2JZ3B

Socs box elonginbc ternary complex
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
118
structure length
118
Chain Sequence
b'MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Suppressor of cytokine signaling 3
publication title The SOCS box domain of SOCS3: structure and interaction with the elonginBC-cullin5 ubiquitin ligase
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription inhibitor/transcription
total genus 12
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2007-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2jz3B01
2JRIB 4WWNA 2Z0EB 5L95C 3ZTDA 4W9JA 2RGFA 2G4DB 4HCPB 4MJSA 2D10A 4LJOB 1WX9A 2V4LA 2N1WA 3HM3A 2JT4B 4IWQA 3QC8B 2DHZA 4I6LB 3ZTCA 1WIAA 1WI0A 4G0NB 4JL9A 3ML8A 4WJQA 2K6QA 4M8NA 2OOBB 3A4RA 4FLHA 2ZNVC 1RFAA 1E7UA 1Z2MA 4GN1A 2LXCA 4GDLA 3IVFA 4FJZA 3H9DA 4HDOA 5CHFA 1ISNA 1E8ZA 1I35A 4K81A 5KHQA 2FIDA 2KMCA 2DYMA 2LUEA 4EZLA 2CKHB 1F9JA 1WR6E 4ZDVA 1V81A 1RLFA 4DHJB 4W9LA 1TTNA 1XQQA 3RD2A 1WMHA 3KH0A 2MBOA 2KFKA 1YQBA 2N1VA 4M0WB 2WX1A 4ZRKA 4MEMA 5KHOA 2MW5A 3DCGA 1E8WA 3L13A 1NI2A 2Z0DB 4W9HA 4WJNA 3WAOA 1QZEA 1YX5B 2EMSA 2KTRB 2NS5A 1WGRA 1V49A 4MGZE 2MA9B 2I1KA 2ZVOA 2CS4A 2NR2A 1D3ZA 2RR9A 3KYDD 4XZ4A 1KOTA 2DYBA 4HK2A 4KIKA 5LLIA 3V6EB 3RYTA 2K6DB 1WGYA 1WGDA 1E7VA 2LJ5A 3PRPB 3RULA 1Y8RC 5J2RA 2IO2B 2BWES 2MSED 2LD9A 2O6VB 4E3CA 2PPHA 3W1YA 4ANXA 3DVNU 3WIMA 1U4AA 4E71A 2GOWA 2MBBB 3KUDB 4IM2A 2EKEC 4K7WA 3DPDA 1UELA 2IO1B 3LDZE 1SGHA 5D2MB 3UIOB 4ZRJA 2CHWA 4IWPA 4JLCA 2LWPA 2M4NA 3NHEB 2IO0B 4JGHB 4EOYA 1LFDA 4GMVA 1EO6A 3PS6A 3QARA 2MP2A 2BKFA 4GOCA 1V86A 4GGQA 1EF1A 2IZVB 2FAZA 2XBBC 1E5WA 1P1AA 3DVGY 2AYOB 4HXDA 3APFA 4W9DA 3TJPA 3DOWA 2JZZA 3QIJA 1V5TA 1WZ0A 4A3PA 2AEHA 2KLGA 4IM0A 4KDLB 3X23A 3L16A 2B3AA 3AXCA 5C23A 2KC2A 4PYZA 3SDLC 4EZJA 4HCNB 3UIPB 1WXVA 2LGYA 1S3SG 3JYUA 4NAWA 2LI5A 2CHZA 2NPTB 3A9KB 2DENB 4K7SA 4AWJA 1EUVB 4NQLB 2KFJA 3AI5A 3QX1A 4A3OA 2JY6A 2KTFA 5AZHA 3V60A 3ZLZA 5AEKB 1GC6A 2O2VB 4KDIC 3D32A 3KYCD 2NBUA 3OLMD 1H4RA 1S1QB 2CR5A 1WE6A 2R2QA 4GU2A 5E6OA 3W1SC 4W9KA 5LXIB 4LJPB 2CU1A 1P3QU 4II3B 4KV2A 4GSWA 2LVPA 3WAMA 3DQVA 3A33B 4PS7A 3SU8X 3QA8A 2KMAA 4RMAA 4I6NB 2M0XA 4WJOA 3ZW3A 3M95A 1E8XA 1V6EA 3WA0A 2WWZA 2ZNVB 2FCNA 2YLMA 3IG3A 4JIOU 3VUYA 4DXAB 3L0WB 4FA6A 3VDZA 2KQ7A 4X57B 4BKGA 3A9JB 2JF5A 4LCDE 4IM3A 4EKUA 1WJNA 1T0YA 1IP9A 3NS8A 2ZEQA 3M63B 1WX7A 3L54A 3PREA 3L08A 1J0GA 3ZIMA 3QK0A 1GC7A 2DZKA 2KC1A 2LRWA 1UBQA 4KZ0A 3ZDMC 2IO3B 3R7QA 3VXWA 2BGFA 2O6VD 2A5UA 1WXAA 1KLVA 3PVLA 3MTNB 2JPHA 4LDTB 2YVCA 1YX6B 3ZNID 3R7RA 4URKA 2KJRA 2GBNA 3S2AA 1P0RA 1P98A 1TZ1A 2IY0B 2KX3A 2OJRA 2RSUA 3LJ3A 3UQBA 2KX0A 3JW0X 2KZRA 2R2OA 2KWUB 4AP4C 2EMTA 1K8RB 1VD2A 4FN2A 5JHAA 3PGEA 1XD3B 3ECIA 2GBMA 4OVUA 3RUIB 2UYZB 1E90A 1R4NI 2DAFA 2WDTB 3MJWA 2GMIC 3C0RB 3A4SC 4AJYB 2RD0A 3B08A 2AWTA 3N3KB 3PTFC 2LVQA 2KQSA 2ZPNA 5E6NA 3DBSA 4MGYE 4F8CB 2KTRA 3R3MA 1EF5A 3RZFA 2LZ6A 3BINA 4E74A 3PZDA 4GDLB 1UBIA 3EC8A 3QAQA 3UQAA 2K1FA 3QCAA 4ZRIA 1VCBA 3AU4A 4IUMB 3TCAA 1UGMA 2BYFA 3L10B 2KO3A 4FBJB 3U30A 4F7ZA 3WANA 2HJ8A 2NVUI 1OEYJ 3KUZA 4DDID 4EEWA 1WF9A 2KWCA 4MGKE 2KDBA 2LASA 1Z5SB 2WX0A 3OJ3A 3NZSA 1P9DU 4II2B 4M8MA 4NQKE 2O6VA 4DHZE 5L83A 3MHSD 5JZEB 4GDKB 3DBLI 2MBEA 2C7MB 2KANA 1WXMA 2N4FA 3ZVVA 2C5LC 2AL3A 3A1QA 1WZ3A 1V2YA 3QHTA 1J19A 1OTRB 2D3GA 2K8HA 1WJ6A 3K9PB 2PE9A 3V62A 2M8SA 4ANUA 1SIFA 3PLVA 4TQ0A 1Q5WB 3V6CB 3UF8A 2IY1B 2BF8B 3H7PB 3PHXB 2Y5BB 4HJKA 1IYFA 2L8JA 1HE8A 4BOZB 2G3QB 2ZJDA 3SHQA 3CSTA 4PYUA 2QHOA 2KHWB 3VUWA 4P7IA 1FXTB 1KJTA 1UZXB 2MBQA 3VTVA 2C9WB 1WJ4A 2L76A 4KSLC 3NZUA 3JSVB 1TBEA 3UINB 3VH4B 2AL6A 2KKCA 4IWOA 2Z59B 3DBRI 3TBLD 2FIFA 3ZKJC 3VTUA 2CHXA 1SE9A 5D7GA 2N9PC 2RPQA 2JVCA 5CTRC 4LDTD 4CYEA 5IA7A 3ALBA 3VTWA 4DK5A 5HKHA 3IFWB 2O2VA 5GMVA 2W9NA 3JVZX 3GOEA 2XK5B 3QQ8B 3K9OB 4NNJB 2HE7A 4KZCA 4W9CA 3ZO5B 4TV3A 1WE7A 3WALA 4HDQA 1Q1OA 4FJVB 3NOBA 5DPRA 4MGIE 2J7QB 4JQWC 5CHWA 1BT0A 2G45B 4HPMB 5D94A 4DHJD 2D2QA 2J0KA 3UGBB 3EFUA 3SD5A 3TL5A 3ZDTA 4BVUC 5LXHA 2NBVB 1CMXB 2IYDB 2K8CA 4IC7B 4AJWA 1ZW7A 1NBFC 3VQIA 5TR5A 4NAWB 5G55A 2WYQA 3EECA 1G6JA 3M3JA 4HPLB 4NY0A 3EHVA 3A9JA 3CMMB 5J17A 4PS3A 2KXJA 5DPWA 4MSMB 4WJPA 2FUHB 3PT2B 3PSEB 2HTHA 5AZFA 4NJ6A 1X1MA 3N30A 1Q0WB 4RM9A 2D07B 2ZPYA 1GJZA 2M17A 4EFOA 3M62B 3ZRFA 4EUTA 2D11A 1J8CA 4ASWC 3ZNHB 4DWFA 3DVGX 3N32A 2IBIB 3TIXA 1H8CA 2MCNB 3I3TB 4J6IA 4ICVA 4G11A 1C3TA 1V5OA 2LGDA 3O65B 4NPNA 4HVBA 2FCQA 3VHTC 3RCZA 1WJUA 2JWZA 1XT9B 2LVOA 3U7DA 4F1SA 4WWPA 3T8MA 1WGGA 5AZGA 2KLCA 2NCNA 3APCA 4ANWA 5EDSA 4W9FA 3IBEA 1GNUA 4FJYA 4K1RB 3QWZB 4WQOB 3HHMA 4MJSB 5BO4B 2I1JA 3IHPC 2KDEB 2MLBA 4G3XB 5FR6A 1RAXA 4MH0E 2KN5A 2V1YA 1LXDA 2A4ZA 2KJ6A 4B9KA 3H1UA 2KJHB 2ASQA 1UD7A 3HIZA 3TMPB 2KDIA 3CF6E 1YJ1A 5DPSA 2K8BA 1WR1A 4RM8A 1OQYA 2ZCCA 1L7YA 3QJZA 5CX3A 1LM8B 1WFYA 2HD5B 4GXBA 1WMHB 1WX8A 4GDKA 2KFKB 4MDKE 1LQBA 5DPTA 1ZKHA 3VH3B 2ZVNA 1V80A 3OJ4B 3ML9A 2C7HA 2MBHA 3AULA 3DVNV 4EZKA 5J18A 1YD8U 4MSQB 1WRDB 4W9GA 2N7DA 3ONSA 3PPAA 2KNBA 4KVGB 4YL8A 3H7PA 3H6NA 4NJ7A 1OEYA 4WWOA 2J0MA 2REXA 2DZIA 2KWVB 2M1MA 2MRPA 2KOXA 3U8ZA 2JRHA 4KIKB 4GIVA 2NBWB 2N9XA 3PLUA 2MX2A 3W1SA 2J0JA 1PQSA 1YIWA 5D6JB 2UWQA 4BOSC 2ZZPB 2C7NB 3KUCB 3PRZA 4G50A 1A5RA 2L0FA 4IW0A 2G4SA 3B0AA 3JSVA 2DYOA 4HWIB 1WYWB 2L7RA 2BPSA 2JUOA 2L0TA 2DZJA 2C60A 3P2BA 3A1QB 2XEWA 1JRUA 3ZNZB 5JHBA 2GBKA 1IPGA 4BBNC 1M94A 2V3SA 2NPTA 4TKNA 3A9KA 4W9IA 1NDDA 2DAJA 2LRUA 3RZWC 1AARA 1WM3A 1I42A 2K25A 2BWFA 2KDFB 5IAAC 1R4MI 4WAAA 2XK5A 3ZNGC 3L17A 5JH5C 3ENEA 2L3ZA 3BY4B 3DDCB 1RRBA 2MP2B 2ZCBA 4FULA 3ZRCA 2PJHA 3B1LX 2MQJA 4PS8A 3T9LA 4BKSD 4XC2A 2DX5B 2LXAA 2N7EA 3AU5A 3HK0A 1WM2A 4BKTA 3PRMB 2LGXA 1V9JA 1WY8A 3DBHI 2PE6B 1MG8A 3R66C 2KVRA 3PV1A 2L00B 4DDGD 5DCNA 3KW5B 1WGHA 2JXXA 3APDA 3RT3B 1GUAB 1WH3A 2BYVE 2K39A 2L05A 4W9EA 4XX5A 4BBNF 3OAWA 4OVVA 1UH6A 4BFRA 2N9EB 3V61A 2FCSA 4A20A 1TGZB 3NY5A 3Q3FA 4AOFA 4GB9A 1ZGUB 3X0WA 3Q3JA 4N9F4 4IG7B 4ZYNA 4AUQC 3GZNI 4HLEA 4CO7A 1WXSA 3CSFA 3PHWB 4K7UA 3WAPA 1L2NA 4FADA 3KVFB 3VVWB 1GG3A 4MM3A 4DBGA 2FNJB 4I6PA 2BKRB 1C1YB 5G2NA 4CHKA 4TUUA 5E6PA 2VRRB 1OGWA 4FHKA 2GBRA 5CHVC 4KSKC 2BYEA 3VFKA 4ICUA 2DZMA 3HM6X 4B6WA 2JZ3B 4FHJA 1KM7A 4DHZB 2PEAA 3H7SA 2KD0A 1E8YA 4MELA 3VAWA 3ZUNA 4B95A 2GBJA 4ANVA 4BKSA 2FCMA 2KK8A 2MWSB 3VUXA 5C1ZA 4TQ1A
chains in the Genus database with same CATH superfamily
