3WANA

Crystal structure of atg13 lir-fused human lc3a_2-121
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
126
structure length
126
Chain Sequence
DDFVMIGSPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of the autophagy-related LC3/Atg13 LIR complex: recognition and interaction mechanism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Autophagy-related protein 13, Microtubule-associated protein
total genus 34
structure length 126
sequence length 126
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3wanA00
1RLFA 1WRDB 3BY4B 4LDTD 2KJRA 3AXCA 4I6LB 4KIKB 4LJPB 2KQSA 3IFWB 4ICVA 4MSQB 4PS7A 4IWPA 3QCAA 1E8WA 3EC8A 3R3MA 3ENEA 4EKUA 3A4SC 2CHWA 3ZDMC 4JIOU 4HPLB 3X0WA 2ZNVB 5DPWA 3WIMA 2LGXA 3VH4B 2EKEC 3TMPB 3NZUA 2LZ6A 2RGFA 3L16A 3VTVA 3M62B 4GDLA 4IM2A 2RR9A 4DXAB 1GC6A 2GBMA 4EEWA 2IY0B 2KO3A 1WGDA 3M63B 4KIKA 3ZNZB 4WJQA 2WWZA 3VUYA 2BF8B 3NHEB 1EO6A 3IVFA 4AOFA 5HKHA 1U4AA 1E8XA 1WXAA 4URKA 2K25A 3QC8B 2CKHB 2LJ5A 1UD7A 4DDGD 4E71A 5JH5C 3UIPB 3QIJA 1WXMA 2KQ7A 3RD2A 4B6WA 4ANWA 2KHWB 4TUUA 4DWFA 1YQBA 2MSED 3WA0A 4MGKE 1X1MA 4K1RB 4A3PA 1ZGUB 1EUVB 2KDEB 1V80A 1L2NA 3H7PA 4KDLB 2O6VD 5LXIB 4OVVA 2DZMA 2KWVB 1SIFA 3KUDB 2K6DB 4ANUA 4G3XB 1OTRB 1ZKHA 1WF9A 2DX5B 2KDFB 3B1LX 4NQKE 2KN5A 5J2RA 3PTFC 3VTWA 2AL6A 1WYWB 4IWQA 1V6EA 2GBRA 3ZNID 3JSVB 2JXXA 3H1UA 1WGHA 1KM7A 1WZ0A 2N7EA 4KZCA 3WALA 4RMAA 3K9OB 5AEKB 2FCQA 2N9EB 1YX6B 5DCNA 4MSMB 4FJYA 3L0WB 4HDOA 3L10B 1XQQA 2MP2B 1GUAB 2PEAA 4AUQC 3N3KB 2EMSA 3PRMB 4KVGB 3ZNHB 1R4MI 4MGYE 2KNBA 4GGQA 4ZRIA 5E6OA 3RULA 4BOSC 3APFA 3DDCB 1UGMA 2MBHA 3VUXA 2KJ6A 2BWFA 4FHKA 1EF5A 2BKRB 1HE8A 3H6NA 1RAXA 2Z0EB 2BYFA 4JLCA 2LGYA 3KVFB 4NNJB 3WANA 4ICUA 4X57B 2K39A 4ZRKA 2KC1A 3V60A 4HVBA 4AJYB 2BKFA 4W9DA 1E7VA 3PLUA 4GSWA 4GU2A 3TJPA 2MW5A 5JZEB 4PS8A 2IYDB 1WE6A 2G45B 2Z0DB 1WY8A 4EZKA 2KDIA 2HE7A 3MTNB 3K9PB 3KUZA 4K7UA 1NDDA 4IWOA 2FIFA 2O6VA 3UGBB 3RZFA 3ZRCA 5DPSA 5CX3A 2KXJA 2GOWA 2AYOB 1UH6A 2B3AA 1I35A 2D07B 1ZW7A 1EF1A 4YL8A 3RZWC 3L13A 3HM6X 5E6PA 2G3QB 2KOXA 2JZ3B 2OOBB 1RFAA 2FCMA 4NAWA 1P0RA 4MGZE 4XX5A 3DBSA 4WWNA 1TZ1A 4GDKA 2C7HA 2JRHA 2KFKA 4BBNF 2N9XA 2KTFA 1PQSA 1JRUA 1YD8U 2PE6B 3R7QA 4AWJA 5KHOA 1TGZB 3B0AA 2J7QB 4PS3A 2L3ZA 4ASWC 1NBFC 1GJZA 3PRPB 1A5RA 3DBRI 1LXDA 2LGDA 4N9F4 4W9HA 3QA8A 4CHKA 5C1ZA 4GDLB 1GNUA 1WX7A 2QHOA 2WYQA 2LD9A 4G50A 4GDKB 4WAAA 4A20A 4K81A 2L00B 2XBBC 4A3OA 4TV3A 3N30A 3ONSA 2KC2A 4EZJA 1WX9A 3ALBA 3U8ZA 3ML9A 2KX0A 3PLVA 2D2QA 1E90A 2ZCBA 4G0NB 1AARA 4IW0A 4WWOA 3JYUA 5GMVA 2LXCA 4DHJD 2IO3B 2YVCA 4F8CB 3I3TB 3KYCD 2I1KA 2D10A 3VH3B 1V5OA 2LVPA 1IPGA 1RRBA 1WJUA 2I1JA 2MP2A 2L8JA 2MA9B 2WX0A 3A1QA 3ECIA 4W9JA 4W9KA 1ISNA 1LFDA 3DVGY 3QK0A 4RM8A 4DHZB 2KLCA 3NZSA 2KKCA 3CSFA 3W1SC 3WAMA 4FADA 3T8MA 2NBVB 3SHQA 2GBNA 4B9KA 1WH3A 1E8YA 2LRUA 3AULA 3H7PB 1D3ZA 3ZIMA 4FLHA 4NJ6A 1WIAA 3AU4A 3PVLA 3W1SA 2A5UA 2LVQA 4KDIC 5LXHA 5D2MB 4MELA 2BWES 1E8ZA 3Q3FA 2ZJDA 3M95A 3U7DA 3PV1A 3A9KB 1V86A 3U30A 1J0GA 4IUMB 3N32A 2KFJA 2C5LC 5IAAC 2LUEA 3VUWA 1WX8A 1V9JA 2W9NA 5D7GA 1WFYA 2IO2B 3D32A 4IM0A 3OAWA 2UWQA 3ZUNA 4JGHB 4NY0A 3WAOA 2DYMA 5DPRA 1LM8B 2K8HA 4BOZB 4DK5A 1CMXB 3HK0A 4BKGA 1TTNA 1FXTB 4FBJB 3DPDA 3SDLC 4E74A 1E5WA 2KFKB 2NR2A 3APCA 2IO0B 2WDTB 2JPHA 3PT2B 2NPTA 3UIOB 2JY6A 2XK5B 3DBHI 4NPNA 3V62A 2C60A 2MBEA 2KDBA 2N4FA 2YLMA 5L95C 4FULA 3PRZA 4TQ0A 2M1MA 1LQBA 2V3SA 4ANVA 4WJNA 3PZDA 1GC7A 3VHTC 2C7NB 2FUHB 2R2OA 3L54A 3QX1A 3UINB 3R66C 3A9JA 1Q5WB 4WJPA 4ZDVA 4GXBA 1G6JA 3DVGX 2KANA 1VCBA 3AU5A 5J18A 3SU8X 2N9PC 5CHVC 2Z59B 4FJVB 3UQAA 1WXSA 2MQJA 1XT9B 2ZPYA 4MJSB 1YIWA 2CHXA 3PHWB 4BKSD 4BKTA 5D6JB 4E3CA 2DYOA 4ZYNA 5C23A 4CYEA 4TQ1A 4W9FA 3DVNU 1UELA 5BO4B 2L76A 3S2AA 3UF8A 2KTRB 2MBQA 3HM3A 1WJ6A 2XEWA 3M3JA 1Q1OA 4K7WA 1Z5SB 2IZVB 3CSTA 3CMMB 2G4SA 4HLEA 3O65B 2KMCA 4MJSA 2JRIB 4M8NA 2PJHA 4ANXA 2IO1B 2ZPNA 4FJZA 4EOYA 3RT3B 2CU1A 4I6PA 3W1YA 2M8SA 3GOEA 3A9KA 3IBEA 2L7RA 3PS6A 2RSUA 4LDTB 1S1QB 2C7MB 2IY1B 2ZEQA 3ZTDA 3EFUA 2JZZA 3HHMA 3OJ4B 2MRPA 2NVUI 2DAFA 2JVCA 2A4ZA 1SE9A 3V6EB 2DHZA 2KD0A 2N1VA 1V5TA 3VAWA 5L83A 4OVUA 3QWZB 2FCNA 4II2B 2KLGA 2KVRA 3VXWA 4W9CA 4DHJB 2DZKA 4KV2A 1V49A 4FA6A 5G2NA 4JL9A 3APDA 5JHAA 4BKSA 2M4NA 4BVUC 2LI5A 1H8CA 2KX3A 3NS8A 4G11A 4GN1A 2V4LA 4P7IA 4J6IA 1S3SG 2RPQA 3C0RB 3RUIB 2KTRA 2MBOA 4IG7B 3ZVVA 5EDSA 4EFOA 1UBQA 1IYFA 3RCZA 4HPMB 1P98A 3V6CB 1WMHB 2HJ8A 1SGHA 1YJ1A 4PYZA 2HD5B 2FNJB 1MG8A 2L05A 2LWPA 2O2VB 3V61A 1WGRA 1F9JA 4CO7A 1T0YA 3DCGA 4LCDE 2JUOA 2UYZB 4GMVA 4RM9A 4IC7B 2CHZA 2Y5BB 4KSLC 5FR6A 5DPTA 3MHSD 2J0MA 3QAQA 3MJWA 1V81A 1J19A 2LVOA 2M17A 4BBNC 1Q0WB 5CHFA 2M0XA 3CF6E 3OJ3A 3PSEB 4MDKE 1C3TA 4W9EA 2G4DB 3LDZE 1Z2MA 5AZGA 3ZRFA 1H4RA 4MM3A 2BPSA 2LASA 2LRWA 3DOWA 1WJNA 1WXVA 2XK5A 4IM3A 5AZFA 1WE7A 2L0FA 3TCAA 2FCSA 3JVZX 3ZKJC 4AJWA 5KHQA 2NPTB 3TL5A 3DBLI 3DVNV 3R7RA 3ZO5B 1WGYA 3H7SA 3ZTCA 2GMIC 5TR5A 1P9DU 1IP9A 4NJ7A 4B95A 2DZJA 4HCPB 1YX5B 1UZXB 3GZNI 4II3B 1WJ4A 2JWZA 1WR1A 2ZNVC 4FN2A 2GBKA 2KJHB 2HTHA 3A9JB 1KOTA 1P3QU 2NBUA 1R4NI 1QZEA 1WMHA 1WM3A 2DYBA 1WZ3A 5E6NA 2D3GA 3VVWB 1TBEA 2BYVE 2ZZPB 3H9DA 3VQIA 4DDID 3L08A 4W9LA 2FAZA 3KH0A 4KSKC 2O6VB 4JQWC 2KK8A 4HCNB 1K8RB 4PYUA 3ZLZA 3ZNGC 4XC2A 4F7ZA 3ML8A 2AEHA 4MEMA 4AP4C 4WJOA 1UBIA 2GBJA 3L17A 1E7UA 1BT0A 4KZ0A 2CS4A 5AZHA 5G55A 4M8MA 1OQYA 2J0JA 2N7DA 2REXA 3QHTA 4HDQA 2R2QA 2AWTA 3QJZA 2K8BA 2DZIA 4TKNA 1P1AA 2PE9A 4W9GA 2LXAA 3A33B 2K8CA 2WX1A 1V2YA 2RD0A 4NAWB 2V1YA 2MBBB 2ZVNA 3ZDTA 1OGWA 3B08A 2EMTA 4I6NB 2OJRA 2AL3A 3SD5A 3JW0X 2FIDA 2JT4B 2PPHA 3RYTA 2NBWB 2J0KA 5LLIA 3IHPC 2BGFA 3Q3JA 3IG3A 1Y8RC 2D11A 2VRRB 2NCNA 3DQVA 1WR6E 2KWCA 3KYDD 1XD3B 3PREA 3VFKA 3VDZA 3AI5A 4MH0E 1NI2A 4HXDA 4GIVA 4DBGA 4FHJA 3NOBA 1WM2A 1I42A 1OEYJ 1L7YA 3ZW3A 3QQ8B 1KLVA 3OLMD 1KJTA 5J17A 1WGGA 2KZRA 3PGEA 3KUCB 2ASQA 3QARA 3T9LA 1M94A 4F1SA 4W9IA 3NY5A 5CHWA 4WQOB 5CTRC 2MX2A 1VD2A 4K7SA 1GG3A 4EZLA 5IA7A 4GOCA 4M0WB 3PPAA 3A1QB 3TIXA 4NQLB 4ZRJA 3EHVA 3VTUA 4HWIB 4LJOB 3LJ3A 4MGIE 2NS5A 3PHXB 3P2BA 1OEYA 3JSVA 3X23A 4WWPA 2CR5A 4GB9A 4HK2A 4XZ4A 5JHBA 2IBIB 2KWUB 4EUTA 2DENB 1WI0A 2KMAA 2BYEA 3WAPA 1C1YB 2JF5A 2K6QA 3KW5B 2ZCCA 4BFRA 3UQBA 2O2VA 2L0TA 2ZVOA 2K1FA 2MWSB 2MLBA 3BINA 3EECA 5D94A 1J8CA 2N1WA 2MCNB 3A4RA 2DAJA 4DHZE 3HIZA 2C9WB 4HJKA 3TBLD
chains in the Genus database with same CATH superfamily
