3WANA

Crystal structure of atg13 lir-fused human lc3a_2-121
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
126
structure length
126
Chain Sequence
DDFVMIGSPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Autophagy-related protein 13, Microtubule-associated protein
publication title Structural basis of the autophagy-related LC3/Atg13 LIR complex: recognition and interaction mechanism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 34
structure length 126
sequence length 126
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3wanA00
2KWUB 3K9PB 1J8CA 2C9WB 2ZVOA 1Q5WB 3MJWA 2LGXA 4EOYA 3AXCA 1Z5SB 2NS5A 2KJHB 4EZKA 3PTFC 3QC8B 2M0XA 3V60A 4DK5A 3TIXA 1UH6A 3APDA 1EF5A 1JRUA 2ZCBA 1WXMA 1Q0WB 2K8CA 1WH3A 2G45B 1GJZA 2DYMA 2B3AA 4FJYA 4HXDA 2UWQA 3TMPB 1I35A 1NDDA 1PQSA 1YX5B 2JF5A 2MQJA 2V1YA 3OLMD 3O65B 3RD2A 3R7RA 4KDLB 4BOZB 2MWSB 4GMVA 2GBJA 3HHMA 2NPTB 3NZUA 2BYVE 5IA7A 2L00B 2M4NA 3DBRI 3PT2B 1E7UA 2FCMA 4A20A 4AWJA 4M8MA 3PS6A 1V80A 4KIKB 5C23A 1WMHA 2DX5B 3WIMA 3L08A 3AU5A 2CR5A 2KDBA 2HTHA 2AL6A 4DDID 3ZNID 3VTWA 3IG3A 4GU2A 2Z0EB 2BKRB 3U8ZA 4FN2A 4WAAA 3M62B 2DHZA 2NBWB 3QK0A 1L2NA 2NPTA 2IBIB 3VDZA 3M63B 2MP2A 3A1QA 2K39A 1OEYA 4NJ7A 3A33B 3R3MA 4ZYNA 2L8JA 3OAWA 4BKSD 2LGYA 3RZFA 2GBKA 2M17A 2KDIA 1WF9A 1WXSA 3W1SC 2DZKA 1V86A 2I1JA 2L05A 4FHJA 1WZ3A 2LASA 4MSMB 4FADA 4BBNF 1WJ4A 4P7IA 1GC6A 3QAQA 2IO0B 2KN5A 2ZVNA 1P9DU 4WJOA 1YD8U 3T8MA 4E71A 2C7MB 2JY6A 3PV1A 1XD3B 3AU4A 3A9JB 4HCNB 4WJNA 4MDKE 2J7QB 1U4AA 3AI5A 2KO3A 2DYBA 4W9CA 4BBNC 1WJUA 2KLGA 4DXAB 2K8HA 4GB9A 4PYUA 5E6OA 4EEWA 3VAWA 2KXJA 2KZRA 1TZ1A 4DBGA 5C1ZA 2KMAA 4FJVB 1KLVA 4WQOB 3PSEB 2RSUA 4MJSB 4II3B 2GOWA 4ANXA 1K8RB 1Q1OA 3DBHI 4E3CA 4BKTA 1WY8A 2CU1A 2L7RA 2K25A 5DPRA 3V6CB 4JLCA 4XX5A 2FNJB 3L0WB 3ZLZA 3RT3B 4JGHB 2D3GA 3VH4B 5L95C 3N32A 1WGRA 1WM2A 3H7PB 4F1SA 1P98A 1HE8A 1WJNA 2LRUA 3QCAA 2ZCCA 4NAWB 5DPTA 4PS8A 3NOBA 3DBLI 4KV2A 3ZTCA 1NBFC 2D07B 4MJSA 2Z59B 4HK2A 1WR6E 2JXXA 5CHFA 1E8ZA 3IVFA 2KK8A 4I6LB 4FBJB 3LJ3A 5J18A 1SE9A 2LVQA 4ASWC 2ZZPB 3PLUA 2RD0A 3W1YA 1X1MA 1KJTA 2R2OA 2IO2B 2KANA 3X23A 2NR2A 1GNUA 1VD2A 3NZSA 4HDOA 5LLIA 2L0FA 1ZW7A 2GBNA 2KD0A 2MBQA 3ML8A 3KYCD 4G0NB 4IWOA 2DYOA 4PS7A 4TV3A 2KNBA 4KSKC 2KC1A 3UIOB 2N7DA 2MBHA 1OEYJ 3X0WA 3KH0A 3ECIA 4IM3A 4DHZE 2ZNVB 1WGHA 5TR5A 3VUYA 4ANVA 2KWCA 4AJYB 1VCBA 4BKSA 5D94A 4A3PA 3L54A 5GMVA 2YLMA 4FHKA 4FLHA 2WX0A 4MSQB 4F8CB 1UBQA 1TGZB 2KFKB 5D2MB 2JVCA 2DAJA 4ICVA 4NJ6A 1UGMA 4CHKA 4CYEA 4GSWA 4HPLB 5KHQA 3VTUA 4JQWC 4AUQC 4EKUA 2MLBA 1EUVB 4GDLA 3ZIMA 4EZLA 3QQ8B 1WMHB 2Z0DB 4K1RB 2NBUA 3NS8A 4NY0A 3PZDA 3K9OB 4W9LA 4HLEA 2DZMA 4EZJA 3DDCB 1R4MI 3JVZX 2AEHA 1KM7A 4ZRIA 4E74A 4IW0A 4WJQA 5JH5C 3L13A 2K8BA 4BOSC 4IG7B 4BFRA 2KFKA 2N4FA 2DAFA 3EFUA 4MGIE 2MP2B 3A1QB 1S1QB 2XEWA 3JW0X 3KYDD 2EMSA 3M3JA 1RRBA 1YQBA 2KMCA 2DZJA 1LFDA 3WA0A 2KKCA 4IUMB 4W9KA 2KHWB 3IHPC 1XQQA 3LDZE 3A9KB 5LXIB 2LGDA 3QARA 5E6PA 3EC8A 3ZDTA 1E8YA 3QWZB 3BY4B 2JT4B 1QZEA 2WDTB 4G11A 4I6PA 3ZO5B 4B6WA 4TQ0A 2N9PC 2NBVB 3V6EB 4TQ1A 2GMIC 2D10A 4FJZA 1SGHA 3ZRFA 3VH3B 4JL9A 1OGWA 2C7HA 2JRHA 1M94A 2MA9B 2R2QA 2XK5A 3MTNB 1RFAA 3JSVA 4GIVA 1YX6B 2M8SA 2PE6B 2YVCA 3N3KB 2KOXA 2C7NB 2ASQA 2OJRA 2KDEB 2FIDA 1J19A 3H9DA 4MGYE 5IAAC 3A9KA 4RM9A 1OTRB 1L7YA 1ISNA 4DDGD 1WYWB 2LVOA 1E90A 2GBRA 5JHBA 3B1LX 4HVBA 4ZRJA 3ZDMC 2BYFA 2BGFA 4N9F4 3RUIB 4AP4C 4MELA 2JUOA 3W1SA 2N1WA 4FA6A 1F9JA 2PJHA 5CTRC 4TKNA 4HJKA 4AOFA 1WM3A 2LJ5A 5AZHA 3P2BA 3ALBA 2O6VD 4GOCA 1V81A 3SHQA 2RPQA 5CHWA 3PHWB 4GGQA 4HPMB 3ZTDA 2MBOA 3L17A 1D3ZA 2REXA 2FCNA 2LI5A 2IY1B 1WI0A 4KZ0A 3RCZA 1WX7A 2KFJA 2Y5BB 4HWIB 3TJPA 2LWPA 2KDFB 4II2B 3GZNI 5AZGA 2D11A 3GOEA 4G3XB 1H8CA 2XBBC 3KUCB 1P3QU 3PRZA 3UQBA 3U7DA 3B0AA 4PS3A 2IYDB 2J0KA 1LQBA 3WAOA 4NNJB 4K81A 5CX3A 4ZDVA 4IC7B 1AARA 4X57B 4ZRKA 2RR9A 4ICUA 2HD5B 2N1VA 3ZNZB 4W9GA 3SDLC 3PPAA 1WGYA 4W9FA 3PRMB 2PEAA 1LM8B 2K6QA 2MW5A 4W9HA 4W9DA 3DQVA 1S3SG 2AYOB 3HK0A 2KVRA 4KVGB 3ONSA 2FCQA 1R4NI 2KTRA 2N9EB 3EECA 3WAPA 2JRIB 4K7WA 3T9LA 3IBEA 2JZ3B 3VVWB 1WXVA 3DBSA 3VXWA 1CMXB 4CO7A 3JYUA 3UIPB 3ZW3A 1WRDB 2LVPA 3QHTA 4GDKB 3WANA 3IFWB 2C60A 3ZKJC 4EUTA 4URKA 1UZXB 1TTNA 2AWTA 2MSED 1ZKHA 2UYZB 4GDLB 1H4RA 2HJ8A 2D2QA 2M1MA 3A4RA 3U30A 4EFOA 2KQ7A 1C3TA 2EMTA 1E5WA 3V62A 3DVNU 4B9KA 1IPGA 2FIFA 4GXBA 1A5RA 1Z2MA 2O6VB 2L0TA 4LDTD 4LJOB 1P1AA 2JPHA 2CHXA 1WX9A 2PE9A 4HCPB 4MGKE 3VUXA 1Y8RC 2WWZA 5CHVC 4B95A 3OJ3A 4WWOA 2W9NA 1E8XA 3HM6X 3PRPB 4ANUA 3QJZA 1IYFA 1GUAB 1FXTB 2CKHB 4GDKA 4DWFA 2IZVB 4RM8A 2FAZA 3I3TB 4MGZE 1TBEA 4I6NB 4F7ZA 3KVFB 2MBBB 2KX3A 2ZPYA 5JHAA 3DVNV 5L83A 3UQAA 3C0RB 3TBLD 2O6VA 1RLFA 2WX1A 3PGEA 2IO1B 3ZVVA 4GN1A 1WE7A 5EDSA 3R66C 3DCGA 2BWES 3RZWC 5G55A 4HDQA 1J0GA 3L10B 2XK5B 2K6DB 2KLCA 1V6EA 5JZEB 1EO6A 2V4LA 2ZNVC 3AULA 3JSVB 4W9EA 1E8WA 3V61A 3PREA 3UINB 3DVGY 3NHEB 4BKGA 3M95A 2K1FA 4G50A 5DPSA 3KUDB 4M0WB 1KOTA 3DPDA 3R7QA 2BYEA 1V5TA 5D6JB 5DCNA 3UF8A 3VUWA 4NQLB 3PVLA 2KWVB 2MCNB 2CS4A 4K7UA 4MM3A 4A3OA 2OOBB 2LXAA 4TUUA 1WR1A 2WYQA 2G3QB 5D7GA 2LXCA 2JWZA 4LCDE 2KTFA 2BF8B 4K7SA 2MBEA 4MEMA 4PYZA 1WJ6A 1WZ0A 4NPNA 4LDTB 3QX1A 4IM2A 2A4ZA 5J2RA 1I42A 4XZ4A 2EKEC 4LJPB 4ANWA 2FCSA 2KJRA 4IWPA 5LXHA 2O2VB 3Q3JA 4WWPA 3ZUNA 2KX0A 3H7SA 2LUEA 2QHOA 2MRPA 3NY5A 3BINA 2KQSA 4OVVA 3Q3FA 3CSFA 4JIOU 5FR6A 3DVGX 1XT9B 3SD5A 5AEKB 5KHOA 2BWFA 1C1YB 1V5OA 3CMMB 2IO3B 4KIKA 5J17A 1G6JA 1IP9A 1NI2A 2LZ6A 3QA8A 5G2NA 4W9IA 2N9XA 3VTVA 1GG3A 2G4SA 4M8NA 2O2VA 2LD9A 3H1UA 3PLVA 4DHJD 2N7EA 1V49A 3ZNHB 2KC2A 1BT0A 2LRWA 2ZPNA 4WJPA 3TL5A 1YJ1A 2G4DB 3L16A 4KSLC 3TCAA 4IWQA 2KTRB 3CSTA 1YIWA 3KUZA 4MH0E 3RULA 2RGFA 2L3ZA 2DZIA 3PHXB 4KZCA 2NVUI 1WGDA 4XC2A 3EHVA 3ZNGC 2L76A 3N30A 4YL8A 5HKHA 1UD7A 2MX2A 2A5UA 3D32A 1WX8A 3DOWA 3HM3A 4NQKE 2I1KA 3VFKA 1UELA 4BVUC 3APFA 1UBIA 5DPWA 4J6IA 3WALA 4KDIC 3ENEA 2JZZA 2NCNA 3A9JA 2VRRB 2CHWA 1V9JA 3OJ4B 5AZFA 1WFYA 2ZEQA 4FULA 1WXAA 5E6NA 3ZRCA 1V2YA 3CF6E 2ZJDA 4IM0A 2CHZA 3VQIA 2PPHA 3MHSD 3UGBB 4RMAA 2BPSA 4AJWA 1ZGUB 3S2AA 4W9JA 5BO4B 3QIJA 1WE6A 1WGGA 2GBMA 2AL3A 2C5LC 1T0YA 3HIZA 1WIAA 2KJ6A 1MG8A 3B08A 1SIFA 1EF1A 3APCA 4OVUA 2IY0B 1OQYA 2J0MA 1RAXA 3H6NA 2HE7A 3RYTA 3VHTC 3ML9A 3WAMA 1E7VA 1P0RA 4WWNA 3H7PA 4DHJB 2FUHB 2J0JA 3KW5B 3SU8X 2BKFA 4NAWA 2V3SA 1LXDA 3A4SC 4DHZB 2DENB 1GC7A
chains in the Genus database with same CATH superfamily
