2JZ3B

Socs box elonginbc ternary complex
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
118
structure length
118
Chain Sequence
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription inhibitor/transcription
molecule keywords Suppressor of cytokine signaling 3
publication title The SOCS box domain of SOCS3: structure and interaction with the elonginBC-cullin5 ubiquitin ligase
pubmed doi rcsb
source organism Mus musculus
total genus 12
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2007-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2jz3B01
1ZKHA 1WGHA 4NJ7A 2HE7A 2K25A 3AULA 2BYEA 3PGEA 2KLCA 2IO1B 3IG3A 4W9HA 2KWUB 2MBBB 3NHEB 3KH0A 4IM3A 5J17A 4E3CA 4TKNA 2LVOA 2DZIA 1E5WA 3WIMA 1WYWB 1WH3A 2J0MA 2G45B 4F1SA 5JH5C 3UQBA 4BKGA 3PLVA 3DVGY 1YIWA 4FJZA 1BT0A 2KXJA 2L3ZA 5DPRA 3QJZA 2KLGA 2ZVNA 3HK0A 2FCNA 1E7UA 2R2QA 4EKUA 3MTNB 3L17A 2NBWB 3SD5A 3VTWA 3OJ4B 3WA0A 1E8XA 3R7RA 2JRHA 3RZFA 3VTUA 5JHAA 1U4AA 2GOWA 2L0FA 2L05A 2M1MA 3PREA 4KZCA 3WAMA 2V3SA 5D7GA 4ZRKA 1EF1A 2Z0DB 3Q3FA 2DX5B 5E6OA 1OGWA 3X23A 3UINB 2K8HA 3PZDA 1V86A 3NZSA 3AU4A 2G4SA 1WF9A 1UZXB 1YQBA 2BPSA 2Z0EB 5L95C 4TUUA 2C7MB 3DOWA 2NBVB 2KWCA 3O65B 3EFUA 2KJHB 3PVLA 2MLBA 4KSKC 3UQAA 3QK0A 3A33B 3RZWC 2MSED 3VUXA 4G3XB 1VCBA 3VVWB 2NPTA 3DCGA 2KC2A 4TQ1A 4G0NB 1E7VA 4CO7A 3A9KA 1ZGUB 4PYUA 3ZIMA 1OEYJ 2KANA 1LXDA 4I6PA 4GDLB 4OVVA 2LGDA 3TCAA 3PRMB 1EUVB 3LJ3A 1E8YA 4G11A 3UIOB 3QA8A 1Z5SB 3KW5B 4EZLA 2XK5B 2O6VD 2UYZB 4ZYNA 2KJ6A 4DDID 1TGZB 4KDIC 1VD2A 1P0RA 2BKFA 3ZTCA 2ZEQA 2ZVOA 5DPTA 1E8WA 4AUQC 3B08A 1LQBA 3UGBB 4E74A 1WFYA 5AZHA 4E71A 4B95A 1D3ZA 1NDDA 1Q5WB 4KIKB 2N7EA 2O2VB 2EKEC 2KD0A 4WWPA 1RLFA 4HPLB 2MCNB 1LM8B 2J7QB 3NS8A 1RAXA 1UELA 4MDKE 2FAZA 4PS8A 4W9KA 4BKSA 3I3TB 2CHXA 4MGKE 2BYVE 4W9IA 2Z59B 3V6EB 5D6JB 1Q0WB 1ISNA 3WAPA 2PEAA 2QHOA 2I1KA 3JSVB 3H6NA 3MJWA 3W1YA 4ZRIA 3WANA 1OQYA 2C9WB 2GBMA 4MGYE 4ANWA 4MSMB 1P3QU 1GJZA 1L7YA 3PS6A 2GBJA 4HCNB 4WJNA 4A3PA 2FCMA 2JY6A 3NOBA 4NNJB 2BWES 2JXXA 4KDLB 2K8CA 3ZRCA 5LXIB 4NAWB 4WWNA 4BKTA 2V4LA 4AWJA 3RCZA 1V49A 2ZZPB 3QWZB 4IUMB 4WQOB 4X57B 4W9LA 1V5OA 3VHTC 4DHZB 2KFKA 4JQWC 2C5LC 1WE6A 2CU1A 3WALA 3PV1A 2DAFA 3ML8A 4HJKA 2OJRA 4HK2A 2LRUA 3CMMB 4KV2A 1P9DU 2BWFA 4HDOA 4YL8A 4ANVA 3A4RA 4AOFA 4MH0E 4EFOA 4BBNF 3H7SA 1X1MA 5J18A 3DBHI 3A1QA 4MELA 5HKHA 2DAJA 2K6QA 3VXWA 1C1YB 2JVCA 2XBBC 4URKA 2LGYA 1WGYA 2O6VB 3VAWA 4DXAB 2ZCCA 4LJPB 4IWOA 2KDFB 1EO6A 3A9JB 4A20A 4MJSA 2LWPA 2LJ5A 2MBQA 2MW5A 1L2NA 3JW0X 3PRPB 2KK8A 1P98A 1WIAA 3CF6E 4GN1A 2YLMA 1V6EA 2K6DB 5BO4B 5DPWA 1WMHB 3VTVA 1IP9A 4DHJD 5KHOA 2L7RA 4XC2A 3KUDB 3M3JA 4MM3A 2FUHB 3NY5A 4GDKA 5KHQA 1WM2A 4HLEA 2WWZA 4KZ0A 1YX5B 2XEWA 1FXTB 1GG3A 4JL9A 4EEWA 5LXHA 2YVCA 2CR5A 2IO3B 4MGIE 2REXA 2D11A 3ML9A 1GUAB 4JGHB 3ALBA 2IYDB 2JZ3B 3M63B 1WZ0A 3B0AA 5AZGA 2IY1B 2IZVB 3KUCB 2MBEA 2XK5A 4FLHA 4HPMB 2D2QA 1JRUA 2CS4A 1R4MI 4KVGB 3U8ZA 1RRBA 2JPHA 3QX1A 3A4SC 3OAWA 5E6PA 1T0YA 5CHWA 2K1FA 3L16A 5AEKB 4JLCA 3TBLD 3DBSA 2L0TA 3N32A 4NPNA 1KOTA 2JZZA 4FN2A 4M8MA 3DVNV 4NY0A 4W9CA 3EHVA 5AZFA 4BOZB 3VH3B 3APFA 2LZ6A 3HM6X 2ZJDA 2N1VA 4IM2A 4NQKE 2C7HA 2LUEA 1UH6A 2KO3A 2GBNA 4HXDA 4FJVB 3ZTDA 4DBGA 4WJQA 3QQ8B 2IO2B 2N7DA 1UBQA 2W9NA 4K7SA 4TQ0A 3ZDTA 2MP2A 3W1SA 4HCPB 2MBHA 5CX3A 3DPDA 1XT9B 3UIPB 2DZJA 2JRIB 4CHKA 4BOSC 1WX9A 3EECA 1K8RB 1WX8A 1ZW7A 4IWQA 5D94A 5D2MB 1WX7A 1WZ3A 4TV3A 1C3TA 4DHJB 3L13A 3APDA 2FCSA 3V62A 4PS7A 2RPQA 2KOXA 5DPSA 1E90A 1A5RA 1TTNA 1WJ4A 1MG8A 1NI2A 2PE6B 2CKHB 1AARA 4PS3A 4EZKA 4K7WA 2FIFA 4K7UA 3RT3B 2MWSB 3ZRFA 1WXSA 4IM0A 2CHWA 1SIFA 2VRRB 3APCA 4ANXA 1HE8A 1J19A 4W9FA 1QZEA 4BKSD 3ZW3A 2K8BA 5JHBA 4NQLB 3L54A 5LLIA 1WY8A 4G50A 1UGMA 1V9JA 3Q3JA 3B1LX 3PHXB 2AEHA 3CSFA 3ONSA 4WJOA 4IWPA 3S2AA 4DDGD 2KDIA 4ANUA 4RM9A 4B9KA 2N9EB 2IBIB 4K1RB 2KQ7A 2D10A 5IA7A 2ZNVB 3AU5A 4GXBA 3AXCA 5FR6A 1UBIA 1WMHA 2KQSA 4ZRJA 4B6WA 5C23A 2A5UA 2NS5A 1KM7A 1WXMA 3HIZA 4MSQB 2DENB 3ZDMC 3KUZA 1J0GA 2LXAA 2NPTB 2WX1A 3L0WB 1YJ1A 2AL6A 5C1ZA 3H1UA 4RM8A 2GBRA 4NJ6A 2MBOA 2LGXA 4N9F4 1E8ZA 1Z2MA 3A9KB 2DYBA 1XQQA 4OVUA 5CHVC 2LVQA 4AJWA 1M94A 3OJ3A 4FHKA 3QCAA 3W1SC 2L76A 2KKCA 4AJYB 2NCNA 2DHZA 4EZJA 1YX6B 1RFAA 1CMXB 4ICVA 1SE9A 2C60A 3RUIB 2ZCBA 3VQIA 3R3MA 2FCQA 2R2OA 4GGQA 3VFKA 4ASWC 4BFRA 2L8JA 3GOEA 3V61A 4LDTD 1KJTA 3IFWB 2BGFA 3EC8A 1EF5A 2G4DB 1F9JA 1YD8U 3SU8X 2FNJB 2N4FA 2MQJA 1LFDA 2RR9A 2K39A 2WYQA 4LCDE 1IPGA 1P1AA 2Y5BB 2C7NB 3PRZA 2G3QB 2PE9A 1WM3A 2LVPA 2JUOA 3ZO5B 4EUTA 1PQSA 2AL3A 3LDZE 2J0JA 2RGFA 3L10B 3VUWA 2EMTA 2JF5A 3ZNHB 2L00B 4GDLA 3VH4B 4FBJB 3PSEB 2ZPYA 3D32A 3U30A 1WGGA 3PT2B 2JT4B 1SGHA 1WGRA 2BF8B 2N1WA 3ZKJC 3TMPB 3R7QA 4I6NB 4IW0A 3DVNU 4A3OA 4GSWA 2GBKA 1WI0A 4HVBA 3PTFC 2LRWA 1I35A 3KYCD 4XX5A 3L08A 2KFKB 2BKRB 1NBFC 2KN5A 3HHMA 4HWIB 4DK5A 4FADA 1S1QB 2MRPA 3CSTA 5TR5A 2A4ZA 2KDBA 2NVUI 4KIKA 2O2VA 1IYFA 4J6IA 3H7PB 4GU2A 1WE7A 4MGZE 3BINA 3C0RB 1V2YA 4FULA 2AYOB 2B3AA 4RMAA 3TL5A 2DYOA 2M4NA 4BBNC 1OTRB 1I42A 4II3B 3DVGX 2KNBA 3QC8B 3A1QB 1XD3B 4FJYA 4HDQA 3P2BA 1G6JA 2MA9B 4FA6A 3RD2A 2KTRB 2HJ8A 3X0WA 2NBUA 2RSUA 1WJUA 3DBRI 3JSVA 5L83A 2V1YA 3M95A 5G55A 4LDTB 4MJSB 4WWOA 3KYDD 3U7DA 3R66C 3QAQA 5J2RA 2GMIC 2KFJA 2WDTB 3H9DA 3PHWB 5JZEB 5E6NA 4AP4C 3ECIA 4WJPA 2OOBB 2LD9A 2PPHA 1TBEA 3ZNZB 4ICUA 3TJPA 4NAWA 4M0WB 4GDKB 4JIOU 1S3SG 1WXAA 2HTHA 3AI5A 3HM3A 3N30A 3ZLZA 2DZKA 2FIDA 2PJHA 2I1JA 3RYTA 2HD5B 4IG7B 1GC7A 1Y8RC 2M0XA 5G2NA 3UF8A 1H8CA 3N3KB 2KTFA 2KX3A 3IHPC 3VUYA 2LASA 2ZPNA 1KLVA 2BYFA 2RD0A 1WR1A 2KX0A 4MEMA 2DYMA 2UWQA 2N9PC 4XZ4A 3TIXA 4I6LB 2O6VA 2DZMA 3K9OB 1WJ6A 3A9JA 4FHJA 3JVZX 3RULA 1WRDB 3BY4B 3V60A 3V6CB 2KHWB 3SHQA 1V5TA 4W9EA 4EOYA 4LJOB 3NZUA 2ASQA 2M17A 4BVUC 3T9LA 4GMVA 3QIJA 3MHSD 4KSLC 3SDLC 1V80A 2KMAA 2D07B 2CHZA 2KMCA 1UD7A 2LI5A 3QARA 4P7IA 1H4RA 3IVFA 5CTRC 3T8MA 4ZDVA 2KVRA 5GMVA 5EDSA 4M8NA 3OLMD 1WXVA 4WAAA 3ZNID 2MP2B 2WX0A 3IBEA 5IAAC 2EMSA 3DBLI 3WAOA 1GNUA 1GC6A 2LXCA 3ZVVA 2D3GA 4W9GA 2KWVB 4W9JA 4GOCA 4CYEA 4F8CB 1V81A 2J0KA 2MX2A 4F7ZA 1Q1OA 3KVFB 3GZNI 1WJNA 2ZNVC 2N9XA 1OEYA 3PLUA 2KC1A 4DWFA 2AWTA 5DCNA 3ZUNA 1WGDA 4DHZE 2KDEB 4II2B 3K9PB 3H7PA 3M62B 3DDCB 2KZRA 3QHTA 5CHFA 1WR6E 3DQVA 2JWZA 3JYUA 4GIVA 4IC7B 2NR2A 2M8SA 1R4NI 4GB9A 3VDZA 4K81A 3ENEA 1J8CA 4PYZA 4W9DA 2KTRA 2KJRA 3ZNGC 1TZ1A 2IY0B 2IO0B 3PPAA
chains in the Genus database with same CATH superfamily
