2LUEA

Lc3b optn-lir ptot complex structure
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
119
structure length
119
Chain Sequence
GAMGKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Microtubule-associated proteins 1A/1B light chain 3B
publication title Structural basis for phosphorylation-triggered autophagic clearance of Salmonella.
pubmed doi rcsb
source organism Homo sapiens
total genus 25
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2012-06-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2lueA00
4GDLA 3AULA 2REXA 4DXAB 4MJSA 1H4RA 1EF1A 1UELA 1WJNA 2ZVOA 4PYUA 2L0TA 3HK0A 3N3KB 4JLCA 5TR5A 3VH4B 2BKFA 2CKHB 2XK5B 3WAMA 4FJZA 3HIZA 5JH5C 3R7QA 4AJWA 1SIFA 4KV2A 3V61A 3H7SA 2O2VA 3ZRFA 2VRRB 1C3TA 2L0FA 5J2RA 2UWQA 3A9JA 2LRWA 1WX8A 3H7PA 3IVFA 4A20A 1ZGUB 3V6EB 3DPDA 1LQBA 2N7EA 5DPTA 2KDBA 2KLGA 1RLFA 3B08A 2MSED 4K1RB 1S3SG 2KK8A 1P0RA 3WA0A 2KFJA 3EC8A 3PRPB 2LXAA 3PREA 4KVGB 3DQVA 3HM6X 2KWCA 1WH3A 2KD0A 1GC7A 5CHWA 3SHQA 1K8RB 1ISNA 1LFDA 4PS3A 5DPSA 1NBFC 1Z2MA 2JY6A 4WJNA 5IAAC 4BOZB 2PEAA 3RULA 1J19A 1E7UA 2KANA 3ML8A 3RYTA 2NR2A 3JSVA 1WXSA 4F8CB 2LGXA 3L13A 1WM2A 1R4MI 2ZCBA 4DWFA 2MP2B 2A4ZA 3VTVA 2ZCCA 3AI5A 1WX7A 4NPNA 2ZVNA 3ZLZA 3DBHI 1T0YA 1V80A 2JZZA 3VQIA 1XQQA 2DYMA 4M0WB 5IA7A 4JIOU 3LJ3A 3ZNID 4IM2A 2C7HA 4WJOA 2J0MA 2KWVB 4FBJB 1WGDA 2UYZB 1V86A 2BWFA 4HWIB 4MELA 3RCZA 1I42A 3U7DA 1GJZA 1Q5WB 5CHFA 3NZSA 3PV1A 4W9CA 2MBQA 2MBOA 2M17A 2LRUA 4GMVA 4IUMB 1UBQA 1WR1A 2KDIA 2KVRA 2LWPA 2EMSA 5E6OA 1YX5B 4TV3A 3VUWA 1Y8RC 1BT0A 2KX3A 4LJPB 1Q1OA 1GC6A 2KNBA 4PS8A 2FCNA 3QA8A 4NJ7A 2MRPA 3V62A 2GOWA 3T8MA 4GU2A 3WANA 2GBJA 1E8ZA 1EUVB 4CO7A 1KOTA 3IHPC 3PGEA 2FUHB 3W1YA 2K8BA 3A4SC 4FHJA 2KWUB 3UINB 3X0WA 3M3JA 3VXWA 3PTFC 4XZ4A 3WAOA 2WX0A 2XBBC 4DDGD 1WIAA 5LLIA 1X1MA 3DBSA 1KJTA 2DZIA 1WGYA 3APDA 2N4FA 3ZVVA 2HJ8A 2BYVE 3PLVA 3VFKA 1SE9A 3ZRCA 1WMHA 4ZDVA 3A9KA 2WWZA 4JL9A 2GMIC 2KJRA 4TKNA 2R2OA 2CHZA 1LXDA 3AU4A 3KVFB 1WR6E 4KIKA 3MTNB 2J0JA 3H6NA 1V2YA 4GIVA 2MX2A 4IC7B 1A5RA 2IO1B 2GBKA 3PRMB 5C23A 1D3ZA 4KSKC 4HK2A 3CF6E 2BYFA 2D07B 1WX9A 2JVCA 3B0AA 3QAQA 4HDQA 3DVGX 4JGHB 4RM8A 2D11A 3IG3A 1WI0A 4MM3A 3T9LA 3NS8A 4NAWA 3M95A 2Z59B 3LDZE 4N9F4 1XD3B 2IZVB 4ZRJA 4AOFA 1ZW7A 4AJYB 3UQBA 1L2NA 4W9LA 3A1QA 3QJZA 4F7ZA 2DAFA 3KYCD 2AEHA 2K39A 1WF9A 1WZ0A 4GXBA 4MJSB 2MQJA 3ZNZB 5D7GA 3VTWA 2WYQA 2HD5B 1P98A 3VHTC 1WYWB 2R2QA 3DBLI 3A33B 3EECA 3QCAA 4K7WA 3L54A 4XX5A 2KDFB 4F1SA 3N32A 2Y5BB 2KOXA 1OEYA 4IWOA 3ZKJC 1KM7A 1EF5A 5C1ZA 3ZUNA 5J18A 5L95C 1C1YB 4G50A 5KHOA 5AZGA 3A9JB 4MSQB 4GOCA 5AZFA 3L08A 3PHWB 2NPTB 3OLMD 3UIPB 4AP4C 2RR9A 2KKCA 2I1JA 3JVZX 3VH3B 2WDTB 4BFRA 2JWZA 2PE6B 3ZDTA 4DK5A 3RUIB 4HPLB 4MGKE 3DDCB 3I3TB 5JZEB 4DHZB 4GGQA 3QHTA 1V81A 2KN5A 5DPRA 2G4DB 2JF5A 2K6QA 3CMMB 2FCMA 2LVOA 1RAXA 4P7IA 1YIWA 1NI2A 1QZEA 2DAJA 4GDKB 1WRDB 4WJPA 3L17A 2O6VA 2DZJA 4W9EA 1P1AA 1TBEA 1WGRA 2ZPNA 3RT3B 1M94A 4IG7B 3WAPA 2MA9B 1TGZB 1WE7A 5AEKB 2BYEA 1E7VA 2XK5A 4HCPB 2V3SA 5G55A 3KUDB 2DYBA 3PT2B 1IPGA 3M62B 5FR6A 2C5LC 3JYUA 4W9HA 3QWZB 2M1MA 2JRIB 3ZNHB 4AUQC 1KLVA 2L3ZA 4PYZA 3KW5B 1WJUA 2LGYA 2NBVB 4IM3A 5E6PA 4ANWA 3QQ8B 2ZNVC 3H1UA 1V6EA 2MBHA 4RMAA 3WALA 4URKA 2J0KA 2N9PC 1Z5SB 4FULA 2KMAA 3W1SA 2JUOA 3HHMA 1WXMA 4WAAA 3V6CB 4EOYA 4CYEA 4XC2A 2LASA 2RGFA 3D32A 2G3QB 4RM9A 3SD5A 1TTNA 4JQWC 2GBRA 1AARA 3RZFA 2KZRA 4E74A 2K8CA 4K7SA 1J8CA 1WY8A 5LXHA 2V1YA 2Z0DB 2L76A 2BGFA 3R7RA 4ANXA 2KJHB 2A5UA 2JPHA 4HCNB 2G45B 4W9GA 2KTFA 3WIMA 2DX5B 2J7QB 2MP2A 1OQYA 4A3OA 2C9WB 3BINA 2MBEA 3MHSD 1V9JA 4BKSA 4DHJD 1E8YA 4II3B 4B95A 4HDOA 1JRUA 4MGZE 3ENEA 3OJ4B 2LVPA 2NBUA 1UGMA 4DBGA 5DPWA 3W1SC 3ZIMA 4B9KA 4E3CA 4WQOB 3TIXA 4FLHA 4LCDE 4IM0A 2ZZPB 2FIDA 5HKHA 1WMHB 4DHJB 1P3QU 3P2BA 3APCA 2FNJB 3L0WB 4YL8A 4HLEA 1G6JA 2RSUA 4KIKB 1WZ3A 4I6NB 4II2B 2M8SA 4GSWA 2PJHA 2LXCA 4KDLB 2JRHA 4MH0E 3DVNU 3U8ZA 2ZPYA 1WGGA 1V49A 2KTRB 2L8JA 4ZRIA 1GG3A 2GBNA 4NQKE 3EHVA 2IO2B 2JT4B 4NAWB 3ZO5B 2CHXA 2Z0EB 4ANUA 5D6JB 5CHVC 5CTRC 2AWTA 2LD9A 5CX3A 1ZKHA 2KQSA 4K81A 3K9OB 3A1QB 3QC8B 1WJ6A 4IW0A 2W9NA 4MSMB 2IO0B 1OEYJ 4LDTD 2KFKB 2KDEB 3PHXB 3QK0A 1S1QB 3A4RA 3Q3JA 2FIFA 4KZ0A 4ZRKA 2JZ3B 4G0NB 4GDLB 2C7MB 3RD2A 2RD0A 4PS7A 2L05A 2CU1A 1UD7A 2PPHA 4LDTB 4W9KA 1YQBA 1E8WA 2LZ6A 5EDSA 4W9JA 5BO4B 2O2VB 2O6VD 4WWNA 3H7PB 4CHKA 1E8XA 1P9DU 3S2AA 4IWPA 3PSEB 4BOSC 4TUUA 3TCAA 1OGWA 2BKRB 1WFYA 4MGIE 4TQ0A 1HE8A 4ZYNA 3OAWA 4NJ6A 2IY1B 4MEMA 1IYFA 2KMCA 2O6VB 3PS6A 3CSFA 3GOEA 1H8CA 4GB9A 3UGBB 2DZKA 1I35A 3QIJA 1IP9A 1UBIA 3VDZA 2YVCA 2MWSB 4FJVB 2YLMA 3JSVB 2HTHA 2IYDB 2ASQA 4KDIC 5JHAA 3DVGY 3ZTDA 1WXAA 2MLBA 4MDKE 3QARA 2KO3A 5KHQA 2KC1A 2NPTA 3TBLD 1E90A 3PVLA 1UH6A 3ZTCA 2N1WA 4LJOB 3VTUA 5L83A 2JXXA 3IBEA 3PRZA 3ZNGC 3R3MA 2IO3B 4J6IA 4BBNF 4DHZE 3EFUA 1YD8U 3NOBA 4HPMB 1GUAB 1U4AA 2DYOA 4GDKA 3B1LX 3C0RB 4ICUA 2L7RA 1VD2A 3ML9A 2EMTA 4M8MA 2KXJA 2NCNA 2IY0B 2FAZA 2G4SA 3ONSA 4NY0A 3L10B 4BKSD 4IWQA 3M63B 5J17A 5JHBA 2KQ7A 3ALBA 3MJWA 3AXCA 2NS5A 4A3PA 4EUTA 3PZDA 1F9JA 1UZXB 3K9PB 3DOWA 4ANVA 4BKGA 4EFOA 1WJ4A 2M0XA 4I6PA 4FJYA 2HE7A 4WWPA 1YJ1A 1V5TA 2AL6A 2ZEQA 5D2MB 3JW0X 1L7YA 2N9EB 2BPSA 3HM3A 4K7UA 2D2QA 3V60A 2IBIB 1Q0WB 2FCSA 3GZNI 2MCNB 3UQAA 3AU5A 4HXDA 2XEWA 2DHZA 3VAWA 3ZDMC 2V4LA 3R66C 2FCQA 2K6DB 2D10A 4HJKA 2KX0A 2LI5A 4B6WA 4FA6A 4OVVA 3NHEB 2NBWB 2QHOA 3X23A 2ZJDA 2K8HA 3UF8A 3SDLC 1PQSA 1WGHA 4ICVA 5DCNA 1WE6A 2AL3A 3NZUA 2CS4A 3U30A 3A9KB 3VVWB 1EO6A 3APFA 4TQ1A 1GNUA 5GMVA 4FHKA 4G11A 2DENB 4BBNC 2NVUI 3QX1A 2WX1A 4DDID 4EZKA 1J0GA 3TMPB 3UIOB 1FXTB 2BWES 2D3GA 5LXIB 1MG8A 4EEWA 5E6NA 4WWOA 1CMXB 1V5OA 2K1FA 4I6LB 1RFAA 4BKTA 4FADA 3KYDD 2LJ5A 2CR5A 3ZW3A 3ECIA 4E71A 3L16A 3SU8X 4EKUA 2KHWB 1OTRB 3DCGA 5G2NA 2C60A 3KUCB 3VUYA 3O65B 4WJQA 3TJPA 2L00B 3CSTA 1SGHA 2KLCA 4KZCA 4NQLB 4EZLA 5AZHA 1TZ1A 1NDDA 1RRBA 3PLUA 3OJ3A 2I1KA 1YX6B 2AYOB 4X57B 2PE9A 4OVUA 4G3XB 2M4NA 2EKEC 3KUZA 4FN2A 3TL5A 3BY4B 2RPQA 3PPAA 3DBRI 3NY5A 1E5WA 4ASWC 3DVNV 2N1VA 1WM3A 4BVUC 3Q3FA 3VUXA 4KSLC 2LGDA 4EZJA 2KTRA 2LVQA 3N30A 4HVBA 2KJ6A 2MW5A 2DZMA 3H9DA 4NNJB 4W9IA 4M8NA 2CHWA 2ZNVB 2GBMA 2K25A 3KH0A 1WXVA 2C7NB 1LM8B 1R4NI 2KC2A 4GN1A 4AWJA 3IFWB 2N7DA 2LUEA 2OJRA 1VCBA 2OOBB 2KFKA 2B3AA 1XT9B 4MGYE 2MBBB 4W9DA 5D94A 3RZWC 2N9XA 4W9FA 2BF8B
chains in the Genus database with same CATH superfamily
