3WANA

Crystal structure of atg13 lir-fused human lc3a_2-121
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
126
structure length
126
Chain Sequence
DDFVMIGSPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Autophagy-related protein 13, Microtubule-associated protein
publication title Structural basis of the autophagy-related LC3/Atg13 LIR complex: recognition and interaction mechanism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 34
structure length 126
sequence length 126
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3wanA00
1SE9A 3TL5A 4PS7A 3JYUA 2DYBA 5LLIA 1MG8A 4GMVA 2DAFA 3R3MA 4FJZA 1RLFA 2JPHA 2V3SA 1TBEA 3Q3JA 4MJSA 1F9JA 3VUWA 2ZPNA 4BKTA 2CHXA 2CU1A 2XEWA 4GDKA 3JSVB 3VUXA 3EHVA 3QAQA 2BYEA 3KUZA 3QJZA 2Z0EB 2HTHA 4M0WB 1RAXA 2HD5B 2KK8A 3VXWA 4AUQC 1YJ1A 4KIKA 2BYFA 1VD2A 3H9DA 2LD9A 3ZTCA 3ZDMC 4YL8A 3QCAA 2K8BA 2KWVB 1IP9A 3B0AA 1YD8U 2KQ7A 5C23A 5J17A 3KUCB 2WYQA 3VDZA 4G3XB 2K8HA 4MJSB 2C5LC 1ZKHA 4W9DA 4LJOB 3OJ4B 1P9DU 2IO2B 3PRPB 2EKEC 3ZRCA 1WX8A 1V5TA 3VUYA 1WJNA 2LUEA 3PSEB 4KZ0A 3JVZX 1G6JA 1WIAA 3BY4B 2FCNA 3H6NA 5G55A 3TJPA 3DBSA 4GDLA 4W9JA 2W9NA 4KIKB 1GJZA 3CMMB 2A4ZA 2NPTA 3OAWA 1YIWA 2RPQA 1WZ3A 2L76A 4KDIC 4HJKA 2NVUI 2RGFA 4FBJB 1YX6B 1WE6A 2C60A 4CHKA 1D3ZA 4MGKE 1R4MI 2AL3A 3RUIB 2MCNB 2K25A 2LZ6A 3PV1A 2Y5BB 3SHQA 2PEAA 1RFAA 4TQ1A 2ZJDA 4CO7A 4DBGA 1WGRA 2K1FA 1OGWA 3CSFA 4GSWA 2LRWA 2C9WB 3VH4B 2MP2A 4BFRA 1QZEA 4W9IA 1OEYJ 3K9PB 1TGZB 3N32A 3AXCA 5E6PA 2KKCA 2JVCA 1E5WA 1Q1OA 3ZKJC 1TTNA 4ICUA 4K7UA 4AP4C 2UWQA 4MGIE 2NBUA 2EMSA 5AZGA 3DBLI 3M63B 4P7IA 1RRBA 1OTRB 1Z5SB 4K1RB 1Y8RC 4RM8A 3ZVVA 3RCZA 4HDQA 1H4RA 3QWZB 2BYVE 4IWOA 4K7WA 4LDTD 1WRDB 3NHEB 3HIZA 4DWFA 3B08A 3IFWB 3HHMA 2MP2B 2RR9A 2N7EA 2BWFA 4ZDVA 2JY6A 2D2QA 2J0KA 3A9JA 3N3KB 1C3TA 2G4SA 1C1YB 4HLEA 4EZKA 3MJWA 2MSED 2NBVB 2PJHA 2LXCA 4LCDE 3WAPA 3VTWA 2KWCA 2IO3B 4URKA 1EF5A 3L16A 3QA8A 4AJWA 4BKGA 1UBIA 4FJVB 4I6NB 4ASWC 2D10A 3PPAA 5DPTA 5IA7A 4EZJA 2J7QB 3T8MA 5DPRA 3PTFC 3M62B 4MH0E 4NY0A 4K81A 1K8RB 2CKHB 4HVBA 5JH5C 2IO0B 2YVCA 1V9JA 3SU8X 1WJ6A 5C1ZA 2R2OA 2KDBA 3APFA 3L10B 2V4LA 3A9JB 3P2BA 4FULA 2NR2A 2LVQA 4M8NA 1YQBA 2JRIB 1LQBA 1WGHA 2ZNVB 3DVNU 4MSMB 3UIOB 5CHWA 5AEKB 1OEYA 1IYFA 3EFUA 4NQLB 2MBQA 5AZFA 2KMAA 4FN2A 4G0NB 2D07B 4CYEA 2DZIA 4ZRIA 3U8ZA 1NI2A 4E74A 3AULA 3PREA 2L3ZA 2FIFA 3RT3B 3IHPC 4IM2A 5AZHA 4NAWA 3PT2B 1ZW7A 4TKNA 2N1WA 4JL9A 1WJUA 1WR1A 4IWPA 2FIDA 3QARA 1WMHA 3JW0X 2MW5A 3V60A 4TV3A 1GNUA 3PLVA 2LGYA 3HM6X 4IW0A 4BBNC 1WZ0A 3N30A 2IY1B 1WXVA 1WR6E 3PZDA 2G4DB 4WWPA 1TZ1A 4RM9A 4ZRKA 3HM3A 4DK5A 3S2AA 3V61A 3CSTA 2ZVNA 3NOBA 1X1MA 3A1QA 1AARA 4GB9A 3CF6E 4KSKC 2KC2A 4XZ4A 2KWUB 2MLBA 4FLHA 2QHOA 4DXAB 2JZ3B 2LVOA 2N9XA 4NAWB 3DDCB 1WFYA 3ZNID 2CS4A 2O6VA 4XX5A 3DVNV 4ICVA 3QQ8B 1WMHB 2JRHA 1SIFA 2KNBA 2LGXA 4MGYE 4N9F4 3UGBB 2OJRA 1WM2A 4AWJA 1S3SG 2BWES 2MX2A 4HDOA 4GDKB 2GMIC 1V80A 3RZFA 3UQAA 3PGEA 3UINB 2WDTB 1GG3A 4GXBA 2O6VD 5LXHA 5L95C 2RSUA 1KLVA 3U7DA 2C7NB 2JT4B 4PS3A 4JQWC 2GBMA 3H1UA 4WJQA 3H7PA 3KUDB 3L54A 2BF8B 2O6VB 3KH0A 2M0XA 2KANA 3QHTA 5HKHA 3ONSA 2IZVB 2N7DA 3QC8B 4W9GA 5FR6A 2CHWA 3A9KA 4EEWA 2KTFA 3NS8A 2KFKA 2KJRA 3D32A 4IUMB 2O2VA 5JHAA 5D2MB 2FCMA 5TR5A 2V1YA 3WIMA 4MDKE 4GDLB 3TBLD 1V5OA 2REXA 3ZTDA 4OVVA 3AU5A 2KDFB 2G3QB 3UF8A 5JHBA 2K8CA 2NPTB 5DCNA 2K6DB 2KFJA 2AEHA 2KQSA 3DBHI 3ZUNA 3NZUA 2KLGA 3WA0A 1WXMA 1E8YA 3KVFB 4HK2A 5JZEB 2GBRA 4MEMA 1WH3A 1WYWB 2KHWB 3U30A 2ZCCA 2MBHA 2B3AA 3ECIA 2LXAA 2BKFA 2LRUA 4FHJA 1M94A 4G11A 5DPWA 3A9KB 5E6NA 5LXIB 2IBIB 3L13A 4IG7B 2KXJA 1A5RA 4AOFA 3UQBA 2D11A 4IC7B 1YX5B 2Z0DB 4EOYA 1V86A 3X23A 5DPSA 4ANUA 2GBNA 4DHZB 1KJTA 4GIVA 2DZMA 1L2NA 5KHOA 3RD2A 1HE8A 4LDTB 4FADA 4II3B 2L0FA 4JIOU 4E71A 2N9PC 2M17A 1T0YA 3NZSA 1H8CA 2AYOB 2FNJB 1WX7A 2DYMA 4K7SA 1WX9A 4W9LA 2LWPA 5CX3A 4WJOA 4BOSC 3ZDTA 1V2YA 2ZPYA 4HXDA 4IWQA 2K6QA 2KLCA 1OQYA 2YLMA 2DAJA 2I1JA 4GN1A 2JF5A 2L0TA 4GU2A 2CR5A 1WXAA 3PHWB 1ZGUB 2KJ6A 3TCAA 3W1SC 1XD3B 1WI0A 1UZXB 2PPHA 4WAAA 1WGYA 1P0RA 4WWNA 2DENB 2C7HA 2MA9B 2MQJA 3NY5A 4DHJD 2N1VA 2ASQA 1WGGA 2KOXA 3A33B 2MBEA 2KDIA 3ML8A 1XT9B 5BO4B 1UELA 1WY8A 4W9KA 3TMPB 4W9FA 1Z2MA 2ZZPB 3UIPB 4ANXA 2KC1A 2BKRB 4LJPB 4DHJB 4TUUA 3DCGA 4KZCA 2J0MA 2EMTA 2FCQA 4TQ0A 2WX0A 4BKSA 3JSVA 4IM3A 1Q5WB 2M8SA 5CHVC 1GC7A 3IVFA 4HWIB 2HE7A 3L17A 5D7GA 4NNJB 3DVGX 4HCPB 2KVRA 2FAZA 1E8ZA 2GOWA 2LI5A 4BKSD 2J0JA 2LJ5A 2M4NA 3L0WB 4JLCA 2KJHB 4HPLB 4PYZA 4B6WA 2C7MB 4KVGB 3K9OB 1LXDA 2L8JA 2GBJA 2AWTA 3DQVA 4I6PA 2K39A 3WAOA 2MRPA 2ZEQA 3LDZE 4HPMB 5D94A 4XC2A 3WALA 3QK0A 4DDID 4A20A 3VAWA 2L05A 4PYUA 4NPNA 4WWOA 2FUHB 3RYTA 4F7ZA 1UBQA 2WX1A 1UD7A 1J0GA 1EO6A 2IY0B 3IBEA 3PVLA 2BGFA 2L00B 3ZRFA 2KMCA 1WGDA 3A1QB 3ZNZB 4EFOA 2DZKA 4AJYB 5IAAC 3HK0A 5EDSA 1J19A 3V6CB 3M95A 2L7RA 3BINA 4KSLC 2M1MA 2ZCBA 3ML9A 1WF9A 5D6JB 2N4FA 1JRUA 4FHKA 5KHQA 1R4NI 3GOEA 3R7RA 3ZNGC 3ZIMA 1UH6A 3KW5B 3VVWB 3ZLZA 4ANWA 4F1SA 3ZW3A 1WM3A 2JZZA 2N9EB 1ISNA 2ZVOA 3SDLC 2PE6B 1KM7A 3PS6A 1FXTB 3PHXB 1LFDA 1EUVB 3EC8A 5L83A 2RD0A 1WE7A 4OVUA 1I42A 2KX3A 3QIJA 2KDEB 3VHTC 1GUAB 3H7PB 1V6EA 3OJ3A 1PQSA 4GGQA 2LASA 4GOCA 3AI5A 2JUOA 3SD5A 3C0RB 4A3OA 4ZRJA 1BT0A 3VQIA 4E3CA 2VRRB 4W9HA 3I3TB 4FA6A 5E6OA 3L08A 1S1QB 3DVGY 4WJNA 4JGHB 2KFKB 3MHSD 3VFKA 2O2VB 3LJ3A 3W1YA 3VH3B 2KZRA 2JXXA 2R2QA 2DYOA 3PRMB 2KX0A 2PE9A 3ALBA 5CTRC 4ZYNA 2ZNVC 2NS5A 4MGZE 2KTRA 1WXSA 1Q0WB 2MWSB 1EF1A 1V81A 1CMXB 2D3GA 3DBRI 2MBOA 1J8CA 4PS8A 2NCNA 3VTUA 1NDDA 1E8WA 3Q3FA 2JWZA 4KV2A 4A3PA 1E7UA 3MTNB 3T9LA 4NJ7A 3RULA 1U4AA 3KYDD 5GMVA 3V62A 1E7VA 4F8CB 1NBFC 3ZO5B 3A4SC 3H7SA 4B95A 3GZNI 4BBNF 2DHZA 3DOWA 3O65B 4DDGD 2UYZB 3AU4A 4MSQB 3IG3A 3WAMA 1V49A 3A4RA 3R66C 4KDLB 5J18A 2I1KA 1UGMA 2KTRB 4EKUA 3VTVA 2WWZA 3RZWC 1E8XA 3R7QA 1IPGA 3OLMD 3APDA 4B9KA 2KO3A 3ENEA 3M3JA 2GBKA 2XK5A 4ANVA 4MM3A 5G2NA 2DZJA 4EZLA 3B1LX 4NJ6A 4I6LB 2G45B 2KD0A 5CHFA 2LGDA 4FJYA 2MBBB 4X57B 4W9EA 3X0WA 2OOBB 4G50A 2LVPA 2IYDB 4M8MA 3PLUA 2XBBC 4WJPA 3WANA 4RMAA 4HCNB 2BPSA 2NBWB 3PRZA 2DX5B 4EUTA 1P1AA 2FCSA 2IO1B 4II2B 4J6IA 3QX1A 3DPDA 4DHZE 4IM0A 4NQKE 2AL6A 3ZNHB 2KN5A 1E90A 4W9CA 1GC6A 1SGHA 3EECA 1P3QU 4BOZB 2Z59B 4BVUC 5J2RA 3APCA 2HJ8A 2CHZA 2A5UA 1I35A 1VCBA 2XK5B 3W1SA 1LM8B 4WQOB 3V6EB 1KOTA 1L7YA 1P98A 3TIXA 3KYCD 4MELA 1XQQA 1WJ4A
chains in the Genus database with same CATH superfamily
