2LUEA

Lc3b optn-lir ptot complex structure
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
119
structure length
119
Chain Sequence
b'GAMGKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Microtubule-associated proteins 1A/1B light chain 3B
publication title Structural basis for phosphorylation-triggered autophagic clearance of Salmonella.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 25
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2012-06-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2lueA00
1SE9A 5JZEB 3B1LX 2AEHA 2KDIA 2K39A 1TBEA 2W9NA 4DK5A 1QZEA 4FJZA 2JRHA 2LUEA 2K6DB 2ZNVC 4W9KA 5D6JB 4BKSD 1EO6A 2LVQA 5D7GA 2LVOA 4G11A 3AXCA 2KC2A 3V61A 3CSTA 3PT2B 1Q1OA 2AYOB 3ZNGC 2MQJA 4GSWA 1P0RA 3RT3B 2QHOA 2UWQA 4TQ0A 3X23A 4LDTD 1WGDA 2YVCA 3GZNI 2KDBA 4WJQA 4GN1A 4CYEA 3EECA 2LGYA 3GOEA 4MH0E 5LLIA 1YIWA 4EZKA 2GBKA 1EUVB 3PVLA 2ZCCA 1GUAB 1WI0A 4MM3A 3CMMB 3PRZA 5CX3A 4GIVA 2MW5A 4W9EA 1WH3A 2O6VA 2DAFA 2KHWB 2KLGA 2OJRA 4HDQA 3JSVA 2NCNA 1CMXB 1WM3A 3P2BA 4FA6A 3UF8A 1WRDB 4IC7B 2O2VA 2NS5A 3APDA 3DVNU 4FHKA 3ZRFA 2K6QA 5E6NA 4KIKA 3WALA 4KV2A 3VTVA 2CHWA 3VQIA 4DBGA 1OEYA 3U30A 2WDTB 4DWFA 1UBQA 3PTFC 2XEWA 1J0GA 1IP9A 1WGRA 1UELA 2DYBA 3M3JA 3IBEA 1TZ1A 1KM7A 1WXAA 2KWCA 4HJKA 2GMIC 4IM0A 3VUXA 4II3B 1RFAA 3ALBA 3VDZA 1I35A 2BYEA 4M0WB 3R66C 4MSMB 2JY6A 1E7VA 1ZGUB 1WE6A 4CHKA 1YQBA 2PE9A 4DHZB 2MX2A 4E74A 4IWOA 2KANA 4K7SA 2XK5B 1WX9A 1OQYA 2BPSA 2KWUB 5CHWA 2CHZA 2C7NB 3ML9A 3R7RA 3DBSA 4FN2A 2MP2B 3HM6X 1LQBA 2D2QA 3IFWB 4EZLA 3APFA 1OEYJ 5G2NA 2DHZA 4MELA 2O6VD 1Q5WB 2KMCA 3RUIB 1WGHA 2LVPA 2N1WA 3L10B 3T8MA 4BOZB 1OTRB 4MGZE 4XX5A 3TMPB 5IAAC 1ZKHA 3OLMD 1XQQA 3O65B 4P7IA 3A9JA 4E3CA 1WGYA 1WMHB 3DVGY 3DOWA 4EUTA 3EC8A 3TL5A 1GJZA 2M4NA 2N7DA 4EFOA 1WX8A 1WR1A 4IM2A 3ENEA 1E7UA 4GMVA 3W1SC 2LASA 4K7WA 3KYDD 4WQOB 3VTUA 2L3ZA 1IYFA 1I42A 5TR5A 2JUOA 4IUMB 3IHPC 1IPGA 4N9F4 5DPWA 2V4LA 1E5WA 1LXDA 3ZTCA 2KJRA 1AARA 2ZNVB 2C7HA 2FCQA 2KJ6A 2FCSA 4ANUA 2N9PC 4RM9A 1WJ4A 1Y8RC 1H8CA 2M8SA 4URKA 4ZRJA 3L54A 1YX6B 1UGMA 4W9GA 4HXDA 2MRPA 1C1YB 3ONSA 5AEKB 4F1SA 1UH6A 2LGXA 4W9LA 3NHEB 1WZ0A 2KLCA 2A4ZA 3DBRI 4IG7B 4NAWB 3B0AA 4WJOA 1TTNA 3WANA 4BKTA 3RZFA 1EF5A 2R2QA 1WE7A 5HKHA 3VXWA 3QAQA 3X0WA 2G3QB 2M0XA 1E8ZA 2KVRA 2G4SA 3N3KB 3PV1A 3QIJA 2L8JA 2NR2A 3CF6E 2FIFA 4MGYE 4PYZA 3PLUA 3VVWB 2CS4A 2KX0A 1NI2A 1E8WA 2KTRB 4GDKB 3JVZX 1E8YA 2JZZA 3EFUA 3B08A 1WJUA 1U4AA 3K9PB 2PEAA 3EHVA 3H9DA 2J0JA 2MP2A 4IM3A 2XBBC 3PGEA 1J19A 5KHOA 1MG8A 2LRWA 4BBNF 2WX1A 5E6PA 2C9WB 2WWZA 4FHJA 2RSUA 1E90A 3HK0A 4NJ6A 1SIFA 3JYUA 3DPDA 3ZVVA 2NVUI 2K8BA 1F9JA 1WMHA 2L0FA 4PS7A 3PZDA 2ZVOA 5E6OA 3ZKJC 4GGQA 2KQ7A 2BKRB 4A3PA 2LJ5A 4M8MA 3UGBB 2BGFA 2IO1B 2EKEC 4DHJD 5KHQA 1UZXB 1XD3B 1V80A 3UIPB 4ZDVA 1JRUA 2FCNA 3PS6A 4G50A 1Z2MA 3WIMA 2LD9A 3OJ4B 3QC8B 4IWPA 3ZDTA 3K9OB 4XC2A 4RMAA 2GOWA 3KH0A 3KUDB 4LJPB 4XZ4A 2D11A 3N30A 3PSEB 2Y5BB 2NPTB 2BWES 2CHXA 3W1YA 2GBJA 3SU8X 4MSQB 3PPAA 3VUYA 4ZRKA 3RCZA 4AUQC 2KFKA 4WJNA 3V60A 2LI5A 4YL8A 3T9LA 1WGGA 2N9EB 4DHZE 4WWNA 4HPMB 1A5RA 3AU5A 1GNUA 4NAWA 4AJWA 5DPSA 4ANXA 3L17A 2KKCA 1GC7A 3TJPA 2KMAA 2KN5A 2NBWB 4MGKE 3CSFA 3H7PB 4GDLB 3VAWA 1TGZB 2J0KA 4W9DA 5FR6A 4MJSA 2EMTA 2N7EA 3A9KB 4GDKA 2K8CA 3TIXA 2LGDA 1OGWA 2LZ6A 2VRRB 3VTWA 1BT0A 5LXHA 2KDEB 4FJYA 2JF5A 5D94A 3QARA 3L13A 4ASWC 2CKHB 1WIAA 2C5LC 4HPLB 2KDFB 4HK2A 3UQBA 4WWOA 3ZNZB 4DDGD 4OVUA 4KDIC 3V6EB 4M8NA 1ISNA 4LDTB 1V5TA 2B3AA 2ZPYA 3TBLD 2KJHB 3DDCB 4ANVA 2C7MB 4MDKE 5J18A 5J2RA 2BKFA 2WYQA 2M1MA 2FAZA 4ZRIA 2LXCA 3DVNV 4WAAA 2KNBA 2FCMA 2AWTA 2MBBB 3M62B 4JL9A 3KUCB 1HE8A 2MBHA 3A1QB 3KW5B 2JXXA 2FIDA 2KXJA 2AL3A 2KO3A 3BINA 4EEWA 1FXTB 2RPQA 4DDID 2KQSA 4KZCA 4BOSC 4W9IA 3ZUNA 1R4MI 3AI5A 2G45B 5AZHA 1H4RA 4BBNC 4DXAB 4EKUA 2K1FA 4NNJB 2RR9A 2Z0DB 5DPRA 5J17A 2DYMA 5AZGA 5BO4B 4IWQA 4GU2A 3VUWA 5CTRC 3ECIA 3PRMB 1WM2A 4W9JA 4TQ1A 1V5OA 1S3SG 2MWSB 3Q3FA 2PJHA 3AULA 4W9FA 3ZW3A 5DCNA 4BFRA 4HCNB 3WA0A 3RYTA 1PQSA 4G3XB 2N4FA 2KD0A 2KWVB 3QJZA 4RM8A 2ZPNA 1UBIA 1L7YA 2IY0B 1LM8B 2L05A 2ZJDA 4GDLA 1KOTA 4AP4C 4EZJA 1WZ3A 2GBMA 2BWFA 3A9KA 4J6IA 2HE7A 3KVFB 4PYUA 2O6VB 1M94A 1T0YA 1RRBA 2ASQA 4HCPB 3IVFA 1X1MA 2KTFA 2YLMA 4I6NB 2V3SA 4BKSA 4JGHB 2DZMA 3QA8A 3ZNID 2I1JA 1WR6E 2XK5A 2I1KA 2O2VB 2ZVNA 3HHMA 2CU1A 2JZ3B 1NDDA 5CHFA 5D2MB 2N1VA 2JPHA 4K81A 1V86A 1K8RB 4K7UA 3H7SA 3ZLZA 2LRUA 3ZNHB 2KX3A 2DZKA 2FUHB 2K8HA 2L0TA 4FADA 2IO0B 4HDOA 3H1UA 3SDLC 2HJ8A 3I3TB 3HIZA 3D32A 3R3MA 1LFDA 4TKNA 4PS3A 2L7RA 4KSLC 3QWZB 4F7ZA 3WAOA 2MLBA 4F8CB 4B6WA 3QX1A 2RGFA 4TUUA 2BF8B 4LCDE 4A3OA 3KYCD 3QQ8B 4W9HA 1WF9A 2D07B 2EMSA 2GBNA 2JVCA 2WX0A 3APCA 4I6LB 1VD2A 3NS8A 4KDLB 4FULA 1V9JA 4G0NB 3V6CB 4A20A 5L83A 1D3ZA 3A9JB 1L2NA 4B95A 4KSKC 3A4SC 4HVBA 5C1ZA 2DAJA 4LJOB 3NZUA 1SGHA 1YX5B 1P98A 2JT4B 4AWJA 1WJNA 1WY8A 3LDZE 1P1AA 3L16A 4FJVB 4NY0A 1YJ1A 1C3TA 2BYVE 4IW0A 5G55A 4K1RB 3NY5A 3MTNB 3A33B 2DZIA 1NBFC 2D10A 2LWPA 3M63B 2KTRA 2MBEA 4WWPA 2PPHA 2KFJA 1WX7A 3UINB 2KK8A 1P3QU 4BKGA 4II2B 3QK0A 2CR5A 1XT9B 2MBQA 4JLCA 3BY4B 4B9KA 5IA7A 2IY1B 2KOXA 3DQVA 1WXVA 1RLFA 2J0MA 1R4NI 2AL6A 3SHQA 4DHJB 4ICUA 4CO7A 2ZEQA 2JWZA 2Z0EB 4GOCA 3UIOB 3V62A 3L0WB 2Z59B 3NOBA 2IO2B 4ICVA 1GC6A 2IYDB 4GB9A 2UYZB 4NQKE 2HTHA 4ANWA 4FLHA 3JW0X 3PLVA 4NQLB 2DENB 2IO3B 2R2OA 1S1QB 3OJ3A 4GXBA 4EOYA 3PRPB 1Z5SB 3ZTDA 2RD0A 3NZSA 2G4DB 3OAWA 2DZJA 4AJYB 1WXMA 1RAXA 4AOFA 4HLEA 2M17A 5GMVA 3M95A 3PHXB 4W9CA 1V2YA 1Q0WB 2NPTA 3PHWB 3ZDMC 1WXSA 1ZW7A 2NBVB 3U8ZA 3QCAA 3RZWC 3U7DA 1KJTA 3ML8A 2C60A 4E71A 4HWIB 4KVGB 2IZVB 1UD7A 3W1SA 2ZCBA 3VHTC 1WFYA 3MHSD 3RULA 5JH5C 3PREA 2BYFA 2A5UA 2LXAA 5C23A 3ZIMA 3C0RB 1GG3A 3H7PA 2MSED 1V49A 3VH4B 2GBRA 5LXIB 1EF1A 1P9DU 2N9XA 4NJ7A 2NBUA 3WAPA 5JHAA 3UQAA 1G6JA 5EDSA 1V81A 4X57B 3A4RA 1VCBA 3H6NA 3JSVB 4WJPA 2JRIB 3DBLI 3TCAA 5DPTA 3DCGA 1E8XA 2DX5B 4JQWC 2D3GA 2KZRA 2ZZPB 1YD8U 2IBIB 5CHVC 2KFKB 4OVVA 2J7QB 4KIKB 2K25A 3MJWA 3ZRCA 3Q3JA 3SD5A 1V6EA 4ZYNA 2MA9B 5JHBA 4NPNA 3S2AA 1J8CA 4TV3A 3KUZA 2MCNB 3HM3A 4BVUC 4FBJB 3L08A 4I6PA 4MGIE 2V1YA 3ZO5B 5AZFA 3N32A 3DBHI 3WAMA 3R7QA 4PS8A 2PE6B 2L76A 4MJSB 2OOBB 1KLVA 2L00B 3A1QA 3IG3A 2MBOA 4MEMA 2REXA 4KZ0A 3VFKA 3VH3B 1WYWB 2FNJB 3RD2A 4JIOU 5L95C 2DYOA 3AU4A 3DVGX 1WJ6A 3LJ3A 2KC1A 3QHTA 2HD5B
chains in the Genus database with same CATH superfamily