4GDLA 4RF1A 3TEZA 2L0TA 3HK0A 4JLCA 2J52A 4Q2JA 4FJZA 3R7QA 4KGRA 2L0FA 3A9JA 1WX8A 2OHFA 3H7PA 2I2YA 1ZGUB 2W3SA 1LQBA 2JXTA 3B08A 4K1RB 1S3SG 2MEKA 1N60A 2KD0A 1MFWA 1LFDA 3Q3MC 5DPSA 1NBFC 5IAAC 2CJOA 3BZDB 4DQOC 1FPYA 2LGXA 3W5VB 2MJDA 1ZDVA 2X8XX 3BVGA 4DWFA 2A4ZA 3AI5A 1WX7A 2IGHA 4MT5A 2JZZA 2DYMA 1J7CA 3LJ3A 2C7HA 1TKYA 2J0MA 2KWVB 3U7DA 1Q5WB 5CHFA 1TYGB 1NEKB 2M17A 2KVRA 2CJNA 2LMCA 3P42A 1YX5B 4TV3A 5HHDG 2KX3A 1GC6A 2KNBA 4NJ7A 2MRPA 1EUVB 1KOTA 1YN4A 2WXGA 2GRIA 3B2FA 4IOIE 4HRSA 3UINB 3MJ5A 3VXWA 1JQ4A 3MC8A 1WIAA 1E10A 1EWCA 3DBSA 1SSNA 4ZRPA 3ZVVA 2HJ8A 4ZDVA 4XWTA 1B1ZA 1V2YA 3O13A 1HTOA 1A5RA 2IO1B 3I57A 1WX9A 3B0AA 4HDQA 2D11A 3IG3A 4LLGM 1WI0A 4NAWA 1BXTA 3KWVA 1XD3B 4N9F4 3AECB 3R2TA 3VR8B 2K39A 2MQJA 2NMQA 2WYQA 1E6EB 1P98A 4XX5A 2KDFB 3N32A 1I4XA 4RH6A 4NAMA 2LEKA 5HG2A 1TIFA 3A9JB 1V1PA 1TS4A 5AZFA 3L4PA 5LXHA 2KKCA 3JVZX 2WDTB 4BFRA 4J3OD 4IDIA 2WXMA 5JZEB 4DHZB 1QOGA 1D5ZC 2KN5A 5FR3A 2DNFA 2SAKA 1L4DB 2K0PA 2LVOA 5C3JB 2PTLA 2DAJA 2WU5B 4GDKB 3LB8C 1M4VA 5EE9A 4WAFA 1TBEA 1WGRA 2ZPNA 4IG7B 3WAPA 4XE0A 1AYFA 1WE7A 1IPGA 3M62B 5FR6A 3QWZB 1KLVA 2BB5A 2LGYA 2WXLA 1QILA 1XEEA 5E6PA 2JU6X 1KF6B 3Q8AA 2ZNVC 2V4IB 2VZKB 2BVCA 2KMAA 4WIPA 2WNMA 3V6CB 2TSSA 4RM9A 3SD5A 4JQWC 4E74A 1I4HA 3ZXRA 4ANXA 3R7RA 2D5GA 1C9FA 4A9AA 4W9GA 3RNCC 2DX5B 2WXFA 1QF6A 3TEXA 4HDOA 4MGZE 3DHIC 2VH1A 3ZIMA 3P4PB 3Q3OC 1C4AA 2WP9B 2ZZPB 5HKHA 3P2BA 2FNJB 3L0WB 4R3DA 2RSUA 1TZOA 3TEWA 5C2TB 4II2B 2M8SA 2PJHA 4KDLB 2JRHA 1KLUD 2ZPYA 1ET6A 1WGGA 1ZDXA 2GBNA 4NQKE 4NAWB 3ZO5B 4ANUA 2DLBA 3U52E 3W9CB 2AWTA 2KQSA 4P1CC 3CWIA 2QEJC 4K81A 4IW0A 4JE3B 1WJ6A 1IGDA 4MSMB 1WYGA 2KDEB 1ACCA 3PHXB 3A4RA 3Q3JA 4KZ0A 1IBXB 2NTSA 1ROEA 2RD0A 2CU1A 2PPHA 2MJEA 2LZ6A 2O2VB 2QC8A 3AEAB 3S2AA 5T8IA 3TCAA 5EE1A 1HE8A 2IY1B 2H88B 4MEMA 3PS6A 1I35A 3AE3B 3DBRB 1UBIA 2MWSB 2QDFA 3JSVB 1SXTA 1FM0D 2ASQA 2WQYB 2MLBA 5KHQA 3TBLD 1E90A 2JXXA 3ZNGC 2IO3B 4DHZE 1NVID 1YD8U 1GUAB 2RDHA 2KN4A 2DYOA 3B1LX 3ZJTA 2EMTA 2KMMA 3AE8B 2FAZA 2G4SA 3ONSA 3L10B 4BKSD 1ZE3D 2KQ7A 1D5MC 2ACZB 4A3PA 4EUTA 1N63A 3PZDA 1F9JA 1KLGD 2PVGC 1YJ1A 2AL6A 2K22A 2ZEQA 1L7YA 2N9EB 2D2QA 1N61A 4HPPA 3ZDMC 3GS2A 2V4LA 1TS3A 4HJKA 4B6WA 3NHEB 2QHOA 2V3PA 1PQSA 1WGHA 3N20C 5E6JA 2AL3A 5HFYA 4M02A 1R7SA 1VZ8A 3VVWB 2JQRB 4KGSA 1N5WA 2J4XA 1J0GA 1UNSA 2ICIA 4EE2A 4B0MA 1ENFA 3AV8A 1CMXB 3AEDB 4FADA 1T0SC 2KHWB 3DCGA 3Q8FA 2C60A 4YXDB 1L5PA 3AM9A 5AZHA 4X57B 4OVUA 3KUZA 3BY4B 3Q3FA 2PW9A 2LVQA 3N30A 4HVBA 2BQQA 3Q69A 2QCZA 2LGIA 2K25A 3KH0A 2C7NB 4LK0M 1R4NI 4OZAA 4C00A 4AS1A 2KC2A 3IFWB 4HJGE 2N7DA 1MG4A 5G5HA 2OJRA 4BAXA 1VCBA 2W54A 1XT9B 1L0VB 5D94A 4HKQA 2FUG1 3N9YC 2JWUA 1NENB 3HIZA 4AJWA 1SIFA 4KV2A 3V61A 3RMKC 3H7SA 4YTNB 3ZRFA 1C3TA 2UWQA 2K5PA 5DPTA 2KDBA 1J7AA 1RLFA 2KK8A 2KACA 3WA0A 2VH2A 3DQVA 5CHWA 3SHQA 1JMLA 4PK1A 3I9V1 4BOZB 1C77A 3RULA 3RYTA 1WXSA 2XN9C 4USAA 1R4MI 3ETRA 2ZCBA 4ARIA 2MP2B 3VTVA 2ZVNA 3ZLZA 3DBHI 4C4VA 4IM2A 1HEZE 3NVVA 2MHJA 3DWMA 1ET9A 3AEEB 2IPKD 3UI3A 1XLPA 2LRUA 4IUMB 1UBQA 1WR1A 2LWPA 5BMIA 2EMSA 1RWSA 2LGSA 1BT0A 4PS8A 2FCNA 3QA8A 5MPOA 4XGAB 1L6VA 2GOWA 2GBJA 1E8ZA 1PFDA 4CO7A 2RMMA 3SEBA 3RNGC 3W1YA 4ACFA 4RFBA 3A4SC 4FHJA 3M3JA 2LHDA 1X1MA 5BMGA 1SJHD 2DZIA 2N7JA 3APDA 2N4FA 2BYVE 3PLVA 1SE9A 1WMHA 2IGDA 3A9KA 4JL9A 2GMIC 1E0ZA 1WR6E 4KIKA 3MTNB 2J0JA 4GIVA 4IC7B 1C76A 4HK2A 2V3NA 4RF0A 2LUMA 4RM8A 2G9HD 3VRAB 2Z59B 3MFGA 4ZRJA 1HA5A 2IZVB 4AOFA 1ZW7A 4LNKA 1L2NA 3Q8BA 4W9LA 3A1QA 4L23A 2QJLA 3QJZA 4F7ZA 2WXRA 2DAFA 3KYCD 4GXBA 1WF9A 1WZ0A 2GI9A 5D7GA 3AE1B 3EA6A 3NS1A 3DBLI 3L54A 2Y5BB 2W3RA 2WXJA 3ZUNA 5L95C 1F2RC 5AZGA 1SF0A 4GOCA 3RNBC 3PHWB 2NPTB 3UIPB 2I1JA 3ZDTA 3RUIB 2IJ0A 1HXYD 4MGKE 3I3TB 2Y5CA 4GGQA 1I4QA 1SBBB 2GLSA 1AWDA 1JRPA 1YIWA 4WH4A 1NI2A 2QIEB 1WRDB 3L17A 2O6VA 4W9EA 4N6EB 1M94A 2WDQB 3AE6B 2AQ1B 2RDGA 5G55A 2XK5A 3PT2B 4W9HA 3T3NA 2AQ3B 4YSZB 5IP4D 3KW5B 1WJUA 2NBVB 3Q2AC 4C7YA 3C19A 2MBHA 1OQQA 3HHMA 3URYA 1ZOYB 2J42A 4CYEA 2PKOA 4CQNA 3MHZA 1TTNA 3N1ZC 1MI0A 1MHHE 4C56C 4M00A 1J8CA 1WY8A 3P4RB 2L76A 2BGFA 2KJHB 1JWUD 2A5UA 2EELA 2KTFA 2WXOA 5IO9A 5BYSA 3RN9C 2C9WB 1UGJA 3BINA 4DHJD 4II3B 4B95A 1JRUA 2LVPA 3TSSA 5TSSA 1UGMA 4B9KA 3TIXA 4FLHA 4LCDE 1WMHB 1P3QU 4HLEA 3APCA 1G6JA 1TKEA 3FILA 2ON8A 4KIKB 3EGRA 1WZ3A 4I6NB 1MPEA 4HROA 4A8XC 2N0SB 1V49A 2KTRB 3HUIA 1I4PA 2WGSA 5H92C 2CHXA 2Q5WD 5I4DA 3PZ8A 5CTRC 5CX3A 1ZKHA 3K9OB 3A1QB 2INPE 1LGRA 1S1QB 4ZRKA 2JZ3B 3DHHC 4G0NB 3FKYA 4GDLB 2C7MB 4YTMB 1WWTA 1F1HA 1FRRA 1UD7A 4LDTB 3GP7A 4KX6B 5BO4B 1DOIA 4US9A 3H7PB 3N1YC 1FFUA 1P9DU 1YN3A 4TQ0A 2BKRB 4MGIE 3NZ3A 4NJ6A 3P63A 1IYFA 2O6VB 1H8CA 2DZKA 1IP9A 2Y3AA 2M19A 2YVCA 1F77A 1SEBD 4ZOHC 2IYDB 2BS2B 1TKGA 5IOIA 4MDKE 3QARA 2KO3A 3PVLA 2N1WA 1R4NB 4J6IA 3ZJUA 1SIJA 3EFUA 2JYEA 4LNOA 1K50A 5IKCM 2X38A 4L1BA 4ICUA 2L7RA 1YJJA 2ZW1A 2KXJA 2NCNA 2IY0B 4XWWA 4XDCA 4IWQA 2L1AA 5J17A 5JHBA 3ALBA 3MJWA 3TEYA 4NJCA 3IAS1 4GLSC 2JYTA 1FNWA 4WURA 2M0XA 2KT7A 5D2MB 3HM3A 2IBIB 3GZNI 1I4GA 2MCNB 3VAWA 2FCQA 3LYYA 1JALA 2D10A 4OVZA 4QAYA 2LI5A 4OVVA 2NBWB 3X23A 1WE6A 3E56A 3NZUA 3NUHB 1R4MB 1V97A 2EKIA 4FHKA 5IN7A 2DENB 4BBNC 4JWUC 3QX1A 4EZKA 3DBHB 4YTPB 3TMPB 2R61A 3UIOB 4YSXB 1MJDA 4EEWA 1YMHE 1V1OA 1SJED 2CR5A 1TY0A 4EKUA 1OTRB 3KUCB 4WJQA 2L00B 4KZCA 1SGHA 4NQLB 4HKZE 3I5JC 1RRBA 3OJ3A 2I1KA 1YX6B 2PE9A 4G3XB 2WXQA 2EKEC 1CJEA 2YEPF 3TL5A 4ASWC 2MH7A 4NZLB 4BVUC 1STEA 1SE2A 1V1PB 4EZJA 2D3CA 2HDEA 2MW5A 3H9DA 4NNJB 3VRBB 1WGKA 2CHWA 2ZNVB 5FK9C 1WXVA 1NYRA 1TJEA 1YJIA 2E6XA 2KFKA 4MGYE 3RZWC 2MBBB 3AEBB 1MVKA 4MJSA 1EF1A 1UELA 2ZVOA 3N3KB 1QKZA 3GE3C 5J2RA 3IT4B 4REZA 3DPDA 2N7EA 2KLGA 2MSED 4RGOS 2KFJA 3EC8A 3PRPB 3AH7A 3HM6X 2KWCA 1WH3A 2KAJA 1ISNA 3DBLB 2H89B 4WJNA 2NR2A 3KQ4A 1FNUA 3AMZA 1F2RI 2WS3B 3PO0A 1T0YA 1V80A 3VQIA 3U4EG 3ZNID 5GXGB 4K3BA 4YSYB 4FBJB 4HWIB 4MELA 3RCZA 4A90A 1I42A 1GJZA 2UU7A 1EU3A 3NZSA 1JWBD 2K3UA 1I4RA 4W9CA 1GPXA 2KDIA 2Z8LA 5E6OA 2W82A 1K51A 4LJPB 4OHJA 3BVMA 4P16A 1YQ3B 3V62A 3T8MA 3NVZA 4GU2A 1SE4A 2BBCA 3GE8C 3PGEA 3HVZA 4OZCA 2B76B 4US8A 1IGCA 2KWUB 3X0WA 3V05A 4P6VF 4XZ4A 3WAOA 2WX0A 2WXPA 4DDGD 4N58A 5LLIA 4MH8A 1WGYA 3IT6B 5EE3A 3ZRCA 1E9MA 4OW0A 2WWZA 2KJRA 2R2OA 2CHZA 4A55A 3AU4A 1XLNA 3KVFB 2OJWA 2GBKA 3V3XA 1VDVA 2PIAA 3W5UB 3CF6E 2BYFA 1PUTA 2D07B 2JVCA 4JGHB 3QAQA 3DVGX 4MM3A 3ZJVA 2NTTA 3WCQA 3Q8CA 1CQVA 4ZYSA 1RM6C 4MJSB 1HTQA 3VTWA 3ABVB 2WDVB 3FAHA 3EECA 4F1SA 2KOXA 1OEYA 4IWOA 3ZKJC 5C1ZA 1VZ7A 1C1YB 4G50A 3MC9A 4MSQB 1YOVB 2LFIA 1SE3A 4AP4C 2JWZA 2PE6B 3AE9B 5DPRA 2K6QA 1DGJA 2FCMA 1N5XA 2XNAC 4P7IA 2SEBD 1F52A 1P1AA 5HI1A 2MA9B 5AEKB 1E7VA 2VZKD 3JYUA 2BTEA 1TS5A 2AX5A 1YN5A 4PYZA 4IM3A 1KRHA 3QQ8B 1V6EA 2CU3A 4RMAA 3WALA 2N9PC 1Z5SB 3RFZB 3W1SA 1VZ6A 2WHIA 4WAAA 1BUIC 4LTUA 2LASA 2RGFA 3D32A 1FRDA 2G3QB 2KVZA 1AARA 3RZFA 2KZRA 5JXVA 1FCCC 4DXGA 1PDXA 4LNIA 2DWQA 2G45B 2J7QB 1OQYA 4A3OA 3BK2A 2KDMA 3MHSD 4BKSA 2ONQA 1ZPSA 1EWYC 2NBUA 4TSSA 3P4QB 1QT9A 3W1SC 3CIRB 3R2IA 4WQOB 1V8CA 3B2GA 3ZYYX 4IM0A 2FIDA 3VR9B 1OFFA 3MC0B 3BK1A 4GSWA 2INNE 3GZNB 2L8JA 4ZRIA 1GG3A 3EHVA 1NYQA 1XF5L 3BVZA 5CHVC 2L52A 2PLPA 3QC8B 2YEPB 2IO0B 1XXGA 1UF0A 1T0RC 1ZP0B 3NVWA 1YQBA 5EDSA 4W9JA 3C8YA 1ZUD2 2AQ2B 1C79A 2MJ3A 4CHKA 1E8XA 4IWPA 3PSEB 4ZRQA 4BOSC 1OGWA 1WFYA 2HJ1A 2DBYA 4ZYNA 3OAWA 4UDUC 2KMCA 4XDDA 4GB9A 3UGBB 1YQ4B 2N9LA 5EE0A 4YWGG 4S0RA 2HTHA 2BS3B 3RI7C 1YNTE 4A6QA 4KDIC 3ZTDA 1WXAA 2KC1A 1UH6A 4LJOB 1E7PB 5L83A 3SFEB 3R3MA 1HZ5A 4BBNF 4C4VB 3NOBA 1C78A 2WXHA 1L4ZB 4KKJA 4GDKA 3C0RB 1VD2A 4OZBA 4M8MA 2IDYA 2NS5A 1C4PA 2LJIA 2Y5PA 1B9RA 3DOWA 1IUEA 1WJ4A 4FJYA 2HE7A 1MHXA 3Q6BA 4WWPA 2WXNA 1FEHA 3JW0X 2BPSA 1N6ZA 1J7BA 4M0WA 3Q3NC 2JSVX 4HXDA 4H2AA 5BYRA 4B0EA 4FA6A 4RGTA 2ZJDA 3UF8A 4ICVA 5DCNA 1AN8A 2CS4A 3U30A 3A9KB 3APFA 3TUOA 4G11A 2NVUI 2WX1A 4ZHOA 2D3GA 4WWOA 1PYWD 4O1NA 2L32A 3SU8X 5G2NA 2KWDA 2IGGA 2KLCA 2M0AA 1GB4A 3KWLA 2BB6A 4C80A 1TT5B 1XLQA 3W2DA 2WXIA 4HEA1 2AYOB 1VLBA 4XYCA 2RPQA 