1SE9A 2WLBA 4GMVA 3PZ8A 1RLFA 4PK1A 2JPHA 1JWAD 4JX1C 4ZYSA 3JSVB 2Z0EB 2X8XX 2BS2B 1JCKB 1VD2A 2LD9A 3ZTCA 4YL8A 3E9SA 2WYQA 3AN1A 3AE7B 4MJSB 4LJOB 3AEAB 2KMMA 3PRPB 1WX8A 2LUEA 3PSEB 4KZ0A 3H6NA 1FNWA 1GJZA 1MG4A 1VZ6A 5EE9A 1JRPA 4CHKA 4P6VF 3CIRB 3RUIB 2MCNB 1SF0A 4CO7A 1CQVA 3AE1B 1JALA 3CSFA 3TEXA 2LRWA 3KWVA 1HA5A 1QZEA 4W9IA 4US9A 1VLBA 5E6PA 2JVCA 2DWQA 4YTPB 1JWMD 4M00A 2E3TA 4QAYA 4P7IA 1OTRB 4K1RB 1Y8RC 3ZVVA 2ZW0A 3BVMA 4K7WA 4LDTD 3NHEB 2K9XA 2N7EA 2BWFA 3AMZA 2D2QA 2J0KA 4XDCA 2V9HA 3BZDB 2KWCA 3BIID 4AJWA 1IBXB 1UBIA 4FJVB 4ASWC 2D10A 2WDVB 5DPTA 4EZJA 1C9FA 3ABVB 3T8MA 2I2YA 2IO0B 2YVCA 4EE2A 3SFEB 3ZXVA 5C2TB 2R2OA 1PDXA 3A9JB 4FULA 4RF0A 1V1OA 2J52A 3AEGB 3N1XC 4LNFA 4ZRIA 1NI2A 4E74A 3AEFB 3P4QB 1IGDA 2L3ZA 3VR8B 1FNUA 4NAWA 4TKNA 1N62A 4JL9A 1L4DB 4RNAA 3JW0X 3C19A 3PLVA 1QOAA 1WR6E 4R3DA 3HRDD 3HM3A 4DK5A 2ZVNA 1QT9A 1X1MA 2KT7A 3CF6E 2KDMA 4H2AA 3URYA 3Q2AC 2KWUB 2MLBA 2BB6A 4FLHA 2QHOA 2JZ3B 2LVOA 2WU2B 1TY0A 4XX5A 3QQ8B 1WMHB 2JRHA 1SIFA 2IJ0A 2KNBA 4MGYE 1YN3A 2BWES 4HDOA 4AS1A 1FPYA 3PGEA 3UINB 2WDTB 5L95C 3DHGC 1ET6A 3W5VB 1UUPA 3U7DA 4JQWC 1MJDA 3Q8FA 1BUIC 1MFWA 3RNCC 3KH0A 1L4ZB 1ZUD2 4W9GA 1E9MA 3QC8B 3A9KA 3NS8A 2KFKA 5JHAA 2V1YA 1XF5L 3WIMA 3TBLD 3ZTDA 4MT5A 3UF8A 3WCQA 3DHHC 3DBHI 3NZUA 1E8YA 3N1ZC 3U30A 2ZCCA 2KACA 4DXGA 2B3AA 3ETRA 2LXAA 2LRUA 1M94A 2YEPB 2HJ1A 5E6NA 3FKYA 3L13A 4M01A 1NENB 1FMAD 3KQ4A 4ANUA 3ZGZA 4GIVA 2DZMA 5KHOA 4FADA 2L0FA 1NVID 2M17A 3NZSA 2WXKA 1H8CA 2FNJB 3AH7A 2VH2A 1YN4A 4K7SA 4W9LA 1L0XB 4IWQA 2WU5B 1R4MB 2D3BA 2QIEB 2DAJA 2I1JA 5E6JA 4K3CA 2L0TA 4GN1A 4GU2A 2L83A 1WGKA 1E7PB 2OEDA 3AEBB 5HFYA 1P7FA 2N1VA 1V1PB 2JYTA 4XDDA 2KOXA 3ML8A 2WXLA 4P1BC 1WY8A 1SJHD 2ZZPB 3FILB 4K3BA 1UWXA 1ZPSA 1I4RA 2J0MA 3V05A 1AW7A 4TQ0A 4BKSA 5FR3A 3JSVA 1GC7A 4HWIB 4HCPB 2FAZA 2GOWA 4RFBA 3L0WB 4JLCA 2KJHB 2BW2A 2GBJA 3Q14C 2MRPA 2ZEQA 4HPMB 3ZQ4A 5BYRA 3W5UB 1PGAA 1SEBD 4NPNA 2FUHB 2WX1A 2KN4A 2FUG1 3PVLA 2L00B 1XO3A 3ZRFA 2WDRB 3P4PB 4AJYB 3V6CB 1CK1A 3BINA 1JRUA 2D3AA 3ZIMA 1TS4A 3KW5B 3KLSX 4ANWA 3TEYA 4XWWA 1BMLC 1KM7A 3PHXB 5L83A 3QIJA 2KDEB 3H7PB 4GGQA 1JWSD 4P1CC 2PMVA 4ARCA 3P1MA 4ZRJA 3VQIA 4W9HA 3DVGY 4JGHB 3PRMB 3AE4B 4ZYNA 4XE0A 2KTRA 1WXSA 1Q0WB 2MWSB 1CMXB 1NDDA 1IBXA 1FD6A 1U4AA 3EA6A 3V62A 1Q10A 3ZO5B 3A4SC 3OG5A 4DDGD 3WAMA 3TSSA 5J18A 1STEA 4LNNA 3VTVA 4EKUA 2J4XA 1QKZA 3OLMD 2KO3A 1OFFA 1SSNA 3ENEA 3NS1A 4MM3A 2AX5A 3CWIA 4NJ6A 3U7ZA 3J9CA 2LGDA 4RMAA 4YT0B 2JWUA 3HVDA 4II2B 3DPDA 2AL6A 4JE3B 2G9HD 2A5UA 1J7AA 3W1SA 1JMLA 1NYRA 3MC8A 4M0WA 4WQOB 1ZE3D 3LB8C 4REZA 2DYBA 1MG8A 2JXTA 3R3MA 4FJZA 2QDFA 1F9JA 3W9CB 3AM9A 5HG2A 3U2SC 1C4AA 2BYEA 2QCZA 3I57A 1P7EA 2PVGC 1RAXA 4HPPA 4KIKA 1HZ5A 3H9DA 2K8BA 2KWVB 3B0AA 4ACFA 4B0EA 3IAM1 3VRAB 4A9AA 2N0SB 5J17A 2K8HA 4W9DA 3OJ4B 4ITKA 2IO2B 1UWMA 4RF1A 5AUKA 3ZRCA 2BYTA 4HEA1 3JVZX 1FM0D 4ZRPA 4W9JA 2W9NA 3T3NA 2A4ZA 2RPQA 2NVUI 2RGFA 1YX6B 2C60A 1R4MI 1EWYC 2AL3A 2OJWA 2LZ6A 2ZJDA 1XXGA 2RPVA 1OGWA 1J7BA 2MP2A 3AE2B 3FAHA 3K9PB 3N32A 3AXCA 1E5WA 1T0SC 1TTNA 3ZKJC 1TT5B 3ZJUA 2UWQA 2WXIA 4HKZE 1XLPA 4RM8A 1TKGA 1L0VB 1WRIA 1H4RA 1J7CA 1WRDB 3IFWB 3HHMA 3SEBA 3N3KB 2G4SA 2INPE 4HLEA 2MH7A 1I7HA 2PJHA 2D5GA 4KGRA 1YQ3B 3I5JC 4URKA 2IO3B 1EF5A 3L16A 4BKGA 2J7QB 2QEJC 4YXDB 3M62B 1K8RB 1TKEA 2PTLA 2KDBA 2KQ4X 3APFA 3L10B 1KTKA 2NR2A 1YQBA 1WGHA 3V3XA 2ZNVB 3Q8CA 5CHWA 3Q8EA 4A55A 1MVKA 3EFUA 2IPKD 4NQLB 2JX5A 4G0NB 2D07B 2DZIA 3RMKC 1E6EB 1I4HA 4C00A 1GOZA 1RWSA 1TJEA 4NZLB 2N1WA 4RGMA 2FIDA 1D5MC 2MW5A 4TV3A 1IGCA 4IW0A 4BBNC 1WZ0A 3N30A 4L1BA 4RM9A 1MHHE 1Y56A 3S2AA 3V61A 3CSTA 1VR9A 1F2RI 2N9KA 2B76B 3DWMA 4KSKC 4XZ4A 2L52A 1C4PA 2QC8A 3DVNV 1RFKA 4N9F4 3UGBB 1WM2A 4AWJA 1S3SG 2GMIC 2V3PA 2BBCA 3RZFA 2O6VD 1F0ZA 1GB1A 2RSUA 5T8IA 4WJQA 3H7PA 1TYGB 2O6VB 4LLGM 3R2IA 1ZP0B 1ESFA 2JSVX 2Z8LA 2LGIA 3ONSA 1TS3A 3AE3B 2PIAA 4OW0A 3SR6A 2FCMA 4GDLB 1B9RA 2REXA 3AU5A 2KDFB 2NPTB 4US8A 1F1HA 2K6DB 2KFJA 2AEHA 3B2GA 2GI9A 3WA0A 5JZEB 4WURA 2GBRA 1WXQA 1QOGA 2MBHA 2BKFA 5DPWA 4GLSC 1PFDA 2BT6A 1VZ8A 4IG7B 2KXJA 2W3SA 5D3IB 4AOFA 1HZ6A 3UQBA 4IC7B 1V86A 2GBNA 4LDTB 4OZBA 2RDHA 3T3OA 1JQ4A 2AYOB 1ACCA 1WX9A 4BOSC 4Q2JA 5BMIA 2K6QA 2KLCA 1GB4A 1WXAA 2J42A 3TCAA 3W1SC 1WI0A 1UZXB 2KYWA 3P42A 2QJLA 2C7HA 2MQJA 2EKIA 2X38A 1WGGA 2IGDA 2MBEA 1XT9B 4KGSA 2MJEA 1I4PA 1AN8A 3TMPB 4KGTA 4LJPB 1PGXA 2BKRB 4TUUA 4KZCA 3Q3MC 2EMTA 2WX0A 2M8SA 3U4EG 1YNTE 2H89B 3IVFA 2HE7A 3L17A 3DVGX 3EUB2 2KVRA 1E8ZA 2LJ5A 3RI7C 3K9OB 4I6PA 2AWTA 3WAOA 3I63C 5D94A 4XC2A 4A20A 4PYUA 1TS5A 2JZPA 1UBQA 5G5GA 3NVZA 2KMCA 3A1QB 3ZNZB 2WQYB 2DZKA 2VH1A 2WXHA 1J19A 2BS4B 3M95A 2L7RA 2K0PA 4MH8A 4KSLC 2ZCBA 2W55A 5D6JB 2N4FA 4FHKA 2WDQB 3R7RA 1UH6A 3VVWB 3ZW3A 2ZVOA 1SJED 3PS6A 1FFVA 1EUVB 1WE7A 1N6ZA 2IGHA 1C78A 2DNFA 1I42A 4XGAB 2QMTA 1KF6B 3OJ3A 1V6EA 2W54A 1ZDXA 3NRZA 2JUOA 1JROA 4A3OA 1ZOYB 1BT0A 1UNSA 4FA6A 5E6OA 4C56C 2ICIA 4TSSA 3RNGC 1WSPA 5BMHA 3LJ3A 3Q6BA 2JXXA 3ALBA 4MGZE 1V81A 2GB1A 2W82A 1FO4A 4PS8A 3L4PA 4KV2A 4A3PA 1E7UA 1N5XA 3MTNB 1D6EC 3T9LA 3RFZB 3RULA 5HI1A 1SB3C 4F8CB 1NBFC 1MPEA 3H7SA 3IT6B 4BBNF 3AU4A 3R66C 4CQNA 2Y5PA 1UGMA 4USAA 2WWZA 1FRDA 1NI3A 2HDEA 3MHZA 3UI3A 3NG0A 3APDA 4B9KA 1RYJA 3M3JA 2GBKA 2XK5A 4ANVA 2LHEA 2WXGA 2DZJA 4EZLA 4I6LB 2LJIA 2MBBB 3X0WA 2LVPA 2IYDB 1VZ7A 4WJPA 1P1AA 4J6IA 5HHDG 4IM0A 3ZNHB 3GE8C 3LYYA 1GC6A 2Z59B 1I4GA 3R8BA 3TIXA 3KYCD 1XQQA 1WJ4A 3TL5A 4BZAA 3JYUA 3P63A 5FK9C 2DAFA 4MJSA 1TBEA 3Q3JA 3VUWA 2ZPNA 1QF6A 4BKTA 2CHXA 2QILA 2XEWA 3QAQA 3QJZA 2HTHA 2KK8A 3VXWA 2DLBA 2BYFA 5MPOA 1IP9A 2DBYA 1F2RC 5C23A 4G3XB 2D3CA 2AQ1B 2L1AA 1ZKHA 1P9DU 2R61A 1V5TA 3ZJVA 1G6JA 1WIAA 3BY4B 5G55A 3DBSA 4GDLA 2Q5WD 3CMMB 2NPTA 1YIWA 4A6QA 4HRSA 1WZ3A 2L76A 4KDIC 4HJKA 4C7ZA 1WE6A 1D3ZA 1SE2A 3PV1A 2Y5BB 2PEAA 1RFAA 4DBGA 3BVZA 5EE0A 2ACZB 1DOYA 4IOIE 3MC9A 1OEYJ 2KKCA 1Q1OA 2KVZA 4AP4C 1LO5D 4MGIE 2NBUA 4DQOC 1YMHE 4ARIA 1RRBA 1Z5SB 4HDQA 5G5HA 3QWZB 2WXOA 4C80A 3HIZA 4DWFA 5IP4D 4JWUC 4LTUA 2RR9A 3A9JA 3N20C 3GP7A 4LCDE 3VTWA 1RM6C 3AE9B 2TSSA 5IA7A 5DPRA 3PTFC 4NY0A 4K81A 1WWTA 2CKHB 5JH5C 4P16A 1V9JA 3SU8X 5C1ZA 2V4LA 3P2BA 4N58A 1BXTA 1OQQA 2JU6X 1PGBA 1LQBA 1TKYA 1OQRA 4MSMB 3UIOB 1IYFA 2MBQA 4CYEA 1XLQA 3DBRB 2YEPF 2VZKD 4NAMA 3IHPC 4IM2A 5AZHA 1ZW7A 1WJUA 1WR1A 2PLPA 1WMHA 2VZKB 1GNUA 1C4CA 3GZNB 5IN7A 4YTMB 1L6UA 2K3UA 2G4DB 3LXFA 4WWPA 3VRBB 5JXVA 3NOBA 4LK0M 3A1QA 1AARA 4GB9A 2KC2A 5AUIA 4DXAB 2N9XA 4NAWB 3DDCB 1WFYA 4ICVA 1ZXIA 1SE4A 4IKGA 1VDVA 4GDKB 2BS3B 1DYQA 3UQAA 5LXHA 3W2DA 2C7NB 4ZHOA 4IDIA 1T6BX 1XLNA 5BYQA 2M0XA 2KANA 5HKHA 2WXFA 2IZVB 1F77A 1K53A 4IUMB 5IKCM 1V5OA 1V97A 2G3QB 2NMQA 5DCNA 2KQSA 2ONQA 3ZUNA 2KLGA 2BQQA 4MEMA 1JWBD 1WYWB 2KHWB 4FHJA 4G11A 1VJKA 3A9KB 1WYGA 2IBIB 2WP9B 3BK2A 1CJEA 2D11A 4D2KA 2Z0DB 4EOYA 1FXAA 3X23A 5DPSA 4M02A 3VR9B 1L2NA 1HE8A 4II3B 3NJTA 4JIOU 2WXQA 3GE3C 1GAQB 4OZCA 1WX7A 1V1PA 4OVZA 1YOVB 5TSSA 1HTOA 5CX3A 2LWPA 4WJOA 3ZDTA 2ZPYA 4HXDA 1SE3A 4ZHPA 2YLMA 2ZW1A 3FILA 1TIFA 4YSYB 2V0GA 3NVWA 2CR5A 3PHWB 2KJ6A 2JQRB 2WS3B 2PPHA 2LMCA 4WAAA 1FRRA 2PKOA 2DENB 2MA9B 1QQRA 1SXTA 3AV8A 4FXCA 1XEEA 4N6EB 4W9KA 4W9FA 1Z2MA 3DCGA 3BVGA 2FCQA 3NZ3A 3RNFC 1ENFA 4IM3A 3E56A 5CHVC 4TMAB 2AQ3B 4BKSD 2M4NA 1SIJA 4HPLB 4PYZA 2C7MB 4KVGB 1B1ZA 2L8JA 1EU4A 3DQVA 4OZAA 2K39A 2SAKA 3LDZE 3WALA 3QK0A 4DDID 1C76A 1N5WA 3VAWA 2L05A 3RYTA 4F7ZA 4WWOA 4MACA 4LNKA 1UD7A 1EO6A 4EFOA 3FC4A 4BAXA 1ET9A 5IAAC 3HK0A 1N60A 2GLSA 5EDSA 2M1MA 2RDGA 2LFIA 3ML9A 1WF9A 2BVCA 5KHQA 3GOEA 5H92C 3ZNGC 1L5PA 2L32A 1WM3A 2JZZA 3I9V1 3KWLA 3HUIA 3SDLC 2PE6B 1TY2A 1PYWD 2WXJA 4YWGG 4O1NA 2RD0A 4RGNA 1L0YB 1R7SA 2KX3A 4RGTA 2RDBC 2PW9A 2LASA 2MEKA 1T3QA 4A8XC 4GOCA 5BYSA 4E3CA 2VRRB 4AQ7A 1K51A 1S1QB 1UF0A 4WJNA 3MHSD 2O2VB 2R2QA 1MHXA 2KX0A 2PE9A 3ZJTA 3DBRI 1EF1A 2D3GA 1J8CA 2NCNA 3VTUA 1E8WA 3DHIC 2JWZA 4C4VB 1EWCA 2EELA 3KYDD 2UU7A 4J3OD 1KLUD 3R2TA 1FXIA 3U52E 2M19A 2LUMA 3GZNI 2DHZA 2UYZB 3IG3A 