3WANA

Crystal structure of atg13 lir-fused human lc3a_2-121
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
126
structure length
126
Chain Sequence
DDFVMIGSPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Autophagy-related protein 13, Microtubule-associated protein
publication title Structural basis of the autophagy-related LC3/Atg13 LIR complex: recognition and interaction mechanism.
pubmed doi rcsb
source organism Homo sapiens
total genus 34
structure length 126
sequence length 126
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3wanA00
4NPNA 2C7NB 3PPAA 4NQKE 3ZDMC 4GMVA 1YQBA 3PHXB 1LFDA 1RRBA 2KVRA 3IFWB 2A5UA 2K8HA 1EO6A 4ZYNA 3SHQA 3RUIB 4HXDA 2QHOA 5J18A 1JRUA 2KX0A 5DPWA 1E8WA 2VRRB 4MJSB 4CHKA 2NBUA 3HM3A 2L8JA 2LWPA 2XBBC 4FHJA 4N9F4 4KSKC 1P98A 1WR1A 1J8CA 3VFKA 4P7IA 3Q3JA 2IO0B 2K8CA 3ENEA 4GDKA 4FJVB 4WWOA 3N3KB 4GDLB 4ANVA 2LRWA 3JSVA 5IAAC 3PZDA 5JH5C 3PLVA 4MGZE 2LVQA 4OVVA 2JT4B 1TGZB 3QK0A 3UQBA 5KHOA 3A1QB 2L00B 1WZ0A 3ZRCA 4W9FA 1D3ZA 2XK5B 2M1MA 1WE6A 2BPSA 2C7HA 3ML8A 3APFA 2J7QB 4AWJA 2NBVB 2W9NA 2DAFA 2GBJA 2IY0B 3VH3B 2AL6A 4BBNC 3MTNB 3DDCB 3N32A 5AZHA 4ANUA 2Z0DB 2ZPNA 3A9KA 4DBGA 4W9GA 2FAZA 3TBLD 3DOWA 2MW5A 5CHWA 3H7SA 3ML9A 3PLUA 4GB9A 2K6DB 2D10A 2MX2A 4BKSA 4DK5A 2JUOA 3PV1A 2DYOA 2RPQA 4KSLC 2MBHA 5D2MB 3WAMA 3H7PB 4HCPB 2CHXA 3IG3A 4CYEA 3OAWA 4HDQA 1WGHA 3X0WA 2D3GA 1E90A 2BYFA 1IP9A 3C0RB 3NY5A 2ASQA 4K81A 1V81A 1MG8A 3ZRFA 3ZVVA 2ZEQA 3W1SC 1WGDA 2LGXA 4I6PA 5CTRC 3U7DA 1PQSA 1SE9A 3M3JA 4KIKB 3RYTA 4E71A 4FA6A 3T9LA 2N9PC 4W9JA 3WANA 3EC8A 3U30A 3RD2A 4BVUC 3APCA 3ZO5B 2LVOA 4ASWC 3KH0A 2JRHA 2M8SA 5KHQA 3L10B 4DDGD 1WXMA 2AWTA 2OJRA 3SD5A 2KKCA 2LVPA 4FLHA 2B3AA 4IWQA 3AU5A 1EF5A 1WXVA 1WJ4A 4HCNB 4GXBA 4W9DA 4AOFA 2FIFA 2NCNA 3CSTA 2JVCA 2NPTB 4TQ0A 3RULA 2KX3A 4ZRKA 1YX5B 2CS4A 3L0WB 5D6JB 3A4SC 3DBLI 1KOTA 4MGIE 4PS8A 2KMAA 2KC1A 2MSED 3JW0X 3D32A 1P0RA 4XZ4A 5LXHA 4KVGB 2MP2B 2IBIB 2NR2A 3JYUA 2KFKB 1EF1A 3QC8B 3L08A 5DCNA 3QA8A 2EMSA 3T8MA 1XD3B 5LLIA 3RZWC 2KTFA 4G3XB 3ZUNA 4FN2A 2KDBA 1H8CA 1WR6E 2IO1B 3NS8A 1E7VA 2ZNVB 4FJYA 2V3SA 2LXCA 3UIPB 3DQVA 1OEYA 3U8ZA 5C23A 4M0WB 4W9CA 4ICVA 4W9HA 2LJ5A 3V62A 4MJSA 1I42A 4II3B 1BT0A 3M95A 2Z0EB 4URKA 4K1RB 1Q0WB 4XC2A 1L7YA 2AL3A 4K7SA 2OOBB 2KLCA 3PSEB 3UIOB 3PGEA 2KJHB 2I1KA 1AARA 2MQJA 3ZDTA 1C3TA 2AEHA 4GDLA 2LGYA 3KUCB 1LXDA 3B08A 1GG3A 1QZEA 2HTHA 3BINA 3A1QA 2Y5BB 3IHPC 4AJYB 2XK5A 5DPTA 3PREA 2HE7A 2N9XA 3AULA 4W9LA 4WJQA 3GOEA 1OEYJ 3VAWA 5JHAA 2BWFA 3SU8X 3EFUA 1UGMA 2ZJDA 5CHFA 4E74A 2REXA 2LD9A 4MSQB 4W9EA 2O6VA 2FCSA 4DXAB 3QHTA 1ZW7A 3A9JB 2GMIC 2KK8A 5AZFA 5AEKB 2ZVOA 5L95C 2FCMA 1EUVB 5J17A 3AI5A 3H7PA 2R2OA 4PYUA 4AUQC 1ZGUB 1L2NA 4KDLB 1WRDB 4IWOA 2KDFB 3RZFA 2J0JA 1WM2A 2L0TA 3R3MA 3DVNV 3QIJA 1KLVA 1UH6A 3RT3B 2IO3B 2WX0A 1KJTA 3WIMA 1WY8A 4KDIC 3ZIMA 4MSMB 4EKUA 1YX6B 4WAAA 1OGWA 4KIKA 3ZNZB 5CHVC 3PRMB 3ZTCA 3L16A 3P2BA 4CO7A 1RAXA 4EZKA 2C5LC 3MJWA 1GC7A 4GN1A 4BBNF 3KVFB 3APDA 4M8NA 4FBJB 1GC6A 3TJPA 4IM2A 4BKTA 3ZNGC 3L17A 3V61A 3VH4B 3DBRI 3QARA 2O6VB 5HKHA 3NZUA 3UINB 4A20A 3AXCA 2WYQA 2PE9A 1M94A 4JLCA 1VCBA 2L76A 1C1YB 4KV2A 2KFJA 4RM8A 2FCNA 5DPSA 2DZKA 3QJZA 4EUTA 2BKRB 4GU2A 4PS7A 4BOSC 2NPTA 4ZRIA 2BYEA 4TQ1A 1XT9B 3VVWB 3W1YA 4K7WA 3UF8A 3ZNHB 2WDTB 3ZTDA 2G45B 3VUWA 3X23A 2KNBA 2UWQA 2IYDB 4RMAA 2MP2A 1V86A 1WH3A 2N7DA 2JF5A 2YLMA 2K25A 2EKEC 3DCGA 3DVGX 3QAQA 2KFKA 3PS6A 2BWES 1YIWA 4DDID 2O6VD 5C1ZA 2KWCA 1V80A 1S3SG 3VHTC 2AYOB 4MM3A 4NNJB 1J19A 3NHEB 1Z2MA 4DHJB 1P3QU 4DWFA 4MH0E 1NBFC 4J6IA 4LDTB 4LCDE 4EOYA 2UYZB 3L54A 4WQOB 1TTNA 4JQWC 3DPDA 2LGDA 4MEMA 4I6NB 3UQAA 1IYFA 1WMHB 3TMPB 2N7EA 3V60A 1GNUA 2MBOA 1WXSA 2ZPYA 4NAWB 4WWNA 4WJPA 1WGYA 3PVLA 1NDDA 1GJZA 1VD2A 3HHMA 3H1UA 2D2QA 2YVCA 3I3TB 4DHJD 4BOZB 1FXTB 3ONSA 2BKFA 4MGYE 5JZEB 4LDTD 3CSFA 4ZDVA 3UGBB 1WXAA 3AU4A 5D94A 2WX1A 4G11A 4MDKE 4NY0A 2K39A 4EZJA 1Y8RC 2NBWB 3TIXA 2FCQA 1TBEA 2DYBA 2MA9B 5IA7A 1R4MI 4HVBA 2MBEA 1UBQA 2CHWA 3HM6X 3K9PB 4EEWA 4PS3A 4HDOA 1RLFA 5D7GA 3PRZA 2RGFA 3A9JA 3GZNI 2D11A 1Z5SB 4A3OA 1P9DU 1R4NI 2N4FA 2PPHA 1X1MA 2MBBB 3M62B 4HK2A 1WF9A 3TCAA 3NOBA 2JPHA 4KZ0A 2DYMA 3VQIA 3CMMB 2L3ZA 2MWSB 1V5OA 3VTWA 5E6NA 4JL9A 4EZLA 1UBIA 1P1AA 1YD8U 4IM3A 2M17A 3M63B 5BO4B 3PRPB 2KN5A 4AP4C 1U4AA 1SIFA 3OJ4B 3R7RA 4NJ6A 2LZ6A 2DZJA 2IO2B 3EHVA 3VDZA 2FIDA 3H9DA 4HJKA 2KQSA 2KJRA 3EECA 4HWIB 3ZNID 1J0GA 2GBRA 1NI2A 3HIZA 1V6EA 3R7QA 4TKNA 2LXAA 2G3QB 3WAOA 3PHWB 2PJHA 2O2VB 1K8RB 1E8ZA 2K6QA 2KHWB 4JIOU 2LI5A 1Q1OA 4HPLB 3WAPA 4B6WA 2J0KA 2N1WA 2Z59B 3LJ3A 2JWZA 2MCNB 3ALBA 4LJPB 2C9WB 1E7UA 3V6EB 4KZCA 1F9JA 2JZ3B 1WFYA 2PE6B 4MGKE 2ZVNA 4E3CA 4FADA 1WJUA 4PYZA 2XEWA 3IBEA 2JZZA 3L13A 4K7UA 2ZCBA 4IWPA 1I35A 2KMCA 3ZW3A 3JVZX 2PEAA 3VTVA 4G0NB 4B9KA 4WJOA 4TV3A 3VUXA 3ZLZA 4HLEA 1HE8A 2KD0A 2LRUA 5GMVA 5G55A 2IY1B 5G2NA 3KYCD 4X57B 2IZVB 2KDIA 1WM3A 4WWPA 5L83A 2CKHB 3LDZE 3ECIA 1T0YA 4B95A 2BYVE 1SGHA 4LJOB 3QX1A 4GIVA 2HJ8A 1OQYA 2KTRB 2A4ZA 5LXIB 2ZNVC 1WGRA 1LM8B 2DZMA 4IUMB 3A4RA 4W9KA 2KXJA 2RSUA 1WMHA 2KQ7A 4HPMB 4F8CB 2R2QA 5J2RA 2WWZA 4F1SA 1WZ3A 3HK0A 3DBSA 2HD5B 4FULA 4IC7B 4NAWA 2G4DB 2RD0A 1XQQA 5EDSA 1OTRB 4YL8A 3K9OB 3Q3FA 4RM9A 1S1QB 2JY6A 4DHZB 2V1YA 3QWZB 4EFOA 4ANXA 1WX8A 3RCZA 4IG7B 2KO3A 3B1LX 3TL5A 2C60A 1IPGA 2K1FA 1WGGA 5DPRA 4GOCA 4ZRJA 4FHKA 3OJ3A 5E6PA 4GDKB 4GSWA 3WA0A 3BY4B 1G6JA 2DENB 3S2AA 3JSVB 4NQLB 2JXXA 2KLGA 2G4SA 1WJNA 1WYWB 2D07B 1V49A 3KYDD 2MBQA 3WALA 4II2B 1KM7A 1ZKHA 4F7ZA 4ICUA 4OVUA 2JRIB 3CF6E 3PT2B 1UD7A 4IM0A 4AJWA 1WJ6A 3B0AA 3A9KB 2KOXA 4WJNA 3IVFA 3MHSD 1WIAA 3A33B 2DAJA 2K8BA 4TUUA 3ZKJC 2KDEB 2J0MA 2NVUI 4W9IA 4M8MA 5TR5A 5JHBA 3KUZA 2GOWA 2KWUB 3DBHI 5FR6A 1UZXB 2GBKA 3DVGY 1A5RA 3KUDB 2ZCCA 1Q5WB 1WE7A 2DZIA 2KJ6A 2NS5A 3NZSA 5CX3A 1V5TA 5E6OA 2EMTA 2O2VA 2GBMA 2KC2A 2FNJB 2M0XA 2KWVB 2DX5B 2MRPA 4FJZA 3W1SA 1E8YA 1WX7A 2BF8B 2RR9A 4I6LB 2CU1A 2V4LA 3N30A 4BFRA 1RFAA 3KW5B 4BKSD 2KZRA 1H4RA 2LUEA 1WX9A 3O65B 2GBNA 1E8XA 3V6CB 5AZGA 3OLMD 4BKGA 2CR5A 1YJ1A 1CMXB 4A3PA 3DVNU 1UELA 2DHZA 4NJ7A 4XX5A 2CHZA 3VXWA 1TZ1A 4GGQA 1V9JA 4ANWA 4DHZE 2LASA 1LQBA 2KTRA 2N1VA 3QQ8B 2L0FA 2L05A 4MELA 1E5WA 3PTFC 2FUHB 4G50A 2I1JA 1V2YA 3SDLC 3VTUA 2ZZPB 1GUAB 2C7MB 2KANA 3R66C 2N9EB 1ISNA 3QCAA 3VUYA 2L7RA 2MLBA 1WI0A 3H6NA 4JGHB 4IW0A 2M4NA 2BGFA
chains in the Genus database with same CATH superfamily