2JRIB 2D5GA 4LLGM 2KVZA 2LHDA 2N1WA 3NVVA 4O1NA 2KQ4X 1WI0A 4M8NA 1EU3A 2ZNVC 1MHHE 3IVFA 1OQRA 3H9DA 4K81A 1D4BA 2LUEA 1FXAA 1WR6E 4DHJB 1XQQA 3Q6BA 1WMHA 2N1VA 1L4DB 3B2GA 1E8WA 1NI2A 2Z0DB 2KN4A 1V49A 2MA9B 1QOBA 3SFDB 2R61A 4HK2A 3V6EB 2KMMA 4YTNB 1QKZA 4LNKA 2LD9A 4E3CA 3W1YA 4ANXA 3WIMA 4E71A 4DXGA 2RPVA 4LNFA 5BMHA 4IM2A 1UELA 1K50A 5BMGA 1ET6A 5C3JB 3LDZE 4ZRJA 2CHWA 3IT4B 3NS1A 4OHJA 3PS6A 2MP2A 1VZ8A 2FAZA 4XWWA 1P1AA 2AYOB 1HQRD 4HXDA 3TJPA 1NYRA 1WZ0A 4KDLB 2B3AA 2VH2A 4PYZA 4HCNB 2LGYA 1S3SG 3JYUA 3AEAB 3QX1A 2JY6A 3GE3C 3OLMD 1ACCA 4ZRQA 4W9KA 3C8YA 5IP4D 1P7EA 4PS7A 3QA8A 1L0XB 2M0XA 1E8XA 1V6EA 2WWZA 2FCNA 3I9V1 2RMMA 4REZA 3P4QB 3A9JB 1WJNA 3MP9A 2TSSA 3ZIMA 3QK0A 2I38A 2LRWA 4H2AA 4RF1A 3VXWA 2JPHA 1RM6C 1YX6B 2WHIA 3R7RA 1TZ1A 2KX3A 3LJ3A 4FXCA 4AP4C 4FN2A 3PGEA 4HKZE 1R4NI 2WDTB 2PVOD 3MJWA 1DOIA 2KAJA 2IGGA 2KTRA 3R3MA 4GLSC 1EF5A 3URYA 4WIPA 3UQAA 4ZRIA 3AU4A 3TCAA 1UGJA 2BYFA 1TYGB 2KO3A 3WANA 1N5WA 2KDBA 2LASA 2WX0A 5HFYA 1C4PA 2W54A 3MHSD 4GDKB 2KANA 1WXMA 2N4FA 3Q8BA 3A1QA 1WZ3A 2BVCA 4ITKA 4C00A 4IOIE 1V2YA 4ANUA 1VLBA 3UF8A 1R4NB 4BOZB 1YN4A 1PFDA 4PYUA 2QHOA 4P7IA 2JX5A 1WJ4A 2L76A 1NVID 3UINB 3VH4B 2KKCA 3DBRI 3TBLD 2FIFA 1SE9A 1I4GA 5D7GA 5G5GA 5CTRC 1JCKB 5GMVA 3JVZX 2L32A 5FKAC 2XK5B 3K9OB 4KZCA 3ZO5B 1WE7A 3WALA 1N5XA 3NOBA 2J7QB 3R2IA 2IGDA 4YT0B 3TL5A 1SJHD 3BK1A 4AJWA 3ZYYX 3J9CA 3M3JA 1KF6B 5J17A 3BIID 5DPWA 2FUHB 1EM7A 1D5ZC 1VRAB 3PSEB 1ESFA 1KH0A 3ETRA 3N30A 2ZPYA 3TEYA 3DBRB 2HJ1A 3LYYA 3PZ8A 2NTSA 3ABVB 3ZNHB 3TIXA 4G11A 1V5OA 2LGDA 3TUOA 1J7AA 4NPNA 2FCQA 1WJUA 1WGKA 3Q8CA 3APCA 5EDSA 3IBEA 4FJYA 3NUHB 1EWYC 3AE5B 4M0WA 1JQ4A 3U7ZA 1RAXA 2KN5A 1HEZE 5AUIA 5G5HA 3NZ3A 2ASQA 1UD7A 2BB6A 3HIZA 3TMPB 5IOIA 4A9AA 2K8BA 2M19A 4RM8A 2N7JA 1WX8A 2KFKB 3HUIA 1LQBA 1ZKHA 3VH3B 4ZOHC 1V80A 3OJ4B 2C7HA 3DVNV 2AQ1B 2RDBC 2N7DA 2HDEA 3PPAA 2KT7A 1OEYA 4WWOA 2K3UA 2DZIA 4KIKB 3PLUA 1YIWA 2ZZPB 1OQQA 2L0FA 1V1OA 3JSVA 3NJTA 1WYWB 2J42A 3MC0B 2JUOA 3A1QB 2XEWA 4BBNC 1QILA 3A9KA 4W9IA 4RCOA 2ZW0A 2KDFB 4WAAA 2IJ0A 1EWCA 1RRBA 2ZCBA 3ZRCA 4PS8A 1EU4A 2LXAA 3AU5A 1YQ4B 2M56B 2PE6B 2WGSA 3PV1A 1BXTA 4P1CC 1WGHA 3APDA 3P4RB 1P7FA 2K39A 2L05A 2PW9A 1FFVA 3ZGZA 2N9EB 2QJLA 2WXIA 2DBYA 3X0WA 3ZQ4A 3GZNI 3VRBB 1WXSA 3CSFA 3VVWB 1GG3A 1STEA 1YMHE 2J52A 4I6PA 1V1PA 1C1YB 1YQ3B 5G2NA 4CHKA 2VRRB 4UDUC 4FHKA 2GBRA 2L1AA 1JMLA 4OVZA 5BYSA 2DZMA 2PEAA 2KD0A 1E8YA 4MELA 3VAWA 3ZUNA 4B95A 4ANVA 2ICIA 2MWSB 3VUXA 4TQ1A 2Z0EB 5L95C 1C4CA 3ZTDA 2RGFA 2G4DB 4MJSA 4RGOS 5D3DA 2V4LA 1XCQL 2X38A 1WIAA 2M0AA 3Q3OC 2GLSA 2I2YA 3A4RA 1Z2MA 1E7UA 4GN1A 2LXCA 3GZNB 5CHFA 3NVYA 4YSZB 5KHQA 2KMCA 4EZLA 4RGNA 2INPE 2BQQA 3RD2A 2QCZA 2VZKD 4M0WB 3BVZA 4MEMA 1LGRA 4QAYA 2MW5A 2H88B 4B0MA 3L13A 4WJNA 3P1MA 1FPYA 1XF5L 2RR9A 1KOTA 1N61A 1QQRA 1WGYA 1PGXA 3PRPB 1QOFA 1Y8RC 5HHDG 3IXSA 2N9KA 4M00A 3KUDB 1I4PA 3MFGA 3DPDA 2K0PA 2IO1B 1C77A 3UIOB 2M4NA 2IO0B 4JGHB 1LFDA 1D6EC 1TJEA 2KDMA 4GGQA 1WYGA 3DVGY 4W9DA 4A3PA 2KLGA 2EELA 3X23A 2HTME 3AXCA 2KC2A 4EZJA 4P6VF 1HZ6A 3A9KB 4K7SA 4NQLB 2KFJA 2IDYA 5AZHA 3ZLZA 4N59A 3ZJUA 1GC6A 4KDIC 4YTPB 3KYCD 2NBUA 1H4RA 1S1QB 1WE6A 2R2QA 4GU2A 3W1SC 2D3AA 2CU1A 5JXVA 1JROA 4KV2A 2N0SB 2KMAA 4I6NB 1SIJA 3M95A 1FCCC 3RNBC 2MHJA 3VDZA 2KQ7A 4X57B 4BKGA 1IGDA 2JZPA 1K52A 2L52A 4EKUA 1T0YA 2ZEQA 4R3DA 3L54A 3PREA 4HJGE 3ZXVA 2DZKA 2YEPB 3ZDMC 1YOVB 2A5UA 2DLBA 3MTNB 2Q5WD 2LGSA 1T3QA 2WXQA 2XN9C 2GBNA 3S2AA 1P0RA 2RSUA 2OJRA 3R2TA 2KX0A 3Q69A 2KZRA 2R2OA 2EMTA 3NVWA 1YNTE 1MG4A 2DAFA 3RNFC 2RD0A 4LNNA 1QOGA 2WXJA 3AEEB 2KQSA 3RZFA 2CU3A 1N6ZA 4RH6A 3EC8A 2SEBD 4IUMB 2DWQA 2X8XX 1UGMA 3U30A 3E56A 4L23A 4JE3B 4DDID 1WF9A 2KWCA 4DHZE 3NZSA 4II2B 4TMAB 2O6VA 3DBLI 4MACA 2C7MB 1VDVA 3ZVVA 3AECB 1VJKA 1SB3C 3QHTA 1WJ6A 2PE9A 2LHEA 2JQRB 5BYRA 1L4ZB 3ZJTA 2M8SA 3PLVA 1Q5WB 3V6CB 4C4VA 3H7PB 2BF8B 4US9A 2L8JA 1E9MA 1RWSA 3BYYB 1UNSA 2ZJDA 3CSTA 2AX5A 1TS2A 2WU2B 1MJDA 1UZXB 2MBQA 4USAA 3NZUA 1TBEA 2D3CA 1C78A 4XDDA 1SBBB 3I63C 2CHXA 4N6EB 3VTWA 5HI1A 2PLPA 2O2VA 1DOXA 1ENFA 3VR8B 2OJWA 4W9CA 4HDQA 1Q1OA 3DBLB 4MGIE 2DNFA 3EGRA 1BT0A 4HPMB 4IDIA 2D2QA 4DHJD 3UGBB 3TEXA 3WCQA 2K8CA 4IC7B 2PVGC 3VQIA 2MEKA 4KGRA 3EECA 4HPLB 3RI7C 4PS3A 5FK9C 4NZLB 2M17A 4M01A 1HXYD 3RNEC 4ZRPA 3N32A 2FUG1 3I3TB 4EE2A 4J6IA 2G9HD 1KLUD 5TSSA 3VHTC 3U7DA 2LVOA 1XT9B 4F1SA 3QWZB 3HHMA 2I1JA 4A90A 3DHGC 4G3XB 3FILA 1LXDA 3AM9A 1E10A 2INNE 2KJ6A 3EFCA 3AE6B 2WXGA 2WXKA 4YTMB 2Y3AA 2KDIA 1SE2A 1MVKA 2HD5B 1WMHB 1HZ5A 4MDKE 1JALA 1ZOYB 1TKYA 2WP9B 3LB8C 1C79A 1JWAD 4P16A 4ACFA 3W2DA 4EZKA 1YD8U 3W5VB 1WRDB 4DXFA 2LJIA 4YL8A 1V97A 4S0RA 1AN8A 2REXA 2JU6X 2MRPA 4GIVA 2MX2A 1R7SA 1UF0A 4IW0A 3B0AA 1JRUA 2GBKA 4OZCA 2NPTA 4TKNA 2DAJA 3RZWC 2UU7A 1AARA 1WM3A 5IAAC 1R4MI 2AQ3B 2J4XA 1CK1A 3ZNGC 5JH5C 2L3ZA 3TEWA 2MP2B 4BKSD 2N7EA 1WM2A 3PRMB 2LGXA 1NYQA 1FMAD 1WY8A 3DBHI 4YWGG 3R66C 1C4AA 1JWMD 4M02A 1UWXA 1WH3A 4OZAA 4OVVA 3V61A 2FCSA 4A20A 1JWBD 3NY5A 3Q3FA 4GB9A 1ZGUB 4HLEA 3PHWB 1DGJA 4FADA 3KVFB 4MM3A 1TKEA 2ACZB 3R8BA 2BKRB 4DQOC 4TUUA 5HG2A 4ICUA 4LK0M 4B6WA 2LUMA 4FHJA 1QT9A 1PYWD 3Q2AC 3KWLA 2GBJA 2FCMA 2KK8A 2GI9A 3PZ7A 4WWNA 1K51A 3DBHB 2D10A 4IWQA 2AQ2B 2JT4B 3QC8B 2DHZA 4YSXB 4G0NB 2QMTA 3ML8A 4WJQA 2K6QA 2V3NA 4FLHA 1GOZA 1SSNA 4GDLA 4HDOA 1XLOA 1IUEA 1E8ZA 4HROA 2K22A 2WLBA 1E0ZA 2FIDA 1PGBA 1F9JA 3KLSX 3BVMA 2KACA 4KKIA 1VZ6A 2MBOA 1SE3A 3NVZA 1YQBA 4WH4A 1SXTA 4ZRKA 1AW7A 2H89B 1OFFA 1YX5B 2EMSA 2KTRB 1XCTL 2NS5A 1WGRA 2B76B 2I1KA 2ZVOA 2CS4A 4A8XC 3KYDD 4XZ4A 5I4DA 5LLIA 3RYTA 1WGDA 1E7VA 1N62A 2LJ5A 1TS3A 2PIAA 3RULA 5J2RA 1T5XD 2BWES 2IO2B 2MSED 2PPHA 3DVNU 1U4AA 1A70A 1XO3A 4K7WA 2EKEC 5D2MB 4IWPA 4JLCA 1F2RI 4HKQA 1Y56A 1YN3A 3GE8C 4KX6B 1WRIA 2BKFA 1V86A 4GOCA 4HPPA 2XBBC 1E5WA 3APFA 2JZZA 1KRHA 3PO0A 5C23A 1WXVA 2BW2A 4NAWA 2LI5A 2NPTB 2DENB 3DHIC 1EUVB 4A3OA 2LEKA 3HVZA 5AEKB 4WWMA 3D32A 4K3BA 2WXMA 2CR5A 1JWSD 5E6OA 4ARIA 3GS2A 1P3QU 4ZHOA 4II3B 2V9HA 2LVPA 3DQVA 3SU8X 4RMAA 2JYEA 1XLNA 3WA0A 2W3RA 2K5PA 3VR9B 2WXNA 2YLMA 3IG3A 4JIOU 3VUYA 4DXAB 3L0WB 1ZDVA 4LCDE 4IM3A 5BMIA 3Q14C 5MPOA 1J0GA 1GC7A 3AE2B 4KZ0A 1XLQA 2BGFA 1WXAA 2YVCA 4URKA 2KJRA 1P98A 3UQBA 1FNVA 3JW0X 2N9LA 5JHAA 1XD3B 3ECIA 4OVUA 3RUIB 2UYZB 4KKJA 1SEBD 3C0RB 2W3SA 3B08A 1KLGD 3N3KB 4C80A 1GAQB 3B9JA 3U4EG 4F8CB 4L2YA 3RNCC 2LZ6A 3BINA 4E74A 4GDLB 1UBIA 1E6EB 3QAQA 3QCAA 4OZBA 3L4PA 2IGHA 2HJ8A 1OEYJ 4MH8A 2JYTA 4EEWA 4MGKE 1JWUD 5L83A 1P9DU 3AE1B 5JZEB 2MBEA 3N20C 2YEPF 4WURA 2C5LC 2AL3A 3LXFA 4Q2JA 1J19A 2V3PA 2D3GA 2K8HA 3K9PB 3V62A 4YXDB 1SIFA 4PT5A 2LMCA 2IY1B 4HJKA 1HE8A 2QDFA 3SHQA 2BS4B 3VUWA 2FE8A 2KHWB 1KJTA 3VTVA 2C9WB 1E7PB 4KSLC 3JSVB 2AL6A 4OW0A 3ZKJC 2WXFA 1PUTA 2W82A 2N9PC 2RPQA 3I57A 3ALBA 4DK5A 5HKHA 3AE7B 1TS5A 2D3BA 3GOEA 1YN5A 2HE7A 4TV3A 3RNAC 4JQWC 4HRSA 5CHWA 2G45B 5D94A 2PKOA 1KFYB 3EFUA 3SD5A 3ZDTA 4BVUC 1CMXB 1HA5A 4JPSA 1SF0A 1NBFC 5TR5A 4NAWB 2WYQA 5C2TB 3RN9C 3BYTB 3EHVA 5H92C 3A9JA 1FNWA 2WXHA 1T0SC 1TY0A 2KXJA 1X1MA 1Q0WB 2D07B 1V1PB 3M62B 5GXGB 4EUTA 2D11A 1J8CA 4ASWC 4DWFA 4TSSA 3DVGX 2IBIB 1VZ7A 1J7BA 1J7CA 3O65B 1FFUA 3EA6A 4HVBA 2JWZA 4WWPA 2PTLA 1WGGA 5AZGA 2KLCA 2NCNA 1C76A 4ANWA 3TSSA 1K53A 4K1RB 3BWUD 2K9XA 4MJSB 1BMLC 2WXPA 3IHPC 2MLBA 5FR6A 4MH0E 2V1YA 1L6VA 2A4ZA 1B1ZA 1NENB 4B9KA 4XGAB 1ET9A 3H1UA 2KJHB 1XLPA 2MJEA 2WDQB 3CF6E 5DPSA 1WR1A 1I4QA 1L7YA 3QJZA 1LM8B 4GXBA 4GDKA 3IAS1 5DPTA 1IBXA 2V0GA 2MBHA 3AULA 4MSQB 2OHFA 3FKYA 4KVGB 4KGSA 1DYQA 3AH7A 1Q10A 2M1MA 2KOXA 2PMVA 3U8ZA 3W1SA 2N9XA 2J0JA 1PQSA 1IGCA 1PDXA 1KTKA 1TZOA 4JWSC 1FO4A 3PRZA 1F0ZA 3AEFB 2G4SA 2L7RA 2BPSA 3P2BA 2DZJA 1N63A 5JHBA 1NI3A 1YJJA 2V3SA 1NDDA 3MHZA 5T8IA 2LRUA 5IN7A 2XK5A 2WNMA 1DOYA 3AV8A 3B1LX 2MQJA 2LFIA 3HK0A 4MT5A 1TIFA 2VH1A 3AMZA 2JWUA 3N9YC 2XNAC 1MG8A 4WAFA 2KVRA 1FCLA 1I4XA 4DDGD 5DCNA 3KW5B 2JXXA 1GUAB 2BYVE 4XX5A 3OAWA 2CJOA 2BT6A 1TGZB 4LNIA 3Q3JA 1QOAA 4IG7B 4ZYNA 4AUQC 4CO7A 1L2NA 3WAPA 