2KWCA

The nmr structure of the autophagy-related protein atg8
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
116
structure length
116
Chain Sequence
MKSTFKSEYPFEKRKAESERIADRFPNRIPVICEKAEKSDIPEIDKRKYLVPADLTVGQFVYVIRKRIMLPPEKAIFIFVNDTLPPTAALMSAIYQEHKDKDGFLYVTYSGENTFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Autophagy-related protein 8
publication title The NMR structure of the autophagy-related protein Atg8
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 18
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2010-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2kwcA00
3PRMB 4ANUA 3IFWB 4EEWA 2LI5A 1WR6E 3R3MA 4ZRIA 3OLMD 2RSUA 2KTRA 4K7SA 5D2MB 2JRIB 2KO3A 3B0AA 3KH0A 3CMMB 2RR9A 2ZNVC 4FJYA 4KVGB 4B95A 2ZCBA 3KW5B 1SE9A 2K8HA 3D32A 2KWVB 3EECA 3H7PA 2REXA 4KSLC 2GBMA 3A4RA 3OAWA 3H1UA 3H9DA 1WMHB 3PVLA 3QAQA 2LGYA 3A1QA 3DBRI 1P9DU 1V2YA 4NJ6A 1RAXA 3QARA 4HJKA 1YX6B 2FCQA 2DYMA 2JPHA 4WJOA 5E6PA 4MEMA 4B6WA 1V5OA 5LLIA 2AL3A 4DDGD 2L00B 1T0YA 2BWES 3DVNU 2CU1A 2K8CA 4M8MA 1H8CA 3W1YA 1ZW7A 2JVCA 3JYUA 2L7RA 4ICUA 2LWPA 3M3JA 1UGMA 2CS4A 1J19A 4MM3A 2LD9A 4G11A 3VTWA 3MTNB 4IM0A 3ZNGC 4W9DA 5TR5A 2FAZA 4CO7A 1JRUA 2FCNA 2K25A 4URKA 3APDA 3PZDA 5DCNA 4FBJB 2K39A 3QX1A 2IYDB 3EC8A 4GGQA 3TCAA 3NOBA 4AJWA 4EOYA 2G45B 3ZNID 3TBLD 2BPSA 3UIPB 1P0RA 4LCDE 2OOBB 1V9JA 2A4ZA 2BYEA 2KWCA 1RFAA 2NBWB 3V6EB 2WWZA 3QWZB 1RRBA 4IWOA 2KTFA 1YD8U 4DHZB 2G3QB 2KTRB 3QK0A 1WFYA 2IBIB 3U30A 2ZPNA 1BT0A 2KJHB 1E8XA 1WXAA 4HK2A 4ANXA 3WANA 3V6CB 3Q3FA 4P7IA 2FIDA 3H7PB 2AL6A 1R4NI 2KX0A 2JXXA 3JSVA 2K6DB 3A1QB 4EFOA 1V86A 2PPHA 4IM3A 2BWFA 2JT4B 1CMXB 2DYOA 3N30A 3VTVA 2EKEC 4EKUA 2O6VA 2GBJA 4II3B 3AU4A 3DVGY 5KHQA 1A5RA 2GOWA 2L0FA 2LRUA 2MX2A 4DWFA 1J8CA 4NQLB 1EF5A 2GMIC 4BVUC 1WJ6A 1L7YA 4HCNB 3RYTA 5J18A 4PS3A 4DHJB 3ML9A 4WWNA 3X0WA 4WJQA 3QC8B 4HLEA 5J17A 2UYZB 1OQYA 4M8NA 1NBFC 4FJVB 2IO0B 3JW0X 4MH0E 2KK8A 4ZRJA 4JGHB 1XQQA 1TZ1A 1Q5WB 1TTNA 2D07B 2V1YA 1K8RB 4IUMB 2BF8B 4GDKA 4NPNA 4GDLB 5AZFA 3RZWC 2WYQA 2ZEQA 2CHZA 1XT9B 4AP4C 5FR6A 4KIKA 1KOTA 4BKSD 1YIWA 2O2VA 2PE6B 4W9LA 4BOSC 1V49A 2KDFB 1LXDA 3DCGA 4IM2A 2MBQA 3IG3A 3T8MA 3A33B 4AJYB 2C60A 3AU5A 4IWPA 3B1LX 3Q3JA 4MSQB 1GG3A 1EO6A 1QZEA 1P1AA 3IBEA 4LDTB 2EMSA 3N32A 4B9KA 2DAFA 1V81A 2MBBB 3NY5A 5AEKB 2G4DB 1Z5SB 2M17A 4W9EA 4EZLA 3VFKA 1OTRB 3HM3A 2DZKA 2JY6A 3ML8A 4FHJA 1VCBA 2KMCA 4HWIB 3ZTCA 2KD0A 2BGFA 4I6PA 3JSVB 2N9XA 4YL8A 1E8WA 2LASA 4RM9A 1R4MI 2NPTA 1WZ3A 2O6VB 2YLMA 3CF6E 3S2AA 2NBUA 3UGBB 4GIVA 2D11A 4HXDA 1E7UA 4PYUA 1C3TA 2GBKA 2KJ6A 3CSTA 4A3PA 4BKGA 3MJWA 3QJZA 2K8BA 4MGZE 3PV1A 2KQ7A 4IW0A 2DAJA 2IO1B 1GUAB 2KOXA 1UBQA 1WGDA 1WM3A 3NZSA 5IA7A 3AXCA 1HE8A 2FNJB 1WX7A 1WXMA 2IZVB 5D6JB 2LGXA 3ZO5B 2MBEA 4GDKB 4GMVA 2CHXA 2MWSB 4EUTA 2WX1A 4PS8A 5L95C 3C0RB 2IY1B 1WGHA 4NY0A 4WAAA 2AWTA 2I1JA 4G50A 1AARA 3JVZX 3DVNV 5DPSA 4JLCA 2O2VB 5CHWA 1S1QB 1M94A 2BYFA 2MP2B 5IAAC 2DZIA 3RZFA 2JWZA 3OJ3A 1VD2A 4KZ0A 2KC2A 3DBSA 4KV2A 2KHWB 3KUDB 2FIFA 4ZDVA 2ZCCA 3ZNHB 1YJ1A 1WF9A 5G55A 1WGRA 1OEYJ 2C5LC 5E6NA 2KXJA 3WIMA 1U4AA 3ZW3A 4DXAB 1WGGA 4RMAA 4KZCA 2D2QA 3ZRCA 3MHSD 4M0WB 3VHTC 3VVWB 3ZUNA 4LDTD 3TJPA 3L10B 1V6EA 3U8ZA 2N9EB 2UWQA 2MBOA 1LM8B 4TQ1A 2NBVB 1J0GA 3QHTA 2NPTB 2MSED 2ZJDA 5LXIB 1EF1A 1GC7A 3L17A 4EZJA 4HPLB 1YX5B 2L3ZA 4MJSA 4X57B 1F9JA 1WJ4A 2LXAA 4K1RB 4FADA 3A9KA 3RT3B 2KFJA 1MG8A 2RGFA 4BBNC 3RD2A 3HK0A 3ZIMA 2LRWA 3N3KB 3O65B 3VXWA 3ENEA 3HIZA 2I1KA 2N1VA 2LUEA 2M0XA 3PLVA 1E8YA 2LVOA 4K7UA 3UIOB 3WAPA 4MSMB 4WJNA 4AUQC 2C7NB 2NVUI 4NJ7A 3PTFC 4GN1A 2J0JA 1IP9A 3PT2B 4DK5A 2N4FA 5CHFA 5CX3A 4FULA 2K6QA 2Z59B 3M62B 1IYFA 2LJ5A 1Y8RC 1WRDB 1D3ZA 1IPGA 4KSKC 3SHQA 4TUUA 2C9WB 3B08A 4TV3A 1UZXB 3RULA 1WJNA 4PS7A 3V62A 4ANVA 4E71A 2NS5A 2L05A 4K81A 2V3SA 2KLCA 4HDOA 4WWPA 3GOEA 2MBHA 2N7DA 2KLGA 4HDQA 3RUIB 3DBLI 2KDBA 4FLHA 1GNUA 4IG7B 2CHWA 4WWOA 3UF8A 2W9NA 1TGZB 3QIJA 2BKRB 1P98A 2EMTA 1E90A 3VTUA 2MCNB 3DOWA 3NZUA 1WH3A 3PPAA 2Y5BB 3NHEB 3ZDMC 3PLUA 2FCSA 1NDDA 2KANA 3DPDA 4RM8A 2KJRA 3R7RA 4WQOB 1LQBA 3TMPB 4GOCA 5C1ZA 3HM6X 2KKCA 4ZRKA 4K7WA 1WYWB 3PHWB 4I6LB 2M8SA 4MJSB 5JHBA 1ZKHA 3A9JA 5JH5C 3HHMA 2PJHA 3VUYA 1Z2MA 3GZNI 2DX5B 4JL9A 3BINA 4GU2A 4DHZE 1P3QU 4G3XB 4NQKE 3KUZA 1WY8A 4W9HA 1I42A 4MGYE 4W9CA 1YQBA 2WDTB 3VDZA 4BKSA 4MGKE 2KDIA 4HCPB 3H6NA 1PQSA 4CHKA 2J0KA 1SGHA 2J0MA 4PYZA 4EZKA 3I3TB 3AULA 2IO3B 4A20A 4LJPB 2KNBA 3KUCB 2HD5B 2L0TA 1E7VA 1ZGUB 4KDIC 3VAWA 4AOFA 3SD5A 2ZPYA 2G4SA 3U7DA 1OGWA 1WM2A 3K9OB 4G0NB 2N1WA 1TBEA 1OEYA 2OJRA 2BKFA 4TKNA 3RCZA 4DHJD 3DVGX 5E6OA 2QHOA 2RD0A 3AI5A 2JZZA 2C7MB 2L76A 2KMAA 4OVVA 3TIXA 1V80A 2GBRA 4KIKB 3VH3B 3EFUA 5LXHA 4W9IA 2B3AA 3L13A 2L8JA 1LFDA 4W9FA 3T9LA 2M4NA 4HPMB 3BY4B 4FJZA 3DQVA 4N9F4 5BO4B 2DZJA 2LGDA 3CSFA 3ALBA 2DHZA 2MQJA 4JQWC 4BBNF 4F1SA 4ASWC 2JUOA 5J2RA 3P2BA 4E3CA 3KVFB 4AWJA 3EHVA 1Q0WB 1WX9A 2MRPA 3A9JB 1E5WA 3PRPB 2IO2B 3R66C 1XD3B 2CKHB 1WR1A 3VQIA 4CYEA 2KWUB 4XZ4A 1V5TA 5EDSA 3SDLC 4E74A 5D94A 5AZHA 2HE7A 4MDKE 3VUXA 2KN5A 3QA8A 3SU8X 3UQBA 3M95A 1WXVA 2A5UA 5DPTA 2BYVE 5CHVC 2GBNA 3PHXB 3APCA 3L16A 2KFKA 4GDLA 1E8ZA 2R2OA 4II2B 5HKHA 3L08A 4TQ0A 3ONSA 1KJTA 4JIOU 2XBBC 2D10A 1I35A 1H4RA 4DBGA 2O6VD 4F7ZA 2NCNA 4XX5A 1WZ0A 1GJZA 2VRRB 3LDZE 3A4SC 2WX0A 2XK5A 2ZVNA 2IY0B 3V61A 3PGEA 3WALA 5GMVA 1EUVB 4NAWA 5AZGA 3KYDD 1WIAA 3ZLZA 4LJOB 4XC2A 2K1FA 3ZRFA 4ANWA 1FXTB 3VH4B 2ZZPB 5C23A 3H7SA 1RLFA 2Z0EB 1NI2A 2DZMA 1GC6A 2FUHB 5D7GA 3UQAA 2ZNVB 2C7HA 1UD7A 4GSWA 4IWQA 2Z0DB 4KDLB 3ZTDA 2NR2A 2CR5A 2MA9B 2R2QA 2DENB 4A3OA 2AYOB 3L54A 3DDCB 3X23A 4OVUA 2KDEB 3ZNZB 3ZKJC 4FA6A 1UELA 3WA0A 1WXSA 1WX8A 2N7EA 3K9PB 5JZEB 1KLVA 2V4LA 2HJ8A 3WAMA 5DPRA 1UBIA 2KQSA 1SIFA 2KC1A 2MW5A 3DBHI 3KYCD 2LVPA 3QCAA 2N9PC 2JRHA 1WMHA 3L0WB 5L83A 2M1MA 2LZ6A 2YVCA 4FN2A 3V60A 3W1SC 3PSEB 1WI0A 3WAOA 3ZDTA 1X1MA 2LXCA 4DDID 2LVQA 2RPQA 1Q1OA 4BFRA 4IC7B 4BOZB 3PREA 1WE7A 2DYBA 2PEAA 3OJ4B 4NNJB 3W1SA 3M63B 4ICVA 5G2NA 3UINB 4W9GA 2KFKB 5JHAA 3NS8A 3LJ3A 1UH6A 5DPWA 1S3SG 2FCMA 5KHOA 1WJUA 2ASQA 2JF5A 3PRZA 3A9KB 4BKTA 2KVRA 1G6JA 2MLBA 2J7QB 2KZRA 2MP2A 2KX3A 1L2NA 2XK5B 4MGIE 1WGYA 2AEHA 4I6NB 1ISNA 2ZVOA 4HVBA 4J6IA 3APFA 4NAWB 3R7QA 3ECIA 4GXBA 1KM7A 2D3GA 4WJPA 2JZ3B 1WE6A 3TL5A 4F8CB 4FHKA 2HTHA 3QQ8B 2XEWA 3PS6A 4MELA 4W9KA 4GB9A 5CTRC 4W9JA 3IHPC 1C1YB 4ZYNA 3ZVVA 3VUWA 2PE9A 3IVFA
chains in the Genus database with same CATH superfamily
