN4A 3H9DA 1PGBA 3V60A 4P1CC 5GXGB 1L4DB 4MH0E 2IJ0A 2D5GA 4E3CA 2WYQA 4EZLA 1V1PB 2X38A 4TUUA 3QWZB 1C76A 4NY0A 2ZZPB 3DBLI 3H7PB 3KVFB 5IAAC 2L1AA 2KDMA 1YN5A 2GB1A 2C7NB 3I5JC 2CS4A 4IOIE 3VDZA 3TUOA 2WX1A 5E6PA 4DXFA 1WX8A 1XF5L 2MBHA 2LRUA 1ENFA 4K7WA 1SSNA 1LO5D 5TSSA 4GDKA 5AUKA 3DBRI 4KDLB 2JX5A 1WX9A 3A1QB 2Z0DB 3PV1A 4KKIA 4OVZA 1V6EA 3U30A 4ANWA 4W9FA 2KDEB 3MHZA 1MG8A 1TS3A 4YSXB 3VR9B 3ZRCA 4IM2A 1SXTA 2WXRA 1WR1A 4L2YA 1OQQA 2KTRA 1HZ6A 2DZKA 1K53A 3GB1A 2V4IB 4BOZB 3RYTA 1WX7A 1XLPA 3AEBB 4MGKE 4BBNC 4HCPB 1XCTL 2LD9A 2MA9B 4NJ6A 1TKEA 2D3GA 2WU5B 4E74A 2H89B 1ZOYB 2ON8A 4XZ4A 2INNE 3ZW3A 1ZDXA 3DWGC 2WXGA 5AZFA 1FNWA 3FC4A 4L23A 1V81A 1ZPSA 2KK8A 5KHQA 3R66C 4C4VB 1ZXIA 1WI0A 1QOBA 3DBLB 1JWUD 2SEBD 3FILA 3GE3C 1D5XC 2O6VB 2CR5A 4RNAA 2KFKA 4RFBA 5C2TB 3AU5A 4A3PA 5L95C 3L16A 1L0VB 4E71A 1M94A 4YSYB 1K51A 3EECA 1JW9D 4BKGA 1SF0A 3MTNB 3Q3MC 1WSPA 4HKZE 3VXWA 1VDVA 2MH7A 2PMVA 1TY0A 3SHQA 3ZTDA 1E0ZA 3Q8AA 1V80A 4C00A 1NYRA 4L1BA 3PHWB 3P4RB 4WQOB 4S0RA 1ESFA 1FCLA 1NI3A 4OZAA 3TMPB 5HG2A 1YN3A 2RR9A 1FNVA 3I63C 5C23A 2QEJC 4LDTB 3RI7C 2HJ8A 2O6VD 2C9WB 3Q3JA 2ZJDA 1NEKB 3FAHA 1D5MC 4MM3B 5D3IB 3BIID 1E7UA 3W1SC 2GOWA 2K6QA 2LUEA 4R3DA 3ML9A 2KAJA 3L54A 2LGDA 4IC7B 3NUHB 2FIFA 4LNNA 3A9KB 1FRDA 2LXAA 2NBVB 2D3CA 4ZYSA 2FCQA 2IO3B 3RZFA 4J6IA 2QJLA 1ZE3D 4P6VF 5D94A 2KQ4X 3R3MA 3VFKA 1ET9A 2DYOA 5GMVA 3IAM1 3PLVA 1TS4A 1K8RB 1MVKA 4MDKE 1UD7A 3O13A 2NR2A 2WXJA 2DAJA 1HEZE 4CYEA 3BK1A 4WJOA 3HM6X 1C78A 4CO7A 2M4NA 1ZKHA 3KWVA 2BTEA 1C3TA 1JWBD 3Q3NC 1XCQL 1L6UA 1XXGA 3C8YA 3MJ5A 1A5RA 4BFRA 4CQNA 2M0XA 2JXTA 1G6JA 4KGTA 1P9DU 3QHTA 4ANVA 1TY2A 5JHAA 3AULA 2MSED 2Y5BB 3RZWC 1I4RA 2BPSA 1KRHA 1YD8U 4IWOA 4DBGA 1EM7A 3RFZB 3QAQA 2BS3B 2JRHA 1WJNA 1XO3A 3AEFB 1L7YA 3UIOB 1E7VA 2WLBA 2BBCA 2INCC 3CSTA 1LGRA 1L0YB 1V1OA 1MI0A 2D07B 3HIZA 4W9DA 2KNBA 3DPDA 1L0XB 4IWPA 2QILA 1GNUA 2N7JA 3PVLA 1JWAD 1P1AA 3AM9A 1YX5B 1Q5WB 1LFDA 2MRPA 4F8CB 1UWXA 2BS4B 2V1YA 4ZRPA 3IG3A 1SBBB 3UI3A 2KXJA 1TZOA 1WH3A 3W5UB 4OVUA 2BT6A 1RWSA 1X1MA 1EWCA 2MX2A 1KF6B 4DDID 4XWWA 1XD3B 1MHXA 3IVFA 5G55A 3VTVA 5L83A 1WGKA 1B9RA 2NTSA 4JIOU 2Y5CA 3JSVA 1N6ZA 3A33B 4MT5A 3GS2A 2R2QA 1D4BA 2LVOA 3BVGA 1HZ5A 2KLGA 1Y56A 2HE7A 4BZAA 2LJIA 2JT4B 3DWMA 4BBNF 1RLFA 1FRRA 1JROA 4PYUA 1NENB 2CKHB 2MJDA 2R61A 3C0RB 3DVGX 1L2NA 1WMHA 1NI2A 3H8HA 4MSMB 1WXMA 3CF6E 2LEKA 4NAMA 1JALA 4AUQC 2JU6X 2CU1A 1Q10A 1C4AA 1EWYC 3M63B 4Q2JA 3U2SC 1SE3A 2N7EA 2L0TA 4IG7B 5J2RA 4WWMA 3N32A 3KUZA 1NYQA 2E3TA 3V05A 3R2IA 4USAA 2VZKD 3AE2B 1E7PB 3WAPA 4HKQA 3M62B 3IBEA 2Z8LA 3NHEB 4MGZE 1PQSA 2LGSA 3UGBB 4DXAB 1JCKB 3UQAA 3KYCD 1ZXHA 3EFUA 3L17A 4ZHPA 1ZW7A 3DBSA 4PK1A 3TEZA 1D3ZA 1KLVA 5BO4B 4II2B 2IDYA 2KTRB 3AI5A 3PRMB 3BY4B 1F2RI 1K52A 2GBMA 2JZ3B 1N60A 4ZHOA 2BYEA 2VZKB 3ZDMC 4KGRA 2BGFA 2FUHB 2KC1A 2OEDA 1QOFA 5FR3A 2BYVE 3ZDTA 1OGWA 3NJTA 1WGHA 1UF0A 4HRSA 4EFOA 3P42A 4B0EA 4FA6A 2BW2A 4DQOC 2DZMA 4K1RB 4NQLB 3VRBB 2W55A 4ZRIA 3AE8B 3NVVA 2KFKB 2WXPA 5JZEB 3KYDD 3GZNB 3NZUA 2JF5A 1XLQA 2K6DB 1DOIA 3JW0X 4LNOA 3I9V1 4UDUC 4PS7A 4JWUC 3ZQ4A 4M0WB 2IY0B 2IGDA 2MJEA 3APFA 1HTQA 1U4AA 1NDDA 2K5PA 3M3JA 5MPOA 2IZVB 1L6VA 3MHSD 4NJCA 4ZRJA 1T0QC 3CWIA 2HTHA 3RNEC 3N1XC 2BYFA 3QCAA 5FK9C 4W9IA 5JHBA 4XDDA 1AN8A 4W9JA 3RNBC 4HPMB 4EE2A 5BMIA 4RF1A 1J7CA 2V3SA 1E5WA 5EE3A 1WGDA 2B76B 4A20A 3AN1A 3P4QB 5BMHA 2NVUI 4KDIC 4W9HA 4LLGM 1V97A 4WIPA 1WRDB 2UU7A 4HCNB 3Q14C 4HK2A 3R8BA 4AOFA 4RGTA 1Z2MA 4YWGG 4H2AA 4ZOHC 2FNJB 2LGXA 3ML8A 2J53A 4XWTA 3T3NA 2FCSA 2V3PA 4HJKA 1JQ4A 2C7HA 2QHOA 1ZDVA 1UWMA 4HWIB 4KZ0A 1KTKA 1PFDA 2KJRA 1QOGA 3IT6B 2LVQA 2YLMA 4HROA 4J3OD 5DPWA 3NVYA 1QF6A 2MBBB 4NQKE 2N1VA 2DYMA 3LDZE 2RSUA 3KH0A 2G3QB 5DCNA 2KDFB 2IGHA 1YQ3B
chains in the Genus database with same CATH topology
3PHXB 3HHMA 2OJRA 3EECA 4MEMA 4BKGA 3MTNB 4BKSA 3VTWA 2BWES 3UF8A 2GBNA 4N9F4 2RD0A 3RCZA 3VXWA 4W9CA 1GG3A 2KVRA 5CTRC 3ZRFA 4ASWC 2G4DB 3CSFA 4PS8A 3SHQA 3ZTDA 1EF1A 2KOXA 1P0RA 1V80A 2KX0A 1YIWA 2JVCA 3WANA 2MP2A 2YVCA 4W9GA 1P3QU 2D10A 3SDLC 2GBRA 2IBIB 2IO0B 3IFWB 3PHWB 4WQOB 4M8NA 1V5TA 2KLCA 2LGYA 2ZEQA 3V6CB 1YJ1A 2N7DA 4GN1A 2DAFA 4LCDE 2M8SA 3TMPB 1KOTA 2ZNVB 4GGQA 2I1KA 3KUDB 2ZVOA 2RR9A 1F9JA 1TBEA 2KFJA 2LRWA 5C23A 4LDTB 4AP4C 3P2BA 2HJ8A 4MJSB 2O6VD 2C9WB 3Q3JA 3TCAA 3NZSA 3WAMA 3CMMB 2ZJDA 4GSWA 4GB9A 1TZ1A 1WXVA 3VAWA 3APDA 3R7QA 5E6OA 1E7UA 3W1SC 4JQWC 1TGZB 1IPGA 2W9NA 2GOWA 2K6QA 2LUEA 4B9KA 3ML9A 4HPLB 3L54A 2LGDA 4IC7B 3VUWA 3QX1A 1Z5SB 2FIFA 3DOWA 3A9KB 2L00B 1J8CA 1V2YA 3QC8B 4II3B 2G45B 3TL5A 1LXDA 2LXAA 3U7DA 2CHXA 4B95A 2NBVB 2FCQA 2IO3B 2WWZA 3RZFA 1WM3A 2Z0EB 4J6IA 2KDIA 2K8BA 2MBOA 1OEYA 2DZJA 3NOBA 4RMAA 4KVGB 4IM0A 5D94A 1UBQA 2N9XA 3R3MA 3QK0A 3H1UA 4KV2A 3VFKA 2DYOA 2KO3A 3TJPA 4K7SA 3W1YA 2M17A 2O2VB 5GMVA 2K8CA 3PLVA 2LWPA 2IO1B 1Q0WB 2JUOA 5HKHA 3QA8A 1K8RB 2XK5A 4G0NB 4GMVA 4EUTA 4MDKE 1UD7A 2NR2A 5CHVC 4W9DA 4AJYB 2DAJA 3PRZA 4CYEA 3B0AA 1GC6A 2AEHA 2LVPA 2MCNB 2KTFA 4WJOA 2NBUA 3HM6X 3DQVA 2M4NA 4CO7A 1ZKHA 3V61A 4FLHA 3B08A 1C3TA 3L0WB 4WWPA 3ZTCA 3GOEA 1QZEA 1WXAA 2NBWB 2JPHA 1UZXB 4BFRA 1A5RA 2KKCA 2M0XA 4NNJB 4KIKB 1EUVB 2MWSB 1IP9A 2GBKA 2KZRA 1G6JA 2J0KA 1AARA 1P9DU 4ANVA 3QHTA 4DHJB 4FHKA 3ZNID 2PJHA 1V5OA 2BKRB 5JHAA 3QQ8B 3AULA 1S1QB 4EEWA 2MSED 3H7PA 2UYZB 5J18A 2K1FA 3VH4B 3ZO5B 3X23A 2Y5BB 3RZWC 1E8WA 3N3KB 3QARA 1C1YB 1EO6A 2BPSA 3APCA 1YQBA 2KHWB 1YD8U 4IWOA 1WIAA 1I42A 5CHFA 4DBGA 1Y8RC 