1V49A 3N1YC 4KDLB 4L2YA 2KTRB 1QOFA 1IPGA 1HQRD 4WQMA 2PVOD 4YTNB 5G2NA 2G45B 3RNAC 2OOBB 3Q8AA 4HKQA 4M8MA 2BPSA 3PRZA 2DX5B 1EM7A 5IO9A 2NTSA 1PUTA 3NVVA 2KN5A 1SGHA 3IT4B 1P3QU 4BOZB 3APCA 2HJ8A 2CHZA 1I35A 3RNEC 1VCBA 4MM3B 1L7YA 3Q69A 3C8YA 4PS7A 2AQ2B 5LLIA 3P4SB 2JYEA 1XCTL 2V3SA 2CU1A 2MJ3A 4GDKA 3VUXA 3EHVA 3KUZA 4M0WB 2W3RA 2HD5B 4AUQC 1YJ1A 5GXGB 3AB5A 3ZDMC 3QCAA 1YD8U 2KQ7A 2IDYA 3KUCB 3VDZA 2WNMA 2C5LC 1NEKB 4S0RA 2EKEC 3VUYA 2I38A 1WJNA 1N61A 2FCNA 3TJPA 1HTQA 4KIKB 1E10A 3OAWA 2RMMA 4FBJB 3N9YC 4XYCA 4S17A 4MGKE 1K50A 4OHJA 1T0RC 5C3JB 2K25A 4WAFA 1QILA 3SHQA 1XCQL 4TQ1A 1WGRA 2K1FA 4GSWA 3VH4B 2C9WB 3IXSA 4BFRA 1TGZB 3IAS1 5IOIA 4ICUA 4K7UA 2CJNA 2EMSA 5AZGA 1I4QA 3DBLI 3M63B 5D3DA 3RCZA 1T0QC 3ZYYX 3Q3NC 2BYVE 4IWOA 2LHDA 3B08A 4L23A 2MP2B 3MP9A 4ZDVA 3AE6B 2JY6A 4KX6B 1R4NB 3BWUD 1C3TA 1C1YB 4EZKA 1XLOA 3BYTB 2MSED 3MJWA 2NBVB 3O13A 2LXCA 3WAPA 1MI0A 3QA8A 1K52A 3EGRA 4I6NB 2GRIA 3PPAA 1ROEA 1TS2A 4MH0E 3NUHB 4HVBA 2K5PA 1WJ6A 1D5XC 3PO0A 2LVQA 4M8NA 2JRIB 3DWGC 3DVNU 3SFDB 5AEKB 1ZXHA 1OEYA 1DGJA 5AZFA 2KMAA 3MC0B 4FN2A 4RH6A 3RN9C 3U8ZA 1V8CA 3AULA 2NTTA 3PREA 3BYYB 2FIFA 2OHFA 2CU3A 3RT3B 2K22A 3EFCA 3P4RB 3PT2B 4C7YA 4IWPA 3QARA 3V60A 2LGYA 3HM6X 2IY1B 1WXVA 3PZDA 1KRHA 1TZ1A 4ZRKA 4HROA 2CJOA 1QLBB 3ZNID 2CS4A 2O6VA 3GB1A 1E0ZA 2LGXA 2OJRA 2MX2A 1V80A 3HVZA 1I4XA 1GG3A 4ZRQA 4GXBA 1KLVA 2JT4B 4PS3A 5EE1A 2GBMA 4YSXB 3H1UA 3KUDB 3L54A 3RPFC 2BF8B 3AEEB 3QHTA 2XNAC 2N7DA 5FR6A 1FIQA 2CHWA 4EEWA 2KTFA 5EE3A 2KJRA 3D32A 1EU3A 2O2VA 5D2MB 5TR5A 1DOIA 1N63A 4MDKE 3NVYA 4OVVA 5JHBA 2K8CA 1WXMA 1ZDVA 3KVFB 4HK2A 4C4VA 1JWUD 1WH3A 4WH4A 3ECIA 1D4BA 3OWEB 5LXIB 2E6XA 1YQ4B 1A5RA 1TZOA 5FKAC 1YX5B 1F52A 4DHZB 1KJTA 4N59A 3RD2A 4E71A 1L6VA 2N9PC 1YJIA 1T0YA 3TUOA 2N7JA 3AE8B 3RNBC 2DYMA 1V2YA 1KH0A 2M0AA 2M56B 5LNK1 1FNVA 4RCOA 1OQYA 2N9LA 2JF5A 1QOBA 2H88B 2FBWB 2BTEA 1ZGUB 4NJCA 1XD3B 2Y3AA 2LGSA 1WGYA 1P0RA 3TEZA 4WWNA 2KAJA 2WXRA 3NY5A 4DHJD 2G1EA 3Q8BA 1FCCC 4YSZB 2ASQA 3A33B 2KDIA 5BO4B 1UELA 2QSDA 2KWDA 2SEBD 3UIPB 4ANXA 2KC1A 4JPSA 4DHJB 2IGGA 4B0MA 4JWSC 3H8HA 1HXYD 1Q5WB 1GPXA 2Y5CA 3GS2A 5D7GA 4NNJB 1IUEA 2V4IB 2ON8A 2INDC 2INCC 2LI5A 2J0JA 4HJGE 2WXMA 4B6WA 4A90A 1LXDA 4ZOHC 1AYFA 2WGSA 2WHIA 1NYQA 1J0GA 2IY0B 3IBEA 3MFGA 2BGFA 1WGDA 1JW9D 1DOXA 2HTME 1A70A 3ZXRA 2J53A 1R4NI 3ZLZA 3BK1A 2WXPA 4F1SA 2N9EB 1ISNA 1CZPA 2XN9C 1FXTB 1LFDA 3EC8A 2FE8A 4OVUA 3AECB 1C77A 1YN5A 2MHJA 3VHTC 4LNIA 1GUAB 1PQSA 1LGRA 3AI5A 3MJ5A 4XWTA 3SD5A 3C0RB 4WWMA 3TEWA 4UDUC 5BMGA 1YJJA 3I3TB 4PT5A 1AWDA 3L08A 4KKJA 4KKIA 2KFKB 3VFKA 3AE5B 3W1YA 3VH3B 2KZRA 2DYOA 2MJDA 5CTRC 2ZNVC 2NS5A 4RGOS 2LEKA 2WXNA 3Q3OC 2MBOA 1KLGD 2BB5A 3Q3FA 5I4DA 3B2FA 1UGJA 1FFUA 4NJ7A 5GMVA 1E7VA 2V3NA 4B95A 1C79A 3DOWA 3O65B 4MSQB 3A4RA 4DXFA 2I1KA 3RZWC 1E8XA 3R7QA 1SBBB 2INNE 1D5ZC 3B1LX 2KD0A 5CHFA 4FJYA 4X57B 1HEZE 3DBHB 4W9EA 4G50A 5H8YE 3B9JA 3PLUA 2XBBC 3DBLB 1FEHA 3WANA 4HCNB 3AEDB 2NBWB 4EUTA 4WIPA 2FCSA 2IO1B 3QX1A 4DHZE 4LNOA 4NQKE 1E90A 4W9CA 1M4VA 3EECA 4BVUC 5J2RA 1T5XD 2XK5B 1LM8B 3V6EB 1KOTA 1VRAB 1P98A 1FCLA 1KFYB 4MELA 3PZ7A
chains in the Genus database with same CATH topology
1SE9A 3TL5A 4PS7A 3JYUA 2DYBA 5LLIA 1MG8A 4GMVA 2DAFA 3R3MA 4FJZA 1RLFA 2JPHA 2V3SA 1TBEA 3Q3JA 4MJSA 1F9JA 3VUWA 2ZPNA 4BKTA 2CHXA 2CU1A 2XEWA 4GDKA 3JSVB 3VUXA 3EHVA 3QAQA 2BYEA 3KUZA 3QJZA 2Z0EB 2HTHA 4M0WB 1RAXA 2HD5B 2KK8A 3VXWA 4AUQC 1YJ1A 4KIKA 2BYFA 1VD2A 3H9DA 2LD9A 3ZTCA 3ZDMC 4YL8A 3QCAA 2K8BA 2KWVB 1IP9A 3B0AA 1YD8U 2KQ7A 5C23A 5J17A 3KUCB 2WYQA 3VDZA 4G3XB 2K8HA 4MJSB 2C5LC 1ZKHA 4W9DA 4LJOB 3OJ4B 1P9DU 2IO2B 3PRPB 2EKEC 3ZRCA 1WX8A 1V5TA 3VUYA 1WJNA 2LUEA 3PSEB 4KZ0A 3JVZX 1G6JA 1WIAA 3BY4B 2FCNA 3H6NA 5G55A 3TJPA 3DBSA 4GDLA 4W9JA 2W9NA 4KIKB 1GJZA 3CMMB 2A4ZA 2NPTA 3OAWA 1YIWA 2RPQA 1WZ3A 2L76A 4KDIC 4HJKA 2NVUI 2RGFA 4FBJB 1YX6B 1WE6A 2C60A 4CHKA 1D3ZA 4MGKE 1R4MI 2AL3A 3RUIB 2MCNB 2K25A 2LZ6A 3PV1A 2Y5BB 3SHQA 2PEAA 1RFAA 4TQ1A 2ZJDA 4CO7A 4DBGA 1WGRA 2K1FA 1OGWA 3CSFA 4GSWA 2LRWA 2C9WB 3VH4B 2MP2A 4BFRA 1QZEA 4W9IA 1OEYJ 3K9PB 1TGZB 3N32A 3AXCA 5E6PA 2KKCA 2JVCA 1E5WA 1Q1OA 3ZKJC 1TTNA 4ICUA 4K7UA 4AP4C 2UWQA 4MGIE 2NBUA 2EMSA 5AZGA 3DBLI 3M63B 4P7IA 1RRBA 1OTRB 1Z5SB 4K1RB 1Y8RC 4RM8A 3ZVVA 3RCZA 4HDQA 1H4RA 3QWZB 2BYVE 4IWOA 4K7WA 4LDTD 1WRDB 3NHEB 3HIZA 4DWFA 3B08A 3IFWB 3HHMA 2MP2B 2RR9A 2N7EA 2BWFA 4ZDVA 2JY6A 2D2QA 2J0KA 3A9JA 3N3KB 1C3TA 2G4SA 1C1YB 4HLEA 4EZKA 3MJWA 2MSED 2NBVB 2PJHA 2LXCA 4LCDE 3WAPA 3VTWA 2KWCA 2IO3B 4URKA 1EF5A 3L16A 3QA8A 4AJWA 4BKGA 1UBIA 4FJVB 4I6NB 4ASWC 2D10A 3PPAA 5DPTA 5IA7A 4EZJA 2J7QB 3T8MA 5DPRA 3PTFC 3M62B 4MH0E 4NY0A 4K81A 1K8RB 2CKHB 4HVBA 5JH5C 2IO0B 2YVCA 1V9JA 3SU8X 1WJ6A 5C1ZA 2R2OA 2KDBA 3APFA 3L10B 2V4LA 3A9JB 3P2BA 4FULA 2NR2A 2LVQA 4M8NA 1YQBA 2JRIB 1LQBA 1WGHA 2ZNVB 3DVNU 4MSMB 3UIOB 5CHWA 5AEKB 1OEYA 1IYFA 3EFUA 4NQLB 2MBQA 5AZFA 2KMAA 4FN2A 4G0NB 2D07B 4CYEA 2DZIA 4ZRIA 3U8ZA 1NI2A 4E74A 3AULA 3PREA 2L3ZA 2FIFA 3RT3B 3IHPC 4IM2A 5AZHA 4NAWA 3PT2B 1ZW7A 4TKNA 2N1WA 4JL9A 1WJUA 1WR1A 4IWPA 2FIDA 3QARA 1WMHA 3JW0X 2MW5A 3V60A 4TV3A 1GNUA 3PLVA 2LGYA 3HM6X 4IW0A 4BBNC 1WZ0A 3N30A 2IY1B 1WXVA 1WR6E 3PZDA 2G4DB 4WWPA 1TZ1A 4RM9A 4ZRKA 3HM3A 4DK5A 3S2AA 3V61A 3CSTA 2ZVNA 3NOBA 1X1MA 3A1QA 1AARA 4GB9A 3CF6E 4KSKC 2KC2A 4XZ4A 2KWUB 2MLBA 4FLHA 2QHOA 4DXAB 2JZ3B 2LVOA 2N9XA 4NAWB 3DDCB 1WFYA 3ZNID 2CS4A 2O6VA 4XX5A 3DVNV 4ICVA 3QQ8B 1WMHB 2JRHA 1SIFA 2KNBA 2LGXA 4MGYE 4N9F4 3UGBB 2OJRA 1WM2A 4AWJA 1S3SG 2BWES 2MX2A 4HDOA 4GDKB 2GMIC 1V80A 3RZFA 3UQAA 3PGEA 3UINB 2WDTB 1GG3A 4GXBA 2O6VD 5LXHA 5L95C 2RSUA 1KLVA 3U7DA 2C7NB 2JT4B 4PS3A 4JQWC 2GBMA 3H1UA 4WJQA 3H7PA 3KUDB 3L54A 2BF8B 2O6VB 3KH0A 2M0XA 2KANA 3QHTA 5HKHA 3ONSA 2IZVB 2N7DA 3QC8B 4W9GA 5FR6A 2CHWA 3A9KA 4EEWA 2KTFA 3NS8A 2KFKA 2KJRA 3D32A 4IUMB 2O2VA 5JHAA 5D2MB 2FCMA 5TR5A 2V1YA 3WIMA 4MDKE 4GDLB 3TBLD 1V5OA 2REXA 3ZTDA 4OVVA 3AU5A 2KDFB 2G3QB 3UF8A 5JHBA 2K8CA 2NPTB 5DCNA 2K6DB 2KFJA 2AEHA 2KQSA 3DBHI 3ZUNA 3NZUA 2KLGA 3WA0A 1WXMA 1E8YA 3KVFB 4HK2A 5JZEB 2GBRA 4MEMA 1WH3A 1WYWB 2KHWB 3U30A 2ZCCA 2MBHA 2B3AA 3ECIA 2LXAA 2BKFA 2LRUA 4FHJA 1M94A 4G11A 5DPWA 3A9KB 5E6NA 5LXIB 2IBIB 3L13A 4IG7B 2KXJA 1A5RA 4AOFA 3UQBA 2D11A 4IC7B 1YX5B 2Z0DB 4EOYA 1V86A 3X23A 5DPSA 4ANUA 2GBNA 4DHZB 1KJTA 4GIVA 2DZMA 1L2NA 5KHOA 3RD2A 1HE8A 4LDTB 4FADA 4II3B 2L0FA 4JIOU 4E71A 2N9PC 2M17A 1T0YA 3NZSA 1H8CA 2AYOB 2FNJB 1WX7A 2DYMA 4K7SA 1WX9A 4W9LA 2LWPA 5CX3A 4WJOA 4BOSC 3ZDTA 1V2YA 2ZPYA 4HXDA 4IWQA 2K6QA 2KLCA 1OQYA 2YLMA 2DAJA 2I1JA 4GN1A 2JF5A 2L0TA 4GU2A 2CR5A 1WXAA 3PHWB 1ZGUB 2KJ6A 3TCAA 3W1SC 1XD3B 1WI0A 1UZXB 2PPHA 4WAAA 1WGYA 1P0RA 4WWNA 2DENB 2C7HA 2MA9B 2MQJA 3NY5A 4DHJD 2N1VA 2ASQA 1WGGA 2KOXA 3A33B 2MBEA 2KDIA 3ML8A 1XT9B 5BO4B 1UELA 1WY8A 4W9KA 3TMPB 4W9FA 1Z2MA 2ZZPB 3UIPB 4ANXA 2KC1A 2BKRB 4LJPB 4DHJB 4TUUA 3DCGA 4KZCA 2J0MA 2EMTA 2FCQA 4TQ0A 2WX0A 4BKSA 3JSVA 4IM3A 1Q5WB 2M8SA 5CHVC 1GC7A 3IVFA 4HWIB 2HE7A 3L17A 5D7GA 4NNJB 3DVGX 4HCPB 2KVRA 2FAZA 1E8ZA 2GOWA 2LI5A 4BKSD 2J0JA 2LJ5A 2M4NA 3L0WB 4JLCA 2KJHB 4HPLB 4PYZA 4B6WA 2C7MB 4KVGB 3K9OB 1LXDA 2L8JA 2GBJA 2AWTA 3DQVA 4I6PA 2K39A 3WAOA 2MRPA 