3SFDB 1Q10A 1WM3A 4LNFA 3VUXA 1FMAD 1LM8B 1D6EC 1JWMD 1QOBA 4BZAA 2OOBB 1A70A 1PGAA 4W9DA 3E9SA 2N9XA 4W9FA 1IBXA 3RPFC 3AULA 2REXA 4DXAB 1H4RA 3B9JA 1WJNA 4PYUA 5TR5A 3VH4B 2BKFA 2CKHB 2XK5B 3WAMA 1KTKA 2ZW0A 5JH5C 2O2VA 2VRRB 2LRWA 3IVFA 4A20A 3V6EB 2W55A 1P0RA 4KVGB 2LXAA 3PREA 4AQ7A 1GC7A 1K8RB 4PS3A 1Z2MA 2JY6A 3HVDA 2PEAA 1E7UA 1J19A 2KANA 3ML8A 3BYTB 3JSVA 3BIID 4F8CB 1F0ZA 3L13A 1WM2A 1PGXA 3EUB2 2ZCCA 4PT5A 4NPNA 1RYJA 3P4SB 1LO5D 1XQQA 4M0WB 5IA7A 3BYYB 4JIOU 1C4CA 2V0GA 4WJOA 3OWEB 1WGDA 2M56B 4DXFA 3AB5A 2UYZB 1V86A 2BWFA 3PV1A 2MBQA 2MBOA 2BT6A 4GMVA 1UWMA 3RNEC 3FILB 3VUWA 1Y8RC 4MACA 1Q1OA 1L6UA 1WSPA 2FE8A 1GOZA 5AUIA 3WANA 2JX5A 3IHPC 2V9HA 2FUHB 2K8BA 1FO4A 1DYQA 3RNAC 1D4BA 1UWXA 3PTFC 3RNFC 1JROA 3U7ZA 2XBBC 1WXQA 2JZPA 1KJTA 1DOXA 3VFKA 2RDBC 4TKNA 3EFCA 1LXDA 1QOAA 3H6NA 2MX2A 1P7FA 1ZXHA 3PRMB 1GB1A 5C23A 1D3ZA 2I38A 4KSKC 1QQRA 4RGNA 3NG0A 5D3IB 3T9LA 2PMVA 2GB1A 3NS8A 3H8HA 3M95A 3LDZE 1VJKA 4AJYB 3UQBA 3NVYA 4ITKA 5AUKA 5LNK1 2AEHA 3ZNZB 3ZGZA 1QOFA 2HD5B 2K9XA 3PZ7A 3AEFB 3VHTC 1WYWB 2R2QA 3QCAA 3A33B 4K7WA 5J18A 1KM7A 1EF5A 1AW7A 5KHOA 1ESFA 3SR6A 3L08A 3OLMD 2RR9A 4DK5A 3N1XC 3VH3B 5G5GA 4HPLB 3DDCB 3I63C 1V81A 3QHTA 3U2SC 2G4DB 2JF5A 3CMMB 2INDC 1DOYA 1RAXA 3ZXVA 1XCQL 1QZEA 4WJPA 1FXAA 2DZJA 1Y56A 3RT3B 1TGZB 1KFYB 2BYEA 4IKGA 4HCPB 2V3SA 4KKIA 3KUDB 2DYBA 1OQRA 2C5LC 2M1MA 2JRIB 3ZNHB 4AUQC 1BMLC 4K3CA 2L3ZA 3KLSX 3NJTA 4D2KA 2WU2B 4ANWA 3H1UA 1FD6A 4URKA 2J0KA 4FULA 3AE5B 4FXCA 2JUOA 1WXMA 1N62A 4EOYA 4XC2A 2GBRA 4WQMA 2K8CA 4JPSA 1VRAB 4K7SA 1JWAD 3FC4A 2QSDA 2V1YA 2Z0DB 1UUPA 2JPHA 4HCNB 1T0QC 3WIMA 2PVOD 2MP2A 2G1EA 2MBEA 1V9JA 1E8YA 1ZXIA 2D3BA 3ENEA 3OJ4B 4RNAA 1FXIA 1TY2A 4DBGA 5DPWA 4E3CA 4DHJB 4YL8A 4ZHPA 1CZPA 4L2YA 1P7EA 2QMTA 3GB1A 2LXCA 4MH0E 3DVNU 3U8ZA 2E3TA 5BYQA 2IO2B 2JT4B 3NRZA 4LNNA 2Z0EB 5D6JB 2LD9A 4RGMA 1L0YB 2W9NA 2BS4B 1T3QA 1OEYJ 4LDTD 2KFKB 1QLBB 3QK0A 2FIFA 1JCKB 2OEDA 3IXSA 3RD2A 4C7ZA 4PS7A 2L05A 4W9KA 1E8WA 4M01A 4YT0B 2O6VD 1NI3A 4WWNA 1XCTL 4TUUA 1T6BX 4N59A 1FCLA 1K52A 5D3DA 3CSFA 3GOEA 5H8YE 3QIJA 4P1BC 3VDZA 3Q8EA 4FJVB 2YLMA 3AEGB 2WDRB 3AE7B 3IAM1 5JHAA 3T3OA 3DVGY 1HQRD 2NPTA 1L0XB 3ZTCA 4S17A 2LHEA 3VTUA 1WRIA 3IBEA 3PRZA 4WWMA 1HZ6A 3LXFA 1K53A 2RPVA 1TS2A 3P1MA 4HPMB 1U4AA 1KH0A 1XO3A 3ML9A 3AN1A 4NY0A 1EM7A 3M63B 2QILA 3DWGC 3DHGC 3AXCA 2WLBA 4RCOA 4ANVA 1UZXB 3K9PB 4JX1C 4BKGA 4EFOA 4JWSC 2KYWA 4I6PA 1JW9D 3J9CA 1V5TA 1CK1A 1XLOA 4K7UA 3V60A 1Q0WB 2FCSA 1SB3C 4TMAB 1D5XC 3UQAA 3AU5A 2XEWA 2DHZA 3BWUD 3ZQ4A 3R66C 4KGTA 2WXKA 2K6DB 2KX0A 2KQ4X 2L83A 1RFKA 2K8HA 3OG5A 3SDLC 2N9KA 2INCC 3MP9A 1JWSD 1I7HA 1EO6A 4TQ1A 1T5XD 1FNVA 1GNUA 5GMVA 4DDID 3HRDD 1FXTB 2BWES 5LXIB 1MG8A 5E6NA 3R8BA 1V5OA 4I6LB 2K1FA 5FKAC 1RFAA 4BKTA 4MM3B 3KYDD 2LJ5A 1EU4A 3ZW3A 3ECIA 4E71A 3L16A 1GAQB 3VUYA 3O65B 3TJPA 3CSTA 2BW2A 4EZLA 1FFVA 1TZ1A 1NDDA 3PLUA 2J53A 1PGBA 1FIQA 2M4NA 2D3AA 4FN2A 3PPAA 3DBRI 3NY5A 1E5WA 3DVNV 2BYTA 2N1VA 4ARCA 5BMHA 4KSLC 2LGDA 2KTRA 2KJ6A 2DZMA 4W9IA 4M8NA 1VR9A 2GBMA 3AE4B 4GN1A 4AWJA 2LUEA 3Q14C 2FBWB 2B3AA 3AE2B 2HTME 2BF8B
chains in the Genus database with same CATH topology
4GDLA 3AULA 2REXA 4DXAB 4MJSA 1H4RA 1EF1A 1UELA 1WJNA 2ZVOA 4PYUA 2L0TA 3HK0A 3N3KB 4JLCA 5TR5A 3VH4B 2BKFA 2CKHB 2XK5B 3WAMA 4FJZA 3HIZA 5JH5C 3R7QA 4AJWA 1SIFA 4KV2A 3V61A 3H7SA 2O2VA 3ZRFA 2VRRB 1C3TA 2L0FA 5J2RA 2UWQA 3A9JA 2LRWA 1WX8A 3H7PA 3IVFA 4A20A 1ZGUB 3V6EB 3DPDA 1LQBA 2N7EA 5DPTA 2KDBA 2KLGA 1RLFA 3B08A 2MSED 4K1RB 1S3SG 2KK8A 1P0RA 3WA0A 2KFJA 3EC8A 3PRPB 2LXAA 3PREA 4KVGB 3DQVA 3HM6X 2KWCA 1WH3A 2KD0A 1GC7A 5CHWA 3SHQA 1K8RB 1ISNA 1LFDA 4PS3A 5DPSA 1NBFC 1Z2MA 2JY6A 4WJNA 5IAAC 4BOZB 2PEAA 3RULA 1J19A 1E7UA 2KANA 3ML8A 3RYTA 2NR2A 3JSVA 1WXSA 4F8CB 2LGXA 3L13A 1WM2A 1R4MI 2ZCBA 4DWFA 2MP2B 2A4ZA 3VTVA 2ZCCA 3AI5A 1WX7A 4NPNA 2ZVNA 3ZLZA 3DBHI 1T0YA 1V80A 2JZZA 3VQIA 1XQQA 2DYMA 4M0WB 5IA7A 4JIOU 3LJ3A 3ZNID 4IM2A 2C7HA 4WJOA 2J0MA 2KWVB 4FBJB 1WGDA 2UYZB 1V86A 2BWFA 4HWIB 4MELA 3RCZA 1I42A 3U7DA 1GJZA 1Q5WB 5CHFA 3NZSA 3PV1A 4W9CA 2MBQA 2MBOA 2M17A 2LRUA 4GMVA 4IUMB 1UBQA 1WR1A 2KDIA 2KVRA 2LWPA 2EMSA 5E6OA 1YX5B 4TV3A 3VUWA 1Y8RC 1BT0A 2KX3A 4LJPB 1Q1OA 1GC6A 2KNBA 4PS8A 2FCNA 3QA8A 4NJ7A 2MRPA 3V62A 2GOWA 3T8MA 4GU2A 3WANA 2GBJA 1E8ZA 1EUVB 4CO7A 1KOTA 3IHPC 3PGEA 2FUHB 3W1YA 2K8BA 3A4SC 4FHJA 2KWUB 3UINB 3X0WA 3M3JA 3VXWA 3PTFC 4XZ4A 3WAOA 2WX0A 2XBBC 4DDGD 1WIAA 5LLIA 1X1MA 3DBSA 1KJTA 2DZIA 1WGYA 3APDA 2N4FA 3ZVVA 2HJ8A 2BYVE 3PLVA 3VFKA 1SE9A 3ZRCA 1WMHA 4ZDVA 3A9KA 2WWZA 4JL9A 2GMIC 2KJRA 4TKNA 2R2OA 2CHZA 1LXDA 3AU4A 3KVFB 1WR6E 4KIKA 3MTNB 2J0JA 3H6NA 1V2YA 4GIVA 2MX2A 4IC7B 1A5RA 2IO1B 2GBKA 3PRMB 5C23A 1D3ZA 4KSKC 4HK2A 3CF6E 2BYFA 2D07B 1WX9A 2JVCA 3B0AA 3QAQA 4HDQA 3DVGX 4JGHB 4RM8A 2D11A 3IG3A 1WI0A 4MM3A 3T9LA 3NS8A 4NAWA 3M95A 2Z59B 3LDZE 4N9F4 1XD3B 2IZVB 4ZRJA 4AOFA 1ZW7A 4AJYB 3UQBA 1L2NA 4W9LA 3A1QA 3QJZA 4F7ZA 2DAFA 3KYCD 2AEHA 2K39A 1WF9A 1WZ0A 4GXBA 4MJSB 2MQJA 3ZNZB 5D7GA 3VTWA 2WYQA 2HD5B 1P98A 3VHTC 1WYWB 2R2QA 3DBLI 3A33B 3EECA 3QCAA 4K7WA 3L54A 4XX5A 2KDFB 4F1SA 3N32A 2Y5BB 2KOXA 1OEYA 4IWOA 3ZKJC 1KM7A 1EF5A 5C1ZA 3ZUNA 5J18A 5L95C 1C1YB 4G50A 5KHOA 5AZGA 3A9JB 4MSQB 4GOCA 5AZFA 3L08A 3PHWB 2NPTB 3OLMD 3UIPB 4AP4C 2RR9A 2KKCA 2I1JA 3JVZX 3VH3B 2WDTB 4BFRA 2JWZA 2PE6B 3ZDTA 4DK5A 3RUIB 4HPLB 4MGKE 3DDCB 3I3TB 5JZEB 4DHZB 4GGQA 3QHTA 1V81A 2KN5A 5DPRA 2G4DB 2JF5A 2K6QA 3CMMB 2FCMA 2LVOA 1RAXA 4P7IA 1YIWA 1NI2A 1QZEA 2DAJA 4GDKB 1WRDB 4WJPA 3L17A 2O6VA 2DZJA 4W9EA 1P1AA 1TBEA 1WGRA 2ZPNA 3RT3B 1M94A 4IG7B 3WAPA 2MA9B 1TGZB 1WE7A 5AEKB 2BYEA 1E7VA 2XK5A 4HCPB 2V3SA 5G55A 3KUDB 2DYBA 3PT2B 1IPGA 3M62B 5FR6A 2C5LC 3JYUA 4W9HA 3QWZB 2M1MA 2JRIB 3ZNHB 4AUQC 1KLVA 2L3ZA 4PYZA 3KW5B 1WJUA 2LGYA 2NBVB 4IM3A 5E6PA 4ANWA 3QQ8B 2ZNVC 3H1UA 1V6EA 2MBHA 4RMAA 3WALA 4URKA 2J0KA 2N9PC 1Z5SB 4FULA 2KMAA 3W1SA 2JUOA 3HHMA 1WXMA 4WAAA 3V6CB 4EOYA 4CYEA 4XC2A 2LASA 2RGFA 3D32A 2G3QB 4RM9A 3SD5A 1TTNA 4JQWC 2GBRA 1AARA 3RZFA 2KZRA 4E74A 2K8CA 4K7SA 1J8CA 1WY8A 5LXHA 2V1YA 2Z0DB 2L76A 2BGFA 3R7RA 4ANXA 2KJHB 2A5UA 2JPHA 4HCNB 2G45B 4W9GA 2KTFA 3WIMA 2DX5B 2J7QB 2MP2A 1OQYA 4A3OA 2C9WB 3BINA 2MBEA 3MHSD 1V9JA 4BKSA 4DHJD 1E8YA 4II3B 4B95A 4HDOA 1JRUA 4MGZE 3ENEA 3OJ4B 2LVPA 2NBUA 1UGMA 4DBGA 5DPWA 3W1SC 3ZIMA 4B9KA 4E3CA 4WQOB 3TIXA 4FLHA 4LCDE 4IM0A 2ZZPB 2FIDA 5HKHA 1WMHB 4DHJB 1P3QU 3P2BA 3APCA 2FNJB 3L0WB 4YL8A 4HLEA 1G6JA 2RSUA 4KIKB 1WZ3A 4I6NB 4II2B 2M8SA 4GSWA 2PJHA 2LXCA 4KDLB 2JRHA 4MH0E 3DVNU 3U8ZA 2ZPYA 1WGGA 1V49A 2KTRB 2L8JA 4ZRIA 1GG3A 2GBNA 4NQKE 3EHVA 2IO2B 2JT4B 4NAWB 3ZO5B 2CHXA 2Z0EB 4ANUA 5D6JB 5CHVC 5CTRC 2AWTA 2LD9A 5CX3A 1ZKHA 2KQSA 4K81A 3K9OB 3A1QB 3QC8B 1WJ6A 4IW0A 2W9NA 4MSMB 2IO0B 1OEYJ 4LDTD 2KFKB 2KDEB 3PHXB 3QK0A 1S1QB 3A4RA 3Q3JA 2FIFA 4KZ0A 4ZRKA 2JZ3B 4G0NB 4GDLB 2C7MB 3RD2A 2RD0A 4PS7A 2L05A 2CU1A 1UD7A 2PPHA 4LDTB 4W9KA 1YQBA 1E8WA 2LZ6A 5EDSA 4W9JA 5BO4B 2O2VB 2O6VD 4WWNA 3H7PB 4CHKA 1E8XA 1P9DU 3S2AA 4IWPA 3PSEB 4BOSC 4TUUA 3TCAA 1OGWA 2BKRB 1WFYA 4MGIE 4TQ0A 1HE8A 4ZYNA 3OAWA 4NJ6A 2IY1B 4MEMA 1IYFA 2KMCA 2O6VB 3PS6A 3CSFA 3GOEA 1H8CA 4GB9A 3UGBB 2DZKA 1I35A 3QIJA 1IP9A 1UBIA 3VDZA 2YVCA 2MWSB 4FJVB 2YLMA 3JSVB 2HTHA 2IYDB 2ASQA 4KDIC 5JHAA 3DVGY 3ZTDA 1WXAA 2MLBA 4MDKE 3QARA 2KO3A 5KHQA 2KC1A 2NPTA 3TBLD 1E90A 3PVLA 1UH6A 3ZTCA 2N1WA 4LJOB 3VTUA 5L83A 2JXXA 3IBEA 3PRZA 3ZNGC 3R3MA 2IO3B 4J6IA 4BBNF 4DHZE 3EFUA 1YD8U 3NOBA 4HPMB 1GUAB 1U4AA 2DYOA 4GDKA 3B1LX 3C0RB 4ICUA 2L7RA 1VD2A 3ML9A 2EMTA 4M8MA 2KXJA 2NCNA 2IY0B 2FAZA 2G4SA 3ONSA 4NY0A 3L10B 4BKSD 4IWQA 3M63B 5J17A 5JHBA 2KQ7A 3ALBA 3MJWA 3AXCA 2NS5A 4A3PA 4EUTA 3PZDA 1F9JA 1UZXB 3K9PB 3DOWA 4ANVA 4BKGA 4EFOA 1WJ4A 2M0XA 4I6PA 4FJYA 2HE7A 4WWPA 1YJ1A 1V5TA 2AL6A 2ZEQA 5D2MB 3JW0X 1L7YA 2N9EB 2BPSA 3HM3A 4K7UA 2D2QA 3V60A 2IBIB 1Q0WB 2FCSA 3GZNI 2MCNB 3UQAA 3AU5A 4HXDA 2XEWA 2DHZA 3VAWA 3ZDMC 2V4LA 3R66C 2FCQA 2K6DB 2D10A 4HJKA 2KX0A 2LI5A 4B6WA 4FA6A 4OVVA 3NHEB 2NBWB 2QHOA 3X23A 2ZJDA 2K8HA 3UF8A 3SDLC 1PQSA 1WGHA 4ICVA 5DCNA 1WE6A 2AL3A 3NZUA 2CS4A 3U30A 3A9KB 3VVWB 1EO6A 3APFA 4TQ1A 1GNUA 5GMVA 4FHKA 4G11A 2DENB 4BBNC 2NVUI 3QX1A 2WX1A 4DDID 4EZKA 1J0GA 3TMPB 3UIOB 1FXTB 2BWES 2D3GA 5LXIB 1MG8A 4EEWA 5E6NA 4WWOA 1CMXB 1V5OA 2K1FA 4I6LB 1RFAA 4BKTA 4FADA 3KYDD 2LJ5A 2CR5A 3ZW3A 3ECIA 4E71A 3L16A 3SU8X 4EKUA 2KHWB 1OTRB 3DCGA 5G2NA 2C60A 3KUCB 3VUYA 3O65B 4WJQA 3TJPA 2L00B 3CSTA 1SGHA 2KLCA 4KZCA 4NQLB 4EZLA 5AZHA 1TZ1A 1NDDA 1RRBA 3PLUA 3OJ3A 2I1KA 1YX6B 2AYOB 4X57B 2PE9A 4OVUA 4G3XB 2M4NA 2EKEC 3KUZA 4FN2A 3TL5A 3BY4B 2RPQA 3PPAA 3DBRI 3NY5A 1E5WA 4ASWC 3DVNV 2N1VA 1WM3A 4BVUC 3Q3FA 3VUXA 4KSLC 2LGDA 4EZJA 2KTRA 2LVQA 3N30A 4HVBA 2KJ6A 2MW5A 2DZMA 3H9DA 4NNJB 4W9IA 4M8NA 2CHWA 2ZNVB 2GBMA 2K25A 3KH0A 1WXVA 2C7NB 1LM8B 1R4NI 2KC2A 4GN1A 4AWJA 3IFWB 2N7DA 2LUEA 2OJRA 1VCBA 2OOBB 2KFKA 2B3AA 1XT9B 4MGYE 2MBBB 4W9DA 5D94A 3RZWC 2N9XA 4W9FA 2BF8B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GDL A;  3AUL A;  2REX A;  4DXA B;  4MJS A;  1H4R A;  1EF1 A;  1UEL A;  1WJN A;  2ZVO A;  4PYU A;  2L0T A;  3HK0 A;  3N3K B;  4JLC A;  5TR5 A;  3VH4 B;  2BKF A;  2CKH B;  2XK5 B;  3WAM A;  4FJZ A;  3HIZ A;  5JH5 C;  3R7Q A;  4AJW A;  1SIF A;  4KV2 A;  3V61 A;  3H7S A;  2O2V A;  3ZRF A;  2VRR B;  1C3T A;  2L0F A;  5J2R A;  2UWQ A;  3A9J A;  2LRW A;  1WX8 A;  3H7P A;  3IVF A;  4A20 A;  1ZGU B;  3V6E B;  3DPD A;  1LQB A;  2N7E A;  5DPT A;  2KDB A;  2KLG A;  1RLF A;  3B08 A;  2MSE D;  4K1R B;  1S3S G;  2KK8 A;  1P0R A;  3WA0 A;  2KFJ A;  3EC8 A;  3PRP B;  2LXA A;  3PRE A;  4KVG B;  3DQV A;  3HM6 X;  2KWC A;  1WH3 A;  2KD0 A;  1GC7 A;  5CHW A;  3SHQ A;  1K8R B;  1ISN A;  1LFD A;  4PS3 A;  5DPS A;  1NBF C;  1Z2M A;  2JY6 A;  4WJN A;  5IAA C;  4BOZ B;  2PEA A;  3RUL A;  1J19 A;  1E7U A;  2KAN A;  3ML8 A;  3RYT A;  2NR2 A;  3JSV A;  1WXS A;  4F8C B;  2LGX A;  3L13 A;  1WM2 A;  1R4M I;  2ZCB A;  4DWF A;  2MP2 B;  2A4Z A;  3VTV A;  2ZCC A;  3AI5 A;  1WX7 A;  4NPN A;  2ZVN A;  3ZLZ A;  3DBH I;  1T0Y A;  1V80 A;  2JZZ A;  3VQI A;  1XQQ A;  2DYM A;  4M0W B;  5IA7 A;  4JIO U;  3LJ3 A;  3ZNI D;  4IM2 A;  2C7H A;  4WJO A;  2J0M A;  2KWV B;  4FBJ B;  1WGD A;  2UYZ B;  1V86 A;  2BWF A;  4HWI B;  4MEL A;  3RCZ A;  1I42 A;  3U7D A;  1GJZ A;  1Q5W B;  5CHF A;  3NZS A;  3PV1 A;  4W9C A;  2MBQ A;  2MBO A;  2M17 A;  2LRU A;  4GMV A;  4IUM B;  1UBQ A;  1WR1 A;  2KDI A;  2KVR A;  2LWP A;  2EMS A;  5E6O A;  1YX5 B;  4TV3 A;  3VUW A;  1Y8R C;  1BT0 A;  2KX3 A;  4LJP B;  1Q1O A;  1GC6 A;  2KNB A;  4PS8 A;  2FCN A;  3QA8 A;  4NJ7 A;  2MRP A;  3V62 A;  2GOW A;  3T8M A;  4GU2 A;  3WAN A;  2GBJ A;  1E8Z A;  1EUV B;  4CO7 A;  1KOT A;  3IHP C;  3PGE A;  2FUH B;  3W1Y A;  2K8B A;  3A4S C;  4FHJ A;  2KWU B;  3UIN B;  3X0W A;  3M3J A;  3VXW A;  3PTF C;  4XZ4 A;  3WAO A;  2WX0 A;  2XBB C;  4DDG D;  1WIA A;  5LLI A;  1X1M A;  3DBS A;  1KJT A;  2DZI A;  1WGY A;  3APD A;  2N4F A;  3ZVV A;  2HJ8 A;  2BYV E;  3PLV A;  3VFK A;  1SE9 A;  3ZRC A;  1WMH A;  4ZDV A;  3A9K A;  2WWZ A;  4JL9 A;  2GMI C;  2KJR A;  4TKN A;  2R2O A;  2CHZ A;  1LXD A;  3AU4 A;  3KVF B;  1WR6 E;  4KIK A;  3MTN B;  2J0J A;  3H6N A;  1V2Y A;  4GIV A;  2MX2 A;  4IC7 B;  1A5R A;  2IO1 B;  2GBK A;  3PRM B;  5C23 A;  1D3Z A;  4KSK C;  4HK2 A;  3CF6 E;  2BYF A;  2D07 B;  1WX9 A;  2JVC A;  3B0A A;  3QAQ A;  4HDQ A;  3DVG X;  4JGH B;  4RM8 A;  2D11 A;  3IG3 A;  1WI0 A;  4MM3 A;  3T9L A;  3NS8 A;  4NAW A;  3M95 A;  2Z59 B;  3LDZ E;  4N9F 4;  1XD3 B;  2IZV B;  4ZRJ A;  4AOF A;  1ZW7 A;  4AJY B;  3UQB A;  1L2N A;  4W9L A;  3A1Q A;  3QJZ A;  4F7Z A;  2DAF A;  3KYC D;  2AEH A;  2K39 A;  1WF9 A;  1WZ0 A;  4GXB A;  4MJS B;  2MQJ A;  3ZNZ B;  5D7G A;  3VTW A;  2WYQ A;  2HD5 B;  1P98 A;  3VHT C;  1WYW B;  2R2Q A;  3DBL I;  3A33 B;  3EEC A;  3QCA A;  4K7W A;  3L54 A;  4XX5 A;  2KDF B;  4F1S A;  3N32 A;  2Y5B B;  2KOX A;  1OEY A;  4IWO A;  3ZKJ C;  1KM7 A;  1EF5 A;  5C1Z A;  3ZUN A;  5J18 A;  5L95 C;  1C1Y B;  4G50 A;  5KHO A;  5AZG A;  3A9J B;  4MSQ B;  4GOC A;  5AZF A;  3L08 A;  3PHW B;  2NPT B;  3OLM D;  3UIP B;  4AP4 C;  2RR9 A;  2KKC A;  2I1J A;  3JVZ X;  3VH3 B;  2WDT B;  4BFR A;  2JWZ A;  2PE6 B;  3ZDT A;  4DK5 A;  3RUI B;  4HPL B;  4MGK E;  3DDC B;  3I3T B;  5JZE B;  4DHZ B;  4GGQ A;  3QHT A;  1V81 A;  2KN5 A;  5DPR A;  2G4D B;  2JF5 A;  2K6Q A;  3CMM B;  2FCM A;  2LVO A;  1RAX A;  4P7I A;  1YIW A;  1NI2 A;  1QZE A;  2DAJ A;  4GDK B;  1WRD B;  4WJP A;  3L17 A;  2O6V A;  2DZJ A;  4W9E A;  1P1A A;  1TBE A;  1WGR A;  2ZPN A;  3RT3 B;  1M94 A;  4IG7 B;  3WAP A;  2MA9 B;  1TGZ B;  1WE7 A;  5AEK B;  2BYE A;  1E7V A;  2XK5 A;  4HCP B;  2V3S A;  5G55 A;  3KUD B;  2DYB A;  3PT2 B;  1IPG A;  3M62 B;  5FR6 A;  2C5L C;  3JYU A;  4W9H A;  3QWZ B;  2M1M A;  2JRI B;  3ZNH B;  4AUQ C;  1KLV A;  2L3Z A;  4PYZ A;  3KW5 B;  1WJU A;  2LGY A;  2NBV B;  4IM3 A;  5E6P A;  4ANW A;  3QQ8 B;  2ZNV C;  3H1U A;  1V6E A;  2MBH A;  4RMA A;  3WAL A;  4URK A;  2J0K A;  2N9P C;  1Z5S B;  4FUL A;  2KMA A;  3W1S A;  2JUO A;  3HHM A;  1WXM A;  4WAA A;  3V6C B;  4EOY A;  4CYE A;  4XC2 A;  2LAS A;  2RGF A;  3D32 A;  2G3Q B;  4RM9 A;  3SD5 A;  1TTN A;  4JQW C;  2GBR A;  1AAR A;  3RZF A;  2KZR A;  4E74 A;  2K8C A;  4K7S A;  1J8C A;  1WY8 A;  5LXH A;  2V1Y A;  2Z0D B;  2L76 A;  2BGF A;  3R7R A;  4ANX A;  2KJH B;  2A5U A;  2JPH A;  4HCN B;  2G45 B;  4W9G A;  2KTF A;  3WIM A;  2DX5 B;  2J7Q B;  2MP2 A;  1OQY A;  4A3O A;  2C9W B;  3BIN A;  2MBE A;  3MHS D;  1V9J A;  4BKS A;  4DHJ D;  1E8Y A;  4II3 B;  4B95 A;  4HDO A;  1JRU A;  4MGZ E;  3ENE A;  3OJ4 B;  2LVP A;  2NBU A;  1UGM A;  4DBG A;  5DPW A;  3W1S C;  3ZIM A;  4B9K A;  4E3C A;  4WQO B;  3TIX A;  4FLH A;  4LCD E;  4IM0 A;  2ZZP B;  2FID A;  5HKH A;  1WMH B;  4DHJ B;  1P3Q U;  3P2B A;  3APC A;  2FNJ B;  3L0W B;  4YL8 A;  4HLE A;  1G6J A;  2RSU A;  4KIK B;  1WZ3 A;  4I6N B;  4II2 B;  2M8S A;  4GSW A;  2PJH A;  2LXC A;  4KDL B;  2JRH A;  4MH0 E;  3DVN U;  3U8Z A;  2ZPY A;  1WGG A;  1V49 A;  2KTR B;  2L8J A;  4ZRI A;  1GG3 A;  2GBN A;  4NQK E;  3EHV A;  2IO2 B;  2JT4 B;  4NAW B;  3ZO5 B;  2CHX A;  2Z0E B;  4ANU A;  5D6J B;  5CHV C;  5CTR C;  2AWT A;  2LD9 A;  5CX3 A;  1ZKH A;  2KQS A;  4K81 A;  3K9O B;  3A1Q B;  3QC8 B;  1WJ6 A;  4IW0 A;  2W9N A;  4MSM B;  2IO0 B;  1OEY J;  