2LUEA

Lc3b optn-lir ptot complex structure
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
119
structure length
119
Chain Sequence
GAMGKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Microtubule-associated proteins 1A/1B light chain 3B
publication title Structural basis for phosphorylation-triggered autophagic clearance of Salmonella.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 25
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2012-06-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2lueA00
4HJKA 2KN5A 2DZIA 3PZDA 3R66C 2L0FA 1S3SG 2GMIC 2N7DA 3NZSA 3QARA 3ZLZA 2M0XA 3QAQA 2L76A 3TL5A 2LGDA 1E90A 4CYEA 4ICVA 2NPTA 2C7HA 2K8HA 2N9EB 1OTRB 5AZHA 2KLCA 4M0WB 2YVCA 4DDGD 2IY0B 4EEWA 2WX1A 4FULA 4ICUA 3VUYA 4MDKE 1UELA 5KHOA 2KNBA 3VTWA 2J0MA 3PVLA 4HCPB 4BVUC 3L16A 4EZJA 4IUMB 1S1QB 3ZRCA 3PGEA 2JRHA 2L00B 1UH6A 2N9XA 4EFOA 4FHJA 1WGDA 3DVGX 2DAJA 2WWZA 3EHVA 1I42A 3EECA 3PHWB 4GDLB 2WYQA 3TBLD 1AARA 4KDLB 4NAWB 2FIDA 4GDKB 1V86A 4W9DA 3DQVA 1OQYA 3L54A 4N9F4 3PSEB 1K8RB 2KMCA 3M95A 4ZYNA 2BKRB 2L3ZA 4MGIE 2J7QB 4HPLB 1WX7A 4JLCA 3PREA 4BBNF 4FJZA 3UQAA 4EKUA 3AU4A 4LJOB 4BOSC 4GSWA 1MG8A 4MM3A 5L95C 2G3QB 5JHBA 2C5LC 2ZNVB 3NOBA 2MP2B 2ZCCA 2DZMA 5TR5A 3U7DA 3VUXA 1LQBA 3OJ3A 3R7QA 1WH3A 2DAFA 2GBRA 5IA7A 2V3SA 3VDZA 4ZRIA 2MCNB 3WAPA 2Y5BB 1WGYA 1V9JA 3RD2A 4NPNA 4URKA 1F9JA 2KJ6A 2KFJA 5IAAC 4DBGA 1YIWA 2MBQA 2K6QA 4K1RB 3PRPB 4M8MA 3V62A 1WF9A 2JWZA 3WAOA 3L0WB 2B3AA 1SGHA 5D94A 4PS3A 1WR6E 4A20A 2KC2A 2PE6B 4MGKE 3VHTC 3RCZA 4E71A 2KOXA 5CHWA 4HCNB 2N7EA 2K25A 3DBRI 5DPWA 5E6PA 2KX3A 3QHTA 3ZIMA 3L17A 1WGHA 2AWTA 2HD5B 2KWUB 2KXJA 1E8WA 1GUAB 1EO6A 1WXSA 3KYDD 2MBHA 4OVUA 4DHJD 2KLGA 2LVPA 1YX6B 4AJYB 1Q1OA 2WX0A 3A9KA 5CTRC 5FR6A 4F8CB 2IO3B 3P2BA 4LDTB 4XZ4A 3ML9A 5G2NA 2HTHA 1WZ3A 2CU1A 3DPDA 2PEAA 3A1QB 4GDLA 4NAWA 4FA6A 2O2VB 4GDKA 2MLBA 3LDZE 1YD8U 4HLEA 1RFAA 4FBJB 2MQJA 4HWIB 2C7NB 2K8CA 3QIJA 4PS7A 2D3GA 4KVGB 2KWCA 4WWPA 5DCNA 4BKTA 2KD0A 2LZ6A 2GBKA 2GOWA 2C7MB 4E74A 1E5WA 3I3TB 5D7GA 4FLHA 3TCAA 4CO7A 4HDQA 3K9OB 2W9NA 4GOCA 4WWNA 3QX1A 4ZRKA 3SDLC 4AJWA 5G55A 3M63B 4RM8A 3ZRFA 1WYWB 3R3MA 3ZTCA 2MP2A 3CF6E 4W9CA 2BPSA 3RT3B 4GIVA 1UZXB 2AYOB 3APCA 4MJSB 1UBIA 2HJ8A 3Q3JA 3ZNID 4F7ZA 5J18A 2L7RA 3KUCB 3PTFC 1E8YA 2RPQA 4MSMB 4TQ1A 2BYEA 3UGBB 2V4LA 5LLIA 1D3ZA 3H7SA 2L0TA 2A5UA 4G0NB 4B9KA 2KDFB 5LXHA 1VD2A 4GXBA 2G4DB 2DYMA 2JF5A 3UIOB 3X0WA 1C3TA 2KO3A 4JL9A 5JZEB 2KTRB 3T9LA 3ZNGC 2MBEA 2MWSB 4CHKA 2JZ3B 1FXTB 2V1YA 2MX2A 3BY4B 5C1ZA 1RAXA 3V6CB 2K8BA 2LWPA 5CHVC 4GB9A 3QA8A 3U8ZA 3U30A 1YJ1A 1LM8B 3IFWB 1J19A 1TTNA 2KX0A 3DBHI 2KZRA 3PPAA 4HK2A 1ISNA 2MRPA 4WWOA 4NQKE 4GU2A 2GBJA 2K39A 2LD9A 4AWJA 2M4NA 3Q3FA 2MBBB 1GG3A 1TGZB 2LVOA 3EFUA 4J6IA 4LJPB 1T0YA 4BFRA 2ZVOA 3A1QA 1WY8A 3ZTDA 2AL3A 2QHOA 4NJ7A 3ONSA 1J0GA 1E7UA 2NVUI 2XBBC 2N1VA 3DCGA 2IBIB 4NNJB 3RZWC 4I6PA 1KM7A 2FCSA 3ML8A 4JGHB 5BO4B 2CHWA 2N4FA 5D6JB 4HVBA 2I1JA 4NY0A 3ZNZB 3OAWA 2M8SA 3V61A 2D10A 1Y8RC 1NDDA 3RULA 2KVRA 4GN1A 3SU8X 1ZW7A 5DPTA 2JXXA 1SIFA 2LRUA 2KFKB 5KHQA 1ZGUB 4W9IA 2Z0DB 3AI5A 3H7PA 1WJ6A 3DBLI 2ZJDA 4G3XB 3PRZA 5JHAA 1XD3B 2IO0B 3B0AA 1NI2A 3A4SC 1WE7A 1WGGA 3L08A 2KTFA 2NS5A 4ZDVA 5L83A 4MSQB 3TIXA 2FCNA 2A4ZA 3KVFB 4K7SA 1H4RA 1PQSA 4HDOA 1WZ0A 1WM2A 4DXAB 5AZGA 1KOTA 4DHZE 2CS4A 2MSED 4W9FA 2MA9B 2KTRA 3N3KB 4FJYA 4IWQA 4P7IA 3VH4B 2ZCBA 5J2RA 2DYOA 4IW0A 1V5OA 2R2QA 2G45B 2CKHB 2DZKA 4RMAA 1P1AA 4DWFA 4EZLA 2ZPYA 2ZVNA 2DENB 2LUEA 3JVZX 1Z5SB 1WMHB 2J0KA 4WJOA 2KWVB 1R4NI 2GBMA 1L7YA 1EF5A 2CR5A 3KH0A 3PRMB 3T8MA 3A9JB 4GGQA 2JY6A 3WIMA 2G4SA 1VCBA 3AULA 2IY1B 4II2B 4XC2A 2O6VB 4IWPA 4WJNA 4I6NB 2OJRA 4FN2A 4E3CA 2N1WA 5D2MB 3AU5A 2KKCA 3RYTA 2BF8B 4DHZB 3IG3A 4K7WA 2AL6A 4IC7B 2EMTA 3B1LX 1GC7A 2J0JA 2PPHA 1V5TA 1WE6A 4DDID 3KUDB 4DK5A 1RRBA 1WX8A 4KIKB 3QK0A 3TMPB 2AEHA 3JW0X 2KC1A 3ALBA 2C9WB 3UQBA 2KANA 2KDBA 3X23A 1E8XA 2LASA 2KDEB 2D2QA 2KJRA 3MTNB 5AZFA 2R2OA 1JRUA 3V6EB 4ZRJA 1XQQA 4PS8A 3ZW3A 1H8CA 4MEMA 1XT9B 2IZVB 3PV1A 3D32A 1EUVB 3R7RA 2FCQA 4FHKA 3ZKJC 3ZNHB 2BGFA 2LVQA 2FAZA 1V80A 4HPMB 1C1YB 4A3OA 1WJUA 2REXA 3QCAA 2RR9A 4AOFA 3W1YA 2K6DB 3M3JA 4KV2A 1LXDA 3VAWA 1TBEA 3W1SA 3SHQA 4KDIC 4W9GA 4W9LA 2Z0EB 3QWZB 4IM0A 2K1FA 4MGZE 4WAAA 5GMVA 2Z59B 4MELA 5E6OA 2KHWB 2IYDB 2OOBB 1LFDA 3WANA 3LJ3A 3C0RB 4G50A 4W9JA 2DZJA 1P0RA 4MGYE 4BKSA 3PS6A 4EOYA 1WMHA 4BBNC 2DX5B 3ZO5B 3L10B 4BKGA 4IM3A 3V60A 4WJPA 2ZEQA 3A9JA 2BKFA 4JIOU 2C60A 3H9DA 2D07B 2LI5A 1OEYJ 1WJNA 3VTUA 3A33B 2O6VA 2M1MA 3ZDMC 1UBQA 1WRDB 4PYUA 4BKSD 4DHJB 2JT4B 2I1KA 4A3PA 3O65B 4MH0E 1TZ1A 2KDIA 3QQ8B 3ECIA 3VQIA 4BOZB 1I35A 3RZFA 2O2VA 2ZNVC 3M62B 2UWQA 4NJ6A 3DVNU 2YLMA 3KYCD 4KZCA 3CMMB 5J17A 3IHPC 1BT0A 1E8ZA 1GJZA 1WGRA 2CHXA 2RSUA 4KIKA 4TV3A 5EDSA 1P9DU 3HHMA 4TKNA 4K7UA 2O6VD 2BYFA 3APFA 3OLMD 4WJQA 4OVVA 4LDTD 3CSFA 3DVGY 1J8CA 4ANVA 1GC6A 1CMXB 4W9EA 5LXIB 3RUIB 3W1SC 2JRIB 3A9KB 2PJHA 4IG7B 5E6NA 2NBUA 4NQLB 3EC8A 2L8JA 3VXWA 1GNUA 3JYUA 4MJSA 3IBEA 2NBVB 5CHFA 1U4AA 3AXCA 2JZZA 5JH5C 2DYBA 1WJ4A 3NHEB 3DOWA 2DHZA 1V49A 3ZUNA 3HM6X 1HE8A 2EKEC 1UGMA 1YQBA 2XEWA 3DDCB 3PLVA 3MJWA 3HIZA 4FJVB 4W9KA 3NY5A 2M17A 1UD7A 1OGWA 1V2YA 2L05A 2NR2A 4I6LB 3KUZA 2LXCA 3H6NA 2KQ7A 1Q5WB 2IO1B 3GOEA 3BINA 2BYVE 1IP9A 2PE9A 2ZZPB 4ASWC 1YX5B 4X57B 3PLUA 3QC8B 1WI0A 1KLVA 3B08A 1E7VA 3HM3A 4XX5A 4GMVA 5CX3A 2XK5B 3WAMA 1P98A 2KMAA 3JSVB 2ASQA 1KJTA 3CSTA 3ENEA 3S2AA 3WA0A 4EUTA 2KJHB 3KW5B 3APDA 3VTVA 3TJPA 3A4RA 2JUOA 3SD5A 4KSKC 4AP4C 2RGFA 4LCDE 2FUHB 3MHSD 1L2NA 3VVWB 2MBOA 2NCNA 4IWOA 1RLFA 3GZNI 2FIFA 2RD0A 3DBSA 4ANWA 2LGXA 3L13A 4II3B 3ZDTA 3VUWA 1M94A 2ZPNA 4EZKA 1Q0WB 2NPTB 2LGYA 1WX9A 2CHZA 3QJZA 2VRRB 2LXAA 4RM9A 1WXMA 3VFKA 3PT2B 1ZKHA 4B95A 1WIAA 5DPRA 1WM3A 3UIPB 4F1SA 1V6EA 2MW5A 5AEKB 1P3QU 2IO2B 1V81A 1QZEA 5HKHA 1OEYA 1SE9A 1G6JA 3DVNV 1WFYA 3HK0A 3VH3B 1IYFA 1A5RA 4YL8A 1R4MI 2D11A 1X1MA 2KFKA 4PYZA 3K9PB 3UINB 3OJ4B 4B6WA 4AUQC 2BWES 4IM2A 4WQOB 2FCMA 3H1UA 3N30A 3IVFA 2NBWB 2JVCA 3N32A 4HXDA 2KK8A 5C23A 3UF8A 4ANUA 4TQ0A 4JQWC 1WR1A 4M8NA 3WALA 2GBNA 3ZVVA 4KSLC 4G11A 1WXVA 3NS8A 3PHXB 4KZ0A 4ANXA 2N9PC 3NZUA 4W9HA 2UYZB 4TUUA 1IPGA 2WDTB 2XK5A 2KQSA 3JSVA 2EMSA 2BWFA 2LRWA 2LJ5A 1Z2MA 2FNJB 4K81A 5DPSA 4FADA 1EF1A 3H7PB 2HE7A 1NBFC 2JPHA 1WXAA
chains in the Genus database with same CATH superfamily