1VR9A 2WXPA 1WRDB 4I6LB 2KQSA 3ZJVA 3IFWB 2J52A 4IWPA 1E8WA 4ZHPA 3EC8A 4EKUA 3GS2A 3A4SC 2CHWA 4HPLB 3Q8EA 3BYYB 1OFFA 3WIMA 2INPE 3MJ5A 2EKEC 4DXFA 2FUG1 3NZUA 1JQ4A 1JMLA 2N0SB 1VRAB 2BS4B 3P1MA 4JWUC 2WWZA 1CQVA 3IVFA 2D5GA 4AOFA 4WURA 1E8XA 1WXAA 3DHGC 1L4DB 1LGRA 5JH5C 3QIJA 1WXMA 4DWFA 4MGKE 1X1MA 3DBLB 1V80A 2K3UA 1YJJA 4OVVA 3KUDB 1D5XC 5BYRA 2K6DB 1OTRB 2K5PA 2YEPF 1AWDA 3VTWA 1WYWB 1V6EA 3H1UA 4J3OD 2FCQA 2N9EB 1I4HA 4M02A 1XQQA 1GUAB 4AUQC 3PRMB 3ZNHB 1R4MI 5E6OA 5FK9C 3APFA 3DDCB 2MBHA 3BYTB 2BKRB 1HE8A 4ZRQA 2Z0EB 1SJED 2K39A 4A9AA 1E7VA 3PLUA 2MW5A 4PS8A 5E6JA 2G45B 2Z0DB 4EZKA 2KDIA 4LTUA 4K7UA 4IWOA 2O6VA 3UGBB 2LMCA 4WH4A 4C4VB 1ZXIA 2HDEA 2INDC 2KXJA 2GOWA 3PZ7A 1I35A 1N5XA 4ZHOA 3RZWC 4BAXA 2KOXA 4XDCA 3Q3NC 2H89B 3BK2A 4H2AA 1ENFA 2FCMA 3ZJUA 1FFVA 4WWNA 1TZ1A 1V1OA 2JRHA 4BBNF 2N9XA 1JRUA 2PE6B 3R7QA 5KHOA 1TGZB 3GP7A 1A5RA 3DBRI 5C1ZA 4C56C 3P4SB 2WYQA 4A3OA 4TV3A 4KGSA 3ALBA 1J7BA 3U8ZA 3PLVA 1E90A 4C4VA 2J4XA 3I3TB 3VH3B 1PUTA 1WJUA 1QOBA 2WX0A 2MP2A 1JWMD 3H8HA 4W9KA 1ISNA 1TYGB 3T3OA 1Q10A 3SHQA 1E8YA 2LRUA 1XLNA 2HTME 1SSNA 1XCTL 5D2MB 2QMTA 1N62A 4RGNA 3Q3FA 3V3XA 2ZJDA 1T6BX 2L32A 2N7JA 4ARIA 1HA5A 4QAYA 3N32A 3W5UB 1WX8A 1V9JA 2Q5WD 5D7GA 1STEA 3D32A 2E6XA 4UDUC 5G5GA 3OAWA 3DBHB 4NY0A 1WYGA 2WXQA 1VLBA 4BOZB 1QF6A 1CMXB 3P4QB 3HK0A 3VR9B 1TS3A 4OZCA 5D3IB 3SDLC 1EM7A 2WXKA 3UIOB 1JALA 2PMVA 4KGRA 2C60A 2YLMA 5L95C 3PRZA 4TQ0A 2M1MA 2KYWA 1FNWA 2LGIA 4ANVA 1GC7A 1QT9A 4MT5A 3QX1A 4C7ZA 4WJPA 2KANA 3AMZA 3AU5A 3SU8X 3BWUD 4FJVB 3DWGC 4YTNB 1V8CA 1WXSA 3C8YA 4BKTA 2L76A 1V1PA 3S2AA 2KTRB 2MBQA 2WQYB 2IJ0A 2JSVX 1Q1OA 4HRSA 2IZVB 3CSTA 1R4MB 4HLEA 3KWLA 1WSPA 2IO1B 2ZPNA 4EOYA 1SE3A 3J9CA 4KKJA 5FKAC 2WXFA 3GOEA 2J42A 2L7RA 2RSUA 2IY1B 1K51A 3EFUA 3HHMA 1N60A 2JXTA 1GPXA 3C19A 4S0RA 2NVUI 1RWSA 1SE9A 1F77A 1FCCC 3NVZA 1SBBB 3N1YC 1YOVB 2XN9C 1E10A 4KV2A 1ZE3D 1D6EC 1PGAA 4BKSA 1C9FA 2M4NA 4BVUC 2LI5A 1QOGA 4GN1A 4P7IA 2RPQA 3C0RB 2MBOA 4MH8A 3RNBC 4HPMB 2MJ3A 5IN7A 1YJ1A 3BVGA 2O2VB 1WGRA 1C77A 4IC7B 2Y5BB 2Y3AA 1R7SA 3I63C 2BB6A 3QAQA 1J19A 2M17A 3E9SA 4MDKE 4JWSC 1Z2MA 4PK1A 1WJNA 1WXVA 4P6VF 3ZKJC 3CIRB 4RH6A 3DBLI 1KFYB 1WRIA 3PZ8A 3ZO5B 2GMIC 2BBCA 3R2IA 2DZJA 2LEKA 2KJHB 1PFDA 3EUB2 4YXDB 1NENB 1QZEA 1N6ZA 4RGMA 1QILA 2ZZPB 3VQIA 1TY2A 4KSKC 1K8RB 1MVKA 3ZNGC 4MEMA 4AP4C 1UBIA 1V1PB 3MC8A 2MJDA 3U4EG 3RNAC 2J0JA 1FXAA 4HDQA 3QHTA 1CK1A 4P1CC 2PE9A 4W9GA 3A33B 2K8CA 2WX1A 3SFDB 2RD0A 4JPSA 2MBBB 1OGWA 1EWYC 2OJRA 2LJIA 4I6NB 3JW0X 2FIDA 1JROA 2PPHA 1VZ7A 2VRRB 3PREA 1HTOA 3VDZA 3VFKA 2WXRA 4DBGA 1UWMA 3ZW3A 3OLMD 5J17A 1WGGA 4AS1A 3T9LA 1P7FA 2MX2A 4K7SA 3TSSA 3SFEB 2V0GA 1E9MA 4NQLB 1HEZE 3EHVA 4HWIB 3LJ3A 2VZKB 3PHXB 3X23A 3ZYYX 1ESFA 4GB9A 4P16A 3HRDD 4EUTA 1WI0A 3Q8AA 4HROA 3NS1A 2RDBC 4PT5A 3ZJTA 2ICIA 3BINA 5D94A 4RFBA 1ACCA 3I57A 4DHZE 1UUPA 1ZDXA 2YEPB 3BY4B 2KJRA 3AXCA 3URYA 2W55A 3HVDA 4OW0A 1YN5A 4PS7A 1BUIC 4EE2A 3ZDMC 2FBWB 1QLBB 1I4XA 4NZLB 3BIID 2ZNVB 1C78A 3BK1A 2RGFA 3L16A 1TIFA 3M62B 4GDLA 4IM2A 4DXAB 1GC6A 1TT5B 3Q3OC 2IY0B 1SIJA 4EEWA 1WGDA 3ZNZB 1EU4A 5T8IA 4YT0B 5BMHA 4R3DA 5HKHA 2WDRB 1JWAD 2CKHB 3HUIA 2LJ5A 3NRZA 2QJLA 1UD7A 4HEA1 3UIPB 4IKGA 4C7YA 1YQBA 2MSED 2R61A 1I4PA 4K1RB 4A3PA 1EUVB 1MJDA 2AQ2B 1L2NA 1I4GA 5H92C 2L52A 2O6VD 5LXIB 2D3AA 2DZMA 4ANUA 2BYTA 2WDQB 2KDFB 1TKGA 3W9CB 1KM7A 1WZ0A 4KZCA 3WALA 3K9OB 3FILB 1IUEA 4YWGG 2OJWA 4HKQA 1YX6B 1YJIA 4MSMB 4WWMA 3L0WB 5BYSA 3L10B 2GB1A 1C4PA 3N3KB 4MGYE 3RULA 3KLSX 2BWFA 4FHKA 1XF5L 2WXOA 4JLCA 3KVFB 3EGRA 3WANA 1TJEA 4XE0A 3AEFB 2K9XA 4HVBA 2DLBA 2NMQA 1DGJA 4GSWA 4GU2A 3I9V1 2DWQA 4YSZB 5JZEB 4LNIA 3AEAB 3MC0B 3MTNB 4HJGE 4TMAB 4XYCA 2FIFA 3RZFA 5CX3A 3W5VB 2KT7A 3AM9A 1C4AA 1ZW7A 3U7ZA 4YL8A 3L13A 1HXYD 2V9HA 2OOBB 1YMHE 1RFAA 3Q2AC 5I4DA 4RGOS 4XX5A 3DBSA 4GDKA 4KGTA 3RNCC 2KTFA 1YD8U 4AWJA 3B0AA 1SE4A 4PS3A 1ZP0B 2X8XX 1GJZA 1LXDA 1VZ8A 4IDIA 1ZUD2 1BMLC 1MFWA 1GB1A 4GDKB 4WAAA 3N30A 1JRPA 3ML9A 4G0NB 4WWOA 1AARA 3AE6B 3JYUA 2DBYA 2YVCA 4F8CB 2I1KA 4KKIA 1IPGA 3SR6A 1RRBA 2I1JA 2OEDA 3ECIA 2MEKA 3NJTA 4ZOHC 2JZPA 1FEHA 1LFDA 3WCQA 2WS3B 1JW9D 2KLCA 3NZSA 3WAMA 4FADA 2GBNA 1WH3A 1AYFA 3AULA 1D3ZA 2K22A 1WIAA 3AU4A 3W1SA 2A5UA 1P7EA 2LVQA 4HKZE 1N63A 4MELA 2BS2B 1UF0A 3AE8B 1E8ZA 4JE3B 3U52E 1N5WA 3TEYA 1GB4A 3GB1A 2LUEA 2Y5PA 2UWQA 3N1ZC 1DYQA 1T0RC 1FNVA 2DYMA 5DPRA 4DK5A 1R4NB 1SF0A 2RDGA 4BKGA 3DPDA 2WXLA 1E5WA 4M00A 1C76A 3B9JA 2NPTA 3V62A 2QCZA 1OQQA 4WJNA 3R8BA 3PZDA 1MI0A 2KMMA 2PVOD 2FUHB 3Q6BA 1L5PA 3R66C 2B76B 4ZDVA 4GXBA 5HHDG 1G6JA 2WXHA 1D5MC 5J18A 1N61A 2N9PC 3NG0A 2KN4A 2MQJA 1XT9B 5DPWA 4ZYNA 5C23A 4TQ1A 5BO4B 1J7AA 3RI7C 1WJ6A 3M3JA 4OZBA 1Z5SB 5H8YE 3GZNB 5D3DA 3CMMB 2N9KA 3O65B 2KMCA 2WDVB 5BMGA 2W3RA 3AEGB 2BB5A 4N6EB 2BT6A 1DOYA 1AW7A 3W1YA 1KH0A 3BVMA 1GOZA 1F0ZA 3IT4B 1F1HA 2JVCA 2A4ZA 2WXJA 3V6EB 5L83A 1NYQA 2FCNA 2KVRA 2IPKD 2QC8A 1ZOYB 3O13A 1GAQB 1ROEA 5G2NA 1TS5A 1XCQL 4JL9A 2XNAC 1IBXB 1AN8A 2WXGA 3NS8A 3R2TA 3RUIB 2KTRA 4IG7B 3ZVVA 5EDSA 1UBQA 1XEEA 1KTKA 1T0SC 1WMHB 2BS3B 1SGHA 4PYZA 4XDDA 2HD5B 1OQRA 2TSSA 4L2YA 5HG2A 4CO7A 2ON8A 2CJOA 2CHZA 4HPPA 5FR6A 5DPTA 3AE4B 3MHSD 3MJWA 2LVOA 1Q0WB 3PSEB 1XLPA 3LDZE 1LO5D 3ZRFA 1H4RA 3AEBB 1WE7A 2FCSA 4XGAB 2NPTB 3DVNV 1NVID 1WGYA 5TR5A 1P9DU 1IP9A 3TEXA 4B95A 1DOXA 1YX5B 1UZXB 3GZNI 1QOFA 2JWZA 1WR1A 1ZXHA 4US9A 3A9JB 1KOTA 1P3QU 4B0EA 2NBUA 1R4NI 1TBEA 1TKEA 3KH0A 2PKOA 3ML8A 3TEZA 4WJOA 2GBJA 2IGDA 4KZ0A 5AZHA 1OQYA 2REXA 2W54A 2DZIA 3U2SC 1PYWD 4OHJA 3RNGC 1FPYA 3LB8C 2JT4B 3RYTA 2J0KA 1MPEA 3IHPC 1XO3A 3FILA 1WR6E 4MH0E 1ET6A 3NOBA 1WM2A 1I42A 3PGEA 5LNK1 4LLGM 2ASQA 3QARA 1QKZA 4ITKA 4F1SA 3NY5A 1L4ZB 1VD2A 3FAHA 4GOCA 1TS4A 3PPAA 1E6EB 4NJCA 3TIXA 3VTUA 4LJOB 3P4RB 2NS5A 1OEYA 3VR8B 2CR5A 4LNKA 1FNUA 2IBIB 3P63A 2BYEA 3TEWA 4BFRA 3AE9B 2ZVOA 2MWSB 1F2RC 3HIZA 1KF6B 4HJKA 3TBLD 4LDTD 2G9HD 4KIKB 2EELA 3AE7B 2Z8LA 3QCAA 3R3MA 1EWCA 1L6VA 3X0WA 3VH4B 1M4VA 2LZ6A 1UNSA 2RR9A 4IOIE 1B9RA 2BQQA 2MH7A 2GBMA 5HFYA 3AE2B 3AE1B 3VUYA 1DOIA 2M0AA 2BF8B 1EO6A 1U4AA 2LHEA 5IOIA 4URKA 1QOAA 4DDGD 4E71A 4C80A 4B6WA 4ANWA 2KHWB 3NVYA 4TUUA 3WA0A 2NTSA 1SE2A 5IO9A 3H7PA 4KDLB 2KWVB 2WNMA 2PLPA 4G3XB 1ZKHA 2QEJC 1WGKA 5J2RA 3PTFC 2AL6A 4IWQA 1CJEA 3ZNID 1WGHA 5AEKB 5DCNA 2INNE 2PEAA 3P4PB 4KVGB 1IYFA 1PDXA 2PVGC 2V3PA 3VUXA 2KJ6A 1YQ4B 4RF0A 2CU3A 4KX6B 2JQRB 4NNJB 3DWMA 1I7HA 2KC1A 4C00A 2BKFA 4M01A 1WE6A 1WY8A 2HE7A 3K9PB 4YTPB 1NDDA 5IP4D 3ZRCA 4B0MA 1HTQA 2B3AA 2D07B 2DNFA 4LK0M 2JZ3B 2L83A 1P0RA 4MGZE 2C7HA 1PQSA 3IAM1 2J7QB 2L3ZA 3HVZA 3Q8CA 2V3NA 2LGDA 4N9F4 4CHKA 4GDLB 2PTLA 1E7PB 4ARCA 2QHOA 4A20A 4K81A 3ONSA 1VZ6A 2D2QA 2ZCBA 2LXCA 3IT6B 3KYCD 2D10A 3L4PA 3A1QA 2MA9B 3DVGY 3QK0A 4RM8A 2EKIA 1NEKB 2RPVA 3CSFA 1L0XB 3T8MA 2NBVB 4B9KA 2ZW0A 3EFCA 4N58A 3ZIMA 4FLHA 4NJ6A 3PVLA 5LXHA 1D4BA 2N9LA 1L0YB 1HZ5A 1JWBD 2VH2A 3U7DA 4YSYB 5FR3A 1V86A 1K52A 3RNFC 1J0GA 4IUMB 2WLBA 3ZQ4A 1MHHE 1WFYA 2IO2B 4IM0A 2HJ1A 3WAOA 1CZPA 2MJEA 3DHHC 4O1NA 4FBJB 2AQ1B 4E74A 2KFKB 4WIPA 2NR2A 3W2DA 2IO0B 2WDTB 3DBHI 1JWSD 4AQ7A 2MBEA 2KDBA 4FULA 2V3SA 2G1EA 1XLQA 2C7NB 2R2OA 3UINB 3A9JA 1Q5WB 2RDHA 5G5HA 3P42A 5CHVC 4DXGA 3UQAA 4BKSD 1YIWA 3PHWB 3VRBB 5D6JB 2DYOA 1UELA 2QIEB 1F52A 2ZW1A 3HM3A 3V05A 2I2YA 1Y56A 2G4SA 3MC9A 4MJSA 4ANXA 2JRIB 2QILA 1FRRA 4FJZA 3KQ4A 4REZA 2M8SA 2WXNA 3AV8A 3IBEA 3A9KA 3PS6A 4LDTB 1S1QB 1FMAD 2C7MB 2ZEQA 4TSSA 3ZTDA 1FCLA 2JZZA 2QDFA 2MRPA 4YTMB 3SEBA 2DHZA 1FIQA 2N1VA 3B2GA 3VAWA 3RNEC 4OVUA 3QWZB 3Q14C 1SB3C 1V49A 1FXIA 4FA6A 3APDA 5JHAA 4G11A 2V4LA 4J6IA 3I5JC 2SAKA 2WU2B 3LYYA 2JX5A 2FNJB 2L05A 3V61A 1F9JA 2BVCA 1T0YA 3DCGA 2E3TA 4GMVA 4RM9A 1YN4A 2D3BA 1L6UA 3Q8FA 4BBNC 2M0XA 3GE8C 3CF6E 3OJ3A 3Q3MC 4W9EA 2G4DB 5AZGA 4MM3A 5EE3A 2LASA 2LRWA 2L0FA 3TL5A 3AB5A 3R7RA 1I4RA 1T3QA 3AN1A 3H7SA 1VJKA 4HCPB 2LFIA 4FN2A 2GBKA 2HTHA 1WM3A 2DYBA 3VVWB 2JYTA 2BYVE 3H9DA 4DDID 3L08A 1XLOA 4W9LA 2FAZA 2WHIA 3AE5B 2O6VB 2KK8A 4HCNB 4PYUA 4F7ZA 