1MPEA

Ensemble of 20 structures of the tetrameric mutant of the b1 domain of streptococcal protein g
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
56
structure length
56
Chain Sequence
MQYKVILNGKTLKGETTTEAVDAATFEKVVKQFFNDNGVDGEWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunoglobulin G binding protein G
publication title Core mutations switch monomeric protein GB1 into an intertwined tetramer.
pubmed doi rcsb
source organism Streptococcus sp. 'group g'
molecule tags Protein binding
total genus 5
structure length 56
sequence length 56
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2002-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1mpeA00
2IGHA 1MVKA 2OEDA 1XF5L 1PGBA 1XCTL 5BMGA 1IBXA 1FCCC 2LUMA 1EM7A 1YNTE 2N9KA 2KDMA 1HZ5A 5BMIA 1ZXHA 3V3XA 1FCLA 5HHDG 2ONQA 2I38A 4KGTA 2LGIA 2RMMA 4OZBA 1FD6A 1MPEA 1F2RC 2RPVA 4KGRA 3GB1A 1UWXA 2PTLA 4HKZE 1MHHE 2GI9A 1YMHE 1IGDA 2JU6X 1C9FA 2GB1A 1F2RI 2KQ4X 5HI1A 4IOIE 4GLSC 5HG2A 4KGSA 2QMTA 1GB4A 1K52A 4D2KA 1D4BA 1K51A 2JXTA 2J52A 2JSVX 1PGAA 1P7EA 2LHEA 2KACA 5JXVA 1K50A 2PLPA 1MHXA 1P7FA 3MP9A 3UI3A 4MACA 2IGGA 2ZW0A 1PGXA 2QSDA 2PW9A 4OZCA 4OZAA 1GB1A 2JWUA 5HFYA 2J53A 1HZ6A 2LHDA 1XCQL 2ZW1A 4HJGE 2K0PA 2N9LA 3FILB 1HEZE 2NMQA 1KH0A 1Q10A 1IGCA 1K53A 1QKZA 1MI0A 4WH4A 4IKGA 5BMHA 2ON8A 1IBXB 2JZPA 2KN4A 2KWDA 1JMLA 2N7JA 2I2YA 2EELA 3FILA 2IGDA
chains in the Genus database with same CATH superfamily
4H2AA 4NQLB 5IP4D 2QDFA 4NAWB 2D2QA 2M17A 3IVFA 2INPE 4LK0M 4F8CB 1V6EA 1TKEA 4KGTA 4TQ0A 4B95A 4ZRIA 2ZCCA 3X0WA 2KHWB 3AE5B 2J7QB 3BVMA 4AUQC 2KFJA 2CJOA 2GOWA 5E6NA 4FULA 2NPTB 1TTNA 2WYQA 1YQ4B 1F52A 2C7NB 2GBKA 3LB8C 1TS2A 5AEKB 3CSFA 3KYCD 1KLUD 4NAMA 4WAAA 2MCNB 1T3QA 2RD0A 2LXAA 1WIAA 4KZ0A 1L4DB 1MJDA 2WXFA 1AWDA 4W9JA 2KLGA 2ZVNA 4LLGM 1N6ZA 4AWJA 5H92C 5LNK1 4IW0A 2WXPA 2WX1A 4JWSC 5MPOA 1T0SC 1GUAB 4XWTA 3RYTA 3BZDB 4ZRPA 3FKYA 1UZXB 2GMIC 4HPPA 2INNE 2KT7A 5DPTA 2Z0EB 1XXGA 1TYGB 5IA7A 3ALBA 4S0RA 1PYWD 2MLBA 3VXWA 1V5TA 2NR2A 2AYOB 1GOZA 3DHHC 1WGDA 1JWSD 2YLMA 3AE6B 1KTKA 3Q14C 3MC0B 4BKGA 2JYTA 4C7ZA 4ZHOA 4IKGA 4GDLA 2UU7A 4EEWA 4IC7B 1WX7A 2G1EA 4DHZE 1ISNA 3TEWA 1RWSA 2KWVB 4ARCA 1FFVA 1NI2A 1CMXB 1WI0A 4MM3B 3DBLB 3TL5A 3VQIA 1L5PA 2KOXA 1N63A 2DHZA 1OQRA 2IBIB 3NOBA 4KGRA 4B9KA 2YVCA 4N59A 4MSQB 3DBRI 1J7CA 1WYGA 2J0JA 4ICUA 3T3NA 2N9XA 2V4IB 1Q0WB 1UBQA 2WU2B 3VR8B 4DXFA 2N9EB 5HG2A 1FO4A 4ZRQA 5EE3A 1J8CA 2BS2B 3ZVVA 1EUVB 3HUIA 1JRUA 2DZMA 2LHEA 5EDSA 4JGHB 1M4VA 1MHXA 3IBEA 2G4DB 4ZRJA 2NBVB 2IGGA 4W9FA 1PGXA 1VJKA 1D6EC 1V2YA 3MHSD 2V3NA 4RGMA 3VHTC 5FR3A 2MW5A 2NS5A 1WE6A 2FUG1 2LJ5A 2R61A 1MI0A 3J9CA 2ACZB 1IBXB 2BKFA 3GE3C 3OAWA 4CHKA 1DOXA 1J7AA 1IPGA 2V3PA 2MA9B 2XK5A 1ZUD2 2IO1B 2BF8B 2IGDA 2WX0A 5DPRA 1FCCC 1N60A 2JPHA 1WF9A 2Y5PA 1Y56A 3B2GA 3B08A 2KD0A 4A3PA 1NYRA 1V81A 4N9F4 3TEXA 5KHQA 2DAFA 2FBWB 1FXTB 4BAXA 4I6NB 1FFUA 3BYYB 5D3IB 3AXCA 2ASQA 3ZQ4A 3GB1A 3W1YA 4HKZE 1JRPA 2D07B 5D3DA 1YN5A 4JWUC 4E3CA 3T9LA 1C9FA 3ZXRA 4MGZE 1RM6C 3RNEC 1EU3A 3PS6A 1NI3A 2OOBB 2Z0DB 3WA0A 3IFWB 2KX3A 3Q8EA 3ZUNA 2MP2A 3BK1A 4URKA 1WXQA 1WR1A 4AJWA 1TKYA 2SAKA 3U8ZA 2HJ8A 1CQVA 2AQ2B 1YN4A 5E6JA 2KANA 1E8XA 4HLEA 3OLMD 1WE7A 1N61A 4NY0A 3RZWC 2W54A 4EZKA 1ZP0B 2IY1B 1RAXA 2KJRA 2L0FA 1GC7A 3H9DA 3I3TB 1FNVA 1PUTA 1ET6A 4W9DA 2K0PA 1R4NB 3VRAB 5LXIB 5LXHA 2ZNVC 1E7PB 4TQ1A 1IGCA 4XE0A 1J0GA 1WGKA 4DHJB 4IDIA 5BMHA 1OEYA 3VUWA 1TJEA 3W1SA 1IP9A 1JMLA 1E7VA 3VUYA 2EMTA 4AJYB 3R8BA 5IKCM 2RDGA 5C3JB 3PLVA 1V1OA 4LDTD 4C00A 2AQ3B 1ZXHA 1E8WA 2D11A 1T6BX 4NJ7A 1RFKA 2QJLA 3B1LX 2WNMA 4IWOA 2WXOA 4W9CA 1V1PB 2WDVB 5D94A 1FD6A 3Q3FA 4KX6B 2CU3A 3L08A 4MSMB 3H7SA 3BWUD 5J2RA 1IGDA 1WH3A 4UDUC 1L2NA 3PZ7A 1KF6B 5DPSA 3NVVA 2M4NA 2JRIB 4MH0E 3CF6E 3PREA 2LFIA 4W9HA 1JALA 1LM8B 1MG4A 2KFKA 4RGOS 2LVPA 2DENB 3L4PA 3N20C 1STEA 5G5GA 2QCZA 2QILA 5JZEB 2LMCA 2OJRA 2WDTB 3WAMA 1EF5A 4M02A 3D32A 4HCNB 1SGHA 1P7FA 3ZTCA 2C7HA 2JY6A 4N6EB 1HTOA 4W9LA 4XDCA 2LWPA 3JSVA 2FAZA 4WAFA 3SFDB 4OHJA 2JWUA 2J53A 2KQSA 2MX2A 3DBSA 3AMZA 1H8CA 3DBHI 3FAHA 2WS3B 1TGZB 4NQKE 1WWTA 3A1QB 2AL6A 3MJ5A 2ZNVB 4LCDE 1KLGD 2EELA 2K25A 3ZW3A 3EUB2 3FILA 2R2QA 2AX5A 2UYZB 1TBEA 4C4VB 2IO0B 3A9KB 2GBRA 1EM7A 1UD7A 4P6VF 2KVRA 4ANWA 4USAA 2JVCA 4KIKA 5HKHA 4TMAB 1KRHA 4JX1C 1YJJA 1N5WA 2JUOA 1DOYA 3PZDA 3H7PB 1E90A 1WGHA 1ZPSA 4ARIA 3DVGX 2K8BA 2HDEA 1NDDA 3NZSA 2JF5A 2FCMA 2G4SA 4LJPB 3KYDD 1C4CA 4IOIE 4PS8A 4BKTA 1NBFC 5E6OA 1D5MC 1HXYD 2JRHA 2BKRB 4AP4C 1TY0A 4MEMA 4AS1A 1LXDA 1JROA 1YN3A 5JHBA 2D3BA 3NZUA 4FN2A 1TS5A 1E10A 3IT4B 2K6DB 5CHFA 4GN1A 5JXVA 3LDZE 3RUIB 2KWUB 1ZDVA 1K50A 3EGRA 5L83A 2LI5A 3AU5A 2K8HA 4XWWA 3Q3JA 1G6JA 1WXMA 1TZ1A 3A33B 2ZW0A 5EE0A 5FR6A 1WZ0A 4MGIE 3LJ3A 4I6PA 4MJSA 4WQOB 2DLBA 5CX3A 3Q3OC 1WY8A 