4LDT D;  2KFK B;  2KDE B;  3PHX B;  3QK0 A;  1S1Q B;  3A4R A;  3Q3J A;  2FIF A;  4KZ0 A;  4ZRK A;  2JZ3 B;  4G0N B;  4GDL B;  2C7M B;  3RD2 A;  2RD0 A;  4PS7 A;  2L05 A;  2CU1 A;  1UD7 A;  2PPH A;  4LDT B;  4W9K A;  1YQB A;  1E8W A;  2LZ6 A;  5EDS A;  4W9J A;  5BO4 B;  2O2V B;  2O6V D;  4WWN A;  3H7P B;  4CHK A;  1E8X A;  1P9D U;  3S2A A;  4IWP A;  3PSE B;  4BOS C;  4TUU A;  3TCA A;  1OGW A;  2BKR B;  1WFY A;  4MGI E;  4TQ0 A;  1HE8 A;  4ZYN A;  3OAW A;  4NJ6 A;  2IY1 B;  4MEM A;  1IYF A;  2KMC A;  2O6V B;  3PS6 A;  3CSF A;  3GOE A;  1H8C A;  4GB9 A;  3UGB B;  2DZK A;  1I35 A;  3QIJ A;  1IP9 A;  1UBI A;  3VDZ A;  2YVC A;  2MWS B;  4FJV B;  2YLM A;  3JSV B;  2HTH A;  2IYD B;  2ASQ A;  4KDI C;  5JHA A;  3DVG Y;  3ZTD A;  1WXA A;  2MLB A;  4MDK E;  3QAR A;  2KO3 A;  5KHQ A;  2KC1 A;  2NPT A;  3TBL D;  1E90 A;  3PVL A;  1UH6 A;  3ZTC A;  2N1W A;  4LJO B;  3VTU A;  5L83 A;  2JXX A;  3IBE A;  3PRZ A;  3ZNG C;  3R3M A;  2IO3 B;  4J6I A;  4BBN F;  4DHZ E;  3EFU A;  1YD8 U;  3NOB A;  4HPM B;  1GUA B;  1U4A A;  2DYO A;  4GDK A;  3B1L X;  3C0R B;  4ICU A;  2L7R A;  1VD2 A;  3ML9 A;  2EMT A;  4M8M A;  2KXJ A;  2NCN A;  2IY0 B;  2FAZ A;  2G4S A;  3ONS A;  4NY0 A;  3L10 B;  4BKS D;  4IWQ A;  3M63 B;  5J17 A;  5JHB A;  2KQ7 A;  3ALB A;  3MJW A;  3AXC A;  2NS5 A;  4A3P A;  4EUT A;  3PZD A;  1F9J A;  1UZX B;  3K9P B;  3DOW A;  4ANV A;  4BKG A;  4EFO A;  1WJ4 A;  2M0X A;  4I6P A;  4FJY A;  2HE7 A;  4WWP A;  1YJ1 A;  1V5T A;  2AL6 A;  2ZEQ A;  5D2M B;  3JW0 X;  1L7Y A;  2N9E B;  2BPS A;  3HM3 A;  4K7U A;  2D2Q A;  3V60 A;  2IBI B;  1Q0W B;  2FCS A;  3GZN I;  2MCN B;  3UQA A;  3AU5 A;  4HXD A;  2XEW A;  2DHZ A;  3VAW A;  3ZDM C;  2V4L A;  3R66 C;  2FCQ A;  2K6D B;  2D10 A;  4HJK A;  2KX0 A;  2LI5 A;  4B6W A;  4FA6 A;  4OVV A;  3NHE B;  2NBW B;  2QHO A;  3X23 A;  2ZJD A;  2K8H A;  3UF8 A;  3SDL C;  1PQS A;  1WGH A;  4ICV A;  5DCN A;  1WE6 A;  2AL3 A;  3NZU A;  2CS4 A;  3U30 A;  3A9K B;  3VVW B;  1EO6 A;  3APF A;  4TQ1 A;  1GNU A;  5GMV A;  4FHK A;  4G11 A;  2DEN B;  4BBN C;  2NVU I;  3QX1 A;  2WX1 A;  4DDI D;  4EZK A;  1J0G A;  3TMP B;  3UIO B;  1FXT B;  2BWE S;  2D3G A;  5LXI B;  1MG8 A;  4EEW A;  5E6N A;  4WWO A;  1CMX B;  1V5O A;  2K1F A;  4I6L B;  1RFA A;  4BKT A;  4FAD A;  3KYD D;  2LJ5 A;  2CR5 A;  3ZW3 A;  3ECI A;  4E71 A;  3L16 A;  3SU8 X;  4EKU A;  2KHW B;  1OTR B;  3DCG A;  5G2N A;  2C60 A;  3KUC B;  3VUY A;  3O65 B;  4WJQ A;  3TJP A;  2L00 B;  3CST A;  1SGH A;  2KLC A;  4KZC A;  4NQL B;  4EZL A;  5AZH A;  1TZ1 A;  1NDD A;  1RRB A;  3PLU A;  3OJ3 A;  2I1K A;  1YX6 B;  2AYO B;  4X57 B;  2PE9 A;  4OVU A;  4G3X B;  2M4N A;  2EKE C;  3KUZ A;  4FN2 A;  3TL5 A;  3BY4 B;  2RPQ A;  3PPA A;  3DBR I;  3NY5 A;  1E5W A;  4ASW C;  3DVN V;  2N1V A;  1WM3 A;  4BVU C;  3Q3F A;  3VUX A;  4KSL C;  2LGD A;  4EZJ A;  2KTR A;  2LVQ A;  3N30 A;  4HVB A;  2KJ6 A;  2MW5 A;  2DZM A;  3H9D A;  4NNJ B;  4W9I A;  4M8N A;  2CHW A;  2ZNV B;  2GBM A;  2K25 A;  3KH0 A;  1WXV A;  2C7N B;  1LM8 B;  1R4N I;  2KC2 A;  4GN1 A;  4AWJ A;  3IFW B;  2N7D A;  2LUE A;  2OJR A;  1VCB A;  2OOB B;  2KFK A;  2B3A A;  1XT9 B;  4MGY E;  2MBB B;  4W9D A;  5D94 A;  3RZW C;  2N9X A;  4W9F A;  2BF8 B; 
#chains in the Genus database with same CATH topology
 4GDL A;  4RF1 A;  3TEZ A;  2L0T A;  3HK0 A;  4JLC A;  2J52 A;  4Q2J A;  4FJZ A;  3R7Q A;  4KGR A;  2L0F A;  3A9J A;  1WX8 A;  2OHF A;  3H7P A;  2I2Y A;  1ZGU B;  2W3S A;  1LQB A;  2JXT A;  3B08 A;  4K1R B;  1S3S G;  2MEK A;  1N60 A;  2KD0 A;  1MFW A;  1LFD A;  3Q3M C;  5DPS A;  1NBF C;  5IAA C;  2CJO A;  3BZD B;  4DQO C;  1FPY A;  2LGX A;  3W5V B;  2MJD A;  1ZDV A;  2X8X X;  3BVG A;  4DWF A;  2A4Z A;  3AI5 A;  1WX7 A;  2IGH A;  4MT5 A;  2JZZ A;  2DYM A;  1J7C A;  3LJ3 A;  2C7H A;  1TKY A;  2J0M A;  2KWV B;  3U7D A;  1Q5W B;  5CHF A;  1TYG B;  1NEK B;  2M17 A;  2KVR A;  2CJN A;  2LMC A;  3P42 A;  1YX5 B;  4TV3 A;  5HHD G;  2KX3 A;  1GC6 A;  2KNB A;  4NJ7 A;  2MRP A;  1EUV B;  1KOT A;  1YN4 A;  2WXG A;  2GRI A;  3B2F A;  4IOI E;  4HRS A;  3UIN B;  3MJ5 A;  3VXW A;  1JQ4 A;  3MC8 A;  1WIA A;  1E10 A;  1EWC A;  3DBS A;  1SSN A;  4ZRP A;  3ZVV A;  2HJ8 A;  4ZDV A;  4XWT A;  1B1Z A;  1V2Y A;  3O13 A;  1HTO A;  1A5R A;  2IO1 B;  3I57 A;  1WX9 A;  3B0A A;  4HDQ A;  2D11 A;  3IG3 A;  4LLG M;  1WI0 A;  4NAW A;  1BXT A;  3KWV A;  1XD3 B;  4N9F 4;  3AEC B;  3R2T A;  3VR8 B;  2K39 A;  2MQJ A;  2NMQ A;  2WYQ A;  1E6E B;  1P98 A;  4XX5 A;  2KDF B;  3N32 A;  1I4X A;  4RH6 A;  4NAM A;  2LEK A;  5HG2 A;  1TIF A;  3A9J B;  1V1P A;  1TS4 A;  5AZF A;  3L4P A;  5LXH A;  2KKC A;  3JVZ X;  2WDT B;  4BFR A;  4J3O D;  4IDI A;  2WXM A;  5JZE B;  4DHZ B;  1QOG A;  1D5Z C;  2KN5 A;  5FR3 A;  2DNF A;  2SAK A;  1L4D B;  2K0P A;  2LVO A;  5C3J B;  2PTL A;  2DAJ A;  2WU5 B;  4GDK B;  3LB8 C;  1M4V A;  5EE9 A;  4WAF A;  1TBE A;  1WGR A;  2ZPN A;  4IG7 B;  3WAP A;  4XE0 A;  1AYF A;  1WE7 A;  1IPG A;  3M62 B;  5FR6 A;  3QWZ B;  1KLV A;  2BB5 A;  2LGY A;  2WXL A;  1QIL A;  1XEE A;  5E6P A;  2JU6 X;  1KF6 B;  3Q8A A;  2ZNV C;  2V4I B;  2VZK B;  2BVC A;  2KMA A;  4WIP A;  2WNM A;  3V6C B;  2TSS A;  4RM9 A;  3SD5 A;  4JQW C;  4E74 A;  1I4H A;  3ZXR A;  4ANX A;  3R7R A;  2D5G A;  1C9F A;  4A9A A;  4W9G A;  3RNC C;  2DX5 B;  2WXF A;  1QF6 A;  3TEX A;  4HDO A;  4MGZ E;  3DHI C;  2VH1 A;  3ZIM A;  3P4P B;  3Q3O C;  1C4A A;  2WP9 B;  2ZZP B;  5HKH A;  3P2B A;  2FNJ B;  3L0W B;  4R3D A;  2RSU A;  1TZO A;  3TEW A;  5C2T B;  4II2 B;  2M8S A;  2PJH A;  4KDL B;  2JRH A;  1KLU D;  2ZPY A;  1ET6 A;  1WGG A;  1ZDX A;  2GBN A;  4NQK E;  4NAW B;  3ZO5 B;  4ANU A;  2DLB A;  3U52 E;  3W9C B;  2AWT A;  2KQS A;  4P1C C;  3CWI A;  2QEJ C;  4K81 A;  4IW0 A;  4JE3 B;  1WJ6 A;  1IGD A;  4MSM B;  1WYG A;  2KDE B;  1ACC A;  3PHX B;  3A4R A;  3Q3J A;  4KZ0 A;  1IBX B;  2NTS A;  1ROE A;  2RD0 A;  2CU1 A;  2PPH A;  2MJE A;  2LZ6 A;  2O2V B;  2QC8 A;  3AEA B;  3S2A A;  5T8I A;  3TCA A;  5EE1 A;  1HE8 A;  2IY1 B;  2H88 B;  4MEM A;  3PS6 A;  1I35 A;  3AE3 B;  3DBR B;  1UBI A;  2MWS B;  2QDF A;  3JSV B;  1SXT A;  1FM0 D;  2ASQ A;  2WQY B;  2MLB A;  5KHQ A;  3TBL D;  1E90 A;  2JXX A;  3ZNG C;  2IO3 B;  4DHZ E;  1NVI D;  1YD8 U;  1GUA B;  2RDH A;  2KN4 A;  2DYO A;  3B1L X;  3ZJT A;  2EMT A;  2KMM A;  3AE8 B;  2FAZ A;  2G4S A;  3ONS A;  3L10 B;  4BKS D;  1ZE3 D;  2KQ7 A;  1D5M C;  2ACZ B;  4A3P A;  4EUT A;  1N63 A;  3PZD A;  1F9J A;  1KLG D;  2PVG C;  1YJ1 A;  2AL6 A;  2K22 A;  2ZEQ A;  1L7Y A;  2N9E B;  2D2Q A;  1N61 A;  4HPP A;  3ZDM C;  3GS2 A;  2V4L A;  1TS3 A;  4HJK A;  4B6W A;  3NHE B;  2QHO A;  2V3P A;  1PQS A;  1WGH A;  3N20 C;  5E6J A;  2AL3 A;  5HFY A;  4M02 A;  1R7S A;  1VZ8 A;  3VVW B;  2JQR B;  4KGS A;  1N5W A;  2J4X A;  1J0G A;  1UNS A;  2ICI A;  4EE2 A;  4B0M A;  1ENF A;  3AV8 A;  1CMX B;  3AED B;  4FAD A;  1T0S C;  2KHW B;  3DCG A;  3Q8F A;  2C60 A;  4YXD B;  1L5P A;  3AM9 A;  5AZH A;  4X57 B;  4OVU A;  3KUZ A;  3BY4 B;  3Q3F A;  2PW9 A;  2LVQ A;  3N30 A;  4HVB A;  2BQQ A;  3Q69 A;  2QCZ A;  2LGI A;  2K25 A;  3KH0 A;  2C7N B;  4LK0 M;  1R4N I;  4OZA