1MPEA

Ensemble of 20 structures of the tetrameric mutant of the b1 domain of streptococcal protein g
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
56
structure length
56
Chain Sequence
MQYKVILNGKTLKGETTTEAVDAATFEKVVKQFFNDNGVDGEWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunoglobulin G binding protein G
publication title Core mutations switch monomeric protein GB1 into an intertwined tetramer.
pubmed doi rcsb
source organism Streptococcus sp. 'group g'
molecule tags Protein binding
total genus 5
structure length 56
sequence length 56
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2002-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1mpeA00
2K0PA 4OZBA 5BMHA 1HEZE 1MHXA 2RMMA 1YNTE 1IGCA 2JWUA 1UWXA 2IGHA 1IBXB 2NMQA 3FILA 2KQ4X 3V3XA 1GB4A 2GI9A 2EELA 2GB1A 5HHDG 2N9LA 1IBXA 4IKGA 2IGDA 1XCTL 3FILB 5HFYA 1HZ5A 4IOIE 1P7FA 1MHHE 1F2RI 4GLSC 4KGRA 1XCQL 1D4BA 1K53A 1PGXA 2ONQA 5HI1A 2JU6X 2KDMA 1FCLA 1PGBA 2QSDA 3MP9A 2JZPA 1K52A 5BMGA 1C9FA 2J52A 1FCCC 1ZXHA 1PGAA 2I38A 1P7EA 3GB1A 1QKZA 2KN4A 2ZW0A 2ZW1A 2PTLA 1Q10A 1HZ6A 2OEDA 2PLPA 2PW9A 2JSVX 2J53A 2QMTA 2IGGA 1GB1A 2N9KA 1XF5L 2N7JA 4KGSA 4D2KA 1EM7A 4OZCA 2I2YA 1F2RC 2KACA 4WH4A 2LGIA 1YMHE 2LHEA 1JMLA 1K50A 1K51A 1KH0A 4MACA 4HJGE 1FD6A 4KGTA 1MI0A 2JXTA 2LUMA 2RPVA 4OZAA 1MPEA 3UI3A 1MVKA 5JXVA 4HKZE 5HG2A 5BMIA 2KWDA 2ON8A 1IGDA 2LHDA
chains in the Genus database with same CATH superfamily
5LNK1 2G9HD 2JZ3B 2KJ6A 2DNFA 3KWLA 4XDDA 2RMMA 1WJUA 4WWPA 2BPSA 3O13A 1Q1OA 2JT4B 2NBVB 3APCA 2GB1A 2WXKA 2C9WB 1AW7A 3PT2B 3FILB 2M4NA 4HCPB 2J0JA 2W9NA 3DBLI 2MP2B 1YN4A 3EUB2 2K3UA 2WXJA 1C4CA 1WMHA 4NPNA 3PZ8A 2CHZA 1CK1A 4MM3A 4HCNB 4OVVA 1FCLA 3WA0A 1Y56A 1VLBA 2DYMA 1V86A 4BKSA 5L95C 4QAYA 2BS4B 1E10A 3TEWA 2ZPNA 1UUPA 2LRWA 4WWNA 4KIKA 2TSSA 5D3IB 2IPKD 3P2BA 4YTNB 1E8ZA 1GOZA 3AE9B 5H8YE 2PPHA 3MJ5A 1WRIA 4EZLA 4W9FA 3IXSA 2ZCBA 2V1YA 3PLVA 2GBNA 3PRMB 3PREA 3HUIA 1FRDA 3QX1A 1E7PB 5JZEB 4A3OA 5JHAA 2K9XA 2WXOA 2GLSA 3SEBA 3TIXA 3B0AA 1GPXA 1PQSA 4FJVB 3AEAB 5IO9A 3W2DA 1IP9A 1C79A 4B95A 3Q8EA 5IN7A 4B9KA 4WWOA 1QILA 3KW5B 4II3B 3KYCD 2LXCA 5HG2A 4LDTB 2LJIA 3KVFB 4KKIA 3J9CA 5DPRA 2A5UA 2NTSA 4EKUA 1KOTA 1HEZE 1UGMA 4W9IA 2NMQA 2KNBA 3ZTDA 4BBNC 1SGHA 4E74A 3U7DA 4WAAA 4LCDE 3LB8C 3RNBC 2IGDA 1WYWB 3W5VB 1EF1A 2X8XX 1XLPA 1J19A 3D32A 2INNE 2KTRA 4KDLB 5AZGA 3B08A 2JYTA 2KDEB 5G55A 4EZKA 2MH7A 2L1AA 2JU6X 2KDMA 1D6EC 4JWUC 1OQQA 1WZ0A 2HDEA 1QOGA 4IM2A 4HLEA 4YWGG 2QJLA 1PGAA 4K81A 1P7EA 3NVZA 4ASWC 3ZNGC 1LM8B 2K5PA 4OVUA 2RDGA 1VJKA 1P0RA 1YJIA 2PLPA 5DPSA 3Q3OC 3T9LA 2KQSA 3RN9C 5AUKA 4CQNA 3DQVA 1V97A 3BZDB 4MGKE 3QCAA 2R61A 3VR8B 2I2YA 3TJPA 1FMAD 4ZRIA 2N0SB 1J7AA 2BF8B 1CMXB 5TSSA 1JWBD 2WP9B 1ET6A 2HTHA 2JRHA 2RPVA 2ZEQA 1MPEA 3K9OB 4ANWA 1MVKA 3RULA 3NG0A 3U52E 4EEWA 4JQWC 3A4RA 3WAMA 3OLMD 1RWSA 4ANXA 1ESFA 2MLBA 4BKGA 4DHZB 4F7ZA 4O1NA 4REZA 4KZCA 2EELA 2E3TA 4GN1A 3V61A 2BVCA 4ICVA 4LK0M 1F77A 2WQYB 3KH0A 3H9DA 3AU4A 1GC6A 1D3ZA 3ENEA 1OTRB 3N9YC 4BVUC 3APDA 3M95A 1PGXA 4BBNF 4E3CA 1RRBA 2C5LC 3Q6BA 1SB3C 3TCAA 1ZXHA 4FADA 2DYOA 2DZKA 3A1QB 2KOXA 4N9F4 1K8RB 4WWMA 3VHTC 2AL6A 4KZ0A 4FLHA 2KX3A 1UD7A 3RNAC 3N1YC 4HKQA 3BYYB 2N9KA 3V60A 2EKIA 4ARIA 2WDRB 4II2B 5LLIA 4AQ7A 1QQRA 1E6EB 4BKSD 3MJWA 4DXFA 2L52A 1NDDA 2N1VA 3DHHC 3SFEB 2MEKA 2KANA 2W54A 4M02A 5E6PA 1YQ3B 3QK0A 3KUDB 1LXDA 3ZVVA 2BB6A 3HHMA 2KWVB 2RPQA 2O6VB 3M3JA 4ACFA 5H92C 4DHJD 1LFDA 1L4DB 2KLGA 1YX5B 2KMCA 2IGHA 2LHDA 2KDBA 2KWUB 1Y8RC 1STEA 2LUEA 3VRAB 3EECA 2LVPA 4B6WA 1YNTE 4W9GA 2FCMA 1IBXB 3VH3B 3N1XC 2KYWA 3V3XA 1D5MC 2K8BA 3U4EG 2DWQA 1I35A 2MRPA 3RNFC 4LNOA 1XD3B 1SF0A 2JF5A 2KHWB 1L0VB 2J0KA 4LJPB 1XCTL 3AU5A 2PMVA 3CWIA 5HFYA 1RFKA 2C7MB 3AV8A 2KKCA 3WCQA 1D4BA 1K53A 4PS7A 4IM3A 3LJ3A 2WXFA 5IOIA 4CYEA 1R4NI 2KTFA 3DDCB 2KJHB 3EFCA 1ZDVA 2KFKB 2CHWA 2NS5A 2NVUI 3GB1A 1TJEA 3NOBA 4W9DA 4FXCA 1J7BA 3V62A 4B0MA 4LNIA 2INDC 1Z5SB 2H88B 4A8XC 2Q5WD 1EM7A 3PRPB 4MH0E 1EF5A 4LTUA 2KACA 4URKA 2NCNA 2LHEA 4LJOB 1FEHA 3Q8CA 5EDSA 3DHIC 5AUIA 4HWIB 1E5WA 4TMAB 2HJ1A 4GIVA 2LZ6A 1T0SC 2NTTA 4EUTA 2H89B 2K39A 3PLUA 2G45B 1GUAB 2M19A 4MELA 2D2QA 1Q0WB 2JYEA 5BMHA 1NYRA 2IYDB 4ZRPA 1WE6A 5C2TB 2YLMA 3QIJA 4P16A 3AH7A 2L0TA 1FIQA 2MBEA 1IBXA 1JALA 4WJQA 5DPTA 1ZDXA 3AEBB 2BTEA 2RGFA 3QJZA 5EE1A 1VZ6A 2REXA 3A4SC 4GOCA 3A9JB 4XE0A 1T5XD 3BK1A 2WLBA 1I4RA 3R2TA 3RZFA 1QZEA 2FIDA 3HVZA 1VDVA 2K22A 3WAPA 3KLSX 4USAA 5AZHA 3Q69A 1K52A 1I7HA 3ZDTA 1E8WA 2J52A 1WXQA 4EFOA 3Q3NC 2L76A 3TUOA 3MHSD 4TKNA 4RNAA 2BBCA 3VTUA 1TBEA 1V80A 1WRDB 4NQKE 4W9KA 1WY8A 1XEEA 4N58A 3UF8A 4Q2JA 2KMAA 4JL9A 4KIKB 4BFRA 4BOZB 1F1HA 3AULA 4HPPA 3BY4B 1JWSD 3W1SA 1ZGUB 2LFIA 3DBHB 1N62A 3N32A 3WALA 3UINB 1IUEA 2CU1A 2MJ3A 1RM6C 3Q2AC 4P6VF 2W82A 4IG7B 3NJTA 1FXIA 2DLBA 2KLCA 1UH6A 2BS3B 1WXAA 3VQIA 3TMPB 4P7IA 2XEWA 3X23A 4ZRJA 4AOFA 1BUIC 1I4XA 1S3SG 2J0MA 2BS2B 2MBOA 2JWUA 1UWXA 3BVZA 2L00B 2VZKB 1H4RA 1SE9A 2QCZA 3PRZA 4PYZA 3RZWC 3BK2A 4MGIE 2CR5A 1H8CA 1TS5A 3NZSA 4FBJB 2FUG1 3QARA 4ZHPA 3TSSA 3NZ3A 3RUIB 2K6DB 2MWSB 3N1ZC 4US9A 4DXAB 3H6NA 5T8IA 4YL8A 2VH2A 1UF0A 2NBWB 1WGKA 2QHOA 2ZVNA 3ZW3A 1T0QC 3I63C 3QC8B 2KMMA 4EZJA 3A9JA 1L7YA 5E6NA 3IFWB 2E6XA 3L4PA 2DHZA 5HI1A 1T3QA 2WU2B 