2DZIA 3ZXRA 4A9AA 3Q69A 3TUOA 3TL5A 2RDHA 4ICVA 2NPTA 2K8HA 1ZUD2 4UDUC 5KHOA 2WXOA 2J0MA 3PVLA 1WXQA 2ZW1A 4Q2JA 1J7AA 2WWZA 3NVZA 3EHVA 3MC0B 2WYQA 2GRIA 3P4QB 2FE8A 3PSEB 1K8RB 2GLSA 2KMCA 4DXFA 4HPLB 2VZKB 1WX7A 3GB1A 4EKUA 4LJOB 4GSWA 1MG8A 4MM3A 2BTEA 2ZNVB 5IA7A 3VDZA 3WAPA 1V9JA 2D5GA 4DBGA 2MBQA 3V62A 3WAOA 5D94A 1WYGA 1GOZA 2PE6B 4MGKE 2PLPA 3RCZA 4M0WA 2KOXA 2MJEA 3I5JC 2N0SB 5DPWA 3ZIMA 1WGHA 1RM6C 2HD5B 1MI0A 3IAS1 4OVUA 3KYDD 2MBHA 4C56C 2KLGA 1YNTE 2G9HD 2WQYB 5CTRC 4F8CB 2WXHA 2MEKA 4GDLA 3DPDA 2PEAA 3A1QB 3U7ZA 4FA6A 4XWTA 1ZXHA 2OEDA 1YN4A 2MQJA 2K8CA 3QIJA 5DCNA 1UF0A 4PK1A 2C7MB 1E5WA 3BVZA 3I3TB 1SB3C 2W9NA 4WWNA 4N59A 5EE3A 4ZRKA 1C4PA 1B1ZA 1WYWB 3CF6E 3RT3B 2AYOB 1ZDVA 1UBIA 4F7ZA 3RNEC 2L7RA 3PTFC 1E8YA 3N1XC 2V4LA 1R7SA 5LLIA 4M02A 2QILA 2KYWA 2L0TA 4G0NB 1AWDA 2KDFB 1T5XD 1V8CA 1K53A 2G4DB 3X0WA 1SE2A 2KTRB 5FKAC 2MBEA 1FCLA 1FXTB 1F0ZA 3BY4B 2LWPA 4HROA 3IFWB 2WU5B 1CQVA 1TTNA 3FC4A 4PT5A 3RPFC 2KZRA 4S0RA 4NQKE 4GU2A 4C80A 3EFUA 4J6IA 4LJPB 2BW2A 1T0YA 2ZVOA 1OFFA 3TEZA 2AL3A 3CWIA 2XBBC 1JWMD 2KN4A 3DCGA 2WNMA 4I6PA 1XLQA 2WXGA 2FCSA 2JYTA 4HVBA 1VLBA 2D10A 1Y8RC 3HVZA 2JXXA 1SIFA 3AI5A 1TZOA 1FMAD 4MH8A 4RGMA 1QOGA 3B0AA 1JWSD 2JX5A 2NS5A 4DXGA 4ZDVA 1H4RA 4K3BA 1WM2A 1I4PA 2DNFA 2MSED 5L83A 3VH4B 5J2RA 1V5OA 2CKHB 4RMAA 2DENB 3JVZX 3KWLA 2KWVB 2GBMA 2JY6A 4ZOHC 2V3PA 1PGXA 2WXMA 4WJNA 5HHDG 4I6NB 2KACA 4TMAB 2K0PA 3RYTA 3WCQA 3DHHC 5FK9C 2EMTA 3B1LX 5BMIA 3KUDB 4OVZA 4DK5A 3QK0A 3TMPB 3JW0X 3ALBA 1KH0A 1KLUD 4RGTA 2KDBA 1E10A 5AZFA 3MTNB 3V6EB 2QCZA 4ZRJA 1F1HA 1XT9B 1YQ3B 4FHKA 2BGFA 2N9LA 1PYWD 2RR9A 3LXFA 5IOIA 3W1YA 3M3JA 4KV2A 1KLGD 1QOAA 3DBRB 1TBEA 1K52A 3SHQA 2NTTA 2Z0EB 1WGKA 4MGZE 4WAAA 4MELA 1OQQA 2OOBB 2K22A 3WANA 3NUHB 3PS6A 4EOYA 1WMHA 4BBNC 1I4HA 3V60A 4A55A 2BKFA 4RH6A 2C60A 3IT4B 1WJNA 3VTUA 1VZ7A 1PDXA 4BKSD 4DHJB 2JT4B 4A3PA 1JWBD 5AUKA 3M62B 1XF5L 3DVNU 3KYCD 4KZCA 1GJZA 4TV3A 1P9DU 5BYQA 3OLMD 3ZXVA 4WJQA 4YSXB 1ZXIA 4LDTD 3CSFA 4N6EB 4OVVA 1J8CA 3AE8B 3W1SC 1T6BX 5E6NA 1NYQA 4NQLB 1IGDA 3JYUA 1K50A 3IBEA 1C78A 3V3XA 5JH5C 3DOWA 1V49A 4C4VB 3HM6X 2Y3AA 4K3CA 3R2IA 2MJ3A 1OGWA 2IGHA 2LXCA 3TSSA 3H6NA 2KQ7A 2IO1B 3Q8AA 2M19A 1IP9A 2ZZPB 4ASWC 2K9XA 3PLUA 1E7VA 4GMVA 3S2AA 3CSTA 3ENEA 2INPE 3APDA 4RCOA 3TJPA 3SD5A 4AP4C 2RGFA 1SJED 2M56B 3PZ8A 2R61A 2FIFA 2HJ1A 3L13A 4II3B 3ZDTA 3EFCA 4B0MA 2K3UA 4LTUA 1Q0WB 2NPTB 2G1EA 2LGYA 5BYSA 2VRRB 3P42A 1WXMA 3Q8EA 2WXIA 3VFKA 1V97A 5AEKB 1V6EA 2MW5A 3L4PA 1P3QU 1SEBD 1QZEA 1SE9A 2LGSA 1XCQL 3DVNV 3VH3B 1TKEA 1XLNA 2RDBC 1FFVA 1X1MA 1E6EB 1YOVB 4JWSC 2LEKA 2N7JA 2ACZB 4AUQC 4IM2A 2QIEB 3H1UA 2JVCA 1N62A 1JWAD 1UWMA 4HXDA 5C23A 4ANUA 4JQWC 1WR1A 4M8NA 2GBNA 1BMLC 1TKGA 3NS8A 4TSSA 4KGTA 4ANXA 2Y5CA 3NZUA 5I4DA 2WDTB 4MM3B 1FO4A 2XK5A 3T3OA 2EMSA 2LRWA 3RNAC 2Z8LA 4FXCA 1Q10A 1T0QC 2WXJA 2NMQA 3CIRB 1WXAA 5HI1A 3R66C 1S3SG 4NAMA 3ZLZA 1FNUA 3NZ3A 3AEDB 2LJIA 2C7HA 1OTRB 4M0WB 2LUMA 3H8HA 1A70A 3AB5A 1FD6A 4MDKE 2KQ4X 1UELA 3VTWA 3Q6BA 4BVUC 4MT5A 1CK1A 1P7FA 1S1QB 3ZRCA 2JRHA 1VZ8A 5MPOA 5FR3A 4EFOA 4FHJA 3DVGX 1JWUD 2DAJA 1DOYA 4HJGE 1I42A 1T0SC 3EECA 4GDLB 2CU3A 5H8YE 1V86A 1UUPA 3L54A 1SXTA 1KTKA 3RNGC 2WXRA 5IP4D 2J7QB 4EE2A 1ZDXA 1DYQA 4JLCA 4BBNF 4FJZA 4BOSC 2DWQA 2C5LC 3U7DA 2DZMA 2JXTA 5TR5A 3VUXA 3R7QA 1D6EC 1TS5A 4US9A 1JRPA 1WGYA 1YQ4B 4URKA 1QLBB 2KAJA 1YIWA 2K6QA 2L83A 4K1RB 3SEBA 3TEWA 3LB8C 2B3AA 1SGHA 4PS3A 1EWCA 4OZCA 4E71A 1MHXA 2OJWA 4HCNB 2K25A 2KX3A 5GXGB 3L17A 2AWTA 2KXJA 1GUAB 3IAM1 1JW9D 2LVPA 1RWSA 2BBCA 1Q1OA 2WX0A 3AH7A 3KQ4A 1F52A 4XZ4A 3ML9A 5G2NA 1WZ3A 4ZYSA 4NAWA 4GDKA 4C00A 1N6ZA 1SE3A 2QJLA 4HLEA 2C7NB 4H2AA 3MHZA 1XLOA 2LZ6A 4CO7A 2D3CA 1VZ6A 1MFWA 2PMVA 5G55A 3ZTCA 2W54A 2MP2A 4NJCA 3AE6B 4MJSB 2HJ8A 3C19A 4O1NA 3NVVA 4LNNA 2VZKD 4MSMB 2WP9B 1D3ZA 2W3SA 1HA5A 4JPSA 1AN8A 3B9JA 4GXBA 2DYMA 2JF5A 3T9LA 3ZNGC 2MWSB 3IXSA 5AUIA 5C1ZA 3AE9B 1VRAB 2HTME 1P7EA 5CHVC 2GB1A 2BS2B 1J19A 3DBHI 3GP7A 3B2GA 3PPAA 3Q2AC 2LD9A 4AWJA 2M4NA 3Q3FA 1EU3A 4BFRA 2OHFA 2LGIA 2QHOA 2WU2B 1J0GA 1FEHA 4ZRQA 4NNJB 3RZWC 4P1BC 3P1MA 3NS1A 2N4FA 1UWXA 4NY0A 3ZNZB 3R2TA 3ZJUA 3BVMA 3MP9A 2KVRA 4GN1A 2TSSA 2RPVA 2Z0DB 1WJ6A 1V1OA 1T3QA 3PRZA 5JHAA 1XD3B 3AEBB 2IO0B 3A4SC 1WE7A 3L08A 4MSQB 2PKOA 3N9YC 4LLGM 4LNFA 4HDOA 1WZ0A 1M4VA 5EE9A 4DHZE 2CS4A 4BAXA 2MA9B 3N3KB 2CJOA 4KGRA 4EZLA 1WMHB 1XLPA 5G5GA 1EF5A 2G4SA 1VCBA 2LHDA 4II2B 4RF0A 4IWPA 3W5UB 1STEA 4E3CA 4L23A 2BF8B 3Q3OC 3I9V1 1GC7A 2J0JA 2PPHA 4DDID 1RRBA 1WX8A 3I63C 3NVYA 3UQBA 3X23A 1E8XA 2DLBA 2LASA 1XQQA 4MEMA 1C4AA 3GZNB 2NTSA 2FCQA 3ZNHB 4RGNA 4HPMB 1V80A 1WJUA 2REXA 4LNKA 2K6DB 2Q5WD 3VAWA 4ARIA 1SSNA 3QWZB 4IM0A 2IYDB 1EWYC 3LJ3A 1E9MA 3AECB 2V4IB 1P0RA 4XDDA 4L2YA 1QOBA 1R4MB 3Q3NC 1ROEA 2QEJC 3ZO5B 4BKGA 4IM3A 3A9JA 3H9DA 2LI5A 1OEYJ 4NZLB 2BYTA 4YSYB 2O6VA 4PYUA 2QSDA 3SR6A 3URYA 1TYGB 1TZ1A 3ECIA 3VQIA 1SBBB 2ZNVC 2UWQA 4KGSA 1WGRA 2RSUA 4KIKA 3HHMA 4ZRPA 4HPPA 5LXIB 3RUIB 3A9KB 2NBUA 2YEPB 3Q8CA 4MJSA 2NBVB 1U4AA 3AXCA 2JZZA 1HE8A 2EKEC 1UGMA 1YQBA 3DDCB 5HG2A 2EKIA 3PLVA 3MJWA 3HIZA 1V2YA 4I6LB 2NR2A 4ACFA 3KUZA 3GOEA 3FAHA 3EA6A 1KLVA 3B08A 5BMHA 5CX3A 1YJJA 1GPXA 2XK5B 3J9CA 4EUTA 3OG5A 3VTVA 4WAFA 2PTLA 4LCDE 3VVWB 2NCNA 3GZNI 2RD0A 3DBSA 4P16A 4ANWA 3VUWA 1XEEA 1M94A 1MVKA 1WX9A 2CHZA 2LXAA 3GS2A 1ZKHA 4F1SA 2XNAC 2JU6X 5HKHA 3DBLB 1ZE3D 4YL8A 1R4MI 1YJIA 4USAA 4PYZA 3K9PB 4B6WA 1C77A 3EGRA 1GB4A 3AE4B 2NBWB 3N32A 3UF8A 3AV8A 3Q3MC 4TQ0A 2HDEA 1CJEA 3WALA 1R4NB 3C8YA 4G11A 3RMKC 1WXVA 1KRHA 3PHXB 4W9HA 1TKYA 4TUUA 1IPGA 1E0ZA 3JSVA 2BWFA 1FPYA 2JWUA 1YMHE 1Z2MA 1FXAA 1NBFC 3HUIA 1HEZE 2M0AA 3AEGB 4HJKA 3PZDA 2L0FA 2GMIC 1B9RA 2WDRB 3QARA 2B76B 2M0XA 2L76A 2LGDA 4CYEA 1FRRA 2YVCA 2IY0B 2WX1A 4FULA 3MC9A 3BVGA 5BMGA 3VUYA 1QQRA 2KNBA 3AMZA 4HCPB 4US8A 3L16A 2SAKA 1N5WA 4IUMB 4XWWA 2L00B 1L5PA 1UH6A 4LNOA 5EE0A 4P1CC 4NAWB 2L52A 2FIDA 4GDKB 2PVGC 3N1ZC 3DQVA 1QF6A 3M95A 1L4ZB 2BS3B 2L3ZA 4AQ7A 1FNWA 2WXNA 5L95C 3TEXA 2IJ0A 2MP2B 2ZCCA 3EUB2 1LQBA 3OJ3A 2DAFA 2GBRA 2V3SA 3NG0A 2KDMA 1JQ4A 4ZRIA 1I4QA 2Y5BB 3RD2A 4IOIE 1E7PB 4NPNA 2KJ6A 3PRPB 4RFBA 4YWGG 1TY0A 1C79A 1TS4A 3VHTC 5CHWA 2BB6A 2N7EA 3DBRI 5E6PA 2J4XA 3U4EG 4OZAA 2KWUB 4ZHPA 1WXSA 1EO6A 1GAQB 2RDGA 1YX6B 4AJYB 3A9KA 5FR6A 3I57A 2IO3B 4LDTB 1DOIA 1JMLA 2MH7A 2MLBA 3LDZE 2K5PA 1RFAA 3FKYA 4KVGB 2UU7A 4WWPA 4BKTA 2KD0A 1TIFA 1HQRD 5D7GA 3TCAA 3K9OB 3RI7C 1UGJA 4LK0M 1IBXA 1HXYD 4AJWA 3SDLC 3M63B 3U2SC 4HEA1 2BPSA 4GIVA 1UZXB 3APCA 4B0EA 3ZNID 5J18A 2J53A 2RPQA 2BYEA 3UGBB 4YT0B 4KKIA 4B9KA 3GE8C 3MFGA 2FUG1 4RGOS 3UIOB 1K51A 1C3TA 2IGDA 4WWMA 4JL9A 4DQOC 1NVID 2JZ3B 2V1YA 2MX2A 2IPKD 1UNSA 3QA8A 2V3NA 3U30A 1YJ1A 1LM8B 1ISNA 2MRPA 4WWOA 3GE3C 2GBJA 4S17A 2MBBB 1TGZB 2LVOA 1AYFA 3E56A 3DHGC 1WY8A 4NJ7A 3ONSA 2BVCA 2WXKA 2N1VA 4YTNB 1BXTA 2IBIB 1KM7A 4JGHB 2CHWA 2I1JA 4REZA 1JALA 3OAWA 2M8SA 3V61A 4C7ZA 1OQRA 3TEYA 1NDDA 1ZW7A 5DPTA 2LRUA 2KFKB 4W9IA 1KF6B 2ZJDA 1L4DB 2AQ3B 1WGGA 4HKZE 5HFYA 2KTFA 2BS4B 3DHIC 3KVFB 4IKGA 4K7SA 4P7IA 4FJYA 4IWQA 1SIJA 2L1AA 2ZCBA 2DYOA 4DWFA 1P1AA 3NVWA 2ZVNA 2LUEA 4P6VF 2J0KA 5LNK1 1L7YA 3ABVB 3KH0A 2AQ2B 3A9JB 4C7YA 3WIMA 1AW7A 4BZAA 2IY1B 4J3OD 2O6VB 3UI3A 2OJRA 1PUTA 4FN2A 5T8IA 2N1WA 5D2MB 2KKCA 3IG3A 2AL6A 4KIKB 2AEHA 1NENB 5IKCM 3FILA 2KANA 3T3NA 2D2QA 2KJRA 2R2OA 1JRUA 4A8XC 4PS8A 2WHIA 2H88B 3HVDA 3PV1A 3D32A 1EUVB 3VR9B 1TS2A 3ZKJC 3DWGC 3P4RB 4GLSC 2LVQA 2FAZA 1C1YB 4A3OA 1V1PB 4AOFA 1I4GA 1LXDA 1ZPSA 2K1FA 2QC8A 1L6UA 2Z59B 5E6OA 2KHWB 1SE4A 3C0RB 4BKSA 2CJNA 2ZEQA 4JIOU 2D07B 2M1MA 3ZDMC 1UBQA 3ETRA 1PGAA 3BK2A 2I1KA 3O65B 2QMTA 4MH0E 2KDIA 1I35A 1QILA 1BUIC 3RZFA 2YLMA 3IHPC 1BT0A 1WWTA 2CHXA 5EDSA 4TKNA 1I4RA 2N9KA 2I2YA 3DVGY 4YTMB 1GC6A 1C76A 1DOXA 1LGRA 2PJHA 3Q8BA 4KX6B 1GNUA 3AEAB 4RNAA 2ON8A 5CHFA 3NHEB 2DHZA 1SJHD 3ZUNA 2XEWA 3DWMA 1KFYB 2WDQB 3OWEB 2INDC 1SF0A 3NY5A 2L05A 3P4PB 1L0YB 1TY2A 2E6XA 2PE9A 1YX5B 3MC8A 3VRBB 4X57B 3QC8B 1WI0A 3ZGZA 3HM3A 1D5MC 