2ZEQA 3LDZE 4HPMB 5D94A 4XC2A 3WALA 3QK0A 4DDID 4A20A 3VAWA 2L05A 4PYUA 4NPNA 4WWOA 2FUHB 3RYTA 4F7ZA 1UBQA 2WX1A 1UD7A 1J0GA 1EO6A 2IY0B 3IBEA 3PVLA 2BGFA 2L00B 3ZRFA 2KMCA 1WGDA 3A1QB 3ZNZB 4EFOA 2DZKA 4AJYB 5IAAC 3HK0A 5EDSA 1J19A 3V6CB 3M95A 2L7RA 3BINA 4KSLC 2M1MA 2ZCBA 3ML9A 1WF9A 5D6JB 2N4FA 1JRUA 4FHKA 5KHQA 1R4NI 3GOEA 3R7RA 3ZNGC 3ZIMA 1UH6A 3KW5B 3VVWB 3ZLZA 4ANWA 4F1SA 3ZW3A 1WM3A 2JZZA 2N9EB 1ISNA 2ZVOA 3SDLC 2PE6B 1KM7A 3PS6A 1FXTB 3PHXB 1LFDA 1EUVB 3EC8A 5L83A 2RD0A 1WE7A 4OVUA 1I42A 2KX3A 3QIJA 2KDEB 3VHTC 1GUAB 3H7PB 1V6EA 3OJ3A 1PQSA 4GGQA 2LASA 4GOCA 3AI5A 2JUOA 3SD5A 3C0RB 4A3OA 4ZRJA 1BT0A 3VQIA 4E3CA 2VRRB 4W9HA 3I3TB 4FA6A 5E6OA 3L08A 1S1QB 3DVGY 4WJNA 4JGHB 2KFKB 3MHSD 3VFKA 2O2VB 3LJ3A 3W1YA 3VH3B 2KZRA 2JXXA 2R2QA 2DYOA 3PRMB 2KX0A 2PE9A 3ALBA 5CTRC 4ZYNA 2ZNVC 2NS5A 4MGZE 2KTRA 1WXSA 1Q0WB 2MWSB 1EF1A 1V81A 1CMXB 2D3GA 3DBRI 2MBOA 1J8CA 4PS8A 2NCNA 3VTUA 1NDDA 1E8WA 3Q3FA 2JWZA 4KV2A 4A3PA 1E7UA 3MTNB 3T9LA 4NJ7A 3RULA 1U4AA 3KYDD 5GMVA 3V62A 1E7VA 4F8CB 1NBFC 3ZO5B 3A4SC 3H7SA 4B95A 3GZNI 4BBNF 2DHZA 3DOWA 3O65B 4DDGD 2UYZB 3AU4A 4MSQB 3IG3A 3WAMA 1V49A 3A4RA 3R66C 4KDLB 5J18A 2I1KA 1UGMA 2KTRB 4EKUA 3VTVA 2WWZA 3RZWC 1E8XA 3R7QA 1IPGA 3OLMD 3APDA 4B9KA 2KO3A 3ENEA 3M3JA 2GBKA 2XK5A 4ANVA 4MM3A 5G2NA 2DZJA 4EZLA 3B1LX 4NJ6A 4I6LB 2G45B 2KD0A 5CHFA 2LGDA 4FJYA 2MBBB 4X57B 4W9EA 3X0WA 2OOBB 4G50A 2LVPA 2IYDB 4M8MA 3PLUA 2XBBC 4WJPA 3WANA 4RMAA 4HCNB 2BPSA 2NBWB 3PRZA 2DX5B 4EUTA 1P1AA 2FCSA 2IO1B 4II2B 4J6IA 3QX1A 3DPDA 4DHZE 4IM0A 4NQKE 2AL6A 3ZNHB 2KN5A 1E90A 4W9CA 1GC6A 1SGHA 3EECA 1P3QU 4BOZB 2Z59B 4BVUC 5J2RA 3APCA 2HJ8A 2CHZA 2A5UA 1I35A 1VCBA 2XK5B 3W1SA 1LM8B 4WQOB 3V6EB 1KOTA 1L7YA 1P98A 3TIXA 3KYCD 4MELA 1XQQA 1WJ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SE9 A;  3TL5 A;  4PS7 A;  3JYU A;  2DYB A;  5LLI A;  1MG8 A;  4GMV A;  2DAF A;  3R3M A;  4FJZ A;  1RLF A;  2JPH A;  2V3S A;  1TBE A;  3Q3J A;  4MJS A;  1F9J A;  3VUW A;  2ZPN A;  4BKT A;  2CHX A;  2CU1 A;  2XEW A;  4GDK A;  3JSV B;  3VUX A;  3EHV A;  3QAQ A;  2BYE A;  3KUZ A;  3QJZ A;  2Z0E B;  2HTH A;  4M0W B;  1RAX A;  2HD5 B;  2KK8 A;  3VXW A;  4AUQ C;  1YJ1 A;  4KIK A;  2BYF A;  1VD2 A;  3H9D A;  2LD9 A;  3ZTC A;  3ZDM C;  4YL8 A;  3QCA A;  2K8B A;  2KWV B;  1IP9 A;  3B0A A;  1YD8 U;  2KQ7 A;  5C23 A;  5J17 A;  3KUC B;  2WYQ A;  3VDZ A;  4G3X B;  2K8H A;  4MJS B;  2C5L C;  1ZKH A;  4W9D A;  4LJO B;  3OJ4 B;  1P9D U;  2IO2 B;  3PRP B;  2EKE C;  3ZRC A;  1WX8 A;  1V5T A;  3VUY A;  1WJN A;  2LUE A;  3PSE B;  4KZ0 A;  3JVZ X;  1G6J A;  1WIA A;  3BY4 B;  2FCN A;  3H6N A;  5G55 A;  3TJP A;  3DBS A;  4GDL A;  4W9J A;  2W9N A;  4KIK B;  1GJZ A;  3CMM B;  2A4Z A;  2NPT A;  3OAW A;  1YIW A;  2RPQ A;  1WZ3 A;  2L76 A;  4KDI C;  4HJK A;  2NVU I;  2RGF A;  4FBJ B;  1YX6 B;  1WE6 A;  2C60 A;  4CHK A;  1D3Z A;  4MGK E;  1R4M I;  2AL3 A;  3RUI B;  2MCN B;  2K25 A;  2LZ6 A;  3PV1 A;  2Y5B B;  3SHQ A;  2PEA A;  1RFA A;  4TQ1 A;  2ZJD A;  4CO7 A;  4DBG A;  1WGR A;  2K1F A;  1OGW A;  3CSF A;  4GSW A;  2LRW A;  2C9W B;  3VH4 B;  2MP2 A;  4BFR A;  1QZE A;  4W9I A;  1OEY J;  3K9P B;  1TGZ B;  3N32 A;  3AXC A;  5E6P A;  2KKC A;  2JVC A;  1E5W A;  1Q1O A;  3ZKJ C;  1TTN A;  4ICU A;  4K7U A;  4AP4 C;  2UWQ A;  4MGI E;  2NBU A;  2EMS A;  5AZG A;  3DBL I;  3M63 B;  4P7I A;  1RRB A;  1OTR B;  1Z5S B;  4K1R B;  1Y8R C;  4RM8 A;  3ZVV A;  3RCZ A;  4HDQ A;  1H4R A;  3QWZ B;  2BYV E;  4IWO A;  4K7W A;  4LDT D;  1WRD B;  3NHE B;  3HIZ A;  4DWF A;  3B08 A;  3IFW B;  3HHM A;  2MP2 B;  2RR9 A;  2N7E A;  2BWF A;  4ZDV A;  2JY6 A;  2D2Q A;  2J0K A;  3A9J A;  3N3K B;  1C3T A;  2G4S A;  1C1Y B;  4HLE A;  4EZK A;  3MJW A;  2MSE D;  2NBV B;  2PJH A;  2LXC A;  4LCD E;  3WAP A;  3VTW A;  2KWC A;  2IO3 B;  4URK A;  1EF5 A;  3L16 A;  3QA8 A;  4AJW A;  4BKG A;  1UBI A;  4FJV B;  4I6N B;  4ASW C;  2D10 A;  3PPA A;  5DPT A;  5IA7 A;  4EZJ A;  2J7Q B;  3T8M A;  5DPR A;  3PTF C;  3M62 B;  4MH0 E;  4NY0 A;  4K81 A;  1K8R B;  2CKH B;  4HVB A;  5JH5 C;  2IO0 B;  2YVC A;  1V9J A;  3SU8 X;  1WJ6 A;  5C1Z A;  2R2O A;  2KDB A;  3APF A;  3L10 B;  2V4L A;  3A9J B;  3P2B A;  4FUL A;  2NR2 A;  2LVQ A;  4M8N A;  1YQB A;  2JRI B;  1LQB A;  1WGH A;  2ZNV B;  3DVN U;  4MSM B;  3UIO B;  5CHW A;  5AEK B;  1OEY A;  1IYF A;  3EFU A;  4NQL B;  2MBQ A;  5AZF A;  2KMA A;  4FN2 A;  4G0N B;  2D07 B;  4CYE A;  2DZI A;  4ZRI A;  3U8Z A;  1NI2 A;  4E74 A;  3AUL A;  3PRE A;  2L3Z A;  2FIF A;  3RT3 B;  3IHP C;  4IM2 A;  5AZH A;  4NAW A;  3PT2 B;  1ZW7 A;  4TKN A;  2N1W A;  4JL9 A;  1WJU A;  1WR1 A;  4IWP A;  2FID A;  3QAR A;  1WMH A;  3JW0 X;  2MW5 A;  3V60 A;  4TV3 A;  1GNU A;  3PLV A;  2LGY A;  3HM6 X;  4IW0 A;  4BBN C;  1WZ0 A;  3N30 A;  2IY1 B;  1WXV A;  1WR6 E;  3PZD A;  2G4D B;  4WWP A;  1TZ1 A;  4RM9 A;  4ZRK A;  3HM3 A;  4DK5 A;  3S2A A;  3V61 A;  3CST A;  2ZVN A;  3NOB A;  1X1M A;  3A1Q A;  1AAR A;  4GB9 A;  3CF6 E;  4KSK C;  2KC2 A;  4XZ4 A;  2KWU B;  2MLB A;  4FLH A;  2QHO A;  4DXA B;  2JZ3 B;  2LVO A;  2N9X A;  4NAW B;  3DDC B;  1WFY A;  3ZNI D;  2CS4 A;  2O6V A;  4XX5 A;  3DVN V;  4ICV A;  3QQ8 B;  1WMH B;  2JRH A;  1SIF A;  2KNB A;  2LGX A;  4MGY E;  4N9F 4;  3UGB B;  2OJR A;  1WM2 A;  4AWJ A;  1S3S G;  2BWE S;  2MX2 A;  4HDO A;  4GDK B;  2GMI C;  1V80 A;  3RZF A;  3UQA A;  3PGE A;  3UIN B;  2WDT B;  1GG3 A;  4GXB A;  2O6V D;  5LXH A;  5L95 C;  2RSU A;  1KLV A;  3U7D A;  2C7N B;  2JT4 B;  4PS3 A;  4JQW C;  2GBM A;  3H1U A;  4WJQ A;  3H7P A;  3KUD B;  3L54 A;  2BF8 B;  2O6V B;  3KH0 A;  2M0X A;  2KAN A;  3QHT A;  5HKH A;  3ONS A;  2IZV B;  2N7D A;  3QC8 B;  4W9G A;  5FR6 A;  2CHW A;  3A9K A;  4EEW A;  2KTF A;  3NS8 A;  2KFK A;  2KJR A;  3D32 A;  4IUM B;  2O2V A;  5JHA A;  5D2M B;  2FCM A;  5TR5 A;  2V1Y A;  3WIM A;  4MDK E;  4GDL B;  3TBL D;  1V5O A;  2REX A;  3ZTD A;  4OVV A;  3AU5 A;  2KDF B;  2G3Q B;  3UF8 A;  5JHB A;  2K8C A;  2NPT B;  5DCN A;  2K6D B;  2KFJ A;  2AEH A;  2KQS A;  3DBH I;  3ZUN A;  3NZU A;  2KLG A;  3WA0 A;  1WXM A;  1E8Y A;  3KVF B;  4HK2 A;  5JZE B;  2GBR A;  4MEM A;  1WH3 A;  1WYW B;  2KHW B;  3U30 A;  2ZCC A;  2MBH A;  2B3A A;  3ECI A;  2LXA A;  2BKF A;  2LRU A;  4FHJ A;  1M94 A;  4G11 A;  5DPW A;  3A9K B;  5E6N A;  5LXI B;  2IBI B;  3L13 A;  4IG7 B;  2KXJ A;  1A5R A;  4AOF A;  3UQB A;  2D11 A;  4IC7 B;  1YX5 B;  2Z0D B;  4EOY A;  1V86 A;  3X23 A;  5DPS A;  4ANU A;  2GBN A;  4DHZ B;  1KJT A;  4GIV A;  2DZM A;  1L2N A;  5KHO A;  3RD2 A;  1HE8 A;  4LDT B;  4FAD A;  4II3 B;  2L0F A;  4JIO U;  4E71 A;  2N9P C;  2M17 A;  1T0Y A;  3NZS A;  1H8C A;  2AYO B;  2FNJ B;  1WX7 A;  2DYM A;  4K7S A;  1WX9 A;  4W9L A;  2LWP A;  5CX3 A;  4WJO A;  4BOS C;  3ZDT A;  1V2Y A;  2ZPY A;  4HXD A;  4IWQ A;  2K6Q A;  2KLC A;  1OQY A;  2YLM A;  2DAJ A;  2I1J A;  4GN1 A;  2JF5 A;  2L0T A;  4GU2 A;  2CR5 A;  1WXA A;  3PHW B;  1ZGU B;  2KJ6 A;  3TCA A;  3W1S C;  1XD3 B;  1WI0 A;  1UZX B;  2PPH A;  4WAA A;  1WGY A;  1P0R A;  4WWN A;  2DEN B;  2C7H A;  2MA9 B;  2MQJ A;  3NY5 A;  4DHJ D;  2N1V A;  2ASQ A;  1WGG A;  2KOX A;  3A33 B;  2MBE A;  2KDI A;  3ML8 A;  