3R3MA 2KTRB 3OWEB 2V9HA 1SEBD 1I4HA 2NPTA 1V5OA 4W9CA 3P63A 4KSKC 4ITKA 3OJ4B 1R4MB 2WXRA 3AE1B 4YT0B 2D11A 1TZOA 3CMMB 4A6QA 1CQVA 1KLUD 3AE5B 1IYFA 2J53A 2QMTA 4KDIC 1JW9D 2BT6A 4AJYB 2D3CA 4W9EA 2V3PA 4AJWA 1WX7A 2LJ5A 1PYWD 4HROA 3AEDB 1L6UA 2PEAA 1WGGA 1WI0A 1E9MA 3HM6X 2FAZA 1AYFA 2BGFA 1WJ6A 1VRAB 1V9JA 3FAHA 2LUMA 3A33B 3P4PB 1GG3A 2PE6B 3TBLD 4US8A 1V81A 2BW2A 4M01A 2KWDA 3GZNB 2AQ2B 3RNEC 3VUXA 3X0WA 3AN1A 1N5XA 3RFZB 1TGZB 2WHIA 3ZRCA 5IA7A 3C8YA 5CX3A 2WXLA 3AEGB 1WJ4A 2XBBC 2LGYA 2PJHA 4KVGB 3L0WB 2PE9A 3ALBA 3RYTA 2FUHB 3SR6A 2C7NB 1TZ1A 3ML8A 2HE7A 3AE3B 5LXHA 4DBGA 3VH4B 4CO7A 4XGAB 5E6JA 4IOIE 4NJ6A 3VUYA 3AE6B 2O6VD 1N60A 3PZ7A 3E56A 2FCSA 4KKJA 3OG5A 1XCQL 2LMCA 4ARCA 3SD5A 2MBHA 3EGRA 5FR3A 3GOEA 2W3SA 1N6ZA 2ZNVC 1PGBA 1SE2A 3W1SC 1TS2A 3Q8BA 1T0RC 2DZMA 3O65B 3P42A 3PVLA 4YSXB 1XLOA 2N7DA 4FJYA 1PFDA 2LVQA 5FK9C 3JYUA 3QQ8B 3AI5A 4DDID 3U30A 4PS3A 2VH1A 3NHEB 2Y5BB 3PGEA 1UELA 4DWFA 1WM3A 4IC7B 4OHJA 2GMIC 3Q8FA 2N7JA 4A90A 3KQ4A 2AQ3B 1S1QB 5AEKB 4OZCA 5C1ZA 2M17A 2KT7A 4EOYA 1YMHE 3VTVA 1GAQB 1OEYA 5D7GA 1J8CA 4XWTA 1IPGA 2AWTA 2Z0DB 1MI0A 2KXJA 3P4SB 3QWZB 3NZUA 4TV3A 2LRUA 3C19A 2HD5B 1WM2A 1JRUA 1ISNA 2EMSA 3DPDA 2ON8A 1IGDA 3PPAA 3ZNZB 4I6NB 3AM9A 1KFYB 1L0YB 4BKTA 4P1BC 5CHFA 4CHKA 5G2NA 2KC2A 2CS4A 5D2MB 5I4DA 1FNWA 4EE2A 1IGCA 3DOWA 4M0WA 3W1YA 1E7UA 1I4QA 3ZKJC 3DVNU 2R2QA 4MGZE 2BQQA 1NENB 1XT9B 2BYTA 3ZJVA 3GE3C 2FCNA 1GNUA 1X1MA 3DCGA 3IAS1 4E71A 1P7FA 1N61A 3TEXA 2K8HA 4XZ4A 3RD2A 1DOXA 1HXYD 1FNVA 3L13A 2W3RA 2VRRB 4YTMB 2LXAA 3AECB 2AX5A 1C9FA 3DVGY 2K25A 2GBKA 2OOBB 3JSVB 4HPMB 4C56C 4M00A 4JIOU 3IVFA 1HTOA 5FR6A 2LGSA 2L3ZA 4C7ZA 5EE9A 4DK5A 2BWES 3AMZA 2KC1A 4F8CB 2M1MA 2B3AA 4L2YA 1RAXA 2L05A 3L16A 3ZJTA 2DAFA 1JMLA 1WX9A 1K51A 3DWMA 3L17A 4HXDA 2YEPF 3R7QA 3Q14C 2D3AA 1OEYJ 1DGJA 3BIID 4G11A 2ICIA 1MFWA 4ZOHC 4RF1A 1KTKA 1HE8A 3AE8B 4OW0A 4OVZA 2I1JA 3IT6B 2AEHA 2JZZA 1WGRA 4OZBA 3ZTCA 1WF9A 2CHXA 1TS4A 3MC8A 5D3DA 3GE8C 4XYCA 2R2OA 2D5GA 3Q3JA 4XC2A 3AEEB 1GC7A 4NJCA 3DBSA 3M63B 2G4DB 3WIMA 4ANVA 3LDZE 3KWVA 3LXFA 4WJPA 4RGTA 1ZUD2 2CU3A 2QIEB 1MJDA 1JQ4A 5AZFA 2AL3A 2WU5B 2W55A 4KGRA 4J3OD 3UQBA 2ASQA 3UIPB 1ZPSA 2ONQA 1T0YA 3HRDD 1D5XC 2MBQA 1JWUD 1QOAA 3EA6A 2VZKD 3VR9B 2JX5A 4MSMB 1FPYA 3RCZA 4RGNA 1BXTA 1I4PA 2OHFA 3PTFC 4C7YA 2UU7A 3R2IA 1V1OA 2CKHB 2OEDA 5IKCM 5C23A 3JSVA 1L2NA 3BWUD 4IDIA 3MHZA 5EE3A 4G3XB 2LVOA 1FRRA 2K6QA 3U2SC 1BT0A 2FE8A 3IT4B 3RI7C 1LO5D 2GRIA 2IO1B 3AEFB 1WGHA 1R7SA 2WXIA 1WXVA 2SEBD 3JVZX 1L5PA 4FN2A 5J2RA 2MW5A 2KVRA 1VZ8A 2YEPB 4KV2A 1CJEA 5LXIB 3NVWA 2C60A 2KQ4X 3NS8A 3L54A 1ENFA 2N9EB 2FIFA 5BO4B 3MTNB 1L0XB 2WXGA 1EU4A 1SIJA 4GSWA 3BYTB 3K9PB 1J0GA 2BYVE 4G0NB 1TTNA 2CJNA 3ZIMA 1OFFA 2L83A 2KO3A 1YQ4B 4YTPB 3PZDA 1C76A 2QSDA 1QF6A 4HRSA 2BB5A 2YVCA 1VD2A 3T3NA 4RMAA 5BYQA 4DDGD 4ZDVA 4LDTD 2ZW1A 2PTLA 1KJTA 1HZ6A 3ZJUA 2KN5A 2ZVOA 4MEMA 2MSED 1JCKB 3QAQA 2NPTB 1P98A 1XF5L 2DX5B 2LGXA 2KJRA 2G4SA 1Z2MA 5D94A 4N6EB 3H8HA 3QHTA 2V3NA 3BVGA 2V0GA 5E6OA 4MACA 1TKEA 3SFDB 1I42A 2MQJA 2MHJA 1WIAA 3EHVA 1KLVA 3VUWA 1YQBA 2N4FA 3Q8AA 2OJRA 1C3TA 4DQOC 1NBFC 2O2VA 1N63A 3IHPC 3HVDA 2ACZB 4GMVA 2BKRB 1FM0D 2KX0A 4X57B 2Z8LA 4MDKE 1GB4A 4A20A 1JWAD 3ZNID 2WDQB 2ZCCA 1BMLC 1YN3A 1AARA 3W9CB 4ICUA 2G1EA 3NVYA 3VDZA 2WXMA 4S17A 2JWZA 1UNSA 1RFAA 3NVVA 2BYFA 1EWYC 1WFYA 2K1FA 1F2RI 1WX8A 2XK5A 4TQ1A 2EMTA 2WYQA 3T8MA 3NUHB 2PVOD 4NQLB 4BZAA 2KDIA 3PO0A 2M0XA 3MP9A 1WE7A 1DYQA 4RGOS 1JRPA 3B2GA 2FBWB 3ETRA 2I38A 3UIOB 1OQRA 4XDCA 3QA8A 2WNMA 5D6JB 2LI5A 3APFA 3C0RB 2D10A 2WGSA 1NYQA 2IO0B 1FFUA 2IDYA 2J4XA 4WQMA 1J7CA 3OAWA 2LEKA 4KGSA 2BKFA 5CTRC 2BYEA 2JXXA 1HTQA 5HKHA 1E8YA 4WH4A 2V4IB 4DXGA 2ZPYA 1HQRD 1TT5B 1TKGA 2IZVB 1WYGA 3I3TB 4KGTA 3IG3A 3U7ZA 1V1PA 3I9V1 1F0ZA 1WZ3A 1C1YB 5JXVA 3NS1A 2LGDA 3B2FA 4YSYB 4WAFA 2N9PC 5L83A 4K3CA 1M4VA 1PDXA 4IWOA 3HM3A 3ZQ4A 3H1UA 3H7PA 5JHBA 1A70A 2GI9A 1U4AA 5HHDG 3HK0A 4K7SA 5IP4D 1Q5WB 1TKYA 3PSEB 4HK2A 3KYDD 4FJZA 4M0WB 2JQRB 3HIZA 3A9KA 1TS3A 1R4NB 3ZDMC 1V6EA 2FCQA 3N20C 3BVMA 4GDLA 2IJ0A 2MA9B 3B1LX 4AWJA 2KK8A 3KUZA 2INPE 2CJOA 4W9HA 4MJSB 2Z0EB 3IAM1 4ZRQA 2JZPA 2KWCA 4JLCA 3PHWB 3URYA 1FCCC 3LYYA 5CHWA 1VR9A 3AE4B 2D3GA 2DAJA 3CF6E 1MG8A 3Q3MC 2QEJC 5BYSA 5GMVA 4L23A 1Q10A 2WDVB 2WDTB 4PS8A 2L0FA 1GB1A 1YIWA 1SBBB 4GB9A 4HJKA 3P4QB 2RD0A 3R8BA 1HA5A 2N1WA 2RDBC 2LGIA 2BWFA 2EKEC 4GGQA 1K50A 3JW0X 2IBIB 3VAWA 1TY2A 1VCBA 4HJGE 5JH5C 1KM7A 2JXTA 4F1SA 3UI3A 1ZE3D 4LNFA 4ZRKA 4RGMA 1F9JA 2ZJDA 3DHGC 1E90A 3DWGC 1C4PA 4AS1A 4J6IA 4FULA 4YSZB 5KHOA 1I4GA 2DZIA 4AP4C 3FILA 2PVGC 2M56B 3WAOA 4C4VB 2MP2A 1A5RA 4ANUA 3MC0B 1EO6A 2IY1B 2IO2B 2JPHA 5MPOA 3V6EB 2A4ZA 1OGWA 2KQ7A 2DENB 3PS6A 4ZHOA 4FHKA 4P1CC 5BYRA 4GLSC 1TYGB 2HTME 4B0EA 4GXBA 1P3QU 3OJ3A 3DBRB 5C3JB 1UWMA 5BMGA 2MCNB 1NI2A 3CIRB 2KZRA 1UBIA 4LNKA 3I5JC 2UWQA 4MJSA 4NY0A 3RNGC 4UDUC 2L7RA 1T6BX 4TUUA 2IO3B 2N9XA 5IAAC 1V5TA 1NEKB 3V05A 2XN9C 3GS2A 3FKYA 2INCC 1YD8U 2IGGA 4NAWB 1XLNA 2FNJB 1NI3A 5TR5A 4PT5A 1ZKHA 4BOSC 1GJZA 2PIAA 1AWDA 3ZRFA 3S2AA 2NR2A 3DBHI 3SDLC 4FA6A 3ZXVA 4K7UA 2LASA 4L1BA 1QOBA 3TL5A 4ZYNA 2D07B 2DYBA 2JRIB 3ZYYX 2D3BA 1KLGD 2K0PA 1JROA 2AYOB 2MX2A 1QT9A 1FXTB 1MHXA 4PYUA 3MFGA 3ZGZA 3N3KB 3FC4A 1EWCA 1P1AA 1V8CA 1UGJA 