3WANA

Crystal structure of atg13 lir-fused human lc3a_2-121
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
126
structure length
126
Chain Sequence
b'DDFVMIGSPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Autophagy-related protein 13, Microtubule-associated protein
molecule tags Protein binding
source organism Homo sapiens
publication title Structural basis of the autophagy-related LC3/Atg13 LIR complex: recognition and interaction mechanism.
pubmed doi rcsb
total genus 34
structure length 126
sequence length 126
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3wanA00
4AP4C 1E8YA 1UBIA 4GDKA 4E3CA 3EC8A 3NY5A 5D2MB 2NBWB 3R7RA 3PS6A 4URKA 3VFKA 3IG3A 2A4ZA 4EZLA 4LJPB 2LRUA 3DVNU 4HVBA 4EKUA 3JYUA 4WAAA 3W1SC 5JZEB 3EFUA 4A20A 2GOWA 4ASWC 3QC8B 2JWZA 1WRDB 4LDTD 4FLHA 4RMAA 3OLMD 3KUZA 3RUIB 3NOBA 1TZ1A 2CU1A 1R4NI 1V49A 3AU4A 3JSVA 1KLVA 3CF6E 4NJ7A 1GC7A 1QZEA 3R7QA 3D32A 2BYFA 3PREA 1P1AA 2A5UA 4HPMB 5E6NA 4DDGD 3M62B 4K7UA 1Q1OA 3UIOB 3X0WA 4G3XB 3A1QB 5C1ZA 5JHAA 4FBJB 4ANUA 1GUAB 1LQBA 2RD0A 1E7UA 5TR5A 1WJ4A 5DPRA 2KD0A 2K8BA 2LD9A 3VQIA 2BWES 2K1FA 3MTNB 4F7ZA 3A33B 3ONSA 4CHKA 1OQYA 1WE6A 2AYOB 1V86A 4IUMB 4JGHB 4CO7A 5JHBA 5DPSA 3WA0A 4EZKA 4TV3A 2O2VA 4MGKE 4RM8A 1EUVB 4BOZB 2LRWA 2NCNA 3VH4B 2G4SA 4DBGA 3Q3JA 1E8ZA 2DZKA 1AARA 2MBOA 4WJNA 1FXTB 2KC2A 4TKNA 2XK5B 2MA9B 1RLFA 4FULA 3QWZB 4IWQA 4IC7B 3ZRFA 2BKFA 2MBHA 2C7HA 4KDIC 4B9KA 3B1LX 3QX1A 4PYUA 3DVGX 5JH5C 2KTRA 2DYOA 2KO3A 4MM3A 2K6QA 3U7DA 1WE7A 2BKRB 1C3TA 2RGFA 3A4RA 5CHWA 2L00B 2N7DA 2CHXA 4X57B 3VAWA 2NBVB 4XC2A 4MDKE 1EO6A 1Y8RC 1WXMA 3VTWA 3PRPB 4GDLA 4GU2A 3PPAA 3L17A 5D6JB 1IP9A 3RZFA 1WGGA 3VVWB 2N1VA 2BYVE 3APCA 1M94A 4BKTA 4I6NB 2BGFA 4FADA 3B08A 2KQSA 1WR6E 4EEWA 3NS8A 1BT0A 3GZNI 3W1SA 3TCAA 2O6VD 2FIDA 2QHOA 4KV2A 3UQAA 4HCPB 2O6VB 3IBEA 3K9PB 1LXDA 3M95A 4MSMB 1WJ6A 5HKHA 3ZTCA 2KTFA 1WYWB 5LXHA 2MP2A 4MJSA 2IO3B 4LDTB 5E6PA 2CHWA 3QJZA 2JXXA 2YVCA 2WWZA 3DBRI 3ZNGC 2L76A 2CS4A 1WGRA 4KDLB 2DZJA 1EF5A 4II2B 3KH0A 3AU5A 2IZVB 4FHKA 2LGDA 4W9DA 3V6EB 2C5LC 2UYZB 4W9EA 3CSTA 3N30A 3SDLC 1WI0A 4WJPA 2IO1B 2KC1A 3LDZE 3ML8A 2C7MB 2CKHB 4GXBA 1RFAA 2IO2B 2FUHB 4F8CB 1YQBA 4JQWC 2HD5B 4K7SA 3A9JB 3CSFA 2MSED 5CTRC 5DPTA 1P0RA 3M3JA 2WYQA 3Q3FA 4TQ1A 3VUWA 4A3PA 1NI2A 2ZVNA 3UF8A 3GOEA 2N9XA 2CR5A 2EMSA 1RAXA 2DAFA 1WX8A 2AL3A 2C9WB 2HTHA 2O6VA 3ZW3A 2N1WA 2KHWB 3H6NA 4GN1A 3HK0A 1V5TA 1WX9A 2FCQA 2KDIA 2Z0DB 4WWOA 4ANXA 1NBFC 2KQ7A 3VTUA 4ANVA 2KKCA 4ICVA 4JL9A 1I35A 3WIMA 3DQVA 4W9IA 2G3QB 2L7RA 3DPDA 3WANA 1YIWA 3KUDB 1OTRB 4FHJA 4K81A 1SIFA 3ZTDA 3ZKJC 2I1JA 2BYEA 3UQBA 2JRIB 3R3MA 3QA8A 3HM6X 2KVRA 3KUCB 4B95A 1E7VA 4DHZE 2KDFB 2OJRA 1YX6B 1TGZB 2KJHB 5C23A 1ISNA 4NAWB 4TQ0A 1WF9A 4HK2A 1UZXB 3S2AA 4GDKB 4NQKE 2L0FA 2KTRB 3W1YA 2DENB 4DDID 2IBIB 3QIJA 1Q0WB 5IA7A 3SD5A 4G50A 1NDDA 2DYBA 3CMMB 4EUTA 2GMIC 3WAPA 4NY0A 3KYDD 1OEYA 1LM8B 4ZDVA 2GBJA 1RRBA 4ZRIA 4JIOU 2D11A 4IM2A 3VXWA 4TUUA 3ML9A 3TBLD 3A9KB 2GBNA 4IG7B 1C1YB 3PRMB 3NZSA 2KNBA 5FR6A 2B3AA 1D3ZA 4FJVB 4HDOA 1ZW7A 2XBBC 2L0TA 1GNUA 4KIKB 2GBMA 5DPWA 1TBEA 4IWOA 4NJ6A 2HJ8A 1S1QB 2XK5A 2XEWA 3APDA 4HWIB 2C60A 3PT2B 4WWPA 5J2RA 2DX5B 2ZCCA 1KJTA 3ALBA 1ZKHA 3DCGA 1GG3A 1VD2A 2DAJA 1OGWA 1V81A 3TJPA 2PJHA 2KWUB 2J7QB 3I3TB 3DBHI 3DVNV 3IFWB 3L54A 4GMVA 5DCNA 3SHQA 4XZ4A 3U8ZA 4F1SA 2ZZPB 5L83A 2BPSA 4KVGB 4B6WA 2LVOA 1KM7A 2KOXA 4AWJA 3V61A 3RYTA 2ZVOA 3C0RB 3PRZA 2LASA 4LCDE 5LLIA 4G0NB 2M17A 4IWPA 4ZYNA 5G2NA 4BKGA 4FN2A 1U4AA 1UGMA 3B0AA 2MRPA 2NPTA 2LGXA 2KX0A 3T8MA 3BINA 2KFKB 4W9GA 1WFYA 1ZGUB 2LVQA 3O65B 1UD7A 3NZUA 1UBQA 3JVZX 5E6OA 3RULA 2J0JA 3VHTC 3VH3B 2MBBB 3KVFB 4PYZA 3WAMA 4GB9A 2JUOA 3KW5B 1LFDA 4AJYB 1UH6A 2N9PC 1V80A 2UWQA 4E71A 2MLBA 2MP2B 2PEAA 3MHSD 4MJSB 1WXSA 2V3SA 3H7SA 3V6CB 1XT9B 3H9DA 2NS5A 2N7EA 2KWVB 2VRRB 2Z59B 1IPGA 2AWTA 2KLCA 4HPLB 3PLVA 3X23A 4ICUA 3ENEA 4KSLC 2MQJA 3VTVA 3ZIMA 4BVUC 3PTFC 2KWCA 1CMXB 3HIZA 3QQ8B 2K8CA 2D2QA 2ZNVC 3PHXB 1PQSA 1WM3A 1UELA 2KDEB 2ZEQA 1YD8U 2Y5BB 4IM0A 4HJKA 3ZNHB 5J18A 2N4FA 4KSKC 2L3ZA 1GJZA 2JY6A 2KANA 2LGYA 3MJWA 2R2OA 2OOBB 3L0WB 4CYEA 2G45B 2LZ6A 4KZCA 3AI5A 3ZDMC 5LXIB 2ASQA 1R4MI 1WGHA 1WJUA 2MX2A 4DHJD 2HE7A 1E8XA 5AZHA 4N9F4 4I6LB 3UGBB 5L95C 3EECA 3RT3B 2K39A 4ZRKA 4PS7A 3HM3A 4BOSC 1J0GA 1E8WA 1GC6A 3BY4B 1YJ1A 4NQLB 3H1UA 3ZO5B 4MGYE 5GMVA 3A9KA 2DYMA 3QAQA 2JF5A 2M0XA 2KMAA 5KHOA 1S3SG 2AL6A 2FIFA 2WDTB 2ZJDA 4WJQA 1WIAA 2KLGA 4DHJB 1XD3B 2KN5A 3QHTA 2O2VB 4W9KA 4DK5A 2NR2A 1SE9A 3H7PA 1WGYA 3U30A 2KXJA 2JRHA 2LVPA 2RSUA 3AULA 1E5WA 1VCBA 3A9JA 5CX3A 4XX5A 5G55A 4GIVA 1WMHB 3DDCB 4MSQB 4FA6A 4IM3A 5D7GA 2FAZA 2M4NA 1WJNA 2FCMA 3IHPC 2R2QA 1V6EA 3A1QA 3PSEB 3PVLA 3APFA 4J6IA 1P98A 2NPTB 3TIXA 1WY8A 3SU8X 2RPQA 1WGDA 4K1RB 4K7WA 4MH0E 4BKSA 4MEMA 3T9LA 2NBUA 1V5OA 3N3KB 3K9OB 2BWFA 5IAAC 3V62A 3PZDA 4BKSD 2IY0B 2BF8B 2KZRA 3OAWA 3ZNZB 5BO4B 4IW0A 3DBLI 5KHQA 2WX0A 2PE6B 4WJOA 1Z5SB 3OJ4B 1SGHA 1J19A 2L8JA 2JZ3B 2MW5A 1F9JA 2K6DB 4WWNA 2KJRA 3ZVVA 4NAWA 1WXVA 1WH3A 4BBNC 2C7NB 5EDSA 1H8CA 4DWFA 3PLUA 3VDZA 1WMHA 2M8SA 3KYCD 3TMPB 2J0KA 2MWSB 4W9FA 2M1MA 3NHEB 1IYFA 1X1MA 3RCZA 3PGEA 2NVUI 2JZZA 2L05A 5CHFA 1WXAA 1Z2MA 3IVFA 3ZUNA 4FJYA 1L7YA 2DHZA 3UIPB 4PS8A 3AXCA 1V9JA 3VUYA 4M0WB 1H4RA 1OEYJ 3HHMA 3UINB 4AOFA 1P9DU 3QK0A 4DXAB 2W9NA 3R66C 4LJOB 2FNJB 3PHWB 2IO0B 3P2BA 2PE9A 3ZRCA 4A3OA 4MGIE 4BBNF 4M8MA 3WAOA 4GSWA 4HCNB 2JT4B 3ZDTA 2ZPYA 2KFJA 5AEKB 4YL8A 4ZRJA 4FJZA 4KZ0A 4RM9A 3VUXA 3QARA 3H7PB 1V2YA 2RR9A 1MG8A 1P3QU 2D3GA 2LWPA 2LJ5A 1T0YA 1YX5B 2DZMA 2PPHA 2KFKA 2Z0EB 4AJWA 1WR1A 3QCAA 1WZ3A 2ZPNA 4WQOB 2MBQA 4PS3A 4MELA 3WALA 1I42A 3ECIA 4G11A 5AZFA 4W9LA 4NPNA 1G6JA 1L2NA 4JLCA 3M63B 2KJ6A 4GDLB 4AUQC 2LXAA 2GBKA 2CHZA 2KX3A 3DOWA 2IYDB 1KOTA 2ZNVB 3LJ3A 4E74A 2N9EB 4I6PA 4W9CA 3TL5A 1EF1A 1WX7A 1Q5WB 2EKEC 2V4LA 5D94A 2YLMA 3V60A 4GGQA 2EMTA 4P7IA 5AZGA 3DBSA 3RZWC 4EZJA 1K8RB 2J0MA 1HE8A 3L16A 2AEHA 2D07B 4HDQA 3PV1A 2DZIA 2G4DB 4W9JA 2JVCA 2LXCA 4II3B 4DHZB 2D10A 4BFRA 4EFOA 2REXA 1E90A 3JW0X 3L08A 3DVGY 4M8NA 5J17A 1JRUA 2MBEA 4HLEA 3N32A 4KIKA 1J8CA 1A5RA 2LUEA 4MGZE 2WX1A 3RD2A 2I1KA 2FCSA 4GOCA 4OVVA 2K8HA 4EOYA 2MCNB 3ZNID 3A4SC 2GBRA 2ZCBA 3L10B 2V1YA 3JSVB 4ANWA 2JPHA 2K25A 4NNJB 3ZLZA 4OVUA 3L13A 1WZ0A 2KK8A 1TTNA 1WM2A 4HXDA 4W9HA 2FCNA 3OJ3A 5CHVC 2LI5A 1XQQA 2IY1B 3EHVA 2KMCA 2KDBA
chains in the Genus database with same CATH superfamily