1SE9A 2KDIA 2K39A 2XN9C 4DK5A 2K6DB 2PVOD 3AXCA 4OZBA 3ZNGC 2MQJA 4GSWA 1P0RA 3RT3B 3X23A 4NJCA 4EE2A 4YSXB 3TEZA 3GZNI 2J42A 4CYEA 2LGYA 3PVLA 2ZCCA 3PRZA 5CX3A 2QDFA 4HDQA 3DHGC 3AE6B 5BYSA 2BB5A 1WRDB 3BK1A 4FHKA 3APDA 3ZRFA 2K6QA 3WALA 1XXGA 1R4NB 3VTVA 2CHWA 4USAA 1OEYA 3U30A 1UBQA 5JXVA 1J0GA 1UELA 4RGOS 4IM0A 4II3B 4ZHOA 1DOIA 2QCZA 1YQBA 2PE9A 1EU3A 1VJKA 2BPSA 2CHZA 2NTSA 2C7NB 3ML9A 4FN2A 3HM6X 4MELA 2N1WA 1OTRB 4MGZE 1E7PB 5IAAC 4C56C 4XWWA 2D3BA 1WMHB 3DOWA 4EUTA 2H88B 4ZRPA 3TL5A 2N7DA 1WX8A 2BT6A 1WR1A 3ENEA 4ZYSA 1YNTE 2KN4A 2LASA 4K7WA 2INCC 3VTUA 2L3ZA 1IYFA 2WU5B 2WXGA 4JWUC 2V4LA 1CK1A 1ZDVA 1GOZA 4J3OD 1AARA 3N20C 3BYYB 1E9MA 3T3NA 3ABVB 2FCSA 4ANUA 2JYEA 1WJ4A 1Y8RC 3ZYYX 4URKA 1YMHE 3L54A 4ACFA 1SJHD 2WHIA 2IJ0A 4RH6A 3IAS1 4NAWB 3TEXA 1MFWA 3RZFA 5HKHA 2JXTA 3VXWA 2DLBA 2M0XA 3QIJA 2KVRA 2G4SA 3KLSX 2NR2A 2FIFA 3VVWB 2KX0A 1NI2A 4RCOA 2CU3A 2JZZA 1SIJA 2DWQA 2JWUA 1T0SC 2MP2A 5KHOA 2WX1A 1ESFA 1XLPA 4FHJA 2RSUA 3JYUA 3ZVVA 2K8BA 4HPPA 1FD6A 2L0FA 5E6OA 2I2YA 5FR3A 2K5PA 4A3PA 2BKRB 4XDDA 2BGFA 4M00A 5KHQA 3UIPB 1V1PA 4G50A 4B0EA 2LD9A 3OJ4B 3ZDTA 3K9OB 2HDEA 3RI7C 5HHDG 4XZ4A 3N30A 2M0AA 2Y5BB 2GBJA 1ZDXA 3DHIC 1JRPA 1DOYA 2LI5A 5FK9C 1A5RA 4TSSA 1GNUA 1NYQA 1KFYB 2EMTA 4GDKA 4KGTA 3TIXA 1R7SA 2LZ6A 3VTWA 3N9YC 4FJYA 2JF5A 2GI9A 3L13A 1WIAA 1FM0D 3Q8CA 2KDFB 4O1NA 1HTQA 4DDGD 2K3UA 1WWTA 3V6EB 4M8NA 1ISNA 1JWUD 2VZKD 1V5TA 2B3AA 3AEFB 3N1ZC 2KJHB 4ZRIA 2LXCA 4A6QA 2MBBB 2INPE 1D6EC 3KW5B 2FIDA 2KO3A 3EFCA 1I4HA 3W5UB 1XF5L 4MH8A 1H4RA 4EKUA 2GB1A 2DYMA 3GE8C 4GU2A 3SFDB 1FFUA 1N61A 3Q3FA 1S3SG 4BAXA 1FIQA 1VZ7A 2N4FA 1EU4A 2ZPNA 1UBIA 2ZJDA 2IY0B 1SEBD 1BUIC 3RFZB 2BBCA 2BWFA 4J6IA 2HE7A 5D3DA 2ONQA 3KVFB 4PYUA 2IGGA 1RRBA 1TZOA 1AYFA 1X1MA 2KTFA 2V3SA 4BKSA 4JGHB 1MVKA 1OQRA 4TMAB 1BMLC 4K7UA 3H7SA 2YEPF 1RFKA 2DZKA 1FPYA 3H1UA 3HIZA 1GB4A 2BB6A 1HA5A 4WAFA 2L7RA 4RF1A 2CJNA 4B6WA 4A3OA 1KTKA 5BYRA 4W9HA 1PFDA 3I5JC 2D07B 5L83A 3NS8A 1D3ZA 4ZHPA 3A9JB 1L2NA 3B2GA 3A4SC 2XNAC 2DAJA 2Y5PA 3ZXVA 1SGHA 1YX5B 1RM6C 3AE4B 5IKCM 1QOAA 4FJVB 3MFGA 1YJ1A 4K1RB 3NY5A 2NMQA 2TSSA 3MTNB 2INNE 1NBFC 3AE1B 2KFJA 3UINB 2KK8A 4B9KA 2MBQA 4JLCA 2KOXA 2SAKA 2J0MA 3SHQA 1L0VB 4ICUA 1V8CA 4OZCA 3V62A 3NOBA 2Z59B 3Q14C 5IOIA 4NQLB 4GXBA 2VH2A 1NEKB 3ZTDA 2RD0A 2G4DB 3C19A 4HLEA 5GMVA 1JWMD 3PHXB 3AE8B 1V2YA 2NPTA 1IBXB 1B9RA 5H92C 2WXPA 4MT5A 3U7DA 3RZWC 1E10A 3ML8A 1CZPA 3VHTC 1YN3A 3MHSD 1YN5A 5JH5C 1KH0A 3ZIMA 1TS3A 3C0RB 1I4XA 2KDMA 3VH4B 1G6JA 2N9XA 3WAPA 2AQ3B 3H6NA 3I57A 4WJPA 3TCAA 3DCGA 2ZW1A 4JQWC 2ZZPB 1YD8U 5CHVC 2KFKB 1IGCA 3W2DA 1V6EA 2MA9B 4NPNA 2QMTA 3S2AA 3L08A 2JX5A 4DXGA 5AZFA 2VH1A 3WAMA 2MJEA 4MJSB 1FO4A 1WSPA 3VH3B 1C76A 2DYOA 4RGMA 3RNGC 2KC1A 2HD5B 4YSYB 5JZEB 3B1LX 5E6JA 1TBEA 1KLGD 2LUEA 2NTTA 3AECB 2LVOA 2WDVB 4TQ0A 2UWQA 2LJIA 1TIFA 3Q6BA 4GN1A 3EECA 1NI3A 4EZKA 1EUVB 1PDXA 1J7BA 4GIVA 1WH3A 1FMAD 3JSVA 2NCNA 1CMXB 3P2BA 2BVCA 2OHFA 1Q10A 2NS5A 1AW7A 3SR6A 4D2KA 3HRDD 2WQYB 4DBGA 2IPKD 4DWFA 2WDTB 1WGRA 3MC8A 4HJKA 3M3JA 1I7HA 3TEYA 4M0WB 1ZP0B 4MSMB 4XWTA 1E7VA 5IO9A 1WE6A 4Q2JA 4IWOA 2XK5B 4ZOHC 1WX9A 5CHWA 4IOIE 3OWEB 1LQBA 2D2QA 3MC0B 3APFA 4UDUC 2DHZA 3RUIB 3T8MA 1ZKHA 4P7IA 3EGRA 4A9AA 3LXFA 2V3PA 1SE2A 1GJZA 2M4NA 2W3SA 2WGSA 1L4DB 3ZXRA 4XGAB 3W1SC 2ZW0A 2JUOA 2UU7A 3C8YA 1IPGA 5DPWA 1LXDA 2W3RA 2BW2A 2KJRA 3U4EG 3VRBB 1MHXA 2C7HA 1XLOA 3Q3MC 3DBLB 3DWGC 1H8CA 4WQMA 3H8HA 1N60A 4NAMA 4P1CC 4W9LA 1WZ0A 2KLCA 3DBHB 1EF5A 2R2QA 1MHHE 1WE7A 1DYQA 3QAQA 2G3QB 5BMGA 3PV1A 2L8JA 2KTRB 3Q3OC 3JVZX 3EFUA 1WJUA 3K9PB 3H9DA 2J0JA 2XBBC 3PGEA 1MG8A 4KGRA 2WWZA 3RNBC 4NJ6A 1SIFA 2OJWA 1WMHA 3IXSA 3ZKJC 4M8MA 1XCQL 2KWDA 4NZLB 2EKEC 2LHEA 1V80A 5MPOA 4ZDVA 1JRUA 2FCNA 3PS6A 1SXTA 3QC8B 2ON8A 4C80A 4RMAA 2D11A 5HI1A 2YEPB 4ZRKA 3BVGA 4WJNA 3V60A 3T9LA 2N9EB 4NAWA 3FC4A 5DPSA 4ANXA 2NBWB 3H7PB 1TGZB 4W9DA 5G5GA 1F77A 1N6ZA 3AN1A 2LGDA 4L1BA 3DHHC 2VRRB 3QARA 4ASWC 2CKHB 1ZE3D 1AWDA 4HPLB 4P6VF 3RNCC 3ZNZB 1J7AA 4KDIC 3AM9A 1VZ8A 4LNNA 3KWVA 1P7EA 3DDCB 5J18A 1ENFA 1VLBA 1BXTA 3DVNV 4WAAA 1DGJA 4M01A 3M62B 1SF0A 2MBHA 1WRIA 2KXJA 2AL3A 2QEJC 2RPQA 2L1AA 3UI3A 4BOSC 3KQ4A 1R4MI 1L5PA 3DWMA 5AZHA 2FBWB 3P4RB 4DXAB 4A90A 2K1FA 2HJ1A 4YXDB 1N5XA 5J17A 2J52A 1TY0A 5BO4B 2SEBD 4IWQA 3VUWA 5CTRC 1WM2A 3GP7A 3WCQA 1V5OA 2MWSB 5DCNA 1I4GA 3WA0A 1T6BX 1PQSA 3DBRB 3NG0A 2KD0A 2KWVB 4RM8A 1JCKB 3NRZA 3OG5A 5HFYA 1LO5D 3RN9C 2GBMA 3R2IA 2MHJA 1M94A 4L2YA 4AQ7A 4HCPB 2YLMA 2PLPA 1WR6E 2I1KA 5LNK1 2CU1A 2JZ3B 5D2MB 3NVZA 4K81A 1I4PA 5C2TB 1Y56A 3URYA 1SBBB 2FUHB 2K8HA 4FADA 2IO0B 2WU2B 1HEZE 3SDLC 3B2FA 3D32A 4TKNA 4KSLC 1ZUD2 3GS2A 2RGFA 4LCDE 1WF9A 4I6LB 4KDLB 5EE1A 4R3DA 4A20A 1UWMA 1HQRD 4LLGM 1WJNA 2V9HA 1WY8A 3NS1A 1P1AA 2N9KA 1T3QA 2DZIA 2D10A 3M63B 2MEKA 1WX7A 1P3QU 1KRHA 3N1YC 4II2B 2QILA 3BY4B 2IY1B 3IAM1 3DQVA 1R4NI 2AL6A 4H2AA 4JPSA 2JWZA 4GOCA 2OEDA 3Q8AA 3L0WB 2IO2B 4ICVA 4GB9A 4BZAA 3AMZA 2DENB 2R2OA 4S17A 3OJ3A 1WYGA 1TY2A 4KKJA 3PRPB 3OAWA 4YTPB 4AJYB 1SSNA 2L32A 3BVMA 3M95A 1XEEA 1Q0WB 1WXSA 1ZW7A 2LEKA 1ACCA 2NBVB 3QCAA 1KJTA 3FAHA 2C60A 2IZVB 1UD7A 3AEBB 3EUB2 1TS2A 1T5XD 4QAYA 2MJ3A 1FFVA 3MC9A 1MJDA 2GLSA 2MSED 1V49A 4C7ZA 3PO0A 4NJ7A 4B0MA 2WDRB 1RWSA 1V81A 4X57B 2M19A 1CQVA 1VCBA 3E9SA 5DPTA 2KZRA 5I4DA 1RYJA 4KIKB 3VR8B 3ZRCA 3Q3JA 4C00A 5JHBA 1PGBA 4WIPA 1J8CA 3KUZA 4FBJB 4BVUC 3AB5A 2V1YA 3ZO5B 1M4VA 3N32A 3I63C 4PS8A 2PE6B 3A1QA 4RGTA 4RNAA 2BQQA 2WNMA 4K3CA 2PTLA 1JMLA 2AQ2B 2AEHA 2JQRB 2X8XX 1IBXA 2N7JA 1QZEA 2JRHA 2LVQA 4G11A 3V61A 2DNFA 2KC2A 3PT2B 1TJEA 1CJEA 1HTOA 2QHOA 3BVZA 2Y3AA 4LDTD 2JZPA 2YVCA 4WJQA 2KDBA 3AH7A 1UUPA 1YIWA 2GBKA 2CJOA 1GUAB 1WI0A 4MM3A 3CMMB 2MW5A 4W9EA 2O6VA 2N9LA 2DAFA 2KHWB 4FA6A 5HG2A 4IDIA 2WXQA 4IC7B 2O2VA 3DVNU 4KV2A 3VQIA 1FRRA 3PTFC 2XEWA 2DYBA 1UF0A 1TZ1A 3VUXA 2KWCA 2GMIC 3BIID 1C77A 2KT7A 1QKZA 3R66C 4XYCA 2JY6A 1TS5A 3AE9B 1QLBB 4K7SA 2KWUB 1OQYA 1K53A 3R7RA 3DBSA 1GPXA 5G2NA 2E3TA 1Q5WB 2QSDA 2LVPA 3L10B 2PKOA 1HZ6A 4BOZB 3TMPB 2KAJA 3OLMD 1XQQA 3O65B 2L83A 3U2SC 2IDYA 3EC8A 3W5VB 2N0SB 5D3IB 4A8XC 1AN8A 1E7UA 3FKYA 1I42A 1YJIA 3KYDD 5TR5A 3Q8BA 1GB1A 4IUMB 3IHPC 2WXIA 1E5WA 4MACA 1YN4A 2ZNVB 3AEDB 2FCQA 1N5WA 5BYQA 2WXJA 4RM9A 4PT5A 1B1ZA 4P1BC 2M8SA 2AX5A 4ZRJA 2WXRA 2BYTA 4W9GA 4HXDA 2MRPA 3ONSA 5AEKB 4F1SA 1UH6A 3NVVA 5EE3A 3NHEB 1I4QA 4ITKA 2A4ZA 1D5MC 4IG7B 3B0AA 3WANA 4BKTA 2QIEB 4GGQA 1E8ZA 3CF6E 1QF6A 4C4VA 4MGYE 3CIRB 2RDGA 1C4CA 2PEAA 3EHVA 1C79A 4IM3A 3GE3C 1EM7A 1J19A 2K0PA 4BBNF 5E6PA 2C9WB 1E90A 3PZDA 2BS4B 2KQ7A 2LJ5A 4DHJD 2J53A 4KGSA 4K3BA 1PGXA 1Z2MA 3WIMA 4LNIA 3CWIA 4XC2A 2GOWA 3KH0A 4LJPB 3PSEB 2IGDA 2NPTB 3SEBA 1D5XC 1VR9A 3W1YA 3SU8X 1WGKA 2FE8A 4ZRQA 4OZAA 3VUYA 2LHDA 3ZJTA 4N58A 4DHZE 3KWLA 4WWNA 1K52A 1UWXA 4AJWA 1ET9A 3HVZA 2J4XA 3L17A 2KKCA 1N63A 1GC7A 3TJPA 2KN5A 1L0YB 4MGKE 4OW0A 4GDLB 3VAWA 5FR6A 3SFEB 2N7EA 2IGHA 3A9KB 2K8CA 5LXHA 1BT0A 2KDEB 5D94A 1P7FA 2PVGC 4HK2A 4WWOA 1ZXHA 4OVUA 3RNFC 4LDTB 4JWSC 1FRDA 3TBLD 5J2RA 2C7MB 2M1MA 1D4BA 2FAZA 3AE5B 2AWTA 4OHJA 4JL9A 2JXXA 2BS2B 4ARCA 2KQSA 4KZCA 3ZUNA 1FNVA 1TS4A 3AI5A 3J9CA 3BK2A 4DQOC 1SB3C 4BBNC 3NJTA 1JWAD 4NNJB 5AZGA 3ECIA 5C3JB 4TQ1A 4W9FA 2RPVA 3ZW3A 2PJHA 4HCNB 1FCCC 1K50A 3FILB 3RYTA 4G3XB 2GRIA 1V1OA 2L05A 1LM8B 2MJDA 1KOTA 4AP4C 5IP4D 4FXCA 2ASQA 4I6NB 4M02A 3QA8A 1NYRA 3HHMA 1NDDA 1F52A 5CHFA 2N1VA 2JPHA 3BZDB 2WS3B 2L0TA 2G9HD 4HDOA 3E56A 2D5GA 2R61A 2HJ8A 3NVYA 3R3MA 3AEAB 1LFDA 1TKEA 1PYWD 4F7ZA 3QWZB 3WAOA 4F8CB 2W55A 3QX1A 4TUUA 3RMKC 3KYCD 3QQ8B 2GBNA 2JVCA 2WX0A 3V6CB 1ZXIA 4G0NB 1JALA 4KSKC 3MHZA 4N59A 5C1ZA 4LJOB 1P98A 4L23A 4ARIA 2QJLA 3VR9B 1C3TA 2BYVE 4IW0A 3A33B 1E6EB 3Q8FA 1MG4A 2LWPA 4LNFA 1L4ZB 2PPHA 3T3OA 2D3AA 3QK0A 2CR5A 5IA7A 2RMMA 1WXVA 4YWGG 3PZ8A 4DHJB 5H8YE 4CO7A 1C9FA 2Z0EB 3UIOB 3ZJUA 3I9V1 1GC6A 2IYDB 2BS3B 4PK1A 2HTHA 4ANWA 4FLHA 3JW0X 3PLVA 1F2RC 1D5ZC 1S1QB 1XLQA 2DZJA 1WXMA 4AOFA 2M17A 3P63A 4W9CA 1FNUA 1TYGB 4N6EB 1ZPSA 