4ANUA 3KWVA 2VH1A 1JWUD 2KACA 2KTRA 1BUIC 2N0SB 2JRIB 2LEKA 3CMMB 4KGSA 4RH6A 3KW5B 1SE9A 3D32A 4KSLC 3A4RA 2V3PA 4YTNB 3H9DA 1P9DU 1V2YA 4NJ6A 1RAXA 4M02A 2JPHA 4MEMA 4DDGD 1DOXA 1STEA 1DYQA 2CU1A 2K8CA 3W5VB 1ZDXA 1CK1A 2L7RA 2WXIA 4OHJA 2B76B 1RM6C 1K50A 2N7JA 2WXRA 1NYRA 4M01A 3NVWA 5DCNA 4FBJB 1SIJA 3B2GA 2IYDB 3TCAA 2JWUA 2G45B 3UIPB 4LCDE 4KKIA 1RYJA 3V6EB 1RFAA 2WWZA 4YSZB 1YD8U 4DHZB 2KTRB 1SF0A 5HFYA 1BT0A 2MJDA 2RDHA 2WXMA 3Q3MC 4ZHOA 1A70A 5D3DA 3Q3FA 1XLQA 2AL6A 5D3IB 2SAKA 5BMGA 4PK1A 1LO5D 2BWFA 4JWUC 2EKEC 3AMZA 4EKUA 1TKEA 2BBCA 3RYTA 5J18A 4WWNA 4ARCA 2KK8A 1TTNA 1HQRD 3AEBB 4GDLB 5AZFA 2CHZA 1SJHD 3AEFB 4N59A 1YMHE 3RNCC 4BKSD 2O2VA 1F2RC 1V49A 4IM2A 3EUB2 2Y5CA 2C60A 1HA5A 4MSQB 1ZDVA 1BXTA 3C8YA 2WLBA 2MJEA 5AEKB 2G4DB 1TYGB 4W9EA 4EZLA 3VFKA 3HM3A 3ZTCA 2DZKA 2D3BA 2JY6A 4HWIB 4M0WA 1P7EA 1VZ6A 2KD0A 2N9XA 1E8WA 2LASA 3E9SA 1R4MI 3VRBB 4ZRPA 3S2AA 3UGBB 4GIVA 5HHDG 2GBKA 2KJ6A 1N5XA 2K5PA 3AE6B 2K8BA 2KQ7A 2DAJA 1GUAB 2KOXA 1E6EB 2WDRB 5H8YE 1XCTL 2CJOA 5D6JB 2LGXA 3NZ3A 4GMVA 2L83A 2YEPB 1DOYA 2AWTA 4G50A 5DPSA 4JLCA 2O2VB 2MP2B 2DZIA 3NVYA 3Q14C 3SFDB 4KZ0A 2WXNA 2KHWB 2FIFA 2D5GA 2ZCCA 3ZNHB 1YJ1A 1PYWD 1TKGA 1UWXA 2PVGC 3ZRCA 1I4PA 3MHSD 4M0WB 3VHTC 3ZUNA 3TJPA 4FXCA 1QOFA 1LM8B 4TQ1A 2NBVB 2D3CA 1P7FA 1QT9A 3GP7A 4CQNA 4MJSA 2LXAA 2WQYB 4FADA 1TS4A 3A9KA 4BBNC 3RD2A 2CJNA 2LUEA 3PLVA 1HTQA 2QEJC 2C7NB 4WH4A 3FKYA 5EE3A 3VR9B 3CWIA 3SHQA 1T5XD 1ZE3D 4TUUA 1GPXA 3B08A 2L32A 4TV3A 2NS5A 3AE2B 1I4HA 3MC9A 2E3TA 1Y56A 4HDOA 2IGHA 3GOEA 3RUIB 2ON8A 3DBLI 2KDBA 1GNUA 4NZLB 2CHWA 2W9NA 1TGZB 3QIJA 3VTUA 4A55A 2MCNB 3PLUA 4LNNA 2FCSA 4RM8A 2KJRA 4KGTA 3TMPB 4HKZE 4I6LB 4MJSB 4JPSA 1QOBA 2M0AA 4HRSA 1Z2MA 3GZNI 2DX5B 4G3XB 3KUZA 1CZPA 4W9CA 1YQBA 1ROEA 3VDZA 4BKSA 4MGKE 4HKQA 3DHGC 2KNBA 2K3UA 3VAWA 3N1ZC 2VZKD 1LGRA 2ZPYA 2HTME 2G4SA 4EE2A 3U7DA 2BS4B 1F1HA 1E10A 2OJRA 1OEYA 4TKNA 4DHJD 3N9YC 1I4RA 1QOAA 1UGJA 5MPOA 2RD0A 5IO9A 2L76A 3VR8B 2I2YA 4OZBA 2B3AA 1IUEA 1FRRA 4HPMB 3BY4B 4FJZA 1XO3A 4S17A 2MQJA 4F1SA 1FO4A 2RMMA 4ASWC 3EHVA 2MRPA 1XD3B 2WNMA 3VQIA 2KN5A 2LFIA 1EU4A 3UQBA 2A5UA 4LNFA 4KKJA 3Q8AA 4II2B 2KFKA 5HKHA 3L08A 1YQ3B 1HXYD 3GS2A 2O6VD 4F7ZA 2NCNA 4D2KA 2VRRB 4NAMA 3A4SC 1DOIA 3WALA 3BK1A 5GMVA 2KAJA 1PFDA 2M56B 4WQMA 4ANWA 1RLFA 1N63A 1GC6A 3UQAA 4B0MA 4GSWA 2NR2A 2R2QA 1UWMA 4N6EB 4C56C 4OVUA 1C76A 1EWYC 3WA0A 1WX8A 2LUMA 2Q5WD 3AE3B 4RGOS 2QC8A 1UBIA 2MW5A 2N9PC 3L0WB 1WMHA 1K51A 2YVCA 4Q2JA 2RPQA 3BYTB 1Q1OA 4YSYB 4BOZB 3PREA 3W1SA 4ICVA 3BVZA 4IOIE 3UINB 2KFKB 1V1PA 5DPWA 1WJUA 1B9RA 5EE1A 4BKTA 3P4PB 2J7QB 1WGYA 1KF6B 1CQVA 4J6IA 1YJIA 4WJPA 4F8CB 3TL5A 4FHKA 3FILA 3QQ8B 2WS3B 4MELA 4W9KA 1FMAD 1RWSA 4W9JA 3VUWA 3R2TA 3IFWB 2ACZB 3AEDB 4EEWA 1ZOYB 2LI5A 1WR6E 4ZRIA 3OLMD 1JWBD 4K7SA 2KO3A 2OHFA 3B0AA 5LNK1 4B95A 2ICIA 2ZCBA 1TJEA 2V3NA 5GXGB 3H7PA 3WCQA 1WMHB 3PVLA 2LGYA 2EELA 2INDC 3P4RB 3QARA 4HJKA 4WJOA 1WGKA 1FFVA 5LLIA 4ZRQA 2L00B 1T0YA 1JRPA 4P1BC 2J4XA 2HDEA 1KLUD 4ICUA 4BAXA 2LWPA 1ZXHA 2OJWA 5G5GA 1J19A 1SE2A 4G11A 2KDMA 3KWLA 1KTKA 5TR5A 2FAZA 3U52E 2FCNA 1JALA 1ZPSA 2K39A 5FK9C 5BMIA 3NOBA 4EOYA 2V4IB 2OOBB 3U4EG 1PGAA 2A4ZA 2ZW0A 1F2RI 3EFCA 2KTFA 1FCLA 2RPVA 2G3QB 1SJED 1TS3A 1ZP0B 4DXGA 2KJHB 1WXAA 4HK2A 4OVZA 4P7IA 2FIDA 3H7PB 2AQ1B 1F52A 1R4NI 2JXXA 4IM3A 3TSSA 1CMXB 3Q6BA 2O6VA 2GBJA 5EE9A 3DVGY 3E56A 1J8CA 1EF5A 2GMIC 4BVUC 1L7YA 4DHJB 4HLEA 1N61A 2UYZB 1OQYA 4M8NA 1NBFC 2IO0B 4MH0E 1TZ1A 1TY2A 1Q5WB 2D07B 2PTLA 1K8RB 4MH8A 2BF8B 4GDKA 4YTPB 2WYQA 1XT9B 3AE7B 3GE3C 4KIKA 1YIWA 2PE6B 4W9LA 2X8XX 2KDFB 1LXDA 2MBQA 3NS1A 1FNWA 4AJYB 3AU5A 4IWPA 1ENFA 1QZEA 3RFZB 1L0XB 3N32A 1V81A 1FEHA 1Z5SB 4YWGG 1QOGA 1K52A 4B0EA 1OTRB 4YL8A 4RM9A 4LK0M 3HUIA 1WZ3A 2WXFA 3IAM1 2V0GA 1T0SC 2O6VB 2YLMA 2D11A 4HXDA 3HVDA 1E7UA 4PYUA 3CSTA 1IGDA 1L6VA 3PV1A 3NZSA 1WM3A 1VR9A 3AXCA 1SB3C 2FNJB 1WX7A 2INNE 4C7ZA 3T3OA 1PGXA 3ZXRA 3ZO5B 2JYTA 4GDKB 2CHXA 4GLSC 4PS8A 5BMHA 5L95C 2IY1B 5IP4D 2AX5A 4WAAA 2I1JA 3DVNV 1M94A 2Y5PA 1JW9D 2JWZA 4K3BA 1XEEA 3KUDB 1ZXIA 1JMLA 4ZDVA 3LB8C 5G55A 5E6NA 2KXJA 3WIMA 1TT5B 4DXAB 3MHZA 1N60A 4LDTD 3L10B 5I4DA 2N9EB 2UWQA 1R4NB 1WRIA 3FAHA 2MSED 2ZJDA 2IDYA 1I7HA 1EF1A 3L17A 2QMTA 1E0ZA 2L3ZA 1T3QA 1UF0A 1WJ4A 4K1RB 4C4VA 3RPFC 2D3AA 3ZIMA 2DWQA 3O65B 3N3KB 3VXWA 3HRDD 2I1KA 1CJEA 4AUQC 4GN1A 1IP9A 3PZ8A 3PT2B 2JZPA 5CX3A 1EU3A 2LJ5A 5JXVA 1Y8RC 1IPGA 2C9WB 1UZXB 2JSVX 3RULA 4E71A 1GOZA 1YN3A 4R3DA 1TIFA 2N7DA 2Z8LA 2GI9A 4FLHA 4IG7B 4WWOA 2LGIA 2PKOA 4M00A 4YXDB 2BKRB 1P98A 3NZUA 3EGRA 4N58A 1AN8A 2JX5A 3DPDA 4RGNA 4WQOB 2WP9B 1JCKB 1I4GA 4K7WA 3PHWB 2M8SA 5JH5C 4C4VB 1HZ6A 2PJHA 4C00A 3TEYA 3VUYA 2WXKA 1MPEA 4GU2A 4NQKE 1XCQL 3DHHC 4RGTA 1YNTE 3EA6A 2KDIA 3C19A 1PQSA 4CHKA 2J0KA 4PYZA 4A20A 2HD5B 1ESFA 1HEZE 1YJJA 1E7VA 1ZGUB 4KDIC 4ACFA 3K9OB 4G0NB 1TBEA 3RCZA 2QHOA 3FC4A 2KWDA 4JX1C 3KQ4A 1C4PA 1C4AA 3AN1A 3HVZA 3EFUA 4WWMA 1IBXA 4W9FA 1LFDA 4AS1A 4LLGM 2ZW1A 3RNFC 1Q10A 2KVZA 3CSFA 1AYFA 4JQWC 2JUOA 2PW9A 4E3CA 3AE4B 3R66C 1WX9A 2IO2B 1KH0A 4CYEA 2KWUB 4XZ4A 1N6ZA 1JQ4A 5AZHA 2FBWB 1HZ5A 2GBNA 3IT6B 4TQ0A 3ONSA 1KJTA 4JIOU 2BS3B 5AUKA 1AWDA 4DBGA 1WZ0A 4A90A 1R7SA 1D5MC 2XK5A 1SXTA 3PGEA 1EUVB 4USAA 1GB1A 1WIAA 4YT0B 3AB5A 3PZ7A 2K1FA 1BMLC 5C23A 3H7SA 1E7PB 1NENB 5D7GA 2ZNVB 1IBXB 3AEAB 1UD7A 3DBHB 4IWQA 2Z0DB 4KDLB 2CR5A 2MA9B 1MHXA 2K0PA 4A3OA 2KDEB 2PIAA 3MP9A 2J52A 1FM0D 2V4LA 3WAMA 1J7CA 1SIFA 3KYCD 2JRHA 2R61A 1X1MA 2LXCA 1FPYA 4IC7B 2WU2B 3OJ4B 2M19A 5JHAA 4RGMA 1S3SG 5KHOA 2JF5A 3PRZA 3A9KB 3RMKC 1NI3A 2KX3A 2XK5B 2AEHA 4I6NB 4HVBA 2DLBA 2ZVOA 3APFA 4GXBA 3AEEB 1WE6A 1AW7A 2HTHA 1F0ZA 3ZGZA 2XEWA 4ZYNA 3ZVVA 2X38A 3PRMB 2DNFA 1MG4A 2JYEA 2RSUA 4XE0A 5D2MB 3W5UB 2WHIA 3DHIC 2ZNVC 4KVGB 4LNIA 2K8HA 2KWVB 3EECA 1WXQA 2REXA 3P42A 4XDDA 1T6BX 3OAWA 1GB4A 2QJLA 3H1UA 3QAQA 3N20C 2IPKD 3AM9A 2DYMA 5E6PA 4B6WA 2AQ2B 1V5OA 3B9JA 2MH7A 2BWES 3BVMA 4M8MA 1QLBB 3R8BA 1ZW7A 2JVCA 2WXPA 3M3JA 4MM3A 2LD9A 3VTWA 4URKA 3APDA 4P6VF 3LYYA 4YSXB 1SSNA 3EC8A 4A9AA 3RNAC 4AJWA 1L4ZB 3TBLD 2BPSA 1P0RA 4IDIA 2BYEA 2KWCA 1K53A 2J42A 1WFYA 1YN4A 4H2AA 2ZPNA 1I4QA 2VH2A 1E8XA 3P4SB 1FIQA 4ARIA 3VRAB 5BYSA 5IN7A 3PO0A 1V86A 2PPHA 2DYOA 2JT4B 2BW2A 3N30A 4S0RA 5KHQA 3AU4A 1QQRA 3TEZA 2L0FA 3AEGB 1XLNA 2WXHA 2G9HD 4PS3A 3X0WA 3KLSX 3QC8B 4WJQA 5J17A 3JW0X 2KMMA 4ZRJA 4JGHB 1XQQA 2V1YA 3Q69A 2ZEQA 2BB6A 5C2TB 1KOTA 2LHEA 4BOSC 1JROA 3IG3A 2ONQA 1VLBA 1GG3A 1V1OA 5FR3A 1UUPA 3IBEA 2AQ3B 4B9KA 2EMSA 2DAFA 3DWGC 3NY5A 2J53A 3MC8A 2M17A 4YTMB 1FFUA 1VCBA 2KMCA 1NYQA 2NPTA 2SEBD 3P63A 3AE8B 3ZQ4A 2NBUA 4BKGA 3MJWA 4IW0A 1FCCC 4P16A 2IO1B 1C79A 1FXIA 1UBQA 1WGDA 3OWEB 5IA7A 4PT5A 1HE8A 4MT5A 1WXMA 4K3CA 1XF5L 2QCZA 3MC0B 1JWSD 2MWSB 4EUTA 2WX1A 1V1PB 1WGHA 2BTEA 4WURA 3RZFA 3AV8A 3RI7C 1OQQA 1PGBA 1WGRA 2C5LC 3FILB 4RF1A 5HG2A 4LTUA 5AUIA 2D2QA 3MFGA 4XDCA 2MBOA 2MJ3A 1J0GA 2NPTB 4WIPA 5LXIB 1VZ7A 1GC7A 1JWMD 3GB1A 4HPLB 1YX5B 2IGGA 2WDVB 2YEPF 1F9JA 2FUG1 2INPE 1MG8A 4OZCA 3ENEA 3HIZA 2LMCA 2M0XA 2JQRB 3UIOB 2VZKB 3WAPA 4MSMB 3GE8C 2NVUI 4NJ7A 2NTSA 4DK5A 2N4FA 2RDGA 2GRIA 4FULA 2Z59B 3M62B 1IYFA 2NTTA 1WRDB 1WJNA 4ANVA 4K81A 3ZXVA 1FNVA 2V3SA 3IAS1 3TEXA 2KLCA 2WU5B 5C3JB 5G5HA 4HDQA 3UF8A 4ZOHC 3DOWA 2JXTA 2KT7A 3NHEB 2IGDA 2WGSA 1NDDA 4JE3B 4O1NA 3R7RA 2QILA 5C1ZA 3HM6X 4ZRKA 1WYWB 4J3OD 5JHBA 3HHMA 4JL9A 5E6JA 4DHZE 1P3QU 1WY8A 1I42A 1T0QC 4MGYE 4HCPB 3H6NA 2DBYA 1SGHA 4EZKA 4XWWA 2IO3B 3KUCB 4AOFA 3SR6A 1J7AA 3ETRA 4ITKA 2BKFA 4BZAA 3CIRB 3SFEB 2JZZA 3NVZA 2KMAA 1MI0A 2N9LA 1M4VA 2I38A 4KIKB 3VH3B 4P1CC 2WXQA 3L13A 2L8JA 3T9LA 3DQVA 4N9F4 2DZJA 3ZJUA 1EWCA 1IGCA 2LGDA 1HTOA 3BVGA 3KVFB 2QDFA 3B2FA 4C80A 4AWJA 4KGRA 1E5WA 2LHDA 1V5TA 5EDSA 3SDLC 4E74A 5D94A 2Y3AA 2HE7A 2W3SA 3QA8A 3SU8X 3MJ5A 1WXVA 5DPTA 2BYVE 3PHXB 4GDLA 3APCA 2R2OA 3OG5A 1I35A 3IT4B 2GLSA 3LDZE 2EKIA 3RNEC 2WX0A 3H8HA 2IY0B 3T3NA 3V61A 5AZGA 3KYDD 1F77A 