1XT9 B;  5BO4 B;  1UEL A;  1WY8 A;  4W9K A;  3TMP B;  4W9F A;  1Z2M A;  2ZZP B;  3UIP B;  4ANX A;  2KC1 A;  2BKR B;  4LJP B;  4DHJ B;  4TUU A;  3DCG A;  4KZC A;  2J0M A;  2EMT A;  2FCQ A;  4TQ0 A;  2WX0 A;  4BKS A;  3JSV A;  4IM3 A;  1Q5W B;  2M8S A;  5CHV C;  1GC7 A;  3IVF A;  4HWI B;  2HE7 A;  3L17 A;  5D7G A;  4NNJ B;  3DVG X;  4HCP B;  2KVR A;  2FAZ A;  1E8Z A;  2GOW A;  2LI5 A;  4BKS D;  2J0J A;  2LJ5 A;  2M4N A;  3L0W B;  4JLC A;  2KJH B;  4HPL B;  4PYZ A;  4B6W A;  2C7M B;  4KVG B;  3K9O B;  1LXD A;  2L8J A;  2GBJ A;  2AWT A;  3DQV A;  4I6P A;  2K39 A;  3WAO A;  2MRP A;  2ZEQ A;  3LDZ E;  4HPM B;  5D94 A;  4XC2 A;  3WAL A;  3QK0 A;  4DDI D;  4A20 A;  3VAW A;  2L05 A;  4PYU A;  4NPN A;  4WWO A;  2FUH B;  3RYT A;  4F7Z A;  1UBQ A;  2WX1 A;  1UD7 A;  1J0G A;  1EO6 A;  2IY0 B;  3IBE A;  3PVL A;  2BGF A;  2L00 B;  3ZRF A;  2KMC A;  1WGD A;  3A1Q B;  3ZNZ B;  4EFO A;  2DZK A;  4AJY B;  5IAA C;  3HK0 A;  5EDS A;  1J19 A;  3V6C B;  3M95 A;  2L7R A;  3BIN A;  4KSL C;  2M1M A;  2ZCB A;  3ML9 A;  1WF9 A;  5D6J B;  2N4F A;  1JRU A;  4FHK A;  5KHQ A;  1R4N I;  3GOE A;  3R7R A;  3ZNG C;  3ZIM A;  1UH6 A;  3KW5 B;  3VVW B;  3ZLZ A;  4ANW A;  4F1S A;  3ZW3 A;  1WM3 A;  2JZZ A;  2N9E B;  1ISN A;  2ZVO A;  3SDL C;  2PE6 B;  1KM7 A;  3PS6 A;  1FXT B;  3PHX B;  1LFD A;  1EUV B;  3EC8 A;  5L83 A;  2RD0 A;  1WE7 A;  4OVU A;  1I42 A;  2KX3 A;  3QIJ A;  2KDE B;  3VHT C;  1GUA B;  3H7P B;  1V6E A;  3OJ3 A;  1PQS A;  4GGQ A;  2LAS A;  4GOC A;  3AI5 A;  2JUO A;  3SD5 A;  3C0R B;  4A3O A;  4ZRJ A;  1BT0 A;  3VQI A;  4E3C A;  2VRR B;  4W9H A;  3I3T B;  4FA6 A;  5E6O A;  3L08 A;  1S1Q B;  3DVG Y;  4WJN A;  4JGH B;  2KFK B;  3MHS D;  3VFK A;  2O2V B;  3LJ3 A;  3W1Y A;  3VH3 B;  2KZR A;  2JXX A;  2R2Q A;  2DYO A;  3PRM B;  2KX0 A;  2PE9 A;  3ALB A;  5CTR C;  4ZYN A;  2ZNV C;  2NS5 A;  4MGZ E;  2KTR A;  1WXS A;  1Q0W B;  2MWS B;  1EF1 A;  1V81 A;  1CMX B;  2D3G A;  3DBR I;  2MBO A;  1J8C A;  4PS8 A;  2NCN A;  3VTU A;  1NDD A;  1E8W A;  3Q3F A;  2JWZ A;  4KV2 A;  4A3P A;  1E7U A;  3MTN B;  3T9L A;  4NJ7 A;  3RUL A;  1U4A A;  3KYD D;  5GMV A;  3V62 A;  1E7V A;  4F8C B;  1NBF C;  3ZO5 B;  3A4S C;  3H7S A;  4B95 A;  3GZN I;  4BBN F;  2DHZ A;  3DOW A;  3O65 B;  4DDG D;  2UYZ B;  3AU4 A;  4MSQ B;  3IG3 A;  3WAM A;  1V49 A;  3A4R A;  3R66 C;  4KDL B;  5J18 A;  2I1K A;  1UGM A;  2KTR B;  4EKU A;  3VTV A;  2WWZ A;  3RZW C;  1E8X A;  3R7Q A;  1IPG A;  3OLM D;  3APD A;  4B9K A;  2KO3 A;  3ENE A;  3M3J A;  2GBK A;  2XK5 A;  4ANV A;  4MM3 A;  5G2N A;  2DZJ A;  4EZL A;  3B1L X;  4NJ6 A;  4I6L B;  2G45 B;  2KD0 A;  5CHF A;  2LGD A;  4FJY A;  2MBB B;  4X57 B;  4W9E A;  3X0W A;  2OOB B;  4G50 A;  2LVP A;  2IYD B;  4M8M A;  3PLU A;  2XBB C;  4WJP A;  3WAN A;  4RMA A;  4HCN B;  2BPS A;  2NBW B;  3PRZ A;  2DX5 B;  4EUT A;  1P1A A;  2FCS A;  2IO1 B;  4II2 B;  4J6I A;  3QX1 A;  3DPD A;  4DHZ E;  4IM0 A;  4NQK E;  2AL6 A;  3ZNH B;  2KN5 A;  1E90 A;  4W9C A;  1GC6 A;  1SGH A;  3EEC A;  1P3Q U;  4BOZ B;  2Z59 B;  4BVU C;  5J2R A;  3APC A;  2HJ8 A;  2CHZ A;  2A5U A;  1I35 A;  1VCB A;  2XK5 B;  3W1S A;  1LM8 B;  4WQO B;  3V6E B;  1KOT A;  1L7Y A;  1P98 A;  3TIX A;  3KYC D;  4MEL A;  1XQQ A;  1WJ4 A; 
#chains in the Genus database with same CATH topology
 1SE9 A;  2WLB A;  4GMV A;  3PZ8 A;  1RLF A;  4PK1 A;  2JPH A;  1JWA D;  4JX1 C;  4ZYS A;  3JSV B;  2Z0E B;  2X8X X;  2BS2 B;  1JCK B;  1VD2 A;  2LD9 A;  3ZTC A;  4YL8 A;  3E9S A;  2WYQ A;  3AN1 A;  3AE7 B;  4MJS B;  4LJO B;  3AEA B;  2KMM A;  3PRP B;  1WX8 A;  2LUE A;  3PSE B;  4KZ0 A;  3H6N A;  1FNW A;  1GJZ A;  1MG4 A;  1VZ6 A;  5EE9 A;  1JRP A;  4CHK A;  4P6V F;  3CIR B;  3RUI B;  2MCN B;  1SF0 A;  4CO7 A;  1CQV A;  3AE1 B;  1JAL A;  3CSF A;  3TEX A;  2LRW A;  3KWV A;  1HA5 A;  1QZE A;  4W9I A;  4US9 A;  1VLB A;  5E6P A;  2JVC A;  2DWQ A;  4YTP B;  1JWM D;  4M00 A;  2E3T A;  4QAY A;  4P7I A;  1OTR B;  4K1R B;  1Y8R C;  3ZVV A;  2ZW0 A;  3BVM A;  4K7W A;  4LDT D;  3NHE B;  2K9X A;  2N7E A;  2BWF A;  3AMZ A;  2D2Q A;  2J0K A;  4XDC A;  2V9H A;  3BZD B;  2KWC A;  3BII D;  4AJW A;  1IBX B;  1UBI A;  4FJV B;  4ASW C;  2D10 A;  2WDV B;  5DPT A;  4EZJ A;  1C9F A;  3ABV B;  3T8M A;  2I2Y A;  2IO0 B;  2YVC A;  4EE2 A;  3SFE B;  3ZXV A;  5C2T B;  2R2O A;  1PDX A;  3A9J B;  4FUL A;  4RF0 A;  1V1O A;  2J52 A;  3AEG B;  3N1X C;  4LNF A;  4ZRI A;  1NI2 A;  4E74 A;  3AEF B;  3P4Q B;  1IGD A;  2L3Z A;  3VR8 B;  1FNU A;  4NAW A;  4TKN A;  1N62 A;  4JL9 A;  1L4D B;  4RNA A;  3JW0 X;  3C19 A;  3PLV A;  1QOA A;  1WR6 E;  4R3D A;  3HRD D;  3HM3 A;  4DK5 A;  2ZVN A;  1QT9 A;  1X1M A;  2KT7 A;  3CF6 E;  2KDM A;  4H2A A;  3URY A;  3Q2A C;  2KWU B;  2MLB A;  2BB6 A;  4FLH A;  2QHO A;  2JZ3 B;  2LVO A;  2WU2 B;  1TY0 A;  4XX5 A;  3QQ8 B;  1WMH B;  2JRH A;  1SIF A;  2IJ0 A;  2KNB A;  4MGY E;  1YN3 A;  2BWE S;  4HDO A;  4AS1 A;  1FPY A;  3PGE A;  3UIN B;  2WDT B;  5L95 C;  3DHG C;  1ET6 A;  3W5V B;  1UUP A;  3U7D A;  4JQW C;  1MJD A;  3Q8F A;  1BUI C;  1MFW A;  3RNC C;  3KH0 A;  1L4Z B;  1ZUD 2;  4W9G A;  1E9M A;  3QC8 B;  3A9K A;  3NS8 A;  2KFK A;  5JHA A;  2V1Y A;  1XF5 L;  3WIM A;  3TBL D;  3ZTD A;  4MT5 A;  3UF8 A;  3WCQ A;  3DHH C;  3DBH I;  3NZU A;  1E8Y A;  3N1Z C;  3U30 A;  2ZCC A;  2KAC A;  4DXG A;  2B3A A;  3ETR A;  2LXA A;  2LRU A;  1M94 A;  2YEP B;  2HJ1 A;  5E6N A;  3FKY A;  3L13 A;  4M01 A;  1NEN B;  1FMA D;  3KQ4 A;  4ANU A;  3ZGZ A;  4GIV A;  2DZM A;  5KHO A;  4FAD A;  2L0F A;  1NVI D;  2M17 A;  3NZS A;  2WXK A;  1H8C A;  2FNJ B;  3AH7 A;  2VH2 A;  1YN4 A;  4K7S A;  4W9L A;  1L0X B;  4IWQ A;  2WU5 B;  1R4M B;  2D3B A;  2QIE B;  2DAJ A;  2I1J A;  5E6J A;  4K3C A;  2L0T A;  4GN1 A;  4GU2 A;  2L83 A;  1WGK A;  1E7P B;  2OED A;  3AEB B;  5HFY A;  1P7F A;  2N1V A;  1V1P B;  2JYT A;  4XDD A;  2KOX A;  3ML8 A;  2WXL A;  4P1B C;  1WY8 A;  1SJH D;  2ZZP B;  3FIL B;  4K3B A;  1UWX A;  1ZPS A;  1I4R A;  2J0M A;  3V05 A;  1AW7 A;  4TQ0 A;  4BKS A;  5FR3 A;  3JSV A;  1GC7 A;  4HWI B;  4HCP B;  2FAZ A;  2GOW A;  4RFB A;  3L0W B;  4JLC A;  2KJH B;  2BW2 A;  2GBJ A;  3Q14 C;  2MRP A;  2ZEQ A;  4HPM B;  3ZQ4 A;  5BYR A;  3W5U B;  1PGA A;  1SEB D;  4NPN A;  2FUH B;  2WX1 A;  2KN4 A;  2FUG 1;  3PVL A;  2L00 B;  1XO3 A;  3ZRF A;  2WDR B;  3P4P B;  4AJY B;  3V6C B;  1CK1 A;  3BIN A;  1JRU A;  2D3A A;  3ZIM A;  1TS4 A;  3KW5 B;  3KLS X;  4ANW A;  3TEY A;  4XWW A;  1BML C;  1KM7 A;  3PHX B;  5L83 A;  3QIJ A;  2KDE B;  3H7P B;  4GGQ A;  1JWS D;  4P1C C;  2PMV A;  4ARC A;  3P1M A;  4ZRJ A;  3VQI A;  4W9H A;  3DVG Y;  4JGH B;  3PRM B;  3AE4 B;  4ZYN A;  4XE0 A;  2KTR A;  1WXS A;  1Q0W B;  2MWS B;  1CMX B;  1NDD A;  1IBX A;  1FD6 A;  1U4A A;  3EA6 A;  3V62 A;  1Q10 A;  3ZO5 B;  3A4S C;  3OG5 A;  4DDG D;  3WAM A;  3TSS A;  5J18 A;  1STE A;  4LNN A;  3VTV A;  4EKU A;  2J4X A;  1QKZ A;  3OLM D;  2KO3 A;  1OFF A;  1SSN A;  3ENE A;  3NS1 A;  4MM3 A;  2AX5 A;  3CWI A;  4NJ6 A;  3U7Z A;  3J9C A;  2LGD A;  4RMA A;  4YT0 B;  2JWU A;  3HVD A;  4II2 B;  3DPD A;  2AL6 A;  4JE3 B;  2G9H D;  2A5U A;  1J7A A;  3W1S A;  1JML A;  1NYR