2H89B 3W1SA 3PREA 3ZJVA 1QILA 2BYFA 2A5UA 4LTUA 4C7YA 2X38A 2JU6X 1C4AA 2GBRA 4LK0M 5LXIB 1P9DU 2L52A 2DBYA 3A4RA 3DBLI 1OQQA 2DX5B 2D3GA 2KQ4X 3ETRA 2IBIB 2J7QB 2K25A 3SD5A 3BWUD 4ZYNA 4TV3A 5FKAC 2MCNB 1YQ4B 4I6PA 1F1HA 3NZ3A 2WXMA 3DBHI 4S0RA 4HJGE 1KLVA 4KZ0A 2FNJB 3RD2A 3L4PA 3AU4A 3DVGX 1WJ6A 4LNOA 4KKIA 2Q5WD 4WWMA 2WXFA 2KVZA 1EWYC 1JQ4A 1IUEA 2W9NA 4XE0A 4FJZA 4P16A 2ZNVC 4W9KA 5D6JB 4BKSD 1EO6A 5D7GA 1HXYD 3CSTA 1Q1OA 2AYOB 4WH4A 1SJED 3P42A 1WGDA 1FCLA 2PMVA 3GOEA 4MH0E 5LLIA 1A70A 2KLGA 2OJRA 1WM3A 2WXHA 2AQ1B 3AV8A 3UF8A 3MJ5A 5E6NA 4KIKA 4LNKA 1IP9A 4BKGA 4DXFA 3IBEA 1KM7A 1WXAA 4YSZB 2KMMA 1RFAA 3ALBA 3VDZA 1I35A 2BYEA 3Q8EA 1ZGUB 4CHKA 2JSVX 1QQRA 4DHZB 2MX2A 4E74A 2KANA 2MP2B 3R2TA 4EZLA 3IFWB 1OEYJ 2O6VD 2KMCA 1WGHA 3Q3NC 2LGIA 4XX5A 5EE9A 3ZQ4A 3A9JA 4E3CA 4YTNB 1WGYA 3DVGY 1K51A 1T0RC 4US8A 1C78A 4EFOA 4IM2A 2EKIA 4GMVA 1V1PB 5TSSA 4WQOB 2WDQB 3IT4B 4HRSA 4N9F4 1T0QC 3LB8C 4XDCA 2D3CA 3ZTCA 1QT9A 2KJ6A 1HZ5A 4WURA 2N9PC 2V0GA 1KF6B 2MH7A 1YX6B 1UGMA 2LGSA 1C1YB 4HKZE 2LGXA 2WXKA 3DBRI 4WJOA 1TTNA 1GAQB 2B76B 5BMHA 3X0WA 3N3KB 1NVID 4PYZA 1XCTL 3PLUA 2CS4A 1TKYA 2RDBC 1E8WA 4GDKB 1E8YA 3B08A 1U4AA 3HUIA 3P4QB 2I38A 2LRWA 3HK0A 3DPDA 1LGRA 2NVUI 2LFIA 1F9JA 4PS7A 2ZVOA 3MP9A 1NENB 3UGBB 2K22A 2IO1B 1MPEA 1YQ3B 3P4SB 1UZXB 1SE4A 1XD3B 3EA6A 5IN7A 1YJJA 4IWPA 2ICIA 3KUDB 2BWES 5T8IA 2CHXA 3IT6B 3P4PB 4MSQB 3PPAA 2QC8A 3RCZA 2PIAA 4AUQC 2KFKA 2E6XA 2ACZB 4YL8A 1WGGA 4HPMB 3AU5A 2KMAA 4US9A 3CSFA 1QOBA 2J0KA 3LYYA 4MJSA 2WXNA 1JWBD 1OGWA 4RFBA 2C5LC 3UQBA 1QOGA 2ZPYA 1PGAA 4ANVA 3VRAB 4MDKE 2BKFA 2WYQA 2G1EA 1ROEA 4JE3B 1JROA 2FCMA 2KNBA 1STEA 3KUCB 1HE8A 3A1QB 4OVZA 1ET6A 4EEWA 3AE2B 1FEHA 3BINA 1FXTB 1JW9D 1VDVA 4DDID 4W9IA 2PW9A 2G45B 3BYTB 2Z8LA 2RR9A 2Z0DB 5DPRA 3PZ7A 3PRMB 4W9JA 5BMIA 3AULA 4BFRA 2K9XA 2WP9B 3QJZA 1JWSD 1L6UA 1L7YA 1XLNA 4GDLA 4EZJA 1WZ3A 3A9KA 4M0WA 4MM3B 2VZKB 5AUKA 1XO3A 2O6VB 1T0YA 3IVFA 1WXQA 2DZMA 3ZNID 2I1JA 3Q69A 1QOFA 2XK5A 2O2VB 2ZVNA 2BTEA 1TT5B 3RNAC 1V86A 1K8RB 1VRAB 3ZLZA 1SE3A 2Y5CA 2LRUA 3ZNHB 2W54A 2KX3A 4KX6B 3W9CB 3I3TB 4AS1A 3NUHB 3TUOA 3GZNB 5G5HA 3HVDA 4PS3A 2MLBA 1UNSA 2KYWA 3U7ZA 1FXIA 1TKGA 1MI0A 2BF8B 2INDC 2EMSA 3APCA 1VD2A 4FULA 1UGJA 1V9JA 1F2RI 4B95A 3GB1A 4HVBA 3FILA 3NZUA 3V3XA 2JT4B 4AWJA 1YOVB 4A55A 3LDZE 4RGNA 3L16A 4NY0A 5G55A 2M56B 2WXOA 3N1XC 1FXAA 4YT0B 2EELA 2KTRA 2MBEA 4WWPA 3RPFC 1L0XB 5GXGB 1XT9B 1RLFA 4CQNA 2ZEQA 2V4IB 4YTMB 1J7CA 2UYZB 4NQKE 4C4VB 2IO3B 2W82A 3RNEC 4EOYA 2HTME 1Z5SB 3AEEB 1IGDA 1R4MB 3NZSA 1RAXA 3PHWB 3ZDMC 2JYTA 1I4RA 1PUTA 4IKGA 1EWCA 1FNWA 1DOXA 3U8ZA 3NVWA 5AUIA 2LMCA 4E71A 4HWIB 4KVGB 1KLUD 1V97A 1VZ6A 2ZCBA 3V05A 1WFYA 3RULA 2WXLA 2LXAA 5C23A 1GG3A 2RDHA 3H7PA 3AEGB 4JX1C 3O13A 2LUMA 2FUG1 1EF1A 4RF0A 3U52E 5JHAA 2NBUA 3UQAA 5EE0A 5EDSA 3AE3B 3B9JA 1OFFA 3AE7B 3JSVB 2KACA 2JRIB 3TEWA 1E8XA 2WLBA 4HROA 4OVVA 3TSSA 3MJWA 1F0ZA 4HKQA 3ZGZA 3P1MA 3HM3A 2V3NA 4MGIE 4REZA 3R7QA 3Q2AC 1E0ZA 4GLSC 3R8BA 2L76A 2OOBB 2L00B 3IG3A 4MEMA 2MBOA 2REXA 1N62A 1C4PA 3VFKA 1WYWB 5L95C 4JIOU 3LJ3A 1L6VA 3QHTA 4HEA1 1ZOYB
chains in the Genus database with same CATH topology
1SE9A 5JZEB 3B1LX 2AEHA 2KDIA 2K39A 1TBEA 2W9NA 4DK5A 1QZEA 4FJZA 2JRHA 2LUEA 2K6DB 2ZNVC 4W9KA 5D6JB 4BKSD 1EO6A 2LVQA 5D7GA 2LVOA 4G11A 3AXCA 2KC2A 3V61A 3CSTA 3PT2B 1Q1OA 2AYOB 3ZNGC 2MQJA 4GSWA 1P0RA 3RT3B 2QHOA 2UWQA 4TQ0A 3X23A 4LDTD 1WGDA 2YVCA 3GZNI 2KDBA 4WJQA 4GN1A 4CYEA 3EECA 2LGYA 3GOEA 4MH0E 5LLIA 1YIWA 4EZKA 2GBKA 1EUVB 3PVLA 2ZCCA 1GUAB 1WI0A 4MM3A 3CMMB 3PRZA 5CX3A 4GIVA 2MW5A 4W9EA 1WH3A 2O6VA 2DAFA 2KHWB 2KLGA 2OJRA 4HDQA 3JSVA 2NCNA 1CMXB 1WM3A 3P2BA 4FA6A 3UF8A 1WRDB 4IC7B 2O2VA 2NS5A 3APDA 3DVNU 4FHKA 3ZRFA 2K6QA 5E6NA 4KIKA 3WALA 4KV2A 3VTVA 2CHWA 3VQIA 4DBGA 1OEYA 3U30A 2WDTB 4DWFA 1UBQA 3PTFC 2XEWA 1J0GA 1IP9A 1WGRA 1UELA 2DYBA 3M3JA 3IBEA 1TZ1A 1KM7A 1WXAA 2KWCA 4HJKA 2GMIC 4IM0A 3VUXA 4II3B 1RFAA 3ALBA 3VDZA 1I35A 2BYEA 4M0WB 3R66C 4MSMB 2JY6A 1E7VA 1ZGUB 1WE6A 4CHKA 1YQBA 2PE9A 4DHZB 2MX2A 4E74A 4IWOA 2KANA 4K7SA 2XK5B 1WX9A 1OQYA 2BPSA 2KWUB 5CHWA 2CHZA 2C7NB 3ML9A 3R7RA 3DBSA 4FN2A 2MP2B 3HM6X 1LQBA 2D2QA 3IFWB 4EZLA 3APFA 1OEYJ 5G2NA 2DHZA 4MELA 2O6VD 1Q5WB 2KMCA 3RUIB 1WGHA 2LVPA 2N1WA 3L10B 3T8MA 4BOZB 1OTRB 4MGZE 4XX5A 3TMPB 5IAAC 1ZKHA 3OLMD 1XQQA 3O65B 4P7IA 3A9JA 4E3CA 1WGYA 1WMHB 3DVGY 3DOWA 4EUTA 3EC8A 3TL5A 1GJZA 2M4NA 2N7DA 4EFOA 1WX8A 1WR1A 4IM2A 3ENEA 1E7UA 4GMVA 3W1SC 2LASA 4K7WA 3KYDD 4WQOB 3VTUA 2L3ZA 1IYFA 1I42A 5TR5A 2JUOA 4IUMB 3IHPC 1IPGA 4N9F4 5DPWA 2V4LA 1E5WA 1LXDA 3ZTCA 2KJRA 1AARA 2ZNVB 2C7HA 2FCQA 2KJ6A 2FCSA 4ANUA 2N9PC 4RM9A 1WJ4A 1Y8RC 1H8CA 2M8SA 4URKA 4ZRJA 3L54A 1YX6B 1UGMA 4W9GA 4HXDA 2MRPA 1C1YB 3ONSA 5AEKB 4F1SA 1UH6A 2LGXA 4W9LA 3NHEB 1WZ0A 2KLCA 2A4ZA 3DBRI 4IG7B 4NAWB 3B0AA 4WJOA 1TTNA 3WANA 4BKTA 3RZFA 1EF5A 2R2QA 1WE7A 5HKHA 3VXWA 3QAQA 3X0WA 2G3QB 2M0XA 1E8ZA 2KVRA 2G4SA 3N3KB 3PV1A 3QIJA 2L8JA 2NR2A 3CF6E 2FIFA 4MGYE 4PYZA 3PLUA 3VVWB 2CS4A 2KX0A 1NI2A 1E8WA 2KTRB 4GDKB 3JVZX 1E8YA 2JZZA 3EFUA 3B08A 1WJUA 1U4AA 3K9PB 2PEAA 3EHVA 3H9DA 2J0JA 2MP2A 4IM3A 2XBBC 3PGEA 1J19A 5KHOA 1MG8A 2LRWA 4BBNF 2WX1A 5E6PA 2C9WB 2WWZA 4FHJA 2RSUA 1E90A 3HK0A 4NJ6A 1SIFA 3JYUA 3DPDA 3ZVVA 2NVUI 2K8BA 1F9JA 1WMHA 2L0FA 4PS7A 3PZDA 2ZVOA 5E6OA 3ZKJC 4GGQA 2KQ7A 2BKRB 4A3PA 2LJ5A 4M8MA 3UGBB 2BGFA 2IO1B 2EKEC 4DHJD 5KHQA 1UZXB 1XD3B 1V80A 3UIPB 4ZDVA 1JRUA 2FCNA 3PS6A 4G50A 1Z2MA 3WIMA 2LD9A 3OJ4B 3QC8B 4IWPA 3ZDTA 3K9OB 4XC2A 4RMAA 2GOWA 3KH0A 3KUDB 4LJPB 4XZ4A 2D11A 3N30A 3PSEB 2Y5BB 2NPTB 2BWES 2CHXA 3W1YA 2GBJA 3SU8X 4MSQB 3PPAA 3VUYA 4ZRKA 3RCZA 4AUQC 2KFKA 4WJNA 3V60A 2LI5A 4YL8A 3T9LA 1WGGA 2N9EB 4DHZE 4WWNA 4HPMB 1A5RA 3AU5A 1GNUA 4NAWA 4AJWA 5DPSA 4ANXA 3L17A 2KKCA 1GC7A 3TJPA 2KMAA 2KN5A 2NBWB 4MGKE 3CSFA 3H7PB 4GDLB 3VAWA 1TGZB 2J0KA 4W9DA 5FR6A 4MJSA 2EMTA 2N7EA 3A9KB 4GDKA 2K8CA 3TIXA 2LGDA 1OGWA 2LZ6A 2VRRB 3VTWA 1BT0A 5LXHA 2KDEB 4FJYA 2JF5A 5D94A 3QARA 3L13A 4ASWC 2CKHB 1WIAA 2C5LC 4HPLB 2KDFB 4HK2A 3UQBA 4WWOA 3ZNZB 4DDGD 4OVUA 4KDIC 3V6EB 4M8NA 1ISNA 4LDTB 1V5TA 2B3AA 2ZPYA 3TBLD 2KJHB 3DDCB 4ANVA 2C7MB 4MDKE 5J18A 5J2RA 2BKFA 2WYQA 2M1MA 2FAZA 4ZRIA 2LXCA 3DVNV 4WAAA 2KNBA 2FCMA 2AWTA 2MBBB 3M62B 4JL9A 3KUCB 1HE8A 2MBHA 3A1QB 3KW5B 2JXXA 2FIDA 2KXJA 2AL3A 2KO3A 3BINA 4EEWA 1FXTB 2RPQA 4DDID 2KQSA 4KZCA 4BOSC 4W9IA 3ZUNA 1R4MI 3AI5A 2G45B 5AZHA 1H4RA 4BBNC 4DXAB 4EKUA 2K1FA 4NNJB 2RR9A 2Z0DB 5DPRA 5J17A 2DYMA 5AZGA 5BO4B 4IWQA 4GU2A 3VUWA 5CTRC 3ECIA 3PRMB 1WM2A 4W9JA 4TQ1A 1V5OA 1S3SG 2MWSB 3Q3FA 2PJHA 3AULA 4W9FA 3ZW3A 5DCNA 4BFRA 4HCNB 3WA0A 3RYTA 1PQSA 4G3XB 2N4FA 2KD0A 2KWVB 3QJZA 4RM8A 2ZPNA 1UBIA 1L7YA 2IY0B 1LM8B 2L05A 2ZJDA 4GDLA 1KOTA 4AP4C 4EZJA 1WZ3A 2GBMA 2BWFA 3A9KA 4J6IA 2HE7A 3KVFB 4PYUA 2O6VB 1M94A 1T0YA 1RRBA 2ASQA 4HCPB 3IVFA 1X1MA 2KTFA 2YLMA 4I6NB 2V3SA 4BKSA 4JGHB 2DZMA 3QA8A 3ZNID 2I1JA 1WR6E 2XK5A 2I1KA 2O2VB 2ZVNA 3HHMA 2CU1A 2JZ3B 1NDDA 5CHFA 5D2MB 2N1VA 2JPHA 4K81A 1V86A 1K8RB 4K7UA 3H7SA 3ZLZA 2LRUA 3ZNHB 2KX3A 2DZKA 2FUHB 2K8HA 2L0TA 4FADA 2IO0B 4HDOA 3H1UA 3SDLC 2HJ8A 3I3TB 3HIZA 3D32A 3R3MA 1LFDA 4TKNA 4PS3A 2L7RA 4KSLC 3QWZB 4F7ZA 