1F77A 4PK1A 4JWUC 3OWEB 4DBGA 2FNJB 1HTQA 1PGAA 2IPKD 1WSPA 1D5MC 1OGWA 3VFKA 1FD6A 1N60A 2JZ3B 1KM7A 2G1EA 4ZYSA 3AEGB 3W9CB 2Y5PA 3RNGC 1T0QC 4W9JA 4IKGA 4HCPB 4LJOB 3T3NA 1WX9A 3VRAB 3HM3A 3MC9A 4RGMA 4I6LB 5E6JA 3ZTCA 4JL9A 5FR3A 2OOBB 1F2RC 1VR9A 1RFAA 3IAM1 4FJZA 1ZPSA 1ISNA 1I35A 2DYMA 2CKHB 4ZDVA 1V81A 1RLFA 4W9LA 1TTNA 3NG0A 3KH0A 2KFKA 1SE4A 2WX1A 5KHOA 2QILA 3HRDD 3RMKC 3DCGA 1C9FA 3N1XC 4W9HA 3WAOA 1QZEA 1TKGA 4D2KA 4MGZE 3SEBA 1F52A 2NR2A 3KWVA 3HVDA 1D3ZA 2DYBA 4KIKA 1F1HA 2K6DB 1FIQA 3SR6A 4XE0A 3AE3B 3I5JC 3BZDB 2NMQA 1RFKA 1I4HA 2O6VB 2BS2B 2GOWA 1FEHA 2MBBB 2WDVB 5EE3A 2WDRB 1YJIA 1IBXB 1SGHA 4US8A 1ZE3D 3AEDB 2LWPA 3B2FA 3NHEB 4EOYA 4GMVA 4C4VB 1EO6A 3AN1A 2WXLA 3QARA 5D3IB 1NEKB 1EF1A 2IZVB 3N1YC 1UWMA 3DOWA 3QIJA 1V5TA 2AEHA 4IM0A 3L16A 3RPFC 1GB4A 3SDLC 1AYFA 1TT5B 3UIPB 2CHZA 1L0YB 4AWJA 3AI5A 2KTFA 3V60A 3NRZA 2O2VB 2LGIA 2QEJC 5LXIB 4LJPB 1D5XC 4GSWA 3WAMA 2RDHA 2L83A 3A33B 3N1ZC 4WJOA 3ZW3A 3Q8AA 2ZNVB 4C7YA 3P63A 4ARCA 4FA6A 2CJNA 1R4MB 2W55A 3AE8B 3Q3MC 1I7HA 2JF5A 3FC4A 4RF0A 1IP9A 3NS8A 3M63B 1WX7A 3L08A 2KC1A 1UBQA 2IO3B 3R7QA 2O6VD 1KLVA 3PVLA 4LDTB 4AQ7A 2BS3B 3ZNID 2IY0B 4LNOA 2KWUB 1K8RB 1VD2A 1WXQA 3AE9B 4N58A 2GBMA 1E90A 1V8CA 3IT6B 1JW9D 2GMIC 4AJYB 3A4SC 2AWTA 3PTFC 2LVQA 2ZPNA 5E6NA 3DBSA 3FILB 3P42A 4MGYE 3PZDA 3P4PB 2Y5CA 1ZXHA 2K1FA 1VCBA 2JSVX 2WXRA 3L10B 4FBJB 4F7ZA 1T0RC 2E3TA 2NVUI 3KUZA 5EE9A 2V4IB 1Z5SB 3OJ3A 4M8MA 4NQKE 3Q8FA 2GRIA 1FXIA 1T6BX 1TY2A 1AWDA 1OTRB 2EKIA 5BYQA 4TQ0A 3PHXB 2Y5BB 1IYFA 1FRDA 2G3QB 4YSYB 4XDCA 1ZP0B 3ZXRA 2ONQA 1FXTB 4IWOA 2Z59B 3VTUA 2BBCA 2JVCA 4LDTD 3H8HA 4CYEA 5IA7A 3DWMA 3SFEB 1MHXA 3IFWB 2W9NA 4A6QA 1FM0D 3QQ8B 2WS3B 4NNJB 4RFBA 3UI3A 4FJVB 5DPRA 2VZKB 2J0KA 1WWTA 3V3XA 2KWDA 5LXHA 2NBVB 2IYDB 1ZW7A 5G55A 1G6JA 3U52E 4NY0A 1L0VB 3OG5A 4L1BA 1RYJA 2MH7A 3CMMB 1B9RA 4MSMB 4WJPA 4CQNA 3PT2B 2HTHA 5AZFA 5LNK1 4NJ6A 4MM3B 4ZHPA 4RM9A 1GJZA 4EFOA 1XEEA 3V05A 1MFWA 3KQ4A 3ZRFA 5H8YE 1H8CA 2MCNB 5IO9A 1JRPA 5AUKA 3MC8A 4ICVA 5EE1A 1C3TA 3DWGC 3BVGA 1M4VA 4JX1C 3GP7A 3RCZA 3AB5A 3T8MA 2GB1A 1TS4A 1BUIC 4W9FA 2BTEA 1GNUA 4A55A 1CQVA 4WQOB 5BO4B 2KDEB 1XXGA 2RDGA 3U2SC 1ZDXA 4KGTA 3CIRB 2OEDA 1FRRA 1FNUA 1GPXA 5EE0A 4LTUA 3Q8EA 2MJDA 2FBWB 3W5UB 4RGTA 1YJ1A 4C7ZA 3CWIA 4HEA1 1MI0A 1OQYA 3BK2A 2ZCCA 4XYCA 5CX3A 1WFYA 3AE4B 3ZJVA 1MPEA 3Q3NC 2ZVNA 3ML9A 4RNAA 5J18A 2BB5A 1CZPA 1ZUD2 4W9GA 4NJCA 3ONSA 2KNBA 3RFZB 3FAHA 3H6NA 1ROEA 3H7PA 4NJ7A 2J0MA 2MJ3A 2QIEB 4AS1A 2KWVB 2NTTA 1I4RA 2JRHA 4S17A 5IKCM 2NBWB 3AEBB 3P4SB 5D6JB 2UWQA 2KYWA 4BOSC 2E6XA 2C7NB 3KUCB 4G50A 1A5RA 1QF6A 4HWIB 2DYOA 2L0TA 3T3OA 2Z8LA 2C60A 1CJEA 2ON8A 3ZNZB 1IPGA 1L5PA 1M94A 1I42A 2K25A 2BWFA 4C56C 3L17A 2WQYB 3ENEA 3BY4B 3DDCB 4BZAA 4FULA 2PJHA 3GB1A 3T9LA 4NAMA 4K3CA 4XC2A 2DX5B 3DHHC 2J53A 2QC8A 4BKTA 3O13A 1V9JA 4B0EA 1HTOA 2L00B 1ZXIA 3RT3B 4W9EA 2INCC 4BBNF 1GB1A 4BFRA 1UH6A 2JXTA 2WU5B 3MJ5A 4AOFA 2WXOA 2QSDA 4N9F4 1QLBB 3EUB2 4K7UA 2BYTA 4BAXA 2INDC 5E6PA 1LO5D 5CHVC 4KSKC 4WQMA 2BYEA 1SJED 2SAKA 3E9SA 3C19A 3HM6X 1L6UA 4DHZB 1UUPA 3H7SA 4P1BC 4XWTA 4J3OD 4BKSA 3TEZA 5C1ZA 2ZW1A
chains in the Genus database with same CATH topology
2JRIB 4WWNA 2Z0EB 5L95C 3ZTDA 4W9JA 2RGFA 2G4DB 4HCPB 4MJSA 2D10A 4LJOB 1WX9A 2V4LA 2N1WA 3HM3A 2JT4B 4IWQA 3QC8B 2DHZA 4I6LB 3ZTCA 1WIAA 1WI0A 4G0NB 4JL9A 3ML8A 4WJQA 2K6QA 4M8NA 2OOBB 3A4RA 4FLHA 2ZNVC 1RFAA 1E7UA 1Z2MA 4GN1A 2LXCA 4GDLA 3IVFA 4FJZA 3H9DA 4HDOA 5CHFA 1ISNA 1E8ZA 1I35A 4K81A 5KHQA 2FIDA 2KMCA 2DYMA 2LUEA 4EZLA 2CKHB 1F9JA 1WR6E 4ZDVA 1V81A 1RLFA 4DHJB 4W9LA 1TTNA 1XQQA 3RD2A 1WMHA 3KH0A 2MBOA 2KFKA 1YQBA 2N1VA 4M0WB 2WX1A 4ZRKA 4MEMA 5KHOA 2MW5A 3DCGA 1E8WA 3L13A 1NI2A 2Z0DB 4W9HA 4WJNA 3WAOA 1QZEA 1YX5B 2EMSA 2KTRB 2NS5A 1WGRA 1V49A 4MGZE 2MA9B 2I1KA 2ZVOA 2CS4A 2NR2A 1D3ZA 2RR9A 3KYDD 4XZ4A 1KOTA 2DYBA 4HK2A 4KIKA 5LLIA 3V6EB 3RYTA 2K6DB 1WGYA 1WGDA 1E7VA 2LJ5A 3PRPB 3RULA 1Y8RC 5J2RA 2IO2B 2BWES 2MSED 2LD9A 2O6VB 4E3CA 2PPHA 3W1YA 4ANXA 3DVNU 3WIMA 1U4AA 4E71A 2GOWA 2MBBB 3KUDB 4IM2A 2EKEC 4K7WA 3DPDA 1UELA 2IO1B 3LDZE 1SGHA 5D2MB 3UIOB 4ZRJA 2CHWA 4IWPA 4JLCA 2LWPA 2M4NA 3NHEB 2IO0B 4JGHB 4EOYA 1LFDA 4GMVA 1EO6A 3PS6A 3QARA 2MP2A 2BKFA 4GOCA 1V86A 4GGQA 1EF1A 2IZVB 2FAZA 2XBBC 1E5WA 1P1AA 3DVGY 2AYOB 4HXDA 3APFA 4W9DA 3TJPA 3DOWA 2JZZA 3QIJA 1V5TA 1WZ0A 4A3PA 2AEHA 2KLGA 4IM0A 4KDLB 3X23A 3L16A 2B3AA 3AXCA 5C23A 2KC2A 4PYZA 3SDLC 4EZJA 4HCNB 3UIPB 1WXVA 2LGYA 1S3SG 3JYUA 4NAWA 2LI5A 2CHZA 2NPTB 3A9KB 2DENB 4K7SA 4AWJA 1EUVB 4NQLB 2KFJA 3AI5A 3QX1A 4A3OA 2JY6A 2KTFA 5AZHA 3V60A 3ZLZA 5AEKB 1GC6A 2O2VB 4KDIC 3D32A 3KYCD 2NBUA 3OLMD 1H4RA 1S1QB 2CR5A 1WE6A 2R2QA 4GU2A 5E6OA 3W1SC 4W9KA 5LXIB 4LJPB 2CU1A 1P3QU 4II3B 4KV2A 4GSWA 2LVPA 3WAMA 3DQVA 3A33B 4PS7A 3SU8X 3QA8A 2KMAA 4RMAA 4I6NB 2M0XA 4WJOA 3ZW3A 3M95A 1E8XA 1V6EA 3WA0A 2WWZA 2ZNVB 2FCNA 2YLMA 3IG3A 4JIOU 3VUYA 4DXAB 3L0WB 4FA6A 3VDZA 2KQ7A 4X57B 4BKGA 3A9JB 2JF5A 4LCDE 4IM3A 4EKUA 1WJNA 1T0YA 1IP9A 3NS8A 2ZEQA 3M63B 1WX7A 3L54A 3PREA 3L08A 1J0GA 3ZIMA 3QK0A 1GC7A 2DZKA 2KC1A 2LRWA 1UBQA 4KZ0A 3ZDMC 2IO3B 3R7QA 3VXWA 2BGFA 2O6VD 2A5UA 1WXAA 1KLVA 3PVLA 3MTNB 2JPHA 4LDTB 2YVCA 1YX6B 3ZNID 3R7RA 4URKA 2KJRA 2GBNA 3S2AA 1P0RA 1P98A 1TZ1A 2IY0B 2KX3A 2OJRA 2RSUA 3LJ3A 3UQBA 2KX0A 3JW0X 2KZRA 2R2OA 2KWUB 4AP4C 2EMTA 1K8RB 1VD2A 4FN2A 5JHAA 3PGEA 1XD3B 3ECIA 2GBMA 4OVUA 3RUIB 2UYZB 1E90A 1R4NI 2DAFA 2WDTB 3MJWA 2GMIC 3C0RB 3A4SC 4AJYB 2RD0A 3B08A 2AWTA 3N3KB 3PTFC 2LVQA 2KQSA 2ZPNA 5E6NA 3DBSA 4MGYE 4F8CB 2KTRA 3R3MA 1EF5A 3RZFA 2LZ6A 3BINA 4E74A 3PZDA 4GDLB 1UBIA 3EC8A 3QAQA 3UQAA 2K1FA 3QCAA 4ZRIA 1VCBA 3AU4A 4IUMB 3TCAA 1UGMA 2BYFA 3L10B 2KO3A 4FBJB 3U30A 4F7ZA 3WANA 2HJ8A 2NVUI 1OEYJ 3KUZA 4DDID 4EEWA 1WF9A 2KWCA 4MGKE 2KDBA 2LASA 1Z5SB 2WX0A 3OJ3A 3NZSA 1P9DU 4II2B 4M8MA 4NQKE 2O6VA 4DHZE 5L83A 3MHSD 5JZEB 4GDKB 3DBLI 2MBEA 2C7MB 2KANA 1WXMA 2N4FA 3ZVVA 2C5LC 2AL3A 3A1QA 1WZ3A 1V2YA 3QHTA 1J19A 1OTRB 2D3GA 2K8HA 1WJ6A 3K9PB 2PE9A 3V62A 2M8SA 4ANUA 1SIFA 3PLVA 4TQ0A 1Q5WB 3V6CB 3UF8A 2IY1B 2BF8B 3H7PB 3PHXB 2Y5BB 4HJKA 1IYFA 2L8JA 1HE8A 4BOZB 2G3QB 2ZJDA 3SHQA 3CSTA 4PYUA 2QHOA 2KHWB 3VUWA 4P7IA 1FXTB 1KJTA 1UZXB 2MBQA 3VTVA 2C9WB 1WJ4A 2L76A 4KSLC 3NZUA 3JSVB 1TBEA 3UINB 3VH4B 2AL6A 2KKCA 4IWOA 2Z59B 3DBRI 3TBLD 2FIFA 3ZKJC 3VTUA 2CHXA 1SE9A 5D7GA 2N9PC 2RPQA 2JVCA 5CTRC 4LDTD 4CYEA 5IA7A 3ALBA 3VTWA 4DK5A 5HKHA 3IFWB 2O2VA 5GMVA 2W9NA 3JVZX 3GOEA 2XK5B 3QQ8B 3K9OB 4NNJB 2HE7A 4KZCA 4W9CA 3ZO5B 4TV3A 1WE7A 3WALA 4HDQA 1Q1OA 4FJVB 3NOBA 5DPRA 4MGIE 2J7QB 4JQWC 5CHWA 1BT0A 2G45B 4HPMB 5D94A 4DHJD 2D2QA 2J0KA 3UGBB 3EFUA 3SD5A 3TL5A 3ZDTA 4BVUC 5LXHA 2NBVB 1CMXB 2IYDB 2K8CA 4IC7B 4AJWA 1ZW7A 1NBFC 3VQIA 5TR5A 4NAWB 5G55A 2WYQA 3EECA 1G6JA 3M3JA 4HPLB 4NY0A 3EHVA 3A9JA 3CMMB 5J17A 4PS3A 2KXJA 5DPWA 4MSMB 4WJPA 2FUHB 3PT2B 3PSEB 2HTHA 5AZFA 4NJ6A 1X1MA 3N30A 1Q0WB 4RM9A 2D07B 2ZPYA 1GJZA 2M17A 4EFOA 3M62B 3ZRFA 4EUTA 2D11A 1J8CA 4ASWC 3ZNHB 4DWFA 3DVGX 3N32A 2IBIB 3TIXA 1H8CA 2MCNB 3I3TB 4J6IA 4ICVA 4G11A 1C3TA 1V5OA 2LGDA 3O65B 4NPNA 4HVBA 2FCQA 3VHTC 3RCZA 1WJUA 2JWZA 1XT9B 2LVOA 3U7DA 4F1SA 4WWPA 3T8MA 1WGGA 5AZGA 2KLCA 2NCNA 3APCA 4ANWA 