4IKGA 2WXPA 3PV1A 4DHZE 4XWWA 4C4VA 1SXTA 4G50A 2GOWA 3VXWA 3E9SA 1QLBB 2GBJA 4LNNA 4A55A 3M62B 3PHXB 2UYZB 2V3SA 2B76B 2MBBB 4XX5A 1VZ7A 4C00A 1TY0A 4WJOA 1SE4A 3AE2B 1WXSA 3DBLB 1UZXB 5G5HA 2WXHA 4ZYSA 4BAXA 1XLQA 4JPSA 3VTWA 2KDFB 2WX1A 3BINA 1QKZA 3EFUA 4HEA1 2KN4A 2ZW0A 4WURA 1RYJA 1E0ZA 4A9AA 2PW9A 1D5ZC 1R4MI 4C80A 3UQAA 2G3QB 3V6CB 1E8XA 4IW0A 2AQ1B 4JGHB 4D2KA 2KD0A 2QILA 3ML9A 1XO3A 3ABVB 3ZXRA 3TEZA 1NVID 2ZZPB 4NAWA 3I57A 4IUMB 4PK1A 1FXAA 4YXDB 3RNCC 3TEYA 3U8ZA 2KFJA 1V49A 3AXCA 3KUCB 5BMIA 4A3PA 1QOFA 4LLGM 4RH6A 4W9LA 2NBUA 4GDKB 1L4ZB 4IM0A 3NRZA 5CHVC 3GZNI 1WR1A 1YOVB 2K8CA 4NNJB 2HJ8A 4RM8A 2WXNA 1WXMA 2ZNVB 1B9RA 1DOIA 2O2VB 1WH3A 4HDQA 2DBYA 4RF0A 2V4LA 2Z59B 5KHQA 3CSTA 1HZ5A 1YJ1A 1KRHA 3AE7B 2LWPA 3RMKC 1MHHE 4K1RB 2I1KA 4TSSA 1YX6B 1WGYA 3L10B 3EC8A 1YN5A 3A1QA 2MJEA 1SJHD 1C78A 2M8SA 3ZUNA 5DPWA 3ZLZA 1EU3A 1SIFA 1WJNA 4MH8A 3VVWB 1MG4A 5J18A 2X38A 2XK5B 2WWZA 1ACCA 1KF6B 1TIFA 1EUVB 3B9JA 1WR6E 4H2AA 3MC9A 3ZNHB 5EE0A 2WS3B 4JE3B 2L32A 1N5WA 4K7WA 2KVZA 4K3BA 1V2YA 2JSVX 1P9DU 1LGRA 4M8NA 1E7VA 1G6JA 2M0AA 4MGYE 4I6PA 2O6VA 4AUQC 2XNAC 5J17A 4NZLB 3W5UB 3GP7A 4IWPA 3UGBB 2PKOA 1FD6A 3VRBB 1ROEA 4TQ0A 2GBRA 1B1ZA 1F52A 1WSPA 2JUOA 4WQOB 1UBQA 4NAMA 1SSNA 1C77A 2J42A 1V1PB 4JX1C 2Y3AA 2J7QB 1OQYA 2C7HA 3RPFC 2WX0A 2MJDA 2RR9A 4GDKA 1LQBA 3DVGX 1XXGA 2KAJA 3Q3FA 1L6VA 1CZPA 2N9LA 3DVNV 4RFBA 1SE3A 3P1MA 2L8JA 2JVCA 1WMHB 2DZJA 4I6LB 3H7PB 3DBRI 4MT5A 4MM3B 3ECIA 3CSFA 1M94A 1WWTA 2LD9A 3ZO5B 3SU8X 1FNUA 1RLFA 2KFKA 2QC8A 2QDFA 2OJWA 5G5GA 1ZXIA 3RT3B 3H7SA 1DOYA 3A9KB 3IBEA 4FHJA 3R66C 4JWSC 4GDLB 2JY6A 1AN8A 1FFVA 2RSUA 3NY5A 4DHJB 3ONSA 2Y5PA 4HVBA 4HPLB 4W9JA 3SHQA 2WXQA 5DCNA 4NJ7A 4HDOA 4KSLC 3R7RA 3N30A 4RM9A 1ZOYB 4S0RA 4WJNA 1WGDA 1YJJA 4IWQA 4RCOA 3T3OA 5FKAC 1F2RC 1ZP0B 4M8MA 4GU2A 3AB5A 3L08A 1KH0A 1FO4A 4WIPA 4N59A 2GBMA 2SAKA 1ET9A 2N7EA 1JWMD 2IY0B 1ZW7A 4MSQB 4R3DA 4OZAA 3WANA 3VFKA 1PUTA 4KX6B 3P4RB 2Y5CA 1XQQA 4HKZE 1SJED 2RDHA 5GXGB 1C4AA
chains in the Genus database with same CATH topology
3DWGC 3IT6B 1C4PA 5LNK1 4AS1A 2JYEA 2G9HD 4OZBA 5BMHA 1NYRA 4YSZB 3KWLA 4XDDA 2RMMA 1I4GA 4ZRPA 1TS4A 5D3DA 3FILA 2PVGC 5C2TB 2M56B 4P16A 2D5GA 3O13A 3AH7A 3AEEB 1FIQA 4NJCA 2GB1A 3MC0B 1IBXA 1JALA 2WXKA 3KWVA 3LXFA 1ZDXA 4RGTA 3AEBB 2BTEA 1AW7A 5MPOA 1ZUD2 2CU3A 5EE1A 2QIEB 1VZ6A 3FILB 4XE0A 1T5XD 1YN4A 3BK1A 2K3UA 1I4RA 2WLBA 2WXJA 3EUB2 1JQ4A 3R2TA 2WU5B 4ZHOA 5BYRA 4GLSC 1C4CA 2W55A 1TYGB 3HVZA 1VDVA 4J3OD 2K22A 2HTME 1ZPSA 4KGRA 2ONQA 4B0EA 3KLSX 4USAA 3HRDD 3PZ8A 1D5XC 1CK1A 1FCLA 1Y56A 1VLBA 2DYMA 3Q69A 5C3JB 1K52A 1I7HA 1JWUD 1UWMA 5BMGA 1E10A 2BS4B 2J52A 1WXQA 3CIRB 1QOAA 3TEWA 3EA6A 1UUPA 2VZKD 3VR9B 2TSSA 5D3IB 2JX5A 2IPKD 4UDUC 4YTNB 1T6BX 3TUOA 1GOZA 3AE9B 5H8YE 3MJ5A 1WRIA 1BXTA 1I4PA 4RGNA 2OHFA 4RNAA 2BBCA 4C7YA 3IXSA 1NEKB 3V05A 2XN9C 3R2IA 1V1OA 2OEDA 1XEEA 4N58A 3GS2A 4Q2JA 3HUIA 2IGGA 3BWUD 4IDIA 3MHZA 4NAWB 1FRDA 5EE3A 1XLNA 1E7PB 2K9XA 1JWSD 1FRRA 1NI3A 3U2SC 2WXOA 3W1SA 2LFIA 3SEBA 1N62A 2FE8A 1GPXA 3IT4B 3AEAB 3W2DA 4PT5A 1LO5D 2GRIA 1IUEA 1C79A 3AEFB 2PIAA 3Q8EA 1AWDA 2MJ3A 1RM6C 4P6VF 1QILA 1R7SA 2WXIA 2W82A 1FXIA 2DLBA 2BS3B 2SEBD 4L1BA 3VQIA 1QOBA 1L5PA 5HG2A 2LJIA 3ZYYX 4KKIA 3J9CA 1KLGD 2K0PA 1JROA 1BUIC 1I4XA 1VZ8A 2YEPB 1CJEA 2BS2B 2NTSA 1HEZE 1QT9A 1MHXA 3NVWA 2JWUA 1UWXA 3BVZA 2NMQA 3MFGA 2KQ4X 3ZGZA 2VZKB 3FC4A 1ENFA 3BK2A 1EWCA 1V8CA 1TS5A 1UGJA 4IKGA 2WXPA 2FUG1 3LB8C 3TSSA 2IGDA 4ZHPA 3NZ3A 4XWWA 3W5VB 1SXTA 4US9A 5T8IA 1L0XB 1XLPA 2WXGA 1EU4A 1SIJA 2INNE 3E9SA 1QLBB 4A55A 1WGKA 3BYTB 2JYTA 2CJNA 2KMMA 1OFFA 2B76B 2MH7A 2L1AA 2E6XA 3L4PA 2L83A 2JU6X 5HI1A 2KDMA 1D6EC 4JWUC 1YQ4B 1VZ7A 4YTPB 1OQQA 1C76A 2QSDA 1T3QA 1TY0A 1SE4A 2WU2B 3AE2B 4HRSA 2HDEA 1QOGA 1QF6A 3OWEB 1SEBD 4YWGG 2QJLA 5G5HA 1I4HA 1PGAA 2WXHA 2BB5A 4ZYSA 1P7EA 3P63A 1XLQA 3NVZA 4ITKA 4JPSA 3T3NA 2WXRA 4YT0B 3AE1B 2K5PA 1TZOA 5BYQA 1QKZA 4A6QA 4HEA1 2KN4A 2ZW0A 2RDGA 2PTLA 2ZW1A 4WURA 1RYJA 1CQVA 1VJKA 1KLUD 1HZ6A 1YJIA 3AE5B 1E0ZA 4A9AA 3ZJUA 2PLPA 2PW9A 1D5ZC 4C80A 1JCKB 2J53A 2QMTA 5AUKA 1XF5L 2AQ1B 4CQNA 1JW9D 2BT6A 1V97A 3BZDB 4D2KA 2R61A 2QILA 2V3PA 4N6EB 3VR8B 2I2YA 3H8HA 1XO3A 1FMAD 1PYWD 2V3NA 3BVGA 4HROA 2V0GA 3ABVB 1L6UA 2N0SB 3AEDB 1J7AA 3TEZA 1NVID 4MACA 5TSSA 1E9MA 3I57A 1TKEA 3SFDB 1JWBD 2WP9B 1AYFA 1FXAA 1ET6A 4YXDB 1VRAB 3FAHA 2LUMA 3TEYA 2RPVA 3P4PB 1MPEA 4US8A 1MVKA 2BW2A 5BMIA 2KWDA 1QOFA 4LLGM 3Q8AA 2AQ2B 4RH6A 4DQOC 4GDKB 1L4ZB 3U52E 1RWSA 1N63A 3HVDA 2ACZB 3AN1A 1ESFA 1N5XA 3RFZB 3NRZA 1FM0D 2Z8LA 3C8YA 4O1NA 1GB4A 4REZA 2WXNA 2WXLA 3AEGB 2EELA 1JWAD 2E3TA 1B9RA 2WDQB 1DOIA 1BMLC 1YN3A 3W9CB 2DBYA 3SR6A 2G1EA 3NVYA 4RF0A 3AE3B 4LK0M 2WXMA 1UNSA 1F77A 2WQYB 3NVVA 5E6JA 1HZ5A 4IOIE 1KRHA 3AE6B 3AE7B 1N60A 1EWYC 3PZ7A 3E56A 1MHHE 3N9YC 1F2RI 4TSSA 4KKJA 4TQ1A 1XCQL 2LMCA 1PGXA 4ARCA 1YN5A 3EGRA 2MJEA 1SJHD 5FR3A 1C78A 2W3SA 2PVOD 3NUHB 3PO0A 1PGBA 1SE2A 1EU3A 1TS2A 3MP9A 3Q8BA 3P42A 1DYQA 4MH8A 4YSXB 1XLOA 4RGOS 2X38A 1SB3C 1JRPA 1ZXHA 1PFDA 2FBWB 1ACCA 1KF6B 3B2GA 3ETRA 2I38A 2DYOA 5FK9C 1OQRA 4XDCA 3B9JA 4H2AA 4WWMA 2WNMA 5EE0A 2WS3B 4JE3B 2L32A 1N5WA 2JSVX 4HKQA 3BYYB 2N9KA 4OHJA 1NYQA 2EKIA 2WDRB 4ARIA 1FFUA 2IDYA 2J4XA 2N7JA 3Q8FA 4WQMA 4A90A 1J7CA 1E6EB 1QQRA 