3WAOA 2MLBA 4F8CB 4B6WA 3QX1A 2RGFA 4TUUA 2BF8B 4LCDE 4A3OA 3KYCD 3QQ8B 4W9HA 1WF9A 2D07B 2EMSA 2GBNA 2JVCA 2WX0A 3APCA 4I6LB 1VD2A 3NS8A 4KDLB 4FULA 1V9JA 4G0NB 3V6CB 4A20A 5L83A 1D3ZA 3A9JB 1L2NA 4B95A 4KSKC 3A4SC 4HVBA 5C1ZA 2DAJA 4LJOB 3NZUA 1SGHA 1YX5B 1P98A 2JT4B 4AWJA 1WJNA 1WY8A 3LDZE 1P1AA 3L16A 4FJVB 4NY0A 1YJ1A 1C3TA 2BYVE 4IW0A 5G55A 4K1RB 3NY5A 3MTNB 3A33B 2DZIA 1NBFC 2D10A 2LWPA 3M63B 2KTRA 2MBEA 4WWPA 2PPHA 2KFJA 1WX7A 3UINB 2KK8A 1P3QU 4BKGA 4II2B 3QK0A 2CR5A 1XT9B 2MBQA 4JLCA 3BY4B 4B9KA 5IA7A 2IY1B 2KOXA 3DQVA 1WXVA 1RLFA 2J0MA 1R4NI 2AL6A 3SHQA 4DHJB 4ICUA 4CO7A 2ZEQA 2JWZA 2Z0EB 4GOCA 3UIOB 3V62A 3L0WB 2Z59B 3NOBA 2IO2B 4ICVA 1GC6A 2IYDB 4GB9A 2UYZB 4NQKE 2HTHA 4ANWA 4FLHA 3JW0X 3PLVA 4NQLB 2DENB 2IO3B 2R2OA 1S1QB 3OJ3A 4GXBA 4EOYA 3PRPB 1Z5SB 3ZTDA 2RD0A 3NZSA 2G4DB 3OAWA 2DZJA 4AJYB 1WXMA 1RAXA 4AOFA 4HLEA 2M17A 5GMVA 3M95A 3PHXB 4W9CA 1V2YA 1Q0WB 2NPTA 3PHWB 3ZDMC 1WXSA 1ZW7A 2NBVB 3U8ZA 3QCAA 3RZWC 3U7DA 1KJTA 3ML8A 2C60A 4E71A 4HWIB 4KVGB 2IZVB 1UD7A 3W1SA 2ZCBA 3VHTC 1WFYA 3MHSD 3RULA 5JH5C 3PREA 2BYFA 2A5UA 2LXAA 5C23A 3ZIMA 3C0RB 1GG3A 3H7PA 2MSED 1V49A 3VH4B 2GBRA 5LXIB 1EF1A 1P9DU 2N9XA 4NJ7A 2NBUA 3WAPA 5JHAA 3UQAA 1G6JA 5EDSA 1V81A 4X57B 3A4RA 1VCBA 3H6NA 3JSVB 4WJPA 2JRIB 3DBLI 3TCAA 5DPTA 3DCGA 1E8XA 2DX5B 4JQWC 2D3GA 2KZRA 2ZZPB 1YD8U 2IBIB 5CHVC 2KFKB 4OVVA 2J7QB 4KIKB 2K25A 3MJWA 3ZRCA 3Q3JA 3SD5A 1V6EA 4ZYNA 2MA9B 5JHBA 4NPNA 3S2AA 1J8CA 4TV3A 3KUZA 2MCNB 3HM3A 4BVUC 4FBJB 3L08A 4I6PA 4MGIE 2V1YA 3ZO5B 5AZFA 3N32A 3DBHI 3WAMA 3R7QA 4PS8A 2PE6B 2L76A 4MJSB 2OOBB 1KLVA 2L00B 3A1QA 3IG3A 2MBOA 4MEMA 2REXA 4KZ0A 3VFKA 3VH3B 1WYWB 2FNJB 3RD2A 4JIOU 5L95C 2DYOA 3AU4A 3DVGX 1WJ6A 3LJ3A 2KC1A 3QHTA 2HD5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SE9 A;  5JZE B;  3B1L X;  2AEH A;  2KDI A;  2K39 A;  1TBE A;  2W9N A;  4DK5 A;  1QZE A;  4FJZ A;  2JRH A;  2LUE A;  2K6D B;  2ZNV C;  4W9K A;  5D6J B;  4BKS D;  1EO6 A;  2LVQ A;  5D7G A;  2LVO A;  4G11 A;  3AXC A;  2KC2 A;  3V61 A;  3CST A;  3PT2 B;  1Q1O A;  2AYO B;  3ZNG C;  2MQJ A;  4GSW A;  1P0R A;  3RT3 B;  2QHO A;  2UWQ A;  4TQ0 A;  3X23 A;  4LDT D;  1WGD A;  2YVC A;  3GZN I;  2KDB A;  4WJQ A;  4GN1 A;  4CYE A;  3EEC A;  2LGY A;  3GOE A;  4MH0 E;  5LLI A;  1YIW A;  4EZK A;  2GBK A;  1EUV B;  3PVL A;  2ZCC A;  1GUA B;  1WI0 A;  4MM3 A;  3CMM B;  3PRZ A;  5CX3 A;  4GIV A;  2MW5 A;  4W9E A;  1WH3 A;  2O6V A;  2DAF A;  2KHW B;  2KLG A;  2OJR A;  4HDQ A;  3JSV A;  2NCN A;  1CMX B;  1WM3 A;  3P2B A;  4FA6 A;  3UF8 A;  1WRD B;  4IC7 B;  2O2V A;  2NS5 A;  3APD A;  3DVN U;  4FHK A;  3ZRF A;  2K6Q A;  5E6N A;  4KIK A;  3WAL A;  4KV2 A;  3VTV A;  2CHW A;  3VQI A;  4DBG A;  1OEY A;  3U30 A;  2WDT B;  4DWF A;  1UBQ A;  3PTF C;  2XEW A;  1J0G A;  1IP9 A;  1WGR A;  1UEL A;  2DYB A;  3M3J A;  3IBE A;  1TZ1 A;  1KM7 A;  1WXA A;  2KWC A;  4HJK A;  2GMI C;  4IM0 A;  3VUX A;  4II3 B;  1RFA A;  3ALB A;  3VDZ A;  1I35 A;  2BYE A;  4M0W B;  3R66 C;  4MSM B;  2JY6 A;  1E7V A;  1ZGU B;  1WE6 A;  4CHK A;  1YQB A;  2PE9 A;  4DHZ B;  2MX2 A;  4E74 A;  4IWO A;  2KAN A;  4K7S A;  2XK5 B;  1WX9 A;  1OQY A;  2BPS A;  2KWU B;  5CHW A;  2CHZ A;  2C7N B;  3ML9 A;  3R7R A;  3DBS A;  4FN2 A;  2MP2 B;  3HM6 X;  1LQB A;  2D2Q A;  3IFW B;  4EZL A;  3APF A;  1OEY J;  5G2N A;  2DHZ A;  4MEL A;  2O6V D;  1Q5W B;  2KMC A;  3RUI B;  1WGH A;  2LVP A;  2N1W A;  3L10 B;  3T8M A;  4BOZ B;  1OTR B;  4MGZ E;  4XX5 A;  3TMP B;  5IAA C;  1ZKH A;  3OLM D;  1XQQ A;  3O65 B;  4P7I A;  3A9J A;  4E3C A;  1WGY A;  1WMH B;  3DVG Y;  3DOW A;  4EUT A;  3EC8 A;  3TL5 A;  1GJZ A;  2M4N A;  2N7D A;  4EFO A;  1WX8 A;  1WR1 A;  4IM2 A;  3ENE A;  1E7U A;  4GMV A;  3W1S C;  2LAS A;  4K7W A;  3KYD D;  4WQO B;  3VTU A;  2L3Z A;  1IYF A;  1I42 A;  5TR5 A;  2JUO A;  4IUM B;  3IHP C;  1IPG A;  4N9F 4;  5DPW A;  2V4L A;  1E5W A;  1LXD A;  3ZTC A;  2KJR A;  1AAR A;  2ZNV B;  2C7H A;  2FCQ A;  2KJ6 A;  2FCS A;  4ANU A;  2N9P C;  4RM9 A;  1WJ4 A;  1Y8R C;  1H8C A;  2M8S A;  4URK A;  4ZRJ A;  3L54 A;  1YX6 B;  1UGM A;  4W9G A;  4HXD A;  2MRP A;  1C1Y B;  3ONS A;  5AEK B;  4F1S A;  1UH6 A;  2LGX A;  4W9L A;  3NHE B;  1WZ0 A;  2KLC A;  2A4Z A;  3DBR I;  4IG7 B;  4NAW B;  3B0A A;  4WJO A;  1TTN A;  3WAN A;  4BKT A;  3RZF A;  1EF5 A;  2R2Q A;  1WE7 A;  5HKH A;  3VXW A;  3QAQ A;  3X0W A;  2G3Q B;  2M0X A;  1E8Z A;  2KVR A;  2G4S A;  3N3K B;  3PV1 A;  3QIJ A;  2L8J A;  2NR2 A;  3CF6 E;  2FIF A;  4MGY E;  4PYZ A;  3PLU A;  3VVW B;  2CS4 A;  2KX0 A;  1NI2 A;  1E8W A;  2KTR B;  4GDK B;  3JVZ X;  1E8Y A;  2JZZ A;  3EFU A;  3B08 A;  1WJU A;  1U4A A;  3K9P B;  2PEA A;  3EHV A;  3H9D A;  2J0J A;  2MP2 A;  4IM3 A;  2XBB C;  3PGE A;  1J19 A;  5KHO A;  1MG8 A;  2LRW A;  4BBN F;  2WX1 A;  5E6P A;  2C9W B;  2WWZ A;  4FHJ A;  2RSU A;  1E90 A;  3HK0 A;  4NJ6 A;  1SIF A;  3JYU A;  3DPD A;  3ZVV A;  2NVU I;  2K8B A;  1F9J A;  1WMH A;  2L0F A;  4PS7 A;  3PZD A;  2ZVO A;  5E6O A;  3ZKJ C;  4GGQ A;  2KQ7 A;  2BKR B;  4A3P A;  2LJ5 A;  4M8M A;  3UGB B;  2BGF A;  2IO1 B;  2EKE C;  4DHJ D;  5KHQ A;  1UZX B;  1XD3 B;  1V80 A;  3UIP B;  4ZDV A;  1JRU A;  2FCN A;  3PS6 A;  4G50 A;  1Z2M A;  3WIM A;  2LD9 A;  3OJ4 B;  3QC8 B;  4IWP A;  3ZDT A;  3K9O B;  4XC2 A;  4RMA A;  2GOW A;  3KH0 A;  3KUD B;  4LJP B;  4XZ4 A;  2D11 A;  3N30 A;  3PSE B;  2Y5B B;  2NPT B;  2BWE S;  2CHX A;  3W1Y A;  2GBJ A;  3SU8 X;  4MSQ B;  3PPA A;  3VUY A;  4ZRK A;  3RCZ A;  4AUQ C;  2KFK A;  4WJN A;  3V60 A;  2LI5 A;  4YL8 A;  3T9L A;  1WGG A;  2N9E B;  4DHZ E;  4WWN A;  4HPM B;  1A5R A;  3AU5 A;  1GNU A;  4NAW A;  4AJW A;  5DPS A;  4ANX A;  3L17 A;  2KKC A;  1GC7 A;  3TJP A;  2KMA A;  2KN5 A;  2NBW B;  4MGK E;  3CSF A;  3H7P B;  4GDL B;  3VAW A;  1TGZ B;  2J0K A;  4W9D A;  5FR6 A;  4MJS A;  2EMT A;  2N7E A;  3A9K B;  4GDK A;  2K8C A;  3TIX A;  2LGD A;  1OGW A;  2LZ6 A;  2VRR B;  3VTW A;  1BT0 A;  5LXH A;  2KDE B;  4FJY A;  2JF5 A;  5D94 A;  3QAR A;  3L13 A;  4ASW C;  2CKH B;  1WIA A;  2C5L C;  4HPL B;  2KDF B;  4HK2 A;  3UQB A;  4WWO A;  3ZNZ B;  4DDG D;  4OVU A;  4KDI C;  3V6E B;  4M8N A;  1ISN A;  4LDT B;  1V5T A;  2B3A A;  2ZPY A;  3TBL D;  2KJH B;  3DDC B;  4ANV A;  2C7M B;  4MDK E;  5J18 A;  5J2R A;  2BKF A;  2WYQ A;  2M1M A;  2FAZ A;  4ZRI A;  2LXC A;  3DVN V;  4WAA A;  2KNB A;  2FCM A;  2AWT A;  2MBB B;  3M62 B;  4JL9 A;  3KUC B;  1HE8 A;  2MBH A;  3A1Q B;  3KW5 B;  2JXX A;  2FID A;  2KXJ A;  2AL3 A;  2KO3 A;  3BIN A;  4EEW A;  1FXT B;  2RPQ A;  4DDI D;  2KQS A;  4KZC A;  4BOS C;  4W9I A;  3ZUN A;  1R4M I;  3AI5 A;  2G45 B;  5AZH A;  1H4R A;  4BBN C;  4DXA B;  4EKU A;  2K1F A;  4NNJ B;  2RR9 A;  2Z0D B;  5DPR A;  5J17 A;  2DYM A;  5AZG A;  5BO4 B;  4IWQ A;  4GU2 A;  3VUW A;  5CTR C;  3ECI A;  3PRM B;  1WM2 A;  4W9J A;  4TQ1 A;  1V5O A;  1S3S G;  2MWS B;  3Q3F A;  2PJH A;  3AUL A;  4W9F A;  3ZW3 A;  5DCN A;  4BFR A;  4HCN B;  3WA0 A;  3RYT A;  1PQS A;  4G3X B;  2N4F A;  2KD0 A;  2KWV B;  3QJZ A;  4RM8 A;  2ZPN A;  1UBI A;  1L7Y A;  2IY0 B;  1LM8 B;  2L05 A;  2ZJD A;  4GDL A;  1KOT A;  4AP4 C;  4EZJ A;  1WZ3 A;  2GBM A;  2BWF