4LJOB 1YOVB 1L0YB 1FXTB 3VH4B 2Z0EB 1NI2A 1ET6A 2FUHB 5IOIA 4C7YA 1ACCA 2OEDA 3L54A 3ZNZB 3ZKJC 1UELA 5T8IA 1QKZA 3NUHB 1ET9A 2HJ8A 3DBHI 2LVPA 4HEA1 3V60A 1WI0A 3ZDTA 1VDVA 4DDID 2LVQA 1D4BA 1WE7A 2DYBA 4NNJB 3M63B 5G2NA 4W9GA 3NS8A 3LJ3A 3Q8EA 3O13A 2KVRA 1G6JA 1V8CA 2KZRA 2MP2A 2HJ1A 1L2NA 1ISNA 1KM7A 4RF0A 1V97A 2D3GA 3ABVB 4L2YA 5CTRC 3IHPC 1C1YB 2PE9A 1SEBD 1TZOA 3R3MA 3Q8BA 3KH0A 2RR9A 4FJYA 1FXAA 1PUTA 1FNUA 3W2DA 2PMVA 2GBMA 3A1QA 3DBRI 3U2SC 2XN9C 1YX6B 2FCQA 4A6QA 1TS5A 2AL3A 4US8A 4RFBA 3DVNU 1H8CA 3W1YA 3JYUA 1UGMA 2CS4A 3MTNB 4IM0A 3ZNGC 4W9DA 1B1ZA 4CO7A 1JRUA 2K25A 3DWMA 4DQOC 3PZDA 3QX1A 2WDQB 4GGQA 2MHJA 3ZNID 2IJ0A 3V05A 1SE3A 1V9JA 2KQ4X 2NBWB 2BYTA 3QWZB 3Q8CA 1RRBA 4IWOA 1SBBB 3QK0A 2GB1A 2IBIB 3U30A 2QIEB 4ANXA 1TS2A 3WANA 2K9XA 2FE8A 4REZA 4DXFA 3V6CB 1J7BA 4UDUC 2KX0A 1D5XC 3JSVA 2K6DB 3A1QB 3Q3NC 4EFOA 3L4PA 3VTVA 3TUOA 4II3B 2TSSA 1A5RA 2GOWA 2LRUA 4WAFA 2MX2A 4DWFA 2MEKA 4NQLB 1WJ6A 4HCNB 4AQ7A 1MFWA 1L4DB 3ML9A 3Q8FA 1C78A 3ZYYX 2WXGA 4FJVB 1C9FA 2INCC 4L23A 3I9V1 2LGSA 5H92C 4IUMB 4NPNA 3RZWC 4TMAB 2WXLA 1GAQB 1N62A 4AP4C 5FR6A 2BB5A 2L1AA 1WYGA 3V3XA 3DCGA 3T8MA 3A33B 2RDBC 3B1LX 3Q3JA 1EO6A 1P1AA 1YQ4B 4LDTB 1R4MB 2MBBB 2WXOA 4HJGE 1WSPA 1JWAD 4FHJA 3I63C 3ML8A 1VRAB 2BGFA 4I6PA 3JSVB 3ZJTA 1L6UA 3DBRB 2BQQA 2CU3A 1TY0A 3AECB 3CF6E 3J9CA 3R2IA 2N9KA 2PVOD 1C3TA 4A3PA 4TSSA 4LNOA 3LXFA 3QJZA 4MGZE 2WXJA 3N1YC 1E9MA 1XXGA 4XWTA 2IZVB 5BYRA 2BVCA 2MBEA 1L5PA 3C0RB 4ZHPA 4NY0A 1OQRA 1AARA 3JVZX 1MVKA 5CHWA 1S1QB 2BYFA 5HI1A 5IAAC 3OJ3A 1VD2A 3NRZA 2KC2A 3DBSA 4KV2A 3ZJVA 5BYQA 1FRDA 1WF9A 1OEYJ 3W9CB 1U4AA 3ZW3A 1WGGA 4RMAA 4KZCA 1N5WA 3VVWB 3U8ZA 1PDXA 1V6EA 5TSSA 1SE4A 3QHTA 1VZ8A 4IKGA 3P4QB 4XYCA 4QAYA 4LNKA 2W54A 2NMQA 4EZJA 4RNAA 4X57B 3RT3B 2UU7A 2KFJA 2RGFA 3HK0A 2XNAC 2LRWA 2N1VA 4K7UA 1E8YA 2LVOA 3RNBC 4WJNA 3PTFC 2J0JA 4RCOA 1KRHA 5CHFA 1C77A 2K6QA 1XLOA 3DBLB 4MM3B 3I57A 1D3ZA 4KSKC 1I4XA 2H88B 3V62A 4PS7A 1FD6A 2L05A 2LJIA 4L1BA 4WWPA 3TEWA 2MBHA 2KLGA 2EMTA 1E90A 1TKYA 1WH3A 2H89B 3BIID 3PPAA 2Y5BB 3GZNB 2KANA 4NJCA 2KYWA 1LQBA 4JWSC 4GOCA 3IXSA 4OW0A 2KKCA 1OFFA 2KN4A 1ZKHA 2JU6X 3A9JA 2E6XA 1KLGD 3BINA 5FKAC 4W9HA 2WDTB 3UI3A 1NEKB 3BZDB 4MACA 2J0MA 2BT6A 1WWTA 3I3TB 3AULA 4LJPB 2G1EA 2L0TA 1D6EC 1NVID 5EE0A 1T0RC 3SD5A 4US9A 3BK2A 1OGWA 1WM2A 2N1WA 3Q3OC 2BS2B 3RNGC 3DVGX 5E6OA 2W3RA 4OZAA 3AI5A 5IKCM 2C7MB 4OVVA 3RN9C 3TIXA 1V80A 2GBRA 5LXHA 3SEBA 4W9IA 1XLPA 2M4NA 4A8XC 5BO4B 3ALBA 2DHZA 3U7ZA 1QILA 4BBNF 5J2RA 1DGJA 4HROA 3P2BA 1Q0WB 3PRPB 3A9JB 1YN5A 2CKHB 1RFKA 1WR1A 1L0VB 2L52A 2QSDA 4ZYSA 4MDKE 3VUXA 3M95A 5CHVC 2K22A 3L16A 1E8ZA 4KX6B 3AE5B 3NJTA 2XBBC 2D10A 4XGAB 1H4RA 4XX5A 1QF6A 1GJZA 3N1XC 2ZVNA 3P1MA 4NAWA 4HPPA 1EM7A 3ZLZA 4XC2A 3ZRFA 1C4CA 1ZUD2 2ZZPB 2DZMA 3AE1B 2C7HA 1UNSA 3ZTDA 2DENB 2AYOB 3DDCB 3X23A 4FA6A 1MJDA 3NG0A 1WXSA 2N7EA 3K9PB 2W55A 5JZEB 1KLVA 5DPRA 2KQSA 2KC1A 3QCAA 3NVVA 5L83A 2M1MA 2LZ6A 4FN2A 3W1SC 3PSEB 3WAOA 2V9HA 3URYA 1MHHE 4BFRA 2PEAA 3AH7A 2W82A 1UH6A 1KFYB 2FCMA 2ASQA 3BYYB 2MLBA 1D5ZC 4MGIE 3R7QA 4NAWB 3ECIA 2JZ3B 3AE9B 3Q2AC 3I5JC 3PS6A 2PLPA 4GB9A 3BWUD 3ZDMC 1VJKA 3IVFA
chains in the Genus database with same CATH topology
3PRMB 4ANUA 3IFWB 4EEWA 2LI5A 1WR6E 3R3MA 4ZRIA 3OLMD 2RSUA 2KTRA 4K7SA 5D2MB 2JRIB 2KO3A 3B0AA 3KH0A 3CMMB 2RR9A 2ZNVC 4FJYA 4KVGB 4B95A 2ZCBA 3KW5B 1SE9A 2K8HA 3D32A 2KWVB 3EECA 3H7PA 2REXA 4KSLC 2GBMA 3A4RA 3OAWA 3H1UA 3H9DA 1WMHB 3PVLA 3QAQA 2LGYA 3A1QA 3DBRI 1P9DU 1V2YA 4NJ6A 1RAXA 3QARA 4HJKA 1YX6B 2FCQA 2DYMA 2JPHA 4WJOA 5E6PA 4MEMA 4B6WA 1V5OA 5LLIA 2AL3A 4DDGD 2L00B 1T0YA 2BWES 3DVNU 2CU1A 2K8CA 4M8MA 1H8CA 3W1YA 1ZW7A 2JVCA 3JYUA 2L7RA 4ICUA 2LWPA 3M3JA 1UGMA 2CS4A 1J19A 4MM3A 2LD9A 4G11A 3VTWA 3MTNB 4IM0A 3ZNGC 4W9DA 5TR5A 2FAZA 4CO7A 1JRUA 2FCNA 2K25A 4URKA 3APDA 3PZDA 5DCNA 4FBJB 2K39A 3QX1A 2IYDB 3EC8A 4GGQA 3TCAA 3NOBA 4AJWA 4EOYA 2G45B 3ZNID 3TBLD 2BPSA 3UIPB 1P0RA 4LCDE 2OOBB 1V9JA 2A4ZA 2BYEA 2KWCA 1RFAA 2NBWB 3V6EB 2WWZA 3QWZB 1RRBA 4IWOA 2KTFA 1YD8U 4DHZB 2G3QB 2KTRB 3QK0A 1WFYA 2IBIB 3U30A 2ZPNA 1BT0A 2KJHB 1E8XA 1WXAA 4HK2A 4ANXA 3WANA 3V6CB 3Q3FA 4P7IA 2FIDA 3H7PB 2AL6A 1R4NI 2KX0A 2JXXA 3JSVA 2K6DB 3A1QB 4EFOA 1V86A 2PPHA 4IM3A 2BWFA 2JT4B 1CMXB 2DYOA 3N30A 3VTVA 2EKEC 4EKUA 2O6VA 2GBJA 4II3B 3AU4A 3DVGY 5KHQA 1A5RA 2GOWA 2L0FA 2LRUA 2MX2A 4DWFA 1J8CA 4NQLB 1EF5A 2GMIC 4BVUC 1WJ6A 1L7YA 4HCNB 3RYTA 5J18A 4PS3A 4DHJB 3ML9A 4WWNA 3X0WA 4WJQA 3QC8B 4HLEA 5J17A 2UYZB 1OQYA 4M8NA 1NBFC 4FJVB 2IO0B 3JW0X 4MH0E 2KK8A 4ZRJA 4JGHB 1XQQA 1TZ1A 1Q5WB 1TTNA 2D07B 2V1YA 1K8RB 4IUMB 2BF8B 4GDKA 4NPNA 4GDLB 5AZFA 3RZWC 2WYQA 2ZEQA 2CHZA 1XT9B 4AP4C 5FR6A 4KIKA 1KOTA 4BKSD 1YIWA 2O2VA 2PE6B 4W9LA 4BOSC 1V49A 2KDFB 1LXDA 3DCGA 4IM2A 2MBQA 3IG3A 3T8MA 3A33B 4AJYB 2C60A 3AU5A 4IWPA 3B1LX 3Q3JA 4MSQB 1GG3A 1EO6A 1QZEA 1P1AA 3IBEA 4LDTB 2EMSA 3N32A 4B9KA 2DAFA 1V81A 2MBBB 3NY5A 5AEKB 2G4DB 1Z5SB 2M17A 4W9EA 4EZLA 3VFKA 1OTRB 3HM3A 2DZKA 2JY6A 3ML8A 4FHJA 1VCBA 2KMCA 4HWIB 3ZTCA 2KD0A 2BGFA 4I6PA 3JSVB 2N9XA 4YL8A 1E8WA 2LASA 4RM9A 1R4MI 2NPTA 1WZ3A 2O6VB 2YLMA 3CF6E 3S2AA 2NBUA 3UGBB 4GIVA 2D11A 4HXDA 1E7UA 4PYUA 1C3TA 2GBKA 2KJ6A 3CSTA 4A3PA 4BKGA 3MJWA 3QJZA 2K8BA 4MGZE 3PV1A 2KQ7A 4IW0A 2DAJA 2IO1B 1GUAB 2KOXA 1UBQA 1WGDA 1WM3A 3NZSA 5IA7A 3AXCA 1HE8A 2FNJB 1WX7A 1WXMA 2IZVB 5D6JB 2LGXA 3ZO5B 2MBEA 4GDKB 4GMVA 2CHXA 2MWSB 4EUTA 2WX1A 4PS8A 5L95C 3C0RB 2IY1B 1WGHA 4NY0A 4WAAA 2AWTA 2I1JA 4G50A 1AARA 3JVZX 3DVNV 5DPSA 4JLCA 2O2VB 5CHWA 1S1QB 1M94A 2BYFA 2MP2B 5IAAC 2DZIA 3RZFA 2JWZA 3OJ3A 1VD2A 4KZ0A 2KC2A 3DBSA 4KV2A 2KHWB 3KUDB 2FIFA 4ZDVA 2ZCCA 3ZNHB 1YJ1A 1WF9A 5G55A 1WGRA 1OEYJ 2C5LC 5E6NA 2KXJA 3WIMA 1U4AA 3ZW3A 4DXAB 1WGGA 4RMAA 4KZCA 2D2QA 3ZRCA 3MHSD 4M0WB 3VHTC 3VVWB 3ZUNA 4LDTD 3TJPA 3L10B 1V6EA 3U8ZA 2N9EB 2UWQA 2MBOA 1LM8B 4TQ1A 2NBVB 1J0GA 3QHTA 2NPTB 2MSED 2ZJDA 5LXIB 1EF1A 1GC7A 3L17A 4EZJA 4HPLB 1YX5B 2L3ZA 4MJSA 4X57B 1F9JA 1WJ4A 2LXAA 4K1RB 4FADA 3A9KA 3RT3B 2KFJA 1MG8A 2RGFA 4BBNC 3RD2A 3HK0A 3ZIMA 2LRWA 3N3KB 3O65B 3VXWA 3ENEA 3HIZA 2I1KA 2N1VA 2LUEA 2M0XA 3PLVA 1E8YA 2LVOA 4K7UA 3UIOB 3WAPA 4MSMB 4WJNA 4AUQC 2C7NB 2NVUI 4NJ7A 3PTFC 4GN1A 2J0JA 1IP9A 3PT2B 4DK5A 2N4FA 5CHFA 5CX3A 4FULA 2K6QA 2Z59B 3M62B 1IYFA 2LJ5A 1Y8RC 1WRDB 1D3ZA 1IPGA 4KSKC 3SHQA 4TUUA 2C9WB 3B08A 4TV3A 1UZXB 3RULA 1WJNA 4PS7A 3V62A 4ANVA 4E71A 2NS5A 2L05A 4K81A 2V3SA 2KLCA 4HDOA 4WWPA 3GOEA 2MBHA 2N7DA 2KLGA 4HDQA 3RUIB 3DBLI 2KDBA 4FLHA 1GNUA 4IG7B 2CHWA 4WWOA 3UF8A 2W9NA 1TGZB 3QIJA 2BKRB 1P98A 2EMTA 1E90A 3VTUA 2MCNB 3DOWA 3NZUA 1WH3A 3PPAA 2Y5BB 3NHEB 3ZDMC 3PLUA 2FCSA 1NDDA 2KANA 3DPDA 4RM8A 2KJRA 3R7RA 4WQOB 1LQBA 3TMPB 4GOCA 5C1ZA 3HM6X 2KKCA 4ZRKA 4K7WA 1WYWB 3PHWB 4I6LB 2M8SA 4MJSB 5JHBA 1ZKHA 3A9JA 5JH5C 3HHMA 2PJHA 3VUYA 1Z2MA 3GZNI 2DX5B 4JL9A 3BINA 4GU2A 4DHZE 1P3QU 4G3XB 4NQKE 3KUZA 1WY8A 4W9HA 1I42A 4MGYE 4W9CA 1YQBA 2WDTB 3VDZA 4BKSA 4MGKE 2KDIA 4HCPB 3H6NA 1PQSA 4CHKA 2J0KA 1SGHA 2J0MA 4PYZA 4EZKA 3I3TB 3AULA 2IO3B 4A20A 4LJPB 2KNBA 3KUCB 2HD5B 2L0TA 1E7VA 1ZGUB 4KDIC 3VAWA 4AOFA 3SD5A 2ZPYA 2G4SA 3U7DA 1OGWA 1WM2A 3K9OB 4G0NB 2N1WA 1TBEA 1OEYA 2OJRA 2BKFA 4TKNA 3RCZA 4DHJD 