5EDSA 4W9FA 3IBEA 1GNUA 4FJYA 4K1RB 3QWZB 4WQOB 3HHMA 4MJSB 5BO4B 2I1JA 3IHPC 2KDEB 2MLBA 4G3XB 5FR6A 1RAXA 4MH0E 2KN5A 2V1YA 1LXDA 2A4ZA 2KJ6A 4B9KA 3H1UA 2KJHB 2ASQA 1UD7A 3HIZA 3TMPB 2KDIA 3CF6E 1YJ1A 5DPSA 2K8BA 1WR1A 4RM8A 1OQYA 2ZCCA 1L7YA 3QJZA 5CX3A 1LM8B 1WFYA 2HD5B 4GXBA 1WMHB 1WX8A 4GDKA 2KFKB 4MDKE 1LQBA 5DPTA 1ZKHA 3VH3B 2ZVNA 1V80A 3OJ4B 3ML9A 2C7HA 2MBHA 3AULA 3DVNV 4EZKA 5J18A 1YD8U 4MSQB 1WRDB 4W9GA 2N7DA 3ONSA 3PPAA 2KNBA 4KVGB 4YL8A 3H7PA 3H6NA 4NJ7A 1OEYA 4WWOA 2J0MA 2REXA 2DZIA 2KWVB 2M1MA 2MRPA 2KOXA 3U8ZA 2JRHA 4KIKB 4GIVA 2NBWB 2N9XA 3PLUA 2MX2A 3W1SA 2J0JA 1PQSA 1YIWA 5D6JB 2UWQA 4BOSC 2ZZPB 2C7NB 3KUCB 3PRZA 4G50A 1A5RA 2L0FA 4IW0A 2G4SA 3B0AA 3JSVA 2DYOA 4HWIB 1WYWB 2L7RA 2BPSA 2JUOA 2L0TA 2DZJA 2C60A 3P2BA 3A1QB 2XEWA 1JRUA 3ZNZB 5JHBA 2GBKA 1IPGA 4BBNC 1M94A 2V3SA 2NPTA 4TKNA 3A9KA 4W9IA 1NDDA 2DAJA 2LRUA 3RZWC 1AARA 1WM3A 1I42A 2K25A 2BWFA 2KDFB 5IAAC 1R4MI 4WAAA 2XK5A 3ZNGC 3L17A 5JH5C 3ENEA 2L3ZA 3BY4B 3DDCB 1RRBA 2MP2B 2ZCBA 4FULA 3ZRCA 2PJHA 3B1LX 2MQJA 4PS8A 3T9LA 4BKSD 4XC2A 2DX5B 2LXAA 2N7EA 3AU5A 3HK0A 1WM2A 4BKTA 3PRMB 2LGXA 1V9JA 1WY8A 3DBHI 2PE6B 1MG8A 3R66C 2KVRA 3PV1A 2L00B 4DDGD 5DCNA 3KW5B 1WGHA 2JXXA 3APDA 3RT3B 1GUAB 1WH3A 2BYVE 2K39A 2L05A 4W9EA 4XX5A 4BBNF 3OAWA 4OVVA 1UH6A 4BFRA 2N9EB 3V61A 2FCSA 4A20A 1TGZB 3NY5A 3Q3FA 4AOFA 4GB9A 1ZGUB 3X0WA 3Q3JA 4N9F4 4IG7B 4ZYNA 4AUQC 3GZNI 4HLEA 4CO7A 1WXSA 3CSFA 3PHWB 4K7UA 3WAPA 1L2NA 4FADA 3KVFB 3VVWB 1GG3A 4MM3A 4DBGA 2FNJB 4I6PA 2BKRB 1C1YB 5G2NA 4CHKA 4TUUA 5E6PA 2VRRB 1OGWA 4FHKA 2GBRA 5CHVC 4KSKC 2BYEA 3VFKA 4ICUA 2DZMA 3HM6X 4B6WA 2JZ3B 4FHJA 1KM7A 4DHZB 2PEAA 3H7SA 2KD0A 1E8YA 4MELA 3VAWA 3ZUNA 4B95A 2GBJA 4ANVA 4BKSA 2FCMA 2KK8A 2MWSB 3VUXA 5C1ZA 4TQ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JRI B;  4WWN A;  2Z0E B;  5L95 C;  3ZTD A;  4W9J A;  2RGF A;  2G4D B;  4HCP B;  4MJS A;  2D10 A;  4LJO B;  1WX9 A;  2V4L A;  2N1W A;  3HM3 A;  2JT4 B;  4IWQ A;  3QC8 B;  2DHZ A;  4I6L B;  3ZTC A;  1WIA A;  1WI0 A;  4G0N B;  4JL9 A;  3ML8 A;  4WJQ A;  2K6Q A;  4M8N A;  2OOB B;  3A4R A;  4FLH A;  2ZNV C;  1RFA A;  1E7U A;  1Z2M A;  4GN1 A;  2LXC A;  4GDL A;  3IVF A;  4FJZ A;  3H9D A;  4HDO A;  5CHF A;  1ISN A;  1E8Z A;  1I35 A;  4K81 A;  5KHQ A;  2FID A;  2KMC A;  2DYM A;  2LUE A;  4EZL A;  2CKH B;  1F9J A;  1WR6 E;  4ZDV A;  1V81 A;  1RLF A;  4DHJ B;  4W9L A;  1TTN A;  1XQQ A;  3RD2 A;  1WMH A;  3KH0 A;  2MBO A;  2KFK A;  1YQB A;  2N1V A;  4M0W B;  2WX1 A;  4ZRK A;  4MEM A;  5KHO A;  2MW5 A;  3DCG A;  1E8W A;  3L13 A;  1NI2 A;  2Z0D B;  4W9H A;  4WJN A;  3WAO A;  1QZE A;  1YX5 B;  2EMS A;  2KTR B;  2NS5 A;  1WGR A;  1V49 A;  4MGZ E;  2MA9 B;  2I1K A;  2ZVO A;  2CS4 A;  2NR2 A;  1D3Z A;  2RR9 A;  3KYD D;  4XZ4 A;  1KOT A;  2DYB A;  4HK2 A;  4KIK A;  5LLI A;  3V6E B;  3RYT A;  2K6D B;  1WGY A;  1WGD A;  1E7V A;  2LJ5 A;  3PRP B;  3RUL A;  1Y8R C;  5J2R A;  2IO2 B;  2BWE S;  2MSE D;  2LD9 A;  2O6V B;  4E3C A;  2PPH A;  3W1Y A;  4ANX A;  3DVN U;  3WIM A;  1U4A A;  4E71 A;  2GOW A;  2MBB B;  3KUD B;  4IM2 A;  2EKE C;  4K7W A;  3DPD A;  1UEL A;  2IO1 B;  3LDZ E;  1SGH A;  5D2M B;  3UIO B;  4ZRJ A;  2CHW A;  4IWP A;  4JLC A;  2LWP A;  2M4N A;  3NHE B;  2IO0 B;  4JGH B;  4EOY A;  1LFD A;  4GMV A;  1EO6 A;  3PS6 A;  3QAR A;  2MP2 A;  2BKF A;  4GOC A;  1V86 A;  4GGQ A;  1EF1 A;  2IZV B;  2FAZ A;  2XBB C;  1E5W A;  1P1A A;  3DVG Y;  2AYO B;  4HXD A;  3APF A;  4W9D A;  3TJP A;  3DOW A;  2JZZ A;  3QIJ A;  1V5T A;  1WZ0 A;  4A3P A;  2AEH A;  2KLG A;  4IM0 A;  4KDL B;  3X23 A;  3L16 A;  2B3A A;  3AXC A;  5C23 A;  2KC2 A;  4PYZ A;  3SDL C;  4EZJ A;  4HCN B;  3UIP B;  1WXV A;  2LGY A;  1S3S G;  3JYU A;  4NAW A;  2LI5 A;  2CHZ A;  2NPT B;  3A9K B;  2DEN B;  4K7S A;  4AWJ A;  1EUV B;  4NQL B;  2KFJ A;  3AI5 A;  3QX1 A;  4A3O A;  2JY6 A;  2KTF A;  5AZH A;  3V60 A;  3ZLZ A;  5AEK B;  1GC6 A;  2O2V B;  4KDI C;  3D32 A;  3KYC D;  2NBU A;  3OLM D;  1H4R A;  1S1Q B;  2CR5 A;  1WE6 A;  2R2Q A;  4GU2 A;  5E6O A;  3W1S C;  4W9K A;  5LXI B;  4LJP B;  2CU1 A;  1P3Q U;  4II3 B;  4KV2 A;  4GSW A;  2LVP A;  3WAM A;  3DQV A;  3A33 B;  4PS7 A;  3SU8 X;  3QA8 A;  2KMA A;  4RMA A;  4I6N B;  2M0X A;  4WJO A;  3ZW3 A;  3M95 A;  1E8X A;  1V6E A;  3WA0 A;  2WWZ A;  2ZNV B;  2FCN A;  2YLM A;  3IG3 A;  4JIO U;  3VUY A;  4DXA B;  3L0W B;  4FA6 A;  3VDZ A;  2KQ7 A;  4X57 B;  4BKG A;  3A9J B;  2JF5 A;  4LCD E;  4IM3 A;  4EKU A;  1WJN A;  1T0Y A;  1IP9 A;  3NS8 A;  2ZEQ A;  3M63 B;  1WX7 A;  3L54 A;  3PRE A;  3L08 A;  1J0G A;  3ZIM A;  3QK0 A;  1GC7 A;  2DZK A;  2KC1 A;  2LRW A;  1UBQ A;  4KZ0 A;  3ZDM C;  2IO3 B;  3R7Q A;  3VXW A;  2BGF A;  2O6V D;  2A5U A;  1WXA A;  1KLV A;  3PVL A;  3MTN B;  2JPH A;  4LDT B;  2YVC A;  1YX6 B;  3ZNI D;  3R7R A;  4URK A;  2KJR A;  2GBN A;  3S2A A;  1P0R A;  1P98 A;  1TZ1 A;  2IY0 B;  2KX3 A;  2OJR A;  2RSU A;  3LJ3 A;  3UQB A;  2KX0 A;  3JW0 X;  2KZR A;  2R2O A;  2KWU B;  4AP4 C;  2EMT A;  1K8R B;  1VD2 A;  4FN2 A;  5JHA A;  3PGE A;  1XD3 B;  3ECI A;  2GBM A;  4OVU A;  3RUI B;  2UYZ B;  1E90 A;  1R4N I;  2DAF A;  2WDT B;  3MJW A;  2GMI C;  3C0R B;  3A4S C;  4AJY B;  2RD0 A;  3B08 A;  2AWT A;  3N3K B;  3PTF C;  2LVQ A;  2KQS A;  2ZPN A;  5E6N A;  3DBS A;  4MGY E;  4F8C B;  2KTR A;  3R3M A;  1EF5 A;  3RZF A;  2LZ6 A;  3BIN A;  4E74 A;  3PZD A;  4GDL B;  1UBI A;  3EC8 A;  3QAQ A;  3UQA A;  2K1F A;  3QCA A;  4ZRI A;  1VCB A;  3AU4 A;  4IUM B;  3TCA A;  1UGM A;  2BYF A;  3L10 B;  2KO3 A;  4FBJ B;  3U30 A;  4F7Z A;  3WAN A;  2HJ8 A;  2NVU I;  1OEY J;  3KUZ A;  4DDI D;  4EEW A;  1WF9 A;  2KWC A;  4MGK E;  2KDB A;  2LAS A;  1Z5S B;  2WX0 A;  3OJ3 A;  3NZS A;  1P9D U;  4II2 B;  4M8M A;  4NQK E;  2O6V A;  4DHZ E;  5L83 A;  3MHS D;  5JZE B;  4GDK B;  3DBL I;  2MBE A;  2C7M B;  2KAN A;  1WXM A;  2N4F A;  3ZVV A;  2C5L C;  2AL3 A;  3A1Q A;  1WZ3 A;  1V2Y A;  3QHT A;  1J19 A;  1OTR B;  2D3G A;  2K8H A;  1WJ6 A;  3K9P B;  2PE9 A;  3V62 A;  2M8S A;  4ANU A;  1SIF A;  3PLV A;  4TQ0 A;  1Q5W B;  3V6C B;  3UF8 A;  2IY1 B;  2BF8 B;  3H7P B;  3PHX B;  2Y5B B;  4HJK A;  1IYF A;  2L8J A;  1HE8 A;  4BOZ B;  2G3Q B;  2ZJD A;  3SHQ A;  3CST A;  4PYU A;  2QHO A;  2KHW B;  3VUW A;  4P7I A;  1FXT B;  1KJT A;  1UZX B;  2MBQ A;  3VTV A;  2C9W B;  1WJ4 A;  2L76 A;  4KSL C;  3NZU A;  3JSV B;  1TBE A;  3UIN B;  3VH4 B;  2AL6 A;  2KKC A;  4IWO A;  2Z59 B;  3DBR I;  3TBL D;  2FIF A;  3ZKJ C;  3VTU A;  2CHX A;  1SE9 A;  5D7G A;  2N9P C;  2RPQ A;  2JVC A;  5CTR C;  4LDT D;  4CYE A;  5IA7 A;  3ALB A;  3VTW A;  4DK5 A;  5HKH A;  3IFW B;  2O2V A;  5GMV A;  2W9N A;  3JVZ X;  3GOE A;  2XK5 B;  3QQ8 B;  3K9O B;  4NNJ B;  2HE7 A;  4KZC A;  4W9C A;  3ZO5 B;  4TV3 A;  1WE7 A;  3WAL A;  4HDQ A;  1Q1O A;  4FJV B;  3NOB A;  5DPR A;  4MGI E;  2J7Q B;  4JQW C;  5CHW A;  1BT0 A;  2G45 B;  4HPM B;  5D94 A;  4DHJ D;  2D2Q A;  2J0K A;  3UGB B;  3EFU A;  3SD5 A;  3TL5 A;  3ZDT A;  4BVU C;  5LXH A;  2NBV B;  1CMX B;  2IYD B;  2K8C A;  4IC7 B;  4AJW A;  1ZW7 A;  1NBF C;  3VQI A;  5TR5 A;  4NAW B;  5G55 A;  2WYQ A;  3EEC A;  1G6J A;  3M3J A;  4HPL B;  4NY0 