1MPEA

Ensemble of 20 structures of the tetrameric mutant of the b1 domain of streptococcal protein g
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
56
structure length
56
Chain Sequence
b'MQYKVILNGKTLKGETTTEAVDAATFEKVVKQFFNDNGVDGEWTYDDATKTFTVTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunoglobulin G binding protein G
publication title Core mutations switch monomeric protein GB1 into an intertwined tetramer.
pubmed doi rcsb
source organism Streptococcus sp. 'group g'
molecule tags Protein binding
total genus 5
structure length 56
sequence length 56
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2002-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1mpeA00
2LHDA 1D4BA 2NMQA 1GB4A 2KQ4X 2KWDA 1XCQL 5HFYA 2GI9A 2IGHA 1GB1A 1QKZA 1K52A 1MI0A 3V3XA 1MHXA 1IBXA 5BMIA 3GB1A 1MHHE 3MP9A 1HEZE 2PW9A 1HZ5A 2RMMA 2K0PA 4GLSC 2JZPA 5BMHA 1F2RC 3FILB 1K51A 2KDMA 1UWXA 4IOIE 1PGAA 1XF5L 1Q10A 4IKGA 1ZXHA 2IGGA 1FD6A 1YMHE 2N9KA 4WH4A 2IGDA 4KGSA 4KGRA 2LHEA 4OZAA 1PGXA 1IGCA 2ZW1A 4OZBA 1F2RI 3FILA 2LGIA 2JXTA 4MACA 1C9FA 2PTLA 4OZCA 2OEDA 2EELA 1FCCC 2JU6X 2RPVA 4KGTA 1K50A 5HHDG 2LUMA 2PLPA 2QMTA 1MPEA 1FCLA 1P7FA 1MVKA 2J52A 3UI3A 2ZW0A 2N9LA 2KN4A 1KH0A 2JSVX 2JWUA 1YNTE 2GB1A 2KACA 1EM7A 2I38A 4HJGE 1K53A 5JXVA 1PGBA 1JMLA 1HZ6A 4HKZE 2QSDA 5HI1A 1IGDA 2N7JA 5HG2A 5BMGA 2I2YA 2ON8A 4D2KA 2ONQA 1IBXB 1P7EA 2J53A 1XCTL
chains in the Genus database with same CATH superfamily
2LHDA 1GB4A 2KQ4X 3HHMA 1T0QC 5IA7A 2GMIC 2ZEQA 3VDZA 2K3UA 2WXQA 1MHHE 3FKYA 3CSFA 1V1PB 4LNIA 3W1SC 1WJ4A 3ZNZB 2OHFA 3AEAB 4DK5A 3DHHC 3U4EG 4K1RB 1WGKA 1XF5L 2KVZA 2G3QB 3AI5A 1V8CA 3SU8X 4KGSA 4WWOA 2GLSA 1D5MC 3ZJUA 3NZ3A 3QC8B 2K6QA 2D3CA 1TZ1A 4JWUC 3P4PB 2Z0DB 5E6JA 5C1ZA 1V86A 3MFGA 4Q2JA 1Y56A 4AJWA 2J7QB 5AEKB 4FJYA 1G6JA 2KLGA 2EELA 4L23A 3Q8CA 1FRDA 4ZRIA 2BVCA 2W3RA 2D5GA 3FC4A 3AM9A 2WDQB 4BAXA 3LDZE 1YOVB 4DXGA 3DQVA 2IPKD 3Q8FA 1Y8RC 2DWQA 3R7QA 3VVWB 3H7SA 2BS2B 3NOBA 2IDYA 1KH0A 2HDEA 2L00B 3BWUD 2KACA 2MP2A 1MG4A 4DQOC 2I38A 2KMMA 2KX0A 4HJGE 4A90A 1CZPA 4EZKA 2G4SA 1E7UA 1FXAA 2YEPF 1E8ZA 1XQQA 4DDGD 2O6VD 1JROA 3AE6B 3C19A 3DDCB 1L6VA 2MBEA 2C7NB 5GMVA 4GDLB 4OVZA 1TS3A 4YWGG 1WE6A 3VFKA 1NYQA 3KWVA 2BKRB 1ENFA 3NY5A 3Q2AC 1UBQA 3Q14C 1L7YA 2R61A 1FPYA 2PVGC 3MC9A 4AQ7A 3NUHB 4XWWA 3EFUA 3P4SB 2M19A 1H8CA 1Z5SB 1FNUA 5AUKA 1SJHD 2IO0B 2KMCA 2IO2B 3NVWA 5EE0A 1C3TA 1WX7A 4EKUA 5J2RA 1R7SA 2CHWA 3U30A 4A3OA 1K51A 4W9FA 4LDTB 2BKFA 4AP4C 2L76A 3U2SC 3M62B 3ML9A 2IGDA 3H1UA 3WAMA 1ZW7A 2J42A 2MJEA 2DZMA 4OZAA 2DNFA 2N7DA 4WURA 3QAQA 1NENB 1L2NA 3DBHI 4OZCA 4MH0E 2BF8B 4RFBA 1ESFA 2OEDA 2ASQA 2KVRA 4A20A 3CWIA 5JHAA 2FAZA 2W55A 2VH1A 2BYEA 2QMTA 1C79A 2EMSA 4A55A 2XK5B 3GZNI 3P1MA 4C80A 2O6VA 3M95A 1VZ8A 1I4QA 1WRIA 3KYCD 3RNEC 2KOXA 4KIKA 1UUPA 2K39A 4P16A 4FN2A 4HEA1 1UGMA 4JE3B 4LNOA 1SB3C 4M02A 1GPXA 4WIPA 2DZJA 1SJED 3KUDB 2KWDA 2N4FA 2EKEC 4GU2A 4TV3A 1WZ0A 1YQ3B 5LXHA 3WALA 1MI0A 1T3QA 4ARIA 4IDIA 1MHXA 1IBXA 1M94A 4HK2A 4X57B 3TEXA 5J17A 2WXFA 1WMHB 5EDSA 2ZZPB 4BZAA 3A9KA 2KTRA 4JLCA 2MX2A 2WP9B 1YJIA 1I42A 1TKEA 3ALBA 3N20C 2MBOA 1Q10A 1QOAA 4WJNA 2WXHA 3DOWA 2AX5A 2KDBA 1R4NB 4P1CC 1OEYJ 4AS1A 4I6LB 1FFVA 5AZGA 2G45B 2ZW1A 3AXCA 1QLBB 5EE3A 3DBRB 2L0FA 3V62A 1KFYB 1C9FA 2JX5A 2WWZA 3AE5B 2DAJA 3OAWA 1NI2A 4G3XB 1L0XB 1VCBA 1LM8B 1YJ1A 3IFWB 3AV8A 1TKGA 4MSMB 2FCNA 1GOZA 3RFZB 1WM3A 2SEBD 2ZW0A 2GRIA 2O2VB 4EUTA 1UELA 2D3BA 4MDKE 2N9EB 1A70A 5J18A 5JXVA 3UQAA 2IYDB 3EECA 5FKAC 2QCZA 3V6CB 1I4HA 1J0GA 4ANXA 1E6EB 1JWMD 3VQIA 4R3DA 5FR6A 1QOBA 2GBRA 4FADA 1XCTL 4F1SA 4XGAB 1F0ZA 2RSUA 3ZDMC 1FNWA 1NYRA 4LNKA 4CYEA 2ICIA 4W9GA 2V3SA 4XYCA 5CHFA 2QIEB 1VZ6A 1HEZE 3LYYA 5BYQA 2R2QA 4MEMA 2CKHB 4HXDA 3LB8C 4J6IA 3BK1A 2BYTA 2PEAA 4W9HA 3RULA 1ZXHA 4ZYSA 3NZUA 1FD6A 2LZ6A 4OVVA 3E56A 3PV1A 3ONSA 1T6BX 2J0KA 2K25A 4JWSC 2NTTA 1TJEA 2B76B 3TBLD 1CQVA 3EA6A 3PLVA 4E71A 2BBCA 3NS8A 5DCNA 2L05A 4KKIA 4K7SA 1OQYA 1UGJA 3UIOB 5TSSA 2RPVA 4KGTA 4M0WB 1ET6A 1E9MA 3V61A 2VRRB 1NDDA 2JQRB 4HRSA 1JQ4A 2D3GA 3OJ3A 5DPSA 3V60A 3DHIC 4LNNA 2K22A 2JT4B 5AZHA 4W9CA 1NI3A 2WXRA 2J0MA 4LTUA 2K8CA 3QQ8B 2AEHA 1J19A 3CIRB 1VDVA 2KKCA 2QEJC 4BFRA 1PFDA 1E0ZA 2KWVB 4FHJA 2W82A 1UWMA 4B6WA 2HJ1A 1ISNA 3QJZA 1FIQA 4HPMB 2J4XA 4LLGM 1Z2MA 1FXIA 1Q1OA 2JF5A 1AW7A 3DPDA 2WNMA 4EFOA 1SSNA 1ZKHA 1EWCA 3PHWB 4A9AA 4BBNC 5IP4D 2INCC 3QK0A 1EU4A 2JWZA 5CHVC 4M8NA 2EKIA 1WGHA 2NCNA 2BQQA 2Y5PA 1HXYD 2VZKD 3ZW3A 3GZNB 3NS1A 5HKHA 2KTFA 3RT3B 2CU3A 3UF8A 4O1NA 3ECIA 3E9SA 3B2GA 2LI5A 2IGGA 3L4PA 1HQRD 1LQBA 1UNSA 3AE8B 2BB5A 2W54A 2JZ3B 1DOYA 4KGRA 1YX6B 3U7ZA 1PGXA 1JALA 2WXKA 4LCDE 3ZDTA 3FILA 2M0XA 3ZNGC 2LGIA 2REXA 3URYA 2DYOA 2PTLA 4DHZB 5L83A 2KD0A 5IOIA 4UDUC 4NJCA 4ZHPA 4YTPB 2MBQA 2PLPA 3VRBB 3W2DA 1MPEA 1B1ZA 3H7PB 2FCMA 2XBBC 1V2YA 3P63A 2N9LA 2KN4A 3Q69A 1ACCA 3T9LA 2QDFA 3A9JB 1UBIA 1KM7A 2AL3A 4HCPB 4HKZE 4JX1C 3SDLC 4W9DA 2B3AA 4L2YA 2BWFA 3RI7C 1WXVA 2ZPNA 3R7RA 2L52A 1JWBD 1KRHA 3EFCA 4NJ6A 2DENB 4FXCA 4P1BC 1SGHA 1H4RA 4YSZB 5BO4B 2L83A 2NPTA 1WGGA 4K7WA 4KSKC 2MWSB 3UQBA 3V3XA 2DZKA 3GB1A 4FULA 4TQ0A 4TKNA 2A5UA 3DBRI 1N6ZA 4US9A 4J3OD 3UIPB 2RMMA 4XDDA 2JZPA 4NAWA 3AE9B 2HD5B 2KFKA 1UWXA 2WXGA 1YD8U 1L6UA 1K8RB 2KDIA 1GC6A 