A;  4C00 A;  4AS1 A;  2KC2 A;  3IFW B;  4HJG E;  2N7D A;  1MG4 A;  5G5H A;  2OJR A;  4BAX A;  1VCB A;  2W54 A;  1XT9 B;  1L0V B;  5D94 A;  4HKQ A;  2FUG 1;  3N9Y C;  2JWU A;  1NEN B;  3HIZ A;  4AJW A;  1SIF A;  4KV2 A;  3V61 A;  3RMK C;  3H7S A;  4YTN B;  3ZRF A;  1C3T A;  2UWQ A;  2K5P A;  5DPT A;  2KDB A;  1J7A A;  1RLF A;  2KK8 A;  2KAC A;  3WA0 A;  2VH2 A;  3DQV A;  5CHW A;  3SHQ A;  1JML A;  4PK1 A;  3I9V 1;  4BOZ B;  1C77 A;  3RUL A;  3RYT A;  1WXS A;  2XN9 C;  4USA A;  1R4M I;  3ETR A;  2ZCB A;  4ARI A;  2MP2 B;  3VTV A;  2ZVN A;  3ZLZ A;  3DBH I;  4C4V A;  4IM2 A;  1HEZ E;  3NVV A;  2MHJ A;  3DWM A;  1ET9 A;  3AEE B;  2IPK D;  3UI3 A;  1XLP A;  2LRU A;  4IUM B;  1UBQ A;  1WR1 A;  2LWP A;  5BMI A;  2EMS A;  1RWS A;  2LGS A;  1BT0 A;  4PS8 A;  2FCN A;  3QA8 A;  5MPO A;  4XGA B;  1L6V A;  2GOW A;  2GBJ A;  1E8Z A;  1PFD A;  4CO7 A;  2RMM A;  3SEB A;  3RNG C;  3W1Y A;  4ACF A;  4RFB A;  3A4S C;  4FHJ A;  3M3J A;  2LHD A;  1X1M A;  5BMG A;  1SJH D;  2DZI A;  2N7J A;  3APD A;  2N4F A;  2BYV E;  3PLV A;  1SE9 A;  1WMH A;  2IGD A;  3A9K A;  4JL9 A;  2GMI C;  1E0Z A;  1WR6 E;  4KIK A;  3MTN B;  2J0J A;  4GIV A;  4IC7 B;  1C76 A;  4HK2 A;  2V3N A;  4RF0 A;  2LUM A;  4RM8 A;  2G9H D;  3VRA B;  2Z59 B;  3MFG A;  4ZRJ A;  1HA5 A;  2IZV B;  4AOF A;  1ZW7 A;  4LNK A;  1L2N A;  3Q8B A;  4W9L A;  3A1Q A;  4L23 A;  2QJL A;  3QJZ A;  4F7Z A;  2WXR A;  2DAF A;  3KYC D;  4GXB A;  1WF9 A;  1WZ0 A;  2GI9 A;  5D7G A;  3AE1 B;  3EA6 A;  3NS1 A;  3DBL I;  3L54 A;  2Y5B B;  2W3R A;  2WXJ A;  3ZUN A;  5L95 C;  1F2R C;  5AZG A;  1SF0 A;  4GOC A;  3RNB C;  3PHW B;  2NPT B;  3UIP B;  2I1J A;  3ZDT A;  3RUI B;  2IJ0 A;  1HXY D;  4MGK E;  3I3T B;  2Y5C A;  4GGQ A;  1I4Q A;  1SBB B;  2GLS A;  1AWD A;  1JRP A;  1YIW A;  4WH4 A;  1NI2 A;  2QIE B;  1WRD B;  3L17 A;  2O6V A;  4W9E A;  4N6E B;  1M94 A;  2WDQ B;  3AE6 B;  2AQ1 B;  2RDG A;  5G55 A;  2XK5 A;  3PT2 B;  4W9H A;  3T3N A;  2AQ3 B;  4YSZ B;  5IP4 D;  3KW5 B;  1WJU A;  2NBV B;  3Q2A C;  4C7Y A;  3C19 A;  2MBH A;  1OQQ A;  3HHM A;  3URY A;  1ZOY B;  2J42 A;  4CYE A;  2PKO A;  4CQN A;  3MHZ A;  1TTN A;  3N1Z C;  1MI0 A;  1MHH E;  4C56 C;  4M00 A;  1J8C A;  1WY8 A;  3P4R B;  2L76 A;  2BGF A;  2KJH B;  1JWU D;  2A5U A;  2EEL A;  2KTF A;  2WXO A;  5IO9 A;  5BYS A;  3RN9 C;  2C9W B;  1UGJ A;  3BIN A;  4DHJ D;  4II3 B;  4B95 A;  1JRU A;  2LVP A;  3TSS A;  5TSS A;  1UGM A;  4B9K A;  3TIX A;  4FLH A;  4LCD E;  1WMH B;  1P3Q U;  4HLE A;  3APC A;  1G6J A;  1TKE A;  3FIL A;  2ON8 A;  4KIK B;  3EGR A;  1WZ3 A;  4I6N B;  1MPE A;  4HRO A;  4A8X C;  2N0S B;  1V49 A;  2KTR B;  3HUI A;  1I4P A;  2WGS A;  5H92 C;  2CHX A;  2Q5W D;  5I4D A;  3PZ8 A;  5CTR C;  5CX3 A;  1ZKH A;  3K9O B;  3A1Q B;  2INP E;  1LGR A;  1S1Q B;  4ZRK A;  2JZ3 B;  3DHH C;  4G0N B;  3FKY A;  4GDL B;  2C7M B;  4YTM B;  1WWT A;  1F1H A;  1FRR A;  1UD7 A;  4LDT B;  3GP7 A;  4KX6 B;  5BO4 B;  1DOI A;  4US9 A;  3H7P B;  3N1Y C;  1FFU A;  1P9D U;  1YN3 A;  4TQ0 A;  2BKR B;  4MGI E;  3NZ3 A;  4NJ6 A;  3P63 A;  1IYF A;  2O6V B;  1H8C A;  2DZK A;  1IP9 A;  2Y3A A;  2M19 A;  2YVC A;  1F77 A;  1SEB D;  4ZOH C;  2IYD B;  2BS2 B;  1TKG A;  5IOI A;  4MDK E;  3QAR A;  2KO3 A;  3PVL A;  2N1W A;  1R4N B;  4J6I A;  3ZJU A;  1SIJ A;  3EFU A;  2JYE A;  4LNO A;  1K50 A;  5IKC M;  2X38 A;  4L1B A;  4ICU A;  2L7R A;  1YJJ A;  2ZW1 A;  2KXJ A;  2NCN A;  2IY0 B;  4XWW A;  4XDC A;  4IWQ A;  2L1A A;  5J17 A;  5JHB A;  3ALB A;  3MJW A;  3TEY A;  4NJC A;  3IAS 1;  4GLS C;  2JYT A;  1FNW A;  4WUR A;  2M0X A;  2KT7 A;  5D2M B;  3HM3 A;  2IBI B;  3GZN I;  1I4G A;  2MCN B;  3VAW A;  2FCQ A;  3LYY A;  1JAL A;  2D10 A;  4OVZ A;  4QAY A;  2LI5 A;  4OVV A;  2NBW B;  3X23 A;  1WE6 A;  3E56 A;  3NZU A;  3NUH B;  1R4M B;  1V97 A;  2EKI A;  4FHK A;  5IN7 A;  2DEN B;  4BBN C;  4JWU C;  3QX1 A;  4EZK A;  3DBH B;  4YTP B;  3TMP B;  2R61 A;  3UIO B;  4YSX B;  1MJD A;  4EEW A;  1YMH E;  1V1O A;  1SJE D;  2CR5 A;  1TY0 A;  4EKU A;  1OTR B;  3KUC B;  4WJQ A;  2L00 B;  4KZC A;  1SGH A;  4NQL B;  4HKZ E;  3I5J C;  1RRB A;  3OJ3 A;  2I1K A;  1YX6 B;  2PE9 A;  4G3X B;  2WXQ A;  2EKE C;  1CJE A;  2YEP F;  3TL5 A;  4ASW C;  2MH7 A;  4NZL B;  4BVU C;  1STE A;  1SE2 A;  1V1P B;  4EZJ A;  2D3C A;  2HDE A;  2MW5 A;  3H9D A;  4NNJ B;  3VRB B;  1WGK A;  2CHW A;  2ZNV B;  5FK9 C;  1WXV A;  1NYR A;  1TJE A;  1YJI A;  2E6X A;  2KFK A;  4MGY E;  3RZW C;  2MBB B;  3AEB B;  1MVK A;  4MJS A;  1EF1 A;  1UEL A;  2ZVO A;  3N3K B;  1QKZ A;  3GE3 C;  5J2R A;  3IT4 B;  4REZ A;  3DPD A;  2N7E A;  2KLG A;  2MSE D;  4RGO S;  2KFJ A;  3EC8 A;  3PRP B;  3AH7 A;  3HM6 X;  2KWC A;  1WH3 A;  2KAJ A;  1ISN A;  3DBL B;  2H89 B;  4WJN A;  2NR2 A;  3KQ4 A;  1FNU A;  3AMZ A;  1F2R I;  2WS3 B;  3PO0 A;  1T0Y A;  1V80 A;  3VQI A;  3U4E G;  3ZNI D;  5GXG B;  4K3B A;  4YSY B;  4FBJ B;  4HWI B;  4MEL A;  3RCZ A;  4A90 A;  1I42 A;  1GJZ A;  2UU7 A;  1EU3 A;  3NZS A;  1JWB D;  2K3U A;  1I4R A;  4W9C A;  1GPX A;  2KDI A;  2Z8L A;  5E6O A;  2W82 A;  1K51 A;  4LJP B;  4OHJ A;  3BVM A;  4P16 A;  1YQ3 B;  3V62 A;  3T8M A;  3NVZ A;  4GU2 A;  1SE4 A;  2BBC A;  3GE8 C;  3PGE A;  3HVZ A;  4OZC A;  2B76 B;  4US8 A;  1IGC A;  2KWU B;  3X0W A;  3V05 A;  4P6V F;  4XZ4 A;  3WAO A;  2WX0 A;  2WXP A;  4DDG D;  4N58 A;  5LLI A;  4MH8 A;  1WGY A;  3IT6 B;  5EE3 A;  3ZRC A;  1E9M A;  4OW0 A;  2WWZ A;  2KJR A;  2R2O A;  2CHZ A;  4A55 A;  3AU4 A;  1XLN A;  3KVF B;  2OJW A;  2GBK A;  3V3X A;  1VDV A;  2PIA A;  3W5U B;  3CF6 E;  2BYF A;  1PUT A;  2D07 B;  2JVC A;  4JGH B;  3QAQ A;  3DVG X;  4MM3 A;  3ZJV A;  2NTT A;  3WCQ A;  3Q8C A;  1CQV A;  4ZYS A;  1RM6 C;  4MJS B;  1HTQ A;  3VTW A;  3ABV B;  2WDV B;  3FAH A;  3EEC A;  4F1S A;  2KOX A;  1OEY A;  4IWO A;  3ZKJ C;  5C1Z A;  1VZ7 A;  1C1Y B;  4G50 A;  3MC9 A;  4MSQ B;  1YOV B;  2LFI A;  1SE3 A;  4AP4 C;  2JWZ A;  2PE6 B;  3AE9 B;  5DPR A;  2K6Q A;  1DGJ A;  2FCM A;  1N5X A;  2XNA C;  4P7I A;  2SEB D;  1F52 A;  1P1A A;  5HI1 A;  2MA9 B;  5AEK B;  1E7V A;  2VZK D;  3JYU A;  2BTE A;  1TS5 A;  2AX5 A;  1YN5 A;  4PYZ A;  4IM3 A;  1KRH A;  3QQ8 B;  1V6E A;  2CU3 A;  4RMA A;  3WAL A;  2N9P C;  1Z5S B;  3RFZ B;  3W1S A;  1VZ6 A;  2WHI A;  4WAA A;  1BUI C;  4LTU A;  2LAS A;  2RGF A;  3D32 A;  1FRD A;  2G3Q B;  2KVZ A;  1AAR A;  3RZF A;  2KZR A;  5JXV A;  1FCC C;  4DXG A;  1PDX A;  4LNI A;  2DWQ A;  2G45 B;  2J7Q B;  1OQY A;  4A3O A;  3BK2 A;  2KDM A;  3MHS D;  4BKS A;  2ONQ A;  1ZPS A;  1EWY C;  2NBU A;  4TSS A;  3P4Q B;  1QT9 A;  3W1S C;  3CIR B;  3R2I A;  4WQO B;  1V8C A;  3B2G A;  3ZYY X;  4IM0 A;  2FID A;  3VR9 B;  1OFF A;  3MC0 B;  3BK1 A;  4GSW A;  2INN E;  3GZN B;  2L8J A;  4ZRI A;  1GG3 A;  3EHV A;  1NYQ A;  1XF5 L;  3BVZ A;  5CHV C;  2L52 A;  2PLP A;  3QC8 B;  2YEP B;  2IO0 B;  1XXG A;  1UF0 A;  1T0R C;  1ZP0 B;  3NVW A;  1YQB A;  5EDS A;  4W9J A;  3C8Y A;  1ZUD 2;  2AQ2 B;  1C79 A;  2MJ3 A;  4CHK A;  1E8X A;  4IWP A;  3PSE B;  4ZRQ A;  4BOS C;  1OGW A;  1WFY A;  2HJ1 A;  2DBY A;  4ZYN A;  3OAW A;  4UDU C;  2KMC A;  4XDD A;  4GB9 A;  3UGB B;  1YQ4 B;  2N9L A;  