2KWCA

The nmr structure of the autophagy-related protein atg8
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
116
structure length
116
Chain Sequence
MKSTFKSEYPFEKRKAESERIADRFPNRIPVICEKAEKSDIPEIDKRKYLVPADLTVGQFVYVIRKRIMLPPEKAIFIFVNDTLPPTAALMSAIYQEHKDKDGFLYVTYSGENTFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Autophagy-related protein 8
publication title The NMR structure of the autophagy-related protein Atg8
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 18
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2010-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2kwcA00
3OLMD 4FJVB 4WJOA 4MGYE 4YL8A 5KHQA 3ZKJC 2AWTA 2LGYA 2BWFA 3A4RA 3PZDA 3VTUA 3ZRCA 3HHMA 2KWUB 3W1YA 2KC2A 4IC7B 4E74A 4PS3A 1G6JA 2DZMA 2PE6B 1WJ6A 2L0FA 1WGYA 1NBFC 2A4ZA 4JLCA 4W9HA 1WYWB 1WZ0A 1UZXB 1WZ3A 1P9DU 2JPHA 2N9PC 4CHKA 2DX5B 4IM2A 4JIOU 2K8HA 3WALA 2M1MA 3AXCA 2NBVB 1OQYA 2DHZA 4W9EA 4DHJB 3W1SC 4EZLA 3CSFA 2MBQA 2CU1A 4BKSA 3NOBA 5E6NA 2KDIA 4W9DA 1KJTA 3U7DA 2BPSA 1Q0WB 1YD8U 2FIDA 2KTFA 3EC8A 4BKTA 2OOBB 1XT9B 2C60A 2K25A 3JW0X 1E8WA 1SGHA 2FUHB 2MLBA 3V61A 4G3XB 2KOXA 3R7RA 2XK5A 4HPLB 2KDEB 3VVWB 2KQSA 2MP2A 4KVGB 1GUAB 4HWIB 2V1YA 4PYUA 5JH5C 3APCA 3ZW3A 3ZDTA 1EO6A 1WI0A 3EFUA 2N9XA 3H7PB 4FULA 4FHJA 4W9FA 4TKNA 4BVUC 1ISNA 2AL3A 2Y5BB 2LGDA 4MSMB 3DOWA 3RZFA 4DHZB 2LJ5A 3N30A 1WXVA 4HK2A 2MWSB 1WY8A 4W9CA 2G4DB 3QCAA 1OTRB 1S1QB 2YVCA 3A33B 2GBJA 3SDLC 2KMCA 3A9KA 3TIXA 2IO2B 1WX7A 1U4AA 2M8SA 1WJUA 1S3SG 2DENB 3QQ8B 2Z0EB 2DYMA 4PYZA 4TQ0A 3X0WA 2LVOA 1WGRA 2N7EA 2R2OA 3CSTA 2K6QA 3A9JB 5D94A 3LDZE 2O6VA 1WE7A 3L54A 3OJ4B 4ASWC 4IWQA 3ZIMA 1WE6A 2QHOA 1J8CA 2FNJB 2N7DA 2ZPNA 3VHTC 3CF6E 4NY0A 4IG7B 4EUTA 2FCSA 3U30A 4E3CA 3ENEA 2M0XA 2MSED 4HXDA 1ZW7A 2YLMA 2KLCA 4F8CB 2VRRB 2KVRA 1I35A 3BY4B 3MJWA 3DBRI 4ANWA 5CX3A 2JWZA 2WWZA 1UGMA 4G11A 1ZKHA 2A5UA 3L13A 4RM9A 3VQIA 4NNJB 4B6WA 4JGHB 2LXAA 3DVGY 4ZRIA 4OVVA 4KSLC 3R3MA 1P98A 4II2B 4PS8A 4EOYA 2JZ3B 4FJYA 3PRPB 2KJ6A 2NBWB 2KWCA 4AUQC 1GJZA 4URKA 2G45B 3ONSA 1E8ZA 4GDLA 2DAFA 2XK5B 2L76A 1K8RB 2D2QA 3QJZA 2HTHA 2MP2B 3ML9A 4ICVA 3GOEA 3UIPB 3WA0A 1Q1OA 3M95A 3DDCB 3B1LX 1E5WA 5DPWA 4GN1A 2O2VB 2REXA 2ZPYA 5LXHA 3UQBA 2NPTA 1C1YB 3H7PA 3O65B 4HPMB 4FBJB 2ZEQA 3QHTA 3RYTA 3L08A 3ZDMC 4K7WA 2ZCBA 4FHKA 4KV2A 2JY6A 2BYFA 2K1FA 3OJ3A 2CR5A 4BBNC 5LLIA 3DCGA 2M17A 2JUOA 4GSWA 4BKSD 5AZGA 5BO4B 2DZKA 3DPDA 3X23A 2KMAA 4HVBA 2JXXA 4KIKB 4MH0E 2I1KA 2FCQA 2LZ6A 1RRBA 4GXBA 1P3QU 5DPTA 3AULA 1Q5WB 2K6DB 3A4SC 2O6VB 2R2QA 3A9JA 2HD5B 5TR5A 2IO0B 4K1RB 4MGKE 3IHPC 4XC2A 4GGQA 3KW5B 1CMXB 3RUIB 4BKGA 3NY5A 4RM8A 4DDGD 2DYBA 4WJPA 2KTRB 3IVFA 5D6JB 2BWES 2LXCA 1WMHA 4OVUA 4P7IA 3LJ3A 4KZCA 2PE9A 2N4FA 5HKHA 4ZDVA 3ZRFA 2RPQA 2B3AA 3WIMA 3JYUA 2KDBA 3DVGX 2J0JA 5IAAC 1I42A 3H9DA 4BBNF 2GBRA 2GBMA 1UH6A 2C5LC 2MBEA 4AWJA 3EHVA 3PLVA 3SHQA 4MEMA 2J0MA 2LD9A 4FJZA 1WXMA 4GDLB 2CHXA 4I6NB 1D3ZA 3K9PB 2LRWA 4MM3A 4NQKE 1FXTB 2LI5A 3ZNID 2MBOA 1GC7A 4W9KA 3QK0A 3ZNHB 2M4NA 2EKEC 2L0TA 1YIWA 2AEHA 3JSVB 2HE7A 2O2VA 2LVPA 2NPTB 3HM6X 4GU2A 3D32A 4RMAA 1V49A 3QAQA 2JT4B 4KDIC 4LJOB 5C1ZA 3WAMA 4FA6A 3DVNU 2HJ8A 3PHXB 4DHJD 2IO1B 5CTRC 1GG3A 2FCMA 2KX0A 2C9WB 1JRUA 2XBBC 2EMSA 2BKRB 2GOWA 1GC6A 3KUCB 1WF9A 3H7SA 4WWOA 2L3ZA 1E8XA 1XQQA 2W9NA 3DBLI 1TZ1A 2RR9A 3RT3B 4EKUA 1V9JA 2RD0A 4DBGA 4KIKA 4B9KA 1WGGA 3B08A 4JL9A 3PS6A 4WJQA 4FLHA 3ZTCA 4F1SA 2LWPA 2KHWB 5DPRA 2RSUA 1GNUA 5C23A 3SD5A 3KUDB 5IA7A 2KC1A 3AU5A 2G3QB 4LDTB 4MSQB 1WH3A 4CO7A 3VH4B 2FCNA 1WGHA 2XEWA 4NPNA 2KTRA 3T9LA 1WMHB 3WAPA 3V62A 1Z5SB 3ZNZB 4NQLB 3HM3A 3IBEA 2GBNA 2KN5A 2PJHA 4A3PA 4KZ0A 1YX6B 1WM3A 1EUVB 1RLFA 1WGDA 4PS7A 4IWPA 3ZUNA 2D11A 3WAOA 4G0NB 2MX2A 1WFYA 2N1WA 3H1UA 2JRIB 3DBHI 1WJNA 1BT0A 3VTVA 3KYDD 4A3OA 3MTNB 4M8NA 1P1AA 1V2YA 2KZRA 2N9EB 4MGZE 5G2NA 4DDID 4BFRA 5JHAA 4G50A 1WJ4A 2DAJA 1EF1A 2D10A 3Q3JA 3QIJA 3APDA 2I1JA 4KDLB 4ZYNA 1KLVA 1NDDA 1WX8A 3KVFB 2LRUA 3VAWA 3EECA 3L16A 1F9JA 4I6PA 3APFA 3BINA 3R7QA 3ZLZA 1ZGUB 2J0KA 4AJWA 3UINB 1WR1A 3IFWB 5AEKB 1H8CA 2N1VA 3JSVA 3PVLA 2BGFA 2KXJA 4FADA 2MRPA 3KUZA 2FIFA 4MJSA 1V80A 4NAWA 3DQVA 4WAAA 4GIVA 2L8JA 1V81A 3PPAA 2KDFB 4ZRJA 3ZNGC 1E90A 2KFKA 3JVZX 4B95A 3DVNV 1E8YA 2IYDB 2CS4A 3MHSD 4K81A 4AJYB 1XD3B 1NI2A 2JRHA 4HDOA 4IWOA 4DHZE 2ZVNA 3NZUA 3UGBB 3GZNI 5L83A 3TJPA 2AYOB 3UQAA 3PLUA 2EMTA 4WWPA 2DYOA 4DK5A 1QZEA 3ZO5B 5J2RA 1IPGA 4ANXA 3L10B 3TBLD 3ZTDA 3OAWA 1WXSA 1H4RA 3CMMB 4W9LA 2NBUA 4AOFA 3S2AA 2GBKA 1L2NA 2K8CA 2UWQA 5D2MB 4HCNB 2LVQA 2MQJA 2KANA 2KX3A 3PTFC 1VD2A 2V4LA 1IYFA 3K9OB 3VUYA 2ZNVB 4ANUA 2FAZA 4K7SA 3W1SA 4GOCA 4IM3A 2KKCA 4W9IA 3A1QA 2V3SA 2DZIA 3H6NA 1OGWA 4DWFA 1T0YA 4EZKA 1WX9A 3RD2A 1WRDB 4AP4C 2BYVE 3ZVVA 4LJPB 2MW5A 2MBBB 3V6CB 2D3GA 1YJ1A 4M8MA 3C0RB 2DZJA 4WQOB 4XZ4A 4BOZB 5J18A 1OEYJ 4W9GA 2AL6A 3M62B 5L95C 2PPHA 3Q3FA 1WIAA 1J0GA 4IUMB 2C7MB 2O6VD 3QC8B 2MCNB 3VH3B 2ASQA 2Z59B 2LGXA 4HCPB 3N32A 1LQBA 1PQSA 2CHWA 2IY1B 1UBIA 4EEWA 3DBSA 5GMVA 1LM8B 1LFDA 5JHBA 3TMPB 4MELA 4NJ7A 3U8ZA 3IG3A 3NZSA 2IBIB 1E7UA 3TL5A 3AI5A 4TQ1A 3B0AA 4J6IA 1J19A 4NAWB 4MJSB 2ZZPB 4K7UA 5LXIB 1AARA 1HE8A 1V5TA 2KWVB 2NVUI 4MDKE 1C3TA 2KFKB 4HDQA 3VUWA 1MG8A 3NS8A 5J17A 2CKHB 2LASA 4JQWC 1LXDA 2KLGA 3KYCD 2IY0B 1TGZB 1WM2A 3PREA 5JZEB 1KOTA 2PEAA 2LUEA 5DCNA 4TUUA 4IM0A 2IZVB 1V6EA 1UD7A 4GDKA 2NCNA 3QWZB 3VUXA 3ECIA 5DPSA 3PV1A 1IP9A 3P2BA 2JZZA 4LCDE 3V6EB 3SU8X 1RFAA 5E6PA 2KNBA 1P0RA 4HLEA 3M3JA 4II3B 1A5RA 4EZJA 3VDZA 2GMIC 4IW0A 1WXAA 3PGEA 4FN2A 4X57B 5AZFA 1M94A 1L7YA 1TBEA 2L05A 1KM7A 3A1QB 3RULA 4MGIE 1TTNA 2WDTB 3PRZA 2WX0A 4A20A 4XX5A 1X1MA 4WWNA 4GB9A 2MBHA 3VXWA 4EFOA 2KJHB 2ZCCA 3HK0A 5KHOA 2K8BA 4HJKA 3UF8A 3KH0A 2C7HA 3L0WB 3PT2B 1UBQA 5D7GA 3QARA 2KK8A 4GMVA 4CYEA 1RAXA 4DXAB 2NR2A 5CHWA 1Z2MA 4KSKC 1R4MI 3QX1A 3L17A 3R66C 1UELA 3QA8A 3PHWB 4LDTD 2G4SA 1YQBA 2WYQA 2IO3B 2OJRA 2WX1A 2MA9B 2ZNVC 2L7RA 3UIOB 4F7ZA 1V5OA 4TV3A 3VFKA 4W9JA 1R4NI 2Z0DB 1WR6E 4NJ6A 1V86A 2BF8B 5CHVC 3ALBA 4BOSC 2JVCA 4N9F4 4ANVA 1SIFA 2ZJDA 2KFJA 2BYEA 3N3KB 3WANA 4M0WB 2UYZB 2K39A 2RGFA 2L00B 3I3TB 3ML8A 4WJNA 3PRMB 3V60A 3TCAA 3RCZA 4ICUA 3VTWA 5FR6A 4GDKB 5AZHA 4I6LB 1Y8RC 5CHFA 3RZWC 3NHEB 5G55A 1OEYA 4E71A 2KQ7A 3AU4A 2J7QB 2KJRA 2CHZA 1EF5A 3A9KB 2KD0A 1E7VA 2KO3A 3HIZA 5E6OA 2NS5A 2BKFA 3PSEB 3T8MA 1VCBA 5EDSA 3M63B 2ZVOA 2C7NB 2JF5A 4ZRKA 1YX5B 1SE9A 2D07B
chains in the Genus database with same CATH superfamily