2ZVNA 1KLGD 3AEFB 4LJPB 4RM9A 4MJSB 5JH5C 3T3NA 4MGZE 2E6XA 3OJ4B 3ZO5B 4C7ZA 3U52E 1LFDA 3I9V1 1CK1A 4WQMA 1SXTA 5AZFA 2HTHA 4MACA 4GSWA 3B9JA 2K8BA 1D6EC 3RNGC 4C4VA 4IUMB 1FMAD 1XO3A 4W9KA 3K9PB 1SE3A 4XZ4A 1TY2A 3Q3FA 4MELA 3ZJTA 1C76A 1TGZB 3ZQ4A 2FE8A 1UF0A 5IAAC 1N63A 3BVMA 4OVUA 1DYQA 3Q3OC 2WHIA 2WX1A 2ZJDA 1FCLA 1MVKA 3MJWA 2KDFB 1KTKA 2MQJA 4JL9A 2C7MB 2JUOA 3HRDD 1WZ3A 1KJTA 2JY6A 2NBVB 2VH2A 3U7DA 2NS5A 4RF0A 1PGBA 1JMLA 1TY0A 1C4CA 2QSDA 1SEBD 4CQNA 1VJKA 1JWAD 1LXDA 2HTME 4ICVA 2C9WB 3APCA 3IXSA 1D3ZA 3AMZA 1YJJA 3A1QA 1KF6B 3PRPB 3QHTA 3VRAB 1FFUA 1PUTA 3JYUA 3ZVVA 1GB1A 4ZHOA 1WSPA 3M63B 1CMXB 1XXGA 3ZTDA 2MRPA 1JWUD 3W1YA 4BKGA 5D94A 2KQSA 1C4PA 2Z59B 1GUAB 3VUWA 1N61A 1PQSA 1CJEA 4BKSD 2CJNA 3MTNB 3PRMB 2E3TA 1YMHE 2DLBA 3RZFA 1ZPSA 4WJPA 3TJPA 1FXTB 1D5ZC 4MM3A 1BMLC 5JZEB 4OZBA 1N5WA 3ZNID 2WDVB 1T0SC 4LJOB 1UD7A 4TSSA 3HUIA 5DPWA 2BYVE 2NBUA 3TMPB 5IO9A 1L5PA 1MFWA 4IM2A 1JW9D 3Q3NC 3AH7A 3BK2A 3TEWA 1J7BA 4ZOHC 2RR9A 3KUZA 2MP2B 3HK0A 3SEBA 4RF1A 3DWMA 5LLIA 3S2AA 3IT4B 4GXBA 4DHJB 1E8YA 3A4SC 3Q8EA 1P7FA 4II3B 1YQBA 2N9PC 2BS3B 4DWFA 4MGYE 1E8WA 2Y5BB 4NQKE 1E7PB 1SE2A 5L95C 1KLUD 2IBIB 1YN5A 2DYMA 3NVYA 1IYFA 1XEEA 3O65B 4YTNB 1ZP0B 1WXMA 3X0WA 2KWCA 3NHEB 4N58A 5G5HA 3R8BA 2MW5A 2WGSA 2ONQA 2ACZB 5D3DA 2JRHA 2WXMA 5EE1A 2MHJA 2LVOA 1E8XA 4WQOB 4KZCA 3PVLA 3RN9C 2N7EA 4CO7A 1J7CA 1OQQA 4WWMA 4BKSA 2V4LA 4XX5A 1WIAA 1YIWA 2GOWA 4GLSC 2XN9C 1F2RC 2KT7A 2MLBA 2KDMA 1ZDVA 2CHZA 3JVZX 4EZLA 2UYZB 1NVID 2ZNVC 1SE9A 1WY8A 5CHWA 5EE9A 3B1LX 2BB6A 2WXJA 1FRRA 3VR8B 3T3OA 2ZCCA 1HA5A 3N30A 3PHXB 1EF5A 4YL8A 5CX3A 2O6VB 2QHOA 2LUMA 4KIKB 3AE3B 3PT2B 2WLBA 5E6PA 2INDC 2BYFA 3QWZB 1P1AA 3N9YC 2QJLA 4HLEA 1I7HA 4HROA 2V0GA 4ASWC 3NVVA 2Z8LA 3VUXA 4GB9A 2ZVOA 1B9RA 2GBJA 2K9XA 1QQRA 2C5LC 4BKTA 1SIFA 1WE7A 2AYOB 2CHXA 3BINA 2OJRA 2UU7A 4RGNA 3PSEB 1WGRA 1V81A 5BYSA 1WXSA 2GBKA 3BVZA 4D2KA 1IBXB 1MG8A 1T5XD 1I4XA 4YT0B 4GDKA 3A9KB 2KTRB 2PJHA 4A3PA 1V80A 4DHZE 3JSVA 2FBWB 4ACFA 1F77A 4C00A 2D3AA 4GGQA 2PVOD 2TSSA 4M01A 2KO3A 3ZRCA 5T8IA 1RAXA 3PRZA 3ZGZA 4IOIE 1ZDXA 4FA6A 4NZLB 2V4IB 3KH0A 3VHTC 3MHZA 1RRBA 3BZDB 4K81A 3TL5A 1TZOA 4GN1A 2HE7A 2LHEA 2KJRA 5G5GA 2FUHB 1IGCA 4KSLC 4IM0A 2KC2A 3ML8A 3NJTA 3WANA 3ZLZA 4RGMA 3TUOA 3R2IA 5KHQA 1F9JA 3ZXRA 4WAFA 4ARCA 4GOCA 2FIFA 1WJ6A 3DVNU 2WXIA 2KC1A 3MHSD 1WJUA 1V9JA 3TEZA 1TIFA 4B9KA 4YSXB 2JU6X 4XWTA 1V5TA 4L1BA 2Y5CA 1RFAA 4RM8A 4HCNB 2L0TA 3ZIMA 5CTRC 4F8CB 5C3JB 3Q8AA 3PPAA 1E7VA 1SBBB 3WAPA 2DAFA 3Q3MC 3AEGB 2GBNA 3PZ8A 2AQ3B 4RH6A 2G1EA 1L4DB 1U4AA 2A4ZA 3HIZA 2C60A 4A8XC 2MCNB 2M17A 4B0MA 2IZVB 4KX6B 2M1MA 2X8XX 2J53A 1BXTA 3SFDB 2Y3AA 4HDQA 4II2B 2GI9A 5I4DA 1I4PA 5AUIA 3AE4B 2V1YA 2WQYB 4KVGB 2Q5WD 2D2QA 3C0RB 4XC2A 2PW9A 5KHOA 3IBEA 2KHWB 2WXNA 5BMHA 3B0AA 4NY0A 1WR1A 1VLBA 1VR9A 5D2MB 4E3CA 3UGBB 4WH4A 2LGSA 4HVBA 2LWPA 2ZPYA 4I6PA 4RCOA 2BW2A 1FEHA 3BY4B 1BT0A 1TS2A 3MC8A 3N1YC 4G50A 2KK8A 1E90A 1K50A 3AEBB 3VR9B 4PK1A 2V3PA 3I57A 4EZJA 2RDBC 4NPNA 3PS6A 4PT5A 2XEWA 2G4DB 2WDTB 3AEEB 5HI1A 3L08A 3Q3JA 3RCZA 3IVFA 2L1AA 5C2TB 2QC8A 1RWSA 3KW5B 1UH6A 3HM3A 4TQ1A 2AL6A 1ZOYB 1WXAA 2CR5A 5HFYA 1YQ4B 3SR6A 1EU3A 3VTUA 2L32A 3L0WB 3VUYA 1WGYA 4MH8A 4GMVA 3LJ3A 3CMMB 2PMVA 1ZUD2 2RD0A 2YLMA 5BYRA 3FILB 3QIJA 2LEKA 5DPTA 4E74A 5H92C 3RZWC 3Q8BA 2UWQA 4MGKE 4NAMA 1V1PA 3SFEB 3VH4B 1RYJA 1EO6A 4RNAA 4YSYB 3W9CB 3DHGC 3NZSA 3TEYA 2YVCA 4IWPA 3N32A 2LMCA 2CS4A 1M4VA 3RPFC 4W9IA 1FCCC 4LDTD 1BUIC 2H88B 1WJNA 2CJOA 2MJDA 5HHDG 4BOZB 1E10A 4FBJB 3A4RA 4N9F4 5E6OA 1S1QB 2YEPB 2JSVX 4H2AA 2PE6B 1FM0D 2K6DB 2W9NA 1TYGB 3DWGC 3APDA 1YX5B 2N1WA 4IC7B 1QILA 2FCSA 2DYBA 1SIJA 2NPTB 4AOFA 2G9HD 5HG2A 2VZKB 4US8A 2BWES 1JWSD 3AE1B 1YN4A 1L4ZB 1WWTA 2XNAC 1WXQA 1V5OA 3V6EB 1TBEA 4AJYB 4G0NB 4YXDB 2NBWB 1L0VB 3MC0B 3D32A 3UINB 1T0YA 2OJWA 3CSTA 1LO5D 3RNFC 3ZKJC 1IPGA 4FLHA 4NAWB 4F7ZA 2KFKB 2D07B 2LVQA 2CU1A 4GDLA 1QF6A 4KKJA 2N9XA 3KVFB 1QZEA 4PS8A 4WJQA 1Q0WB 4NJ7A 4K3CA 1E5WA 2K0PA 2BTEA 1GJZA 2KMAA 3IG3A 1XT9B 3KQ4A 5D6JB 3T8MA 3KWLA 1WH3A 1P98A 4C4VB 1GC7A 1DOIA 2EMTA 4HDOA 2LGDA 2WXLA 3L10B 3K9OB 3DVNV 2JXTA 2KYWA 2LRUA 2DHZA 1JCKB 1I35A 2AQ2B 3TCAA 2IY0B 1VZ7A 3WIMA 5LNK1 4B95A 4I6NB 2ZCBA 5D3IB 3QARA 1QOFA 4IM3A 3IHPC 3SD5A 2JYEA 3UI3A 4W9JA 4OHJA 4DXFA 3A1QB 4ITKA 1K53A 2N1VA 4JPSA 1QT9A 1F1HA 1HTQA 1JRPA 2MBHA 2XK5A 2INPE 1XLPA 2I1JA 5IN7A 1EF1A 3H8HA 3L54A 3ZUNA 2I2YA 2ON8A 3I5JC 1NBFC 3AE2B 1EUVB 4WWNA 3QA8A 2KX3A 3RYTA 2KJHB 2LD9A 1RLFA 2FUG1 2L7RA 2RDHA 4FHKA 2JRIB 4AUQC 4IWQA 1WYWB 2KXJA 2WS3B 4B0EA 2LXCA 4NNJB 4WWPA 2MA9B 3VXWA 3AECB 3MP9A 4PYZA 2BGFA 2LGXA 4MM3B 2M0AA 2LFIA 3ZXVA 3PGEA 3ENEA 3KLSX 3PZDA 1WRDB 1TTNA 4EEWA 2JYTA 1IP9A 2J0JA 1LGRA 3AEDB 1WMHA 2D10A 3P42A 1I4RA 2JPHA 4IG7B 3IAS1 1KOTA 2FIDA 3QX1A 2X38A 2AWTA 4KZ0A 2DX5B 3H6NA 2M56B 3RNCC 1WGDA 2W3SA 2KWUB 4G11A 3APFA 2PPHA 4IW0A 2FNJB 1J7AA 1J8CA 5TR5A 1XLOA 2JZZA 1R4MI 1PDXA 2LASA 2PKOA 3OG5A 1QOGA 3WAOA 2KN5A 1XD3B 3ETRA 3HVZA 2GBMA 4RGOS 3SHQA 4PS3A 4RGTA 2Z0EB 4ANUA 5G2NA 2K1FA 2MBBB 2V9HA 2WU5B 2GB1A 2NTSA 3BYTB 4W9EA 1TKYA 2ZNVB 1OEYA 4W9LA 2RPQA 1SF0A 3P4RB 1WX8A 3EGRA 5MPOA 2MH7A 1OGWA 3PREA 1AYFA 5BMGA 2O2VA 2PIAA 1HE8A 3B2FA 4BOSC 3QCAA 4XE0A 3P4QB 1GNUA 1OQRA 1D4BA 2NMQA 4YTMB 3DBLI 