3L10B 2HD5B 1XT9B 2KQ7A 3QAQA 4AJWA 2PE6B 3T9LA 3UINB 2IYDB 2O6VA 2JRHA 3OLMD 4ANXA 1WJNA 1I35A 2AWTA 4HLEA 5TR5A 2KDBA 4TKNA 4TQ1A 2LJ5A 2K39A 3DBHI 4G11A 2R2OA 5C1ZA 1NBFC 2BKFA 3B1LX 3VQIA 1L7YA 3AXCA 3UIOB 1E7VA 2LXCA 3VH3B 3CSTA 4KSLC 3WA0A 1VD2A 4CHKA 3K9PB 4P7IA 1XQQA 1YX6B 2D07B 3IHPC 3HIZA 1GC7A 2BWFA 2KNBA 3DPDA 4GIVA 1HE8A 1V9JA 2MBQA 2GBJA 4HXDA 1GNUA 2KX3A 4IWPA 3PVLA 1P1AA 2J0MA 4PYZA 1WFYA 3OAWA 1YX5B 4HVBA 1Q5WB 1LFDA 2MRPA 5CX3A 4URKA 1WGYA 2KN5A 4F8CB 3PREA 2V1YA 4GDKB 4M8MA 3DDCB 3QJZA 3IG3A 1LQBA 3PPAA 2KXJA 1WH3A 4FJYA 3PTFC 3RULA 4OVUA 4G3XB 3A1QA 3ALBA 4MM3A 5FR6A 1WE6A 1VCBA 3PRPB 1X1MA 2IO2B 1WZ3A 1S3SG 3PZDA 1J0GA 2JXXA 2A4ZA 2MX2A 4DDID 1GJZA 2NPTB 1XD3B 2KANA 2N9EB 3IVFA 5G55A 1UGMA 3VTVA 2ZVNA 4B6WA 5DPRA 1E8ZA 1BT0A 2N1WA 4BOSC 1UELA 2KQSA 1TTNA 4W9KA 5G2NA 4JGHB 4JIOU 1OTRB 3JSVA 4GDLB 2REXA 5EDSA 4LJPB 2EMTA 4ICUA 4KSKC 3A33B 4MSQB 3VUYA 2R2QA 3A4SC 4FJVB 2LVOA 4WJPA 1WR6E 2ASQA 2C60A 3OJ4B 4IWQA 2KLGA 4NPNA 3VUXA 4AWJA 1FXTB 2HE7A 3H7SA 5D6JB 1SGHA 1RFAA 2JT4B 4BBNF 2EKEC 2N4FA 1RLFA 2AL6A 2C5LC 5AEKB 4PYUA 1V49A 4FN2A 1WY8A 2AYOB 2CKHB 3C0RB 3ZNGC 1OQYA 3DVGX 3RT3B 4NJ7A 1L2NA 1WMHA 1NI2A 2KD0A 4MSMB 4PS3A 1WXMA 3CF6E 4X57B 4ZDVA 3V6EB 3L08A 5J17A 4AUQC 4JL9A 2CU1A 5DPTA 1J19A 1OEYJ 2KWVB 3HK0A 1WGRA 4TQ0A 2CHZA 1KJTA 3M63B 3A4RA 1JRUA 4EOYA 4FHJA 2Z59B 3EC8A 1EF5A 1P98A 5LXIB 2NS5A 4ZRKA 2VRRB 3BINA 2MBEA 3ENEA 3S2AA 3A9JB 4LJOB 2N7EA 2L0TA 4IG7B 2MW5A 3QIJA 4WWNA 2WDTB 5J2RA 3EHVA 4K7UA 3N32A 3KUZA 2LZ6A 2D2QA 1GUAB 3K9OB 2MQJA 2FCMA 3WAPA 4WJNA 4W9EA 1H8CA 1R4MI 3M62B 3M95A 3IBEA 1WE7A 2K25A 4DHJD 3PT2B 3NHEB 4MGZE 1PQSA 2L3ZA 3NY5A 1E8XA 5L83A 2PPHA 3D32A 3UGBB 3TIXA 4DXAB 3DVNU 3UQAA 2JY6A 3KYCD 2FCNA 3EFUA 3L17A 2L05A 4EKUA 3H6NA 3Q3FA 4FJZA 2LI5A 2GMIC 1ZW7A 4EZJA 3DBSA 3SU8X 3ZUNA 3KW5B 1D3ZA 5BO4B 1KLVA 4II2B 1SIFA 3WALA 2UWQA 2KTRB 1WJ4A 3AI5A 2ZCBA 3TBLD 3PRMB 4EZKA 3BY4B 2JZZA 3NS8A 4NAWB 2GBMA 4ANUA 5AZHA 2JWZA 4I6NB 4FBJB 3DCGA 3PSEB 4HDQA 2JZ3B 5E6NA 2FAZA 2J0JA 3PS6A 4WAAA 4ICVA 2BYEA 3VHTC 3VVWB 1E8YA 3ZDMC 2BGFA 1E90A 2L76A 2FUHB 1IYFA 2I1JA 4RM8A 1UH6A 2C7MB 2EMSA 2KC1A 2NCNA 5IA7A 3WAOA 4TV3A 2PE9A 3A9KA 2BYVE 3ZDTA 3I3TB 2RPQA 1OGWA 1WGHA 2J7QB 3GZNI 4GXBA 1WGGA 5KHOA 4EFOA 2KWCA 2DYBA 1H4RA 2NPTA 2FIDA 5AZGA 2XEWA 3ECIA 3ZNZB 2K8HA 4IUMB 4XC2A 4XX5A 4FA6A 1V86A 2L0FA 3ZVVA 4K81A 4FULA 3JSVB 4GDLA 4KIKA 2DZMA 2O2VA 3T8MA 4K1RB 4DDGD 4NQLB 4ZYNA 1RRBA 1LM8B 2JRIB 1T0YA 5D2MB 4ZRIA 4DHZB 1CMXB 2KMAA 3JYUA 4FADA 2RGFA 5DPSA 3X0WA 2KFKB 2KJ6A 3ZIMA 5JZEB 3KYDD 2IY1B 3VTUA 2CHWA 2LASA 4I6LB 3H9DA 3V60A 3NZUA 2MLBA 2JF5A 4MH0E 2K6DB 3JW0X 2B3AA 3V62A 2L7RA 2V4LA 2XBBC 4E3CA 4F7ZA 2WYQA 4EZLA 2M1MA 4PS7A 3L13A 4TUUA 2KJHB 2DX5B 3QWZB 1WF9A 2DHZA 2MP2B 4NY0A 2KMCA 2IY0B 2ZZPB 3DBLI 1WJ6A 3H7PB 3APFA 3KVFB 1U4AA 4M0WB 1NDDA 3M3JA 5IAAC 2IZVB 4I6PA 2C7NB 2DENB 4GU2A 5JH5C 1Q1OA 3U8ZA 3MHSD 2CS4A 4ZRJA 3VDZA 1RAXA 4YL8A 2WX1A 3AU4A 1R4NI 5E6PA 3ONSA 2BF8B 4LDTD 2ZPNA 2HTHA 1WX8A 3RUIB 3ZNHB 4MELA 2AL3A 2BYFA 2MBHA 3QCAA 4MJSA 3LJ3A 3MJWA 2LRUA 4K7WA 4W9IA 5JHBA 4GOCA 4W9JA 1ISNA 2DZIA 4HPMB 2V3SA 4GDKA 1E5WA 3DBRI 1WGDA 2KC2A 2WX0A 3PGEA 4KDLB 4A20A 2OOBB 2L8JA 3UQBA 4OVVA 2N9PC 4BKSD 2KWUB 1WZ0A 1WX9A 3A1QB 2NVUI 4KDIC 2Z0DB 3PV1A 4W9HA 3W1SA 2ZNVC 4W9LA 4IW0A 1V6EA 4HDOA 3U30A 4ANWA 4W9FA 2KDEB 1WRDB 4DWFA 1MG8A 4HCNB 5CHWA 3ZRCA 4F1SA 1WJUA 4HK2A 4IM2A 4WJQA 4AOFA 1WR1A 1Z2MA 1WYWB 4IM3A 2FNJB 2KTRA 4KZCA 2LGXA 3ML8A 2XK5B 4NAWA 3DVGY 2DZKA 2PEAA 3JVZX 4BOZB 3RYTA 2FCSA 1WX7A 4MGKE 3O65B 4A3OA 4BBNC 3ZKJC 4HJKA 4DK5A 2C7HA 4HCPB 2QHOA 5LLIA 2LD9A 2MA9B 4NJ6A 4HWIB 2D3GA 4KZ0A 3HM3A 4E74A 2KJRA 3UIPB 3RD2A 4XZ4A 3ZW3A 4DHZE 5LXHA 2LVQA 2ZCCA 5AZFA 2YLMA 4G50A 3KUCB 3ZLZA 3PLUA 2ZPYA 3R7RA 1V81A 2A5UA 1WXSA 2KK8A 3N30A 4MGYE 4BKTA 4BVUC 5KHQA 5DPWA 3R66C 3DVNV 2D11A 1KM7A 1WI0A 2G4SA 2MBBB 1ZGUB 4NQKE 1UBIA 5D7GA 1SE9A 1WM2A 3SD5A 4MGIE 3A9JA 4WWOA 2O6VB 3WIMA 2N1VA 2CR5A 2DYMA 3LDZE 2RSUA 3KH0A 2KFKA 1WMHB 2G3QB 3OJ3A 5DCNA 2KDFB 3AU5A 4A3PA 5L95C 3L16A 4RM9A 4JLCA 4E71A 1M94A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PHX B;  3HHM A;  2OJR A;  3EEC A;  4MEM A;  4BKG A;  3MTN B;  4BKS A;  3VTW A;  2BWE S;  3UF8 A;  2GBN A;  4N9F 4;  2RD0 A;  3RCZ A;  3VXW A;  4W9C A;  1GG3 A;  2KVR A;  5CTR C;  3ZRF A;  4ASW C;  2G4D B;  3CSF A;  4PS8 A;  3SHQ A;  3ZTD A;  1EF1 A;  2KOX A;  1P0R A;  1V80 A;  2KX0 A;  1YIW A;  2JVC A;  3WAN A;  2MP2 A;  2YVC A;  4W9G A;  1P3Q U;  2D10 A;  3SDL C;  2GBR A;  2IBI B;  2IO0 B;  3IFW B;  3PHW B;  4WQO B;  4M8N A;  1V5T A;  2KLC A;  2LGY A;  2ZEQ A;  3V6C B;  1YJ1 A;  2N7D A;  4GN1 A;  2DAF A;  4LCD E;  2M8S A;  3TMP B;  1KOT A;  2ZNV B;  4GGQ A;  2I1K A;  3KUD B;  2ZVO A;  2RR9 A;  1F9J A;  1TBE A;  2KFJ A;  2LRW A;  5C23 A;  4LDT B;  4AP4 C;  3P2B A;  2HJ8 A;  4MJS B;  2O6V D;  2C9W B;  3Q3J A;  3TCA A;  3NZS A;  3WAM A;  3CMM B;  2ZJD A;  4GSW A;  4GB9 A;  1TZ1 A;  1WXV A;  3VAW A;  3APD A;  3R7Q A;  5E6O A;  1E7U A;  3W1S C;  4JQW C;  1TGZ B;  1IPG A;  2W9N A;  2GOW A;  2K6Q A;  2LUE A;  4B9K A;  3ML9 A;  4HPL B;  3L54 A;  2LGD A;  4IC7 B;  3VUW A;  3QX1 A;  1Z5S B;  2FIF A;  3DOW A;  3A9K B;  2L00 B;  1J8C A;  1V2Y A;  3QC8 B;  4II3 B;  2G45 B;  3TL5 A;  1LXD A;  2LXA A;  3U7D A;  2CHX A;  4B95 A;  2NBV B;  2FCQ A;  2IO3 B;  2WWZ A;  3RZF A;  1WM3 A;  2Z0E B;  4J6I A;  2KDI A;  2K8B A;  2MBO A;  1OEY