1RWSA 2LJIA 2INDC 5KHQA 3ZKJC 2LGYA 1FRDA 2FBWB 1G6JA 2DZMA 1PUTA 2PE6B 1WJ6A 2L0FA 2A4ZA 1WYWB 1WZ0A 3C8YA 1P9DU 1AWDA 3I63C 4CHKA 4DXFA 1R7SA 2NBVB 1OQYA 4KKIA 1QOBA 2DHZA 4W9EA 1RYJA 3U7DA 2BPSA 3FKYA 3KQ4A 1Q0WB 3BK2A 2KTFA 4BKTA 2OOBB 1XT9B 3JW0X 3V61A 2MLBA 4NJCA 3BYTB 5AUKA 3VVWB 4J3OD 2IJ0A 1K52A 2MP2A 1GUAB 4PYUA 2CJOA 3EFCA 1YQ3B 1ZDXA 4FULA 1FO4A 2K0PA 3RPFC 2LGDA 3DOWA 4DHZB 2BYTA 2G4DB 2YVCA 3SDLC 2KMCA 2IO2B 2Z0EB 1AW7A 2QDFA 2DYMA 4L23A 2WDRB 2R2OA 4LTUA 3L54A 3OJ4B 4ASWC 4IWQA 2QHOA 2CJNA 2ZPNA 4OW0A 4E3CA 2MSED 2YLMA 2VRRB 2KVRA 1I35A 1UGMA 1ZKHA 4B6WA 5D3IB 3TEXA 2JYTA 2L32A 4ZRIA 4OVVA 3PRPB 2KJ6A 2V9HA 2G45B 1ZPSA 4OHJA 1Q1OA 3M95A 3DDCB 3TUOA 2GLSA 5G5HA 1E5WA 3AE6B 5G5GA 5DPWA 2O2VB 2KVZA 2ZPYA 5LXHA 3UI3A 2D5GA 2KWDA 1J7BA 3QHTA 3ZDMC 2ZCBA 4FHKA 1N6ZA 2GB1A 2JY6A 2K1FA 1XLNA 5IP4D 3O13A 5LLIA 4GSWA 5AZGA 5BO4B 2DZKA 1YN3A 2I1KA 2LZ6A 1RRBA 2JSVX 4GXBA 3AV8A 4WURA 5DPTA 4C7ZA 2R2QA 2W3RA 2HD5B 2ON8A 2QIEB 1K51A 3IHPC 2UU7A 4C4VB 3RNAC 3KW5B 4BKGA 4DDGD 1TKGA 3DHGC 2DLBA 4WJPA 2WLBA 3RFZB 5D6JB 2LHEA 4P7IA 3ZRFA 2D3BA 4YTPB 4BBNF 1UH6A 2MBEA 1JWMD 4MEMA 2BQQA 2J0MA 1WXMA 2CHXA 1DYQA 2MHJA 1GC7A 3RN9C 4W9KA 1VDVA 3QK0A 2GI9A 2M4NA 2VZKB 1TJEA 2AEHA 2O2VA 2NPTB 4RMAA 1V49A 3QAQA 4RGNA 3WAMA 1I4PA 3AECB 3PHXB 4DHJD 1GG3A 2FCMA 3VUWA 3KUCB 1WF9A 3AE5B 3IAS1 4YT0B 4JL9A 3Q14C 2LWPA 4EE2A 2RSUA 1GNUA 4C4VA 2KC1A 3TEZA 2G3QB 4LDTB 1WWTA 3OG5A 1WMHB 1YJJA 4ARCA 1V1PB 3HM3A 4A8XC 2KN5A 3LXFA 1FFVA 1WM3A 1EUVB 2HDEA 4YSZB 3DWMA 3WAOA 1L4DB 1WFYA 3DBLB 3H1UA 4A3OA 1I4RA 3KYDD 1P1AA 1V2YA 1PFDA 4DDID 1MHHE 5G2NA 4BFRA 2Y5CA 2AQ3B 2DAJA 2D10A 3W9CB 1F9JA 1T3QA 2J0KA 3Q3OC 5AEKB 2KACA 1SXTA 1B1ZA 3MC9A 3KUZA 3EA6A 3ZNGC 1E90A 1JW9D 4D2KA 3BIID 4C7YA 2IYDB 4HROA 4AJYB 4ZHPA 4B0EA 3SFDB 3AEEB 3GZNI 1EWYC 1ET9A 4WWPA 1FMAD 3CMMB 4NAMA 3PZ8A 2NBUA 3MC0B 3S2AA 1R4MB 5D2MB 4LNOA 1FPYA 2WXNA 3PTFC 2SAKA 1IYFA 2ZNVB 2FAZA 3W1SA 1PGXA 3IT6B 4HKQA 2V3SA 1OGWA 4EZKA 3HRDD 3Q8CA 2BYVE 1JALA 3ZVVA 2MW5A 4JX1C 3C0RB 2DZJA 4CQNA 5J18A 1UWXA 3M62B 5HHDG 3Q3FA 1WIAA 4OVZA 4IUMB 5BYRA 2C7MB 2O6VD 3QC8B 3NVVA 2MCNB 4NZLB 4HCPB 1TYGB 1IBXB 5GMVA 5EE0A 1RFKA 3R2IA 4J6IA 3P4SB 1AARA 2NVUI 2KFKB 1MG8A 2OHFA 2L83A 2CKHB 2LASA 2IY0B 3PREA 4Q2JA 4TUUA 4RGMA 4IM0A 1LGRA 3Q6BA 3Q8FA 3NG0A 1V6EA 1UD7A 4US8A 3N20C 1SF0A 4ZOHC 3RNEC 2NTTA 1SB3C 2JYEA 3PO0A 4EZJA 3P4QB 5AZFA 2J4XA 3A1QB 1TTNA 2IGHA 4WWNA 3VXWA 3UF8A 1L4ZB 3KH0A 4XGAB 4R3DA 1UBQA 4GMVA 4CYEA 1FCCC 1RAXA 2PVOD 5CHWA 5TSSA 1UELA 1SJED 1YQBA 2BB5A 2BVCA 2WX1A 5H92C 2ZNVC 3UIOB 4TV3A 3VFKA 2JVCA 3AN1A 2FUG1 3IAM1 1J7AA 1FM0D 2ZJDA 2AQ2B 4M0WB 2K39A 1VRAB 1I4QA 1TS5A 3WCQA 3PRMB 3NVZA 2WXOA 2LGIA 3VR8B 3VRAB 1WRIA 2PIAA 2JWUA 5CHFA 4LNNA 3RZWC 2BW2A 1IUEA 2J7QB 2RDGA 3HIZA 5E6OA 1FD6A 4UDUC 3T8MA 1R4NB 3GB1A 2JF5A 1YX5B 3VTUA 1FXIA 4ZYSA 1HTOA 4YL8A 1TKEA 3ZRCA 3SR6A 3N1XC 2KWUB 4IC7B 3T3NA 4RH6A 1SIJA 1QKZA 3C19A 1NBFC 2N9PC 3WALA 2M1MA 1FEHA 1UWMA 3CSFA 2CU1A 3NOBA 2KDIA 4L1BA 2FIDA 3EC8A 2NMQA 1XCTL 2PMVA 2K25A 1E8WA 1SGHA 2FUHB 2WHIA 2RDHA 4M0WA 3R2TA 2V1YA 3ZW3A 1WI0A 3EFUA 2N9XA 4US9A 2IDYA 4MSMB 3RZFA 4FXCA 1WXVA 1WY8A 2KT7A 4W9CA 3Q2AC 3A33B 4LNFA 1U4AA 2M8SA 1WJUA 1S3SG 2DENB 3B9JA 3QQ8B 2CU3A 4PYZA 1LO5D 1WGRA 2N7EA 2K6QA 3A9JB 5C3JB 1VJKA 3Q3NC 2O6VA 1EU4A 3ZGZA 1J8CA 3CF6E 4NY0A 3ENEA 2M0XA 1UF0A 1NENB 1I4HA 2KLCA 5EE9A 4F8CB 2WWZA 4RM9A 1PYWD 3L13A 2I38A 2W55A 5MPOA 2LXAA 4K3BA 4KSLC 1PGBA 1P98A 2KN4A 4A9AA 4EOYA 2JZ3B 3AM9A 2KWCA 1GJZA 4URKA 4YSXB 2L1AA 1SSNA 4GDLA 2KAJA 2L76A 2PTLA 1YNTE 2HTHA 3Q69A 2MP2B 2RDBC 3ML9A 4ICVA 3UIPB 2G1EA 1C1YB 4HPMB 4FBJB 3L08A 4USAA 4KV2A 4IDIA 2PVGC 3OJ3A 2CR5A 3DCGA 1TS4A 4BKSD 2D3CA 3DPDA 4HVBA 2JXXA 1QILA 2IGGA 2V3NA 1XF5L 2K6DB 3A4SC 3A9JA 1SEBD 5TR5A 4K1RB 1JCKB 4XC2A 1CMXB 4KX6B 3RUIB 3NY5A 3IXSA 2DYBA 2BWES 2LXCA 4OVUA 3LJ3A 1JWUD 2N4FA 5HKHA 4ZDVA 2B3AA 3WIMA 2KDBA 3H9DA 2GBRA 2GBMA 3P63A 1CZPA 1T0RC 3Q8AA 2J53A 2V0GA 1D3ZA 4FJZA 3MHZA 2LI5A 2JZPA 3ZXVA 3URYA 3ZQ4A 3V05A 3ZNHB 5BMHA 1F2RI 4RNAA 3JSVB 2HE7A 3HM6X 2LVPA 1L0YB 2V4IB 3B2FA 4FA6A 3DVNU 3MJ5A 1JRUA 2GOWA 3DBLI 1XQQA 1TZ1A 3DHHC 4EKUA 3EUB2 1EM7A 3B08A 3PS6A 4WJQA 4FLHA 3ZTCA 3P42A 2BTEA 4RFBA 3KUDB 1MI0A 5BMIA 1WGHA 3RI7C 3T9LA 3WAPA 2PJHA 1IGCA 2LHDA 1WGDA 2MX2A 5BYSA 2JRIB 1WJNA 2V3PA 4MGZE 2N9EB 1SE2A 2I1JA 1CK1A 1N60A 1QOGA 3L16A 3ZLZA 3IFWB 1JWBD 1C77A 3JSVA 3PVLA 4FADA 4NAWA 2FIFA 4MJSA 4XWTA 2KDFB 4ZRJA 1E8YA 3R8BA 2CS4A 4K81A 3FC4A 4IWOA 4YSYB 2AYOB 3PLUA 2EMTA 4DQOC 4DK5A 4AQ7A 3VRBB 3DBHB 1ZXIA 1WXSA 4K3CA 2EKIA 2K8CA 1JWAD 2YEPB 3B2GA 1E6EB 1YN4A 1HA5A 3VUYA 3H6NA 2PW9A 4B0MA 3V6CB 4M8MA 4XZ4A 2JQRB 4BOZB 1OEYJ 2ASQA 2Z59B 1PQSA 3I9V1 4EEWA 1QT9A 3AH7A 4MELA 3IG3A 2IBIB 1E7UA 2WXGA 4IOIE 3AI5A 1UGJA 1EU3A 3B0AA 4P1CC 3DHIC 2ZZPB 4A6QA 1HQRD 2KWVB 4MDKE 4C80A 4HDQA 4QAYA 5J17A 1NYRA 4JQWC 2KLGA 4REZA 3U7ZA 1TGZB 4M00A 2QSDA 3LYYA 1L0XB 3ECIA 1IP9A 2WGSA 1RFAA 5E6PA 2MJ3A 3M3JA 1A5RA 1GPXA 3VDZA 4IW0A 4WWMA 1ZE3D 1M94A 1TBEA 1F52A 3PRZA 2PLPA 3HVDA 4LK0M 5KHOA 4HJKA 2WU2B 5D7GA 4ACFA 3QARA 2BS4B 1KLGD 1FXAA 3L17A 3R66C 3PHWB 2WYQA 3AE8B 2IO3B 2MA9B 1NI3A 1E7PB 4F7ZA 2H89B 4OZCA 4W9JA 1R4NI 2Z0DB 2QMTA 4N9F4 3CWIA 1A70A 2BYEA 2J52A 1YQ4B 2RGFA 3I3TB 1SE4A 3TCAA 1TKYA 5IKCM 5AZHA 5IOIA 2X8XX 3U52E 4M01A 4ZRQA 5G55A 2BBCA 1D5XC 1N5XA 2KQ7A 1ZXHA 2KJRA 2WXKA 3IT4B 2KD0A 1E7VA 4LNIA 5EDSA 1VCBA 1KH0A 5FK9C 2E6XA 2NTSA 4G50A 2D07B 1QOAA 2AWTA 3PZDA 2BWFA 3A4RA 3AEDB 4RF0A 2AQ1B 2KC2A 4PS3A 1WGYA 4W9HA 3PZ7A 3T3OA 4P1BC 2KDMA 4JIOU 4DHJB 3W1SC 5FKAC 4EZLA 1WSPA 5E6NA 2KMMA 3HVZA 4P6VF 1B9RA 4W9DA 1KJTA 1YMHE 1BUIC 2C60A 4P16A 3AE2B 4G3XB 2KOXA 3R7RA 2XK5A 4HPLB 2ZW1A 4N59A 1K53A 2KQSA 3RNBC 5JH5C 2ZW0A 3APCA 3ZDTA 1EO6A 3H7PB 1JMLA 3ABVB 4FHJA 4TKNA 1ISNA 2Y5BB 3OWEB 1WGKA 3N30A 4HK2A 1UUPA 1OTRB 1S1QB 3LB8C 1XO3A 2GBJA 2W3SA 2PKOA 2TSSA 4TQ0A 3CSTA 5D94A 3P4RB 3LDZE 1ACCA 3ZJTA 1V97A 1WE7A 3ZIMA 1P7EA 2FNJB 2N7DA 1C4PA 3VHTC 2FCSA 3U30A 2Z8LA 1ZW7A 5HI1A 3BVMA 5EE3A 3BYYB 4ANWA 5CX3A 2JWZA 1YJIA 2A5UA 4JGHB 4N58A 3R3MA 1FFUA 4II2B 1VR9A 4PS8A 4FJYA 1I7HA 1L6VA 5E6JA 3ONSA 1E8ZA 1JQ4A 1FRRA 2WS3B 1WXQA 4M02A 1ROEA 2RMMA 1ZOYB 3RNFC 5JXVA 3WA0A 2REXA 3TSSA 3UQBA 3BK1A 1D5MC 4ARIA 3H7PA 5HFYA 2BT6A 1ENFA 3DBRB 3BZDB 4BBNC 2JUOA 2AX5A 2K3UA 1ZP0B 3X23A 3BWUD 1GAQB 1ZDVA 1C4AA 2O6VB 3RNCC 2WXPA 4MGKE 4LNKA 2WXMA 4GGQA 2EELA 4RM8A 1NVID 3IVFA 2MJEA 4KZCA 2PE9A 1I4GA 1ESFA 3AE1B 3KWVA 3JYUA 5IAAC 3DVGX 2J0JA 1ZUD2 2C5LC 2X38A 1DOYA 1QF6A 1FCLA 1MHXA 4GDLB 5H8YE 3AE7B 1F77A 3K9PB 2LRWA 4MM3A 4NQKE 1FXTB 4HJGE 5FR3A 4YXDB 3AEAB 1C79A 3ZNID 2MBOA 1YN5A 3BVZA 1JROA 2L0TA 1XLQA 4KDIC 1FNWA 2JT4B 3AMZA 3N1ZC 4JWSC 2HJ8A 4XYCA 2IO1B 3E56A 5CTRC 2C9WB 2BB6A 3U4EG 2RR9A 2QEJC 4B9KA 1KLUD 2WXHA 4F1SA 4YTMB 2ACZB 2DBYA 5DPRA 2WXFA 5C23A 5IA7A 1ET6A 4XDDA 1WH3A 3VH4B 2XEWA 3V62A 3ZNZB 3IBEA 2GBNA 3AB5A 4A3PA 2FE8A 1HZ5A 1DGJA 2B76B 4PS7A 3ZUNA 2D11A 1SBBB 3DBHI 3VTVA 3MTNB 4M8NA 2KZRA 1EF1A 3APDA 4KDLB 4ZYNA 1NDDA 1WX8A 2M19A 2LRUA 3SFEB 4DXGA 3EECA 4I6PA 3BINA 2INCC 1ZGUB 3UINB 1WR1A 2N1VA 2BGFA 2KXJA 4HKZE 2MRPA 4WAAA 3DQVA 1V81A 3JVZX 4B95A 2BS2B 4ITKA 3MHSD 3N1YC 3NZUA 4TMAB 2DYOA 2LGSA 1N5WA 1QZEA 3U2SC 3ZO5B 1IPGA 3L10B 3TBLD 1KRHA 3ZTDA 1C76A 2MH7A 4W9LA 2GBKA 4HCNB 1VD2A 2V4LA 5AUIA 2DWQA 3K9OB 1YOVB 4ANUA 4K7SA 1VZ7A 2KQ4X 2KKCA 4HEA1 4DWFA 1T0YA 1WX9A 3RD2A 4AP4C 2MBBB 4ZHOA 2D3GA 4O1NA 2LFIA 4W9GA 4BAXA 4XWWA 2AL6A 5L95C 3TEYA 1V1OA 4MH8A 3V3XA 3VH3B 4XDCA 3N32A 1LQBA 2IY1B 1XLOA 4HRSA 4TSSA 1VZ8A 1L0VB 2Y5PA 4NJ7A 3NZSA 3AE9B 2IPKD 4KGTA 4BZAA 4JWUC 1J19A 1Y56A 4NAWB 4MJSB 4K7UA 2QJLA 5EE1A 5LXIB 1HE8A 5C2TB 3NS8A 3CIRB 4JE3B 4XE0A 4RCOA 1LXDA 3KYCD 3FAHA 2Y3AA 1KOTA 2PEAA 2LUEA 1BMLC 1XCQL 2N7JA 4GDKA 2NCNA 3GE3C 3VUXA 3P2BA 2JZZA 4LCDE 3SU8X 4II3B 4H2AA 2VZKD 3ZJUA 1WXAA 3PGEA 1T5XD 1GOZA 4A55A 1KM7A 2LUMA 2WDTB 1XLPA 