2ICIA 1E8YA 4GDKA 3N1XC 3RNGC 3VFKA 2A4ZA 4LJPB 2LRUA 3DVNU 4HVBA 4EKUA 3JYUA 4OZBA 3EFUA 4XE0A 1WRDB 3Q69A 4RMAA 3OLMD 3KUZA 2AQ2B 4RNAA 4WQMA 1V49A 3JSVA 1PGAA 1FNUA 5BMGA 4DDGD 3M62B 4K7UA 1SEBD 5C1ZA 4FBJB 4ANUA 2RD0A 2MJDA 5DPRA 2LD9A 2JWUA 2D3AA 4JGHB 3Q8FA 3I57A 4EZKA 4KX6B 4MGKE 2PW9A 4RM8A 4TSSA 2V0GA 2LFIA 1XLQA 2MA9B 1FRDA 2ONQA 3ZXRA 4IC7B 4YT0B 2BKFA 2C7HA 3BVZA 2KTRA 2DYOA 1L0YB 2GI9A 3A4RA 5CHWA 4MDKE 5G5HA 1EO6A 3VTWA 1WXMA 4ZHPA 3Q3NC 3L17A 5TSSA 2BYVE 1HEZE 4RCOA 1TY0A 4RGMA 1WR6E 5EE9A 2SAKA 3EA6A 2DBYA 3SFEB 3TCAA 2O6VD 1E10A 3IT6B 2AQ1B 3AH7A 4MSMB 1WJ6A 2MP2A 4MJSA 2WXOA 1ZXHA 5E6PA 2IGHA 4II2B 4JE3B 2LGDA 2K9XA 2WXMA 4W9DA 3V6EB 2JX5A 4M01A 3HVZA 2IO1B 2KC1A 2C7MB 2PMVA 4GXBA 1WRIA 4JQWC 1FEHA 2RDHA 1QF6A 2MSED 3FKYA 4JWSC 3VUWA 2RDGA 4C4VA 4BZAA 2DAFA 3Q6BA 2O6VA 3E56A 1QOGA 1SXTA 1V5TA 1WX9A 4WWOA 4ANXA 2KQ7A 1JWAD 4ICVA 3WIMA 3DQVA 4ZRPA 2W54A 2KVRA 4B95A 4TQ0A 1ISNA 2I38A 1JRPA 2MJEA 1WWTA 2HTME 1OEYA 4YTNB 1RRBA 5BYSA 1Q10A 2D11A 1IBXA 2ZW0A 2V4IB 1TJEA 3A9KB 3PRMB 1K53A 4FJVB 4HDOA 1S1QB 2XK5A 2XEWA 3APDA 2PLPA 1C9FA 3Q8CA 2BT6A 3DWMA 4K3CA 2EELA 2H88B 3ALBA 1ZKHA 3AE4B 3P42A 3TJPA 3L54A 3I3TB 3DBHI 1DOIA 1QILA 1I7HA 4AWJA 3C0RB 3PRZA 2LASA 4LCDE 5IOIA 2JU6X 3DBLB 4FN2A 1JWUD 2WLBA 2KMMA 2KX0A 3BK2A 1C79A 2AX5A 3AE9B 4RFBA 3JVZX 1V1PB 2W3SA 3VH3B 3WAMA 4OZCA 2JUOA 5H92C 1MJDA 2V3SA 3H7SA 1MG4A 1XT9B 4A6QA 3Q3OC 2KWVB 2Z59B 2VRRB 2AWTA 2KLCA 2KWCA 3HIZA 3PHXB 1UELA 3NZ3A 4EE2A 4HPPA 2M19A 4KSKC 4A55A 1GJZA 2JY6A 2LGYA 1OFFA 2G45B 3AV8A 2QDFA 3AI5A 1MI0A 2WDQB 1R4MI 2I2YA 2GLSA 2KVZA 3UGBB 1FRRA 5FKAC 5L95C 4XDDA 1JW9D 3RT3B 2K39A 1XXGA 4NQLB 1VRAB 2DYMA 1E0ZA 1S3SG 4WJQA 2KWDA 2KN5A 2O2VB 1V1OA 4N58A 2NR2A 1FD6A 3U30A 2RSUA 3AULA 5IN7A 1E5WA 1SB3C 3LB8C 3AECB 5CX3A 4IM3A 1ZUD2 3GB1A 1V6EA 3KWLA 1P98A 3TIXA 1WY8A 2M0AA 3W5VB 1HA5A 2RPQA 4K1RB 4K7WA 4MH0E 2BWFA 1JWSD 2Q5WD 3V05A 3V62A 5I4DA 2IY0B 5BO4B 1NYQA 5KHQA 1JALA 2L8JA 2MW5A 1WYGA 1WXVA 2C7NB 2JQRB 4DWFA 1WMHA 3TMPB 2M1MA 3RCZA 1C77A 1QOAA 3PGEA 4RGNA 5CHFA 3ZUNA 2DHZA 2N7JA 2HDEA 4PS8A 4OZAA 1T6BX 3VUYA 1H4RA 1OEYJ 3HHMA 3UINB 3KQ4A 4ACFA 2FNJB 2IO0B 3P2BA 1N5WA 3UI3A 4MGIE 4M8MA 3WAOA 2JT4B 3ZDTA 4YL8A 1V1PA 2K5PA 4RM9A 3NG0A 3Q2AC 1PGBA 1V2YA 2RR9A 1XO3A 1MG8A 1P3QU 2LJ5A 3RN9C 4YTMB 4LTUA 4OHJA 4OVZA 4PS3A 3WALA 2CJNA 4REZA 3IT4B 4NPNA 1ZDXA 2LXAA 4NAMA 2KX3A 2IYDB 4E74A 4I6PA 4W9CA 1EF1A 1WX7A 1Q5WB 1ZP0B 4MM3B 3RZWC 1JMLA 2AEHA 4W9JA 4II3B 1HZ6A 5HFYA 4BFRA 4EFOA 2REXA 3JW0X 3L08A 3IAM1 4M8NA 5J17A 2MBEA 3V3XA 1J8CA 5E6JA 1PYWD 4S0RA 4MGZE 4N59A 2WX1A 4NJCA 4OVVA 1F52A 3ZNID 1T0QC 3A4SC 3L10B 3URYA 1I4GA 2RDBC 4NNJB 3FILA 3L13A 4HXDA 5CHVC 3N9YC 1XQQA 2ON8A 2KDBA 1UBIA 4E3CA 3EC8A 1YQ3B 4URKA 3MC8A 1ET9A 3I5JC 2SEBD 1R7SA 4WAAA 3W1SC 4LNKA 5JZEB 1FFVA 4A20A 4FLHA 3CWIA 3NOBA 2CU1A 2WDRB 1KLVA 3R7QA 1GC7A 1QZEA 2MEKA 2BYFA 3PREA 4HPMB 5E6NA 1NI3A 1Q1OA 4G3XB 2JYTA 5C2TB 2QCZA 2KD0A 4YSZB 3MTNB 1IUEA 4CHKA 1WE6A 2AYOB 4C00A 5JHBA 3NJTA 2WDVB 1WSPA 1YN5A 3P1MA 2O2VA 1XF5L 2NCNA 4DBGA 1SE2A 1AARA 4WJNA 2KC2A 1RLFA 2WU2B 1QOBA 4ARCA 3ZRFA 2MJ3A 2INDC 3B1LX 2CU3A 2KO3A 3U7DA 2RGFA 3VAWA 2L00B 2N7DA 1UF0A 3W2DA 1TS5A 1Y8RC 3PRPB 4GU2A 3PPAA 4L23A 1IP9A 2V3NA 3APCA 4FADA 2MHJA 3GZNI 3W1SA 3P4QB 4HCPB 2O6VB 3IBEA 3R2IA 2WP9B 3Q14C 1AWDA 4LDTB 2CHWA 3QJZA 3ZNGC 2YVCA 2OJWA 2VZKD 1I4HA 1EF5A 2IZVB 2C5LC 5FK9C 3TEYA 4WJPA 2CKHB 4F8CB 1YQBA 2HD5B 4A8XC 3A9JB 3CSFA 5CTRC 1P0RA 2KQ4X 2ZVNA 3MC0B 2CR5A 1QQRA 1L0XB 1RFKA 2IGDA 1B1ZA 3NVVA 4GN1A 3HK0A 2FCQA 3VTUA 1I35A 4TMAB 4FHJA 3ZTDA 2BYEA 2JRIB 3R3MA 3HM6X 3KUCB 4DHZE 1E7VA 1YN3A 1YX6B 4GDKB 3PO0A 3T3OA 1NDDA 2DYBA 1DOXA 4NY0A 2WQYB 3B2GA 4WAFA 4ZRIA 3J9CA 4IM2A 3DWGC 2GBNA 2VH1A 2B3AA 3P63A 3BIID 5D3IB 1D3ZA 4RF1A 2XBBC 3E9SA 2HJ8A 4HWIB 3PT2B 4WWPA 5J2RA 2KACA 4PT5A 2DWQA 2DX5B 2WXRA 1KJTA 1N61A 4RF0A 1GG3A 2PJHA 4L1BA 3SHQA 3IFWB 3U8ZA 5L83A 2LVOA 1VZ8A 1WGKA 3RMKC 3RYTA 4MACA 3FILB 2M17A 1V8CA 3B2FA 1FIQA 4BKGA 1U4AA 2LGIA 2MRPA 2NPTA 3U7ZA 1CK1A 3T8MA 3AM9A 1ZGUB 3O65B 1UD7A 1JWBD 3RULA 2J0JA 3KVFB 3KW5B 4AJYB 4YXDB 1UWXA 4E71A 2UWQA 2MP2B 3MHSD 4MJSB 5EE0A 2N7EA 1R4MB 1N5XA 2MQJA 4KSLC 3VTVA 3ZIMA 3RI7C 2N9LA 1CMXB 1T0RC 1DYQA 2D2QA 1PQSA 1YD8U 3H8HA 4HJKA 3TEXA 5J18A 2R61A 1I4QA 2E3TA 3U52E 4CYEA 2LZ6A 3ZDMC 1F77A 3BYYB 1FCLA 1XEEA 1WJUA 2MX2A 2PVOD 2HE7A 1N62A 5AZHA 4RGTA 4I6LB 1F0ZA 2G9HD 2BS2B 1GC6A 3DHGC 3A9KA 1D5XC 3QAQA 2M0XA 2KMAA 2FIFA 2AL6A 2ZJDA 1XD3B 4W9KA 4DK5A 1WGYA 2LVPA 4D2KA 4XX5A 5G55A 4GIVA 3DDCB 5D7GA 2L32A 3IXSA 3R8BA 1SJED 1WJNA 1T5XD 1JROA 3A1QA 3HVDA 3APFA 2NPTB 3DBHB 3AEFB 3SU8X 1J7BA 1WGDA 2WGSA 1BMLC 3K9OB 3B9JA 5IAAC 2DNFA 3PZDA 2L52A 3OAWA 3W5UB 2Y5CA 3DBLI 4IW0A 1NENB 4WJOA 1Z5SB 3OJ4B 1J19A 1F9JA 4WWNA 4XYCA 4NAWA 3AE8B 1WH3A 4BBNC 3PLUA 4W9FA 4K3BA 2D3BA 2X8XX 2JYEA 4IOIE 3IVFA 4FJYA 3C19A 2BW2A 2Y5PA 3NVYA 2G1EA 1VJKA 1P9DU 3QK0A 2W9NA 4M0WA 5EE1A 3R66C 3PHWB 4A3OA 4GSWA 1F2RC 2ZPYA 3P4RB 5AEKB 1PUTA 4KGSA 3VUXA 4JWUC 3QARA 1LO5D 2D3GA 2LWPA 1T0YA 2AQ3B 2NTSA 2Z0EB 4AJWA 1WR1A 2MBQA 4MELA 1I42A 4G11A 4KKIA 3ZJTA 3ZJVA 1FNWA 4JLCA 2UU7A 2KJ6A 1AN8A 1EM7A 1KOTA 3DOWA 3LJ3A 2N9EB 2EKEC 2WXQA 2EMTA 2JSVX 4P7IA 5AZGA 4EZJA 1VZ7A 2FE8A 1HE8A 2D07B 2BS4B 3MC9A 1XLOA 4LK0M 3RPFC 3DVGY 1JRUA 1E7PB 3N32A 4KIKA 1XCQL 1A5RA 3DBRB 3N20C 2I1KA 2K8HA 1T0SC 2GBRA 2J53A 4ANWA 2JPHA 2K25A 2KYWA 3ZLZA 2OHFA 3EFCA 4W9HA 2IPKD 2WXLA 2IY1B 1XLNA 4AP4C 1SSNA 2NBWB 2PKOA 3R7RA 1KLGD 3IG3A 1QLBB 4EZLA 2VH2A 3OWEB 3ZGZA 4XWWA 4P1CC 2CJOA 1GOZA 1PFDA 2JWZA 2IDYA 1TZ1A 1R4NI 3AU4A 2NMQA 4NJ7A 3Q8BA 3D32A 2QEJC 2A5UA 3SR6A 3UIOB 2JZPA 4LNFA 5TR5A 1E7UA 1SF0A 1WJ4A 2K8BA 2K1FA 4F7ZA 3A33B 4C7YA 3ONSA 1OQYA 1V86A 4CO7A 3SFDB 2W82A 4TV3A 5BYQA 1FFUA 1TS4A 1YJIA 5C3JB 1C4AA 4L2YA 2G4SA 1FXTB 1TKYA 3KWVA 4M00A 3QWZB 3ETRA 1NYRA 2J52A 4KDIC 4B9KA 3MFGA 3QX1A 4OW0A 1KF6B 1NEKB 5JH5C 4MM3A 1WE7A 2BKRB 1C3TA 4USAA 2CHXA 4X57B 2K0PA 4WIPA 3ZYYX 3KLSX 3RNFC 1OQQA 5D6JB 1EU3A 3RZFA 4ZOHC 2N1VA 1UNSA 2W3RA 4I6NB 1VZ6A 2BGFA 2W55A 3B08A 2KQSA 3NS1A 1BT0A 2VZKB 2FIDA 2QHOA 3K9PB 3OG5A 4YSXB 1FO4A 1D5MC 3C8YA 2JXXA 2WWZA 3DBRI 2L76A 2CS4A 1WGRA 2DZJA 3KH0A 1AYFA 4FHKA 1SJHD 3CSTA 3T3NA 3I9V1 3SDLC 1WI0A 1JQ4A 3LDZE 2IO2B 1QT9A 3AEAB 3AEBB 1D4BA 2Y3AA 2WXHA 2WXFA 3M3JA 3Q3FA 4A3PA 1NI2A 1MFWA 3GOEA 1RAXA 1WX8A 2HTHA 5EE3A 2KHWB 3H6NA 2PIAA 3AE1B 2KKCA 2PVGC 3AB5A 4W9IA 2L7RA 3DPDA 3WANA 1YIWA 3KUDB 4K81A 3ZKJC 3UQBA 1R4NB 1VDVA 3QA8A 4J3OD 2OJRA 4LNIA 5C23A 4HK2A 4HKZE 2L0FA 2KTRB 3W1YA 2V9HA 1IGCA 3QIJA 1Q0WB 3SD5A 3CMMB 4EUTA 2KAJA 3KYDD 1LM8B 2GBJA 4JIOU 4TUUA 4LNNA 1RWSA 2LHDA 4IG7B 1C1YB 4M02A 3NZSA 1RYJA 2KNBA 3P4PB 1L0VB 2IJ0A 2L0TA 1GNUA 3P4SB 2GBMA 1KFYB 2WNMA 2WXPA 4KIKB 2WU5B 1TBEA 1HQRD 3GP7A 4A90A 1FCCC 3Q8AA 2C60A 1GPXA 2ZCCA 1ESFA 1JWMD 2WS3B 1ZDVA 3AE3B 3TSSA 1OGWA 2KWUB 1TKEA 2J7QB 5DCNA 4F1SA 4GLSC 4XZ4A 2ZZPB 2BPSA 2L1AA 1N63A 3V61A 4XDCA 4KKJA 3MHZA 3NUHB 3SEBA 5BMHA 2K3UA 1UGMA 3B0AA 1L4DB 2WXIA 3BINA 2KFKB 4W9GA 2LVQA 3O13A 1BXTA 3NZUA 5E6OA 1T3QA 2MBBB 1SBBB 3BK1A 2N9PC 1B9RA 2MLBA 2PEAA 1UWMA 3V6CB 2YEPF 3H9DA 1TY2A 2NS5A 1IPGA 4HPLB 3PLVA 4ICUA 1F1HA 3QQ8B 2ZNVC 2EKIA 4DXGA 2KDEB 2ZEQA 2Y5BB 4IM0A 3BWUD 3ZXVA 3AMZA 3Q8EA 2QIEB 2L3ZA 4R3DA 3MJWA 2KANA 2R2OA 2OOBB 4KZCA 1L6UA 5LXIB 1MVKA 1ZXIA 3VR8B 4DHJD 1E8XA 3R2TA 4N9F4 1UUPA 3EECA 1KTKA 3GE8C 4ZRKA 4PS7A 3HM3A 1FPYA 1D6EC 1E8WA 3BY4B 1J0GA 1HTQA 1YJ1A 3ZO5B 3H1UA 5IP4D 1FXAA 3I63C 4P6VF 1WIAA 1P7EA 1SE9A 2JRHA 2BB6A 4HRSA 1VCBA 4YWGG 1WMHB 4MSQB 2FAZA 2M4NA 2INCC 1ZOYB 3PSEB 3PVLA 1FXIA 4CQNA 1DOYA 5HHDG 3T9LA 1EWCA 4C4VB 3N3KB 1QKZA 4BKSD 2BF8B 3ZNZB 2JZ3B 2K6DB 3BZDB 2KJRA 2NTTA 2QC8A 3RNCC 2M8SA 3KYCD 2MWSB 2BYTA 1TKGA 3NHEB 1IYFA 1X1MA 2GRIA 2JZZA 3DHIC 3MJ5A 5T8IA 1Z2MA 3UIPB 3AXCA 4M0WB 4AS1A 3AE2B 4RGOS 4FXCA 1XCTL 2INNE 2LHEA 4AQ7A 3ZRCA 1ZPSA 3BVGA 5HI1A 3FC4A 1E6EB 4KZ0A 