A;  3A9K A;  4J6I A;  2HE7 A;  3KVF B;  4PYU A;  2O6V B;  1M94 A;  1T0Y A;  1RRB A;  2ASQ A;  4HCP B;  3IVF A;  1X1M A;  2KTF A;  2YLM A;  4I6N B;  2V3S A;  4BKS A;  4JGH B;  2DZM A;  3QA8 A;  3ZNI D;  2I1J A;  1WR6 E;  2XK5 A;  2I1K A;  2O2V B;  2ZVN A;  3HHM A;  2CU1 A;  2JZ3 B;  1NDD A;  5CHF A;  5D2M B;  2N1V A;  2JPH A;  4K81 A;  1V86 A;  1K8R B;  4K7U A;  3H7S A;  3ZLZ A;  2LRU A;  3ZNH B;  2KX3 A;  2DZK A;  2FUH B;  2K8H A;  2L0T A;  4FAD A;  2IO0 B;  4HDO A;  3H1U A;  3SDL C;  2HJ8 A;  3I3T B;  3HIZ A;  3D32 A;  3R3M A;  1LFD A;  4TKN A;  4PS3 A;  2L7R A;  4KSL C;  3QWZ B;  4F7Z A;  3WAO A;  2MLB A;  4F8C B;  4B6W A;  3QX1 A;  2RGF A;  4TUU A;  2BF8 B;  4LCD E;  4A3O A;  3KYC D;  3QQ8 B;  4W9H A;  1WF9 A;  2D07 B;  2EMS A;  2GBN A;  2JVC A;  2WX0 A;  3APC A;  4I6L B;  1VD2 A;  3NS8 A;  4KDL B;  4FUL A;  1V9J A;  4G0N B;  3V6C B;  4A20 A;  5L83 A;  1D3Z A;  3A9J B;  1L2N A;  4B95 A;  4KSK C;  3A4S C;  4HVB A;  5C1Z A;  2DAJ A;  4LJO B;  3NZU A;  1SGH A;  1YX5 B;  1P98 A;  2JT4 B;  4AWJ A;  1WJN A;  1WY8 A;  3LDZ E;  1P1A A;  3L16 A;  4FJV B;  4NY0 A;  1YJ1 A;  1C3T A;  2BYV E;  4IW0 A;  5G55 A;  4K1R B;  3NY5 A;  3MTN B;  3A33 B;  2DZI A;  1NBF C;  2D10 A;  2LWP A;  3M63 B;  2KTR A;  2MBE A;  4WWP A;  2PPH A;  2KFJ A;  1WX7 A;  3UIN B;  2KK8 A;  1P3Q U;  4BKG A;  4II2 B;  3QK0 A;  2CR5 A;  1XT9 B;  2MBQ A;  4JLC A;  3BY4 B;  4B9K A;  5IA7 A;  2IY1 B;  2KOX A;  3DQV A;  1WXV A;  1RLF A;  2J0M A;  1R4N I;  2AL6 A;  3SHQ A;  4DHJ B;  4ICU A;  4CO7 A;  2ZEQ A;  2JWZ A;  2Z0E B;  4GOC A;  3UIO B;  3V62 A;  3L0W B;  2Z59 B;  3NOB A;  2IO2 B;  4ICV A;  1GC6 A;  2IYD B;  4GB9 A;  2UYZ B;  4NQK E;  2HTH A;  4ANW A;  4FLH A;  3JW0 X;  3PLV A;  4NQL B;  2DEN B;  2IO3 B;  2R2O A;  1S1Q B;  3OJ3 A;  4GXB A;  4EOY A;  3PRP B;  1Z5S B;  3ZTD A;  2RD0 A;  3NZS A;  2G4D B;  3OAW A;  2DZJ A;  4AJY B;  1WXM A;  1RAX A;  4AOF A;  4HLE A;  2M17 A;  5GMV A;  3M95 A;  3PHX B;  4W9C A;  1V2Y A;  1Q0W B;  2NPT A;  3PHW B;  3ZDM C;  1WXS A;  1ZW7 A;  2NBV B;  3U8Z A;  3QCA A;  3RZW C;  3U7D A;  1KJT A;  3ML8 A;  2C60 A;  4E71 A;  4HWI B;  4KVG B;  2IZV B;  1UD7 A;  3W1S A;  2ZCB A;  3VHT C;  1WFY A;  3MHS D;  3RUL A;  5JH5 C;  3PRE A;  2BYF A;  2A5U A;  2LXA A;  5C23 A;  3ZIM A;  3C0R B;  1GG3 A;  3H7P A;  2MSE D;  1V49 A;  3VH4 B;  2GBR A;  5LXI B;  1EF1 A;  1P9D U;  2N9X A;  4NJ7 A;  2NBU A;  3WAP A;  5JHA A;  3UQA A;  1G6J A;  5EDS A;  1V81 A;  4X57 B;  3A4R A;  1VCB A;  3H6N A;  3JSV B;  4WJP A;  2JRI B;  3DBL I;  3TCA A;  5DPT A;  3DCG A;  1E8X A;  2DX5 B;  4JQW C;  2D3G A;  2KZR A;  2ZZP B;  1YD8 U;  2IBI B;  5CHV C;  2KFK B;  4OVV A;  2J7Q B;  4KIK B;  2K25 A;  3MJW A;  3ZRC A;  3Q3J A;  3SD5 A;  1V6E A;  4ZYN A;  2MA9 B;  5JHB A;  4NPN A;  3S2A A;  1J8C A;  4TV3 A;  3KUZ A;  2MCN B;  3HM3 A;  4BVU C;  4FBJ B;  3L08 A;  4I6P A;  4MGI E;  2V1Y A;  3ZO5 B;  5AZF A;  3N32 A;  3DBH I;  3WAM A;  3R7Q A;  4PS8 A;  2PE6 B;  2L76 A;  4MJS B;  2OOB B;  1KLV A;  2L00 B;  3A1Q A;  3IG3 A;  2MBO A;  4MEM A;  2REX A;  4KZ0 A;  3VFK A;  3VH3 B;  1WYW B;  2FNJ B;  3RD2 A;  4JIO U;  5L95 C;  2DYO A;  3AU4 A;  3DVG X;  1WJ6 A;  3LJ3 A;  2KC1 A;  3QHT A;  2HD5 B; 
#chains in the Genus database with same CATH topology
 1SE9 A;  2KDI A;  2K39 A;  2XN9 C;  4DK5 A;  2K6D B;  2PVO D;  3AXC A;  4OZB A;  3ZNG C;  2MQJ A;  4GSW A;  1P0R A;  3RT3 B;  3X23 A;  4NJC A;  4EE2 A;  4YSX B;  3TEZ A;  3GZN I;  2J42 A;  4CYE A;  2LGY A;  3PVL A;  2ZCC A;  3PRZ A;  5CX3 A;  2QDF A;  4HDQ A;  3DHG C;  3AE6 B;  5BYS A;  2BB5 A;  1WRD B;  3BK1 A;  4FHK A;  3APD A;  3ZRF A;  2K6Q A;  3WAL A;  1XXG A;  1R4N B;  3VTV A;  2CHW A;  4USA A;  1OEY A;  3U30 A;  1UBQ A;  5JXV A;  1J0G A;  1UEL A;  4RGO S;  4IM0 A;  4II3 B;  4ZHO A;  1DOI A;  2QCZ A;  1YQB A;  2PE9 A;  1EU3 A;  1VJK A;  2BPS A;  2CHZ A;  2NTS A;  2C7N B;  3ML9 A;  4FN2 A;  3HM6 X;  4MEL A;  2N1W A;  1OTR B;  4MGZ E;  1E7P B;  5IAA C;  4C56 C;  4XWW A;  2D3B A;  1WMH B;  3DOW A;  4EUT A;  2H88 B;  4ZRP A;  3TL5 A;  2N7D A;  1WX8 A;  2BT6 A;  1WR1 A;  3ENE A;  4ZYS A;  1YNT E;  2KN4 A;  2LAS A;  4K7W A;  2INC C;  3VTU A;  2L3Z A;  1IYF A;  2WU5 B;  2WXG A;  4JWU C;  2V4L A;  1CK1 A;  1ZDV A;  1GOZ A;  4J3O D;  1AAR A;  3N20 C;  3BYY B;  1E9M A;  3T3N A;  3ABV B;  2FCS A;  4ANU A;  2JYE A;  1WJ4 A;  1Y8R C;  3ZYY X;  4URK A;  1YMH E;  3L54 A;  4ACF A;  1SJH D;  2WHI A;  2IJ0 A;  4RH6 A;  3IAS 1;  4NAW B;  3TEX A;  1MFW A;  3RZF A;  5HKH A;  2JXT A;  3VXW A;  2DLB A;  2M0X A;  3QIJ A;  2KVR A;  2G4S A;  3KLS X;  2NR2 A;  2FIF A;  3VVW B;  2KX0 A;  1NI2 A;  4RCO A;  2CU3 A;  2JZZ A;  1SIJ A;  2DWQ A;  2JWU A;  1T0S C;  2MP2 A;  5KHO A;  2WX1 A;  1ESF A;  1XLP A;  4FHJ A;  2RSU A;  3JYU A;  3ZVV A;  2K8B A;  4HPP A;  1FD6 A;  2L0F A;  5E6O A;  2I2Y A;  5FR3 A;  2K5P A;  4A3P A;  2BKR B;  4XDD A;  2BGF A;  4M00 A;  5KHQ A;  3UIP B;  1V1P A;  4G50 A;  4B0E A;  2LD9 A;  3OJ4 B;  3ZDT A;  3K9O B;  2HDE A;  3RI7 C;  5HHD G;  4XZ4 A;  3N30 A;  2M0A A;  2Y5B B;  2GBJ A;  1ZDX A;  3DHI C;  1JRP A;  1DOY A;  2LI5 A;  5FK9 C;  1A5R A;  4TSS A;  1GNU A;  1NYQ A;  1KFY B;  2EMT A;  4GDK A;  4KGT A;  3TIX A;  1R7S A;  2LZ6 A;  3VTW A;  3N9Y C;  4FJY A;  2JF5 A;  2GI9 A;  3L13 A;  1WIA A;  1FM0 D;  3Q8C A;  2KDF B;  4O1N A;  1HTQ A;  4DDG D;  2K3U A;  1WWT A;  3V6E B;  4M8N A;  1ISN A;  1JWU D;  2VZK D;  1V5T A;  2B3A A;  3AEF B;  3N1Z C;  2KJH B;  4ZRI A;  2LXC A;  4A6Q A;  2MBB B;  2INP E;  1D6E C;  3KW5 B;  2FID A;  2KO3 A;  3EFC A;  1I4H A;  3W5U B;  1XF5 L;  4MH8 A;  1H4R A;  4EKU A;  2GB1 A;  2DYM A;  3GE8 C;  4GU2 A;  3SFD B;  1FFU A;  1N61 A;  3Q3F A;  1S3S G;  4BAX A;  1FIQ A;  1VZ7 A;  2N4F A;  1EU4 A;  2ZPN A;  1UBI A;  2ZJD A;  2IY0 B;  1SEB D;  1BUI C;  3RFZ B;  2BBC A;  2BWF A;  4J6I A;  2HE7 A;  5D3D A;  2ONQ A;  3KVF B;  4PYU A;  2IGG A;  1RRB A;  1TZO A;  1AYF A;  1X1M A;  2KTF A;  2V3S A;  4BKS A;  4JGH B;  1MVK A;  1OQR A;  4TMA B;  1BML C;  4K7U A;  3H7S A;  2YEP F;  1RFK A;  2DZK A;  1FPY A;  3H1U A;  3HIZ A;  1GB4 A;  2BB6 A;  1HA5 A;  4WAF A;  2L7R A;  4RF1 A;  2CJN A;  4B6W A;  4A3O A;  1KTK A;  5BYR A;  4W9H A;  1PFD A;  3I5J C;  2D07 B;  5L83 A;  3NS8 A;  1D3Z A;  4ZHP A;  3A9J B;  1L2N A;  3B2G A;  3A4S C;  2XNA C;  2DAJ A;  2Y5P A;  3ZXV A;  1SGH A;  1YX5 B;  1RM6 C;  3AE4 B;  5IKC M;  1QOA A;  4FJV B;  3MFG A;  1YJ1 A;  4K1R B;  3NY5 A;  2NMQ A;  2TSS A;  3MTN B;  2INN E;  1NBF C;  3AE1 B;  2KFJ A;  3UIN B;  2KK8 A;  4B9K A;  2MBQ A;  4JLC A;  2KOX A;  2SAK A;  2J0M A;  3SHQ A;  1L0V B;  4ICU A;  1V8C A;  4OZC A;  3V62 A;  3NOB A;  2Z59 B;  3Q14 C;  5IOI A;  4NQL B;  4GXB A;  2VH2 A;  1NEK B;  3ZTD A;  2RD0 A;  2G4D B;  3C19 A;  4HLE A;  5GMV A;  1JWM D;  3PHX B;  3AE8 B;  1V2Y A;  2NPT A;  1IBX B;  1B9R A;  5H92 C;  2WXP A;  4MT5 A;  3U7D A;  3RZW C;  1E10 A;  3ML8 A;  1CZP A;  3VHT C;  1YN3 A;  3MHS D;  1YN5 A;  5JH5 C;  1KH0 A;  3ZIM A;  1TS3 A;  3C0R B;  1I4X A;  2KDM A;  3VH4 B;  1G6J A;  2N9X A;  3WAP A;  2AQ3 B;  3H6N A;  3I57 A;  4WJP A;  3TCA A;  3DCG