1E9MA 4A20A 1MVKA 1X1MA 4GB9A 2MBHA 1MFWA 4N6EB 4EFOA 2ZCCA 1L6UA 1TS2A 2K8BA 3FILB 2C7HA 2WXQA 3PT2B 3TEWA 1QLBB 1JWSD 4KSKC 1R4MI 3QX1A 2L52A 2OJWA 4LDTD 2G4SA 1TZOA 3I57A 2WXLA 2OJRA 1MG4A 2L7RA 1V5OA 1WR6E 2BF8B 5CHVC 4BOSC 4OZAA 4ANVA 1SIFA 1WYGA 3N3KB 2UYZB 3ZXRA 3Q8EA 1D5ZC 2L00B 3ML8A 4WJNA 3RCZA 1HZ6A 3VTWA 3I5JC 3NHEB 2WNMA 1J7CA 4E71A 3KWLA 3AU4A 3A9KB 2KO3A 2HTME 2BKFA 3PSEB 2K9XA 3M63B 2C7NB 5I4DA 3OLMD 3VR9B 4FJVB 4WJOA 4MGYE 1XXGA 2LEKA 3HHMA 3FILA 1FNVA 3W1YA 4E74A 2VH2A 1PDXA 1OFFA 4JLCA 2J42A 1UZXB 1WZ3A 2JPHA 3ZJVA 3NJTA 2DX5B 4IM2A 2LMCA 2K8HA 3AXCA 2MBQA 5GXGB 1KFYB 1TT5B 4BKSA 1P7FA 1N62A 1DOIA 1YD8U 3Q3MC 1K50A 1TY0A 2KDEB 2INNE 2JU6X 2Q5WD 4KVGB 4HWIB 3MC8A 4W9FA 4BVUC 5HG2A 2AL3A 2E3TA 1Q10A 1GB1A 2LJ5A 2MWSB 1UNSA 2BS3B 3QCAA 4C56C 2WQYB 4PK1A 1NYQA 3A9KA 3TIXA 1WX7A 1FIQA 4KKJA 3X0WA 2LVOA 4IKGA 1HXYD 2VH1A 1WE6A 1OQQA 4IG7B 4EUTA 1QOFA 4HXDA 4LLGM 2QCZA 1BXTA 3BY4B 3MJWA 2D3AA 3DBRI 4G11A 3VQIA 5D3DA 2N9KA 2M0AA 4NNJB 3DVGY 2JX5A 4JPSA 2NBWB 3E9SA 4AUQC 4KGSA 4RGTA 2DAFA 2XK5B 1F1HA 1SE3A 2R61A 5BYQA 1NEKB 1K8RB 2D2QA 1C78A 3ETRA 3QJZA 3RMKC 3GOEA 4RGOS 2GRIA 3AE3B 3B1LX 4GN1A 2NPTA 3O65B 2WU5B 2ZEQA 3RYTA 4K7WA 2BYFA 2M17A 2W54A 2KMAA 3H8HA 4KIKB 4MH0E 2FCQA 1P3QU 5LNK1 3AULA 1Q5WB 2WXRA 1EWCA 2IO0B 2HJ1A 2WDVB 2SEBD 2G9HD 4HPPA 3KLSX 4MT5A 2OEDA 2KTRB 1WMHA 1V1PA 3EGRA 1VLBA 2XN9C 2RPQA 3L4PA 1I42A 4AWJA 1KTKA 3EHVA 3PLVA 3SHQA 2LD9A 4I6NB 2EKEC 1F2RC 2MEKA 1AN8A 1YIWA 4GU2A 3BVGA 3D32A 1TIFA 4LJOB 5T8IA 1STEA 5C1ZA 3MFGA 3GS2A 2XBBC 2KX0A 4WWOA 2EMSA 2BKRB 1GC6A 4AS1A 3H7SA 1PGAA 1E8XA 2L3ZA 2W9NA 3RT3B 3NUHB 1V9JA 2RD0A 5BMGA 4DBGA 4KIKA 1WGGA 2N9LA 2KHWB 1GB4A 3SD5A 1L5PA 2DNFA 3AU5A 3NVWA 4MSQB 4CO7A 1KF6B 2FCNA 1T6BX 4NPNA 2KTRA 1Z5SB 4NQLB 1TY2A 4KZ0A 2H88B 1YX6B 4WAFA 1T0QC 1RLFA 4IWPA 4G0NB 2N1WA 1C4CA 1BT0A 2QC8A 5JHAA 4A90A 1WJ4A 3Q3JA 3QIJA 4MM3B 1M4VA 4OZBA 3ZYYX 1KLVA 3KVFB 1IBXA 4MACA 3VAWA 2WXJA 1CJEA 3APFA 3R7QA 2WDQB 3SEBA 1H8CA 4AJWA 3Q8BA 3RNGC 1V80A 1MPEA 4GIVA 2L8JA 3PPAA 4C00A 2KFKA 1HTQA 3DVNV 1XD3B 1NI2A 2JRHA 4HDOA 4DHZE 2ZVNA 3UGBB 5L83A 3TJPA 1V8CA 4RF1A 3W5UB 3UQAA 4PT5A 5IO9A 5J2RA 4ANXA 3OAWA 4WH4A 1H4RA 4AOFA 1L2NA 2UWQA 3NVYA 1E10A 2LVQA 2MQJA 2KANA 2KX3A 3P1MA 2MJDA 2K22A 4GOCA 4IM3A 1I4XA 4W9IA 3A1QA 2JXTA 1F0ZA 2DZIA 4WQMA 1SJHD 1WRDB 4LJPB 2W82A 1C9FA 1YJ1A 1VZ6A 4WQOB 2WP9B 3NRZA 2PPHA 1J0GA 3GZNB 2LGXA 1AYFA 2CHWA 1UBIA 3AEFB 3DBSA 3DWGC 4WIPA 1LM8B 1LFDA 5JHBA 3TMPB 3U8ZA 3TL5A 4TQ1A 1IGDA 4YTNB 1D4BA 1V5TA 1C3TA 2ONQA 2RPVA 1WM2A 5JZEB 5DCNA 1FNUA 2IZVB 1JRPA 3QWZB 2K5PA 2IGDA 3PV1A 5DPSA 3V6EB 2KNBA 1P0RA 4HLEA 2GMIC 3P4PB 4FN2A 4X57B 3GP7A 1L7YA 3GE8C 2ICIA 2L05A 1OQRA 3NS1A 4MGIE 3RULA 1DOXA 2M56B 2WX0A 1QQRA 3AEBB 2QILA 4XX5A 2KJHB 3HK0A 5IN7A 3AEGB 2WXIA 3L0WB 2KK8A 4DXAB 2NR2A 1TS3A 1Z2MA 3HUIA 4KGRA 4L2YA 3J9CA 1RM6C 3QA8A 2XNAC 1HEZE 2I2YA 4ZRPA 4NJ6A 1V86A 3AE4B 3ALBA 4YWGG 2KFJA 3WANA 1N63A 3MP9A 2INPE 3N9YC 1XEEA 1E0ZA 3V60A 1MJDA 3NZ3A 3W2DA 4S17A 4ICUA 5FR6A 2KYWA 4GDKB 4I6LB 1Y8RC 2N0SB 1OEYA 2YEPF 1T0SC 1D6EC 2CHZA 1EF5A 4GLSC 3W5VB 1N61A 2NS5A 4S0RA 1CQVA 2ZVOA 4ZRKA 1SE9A
chains in the Genus database with same CATH topology
3OLMD 4FJVB 4WJOA 4MGYE 4YL8A 5KHQA 3ZKJC 2AWTA 2LGYA 2BWFA 3A4RA 3PZDA 3VTUA 3ZRCA 3HHMA 2KWUB 3W1YA 2KC2A 4IC7B 4E74A 4PS3A 1G6JA 2DZMA 2PE6B 1WJ6A 2L0FA 1WGYA 1NBFC 2A4ZA 4JLCA 4W9HA 1WYWB 1WZ0A 1UZXB 1WZ3A 1P9DU 2JPHA 2N9PC 4CHKA 2DX5B 4IM2A 4JIOU 2K8HA 3WALA 2M1MA 3AXCA 2NBVB 1OQYA 2DHZA 4W9EA 4DHJB 3W1SC 4EZLA 3CSFA 2MBQA 2CU1A 4BKSA 3NOBA 5E6NA 2KDIA 4W9DA 1KJTA 3U7DA 2BPSA 1Q0WB 1YD8U 2FIDA 2KTFA 3EC8A 4BKTA 2OOBB 1XT9B 2C60A 2K25A 3JW0X 1E8WA 1SGHA 2FUHB 2MLBA 3V61A 4G3XB 2KOXA 3R7RA 2XK5A 4HPLB 2KDEB 3VVWB 2KQSA 2MP2A 4KVGB 1GUAB 4HWIB 2V1YA 4PYUA 5JH5C 3APCA 3ZW3A 3ZDTA 1EO6A 1WI0A 3EFUA 2N9XA 3H7PB 4FULA 4FHJA 4W9FA 4TKNA 4BVUC 1ISNA 2AL3A 2Y5BB 2LGDA 4MSMB 3DOWA 3RZFA 4DHZB 2LJ5A 3N30A 1WXVA 4HK2A 2MWSB 1WY8A 4W9CA 2G4DB 3QCAA 1OTRB 1S1QB 2YVCA 3A33B 2GBJA 3SDLC 2KMCA 3A9KA 3TIXA 2IO2B 1WX7A 1U4AA 2M8SA 1WJUA 1S3SG 2DENB 3QQ8B 2Z0EB 2DYMA 4PYZA 4TQ0A 3X0WA 2LVOA 1WGRA 2N7EA 2R2OA 3CSTA 2K6QA 3A9JB 5D94A 3LDZE 2O6VA 1WE7A 3L54A 3OJ4B 4ASWC 4IWQA 3ZIMA 1WE6A 2QHOA 1J8CA 2FNJB 2N7DA 2ZPNA 3VHTC 3CF6E 4NY0A 4IG7B 4EUTA 2FCSA 3U30A 4E3CA 3ENEA 2M0XA 2MSED 4HXDA 1ZW7A 2YLMA 2KLCA 4F8CB 2VRRB 2KVRA 1I35A 3BY4B 3MJWA 3DBRI 4ANWA 5CX3A 2JWZA 2WWZA 1UGMA 4G11A 1ZKHA 2A5UA 3L13A 4RM9A 3VQIA 4NNJB 4B6WA 4JGHB 2LXAA 3DVGY 4ZRIA 4OVVA 4KSLC 3R3MA 1P98A 4II2B 4PS8A 4EOYA 2JZ3B 4FJYA 3PRPB 2KJ6A 2NBWB 2KWCA 4AUQC 1GJZA 4URKA 2G45B 3ONSA 1E8ZA 4GDLA 2DAFA 2XK5B 2L76A 1K8RB 2D2QA 3QJZA 2HTHA 2MP2B 3ML9A 4ICVA 3GOEA 3UIPB 3WA0A 1Q1OA 3M95A 3DDCB 3B1LX 1E5WA 5DPWA 4GN1A 2O2VB 2REXA 2ZPYA 5LXHA 3UQBA 2NPTA 1C1YB 3H7PA 3O65B 4HPMB 4FBJB 2ZEQA 3QHTA 3RYTA 3L08A 3ZDMC 4K7WA 2ZCBA 4FHKA 4KV2A 2JY6A 2BYFA 2K1FA 3OJ3A 2CR5A 4BBNC 5LLIA 3DCGA 2M17A 2JUOA 4GSWA 4BKSD 5AZGA 5BO4B 2DZKA 3DPDA 3X23A 2KMAA 4HVBA 2JXXA 4KIKB 4MH0E 2I1KA 2FCQA 2LZ6A 1RRBA 4GXBA 1P3QU 5DPTA 3AULA 1Q5WB 2K6DB 3A4SC 2O6VB 2R2QA 3A9JA 2HD5B 5TR5A 2IO0B 4K1RB 4MGKE 3IHPC 4XC2A 4GGQA 3KW5B 1CMXB 3RUIB 4BKGA 3NY5A 4RM8A 4DDGD 2DYBA 4WJPA 2KTRB 3IVFA 5D6JB 2BWES 2LXCA 1WMHA 4OVUA 4P7IA 3LJ3A 4KZCA 2PE9A 2N4FA 5HKHA 4ZDVA 3ZRFA 2RPQA 2B3AA 3WIMA 3JYUA 2KDBA 3DVGX 2J0JA 5IAAC 1I42A 3H9DA 4BBNF 2GBRA 2GBMA 1UH6A 2C5LC 2MBEA 4AWJA 3EHVA 3PLVA 3SHQA 4MEMA 2J0MA 2LD9A 4FJZA 1WXMA 4GDLB 2CHXA 4I6NB 1D3ZA 3K9PB 2LRWA 4MM3A 4NQKE 1FXTB 2LI5A 3ZNID 2MBOA 1GC7A 4W9KA 3QK0A 3ZNHB 2M4NA 2EKEC 2L0TA 1YIWA 2AEHA 3JSVB 2HE7A 2O2VA 2LVPA 2NPTB 3HM6X 4GU2A 3D32A 4RMAA 1V49A 3QAQA 2JT4B 4KDIC 4LJOB 5C1ZA 3WAMA 4FA6A 3DVNU 2HJ8A 3PHXB 4DHJD 2IO1B 5CTRC 1GG3A 2FCMA 2KX0A 2C9WB 1JRUA 2XBBC 2EMSA 2BKRB 2GOWA 1GC6A 3KUCB 1WF9A 3H7SA 4WWOA 2L3ZA 1E8XA 1XQQA 2W9NA 3DBLI 1TZ1A 2RR9A 3RT3B 4EKUA 1V9JA 2RD0A 4DBGA 4KIKA 4B9KA 1WGGA 3B08A 4JL9A 3PS6A 4WJQA 4FLHA 3ZTCA 4F1SA 2LWPA 2KHWB 5DPRA 2RSUA 1GNUA 5C23A 3SD5A 3KUDB 5IA7A 2KC1A 3AU5A 2G3QB 4LDTB 4MSQB 1WH3A 4CO7A 3VH4B 2FCNA 1WGHA 2XEWA 4NPNA 2KTRA 3T9LA 1WMHB 3WAPA 3V62A 1Z5SB 3ZNZB 4NQLB 3HM3A 3IBEA 2GBNA 2KN5A 2PJHA 4A3PA 4KZ0A 1YX6B 1WM3A 1EUVB 1RLFA 1WGDA 4PS7A 4IWPA 3ZUNA 2D11A 3WAOA 4G0NB 2MX2A 1WFYA 2N1WA 3H1UA 2JRIB 3DBHI 1WJNA 1BT0A 3VTVA 3KYDD 4A3OA 3MTNB 4M8NA 1P1AA 1V2YA 2KZRA 2N9EB 4MGZE 5G2NA 4DDID 4BFRA 5JHAA 4G50A 1WJ4A 2DAJA 1EF1A 2D10A 3Q3JA 3QIJA 3APDA 2I1JA 4KDLB 4ZYNA 1KLVA 1NDDA 1WX8A 3KVFB 2LRUA 3VAWA 3EECA 3L16A 1F9JA 4I6PA 3APFA 3BINA 3R7QA 3ZLZA 1ZGUB 2J0KA 4AJWA 3UINB 1WR1A 3IFWB 5AEKB 1H8CA 2N1VA 3JSVA 3PVLA 2BGFA 2KXJA 4FADA 2MRPA 3KUZA 2FIFA 4MJSA 1V80A 4NAWA 3DQVA 4WAAA 4GIVA 2L8JA 1V81A 3PPAA 2KDFB 4ZRJA 3ZNGC 1E90A 2KFKA 3JVZX 4B95A 3DVNV 1E8YA 2IYDB 2CS4A 3MHSD 4K81A 4AJYB 1XD3B 1NI2A 2JRHA 4HDOA 4IWOA 4DHZE 2ZVNA 3NZUA 3UGBB 3GZNI 5L83A 3TJPA 2AYOB 3UQAA 3PLUA 2EMTA 4WWPA 2DYOA 4DK5A 1QZEA 3ZO5B 5J2RA 1IPGA 4ANXA 3L10B 3TBLD 3ZTDA 3OAWA 1WXSA 1H4RA 3CMMB 4W9LA 2NBUA 4AOFA 3S2AA 2GBKA 1L2NA 2K8CA 2UWQA 5D2MB 4HCNB 2LVQA 2MQJA 2KANA 2KX3A 3PTFC 1VD2A 2V4LA 1IYFA 3K9OB 3VUYA 