4XX5A 3AE7B 3RNCC 5E6JA 3WAMA 1P98A 3JSVB 2WXQA 1KJTA 3LYYA 2PW9A 1EU4A 3A4RA 2FBWB 4KSKC 1ET6A 2INNE 4LNIA 3AN1A 3AEFB 1RLFA 1JROA 1TJEA 4KKJA 1I4XA 2L32A 2LMCA 4B95A 1WIAA 3UIPB 3BZDB 1G6JA 1OEYA 3P4SB 2JZPA 3HK0A 1NYRA 1IYFA 2BB5A 1EM7A 3AM9A 1YN3A 5D3DA 2D11A 2KFKA 2AQ1B 2I38A 3OJ4B 3UINB 3PO0A 2BWES 4WQOB 3N30A 3VR8B 2KK8A 1J7BA 1NI3A 4XDCA 2D3BA 4KSLC 2JYEA 2H89B 1FM0D 4KZ0A 2N9PC 2VH2A 3HRDD 2KQSA 1C9FA 5G5HA 2X38A 2FNJB 4FADA 4XE0A 1EF1A 3H7PB 3W9CB 2KN5A 1N5XA 2LHEA 2N7DA 3NZSA 3QAQA 1I7HA 1E90A 1LO5D 2BQQA 2N9EB 5AZHA 1ACCA 2KLCA 4DDGD 1XXGA 4EEWA 3ZJTA 4ICUA 4YSZB 1VDVA 1D4BA 4EZJA 4M01A 3PGEA 3RNFC 2Y5PA 2N9XA 3Q14C 2WXPA 1WGDA 2J52A 4RF1A 3PHWB 4HKQA 3TBLD 1AARA 4KDLB 1V1PA 2W82A 4W9DA 1OQYA 4N9F4 4ZYNA 2BKRB 4MGIE 1FRDA 2AX5A 3PREA 4WIPA 5EE1A 3UQAA 1IBXB 3AU4A 3VRAB 2G3QB 5JHBA 3NOBA 3NJTA 1WH3A 5D3IB 2MCNB 2W3RA 1D5ZC 2KWDA 1N60A 3R8BA 1F9JA 2KFJA 5IAAC 1WSPA 4M8MA 3KLSX 2WXLA 1WF9A 4A90A 2JWZA 3L0WB 1T0RC 4OZBA 1WR6E 4A20A 2KC2A 3MJ5A 1HZ5A 1XO3A 1FFUA 3QHTA 1PFDA 1E8WA 1XCTL 2VH1A 4DHJD 4XGAB 5TSSA 1ET9A 4L1BA 2QDFA 4YXDB 3P2BA 1YN5A 2HTHA 2CU1A 2O2VB 1HTOA 3RFZB 1YD8U 4FBJB 4HWIB 4PS7A 2D3GA 2J42A 2KWCA 2GBKA 2V9HA 2GOWA 4E74A 4FLHA 3B2FA 4HDQA 4GOCA 3QX1A 3ZRFA 4RM8A 3R3MA 4W9CA 5BYRA 3BIID 2MHJA 3Q3JA 3KUCB 4TQ1A 3H7SA 3N20C 2A5UA 1ZOYB 4JWUC 5LXHA 1FCCC 1VD2A 1HTQA 2KO3A 5JZEB 2INCC 4CHKA 1RAXA 3V6CB 2K8BA 4GB9A 3U8ZA 2KX0A 4HK2A 2K39A 4CQNA 1GG3A 2GI9A 1L6VA 1D5XC 3RN9C 3A1QA 4QAYA 3ZTDA 1E7UA 1DGJA 2NVUI 2WXFA 3ZQ4A 3ML8A 5BO4B 1PGBA 2KMMA 5D6JB 3P63A 3FILB 2ONQA 3RULA 3SU8X 3NRZA 5KHQA 1ZGUB 1Y56A 4HRSA 3H7PA 4MACA 1F2RI 3DBLI 4G3XB 1N61A 2JSVX 1NI2A 2IGGA 4WH4A 3TIXA 2FCNA 1F2RC 2A4ZA 1PQSA 1CZPA 5AZGA 4YTPB 4DXAB 1KOTA 4W9FA 2WGSA 2KTRA 4OHJA 4IW0A 2R2QA 2BT6A 2G45B 2DZKA 2WLBA 2ZPYA 1Z5SB 4WJOA 1R4NI 4AS1A 4ARCA 2CR5A 3PRMB 3T8MA 1IUEA 4GGQA 1F77A 4D2KA 1ENFA 3AULA 4XC2A 3N1YC 4WQMA 1ZP0B 3AU5A 3AE2B 4DHZB 4K7WA 4IC7B 3ZYYX 1C4CA 4XYCA 1V5TA 1WE6A 1MG4A 2SEBD 2KC1A 2C9WB 1MPEA 2KDEB 2PIAA 4JX1C 3ZW3A 1H8CA 2RMMA 2IZVB 3R7RA 3BYTB 3QCAA 3AE5B 2JQRB 3PZ7A 3W1SA 1VJKA 4KDIC 4W9GA 1JCKB 4W9LA 3BYYB 4M00A 1QOFA 5GMVA 1QT9A 2IDYA 1LFDA 3U52E 4G50A 4W9JA 1N63A 2DZJA 4JE3B 3Q8FA 4MGYE 3IT6B 1RYJA 1VR9A 2DX5B 3L10B 4WJPA 1QKZA 2EELA 2V0GA 3ZJVA 2X8XX 3A33B 1WRDB 4R3DA 5JXVA 3QQ8B 1WRIA 5C2TB 1GB1A 4BOZB 2O2VA 4NJ6A 2MJDA 5J17A 3CMMB 3SFDB 1E8ZA 2XN9C 1TS3A 1NEKB 2KT7A 4K7UA 2O6VD 2BYFA 3APFA 4ANVA 4ZHOA 1CMXB 4W9EA 3W5VB 3BWUD 1IGCA 2JRIB 4IG7B 3EC8A 2L8JA 2D3AA 3VXWA 5IN7A 2KVZA 4ITKA 4A6QA 2DYBA 2PVOD 1WJ4A 4WURA 3SFEB 3KWVA 1RFKA 4FJVB 4W9KA 1HZ6A 2M17A 1UD7A 2WDVB 2YEPF 1Q5WB 1FXIA 2BYVE 3BINA 3DBHB 4N58A 3E9SA 3RNBC 2E3TA 2KMAA 2ASQA 1TT5B 3WA0A 2KJHB 3KW5B 3AEEB 2JUOA 2FUHB 3MHSD 1L2NA 1J7CA 2MBOA 4IWOA 2LGXA 3AE3B 1MJDA 2DBYA 2ZPNA 1MHHE 5H92C 4EZKA 2W55A 2WS3B 3QJZA 4RM9A 1L0XB 3PT2B 3AE1B 3W2DA 5DPRA 1WM3A 2IO2B 1V81A 4OW0A 1WFYA 1A5RA 2ICIA 2LFIA 4C4VA 2FCMA 1L0VB 3O13A 3IVFA 3ZVVA 2UYZB 5C3JB 1ESFA 4IDIA 3BK1A 2LJ5A 5IO9A 1FIQA 3V05A 4K81A 5DPSA 1FNVA 2HE7A 2JPHA 2ZW0A
chains in the Genus database with same CATH topology
4HJKA 2KN5A 2DZIA 3PZDA 3R66C 2L0FA 1S3SG 2GMIC 2N7DA 3NZSA 3QARA 3ZLZA 2M0XA 3QAQA 2L76A 3TL5A 2LGDA 1E90A 4CYEA 4ICVA 2NPTA 2C7HA 2K8HA 2N9EB 1OTRB 5AZHA 2KLCA 4M0WB 2YVCA 4DDGD 2IY0B 4EEWA 2WX1A 4FULA 4ICUA 3VUYA 4MDKE 1UELA 5KHOA 2KNBA 3VTWA 2J0MA 3PVLA 4HCPB 4BVUC 3L16A 4EZJA 4IUMB 1S1QB 3ZRCA 3PGEA 2JRHA 2L00B 1UH6A 2N9XA 4EFOA 4FHJA 1WGDA 3DVGX 2DAJA 2WWZA 3EHVA 1I42A 3EECA 3PHWB 4GDLB 2WYQA 3TBLD 1AARA 4KDLB 4NAWB 2FIDA 4GDKB 1V86A 4W9DA 3DQVA 1OQYA 3L54A 4N9F4 3PSEB 1K8RB 2KMCA 3M95A 4ZYNA 2BKRB 2L3ZA 4MGIE 2J7QB 4HPLB 1WX7A 4JLCA 3PREA 4BBNF 4FJZA 3UQAA 4EKUA 3AU4A 4LJOB 4BOSC 4GSWA 1MG8A 4MM3A 5L95C 2G3QB 5JHBA 2C5LC 2ZNVB 3NOBA 2MP2B 2ZCCA 2DZMA 5TR5A 3U7DA 3VUXA 1LQBA 3OJ3A 3R7QA 1WH3A 2DAFA 2GBRA 5IA7A 2V3SA 3VDZA 4ZRIA 2MCNB 3WAPA 2Y5BB 1WGYA 1V9JA 3RD2A 4NPNA 4URKA 1F9JA 2KJ6A 2KFJA 5IAAC 4DBGA 1YIWA 2MBQA 2K6QA 4K1RB 3PRPB 4M8MA 3V62A 1WF9A 2JWZA 3WAOA 3L0WB 2B3AA 1SGHA 5D94A 4PS3A 1WR6E 4A20A 2KC2A 2PE6B 4MGKE 3VHTC 3RCZA 4E71A 2KOXA 5CHWA 4HCNB 2N7EA 2K25A 3DBRI 5DPWA 5E6PA 2KX3A 3QHTA 3ZIMA 3L17A 1WGHA 2AWTA 2HD5B 2KWUB 2KXJA 1E8WA 1GUAB 1EO6A 1WXSA 3KYDD 2MBHA 4OVUA 4DHJD 2KLGA 2LVPA 1YX6B 4AJYB 1Q1OA 2WX0A 3A9KA 5CTRC 5FR6A 4F8CB 2IO3B 3P2BA 4LDTB 4XZ4A 3ML9A 5G2NA 2HTHA 1WZ3A 2CU1A 3DPDA 2PEAA 3A1QB 4GDLA 4NAWA 4FA6A 2O2VB 4GDKA 2MLBA 3LDZE 1YD8U 4HLEA 1RFAA 4FBJB 2MQJA 4HWIB 2C7NB 2K8CA 3QIJA 4PS7A 2D3GA 4KVGB 2KWCA 4WWPA 5DCNA 4BKTA 2KD0A 2LZ6A 2GBKA 2GOWA 2C7MB 4E74A 1E5WA 3I3TB 5D7GA 4FLHA 3TCAA 4CO7A 4HDQA 3K9OB 2W9NA 4GOCA 4WWNA 3QX1A 4ZRKA 3SDLC 4AJWA 5G55A 3M63B 4RM8A 3ZRFA 1WYWB 3R3MA 3ZTCA 2MP2A 3CF6E 4W9CA 2BPSA 3RT3B 4GIVA 1UZXB 2AYOB 3APCA 4MJSB 1UBIA 2HJ8A 3Q3JA 3ZNID 4F7ZA 5J18A 2L7RA 3KUCB 3PTFC 1E8YA 2RPQA 4MSMB 4TQ1A 2BYEA 3UGBB 2V4LA 5LLIA 1D3ZA 3H7SA 2L0TA 2A5UA 4G0NB 4B9KA 2KDFB 5LXHA 1VD2A 4GXBA 2G4DB 2DYMA 2JF5A 3UIOB 3X0WA 1C3TA 2KO3A 4JL9A 5JZEB 2KTRB 3T9LA 3ZNGC 2MBEA 2MWSB 4CHKA 2JZ3B 1FXTB 2V1YA 2MX2A 3BY4B 5C1ZA 1RAXA 3V6CB 2K8BA 2LWPA 5CHVC 4GB9A 3QA8A 3U8ZA 3U30A 1YJ1A 1LM8B 3IFWB 1J19A 1TTNA 2KX0A 3DBHI 2KZRA 3PPAA 4HK2A 1ISNA 2MRPA 4WWOA 4NQKE 4GU2A 2GBJA 2K39A 2LD9A 4AWJA 2M4NA 3Q3FA 2MBBB 1GG3A 1TGZB 2LVOA 3EFUA 4J6IA 4LJPB 1T0YA 4BFRA 2ZVOA 3A1QA 1WY8A 3ZTDA 2AL3A 2QHOA 4NJ7A 3ONSA 1J0GA 1E7UA 2NVUI 2XBBC 2N1VA 3DCGA 2IBIB 4NNJB 3RZWC 4I6PA 1KM7A 2FCSA 3ML8A 4JGHB 5BO4B 2CHWA 2N4FA 5D6JB 4HVBA 2I1JA 4NY0A 3ZNZB 3OAWA 2M8SA 3V61A 2D10A 1Y8RC 1NDDA 3RULA 2KVRA 4GN1A 3SU8X 1ZW7A 5DPTA 2JXXA 1SIFA 2LRUA 2KFKB 5KHQA 1ZGUB 4W9IA 2Z0DB 3AI5A 3H7PA 1WJ6A 3DBLI 2ZJDA 4G3XB 3PRZA 5JHAA 1XD3B 2IO0B 3B0AA 1NI2A 3A4SC 1WE7A 1WGGA 3L08A 2KTFA 2NS5A 4ZDVA 5L83A 4MSQB 3TIXA 2FCNA 2A4ZA 3KVFB 4K7SA 1H4RA 1PQSA 4HDOA 1WZ0A 1WM2A 4DXAB 5AZGA 1KOTA 4DHZE 2CS4A 2MSED 4W9FA 2MA9B 2KTRA 3N3KB 4FJYA 4IWQA 4P7IA 3VH4B 2ZCBA 5J2RA 2DYOA 4IW0A 1V5OA 2R2QA 2G45B 2CKHB 2DZKA 4RMAA 1P1AA 4DWFA 4EZLA 2ZPYA 2ZVNA 2DENB 2LUEA 3JVZX 1Z5SB 1WMHB 2J0KA 4WJOA 2KWVB 1R4NI 2GBMA 1L7YA 1EF5A 2CR5A 3KH0A 3PRMB 3T8MA 3A9JB 4GGQA 2JY6A 3WIMA 2G4SA 1VCBA 3AULA 2IY1B 4II2B 4XC2A 2O6VB 4IWPA 4WJNA 4I6NB 2OJRA 4FN2A 4E3CA 2N1WA 5D2MB 3AU5A 2KKCA 3RYTA 2BF8B 4DHZB 3IG3A 4K7WA 2AL6A 4IC7B 2EMTA 3B1LX 1GC7A 2J0JA 2PPHA 1V5TA 1WE6A 4DDID 3KUDB 4DK5A 1RRBA 1WX8A 4KIKB 3QK0A 3TMPB 2AEHA 3JW0X 2KC1A 3ALBA 2C9WB 3UQBA 2KANA 2KDBA 3X23A 1E8XA 2LASA 2KDEB 2D2QA 2KJRA 3MTNB 5AZFA 2R2OA 1JRUA 3V6EB 4ZRJA 1XQQA 4PS8A 3ZW3A 1H8CA 4MEMA 1XT9B 2IZVB 3PV1A 3D32A 1EUVB 3R7RA 2FCQA 4FHKA 3ZKJC 3ZNHB 2BGFA 2LVQA 2FAZA 1V80A 4HPMB 1C1YB 4A3OA 1WJUA 2REXA 3QCAA 2RR9A 4AOFA 3W1YA 2K6DB 3M3JA 4KV2A 1LXDA 3VAWA 1TBEA 3W1SA 3SHQA 4KDIC 4W9GA 4W9LA 2Z0EB 3QWZB 4IM0A 2K1FA 4MGZE 4WAAA 5GMVA 2Z59B 4MELA 5E6OA 2KHWB 2IYDB 2OOBB 1LFDA 3WANA 3LJ3A 3C0RB 4G50A 4W9JA 2DZJA 1P0RA 4MGYE 4BKSA 3PS6A 4EOYA 1WMHA 4BBNC 2DX5B 3ZO5B 3L10B 4BKGA 4IM3A 3V60A 4WJPA 2ZEQA 3A9JA 2BKFA 4JIOU 2C60A 3H9DA 2D07B 2LI5A 1OEYJ 1WJNA 3VTUA 3A33B 2O6VA 2M1MA 3ZDMC 1UBQA 