4ZRJA 1I4XA 2J42A 1ZE3D 3H7PB 3GE3C 2ZW1A 2PPHA 1K50A 2KFKA 4C7ZA 4LNOA 3N1YC 1IBXB 1L2NA 3M63B 4GDLB 1ENFA 2V3PA 2CHZA 2JXTA 5MPOA 3TL5A 1P7FA 2YLMA 4QAYA 3V60A 1YNTE 2XNAC 2WXJA 3AEGB 3DBSA 1K8RB 2J0MA 4JX1C 2KT7A 5H8YE 1YOVB 3PV1A 2G4DB 4DHZB 2JVCA 2D10A 1QOFA 1KH0A 1E90A 2KDMA 3W9CB 4HLEA 4P16A 4HROA 3RD2A 1BUIC 2FCSA 4EOYA 4YSYB 2ZCBA 1TTNA 1CZPA 3EHVA 2KMCA 2LGSA 3UQAA 5D2MB 3NY5A 3PS6A 4WURA 4P1BC 2GOWA 4ASWC 1HZ5A 3QC8B 2IGGA 4LDTD 3AN1A 3RUIB 3TUOA 3AEEB 3CF6E 1P1AA 1F2RI 3X0WA 3A1QB 5JHAA 2E6XA 5HG2A 4XGAB 1GUAB 1LQBA 3IAS1 5FR3A 3VQIA 2BWES 4S17A 4IUMB 3RFZB 4N6EB 5DPSA 3WA0A 2Z8LA 2ACZB 5LNK1 1EUVB 4BOZB 4IDIA 2LRWA 4LLGM 3VH4B 3Q3JA 1E8ZA 2DZKA 1TS2A 3L4PA 2MBOA 2D5GA 3NRZA 4TKNA 3U4EG 2XK5B 4FULA 1YQ4B 4IWQA 3AE6B 1MHHE 2MBHA 2XN9C 4PYUA 3DVGX 2YEPB 2K6QA 2BVCA 2M56B 2NBVB 4XC2A 5IKCM 4GDLA 1PGXA 3EUB2 1WGGA 3VVWB 4BKTA 1M94A 3DHHC 4EEWA 3NS8A 1J7AA 1EU4A 4KV2A 1JCKB 1LXDA 1N6ZA 3M95A 1RM6C 5HKHA 3ZTCA 2KTFA 1WYWB 5LXHA 3WCQA 2IO3B 2BS3B 1L4ZB 4KDLB 3AU5A 2UYZB 2L83A 4W9EA 3N30A 3ML8A 1RFAA 2FUHB 4K7SA 2LMCA 2K22A 2GB1A 5DPTA 2WYQA 4TQ1A 1J7CA 3UF8A 2BB5A 2N9XA 2EMSA 5GXGB 2RMMA 2AL3A 2C9WB 3ZW3A 2N1WA 1N60A 2Z0DB 5AUKA 2KDIA 1NBFC 4ANVA 4JL9A 1ACCA 1E9MA 2G3QB 3AE5B 1OTRB 1SIFA 2I1JA 1TZOA 1VR9A 4C56C 2KDFB 4JPSA 2KN4A 1TGZB 2KJHB 4NAWB 2D3CA 1WF9A 3AE7B 1UZXB 3S2AA 2FUG1 4NQKE 3PZ8A 2DENB 4DDID 2IBIB 4HKQA 5IA7A 3NVWA 4G50A 2GMIC 3WAPA 3AEDB 4ZDVA 1GAQB 4PK1A 3VXWA 3ML9A 1KLUD 3TBLD 2LJIA 1TS3A 4IKGA 5FR6A 1ZW7A 4UDUC 3RNAC 2WXKA 5DPWA 4IWOA 4NJ6A 4KGRA 2INPE 1PDXA 3EGRA 2HJ1A 1ET6A 1YJJA 1KRHA 3DCGA 4WH4A 3HUIA 1VD2A 2DAJA 1V81A 3DVNV 4GMVA 3U2SC 3ZJUA 1CJEA 4KVGB 4B6WA 1A70A 3VR9B 1KM7A 2KOXA 1TIFA 2ZVOA 5AUIA 5LLIA 4G0NB 4IWPA 2TSSA 4ZYNA 4XWTA 5G2NA 4DXFA 3LXFA 4ITKA 2LGXA 1YN4A 2X38A 1WFYA 3TEWA 2RPVA 1UBQA 1D5ZC 3VHTC 4PYZA 4GB9A 1LFDA 1L5PA 1UH6A 1V80A 1TYGB 1WXSA 2WXNA 5G5GA 2QSDA 4O1NA 1M4VA 3X23A 3ENEA 4BVUC 3PTFC 1GB1A 3LYYA 2K8CA 4ZHOA 1WM3A 3BYTB 4ARIA 2BQQA 3ZNHB 1MPEA 2N4FA 3GS2A 4H2AA 1AW7A 5IO9A 1VLBA 3L0WB 4US9A 2J4XA 2ASQA 1V97A 2DLBA 1SE4A 1TT5B 1WGHA 3TEZA 5D3DA 1FNVA 3VRAB 1Y56A 2H89B 3ZQ4A 1UGJA 1OQRA 2WXGA 2FBWB 4BOSC 2B76B 4BAXA 5JXVA 4MGYE 5GMVA 1EWYC 2JF5A 5KHOA 2WDTB 3HRDD 2KLGA 4DHJB 4DQOC 3QHTA 1SE3A 3NVZA 3H7PA 1C78A 1CQVA 2KXJA 2BTEA 3A9JA 4MT5A 4FA6A 4A9AA 2FCMA 1HTOA 3IHPC 1C76A 2R2QA 4MH8A 1LGRA 4KGTA 3VRBB 4J6IA 1DGJA 4BKSA 1I4PA 4MEMA 1WXQA 4US8A 2NBUA 1V5OA 2WHIA 1C4PA 4B0EA 2KZRA 2WX0A 2PE6B 1SIJA 1HXYD 3N1ZC 1SGHA 1IGDA 1I4RA 3ZVVA 3RNBC 1H8CA 5EDSA 2LEKA 1C4CA 4C80A 3VDZA 2J0KA 3Q3MC 2NVUI 2QJLA 1FMAD 2L05A 1ROEA 1WXAA 1L7YA 2MH7A 2BBCA 1V9JA 4B0MA 1L6VA 3CIRB 1FM0D 2QMTA 4AOFA 1GB4A 4DXAB 4HJGE 4LJOB 3FAHA 1MHXA 1K51A 2PE9A 4BBNF 3RNEC 4HCNB 5BYRA 1STEA 2KFJA 4ZRQA 4FJZA 1NVID 1YX5B 2DZMA 3QCAA 1WZ3A 2ZPNA 4WQOB 5BMIA 1XLPA 3ECIA 5AZFA 4W9LA 1G6JA 2QILA 3ABVB 4ZYSA 4AUQC 2GBKA 2ZNVB 2V4LA 5D94A 3MP9A 4GGQA 2PTLA 2N0SB 3L16A 1K52A 4HDQA 2DZIA 2LXCA 4RH6A 3BVMA 2OEDA 4YTPB 2LUEA 3GZNB 1YMHE 4GOCA 2MCNB 2LUMA 4WWMA 2V1YA 3JSVB 4HEA1 4Q2JA 4OVUA 1WZ0A 2KK8A 2N9KA 1WM2A 4NZLB 2FCNA 3OJ3A 2LI5A 3PZ7A
chains in the Genus database with same CATH topology
4AP4C 1E8YA 1UBIA 4GDKA 4E3CA 3EC8A 3NY5A 5D2MB 2NBWB 3R7RA 3PS6A 4URKA 3VFKA 3IG3A 2A4ZA 4EZLA 4LJPB 2LRUA 3DVNU 4HVBA 4EKUA 3JYUA 4WAAA 3W1SC 5JZEB 3EFUA 4A20A 2GOWA 4ASWC 3QC8B 2JWZA 1WRDB 4LDTD 4FLHA 4RMAA 3OLMD 3KUZA 3RUIB 3NOBA 1TZ1A 2CU1A 1R4NI 1V49A 3AU4A 3JSVA 1KLVA 3CF6E 4NJ7A 1GC7A 1QZEA 3R7QA 3D32A 2BYFA 3PREA 1P1AA 2A5UA 4HPMB 5E6NA 4DDGD 3M62B 4K7UA 1Q1OA 3UIOB 3X0WA 4G3XB 3A1QB 5C1ZA 5JHAA 4FBJB 4ANUA 1GUAB 1LQBA 2RD0A 1E7UA 5TR5A 1WJ4A 5DPRA 2KD0A 2K8BA 2LD9A 3VQIA 2BWES 2K1FA 3MTNB 4F7ZA 3A33B 3ONSA 4CHKA 1OQYA 1WE6A 2AYOB 1V86A 4IUMB 4JGHB 4CO7A 5JHBA 5DPSA 3WA0A 4EZKA 4TV3A 2O2VA 4MGKE 4RM8A 1EUVB 4BOZB 2LRWA 2NCNA 3VH4B 2G4SA 4DBGA 3Q3JA 1E8ZA 2DZKA 1AARA 2MBOA 4WJNA 1FXTB 2KC2A 4TKNA 2XK5B 2MA9B 1RLFA 4FULA 3QWZB 4IWQA 4IC7B 3ZRFA 2BKFA 2MBHA 2C7HA 4KDIC 4B9KA 3B1LX 3QX1A 4PYUA 3DVGX 5JH5C 2KTRA 2DYOA 2KO3A 4MM3A 2K6QA 3U7DA 1WE7A 2BKRB 1C3TA 2RGFA 3A4RA 5CHWA 2L00B 2N7DA 2CHXA 4X57B 3VAWA 2NBVB 4XC2A 4MDKE 1EO6A 1Y8RC 1WXMA 3VTWA 3PRPB 4GDLA 4GU2A 3PPAA 3L17A 5D6JB 1IP9A 3RZFA 1WGGA 3VVWB 2N1VA 2BYVE 3APCA 1M94A 4BKTA 4I6NB 2BGFA 4FADA 3B08A 2KQSA 1WR6E 4EEWA 3NS8A 1BT0A 3GZNI 3W1SA 3TCAA 2O6VD 2FIDA 2QHOA 4KV2A 3UQAA 4HCPB 2O6VB 3IBEA 3K9PB 1LXDA 3M95A 4MSMB 1WJ6A 5HKHA 3ZTCA 2KTFA 1WYWB 5LXHA 2MP2A 4MJSA 2IO3B 4LDTB 5E6PA 2CHWA 3QJZA 2JXXA 2YVCA 2WWZA 3DBRI 3ZNGC 2L76A 2CS4A 1WGRA 4KDLB 2DZJA 1EF5A 4II2B 3KH0A 3AU5A 2IZVB 4FHKA 2LGDA 4W9DA 3V6EB 2C5LC 2UYZB 4W9EA 3CSTA 3N30A 3SDLC 1WI0A 4WJPA 2IO1B 2KC1A 3LDZE 3ML8A 2C7MB 2CKHB 4GXBA 1RFAA 2IO2B 2FUHB 4F8CB 1YQBA 4JQWC 2HD5B 4K7SA 3A9JB 3CSFA 2MSED 5CTRC 5DPTA 1P0RA 3M3JA 2WYQA 3Q3FA 4TQ1A 3VUWA 4A3PA 1NI2A 2ZVNA 3UF8A 3GOEA 2N9XA 2CR5A 2EMSA 1RAXA 2DAFA 1WX8A 2AL3A 2C9WB 2HTHA 2O6VA 3ZW3A 2N1WA 2KHWB 3H6NA 4GN1A 3HK0A 1V5TA 1WX9A 2FCQA 2KDIA 2Z0DB 4WWOA 4ANXA 1NBFC 2KQ7A 3VTUA 4ANVA 2KKCA 4ICVA 4JL9A 1I35A 3WIMA 3DQVA 4W9IA 2G3QB 2L7RA 3DPDA 3WANA 1YIWA 3KUDB 1OTRB 4FHJA 4K81A 1SIFA 3ZTDA 3ZKJC 2I1JA 2BYEA 3UQBA 2JRIB 3R3MA 3QA8A 3HM6X 2KVRA 3KUCB 4B95A 1E7VA 4DHZE 2KDFB 2OJRA 1YX6B 1TGZB 2KJHB 5C23A 1ISNA 4NAWB 4TQ0A 1WF9A 4HK2A 1UZXB 3S2AA 4GDKB 4NQKE 2L0FA 2KTRB 3W1YA 2DENB 4DDID 2IBIB 3QIJA 1Q0WB 5IA7A 3SD5A 4G50A 1NDDA 2DYBA 3CMMB 4EUTA 2GMIC 3WAPA 4NY0A 3KYDD 1OEYA 1LM8B 4ZDVA 2GBJA 1RRBA 4ZRIA 4JIOU 2D11A 4IM2A 3VXWA 4TUUA 3ML9A 3TBLD 3A9KB 2GBNA 4IG7B 1C1YB 3PRMB 3NZSA 2KNBA 5FR6A 2B3AA 1D3ZA 4FJVB 4HDOA 1ZW7A 2XBBC 2L0TA 1GNUA 4KIKB 2GBMA 5DPWA 1TBEA 4IWOA 4NJ6A 2HJ8A 1S1QB 2XK5A 2XEWA 3APDA 4HWIB 2C60A 3PT2B 4WWPA 5J2RA 2DX5B 2ZCCA 1KJTA 3ALBA 1ZKHA 3DCGA 1GG3A 1VD2A 2DAJA 1OGWA 1V81A 3TJPA 2PJHA 2KWUB 2J7QB 3I3TB 3DBHI 3DVNV 3IFWB 3L54A 4GMVA 5DCNA 3SHQA 4XZ4A 3U8ZA 4F1SA 2ZZPB 5L83A 2BPSA 4KVGB 4B6WA 2LVOA 1KM7A 2KOXA 4AWJA 3V61A 3RYTA 2ZVOA 3C0RB 3PRZA 2LASA 4LCDE 5LLIA 4G0NB 2M17A 4IWPA 4ZYNA 5G2NA 4BKGA 4FN2A 1U4AA 1UGMA 3B0AA 2MRPA 2NPTA 2LGXA 2KX0A 3T8MA 3BINA 2KFKB 4W9GA 1WFYA 1ZGUB 2LVQA 3O65B 1UD7A 3NZUA 1UBQA 3JVZX 5E6OA 3RULA 2J0JA 3VHTC 3VH3B 2MBBB 3KVFB 4PYZA 3WAMA 4GB9A 2JUOA 3KW5B 1LFDA 4AJYB 1UH6A 2N9PC 1V80A 2UWQA 4E71A 2MLBA 2MP2B 2PEAA 3MHSD 4MJSB 1WXSA 2V3SA 3H7SA 3V6CB 1XT9B 3H9DA 2NS5A 2N7EA 2KWVB 2VRRB 2Z59B 1IPGA 2AWTA 2KLCA 4HPLB 3PLVA 3X23A 4ICUA 3ENEA 4KSLC 2MQJA 3VTVA 3ZIMA 4BVUC 3PTFC 2KWCA 1CMXB 3HIZA 3QQ8B 2K8CA 2D2QA 2ZNVC 3PHXB 1PQSA 1WM3A 1UELA 2KDEB 2ZEQA 1YD8U 2Y5BB 4IM0A 4HJKA 3ZNHB 5J18A 2N4FA 4KSKC 2L3ZA 1GJZA 2JY6A 2KANA 2LGYA 3MJWA 2R2OA 2OOBB 3L0WB 4CYEA 2G45B 2LZ6A 4KZCA 3AI5A 3ZDMC 5LXIB 2ASQA 1R4MI 1WGHA 1WJUA 2MX2A 4DHJD 2HE7A 1E8XA 5AZHA 4N9F4 4I6LB 3UGBB 5L95C 3EECA 3RT3B 2K39A 4ZRKA 4PS7A 3HM3A 4BOSC 1J0GA 1E8WA 1GC6A 3BY4B 1YJ1A 4NQLB 3H1UA 3ZO5B 4MGYE 5GMVA 3A9KA 2DYMA 3QAQA 2JF5A 2M0XA 2KMAA 5KHOA 1S3SG 2AL6A 2FIFA 2WDTB 2ZJDA 4WJQA 1WIAA 2KLGA 4DHJB 1XD3B 2KN5A 3QHTA 2O2VB 4W9KA 4DK5A 2NR2A 1SE9A 3H7PA 1WGYA 3U30A 2KXJA 2JRHA 2LVPA 2RSUA 3AULA 1E5WA 1VCBA 