1XCQL 3DVGY 4MSQB 2MJ3A 1QKZA 2KANA 1K52A 2LVPA 2LJIA 3DVGX 4KDIC 4HPLB 2BS4B 1WX9A 4S17A 4P7IA 2LJ5A 4ZRJA 5FK9C 3EUB2 3DBSA 1TS4A 1HZ5A 4JIOU 5DPRA 3HM6X 1HTOA 4IKGA 3BVGA 3WCQA 4LK0M 4EE2A 1WFYA 2FCQA 1L0YB 3N1ZC 3PO0A 4M00A 1RM6C 2JXXA 4AWJA 2WX0A 2KAJA 3CF6E 4P6VF 5E6NA 3NRZA 2KDEB 2LRWA 1P3QU 1JRUA 1UZXB 2KNBA 4QAYA 2LGYA 1N62A 4DDID 3LXFA 1VRAB 4A6QA 1DOXA 2D11A 2BPSA 3C8YA 4ZRKA 1YNTE 1RFKA 1GAQB 5JHBA 2C7HA 4XDCA 1C4AA 3I3TB 3VTVA 1EM7A 2HJ8A 4M0WA 1XLNA 4JGHB 2WDRB 1N60A 4GDKB 2KFJA 4DBGA 2PE9A 3EHVA 4HJKA 4K7UA 1C77A 3JSVB 1C1YB 3FAHA 1T0RC 1Q5WB 1D5XC 2KLCA 1VD2A 4LNFA 1WM2A 3P2BA 3O13A 4ZDVA 3R66C 3VAWA 3JW0X 3OWEB 2IGHA 2RGFA 1C78A 4WAAA 2MSED 1ZGUB 3NVZA 1MJDA 2DZIA 2IJ0A 3IT6B 3L16A 1FNVA 4CHKA 1I4GA 4C7YA 1P0RA 4NQLB 2IO3B 4DXAB 2WXPA 2IO1B 1WYGA 3GS2A 1WI0A 1N5XA 2AQ1B 3ZYYX 4EOYA 1V97A 2N9KA 4URKA 4ANVA 2LXAA 1V1OA 4JQWC 4REZA 2WU2B 3W5UB 3RNBC 1AARA 5IKCM 1KLVA 3Q6BA 1ZE3D 1A5RA 3PZ7A 3N3KB 2R2OA 3DCGA 3AE7B 5D7GA 2KJ6A 1V49A 4ZRPA 4BVUC 1S3SG 3KYDD 5H8YE 2H89B 5FR3A 2OOBB 3TIXA 5G55A 2MEKA 4K3BA 2M4NA 5C23A 2JWUA 3ZJVA 3TSSA 3KUCB 3DBHB 1AN8A 4PYUA 1ET9A 4USAA 4TMAB 1FO4A 3ABVB 2SAKA 3H7PA 4FJVB 3V05A 3BYYB 1IGDA 3BIID 2DBYA 2QILA 3AU4A 2BT6A 3A9JA 1ROEA 3X23A 4PS7A 1P7EA 2V3NA 1ZXIA 1WF9A 3GP7A 3H9DA 4ANWA 3AULA 2K8HA 1AWDA 3OLMD 3GE3C 3RUIB 4ICUA 2INNE 1R4MB 4WJOA 3M3JA 1YN3A 1WR6E 2WXOA 2NVUI 4MGIE 5BMIA 4IWOA 2IY1B 1OTRB 3VH3B 2WYQA 4KDLB 1PYWD 3RD2A 3GOEA 1PGAA 4RMAA 3IAM1 3PTFC 3GE8C 4ZYNA 3RMKC 4N6EB 1EWYC 1XLQA 2LUEA 2M8SA 2N0SB 4S0RA 4M8MA 2L3ZA 3A33B 2K5PA 1F2RI 1OFFA 3ZRFA 3J9CA 3MJ5A 3ZNHB 4OW0A 5GXGB 3U8ZA 2RDGA 4MT5A 4HPPA 1F52A 3AU5A 3DBLB 4MJSA 1IUEA 3B08A 3RNAC 1SE4A 3W5VB 4HWIB 2JVCA 3VTWA 1P9DU 4FJZA 3L17A 4BBNF 3PLUA 1DGJA 1STEA 3R2TA 2I1KA 3R3MA 1NEKB 3NG0A 2J52A 4C56C 3WA0A 3I63C 4HKQA 3EC8A 2NR2A 4TUUA 5LXIB 4KV2A 3HVDA 3W1SA 1R4NI 1HZ6A 1V6EA 4GIVA 2N7JA 3N1XC 4N59A 2L8JA 3ZTCA 2KZRA 4ZRQA 3L13A 2KQ7A 4DHJD 3AN1A 1TT5B 1X1MA 3AB5A 1GG3A 1TS5A
chains in the Genus database with same CATH topology
1T5XD 1I4XA 4YT0B 2LHDA 2FUG1 2RDHA 1GB4A 1FXIA 2KQ4X 1AW7A 2WNMA 4LLGM 1SSNA 1EWCA 4A9AA 2WS3B 4B0EA 2FBWB 1EU4A 2K3UA 1F77A 2WXQA 3AECB 2EKIA 1MHHE 3MP9A 2Y5PA 1V1PB 1HXYD 2VZKD 4MM3B 3NS1A 2M0AA 2LFIA 2CU3A 2PVOD 4O1NA 2TSSA 2OHFA 3AEAB 3KLSX 5T8IA 3E9SA 3ZGZA 3U4EG 3B2GA 4IOIE 1WGKA 1XF5L 1ZDXA 2IGGA 3L4PA 4NZLB 2V4IB 1HQRD 2JYTA 3MHZA 1UNSA 3AE8B 2BB5A 3BZDB 2W54A 3AEDB 1V8CA 3P42A 1I4RA 1TZOA 4KGSA 1DOYA 3IAS1 4KGRA 2LHEA 5G5GA 1D5MC 3U7ZA 1PGXA 1IGCA 3ZJUA 1JALA 2WXKA 2X38A 3NZ3A 3FILA 2M56B 2LGIA 4JWUC 3URYA 4RGMA 3TUOA 3P4PB 2W3SA 3R2IA 5E6JA 3MFGA 2DYOA 4Q2JA 4WAFA 1Y56A 4ARCA 2PTLA 1J7AA 2WXIA 1XLOA 4UDUC 2EELA 4NJCA 4L23A 4ZHPA 4YTPB 3TEZA 4YSXB 2JU6X 4XWTA 1PDXA 3Q8CA 1FRDA 2PKOA 2W3RA 2D5GA 2Y5CA 4L1BA 1QOGA 3FC4A 2PLPA 3ETRA 3HVZA 3AM9A 2WDQB 3VRBB 1MPEA 4RGOS 3W2DA 4DXGA 1B1ZA 4RGTA 2IPKD 3Q8FA 2DWQA 3P63A 2BS2B 5C3JB 3Q8AA 2IDYA 2KN4A 2N9LA 1KH0A 1SBBB 2HDEA 3Q69A 1ACCA 2WU5B 3BWUD 2GB1A 2KACA 2NTSA 3BYTB 1TKYA 3AEGB 3PZ8A 2AQ3B 4RH6A 2G1EA 4DQOC 2I38A 2KMMA 4HJGE 4A90A 1CZPA 1L4DB 1SF0A 1FXAA 4HKZE 4JX1C 3P4RB 2YEPF 3EGRA 1JROA 3AE6B 5MPOA 2MH7A 1L6VA 4A8XC 1AYFA 5BMGA 4L2YA 2PIAA 4B0MA 3B2FA 4GDLB 4OVZA 2L52A 1JWBD 1KRHA 4KX6B 1TS3A 4YWGG 4FXCA 4XE0A 2J53A 1NYQA 1BXTA 3P4QB 3KWVA 3SFDB 4YSZB 1ENFA 1OQRA 2Y3AA 1D4BA 2NMQA 4YTMB 1XCQL 2GI9A 2L83A 5I4DA 1I4PA 2R61A 2PVGC 5AUIA 4AQ7A 3NUHB 2MJ3A 4XWWA 3AE4B 1QKZA 2WQYB 3P4SB 2M19A 1FNUA 1K52A 2LJIA 1SJHD 5AUKA 2BS4B 3V3XA 2Q5WD 3NVWA 3GB1A 5EE0A 5FK9C 4TQ0A 3EUB2 1R7SA 1TS4A 2PW9A 1HZ5A 4US9A 4J3OD 2RMMA 4XDDA 2JZPA 2WXNA 5BMHA 3AE9B 1K51A 1UWXA 2WXGA 1L6UA 4IKGA 3BVGA 3WCQA 1VLBA 4LK0M 1VR9A 4EE2A 1KLGD 1L0YB 3AEFB 3U2SC 3PO0A 4WH4A 2IGDA 3T3NA 2J42A 2E6XA 2MJEA 4OZAA 4RCOA 1RM6C 4C7ZA 2BW2A 3U52E 1FEHA 3I9V1 4WURA 1CK1A 4WQMA 1NENB 1SXTA 1TS2A 4MACA 3B9JA 2KAJA 1D6EC 4OZCA 4P6VF 3NRZA 1FMAD 1ESFA 1XO3A 2OEDA 4RFBA 1SE3A 1TY2A 3CWIA 3ZJTA 1C76A 1N62A 2W55A 3ZQ4A 1K50A 2FE8A 3AEBB 3LXFA 3VR9B 1N63A 2QMTA 1VRAB 3BVMA 1DYQA 4A6QA 1DOXA 1FCLA 1MVKA 1C79A 4A55A 2V3PA 1KTKA 3I57A 3C8YA 3P1MA 4C80A 1YNTE 3HRDD 1RFKA 1GAQB 4XDCA 1C4AA 1VZ8A 1I4QA 1EM7A 1WRIA 4M0WA 1XLNA 4RF0A 1PGBA 1UUPA 1JMLA 4PT5A 1TY0A 1C4CA 2QSDA 3AEEB 1SEBD 2WDRB 4P16A 1N60A 5HI1A 4GDKB 4CQNA 1VJKA 4HEA1 1JWAD 2HTME 2L1AA 5C2TB 1RWSA 4JE3B 1C77A 3FAHA 1SB3C 3IXSA 3AMZA 1D5XC 1YJJA 4TQ1A 1GPXA 3O13A 4WIPA 1KF6B 1ZOYB 1SJED 3VRAB 1FFUA 1PUTA 2KWDA 3OWEB 5HFYA 2IGHA 1GB1A 4ZHOA 1WSPA 1YQ4B 1C78A 3SR6A 1YQ3B 1XXGA 3NVZA 1MI0A 1T3QA 4ARIA 4IDIA 2IJ0A 3IT6B 1FNVA 1MHXA 1IBXA 1EU3A 1I4GA 1JWUD 3TEXA 2L32A 2WXFA 4MH8A 1C4PA 4C7YA 2PMVA 1ZUD2 2WXPA 2WP9B 1YJIA 1WYGA 1TKEA 3FILB 1N61A 5BYRA 1CJEA 2LEKA 3GS2A 1Q10A 1QOAA 5H92C 2AQ1B 1N5XA 2CJNA 2WXHA 2AX5A 3Q8BA 3ZYYX 2E3TA 1V97A 1YMHE 2DLBA 2N9KA 1ZPSA 4NAMA 1V1PA 4AS1A 3SFEB 1FFVA 1D5ZC 1BMLC 1RYJA 2ZW1A 1N5WA 4OZBA 4RNAA 1V1OA 4YSYB 2WDVB 3W9CB 1QLBB 4REZA 5EE3A 3TEYA 2WU2B 3HUIA 4TSSA 3W5UB 2LMCA 1KFYB 1C9FA 1L5PA 1M4VA 1ZE3D 2JX5A 3RPFC 1JW9D 3PZ7A 3AE5B 1FCCC 3AH7A 3BK2A 3TEWA 1J7BA 1L0XB 4ZOHC 3AE7B 5D7GA 1BUIC 2H88B 4ZRPA 2CJOA 2MJDA 5HHDG 4RF1A 3SEBA 3DWMA 1E10A 3IT4B 3AV8A 1TKGA 5H8YE 2H89B 3Q8EA 