2DNFA 3NVZA 1EWCA 5HFYA 2KVZA 2JZ3B 5CHWA 3TUOA 2GRIA 1OTRB 1XCQL 4AOFA 2N7EA 2D3AA 2QC8A 1HEZE 4BOSC 3IHPC 2MH7A 3B0AA 5D6JB 1UNSA 1WXAA 1MFWA 3AN1A 2L1AA 4E74A 3JYUA 3R7RA 2BPSA 5DCNA 3A4SC 3ZYYX 1A70A 1C79A 3PO0A 5IAAC 3WAOA 2IGHA 4MH8A 1SJED 1VLBA 2JXXA 4P1BC 3KLSX 1QOAA 2LD9A 4RGTA 2PPHA 2BQQA 2FNJB 1FRDA 2LGDA 2N1WA 2BBCA 3VVWB 1V8CA 2O6VD 3MJWA 1TKGA 4K7SA 1LFDA 4RGNA 2PTLA 3VDZA 2WU5B 3H1UA 4GDKA 4RNAA 1J7BA 4GU2A 1QILA 4GIVA 2FCQA 2KQ4X 5TR5A 4BBNC 2M19A 1SEBD 2KTRB 4XGAB 5JH5C 2DYBA 3ZDMC 2BYTA 2DYOA 2M1MA 3PHWB 1YOVB 2A5UA 1GPXA 1JW9D 3KUZA 5H8YE 1SE3A 1OQYA 4HXDA 3EA6A 3SU8X 4IM0A 2WXRA 1GNUA 4BKSD 3AE3B 4NJ6A 3EHVA 3B9JA 1E0ZA 3HM3A 1YQBA 2PJHA 3SDLC 2K22A 4IWPA 5I4DA 3OG5A 3EFUA 3GZNI 3URYA 1V86A 1TS4A 3KWVA 2LGSA 2IJ0A 2Q5WD 3QAQA 2QHOA 1KH0A 2O6VA 3AB5A 2IZVB 3AE4B 2LUEA 1AN8A 3T8MA 4WH4A 2NTTA 3RNGC 3QWZB 4M0WB 3PLUA 4HWIB 3I57A 3W2DA 3AEBB 4M00A 3NVWA 4HPLB 1ZDXA 2WGSA 2L05A 2X38A 3AE1B 2EKIA 4E71A 3AEDB 4KZCA 5FK9C 2W9NA 3ZGZA 2G3QB 4BZAA 1ET9A 1XD3B 3DOWA 4P1CC 1RRBA 2I38A 4KKIA 2FE8A 2LGIA 3AM9A 4LJOB 2DWQA 4K3CA 1SBBB 2CU1A 4JLCA 5C1ZA 2LGXA 3DBRB 3BVGA 1C78A 3SHQA 2RPVA 1SXTA 3NS8A 4BKSA 3RMKC 2K1FA 4OW0A 2RDBC 2KQ7A 3ECIA 3V62A 2KXJA 3DHIC 4Q2JA 3CWIA 2NBWB 2MRPA 4BFRA 1QT9A 3GS2A 2A4ZA 4WURA 2VZKB 3NG0A 3KUCB 2L76A 4WJNA 2L8JA 2BWES 4WWNA 3WANA 1I4PA 4ASWC 1PGAA 3I9V1 3H6NA 3R2TA 4PK1A 4JL9A 4DXGA 5G5HA 2KACA 3DWGC 4AQ7A 4R3DA 2RPQA 2PMVA 1FPYA 2XNAC 1I4QA 2BGFA 4M8MA 3UINB 3AEFB 3LYYA 4L23A 2PW9A 1SF0A 2PEAA 3DDCB 2WXIA 4K81A 2VH2A 3C0RB 1JWAD 2DZJA 1FIQA 2KDBA 1V97A 2RGFA 2TSSA 1MG8A 2NVUI 4ACFA 2O2VB 2BB6A 2HE7A 4RCOA 2KN4A 4C56C 2FIDA 4X57B 1BUIC 3PRMB 2WLBA 3ZIMA 1QOGA 2M0AA 2BYEA 3A9JA 1XCTL 5J18A 3VH3B 3RD2A 4HEA1 3EC8A 4IG7B 1SSNA 3WCQA 3PRPB 3O65B 1XLPA 1ZKHA 2LVOA 1UBIA 1Y8RC 3V6CB 4NJCA 1SIJA 4WIPA 1T0QC 4HDOA 1P9DU 1WGGA 3EECA 2EKEC 3PPAA 1TIFA 2FCNA 1ESFA 1XT9B 4RH6A 1WMHB 2MBEA 3VRBB 1AYFA 1UWMA 4TKNA 1V9JA 5T8IA 3OWEB 2FCSA 1WM2A 4FHKA 2INDC 2ICIA 3MP9A 4B0EA 4YTPB 3BYTB 2J0MA 1K8RB 2K9XA 4A9AA 2RR9A 2MJDA 4OZAA 2GBJA 1OGWA 2YEPB 2N0SB 4G50A 3RNBC 2C7MB 4JPSA 2LASA 1ROEA 1HQRD 2IO3B 3SEBA 1LO5D 1PFDA 2KJHB 3HHMA 2WXLA 4XYCA 4DK5A 2JZPA 2VH1A 4EKUA 1FNWA 3RT3B 5D7GA 1ZE3D 3RNFC 4RM9A 3E56A 3Q2AC 4LNOA 4W9IA 1D5ZC 1PGBA 3BY4B 5BMGA 2KMAA 2BWFA 3L54A 4KSLC 5BYSA 1P1AA 2BW2A 3N3KB 4ITKA 1WJ4A 2QEJC 4NAWA 4HKQA 1WXSA 1MHHE 2KNBA 1A5RA 1FXAA 1BMLC 2AWTA 2KMMA 3GE8C 3NS1A 2C9WB 3QHTA 3U4EG 1R4MI 4LNIA 3WAPA 2NPTA 2V9HA 2J0KA 4PYUA 4DDGD 2KWCA 3Q8FA 4I6LB 4A20A 2JWZA 1V49A 1WM3A 4XC2A 4ZRKA 4WWPA 2ZVOA 5IOIA 3K9PB 2PVOD 3ZTDA 2PLPA 2ZPNA 2KAJA 2K39A 3TCAA 3DQVA 2MJ3A 3A4RA 1R4NI 4HJKA 5TSSA 3O13A 3DBHB 4IM3A 3QK0A 3APDA 3ZNID 4GDLB 4GXBA 1HZ6A 1EU4A 3BIID 2LHDA 4K3BA 1DOIA 1CJEA 2ZW1A 1SE9A 1E6EB 1WR6E 5E6PA 2PE9A 2ON8A 3M62B 2BVCA 2D3GA 2KJ6A 4REZA 2XEWA 2EMSA 1L6UA 1YQ3B 2N9KA 3ZJTA 1VZ7A 2MSED 3NZ3A 2D10A 1J19A 1P98A 2KTFA 3NRZA 4ANVA 4L2YA 1LQBA 3VUXA 4IM2A 4MM3A 1ZGUB 1Q5WB 3UGBB 4FJVB 2IO2B 2K3UA 4EE2A 2MBHA 2NBUA 1FRRA 4JQWC 3N1ZC 4W9EA 3KH0A 1L0YB 2GB1A 2MBQA 1F2RI 3RN9C 3UIPB 1VZ6A 1KOTA 3R7QA 5GXGB 5AZHA 1SE2A 3TJPA 3KQ4A 4RM8A 4FA6A 4P7IA 3QA8A 1OQQA 1I7HA 3BINA 1D3ZA 3OJ4B 2WXHA 4DQOC 4LTUA 4C7YA 2L83A 3BK2A 3PRZA 1VDVA 2MBOA 3W1SC 1C4PA 3RULA 2KO3A 4US8A 1IYFA 2KDIA 2I1JA 2XK5B 3GP7A 3NJTA 1Q10A 1GJZA 4FBJB 4J6IA 2D5GA 4EUTA 4FHJA 3AE2B 3L10B 2KWDA 3AI5A 3PTFC 3AE8B 5BYRA 2E6XA 2I2YA 4EFOA 1Z2MA 1QLBB 3U2SC 2V1YA 1IBXA 3DVNU 2KDMA 2LJIA 2KC1A 3U52E 1UUPA 2DYMA 1VD2A 3PSEB 4HVBA 2ONQA 2V0GA 4K1RB 2LGYA 3AECB 2ZJDA 1ENFA 1YJ1A 4BOZB 1BT0A 2AQ1B 2OJWA 3ETRA 3NVYA 3EFCA 2M56B 3P4SB 2KN5A 2MQJA 2MP2B 3MTNB 2N4FA 2WP9B 2Y3AA 4RF0A 4B0MA 3HVDA 4DHJD 2Y5CA 3ML8A 1GB4A 4JIOU 1VCBA 3V61A 4KVGB 2J52A 2DX5B 2WXNA 3IAS1 5CHVC 1QQRA 2BS3B 3DHGC 2MEKA 3PHXB 3VR9B 2B76B 1HA5A 2GBMA 1TY2A 1U4AA 3PT2B 1AARA 2J42A 1JQ4A 4BBNF 2FUHB 3N30A 3GZNB 1WJUA 1C4AA 2PVGC 4N58A 3CMMB 3E9SA 2W3RA 2QSDA 1QOBA 4LNKA 4WJOA 3VAWA 2WHIA 3AULA 2I1KA 2BYVE 2ZPYA 2N9LA 1FEHA 2MHJA 4OVVA 2L52A 3L16A 2N7JA 1C1YB 2CHZA 4HK2A 1WFYA 3CIRB 2RSUA 3PZ8A 3ZLZA 4P16A 4WWOA 2WXKA 4WJPA 3M63B 4MELA 3MHZA 5HHDG 1PDXA 3TEYA 3HVZA 4ICVA 4B6WA 2WXQA 2MWSB 1I4RA 2L32A 3L13A 4FJZA 3V05A 2XN9C 4XDDA 1YJIA 1S3SG 3RI7C 1DYQA 2KFKB 1OFFA 1I35A 1V1PA 3KWLA 3CSTA 5D2MB 2BS4B 4K7UA 1N62A 3Q69A 1NENB 1XLQA 3ML9A 4CQNA 2GLSA 2L0TA 3Q3MC 4LNNA 1XEEA 3MC8A 4QAYA 2RDHA 3V60A 4LDTB 3Q3NC 3JSVB 1AW7A 2KZRA 3HK0A 3L0WB 3RNAC 3ZRCA 1FNUA 4IWQA 3T3OA 2AL3A 3W5VB 1TZOA 4MACA 4DDID 1SE4A 3S2AA 2REXA 1GB1A 4ANXA 1M94A 2K6QA 5GMVA 3TIXA 2MJEA 1TS3A 5JHAA 2W82A 2LXCA 4HJGE 4PS7A 3AE9B 2VRRB 1JWBD 3FILB 1E8YA 4OVUA 3AV8A 2INCC 2L7RA 4RMAA 3PV1A 4ZDVA 2CJNA 3ZJVA 2BTEA 4KIKB 4NPNA 3K9OB 2WXJA 3A1QA 2YEPF 2Y5BB 