A;  2DZJ A;  3NOB A;  4RMA A;  4KVG B;  4IM0 A;  5D94 A;  1UBQ A;  2N9X A;  3R3M A;  3QK0 A;  3H1U A;  4KV2 A;  3VFK A;  2DYO A;  2KO3 A;  3TJP A;  4K7S A;  3W1Y A;  2M17 A;  2O2V B;  5GMV A;  2K8C A;  3PLV A;  2LWP A;  2IO1 B;  1Q0W B;  2JUO A;  5HKH A;  3QA8 A;  1K8R B;  2XK5 A;  4G0N B;  4GMV A;  4EUT A;  4MDK E;  1UD7 A;  2NR2 A;  5CHV C;  4W9D A;  4AJY B;  2DAJ A;  3PRZ A;  4CYE A;  3B0A A;  1GC6 A;  2AEH A;  2LVP A;  2MCN B;  2KTF A;  4WJO A;  2NBU A;  3HM6 X;  3DQV A;  2M4N A;  4CO7 A;  1ZKH A;  3V61 A;  4FLH A;  3B08 A;  1C3T A;  3L0W B;  4WWP A;  3ZTC A;  3GOE A;  1QZE A;  1WXA A;  2NBW B;  2JPH A;  1UZX B;  4BFR A;  1A5R A;  2KKC A;  2M0X A;  4NNJ B;  4KIK B;  1EUV B;  2MWS B;  1IP9 A;  2GBK A;  2KZR A;  1G6J A;  2J0K A;  1AAR A;  1P9D U;  4ANV A;  3QHT A;  4DHJ B;  4FHK A;  3ZNI D;  2PJH A;  1V5O A;  2BKR B;  5JHA A;  3QQ8 B;  3AUL A;  1S1Q B;  4EEW A;  2MSE D;  3H7P A;  2UYZ B;  5J18 A;  2K1F A;  3VH4 B;  3ZO5 B;  3X23 A;  2Y5B B;  3RZW C;  1E8W A;  3N3K B;  3QAR A;  1C1Y B;  1EO6 A;  2BPS A;  3APC A;  1YQB A;  2KHW B;  1YD8 U;  4IWO A;  1WIA A;  1I42 A;  5CHF A;  4DBG A;  1Y8R C;  3L10 B;  2HD5 B;  1XT9 B;  2KQ7 A;  3QAQ A;  4AJW A;  2PE6 B;  3T9L A;  3UIN B;  2IYD B;  2O6V A;  2JRH A;  3OLM D;  4ANX A;  1WJN A;  1I35 A;  2AWT A;  4HLE A;  5TR5 A;  2KDB A;  4TKN A;  4TQ1 A;  2LJ5 A;  2K39 A;  3DBH I;  4G11 A;  2R2O A;  5C1Z A;  1NBF C;  2BKF A;  3B1L X;  3VQI A;  1L7Y A;  3AXC A;  3UIO B;  1E7V A;  2LXC A;  3VH3 B;  3CST A;  4KSL C;  3WA0 A;  1VD2 A;  4CHK A;  3K9P B;  4P7I A;  1XQQ A;  1YX6 B;  2D07 B;  3IHP C;  3HIZ A;  1GC7 A;  2BWF A;  2KNB A;  3DPD A;  4GIV A;  1HE8 A;  1V9J A;  2MBQ A;  2GBJ A;  4HXD A;  1GNU A;  2KX3 A;  4IWP A;  3PVL A;  1P1A A;  2J0M A;  4PYZ A;  1WFY A;  3OAW A;  1YX5 B;  4HVB A;  1Q5W B;  1LFD A;  2MRP A;  5CX3 A;  4URK A;  1WGY A;  2KN5 A;  4F8C B;  3PRE A;  2V1Y A;  4GDK B;  4M8M A;  3DDC B;  3QJZ A;  3IG3 A;  1LQB A;  3PPA A;  2KXJ A;  1WH3 A;  4FJY A;  3PTF C;  3RUL A;  4OVU A;  4G3X B;  3A1Q A;  3ALB A;  4MM3 A;  5FR6 A;  1WE6 A;  1VCB A;  3PRP B;  1X1M A;  2IO2 B;  1WZ3 A;  1S3S G;  3PZD A;  1J0G A;  2JXX A;  2A4Z A;  2MX2 A;  4DDI D;  1GJZ A;  2NPT B;  1XD3 B;  2KAN A;  2N9E B;  3IVF A;  5G55 A;  1UGM A;  3VTV A;  2ZVN A;  4B6W A;  5DPR A;  1E8Z A;  1BT0 A;  2N1W A;  4BOS C;  1UEL A;  2KQS A;  1TTN A;  4W9K A;  5G2N A;  4JGH B;  4JIO U;  1OTR B;  3JSV A;  4GDL B;  2REX A;  5EDS A;  4LJP B;  2EMT A;  4ICU A;  4KSK C;  3A33 B;  4MSQ B;  3VUY A;  2R2Q A;  3A4S C;  4FJV B;  2LVO A;  4WJP A;  1WR6 E;  2ASQ A;  2C60 A;  3OJ4 B;  4IWQ A;  2KLG A;  4NPN A;  3VUX A;  4AWJ A;  1FXT B;  2HE7 A;  3H7S A;  5D6J B;  1SGH A;  1RFA A;  2JT4 B;  4BBN F;  2EKE C;  2N4F A;  1RLF A;  2AL6 A;  2C5L C;  5AEK B;  4PYU A;  1V49 A;  4FN2 A;  1WY8 A;  2AYO B;  2CKH B;  3C0R B;  3ZNG C;  1OQY A;  3DVG X;  3RT3 B;  4NJ7 A;  1L2N A;  1WMH A;  1NI2 A;  2KD0 A;  4MSM B;  4PS3 A;  1WXM A;  3CF6 E;  4X57 B;  4ZDV A;  3V6E B;  3L08 A;  5J17 A;  4AUQ C;  4JL9 A;  2CU1 A;  5DPT A;  1J19 A;  1OEY J;  2KWV B;  3HK0 A;  1WGR A;  4TQ0 A;  2CHZ A;  1KJT A;  3M63 B;  3A4R A;  1JRU A;  4EOY A;  4FHJ A;  2Z59 B;  3EC8 A;  1EF5 A;  1P98 A;  5LXI B;  2NS5 A;  4ZRK A;  2VRR B;  3BIN A;  2MBE A;  3ENE A;  3S2A A;  3A9J B;  4LJO B;  2N7E A;  2L0T A;  4IG7 B;  2MW5 A;  3QIJ A;  4WWN A;  2WDT B;  5J2R A;  3EHV A;  4K7U A;  3N32 A;  3KUZ A;  2LZ6 A;  2D2Q A;  1GUA B;  3K9O B;  2MQJ A;  2FCM A;  3WAP A;  4WJN A;  4W9E A;  1H8C A;  1R4M I;  3M62 B;  3M95 A;  3IBE A;  1WE7 A;  2K25 A;  4DHJ D;  3PT2 B;  3NHE B;  4MGZ E;  1PQS A;  2L3Z A;  3NY5 A;  1E8X A;  5L83 A;  2PPH A;  3D32 A;  3UGB B;  3TIX A;  4DXA B;  3DVN U;  3UQA A;  2JY6 A;  3KYC D;  2FCN A;  3EFU A;  3L17 A;  2L05 A;  4EKU A;  3H6N A;  3Q3F A;  4FJZ A;  2LI5 A;  2GMI C;  1ZW7 A;  4EZJ A;  3DBS A;  3SU8 X;  3ZUN A;  3KW5 B;  1D3Z A;  5BO4 B;  1KLV A;  4II2 B;  1SIF A;  3WAL A;  2UWQ A;  2KTR B;  1WJ4 A;  3AI5 A;  2ZCB A;  3TBL D;  3PRM B;  4EZK A;  3BY4 B;  2JZZ A;  3NS8 A;  4NAW B;  2GBM A;  4ANU A;  5AZH A;  2JWZ A;  4I6N B;  4FBJ B;  3DCG A;  3PSE B;  4HDQ A;  2JZ3 B;  5E6N A;  2FAZ A;  2J0J A;  3PS6 A;  4WAA A;  4ICV A;  2BYE A;  3VHT C;  3VVW B;  1E8Y A;  3ZDM C;  2BGF A;  1E90 A;  2L76 A;  2FUH B;  1IYF A;  2I1J A;  4RM8 A;  1UH6 A;  2C7M B;  2EMS A;  2KC1 A;  2NCN A;  5IA7 A;  3WAO A;  4TV3 A;  2PE9 A;  3A9K A;  2BYV E;  3ZDT A;  3I3T B;  2RPQ A;  1OGW A;  1WGH A;  2J7Q B;  3GZN I;  4GXB A;  1WGG A;  5KHO A;  4EFO A;  2KWC A;  2DYB A;  1H4R A;  2NPT A;  2FID A;  5AZG A;  2XEW A;  3ECI A;  3ZNZ B;  2K8H A;  4IUM B;  4XC2 A;  4XX5 A;  4FA6 A;  1V86 A;  2L0F A;  3ZVV A;  4K81 A;  4FUL A;  3JSV B;  4GDL A;  4KIK A;  2DZM A;  2O2V A;  3T8M A;  4K1R B;  4DDG D;  4NQL B;  4ZYN A;  1RRB A;  1LM8 B;  2JRI B;  1T0Y A;  5D2M B;  4ZRI A;  4DHZ B;  1CMX B;  2KMA A;  3JYU A;  4FAD A;  2RGF A;  5DPS A;  3X0W A;  2KFK B;  2KJ6 A;  3ZIM A;  5JZE B;  3KYD D;  2IY1 B;  3VTU A;  2CHW A;  2LAS A;  4I6L B;  3H9D A;  3V60 A;  3NZU A;  2MLB A;  2JF5 A;  4MH0 E;  2K6D B;  3JW0 X;  2B3A A;  3V62 A;  2L7R A;  2V4L A;  2XBB C;  4E3C A;  4F7Z A;  2WYQ A;  4EZL A;  2M1M A;  4PS7 A;  3L13 A;  4TUU A;  2KJH B;  2DX5 B;  3QWZ B;  1WF9 A;  2DHZ A;  2MP2 B;  4NY0 A;  2KMC A;  2IY0 B;  2ZZP B;  3DBL I;  1WJ6 A;  3H7P B;  3APF A;  3KVF B;  1U4A A;  4M0W B;  