2ZNVB 4ANUA 2FAZA 4K7SA 3W1SA 4GOCA 4IM3A 2KKCA 4W9IA 3A1QA 2V3SA 2DZIA 3H6NA 1OGWA 4DWFA 1T0YA 4EZKA 1WX9A 3RD2A 1WRDB 4AP4C 2BYVE 3ZVVA 4LJPB 2MW5A 2MBBB 3V6CB 2D3GA 1YJ1A 4M8MA 3C0RB 2DZJA 4WQOB 4XZ4A 4BOZB 5J18A 1OEYJ 4W9GA 2AL6A 3M62B 5L95C 2PPHA 3Q3FA 1WIAA 1J0GA 4IUMB 2C7MB 2O6VD 3QC8B 2MCNB 3VH3B 2ASQA 2Z59B 2LGXA 4HCPB 3N32A 1LQBA 1PQSA 2CHWA 2IY1B 1UBIA 4EEWA 3DBSA 5GMVA 1LM8B 1LFDA 5JHBA 3TMPB 4MELA 4NJ7A 3U8ZA 3IG3A 3NZSA 2IBIB 1E7UA 3TL5A 3AI5A 4TQ1A 3B0AA 4J6IA 1J19A 4NAWB 4MJSB 2ZZPB 4K7UA 5LXIB 1AARA 1HE8A 1V5TA 2KWVB 2NVUI 4MDKE 1C3TA 2KFKB 4HDQA 3VUWA 1MG8A 3NS8A 5J17A 2CKHB 2LASA 4JQWC 1LXDA 2KLGA 3KYCD 2IY0B 1TGZB 1WM2A 3PREA 5JZEB 1KOTA 2PEAA 2LUEA 5DCNA 4TUUA 4IM0A 2IZVB 1V6EA 1UD7A 4GDKA 2NCNA 3QWZB 3VUXA 3ECIA 5DPSA 3PV1A 1IP9A 3P2BA 2JZZA 4LCDE 3V6EB 3SU8X 1RFAA 5E6PA 2KNBA 1P0RA 4HLEA 3M3JA 4II3B 1A5RA 4EZJA 3VDZA 2GMIC 4IW0A 1WXAA 3PGEA 4FN2A 4X57B 5AZFA 1M94A 1L7YA 1TBEA 2L05A 1KM7A 3A1QB 3RULA 4MGIE 1TTNA 2WDTB 3PRZA 2WX0A 4A20A 4XX5A 1X1MA 4WWNA 4GB9A 2MBHA 3VXWA 4EFOA 2KJHB 2ZCCA 3HK0A 5KHOA 2K8BA 4HJKA 3UF8A 3KH0A 2C7HA 3L0WB 3PT2B 1UBQA 5D7GA 3QARA 2KK8A 4GMVA 4CYEA 1RAXA 4DXAB 2NR2A 5CHWA 1Z2MA 4KSKC 1R4MI 3QX1A 3L17A 3R66C 1UELA 3QA8A 3PHWB 4LDTD 2G4SA 1YQBA 2WYQA 2IO3B 2OJRA 2WX1A 2MA9B 2ZNVC 2L7RA 3UIOB 4F7ZA 1V5OA 4TV3A 3VFKA 4W9JA 1R4NI 2Z0DB 1WR6E 4NJ6A 1V86A 2BF8B 5CHVC 3ALBA 4BOSC 2JVCA 4N9F4 4ANVA 1SIFA 2ZJDA 2KFJA 2BYEA 3N3KB 3WANA 4M0WB 2UYZB 2K39A 2RGFA 2L00B 3I3TB 3ML8A 4WJNA 3PRMB 3V60A 3TCAA 3RCZA 4ICUA 3VTWA 5FR6A 4GDKB 5AZHA 4I6LB 1Y8RC 5CHFA 3RZWC 3NHEB 5G55A 1OEYA 4E71A 2KQ7A 3AU4A 2J7QB 2KJRA 2CHZA 1EF5A 3A9KB 2KD0A 1E7VA 2KO3A 3HIZA 5E6OA 2NS5A 2BKFA 3PSEB 3T8MA 1VCBA 5EDSA 3M63B 2ZVOA 2C7NB 2JF5A 4ZRKA 1YX5B 1SE9A 2D07B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OLM D;  4FJV B;  4WJO A;  4MGY E;  4YL8 A;  5KHQ A;  3ZKJ C;  2AWT A;  2LGY A;  2BWF A;  3A4R A;  3PZD A;  3VTU A;  3ZRC A;  3HHM A;  2KWU B;  3W1Y A;  2KC2 A;  4IC7 B;  4E74 A;  4PS3 A;  1G6J A;  2DZM A;  2PE6 B;  1WJ6 A;  2L0F A;  1WGY A;  1NBF C;  2A4Z A;  4JLC A;  4W9H A;  1WYW B;  1WZ0 A;  1UZX B;  1WZ3 A;  1P9D U;  2JPH A;  2N9P C;  4CHK A;  2DX5 B;  4IM2 A;  4JIO U;  2K8H A;  3WAL A;  2M1M A;  3AXC A;  2NBV B;  1OQY A;  2DHZ A;  4W9E A;  4DHJ B;  3W1S C;  4EZL A;  3CSF A;  2MBQ A;  2CU1 A;  4BKS A;  3NOB A;  5E6N A;  2KDI A;  4W9D A;  1KJT A;  3U7D A;  2BPS A;  1Q0W B;  1YD8 U;  2FID A;  2KTF A;  3EC8 A;  4BKT A;  2OOB B;  1XT9 B;  2C60 A;  2K25 A;  3JW0 X;  1E8W A;  1SGH A;  2FUH B;  2MLB A;  3V61 A;  4G3X B;  2KOX A;  3R7R A;  2XK5 A;  4HPL B;  2KDE B;  3VVW B;  2KQS A;  2MP2 A;  4KVG B;  1GUA B;  4HWI B;  2V1Y A;  4PYU A;  5JH5 C;  3APC A;  3ZW3 A;  3ZDT A;  1EO6 A;  1WI0 A;  3EFU A;  2N9X A;  3H7P B;  4FUL A;  4FHJ A;  4W9F A;  4TKN A;  4BVU C;  1ISN A;  2AL3 A;  2Y5B B;  2LGD A;  4MSM B;  3DOW A;  3RZF A;  4DHZ B;  2LJ5 A;  3N30 A;  1WXV A;  4HK2 A;  2MWS B;  1WY8 A;  4W9C A;  2G4D B;  3QCA A;  1OTR B;  1S1Q B;  2YVC A;  3A33 B;  2GBJ A;  3SDL C;  2KMC A;  3A9K A;  3TIX A;  2IO2 B;  1WX7 A;  1U4A A;  2M8S A;  1WJU A;  1S3S G;  2DEN B;  3QQ8 B;  2Z0E B;  2DYM A;  4PYZ A;  4TQ0 A;  3X0W A;  2LVO A;  1WGR A;  2N7E A;  2R2O A;  3CST A;  2K6Q A;  3A9J B;  5D94 A;  3LDZ E;  2O6V A;  1WE7 A;  3L54 A;  3OJ4 B;  4ASW C;  4IWQ A;  3ZIM A;  1WE6 A;  2QHO A;  1J8C A;  2FNJ B;  2N7D A;  2ZPN A;  3VHT C;  3CF6 E;  4NY0 A;  4IG7 B;  4EUT A;  2FCS A;  3U30 A;  4E3C A;  3ENE A;  2M0X A;  2MSE D;  4HXD A;  1ZW7 A;  2YLM A;  2KLC A;  4F8C B;  2VRR B;  2KVR A;  1I35 A;  3BY4 B;  3MJW A;  3DBR I;  4ANW A;  5CX3 A;  2JWZ A;  2WWZ A;  1UGM A;  4G11 A;  1ZKH A;  2A5U A;  3L13 A;  4RM9 A;  3VQI A;  4NNJ B;  4B6W A;  4JGH B;  2LXA A;  3DVG Y;  4ZRI A;  4OVV A;  4KSL C;  3R3M A;  1P98 A;  4II2 B;  4PS8 A;  4EOY A;  2JZ3 B;  4FJY A;  3PRP B;  2KJ6 A;  2NBW B;  2KWC A;  4AUQ C;  1GJZ A;  4URK A;  2G45 B;  3ONS A;  1E8Z A;  4GDL A;  2DAF A;  2XK5 B;  2L76 A;  1K8R B;  2D2Q A;  3QJZ A;  2HTH A;  2MP2 B;  3ML9 A;  4ICV A;  3GOE A;  3UIP B;  3WA0 A;  1Q1O A;  3M95 A;  3DDC B;  3B1L X;  1E5W A;  5DPW A;  4GN1 A;  2O2V B;  2REX A;  2ZPY A;  5LXH A;  3UQB A;  2NPT A;  1C1Y B;  3H7P A;  3O65 B;  4HPM B;  4FBJ B;  2ZEQ A;  3QHT A;  3RYT A;  3L08 A;  3ZDM C;  4K7W A;  2ZCB A;  4FHK A;  4KV2 A;  2JY6 A;  2BYF A;  2K1F A;  3OJ3 A;  2CR5 A;  4BBN C;  5LLI A;  3DCG A;  2M17 A;  2JUO A;  4GSW A;  4BKS D;  5AZG A;  5BO4 B;  2DZK A;  3DPD A;  3X23 A;  2KMA A;  4HVB A;  2JXX A;  4KIK B;  4MH0 E;  2I1K A;  2FCQ A;  2LZ6 A;  1RRB A;  4GXB A;  1P3Q U;  5DPT A;  3AUL A;  1Q5W B;  2K6D B;  3A4S C;  2O6V B;  2R2Q A;  3A9J A;  2HD5 B;  5TR5 A;  2IO0 B;  4K1R B;  4MGK E;  3IHP C;  4XC2 A;  4GGQ A;  3KW5 B;  1CMX B;  3RUI B;  4BKG A;  3NY5 A;  4RM8 A;  4DDG D;  2DYB A;  4WJP A;  2KTR B;  3IVF A;  5D6J B;  2BWE S;  2LXC A;  1WMH A;  4OVU A;  4P7I A;  3LJ3 A;  4KZC A;  2PE9 A;  2N4F A;  5HKH A;  4ZDV A;  3ZRF A;  2RPQ A;  2B3A A;  3WIM A;  3JYU A;  2KDB A;  3DVG X;  2J0J A;  5IAA C;  1I42 A;  3H9D A;  4BBN F;  2GBR A;  2GBM A;  1UH6 A;  2C5L C;  2MBE A;  4AWJ A;  3EHV A;  3PLV A;  3SHQ A;  4MEM A;  2J0M A;  2LD9 A;  4FJZ A;  1WXM A;  4GDL B;  2CHX A;  4I6N B;  1D3Z A;  3K9P B;  2LRW A;  4MM3 A;  4NQK E;  1FXT B;  2LI5 A;  3ZNI D;  2MBO A;  1GC7 A;  4W9K A;  3QK0 A;  3ZNH B;  2M4N A;  2EKE C;  2L0T A;  1YIW A;  2AEH A;  3JSV B;  2HE7 A;  2O2V A;  2LVP A;  2NPT B;  3HM6 X;  4GU2 A;  3D32 A;  4RMA A;  1V49 A;  3QAQ A;  2JT4 B;  4KDI C;  4LJO B;  5C1Z A;  3WAM A;  4FA6 A;  3DVN U;  2HJ8 A;  3PHX B;  4DHJ D;  2IO1 B;  5CTR C;  1GG3 A;  2FCM A;  2KX0 A;  2C9W B;  1JRU A;  2XBB C;  2EMS A;  2BKR B;  2GOW A;  1GC6 A;  3KUC B;  1WF9 A;  3H7S A;  4WWO A;  2L3Z A;  1E8X A;  1XQQ A;  2W9N A;  3DBL I;  1TZ1 A;  2RR9 A;  3RT3 B;  4EKU A;  1V9J A;  2RD0 A;  4DBG A;  4KIK A;  4B9K A;  1WGG A;  3B08 A;  4JL9 A;  3PS6 A;  4WJQ A;  4FLH A;  3ZTC A;  4F1S A;  2LWP A;  2KHW B;  5DPR A;  2RSU A;  1GNU A;  5C23 A;  3SD5 A;  3KUD B;  5IA7 A;  2KC1 A;  3AU5 A;  2G3Q B;  4LDT B;  4MSQ B;  1WH3 A;  4CO7 A;  3VH4 B;  2FCN A;  1WGH A;  2XEW A;  4NPN A;  2KTR A;  3T9L A;  1WMH B;  3WAP A;  3V62 A;  1Z5S B;  3ZNZ B;  4NQL B;  3HM3 A;  3IBE A;  2GBN A;  2KN5 A;  2PJH A;  4A3P A;  4KZ0 A;  1YX6 B;  1WM3 A;  1EUV B;  1RLF A;  1WGD A;  4PS7 A;  4IWP A;  3ZUN A;  2D11 A;  3WAO A;  4G0N B;  2MX2 A;  1WFY A;  2N1W A;  3H1U A;  2JRI B;  3DBH I;  1WJN A;  1BT0 A;  3VTV A;  3KYD D;  4A3O A;  3MTN B;  4M8N A;  1P1A A;  1V2Y A;  2KZR A;  2N9E B;  4MGZ E;  5G2N A;  4DDI D;  4BFR A;  5JHA A;  4G50 A;  1WJ4 A;  2DAJ A;  1EF1 A;  2D10 A;  3Q3J A;  3QIJ A;  3APD A;  2I1J A;  4KDL B;  4ZYN A;  1KLV A;  1NDD A;  1WX8 A;  3KVF B;  2LRU A;  3VAW A;  3EEC A;  3L16 A;  1F9J A;  4I6P A;  3APF A;  3BIN A;  3R7Q A;  3ZLZ A;  1ZGU B;  2J0K A;  4AJW A;  3UIN B;  1WR1 A;  3IFW B;  5AEK B;  1H8C A;  2N1V A;  3JSV A;  3PVL A;  2BGF A;  2KXJ A;  4FAD A;  2MRP A;  3KUZ A;  2FIF A;  4MJS A;  1V80 A;  4NAW A;  3DQV A;  4WAA A;  4GIV A;  2L8J A;  1V81 A;  3PPA A;  2KDF B;  