3KQ4A 2AQ3B 2LEKA 4KGSA 4AQ7A 2M0AA 4DXFA 4OZCA 2L52A 2XNAC 3SFEB 2MEKA 4WH4A 2V4IB 1YMHE 2W54A 4NZLB 3W5UB 4DXGA 1YQ3B 3GP7A 1GAQB 1HQRD 5D7GA 2PKOA 4XWTA 1TKGA 1FD6A 1WYGA 3VRBB 2BB6A 1ROEA 4KGTA 3U7ZA 1MI0A 4TQ0A 1V1PA 3I9V1 3P4SB 1F0ZA 1B1ZA 5JXVA 1WSPA 3NS1A 5H92C 1L4DB 2ON8A 1IGDA 3B2FA 4NAMA 2IGHA 2LHDA 3AM9A 1KFYB 4WAFA 1SSNA 4YSYB 1C77A 1L0YB 2J42A 1STEA 1V1PB 1M4VA 3VRAB 1PDXA 4JX1C 2Y3AA 5I4DA 1FNWA 1YNTE 1IGCA 3RPFC 4EE2A 1IBXB 2MJDA 3ZQ4A 4M0WA 3V3XA 1D5MC 1I4QA 1A70A 3U4EG 2DWQA 2GI9A 1NENB 2BYTA 3ZJVA 1XXGA 1SF0A 2KAJA 1L6VA 1CZPA 5HHDG 2N9LA 4RFBA 1SE3A 3P1MA 1TKYA 1L0VB 3IAS1 1XCTL 2PMVA 2JQRB 3CWIA 5HFYA 1RFKA 1P7FA 1N61A 4MT5A 3AV8A 4MM3B 3TEXA 1TS3A 1WWTA 3WCQA 3BVMA 1DOXA 1FNUA 2IJ0A 1HXYD 1D4BA 1K53A 1FNVA 2INPE 2W3RA 2CJOA 2WXFA 5G5GA 4YTMB 1ZXIA 3AECB 1DOYA 3IAM1 2AX5A 4ZRQA 2JZPA 1C9FA 4JWSC 3URYA 4GDLB 1FCCC 1ZDVA 3LYYA 1VR9A 3AE4B 1AN8A 1FFVA 3GB1A 1TJEA 4C56C 2Y5PA 2QEJC 2WXQA 5BYSA 4FXCA 4L23A 1J7BA 1Q10A 2WDVB 4B0MA 4C7ZA 5EE9A 1GB1A 1SBBB 3AMZA 2H88B 4A8XC 1ZOYB 2Q5WD 3P4QB 1EM7A 1YJJA 4RCOA 3R8BA 3T3OA 5FKAC 4L2YA 1F2RC 1HA5A 4LTUA 1ZP0B 2KACA 2LGIA 2LHEA 1FEHA 3AB5A 1JMLA 3ZJTA 1K50A 3DWMA 1K51A 1KH0A 3Q8CA 1FO4A 4WIPA 1TY2A 4N59A 5AUIA 2YEPF 4HJGE 2SAKA 1ET9A 4TMAB 1DGJA 3BIID 1JWMD 2ICIA 2JXTA 4R3DA 4OZAA 2NTTA 4ZOHC 2H89B 1ZE3D 3UI3A 4RF1A 1KTKA 1PUTA 4KX6B 3P4RB 2Y5CA 4RGMA 3AE8B 4HKZE 1SJED 2M19A 2RDHA 4OW0A 4OVZA 5GXGB 1C4AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K0P A;  4OZB A;  5BMH A;  1HEZ E;  1MHX A;  2RMM A;  1YNT E;  1IGC A;  2JWU A;  1UWX A;  2IGH A;  1IBX B;  2NMQ A;  3FIL A;  2KQ4 X;  3V3X A;  1GB4 A;  2GI9 A;  2EEL A;  2GB1 A;  5HHD G;  2N9L A;  1IBX A;  4IKG A;  2IGD A;  1XCT L;  3FIL B;  5HFY A;  1HZ5 A;  4IOI E;  1P7F A;  1MHH E;  1F2R I;  4GLS C;  4KGR A;  1XCQ L;  1D4B A;  1K53 A;  1PGX A;  2ONQ A;  5HI1 A;  2JU6 X;  2KDM A;  1FCL A;  1PGB A;  2QSD A;  3MP9 A;  2JZP A;  1K52 A;  5BMG A;  1C9F A;  2J52 A;  1FCC C;  1ZXH A;  1PGA A;  2I38 A;  1P7E A;  3GB1 A;  1QKZ A;  2KN4 A;  2ZW0 A;  2ZW1 A;  2PTL A;  1Q10 A;  1HZ6 A;  2OED A;  2PLP A;  2PW9 A;  2JSV X;  2J53 A;  2QMT A;  2IGG A;  1GB1 A;  2N9K A;  1XF5 L;  2N7J A;  4KGS A;  4D2K A;  1EM7 A;  4OZC A;  2I2Y A;  1F2R C;  2KAC A;  4WH4 A;  2LGI A;  1YMH E;  2LHE A;  1JML A;  1K50 A;  1K51 A;  1KH0 A;  4MAC A;  4HJG E;  1FD6 A;  4KGT A;  1MI0 A;  2JXT A;  2LUM A;  2RPV A;  4OZA A;  1MPE A;  3UI3 A;  1MVK A;  5JXV A;  4HKZ E;  5HG2 A;  5BMI A;  2KWD A;  2ON8 A;  1IGD A;  2LHD A; 
#chains in the Genus database with same CATH topology
 5LNK 1;  2G9H D;  2JZ3 B;  2KJ6 A;  2DNF A;  3KWL A;  4XDD A;  2RMM A;  1WJU A;  4WWP A;  2BPS A;  3O13 A;  1Q1O A;  2JT4 B;  2NBV B;  3APC A;  2GB1 A;  2WXK A;  2C9W B;  1AW7 A;  3PT2 B;  3FIL B;  2M4N A;  4HCP B;  2J0J A;  2W9N A;  3DBL I;  2MP2 B;  1YN4 A;  3EUB 2;  2K3U A;  2WXJ A;  1C4C A;  1WMH A;  4NPN A;  3PZ8 A;  2CHZ A;  1CK1 A;  4MM3 A;  4HCN B;  4OVV A;  1FCL A;  3WA0 A;  1Y56 A;  1VLB A;  2DYM A;  1V86 A;  4BKS A;  5L95 C;  4QAY A;  2BS4 B;  1E10 A;  3TEW A;  2ZPN A;  1UUP A;  2LRW A;  4WWN A;  4KIK A;  2TSS A;  5D3I B;  2IPK D;  3P2B A;  4YTN B;  1E8Z A;  1GOZ A;  3AE9 B;  5H8Y E;  2PPH A;  3MJ5 A;  1WRI A;  4EZL A;  4W9F A;  3IXS A;  2ZCB A;  2V1Y A;  3PLV A;  2GBN A;  3PRM B;  3PRE A;  3HUI A;  1FRD A;  3QX1 A;  1E7P B;  5JZE B;  4A3O A;  5JHA A;  2K9X A;  2WXO A;  2GLS A;  3SEB A;  3TIX A;  3B0A A;  1GPX A;  1PQS A;  4FJV B;  3AEA B;  5IO9 A;  3W2D A;  1IP9 A;  1C79 A;  4B95 A;  3Q8E A;  5IN7 A;  4B9K A;  4WWO A;  1QIL A;  3KW5 B;  4II3 B;  3KYC D;  2LXC A;  5HG2 A;  4LDT B;  2LJI A;  3KVF B;  4KKI A;  3J9C A;  5DPR A;  2A5U A;  2NTS A;  4EKU A;  1KOT A;  1HEZ E;  1UGM A;  4W9I A;  2NMQ A;  2KNB A;  3ZTD A;  4BBN C;  1SGH A;  4E74 A;  3U7D A;  4WAA A;  4LCD E;  3LB8 C;  3RNB C;  2IGD A;  1WYW B;  3W5V B;  1EF1 A;  2X8X X;  1XLP A;  1J19 A;  3D32 A;  2INN E;  2KTR A;  4KDL B;  5AZG A;  3B08 A;  2JYT A;  2KDE B;  5G55 A;  4EZK A;  2MH7 A;  2L1A A;  2JU6 X;  2KDM A;  1D6E C;  4JWU C;  1OQQ A;  1WZ0 A;  2HDE A;  1QOG A;  4IM2 A;  4HLE A;  4YWG G;  2QJL A;  1PGA A;  4K81 A;  1P7E A;  3NVZ A;  4ASW C;  3ZNG C;  1LM8 B;  2K5P A;  4OVU A;  2RDG A;  1VJK A;  1P0R A;  1YJI A;  2PLP A;  5DPS A;  3Q3O C;  3T9L A;  2KQS A;  3RN9 C;  5AUK A;  4CQN A;  3DQV A;  1V97 A;  3BZD B;  4MGK E;  3QCA A;  2R61 A;  3VR8 B;  2I2Y A;  3TJP A;  1FMA D;  4ZRI A;  2N0S B;  1J7A A;  2BF8 B;  1CMX B;  5TSS A;  1JWB D;  2WP9 B;  1ET6 A;  2HTH A;  2JRH A;  2RPV A;  2ZEQ A;  1MPE A;  3K9O B;  4ANW A;  1MVK A;  3RUL A;  3NG0 A;  3U52 E;  4EEW A;  4JQW C;  3A4R A;  3WAM A;  3OLM D;  1RWS A;  4ANX A;  1ESF A;  2MLB A;  4BKG A;  4DHZ B;  4F7Z A;  4O1N A;  4REZ A;  4KZC A;  2EEL A;  2E3T A;  4GN1 A;  3V61 A;  2BVC A;  4ICV A;  4LK0 M;  1F77 A;  2WQY B;  3KH0 A;  3H9D A;  3AU4 A;  1GC6 A;  1D3Z A;  3ENE A;  1OTR B;  3N9Y C;  4BVU C;  3APD A;  3M95 A;  1PGX A;  4BBN F;  4E3C A;  1RRB A;  2C5L C;  3Q6B A;  1SB3 C;  3TCA A;  1ZXH A;  4FAD A;  2DYO A;  2DZK A;  3A1Q B;  2KOX A;  4N9F 4;  1K8R B;  4WWM A;  3VHT C;  2AL6 A;  4KZ0 A;  4FLH A;  2KX3 A;  1UD7 A;  3RNA C;  3N1Y C;  4HKQ A;  3BYY B;  