3A9JA 5CX3A 4XX5A 5G55A 4GIVA 1WMHB 3DDCB 4MSQB 4FA6A 4IM3A 5D7GA 2FAZA 2M4NA 1WJNA 2FCMA 3IHPC 2R2QA 1V6EA 3A1QA 3PSEB 3PVLA 3APFA 4J6IA 1P98A 2NPTB 3TIXA 1WY8A 3SU8X 2RPQA 1WGDA 4K1RB 4K7WA 4MH0E 4BKSA 4MEMA 3T9LA 2NBUA 1V5OA 3N3KB 3K9OB 2BWFA 5IAAC 3V62A 3PZDA 4BKSD 2IY0B 2BF8B 2KZRA 3OAWA 3ZNZB 5BO4B 4IW0A 3DBLI 5KHQA 2WX0A 2PE6B 4WJOA 1Z5SB 3OJ4B 1SGHA 1J19A 2L8JA 2JZ3B 2MW5A 1F9JA 2K6DB 4WWNA 2KJRA 3ZVVA 4NAWA 1WXVA 1WH3A 4BBNC 2C7NB 5EDSA 1H8CA 4DWFA 3PLUA 3VDZA 1WMHA 2M8SA 3KYCD 3TMPB 2J0KA 2MWSB 4W9FA 2M1MA 3NHEB 1IYFA 1X1MA 3RCZA 3PGEA 2NVUI 2JZZA 2L05A 5CHFA 1WXAA 1Z2MA 3IVFA 3ZUNA 4FJYA 1L7YA 2DHZA 3UIPB 4PS8A 3AXCA 1V9JA 3VUYA 4M0WB 1H4RA 1OEYJ 3HHMA 3UINB 4AOFA 1P9DU 3QK0A 4DXAB 2W9NA 3R66C 4LJOB 2FNJB 3PHWB 2IO0B 3P2BA 2PE9A 3ZRCA 4A3OA 4MGIE 4BBNF 4M8MA 3WAOA 4GSWA 4HCNB 2JT4B 3ZDTA 2ZPYA 2KFJA 5AEKB 4YL8A 4ZRJA 4FJZA 4KZ0A 4RM9A 3VUXA 3QARA 3H7PB 1V2YA 2RR9A 1MG8A 1P3QU 2D3GA 2LWPA 2LJ5A 1T0YA 1YX5B 2DZMA 2PPHA 2KFKA 2Z0EB 4AJWA 1WR1A 3QCAA 1WZ3A 2ZPNA 4WQOB 2MBQA 4PS3A 4MELA 3WALA 1I42A 3ECIA 4G11A 5AZFA 4W9LA 4NPNA 1G6JA 1L2NA 4JLCA 3M63B 2KJ6A 4GDLB 4AUQC 2LXAA 2GBKA 2CHZA 2KX3A 3DOWA 2IYDB 1KOTA 2ZNVB 3LJ3A 4E74A 2N9EB 4I6PA 4W9CA 3TL5A 1EF1A 1WX7A 1Q5WB 2EKEC 2V4LA 5D94A 2YLMA 3V60A 4GGQA 2EMTA 4P7IA 5AZGA 3DBSA 3RZWC 4EZJA 1K8RB 2J0MA 1HE8A 3L16A 2AEHA 2D07B 4HDQA 3PV1A 2DZIA 2G4DB 4W9JA 2JVCA 2LXCA 4II3B 4DHZB 2D10A 4BFRA 4EFOA 2REXA 1E90A 3JW0X 3L08A 3DVGY 4M8NA 5J17A 1JRUA 2MBEA 4HLEA 3N32A 4KIKA 1J8CA 1A5RA 2LUEA 4MGZE 2WX1A 3RD2A 2I1KA 2FCSA 4GOCA 4OVVA 2K8HA 4EOYA 2MCNB 3ZNID 3A4SC 2GBRA 2ZCBA 3L10B 2V1YA 3JSVB 4ANWA 2JPHA 2K25A 4NNJB 3ZLZA 4OVUA 3L13A 1WZ0A 2KK8A 1TTNA 1WM2A 4HXDA 4W9HA 2FCNA 3OJ3A 5CHVC 2LI5A 1XQQA 2IY1B 3EHVA 2KMCA 2KDBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AP4 C;  1E8Y A;  1UBI A;  4GDK A;  4E3C A;  3EC8 A;  3NY5 A;  5D2M B;  2NBW B;  3R7R A;  3PS6 A;  4URK A;  3VFK A;  3IG3 A;  2A4Z A;  4EZL A;  4LJP B;  2LRU A;  3DVN U;  4HVB A;  4EKU A;  3JYU A;  4WAA A;  3W1S C;  5JZE B;  3EFU A;  4A20 A;  2GOW A;  4ASW C;  3QC8 B;  2JWZ A;  1WRD B;  4LDT D;  4FLH A;  4RMA A;  3OLM D;  3KUZ A;  3RUI B;  3NOB A;  1TZ1 A;  2CU1 A;  1R4N I;  1V49 A;  3AU4 A;  3JSV A;  1KLV A;  3CF6 E;  4NJ7 A;  1GC7 A;  1QZE A;  3R7Q A;  3D32 A;  2BYF A;  3PRE A;  1P1A A;  2A5U A;  4HPM B;  5E6N A;  4DDG D;  3M62 B;  4K7U A;  1Q1O A;  3UIO B;  3X0W A;  4G3X B;  3A1Q B;  5C1Z A;  5JHA A;  4FBJ B;  4ANU A;  1GUA B;  1LQB A;  2RD0 A;  1E7U A;  5TR5 A;  1WJ4 A;  5DPR A;  2KD0 A;  2K8B A;  2LD9 A;  3VQI A;  2BWE S;  2K1F A;  3MTN B;  4F7Z A;  3A33 B;  3ONS A;  4CHK A;  1OQY A;  1WE6 A;  2AYO B;  1V86 A;  4IUM B;  4JGH B;  4CO7 A;  5JHB A;  5DPS A;  3WA0 A;  4EZK A;  4TV3 A;  2O2V A;  4MGK E;  4RM8 A;  1EUV B;  4BOZ B;  2LRW A;  2NCN A;  3VH4 B;  2G4S A;  4DBG A;  3Q3J A;  1E8Z A;  2DZK A;  1AAR A;  2MBO A;  4WJN A;  1FXT B;  2KC2 A;  4TKN A;  2XK5 B;  2MA9 B;  1RLF A;  4FUL A;  3QWZ B;  4IWQ A;  4IC7 B;  3ZRF A;  2BKF A;  2MBH A;  2C7H A;  4KDI C;  4B9K A;  3B1L X;  3QX1 A;  4PYU A;  3DVG X;  5JH5 C;  2KTR A;  2DYO A;  2KO3 A;  4MM3 A;  2K6Q A;  3U7D A;  1WE7 A;  2BKR B;  1C3T A;  2RGF A;  3A4R A;  5CHW A;  2L00 B;  2N7D A;  2CHX A;  4X57 B;  3VAW A;  2NBV B;  4XC2 A;  4MDK E;  1EO6 A;  1Y8R C;  1WXM A;  3VTW A;  3PRP B;  4GDL A;  4GU2 A;  3PPA A;  3L17 A;  5D6J B;  1IP9 A;  3RZF A;  1WGG A;  3VVW B;  2N1V A;  2BYV E;  3APC A;  1M94 A;  4BKT A;  4I6N B;  2BGF A;  4FAD A;  3B08 A;  2KQS A;  1WR6 E;  4EEW A;  3NS8 A;  1BT0 A;  3GZN I;  3W1S A;  3TCA A;  2O6V D;  2FID A;  2QHO A;  4KV2 A;  3UQA A;  4HCP B;  2O6V B;  3IBE A;  3K9P B;  1LXD A;  3M95 A;  4MSM B;  1WJ6 A;  5HKH A;  3ZTC A;  2KTF A;  1WYW B;  5LXH A;  2MP2 A;  4MJS A;  2IO3 B;  4LDT B;  5E6P A;  2CHW A;  3QJZ A;  2JXX A;  2YVC A;  2WWZ A;  3DBR I;  3ZNG C;  2L76 A;  2CS4 A;  1WGR A;  4KDL B;  2DZJ A;  1EF5 A;  4II2 B;  3KH0 A;  3AU5 A;  2IZV B;  4FHK A;  2LGD A;  4W9D A;  3V6E B;  2C5L C;  2UYZ B;  4W9E A;  3CST A;  3N30 A;  3SDL C;  1WI0 A;  4WJP A;  2IO1 B;  2KC1 A;  3LDZ E;  3ML8 A;  2C7M B;  2CKH B;  4GXB A;  1RFA A;  2IO2 B;  2FUH B;  4F8C B;  1YQB A;  4JQW C;  2HD5 B;  4K7S A;  3A9J B;  3CSF A;  2MSE D;  5CTR C;  5DPT A;  1P0R A;  3M3J A;  2WYQ A;  3Q3F A;  4TQ1 A;  3VUW A;  4A3P A;  1NI2 A;  2ZVN A;  3UF8 A;  3GOE A;  2N9X A;  2CR5 A;  2EMS A;  1RAX A;  2DAF A;  1WX8 A;  2AL3 A;  2C9W B;  2HTH A;  2O6V A;  3ZW3 A;  2N1W A;  2KHW B;  3H6N A;  4GN1 A;  3HK0 A;  1V5T A;  1WX9 A;  2FCQ A;  2KDI A;  2Z0D B;  4WWO A;  4ANX A;  1NBF C;  2KQ7 A;  3VTU A;  4ANV A;  2KKC A;  4ICV A;  4JL9 A;  1I35 A;  3WIM A;  3DQV A;  4W9I A;  2G3Q B;  2L7R A;  3DPD A;  3WAN A;  1YIW A;  3KUD B;  1OTR B;  4FHJ A;  4K81 A;  1SIF A;  3ZTD A;  3ZKJ C;  2I1J A;  2BYE A;  3UQB A;  2JRI B;  3R3M A;  3QA8 A;  3HM6 X;  2KVR A;  3KUC B;  4B95 A;  1E7V A;  4DHZ E;  2KDF B;  2OJR A;  1YX6 B;  1TGZ B;  2KJH B;  5C23 A;  1ISN A;  4NAW B;  4TQ0 A;  1WF9 A;  4HK2 A;  1UZX B;  3S2A A;  4GDK B;  4NQK E;  2L0F A;  2KTR B;  3W1Y A;  2DEN B;  4DDI D;  2IBI B;  3QIJ A;  1Q0W B;  5IA7 A;  3SD5 A;  4G50 A;  1NDD A;  2DYB A;  3CMM B;  4EUT A;  2GMI C;  3WAP A;  4NY0 A;  3KYD D;  1OEY A;  1LM8 B;  4ZDV A;  2GBJ A;  1RRB A;  4ZRI A;  4JIO U;  2D11 A;  4IM2 A;  3VXW A;  4TUU A;  3ML9 A;  3TBL D;  3A9K B;  2GBN A;  4IG7 B;  1C1Y B;  3PRM B;  3NZS A;  2KNB A;  5FR6 A;  2B3A A;  1D3Z A;  4FJV B;  4HDO A;  1ZW7 A;  2XBB C;  2L0T A;  1GNU A;  4KIK B;  2GBM A;  5DPW A;  1TBE A;  4IWO A;  4NJ6 A;  2HJ8 A;  1S1Q B;  2XK5 A;  2XEW A;  3APD A;  4HWI B;  2C60 A;  3PT2 B;  4WWP A;  5J2R A;  2DX5 B;  2ZCC A;  1KJT A;  3ALB A;  1ZKH A;  3DCG A;  1GG3 A;  1VD2 A;  2DAJ A;  1OGW A;  1V81 A;  3TJP A;  2PJH A;  2KWU B;  2J7Q B;  3I3T B;  3DBH I;  3DVN V;  3IFW B;  3L54 A;  4GMV A;  5DCN A;  3SHQ A;  4XZ4 A;  3U8Z A;  4F1S A;  2ZZP B;  5L83 A;  2BPS A;  4KVG B;  4B6W A;  2LVO A;  1KM7 A;  2KOX A;  4AWJ A;  3V61 A;  3RYT A;  2ZVO A;  3C0R B;  3PRZ A;  2LAS A;  4LCD E;  5LLI A;  4G0N B;  2M17 A;  4IWP A;  4ZYN A;  5G2N A;  4BKG A;  4FN2 A;  1U4A A;  1UGM A;  3B0A A;  2MRP A;  2NPT A;  2LGX A;  2KX0 A;  3T8M A;  3BIN A;  2KFK B;  4W9G A;  1WFY A;  1ZGU B;  2LVQ A;  3O65 B;  1UD7 A;  3NZU A;  1UBQ A;  3JVZ X;  5E6O A;  3RUL A;  2J0J A;  3VHT C;  3VH3 B;  2MBB B;  3KVF B;  4PYZ A;  3WAM A;  4GB9 A;  2JUO A;  3KW5 B;  1LFD A;  4AJY B;  1UH6 A;  2N9P C;  1V80 A;  2UWQ A;  4E71 A;  2MLB A;  2MP2 B;  2PEA A;  3MHS D;  4MJS B;  1WXS A;  2V3S A;  3H7S A;  3V6C B;  1XT9 B;  3H9D A;  2NS5 A;  2N7E A;  2KWV B;  2VRR B;  2Z59 B;  1IPG A;  2AWT A;  2KLC A;  4HPL B;  3PLV A;  3X23 A;  4ICU A;  3ENE A;  4KSL C;  2MQJ A;  3VTV A;  3ZIM A;  4BVU C;  3PTF C;  2KWC A;  1CMX B;  3HIZ A;  3QQ8 B;  2K8C A;  2D2Q A;  2ZNV C;  3PHX B;  1PQS A;  1WM3 A;  1UEL A;  2KDE B;  2ZEQ A;  1YD8 U;  2Y5B B;  4IM0 A;  4HJK A;  3ZNH B;  5J18 A;  2N4F A;  4KSK C;  2L3Z A;  1GJZ A;  2JY6 A;  2KAN A;  2LGY A;  3MJW A;  2R2O A;  2OOB B;  3L0W B;  4CYE A;  2G45 B;  2LZ6 A;  4KZC A;  3AI5 A;  3ZDM C;  5LXI