3ETRA 4XWTA 5G55A 2KAJA 4M8MA 2AWTA 4TKNA 3AEDB 3MP9A 4NAWB 2V1YA 2ZVNA 5EE0A 4D2KA 2FE8A 2EMTA 3B08A 1F2RI 1RFKA 2NBWB 2I38A 3Q3JA 1XD3B 1QQRA 3IXSA 1UGJA 4A55A 1OEYJ 1L7YA 1KJTA 2KZRA 1M94A 4WQOB 5IA7A 1GG3A 4RGTA 1D5ZC 2LHDA 2V4IB 1KLGD 4HK2A 3RMKC 4XZ4A 5JHBA 2KMAA 3WAPA 1C1YB 2J53A 2K6QA 3KW5B 2ZCCA 2GLSA 3UQBA 2O2VA 1L0VB 2BW2A 4RNAA 3A4RA 1WXQA 2KVZA 4JGHB 2C9WB 1JWUD 1RLFA 2M19A 4LJPB 4ICVA 4MSQB 3ENEA 4JIOU 1PGBA 2LGXA 3TMPB 1YNTE 3VTVA 2LUMA 3AH7A 2KO3A 4US8A 3M63B 4KIKA 1NYRA 4WJQA 3NHEB 2K25A 3QC8B 2W82A 1MG4A 3N20C 4WAFA 2KQ7A 3RD2A 5C3JB 1ZGUB 2KDEB 3ZXVA 1SIFA 2AX5A 1WF9A 2DX5B 2JU6X 3B1LX 4NQKE 2KN5A 2NTTA 3UI3A 1KLUD 2GBRA 3JSVB 2JXXA 2N7EA 4RMAA 4FJYA 4HDOA 4YSXB 2MP2B 3NUHB 1HZ6A 5EE9A 2EMSA 2KNBA 4GGQA 4ZRIA 4BOSC 1UGMA 2KQ4X 4RF1A 2Y5CA 1EF5A 3RN9C 3H6NA 1RAXA 2BYFA 2LGYA 1XXGA 1SJHD 2ONQA 1BXTA 2JYEA 1T5XD 4ICUA 4X57B 1TY0A 4ZRKA 3V60A 4A8XC 2KACA 2SEBD 4AJYB 4W9DA 2M56B 1FM0D 3TJPA 2IYDB 1V97A 3KUZA 2WP9B 5DPSA 2AYOB 1IBXA 1UH6A 1FO4A 2PIAA 5AUKA 1EF1A 4XWWA 3DHIC 2AQ3B 3HM6X 5E6PA 2G3QB 2BTEA 3NVWA 1T0QC 2ACZB 4NAWA 4M0WA 2KFKA 5C2TB 4A6QA 3PO0A 4ASWC 1NBFC 3PRPB 2JWUA 5BYQA 4W9HA 3QA8A 1GNUA 1WX7A 2LD9A 4G50A 2L00B 2XBBC 4EZJA 2W3SA 2KC2A 1WX9A 3RPFC 1FRDA 4WQMA 2KX0A 3CWIA 4IW0A 4ZRJA 5GMVA 1I4QA 4DHJD 2IO3B 5KHQA 1V5OA 2LVPA 2UU7A 2L8JA 1C79A 4W9JA 2GI9A 2KWDA 4USAA 4DHZB 2KKCA 3W1SC 3LXFA 3H7PB 3ZGZA 4KDIC 1TKYA 2BWES 3M95A 3PV1A 3A9KB 3U30A 3N1XC 2KFJA 2C5LC 5IAAC 3VUWA 2W9NA 1C4CA 3ZUNA 1LM8B 2K8HA 4OVZA 2WXIA 1TTNA 1FXTB 2IGHA 3EA6A 3APCA 2JPHA 2IDYA 4K3CA 3PT2B 4P1BC 1PGXA 4MM3B 2JY6A 2XK5B 4NPNA 5GXGB 2N4FA 4JX1C 5EE1A 1LQBA 5HI1A 1TZOA 3OG5A 3VHTC 3Q69A 3L54A 1ET9A 3E56A 3DVGX 1VCBA 1ZPSA 3OWEB 3ZXRA 2Z59B 2ZPYA 4MJSB 2CHXA 4E3CA 4CYEA 2VZKD 4W9FA 3DVNU 3NZ3A 1IGDA 3UF8A 4Q2JA 2XEWA 4K7WA 3BVZA 2CJNA 1YQ3B 3T3NA 4M8NA 2PJHA 3ABVB 2KDMA 3RT3B 2CU1A 4I6PA 1UWXA 2MHJA 3AE3B 1B1ZA 2WXMA 3VRAB 1ZDVA 3OJ4B 4OZAA 2DAFA 4LNOA 2KD0A 1V5TA 3N9YC 4II2B 2KLGA 3VXWA 4W9CA 4DHJB 2DZKA 4DQOC 3DBRB 1H8CA 2KX3A 4LNFA 4ZRPA 1K53A 3B2FA 1S3SG 1YN3A 4EFOA 1RYJA 3RCZA 5BMIA 1P98A 3MHZA 3V6CB 1RM6C 1TS2A 2HJ8A 3RFZB 1MG8A 2D3CA 2LWPA 2WGSA 3AEEB 2WU5B 4FXCA 4LCDE 2JUOA 2UYZB 4KSLC 2J0MA 1V81A 1NI3A 5CHFA 2QSDA 1SXTA 3AECB 1C3TA 2BPSA 3IAS1 4IM3A 3DOWA 4GLSC 5AUIA 5AZFA 2XK5A 4A90A 3TCAA 3JVZX 4AJWA 3TUOA 3BZDB 2LGSA 3NVVA 3ZTCA 3FKYA 1HQRD 2GRIA 4NJ7A 4II3B 1WJ4A 3GE3C 2ZNVC 1MHXA 5MPOA 1WMHA 5E6NA 5IKCM 1WZ3A 2D3GA 2OHFA 1IGCA 4JQWC 3ZLZA 4XC2A 2AEHA 1FD6A 4NAMA 3L17A 1VDVA 1E7UA 1BT0A 2RMMA 2PW9A 2CS4A 3Q8BA 2N7DA 2R2QA 3QJZA 2L1AA 2K8BA 4ZYSA 1A70A 1P1AA 4L23A 2LXAA 1V2YA 3FC4A 1JCKB 3ZDTA 4LNNA 1EU3A 2AL3A 3SD5A 1WWTA 4N59A 1E0ZA 5LLIA 2BGFA 3IG3A 1Y8RC 2D11A 4S17A 2NCNA 3DQVA 2KWCA 3KYDD 1FFUA 3AI5A 4RCOA 1NI2A 4HXDA 4GIVA 1KRHA 4FHJA 4L1BA 1KLVA 3MFGA 3QQ8B 3KUCB 1K50A 4W9IA 5CHWA 1J7CA 5CTRC 4BZAA 4EZLA 5JXVA 4M0WB 3A1QB 4ACFA 4MACA 2X38A 4MGIE 3P2BA 3JSVA 4WWPA 5TSSA 2INCC 2VH1A 2KWUB 2DENB 1SEBD 2JF5A 2H88B 2L0TA 2K0PA 2K1FA 4CQNA 2MLBA 3EECA 1J8CA 2IGGA 2N1WA 2MCNB 2DAJA 3KWVA 4K3BA
chains in the Genus database with same CATH topology
1RLFA 1WRDB 3BY4B 4LDTD 2KJRA 3AXCA 4I6LB 4KIKB 4LJPB 2KQSA 3IFWB 4ICVA 4MSQB 4PS7A 4IWPA 3QCAA 1E8WA 3EC8A 3R3MA 3ENEA 4EKUA 3A4SC 2CHWA 3ZDMC 4JIOU 4HPLB 3X0WA 2ZNVB 5DPWA 3WIMA 2LGXA 3VH4B 2EKEC 3TMPB 3NZUA 2LZ6A 2RGFA 3L16A 3VTVA 3M62B 4GDLA 4IM2A 2RR9A 4DXAB 1GC6A 2GBMA 4EEWA 2IY0B 2KO3A 1WGDA 3M63B 4KIKA 3ZNZB 4WJQA 2WWZA 3VUYA 2BF8B 3NHEB 1EO6A 3IVFA 4AOFA 5HKHA 1U4AA 1E8XA 1WXAA 4URKA 2K25A 3QC8B 2CKHB 2LJ5A 1UD7A 4DDGD 4E71A 5JH5C 3UIPB 3QIJA 1WXMA 2KQ7A 3RD2A 4B6WA 4ANWA 2KHWB 4TUUA 4DWFA 1YQBA 2MSED 3WA0A 4MGKE 1X1MA 4K1RB 4A3PA 1ZGUB 1EUVB 2KDEB 1V80A 1L2NA 3H7PA 4KDLB 2O6VD 5LXIB 4OVVA 2DZMA 2KWVB 1SIFA 3KUDB 2K6DB 4ANUA 4G3XB 1OTRB 1ZKHA 1WF9A 2DX5B 2KDFB 3B1LX 4NQKE 2KN5A 5J2RA 3PTFC 3VTWA 2AL6A 1WYWB 4IWQA 1V6EA 2GBRA 3ZNID 3JSVB 2JXXA 3H1UA 1WGHA 1KM7A 1WZ0A 2N7EA 4KZCA 3WALA 4RMAA 3K9OB 5AEKB 2FCQA 2N9EB 1YX6B 5DCNA 4MSMB 4FJYA 3L0WB 4HDOA 3L10B 1XQQA 2MP2B 1GUAB 2PEAA 4AUQC 3N3KB 2EMSA 3PRMB 4KVGB 3ZNHB 1R4MI 4MGYE 2KNBA 4GGQA 4ZRIA 5E6OA 3RULA 4BOSC 3APFA 3DDCB 1UGMA 2MBHA 3VUXA 2KJ6A 2BWFA 4FHKA 1EF5A 2BKRB 1HE8A 3H6NA 1RAXA 2Z0EB 2BYFA 4JLCA 2LGYA 3KVFB 4NNJB 3WANA 4ICUA 4X57B 2K39A 4ZRKA 2KC1A 3V60A 4HVBA 4AJYB 2BKFA 4W9DA 1E7VA 3PLUA 4GSWA 4GU2A 3TJPA 2MW5A 5JZEB 4PS8A 2IYDB 1WE6A 2G45B 2Z0DB 1WY8A 4EZKA 2KDIA 2HE7A 3MTNB 3K9PB 3KUZA 4K7UA 1NDDA 4IWOA 2FIFA 2O6VA 3UGBB 3RZFA 3ZRCA 5DPSA 5CX3A 2KXJA 2GOWA 2AYOB 1UH6A 2B3AA 1I35A 2D07B 1ZW7A 1EF1A 4YL8A 3RZWC 3L13A 3HM6X 5E6PA 2G3QB 2KOXA 2JZ3B 2OOBB 1RFAA 2FCMA 4NAWA 1P0RA 4MGZE 4XX5A 3DBSA 4WWNA 1TZ1A 4GDKA 2C7HA 2JRHA 2KFKA 4BBNF 2N9XA 2KTFA 1PQSA 1JRUA 1YD8U 2PE6B 3R7QA 4AWJA 5KHOA 1TGZB 3B0AA 2J7QB 4PS3A 2L3ZA 4ASWC 1NBFC 1GJZA 3PRPB 1A5RA 3DBRI 1LXDA 2LGDA 4N9F4 4W9HA 3QA8A 4CHKA 5C1ZA 4GDLB 1GNUA 1WX7A 2QHOA 2WYQA 2LD9A 4G50A 4GDKB 4WAAA 4A20A 4K81A 2L00B 2XBBC 4A3OA 4TV3A 3N30A 3ONSA 2KC2A 4EZJA 1WX9A 3ALBA 3U8ZA 3ML9A 2KX0A 3PLVA 2D2QA 1E90A 2ZCBA 4G0NB 1AARA 4IW0A 4WWOA 3JYUA 5GMVA 2LXCA 4DHJD 2IO3B 2YVCA 4F8CB 3I3TB 3KYCD 2I1KA 2D10A 3VH3B 1V5OA 2LVPA 1IPGA 1RRBA 1WJUA 2I1JA 2MP2A 2L8JA 2MA9B 2WX0A 3A1QA 3ECIA 4W9JA 4W9KA 1ISNA 1LFDA 3DVGY 3QK0A 4RM8A 4DHZB 2KLCA 3NZSA 2KKCA 3CSFA 3W1SC 3WAMA 4FADA 3T8MA 2NBVB 3SHQA 2GBNA 4B9KA 1WH3A 1E8YA 2LRUA 3AULA 3H7PB 1D3ZA 3ZIMA 4FLHA 4NJ6A 1WIAA 3AU4A 3PVLA 3W1SA 2A5UA 2LVQA 4KDIC 5LXHA 5D2MB 4MELA 2BWES 1E8ZA 3Q3FA 2ZJDA 3M95A 3U7DA 3PV1A 3A9KB 1V86A 3U30A 1J0GA 4IUMB 3N32A 2KFJA 2C5LC 5IAAC 2LUEA 3VUWA 1WX8A 1V9JA 2W9NA 5D7GA 1WFYA 2IO2B 3D32A 4IM0A 3OAWA 2UWQA 3ZUNA 4JGHB 4NY0A 3WAOA 2DYMA 5DPRA 1LM8B 2K8HA 4BOZB 4DK5A 1CMXB 3HK0A 4BKGA 1TTNA 1FXTB 4FBJB 3DPDA 3SDLC 4E74A 1E5WA 2KFKB 2NR2A 3APCA 2IO0B 2WDTB 2JPHA 3PT2B 2NPTA 3UIOB 2JY6A 2XK5B 3DBHI 4NPNA 3V62A 2C60A 2MBEA 2KDBA 2N4FA 2YLMA 5L95C 4FULA 3PRZA 4TQ0A 2M1MA 1LQBA 2V3SA 4ANVA 4WJNA 3PZDA 1GC7A 3VHTC 2C7NB 2FUHB 2R2OA 3L54A 3QX1A 3UINB 3R66C 3A9JA 1Q5WB 4WJPA 4ZDVA 4GXBA 1G6JA 3DVGX 2KANA 1VCBA 3AU5A 5J18A 3SU8X 2N9PC 5CHVC 2Z59B 4FJVB 3UQAA 1WXSA 2MQJA 1XT9B 2ZPYA 4MJSB 1YIWA 2CHXA 3PHWB 4BKSD 4BKTA 5D6JB 4E3CA 2DYOA 4ZYNA 5C23A 4CYEA 4TQ1A 4W9FA 3DVNU 1UELA 5BO4B 2L76A 3S2AA 3UF8A 2KTRB 2MBQA 3HM3A 1WJ6A 2XEWA 3M3JA 1Q1OA 4K7WA 1Z5SB 2IZVB 3CSTA 3CMMB 2G4SA 4HLEA 3O65B 2KMCA 4MJSA 2JRIB 4M8NA 2PJHA 4ANXA 2IO1B 2ZPNA 4FJZA 4EOYA 3RT3B 2CU1A 4I6PA 3W1YA 2M8SA 3GOEA 3A9KA 3IBEA 2L7RA 3PS6A 2RSUA 4LDTB 1S1QB 2C7MB 2IY1B 2ZEQA 3ZTDA 3EFUA 2JZZA 3HHMA 3OJ4B 2MRPA 2NVUI 2DAFA 2JVCA 2A4ZA 1SE9A 3V6EB 2DHZA 2KD0A 2N1VA 1V5TA 3VAWA 5L83A 4OVUA 3QWZB 2FCNA 4II2B 2KLGA 2KVRA 3VXWA 4W9CA 4DHJB 2DZKA 4KV2A 1V49A 4FA6A 5G2NA 4JL9A 3APDA 5JHAA 4BKSA 2M4NA 4BVUC 2LI5A 1H8CA 2KX3A 3NS8A 4G11A 4GN1A 2V4LA 4P7IA 4J6IA 1S3SG 2RPQA 3C0RB 3RUIB 2KTRA 2MBOA 4IG7B 3ZVVA 5EDSA 4EFOA 1UBQA 1IYFA 3RCZA 4HPMB 1P98A 3V6CB 1WMHB 2HJ8A 1SGHA 1YJ1A 4PYZA 2HD5B 2FNJB 1MG8A 2L05A 2LWPA 2O2VB 3V61A 1WGRA 1F9JA 4CO7A 1T0YA 3DCGA 4LCDE 2JUOA 2UYZB 4GMVA 4RM9A 4IC7B 2CHZA 2Y5BB 