1P7FA 5FR3A 1GOZA 3RFZB 2SEBD 2ZW0A 2BS3B 2MEKA 2GRIA 2YEPB 2JSVX 4H2AA 2JWUA 3ZJVA 3TSSA 1FM0D 1AN8A 1TYGB 1ET9A 1E7PB 3DWGC 1SE2A 4USAA 1A70A 4TMAB 1FO4A 3ABVB 5JXVA 1KLUD 1YN5A 2DYMA 2SAKA 3NVYA 1XEEA 4YTNB 1QILA 1ZP0B 5FKAC 3V05A 3BYYB 1SIJA 1IGDA 1I4HA 2G9HD 5HG2A 2VZKB 3BIID 1E6EB 2DBYA 4N58A 1JWMD 3VQIA 4US8A 5G5HA 1JWSD 3AE1B 2QILA 4R3DA 3R8BA 1YN4A 1L4ZB 1WWTA 2BT6A 2XNAC 2ONQA 1ROEA 1WXQA 2ACZB 5D3DA 1QOBA 1P7EA 2WXMA 2V3NA 1XCTL 1ZXIA 5EE1A 4YXDB 1F0ZA 3GP7A 1L0VB 3MC0B 1AWDA 1FNWA 1LO5D 1NYRA 2ICIA 4NAWB 2INNE 1YN3A 2WXOA 1QF6A 4KKJA 1J7CA 1OQQA 2QIEB 4WWMA 5BMIA 1VZ6A 1HEZE 3LYYA 5BYQA 2K0PA 4GLSC 2BTEA 2XN9C 1PYWD 3LB8C 1F2RC 3BK1A 3KQ4A 2BYTA 2KDMA 1ZDVA 1PGAA 3KWLA 4ZYSA 1ZXHA 3IAM1 1FD6A 4N6EB 1NVID 3E56A 1EWYC 1XLQA 2N0SB 1T6BX 1DOIA 5EE9A 2BB6A 4JWSC 2NTTA 2WXJA 2K5PA 2WXLA 1TJEA 1F2RI 1OFFA 1FRRA 3J9CA 3MJ5A 3VR8B 3T3OA 2JXTA 2B76B 4OW0A 1CQVA 5GXGB 3EA6A 1HA5A 2RDGA 2BBCA 1JCKB 4KKIA 4MT5A 2AQ2B 1IUEA 1VZ7A 1UGJA 1SE4A 3W5VB 5LNK1 5TSSA 2RPVA 4KGTA 2LUMA 3AE3B 1ET6A 1E9MA 2WLBA 5D3IB 2JQRB 1QOFA 4HRSA 1DGJA 1STEA 3R2TA 1JQ4A 1NEKB 2JYEA 3N9YC 2J52A 2QJLA 3UI3A 4C56C 1I7HA 4HROA 4HKQA 2K22A 2V0GA 4OHJA 4DXFA 1NI3A 2WXRA 4LTUA 3NVVA 2Z8LA 4ITKA 1K53A 3HVDA 1B9RA 3W1SA 2K9XA 4JPSA 1QQRA 1HZ6A 3CIRB 1QT9A 1VDVA 2QEJC 1JRPA 1PFDA 1E0ZA 2N7JA 2INPE 1XLPA 4N59A 3H8HA 2I2YA 2ON8A 2W82A 4RGNA 4ZRQA 1UWMA 3AE2B 3AN1A 3AB5A 5BYSA 3BVZA 4D2KA 1IBXB 1FIQA 2J4XA 1TS5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LHD A;  1D4B A;  2NMQ A;  1GB4 A;  2KQ4 X;  2KWD A;  1XCQ L;  5HFY A;  2GI9 A;  2IGH A;  1GB1 A;  1QKZ A;  1K52 A;  1MI0 A;  3V3X A;  1MHX A;  1IBX A;  5BMI A;  3GB1 A;  1MHH E;  3MP9 A;  1HEZ E;  2PW9 A;  1HZ5 A;  2RMM A;  2K0P A;  4GLS C;  2JZP A;  5BMH A;  1F2R C;  3FIL B;  1K51 A;  2KDM A;  1UWX A;  4IOI E;  1PGA A;  1XF5 L;  1Q10 A;  4IKG A;  1ZXH A;  2IGG A;  1FD6 A;  1YMH E;  2N9K A;  4WH4 A;  2IGD A;  4KGS A;  4KGR A;  2LHE A;  4OZA A;  1PGX A;  1IGC A;  2ZW1 A;  4OZB A;  1F2R I;  3FIL A;  2LGI A;  2JXT A;  4MAC A;  1C9F A;  2PTL A;  4OZC A;  2OED A;  2EEL A;  1FCC C;  2JU6 X;  2RPV A;  4KGT A;  1K50 A;  5HHD G;  2LUM A;  2PLP A;  2QMT A;  1MPE A;  1FCL A;  1P7F A;  1MVK A;  2J52 A;  3UI3 A;  2ZW0 A;  2N9L A;  2KN4 A;  1KH0 A;  2JSV X;  2JWU A;  1YNT E;  2GB1 A;  2KAC A;  1EM7 A;  2I38 A;  4HJG E;  1K53 A;  5JXV A;  1PGB A;  1JML A;  1HZ6 A;  4HKZ E;  2QSD A;  5HI1 A;  1IGD A;  2N7J A;  5HG2 A;  5BMG A;  2I2Y A;  2ON8 A;  4D2K A;  2ONQ A;  1IBX B;  1P7E A;  2J53 A;  1XCT L; 
#chains in the Genus database with same CATH topology
 2LHD A;  1GB4 A;  2KQ4 X;  3HHM A;  1T0Q C;  5IA7 A;  2GMI C;  2ZEQ A;  3VDZ A;  2K3U A;  2WXQ A;  1MHH E;  3FKY A;  3CSF A;  1V1P B;  4LNI A;  3W1S C;  1WJ4 A;  3ZNZ B;  2OHF A;  3AEA B;  4DK5 A;  3DHH C;  3U4E G;  4K1R B;  1WGK A;  1XF5 L;  2KVZ A;  2G3Q B;  3AI5 A;  1V8C A;  3SU8 X;  4KGS A;  4WWO A;  2GLS A;  1D5M C;  3ZJU A;  3NZ3 A;  3QC8 B;  2K6Q A;  2D3C A;  1TZ1 A;  4JWU C;  3P4P B;  2Z0D B;  5E6J A;  5C1Z A;  1V86 A;  3MFG A;  4Q2J A;  1Y56 A;  4AJW A;  2J7Q B;  5AEK B;  4FJY A;  1G6J A;  2KLG A;  2EEL A;  4L23 A;  3Q8C A;  1FRD A;  4ZRI A;  2BVC A;  2W3R A;  2D5G A;  3FC4 A;  3AM9 A;  2WDQ B;  4BAX A;  3LDZ E;  1YOV B;  4DXG A;  3DQV A;  2IPK D;  3Q8F A;  1Y8R C;  2DWQ A;  3R7Q A;  3VVW B;  3H7S A;  2BS2 B;  3NOB A;  2IDY A;  1KH0 A;  2HDE A;  2L00 B;  3BWU D;  2KAC A;  2MP2 A;  1MG4 A;  4DQO C;  2I38 A;  2KMM A;  2KX0 A;  4HJG E;  4A90 A;  1CZP A;  4EZK A;  2G4S A;  1E7U A;  1FXA A;  2YEP F;  1E8Z A;  1XQQ A;  4DDG D;  2O6V D;  1JRO A;  3AE6 B;  3C19 A;  3DDC B;  1L6V A;  2MBE A;  2C7N B;  5GMV A;  4GDL B;  4OVZ A;  1TS3 A;  4YWG G;  1WE6 A;  3VFK A;  1NYQ A;  3KWV A;  2BKR B;  1ENF A;  3NY5 A;  3Q2A C;  1UBQ A;  3Q14 C;  1L7Y A;  2R61 A;  1FPY A;  2PVG C;  3MC9 A;  4AQ7 A;  3NUH B;  4XWW A;  3EFU A;  3P4S B;  2M19 A;  1H8C A;  1Z5S B;  1FNU A;  5AUK A;  1SJH D;  2IO0 B;  2KMC A;  2IO2 B;  3NVW A;  5EE0 A;  1C3T A;  1WX7 A;  4EKU A;  5J2R A;  1R7S A;  2CHW A;  3U30 A;  4A3O A;  1K51 A;  4W9F A;  4LDT B;  2BKF A;  4AP4 C;  2L76 A;  3U2S C;  3M62 B;  3ML9 A;  2IGD A;  3H1U A;  3WAM A;  1ZW7 A;  2J42 A;  2MJE A;  2DZM A;  4OZA A;  2DNF A;  2N7D A;  4WUR A;  3QAQ A;  1NEN B;  1L2N A;  3DBH I;  4OZC A;  4MH0 E;  2BF8 B;  4RFB A;  1ESF A;  2OED A;  2ASQ A;  2KVR A;  4A20 A;  3CWI A;  5JHA A;  2FAZ A;  2W55 A;  2VH1 A;  2BYE A;  2QMT A;  1C79 A;  2EMS A;  4A55 A;  2XK5 B;  3GZN I;  3P1M A;  4C80 A;  2O6V A;  3M95 A;  1VZ8 A;  1I4Q A;  1WRI A;  3KYC D;  3RNE C;  2KOX A;  4KIK A;  1UUP A;  2K39 A;  4P16 A;  4FN2 A;  4HEA 1;  1UGM A;  4JE3 B;  4LNO A;  1SB3 C;  4M02 A;  1GPX A;  4WIP A;  2DZJ A;  1SJE D;  3KUD B;  2KWD A;  2N4F A;  2EKE C;  4GU2 A;  4TV3 A;  1WZ0 A;  1YQ3 B;  5LXH A;  3WAL A;  1MI0 A;  1T3Q A;  4ARI A;  4IDI A;  1MHX A;  1IBX A;  1M94 A;  4HK2 A;  4X57 B;  3TEX A;  5J17 A;  2WXF A;  1WMH B;  5EDS A;  2ZZP B;  4BZA A;  3A9K A;  2KTR A;  4JLC A;  2MX2 A;  2WP9 B;  1YJI A;  1I42 A;  1TKE A;  3ALB A;  3N20 C;  2MBO A;  1Q10 A;  1QOA A;  4WJN A;  2WXH A;  3DOW A;  2AX5 A;  2KDB A;  1R4N B;  4P1C C;  1OEY J;  4AS1 A;  4I6L B;  1FFV A;  5AZG A;  2G45 