B;  2ASQ A;  1R4M I;  1WGH A;  1WJU A;  2MX2 A;  4DHJ D;  2HE7 A;  1E8X A;  5AZH A;  4N9F 4;  4I6L B;  3UGB B;  5L95 C;  3EEC A;  3RT3 B;  2K39 A;  4ZRK A;  4PS7 A;  3HM3 A;  4BOS C;  1J0G A;  1E8W A;  1GC6 A;  3BY4 B;  1YJ1 A;  4NQL B;  3H1U A;  3ZO5 B;  4MGY E;  5GMV A;  3A9K A;  2DYM A;  3QAQ A;  2JF5 A;  2M0X A;  2KMA A;  5KHO A;  1S3S G;  2AL6 A;  2FIF A;  2WDT B;  2ZJD A;  4WJQ A;  1WIA A;  2KLG A;  4DHJ B;  1XD3 B;  2KN5 A;  3QHT A;  2O2V B;  4W9K A;  4DK5 A;  2NR2 A;  1SE9 A;  3H7P A;  1WGY A;  3U30 A;  2KXJ A;  2JRH A;  2LVP A;  2RSU A;  3AUL A;  1E5W A;  1VCB A;  3A9J A;  5CX3 A;  4XX5 A;  5G55 A;  4GIV A;  1WMH B;  3DDC B;  4MSQ B;  4FA6 A;  4IM3 A;  5D7G A;  2FAZ A;  2M4N A;  1WJN A;  2FCM A;  3IHP C;  2R2Q A;  1V6E A;  3A1Q A;  3PSE B;  3PVL A;  3APF A;  4J6I A;  1P98 A;  2NPT B;  3TIX A;  1WY8 A;  3SU8 X;  2RPQ A;  1WGD A;  4K1R B;  4K7W A;  4MH0 E;  4BKS A;  4MEM A;  3T9L A;  2NBU A;  1V5O A;  3N3K B;  3K9O B;  2BWF A;  5IAA C;  3V62 A;  3PZD A;  4BKS D;  2IY0 B;  2BF8 B;  2KZR A;  3OAW A;  3ZNZ B;  5BO4 B;  4IW0 A;  3DBL I;  5KHQ A;  2WX0 A;  2PE6 B;  4WJO A;  1Z5S B;  3OJ4 B;  1SGH A;  1J19 A;  2L8J A;  2JZ3 B;  2MW5 A;  1F9J A;  2K6D B;  4WWN A;  2KJR A;  3ZVV A;  4NAW A;  1WXV A;  1WH3 A;  4BBN C;  2C7N B;  5EDS A;  1H8C A;  4DWF A;  3PLU A;  3VDZ A;  1WMH A;  2M8S A;  3KYC D;  3TMP B;  2J0K A;  2MWS B;  4W9F A;  2M1M A;  3NHE B;  1IYF A;  1X1M A;  3RCZ A;  3PGE A;  2NVU I;  2JZZ A;  2L05 A;  5CHF A;  1WXA A;  1Z2M A;  3IVF A;  3ZUN A;  4FJY A;  1L7Y A;  2DHZ A;  3UIP B;  4PS8 A;  3AXC A;  1V9J A;  3VUY A;  4M0W B;  1H4R A;  1OEY J;  3HHM A;  3UIN B;  4AOF A;  1P9D U;  3QK0 A;  4DXA B;  2W9N A;  3R66 C;  4LJO B;  2FNJ B;  3PHW B;  2IO0 B;  3P2B A;  2PE9 A;  3ZRC A;  4A3O A;  4MGI E;  4BBN F;  4M8M A;  3WAO A;  4GSW A;  4HCN B;  2JT4 B;  3ZDT A;  2ZPY A;  2KFJ A;  5AEK B;  4YL8 A;  4ZRJ A;  4FJZ A;  4KZ0 A;  4RM9 A;  3VUX A;  3QAR A;  3H7P B;  1V2Y A;  2RR9 A;  1MG8 A;  1P3Q U;  2D3G A;  2LWP A;  2LJ5 A;  1T0Y A;  1YX5 B;  2DZM A;  2PPH A;  2KFK A;  2Z0E B;  4AJW A;  1WR1 A;  3QCA A;  1WZ3 A;  2ZPN A;  4WQO B;  2MBQ A;  4PS3 A;  4MEL A;  3WAL A;  1I42 A;  3ECI A;  4G11 A;  5AZF A;  4W9L A;  4NPN A;  1G6J A;  1L2N A;  4JLC A;  3M63 B;  2KJ6 A;  4GDL B;  4AUQ C;  2LXA A;  2GBK A;  2CHZ A;  2KX3 A;  3DOW A;  2IYD B;  1KOT A;  2ZNV B;  3LJ3 A;  4E74 A;  2N9E B;  4I6P A;  4W9C A;  3TL5 A;  1EF1 A;  1WX7 A;  1Q5W B;  2EKE C;  2V4L A;  5D94 A;  2YLM A;  3V60 A;  4GGQ A;  2EMT A;  4P7I A;  5AZG A;  3DBS A;  3RZW C;  4EZJ A;  1K8R B;  2J0M A;  1HE8 A;  3L16 A;  2AEH A;  2D07 B;  4HDQ A;  3PV1 A;  2DZI A;  2G4D B;  4W9J A;  2JVC A;  2LXC A;  4II3 B;  4DHZ B;  2D10 A;  4BFR A;  4EFO A;  2REX A;  1E90 A;  3JW0 X;  3L08 A;  3DVG Y;  4M8N A;  5J17 A;  1JRU A;  2MBE A;  4HLE A;  3N32 A;  4KIK A;  1J8C A;  1A5R A;  2LUE A;  4MGZ E;  2WX1 A;  3RD2 A;  2I1K A;  2FCS A;  4GOC A;  4OVV A;  2K8H A;  4EOY A;  2MCN B;  3ZNI D;  3A4S C;  2GBR A;  2ZCB A;  3L10 B;  2V1Y A;  3JSV B;  4ANW A;  2JPH A;  2K25 A;  4NNJ B;  3ZLZ A;  4OVU A;  3L13 A;  1WZ0 A;  2KK8 A;  1TTN A;  1WM2 A;  4HXD A;  4W9H A;  2FCN A;  3OJ3 A;  5CHV C;  2LI5 A;  1XQQ A;  2IY1 B;  3EHV A;  2KMC A;  2KDB A; 
#chains in the Genus database with same CATH topology
 2ICI A;  1E8Y A;  4GDK A;  3N1X C;  3RNG C;  3VFK A;  2A4Z A;  4LJP B;  2LRU A;  3DVN U;  4HVB A;  4EKU A;  3JYU A;  4OZB A;  3EFU A;  4XE0 A;  1WRD B;  3Q69 A;  4RMA A;  3OLM D;  3KUZ A;  2AQ2 B;  4RNA A;  4WQM A;  1V49 A;  3JSV A;  1PGA A;  1FNU A;  5BMG A;  4DDG D;  3M62 B;  4K7U A;  1SEB D;  5C1Z A;  4FBJ B;  4ANU A;  2RD0 A;  2MJD A;  5DPR A;  2LD9 A;  2JWU A;  2D3A A;  4JGH B;  3Q8F A;  3I57 A;  4EZK A;  4KX6 B;  4MGK E;  2PW9 A;  4RM8 A;  4TSS A;  2V0G A;  2LFI A;  1XLQ A;  2MA9 B;  1FRD A;  2ONQ A;  3ZXR A;  4IC7 B;  4YT0 B;  2BKF A;  2C7H A;  3BVZ A;  2KTR A;  2DYO A;  1L0Y B;  2GI9 A;  3A4R A;  5CHW A;  4MDK E;  5G5H A;  1EO6 A;  3VTW A;  1WXM A;  4ZHP A;  3Q3N C;  3L17 A;  5TSS A;  2BYV E;  1HEZ E;  4RCO A;  1TY0 A;  4RGM A;  1WR6 E;  5EE9 A;  2SAK A;  3EA6 A;  2DBY A;  3SFE B;  3TCA A;  2O6V D;  1E10 A;  3IT6 B;  2AQ1 B;  3AH7 A;  4MSM B;  1WJ6 A;  2MP2 A;  4MJS A;  2WXO A;  1ZXH A;  5E6P A;  2IGH A;  4II2 B;  4JE3 B;  2LGD A;  2K9X A;  2WXM A;  4W9D A;  3V6E B;  2JX5 A;  4M01 A;  3HVZ A;  2IO1 B;  2KC1 A;  2C7M B;  2PMV A;  4GXB A;  1WRI A;  4JQW C;  1FEH A;  2RDH A;  1QF6 A;  2MSE D;  3FKY A;  4JWS C;  3VUW A;  2RDG A;  4C4V A;  4BZA A;  2DAF A;  3Q6B A;  2O6V A;  3E56 A;  1QOG A;  1SXT A;  1V5T A;  1WX9 A;  4WWO A;  4ANX A;  2KQ7 A;  1JWA D;  4ICV A;  3WIM A;  3DQV A;  4ZRP A;  2W54 A;  2KVR A;  4B95 A;  4TQ0 A;  1ISN A;  2I38 A;  1JRP A;  2MJE A;  1WWT A;  2HTM E;  1OEY A;  4YTN B;  1RRB A;  5BYS A;  1Q10 A;  2D11 A;  1IBX A;  2ZW0 A;  2V4I B;  1TJE A;  3A9K B;  3PRM B;  1K53 A;  4FJV B;  4HDO A;  1S1Q B;  2XK5 A;  2XEW A;  3APD A;  2PLP A;  1C9F A;  3Q8C A;  2BT6 A;  3DWM A;  4K3C A;  2EEL A;  2H88 B;  3ALB A;  1ZKH A;  3AE4 B;  3P42 A;  3TJP A;  3L54 A;  3I3T B;  3DBH I;  1DOI A;  1QIL A;  1I7H A;  4AWJ A;  3C0R B;  3PRZ A;  2LAS A;  4LCD E;  5IOI A;  2JU6 X;  3DBL B;  4FN2 A;  1JWU D;  2WLB A;  2KMM A;  2KX0 A;  3BK2 A;  1C79 A;  2AX5 A;  3AE9 B;  4RFB A;  3JVZ X;  1V1P B;  2W3S A;  3VH3 B;  3WAM A;  4OZC A;  2JUO A;  5H92 C;  1MJD A;  2V3S A;  3H7S A;  1MG4 A;  1XT9 B;  4A6Q A;  3Q3O C;  2KWV B;  2Z59 B;  2VRR B;  2AWT A;  2KLC A;  2KWC A;  3HIZ A;  3PHX B;  1UEL A;  3NZ3 A;  4EE2 A;  4HPP A;  2M19 A;  4KSK C;  4A55 A;  1GJZ A;  2JY6 A;  2LGY A;  1OFF A;  2G45 B;  3AV8 A;  2QDF A;  3AI5 A;  1MI0 A;  2WDQ B;  1R4M I;  2I2Y A;  2GLS A;  2KVZ A;  3UGB B;  1FRR A;  5FKA C;  5L95 C;  4XDD A;  1JW9 D;  3RT3 B;  2K39 A;  1XXG A;  4NQL B;  1VRA B;  2DYM A;  1E0Z A;  1S3S G;  4WJQ A;  2KWD A;  2KN5 A;  2O2V B;  1V1O A;  4N58 A;  2NR2 A;  1FD6 A;  3U30 A;  2RSU A;  3AUL A;  5IN7 A;  1E5W A;  1SB3 C;  3LB8 C;  3AEC B;  5CX3 A;  4IM3 A;  1ZUD 2;  3GB1 A;  1V6E A;  3KWL A;  1P98 A;  3TIX A;  1WY8 A;  2M0A A;  3W5V B;  1HA5 A;  2RPQ A;  4K1R B;  4K7W A;  4MH0 E;  2BWF A;  1JWS D;  2Q5W D;  3V05 A;  3V62 A;  5I4D A;  2IY0 B;  5BO4 B;  1NYQ A;  5KHQ A;  1JAL A;  2L8J A;  2MW5 A;  1WYG A;  1WXV A;  2C7N B;  2JQR B;  4DWF A;  1WMH A;  3TMP B;  2M1M A;  3RCZ A;  1C77 A;  1QOA A;  3PGE A;  4RGN A;  5CHF A;  3ZUN A;  2DHZ A;  2N7J A;  2HDE A;  4PS8 A;  4OZA A;  1T6B X;  3VUY A;  1H4R A;  1OEY J;  3HHM A;  3UIN B;  3KQ4 A;  4ACF A;  2FNJ B;  2IO0 B;  3P2B A;  1N5W A;  3UI3 A;  4MGI E;  4M8M A;  3WAO A;  2JT4 B;  3ZDT A;  4YL8 A;  1V1P A;  2K5P A;  4RM9 A;  3NG0 A;  3Q2A C;  1PGB A;  1V2Y A;  2RR9 A;  1XO3 A;  1MG8 A;  1P3Q U;  2LJ5 A;  3RN9 C;  4YTM B;  4LTU A;  4OHJ A;  4OVZ A;  4PS3 A;  3WAL A;  2CJN A;  4REZ A;  3IT4 B;  4NPN A;  1ZDX A;  2LXA A;  4NAM A;  2KX3 A;  2IYD B;  4E74 A;  4I6P A;  4W9C A;  1EF1 A;  1WX7 A;  1Q5W B;  1ZP0 B;  4MM3 B;  3RZW C;  1JML A;  2AEH A;  4W9J A;  4II3 B;  1HZ6 A;  5HFY A;  4BFR A;  4EFO A;  2REX A;  3JW0 X;  3L08 A;  3IAM 1;  4M8N A;  