4KSLC 5FR6A 5DPTA 3MHSD 2J0MA 3QAQA 3MJWA 1V81A 1J19A 2LVOA 2M17A 4BBNC 1Q0WB 5CHFA 2M0XA 3CF6E 3OJ3A 3PSEB 4MDKE 1C3TA 4W9EA 2G4DB 3LDZE 1Z2MA 5AZGA 3ZRFA 1H4RA 4MM3A 2BPSA 2LASA 2LRWA 3DOWA 1WJNA 1WXVA 2XK5A 4IM3A 5AZFA 1WE7A 2L0FA 3TCAA 2FCSA 3JVZX 3ZKJC 4AJWA 5KHQA 2NPTB 3TL5A 3DBLI 3DVNV 3R7RA 3ZO5B 1WGYA 3H7SA 3ZTCA 2GMIC 5TR5A 1P9DU 1IP9A 4NJ7A 4B95A 2DZJA 4HCPB 1YX5B 1UZXB 3GZNI 4II3B 1WJ4A 2JWZA 1WR1A 2ZNVC 4FN2A 2GBKA 2KJHB 2HTHA 3A9JB 1KOTA 1P3QU 2NBUA 1R4NI 1QZEA 1WMHA 1WM3A 2DYBA 1WZ3A 5E6NA 2D3GA 3VVWB 1TBEA 2BYVE 2ZZPB 3H9DA 3VQIA 4DDID 3L08A 4W9LA 2FAZA 3KH0A 4KSKC 2O6VB 4JQWC 2KK8A 4HCNB 1K8RB 4PYUA 3ZLZA 3ZNGC 4XC2A 4F7ZA 3ML8A 2AEHA 4MEMA 4AP4C 4WJOA 1UBIA 2GBJA 3L17A 1E7UA 1BT0A 4KZ0A 2CS4A 5AZHA 5G55A 4M8MA 1OQYA 2J0JA 2N7DA 2REXA 3QHTA 4HDQA 2R2QA 2AWTA 3QJZA 2K8BA 2DZIA 4TKNA 1P1AA 2PE9A 4W9GA 2LXAA 3A33B 2K8CA 2WX1A 1V2YA 2RD0A 4NAWB 2V1YA 2MBBB 2ZVNA 3ZDTA 1OGWA 3B08A 2EMTA 4I6NB 2OJRA 2AL3A 3SD5A 3JW0X 2FIDA 2JT4B 2PPHA 3RYTA 2NBWB 2J0KA 5LLIA 3IHPC 2BGFA 3Q3JA 3IG3A 1Y8RC 2D11A 2VRRB 2NCNA 3DQVA 1WR6E 2KWCA 3KYDD 1XD3B 3PREA 3VFKA 3VDZA 3AI5A 4MH0E 1NI2A 4HXDA 4GIVA 4DBGA 4FHJA 3NOBA 1WM2A 1I42A 1OEYJ 1L7YA 3ZW3A 3QQ8B 1KLVA 3OLMD 1KJTA 5J17A 1WGGA 2KZRA 3PGEA 3KUCB 2ASQA 3QARA 3T9LA 1M94A 4F1SA 4W9IA 3NY5A 5CHWA 4WQOB 5CTRC 2MX2A 1VD2A 4K7SA 1GG3A 4EZLA 5IA7A 4GOCA 4M0WB 3PPAA 3A1QB 3TIXA 4NQLB 4ZRJA 3EHVA 3VTUA 4HWIB 4LJOB 3LJ3A 4MGIE 2NS5A 3PHXB 3P2BA 1OEYA 3JSVA 3X23A 4WWPA 2CR5A 4GB9A 4HK2A 4XZ4A 5JHBA 2IBIB 2KWUB 4EUTA 2DENB 1WI0A 2KMAA 2BYEA 3WAPA 1C1YB 2JF5A 2K6QA 3KW5B 2ZCCA 4BFRA 3UQBA 2O2VA 2L0TA 2ZVOA 2K1FA 2MWSB 2MLBA 3BINA 3EECA 5D94A 1J8CA 2N1WA 2MCNB 3A4RA 2DAJA 4DHZE 3HIZA 2C9WB 4HJKA 3TBLD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RLF A;  1WRD B;  3BY4 B;  4LDT D;  2KJR A;  3AXC A;  4I6L B;  4KIK B;  4LJP B;  2KQS A;  3IFW B;  4ICV A;  4MSQ B;  4PS7 A;  4IWP A;  3QCA A;  1E8W A;  3EC8 A;  3R3M A;  3ENE A;  4EKU A;  3A4S C;  2CHW A;  3ZDM C;  4JIO U;  4HPL B;  3X0W A;  2ZNV B;  5DPW A;  3WIM A;  2LGX A;  3VH4 B;  2EKE C;  3TMP B;  3NZU A;  2LZ6 A;  2RGF A;  3L16 A;  3VTV A;  3M62 B;  4GDL A;  4IM2 A;  2RR9 A;  4DXA B;  1GC6 A;  2GBM A;  4EEW A;  2IY0 B;  2KO3 A;  1WGD A;  3M63 B;  4KIK A;  3ZNZ B;  4WJQ A;  2WWZ A;  3VUY A;  2BF8 B;  3NHE B;  1EO6 A;  3IVF A;  4AOF A;  5HKH A;  1U4A A;  1E8X A;  1WXA A;  4URK A;  2K25 A;  3QC8 B;  2CKH B;  2LJ5 A;  1UD7 A;  4DDG D;  4E71 A;  5JH5 C;  3UIP B;  3QIJ A;  1WXM A;  2KQ7 A;  3RD2 A;  4B6W A;  4ANW A;  2KHW B;  4TUU A;  4DWF A;  1YQB A;  2MSE D;  3WA0 A;  4MGK E;  1X1M A;  4K1R B;  4A3P A;  1ZGU B;  1EUV B;  2KDE B;  1V80 A;  1L2N A;  3H7P A;  4KDL B;  2O6V D;  5LXI B;  4OVV A;  2DZM A;  2KWV B;  1SIF A;  3KUD B;  2K6D B;  4ANU A;  4G3X B;  1OTR B;  1ZKH A;  1WF9 A;  2DX5 B;  2KDF B;  3B1L X;  4NQK E;  2KN5 A;  5J2R A;  3PTF C;  3VTW A;  2AL6 A;  1WYW B;  4IWQ A;  1V6E A;  2GBR A;  3ZNI D;  3JSV B;  2JXX A;  3H1U A;  1WGH A;  1KM7 A;  1WZ0 A;  2N7E A;  4KZC A;  3WAL A;  4RMA A;  3K9O B;  5AEK B;  2FCQ A;  2N9E B;  1YX6 B;  5DCN A;  4MSM B;  4FJY A;  3L0W B;  4HDO A;  3L10 B;  1XQQ A;  2MP2 B;  1GUA B;  2PEA A;  4AUQ C;  3N3K B;  2EMS A;  3PRM B;  4KVG B;  3ZNH B;  1R4M I;  4MGY E;  2KNB A;  4GGQ A;  4ZRI A;  5E6O A;  3RUL A;  4BOS C;  3APF A;  3DDC B;  1UGM A;  2MBH A;  3VUX A;  2KJ6 A;  2BWF A;  4FHK A;  1EF5 A;  2BKR B;  1HE8 A;  3H6N A;  1RAX A;  2Z0E B;  2BYF A;  4JLC A;  2LGY A;  3KVF B;  4NNJ B;  3WAN A;  4ICU A;  4X57 B;  2K39 A;  4ZRK A;  2KC1 A;  3V60 A;  4HVB A;  4AJY B;  2BKF A;  4W9D A;  1E7V A;  3PLU A;  4GSW A;  4GU2 A;  3TJP A;  2MW5 A;  5JZE B;  4PS8 A;  2IYD B;  1WE6 A;  2G45 B;  2Z0D B;  1WY8 A;  4EZK A;  2KDI A;  2HE7 A;  3MTN B;  3K9P B;  3KUZ A;  4K7U A;  1NDD A;  4IWO A;  2FIF A;  2O6V A;  3UGB B;  3RZF A;  3ZRC A;  5DPS A;  5CX3 A;  2KXJ A;  2GOW A;  2AYO B;  1UH6 A;  2B3A A;  1I35 A;  2D07 B;  1ZW7 A;  1EF1 A;  4YL8 A;  3RZW C;  3L13 A;  3HM6 X;  5E6P A;  2G3Q B;  2KOX A;  2JZ3 B;  2OOB B;  1RFA A;  2FCM A;  4NAW A;  1P0R A;  4MGZ E;  4XX5 A;  3DBS A;  4WWN A;  1TZ1 A;  4GDK A;  2C7H A;  2JRH A;  2KFK A;  4BBN F;  2N9X A;  2KTF A;  1PQS A;  1JRU A;  1YD8 U;  2PE6 B;  3R7Q A;  4AWJ A;  5KHO A;  1TGZ B;  3B0A A;  2J7Q B;  4PS3 A;  2L3Z A;  4ASW C;  1NBF C;  1GJZ A;  3PRP B;  1A5R A;  3DBR I;  1LXD A;  2LGD A;  4N9F 4;  4W9H A;  3QA8 A;  4CHK A;  5C1Z A;  4GDL B;  1GNU A;  1WX7 A;  2QHO A;  2WYQ A;  2LD9 A;  4G50 A;  4GDK B;  4WAA A;  4A20 A;  4K81 A;  2L00 B;  2XBB C;  4A3O A;  4TV3 A;  3N30 A;  3ONS A;  2KC2 A;  4EZJ A;  1WX9 A;  3ALB A;  3U8Z A;  3ML9 A;  2KX0 A;  3PLV A;  2D2Q A;  1E90 A;  2ZCB A;  4G0N B;  1AAR A;  4IW0 A;  4WWO A;  3JYU A;  5GMV A;  2LXC A;  4DHJ D;  2IO3 B;  2YVC A;  4F8C B;  3I3T B;  3KYC D;  2I1K A;  2D10 A;  3VH3 B;  1V5O A;  2LVP A;  1IPG A;  1RRB A;  1WJU A;  2I1J A;  2MP2 A;  2L8J A;  2MA9 B;  2WX0 A;  3A1Q A;  3ECI A;  4W9J A;  4W9K A;  1ISN A;  1LFD A;  3DVG Y;  3QK0 A;  4RM8 A;  4DHZ B;  2KLC A;  3NZS A;  2KKC A;  3CSF A;  3W1S C;  3WAM A;  4FAD A;  3T8M A;  2NBV B;  3SHQ A;  2GBN A;  4B9K A;  1WH3 A;  1E8Y A;  2LRU A;  3AUL A;  3H7P B;  1D3Z A;  3ZIM A;  4FLH A;  4NJ6 A;  1WIA A;  3AU4 A;  3PVL A;  3W1S A;  2A5U A;  2LVQ A;  4KDI C;  5LXH A;  5D2M B;  4MEL A;  2BWE S;  1E8Z A;  3Q3F A;  2ZJD A;  3M95 A;  3U7D A;  3PV1 A;  3A9K B;  1V86 A;  3U30 A;  1J0G A;  4IUM B;  3N32 A;  2KFJ A;  2C5L C;  5IAA C;  2LUE A;  3VUW A;  1WX8 A;  1V9J A;  2W9N A;  5D7G A;  1WFY A;  2IO2 B;  3D32 A;  4IM0 A;  3OAW A;  2UWQ A;  3ZUN A;  4JGH B;  4NY0 A;  3WAO A;  2DYM A;  5DPR A;  1LM8 B;  2K8H A;  4BOZ B;  4DK5 A;  1CMX B;  3HK0 A;  4BKG A;  1TTN A;  1FXT B;  4FBJ B;  3DPD A;  3SDL C;  4E74 A;  1E5W A;  2KFK B;  2NR2 A;  3APC A;  2IO0 B;  2WDT B;  2JPH A;  3PT2 B;  2NPT A;  3UIO B;  2JY6 A;  2XK5 B;  3DBH I;  4NPN A;  3V62 A;  2C60 A;  2MBE A;  2KDB A;  2N4F A;  2YLM A;  5L95 C;  4FUL A;  3PRZ A;  4TQ0 A;  2M1M A;  1LQB A;  2V3S A;  4ANV A;  4WJN A;  3PZD A;  1GC7 A;  3VHT C;  2C7N B;  2FUH B;  2R2O A;  3L54 A;  3QX1 A;  3UIN B;  3R66 C;  3A9J A;  1Q5W B;  4WJP A;  4ZDV A;  4GXB A;  1G6J A;  3DVG X;  2KAN A;  1VCB A;  3AU5 A;  5J18 A;  3SU8 X;  2N9P C;  5CHV C;  2Z59 B;  4FJV B;  3UQA A;  1WXS A;  2MQJ A;  1XT9 B;  2ZPY A;  4MJS B;  1YIW A;  2CHX A;  3PHW B;  4BKS D;  4BKT A;  5D6J B;  4E3C A;  2DYO A;  4ZYN A;  5C23 A;  4CYE A;  4TQ1 A;  4W9F A;  3DVN U;  1UEL A;  5BO4 B;  2L76 A;  3S2A A;  3UF8 A;  2KTR B;  2MBQ A;  3HM3 A;  1WJ6 A;  2XEW A;  3M3J A;  1Q1O A;  4K7W A;  1Z5S B;  2IZV B;  3CST A;  3CMM B;  2G4S A;  4HLE A;  3O65 B;  2KMC A;  4MJS A;  2JRI B;  4M8N A;  2PJH A;  4ANX A;  2IO1 B;  2ZPN A;  4FJZ A;  4EOY A;  3RT3 B;  2CU1 A;  4I6P A;  3W1Y A;  2M8S A;  3GOE A;  3A9K A;  3IBE A;  2L7R A;  3PS6 A;  2RSU A;  4LDT B;  1S1Q B;  2C7M B;  2IY1 B;  2ZEQ A;  3ZTD A;  3EFU A;  2JZZ A;  3HHM A;  3OJ4 B;  2MRP A;  2NVU I;  2DAF A;  2JVC A;  2A4Z A;  1SE9 A;  3V6E B;  2DHZ A;  2KD0 A;  2N1V A;  1V5T A;  3VAW A;  5L83 A;  4OVU A;  3QWZ B;  2FCN A;  