A;  2ZW1 A;  4JQW C;  2ZZP B;  1YD8 U;  5CHV C;  2KFK B;  1IGC A;  3W2D A;  1V6E A;  2MA9 B;  4NPN A;  2QMT A;  3S2A A;  3L08 A;  2JX5 A;  4DXG A;  5AZF A;  2VH1 A;  3WAM A;  2MJE A;  4MJS B;  1FO4 A;  1WSP A;  3VH3 B;  1C76 A;  2DYO A;  4RGM A;  3RNG C;  2KC1 A;  2HD5 B;  4YSY B;  5JZE B;  3B1L X;  5E6J A;  1TBE A;  1KLG D;  2LUE A;  2NTT A;  3AEC B;  2LVO A;  2WDV B;  4TQ0 A;  2UWQ A;  2LJI A;  1TIF A;  3Q6B A;  4GN1 A;  3EEC A;  1NI3 A;  4EZK A;  1EUV B;  1PDX A;  1J7B A;  4GIV A;  1WH3 A;  1FMA D;  3JSV A;  2NCN A;  1CMX B;  3P2B A;  2BVC A;  2OHF A;  1Q10 A;  2NS5 A;  1AW7 A;  3SR6 A;  4D2K A;  3HRD D;  2WQY B;  4DBG A;  2IPK D;  4DWF A;  2WDT B;  1WGR A;  3MC8 A;  4HJK A;  3M3J A;  1I7H A;  3TEY A;  4M0W B;  1ZP0 B;  4MSM B;  4XWT A;  1E7V A;  5IO9 A;  1WE6 A;  4Q2J A;  4IWO A;  2XK5 B;  4ZOH C;  1WX9 A;  5CHW A;  4IOI E;  3OWE B;  1LQB A;  2D2Q A;  3MC0 B;  3APF A;  4UDU C;  2DHZ A;  3RUI B;  3T8M A;  1ZKH A;  4P7I A;  3EGR A;  4A9A A;  3LXF A;  2V3P A;  1SE2 A;  1GJZ A;  2M4N A;  2W3S A;  2WGS A;  1L4D B;  3ZXR A;  4XGA B;  3W1S C;  2ZW0 A;  2JUO A;  2UU7 A;  3C8Y A;  1IPG A;  5DPW A;  1LXD A;  2W3R A;  2BW2 A;  2KJR A;  3U4E G;  3VRB B;  1MHX A;  2C7H A;  1XLO A;  3Q3M C;  3DBL B;  3DWG C;  1H8C A;  4WQM A;  3H8H A;  1N60 A;  4NAM A;  4P1C C;  4W9L A;  1WZ0 A;  2KLC A;  3DBH B;  1EF5 A;  2R2Q A;  1MHH E;  1WE7 A;  1DYQ A;  3QAQ A;  2G3Q B;  5BMG A;  3PV1 A;  2L8J A;  2KTR B;  3Q3O C;  3JVZ X;  3EFU A;  1WJU A;  3K9P B;  3H9D A;  2J0J A;  2XBB C;  3PGE A;  1MG8 A;  4KGR A;  2WWZ A;  3RNB C;  4NJ6 A;  1SIF A;  2OJW A;  1WMH A;  3IXS A;  3ZKJ C;  4M8M A;  1XCQ L;  2KWD A;  4NZL B;  2EKE C;  2LHE A;  1V80 A;  5MPO A;  4ZDV A;  1JRU A;  2FCN A;  3PS6 A;  1SXT A;  3QC8 B;  2ON8 A;  4C80 A;  4RMA A;  2D11 A;  5HI1 A;  2YEP B;  4ZRK A;  3BVG A;  4WJN A;  3V60 A;  3T9L A;  2N9E B;  4NAW A;  3FC4 A;  5DPS A;  4ANX A;  2NBW B;  3H7P B;  1TGZ B;  4W9D A;  5G5G A;  1F77 A;  1N6Z A;  3AN1 A;  2LGD A;  4L1B A;  3DHH C;  2VRR B;  3QAR A;  4ASW C;  2CKH B;  1ZE3 D;  1AWD A;  4HPL B;  4P6V F;  3RNC C;  3ZNZ B;  1J7A A;  4KDI C;  3AM9 A;  1VZ8 A;  4LNN A;  3KWV A;  1P7E A;  3DDC B;  5J18 A;  1ENF A;  1VLB A;  1BXT A;  3DVN V;  4WAA A;  1DGJ A;  4M01 A;  3M62 B;  1SF0 A;  2MBH A;  1WRI A;  2KXJ A;  2AL3 A;  2QEJ C;  2RPQ A;  2L1A A;  3UI3 A;  4BOS C;  3KQ4 A;  1R4M I;  1L5P A;  3DWM A;  5AZH A;  2FBW B;  3P4R B;  4DXA B;  4A90 A;  2K1F A;  2HJ1 A;  4YXD B;  1N5X A;  5J17 A;  2J52 A;  1TY0 A;  5BO4 B;  2SEB D;  4IWQ A;  3VUW A;  5CTR C;  1WM2 A;  3GP7 A;  3WCQ A;  1V5O A;  2MWS B;  5DCN A;  1I4G A;  3WA0 A;  1T6B X;  1PQS A;  3DBR B;  3NG0 A;  2KD0 A;  2KWV B;  4RM8 A;  1JCK B;  3NRZ A;  3OG5 A;  5HFY A;  1LO5 D;  3RN9 C;  2GBM A;  3R2I A;  2MHJ A;  1M94 A;  4L2Y A;  4AQ7 A;  4HCP B;  2YLM A;  2PLP A;  1WR6 E;  2I1K A;  5LNK 1;  2CU1 A;  2JZ3 B;  5D2M B;  3NVZ A;  4K81 A;  1I4P A;  5C2T B;  1Y56 A;  3URY A;  1SBB B;  2FUH B;  2K8H A;  4FAD A;  2IO0 B;  2WU2 B;  1HEZ E;  3SDL C;  3B2F A;  3D32 A;  4TKN A;  4KSL C;  1ZUD 2;  3GS2 A;  2RGF A;  4LCD E;  1WF9 A;  4I6L B;  4KDL B;  5EE1 A;  4R3D A;  4A20 A;  1UWM A;  1HQR D;  4LLG M;  1WJN A;  2V9H A;  1WY8 A;  3NS1 A;  1P1A A;  2N9K A;  1T3Q A;  2DZI A;  2D10 A;  3M63 B;  2MEK A;  1WX7 A;  1P3Q U;  1KRH A;  3N1Y C;  4II2 B;  2QIL A;  3BY4 B;  2IY1 B;  3IAM 1;  3DQV A;  1R4N I;  2AL6 A;  4H2A A;  4JPS A;  2JWZ A;  4GOC A;  2OED A;  3Q8A A;  3L0W B;  2IO2 B;  4ICV A;  4GB9 A;  4BZA A;  3AMZ A;  2DEN B;  2R2O A;  4S17 A;  3OJ3 A;  1WYG A;  1TY2 A;  4KKJ A;  3PRP B;  3OAW A;  4YTP B;  4AJY B;  1SSN A;  2L32 A;  3BVM A;  3M95 A;  1XEE A;  1Q0W B;  1WXS A;  1ZW7 A;  2LEK A;  1ACC A;  2NBV B;  3QCA A;  1KJT A;  3FAH A;  2C60 A;  2IZV B;  1UD7 A;  3AEB B;  3EUB 2;  1TS2 A;  1T5X D;  4QAY A;  2MJ3 A;  1FFV A;  3MC9 A;  1MJD A;  2GLS A;  2MSE D;  1V49 A;  4C7Z A;  3PO0 A;  4NJ7 A;  4B0M A;  2WDR B;  1RWS A;  1V81 A;  4X57 B;  2M19 A;  1CQV A;  1VCB A;  3E9S A;  5DPT A;  2KZR A;  5I4D A;  1RYJ A;  4KIK B;  3VR8 B;  3ZRC A;  3Q3J A;  4C00 A;  5JHB A;  1PGB A;  4WIP A;  1J8C A;  3KUZ A;  4FBJ B;  4BVU C;  3AB5 A;  2V1Y A;  3ZO5 B;  1M4V A;  3N32 A;  3I63 C;  4PS8 A;  2PE6 B;  3A1Q A;  4RGT A;  4RNA A;  2BQQ A;  2WNM A;  4K3C A;  2PTL A;  1JML A;  2AQ2 B;  2AEH A;  2JQR B;  2X8X X;  1IBX A;  2N7J A;  1QZE A;  2JRH A;  2LVQ A;  4G11 A;  3V61 A;  2DNF A;  2KC2 A;  3PT2 B;  1TJE A;  1CJE A;  1HTO A;  2QHO A;  3BVZ A;  2Y3A A;  4LDT D;  2JZP A;  2YVC A;  4WJQ A;  2KDB A;  3AH7 A;  1UUP A;  1YIW A;  2GBK A;  2CJO A;  1GUA B;  1WI0 A;  4MM3 A;  3CMM B;  2MW5 A;  4W9E A;  2O6V A;  2N9L A;  2DAF A;  2KHW B;  4FA6 A;  5HG2 A;  4IDI A;  2WXQ A;  4IC7 B;  2O2V A;  3DVN U;  4KV2 A;  3VQI A;  1FRR A;  3PTF C;  2XEW A;  2DYB A;  1UF0 A;  1TZ1 A;  3VUX A;  2KWC A;  2GMI C;  3BII D;  1C77 A;  2KT7 A;  1QKZ A;  3R66 C;  4XYC A;  2JY6 A;  1TS5 A;  3AE9 B;  1QLB B;  4K7S A;  2KWU B;  1OQY A;  1K53 A;  3R7R A;  3DBS A;  1GPX A;  5G2N A;  2E3T A;  1Q5W B;  2QSD A;  2LVP A;  3L10 B;  2PKO A;  1HZ6 A;  4BOZ B;  3TMP B;  2KAJ A;  3OLM D;  1XQQ A;  3O65 B;  2L83 A;  3U2S C;  2IDY A;  3EC8 A;  3W5V B;  2N0S B;  5D3I B;  4A8X C;  1AN8 A;  1E7U A;  3FKY A;  1I42 A;  1YJI A;  3KYD D;  5TR5 A;  3Q8B A;  1GB1 A;  4IUM B;  3IHP C;  2WXI A;  1E5W A;  4MAC A;  1YN4 A;  2ZNV B;  3AED B;  2FCQ A;  1N5W A;  5BYQ A;  2WXJ A;  4RM9 A;  4PT5 A;  1B1Z A;  4P1B C;  2M8S A;  2AX5 A;  4ZRJ A;  2WXR A;  2BYT A;  4W9G A;  4HXD A;  2MRP A;  3ONS A;  5AEK B;  4F1S A;  1UH6 A;  3NVV A;  5EE3 A;  3NHE B;  1I4Q A;  4ITK A;  2A4Z A;  1D5M C;  4IG7 B;  3B0A A;  3WAN A;  4BKT A;  2QIE B;  4GGQ A;  1E8Z A;  3CF6 E;  1QF6 A;  4C4V A;  4MGY E;  3CIR B;  2RDG A;  1C4C A;  2PEA A;  3EHV A;  1C79 A;  4IM3 A;  3GE3 C;  1EM7 A;  1J19 A;  2K0P A;  4BBN F;  5E6P A;  2C9W B;  1E90 A;  3PZD A;  2BS4 B;  2KQ7 A;  2LJ5 A;  4DHJ D;  2J53 A;  4KGS A;  4K3B A;  1PGX A;  1Z2M A;  3WIM A;  4LNI A;  3CWI A;  4XC2 A;  2GOW A;  3KH0 A;  4LJP B;  3PSE B;  2IGD A;  2NPT B;  3SEB A;  1D5X C;  1VR9 A;  3W1Y A;  3SU8 X;  1WGK A;  2FE8 A;  4ZRQ A;  4OZA A;  3VUY A;  2LHD A;  3ZJT A;  4N58 A;  4DHZ E;  3KWL A;  4WWN A;  1K52 A;  1UWX A;  4AJW A;  1ET9 A;  3HVZ A;  2J4X A;  3L17 A;  2KKC A;  1N63 A;  1GC7 A;  3TJP A;  2KN5 A;  1L0Y B;  4MGK E;  4OW0 A;  4GDL B;  3VAW A;  5FR6 A;  3SFE B;  2N7E A;  2IGH A;  3A9K B;  2K8C A;  5LXH A;  1BT0 A;  2KDE B;  5D94 A;  1P7F A;  2PVG C;  4HK2 A;  4WWO A;  1ZXH A;  4OVU A;  3RNF C;  4LDT B;  4JWS C;  1FRD A;  3TBL D;  5J2R A;  2C7M B;  2M1M A;  1D4B A;  2FAZ A;  3AE5 B;  2AWT A;  4OHJ A;  4JL9 A;  2JXX A;  2BS2 B;  4ARC A;  2KQS A;  4KZC A;  3ZUN A;  1FNV A;  1TS4 A;  3AI5 A;  3J9C A;  3BK2 A;  4DQO C;  1SB3 C;  4BBN C;  3NJT A;  1JWA D;  4NNJ B;  5AZG A;  3ECI A;  5C3J B;  4TQ1 A;  4W9F A;  2RPV A;  3ZW3 A;  2PJH A;  4HCN B;  1FCC C;  1K50 A;  3FIL B;  3RYT A;  4G3X B;  2GRI A;  1V1O A;  2L05 A;  1LM8 B;  2MJD A;  1KOT A;  4AP4 C;  5IP4 D;  4FXC A;  2ASQ A;  4I6N B;  4M02 A;  3QA8 A;  1NYR A;  3HHM A;  