2N9K A;  3V60 A;  2EKI A;  4ARI A;  2WDR B;  4II2 B;  5LLI A;  4AQ7 A;  1QQR A;  1E6E B;  4BKS D;  3MJW A;  4DXF A;  2L52 A;  1NDD A;  2N1V A;  3DHH C;  3SFE B;  2MEK A;  2KAN A;  2W54 A;  4M02 A;  5E6P A;  1YQ3 B;  3QK0 A;  3KUD B;  1LXD A;  3ZVV A;  2BB6 A;  3HHM A;  2KWV B;  2RPQ A;  2O6V B;  3M3J A;  4ACF A;  5H92 C;  4DHJ D;  1LFD A;  1L4D B;  2KLG A;  1YX5 B;  2KMC A;  2IGH A;  2LHD A;  2KDB A;  2KWU B;  1Y8R C;  1STE A;  2LUE A;  3VRA B;  3EEC A;  2LVP A;  4B6W A;  1YNT E;  4W9G A;  2FCM A;  1IBX B;  3VH3 B;  3N1X C;  2KYW A;  3V3X A;  1D5M C;  2K8B A;  3U4E G;  2DWQ A;  1I35 A;  2MRP A;  3RNF C;  4LNO A;  1XD3 B;  1SF0 A;  2JF5 A;  2KHW B;  1L0V B;  2J0K A;  4LJP B;  1XCT L;  3AU5 A;  2PMV A;  3CWI A;  5HFY A;  1RFK A;  2C7M B;  3AV8 A;  2KKC A;  3WCQ A;  1D4B A;  1K53 A;  4PS7 A;  4IM3 A;  3LJ3 A;  2WXF A;  5IOI A;  4CYE A;  1R4N I;  2KTF A;  3DDC B;  2KJH B;  3EFC A;  1ZDV A;  2KFK B;  2CHW A;  2NS5 A;  2NVU I;  3GB1 A;  1TJE A;  3NOB A;  4W9D A;  4FXC A;  1J7B A;  3V62 A;  4B0M A;  4LNI A;  2IND C;  1Z5S B;  2H88 B;  4A8X C;  2Q5W D;  1EM7 A;  3PRP B;  4MH0 E;  1EF5 A;  4LTU A;  2KAC A;  4URK A;  2NCN A;  2LHE A;  4LJO B;  1FEH A;  3Q8C A;  5EDS A;  3DHI C;  5AUI A;  4HWI B;  1E5W A;  4TMA B;  2HJ1 A;  4GIV A;  2LZ6 A;  1T0S C;  2NTT A;  4EUT A;  2H89 B;  2K39 A;  3PLU A;  2G45 B;  1GUA B;  2M19 A;  4MEL A;  2D2Q A;  1Q0W B;  2JYE A;  5BMH A;  1NYR A;  2IYD B;  4ZRP A;  1WE6 A;  5C2T B;  2YLM A;  3QIJ A;  4P16 A;  3AH7 A;  2L0T A;  1FIQ A;  2MBE A;  1IBX A;  1JAL A;  4WJQ A;  5DPT A;  1ZDX A;  3AEB B;  2BTE A;  2RGF A;  3QJZ A;  5EE1 A;  1VZ6 A;  2REX A;  3A4S C;  4GOC A;  3A9J B;  4XE0 A;  1T5X D;  3BK1 A;  2WLB A;  1I4R A;  3R2T A;  3RZF A;  1QZE A;  2FID A;  3HVZ A;  1VDV A;  2K22 A;  3WAP A;  3KLS X;  4USA A;  5AZH A;  3Q69 A;  1K52 A;  1I7H A;  3ZDT A;  1E8W A;  2J52 A;  1WXQ A;  4EFO A;  3Q3N C;  2L76 A;  3TUO A;  3MHS D;  4TKN A;  4RNA A;  2BBC A;  3VTU A;  1TBE A;  1V80 A;  1WRD B;  4NQK E;  4W9K A;  1WY8 A;  1XEE A;  4N58 A;  3UF8 A;  4Q2J A;  2KMA A;  4JL9 A;  4KIK B;  4BFR A;  4BOZ B;  1F1H A;  3AUL A;  4HPP A;  3BY4 B;  1JWS D;  3W1S A;  1ZGU B;  2LFI A;  3DBH B;  1N62 A;  3N32 A;  3WAL A;  3UIN B;  1IUE A;  2CU1 A;  2MJ3 A;  1RM6 C;  3Q2A C;  4P6V F;  2W82 A;  4IG7 B;  3NJT A;  1FXI A;  2DLB A;  2KLC A;  1UH6 A;  2BS3 B;  1WXA A;  3VQI A;  3TMP B;  4P7I A;  2XEW A;  3X23 A;  4ZRJ A;  4AOF A;  1BUI C;  1I4X A;  1S3S G;  2J0M A;  2BS2 B;  2MBO A;  2JWU A;  1UWX A;  3BVZ A;  2L00 B;  2VZK B;  1H4R A;  1SE9 A;  2QCZ A;  3PRZ A;  4PYZ A;  3RZW C;  3BK2 A;  4MGI E;  2CR5 A;  1H8C A;  1TS5 A;  3NZS A;  4FBJ B;  2FUG 1;  3QAR A;  4ZHP A;  3TSS A;  3NZ3 A;  3RUI B;  2K6D B;  2MWS B;  3N1Z C;  4US9 A;  4DXA B;  3H6N A;  5T8I A;  4YL8 A;  2VH2 A;  1UF0 A;  2NBW B;  1WGK A;  2QHO A;  2ZVN A;  3ZW3 A;  1T0Q C;  3I63 C;  3QC8 B;  2KMM A;  4EZJ A;  3A9J A;  1L7Y A;  5E6N A;  3IFW B;  2E6X A;  3L4P A;  2DHZ A;  5HI1 A;  1T3Q A;  2WU2 B;  3R3M A;  2KTR B;  3OWE B;  2V9H A;  1SEB D;  1I4H A;  2NPT A;  1V5O A;  4W9C A;  3P63 A;  4KSK C;  4ITK A;  3OJ4 B;  1R4M B;  2WXR A;  3AE1 B;  4YT0 B;  2D11 A;  1TZO A;  3CMM B;  4A6Q A;  1CQV A;  1KLU D;  3AE5 B;  1IYF A;  2J53 A;  2QMT A;  4KDI C;  1JW9 D;  2BT6 A;  4AJY B;  2D3C A;  4W9E A;  2V3P A;  4AJW A;  1WX7 A;  2LJ5 A;  1PYW D;  4HRO A;  3AED B;  1L6U A;  2PEA A;  1WGG A;  1WI0 A;  1E9M A;  3HM6 X;  2FAZ A;  1AYF A;  2BGF A;  1WJ6 A;  1VRA B;  1V9J A;  3FAH A;  2LUM A;  3A33 B;  3P4P B;  1GG3 A;  2PE6 B;  3TBL D;  4US8 A;  1V81 A;  2BW2 A;  4M01 A;  2KWD A;  3GZN B;  2AQ2 B;  3RNE C;  3VUX A;  3X0W A;  3AN1 A;  1N5X A;  3RFZ B;  1TGZ B;  2WHI A;  3ZRC A;  5IA7 A;  3C8Y A;  5CX3 A;  2WXL A;  3AEG B;  1WJ4 A;  2XBB C;  2LGY A;  2PJH A;  4KVG B;  3L0W B;  2PE9 A;  3ALB A;  3RYT A;  2FUH B;  3SR6 A;  2C7N B;  1TZ1 A;  3ML8 A;  2HE7 A;  3AE3 B;  5LXH A;  4DBG A;  3VH4 B;  4CO7 A;  4XGA B;  5E6J A;  4IOI E;  4NJ6 A;  3VUY A;  3AE6 B;  2O6V D;  1N60 A;  3PZ7 A;  3E56 A;  2FCS A;  4KKJ A;  3OG5 A;  1XCQ L;  2LMC A;  4ARC A;  3SD5 A;  2MBH A;  3EGR A;  5FR3 A;  3GOE A;  2W3S A;  1N6Z A;  2ZNV C;  1PGB A;  1SE2 A;  3W1S C;  1TS2 A;  3Q8B A;  1T0R C;  2DZM A;  3O65 B;  3P42 A;  3PVL A;  4YSX B;  1XLO A;  2N7D A;  4FJY A;  1PFD A;  2LVQ A;  5FK9 C;  3JYU A;  3QQ8 B;  3AI5 A;  4DDI D;  3U30 A;  4PS3 A;  2VH1 A;  3NHE B;  2Y5B B;  3PGE A;  1UEL A;  4DWF A;  1WM3 A;  4IC7 B;  4OHJ A;  2GMI C;  3Q8F A;  2N7J A;  4A90 A;  3KQ4 A;  2AQ3 B;  1S1Q B;  5AEK B;  4OZC A;  5C1Z A;  2M17 A;  2KT7 A;  4EOY A;  1YMH E;  3VTV A;  1GAQ B;  1OEY A;  5D7G A;  1J8C A;  4XWT A;  1IPG A;  2AWT A;  2Z0D B;  1MI0 A;  2KXJ A;  3P4S B;  3QWZ B;  3NZU A;  4TV3 A;  2LRU A;  3C19 A;  2HD5 B;  1WM2 A;  1JRU A;  1ISN A;  2EMS A;  3DPD A;  2ON8 A;  1IGD A;  3PPA A;  3ZNZ B;  4I6N B;  3AM9 A;  1KFY B;  1L0Y B;  4BKT A;  4P1B C;  5CHF A;  4CHK A;  5G2N A;  2KC2 A;  2CS4 A;  5D2M B;  5I4D A;  1FNW A;  4EE2 A;  1IGC A;  3DOW A;  4M0W A;  3W1Y A;  1E7U A;  1I4Q A;  3ZKJ C;  3DVN U;  2R2Q A;  4MGZ E;  2BQQ A;  1NEN B;  1XT9 B;  2BYT A;  3ZJV A;  3GE3 C;  2FCN A;  1GNU A;  1X1M A;  3DCG A;  3IAS 1;  4E71 A;  1P7F