1NDD A;  3M3J A;  5IAA C;  2IZV B;  4I6P A;  2C7N B;  2DEN B;  4GU2 A;  5JH5 C;  1Q1O A;  3U8Z A;  3MHS D;  2CS4 A;  4ZRJ A;  3VDZ A;  1RAX A;  4YL8 A;  2WX1 A;  3AU4 A;  1R4N I;  5E6P A;  3ONS A;  2BF8 B;  4LDT D;  2ZPN A;  2HTH A;  1WX8 A;  3RUI B;  3ZNH B;  4MEL A;  2AL3 A;  2BYF A;  2MBH A;  3QCA A;  4MJS A;  3LJ3 A;  3MJW A;  2LRU A;  4K7W A;  4W9I A;  5JHB A;  4GOC A;  4W9J A;  1ISN A;  2DZI A;  4HPM B;  2V3S A;  4GDK A;  1E5W A;  3DBR I;  1WGD A;  2KC2 A;  2WX0 A;  3PGE A;  4KDL B;  4A20 A;  2OOB B;  2L8J A;  3UQB A;  4OVV A;  2N9P C;  4BKS D;  2KWU B;  1WZ0 A;  1WX9 A;  3A1Q B;  2NVU I;  4KDI C;  2Z0D B;  3PV1 A;  4W9H A;  3W1S A;  2ZNV C;  4W9L A;  4IW0 A;  1V6E A;  4HDO A;  3U30 A;  4ANW A;  4W9F A;  2KDE B;  1WRD B;  4DWF A;  1MG8 A;  4HCN B;  5CHW A;  3ZRC A;  4F1S A;  1WJU A;  4HK2 A;  4IM2 A;  4WJQ A;  4AOF A;  1WR1 A;  1Z2M A;  1WYW B;  4IM3 A;  2FNJ B;  2KTR A;  4KZC A;  2LGX A;  3ML8 A;  2XK5 B;  4NAW A;  3DVG Y;  2DZK A;  2PEA A;  3JVZ X;  4BOZ B;  3RYT A;  2FCS A;  1WX7 A;  4MGK E;  3O65 B;  4A3O A;  4BBN C;  3ZKJ C;  4HJK A;  4DK5 A;  2C7H A;  4HCP B;  2QHO A;  5LLI A;  2LD9 A;  2MA9 B;  4NJ6 A;  4HWI B;  2D3G A;  4KZ0 A;  3HM3 A;  4E74 A;  2KJR A;  3UIP B;  3RD2 A;  4XZ4 A;  3ZW3 A;  4DHZ E;  5LXH A;  2LVQ A;  2ZCC A;  5AZF A;  2YLM A;  4G50 A;  3KUC B;  3ZLZ A;  3PLU A;  2ZPY A;  3R7R A;  1V81 A;  2A5U A;  1WXS A;  2KK8 A;  3N30 A;  4MGY E;  4BKT A;  4BVU C;  5KHQ A;  5DPW A;  3R66 C;  3DVN V;  2D11 A;  1KM7 A;  1WI0 A;  2G4S A;  2MBB B;  1ZGU B;  4NQK E;  1UBI A;  5D7G A;  1SE9 A;  1WM2 A;  3SD5 A;  4MGI E;  3A9J A;  4WWO A;  2O6V B;  3WIM A;  2N1V A;  2CR5 A;  2DYM A;  3LDZ E;  2RSU A;  3KH0 A;  2KFK A;  1WMH B;  2G3Q B;  3OJ3 A;  5DCN A;  2KDF B;  3AU5 A;  4A3P A;  5L95 C;  3L16 A;  4RM9 A;  4JLC A;  4E71 A;  1M94 A; 
#chains in the Genus database with same CATH topology
 2J4X A;  3HHM A;  4MEM A;  1GG3 A;  2KVR A;  5IKC M;  2G4D B;  3CSF A;  4A55 A;  4PS8 A;  2CJO A;  1EF1 A;  2KOX A;  4YSZ B;  2KX0 A;  1YIW A;  2JVC A;  2MP2 A;  1HTO A;  1P7F A;  2LGY A;  3V6C B;  1KFY B;  3W5V B;  2N7D A;  4GN1 A;  4LCD E;  2M8S A;  2I1K A;  4ITK A;  1F9J A;  4MJS B;  4OZB A;  3ZJU A;  2GLS A;  3APD A;  5E6O A;  2AX5 A;  2K22 A;  1TGZ B;  4K3C A;  2L83 A;  3VUW A;  1Z5S B;  3RN9 C;  2L32 A;  5LNK 1;  1J8C A;  3QC8 B;  4OW0 A;  4DXG A;  3VR8 B;  1QLB B;  1WM3 A;  2KDI A;  3SEB A;  3NOB A;  4RMA A;  3KQ4 A;  4IM0 A;  3TEX A;  1YN4 A;  4YXD B;  3H1U A;  3Q8E A;  3DBR B;  4C80 A;  5HKH A;  2XK5 A;  4GMV A;  2RPV A;  1TS2 A;  1TKG A;  3PRZ A;  3B0A A;  2LVP A;  3DQV A;  1B1Z A;  3ABV B;  3L0W B;  2LHE A;  3E56 A;  2JSV X;  1E6E B;  1JML A;  2KKC A;  4NNJ B;  4M01 A;  1EUV B;  1AW7 A;  3HVD A;  1IP9 A;  3SFD B;  1AAR A;  4DHJ B;  2OHF A;  3IT4 B;  3Q3O C;  4JX1 C;  2PJH A;  3QQ8 B;  1S1Q B;  3H7P A;  2K9X A;  3J9C A;  3VH4 B;  3N3K B;  3N1Y C;  3PZ8 A;  1IGC A;  2KQ7 A;  2L52 A;  4AJW A;  1KLG D;  4ANX A;  2AWT A;  4HLE A;  1C9F A;  4TQ1 A;  2N9K A;  3FKY A;  2K0P A;  4G11 A;  5C1Z A;  2BYT A;  1R4M B;  1N61 A;  1EU3 A;  3AXC A;  2LXC A;  3AEE B;  3WA0 A;  1VD2 A;  4KX6 B;  4P7I A;  1XQQ A;  4GIV A;  2BWF A;  3TCA A;  1V9J A;  2J0M A;  1T0R C;  1WFY A;  3OAW A;  2WHI A;  4KGS A;  4AS1 A;  4ZRQ A;  4FJY A;  1ACC A;  3PTF C;  4G3X B;  4XYC A;  2HDE A;  4IDI A;  2IO2 B;  3PZD A;  1J0G A;  3KWL A;  2N9E B;  4N58 A;  4BOS C;  2I2Y A;  1L4Z B;  2KQS A;  1TTN A;  4JGH B;  1YNT E;  5EDS A;  4LJP B;  4ICU A;  2LHD A;  4D2K A;  2ASQ A;  4IWQ A;  2BQQ A;  1N62 A;  1IBX B;  1VR9 A;  1RFA A;  3AV8 A;  2EKE C;  2N4F A;  4B0M A;  1TKY A;  3N1Z C;  1YMH E;  3FIL B;  2CJN A;  1E9M A;  4MH8 A;  4NJ7 A;  2KD0 A;  1VRA B;  3AEA B;  4ZDV A;  3V6E B;  3L08 A;  2JYE A;  2WXI A;  3RPF C;  5J17 A;  3LYY A;  4M0W A;  1OEY J;  2KWV B;  1WGR A;  4ACF A;  3A4R A;  1HQR D;  5LXI B;  4ZRK A;  4NZL B;  3BIN A;  5EE1 A;  3A9J B;  3N20 C;  1WRI A;  4TMA B;  3ZJV A;  3QIJ A;  4WWN A;  4C7Y A;  3EHV A;  4K7U A;  2WXN A;  4C7Z A;  2WS3 B;  2D2Q A;  1J7A A;  3AE4 B;  4W9E A;  1H8C A;  1R4M I;  3M95 A;  3EA6 A;  3PT2 B;  2WXM A;  2RDB C;  2L3Z A;  1PGX A;  2PPH A;  3TIX A;  3ETR A;  2JY6 A;  2WDV B;  2FCN A;  1TS5 A;  2L05 A;  3H6N A;  3ZUN A;  4S17 A;  1SIF A;  2KVZ A;  3WAL A;  2UWQ A;  2ZCB A;  3AE3 B;  5AZH A;  4I6N B;  4HDQ A;  2FAZ A;  1T3Q A;  2HTM E;  2J0J A;  1SE4 A;  3VVW B;  3VHT C;  1ET6 A;  3AED B;  1E90 A;  4RCO A;  2L76 A;  1A70 A;  1I7H A;  1XEE A;  2NCN A;  5IA7 A;  2M19 A;  3I3T B;  4RGM A;  2IND C;  2KWC A;  1H4R A;  2NPT A;  5AZG A;  3ECI A;  4IUM B;  4YT0 B;  2L0F A;  2EKI A;  1I4X A;  2PTL A;  2O2V A;  4ZYN A;  1LM8 B;  1T0Y A;  1DGJ A;  4OZC A;  2KYW A;  2RDH A;  2KJ6 A;  2WU2 B;  3VTU A;  2CHW A;  4ARC A;  2LAS A;  4I6L B;  2MEK A;  4US8 A;  1GAQ B;  1SE2 A;  1F0Z A;  2Y3A A;  3V62 A;  2B3A A;  2L7R A;  2V4L A;  2WXO A;  4REZ A;  3NS1 A;  4F7Z A;  3L13 A;  4RH6 A;  3W2D A;  3NVW A;  2DHZ A;  2MP2 B;  2KMC A;  4O1N A;  1WJ6 A;  4M02 A;  3Q69 A;  1PUT A;  2DEN B;  1Q1O A;  3U8Z A;  4LNF A;  1RAX A;  4YL8 A;  3AU4 A;  3ZXV A;  3NG0 A;  1R4N I;  1I4G A;  2BF8 B;  4LDT D;  2ZPN A;  1GB4 A;  2BVC A;  3RUI B;  4MJS A;  2AL3 A;  4MEL A;  3MJW A;  1ISN A;  2DZI A;  1OQR A;  2SAK A;  5HI1 A;  2DNF A;  1XLN A;  2WXK A;  2QCZ A;  2OOB B;  3UQB A;  4LNI A;  1RFK A;  5HFY A;  3W1S A;  2ZNV C;  3BVZ A;  4W9L A;  