1WRDB 4PYUA 4BKSD 4DHJB 2JT4B 2I1KA 4A3PA 3O65B 4MH0E 1TZ1A 2KDIA 3QQ8B 3ECIA 3VQIA 4BOZB 1I35A 3RZFA 2O2VA 2ZNVC 3M62B 2UWQA 4NJ6A 3DVNU 2YLMA 3KYCD 4KZCA 3CMMB 5J17A 3IHPC 1BT0A 1E8ZA 1GJZA 1WGRA 2CHXA 2RSUA 4KIKA 4TV3A 5EDSA 1P9DU 3HHMA 4TKNA 4K7UA 2O6VD 2BYFA 3APFA 3OLMD 4WJQA 4OVVA 4LDTD 3CSFA 3DVGY 1J8CA 4ANVA 1GC6A 1CMXB 4W9EA 5LXIB 3RUIB 3W1SC 2JRIB 3A9KB 2PJHA 4IG7B 5E6NA 2NBUA 4NQLB 3EC8A 2L8JA 3VXWA 1GNUA 3JYUA 4MJSA 3IBEA 2NBVB 5CHFA 1U4AA 3AXCA 2JZZA 5JH5C 2DYBA 1WJ4A 3NHEB 3DOWA 2DHZA 1V49A 3ZUNA 3HM6X 1HE8A 2EKEC 1UGMA 1YQBA 2XEWA 3DDCB 3PLVA 3MJWA 3HIZA 4FJVB 4W9KA 3NY5A 2M17A 1UD7A 1OGWA 1V2YA 2L05A 2NR2A 4I6LB 3KUZA 2LXCA 3H6NA 2KQ7A 1Q5WB 2IO1B 3GOEA 3BINA 2BYVE 1IP9A 2PE9A 2ZZPB 4ASWC 1YX5B 4X57B 3PLUA 3QC8B 1WI0A 1KLVA 3B08A 1E7VA 3HM3A 4XX5A 4GMVA 5CX3A 2XK5B 3WAMA 1P98A 2KMAA 3JSVB 2ASQA 1KJTA 3CSTA 3ENEA 3S2AA 3WA0A 4EUTA 2KJHB 3KW5B 3APDA 3VTVA 3TJPA 3A4RA 2JUOA 3SD5A 4KSKC 4AP4C 2RGFA 4LCDE 2FUHB 3MHSD 1L2NA 3VVWB 2MBOA 2NCNA 4IWOA 1RLFA 3GZNI 2FIFA 2RD0A 3DBSA 4ANWA 2LGXA 3L13A 4II3B 3ZDTA 3VUWA 1M94A 2ZPNA 4EZKA 1Q0WB 2NPTB 2LGYA 1WX9A 2CHZA 3QJZA 2VRRB 2LXAA 4RM9A 1WXMA 3VFKA 3PT2B 1ZKHA 4B95A 1WIAA 5DPRA 1WM3A 3UIPB 4F1SA 1V6EA 2MW5A 5AEKB 1P3QU 2IO2B 1V81A 1QZEA 5HKHA 1OEYA 1SE9A 1G6JA 3DVNV 1WFYA 3HK0A 3VH3B 1IYFA 1A5RA 4YL8A 1R4MI 2D11A 1X1MA 2KFKA 4PYZA 3K9PB 3UINB 3OJ4B 4B6WA 4AUQC 2BWES 4IM2A 4WQOB 2FCMA 3H1UA 3N30A 3IVFA 2NBWB 2JVCA 3N32A 4HXDA 2KK8A 5C23A 3UF8A 4ANUA 4TQ0A 4JQWC 1WR1A 4M8NA 3WALA 2GBNA 3ZVVA 4KSLC 4G11A 1WXVA 3NS8A 3PHXB 4KZ0A 4ANXA 2N9PC 3NZUA 4W9HA 2UYZB 4TUUA 1IPGA 2WDTB 2XK5A 2KQSA 3JSVA 2EMSA 2BWFA 2LRWA 2LJ5A 1Z2MA 2FNJB 4K81A 5DPSA 4FADA 1EF1A 3H7PB 2HE7A 1NBFC 2JPHA 1WXAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HJK A;  2KN5 A;  2DZI A;  3PZD A;  3R66 C;  2L0F A;  1S3S G;  2GMI C;  2N7D A;  3NZS A;  3QAR A;  3ZLZ A;  2M0X A;  3QAQ A;  2L76 A;  3TL5 A;  2LGD A;  1E90 A;  4CYE A;  4ICV A;  2NPT A;  2C7H A;  2K8H A;  2N9E B;  1OTR B;  5AZH A;  2KLC A;  4M0W B;  2YVC A;  4DDG D;  2IY0 B;  4EEW A;  2WX1 A;  4FUL A;  4ICU A;  3VUY A;  4MDK E;  1UEL A;  5KHO A;  2KNB A;  3VTW A;  2J0M A;  3PVL A;  4HCP B;  4BVU C;  3L16 A;  4EZJ A;  4IUM B;  1S1Q B;  3ZRC A;  3PGE A;  2JRH A;  2L00 B;  1UH6 A;  2N9X A;  4EFO A;  4FHJ A;  1WGD A;  3DVG X;  2DAJ A;  2WWZ A;  3EHV A;  1I42 A;  3EEC A;  3PHW B;  4GDL B;  2WYQ A;  3TBL D;  1AAR A;  4KDL B;  4NAW B;  2FID A;  4GDK B;  1V86 A;  4W9D A;  3DQV A;  1OQY A;  3L54 A;  4N9F 4;  3PSE B;  1K8R B;  2KMC A;  3M95 A;  4ZYN A;  2BKR B;  2L3Z A;  4MGI E;  2J7Q B;  4HPL B;  1WX7 A;  4JLC A;  3PRE A;  4BBN F;  4FJZ A;  3UQA A;  4EKU A;  3AU4 A;  4LJO B;  4BOS C;  4GSW A;  1MG8 A;  4MM3 A;  5L95 C;  2G3Q B;  5JHB A;  2C5L C;  2ZNV B;  3NOB A;  2MP2 B;  2ZCC A;  2DZM A;  5TR5 A;  3U7D A;  3VUX A;  1LQB A;  3OJ3 A;  3R7Q A;  1WH3 A;  2DAF A;  2GBR A;  5IA7 A;  2V3S A;  3VDZ A;  4ZRI A;  2MCN B;  3WAP A;  2Y5B B;  1WGY A;  1V9J A;  3RD2 A;  4NPN A;  4URK A;  1F9J A;  2KJ6 A;  2KFJ A;  5IAA C;  4DBG A;  1YIW A;  2MBQ A;  2K6Q A;  4K1R B;  3PRP B;  4M8M A;  3V62 A;  1WF9 A;  2JWZ A;  3WAO A;  3L0W B;  2B3A A;  1SGH A;  5D94 A;  4PS3 A;  1WR6 E;  4A20 A;  2KC2 A;  2PE6 B;  4MGK E;  3VHT C;  3RCZ A;  4E71 A;  2KOX A;  5CHW A;  4HCN B;  2N7E A;  2K25 A;  3DBR I;  5DPW A;  5E6P A;  2KX3 A;  3QHT A;  3ZIM A;  3L17 A;  1WGH A;  2AWT A;  2HD5 B;  2KWU B;  2KXJ A;  1E8W A;  1GUA B;  1EO6 A;  1WXS A;  3KYD D;  2MBH A;  4OVU A;  4DHJ D;  2KLG A;  2LVP A;  1YX6 B;  4AJY B;  1Q1O A;  2WX0 A;  3A9K A;  5CTR C;  5FR6 A;  4F8C B;  2IO3 B;  3P2B A;  4LDT B;  4XZ4 A;  3ML9 A;  5G2N A;  2HTH A;  1WZ3 A;  2CU1 A;  3DPD A;  2PEA A;  3A1Q B;  4GDL A;  4NAW A;  4FA6 A;  2O2V B;  4GDK A;  2MLB A;  3LDZ E;  1YD8 U;  4HLE A;  1RFA A;  4FBJ B;  2MQJ A;  4HWI B;  2C7N B;  2K8C A;  3QIJ A;  4PS7 A;  2D3G A;  4KVG B;  2KWC A;  4WWP A;  5DCN A;  4BKT A;  2KD0 A;  2LZ6 A;  2GBK A;  2GOW A;  2C7M B;  4E74 A;  1E5W A;  3I3T B;  5D7G A;  4FLH A;  3TCA A;  4CO7 A;  4HDQ A;  3K9O B;  2W9N A;  4GOC A;  4WWN A;  3QX1 A;  4ZRK A;  3SDL C;  4AJW A;  5G55 A;  3M63 B;  4RM8 A;  3ZRF A;  1WYW B;  3R3M A;  3ZTC A;  2MP2 A;  3CF6 E;  4W9C A;  2BPS A;  3RT3 B;  4GIV A;  1UZX B;  2AYO B;  3APC A;  4MJS B;  1UBI A;  2HJ8 A;  3Q3J A;  3ZNI D;  4F7Z A;  5J18 A;  2L7R A;  3KUC B;  3PTF C;  1E8Y A;  2RPQ A;  4MSM B;  4TQ1 A;  2BYE A;  3UGB B;  2V4L A;  5LLI A;  1D3Z A;  3H7S A;  2L0T A;  2A5U A;  4G0N B;  4B9K A;  2KDF B;  5LXH A;  1VD2 A;  4GXB A;  2G4D B;  2DYM A;  2JF5 A;  3UIO B;  3X0W A;  1C3T A;  2KO3 A;  4JL9 A;  5JZE B;  2KTR B;  3T9L A;  3ZNG C;  2MBE A;  2MWS B;  4CHK A;  2JZ3 B;  1FXT B;  2V1Y A;  2MX2 A;  3BY4 B;  5C1Z A;  1RAX A;  3V6C B;  2K8B A;  2LWP A;  5CHV C;  4GB9 A;  3QA8 A;  3U8Z A;  3U30 A;  1YJ1 A;  1LM8 B;  3IFW B;  1J19 A;  1TTN A;  2KX0 A;  3DBH I;  2KZR A;  3PPA A;  4HK2 A;  1ISN A;  2MRP A;  4WWO A;  4NQK E;  4GU2 A;  2GBJ A;  2K39 A;  2LD9 A;  4AWJ A;  2M4N A;  3Q3F A;  2MBB B;  1GG3 A;  1TGZ B;  2LVO A;  3EFU A;  4J6I A;  4LJP B;  1T0Y A;  4BFR A;  2ZVO A;  3A1Q A;  1WY8 A;  3ZTD A;  2AL3 A;  2QHO A;  4NJ7 A;  3ONS A;  1J0G A;  1E7U A;  2NVU I;  2XBB C;  2N1V A;  3DCG A;  2IBI B;  4NNJ B;  3RZW C;  4I6P A;  1KM7 A;  2FCS A;  3ML8 A;  4JGH B;  5BO4 B;  2CHW A;  2N4F A;  5D6J B;  4HVB A;  2I1J A;  4NY0 A;  3ZNZ B;  3OAW A;  2M8S A;  3V61 A;  2D10 A;  1Y8R C;  1NDD A;  3RUL A;  2KVR A;  4GN1 A;  3SU8 X;  1ZW7 A;  5DPT A;  2JXX A;  1SIF A;  2LRU A;  2KFK B;  5KHQ A;  1ZGU B;  4W9I A;  2Z0D B;  3AI5 A;  3H7P A;  1WJ6 A;  3DBL I;  2ZJD A;  4G3X B;  3PRZ A;  5JHA A;  1XD3 B;  2IO0 B;  3B0A A;  1NI2 A;  3A4S C;  1WE7 A;  1WGG A;  3L08 A;  2KTF A;  2NS5 A;  4ZDV A;  5L83 A;  4MSQ B;  3TIX A;  2FCN A;  2A4Z A;  3KVF B;  4K7S A;  1H4R A;  1PQS A;  4HDO A;  1WZ0 A;  1WM2 A;  4DXA B;  5AZG A;  1KOT A;  4DHZ E;  2CS4 A;  2MSE D;  4W9F A;  2MA9 B;  2KTR A;  3N3K B;  4FJY A;  4IWQ A;  4P7I A;  3VH4 B;  2ZCB A;  5J2R A;  2DYO A;  4IW0 A;  1V5O A;  2R2Q A;  2G45 B;  2CKH B;  2DZK A;  4RMA A;  1P1A A;  4DWF A;  4EZL A;  2ZPY A;  2ZVN A;  2DEN B;  2LUE A;  3JVZ X;  1Z5S B;  1WMH B;  2J0K A;  4WJO A;  2KWV B;  1R4N I;  2GBM A;  1L7Y A;  1EF5 A;  2CR5 A;  3KH0 A;  3PRM B;  3T8M A;  3A9J B;  4GGQ A;  2JY6 A;  3WIM A;  2G4S A;  1VCB A;  3AUL A;  2IY1 B;  4II2 B;  4XC2 A;  2O6V B;  4IWP A;  4WJN A;  4I6N B;  2OJR A;  4FN2 A;  4E3C A;  2N1W A;  5D2M B;  3AU5 A;  2KKC A;  3RYT A;  2BF8 B;  4DHZ B;  3IG3 A;  4K7W A;  2AL6 A;  4IC7 B;  2EMT A;  3B1L X;  1GC7 A;  2J0J A;  2PPH A;  1V5T A;  1WE6 A;  4DDI D;  3KUD B;  4DK5 A;  1RRB A;  1WX8 A;  4KIK B;  3QK0 A;  3TMP B;  2AEH A;  3JW0 X;  2KC1 A;  3ALB A;  2C9W B;  3UQB A;  2KAN A;  2KDB A;  3X23 A;  1E8X A;  2LAS A;  2KDE B;  2D2Q A;  2KJR A;  3MTN B;  5AZF A;  2R2O A;  1JRU A;  3V6E B;  4ZRJ A;  1XQQ A;  4PS8 A;  3ZW3 A;  1H8C A;  4MEM A;  1XT9 B;  2IZV B;  3PV1 A;  3D32 A;  1EUV B;  3R7R A;  2FCQ A;  4FHK A;  3ZKJ C;  3ZNH B;  2BGF A;  2LVQ A;  2FAZ A;  1V80 A;  4HPM B;  1C1Y B;  4A3O A;  1WJU