A;  3EHV A;  3A9J A;  3CMM B;  5J17 A;  4PS3 A;  2KXJ A;  5DPW A;  4MSM B;  4WJP A;  2FUH B;  3PT2 B;  3PSE B;  2HTH A;  5AZF A;  4NJ6 A;  1X1M A;  3N30 A;  1Q0W B;  4RM9 A;  2D07 B;  2ZPY A;  1GJZ A;  2M17 A;  4EFO A;  3M62 B;  3ZRF A;  4EUT A;  2D11 A;  1J8C A;  4ASW C;  3ZNH B;  4DWF A;  3DVG X;  3N32 A;  2IBI B;  3TIX A;  1H8C A;  2MCN B;  3I3T B;  4J6I A;  4ICV A;  4G11 A;  1C3T A;  1V5O A;  2LGD A;  3O65 B;  4NPN A;  4HVB A;  2FCQ A;  3VHT C;  3RCZ A;  1WJU A;  2JWZ A;  1XT9 B;  2LVO A;  3U7D A;  4F1S A;  4WWP A;  3T8M A;  1WGG A;  5AZG A;  2KLC A;  2NCN A;  3APC A;  4ANW A;  5EDS A;  4W9F A;  3IBE A;  1GNU A;  4FJY A;  4K1R B;  3QWZ B;  4WQO B;  3HHM A;  4MJS B;  5BO4 B;  2I1J A;  3IHP C;  2KDE B;  2MLB A;  4G3X B;  5FR6 A;  1RAX A;  4MH0 E;  2KN5 A;  2V1Y A;  1LXD A;  2A4Z A;  2KJ6 A;  4B9K A;  3H1U A;  2KJH B;  2ASQ A;  1UD7 A;  3HIZ A;  3TMP B;  2KDI A;  3CF6 E;  1YJ1 A;  5DPS A;  2K8B A;  1WR1 A;  4RM8 A;  1OQY A;  2ZCC A;  1L7Y A;  3QJZ A;  5CX3 A;  1LM8 B;  1WFY A;  2HD5 B;  4GXB A;  1WMH B;  1WX8 A;  4GDK A;  2KFK B;  4MDK E;  1LQB A;  5DPT A;  1ZKH A;  3VH3 B;  2ZVN A;  1V80 A;  3OJ4 B;  3ML9 A;  2C7H A;  2MBH A;  3AUL A;  3DVN V;  4EZK A;  5J18 A;  1YD8 U;  4MSQ B;  1WRD B;  4W9G A;  2N7D A;  3ONS A;  3PPA A;  2KNB A;  4KVG B;  4YL8 A;  3H7P A;  3H6N A;  4NJ7 A;  1OEY A;  4WWO A;  2J0M A;  2REX A;  2DZI A;  2KWV B;  2M1M A;  2MRP A;  2KOX A;  3U8Z A;  2JRH A;  4KIK B;  4GIV A;  2NBW B;  2N9X A;  3PLU A;  2MX2 A;  3W1S A;  2J0J A;  1PQS A;  1YIW A;  5D6J B;  2UWQ A;  4BOS C;  2ZZP B;  2C7N B;  3KUC B;  3PRZ A;  4G50 A;  1A5R A;  2L0F A;  4IW0 A;  2G4S A;  3B0A A;  3JSV A;  2DYO A;  4HWI B;  1WYW B;  2L7R A;  2BPS A;  2JUO A;  2L0T A;  2DZJ A;  2C60 A;  3P2B A;  3A1Q B;  2XEW A;  1JRU A;  3ZNZ B;  5JHB A;  2GBK A;  1IPG A;  4BBN C;  1M94 A;  2V3S A;  2NPT A;  4TKN A;  3A9K A;  4W9I A;  1NDD A;  2DAJ A;  2LRU A;  3RZW C;  1AAR A;  1WM3 A;  1I42 A;  2K25 A;  2BWF A;  2KDF B;  5IAA C;  1R4M I;  4WAA A;  2XK5 A;  3ZNG C;  3L17 A;  5JH5 C;  3ENE A;  2L3Z A;  3BY4 B;  3DDC B;  1RRB A;  2MP2 B;  2ZCB A;  4FUL A;  3ZRC A;  2PJH A;  3B1L X;  2MQJ A;  4PS8 A;  3T9L A;  4BKS D;  4XC2 A;  2DX5 B;  2LXA A;  2N7E A;  3AU5 A;  3HK0 A;  1WM2 A;  4BKT A;  3PRM B;  2LGX A;  1V9J A;  1WY8 A;  3DBH I;  2PE6 B;  1MG8 A;  3R66 C;  2KVR A;  3PV1 A;  2L00 B;  4DDG D;  5DCN A;  3KW5 B;  1WGH A;  2JXX A;  3APD A;  3RT3 B;  1GUA B;  1WH3 A;  2BYV E;  2K39 A;  2L05 A;  4W9E A;  4XX5 A;  4BBN F;  3OAW A;  4OVV A;  1UH6 A;  4BFR A;  2N9E B;  3V61 A;  2FCS A;  4A20 A;  1TGZ B;  3NY5 A;  3Q3F A;  4AOF A;  4GB9 A;  1ZGU B;  3X0W A;  3Q3J A;  4N9F 4;  4IG7 B;  4ZYN A;  4AUQ C;  3GZN I;  4HLE A;  4CO7 A;  1WXS A;  3CSF A;  3PHW B;  4K7U A;  3WAP A;  1L2N A;  4FAD A;  3KVF B;  3VVW B;  1GG3 A;  4MM3 A;  4DBG A;  2FNJ B;  4I6P A;  2BKR B;  1C1Y B;  5G2N A;  4CHK A;  4TUU A;  5E6P A;  2VRR B;  1OGW A;  4FHK A;  2GBR A;  5CHV C;  4KSK C;  2BYE A;  3VFK A;  4ICU A;  2DZM A;  3HM6 X;  4B6W A;  2JZ3 B;  4FHJ A;  1KM7 A;  4DHZ B;  2PEA A;  3H7S A;  2KD0 A;  1E8Y A;  4MEL A;  3VAW A;  3ZUN A;  4B95 A;  2GBJ A;  4ANV A;  4BKS A;  2FCM A;  2KK8 A;  2MWS B;  3VUX A;  5C1Z A;  4TQ1 A; 
#chains in the Genus database with same CATH topology
 2JRI B;  2D5G A;  4LLG M;  2KVZ A;  2LHD A;  2N1W A;  3NVV A;  4O1N A;  2KQ4 X;  1WI0 A;  4M8N A;  1EU3 A;  2ZNV C;  1MHH E;  3IVF A;  1OQR A;  3H9D A;  4K81 A;  1D4B A;  2LUE A;  1FXA A;  1WR6 E;  4DHJ B;  1XQQ A;  3Q6B A;  1WMH A;  2N1V A;  1L4D B;  3B2G A;  1E8W A;  1NI2 A;  2Z0D B;  2KN4 A;  1V49 A;  2MA9 B;  1QOB A;  3SFD B;  2R61 A;  4HK2 A;  3V6E B;  2KMM A;  4YTN B;  1QKZ A;  4LNK A;  2LD9 A;  4E3C A;  3W1Y A;  4ANX A;  3WIM A;  4E71 A;  4DXG A;  2RPV A;  4LNF A;  5BMH A;  4IM2 A;  1UEL A;  1K50 A;  5BMG A;  1ET6 A;  5C3J B;  3LDZ E;  4ZRJ A;  2CHW A;  3IT4 B;  3NS1 A;  4OHJ A;  3PS6 A;  2MP2 A;  1VZ8 A;  2FAZ A;  4XWW A;  1P1A A;  2AYO B;  1HQR D;  4HXD A;  3TJP A;  1NYR A;  1WZ0 A;  4KDL B;  2B3A A;  2VH2 A;  4PYZ A;  4HCN B;  2LGY A;  1S3S G;  3JYU A;  3AEA B;  3QX1 A;  2JY6 A;  3GE3 C;  3OLM D;  1ACC A;  4ZRQ A;  4W9K A;  3C8Y A;  5IP4 D;  1P7E A;  4PS7 A;  3QA8 A;  1L0X B;  2M0X A;  1E8X A;  1V6E A;  2WWZ A;  2FCN A;  3I9V 1;  2RMM A;  4REZ A;  3P4Q B;  3A9J B;  1WJN A;  3MP9 A;  2TSS A;  3ZIM A;  3QK0 A;  2I38 A;  2LRW A;  4H2A A;  4RF1 A;  3VXW A;  2JPH A;  1RM6 C;  1YX6 B;  2WHI A;  3R7R A;  1TZ1 A;  2KX3 A;  3LJ3 A;  4FXC A;  4AP4 C;  4FN2 A;  3PGE A;  4HKZ E;  1R4N I;  2WDT B;  2PVO D;  3MJW A;  1DOI A;  2KAJ A;  2IGG A;  2KTR A;  3R3M A;  4GLS C;  1EF5 A;  3URY A;  4WIP A;  3UQA A;  4ZRI A;  3AU4 A;  3TCA A;  1UGJ A;  2BYF A;  1TYG B;  2KO3 A;  3WAN A;  1N5W A;  2KDB A;  2LAS A;  2WX0 A;  5HFY A;  1C4P A;  2W54 A;  3MHS D;  4GDK B;  2KAN A;  1WXM A;  2N4F A;  3Q8B A;  3A1Q A;  1WZ3 A;  2BVC A;  4ITK A;  4C00 A;  4IOI E;  1V2Y A;  4ANU A;  1VLB A;  3UF8 A;  1R4N B;  4BOZ B;  1YN4 A;  1PFD A;  4PYU A;  2QHO A;  4P7I A;  2JX5 A;  1WJ4 A;  2L76 A;  1NVI D;  3UIN B;  3VH4 B;  2KKC A;  3DBR I;  3TBL D;  2FIF A;  1SE9 A;  1I4G A;  5D7G A;  5G5G A;  5CTR C;  1JCK B;  5GMV A;  3JVZ X;  2L32 A;  5FKA C;  2XK5 B;  3K9O B;  4KZC A;  3ZO5 B;  1WE7 A;  3WAL A;  1N5X A;  3NOB A;  2J7Q B;  3R2I A;  2IGD A;  4YT0 B;  3TL5 A;  1SJH D;  3BK1 A;  4AJW A;  3ZYY X;  3J9C A;  3M3J A;  1KF6 B;  5J17 A;  3BII D;  5DPW A;  2FUH B;  1EM7 A;  1D5Z C;  1VRA B;  3PSE B;  1ESF A;  1KH0 A;  3ETR A;  3N30 A;  2ZPY A;  3TEY A;  3DBR B;  2HJ1 A;  3LYY A;  3PZ8 A;  2NTS A;  3ABV B;  3ZNH B;  3TIX A;  4G11 A;  1V5O A;  2LGD A;  3TUO A;  1J7A A;  4NPN A;  2FCQ A;  1WJU A;  1WGK A;  3Q8C A;  3APC A;  5EDS A;  3IBE A;  4FJY A;  3NUH B;  1EWY C;  3AE5 B;  4M0W A;  1JQ4 A;  3U7Z A;  1RAX A;  2KN5 A;  1HEZ E;  5AUI A;  5G5H A;  3NZ3 A;  2ASQ A;  1UD7 A;  2BB6 A;  3HIZ A;  3TMP B;  5IOI A;  4A9A A;  2K8B A;  2M19 A;  4RM8 A;  2N7J A;  1WX8 A;  2KFK B;  3HUI A;  1LQB A;  1ZKH A;  3VH3 B;  4ZOH C;  1V80 A;  3OJ4 B;  2C7H A;  3DVN V;  2AQ1 B;  2RDB C;  2N7D A;  2HDE A;  3PPA A;  2KT7 A;  1OEY A;  4WWO A;  2K3U A;  2DZI A;  4KIK B;  3PLU A;  1YIW A;  2ZZP B;  1OQQ A;  2L0F A;  1V1O A;  3JSV A;  3NJT A;  1WYW B;  2J42 A;  3MC0 B;  2JUO A;  3A1Q B;  2XEW A;  4BBN C;  1QIL A;  3A9K A;  4W9I A;  4RCO A;  2ZW0 A;  2KDF B;  4WAA A;  2IJ0 A;  1EWC A;  1RRB A;  2ZCB A;  3ZRC A;  4PS8 A;  1EU4 A;  2LXA A;  3AU5 A;  1YQ4 B;  2M56 B;  2PE6 B;  2WGS A;  3PV1 A;  1BXT A;  4P1C C;  1WGH A;  3APD A;  3P4R B;  1P7F A;  2K39 A;  2L05 A;  2PW9 A;  1FFV A;  3ZGZ A;  2N9E B;  2QJL A;  2WXI A;  2DBY A;  3X0W A;  3ZQ4 A;  3GZN I;  3VRB B;  1WXS A;  3CSF A;  3VVW B;  1GG3 A;  1STE A;  1YMH E;  2J52 A;  4I6P A;  1V1P A;  1C1Y B;  1YQ3 B;  5G2N A;  4CHK A;  2VRR B;  4UDU C;  4FHK A;  2GBR A;  2L1A A;  1JML A;  4OVZ A;  5BYS A;  2DZM A;  2PEA A;  2KD0 A;  1E8Y A;  4MEL A;  3VAW A;  3ZUN A;  4B95 A;  4ANV A;  2ICI A;  2MWS B;  3VUX A;  4TQ1 A;  2Z0E B;  5L95 C;  1C4C A;  3ZTD A;  2RGF A;  2G4D B;  4MJS A;  4RGO S;  5D3D A;  2V4L A;  