1T5XD 4GMVA 1LFDA 4ZYNA 4OZAA 4HXDA 4WH4A 4MJSB 2NBUA 2XBBC 2VZKB 4N9F4 3W5VB 2RPVA 1FPYA 1ZE3D 2K8CA 4GDKA 2IJ0A 2LRWA 3AE4B 2LVQA 3UQBA 2JT4B 3QK0A 5KHOA 1ZP0B 1WE6A 3APFA 4HKQA 4AWJA 2WXPA 3AN1A 3DDCB 4HRSA 1C9FA 2Z0DB 1ZXIA 4NAMA 4RF0A 2FAZA 1P7FA 1ET6A 3Q8FA 2MW5A 5CHWA 3ML9A 2XN9C 2D10A 2MX2A 2JUOA 1R4MB 1XLQA 2MBHA 5D2MB 3WAMA 2M19A 4H2AA 3H7PB 2YEPB 1ET9A 2VH2A 3IG3A 3OAWA 2KT7A 2D3GA 4TMAB 2Y5CA 5H92C 1N61A 3BYYB 3EGRA 4KIKB 4E71A 3RYTA 4FA6A 2W82A 1ROEA 3Q69A 3APCA 1C4AA 3NVWA 2J52A 2I2YA 1ZUD2 2JRHA 1WYGA 5BMGA 4LNNA 2INCC 3W2DA 1WJ4A 4AOFA 1FM0D 4WIPA 3C8YA 1FNWA 2DBYA 2CS4A 3A4SC 3DBLI 1KOTA 4AS1A 4XZ4A 3NVVA 2MP2B 2IBIB 4N6EB 3ZUNA 2KDBA 1WR6E 2ACZB 2ZNVB 1Y56A 1SSNA 3V62A 4MJSA 1I42A 1CZPA 2BS2B 1BT0A 3CIRB 4K3BA 5H8YE 1L7YA 3PGEA 4HEA1 1FFVA 2TSSA 3B2GA 3WCQA 3B08A 2HTHA 1QZEA 2W3SA 2Y5PA 4AJYB 2WQYB 5DPTA 4RGTA 3V05A 4A9AA 4DXFA 1V8CA 2OHFA 3AH7A 1UGMA 4WQMA 4E74A 2LD9A 4MSQB 2Y3AA 2O6VA 4DXAB 3DHGC 2GMIC 2KK8A 5AZFA 1C4CA 3DHIC 2FCMA 5J17A 3N1ZC 3AI5A 3H7PA 3RNCC 2KQ4X 3VR9B 2J0JA 1WM2A 3Q14C 4A8XC 3DVNV 1I4PA 4MSMB 4Q2JA 1YX6B 2PIAA 2WNMA 4KIKA 3RNEC 1RAXA 3B9JA 3MJWA 1GC7A 4RFBA 1TJEA 2INDC 4FBJB 3FILB 3V61A 1VR9A 3DBRI 5HKHA 1JQ4A 2IGDA 4RM8A 5AUIA 5DPSA 1ESFA 4BOSC 3N1YC 1R4NB 2PVGC 1QLBB 2IYDB 2MP2A 1V86A 3SEBA 3DVGX 2EKEC 3QAQA 2BWES 2MJ3A 2O6VD 2KWCA 1V80A 4YSXB 1KLUD 4OZCA 4MM3A 4NNJB 1P3QU 4EOYA 1JWUD 2UYZB 5MPOA 1N63A 3L54A 1LGRA 4I6NB 4PK1A 4XYCA 3UQAA 3TMPB 2N7EA 4B0EA 3Q3NC 2D5GA 2CJOA 1OQRA 3MHZA 3PVLA 3C19A 1GJZA 1VD2A 5AUKA 1RYJA 2BW2A 3BIID 4LDTD 3U2SC 1WXAA 5D94A 2KN4A 5G5GA 1JROA 3TIXA 3EA6A 1TBEA 3R2IA 2MA9B 5IA7A 3GP7A 1E6EB 2IGGA 1TY0A 4EEWA 4J3OD 1RLFA 1D6EC 3N1XC 1Z5SB 1WF9A 2B76B 5GXGB 2VH1A 4KZ0A 1ZPSA 4PT5A 1V1OA 2LMCA 1UBIA 4S0RA 3M63B 5FK9C 4YTNB 2X8XX 4O1NA 4A55A 3Q3MC 2LZ6A 1HTQA 3BVZA 1QOBA 2FIDA 3H9DA 3E9SA 3ZQ4A 2KJRA 2K5PA 3EECA 3W5UB 2RDBC 3HIZA 4TKNA 3FILA 1YQ3B 2O2VB 1KLGD 3ZGZA 1K8RB 2K6QA 3NVZA 1HEZE 2IDYA 3P4RB 1IBXB 2J0KA 2Z59B 3LJ3A 5BMHA 1E7UA 3V6EB 1F9JA 2PE6B 4E3CA 3L13A 4IWPA 1XEEA 4WJOA 1BXTA 4HLEA 2LRUA 3T3OA 3ECIA 1T0YA 1YMHE 4LJOB 3QX1A 1MI0A 4GIVA 1WGRA 3DWGC 2HJ1A 3DBHB 4ARCA 1GAQB 4BZAA 4W9KA 2RSUA 1CJEA 5TSSA 4A90A 4F8CB 4DQOC 1OTRB 4YL8A 4RM9A 5EE1A 2WDRB 4ANXA 2KO3A 1I4GA 5DPRA 4GOCA 4P1CC 1YJIA 3OJ3A 5E6PA 1XF5L 1V97A 2JXXA 2KLGA 5BYSA 1WJNA 2D07B 1V49A 3KYDD 3WALA 4JPSA 2JRIB 1UD7A 1WJ6A 1TKEA 1XCTL 1FFUA 3B0AA 1N5XA 2BS4B 1WIAA 3ZKJC 4USAA 5JHBA 1PYWD 1SE3A 3OWEB 4ZRQA 2KWUB 2LJIA 1F2RI 1XLPA 3DVGY 3N9YC 1VDVA 1WE7A 2O2VA 5JXVA 1N60A 1IBXA 1RM6C 2DX5B 4FJZA 3W1SA 2BB5A 2CU1A 2V4LA 4BFRA 1HZ6A 2GBNA 1SE2A 2XNAC 2YEPF 4NZLB 1UELA 4YT0B 1SF0A 1TZ1A 1YN5A 1EWCA 1GPXA 4GGQA 1V9JA 1TZOA 2WHIA 4YSYB 4FXCA 2L05A 2FUHB 1C78A 2M0AA 1ISNA 3QCAA 3VUYA 2L7RA 3EFCA 4JGHB 2SEBD 3J9CA 3PHXB 2KVRA 3IFWB 1EO6A 3SHQA 3RUIB 2QHOA 2QIEB 1JRUA 2KX0A 5DPWA 2VRRB 2G1EA 4WWMA 4CHKA 3HM3A 1XLOA 1ZXHA 4KSKC 4LTUA 3VFKA 3Q3JA 2IO0B 4WWOA 4GDLB 2L52A 3PZDA 5JH5C 3PLVA 2EELA 1TGZB 3A1QB 1IGDA 1WZ0A 2BPSA 2C7HA 3ML8A 4REZA 2NBVB 2DAFA 2IY0B 3MTNB 3N32A 2G9HD 5I4DA 4W9GA 3IT6B 1DOYA 3TBLD 3DOWA 3H7SA 1VZ8A 4JWSC 3PV1A 2DYOA 2RPQA 4KSLC 3NJTA 4OZBA 2CHXA 3R8BA 4R3DA 4LNFA 1WGHA 1MG4A 2BYFA 3NY5A 3NS1A 2ASQA 4K81A 3ZVVA 3AE8B 1AN8A 1E10A 4W9JA 3EC8A 2JYTA 3RD2A 2QDFA 3KH0A 2M8SA 1L6VA 3L10B 4DDGD 4RNAA 2OJWA 2LVPA 4FLHA 2B3AA 3AU5A 1N62A 4GXBA 3LXFA 1QT9A 4W9DA 2LFIA 2JSVX 2FIFA 3CSTA 4ZHOA 4JWUC 4TQ0A 3RULA 1SE4A 4YTMB 5D6JB 1HZ5A 4MGIE 5LXHA 2KC1A 2MSED 3D32A 4CQNA 1C79A 3JYUA 1FCLA 1JWMD 1XD3B 2LEKA 3AEFB 4G3XB 2JXTA 3NS8A 2WU5B 4XDCA 2V3SA 1OEYA 3U8ZA 5C23A 4ICVA 2LJ5A 4K3CA 4II3B 3M95A 2WXHA 4K1RB 4XC2A 4QAYA 1TS3A 3UIOB 5LNK1 3AECB 1F1HA 2MQJA 4C7YA 4XDDA 4GDLA 4ZRPA 1LXDA 3A1QA 2Y5BB 4M01A 2ICIA 2AQ2B 2HE7A 4MT5A 1OEYJ 3VAWA 3SU8X 3EFUA 2E3TA 2BS3B 2GB1A 1SXTA 1SJHD 4W9EA 3KQ4A 2LUMA 2FCSA 1ZW7A 1ACCA 2WXQA 2ZVOA 2R2OA 3AM9A 4AUQC 1L2NA 4KDLB 4IWOA 2PW9A 3TEXA 2L0TA 4XWTA 1N6ZA 2V9HA 5C3JB 1KLVA 3RT3B 2WX0A 3WIMA 5T8IA 2DWQA 4KDIC 3ZIMA 4EKUA 1I4HA 4WAAA 1OGWA 3U52E 3ZTCA 3L16A 2C5LC 1NEKB 4BBNF 1XLNA 3KVFB 1NENB 3SR6A 3KLSX 3QARA 2O6VB 1P7EA 3UINB 3AXCA 1PGAA 1M94A 4JLCA 1VCBA 2L76A 4KV2A 3ZJUA 2KFJA 2V3NA 4PS7A 2BYEA 4K7WA 3ZNHB 3ZTDA 2G45B 3VUWA 3KWVA 4RMAA 1WH3A 2N7DA 2K25A 4KGRA 2HTME 3KWLA 2JX5A 1Z2MA 4HJGE 1K50A 4DWFA 1NBFC 4LDTB 4LCDE 4WQOB 1TTNA 1AYFA 2LGDA 3DHHC 4MEMA 1TT5B 1IYFA 2H88B 1UGJA 2M56B 3V60A 4RH6A 2ZPYA 1PGBA 1NDDA 2INNE 3RI7C 4BAXA 2D2QA 3I3TB 4DHJD 4BOZB 4MGYE 3MJ5A 1D5ZC 1KF6B 2WX1A 4JX1C 2QCZA 2NBWB 2FCQA 2DYBA 4MM3B 4HVBA 2MBEA 1UBQA 3AEDB 3HM6X 2D3CA 1QF6A 4P6VF 4HDOA 5D7GA 2LHEA 2RGFA 3ZJTA 4A3OA 1R4NI 2N4FA 2PPHA 1UF0A 4JE3B 3TCAA 3NOBA 3TUOA 2JPHA 1E9MA 2Q5WD 3VQIA 1V5OA 3VTWA 4D2KA 2M17A 3OG5A 4AP4C 3R7RA 4NJ6A 4US9A 1UWXA 2DZJA 4RGOS 3VDZA 2BYTA 4IKGA 1N5WA 1NI2A 3R7QA 3UI3A 5IOIA 2PJHA 3NRZA 1E8ZA 2KHWB 4JIOU 2WXIA 1YN4A 2LI5A 3ZJVA 3WAPA 2JWZA 4KZCA 2JZ3B 1WJUA 1GOZA 2JZZA 4K7UA 3ZW3A 2AQ3B 5GMVA 2KYWA 2W55A 3MFGA 3R2TA 4WWPA 2FE8A 4P1BC 1OQYA 2A4ZA 2WXFA 5LXIB 1NYRA 3A4RA 3AEEB 2KXJA 2KQ7A 5J2RA 1WZ3A 3N20C 4FULA 4KGTA 1B1ZA 3B2FA 4IC7B 2G4DB 2RD0A 3DBLB 1DOIA 1S1QB 1MJDA 2KMMA 1SJED 1HQRD 2V1YA 3RCZA 4IG7B 2WXMA 3B1LX 2C60A 1LO5D 4GSWA 1PUTA 1G6JA 3JSVB 1L0YB 2W54A 2WDQB 1ZOYB 1KM7A 4F7ZA 3CF6E 1CK1A 1PFDA 3A9KB 4WJNA 3IVFA 3MHSD 2FUG1 2JQRB 2K8BA 1A70A 2KDEB 2J0MA 2NVUI 2GLSA 1RWSA 3DBHI 5FR6A 1A5RA 3BK2A 3KUDB 4OVZA 1Q5WB 2KJ6A 2WP9B 4N59A 5E6OA 2EMTA 1QOFA 1E8YA 1WX7A 2BF8B 3IAM1 1IUEA 4BKSD 1KH0A 1L0VB 1WX9A 3O65B 4ITKA 3OLMD 4C56C 4GLSC 2CR5A 4RGMA 3DVNU 1YOVB 2D3BA 4XX5A 2CHZA 4ANWA 2LASA 3AEAB 4MELA 2BVCA 3DBRB 5FR3A 1WXQA 3AE7B 1Q10A 3GE8C 2ZZPB 2X38A 4XGAB 3RNFC 2L32A 2ONQA 3H6NA 1JWBD 3HVDA 2BGFA 3PPAA 2J53A 2SAKA 4NQKE 1YQBA 1RRBA 2K8HA 1GB1A 3LB8C 2ON8A 5J18A 1E8WA 2L8JA 4FHJA 1P98A 1WR1A 4P7IA 3U7ZA 4C00A 3ENEA 3N3KB 4ANVA 3DWMA 3JSVA 3Q8BA 1T0QC 5IAAC 4MGZE 4OVVA 4KKIA 2L00B 2XK5B 2M1MA 1FNVA 2GBJA 3VH3B 4ANUA 4L23A 2ZPNA 1CQVA 4RF1A 4YSZB 3A9KA 4DBGA 1RFKA 3PO0A 1F0ZA 5IO9A 3PLUA 2K6DB 4DK5A 2KAJA 2LGSA 4ZHPA 3C0RB 2BB6A 1V81A 2LGXA 4I6PA 5CTRC 1PQSA 1SE9A 2IGHA 2L83A 2PVOD 3U30A 1OFFA 4BVUC 2OEDA 3FAHA 3ZO5B 1L6UA 4ASWC 2N9LA 5KHQA 1WXMA 3SD5A 2V4IB 1EF5A 4HCNB 1FD6A 2WS3B 2WGSA 1MVKA 3NG0A 1HXYD 2JVCA 1I7HA 2KX3A 2CU3A 1YX5B 3RFZB 1FXIA 2WXOA 4PS8A 2KMAA 1F2RC 3JW0X 4KVGB 1FMAD 4US8A 2KFKB 1EF1A 5DCNA 1TY2A 4KKJA 3LYYA 2WXKA 5LLIA 2KTFA 2ZW1A 4FN2A 3VRAB 2IO1B 1E7VA 2LXCA 4M0WB 4W9CA 3Q8EA 4W9HA 4YXDB 2Z0EB 4URKA 1Q0WB 4LLGM 1BMLC 4K7SA 2OOBB 3PSEB 2KJHB 2I1KA 2LGYA 3T3NA 1E7PB 3KUCB 3IHPC 2QJLA 2XK5A 3PREA 2N9XA 3Q8AA 2KACA 3GOEA 2BWFA 4RGNA 2ZJDA 2REXA 4ZYSA 2WXRA 3QHTA 3A9JB 5AEKB 2JWUA 1F77A 1IGCA 3Q6BA 2D3AA 1WWTA 2KDFB 1FO4A 1WY8A 4OHJA 3MC0B 4AQ7A 1YQ4B 5CHVC 2K9XA 3PRMB 1WRIA 3P2BA 4CO7A 4EZKA 2Z8LA 4GN1A 3APDA 4M8NA 1GC6A 3E56A 4BKTA 3NVYA 3VH4B 1DYQA 2LHDA 2WXNA 3NZUA 2WYQA 3I5JC 4LNIA 4IOIE 5IKCM 4UDUC 4LNKA 1WGKA 1E0ZA 4EUTA 2BKRB 4GU2A 3GZNB 3Q3OC 4IDIA 4ZRIA 1SB3C 1EU4A 1XT9B 3HRDD 4TQ1A 4N58A 3UF8A 3VVWB 3W1YA 3GE3C 1ZDVA 3X23A 2KNBA 2UWQA 1FCCC 1YNTE 2JF5A 2KFKA 2RMMA 3PS6A 4DDID 1QQRA 5C1ZA 2E6XA 2AYOB 1VLBA 4DHJB 4MH0E 4M0WA 2R61A 3Q2AC 2K22A 4NJCA 1WMHB 2BQQA 1JRPA 1TS4A 1C77A 4NAWB 1WGYA 3HHMA 2YVCA 5G5HA 1FXTB 3ONSA 2BKFA 2RDGA 3CSFA 4ZDVA 3AU4A 1XXGA 5C2TB 2HDEA 4NY0A 2K39A 3RNBC 3HVZA 4HPPA 2BTEA 1R4MI 3A9JA 1P9DU 4L2YA 5E6JA 2K3UA 2MBBB 3M62B 3CMMB 3L4PA 2L3ZA 3I63C 1J7CA 4EZLA 1MHHE 5E6NA 2NMQA 2V3PA 4JL9A 4IM3A 1P1AA 1AWDA 2KN5A 1U4AA 3ZXVA 3OJ4B 1HA5A 3EHVA 2IO2B 4C4VB 4HJKA 1J0GA 3ZNID 3NUHB 2GBRA 1V6EA 2LXAA 3ZYYX 3WAOA 1Q1OA 4HPLB 1QOGA 4B6WA 3IXSA 5BYRA 3ALBA 2MCNB 1ENFA 4LJPB 2LGIA 1WFYA 2QILA 3P63A 4ARIA 2ZVNA 1WSPA 4PYZA 3IBEA 5HG2A 2RDHA 2ZCBA 1I35A 2PEAA 4G0NB 4TV3A 3VUXA 2KD0A 5G55A 4YTPB 2IY1B 3KYCD 2GRIA 1WM3A 3AE6B 5L83A 3LDZE 2BYVE 1SGHA 1L4DB 2KTRB 2ZNVC 