3AULA 2BYEA 3IG3A 2IO1B 1K51A 2DZIA 1R4MB 1WH3A 3DHHC 1AW7A 1BT0A 4XWWA 3IXSA 3HK0A 2WGSA 1JCKB 2R2QA 4EKUA 3L17A 3WA0A 3MHZA 2JRHA 4HEA1 3RZFA 3VTUA 1TY0A 2L05A 5D7GA 3AEEB 3Q3FA 1OGWA 3X23A 2BVCA 2K8HA 1V86A 3NZSA 1I7HA 1WF9A 2BPSA 4M00A 1VLBA 4TUUA 1SJHD 2NBVB 4KSKC 4D2KA 3QK0A 4G3XB 3VVWB 3B2FA 3DCGA 5IO9A 3Q69A 1E7VA 1V97A 3A9KA 2CU3A 2BT6A 3Q3MC 1Q10A 2G9HD 3UIOB 1ZDXA 1DOXA 1ET6A 4DDID 3TEZA 2BKFA 3PZ7A 1XF5L 3ZTCA 2WXRA 1T0RC 2ZVOA 2INPE 5DPTA 1E8WA 4AUQC 4IKGA 2G1EA 1XLNA 3RNBC 1NDDA 1Q5WB 4KIKB 3NJTA 1XO3A 1K52A 2LMCA 2JSVX 2J7QB 4A9AA 1RAXA 2INCC 4N58A 2IPKD 4BKSA 3HRDD 2BYVE 2Z59B 2K9XA 1Q0WB 1ISNA 2QHOA 1OQYA 4HRSA 3NUHB 2GBJA 3OWEB 4BKTA 2V4LA 3NVVA 3RCZA 1V49A 4A90A 1L0XB 4WQOB 1V5OA 1C4CA 5G5HA 2DLBA 3AE5B 1ZE3D 2LRUA 4KGSA 2BYTA 3A4RA 4AOFA 4EFOA 1NENB 2WHIA 5IN7A 4MELA 1C1YB 2LGYA 4DXAB 3AE3B 1KRHA 4A20A 2V4IB 4MJSA 2MBQA 2SEBD 1P98A 2WU2B 4A6QA 3VTVA 5FK9C 2L7RA 3M3JA 4MM3A 2ONQA 4JL9A 5BMGA 3AE8B 3AEFB 3Q2AC 2D11A 2MJDA 3ML9A 1GUAB 2N7JA 3ALBA 2IZVB 4WWMA 4KVGB 3GS2A 1JRUA 2CS4A 1F0ZA 3U8ZA 4DQOC 1N5WA 3DBSA 1TJEA 3GP7A 2WDQB 3BVMA 4M8MA 4W9CA 4LTUA 2WXHA 2N1VA 4IM2A 2LUEA 1UH6A 3ZTDA 1FXAA 2IO2B 3B2GA 1UBQA 4TQ0A 3ZDTA 1WWTA 2MP2A 3W1SA 5CX3A 3DPDA 1XT9B 4CHKA 4BOSC 1WX8A 1AWDA 4NAMA 1C3TA 4ZHOA 2MJ3A 2FCSA 3V62A 1E90A 3BZDB 1FFVA 1TTNA 1AARA 1NYRA 4EZKA 2D3BA 3RFZB 1WXSA 3URYA 4ZOHC 2CHWA 2VH2A 4W9FA 5D3IB 4BKSD 2B76B 1VJKA 5JHBA 3P4SB 4NJCA 2IBIB 2INDC 2D10A 5EE0A 4KKIA 1WMHA 2KQSA 3FAHA 4ZRJA 2A5UA 1C4AA 1KM7A 2NS5A 1C9FA 3KUZA 1J0GA 2NPTB 3H1UA 1D5MC 2L52A 4N9F4 1E8ZA 1IBXB 2DYBA 1BUIC 2LVQA 2LHDA 4AJWA 2WXPA 1R4NB 3W1SC 4AJYB 3ETRA 2DHZA 1YX6B 4ICVA 1SE9A 3RUIB 2ZCBA 4GGQA 3VFKA 2J42A 2L8JA 5FR3A 3V61A 4O1NA 3VR8B 2BGFA 2G4DB 1DYQA 1WYGA 2N4FA 1L4ZB 2WYQA 3GB1A 1IPGA 1CJEA 3PRZA 2G3QB 2PE9A 4RNAA 3ZO5B 4EUTA 3LDZE 5HFYA 2EMTA 2W82A 3TEXA 3P4RB 3VH4B 1FD6A 3PSEB 4WAFA 3PT2B 1PGAA 4RF0A 1FO4A 2BF8B 2N1WA 1N61A 4I6NB 3DVNU 4GSWA 2KQ4X 4P6VF 3HHMA 2PVGC 1NI3A 4HROA 1SE3A 4KIKA 1F52A 1M4VA 4GU2A 3TL5A 4DK5A 1V2YA 3AH7A 2B3AA 1I42A 1JWAD 2DYOA 1I4HA 2KVZA 3NRZA 4L23A 1ENFA 3SFEB 2JQRB 4LK0M 3X0WA 2NBUA 2RSUA 1WJUA 1EWCA 3DBRI 1J7CA 1GAQB 2V1YA 5L83A 4ZYSA 3R66C 5J2RA 2WXKA 3PHWB 2K3UA 5E6NA 4AP4C 2KYWA 4WJPA 2LD9A 1L0VB 1TBEA 5BYQA 1TT5B 2JZPA 1WXAA 1FNVA 2HTHA 3N30A 1CQVA 2HD5B 4IG7B 1N5XA 1H8CA 3N3KB 1QOBA 2KTFA 1YJJA 3W2DA 3NS1A 5MPOA 1BMLC 2LJIA 4NZLB 2N9PC 2PTLA 2DZMA 1UNSA 3K9OB 1WJ6A 1TS2A 3BY4B 5EE9A 3SHQA 1V5TA 2Y5PA 1UUPA 1F2RI 3T9LA 1E10A 3QIJA 3MHSD 4KSLC 1E6EB 1UD7A 1SE2A 5CTRC 5GMVA 4B0EA 4M8NA 3OLMD 3GE3C 3IBEA 5BMIA 1FNWA 1GC6A 3LYYA 3ZVVA 1PDXA 3IAS1 4W9JA 4CYEA 4F8CB 1V81A 3W9CB 3N1XC 1QF6A 3GZNI 2PMVA 1V1OA 3ZUNA 1WGDA 2JXTA 4LNNA 4II2B 2Y3AA 1NEKB 2M0AA 2R61A 2JWZA 4K81A 3ENEA 1J8CA 4W9DA 2BW2A 2HTME 2IY0B 1ZKHA 1WGHA 5TSSA 4NJ7A 4WH4A 4W9HA 2KWUB 2MBBB 5J17A 3WIMA 4AS1A 1WYWB 3DVGY 1HTOA 2KXJA 5DPRA 2PLPA 2KDMA 2KLGA 2ZVNA 2FCNA 3MTNB 2BS2B 2NBWB 3SD5A 3RN9C 1XCQL 3R7RA 4PT5A 2L0FA 2M1MA 3PREA 3WAMA 1YJIA 4AQ7A 3HVZA 3KLSX 2IDYA 4S17A 3PZDA 4USAA 3AU4A 2G4SA 1UZXB 1YQBA 5L95C 2KWCA 3O65B 1HXYD 3EFUA 3MC0B 3PVLA 3UQAA 3A33B 3RZWC 2MSED 2NPTA 2KC2A 4C00A 4TQ1A 3L4PA 4CO7A 3TEYA 2KANA 1LXDA 4P1CC 4OVVA 3PRMB 1EUVB 2PW9A 2V3NA 4IOIE 2LHEA 1SIJA 3R8BA 4ZYNA 1TGZB 2L32A 3MP9A 1SXTA 4XWTA 3B08A 3AV8A 4RF1A 5AZHA 2X38A 2O2VB 2KD0A 4HPLB 3NS8A 4TSSA 1KFYB 4MDKE 2FAZA 4PS8A 4RGNA 4W9KA 4MGKE 3W5UB 2L1AA 2XNAC 3BK2A 2QMTA 3WAPA 2IGHA 3JSVB 3H6NA 1YN3A 3W1YA 3WANA 4BZAA 2C9WB 2GBMA 2BBCA 1GJZA 1T0SC 2QC8A 1L7YA 4WJNA 4A3PA 4NNJB 2WXGA 2BWES 5LXIB 2K8CA 3QWZB 4IUMB 4X57B 4W9LA 3VHTC 4DHZB 4ARIA 1EWYC 4YXDB 4XE0A 4HJKA 4HK2A 1FIQA 1KF6B 4ANVA 4YL8A 1SJED 1JW9D 2GRIA 3KWVA 3H7SA 4BBNF 1X1MA 5J18A 3AE1B 5HKHA 2DWQA 4MT5A 2N0SB 1HTQA 2JVCA 3MC8A 2XBBC 3V3XA 1WGYA 3O13A 4LJPB 3A9JB 2K22A 4JWUC 2KK8A 4JWSC 2D3AA 1WMHB 4XC2A 3KUDB 3PZ8A 2FUHB 2FE8A 3WCQA 1WM2A 3AMZA 2XEWA 1GG3A 1FRDA 1FEHA 2CR5A 1D5ZC 1WSPA 1J7AA 4US8A 1VZ7A 1UWXA 3BVZA 4ZHPA 2IYDB 2JZ3B 2IY1B 4HPMB 1ZXIA 2MBEA 2D2QA 1SF0A 3OAWA 3AB5A 1T0YA 3L16A 1ZPSA 1SB3C 1VDVA 2KWDA 4NQKE 2KO3A 4HXDA 2GBNA 1R7SA 1F1HA 4DBGA 4WJQA 3QQ8B 2ACZB 2N7DA 2W9NA 1PGBA 4HCPB 1YN4A 1K53A 1JWSD 3UIPB 1YOVB 1WX9A 3EECA 1K8RB 1ZW7A 3SEBA 5D2MB 1WX7A 3L13A 3U2SC 4N59A 2RPVA 4TMAB 2KOXA 3N1ZC 1MG8A 1NI2A 2PE6B 4PS3A 1EM7A 4IM0A 2VRRB 1SIFA 4ANXA 2NMQA 1QZEA 1RWSA 3L54A 5LLIA 1WY8A 3PHXB 4C80A 2AEHA 3DBLB 2N9EB 2KT7A 3AU5A 3AXCA 4XDCA 2QILA 3V05A 4FXCA 4MSQB 2DENB 1GB1A 2IJ0A 1YJ1A 2AL6A 3NVWA 2GBRA 3ZQ4A 2MBOA 1RYJA 4OVUA 2INNE 2NTSA 4C7YA 3GE8C 4P1BC 3NZ3A 1YN5A 1RFKA 2NCNA 4YSZB 3B9JA 3HUIA 4WQMA 3GOEA 1KJTA 3P63A 3IFWB 3EC8A 3RNEC 1F9JA 3SU8X 4YT0B 1JMLA 2MQJA 1LFDA 2K39A 1JROA 2Y5BB 2SAKA 2LVPA 3KQ4A 2LUMA 2RGFA 3L10B 2CJOA 2KMMA 2MHJA 3ZNHB 2VZKD 4FBJB 2ZPYA 1WGGA 2JT4B 3ZKJC 4H2AA 3R7QA 4IW0A 3HVDA 4A3OA 2J4XA 1MFWA 2VH1A 5T8IA 1XLPA 4XX5A 4RCOA 1NBFC 2KN5A 4FADA 1S1QB 2MRPA 5TR5A 2KDBA 1F77A 2GI9A 2O2VA 1WE7A 4FA6A 3C0RB 4BBNC 4II3B 3DVGX 3QC8B 1I4PA 4HDQA 3P2BA 2JU6X 2HJ8A 4LLGM 3DHGC 1QT9A 3JSVA 2L83A 3M95A 5G55A 4LDTB 3KYDD 4MACA 3U7DA 3QAQA 2GMIC 2KFJA 3H9DA 1IGDA 2PPHA 4WIPA 2KN4A 3ZLZA 2DZKA 1TZOA 2K5PA 2V0GA 2I1JA 3RYTA 1GC7A 3AN1A 3IHPC 1C4PA 2DBYA 2LASA 2ZPNA 2BYFA 2RD0A 4MEMA 4XZ4A 2WXLA 1ZOYB 2DNFA 3A9JA 5AUKA 1SSNA 1WRDB 5LNK1 2WXNA 3V60A 3V6CB 2KHWB 4W9EA 1D5XC 1PUTA 3NZUA 4BVUC 4GMVA 4YTNB 3RNGC 3I57A 1H4RA 3IVFA 3T8MA 4ZDVA 2KVRA 2WS3B 2IGGA 1WXVA 5BYRA 3J9CA 2EMSA 1YNTE 3IT4B 1FNUA 1GNUA 2LXCA 4ARCA 1P7FA 1FCCC 1JRPA 2AQ2B 1PFDA 4F7ZA 5G5GA 3Q3NC 3PLUA 4WURA 1L6VA 1TS3A 2KDEB 1SBBB 3K9PB 3DDCB 2KZRA 3QHTA 4C7ZA 1WR6E 3DQVA 3NVYA 2PIAA 3C19A 4QAYA 3U4EG 1Y56A 4PYZA 2KJRA 4OW0A 3T3OA 1N60A 3ECIA 4XDDA 2HE7A 2K25A 2W3RA 3BIID 3E9SA 4L2YA 2I38A 3KH0A 3NHEB 4IM3A 4E3CA 4TKNA 4F1SA 1OQQA 3VTWA 3OJ4B 1GOZA 2J53A 1SE4A 4N6EB 2V3SA 4ZRKA 1EF1A 2Z0DB 2FUG1 2Z0EB 2H88B 2C7MB 4LNIA 3DHIC 2AQ3B 2KJHB 2MLBA 4YSYB 3Q8CA 3ZXRA 3VUXA 1VCBA 2BTEA 1WXQA 2WXJA 1VZ8A 2GB1A 1ZGUB 4PYUA 1ACCA 4I6PA 4DXFA 2WLBA 3TCAA 2VZKB 3IAM1 1OFFA 3QA8A 2XN9C 3RMKC 3KW5B 4MH8A 2ZEQA 3FILA 3SR6A 3UGBB 4B95A 2ICIA 2EKEC 2D3CA 4WWPA 3T3NA 1I4RA 1J7BA 1UELA 4RGTA 2MJEA 2CHXA 4W9IA 3V6EB 1BXTA 2PEAA 3Q8BA 2KAJA 1JWBD 3MJWA 4ZRIA 4ANWA 4MGYE 2ZW0A 5E6JA 3PS6A 2FCMA 2JY6A 2JXXA 4NAWB 4AWJA 2ZZPB 3DWMA 1N62A 2C5LC 3WALA 3PV1A 3ML8A 3CMMB 5HG2A 3MC9A 1IUEA 1P9DU 2BWFA 3AE6B 4HDOA 5HI1A 5BYSA 3ZXVA 3DBHI 3VXWA 2K6QA 3RNCC 2O6VB 3VAWA 2ZCCA 2KDFB 2LWPA 2LJ5A 2MW5A 3PRPB 2WXQA 4GN1A 5D3DA 5DPWA 2K6DB 1V1PB 4KGRA 5KHOA 3NY5A 2M19A 3Q6BA 1B9RA 2WWZA 3VRAB 3AE7B 1YX5B 4EEWA 4LNFA 5LXHA 2YVCA 2IO3B 4MGIE 1I4GA 2REXA 2N9KA 1T5XD 3M63B 2JYEA 3KUCB 2XK5A 1R4MI 2V3PA 1FM0D 1RRBA 2JPHA 1P7EA 4REZA 3DBRB 1NYQA 1LO5D 2K1FA 5AEKB 4C4VA 2WXMA 3BWUD 3N32A 2L0TA 2E3TA 1KOTA 1YMHE 4FN2A 3DVNV 1SEBD 3EHVA 4BOZB 3VH3B 3APFA 2K0PA 3HM6X 2NTTA 3I9V1 4K7SA 1C77A 1V8CA 1STEA 2HJ1A 3N20C 1CZPA 3ZJVA 1IGCA 1TKYA 2JRIB 1TY2A 5D94A 4TV3A 4DHJB 3APDA 2RPQA 1WJ4A 3BVGA 1L6UA 2ZW1A 3RT3B 1QILA 1ZP0B 2WDRB 1HE8A 1J19A 3ZJTA 3BYTB 3ZW3A 3TEWA 4NQLB 4G50A 1UGMA 3Q3JA 3B1LX 2MEKA 1PGXA 1VZ6A 2KDIA 4RM9A 4ANUA 1HZ6A 4K1RB 2KQ7A 2WQYB 1EU3A 1UBIA 2BS3B 3AEDB 2PKOA 3GZNB 2WX1A 3IT6B 5C1ZA 1KTKA 4NJ6A 5C2TB 1T6BX 2QDFA 4ZRQA 1XQQA 5CHVC 4BAXA 4K3CA 3OJ3A 1UF0A 3QCAA 5I4DA 4EZJA 1CMXB 5FKAC 4BFRA 2WP9B 3U7ZA 5EE3A 4LDTD 3SFDB 1EF5A 1YD8U 2FNJB 2RDHA 2C7NB 3EFCA 2JUOA 1T0QC 1DGJA 1FXIA 2J0JA 3VUWA 1XCTL 3NVZA 2JF5A 1PYWD 1TIFA 2AX5A 3D32A 2KACA 1WGRA 3AEAB 3AE9B 3R2TA 4RH6A 2JWUA 5HHDG 2GBKA 1WI0A 2LRWA 1QKZA 2E6XA 4P16A 1QOAA 4JX1C 2OHFA 3OG5A 2KFKB 2BKRB 4HWIB 1TKGA 2A4ZA 2NVUI 2GLSA 1TS4A 2WXIA 2H89B 4FULA 4MGZE 2AYOB 2M4NA 3EGRA 5EE1A 1OTRB 2KNBA 3A1QB 3CIRB 2RDBC 1XD3B 1G6JA 2MA9B 1HEZE 2BB5A 3RD2A 3Q14C 4RGOS 4CQNA 2V9HA 3AM9A 3MFGA 4WWOA 4KKJA 1L5PA 1MHHE 2WDTB 2OOBB 1XXGA 4ICUA 3TJPA 4NAWA 