4F1SA 3IAM1 2HD5B 4GMVA 3AEGB 2C5LC 1JCKB 3RZFA 1XLNA 1V80A 2XBBC 1WX8A 3V6EB 3QARA 4FADA 4M01A 2R2OA 1SJHD 3VH4B 3OJ3A 4C4VA 3A9KA 3DBLI 4JE3B 2RMMA 1L6VA 3I5JC 3W9CB 1QF6A 1MPEA 1CK1A 2V4LA 3UIOB 2MBBB 3P4PB 1IUEA 1R7SA 4F7ZA 2H88B 3QQ8B 2ZEQA 4RF1A 2Z59B 1CZPA 2JU6X 3TMPB 3ZNHB 3QJZA 5BO4B 4KDIC 3DWMA 4RFBA 3H7PA 2W3SA 2L00B 4KGSA 4D2KA 1HE8A 4S17A 2KMCA 2JSVX 3U7DA 1RYJA 1P7EA 3Q8CA 1WYWB 4MJSB 4ZYNA 4II2B 1UH6A 4FLHA 2OHFA 3I63C 2IDYA 1NVID 2M8SA 1EWYC 1GG3A 3ZO5B 1QOFA 2PIAA 2WXMA 1F0ZA 5G2NA 2K8CA 5AZGA 3W5UB 5LLIA 1JWUD 2PKOA 2JX5A 3PGEA 4NZLB 4II3B 4PYZA 1WJ6A 4WWMA 3PVLA 2ZZPB 1C77A 4YXDB 1EO6A 4TSSA 2CHWA 3MC9A 3AEEB 4K7WA 3UF8A 1VRAB 1UGJA 3ENEA 2N9PC 3P2BA 1I4GA 3JVZX 1ZW7A 1MVKA 4A90A 4ZYSA 3N32A 4A3OA 4ZHPA 3P4QB 1YNTE 5EE9A 4MGKE 1E5WA 2QIEB 2HJ1A 2KK8A 1NYQA 4HRSA 4GDKB 3C19A 1VZ8A 4C80A 4A8XC 4DWFA 3X23A 4J3OD 4FJYA 3H8HA 3IT6B 3QIJA 5AUIA 4BVUC 1YX5B 3RNCC 1F2RC 1R4MB 3AEAB 1L0VB 4FXCA 3AU4A 3P1MA 3APFA 3IG3A 4YWGG 1X1MA 1WXVA 1Q1OA 1VR9A 1E8ZA 5IN7A 1C76A 5HI1A 2IPKD 2JYEA 2N7DA 3AH7A 4ZOHC 3DVNV 3U7ZA 4XX5A 2K5PA 4G3XB 2JXTA 3TSSA 4DBGA 2JT4B 3R3MA 1EF1A 5L95C 2KTRA 2C60A 1I4HA 3P63A 3APCA 3HM6X 3P42A 4OVZA 2O6VB 1SIFA 4G0NB 1WJNA 4NNJB 2DZKA 3N9YC 1E9MA 2WDRB 3RPFC 4EZLA 2LZ6A 3SD5A 1Z5SB 2NMQA 3QCAA 4A55A 2HTHA 2X8XX 3UQAA 5C2TB 2JZZA 1P3QU 4G11A 2KDFB 4PT5A 2DBYA 3GOEA 3U30A 1C3TA 3KW5B 3VFKA 2VZKD 2AEHA 3L17A 2FIFA 2KKCA 4WJQA 4A6QA 1WRDB 1FMAD 3MFGA 5IO9A 2WXGA 4GGQA 2G9HD 2J4XA 4LNFA 2DZIA 4M0WA 1V5OA 1HZ5A 4HROA 3SFEB 5G55A 5BMIA 3R66C 3V3XA 2LEKA 1KJTA 2KYWA 1L7YA 1YD8U 2G45B 4KKJA 4XZ4A 3N1XC 3R2IA 4W9GA 4KV2A 2SEBD 4OZBA 4YTNB 2CR5A 1L0XB 1WX9A 1T5XD 3ZRFA 1YX6B 3NUHB 3M3JA 3ZNZB 4M8NA 1I4XA 3WIMA 4YL8A 3ZNGC 4GLSC 1PQSA 3BVZA 4L1BA 1WGYA 2QMTA 2BB5A 1K51A 1HTQA 5EE1A 1LGRA 1NEKB 1WGRA 1WZ3A 3Q6BA 2CS4A 3Q8AA 1F77A 2ZCBA 3Q8BA 3ZDTA 2KDEB 3FC4A 4CO7A 1D5XC 4O1NA 2KC2A 4GOCA 1DGJA 4KSKC 2Z8LA 4OZCA 3TBLD 5DPWA 1P0RA 4HDQA 2LRWA 5AUKA 1BXTA 2LVQA 5CTRC 5J17A 4IUMB 1K53A 3A9JB 3N1YC 3DPDA 3NHEB 2H89B 4HCPB 1XLOA 1SB3C 2IY0B 1N5XA 5BYQA 3TEZA 2O2VA 4MGYE 2OEDA 1XF5L 4W9KA 1E7UA 2CKHB 3C8YA 1UGMA 2LUMA 2CHXA 2PE6B 4EOYA 4US9A 1KFYB 1FCLA 2L3ZA 3JW0X 4YSZB 2V3SA 2LRUA 3RFZB 1UELA 4DXAB 2GBNA 1B9RA 1H4RA 2WQYB 2BYFA 3DCGA 1WRIA 1TT5B 5FKAC 2HTME 1KLVA 4YSXB 4TUUA 4GSWA 4HPMB 1T0YA 1UWXA 4PS3A 2NCNA 3QX1A 1S1QB 2GI9A 3DVGY 1YMHE 4CYEA 1GC6A 2JQRB 1I42A 1ZXIA 3QC8B 3IXSA 3VTWA 3KVFB 5C23A 1ACCA 4KDLB 5KHOA 1K52A 1ZOYB 1KM7A 4EZJA 1D4BA 2KX0A 1OEYJ 4TV3A 4YSYB 1F9JA 2KLCA 2UWQA 4DHZB 3VTVA 4GB9A 2NTSA 1WSPA 3ZKJC 2WWZA 3ZXVA 4MDKE 1T0RC 2D3CA 3P4RB 5AZFA 1B1ZA 2B3AA 1WMHA 1YIWA 2DAJA 3UI3A 4WQMA 1UF0A 4YTMB 3LXFA 4ANUA 3UQBA 3HRDD 2BT6A 3ONSA 2E3TA 3VTUA 4YT0B 3B2FA 1QZEA 3NY5A 3M95A 3AE7B 1FXIA 1XO3A 3ZJUA 1L4ZB 1QKZA 3WALA 1RLFA 1FM0D 2W55A 1GAQB 4MT5A 3HIZA 1RFAA 3ABVB 1JWMD 3RCZA 3KUDB 2WDQB 1F1HA 2IYDB 2N1VA 1XQQA 2M0XA 3SR6A
chains in the Genus database with same CATH topology
2WXJA 4H2AA 1D5ZC 1PGBA 5BMGA 3IAM1 1EM7A 3AEGB 4P6VF 1JCKB 1XLNA 4NAWB 5BYSA 4USAA 2INPE 4LK0M 1TKEA 4KGTA 4TMAB 4TQ0A 2BW2A 4ITKA 1KRHA 3AE5B 1SJHD 3BVMA 4JX1C 1YJJA 1N5WA 4JE3B 2RMMA 1L6VA 2QEJC 1DOYA 2CJOA 3W9CB 1QF6A 1MPEA 1CK1A 4HKQA 3P4PB 1YQ4B 1IUEA 1R7SA 1ZPSA 1MHHE 3LB8C 4ARIA 2H88B 1TS2A 1FXAA 2HDEA 1BMLC 2KMMA 4RF1A 1CZPA 2JU6X 3NS1A 3U4EG 1KLUD 4NAMA 1C4CA 3DWMA 4RFBA 1T3QA 4IOIE 2W3SA 1D5MC 1HXYD 4KGSA 1L4DB 2WXFA 1TY0A 4D2KA 4AS1A 1AWDA 3Q8FA 1YN3A 1JROA 4LLGM 1TS5A 2JSVX 5H92C 1RYJA 5LNK1 1E10A 1P7EA 3Q8CA 2WXPA 3IT4B 4JWSC 5MPOA 5JXVA 2PVOD 3EGRA 1ZDVA 1K50A 2PLPA 4XWTA 2OHFA 2KAJA 3BZDB 2MJ3A 2IDYA 4XWWA 1NVID 4ZRPA 2ZW0A 5TSSA 5EE0A 2INNE 1EWYC 3O13A 2DLBA 1QOFA 2PIAA 3NVZA 1EWCA 1XXGA 4GDLB 1TYGB 5HFYA 2WXMA 1HZ6A 1EU4A 3BIID 3TUOA 1PYWD 2LHDA 1F0ZA 2GRIA 1GOZA 1DOIA 1XCQL 1CJEA 2ZW1A 3W5UB 1JWSD 3AE6B 1HEZE 1JWUD 1KTKA 2PKOA 2JX5A 1E6EB 3MC0B 4NZLB 2JYTA 2MH7A 4C7ZA 4ZHOA 1UNSA 4IKGA 2ON8A 3AN1A 2L1AA 4WWMA 1C77A 4YXDB 4TSSA 3AEEB 1VRAB 4REZA 1UGJA 3ZYYX 1A70A 1C79A 1I4GA 2G1EA 3PO0A 3TEWA 1RWSA 1L6UA 2IGHA 1MVKA 4A90A 4ZYSA 4ARCA 4MH8A 4ZHPA 1FFVA 1YQ3B 3P4QB 1YNTE 1SJED 1VLBA 2N9KA 5EE9A 3ZJTA 3KLSX 1QOAA 4MM3B 1VZ7A 3NZ3A 2QIEB 4RGTA 4HRSA 1NYQA 3VQIA 4GDKB 1L5PA 1FRDA 1VZ8A 4C80A 4A8XC 3NRZA 4J3OD 2BBCA 1V8CA 4L2YA 1N63A 3H8HA 3IT6B 1OQRA 5AUIA 1F2RC 1TKGA 4KGRA 4RGNA 2PTLA 3AEAB 2WU5B 1L0VB 4FXCA 2K3UA 4N59A 4RNAA 3P1MA 4EE2A 4YWGG 1J7BA 1J7CA 1FRRA 1WYGA 1VR9A 1QILA 3T3NA 2V4IB 1C76A 1L0YB 2GB1A 2WU2B 1F2RI 2KQ4X 5HI1A 3VR8B 2IPKD 1VZ6A 4DXFA 2JYEA 3AH7A 4ZOHC 5HG2A 3U7ZA 2M19A 1SEBD 5GXGB 1FO4A 2K5PA 2BYTA 2DYOA 1SE2A 2JXTA 3TSSA 4ZRQA 5EE3A 1JW9D 1GPXA 3KQ4A 5H8YE 2BS2B 1SE3A 3HUIA 3EA6A 2LHEA 1OQQA 1I7HA 2WXRA 1M4VA 1MHXA 1I4HA 2WXHA 3AE3B 3P63A 