2MHJA 5D3IB 1LM8B 3IT4B 2DZMA 2FBWB 5BYQA 1WMHA 4WURA 2R2QA 3HK0A 2HD5B 4NAWA 3AE3B 1MHXA 3Q3FA 1C76A 2JY6A 3QWZB 4EFOA 1WGGA 1L0XB 3ABVB 5FKAC 4EE2A 3RNAC 1T0SC 1I4QA 3WA0A 3BY4B 4C80A 3S2AA 3FKYA 3TEZA 1WYWB 2DNFA 3MC9A 4OVUA 3PT2B 2WDVB 4AJWA 2KOXA 1XO3A 3A33B 4TUUA 2GI9A 1KFYB 4M8MA 3AE2B 4DXGA 2WLBA 2GOWA 1ZDXA 2GBKA 1I4RA 4C4VA 2ZCCA 2QEJC 1V5TA 1JWSD 2GBMA 3MC8A 1SEBD 2MRPA 2RR9A 3N30A 3AEBB 1RFAA 1UNSA 1H4RA 1VRAB 1E8XA 1PGXA 3V6CB 5AZGA 4BKGA 4A3PA 1CMXB 5HHDG 1T6BX 2K0PA 1LQBA 3AE1B 1VZ6A 2KTRA 2N1VA 3QQ8B 2WXGA 1E5WA 4G50A 1STEA 1V2YA 3SDLC 2KANA 3R66C 2EKIA 1C4PA 3P4PB 4IW0A 4NPNA 2C7NB 3ZDMC 2A5UA 4P16A 5IP4D 2LWPA 2AQ1B 2MEKA 1J8CA 1NVID 4FJVB 3H8HA 2WU2B 2ZW0A 3ZRCA 2CJNA 4W9FA 1D3ZA 3Q8CA 5HI1A 1UWMA 1V1PB 2J7QB 2PMVA 3ZXRA 2W9NA 4BBNC 2VZKD 2AL6A 5AZHA 3BYTB 4M02A 1AW7A 3TEYA 3RN9C 4GB9A 4BKSA 2N9KA 2MH7A 4HCPB 1FNUA 4CYEA 4HDQA 3X0WA 2INPE 1EM7A 1E90A 1EWYC 1IP9A 3SFDB 5HFYA 1L4ZB 1MG8A 3ZRFA 2ZEQA 3AB5A 3W1SC 2PTLA 1WGDA 4MH8A 3U7DA 3M3JA 2MJEA 3T9LA 2N9PC 3WANA 1T0RC 2LVOA 1FXAA 2JZPA 1KRHA 2AWTA 2OJRA 4HROA 2KKCA 4IWQA 1JCKB 1WXVA 3CWIA 1JWAD 2KWDA 2NCNA 1TKGA 2NPTB 3GB1A 4ZRKA 3L0WB 1P0RA 2NR2A 3QC8B 4C7ZA 3L08A 3T8MA 3QA8A 2EMSA 1J7BA 3P42A 3VRBB 3RZWC 1H8CA 1QILA 4FJYA 3UIPB 3DQVA 1PDXA 3PZ7A 1B9RA 1TKYA 1D5MC 3PZ8A 4KX6B 2AL3A 2KLCA 1AARA 3TSSA 3ZDTA 1C3TA 2AEHA 3V3XA 2QC8A 1GG3A 3BINA 2WXJA 5EE9A 1V1PA 1SBBB 3AULA 4W9LA 4WJQA 2PKOA 5JHAA 3P4SB 5CHFA 2N0SB 1I4XA 4TSSA 3AE5B 2J42A 3AMZA 5L95C 1EUVB 4PYUA 1ZGUB 1WRDB 3RZFA 3R3MA 3QIJA 5EE3A 1UH6A 2KVZA 2IO3B 4M00A 1KJTA 1EU3A 1NI3A 3MP9A 3RPFC 2QMTA 3ZNZB 1K51A 2WXLA 3TJPA 4IM2A 3AV8A 3ZNGC 3L17A 2QSDA 4A20A 3EUB2 2PE9A 2MJDA 1C1YB 5D3DA 2FCNA 3BWUD 2DZKA 3QJZA 1FEHA 2NPTA 5IN7A 2WDTB 2YLMA 3I57A 3DCGA 1FRRA 1YIWA 1BUIC 1S3SG 3VHTC 3ETRA 1J19A 3NHEB 3SFEB 4J6IA 4JQWC 1NYQA 3DPDA 2AX5A 1D5XC 4WAFA 4HKZE 1GNUA 2MBOA 1WXSA 4LNOA 4WWNA 2DLBA 4WJPA 3P4QB 3H1UA 1J7AA 4YWGG 3RMKC 1JMLA 5JZEB 4RCOA 3O13A 3UGBB 4MDKE 4G11A 1MFWA 4EZJA 1Y8RC 2H89B 1HTOA 2CHWA 3K9PB 4PS3A 1TS2A 2JYEA 3PRZA 2PLPA 3GZNI 2D11A 1X1MA 2V0GA 2UU7A 4HK2A 2BBCA 3BZDB 1FIQA 2DYMA 2JU6X 4OW0A 2MWSB 4L1BA 3URYA 1TYGB 1YD8U 2BT6A 5BO4B 3PRPB 1SIFA 1YJJA 1TIFA 2KQSA 4HWIB 2G3QB 3AE9B 3PHWB 1QOAA 1MPEA 2N1WA 3FC4A 2C9WB 4MACA 2L1AA 1K53A 4MGKE 4FADA 2XEWA 4A6QA 2KMCA 3JVZX 3VTVA 4B9KA 3ZLZA 1HE8A 3HUIA 1DGJA 3TEWA 5G2NA 1T3QA 4X57B 4XWWA 2IZVB 2KDIA 1FRDA 2CKHB 1SIJA 4B95A 2HJ8A 4IUMB 4XE0A 1K52A 4HPMB 2WWZA 4F1SA 3DBSA 1OQQA 3I9V1 5EDSA 1XQQA 4S17A 3K9OB 4ZOHC 4DHZB 1WX8A 1JW9D 3TL5A 1IPGA 3P1MA 2K1FA 2I38A 4ACFA 4ZRJA 4FHKA 2N7JA 4B0MA 4GDKB 1L5PA 1GB4A 2DENB 4NQLB 1M4VA 2G4SA 4KGSA 2MBQA 4II2B 1ZKHA 4ICUA 4IM0A 1YN3A 5EE0A 3AEGB 2DAJA 4W9IA 1QKZA 5TR5A 3KUZA 1D4BA 3W9CB 1UZXB 3VR8B 2W3RA 1R7SA 1UUPA 2DZIA 2NS5A 3NZSA 3NZ3A 5CX3A 2IPKD 3BK1A 2KC2A 2FNJB 2M0XA 2KWVB 1JALA 3BVGA 4I6LB 3KW5B 2KZRA 2LUEA 5BMIA 3IAS1 3RNGC 2NTSA 3GS2A 2NTTA 1YJ1A 2DHZA 4NJ7A 3VXWA 1XCQL 2KDMA 4DHZE 2L0FA 3U4EG 3PTFC 2I1JA 1TS5A 3VTUA 1VZ7A 1GUAB 3BVMA 1KTKA 2C7MB 2N9EB 1F52A 1VJKA 2MLBA 2J4XA 1DOXA 1WI0A 4LK0M 2M4NA
chains in the Genus database with same CATH topology
4NPNA 2C7NB 3PPAA 4NQKE 3ZDMC 4GMVA 1YQBA 3PHXB 1LFDA 1RRBA 2KVRA 3IFWB 2A5UA 2K8HA 1EO6A 4ZYNA 3SHQA 3RUIB 4HXDA 2QHOA 5J18A 1JRUA 2KX0A 5DPWA 1E8WA 2VRRB 4MJSB 4CHKA 2NBUA 3HM3A 2L8JA 2LWPA 2XBBC 4FHJA 4N9F4 4KSKC 1P98A 1WR1A 1J8CA 3VFKA 4P7IA 3Q3JA 2IO0B 2K8CA 3ENEA 4GDKA 4FJVB 4WWOA 3N3KB 4GDLB 4ANVA 2LRWA 3JSVA 5IAAC 3PZDA 5JH5C 3PLVA 4MGZE 2LVQA 4OVVA 2JT4B 1TGZB 3QK0A 3UQBA 5KHOA 3A1QB 2L00B 1WZ0A 3ZRCA 4W9FA 1D3ZA 2XK5B 2M1MA 1WE6A 2BPSA 2C7HA 3ML8A 3APFA 2J7QB 4AWJA 2NBVB 2W9NA 2DAFA 2GBJA 2IY0B 3VH3B 2AL6A 4BBNC 3MTNB 3DDCB 3N32A 5AZHA 4ANUA 2Z0DB 2ZPNA 3A9KA 4DBGA 4W9GA 2FAZA 3TBLD 3DOWA 2MW5A 5CHWA 3H7SA 3ML9A 3PLUA 4GB9A 2K6DB 2D10A 2MX2A 4BKSA 4DK5A 2JUOA 3PV1A 2DYOA 2RPQA 4KSLC 2MBHA 5D2MB 3WAMA 3H7PB 4HCPB 2CHXA 3IG3A 4CYEA 3OAWA 4HDQA 1WGHA 3X0WA 2D3GA 1E90A 2BYFA 1IP9A 3C0RB 3NY5A 2ASQA 4K81A 1V81A 1MG8A 3ZRFA 3ZVVA 2ZEQA 3W1SC 1WGDA 2LGXA 4I6PA 5CTRC 3U7DA 1PQSA 1SE9A 3M3JA 4KIKB 3RYTA 4E71A 4FA6A 3T9LA 2N9PC 4W9JA 3WANA 3EC8A 3U30A 3RD2A 4BVUC 3APCA 3ZO5B 2LVOA 4ASWC 3KH0A 2JRHA 2M8SA 5KHQA 3L10B 4DDGD 1WXMA 2AWTA 2OJRA 3SD5A 2KKCA 2LVPA 4FLHA 2B3AA 4IWQA 3AU5A 1EF5A 1WXVA 1WJ4A 4HCNB 4GXBA 4W9DA 4AOFA 2FIFA 2NCNA 3CSTA 2JVCA 2NPTB 4TQ0A 3RULA 2KX3A 4ZRKA 1YX5B 2CS4A 3L0WB 5D6JB 3A4SC 3DBLI 1KOTA 4MGIE 4PS8A 2KMAA 2KC1A 2MSED 3JW0X 3D32A 1P0RA 4XZ4A 5LXHA 4KVGB 2MP2B 2IBIB 2NR2A 3JYUA 2KFKB 1EF1A 3QC8B 3L08A 5DCNA 3QA8A 2EMSA 3T8MA 1XD3B 5LLIA 3RZWC 2KTFA 4G3XB 3ZUNA 4FN2A 2KDBA 1H8CA 1WR6E 2IO1B 3NS8A 1E7VA 2ZNVB 4FJYA 2V3SA 2LXCA 3UIPB 3DQVA 1OEYA 3U8ZA 5C23A 4M0WB 4W9CA 4ICVA 4W9HA 2LJ5A 3V62A 4MJSA 1I42A 4II3B 1BT0A 3M95A 2Z0EB 4URKA 4K1RB 1Q0WB 4XC2A 1L7YA 2AL3A 4K7SA 2OOBB 2KLCA 3PSEB 3UIOB 3PGEA 2KJHB 2I1KA 1AARA 2MQJA 3ZDTA 1C3TA 2AEHA 4GDLA 2LGYA 3KUCB 1LXDA 3B08A 1GG3A 1QZEA 2HTHA 3BINA 3A1QA 2Y5BB 3IHPC 4AJYB 2XK5A 5DPTA 3PREA 2HE7A 2N9XA 3AULA 4W9LA 4WJQA 3GOEA 1OEYJ 3VAWA 5JHAA 2BWFA 3SU8X 3EFUA 1UGMA 2ZJDA 5CHFA 4E74A 2REXA 2LD9A 4MSQB 4W9EA 2O6VA 2FCSA 4DXAB 3QHTA 1ZW7A 3A9JB 2GMIC 2KK8A 5AZFA 5AEKB 2ZVOA 5L95C 2FCMA 1EUVB 5J17A 3AI5A 3H7PA 2R2OA 4PYUA 4AUQC 1ZGUB 1L2NA 4KDLB 1WRDB 4IWOA 2KDFB 3RZFA 2J0JA 1WM2A 2L0TA 3R3MA 3DVNV 3QIJA 1KLVA 1UH6A 3RT3B 2IO3B 2WX0A 1KJTA 3WIMA 1WY8A 4KDIC 3ZIMA 4MSMB 4EKUA 1YX6B 4WAAA 1OGWA 4KIKA 3ZNZB 5CHVC 3PRMB 3ZTCA 3L16A 3P2BA 4CO7A 1RAXA 4EZKA 2C5LC 3MJWA 1GC7A 4GN1A 4BBNF 3KVFB 3APDA 4M8NA 4FBJB 1GC6A 3TJPA 4IM2A 4BKTA 3ZNGC 3L17A 3V61A 3VH4B 3DBRI 3QARA 2O6VB 5HKHA 3NZUA 3UINB 4A20A 3AXCA 2WYQA 2PE9A 1M94A 4JLCA 1VCBA 2L76A 1C1YB 4KV2A 2KFJA 4RM8A 2FCNA 5DPSA 2DZKA 3QJZA 4EUTA 2BKRB 4GU2A 4PS7A 4BOSC 2NPTA 4ZRIA 2BYEA 4TQ1A 1XT9B 3VVWB 3W1YA 4K7WA 3UF8A 3ZNHB 2WDTB 3ZTDA 2G45B 3VUWA 3X23A 2KNBA 2UWQA 2IYDB 4RMAA 2MP2A 1V86A 1WH3A 2N7DA 2JF5A 2YLMA 2K25A 2EKEC 3DCGA 3DVGX 3QAQA 2KFKA 3PS6A 2BWES 1YIWA 4DDID 2O6VD 5C1ZA 2KWCA 1V80A 1S3SG 3VHTC 2AYOB 4MM3A 4NNJB 1J19A 3NHEB 1Z2MA 4DHJB 1P3QU 4DWFA 4MH0E 1NBFC 4J6IA 4LDTB 4LCDE 4EOYA 2UYZB 3L54A 4WQOB 1TTNA 4JQWC 3DPDA 2LGDA 4MEMA 4I6NB 3UQAA 1IYFA 1WMHB 3TMPB 2N7EA 3V60A 1GNUA 2MBOA 1WXSA 2ZPYA 4NAWB 4WWNA 4WJPA 1WGYA 3PVLA 1NDDA 1GJZA 1VD2A 3HHMA 3H1UA 2D2QA 2YVCA 3I3TB 4DHJD 4BOZB 1FXTB 3ONSA 2BKFA 4MGYE 5JZEB 4LDTD 3CSFA 4ZDVA 3UGBB 1WXAA 3AU4A 5D94A 2WX1A 4G11A 4MDKE 4NY0A 2K39A 4EZJA 1Y8RC 2NBWB 3TIXA 2FCQA 1TBEA 2DYBA 2MA9B 5IA7A 1R4MI 4HVBA 2MBEA 1UBQA 2CHWA 3HM6X 3K9PB 4EEWA 4PS3A 4HDOA 1RLFA 5D7GA 3PRZA 2RGFA 3A9JA 3GZNI 2D11A 1Z5SB 4A3OA 1P9DU 1R4NI 2N4FA 2PPHA 1X1MA 2MBBB 3M62B 4HK2A 1WF9A 3TCAA 3NOBA 2JPHA 4KZ0A 2DYMA 3VQIA 3CMMB 2L3ZA 2MWSB 1V5OA 3VTWA 5E6NA 4JL9A 4EZLA 1UBIA 1P1AA 1YD8U 4IM3A 2M17A 3M63B 5BO4B 3PRPB 2KN5A 4AP4C 1U4AA 1SIFA 3OJ4B 3R7RA 4NJ6A 2LZ6A 2DZJA 2IO2B 3EHVA 3VDZA 2FIDA 3H9DA 4HJKA 2KQSA 2KJRA 3EECA 4HWIB 3ZNID 1J0GA 2GBRA 1NI2A 3HIZA 1V6EA 3R7QA 4TKNA 2LXAA 2G3QB 3WAOA 3PHWB 2PJHA 2O2VB 1K8RB 1E8ZA 2K6QA 2KHWB 4JIOU 2LI5A 1Q1OA 4HPLB 3WAPA 4B6WA 2J0KA 