A;  1N61 A;  3TEX A;  2K8H A;  4XZ4 A;  3RD2 A;  1DOX A;  1HXY D;  1FNV A;  3L13 A;  2W3R A;  2VRR B;  4YTM B;  2LXA A;  3AEC B;  2AX5 A;  1C9F A;  3DVG Y;  2K25 A;  2GBK A;  2OOB B;  3JSV B;  4HPM B;  4C56 C;  4M00 A;  4JIO U;  3IVF A;  1HTO A;  5FR6 A;  2LGS A;  2L3Z A;  4C7Z A;  5EE9 A;  4DK5 A;  2BWE S;  3AMZ A;  2KC1 A;  4F8C B;  2M1M A;  2B3A A;  4L2Y A;  1RAX A;  2L05 A;  3L16 A;  3ZJT A;  2DAF A;  1JML A;  1WX9 A;  1K51 A;  3DWM A;  3L17 A;  4HXD A;  2YEP F;  3R7Q A;  3Q14 C;  2D3A A;  1OEY J;  1DGJ A;  3BII D;  4G11 A;  2ICI A;  1MFW A;  4ZOH C;  4RF1 A;  1KTK A;  1HE8 A;  3AE8 B;  4OW0 A;  4OVZ A;  2I1J A;  3IT6 B;  2AEH A;  2JZZ A;  1WGR A;  4OZB A;  3ZTC A;  1WF9 A;  2CHX A;  1TS4 A;  3MC8 A;  5D3D A;  3GE8 C;  4XYC A;  2R2O A;  2D5G A;  3Q3J A;  4XC2 A;  3AEE B;  1GC7 A;  4NJC A;  3DBS A;  3M63 B;  2G4D B;  3WIM A;  4ANV A;  3LDZ E;  3KWV A;  3LXF A;  4WJP A;  4RGT A;  1ZUD 2;  2CU3 A;  2QIE B;  1MJD A;  1JQ4 A;  5AZF A;  2AL3 A;  2WU5 B;  2W55 A;  4KGR A;  4J3O D;  3UQB A;  2ASQ A;  3UIP B;  1ZPS A;  2ONQ A;  1T0Y A;  3HRD D;  1D5X C;  2MBQ A;  1JWU D;  1QOA A;  3EA6 A;  2VZK D;  3VR9 B;  2JX5 A;  4MSM B;  1FPY A;  3RCZ A;  4RGN A;  1BXT A;  1I4P A;  2OHF A;  3PTF C;  4C7Y A;  2UU7 A;  3R2I A;  1V1O A;  2CKH B;  2OED A;  5IKC M;  5C23 A;  3JSV A;  1L2N A;  3BWU D;  4IDI A;  3MHZ A;  5EE3 A;  4G3X B;  2LVO A;  1FRR A;  2K6Q A;  3U2S C;  1BT0 A;  2FE8 A;  3IT4 B;  3RI7 C;  1LO5 D;  2GRI A;  2IO1 B;  3AEF B;  1WGH A;  1R7S A;  2WXI A;  1WXV A;  2SEB D;  3JVZ X;  1L5P A;  4FN2 A;  5J2R A;  2MW5 A;  2KVR A;  1VZ8 A;  2YEP B;  4KV2 A;  1CJE A;  5LXI B;  3NVW A;  2C60 A;  2KQ4 X;  3NS8 A;  3L54 A;  1ENF A;  2N9E B;  2FIF A;  5BO4 B;  3MTN B;  1L0X B;  2WXG A;  1EU4 A;  1SIJ A;  4GSW A;  3BYT B;  3K9P B;  1J0G A;  2BYV E;  4G0N B;  1TTN A;  2CJN A;  3ZIM A;  1OFF A;  2L83 A;  2KO3 A;  1YQ4 B;  4YTP B;  3PZD A;  1C76 A;  2QSD A;  1QF6 A;  4HRS A;  2BB5 A;  2YVC A;  1VD2 A;  3T3N A;  4RMA A;  5BYQ A;  4DDG D;  4ZDV A;  4LDT D;  2ZW1 A;  2PTL A;  1KJT A;  1HZ6 A;  3ZJU A;  2KN5 A;  2ZVO A;  4MEM A;  2MSE D;  1JCK B;  3QAQ A;  2NPT B;  1P98 A;  1XF5 L;  2DX5 B;  2LGX A;  2KJR A;  2G4S A;  1Z2M A;  5D94 A;  4N6E B;  3H8H A;  3QHT A;  2V3N A;  3BVG A;  2V0G A;  5E6O A;  4MAC A;  1TKE A;  3SFD B;  1I42 A;  2MQJ A;  2MHJ A;  1WIA A;  3EHV A;  1KLV A;  3VUW A;  1YQB A;  2N4F A;  3Q8A A;  2OJR A;  1C3T A;  4DQO C;  1NBF C;  2O2V A;  1N63 A;  3IHP C;  3HVD A;  2ACZ B;  4GMV A;  2BKR B;  1FM0 D;  2KX0 A;  4X57 B;  2Z8L A;  4MDK E;  1GB4 A;  4A20 A;  1JWA D;  3ZNI D;  2WDQ B;  2ZCC A;  1BML C;  1YN3 A;  1AAR A;  3W9C B;  4ICU A;  2G1E A;  3NVY A;  3VDZ A;  2WXM A;  4S17 A;  2JWZ A;  1UNS A;  1RFA A;  3NVV A;  2BYF A;  1EWY C;  1WFY A;  2K1F A;  1F2R I;  1WX8 A;  2XK5 A;  4TQ1 A;  2EMT A;  2WYQ A;  3T8M A;  3NUH B;  2PVO D;  4NQL B;  4BZA A;  2KDI A;  3PO0 A;  2M0X A;  3MP9 A;  1WE7 A;  1DYQ A;  4RGO S;  1JRP A;  3B2G A;  2FBW B;  3ETR A;  2I38 A;  3UIO B;  1OQR A;  4XDC A;  3QA8 A;  2WNM A;  5D6J B;  2LI5 A;  3APF A;  3C0R B;  2D10 A;  2WGS A;  1NYQ A;  2IO0 B;  1FFU A;  2IDY A;  2J4X A;  4WQM A;  1J7C A;  3OAW A;  2LEK A;  4KGS A;  2BKF A;  5CTR C;  2BYE A;  2JXX A;  1HTQ A;  5HKH A;  1E8Y A;  4WH4 A;  2V4I B;  4DXG A;  2ZPY A;  1HQR D;  1TT5 B;  1TKG A;  2IZV B;  1WYG A;  3I3T B;  4KGT A;  3IG3 A;  3U7Z A;  1V1P A;  3I9V 1;  1F0Z A;  1WZ3 A;  1C1Y B;  5JXV A;  3NS1 A;  2LGD A;  3B2F A;  4YSY B;  4WAF A;  2N9P C;  5L83 A;  4K3C A;  1M4V A;  1PDX A;  4IWO A;  3HM3 A;  3ZQ4 A;  3H1U A;  3H7P A;  5JHB A;  1A70 A;  2GI9 A;  1U4A A;  5HHD G;  3HK0 A;  4K7S A;  5IP4 D;  1Q5W B;  1TKY A;  3PSE B;  4HK2 A;  3KYD D;  4FJZ A;  4M0W B;  2JQR B;  3HIZ A;  3A9K A;  1TS3 A;  1R4N B;  3ZDM C;  1V6E A;  2FCQ A;  3N20 C;  3BVM A;  4GDL A;  2IJ0 A;  2MA9 B;  3B1L X;  4AWJ A;  2KK8 A;  3KUZ A;  2INP E;  2CJO A;  4W9H A;  4MJS B;  2Z0E B;  3IAM 1;  4ZRQ A;  2JZP A;  2KWC A;  4JLC A;  3PHW B;  3URY A;  1FCC C;  3LYY A;  5CHW A;  1VR9 A;  3AE4 B;  2D3G A;  2DAJ A;  3CF6 E;  1MG8 A;  3Q3M C;  2QEJ C;  5BYS A;  5GMV A;  4L23 A;  1Q10 A;  2WDV B;  2WDT B;  4PS8 A;  2L0F A;  1GB1 A;  1YIW A;  1SBB B;  4GB9 A;  4HJK A;  3P4Q B;  2RD0 A;  3R8B A;  1HA5 A;  2N1W A;  2RDB C;  2LGI A;  2BWF A;  2EKE C;  4GGQ A;  1K50 A;  3JW0 X;  2IBI B;  3VAW A;  1TY2 A;  1VCB A;  4HJG E;  5JH5 C;  1KM7 A;  2JXT A;  4F1S A;  3UI3 A;  1ZE3 D;  4LNF A;  4ZRK A;  4RGM A;  1F9J A;  2ZJD A;  3DHG C;  1E90 A;  3DWG C;  1C4P A;  4AS1 A;  4J6I A;  4FUL A;  4YSZ B;  5KHO A;  1I4G A;  2DZI A;  4AP4 C;  3FIL A;  2PVG C;  2M56 B;  3WAO A;  4C4V B;  2MP2 A;  1A5R A;  4ANU A;  3MC0 B;  1EO6 A;  2IY1 B;  2IO2 B;  2JPH A;  5MPO A;  3V6E B;  2A4Z A;  1OGW A;  2KQ7 A;  2DEN B;  3PS6 A;  4ZHO A;  4FHK A;  4P1C C;  5BYR A;  4GLS C;  1TYG B;  2HTM E;  4B0E A;  4GXB A;  1P3Q U;  3OJ3 A;  3DBR B;  5C3J B;  1UWM A;  5BMG A;  2MCN B;  1NI2 A;  3CIR B;  2KZR A;  1UBI A;  4LNK A;  3I5J C;  2UWQ A;  4MJS A;  4NY0 A;  3RNG C;  4UDU C;  2L7R A;  1T6B X;  4TUU A;  2IO3 B;  2N9X A;  5IAA C;  1V5T A;  1NEK B;  3V05 A;  2XN9 C;  3GS2 A;  3FKY A;  2INC C;  1YD8 U;  2IGG A;  4NAW B;  1XLN A;  2FNJ B;  1NI3 A;  5TR5 A;  4PT5 A;  1ZKH A;  4BOS C;  1GJZ A;  2PIA A;  1AWD A;  3ZRF A;  3S2A A;  2NR2 A;  3DBH I;  3SDL C;  4FA6 A;  3ZXV A;  4K7U A;  2LAS A;  4L1B A;  1QOB A;  3TL5 A;  4ZYN A;  2D07 B;  2DYB A;  2JRI B;  3ZYY X;  2D3B A;  1KLG D;  2K0P A;  1JRO A;  2AYO B;  2MX2 A;  1QT9 A;  1FXT B;  1MHX A;  4PYU A;  3MFG A;  3ZGZ A;  3N3K B;  3FC4 A;  1EWC A;  1P1A A;  1V8C A;  1UGJ A;  4IKG A;  2WXP A;  3PV1 A;  4DHZ E;  4XWW A;  4C4V A;  1SXT A;  4G50 A;  2GOW A;  3VXW A;  3E9S A;  1QLB B;  2GBJ A;  4LNN A;  4A55 A;  3M62 B;  3PHX B;  2UYZ B;  2V3S A;  2B76 B;  2MBB B;  4XX5 A;  1VZ7 A;  4C00 A;  1TY0 A;  4WJO A;  1SE4 A;  3AE2 B;  1WXS A;  3DBL B;  1UZX B;  5G5H A;  2WXH A;  4ZYS A;  4BAX A;  1XLQ A;  4JPS A;  3VTW A;  2KDF B;  2WX1 A;  3BIN A;  1QKZ A;  3EFU A;  4HEA 1;  2KN4 A;  2ZW0 A;  4WUR A;  1RYJ A;  1E0Z A;  4A9A A;  2PW9 A;  1D5Z C;  1R4M I;  4C80 A;  3UQA A;  2G3Q B;  3V6C B;  1E8X A;  4IW0 A;  2AQ1 B;  4JGH B;  4D2K A;  2KD0 A;  2QIL A;  3ML9 A;  1XO3 A;  3ABV B;  3ZXR A;  3TEZ A;  1NVI D;  2ZZP B;  4NAW A;  3I57 A;  4IUM B;  4PK1 A;  1FXA A;  4YXD B;  3RNC C;  3TEY A;  3U8Z A;  2KFJ A;  1V49 A;  3AXC A;  3KUC B;  5BMI A;  4A3P A;  1QOF A;  4LLG M;  4RH6 A;  4W9L A;  2NBU A;  4GDK B;  1L4Z B;  4IM0 A;  3NRZ A;  5CHV C;  3GZN I;  1WR1 A;  1YOV B;  2K8C A;  4NNJ B;  2HJ8 A;  4RM8 A;  2WXN A;  1WXM A;  2ZNV B;  1B9R A;  1DOI A;  2O2V B;  1WH3 A;  4HDQ A;  2DBY A;  4RF0 A;  2V4L A;  2Z59 B;  5KHQ A;  3CST A;  1HZ5 A;  1YJ1 A;  1KRH A;  3AE7 B;  2LWP A;  3RMK C;  1MHH E;  4K1R B;  2I1K A;  4TSS A;  1YX6 B;  1WGY A;  3L10 B;  3EC8 A;  1YN5 A;  3A1Q A;  2MJE A;  1SJH D;  1C78 A;  2M8S A;  3ZUN A;  5DPW A;  3ZLZ A;  1EU3 A;  1SIF A;  1WJN A;  4MH8 A;  3VVW B;  1MG4 A;  5J18 A;  2X38 A;  2XK5 B;  2WWZ A;  1ACC A;  1KF6 B;  1TIF A;  1EUV B;  3B9J A;  1WR6 E;  4H2A A;  3MC9 A;  3ZNH B;  5EE0 A;  2WS3 B;  4JE3 B;  2L32 A;  1N5W A;  4K7W A;  2KVZ A;  4K3B A;  1V2Y A;  2JSV X;  1P9D U;  1LGR A;  4M8N A;  1E7V A;  1G6J A;  2M0A A;  4MGY E;  4I6P A;  2O6V A;  4AUQ C;  2XNA C;  5J17 A;  4NZL B;  3W5U B;  3GP7 A;  4IWP A;  3UGB B;  2PKO A;  1FD6 A;  3VRB B;  1ROE A;  4TQ0 A;  2GBR A;  1B1Z A;  1F52 A;  1WSP A;  2JUO A;  4WQO B;  1UBQ A;  4NAM A;  1SSN A;  1C77 A;  2J42 A;  1V1P B;  4JX1 C;  2Y3A A;  2J7Q B;  1OQY A;  2C7H A;  3RPF C;  2WX0 A;  2MJD A;  2RR9 A;  4GDK A;  1LQB A;  3DVG X;  1XXG A;  2KAJ A;  3Q3F A;  1L6V A;  1CZP A;  2N9L A;  3DVN V;  4RFB A;  1SE3 A;  3P1M A;  2L8J A;  2JVC A;  1WMH B;  2DZJ A;  4I6L B;  3H7P B;  3DBR I;  4MT5 A;  4MM3 B;  3ECI A;  3CSF A;  1M94 A;  1WWT A;  2LD9 A;  3ZO5 B;  3SU8 X;  1FNU A;  1RLF A;  2KFK A;  2QC8 A;  2QDF A;  2OJW A;  5G5G A;  1ZXI A;  3RT3 B;  3H7S A;  1DOY A;  3A9K B;  3IBE A;  4FHJ A;  3R66 C;  4JWS C;  4GDL B;  2JY6 A;  1AN8 A;  1FFV A;  2RSU A;  3NY5 A;  4DHJ B;  3ONS A;  2Y5P A;  4HVB A;  4HPL B;  4W9J A;  3SHQ A;  2WXQ A;  5DCN A;  4NJ7 A;  4HDO A;  4KSL C;  3R7R A;  3N30 A;  4RM9 A;  1ZOY B;  4S0R A;  4WJN A;  1WGD A;  1YJJ A;  4IWQ A;  4RCO A;  3T3O A;  5FKA C;  1F2R C;  1ZP0 B;  4M8M A;  4GU2 A;  3AB5 A;  3L08 A;  1KH0 A;  1FO4 A;  4WIP A;  4N59 A;  2GBM A;  2SAK A;  1ET9 A;  2N7E A;  1JWM D;  2IY0 B;  1ZW7 A;  4MSQ B;  4R3D A;  4OZA A;  3WAN A;  3VFK A;  1PUT A;  4KX6 B;  3P4R B;  2Y5C A;  1XQQ A;  4HKZ E;  1SJE D;  2RDH A;  5GXG B;  1C4A A; 
#chains in the Genus database with same CATH homology
 3DWG C;  3IT6 B;  1C4P A;  5LNK 1;  4AS1 A;  2JYE A;  2G9H D;  4OZB A;  5BMH A;  1NYR A;  4YSZ B;  3KWL A;  4XDD A;  2RMM A;  1I4G A;  4ZRP A;  1TS4 A;  5D3D A;  3FIL A;  2PVG C;  5C2T B;  2M56 B;  4P16 A;  2D5G A;  3O13 A;  3AH7 A;  3AEE B;  1FIQ A;  4NJC A;  2GB1 A;  3MC0 B;  1IBX A;  1JAL A;  2WXK A;  3KWV A;  3LXF A;  1ZDX A;  4RGT A;  3AEB B;  2BTE A;  1AW7 A;  5MPO A;  1ZUD 2;  2CU3 A;  5EE1 A;  2QIE B;  1VZ6 A;  3FIL B;  4XE0 A;  1T5X D;  1YN4 A;  3BK1 A;  2K3U A;  1I4R A;  2WLB A;  2WXJ A;  3EUB 2;  1JQ4 A;  3R2T A;  2WU5 B;  4ZHO A;  5BYR A;  4GLS C;  1C4C A;  2W55 A;  1TYG B;  3HVZ A;  1VDV A;  4J3O D;  2K22 A;  2HTM E;  1ZPS A;  4KGR A;  2ONQ A;  4B0E A;  3KLS X;  4USA A;  3HRD D;  3PZ8 A;  1D5X C;  1CK1 A;  1FCL A;  1Y56 A;  1VLB A;  2DYM A;  3Q69 A;  5C3J B;  1K52 A;  1I7H A;  1JWU D;  1UWM A;  5BMG A;  1E10 A;  2BS4 B;  2J52 A;  1WXQ A;  3CIR B;  1QOA A;  3TEW A;  3EA6 A;  1UUP A;  2VZK D;  3VR9 B;  2TSS A;  5D3I B;  2JX5 A;  2IPK D;  4UDU C;  4YTN B;  1T6B X;  3TUO A;  1GOZ A;  3AE9 B;  5H8Y E;  3MJ5 A;  1WRI A;  1BXT A;  1I4P A;  4RGN A;  2OHF A;  4RNA A;  2BBC A;  4C7Y A;  3IXS A;  1NEK B;  3V05 A;  2XN9 C;  3R2I A;  1V1O A;  2OED A;  1XEE A;  4N58 A;  3GS2 A;  4Q2J A;  3HUI A;  2IGG A;  3BWU D;  4IDI A;  3MHZ A;  4NAW B;  1FRD A;  5EE3 A;  1XLN A;  1E7P B;  2K9X A;  1JWS D;  1FRR A;  1NI3 A;  3U2S C;  2WXO A;  3W1S A;  2LFI A;  3SEB A;  1N62 A;  2FE8 A;  1GPX A;  3IT4 B;  3AEA B;  3W2D A;  4PT5 A;  1LO5 D;  2GRI A;  1IUE A;  1C79 A;  3AEF B;  2PIA A;  3Q8E A;  1AWD A;  2MJ3 A;  1RM6 C;  4P6V F;  1QIL A;  1R7S A;  2WXI A;  2W82 A;  1FXI A;  2DLB A;  2BS3 B;  2SEB D;  4L1B A;  3VQI A;  1QOB A;  1L5P A;  5HG2 A;  2LJI A;  3ZYY X;  4KKI A;  3J9C