4II2 B;  2KLG A;  2KVR A;  3VXW A;  4W9C A;  4DHJ B;  2DZK A;  4KV2 A;  1V49 A;  4FA6 A;  5G2N A;  4JL9 A;  3APD A;  5JHA A;  4BKS A;  2M4N A;  4BVU C;  2LI5 A;  1H8C A;  2KX3 A;  3NS8 A;  4G11 A;  4GN1 A;  2V4L A;  4P7I A;  4J6I A;  1S3S G;  2RPQ A;  3C0R B;  3RUI B;  2KTR A;  2MBO A;  4IG7 B;  3ZVV A;  5EDS A;  4EFO A;  1UBQ A;  1IYF A;  3RCZ A;  4HPM B;  1P98 A;  3V6C B;  1WMH B;  2HJ8 A;  1SGH A;  1YJ1 A;  4PYZ A;  2HD5 B;  2FNJ B;  1MG8 A;  2L05 A;  2LWP A;  2O2V B;  3V61 A;  1WGR A;  1F9J A;  4CO7 A;  1T0Y A;  3DCG A;  4LCD E;  2JUO A;  2UYZ B;  4GMV A;  4RM9 A;  4IC7 B;  2CHZ A;  2Y5B B;  4KSL C;  5FR6 A;  5DPT A;  3MHS D;  2J0M A;  3QAQ A;  3MJW A;  1V81 A;  1J19 A;  2LVO A;  2M17 A;  4BBN C;  1Q0W B;  5CHF A;  2M0X A;  3CF6 E;  3OJ3 A;  3PSE B;  4MDK E;  1C3T A;  4W9E A;  2G4D B;  3LDZ E;  1Z2M A;  5AZG A;  3ZRF A;  1H4R A;  4MM3 A;  2BPS A;  2LAS A;  2LRW A;  3DOW A;  1WJN A;  1WXV A;  2XK5 A;  4IM3 A;  5AZF A;  1WE7 A;  2L0F A;  3TCA A;  2FCS A;  3JVZ X;  3ZKJ C;  4AJW A;  5KHQ A;  2NPT B;  3TL5 A;  3DBL I;  3DVN V;  3R7R A;  3ZO5 B;  1WGY A;  3H7S A;  3ZTC A;  2GMI C;  5TR5 A;  1P9D U;  1IP9 A;  4NJ7 A;  4B95 A;  2DZJ A;  4HCP B;  1YX5 B;  1UZX B;  3GZN I;  4II3 B;  1WJ4 A;  2JWZ A;  1WR1 A;  2ZNV C;  4FN2 A;  2GBK A;  2KJH B;  2HTH A;  3A9J B;  1KOT A;  1P3Q U;  2NBU A;  1R4N I;  1QZE A;  1WMH A;  1WM3 A;  2DYB A;  1WZ3 A;  5E6N A;  2D3G A;  3VVW B;  1TBE A;  2BYV E;  2ZZP B;  3H9D A;  3VQI A;  4DDI D;  3L08 A;  4W9L A;  2FAZ A;  3KH0 A;  4KSK C;  2O6V B;  4JQW C;  2KK8 A;  4HCN B;  1K8R B;  4PYU A;  3ZLZ A;  3ZNG C;  4XC2 A;  4F7Z A;  3ML8 A;  2AEH A;  4MEM A;  4AP4 C;  4WJO A;  1UBI A;  2GBJ A;  3L17 A;  1E7U A;  1BT0 A;  4KZ0 A;  2CS4 A;  5AZH A;  5G55 A;  4M8M A;  1OQY A;  2J0J A;  2N7D A;  2REX A;  3QHT A;  4HDQ A;  2R2Q A;  2AWT A;  3QJZ A;  2K8B A;  2DZI A;  4TKN A;  1P1A A;  2PE9 A;  4W9G A;  2LXA A;  3A33 B;  2K8C A;  2WX1 A;  1V2Y A;  2RD0 A;  4NAW B;  2V1Y A;  2MBB B;  2ZVN A;  3ZDT A;  1OGW A;  3B08 A;  2EMT A;  4I6N B;  2OJR A;  2AL3 A;  3SD5 A;  3JW0 X;  2FID A;  2JT4 B;  2PPH A;  3RYT A;  2NBW B;  2J0K A;  5LLI A;  3IHP C;  2BGF A;  3Q3J A;  3IG3 A;  1Y8R C;  2D11 A;  2VRR B;  2NCN A;  3DQV A;  1WR6 E;  2KWC A;  3KYD D;  1XD3 B;  3PRE A;  3VFK A;  3VDZ A;  3AI5 A;  4MH0 E;  1NI2 A;  4HXD A;  4GIV A;  4DBG A;  4FHJ A;  3NOB A;  1WM2 A;  1I42 A;  1OEY J;  1L7Y A;  3ZW3 A;  3QQ8 B;  1KLV A;  3OLM D;  1KJT A;  5J17 A;  1WGG A;  2KZR A;  3PGE A;  3KUC B;  2ASQ A;  3QAR A;  3T9L A;  1M94 A;  4F1S A;  4W9I A;  3NY5 A;  5CHW A;  4WQO B;  5CTR C;  2MX2 A;  1VD2 A;  4K7S A;  1GG3 A;  4EZL A;  5IA7 A;  4GOC A;  4M0W B;  3PPA A;  3A1Q B;  3TIX A;  4NQL B;  4ZRJ A;  3EHV A;  3VTU A;  4HWI B;  4LJO B;  3LJ3 A;  4MGI E;  2NS5 A;  3PHX B;  3P2B A;  1OEY A;  3JSV A;  3X23 A;  4WWP A;  2CR5 A;  4GB9 A;  4HK2 A;  4XZ4 A;  5JHB A;  2IBI B;  2KWU B;  4EUT A;  2DEN B;  1WI0 A;  2KMA A;  2BYE A;  3WAP A;  1C1Y B;  2JF5 A;  2K6Q A;  3KW5 B;  2ZCC A;  4BFR A;  3UQB A;  2O2V A;  2L0T A;  2ZVO A;  2K1F A;  2MWS B;  2MLB A;  3BIN A;  3EEC A;  5D94 A;  1J8C A;  2N1W A;  2MCN B;  3A4R A;  2DAJ A;  4DHZ E;  3HIZ A;  2C9W B;  4HJK A;  3TBL D; 
#chains in the Genus database with same CATH topology
 1VR9 A;  2WXP A;  1WRD B;  4I6L B;  2KQS A;  3ZJV A;  3IFW B;  2J52 A;  4IWP A;  1E8W A;  4ZHP A;  3EC8 A;  4EKU A;  3GS2 A;  3A4S C;  2CHW A;  4HPL B;  3Q8E A;  3BYY B;  1OFF A;  3WIM A;  2INP E;  3MJ5 A;  2EKE C;  4DXF A;  2FUG 1;  3NZU A;  1JQ4 A;  1JML A;  2N0S B;  1VRA B;  2BS4 B;  3P1M A;  4JWU C;  2WWZ A;  1CQV A;  3IVF A;  2D5G A;  4AOF A;  4WUR A;  1E8X A;  1WXA A;  3DHG C;  1L4D B;  1LGR A;  5JH5 C;  3QIJ A;  1WXM A;  4DWF A;  4MGK E;  1X1M A;  3DBL B;  1V80 A;  2K3U A;  1YJJ A;  4OVV A;  3KUD B;  1D5X C;  5BYR A;  2K6D B;  1OTR B;  2K5P A;  2YEP F;  1AWD A;  3VTW A;  1WYW B;  1V6E A;  3H1U A;  4J3O D;  2FCQ A;  2N9E B;  1I4H A;  4M02 A;  1XQQ A;  1GUA B;  4AUQ C;  3PRM B;  3ZNH B;  1R4M I;  5E6O A;  5FK9 C;  3APF A;  3DDC B;  2MBH A;  3BYT B;  2BKR B;  1HE8 A;  4ZRQ A;  2Z0E B;  1SJE D;  2K39 A;  4A9A A;  1E7V A;  3PLU A;  2MW5 A;  4PS8 A;  5E6J A;  2G45 B;  2Z0D B;  4EZK A;  2KDI A;  4LTU A;  4K7U A;  4IWO A;  2O6V A;  3UGB B;  2LMC A;  4WH4 A;  4C4V B;  1ZXI A;  2HDE A;  2IND C;  2KXJ A;  2GOW A;  3PZ7 A;  1I35 A;  1N5X A;  4ZHO A;  3RZW C;  4BAX A;  2KOX A;  4XDC A;  3Q3N C;  2H89 B;  3BK2 A;  4H2A A;  1ENF A;  2FCM A;  3ZJU A;  1FFV A;  4WWN A;  1TZ1 A;  1V1O A;  2JRH A;  4BBN F;  2N9X A;  1JRU A;  2PE6 B;  3R7Q A;  5KHO A;  1TGZ B;  3GP7 A;  1A5R A;  3DBR I;  5C1Z A;  4C56 C;  3P4S B;  2WYQ A;  4A3O A;  4TV3 A;  4KGS A;  3ALB A;  1J7B A;  3U8Z A;  3PLV A;  1E90 A;  4C4V A;  2J4X A;  3I3T B;  3VH3 B;  1PUT A;  1WJU A;  1QOB A;  2WX0 A;  2MP2 A;  1JWM D;  3H8H A;  4W9K A;  1ISN A;  1TYG B;  3T3O A;  1Q10 A;  3SHQ A;  1E8Y A;  2LRU A;  1XLN A;  2HTM E;  1SSN A;  1XCT L;  5D2M B;  2QMT A;  1N62 A;  4RGN A;  3Q3F A;  3V3X A;  2ZJD A;  1T6B X;  2L32 A;  2N7J A;  4ARI A;  1HA5 A;  4QAY A;  3N32 A;  3W5U B;  1WX8 A;  1V9J A;  2Q5W D;  5D7G A;  1STE A;  3D32 A;  2E6X A;  4UDU C;  5G5G A;  3OAW A;  3DBH B;  4NY0 A;  1WYG A;  2WXQ A;  1VLB A;  4BOZ B;  1QF6 A;  1CMX B;  3P4Q B;  3HK0 A;  3VR9 B;  1TS3 A;  4OZC A;  5D3I B;  3SDL C;  1EM7 A;  2WXK A;  3UIO B;  1JAL A;  2PMV A;  4KGR A;  2C60 A;  2YLM A;  5L95 C;  3PRZ A;  4TQ0 A;  2M1M A;  2KYW A;  1FNW A;  2LGI A;  4ANV A;  1GC7 A;  1QT9 A;  4MT5 A;  3QX1 A;  4C7Z A;  4WJP A;  2KAN A;  3AMZ A;  3AU5 A;  3SU8 X;  3BWU D;  4FJV B;  3DWG C;  4YTN B;  1V8C A;  1WXS A;  3C8Y A;  4BKT A;  2L76 A;  1V1P A;  3S2A A;  2KTR B;  2MBQ A;  2WQY B;  2IJ0 A;  2JSV X;  1Q1O A;  4HRS A;  2IZV B;  3CST A;  1R4M B;  4HLE A;  3KWL A;  1WSP A;  2IO1 B;  2ZPN A;  4EOY A;  1SE3 A;  3J9C A;  4KKJ A;  5FKA C;  2WXF A;  3GOE A;  2J42 A;  2L7R A;  2RSU A;  2IY1 B;  1K51 A;  3EFU A;  3HHM A;  1N60 A;  2JXT A;  1GPX A;  3C19 A;  4S0R A;  2NVU I;  1RWS A;  1SE9 A;  1F77 A;  1FCC C;  3NVZ A;  1SBB B;  3N1Y C;  1YOV B;  2XN9 C;  1E10 A;  4KV2 A;  1ZE3 D;  1D6E C;  1PGA A;  4BKS A;  1C9F A;  2M4N A;  4BVU C;  2LI5 A;  1QOG A;  4GN1 A;  4P7I A;  2RPQ A;  3C0R B;  2MBO A;  4MH8 A;  3RNB C;  4HPM B;  2MJ3 A;  5IN7 A;  1YJ1 A;  3BVG A;  2O2V B;  1WGR A;  1C77 A;  4IC7 B;  2Y5B B;  2Y3A A;  1R7S A;  3I63 C;  2BB6 A;  3QAQ A;  1J19 A;  2M17 A;  3E9S A;  4MDK E;  4JWS C;  1Z2M A;  4PK1 A;  1WJN A;  1WXV A;  4P6V F;  3ZKJ C;  3CIR B;  4RH6 A;  3DBL I;  1KFY B;  1WRI A;  3PZ8 A;  3ZO5 B;  2GMI C;  2BBC A;  3R2I A;  2DZJ A;  2LEK A;  2KJH B;  1PFD A;  3EUB 2;  4YXD B;  1NEN B;  1QZE A;  1N6Z A;  4RGM A;  1QIL A;  2ZZP B;  3VQI A;  1TY2 A;  4KSK C;  1K8R B;  1MVK A;  3ZNG C;  4MEM A;  4AP4 C;  1UBI A;  1V1P B;  3MC8 A;  2MJD A;  3U4E G;  3RNA C;  2J0J A;  1FXA A;  4HDQ A;  3QHT A;  1CK1 A;  4P1C C;  2PE9 A;  4W9G A;  3A33 B;  2K8C A;  2WX1 A;  3SFD B;  2RD0 A;  4JPS A;  2MBB B;  1OGW A;  1EWY C;  2OJR A;  2LJI A;  4I6N B;  3JW0 X;  2FID A;  1JRO A;  2PPH A;  1VZ7 A;  2VRR B;  3PRE