1NDD A;  1F52 A;  5CHF A;  2N1V A;  2JPH A;  3BZD B;  2WS3 B;  2L0T A;  2G9H D;  4HDO A;  3E56 A;  2D5G A;  2R61 A;  2HJ8 A;  3NVY A;  3R3M A;  3AEA B;  1LFD A;  1TKE A;  1PYW D;  4F7Z A;  3QWZ B;  3WAO A;  4F8C B;  2W55 A;  3QX1 A;  4TUU A;  3RMK C;  3KYC D;  3QQ8 B;  2GBN A;  2JVC A;  2WX0 A;  3V6C B;  1ZXI A;  4G0N B;  1JAL A;  4KSK C;  3MHZ A;  4N59 A;  5C1Z A;  4LJO B;  1P98 A;  4L23 A;  4ARI A;  2QJL A;  3VR9 B;  1C3T A;  2BYV E;  4IW0 A;  3A33 B;  1E6E B;  3Q8F A;  1MG4 A;  2LWP A;  4LNF A;  1L4Z B;  2PPH A;  3T3O A;  2D3A A;  3QK0 A;  2CR5 A;  5IA7 A;  2RMM A;  1WXV A;  4YWG G;  3PZ8 A;  4DHJ B;  5H8Y E;  4CO7 A;  1C9F A;  2Z0E B;  3UIO B;  3ZJU A;  3I9V 1;  1GC6 A;  2IYD B;  2BS3 B;  4PK1 A;  2HTH A;  4ANW A;  4FLH A;  3JW0 X;  3PLV A;  1F2R C;  1D5Z C;  1S1Q B;  1XLQ A;  2DZJ A;  1WXM A;  4AOF A;  2M17 A;  3P63 A;  4W9C A;  1FNU A;  1TYG B;  4N6E B;  1ZPS A;  2H89 B;  3W1S A;  3PRE A;  3ZJV A;  1QIL A;  2BYF A;  2A5U A;  4LTU A;  4C7Y A;  2X38 A;  2JU6 X;  1C4A A;  2GBR A;  4LK0 M;  5LXI B;  1P9D U;  2L52 A;  2DBY A;  3A4R A;  3DBL I;  1OQQ A;  2DX5 B;  2D3G A;  2KQ4 X;  3ETR A;  2IBI B;  2J7Q B;  2K25 A;  3SD5 A;  3BWU D;  4ZYN A;  4TV3 A;  5FKA C;  2MCN B;  1YQ4 B;  4I6P A;  1F1H A;  3NZ3 A;  2WXM A;  3DBH I;  4S0R A;  4HJG E;  1KLV A;  4KZ0 A;  2FNJ B;  3RD2 A;  3L4P A;  3AU4 A;  3DVG X;  1WJ6 A;  4LNO A;  4KKI A;  2Q5W D;  4WWM A;  2WXF A;  2KVZ A;  1EWY C;  1JQ4 A;  1IUE A;  2W9N A;  4XE0 A;  4FJZ A;  4P16 A;  2ZNV C;  4W9K A;  5D6J B;  4BKS D;  1EO6 A;  5D7G A;  1HXY D;  3CST A;  1Q1O A;  2AYO B;  4WH4 A;  1SJE D;  3P42 A;  1WGD A;  1FCL A;  2PMV A;  3GOE A;  4MH0 E;  5LLI A;  1A70 A;  2KLG A;  2OJR A;  1WM3 A;  2WXH A;  2AQ1 B;  3AV8 A;  3UF8 A;  3MJ5 A;  5E6N A;  4KIK A;  4LNK A;  1IP9 A;  4BKG A;  4DXF A;  3IBE A;  1KM7 A;  1WXA A;  4YSZ B;  2KMM A;  1RFA A;  3ALB A;  3VDZ A;  1I35 A;  2BYE A;  3Q8E A;  1ZGU B;  4CHK A;  2JSV X;  1QQR A;  4DHZ B;  2MX2 A;  4E74 A;  2KAN A;  2MP2 B;  3R2T A;  4EZL A;  3IFW B;  1OEY J;  2O6V D;  2KMC A;  1WGH A;  3Q3N C;  2LGI A;  4XX5 A;  5EE9 A;  3ZQ4 A;  3A9J A;  4E3C A;  4YTN B;  1WGY A;  3DVG Y;  1K51 A;  1T0R C;  4US8 A;  1C78 A;  4EFO A;  4IM2 A;  2EKI A;  4GMV A;  1V1P B;  5TSS A;  4WQO B;  2WDQ B;  3IT4 B;  4HRS A;  4N9F 4;  1T0Q C;  3LB8 C;  4XDC A;  2D3C A;  3ZTC A;  1QT9 A;  2KJ6 A;  1HZ5 A;  4WUR A;  2N9P C;  2V0G A;  1KF6 B;  2MH7 A;  1YX6 B;  1UGM A;  2LGS A;  1C1Y B;  4HKZ E;  2LGX A;  2WXK A;  3DBR I;  4WJO A;  1TTN A;  1GAQ B;  2B76 B;  5BMH A;  3X0W A;  3N3K B;  1NVI D;  4PYZ A;  1XCT L;  3PLU A;  2CS4 A;  1TKY A;  2RDB C;  1E8W A;  4GDK B;  1E8Y A;  3B08 A;  1U4A A;  3HUI A;  3P4Q B;  2I38 A;  2LRW A;  3HK0 A;  3DPD A;  1LGR A;  2NVU I;  2LFI A;  1F9J A;  4PS7 A;  2ZVO A;  3MP9 A;  1NEN B;  3UGB B;  2K22 A;  2IO1 B;  1MPE A;  1YQ3 B;  3P4S B;  1UZX B;  1SE4 A;  1XD3 B;  3EA6 A;  5IN7 A;  1YJJ A;  4IWP A;  2ICI A;  3KUD B;  2BWE S;  5T8I A;  2CHX A;  3IT6 B;  3P4P B;  4MSQ B;  3PPA A;  2QC8 A;  3RCZ A;  2PIA A;  4AUQ C;  2KFK A;  2E6X A;  2ACZ B;  4YL8 A;  1WGG A;  4HPM B;  3AU5 A;  2KMA A;  4US9 A;  3CSF A;  1QOB A;  2J0K A;  3LYY A;  4MJS A;  2WXN A;  1JWB D;  1OGW A;  4RFB A;  2C5L C;  3UQB A;  1QOG A;  2ZPY A;  1PGA A;  4ANV A;  3VRA B;  4MDK E;  2BKF A;  2WYQ A;  2G1E A;  1ROE A;  4JE3 B;  1JRO A;  2FCM A;  2KNB A;  1STE A;  3KUC B;  1HE8 A;  3A1Q B;  4OVZ A;  1ET6 A;  4EEW A;  3AE2 B;  1FEH A;  3BIN A;  1FXT B;  1JW9 D;  1VDV A;  4DDI D;  4W9I A;  2PW9 A;  2G45 B;  3BYT B;  2Z8L A;  2RR9 A;  2Z0D B;  5DPR A;  3PZ7 A;  3PRM B;  4W9J A;  5BMI A;  3AUL A;  4BFR A;  2K9X A;  2WP9 B;  3QJZ A;  1JWS D;  1L6U A;  1L7Y A;  1XLN A;  4GDL A;  4EZJ A;  1WZ3 A;  3A9K A;  4M0W A;  4MM3 B;  2VZK B;  5AUK A;  1XO3 A;  2O6V B;  1T0Y A;  3IVF A;  1WXQ A;  2DZM A;  3ZNI D;  2I1J A;  3Q69 A;  1QOF A;  2XK5 A;  2O2V B;  2ZVN A;  2BTE A;  1TT5 B;  3RNA C;  1V86 A;  1K8R B;  1VRA B;  3ZLZ A;  1SE3 A;  2Y5C A;  2LRU A;  3ZNH B;  2W54 A;  2KX3 A;  4KX6 B;  3W9C B;  3I3T B;  4AS1 A;  3NUH B;  3TUO A;  3GZN B;  5G5H A;  3HVD A;  4PS3 A;  2MLB A;  1UNS A;  2KYW A;  3U7Z A;  1FXI A;  1TKG A;  1MI0 A;  2BF8 B;  2IND C;  2EMS A;  3APC A;  1VD2 A;  4FUL A;  1UGJ A;  1V9J A;  1F2R I;  4B95 A;  3GB1 A;  4HVB A;  3FIL A;  3NZU A;  3V3X A;  2JT4 B;  4AWJ A;  1YOV B;  4A55 A;  3LDZ E;  4RGN A;  3L16 A;  4NY0 A;  5G55 A;  2M56 B;  2WXO A;  3N1X C;  1FXA A;  4YT0 B;  2EEL A;  2KTR A;  2MBE A;  4WWP A;  3RPF C;  1L0X B;  5GXG B;  1XT9 B;  1RLF A;  4CQN A;  2ZEQ A;  2V4I B;  4YTM B;  1J7C A;  2UYZ B;  4NQK E;  4C4V B;  2IO3 B;  2W82 A;  3RNE C;  4EOY A;  2HTM E;  1Z5S B;  3AEE B;  1IGD A;  1R4M B;  3NZS A;  1RAX A;  3PHW B;  3ZDM C;  2JYT A;  1I4R A;  1PUT A;  4IKG A;  1EWC A;  1FNW A;  1DOX A;  3U8Z A;  3NVW A;  5AUI A;  2LMC A;  4E71 A;  4HWI B;  4KVG B;  1KLU D;  1V97 A;  1VZ6 A;  2ZCB A;  3V05 A;  1WFY A;  3RUL A;  2WXL A;  2LXA A;  5C23 A;  1GG3 A;  2RDH A;  3H7P A;  3AEG B;  4JX1 C;  3O13 A;  2LUM A;  2FUG 1;  1EF1 A;  4RF0 A;  3U52 E;  5JHA A;  2NBU A;  3UQA A;  5EE0 A;  5EDS A;  3AE3 B;  3B9J A;  1OFF A;  3AE7 B;  3JSV B;  2KAC A;  2JRI B;  3TEW A;  1E8X A;  2WLB A;  4HRO A;  4OVV A;  3TSS A;  3MJW A;  1F0Z A;  4HKQ A;  3ZGZ A;  3P1M A;  3HM3 A;  2V3N A;  4MGI E;  4REZ A;  3R7Q A;  3Q2A C;  1E0Z A;  4GLS C;  3R8B A;  2L76 A;  2OOB B;  2L00 B;  3IG3 A;  4MEM A;  2MBO A;  2REX A;  1N62 A;  1C4P A;  3VFK A;  1WYW B;  5L95 C;  4JIO U;  3LJ3 A;  1L6V A;  3QHT A;  4HEA 1;  1ZOY B; 
#chains in the Genus database with same CATH homology
 1SE9 A;  5JZE B;  3B1L X;  2AEH A;  2KDI A;  2K39 A;  1TBE A;  2W9N A;  4DK5 A;  1QZE A;  4FJZ A;  2JRH A;  2LUE A;  2K6D B;  2ZNV C;  4W9K A;  5D6J B;  4BKS D;  1EO6 A;  2LVQ A;  5D7G A;  2LVO A;  4G11 A;  3AXC A;  2KC2 A;  3V61 A;  3CST A;  3PT2 B;  1Q1O A;  2AYO B;  3ZNG C;  2MQJ A;  4GSW A;  1P0R A;  3RT3 B;  2QHO A;  2UWQ A;  4TQ0 A;  3X23 A;  4LDT D;  1WGD A;  2YVC A;  3GZN I;  2KDB A;  4WJQ A;  4GN1 A;  4CYE A;  3EEC A;  2LGY A;  3GOE A;  4MH0 E;  5LLI A;  1YIW A;  4EZK A;  2GBK A;  1EUV B;  3PVL A;  2ZCC A;  1GUA B;  1WI0 A;  4MM3 A;  3CMM B;  3PRZ A;  5CX3 A;  4GIV A;  2MW5 A;  4W9E A;  1WH3 A;  2O6V A;  2DAF A;  2KHW B;  2KLG A;  2OJR A;  4HDQ A;  3JSV A;  2NCN A;  1CMX B;  1WM3 A;  3P2B A;  4FA6 A;  3UF8 A;  1WRD B;  4IC7 B;  2O2V A;  2NS5 A;  3APD A;  3DVN U;  4FHK A;  3ZRF A;  2K6Q A;  5E6N A;  4KIK A;  3WAL A;  4KV2 A;  3VTV A;  2CHW A;  3VQI A;  4DBG A;  1OEY A;  3U30 A;  2WDT B;  4DWF A;  1UBQ A;  3PTF C;  2XEW A;  1J0G A;  1IP9 A;  1WGR A;  1UEL A;  2DYB A;  3M3J A;  3IBE A;  1TZ1 A;  1KM7 A;  1WXA A;  2KWC A;  4HJK A;  2GMI C;  4IM0 A;  3VUX A;  4II3 B;  1RFA A;  3ALB A;  3VDZ A;  1I35 A;  2BYE A;  4M0W B;  3R66 C;  4MSM B;  2JY6 A;  1E7V A;  1ZGU B;  1WE6 A;  4CHK A;  1YQB A;  2PE9 A;  4DHZ B;  2MX2 A;  4E74 A;  4IWO A;  2KAN A;  4K7S A;  2XK5 B;  1WX9 A;  1OQY A;  2BPS A;  2KWU B;  5CHW A;  2CHZ A;  2C7N B;  3ML9 A;  3R7R A;  3DBS A;  4FN2 A;  2MP2 B;  3HM6 X;  1LQB A;  2D2Q A;  3IFW B;  