4DQOC 3B9JA 2IGGA 3P42A 1E0ZA 1PGXA 4LTUA 4C7YA 1VJKA 2L83A 4OVZA 3BK2A 1D6EC 2V3NA 2K22A 1VDVA 4RGMA 5I4DA 1C4PA 5FR3A 3URYA 3N9YC 1E9MA 1TS4A 4US8A 3KWVA 2WDRB 3RPFC 2IJ0A 2Q5WD 3GP7A 2NMQA 1KH0A 3AB5A 4A55A 2FUG1 1Q10A 2R61A 3AE4B 1MI0A 3J9CA 1AN8A 2ACZB 4WH4A 2D5GA 1IBXB 2NTTA 5C2TB 1DOXA 3AE2B 2KWDA 4PT5A 2DBYA 1J7AA 3AE8B 5BYRA 3I57A 2V3PA 2E6XA 3W2DA 3AEBB 2I2YA 2VZKD 3NVWA 1ZDXA 2X38A 1ZUD2 4A6QA 3AE1B 2EKIA 1QLBB 2IGDA 3U2SC 1FMAD 3AEDB 3MFGA 5FK9C 1IBXA 2WXGA 3ZGZA 2G9HD 1FCCC 2J4XA 1N60A 2KDMA 2LJIA 2Y5PA 4M0WA 3U52E 1UUPA 1Y56A 1HZ5A 3B2GA 4HROA 3SFEB 1ET9A 5BMIA 2DYMA 3V3XA 2LEKA 1NYRA 2ONQA 2I38A 2V0GA 4KKIA 4KKJA 2FE8A 2LGIA 3AM9A 3TEXA 3R2IA 2DWQA 2FBWB 1SBBB 4YTNB 2SEBD 3AECB 1FFUA 4OZBA 1ENFA 3BYYB 3BVGA 1C78A 5D3IB 2RPVA 1L0XB 1SXTA 2AQ1B 3ETRA 3NVYA 3ZQ4A 3GB1A 4HKZE 1T5XD 2M56B 3P4SB 4OW0A 1JRPA 3NUHB 5D3DA 1YN5A 4JWUC 2WP9B 1C9FA 2Y3AA 4Q2JA 4RF0A 3CWIA 4B0MA 3HVDA 1RM6C 1I4XA 2Y5CA 1EU3A 1QT9A 4GLSC 3GS2A 4WURA 1NI3A 4L1BA 3BVZA 2QMTA 2VZKB 1GB4A 2BB5A 3Q8EA 1K51A 2J52A 3BK1A 2WXNA 5EE1A 1I4PA 3IAS1 1NEKB 1PGAA 3I9V1 1QQRA 1WXQA 2BS3B 3R2TA 3Q8AA 2MEKA 3VR9B 1TKYA 2SAKA 4DXGA 1F77A 3Q8BA 5G5HA 2KACA 3DWGC 4AQ7A 2B76B 1CQVA 1HA5A 4R3DA 2AQ2B 1YN4A 5E6JA 1TY2A 3FC4A 1D5XC 2PMVA 2J42A 1JQ4A 2XNAC 1I4QA 1N61A 4O1NA 2PVGC 1C4AA 2W54A 4N58A 3AEFB 1DGJA 1ZP0B 3E9SA 3LYYA 4L23A 2W3RA 2QSDA 1QOBA 2Z8LA 2PW9A 1SF0A 4OZCA 2WXIA 1JWAD 1FIQA 1V97A 2TSSA 5AUKA 1FNVA 1PUTA 1BXTA 1ET6A 2K0PA 2N9LA 1FEHA 3VRAB 1E7PB 4TQ1A 1IGCA 1K53A 4XE0A 1WGKA 2BB6A 4IDIA 5BMHA 4RCOA 2H89B 2KN4A 4C56C 2L52A 1TJEA 3W1SA 1JMLA 1XLOA 2N7JA 1SB3C 1BUIC 1N5XA 2WLBA 3CIRB 1QOGA 5BYQA 2M0AA 3R8BA 3PZ8A 3TEZA 2RDGA 2OEDA 1XF5L 5C3JB 1V1OA 4P16A 1XCTL 3C8YA 2WXKA 2LUMA 2AQ3B 4US9A 1KFYB 1ZXHA 4HEA1 3MHZA 1FCLA 5HHDG 1SSNA 1PDXA 1T6BX 4YSZB 1RFKA 3TEYA 2QJLA 3HVZA 2WNMA 3RFZB 2WXQA 1B9RA 2WXOA 2WQYB 3WCQA 1V1PB 1WRIA 2WDVB 1I4RA 5FKAC 2HTME 1FD6A 4YSXB 2L32A 1XLPA 4KX6B 3V05A 2CU3A 2XN9C 4XDDA 1YJIA 1UWXA 1DYQA 2GI9A 3BWUD 4NJCA 1SIJA 1OFFA 1YMHE 1IGDA 4UDUC 2JQRB 1V1PA 4WIPA 1ZXIA 3IXSA 1KF6B 3KWLA 3PZ7A 3NVVA 2BS4B 1N62A 3Q69A 1NENB 1XLQA 1ACCA 2LFIA 4CQNA 1K52A 1ZOYB 1ESFA 1D4BA 1JALA 4RGOS 4YSYB 4RH6A 1XEEA 2RDHA 2NTSA 3L4PA 1STEA 5G5GA 1WSPA 3VRBB 2QILA 1AYFA 1UWMA 2LMCA 1AW7A 5T8IA 3OWEB 3P4RB 1FNUA 3T3OA 1P7FA 1B1ZA 2ICIA 3MP9A 3UI3A 4N6EB 3W5VB 1TZOA 4WQMA 4MACA 4YTPB 4B0EA 4YTMB 1SE4A 4XDCA 3LXFA 3BYTB 2K9XA 4A9AA 2MJDA 4WAFA 4OZAA 1GB1A 3SFDB 3HRDD 4OHJA 2JWUA 2BT6A 2J53A 2E3TA 3AMZA 4YT0B 2YEPB 2N0SB 3B2FA 2MJEA 1TS3A 4JPSA 2W82A 3AE7B 4HJGE 1ROEA 3AE9B 3FAHA 2WS3B 1HQRD 1JWBD 3FILB 1FXIA 1XO3A 3SEBA 3ZJUA 1WWTA 1LO5D 1L4ZB 1PFDA 1QKZA 3AV8A 2WXLA 1FM0D 2W55A 3MJ5A 1GAQB 2JZPA 4MT5A 3ABVB 1JWMD 1KLGD 2CJNA 1FNWA 5D7GA 1ZE3D 2EELA 2WDQB 3ZJVA 3EUB2 2BTEA 3FILA 3E56A 2AX5A 3SR6A 2YEPF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IGH A;  1MVK A;  2OED A;  1XF5 L;  1PGB A;  1XCT L;  5BMG A;  1IBX A;  1FCC C;  2LUM A;  1EM7 A;  1YNT E;  2N9K A;  2KDM A;  1HZ5 A;  5BMI A;  1ZXH A;  3V3X A;  1FCL A;  5HHD G;  2ONQ A;  2I38 A;  4KGT A;  2LGI A;  2RMM A;  4OZB A;  1FD6 A;  1MPE A;  1F2R C;  2RPV A;  4KGR A;  3GB1 A;  1UWX A;  2PTL A;  4HKZ E;  1MHH E;  2GI9 A;  1YMH E;  1IGD A;  2JU6 X;  1C9F A;  2GB1 A;  1F2R I;  2KQ4 X;  5HI1 A;  4IOI E;  4GLS C;  5HG2 A;  4KGS A;  2QMT A;  1GB4 A;  1K52 A;  4D2K A;  1D4B A;  1K51 A;  2JXT A;  2J52 A;  2JSV X;  1PGA A;  1P7E A;  2LHE A;  2KAC A;  5JXV A;  1K50 A;  2PLP A;  1MHX A;  1P7F A;  3MP9 A;  3UI3 A;  4MAC A;  2IGG A;  2ZW0 A;  1PGX A;  2QSD A;  2PW9 A;  4OZC A;  4OZA A;  1GB1 A;  2JWU A;  5HFY A;  2J53 A;  1HZ6 A;  2LHD A;  1XCQ L;  2ZW1 A;  4HJG E;  2K0P A;  2N9L A;  3FIL B;  1HEZ E;  2NMQ A;  1KH0 A;  1Q10 A;  1IGC A;  1K53 A;  1QKZ A;  1MI0 A;  4WH4 A;  4IKG A;  5BMH A;  2ON8 A;  1IBX B;  2JZP A;  2KN4 A;  2KWD A;  1JML A;  2N7J A;  2I2Y A;  2EEL A;  3FIL A;  2IGD A; 
#chains in the Genus database with same CATH topology
 4H2A A;  4NQL B;  5IP4 D;  2QDF A;  4NAW B;  2D2Q A;  2M17 A;  3IVF A;  2INP E;  4LK0 M;  4F8C B;  1V6E A;  1TKE A;  4KGT A;  4TQ0 A;  4B95 A;  4ZRI A;  2ZCC A;  3X0W A;  2KHW B;  3AE5 B;  2J7Q B;  3BVM A;  4AUQ C;  2KFJ A;  2CJO A;  2GOW A;  5E6N A;  4FUL A;  2NPT B;  1TTN A;  2WYQ A;  1YQ4 B;  1F52 A;  2C7N B;  2GBK A;  3LB8 C;  1TS2 A;  5AEK B;  3CSF A;  3KYC D;  1KLU D;  4NAM A;  4WAA A;  2MCN B;  1T3Q A;  2RD0 A;  2LXA A;  1WIA A;  4KZ0 A;  1L4D B;  1MJD A;  2WXF A;  1AWD A;  4W9J A;  2KLG A;  2ZVN A;  4LLG M;  1N6Z A;  4AWJ A;  5H92 C;  5LNK 1;  4IW0 A;  2WXP A;  2WX1 A;  4JWS C;  5MPO A;  1T0S C;  1GUA B;  4XWT A;  3RYT A;  3BZD B;  4ZRP A;  3FKY A;  1UZX B;  2GMI C;  4HPP A;  2INN E;  2KT7 A;  5DPT A;  2Z0E B;  