4ZRJ A;  3ZNG C;  1E90 A;  2KFK A;  3JVZ X;  4B95 A;  3DVN V;  1E8Y A;  2IYD B;  2CS4 A;  3MHS D;  4K81 A;  4AJY B;  1XD3 B;  1NI2 A;  2JRH A;  4HDO A;  4IWO A;  4DHZ E;  2ZVN A;  3NZU A;  3UGB B;  3GZN I;  5L83 A;  3TJP A;  2AYO B;  3UQA A;  3PLU A;  2EMT A;  4WWP A;  2DYO A;  4DK5 A;  1QZE A;  3ZO5 B;  5J2R A;  1IPG A;  4ANX A;  3L10 B;  3TBL D;  3ZTD A;  3OAW A;  1WXS A;  1H4R A;  3CMM B;  4W9L A;  2NBU A;  4AOF A;  3S2A A;  2GBK A;  1L2N A;  2K8C A;  2UWQ A;  5D2M B;  4HCN B;  2LVQ A;  2MQJ A;  2KAN A;  2KX3 A;  3PTF C;  1VD2 A;  2V4L A;  1IYF A;  3K9O B;  3VUY A;  2ZNV B;  4ANU A;  2FAZ A;  4K7S A;  3W1S A;  4GOC A;  4IM3 A;  2KKC A;  4W9I A;  3A1Q A;  2V3S A;  2DZI A;  3H6N A;  1OGW A;  4DWF A;  1T0Y A;  4EZK A;  1WX9 A;  3RD2 A;  1WRD B;  4AP4 C;  2BYV E;  3ZVV A;  4LJP B;  2MW5 A;  2MBB B;  3V6C B;  2D3G A;  1YJ1 A;  4M8M A;  3C0R B;  2DZJ A;  4WQO B;  4XZ4 A;  4BOZ B;  5J18 A;  1OEY J;  4W9G A;  2AL6 A;  3M62 B;  5L95 C;  2PPH A;  3Q3F A;  1WIA A;  1J0G A;  4IUM B;  2C7M B;  2O6V D;  3QC8 B;  2MCN B;  3VH3 B;  2ASQ A;  2Z59 B;  2LGX A;  4HCP B;  3N32 A;  1LQB A;  1PQS A;  2CHW A;  2IY1 B;  1UBI A;  4EEW A;  3DBS A;  5GMV A;  1LM8 B;  1LFD A;  5JHB A;  3TMP B;  4MEL A;  4NJ7 A;  3U8Z A;  3IG3 A;  3NZS A;  2IBI B;  1E7U A;  3TL5 A;  3AI5 A;  4TQ1 A;  3B0A A;  4J6I A;  1J19 A;  4NAW B;  4MJS B;  2ZZP B;  4K7U A;  5LXI B;  1AAR A;  1HE8 A;  1V5T A;  2KWV B;  2NVU I;  4MDK E;  1C3T A;  2KFK B;  4HDQ A;  3VUW A;  1MG8 A;  3NS8 A;  5J17 A;  2CKH B;  2LAS A;  4JQW C;  1LXD A;  2KLG A;  3KYC D;  2IY0 B;  1TGZ B;  1WM2 A;  3PRE A;  5JZE B;  1KOT A;  2PEA A;  2LUE A;  5DCN A;  4TUU A;  4IM0 A;  2IZV B;  1V6E A;  1UD7 A;  4GDK A;  2NCN A;  3QWZ B;  3VUX A;  3ECI A;  5DPS A;  3PV1 A;  1IP9 A;  3P2B A;  2JZZ A;  4LCD E;  3V6E B;  3SU8 X;  1RFA A;  5E6P A;  2KNB A;  1P0R A;  4HLE A;  3M3J A;  4II3 B;  1A5R A;  4EZJ A;  3VDZ A;  2GMI C;  4IW0 A;  1WXA A;  3PGE A;  4FN2 A;  4X57 B;  5AZF A;  1M94 A;  1L7Y A;  1TBE A;  2L05 A;  1KM7 A;  3A1Q B;  3RUL A;  4MGI E;  1TTN A;  2WDT B;  3PRZ A;  2WX0 A;  4A20 A;  4XX5 A;  1X1M A;  4WWN A;  4GB9 A;  2MBH A;  3VXW A;  4EFO A;  2KJH B;  2ZCC A;  3HK0 A;  5KHO A;  2K8B A;  4HJK A;  3UF8 A;  3KH0 A;  2C7H A;  3L0W B;  3PT2 B;  1UBQ A;  5D7G A;  3QAR A;  2KK8 A;  4GMV A;  4CYE A;  1RAX A;  4DXA B;  2NR2 A;  5CHW A;  1Z2M A;  4KSK C;  1R4M I;  3QX1 A;  3L17 A;  3R66 C;  1UEL A;  3QA8 A;  3PHW B;  4LDT D;  2G4S A;  1YQB A;  2WYQ A;  2IO3 B;  2OJR A;  2WX1 A;  2MA9 B;  2ZNV C;  2L7R A;  3UIO B;  4F7Z A;  1V5O A;  4TV3 A;  3VFK A;  4W9J A;  1R4N I;  2Z0D B;  1WR6 E;  4NJ6 A;  1V86 A;  2BF8 B;  5CHV C;  3ALB A;  4BOS C;  2JVC A;  4N9F 4;  4ANV A;  1SIF A;  2ZJD A;  2KFJ A;  2BYE A;  3N3K B;  3WAN A;  4M0W B;  2UYZ B;  2K39 A;  2RGF A;  2L00 B;  3I3T B;  3ML8 A;  4WJN A;  3PRM B;  3V60 A;  3TCA A;  3RCZ A;  4ICU A;  3VTW A;  5FR6 A;  4GDK B;  5AZH A;  4I6L B;  1Y8R C;  5CHF A;  3RZW C;  3NHE B;  5G55 A;  1OEY A;  4E71 A;  2KQ7 A;  3AU4 A;  2J7Q B;  2KJR A;  2CHZ A;  1EF5 A;  3A9K B;  2KD0 A;  1E7V A;  2KO3 A;  3HIZ A;  5E6O A;  2NS5 A;  2BKF A;  3PSE B;  3T8M A;  1VCB A;  5EDS A;  3M63 B;  2ZVO A;  2C7N B;  2JF5 A;  4ZRK A;  1YX5 B;  1SE9 A;  2D07 B; 
#chains in the Genus database with same CATH topology
 1RWS A;  2LJI A;  2IND C;  5KHQ A;  3ZKJ C;  2LGY A;  1FRD A;  2FBW B;  1G6J A;  2DZM A;  1PUT A;  2PE6 B;  1WJ6 A;  2L0F A;  2A4Z A;  1WYW B;  1WZ0 A;  3C8Y A;  1P9D U;  1AWD A;  3I63 C;  4CHK A;  4DXF A;  1R7S A;  2NBV B;  1OQY A;  4KKI A;  1QOB A;  2DHZ A;  4W9E A;  1RYJ A;  3U7D A;  2BPS A;  3FKY A;  3KQ4 A;  1Q0W B;  3BK2 A;  2KTF A;  4BKT A;  2OOB B;  1XT9 B;  3JW0 X;  3V61 A;  2MLB A;  4NJC A;  3BYT B;  5AUK A;  3VVW B;  4J3O D;  2IJ0 A;  1K52 A;  2MP2 A;  1GUA B;  4PYU A;  2CJO A;  3EFC A;  1YQ3 B;  1ZDX A;  4FUL A;  1FO4 A;  2K0P A;  3RPF C;  2LGD A;  3DOW A;  4DHZ B;  2BYT A;  2G4D B;  2YVC A;  3SDL C;  2KMC A;  2IO2 B;  2Z0E B;  1AW7 A;  2QDF A;  2DYM A;  4L23 A;  2WDR B;  2R2O A;  4LTU A;  3L54 A;  3OJ4 B;  4ASW C;  4IWQ A;  2QHO A;  2CJN A;  2ZPN A;  4OW0 A;  4E3C A;  2MSE D;  2YLM A;  2VRR B;  2KVR A;  1I35 A;  1UGM A;  1ZKH A;  4B6W A;  5D3I B;  3TEX A;  2JYT A;  2L32 A;  4ZRI A;  4OVV A;  3PRP B;  2KJ6 A;  2V9H A;  2G45 B;  1ZPS A;  4OHJ A;  1Q1O A;  3M95 A;  3DDC B;  3TUO A;  2GLS A;  5G5H A;  1E5W A;  3AE6 B;  5G5G A;  5DPW A;  2O2V B;  2KVZ A;  2ZPY A;  5LXH A;  3UI3 A;  2D5G A;  2KWD A;  1J7B A;  3QHT A;  3ZDM C;  2ZCB A;  4FHK A;  1N6Z A;  2GB1 A;  2JY6 A;  2K1F A;  1XLN A;  5IP4 D;  3O13 A;  5LLI A;  4GSW A;  5AZG A;  5BO4 B;  2DZK A;  1YN3 A;  2I1K A;  2LZ6 A;  1RRB A;  2JSV X;  4GXB A;  3AV8 A;  4WUR A;  5DPT A;  4C7Z A;  2R2Q A;  2W3R A;  2HD5 B;  2ON8 A;  2QIE B;  1K51 A;  3IHP C;  2UU7 A;  4C4V B;  3RNA C;  3KW5 B;  4BKG A;  4DDG D;  1TKG A;  3DHG C;  2DLB A;  4WJP A;  2WLB A;  3RFZ B;  5D6J B;  2LHE A;  4P7I A;  3ZRF A;  2D3B A;  4YTP B;  4BBN F;  1UH6 A;  2MBE A;  1JWM D;  4MEM A;  2BQQ A;  2J0M A;  1WXM A;  2CHX A;  1DYQ A;  2MHJ A;  1GC7 A;  3RN9 C;  4W9K A;  1VDV A;  3QK0 A;  2GI9 A;  2M4N A;  2VZK B;  1TJE A;  2AEH A;  2O2V A;  2NPT B;  4RMA A;  1V49 A;  3QAQ A;  4RGN A;  3WAM A;  1I4P A;  3AEC B;  3PHX B;  4DHJ D;  1GG3 A;  2FCM A;  3VUW A;  3KUC B;  1WF9 A;  3AE5 B;  3IAS 1;  4YT0 B;  4JL9 A;  3Q14 C;  2LWP A;  4EE2 A;  2RSU A;  1GNU A;  4C4V A;  2KC1 A;  3TEZ A;  2G3Q B;  4LDT B;  1WWT A;  3OG5 A;  1WMH B;  1YJJ A;  4ARC A;  1V1P B;  3HM3 A;  4A8X C;  2KN5 A;  3LXF A;  1FFV A;  1WM3 A;  1EUV B;  2HDE A;  4YSZ B;  3DWM A;  3WAO A;  1L4D B;  1WFY A;  3DBL B;  3H1U A;  4A3O A;  1I4R A;  3KYD D;  1P1A A;  1V2Y A;  1PFD A;  4DDI D;  1MHH E;  5G2N A;  4BFR A;  2Y5C A;  2AQ3 B;  2DAJ A;  2D10 A;  3W9C B;  1F9J A;  1T3Q A;  2J0K A;  3Q3O C;  5AEK B;  2KAC A;  1SXT A;  1B1Z A;  3MC9 A;  3KUZ A;  3EA6 A;  3ZNG C;  1E90 A;  1JW9 D;  4D2K A;  3BII D;  4C7Y A;  2IYD B;  4HRO A;  4AJY B;  4ZHP A;  4B0E A;  3SFD B;  3AEE B;  3GZN I;  1EWY C;  1ET9 A;  4WWP A;  1FMA D;  3CMM B;  4NAM A;  3PZ8 A;  2NBU A;  3MC0 B;  3S2A A;  1R4M B;  5D2M B;  4LNO A;  1FPY A;  2WXN A;  3PTF C;  2SAK A;  1IYF A;  2ZNV B;  2FAZ A;  3W1S A;  1PGX A;  3IT6 B;  4HKQ A;  2V3S A;  1OGW A;  4EZK A;  3HRD D;  3Q8C A;  2BYV E;  1JAL A;  3ZVV A;  2MW5 A;  4JX1 C;  3C0R B;  2DZJ A;  4CQN A;  5J18 A;  1UWX A;  3M62 B;  5HHD G;  3Q3F A;  1WIA A;  4OVZ A;  4IUM B;  5BYR A;  2C7M B;  2O6V D;  3QC8 B;  3NVV A;  2MCN B;  4NZL B;  4HCP B;  1TYG B;  1IBX B;  5GMV A;  5EE0 A;  1RFK A;  3R2I A;  4J6I A;  3P4S B;  1AAR A;  2NVU I;  2KFK B;  1MG8 A;  2OHF A;  2L83 A;  2CKH B;  2LAS A;  2IY0 B;  3PRE A;  4Q2J A;  4TUU A;  4RGM A;  4IM0 A;  1LGR A;  3Q6B A;  3Q8F A;  3NG0 A;  1V6E A;  1UD7 A;  4US8 A;  3N20 C;  1SF0 A;  4ZOH C;  3RNE C;  2NTT A;  1SB3 C;  2JYE A;  3PO0 A;  4EZJ A;  3P4Q B;  5AZF A;  2J4X A;  3A1Q B;  1TTN A;  2IGH A;  4WWN A;  3VXW A;  3UF8 A;  1L4Z B;  3KH0 A;  4XGA B;  4R3D A;  1UBQ A;  4GMV A;  4CYE A;  1FCC C;  1RAX A;  2PVO D;  5CHW A;  5TSS A;  1UEL A;  1SJE D;  1YQB