A;  3MC8 A;  4M0W A;  4WQO B;  1ZE3 D;  3LB8 C;  4REZ A;  2DYB A;  1MG8 A;  2JXT A;  3R3M A;  4FJZ A;  2QDF A;  1F9J A;  3W9C B;  3AM9 A;  5HG2 A;  3U2S C;  1C4A A;  2BYE A;  2QCZ A;  3I57 A;  1P7E A;  2PVG C;  1RAX A;  4HPP A;  4KIK A;  1HZ5 A;  3H9D A;  2K8B A;  2KWV B;  3B0A A;  4ACF A;  4B0E A;  3IAM 1;  3VRA B;  4A9A A;  2N0S B;  5J17 A;  2K8H A;  4W9D A;  3OJ4 B;  4ITK A;  2IO2 B;  1UWM A;  4RF1 A;  5AUK A;  3ZRC A;  2BYT A;  4HEA 1;  3JVZ X;  1FM0 D;  4ZRP A;  4W9J A;  2W9N A;  3T3N A;  2A4Z A;  2RPQ A;  2NVU I;  2RGF A;  1YX6 B;  2C60 A;  1R4M I;  1EWY C;  2AL3 A;  2OJW A;  2LZ6 A;  2ZJD A;  1XXG A;  2RPV A;  1OGW A;  1J7B A;  2MP2 A;  3AE2 B;  3FAH A;  3K9P B;  3N32 A;  3AXC A;  1E5W A;  1T0S C;  1TTN A;  3ZKJ C;  1TT5 B;  3ZJU A;  2UWQ A;  2WXI A;  4HKZ E;  1XLP A;  4RM8 A;  1TKG A;  1L0V B;  1WRI A;  1H4R A;  1J7C A;  1WRD B;  3IFW B;  3HHM A;  3SEB A;  3N3K B;  2G4S A;  2INP E;  4HLE A;  2MH7 A;  1I7H A;  2PJH A;  2D5G A;  4KGR A;  1YQ3 B;  3I5J C;  4URK A;  2IO3 B;  1EF5 A;  3L16 A;  4BKG A;  2J7Q B;  2QEJ C;  4YXD B;  3M62 B;  1K8R B;  1TKE A;  2PTL A;  2KDB A;  2KQ4 X;  3APF A;  3L10 B;  1KTK A;  2NR2 A;  1YQB A;  1WGH A;  3V3X A;  2ZNV B;  3Q8C A;  5CHW A;  3Q8E A;  4A55 A;  1MVK A;  3EFU A;  2IPK D;  4NQL B;  2JX5 A;  4G0N B;  2D07 B;  2DZI A;  3RMK C;  1E6E B;  1I4H A;  4C00 A;  1GOZ A;  1RWS A;  1TJE A;  4NZL B;  2N1W A;  4RGM A;  2FID A;  1D5M C;  2MW5 A;  4TV3 A;  1IGC A;  4IW0 A;  4BBN C;  1WZ0 A;  3N30 A;  4L1B A;  4RM9 A;  1MHH E;  1Y56 A;  3S2A A;  3V61 A;  3CST A;  1VR9 A;  1F2R I;  2N9K A;  2B76 B;  3DWM A;  4KSK C;  4XZ4 A;  2L52 A;  1C4P A;  2QC8 A;  3DVN V;  1RFK A;  4N9F 4;  3UGB B;  1WM2 A;  4AWJ A;  1S3S G;  2GMI C;  2V3P A;  2BBC A;  3RZF A;  2O6V D;  1F0Z A;  1GB1 A;  2RSU A;  5T8I A;  4WJQ A;  3H7P A;  1TYG B;  2O6V B;  4LLG M;  3R2I A;  1ZP0 B;  1ESF A;  2JSV X;  2Z8L A;  2LGI A;  3ONS A;  1TS3 A;  3AE3 B;  2PIA A;  4OW0 A;  3SR6 A;  2FCM A;  4GDL B;  1B9R A;  2REX A;  3AU5 A;  2KDF B;  2NPT B;  4US8 A;  1F1H A;  2K6D B;  2KFJ A;  2AEH A;  3B2G A;  2GI9 A;  3WA0 A;  5JZE B;  4WUR A;  2GBR A;  1WXQ A;  1QOG A;  2MBH A;  2BKF A;  5DPW A;  4GLS C;  1PFD A;  2BT6 A;  1VZ8 A;  4IG7 B;  2KXJ A;  2W3S A;  5D3I B;  4AOF A;  1HZ6 A;  3UQB A;  4IC7 B;  1V86 A;  2GBN A;  4LDT B;  4OZB A;  2RDH A;  3T3O A;  1JQ4 A;  2AYO B;  1ACC A;  1WX9 A;  4BOS C;  4Q2J A;  5BMI A;  2K6Q A;  2KLC A;  1GB4 A;  1WXA A;  2J42 A;  3TCA A;  3W1S C;  1WI0 A;  1UZX B;  2KYW A;  3P42 A;  2QJL A;  2C7H A;  2MQJ A;  2EKI A;  2X38 A;  1WGG A;  2IGD A;  2MBE A;  1XT9 B;  4KGS A;  2MJE A;  1I4P A;  1AN8 A;  3TMP B;  4KGT A;  4LJP B;  1PGX A;  2BKR B;  4TUU A;  4KZC A;  3Q3M C;  2EMT A;  2WX0 A;  2M8S A;  3U4E G;  1YNT E;  2H89 B;  3IVF A;  2HE7 A;  3L17 A;  3DVG X;  3EUB 2;  2KVR A;  1E8Z A;  2LJ5 A;  3RI7 C;  3K9O B;  4I6P A;  2AWT A;  3WAO A;  3I63 C;  5D94 A;  4XC2 A;  4A20 A;  4PYU A;  1TS5 A;  2JZP A;  1UBQ A;  5G5G A;  3NVZ A;  2KMC A;  3A1Q B;  3ZNZ B;  2WQY B;  2DZK A;  2VH1 A;  2WXH A;  1J19 A;  2BS4 B;  3M95 A;  2L7R A;  2K0P A;  4MH8 A;  4KSL C;  2ZCB A;  2W55 A;  5D6J B;  2N4F A;  4FHK A;  2WDQ B;  3R7R A;  1UH6 A;  3VVW B;  3ZW3 A;  2ZVO A;  1SJE D;  3PS6 A;  1FFV A;  1EUV B;  1WE7 A;  1N6Z A;  2IGH A;  1C78 A;  2DNF A;  1I42 A;  4XGA B;  2QMT A;  1KF6 B;  3OJ3 A;  1V6E A;  2W54 A;  1ZDX A;  3NRZ A;  2JUO A;  1JRO A;  4A3O A;  1ZOY B;  1BT0 A;  1UNS A;  4FA6 A;  5E6O A;  4C56 C;  2ICI A;  4TSS A;  3RNG C;  1WSP A;  5BMH A;  3LJ3 A;  3Q6B A;  2JXX A;  3ALB A;  4MGZ E;  1V81 A;  2GB1 A;  2W82 A;  1FO4 A;  4PS8 A;  3L4P A;  4KV2 A;  4A3P A;  1E7U A;  1N5X A;  3MTN B;  1D6E C;  3T9L A;  3RFZ B;  3RUL A;  5HI1 A;  1SB3 C;  4F8C B;  1NBF C;  1MPE A;  3H7S A;  3IT6 B;  4BBN F;  3AU4 A;  3R66 C;  4CQN A;  2Y5P A;  1UGM A;  4USA A;  2WWZ A;  1FRD A;  1NI3 A;  2HDE A;  3MHZ A;  3UI3 A;  3NG0 A;  3APD A;  4B9K A;  1RYJ A;  3M3J A;  2GBK A;  2XK5 A;  4ANV A;  2LHE A;  2WXG A;  2DZJ A;  4EZL A;  4I6L B;  2LJI A;  2MBB B;  3X0W A;  2LVP A;  2IYD B;  1VZ7 A;  4WJP A;  1P1A A;  4J6I A;  5HHD G;  4IM0 A;  3ZNH B;  3GE8 C;  3LYY A;  1GC6 A;  2Z59 B;  1I4G A;  3R8B A;  3TIX A;  3KYC D;  1XQQ A;  1WJ4 A;  3TL5 A;  4BZA A;  3JYU A;  3P63 A;  5FK9 C;  2DAF A;  4MJS A;  1TBE A;  3Q3J A;  3VUW A;  2ZPN A;  1QF6 A;  4BKT A;  2CHX A;  2QIL A;  2XEW A;  3QAQ A;  3QJZ A;  2HTH A;  2KK8 A;  3VXW A;  2DLB A;  2BYF A;  5MPO A;  1IP9 A;  2DBY A;  1F2R C;  5C23 A;  4G3X B;  2D3C A;  2AQ1 B;  2L1A A;  1ZKH A;  1P9D U;  2R61 A;  1V5T A;  3ZJV A;  1G6J A;  1WIA A;  3BY4 B;  5G55 A;  3DBS A;  4GDL A;  2Q5W D;  3CMM B;  2NPT A;  1YIW A;  4A6Q A;  4HRS A;  1WZ3 A;  2L76 A;  4KDI C;  4HJK A;  4C7Z A;  1WE6 A;  1D3Z A;  1SE2 A;  3PV1 A;  2Y5B B;  2PEA A;  1RFA A;  4DBG A;  3BVZ A;  5EE0 A;  2ACZ B;  1DOY A;  4IOI E;  3MC9 A;  1OEY J;  2KKC A;  1Q1O A;  2KVZ A;  4AP4 C;  1LO5 D;  4MGI E;  2NBU A;  4DQO C;  1YMH E;  4ARI A;  1RRB A;  1Z5S B;  4HDQ A;  5G5H A;  3QWZ B;  2WXO A;  4C80 A;  3HIZ A;  4DWF A;  5IP4 D;  4JWU C;  4LTU A;  2RR9 A;  3A9J A;  3N20 C;  3GP7 A;  4LCD E;  3VTW A;  1RM6 C;  3AE9 B;  2TSS A;  5IA7 A;  5DPR A;  3PTF C;  4NY0 A;  4K81 A;  1WWT A;  2CKH B;  5JH5 C;  4P16 A;  1V9J A;  3SU8 X;  5C1Z A;  2V4L A;  3P2B A;  4N58 A;  1BXT A;  1OQQ A;  2JU6 X;  1PGB A;  1LQB A;  1TKY A;  1OQR A;  4MSM B;  3UIO B;  1IYF A;  2MBQ A;  4CYE A;  1XLQ A;  3DBR B;  2YEP F;  2VZK D;  4NAM A;  3IHP C;  4IM2 A;  5AZH A;  1ZW7 A;  1WJU A;  1WR1 A;  2PLP A;  1WMH A;  2VZK B;  1GNU A;  1C4C A;  3GZN B;  5IN7 A;  4YTM B;  1L6U A;  2K3U A;  2G4D B;  3LXF A;  4WWP A;  3VRB B;  5JXV A;  3NOB A;  4LK0 M;  3A1Q A;  1AAR A;  4GB9 A;  2KC2 A;  5AUI A;  4DXA B;  2N9X A;  4NAW B;  3DDC B;  1WFY A;  4ICV A;  1ZXI A;  1SE4 A;  4IKG A;  1VDV A;  4GDK B;  2BS3 B;  1DYQ A;  3UQA A;  5LXH A;  3W2D A;  2C7N B;  4ZHO A;  4IDI A;  1T6B X;  1XLN A;  5BYQ A;  2M0X A;  2KAN A;  5HKH A;  2WXF A;  2IZV B;  1F77 A;  1K53 A;  4IUM B;  5IKC M;  1V5O A;  1V97 A;  2G3Q B;  2NMQ A;  5DCN A;  2KQS A;  2ONQ A;  3ZUN A;  2KLG A;  2BQQ A;  4MEM A;  1JWB D;  1WYW B;  2KHW B;  4FHJ A;  4G11 A;  1VJK A;  3A9K B;  1WYG A;  2IBI B;  2WP9 B;  3BK2 A;  1CJE A;  2D11 A;  4D2K A;  2Z0D B;  4EOY A;  1FXA A;  3X23 A;  5DPS A;  4M02 A;  3VR9 B;  1L2N A;  1HE8 A;  4II3 B;  3NJT A;  4JIO U;  2WXQ A;  3GE3 C;  1GAQ B;  4OZC A;  1WX7 A;  1V1P A;  4OVZ A;  1YOV B;  5TSS A;  1HTO A;  5CX3 A;  2LWP A;  4WJO A;  3ZDT A;  2ZPY A;  4HXD A;  1SE3 A;  4ZHP A;  2YLM A;  2ZW1 A;  3FIL A;  1TIF A;  4YSY B;  2V0G A;  3NVW A;  2CR5 A;  3PHW B;  2KJ6 A;  2JQR B;  2WS3 B;  2PPH A;  2LMC A;  4WAA A;  1FRR A;  2PKO A;  2DEN B;  2MA9 B;  1QQR A;  1SXT A;  3AV8 A;  4FXC A;  1XEE A;  4N6E B;  4W9K A;  4W9F A;  1Z2M A;  3DCG A;  3BVG A;  2FCQ A;  3NZ3 A;  3RNF C;  1ENF A;  4IM3 A;  3E56 A;  5CHV C;  4TMA B;  2AQ3 B;  4BKS D;  2M4N A;  1SIJ A;  4HPL B;  4PYZ A;  2C7M B;  4KVG B;  1B1Z A;  2L8J A;  1EU4 A;  3DQV A;  4OZA A;  2K39 A;  2SAK A;  3LDZ E;  3WAL A;  3QK0 A;  4DDI D;  1C76 A;  