2N1WA 2Z59B 3LJ3A 2JWZA 2MCNB 3ALBA 4LJPB 2C9WB 1E7UA 3V6EB 4KZCA 1F9JA 2JZ3B 1WFYA 2PE6B 4MGKE 2ZVNA 4E3CA 4FADA 1WJUA 4PYZA 2XEWA 3IBEA 2JZZA 3L13A 4K7UA 2ZCBA 4IWPA 1I35A 2KMCA 3ZW3A 3JVZX 2PEAA 3VTVA 4G0NB 4B9KA 4WJOA 4TV3A 3VUXA 3ZLZA 4HLEA 1HE8A 2KD0A 2LRUA 5GMVA 5G55A 2IY1B 5G2NA 3KYCD 4X57B 2IZVB 2KDIA 1WM3A 4WWPA 5L83A 2CKHB 3LDZE 3ECIA 1T0YA 4B95A 2BYVE 1SGHA 4LJOB 3QX1A 4GIVA 2HJ8A 1OQYA 2KTRB 2A4ZA 5LXIB 2ZNVC 1WGRA 1LM8B 2DZMA 4IUMB 3A4RA 4W9KA 2KXJA 2RSUA 1WMHA 2KQ7A 4HPMB 4F8CB 2R2QA 5J2RA 2WWZA 4F1SA 1WZ3A 3HK0A 3DBSA 2HD5B 4FULA 4IC7B 4NAWA 2G4DB 2RD0A 1XQQA 5EDSA 1OTRB 4YL8A 3K9OB 3Q3FA 4RM9A 1S1QB 2JY6A 4DHZB 2V1YA 3QWZB 4EFOA 4ANXA 1WX8A 3RCZA 4IG7B 2KO3A 3B1LX 3TL5A 2C60A 1IPGA 2K1FA 1WGGA 5DPRA 4GOCA 4ZRJA 4FHKA 3OJ3A 5E6PA 4GDKB 4GSWA 3WA0A 3BY4B 1G6JA 2DENB 3S2AA 3JSVB 4NQLB 2JXXA 2KLGA 2G4SA 1WJNA 1WYWB 2D07B 1V49A 3KYDD 2MBQA 3WALA 4II2B 1KM7A 1ZKHA 4F7ZA 4ICUA 4OVUA 2JRIB 3CF6E 3PT2B 1UD7A 4IM0A 4AJWA 1WJ6A 3B0AA 3A9KB 2KOXA 4WJNA 3IVFA 3MHSD 1WIAA 3A33B 2DAJA 2K8BA 4TUUA 3ZKJC 2KDEB 2J0MA 2NVUI 4W9IA 4M8MA 5TR5A 5JHBA 3KUZA 2GOWA 2KWUB 3DBHI 5FR6A 1UZXB 2GBKA 3DVGY 1A5RA 3KUDB 2ZCCA 1Q5WB 1WE7A 2DZIA 2KJ6A 2NS5A 3NZSA 5CX3A 1V5TA 5E6OA 2EMTA 2O2VA 2GBMA 2KC2A 2FNJB 2M0XA 2KWVB 2DX5B 2MRPA 4FJZA 3W1SA 1E8YA 1WX7A 2BF8B 2RR9A 4I6LB 2CU1A 2V4LA 3N30A 4BFRA 1RFAA 3KW5B 4BKSD 2KZRA 1H4RA 2LUEA 1WX9A 3O65B 2GBNA 1E8XA 3V6CB 5AZGA 3OLMD 4BKGA 2CR5A 1YJ1A 1CMXB 4A3PA 3DVNU 1UELA 2DHZA 4NJ7A 4XX5A 2CHZA 3VXWA 1TZ1A 4GGQA 1V9JA 4ANWA 4DHZE 2LASA 1LQBA 2KTRA 2N1VA 3QQ8B 2L0FA 2L05A 4MELA 1E5WA 3PTFC 2FUHB 4G50A 2I1JA 1V2YA 3SDLC 3VTUA 2ZZPB 1GUAB 2C7MB 2KANA 3R66C 2N9EB 1ISNA 3QCAA 3VUYA 2L7RA 2MLBA 1WI0A 3H6NA 4JGHB 4IW0A 2M4NA 2BGFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NPN A;  2C7N B;  3PPA A;  4NQK E;  3ZDM C;  4GMV A;  1YQB A;  3PHX B;  1LFD A;  1RRB A;  2KVR A;  3IFW B;  2A5U A;  2K8H A;  1EO6 A;  4ZYN A;  3SHQ A;  3RUI B;  4HXD A;  2QHO A;  5J18 A;  1JRU A;  2KX0 A;  5DPW A;  1E8W A;  2VRR B;  4MJS B;  4CHK A;  2NBU A;  3HM3 A;  2L8J A;  2LWP A;  2XBB C;  4FHJ A;  4N9F 4;  4KSK C;  1P98 A;  1WR1 A;  1J8C A;  3VFK A;  4P7I A;  3Q3J A;  2IO0 B;  2K8C A;  3ENE A;  4GDK A;  4FJV B;  4WWO A;  3N3K B;  4GDL B;  4ANV A;  2LRW A;  3JSV A;  5IAA C;  3PZD A;  5JH5 C;  3PLV A;  4MGZ E;  2LVQ A;  4OVV A;  2JT4 B;  1TGZ B;  3QK0 A;  3UQB A;  5KHO A;  3A1Q B;  2L00 B;  1WZ0 A;  3ZRC A;  4W9F A;  1D3Z A;  2XK5 B;  2M1M A;  1WE6 A;  2BPS A;  2C7H A;  3ML8 A;  3APF A;  2J7Q B;  4AWJ A;  2NBV B;  2W9N A;  2DAF A;  2GBJ A;  2IY0 B;  3VH3 B;  2AL6 A;  4BBN C;  3MTN B;  3DDC B;  3N32 A;  5AZH A;  4ANU A;  2Z0D B;  2ZPN A;  3A9K A;  4DBG A;  4W9G A;  2FAZ A;  3TBL D;  3DOW A;  2MW5 A;  5CHW A;  3H7S A;  3ML9 A;  3PLU A;  4GB9 A;  2K6D B;  2D10 A;  2MX2 A;  4BKS A;  4DK5 A;  2JUO A;  3PV1 A;  2DYO A;  2RPQ A;  4KSL C;  2MBH A;  5D2M B;  3WAM A;  3H7P B;  4HCP B;  2CHX A;  3IG3 A;  4CYE A;  3OAW A;  4HDQ A;  1WGH A;  3X0W A;  2D3G A;  1E90 A;  2BYF A;  1IP9 A;  3C0R B;  3NY5 A;  2ASQ A;  4K81 A;  1V81 A;  1MG8 A;  3ZRF A;  3ZVV A;  2ZEQ A;  3W1S C;  1WGD A;  2LGX A;  4I6P A;  5CTR C;  3U7D A;  1PQS A;  1SE9 A;  3M3J A;  4KIK B;  3RYT A;  4E71 A;  4FA6 A;  3T9L A;  2N9P C;  4W9J A;  3WAN A;  3EC8 A;  3U30 A;  3RD2 A;  4BVU C;  3APC A;  3ZO5 B;  2LVO A;  4ASW C;  3KH0 A;  2JRH A;  2M8S A;  5KHQ A;  3L10 B;  4DDG D;  1WXM A;  2AWT A;  2OJR A;  3SD5 A;  2KKC A;  2LVP A;  4FLH A;  2B3A A;  4IWQ A;  3AU5 A;  1EF5 A;  1WXV A;  1WJ4 A;  4HCN B;  4GXB A;  4W9D A;  4AOF A;  2FIF A;  2NCN A;  3CST A;  2JVC A;  2NPT B;  4TQ0 A;  3RUL A;  2KX3 A;  4ZRK A;  1YX5 B;  2CS4 A;  3L0W B;  5D6J B;  3A4S C;  3DBL I;  1KOT A;  4MGI E;  4PS8 A;  2KMA A;  2KC1 A;  2MSE D;  3JW0 X;  3D32 A;  1P0R A;  4XZ4 A;  5LXH A;  4KVG B;  2MP2 B;  2IBI B;  2NR2 A;  3JYU A;  2KFK B;  1EF1 A;  3QC8 B;  3L08 A;  5DCN A;  3QA8 A;  2EMS A;  3T8M A;  1XD3 B;  5LLI A;  3RZW C;  2KTF A;  4G3X B;  3ZUN A;  4FN2 A;  2KDB A;  1H8C A;  1WR6 E;  2IO1 B;  3NS8 A;  1E7V A;  2ZNV B;  4FJY A;  2V3S A;  2LXC A;  3UIP B;  3DQV A;  1OEY A;  3U8Z A;  5C23 A;  4M0W B;  4W9C A;  4ICV A;  4W9H A;  2LJ5 A;  3V62 A;  4MJS A;  1I42 A;  4II3 B;  1BT0 A;  3M95 A;  2Z0E B;  4URK A;  4K1R B;  1Q0W B;  4XC2 A;  1L7Y A;  2AL3 A;  4K7S A;  2OOB B;  2KLC A;  3PSE B;  3UIO B;  3PGE A;  2KJH B;  2I1K A;  1AAR A;  2MQJ A;  3ZDT A;  1C3T A;  2AEH A;  4GDL A;  2LGY A;  3KUC B;  1LXD A;  3B08 A;  1GG3 A;  1QZE A;  2HTH A;  3BIN A;  3A1Q A;  2Y5B B;  3IHP C;  4AJY B;  2XK5 A;  5DPT A;  3PRE A;  2HE7 A;  2N9X A;  3AUL A;  4W9L A;  4WJQ A;  3GOE A;  1OEY J;  3VAW A;  5JHA A;  2BWF A;  3SU8 X;  3EFU A;  1UGM A;  2ZJD A;  5CHF A;  4E74 A;  2REX A;  2LD9 A;  4MSQ B;  4W9E A;  2O6V A;  2FCS A;  4DXA B;  3QHT A;  1ZW7 A;  3A9J B;  2GMI C;  2KK8 A;  5AZF A;  5AEK B;  2ZVO A;  5L95 C;  2FCM A;  1EUV B;  5J17 A;  3AI5 A;  3H7P A;  2R2O A;  4PYU A;  4AUQ C;  1ZGU B;  1L2N A;  4KDL B;  1WRD B;  4IWO A;  2KDF B;  3RZF A;  2J0J A;  1WM2 A;  2L0T A;  3R3M A;  3DVN V;  3QIJ A;  1KLV A;  1UH6 A;  3RT3 B;  2IO3 B;  2WX0 A;  1KJT A;  3WIM A;  1WY8 A;  4KDI C;  3ZIM A;  4MSM B;  4EKU A;  1YX6 B;  4WAA A;  1OGW A;  4KIK A;  3ZNZ B;  5CHV C;  3PRM B;  3ZTC A;  3L16 A;  3P2B A;  4CO7 A;  1RAX A;  4EZK A;  2C5L C;  3MJW A;  1GC7 A;  4GN1 A;  4BBN F;  3KVF B;  3APD A;  4M8N A;  4FBJ B;  1GC6 A;  3TJP A;  4IM2 A;  4BKT A;  3ZNG C;  3L17 A;  3V61 A;  3VH4 B;  3DBR I;  3QAR A;  2O6V B;  5HKH A;  3NZU A;  3UIN B;  4A20 A;  3AXC A;  2WYQ A;  2PE9 A;  1M94 A;  4JLC A;  1VCB A;  2L76 A;  1C1Y B;  4KV2 A;  2KFJ A;  4RM8 A;  2FCN A;  5DPS A;  2DZK A;  3QJZ A;  4EUT A;  2BKR B;  4GU2 A;  4PS7 A;  4BOS C;  2NPT A;  4ZRI A;  2BYE A;  4TQ1 A;  1XT9 B;  3VVW B;  3W1Y A;  4K7W A;  3UF8 A;  3ZNH B;  2WDT B;  3ZTD A;  2G45 B;  3VUW A;  3X23 A;  2KNB A;  2UWQ A;  2IYD B;  4RMA A;  2MP2 A;  1V86 A;  1WH3 A;  2N7D A;  2JF5 A;  2YLM A;  2K25 A;  2EKE C;  3DCG A;  3DVG X;  3QAQ A;  2KFK A;  3PS6 A;  2BWE S;  1YIW A;  4DDI D;  2O6V D;  5C1Z A;  2KWC A;  1V80 A;  1S3S G;  3VHT C;  2AYO B;  4MM3 A;  4NNJ B;  1J19 A;  3NHE B;  1Z2M A;  4DHJ B;  1P3Q U;  4DWF A;  4MH0 E;  1NBF C;  4J6I A;  4LDT B;  4LCD E;  4EOY A;  2UYZ B;  3L54 A;  4WQO B;  1TTN A;  4JQW C;  3DPD A;  2LGD A;  4MEM A;  4I6N B;  3UQA A;  1IYF A;  1WMH B;  3TMP B;  2N7E A;  3V60 A;  1GNU A;  2MBO A;  1WXS A;  2ZPY A;  4NAW B;  4WWN A;  4WJP A;  1WGY A;  3PVL A;  1NDD A;  1GJZ A;  1VD2 A;  3HHM A;  3H1U A;  2D2Q A;  2YVC A;  3I3T B;  4DHJ D;  4BOZ B;  1FXT B;  3ONS A;  2BKF A;  4MGY E;  5JZE B;  4LDT D;  3CSF A;  4ZDV A;  3UGB B;  1WXA A;  3AU4 A;  5D94 A;  2WX1 A;  4G11 A;  4MDK E;  4NY0 A;  2K39 A;  4EZJ A;  1Y8R C;  2NBW B;  3TIX A;  2FCQ A;  1TBE A;  2DYB A;  2MA9 B;  5IA7 A;  1R4M I;  4HVB A;  2MBE A;  1UBQ A;  2CHW A;  3HM6 X;  3K9P B;  4EEW A;  4PS3 A;  4HDO A;  1RLF A;  5D7G A;  3PRZ A;  2RGF A;  3A9J A;  3GZN I;  2D11 A;  1Z5S B;  4A3O A;  1P9D U;  1R4N I;  2N4F A;  2PPH A;  1X1M A;  2MBB B;  3M62 B;  4HK2 A;  1WF9 A;  3TCA