B;  2ZW1 A;  3AXC A;  1QLB B;  5EE3 A;  3DBR B;  2L0F A;  3V62 A;  1KFY B;  1C9F A;  2JX5 A;  2WWZ A;  3AE5 B;  2DAJ A;  3OAW A;  1NI2 A;  4G3X B;  1L0X B;  1VCB A;  1LM8 B;  1YJ1 A;  3IFW B;  3AV8 A;  1TKG A;  4MSM B;  2FCN A;  1GOZ A;  3RFZ B;  1WM3 A;  2SEB D;  2ZW0 A;  2GRI A;  2O2V B;  4EUT A;  1UEL A;  2D3B A;  4MDK E;  2N9E B;  1A70 A;  5J18 A;  5JXV A;  3UQA A;  2IYD B;  3EEC A;  5FKA C;  2QCZ A;  3V6C B;  1I4H A;  1J0G A;  4ANX A;  1E6E B;  1JWM D;  3VQI A;  4R3D A;  5FR6 A;  1QOB A;  2GBR A;  4FAD A;  1XCT L;  4F1S A;  4XGA B;  1F0Z A;  2RSU A;  3ZDM C;  1FNW A;  1NYR A;  4LNK A;  4CYE A;  2ICI A;  4W9G A;  2V3S A;  4XYC A;  5CHF A;  2QIE B;  1VZ6 A;  1HEZ E;  3LYY A;  5BYQ A;  2R2Q A;  4MEM A;  2CKH B;  4HXD A;  3LB8 C;  4J6I A;  3BK1 A;  2BYT A;  2PEA A;  4W9H A;  3RUL A;  1ZXH A;  4ZYS A;  3NZU A;  1FD6 A;  2LZ6 A;  4OVV A;  3E56 A;  3PV1 A;  3ONS A;  1T6B X;  2J0K A;  2K25 A;  4JWS C;  2NTT A;  1TJE A;  2B76 B;  3TBL D;  1CQV A;  3EA6 A;  3PLV A;  4E71 A;  2BBC A;  3NS8 A;  5DCN A;  2L05 A;  4KKI A;  4K7S A;  1OQY A;  1UGJ A;  3UIO B;  5TSS A;  2RPV A;  4KGT A;  4M0W B;  1ET6 A;  1E9M A;  3V61 A;  2VRR B;  1NDD A;  2JQR B;  4HRS A;  1JQ4 A;  2D3G A;  3OJ3 A;  5DPS A;  3V60 A;  3DHI C;  4LNN A;  2K22 A;  2JT4 B;  5AZH A;  4W9C A;  1NI3 A;  2WXR A;  2J0M A;  4LTU A;  2K8C A;  3QQ8 B;  2AEH A;  1J19 A;  3CIR B;  1VDV A;  2KKC A;  2QEJ C;  4BFR A;  1PFD A;  1E0Z A;  2KWV B;  4FHJ A;  2W82 A;  1UWM A;  4B6W A;  2HJ1 A;  1ISN A;  3QJZ A;  1FIQ A;  4HPM B;  2J4X A;  4LLG M;  1Z2M A;  1FXI A;  1Q1O A;  2JF5 A;  1AW7 A;  3DPD A;  2WNM A;  4EFO A;  1SSN A;  1ZKH A;  1EWC A;  3PHW B;  4A9A A;  4BBN C;  5IP4 D;  2INC C;  3QK0 A;  1EU4 A;  2JWZ A;  5CHV C;  4M8N A;  2EKI A;  1WGH A;  2NCN A;  2BQQ A;  2Y5P A;  1HXY D;  2VZK D;  3ZW3 A;  3GZN B;  3NS1 A;  5HKH A;  2KTF A;  3RT3 B;  2CU3 A;  3UF8 A;  4O1N A;  3ECI A;  3E9S A;  3B2G A;  2LI5 A;  2IGG A;  3L4P A;  1HQR D;  1LQB A;  1UNS A;  3AE8 B;  2BB5 A;  2W54 A;  2JZ3 B;  1DOY A;  4KGR A;  1YX6 B;  3U7Z A;  1PGX A;  1JAL A;  2WXK A;  4LCD E;  3ZDT A;  3FIL A;  2M0X A;  3ZNG C;  2LGI A;  2REX A;  3URY A;  2DYO A;  2PTL A;  4DHZ B;  5L83 A;  2KD0 A;  5IOI A;  4UDU C;  4NJC A;  4ZHP A;  4YTP B;  2MBQ A;  2PLP A;  3VRB B;  3W2D A;  1MPE A;  1B1Z A;  3H7P B;  2FCM A;  2XBB C;  1V2Y A;  3P63 A;  2N9L A;  2KN4 A;  3Q69 A;  1ACC A;  3T9L A;  2QDF A;  3A9J B;  1UBI A;  1KM7 A;  2AL3 A;  4HCP B;  4HKZ E;  4JX1 C;  3SDL C;  4W9D A;  2B3A A;  4L2Y A;  2BWF A;  3RI7 C;  1WXV A;  2ZPN A;  3R7R A;  2L52 A;  1JWB D;  1KRH A;  3EFC A;  4NJ6 A;  2DEN B;  4FXC A;  4P1B C;  1SGH A;  1H4R A;  4YSZ B;  5BO4 B;  2L83 A;  2NPT A;  1WGG A;  4K7W A;  4KSK C;  2MWS B;  3UQB A;  3V3X A;  2DZK A;  3GB1 A;  4FUL A;  4TQ0 A;  4TKN A;  2A5U A;  3DBR I;  1N6Z A;  4US9 A;  4J3O D;  3UIP B;  2RMM A;  4XDD A;  2JZP A;  4NAW A;  3AE9 B;  2HD5 B;  2KFK A;  1UWX A;  2WXG A;  1YD8 U;  1L6U A;  1K8R B;  2KDI A;  1GC6 A;  2ZVN A;  1KLG D;  3AEF B;  4LJP B;  4RM9 A;  4MJS B;  5JH5 C;  3T3N A;  4MGZ E;  2E6X A;  3OJ4 B;  3ZO5 B;  4C7Z A;  3U52 E;  1LFD A;  3I9V 1;  1CK1 A;  4WQM A;  1SXT A;  5AZF A;  2HTH A;  4MAC A;  4GSW A;  3B9J A;  2K8B A;  1D6E C;  3RNG C;  4C4V A;  4IUM B;  1FMA D;  1XO3 A;  4W9K A;  3K9P B;  1SE3 A;  4XZ4 A;  1TY2 A;  3Q3F A;  4MEL A;  3ZJT A;  1C76 A;  1TGZ B;  3ZQ4 A;  2FE8 A;  1UF0 A;  5IAA C;  1N63 A;  3BVM A;  4OVU A;  1DYQ A;  3Q3O C;  2WHI A;  2WX1 A;  2ZJD A;  1FCL A;  1MVK A;  3MJW A;  2KDF B;  1KTK A;  2MQJ A;  4JL9 A;  2C7M B;  2JUO A;  3HRD D;  1WZ3 A;  1KJT A;  2JY6 A;  2NBV B;  2VH2 A;  3U7D A;  2NS5 A;  4RF0 A;  1PGB A;  1JML A;  1TY0 A;  1C4C A;  2QSD A;  1SEB D;  4CQN A;  1VJK A;  1JWA D;  1LXD A;  2HTM E;  4ICV A;  2C9W B;  3APC A;  3IXS A;  1D3Z A;  3AMZ A;  1YJJ A;  3A1Q A;  1KF6 B;  3PRP B;  3QHT A;  3VRA B;  1FFU A;  1PUT A;  3JYU A;  3ZVV A;  1GB1 A;  4ZHO A;  1WSP A;  3M63 B;  1CMX B;  1XXG A;  3ZTD A;  2MRP A;  1JWU D;  3W1Y A;  4BKG A;  5D94 A;  2KQS A;  1C4P A;  2Z59 B;  1GUA B;  3VUW A;  1N61 A;  1PQS A;  1CJE A;  4BKS D;  2CJN A;  3MTN B;  3PRM B;  2E3T A;  1YMH E;  2DLB A;  3RZF A;  1ZPS A;  4WJP A;  3TJP A;  1FXT B;  1D5Z C;  4MM3 A;  1BML C;  5JZE B;  4OZB A;  1N5W A;  3ZNI D;  2WDV B;  1T0S C;  4LJO B;  1UD7 A;  4TSS A;  3HUI A;  5DPW A;  2BYV E;  2NBU A;  3TMP B;  5IO9 A;  1L5P A;  1MFW A;  4IM2 A;  1JW9 D;  3Q3N C;  3AH7 A;  3BK2 A;  3TEW A;  1J7B A;  4ZOH C;  2RR9 A;  3KUZ A;  2MP2 B;  3HK0 A;  3SEB A;  4RF1 A;  3DWM A;  5LLI A;  3S2A A;  3IT4 B;  4GXB A;  4DHJ B;  1E8Y A;  3A4S C;  3Q8E A;  1P7F A;  4II3 B;  1YQB A;  2N9P C;  2BS3 B;  4DWF A;  4MGY E;  1E8W A;  2Y5B B;  4NQK E;  1E7P B;  1SE2 A;  5L95 C;  1KLU D;  2IBI B;  1YN5 A;  2DYM A;  3NVY A;  1IYF A;  1XEE A;  3O65 B;  4YTN B;  1ZP0 B;  1WXM A;  3X0W A;  2KWC A;  3NHE B;  4N58 A;  5G5H A;  3R8B A;  2MW5 A;  2WGS A;  2ONQ A;  2ACZ B;  5D3D A;  2JRH A;  2WXM A;  5EE1 A;  2MHJ A;  2LVO A;  1E8X A;  4WQO B;  4KZC A;  3PVL A;  3RN9 C;  2N7E A;  4CO7 A;  1J7C A;  1OQQ A;  4WWM A;  4BKS A;  2V4L A;  4XX5 A;  1WIA A;  1YIW A;  2GOW A;  4GLS C;  2XN9 C;  1F2R C;  2KT7 A;  2MLB A;  2KDM A;  1ZDV A;  