4GDKB 4JIOU 4OVZA 1S3SG 3MJ5A 2QCZA 1KLGD 2PJHA 2Z8LA 4M01A 1Y8RC 2M0XA 1UWMA 1KLUD 5G2NA 3UF8A 1HA5A 2KX3A 3I63C 3VUYA 4JE3B 1QOFA 2KX0A 2DYMA 2BQQA 4I6LB 2O6VA 2OEDA 1C76A 4HKQA 4FHJA 3RULA 3LXFA 1T3QA 3ZGZA 4LJOB 3ZYYX 2LFIA 1V1PA 4B0MA 2Y5CA 2WXFA 2KMAA 2D07B 2KMCA 3QARA 4P7IA 4Q2JA 5EDSA 3Q8AA 3ZNID 5IAAC 2WX0A 4OZBA 1YQ4B 2D3GA 4W9GA 2KWVB 1E0ZA 1EU4A 1FCLA 4R3DA 2MX2A 1Q1OA 2ZNVC 2N9XA 1OEYA 3FILB 2WXOA 4DHZE 3Q8EA 3KWLA 3H7PA 3JYUA 4GIVA 4IC7B 2NR2A 2M8SA 1R4NI 4GB9A 3Q8FA 2KTRA 5AUIA 1TZ1A 3PPAA 2BS4B 2PVOD 3H8HA 3PGEA 2KLCA 2LVOA 4M02A 1E5WA 2J0MA 4ZRPA 2G45B 4J3OD 4M0WA 2MH7A 3AEBB 4BKGA 3PLVA 3UQBA 3EA6A 1YIWA 4FJZA 4A8XC 2L3ZA 3QJZA 4K3BA 4US9A 2AQ1B 3P4QB 1E7UA 4XYCA 3C8YA 1E8XA 1ROEA 5JHAA 2LEKA 1U4AA 2GOWA 4KZCA 2M56B 1K50A 3UI3A 2DX5B 3CWIA 5E6OA 3FC4A 1MPEA 1XLOA 3UINB 2CJNA 1YQ3B 1L4DB 3DOWA 1TYGB 5IP4D 2HDEA 2BB6A 4G0NB 4LNOA 3ZIMA 1OEYJ 4GDLB 1LGRA 2LGDA 1E9MA 3LJ3A 3BYYB 1E8YA 4G11A 1Z5SB 4EZLA 2XK5B 2O6VD 2UYZB 2W55A 2KJ6A 4KDIC 1VD2A 1P0RA 4KX6B 1LQBA 1TKEA 2QSDA 4HJGE 5H92C 4C4VB 4E74A 1WFYA 4LNKA 4E71A 1D3ZA 1AYFA 2N7EA 4YTPB 1RLFA 2MCNB 1AN8A 1LM8B 4GLSC 4IDIA 3E56A 1F2RC 3I3TB 4OZAA 1DOIA 5D6JB 1L0YB 5H8YE 2I1KA 4MSMB 1P3QU 1B1ZA 1JWUD 1ET9A 4HCNB 3NOBA 3ZRCA 4KDLB 4WWNA 5JH5C 1JQ4A 2KFKA 1VR9A 4JQWC 4RGMA 3RI7C 1WE6A 2CU1A 2DAFA 2OJRA 4KV2A 4MH0E 3A1QA 1ZXHA 2DAJA 2WNMA 1UGJA 2IGDA 2W54A 4URKA 4IWOA 1EO6A 4HPPA 1GPXA 1L2NA 3JW0X 2OJWA 3CF6E 1WIAA 5BO4B 2YLMA 1V6EA 1WGKA 1MJDA 1IP9A 4DHJD 4GDKA 5KHQA 4HLEA 4KZ0A 1FXTB 4ACFA 1JWMD 4UDUC 4JGHB 1FRRA 1WZ0A 3B0AA 5AZGA 4FLHA 2D5GA 3QX1A 3A4SC 5E6PA 5CHWA 2RDGA 4JLCA 3TBLD 1C78A 1GB4A 4PK1A 4NPNA 3TSSA 2JZZA 2EELA 5AZFA 4NY0A 3P1MA 4ITKA 2LZ6A 2QJLA 2ZJDA 1XLQA 1HQRD 2C7HA 3N1YC 4YSXB 3NG0A 4FJVB 2EKIA 2RMMA 2MBHA 3P4PB 2DZJA 4IWQA 3RNFC 1XEEA 1WZ3A 3AEGB 2LGIA 5IKCM 3VRBB 4PS7A 5DPSA 1A5RA 1QOGA 2CKHB 4K7WA 2FIFA 4K7UA 2MWSB 3ZRFA 3APCA 3ZJUA 2X8XX 2K8BA 1I4XA 2UU7A 1QQRA 1V9JA 2Q5WD 3CSFA 3ONSA 4WJOA 4IWPA 3S2AA 4DDGD 4B9KA 4C56C 3Q3OC 4RFBA 5IA7A 2ZNVB 4GXBA 3FKYA 5FR6A 1E7PB 4B6WA 5C23A 3HIZA 3ZDMC 1WXMA 2N9LA 2LXAA 3L0WB 4RM8A 3P42A 2LGXA 4YWGG 1FPYA 1Z2MA 3A9KB 4S0RA 1RM6C 1M94A 4FHKA 2L76A 2KKCA 3RNAC 1RFAA 2C60A 4A55A 2QEJC 3VQIA 3R3MA 2FCQA 2R2OA 4ASWC 1C79A 3DWGC 4JPSA 2LGSA 3R2IA 3I5JC 1FMAD 1QLBB 5JXVA 2RR9A 2J52A 4LCDE 1P1AA 4HKZE 3W5VB 1WM3A 1PQSA 2AL3A 1FFUA 1ZUD2 2L00B 1WRIA 4GDLA 3U52E 3U30A 1SGHA 1DOYA 3TMPB 1HZ5A 2YEPB 4HVBA 3EUB2 3PTFC 1I35A 3KYCD 3L08A 3VR9B 1JALA 3CSTA 3PO0A 1ZDVA 1IYFA 1MI0A 4J6IA 3H7PB 4RMAA 3BINA 5C3JB 3AE4B 4FJYA 1VRAB 3AECB 2KTRB 1TS5A 1I4QA 2JX5A 1KH0A 4MJSB 2I2YA 4YTMB 5JZEB 3BK1A 3ZNZB 2QIEB 4MM3B 4M0WB 3AI5A 3HM3A 2FIDA 4L1BA 1NVID 1IBXA 3LB8C 1ESFA 5BMHA 1N63A 4EE2A 1KLVA 1WR1A 1D4BA 2UWQA 3TIXA 4OHJA 1D6EC 2WU5B 3JVZX 5GXGB 4EOYA 3ABVB 3RPFC 3AE2B 1MHXA 2ASQA 2M17A 4OZCA 3SDLC 1V80A 1OQRA 4KGTA 2CHZA 2LI5A 4DXGA 1MVKA 2W3SA 2FBWB 2JYTA 4WAAA 2MP2B 3DBLI 3WAOA 2WDVB 4GOCA 3DBHB 2ON8A 3TUOA 2J0KA 3KVFB 1N6ZA 1WJNA 2KC1A 4DWFA 2AWTA 5DCNA 2YEPF 4XGAB 3N9YC 3M62B 5CHFA 3VDZA 1A70A 1CK1A 2TSSA 5IOIA 1MG4A 3ZNGC 2IO0B
chains in the Genus database with same CATH topology
1ZKHA 1WGHA 4NJ7A 2HE7A 2K25A 3AULA 2BYEA 3PGEA 2KLCA 2IO1B 3IG3A 4W9HA 2KWUB 2MBBB 3NHEB 3KH0A 4IM3A 5J17A 4E3CA 4TKNA 2LVOA 2DZIA 1E5WA 3WIMA 1WYWB 1WH3A 2J0MA 2G45B 4F1SA 5JH5C 3UQBA 4BKGA 3PLVA 3DVGY 1YIWA 4FJZA 1BT0A 2KXJA 2L3ZA 5DPRA 3QJZA 2KLGA 2ZVNA 3HK0A 2FCNA 1E7UA 2R2QA 4EKUA 3MTNB 3L17A 2NBWB 3SD5A 3VTWA 3OJ4B 3WA0A 1E8XA 3R7RA 2JRHA 3RZFA 3VTUA 5JHAA 1U4AA 2GOWA 2L0FA 2L05A 2M1MA 3PREA 4KZCA 3WAMA 2V3SA 5D7GA 4ZRKA 1EF1A 2Z0DB 3Q3FA 2DX5B 5E6OA 1OGWA 3X23A 3UINB 2K8HA 3PZDA 1V86A 3NZSA 3AU4A 2G4SA 1WF9A 1UZXB 1YQBA 2BPSA 2Z0EB 5L95C 4TUUA 2C7MB 3DOWA 2NBVB 2KWCA 3O65B 3EFUA 2KJHB 3PVLA 2MLBA 4KSKC 3UQAA 3QK0A 3A33B 3RZWC 2MSED 3VUXA 4G3XB 1VCBA 3VVWB 2NPTA 3DCGA 2KC2A 4TQ1A 4G0NB 1E7VA 4CO7A 3A9KA 1ZGUB 4PYUA 3ZIMA 1OEYJ 2KANA 1LXDA 4I6PA 4GDLB 4OVVA 2LGDA 3TCAA 3PRMB 1EUVB 3LJ3A 1E8YA 4G11A 3UIOB 3QA8A 1Z5SB 3KW5B 4EZLA 2XK5B 2O6VD 2UYZB 4ZYNA 2KJ6A 4DDID 1TGZB 4KDIC 1VD2A 1P0RA 2BKFA 3ZTCA 2ZEQA 2ZVOA 5DPTA 1E8WA 4AUQC 3B08A 1LQBA 3UGBB 4E74A 1WFYA 5AZHA 4E71A 4B95A 1D3ZA 1NDDA 1Q5WB 4KIKB 2N7EA 2O2VB 2EKEC 2KD0A 4WWPA 1RLFA 4HPLB 2MCNB 1LM8B 2J7QB 3NS8A 1RAXA 1UELA 4MDKE 2FAZA 4PS8A 4W9KA 4BKSA 3I3TB 2CHXA 4MGKE 2BYVE 4W9IA 2Z59B 3V6EB 5D6JB 1Q0WB 1ISNA 3WAPA 2PEAA 2QHOA 2I1KA 3JSVB 3H6NA 3MJWA 3W1YA 4ZRIA 3WANA 1OQYA 2C9WB 2GBMA 4MGYE 4ANWA 4MSMB 1P3QU 1GJZA 1L7YA 3PS6A 2GBJA 4HCNB 4WJNA 4A3PA 2FCMA 2JY6A 3NOBA 4NNJB 2BWES 2JXXA 4KDLB 2K8CA 3ZRCA 5LXIB 4NAWB 4WWNA 4BKTA 2V4LA 4AWJA 3RCZA 1V49A 2ZZPB 3QWZB 4IUMB 4WQOB 4X57B 4W9LA 1V5OA 3VHTC 4DHZB 2KFKA 4JQWC 2C5LC 1WE6A 2CU1A 3WALA 3PV1A 2DAFA 3ML8A 4HJKA 2OJRA 4HK2A 2LRUA 3CMMB 4KV2A 1P9DU 2BWFA 4HDOA 4YL8A 4ANVA 3A4RA 4AOFA 4MH0E 4EFOA 4BBNF 3H7SA 1X1MA 5J18A 3DBHI 3A1QA 4MELA 5HKHA 2DAJA 2K6QA 3VXWA 1C1YB 2JVCA 2XBBC 4URKA 2LGYA 1WGYA 2O6VB 3VAWA 4DXAB 2ZCCA 4LJPB 4IWOA 2KDFB 1EO6A 3A9JB 4A20A 4MJSA 2LWPA 2LJ5A 2MBQA 2MW5A 1L2NA 3JW0X 3PRPB 2KK8A 1P98A 1WIAA 3CF6E 4GN1A 2YLMA 1V6EA 2K6DB 5BO4B 5DPWA 1WMHB 3VTVA 1IP9A 4DHJD 5KHOA 2L7RA 4XC2A 3KUDB 3M3JA 4MM3A 2FUHB 3NY5A 4GDKA 5KHQA 1WM2A 4HLEA 2WWZA 4KZ0A 1YX5B 2XEWA 1FXTB 1GG3A 4JL9A 4EEWA 5LXHA 2YVCA 2CR5A 2IO3B 4MGIE 2REXA 2D11A 3ML9A 1GUAB 4JGHB 3ALBA 2IYDB 2JZ3B 3M63B 1WZ0A 3B0AA 5AZGA 2IY1B 2IZVB 3KUCB 2MBEA 2XK5A 4FLHA 4HPMB 2D2QA 1JRUA 2CS4A 1R4MI 4KVGB 3U8ZA 1RRBA 2JPHA 3QX1A 3A4SC 3OAWA 5E6PA 1T0YA 5CHWA 2K1FA 3L16A 5AEKB 4JLCA 3TBLD 3DBSA 2L0TA 3N32A 4NPNA 1KOTA 2JZZA 4FN2A 4M8MA 3DVNV 4NY0A 4W9CA 3EHVA 5AZFA 4BOZB 3VH3B 3APFA 2LZ6A 3HM6X 2ZJDA 2N1VA 4IM2A 4NQKE 2C7HA 2LUEA 1UH6A 2KO3A 2GBNA 4HXDA 4FJVB 3ZTDA 4DBGA 4WJQA 3QQ8B 2IO2B 2N7DA 1UBQA 2W9NA 4K7SA 4TQ0A 3ZDTA 2MP2A 3W1SA 4HCPB 2MBHA 5CX3A 3DPDA 1XT9B 3UIPB 2DZJA 2JRIB 4CHKA 4BOSC 1WX9A 3EECA 1K8RB 1WX8A 1ZW7A 4IWQA 5D94A 5D2MB 1WX7A 1WZ3A 4TV3A 1C3TA 4DHJB 3L13A 3APDA 2FCSA 3V62A 4PS7A 2RPQA 2KOXA 5DPSA 1E90A 1A5RA 1TTNA 1WJ4A 1MG8A 1NI2A 2PE6B 2CKHB 1AARA 4PS3A 4EZKA 4K7WA 2FIFA 4K7UA 3RT3B 2MWSB 3ZRFA 1WXSA 4IM0A 2CHWA 1SIFA 2VRRB 3APCA 4ANXA 1HE8A 1J19A 4W9FA 1QZEA 4BKSD 3ZW3A 2K8BA 5JHBA 4NQLB 3L54A 5LLIA 1WY8A 4G50A 1UGMA 1V9JA 3Q3JA 3B1LX 3PHXB 2AEHA 3CSFA 3ONSA 4WJOA 4IWPA 3S2AA 4DDGD 2KDIA 4ANUA 4RM9A 4B9KA 2N9EB 2IBIB 4K1RB 2KQ7A 2D10A 5IA7A 2ZNVB 3AU5A 4GXBA 3AXCA 5FR6A 1UBIA 1WMHA 2KQSA 4ZRJA 4B6WA 5C23A 2A5UA 2NS5A 1KM7A 1WXMA 3HIZA 4MSQB 2DENB 3ZDMC 3KUZA 1J0GA 2LXAA 2NPTB 2WX1A 3L0WB 1YJ1A 2AL6A 5C1ZA 3H1UA 4RM8A 2GBRA 4NJ6A 2MBOA 2LGXA 4N9F4 1E8ZA 1Z2MA 3A9KB 2DYBA 1XQQA 4OVUA 5CHVC 2LVQA 4AJWA 1M94A 3OJ3A 4FHKA 3QCAA 3W1SC 2L76A 2KKCA 4AJYB 2NCNA 2DHZA 4EZJA 1YX6B 1RFAA 1CMXB 4ICVA 1SE9A 2C60A 3RUIB 2ZCBA 3VQIA 3R3MA 2FCQA 2R2OA 4GGQA 3VFKA 4ASWC 4BFRA 2L8JA 3GOEA 3V61A 4LDTD 1KJTA 3IFWB 2BGFA 3EC8A 1EF5A 2G4DB 1F9JA 1YD8U 3SU8X 2FNJB 2N4FA 2MQJA 1LFDA 2RR9A 2K39A 2WYQA 4LCDE 1IPGA 1P1AA 2Y5BB 2C7NB 3PRZA 2G3QB 2PE9A 1WM3A 2LVPA 2JUOA 3ZO5B 4EUTA 1PQSA 2AL3A 3LDZE 2J0JA 2RGFA 3L10B 3VUWA 2EMTA 2JF5A 3ZNHB 2L00B 4GDLA 3VH4B 4FBJB 3PSEB 2ZPYA 3D32A 3U30A 1WGGA 3PT2B 2JT4B 1SGHA 1WGRA 2BF8B 2N1WA 3ZKJC 3TMPB 3R7QA 4I6NB 4IW0A 3DVNU 4A3OA 4GSWA 2GBKA 1WI0A 4HVBA 3PTFC 2LRWA 1I35A 3KYCD 4XX5A 3L08A 2KFKB 2BKRB 1NBFC 2KN5A 3HHMA 4HWIB 4DK5A 4FADA 1S1QB 2MRPA 3CSTA 5TR5A 2A4ZA 2KDBA 2NVUI 4KIKA 2O2VA 1IYFA 4J6IA 3H7PB 4GU2A 1WE7A 4MGZE 3BINA 3C0RB 1V2YA 4FULA 2AYOB 2B3AA 4RMAA 3TL5A 2DYOA 2M4NA 4BBNC 1OTRB 1I42A 4II3B 3DVGX 2KNBA 3QC8B 3A1QB 1XD3B 4FJYA 4HDQA 3P2BA 1G6JA 2MA9B 4FA6A 3RD2A 2KTRB 2HJ8A 3X0WA 2NBUA 2RSUA 1WJUA 3DBRI 3JSVA 5L83A 2V1YA 3M95A 5G55A 4LDTB 4MJSB 4WWOA 3KYDD 3U7DA 3R66C 3QAQA 5J2RA 2GMIC 2KFJA 2WDTB 3H9DA 3PHWB 5JZEB 5E6NA 4AP4C 3ECIA 4WJPA 2OOBB 2LD9A 2PPHA 1TBEA 3ZNZB 4ICUA 3TJPA 4NAWA 4M0WB 4GDKB 4JIOU 1S3SG 1WXAA 2HTHA 3AI5A 3HM3A 3N30A 3ZLZA 2DZKA 2FIDA 2PJHA 2I1JA 3RYTA 2HD5B 4IG7B 1GC7A 1Y8RC 2M0XA 5G2NA 3UF8A 1H8CA 3N3KB 2KTFA 2KX3A 3IHPC 3VUYA 2LASA 2ZPNA 1KLVA 2BYFA 2RD0A 1WR1A 2KX0A 4MEMA 2DYMA 2UWQA 2N9PC 4XZ4A 3TIXA 4I6LB 2O6VA 2DZMA 3K9OB 1WJ6A 3A9JA 4FHJA 3JVZX 3RULA 1WRDB 3BY4B 3V60A 3V6CB 2KHWB 3SHQA 1V5TA 4W9EA 4EOYA 4LJOB 3NZUA 2ASQA 2M17A 4BVUC 3T9LA 4GMVA 3QIJA 3MHSD 4KSLC 3SDLC 1V80A 2KMAA 2D07B 2CHZA 2KMCA 1UD7A 2LI5A 3QARA 4P7IA 1H4RA 3IVFA 5CTRC 3T8MA 4ZDVA 2KVRA 5GMVA 5EDSA 4M8NA 3OLMD 1WXVA 4WAAA 3ZNID 2MP2B 2WX0A 3IBEA 5IAAC 2EMSA 3DBLI 3WAOA 1GNUA 1GC6A 2LXCA 3ZVVA 2D3GA 4W9GA 2KWVB 4W9JA 4GOCA 4CYEA 4F8CB 1V81A 2J0KA 2MX2A 4F7ZA 1Q1OA 3KVFB 3GZNI 1WJNA 2ZNVC 2N9XA 1OEYA 3PLUA 2KC1A 4DWFA 2AWTA 5DCNA 3ZUNA 1WGDA 4DHZE 2KDEB 4II2B 3K9PB 3H7PA 3M62B 3DDCB 2KZRA 3QHTA 5CHFA 1WR6E 3DQVA 2JWZA 3JYUA 4GIVA 4IC7B 2NR2A 2M8SA 1R4NI 4GB9A 3VDZA 4K81A 3ENEA 1J8CA 4PYZA 4W9DA 2KTRA 2KJRA 3ZNGC 1TZ1A 2IY0B 2IO0B 3PPAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZKH A;  1WGH A;  4NJ7 A;  2HE7 A;  2K25 A;  3AUL A;  2BYE A;  3PGE A;  2KLC A;  2IO1 B;  3IG3 A;  4W9H A;  2KWU B;  2MBB B;  3NHE B;  3KH0 A;  4IM3 A;  5J17 A;  4E3C A;  4TKN A;  2LVO A;  2DZI A;  1E5W A;  3WIM A;  1WYW B;  1WH3 A;  2J0M A;  2G45 B;  4F1S A;  5JH5 C;  3UQB A;  4BKG A;  3PLV A;  3DVG Y;  1YIW A;  4FJZ A;  1BT0 A;  2KXJ A;  2L3Z A;  5DPR A;  3QJZ A;  2KLG A;  2ZVN A;  3HK0 A;  2FCN A;  1E7U A;  2R2Q A;  4EKU A;  3MTN B;  3L17 A;  2NBW B;  3SD5 A;  3VTW A;  3OJ4 B;  3WA0 A;  1E8X A;  3R7R A;  2JRH A;  3RZF A;  3VTU A;  5JHA A;  1U4A A;  2GOW A;  2L0F A;  2L05 A;  2M1M A;  3PRE A;  4KZC A;  3WAM A;  2V3S A;  5D7G A;  4ZRK A;  1EF1 A;  2Z0D B;  3Q3F A;  2DX5 B;  5E6O A;  1OGW A;  3X23 A;  3UIN B;  2K8H A;  3PZD A;  1V86 A;  3NZS A;  3AU4 A;  2G4S A;  1WF9 A;  1UZX B;  1YQB A;  2BPS A;  2Z0E B;  5L95 C;  4TUU A;  2C7M B;  3DOW A;  2NBV B;  2KWC A;  3O65 B;  3EFU A;  2KJH B;  3PVL A;  2MLB A;  4KSK C;  3UQA A;  3QK0 A;  3A33 B;  3RZW C;  2MSE D;  3VUX A;  4G3X B;  1VCB A;  3VVW B;  2NPT A;  3DCG A;  2KC2 A;  4TQ1 A;  4G0N B;  1E7V A;  4CO7 A;  3A9K A;  1ZGU B;  4PYU A;  3ZIM A;  1OEY J;  2KAN A;  1LXD A;  4I6P A;  4GDL B;  4OVV A;  2LGD A;  3TCA A;  3PRM B;  1EUV B;  3LJ3 A;  1E8Y A;  4G11 A;  3UIO B;  3QA8 A;  1Z5S B;  3KW5 B;  4EZL A;  2XK5 B;  2O6V D;  2UYZ B;  4ZYN A;  2KJ6 A;  4DDI D;  1TGZ B;  4KDI C;  1VD2 A;  1P0R A;  2BKF A;  3ZTC A;  2ZEQ A;  2ZVO A;  5DPT A;  1E8W A;  4AUQ C;  3B08 A;  1LQB A;  3UGB B;  4E74 A;  1WFY A;  5AZH A;  4E71 A;  4B95 A;  1D3Z A;  1NDD A;  1Q5W B;  4KIK B;  2N7E A;  2O2V B;  2EKE C;  2KD0 A;  4WWP A;  1RLF A;  4HPL B;  2MCN B;  1LM8 B;  2J7Q B;  3NS8 A;  1RAX A;  1UEL A;  4MDK E;  2FAZ A;  4PS8 A;  4W9K A;  4BKS A;  3I3T B;  2CHX A;  4MGK E;  2BYV E;  4W9I A;  2Z59 B;  3V6E B;  5D6J B;  1Q0W B;  1ISN A;  3WAP A;  2PEA A;  2QHO A;  2I1K A;  3JSV B;  3H6N A;  3MJW A;  3W1Y A;  4ZRI A;  3WAN A;  1OQY A;  2C9W B;  2GBM A;  4MGY E;  4ANW A;  4MSM B;  1P3Q U;  1GJZ A;  1L7Y A;  3PS6 A;  2GBJ A;  4HCN B;  4WJN A;  4A3P A;  2FCM A;  2JY6 A;  3NOB A;  4NNJ B;  2BWE S;  2JXX A;  4KDL B;  2K8C A;  3ZRC A;  5LXI B;  4NAW B;  4WWN A;  4BKT A;  2V4L A;  4AWJ A;  3RCZ A;  1V49 A;  2ZZP B;  3QWZ B;  4IUM B;  4WQO B;  4X57 B;  4W9L A;  1V5O A;  3VHT C;  4DHZ B;  2KFK A;  4JQW C;  2C5L C;  1WE6 A;  2CU1 A;  3WAL A;  3PV1 A;  2DAF A;  3ML8 A;  4HJK A;  2OJR A;  4HK2 A;  2LRU A;  3CMM B;  4KV2 A;  1P9D U;  2BWF A;  4HDO A;  4YL8 A;  4ANV A;  3A4R A;  4AOF A;  4MH0 E;  4EFO A;  4BBN F;  3H7S A;  1X1M A;  5J18 A;  3DBH I;  3A1Q A;  4MEL A;  5HKH A;  2DAJ A;  2K6Q A;  3VXW A;  1C1Y B;  2JVC A;  2XBB C;  4URK A;  2LGY A;  1WGY A;  2O6V B;  3VAW A;  4DXA B;  2ZCC A;  4LJP B;  4IWO A;  2KDF B;  1EO6 A;  3A9J B;  4A20 A;  4MJS A;  2LWP A;  2LJ5 A;  2MBQ A;  2MW5 A;  1L2N A;  3JW0 X;  3PRP B;  2KK8 A;  1P98 A;  1WIA A;  3CF6 E;  4GN1 A;  2YLM A;  1V6E A;  2K6D B;  5BO4 B;  5DPW A;  1WMH B;  3VTV A;  1IP9 A;  4DHJ D;  5KHO A;  2L7R A;  4XC2 A;  3KUD B;  3M3J A;  4MM3 A;  2FUH B;  3NY5 A;  4GDK A;  5KHQ A;  1WM2 A;  4HLE A;  2WWZ A;  4KZ0 A;  1YX5 B;  2XEW A;  1FXT B;  1GG3 A;  4JL9 A;  4EEW A;  5LXH A;  2YVC A;  2CR5 A;  2IO3 B;  4MGI E;  2REX A;  2D11 A;  3ML9 A;  1GUA B;  4JGH B;  3ALB A;  2IYD B;  2JZ3 B;  3M63 B;  1WZ0 A;  3B0A A;  5AZG A;  2IY1 B;  2IZV B;  3KUC B;  2MBE A;  2XK5 A;  4FLH A;  4HPM B;  2D2Q A;  1JRU A;  2CS4 A;  1R4M I;  4KVG B;  3U8Z A;  1RRB A;  2JPH A;  3QX1 A;  3A4S C;  3OAW A;  5E6P A;  1T0Y A;  5CHW A;  2K1F A;  3L16 A;  5AEK B;  4JLC A;  3TBL D;  3DBS A;  2L0T A;  3N32 A;  4NPN A;  1KOT A;  2JZZ A;  4FN2 A;  4M8M A;  3DVN V;  4NY0 A;  4W9C A;  3EHV A;  5AZF A;  4BOZ B;  3VH3 B;  3APF A;  2LZ6 A;  3HM6 X;  2ZJD A;  2N1V A;  4IM2 A;  4NQK E;  2C7H A;  2LUE A;  1UH6 A;  2KO3 A;  2GBN A;  4HXD A;  4FJV B;  3ZTD A;  4DBG A;  4WJQ A;  3QQ8 B;  2IO2 B;  2N7D A;  1UBQ A;  2W9N A;  4K7S A;  4TQ0 A;  3ZDT A;  2MP2 A;  3W1S A;  4HCP B;  2MBH A;  5CX3 A;  3DPD A;  1XT9 B;  3UIP B;  2DZJ A;  2JRI B;  4CHK A;  4BOS C;  1WX9 A;  3EEC A;  1K8R B;  1WX8 A;  1ZW7 A;  4IWQ A;  5D94 A;  5D2M B;  1WX7 A;  1WZ3 A;  4TV3 A;  1C3T A;  4DHJ B;  3L13 A;  3APD A;  2FCS A;  3V62 A;  4PS7 A;  2RPQ A;  2KOX A;  5DPS A;  1E90 A;  1A5R A;  1TTN A;  1WJ4 A;  1MG8 A;  1NI2 A;  2PE6 B;  2CKH B;  1AAR A;  4PS3 A;  4EZK A;  4K7W A;  2FIF A;  4K7U A;  3RT3 B;  2MWS B;  3ZRF A;  1WXS A;  4IM0 A;  2CHW A;  1SIF A;  2VRR B;  3APC A;  4ANX A;  1HE8 A;  1J19 A;  4W9F A;  1QZE A;  4BKS D;  3ZW3 A;  2K8B A;  5JHB A;  4NQL B;  3L54 A;  5LLI A;  1WY8 A;  4G50 A;  1UGM A;  1V9J A;  3Q3J A;  3B1L X;  3PHX B;  2AEH A;  3CSF A;  3ONS A;  4WJO A;  4IWP A;  3S2A A;  4DDG D;  2KDI A;  4ANU A;  4RM9 A;  4B9K A;  2N9E B;  2IBI B;  4K1R B;  2KQ7 A;  2D10 A;  5IA7 A;  2ZNV B;  3AU5 A;  4GXB A;  3AXC A;  5FR6 A;  1UBI A;  1WMH A;  2KQS A;  4ZRJ A;  4B6W A;  5C23 A;  2A5U A;  2NS5 A;  1KM7 A;  1WXM A;  3HIZ A;  4MSQ B;  2DEN B;  3ZDM C;  3KUZ A;  1J0G A;  2LXA A;  2NPT B;  2WX1 A;  3L0W B;  1YJ1 A;  2AL6 A;  5C1Z A;  3H1U A;  4RM8 A;  2GBR A;  4NJ6 A;  2MBO A;  2LGX A;  4N9F 4;  1E8Z A;  1Z2M A;  3A9K B;  2DYB A;  1XQQ A;  4OVU A;  5CHV C;  2LVQ A;  4AJW A;  1M94 A;  3OJ3 A;  4FHK A;  3QCA A;  