1PYWD 3MJWA 2LGXA 3BZDB 1SE4A 2QCZA 1UWMA 2PIAA 1V1PA 3APDA 1VDVA 1FCCC 1WXMA 2ZCBA 1WH3A 2G45B 2PVOD 2N7JA 4FJYA 1OQQA 1I35A 4C4VB 1ET6A 3OLMD 3RD2A 4GMVA 2GBJA 3HHMA 2XN9C 1KLUD 3MP9A 1EWCA 1V80A 1TKGA 2AL6A 1AWDA 2L1AA 2N9KA 3TEXA 2BKRB 3I9V1 4FN2A 2PMVA 3VDZA 3B2GA 2MP2A 4ZYSA 3R3MA 4US9A 4BAXA 1SJED 2YEPF 1MPEA 1J7AA 3DBRB 3ABVB 1WXSA 1MVKA 1AYFA 1V86A 1PFDA 1FFUA 2XNAC 2LASA 4FADA 4P7IA 1GC6A 2IO0B 2ZVNA 1P9DU 3N9YC 1XCTL 3FAHA 4E71A 3PV1A 1XD3B 1I7HA 1LGRA 1TKEA 2DYBA 4M02A 2TSSA 2K8HA 4EEWA 2WDQB 4OHJA 2KZRA 1ZDXA 1TZ1A 3GE8C 4FJVB 4WQOB 2W54A 2RSUA 4MJSB 4II3B 1K8RB 4BKTA 2CU1A 2K25A 4XWWA 3ZLZA 2BVCA 5L95C 2G9HD 3IT4B 1WGRA 3H7PB 1WJNA 4JWUC 2BBCA 4PS8A 3ZTCA 1JCKB 4L1BA 1E8ZA 4H2AA 1XLQA 4GLSC 3LJ3A 2GI9A 4ASWC 5BYQA 1XLOA 5EE1A 1V1PB 2IGGA 2R2OA 1GNUA 5D3DA 2L0FA 2NMQA 3ML8A 4IWOA 1RM6C 2DYOA 4PS7A 2KC1A 1NYRA 4BKSA 3Q8BA 1ZPSA 4KKIA 2WX0A 4MSQB 4F8CB 1UBQA 5D2MB 2WXPA 2JVCA 3DWGC 4JE3B 4B0EA 4GSWA 3VTUA 4RGOS 4AUQC 4XDDA 2VH1A 4ZRQA 1CK1A 3PZDA 4HLEA 1R4MI 2AEHA 1KM7A 4ZRIA 3IXSA 1KH0A 4IW0A 2JU6X 2KFKA 2DAFA 2MP2B 1YQ4B 2DNFA 1YQBA 2DZJA 1LFDA 4W9KA 3IHPC 1XQQA 3A9KB 4DXGA 5E6PA 3EC8A 3QWZB 1QZEA 1T5XD 2AQ2B 1L6UA 4FJZA 1SGHA 1PUTA 4JL9A 5AZFA 1SXTA 2C7NB 2ASQA 2OJRA 2BQQA 2KDEB 1JWUD 4MGYE 5IAAC 1OTRB 1TS5A 5JHBA 3BIID 1L6VA 4ZRJA 3B2FA 4N9F4 2BGFA 3RFZB 2JUOA 4AOFA 1VJKA 2LJ5A 3E56A 3ALBA 3P2BA 2O6VD 1V81A 2RPQA 5CHWA 3I5JC 4PT5A 3PHWB 5IN7A 1ZUD2 2MJ3A 2BW2A 2PW9A 1I4PA 3IT6B 1D3ZA 2REXA 2BB5A 2IY1B 3RCZA 4IDIA 1FNUA 2G1EA 1ACCA 2MHJA 4II2B 1TJEA 1N62A 3GOEA 2KWDA 2XBBC 2M19A 4R3DA 3U7DA 2J0KA 2WXJA 2N9LA 2W3SA 4ZDVA 2HD5B 3ZNZB 3KLSX 2K6QA 2VZKD 4NZLB 2L32A 1R4NI 2KTRA 3PO0A 3WAPA 2WXFA 1P7FA 4US8A 3VVWB 2JZ3B 1WXVA 3MC0B 1EM7A 2RDHA 3ZKJC 4OZAA 2AWTA 1TTNA 2ACZB 4TMAB 3Q8AA 2D2QA 4EFOA 2KQ7A 2LHEA 4LNNA 3U4EG 3AN1A 1Z2MA 2PKOA 4LDTD 2FBWB 3VUXA 4HCPB 4B95A 4P16A 1Y8RC 3OJ3A 3OWEB 3PRPB 3DHHC 4ANUA 3QJZA 1GUAB 1ZP0B 1FXTB 2CKHB 4RM8A 1ET9A 2MBBB 4EE2A 1ROEA 3C0RB 3TBLD 3PGEA 2IO1B 4GN1A 1WE7A 5EDSA 3P4SB 3DCGA 4MACA 3AULA 2V4LA 3KWVA 1FXIA 3V61A 5D3IB 4BKGA 3CIRB 4JX1C 2KQ4X 3AE2B 4G50A 4ZHPA 2WNMA 3TEZA 3KUDB 1KOTA 1MHXA 2BYEA 1J7CA 3HRDD 3ZJUA 4MM3A 2RDBC 1WR1A 2WYQA 2DBYA 5D7GA 1C76A 2KTFA 2BF8B 2MBEA 1I4GA 3CWIA 2HTME 4NPNA 4XZ4A 2IJ0A 3Q3JA 4WWPA 3H7SA 2KQSA 2J52A 5FR6A 4RF0A 1XT9B 5KHOA 1HTQA 1C1YB 2IO3B 4KIKA 5J17A 2LZ6A 3QA8A 5G2NA 1B9RA 2WXGA 2G4SA 1I4XA 2O2VA 4DHJD 3H1UA 3PLVA 2N7EA 1BMLC 1V49A 2LRWA 1YJ1A 2G4DB 4WQMA 2KTRB 2B76B 2IPKD 2DZIA 4YSYB 4KZCA 2KT7A 2K5PA 3DOWA 2ICIA 3WALA 3I57A 2JZZA 1XXGA 3A9JA 1V9JA 1XEEA 4IM0A 1I4RA 3UGBB 5EE9A 4AJWA 4W9JA 5BO4B 5HFYA 1WIAA 1SIFA 4OVUA 2IY0B 4YT0B 2J0MA 1SE3A 3Q8FA 3RYTA 1E7VA 2W82A 4WWNA 2FUHB 3KW5B 4P1BC 2BKFA 2V3SA 3A4SC 3SEBA 2C9WB 1Q5WB 4YTMB 4IOIE 3R2TA 2OHFA 1E9MA 2NS5A 2KJHB 3DBLB 1HTOA 3QC8B 3V60A 4DK5A 3TIXA 1GB4A 1SEBD 4MM3B 4C00A 2QJLA 4LTUA 2B3AA 2BS2B 3C8YA 2MQJA 3U52E 4XYCA 3O65B 2MWSB 3ZYYX 2NPTB 4XGAB 5IA7A 2L00B 3DBRI 3PT2B 2WLBA 5T8IA 4AWJA 4M8MA 4KIKB 1GPXA 3WIMA 4C4VA 3AU5A 2CR5A 1C4PA 3VTWA 3IG3A 3DWMA 2Z0EB 1YQ3B 2DLBA 5TSSA 1YOVB 5AUIA 1N5XA 1YMHE 2ON8A 3M63B 4NJ7A 2L8JA 3OAWA 4BKSD 3MHZA 4KX6B 2LGYA 3RZFA 2M17A 2DZKA 3VR8B 3AEEB 1L4DB 4BBNF 1WJ4A 4PK1A 2MEKA 1HXYD 4ZHOA 2E6XA 1I4HA 3RNCC 3AU4A 3A9JB 1TZOA 4MDKE 3AI5A 2KO3A 4RH6A 1T0RC 4YXDB 4W9CA 4BBNC 2KLGA 4KGTA 4GB9A 4PYUA 4DBGA 2KMAA 1KLVA 3W9CB 1I4QA 1WXQA 3PSEB 3AEAB 5I4DA 4E3CA 2PLPA 4RCOA 1HZ6A 4XX5A 2FNJB 3L0WB 1STEA 3N32A 1EU4A 4MJSA 2JXXA 2LJIA 2WHIA 4C56C 3IVFA 3DHGC 3TUOA 1ZXHA 1X1MA 1KJTA 1PGBA 3DBHB 2KANA 3W1YA 3SFEB 3NZSA 4HDOA 5LLIA 1PDXA 1ZW7A 3SU8X 2KACA 1OEYJ 1TYGB 4DHZE 2ZNVB 3OG5A 2WU5B 3VUYA 2KWCA 1N5WA 1UGMA 5KHQA 2MLBA 3L4PA 3V3XA 1QOBA 3K9OB 2DZMA 3DDCB 1JWMD 2LGSA 3BK1A 4BFRA 2N4FA 1L0YB 2XEWA 4YSZB 2SEBD 3KYDD 4DXFA 1D5ZC 1YJJA 4A90A 2KHWB 3LDZE 5LXIB 1E8YA 4G11A 3V6EB 2GMIC 2H89B 2R2QA 2C7HA 3MTNB 1RFAA 1YX6B 2WP9B 3N3KB 1OQRA 3H9DA 2WXMA 3A9KA 4RM9A 4DDGD 4M0WA 2LVOA 1E90A 2GBRA 1AW7A 2UU7A 4XE0A 4AP4C 3RUIB 3W1SA 3ZGZA 5CTRC 1NVID 3LXFA 5AZHA 1OFFA 4GOCA 3AE5B 4YTPB 2MBOA 3KWLA 1JWBD 4KZ0A 2KFJA 3TJPA 2LWPA 2KDFB 5AZGA 3AH7A 1FO4A 1XLNA 1LQBA 1F2RC 4NNJB 4IC7B 4X57B 3BK2A 1N61A 3PRMB 2PEAA 1K52A 3RNEC 3DQVA 1S3SG 3HK0A 2KVRA 4WAFA 2FCQA 3GE3C 4C7ZA 3T9LA 2PTLA 3RNBC 1CMXB 3JYUA 1SE2A 3WANA 3NG0A 2IGHA 1H4RA 2KDMA 2V0GA 3U30A 3A4RA 1C3TA 1E5WA 4GXBA 1P1AA 2JPHA 2CHXA 3BVZA 4MGKE 2WWZA 1YJIA 4WWOA 3BVMA 1IYFA 4DWFA 4F7ZA 3AB5A 2J53A 1TT5B 1RLFA 1EWYC 3Q14C 2LHDA 5IP4D 3RZWC 1JW9D 4HDQA 4W9EA 3DVGY 4JPSA 5DPSA 1FRDA 4M0WB 3H8HA 3DPDA 2ZW1A 2PVGC 2LMCA 4M01A 3VUWA 1SSNA 2CS4A 1E10A 4RFBA 1TIFA 2LXCA 1GAQB 2JWZA 4HKZE 2AX5A 4MEMA 4PYZA 4J3OD 4IKGA 5GXGB 1HA5A 1Q10A 1N60A 2A4ZA 1DOIA 2EKEC 4LJPB 2FCSA 4IWPA 3HVZA 3ZUNA 1YN3A 2FUG1 2LUEA 1WSPA 2LUMA 3N1ZC 3CSFA 4JIOU 2QILA 3DVGX 5AEKB 3FC4A 1V5OA 3AV8A 1G6JA 3AMZA 3ZNHB 4ZRPA 3NRZA 1BT0A 5C3JB 1AN8A 3NVZA 4LNFA 4KSLC 3U2SC 2L3ZA 2GRIA 4XC2A 3ZNGC 4RGMA 5G5GA 2L76A 4YL8A 2MX2A 1WGKA 2I1KA 3VFKA 3APFA 4MH8A 3HVDA 3RNGC 3OJ4B 2CU3A 2CHWA 2VRRB 1WFYA 1WXAA 3ZRCA 2ZJDA 1QLBB 4RMAA 2BPSA 1ZGUB 4ARIA 4MT5A 1WGGA 2JYEA 1DOYA 2WDVB 1FIQA 3B08A 3APCA 1RAXA 1KFYB 1F1HA 5AUKA 3VHTC 3WAMA 3R8BA 2KVZA 3RMKC 4NAWA 3RNFC 1LXDA 4DHZB 1RFKA 3K9PB 3SFDB 1J8CA 2LEKA 3GB1A 3PTFC 4WURA 2M0XA 5BYRA 3VRBB 1EF5A 1JRUA 1Q0WB 1VZ7A 1QT9A 1GJZA 5BMGA 3AE1B 3LB8C 4HXDA 1CJEA 3TMPB 1NDDA 3RPFC 1PQSA 2JF5A 4UDUC 2V1YA 1K53A 3EUB2 1XLPA 2E3TA 4KDLB 3R7RA 2BS3B 1YNTE 4BOZB 2Q5WD 1CQVA 1C77A 4B0MA 3NZUA 2K3UA 1HEZE 2M4NA 1QILA 1D6EC 1ZOYB 3MJ5A 3P42A 3P1MA 5C23A 1WMHA 2KMMA 3L08A 2HTHA 4DDID 2GLSA 2DWQA 4FXCA 5HI1A 2JWUA 3U8ZA 3ETRA 3M62B 1J7BA 3QK0A 4RNAA 2NPTA 1SIJA 3AEGB 3A1QA 1KTKA 2K39A 2OJWA 2V4IB 4S17A 4ZYNA 1L4ZB 2GBKA 2INCC 2KDIA 1WF9A 3ZJVA 2I1JA 2L05A 3IAS1 2OEDA 4FHJA 1WZ3A 4MSMB 3QAQA 1PGAA 4WJOA 2C7MB 2JY6A 2INDC 4KGRA 1U4AA 1WJUA 4LLGM 4DXAB 1VR9A 3AEBB 1EU3A 5E6OA 3VAWA 2KXJA 2AQ1B 5C1ZA 1ZE3D 4ANXA 3DBHI 2WXRA 1WY8A 2FE8A 2L7RA 1NI3A 3BYTB 5C2TB 3UI3A 4JLCA 4JGHB 5LNK1 1RYJA 1QF6A 1F0ZA 1WM2A 1P98A 1HE8A 3QCAA 4NAWB 4L2YA 1YN5A 1DYQA 1ZXIA 2Z59B 1WR6E 3Q6BA 1UWXA 2D3AA 4FBJB 2INPE 5J18A 1SE9A 3EA6A 2ZZPB 3T3OA 1GB1A 3PLUA 2RD0A 1T0SC 3X23A 1P7EA 1VD2A 2WXHA 2WGSA 2D5GA 2GBNA 2MBQA 2QEJC 4REZA 4TV3A 4KSKC 3GS2A 1QKZA 4XDCA 2N7DA 1SB3C 3ECIA 4IM3A 1WGHA 4ANVA 1VCBA 5D94A 1RWSA 3J9CA 4A3PA 3L54A 2JX5A 5GMVA 4FLHA 3U7ZA 4NJ6A 4HPLB 2V9HA 1WMHB 4WWMA 3NS8A 4W9LA 2JYTA 2H88B 1JRPA 5FR3A 3AEFB 1XO3A 4LNOA 4OZCA 2K8BA 1L0VB 3EFUA 3A1QB 3JW0X 2EMSA 3M3JA 1RRBA 5MPOA 1F2RI 2KMCA 1UGJA 1JWAD 1UUPA 3WA0A 2EELA 2LGDA 3QARA 3ZDTA 1ENFA 3BY4B 2JT4B 2WDTB 3V05A 3ZO5B 1FPYA 2D10A 3ZRFA 2GB1A 2XK5A 2JRHA 1M94A 2MA9B 4GIVA 3JSVA 5BMHA 1J19A 1CZPA 2I2YA 1L7YA 1ISNA 1XCQL 1NEKB 3B1LX 3ZDMC 2BYFA 2N1WA 4TKNA 1WM3A 3SHQA 3L17A 2FCNA 1WI0A 1E7PB 1WX7A 4HROA 2Y5BB 3KQ4A 3Q3MC 1FNWA 1IGDA 2D11A 3P4QB 4G3XB 1H8CA 4YSXB 3PRZA 1WWTA 2IYDB 3WAOA 4K81A 5CX3A 2HDEA 2BT6A 4JWSC 4ZRKA 2RR9A 2WXOA 2N1VA 4HJGE 4ZOHC 3SDLC 4AQ7A 3PPAA 1F77A 2MW5A 3B9JA 2AYOB 1TY2A 3AE4B 3ONSA 5EE0A 2Z8LA 2CJNA 4K7WA 3GZNB 3DBSA 4CO7A 3UIPB 3ZW3A 3NJTA 1WRDB 4GDKB 1BUIC 4EUTA 1HZ5A 3W5VB 2HJ8A 3T3NA 3RNAC 2EMTA 1VRAB 2FIFA 1A5RA 2O6VB 2L0TA 2MJDA 4LJOB 2PE9A 1WX9A 4EKUA 3Q8CA 2W55A 2W9NA 4QAYA 1E8XA 2IZVB 2FAZA 2KX3A 2ZPYA 1IBXB 1DGJA 2INNE 2WX1A 4HEA1 3ZVVA 3PZ7A 1C4CA 3R66C 2XK5B 2K6DB 2M56B 5JZEB 3JSVB 2ZNVC 2VZKB 2JXTA 3UINB 4L23A 4AS1A 3M95A 2JSVX 3R7QA 5BMIA 4YWGG 1V5TA 4WH4A 1T0QC 5D6JB 3ZXRA 4NQLB 3PVLA 2MCNB 4K7UA 4A3OA 3FILA 1VZ6A 3AEDB 4K7SA 1MG4A 1WJ6A 2HJ1A 2YEPB 1WZ0A 1Y56A 3AE3B 3QX1A 4IM2A 1IUEA 4LDTB 4CQNA 4ANWA 2LFIA 1BXTA 2KJRA 1TY0A 1VLBA 5EE3A 4N59A 2QHOA 2MRPA 3MC8A 3NY5A 5FKAC 3Q3FA 5JXVA 4ACFA 2BTEA 3BYYB 1FFVA 4HRSA 1NI2A 2WXNA 3SR6A 4W9IA 2N9XA 2JQRB 1FXAA 3W2DA 2LD9A 4M00A 1T6BX 5HHDG 3TL5A 3L16A 1MHHE 3TCAA 4IWQA 3CSTA 1TKYA 