3DVGX 5E6OA 2QHOA 2RD0A 3AI5A 2JZZA 2C7MB 2L76A 2KMAA 4OVVA 3TIXA 1V80A 2GBRA 4KIKB 3VH3B 3EFUA 5LXHA 4W9IA 2B3AA 3L13A 2L8JA 1LFDA 4W9FA 3T9LA 2M4NA 4HPMB 3BY4B 4FJZA 3DQVA 4N9F4 5BO4B 2DZJA 2LGDA 3CSFA 3ALBA 2DHZA 2MQJA 4JQWC 4BBNF 4F1SA 4ASWC 2JUOA 5J2RA 3P2BA 4E3CA 3KVFB 4AWJA 3EHVA 1Q0WB 1WX9A 2MRPA 3A9JB 1E5WA 3PRPB 2IO2B 3R66C 1XD3B 2CKHB 1WR1A 3VQIA 4CYEA 2KWUB 4XZ4A 1V5TA 5EDSA 3SDLC 4E74A 5D94A 5AZHA 2HE7A 4MDKE 3VUXA 2KN5A 3QA8A 3SU8X 3UQBA 3M95A 1WXVA 2A5UA 5DPTA 2BYVE 5CHVC 2GBNA 3PHXB 3APCA 3L16A 2KFKA 4GDLA 1E8ZA 2R2OA 4II2B 5HKHA 3L08A 4TQ0A 3ONSA 1KJTA 4JIOU 2XBBC 2D10A 1I35A 1H4RA 4DBGA 2O6VD 4F7ZA 2NCNA 4XX5A 1WZ0A 1GJZA 2VRRB 3LDZE 3A4SC 2WX0A 2XK5A 2ZVNA 2IY0B 3V61A 3PGEA 3WALA 5GMVA 1EUVB 4NAWA 5AZGA 3KYDD 1WIAA 3ZLZA 4LJOB 4XC2A 2K1FA 3ZRFA 4ANWA 1FXTB 3VH4B 2ZZPB 5C23A 3H7SA 1RLFA 2Z0EB 1NI2A 2DZMA 1GC6A 2FUHB 5D7GA 3UQAA 2ZNVB 2C7HA 1UD7A 4GSWA 4IWQA 2Z0DB 4KDLB 3ZTDA 2NR2A 2CR5A 2MA9B 2R2QA 2DENB 4A3OA 2AYOB 3L54A 3DDCB 3X23A 4OVUA 2KDEB 3ZNZB 3ZKJC 4FA6A 1UELA 3WA0A 1WXSA 1WX8A 2N7EA 3K9PB 5JZEB 1KLVA 2V4LA 2HJ8A 3WAMA 5DPRA 1UBIA 2KQSA 1SIFA 2KC1A 2MW5A 3DBHI 3KYCD 2LVPA 3QCAA 2N9PC 2JRHA 1WMHA 3L0WB 5L83A 2M1MA 2LZ6A 2YVCA 4FN2A 3V60A 3W1SC 3PSEB 1WI0A 3WAOA 3ZDTA 1X1MA 2LXCA 4DDID 2LVQA 2RPQA 1Q1OA 4BFRA 4IC7B 4BOZB 3PREA 1WE7A 2DYBA 2PEAA 3OJ4B 4NNJB 3W1SA 3M63B 4ICVA 5G2NA 3UINB 4W9GA 2KFKB 5JHAA 3NS8A 3LJ3A 1UH6A 5DPWA 1S3SG 2FCMA 5KHOA 1WJUA 2ASQA 2JF5A 3PRZA 3A9KB 4BKTA 2KVRA 1G6JA 2MLBA 2J7QB 2KZRA 2MP2A 2KX3A 1L2NA 2XK5B 4MGIE 1WGYA 2AEHA 4I6NB 1ISNA 2ZVOA 4HVBA 4J6IA 3APFA 4NAWB 3R7QA 3ECIA 4GXBA 1KM7A 2D3GA 4WJPA 2JZ3B 1WE6A 3TL5A 4F8CB 4FHKA 2HTHA 3QQ8B 2XEWA 3PS6A 4MELA 4W9KA 4GB9A 5CTRC 4W9JA 3IHPC 1C1YB 4ZYNA 3ZVVA 3VUWA 2PE9A 3IVFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PRM B;  4ANU A;  3IFW B;  4EEW A;  2LI5 A;  1WR6 E;  3R3M A;  4ZRI A;  3OLM D;  2RSU A;  2KTR A;  4K7S A;  5D2M B;  2JRI B;  2KO3 A;  3B0A A;  3KH0 A;  3CMM B;  2RR9 A;  2ZNV C;  4FJY A;  4KVG B;  4B95 A;  2ZCB A;  3KW5 B;  1SE9 A;  2K8H A;  3D32 A;  2KWV B;  3EEC A;  3H7P A;  2REX A;  4KSL C;  2GBM A;  3A4R A;  3OAW A;  3H1U A;  3H9D A;  1WMH B;  3PVL A;  3QAQ A;  2LGY A;  3A1Q A;  3DBR I;  1P9D U;  1V2Y A;  4NJ6 A;  1RAX A;  3QAR A;  4HJK A;  1YX6 B;  2FCQ A;  2DYM A;  2JPH A;  4WJO A;  5E6P A;  4MEM A;  4B6W A;  1V5O A;  5LLI A;  2AL3 A;  4DDG D;  2L00 B;  1T0Y A;  2BWE S;  3DVN U;  2CU1 A;  2K8C A;  4M8M A;  1H8C A;  3W1Y A;  1ZW7 A;  2JVC A;  3JYU A;  2L7R A;  4ICU A;  2LWP A;  3M3J A;  1UGM A;  2CS4 A;  1J19 A;  4MM3 A;  2LD9 A;  4G11 A;  3VTW A;  3MTN B;  4IM0 A;  3ZNG C;  4W9D A;  5TR5 A;  2FAZ A;  4CO7 A;  1JRU A;  2FCN A;  2K25 A;  4URK A;  3APD A;  3PZD A;  5DCN A;  4FBJ B;  2K39 A;  3QX1 A;  2IYD B;  3EC8 A;  4GGQ A;  3TCA A;  3NOB A;  4AJW A;  4EOY A;  2G45 B;  3ZNI D;  3TBL D;  2BPS A;  3UIP B;  1P0R A;  4LCD E;  2OOB B;  1V9J A;  2A4Z A;  2BYE A;  2KWC A;  1RFA A;  2NBW B;  3V6E B;  2WWZ A;  3QWZ B;  1RRB A;  4IWO A;  2KTF A;  1YD8 U;  4DHZ B;  2G3Q B;  2KTR B;  3QK0 A;  1WFY A;  2IBI B;  3U30 A;  2ZPN A;  1BT0 A;  2KJH B;  1E8X A;  1WXA A;  4HK2 A;  4ANX A;  3WAN A;  3V6C B;  3Q3F A;  4P7I A;  2FID A;  3H7P B;  2AL6 A;  1R4N I;  2KX0 A;  2JXX A;  3JSV A;  2K6D B;  3A1Q B;  4EFO A;  1V86 A;  2PPH A;  4IM3 A;  2BWF A;  2JT4 B;  1CMX B;  2DYO A;  3N30 A;  3VTV A;  2EKE C;  4EKU A;  2O6V A;  2GBJ A;  4II3 B;  3AU4 A;  3DVG Y;  5KHQ A;  1A5R A;  2GOW A;  2L0F A;  2LRU A;  2MX2 A;  4DWF A;  1J8C A;  4NQL B;  1EF5 A;  2GMI C;  4BVU C;  1WJ6 A;  1L7Y A;  4HCN B;  3RYT A;  5J18 A;  4PS3 A;  4DHJ B;  3ML9 A;  4WWN A;  3X0W A;  4WJQ A;  3QC8 B;  4HLE A;  5J17 A;  2UYZ B;  1OQY A;  4M8N A;  1NBF C;  4FJV B;  2IO0 B;  3JW0 X;  4MH0 E;  2KK8 A;  4ZRJ A;  4JGH B;  1XQQ A;  1TZ1 A;  1Q5W B;  1TTN A;  2D07 B;  2V1Y A;  1K8R B;  4IUM B;  2BF8 B;  4GDK A;  4NPN A;  4GDL B;  5AZF A;  3RZW C;  2WYQ A;  2ZEQ A;  2CHZ A;  1XT9 B;  4AP4 C;  5FR6 A;  4KIK A;  1KOT A;  4BKS D;  1YIW A;  2O2V A;  2PE6 B;  4W9L A;  4BOS C;  1V49 A;  2KDF B;  1LXD A;  3DCG A;  4IM2 A;  2MBQ A;  3IG3 A;  3T8M A;  3A33 B;  4AJY B;  2C60 A;  3AU5 A;  4IWP A;  3B1L X;  3Q3J A;  4MSQ B;  1GG3 A;  1EO6 A;  1QZE A;  1P1A A;  3IBE A;  4LDT B;  2EMS A;  3N32 A;  4B9K A;  2DAF A;  1V81 A;  2MBB B;  3NY5 A;  5AEK B;  2G4D B;  1Z5S B;  2M17 A;  4W9E A;  4EZL A;  3VFK A;  1OTR B;  3HM3 A;  2DZK A;  2JY6 A;  3ML8 A;  4FHJ A;  1VCB A;  2KMC A;  4HWI B;  3ZTC A;  2KD0 A;  2BGF A;  4I6P A;  3JSV B;  2N9X A;  4YL8 A;  1E8W A;  2LAS A;  4RM9 A;  1R4M I;  2NPT A;  1WZ3 A;  2O6V B;  2YLM A;  3CF6 E;  3S2A A;  2NBU A;  3UGB B;  4GIV A;  2D11 A;  4HXD A;  1E7U A;  4PYU A;  1C3T A;  2GBK A;  2KJ6 A;  3CST A;  4A3P A;  4BKG A;  3MJW A;  3QJZ A;  2K8B A;  4MGZ E;  3PV1 A;  2KQ7 A;  4IW0 A;  2DAJ A;  2IO1 B;  1GUA B;  2KOX A;  1UBQ A;  1WGD A;  1WM3 A;  3NZS A;  5IA7 A;  3AXC A;  1HE8 A;  2FNJ B;  1WX7 A;  1WXM A;  2IZV B;  5D6J B;  2LGX A;  3ZO5 B;  2MBE A;  4GDK B;  4GMV A;  2CHX A;  2MWS B;  4EUT A;  2WX1 A;  4PS8 A;  5L95 C;  3C0R B;  2IY1 B;  1WGH A;  4NY0 A;  4WAA A;  2AWT A;  2I1J A;  4G50 A;  1AAR A;  3JVZ X;  3DVN V;  5DPS A;  4JLC A;  2O2V B;  5CHW A;  1S1Q B;  1M94 A;  2BYF A;  2MP2 B;  5IAA C;  2DZI A;  3RZF A;  2JWZ A;  3OJ3 A;  1VD2 A;  4KZ0 A;  2KC2 A;  3DBS A;  4KV2 A;  2KHW B;  3KUD B;  2FIF A;  4ZDV A;  2ZCC A;  3ZNH B;  1YJ1 A;  1WF9 A;  5G55 A;  1WGR A;  1OEY J;  2C5L C;  5E6N A;  2KXJ A;  3WIM A;  1U4A A;  3ZW3 A;  4DXA B;  1WGG A;  4RMA A;  4KZC A;  2D2Q A;  3ZRC A;  3MHS D;  4M0W B;  3VHT C;  3VVW B;  3ZUN A;  4LDT D;  3TJP A;  3L10 B;  1V6E A;  3U8Z A;  2N9E B;  2UWQ A;  2MBO A;  1LM8 B;  4TQ1 A;  2NBV B;  1J0G A;  3QHT A;  2NPT B;  2MSE D;  2ZJD A;  5LXI B;  1EF1 A;  1GC7 A;  3L17 A;  4EZJ A;  4HPL B;  1YX5 B;  2L3Z A;  4MJS A;  4X57 B;  1F9J A;  1WJ4 A;  2LXA A;  4K1R B;  4FAD A;  3A9K A;  3RT3 B;  2KFJ A;  1MG8 A;  2RGF A;  4BBN C;  3RD2 A;  3HK0 A;  3ZIM A;  2LRW A;  3N3K B;  3O65 B;  3VXW A;  3ENE A;  3HIZ A;  2I1K A;  2N1V A;  2LUE A;  2M0X A;  3PLV A;  1E8Y A;  2LVO A;  4K7U A;  3UIO B;  3WAP A;  4MSM B;  4WJN A;  4AUQ C;  2C7N B;  2NVU I;  4NJ7 A;  3PTF C;  4GN1 A;  2J0J A;  1IP9 A;  3PT2 B;  4DK5 A;  2N4F A;  5CHF A;  5CX3 A;  4FUL A;  2K6Q A;  2Z59 B;  3M62 B;  1IYF A;  2LJ5 A;  1Y8R C;  1WRD B;  1D3Z A;  1IPG A;  4KSK C;  3SHQ A;  4TUU A;  2C9W B;  3B08 A;  4TV3 A;  1UZX B;  3RUL A;  1WJN A;  4PS7 A;  3V62 A;  4ANV A;  4E71 A;  2NS5 A;  2L05 A;  4K81 A;  2V3S A;  2KLC A;  4HDO A;  4WWP A;  3GOE A;  2MBH A;  2N7D A;  2KLG A;  4HDQ A;  3RUI B;  3DBL I;  2KDB A;  4FLH A;  1GNU A;  4IG7 B;  2CHW A;  4WWO A;  3UF8 A;  2W9N A;  1TGZ B;  3QIJ A;  2BKR B;  1P98 A;  2EMT A;  1E90 A;  3VTU A;  2MCN B;  3DOW A;  3NZU A;  1WH3 A;  3PPA A;  2Y5B B;  3NHE B;  3ZDM C;  3PLU A;  2FCS A;  1NDD A;  2KAN A;  3DPD A;  4RM8 A;  2KJR A;  3R7R A;  4WQO B;  1LQB A;  3TMP B;  4GOC A;  5C1Z A;  3HM6 X;  2KKC A;  4ZRK A;  4K7W A;  1WYW B;  3PHW B;  4I6L B;  2M8S A;  4MJS B;  5JHB A;  1ZKH A;  3A9J A;  5JH5 C;  