1XXG A;  1TYG B;  5IA7 A;  3ALB A;  4S0R A;  1PYW D;  2MLB A;  3VXW A;  1V5T A;  2NR2 A;  2AYO B;  1GOZ A;  3DHH C;  1WGD A;  1JWS D;  2YLM A;  3AE6 B;  1KTK A;  3Q14 C;  3MC0 B;  4BKG A;  2JYT A;  4C7Z A;  4ZHO A;  4IKG A;  4GDL A;  2UU7 A;  4EEW A;  4IC7 B;  1WX7 A;  2G1E A;  4DHZ E;  1ISN A;  3TEW A;  1RWS A;  2KWV B;  4ARC A;  1FFV A;  1NI2 A;  1CMX B;  1WI0 A;  4MM3 B;  3DBL B;  3TL5 A;  3VQI A;  1L5P A;  2KOX A;  1N63 A;  2DHZ A;  1OQR A;  2IBI B;  3NOB A;  4KGR A;  4B9K A;  2YVC A;  4N59 A;  4MSQ B;  3DBR I;  1J7C A;  1WYG A;  2J0J A;  4ICU A;  3T3N A;  2N9X A;  2V4I B;  1Q0W B;  1UBQ A;  2WU2 B;  3VR8 B;  4DXF A;  2N9E B;  5HG2 A;  1FO4 A;  4ZRQ A;  5EE3 A;  1J8C A;  2BS2 B;  3ZVV A;  1EUV B;  3HUI A;  1JRU A;  2DZM A;  2LHE A;  5EDS A;  4JGH B;  1M4V A;  1MHX A;  3IBE A;  2G4D B;  4ZRJ A;  2NBV B;  2IGG A;  4W9F A;  1PGX A;  1VJK A;  1D6E C;  1V2Y A;  3MHS D;  2V3N A;  4RGM A;  3VHT C;  5FR3 A;  2MW5 A;  2NS5 A;  1WE6 A;  2FUG 1;  2LJ5 A;  2R61 A;  1MI0 A;  3J9C A;  2ACZ B;  1IBX B;  2BKF A;  3GE3 C;  3OAW A;  4CHK A;  1DOX A;  1J7A A;  1IPG A;  2V3P A;  2MA9 B;  2XK5 A;  1ZUD 2;  2IO1 B;  2BF8 B;  2IGD A;  2WX0 A;  5DPR A;  1FCC C;  1N60 A;  2JPH A;  1WF9 A;  2Y5P A;  1Y56 A;  3B2G A;  3B08 A;  2KD0 A;  4A3P A;  1NYR A;  1V81 A;  4N9F 4;  3TEX A;  5KHQ A;  2DAF A;  2FBW B;  1FXT B;  4BAX A;  4I6N B;  1FFU A;  3BYY B;  5D3I B;  3AXC A;  2ASQ A;  3ZQ4 A;  3GB1 A;  3W1Y A;  4HKZ E;  1JRP A;  2D07 B;  5D3D A;  1YN5 A;  4JWU C;  4E3C A;  3T9L A;  1C9F A;  3ZXR A;  4MGZ E;  1RM6 C;  3RNE C;  1EU3 A;  3PS6 A;  1NI3 A;  2OOB B;  2Z0D B;  3WA0 A;  3IFW B;  2KX3 A;  3Q8E A;  3ZUN A;  2MP2 A;  3BK1 A;  4URK A;  1WXQ A;  1WR1 A;  4AJW A;  1TKY A;  2SAK A;  3U8Z A;  2HJ8 A;  1CQV A;  2AQ2 B;  1YN4 A;  5E6J A;  2KAN A;  1E8X A;  4HLE A;  3OLM D;  1WE7 A;  1N61 A;  4NY0 A;  3RZW C;  2W54 A;  4EZK A;  1ZP0 B;  2IY1 B;  1RAX A;  2KJR A;  2L0F A;  1GC7 A;  3H9D A;  3I3T B;  1FNV A;  1PUT A;  1ET6 A;  4W9D A;  2K0P A;  1R4N B;  3VRA B;  5LXI B;  5LXH A;  2ZNV C;  1E7P B;  4TQ1 A;  1IGC A;  4XE0 A;  1J0G A;  1WGK A;  4DHJ B;  4IDI A;  5BMH A;  1OEY A;  3VUW A;  1TJE A;  3W1S A;  1IP9 A;  1JML A;  1E7V A;  3VUY A;  2EMT A;  4AJY B;  3R8B A;  5IKC M;  2RDG A;  5C3J B;  3PLV A;  1V1O A;  4LDT D;  4C00 A;  2AQ3 B;  1ZXH A;  1E8W A;  2D11 A;  1T6B X;  4NJ7 A;  1RFK A;  2QJL A;  3B1L X;  2WNM A;  4IWO A;  2WXO A;  4W9C A;  1V1P B;  2WDV B;  5D94 A;  1FD6 A;  3Q3F A;  4KX6 B;  2CU3 A;  3L08 A;  4MSM B;  3H7S A;  3BWU D;  5J2R A;  1IGD A;  1WH3 A;  4UDU C;  1L2N A;  3PZ7 A;  1KF6 B;  5DPS A;  3NVV A;  2M4N A;  2JRI B;  4MH0 E;  3CF6 E;  3PRE A;  2LFI A;  4W9H A;  1JAL A;  1LM8 B;  1MG4 A;  2KFK A;  4RGO S;  2LVP A;  2DEN B;  3L4P A;  3N20 C;  1STE A;  5G5G A;  2QCZ A;  2QIL A;  5JZE B;  2LMC A;  2OJR A;  2WDT B;  3WAM A;  1EF5 A;  4M02 A;  3D32 A;  4HCN B;  1SGH A;  1P7F A;  3ZTC A;  2C7H A;  2JY6 A;  4N6E B;  1HTO A;  4W9L A;  4XDC A;  2LWP A;  3JSV A;  2FAZ A;  4WAF A;  3SFD B;  4OHJ A;  2JWU A;  2J53 A;  2KQS A;  2MX2 A;  3DBS A;  3AMZ A;  1H8C A;  3DBH I;  3FAH A;  2WS3 B;  1TGZ B;  4NQK E;  1WWT A;  3A1Q B;  2AL6 A;  3MJ5 A;  2ZNV B;  4LCD E;  1KLG D;  2EEL A;  2K25 A;  3ZW3 A;  3EUB 2;  3FIL A;  2R2Q A;  2AX5 A;  2UYZ B;  1TBE A;  4C4V B;  2IO0 B;  3A9K B;  2GBR A;  1EM7 A;  1UD7 A;  4P6V F;  2KVR A;  4ANW A;  4USA A;  2JVC A;  4KIK A;  5HKH A;  4TMA B;  1KRH A;  4JX1 C;  1YJJ A;  1N5W A;  2JUO A;  1DOY A;  3PZD A;  3H7P B;  1E90 A;  1WGH A;  1ZPS A;  4ARI A;  3DVG X;  2K8B A;  2HDE A;  1NDD A;  3NZS A;  2JF5 A;  2FCM A;  2G4S A;  4LJP B;  3KYD D;  1C4C A;  4IOI E;  4PS8 A;  4BKT A;  1NBF C;  5E6O A;  1D5M C;  1HXY D;  2JRH A;  2BKR B;  4AP4 C;  1TY0 A;  4MEM A;  4AS1 A;  1LXD A;  1JRO A;  1YN3 A;  5JHB A;  2D3B A;  3NZU A;  4FN2 A;  1TS5 A;  1E10 A;  3IT4 B;  2K6D B;  5CHF A;  4GN1 A;  5JXV A;  3LDZ E;  3RUI B;  2KWU B;  1ZDV A;  1K50 A;  3EGR A;  5L83 A;  2LI5 A;  3AU5 A;  2K8H A;  4XWW A;  3Q3J A;  1G6J A;  1WXM A;  1TZ1 A;  3A33 B;  2ZW0 A;  5EE0 A;  5FR6 A;  1WZ0 A;  4MGI E;  3LJ3 A;  4I6P A;  4MJS A;  4WQO B;  2DLB A;  5CX3 A;  3Q3O C;  1WY8 A;  2DNF A;  3NVZ A;  1EWC A;  5HFY A;  2KVZ A;  2JZ3 B;  5CHW A;  3TUO A;  2GRI A;  1OTR B;  1XCQ L;  4AOF A;  2N7E A;  2D3A A;  2QC8 A;  1HEZ E;  4BOS C;  3IHP C;  2MH7 A;  3B0A A;  5D6J B;  1UNS A;  1WXA A;  1MFW A;  3AN1 A;  2L1A A;  4E74 A;  3JYU A;  3R7R A;  2BPS A;  5DCN A;  3A4S C;  3ZYY X;  1A70 A;  1C79 A;  3PO0 A;  5IAA C;  3WAO A;  2IGH A;  4MH8 A;  1SJE D;  1VLB A;  2JXX A;  4P1B C;  3KLS X;  1QOA A;  2LD9 A;  4RGT A;  2PPH A;  2BQQ A;  2FNJ B;  1FRD A;  2LGD A;  2N1W A;  2BBC A;  3VVW B;  1V8C A;  2O6V D;  3MJW A;  1TKG A;  4K7S A;  