A;  2REX A;  3QCA A;  2RR9 A;  4AOF A;  3W1Y A;  2K6D B;  3M3J A;  4KV2 A;  1LXD A;  3VAW A;  1TBE A;  3W1S A;  3SHQ A;  4KDI C;  4W9G A;  4W9L A;  2Z0E B;  3QWZ B;  4IM0 A;  2K1F A;  4MGZ E;  4WAA A;  5GMV A;  2Z59 B;  4MEL A;  5E6O A;  2KHW B;  2IYD B;  2OOB B;  1LFD A;  3WAN A;  3LJ3 A;  3C0R B;  4G50 A;  4W9J A;  2DZJ A;  1P0R A;  4MGY E;  4BKS A;  3PS6 A;  4EOY A;  1WMH A;  4BBN C;  2DX5 B;  3ZO5 B;  3L10 B;  4BKG A;  4IM3 A;  3V60 A;  4WJP A;  2ZEQ A;  3A9J A;  2BKF A;  4JIO U;  2C60 A;  3H9D A;  2D07 B;  2LI5 A;  1OEY J;  1WJN A;  3VTU A;  3A33 B;  2O6V A;  2M1M A;  3ZDM C;  1UBQ A;  1WRD B;  4PYU A;  4BKS D;  4DHJ B;  2JT4 B;  2I1K A;  4A3P A;  3O65 B;  4MH0 E;  1TZ1 A;  2KDI A;  3QQ8 B;  3ECI A;  3VQI A;  4BOZ B;  1I35 A;  3RZF A;  2O2V A;  2ZNV C;  3M62 B;  2UWQ A;  4NJ6 A;  3DVN U;  2YLM A;  3KYC D;  4KZC A;  3CMM B;  5J17 A;  3IHP C;  1BT0 A;  1E8Z A;  1GJZ A;  1WGR A;  2CHX A;  2RSU A;  4KIK A;  4TV3 A;  5EDS A;  1P9D U;  3HHM A;  4TKN A;  4K7U A;  2O6V D;  2BYF A;  3APF A;  3OLM D;  4WJQ A;  4OVV A;  4LDT D;  3CSF A;  3DVG Y;  1J8C A;  4ANV A;  1GC6 A;  1CMX B;  4W9E A;  5LXI B;  3RUI B;  3W1S C;  2JRI B;  3A9K B;  2PJH A;  4IG7 B;  5E6N A;  2NBU A;  4NQL B;  3EC8 A;  2L8J A;  3VXW A;  1GNU A;  3JYU A;  4MJS A;  3IBE A;  2NBV B;  5CHF A;  1U4A A;  3AXC A;  2JZZ A;  5JH5 C;  2DYB A;  1WJ4 A;  3NHE B;  3DOW A;  2DHZ A;  1V49 A;  3ZUN A;  3HM6 X;  1HE8 A;  2EKE C;  1UGM A;  1YQB A;  2XEW A;  3DDC B;  3PLV A;  3MJW A;  3HIZ A;  4FJV B;  4W9K A;  3NY5 A;  2M17 A;  1UD7 A;  1OGW A;  1V2Y A;  2L05 A;  2NR2 A;  4I6L B;  3KUZ A;  2LXC A;  3H6N A;  2KQ7 A;  1Q5W B;  2IO1 B;  3GOE A;  3BIN A;  2BYV E;  1IP9 A;  2PE9 A;  2ZZP B;  4ASW C;  1YX5 B;  4X57 B;  3PLU A;  3QC8 B;  1WI0 A;  1KLV A;  3B08 A;  1E7V A;  3HM3 A;  4XX5 A;  4GMV A;  5CX3 A;  2XK5 B;  3WAM A;  1P98 A;  2KMA A;  3JSV B;  2ASQ A;  1KJT A;  3CST A;  3ENE A;  3S2A A;  3WA0 A;  4EUT A;  2KJH B;  3KW5 B;  3APD A;  3VTV A;  3TJP A;  3A4R A;  2JUO A;  3SD5 A;  4KSK C;  4AP4 C;  2RGF A;  4LCD E;  2FUH B;  3MHS D;  1L2N A;  3VVW B;  2MBO A;  2NCN A;  4IWO A;  1RLF A;  3GZN I;  2FIF A;  2RD0 A;  3DBS A;  4ANW A;  2LGX A;  3L13 A;  4II3 B;  3ZDT A;  3VUW A;  1M94 A;  2ZPN A;  4EZK A;  1Q0W B;  2NPT B;  2LGY A;  1WX9 A;  2CHZ A;  3QJZ A;  2VRR B;  2LXA A;  4RM9 A;  1WXM A;  3VFK A;  3PT2 B;  1ZKH A;  4B95 A;  1WIA A;  5DPR A;  1WM3 A;  3UIP B;  4F1S A;  1V6E A;  2MW5 A;  5AEK B;  1P3Q U;  2IO2 B;  1V81 A;  1QZE A;  5HKH A;  1OEY A;  1SE9 A;  1G6J A;  3DVN V;  1WFY A;  3HK0 A;  3VH3 B;  1IYF A;  1A5R A;  4YL8 A;  1R4M I;  2D11 A;  1X1M A;  2KFK A;  4PYZ A;  3K9P B;  3UIN B;  3OJ4 B;  4B6W A;  4AUQ C;  2BWE S;  4IM2 A;  4WQO B;  2FCM A;  3H1U A;  3N30 A;  3IVF A;  2NBW B;  2JVC A;  3N32 A;  4HXD A;  2KK8 A;  5C23 A;  3UF8 A;  4ANU A;  4TQ0 A;  4JQW C;  1WR1 A;  4M8N A;  3WAL A;  2GBN A;  3ZVV A;  4KSL C;  4G11 A;  1WXV A;  3NS8 A;  3PHX B;  4KZ0 A;  4ANX A;  2N9P C;  3NZU A;  4W9H A;  2UYZ B;  4TUU A;  1IPG A;  2WDT B;  2XK5 A;  2KQS A;  3JSV A;  2EMS A;  2BWF A;  2LRW A;  2LJ5 A;  1Z2M A;  2FNJ B;  4K81 A;  5DPS A;  4FAD A;  1EF1 A;  3H7P B;  2HE7 A;  1NBF C;  2JPH A;  1WXA A; 
#chains in the Genus database with same CATH topology
 2DZI A;  3ZXR A;  4A9A A;  3Q69 A;  3TUO A;  3TL5 A;  2RDH A;  4ICV A;  2NPT A;  2K8H A;  1ZUD 2;  4UDU C;  5KHO A;  2WXO A;  2J0M A;  3PVL A;  1WXQ A;  2ZW1 A;  4Q2J A;  1J7A A;  2WWZ A;  3NVZ A;  3EHV A;  3MC0 B;  2WYQ A;  2GRI A;  3P4Q B;  2FE8 A;  3PSE B;  1K8R B;  2GLS A;  2KMC A;  4DXF A;  4HPL B;  2VZK B;  1WX7 A;  3GB1 A;  4EKU A;  4LJO B;  4GSW A;  1MG8 A;  4MM3 A;  2BTE A;  2ZNV B;  5IA7 A;  3VDZ A;  3WAP A;  1V9J A;  2D5G A;  4DBG A;  2MBQ A;  3V62 A;  3WAO A;  5D94 A;  1WYG A;  1GOZ A;  2PE6 B;  4MGK E;  2PLP A;  3RCZ A;  4M0W A;  2KOX A;  2MJE A;  3I5J C;  2N0S B;  5DPW A;  3ZIM A;  1WGH A;  1RM6 C;  2HD5 B;  1MI0 A;  3IAS 1;  4OVU A;  3KYD D;  2MBH A;  4C56 C;  2KLG A;  1YNT E;  2G9H D;  2WQY B;  5CTR C;  4F8C B;  2WXH A;  2MEK A;  4GDL A;  3DPD A;  2PEA A;  3A1Q B;  3U7Z A;  4FA6 A;  4XWT A;  1ZXH A;  2OED A;  1YN4 A;  2MQJ A;  2K8C A;  3QIJ A;  5DCN A;  1UF0 A;  4PK1 A;  2C7M B;  1E5W A;  3BVZ A;  3I3T B;  1SB3 C;  2W9N A;  4WWN A;  4N59 A;  5EE3 A;  4ZRK A;  1C4P A;  1B1Z A;  1WYW B;  3CF6 E;  3RT3 B;  2AYO B;  1ZDV A;  1UBI A;  4F7Z A;  3RNE C;  2L7R A;  3PTF C;  1E8Y A;  3N1X C;  2V4L A;  1R7S A;  5LLI A;  4M02 A;  2QIL A;  2KYW A;  2L0T A;  4G0N B;  1AWD A;  2KDF B;  1T5X D;  1V8C A;  1K53 A;  2G4D B;  3X0W A;  1SE2 A;  2KTR B;  5FKA C;  2MBE A;  1FCL A;  1FXT B;  1F0Z A;  3BY4 B;  2LWP A;  4HRO A;  3IFW B;  2WU5 B;  1CQV A;  1TTN A;  3FC4 A;  4PT5 A;  3RPF C;  2KZR A;  4S0R A;  4NQK E;  4GU2 A;  4C80 A;  3EFU A;  4J6I A;  4LJP B;  2BW2 A;  1T0Y A;  2ZVO A;  1OFF A;  3TEZ A;  2AL3 A;  3CWI A;  2XBB C;  1JWM D;  2KN4 A;  3DCG A;  2WNM A;  4I6P A;  1XLQ A;  2WXG A;  2FCS A;  2JYT A;  4HVB A;  1VLB A;  2D10 A;  1Y8R C;  3HVZ A;  2JXX A;  1SIF A;  3AI5 A;  1TZO A;  1FMA D;  4MH8 A;  4RGM A;  1QOG A;  3B0A A;  1JWS D;  2JX5 A;  2NS5 A;  4DXG A;  4ZDV A;  1H4R A;  4K3B A;  1WM2 A;  1I4P A;  2DNF A;  2MSE D;  5L83 A;  3VH4 B;  5J2R A;  1V5O A;  2CKH B;  4RMA A;  2DEN B;  3JVZ X;  3KWL A;  2KWV B;  2GBM A;  2JY6 A;  4ZOH C;  2V3P A;  1PGX A;  2WXM A;  4WJN A;  5HHD G;  4I6N B;  2KAC A;  4TMA B;  2K0P A;  3RYT A;  3WCQ A;  3DHH C;  5FK9 C;  2EMT A;  3B1L X;  5BMI A;  3KUD B;  4OVZ A;  4DK5 A;  3QK0 A;  3TMP B;  3JW0 X;  3ALB A;  1KH0 A;  1KLU D;  4RGT A;  2KDB A;  1E10 A;  5AZF A;  3MTN B;  3V6E B;  2QCZ A;  4ZRJ A;  1F1H A;  1XT9 B;  1YQ3 B;  4FHK A;  2BGF A;  2N9L A;  1PYW D;  2RR9 A;  3LXF A;  5IOI A;  3W1Y A;  3M3J A;  4KV2 A;  1KLG D;  1QOA A;  3DBR B;  1TBE A;  1K52 A;  3SHQ A;  2NTT A;  2Z0E B;  1WGK A;  4MGZ E;  4WAA A;  4MEL A;  1OQQ A;  2OOB B;  2K22 A;  3WAN A;  3NUH B;  3PS6 A;  4EOY A;  1WMH A;  4BBN C;  1I4H A;  3V60 A;  4A55 A;  2BKF A;  4RH6 A;  2C60 A;  3IT4 B;  1WJN A;  3VTU A;  1VZ7 A;  1PDX A;  4BKS D;  4DHJ B;  2JT4 B;  4A3P A;  1JWB D;  5AUK A;  3M62 B;  1XF5 L;  3DVN U;  3KYC D;  4KZC A;  1GJZ A;  4TV3 A;  1P9D U;  5BYQ A;  3OLM D;  3ZXV A;  4WJQ A;  4YSX B;  1ZXI A;  4LDT D;  3CSF A;  4N6E B;  4OVV A;  1J8C A;  3AE8 B;  3W1S C;  1T6B X;  5E6N A;  1NYQ A;  4NQL B;  1IGD A;  3JYU A;  1K50 A;  3IBE A;  1C78 A;  3V3X A;  5JH5 C;  3DOW A;  1V49 A;  4C4V B;  3HM6 X;  2Y3A A;  4K3C A;  3R2I A;  2MJ3 A;  1OGW A;  2IGH A;  2LXC A;  3TSS A;  3H6N A;  2KQ7 A;  2IO1 B;  3Q8A A;  2M19 A;  1IP9 A;  2ZZP B;  4ASW C;  2K9X A;  3PLU A;  1E7V A;  4GMV A;  3S2A A;  3CST A;  3ENE A;  2INP E;  3APD A;  4RCO A;  3TJP A;  3SD5 A;  4AP4 C;  2RGF A;  1SJE D;  2M56 B;  3PZ8 A;  2R61 A;  2FIF A;  2HJ1 A;  3L13 A;  4II3 B;  3ZDT A;  3EFC A;  4B0M A;  2K3U A;  4LTU A;  1Q0W B;  2NPT B;  2G1E A;  2LGY A;  5BYS A;  2VRR B;  3P42 A;  1WXM A;  3Q8E A;  2WXI A;  3VFK A;  1V97 A;  5AEK B;  1V6E A;  2MW5 A;  3L4P A;  1P3Q U;  1SEB D;  1QZE A;  1SE9 A;  2LGS A;  1XCQ L;  3DVN V;  3VH3 B;  1TKE