A;  1KLG D;  2K0P A;  1JRO A;  1BUI C;  1I4X A;  1VZ8 A;  2YEP B;  1CJE A;  2BS2 B;  2NTS A;  1HEZ E;  1QT9 A;  1MHX A;  3NVW A;  2JWU A;  1UWX A;  3BVZ A;  2NMQ A;  3MFG A;  2KQ4 X;  3ZGZ A;  2VZK B;  3FC4 A;  1ENF A;  3BK2 A;  1EWC A;  1V8C A;  1TS5 A;  1UGJ A;  4IKG A;  2WXP A;  2FUG 1;  3LB8 C;  3TSS A;  2IGD A;  4ZHP A;  3NZ3 A;  4XWW A;  3W5V B;  1SXT A;  4US9 A;  5T8I A;  1L0X B;  1XLP A;  2WXG A;  1EU4 A;  1SIJ A;  2INN E;  3E9S A;  1QLB B;  4A55 A;  1WGK A;  3BYT B;  2JYT A;  2CJN A;  2KMM A;  1OFF A;  2B76 B;  2MH7 A;  2L1A A;  2E6X A;  3L4P A;  2L83 A;  2JU6 X;  5HI1 A;  2KDM A;  1D6E C;  4JWU C;  1YQ4 B;  1VZ7 A;  4YTP B;  1OQQ A;  1C76 A;  2QSD A;  1T3Q A;  1TY0 A;  1SE4 A;  2WU2 B;  3AE2 B;  4HRS A;  2HDE A;  1QOG A;  1QF6 A;  3OWE B;  1SEB D;  4YWG G;  2QJL A;  5G5H A;  1I4H A;  1PGA A;  2WXH A;  2BB5 A;  4ZYS A;  1P7E A;  3P63 A;  1XLQ A;  3NVZ A;  4ITK A;  4JPS A;  3T3N A;  2WXR A;  4YT0 B;  3AE1 B;  2K5P A;  1TZO A;  5BYQ A;  1QKZ A;  4A6Q A;  4HEA 1;  2KN4 A;  2ZW0 A;  2RDG A;  2PTL A;  2ZW1 A;  4WUR A;  1RYJ A;  1CQV A;  1VJK A;  1KLU D;  1HZ6 A;  1YJI A;  3AE5 B;  1E0Z A;  4A9A A;  3ZJU A;  2PLP A;  2PW9 A;  1D5Z C;  4C80 A;  1JCK B;  2J53 A;  2QMT A;  5AUK A;  1XF5 L;  2AQ1 B;  4CQN A;  1JW9 D;  2BT6 A;  1V97 A;  3BZD B;  4D2K A;  2R61 A;  2QIL A;  2V3P A;  4N6E B;  3VR8 B;  2I2Y A;  3H8H A;  1XO3 A;  1FMA D;  1PYW D;  2V3N A;  3BVG A;  4HRO A;  2V0G A;  3ABV B;  1L6U A;  2N0S B;  3AED B;  1J7A A;  3TEZ A;  1NVI D;  4MAC A;  5TSS A;  1E9M A;  3I57 A;  1TKE A;  3SFD B;  1JWB D;  2WP9 B;  1AYF A;  1FXA A;  1ET6 A;  4YXD B;  1VRA B;  3FAH A;  2LUM A;  3TEY A;  2RPV A;  3P4P B;  1MPE A;  4US8 A;  1MVK A;  2BW2 A;  5BMI A;  2KWD A;  1QOF A;  4LLG M;  3Q8A A;  2AQ2 B;  4RH6 A;  4DQO C;  4GDK B;  1L4Z B;  3U52 E;  1RWS A;  1N63 A;  3HVD A;  2ACZ B;  3AN1 A;  1ESF A;  1N5X A;  3RFZ B;  3NRZ A;  1FM0 D;  2Z8L A;  3C8Y A;  4O1N A;  1GB4 A;  4REZ A;  2WXN A;  2WXL A;  3AEG B;  2EEL A;  1JWA D;  2E3T A;  1B9R A;  2WDQ B;  1DOI A;  1BML C;  1YN3 A;  3W9C B;  2DBY A;  3SR6 A;  2G1E A;  3NVY A;  4RF0 A;  3AE3 B;  4LK0 M;  2WXM A;  1UNS A;  1F77 A;  2WQY B;  3NVV A;  5E6J A;  1HZ5 A;  4IOI E;  1KRH A;  3AE6 B;  3AE7 B;  1N60 A;  1EWY C;  3PZ7 A;  3E56 A;  1MHH E;  3N9Y C;  1F2R I;  4TSS A;  4KKJ A;  4TQ1 A;  1XCQ L;  2LMC A;  1PGX A;  4ARC A;  1YN5 A;  3EGR A;  2MJE A;  1SJH D;  5FR3 A;  1C78 A;  2W3S A;  2PVO D;  3NUH B;  3PO0 A;  1PGB A;  1SE2 A;  1EU3 A;  1TS2 A;  3MP9 A;  3Q8B A;  3P42 A;  1DYQ A;  4MH8 A;  4YSX B;  1XLO A;  4RGO S;  2X38 A;  1SB3 C;  1JRP A;  1ZXH A;  1PFD A;  2FBW B;  1ACC A;  1KF6 B;  3B2G A;  3ETR A;  2I38 A;  2DYO A;  5FK9 C;  1OQR A;  4XDC A;  3B9J A;  4H2A A;  4WWM A;  2WNM A;  5EE0 A;  2WS3 B;  4JE3 B;  2L32 A;  1N5W A;  2JSV X;  4HKQ A;  3BYY B;  2N9K A;  4OHJ A;  1NYQ A;  2EKI A;  2WDR B;  4ARI A;  1FFU A;  2IDY A;  2J4X A;  2N7J A;  3Q8F A;  4WQM A;  4A90 A;  1J7C A;  1E6E B;  1QQR A;  3KQ4 A;  2AQ3 B;  2LEK A;  4KGS A;  4AQ7 A;  2M0A A;  4DXF A;  4OZC A;  2L52 A;  2XNA C;  3SFE B;  2MEK A;  4WH4 A;  2V4I B;  1YMH E;  2W54 A;  4NZL B;  3W5U B;  4DXG A;  1YQ3 B;  3GP7 A;  1GAQ B;  1HQR D;  5D7G A;  2PKO A;  4XWT A;  1TKG A;  1FD6 A;  1WYG A;  3VRB B;  2BB6 A;  1ROE A;  4KGT A;  3U7Z A;  1MI0 A;  4TQ0 A;  1V1P A;  3I9V 1;  3P4S B;  1F0Z A;  1B1Z A;  5JXV A;  1WSP A;  3NS1 A;  5H92 C;  1L4D B;  2ON8 A;  1IGD A;  3B2F A;  4NAM A;  2IGH A;  2LHD A;  3AM9 A;  1KFY B;  4WAF A;  1SSN A;  4YSY B;  1C77 A;  1L0Y B;  2J42 A;  1STE A;  1V1P B;  1M4V A;  3VRA B;  1PDX A;  4JX1 C;  2Y3A A;  5I4D A;  1FNW A;  1YNT E;  1IGC A;  3RPF C;  4EE2 A;  1IBX B;  2MJD A;  3ZQ4 A;  4M0W A;  3V3X A;  1D5M C;  1I4Q A;  1A70 A;  3U4E G;  2DWQ A;  2GI9 A;  1NEN B;  2BYT A;  3ZJV A;  1XXG A;  1SF0 A;  2KAJ A;  1L6V A;  1CZP A;  5HHD G;  2N9L A;  4RFB A;  1SE3 A;  3P1M A;  1TKY A;  1L0V B;  3IAS 1;  1XCT L;  2PMV A;  2JQR B;  3CWI A;  5HFY A;  1RFK A;  1P7F A;  1N61 A;  4MT5 A;  3AV8 A;  4MM3 B;  3TEX A;  1TS3 A;  1WWT A;  3WCQ A;  3BVM A;  1DOX A;  1FNU A;  2IJ0 A;  1HXY D;  1D4B A;  1K53 A;  1FNV A;  2INP E;  2W3R A;  2CJO A;  2WXF A;  5G5G A;  4YTM B;  1ZXI A;  3AEC B;  1DOY A;  3IAM 1;  2AX5 A;  4ZRQ A;  2JZP A;  1C9F A;  4JWS C;  3URY A;  4GDL B;  1FCC C;  1ZDV A;  3LYY A;  1VR9 A;  3AE4 B;  1AN8 A;  1FFV A;  3GB1 A;  1TJE A;  4C56 C;  2Y5P A;  2QEJ C;  2WXQ A;  5BYS A;  4FXC A;  4L23 A;  1J7B A;  1Q10 A;  2WDV B;  4B0M A;  4C7Z A;  5EE9 A;  1GB1 A;  1SBB B;  3AMZ A;  2H88 B;  4A8X C;  1ZOY B;  2Q5W D;  3P4Q B;  1EM7 A;  1YJJ A;  4RCO A;  3R8B A;  3T3O A;  5FKA C;  4L2Y A;  1F2R C;  1HA5 A;  4LTU A;  1ZP0 B;  2KAC A;  2LGI A;  2LHE A;  1FEH A;  3AB5 A;  1JML A;  3ZJT A;  1K50 A;  3DWM A;  1K51 A;  1KH0 A;  3Q8C A;  1FO4 A;  4WIP A;  1TY2 A;  4N59 A;  5AUI A;  2YEP F;  4HJG E;  2SAK A;  1ET9 A;  4TMA B;  1DGJ A;  3BII D;  1JWM D;  2ICI A;  2JXT A;  4R3D A;  4OZA A;  2NTT A;  4ZOH C;  2H89 B;  1ZE3 D;  3UI3 A;  4RF1 A;  1KTK A;  1PUT A;  4KX6 B;  3P4R B;  2Y5C A;  4RGM A;  3AE8 B;  4HKZ E;  1SJE D;  2M19 A;  2RDH A;  4OW0 A;  4OVZ A;  5GXG B;  1C4A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...