1LFD A;  4RGN A;  2PTL A;  3VDZ A;  2WU5 B;  3H1U A;  4GDK A;  4RNA A;  1J7B A;  4GU2 A;  1QIL A;  4GIV A;  2FCQ A;  2KQ4 X;  5TR5 A;  4BBN C;  2M19 A;  1SEB D;  2KTR B;  4XGA B;  5JH5 C;  2DYB A;  3ZDM C;  2BYT A;  2DYO A;  2M1M A;  3PHW B;  1YOV B;  2A5U A;  1GPX A;  1JW9 D;  3KUZ A;  5H8Y E;  1SE3 A;  1OQY A;  4HXD A;  3EA6 A;  3SU8 X;  4IM0 A;  2WXR A;  1GNU A;  4BKS D;  3AE3 B;  4NJ6 A;  3EHV A;  3B9J A;  1E0Z A;  3HM3 A;  1YQB A;  2PJH A;  3SDL C;  2K22 A;  4IWP A;  5I4D A;  3OG5 A;  3EFU A;  3GZN I;  3URY A;  1V86 A;  1TS4 A;  3KWV A;  2LGS A;  2IJ0 A;  2Q5W D;  3QAQ A;  2QHO A;  1KH0 A;  2O6V A;  3AB5 A;  2IZV B;  3AE4 B;  2LUE A;  1AN8 A;  3T8M A;  4WH4 A;  2NTT A;  3RNG C;  3QWZ B;  4M0W B;  3PLU A;  4HWI B;  3I57 A;  3W2D A;  3AEB B;  4M00 A;  3NVW A;  4HPL B;  1ZDX A;  2WGS A;  2L05 A;  2X38 A;  3AE1 B;  2EKI A;  4E71 A;  3AED B;  4KZC A;  5FK9 C;  2W9N A;  3ZGZ A;  2G3Q B;  4BZA A;  1ET9 A;  1XD3 B;  3DOW A;  4P1C C;  1RRB A;  2I38 A;  4KKI A;  2FE8 A;  2LGI A;  3AM9 A;  4LJO B;  2DWQ A;  4K3C A;  1SBB B;  2CU1 A;  4JLC A;  5C1Z A;  2LGX A;  3DBR B;  3BVG A;  1C78 A;  3SHQ A;  2RPV A;  1SXT A;  3NS8 A;  4BKS A;  3RMK C;  2K1F A;  4OW0 A;  2RDB C;  2KQ7 A;  3ECI A;  3V62 A;  2KXJ A;  3DHI C;  4Q2J A;  3CWI A;  2NBW B;  2MRP A;  4BFR A;  1QT9 A;  3GS2 A;  2A4Z A;  4WUR A;  2VZK B;  3NG0 A;  3KUC B;  2L76 A;  4WJN A;  2L8J A;  2BWE S;  4WWN A;  3WAN A;  1I4P A;  4ASW C;  1PGA A;  3I9V 1;  3H6N A;  3R2T A;  4PK1 A;  4JL9 A;  4DXG A;  5G5H A;  2KAC A;  3DWG C;  4AQ7 A;  4R3D A;  2RPQ A;  2PMV A;  1FPY A;  2XNA C;  1I4Q A;  2BGF A;  4M8M A;  3UIN B;  3AEF B;  3LYY A;  4L23 A;  2PW9 A;  1SF0 A;  2PEA A;  3DDC B;  2WXI A;  4K81 A;  2VH2 A;  3C0R B;  1JWA D;  2DZJ A;  1FIQ A;  2KDB A;  1V97 A;  2RGF A;  2TSS A;  1MG8 A;  2NVU I;  4ACF A;  2O2V B;  2BB6 A;  2HE7 A;  4RCO A;  2KN4 A;  4C56 C;  2FID A;  4X57 B;  1BUI C;  3PRM B;  2WLB A;  3ZIM A;  1QOG A;  2M0A A;  2BYE A;  3A9J A;  1XCT L;  5J18 A;  3VH3 B;  3RD2 A;  4HEA 1;  3EC8 A;  4IG7 B;  1SSN A;  3WCQ A;  3PRP B;  3O65 B;  1XLP A;  1ZKH A;  2LVO A;  1UBI A;  1Y8R C;  3V6C B;  4NJC A;  1SIJ A;  4WIP A;  1T0Q C;  4HDO A;  1P9D U;  1WGG A;  3EEC A;  2EKE C;  3PPA A;  1TIF A;  2FCN A;  1ESF A;  1XT9 B;  4RH6 A;  1WMH B;  2MBE A;  3VRB B;  1AYF A;  1UWM A;  4TKN A;  1V9J A;  5T8I A;  3OWE B;  2FCS A;  1WM2 A;  4FHK A;  2IND C;  2ICI A;  3MP9 A;  4B0E A;  4YTP B;  3BYT B;  2J0M A;  1K8R B;  2K9X A;  4A9A A;  2RR9 A;  2MJD A;  4OZA A;  2GBJ A;  1OGW A;  2YEP B;  2N0S B;  4G50 A;  3RNB C;  2C7M B;  4JPS A;  2LAS A;  1ROE A;  1HQR D;  2IO3 B;  3SEB A;  1LO5 D;  1PFD A;  2KJH B;  3HHM A;  2WXL A;  4XYC A;  4DK5 A;  2JZP A;  2VH1 A;  4EKU A;  1FNW A;  3RT3 B;  5D7G A;  1ZE3 D;  3RNF C;  4RM9 A;  3E56 A;  3Q2A C;  4LNO A;  4W9I A;  1D5Z C;  1PGB A;  3BY4 B;  5BMG A;  2KMA A;  2BWF A;  3L54 A;  4KSL C;  5BYS A;  1P1A A;  2BW2 A;  3N3K B;  4ITK A;  1WJ4 A;  2QEJ C;  4NAW A;  4HKQ A;  1WXS A;  1MHH E;  2KNB A;  1A5R A;  1FXA A;  1BML C;  2AWT A;  2KMM A;  3GE8 C;  3NS1 A;  2C9W B;  3QHT A;  3U4E G;  1R4M I;  4LNI A;  3WAP A;  2NPT A;  2V9H A;  2J0K A;  4PYU A;  4DDG D;  2KWC A;  3Q8F A;  4I6L B;  4A20 A;  2JWZ A;  1V49 A;  1WM3 A;  4XC2 A;  4ZRK A;  4WWP A;  2ZVO A;  5IOI A;  3K9P B;  2PVO D;  3ZTD A;  2PLP A;  2ZPN A;  2KAJ A;  2K39 A;  3TCA A;  3DQV A;  2MJ3 A;  3A4R A;  1R4N I;  4HJK A;  5TSS A;  3O13 A;  3DBH B;  4IM3 A;  3QK0 A;  3APD A;  3ZNI D;  4GDL B;  4GXB A;  1HZ6 A;  1EU4 A;  3BII D;  2LHD A;  4K3B A;  1DOI A;  1CJE A;  2ZW1 A;  1SE9 A;  1E6E B;  1WR6 E;  5E6P A;  2PE9 A;  2ON8 A;  3M62 B;  2BVC A;  2D3G A;  2KJ6 A;  4REZ A;  2XEW A;  2EMS A;  1L6U A;  1YQ3 B;  2N9K A;  3ZJT A;  1VZ7 A;  2MSE D;  3NZ3 A;  2D10 A;  1J19 A;  1P98 A;  2KTF A;  3NRZ A;  4ANV A;  4L2Y A;  1LQB A;  3VUX A;  4IM2 A;  4MM3 A;  1ZGU B;  1Q5W B;  3UGB B;  4FJV B;  2IO2 B;  2K3U A;  4EE2 A;  2MBH A;  2NBU A;  1FRR A;  4JQW C;  3N1Z C;  4W9E A;  3KH0 A;  1L0Y B;  2GB1 A;  2MBQ A;  1F2R I;  3RN9 C;  3UIP B;  1VZ6 A;  1KOT A;  3R7Q A;  5GXG B;  5AZH A;  1SE2 A;  3TJP A;  3KQ4 A;  4RM8 A;  4FA6 A;  4P7I A;  3QA8 A;  1OQQ A;  1I7H A;  3BIN A;  1D3Z A;  3OJ4 B;  2WXH A;  4DQO C;  4LTU A;  4C7Y A;  2L83 A;  3BK2 A;  3PRZ A;  1VDV A;  2MBO A;  3W1S C;  1C4P A;  3RUL A;  2KO3 A;  4US8 A;  1IYF A;  2KDI A;  2I1J A;  2XK5 B;  3GP7 A;  3NJT A;  1Q10 A;  1GJZ A;  4FBJ B;  4J6I A;  2D5G A;  4EUT A;  4FHJ A;  3AE2 B;  3L10 B;  2KWD A;  3AI5 A;  3PTF C;  3AE8 B;  5BYR A;  2E6X A;  2I2Y A;  4EFO A;  1Z2M A;  1QLB B;  3U2S C;  2V1Y A;  1IBX A;  3DVN U;  2KDM A;  2LJI A;  2KC1 A;  3U52 E;  1UUP A;  2DYM A;  1VD2 A;  3PSE B;  4HVB A;  2ONQ A;  2V0G A;  4K1R B;  2LGY