3W1S C;  2L76 A;  2KKC A;  4AJY B;  2NCN A;  2DHZ A;  4EZJ A;  1YX6 B;  1RFA A;  1CMX B;  4ICV A;  1SE9 A;  2C60 A;  3RUI B;  2ZCB A;  3VQI A;  3R3M A;  2FCQ A;  2R2O A;  4GGQ A;  3VFK A;  4ASW C;  4BFR A;  2L8J A;  3GOE A;  3V61 A;  4LDT D;  1KJT A;  3IFW B;  2BGF A;  3EC8 A;  1EF5 A;  2G4D B;  1F9J A;  1YD8 U;  3SU8 X;  2FNJ B;  2N4F A;  2MQJ A;  1LFD A;  2RR9 A;  2K39 A;  2WYQ A;  4LCD E;  1IPG A;  1P1A A;  2Y5B B;  2C7N B;  3PRZ A;  2G3Q B;  2PE9 A;  1WM3 A;  2LVP A;  2JUO A;  3ZO5 B;  4EUT A;  1PQS A;  2AL3 A;  3LDZ E;  2J0J A;  2RGF A;  3L10 B;  3VUW A;  2EMT A;  2JF5 A;  3ZNH B;  2L00 B;  4GDL A;  3VH4 B;  4FBJ B;  3PSE B;  2ZPY A;  3D32 A;  3U30 A;  1WGG A;  3PT2 B;  2JT4 B;  1SGH A;  1WGR A;  2BF8 B;  2N1W A;  3ZKJ C;  3TMP B;  3R7Q A;  4I6N B;  4IW0 A;  3DVN U;  4A3O A;  4GSW A;  2GBK A;  1WI0 A;  4HVB A;  3PTF C;  2LRW A;  1I35 A;  3KYC D;  4XX5 A;  3L08 A;  2KFK B;  2BKR B;  1NBF C;  2KN5 A;  3HHM A;  4HWI B;  4DK5 A;  4FAD A;  1S1Q B;  2MRP A;  3CST A;  5TR5 A;  2A4Z A;  2KDB A;  2NVU I;  4KIK A;  2O2V A;  1IYF A;  4J6I A;  3H7P B;  4GU2 A;  1WE7 A;  4MGZ E;  3BIN A;  3C0R B;  1V2Y A;  4FUL A;  2AYO B;  2B3A A;  4RMA A;  3TL5 A;  2DYO A;  2M4N A;  4BBN C;  1OTR B;  1I42 A;  4II3 B;  3DVG X;  2KNB A;  3QC8 B;  3A1Q B;  1XD3 B;  4FJY A;  4HDQ A;  3P2B A;  1G6J A;  2MA9 B;  4FA6 A;  3RD2 A;  2KTR B;  2HJ8 A;  3X0W A;  2NBU A;  2RSU A;  1WJU A;  3DBR I;  3JSV A;  5L83 A;  2V1Y A;  3M95 A;  5G55 A;  4LDT B;  4MJS B;  4WWO A;  3KYD D;  3U7D A;  3R66 C;  3QAQ A;  5J2R A;  2GMI C;  2KFJ A;  2WDT B;  3H9D A;  3PHW B;  5JZE B;  5E6N A;  4AP4 C;  3ECI A;  4WJP A;  2OOB B;  2LD9 A;  2PPH A;  1TBE A;  3ZNZ B;  4ICU A;  3TJP A;  4NAW A;  4M0W B;  4GDK B;  4JIO U;  1S3S G;  1WXA A;  2HTH A;  3AI5 A;  3HM3 A;  3N30 A;  3ZLZ A;  2DZK A;  2FID A;  2PJH A;  2I1J A;  3RYT A;  2HD5 B;  4IG7 B;  1GC7 A;  1Y8R C;  2M0X A;  5G2N A;  3UF8 A;  1H8C A;  3N3K B;  2KTF A;  2KX3 A;  3IHP C;  3VUY A;  2LAS A;  2ZPN A;  1KLV A;  2BYF A;  2RD0 A;  1WR1 A;  2KX0 A;  4MEM A;  2DYM A;  2UWQ A;  2N9P C;  4XZ4 A;  3TIX A;  4I6L B;  2O6V A;  2DZM A;  3K9O B;  1WJ6 A;  3A9J A;  4FHJ A;  3JVZ X;  3RUL A;  1WRD B;  3BY4 B;  3V60 A;  3V6C B;  2KHW B;  3SHQ A;  1V5T A;  4W9E A;  4EOY A;  4LJO B;  3NZU A;  2ASQ A;  2M17 A;  4BVU C;  3T9L A;  4GMV A;  3QIJ A;  3MHS D;  4KSL C;  3SDL C;  1V80 A;  2KMA A;  2D07 B;  2CHZ A;  2KMC A;  1UD7 A;  2LI5 A;  3QAR A;  4P7I A;  1H4R A;  3IVF A;  5CTR C;  3T8M A;  4ZDV A;  2KVR A;  5GMV A;  5EDS A;  4M8N A;  3OLM D;  1WXV A;  4WAA A;  3ZNI D;  2MP2 B;  2WX0 A;  3IBE A;  5IAA C;  2EMS A;  3DBL I;  3WAO A;  1GNU A;  1GC6 A;  2LXC A;  3ZVV A;  2D3G A;  4W9G A;  2KWV B;  4W9J A;  4GOC A;  4CYE A;  4F8C B;  1V81 A;  2J0K A;  2MX2 A;  4F7Z A;  1Q1O A;  3KVF B;  3GZN I;  1WJN A;  2ZNV C;  2N9X A;  1OEY A;  3PLU A;  2KC1 A;  4DWF A;  2AWT A;  5DCN A;  3ZUN A;  1WGD A;  4DHZ E;  2KDE B;  4II2 B;  3K9P B;  3H7P A;  3M62 B;  3DDC B;  2KZR A;  3QHT A;  5CHF A;  1WR6 E;  3DQV A;  2JWZ A;  3JYU A;  4GIV A;  4IC7 B;  2NR2 A;  2M8S A;  1R4N I;  4GB9 A;  3VDZ A;  4K81 A;  3ENE A;  1J8C A;  4PYZ A;  4W9D A;  2KTR A;  2KJR A;  3ZNG C;  1TZ1 A;  2IY0 B;  2IO0 B;  3PPA A; 
#chains in the Genus database with same CATH topology
 3AUL A;  2BYE A;  3IG3 A;  2IO1 B;  1K51 A;  2DZI A;  1R4M B;  1WH3 A;  3DHH C;  1AW7 A;  1BT0 A;  4XWW A;  3IXS A;  3HK0 A;  2WGS A;  1JCK B;  2R2Q A;  4EKU A;  3L17 A;  3WA0 A;  3MHZ A;  2JRH A;  4HEA 1;  3RZF A;  3VTU A;  1TY0 A;  2L05 A;  5D7G A;  3AEE B;  3Q3F A;  1OGW A;  3X23 A;  2BVC A;  2K8H A;  1V86 A;  3NZS A;  1I7H A;  1WF9 A;  2BPS A;  4M00 A;  1VLB A;  4TUU A;  1SJH D;  2NBV B;  4KSK C;  4D2K A;  3QK0 A;  4G3X B;  3VVW B;  3B2F A;  3DCG A;  5IO9 A;  3Q69 A;  1E7V A;  1V97 A;  3A9K A;  2CU3 A;  2BT6 A;  3Q3M C;  1Q10 A;  2G9H D;  3UIO B;  1ZDX A;  1DOX A;  1ET6 A;  4DDI D;  3TEZ A;  2BKF A;  3PZ7 A;  1XF5 L;  3ZTC A;  2WXR A;  1T0R C;  2ZVO A;  2INP E;  5DPT A;  1E8W A;  4AUQ C;  4IKG A;  2G1E A;  1XLN A;  3RNB C;  1NDD A;  1Q5W B;  4KIK B;  3NJT A;  1XO3 A;  1K52 A;  2LMC A;  2JSV X;  2J7Q B;  4A9A A;  1RAX A;  2INC C;  4N58 A;  2IPK D;  4BKS A;  3HRD D;  2BYV E;  2Z59 B;  2K9X A;  1Q0W B;  1ISN A;  2QHO A;  1OQY A;  4HRS A;  3NUH B;  2GBJ A;  3OWE B;  4BKT A;  2V4L A;  3NVV A;  3RCZ A;  1V49 A;  4A90 A;  1L0X B;  4WQO B;  1V5O A;  1C4C A;  5G5H A;  2DLB A;  3AE5 B;  1ZE3 D;  2LRU A;  4KGS A;  2BYT A;  3A4R A;  4AOF A;  4EFO A;  1NEN B;  2WHI A;  5IN7 A;  4MEL A;  1C1Y B;  2LGY A;  4DXA B;  3AE3 B;  1KRH A;  4A20 A;  2V4I B;  4MJS A;  2MBQ A;  2SEB D;  1P98 A;  2WU2 B;  4A6Q A;  3VTV A;  5FK9 C;  2L7R A;  3M3J A;  4MM3 A;  2ONQ A;  4JL9 A;  5BMG A;  3AE8 B;  3AEF B;  3Q2A C;  2D11 A;  2MJD A;  3ML9 A;  1GUA B;  2N7J A;  3ALB A;  2IZV B;  4WWM A;  4KVG B;  3GS2 A;  1JRU A;  2CS4 A;  1F0Z A;  3U8Z A;  4DQO C;  1N5W A;  3DBS A;  1TJE A;  3GP7 A;  2WDQ B;  3BVM A;  4M8M A;  4W9C A;  4LTU A;  2WXH A;  2N1V A;  4IM2 A;  2LUE A;  1UH6 A;  3ZTD A;  1FXA A;  2IO2 B;  3B2G A;  1UBQ A;  4TQ0 A;  3ZDT A;  1WWT A;  2MP2 A;  3W1S A;  5CX3 A;  3DPD A;  1XT9 B;  4CHK A;  4BOS C;  1WX8 A;  1AWD A;  4NAM A;  1C3T A;  4ZHO A;  2MJ3 A;  2FCS A;  3V62 A;  1E90 A;  3BZD B;  1FFV A;  1TTN A;  1AAR A;  1NYR A;  4EZK A;  2D3B A;  3RFZ B;  1WXS A;  3URY A;  4ZOH C;  2CHW A;  2VH2 A;  4W9F A;  5D3I B;  4BKS D;  2B76 B;  1VJK A;  5JHB A;  3P4S B;  4NJC A;  2IBI B;  2IND C;  2D10 A;  5EE0 A;  4KKI A;  1WMH A;  2KQS A;  3FAH A;  4ZRJ A;  2A5U A;  1C4A A;  1KM7 A;  2NS5 A;  1C9F A;  3KUZ A;  1J0G A;  2NPT B;  3H1U A;  1D5M C;  2L52 A;  4N9F 4;  1E8Z A;  1IBX B;  2DYB A;  1BUI C;  2LVQ A;  2LHD A;  4AJW A;  2WXP A;  1R4N B;  3W1S C;  4AJY B;  3ETR A;  2DHZ A;  1YX6 B;  4ICV A;  1SE9 A;  3RUI B;  2ZCB A;  4GGQ A;  3VFK A;  2J42 A;  2L8J A;  5FR3 A;  3V61 A;  4O1N A;  3VR8 B;  2BGF A;  2G4D B;  1DYQ A;  1WYG A;  2N4F A;  1L4Z B;  2WYQ A;  3GB1 A;  1IPG A;  1CJE A;  3PRZ A;  2G3Q B;  2PE9 A;  4RNA A;  3ZO5 B;  4EUT A;  3LDZ E;  5HFY A;  2EMT A;  2W82 A;  3TEX A;  3P4R B;  3VH4 B;  1FD6 A;  3PSE B;  4WAF A;  3PT2 B;  1PGA A;  4RF0 A;  1FO4 A;  2BF8 B;  2N1W A;  1N61 A;  4I6N B;  3DVN U;  4GSW A;  2KQ4 X;  4P6V F;  3HHM A;  2PVG C;  1NI3 A;  4HRO A;  1SE3 A;  4KIK A;  1F52 A;  1M4V A;  4GU2 A;  3TL5 A;  4DK5 A;  1V2Y A;  3AH7 A;  2B3A A;  1I42 A;  1JWA D;  2DYO A;  1I4H A;  2KVZ A;  3NRZ A;  4L23 A;  1ENF A;  3SFE B;  2JQR B;  4LK0 M;  3X0W A;  2NBU A;  2RSU A;  1WJU A;  1EWC A;  3DBR I;  1J7C A;  1GAQ B;  2V1Y A;  5L83 A;  4ZYS A;  3R66 C;  5J2R A;  2WXK A;  3PHW B;  2K3U A;  5E6N A;  4AP4 C;  2KYW A;  4WJP A;  2LD9 A;  1L0V B;  1TBE A;  5BYQ A;  1TT5 B;  2JZP A;  1WXA A;  1FNV A;  2HTH A;  3N30 A;  1CQV A;  2HD5 B;  4IG7 B;  1N5X A;  1H8C A;  3N3K B;  1QOB A;  2KTF A;  1YJJ A;  3W2D A;  3NS1 A;  5MPO A;  1BML C;  2LJI A;  4NZL B;  2N9P C;  2PTL A;  2DZM A;  1UNS A;  3K9O B;  1WJ6 A;  1TS2 A;  3BY4 B;  5EE9 A;  3SHQ A;  1V5T A;  2Y5P A;  1UUP A;  1F2R I;  3T9L A;  1E10 A;  3QIJ A;  3MHS D;  4KSL C;  