2CHZ A;  3JVZ X;  4EZL A;  2UYZ B;  1NVI D;  2ZNV C;  1SE9 A;  1WY8 A;  5CHW A;  5EE9 A;  3B1L X;  2BB6 A;  2WXJ A;  1FRR A;  3VR8 B;  3T3O A;  2ZCC A;  1HA5 A;  3N30 A;  3PHX B;  1EF5 A;  4YL8 A;  5CX3 A;  2O6V B;  2QHO A;  2LUM A;  4KIK B;  3AE3 B;  3PT2 B;  2WLB A;  5E6P A;  2IND C;  2BYF A;  3QWZ B;  1P1A A;  3N9Y C;  2QJL A;  4HLE A;  1I7H A;  4HRO A;  2V0G A;  4ASW C;  3NVV A;  2Z8L A;  3VUX A;  4GB9 A;  2ZVO A;  1B9R A;  2GBJ A;  2K9X A;  1QQR A;  2C5L C;  4BKT A;  1SIF A;  1WE7 A;  2AYO B;  2CHX A;  3BIN A;  2OJR A;  2UU7 A;  4RGN A;  3PSE B;  1WGR A;  1V81 A;  5BYS A;  1WXS A;  2GBK A;  3BVZ A;  4D2K A;  1IBX B;  1MG8 A;  1T5X D;  1I4X A;  4YT0 B;  4GDK A;  3A9K B;  2KTR B;  2PJH A;  4A3P A;  1V80 A;  4DHZ E;  3JSV A;  2FBW B;  4ACF A;  1F77 A;  4C00 A;  2D3A A;  4GGQ A;  2PVO D;  2TSS A;  4M01 A;  2KO3 A;  3ZRC A;  5T8I A;  1RAX A;  3PRZ A;  3ZGZ A;  4IOI E;  1ZDX A;  4FA6 A;  4NZL B;  2V4I B;  3KH0 A;  3VHT C;  3MHZ A;  1RRB A;  3BZD B;  4K81 A;  3TL5 A;  1TZO A;  4GN1 A;  2HE7 A;  2LHE A;  2KJR A;  5G5G A;  2FUH B;  1IGC A;  4KSL C;  4IM0 A;  2KC2 A;  3ML8 A;  3NJT A;  3WAN A;  3ZLZ A;  4RGM A;  3TUO A;  3R2I A;  5KHQ A;  1F9J A;  3ZXR A;  4WAF A;  4ARC A;  4GOC A;  2FIF A;  1WJ6 A;  3DVN U;  2WXI A;  2KC1 A;  3MHS D;  1WJU A;  1V9J A;  3TEZ A;  1TIF A;  4B9K A;  4YSX B;  2JU6 X;  4XWT A;  1V5T A;  4L1B A;  2Y5C A;  1RFA A;  4RM8 A;  4HCN B;  2L0T A;  3ZIM A;  5CTR C;  4F8C B;  5C3J B;  3Q8A A;  3PPA A;  1E7V A;  1SBB B;  3WAP A;  2DAF A;  3Q3M C;  3AEG B;  2GBN A;  3PZ8 A;  2AQ3 B;  4RH6 A;  2G1E A;  1L4D B;  1U4A A;  2A4Z A;  3HIZ A;  2C60 A;  4A8X C;  2MCN B;  2M17 A;  4B0M A;  2IZV B;  4KX6 B;  2M1M A;  2X8X X;  2J53 A;  1BXT A;  3SFD B;  2Y3A A;  4HDQ A;  4II2 B;  2GI9 A;  5I4D A;  1I4P A;  5AUI A;  3AE4 B;  2V1Y A;  2WQY B;  4KVG B;  2Q5W D;  2D2Q A;  3C0R B;  4XC2 A;  2PW9 A;  5KHO A;  3IBE A;  2KHW B;  2WXN A;  5BMH A;  3B0A A;  4NY0 A;  1WR1 A;  1VLB A;  1VR9 A;  5D2M B;  4E3C A;  3UGB B;  4WH4 A;  2LGS A;  4HVB A;  2LWP A;  2ZPY A;  4I6P A;  4RCO A;  2BW2 A;  1FEH A;  3BY4 B;  1BT0 A;  1TS2 A;  3MC8 A;  3N1Y C;  4G50 A;  2KK8 A;  1E90 A;  1K50 A;  3AEB B;  3VR9 B;  4PK1 A;  2V3P A;  3I57 A;  4EZJ A;  2RDB C;  4NPN A;  3PS6 A;  4PT5 A;  2XEW A;  2G4D B;  2WDT B;  3AEE B;  5HI1 A;  3L08 A;  3Q3J A;  3RCZ A;  3IVF A;  2L1A A;  5C2T B;  2QC8 A;  1RWS A;  3KW5 B;  1UH6 A;  3HM3 A;  4TQ1 A;  2AL6 A;  1ZOY B;  1WXA A;  2CR5 A;  5HFY A;  1YQ4 B;  3SR6 A;  1EU3 A;  3VTU A;  2L32 A;  3L0W B;  3VUY A;  1WGY A;  4MH8 A;  4GMV A;  3LJ3 A;  3CMM B;  2PMV A;  1ZUD 2;  2RD0 A;  2YLM A;  5BYR A;  3FIL B;  3QIJ A;  2LEK A;  5DPT A;  4E74 A;  5H92 C;  3RZW C;  3Q8B A;  2UWQ A;  4MGK E;  4NAM A;  1V1P A;  3SFE B;  3VH4 B;  1RYJ A;  1EO6 A;  4RNA A;  4YSY B;  3W9C B;  3DHG C;  3NZS A;  3TEY A;  2YVC A;  4IWP A;  3N32 A;  2LMC A;  2CS4 A;  1M4V A;  3RPF C;  4W9I A;  1FCC C;  4LDT D;  1BUI C;  2H88 B;  1WJN A;  2CJO A;  2MJD A;  5HHD G;  4BOZ B;  1E10 A;  4FBJ B;  3A4R A;  4N9F 4;  5E6O A;  1S1Q B;  2YEP B;  2JSV X;  4H2A A;  2PE6 B;  1FM0 D;  2K6D B;  2W9N A;  1TYG B;  3DWG C;  3APD A;  1YX5 B;  2N1W A;  4IC7 B;  1QIL A;  2FCS A;  2DYB A;  1SIJ A;  2NPT B;  4AOF A;  2G9H D;  5HG2 A;  2VZK B;  4US8 A;  2BWE S;  1JWS D;  3AE1 B;  1YN4 A;  1L4Z B;  1WWT A;  2XNA C;  1WXQ A;  1V5O A;  3V6E B;  1TBE A;  4AJY B;  4G0N B;  4YXD B;  2NBW B;  1L0V B;  3MC0 B;  3D32 A;  3UIN B;  1T0Y A;  2OJW A;  3CST A;  1LO5 D;  3RNF C;  3ZKJ C;  1IPG A;  4FLH A;  4NAW B;  4F7Z A;  2KFK B;  2D07 B;  2LVQ A;  2CU1 A;  4GDL A;  1QF6 A;  4KKJ A;  2N9X A;  3KVF B;  1QZE A;  4PS8 A;  4WJQ A;  1Q0W B;  4NJ7 A;  4K3C A;  1E5W A;  2K0P A;  2BTE A;  1GJZ A;  2KMA A;  3IG3 A;  1XT9 B;  3KQ4 A;  5D6J B;  3T8M A;  3KWL A;  1WH3 A;  1P98 A;  4C4V B;  1GC7 A;  1DOI A;  2EMT A;  4HDO A;  2LGD A;  2WXL A;  3L10 B;  3K9O B;  3DVN V;  2JXT A;  2KYW A;  2LRU A;  2DHZ A;  1JCK B;  1I35 A;  2AQ2 B;  3TCA A;  2IY0 B;  1VZ7 A;  3WIM A;  5LNK 1;  4B95 A;  4I6N B;  2ZCB A;  5D3I B;  3QAR A;  1QOF A;  4IM3 A;  3IHP C;  3SD5 A;  2JYE A;  3UI3 A;  4W9J A;  4OHJ A;  4DXF A;  3A1Q B;  4ITK A;  1K53 A;  2N1V A;  4JPS A;  1QT9 A;  1F1H A;  1HTQ A;  1JRP A;  2MBH A;  2XK5 A;  2INP E;  1XLP A;  2I1J A;  5IN7 A;  1EF1 A;  3H8H A;  3L54 A;  3ZUN A;  2I2Y A;  2ON8 A;  3I5J C;  1NBF C;  3AE2 B;  1EUV B;  4WWN A;  3QA8 A;  2KX3 A;  3RYT A;  2KJH B;  2LD9 A;  1RLF A;  2FUG 1;  2L7R A;  2RDH A;  4FHK A;  2JRI B;  4AUQ C;  4IWQ A;  1WYW B;  2KXJ A;  2WS3 B;  4B0E A;  2LXC A;  4NNJ B;  4WWP A;  2MA9 B;  3VXW A;  3AEC B;  3MP9 A;  4PYZ A;  2BGF A;  2LGX A;  4MM3 B;  2M0A A;  2LFI A;  3ZXV A;  3PGE A;  3ENE A;  3KLS X;  3PZD A;  1WRD B;  1TTN A;  4EEW A;  2JYT A;  1IP9 A;  2J0J A;  1LGR A;  3AED B;  1WMH A;  2D10 A;  3P42 A;  1I4R A;  2JPH A;  4IG7 B;  3IAS 1;  1KOT A;  2FID A;  3QX1 A;  2X38 A;  2AWT A;  4KZ0 A;  2DX5 B;  3H6N A;  2M56 B;  3RNC C;  1WGD A;  2W3S A;  2KWU B;  4G11 A;  3APF A;  2PPH A;  4IW0 A;  2FNJ B;  1J7A A;  1J8C A;  5TR5 A;  1XLO A;  2JZZ A;  1R4M I;  1PDX A;  2LAS A;  2PKO A;  3OG5 A;  1QOG A;  3WAO A;  2KN5 A;  1XD3 B;  3ETR A;  3HVZ A;  2GBM A;  4RGO S;  