A;  1XLN A;  2RDB C;  1FFV A;  1X1M A;  1E6E B;  1YOV B;  4JWS C;  2LEK A;  2N7J A;  2ACZ B;  4AUQ C;  4IM2 A;  2QIE B;  3H1U A;  2JVC A;  1N62 A;  1JWA D;  1UWM A;  4HXD A;  5C23 A;  4ANU A;  4JQW C;  1WR1 A;  4M8N A;  2GBN A;  1BML C;  1TKG A;  3NS8 A;  4TSS A;  4KGT A;  4ANX A;  2Y5C A;  3NZU A;  5I4D A;  2WDT B;  4MM3 B;  1FO4 A;  2XK5 A;  3T3O A;  2EMS A;  2LRW A;  3RNA C;  2Z8L A;  4FXC A;  1Q10 A;  1T0Q C;  2WXJ A;  2NMQ A;  3CIR B;  1WXA A;  5HI1 A;  3R66 C;  1S3S G;  4NAM A;  3ZLZ A;  1FNU A;  3NZ3 A;  3AED B;  2LJI A;  2C7H A;  1OTR B;  4M0W B;  2LUM A;  3H8H A;  1A70 A;  3AB5 A;  1FD6 A;  4MDK E;  2KQ4 X;  1UEL A;  3VTW A;  3Q6B A;  4BVU C;  4MT5 A;  1CK1 A;  1P7F A;  1S1Q B;  3ZRC A;  2JRH A;  1VZ8 A;  5MPO A;  5FR3 A;  4EFO A;  4FHJ A;  3DVG X;  1JWU D;  2DAJ A;  1DOY A;  4HJG E;  1I42 A;  1T0S C;  3EEC A;  4GDL B;  2CU3 A;  5H8Y E;  1V86 A;  1UUP A;  3L54 A;  1SXT A;  1KTK A;  3RNG C;  2WXR A;  5IP4 D;  2J7Q B;  4EE2 A;  1ZDX A;  1DYQ A;  4JLC A;  4BBN F;  4FJZ A;  4BOS C;  2DWQ A;  2C5L C;  3U7D A;  2DZM A;  2JXT A;  5TR5 A;  3VUX A;  3R7Q A;  1D6E C;  1TS5 A;  4US9 A;  1JRP A;  1WGY A;  1YQ4 B;  4URK A;  1QLB B;  2KAJ A;  1YIW A;  2K6Q A;  2L83 A;  4K1R B;  3SEB A;  3TEW A;  3LB8 C;  2B3A A;  1SGH A;  4PS3 A;  1EWC A;  4OZC A;  4E71 A;  1MHX A;  2OJW A;  4HCN B;  2K25 A;  2KX3 A;  5GXG B;  3L17 A;  2AWT A;  2KXJ A;  1GUA B;  3IAM 1;  1JW9 D;  2LVP A;  1RWS A;  2BBC A;  1Q1O A;  2WX0 A;  3AH7 A;  3KQ4 A;  1F52 A;  4XZ4 A;  3ML9 A;  5G2N A;  1WZ3 A;  4ZYS A;  4NAW A;  4GDK A;  4C00 A;  1N6Z A;  1SE3 A;  2QJL A;  4HLE A;  2C7N B;  4H2A A;  3MHZ A;  1XLO A;  2LZ6 A;  4CO7 A;  2D3C A;  1VZ6 A;  1MFW A;  2PMV A;  5G55 A;  3ZTC A;  2W54 A;  2MP2 A;  4NJC A;  3AE6 B;  4MJS B;  2HJ8 A;  3C19 A;  4O1N A;  3NVV A;  4LNN A;  2VZK D;  4MSM B;  2WP9 B;  1D3Z A;  2W3S A;  1HA5 A;  4JPS A;  1AN8 A;  3B9J A;  4GXB A;  2DYM A;  2JF5 A;  3T9L A;  3ZNG C;  2MWS B;  3IXS A;  5AUI A;  5C1Z A;  3AE9 B;  1VRA B;  2HTM E;  1P7E A;  5CHV C;  2GB1 A;  2BS2 B;  1J19 A;  3DBH I;  3GP7 A;  3B2G A;  3PPA A;  3Q2A C;  2LD9 A;  4AWJ A;  2M4N A;  3Q3F A;  1EU3 A;  4BFR A;  2OHF A;  2LGI A;  2QHO A;  2WU2 B;  1J0G A;  1FEH A;  4ZRQ A;  4NNJ B;  3RZW C;  4P1B C;  3P1M A;  3NS1 A;  2N4F A;  1UWX A;  4NY0 A;  3ZNZ B;  3R2T A;  3ZJU A;  3BVM A;  3MP9 A;  2KVR A;  4GN1 A;  2TSS A;  2RPV A;  2Z0D B;  1WJ6 A;  1V1O A;  1T3Q A;  3PRZ A;  5JHA A;  1XD3 B;  3AEB B;  2IO0 B;  3A4S C;  1WE7 A;  3L08 A;  4MSQ B;  2PKO A;  3N9Y C;  4LLG M;  4LNF A;  4HDO A;  1WZ0 A;  1M4V A;  5EE9 A;  4DHZ E;  2CS4 A;  4BAX A;  2MA9 B;  3N3K B;  2CJO A;  4KGR A;  4EZL A;  1WMH B;  1XLP A;  5G5G A;  1EF5 A;  2G4S A;  1VCB A;  2LHD A;  4II2 B;  4RF0 A;  4IWP A;  3W5U B;  1STE A;  4E3C A;  4L23 A;  2BF8 B;  3Q3O C;  3I9V 1;  1GC7 A;  2J0J A;  2PPH A;  4DDI D;  1RRB A;  1WX8 A;  3I63 C;  3NVY A;  3UQB A;  3X23 A;  1E8X A;  2DLB A;  2LAS A;  1XQQ A;  4MEM A;  1C4A A;  3GZN B;  2NTS A;  2FCQ A;  3ZNH B;  4RGN A;  4HPM B;  1V80 A;  1WJU A;  2REX A;  4LNK A;  2K6D B;  2Q5W D;  3VAW A;  4ARI A;  1SSN A;  3QWZ B;  4IM0 A;  2IYD B;  1EWY C;  3LJ3 A;  1E9M A;  3AEC B;  2V4I B;  1P0R A;  4XDD A;  4L2Y A;  1QOB A;  1R4M B;  3Q3N C;  1ROE A;  2QEJ C;  3ZO5 B;  4BKG A;  4IM3 A;  3A9J A;  3H9D A;  2LI5 A;  1OEY J;  4NZL B;  2BYT A;  4YSY B;  2O6V A;  4PYU A;  2QSD A;  3SR6 A;  3URY A;  1TYG B;  1TZ1 A;  3ECI A;  3VQI A;  1SBB B;  2ZNV C;  2UWQ A;  4KGS A;  1WGR A;  2RSU A;  4KIK A;  3HHM A;  4ZRP A;  4HPP A;  5LXI B;  3RUI B;  3A9K B;  2NBU A;  2YEP B;  3Q8C A;  4MJS A;  2NBV B;  1U4A A;  3AXC A;  2JZZ A;  1HE8 A;  2EKE C;  1UGM A;  1YQB A;  3DDC B;  5HG2 A;  2EKI A;  3PLV A;  3MJW A;  3HIZ A;  1V2Y A;  4I6L B;  2NR2 A;  4ACF A;  3KUZ A;  3GOE A;  3FAH A;  3EA6 A;  1KLV A;  3B08 A;  5BMH A;  5CX3 A;  1YJJ A;  1GPX A;  2XK5 B;  3J9C A;  4EUT A;  3OG5 A;  3VTV A;  4WAF A;  2PTL A;  4LCD E;  3VVW B;  2NCN A;  3GZN I;  2RD0 A;  3DBS A;  4P16 A;  4ANW A;  3VUW A;  1XEE A;  1M94 A;  1MVK A;  1WX9 A;  2CHZ A;  2LXA A;  3GS2 A;  1ZKH A;  4F1S A;  2XNA C;  2JU6 X;  5HKH A;  3DBL B;  1ZE3 D;  4YL8 A;  1R4M I;  1YJI A;  4USA A;  4PYZ A;  3K9P B;  4B6W A;  1C77 A;  3EGR A;  1GB4 A;  3AE4 B;  2NBW B;  3N32 A;  3UF8 A;  3AV8 A;  3Q3M C;  4TQ0 A;  2HDE A;  1CJE A;  3WAL A;  1R4N B;  3C8Y A;  4G11 A;  3RMK C;  1WXV A;  1KRH A;  3PHX B;  4W9H A;  1TKY A;  4TUU A;  1IPG A;  1E0Z A;  3JSV A;  2BWF A;  1FPY A;  2JWU A;  1YMH E;  1Z2M A;  1FXA A;  1NBF C;  3HUI A;  1HEZ E;  2M0A A;  3AEG B;  4HJK A;  3PZD A;  2L0F A;  2GMI C;  1B9R A;  2WDR B;  3QAR A;  2B76 B;  2M0X A;  2L76 A;  2LGD A;  4CYE A;  1FRR A;  2YVC A;  2IY0 B;  2WX1 A;  4FUL A;  3MC9 A;  3BVG A;  5BMG A;  3VUY A;  1QQR A;  2KNB A;  3AMZ A;  4HCP B;  4US8 A;  3L16 A;  2SAK A;  1N5W A;  4IUM B;  4XWW A;  2L00 B;  1L5P A;  1UH6 A;  4LNO A;  5EE0 A;  4P1C C;  4NAW B;  2L52 A;  2FID A;  4GDK B;  2PVG C;  3N1Z C;  3DQV A;  1QF6 A;  3M95 A;  1L4Z B;  2BS3 B;  2L3Z A;  4AQ7 A;  1FNW A;  2WXN A;  5L95 C;  3TEX A;  2IJ0 A;  2MP2 B;  2ZCC A;  3EUB 2;  1LQB A;  3OJ3 A;  2DAF A;  2GBR A;  2V3S A;  3NG0 A;  2KDM A;  1JQ4 A;  4ZRI A;  1I4Q A;  2Y5B B;  3RD2 A;  4IOI E;  1E7P B;  4NPN A;  2KJ6 A;  3PRP B;  4RFB A;  4YWG G;  1TY0 A;  1C79 A;  1TS4 A;  3VHT C;  5CHW A;  2BB6 A;  2N7E A;  3DBR I;  5E6P A;  2J4X A;  3U4E G;  4OZA A;  2KWU B;  4ZHP A;  1WXS A;  1EO6 A;  1GAQ B;  2RDG A;  1YX6 B;  4AJY B;  3A9K A;  5FR6 A;  3I57 A;  2IO3 B;  4LDT B;  1DOI A;  1JML A;  2MH7 A;  2MLB A;  3LDZ E;  2K5P A;  1RFA A;  3FKY A;  4KVG B;  2UU7 A;  4WWP A;  4BKT A;  2KD0 A;  1TIF A;  1HQR D;  5D7G A;  3TCA A;  3K9O B;  3RI7 C;  1UGJ A;  4LK0 M;  1IBX A;  1HXY D;  4AJW A;  3SDL C;  3M63 B;  3U2S C;  4HEA 1;  2BPS A;  4GIV A;  1UZX B;  3APC A;  4B0E A;  3ZNI D;  5J18 A;  2J53 A;  2RPQ A;  2BYE A;  3UGB B;  4YT0 B;  4KKI A;  4B9K A;  3GE8 C;  3MFG A;  2FUG 1;  4RGO S;  3UIO B;  1K51 A;  1C3T A;  2IGD A;  4WWM A;  4JL9 A;  4DQO C;  1NVI D;  2JZ3 B;  2V1Y A;  2MX2 A;  2IPK D;  1UNS A;  3QA8 A;  2V3N A;  3U30 A;  1YJ1 A;  1LM8 B;  1ISN A;  2MRP A;  4WWO A;  3GE3 C;  2GBJ A;  4S17 A;  2MBB B;  1TGZ B;  2LVO A;  1AYF A;  3E56 A;  3DHG C;  1WY8 A;  4NJ7 A;  3ONS A;  2BVC A;  2WXK A;  2N1V A;  4YTN B;  1BXT A;  2IBI B;  1KM7 A;  4JGH B;  2CHW A;  2I1J A;  4REZ A;  1JAL A;  3OAW A;  2M8S A;  3V61 A;  4C7Z A;  1OQR A;  3TEY A;  1NDD A;  1ZW7 A;  5DPT A;  2LRU A;  2KFK B;  4W9I A;  1KF6 B;  2ZJD A;  1L4D B;  2AQ3 B;  1WGG A;  4HKZ E;  5HFY A;  2KTF A;  2BS4 B;  3DHI C;  3KVF B;  4IKG A;  4K7S A;  4P7I A;  4FJY A;  4IWQ A;  1SIJ A;  2L1A A;  2ZCB A;  2DYO A;  4DWF A;  1P1A A;  3NVW A;  2ZVN A;  2LUE A;  4P6V F;  2J0K A;  5LNK 1;  1L7Y A;  3ABV B;  3KH0 A;  2AQ2 B;  3A9J B;  4C7Y A;  3WIM A;  1AW7 A;  4BZA A;  2IY1 B;  4J3O D;  2O6V B;  3UI3 A;  2OJR A;  1PUT A;  4FN2 A;  5T8I A;  2N1W A;  5D2M B;  2KKC A;  3IG3 A;  2AL6 A;  4KIK B;  2AEH A;  1NEN B;  5IKC M;  3FIL A;  2KAN A;  3T3N A;  2D2Q A;  2KJR A;  2R2O A;  1JRU A;  4A8X C;  4PS8 A;  2WHI A;  