5EE0 A;  4YWG G;  4S0R A;  2HTH A;  2BS3 B;  3RI7 C;  1YNT E;  4A6Q A;  4KDI C;  3ZTD A;  1WXA A;  2KC1 A;  1UH6 A;  4LJO B;  1E7P B;  5L83 A;  3SFE B;  3R3M A;  1HZ5 A;  4BBN F;  4C4V B;  3NOB A;  1C78 A;  2WXH A;  1L4Z B;  4KKJ A;  4GDK A;  3C0R B;  1VD2 A;  4OZB A;  4M8M A;  2IDY A;  2NS5 A;  1C4P A;  2LJI A;  2Y5P A;  1B9R A;  3DOW A;  1IUE A;  1WJ4 A;  4FJY A;  2HE7 A;  1MHX A;  3Q6B A;  4WWP A;  2WXN A;  1FEH A;  3JW0 X;  2BPS A;  1N6Z A;  1J7B A;  4M0W A;  3Q3N C;  2JSV X;  4HXD A;  4H2A A;  5BYR A;  4B0E A;  4FA6 A;  4RGT A;  2ZJD A;  3UF8 A;  4ICV A;  5DCN A;  1AN8 A;  2CS4 A;  3U30 A;  3A9K B;  3APF A;  3TUO A;  4G11 A;  2NVU I;  2WX1 A;  4ZHO A;  2D3G A;  4WWO A;  1PYW D;  4O1N A;  2L32 A;  3SU8 X;  5G2N A;  2KWD A;  2IGG A;  2KLC A;  2M0A A;  1GB4 A;  3KWL A;  2BB6 A;  4C80 A;  1TT5 B;  1XLQ A;  3W2D A;  2WXI A;  4HEA 1;  2AYO B;  1VLB A;  4XYC A;  2RPQ A;  3SFD B;  1Q10 A;  1WM3 A;  4LNF A;  3VUX A;  1FMA D;  1LM8 B;  1D6E C;  1JWM D;  1QOB A;  4BZA A;  2OOB B;  1A70 A;  1PGA A;  4W9D A;  3E9S A;  2N9X A;  4W9F A;  1IBX A;  3RPF C;  3AUL A;  2REX A;  4DXA B;  1H4R A;  3B9J A;  1WJN A;  4PYU A;  5TR5 A;  3VH4 B;  2BKF A;  2CKH B;  2XK5 B;  3WAM A;  1KTK A;  2ZW0 A;  5JH5 C;  2O2V A;  2VRR B;  2LRW A;  3IVF A;  4A20 A;  3V6E B;  2W55 A;  1P0R A;  4KVG B;  2LXA A;  3PRE A;  4AQ7 A;  1GC7 A;  1K8R B;  4PS3 A;  1Z2M A;  2JY6 A;  3HVD A;  2PEA A;  1E7U A;  1J19 A;  2KAN A;  3ML8 A;  3BYT B;  3JSV A;  3BII D;  4F8C B;  1F0Z A;  3L13 A;  1WM2 A;  1PGX A;  3EUB 2;  2ZCC A;  4PT5 A;  4NPN A;  1RYJ A;  3P4S B;  1LO5 D;  1XQQ A;  4M0W B;  5IA7 A;  3BYY B;  4JIO U;  1C4C A;  2V0G A;  4WJO A;  3OWE B;  1WGD A;  2M56 B;  4DXF A;  3AB5 A;  2UYZ B;  1V86 A;  2BWF A;  3PV1 A;  2MBQ A;  2MBO A;  2BT6 A;  4GMV A;  1UWM A;  3RNE C;  3FIL B;  3VUW A;  1Y8R C;  4MAC A;  1Q1O A;  1L6U A;  1WSP A;  2FE8 A;  1GOZ A;  5AUI A;  3WAN A;  2JX5 A;  3IHP C;  2V9H A;  2FUH B;  2K8B A;  1FO4 A;  1DYQ A;  3RNA C;  1D4B A;  1UWX A;  3PTF C;  3RNF C;  1JRO A;  3U7Z A;  2XBB C;  1WXQ A;  2JZP A;  1KJT A;  1DOX A;  3VFK A;  2RDB C;  4TKN A;  3EFC A;  1LXD A;  1QOA A;  3H6N A;  2MX2 A;  1P7F A;  1ZXH A;  3PRM B;  1GB1 A;  5C23 A;  1D3Z A;  2I38 A;  4KSK C;  1QQR A;  4RGN A;  3NG0 A;  5D3I B;  3T9L A;  2PMV A;  2GB1 A;  3NS8 A;  3H8H A;  3M95 A;  3LDZ E;  1VJK A;  4AJY B;  3UQB A;  3NVY A;  4ITK A;  5AUK A;  5LNK 1;  2AEH A;  3ZNZ B;  3ZGZ A;  1QOF A;  2HD5 B;  2K9X A;  3PZ7 A;  3AEF B;  3VHT C;  1WYW B;  2R2Q A;  3QCA A;  3A33 B;  4K7W A;  5J18 A;  1KM7 A;  1EF5 A;  1AW7 A;  5KHO A;  1ESF A;  3SR6 A;  3L08 A;  3OLM D;  2RR9 A;  4DK5 A;  3N1X C;  3VH3 B;  5G5G A;  4HPL B;  3DDC B;  3I63 C;  1V81 A;  3QHT A;  3U2S C;  2G4D B;  2JF5 A;  3CMM B;  2IND C;  1DOY A;  1RAX A;  3ZXV A;  1XCQ L;  1QZE A;  4WJP A;  1FXA A;  2DZJ A;  1Y56 A;  3RT3 B;  1TGZ B;  1KFY B;  2BYE A;  4IKG A;  4HCP B;  2V3S A;  4KKI A;  3KUD B;  2DYB A;  1OQR A;  2C5L C;  2M1M A;  2JRI B;  3ZNH B;  4AUQ C;  1BML C;  4K3C A;  2L3Z A;  3KLS X;  3NJT A;  4D2K A;  2WU2 B;  4ANW A;  3H1U A;  1FD6 A;  4URK A;  2J0K A;  4FUL A;  3AE5 B;  4FXC A;  2JUO A;  1WXM A;  1N62 A;  4EOY A;  4XC2 A;  2GBR A;  4WQM A;  2K8C A;  4JPS A;  1VRA B;  4K7S A;  1JWA D;  3FC4 A;  2QSD A;  2V1Y A;  2Z0D B;  1UUP A;  2JPH A;  4HCN B;  1T0Q C;  3WIM A;  2PVO D;  2MP2 A;  2G1E A;  2MBE A;  1V9J A;  1E8Y A;  1ZXI A;  2D3B A;  3ENE A;  3OJ4 B;  4RNA A;  1FXI A;  1TY2 A;  4DBG A;  5DPW A;  4E3C A;  4DHJ B;  4YL8 A;  4ZHP A;  1CZP A;  4L2Y A;  1P7E A;  2QMT A;  3GB1 A;  2LXC A;  4MH0 E;  3DVN U;  3U8Z A;  2E3T A;  5BYQ A;  2IO2 B;  2JT4 B;  3NRZ A;  4LNN A;  2Z0E B;  5D6J B;  2LD9 A;  4RGM A;  1L0Y B;  2W9N A;  2BS4 B;  1T3Q A;  1OEY J;  4LDT D;  2KFK B;  1QLB B;  3QK0 A;  2FIF A;  1JCK B;  2OED A;  3IXS A;  3RD2 A;  4C7Z A;  4PS7 A;  2L05 A;  4W9K A;  1E8W A;  4M01 A;  4YT0 B;  2O6V D;  1NI3 A;  4WWN A;  1XCT L;  4TUU A;  1T6B X;  4N59 A;  1FCL A;  1K52 A;  5D3D A;  3CSF A;  3GOE A;  5H8Y E;  3QIJ A;  4P1B C;  3VDZ A;  3Q8E A;  4FJV B;  2YLM A;  3AEG B;  2WDR B;  3AE7 B;  3IAM 1;  5JHA A;  3T3O A;  3DVG Y;  1HQR D;  2NPT A;  1L0X B;  3ZTC A;  4S17 A;  2LHE A;  3VTU A;  1WRI A;  3IBE A;  3PRZ A;  4WWM A;  1HZ6 A;  3LXF A;  1K53 A;  2RPV A;  1TS2 A;  3P1M A;  4HPM B;  1U4A A;  1KH0 A;  1XO3 A;  3ML9 A;  3AN1 A;  4NY0 A;  1EM7 A;  3M63 B;  2QIL A;  3DWG C;  3DHG C;  3AXC A;  2WLB A;  4RCO A;  4ANV A;  1UZX B;  3K9P B;  4JX1 C;  4BKG A;  4EFO A;  4JWS C;  2KYW A;  4I6P A;  1JW9 D;  3J9C A;  1V5T A;  1CK1 A;  1XLO A;  4K7U A;  3V60 A;  1Q0W B;  2FCS A;  1SB3 C;  4TMA B;  1D5X C;  3UQA A;  3AU5 A;  2XEW A;  2DHZ A;  3BWU D;  3ZQ4 A;  3R66 C;  4KGT A;  2WXK A;  2K6D B;  2KX0 A;  2KQ4 X;  2L83 A;  1RFK A;  2K8H A;  3OG5 A;  3SDL C;  2N9K A;  2INC C;  3MP9 A;  1JWS D;  1I7H A;  1EO6 A;  4TQ1 A;  1T5X D;  1FNV A;  1GNU A;  5GMV A;  4DDI D;  3HRD D;  1FXT B;  2BWE S;  5LXI B;  1MG8 A;  5E6N A;  3R8B A;  1V5O A;  4I6L B;  2K1F A;  5FKA C;  1RFA A;  4BKT A;  4MM3 B;  3KYD D;  2LJ5 A;  1EU4 A;  3ZW3 A;  3ECI A;  4E71 A;  3L16 A;  1GAQ B;  3VUY A;  3O65 B;  3TJP A;  3CST A;  2BW2 A;  4EZL A;  1FFV A;  1TZ1 A;  1NDD A;  3PLU A;  2J53 A;  1PGB A;  1FIQ A;  2M4N A;  2D3A A;  4FN2 A;  3PPA A;  3DBR I;  3NY5 A;  1E5W A;  3DVN V;  2BYT A;  2N1V A;  4ARC A;  5BMH A;  4KSL C;  2LGD A;  2KTR A;  2KJ6 A;  2DZM A;  4W9I A;  4M8N A;  1VR9 A;  2GBM A;  3AE4 B;  4GN1 A;  4AWJ A;  2LUE A;  3Q14 C;  2FBW B;  2B3A A;  3AE2 B;  2HTM E;  2BF8 B; 
#chains in the Genus database with same CATH homology
 4GDL A;  3AUL A;  2REX A;  4DXA B;  4MJS A;  1H4R A;  1EF1 A;  1UEL A;  1WJN A;  2ZVO A;  4PYU A;  2L0T A;  3HK0 A;  3N3K B;  4JLC A;  5TR5 A;  3VH4 B;  2BKF A;  2CKH B;  2XK5 B;  3WAM A;  4FJZ A;  3HIZ A;  5JH5 C;  3R7Q A;  4AJW A;  1SIF A;  4KV2 A;  3V61 A;  3H7S A;  2O2V A;  3ZRF A;  2VRR B;  1C3T A;  2L0F A;  5J2R A;  2UWQ A;  3A9J A;  2LRW A;  1WX8 A;  3H7P A;  3IVF A;  4A20 A;  1ZGU B;  3V6E B;  3DPD A;  1LQB A;  2N7E A;  5DPT A;  2KDB A;  2KLG A;  1RLF A;  3B08 A;  2MSE D;  4K1R B;  1S3S G;  2KK8 A;  1P0R A;  3WA0 A;  2KFJ A;  3EC8 A;  3PRP B;  2LXA A;  3PRE A;  4KVG B;  3DQV A;  3HM6 X;  2KWC A;  1WH3 A;  2KD0 A;  1GC7 A;  5CHW A;  3SHQ A;  1K8R B;  1ISN A;  1LFD A;  4PS3 A;  5DPS A;  1NBF C;  1Z2M A;  2JY6 A;  4WJN A;  5IAA C;  4BOZ B;  2PEA A;  3RUL A;  1J19 A;  1E7U A;  2KAN A;  3ML8 A;  3RYT A;  2NR2 A;  3JSV A;  1WXS A;  4F8C B;  2LGX A;  3L13 A;  1WM2 A;  1R4M I;  2ZCB A;  4DWF A;  2MP2 B;  2A4Z A;  3VTV A;  2ZCC A;  3AI5 A;  1WX7 A;  4NPN A;  2ZVN A;  3ZLZ A;  3DBH I;  1T0Y A;  1V80 A;  2JZZ A;  3VQI A;  1XQQ A;  2DYM A;  4M0W B;  5IA7 A;  4JIO U;  3LJ3 A;  3ZNI D;  4IM2 A;  2C7H A;  4WJO A;  2J0M A;  2KWV B;  4FBJ B;  1WGD A;  2UYZ B;  1V86 A;  2BWF A;  4HWI B;  4MEL A;  3RCZ A;  1I42 A;  3U7D A;  1GJZ A;  1Q5W B;  5CHF A;  3NZS A;  3PV1 A;  4W9C A;  2MBQ A;  2MBO A;  2M17 A;  2LRU A;  4GMV A;  4IUM B;  1UBQ A;  1WR1 A;  2KDI A;  2KVR A;  2LWP A;  2EMS A;  5E6O A;  1YX5 B;  4TV3 A;  3VUW A;  1Y8R