A;  3AEC B;  2ZJD A;  1ENF A;  1YJ1 A;  4BOZ B;  1BT0 A;  2AQ1 B;  2OJW A;  3ETR A;  3NVY A;  3EFC A;  2M56 B;  3P4S B;  2KN5 A;  2MQJ A;  2MP2 B;  3MTN B;  2N4F A;  2WP9 B;  2Y3A A;  4RF0 A;  4B0M A;  3HVD A;  4DHJ D;  2Y5C A;  3ML8 A;  1GB4 A;  4JIO U;  1VCB A;  3V61 A;  4KVG B;  2J52 A;  2DX5 B;  2WXN A;  3IAS 1;  5CHV C;  1QQR A;  2BS3 B;  3DHG C;  2MEK A;  3PHX B;  3VR9 B;  2B76 B;  1HA5 A;  2GBM A;  1TY2 A;  1U4A A;  3PT2 B;  1AAR A;  2J42 A;  1JQ4 A;  4BBN F;  2FUH B;  3N30 A;  3GZN B;  1WJU A;  1C4A A;  2PVG C;  4N58 A;  3CMM B;  3E9S A;  2W3R A;  2QSD A;  1QOB A;  4LNK A;  4WJO A;  3VAW A;  2WHI A;  3AUL A;  2I1K A;  2BYV E;  2ZPY A;  2N9L A;  1FEH A;  2MHJ A;  4OVV A;  2L52 A;  3L16 A;  2N7J A;  1C1Y B;  2CHZ A;  4HK2 A;  1WFY A;  3CIR B;  2RSU A;  3PZ8 A;  3ZLZ A;  4P16 A;  4WWO A;  2WXK A;  4WJP A;  3M63 B;  4MEL A;  3MHZ A;  5HHD G;  1PDX A;  3TEY A;  3HVZ A;  4ICV A;  4B6W A;  2WXQ A;  2MWS B;  1I4R A;  2L32 A;  3L13 A;  4FJZ A;  3V05 A;  2XN9 C;  4XDD A;  1YJI A;  1S3S G;  3RI7 C;  1DYQ A;  2KFK B;  1OFF A;  1I35 A;  1V1P A;  3KWL A;  3CST A;  5D2M B;  2BS4 B;  4K7U A;  1N62 A;  3Q69 A;  1NEN B;  1XLQ A;  3ML9 A;  4CQN A;  2GLS A;  2L0T A;  3Q3M C;  4LNN A;  1XEE A;  3MC8 A;  4QAY A;  2RDH A;  3V60 A;  4LDT B;  3Q3N C;  3JSV B;  1AW7 A;  2KZR A;  3HK0 A;  3L0W B;  3RNA C;  3ZRC A;  1FNU A;  4IWQ A;  3T3O A;  2AL3 A;  3W5V B;  1TZO A;  4MAC A;  4DDI D;  1SE4 A;  3S2A A;  2REX A;  1GB1 A;  4ANX A;  1M94 A;  2K6Q A;  5GMV A;  3TIX A;  2MJE A;  1TS3 A;  5JHA A;  2W82 A;  2LXC A;  4HJG E;  4PS7 A;  3AE9 B;  2VRR B;  1JWB D;  3FIL B;  1E8Y A;  4OVU A;  3AV8 A;  2INC C;  2L7R A;  4RMA A;  3PV1 A;  4ZDV A;  2CJN A;  3ZJV A;  2BTE A;  4KIK B;  4NPN A;  3K9O B;  2WXJ A;  3A1Q A;  2YEP F;  2Y5B B;  4F1S A;  3IAM 1;  2HD5 B;  4GMV A;  3AEG B;  2C5L C;  1JCK B;  3RZF A;  1XLN A;  1V80 A;  2XBB C;  1WX8 A;  3V6E B;  3QAR A;  4FAD A;  4M01 A;  2R2O A;  1SJH D;  3VH4 B;  3OJ3 A;  4C4V A;  3A9K A;  3DBL I;  4JE3 B;  2RMM A;  1L6V A;  3I5J C;  3W9C B;  1QF6 A;  1MPE A;  1CK1 A;  2V4L A;  3UIO B;  2MBB B;  3P4P B;  1IUE A;  1R7S A;  4F7Z A;  2H88 B;  3QQ8 B;  2ZEQ A;  4RF1 A;  2Z59 B;  1CZP A;  2JU6 X;  3TMP B;  3ZNH B;  3QJZ A;  5BO4 B;  4KDI C;  3DWM A;  4RFB A;  3H7P A;  2W3S A;  2L00 B;  4KGS A;  4D2K A;  1HE8 A;  4S17 A;  2KMC A;  2JSV X;  3U7D A;  1RYJ A;  1P7E A;  3Q8C A;  1WYW B;  4MJS B;  4ZYN A;  4II2 B;  1UH6 A;  4FLH A;  2OHF A;  3I63 C;  2IDY A;  1NVI D;  2M8S A;  1EWY C;  1GG3 A;  3ZO5 B;  1QOF A;  2PIA A;  2WXM A;  1F0Z A;  5G2N A;  2K8C A;  5AZG A;  3W5U B;  5LLI A;  1JWU D;  2PKO A;  2JX5 A;  3PGE A;  4NZL B;  4II3 B;  4PYZ A;  1WJ6 A;  4WWM A;  3PVL A;  2ZZP B;  1C77 A;  4YXD B;  1EO6 A;  4TSS A;  2CHW A;  3MC9 A;  3AEE B;  4K7W A;  3UF8 A;  1VRA B;  1UGJ A;  3ENE A;  2N9P C;  3P2B A;  1I4G A;  3JVZ X;  1ZW7 A;  1MVK A;  4A90 A;  4ZYS A;  3N32 A;  4A3O A;  4ZHP A;  3P4Q B;  1YNT E;  5EE9 A;  4MGK E;  1E5W A;  2QIE B;  2HJ1 A;  2KK8 A;  1NYQ A;  4HRS A;  4GDK B;  3C19 A;  1VZ8 A;  4C80 A;  4A8X C;  4DWF A;  3X23 A;  4J3O D;  4FJY A;  3H8H A;  3IT6 B;  3QIJ A;  5AUI A;  4BVU C;  1YX5 B;  3RNC C;  1F2R C;  1R4M B;  3AEA B;  1L0V B;  4FXC A;  3AU4 A;  3P1M A;  3APF A;  3IG3 A;  4YWG G;  1X1M A;  1WXV A;  1Q1O A;  1VR9 A;  1E8Z A;  5IN7 A;  1C76 A;  5HI1 A;  2IPK D;  2JYE A;  2N7D A;  3AH7 A;  4ZOH C;  3DVN V;  3U7Z A;  4XX5 A;  2K5P A;  4G3X B;  2JXT A;  3TSS A;  4DBG A;  2JT4 B;  3R3M A;  1EF1 A;  5L95 C;  2KTR A;  2C60 A;  1I4H A;  3P63 A;  3APC A;  3HM6 X;  3P42 A;  4OVZ A;  2O6V B;  1SIF A;  4G0N B;  1WJN A;  4NNJ B;  2DZK A;  3N9Y C;  1E9M A;  2WDR B;  3RPF C;  4EZL A;  2LZ6 A;  3SD5 A;  1Z5S B;  2NMQ A;  3QCA A;  4A55 A;  2HTH A;  2X8X X;  3UQA A;  5C2T B;  2JZZ A;  1P3Q U;  4G11 A;  2KDF B;  4PT5 A;  2DBY A;  3GOE A;  3U30 A;  1C3T A;  3KW5 B;  3VFK A;  2VZK D;  2AEH A;  3L17 A;  2FIF A;  2KKC A;  4WJQ A;  4A6Q A;  1WRD B;  1FMA D;  3MFG A;  5IO9 A;  2WXG A;  4GGQ A;  2G9H D;  2J4X A;  4LNF A;  2DZI A;  4M0W A;  1V5O A;  1HZ5 A;  4HRO A;  3SFE B;  5G55 A;  5BMI A;  3R66 C;  3V3X A;  2LEK A;  1KJT A;  2KYW A;  1L7Y A;  1YD8 U;  2G45 B;  4KKJ A;  4XZ4 A;  3N1X C;  3R2I A;  4W9G A;  4KV2 A;  2SEB D;  4OZB A;  4YTN B;  2CR5 A;  1L0X B;  1WX9 A;  1T5X D;  3ZRF A;  1YX6 B;  3NUH B;  3M3J A;  3ZNZ B;  4M8N A;  1I4X A;  3WIM A;  4YL8 A;  3ZNG C;  4GLS C;  1PQS A;  3BVZ A;  4L1B A;  1WGY A;  2QMT A;  2BB5 A;  1K51 A;  1HTQ A;  5EE1 A;  1LGR A;  1NEK B;  1WGR A;  1WZ3 A;  3Q6B A;  2CS4 A;  3Q8A A;  1F77 A;  2ZCB A;  3Q8B A;  3ZDT A;  2KDE B;  3FC4 A;  4CO7 A;  1D5X C;  4O1N A;  2KC2 A;  4GOC A;  1DGJ A;  4KSK C;  2Z8L A;  4OZC A;  3TBL D;  5DPW A;  1P0R A;  4HDQ A;  