3RULA 4TSSA 3Q3NC 1M4VA 2QDFA 1MJDA 1L0XB 2IDYA 1E6EB 2WDRB 5HKHA 3NVVA 2A5UA 1WX8A 3HM3A 3AE6B 2BB6A 4K3BA 1UELA 5DPWA 2ZW0A 4J6IA 3Q2AC 4KDIC 2NCNA 2ZEQA 4FULA 5E6NA 3CF6E 5H92C 2PPHA 3MHSD 3NUHB 3MFGA 2WU2B 3P63A 2AL3A 3C19A 1HQRD 5HG2A 3HIZA 2KJ6A 1N6ZA 4D2KA 4O1NA 1IGCA 1OQYA 3H6NA 3NS1A 2HE7A 4ARCA 4BZAA 3ML9A 1P0RA 4DHJB 5G5HA 1GC7A 2KWUB 2KAJA 2ZVOA 1VZ8A 4EOYA 4YTNB 2RDGA 3AXCA 1V1OA 1Z5SB 4EZKA 1UH6A 3RN9C 2K8CA 1T3QA 1FNVA 3FILB 5IO9A 2DYMA 2UWQA 3HUIA 4Q2JA 1YX5B 2J42A 1JQ4A 2BYVE 3P4RB 1E7UA 2FCMA 1KRHA 4A20A 3PS6A 2W3RA 2DX5B 2KDBA 4N58A 3RI7C 3ZNID 4GU2A 4OVZA 4HKQA 1C4AA 4WAAA 2DHZA 2NBWB 1L2NA 2IBIB 2NTTA 1OEYA 3A33B 2KN4A 4A9AA 2J4XA 3ZXVA 2CJOA 3W1SC 4A8XC 2Y5PA 1DOXA 1FRRA 1FCLA 2KN5A 2QC8A 3T8MA 1YD8U 4HCNB 4WJNA 2J7QB 4LK0M 1F52A 2Y5CA 1N63A 1FD6A 4OW0A 3DHIC 3URYA 2GOWA 1Q1OA 1NYQA 3V6CB 2X8XX 5DPRA 3EGRA 3RT3B 2D3GA 3VH4B 1V97A 3ZQ4A 3AE8B 4F1SA 1SF0A 2LRUA 2ZCCA 5DPTA 4OZBA 4KV2A 3DBLI 1NBFC 2D07B 1JWSD 2QIEB 4HK2A 5CHFA 1L5PA 2KK8A 4I6LB 3AM9A 2LVQA 1MI0A 3N1YC 2IO2B 2NR2A 1D4BA 1V8CA 2KD0A 4G0NB 3KYCD 2KNBA 3UIOB 2NTSA 2I38A 2MBHA 3X0WA 3KH0A 3TSSA 5TR5A 4AJYB 3P4PB 1FEHA 1GOZA 2YLMA 1PGXA 3Q3OC 3R2IA 4FHKA 4KKJA 3W5UB 2KFKB 1TGZB 2X38A 2DAJA 4ICVA 4CHKA 4CYEA 1ESFA 4JQWC 1EUVB 4GDLA 3ZIMA 4EZLA 3QQ8B 2Z0DB 4K1RB 2NBUA 4NY0A 4EZJA 1R7SA 4N6EB 3JVZX 2RMMA 4E74A 4WJQA 2WXQA 3NVYA 3L13A 5JH5C 4BOSC 4MGIE 1S1QB 4C7YA 1MFWA 2BS4B 2KKCA 4IUMB 5H8YE 1QOFA 1K51A 4I6PA 4B6WA 4TQ0A 2N9PC 2NBVB 2BYTA 4TQ1A 2LGIA 2JZPA 1R4MB 3VH3B 3NOBA 1OGWA 4IG7B 2RPVA 3O13A 2QMTA 2PE6B 2M8SA 2YVCA 5E6JA 2KOXA 2FIDA 1JROA 1WYWB 3MC9A 4RGNA 4HVBA 2D3CA 4MELA 1UNSA 1D5MC 4FA6A 1F9JA 2PJHA 4HJKA 1UF0A 3Q69A 3TEYA 4K3CA 3BVGA 3VRAB 2AQ3B 4HPMB 4GGQA 3ZTDA 1A70A 2LI5A 4HWIB 1QOGA 4DQOC 2EKIA 5BYSA 3GZNI 2KYWA 3PZ8A 3KUCB 1P3QU 1E0ZA 4WIPA 3UQBA 2ONQA 5FK9C 3B0AA 4PS3A 2D3BA 1AARA 4ICUA 4W9GA 3N20C 1WGYA 3AE7B 4W9FA 1NENB 1LM8B 2WXLA 4W9HA 3LYYA 2MH7A 4W9DA 4S0RA 4KVGB 1SBBB 2N9EB 4P6VF 3EECA 2JRIB 1JALA 3IBEA 3VXWA 3BWUD 2LVPA 1D5XC 3QHTA 3IFWB 2C60A 4URKA 1UZXB 2WXIA 2MSED 2M0AA 1ZKHA 4GDLB 2UYZB 3GP7A 1B1ZA 2M1MA 3V62A 3DVNU 4B9KA 1IPGA 1KLGD 3EFCA 1K50A 5CHVC 2WS3B 1SJHD 3HM6X 1XF5L 4C80A 1TS3A 4GDKA 1R4NB 3I3TB 4MGZE 1TBEA 4I6NB 5IOIA 3KVFB 4RF1A 2MJEA 5JHAA 3DVNV 5L83A 3UQAA 2O6VA 3FKYA 2BWES 5G55A 1J0GA 3L10B 1V6EA 2KLCA 1EO6A 1E8WA 3E9SA 1LO5D 4RGTA 3ZJTA 3PREA 3Q8EA 3NHEB 2K1FA 1IBXA 3VR9B 4A55A 1TS2A 3NVWA 5DCNA 3UF8A 2KWVB 2VH2A 2OOBB 2LXAA 4TUUA 2G3QB 2WQYB 4LCDE 4KGSA 4P1CC 1QQRA 5J2RA 1I42A 5LXHA 2O2VB 2K9XA 4LNKA 2KX0A 1YN4A 3BINA 4OVVA 3SD5A 1C78A 2BWFA 1FM0D 3CMMB 1IP9A 2K0PA 1C79A 3VTVA 1GG3A 4M8NA 4USAA 2Y3AA 2KC2A 1ZDVA 2ZPNA 4WJPA 2N0SB 2IGDA 5IKCM 2V3NA 1YIWA 1WYGA 3KUZA 4MH0E 2K22A 2RGFA 3PHXB 1QOAA 2NVUI 1WGDA 3EHVA 1KF6B 4NAMA 1TS4A 1FMAD 2QSDA 3N30A 2L52A 1UD7A 2WXKA 3I63C 2V3PA 3D32A 4NQKE 3AECB 4BVUC 1UBIA 3ENEA 3TEWA 1WRIA 3N1XC 1V2YA 1JMLA 3AE9B 2CHZA 4ITKA 3VQIA 4NJCA 2L83A 3NZ3A 3S2AA 4XWTA 3QIJA 1WE6A 2SAKA 2GBMA 2C5LC 2R61A 1T0YA 1C9FA 1MG8A 1EF1A 4LNIA 3IAM1 4A6QA 3H7PA 3WCQA 2J0JA 4HPPA 2DENB
chains in the Genus database with same CATH topology
2KWUB 3K9PB 1J8CA 2C9WB 2ZVOA 1Q5WB 3MJWA 2LGXA 4EOYA 3AXCA 1Z5SB 2NS5A 2KJHB 4EZKA 3PTFC 3QC8B 2M0XA 3V60A 4DK5A 3TIXA 1UH6A 3APDA 1EF5A 1JRUA 2ZCBA 1WXMA 1Q0WB 2K8CA 1WH3A 2G45B 1GJZA 2DYMA 2B3AA 4FJYA 4HXDA 2UWQA 3TMPB 1I35A 1NDDA 1PQSA 1YX5B 2JF5A 2MQJA 2V1YA 3OLMD 3O65B 3RD2A 3R7RA 4KDLB 4BOZB 2MWSB 4GMVA 2GBJA 3HHMA 2NPTB 3NZUA 2BYVE 5IA7A 2L00B 2M4NA 3DBRI 3PT2B 1E7UA 2FCMA 4A20A 4AWJA 4M8MA 3PS6A 1V80A 4KIKB 5C23A 1WMHA 2DX5B 3WIMA 3L08A 3AU5A 2CR5A 2KDBA 2HTHA 2AL6A 4DDID 3ZNID 3VTWA 3IG3A 4GU2A 2Z0EB 2BKRB 3U8ZA 4FN2A 4WAAA 3M62B 2DHZA 2NBWB 3QK0A 1L2NA 2NPTA 2IBIB 3VDZA 3M63B 2MP2A 3A1QA 2K39A 1OEYA 4NJ7A 3A33B 3R3MA 4ZYNA 2L8JA 3OAWA 4BKSD 2LGYA 3RZFA 2GBKA 2M17A 2KDIA 1WF9A 1WXSA 3W1SC 2DZKA 1V86A 2I1JA 2L05A 4FHJA 1WZ3A 2LASA 4MSMB 4FADA 4BBNF 1WJ4A 4P7IA 1GC6A 3QAQA 2IO0B 2KN5A 2ZVNA 1P9DU 4WJOA 1YD8U 3T8MA 4E71A 2C7MB 2JY6A 3PV1A 1XD3B 3AU4A 3A9JB 4HCNB 4WJNA 4MDKE 2J7QB 1U4AA 3AI5A 2KO3A 2DYBA 4W9CA 4BBNC 1WJUA 2KLGA 4DXAB 2K8HA 4GB9A 4PYUA 5E6OA 4EEWA 3VAWA 2KXJA 2KZRA 1TZ1A 4DBGA 5C1ZA 2KMAA 4FJVB 1KLVA 4WQOB 3PSEB 2RSUA 4MJSB 4II3B 2GOWA 4ANXA 1K8RB 1Q1OA 3DBHI 4E3CA 4BKTA 1WY8A 2CU1A 2L7RA 2K25A 5DPRA 3V6CB 4JLCA 4XX5A 2FNJB 3L0WB 3ZLZA 3RT3B 4JGHB 2D3GA 3VH4B 5L95C 3N32A 1WGRA 1WM2A 3H7PB 4F1SA 1P98A 1HE8A 1WJNA 2LRUA 3QCAA 2ZCCA 4NAWB 5DPTA 4PS8A 3NOBA 3DBLI 4KV2A 3ZTCA 1NBFC 2D07B 4MJSA 2Z59B 4HK2A 1WR6E 2JXXA 5CHFA 1E8ZA 3IVFA 2KK8A 4I6LB 4FBJB 3LJ3A 5J18A 1SE9A 2LVQA 4ASWC 2ZZPB 3PLUA 2RD0A 3W1YA 1X1MA 1KJTA 2R2OA 2IO2B 2KANA 3X23A 2NR2A 1GNUA 1VD2A 3NZSA 4HDOA 5LLIA 2L0FA 1ZW7A 2GBNA 2KD0A 2MBQA 3ML8A 3KYCD 4G0NB 4IWOA 2DYOA 4PS7A 4TV3A 2KNBA 4KSKC 2KC1A 3UIOB 2N7DA 2MBHA 1OEYJ 3X0WA 3KH0A 3ECIA 4IM3A 4DHZE 2ZNVB 1WGHA 5TR5A 3VUYA 4ANVA 2KWCA 4AJYB 1VCBA 4BKSA 5D94A 4A3PA 3L54A 5GMVA 2YLMA 4FHKA 4FLHA 2WX0A 4MSQB 4F8CB 1UBQA 1TGZB 2KFKB 5D2MB 2JVCA 2DAJA 4ICVA 4NJ6A 1UGMA 4CHKA 4CYEA 4GSWA 4HPLB 5KHQA 3VTUA 4JQWC 4AUQC 4EKUA 2MLBA 1EUVB 4GDLA 3ZIMA 4EZLA 3QQ8B 1WMHB 2Z0DB 4K1RB 2NBUA 3NS8A 4NY0A 3PZDA 3K9OB 4W9LA 4HLEA 2DZMA 4EZJA 3DDCB 1R4MI 3JVZX 2AEHA 1KM7A 4ZRIA 4E74A 4IW0A 4WJQA 5JH5C 3L13A 2K8BA 4BOSC 4IG7B 4BFRA 2KFKA 2N4FA 2DAFA 3EFUA 4MGIE 2MP2B 3A1QB 1S1QB 2XEWA 3JW0X 3KYDD 2EMSA 3M3JA 1RRBA 1YQBA 2KMCA 2DZJA 1LFDA 3WA0A 2KKCA 4IUMB 4W9KA 2KHWB 3IHPC 1XQQA 3LDZE 3A9KB 5LXIB 2LGDA 3QARA 5E6PA 3EC8A 3ZDTA 1E8YA 3QWZB 3BY4B 2JT4B 1QZEA 2WDTB 4G11A 4I6PA 3ZO5B 4B6WA 4TQ0A 2N9PC 2NBVB 3V6EB 4TQ1A 2GMIC 2D10A 4FJZA 1SGHA 3ZRFA 3VH3B 4JL9A 1OGWA 2C7HA 2JRHA 1M94A 2MA9B 2R2QA 2XK5A 3MTNB 1RFAA 3JSVA 4GIVA 1YX6B 2M8SA 2PE6B 2YVCA 3N3KB 2KOXA 2C7NB 2ASQA 2OJRA 2KDEB 2FIDA 1J19A 3H9DA 4MGYE 5IAAC 3A9KA 4RM9A 1OTRB 1L7YA 1ISNA 4DDGD 1WYWB 2LVOA 1E90A 2GBRA 5JHBA 3B1LX 4HVBA 4ZRJA 3ZDMC 2BYFA 2BGFA 4N9F4 3RUIB 4AP4C 4MELA 2JUOA 3W1SA 2N1WA 4FA6A 1F9JA 2PJHA 5CTRC 4TKNA 4HJKA 4AOFA 1WM3A 2LJ5A 5AZHA 3P2BA 3ALBA 2O6VD 4GOCA 1V81A 3SHQA 2RPQA 5CHWA 3PHWB 4GGQA 4HPMB 3ZTDA 2MBOA 3L17A 1D3ZA 2REXA 2FCNA 2LI5A 2IY1B 1WI0A 4KZ0A 3RCZA 1WX7A 2KFJA 2Y5BB 4HWIB 3TJPA 2LWPA 2KDFB 4II2B 3GZNI 5AZGA 2D11A 3GOEA 4G3XB 1H8CA 2XBBC 3KUCB 1P3QU 3PRZA 3UQBA 3U7DA 3B0AA 4PS3A 2IYDB 2J0KA 1LQBA 3WAOA 4NNJB 4K81A 5CX3A 4ZDVA 4IC7B 1AARA 4X57B 4ZRKA 2RR9A 4ICUA 2HD5B 2N1VA 3ZNZB 4W9GA 3SDLC 3PPAA 1WGYA 4W9FA 3PRMB 2PEAA 1LM8B 2K6QA 2MW5A 4W9HA 4W9DA 3DQVA 1S3SG 2AYOB 3HK0A 2KVRA 4KVGB 3ONSA 2FCQA 1R4NI 2KTRA 2N9EB 3EECA 3WAPA 2JRIB 4K7WA 3T9LA 3IBEA 2JZ3B 3VVWB 1WXVA 3DBSA 3VXWA 1CMXB 4CO7A 3JYUA 3UIPB 3ZW3A 1WRDB 2LVPA 3QHTA 4GDKB 3WANA 3IFWB 2C60A 3ZKJC 4EUTA 4URKA 1UZXB 1TTNA 2AWTA 2MSED 1ZKHA 2UYZB 4GDLB 1H4RA 2HJ8A 2D2QA 2M1MA 3A4RA 3U30A 4EFOA 2KQ7A 1C3TA 2EMTA 1E5WA 3V62A 3DVNU 4B9KA 1IPGA 2FIFA 4GXBA 1A5RA 1Z2MA 2O6VB 2L0TA 4LDTD 4LJOB 1P1AA 2JPHA 2CHXA 1WX9A 2PE9A 4HCPB 4MGKE 3VUXA 1Y8RC 2WWZA 5CHVC 4B95A 3OJ3A 4WWOA 2W9NA 1E8XA 3HM6X 3PRPB 4ANUA 3QJZA 1IYFA 1GUAB 1FXTB 2CKHB 4GDKA 4DWFA 2IZVB 4RM8A 