A;  2BB5 A;  2BVC A;  2WX1 A;  5H92 C;  2ZNV C;  3UIO B;  4TV3 A;  3VFK A;  2JVC A;  3AN1 A;  2FUG 1;  3IAM 1;  1J7A A;  1FM0 D;  2ZJD A;  2AQ2 B;  4M0W B;  2K39 A;  1VRA B;  1I4Q A;  1TS5 A;  3WCQ A;  3PRM B;  3NVZ A;  2WXO A;  2LGI A;  3VR8 B;  3VRA B;  1WRI A;  2PIA A;  2JWU A;  5CHF A;  4LNN A;  3RZW C;  2BW2 A;  1IUE A;  2J7Q B;  2RDG A;  3HIZ A;  5E6O A;  1FD6 A;  4UDU C;  3T8M A;  1R4N B;  3GB1 A;  2JF5 A;  1YX5 B;  3VTU A;  1FXI A;  4ZYS A;  1HTO A;  4YL8 A;  1TKE A;  3ZRC A;  3SR6 A;  3N1X C;  2KWU B;  4IC7 B;  3T3N A;  4RH6 A;  1SIJ A;  1QKZ A;  3C19 A;  1NBF C;  2N9P C;  3WAL A;  2M1M A;  1FEH A;  1UWM A;  3CSF A;  2CU1 A;  3NOB A;  2KDI A;  4L1B A;  2FID A;  3EC8 A;  2NMQ A;  1XCT L;  2PMV A;  2K25 A;  1E8W A;  1SGH A;  2FUH B;  2WHI A;  2RDH A;  4M0W A;  3R2T A;  2V1Y A;  3ZW3 A;  1WI0 A;  3EFU A;  2N9X A;  4US9 A;  2IDY A;  4MSM B;  3RZF A;  4FXC A;  1WXV A;  1WY8 A;  2KT7 A;  4W9C A;  3Q2A C;  3A33 B;  4LNF A;  1U4A A;  2M8S A;  1WJU A;  1S3S G;  2DEN B;  3B9J A;  3QQ8 B;  2CU3 A;  4PYZ A;  1LO5 D;  1WGR A;  2N7E A;  2K6Q A;  3A9J B;  5C3J B;  1VJK A;  3Q3N C;  2O6V A;  1EU4 A;  3ZGZ A;  1J8C A;  3CF6 E;  4NY0 A;  3ENE A;  2M0X A;  1UF0 A;  1NEN B;  1I4H A;  2KLC A;  5EE9 A;  4F8C B;  2WWZ A;  4RM9 A;  1PYW D;  3L13 A;  2I38 A;  2W55 A;  5MPO A;  2LXA A;  4K3B A;  4KSL C;  1PGB A;  1P98 A;  2KN4 A;  4A9A A;  4EOY A;  2JZ3 B;  3AM9 A;  2KWC A;  1GJZ A;  4URK A;  4YSX B;  2L1A A;  1SSN A;  4GDL A;  2KAJ A;  2L76 A;  2PTL A;  1YNT E;  2HTH A;  3Q69 A;  2MP2 B;  2RDB C;  3ML9 A;  4ICV A;  3UIP B;  2G1E A;  1C1Y B;  4HPM B;  4FBJ B;  3L08 A;  4USA A;  4KV2 A;  4IDI A;  2PVG C;  3OJ3 A;  2CR5 A;  3DCG A;  1TS4 A;  4BKS D;  2D3C A;  3DPD A;  4HVB A;  2JXX A;  1QIL A;  2IGG A;  2V3N A;  1XF5 L;  2K6D B;  3A4S C;  3A9J A;  1SEB D;  5TR5 A;  4K1R B;  1JCK B;  4XC2 A;  1CMX B;  4KX6 B;  3RUI B;  3NY5 A;  3IXS A;  2DYB A;  2BWE S;  2LXC A;  4OVU A;  3LJ3 A;  1JWU D;  2N4F A;  5HKH A;  4ZDV A;  2B3A A;  3WIM A;  2KDB A;  3H9D A;  2GBR A;  2GBM A;  3P63 A;  1CZP A;  1T0R C;  3Q8A A;  2J53 A;  2V0G A;  1D3Z A;  4FJZ A;  3MHZ A;  2LI5 A;  2JZP A;  3ZXV A;  3URY A;  3ZQ4 A;  3V05 A;  3ZNH B;  5BMH A;  1F2R I;  4RNA A;  3JSV B;  2HE7 A;  3HM6 X;  2LVP A;  1L0Y B;  2V4I B;  3B2F A;  4FA6 A;  3DVN U;  3MJ5 A;  1JRU A;  2GOW A;  3DBL I;  1XQQ A;  1TZ1 A;  3DHH C;  4EKU A;  3EUB 2;  1EM7 A;  3B08 A;  3PS6 A;  4WJQ A;  4FLH A;  3ZTC A;  3P42 A;  2BTE A;  4RFB A;  3KUD B;  1MI0 A;  5BMI A;  1WGH A;  3RI7 C;  3T9L A;  3WAP A;  2PJH A;  1IGC A;  2LHD A;  1WGD A;  2MX2 A;  5BYS A;  2JRI B;  1WJN A;  2V3P A;  4MGZ E;  2N9E B;  1SE2 A;  2I1J A;  1CK1 A;  1N60 A;  1QOG A;  3L16 A;  3ZLZ A;  3IFW B;  1JWB D;  1C77 A;  3JSV A;  3PVL A;  4FAD A;  4NAW A;  2FIF A;  4MJS A;  4XWT A;  2KDF B;  4ZRJ A;  1E8Y A;  3R8B A;  2CS4 A;  4K81 A;  3FC4 A;  4IWO A;  4YSY B;  2AYO B;  3PLU A;  2EMT A;  4DQO C;  4DK5 A;  4AQ7 A;  3VRB B;  3DBH B;  1ZXI A;  1WXS A;  4K3C A;  2EKI A;  2K8C A;  1JWA D;  2YEP B;  3B2G A;  1E6E B;  1YN4 A;  1HA5 A;  3VUY A;  3H6N A;  2PW9 A;  4B0M A;  3V6C B;  4M8M A;  4XZ4 A;  2JQR B;  4BOZ B;  1OEY J;  2ASQ A;  2Z59 B;  1PQS A;  3I9V 1;  4EEW A;  1QT9 A;  3AH7 A;  4MEL A;  3IG3 A;  2IBI B;  1E7U A;  2WXG A;  4IOI E;  3AI5 A;  1UGJ A;  1EU3 A;  3B0A A;  4P1C C;  3DHI C;  2ZZP B;  4A6Q A;  1HQR D;  2KWV B;  4MDK E;  4C80 A;  4HDQ A;  4QAY A;  5J17 A;  1NYR A;  4JQW C;  2KLG A;  4REZ A;  3U7Z A;  1TGZ B;  4M00 A;  2QSD A;  3LYY A;  1L0X B;  3ECI A;  1IP9 A;  2WGS A;  1RFA A;  5E6P A;  2MJ3 A;  3M3J A;  1A5R A;  1GPX A;  3VDZ A;  4IW0 A;  4WWM A;  1ZE3 D;  1M94 A;  1TBE A;  1F52 A;  3PRZ A;  2PLP A;  3HVD A;  4LK0 M;  5KHO A;  4HJK A;  2WU2 B;  5D7G A;  4ACF A;  3QAR A;  2BS4 B;  1KLG D;  1FXA A;  3L17 A;  3R66 C;  3PHW B;  2WYQ A;  3AE8 B;  2IO3 B;  2MA9 B;  1NI3 A;  1E7P B;  4F7Z A;  2H89 B;  4OZC A;  4W9J A;  1R4N I;  2Z0D B;  2QMT A;  4N9F 4;  3CWI A;  1A70 A;  2BYE A;  2J52 A;  1YQ4 B;  2RGF A;  3I3T B;  1SE4 A;  3TCA A;  1TKY A;  5IKC M;  5AZH A;  5IOI A;  2X8X X;  3U52 E;  4M01 A;  4ZRQ A;  5G55 A;  2BBC A;  1D5X C;  1N5X A;  2KQ7 A;  1ZXH A;  2KJR A;  2WXK A;  3IT4 B;  2KD0 A;  1E7V A;  4LNI A;  5EDS A;  1VCB A;  1KH0 A;  5FK9 C;  2E6X A;  2NTS A;  4G50 A;  2D07 B;  1QOA A;  2AWT A;  3PZD A;  2BWF A;  3A4R A;  3AED B;  4RF0 A;  2AQ1 B;  2KC2 A;  4PS3 A;  1WGY A;  4W9H A;  3PZ7 A;  3T3O A;  4P1B C;  2KDM A;  4JIO U;  4DHJ B;  3W1S C;  5FKA C;  4EZL A;  1WSP A;  5E6N A;  2KMM A;  3HVZ A;  4P6V F;  1B9R A;  4W9D A;  1KJT A;  1YMH E;  1BUI C;  2C60 A;  4P16 A;  3AE2 B;  4G3X B;  2KOX A;  3R7R A;  2XK5 A;  4HPL B;  2ZW1 A;  4N59 A;  1K53 A;  2KQS A;  3RNB C;  5JH5 C;  2ZW0 A;  3APC A;  3ZDT A;  1EO6 A;  3H7P B;  1JML A;  3ABV B;  4FHJ A;  4TKN A;  1ISN A;  2Y5B B;  3OWE B;  1WGK A;  3N30 A;  4HK2 A;  1UUP A;  1OTR B;  1S1Q B;  3LB8 C;  1XO3 A;  2GBJ A;  2W3S A;  2PKO A;  2TSS A;  4TQ0 A;  3CST A;  5D94 A;  3P4R B;  3LDZ E;  1ACC A;  3ZJT A;  1V97 A;  1WE7 A;  3ZIM A;  1P7E A;  2FNJ B;  2N7D A;  1C4P A;  3VHT C;  2FCS A;  3U30 A;  2Z8L A;  1ZW7 A;  5HI1 A;  3BVM A;  5EE3 A;  3BYY B;  4ANW A;  5CX3 A;  2JWZ A;  1YJI A;  2A5U A;  4JGH B;  4N58 A;  3R3M A;  1FFU A;  4II2 B;  1VR9 A;  4PS8 A;  4FJY A;  1I7H A;  1L6V A;  5E6J A;  3ONS A;  1E8Z A;  1JQ4 A;  1FRR A;  2WS3 B;  1WXQ A;  4M02 A;  1ROE A;  2RMM A;  1ZOY B;  3RNF C;  5JXV A;  3WA0 A;  2REX A;  3TSS A;  3UQB A;  3BK1 A;  1D5M C;  4ARI A;  3H7P A;  5HFY A;  2BT6 A;  1ENF A;  3DBR B;  3BZD B;  4BBN C;  2JUO A;  2AX5 A;  2K3U A;  1ZP0 B;  3X23 A;  3BWU D;  1GAQ B;  1ZDV A;  1C4A A;  2O6V B;  3RNC C;  2WXP A;  4MGK E;  4LNK A;  2WXM A;  4GGQ A;  2EEL A;  4RM8 A;  1NVI D;  3IVF A;  2MJE A;  4KZC A;  2PE9 A;  1I4G A;  1ESF A;  3AE1 B;  3KWV A;  3JYU A;  5IAA C;  3DVG X;  2J0J A;  1ZUD 2;  2C5L C;  2X38 A;  1DOY A;  1QF6 A;  1FCL A;  1MHX A;  4GDL B;  5H8Y E;  3AE7 B;  1F77 A;  3K9P B;  2LRW A;  4MM3 A;  4NQK E;  1FXT B;  4HJG E;  5FR3 A;  4YXD B;  3AEA B;  1C79 A;  3ZNI D;  2MBO A;  1YN5 A;  3BVZ A;  1JRO A;  2L0T A;  1XLQ A;  4KDI C;  1FNW A;  2JT4 B;  3AMZ A;  3N1Z C;  4JWS C;  2HJ8 A;  4XYC A;  2IO1 B;  3E56 A;  5CTR C;  2C9W B;  2BB6 A;  3U4E G;  2RR9 A;  2QEJ C;  4B9K A;  1KLU D;  2WXH A;  4F1S A;  4YTM B;  2ACZ B;  2DBY A;  5DPR A;  2WXF A;  5C23 A;  5IA7 A;  1ET6 A;  4XDD A;  1WH3 A;  3VH4 B;  2XEW A;  3V62 A;  3ZNZ B;  3IBE A;  2GBN A;  3AB5 A;  4A3P A;  2FE8 A;  1HZ5 A;  1DGJ A;  2B76 B;  4PS7 A;  3ZUN A;  2D11 A;  1SBB B;  3DBH I;  3VTV A;  3MTN B;  4M8N A;  2KZR A;  1EF1 A;  3APD A;  4KDL B;  4ZYN A;  1NDD A;  1WX8 A;  2M19 A;  2LRU A;  3SFE B;  4DXG A;  3EEC A;  4I6P A;  3BIN A;  2INC C;  1ZGU B;  3UIN B;  1WR1 A;  2N1V A;  2BGF A;  2KXJ A;  4HKZ E;  2MRP A;  4WAA A;  3DQV A;  1V81 A;  3JVZ X;  4B95 A;  2BS2 B;  4ITK A;  3MHS D;  3N1Y C;  3NZU A;  4TMA B;  2DYO A;  2LGS A;  1N5W A;  1QZE A;  3U2S C;  3ZO5 B;  1IPG A;  3L10 B;  3TBL D;  1KRH A;  3ZTD A;  1C76 A;  2MH7 A;  4W9L A;  2GBK A;  4HCN B;  1VD2 A;  2V4L A;  5AUI A;  2DWQ A;  