3SHQ A;  4PS3 A;  4RGT A;  2Z0E B;  4ANU A;  5G2N A;  2K1F A;  2MBB B;  2V9H A;  2WU5 B;  2GB1 A;  2NTS A;  3BYT B;  4W9E A;  1TKY A;  2ZNV B;  1OEY A;  4W9L A;  2RPQ A;  1SF0 A;  3P4R B;  1WX8 A;  3EGR A;  5MPO A;  2MH7 A;  1OGW A;  3PRE A;  1AYF A;  5BMG A;  2O2V A;  2PIA A;  1HE8 A;  3B2F A;  4BOS C;  3QCA A;  4XE0 A;  3P4Q B;  1GNU A;  1OQR A;  1D4B A;  2NMQ A;  4YTM B;  3DBL I;  1XCQ L;  3DVG Y;  4MSQ B;  2MJ3 A;  1QKZ A;  2KAN A;  1K52 A;  2LVP A;  2LJI A;  3DVG X;  4KDI C;  4HPL B;  2BS4 B;  1WX9 A;  4S17 A;  4P7I A;  2LJ5 A;  4ZRJ A;  5FK9 C;  3EUB 2;  3DBS A;  1TS4 A;  1HZ5 A;  4JIO U;  5DPR A;  3HM6 X;  1HTO A;  4IKG A;  3BVG A;  3WCQ A;  4LK0 M;  4EE2 A;  1WFY A;  2FCQ A;  1L0Y B;  3N1Z C;  3PO0 A;  4M00 A;  1RM6 C;  2JXX A;  4AWJ A;  2WX0 A;  2KAJ A;  3CF6 E;  4P6V F;  5E6N A;  3NRZ A;  2KDE B;  2LRW A;  1P3Q U;  1JRU A;  1UZX B;  2KNB A;  4QAY A;  2LGY A;  1N62 A;  4DDI D;  3LXF A;  1VRA B;  4A6Q A;  1DOX A;  2D11 A;  2BPS A;  3C8Y A;  4ZRK A;  1YNT E;  1RFK A;  1GAQ B;  5JHB A;  2C7H A;  4XDC A;  1C4A A;  3I3T B;  3VTV A;  1EM7 A;  2HJ8 A;  4M0W A;  1XLN A;  4JGH B;  2WDR B;  1N60 A;  4GDK B;  2KFJ A;  4DBG A;  2PE9 A;  3EHV A;  4HJK A;  4K7U A;  1C77 A;  3JSV B;  1C1Y B;  3FAH A;  1T0R C;  1Q5W B;  1D5X C;  2KLC A;  1VD2 A;  4LNF A;  1WM2 A;  3P2B A;  3O13 A;  4ZDV A;  3R66 C;  3VAW A;  3JW0 X;  3OWE B;  2IGH A;  2RGF A;  1C78 A;  4WAA A;  2MSE D;  1ZGU B;  3NVZ A;  1MJD A;  2DZI A;  2IJ0 A;  3IT6 B;  3L16 A;  1FNV A;  4CHK A;  1I4G A;  4C7Y A;  1P0R A;  4NQL B;  2IO3 B;  4DXA B;  2WXP A;  2IO1 B;  1WYG A;  3GS2 A;  1WI0 A;  1N5X A;  2AQ1 B;  3ZYY X;  4EOY A;  1V97 A;  2N9K A;  4URK A;  4ANV A;  2LXA A;  1V1O A;  4JQW C;  4REZ A;  2WU2 B;  3W5U B;  3RNB C;  1AAR A;  5IKC M;  1KLV A;  3Q6B A;  1ZE3 D;  1A5R A;  3PZ7 A;  3N3K B;  2R2O A;  3DCG A;  3AE7 B;  5D7G A;  2KJ6 A;  1V49 A;  4ZRP A;  4BVU C;  1S3S G;  3KYD D;  5H8Y E;  2H89 B;  5FR3 A;  2OOB B;  3TIX A;  5G55 A;  2MEK A;  4K3B A;  2M4N A;  5C23 A;  2JWU A;  3ZJV A;  3TSS A;  3KUC B;  3DBH B;  1AN8 A;  4PYU A;  1ET9 A;  4USA A;  4TMA B;  1FO4 A;  3ABV B;  2SAK A;  3H7P A;  4FJV B;  3V05 A;  3BYY B;  1IGD A;  3BII D;  2DBY A;  2QIL A;  3AU4 A;  2BT6 A;  3A9J A;  1ROE A;  3X23 A;  4PS7 A;  1P7E A;  2V3N A;  1ZXI A;  1WF9 A;  3GP7 A;  3H9D A;  4ANW A;  3AUL A;  2K8H A;  1AWD A;  3OLM D;  3GE3 C;  3RUI B;  4ICU A;  2INN E;  1R4M B;  4WJO A;  3M3J A;  1YN3 A;  1WR6 E;  2WXO A;  2NVU I;  4MGI E;  5BMI A;  4IWO A;  2IY1 B;  1OTR B;  3VH3 B;  2WYQ A;  4KDL B;  1PYW D;  3RD2 A;  3GOE A;  1PGA A;  4RMA A;  3IAM 1;  3PTF C;  3GE8 C;  4ZYN A;  3RMK C;  4N6E B;  1EWY C;  1XLQ A;  2LUE A;  2M8S A;  2N0S B;  4S0R A;  4M8M A;  2L3Z A;  3A33 B;  2K5P A;  1F2R I;  1OFF A;  3ZRF A;  3J9C A;  3MJ5 A;  3ZNH B;  4OW0 A;  5GXG B;  3U8Z A;  2RDG A;  4MT5 A;  4HPP A;  1F52 A;  3AU5 A;  3DBL B;  4MJS A;  1IUE A;  3B08 A;  3RNA C;  1SE4 A;  3W5V B;  4HWI B;  2JVC A;  3VTW A;  1P9D U;  4FJZ A;  3L17 A;  4BBN F;  3PLU A;  1DGJ A;  1STE A;  3R2T A;  2I1K A;  3R3M A;  1NEK B;  3NG0 A;  2J52 A;  4C56 C;  3WA0 A;  3I63 C;  4HKQ A;  3EC8 A;  2NR2 A;  4TUU A;  5LXI B;  4KV2 A;  3HVD A;  3W1S A;  1R4N I;  1HZ6 A;  1V6E A;  4GIV A;  2N7J A;  3N1X C;  4N59 A;  2L8J A;  3ZTC A;  2KZR A;  4ZRQ A;  3L13 A;  2KQ7 A;  4DHJ D;  3AN1 A;  1TT5 B;  1X1M A;  3AB5 A;  1GG3 A;  1TS5 A; 
#chains in the Genus database with same CATH homology
 1T5X D;  1I4X A;  4YT0 B;  2LHD A;  2FUG 1;  2RDH A;  1GB4 A;  1FXI A;  2KQ4 X;  1AW7 A;  2WNM A;  4LLG M;  1SSN A;  1EWC A;  4A9A A;  2WS3 B;  4B0E A;  2FBW B;  1EU4 A;  2K3U A;  1F77 A;  2WXQ A;  3AEC B;  2EKI A;  1MHH E;  3MP9 A;  2Y5P A;  1V1P B;  1HXY D;  2VZK D;  4MM3 B;  3NS1 A;  2M0A A;  2LFI A;  2CU3 A;  2PVO D;  4O1N A;  2TSS A;  2OHF A;  3AEA B;  3KLS X;  5T8I A;  3E9S A;  3ZGZ A;  3U4E G;  3B2G A;  4IOI E;  1WGK A;  1XF5 L;  1ZDX A;  2IGG A;  3L4P A;  4NZL B;  2V4I B;  1HQR D;  2JYT A;  3MHZ A;  1UNS A;  3AE8 B;  2BB5 A;  3BZD B;  2W54 A;  3AED B;  1V8C A;  3P42 A;  1I4R A;  1TZO A;  4KGS A;  1DOY A;  3IAS 1;  4KGR A;  2LHE A;  5G5G A;  1D5M C;  3U7Z A;  1PGX A;  1IGC A;  3ZJU A;  1JAL A;  2WXK A;  2X38 A;  3NZ3 A;  3FIL A;  2M56 B;  2LGI A;  4JWU C;  3URY A;  4RGM A;  3TUO A;  3P4P B;  2W3S A;  3R2I A;  5E6J A;  3MFG A;  2DYO A;  4Q2J A;  4WAF A;  1Y56 A;  4ARC A;  2PTL A;  1J7A A;  2WXI A;  1XLO A;  4UDU C;  2EEL A;  4NJC A;  4L23 A;  4ZHP A;  4YTP B;  3TEZ A;  4YSX B;  2JU6 X;  4XWT A;  1PDX A;  3Q8C A;  1FRD A;  2PKO A;  2W3R A;  2D5G A;  2Y5C A;  4L1B A;  1QOG A;  3FC4 A;  2PLP A;  3ETR A;  3HVZ A;  3AM9 A;  2WDQ B;  3VRB B;  1MPE A;  4RGO S;  3W2D A;  4DXG A;  1B1Z A;  4RGT A;  2IPK D;  3Q8F A;  2DWQ A;  3P63 A;  2BS2 B;  5C3J B;  3Q8A A;  2IDY A;  2KN4 A;  2N9L A;  1KH0 A;  1SBB B;  2HDE A;  3Q69 A;  1ACC A;  2WU5 B;  3BWU D;  2GB1 A;  2KAC A;  2NTS A;  3BYT B;  1TKY A;  3AEG B;  3PZ8 A;  2AQ3 B;  4RH6 A;  2G1E A;  4DQO C;  2I38 A;  2KMM A;  4HJG E;  4A90 A;  1CZP A;  1L4D B;  1SF0 A;  1FXA A;  4HKZ E;  4JX1 C;  3P4R B;  2YEP F;  3EGR A;  1JRO A;  3AE6 B;  5MPO A;  2MH7 A;  1L6V A;  4A8X C;  1AYF A;  5BMG A;  4L2Y A;  2PIA A;  4B0M A;  3B2F