A;  3NOB A;  2JPH A;  4KZ0 A;  2DYM A;  3VQI A;  3CMM B;  2L3Z A;  2MWS B;  1V5O A;  3VTW A;  5E6N A;  4JL9 A;  4EZL A;  1UBI A;  1P1A A;  1YD8 U;  4IM3 A;  2M17 A;  3M63 B;  5BO4 B;  3PRP B;  2KN5 A;  4AP4 C;  1U4A A;  1SIF A;  3OJ4 B;  3R7R A;  4NJ6 A;  2LZ6 A;  2DZJ A;  2IO2 B;  3EHV A;  3VDZ A;  2FID A;  3H9D A;  4HJK A;  2KQS A;  2KJR A;  3EEC A;  4HWI B;  3ZNI D;  1J0G A;  2GBR A;  1NI2 A;  3HIZ A;  1V6E A;  3R7Q A;  4TKN A;  2LXA A;  2G3Q B;  3WAO A;  3PHW B;  2PJH A;  2O2V B;  1K8R B;  1E8Z A;  2K6Q A;  2KHW B;  4JIO U;  2LI5 A;  1Q1O A;  4HPL B;  3WAP A;  4B6W A;  2J0K A;  2N1W A;  2Z59 B;  3LJ3 A;  2JWZ A;  2MCN B;  3ALB A;  4LJP B;  2C9W B;  1E7U A;  3V6E B;  4KZC A;  1F9J A;  2JZ3 B;  1WFY A;  2PE6 B;  4MGK E;  2ZVN A;  4E3C A;  4FAD A;  1WJU A;  4PYZ A;  2XEW A;  3IBE A;  2JZZ A;  3L13 A;  4K7U A;  2ZCB A;  4IWP A;  1I35 A;  2KMC A;  3ZW3 A;  3JVZ X;  2PEA A;  3VTV A;  4G0N B;  4B9K A;  4WJO A;  4TV3 A;  3VUX A;  3ZLZ A;  4HLE A;  1HE8 A;  2KD0 A;  2LRU A;  5GMV A;  5G55 A;  2IY1 B;  5G2N A;  3KYC D;  4X57 B;  2IZV B;  2KDI A;  1WM3 A;  4WWP A;  5L83 A;  2CKH B;  3LDZ E;  3ECI A;  1T0Y A;  4B95 A;  2BYV E;  1SGH A;  4LJO B;  3QX1 A;  4GIV A;  2HJ8 A;  1OQY A;  2KTR B;  2A4Z A;  5LXI B;  2ZNV C;  1WGR A;  1LM8 B;  2DZM A;  4IUM B;  3A4R A;  4W9K A;  2KXJ A;  2RSU A;  1WMH A;  2KQ7 A;  4HPM B;  4F8C B;  2R2Q A;  5J2R A;  2WWZ A;  4F1S A;  1WZ3 A;  3HK0 A;  3DBS A;  2HD5 B;  4FUL A;  4IC7 B;  4NAW A;  2G4D B;  2RD0 A;  1XQQ A;  5EDS A;  1OTR B;  4YL8 A;  3K9O B;  3Q3F A;  4RM9 A;  1S1Q B;  2JY6 A;  4DHZ B;  2V1Y A;  3QWZ B;  4EFO A;  4ANX A;  1WX8 A;  3RCZ A;  4IG7 B;  2KO3 A;  3B1L X;  3TL5 A;  2C60 A;  1IPG A;  2K1F A;  1WGG A;  5DPR A;  4GOC A;  4ZRJ A;  4FHK A;  3OJ3 A;  5E6P A;  4GDK B;  4GSW A;  3WA0 A;  3BY4 B;  1G6J A;  2DEN B;  3S2A A;  3JSV B;  4NQL B;  2JXX A;  2KLG A;  2G4S A;  1WJN A;  1WYW B;  2D07 B;  1V49 A;  3KYD D;  2MBQ A;  3WAL A;  4II2 B;  1KM7 A;  1ZKH A;  4F7Z A;  4ICU A;  4OVU A;  2JRI B;  3CF6 E;  3PT2 B;  1UD7 A;  4IM0 A;  4AJW A;  1WJ6 A;  3B0A A;  3A9K B;  2KOX A;  4WJN A;  3IVF A;  3MHS D;  1WIA A;  3A33 B;  2DAJ A;  2K8B A;  4TUU A;  3ZKJ C;  2KDE B;  2J0M A;  2NVU I;  4W9I A;  4M8M A;  5TR5 A;  5JHB A;  3KUZ A;  2GOW A;  2KWU B;  3DBH I;  5FR6 A;  1UZX B;  2GBK A;  3DVG Y;  1A5R A;  3KUD B;  2ZCC A;  1Q5W B;  1WE7 A;  2DZI A;  2KJ6 A;  2NS5 A;  3NZS A;  5CX3 A;  1V5T A;  5E6O A;  2EMT A;  2O2V A;  2GBM A;  2KC2 A;  2FNJ B;  2M0X A;  2KWV B;  2DX5 B;  2MRP A;  4FJZ A;  3W1S A;  1E8Y A;  1WX7 A;  2BF8 B;  2RR9 A;  4I6L B;  2CU1 A;  2V4L A;  3N30 A;  4BFR A;  1RFA A;  3KW5 B;  4BKS D;  2KZR A;  1H4R A;  2LUE A;  1WX9 A;  3O65 B;  2GBN A;  1E8X A;  3V6C B;  5AZG A;  3OLM D;  4BKG A;  2CR5 A;  1YJ1 A;  1CMX B;  4A3P A;  3DVN U;  1UEL A;  2DHZ A;  4NJ7 A;  4XX5 A;  2CHZ A;  3VXW A;  1TZ1 A;  4GGQ A;  1V9J A;  4ANW A;  4DHZ E;  2LAS A;  1LQB A;  2KTR A;  2N1V A;  3QQ8 B;  2L0F A;  2L05 A;  4MEL A;  1E5W A;  3PTF C;  2FUH B;  4G50 A;  2I1J A;  1V2Y A;  3SDL C;  3VTU A;  2ZZP B;  1GUA B;  2C7M B;  2KAN A;  3R66 C;  2N9E B;  1ISN A;  3QCA A;  3VUY A;  2L7R A;  2MLB A;  1WI0 A;  3H6N A;  4JGH B;  4IW0 A;  2M4N A;  2BGF A; 
#chains in the Genus database with same CATH topology
 1T5X D;  4GMV A;  1LFD A;  4ZYN A;  4OZA A;  4HXD A;  4WH4 A;  4MJS B;  2NBU A;  2XBB C;  2VZK B;  4N9F 4;  3W5V B;  2RPV A;  1FPY A;  1ZE3 D;  2K8C A;  4GDK A;  2IJ0 A;  2LRW A;  3AE4 B;  2LVQ A;  3UQB A;  2JT4 B;  3QK0 A;  5KHO A;  1ZP0 B;  1WE6 A;  3APF A;  4HKQ A;  4AWJ A;  2WXP A;  3AN1 A;  3DDC B;  4HRS A;  1C9F A;  2Z0D B;  1ZXI A;  4NAM A;  4RF0 A;  2FAZ A;  1P7F A;  1ET6 A;  3Q8F A;  2MW5 A;  5CHW A;  3ML9 A;  2XN9 C;  2D10 A;  2MX2 A;  2JUO A;  1R4M B;  1XLQ A;  2MBH A;  5D2M B;  3WAM A;  2M19 A;  4H2A A;  3H7P B;  2YEP B;  1ET9 A;  2VH2 A;  3IG3 A;  3OAW A;  2KT7 A;  2D3G A;  4TMA B;  2Y5C A;  5H92 C;  1N61 A;  3BYY B;  3EGR A;  4KIK B;  4E71 A;  3RYT A;  4FA6 A;  2W82 A;  1ROE A;  3Q69 A;  3APC A;  1C4A A;  3NVW A;  2J52 A;  2I2Y A;  1ZUD 2;  2JRH A;  1WYG A;  5BMG A;  4LNN A;  2INC C;  3W2D A;  1WJ4 A;  4AOF A;  1FM0 D;  4WIP A;  3C8Y A;  1FNW A;  2DBY A;  2CS4 A;  3A4S C;  3DBL I;  1KOT A;  4AS1 A;  4XZ4 A;  3NVV A;  2MP2 B;  2IBI B;  4N6E B;  3ZUN A;  2KDB A;  1WR6 E;  2ACZ B;  2ZNV B;  1Y56 A;  1SSN A;  3V62 A;  4MJS A;  1I42 A;  1CZP A;  2BS2 B;  1BT0 A;  3CIR B;  4K3B A;  5H8Y E;  1L7Y A;  3PGE A;  4HEA 1;  1FFV A;  2TSS A;  3B2G A;  3WCQ A;  3B08 A;  2HTH A;  1QZE A;  2W3S A;  2Y5P A;  4AJY B;  2WQY B;  5DPT A;  4RGT A;  3V05 A;  4A9A A;  4DXF A;  1V8C A;  2OHF A;  3AH7 A;  1UGM A;  4WQM A;  4E74 A;  2LD9 A;  4MSQ B;  2Y3A A;  2O6V A;  4DXA B;  3DHG C;  2GMI C;  2KK8 A;  5AZF A;  1C4C A;  3DHI C;  2FCM A;  5J17 A;  3N1Z C;  3AI5 A;  3H7P A;  3RNC C;  2KQ4 X;  3VR9 B;  2J0J A;  1WM2 A;  3Q14 C;  4A8X C;  3DVN V;  1I4P A;  4MSM B;  4Q2J A;  1YX6 B;  2PIA A;  2WNM A;  4KIK A;  3RNE C;  1RAX A;  3B9J A;  3MJW A;  1GC7 A;  4RFB A;  1TJE A;  2IND C;  4FBJ B;  3FIL B;  3V61 A;  1VR9 A;  3DBR I;  5HKH A;  1JQ4 A;  2IGD A;  4RM8 A;  5AUI A;  5DPS A;  1ESF A;  4BOS C;  3N1Y C;  1R4N B;  2PVG C;  1QLB B;  2IYD B;  2MP2 A;  1V86 A;  3SEB A;  3DVG X;  2EKE C;  3QAQ A;  2BWE S;  2MJ3 A;  2O6V D;  2KWC A;  1V80 A;  4YSX B;  1KLU D;  4OZC A;  4MM3 A;  4NNJ B;  1P3Q U;  4EOY A;  1JWU D;  2UYZ B;  5MPO A;  1N63 A;  3L54 A;  1LGR A;  4I6N B;  4PK1 A;  4XYC A;  3UQA A;  3TMP B;  2N7E A;  4B0E A;  3Q3N C;  2D5G A;  2CJO A;  1OQR A;  3MHZ A;  3PVL A;  3C19 A;  1GJZ A;  1VD2 A;  5AUK A;  1RYJ A;  2BW2 A;  3BII D;  4LDT D;  3U2S C;  1WXA A;  5D94 A;  2KN4 A;  5G5G A;  1JRO A;  3TIX A;  3EA6 A;  1TBE A;  3R2I A;  2MA9 B;  5IA7 A;  3GP7 A;  1E6E B;  2IGG A;  1TY0 A;  4EEW A;  4J3O D;  1RLF A;  1D6E C;  3N1X C;  1Z5S B;  1WF9 A;  2B76 B;  5GXG B;  2VH1 A;  4KZ0 A;  1ZPS A;  4PT5 A;  1V1O A;  2LMC A;  1UBI A;  4S0R A;  3M63 B;  5FK9 C;  4YTN B;  2X8X X;  4O1N A;  4A55 A;  3Q3M C;  2LZ6 A;  1HTQ A;  3BVZ A;  1QOB A;  2FID A;  3H9D A;  3E9S A;  3ZQ4 A;  2KJR A;  2K5P A;  3EEC A;  3W5U B;  2RDB C;  3HIZ A;  4TKN A;  3FIL A;  1YQ3 B;  2O2V B;  1KLG D;  3ZGZ A;  1K8R B;  2K6Q A;  3NVZ A;  1HEZ E;  2IDY A;  3P4R B;  1IBX B;  2J0K A;  2Z59 B;  3LJ3 A;  5BMH A;  1E7U A;  3V6E B;  1F9J A;  2PE6 B;  4E3C A;  3L13 A;  4IWP A;  1XEE A;  4WJO A;  1BXT A;  4HLE A;  2LRU A;  3T3O A;  3ECI A;  1T0Y A;  1YMH E;  4LJO B;  3QX1 A;  1MI0 A;  4GIV A;  1WGR A;  3DWG C;  2HJ1 A;  3DBH B;  4ARC A;  1GAQ B;  4BZA A;  4W9K A;  2RSU A;  1CJE A;  5TSS A;  4A90 A;  4F8C B;  4DQO C;  1OTR B;  4YL8 A;  4RM9 A;  5EE1 A;  2WDR B;  4ANX A;  2KO3 A;  1I4G A;  5DPR A;  4GOC A;  4P1C C;  1YJI A;  3OJ3 A;  5E6P A;  1XF5 L;  1V97 A;  2JXX A;  2KLG A;  5BYS A;  1WJN A;  2D07 B;  1V49 A;  3KYD D;  3WAL A;  4JPS A;  2JRI B;  1UD7 A;  1WJ6 A;  1TKE A;  1XCT L;  1FFU A;  3B0A A;  1N5X A;  2BS4 B;  1WIA A;  3ZKJ C;  4USA A;  5JHB A;  1PYW D;  1SE3 A;  3OWE B;  4ZRQ A;  2KWU B;  2LJI A;  1F2R I;  1XLP A;  3DVG Y;  3N9Y C;  1VDV A;  