2FAZA 3I3TB 4MGZE 1TBEA 4I6NB 4F7ZA 3KVFB 2MBBB 2KX3A 2ZPYA 5JHAA 3DVNV 5L83A 3UQAA 3C0RB 3TBLD 2O6VA 1RLFA 2WX1A 3PGEA 2IO1B 3ZVVA 4GN1A 1WE7A 5EDSA 3R66C 3DCGA 2BWES 3RZWC 5G55A 4HDQA 1J0GA 3L10B 2XK5B 2K6DB 2KLCA 1V6EA 5JZEB 1EO6A 2V4LA 2ZNVC 3AULA 3JSVB 4W9EA 1E8WA 3V61A 3PREA 3UINB 3DVGY 3NHEB 4BKGA 3M95A 2K1FA 4G50A 5DPSA 3KUDB 4M0WB 1KOTA 3DPDA 3R7QA 2BYEA 1V5TA 5D6JB 5DCNA 3UF8A 3VUWA 4NQLB 3PVLA 2KWVB 2MCNB 2CS4A 4K7UA 4MM3A 4A3OA 2OOBB 2LXAA 4TUUA 1WR1A 2WYQA 2G3QB 5D7GA 2LXCA 2JWZA 4LCDE 2KTFA 2BF8B 4K7SA 2MBEA 4MEMA 4PYZA 1WJ6A 1WZ0A 4NPNA 4LDTB 3QX1A 4IM2A 2A4ZA 5J2RA 1I42A 4XZ4A 2EKEC 4LJPB 4ANWA 2FCSA 2KJRA 4IWPA 5LXHA 2O2VB 3Q3JA 4WWPA 3ZUNA 2KX0A 3H7SA 2LUEA 2QHOA 2MRPA 3NY5A 3BINA 2KQSA 4OVVA 3Q3FA 3CSFA 4JIOU 5FR6A 3DVGX 1XT9B 3SD5A 5AEKB 5KHOA 2BWFA 1C1YB 1V5OA 3CMMB 2IO3B 4KIKA 5J17A 1G6JA 1IP9A 1NI2A 2LZ6A 3QA8A 5G2NA 4W9IA 2N9XA 3VTVA 1GG3A 2G4SA 4M8NA 2O2VA 2LD9A 3H1UA 3PLVA 4DHJD 2N7EA 1V49A 3ZNHB 2KC2A 1BT0A 2LRWA 2ZPNA 4WJPA 3TL5A 1YJ1A 2G4DB 3L16A 4KSLC 3TCAA 4IWQA 2KTRB 3CSTA 1YIWA 3KUZA 4MH0E 3RULA 2RGFA 2L3ZA 2DZIA 3PHXB 4KZCA 2NVUI 1WGDA 4XC2A 3EHVA 3ZNGC 2L76A 3N30A 4YL8A 5HKHA 1UD7A 2MX2A 2A5UA 3D32A 1WX8A 3DOWA 3HM3A 4NQKE 2I1KA 3VFKA 1UELA 4BVUC 3APFA 1UBIA 5DPWA 4J6IA 3WALA 4KDIC 3ENEA 2JZZA 2NCNA 3A9JA 2VRRB 2CHWA 1V9JA 3OJ4B 5AZFA 1WFYA 2ZEQA 4FULA 1WXAA 5E6NA 3ZRCA 1V2YA 3CF6E 2ZJDA 4IM0A 2CHZA 3VQIA 2PPHA 3MHSD 3UGBB 4RMAA 2BPSA 4AJWA 1ZGUB 3S2AA 4W9JA 5BO4B 3QIJA 1WE6A 1WGGA 2GBMA 2AL3A 2C5LC 1T0YA 3HIZA 1WIAA 2KJ6A 1MG8A 3B08A 1SIFA 1EF1A 3APCA 4OVUA 2IY0B 1OQYA 2J0MA 1RAXA 3H6NA 2HE7A 3RYTA 3VHTC 3ML9A 3WAMA 1E7VA 1P0RA 4WWNA 3H7PA 4DHJB 2FUHB 2J0JA 3KW5B 3SU8X 2BKFA 4NAWA 2V3SA 1LXDA 3A4SC 4DHZB 2DENB 1GC7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KWU B;  3K9P B;  1J8C A;  2C9W B;  2ZVO A;  1Q5W B;  3MJW A;  2LGX A;  4EOY A;  3AXC A;  1Z5S B;  2NS5 A;  2KJH B;  4EZK A;  3PTF C;  3QC8 B;  2M0X A;  3V60 A;  4DK5 A;  3TIX A;  1UH6 A;  3APD A;  1EF5 A;  1JRU A;  2ZCB A;  1WXM A;  1Q0W B;  2K8C A;  1WH3 A;  2G45 B;  1GJZ A;  2DYM A;  2B3A A;  4FJY A;  4HXD A;  2UWQ A;  3TMP B;  1I35 A;  1NDD A;  1PQS A;  1YX5 B;  2JF5 A;  2MQJ A;  2V1Y A;  3OLM D;  3O65 B;  3RD2 A;  3R7R A;  4KDL B;  4BOZ B;  2MWS B;  4GMV A;  2GBJ A;  3HHM A;  2NPT B;  3NZU A;  2BYV E;  5IA7 A;  2L00 B;  2M4N A;  3DBR I;  3PT2 B;  1E7U A;  2FCM A;  4A20 A;  4AWJ A;  4M8M A;  3PS6 A;  1V80 A;  4KIK B;  5C23 A;  1WMH A;  2DX5 B;  3WIM A;  3L08 A;  3AU5 A;  2CR5 A;  2KDB A;  2HTH A;  2AL6 A;  4DDI D;  3ZNI D;  3VTW A;  3IG3 A;  4GU2 A;  2Z0E B;  2BKR B;  3U8Z A;  4FN2 A;  4WAA A;  3M62 B;  2DHZ A;  2NBW B;  3QK0 A;  1L2N A;  2NPT A;  2IBI B;  3VDZ A;  3M63 B;  2MP2 A;  3A1Q A;  2K39 A;  1OEY A;  4NJ7 A;  3A33 B;  3R3M A;  4ZYN A;  2L8J A;  3OAW A;  4BKS D;  2LGY A;  3RZF A;  2GBK A;  2M17 A;  2KDI A;  1WF9 A;  1WXS A;  3W1S C;  2DZK A;  1V86 A;  2I1J A;  2L05 A;  4FHJ A;  1WZ3 A;  2LAS A;  4MSM B;  4FAD A;  4BBN F;  1WJ4 A;  4P7I A;  1GC6 A;  3QAQ A;  2IO0 B;  2KN5 A;  2ZVN A;  1P9D U;  4WJO A;  1YD8 U;  3T8M A;  4E71 A;  2C7M B;  2JY6 A;  3PV1 A;  1XD3 B;  3AU4 A;  3A9J B;  4HCN B;  4WJN A;  4MDK E;  2J7Q B;  1U4A A;  3AI5 A;  2KO3 A;  2DYB A;  4W9C A;  4BBN C;  1WJU A;  2KLG A;  4DXA B;  2K8H A;  4GB9 A;  4PYU A;  5E6O A;  4EEW A;  3VAW A;  2KXJ A;  2KZR A;  1TZ1 A;  4DBG A;  5C1Z A;  2KMA A;  4FJV B;  1KLV A;  4WQO B;  3PSE B;  2RSU A;  4MJS B;  4II3 B;  2GOW A;  4ANX A;  1K8R B;  1Q1O A;  3DBH I;  4E3C A;  4BKT A;  1WY8 A;  2CU1 A;  2L7R A;  2K25 A;  5DPR A;  3V6C B;  4JLC A;  4XX5 A;  2FNJ B;  3L0W B;  3ZLZ A;  3RT3 B;  4JGH B;  2D3G A;  3VH4 B;  5L95 C;  3N32 A;  1WGR A;  1WM2 A;  3H7P B;  4F1S A;  1P98 A;  1HE8 A;  1WJN A;  2LRU A;  3QCA A;  2ZCC A;  4NAW B;  5DPT A;  4PS8 A;  3NOB A;  3DBL I;  4KV2 A;  3ZTC A;  1NBF C;  2D07 B;  4MJS A;  2Z59 B;  4HK2 A;  1WR6 E;  2JXX A;  5CHF A;  1E8Z A;  3IVF A;  2KK8 A;  4I6L B;  4FBJ B;  3LJ3 A;  5J18 A;  1SE9 A;  2LVQ A;  4ASW C;  2ZZP B;  3PLU A;  2RD0 A;  3W1Y A;  1X1M A;  1KJT A;  2R2O A;  2IO2 B;  2KAN A;  3X23 A;  2NR2 A;  1GNU A;  1VD2 A;  3NZS A;  4HDO A;  5LLI A;  2L0F A;  1ZW7 A;  2GBN A;  2KD0 A;  2MBQ A;  3ML8 A;  3KYC D;  4G0N B;  4IWO A;  2DYO A;  4PS7 A;  4TV3 A;  2KNB A;  4KSK C;  2KC1 A;  3UIO B;  2N7D A;  2MBH A;  1OEY J;  3X0W A;  3KH0 A;  3ECI A;  4IM3 A;  4DHZ E;  2ZNV B;  1WGH A;  5TR5 A;  3VUY A;  4ANV A;  2KWC A;  4AJY B;  1VCB A;  4BKS A;  5D94 A;  4A3P A;  3L54 A;  5GMV A;  2YLM A;  4FHK A;  4FLH A;  2WX0 A;  4MSQ B;  4F8C B;  1UBQ A;  1TGZ B;  2KFK B;  5D2M B;  2JVC A;  2DAJ A;  4ICV A;  4NJ6 A;  1UGM A;  4CHK A;  4CYE A;  4GSW A;  4HPL B;  5KHQ A;  3VTU A;  4JQW C;  4AUQ C;  4EKU A;  2MLB A;  1EUV B;  4GDL A;  3ZIM A;  4EZL A;  3QQ8 B;  1WMH B;  2Z0D B;  4K1R B;  2NBU A;  3NS8 A;  4NY0 A;  3PZD A;  3K9O B;  4W9L A;  4HLE A;  2DZM A;  4EZJ A;  3DDC B;  1R4M I;  3JVZ X;  2AEH A;  1KM7 A;  4ZRI A;  4E74 A;  4IW0 A;  4WJQ A;  5JH5 C;  3L13 A;  2K8B A;  4BOS C;  4IG7 B;  4BFR A;  2KFK A;  2N4F A;  2DAF A;  3EFU A;  4MGI E;  2MP2 B;  3A1Q B;  1S1Q B;  2XEW A;  3JW0 X;  3KYD D;  2EMS A;  3M3J A;  1RRB A;  1YQB A;  2KMC A;  2DZJ A;  1LFD A;  3WA0 A;  2KKC A;  4IUM B;  4W9K A;  2KHW B;  3IHP C;  1XQQ A;  3LDZ E;  3A9K B;  5LXI B;  2LGD A;  3QAR A;  5E6P A;  3EC8 A;  3ZDT A;  1E8Y A;  3QWZ B;  3BY4 B;  2JT4 B;  1QZE A;  2WDT B;  4G11 A;  4I6P A;  3ZO5 B;  4B6W A;  4TQ0 A;  2N9P C;  2NBV B;  3V6E B;  4TQ1 A;  2GMI C;  2D10 A;  4FJZ A;  1SGH A;  3ZRF A;  3VH3 B;  4JL9 A;  1OGW A;  2C7H A;  2JRH A;  1M94 A;  2MA9 B;  2R2Q A;  2XK5 A;  3MTN B;  1RFA A;  3JSV A;  4GIV A;  1YX6 B;  2M8S A;  2PE6 B;  2YVC A;  3N3K B;  2KOX A;  2C7N B;  2ASQ A;  2OJR A;  2KDE B;  2FID A;  1J19 A;  3H9D A;  4MGY E;  5IAA C;  3A9K A;  4RM9 A;  1OTR B;  1L7Y A;  1ISN A;  4DDG D;  1WYW B;  2LVO A;  1E90 A;  2GBR A;  5JHB A;  3B1L X;  4HVB A;  4ZRJ A;  3ZDM C;  2BYF A;  2BGF A;  4N9F 4;  3RUI B;  4AP4 C;  4MEL A;  2JUO A;  3W1S A;  2N1W A;  4FA6 A;  1F9J A;  2PJH A;  5CTR C;  4TKN A;  4HJK A;  4AOF A;  1WM3 A;  2LJ5 A;  5AZH A;  3P2B A;  3ALB A;  2O6V D;  4GOC A;  1V81 A;  3SHQ A;  2RPQ A;  5CHW A;  3PHW B;  4GGQ A;  4HPM B;  3ZTD A;  2MBO A;  3L17 A;  1D3Z A;  2REX A;  2FCN A;  2LI5 A;  2IY1 B;  1WI0 A;  4KZ0 A;  3RCZ A;  1WX7 A;  2KFJ A;  2Y5B B;  4HWI B;  3TJP A;  2LWP A;  2KDF B;  4II2 B;  3GZN I;  5AZG A;  2D11 A;  3GOE A;  4G3X B;  1H8C A;  2XBB C;  3KUC B;  1P3Q U;  3PRZ A;  3UQB A;  3U7D A;  3B0A A;  4PS3 A;  2IYD B;  2J0K A;  1LQB A;  3WAO A;  4NNJ B;  4K81 A;  5CX3 A;  4ZDV A;  4IC7 B;  1AAR A;  4X57 B;  4ZRK A;  2RR9 A;  4ICU A;  2HD5 B;  2N1V A;  3ZNZ B;  4W9G A;  3SDL C;  3PPA A;  1WGY A;  4W9F A;  3PRM B;  2PEA A;  1LM8 B;  2K6Q A;  2MW5 A;  4W9H A;  4W9D A;  3DQV A;  1S3S G;  2AYO B;  3HK0 A;  2KVR A;  4KVG B;  3ONS A;  2FCQ A;  1R4N I;  2KTR A;  2N9E B;  3EEC A;  3WAP A;  2JRI B;  4K7W A;  3T9L A;  3IBE A;  2JZ3 B;  3VVW B;  1WXV A;  3DBS A;  3VXW A;  1CMX B;  4CO7 A;  3JYU A;  3UIP B;  3ZW3 A;  1WRD B;  2LVP A;  3QHT A;  