1XCQ L;  2X38 A;  1WIA A;  2M0A A;  3Q3O C;  2GLS A;  2I2Y A;  3A4R A;  1Z2M A;  1E7U A;  4GN1 A;  2LXC A;  3GZN B;  5CHF A;  3NVY A;  4YSZ B;  5KHQ A;  2KMC A;  4EZL A;  4RGN A;  2INP E;  2BQQ A;  3RD2 A;  2QCZ A;  2VZK D;  4M0W B;  3BVZ A;  4MEM A;  1LGR A;  4QAY A;  2MW5 A;  2H88 B;  4B0M A;  3L13 A;  4WJN A;  3P1M A;  1FPY A;  1XF5 L;  2RR9 A;  1KOT A;  1N61 A;  1QQR A;  1WGY A;  1PGX A;  3PRP B;  1QOF A;  1Y8R C;  5HHD G;  3IXS A;  2N9K A;  4M00 A;  3KUD B;  1I4P A;  3MFG A;  3DPD A;  2K0P A;  2IO1 B;  1C77 A;  3UIO B;  2M4N A;  2IO0 B;  4JGH B;  1LFD A;  1D6E C;  1TJE A;  2KDM A;  4GGQ A;  1WYG A;  3DVG Y;  4W9D A;  4A3P A;  2KLG A;  2EEL A;  3X23 A;  2HTM E;  3AXC A;  2KC2 A;  4EZJ A;  4P6V F;  1HZ6 A;  3A9K B;  4K7S A;  4NQL B;  2KFJ A;  2IDY A;  5AZH A;  3ZLZ A;  4N59 A;  3ZJU A;  1GC6 A;  4KDI C;  4YTP B;  3KYC D;  2NBU A;  1H4R A;  1S1Q B;  1WE6 A;  2R2Q A;  4GU2 A;  3W1S C;  2D3A A;  2CU1 A;  5JXV A;  1JRO A;  4KV2 A;  2N0S B;  2KMA A;  4I6N B;  1SIJ A;  3M95 A;  1FCC C;  3RNB C;  2MHJ A;  3VDZ A;  2KQ7 A;  4X57 B;  4BKG A;  1IGD A;  2JZP A;  1K52 A;  2L52 A;  4EKU A;  1T0Y A;  2ZEQ A;  4R3D A;  3L54 A;  3PRE A;  4HJG E;  3ZXV A;  2DZK A;  2YEP B;  3ZDM C;  1YOV B;  2A5U A;  2DLB A;  3MTN B;  2Q5W D;  2LGS A;  1T3Q A;  2WXQ A;  2XN9 C;  2GBN A;  3S2A A;  1P0R A;  2RSU A;  2OJR A;  3R2T A;  2KX0 A;  3Q69 A;  2KZR A;  2R2O A;  2EMT A;  3NVW A;  1YNT E;  1MG4 A;  2DAF A;  3RNF C;  2RD0 A;  4LNN A;  1QOG A;  2WXJ A;  3AEE B;  2KQS A;  3RZF A;  2CU3 A;  1N6Z A;  4RH6 A;  3EC8 A;  2SEB D;  4IUM B;  2DWQ A;  2X8X X;  1UGM A;  3U30 A;  3E56 A;  4L23 A;  4JE3 B;  4DDI D;  1WF9 A;  2KWC A;  4DHZ E;  3NZS A;  4II2 B;  4TMA B;  2O6V A;  3DBL I;  4MAC A;  2C7M B;  1VDV A;  3ZVV A;  3AEC B;  1VJK A;  1SB3 C;  3QHT A;  1WJ6 A;  2PE9 A;  2LHE A;  2JQR B;  5BYR A;  1L4Z B;  3ZJT A;  2M8S A;  3PLV A;  1Q5W B;  3V6C B;  4C4V A;  3H7P B;  2BF8 B;  4US9 A;  2L8J A;  1E9M A;  1RWS A;  3BYY B;  1UNS A;  2ZJD A;  3CST A;  2AX5 A;  1TS2 A;  2WU2 B;  1MJD A;  1UZX B;  2MBQ A;  4USA A;  3NZU A;  1TBE A;  2D3C A;  1C78 A;  4XDD A;  1SBB B;  3I63 C;  2CHX A;  4N6E B;  3VTW A;  5HI1 A;  2PLP A;  2O2V A;  1DOX A;  1ENF A;  3VR8 B;  2OJW A;  4W9C A;  4HDQ A;  1Q1O A;  3DBL B;  4MGI E;  2DNF A;  3EGR A;  1BT0 A;  4HPM B;  4IDI A;  2D2Q A;  4DHJ D;  3UGB B;  3TEX A;  3WCQ A;  2K8C A;  4IC7 B;  2PVG C;  3VQI A;  2MEK A;  4KGR A;  3EEC A;  4HPL B;  3RI7 C;  4PS3 A;  5FK9 C;  4NZL B;  2M17 A;  4M01 A;  1HXY D;  3RNE C;  4ZRP A;  3N32 A;  2FUG 1;  3I3T B;  4EE2 A;  4J6I A;  2G9H D;  1KLU D;  5TSS A;  3VHT C;  3U7D A;  2LVO A;  1XT9 B;  4F1S A;  3QWZ B;  3HHM A;  2I1J A;  4A90 A;  3DHG C;  4G3X B;  3FIL A;  1LXD A;  3AM9 A;  1E10 A;  2INN E;  2KJ6 A;  3EFC A;  3AE6 B;  2WXG A;  2WXK A;  4YTM B;  2Y3A A;  2KDI A;  1SE2 A;  1MVK A;  2HD5 B;  1WMH B;  1HZ5 A;  4MDK E;  1JAL A;  1ZOY B;  1TKY A;  2WP9 B;  3LB8 C;  1C79 A;  1JWA D;  4P16 A;  4ACF A;  3W2D A;  4EZK A;  1YD8 U;  3W5V B;  1WRD B;  4DXF A;  2LJI A;  4YL8 A;  1V97 A;  4S0R A;  1AN8 A;  2REX A;  2JU6 X;  2MRP A;  4GIV A;  2MX2 A;  1R7S A;  1UF0 A;  4IW0 A;  3B0A A;  1JRU A;  2GBK A;  4OZC A;  2NPT A;  4TKN A;  2DAJ A;  3RZW C;  2UU7 A;  1AAR A;  1WM3 A;  5IAA C;  1R4M I;  2AQ3 B;  2J4X A;  1CK1 A;  3ZNG C;  5JH5 C;  2L3Z A;  3TEW A;  2MP2 B;  4BKS D;  2N7E A;  1WM2 A;  3PRM B;  2LGX A;  1NYQ A;  1FMA D;  1WY8 A;  3DBH I;  4YWG G;  3R66 C;  1C4A A;  1JWM D;  4M02 A;  1UWX A;  1WH3 A;  4OZA A;  4OVV A;  3V61 A;  2FCS A;  4A20 A;  1JWB D;  3NY5 A;  3Q3F A;  4GB9 A;  1ZGU B;  4HLE A;  3PHW B;  1DGJ A;  4FAD A;  3KVF B;  4MM3 A;  1TKE A;  2ACZ B;  3R8B A;  2BKR B;  4DQO C;  4TUU A;  5HG2 A;  4ICU A;  4LK0 M;  4B6W A;  2LUM A;  4FHJ A;  1QT9 A;  1PYW D;  3Q2A C;  3KWL A;  2GBJ A;  2FCM A;  2KK8 A;  2GI9 A;  3PZ7 A;  4WWN A;  1K51 A;  3DBH B;  2D10 A;  4IWQ A;  2AQ2 B;  2JT4 B;  3QC8 B;  2DHZ A;  4YSX B;  4G0N B;  2QMT A;  3ML8 A;  4WJQ A;  2K6Q A;  2V3N A;  4FLH A;  1GOZ A;  1SSN A;  4GDL A;  4HDO A;  1XLO A;  1IUE A;  1E8Z A;  4HRO A;  2K22 A;  2WLB A;  1E0Z A;  2FID A;  1PGB A;  1F9J A;  3KLS X;  3BVM A;  2KAC A;  4KKI A;  1VZ6 A;  2MBO A;  1SE3 A;  3NVZ A;  1YQB A;  4WH4 A;  1SXT A;  4ZRK A;  1AW7 A;  2H89 B;  1OFF A;  1YX5 B;  2EMS A;  2KTR B;  1XCT L;  2NS5 A;  1WGR A;  2B76 B;  2I1K A;  2ZVO A;  2CS4 A;  4A8X C;  3KYD D;  4XZ4 A;  5I4D A;  5LLI A;  3RYT A;  1WGD A;  1E7V A;  1N62 A;  2LJ5 A;  1TS3 A;  2PIA A;  3RUL A;  5J2R A;  1T5X D;  2BWE S;  2IO2 B;  2MSE D;  2PPH A;  3DVN U;  1U4A A;  1A70 A;  1XO3 A;  4K7W A;  2EKE C;  5D2M B;  4IWP A;  4JLC A;  1F2R I;  4HKQ A;  1Y56 A;  1YN3 A;  3GE8 C;  4KX6 B;  1WRI A;  2BKF A;  1V86 A;  4GOC A;  4HPP A;  2XBB C;  1E5W A;  3APF A;  2JZZ A;  1KRH A;  3PO0 A;  5C23 A;  1WXV A;  2BW2 A;  4NAW A;  2LI5 A;  2NPT B;  2DEN B;  3DHI C;  1EUV B;  4A3O A;  2LEK A;  3HVZ A;  5AEK B;  4WWM A;  3D32 A;  4K3B A;  2WXM A;  2CR5 A;  1JWS D;  5E6O A;  4ARI A;  3GS2 A;  1P3Q U;  4ZHO A;  4II3 B;  2V9H A;  2LVP A;  3DQV A;  3SU8 X;  4RMA A;  2JYE A;  1XLN A;  3WA0 A;  2W3R A;  2K5P A;  3VR9 B;  2WXN A;  2YLM A;  3IG3 A;  4JIO U;  3VUY A;  4DXA B;  3L0W B;  1ZDV A;  4LCD E;  4IM3 A;  5BMI A;  3Q14 C;  5MPO A;  1J0G A;  1GC7 A;  3AE2 B;  4KZ0 A;  1XLQ A;  2BGF A;  1WXA A;  2YVC A;  4URK A;  2KJR A;  1P98 A;  3UQB A;  1FNV A;  3JW0 X;  2N9L A;  5JHA A;  1XD3 B;  3ECI A;  4OVU A;  3RUI B;  2UYZ B;  4KKJ A;  1SEB D;  3C0R B;  2W3S A;  3B08 A;  1KLG D;  3N3K B;  4C80 A;  1GAQ B;  3B9J A;  3U4E G;  4F8C B;  4L2Y A;  3RNC C;  2LZ6 A;  3BIN A;  4E74 A;  4GDL B;  1UBI A;  1E6E B;  3QAQ A;  3QCA A;  4OZB A;  3L4P A;  2IGH A;  2HJ8 A;  1OEY J;  4MH8 A;  2JYT A;  4EEW A;  4MGK E;  1JWU D;  5L83 A;  1P9D U;  3AE1 B;  5JZE B;  2MBE A;  3N20 C;  2YEP F;  4WUR A;  2C5L C;  2AL3 A;  3LXF A;  4Q2J A;  1J19 A;  2V3P A;  2D3G A;  2K8H A;  3K9P B;  3V62 A;  4YXD B;  1SIF A;  4PT5 A;  2LMC A;  2IY1 B;  4HJK A;  1HE8 A;  2QDF A;  3SHQ A;  2BS4 B;  3VUW A;  2FE8 A;  2KHW B;  1KJT A;  3VTV A;  2C9W B;  1E7P B;  4KSL C;  3JSV B;  2AL6 A;  4OW0 A;  3ZKJ C;  2WXF A;  1PUT A;  2W82 A;  2N9P C;  2RPQ A;  3I57 A;  3ALB A;  4DK5 A;  5HKH A;  3AE7 B;  1TS5 A;  2D3B A;  3GOE A;  1YN5 A;  2HE7 A;  4TV3 A;  3RNA C;  4JQW C;  4HRS A;  5CHW A;  2G45 B;  5D94 A;  2PKO A;  1KFY B;  3EFU A;  3SD5 A;  3ZDT A;  4BVU C;  1CMX B;  1HA5 A;  4JPS A;  1SF0 A;  1NBF C;  5TR5 A;  4NAW B;  2WYQ A;  5C2T B;  3RN9 C;  3BYT B;  3EHV A;  5H92 C;  3A9J A;  1FNW A;  2WXH A;  1T0S C;  1TY0 A;  2KXJ A;  1X1M A;  1Q0W B;  2D07 B;  1V1P B;  3M62 B;  5GXG B;  4EUT A;  2D11 A;  1J8C A;  4ASW C;  4DWF A;  4TSS A;  3DVG X;  2IBI B;  1VZ7 A;  1J7B A;  1J7C A;  3O65 B;  1FFU A;  3EA6 A;  4HVB A;  2JWZ A;  4WWP A;  2PTL A;  1WGG A;  5AZG A;  2KLC A;  2NCN A;  1C76 A;  4ANW A;  3TSS A;  1K53 A;  4K1R B;  3BWU D;  2K9X A;  4MJS B;  1BML C;  2WXP A;  3IHP C;  2MLB A;  5FR6 A;  4MH0 E;  2V1Y A;  1L6V A;  2A4Z A;  1B1Z A;  1NEN B;  4B9K A;  4XGA B;  1ET9 A;  3H1U A;  2KJH B;  1XLP A;  2MJE A;  2WDQ B;  