1WE7 A;  2O2V A;  5JXV A;  1N60 A;  1IBX A;  1RM6 C;  2DX5 B;  4FJZ A;  3W1S A;  2BB5 A;  2CU1 A;  2V4L A;  4BFR A;  1HZ6 A;  2GBN A;  1SE2 A;  2XNA C;  2YEP F;  4NZL B;  1UEL A;  4YT0 B;  1SF0 A;  1TZ1 A;  1YN5 A;  1EWC A;  1GPX A;  4GGQ A;  1V9J A;  1TZO A;  2WHI A;  4YSY B;  4FXC A;  2L05 A;  2FUH B;  1C78 A;  2M0A A;  1ISN A;  3QCA A;  3VUY A;  2L7R A;  3EFC A;  4JGH B;  2SEB D;  3J9C A;  3PHX B;  2KVR A;  3IFW B;  1EO6 A;  3SHQ A;  3RUI B;  2QHO A;  2QIE B;  1JRU A;  2KX0 A;  5DPW A;  2VRR B;  2G1E A;  4WWM A;  4CHK A;  3HM3 A;  1XLO A;  1ZXH A;  4KSK C;  4LTU A;  3VFK A;  3Q3J A;  2IO0 B;  4WWO A;  4GDL B;  2L52 A;  3PZD A;  5JH5 C;  3PLV A;  2EEL A;  1TGZ B;  3A1Q B;  1IGD A;  1WZ0 A;  2BPS A;  2C7H A;  3ML8 A;  4REZ A;  2NBV B;  2DAF A;  2IY0 B;  3MTN B;  3N32 A;  2G9H D;  5I4D A;  4W9G A;  3IT6 B;  1DOY A;  3TBL D;  3DOW A;  3H7S A;  1VZ8 A;  4JWS C;  3PV1 A;  2DYO A;  2RPQ A;  4KSL C;  3NJT A;  4OZB A;  2CHX A;  3R8B A;  4R3D A;  4LNF A;  1WGH A;  1MG4 A;  2BYF A;  3NY5 A;  3NS1 A;  2ASQ A;  4K81 A;  3ZVV A;  3AE8 B;  1AN8 A;  1E10 A;  4W9J A;  3EC8 A;  2JYT A;  3RD2 A;  2QDF A;  3KH0 A;  2M8S A;  1L6V A;  3L10 B;  4DDG D;  4RNA A;  2OJW A;  2LVP A;  4FLH A;  2B3A A;  3AU5 A;  1N62 A;  4GXB A;  3LXF A;  1QT9 A;  4W9D A;  2LFI A;  2JSV X;  2FIF A;  3CST A;  4ZHO A;  4JWU C;  4TQ0 A;  3RUL A;  1SE4 A;  4YTM B;  5D6J B;  1HZ5 A;  4MGI E;  5LXH A;  2KC1 A;  2MSE D;  3D32 A;  4CQN A;  1C79 A;  3JYU A;  1FCL A;  1JWM D;  1XD3 B;  2LEK A;  3AEF B;  4G3X B;  2JXT A;  3NS8 A;  2WU5 B;  4XDC A;  2V3S A;  1OEY A;  3U8Z A;  5C23 A;  4ICV A;  2LJ5 A;  4K3C A;  4II3 B;  3M95 A;  2WXH A;  4K1R B;  4XC2 A;  4QAY A;  1TS3 A;  3UIO B;  5LNK 1;  3AEC B;  1F1H A;  2MQJ A;  4C7Y A;  4XDD A;  4GDL A;  4ZRP A;  1LXD A;  3A1Q A;  2Y5B B;  4M01 A;  2ICI A;  2AQ2 B;  2HE7 A;  4MT5 A;  1OEY J;  3VAW A;  3SU8 X;  3EFU A;  2E3T A;  2BS3 B;  2GB1 A;  1SXT A;  1SJH D;  4W9E A;  3KQ4 A;  2LUM A;  2FCS A;  1ZW7 A;  1ACC A;  2WXQ A;  2ZVO A;  2R2O A;  3AM9 A;  4AUQ C;  1L2N A;  4KDL B;  4IWO A;  2PW9 A;  3TEX A;  2L0T A;  4XWT A;  1N6Z A;  2V9H A;  5C3J B;  1KLV A;  3RT3 B;  2WX0 A;  3WIM A;  5T8I A;  2DWQ A;  4KDI C;  3ZIM A;  4EKU A;  1I4H A;  4WAA A;  1OGW A;  3U52 E;  3ZTC A;  3L16 A;  2C5L C;  1NEK B;  4BBN F;  1XLN A;  3KVF B;  1NEN B;  3SR6 A;  3KLS X;  3QAR A;  2O6V B;  1P7E A;  3UIN B;  3AXC A;  1PGA A;  1M94 A;  4JLC A;  1VCB A;  2L76 A;  4KV2 A;  3ZJU A;  2KFJ A;  2V3N A;  4PS7 A;  2BYE A;  4K7W A;  3ZNH B;  3ZTD A;  2G45 B;  3VUW A;  3KWV A;  4RMA A;  1WH3 A;  2N7D A;  2K25 A;  4KGR A;  2HTM E;  3KWL A;  2JX5 A;  1Z2M A;  4HJG E;  1K50 A;  4DWF A;  1NBF C;  4LDT B;  4LCD E;  4WQO B;  1TTN A;  1AYF A;  2LGD A;  3DHH C;  4MEM A;  1TT5 B;  1IYF A;  2H88 B;  1UGJ A;  2M56 B;  3V60 A;  4RH6 A;  2ZPY A;  1PGB A;  1NDD A;  2INN E;  3RI7 C;  4BAX A;  2D2Q A;  3I3T B;  4DHJ D;  4BOZ B;  4MGY E;  3MJ5 A;  1D5Z C;  1KF6 B;  2WX1 A;  4JX1 C;  2QCZ A;  2NBW B;  2FCQ A;  2DYB A;  4MM3 B;  4HVB A;  2MBE A;  1UBQ A;  3AED B;  3HM6 X;  2D3C A;  1QF6 A;  4P6V F;  4HDO A;  5D7G A;  2LHE A;  2RGF A;  3ZJT A;  4A3O A;  1R4N I;  2N4F A;  2PPH A;  1UF0 A;  4JE3 B;  3TCA A;  3NOB A;  3TUO A;  2JPH A;  1E9M A;  2Q5W D;  3VQI A;  1V5O A;  3VTW A;  4D2K A;  2M17 A;  3OG5 A;  4AP4 C;  3R7R A;  4NJ6 A;  4US9 A;  1UWX A;  2DZJ A;  4RGO S;  3VDZ A;  2BYT A;  4IKG A;  1N5W A;  1NI2 A;  3R7Q A;  3UI3 A;  5IOI A;  2PJH A;  3NRZ A;  1E8Z A;  2KHW B;  4JIO U;  2WXI A;  1YN4 A;  2LI5 A;  3ZJV A;  3WAP A;  2JWZ A;  4KZC A;  2JZ3 B;  1WJU A;  1GOZ A;  2JZZ A;  4K7U A;  3ZW3 A;  2AQ3 B;  5GMV A;  2KYW A;  2W55 A;  3MFG A;  3R2T A;  4WWP A;  2FE8 A;  4P1B C;  1OQY A;  2A4Z A;  2WXF A;  5LXI B;  1NYR A;  3A4R A;  3AEE B;  2KXJ A;  2KQ7 A;  5J2R A;  1WZ3 A;  3N20 C;  4FUL A;  4KGT A;  1B1Z A;  3B2F A;  4IC7 B;  2G4D B;  2RD0 A;  3DBL B;  1DOI A;  1S1Q B;  1MJD A;  2KMM A;  1SJE D;  1HQR D;  2V1Y A;  3RCZ A;  4IG7 B;  2WXM A;  3B1L X;  2C60 A;  1LO5 D;  4GSW A;  1PUT A;  1G6J A;  3JSV B;  1L0Y B;  2W54 A;  2WDQ B;  1ZOY B;  1KM7 A;  4F7Z A;  3CF6 E;  1CK1 A;  1PFD A;  3A9K B;  4WJN A;  3IVF A;  3MHS D;  2FUG 1;  2JQR B;  2K8B A;  1A70 A;  2KDE B;  2J0M A;  2NVU I;  2GLS A;  1RWS A;  3DBH I;  5FR6 A;  1A5R A;  3BK2 A;  3KUD B;  4OVZ A;  1Q5W B;  2KJ6 A;  2WP9 B;  4N59 A;  5E6O A;  2EMT A;  1QOF A;  1E8Y A;  1WX7 A;  2BF8 B;  3IAM 1;  1IUE A;  4BKS D;  1KH0 A;  1L0V B;  1WX9 A;  3O65 B;  4ITK A;  3OLM D;  4C56 C;  4GLS C;  2CR5 A;  4RGM A;  3DVN U;  1YOV B;  2D3B A;  4XX5 A;  2CHZ A;  4ANW A;  2LAS A;  3AEA B;  4MEL A;  2BVC A;  3DBR B;  5FR3 A;  1WXQ A;  3AE7 B;  1Q10 A;  3GE8 C;  2ZZP B;  2X38 A;  4XGA B;  3RNF C;  2L32 A;  2ONQ A;  3H6N A;  1JWB D;  3HVD A;  2BGF A;  3PPA A;  2J53 A;  2SAK A;  4NQK E;  1YQB A;  1RRB A;  2K8H A;  1GB1 A;  3LB8 C;  2ON8 A;  5J18 A;  1E8W A;  2L8J A;  4FHJ A;  1P98 A;  1WR1 A;  4P7I A;  3U7Z A;  4C00 A;  3ENE A;  3N3K B;  4ANV A;  3DWM A;  3JSV A;  3Q8B A;  1T0Q C;  5IAA C;  4MGZ E;  4OVV A;  4KKI A;  2L00 B;  2XK5 B;  2M1M A;  1FNV A;  2GBJ A;  3VH3 B;  4ANU A;  4L23 A;  2ZPN A;  1CQV A;  4RF1 A;  4YSZ B;  3A9K A;  4DBG A;  1RFK A;  3PO0 A;  1F0Z A;  5IO9 A;  3PLU A;  2K6D B;  4DK5 A;  2KAJ A;  2LGS A;  4ZHP A;  3C0R B;  2BB6 A;  1V81 A;  2LGX A;  4I6P A;  5CTR C;  1PQS A;  1SE9 A;  2IGH A;  2L83 A;  2PVO D;  3U30 A;  1OFF A;  4BVU C;  2OED A;  3FAH A;  3ZO5 B;  1L6U A;  4ASW C;  2N9L A;  5KHQ A;  1WXM A;  3SD5 A;  2V4I B;  1EF5 A;  4HCN B;  1FD6 A;  2WS3 B;  2WGS A;  1MVK A;  3NG0 A;  1HXY D;  2JVC A;  1I7H A;  2KX3 A;  2CU3 A;  1YX5 B;  3RFZ B;  1FXI A;  2WXO A;  4PS8 A;  2KMA A;  1F2R C;  3JW0 X;  4KVG B;  1FMA D;  4US8 A;  2KFK B;  1EF1 A;  5DCN A;  1TY2 A;  4KKJ A;  3LYY A;  2WXK A;  5LLI A;  2KTF A;  2ZW1 A;  4FN2 A;  3VRA B;  2IO1 B;  1E7V A;  2LXC A;  4M0W B;  4W9C A;  3Q8E A;  4W9H A;  4YXD B;  2Z0E B;  4URK A;  1Q0W B;  4LLG M;  1BML C;  4K7S A;  2OOB B;  3PSE B;  2KJH B;  2I1K A;  2LGY A;  3T3N A;  1E7P B;  3KUC B;  3IHP C;  2QJL A;  2XK5 A;  3PRE A;  2N9X A;  3Q8A A;  2KAC A;  3GOE A;  2BWF A;  4RGN A;  2ZJD A;  2REX A;  4ZYS A;  2WXR A;  3QHT A;  3A9J B;  5AEK B;  2JWU A;  1F77 A;  1IGC A;  3Q6B A;  2D3A A;  1WWT A;  2KDF B;  1FO4 A;  1WY8 A;  4OHJ A;  3MC0 B;  4AQ7 A;  1YQ4 B;  5CHV C;  2K9X A;  3PRM B;  1WRI A;  3P2B A;  4CO7 A;  4EZK A;  2Z8L A;  4GN1 A;  3APD A;  4M8N A;  1GC6 A;  3E56 A;  4BKT A;  3NVY A;  3VH4 B;  1DYQ A;  2LHD A;  2WXN A;  3NZU A;  2WYQ A;  3I5J C;  4LNI A;  4IOI E;  5IKC M;  4UDU C;  4LNK A;  1WGK A;  1E0Z A;  4EUT A;  2BKR B;  4GU2 A;  3GZN B;  3Q3O C;  4IDI A;  4ZRI A;  1SB3 C;  1EU4 A;  1XT9 B;  3HRD D;  4TQ1 A;  4N58 A;  3UF8 A;  3VVW B;  3W1Y A;  3GE3 C;  1ZDV A;  3X23 A;  2KNB A;  2UWQ A;  1FCC C;  1YNT E;  2JF5 A;  2KFK A;  2RMM A;  3PS6 A;  4DDI D;  1QQR A;  5C1Z A;  2E6X A;  2AYO B;  1VLB A;  4DHJ B;  4MH0 E;  4M0W A;  2R61 A;  3Q2A C;  2K22 A;  4NJC A;  1WMH B;  2BQQ A;  1JRP A;  1TS4 A;  1C77 A;  4NAW B;  1WGY A;  3HHM A;  2YVC A;  5G5H A;  1FXT B;  3ONS A;  