3K9O B;  1YOV B;  4ANU A;  4K7S A;  1VZ7 A;  2KQ4 X;  2KKC A;  4HEA 1;  4DWF A;  1T0Y A;  1WX9 A;  3RD2 A;  4AP4 C;  2MBB B;  4ZHO A;  2D3G A;  4O1N A;  2LFI A;  4W9G A;  4BAX A;  4XWW A;  2AL6 A;  5L95 C;  3TEY A;  1V1O A;  4MH8 A;  3V3X A;  3VH3 B;  4XDC A;  3N32 A;  1LQB A;  2IY1 B;  1XLO A;  4HRS A;  4TSS A;  1VZ8 A;  1L0V B;  2Y5P A;  4NJ7 A;  3NZS A;  3AE9 B;  2IPK D;  4KGT A;  4BZA A;  4JWU C;  1J19 A;  1Y56 A;  4NAW B;  4MJS B;  4K7U A;  2QJL A;  5EE1 A;  5LXI B;  1HE8 A;  5C2T B;  3NS8 A;  3CIR B;  4JE3 B;  4XE0 A;  4RCO A;  1LXD A;  3KYC D;  3FAH A;  2Y3A A;  1KOT A;  2PEA A;  2LUE A;  1BML C;  1XCQ L;  2N7J A;  4GDK A;  2NCN A;  3GE3 C;  3VUX A;  3P2B A;  2JZZ A;  4LCD E;  3SU8 X;  4II3 B;  4H2A A;  2VZK D;  3ZJU A;  1WXA A;  3PGE A;  1T5X D;  1GOZ A;  4A55 A;  1KM7 A;  2LUM A;  2WDT B;  1XLP A;  1E9M A;  4A20 A;  1MVK A;  1X1M A;  4GB9 A;  2MBH A;  1MFW A;  4N6E B;  4EFO A;  2ZCC A;  1L6U A;  1TS2 A;  2K8B A;  3FIL B;  2C7H A;  2WXQ A;  3PT2 B;  3TEW A;  1QLB B;  1JWS D;  4KSK C;  1R4M I;  3QX1 A;  2L52 A;  2OJW A;  4LDT D;  2G4S A;  1TZO A;  3I57 A;  2WXL A;  2OJR A;  1MG4 A;  2L7R A;  1V5O A;  1WR6 E;  2BF8 B;  5CHV C;  4BOS C;  4OZA A;  4ANV A;  1SIF A;  1WYG A;  3N3K B;  2UYZ B;  3ZXR A;  3Q8E A;  1D5Z C;  2L00 B;  3ML8 A;  4WJN A;  3RCZ A;  1HZ6 A;  3VTW A;  3I5J C;  3NHE B;  2WNM A;  1J7C A;  4E71 A;  3KWL A;  3AU4 A;  3A9K B;  2KO3 A;  2HTM E;  2BKF A;  3PSE B;  2K9X A;  3M63 B;  2C7N B;  5I4D A;  3OLM D;  3VR9 B;  4FJV B;  4WJO A;  4MGY E;  1XXG A;  2LEK A;  3HHM A;  3FIL A;  1FNV A;  3W1Y A;  4E74 A;  2VH2 A;  1PDX A;  1OFF A;  4JLC A;  2J42 A;  1UZX B;  1WZ3 A;  2JPH A;  3ZJV A;  3NJT A;  2DX5 B;  4IM2 A;  2LMC A;  2K8H A;  3AXC A;  2MBQ A;  5GXG B;  1KFY B;  1TT5 B;  4BKS A;  1P7F A;  1N62 A;  1DOI A;  1YD8 U;  3Q3M C;  1K50 A;  1TY0 A;  2KDE B;  2INN E;  2JU6 X;  2Q5W D;  4KVG B;  4HWI B;  3MC8 A;  4W9F A;  4BVU C;  5HG2 A;  2AL3 A;  2E3T A;  1Q10 A;  1GB1 A;  2LJ5 A;  2MWS B;  1UNS A;  2BS3 B;  3QCA A;  4C56 C;  2WQY B;  4PK1 A;  1NYQ A;  3A9K A;  3TIX A;  1WX7 A;  1FIQ A;  4KKJ A;  3X0W A;  2LVO A;  4IKG A;  1HXY D;  2VH1 A;  1WE6 A;  1OQQ A;  4IG7 B;  4EUT A;  1QOF A;  4HXD A;  4LLG M;  2QCZ A;  1BXT A;  3BY4 B;  3MJW A;  2D3A A;  3DBR I;  4G11 A;  3VQI A;  5D3D A;  2N9K A;  2M0A A;  4NNJ B;  3DVG Y;  2JX5 A;  4JPS A;  2NBW B;  3E9S A;  4AUQ C;  4KGS A;  4RGT A;  2DAF A;  2XK5 B;  1F1H A;  1SE3 A;  2R61 A;  5BYQ A;  1NEK B;  1K8R B;  2D2Q A;  1C78 A;  3ETR A;  3QJZ A;  3RMK C;  3GOE A;  4RGO S;  2GRI A;  3AE3 B;  3B1L X;  4GN1 A;  2NPT A;  3O65 B;  2WU5 B;  2ZEQ A;  3RYT A;  4K7W A;  2BYF A;  2M17 A;  2W54 A;  2KMA A;  3H8H A;  4KIK B;  4MH0 E;  2FCQ A;  1P3Q U;  5LNK 1;  3AUL A;  1Q5W B;  2WXR A;  1EWC A;  2IO0 B;  2HJ1 A;  2WDV B;  2SEB D;  2G9H D;  4HPP A;  3KLS X;  4MT5 A;  2OED A;  2KTR B;  1WMH A;  1V1P A;  3EGR A;  1VLB A;  2XN9 C;  2RPQ A;  3L4P A;  1I42 A;  4AWJ A;  1KTK A;  3EHV A;  3PLV A;  3SHQ A;  2LD9 A;  4I6N B;  2EKE C;  1F2R C;  2MEK A;  1AN8 A;  1YIW A;  4GU2 A;  3BVG A;  3D32 A;  1TIF A;  4LJO B;  5T8I A;  1STE A;  5C1Z A;  3MFG A;  3GS2 A;  2XBB C;  2KX0 A;  4WWO A;  2EMS A;  2BKR B;  1GC6 A;  4AS1 A;  3H7S A;  1PGA A;  1E8X A;  2L3Z A;  2W9N A;  3RT3 B;  3NUH B;  1V9J A;  2RD0 A;  5BMG A;  4DBG A;  4KIK A;  1WGG A;  2N9L A;  2KHW B;  1GB4 A;  3SD5 A;  1L5P A;  2DNF A;  3AU5 A;  3NVW A;  4MSQ B;  4CO7 A;  1KF6 B;  2FCN A;  1T6B X;  4NPN A;  2KTR A;  1Z5S B;  4NQL B;  1TY2 A;  4KZ0 A;  2H88 B;  1YX6 B;  4WAF A;  1T0Q C;  1RLF A;  4IWP A;  4G0N B;  2N1W A;  1C4C A;  1BT0 A;  2QC8 A;  5JHA A;  4A90 A;  1WJ4 A;  3Q3J A;  3QIJ A;  4MM3 B;  1M4V A;  4OZB A;  3ZYY X;  1KLV A;  3KVF B;  1IBX A;  4MAC A;  3VAW A;  2WXJ A;  1CJE A;  3APF A;  3R7Q A;  2WDQ B;  3SEB A;  1H8C A;  4AJW A;  3Q8B A;  3RNG C;  1V80 A;  1MPE A;  4GIV A;  2L8J A;  3PPA A;  4C00 A;  2KFK A;  1HTQ A;  3DVN V;  1XD3 B;  1NI2 A;  2JRH A;  4HDO A;  4DHZ E;  2ZVN A;  3UGB B;  5L83 A;  3TJP A;  1V8C A;  4RF1 A;  3W5U B;  3UQA A;  4PT5 A;  5IO9 A;  5J2R A;  4ANX A;  3OAW A;  4WH4 A;  1H4R A;  4AOF A;  1L2N A;  2UWQ A;  3NVY A;  1E10 A;  2LVQ A;  2MQJ A;  2KAN A;  2KX3 A;  3P1M A;  2MJD A;  2K22 A;  4GOC A;  4IM3 A;  1I4X A;  4W9I A;  3A1Q A;  2JXT A;  1F0Z A;  2DZI A;  4WQM A;  1SJH D;  1WRD B;  4LJP B;  2W82 A;  1C9F A;  1YJ1 A;  1VZ6 A;  4WQO B;  2WP9 B;  3NRZ A;  2PPH A;  1J0G A;  3GZN B;  2LGX A;  1AYF A;  2CHW A;  1UBI A;  3AEF B;  3DBS A;  3DWG C;  4WIP A;  1LM8 B;  1LFD A;  5JHB A;  3TMP B;  3U8Z A;  3TL5 A;  4TQ1 A;  1IGD A;  4YTN B;  1D4B A;  1V5T A;  1C3T A;  2ONQ A;  2RPV A;  1WM2 A;  5JZE B;  5DCN A;  1FNU A;  2IZV B;  1JRP A;  3QWZ B;  2K5P A;  2IGD A;  3PV1 A;  5DPS A;  3V6E B;  2KNB A;  1P0R A;  4HLE A;  2GMI C;  3P4P B;  4FN2 A;  4X57 B;  3GP7 A;  1L7Y A;  3GE8 C;  2ICI A;  2L05 A;  1OQR A;  3NS1 A;  4MGI E;  3RUL A;  1DOX A;  2M56 B;  2WX0 A;  1QQR A;  3AEB B;  2QIL A;  4XX5 A;  2KJH B;  3HK0 A;  5IN7 A;  3AEG B;  2WXI A;  3L0W B;  2KK8 A;  4DXA B;  2NR2 A;  1TS3 A;  1Z2M A;  3HUI A;  4KGR A;  4L2Y A;  3J9C A;  1RM6 C;  3QA8 A;  2XNA C;  1HEZ E;  2I2Y A;  4ZRP A;  4NJ6 A;  1V86 A;  3AE4 B;  3ALB A;  4YWG G;  2KFJ A;  3WAN A;  1N63 A;  3MP9 A;  2INP E;  3N9Y C;  1XEE A;  1E0Z A;  3V60 A;  1MJD A;  3NZ3 A;  3W2D A;  4S17 A;  4ICU A;  5FR6 A;  2KYW A;  4GDK B;  4I6L B;  1Y8R C;  2N0S B;  1OEY A;  2YEP F;  1T0S C;  1D6E C;  2CHZ A;  1EF5 A;  4GLS C;  3W5V B;  1N61 A;  2NS5 A;  4S0R A;  1CQV A;  2ZVO A;  4ZRK A;  1SE9 A; 
#chains in the Genus database with same CATH homology
 3OLM D;  4FJV B;  4WJO A;  4MGY E;  4YL8 A;  5KHQ A;  3ZKJ C;  2AWT A;  2LGY A;  2BWF A;  3A4R A;  3PZD A;  3VTU A;  3ZRC A;  3HHM A;  2KWU B;  3W1Y A;  2KC2 A;  4IC7 B;  4E74 A;  4PS3 A;  1G6J A;  2DZM A;  2PE6 B;  1WJ6 A;  2L0F A;  1WGY A;  1NBF C;  2A4Z A;  4JLC A;  4W9H A;  1WYW B;  1WZ0 A;  1UZX B;  1WZ3 A;  1P9D U;  2JPH A;  2N9P C;  4CHK A;  2DX5 B;  4IM2 A;  4JIO U;  2K8H A;  3WAL A;  2M1M A;  3AXC A;  2NBV B;  1OQY A;  2DHZ A;  4W9E A;  4DHJ B;  3W1S C;  4EZL A;  3CSF A;  2MBQ A;  2CU1 A;  4BKS A;  3NOB A;  5E6N A;  2KDI A;  4W9D A;  1KJT A;  3U7D A;  2BPS A;  1Q0W B;  1YD8 U;  2FID A;  2KTF A;  3EC8 A;  4BKT A;  2OOB B;  1XT9 B;  2C60 A;  2K25 A;  3JW0 X;  1E8W A;  1SGH A;  2FUH B;  2MLB A;  3V61 A;  4G3X B;  2KOX A;  3R7R A;  2XK5 A;  4HPL B;  2KDE B;  3VVW B;  2KQS A;  2MP2 A;  4KVG B;  1GUA B;  4HWI B;  2V1Y A;  4PYU A;  5JH5 C;  3APC A;  3ZW3 A;  3ZDT A;  1EO6 A;  1WI0 A;  3EFU A;  2N9X A;  3H7P B;  4FUL A;  4FHJ A;  4W9F A;  4TKN A;  4BVU C;  1ISN A;  2AL3 A;  2Y5B B;  2LGD A;  4MSM B;  3DOW A;  3RZF A;  4DHZ B;  2LJ5 A;  3N30 A;  1WXV A;  4HK2 A;  2MWS B;  1WY8 A;  4W9C A;  2G4D B;  3QCA A;  1OTR B;  1S1Q B;  2YVC A;  3A33 B;  2GBJ A;  3SDL C;  2KMC A;  3A9K A;  3TIX A;  2IO2 B;  1WX7 A;  1U4A A;  2M8S A;  1WJU A;  1S3S G;  2DEN B;  3QQ8 B;  2Z0E B;  2DYM A;  4PYZ A;  4TQ0 A;  3X0W A;  2LVO A;  1WGR A;  2N7E A;  2R2O A;  3CST A;  2K6Q A;  3A9J B;  5D94 A;  3LDZ E;  2O6V A;  1WE7 A;  3L54 