3HHM A;  2PJH A;  3VUY A;  1Z2M A;  3GZN I;  2DX5 B;  4JL9 A;  3BIN A;  4GU2 A;  4DHZ E;  1P3Q U;  4G3X B;  4NQK E;  3KUZ A;  1WY8 A;  4W9H A;  1I42 A;  4MGY E;  4W9C A;  1YQB A;  2WDT B;  3VDZ A;  4BKS A;  4MGK E;  2KDI A;  4HCP B;  3H6N A;  1PQS A;  4CHK A;  2J0K A;  1SGH A;  2J0M A;  4PYZ A;  4EZK A;  3I3T B;  3AUL A;  2IO3 B;  4A20 A;  4LJP B;  2KNB A;  3KUC B;  2HD5 B;  2L0T A;  1E7V A;  1ZGU B;  4KDI C;  3VAW A;  4AOF A;  3SD5 A;  2ZPY A;  2G4S A;  3U7D A;  1OGW A;  1WM2 A;  3K9O B;  4G0N B;  2N1W A;  1TBE A;  1OEY A;  2OJR A;  2BKF A;  4TKN A;  3RCZ A;  4DHJ D;  3DVG X;  5E6O A;  2QHO A;  2RD0 A;  3AI5 A;  2JZZ A;  2C7M B;  2L76 A;  2KMA A;  4OVV A;  3TIX A;  1V80 A;  2GBR A;  4KIK B;  3VH3 B;  3EFU A;  5LXH A;  4W9I A;  2B3A A;  3L13 A;  2L8J A;  1LFD A;  4W9F A;  3T9L A;  2M4N A;  4HPM B;  3BY4 B;  4FJZ A;  3DQV A;  4N9F 4;  5BO4 B;  2DZJ A;  2LGD A;  3CSF A;  3ALB A;  2DHZ A;  2MQJ A;  4JQW C;  4BBN F;  4F1S A;  4ASW C;  2JUO A;  5J2R A;  3P2B A;  4E3C A;  3KVF B;  4AWJ A;  3EHV A;  1Q0W B;  1WX9 A;  2MRP A;  3A9J B;  1E5W A;  3PRP B;  2IO2 B;  3R66 C;  1XD3 B;  2CKH B;  1WR1 A;  3VQI A;  4CYE A;  2KWU B;  4XZ4 A;  1V5T A;  5EDS A;  3SDL C;  4E74 A;  5D94 A;  5AZH A;  2HE7 A;  4MDK E;  3VUX A;  2KN5 A;  3QA8 A;  3SU8 X;  3UQB A;  3M95 A;  1WXV A;  2A5U A;  5DPT A;  2BYV E;  5CHV C;  2GBN A;  3PHX B;  3APC A;  3L16 A;  2KFK A;  4GDL A;  1E8Z A;  2R2O A;  4II2 B;  5HKH A;  3L08 A;  4TQ0 A;  3ONS A;  1KJT A;  4JIO U;  2XBB C;  2D10 A;  1I35 A;  1H4R A;  4DBG A;  2O6V D;  4F7Z A;  2NCN A;  4XX5 A;  1WZ0 A;  1GJZ A;  2VRR B;  3LDZ E;  3A4S C;  2WX0 A;  2XK5 A;  2ZVN A;  2IY0 B;  3V61 A;  3PGE A;  3WAL A;  5GMV A;  1EUV B;  4NAW A;  5AZG A;  3KYD D;  1WIA A;  3ZLZ A;  4LJO B;  4XC2 A;  2K1F A;  3ZRF A;  4ANW A;  1FXT B;  3VH4 B;  2ZZP B;  5C23 A;  3H7S A;  1RLF A;  2Z0E B;  1NI2 A;  2DZM A;  1GC6 A;  2FUH B;  5D7G A;  3UQA A;  2ZNV B;  2C7H A;  1UD7 A;  4GSW A;  4IWQ A;  2Z0D B;  4KDL B;  3ZTD A;  2NR2 A;  2CR5 A;  2MA9 B;  2R2Q A;  2DEN B;  4A3O A;  2AYO B;  3L54 A;  3DDC B;  3X23 A;  4OVU A;  2KDE B;  3ZNZ B;  3ZKJ C;  4FA6 A;  1UEL A;  3WA0 A;  1WXS A;  1WX8 A;  2N7E A;  3K9P B;  5JZE B;  1KLV A;  2V4L A;  2HJ8 A;  3WAM A;  5DPR A;  1UBI A;  2KQS A;  1SIF A;  2KC1 A;  2MW5 A;  3DBH I;  3KYC D;  2LVP A;  3QCA A;  2N9P C;  2JRH A;  1WMH A;  3L0W B;  5L83 A;  2M1M A;  2LZ6 A;  2YVC A;  4FN2 A;  3V60 A;  3W1S C;  3PSE B;  1WI0 A;  3WAO A;  3ZDT A;  1X1M A;  2LXC A;  4DDI D;  2LVQ A;  2RPQ A;  1Q1O A;  4BFR A;  4IC7 B;  4BOZ B;  3PRE A;  1WE7 A;  2DYB A;  2PEA A;  3OJ4 B;  4NNJ B;  3W1S A;  3M63 B;  4ICV A;  5G2N A;  3UIN B;  4W9G A;  2KFK B;  5JHA A;  3NS8 A;  3LJ3 A;  1UH6 A;  5DPW A;  1S3S G;  2FCM A;  5KHO A;  1WJU A;  2ASQ A;  2JF5 A;  3PRZ A;  3A9K B;  4BKT A;  2KVR A;  1G6J A;  2MLB A;  2J7Q B;  2KZR A;  2MP2 A;  2KX3 A;  1L2N A;  2XK5 B;  4MGI E;  1WGY A;  2AEH A;  4I6N B;  1ISN A;  2ZVO A;  4HVB A;  4J6I A;  3APF A;  4NAW B;  3R7Q A;  3ECI A;  4GXB A;  1KM7 A;  2D3G A;  4WJP A;  2JZ3 B;  1WE6 A;  3TL5 A;  4F8C B;  4FHK A;  2HTH A;  3QQ8 B;  2XEW A;  3PS6 A;  4MEL A;  4W9K A;  4GB9 A;  5CTR C;  4W9J A;  3IHP C;  1C1Y B;  4ZYN A;  3ZVV A;  3VUW A;  2PE9 A;  3IVF A; 
#chains in the Genus database with same CATH topology
 4ANU A;  3KWV A;  2VH1 A;  1JWU D;  2KAC A;  2KTR A;  1BUI C;  2N0S B;  2JRI B;  2LEK A;  3CMM B;  4KGS A;  4RH6 A;  3KW5 B;  1SE9 A;  3D32 A;  4KSL C;  3A4R A;  2V3P A;  4YTN B;  3H9D A;  1P9D U;  1V2Y A;  4NJ6 A;  1RAX A;  4M02 A;  2JPH A;  4MEM A;  4DDG D;  1DOX A;  1STE A;  1DYQ A;  2CU1 A;  2K8C A;  3W5V B;  1ZDX A;  1CK1 A;  2L7R A;  2WXI A;  4OHJ A;  2B76 B;  1RM6 C;  1K50 A;  2N7J A;  2WXR A;  1NYR A;  4M01 A;  3NVW A;  5DCN A;  4FBJ B;  1SIJ A;  3B2G A;  2IYD B;  3TCA A;  2JWU A;  2G45 B;  3UIP B;  4LCD E;  4KKI A;  1RYJ A;  3V6E B;  1RFA A;  2WWZ A;  4YSZ B;  1YD8 U;  4DHZ B;  2KTR B;  1SF0 A;  5HFY A;  1BT0 A;  2MJD A;  2RDH A;  2WXM A;  3Q3M C;  4ZHO A;  1A70 A;  5D3D A;  3Q3F A;  1XLQ A;  2AL6 A;  5D3I B;  2SAK A;  5BMG A;  4PK1 A;  1LO5 D;  2BWF A;  4JWU C;  2EKE C;  3AMZ A;  4EKU A;  1TKE A;  2BBC A;  3RYT A;  5J18 A;  4WWN A;  4ARC A;  2KK8 A;  1TTN A;  1HQR D;  3AEB B;  4GDL B;  5AZF A;  2CHZ A;  1SJH D;  3AEF B;  4N59 A;  1YMH E;  3RNC C;  4BKS D;  2O2V A;  1F2R C;  1V49 A;  4IM2 A;  3EUB 2;  2Y5C A;  2C60 A;  1HA5 A;  4MSQ B;  1ZDV A;  1BXT A;  3C8Y A;  2WLB A;  2MJE A;  5AEK B;  2G4D B;  1TYG B;  4W9E A;  4EZL A;  3VFK A;  3HM3 A;  3ZTC A;  2DZK A;  2D3B A;  2JY6 A;  4HWI B;  4M0W A;  1P7E A;  1VZ6 A;  2KD0 A;  2N9X A;  1E8W A;  2LAS A;  3E9S A;  1R4M I;  3VRB B;  4ZRP A;  3S2A A;  3UGB B;  4GIV A;  5HHD G;  2GBK A;  2KJ6 A;  1N5X A;  2K5P A;  3AE6 B;  2K8B A;  2KQ7 A;  2DAJ A;  1GUA B;  2KOX A;  1E6E B;  2WDR B;  5H8Y E;  1XCT L;  2CJO A;  5D6J B;  2LGX A;  3NZ3 A;  4GMV A;  2L83 A;  2YEP B;  1DOY A;  2AWT A;  4G50 A;  5DPS A;  4JLC A;  2O2V B;  2MP2 B;  2DZI A;  3NVY A;  3Q14 C;  3SFD B;  4KZ0 A;  2WXN A;  2KHW B;  2FIF A;  2D5G A;  2ZCC A;  3ZNH B;  1YJ1 A;  1PYW D;  1TKG A;  1UWX A;  2PVG C;  3ZRC A;  1I4P A;  3MHS D;  4M0W B;  3VHT C;  3ZUN A;  3TJP A;  4FXC A;  1QOF A;  1LM8 B;  4TQ1 A;  2NBV B;  2D3C A;  1P7F A;  1QT9 A;  3GP7 A;  4CQN A;  4MJS A;  2LXA A;  2WQY B;  4FAD A;  1TS4 A;  3A9K A;  4BBN C;  3RD2 A;  2CJN A;  2LUE A;  3PLV A;  1HTQ A;  2QEJ C;  2C7N B;  4WH4 A;  3FKY A;  5EE3 A;  3VR9 B;  3CWI A;  3SHQ A;  1T5X D;  1ZE3 D;  4TUU A;  1GPX A;  3B08 A;  2L32 A;  4TV3 A;  2NS5 A;  3AE2 B;  1I4H A;  3MC9 A;  2E3T A;  1Y56 A;  4HDO A;  2IGH A;  3GOE A;  3RUI B;  2ON8 A;  3DBL I;  2KDB A;  1GNU A;  4NZL B;  2CHW A;  2W9N A;  1TGZ B;  3QIJ A;  3VTU A;  4A55 A;  2MCN B;  3PLU A;  4LNN A;  2FCS A;  4RM8 A;  2KJR A;  4KGT A;  3TMP B;  4HKZ E;  4I6L B;  4MJS B;  4JPS A;  1QOB A;  2M0A A;  4HRS A;  1Z2M A;  3GZN I;  2DX5 B;  4G3X B;  3KUZ A;  1CZP A;  4W9C A;  1YQB A;  1ROE A;  3VDZ A;  4BKS A;  4MGK E;  4HKQ A;  3DHG C;  2KNB A;  2K3U A;  3VAW A;  3N1Z C;  2VZK D;  1LGR A;  2ZPY A;  2HTM E;  2G4S A;  4EE2 A;  3U7D A;  2BS4 B;  1F1H A;  1E10 A;  2OJR A;  1OEY A;  4TKN A;  4DHJ D;  3N9Y C;  1I4R A;  1QOA A;  1UGJ A;  5MPO A;  2RD0 A;  5IO9 A;  2L76 A;  3VR8 B;  2I2Y A;  4OZB A;  2B3A A;  1IUE A;  1FRR A;  4HPM B;  3BY4 B;  4FJZ A;  1XO3 A;  4S17 A;  2MQJ A;  4F1S A;  1FO4 A;  2RMM A;  4ASW C;  3EHV A;  2MRP A;  1XD3 B;  2WNM A;  3VQI A;  2KN5 A;  2LFI A;  1EU4 A;  3UQB A;  2A5U A;  4LNF A;  4KKJ A;  3Q8A A;  4II2 B;  2KFK A;  5HKH A;  3L08 A;  1YQ3 B;  1HXY D;  3GS2 A;  2O6V D;  4F7Z A;  2NCN A;  4D2K A;  2VRR B;  4NAM A;  3A4S C;  1DOI A;  3WAL A;  3BK1 A;  5GMV A;  2KAJ A;  1PFD A;  2M56 B;  4WQM A;  4ANW A;  1RLF A;  1N63 A;  1GC6 A;  3UQA A;  4B0M A;  4GSW A;  2NR2 A;  2R2Q A;  1UWM A;  4N6E B;  4C56 C;  4OVU A;  1C76 A;  1EWY C;  3WA0 A;  1WX8 A;  2LUM A;  2Q5W D;  3AE3 B;  4RGO S;  2QC8 A;  1UBI A;  2MW5 A;  2N9P C;  3L0W B;  1WMH A;  1K51 A;  2YVC A;  4Q2J A;  2RPQ A;  3BYT B;  1Q1O A;  4YSY B;  4BOZ B;  3PRE A;  3W1S A;  4ICV A;  3BVZ A;  4IOI E;  3UIN B;  2KFK B;  1V1P A;  5DPW A;  1WJU A;  1B9R A;  5EE1 A;  4BKT A;  3P4P B;  2J7Q B;  1WGY A;  1KF6 B;  1CQV A;  4J6I A;  1YJI A;  4WJP A;  4F8C B;  3TL5 A;  4FHK A;  3FIL A;  3QQ8 B;  2WS3 B;  4MEL A;  4W9K A;  1FMA D;  1RWS A;  4W9J A;  3VUW A;  3R2T A;  3IFW B;  2ACZ B;  3AED B;  4EEW A;  1ZOY B;  2LI5 A;  1WR6 E;  4ZRI A;  3OLM D;  1JWB D;  4K7S A;  2KO3 A;  2OHF A;  3B0A A;  5LNK 1;  4B95 A;  2ICI A;  2ZCB A;  1TJE A;  2V3N A;  5GXG B;  3H7P A;  3WCQ A;  1WMH B;  3PVL A;  2LGY A;  2EEL A;  2IND C;  3P4R B;  3QAR A;  4HJK A;  4WJO A;  1WGK A;  1FFV A;  5LLI A;  4ZRQ A;  2L00 B;  1T0Y A;  1JRP A;  4P1B C;  2J4X A;  2HDE A;  1KLU D;  4ICU A;  4BAX A;  2LWP A;  1ZXH A;  2OJW A;  5G5G A;  1J19 A;  1SE2 A;  4G11 A;  2KDM A;  3KWL A;  1KTK A;  5TR5 A;  2FAZ A;  3U52 E;  2FCN A;  1JAL A;  1ZPS A;  2K39 A;  5FK9 C;  5BMI A;  3NOB A;  4EOY A;  2V4I B;  2OOB B;  3U4E G;  1PGA A;  2A4Z A;  2ZW0 A;  1F2R I;  3EFC A;  2KTF A;  1FCL A;  2RPV A;  2G3Q B;  1SJE D;  1TS3 A;  1ZP0 B;  4DXG A;  2KJH B;  1WXA A;  4HK2 A;  4OVZ A;  4P7I A;  2FID A;  3H7P B;  2AQ1 B;  1F52 A;  1R4N I;  2JXX A;  4IM3 A;  3TSS A;  1CMX B;  3Q6B A;  2O6V A;  2GBJ A;  5EE9 A;  3DVG Y;  3E56 A;  1J8C A;  1EF5 A;  2GMI C;  4BVU C;  1L7Y A;  4DHJ B;  4HLE A;  1N61 A;  2UYZ B;  1OQY A;  4M8N A;  1NBF C;  2IO0 B;  4MH0 E;  1TZ1 A;  1TY2 A;  1Q5W B;  2D07 B;  2PTL A;  1K8R B;  4MH8 A;  2BF8 B;  4GDK A;  4YTP B;  2WYQ A;  1XT9 B;  3AE7 B;  3GE3 C;  4KIK A;  1YIW A;  2PE6 B;  4W9L A;  2X8X X;  2KDF B;  1LXD A;  2MBQ A;  3NS1 A;  1FNW A;  4AJY B;  3AU5 A;  4IWP A;  1ENF A;  1QZE A;  3RFZ B;  1L0X B;  3N32 A;  1V81 A;  1FEH A;  1Z5S B;  4YWG G;  1QOG A;  1K52 A;  4B0E A;  1OTR B;  4YL8 A;  4RM9 A;  4LK0 M;  3HUI A;  1WZ3 A;  2WXF A;  3IAM 1;  2V0G A;  1T0S C;  2O6V B;  2YLM A;  2D11 A;  4HXD A;  3HVD A;  1E7U A;  4PYU A;  3CST A;  1IGD A;  1L6V A;  3PV1 A;  3NZS A;  1WM3 A;  1VR9 A;  3AXC A;  1SB3 C;  2FNJ B;  1WX7 A;  2INN E;  4C7Z A;  3T3O A;  1PGX A;  3ZXR A;  3ZO5 B;  2JYT A;  4GDK B;  2CHX A;  4GLS C;  4PS8 A;  5BMH A;  5L95 C;  2IY1 B;  5IP4 D;  2AX5 A;  4WAA A;  2I1J A;  3DVN V;  1M94 A;  2Y5P A;  1JW9 D;  2JWZ A;  4K3B A;  1XEE A;  3KUD B;  1ZXI A;  1JML A;  4ZDV A;  3LB8 C;  5G55 A;  5E6N A;  2KXJ A;  3WIM A;  1TT5 B;  4DXA B;  3MHZ A;  1N60 A;  4LDT D;  3L10 B;  5I4D A;  2N9E B;  2UWQ A;  1R4N B;  1WRI A;  3FAH A;  2MSE D;  2ZJD A;  2IDY A;  1I7H A;  1EF1 A;  3L17 A;  2QMT A;  1E0Z A;  2L3Z A;  1T3Q A;  1UF0 A;  1WJ4 A;  4K1R B;  4C4V A;  3RPF C;  2D3A A;  3ZIM A;  2DWQ A;  3O65 B;  3N3K B;  3VXW A;  3HRD D;  2I1K A;  1CJE A;  4AUQ C;  4GN1 A;  1IP9 A;  3PZ8 A;  3PT2 B;  2JZP A;  5CX3 A;  1EU3 A;  2LJ5 A;  5JXV A;  1Y8R C;  1IPG A;  2C9W B;  1UZX B;  2JSV X;  3RUL A;  4E71 A;  1GOZ A;  1YN3 A;  4R3D A;  1TIF A;  2N7D A;  2Z8L A;  2GI9 A;  4FLH A;  4IG7 B;  4WWO A;  2LGI A;  2PKO A;  4M00 A;  4YXD B;  2BKR B;  1P98 A;  3NZU A;  3EGR A;  4N58 A;  1AN8 A;  2JX5 A;  3DPD A;  4RGN A;  4WQO B;  2WP9 B;  1JCK B;  1I4G A;  4K7W A;  3PHW B;  2M8S A;  5JH5 C;  4C4V B;  1HZ6 A;  2PJH A;  4C00 A;  3TEY A;  3VUY A;  2WXK A;  1MPE A;  4GU2 A;  4NQK E;  1XCQ L;  3DHH C;  4RGT A;  1YNT E;  3EA6 A;  2KDI A;  3C19 A;  1PQS A;  4CHK A;  2J0K A;  4PYZ A;  4A20 A;  2HD5 B;  1ESF A;  1HEZ E;  1YJJ A;  1E7V A;  1ZGU B;  4KDI C;  4ACF A;  3K9O B;  4G0N B;  1TBE A;  3RCZ A;  2QHO A;  3FC4 A;  2KWD A;  4JX1 C;  3KQ4 A;  1C4P A;  1C4A A;  3AN1 A;  3HVZ A;  3EFU A;  4WWM A;  1IBX A;  4W9F A;  1LFD A;  4AS1 A;  4LLG M;  2ZW1 A;  3RNF C;  1Q10 A;  2KVZ A;  3CSF A;  1AYF A;  4JQW C;  2JUO A;  2PW9 A;  4E3C A;  3AE4 B;  3R66 C;  1WX9 A;  2IO2 B;  1KH0 A;  4CYE A;  2KWU B;  4XZ4 A;  1N6Z A;  1JQ4 A;  5AZH A;  2FBW B;  1HZ5 A;  2GBN A;  3IT6 B;  4TQ0 A;  3ONS A;  1KJT A;  4JIO U;  2BS3 B;  5AUK A;  1AWD A;  4DBG A;  1WZ0 A;  4A90 A;  1R7S A;  1D5M C;  2XK5 A;  1SXT A;  3PGE A;  1EUV B;  4USA A;  1GB1 A;  1WIA A;  4YT0 B;  3AB5 A;  3PZ7 A;  2K1F A;  1BML C;  5C23 A;  3H7S A;  1E7P B;  1NEN B;  5D7G A;  2ZNV B;  1IBX B;  3AEA B;  1UD7 A;  3DBH B;  4IWQ A;  2Z0D B;  4KDL B;  2CR5 A;  2MA9 B;  1MHX A;  2K0P A;  4A3O A;  2KDE B;  2PIA A;  3MP9 A;  2J52 A;  1FM0 D;  2V4L A;  3WAM A;  1J7C A;  1SIF A;  3KYC D;  2JRH A;  2R61 A;  1X1M A;  2LXC A;  1FPY A;  4IC7 B;  2WU2 B;  3OJ4 B;  2M19 A;  5JHA A;  4RGM A;  1S3S G;  5KHO A;  2JF5 A;  3PRZ A;  3A9K B;  3RMK C;  1NI3 A;  2KX3 A;  2XK5 B;  2AEH A;  4I6N B;  4HVB A;  2DLB A;  2ZVO A;  3APF A;  4GXB A;  3AEE B;  1WE6 A;  1AW7 A;  2HTH A;  1F0Z A;  3ZGZ A;  2XEW A;  4ZYN A;  3ZVV A;  2X38 A;  3PRM B;  2DNF A;  1MG4 A;  2JYE A;  2RSU A;  4XE0 A;  5D2M B;  3W5U B;  2WHI A;  3DHI C;  2ZNV C;  4KVG B;  4LNI A;  2K8H A;  2KWV B;  3EEC A;  1WXQ A;  2REX A;  3P42 A;  4XDD A;  1T6B X;  3OAW A;  1GB4 A;  2QJL A;  3H1U A;  3QAQ A;  3N20 C;  2IPK D;  3AM9 A;  2DYM A;  5E6P A;  4B6W A;  2AQ2 B;  1V5O A;  3B9J A;  2MH7 A;  2BWE S;  3BVM A;  4M8M A;  1QLB B;  3R8B A;  1ZW7 A;  2JVC A;  2WXP A;  3M3J A;  4MM3 A;  2LD9 A;  3VTW A;  4URK A;  3APD A;  4P6V F;  3LYY A;  4YSX B;  1SSN A;  3EC8 A;  4A9A A;  3RNA C;  4AJW A;  1L4Z B;  3TBL D;  2BPS A;  1P0R A;  4IDI A;  2BYE A;  2KWC A;  1K53 A;  2J42 A;  1WFY A;  1YN4 A;  4H2A A;  2ZPN A;  1I4Q A;  2VH2 A;  1E8X A;  3P4S B;  1FIQ A;  4ARI A;  3VRA B;  5BYS A;  5IN7 A;  3PO0 A;  1V86 A;  2PPH A;  2DYO A;  2JT4 B;  2BW2 A;  3N30 A;  4S0R A;  5KHQ A;  3AU4 A;  1QQR A;  3TEZ A;  2L0F A;  3AEG B;  1XLN A;  2WXH A;  2G9H D;  4PS3 A;  3X0W A;  3KLS X;  3QC8 B;  4WJQ A;  5J17 A;  3JW0 X;  2KMM A;  4ZRJ A;  4JGH B;  1XQQ A;  2V1Y A;  3Q69 A;  2ZEQ A;  2BB6 A;  5C2T B;  1KOT A;  2LHE A;  4BOS C;  1JRO A;  3IG3 A;  2ONQ A;  1VLB A;  1GG3 A;  1V1O A;  5FR3 A;  1UUP A;  3IBE A;  2AQ3 B;  4B9K A;  2EMS A;  2DAF A;  3DWG C;  3NY5 A;  2J53 A;  3MC8 A;  2M17 A;  4YTM B;  1FFU A;  1VCB A;  2KMC A;  1NYQ A;  2NPT A;  2SEB D;  3P63 A;  3AE8 B;  3ZQ4 A;  2NBU A;  4BKG A;  3MJW A;  4IW0 A;  1FCC C;  4P16 A;  2IO1 B;  1C79 A;  1FXI A;  1UBQ A;  1WGD A;  3OWE B;  5IA7 A;  4PT5 A;  1HE8 A;  4MT5 A;  1WXM A;  4K3C A;  1XF5 L;  2QCZ A;  3MC0 B;  1JWS D;  2MWS B;  4EUT A;  2WX1 A;  1V1P B;  1WGH A;  2BTE A;  4WUR A;  3RZF A;  3AV8 A;  3RI7 C;  1OQQ A;  1PGB A;  1WGR A;  2C5L C;  3FIL B;  4RF1 A;  5HG2 A;  4LTU A;  5AUI A;  2D2Q A;  3MFG A;  4XDC A;  2MBO A;  2MJ3 A;  1J0G A;  2NPT B;  4WIP A;  5LXI B;  1VZ7 A;  1GC7 A;  1JWM D;  3GB1 A;  4HPL B;  1YX5 B;  2IGG A;  2WDV B;  2YEP F;  1F9J A;  2FUG 1;  2INP E;  1MG8 A;  4OZC A;  3ENE A;  3HIZ A;  2LMC A;  2M0X A;  2JQR B;  3UIO B;  2VZK B;  3WAP A;  4MSM B;  3GE8 C;  2NVU I;  4NJ7 A;  2NTS A;  4DK5 A;  2N4F A;  2RDG A;  2GRI A;  4FUL A;  2Z59 B;  3M62 B;  1IYF A;  2NTT A;  1WRD B;  1WJN A;  4ANV A;  4K81 A;  3ZXV A;  1FNV A;  2V3S A;  3IAS 1;  3TEX A;  2KLC A;  2WU5 B;  5C3J B;  5G5H A;  4HDQ A;  3UF8 A;  4ZOH C;  3DOW A;  2JXT A;  2KT7 A;  3NHE B;  2IGD A;  2WGS A;  1NDD A;  4JE3 B;  4O1N A;  3R7R A;  2QIL A;  5C1Z A;  3HM6 X;  4ZRK A;  1WYW B;  4J3O D;  