1N5W A;  3VAW A;  2L05 A;  3RYT A;  4F7Z A;  4WWO A;  4MAC A;  4LNK A;  1UD7 A;  1EO6 A;  4EFO A;  3FC4 A;  4BAX A;  1ET9 A;  5IAA C;  3HK0 A;  1N60 A;  2GLS A;  5EDS A;  2M1M A;  2RDG A;  2LFI A;  3ML9 A;  1WF9 A;  2BVC A;  5KHQ A;  3GOE A;  5H92 C;  3ZNG C;  1L5P A;  2L32 A;  1WM3 A;  2JZZ A;  3I9V 1;  3KWL A;  3HUI A;  3SDL C;  2PE6 B;  1TY2 A;  1PYW D;  2WXJ A;  4YWG G;  4O1N A;  2RD0 A;  4RGN A;  1L0Y B;  1R7S A;  2KX3 A;  4RGT A;  2RDB C;  2PW9 A;  2LAS A;  2MEK A;  1T3Q A;  4A8X C;  4GOC A;  5BYS A;  4E3C A;  2VRR B;  4AQ7 A;  1K51 A;  1S1Q B;  1UF0 A;  4WJN A;  3MHS D;  2O2V B;  2R2Q A;  1MHX A;  2KX0 A;  2PE9 A;  3ZJT A;  3DBR I;  1EF1 A;  2D3G A;  1J8C A;  2NCN A;  3VTU A;  1E8W A;  3DHI C;  2JWZ A;  4C4V B;  1EWC A;  2EEL A;  3KYD D;  2UU7 A;  4J3O D;  1KLU D;  3R2T A;  1FXI A;  3U52 E;  2M19 A;  2LUM A;  3GZN I;  2DHZ A;  2UYZ B;  3IG3 A;  1V49 A;  3N1Y C;  4KDL B;  4L2Y A;  2KTR B;  1QOF A;  1IPG A;  1HQR D;  4WQM A;  2PVO D;  4YTN B;  5G2N A;  2G45 B;  3RNA C;  2OOB B;  3Q8A A;  4HKQ A;  4M8M A;  2BPS A;  3PRZ A;  2DX5 B;  1EM7 A;  5IO9 A;  2NTS A;  1PUT A;  3NVV A;  2KN5 A;  1SGH A;  3IT4 B;  1P3Q U;  4BOZ B;  3APC A;  2HJ8 A;  2CHZ A;  1I35 A;  3RNE C;  1VCB A;  4MM3 B;  1L7Y A;  3Q69 A;  3C8Y A;  4PS7 A;  2AQ2 B;  5LLI A;  3P4S B;  2JYE A;  1XCT L;  2V3S A;  2CU1 A;  2MJ3 A;  4GDK A;  3VUX A;  3EHV A;  3KUZ A;  4M0W B;  2W3R A;  2HD5 B;  4AUQ C;  1YJ1 A;  5GXG B;  3AB5 A;  3ZDM C;  3QCA A;  1YD8 U;  2KQ7 A;  2IDY A;  3KUC B;  3VDZ A;  2WNM A;  2C5L C;  1NEK B;  4S0R A;  2EKE C;  3VUY A;  2I38 A;  1WJN A;  1N61 A;  2FCN A;  3TJP A;  1HTQ A;  4KIK B;  1E10 A;  3OAW A;  2RMM A;  4FBJ B;  3N9Y C;  4XYC A;  4S17 A;  4MGK E;  1K50 A;  4OHJ A;  1T0R C;  5C3J B;  2K25 A;  4WAF A;  1QIL A;  3SHQ A;  1XCQ L;  4TQ1 A;  1WGR A;  2K1F A;  4GSW A;  3VH4 B;  2C9W B;  3IXS A;  4BFR A;  1TGZ B;  3IAS 1;  5IOI A;  4ICU A;  4K7U A;  2CJN A;  2EMS A;  5AZG A;  1I4Q A;  3DBL I;  3M63 B;  5D3D A;  3RCZ A;  1T0Q C;  3ZYY X;  3Q3N C;  2BYV E;  4IWO A;  2LHD A;  3B08 A;  4L23 A;  2MP2 B;  3MP9 A;  4ZDV A;  3AE6 B;  2JY6 A;  4KX6 B;  1R4N B;  3BWU D;  1C3T A;  1C1Y B;  4EZK A;  1XLO A;  3BYT B;  2MSE D;  3MJW A;  2NBV B;  3O13 A;  2LXC A;  3WAP A;  1MI0 A;  3QA8 A;  1K52 A;  3EGR A;  4I6N B;  2GRI A;  3PPA A;  1ROE A;  1TS2 A;  4MH0 E;  3NUH B;  4HVB A;  2K5P A;  1WJ6 A;  1D5X C;  3PO0 A;  2LVQ A;  4M8N A;  2JRI B;  3DWG C;  3DVN U;  3SFD B;  5AEK B;  1ZXH A;  1OEY A;  1DGJ A;  5AZF A;  2KMA A;  3MC0 B;  4FN2 A;  4RH6 A;  3RN9 C;  3U8Z A;  1V8C A;  3AUL A;  2NTT A;  3PRE A;  3BYY B;  2FIF A;  2OHF A;  2CU3 A;  3RT3 B;  2K22 A;  3EFC A;  3P4R B;  3PT2 B;  4C7Y A;  4IWP A;  3QAR A;  3V60 A;  2LGY A;  3HM6 X;  2IY1 B;  1WXV A;  3PZD A;  1KRH A;  1TZ1 A;  4ZRK A;  4HRO A;  2CJO A;  1QLB B;  3ZNI D;  2CS4 A;  2O6V A;  3GB1 A;  1E0Z A;  2LGX A;  2OJR A;  2MX2 A;  1V80 A;  3HVZ A;  1I4X A;  1GG3 A;  4ZRQ A;  4GXB A;  1KLV A;  2JT4 B;  4PS3 A;  5EE1 A;  2GBM A;  4YSX B;  3H1U A;  3KUD B;  3L54 A;  3RPF C;  2BF8 B;  3AEE B;  3QHT A;  2XNA C;  2N7D A;  5FR6 A;  1FIQ A;  2CHW A;  4EEW A;  2KTF A;  5EE3 A;  2KJR A;  3D32 A;  1EU3 A;  2O2V A;  5D2M B;  5TR5 A;  1DOI A;  1N63 A;  4MDK E;  3NVY A;  4OVV A;  5JHB A;  2K8C A;  1WXM A;  1ZDV A;  3KVF B;  4HK2 A;  4C4V A;  1JWU D;  1WH3 A;  4WH4 A;  3ECI A;  1D4B A;  3OWE B;  5LXI B;  2E6X A;  1YQ4 B;  1A5R A;  1TZO A;  5FKA C;  1YX5 B;  1F52 A;  4DHZ B;  1KJT A;  4N59 A;  3RD2 A;  4E71 A;  1L6V A;  2N9P C;  1YJI A;  1T0Y A;  3TUO A;  2N7J A;  3AE8 B;  3RNB C;  2DYM A;  1V2Y A;  1KH0 A;  2M0A A;  2M56 B;  5LNK 1;  1FNV A;  4RCO A;  1OQY A;  2N9L A;  2JF5 A;  1QOB A;  2H88 B;  2FBW B;  2BTE A;  1ZGU B;  4NJC A;  1XD3 B;  2Y3A A;  2LGS A;  1WGY A;  1P0R A;  3TEZ A;  4WWN A;  2KAJ A;  2WXR A;  3NY5 A;  4DHJ D;  2G1E A;  3Q8B A;  1FCC C;  4YSZ B;  2ASQ A;  3A33 B;  2KDI A;  5BO4 B;  1UEL A;  2QSD A;  2KWD A;  2SEB D;  3UIP B;  4ANX A;  2KC1 A;  4JPS A;  4DHJ B;  2IGG A;  4B0M A;  4JWS C;  3H8H A;  1HXY D;  1Q5W B;  1GPX A;  2Y5C A;  3GS2 A;  5D7G A;  4NNJ B;  1IUE A;  2V4I B;  2ON8 A;  2IND C;  2INC C;  2LI5 A;  2J0J A;  4HJG E;  2WXM A;  4B6W A;  4A90 A;  1LXD A;  4ZOH C;  1AYF A;  2WGS A;  2WHI A;  1NYQ A;  1J0G A;  2IY0 B;  3IBE A;  3MFG A;  2BGF A;  1WGD A;  1JW9 D;  1DOX A;  2HTM E;  1A70 A;  3ZXR A;  2J53 A;  1R4N I;  3ZLZ A;  3BK1 A;  2WXP A;  4F1S A;  2N9E B;  1ISN A;  1CZP A;  2XN9 C;  1FXT B;  1LFD A;  3EC8 A;  2FE8 A;  4OVU A;  3AEC B;  1C77 A;  1YN5 A;  2MHJ A;  3VHT C;  4LNI A;  1GUA B;  1PQS A;  1LGR A;  3AI5 A;  3MJ5 A;  4XWT A;  3SD5 A;  3C0R B;  4WWM A;  3TEW A;  4UDU C;  5BMG A;  1YJJ A;  3I3T B;  4PT5 A;  1AWD A;  3L08 A;  4KKJ A;  4KKI A;  2KFK B;  3VFK A;  3AE5 B;  3W1Y A;  3VH3 B;  2KZR A;  2DYO A;  2MJD A;  5CTR C;  2ZNV C;  2NS5 A;  4RGO S;  2LEK A;  2WXN A;  3Q3O C;  2MBO A;  1KLG D;  2BB5 A;  3Q3F A;  5I4D A;  3B2F A;  1UGJ A;  1FFU A;  4NJ7 A;  5GMV A;  1E7V A;  2V3N A;  4B95 A;  1C79 A;  3DOW A;  3O65 B;  4MSQ B;  3A4R A;  4DXF A;  2I1K A;  3RZW C;  1E8X A;  3R7Q A;  1SBB B;  2INN E;  1D5Z C;  3B1L X;  2KD0 A;  5CHF A;  4FJY A;  4X57 B;  1HEZ E;  3DBH B;  4W9E A;  4G50 A;  5H8Y E;  3B9J A;  3PLU A;  2XBB C;  3DBL B;  1FEH A;  3WAN A;  4HCN B;  3AED B;  2NBW B;  4EUT A;  4WIP A;  2FCS A;  2IO1 B;  3QX1 A;  4DHZ E;  4LNO A;  4NQK E;  1E90 A;  4W9C A;  1M4V A;  3EEC A;  4BVU C;  5J2R A;  1T5X D;  2XK5 B;  1LM8 B;  3V6E B;  1KOT A;  1VRA B;  1P98 A;  1FCL A;  1KFY B;  4MEL A;  3PZ7 A; 
#chains in the Genus database with same CATH homology
 1SE9 A;  3TL5 A;  4PS7 A;  3JYU A;  2DYB A;  5LLI A;  1MG8 A;  4GMV A;  2DAF A;  3R3M A;  4FJZ A;  1RLF A;  2JPH A;  2V3S A;  1TBE A;  3Q3J A;  4MJS A;  1F9J A;  3VUW A;  2ZPN A;  4BKT A;  2CHX A;  2CU1 A;  2XEW A;  4GDK A;  3JSV B;  3VUX A;  3EHV A;  3QAQ A;  2BYE A;  3KUZ A;  3QJZ A;  2Z0E B;  2HTH A;  4M0W B;  1RAX A;  2HD5 B;  2KK8 A;  3VXW A;  4AUQ C;  1YJ1 A;  4KIK A;  2BYF A;  1VD2 A;  3H9D A;  2LD9 A;  3ZTC A;  3ZDM C;  4YL8 A;  3QCA A;  2K8B A;  2KWV B;  1IP9 A;  3B0A A;  1YD8 U;  2KQ7 A;  5C23 A;  5J17 A;  3KUC B;  2WYQ A;  3VDZ A;  4G3X B;  2K8H A;  4MJS B;  2C5L C;  1ZKH A;  4W9D A;  4LJO B;  3OJ4 B;  1P9D U;  2IO2 B;  3PRP B;  2EKE C;  3ZRC A;  1WX8 A;  1V5T A;  3VUY A;  1WJN A;  2LUE A;  3PSE B;  4KZ0 A;  3JVZ X;  1G6J A;  1WIA A;  3BY4 B;  2FCN A;  3H6N A;  5G55 A;  3TJP A;  3DBS A;  4GDL A;  4W9J A;  2W9N A;  4KIK B;  1GJZ A;  3CMM B;  2A4Z A;  2NPT A;  3OAW A;  1YIW A;  2RPQ A;  1WZ3 A;  2L76 A;  4KDI C;  4HJK A;  2NVU I;  2RGF A;  4FBJ B;  1YX6 B;  1WE6 A;  2C60 A;  4CHK A;  1D3Z A;  4MGK E;  1R4M I;  2AL3 A;  3RUI B;  2MCN B;  2K25 A;  2LZ6 A;  3PV1 A;  2Y5B B;  3SHQ A;  2PEA A;  1RFA A;  4TQ1 A;  2ZJD A;  4CO7 A;  4DBG A;  1WGR A;  2K1F A;  1OGW A;  3CSF A;  4GSW A;  2LRW A;  2C9W B;  3VH4 B;  2MP2 A;  4BFR A;  1QZE A;  4W9I A;  1OEY J;  3K9P B;  1TGZ B;  3N32 A;  3AXC A;  5E6P A;  2KKC A;  2JVC A;  1E5W A;  1Q1O A;  3ZKJ C;  1TTN A;  4ICU A;  4K7U A;  4AP4 C;  2UWQ A;  4MGI E;  2NBU A;  