5J17 A;  2MBE A;  3V3X A;  1J8C A;  5E6J A;  1PYW D;  4S0R A;  4MGZ E;  4N59 A;  2WX1 A;  4NJC A;  4OVV A;  1F52 A;  3ZNI D;  1T0Q C;  3A4S C;  3L10 B;  3URY A;  1I4G A;  2RDB C;  4NNJ B;  3FIL A;  3L13 A;  4HXD A;  5CHV C;  3N9Y C;  1XQQ A;  2ON8 A;  2KDB A;  1UBI A;  4E3C A;  3EC8 A;  1YQ3 B;  4URK A;  3MC8 A;  1ET9 A;  3I5J C;  2SEB D;  1R7S A;  4WAA A;  3W1S C;  4LNK A;  5JZE B;  1FFV A;  4A20 A;  4FLH A;  3CWI A;  3NOB A;  2CU1 A;  2WDR B;  1KLV A;  3R7Q A;  1GC7 A;  1QZE A;  2MEK A;  2BYF A;  3PRE A;  4HPM B;  5E6N A;  1NI3 A;  1Q1O A;  4G3X B;  2JYT A;  5C2T B;  2QCZ A;  2KD0 A;  4YSZ B;  3MTN B;  1IUE A;  4CHK A;  1WE6 A;  2AYO B;  4C00 A;  5JHB A;  3NJT A;  2WDV B;  1WSP A;  1YN5 A;  3P1M A;  2O2V A;  1XF5 L;  2NCN A;  4DBG A;  1SE2 A;  1AAR A;  4WJN A;  2KC2 A;  1RLF A;  2WU2 B;  1QOB A;  4ARC A;  3ZRF A;  2MJ3 A;  2IND C;  3B1L X;  2CU3 A;  2KO3 A;  3U7D A;  2RGF A;  3VAW A;  2L00 B;  2N7D A;  1UF0 A;  3W2D A;  1TS5 A;  1Y8R C;  3PRP B;  4GU2 A;  3PPA A;  4L23 A;  1IP9 A;  2V3N A;  3APC A;  4FAD A;  2MHJ A;  3GZN I;  3W1S A;  3P4Q B;  4HCP B;  2O6V B;  3IBE A;  3R2I A;  2WP9 B;  3Q14 C;  1AWD A;  4LDT B;  2CHW A;  3QJZ A;  3ZNG C;  2YVC A;  2OJW A;  2VZK D;  1I4H A;  1EF5 A;  2IZV B;  2C5L C;  5FK9 C;  3TEY A;  4WJP A;  2CKH B;  4F8C B;  1YQB A;  2HD5 B;  4A8X C;  3A9J B;  3CSF A;  5CTR C;  1P0R A;  2KQ4 X;  2ZVN A;  3MC0 B;  2CR5 A;  1QQR A;  1L0X B;  1RFK A;  2IGD A;  1B1Z A;  3NVV A;  4GN1 A;  3HK0 A;  2FCQ A;  3VTU A;  1I35 A;  4TMA B;  4FHJ A;  3ZTD A;  2BYE A;  2JRI B;  3R3M A;  3HM6 X;  3KUC B;  4DHZ E;  1E7V A;  1YN3 A;  1YX6 B;  4GDK B;  3PO0 A;  3T3O A;  1NDD A;  2DYB A;  1DOX A;  4NY0 A;  2WQY B;  3B2G A;  4WAF A;  4ZRI A;  3J9C A;  4IM2 A;  3DWG C;  2GBN A;  2VH1 A;  2B3A A;  3P63 A;  3BII D;  5D3I B;  1D3Z A;  4RF1 A;  2XBB C;  3E9S A;  2HJ8 A;  4HWI B;  3PT2 B;  4WWP A;  5J2R A;  2KAC A;  4PT5 A;  2DWQ A;  2DX5 B;  2WXR A;  1KJT A;  1N61 A;  4RF0 A;  1GG3 A;  2PJH A;  4L1B A;  3SHQ A;  3IFW B;  3U8Z A;  5L83 A;  2LVO A;  1VZ8 A;  1WGK A;  3RMK C;  3RYT A;  4MAC A;  3FIL B;  2M17 A;  1V8C A;  3B2F A;  1FIQ A;  4BKG A;  1U4A A;  2LGI A;  2MRP A;  2NPT A;  3U7Z A;  1CK1 A;  3T8M A;  3AM9 A;  1ZGU B;  3O65 B;  1UD7 A;  1JWB D;  3RUL A;  2J0J A;  3KVF B;  3KW5 B;  4AJY B;  4YXD B;  1UWX A;  4E71 A;  2UWQ A;  2MP2 B;  3MHS D;  4MJS B;  5EE0 A;  2N7E A;  1R4M B;  1N5X A;  2MQJ A;  4KSL C;  3VTV A;  3ZIM A;  3RI7 C;  2N9L A;  1CMX B;  1T0R C;  1DYQ A;  2D2Q A;  1PQS A;  1YD8 U;  3H8H A;  4HJK A;  3TEX A;  5J18 A;  2R61 A;  1I4Q A;  2E3T A;  3U52 E;  4CYE A;  2LZ6 A;  3ZDM C;  1F77 A;  3BYY B;  1FCL A;  1XEE A;  1WJU A;  2MX2 A;  2PVO D;  2HE7 A;  1N62 A;  5AZH A;  4RGT A;  4I6L B;  1F0Z A;  2G9H D;  2BS2 B;  1GC6 A;  3DHG C;  3A9K A;  1D5X C;  3QAQ A;  2M0X A;  2KMA A;  2FIF A;  2AL6 A;  2ZJD A;  1XD3 B;  4W9K A;  4DK5 A;  1WGY A;  2LVP A;  4D2K A;  4XX5 A;  5G55 A;  4GIV A;  3DDC B;  5D7G A;  2L32 A;  3IXS A;  3R8B A;  1SJE D;  1WJN A;  1T5X D;  1JRO A;  3A1Q A;  3HVD A;  3APF A;  2NPT B;  3DBH B;  3AEF B;  3SU8 X;  1J7B A;  1WGD A;  2WGS A;  1BML C;  3K9O B;  3B9J A;  5IAA C;  2DNF A;  3PZD A;  2L52 A;  3OAW A;  3W5U B;  2Y5C A;  3DBL I;  4IW0 A;  1NEN B;  4WJO A;  1Z5S B;  3OJ4 B;  1J19 A;  1F9J A;  4WWN A;  4XYC A;  4NAW A;  3AE8 B;  1WH3 A;  4BBN C;  3PLU A;  4W9F A;  4K3B A;  2D3B A;  2X8X X;  2JYE A;  4IOI E;  3IVF A;  4FJY A;  3C19 A;  2BW2 A;  2Y5P A;  3NVY A;  2G1E A;  1VJK A;  1P9D U;  3QK0 A;  2W9N A;  4M0W A;  5EE1 A;  3R66 C;  3PHW B;  4A3O A;  4GSW A;  1F2R C;  2ZPY A;  3P4R B;  5AEK B;  1PUT A;  4KGS A;  3VUX A;  4JWU C;  3QAR A;  1LO5 D;  2D3G A;  2LWP A;  1T0Y A;  2AQ3 B;  2NTS A;  2Z0E B;  4AJW A;  1WR1 A;  2MBQ A;  4MEL A;  1I42 A;  4G11 A;  4KKI A;  3ZJT A;  3ZJV A;  1FNW A;  4JLC A;  2UU7 A;  2KJ6 A;  1AN8 A;  1EM7 A;  1KOT A;  3DOW A;  3LJ3 A;  2N9E B;  2EKE C;  2WXQ A;  2EMT A;  2JSV X;  4P7I A;  5AZG A;  4EZJ A;  1VZ7 A;  2FE8 A;  1HE8 A;  2D07 B;  2BS4 B;  3MC9 A;  1XLO A;  4LK0 M;  3RPF C;  3DVG Y;  1JRU A;  1E7P B;  3N32 A;  4KIK A;  1XCQ L;  1A5R A;  3DBR B;  3N20 C;  2I1K A;  2K8H A;  1T0S C;  2GBR A;  2J53 A;  4ANW A;  2JPH A;  2K25 A;  2KYW A;  3ZLZ A;  2OHF A;  3EFC A;  4W9H A;  2IPK D;  2WXL A;  2IY1 B;  1XLN A;  4AP4 C;  1SSN A;  2NBW B;  2PKO A;  3R7R A;  1KLG D;  3IG3 A;  1QLB B;  4EZL A;  2VH2 A;  3OWE B;  3ZGZ A;  4XWW A;  4P1C C;  2CJO A;  1GOZ A;  1PFD A;  2JWZ A;  2IDY A;  1TZ1 A;  1R4N I;  3AU4 A;  2NMQ A;  4NJ7 A;  3Q8B A;  3D32 A;  2QEJ C;  2A5U A;  3SR6 A;  3UIO B;  2JZP A;  4LNF A;  5TR5 A;  1E7U A;  1SF0 A;  1WJ4 A;  2K8B A;  2K1F A;  4F7Z A;  3A33 B;  4C7Y A;  3ONS A;  1OQY A;  1V86 A;  4CO7 A;  3SFD B;  2W82 A;  4TV3 A;  5BYQ A;  1FFU A;  1TS4 A;  1YJI A;  5C3J B;  1C4A A;  4L2Y A;  2G4S A;  1FXT B;  1TKY A;  3KWV A;  4M00 A;  3QWZ B;  3ETR A;  1NYR A;  2J52 A;  4KDI C;  4B9K A;  3MFG A;  3QX1 A;  4OW0 A;  1KF6 B;  1NEK B;  5JH5 C;  4MM3 A;  1WE7 A;  2BKR B;  1C3T A;  4USA A;  2CHX A;  4X57 B;  2K0P A;  4WIP A;  3ZYY X;  3KLS X;  3RNF C;  1OQQ A;  5D6J B;  1EU3 A;  3RZF A;  4ZOH C;  2N1V A;  1UNS A;  2W3R A;  4I6N B;  1VZ6 A;  2BGF A;  2W55 A;  3B08 A;  2KQS A;  3NS1 A;  1BT0 A;  2VZK B;  2FID A;  2QHO A;  3K9P B;  3OG5 A;  4YSX B;  1FO4 A;  1D5M C;  3C8Y A;  2JXX A;  2WWZ A;  3DBR I;  2L76 A;  2CS4 A;  1WGR A;  2DZJ A;  3KH0 A;  1AYF A;  4FHK A;  1SJH D;  3CST A;  3T3N A;  3I9V 1;  3SDL C;  1WI0 A;  1JQ4 A;  3LDZ E;  2IO2 B;  1QT9 A;  3AEA B;  3AEB B;  1D4B A;  2Y3A A;  2WXH A;  2WXF A;  3M3J A;  3Q3F A;  4A3P A;  1NI2 A;  1MFW A;  3GOE A;  1RAX A;  1WX8 A;  2HTH A;  5EE3 A;  2KHW B;  3H6N A;  2PIA A;  3AE1 B;  2KKC A;  2PVG C;  3AB5 A;  4W9I A;  2L7R A;  3DPD A;  3WAN A;  1YIW A;  3KUD B;  4K81 A;  3ZKJ C;  3UQB A;  1R4N B;  1VDV A;  3QA8 A;  4J3O D;  2OJR A;  4LNI A;  5C23 A;  4HK2 A;  4HKZ E;  2L0F A;  2KTR B;  3W1Y A;  2V9H A;  1IGC A;  3QIJ A;  1Q0W B;  3SD5 A;  3CMM B;  4EUT A;  2KAJ A;  3KYD D;  1LM8 B;  2GBJ A;  4JIO U;  4TUU A;  4LNN A;  1RWS A;  2LHD A;  4IG7 B;  1C1Y B;  4M02 A;  3NZS A;  1RYJ A;  2KNB A;  3P4P B;  1L0V B;  2IJ0 A;  2L0T A;  1GNU A;  3P4S B;  2GBM A;  1KFY B;  2WNM A;  2WXP A;  4KIK B;  2WU5 B;  1TBE A;  1HQR D;  3GP7 A;  4A90 A;  1FCC C;  3Q8A A;  2C60 A;  1GPX A;  2ZCC A;  1ESF A;  1JWM D;  2WS3 B;  1ZDV A;  3AE3 B;  3TSS A;  1OGW A;  2KWU B;  1TKE A;  2J7Q B;  5DCN A;  4F1S A;  4GLS C;  4XZ4 A;  2ZZP B;  2BPS A;  2L1A A;  1N63 A;  3V61 A;  4XDC A;  4KKJ A;  3MHZ A;  3NUH B;  3SEB A;  5BMH A;  2K3U A;  1UGM A;  3B0A A;  1L4D B;  2WXI A;  3BIN A;  2KFK B;  4W9G A;  2LVQ A;  3O13 A;  1BXT A;  3NZU A;  5E6O A;  1T3Q A;  2MBB B;  1SBB B;  3BK1 A;  2N9P C;  1B9R A;  2MLB A;  2PEA A;  1UWM A;  3V6C B;  2YEP F;  3H9D A;  1TY2 A;  2NS5 A;  1IPG A;  4HPL B;  3PLV A;  4ICU A;  1F1H A;  3QQ8 B;  2ZNV C;  2EKI A;  4DXG A;  2KDE B;  2ZEQ A;  2Y5B B;  4IM0 A;  3BWU D;  3ZXV A;  3AMZ A;  3Q8E A;  2QIE B;  2L3Z A;  4R3D A;  3MJW A;  2KAN A;  2R2O A;  2OOB B;  4KZC A;  1L6U A;  5LXI B;  1MVK A;  1ZXI A;  