5JHB A;  3HHM A;  4JL9 A;  5E6J A;  4DHZ E;  1P3Q U;  1WY8 A;  1I42 A;  1T0Q C;  4MGY E;  4HCP B;  3H6N A;  2DBY A;  1SGH A;  4EZK A;  4XWW A;  2IO3 B;  3KUC B;  4AOF A;  3SR6 A;  1J7A A;  3ETR A;  4ITK A;  2BKF A;  4BZA A;  3CIR B;  3SFE B;  2JZZ A;  3NVZ A;  2KMA A;  1MI0 A;  2N9L A;  1M4V A;  2I38 A;  4KIK B;  3VH3 B;  4P1C C;  2WXQ A;  3L13 A;  2L8J A;  3T9L A;  3DQV A;  4N9F 4;  2DZJ A;  3ZJU A;  1EWC A;  1IGC A;  2LGD A;  1HTO A;  3BVG A;  3KVF B;  2QDF A;  3B2F A;  4C80 A;  4AWJ A;  4KGR A;  1E5W A;  2LHD A;  1V5T A;  5EDS A;  3SDL C;  4E74 A;  5D94 A;  2Y3A A;  2HE7 A;  2W3S A;  3QA8 A;  3SU8 X;  3MJ5 A;  1WXV A;  5DPT A;  2BYV E;  3PHX B;  4GDL A;  3APC A;  2R2O A;  3OG5 A;  1I35 A;  3IT4 B;  2GLS A;  3LDZ E;  2EKI A;  3RNE C;  2WX0 A;  3H8H A;  2IY0 B;  3T3N A;  3V61 A;  5AZG A;  3KYD D;  1F77 A;  4LJO B;  1YOV B;  1L0Y B;  1FXT B;  3VH4 B;  2Z0E B;  1NI2 A;  1ET6 A;  2FUH B;  5IOI A;  4C7Y A;  1ACC A;  2OED A;  3L54 A;  3ZNZ B;  3ZKJ C;  1UEL A;  5T8I A;  1QKZ A;  3NUH B;  1ET9 A;  2HJ8 A;  3DBH I;  2LVP A;  4HEA 1;  3V60 A;  1WI0 A;  3ZDT A;  1VDV A;  4DDI D;  2LVQ A;  1D4B A;  1WE7 A;  2DYB A;  4NNJ B;  3M63 B;  5G2N A;  4W9G A;  3NS8 A;  3LJ3 A;  3Q8E A;  3O13 A;  2KVR A;  1G6J A;  1V8C A;  2KZR A;  2MP2 A;  2HJ1 A;  1L2N A;  1ISN A;  1KM7 A;  4RF0 A;  1V97 A;  2D3G A;  3ABV B;  4L2Y A;  5CTR C;  3IHP C;  1C1Y B;  2PE9 A;  1SEB D;  1TZO A;  3R3M A;  3Q8B A;  3KH0 A;  2RR9 A;  4FJY A;  1FXA A;  1PUT A;  1FNU A;  3W2D A;  2PMV A;  2GBM A;  3A1Q A;  3DBR I;  3U2S C;  2XN9 C;  1YX6 B;  2FCQ A;  4A6Q A;  1TS5 A;  2AL3 A;  4US8 A;  4RFB A;  3DVN U;  1H8C A;  3W1Y A;  3JYU A;  1UGM A;  2CS4 A;  3MTN B;  4IM0 A;  3ZNG C;  4W9D A;  1B1Z A;  4CO7 A;  1JRU A;  2K25 A;  3DWM A;  4DQO C;  3PZD A;  3QX1 A;  2WDQ B;  4GGQ A;  2MHJ A;  3ZNI D;  2IJ0 A;  3V05 A;  1SE3 A;  1V9J A;  2KQ4 X;  2NBW B;  2BYT A;  3QWZ B;  3Q8C A;  1RRB A;  4IWO A;  1SBB B;  3QK0 A;  2GB1 A;  2IBI B;  3U30 A;  2QIE B;  4ANX A;  1TS2 A;  3WAN A;  2K9X A;  2FE8 A;  4REZ A;  4DXF A;  3V6C B;  1J7B A;  4UDU C;  2KX0 A;  1D5X C;  3JSV A;  2K6D B;  3A1Q B;  3Q3N C;  4EFO A;  3L4P A;  3VTV A;  3TUO A;  4II3 B;  2TSS A;  1A5R A;  2GOW A;  2LRU A;  4WAF A;  2MX2 A;  4DWF A;  2MEK A;  4NQL B;  1WJ6 A;  4HCN B;  4AQ7 A;  1MFW A;  1L4D B;  3ML9 A;  3Q8F A;  1C78 A;  3ZYY X;  2WXG A;  4FJV B;  1C9F A;  2INC C;  4L23 A;  3I9V 1;  2LGS A;  5H92 C;  4IUM B;  4NPN A;  3RZW C;  4TMA B;  2WXL A;  1GAQ B;  1N62 A;  4AP4 C;  5FR6 A;  2BB5 A;  2L1A A;  1WYG A;  3V3X A;  3DCG A;  3T8M A;  3A33 B;  2RDB C;  3B1L X;  3Q3J A;  1EO6 A;  1P1A A;  1YQ4 B;  4LDT B;  1R4M B;  2MBB B;  2WXO A;  4HJG E;  1WSP A;  1JWA D;  4FHJ A;  3I63 C;  3ML8 A;  1VRA B;  2BGF A;  4I6P A;  3JSV B;  3ZJT A;  1L6U A;  3DBR B;  2BQQ A;  2CU3 A;  1TY0 A;  3AEC B;  3CF6 E;  3J9C A;  3R2I A;  2N9K A;  2PVO D;  1C3T A;  4A3P A;  4TSS A;  4LNO A;  3LXF A;  3QJZ A;  4MGZ E;  2WXJ A;  3N1Y C;  1E9M A;  1XXG A;  4XWT A;  2IZV B;  5BYR A;  2BVC A;  2MBE A;  1L5P A;  3C0R B;  4ZHP A;  4NY0 A;  1OQR A;  1AAR A;  3JVZ X;  1MVK A;  5CHW A;  1S1Q B;  2BYF A;  5HI1 A;  5IAA C;  3OJ3 A;  1VD2 A;  3NRZ A;  2KC2 A;  3DBS A;  4KV2 A;  3ZJV A;  5BYQ A;  1FRD A;  1WF9 A;  1OEY J;  3W9C B;  1U4A A;  3ZW3 A;  1WGG A;  4RMA A;  4KZC A;  1N5W A;  3VVW B;  3U8Z A;  1PDX A;  1V6E A;  5TSS A;  1SE4 A;  3QHT A;  1VZ8 A;  4IKG A;  3P4Q B;  4XYC A;  4QAY A;  4LNK A;  2W54 A;  2NMQ A;  4EZJ A;  4RNA A;  4X57 B;  3RT3 B;  2UU7 A;  2KFJ A;  2RGF A;  3HK0 A;  2XNA C;  2LRW A;  2N1V A;  4K7U A;  1E8Y A;  2LVO A;  3RNB C;  4WJN A;  3PTF C;  2J0J A;  4RCO A;  1KRH A;  5CHF A;  1C77 A;  2K6Q A;  1XLO A;  3DBL B;  4MM3 B;  3I57 A;  1D3Z A;  4KSK C;  1I4X A;  2H88 B;  3V62 A;  4PS7 A;  1FD6 A;  2L05 A;  2LJI A;  4L1B A;  4WWP A;  3TEW A;  2MBH A;  2KLG A;  2EMT A;  1E90 A;  1TKY A;  1WH3 A;  2H89 B;  3BII D;  3PPA A;  2Y5B B;  3GZN B;  2KAN A;  4NJC A;  2KYW A;  1LQB A;  4JWS C;  4GOC A;  3IXS A;  4OW0 A;  2KKC A;  1OFF A;  2KN4 A;  1ZKH A;  2JU6 X;  3A9J A;  2E6X A;  1KLG D;  3BIN A;  5FKA C;  4W9H A;  2WDT B;  3UI3 A;  1NEK B;  3BZD B;  4MAC A;  2J0M A;  2BT6 A;  1WWT A;  3I3T B;  3AUL A;  4LJP B;  2G1E A;  2L0T A;  1D6E C;  1NVI D;  5EE0 A;  1T0R C;  3SD5 A;  4US9 A;  3BK2 A;  1OGW A;  1WM2 A;  2N1W A;  3Q3O C;  2BS2 B;  3RNG C;  3DVG X;  5E6O A;  2W3R A;  4OZA A;  3AI5 A;  5IKC M;  2C7M B;  4OVV A;  3RN9 C;  3TIX A;  1V80 A;  2GBR A;  5LXH A;  3SEB A;  4W9I A;  1XLP A;  2M4N A;  4A8X C;  5BO4 B;  3ALB A;  2DHZ A;  3U7Z A;  1QIL A;  4BBN F;  5J2R A;  1DGJ A;  4HRO A;  3P2B A;  1Q0W B;  3PRP B;  3A9J B;  1YN5 A;  2CKH B;  1RFK A;  1WR1 A;  1L0V B;  2L52 A;  2QSD A;  4ZYS A;  4MDK E;  3VUX A;  3M95 A;  5CHV C;  2K22 A;  3L16 A;  1E8Z A;  4KX6 B;  3AE5 B;  3NJT A;  2XBB C;  2D10 A;  4XGA B;  1H4R A;  4XX5 A;  1QF6 A;  1GJZ A;  3N1X C;  2ZVN A;  3P1M A;  4NAW A;  4HPP A;  1EM7 A;  3ZLZ A;  4XC2 A;  3ZRF A;  1C4C A;  1ZUD 2;  2ZZP B;  2DZM A;  3AE1 B;  2C7H A;  1UNS A;  3ZTD A;  2DEN B;  2AYO B;  3DDC B;  3X23 A;  4FA6 A;  1MJD A;  3NG0 A;  1WXS A;  2N7E A;  3K9P B;  2W55 A;  5JZE B;  1KLV A;  5DPR A;  2KQS A;  2KC1 A;  3QCA A;  3NVV A;  5L83 A;  2M1M A;  2LZ6 A;  4FN2 A;  3W1S C;  3PSE B;  3WAO A;  2V9H A;  3URY A;  1MHH E;  4BFR A;  2PEA A;  3AH7 A;  2W82 A;  1UH6 A;  1KFY B;  2FCM A;  2ASQ A;  3BYY B;  2MLB A;  1D5Z C;  4MGI E;  3R7Q A;  4NAW B;  3ECI A;  2JZ3 B;  3AE9 B;  3Q2A C;  3I5J C;  3PS6 A;  2PLP A;  4GB9 A;  3BWU D;  3ZDM C;  1VJK A;  3IVF A; 
#chains in the Genus database with same CATH homology
 3PRM B;  4ANU A;  3IFW B;  4EEW A;  2LI5 A;  1WR6 E;  3R3M A;  4ZRI A;  3OLM D;  2RSU A;  2KTR A;  4K7S A;  5D2M B;  2JRI B;  2KO3 A;  3B0A A;  3KH0 A;  3CMM B;  2RR9 A;  2ZNV C;  4FJY A;  4KVG B;  4B95 A;  2ZCB A;  3KW5 B;  1SE9 A;  2K8H A;  3D32 A;  2KWV B;  3EEC A;  3H7P A;  2REX A;  4KSL C;  2GBM A;  3A4R A;  3OAW A;  3H1U A;  3H9D A;  1WMH B;  3PVL A;  3QAQ A;  2LGY A;  3A1Q A;  3DBR I;  1P9D U;  1V2Y A;  4NJ6 A;  1RAX A;  3QAR A;  4HJK A;  1YX6 B;  2FCQ A;  2DYM A;  2JPH A;  4WJO A;  5E6P A;  4MEM A;  4B6W A;  1V5O A;  5LLI A;  2AL3 A;  4DDG D;  2L00 B;  1T0Y A;  2BWE S;  3DVN U;  2CU1 A;  2K8C A;  4M8M A;  1H8C A;  3W1Y A;  1ZW7 A;  2JVC A;  3JYU A;  2L7R A;  4ICU A;  2LWP A;  3M3J A;  1UGM A;  2CS4 A;  1J19 A;  4MM3 A;  2LD9 A;  4G11 A;  3VTW A;  3MTN B;  4IM0 A;  3ZNG C;  4W9D A;  5TR5 A;  2FAZ A;  4CO7 A;  1JRU A;  2FCN A;  2K25 A;  4URK A;  3APD A;  3PZD A;  5DCN A;  4FBJ B;  2K39 A;  3QX1 A;  2IYD B;  3EC8 A;  4GGQ A;  3TCA A;  3NOB A;  4AJW A;  4EOY A;  2G45 B;  3ZNI D;  3TBL D;  2BPS A;  3UIP B;  1P0R A;  4LCD E;  2OOB B;  1V9J A;  2A4Z A;  2BYE A;  2KWC A;  1RFA A;  2NBW B;  3V6E B;  2WWZ A;  3QWZ B;  1RRB A;  4IWO A;  2KTF A;  1YD8 U;  4DHZ B;  2G3Q B;  2KTR B;  3QK0 A;  1WFY A;  2IBI B;  3U30 A;  2ZPN A;  1BT0 A;  2KJH B;  1E8X A;  1WXA A;  4HK2 A;  4ANX A;  3WAN A;  3V6C B;  3Q3F A;  4P7I A;  2FID A;  3H7P B;  2AL6 A;  1R4N I;  2KX0 A;  2JXX A;  3JSV A;  2K6D B;  3A1Q B;  4EFO A;  