A;  4GDL B;  4OVZ A;  2L52 A;  1JWB D;  1KRH A;  4KX6 B;  1TS3 A;  4YWG G;  4FXC A;  4XE0 A;  2J53 A;  1NYQ A;  1BXT A;  3P4Q B;  3KWV A;  3SFD B;  4YSZ B;  1ENF A;  1OQR A;  2Y3A A;  1D4B A;  2NMQ A;  4YTM B;  1XCQ L;  2GI9 A;  2L83 A;  5I4D A;  1I4P A;  2R61 A;  2PVG C;  5AUI A;  4AQ7 A;  3NUH B;  2MJ3 A;  4XWW A;  3AE4 B;  1QKZ A;  2WQY B;  3P4S B;  2M19 A;  1FNU A;  1K52 A;  2LJI A;  1SJH D;  5AUK A;  2BS4 B;  3V3X A;  2Q5W D;  3NVW A;  3GB1 A;  5EE0 A;  5FK9 C;  4TQ0 A;  3EUB 2;  1R7S A;  1TS4 A;  2PW9 A;  1HZ5 A;  4US9 A;  4J3O D;  2RMM A;  4XDD A;  2JZP A;  2WXN A;  5BMH A;  3AE9 B;  1K51 A;  1UWX A;  2WXG A;  1L6U A;  4IKG A;  3BVG A;  3WCQ A;  1VLB A;  4LK0 M;  1VR9 A;  4EE2 A;  1KLG D;  1L0Y B;  3AEF B;  3U2S C;  3PO0 A;  4WH4 A;  2IGD A;  3T3N A;  2J42 A;  2E6X A;  2MJE A;  4OZA A;  4RCO A;  1RM6 C;  4C7Z A;  2BW2 A;  3U52 E;  1FEH A;  3I9V 1;  4WUR A;  1CK1 A;  4WQM A;  1NEN B;  1SXT A;  1TS2 A;  4MAC A;  3B9J A;  2KAJ A;  1D6E C;  4OZC A;  4P6V F;  3NRZ A;  1FMA D;  1ESF A;  1XO3 A;  2OED A;  4RFB A;  1SE3 A;  1TY2 A;  3CWI A;  3ZJT A;  1C76 A;  1N62 A;  2W55 A;  3ZQ4 A;  1K50 A;  2FE8 A;  3AEB B;  3LXF A;  3VR9 B;  1N63 A;  2QMT A;  1VRA B;  3BVM A;  1DYQ A;  4A6Q A;  1DOX A;  1FCL A;  1MVK A;  1C79 A;  4A55 A;  2V3P A;  1KTK A;  3I57 A;  3C8Y A;  3P1M A;  4C80 A;  1YNT E;  3HRD D;  1RFK A;  1GAQ B;  4XDC A;  1C4A A;  1VZ8 A;  1I4Q A;  1EM7 A;  1WRI A;  4M0W A;  1XLN A;  4RF0 A;  1PGB A;  1UUP A;  1JML A;  4PT5 A;  1TY0 A;  1C4C A;  2QSD A;  3AEE B;  1SEB D;  2WDR B;  4P16 A;  1N60 A;  5HI1 A;  4GDK B;  4CQN A;  1VJK A;  4HEA 1;  1JWA D;  2HTM E;  2L1A A;  5C2T B;  1RWS A;  4JE3 B;  1C77 A;  3FAH A;  1SB3 C;  3IXS A;  3AMZ A;  1D5X C;  1YJJ A;  4TQ1 A;  1GPX A;  3O13 A;  4WIP A;  1KF6 B;  1ZOY B;  1SJE D;  3VRA B;  1FFU A;  1PUT A;  2KWD A;  3OWE B;  5HFY A;  2IGH A;  1GB1 A;  4ZHO A;  1WSP A;  1YQ4 B;  1C78 A;  3SR6 A;  1YQ3 B;  1XXG A;  3NVZ A;  1MI0 A;  1T3Q A;  4ARI A;  4IDI A;  2IJ0 A;  3IT6 B;  1FNV A;  1MHX A;  1IBX A;  1EU3 A;  1I4G A;  1JWU D;  3TEX A;  2L32 A;  2WXF A;  4MH8 A;  1C4P A;  4C7Y A;  2PMV A;  1ZUD 2;  2WXP A;  2WP9 B;  1YJI A;  1WYG A;  1TKE A;  3FIL B;  1N61 A;  5BYR A;  1CJE A;  2LEK A;  3GS2 A;  1Q10 A;  1QOA A;  5H92 C;  2AQ1 B;  1N5X A;  2CJN A;  2WXH A;  2AX5 A;  3Q8B A;  3ZYY X;  2E3T A;  1V97 A;  1YMH E;  2DLB A;  2N9K A;  1ZPS A;  4NAM A;  1V1P A;  4AS1 A;  3SFE B;  1FFV A;  1D5Z C;  1BML C;  1RYJ A;  2ZW1 A;  1N5W A;  4OZB A;  4RNA A;  1V1O A;  4YSY B;  2WDV B;  3W9C B;  1QLB B;  4REZ A;  5EE3 A;  3TEY A;  2WU2 B;  3HUI A;  4TSS A;  3W5U B;  2LMC A;  1KFY B;  1C9F A;  1L5P A;  1M4V A;  1ZE3 D;  2JX5 A;  3RPF C;  1JW9 D;  3PZ7 A;  3AE5 B;  1FCC C;  3AH7 A;  3BK2 A;  3TEW A;  1J7B A;  1L0X B;  4ZOH C;  3AE7 B;  5D7G A;  1BUI C;  2H88 B;  4ZRP A;  2CJO A;  2MJD A;  5HHD G;  4RF1 A;  3SEB A;  3DWM A;  1E10 A;  3IT4 B;  3AV8 A;  1TKG A;  5H8Y E;  2H89 B;  3Q8E A;  1P7F A;  5FR3 A;  1GOZ A;  3RFZ B;  2SEB D;  2ZW0 A;  2BS3 B;  2MEK A;  2GRI A;  2YEP B;  2JSV X;  4H2A A;  2JWU A;  3ZJV A;  3TSS A;  1FM0 D;  1AN8 A;  1TYG B;  1ET9 A;  1E7P B;  3DWG C;  1SE2 A;  4USA A;  1A70 A;  4TMA B;  1FO4 A;  3ABV B;  5JXV A;  1KLU D;  1YN5 A;  2DYM A;  2SAK A;  3NVY A;  1XEE A;  4YTN B;  1QIL A;  1ZP0 B;  5FKA C;  3V05 A;  3BYY B;  1SIJ A;  1IGD A;  1I4H A;  2G9H D;  5HG2 A;  2VZK B;  3BII D;  1E6E B;  2DBY A;  4N58 A;  1JWM D;  3VQI A;  4US8 A;  5G5H A;  1JWS D;  3AE1 B;  2QIL A;  4R3D A;  3R8B A;  1YN4 A;  1L4Z B;  1WWT A;  2BT6 A;  2XNA C;  2ONQ A;  1ROE A;  1WXQ A;  2ACZ B;  5D3D A;  1QOB A;  1P7E A;  2WXM A;  2V3N A;  1XCT L;  1ZXI A;  5EE1 A;  4YXD B;  1F0Z A;  3GP7 A;  1L0V B;  3MC0 B;  1AWD A;  1FNW A;  1LO5 D;  1NYR A;  2ICI A;  4NAW B;  2INN E;  1YN3 A;  2WXO A;  1QF6 A;  4KKJ A;  1J7C A;  1OQQ A;  2QIE B;  4WWM A;  5BMI A;  1VZ6 A;  1HEZ E;  3LYY A;  5BYQ A;  2K0P A;  4GLS C;  2BTE A;  2XN9 C;  1PYW D;  3LB8 C;  1F2R C;  3BK1 A;  3KQ4 A;  2BYT A;  2KDM A;  1ZDV A;  1PGA A;  3KWL A;  4ZYS A;  1ZXH A;  3IAM 1;  1FD6 A;  4N6E B;  1NVI D;  3E56 A;  1EWY C;  1XLQ A;  2N0S B;  1T6B X;  1DOI A;  5EE9 A;  2BB6 A;  4JWS C;  2NTT A;  2WXJ A;  2K5P A;  2WXL A;  1TJE A;  1F2R I;  1OFF A;  1FRR A;  3J9C A;  3MJ5 A;  3VR8 B;  3T3O A;  2JXT A;  2B76 B;  4OW0 A;  1CQV A;  5GXG B;  3EA6 A;  1HA5 A;  2RDG A;  2BBC A;  1JCK B;  4KKI A;  4MT5 A;  2AQ2 B;  1IUE A;  1VZ7 A;  1UGJ A;  1SE4 A;  3W5V B;  5LNK 1;  5TSS A;  2RPV A;  4KGT A;  2LUM A;  3AE3 B;  1ET6 A;  1E9M A;  2WLB A;  5D3I B;  2JQR B;  1QOF A;  4HRS A;  1DGJ A;  1STE A;  3R2T A;  1JQ4 A;  1NEK B;  2JYE A;  3N9Y C;  2J52 A;  2QJL A;  3UI3 A;  4C56 C;  1I7H A;  4HRO A;  4HKQ A;  2K22 A;  2V0G A;  4OHJ A;  4DXF A;  1NI3 A;  2WXR A;  4LTU A;  3NVV A;  2Z8L A;  4ITK A;  1K53 A;  3HVD A;  1B9R A;  3W1S A;  2K9X A;  4JPS A;  1QQR A;  1HZ6 A;  3CIR B;  1QT9 A;  1VDV A;  2QEJ C;  1JRP A;  1PFD A;  1E0Z A;  2N7J A;  2INP E;  1XLP A;  4N59 A;  3H8H A;  2I2Y A;  2ON8 A;  2W82 A;  4RGN A;  4ZRQ A;  1UWM A;  3AE2 B;  3AN1 A;  3AB5 A;  5BYS A;  3BVZ A;  4D2K A;  1IBX B;  1FIQ A;  2J4X A;  1TS5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...