3CF6 E;  5DPS A;  1WR1 A;  1I4Q A;  1L7Y A;  3QJZ A;  1LM8 B;  4GXB A;  4GDK A;  3IAS 1;  5DPT A;  1IBX A;  2V0G A;  2MBH A;  3AUL A;  4MSQ B;  2OHF A;  3FKY A;  4KVG B;  4KGS A;  1DYQ A;  3AH7 A;  1Q10 A;  2M1M A;  2KOX A;  2PMV A;  3U8Z A;  3W1S A;  2N9X A;  2J0J A;  1PQS A;  1IGC A;  1PDX A;  1KTK A;  1TZO A;  4JWS C;  1FO4 A;  3PRZ A;  1F0Z A;  3AEF B;  2G4S A;  2L7R A;  2BPS A;  3P2B A;  2DZJ A;  1N63 A;  5JHB A;  1NI3 A;  1YJJ A;  2V3S A;  1NDD A;  3MHZ A;  5T8I A;  2LRU A;  5IN7 A;  2XK5 A;  2WNM A;  1DOY A;  3AV8 A;  3B1L X;  2MQJ A;  2LFI A;  3HK0 A;  4MT5 A;  1TIF A;  2VH1 A;  3AMZ A;  2JWU A;  3N9Y C;  2XNA C;  1MG8 A;  4WAF A;  2KVR A;  1FCL A;  1I4X A;  4DDG D;  5DCN A;  3KW5 B;  2JXX A;  1GUA B;  2BYV E;  4XX5 A;  3OAW A;  2CJO A;  2BT6 A;  1TGZ B;  4LNI A;  3Q3J A;  1QOA A;  4IG7 B;  4ZYN A;  4AUQ C;  4CO7 A;  1L2N A;  3WAP A;  1F77 A;  4PK1 A;  4JWU C;  3OWE B;  4DBG A;  2FNJ B;  1HTQ A;  1PGA A;  2IPK D;  1WSP A;  1D5M C;  1OGW A;  3VFK A;  1FD6 A;  1N60 A;  2JZ3 B;  1KM7 A;  2G1E A;  4ZYS A;  3AEG B;  3W9C B;  2Y5P A;  3RNG C;  1T0Q C;  4W9J A;  4IKG A;  4HCP B;  4LJO B;  3T3N A;  1WX9 A;  3VRA B;  3HM3 A;  3MC9 A;  4RGM A;  4I6L B;  5E6J A;  3ZTC A;  4JL9 A;  5FR3 A;  2OOB B;  1F2R C;  1VR9 A;  1RFA A;  3IAM 1;  4FJZ A;  1ZPS A;  1ISN A;  1I35 A;  2DYM A;  2CKH B;  4ZDV A;  1V81 A;  1RLF A;  4W9L A;  1TTN A;  3NG0 A;  3KH0 A;  2KFK A;  1SE4 A;  2WX1 A;  5KHO A;  2QIL A;  3HRD D;  3RMK C;  3DCG A;  1C9F A;  3N1X C;  4W9H A;  3WAO A;  1QZE A;  1TKG A;  4D2K A;  4MGZ E;  3SEB A;  1F52 A;  2NR2 A;  3KWV A;  3HVD A;  1D3Z A;  2DYB A;  4KIK A;  1F1H A;  2K6D B;  1FIQ A;  3SR6 A;  4XE0 A;  3AE3 B;  3I5J C;  3BZD B;  2NMQ A;  1RFK A;  1I4H A;  2O6V B;  2BS2 B;  2GOW A;  1FEH A;  2MBB B;  2WDV B;  5EE3 A;  2WDR B;  1YJI A;  1IBX B;  1SGH A;  4US8 A;  1ZE3 D;  3AED B;  2LWP A;  3B2F A;  3NHE B;  4EOY A;  4GMV A;  4C4V B;  1EO6 A;  3AN1 A;  2WXL A;  3QAR A;  5D3I B;  1NEK B;  1EF1 A;  2IZV B;  3N1Y C;  1UWM A;  3DOW A;  3QIJ A;  1V5T A;  2AEH A;  4IM0 A;  3L16 A;  3RPF C;  1GB4 A;  3SDL C;  1AYF A;  1TT5 B;  3UIP B;  2CHZ A;  1L0Y B;  4AWJ A;  3AI5 A;  2KTF A;  3V60 A;  3NRZ A;  2O2V B;  2LGI A;  2QEJ C;  5LXI B;  4LJP B;  1D5X C;  4GSW A;  3WAM A;  2RDH A;  2L83 A;  3A33 B;  3N1Z C;  4WJO A;  3ZW3 A;  3Q8A A;  2ZNV B;  4C7Y A;  3P63 A;  4ARC A;  4FA6 A;  2CJN A;  1R4M B;  2W55 A;  3AE8 B;  3Q3M C;  1I7H A;  2JF5 A;  3FC4 A;  4RF0 A;  1IP9 A;  3NS8 A;  3M63 B;  1WX7 A;  3L08 A;  2KC1 A;  1UBQ A;  2IO3 B;  3R7Q A;  2O6V D;  1KLV A;  3PVL A;  4LDT B;  4AQ7 A;  2BS3 B;  3ZNI D;  2IY0 B;  4LNO A;  2KWU B;  1K8R B;  1VD2 A;  1WXQ A;  3AE9 B;  4N58 A;  2GBM A;  1E90 A;  1V8C A;  3IT6 B;  1JW9 D;  2GMI C;  4AJY B;  3A4S C;  2AWT A;  3PTF C;  2LVQ A;  2ZPN A;  5E6N A;  3DBS A;  3FIL B;  3P42 A;  4MGY E;  3PZD A;  3P4P B;  2Y5C A;  1ZXH A;  2K1F A;  1VCB A;  2JSV X;  2WXR A;  3L10 B;  4FBJ B;  4F7Z A;  1T0R C;  2E3T A;  2NVU I;  3KUZ A;  5EE9 A;  2V4I B;  1Z5S B;  3OJ3 A;  4M8M A;  4NQK E;  3Q8F A;  2GRI A;  1FXI A;  1T6B X;  1TY2 A;  1AWD A;  1OTR B;  2EKI A;  5BYQ A;  4TQ0 A;  3PHX B;  2Y5B B;  1IYF A;  1FRD A;  2G3Q B;  4YSY B;  4XDC A;  1ZP0 B;  3ZXR A;  2ONQ A;  1FXT B;  4IWO A;  2Z59 B;  3VTU A;  2BBC A;  2JVC A;  4LDT D;  3H8H A;  4CYE A;  5IA7 A;  3DWM A;  3SFE B;  1MHX A;  3IFW B;  2W9N A;  4A6Q A;  1FM0 D;  3QQ8 B;  2WS3 B;  4NNJ B;  4RFB A;  3UI3 A;  4FJV B;  5DPR A;  2VZK B;  2J0K A;  1WWT A;  3V3X A;  2KWD A;  5LXH A;  2NBV B;  2IYD B;  1ZW7 A;  5G55 A;  1G6J A;  3U52 E;  4NY0 A;  1L0V B;  3OG5 A;  4L1B A;  1RYJ A;  2MH7 A;  3CMM B;  1B9R A;  4MSM B;  4WJP A;  4CQN A;  3PT2 B;  2HTH A;  5AZF A;  5LNK 1;  4NJ6 A;  4MM3 B;  4ZHP A;  4RM9 A;  1GJZ A;  4EFO A;  1XEE A;  3V05 A;  1MFW A;  3KQ4 A;  3ZRF A;  5H8Y E;  1H8C A;  2MCN B;  5IO9 A;  1JRP A;  5AUK A;  3MC8 A;  4ICV A;  5EE1 A;  1C3T A;  3DWG C;  3BVG A;  1M4V A;  4JX1 C;  3GP7 A;  3RCZ A;  3AB5 A;  3T8M A;  2GB1 A;  1TS4 A;  1BUI C;  4W9F A;  2BTE A;  1GNU A;  4A55 A;  1CQV A;  4WQO B;  5BO4 B;  2KDE B;  1XXG A;  2RDG A;  3U2S C;  1ZDX A;  4KGT A;  3CIR B;  2OED A;  1FRR A;  1FNU A;  1GPX A;  5EE0 A;  4LTU A;  3Q8E A;  2MJD A;  2FBW B;  3W5U B;  4RGT A;  1YJ1 A;  4C7Z A;  3CWI A;  4HEA 1;  1MI0 A;  1OQY A;  3BK2 A;  2ZCC A;  4XYC A;  5CX3 A;  1WFY A;  3AE4 B;  3ZJV A;  1MPE A;  3Q3N C;  2ZVN A;  3ML9 A;  4RNA A;  5J18 A;  2BB5 A;  1CZP A;  1ZUD 2;  4W9G A;  4NJC A;  3ONS A;  2KNB A;  3RFZ B;  3FAH A;  3H6N A;  1ROE A;  3H7P A;  4NJ7 A;  2J0M A;  2MJ3 A;  2QIE B;  4AS1 A;  2KWV B;  2NTT A;  1I4R A;  2JRH A;  4S17 A;  5IKC M;  2NBW B;  3AEB B;  3P4S B;  5D6J B;  2UWQ A;  2KYW A;  4BOS C;  2E6X A;  2C7N B;  3KUC B;  4G50 A;  1A5R A;  1QF6 A;  4HWI B;  2DYO A;  2L0T A;  3T3O A;  2Z8L A;  2C60 A;  1CJE A;  2ON8 A;  3ZNZ B;  1IPG A;  1L5P A;  1M94 A;  1I42 A;  2K25 A;  2BWF A;  4C56 C;  3L17 A;  2WQY B;  3ENE A;  3BY4 B;  3DDC B;  4BZA A;  4FUL A;  2PJH A;  3GB1 A;  3T9L A;  4NAM A;  4K3C A;  4XC2 A;  2DX5 B;  3DHH C;  2J53 A;  2QC8 A;  4BKT A;  3O13 A;  1V9J A;  4B0E A;  1HTO A;  2L00 B;  1ZXI A;  3RT3 B;  4W9E A;  2INC C;  4BBN F;  1GB1 A;  4BFR A;  1UH6 A;  2JXT A;  2WU5 B;  3MJ5 A;  4AOF A;  2WXO A;  2QSD A;  4N9F 4;  1QLB B;  3EUB 2;  4K7U A;  2BYT A;  4BAX A;  2IND C;  5E6P A;  1LO5 D;  5CHV C;  4KSK C;  4WQM A;  2BYE A;  1SJE D;  2SAK A;  3E9S A;  3C19 A;  3HM6 X;  1L6U A;  4DHZ B;  1UUP A;  3H7S A;  4P1B C;  4XWT A;  4J3O D;  4BKS A;  3TEZ A;  5C1Z A;  2ZW1 A; 
#chains in the Genus database with same CATH homology
 2JRI B;  4WWN A;  2Z0E B;  5L95 C;  3ZTD A;  4W9J A;  2RGF A;  2G4D B;  4HCP B;  4MJS A;  2D10 A;  4LJO B;  1WX9 A;  2V4L A;  2N1W A;  3HM3 A;  2JT4 B;  4IWQ A;  3QC8 B;  2DHZ A;  4I6L B;  3ZTC A;  1WIA A;  1WI0 A;  4G0N B;  4JL9 A;  3ML8 A;  4WJQ A;  2K6Q A;  4M8N A;  2OOB B;  3A4R A;  4FLH A;  2ZNV C;  1RFA A;  1E7U A;  1Z2M A;  4GN1 A;  2LXC A;  4GDL A;  3IVF A;  4FJZ A;  3H9D A;  4HDO A;  5CHF A;  1ISN A;  1E8Z A;  1I35 A;  4K81 A;  5KHQ A;  2FID A;  2KMC A;  2DYM A;  2LUE A;  4EZL A;  2CKH B;  1F9J A;  1WR6 E;  4ZDV A;  1V81 A;  1RLF A;  4DHJ B;  4W9L A;  1TTN A;  1XQQ A;  3RD2 A;  1WMH A;  3KH0 A;  2MBO A;  2KFK A;  1YQB A;  2N1V A;  4M0W B;  2WX1 A;  4ZRK A;  4MEM A;  5KHO A;  2MW5 A;  3DCG A;  1E8W A;  3L13 A;  1NI2 A;  2Z0D B;  4W9H A;  4WJN A;  3WAO A;  1QZE A;  1YX5 B;  2EMS A;  2KTR B;  2NS5 A;  1WGR A;  1V49 A;  4MGZ E;  2MA9 B;  2I1K A;  2ZVO A;  2CS4 A;  2NR2 A;  1D3Z A;  2RR9 A;  3KYD D;  4XZ4 A;  1KOT A;  2DYB A;  4HK2 A;  4KIK A;  5LLI A;  3V6E B;  3RYT A;  2K6D B;  1WGY A;  1WGD A;  1E7V A;  2LJ5 A;  3PRP B;  3RUL A;  1Y8R C;  5J2R A;  2IO2 B;  2BWE S;  2MSE D;  2LD9 A;  2O6V B;  4E3C A;  2PPH A;  3W1Y A;  4ANX A;  3DVN U;  3WIM A;  1U4A A;  4E71 A;  2GOW A;  2MBB B;  3KUD B;  4IM2 A;  2EKE C;  4K7W A;  3DPD A;  1UEL A;  2IO1 B;  3LDZ E;  1SGH A;  5D2M B;  3UIO B;  4ZRJ A;  2CHW A;  4IWP A;  4JLC A;  2LWP A;  2M4N A;  3NHE B;  2IO0 B;  4JGH B;  4EOY A;  1LFD A;  4GMV A;  1EO6 A;  3PS6 