4WH4 A;  3AMZ A;  2DLB A;  4DWF A;  3WCQ A;  1FFU A;  2GRI A;  2XN9 C;  3PZ7 A;  5CHW A;  1WJU A;  4WJQ A;  4IM3 A;  2XK5 B;  4NAW A;  1SB3 C;  1VLB A;  2PEA A;  2ONQ A;  3ZXR A;  4A3O A;  1CZP A;  2IGG A;  3O65 B;  3ZKJ C;  2VH1 A;  5JXV A;  1F77 A;  5LLI A;  2WGS A;  1VZ8 A;  1WYG A;  3URY A;  3ZGZ A;  1KLU D;  4G50 A;  2AQ2 B;  2ZPY A;  3R7R A;  1WXS A;  3N30 A;  3DVN V;  2D11 A;  1KM7 A;  2G4S A;  1ZGU B;  5D7G A;  2V0G A;  2QC8 A;  2LFI A;  2MJ3 A;  3OJ3 A;  3AB5 A;  2JYT A;  4JLC A;  3TJP A;  3CIR B;  1FEH A;  3PHX B;  3NVZ A;  4BKS A;  2BWE S;  2GBN A;  1CJE A;  4N9F 4;  2RD0 A;  1XLO A;  5CTR C;  3ZRF A;  4HJG E;  1TYG B;  1QKZ A;  3AEG B;  3WAN A;  2YVC A;  4W9G A;  1P3Q U;  2D10 A;  3SFE B;  2GBR A;  3Q6B A;  3IFW B;  3MFG A;  2BB5 A;  2HJ1 A;  4M8N A;  2KLC A;  2ZNV B;  1D5Z C;  2ZVO A;  2LRW A;  2AQ1 B;  4AP4 C;  3P2B A;  3BK2 A;  2JWU A;  5T8I A;  1WXV A;  1IPG A;  4HPL B;  2EEL A;  5H8Y E;  1AYF A;  1L5P A;  2L00 B;  3DOW A;  3U7D A;  4II3 B;  5D3D A;  2G45 B;  1LXD A;  2WXH A;  4B95 A;  2WWZ A;  2Z0E B;  2GI9 A;  4A9A A;  2MBO A;  1OEY A;  2DZJ A;  1UBQ A;  3DHH C;  3QK0 A;  4KV2 A;  1F2R C;  2KO3 A;  1VZ7 A;  1IBX A;  1BML C;  2K8C A;  2LWP A;  2IO1 B;  2JUO A;  2JQR B;  4LNK A;  2TSS A;  4EUT A;  2N9L A;  5CHV C;  5BYR A;  3LXF A;  2AEH A;  2KTF A;  3V61 A;  3B08 A;  5I4D A;  1IUE A;  3GOE A;  1QZE A;  2NBW B;  2JPH A;  2M56 B;  4KIK B;  4FXC A;  1EU4 A;  2KZR A;  1FXA A;  4FHK A;  3ZNI D;  1V5O A;  1QIL A;  1FD6 A;  3VRA B;  3X23 A;  4JPS A;  1E8W A;  1C1Y B;  1EO6 A;  3AE6 B;  1YQB A;  2KHW B;  1I42 A;  1WIA A;  5CHF A;  1Y8R C;  3L10 B;  2PE6 B;  3UIN B;  4US9 A;  1VZ6 A;  4A8X C;  1I35 A;  1SEB D;  2V3N A;  1N5W A;  5TR5 A;  2KDB A;  2J42 A;  4TKN A;  1UGJ A;  1FNU A;  4ARI A;  1MFW A;  1T6B X;  2WNM A;  2R2O A;  2BKF A;  3VQI A;  3VH3 B;  3N9Y C;  4RGO S;  5E6J A;  1YX6 B;  4QAY A;  3RNF C;  4HPP A;  3C19 A;  4URK A;  1WGY A;  5BYS A;  4A6Q A;  4GDK B;  4M8M A;  3QJZ A;  1LQB A;  5IN7 A;  3PPA A;  1RM6 C;  3A1Q A;  3ALB A;  4JWS C;  5FR6 A;  2KWD A;  2JXX A;  4TSS A;  2NPT B;  2KAN A;  1UGM A;  2ZVN A;  1E8Z A;  2ZW0 A;  2N1W A;  1J7B A;  5G2N A;  1MG4 A;  4KSK C;  3VUY A;  4FJV B;  1WR6 E;  1CQV A;  1BUI C;  4AWJ A;  4NPN A;  3H7S A;  4HEA 1;  3HVZ A;  2KT7 A;  2AL6 A;  2N0S B;  2C5L C;  5AEK B;  4PT5 A;  4FN2 A;  1C4P A;  2AYO B;  3BYT B;  3ZNG C;  1OQY A;  4PS3 A;  5IOI A;  4JL9 A;  3P4P B;  4N59 A;  4TQ0 A;  2CHZ A;  4EOY A;  4FHJ A;  3EC8 A;  1EF5 A;  2KAC A;  4C4V A;  1JRP A;  3EUB 2;  2VRR B;  2MBE A;  3BWU D;  4LJO B;  4N6E B;  1FMA D;  2RMM A;  2LZ6 A;  4P16 A;  1FXI A;  3RMK C;  2MQJ A;  5C3J B;  2IPK D;  4WJN A;  2W3R A;  4YTP B;  2K25 A;  4DHJ D;  1F52 A;  3AE1 B;  3NY5 A;  1E8X A;  3D32 A;  2D3A A;  1UNS A;  3GP7 A;  4XGA B;  4EKU A;  2WXQ A;  3AE5 B;  2JZP A;  2GMI C;  1GOZ A;  2LI5 A;  3RNA C;  4EZJ A;  3SU8 X;  3Q8B A;  3KW5 B;  3OG5 A;  1WJ4 A;  4EZK A;  3NS8 A;  4NAW B;  1TJE A;  4OHJ A;  2JWZ A;  4P1B C;  3PSE B;  4ICV A;  2K3U A;  3OWE B;  1VJK A;  2W3S A;  1IYF A;  2I1J A;  2C7M B;  3DHI C;  2EMS A;  4RGN A;  3WAO A;  1C4C A;  2WQY B;  2PE9 A;  3A9K A;  2RPQ A;  5EE0 A;  2DYB A;  3ZVV A;  5FKA C;  4GDL A;  3BVM A;  3T8M A;  4DDG D;  1RRB A;  2JRI B;  1WWT A;  1CMX B;  2KMA A;  2RGF A;  1ZUD 2;  4KKJ A;  3ZIM A;  2J52 A;  1MPE A;  1ROE A;  1FCC C;  2MLB A;  3NRZ A;  4A90 A;  2XBB C;  3RNC C;  2M1M A;  2VH2 A;  2KJH B;  1E10 A;  2DX5 B;  1WF9 A;  1T5X D;  1STE A;  4I6P A;  3I57 A;  1HA5 A;  4GU2 A;  5JH5 C;  3ONS A;  1QT9 A;  3DHG C;  4YTM B;  3ZNH B;  1R7S A;  3HUI A;  3LJ3 A;  4GOC A;  3R2T A;  2RDG A;  2KMM A;  2KC2 A;  2WX0 A;  3PGE A;  2I38 A;  2L8J A;  4OVV A;  2N9P C;  4BKS D;  3T3O A;  2KWU B;  1WZ0 A;  4IW0 A;  4HDO A;  3RNG C;  4LK0 M;  2PKO A;  3AH7 A;  1JWS D;  1YQ4 B;  1DOX A;  4F1S A;  2OJW A;  2WDR B;  4LTU A;  1WYW B;  4KZC A;  5IO9 A;  2BB6 A;  3DVG Y;  3JVZ X;  3B2F A;  4DK5 A;  3TEY A;  1CK1 A;  1I4Q A;  3U7Z A;  1PGA A;  4BAX A;  3HM3 A;  1AWD A;  2WXL A;  3UIP B;  3RD2 A;  3L4P A;  4DHZ E;  5LXH A;  2ZCC A;  4RF0 A;  3KUC B;  3ZLZ A;  3PLU A;  3AE7 B;  2A5U A;  1TT5 B;  4MGY E;  4BVU C;  4BKT A;  1V8C A;  3E9S A;  4WAF A;  1UBI A;  2LGI A;  3IAS 1;  3P63 A;  1SE9 A;  1WM2 A;  3SD5 A;  4MGI E;  3A9J A;  4WWO A;  3WIM A;  1ZP0 B;  1WMH B;  3Q8C A;  4RM9 A;  2OJR A;  1YJJ A;  2YEP F;  3VTW A;  3Q2A C;  3UF8 A;  3RCZ A;  4W9C A;  4ASW C;  3ZJT A;  1V1P A;  2PIA A;  1YJI A;  1KH0 A;  1P0R A;  3SDL C;  2IBI B;  2IO0 B;  1TIF A;  4C56 C;  1V5T A;  5BYQ A;  2ZEQ A;  1YJ1 A;  4MAC A;  1KOT A;  2DAF A;  2PVG C;  4GGQ A;  3KUD B;  1QQR A;  1TBE A;  2KFJ A;  2QMT A;  2ZW1 A;  3WAM A;  3NZS A;  3CMM B;  4GSW A;  4GB9 A;  1TZ1 A;  5G5H A;  3VAW A;  3R7Q A;  3GE8 C;  2PW9 A;  4JQW C;  2W9N A;  4B9K A;  1FPY A;  1K50 A;  3QX1 A;  5EE9 A;  3PO0 A;  1V2Y A;  2PLP A;  3TL5 A;  2CHX A;  4WQM A;  4XDC A;  4YTN B;  1T0S C;  1GPX A;  2K8B A;  2FBW B;  4KVG B;  2N9X A;  4K3B A;  3IXS A;  4K7S A;  3W1Y A;  2M17 A;  2O2V B;  3TSS A;  1Q0W B;  2AQ3 B;  3QA8 A;  3BZD B;  1SJE D;  4G0N B;  1BXT A;  4WUR A;  4AJY B;  3V3X A;  2QDF A;  1GC6 A;  2MCN B;  1M4V A;  2NBU A;  3BYY B;  4FLH A;  3Q8F A;  1PDX A;  4WWP A;  3ZTC A;  2CU3 A;  1WXA A;  1DOY A;  1FIQ A;  1UZX B;  1I4P A;  2MWS B;  2GBK A;  1YOV B;  2QIE B;  2J0K A;  2BKR B;  2LUM A;  3DBH B;  5J18 