4GDK B;  3WAN A;  3IFW B;  2C60 A;  3ZKJ C;  4EUT A;  4URK A;  1UZX B;  1TTN A;  2AWT A;  2MSE D;  1ZKH A;  2UYZ B;  4GDL B;  1H4R A;  2HJ8 A;  2D2Q A;  2M1M A;  3A4R A;  3U30 A;  4EFO A;  2KQ7 A;  1C3T A;  2EMT A;  1E5W A;  3V62 A;  3DVN U;  4B9K A;  1IPG A;  2FIF A;  4GXB A;  1A5R A;  1Z2M A;  2O6V B;  2L0T A;  4LDT D;  4LJO B;  1P1A A;  2JPH A;  2CHX A;  1WX9 A;  2PE9 A;  4HCP B;  4MGK E;  3VUX A;  1Y8R C;  2WWZ A;  5CHV C;  4B95 A;  3OJ3 A;  4WWO A;  2W9N A;  1E8X A;  3HM6 X;  3PRP B;  4ANU A;  3QJZ A;  1IYF A;  1GUA B;  1FXT B;  2CKH B;  4GDK A;  4DWF A;  2IZV B;  4RM8 A;  2FAZ A;  3I3T B;  4MGZ E;  1TBE A;  4I6N B;  4F7Z A;  3KVF B;  2MBB B;  2KX3 A;  2ZPY A;  5JHA A;  3DVN V;  5L83 A;  3UQA A;  3C0R B;  3TBL D;  2O6V A;  1RLF A;  2WX1 A;  3PGE A;  2IO1 B;  3ZVV A;  4GN1 A;  1WE7 A;  5EDS A;  3R66 C;  3DCG A;  2BWE S;  3RZW C;  5G55 A;  4HDQ A;  1J0G A;  3L10 B;  2XK5 B;  2K6D B;  2KLC A;  1V6E A;  5JZE B;  1EO6 A;  2V4L A;  2ZNV C;  3AUL A;  3JSV B;  4W9E A;  1E8W A;  3V61 A;  3PRE A;  3UIN B;  3DVG Y;  3NHE B;  4BKG A;  3M95 A;  2K1F A;  4G50 A;  5DPS A;  3KUD B;  4M0W B;  1KOT A;  3DPD A;  3R7Q A;  2BYE A;  1V5T A;  5D6J B;  5DCN A;  3UF8 A;  3VUW A;  4NQL B;  3PVL A;  2KWV B;  2MCN B;  2CS4 A;  4K7U A;  4MM3 A;  4A3O A;  2OOB B;  2LXA A;  4TUU A;  1WR1 A;  2WYQ A;  2G3Q B;  5D7G A;  2LXC A;  2JWZ A;  4LCD E;  2KTF A;  2BF8 B;  4K7S A;  2MBE A;  4MEM A;  4PYZ A;  1WJ6 A;  1WZ0 A;  4NPN A;  4LDT B;  3QX1 A;  4IM2 A;  2A4Z A;  5J2R A;  1I42 A;  4XZ4 A;  2EKE C;  4LJP B;  4ANW A;  2FCS A;  2KJR A;  4IWP A;  5LXH A;  2O2V B;  3Q3J A;  4WWP A;  3ZUN A;  2KX0 A;  3H7S A;  2LUE A;  2QHO A;  2MRP A;  3NY5 A;  3BIN A;  2KQS A;  4OVV A;  3Q3F A;  3CSF A;  4JIO U;  5FR6 A;  3DVG X;  1XT9 B;  3SD5 A;  5AEK B;  5KHO A;  2BWF A;  1C1Y B;  1V5O A;  3CMM B;  2IO3 B;  4KIK A;  5J17 A;  1G6J A;  1IP9 A;  1NI2 A;  2LZ6 A;  3QA8 A;  5G2N A;  4W9I A;  2N9X A;  3VTV A;  1GG3 A;  2G4S A;  4M8N A;  2O2V A;  2LD9 A;  3H1U A;  3PLV A;  4DHJ D;  2N7E A;  1V49 A;  3ZNH B;  2KC2 A;  1BT0 A;  2LRW A;  2ZPN A;  4WJP A;  3TL5 A;  1YJ1 A;  2G4D B;  3L16 A;  4KSL C;  3TCA A;  4IWQ A;  2KTR B;  3CST A;  1YIW A;  3KUZ A;  4MH0 E;  3RUL A;  2RGF A;  2L3Z A;  2DZI A;  3PHX B;  4KZC A;  2NVU I;  1WGD A;  4XC2 A;  3EHV A;  3ZNG C;  2L76 A;  3N30 A;  4YL8 A;  5HKH A;  1UD7 A;  2MX2 A;  2A5U A;  3D32 A;  1WX8 A;  3DOW A;  3HM3 A;  4NQK E;  2I1K A;  3VFK A;  1UEL A;  4BVU C;  3APF A;  1UBI A;  5DPW A;  4J6I A;  3WAL A;  4KDI C;  3ENE A;  2JZZ A;  2NCN A;  3A9J A;  2VRR B;  2CHW A;  1V9J A;  3OJ4 B;  5AZF A;  1WFY A;  2ZEQ A;  4FUL A;  1WXA A;  5E6N A;  3ZRC A;  1V2Y A;  3CF6 E;  2ZJD A;  4IM0 A;  2CHZ A;  3VQI A;  2PPH A;  3MHS D;  3UGB B;  4RMA A;  2BPS A;  4AJW A;  1ZGU B;  3S2A A;  4W9J A;  5BO4 B;  3QIJ A;  1WE6 A;  1WGG A;  2GBM A;  2AL3 A;  2C5L C;  1T0Y A;  3HIZ A;  1WIA A;  2KJ6 A;  1MG8 A;  3B08 A;  1SIF A;  1EF1 A;  3APC A;  4OVU A;  2IY0 B;  1OQY A;  2J0M A;  1RAX A;  3H6N A;  2HE7 A;  3RYT A;  3VHT C;  3ML9 A;  3WAM A;  1E7V A;  1P0R A;  4WWN A;  3H7P A;  4DHJ B;  2FUH B;  2J0J A;  3KW5 B;  3SU8 X;  2BKF A;  4NAW A;  2V3S A;  1LXD A;  3A4S C;  4DHZ B;  2DEN B;  1GC7 A; 
#chains in the Genus database with same CATH topology
 1PYW D;  3MJW A;  2LGX A;  3BZD B;  1SE4 A;  2QCZ A;  1UWM A;  2PIA A;  1V1P A;  3APD A;  1VDV A;  1FCC C;  1WXM A;  2ZCB A;  1WH3 A;  2G45 B;  2PVO D;  2N7J A;  4FJY A;  1OQQ A;  1I35 A;  4C4V B;  1ET6 A;  3OLM D;  3RD2 A;  4GMV A;  2GBJ A;  3HHM A;  2XN9 C;  1KLU D;  3MP9 A;  1EWC A;  1V80 A;  1TKG A;  2AL6 A;  1AWD A;  2L1A A;  2N9K A;  3TEX A;  2BKR B;  3I9V 1;  4FN2 A;  2PMV A;  3VDZ A;  3B2G A;  2MP2 A;  4ZYS A;  3R3M A;  4US9 A;  4BAX A;  1SJE D;  2YEP F;  1MPE A;  1J7A A;  3DBR B;  3ABV B;  1WXS A;  1MVK A;  1AYF A;  1V86 A;  1PFD A;  1FFU A;  2XNA C;  2LAS A;  4FAD A;  4P7I A;  1GC6 A;  2IO0 B;  2ZVN A;  1P9D U;  3N9Y C;  1XCT L;  3FAH A;  4E71 A;  3PV1 A;  1XD3 B;  1I7H A;  1LGR A;  1TKE A;  2DYB A;  4M02 A;  2TSS A;  2K8H A;  4EEW A;  2WDQ B;  4OHJ A;  2KZR A;  1ZDX A;  1TZ1 A;  3GE8 C;  4FJV B;  4WQO B;  2W54 A;  2RSU A;  4MJS B;  4II3 B;  1K8R B;  4BKT A;  2CU1 A;  2K25 A;  4XWW A;  3ZLZ A;  2BVC A;  5L95 C;  2G9H D;  3IT4 B;  1WGR A;  3H7P B;  1WJN A;  4JWU C;  2BBC A;  4PS8 A;  3ZTC A;  1JCK B;  4L1B A;  1E8Z A;  4H2A A;  1XLQ A;  4GLS C;  3LJ3 A;  2GI9 A;  4ASW C;  5BYQ A;  1XLO A;  5EE1 A;  1V1P B;  2IGG A;  2R2O A;  1GNU A;  5D3D A;  2L0F A;  2NMQ A;  3ML8 A;  4IWO A;  1RM6 C;  2DYO A;  4PS7 A;  2KC1 A;  1NYR A;  4BKS A;  3Q8B A;  1ZPS A;  4KKI A;  2WX0 A;  4MSQ B;  4F8C B;  1UBQ A;  5D2M B;  2WXP A;  2JVC A;  3DWG C;  4JE3 B;  4B0E A;  4GSW A;  3VTU A;  4RGO S;  4AUQ C;  4XDD A;  2VH1 A;  4ZRQ A;  1CK1 A;  3PZD A;  4HLE A;  1R4M I;  2AEH A;  1KM7 A;  4ZRI A;  3IXS A;  1KH0 A;  4IW0 A;  2JU6 X;  2KFK A;  2DAF A;  2MP2 B;  1YQ4 B;  2DNF A;  1YQB A;  2DZJ A;  1LFD A;  4W9K A;  3IHP C;  1XQQ A;  3A9K B;  4DXG A;  5E6P A;  3EC8 A;  3QWZ B;  1QZE A;  1T5X D;  2AQ2 B;  1L6U A;  4FJZ A;  1SGH A;  1PUT A;  4JL9 A;  5AZF A;  1SXT A;  2C7N B;  2ASQ A;  2OJR A;  2BQQ A;  2KDE B;  1JWU D;  4MGY E;  5IAA C;  1OTR B;  1TS5 A;  5JHB A;  3BII D;  1L6V A;  4ZRJ A;  3B2F A;  4N9F 4;  2BGF A;  3RFZ B;  2JUO A;  4AOF A;  1VJK A;  2LJ5 A;  3E56 A;  3ALB A;  3P2B A;  2O6V D;  1V81 A;  2RPQ A;  5CHW A;  3I5J C;  4PT5 A;  3PHW B;  5IN7 A;  1ZUD 2;  2MJ3 A;  2BW2 A;  2PW9 A;  1I4P A;  3IT6 B;  1D3Z A;  2REX A;  2BB5 A;  2IY1 B;  3RCZ A;  4IDI A;  1FNU A;  2G1E A;  1ACC A;  2MHJ A;  4II2 B;  1TJE A;  1N62 A;  3GOE A;  2KWD A;  2XBB C;  2M19 A;  4R3D A;  3U7D A;  2J0K A;  2WXJ A;  2N9L A;  2W3S A;  4ZDV A;  2HD5 B;  3ZNZ B;  3KLS X;  2K6Q A;  2VZK D;  4NZL B;  2L32 A;  1R4N I;  2KTR A;  3PO0 A;  3WAP A;  2WXF A;  1P7F A;  4US8 A;  3VVW B;  2JZ3 B;  1WXV A;  3MC0 B;  1EM7 A;  2RDH A;  3ZKJ C;  4OZA A;  2AWT A;  1TTN A;  2ACZ B;  4TMA B;  3Q8A A;  2D2Q A;  4EFO A;  2KQ7 A;  2LHE A;  4LNN A;  3U4E G;  3AN1 A;  1Z2M A;  2PKO A;  4LDT D;  2FBW B;  3VUX A;  4HCP B;  4B95 A;  4P16 A;  1Y8R C;  3OJ3 A;  3OWE B;  3PRP B;  3DHH C;  4ANU A;  3QJZ A;  1GUA B;  1ZP0 B;  1FXT B;  2CKH B;  4RM8 A;  1ET9 A;  2MBB B;  4EE2 A;  1ROE A;  3C0R B;  3TBL D;  3PGE A;  2IO1 B;  4GN1 A;  1WE7 A;  5EDS A;  3P4S B;  3DCG A;  4MAC A;  3AUL A;  2V4L A;  3KWV A;  1FXI A;  3V61 A;  5D3I B;  4BKG A;  3CIR B;  4JX1 C;  2KQ4 X;  3AE2 B;  4G50 A;  4ZHP A;  2WNM A;  3TEZ A;  3KUD B;  1KOT A;  1MHX A;  2BYE A;  1J7C A;  3HRD D;  3ZJU A;  4MM3 A;  2RDB C;  1WR1 A;  2WYQ A;  2DBY A;  5D7G A;  1C76 A;  2KTF A;  2BF8 B;  2MBE A;  1I4G A;  3CWI A;  2HTM E;  4NPN A;  4XZ4 A;  2IJ0 A;  3Q3J A;  4WWP A;  3H7S A;  2KQS A;  2J52 A;  5FR6 A;  4RF0 A;  1XT9 B;  5KHO A;  1HTQ A;  1C1Y B;  2IO3 B;  4KIK A;  5J17 A;  2LZ6 A;  3QA8 A;  5G2N A;  1B9R A;  2WXG A;  2G4S A;  1I4X A;  2O2V A;  4DHJ D;  3H1U A;  3PLV A;  2N7E A;  1BML C;  1V49 A;  2LRW A;  1YJ1 A;  2G4D B;  4WQM A;  2KTR B;  2B76 B;  2IPK D;  2DZI A;  4YSY B;  4KZC A;  2KT7 A;  2K5P