3VR8 B;  4DHJ D;  1E8X A;  3R2T A;  4N9F 4;  1UUP A;  3EEC A;  1KTK A;  3GE8 C;  4ZRK A;  4PS7 A;  3HM3 A;  1FPY A;  1D6E C;  1E8W A;  3BY4 B;  1J0G A;  1HTQ A;  1YJ1 A;  3ZO5 B;  3H1U A;  5IP4 D;  1FXA A;  3I63 C;  4P6V F;  1WIA A;  1P7E A;  1SE9 A;  2JRH A;  2BB6 A;  4HRS A;  1VCB A;  4YWG G;  1WMH B;  4MSQ B;  2FAZ A;  2M4N A;  2INC C;  1ZOY B;  3PSE B;  3PVL A;  1FXI A;  4CQN A;  1DOY A;  5HHD G;  3T9L A;  1EWC A;  4C4V B;  3N3K B;  1QKZ A;  4BKS D;  2BF8 B;  3ZNZ B;  2JZ3 B;  2K6D B;  3BZD B;  2KJR A;  2NTT A;  2QC8 A;  3RNC C;  2M8S A;  3KYC D;  2MWS B;  2BYT A;  1TKG A;  3NHE B;  1IYF A;  1X1M A;  2GRI A;  2JZZ A;  3DHI C;  3MJ5 A;  5T8I A;  1Z2M A;  3UIP B;  3AXC A;  4M0W B;  4AS1 A;  3AE2 B;  4RGO S;  4FXC A;  1XCT L;  2INN E;  2LHE A;  4AQ7 A;  3ZRC A;  1ZPS A;  3BVG A;  5HI1 A;  3FC4 A;  1E6E B;  4KZ0 A;  4ZRJ A;  1I4X A;  2J42 A;  1ZE3 D;  3H7P B;  3GE3 C;  2ZW1 A;  2PPH A;  1K50 A;  2KFK A;  4C7Z A;  4LNO A;  3N1Y C;  1IBX B;  1L2N A;  3M63 B;  4GDL B;  1ENF A;  2V3P A;  2CHZ A;  2JXT A;  5MPO A;  3TL5 A;  1P7F A;  2YLM A;  4QAY A;  3V60 A;  1YNT E;  2XNA C;  2WXJ A;  3AEG B;  3DBS A;  1K8R B;  2J0M A;  4JX1 C;  2KT7 A;  5H8Y E;  1YOV B;  3PV1 A;  2G4D B;  4DHZ B;  2JVC A;  2D10 A;  1QOF A;  1KH0 A;  1E90 A;  2KDM A;  3W9C B;  4HLE A;  4P16 A;  4HRO A;  3RD2 A;  1BUI C;  2FCS A;  4EOY A;  4YSY B;  2ZCB A;  1TTN A;  1CZP A;  3EHV A;  2KMC A;  2LGS A;  3UQA A;  5D2M B;  3NY5 A;  3PS6 A;  4WUR A;  4P1B C;  2GOW A;  4ASW C;  1HZ5 A;  3QC8 B;  2IGG A;  4LDT D;  3AN1 A;  3RUI B;  3TUO A;  3AEE B;  3CF6 E;  1P1A A;  1F2R I;  3X0W A;  3A1Q B;  5JHA A;  2E6X A;  5HG2 A;  4XGA B;  1GUA B;  1LQB A;  3IAS 1;  5FR3 A;  3VQI A;  2BWE S;  4S17 A;  4IUM B;  3RFZ B;  4N6E B;  5DPS A;  3WA0 A;  2Z8L A;  2ACZ B;  5LNK 1;  1EUV B;  4BOZ B;  4IDI A;  2LRW A;  4LLG M;  3VH4 B;  3Q3J A;  1E8Z A;  2DZK A;  1TS2 A;  3L4P A;  2MBO A;  2D5G A;  3NRZ A;  4TKN A;  3U4E G;  2XK5 B;  4FUL A;  1YQ4 B;  4IWQ A;  3AE6 B;  1MHH E;  2MBH A;  2XN9 C;  4PYU A;  3DVG X;  2YEP B;  2K6Q A;  2BVC A;  2M56 B;  2NBV B;  4XC2 A;  5IKC M;  4GDL A;  1PGX A;  3EUB 2;  1WGG A;  3VVW B;  4BKT A;  1M94 A;  3DHH C;  4EEW A;  3NS8 A;  1J7A A;  1EU4 A;  4KV2 A;  1JCK B;  1LXD A;  1N6Z A;  3M95 A;  1RM6 C;  5HKH A;  3ZTC A;  2KTF A;  1WYW B;  5LXH A;  3WCQ A;  2IO3 B;  2BS3 B;  1L4Z B;  4KDL B;  3AU5 A;  2UYZ B;  2L83 A;  4W9E A;  3N30 A;  3ML8 A;  1RFA A;  2FUH B;  4K7S A;  2LMC A;  2K22 A;  2GB1 A;  5DPT A;  2WYQ A;  4TQ1 A;  1J7C A;  3UF8 A;  2BB5 A;  2N9X A;  2EMS A;  5GXG B;  2RMM A;  2AL3 A;  2C9W B;  3ZW3 A;  2N1W A;  1N60 A;  2Z0D B;  5AUK A;  2KDI A;  1NBF C;  4ANV A;  4JL9 A;  1ACC A;  1E9M A;  2G3Q B;  3AE5 B;  1OTR B;  1SIF A;  2I1J A;  1TZO A;  1VR9 A;  4C56 C;  2KDF B;  4JPS A;  2KN4 A;  1TGZ B;  2KJH B;  4NAW B;  2D3C A;  1WF9 A;  3AE7 B;  1UZX B;  3S2A A;  2FUG 1;  4NQK E;  3PZ8 A;  2DEN B;  4DDI D;  2IBI B;  4HKQ A;  5IA7 A;  3NVW A;  4G50 A;  2GMI C;  3WAP A;  3AED B;  4ZDV A;  1GAQ B;  4PK1 A;  3VXW A;  3ML9 A;  1KLU D;  3TBL D;  2LJI A;  1TS3 A;  4IKG A;  5FR6 A;  1ZW7 A;  4UDU C;  3RNA C;  2WXK A;  5DPW A;  4IWO A;  4NJ6 A;  4KGR A;  2INP E;  1PDX A;  3EGR A;  2HJ1 A;  1ET6 A;  1YJJ A;  1KRH A;  3DCG A;  4WH4 A;  3HUI A;  1VD2 A;  2DAJ A;  1V81 A;  3DVN V;  4GMV A;  3U2S C;  3ZJU A;  1CJE A;  4KVG B;  4B6W A;  1A70 A;  3VR9 B;  1KM7 A;  2KOX A;  1TIF A;  2ZVO A;  5AUI A;  5LLI A;  4G0N B;  4IWP A;  2TSS A;  4ZYN A;  4XWT A;  5G2N A;  4DXF A;  3LXF A;  4ITK A;  2LGX A;  1YN4 A;  2X38 A;  1WFY A;  3TEW A;  2RPV A;  1UBQ A;  1D5Z C;  3VHT C;  4PYZ A;  4GB9 A;  1LFD A;  1L5P A;  1UH6 A;  1V80 A;  1TYG B;  1WXS A;  2WXN A;  5G5G A;  2QSD A;  4O1N A;  1M4V A;  3X23 A;  3ENE A;  4BVU C;  3PTF C;  1GB1 A;  3LYY A;  2K8C A;  4ZHO A;  1WM3 A;  3BYT B;  4ARI A;  2BQQ A;  3ZNH B;  1MPE A;  2N4F A;  3GS2 A;  4H2A A;  1AW7 A;  5IO9 A;  1VLB A;  3L0W B;  4US9 A;  2J4X A;  2ASQ A;  1V97 A;  2DLB A;  1SE4 A;  1TT5 B;  1WGH A;  3TEZ A;  5D3D A;  1FNV A;  3VRA B;  1Y56 A;  2H89 B;  3ZQ4 A;  1UGJ A;  1OQR A;  2WXG A;  2FBW B;  4BOS C;  2B76 B;  4BAX A;  5JXV A;  4MGY E;  5GMV A;  1EWY C;  2JF5 A;  5KHO A;  2WDT B;  3HRD D;  2KLG A;  4DHJ B;  4DQO C;  3QHT A;  1SE3 A;  3NVZ A;  3H7P A;  1C78 A;  1CQV A;  2KXJ A;  2BTE A;  3A9J A;  4MT5 A;  4FA6 A;  4A9A A;  2FCM A;  1HTO A;  3IHP C;  1C76 A;  2R2Q A;  4MH8 A;  1LGR A;  4KGT A;  3VRB B;  4J6I A;  1DGJ A;  4BKS A;  1I4P A;  4MEM A;  1WXQ A;  4US8 A;  2NBU A;  1V5O A;  2WHI A;  1C4P A;  4B0E A;  2KZR A;  2WX0 A;  2PE6 B;  1SIJ A;  1HXY D;  3N1Z C;  1SGH A;  1IGD A;  1I4R A;  3ZVV A;  3RNB C;  1H8C A;  5EDS A;  2LEK A;  1C4C A;  4C80 A;  3VDZ A;  2J0K A;  3Q3M C;  2NVU I;  2QJL A;  1FMA D;  2L05 A;  1ROE A;  1WXA A;  1L7Y A;  2MH7 A;  2BBC A;  1V9J A;  4B0M A;  1L6V A;  3CIR B;  1FM0 D;  2QMT A;  4AOF A;  1GB4 A;  4DXA B;  4HJG E;  4LJO B;  3FAH A;  1MHX A;  1K51 A;  2PE9 A;  4BBN F;  3RNE C;  4HCN B;  5BYR A;  1STE A;  2KFJ A;  4ZRQ A;  4FJZ A;  1NVI D;  1YX5 B;  2DZM A;  3QCA A;  1WZ3 A;  2ZPN A;  4WQO B;  5BMI A;  1XLP A;  3ECI A;  5AZF A;  4W9L A;  1G6J A;  2QIL A;  3ABV B;  4ZYS A;  4AUQ C;  2GBK A;  2ZNV B;  2V4L A;  5D94 A;  3MP9 A;  4GGQ A;  2PTL A;  2N0S B;  3L16 A;  1K52 A;  4HDQ A;  2DZI A;  2LXC A;  4RH6 A;  3BVM A;  2OED A;  4YTP B;  2LUE A;  3GZN B;  1YMH E;  4GOC A;  2MCN B;  2LUM A;  4WWM A;  2V1Y A;  3JSV B;  4HEA 1;  4Q2J A;  4OVU A;  1WZ0 A;  2KK8 A;  2N9K A;  1WM2 A;  4NZL B;  2FCN A;  3OJ3 A;  2LI5 A;  3PZ7 A; 
#chains in the Genus database with same CATH homology
 4AP4 C;  1E8Y A;  1UBI A;  4GDK A;  4E3C A;  3EC8 A;  3NY5 A;  5D2M B;  2NBW B;  3R7R A;  3PS6 A;  4URK A;  3VFK A;  3IG3 A;  2A4Z A;  4EZL A;  4LJP B;  2LRU A;  3DVN U;  4HVB A;  4EKU A;  3JYU A;  4WAA A;  3W1S C;  5JZE B;  3EFU A;  4A20 A;  2GOW A;  4ASW C;  3QC8 B;  2JWZ A;  1WRD B;  4LDT D;  4FLH A;  4RMA A;  3OLM D;  3KUZ A;  3RUI B;  3NOB A;  1TZ1 A;  2CU1 A;  1R4N I;  1V49 A;  3AU4 A;  3JSV A;  1KLV A;  3CF6 E;  4NJ7 A;  1GC7 A;  1QZE A;  3R7Q A;  3D32 A;  2BYF A;  3PRE A;  1P1A A;  2A5U A;  4HPM B;  5E6N A;  4DDG D;  3M62 B;  4K7U A;  1Q1O A;  3UIO B;  3X0W A;  4G3X B;  3A1Q B;  5C1Z A;  5JHA A;  4FBJ B;  4ANU A;  1GUA B;  1LQB A;  2RD0 A;  1E7U A;  5TR5 A;  1WJ4 A;  5DPR A;  2KD0 A;  2K8B A;  2LD9 A;  3VQI A;  2BWE S;  2K1F A;  3MTN B;  4F7Z A;  3A33 B;  3ONS A;  4CHK A;  1OQY A;  1WE6 A;  2AYO B;  1V86 A;  4IUM B;  4JGH B;  4CO7 A;  5JHB A;  5DPS A;  3WA0 A;  4EZK A;  4TV3 A;  2O2V A;  4MGK E;  4RM8 A;  1EUV B;  4BOZ B;  2LRW A;  2NCN A;  3VH4 B;  2G4S A;  4DBG A;  3Q3J A;  1E8Z A;  2DZK A;  1AAR A;  2MBO A;  4WJN A;  1FXT B;  2KC2 A;  4TKN A;  2XK5 B;  2MA9 B;  1RLF A;  4FUL A;  3QWZ B;  4IWQ A;  4IC7 B;  3ZRF A;  2BKF A;  2MBH A;  2C7H A;  4KDI C;  4B9K A;  3B1L X;  3QX1 A;  4PYU A;  3DVG X;  5JH5 C;  2KTR A;  2DYO A;  2KO3 A;  4MM3 A;  2K6Q A;  3U7D A;  1WE7 A;  2BKR B;  1C3T A;  2RGF A;  3A4R A;  5CHW A;  2L00 B;  2N7D A;  2CHX A;  4X57 B;  3VAW A;  2NBV B;  4XC2 A;  4MDK E;  1EO6 A;  1Y8R