4EZL A;  3APF A;  1OEY J;  5G2N A;  2DHZ A;  4MEL A;  2O6V D;  1Q5W B;  2KMC A;  3RUI B;  1WGH A;  2LVP A;  2N1W A;  3L10 B;  3T8M A;  4BOZ B;  1OTR B;  4MGZ E;  4XX5 A;  3TMP B;  5IAA C;  1ZKH A;  3OLM D;  1XQQ A;  3O65 B;  4P7I A;  3A9J A;  4E3C A;  1WGY A;  1WMH B;  3DVG Y;  3DOW A;  4EUT A;  3EC8 A;  3TL5 A;  1GJZ A;  2M4N A;  2N7D A;  4EFO A;  1WX8 A;  1WR1 A;  4IM2 A;  3ENE A;  1E7U A;  4GMV A;  3W1S C;  2LAS A;  4K7W A;  3KYD D;  4WQO B;  3VTU A;  2L3Z A;  1IYF A;  1I42 A;  5TR5 A;  2JUO A;  4IUM B;  3IHP C;  1IPG A;  4N9F 4;  5DPW A;  2V4L A;  1E5W A;  1LXD A;  3ZTC A;  2KJR A;  1AAR A;  2ZNV B;  2C7H A;  2FCQ A;  2KJ6 A;  2FCS A;  4ANU A;  2N9P C;  4RM9 A;  1WJ4 A;  1Y8R C;  1H8C A;  2M8S A;  4URK A;  4ZRJ A;  3L54 A;  1YX6 B;  1UGM A;  4W9G A;  4HXD A;  2MRP A;  1C1Y B;  3ONS A;  5AEK B;  4F1S A;  1UH6 A;  2LGX A;  4W9L A;  3NHE B;  1WZ0 A;  2KLC A;  2A4Z A;  3DBR I;  4IG7 B;  4NAW B;  3B0A A;  4WJO A;  1TTN A;  3WAN A;  4BKT A;  3RZF A;  1EF5 A;  2R2Q A;  1WE7 A;  5HKH A;  3VXW A;  3QAQ A;  3X0W A;  2G3Q B;  2M0X A;  1E8Z A;  2KVR A;  2G4S A;  3N3K B;  3PV1 A;  3QIJ A;  2L8J A;  2NR2 A;  3CF6 E;  2FIF A;  4MGY E;  4PYZ A;  3PLU A;  3VVW B;  2CS4 A;  2KX0 A;  1NI2 A;  1E8W A;  2KTR B;  4GDK B;  3JVZ X;  1E8Y A;  2JZZ A;  3EFU A;  3B08 A;  1WJU A;  1U4A A;  3K9P B;  2PEA A;  3EHV A;  3H9D A;  2J0J A;  2MP2 A;  4IM3 A;  2XBB C;  3PGE A;  1J19 A;  5KHO A;  1MG8 A;  2LRW A;  4BBN F;  2WX1 A;  5E6P A;  2C9W B;  2WWZ A;  4FHJ A;  2RSU A;  1E90 A;  3HK0 A;  4NJ6 A;  1SIF A;  3JYU A;  3DPD A;  3ZVV A;  2NVU I;  2K8B A;  1F9J A;  1WMH A;  2L0F A;  4PS7 A;  3PZD A;  2ZVO A;  5E6O A;  3ZKJ C;  4GGQ A;  2KQ7 A;  2BKR B;  4A3P A;  2LJ5 A;  4M8M A;  3UGB B;  2BGF A;  2IO1 B;  2EKE C;  4DHJ D;  5KHQ A;  1UZX B;  1XD3 B;  1V80 A;  3UIP B;  4ZDV A;  1JRU A;  2FCN A;  3PS6 A;  4G50 A;  1Z2M A;  3WIM A;  2LD9 A;  3OJ4 B;  3QC8 B;  4IWP A;  3ZDT A;  3K9O B;  4XC2 A;  4RMA A;  2GOW A;  3KH0 A;  3KUD B;  4LJP B;  4XZ4 A;  2D11 A;  3N30 A;  3PSE B;  2Y5B B;  2NPT B;  2BWE S;  2CHX A;  3W1Y A;  2GBJ A;  3SU8 X;  4MSQ B;  3PPA A;  3VUY A;  4ZRK A;  3RCZ A;  4AUQ C;  2KFK A;  4WJN A;  3V60 A;  2LI5 A;  4YL8 A;  3T9L A;  1WGG A;  2N9E B;  4DHZ E;  4WWN A;  4HPM B;  1A5R A;  3AU5 A;  1GNU A;  4NAW A;  4AJW A;  5DPS A;  4ANX A;  3L17 A;  2KKC A;  1GC7 A;  3TJP A;  2KMA A;  2KN5 A;  2NBW B;  4MGK E;  3CSF A;  3H7P B;  4GDL B;  3VAW A;  1TGZ B;  2J0K A;  4W9D A;  5FR6 A;  4MJS A;  2EMT A;  2N7E A;  3A9K B;  4GDK A;  2K8C A;  3TIX A;  2LGD A;  1OGW A;  2LZ6 A;  2VRR B;  3VTW A;  1BT0 A;  5LXH A;  2KDE B;  4FJY A;  2JF5 A;  5D94 A;  3QAR A;  3L13 A;  4ASW C;  2CKH B;  1WIA A;  2C5L C;  4HPL B;  2KDF B;  4HK2 A;  3UQB A;  4WWO A;  3ZNZ B;  4DDG D;  4OVU A;  4KDI C;  3V6E B;  4M8N A;  1ISN A;  4LDT B;  1V5T A;  2B3A A;  2ZPY A;  3TBL D;  2KJH B;  3DDC B;  4ANV A;  2C7M B;  4MDK E;  5J18 A;  5J2R A;  2BKF A;  2WYQ A;  2M1M A;  2FAZ A;  4ZRI A;  2LXC A;  3DVN V;  4WAA A;  2KNB A;  2FCM A;  2AWT A;  2MBB B;  3M62 B;  4JL9 A;  3KUC B;  1HE8 A;  2MBH A;  3A1Q B;  3KW5 B;  2JXX A;  2FID A;  2KXJ A;  2AL3 A;  2KO3 A;  3BIN A;  4EEW A;  1FXT B;  2RPQ A;  4DDI D;  2KQS A;  4KZC A;  4BOS C;  4W9I A;  3ZUN A;  1R4M I;  3AI5 A;  2G45 B;  5AZH A;  1H4R A;  4BBN C;  4DXA B;  4EKU A;  2K1F A;  4NNJ B;  2RR9 A;  2Z0D B;  5DPR A;  5J17 A;  2DYM A;  5AZG A;  5BO4 B;  4IWQ A;  4GU2 A;  3VUW A;  5CTR C;  3ECI A;  3PRM B;  1WM2 A;  4W9J A;  4TQ1 A;  1V5O A;  1S3S G;  2MWS B;  3Q3F A;  2PJH A;  3AUL A;  4W9F A;  3ZW3 A;  5DCN A;  4BFR A;  4HCN B;  3WA0 A;  3RYT A;  1PQS A;  4G3X B;  2N4F A;  2KD0 A;  2KWV B;  3QJZ A;  4RM8 A;  2ZPN A;  1UBI A;  1L7Y A;  2IY0 B;  1LM8 B;  2L05 A;  2ZJD A;  4GDL A;  1KOT A;  4AP4 C;  4EZJ A;  1WZ3 A;  2GBM A;  2BWF A;  3A9K A;  4J6I A;  2HE7 A;  3KVF B;  4PYU A;  2O6V B;  1M94 A;  1T0Y A;  1RRB A;  2ASQ A;  4HCP B;  3IVF A;  1X1M A;  2KTF A;  2YLM A;  4I6N B;  2V3S A;  4BKS A;  4JGH B;  2DZM A;  3QA8 A;  3ZNI D;  2I1J A;  1WR6 E;  2XK5 A;  2I1K A;  2O2V B;  2ZVN A;  3HHM A;  2CU1 A;  2JZ3 B;  1NDD A;  5CHF A;  5D2M B;  2N1V A;  2JPH A;  4K81 A;  1V86 A;  1K8R B;  4K7U A;  3H7S A;  3ZLZ A;  2LRU A;  3ZNH B;  2KX3 A;  2DZK A;  2FUH B;  2K8H A;  2L0T A;  4FAD A;  2IO0 B;  4HDO A;  3H1U A;  3SDL C;  2HJ8 A;  3I3T B;  3HIZ A;  3D32 A;  3R3M A;  1LFD A;  4TKN A;  4PS3 A;  2L7R A;  4KSL C;  3QWZ B;  4F7Z A;  3WAO A;  2MLB A;  4F8C B;  4B6W A;  3QX1 A;  2RGF A;  4TUU A;  2BF8 B;  4LCD E;  4A3O A;  3KYC D;  3QQ8 B;  4W9H A;  1WF9 A;  2D07 B;  2EMS A;  2GBN A;  2JVC A;  2WX0 A;  3APC A;  4I6L B;  1VD2 A;  3NS8 A;  4KDL B;  4FUL A;  1V9J A;  4G0N B;  3V6C B;  4A20 A;  5L83 A;  1D3Z A;  3A9J B;  1L2N A;  4B95 A;  4KSK C;  3A4S C;  4HVB A;  5C1Z A;  2DAJ A;  4LJO B;  3NZU A;  1SGH A;  1YX5 B;  1P98 A;  2JT4 B;  4AWJ A;  1WJN A;  1WY8 A;  3LDZ E;  1P1A A;  3L16 A;  4FJV B;  4NY0 A;  1YJ1 A;  1C3T A;  2BYV E;  4IW0 A;  5G55 A;  4K1R B;  3NY5 A;  3MTN B;  3A33 B;  2DZI A;  1NBF C;  2D10 A;  2LWP A;  3M63 B;  2KTR A;  2MBE A;  4WWP A;  2PPH A;  2KFJ A;  1WX7 A;  3UIN B;  2KK8 A;  1P3Q U;  4BKG A;  4II2 B;  3QK0 A;  2CR5 A;  1XT9 B;  2MBQ A;  4JLC A;  3BY4 B;  4B9K A;  5IA7 A;  2IY1 B;  2KOX A;  3DQV A;  1WXV A;  1RLF A;  2J0M A;  1R4N I;  2AL6 A;  3SHQ A;  4DHJ B;  4ICU A;  4CO7 A;  2ZEQ A;  2JWZ A;  2Z0E B;  4GOC A;  3UIO B;  3V62 A;  3L0W B;  2Z59 B;  3NOB A;  2IO2 B;  4ICV A;  1GC6 A;  2IYD B;  4GB9 A;  2UYZ B;  4NQK E;  2HTH A;  4ANW A;  4FLH A;  3JW0 X;  3PLV A;  4NQL B;  2DEN B;  2IO3 B;  2R2O A;  1S1Q B;  3OJ3 A;  4GXB A;  4EOY A;  3PRP B;  1Z5S B;  3ZTD A;  2RD0 A;  3NZS A;  2G4D B;  3OAW A;  2DZJ A;  4AJY B;  1WXM A;  1RAX A;  4AOF A;  4HLE A;  2M17 A;  5GMV A;  3M95 A;  3PHX B;  4W9C A;  1V2Y A;  1Q0W B;  2NPT A;  3PHW B;  3ZDM C;  1WXS A;  1ZW7 A;  2NBV B;  3U8Z A;  3QCA A;  3RZW C;  3U7D A;  1KJT A;  3ML8 A;  2C60 A;  4E71 A;  4HWI B;  4KVG B;  2IZV B;  1UD7 A;  3W1S A;  2ZCB A;  3VHT C;  1WFY A;  3MHS D;  3RUL A;  5JH5 C;  3PRE A;  2BYF A;  2A5U A;  2LXA A;  5C23 A;  3ZIM A;  3C0R B;  1GG3 A;  3H7P A;  2MSE D;  1V49 A;  3VH4 B;  2GBR A;  5LXI B;  1EF1 A;  1P9D U;  2N9X A;  4NJ7 A;  2NBU A;  3WAP A;  5JHA A;  3UQA A;  1G6J A;  5EDS A;  1V81 A;  4X57 B;  3A4R A;  1VCB A;  3H6N A;  3JSV B;  4WJP A;  2JRI B;  3DBL I;  3TCA A;  5DPT A;  3DCG A;  1E8X A;  2DX5 B;  4JQW C;  2D3G A;  2KZR A;  2ZZP B;  1YD8 U;  2IBI B;  5CHV C;  2KFK B;  4OVV A;  2J7Q B;  4KIK B;  2K25 A;  3MJW A;  3ZRC A;  3Q3J A;  3SD5 A;  1V6E A;  4ZYN A;  2MA9 B;  5JHB A;  4NPN A;  3S2A A;  1J8C A;  4TV3 A;  3KUZ A;  2MCN B;  3HM3 A;  4BVU C;  4FBJ B;  3L08 A;  4I6P A;  4MGI E;  2V1Y A;  3ZO5 B;  5AZF A;  3N32 A;  3DBH I;  3WAM A;  3R7Q A;  4PS8 A;  2PE6 B;  2L76 A;  4MJS B;  2OOB B;  1KLV A;  2L00 B;  3A1Q A;  3IG3 A;  2MBO A;  4MEM A;  2REX A;  4KZ0 A;  3VFK A;  3VH3 B;  1WYW B;  2FNJ B;  3RD2 A;  4JIO U;  5L95 C;  2DYO A;  3AU4 A;  3DVG X;  1WJ6 A;  3LJ3 A;  2KC1 A;  3QHT A;  2HD5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...