A;  4EEW A;  2UYZ B;  4GLS C;  2K1F A;  3ZO5 B;  3QAR A;  1I4H A;  1RYJ A;  3W9C B;  1QOA A;  3APC A;  2D3B A;  1MHH E;  2HD5 B;  1XT9 B;  1C77 A;  2ICI A;  3T9L A;  2IYD B;  2O6V A;  3TEW A;  3OLM D;  1HXY D;  3SR6 A;  1C79 A;  2LJ5 A;  2K39 A;  3DBH I;  1NBF C;  2V9H A;  3B1L X;  1N5X A;  4M00 A;  1SIJ A;  4KSL C;  4CHK A;  2NMQ A;  3K9P B;  2Q5W D;  3IHP C;  1GC7 A;  4HXD A;  1HE8 A;  2GBJ A;  2MBQ A;  2KX3 A;  1MJD A;  1FM0 D;  3HRD D;  4PYZ A;  2BS2 B;  4HVB A;  3U4E G;  5CX3 A;  2KN5 A;  3PRE A;  3DDC B;  4JE3 B;  3RUL A;  5AUI A;  2NTT A;  4MM3 A;  1D6E C;  1WE6 A;  3EFC A;  1VCB A;  3PRP B;  1WZ3 A;  1S3S G;  1GJZ A;  1IGD A;  2A4Z A;  2ACZ B;  1GB1 A;  3MC0 B;  4B6W A;  1F1H A;  5DPR A;  1BT0 A;  1UEL A;  2H88 B;  4W9K A;  1OTR B;  4GDL B;  2REX A;  2EMT A;  4IKG A;  4MSQ B;  3A4S C;  4WJP A;  2C60 A;  3OJ4 B;  3VUX A;  1FXT B;  5D6J B;  1SGH A;  1V49 A;  1WY8 A;  3RT3 B;  1P7E A;  2WP9 B;  1FFV A;  4X57 B;  2G1E A;  1FO4 A;  5DPT A;  1J19 A;  3HK0 A;  1NVI D;  1KJT A;  5IP4 D;  2LMC A;  1JRU A;  2Z59 B;  1R4N B;  1P98 A;  2NS5 A;  3KLS X;  3ENE A;  3S2A A;  2DBY A;  2MW5 A;  2WXF A;  2WDT B;  5BMG A;  2XNA C;  1GUA B;  3K9O B;  2G9H D;  2FCM A;  1JWM D;  2DWQ A;  3LB8 C;  2M0A A;  1WE7 A;  2PVO D;  2E6X A;  3MP9 A;  2MHJ A;  2FUG 1;  3DVN U;  3P1M A;  2W54 A;  3B9J A;  4FJZ A;  3Q3F A;  1UUP A;  1DYQ A;  3P4S B;  2YEP B;  2QSD A;  2WDQ B;  3TBL D;  2JZZ A;  1OFF A;  2X8X X;  2FE8 A;  3AE9 B;  2INP E;  4ANU A;  4XE0 A;  4FBJ B;  3DCG A;  5E6N A;  1SJH D;  3PS6 A;  1WXQ A;  4WAA A;  3ZYY X;  1E8Y A;  1PYW D;  5G5G A;  4RM8 A;  3AEC B;  3NZ3 A;  1UH6 A;  4TV3 A;  4AQ7 A;  3GZN I;  2J7Q B;  4GXB A;  1WGG A;  5KHO A;  2FID A;  3MC8 A;  2XEW A;  1N63 A;  3ZNZ B;  2K8H A;  4XX5 A;  4XC2 A;  1V86 A;  4K81 A;  4FUL A;  3JSV B;  3MC9 A;  4KIK A;  5D2M B;  4DHZ B;  3EGR A;  5H92 C;  5HHD G;  3JYU A;  4FAD A;  3B2G A;  5DPS A;  3X0W A;  2Y5P A;  2W82 A;  2IY1 B;  3U52 E;  2KN4 A;  3H9D A;  1PGB A;  3V60 A;  4P1C C;  5GXG B;  1L4D B;  4MH0 E;  2IJ0 A;  2D5G A;  4E3C A;  2WYQ A;  4EZL A;  1V1P B;  2X38 A;  4TUU A;  3QWZ B;  1C76 A;  4NY0 A;  2ZZP B;  3DBL I;  3H7P B;  3KVF B;  5IAA C;  2L1A A;  2KDM A;  1YN5 A;  2GB1 A;  2C7N B;  3I5J C;  2CS4 A;  4IOI E;  3VDZ A;  3TUO A;  2WX1 A;  5E6P A;  4DXF A;  1WX8 A;  1XF5 L;  2MBH A;  2LRU A;  1ENF A;  4K7W A;  1SSN A;  1LO5 D;  5TSS A;  4GDK A;  5AUK A;  3DBR I;  4KDL B;  2JX5 A;  1WX9 A;  3A1Q B;  2Z0D B;  3PV1 A;  4KKI A;  4OVZ A;  1V6E A;  3U30 A;  4ANW A;  4W9F A;  2KDE B;  3MHZ A;  1MG8 A;  1TS3 A;  4YSX B;  3VR9 B;  3ZRC A;  4IM2 A;  1SXT A;  2WXR A;  1WR1 A;  4L2Y A;  1OQQ A;  2KTR A;  1HZ6 A;  2DZK A;  1K53 A;  3GB1 A;  2V4I B;  4BOZ B;  3RYT A;  1WX7 A;  1XLP A;  3AEB B;  4MGK E;  4BBN C;  4HCP B;  1XCT L;  2LD9 A;  2MA9 B;  4NJ6 A;  1TKE A;  2D3G A;  2WU5 B;  4E74 A;  2H89 B;  1ZOY B;  2ON8 A;  4XZ4 A;  2INN E;  3ZW3 A;  1ZDX A;  3DWG C;  2WXG A;  5AZF A;  1FNW A;  3FC4 A;  4L23 A;  1V81 A;  1ZPS A;  2KK8 A;  5KHQ A;  3R66 C;  4C4V B;  1ZXI A;  1WI0 A;  1QOB A;  3DBL B;  1JWU D;  2SEB D;  3FIL A;  3GE3 C;  1D5X C;  2O6V B;  2CR5 A;  4RNA A;  2KFK A;  4RFB A;  5C2T B;  3AU5 A;  4A3P A;  5L95 C;  3L16 A;  1L0V B;  4E71 A;  1M94 A;  4YSY B;  1K51 A;  3EEC A;  1JW9 D;  4BKG A;  1SF0 A;  3MTN B;  3Q3M C;  1WSP A;  4HKZ E;  3VXW A;  1VDV A;  2MH7 A;  2PMV A;  1TY0 A;  3SHQ A;  3ZTD A;  1E0Z A;  3Q8A A;  1V80 A;  4C00 A;  1NYR A;  4L1B A;  3PHW B;  3P4R B;  4WQO B;  4S0R A;  1ESF A;  1FCL A;  1NI3 A;  4OZA A;  3TMP B;  5HG2 A;  1YN3 A;  2RR9 A;  1FNV A;  3I63 C;  5C23 A;  2QEJ C;  4LDT B;  3RI7 C;  2HJ8 A;  2O6V D;  2C9W B;  3Q3J A;  2ZJD A;  1NEK B;  3FAH A;  1D5M C;  4MM3 B;  5D3I B;  3BII D;  1E7U A;  3W1S C;  2GOW A;  2K6Q A;  2LUE A;  4R3D A;  3ML9 A;  2KAJ A;  3L54 A;  2LGD A;  4IC7 B;  3NUH B;  2FIF A;  4LNN A;  3A9K B;  1FRD A;  2LXA A;  2NBV B;  2D3C A;  4ZYS A;  2FCQ A;  2IO3 B;  3RZF A;  4J6I A;  2QJL A;  1ZE3 D;  4P6V F;  5D94 A;  2KQ4 X;  3R3M A;  3VFK A;  1ET9 A;  2DYO A;  5GMV A;  3IAM 1;  3PLV A;  1TS4 A;  1K8R B;  1MVK A;  4MDK E;  1UD7 A;  3O13 A;  2NR2 A;  2WXJ A;  2DAJ A;  1HEZ E;  4CYE A;  3BK1 A;  4WJO A;  3HM6 X;  1C78 A;  4CO7 A;  2M4N A;  1ZKH A;  3KWV A;  2BTE A;  1C3T A;  1JWB D;  3Q3N C;  1XCQ L;  1L6U A;  1XXG A;  3C8Y A;  3MJ5 A;  1A5R A;  4BFR A;  4CQN A;  2M0X A;  2JXT A;  1G6J A;  4KGT A;  1P9D U;  3QHT A;  4ANV A;  1TY2 A;  5JHA A;  3AUL A;  2MSE D;  2Y5B B;  3RZW C;  1I4R A;  2BPS A;  1KRH A;  1YD8 U;  4IWO A;  4DBG A;  1EM7 A;  3RFZ B;  3QAQ A;  2BS3 B;  2JRH A;  1WJN A;  1XO3 A;  3AEF B;  1L7Y A;  3UIO B;  1E7V A;  2WLB A;  2BBC A;  2INC C;  3CST A;  1LGR A;  1L0Y B;  1V1O A;  1MI0 A;  2D07 B;  3HIZ A;  4W9D A;  2KNB A;  3DPD A;  1L0X B;  4IWP A;  2QIL A;  1GNU A;  2N7J A;  3PVL A;  1JWA D;  1P1A A;  3AM9 A;  1YX5 B;  1Q5W B;  1LFD A;  2MRP A;  4F8C B;  1UWX A;  2BS4 B;  2V1Y A;  4ZRP A;  3IG3 A;  1SBB B;  3UI3 A;  2KXJ A;  1TZO A;  1WH3 A;  3W5U B;  4OVU A;  2BT6 A;  1RWS A;  1X1M A;  1EWC A;  2MX2 A;  1KF6 B;  4DDI D;  4XWW A;  1XD3 B;  1MHX A;  3IVF A;  5G55 A;  3VTV A;  5L83 A;  1WGK A;  1B9R A;  2NTS A;  4JIO U;  2Y5C A;  3JSV A;  1N6Z A;  3A33 B;  4MT5 A;  3GS2 A;  2R2Q A;  1D4B A;  2LVO A;  3BVG A;  1HZ5 A;  2KLG A;  1Y56 A;  2HE7 A;  4BZA A;  2LJI A;  2JT4 B;  3DWM A;  4BBN F;  1RLF A;  1FRR A;  1JRO