2H88 B;  3HVD A;  3PV1 A;  3D32 A;  1EUV B;  3VR9 B;  1TS2 A;  3ZKJ C;  3DWG C;  3P4R B;  4GLS C;  2LVQ A;  2FAZ A;  1C1Y B;  4A3O A;  1V1P B;  4AOF A;  1I4G A;  1LXD A;  1ZPS A;  2K1F A;  2QC8 A;  1L6U A;  2Z59 B;  5E6O A;  2KHW B;  1SE4 A;  3C0R B;  4BKS A;  2CJN A;  2ZEQ A;  4JIO U;  2D07 B;  2M1M A;  3ZDM C;  1UBQ A;  3ETR A;  1PGA A;  3BK2 A;  2I1K A;  3O65 B;  2QMT A;  4MH0 E;  2KDI A;  1I35 A;  1QIL A;  1BUI C;  3RZF A;  2YLM A;  3IHP C;  1BT0 A;  1WWT A;  2CHX A;  5EDS A;  4TKN A;  1I4R A;  2N9K A;  2I2Y A;  3DVG Y;  4YTM B;  1GC6 A;  1C76 A;  1DOX A;  1LGR A;  2PJH A;  3Q8B A;  4KX6 B;  1GNU A;  3AEA B;  4RNA A;  2ON8 A;  5CHF A;  3NHE B;  2DHZ A;  1SJH D;  3ZUN A;  2XEW A;  3DWM A;  1KFY B;  2WDQ B;  3OWE B;  2IND C;  1SF0 A;  3NY5 A;  2L05 A;  3P4P B;  1L0Y B;  1TY2 A;  2E6X A;  2PE9 A;  1YX5 B;  3MC8 A;  3VRB B;  4X57 B;  3QC8 B;  1WI0 A;  3ZGZ A;  3HM3 A;  1D5M C;  4XX5 A;  3AE7 B;  3RNC C;  5E6J A;  3WAM A;  1P98 A;  3JSV B;  2WXQ A;  1KJT A;  3LYY A;  2PW9 A;  1EU4 A;  3A4R A;  2FBW B;  4KSK C;  1ET6 A;  2INN E;  4LNI A;  3AN1 A;  3AEF B;  1RLF A;  1JRO A;  1TJE A;  4KKJ A;  1I4X A;  2L32 A;  2LMC A;  4B95 A;  1WIA A;  3UIP B;  3BZD B;  1G6J A;  1OEY A;  3P4S B;  2JZP A;  3HK0 A;  1NYR A;  1IYF A;  2BB5 A;  1EM7 A;  3AM9 A;  1YN3 A;  5D3D A;  2D11 A;  2KFK A;  2AQ1 B;  2I38 A;  3OJ4 B;  3UIN B;  3PO0 A;  2BWE S;  4WQO B;  3N30 A;  3VR8 B;  2KK8 A;  1J7B A;  1NI3 A;  4XDC A;  2D3B A;  4KSL C;  2JYE A;  2H89 B;  1FM0 D;  4KZ0 A;  2N9P C;  2VH2 A;  3HRD D;  2KQS A;  1C9F A;  5G5H A;  2X38 A;  2FNJ B;  4FAD A;  4XE0 A;  1EF1 A;  3H7P B;  3W9C B;  2KN5 A;  1N5X A;  2LHE A;  2N7D A;  3NZS A;  3QAQ A;  1I7H A;  1E90 A;  1LO5 D;  2BQQ A;  2N9E B;  5AZH A;  1ACC A;  2KLC A;  4DDG D;  1XXG A;  4EEW A;  3ZJT A;  4ICU A;  4YSZ B;  1VDV A;  1D4B A;  4EZJ A;  4M01 A;  3PGE A;  3RNF C;  2Y5P A;  2N9X A;  3Q14 C;  2WXP A;  1WGD A;  2J52 A;  4RF1 A;  3PHW B;  4HKQ A;  3TBL D;  1AAR A;  4KDL B;  1V1P A;  2W82 A;  4W9D A;  1OQY A;  4N9F 4;  4ZYN A;  2BKR B;  4MGI E;  1FRD A;  2AX5 A;  3PRE A;  4WIP A;  5EE1 A;  3UQA A;  1IBX B;  3AU4 A;  3VRA B;  2G3Q B;  5JHB A;  3NOB A;  3NJT A;  1WH3 A;  5D3I B;  2MCN B;  2W3R A;  1D5Z C;  2KWD A;  1N60 A;  3R8B A;  1F9J A;  2KFJ A;  5IAA C;  1WSP A;  4M8M A;  3KLS X;  2WXL A;  1WF9 A;  4A90 A;  2JWZ A;  3L0W B;  1T0R C;  4OZB A;  1WR6 E;  4A20 A;  2KC2 A;  3MJ5 A;  1HZ5 A;  1XO3 A;  1FFU A;  3QHT A;  1PFD A;  1E8W A;  1XCT L;  2VH1 A;  4DHJ D;  4XGA B;  5TSS A;  1ET9 A;  4L1B A;  2QDF A;  4YXD B;  3P2B A;  1YN5 A;  2HTH A;  2CU1 A;  2O2V B;  1HTO A;  3RFZ B;  1YD8 U;  4FBJ B;  4HWI B;  4PS7 A;  2D3G A;  2J42 A;  2KWC A;  2GBK A;  2V9H A;  2GOW A;  4E74 A;  4FLH A;  3B2F A;  4HDQ A;  4GOC A;  3QX1 A;  3ZRF A;  4RM8 A;  3R3M A;  4W9C A;  5BYR A;  3BII D;  2MHJ A;  3Q3J A;  3KUC B;  4TQ1 A;  3H7S A;  3N20 C;  2A5U A;  1ZOY B;  4JWU C;  5LXH A;  1FCC C;  1VD2 A;  1HTQ A;  2KO3 A;  5JZE B;  2INC C;  4CHK A;  1RAX A;  3V6C B;  2K8B A;  4GB9 A;  3U8Z A;  2KX0 A;  4HK2 A;  2K39 A;  4CQN A;  1GG3 A;  2GI9 A;  1L6V A;  1D5X C;  3RN9 C;  3A1Q A;  4QAY A;  3ZTD A;  1E7U A;  1DGJ A;  2NVU I;  2WXF A;  3ZQ4 A;  3ML8 A;  5BO4 B;  1PGB A;  2KMM A;  5D6J B;  3P63 A;  3FIL B;  2ONQ A;  3RUL A;  3SU8 X;  3NRZ A;  5KHQ A;  1ZGU B;  1Y56 A;  4HRS A;  3H7P A;  4MAC A;  1F2R I;  3DBL I;  4G3X B;  1N61 A;  2JSV X;  1NI2 A;  2IGG A;  4WH4 A;  3TIX A;  2FCN A;  1F2R C;  2A4Z A;  1PQS A;  1CZP A;  5AZG A;  4YTP B;  4DXA B;  1KOT A;  4W9F A;  2WGS A;  2KTR A;  4OHJ A;  4IW0 A;  2R2Q A;  2BT6 A;  2G45 B;  2DZK A;  2WLB A;  2ZPY A;  1Z5S B;  4WJO A;  1R4N I;  4AS1 A;  4ARC A;  2CR5 A;  3PRM B;  3T8M A;  1IUE A;  4GGQ A;  1F77 A;  4D2K A;  1ENF A;  3AUL A;  4XC2 A;  3N1Y C;  4WQM A;  1ZP0 B;  3AU5 A;  3AE2 B;  4DHZ B;  4K7W A;  4IC7 B;  3ZYY X;  1C4C A;  4XYC A;  1V5T A;  1WE6 A;  1MG4 A;  2SEB D;  2KC1 A;  2C9W B;  1MPE A;  2KDE B;  2PIA A;  4JX1 C;  3ZW3 A;  1H8C A;  2RMM A;  2IZV B;  3R7R A;  3BYT B;  3QCA A;  3AE5 B;  2JQR B;  3PZ7 A;  3W1S A;  1VJK A;  4KDI C;  4W9G A;  1JCK B;  4W9L A;  3BYY B;  4M00 A;  1QOF A;  5GMV A;  1QT9 A;  2IDY A;  1LFD A;  3U52 E;  4G50 A;  4W9J A;  1N63 A;  2DZJ A;  4JE3 B;  3Q8F A;  4MGY E;  3IT6 B;  1RYJ A;  1VR9 A;  2DX5 B;  3L10 B;  4WJP A;  1QKZ A;  2EEL A;  2V0G A;  3ZJV A;  2X8X X;  3A33 B;  1WRD B;  4R3D A;  5JXV A;  3QQ8 B;  1WRI A;  5C2T B;  1GB1 A;  4BOZ B;  2O2V A;  4NJ6 A;  2MJD A;  5J17 A;  3CMM B;  3SFD B;  1E8Z A;  2XN9 C;  1TS3 A;  1NEK B;  2KT7 A;  4K7U A;  2O6V D;  2BYF A;  3APF A;  4ANV A;  4ZHO A;  1CMX B;  4W9E A;  3W5V B;  3BWU D;  1IGC A;  2JRI B;  4IG7 B;  3EC8 A;  2L8J A;  2D3A A;  3VXW A;  5IN7 A;  2KVZ A;  4ITK A;  4A6Q A;  2DYB A;  2PVO D;  1WJ4 A;  4WUR A;  3SFE B;  3KWV A;  1RFK A;  4FJV B;  4W9K A;  1HZ6 A;  2M17 A;  1UD7 A;  2WDV B;  2YEP F;  1Q5W B;  1FXI A;  2BYV E;  3BIN A;  3DBH B;  4N58 A;  3E9S A;  3RNB C;  2E3T A;  2KMA A;  2ASQ A;  1TT5 B;  3WA0 A;  2KJH B;  3KW5 B;  3AEE B;  2JUO A;  2FUH B;  3MHS D;  1L2N A;  1J7C A;  2MBO A;  4IWO A;  2LGX A;  3AE3 B;  1MJD A;  2DBY A;  2ZPN A;  1MHH E;  5H92 C;  4EZK A;  2W55 A;  2WS3 B;  3QJZ A;  4RM9 A;  1L0X B;  3PT2 B;  3AE1 B;  3W2D A;  5DPR A;  1WM3 A;  2IO2 B;  1V81 A;  4OW0 A;  1WFY A;  1A5R A;  2ICI A;  2LFI A;  4C4V A;  2FCM A;  1L0V B;  3O13 A;  3IVF A;  3ZVV A;  2UYZ B;  5C3J B;  1ESF A;  4IDI A;  3BK1 A;  2LJ5 A;  5IO9 A;  1FIQ A;  3V05 A;  4K81 A;  5DPS A;  1FNV A;  2HE7 A;  2JPH A;  2ZW0 A; 
#chains in the Genus database with same CATH homology
 4HJK A;  2KN5 A;  2DZI A;  3PZD A;  3R66 C;  2L0F A;  1S3S G;  2GMI C;  2N7D A;  3NZS A;  3QAR A;  3ZLZ A;  2M0X A;  3QAQ A;  2L76 A;  3TL5 A;  2LGD A;  1E90 A;  4CYE A;  4ICV A;  2NPT A;  2C7H A;  2K8H A;  2N9E B;  1OTR B;  5AZH A;  2KLC A;  4M0W B;  2YVC A;  4DDG D;  2IY0 B;  4EEW A;  2WX1 A;  4FUL A;  4ICU A;  3VUY A;  4MDK E;  1UEL A;  5KHO A;  2KNB A;  3VTW A;  2J0M A;  3PVL A;  4HCP B;  4BVU C;  3L16 A;  4EZJ A;  4IUM B;  1S1Q B;  3ZRC A;  3PGE A;  2JRH A;  2L00 B;  1UH6 A;  2N9X A;  4EFO A;  4FHJ A;  1WGD A;  3DVG X;  2DAJ A;  2WWZ A;  3EHV A;  1I42 A;  3EEC A;  3PHW B;  4GDL B;  2WYQ A;  3TBL D;  1AAR A;  4KDL B;  4NAW B;  2FID A;  4GDK B;  1V86 A;  4W9D A;  3DQV A;  1OQY A;  3L54 A;  4N9F 4;  3PSE B;  1K8R B;  2KMC A;  3M95 A;  4ZYN A;  2BKR B;  2L3Z A;  4MGI E;  2J7Q B;  4HPL B;  1WX7 A;  4JLC A;  3PRE A;  4BBN F;  4FJZ A;  3UQA A;  4EKU A;  3AU4 A;  4LJO B;  4BOS C;  4GSW A;  1MG8 A;  4MM3 A;  5L95 C;  2G3Q B;  5JHB A;  2C5L C;  2ZNV B;  3NOB A;  2MP2 B;  2ZCC A;  2DZM A;  5TR5 A;  3U7D A;  3VUX A;  1LQB A;  3OJ3 A;  3R7Q A;  1WH3 A;  2DAF A;  2GBR A;  5IA7 A;  2V3S A;  3VDZ A;  4ZRI A;  2MCN B;  3WAP A;  2Y5B B;  1WGY A;  1V9J A;  3RD2 A;  4NPN A;  4URK A;  1F9J A;  2KJ6 A;  2KFJ A;  5IAA C;  4DBG A;  1YIW A;  2MBQ A;  2K6Q A;  4K1R B;  3PRP B;  4M8M A;  3V62 A;  1WF9 A;  2JWZ A;  3WAO A;  3L0W B;  2B3A A;  1SGH A;  5D94 A;  4PS3 A;  1WR6 E;  4A20 A;  2KC2 A;  2PE6 B;  4MGK E;  3VHT C;  3RCZ A;  4E71 A;  2KOX A;  5CHW A;  4HCN B;  2N7E A;  2K25 A;  3DBR I;  5DPW A;  5E6P A;  2KX3 A;  3QHT A;  3ZIM A;  3L17 A;  1WGH A;  2AWT A;  2HD5 B;  2KWU B;  2KXJ A;  1E8W A;  1GUA B;  1EO6 A;  1WXS A;  3KYD D;  2MBH A;  4OVU A;  4DHJ D;  2KLG A;  2LVP A;  1YX6 B;  4AJY B;  1Q1O A;  2WX0 A;  3A9K A;  5CTR C;  5FR6 A;  4F8C B;  2IO3 B;  3P2B A;  4LDT B;  4XZ4 A;  3ML9 A;  5G2N A;  2HTH A;  1WZ3 A;  2CU1 A;  3DPD A;  2PEA A;  3A1Q B;  4GDL A;  4NAW A;  4FA6 A;  2O2V B;  4GDK A;  2MLB A;  3LDZ E;  1YD8 U;  4HLE A;  1RFA A;  4FBJ B;  2MQJ A;  4HWI B;  2C7N B;  2K8C A;  3QIJ A;  4PS7 A;  2D3G A;  4KVG B;  2KWC A;  4WWP A;  5DCN A;  4BKT A;  2KD0 A;  2LZ6 A;  2GBK A;  2GOW A;  2C7M B;  4E74 A;  1E5W A;  3I3T B;  5D7G A;  4FLH A;  3TCA A;  4CO7 A;  4HDQ A;  3K9O B;  2W9N A;  4GOC A;  4WWN A;  3QX1 A;  4ZRK A;  3SDL C;  4AJW A;  5G55 A;  3M63 B;  4RM8 A;  3ZRF A;  1WYW B;  3R3M A;  3ZTC A;  2MP2 A;  3CF6 E;  4W9C A;  2BPS A;  3RT3 B;  4GIV A;  1UZX B;  2AYO B;  3APC A;  4MJS B;  1UBI A;  2HJ8 A;  3Q3J A;  3ZNI D;  4F7Z A;  5J18 A;  2L7R A;  3KUC B;  3PTF C;  1E8Y A;  2RPQ A;  4MSM B;  4TQ1 A;  2BYE A;  3UGB B;  2V4L A;  5LLI A;  1D3Z A;  3H7S A;  2L0T A;  2A5U A;  4G0N B;  4B9K A;  2KDF B;  5LXH A;  1VD2 A;  4GXB A;  2G4D B;  2DYM A;  2JF5 A;  3UIO B;  3X0W A;  1C3T A;  2KO3 A;  4JL9 A;  5JZE B;  2KTR B;  3T9L A;  3ZNG C;  2MBE A;  2MWS B;  4CHK A;  2JZ3 B;  1FXT B;  2V1Y A;  2MX2 A;  3BY4 B;  5C1Z A;  1RAX A;  3V6C B;  2K8B A;  2LWP A;  5CHV C;  4GB9 A;  3QA8 A;  3U8Z A;  3U30 A;  1YJ1 A;  1LM8 B;  3IFW B;  1J19 A;  1TTN A;  2KX0 A;  3DBH I;  2KZR A;  3PPA A;  4HK2 A;  1ISN A;  2MRP A;  4WWO A;  4NQK E;  4GU2 A;  2GBJ A;  2K39 A;  2LD9 A;  4AWJ A;  2M4N A;  3Q3F A;  2MBB B;  1GG3 A;  1TGZ B;  2LVO A;  3EFU A;  4J6I A;  4LJP B;  1T0Y A;  4BFR A;  2ZVO A;  3A1Q A;  1WY8 A;  3ZTD A;  2AL3 A;  2QHO A;  4NJ7 A;  3ONS A;  1J0G A;  1E7U A;  2NVU I;  2XBB C;  2N1V A;  3DCG A;  2IBI B;  4NNJ B;  3RZW C;  4I6P A;  1KM7 A;  2FCS A;  3ML8 A;  4JGH B;  5BO4 B;  2CHW A;  2N4F A;  5D6J B;  4HVB A;  2I1J A;  4NY0 A;  3ZNZ B;  3OAW A;  2M8S A;  3V61 A;  2D10 A;  1Y8R C;  1NDD A;  3RUL A;  2KVR A;  4GN1 A;  3SU8 X;  1ZW7 A;  5DPT A;  2JXX A;  1SIF A;  2LRU A;  2KFK B;  5KHQ A;  1ZGU B;  4W9I A;  2Z0D B;  3AI5 A;  3H7P A;  1WJ6 A;  3DBL I;  2ZJD A;  4G3X B;  3PRZ A;  5JHA A;  1XD3 B;  2IO0 B;  3B0A A;  1NI2 A;  3A4S C;  1WE7 A;  1WGG A;  3L08 A;  2KTF A;  2NS5 A;  4ZDV A;  5L83 A;  4MSQ B;  3TIX A;  2FCN A;  2A4Z A;  3KVF B;  4K7S A;  1H4R A;  1PQS A;  4HDO A;  1WZ0 A;  1WM2 A;  4DXA B;  5AZG A;  1KOT A;  4DHZ E;  2CS4 A;  2MSE D;  4W9F A;  2MA9 B;  2KTR A;  3N3K B;  4FJY A;  4IWQ A;  4P7I A;  3VH4 B;  2ZCB A;  5J2R A;  2DYO A;  4IW0 A;  1V5O A;  2R2Q A;  2G45 B;  2CKH B;  2DZK A;  4RMA A;  1P1A A;  4DWF A;  4EZL A;  2ZPY A;  2ZVN A;  2DEN B;  2LUE A;  3JVZ X;  1Z5S B;  1WMH B;  2J0K A;  4WJO A;  2KWV B;  1R4N I;  2GBM A;  1L7Y A;  1EF5 A;  2CR5 A;  3KH0 A;  3PRM B;  3T8M A;  3A9J B;  4GGQ A;  2JY6 A;  3WIM A;  2G4S A;  1VCB A;  3AUL A;  2IY1 B;  4II2 B;  4XC2 A;  2O6V B;  4IWP A;  4WJN A;  4I6N B;  2OJR A;  4FN2 A;  4E3C A;  2N1W A;  5D2M B;  3AU5 A;  2KKC A;  3RYT A;  2BF8 B;  4DHZ B;  3IG3 A;  4K7W A;  2AL6 A;  4IC7 B;  2EMT A;  3B1L X;  1GC7 A;  2J0J A;  2PPH A;  1V5T A;  1WE6 A;  4DDI D;  3KUD B;  4DK5 A;  1RRB A;  1WX8 A;  4KIK B;  3QK0 A;  3TMP B;  2AEH A;  3JW0 X;  2KC1 A;  3ALB A;  2C9W B;  3UQB A;  2KAN A;  2KDB A;  3X23 A;  1E8X A;  2LAS A;  2KDE B;  2D2Q A;  2KJR A;  3MTN B;  5AZF A;  2R2O A;  1JRU A;  3V6E B;  4ZRJ A;  1XQQ A;  4PS8 A;  3ZW3 A;  1H8C A;  4MEM A;  1XT9 B;  2IZV B;  3PV1 A;  3D32 A;  1EUV B;  3R7R A;  2FCQ A;  4FHK A;  3ZKJ C;  3ZNH B;  2BGF A;  2LVQ A;  2FAZ A;  1V80 A;  4HPM B;  1C1Y B;  4A3O A;  1WJU A;  2REX A;  3QCA A;  2RR9 A;  4AOF A;  3W1Y A;  2K6D B;  3M3J A;  4KV2 A;  1LXD A;  3VAW A;  1TBE A;  3W1S A;  3SHQ A;  4KDI C;  4W9G A;  4W9L A;  2Z0E B;  3QWZ B;  4IM0 A;  2K1F A;  4MGZ E;  4WAA A;  5GMV A;  2Z59 B;  4MEL A;  5E6O A;  2KHW B;  2IYD B;  2OOB B;  1LFD A;  3WAN A;  3LJ3 A;  3C0R B;  4G50 A;  4W9J A;  2DZJ A;  1P0R A;  4MGY E;  4BKS A;  3PS6 A;  4EOY A;  1WMH A;  4BBN C;  2DX5 B;  3ZO5 B;  3L10 B;  4BKG A;  4IM3 A;  3V60 A;  4WJP A;  2ZEQ A;  3A9J A;  2BKF A;  4JIO U;  2C60 A;  3H9D A;  2D07 B;  2LI5 A;  1OEY J;  1WJN A;  3VTU A;  3A33 B;  2O6V A;  2M1M A;  3ZDM C;  1UBQ A;  1WRD B;  4PYU A;  4BKS D;  4DHJ B;  2JT4 B;  2I1K A;  4A3P A;  3O65 B;  4MH0 E;  1TZ1 A;  2KDI A;  3QQ8 B;  3ECI A;  3VQI A;  4BOZ B;  1I35 A;  3RZF A;  2O2V A;  2ZNV C;  3M62 B;  2UWQ A;  4NJ6 A;  3DVN U;  2YLM A;  3KYC D;  4KZC A;  3CMM B;  5J17 A;  3IHP C;  1BT0 A;  1E8Z A;  1GJZ A;  1WGR A;  2CHX A;  2RSU A;  4KIK A;  4TV3 A;  5EDS A;  1P9D U;  3HHM A;  4TKN A;  4K7U A;  2O6V D;  2BYF A;  3APF A;  3OLM D;  4WJQ A;  4OVV A;  4LDT D;  3CSF A;  3DVG Y;  1J8C A;  4ANV A;  1GC6 A;  1CMX B;  4W9E A;  5LXI B;  3RUI B;  3W1S C;  2JRI B;  3A9K B;  2PJH A;  4IG7 B;  5E6N A;  2NBU A;  4NQL B;  3EC8 A;  2L8J A;  3VXW A;  1GNU A;  3JYU A;  4MJS A;  3IBE A;  2NBV B;  5CHF A;  1U4A A;  3AXC A;  2JZZ A;  5JH5 C;  2DYB A;  1WJ4 A;  3NHE B;  3DOW A;  2DHZ A;  1V49 A;  3ZUN A;  3HM6 X;  1HE8 A;  2EKE C;  1UGM A;  1YQB A;  2XEW A;  3DDC B;  3PLV A;  3MJW A;  3HIZ A;  4FJV B;  4W9K A;  3NY5 A;  2M17 A;  1UD7 A;  1OGW A;  1V2Y A;  2L05 A;  2NR2 A;  4I6L B;  3KUZ A;  2LXC A;  3H6N A;  2KQ7 A;  1Q5W B;  2IO1 B;  3GOE A;  3BIN A;  2BYV E;  1IP9 A;  2PE9 A;  2ZZP B;  4ASW C;  1YX5 B;  4X57 B;  3PLU A;  3QC8 B;  1WI0 A;  1KLV A;  3B08 A;  1E7V A;  3HM3 A;  4XX5 A;  4GMV A;  5CX3 A;  2XK5 B;  3WAM A;  1P98 A;  2KMA A;  3JSV B;  2ASQ A;  1KJT A;  3CST A;  3ENE A;  3S2A A;  3WA0 A;  4EUT A;  2KJH B;  3KW5 B;  3APD A;  3VTV A;  3TJP A;  3A4R A;  2JUO A;  3SD5 A;  4KSK C;  4AP4 C;  2RGF A;  4LCD E;  2FUH B;  3MHS D;  1L2N A;  3VVW B;  2MBO A;  2NCN A;  4IWO A;  1RLF A;  3GZN I;  2FIF A;  2RD0 A;  3DBS A;  4ANW A;  2LGX A;  3L13 A;  4II3 B;  3ZDT A;  3VUW A;  1M94 A;  2ZPN A;  4EZK A;  1Q0W B;  2NPT B;  2LGY A;  1WX9 A;  2CHZ A;  3QJZ A;  2VRR B;  2LXA A;  4RM9 A;  1WXM A;  3VFK A;  3PT2 B;  1ZKH A;  4B95 A;  1WIA A;  5DPR A;  1WM3 A;  3UIP B;  4F1S A;  1V6E A;  2MW5 A;  5AEK B;  1P3Q U;  2IO2 B;  1V81 A;  1QZE A;  5HKH A;  1OEY A;  1SE9 A;  1G6J A;  3DVN V;  1WFY A;  3HK0 A;  3VH3 B;  1IYF A;  1A5R A;  4YL8 A;  1R4M I;  2D11 A;  1X1M A;  2KFK A;  4PYZ A;  3K9P B;  3UIN B;  3OJ4 B;  4B6W A;  4AUQ C;  2BWE S;  4IM2 A;  4WQO B;  2FCM A;  3H1U A;  3N30 A;  3IVF A;  2NBW B;  2JVC A;  3N32 A;  4HXD A;  2KK8 A;  5C23 A;  3UF8 A;  4ANU A;  4TQ0 A;  4JQW C;  1WR1 A;  4M8N A;  3WAL A;  2GBN A;  3ZVV A;  4KSL C;  4G11 A;  1WXV A;  3NS8 A;  3PHX B;  4KZ0 A;  4ANX A;  2N9P C;  3NZU A;  4W9H A;  2UYZ B;  4TUU A;  1IPG A;  2WDT B;  2XK5 A;  2KQS A;  3JSV A;  2EMS A;  2BWF A;  2LRW A;  2LJ5 A;  1Z2M A;  2FNJ B;  4K81 A;  5DPS A;  4FAD A;  1EF1 A;  3H7P B;  2HE7 A;  1NBF C;  2JPH A;  1WXA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...