1E6E B;  1UD7 A;  1SE2 A;  5CTR C;  5GMV A;  4B0E A;  4M8N A;  3OLM D;  3GE3 C;  3IBE A;  5BMI A;  1FNW A;  1GC6 A;  3LYY A;  3ZVV A;  1PDX A;  3IAS 1;  4W9J A;  4CYE A;  4F8C B;  1V81 A;  3W9C B;  3N1X C;  1QF6 A;  3GZN I;  2PMV A;  1V1O A;  3ZUN A;  1WGD A;  2JXT A;  4LNN A;  4II2 B;  2Y3A A;  1NEK B;  2M0A A;  2R61 A;  2JWZ A;  4K81 A;  3ENE A;  1J8C A;  4W9D A;  2BW2 A;  2HTM E;  2IY0 B;  1ZKH A;  1WGH A;  5TSS A;  4NJ7 A;  4WH4 A;  4W9H A;  2KWU B;  2MBB B;  5J17 A;  3WIM A;  4AS1 A;  1WYW B;  3DVG Y;  1HTO A;  2KXJ A;  5DPR A;  2PLP A;  2KDM A;  2KLG A;  2ZVN A;  2FCN A;  3MTN B;  2BS2 B;  2NBW B;  3SD5 A;  3RN9 C;  1XCQ L;  3R7R A;  4PT5 A;  2L0F A;  2M1M A;  3PRE A;  3WAM A;  1YJI A;  4AQ7 A;  3HVZ A;  3KLS X;  2IDY A;  4S17 A;  3PZD A;  4USA A;  3AU4 A;  2G4S A;  1UZX B;  1YQB A;  5L95 C;  2KWC A;  3O65 B;  1HXY D;  3EFU A;  3MC0 B;  3PVL A;  3UQA A;  3A33 B;  3RZW C;  2MSE D;  2NPT A;  2KC2 A;  4C00 A;  4TQ1 A;  3L4P A;  4CO7 A;  3TEY A;  2KAN A;  1LXD A;  4P1C C;  4OVV A;  3PRM B;  1EUV B;  2PW9 A;  2V3N A;  4IOI E;  2LHE A;  1SIJ A;  3R8B A;  4ZYN A;  1TGZ B;  2L32 A;  3MP9 A;  1SXT A;  4XWT A;  3B08 A;  3AV8 A;  4RF1 A;  5AZH A;  2X38 A;  2O2V B;  2KD0 A;  4HPL B;  3NS8 A;  4TSS A;  1KFY B;  4MDK E;  2FAZ A;  4PS8 A;  4RGN A;  4W9K A;  4MGK E;  3W5U B;  2L1A A;  2XNA C;  3BK2 A;  2QMT A;  3WAP A;  2IGH A;  3JSV B;  3H6N A;  1YN3 A;  3W1Y A;  3WAN A;  4BZA A;  2C9W B;  2GBM A;  2BBC A;  1GJZ A;  1T0S C;  2QC8 A;  1L7Y A;  4WJN A;  4A3P A;  4NNJ B;  2WXG A;  2BWE S;  5LXI B;  2K8C A;  3QWZ B;  4IUM B;  4X57 B;  4W9L A;  3VHT C;  4DHZ B;  4ARI A;  1EWY C;  4YXD B;  4XE0 A;  4HJK A;  4HK2 A;  1FIQ A;  1KF6 B;  4ANV A;  4YL8 A;  1SJE D;  1JW9 D;  2GRI A;  3KWV A;  3H7S A;  4BBN F;  1X1M A;  5J18 A;  3AE1 B;  5HKH A;  2DWQ A;  4MT5 A;  2N0S B;  1HTQ A;  2JVC A;  3MC8 A;  2XBB C;  3V3X A;  1WGY A;  3O13 A;  4LJP B;  3A9J B;  2K22 A;  4JWU C;  2KK8 A;  4JWS C;  2D3A A;  1WMH B;  4XC2 A;  3KUD B;  3PZ8 A;  2FUH B;  2FE8 A;  3WCQ A;  1WM2 A;  3AMZ A;  2XEW A;  1GG3 A;  1FRD A;  1FEH A;  2CR5 A;  1D5Z C;  1WSP A;  1J7A A;  4US8 A;  1VZ7 A;  1UWX A;  3BVZ A;  4ZHP A;  2IYD B;  2JZ3 B;  2IY1 B;  4HPM B;  1ZXI A;  2MBE A;  2D2Q A;  1SF0 A;  3OAW A;  3AB5 A;  1T0Y A;  3L16 A;  1ZPS A;  1SB3 C;  1VDV A;  2KWD A;  4NQK E;  2KO3 A;  4HXD A;  2GBN A;  1R7S A;  1F1H A;  4DBG A;  4WJQ A;  3QQ8 B;  2ACZ B;  2N7D A;  2W9N A;  1PGB A;  4HCP B;  1YN4 A;  1K53 A;  1JWS D;  3UIP B;  1YOV B;  1WX9 A;  3EEC A;  1K8R B;  1ZW7 A;  3SEB A;  5D2M B;  1WX7 A;  3L13 A;  3U2S C;  4N59 A;  2RPV A;  4TMA B;  2KOX A;  3N1Z C;  1MG8 A;  1NI2 A;  2PE6 B;  4PS3 A;  1EM7 A;  4IM0 A;  2VRR B;  1SIF A;  4ANX A;  2NMQ A;  1QZE A;  1RWS A;  3L54 A;  5LLI A;  1WY8 A;  3PHX B;  4C80 A;  2AEH A;  3DBL B;  2N9E B;  2KT7 A;  3AU5 A;  3AXC A;  4XDC A;  2QIL A;  3V05 A;  4FXC A;  4MSQ B;  2DEN B;  1GB1 A;  2IJ0 A;  1YJ1 A;  2AL6 A;  3NVW A;  2GBR A;  3ZQ4 A;  2MBO A;  1RYJ A;  4OVU A;  2INN E;  2NTS A;  4C7Y A;  3GE8 C;  4P1B C;  3NZ3 A;  1YN5 A;  1RFK A;  2NCN A;  4YSZ B;  3B9J A;  3HUI A;  4WQM A;  3GOE A;  1KJT A;  3P63 A;  3IFW B;  3EC8 A;  3RNE C;  1F9J A;  3SU8 X;  4YT0 B;  1JML A;  2MQJ A;  1LFD A;  2K39 A;  1JRO A;  2Y5B B;  2SAK A;  2LVP A;  3KQ4 A;  2LUM A;  2RGF A;  3L10 B;  2CJO A;  2KMM A;  2MHJ A;  3ZNH B;  2VZK D;  4FBJ B;  2ZPY A;  1WGG A;  2JT4 B;  3ZKJ C;  4H2A A;  3R7Q A;  4IW0 A;  3HVD A;  4A3O A;  2J4X A;  1MFW A;  2VH1 A;  5T8I A;  1XLP A;  4XX5 A;  4RCO A;  1NBF C;  2KN5 A;  4FAD A;  1S1Q B;  2MRP A;  5TR5 A;  2KDB A;  1F77 A;  2GI9 A;  2O2V A;  1WE7 A;  4FA6 A;  3C0R B;  4BBN C;  4II3 B;  3DVG X;  3QC8 B;  1I4P A;  4HDQ A;  3P2B A;  2JU6 X;  2HJ8 A;  4LLG M;  3DHG C;  1QT9 A;  3JSV A;  2L83 A;  3M95 A;  5G55 A;  4LDT B;  3KYD D;  4MAC A;  3U7D A;  3QAQ A;  2GMI C;  2KFJ A;  3H9D A;  1IGD A;  2PPH A;  4WIP A;  2KN4 A;  3ZLZ A;  2DZK A;  1TZO A;  2K5P A;  2V0G A;  2I1J A;  3RYT A;  1GC7 A;  3AN1 A;  3IHP C;  1C4P A;  2DBY A;  2LAS A;  2ZPN A;  2BYF A;  2RD0 A;  4MEM A;  4XZ4 A;  2WXL A;  1ZOY B;  2DNF A;  3A9J A;  5AUK A;  1SSN A;  1WRD B;  5LNK 1;  2WXN A;  3V60 A;  3V6C B;  2KHW B;  4W9E A;  1D5X C;  1PUT A;  3NZU A;  4BVU C;  4GMV A;  4YTN B;  3RNG C;  3I57 A;  1H4R A;  3IVF A;  3T8M A;  4ZDV A;  2KVR A;  2WS3 B;  2IGG A;  1WXV A;  5BYR A;  3J9C A;  2EMS A;  1YNT E;  3IT4 B;  1FNU A;  1GNU A;  2LXC A;  4ARC A;  1P7F A;  1FCC C;  1JRP A;  2AQ2 B;  1PFD A;  4F7Z A;  5G5G A;  3Q3N C;  3PLU A;  4WUR A;  1L6V A;  1TS3 A;  2KDE B;  1SBB B;  3K9P B;  3DDC B;  2KZR A;  3QHT A;  4C7Z A;  1WR6 E;  3DQV A;  3NVY A;  2PIA A;  3C19 A;  4QAY A;  3U4E G;  1Y56 A;  4PYZ A;  2KJR A;  4OW0 A;  3T3O A;  1N60 A;  3ECI A;  4XDD A;  2HE7 A;  2K25 A;  2W3R A;  3BII D;  3E9S A;  4L2Y A;  2I38 A;  3KH0 A;  3NHE B;  4IM3 A;  4E3C A;  4TKN A;  4F1S A;  1OQQ A;  3VTW A;  3OJ4 B;  1GOZ A;  2J53 A;  1SE4 A;  4N6E B;  2V3S A;  4ZRK A;  1EF1 A;  2Z0D B;  2FUG 1;  2Z0E B;  2H88 B;  2C7M B;  4LNI A;  3DHI C;  2AQ3 B;  2KJH B;  2MLB A;  4YSY B;  3Q8C A;  3ZXR A;  3VUX A;  1VCB A;  2BTE A;  1WXQ A;  2WXJ A;  1VZ8 A;  2GB1 A;  1ZGU B;  4PYU A;  1ACC A;  4I6P A;  4DXF A;  2WLB A;  3TCA A;  2VZK B;  3IAM 1;  1OFF A;  3QA8 A;  2XN9 C;  3RMK C;  3KW5 B;  4MH8 A;  2ZEQ A;  3FIL A;  3SR6 A;  3UGB B;  4B95 A;  2ICI A;  2EKE C;  2D3C A;  4WWP A;  3T3N A;  1I4R A;  1J7B A;  1UEL A;  4RGT A;  2MJE A;  2CHX A;  4W9I A;  3V6E B;  1BXT A;  2PEA A;  3Q8B A;  2KAJ A;  1JWB D;  3MJW A;  4ZRI A;  4ANW A;  4MGY E;  2ZW0 A;  5E6J A;  3PS6 A;  2FCM A;  2JY6 A;  2JXX A;  4NAW B;  4AWJ A;  2ZZP B;  3DWM A;  1N62 A;  2C5L C;  3WAL A;  3PV1 A;  3ML8 A;  3CMM B;  5HG2 A;  3MC9 A;  1IUE A;  1P9D U;  2BWF A;  3AE6 B;  4HDO A;  5HI1 A;  5BYS A;  3ZXV A;  3DBH I;  3VXW A;  2K6Q A;  3RNC C;  2O6V B;  3VAW A;  2ZCC A;  2KDF B;  2LWP A;  2LJ5 A;  2MW5 A;  3PRP B;  2WXQ A;  4GN1 A;  5D3D A;  5DPW A;  2K6D B;  1V1P B;  4KGR A;  5KHO A;  3NY5 A;  2M19 A;  3Q6B A;  1B9R A;  2WWZ A;  3VRA B;  3AE7 B;  1YX5 B;  4EEW A;  4LNF A;  5LXH A;  2YVC A;  2IO3 B;  4MGI E;  1I4G A;  2REX A;  2N9K A;  1T5X D;  3M63 B;  2JYE A;  3KUC B;  2XK5 A;  1R4M I;  2V3P A;  1FM0 D;  1RRB A;  2JPH A;  1P7E A;  4REZ A;  3DBR B;  1NYQ A;  1LO5 D;  2K1F A;  5AEK B;  4C4V A;  2WXM A;  3BWU D;  3N32 A;  2L0T A;  2E3T A;  1KOT A;  1YMH E;  4FN2 A;  3DVN V;  1SEB D;  3EHV A;  4BOZ B;  3VH3 B;  3APF A;  2K0P A;  3HM6 X;  2NTT A;  3I9V 1;  4K7S A;  1C77 A;  1V8C A;  1STE A;  2HJ1 A;  3N20 C;  1CZP A;  3ZJV A;  1IGC A;  1TKY A;  2JRI B;  1TY2 A;  5D94 A;  4TV3 A;  4DHJ B;  3APD A;  2RPQ A;  1WJ4 A;  3BVG A;  1L6U A;  2ZW1 A;  3RT3 B;  1QIL A;  1ZP0 B;  2WDR B;  1HE8 A;  1J19 A;  3ZJT A;  3BYT B;  3ZW3 A;  3TEW A;  4NQL B;  4G50 A;  1UGM A;  3Q3J A;  3B1L X;  2MEK A;  1PGX A;  1VZ6 A;  2KDI A;  4RM9 A;  4ANU A;  1HZ6 A;  4K1R B;  2KQ7 A;  2WQY B;  1EU3 A;  1UBI A;  2BS3 B;  3AED B;  2PKO A;  3GZN B;  2WX1 A;  3IT6 B;  5C1Z A;  1KTK A;  4NJ6 A;  5C2T B;  1T6B X;  2QDF A;  4ZRQ A;  1XQQ A;  5CHV C;  4BAX A;  