A;  4PYU A;  1NEN B;  2CKH B;  2MJD A;  2R61 A;  3C0R B;  3DVG X;  1L2N A;  1WMH A;  1NI2 A;  3H8H A;  4MSM B;  1WXM A;  3CF6 E;  2LEK A;  4NAM A;  1JAL A;  4AUQ C;  2JU6 X;  2CU1 A;  1Q10 A;  1C4A A;  1EWY C;  3M63 B;  4Q2J A;  3U2S C;  1SE3 A;  2N7E A;  2L0T A;  4IG7 B;  5J2R A;  4WWM A;  3N32 A;  3KUZ A;  1NYQ A;  2E3T A;  3V05 A;  3R2I A;  4USA A;  2VZK D;  3AE2 B;  1E7P B;  3WAP A;  4HKQ A;  3M62 B;  3IBE A;  2Z8L A;  3NHE B;  4MGZ E;  1PQS A;  2LGS A;  3UGB B;  4DXA B;  1JCK B;  3UQA A;  3KYC D;  1ZXH A;  3EFU A;  3L17 A;  4ZHP A;  1ZW7 A;  3DBS A;  4PK1 A;  3TEZ A;  1D3Z A;  1KLV A;  5BO4 B;  4II2 B;  2IDY A;  2KTR B;  3AI5 A;  3PRM B;  3BY4 B;  1F2R I;  1K52 A;  2GBM A;  2JZ3 B;  1N60 A;  4ZHO A;  2BYE A;  2VZK B;  3ZDM C;  4KGR A;  2BGF A;  2FUH B;  2KC1 A;  2OED A;  1QOF A;  5FR3 A;  2BYV E;  3ZDT A;  1OGW A;  3NJT A;  1WGH A;  1UF0 A;  4HRS A;  4EFO A;  3P42 A;  4B0E A;  4FA6 A;  2BW2 A;  4DQO C;  2DZM A;  4K1R B;  4NQL B;  3VRB B;  2W55 A;  4ZRI A;  3AE8 B;  3NVV A;  2KFK B;  2WXP A;  5JZE B;  3KYD D;  3GZN B;  3NZU A;  2JF5 A;  1XLQ A;  2K6D B;  1DOI A;  3JW0 X;  4LNO A;  3I9V 1;  4UDU C;  4PS7 A;  4JWU C;  3ZQ4 A;  4M0W B;  2IY0 B;  2IGD A;  2MJE A;  3APF A;  1HTQ A;  1U4A A;  1NDD A;  2K5P A;  3M3J A;  5MPO A;  2IZV B;  1L6V A;  3MHS D;  4NJC A;  4ZRJ A;  1T0Q C;  3CWI A;  2HTH A;  3RNE C;  3N1X C;  2BYF A;  3QCA A;  5FK9 C;  4W9I A;  5JHB A;  4XDD A;  1AN8 A;  4W9J A;  3RNB C;  4HPM B;  4EE2 A;  5BMI A;  4RF1 A;  1J7C A;  2V3S A;  1E5W A;  5EE3 A;  1WGD A;  2B76 B;  4A20 A;  3AN1 A;  3P4Q B;  5BMH A;  2NVU I;  4KDI C;  4W9H A;  4LLG M;  1V97 A;  4WIP A;  1WRD B;  2UU7 A;  4HCN B;  3Q14 C;  4HK2 A;  3R8B A;  4AOF A;  4RGT A;  1Z2M A;  4YWG G;  4H2A A;  4ZOH C;  2FNJ B;  2LGX A;  3ML8 A;  2J53 A;  4XWT A;  3T3N A;  2FCS A;  2V3P A;  4HJK A;  1JQ4 A;  2C7H A;  2QHO A;  1ZDV A;  1UWM A;  4HWI B;  4KZ0 A;  1KTK A;  1PFD A;  2KJR A;  1QOG A;  3IT6 B;  2LVQ A;  2YLM A;  4HRO A;  4J3O D;  5DPW A;  3NVY A;  1QF6 A;  2MBB B;  4NQK E;  2N1V A;  2DYM A;  3LDZ E;  2RSU A;  3KH0 A;  2G3Q B;  5DCN A;  2KDF B;  2IGH A;  1YQ3 B; 
#chains in the Genus database with same CATH homology
 3PHX B;  3HHM A;  2OJR A;  3EEC A;  4MEM A;  4BKG A;  3MTN B;  4BKS A;  3VTW A;  2BWE S;  3UF8 A;  2GBN A;  4N9F 4;  2RD0 A;  3RCZ A;  3VXW A;  4W9C A;  1GG3 A;  2KVR A;  5CTR C;  3ZRF A;  4ASW C;  2G4D B;  3CSF A;  4PS8 A;  3SHQ A;  3ZTD A;  1EF1 A;  2KOX A;  1P0R A;  1V80 A;  2KX0 A;  1YIW A;  2JVC A;  3WAN A;  2MP2 A;  2YVC A;  4W9G A;  1P3Q U;  2D10 A;  3SDL C;  2GBR A;  2IBI B;  2IO0 B;  3IFW B;  3PHW B;  4WQO B;  4M8N A;  1V5T A;  2KLC A;  2LGY A;  2ZEQ A;  3V6C B;  1YJ1 A;  2N7D A;  4GN1 A;  2DAF A;  4LCD E;  2M8S A;  3TMP B;  1KOT A;  2ZNV B;  4GGQ A;  2I1K A;  3KUD B;  2ZVO A;  2RR9 A;  1F9J A;  1TBE A;  2KFJ A;  2LRW A;  5C23 A;  4LDT B;  4AP4 C;  3P2B A;  2HJ8 A;  4MJS B;  2O6V D;  2C9W B;  3Q3J A;  3TCA A;  3NZS A;  3WAM A;  3CMM B;  2ZJD A;  4GSW A;  4GB9 A;  1TZ1 A;  1WXV A;  3VAW A;  3APD A;  3R7Q A;  5E6O A;  1E7U A;  3W1S C;  4JQW C;  1TGZ B;  1IPG A;  2W9N A;  2GOW A;  2K6Q A;  2LUE A;  4B9K A;  3ML9 A;  4HPL B;  3L54 A;  2LGD A;  4IC7 B;  3VUW A;  3QX1 A;  1Z5S B;  2FIF A;  3DOW A;  3A9K B;  2L00 B;  1J8C A;  1V2Y A;  3QC8 B;  4II3 B;  2G45 B;  3TL5 A;  1LXD A;  2LXA A;  3U7D A;  2CHX A;  4B95 A;  2NBV B;  2FCQ A;  2IO3 B;  2WWZ A;  3RZF A;  1WM3 A;  2Z0E B;  4J6I A;  2KDI A;  2K8B A;  2MBO A;  1OEY A;  2DZJ A;  3NOB A;  4RMA A;  4KVG B;  4IM0 A;  5D94 A;  1UBQ A;  2N9X A;  3R3M A;  3QK0 A;  3H1U A;  4KV2 A;  3VFK A;  2DYO A;  2KO3 A;  3TJP A;  4K7S A;  3W1Y A;  2M17 A;  2O2V B;  5GMV A;  2K8C A;  3PLV A;  2LWP A;  2IO1 B;  1Q0W B;  2JUO A;  5HKH A;  3QA8 A;  1K8R B;  2XK5 A;  4G0N B;  4GMV A;  4EUT A;  4MDK E;  1UD7 A;  2NR2 A;  5CHV C;  4W9D A;  4AJY B;  2DAJ A;  3PRZ A;  4CYE A;  3B0A A;  1GC6 A;  2AEH A;  2LVP A;  2MCN B;  2KTF A;  4WJO A;  2NBU A;  3HM6 X;  3DQV A;  2M4N A;  4CO7 A;  1ZKH A;  3V61 A;  4FLH A;  3B08 A;  1C3T A;  3L0W B;  4WWP A;  3ZTC A;  3GOE A;  1QZE A;  1WXA A;  2NBW B;  2JPH A;  1UZX B;  4BFR A;  1A5R A;  2KKC A;  2M0X A;  4NNJ B;  4KIK B;  1EUV B;  2MWS B;  1IP9 A;  2GBK A;  2KZR A;  1G6J A;  2J0K A;  1AAR A;  1P9D U;  4ANV A;  3QHT A;  4DHJ B;  4FHK A;  3ZNI D;  2PJH A;  1V5O A;  2BKR B;  5JHA A;  3QQ8 B;  3AUL A;  1S1Q B;  4EEW A;  2MSE D;  3H7P A;  2UYZ B;  5J18 A;  2K1F A;  3VH4 B;  3ZO5 B;  3X23 A;  2Y5B B;  3RZW C;  1E8W A;  3N3K B;  3QAR A;  1C1Y B;  1EO6 A;  2BPS A;  3APC A;  1YQB A;  2KHW B;  1YD8 U;  4IWO A;  1WIA A;  1I42 A;  5CHF A;  4DBG A;  1Y8R C;  3L10 B;  2HD5 B;  1XT9 B;  2KQ7 A;  3QAQ A;  4AJW A;  2PE6 B;  3T9L A;  3UIN B;  2IYD B;  2O6V A;  2JRH A;  3OLM D;  4ANX A;  1WJN A;  1I35 A;  2AWT A;  4HLE A;  5TR5 A;  2KDB A;  4TKN A;  4TQ1 A;  2LJ5 A;  2K39 A;  3DBH I;  4G11 A;  2R2O A;  5C1Z A;  1NBF C;  2BKF A;  3B1L X;  3VQI A;  1L7Y A;  3AXC A;  3UIO B;  1E7V A;  2LXC A;  3VH3 B;  3CST A;  4KSL C;  3WA0 A;  1VD2 A;  4CHK A;  3K9P B;  4P7I A;  1XQQ A;  1YX6 B;  2D07 B;  3IHP C;  3HIZ A;  1GC7 A;  2BWF A;  2KNB A;  3DPD A;  4GIV A;  1HE8 A;  1V9J A;  2MBQ A;  2GBJ A;  4HXD A;  1GNU A;  2KX3 A;  4IWP A;  3PVL A;  1P1A A;  2J0M A;  4PYZ A;  1WFY A;  3OAW A;  1YX5 B;  4HVB A;  1Q5W B;  1LFD A;  2MRP A;  5CX3 A;  4URK A;  1WGY A;  2KN5 A;  4F8C B;  