A;  3DOW A;  2ICI A;  3WAL A;  3I57 A;  2JZZ A;  1XXG A;  3A9J A;  1V9J A;  1XEE A;  4IM0 A;  1I4R A;  3UGB B;  5EE9 A;  4AJW A;  4W9J A;  5BO4 B;  5HFY A;  1WIA A;  1SIF A;  4OVU A;  2IY0 B;  4YT0 B;  2J0M A;  1SE3 A;  3Q8F A;  3RYT A;  1E7V A;  2W82 A;  4WWN A;  2FUH B;  3KW5 B;  4P1B C;  2BKF A;  2V3S A;  3A4S C;  3SEB A;  2C9W B;  1Q5W B;  4YTM B;  4IOI E;  3R2T A;  2OHF A;  1E9M A;  2NS5 A;  2KJH B;  3DBL B;  1HTO A;  3QC8 B;  3V60 A;  4DK5 A;  3TIX A;  1GB4 A;  1SEB D;  4MM3 B;  4C00 A;  2QJL A;  4LTU A;  2B3A A;  2BS2 B;  3C8Y A;  2MQJ A;  3U52 E;  4XYC A;  3O65 B;  2MWS B;  3ZYY X;  2NPT B;  4XGA B;  5IA7 A;  2L00 B;  3DBR I;  3PT2 B;  2WLB A;  5T8I A;  4AWJ A;  4M8M A;  4KIK B;  1GPX A;  3WIM A;  4C4V A;  3AU5 A;  2CR5 A;  1C4P A;  3VTW A;  3IG3 A;  3DWM A;  2Z0E B;  1YQ3 B;  2DLB A;  5TSS A;  1YOV B;  5AUI A;  1N5X A;  1YMH E;  2ON8 A;  3M63 B;  4NJ7 A;  2L8J A;  3OAW A;  4BKS D;  3MHZ A;  4KX6 B;  2LGY A;  3RZF A;  2M17 A;  2DZK A;  3VR8 B;  3AEE B;  1L4D B;  4BBN F;  1WJ4 A;  4PK1 A;  2MEK A;  1HXY D;  4ZHO A;  2E6X A;  1I4H A;  3RNC C;  3AU4 A;  3A9J B;  1TZO A;  4MDK E;  3AI5 A;  2KO3 A;  4RH6 A;  1T0R C;  4YXD B;  4W9C A;  4BBN C;  2KLG A;  4KGT A;  4GB9 A;  4PYU A;  4DBG A;  2KMA A;  1KLV A;  3W9C B;  1I4Q A;  1WXQ A;  3PSE B;  3AEA B;  5I4D A;  4E3C A;  2PLP A;  4RCO A;  1HZ6 A;  4XX5 A;  2FNJ B;  3L0W B;  1STE A;  3N32 A;  1EU4 A;  4MJS A;  2JXX A;  2LJI A;  2WHI A;  4C56 C;  3IVF A;  3DHG C;  3TUO A;  1ZXH A;  1X1M A;  1KJT A;  1PGB A;  3DBH B;  2KAN A;  3W1Y A;  3SFE B;  3NZS A;  4HDO A;  5LLI A;  1PDX A;  1ZW7 A;  3SU8 X;  2KAC A;  1OEY J;  1TYG B;  4DHZ E;  2ZNV B;  3OG5 A;  2WU5 B;  3VUY A;  2KWC A;  1N5W A;  1UGM A;  5KHQ A;  2MLB A;  3L4P A;  3V3X A;  1QOB A;  3K9O B;  2DZM A;  3DDC B;  1JWM D;  2LGS A;  3BK1 A;  4BFR A;  2N4F A;  1L0Y B;  2XEW A;  4YSZ B;  2SEB D;  3KYD D;  4DXF A;  1D5Z C;  1YJJ A;  4A90 A;  2KHW B;  3LDZ E;  5LXI B;  1E8Y A;  4G11 A;  3V6E B;  2GMI C;  2H89 B;  2R2Q A;  2C7H A;  3MTN B;  1RFA A;  1YX6 B;  2WP9 B;  3N3K B;  1OQR A;  3H9D A;  2WXM A;  3A9K A;  4RM9 A;  4DDG D;  4M0W A;  2LVO A;  1E90 A;  2GBR A;  1AW7 A;  2UU7 A;  4XE0 A;  4AP4 C;  3RUI B;  3W1S A;  3ZGZ A;  5CTR C;  1NVI D;  3LXF A;  5AZH A;  1OFF A;  4GOC A;  3AE5 B;  4YTP B;  2MBO A;  3KWL A;  1JWB D;  4KZ0 A;  2KFJ A;  3TJP A;  2LWP A;  2KDF B;  5AZG A;  3AH7 A;  1FO4 A;  1XLN A;  1LQB A;  1F2R C;  4NNJ B;  4IC7 B;  4X57 B;  3BK2 A;  1N61 A;  3PRM B;  2PEA A;  1K52 A;  3RNE C;  3DQV A;  1S3S G;  3HK0 A;  2KVR A;  4WAF A;  2FCQ A;  3GE3 C;  4C7Z A;  3T9L A;  2PTL A;  3RNB C;  1CMX B;  3JYU A;  1SE2 A;  3WAN A;  3NG0 A;  2IGH A;  1H4R A;  2KDM A;  2V0G A;  3U30 A;  3A4R A;  1C3T A;  1E5W A;  4GXB A;  1P1A A;  2JPH A;  2CHX A;  3BVZ A;  4MGK E;  2WWZ A;  1YJI A;  4WWO A;  3BVM A;  1IYF A;  4DWF A;  4F7Z A;  3AB5 A;  2J53 A;  1TT5 B;  1RLF A;  1EWY C;  3Q14 C;  2LHD A;  5IP4 D;  3RZW C;  1JW9 D;  4HDQ A;  4W9E A;  3DVG Y;  4JPS A;  5DPS A;  1FRD A;  4M0W B;  3H8H A;  3DPD A;  2ZW1 A;  2PVG C;  2LMC A;  4M01 A;  3VUW A;  1SSN A;  2CS4 A;  1E10 A;  4RFB A;  1TIF A;  2LXC A;  1GAQ B;  2JWZ A;  4HKZ E;  2AX5 A;  4MEM A;  4PYZ A;  4J3O D;  4IKG A;  5GXG B;  1HA5 A;  1Q10 A;  1N60 A;  2A4Z A;  1DOI A;  2EKE C;  4LJP B;  2FCS A;  4IWP A;  3HVZ A;  3ZUN A;  1YN3 A;  2FUG 1;  2LUE A;  1WSP A;  2LUM A;  3N1Z C;  3CSF A;  4JIO U;  2QIL A;  3DVG X;  5AEK B;  3FC4 A;  1V5O A;  3AV8 A;  1G6J A;  3AMZ A;  3ZNH B;  4ZRP A;  3NRZ A;  1BT0 A;  5C3J B;  1AN8 A;  3NVZ A;  4LNF A;  4KSL C;  3U2S C;  2L3Z A;  2GRI A;  4XC2 A;  3ZNG C;  4RGM A;  5G5G A;  2L76 A;  4YL8 A;  2MX2 A;  1WGK A;  2I1K A;  3VFK A;  3APF A;  4MH8 A;  3HVD A;  3RNG C;  3OJ4 B;  2CU3 A;  2CHW A;  2VRR B;  1WFY A;  1WXA A;  3ZRC A;  2ZJD A;  1QLB B;  4RMA A;  2BPS A;  1ZGU B;  4ARI A;  4MT5 A;  1WGG A;  2JYE A;  1DOY A;  2WDV B;  1FIQ A;  3B08 A;  3APC A;  1RAX A;  1KFY B;  1F1H A;  5AUK A;  3VHT C;  3WAM A;  3R8B A;  2KVZ A;  3RMK C;  4NAW A;  3RNF C;  1LXD A;  4DHZ B;  1RFK A;  3K9P B;  3SFD B;  1J8C A;  2LEK A;  3GB1 A;  3PTF C;  4WUR A;  2M0X A;  5BYR A;  3VRB B;  1EF5 A;  1JRU A;  1Q0W B;  1VZ7 A;  1QT9 A;  1GJZ A;  5BMG A;  3AE1 B;  3LB8 C;  4HXD A;  1CJE A;  3TMP B;  1NDD A;  3RPF C;  1PQS A;  2JF5 A;  4UDU C;  2V1Y A;  1K53 A;  3EUB 2;  1XLP A;  2E3T A;  4KDL B;  3R7R A;  2BS3 B;  1YNT E;  4BOZ B;  2Q5W D;  1CQV A;  1C77 A;  4B0M A;  3NZU A;  2K3U A;  1HEZ E;  2M4N A;  1QIL A;  1D6E C;  1ZOY B;  3MJ5 A;  3P42 A;  3P1M A;  5C23 A;  1WMH A;  2KMM A;  3L08 A;  2HTH A;  4DDI D;  2GLS A;  2DWQ A;  4FXC A;  5HI1 A;  2JWU A;  3U8Z A;  3ETR A;  3M62 B;  1J7B A;  3QK0 A;  4RNA A;  2NPT A;  1SIJ A;  3AEG B;  3A1Q A;  1KTK A;  2K39 A;  2OJW A;  2V4I B;  4S17 A;  4ZYN A;  1L4Z B;  2GBK A;  2INC C;  2KDI A;  1WF9 A;  3ZJV A;  2I1J A;  2L05 A;  3IAS 1;  2OED A;  4FHJ A;  1WZ3 A;  4MSM B;  3QAQ A;  1PGA A;  4WJO A;  2C7M B;  2JY6 A;  2IND C;  4KGR A;  1U4A A;  1WJU A;  4LLG M;  4DXA B;  1VR9 A;  3AEB B;  1EU3 A;  5E6O A;  3VAW A;  2KXJ A;  2AQ1 B;  5C1Z A;  1ZE3 D;  4ANX A;  3DBH I;  2WXR A;  1WY8 A;  2FE8 A;  2L7R A;  1NI3 A;  3BYT B;  5C2T B;  3UI3 A;  4JLC A;  4JGH B;  5LNK 1;  1RYJ A;  1QF6 A;  1F0Z A;  1WM2 A;  1P98 A;  1HE8 A;  3QCA A;  4NAW B;  4L2Y A;  1YN5 A;  1DYQ A;  1ZXI A;  2Z59 B;  1WR6 E;  3Q6B A;  1UWX A;  2D3A A;  4FBJ B;  2INP E;  5J18 A;  1SE9 A;  3EA6 A;  2ZZP B;  3T3O A;  1GB1 A;  3PLU A;  2RD0 A;  1T0S C;  3X23 A;  1P7E A;  1VD2 A;  2WXH A;  2WGS A;  2D5G A;  2GBN A;  2MBQ A;  2QEJ C;  4REZ A;  4TV3 A;  4KSK C;  3GS2 A;  1QKZ A;  4XDC A;  2N7D A;  1SB3 C;  3ECI A;  4IM3 A;  1WGH A;  4ANV A;  1VCB A;  5D94 A;  1RWS A;  3J9C A;  4A3P A;  3L54 A;  2JX5 A;  5GMV A;  4FLH A;  3U7Z A;  4NJ6 A;  4HPL B;  2V9H A;  1WMH B;  4WWM A;  3NS8 A;  4W9L A;  2JYT A;  2H88 B;  1JRP A;  5FR3 A;  3AEF B;  1XO3 A;  4LNO A;  4OZC A;  2K8B A;  1L0V B;  3EFU A;  3A1Q B;  3JW0 X;  2EMS A;  3M3J A;  1RRB A;  5MPO A;  1F2R I;  2KMC A;  1UGJ A;  1JWA D;  1UUP A;  3WA0 A;  2EEL A;  2LGD A;  3QAR A;  3ZDT A;  1ENF A;  3BY4 B;  2JT4 B;  2WDT B;  3V05 A;  3ZO5 B;  1FPY A;  2D10 A;  3ZRF A;  2GB1 A;  2XK5 A;  2JRH A;  1M94 A;  2MA9 B;  4GIV A;  3JSV A;  5BMH A;  1J19 A;  1CZP A;  2I2Y A;  1L7Y A;  1ISN A;  1XCQ L;  1NEK B;  3B1L X;  3ZDM C;  2BYF A;  2N1W A;  4TKN A;  1WM3 A;  3SHQ A;  3L17 A;  2FCN A;  1WI0 A;  1E7P B;  1WX7 A;  4HRO A;  2Y5B B;  3KQ4 A;  3Q3M C;  1FNW A;  1IGD A;  2D11 A;  3P4Q B;  4G3X B;  1H8C A;  4YSX B;  3PRZ A;  1WWT A;  2IYD B;  3WAO A;  4K81 A;  5CX3 A;  2HDE A;  2BT6 A;  4JWS C;  4ZRK A;  2RR9 A;  2WXO A;  2N1V A;  4HJG E;  4ZOH C;  3SDL C;  4AQ7 A;  3PPA A;  1F77 A;  2MW5 A;  3B9J A;  2AYO B;  1TY2 A;  3AE4 B;  3ONS A;  5EE0 A;  2Z8L A;  2CJN A;  4K7W A;  3GZN B;  3DBS A;  4CO7 A;  3UIP B;  3ZW3 A;  3NJT A;  1WRD B;  4GDK B;  1BUI C;  4EUT A;  1HZ5 A;  3W5V B;  2HJ8 A;  3T3N A;  3RNA C;  2EMT A;  1VRA B;  2FIF A;  1A5R A;  2O6V B;  2L0T A;  2MJD A;  4LJO B;  2PE9 A;  1WX9 A;  4EKU A;  3Q8C A;  2W55 A;  2W9N A;  