A;  3QAR A;  2MP2 A;  2BKF A;  4GOC A;  1V86 A;  4GGQ A;  1EF1 A;  2IZV B;  2FAZ A;  2XBB C;  1E5W A;  1P1A A;  3DVG Y;  2AYO B;  4HXD A;  3APF A;  4W9D A;  3TJP A;  3DOW A;  2JZZ A;  3QIJ A;  1V5T A;  1WZ0 A;  4A3P A;  2AEH A;  2KLG A;  4IM0 A;  4KDL B;  3X23 A;  3L16 A;  2B3A A;  3AXC A;  5C23 A;  2KC2 A;  4PYZ A;  3SDL C;  4EZJ A;  4HCN B;  3UIP B;  1WXV A;  2LGY A;  1S3S G;  3JYU A;  4NAW A;  2LI5 A;  2CHZ A;  2NPT B;  3A9K B;  2DEN B;  4K7S A;  4AWJ A;  1EUV B;  4NQL B;  2KFJ A;  3AI5 A;  3QX1 A;  4A3O A;  2JY6 A;  2KTF A;  5AZH A;  3V60 A;  3ZLZ A;  5AEK B;  1GC6 A;  2O2V B;  4KDI C;  3D32 A;  3KYC D;  2NBU A;  3OLM D;  1H4R A;  1S1Q B;  2CR5 A;  1WE6 A;  2R2Q A;  4GU2 A;  5E6O A;  3W1S C;  4W9K A;  5LXI B;  4LJP B;  2CU1 A;  1P3Q U;  4II3 B;  4KV2 A;  4GSW A;  2LVP A;  3WAM A;  3DQV A;  3A33 B;  4PS7 A;  3SU8 X;  3QA8 A;  2KMA A;  4RMA A;  4I6N B;  2M0X A;  4WJO A;  3ZW3 A;  3M95 A;  1E8X A;  1V6E A;  3WA0 A;  2WWZ A;  2ZNV B;  2FCN A;  2YLM A;  3IG3 A;  4JIO U;  3VUY A;  4DXA B;  3L0W B;  4FA6 A;  3VDZ A;  2KQ7 A;  4X57 B;  4BKG A;  3A9J B;  2JF5 A;  4LCD E;  4IM3 A;  4EKU A;  1WJN A;  1T0Y A;  1IP9 A;  3NS8 A;  2ZEQ A;  3M63 B;  1WX7 A;  3L54 A;  3PRE A;  3L08 A;  1J0G A;  3ZIM A;  3QK0 A;  1GC7 A;  2DZK A;  2KC1 A;  2LRW A;  1UBQ A;  4KZ0 A;  3ZDM C;  2IO3 B;  3R7Q A;  3VXW A;  2BGF A;  2O6V D;  2A5U A;  1WXA A;  1KLV A;  3PVL A;  3MTN B;  2JPH A;  4LDT B;  2YVC A;  1YX6 B;  3ZNI D;  3R7R A;  4URK A;  2KJR A;  2GBN A;  3S2A A;  1P0R A;  1P98 A;  1TZ1 A;  2IY0 B;  2KX3 A;  2OJR A;  2RSU A;  3LJ3 A;  3UQB A;  2KX0 A;  3JW0 X;  2KZR A;  2R2O A;  2KWU B;  4AP4 C;  2EMT A;  1K8R B;  1VD2 A;  4FN2 A;  5JHA A;  3PGE A;  1XD3 B;  3ECI A;  2GBM A;  4OVU A;  3RUI B;  2UYZ B;  1E90 A;  1R4N I;  2DAF A;  2WDT B;  3MJW A;  2GMI C;  3C0R B;  3A4S C;  4AJY B;  2RD0 A;  3B08 A;  2AWT A;  3N3K B;  3PTF C;  2LVQ A;  2KQS A;  2ZPN A;  5E6N A;  3DBS A;  4MGY E;  4F8C B;  2KTR A;  3R3M A;  1EF5 A;  3RZF A;  2LZ6 A;  3BIN A;  4E74 A;  3PZD A;  4GDL B;  1UBI A;  3EC8 A;  3QAQ A;  3UQA A;  2K1F A;  3QCA A;  4ZRI A;  1VCB A;  3AU4 A;  4IUM B;  3TCA A;  1UGM A;  2BYF A;  3L10 B;  2KO3 A;  4FBJ B;  3U30 A;  4F7Z A;  3WAN A;  2HJ8 A;  2NVU I;  1OEY J;  3KUZ A;  4DDI D;  4EEW A;  1WF9 A;  2KWC A;  4MGK E;  2KDB A;  2LAS A;  1Z5S B;  2WX0 A;  3OJ3 A;  3NZS A;  1P9D U;  4II2 B;  4M8M A;  4NQK E;  2O6V A;  4DHZ E;  5L83 A;  3MHS D;  5JZE B;  4GDK B;  3DBL I;  2MBE A;  2C7M B;  2KAN A;  1WXM A;  2N4F A;  3ZVV A;  2C5L C;  2AL3 A;  3A1Q A;  1WZ3 A;  1V2Y A;  3QHT A;  1J19 A;  1OTR B;  2D3G A;  2K8H A;  1WJ6 A;  3K9P B;  2PE9 A;  3V62 A;  2M8S A;  4ANU A;  1SIF A;  3PLV A;  4TQ0 A;  1Q5W B;  3V6C B;  3UF8 A;  2IY1 B;  2BF8 B;  3H7P B;  3PHX B;  2Y5B B;  4HJK A;  1IYF A;  2L8J A;  1HE8 A;  4BOZ B;  2G3Q B;  2ZJD A;  3SHQ A;  3CST A;  4PYU A;  2QHO A;  2KHW B;  3VUW A;  4P7I A;  1FXT B;  1KJT A;  1UZX B;  2MBQ A;  3VTV A;  2C9W B;  1WJ4 A;  2L76 A;  4KSL C;  3NZU A;  3JSV B;  1TBE A;  3UIN B;  3VH4 B;  2AL6 A;  2KKC A;  4IWO A;  2Z59 B;  3DBR I;  3TBL D;  2FIF A;  3ZKJ C;  3VTU A;  2CHX A;  1SE9 A;  5D7G A;  2N9P C;  2RPQ A;  2JVC A;  5CTR C;  4LDT D;  4CYE A;  5IA7 A;  3ALB A;  3VTW A;  4DK5 A;  5HKH A;  3IFW B;  2O2V A;  5GMV A;  2W9N A;  3JVZ X;  3GOE A;  2XK5 B;  3QQ8 B;  3K9O B;  4NNJ B;  2HE7 A;  4KZC A;  4W9C A;  3ZO5 B;  4TV3 A;  1WE7 A;  3WAL A;  4HDQ A;  1Q1O A;  4FJV B;  3NOB A;  5DPR A;  4MGI E;  2J7Q B;  4JQW C;  5CHW A;  1BT0 A;  2G45 B;  4HPM B;  5D94 A;  4DHJ D;  2D2Q A;  2J0K A;  3UGB B;  3EFU A;  3SD5 A;  3TL5 A;  3ZDT A;  4BVU C;  5LXH A;  2NBV B;  1CMX B;  2IYD B;  2K8C A;  4IC7 B;  4AJW A;  1ZW7 A;  1NBF C;  3VQI A;  5TR5 A;  4NAW B;  5G55 A;  2WYQ A;  3EEC A;  1G6J A;  3M3J A;  4HPL B;  4NY0 A;  3EHV A;  3A9J A;  3CMM B;  5J17 A;  4PS3 A;  2KXJ A;  5DPW A;  4MSM B;  4WJP A;  2FUH B;  3PT2 B;  3PSE B;  2HTH A;  5AZF A;  4NJ6 A;  1X1M A;  3N30 A;  1Q0W B;  4RM9 A;  2D07 B;  2ZPY A;  1GJZ A;  2M17 A;  4EFO A;  3M62 B;  3ZRF A;  4EUT A;  2D11 A;  1J8C A;  4ASW C;  3ZNH B;  4DWF A;  3DVG X;  3N32 A;  2IBI B;  3TIX A;  1H8C A;  2MCN B;  3I3T B;  4J6I A;  4ICV A;  4G11 A;  1C3T A;  1V5O A;  2LGD A;  3O65 B;  4NPN A;  4HVB A;  2FCQ A;  3VHT C;  3RCZ A;  1WJU A;  2JWZ A;  1XT9 B;  2LVO A;  3U7D A;  4F1S A;  4WWP A;  3T8M A;  1WGG A;  5AZG A;  2KLC A;  2NCN A;  3APC A;  4ANW A;  5EDS A;  4W9F A;  3IBE A;  1GNU A;  4FJY A;  4K1R B;  3QWZ B;  4WQO B;  3HHM A;  4MJS B;  5BO4 B;  2I1J A;  3IHP C;  2KDE B;  2MLB A;  4G3X B;  5FR6 A;  1RAX A;  4MH0 E;  2KN5 A;  2V1Y A;  1LXD A;  2A4Z A;  2KJ6 A;  4B9K A;  3H1U A;  2KJH B;  2ASQ A;  1UD7 A;  3HIZ A;  3TMP B;  2KDI A;  3CF6 E;  1YJ1 A;  5DPS A;  2K8B A;  1WR1 A;  4RM8 A;  1OQY A;  2ZCC A;  1L7Y A;  3QJZ A;  5CX3 A;  1LM8 B;  1WFY A;  2HD5 B;  4GXB A;  1WMH B;  1WX8 A;  4GDK A;  2KFK B;  4MDK E;  1LQB A;  5DPT A;  1ZKH A;  3VH3 B;  2ZVN A;  1V80 A;  3OJ4 B;  3ML9 A;  2C7H A;  2MBH A;  3AUL A;  3DVN V;  4EZK A;  5J18 A;  1YD8 U;  4MSQ B;  1WRD B;  4W9G A;  2N7D A;  3ONS A;  3PPA A;  2KNB A;  4KVG B;  4YL8 A;  3H7P A;  3H6N A;  4NJ7 A;  1OEY A;  4WWO A;  2J0M A;  2REX A;  2DZI A;  2KWV B;  2M1M A;  2MRP A;  2KOX A;  3U8Z A;  2JRH A;  4KIK B;  4GIV A;  2NBW B;  2N9X A;  3PLU A;  2MX2 A;  3W1S A;  2J0J A;  1PQS A;  1YIW A;  5D6J B;  2UWQ A;  4BOS C;  2ZZP B;  2C7N B;  3KUC B;  3PRZ A;  4G50 A;  1A5R A;  2L0F A;  4IW0 A;  2G4S A;  3B0A A;  3JSV A;  2DYO A;  4HWI B;  1WYW B;  2L7R A;  2BPS A;  2JUO A;  2L0T A;  2DZJ A;  2C60 A;  3P2B A;  3A1Q B;  2XEW A;  1JRU A;  3ZNZ B;  5JHB A;  2GBK A;  1IPG A;  4BBN C;  1M94 A;  2V3S A;  2NPT A;  4TKN A;  3A9K A;  4W9I A;  1NDD A;  2DAJ A;  2LRU A;  3RZW C;  1AAR A;  1WM3 A;  1I42 A;  2K25 A;  2BWF A;  2KDF B;  5IAA C;  1R4M I;  4WAA A;  2XK5 A;  3ZNG C;  3L17 A;  5JH5 C;  3ENE A;  2L3Z A;  3BY4 B;  3DDC B;  1RRB A;  2MP2 B;  2ZCB A;  4FUL A;  3ZRC A;  2PJH A;  3B1L X;  2MQJ A;  4PS8 A;  3T9L A;  4BKS D;  4XC2 A;  2DX5 B;  2LXA A;  2N7E A;  3AU5 A;  3HK0 A;  1WM2 A;  4BKT A;  3PRM B;  2LGX A;  1V9J A;  1WY8 A;  3DBH I;  2PE6 B;  1MG8 A;  3R66 C;  2KVR A;  3PV1 A;  2L00 B;  4DDG D;  5DCN A;  3KW5 B;  1WGH A;  2JXX A;  3APD A;  3RT3 B;  1GUA B;  1WH3 A;  2BYV E;  2K39 A;  2L05 A;  4W9E A;  4XX5 A;  4BBN F;  3OAW A;  4OVV A;  1UH6 A;  4BFR A;  2N9E B;  3V61 A;  2FCS A;  4A20 A;  1TGZ B;  3NY5 A;  3Q3F A;  4AOF A;  4GB9 A;  1ZGU B;  3X0W A;  3Q3J A;  4N9F 4;  4IG7 B;  4ZYN A;  4AUQ C;  3GZN I;  4HLE A;  4CO7 A;  1WXS A;  3CSF A;  3PHW B;  4K7U A;  3WAP A;  1L2N A;  4FAD A;  3KVF B;  3VVW B;  1GG3 A;  4MM3 A;  4DBG A;  2FNJ B;  4I6P A;  2BKR B;  1C1Y B;  5G2N A;  4CHK A;  4TUU A;  5E6P A;  2VRR B;  1OGW A;  4FHK A;  2GBR A;  5CHV C;  4KSK C;  2BYE A;  3VFK A;  4ICU A;  2DZM A;  3HM6 X;  4B6W A;  2JZ3 B;  4FHJ A;  1KM7 A;  4DHZ B;  2PEA A;  3H7S A;  2KD0 A;  1E8Y A;  4MEL A;  3VAW A;  3ZUN A;  4B95 A;  2GBJ A;  4ANV A;  4BKS A;  2FCM A;  2KK8 A;  2MWS B;  3VUX A;  5C1Z A;  4TQ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...