A;  1HTO A;  3VDZ A;  3VFK A;  2WXR A;  4DBG A;  1UWM A;  3ZW3 A;  3OLM D;  5J17 A;  1WGG A;  4AS1 A;  3T9L A;  1P7F A;  2MX2 A;  4K7S A;  3TSS A;  3SFE B;  2V0G A;  1E9M A;  4NQL B;  1HEZ E;  3EHV A;  4HWI B;  3LJ3 A;  2VZK B;  3PHX B;  3X23 A;  3ZYY X;  1ESF A;  4GB9 A;  4P16 A;  3HRD D;  4EUT A;  1WI0 A;  3Q8A A;  4HRO A;  3NS1 A;  2RDB C;  4PT5 A;  3ZJT A;  2ICI A;  3BIN A;  5D94 A;  4RFB A;  1ACC A;  3I57 A;  4DHZ E;  1UUP A;  1ZDX A;  2YEP B;  3BY4 B;  2KJR A;  3AXC A;  3URY A;  2W55 A;  3HVD A;  4OW0 A;  1YN5 A;  4PS7 A;  1BUI C;  4EE2 A;  3ZDM C;  2FBW B;  1QLB B;  1I4X A;  4NZL B;  3BII D;  2ZNV B;  1C78 A;  3BK1 A;  2RGF A;  3L16 A;  1TIF A;  3M62 B;  4GDL A;  4IM2 A;  4DXA B;  1GC6 A;  1TT5 B;  3Q3O C;  2IY0 B;  1SIJ A;  4EEW A;  1WGD A;  3ZNZ B;  1EU4 A;  5T8I A;  4YT0 B;  5BMH A;  4R3D A;  5HKH A;  2WDR B;  1JWA D;  2CKH B;  3HUI A;  2LJ5 A;  3NRZ A;  2QJL A;  1UD7 A;  4HEA 1;  3UIP B;  4IKG A;  4C7Y A;  1YQB A;  2MSE D;  2R61 A;  1I4P A;  4K1R B;  4A3P A;  1EUV B;  1MJD A;  2AQ2 B;  1L2N A;  1I4G A;  5H92 C;  2L52 A;  2O6V D;  5LXI B;  2D3A A;  2DZM A;  4ANU A;  2BYT A;  2WDQ B;  2KDF B;  1TKG A;  3W9C B;  1KM7 A;  1WZ0 A;  4KZC A;  3WAL A;  3K9O B;  3FIL B;  1IUE A;  4YWG G;  2OJW A;  4HKQ A;  1YX6 B;  1YJI A;  4MSM B;  4WWM A;  3L0W B;  5BYS A;  3L10 B;  2GB1 A;  1C4P A;  3N3K B;  4MGY E;  3RUL A;  3KLS X;  2BWF A;  4FHK A;  1XF5 L;  2WXO A;  4JLC A;  3KVF B;  3EGR A;  3WAN A;  1TJE A;  4XE0 A;  3AEF B;  2K9X A;  4HVB A;  2DLB A;  2NMQ A;  1DGJ A;  4GSW A;  4GU2 A;  3I9V 1;  2DWQ A;  4YSZ B;  5JZE B;  4LNI A;  3AEA B;  3MC0 B;  3MTN B;  4HJG E;  4TMA B;  4XYC A;  2FIF A;  3RZF A;  5CX3 A;  3W5V B;  2KT7 A;  3AM9 A;  1C4A A;  1ZW7 A;  3U7Z A;  4YL8 A;  3L13 A;  1HXY D;  2V9H A;  2OOB B;  1YMH E;  1RFA A;  3Q2A C;  5I4D A;  4RGO S;  4XX5 A;  3DBS A;  4GDK A;  4KGT A;  3RNC C;  2KTF A;  1YD8 U;  4AWJ A;  3B0A A;  1SE4 A;  4PS3 A;  1ZP0 B;  2X8X X;  1GJZ A;  1LXD A;  1VZ8 A;  4IDI A;  1ZUD 2;  1BML C;  1MFW A;  1GB1 A;  4GDK B;  4WAA A;  3N30 A;  1JRP A;  3ML9 A;  4G0N B;  4WWO A;  1AAR A;  3AE6 B;  3JYU A;  2DBY A;  2YVC A;  4F8C B;  2I1K A;  4KKI A;  1IPG A;  3SR6 A;  1RRB A;  2I1J A;  2OED A;  3ECI A;  2MEK A;  3NJT A;  4ZOH C;  2JZP A;  1FEH A;  1LFD A;  3WCQ A;  2WS3 B;  1JW9 D;  2KLC A;  3NZS A;  3WAM A;  4FAD A;  2GBN A;  1WH3 A;  1AYF A;  3AUL A;  1D3Z A;  2K22 A;  1WIA A;  3AU4 A;  3W1S A;  2A5U A;  1P7E A;  2LVQ A;  4HKZ E;  1N63 A;  4MEL A;  2BS2 B;  1UF0 A;  3AE8 B;  1E8Z A;  4JE3 B;  3U52 E;  1N5W A;  3TEY A;  1GB4 A;  3GB1 A;  2LUE A;  2Y5P A;  2UWQ A;  3N1Z C;  1DYQ A;  1T0R C;  1FNV A;  2DYM A;  5DPR A;  4DK5 A;  1R4N B;  1SF0 A;  2RDG A;  4BKG A;  3DPD A;  2WXL A;  1E5W A;  4M00 A;  1C76 A;  3B9J A;  2NPT A;  3V62 A;  2QCZ A;  1OQQ A;  4WJN A;  3R8B A;  3PZD A;  1MI0 A;  2KMM A;  2PVO D;  2FUH B;  3Q6B A;  1L5P A;  3R66 C;  2B76 B;  4ZDV A;  4GXB A;  5HHD G;  1G6J A;  2WXH A;  1D5M C;  5J18 A;  1N61 A;  2N9P C;  3NG0 A;  2KN4 A;  2MQJ A;  1XT9 B;  5DPW A;  4ZYN A;  5C23 A;  4TQ1 A;  5BO4 B;  1J7A A;  3RI7 C;  1WJ6 A;  3M3J A;  4OZB A;  1Z5S B;  5H8Y E;  3GZN B;  5D3D A;  3CMM B;  2N9K A;  3O65 B;  2KMC A;  2WDV B;  5BMG A;  2W3R A;  3AEG B;  2BB5 A;  4N6E B;  2BT6 A;  1DOY A;  1AW7 A;  3W1Y A;  1KH0 A;  3BVM A;  1GOZ A;  1F0Z A;  3IT4 B;  1F1H A;  2JVC A;  2A4Z A;  2WXJ A;  3V6E B;  5L83 A;  1NYQ A;  2FCN A;  2KVR A;  2IPK D;  2QC8 A;  1ZOY B;  3O13 A;  1GAQ B;  1ROE A;  5G2N A;  1TS5 A;  1XCQ L;  4JL9 A;  2XNA C;  1IBX B;  1AN8 A;  2WXG A;  3NS8 A;  3R2T A;  3RUI B;  2KTR A;  4IG7 B;  3ZVV A;  5EDS A;  1UBQ A;  1XEE A;  1KTK A;  1T0S C;  1WMH B;  2BS3 B;  1SGH A;  4PYZ A;  4XDD A;  2HD5 B;  1OQR A;  2TSS A;  4L2Y A;  5HG2 A;  4CO7 A;  2ON8 A;  2CJO A;  2CHZ A;  4HPP A;  5FR6 A;  5DPT A;  3AE4 B;  3MHS D;  3MJW A;  2LVO A;  1Q0W B;  3PSE B;  1XLP A;  3LDZ E;  1LO5 D;  3ZRF A;  1H4R A;  3AEB B;  1WE7 A;  2FCS A;  4XGA B;  2NPT B;  3DVN V;  1NVI D;  1WGY A;  5TR5 A;  1P9D U;  1IP9 A;  3TEX A;  4B95 A;  1DOX A;  1YX5 B;  1UZX B;  3GZN I;  1QOF A;  2JWZ A;  1WR1 A;  1ZXH A;  4US9 A;  3A9J B;  1KOT A;  1P3Q U;  4B0E A;  2NBU A;  1R4N I;  1TBE A;  1TKE A;  3KH0 A;  2PKO A;  3ML8 A;  3TEZ A;  4WJO A;  2GBJ A;  2IGD A;  4KZ0 A;  5AZH A;  1OQY A;  2REX A;  2W54 A;  2DZI A;  3U2S C;  1PYW D;  4OHJ A;  3RNG C;  1FPY A;  3LB8 C;  2JT4 B;  3RYT A;  2J0K A;  1MPE A;  3IHP C;  1XO3 A;  3FIL A;  1WR6 E;  4MH0 E;  1ET6 A;  3NOB A;  1WM2 A;  1I42 A;  3PGE A;  5LNK 1;  4LLG M;  2ASQ A;  3QAR A;  1QKZ A;  4ITK A;  4F1S A;  3NY5 A;  1L4Z B;  1VD2 A;  3FAH A;  4GOC A;  1TS4 A;  3PPA A;  1E6E B;  4NJC A;  3TIX A;  3VTU A;  4LJO B;  3P4R B;  2NS5 A;  1OEY A;  3VR8 B;  2CR5 A;  4LNK A;  1FNU A;  2IBI B;  3P63 A;  2BYE A;  3TEW A;  4BFR A;  3AE9 B;  2ZVO A;  2MWS B;  1F2R C;  3HIZ A;  1KF6 B;  4HJK A;  3TBL D;  4LDT D;  2G9H D;  4KIK B;  2EEL A;  3AE7 B;  2Z8L A;  3QCA A;  3R3M A;  1EWC A;  1L6V A;  3X0W A;  3VH4 B;  1M4V A;  2LZ6 A;  1UNS A;  2RR9 A;  4IOI E;  1B9R A;  2BQQ A;  2MH7 A;  2GBM A;  5HFY A;  3AE2 B;  3AE1 B;  3VUY A;  1DOI A;  2M0A A;  2BF8 B;  1EO6 A;  1U4A A;  2LHE A;  5IOI A;  4URK A;  1QOA A;  4DDG D;  4E71 A;  4C80 A;  4B6W A;  4ANW A;  2KHW B;  3NVY A;  4TUU A;  3WA0 A;  2NTS A;  1SE2 A;  5IO9 A;  3H7P A;  4KDL B;  2KWV B;  2WNM A;  2PLP A;  4G3X B;  1ZKH A;  2QEJ C;  1WGK A;  5J2R A;  3PTF C;  2AL6 A;  4IWQ A;  1CJE A;  3ZNI D;  1WGH A;  5AEK B;  5DCN A;  2INN E;  2PEA A;  3P4P B;  4KVG B;  1IYF A;  1PDX A;  2PVG C;  2V3P A;  3VUX A;  2KJ6 A;  1YQ4 B;  4RF0 A;  2CU3 A;  4KX6 B;  2JQR B;  4NNJ B;  3DWM A;  1I7H A;  2KC1 A;  4C00 A;  2BKF A;  4M01 A;  1WE6 A;  1WY8 A;  2HE7 A;  3K9P B;  4YTP B;  1NDD A;  5IP4 D;  3ZRC A;  4B0M A;  1HTQ A;  2B3A A;  2D07 B;  2DNF A;  4LK0 M;  2JZ3 B;  2L83 A;  1P0R A;  4MGZ E;  2C7H A;  1PQS A;  3IAM 1;  2J7Q B;  2L3Z A;  3HVZ A;  3Q8C A;  2V3N A;  2LGD A;  4N9F 4;  4CHK A;  4GDL B;  2PTL A;  1E7P B;  4ARC A;  2QHO A;  4A20 A;  4K81 A;  3ONS A;  1VZ6 A;  2D2Q A;  2ZCB A;  2LXC A;  3IT6 B;  3KYC D;  2D10 A;  3L4P A;  3A1Q A;  2MA9 B;  3DVG Y;  3QK0 A;  4RM8 A;  2EKI A;  1NEK B;  2RPV A;  3CSF A;  1L0X B;  3T8M A;  2NBV B;  4B9K A;  2ZW0 A;  3EFC A;  4N58 A;  3ZIM A;  4FLH A;  4NJ6 A;  3PVL A;  5LXH A;  1D4B A;  2N9L A;  1L0Y B;  1HZ5 A;  1JWB D;  2VH2 A;  3U7D A;  4YSY B;  5FR3 A;  1V86 A;  1K52 A;  3RNF C;  1J0G A;  4IUM B;  2WLB A;  3ZQ4 A;  1MHH E;  1WFY A;  2IO2 B;  4IM0 A;  2HJ1 A;  3WAO A;  1CZP A;  2MJE A;  3DHH C;  4O1N A;  4FBJ B;  2AQ1 B;  4E74 A;  2KFK B;  4WIP A;  2NR2 A;  3W2D A;  2IO0 B;  2WDT B;  3DBH I;  1JWS D;  4AQ7 A;  2MBE A;  2KDB A;  4FUL A;  2V3S A;  2G1E A;  1XLQ A;  2C7N B;  2R2O A;  3UIN B;  3A9J A;  1Q5W B;  2RDH A;  5G5H A;  3P42 A;  5CHV C;  4DXG A;  3UQA A;  4BKS D;  1YIW A;  3PHW B;  3VRB B;  5D6J B;  2DYO A;  1UEL A;  2QIE B;  1F52 A;  2ZW1 A;  3HM3 A;  3V05 A;  2I2Y A;  1Y56 A;  2G4S A;  3MC9 A;  4MJS A;  4ANX A;  2JRI B;  2QIL A;  1FRR A;  4FJZ A;  3KQ4 A;  4REZ A;  2M8S A;  2WXN A;  3AV8 A;  