4K3C A;  3OJ3 A;  1UF0 A;  3QCA A;  5I4D A;  4EZJ A;  1CMX B;  5FKA C;  4BFR A;  2WP9 B;  3U7Z A;  5EE3 A;  4LDT D;  3SFD B;  1EF5 A;  1YD8 U;  2FNJ B;  2RDH A;  2C7N B;  3EFC A;  2JUO A;  1T0Q C;  1DGJ A;  1FXI A;  2J0J A;  3VUW A;  1XCT L;  3NVZ A;  2JF5 A;  1PYW D;  1TIF A;  2AX5 A;  3D32 A;  2KAC A;  1WGR A;  3AEA B;  3AE9 B;  3R2T A;  4RH6 A;  2JWU A;  5HHD G;  2GBK A;  1WI0 A;  2LRW A;  1QKZ A;  2E6X A;  4P16 A;  1QOA A;  4JX1 C;  2OHF A;  3OG5 A;  2KFK B;  2BKR B;  4HWI B;  1TKG A;  2A4Z A;  2NVU I;  2GLS A;  1TS4 A;  2WXI A;  2H89 B;  4FUL A;  4MGZ E;  2AYO B;  2M4N A;  3EGR A;  5EE1 A;  1OTR B;  2KNB A;  3A1Q B;  3CIR B;  2RDB C;  1XD3 B;  1G6J A;  2MA9 B;  1HEZ E;  2BB5 A;  3RD2 A;  3Q14 C;  4RGO S;  4CQN A;  2V9H A;  3AM9 A;  3MFG A;  4WWO A;  4KKJ A;  1L5P A;  1MHH E;  2WDT B;  2OOB B;  1XXG A;  4ICU A;  3TJP A;  4NAW A;  4GDK B;  4JIO U;  4OVZ A;  1S3S G;  3MJ5 A;  2QCZ A;  1KLG D;  2PJH A;  2Z8L A;  4M01 A;  1Y8R C;  2M0X A;  1UWM A;  1KLU D;  5G2N A;  3UF8 A;  1HA5 A;  2KX3 A;  3I63 C;  3VUY A;  4JE3 B;  1QOF A;  2KX0 A;  2DYM A;  2BQQ A;  4I6L B;  2O6V A;  2OED A;  1C76 A;  4HKQ A;  4FHJ A;  3RUL A;  3LXF A;  1T3Q A;  3ZGZ A;  4LJO B;  3ZYY X;  2LFI A;  1V1P A;  4B0M A;  2Y5C A;  2WXF A;  2KMA A;  2D07 B;  2KMC A;  3QAR A;  4P7I A;  4Q2J A;  5EDS A;  3Q8A A;  3ZNI D;  5IAA C;  2WX0 A;  4OZB A;  1YQ4 B;  2D3G A;  4W9G A;  2KWV B;  1E0Z A;  1EU4 A;  1FCL A;  4R3D A;  2MX2 A;  1Q1O A;  2ZNV C;  2N9X A;  1OEY A;  3FIL B;  2WXO A;  4DHZ E;  3Q8E A;  3KWL A;  3H7P A;  3JYU A;  4GIV A;  4IC7 B;  2NR2 A;  2M8S A;  1R4N I;  4GB9 A;  3Q8F A;  2KTR A;  5AUI A;  1TZ1 A;  3PPA A;  2BS4 B;  2PVO D;  3H8H A;  3PGE A;  2KLC A;  2LVO A;  4M02 A;  1E5W A;  2J0M A;  4ZRP A;  2G45 B;  4J3O D;  4M0W A;  2MH7 A;  3AEB B;  4BKG A;  3PLV A;  3UQB A;  3EA6 A;  1YIW A;  4FJZ A;  4A8X C;  2L3Z A;  3QJZ A;  4K3B A;  4US9 A;  2AQ1 B;  3P4Q B;  1E7U A;  4XYC A;  3C8Y A;  1E8X A;  1ROE A;  5JHA A;  2LEK A;  1U4A A;  2GOW A;  4KZC A;  2M56 B;  1K50 A;  3UI3 A;  2DX5 B;  3CWI A;  5E6O A;  3FC4 A;  1MPE A;  1XLO A;  3UIN B;  2CJN A;  1YQ3 B;  1L4D B;  3DOW A;  1TYG B;  5IP4 D;  2HDE A;  2BB6 A;  4G0N B;  4LNO A;  3ZIM A;  1OEY J;  4GDL B;  1LGR A;  2LGD A;  1E9M A;  3LJ3 A;  3BYY B;  1E8Y A;  4G11 A;  1Z5S B;  4EZL A;  2XK5 B;  2O6V D;  2UYZ B;  2W55 A;  2KJ6 A;  4KDI C;  1VD2 A;  1P0R A;  4KX6 B;  1LQB A;  1TKE A;  2QSD A;  4HJG E;  5H92 C;  4C4V B;  4E74 A;  1WFY A;  4LNK A;  4E71 A;  1D3Z A;  1AYF A;  2N7E A;  4YTP B;  1RLF A;  2MCN B;  1AN8 A;  1LM8 B;  4GLS C;  4IDI A;  3E56 A;  1F2R C;  3I3T B;  4OZA A;  1DOI A;  5D6J B;  1L0Y B;  5H8Y E;  2I1K A;  4MSM B;  1P3Q U;  1B1Z A;  1JWU D;  1ET9 A;  4HCN B;  3NOB A;  3ZRC A;  4KDL B;  4WWN A;  5JH5 C;  1JQ4 A;  2KFK A;  1VR9 A;  4JQW C;  4RGM A;  3RI7 C;  1WE6 A;  2CU1 A;  2DAF A;  2OJR A;  4KV2 A;  4MH0 E;  3A1Q A;  1ZXH A;  2DAJ A;  2WNM A;  1UGJ A;  2IGD A;  2W54 A;  4URK A;  4IWO A;  1EO6 A;  4HPP A;  1GPX A;  1L2N A;  3JW0 X;  2OJW A;  3CF6 E;  1WIA A;  5BO4 B;  2YLM A;  1V6E A;  1WGK A;  1MJD A;  1IP9 A;  4DHJ D;  4GDK A;  5KHQ A;  4HLE A;  4KZ0 A;  1FXT B;  4ACF A;  1JWM D;  4UDU C;  4JGH B;  1FRR A;  1WZ0 A;  3B0A A;  5AZG A;  4FLH A;  2D5G A;  3QX1 A;  3A4S C;  5E6P A;  5CHW A;  2RDG A;  4JLC A;  3TBL D;  1C78 A;  1GB4 A;  4PK1 A;  4NPN A;  3TSS A;  2JZZ A;  2EEL A;  5AZF A;  4NY0 A;  3P1M A;  4ITK A;  2LZ6 A;  2QJL A;  2ZJD A;  1XLQ A;  1HQR D;  2C7H A;  3N1Y C;  4YSX B;  3NG0 A;  4FJV B;  2EKI A;  2RMM A;  2MBH A;  3P4P B;  2DZJ A;  4IWQ A;  3RNF C;  1XEE A;  1WZ3 A;  3AEG B;  2LGI A;  5IKC M;  3VRB B;  4PS7 A;  5DPS A;  1A5R A;  1QOG A;  2CKH B;  4K7W A;  2FIF A;  4K7U A;  2MWS B;  3ZRF A;  3APC A;  3ZJU A;  2X8X X;  2K8B A;  1I4X A;  2UU7 A;  1QQR A;  1V9J A;  2Q5W D;  3CSF A;  3ONS A;  4WJO A;  4IWP A;  3S2A A;  4DDG D;  4B9K A;  4C56 C;  3Q3O C;  4RFB A;  5IA7 A;  2ZNV B;  4GXB A;  3FKY A;  5FR6 A;  1E7P B;  4B6W A;  5C23 A;  3HIZ A;  3ZDM C;  1WXM A;  2N9L A;  2LXA A;  3L0W B;  4RM8 A;  3P42 A;  2LGX A;  4YWG G;  1FPY A;  1Z2M A;  3A9K B;  4S0R A;  1RM6 C;  1M94 A;  4FHK A;  2L76 A;  2KKC A;  3RNA C;  1RFA A;  2C60 A;  4A55 A;  2QEJ C;  3VQI A;  3R3M A;  2FCQ A;  2R2O A;  4ASW C;  1C79 A;  3DWG C;  4JPS A;  2LGS A;  3R2I A;  3I5J C;  1FMA D;  1QLB B;  5JXV A;  2RR9 A;  2J52 A;  4LCD E;  1P1A A;  4HKZ E;  3W5V B;  1WM3 A;  1PQS A;  2AL3 A;  1FFU A;  1ZUD 2;  2L00 B;  1WRI A;  4GDL A;  3U52 E;  3U30 A;  1SGH A;  1DOY A;  3TMP B;  1HZ5 A;  2YEP B;  4HVB A;  3EUB 2;  3PTF C;  1I35 A;  3KYC D;  3L08 A;  3VR9 B;  1JAL A;  3CST A;  3PO0 A;  1ZDV A;  1IYF A;  1MI0 A;  4J6I A;  3H7P B;  4RMA A;  3BIN A;  5C3J B;  3AE4 B;  4FJY A;  1VRA B;  3AEC B;  2KTR B;  1TS5 A;  1I4Q A;  2JX5 A;  1KH0 A;  4MJS B;  2I2Y A;  4YTM B;  5JZE B;  3BK1 A;  3ZNZ B;  2QIE B;  4MM3 B;  4M0W B;  3AI5 A;  3HM3 A;  2FID A;  4L1B A;  1NVI D;  1IBX A;  3LB8 C;  1ESF A;  5BMH A;  1N63 A;  4EE2 A;  1KLV A;  1WR1 A;  1D4B A;  2UWQ A;  3TIX A;  4OHJ A;  1D6E C;  2WU5 B;  3JVZ X;  5GXG B;  4EOY A;  3ABV B;  3RPF C;  3AE2 B;  1MHX A;  2ASQ A;  2M17 A;  4OZC A;  3SDL C;  1V80 A;  1OQR A;  4KGT A;  2CHZ A;  2LI5 A;  4DXG A;  1MVK A;  2W3S A;  2FBW B;  2JYT A;  4WAA A;  2MP2 B;  3DBL I;  3WAO A;  2WDV B;  4GOC A;  3DBH B;  2ON8 A;  3TUO A;  2J0K A;  3KVF B;  1N6Z A;  1WJN A;  2KC1 A;  4DWF A;  2AWT A;  5DCN A;  2YEP F;  4XGA B;  3N9Y C;  3M62 B;  5CHF A;  3VDZ A;  1A70 A;  1CK1 A;  2TSS A;  5IOI A;  1MG4 A;  3ZNG C;  2IO0 B; 
#chains in the Genus database with same CATH homology
 1ZKH A;  1WGH A;  4NJ7 A;  2HE7 A;  2K25 A;  3AUL A;  2BYE A;  3PGE A;  2KLC A;  2IO1 B;  3IG3 A;  4W9H A;  2KWU B;  2MBB B;  3NHE B;  3KH0 A;  4IM3 A;  5J17 A;  4E3C A;  4TKN A;  2LVO A;  2DZI A;  1E5W A;  3WIM A;  1WYW B;  1WH3 A;  2J0M A;  2G45 B;  4F1S A;  5JH5 C;  3UQB A;  4BKG A;  3PLV A;  3DVG Y;  1YIW A;  4FJZ A;  1BT0 A;  2KXJ A;  2L3Z A;  5DPR A;  3QJZ A;  2KLG A;  2ZVN A;  3HK0 A;  2FCN A;  1E7U A;  2R2Q A;  4EKU A;  3MTN B;  3L17 A;  2NBW B;  3SD5 A;  3VTW A;  3OJ4 B;  3WA0 A;  1E8X A;  3R7R A;  2JRH A;  3RZF A;  3VTU A;  5JHA A;  1U4A A;  2GOW A;  2L0F A;  2L05 A;  2M1M A;  3PRE A;  4KZC A;  3WAM A;  2V3S A;  5D7G A;  4ZRK A;  1EF1 A;  2Z0D B;  3Q3F A;  2DX5 B;  5E6O A;  1OGW A;  3X23 A;  3UIN B;  2K8H A;  3PZD A;  1V86 A;  3NZS A;  3AU4 A;  2G4S A;  1WF9 A;  1UZX B;  1YQB A;  2BPS A;  2Z0E B;  5L95 C;  4TUU A;  2C7M B;  3DOW A;  2NBV B;  2KWC A;  3O65 B;  3EFU A;  2KJH B;  3PVL A;  2MLB A;  4KSK C;  3UQA A;  3QK0 A;  3A33 B;  3RZW C;  2MSE D;  3VUX A;  4G3X B;  1VCB A;  3VVW B;  2NPT A;  3DCG A;  2KC2 A;  4TQ1 A;  4G0N B;  1E7V A;  4CO7 A;  3A9K A;  1ZGU B;  4PYU A;  3ZIM A;  1OEY J;  2KAN A;  1LXD A;  4I6P A;  4GDL B;  4OVV A;  2LGD A;  3TCA A;  3PRM B;  1EUV B;  3LJ3 A;  1E8Y A;  4G11 A;  3UIO B;  3QA8 A;  1Z5S B;  3KW5 B;  4EZL A;  2XK5 B;  2O6V D;  2UYZ B;  4ZYN A;  2KJ6 A;  4DDI D;  1TGZ B;  4KDI C;  1VD2 A;  1P0R A;  2BKF A;  3ZTC A;  2ZEQ A;  2ZVO A;  5DPT A;  1E8W A;  4AUQ C;  3B08 