4QAY A;  1E8X A;  2IZV B;  2FAZ A;  2KX3 A;  2ZPY A;  1IBX B;  1DGJ A;  2INN E;  2WX1 A;  4HEA 1;  3ZVV A;  3PZ7 A;  1C4C A;  3R66 C;  2XK5 B;  2K6D B;  2M56 B;  5JZE B;  3JSV B;  2ZNV C;  2VZK B;  2JXT A;  3UIN B;  4L23 A;  4AS1 A;  3M95 A;  2JSV X;  3R7Q A;  5BMI A;  4YWG G;  1V5T A;  4WH4 A;  1T0Q C;  5D6J B;  3ZXR A;  4NQL B;  3PVL A;  2MCN B;  4K7U A;  4A3O A;  3FIL A;  1VZ6 A;  3AED B;  4K7S A;  1MG4 A;  1WJ6 A;  2HJ1 A;  2YEP B;  1WZ0 A;  1Y56 A;  3AE3 B;  3QX1 A;  4IM2 A;  1IUE A;  4LDT B;  4CQN A;  4ANW A;  2LFI A;  1BXT A;  2KJR A;  1TY0 A;  1VLB A;  5EE3 A;  4N59 A;  2QHO A;  2MRP A;  3MC8 A;  3NY5 A;  5FKA C;  3Q3F A;  5JXV A;  4ACF A;  2BTE A;  3BYY B;  1FFV A;  4HRS A;  1NI2 A;  2WXN A;  3SR6 A;  4W9I A;  2N9X A;  2JQR B;  1FXA A;  3W2D A;  2LD9 A;  4M00 A;  1T6B X;  5HHD G;  3TL5 A;  3L16 A;  1MHH E;  3TCA A;  4IWQ A;  3CST A;  1TKY A;  3RUL A;  4TSS A;  3Q3N C;  1M4V A;  2QDF A;  1MJD A;  1L0X B;  2IDY A;  1E6E B;  2WDR B;  5HKH A;  3NVV A;  2A5U A;  1WX8 A;  3HM3 A;  3AE6 B;  2BB6 A;  4K3B A;  1UEL A;  5DPW A;  2ZW0 A;  4J6I A;  3Q2A C;  4KDI C;  2NCN A;  2ZEQ A;  4FUL A;  5E6N A;  3CF6 E;  5H92 C;  2PPH A;  3MHS D;  3NUH B;  3MFG A;  2WU2 B;  3P63 A;  2AL3 A;  3C19 A;  1HQR D;  5HG2 A;  3HIZ A;  2KJ6 A;  1N6Z A;  4D2K A;  4O1N A;  1IGC A;  1OQY A;  3H6N A;  3NS1 A;  2HE7 A;  4ARC A;  4BZA A;  3ML9 A;  1P0R A;  4DHJ B;  5G5H A;  1GC7 A;  2KWU B;  2KAJ A;  2ZVO A;  1VZ8 A;  4EOY A;  4YTN B;  2RDG A;  3AXC A;  1V1O A;  1Z5S B;  4EZK A;  1UH6 A;  3RN9 C;  2K8C A;  1T3Q A;  1FNV A;  3FIL B;  5IO9 A;  2DYM A;  2UWQ A;  3HUI A;  4Q2J A;  1YX5 B;  2J42 A;  1JQ4 A;  2BYV E;  3P4R B;  1E7U A;  2FCM A;  1KRH A;  4A20 A;  3PS6 A;  2W3R A;  2DX5 B;  2KDB A;  4N58 A;  3RI7 C;  3ZNI D;  4GU2 A;  4OVZ A;  4HKQ A;  1C4A A;  4WAA A;  2DHZ A;  2NBW B;  1L2N A;  2IBI B;  2NTT A;  1OEY A;  3A33 B;  2KN4 A;  4A9A A;  2J4X A;  3ZXV A;  2CJO A;  3W1S C;  4A8X C;  2Y5P A;  1DOX A;  1FRR A;  1FCL A;  2KN5 A;  2QC8 A;  3T8M A;  1YD8 U;  4HCN B;  4WJN A;  2J7Q B;  4LK0 M;  1F52 A;  2Y5C A;  1N63 A;  1FD6 A;  4OW0 A;  3DHI C;  3URY A;  2GOW A;  1Q1O A;  1NYQ A;  3V6C B;  2X8X X;  5DPR A;  3EGR A;  3RT3 B;  2D3G A;  3VH4 B;  1V97 A;  3ZQ4 A;  3AE8 B;  4F1S A;  1SF0 A;  2LRU A;  2ZCC A;  5DPT A;  4OZB A;  4KV2 A;  3DBL I;  1NBF C;  2D07 B;  1JWS D;  2QIE B;  4HK2 A;  5CHF A;  1L5P A;  2KK8 A;  4I6L B;  3AM9 A;  2LVQ A;  1MI0 A;  3N1Y C;  2IO2 B;  2NR2 A;  1D4B A;  1V8C A;  2KD0 A;  4G0N B;  3KYC D;  2KNB A;  3UIO B;  2NTS A;  2I38 A;  2MBH A;  3X0W A;  3KH0 A;  3TSS A;  5TR5 A;  4AJY B;  3P4P B;  1FEH A;  1GOZ A;  2YLM A;  1PGX A;  3Q3O C;  3R2I A;  4FHK A;  4KKJ A;  3W5U B;  2KFK B;  1TGZ B;  2X38 A;  2DAJ A;  4ICV A;  4CHK A;  4CYE A;  1ESF A;  4JQW C;  1EUV B;  4GDL A;  3ZIM A;  4EZL A;  3QQ8 B;  2Z0D B;  4K1R B;  2NBU A;  4NY0 A;  4EZJ A;  1R7S A;  4N6E B;  3JVZ X;  2RMM A;  4E74 A;  4WJQ A;  2WXQ A;  3NVY A;  3L13 A;  5JH5 C;  4BOS C;  4MGI E;  1S1Q B;  4C7Y A;  1MFW A;  2BS4 B;  2KKC A;  4IUM B;  5H8Y E;  1QOF A;  1K51 A;  4I6P A;  4B6W A;  4TQ0 A;  2N9P C;  2NBV B;  2BYT A;  4TQ1 A;  2LGI A;  2JZP A;  1R4M B;  3VH3 B;  3NOB A;  1OGW A;  4IG7 B;  2RPV A;  3O13 A;  2QMT A;  2PE6 B;  2M8S A;  2YVC A;  5E6J A;  2KOX A;  2FID A;  1JRO A;  1WYW B;  3MC9 A;  4RGN A;  4HVB A;  2D3C A;  4MEL A;  1UNS A;  1D5M C;  4FA6 A;  1F9J A;  2PJH A;  4HJK A;  1UF0 A;  3Q69 A;  3TEY A;  4K3C A;  3BVG A;  3VRA B;  2AQ3 B;  4HPM B;  4GGQ A;  3ZTD A;  1A70 A;  2LI5 A;  4HWI B;  1QOG A;  4DQO C;  2EKI A;  5BYS A;  3GZN I;  2KYW A;  3PZ8 A;  3KUC B;  1P3Q U;  1E0Z A;  4WIP A;  3UQB A;  2ONQ A;  5FK9 C;  3B0A A;  4PS3 A;  2D3B A;  1AAR A;  4ICU A;  4W9G A;  3N20 C;  1WGY A;  3AE7 B;  4W9F A;  1NEN B;  1LM8 B;  2WXL A;  4W9H A;  3LYY A;  2MH7 A;  4W9D A;  4S0R A;  4KVG B;  1SBB B;  2N9E B;  4P6V F;  3EEC A;  2JRI B;  1JAL A;  3IBE A;  3VXW A;  3BWU D;  2LVP A;  1D5X C;  3QHT A;  3IFW B;  2C60 A;  4URK A;  1UZX B;  2WXI A;  2MSE D;  2M0A A;  1ZKH A;  4GDL B;  2UYZ B;  3GP7 A;  1B1Z A;  2M1M A;  3V62 A;  3DVN U;  4B9K A;  1IPG A;  1KLG D;  3EFC A;  1K50 A;  5CHV C;  2WS3 B;  1SJH D;  3HM6 X;  1XF5 L;  4C80 A;  1TS3 A;  4GDK A;  1R4N B;  3I3T B;  4MGZ E;  1TBE A;  4I6N B;  5IOI A;  3KVF B;  4RF1 A;  2MJE A;  5JHA A;  3DVN V;  5L83 A;  3UQA A;  2O6V A;  3FKY A;  2BWE S;  5G55 A;  1J0G A;  3L10 B;  1V6E A;  2KLC A;  1EO6 A;  1E8W A;  3E9S A;  1LO5 D;  4RGT A;  3ZJT A;  3PRE A;  3Q8E A;  3NHE B;  2K1F A;  1IBX A;  3VR9 B;  4A55 A;  1TS2 A;  3NVW A;  5DCN A;  3UF8 A;  2KWV B;  2VH2 A;  2OOB B;  2LXA A;  4TUU A;  2G3Q B;  2WQY B;  4LCD E;  4KGS A;  4P1C C;  1QQR A;  5J2R A;  1I42 A;  5LXH A;  2O2V B;  2K9X A;  4LNK A;  2KX0 A;  1YN4 A;  3BIN A;  4OVV A;  3SD5 A;  1C78 A;  2BWF A;  1FM0 D;  3CMM B;  1IP9 A;  2K0P A;  1C79 A;  3VTV A;  1GG3 A;  4M8N A;  4USA A;  2Y3A A;  2KC2 A;  1ZDV A;  2ZPN A;  4WJP A;  2N0S B;  2IGD A;  5IKC M;  2V3N A;  1YIW A;  1WYG A;  3KUZ A;  4MH0 E;  2K22 A;  2RGF A;  3PHX B;  1QOA A;  2NVU I;  1WGD A;  3EHV A;  1KF6 B;  4NAM A;  1TS4 A;  1FMA D;  2QSD A;  3N30 A;  2L52 A;  1UD7 A;  2WXK A;  3I63 C;  2V3P A;  3D32 A;  4NQK E;  3AEC B;  4BVU C;  1UBI A;  3ENE A;  3TEW A;  1WRI A;  3N1X C;  1V2Y A;  1JML A;  3AE9 B;  2CHZ A;  4ITK A;  3VQI A;  4NJC A;  2L83 A;  3NZ3 A;  3S2A A;  4XWT A;  3QIJ A;  1WE6 A;  2SAK A;  2GBM A;  2C5L C;  2R61 A;  1T0Y A;  1C9F A;  1MG8 A;  1EF1 A;  4LNI A;  3IAM 1;  4A6Q A;  3H7P A;  3WCQ A;  2J0J A;  4HPP A;  2DEN B; 
#chains in the Genus database with same CATH homology
 2KWU B;  3K9P B;  1J8C A;  2C9W B;  2ZVO A;  1Q5W B;  3MJW A;  2LGX A;  4EOY A;  3AXC A;  1Z5S B;  2NS5 A;  2KJH B;  4EZK A;  3PTF C;  3QC8 B;  2M0X A;  3V60 A;  4DK5 A;  3TIX A;  1UH6 A;  3APD A;  1EF5 A;  1JRU A;  2ZCB A;  1WXM A;  1Q0W B;  2K8C A;  1WH3 A;  2G45 B;  1GJZ A;  2DYM A;  2B3A A;  4FJY A;  4HXD A;  2UWQ A;  3TMP B;  1I35 A;  1NDD A;  1PQS A;  1YX5 B;  2JF5 A;  2MQJ A;  2V1Y A;  3OLM D;  3O65 B;  3RD2 A;  3R7R A;  4KDL B;  4BOZ B;  2MWS B;  4GMV A;  2GBJ A;  3HHM A;  2NPT B;  3NZU A;  2BYV E;  5IA7 A;  2L00 B;  2M4N A;  3DBR I;  3PT2 B;  1E7U A;  2FCM A;  4A20 A;  4AWJ A;  4M8M A;  3PS6 A;  1V80 A;  4KIK B;  5C23 A;  1WMH A;  2DX5 B;  3WIM A;  3L08 A;  3AU5 A;  2CR5 A;  2KDB A;  2HTH A;  2AL6 A;  4DDI D;  3ZNI D;  3VTW A;  3IG3 A;  4GU2 A;  2Z0E B;  2BKR B;  3U8Z A;  4FN2 A;  4WAA A;  3M62 B;  2DHZ A;  2NBW B;  3QK0 A;  1L2N A;  2NPT A;  2IBI B;  3VDZ A;  3M63 B;  2MP2 A;  3A1Q A;  2K39 A;  1OEY A;  4NJ7 A;  3A33 B;  3R3M A;  4ZYN A;  2L8J A;  3OAW A;  4BKS D;  2LGY A;  3RZF A;  2GBK A;  2M17 A;  2KDI A;  1WF9 A;  1WXS A;  3W1S C;  2DZK A;  1V86 A;  2I1J A;  2L05 A;  4FHJ A;  1WZ3 A;  2LAS A;  4MSM B;  4FAD A;  4BBN F;  1WJ4 A;  4P7I A;  1GC6 A;  3QAQ A;  2IO0 B;  2KN5 A;  2ZVN A;  1P9D U;  4WJO A;  1YD8 U;  3T8M A;  4E71 A;  2C7M B;  2JY6 A;  3PV1 A;  1XD3 B;  3AU4 A;  3A9J B;  4HCN B;  4WJN A;  4MDK E;  2J7Q B;  1U4A A;  3AI5 A;  2KO3 A;  2DYB A;  4W9C A;  4BBN C;  1WJU A;  2KLG A;  4DXA B;  