A;  3OJ4 B;  4ASW C;  4IWQ A;  3ZIM A;  1WE6 A;  2QHO A;  1J8C A;  2FNJ B;  2N7D A;  2ZPN A;  3VHT C;  3CF6 E;  4NY0 A;  4IG7 B;  4EUT A;  2FCS A;  3U30 A;  4E3C A;  3ENE A;  2M0X A;  2MSE D;  4HXD A;  1ZW7 A;  2YLM A;  2KLC A;  4F8C B;  2VRR B;  2KVR A;  1I35 A;  3BY4 B;  3MJW A;  3DBR I;  4ANW A;  5CX3 A;  2JWZ A;  2WWZ A;  1UGM A;  4G11 A;  1ZKH A;  2A5U A;  3L13 A;  4RM9 A;  3VQI A;  4NNJ B;  4B6W A;  4JGH B;  2LXA A;  3DVG Y;  4ZRI A;  4OVV A;  4KSL C;  3R3M A;  1P98 A;  4II2 B;  4PS8 A;  4EOY A;  2JZ3 B;  4FJY A;  3PRP B;  2KJ6 A;  2NBW B;  2KWC A;  4AUQ C;  1GJZ A;  4URK A;  2G45 B;  3ONS A;  1E8Z A;  4GDL A;  2DAF A;  2XK5 B;  2L76 A;  1K8R B;  2D2Q A;  3QJZ A;  2HTH A;  2MP2 B;  3ML9 A;  4ICV A;  3GOE A;  3UIP B;  3WA0 A;  1Q1O A;  3M95 A;  3DDC B;  3B1L X;  1E5W A;  5DPW A;  4GN1 A;  2O2V B;  2REX A;  2ZPY A;  5LXH A;  3UQB A;  2NPT A;  1C1Y B;  3H7P A;  3O65 B;  4HPM B;  4FBJ B;  2ZEQ A;  3QHT A;  3RYT A;  3L08 A;  3ZDM C;  4K7W A;  2ZCB A;  4FHK A;  4KV2 A;  2JY6 A;  2BYF A;  2K1F A;  3OJ3 A;  2CR5 A;  4BBN C;  5LLI A;  3DCG A;  2M17 A;  2JUO A;  4GSW A;  4BKS D;  5AZG A;  5BO4 B;  2DZK A;  3DPD A;  3X23 A;  2KMA A;  4HVB A;  2JXX A;  4KIK B;  4MH0 E;  2I1K A;  2FCQ A;  2LZ6 A;  1RRB A;  4GXB A;  1P3Q U;  5DPT A;  3AUL A;  1Q5W B;  2K6D B;  3A4S C;  2O6V B;  2R2Q A;  3A9J A;  2HD5 B;  5TR5 A;  2IO0 B;  4K1R B;  4MGK E;  3IHP C;  4XC2 A;  4GGQ A;  3KW5 B;  1CMX B;  3RUI B;  4BKG A;  3NY5 A;  4RM8 A;  4DDG D;  2DYB A;  4WJP A;  2KTR B;  3IVF A;  5D6J B;  2BWE S;  2LXC A;  1WMH A;  4OVU A;  4P7I A;  3LJ3 A;  4KZC A;  2PE9 A;  2N4F A;  5HKH A;  4ZDV A;  3ZRF A;  2RPQ A;  2B3A A;  3WIM A;  3JYU A;  2KDB A;  3DVG X;  2J0J A;  5IAA C;  1I42 A;  3H9D A;  4BBN F;  2GBR A;  2GBM A;  1UH6 A;  2C5L C;  2MBE A;  4AWJ A;  3EHV A;  3PLV A;  3SHQ A;  4MEM A;  2J0M A;  2LD9 A;  4FJZ A;  1WXM A;  4GDL B;  2CHX A;  4I6N B;  1D3Z A;  3K9P B;  2LRW A;  4MM3 A;  4NQK E;  1FXT B;  2LI5 A;  3ZNI D;  2MBO A;  1GC7 A;  4W9K A;  3QK0 A;  3ZNH B;  2M4N A;  2EKE C;  2L0T A;  1YIW A;  2AEH A;  3JSV B;  2HE7 A;  2O2V A;  2LVP A;  2NPT B;  3HM6 X;  4GU2 A;  3D32 A;  4RMA A;  1V49 A;  3QAQ A;  2JT4 B;  4KDI C;  4LJO B;  5C1Z A;  3WAM A;  4FA6 A;  3DVN U;  2HJ8 A;  3PHX B;  4DHJ D;  2IO1 B;  5CTR C;  1GG3 A;  2FCM A;  2KX0 A;  2C9W B;  1JRU A;  2XBB C;  2EMS A;  2BKR B;  2GOW A;  1GC6 A;  3KUC B;  1WF9 A;  3H7S A;  4WWO A;  2L3Z A;  1E8X A;  1XQQ A;  2W9N A;  3DBL I;  1TZ1 A;  2RR9 A;  3RT3 B;  4EKU A;  1V9J A;  2RD0 A;  4DBG A;  4KIK A;  4B9K A;  1WGG A;  3B08 A;  4JL9 A;  3PS6 A;  4WJQ A;  4FLH A;  3ZTC A;  4F1S A;  2LWP A;  2KHW B;  5DPR A;  2RSU A;  1GNU A;  5C23 A;  3SD5 A;  3KUD B;  5IA7 A;  2KC1 A;  3AU5 A;  2G3Q B;  4LDT B;  4MSQ B;  1WH3 A;  4CO7 A;  3VH4 B;  2FCN A;  1WGH A;  2XEW A;  4NPN A;  2KTR A;  3T9L A;  1WMH B;  3WAP A;  3V62 A;  1Z5S B;  3ZNZ B;  4NQL B;  3HM3 A;  3IBE A;  2GBN A;  2KN5 A;  2PJH A;  4A3P A;  4KZ0 A;  1YX6 B;  1WM3 A;  1EUV B;  1RLF A;  1WGD A;  4PS7 A;  4IWP A;  3ZUN A;  2D11 A;  3WAO A;  4G0N B;  2MX2 A;  1WFY A;  2N1W A;  3H1U A;  2JRI B;  3DBH I;  1WJN A;  1BT0 A;  3VTV A;  3KYD D;  4A3O A;  3MTN B;  4M8N A;  1P1A A;  1V2Y A;  2KZR A;  2N9E B;  4MGZ E;  5G2N A;  4DDI D;  4BFR A;  5JHA A;  4G50 A;  1WJ4 A;  2DAJ A;  1EF1 A;  2D10 A;  3Q3J A;  3QIJ A;  3APD A;  2I1J A;  4KDL B;  4ZYN A;  1KLV A;  1NDD A;  1WX8 A;  3KVF B;  2LRU A;  3VAW A;  3EEC A;  3L16 A;  1F9J A;  4I6P A;  3APF A;  3BIN A;  3R7Q A;  3ZLZ A;  1ZGU B;  2J0K A;  4AJW A;  3UIN B;  1WR1 A;  3IFW B;  5AEK B;  1H8C A;  2N1V A;  3JSV A;  3PVL A;  2BGF A;  2KXJ A;  4FAD A;  2MRP A;  3KUZ A;  2FIF A;  4MJS A;  1V80 A;  4NAW A;  3DQV A;  4WAA A;  4GIV A;  2L8J A;  1V81 A;  3PPA A;  2KDF B;  4ZRJ A;  3ZNG C;  1E90 A;  2KFK A;  3JVZ X;  4B95 A;  3DVN V;  1E8Y A;  2IYD B;  2CS4 A;  3MHS D;  4K81 A;  4AJY B;  1XD3 B;  1NI2 A;  2JRH A;  4HDO A;  4IWO A;  4DHZ E;  2ZVN A;  3NZU A;  3UGB B;  3GZN I;  5L83 A;  3TJP A;  2AYO B;  3UQA A;  3PLU A;  2EMT A;  4WWP A;  2DYO A;  4DK5 A;  1QZE A;  3ZO5 B;  5J2R A;  1IPG A;  4ANX A;  3L10 B;  3TBL D;  3ZTD A;  3OAW A;  1WXS A;  1H4R A;  3CMM B;  4W9L A;  2NBU A;  4AOF A;  3S2A A;  2GBK A;  1L2N A;  2K8C A;  2UWQ A;  5D2M B;  4HCN B;  2LVQ A;  2MQJ A;  2KAN A;  2KX3 A;  3PTF C;  1VD2 A;  2V4L A;  1IYF A;  3K9O B;  3VUY A;  2ZNV B;  4ANU A;  2FAZ A;  4K7S A;  3W1S A;  4GOC A;  4IM3 A;  2KKC A;  4W9I A;  3A1Q A;  2V3S A;  2DZI A;  3H6N A;  1OGW A;  4DWF A;  1T0Y A;  4EZK A;  1WX9 A;  3RD2 A;  1WRD B;  4AP4 C;  2BYV E;  3ZVV A;  4LJP B;  2MW5 A;  2MBB B;  3V6C B;  2D3G A;  1YJ1 A;  4M8M A;  3C0R B;  2DZJ A;  4WQO B;  4XZ4 A;  4BOZ B;  5J18 A;  1OEY J;  4W9G A;  2AL6 A;  3M62 B;  5L95 C;  2PPH A;  3Q3F A;  1WIA A;  1J0G A;  4IUM B;  2C7M B;  2O6V D;  3QC8 B;  2MCN B;  3VH3 B;  2ASQ A;  2Z59 B;  2LGX A;  4HCP B;  3N32 A;  1LQB A;  1PQS A;  2CHW A;  2IY1 B;  1UBI A;  4EEW A;  3DBS A;  5GMV A;  1LM8 B;  1LFD A;  5JHB A;  3TMP B;  4MEL A;  4NJ7 A;  3U8Z A;  3IG3 A;  3NZS A;  2IBI B;  1E7U A;  3TL5 A;  3AI5 A;  4TQ1 A;  3B0A A;  4J6I A;  1J19 A;  4NAW B;  4MJS B;  2ZZP B;  4K7U A;  5LXI B;  1AAR A;  1HE8 A;  1V5T A;  2KWV B;  2NVU I;  4MDK E;  1C3T A;  2KFK B;  4HDQ A;  3VUW A;  1MG8 A;  3NS8 A;  5J17 A;  2CKH B;  2LAS A;  4JQW C;  1LXD A;  2KLG A;  3KYC D;  2IY0 B;  1TGZ B;  1WM2 A;  3PRE A;  5JZE B;  1KOT A;  2PEA A;  2LUE A;  5DCN A;  4TUU A;  4IM0 A;  2IZV B;  1V6E A;  1UD7 A;  4GDK A;  2NCN A;  3QWZ B;  3VUX A;  3ECI A;  5DPS A;  3PV1 A;  1IP9 A;  3P2B A;  2JZZ A;  4LCD E;  3V6E B;  3SU8 X;  1RFA A;  5E6P A;  2KNB A;  1P0R A;  4HLE A;  3M3J A;  4II3 B;  1A5R A;  4EZJ A;  3VDZ A;  2GMI C;  4IW0 A;  1WXA A;  3PGE A;  4FN2 A;  4X57 B;  5AZF A;  1M94 A;  1L7Y A;  1TBE A;  2L05 A;  1KM7 A;  3A1Q B;  3RUL A;  4MGI E;  1TTN A;  2WDT B;  3PRZ A;  2WX0 A;  4A20 A;  4XX5 A;  1X1M A;  4WWN A;  4GB9 A;  2MBH A;  3VXW A;  4EFO A;  2KJH B;  2ZCC A;  3HK0 A;  5KHO A;  2K8B A;  4HJK A;  3UF8 A;  3KH0 A;  2C7H A;  3L0W B;  3PT2 B;  1UBQ A;  5D7G A;  3QAR A;  2KK8 A;  4GMV A;  4CYE A;  1RAX A;  4DXA B;  2NR2 A;  5CHW A;  1Z2M A;  4KSK C;  1R4M I;  3QX1 A;  3L17 A;  3R66 C;  1UEL A;  3QA8 A;  3PHW B;  4LDT D;  2G4S A;  1YQB A;  2WYQ A;  2IO3 B;  2OJR A;  2WX1 A;  2MA9 B;  2ZNV C;  2L7R A;  3UIO B;  4F7Z A;  1V5O A;  4TV3 A;  3VFK A;  4W9J A;  1R4N I;  2Z0D B;  1WR6 E;  4NJ6 A;  1V86 A;  2BF8 B;  5CHV C;  3ALB A;  4BOS C;  2JVC A;  4N9F 4;  4ANV A;  1SIF A;  2ZJD A;  2KFJ A;  2BYE A;  3N3K B;  3WAN A;  4M0W B;  2UYZ B;  2K39 A;  2RGF A;  2L00 B;  3I3T B;  3ML8 A;  4WJN A;  3PRM B;  3V60 A;  3TCA A;  3RCZ A;  4ICU A;  3VTW A;  5FR6 A;  4GDK B;  5AZH A;  4I6L B;  1Y8R C;  5CHF A;  3RZW C;  3NHE B;  5G55 A;  1OEY A;  4E71 A;  2KQ7 A;  3AU4 A;  2J7Q B;  2KJR A;  2CHZ A;  1EF5 A;  3A9K B;  2KD0 A;  1E7V A;  2KO3 A;  3HIZ A;  5E6O A;  2NS5 A;  2BKF A;  3PSE B;  3T8M A;  1VCB A;  5EDS A;  3M63 B;  2ZVO A;  2C7N B;  2JF5 A;  4ZRK A;  1YX5 B;  1SE9 A;  2D07 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...