A;  1LQB A;  3UGB B;  4E74 A;  1WFY A;  5AZH A;  4E71 A;  4B95 A;  1D3Z A;  1NDD A;  1Q5W B;  4KIK B;  2N7E A;  2O2V B;  2EKE C;  2KD0 A;  4WWP A;  1RLF A;  4HPL B;  2MCN B;  1LM8 B;  2J7Q B;  3NS8 A;  1RAX A;  1UEL A;  4MDK E;  2FAZ A;  4PS8 A;  4W9K A;  4BKS A;  3I3T B;  2CHX A;  4MGK E;  2BYV E;  4W9I A;  2Z59 B;  3V6E B;  5D6J B;  1Q0W B;  1ISN A;  3WAP A;  2PEA A;  2QHO A;  2I1K A;  3JSV B;  3H6N A;  3MJW A;  3W1Y A;  4ZRI A;  3WAN A;  1OQY A;  2C9W B;  2GBM A;  4MGY E;  4ANW A;  4MSM B;  1P3Q U;  1GJZ A;  1L7Y A;  3PS6 A;  2GBJ A;  4HCN B;  4WJN A;  4A3P A;  2FCM A;  2JY6 A;  3NOB A;  4NNJ B;  2BWE S;  2JXX A;  4KDL B;  2K8C A;  3ZRC A;  5LXI B;  4NAW B;  4WWN A;  4BKT A;  2V4L A;  4AWJ A;  3RCZ A;  1V49 A;  2ZZP B;  3QWZ B;  4IUM B;  4WQO B;  4X57 B;  4W9L A;  1V5O A;  3VHT C;  4DHZ B;  2KFK A;  4JQW C;  2C5L C;  1WE6 A;  2CU1 A;  3WAL A;  3PV1 A;  2DAF A;  3ML8 A;  4HJK A;  2OJR A;  4HK2 A;  2LRU A;  3CMM B;  4KV2 A;  1P9D U;  2BWF A;  4HDO A;  4YL8 A;  4ANV A;  3A4R A;  4AOF A;  4MH0 E;  4EFO A;  4BBN F;  3H7S A;  1X1M A;  5J18 A;  3DBH I;  3A1Q A;  4MEL A;  5HKH A;  2DAJ A;  2K6Q A;  3VXW A;  1C1Y B;  2JVC A;  2XBB C;  4URK A;  2LGY A;  1WGY A;  2O6V B;  3VAW A;  4DXA B;  2ZCC A;  4LJP B;  4IWO A;  2KDF B;  1EO6 A;  3A9J B;  4A20 A;  4MJS A;  2LWP A;  2LJ5 A;  2MBQ A;  2MW5 A;  1L2N A;  3JW0 X;  3PRP B;  2KK8 A;  1P98 A;  1WIA A;  3CF6 E;  4GN1 A;  2YLM A;  1V6E A;  2K6D B;  5BO4 B;  5DPW A;  1WMH B;  3VTV A;  1IP9 A;  4DHJ D;  5KHO A;  2L7R A;  4XC2 A;  3KUD B;  3M3J A;  4MM3 A;  2FUH B;  3NY5 A;  4GDK A;  5KHQ A;  1WM2 A;  4HLE A;  2WWZ A;  4KZ0 A;  1YX5 B;  2XEW A;  1FXT B;  1GG3 A;  4JL9 A;  4EEW A;  5LXH A;  2YVC A;  2CR5 A;  2IO3 B;  4MGI E;  2REX A;  2D11 A;  3ML9 A;  1GUA B;  4JGH B;  3ALB A;  2IYD B;  2JZ3 B;  3M63 B;  1WZ0 A;  3B0A A;  5AZG A;  2IY1 B;  2IZV B;  3KUC B;  2MBE A;  2XK5 A;  4FLH A;  4HPM B;  2D2Q A;  1JRU A;  2CS4 A;  1R4M I;  4KVG B;  3U8Z A;  1RRB A;  2JPH A;  3QX1 A;  3A4S C;  3OAW A;  5E6P A;  1T0Y A;  5CHW A;  2K1F A;  3L16 A;  5AEK B;  4JLC A;  3TBL D;  3DBS A;  2L0T A;  3N32 A;  4NPN A;  1KOT A;  2JZZ A;  4FN2 A;  4M8M A;  3DVN V;  4NY0 A;  4W9C A;  3EHV A;  5AZF A;  4BOZ B;  3VH3 B;  3APF A;  2LZ6 A;  3HM6 X;  2ZJD A;  2N1V A;  4IM2 A;  4NQK E;  2C7H A;  2LUE A;  1UH6 A;  2KO3 A;  2GBN A;  4HXD A;  4FJV B;  3ZTD A;  4DBG A;  4WJQ A;  3QQ8 B;  2IO2 B;  2N7D A;  1UBQ A;  2W9N A;  4K7S A;  4TQ0 A;  3ZDT A;  2MP2 A;  3W1S A;  4HCP B;  2MBH A;  5CX3 A;  3DPD A;  1XT9 B;  3UIP B;  2DZJ A;  2JRI B;  4CHK A;  4BOS C;  1WX9 A;  3EEC A;  1K8R B;  1WX8 A;  1ZW7 A;  4IWQ A;  5D94 A;  5D2M B;  1WX7 A;  1WZ3 A;  4TV3 A;  1C3T A;  4DHJ B;  3L13 A;  3APD A;  2FCS A;  3V62 A;  4PS7 A;  2RPQ A;  2KOX A;  5DPS A;  1E90 A;  1A5R A;  1TTN A;  1WJ4 A;  1MG8 A;  1NI2 A;  2PE6 B;  2CKH B;  1AAR A;  4PS3 A;  4EZK A;  4K7W A;  2FIF A;  4K7U A;  3RT3 B;  2MWS B;  3ZRF A;  1WXS A;  4IM0 A;  2CHW A;  1SIF A;  2VRR B;  3APC A;  4ANX A;  1HE8 A;  1J19 A;  4W9F A;  1QZE A;  4BKS D;  3ZW3 A;  2K8B A;  5JHB A;  4NQL B;  3L54 A;  5LLI A;  1WY8 A;  4G50 A;  1UGM A;  1V9J A;  3Q3J A;  3B1L X;  3PHX B;  2AEH A;  3CSF A;  3ONS A;  4WJO A;  4IWP A;  3S2A A;  4DDG D;  2KDI A;  4ANU A;  4RM9 A;  4B9K A;  2N9E B;  2IBI B;  4K1R B;  2KQ7 A;  2D10 A;  5IA7 A;  2ZNV B;  3AU5 A;  4GXB A;  3AXC A;  5FR6 A;  1UBI A;  1WMH A;  2KQS A;  4ZRJ A;  4B6W A;  5C23 A;  2A5U A;  2NS5 A;  1KM7 A;  1WXM A;  3HIZ A;  4MSQ B;  2DEN B;  3ZDM C;  3KUZ A;  1J0G A;  2LXA A;  2NPT B;  2WX1 A;  3L0W B;  1YJ1 A;  2AL6 A;  5C1Z A;  3H1U A;  4RM8 A;  2GBR A;  4NJ6 A;  2MBO A;  2LGX A;  4N9F 4;  1E8Z A;  1Z2M A;  3A9K B;  2DYB A;  1XQQ A;  4OVU A;  5CHV C;  2LVQ A;  4AJW A;  1M94 A;  3OJ3 A;  4FHK A;  3QCA A;  3W1S C;  2L76 A;  2KKC A;  4AJY B;  2NCN A;  2DHZ A;  4EZJ A;  1YX6 B;  1RFA A;  1CMX B;  4ICV A;  1SE9 A;  2C60 A;  3RUI B;  2ZCB A;  3VQI A;  3R3M A;  2FCQ A;  2R2O A;  4GGQ A;  3VFK A;  4ASW C;  4BFR A;  2L8J A;  3GOE A;  3V61 A;  4LDT D;  1KJT A;  3IFW B;  2BGF A;  3EC8 A;  1EF5 A;  2G4D B;  1F9J A;  1YD8 U;  3SU8 X;  2FNJ B;  2N4F A;  2MQJ A;  1LFD A;  2RR9 A;  2K39 A;  2WYQ A;  4LCD E;  1IPG A;  1P1A A;  2Y5B B;  2C7N B;  3PRZ A;  2G3Q B;  2PE9 A;  1WM3 A;  2LVP A;  2JUO A;  3ZO5 B;  4EUT A;  1PQS A;  2AL3 A;  3LDZ E;  2J0J A;  2RGF A;  3L10 B;  3VUW A;  2EMT A;  2JF5 A;  3ZNH B;  2L00 B;  4GDL A;  3VH4 B;  4FBJ B;  3PSE B;  2ZPY A;  3D32 A;  3U30 A;  1WGG A;  3PT2 B;  2JT4 B;  1SGH A;  1WGR A;  2BF8 B;  2N1W A;  3ZKJ C;  3TMP B;  3R7Q A;  4I6N B;  4IW0 A;  3DVN U;  4A3O A;  4GSW A;  2GBK A;  1WI0 A;  4HVB A;  3PTF C;  2LRW A;  1I35 A;  3KYC D;  4XX5 A;  3L08 A;  2KFK B;  2BKR B;  1NBF C;  2KN5 A;  3HHM A;  4HWI B;  4DK5 A;  4FAD A;  1S1Q B;  2MRP A;  3CST A;  5TR5 A;  2A4Z A;  2KDB A;  2NVU I;  4KIK A;  2O2V A;  1IYF A;  4J6I A;  3H7P B;  4GU2 A;  1WE7 A;  4MGZ E;  3BIN A;  3C0R B;  1V2Y A;  4FUL A;  2AYO B;  2B3A A;  4RMA A;  3TL5 A;  2DYO A;  2M4N A;  4BBN C;  1OTR B;  1I42 A;  4II3 B;  3DVG X;  2KNB A;  3QC8 B;  3A1Q B;  1XD3 B;  4FJY A;  4HDQ A;  3P2B A;  1G6J A;  2MA9 B;  4FA6 A;  3RD2 A;  2KTR B;  2HJ8 A;  3X0W A;  2NBU A;  2RSU A;  1WJU A;  3DBR I;  3JSV A;  5L83 A;  2V1Y A;  3M95 A;  5G55 A;  4LDT B;  4MJS B;  4WWO A;  3KYD D;  3U7D A;  3R66 C;  3QAQ A;  5J2R A;  2GMI C;  2KFJ A;  2WDT B;  3H9D A;  3PHW B;  5JZE B;  5E6N A;  4AP4 C;  3ECI A;  4WJP A;  2OOB B;  2LD9 A;  2PPH A;  1TBE A;  3ZNZ B;  4ICU A;  3TJP A;  4NAW A;  4M0W B;  4GDK B;  4JIO U;  1S3S G;  1WXA A;  2HTH A;  3AI5 A;  3HM3 A;  3N30 A;  3ZLZ A;  2DZK A;  2FID A;  2PJH A;  2I1J A;  3RYT A;  2HD5 B;  4IG7 B;  1GC7 A;  1Y8R C;  2M0X A;  5G2N A;  3UF8 A;  1H8C A;  3N3K B;  2KTF A;  2KX3 A;  3IHP C;  3VUY A;  2LAS A;  2ZPN A;  1KLV A;  2BYF A;  2RD0 A;  1WR1 A;  2KX0 A;  4MEM A;  2DYM A;  2UWQ A;  2N9P C;  4XZ4 A;  3TIX A;  4I6L B;  2O6V A;  2DZM A;  3K9O B;  1WJ6 A;  3A9J A;  4FHJ A;  3JVZ X;  3RUL A;  1WRD B;  3BY4 B;  3V60 A;  3V6C B;  2KHW B;  3SHQ A;  1V5T A;  4W9E A;  4EOY A;  4LJO B;  3NZU A;  2ASQ A;  2M17 A;  4BVU C;  3T9L A;  4GMV A;  3QIJ A;  3MHS D;  4KSL C;  3SDL C;  1V80 A;  2KMA A;  2D07 B;  2CHZ A;  2KMC A;  1UD7 A;  2LI5 A;  3QAR A;  4P7I A;  1H4R A;  3IVF A;  5CTR C;  3T8M A;  4ZDV A;  2KVR A;  5GMV A;  5EDS A;  4M8N A;  3OLM D;  1WXV A;  4WAA A;  3ZNI D;  2MP2 B;  2WX0 A;  3IBE A;  5IAA C;  2EMS A;  3DBL I;  3WAO A;  1GNU A;  1GC6 A;  2LXC A;  3ZVV A;  2D3G A;  4W9G A;  2KWV B;  4W9J A;  4GOC A;  4CYE A;  4F8C B;  1V81 A;  2J0K A;  2MX2 A;  4F7Z A;  1Q1O A;  3KVF B;  3GZN I;  1WJN A;  2ZNV C;  2N9X A;  1OEY A;  3PLU A;  2KC1 A;  4DWF A;  2AWT A;  5DCN A;  3ZUN A;  1WGD A;  4DHZ E;  2KDE B;  4II2 B;  3K9P B;  3H7P A;  3M62 B;  3DDC B;  2KZR A;  3QHT A;  5CHF A;  1WR6 E;  3DQV A;  2JWZ A;  3JYU A;  4GIV A;  4IC7 B;  2NR2 A;  2M8S A;  1R4N I;  4GB9 A;  3VDZ A;  4K81 A;  3ENE A;  1J8C A;  4PYZ A;  4W9D A;  2KTR A;  2KJR A;  3ZNG C;  1TZ1 A;  2IY0 B;  2IO0 B;  3PPA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...