C;  1WXM A;  3VTW A;  3PRP B;  4GDL A;  4GU2 A;  3PPA A;  3L17 A;  5D6J B;  1IP9 A;  3RZF A;  1WGG A;  3VVW B;  2N1V A;  2BYV E;  3APC A;  1M94 A;  4BKT A;  4I6N B;  2BGF A;  4FAD A;  3B08 A;  2KQS A;  1WR6 E;  4EEW A;  3NS8 A;  1BT0 A;  3GZN I;  3W1S A;  3TCA A;  2O6V D;  2FID A;  2QHO A;  4KV2 A;  3UQA A;  4HCP B;  2O6V B;  3IBE A;  3K9P B;  1LXD A;  3M95 A;  4MSM B;  1WJ6 A;  5HKH A;  3ZTC A;  2KTF A;  1WYW B;  5LXH A;  2MP2 A;  4MJS A;  2IO3 B;  4LDT B;  5E6P A;  2CHW A;  3QJZ A;  2JXX A;  2YVC A;  2WWZ A;  3DBR I;  3ZNG C;  2L76 A;  2CS4 A;  1WGR A;  4KDL B;  2DZJ A;  1EF5 A;  4II2 B;  3KH0 A;  3AU5 A;  2IZV B;  4FHK A;  2LGD A;  4W9D A;  3V6E B;  2C5L C;  2UYZ B;  4W9E A;  3CST A;  3N30 A;  3SDL C;  1WI0 A;  4WJP A;  2IO1 B;  2KC1 A;  3LDZ E;  3ML8 A;  2C7M B;  2CKH B;  4GXB A;  1RFA A;  2IO2 B;  2FUH B;  4F8C B;  1YQB A;  4JQW C;  2HD5 B;  4K7S A;  3A9J B;  3CSF A;  2MSE D;  5CTR C;  5DPT A;  1P0R A;  3M3J A;  2WYQ A;  3Q3F A;  4TQ1 A;  3VUW A;  4A3P A;  1NI2 A;  2ZVN A;  3UF8 A;  3GOE A;  2N9X A;  2CR5 A;  2EMS A;  1RAX A;  2DAF A;  1WX8 A;  2AL3 A;  2C9W B;  2HTH A;  2O6V A;  3ZW3 A;  2N1W A;  2KHW B;  3H6N A;  4GN1 A;  3HK0 A;  1V5T A;  1WX9 A;  2FCQ A;  2KDI A;  2Z0D B;  4WWO A;  4ANX A;  1NBF C;  2KQ7 A;  3VTU A;  4ANV A;  2KKC A;  4ICV A;  4JL9 A;  1I35 A;  3WIM A;  3DQV A;  4W9I A;  2G3Q B;  2L7R A;  3DPD A;  3WAN A;  1YIW A;  3KUD B;  1OTR B;  4FHJ A;  4K81 A;  1SIF A;  3ZTD A;  3ZKJ C;  2I1J A;  2BYE A;  3UQB A;  2JRI B;  3R3M A;  3QA8 A;  3HM6 X;  2KVR A;  3KUC B;  4B95 A;  1E7V A;  4DHZ E;  2KDF B;  2OJR A;  1YX6 B;  1TGZ B;  2KJH B;  5C23 A;  1ISN A;  4NAW B;  4TQ0 A;  1WF9 A;  4HK2 A;  1UZX B;  3S2A A;  4GDK B;  4NQK E;  2L0F A;  2KTR B;  3W1Y A;  2DEN B;  4DDI D;  2IBI B;  3QIJ A;  1Q0W B;  5IA7 A;  3SD5 A;  4G50 A;  1NDD A;  2DYB A;  3CMM B;  4EUT A;  2GMI C;  3WAP A;  4NY0 A;  3KYD D;  1OEY A;  1LM8 B;  4ZDV A;  2GBJ A;  1RRB A;  4ZRI A;  4JIO U;  2D11 A;  4IM2 A;  3VXW A;  4TUU A;  3ML9 A;  3TBL D;  3A9K B;  2GBN A;  4IG7 B;  1C1Y B;  3PRM B;  3NZS A;  2KNB A;  5FR6 A;  2B3A A;  1D3Z A;  4FJV B;  4HDO A;  1ZW7 A;  2XBB C;  2L0T A;  1GNU A;  4KIK B;  2GBM A;  5DPW A;  1TBE A;  4IWO A;  4NJ6 A;  2HJ8 A;  1S1Q B;  2XK5 A;  2XEW A;  3APD A;  4HWI B;  2C60 A;  3PT2 B;  4WWP A;  5J2R A;  2DX5 B;  2ZCC A;  1KJT A;  3ALB A;  1ZKH A;  3DCG A;  1GG3 A;  1VD2 A;  2DAJ A;  1OGW A;  1V81 A;  3TJP A;  2PJH A;  2KWU B;  2J7Q B;  3I3T B;  3DBH I;  3DVN V;  3IFW B;  3L54 A;  4GMV A;  5DCN A;  3SHQ A;  4XZ4 A;  3U8Z A;  4F1S A;  2ZZP B;  5L83 A;  2BPS A;  4KVG B;  4B6W A;  2LVO A;  1KM7 A;  2KOX A;  4AWJ A;  3V61 A;  3RYT A;  2ZVO A;  3C0R B;  3PRZ A;  2LAS A;  4LCD E;  5LLI A;  4G0N B;  2M17 A;  4IWP A;  4ZYN A;  5G2N A;  4BKG A;  4FN2 A;  1U4A A;  1UGM A;  3B0A A;  2MRP A;  2NPT A;  2LGX A;  2KX0 A;  3T8M A;  3BIN A;  2KFK B;  4W9G A;  1WFY A;  1ZGU B;  2LVQ A;  3O65 B;  1UD7 A;  3NZU A;  1UBQ A;  3JVZ X;  5E6O A;  3RUL A;  2J0J A;  3VHT C;  3VH3 B;  2MBB B;  3KVF B;  4PYZ A;  3WAM A;  4GB9 A;  2JUO A;  3KW5 B;  1LFD A;  4AJY B;  1UH6 A;  2N9P C;  1V80 A;  2UWQ A;  4E71 A;  2MLB A;  2MP2 B;  2PEA A;  3MHS D;  4MJS B;  1WXS A;  2V3S A;  3H7S A;  3V6C B;  1XT9 B;  3H9D A;  2NS5 A;  2N7E A;  2KWV B;  2VRR B;  2Z59 B;  1IPG A;  2AWT A;  2KLC A;  4HPL B;  3PLV A;  3X23 A;  4ICU A;  3ENE A;  4KSL C;  2MQJ A;  3VTV A;  3ZIM A;  4BVU C;  3PTF C;  2KWC A;  1CMX B;  3HIZ A;  3QQ8 B;  2K8C A;  2D2Q A;  2ZNV C;  3PHX B;  1PQS A;  1WM3 A;  1UEL A;  2KDE B;  2ZEQ A;  1YD8 U;  2Y5B B;  4IM0 A;  4HJK A;  3ZNH B;  5J18 A;  2N4F A;  4KSK C;  2L3Z A;  1GJZ A;  2JY6 A;  2KAN A;  2LGY A;  3MJW A;  2R2O A;  2OOB B;  3L0W B;  4CYE A;  2G45 B;  2LZ6 A;  4KZC A;  3AI5 A;  3ZDM C;  5LXI B;  2ASQ A;  1R4M I;  1WGH A;  1WJU A;  2MX2 A;  4DHJ D;  2HE7 A;  1E8X A;  5AZH A;  4N9F 4;  4I6L B;  3UGB B;  5L95 C;  3EEC A;  3RT3 B;  2K39 A;  4ZRK A;  4PS7 A;  3HM3 A;  4BOS C;  1J0G A;  1E8W A;  1GC6 A;  3BY4 B;  1YJ1 A;  4NQL B;  3H1U A;  3ZO5 B;  4MGY E;  5GMV A;  3A9K A;  2DYM A;  3QAQ A;  2JF5 A;  2M0X A;  2KMA A;  5KHO A;  1S3S G;  2AL6 A;  2FIF A;  2WDT B;  2ZJD A;  4WJQ A;  1WIA A;  2KLG A;  4DHJ B;  1XD3 B;  2KN5 A;  3QHT A;  2O2V B;  4W9K A;  4DK5 A;  2NR2 A;  1SE9 A;  3H7P A;  1WGY A;  3U30 A;  2KXJ A;  2JRH A;  2LVP A;  2RSU A;  3AUL A;  1E5W A;  1VCB A;  3A9J A;  5CX3 A;  4XX5 A;  5G55 A;  4GIV A;  1WMH B;  3DDC B;  4MSQ B;  4FA6 A;  4IM3 A;  5D7G A;  2FAZ A;  2M4N A;  1WJN A;  2FCM A;  3IHP C;  2R2Q A;  1V6E A;  3A1Q A;  3PSE B;  3PVL A;  3APF A;  4J6I A;  1P98 A;  2NPT B;  3TIX A;  1WY8 A;  3SU8 X;  2RPQ A;  1WGD A;  4K1R B;  4K7W A;  4MH0 E;  4BKS A;  4MEM A;  3T9L A;  2NBU A;  1V5O A;  3N3K B;  3K9O B;  2BWF A;  5IAA C;  3V62 A;  3PZD A;  4BKS D;  2IY0 B;  2BF8 B;  2KZR A;  3OAW A;  3ZNZ B;  5BO4 B;  4IW0 A;  3DBL I;  5KHQ A;  2WX0 A;  2PE6 B;  4WJO A;  1Z5S B;  3OJ4 B;  1SGH A;  1J19 A;  2L8J A;  2JZ3 B;  2MW5 A;  1F9J A;  2K6D B;  4WWN A;  2KJR A;  3ZVV A;  4NAW A;  1WXV A;  1WH3 A;  4BBN C;  2C7N B;  5EDS A;  1H8C A;  4DWF A;  3PLU A;  3VDZ A;  1WMH A;  2M8S A;  3KYC D;  3TMP B;  2J0K A;  2MWS B;  4W9F A;  2M1M A;  3NHE B;  1IYF A;  1X1M A;  3RCZ A;  3PGE A;  2NVU I;  2JZZ A;  2L05 A;  5CHF A;  1WXA A;  1Z2M A;  3IVF A;  3ZUN A;  4FJY A;  1L7Y A;  2DHZ A;  3UIP B;  4PS8 A;  3AXC A;  1V9J A;  3VUY A;  4M0W B;  1H4R A;  1OEY J;  3HHM A;  3UIN B;  4AOF A;  1P9D U;  3QK0 A;  4DXA B;  2W9N A;  3R66 C;  4LJO B;  2FNJ B;  3PHW B;  2IO0 B;  3P2B A;  2PE9 A;  3ZRC A;  4A3O A;  4MGI E;  4BBN F;  4M8M A;  3WAO A;  4GSW A;  4HCN B;  2JT4 B;  3ZDT A;  2ZPY A;  2KFJ A;  5AEK B;  4YL8 A;  4ZRJ A;  4FJZ A;  4KZ0 A;  4RM9 A;  3VUX A;  3QAR A;  3H7P B;  1V2Y A;  2RR9 A;  1MG8 A;  1P3Q U;  2D3G A;  2LWP A;  2LJ5 A;  1T0Y A;  1YX5 B;  2DZM A;  2PPH A;  2KFK A;  2Z0E B;  4AJW A;  1WR1 A;  3QCA A;  1WZ3 A;  2ZPN A;  4WQO B;  2MBQ A;  4PS3 A;  4MEL A;  3WAL A;  1I42 A;  3ECI A;  4G11 A;  5AZF A;  4W9L A;  4NPN A;  1G6J A;  1L2N A;  4JLC A;  3M63 B;  2KJ6 A;  4GDL B;  4AUQ C;  2LXA A;  2GBK A;  2CHZ A;  2KX3 A;  3DOW A;  2IYD B;  1KOT A;  2ZNV B;  3LJ3 A;  4E74 A;  2N9E B;  4I6P A;  4W9C A;  3TL5 A;  1EF1 A;  1WX7 A;  1Q5W B;  2EKE C;  2V4L A;  5D94 A;  2YLM A;  3V60 A;  4GGQ A;  2EMT A;  4P7I A;  5AZG A;  3DBS A;  3RZW C;  4EZJ A;  1K8R B;  2J0M A;  1HE8 A;  3L16 A;  2AEH A;  2D07 B;  4HDQ A;  3PV1 A;  2DZI A;  2G4D B;  4W9J A;  2JVC A;  2LXC A;  4II3 B;  4DHZ B;  2D10 A;  4BFR A;  4EFO A;  2REX A;  1E90 A;  3JW0 X;  3L08 A;  3DVG Y;  4M8N A;  5J17 A;  1JRU A;  2MBE A;  4HLE A;  3N32 A;  4KIK A;  1J8C A;  1A5R A;  2LUE A;  4MGZ E;  2WX1 A;  3RD2 A;  2I1K A;  2FCS A;  4GOC A;  4OVV A;  2K8H A;  4EOY A;  2MCN B;  3ZNI D;  3A4S C;  2GBR A;  2ZCB A;  3L10 B;  2V1Y A;  3JSV B;  4ANW A;  2JPH A;  2K25 A;  4NNJ B;  3ZLZ A;  4OVU A;  3L13 A;  1WZ0 A;  2KK8 A;  1TTN A;  1WM2 A;  4HXD A;  4W9H A;  2FCN A;  3OJ3 A;  5CHV C;  2LI5 A;  1XQQ A;  2IY1 B;  3EHV A;  2KMC A;  2KDB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...