2BKF A;  2RDG A;  3CSF A;  4ZDV A;  3AU4 A;  1XXG A;  5C2T B;  2HDE A;  4NY0 A;  2K39 A;  3RNB C;  3HVZ A;  4HPP A;  2BTE A;  1R4M I;  3A9J A;  1P9D U;  4L2Y A;  5E6J A;  2K3U A;  2MBB B;  3M62 B;  3CMM B;  3L4P A;  2L3Z A;  3I63 C;  1J7C A;  4EZL A;  1MHH E;  5E6N A;  2NMQ A;  2V3P A;  4JL9 A;  4IM3 A;  1P1A A;  1AWD A;  2KN5 A;  1U4A A;  3ZXV A;  3OJ4 B;  1HA5 A;  3EHV A;  2IO2 B;  4C4V B;  4HJK A;  1J0G A;  3ZNI D;  3NUH B;  2GBR A;  1V6E A;  2LXA A;  3ZYY X;  3WAO A;  1Q1O A;  4HPL B;  1QOG A;  4B6W A;  3IXS A;  5BYR A;  3ALB A;  2MCN B;  1ENF A;  4LJP B;  2LGI A;  1WFY A;  2QIL A;  3P63 A;  4ARI A;  2ZVN A;  1WSP A;  4PYZ A;  3IBE A;  5HG2 A;  2RDH A;  2ZCB A;  1I35 A;  2PEA A;  4G0N B;  4TV3 A;  3VUX A;  2KD0 A;  5G55 A;  4YTP B;  2IY1 B;  3KYC D;  2GRI A;  1WM3 A;  3AE6 B;  5L83 A;  3LDZ E;  2BYV E;  1SGH A;  1L4D B;  2KTR B;  2ZNV C;  2MHJ A;  5D3I B;  1LM8 B;  3IT4 B;  2DZM A;  2FBW B;  5BYQ A;  1WMH A;  4WUR A;  2R2Q A;  3HK0 A;  2HD5 B;  4NAW A;  3AE3 B;  1MHX A;  3Q3F A;  1C76 A;  2JY6 A;  3QWZ B;  4EFO A;  1WGG A;  1L0X B;  3ABV B;  5FKA C;  4EE2 A;  3RNA C;  1T0S C;  1I4Q A;  3WA0 A;  3BY4 B;  4C80 A;  3S2A A;  3FKY A;  3TEZ A;  1WYW B;  2DNF A;  3MC9 A;  4OVU A;  3PT2 B;  2WDV B;  4AJW A;  2KOX A;  1XO3 A;  3A33 B;  4TUU A;  2GI9 A;  1KFY B;  4M8M A;  3AE2 B;  4DXG A;  2WLB A;  2GOW A;  1ZDX A;  2GBK A;  1I4R A;  4C4V A;  2ZCC A;  2QEJ C;  1V5T A;  1JWS D;  2GBM A;  3MC8 A;  1SEB D;  2MRP A;  2RR9 A;  3N30 A;  3AEB B;  1RFA A;  1UNS A;  1H4R A;  1VRA B;  1E8X A;  1PGX A;  3V6C B;  5AZG A;  4BKG A;  4A3P A;  1CMX B;  5HHD G;  1T6B X;  2K0P A;  1LQB A;  3AE1 B;  1VZ6 A;  2KTR A;  2N1V A;  3QQ8 B;  2WXG A;  1E5W A;  4G50 A;  1STE A;  1V2Y A;  3SDL C;  2KAN A;  3R66 C;  2EKI A;  1C4P A;  3P4P B;  4IW0 A;  4NPN A;  2C7N B;  3ZDM C;  2A5U A;  4P16 A;  5IP4 D;  2LWP A;  2AQ1 B;  2MEK A;  1J8C A;  1NVI D;  4FJV B;  3H8H A;  2WU2 B;  2ZW0 A;  3ZRC A;  2CJN A;  4W9F A;  1D3Z A;  3Q8C A;  5HI1 A;  1UWM A;  1V1P B;  2J7Q B;  2PMV A;  3ZXR A;  2W9N A;  4BBN C;  2VZK D;  2AL6 A;  5AZH A;  3BYT B;  4M02 A;  1AW7 A;  3TEY A;  3RN9 C;  4GB9 A;  4BKS A;  2N9K A;  2MH7 A;  4HCP B;  1FNU A;  4CYE A;  4HDQ A;  3X0W A;  2INP E;  1EM7 A;  1E90 A;  1EWY C;  1IP9 A;  3SFD B;  5HFY A;  1L4Z B;  1MG8 A;  3ZRF A;  2ZEQ A;  3AB5 A;  3W1S C;  2PTL A;  1WGD A;  4MH8 A;  3U7D A;  3M3J A;  2MJE A;  3T9L A;  2N9P C;  3WAN A;  1T0R C;  2LVO A;  1FXA A;  2JZP A;  1KRH A;  2AWT A;  2OJR A;  4HRO A;  2KKC A;  4IWQ A;  1JCK B;  1WXV A;  3CWI A;  1JWA D;  2KWD A;  2NCN A;  1TKG A;  2NPT B;  3GB1 A;  4ZRK A;  3L0W B;  1P0R A;  2NR2 A;  3QC8 B;  4C7Z A;  3L08 A;  3T8M A;  3QA8 A;  2EMS A;  1J7B A;  3P42 A;  3VRB B;  3RZW C;  1H8C A;  1QIL A;  4FJY A;  3UIP B;  3DQV A;  1PDX A;  3PZ7 A;  1B9R A;  1TKY A;  1D5M C;  3PZ8 A;  4KX6 B;  2AL3 A;  2KLC A;  1AAR A;  3TSS A;  3ZDT A;  1C3T A;  2AEH A;  3V3X A;  2QC8 A;  1GG3 A;  3BIN A;  2WXJ A;  5EE9 A;  1V1P A;  1SBB B;  3AUL A;  4W9L A;  4WJQ A;  2PKO A;  5JHA A;  3P4S B;  5CHF A;  2N0S B;  1I4X A;  4TSS A;  3AE5 B;  2J42 A;  3AMZ A;  5L95 C;  1EUV B;  4PYU A;  1ZGU B;  1WRD B;  3RZF A;  3R3M A;  3QIJ A;  5EE3 A;  1UH6 A;  2KVZ A;  2IO3 B;  4M00 A;  1KJT A;  1EU3 A;  1NI3 A;  3MP9 A;  3RPF C;  2QMT A;  3ZNZ B;  1K51 A;  2WXL A;  3TJP A;  4IM2 A;  3AV8 A;  3ZNG C;  3L17 A;  2QSD A;  4A20 A;  3EUB 2;  2PE9 A;  2MJD A;  1C1Y B;  5D3D A;  2FCN A;  3BWU D;  2DZK A;  3QJZ A;  1FEH A;  2NPT A;  5IN7 A;  2WDT B;  2YLM A;  3I57 A;  3DCG A;  1FRR A;  1YIW A;  1BUI C;  1S3S G;  3VHT C;  3ETR A;  1J19 A;  3NHE B;  3SFE B;  4J6I A;  4JQW C;  1NYQ A;  3DPD A;  2AX5 A;  1D5X C;  4WAF A;  4HKZ E;  1GNU A;  2MBO A;  1WXS A;  4LNO A;  4WWN A;  2DLB A;  4WJP A;  3P4Q B;  3H1U A;  1J7A A;  4YWG G;  3RMK C;  1JML A;  5JZE B;  4RCO A;  3O13 A;  3UGB B;  4MDK E;  4G11 A;  1MFW A;  4EZJ A;  1Y8R C;  2H89 B;  1HTO A;  2CHW A;  3K9P B;  4PS3 A;  1TS2 A;  2JYE A;  3PRZ A;  2PLP A;  3GZN I;  2D11 A;  1X1M A;  2V0G A;  2UU7 A;  4HK2 A;  2BBC A;  3BZD B;  1FIQ A;  2DYM A;  2JU6 X;  4OW0 A;  2MWS B;  4L1B A;  3URY A;  1TYG B;  1YD8 U;  2BT6 A;  5BO4 B;  3PRP B;  1SIF A;  1YJJ A;  1TIF A;  2KQS A;  4HWI B;  2G3Q B;  3AE9 B;  3PHW B;  1QOA A;  1MPE A;  2N1W A;  3FC4 A;  2C9W B;  4MAC A;  2L1A A;  1K53 A;  4MGK E;  4FAD A;  2XEW A;  4A6Q A;  2KMC A;  3JVZ X;  3VTV A;  4B9K A;  3ZLZ A;  1HE8 A;  3HUI A;  1DGJ A;  3TEW A;  5G2N A;  1T3Q A;  4X57 B;  4XWW A;  2IZV B;  2KDI A;  1FRD A;  2CKH B;  1SIJ A;  4B95 A;  2HJ8 A;  4IUM B;  4XE0 A;  1K52 A;  4HPM B;  2WWZ A;  4F1S A;  3DBS A;  1OQQ A;  3I9V 1;  5EDS A;  1XQQ A;  4S17 A;  3K9O B;  4ZOH C;  4DHZ B;  1WX8 A;  1JW9 D;  3TL5 A;  1IPG A;  3P1M A;  2K1F A;  2I38 A;  4ACF A;  4ZRJ A;  4FHK A;  2N7J A;  4B0M A;  4GDK B;  1L5P A;  1GB4 A;  2DEN B;  4NQL B;  1M4V A;  2G4S A;  4KGS A;  2MBQ A;  4II2 B;  1ZKH A;  4ICU A;  4IM0 A;  1YN3 A;  5EE0 A;  3AEG B;  2DAJ A;  4W9I A;  1QKZ A;  5TR5 A;  3KUZ A;  1D4B A;  3W9C B;  1UZX B;  3VR8 B;  2W3R A;  1R7S A;  1UUP A;  2DZI A;  2NS5 A;  3NZS A;  3NZ3 A;  5CX3 A;  2IPK D;  3BK1 A;  2KC2 A;  2FNJ B;  2M0X A;  2KWV B;  1JAL A;  3BVG A;  4I6L B;  3KW5 B;  2KZR A;  2LUE A;  5BMI A;  3IAS 1;  3RNG C;  2NTS A;  3GS2 A;  2NTT A;  1YJ1 A;  2DHZ A;  4NJ7 A;  3VXW A;  1XCQ L;  2KDM A;  4DHZ E;  2L0F A;  3U4E G;  3PTF C;  2I1J A;  1TS5 A;  3VTU A;  1VZ7 A;  1GUA B;  3BVM A;  1KTK A;  2C7M B;  2N9E B;  1F52 A;  1VJK A;  2MLB A;  2J4X A;  1DOX A;  1WI0 A;  4LK0 M;  2M4N A; 
#chains in the Genus database with same CATH homology
 4NPN A;  2C7N B;  3PPA A;  4NQK E;  3ZDM C;  4GMV A;  1YQB A;  3PHX B;  1LFD A;  1RRB A;  2KVR A;  3IFW B;  2A5U A;  2K8H A;  1EO6 A;  4ZYN A;  3SHQ A;  3RUI B;  4HXD A;  2QHO A;  5J18 A;  1JRU A;  2KX0 A;  5DPW A;  1E8W A;  2VRR B;  4MJS B;  4CHK A;  2NBU A;  3HM3 A;  2L8J A;  2LWP A;  2XBB C;  4FHJ A;  4N9F 4;  4KSK C;  1P98 A;  1WR1 A;  1J8C A;  3VFK A;  4P7I A;  3Q3J A;  2IO0 B;  2K8C A;  3ENE A;  4GDK A;  4FJV B;  4WWO A;  3N3K B;  4GDL B;  4ANV A;  2LRW A;  3JSV A;  5IAA C;  3PZD A;  5JH5 C;  3PLV A;  4MGZ E;  2LVQ A;  4OVV A;  2JT4 B;  1TGZ B;  3QK0 A;  3UQB A;  5KHO A;  3A1Q B;  2L00 B;  1WZ0 A;  3ZRC A;  4W9F A;  1D3Z A;  2XK5 B;  2M1M A;  1WE6 A;  2BPS A;  2C7H A;  3ML8 A;  3APF A;  2J7Q B;  4AWJ A;  2NBV B;  2W9N A;  2DAF A;  2GBJ A;  2IY0 B;  3VH3 B;  2AL6 A;  4BBN C;  3MTN B;  3DDC B;  3N32 A;  5AZH A;  4ANU A;  2Z0D B;  2ZPN A;  3A9K A;  4DBG A;  4W9G A;  2FAZ A;  3TBL D;  3DOW A;  2MW5 A;  5CHW A;  3H7S A;  3ML9 A;  3PLU A;  4GB9 A;  2K6D B;  2D10 A;  2MX2 A;  4BKS A;  4DK5 A;  2JUO A;  3PV1 A;  2DYO A;  2RPQ A;  4KSL C;  2MBH A;  5D2M B;  3WAM A;  3H7P B;  4HCP B;  2CHX A;  3IG3 A;  4CYE A;  3OAW A;  4HDQ A;  1WGH A;  3X0W A;  2D3G A;  1E90 A;  2BYF A;  1IP9 A;  3C0R B;  3NY5 A;  2ASQ A;  4K81 A;  1V81 A;  1MG8 A;  3ZRF A;  3ZVV A;  2ZEQ A;  3W1S C;  1WGD A;  2LGX A;  4I6P A;  5CTR C;  3U7D A;  1PQS A;  1SE9 A;  3M3J A;  4KIK B;  3RYT A;  4E71 A;  4FA6 A;  3T9L A;  2N9P C;  4W9J A;  3WAN A;  