3PRE A;  2V1Y A;  4GDK B;  4M8M A;  3DDC B;  3QJZ A;  3IG3 A;  1LQB A;  3PPA A;  2KXJ A;  1WH3 A;  4FJY A;  3PTF C;  3RUL A;  4OVU A;  4G3X B;  3A1Q A;  3ALB A;  4MM3 A;  5FR6 A;  1WE6 A;  1VCB A;  3PRP B;  1X1M A;  2IO2 B;  1WZ3 A;  1S3S G;  3PZD A;  1J0G A;  2JXX A;  2A4Z A;  2MX2 A;  4DDI D;  1GJZ A;  2NPT B;  1XD3 B;  2KAN A;  2N9E B;  3IVF A;  5G55 A;  1UGM A;  3VTV A;  2ZVN A;  4B6W A;  5DPR A;  1E8Z A;  1BT0 A;  2N1W A;  4BOS C;  1UEL A;  2KQS A;  1TTN A;  4W9K A;  5G2N A;  4JGH B;  4JIO U;  1OTR B;  3JSV A;  4GDL B;  2REX A;  5EDS A;  4LJP B;  2EMT A;  4ICU A;  4KSK C;  3A33 B;  4MSQ B;  3VUY A;  2R2Q A;  3A4S C;  4FJV B;  2LVO A;  4WJP A;  1WR6 E;  2ASQ A;  2C60 A;  3OJ4 B;  4IWQ A;  2KLG A;  4NPN A;  3VUX A;  4AWJ A;  1FXT B;  2HE7 A;  3H7S A;  5D6J B;  1SGH A;  1RFA A;  2JT4 B;  4BBN F;  2EKE C;  2N4F A;  1RLF A;  2AL6 A;  2C5L C;  5AEK B;  4PYU A;  1V49 A;  4FN2 A;  1WY8 A;  2AYO B;  2CKH B;  3C0R B;  3ZNG C;  1OQY A;  3DVG X;  3RT3 B;  4NJ7 A;  1L2N A;  1WMH A;  1NI2 A;  2KD0 A;  4MSM B;  4PS3 A;  1WXM A;  3CF6 E;  4X57 B;  4ZDV A;  3V6E B;  3L08 A;  5J17 A;  4AUQ C;  4JL9 A;  2CU1 A;  5DPT A;  1J19 A;  1OEY J;  2KWV B;  3HK0 A;  1WGR A;  4TQ0 A;  2CHZ A;  1KJT A;  3M63 B;  3A4R A;  1JRU A;  4EOY A;  4FHJ A;  2Z59 B;  3EC8 A;  1EF5 A;  1P98 A;  5LXI B;  2NS5 A;  4ZRK A;  2VRR B;  3BIN A;  2MBE A;  3ENE A;  3S2A A;  3A9J B;  4LJO B;  2N7E A;  2L0T A;  4IG7 B;  2MW5 A;  3QIJ A;  4WWN A;  2WDT B;  5J2R A;  3EHV A;  4K7U A;  3N32 A;  3KUZ A;  2LZ6 A;  2D2Q A;  1GUA B;  3K9O B;  2MQJ A;  2FCM A;  3WAP A;  4WJN A;  4W9E A;  1H8C A;  1R4M I;  3M62 B;  3M95 A;  3IBE A;  1WE7 A;  2K25 A;  4DHJ D;  3PT2 B;  3NHE B;  4MGZ E;  1PQS A;  2L3Z A;  3NY5 A;  1E8X A;  5L83 A;  2PPH A;  3D32 A;  3UGB B;  3TIX A;  4DXA B;  3DVN U;  3UQA A;  2JY6 A;  3KYC D;  2FCN A;  3EFU A;  3L17 A;  2L05 A;  4EKU A;  3H6N A;  3Q3F A;  4FJZ A;  2LI5 A;  2GMI C;  1ZW7 A;  4EZJ A;  3DBS A;  3SU8 X;  3ZUN A;  3KW5 B;  1D3Z A;  5BO4 B;  1KLV A;  4II2 B;  1SIF A;  3WAL A;  2UWQ A;  2KTR B;  1WJ4 A;  3AI5 A;  2ZCB A;  3TBL D;  3PRM B;  4EZK A;  3BY4 B;  2JZZ A;  3NS8 A;  4NAW B;  2GBM A;  4ANU A;  5AZH A;  2JWZ A;  4I6N B;  4FBJ B;  3DCG A;  3PSE B;  4HDQ A;  2JZ3 B;  5E6N A;  2FAZ A;  2J0J A;  3PS6 A;  4WAA A;  4ICV A;  2BYE A;  3VHT C;  3VVW B;  1E8Y A;  3ZDM C;  2BGF A;  1E90 A;  2L76 A;  2FUH B;  1IYF A;  2I1J A;  4RM8 A;  1UH6 A;  2C7M B;  2EMS A;  2KC1 A;  2NCN A;  5IA7 A;  3WAO A;  4TV3 A;  2PE9 A;  3A9K A;  2BYV E;  3ZDT A;  3I3T B;  2RPQ A;  1OGW A;  1WGH A;  2J7Q B;  3GZN I;  4GXB A;  1WGG A;  5KHO A;  4EFO A;  2KWC A;  2DYB A;  1H4R A;  2NPT A;  2FID A;  5AZG A;  2XEW A;  3ECI A;  3ZNZ B;  2K8H A;  4IUM B;  4XC2 A;  4XX5 A;  4FA6 A;  1V86 A;  2L0F A;  3ZVV A;  4K81 A;  4FUL A;  3JSV B;  4GDL A;  4KIK A;  2DZM A;  2O2V A;  3T8M A;  4K1R B;  4DDG D;  4NQL B;  4ZYN A;  1RRB A;  1LM8 B;  2JRI B;  1T0Y A;  5D2M B;  4ZRI A;  4DHZ B;  1CMX B;  2KMA A;  3JYU A;  4FAD A;  2RGF A;  5DPS A;  3X0W A;  2KFK B;  2KJ6 A;  3ZIM A;  5JZE B;  3KYD D;  2IY1 B;  3VTU A;  2CHW A;  2LAS A;  4I6L B;  3H9D A;  3V60 A;  3NZU A;  2MLB A;  2JF5 A;  4MH0 E;  2K6D B;  3JW0 X;  2B3A A;  3V62 A;  2L7R A;  2V4L A;  2XBB C;  4E3C A;  4F7Z A;  2WYQ A;  4EZL A;  2M1M A;  4PS7 A;  3L13 A;  4TUU A;  2KJH B;  2DX5 B;  3QWZ B;  1WF9 A;  2DHZ A;  2MP2 B;  4NY0 A;  2KMC A;  2IY0 B;  2ZZP B;  3DBL I;  1WJ6 A;  3H7P B;  3APF A;  3KVF B;  1U4A A;  4M0W B;  1NDD A;  3M3J A;  5IAA C;  2IZV B;  4I6P A;  2C7N B;  2DEN B;  4GU2 A;  5JH5 C;  1Q1O A;  3U8Z A;  3MHS D;  2CS4 A;  4ZRJ A;  3VDZ A;  1RAX A;  4YL8 A;  2WX1 A;  3AU4 A;  1R4N I;  5E6P A;  3ONS A;  2BF8 B;  4LDT D;  2ZPN A;  2HTH A;  1WX8 A;  3RUI B;  3ZNH B;  4MEL A;  2AL3 A;  2BYF A;  2MBH A;  3QCA A;  4MJS A;  3LJ3 A;  3MJW A;  2LRU A;  4K7W A;  4W9I A;  5JHB A;  4GOC A;  4W9J A;  1ISN A;  2DZI A;  4HPM B;  2V3S A;  4GDK A;  1E5W A;  3DBR I;  1WGD A;  2KC2 A;  2WX0 A;  3PGE A;  4KDL B;  4A20 A;  2OOB B;  2L8J A;  3UQB A;  4OVV A;  2N9P C;  4BKS D;  2KWU B;  1WZ0 A;  1WX9 A;  3A1Q B;  2NVU I;  4KDI C;  2Z0D B;  3PV1 A;  4W9H A;  3W1S A;  2ZNV C;  4W9L A;  4IW0 A;  1V6E A;  4HDO A;  3U30 A;  4ANW A;  4W9F A;  2KDE B;  1WRD B;  4DWF A;  1MG8 A;  4HCN B;  5CHW A;  3ZRC A;  4F1S A;  1WJU A;  4HK2 A;  4IM2 A;  4WJQ A;  4AOF A;  1WR1 A;  1Z2M A;  1WYW B;  4IM3 A;  2FNJ B;  2KTR A;  4KZC A;  2LGX A;  3ML8 A;  2XK5 B;  4NAW A;  3DVG Y;  2DZK A;  2PEA A;  3JVZ X;  4BOZ B;  3RYT A;  2FCS A;  1WX7 A;  4MGK E;  3O65 B;  4A3O A;  4BBN C;  3ZKJ C;  4HJK A;  4DK5 A;  2C7H A;  4HCP B;  2QHO A;  5LLI A;  2LD9 A;  2MA9 B;  4NJ6 A;  4HWI B;  2D3G A;  4KZ0 A;  3HM3 A;  4E74 A;  2KJR A;  3UIP B;  3RD2 A;  4XZ4 A;  3ZW3 A;  4DHZ E;  5LXH A;  2LVQ A;  2ZCC A;  5AZF A;  2YLM A;  4G50 A;  3KUC B;  3ZLZ A;  3PLU A;  2ZPY A;  3R7R A;  1V81 A;  2A5U A;  1WXS A;  2KK8 A;  3N30 A;  4MGY E;  4BKT A;  4BVU C;  5KHQ A;  5DPW A;  3R66 C;  3DVN V;  2D11 A;  1KM7 A;  1WI0 A;  2G4S A;  2MBB B;  1ZGU B;  4NQK E;  1UBI A;  5D7G A;  1SE9 A;  1WM2 A;  3SD5 A;  4MGI E;  3A9J A;  4WWO A;  2O6V B;  3WIM A;  2N1V A;  2CR5 A;  2DYM A;  3LDZ E;  2RSU A;  3KH0 A;  2KFK A;  1WMH B;  2G3Q B;  3OJ3 A;  5DCN A;  2KDF B;  3AU5 A;  4A3P A;  5L95 C;  3L16 A;  4RM9 A;  4JLC A;  4E71 A;  1M94 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...