2EMS A;  5AZG A;  3DBL I;  3M63 B;  4P7I A;  1RRB A;  1OTR B;  1Z5S B;  4K1R B;  1Y8R C;  4RM8 A;  3ZVV A;  3RCZ A;  4HDQ A;  1H4R A;  3QWZ B;  2BYV E;  4IWO A;  4K7W A;  4LDT D;  1WRD B;  3NHE B;  3HIZ A;  4DWF A;  3B08 A;  3IFW B;  3HHM A;  2MP2 B;  2RR9 A;  2N7E A;  2BWF A;  4ZDV A;  2JY6 A;  2D2Q A;  2J0K A;  3A9J A;  3N3K B;  1C3T A;  2G4S A;  1C1Y B;  4HLE A;  4EZK A;  3MJW A;  2MSE D;  2NBV B;  2PJH A;  2LXC A;  4LCD E;  3WAP A;  3VTW A;  2KWC A;  2IO3 B;  4URK A;  1EF5 A;  3L16 A;  3QA8 A;  4AJW A;  4BKG A;  1UBI A;  4FJV B;  4I6N B;  4ASW C;  2D10 A;  3PPA A;  5DPT A;  5IA7 A;  4EZJ A;  2J7Q B;  3T8M A;  5DPR A;  3PTF C;  3M62 B;  4MH0 E;  4NY0 A;  4K81 A;  1K8R B;  2CKH B;  4HVB A;  5JH5 C;  2IO0 B;  2YVC A;  1V9J A;  3SU8 X;  1WJ6 A;  5C1Z A;  2R2O A;  2KDB A;  3APF A;  3L10 B;  2V4L A;  3A9J B;  3P2B A;  4FUL A;  2NR2 A;  2LVQ A;  4M8N A;  1YQB A;  2JRI B;  1LQB A;  1WGH A;  2ZNV B;  3DVN U;  4MSM B;  3UIO B;  5CHW A;  5AEK B;  1OEY A;  1IYF A;  3EFU A;  4NQL B;  2MBQ A;  5AZF A;  2KMA A;  4FN2 A;  4G0N B;  2D07 B;  4CYE A;  2DZI A;  4ZRI A;  3U8Z A;  1NI2 A;  4E74 A;  3AUL A;  3PRE A;  2L3Z A;  2FIF A;  3RT3 B;  3IHP C;  4IM2 A;  5AZH A;  4NAW A;  3PT2 B;  1ZW7 A;  4TKN A;  2N1W A;  4JL9 A;  1WJU A;  1WR1 A;  4IWP A;  2FID A;  3QAR A;  1WMH A;  3JW0 X;  2MW5 A;  3V60 A;  4TV3 A;  1GNU A;  3PLV A;  2LGY A;  3HM6 X;  4IW0 A;  4BBN C;  1WZ0 A;  3N30 A;  2IY1 B;  1WXV A;  1WR6 E;  3PZD A;  2G4D B;  4WWP A;  1TZ1 A;  4RM9 A;  4ZRK A;  3HM3 A;  4DK5 A;  3S2A A;  3V61 A;  3CST A;  2ZVN A;  3NOB A;  1X1M A;  3A1Q A;  1AAR A;  4GB9 A;  3CF6 E;  4KSK C;  2KC2 A;  4XZ4 A;  2KWU B;  2MLB A;  4FLH A;  2QHO A;  4DXA B;  2JZ3 B;  2LVO A;  2N9X A;  4NAW B;  3DDC B;  1WFY A;  3ZNI D;  2CS4 A;  2O6V A;  4XX5 A;  3DVN V;  4ICV A;  3QQ8 B;  1WMH B;  2JRH A;  1SIF A;  2KNB A;  2LGX A;  4MGY E;  4N9F 4;  3UGB B;  2OJR A;  1WM2 A;  4AWJ A;  1S3S G;  2BWE S;  2MX2 A;  4HDO A;  4GDK B;  2GMI C;  1V80 A;  3RZF A;  3UQA A;  3PGE A;  3UIN B;  2WDT B;  1GG3 A;  4GXB A;  2O6V D;  5LXH A;  5L95 C;  2RSU A;  1KLV A;  3U7D A;  2C7N B;  2JT4 B;  4PS3 A;  4JQW C;  2GBM A;  3H1U A;  4WJQ A;  3H7P A;  3KUD B;  3L54 A;  2BF8 B;  2O6V B;  3KH0 A;  2M0X A;  2KAN A;  3QHT A;  5HKH A;  3ONS A;  2IZV B;  2N7D A;  3QC8 B;  4W9G A;  5FR6 A;  2CHW A;  3A9K A;  4EEW A;  2KTF A;  3NS8 A;  2KFK A;  2KJR A;  3D32 A;  4IUM B;  2O2V A;  5JHA A;  5D2M B;  2FCM A;  5TR5 A;  2V1Y A;  3WIM A;  4MDK E;  4GDL B;  3TBL D;  1V5O A;  2REX A;  3ZTD A;  4OVV A;  3AU5 A;  2KDF B;  2G3Q B;  3UF8 A;  5JHB A;  2K8C A;  2NPT B;  5DCN A;  2K6D B;  2KFJ A;  2AEH A;  2KQS A;  3DBH I;  3ZUN A;  3NZU A;  2KLG A;  3WA0 A;  1WXM A;  1E8Y A;  3KVF B;  4HK2 A;  5JZE B;  2GBR A;  4MEM A;  1WH3 A;  1WYW B;  2KHW B;  3U30 A;  2ZCC A;  2MBH A;  2B3A A;  3ECI A;  2LXA A;  2BKF A;  2LRU A;  4FHJ A;  1M94 A;  4G11 A;  5DPW A;  3A9K B;  5E6N A;  5LXI B;  2IBI B;  3L13 A;  4IG7 B;  2KXJ A;  1A5R A;  4AOF A;  3UQB A;  2D11 A;  4IC7 B;  1YX5 B;  2Z0D B;  4EOY A;  1V86 A;  3X23 A;  5DPS A;  4ANU A;  2GBN A;  4DHZ B;  1KJT A;  4GIV A;  2DZM A;  1L2N A;  5KHO A;  3RD2 A;  1HE8 A;  4LDT B;  4FAD A;  4II3 B;  2L0F A;  4JIO U;  4E71 A;  2N9P C;  2M17 A;  1T0Y A;  3NZS A;  1H8C A;  2AYO B;  2FNJ B;  1WX7 A;  2DYM A;  4K7S A;  1WX9 A;  4W9L A;  2LWP A;  5CX3 A;  4WJO A;  4BOS C;  3ZDT A;  1V2Y A;  2ZPY A;  4HXD A;  4IWQ A;  2K6Q A;  2KLC A;  1OQY A;  2YLM A;  2DAJ A;  2I1J A;  4GN1 A;  2JF5 A;  2L0T A;  4GU2 A;  2CR5 A;  1WXA A;  3PHW B;  1ZGU B;  2KJ6 A;  3TCA A;  3W1S C;  1XD3 B;  1WI0 A;  1UZX B;  2PPH A;  4WAA A;  1WGY A;  1P0R A;  4WWN A;  2DEN B;  2C7H A;  2MA9 B;  2MQJ A;  3NY5 A;  4DHJ D;  2N1V A;  2ASQ A;  1WGG A;  2KOX A;  3A33 B;  2MBE A;  2KDI A;  3ML8 A;  1XT9 B;  5BO4 B;  1UEL A;  1WY8 A;  4W9K A;  3TMP B;  4W9F A;  1Z2M A;  2ZZP B;  3UIP B;  4ANX A;  2KC1 A;  2BKR B;  4LJP B;  4DHJ B;  4TUU A;  3DCG A;  4KZC A;  2J0M A;  2EMT A;  2FCQ A;  4TQ0 A;  2WX0 A;  4BKS A;  3JSV A;  4IM3 A;  1Q5W B;  2M8S A;  5CHV C;  1GC7 A;  3IVF A;  4HWI B;  2HE7 A;  3L17 A;  5D7G A;  4NNJ B;  3DVG X;  4HCP B;  2KVR A;  2FAZ A;  1E8Z A;  2GOW A;  2LI5 A;  4BKS D;  2J0J A;  2LJ5 A;  2M4N A;  3L0W B;  4JLC A;  2KJH B;  4HPL B;  4PYZ A;  4B6W A;  2C7M B;  4KVG B;  3K9O B;  1LXD A;  2L8J A;  2GBJ A;  2AWT A;  3DQV A;  4I6P A;  2K39 A;  3WAO A;  2MRP A;  2ZEQ A;  3LDZ E;  4HPM B;  5D94 A;  4XC2 A;  3WAL A;  3QK0 A;  4DDI D;  4A20 A;  3VAW A;  2L05 A;  4PYU A;  4NPN A;  4WWO A;  2FUH B;  3RYT A;  4F7Z A;  1UBQ A;  2WX1 A;  1UD7 A;  1J0G A;  1EO6 A;  2IY0 B;  3IBE A;  3PVL A;  2BGF A;  2L00 B;  3ZRF A;  2KMC A;  1WGD A;  3A1Q B;  3ZNZ B;  4EFO A;  2DZK A;  4AJY B;  5IAA C;  3HK0 A;  5EDS A;  1J19 A;  3V6C B;  3M95 A;  2L7R A;  3BIN A;  4KSL C;  2M1M A;  2ZCB A;  3ML9 A;  1WF9 A;  5D6J B;  2N4F A;  1JRU A;  4FHK A;  5KHQ A;  1R4N I;  3GOE A;  3R7R A;  3ZNG C;  3ZIM A;  1UH6 A;  3KW5 B;  3VVW B;  3ZLZ A;  4ANW A;  4F1S A;  3ZW3 A;  1WM3 A;  2JZZ A;  2N9E B;  1ISN A;  2ZVO A;  3SDL C;  2PE6 B;  1KM7 A;  3PS6 A;  1FXT B;  3PHX B;  1LFD A;  1EUV B;  3EC8 A;  5L83 A;  2RD0 A;  1WE7 A;  4OVU A;  1I42 A;  2KX3 A;  3QIJ A;  2KDE B;  3VHT C;  1GUA B;  3H7P B;  1V6E A;  3OJ3 A;  1PQS A;  4GGQ A;  2LAS A;  4GOC A;  3AI5 A;  2JUO A;  3SD5 A;  3C0R B;  4A3O A;  4ZRJ A;  1BT0 A;  3VQI A;  4E3C A;  2VRR B;  4W9H A;  3I3T B;  4FA6 A;  5E6O A;  3L08 A;  1S1Q B;  3DVG Y;  4WJN A;  4JGH B;  2KFK B;  3MHS D;  3VFK A;  2O2V B;  3LJ3 A;  3W1Y A;  3VH3 B;  2KZR A;  2JXX A;  2R2Q A;  2DYO A;  3PRM B;  2KX0 A;  2PE9 A;  3ALB A;  5CTR C;  4ZYN A;  2ZNV C;  2NS5 A;  4MGZ E;  2KTR A;  1WXS A;  1Q0W B;  2MWS B;  1EF1 A;  1V81 A;  1CMX B;  2D3G A;  3DBR I;  2MBO A;  1J8C A;  4PS8 A;  2NCN A;  3VTU A;  1NDD A;  1E8W A;  3Q3F A;  2JWZ A;  4KV2 A;  4A3P A;  1E7U A;  3MTN B;  3T9L A;  4NJ7 A;  3RUL A;  1U4A A;  3KYD D;  5GMV A;  3V62 A;  1E7V A;  4F8C B;  1NBF C;  3ZO5 B;  3A4S C;  3H7S A;  4B95 A;  3GZN I;  4BBN F;  2DHZ A;  3DOW A;  3O65 B;  4DDG D;  2UYZ B;  3AU4 A;  4MSQ B;  3IG3 A;  3WAM A;  1V49 A;  3A4R A;  3R66 C;  4KDL B;  5J18 A;  2I1K A;  1UGM A;  2KTR B;  4EKU A;  3VTV A;  2WWZ A;  3RZW C;  1E8X A;  3R7Q A;  1IPG A;  3OLM D;  3APD A;  4B9K A;  2KO3 A;  3ENE A;  3M3J A;  2GBK A;  2XK5 A;  4ANV A;  4MM3 A;  5G2N A;  2DZJ A;  4EZL A;  3B1L X;  4NJ6 A;  4I6L B;  2G45 B;  2KD0 A;  5CHF A;  2LGD A;  4FJY A;  2MBB B;  4X57 B;  4W9E A;  3X0W A;  2OOB B;  4G50 A;  2LVP A;  2IYD B;  4M8M A;  3PLU A;  2XBB C;  4WJP A;  3WAN A;  4RMA A;  4HCN B;  2BPS A;  2NBW B;  3PRZ A;  2DX5 B;  4EUT A;  1P1A A;  2FCS A;  2IO1 B;  4II2 B;  4J6I A;  3QX1 A;  3DPD A;  4DHZ E;  4IM0 A;  4NQK E;  2AL6 A;  3ZNH B;  2KN5 A;  1E90 A;  4W9C A;  1GC6 A;  1SGH A;  3EEC A;  1P3Q U;  4BOZ B;  2Z59 B;  4BVU C;  5J2R A;  3APC A;  2HJ8 A;  2CHZ A;  2A5U A;  1I35 A;  1VCB A;  2XK5 B;  3W1S A;  1LM8 B;  4WQO B;  3V6E B;  1KOT A;  1L7Y A;  1P98 A;  3TIX A;  3KYC D;  4MEL A;  1XQQ A;  1WJ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...