1V86 A;  2PPH A;  4IM3 A;  2BWF A;  2JT4 B;  1CMX B;  2DYO A;  3N30 A;  3VTV A;  2EKE C;  4EKU A;  2O6V A;  2GBJ A;  4II3 B;  3AU4 A;  3DVG Y;  5KHQ A;  1A5R A;  2GOW A;  2L0F A;  2LRU A;  2MX2 A;  4DWF A;  1J8C A;  4NQL B;  1EF5 A;  2GMI C;  4BVU C;  1WJ6 A;  1L7Y A;  4HCN B;  3RYT A;  5J18 A;  4PS3 A;  4DHJ B;  3ML9 A;  4WWN A;  3X0W A;  4WJQ A;  3QC8 B;  4HLE A;  5J17 A;  2UYZ B;  1OQY A;  4M8N A;  1NBF C;  4FJV B;  2IO0 B;  3JW0 X;  4MH0 E;  2KK8 A;  4ZRJ A;  4JGH B;  1XQQ A;  1TZ1 A;  1Q5W B;  1TTN A;  2D07 B;  2V1Y A;  1K8R B;  4IUM B;  2BF8 B;  4GDK A;  4NPN A;  4GDL B;  5AZF A;  3RZW C;  2WYQ A;  2ZEQ A;  2CHZ A;  1XT9 B;  4AP4 C;  5FR6 A;  4KIK A;  1KOT A;  4BKS D;  1YIW A;  2O2V A;  2PE6 B;  4W9L A;  4BOS C;  1V49 A;  2KDF B;  1LXD A;  3DCG A;  4IM2 A;  2MBQ A;  3IG3 A;  3T8M A;  3A33 B;  4AJY B;  2C60 A;  3AU5 A;  4IWP A;  3B1L X;  3Q3J A;  4MSQ B;  1GG3 A;  1EO6 A;  1QZE A;  1P1A A;  3IBE A;  4LDT B;  2EMS A;  3N32 A;  4B9K A;  2DAF A;  1V81 A;  2MBB B;  3NY5 A;  5AEK B;  2G4D B;  1Z5S B;  2M17 A;  4W9E A;  4EZL A;  3VFK A;  1OTR B;  3HM3 A;  2DZK A;  2JY6 A;  3ML8 A;  4FHJ A;  1VCB A;  2KMC A;  4HWI B;  3ZTC A;  2KD0 A;  2BGF A;  4I6P A;  3JSV B;  2N9X A;  4YL8 A;  1E8W A;  2LAS A;  4RM9 A;  1R4M I;  2NPT A;  1WZ3 A;  2O6V B;  2YLM A;  3CF6 E;  3S2A A;  2NBU A;  3UGB B;  4GIV A;  2D11 A;  4HXD A;  1E7U A;  4PYU A;  1C3T A;  2GBK A;  2KJ6 A;  3CST A;  4A3P A;  4BKG A;  3MJW A;  3QJZ A;  2K8B A;  4MGZ E;  3PV1 A;  2KQ7 A;  4IW0 A;  2DAJ A;  2IO1 B;  1GUA B;  2KOX A;  1UBQ A;  1WGD A;  1WM3 A;  3NZS A;  5IA7 A;  3AXC A;  1HE8 A;  2FNJ B;  1WX7 A;  1WXM A;  2IZV B;  5D6J B;  2LGX A;  3ZO5 B;  2MBE A;  4GDK B;  4GMV A;  2CHX A;  2MWS B;  4EUT A;  2WX1 A;  4PS8 A;  5L95 C;  3C0R B;  2IY1 B;  1WGH A;  4NY0 A;  4WAA A;  2AWT A;  2I1J A;  4G50 A;  1AAR A;  3JVZ X;  3DVN V;  5DPS A;  4JLC A;  2O2V B;  5CHW A;  1S1Q B;  1M94 A;  2BYF A;  2MP2 B;  5IAA C;  2DZI A;  3RZF A;  2JWZ A;  3OJ3 A;  1VD2 A;  4KZ0 A;  2KC2 A;  3DBS A;  4KV2 A;  2KHW B;  3KUD B;  2FIF A;  4ZDV A;  2ZCC A;  3ZNH B;  1YJ1 A;  1WF9 A;  5G55 A;  1WGR A;  1OEY J;  2C5L C;  5E6N A;  2KXJ A;  3WIM A;  1U4A A;  3ZW3 A;  4DXA B;  1WGG A;  4RMA A;  4KZC A;  2D2Q A;  3ZRC A;  3MHS D;  4M0W B;  3VHT C;  3VVW B;  3ZUN A;  4LDT D;  3TJP A;  3L10 B;  1V6E A;  3U8Z A;  2N9E B;  2UWQ A;  2MBO A;  1LM8 B;  4TQ1 A;  2NBV B;  1J0G A;  3QHT A;  2NPT B;  2MSE D;  2ZJD A;  5LXI B;  1EF1 A;  1GC7 A;  3L17 A;  4EZJ A;  4HPL B;  1YX5 B;  2L3Z A;  4MJS A;  4X57 B;  1F9J A;  1WJ4 A;  2LXA A;  4K1R B;  4FAD A;  3A9K A;  3RT3 B;  2KFJ A;  1MG8 A;  2RGF A;  4BBN C;  3RD2 A;  3HK0 A;  3ZIM A;  2LRW A;  3N3K B;  3O65 B;  3VXW A;  3ENE A;  3HIZ A;  2I1K A;  2N1V A;  2LUE A;  2M0X A;  3PLV A;  1E8Y A;  2LVO A;  4K7U A;  3UIO B;  3WAP A;  4MSM B;  4WJN A;  4AUQ C;  2C7N B;  2NVU I;  4NJ7 A;  3PTF C;  4GN1 A;  2J0J A;  1IP9 A;  3PT2 B;  4DK5 A;  2N4F A;  5CHF A;  5CX3 A;  4FUL A;  2K6Q A;  2Z59 B;  3M62 B;  1IYF A;  2LJ5 A;  1Y8R C;  1WRD B;  1D3Z A;  1IPG A;  4KSK C;  3SHQ A;  4TUU A;  2C9W B;  3B08 A;  4TV3 A;  1UZX B;  3RUL A;  1WJN A;  4PS7 A;  3V62 A;  4ANV A;  4E71 A;  2NS5 A;  2L05 A;  4K81 A;  2V3S A;  2KLC A;  4HDO A;  4WWP A;  3GOE A;  2MBH A;  2N7D A;  2KLG A;  4HDQ A;  3RUI B;  3DBL I;  2KDB A;  4FLH A;  1GNU A;  4IG7 B;  2CHW A;  4WWO A;  3UF8 A;  2W9N A;  1TGZ B;  3QIJ A;  2BKR B;  1P98 A;  2EMT A;  1E90 A;  3VTU A;  2MCN B;  3DOW A;  3NZU A;  1WH3 A;  3PPA A;  2Y5B B;  3NHE B;  3ZDM C;  3PLU A;  2FCS A;  1NDD A;  2KAN A;  3DPD A;  4RM8 A;  2KJR A;  3R7R A;  4WQO B;  1LQB A;  3TMP B;  4GOC A;  5C1Z A;  3HM6 X;  2KKC A;  4ZRK A;  4K7W A;  1WYW B;  3PHW B;  4I6L B;  2M8S A;  4MJS B;  5JHB A;  1ZKH A;  3A9J A;  5JH5 C;  3HHM A;  2PJH A;  3VUY A;  1Z2M A;  3GZN I;  2DX5 B;  4JL9 A;  3BIN A;  4GU2 A;  4DHZ E;  1P3Q U;  4G3X B;  4NQK E;  3KUZ A;  1WY8 A;  4W9H A;  1I42 A;  4MGY E;  4W9C A;  1YQB A;  2WDT B;  3VDZ A;  4BKS A;  4MGK E;  2KDI A;  4HCP B;  3H6N A;  1PQS A;  4CHK A;  2J0K A;  1SGH A;  2J0M A;  4PYZ A;  4EZK A;  3I3T B;  3AUL A;  2IO3 B;  4A20 A;  4LJP B;  2KNB A;  3KUC B;  2HD5 B;  2L0T A;  1E7V A;  1ZGU B;  4KDI C;  3VAW A;  4AOF A;  3SD5 A;  2ZPY A;  2G4S A;  3U7D A;  1OGW A;  1WM2 A;  3K9O B;  4G0N B;  2N1W A;  1TBE A;  1OEY A;  2OJR A;  2BKF A;  4TKN A;  3RCZ A;  4DHJ D;  3DVG X;  5E6O A;  2QHO A;  2RD0 A;  3AI5 A;  2JZZ A;  2C7M B;  2L76 A;  2KMA A;  4OVV A;  3TIX A;  1V80 A;  2GBR A;  4KIK B;  3VH3 B;  3EFU A;  5LXH A;  4W9I A;  2B3A A;  3L13 A;  2L8J A;  1LFD A;  4W9F A;  3T9L A;  2M4N A;  4HPM B;  3BY4 B;  4FJZ A;  3DQV A;  4N9F 4;  5BO4 B;  2DZJ A;  2LGD A;  3CSF A;  3ALB A;  2DHZ A;  2MQJ A;  4JQW C;  4BBN F;  4F1S A;  4ASW C;  2JUO A;  5J2R A;  3P2B A;  4E3C A;  3KVF B;  4AWJ A;  3EHV A;  1Q0W B;  1WX9 A;  2MRP A;  3A9J B;  1E5W A;  3PRP B;  2IO2 B;  3R66 C;  1XD3 B;  2CKH B;  1WR1 A;  3VQI A;  4CYE A;  2KWU B;  4XZ4 A;  1V5T A;  5EDS A;  3SDL C;  4E74 A;  5D94 A;  5AZH A;  2HE7 A;  4MDK E;  3VUX A;  2KN5 A;  3QA8 A;  3SU8 X;  3UQB A;  3M95 A;  1WXV A;  2A5U A;  5DPT A;  2BYV E;  5CHV C;  2GBN A;  3PHX B;  3APC A;  3L16 A;  2KFK A;  4GDL A;  1E8Z A;  2R2O A;  4II2 B;  5HKH A;  3L08 A;  4TQ0 A;  3ONS A;  1KJT A;  4JIO U;  2XBB C;  2D10 A;  1I35 A;  1H4R A;  4DBG A;  2O6V D;  4F7Z A;  2NCN A;  4XX5 A;  1WZ0 A;  1GJZ A;  2VRR B;  3LDZ E;  3A4S C;  2WX0 A;  2XK5 A;  2ZVN A;  2IY0 B;  3V61 A;  3PGE A;  3WAL A;  5GMV A;  1EUV B;  4NAW A;  5AZG A;  3KYD D;  1WIA A;  3ZLZ A;  4LJO B;  4XC2 A;  2K1F A;  3ZRF A;  4ANW A;  1FXT B;  3VH4 B;  2ZZP B;  5C23 A;  3H7S A;  1RLF A;  2Z0E B;  1NI2 A;  2DZM A;  1GC6 A;  2FUH B;  5D7G A;  3UQA A;  2ZNV B;  2C7H A;  1UD7 A;  4GSW A;  4IWQ A;  2Z0D B;  4KDL B;  3ZTD A;  2NR2 A;  2CR5 A;  2MA9 B;  2R2Q A;  2DEN B;  4A3O A;  2AYO B;  3L54 A;  3DDC B;  3X23 A;  4OVU A;  2KDE B;  3ZNZ B;  3ZKJ C;  4FA6 A;  1UEL A;  3WA0 A;  1WXS A;  1WX8 A;  2N7E A;  3K9P B;  5JZE B;  1KLV A;  2V4L A;  2HJ8 A;  3WAM A;  5DPR A;  1UBI A;  2KQS A;  1SIF A;  2KC1 A;  2MW5 A;  3DBH I;  3KYC D;  2LVP A;  3QCA A;  2N9P C;  2JRH A;  1WMH A;  3L0W B;  5L83 A;  2M1M A;  2LZ6 A;  2YVC A;  4FN2 A;  3V60 A;  3W1S C;  3PSE B;  1WI0 A;  3WAO A;  3ZDT A;  1X1M A;  2LXC A;  4DDI D;  2LVQ A;  2RPQ A;  1Q1O A;  4BFR A;  4IC7 B;  4BOZ B;  3PRE A;  1WE7 A;  2DYB A;  2PEA A;  3OJ4 B;  4NNJ B;  3W1S A;  3M63 B;  4ICV A;  5G2N A;  3UIN B;  4W9G A;  2KFK B;  5JHA A;  3NS8 A;  3LJ3 A;  1UH6 A;  5DPW A;  1S3S G;  2FCM A;  5KHO A;  1WJU A;  2ASQ A;  2JF5 A;  3PRZ A;  3A9K B;  4BKT A;  2KVR A;  1G6J A;  2MLB A;  2J7Q B;  2KZR A;  2MP2 A;  2KX3 A;  1L2N A;  2XK5 B;  4MGI E;  1WGY A;  2AEH A;  4I6N B;  1ISN A;  2ZVO A;  4HVB A;  4J6I A;  3APF A;  4NAW B;  3R7Q A;  3ECI A;  4GXB A;  1KM7 A;  2D3G A;  4WJP A;  2JZ3 B;  1WE6 A;  3TL5 A;  4F8C B;  4FHK A;  2HTH A;  3QQ8 B;  2XEW A;  3PS6 A;  4MEL A;  4W9K A;  4GB9 A;  5CTR C;  4W9J A;  3IHP C;  1C1Y B;  4ZYN A;  3ZVV A;  3VUW A;  2PE9 A;  3IVF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...