2K8H A;  4GB9 A;  4PYU A;  5E6O A;  4EEW A;  3VAW A;  2KXJ A;  2KZR A;  1TZ1 A;  4DBG A;  5C1Z A;  2KMA A;  4FJV B;  1KLV A;  4WQO B;  3PSE B;  2RSU A;  4MJS B;  4II3 B;  2GOW A;  4ANX A;  1K8R B;  1Q1O A;  3DBH I;  4E3C A;  4BKT A;  1WY8 A;  2CU1 A;  2L7R A;  2K25 A;  5DPR A;  3V6C B;  4JLC A;  4XX5 A;  2FNJ B;  3L0W B;  3ZLZ A;  3RT3 B;  4JGH B;  2D3G A;  3VH4 B;  5L95 C;  3N32 A;  1WGR A;  1WM2 A;  3H7P B;  4F1S A;  1P98 A;  1HE8 A;  1WJN A;  2LRU A;  3QCA A;  2ZCC A;  4NAW B;  5DPT A;  4PS8 A;  3NOB A;  3DBL I;  4KV2 A;  3ZTC A;  1NBF C;  2D07 B;  4MJS A;  2Z59 B;  4HK2 A;  1WR6 E;  2JXX A;  5CHF A;  1E8Z A;  3IVF A;  2KK8 A;  4I6L B;  4FBJ B;  3LJ3 A;  5J18 A;  1SE9 A;  2LVQ A;  4ASW C;  2ZZP B;  3PLU A;  2RD0 A;  3W1Y A;  1X1M A;  1KJT A;  2R2O A;  2IO2 B;  2KAN A;  3X23 A;  2NR2 A;  1GNU A;  1VD2 A;  3NZS A;  4HDO A;  5LLI A;  2L0F A;  1ZW7 A;  2GBN A;  2KD0 A;  2MBQ A;  3ML8 A;  3KYC D;  4G0N B;  4IWO A;  2DYO A;  4PS7 A;  4TV3 A;  2KNB A;  4KSK C;  2KC1 A;  3UIO B;  2N7D A;  2MBH A;  1OEY J;  3X0W A;  3KH0 A;  3ECI A;  4IM3 A;  4DHZ E;  2ZNV B;  1WGH A;  5TR5 A;  3VUY A;  4ANV A;  2KWC A;  4AJY B;  1VCB A;  4BKS A;  5D94 A;  4A3P A;  3L54 A;  5GMV A;  2YLM A;  4FHK A;  4FLH A;  2WX0 A;  4MSQ B;  4F8C B;  1UBQ A;  1TGZ B;  2KFK B;  5D2M B;  2JVC A;  2DAJ A;  4ICV A;  4NJ6 A;  1UGM A;  4CHK A;  4CYE A;  4GSW A;  4HPL B;  5KHQ A;  3VTU A;  4JQW C;  4AUQ C;  4EKU A;  2MLB A;  1EUV B;  4GDL A;  3ZIM A;  4EZL A;  3QQ8 B;  1WMH B;  2Z0D B;  4K1R B;  2NBU A;  3NS8 A;  4NY0 A;  3PZD A;  3K9O B;  4W9L A;  4HLE A;  2DZM A;  4EZJ A;  3DDC B;  1R4M I;  3JVZ X;  2AEH A;  1KM7 A;  4ZRI A;  4E74 A;  4IW0 A;  4WJQ A;  5JH5 C;  3L13 A;  2K8B A;  4BOS C;  4IG7 B;  4BFR A;  2KFK A;  2N4F A;  2DAF A;  3EFU A;  4MGI E;  2MP2 B;  3A1Q B;  1S1Q B;  2XEW A;  3JW0 X;  3KYD D;  2EMS A;  3M3J A;  1RRB A;  1YQB A;  2KMC A;  2DZJ A;  1LFD A;  3WA0 A;  2KKC A;  4IUM B;  4W9K A;  2KHW B;  3IHP C;  1XQQ A;  3LDZ E;  3A9K B;  5LXI B;  2LGD A;  3QAR A;  5E6P A;  3EC8 A;  3ZDT A;  1E8Y A;  3QWZ B;  3BY4 B;  2JT4 B;  1QZE A;  2WDT B;  4G11 A;  4I6P A;  3ZO5 B;  4B6W A;  4TQ0 A;  2N9P C;  2NBV B;  3V6E B;  4TQ1 A;  2GMI C;  2D10 A;  4FJZ A;  1SGH A;  3ZRF A;  3VH3 B;  4JL9 A;  1OGW A;  2C7H A;  2JRH A;  1M94 A;  2MA9 B;  2R2Q A;  2XK5 A;  3MTN B;  1RFA A;  3JSV A;  4GIV A;  1YX6 B;  2M8S A;  2PE6 B;  2YVC A;  3N3K B;  2KOX A;  2C7N B;  2ASQ A;  2OJR A;  2KDE B;  2FID A;  1J19 A;  3H9D A;  4MGY E;  5IAA C;  3A9K A;  4RM9 A;  1OTR B;  1L7Y A;  1ISN A;  4DDG D;  1WYW B;  2LVO A;  1E90 A;  2GBR A;  5JHB A;  3B1L X;  4HVB A;  4ZRJ A;  3ZDM C;  2BYF A;  2BGF A;  4N9F 4;  3RUI B;  4AP4 C;  4MEL A;  2JUO A;  3W1S A;  2N1W A;  4FA6 A;  1F9J A;  2PJH A;  5CTR C;  4TKN A;  4HJK A;  4AOF A;  1WM3 A;  2LJ5 A;  5AZH A;  3P2B A;  3ALB A;  2O6V D;  4GOC A;  1V81 A;  3SHQ A;  2RPQ A;  5CHW A;  3PHW B;  4GGQ A;  4HPM B;  3ZTD A;  2MBO A;  3L17 A;  1D3Z A;  2REX A;  2FCN A;  2LI5 A;  2IY1 B;  1WI0 A;  4KZ0 A;  3RCZ A;  1WX7 A;  2KFJ A;  2Y5B B;  4HWI B;  3TJP A;  2LWP A;  2KDF B;  4II2 B;  3GZN I;  5AZG A;  2D11 A;  3GOE A;  4G3X B;  1H8C A;  2XBB C;  3KUC B;  1P3Q U;  3PRZ A;  3UQB A;  3U7D A;  3B0A A;  4PS3 A;  2IYD B;  2J0K A;  1LQB A;  3WAO A;  4NNJ B;  4K81 A;  5CX3 A;  4ZDV A;  4IC7 B;  1AAR A;  4X57 B;  4ZRK A;  2RR9 A;  4ICU A;  2HD5 B;  2N1V A;  3ZNZ B;  4W9G A;  3SDL C;  3PPA A;  1WGY A;  4W9F A;  3PRM B;  2PEA A;  1LM8 B;  2K6Q A;  2MW5 A;  4W9H A;  4W9D A;  3DQV A;  1S3S G;  2AYO B;  3HK0 A;  2KVR A;  4KVG B;  3ONS A;  2FCQ A;  1R4N I;  2KTR A;  2N9E B;  3EEC A;  3WAP A;  2JRI B;  4K7W A;  3T9L A;  3IBE A;  2JZ3 B;  3VVW B;  1WXV A;  3DBS A;  3VXW A;  1CMX B;  4CO7 A;  3JYU A;  3UIP B;  3ZW3 A;  1WRD B;  2LVP A;  3QHT A;  4GDK B;  3WAN A;  3IFW B;  2C60 A;  3ZKJ C;  4EUT A;  4URK A;  1UZX B;  1TTN A;  2AWT A;  2MSE D;  1ZKH A;  2UYZ B;  4GDL B;  1H4R A;  2HJ8 A;  2D2Q A;  2M1M A;  3A4R A;  3U30 A;  4EFO A;  2KQ7 A;  1C3T A;  2EMT A;  1E5W A;  3V62 A;  3DVN U;  4B9K A;  1IPG A;  2FIF A;  4GXB A;  1A5R A;  1Z2M A;  2O6V B;  2L0T A;  4LDT D;  4LJO B;  1P1A A;  2JPH A;  2CHX A;  1WX9 A;  2PE9 A;  4HCP B;  4MGK E;  3VUX A;  1Y8R C;  2WWZ A;  5CHV C;  4B95 A;  3OJ3 A;  4WWO A;  2W9N A;  1E8X A;  3HM6 X;  3PRP B;  4ANU A;  3QJZ A;  1IYF A;  1GUA B;  1FXT B;  2CKH B;  4GDK A;  4DWF A;  2IZV B;  4RM8 A;  2FAZ A;  3I3T B;  4MGZ E;  1TBE A;  4I6N B;  4F7Z A;  3KVF B;  2MBB B;  2KX3 A;  2ZPY A;  5JHA A;  3DVN V;  5L83 A;  3UQA A;  3C0R B;  3TBL D;  2O6V A;  1RLF A;  2WX1 A;  3PGE A;  2IO1 B;  3ZVV A;  4GN1 A;  1WE7 A;  5EDS A;  3R66 C;  3DCG A;  2BWE S;  3RZW C;  5G55 A;  4HDQ A;  1J0G A;  3L10 B;  2XK5 B;  2K6D B;  2KLC A;  1V6E A;  5JZE B;  1EO6 A;  2V4L A;  2ZNV C;  3AUL A;  3JSV B;  4W9E A;  1E8W A;  3V61 A;  3PRE A;  3UIN B;  3DVG Y;  3NHE B;  4BKG A;  3M95 A;  2K1F A;  4G50 A;  5DPS A;  3KUD B;  4M0W B;  1KOT A;  3DPD A;  3R7Q A;  2BYE A;  1V5T A;  5D6J B;  5DCN A;  3UF8 A;  3VUW A;  4NQL B;  3PVL A;  2KWV B;  2MCN B;  2CS4 A;  4K7U A;  4MM3 A;  4A3O A;  2OOB B;  2LXA A;  4TUU A;  1WR1 A;  2WYQ A;  2G3Q B;  5D7G A;  2LXC A;  2JWZ A;  4LCD E;  2KTF A;  2BF8 B;  4K7S A;  2MBE A;  4MEM A;  4PYZ A;  1WJ6 A;  1WZ0 A;  4NPN A;  4LDT B;  3QX1 A;  4IM2 A;  2A4Z A;  5J2R A;  1I42 A;  4XZ4 A;  2EKE C;  4LJP B;  4ANW A;  2FCS A;  2KJR A;  4IWP A;  5LXH A;  2O2V B;  3Q3J A;  4WWP A;  3ZUN A;  2KX0 A;  3H7S A;  2LUE A;  2QHO A;  2MRP A;  3NY5 A;  3BIN A;  2KQS A;  4OVV A;  3Q3F A;  3CSF A;  4JIO U;  5FR6 A;  3DVG X;  1XT9 B;  3SD5 A;  5AEK B;  5KHO A;  2BWF A;  1C1Y B;  1V5O A;  3CMM B;  2IO3 B;  4KIK A;  5J17 A;  1G6J A;  1IP9 A;  1NI2 A;  2LZ6 A;  3QA8 A;  5G2N A;  4W9I A;  2N9X A;  3VTV A;  1GG3 A;  2G4S A;  4M8N A;  2O2V A;  2LD9 A;  3H1U A;  3PLV A;  4DHJ D;  2N7E A;  1V49 A;  3ZNH B;  2KC2 A;  1BT0 A;  2LRW A;  2ZPN A;  4WJP A;  3TL5 A;  1YJ1 A;  2G4D B;  3L16 A;  4KSL C;  3TCA A;  4IWQ A;  2KTR B;  3CST A;  1YIW A;  3KUZ A;  4MH0 E;  3RUL A;  2RGF A;  2L3Z A;  2DZI A;  3PHX B;  4KZC A;  2NVU I;  1WGD A;  4XC2 A;  3EHV A;  3ZNG C;  2L76 A;  3N30 A;  4YL8 A;  5HKH A;  1UD7 A;  2MX2 A;  2A5U A;  3D32 A;  1WX8 A;  3DOW A;  3HM3 A;  4NQK E;  2I1K A;  3VFK A;  1UEL A;  4BVU C;  3APF A;  1UBI A;  5DPW A;  4J6I A;  3WAL A;  4KDI C;  3ENE A;  2JZZ A;  2NCN A;  3A9J A;  2VRR B;  2CHW A;  1V9J A;  3OJ4 B;  5AZF A;  1WFY A;  2ZEQ A;  4FUL A;  1WXA A;  5E6N A;  3ZRC A;  1V2Y A;  3CF6 E;  2ZJD A;  4IM0 A;  2CHZ A;  3VQI A;  2PPH A;  3MHS D;  3UGB B;  4RMA A;  2BPS A;  4AJW A;  1ZGU B;  3S2A A;  4W9J A;  5BO4 B;  3QIJ A;  1WE6 A;  1WGG A;  2GBM A;  2AL3 A;  2C5L C;  1T0Y A;  3HIZ A;  1WIA A;  2KJ6 A;  1MG8 A;  3B08 A;  1SIF A;  1EF1 A;  3APC A;  4OVU A;  2IY0 B;  1OQY A;  2J0M A;  1RAX A;  3H6N A;  2HE7 A;  3RYT A;  3VHT C;  3ML9 A;  3WAM A;  1E7V A;  1P0R A;  4WWN A;  3H7P A;  4DHJ B;  2FUH B;  2J0J A;  3KW5 B;  3SU8 X;  2BKF A;  4NAW A;  2V3S A;  1LXD A;  3A4S C;  4DHZ B;  2DEN B;  1GC7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...