3EC8 A;  3U30 A;  3RD2 A;  4BVU C;  3APC A;  3ZO5 B;  2LVO A;  4ASW C;  3KH0 A;  2JRH A;  2M8S A;  5KHQ A;  3L10 B;  4DDG D;  1WXM A;  2AWT A;  2OJR A;  3SD5 A;  2KKC A;  2LVP A;  4FLH A;  2B3A A;  4IWQ A;  3AU5 A;  1EF5 A;  1WXV A;  1WJ4 A;  4HCN B;  4GXB A;  4W9D A;  4AOF A;  2FIF A;  2NCN A;  3CST A;  2JVC A;  2NPT B;  4TQ0 A;  3RUL A;  2KX3 A;  4ZRK A;  1YX5 B;  2CS4 A;  3L0W B;  5D6J B;  3A4S C;  3DBL I;  1KOT A;  4MGI E;  4PS8 A;  2KMA A;  2KC1 A;  2MSE D;  3JW0 X;  3D32 A;  1P0R A;  4XZ4 A;  5LXH A;  4KVG B;  2MP2 B;  2IBI B;  2NR2 A;  3JYU A;  2KFK B;  1EF1 A;  3QC8 B;  3L08 A;  5DCN A;  3QA8 A;  2EMS A;  3T8M A;  1XD3 B;  5LLI A;  3RZW C;  2KTF A;  4G3X B;  3ZUN A;  4FN2 A;  2KDB A;  1H8C A;  1WR6 E;  2IO1 B;  3NS8 A;  1E7V A;  2ZNV B;  4FJY A;  2V3S A;  2LXC A;  3UIP B;  3DQV A;  1OEY A;  3U8Z A;  5C23 A;  4M0W B;  4W9C A;  4ICV A;  4W9H A;  2LJ5 A;  3V62 A;  4MJS A;  1I42 A;  4II3 B;  1BT0 A;  3M95 A;  2Z0E B;  4URK A;  4K1R B;  1Q0W B;  4XC2 A;  1L7Y A;  2AL3 A;  4K7S A;  2OOB B;  2KLC A;  3PSE B;  3UIO B;  3PGE A;  2KJH B;  2I1K A;  1AAR A;  2MQJ A;  3ZDT A;  1C3T A;  2AEH A;  4GDL A;  2LGY A;  3KUC B;  1LXD A;  3B08 A;  1GG3 A;  1QZE A;  2HTH A;  3BIN A;  3A1Q A;  2Y5B B;  3IHP C;  4AJY B;  2XK5 A;  5DPT A;  3PRE A;  2HE7 A;  2N9X A;  3AUL A;  4W9L A;  4WJQ A;  3GOE A;  1OEY J;  3VAW A;  5JHA A;  2BWF A;  3SU8 X;  3EFU A;  1UGM A;  2ZJD A;  5CHF A;  4E74 A;  2REX A;  2LD9 A;  4MSQ B;  4W9E A;  2O6V A;  2FCS A;  4DXA B;  3QHT A;  1ZW7 A;  3A9J B;  2GMI C;  2KK8 A;  5AZF A;  5AEK B;  2ZVO A;  5L95 C;  2FCM A;  1EUV B;  5J17 A;  3AI5 A;  3H7P A;  2R2O A;  4PYU A;  4AUQ C;  1ZGU B;  1L2N A;  4KDL B;  1WRD B;  4IWO A;  2KDF B;  3RZF A;  2J0J A;  1WM2 A;  2L0T A;  3R3M A;  3DVN V;  3QIJ A;  1KLV A;  1UH6 A;  3RT3 B;  2IO3 B;  2WX0 A;  1KJT A;  3WIM A;  1WY8 A;  4KDI C;  3ZIM A;  4MSM B;  4EKU A;  1YX6 B;  4WAA A;  1OGW A;  4KIK A;  3ZNZ B;  5CHV C;  3PRM B;  3ZTC A;  3L16 A;  3P2B A;  4CO7 A;  1RAX A;  4EZK A;  2C5L C;  3MJW A;  1GC7 A;  4GN1 A;  4BBN F;  3KVF B;  3APD A;  4M8N A;  4FBJ B;  1GC6 A;  3TJP A;  4IM2 A;  4BKT A;  3ZNG C;  3L17 A;  3V61 A;  3VH4 B;  3DBR I;  3QAR A;  2O6V B;  5HKH A;  3NZU A;  3UIN B;  4A20 A;  3AXC A;  2WYQ A;  2PE9 A;  1M94 A;  4JLC A;  1VCB A;  2L76 A;  1C1Y B;  4KV2 A;  2KFJ A;  4RM8 A;  2FCN A;  5DPS A;  2DZK A;  3QJZ A;  4EUT A;  2BKR B;  4GU2 A;  4PS7 A;  4BOS C;  2NPT A;  4ZRI A;  2BYE A;  4TQ1 A;  1XT9 B;  3VVW B;  3W1Y A;  4K7W A;  3UF8 A;  3ZNH B;  2WDT B;  3ZTD A;  2G45 B;  3VUW A;  3X23 A;  2KNB A;  2UWQ A;  2IYD B;  4RMA A;  2MP2 A;  1V86 A;  1WH3 A;  2N7D A;  2JF5 A;  2YLM A;  2K25 A;  2EKE C;  3DCG A;  3DVG X;  3QAQ A;  2KFK A;  3PS6 A;  2BWE S;  1YIW A;  4DDI D;  2O6V D;  5C1Z A;  2KWC A;  1V80 A;  1S3S G;  3VHT C;  2AYO B;  4MM3 A;  4NNJ B;  1J19 A;  3NHE B;  1Z2M A;  4DHJ B;  1P3Q U;  4DWF A;  4MH0 E;  1NBF C;  4J6I A;  4LDT B;  4LCD E;  4EOY A;  2UYZ B;  3L54 A;  4WQO B;  1TTN A;  4JQW C;  3DPD A;  2LGD A;  4MEM A;  4I6N B;  3UQA A;  1IYF A;  1WMH B;  3TMP B;  2N7E A;  3V60 A;  1GNU A;  2MBO A;  1WXS A;  2ZPY A;  4NAW B;  4WWN A;  4WJP A;  1WGY A;  3PVL A;  1NDD A;  1GJZ A;  1VD2 A;  3HHM A;  3H1U A;  2D2Q A;  2YVC A;  3I3T B;  4DHJ D;  4BOZ B;  1FXT B;  3ONS A;  2BKF A;  4MGY E;  5JZE B;  4LDT D;  3CSF A;  4ZDV A;  3UGB B;  1WXA A;  3AU4 A;  5D94 A;  2WX1 A;  4G11 A;  4MDK E;  4NY0 A;  2K39 A;  4EZJ A;  1Y8R C;  2NBW B;  3TIX A;  2FCQ A;  1TBE A;  2DYB A;  2MA9 B;  5IA7 A;  1R4M I;  4HVB A;  2MBE A;  1UBQ A;  2CHW A;  3HM6 X;  3K9P B;  4EEW A;  4PS3 A;  4HDO A;  1RLF A;  5D7G A;  3PRZ A;  2RGF A;  3A9J A;  3GZN I;  2D11 A;  1Z5S B;  4A3O A;  1P9D U;  1R4N I;  2N4F A;  2PPH A;  1X1M A;  2MBB B;  3M62 B;  4HK2 A;  1WF9 A;  3TCA A;  3NOB A;  2JPH A;  4KZ0 A;  2DYM A;  3VQI A;  3CMM B;  2L3Z A;  2MWS B;  1V5O A;  3VTW A;  5E6N A;  4JL9 A;  4EZL A;  1UBI A;  1P1A A;  1YD8 U;  4IM3 A;  2M17 A;  3M63 B;  5BO4 B;  3PRP B;  2KN5 A;  4AP4 C;  1U4A A;  1SIF A;  3OJ4 B;  3R7R A;  4NJ6 A;  2LZ6 A;  2DZJ A;  2IO2 B;  3EHV A;  3VDZ A;  2FID A;  3H9D A;  4HJK A;  2KQS A;  2KJR A;  3EEC A;  4HWI B;  3ZNI D;  1J0G A;  2GBR A;  1NI2 A;  3HIZ A;  1V6E A;  3R7Q A;  4TKN A;  2LXA A;  2G3Q B;  3WAO A;  3PHW B;  2PJH A;  2O2V B;  1K8R B;  1E8Z A;  2K6Q A;  2KHW B;  4JIO U;  2LI5 A;  1Q1O A;  4HPL B;  3WAP A;  4B6W A;  2J0K A;  2N1W A;  2Z59 B;  3LJ3 A;  2JWZ A;  2MCN B;  3ALB A;  4LJP B;  2C9W B;  1E7U A;  3V6E B;  4KZC A;  1F9J A;  2JZ3 B;  1WFY A;  2PE6 B;  4MGK E;  2ZVN A;  4E3C A;  4FAD A;  1WJU A;  4PYZ A;  2XEW A;  3IBE A;  2JZZ A;  3L13 A;  4K7U A;  2ZCB A;  4IWP A;  1I35 A;  2KMC A;  3ZW3 A;  3JVZ X;  2PEA A;  3VTV A;  4G0N B;  4B9K A;  4WJO A;  4TV3 A;  3VUX A;  3ZLZ A;  4HLE A;  1HE8 A;  2KD0 A;  2LRU A;  5GMV A;  5G55 A;  2IY1 B;  5G2N A;  3KYC D;  4X57 B;  2IZV B;  2KDI A;  1WM3 A;  4WWP A;  5L83 A;  2CKH B;  3LDZ E;  3ECI A;  1T0Y A;  4B95 A;  2BYV E;  1SGH A;  4LJO B;  3QX1 A;  4GIV A;  2HJ8 A;  1OQY A;  2KTR B;  2A4Z A;  5LXI B;  2ZNV C;  1WGR A;  1LM8 B;  2DZM A;  4IUM B;  3A4R A;  4W9K A;  2KXJ A;  2RSU A;  1WMH A;  2KQ7 A;  4HPM B;  4F8C B;  2R2Q A;  5J2R A;  2WWZ A;  4F1S A;  1WZ3 A;  3HK0 A;  3DBS A;  2HD5 B;  4FUL A;  4IC7 B;  4NAW A;  2G4D B;  2RD0 A;  1XQQ A;  5EDS A;  1OTR B;  4YL8 A;  3K9O B;  3Q3F A;  4RM9 A;  1S1Q B;  2JY6 A;  4DHZ B;  2V1Y A;  3QWZ B;  4EFO A;  4ANX A;  1WX8 A;  3RCZ A;  4IG7 B;  2KO3 A;  3B1L X;  3TL5 A;  2C60 A;  1IPG A;  2K1F A;  1WGG A;  5DPR A;  4GOC A;  4ZRJ A;  4FHK A;  3OJ3 A;  5E6P A;  4GDK B;  4GSW A;  3WA0 A;  3BY4 B;  1G6J A;  2DEN B;  3S2A A;  3JSV B;  4NQL B;  2JXX A;  2KLG A;  2G4S A;  1WJN A;  1WYW B;  2D07 B;  1V49 A;  3KYD D;  2MBQ A;  3WAL A;  4II2 B;  1KM7 A;  1ZKH A;  4F7Z A;  4ICU A;  4OVU A;  2JRI B;  3CF6 E;  3PT2 B;  1UD7 A;  4IM0 A;  4AJW A;  1WJ6 A;  3B0A A;  3A9K B;  2KOX A;  4WJN A;  3IVF A;  3MHS D;  1WIA A;  3A33 B;  2DAJ A;  2K8B A;  4TUU A;  3ZKJ C;  2KDE B;  2J0M A;  2NVU I;  4W9I A;  4M8M A;  5TR5 A;  5JHB A;  3KUZ A;  2GOW A;  2KWU B;  3DBH I;  5FR6 A;  1UZX B;  2GBK A;  3DVG Y;  1A5R A;  3KUD B;  2ZCC A;  1Q5W B;  1WE7 A;  2DZI A;  2KJ6 A;  2NS5 A;  3NZS A;  5CX3 A;  1V5T A;  5E6O A;  2EMT A;  2O2V A;  2GBM A;  2KC2 A;  2FNJ B;  2M0X A;  2KWV B;  2DX5 B;  2MRP A;  4FJZ A;  3W1S A;  1E8Y A;  1WX7 A;  2BF8 B;  2RR9 A;  4I6L B;  2CU1 A;  2V4L A;  3N30 A;  4BFR A;  1RFA A;  3KW5 B;  4BKS D;  2KZR A;  1H4R A;  2LUE A;  1WX9 A;  3O65 B;  2GBN A;  1E8X A;  3V6C B;  5AZG A;  3OLM D;  4BKG A;  2CR5 A;  1YJ1 A;  1CMX B;  4A3P A;  3DVN U;  1UEL A;  2DHZ A;  4NJ7 A;  4XX5 A;  2CHZ A;  3VXW A;  1TZ1 A;  4GGQ A;  1V9J A;  4ANW A;  4DHZ E;  2LAS A;  1LQB A;  2KTR A;  2N1V A;  3QQ8 B;  2L0F A;  2L05 A;  4MEL A;  1E5W A;  3PTF C;  2FUH B;  4G50 A;  2I1J A;  1V2Y A;  3SDL C;  3VTU A;  2ZZP B;  1GUA B;  2C7M B;  2KAN A;  3R66 C;  2N9E B;  1ISN A;  3QCA A;  3VUY A;  2L7R A;  2MLB A;  1WI0 A;  3H6N A;  4JGH B;  4IW0 A;  2M4N A;  2BGF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...