3IBE A;  3A9K A;  3PS6 A;  4LDT B;  1S1Q B;  1FMA D;  2C7M B;  2ZEQ A;  4TSS A;  3ZTD A;  1FCL A;  2JZZ A;  2QDF A;  2MRP A;  4YTM B;  3SEB A;  2DHZ A;  1FIQ A;  2N1V A;  3B2G A;  3VAW A;  3RNE C;  4OVU A;  3QWZ B;  3Q14 C;  1SB3 C;  1V49 A;  1FXI A;  4FA6 A;  3APD A;  5JHA A;  4G11 A;  2V4L A;  4J6I A;  3I5J C;  2SAK A;  2WU2 B;  3LYY A;  2JX5 A;  2FNJ B;  2L05 A;  3V61 A;  1F9J A;  2BVC A;  1T0Y A;  3DCG A;  2E3T A;  4GMV A;  4RM9 A;  1YN4 A;  2D3B A;  1L6U A;  3Q8F A;  4BBN C;  2M0X A;  3GE8 C;  3CF6 E;  3OJ3 A;  3Q3M C;  4W9E A;  2G4D B;  5AZG A;  4MM3 A;  5EE3 A;  2LAS A;  2LRW A;  2L0F A;  3TL5 A;  3AB5 A;  3R7R A;  1I4R A;  1T3Q A;  3AN1 A;  3H7S A;  1VJK A;  4HCP B;  2LFI A;  4FN2 A;  2GBK A;  2HTH A;  1WM3 A;  2DYB A;  3VVW B;  2JYT A;  2BYV E;  3H9D A;  4DDI D;  3L08 A;  1XLO A;  4W9L A;  2FAZ A;  2WHI A;  3AE5 B;  2O6V B;  2KK8 A;  4HCN B;  4PYU A;  4F7Z A;  3ETR A;  4XWT A;  5G55 A;  2KAJ A;  4M8M A;  2AWT A;  4TKN A;  3AED B;  3MP9 A;  4NAW B;  2V1Y A;  2ZVN A;  5EE0 A;  4D2K A;  2FE8 A;  2EMT A;  3B08 A;  1F2R I;  1RFK A;  2NBW B;  2I38 A;  3Q3J A;  1XD3 B;  1QQR A;  3IXS A;  1UGJ A;  4A55 A;  1OEY J;  1L7Y A;  1KJT A;  2KZR A;  1M94 A;  4WQO B;  5IA7 A;  1GG3 A;  4RGT A;  1D5Z C;  2LHD A;  2V4I B;  1KLG D;  4HK2 A;  3RMK C;  4XZ4 A;  5JHB A;  2KMA A;  3WAP A;  1C1Y B;  2J53 A;  2K6Q A;  3KW5 B;  2ZCC A;  2GLS A;  3UQB A;  2O2V A;  1L0V B;  2BW2 A;  4RNA A;  3A4R A;  1WXQ A;  2KVZ A;  4JGH B;  2C9W B;  1JWU D;  1RLF A;  2M19 A;  4LJP B;  4ICV A;  4MSQ B;  3ENE A;  4JIO U;  1PGB A;  2LGX A;  3TMP B;  1YNT E;  3VTV A;  2LUM A;  3AH7 A;  2KO3 A;  4US8 A;  3M63 B;  4KIK A;  1NYR A;  4WJQ A;  3NHE B;  2K25 A;  3QC8 B;  2W82 A;  1MG4 A;  3N20 C;  4WAF A;  2KQ7 A;  3RD2 A;  5C3J B;  1ZGU B;  2KDE B;  3ZXV A;  1SIF A;  2AX5 A;  1WF9 A;  2DX5 B;  2JU6 X;  3B1L X;  4NQK E;  2KN5 A;  2NTT A;  3UI3 A;  1KLU D;  2GBR A;  3JSV B;  2JXX A;  2N7E A;  4RMA A;  4FJY A;  4HDO A;  4YSX B;  2MP2 B;  3NUH B;  1HZ6 A;  5EE9 A;  2EMS A;  2KNB A;  4GGQ A;  4ZRI A;  4BOS C;  1UGM A;  2KQ4 X;  4RF1 A;  2Y5C A;  1EF5 A;  3RN9 C;  3H6N A;  1RAX A;  2BYF A;  2LGY A;  1XXG A;  1SJH D;  2ONQ A;  1BXT A;  2JYE A;  1T5X D;  4ICU A;  4X57 B;  1TY0 A;  4ZRK A;  3V60 A;  4A8X C;  2KAC A;  2SEB D;  4AJY B;  4W9D A;  2M56 B;  1FM0 D;  3TJP A;  2IYD B;  1V97 A;  3KUZ A;  2WP9 B;  5DPS A;  2AYO B;  1IBX A;  1UH6 A;  1FO4 A;  2PIA A;  5AUK A;  1EF1 A;  4XWW A;  3DHI C;  2AQ3 B;  3HM6 X;  5E6P A;  2G3Q B;  2BTE A;  3NVW A;  1T0Q C;  2ACZ B;  4NAW A;  4M0W A;  2KFK A;  5C2T B;  4A6Q A;  3PO0 A;  4ASW C;  1NBF C;  3PRP B;  2JWU A;  5BYQ A;  4W9H A;  3QA8 A;  1GNU A;  1WX7 A;  2LD9 A;  4G50 A;  2L00 B;  2XBB C;  4EZJ A;  2W3S A;  2KC2 A;  1WX9 A;  3RPF C;  1FRD A;  4WQM A;  2KX0 A;  3CWI A;  4IW0 A;  4ZRJ A;  5GMV A;  1I4Q A;  4DHJ D;  2IO3 B;  5KHQ A;  1V5O A;  2LVP A;  2UU7 A;  2L8J A;  1C79 A;  4W9J A;  2GI9 A;  2KWD A;  4USA A;  4DHZ B;  2KKC A;  3W1S C;  3LXF A;  3H7P B;  3ZGZ A;  4KDI C;  1TKY A;  2BWE S;  3M95 A;  3PV1 A;  3A9K B;  3U30 A;  3N1X C;  2KFJ A;  2C5L C;  5IAA C;  3VUW A;  2W9N A;  1C4C A;  3ZUN A;  1LM8 B;  2K8H A;  4OVZ A;  2WXI A;  1TTN A;  1FXT B;  2IGH A;  3EA6 A;  3APC A;  2JPH A;  2IDY A;  4K3C A;  3PT2 B;  4P1B C;  1PGX A;  4MM3 B;  2JY6 A;  2XK5 B;  4NPN A;  5GXG B;  2N4F A;  4JX1 C;  5EE1 A;  1LQB A;  5HI1 A;  1TZO A;  3OG5 A;  3VHT C;  3Q69 A;  3L54 A;  1ET9 A;  3E56 A;  3DVG X;  1VCB A;  1ZPS A;  3OWE B;  3ZXR A;  2Z59 B;  2ZPY A;  4MJS B;  2CHX A;  4E3C A;  4CYE A;  2VZK D;  4W9F A;  3DVN U;  3NZ3 A;  1IGD A;  3UF8 A;  4Q2J A;  2XEW A;  4K7W A;  3BVZ A;  2CJN A;  1YQ3 B;  3T3N A;  4M8N A;  2PJH A;  3ABV B;  2KDM A;  3RT3 B;  2CU1 A;  4I6P A;  1UWX A;  2MHJ A;  3AE3 B;  1B1Z A;  2WXM A;  3VRA B;  1ZDV A;  3OJ4 B;  4OZA A;  2DAF A;  4LNO A;  2KD0 A;  1V5T A;  3N9Y C;  4II2 B;  2KLG A;  3VXW A;  4W9C A;  4DHJ B;  2DZK A;  4DQO C;  3DBR B;  1H8C A;  2KX3 A;  4LNF A;  4ZRP A;  1K53 A;  3B2F A;  1S3S G;  1YN3 A;  4EFO A;  1RYJ A;  3RCZ A;  5BMI A;  1P98 A;  3MHZ A;  3V6C B;  1RM6 C;  1TS2 A;  2HJ8 A;  3RFZ B;  1MG8 A;  2D3C A;  2LWP A;  2WGS A;  3AEE B;  2WU5 B;  4FXC A;  4LCD E;  2JUO A;  2UYZ B;  4KSL C;  2J0M A;  1V81 A;  1NI3 A;  5CHF A;  2QSD A;  1SXT A;  3AEC B;  1C3T A;  2BPS A;  3IAS 1;  4IM3 A;  3DOW A;  4GLS C;  5AUI A;  5AZF A;  2XK5 A;  4A90 A;  3TCA A;  3JVZ X;  4AJW A;  3TUO A;  3BZD B;  2LGS A;  3NVV A;  3ZTC A;  3FKY A;  1HQR D;  2GRI A;  4NJ7 A;  4II3 B;  1WJ4 A;  3GE3 C;  2ZNV C;  1MHX A;  5MPO A;  1WMH A;  5E6N A;  5IKC M;  1WZ3 A;  2D3G A;  2OHF A;  1IGC A;  4JQW C;  3ZLZ A;  4XC2 A;  2AEH A;  1FD6 A;  4NAM A;  3L17 A;  1VDV A;  1E7U A;  1BT0 A;  2RMM A;  2PW9 A;  2CS4 A;  3Q8B A;  2N7D A;  2R2Q A;  3QJZ A;  2L1A A;  2K8B A;  4ZYS A;  1A70 A;  1P1A A;  4L23 A;  2LXA A;  1V2Y A;  3FC4 A;  1JCK B;  3ZDT A;  4LNN A;  1EU3 A;  2AL3 A;  3SD5 A;  1WWT A;  4N59 A;  1E0Z A;  5LLI A;  2BGF A;  3IG3 A;  1Y8R C;  2D11 A;  4S17 A;  2NCN A;  3DQV A;  2KWC A;  3KYD D;  1FFU A;  3AI5 A;  4RCO A;  1NI2 A;  4HXD A;  4GIV A;  1KRH A;  4FHJ A;  4L1B A;  1KLV A;  3MFG A;  3QQ8 B;  3KUC B;  1K50 A;  4W9I A;  5CHW A;  1J7C A;  5CTR C;  4BZA A;  4EZL A;  5JXV A;  4M0W B;  3A1Q B;  4ACF A;  4MAC A;  2X38 A;  4MGI E;  3P2B A;  3JSV A;  4WWP A;  5TSS A;  2INC C;  2VH1 A;  2KWU B;  2DEN B;  1SEB D;  2JF5 A;  2H88 B;  2L0T A;  2K0P A;  2K1F A;  4CQN A;  2MLB A;  3EEC A;  1J8C A;  2IGG A;  2N1W A;  2MCN B;  2DAJ A;  3KWV A;  4K3B A; 
#chains in the Genus database with same CATH homology
 1RLF A;  1WRD B;  3BY4 B;  4LDT D;  2KJR A;  3AXC A;  4I6L B;  4KIK B;  4LJP B;  2KQS A;  3IFW B;  4ICV A;  4MSQ B;  4PS7 A;  4IWP A;  3QCA A;  1E8W A;  3EC8 A;  3R3M A;  3ENE A;  4EKU A;  3A4S C;  2CHW A;  3ZDM C;  4JIO U;  4HPL B;  3X0W A;  2ZNV B;  5DPW A;  3WIM A;  2LGX A;  3VH4 B;  2EKE C;  3TMP B;  3NZU A;  2LZ6 A;  2RGF A;  3L16 A;  3VTV A;  3M62 B;  4GDL A;  4IM2 A;  2RR9 A;  4DXA B;  1GC6 A;  2GBM A;  4EEW A;  2IY0 B;  2KO3 A;  1WGD A;  3M63 B;  4KIK A;  3ZNZ B;  4WJQ A;  2WWZ A;  3VUY A;  2BF8 B;  3NHE B;  1EO6 A;  3IVF A;  4AOF A;  5HKH A;  1U4A A;  1E8X A;  1WXA A;  4URK A;  2K25 A;  3QC8 B;  2CKH B;  2LJ5 A;  1UD7 A;  4DDG D;  4E71 A;  5JH5 C;  3UIP B;  3QIJ A;  1WXM A;  2KQ7 A;  3RD2 A;  4B6W A;  4ANW A;  2KHW B;  4TUU A;  4DWF A;  1YQB A;  2MSE D;  3WA0 A;  4MGK E;  1X1M A;  4K1R B;  4A3P A;  1ZGU B;  1EUV B;  2KDE B;  1V80 A;  1L2N A;  3H7P A;  4KDL B;  2O6V D;  5LXI B;  4OVV A;  2DZM A;  2KWV B;  1SIF A;  3KUD B;  2K6D B;  4ANU A;  4G3X B;  1OTR B;  1ZKH A;  1WF9 A;  2DX5 B;  2KDF B;  3B1L X;  4NQK E;  2KN5 A;  5J2R A;  3PTF C;  3VTW A;  2AL6 A;  1WYW B;  4IWQ A;  1V6E A;  2GBR A;  3ZNI D;  3JSV B;  2JXX A;  3H1U A;  1WGH A;  1KM7 A;  1WZ0 A;  2N7E A;  4KZC A;  3WAL A;  4RMA A;  3K9O B;  5AEK B;  2FCQ A;  2N9E B;  1YX6 B;  5DCN A;  4MSM B;  4FJY A;  3L0W B;  4HDO A;  3L10 B;  1XQQ A;  2MP2 B;  1GUA B;  2PEA A;  4AUQ C;  3N3K B;  2EMS A;  3PRM B;  4KVG B;  3ZNH B;  1R4M I;  4MGY E;  2KNB A;  4GGQ A;  4ZRI A;  5E6O A;  3RUL A;  4BOS C;  3APF A;  3DDC B;  1UGM A;  2MBH A;  3VUX A;  2KJ6 A;  2BWF A;  4FHK A;  1EF5 A;  2BKR B;  1HE8 A;  3H6N A;  1RAX A;  2Z0E B;  2BYF A;  4JLC A;  2LGY A;  3KVF B;  4NNJ B;  3WAN A;  4ICU A;  4X57 B;  2K39 A;  4ZRK A;  2KC1 A;  3V60 A;  4HVB A;  4AJY B;  2BKF A;  4W9D A;  1E7V A;  3PLU A;  4GSW A;  4GU2 A;  3TJP A;  2MW5 A;  5JZE B;  4PS8 A;  2IYD B;  1WE6 A;  2G45 B;  2Z0D B;  1WY8 A;  4EZK A;  2KDI A;  2HE7 A;  3MTN B;  3K9P B;  3KUZ A;  4K7U A;  1NDD A;  4IWO A;  2FIF A;  2O6V A;  3UGB B;  3RZF A;  3ZRC A;  5DPS A;  5CX3 A;  2KXJ A;  2GOW A;  2AYO B;  1UH6 A;  2B3A A;  1I35 A;  2D07 B;  1ZW7 A;  1EF1 A;  4YL8 A;  3RZW C;  3L13 A;  3HM6 X;  5E6P A;  2G3Q B;  2KOX A;  2JZ3 B;  2OOB B;  1RFA A;  2FCM A;  4NAW A;  1P0R A;  4MGZ E;  4XX5 A;  3DBS A;  4WWN A;  1TZ1 A;  4GDK A;  2C7H A;  2JRH A;  2KFK A;  4BBN F;  2N9X A;  2KTF A;  1PQS A;  1JRU A;  1YD8 U;  2PE6 B;  3R7Q A;  4AWJ A;  5KHO A;  1TGZ B;  3B0A A;  2J7Q B;  4PS3 A;  2L3Z A;  4ASW C;  1NBF C;  1GJZ A;  3PRP B;  1A5R A;  3DBR I;  1LXD A;  2LGD A;  4N9F 4;  4W9H A;  3QA8 A;  4CHK A;  5C1Z A;  4GDL B;  1GNU A;  1WX7 A;  2QHO A;  2WYQ A;  2LD9 A;  4G50 A;  4GDK B;  4WAA A;  4A20 A;  4K81 A;  2L00 B;  2XBB C;  4A3O A;  4TV3 A;  3N30 A;  3ONS A;  2KC2 A;  4EZJ A;  1WX9 A;  3ALB A;  3U8Z A;  3ML9 A;  2KX0 A;  3PLV A;  2D2Q A;  1E90 A;  2ZCB A;  4G0N B;  1AAR A;  4IW0 A;  4WWO A;  3JYU A;  5GMV A;  2LXC A;  4DHJ D;  2IO3 B;  2YVC A;  4F8C B;  3I3T B;  3KYC D;  2I1K A;  2D10 A;  3VH3 B;  1V5O A;  2LVP A;  1IPG A;  1RRB A;  1WJU A;  2I1J A;  2MP2 A;  2L8J A;  2MA9 B;  2WX0 A;  3A1Q A;  3ECI A;  4W9J A;  4W9K A;  1ISN A;  1LFD A;  3DVG Y;  3QK0 A;  4RM8 A;  4DHZ B;  2KLC A;  3NZS A;  2KKC A;  3CSF A;  3W1S C;  3WAM A;  4FAD A;  3T8M A;  2NBV B;  3SHQ A;  2GBN A;  4B9K A;  1WH3 A;  1E8Y A;  2LRU A;  3AUL A;  3H7P B;  1D3Z A;  3ZIM A;  4FLH A;  4NJ6 A;  1WIA A;  3AU4 A;  3PVL A;  3W1S A;  2A5U A;  2LVQ A;  4KDI C;  5LXH A;  5D2M B;  4MEL A;  2BWE S;  1E8Z A;  3Q3F A;  2ZJD A;  3M95 A;  3U7D A;  3PV1 A;  3A9K B;  1V86 A;  3U30 A;  1J0G A;  4IUM B;  3N32 A;  2KFJ A;  2C5L C;  5IAA C;  2LUE A;  3VUW A;  1WX8 A;  1V9J A;  2W9N A;  5D7G A;  1WFY A;  2IO2 B;  3D32 A;  4IM0 A;  3OAW A;  2UWQ A;  3ZUN A;  4JGH B;  4NY0 A;  3WAO A;  2DYM A;  5DPR A;  1LM8 B;  2K8H A;  4BOZ B;  4DK5 A;  1CMX B;  3HK0 A;  4BKG A;  1TTN A;  1FXT B;  4FBJ B;  3DPD A;  3SDL C;  4E74 A;  1E5W A;  2KFK B;  2NR2 A;  3APC A;  2IO0 B;  2WDT B;  2JPH A;  3PT2 B;  2NPT A;  3UIO B;  2JY6 A;  2XK5 B;  3DBH I;  4NPN A;  3V62 A;  2C60 A;  2MBE A;  2KDB A;  2N4F A;  2YLM A;  5L95 C;  4FUL A;  3PRZ A;  4TQ0 A;  2M1M A;  1LQB A;  2V3S A;  4ANV A;  4WJN A;  3PZD A;  1GC7 A;  3VHT C;  2C7N B;  2FUH B;  2R2O A;  3L54 A;  3QX1 A;  3UIN B;  3R66 C;  3A9J A;  1Q5W B;  4WJP A;  4ZDV A;  4GXB A;  1G6J A;  3DVG X;  2KAN A;  1VCB A;  3AU5 A;  5J18 A;  3SU8 X;  2N9P C;  5CHV C;  2Z59 B;  4FJV B;  3UQA A;  1WXS A;  2MQJ A;  1XT9 B;  2ZPY A;  4MJS B;  1YIW A;  2CHX A;  3PHW B;  4BKS D;  4BKT A;  5D6J B;  4E3C A;  2DYO A;  4ZYN A;  5C23 A;  4CYE A;  4TQ1 A;  4W9F A;  3DVN U;  1UEL A;  5BO4 B;  2L76 A;  3S2A A;  3UF8 A;  2KTR B;  2MBQ A;  3HM3 A;  1WJ6 A;  2XEW A;  3M3J A;  1Q1O A;  4K7W A;  1Z5S B;  2IZV B;  3CST A;  3CMM B;  2G4S A;  4HLE A;  3O65 B;  2KMC A;  4MJS A;  2JRI B;  4M8N A;  2PJH A;  4ANX A;  2IO1 B;  2ZPN A;  4FJZ A;  4EOY A;  3RT3 B;  2CU1 A;  4I6P A;  3W1Y A;  2M8S A;  3GOE A;  3A9K A;  3IBE A;  2L7R A;  3PS6 A;  2RSU A;  4LDT B;  1S1Q B;  2C7M B;  2IY1 B;  2ZEQ A;  3ZTD A;  3EFU A;  2JZZ A;  3HHM A;  3OJ4 B;  2MRP A;  2NVU I;  2DAF A;  2JVC A;  2A4Z A;  1SE9 A;  3V6E B;  2DHZ A;  2KD0 A;  2N1V A;  1V5T A;  3VAW A;  5L83 A;  4OVU A;  3QWZ B;  2FCN A;  4II2 B;  2KLG A;  2KVR A;  3VXW A;  4W9C A;  4DHJ B;  2DZK A;  4KV2 A;  1V49 A;  4FA6 A;  5G2N A;  4JL9 A;  3APD A;  5JHA A;  4BKS A;  2M4N A;  4BVU C;  2LI5 A;  1H8C A;  2KX3 A;  3NS8 A;  4G11 A;  4GN1 A;  2V4L A;  4P7I A;  4J6I A;  1S3S G;  2RPQ A;  3C0R B;  3RUI B;  2KTR A;  2MBO A;  4IG7 B;  3ZVV A;  5EDS A;  4EFO A;  1UBQ A;  1IYF A;  3RCZ A;  4HPM B;  1P98 A;  3V6C B;  1WMH B;  2HJ8 A;  1SGH A;  1YJ1 A;  4PYZ A;  2HD5 B;  2FNJ B;  1MG8 A;  2L05 A;  2LWP A;  2O2V B;  3V61 A;  1WGR A;  1F9J A;  4CO7 A;  1T0Y A;  3DCG A;  4LCD E;  2JUO A;  2UYZ B;  4GMV A;  4RM9 A;  4IC7 B;  2CHZ A;  2Y5B B;  4KSL C;  5FR6 A;  5DPT A;  3MHS D;  2J0M A;  3QAQ A;  3MJW A;  1V81 A;  1J19 A;  2LVO A;  2M17 A;  4BBN C;  1Q0W B;  5CHF A;  2M0X A;  3CF6 E;  3OJ3 A;  3PSE B;  4MDK E;  1C3T A;  4W9E A;  2G4D B;  3LDZ E;  1Z2M A;  5AZG A;  3ZRF A;  1H4R A;  4MM3 A;  2BPS A;  2LAS A;  2LRW A;  3DOW A;  1WJN A;  1WXV A;  2XK5 A;  4IM3 A;  5AZF A;  1WE7 A;  2L0F A;  3TCA A;  2FCS A;  3JVZ X;  3ZKJ C;  4AJW A;  5KHQ A;  2NPT B;  3TL5 A;  3DBL I;  3DVN V;  3R7R A;  3ZO5 B;  1WGY A;  3H7S A;  3ZTC A;  2GMI C;  5TR5 A;  1P9D U;  1IP9 A;  4NJ7 A;  4B95 A;  2DZJ A;  4HCP B;  1YX5 B;  1UZX B;  3GZN I;  4II3 B;  1WJ4 A;  2JWZ A;  1WR1 A;  2ZNV C;  4FN2 A;  2GBK A;  2KJH B;  2HTH A;  3A9J B;  1KOT A;  1P3Q U;  2NBU A;  1R4N I;  1QZE A;  1WMH A;  1WM3 A;  2DYB A;  1WZ3 A;  5E6N A;  2D3G A;  3VVW B;  1TBE A;  2BYV E;  2ZZP B;  3H9D A;  3VQI A;  4DDI D;  3L08 A;  4W9L A;  2FAZ A;  3KH0 A;  4KSK C;  2O6V B;  4JQW C;  2KK8 A;  4HCN B;  1K8R B;  4PYU A;  3ZLZ A;  3ZNG C;  4XC2 A;  4F7Z A;  3ML8 A;  2AEH A;  4MEM A;  4AP4 C;  4WJO A;  1UBI A;  2GBJ A;  3L17 A;  1E7U A;  1BT0 A;  4KZ0 A;  2CS4 A;  5AZH A;  5G55 A;  4M8M A;  1OQY A;  2J0J A;  2N7D A;  2REX A;  3QHT A;  4HDQ A;  2R2Q A;  2AWT A;  3QJZ A;  2K8B A;  2DZI A;  4TKN A;  1P1A A;  2PE9 A;  4W9G A;  2LXA A;  3A33 B;  2K8C A;  2WX1 A;  1V2Y A;  2RD0 A;  4NAW B;  2V1Y A;  2MBB B;  2ZVN A;  3ZDT A;  1OGW A;  3B08 A;  2EMT A;  4I6N B;  2OJR A;  2AL3 A;  3SD5 A;  3JW0 X;  2FID A;  2JT4 B;  2PPH A;  3RYT A;  2NBW B;  2J0K A;  5LLI A;  3IHP C;  2BGF A;  3Q3J A;  3IG3 A;  1Y8R C;  2D11 A;  2VRR B;  2NCN A;  3DQV A;  1WR6 E;  2KWC A;  3KYD D;  1XD3 B;  3PRE A;  3VFK A;  3VDZ A;  3AI5 A;  4MH0 E;  1NI2 A;  4HXD A;  4GIV A;  4DBG A;  4FHJ A;  3NOB A;  1WM2 A;  1I42 A;  1OEY J;  1L7Y A;  3ZW3 A;  3QQ8 B;  1KLV A;  3OLM D;  1KJT A;  5J17 A;  1WGG A;  2KZR A;  3PGE A;  3KUC B;  2ASQ A;  3QAR A;  3T9L A;  1M94 A;  4F1S A;  4W9I A;  3NY5 A;  5CHW A;  4WQO B;  5CTR C;  2MX2 A;  1VD2 A;  4K7S A;  1GG3 A;  4EZL A;  5IA7 A;  4GOC A;  4M0W B;  3PPA A;  3A1Q B;  3TIX A;  4NQL B;  4ZRJ A;  3EHV A;  3VTU A;  4HWI B;  4LJO B;  3LJ3 A;  4MGI E;  2NS5 A;  3PHX B;  3P2B A;  1OEY A;  3JSV A;  3X23 A;  4WWP A;  2CR5 A;  4GB9 A;  4HK2 A;  4XZ4 A;  5JHB A;  2IBI B;  2KWU B;  4EUT A;  2DEN B;  1WI0 A;  2KMA A;  2BYE A;  3WAP A;  1C1Y B;  2JF5 A;  2K6Q A;  3KW5 B;  2ZCC A;  4BFR A;  3UQB A;  2O2V A;  2L0T A;  2ZVO A;  2K1F A;  2MWS B;  2MLB A;  3BIN A;  3EEC A;  5D94 A;  1J8C A;  2N1W A;  2MCN B;  3A4R A;  2DAJ A;  4DHZ E;  3HIZ A;  2C9W B;  4HJK A;  3TBL D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...