C;  1BT0 A;  2KX3 A;  4LJP B;  1Q1O A;  1GC6 A;  2KNB A;  4PS8 A;  2FCN A;  3QA8 A;  4NJ7 A;  2MRP A;  3V62 A;  2GOW A;  3T8M A;  4GU2 A;  3WAN A;  2GBJ A;  1E8Z A;  1EUV B;  4CO7 A;  1KOT A;  3IHP C;  3PGE A;  2FUH B;  3W1Y A;  2K8B A;  3A4S C;  4FHJ A;  2KWU B;  3UIN B;  3X0W A;  3M3J A;  3VXW A;  3PTF C;  4XZ4 A;  3WAO A;  2WX0 A;  2XBB C;  4DDG D;  1WIA A;  5LLI A;  1X1M A;  3DBS A;  1KJT A;  2DZI A;  1WGY A;  3APD A;  2N4F A;  3ZVV A;  2HJ8 A;  2BYV E;  3PLV A;  3VFK A;  1SE9 A;  3ZRC A;  1WMH A;  4ZDV A;  3A9K A;  2WWZ A;  4JL9 A;  2GMI C;  2KJR A;  4TKN A;  2R2O A;  2CHZ A;  1LXD A;  3AU4 A;  3KVF B;  1WR6 E;  4KIK A;  3MTN B;  2J0J A;  3H6N A;  1V2Y A;  4GIV A;  2MX2 A;  4IC7 B;  1A5R A;  2IO1 B;  2GBK A;  3PRM B;  5C23 A;  1D3Z A;  4KSK C;  4HK2 A;  3CF6 E;  2BYF A;  2D07 B;  1WX9 A;  2JVC A;  3B0A A;  3QAQ A;  4HDQ A;  3DVG X;  4JGH B;  4RM8 A;  2D11 A;  3IG3 A;  1WI0 A;  4MM3 A;  3T9L A;  3NS8 A;  4NAW A;  3M95 A;  2Z59 B;  3LDZ E;  4N9F 4;  1XD3 B;  2IZV B;  4ZRJ A;  4AOF A;  1ZW7 A;  4AJY B;  3UQB A;  1L2N A;  4W9L A;  3A1Q A;  3QJZ A;  4F7Z A;  2DAF A;  3KYC D;  2AEH A;  2K39 A;  1WF9 A;  1WZ0 A;  4GXB A;  4MJS B;  2MQJ A;  3ZNZ B;  5D7G A;  3VTW A;  2WYQ A;  2HD5 B;  1P98 A;  3VHT C;  1WYW B;  2R2Q A;  3DBL I;  3A33 B;  3EEC A;  3QCA A;  4K7W A;  3L54 A;  4XX5 A;  2KDF B;  4F1S A;  3N32 A;  2Y5B B;  2KOX A;  1OEY A;  4IWO A;  3ZKJ C;  1KM7 A;  1EF5 A;  5C1Z A;  3ZUN A;  5J18 A;  5L95 C;  1C1Y B;  4G50 A;  5KHO A;  5AZG A;  3A9J B;  4MSQ B;  4GOC A;  5AZF A;  3L08 A;  3PHW B;  2NPT B;  3OLM D;  3UIP B;  4AP4 C;  2RR9 A;  2KKC A;  2I1J A;  3JVZ X;  3VH3 B;  2WDT B;  4BFR A;  2JWZ A;  2PE6 B;  3ZDT A;  4DK5 A;  3RUI B;  4HPL B;  4MGK E;  3DDC B;  3I3T B;  5JZE B;  4DHZ B;  4GGQ A;  3QHT A;  1V81 A;  2KN5 A;  5DPR A;  2G4D B;  2JF5 A;  2K6Q A;  3CMM B;  2FCM A;  2LVO A;  1RAX A;  4P7I A;  1YIW A;  1NI2 A;  1QZE A;  2DAJ A;  4GDK B;  1WRD B;  4WJP A;  3L17 A;  2O6V A;  2DZJ A;  4W9E A;  1P1A A;  1TBE A;  1WGR A;  2ZPN A;  3RT3 B;  1M94 A;  4IG7 B;  3WAP A;  2MA9 B;  1TGZ B;  1WE7 A;  5AEK B;  2BYE A;  1E7V A;  2XK5 A;  4HCP B;  2V3S A;  5G55 A;  3KUD B;  2DYB A;  3PT2 B;  1IPG A;  3M62 B;  5FR6 A;  2C5L C;  3JYU A;  4W9H A;  3QWZ B;  2M1M A;  2JRI B;  3ZNH B;  4AUQ C;  1KLV A;  2L3Z A;  4PYZ A;  3KW5 B;  1WJU A;  2LGY A;  2NBV B;  4IM3 A;  5E6P A;  4ANW A;  3QQ8 B;  2ZNV C;  3H1U A;  1V6E A;  2MBH A;  4RMA A;  3WAL A;  4URK A;  2J0K A;  2N9P C;  1Z5S B;  4FUL A;  2KMA A;  3W1S A;  2JUO A;  3HHM A;  1WXM A;  4WAA A;  3V6C B;  4EOY A;  4CYE A;  4XC2 A;  2LAS A;  2RGF A;  3D32 A;  2G3Q B;  4RM9 A;  3SD5 A;  1TTN A;  4JQW C;  2GBR A;  1AAR A;  3RZF A;  2KZR A;  4E74 A;  2K8C A;  4K7S A;  1J8C A;  1WY8 A;  5LXH A;  2V1Y A;  2Z0D B;  2L76 A;  2BGF A;  3R7R A;  4ANX A;  2KJH B;  2A5U A;  2JPH A;  4HCN B;  2G45 B;  4W9G A;  2KTF A;  3WIM A;  2DX5 B;  2J7Q B;  2MP2 A;  1OQY A;  4A3O A;  2C9W B;  3BIN A;  2MBE A;  3MHS D;  1V9J A;  4BKS A;  4DHJ D;  1E8Y A;  4II3 B;  4B95 A;  4HDO A;  1JRU A;  4MGZ E;  3ENE A;  3OJ4 B;  2LVP A;  2NBU A;  1UGM A;  4DBG A;  5DPW A;  3W1S C;  3ZIM A;  4B9K A;  4E3C A;  4WQO B;  3TIX A;  4FLH A;  4LCD E;  4IM0 A;  2ZZP B;  2FID A;  5HKH A;  1WMH B;  4DHJ B;  1P3Q U;  3P2B A;  3APC A;  2FNJ B;  3L0W B;  4YL8 A;  4HLE A;  1G6J A;  2RSU A;  4KIK B;  1WZ3 A;  4I6N B;  4II2 B;  2M8S A;  4GSW A;  2PJH A;  2LXC A;  4KDL B;  2JRH A;  4MH0 E;  3DVN U;  3U8Z A;  2ZPY A;  1WGG A;  1V49 A;  2KTR B;  2L8J A;  4ZRI A;  1GG3 A;  2GBN A;  4NQK E;  3EHV A;  2IO2 B;  2JT4 B;  4NAW B;  3ZO5 B;  2CHX A;  2Z0E B;  4ANU A;  5D6J B;  5CHV C;  5CTR C;  2AWT A;  2LD9 A;  5CX3 A;  1ZKH A;  2KQS A;  4K81 A;  3K9O B;  3A1Q B;  3QC8 B;  1WJ6 A;  4IW0 A;  2W9N A;  4MSM B;  2IO0 B;  1OEY J;  4LDT D;  2KFK B;  2KDE B;  3PHX B;  3QK0 A;  1S1Q B;  3A4R A;  3Q3J A;  2FIF A;  4KZ0 A;  4ZRK A;  2JZ3 B;  4G0N B;  4GDL B;  2C7M B;  3RD2 A;  2RD0 A;  4PS7 A;  2L05 A;  2CU1 A;  1UD7 A;  2PPH A;  4LDT B;  4W9K A;  1YQB A;  1E8W A;  2LZ6 A;  5EDS A;  4W9J A;  5BO4 B;  2O2V B;  2O6V D;  4WWN A;  3H7P B;  4CHK A;  1E8X A;  1P9D U;  3S2A A;  4IWP A;  3PSE B;  4BOS C;  4TUU A;  3TCA A;  1OGW A;  2BKR B;  1WFY A;  4MGI E;  4TQ0 A;  1HE8 A;  4ZYN A;  3OAW A;  4NJ6 A;  2IY1 B;  4MEM A;  1IYF A;  2KMC A;  2O6V B;  3PS6 A;  3CSF A;  3GOE A;  1H8C A;  4GB9 A;  3UGB B;  2DZK A;  1I35 A;  3QIJ A;  1IP9 A;  1UBI A;  3VDZ A;  2YVC A;  2MWS B;  4FJV B;  2YLM A;  3JSV B;  2HTH A;  2IYD B;  2ASQ A;  4KDI C;  5JHA A;  3DVG Y;  3ZTD A;  1WXA A;  2MLB A;  4MDK E;  3QAR A;  2KO3 A;  5KHQ A;  2KC1 A;  2NPT A;  3TBL D;  1E90 A;  3PVL A;  1UH6 A;  3ZTC A;  2N1W A;  4LJO B;  3VTU A;  5L83 A;  2JXX A;  3IBE A;  3PRZ A;  3ZNG C;  3R3M A;  2IO3 B;  4J6I A;  4BBN F;  4DHZ E;  3EFU A;  1YD8 U;  3NOB A;  4HPM B;  1GUA B;  1U4A A;  2DYO A;  4GDK A;  3B1L X;  3C0R B;  4ICU A;  2L7R A;  1VD2 A;  3ML9 A;  2EMT A;  4M8M A;  2KXJ A;  2NCN A;  2IY0 B;  2FAZ A;  2G4S A;  3ONS A;  4NY0 A;  3L10 B;  4BKS D;  4IWQ A;  3M63 B;  5J17 A;  5JHB A;  2KQ7 A;  3ALB A;  3MJW A;  3AXC A;  2NS5 A;  4A3P A;  4EUT A;  3PZD A;  1F9J A;  1UZX B;  3K9P B;  3DOW A;  4ANV A;  4BKG A;  4EFO A;  1WJ4 A;  2M0X A;  4I6P A;  4FJY A;  2HE7 A;  4WWP A;  1YJ1 A;  1V5T A;  2AL6 A;  2ZEQ A;  5D2M B;  3JW0 X;  1L7Y A;  2N9E B;  2BPS A;  3HM3 A;  4K7U A;  2D2Q A;  3V60 A;  2IBI B;  1Q0W B;  2FCS A;  3GZN I;  2MCN B;  3UQA A;  3AU5 A;  4HXD A;  2XEW A;  2DHZ A;  3VAW A;  3ZDM C;  2V4L A;  3R66 C;  2FCQ A;  2K6D B;  2D10 A;  4HJK A;  2KX0 A;  2LI5 A;  4B6W A;  4FA6 A;  4OVV A;  3NHE B;  2NBW B;  2QHO A;  3X23 A;  2ZJD A;  2K8H A;  3UF8 A;  3SDL C;  1PQS A;  1WGH A;  4ICV A;  5DCN A;  1WE6 A;  2AL3 A;  3NZU A;  2CS4 A;  3U30 A;  3A9K B;  3VVW B;  1EO6 A;  3APF A;  4TQ1 A;  1GNU A;  5GMV A;  4FHK A;  4G11 A;  2DEN B;  4BBN C;  2NVU I;  3QX1 A;  2WX1 A;  4DDI D;  4EZK A;  1J0G A;  3TMP B;  3UIO B;  1FXT B;  2BWE S;  2D3G A;  5LXI B;  1MG8 A;  4EEW A;  5E6N A;  4WWO A;  1CMX B;  1V5O A;  2K1F A;  4I6L B;  1RFA A;  4BKT A;  4FAD A;  3KYD D;  2LJ5 A;  2CR5 A;  3ZW3 A;  3ECI A;  4E71 A;  3L16 A;  3SU8 X;  4EKU A;  2KHW B;  1OTR B;  3DCG A;  5G2N A;  2C60 A;  3KUC B;  3VUY A;  3O65 B;  4WJQ A;  3TJP A;  2L00 B;  3CST A;  1SGH A;  2KLC A;  4KZC A;  4NQL B;  4EZL A;  5AZH A;  1TZ1 A;  1NDD A;  1RRB A;  3PLU A;  3OJ3 A;  2I1K A;  1YX6 B;  2AYO B;  4X57 B;  2PE9 A;  4OVU A;  4G3X B;  2M4N A;  2EKE C;  3KUZ A;  4FN2 A;  3TL5 A;  3BY4 B;  2RPQ A;  3PPA A;  3DBR I;  3NY5 A;  1E5W A;  4ASW C;  3DVN V;  2N1V A;  1WM3 A;  4BVU C;  3Q3F A;  3VUX A;  4KSL C;  2LGD A;  4EZJ A;  2KTR A;  2LVQ A;  3N30 A;  4HVB A;  2KJ6 A;  2MW5 A;  2DZM A;  3H9D A;  4NNJ B;  4W9I A;  4M8N A;  2CHW A;  2ZNV B;  2GBM A;  2K25 A;  3KH0 A;  1WXV A;  2C7N B;  1LM8 B;  1R4N I;  2KC2 A;  4GN1 A;  4AWJ A;  3IFW B;  2N7D A;  2LUE A;  2OJR A;  1VCB A;  2OOB B;  2KFK A;  2B3A A;  1XT9 B;  4MGY E;  2MBB B;  4W9D A;  5D94 A;  3RZW C;  2N9X A;  4W9F A;  2BF8 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...