2LRW A;  5AUK A;  1BXT A;  2LVQ A;  5CTR C;  5J17 A;  4IUM B;  1K53 A;  3A9J B;  3N1Y C;  3DPD A;  3NHE B;  2H89 B;  4HCP B;  1XLO A;  1SB3 C;  2IY0 B;  1N5X A;  5BYQ A;  3TEZ A;  2O2V A;  4MGY E;  2OED A;  1XF5 L;  4W9K A;  1E7U A;  2CKH B;  3C8Y A;  1UGM A;  2LUM A;  2CHX A;  2PE6 B;  4EOY A;  4US9 A;  1KFY B;  1FCL A;  2L3Z A;  3JW0 X;  4YSZ B;  2V3S A;  2LRU A;  3RFZ B;  1UEL A;  4DXA B;  2GBN A;  1B9R A;  1H4R A;  2WQY B;  2BYF A;  3DCG A;  1WRI A;  1TT5 B;  5FKA C;  2HTM E;  1KLV A;  4YSX B;  4TUU A;  4GSW A;  4HPM B;  1T0Y A;  1UWX A;  4PS3 A;  2NCN A;  3QX1 A;  1S1Q B;  2GI9 A;  3DVG Y;  1YMH E;  4CYE A;  1GC6 A;  2JQR B;  1I42 A;  1ZXI A;  3QC8 B;  3IXS A;  3VTW A;  3KVF B;  5C23 A;  1ACC A;  4KDL B;  5KHO A;  1K52 A;  1ZOY B;  1KM7 A;  4EZJ A;  1D4B A;  2KX0 A;  1OEY J;  4TV3 A;  4YSY B;  1F9J A;  2KLC A;  2UWQ A;  4DHZ B;  3VTV A;  4GB9 A;  2NTS A;  1WSP A;  3ZKJ C;  2WWZ A;  3ZXV A;  4MDK E;  1T0R C;  2D3C A;  3P4R B;  5AZF A;  1B1Z A;  2B3A A;  1WMH A;  1YIW A;  2DAJ A;  3UI3 A;  4WQM A;  1UF0 A;  4YTM B;  3LXF A;  4ANU A;  3UQB A;  3HRD D;  2BT6 A;  3ONS A;  2E3T A;  3VTU A;  4YT0 B;  3B2F A;  1QZE A;  3NY5 A;  3M95 A;  3AE7 B;  1FXI A;  1XO3 A;  3ZJU A;  1L4Z B;  1QKZ A;  3WAL A;  1RLF A;  1FM0 D;  2W55 A;  1GAQ B;  4MT5 A;  3HIZ A;  1RFA A;  3ABV B;  1JWM D;  3RCZ A;  3KUD B;  2WDQ B;  1F1H A;  2IYD B;  2N1V A;  1XQQ A;  2M0X A;  3SR6 A; 
#chains in the Genus database with same CATH homology
 2WXJ A;  4H2A A;  1D5Z C;  1PGB A;  5BMG A;  3IAM 1;  1EM7 A;  3AEG B;  4P6V F;  1JCK B;  1XLN A;  4NAW B;  5BYS A;  4USA A;  2INP E;  4LK0 M;  1TKE A;  4KGT A;  4TMA B;  4TQ0 A;  2BW2 A;  4ITK A;  1KRH A;  3AE5 B;  1SJH D;  3BVM A;  4JX1 C;  1YJJ A;  1N5W A;  4JE3 B;  2RMM A;  1L6V A;  2QEJ C;  1DOY A;  2CJO A;  3W9C B;  1QF6 A;  1MPE A;  1CK1 A;  4HKQ A;  3P4P B;  1YQ4 B;  1IUE A;  1R7S A;  1ZPS A;  1MHH E;  3LB8 C;  4ARI A;  2H88 B;  1TS2 A;  1FXA A;  2HDE A;  1BML C;  2KMM A;  4RF1 A;  1CZP A;  2JU6 X;  3NS1 A;  3U4E G;  1KLU D;  4NAM A;  1C4C A;  3DWM A;  4RFB A;  1T3Q A;  4IOI E;  2W3S A;  1D5M C;  1HXY D;  4KGS A;  1L4D B;  2WXF A;  1TY0 A;  4D2K A;  4AS1 A;  1AWD A;  3Q8F A;  1YN3 A;  1JRO A;  4LLG M;  1TS5 A;  2JSV X;  5H92 C;  1RYJ A;  5LNK 1;  1E10 A;  1P7E A;  3Q8C A;  2WXP A;  3IT4 B;  4JWS C;  5MPO A;  5JXV A;  2PVO D;  3EGR A;  1ZDV A;  1K50 A;  2PLP A;  4XWT A;  2OHF A;  2KAJ A;  3BZD B;  2MJ3 A;  2IDY A;  4XWW A;  1NVI D;  4ZRP A;  2ZW0 A;  5TSS A;  5EE0 A;  2INN E;  1EWY C;  3O13 A;  2DLB A;  1QOF A;  2PIA A;  3NVZ A;  1EWC A;  1XXG A;  4GDL B;  1TYG B;  5HFY A;  2WXM A;  1HZ6 A;  1EU4 A;  3BII D;  3TUO A;  1PYW D;  2LHD A;  1F0Z A;  2GRI A;  1GOZ A;  1DOI A;  1XCQ L;  1CJE A;  2ZW1 A;  3W5U B;  1JWS D;  3AE6 B;  1HEZ E;  1JWU D;  1KTK A;  2PKO A;  2JX5 A;  1E6E B;  3MC0 B;  4NZL B;  2JYT A;  2MH7 A;  4C7Z A;  4ZHO A;  1UNS A;  4IKG A;  2ON8 A;  3AN1 A;  2L1A A;  4WWM A;  1C77 A;  4YXD B;  4TSS A;  3AEE B;  1VRA B;  4REZ A;  1UGJ A;  3ZYY X;  1A70 A;  1C79 A;  1I4G A;  2G1E A;  3PO0 A;  3TEW A;  1RWS A;  1L6U A;  2IGH A;  1MVK A;  4A90 A;  4ZYS A;  4ARC A;  4MH8 A;  4ZHP A;  1FFV A;  1YQ3 B;  3P4Q B;  1YNT E;  1SJE D;  1VLB A;  2N9K A;  5EE9 A;  3ZJT A;  3KLS X;  1QOA A;  4MM3 B;  1VZ7 A;  3NZ3 A;  2QIE B;  4RGT A;  4HRS A;  1NYQ A;  3VQI A;  4GDK B;  1L5P A;  1FRD A;  1VZ8 A;  4C80 A;  4A8X C;  3NRZ A;  4J3O D;  2BBC A;  1V8C A;  4L2Y A;  1N63 A;  3H8H A;  3IT6 B;  1OQR A;  5AUI A;  1F2R C;  1TKG A;  4KGR A;  4RGN A;  2PTL A;  3AEA B;  2WU5 B;  1L0V B;  4FXC A;  2K3U A;  4N59 A;  4RNA A;  3P1M A;  4EE2 A;  4YWG G;  1J7B A;  1J7C A;  1FRR A;  1WYG A;  1VR9 A;  1QIL A;  3T3N A;  2V4I B;  1C76 A;  1L0Y B;  2GB1 A;  2WU2 B;  1F2R I;  2KQ4 X;  5HI1 A;  3VR8 B;  2IPK D;  1VZ6 A;  4DXF A;  2JYE A;  3AH7 A;  4ZOH C;  5HG2 A;  3U7Z A;  2M19 A;  1SEB D;  5GXG B;  1FO4 A;  2K5P A;  2BYT A;  2DYO A;  1SE2 A;  2JXT A;  3TSS A;  4ZRQ A;  5EE3 A;  1JW9 D;  1GPX A;  3KQ4 A;  5H8Y E;  2BS2 B;  1SE3 A;  3HUI A;  3EA6 A;  2LHE A;  1OQQ A;  1I7H A;  2WXR A;  1M4V A;  1MHX A;  1I4H A;  2WXH A;  3AE3 B;  3P63 A;  4DQO C;  3B9J A;  2IGG A;  3P42 A;  1E0Z A;  1PGX A;  4LTU A;  4C7Y A;  1VJK A;  2L83 A;  4OVZ A;  3BK2 A;  1D6E C;  2V3N A;  2K22 A;  1VDV A;  4RGM A;  5I4D A;  1C4P A;  5FR3 A;  3URY A;  3N9Y C;  1E9M A;  1TS4 A;  4US8 A;  3KWV A;  2WDR B;  3RPF C;  2IJ0 A;  2Q5W D;  3GP7 A;  2NMQ A;  1KH0 A;  3AB5 A;  4A55 A;  2FUG 1;  1Q10 A;  2R61 A;  3AE4 B;  1MI0 A;  3J9C A;  1AN8 A;  2ACZ B;  4WH4 A;  2D5G A;  1IBX B;  2NTT A;  5C2T B;  1DOX A;  3AE2 B;  2KWD A;  4PT5 A;  2DBY A;  1J7A A;  3AE8 B;  5BYR A;  3I57 A;  2V3P A;  2E6X A;  3W2D A;  3AEB B;  2I2Y A;  2VZK D;  3NVW A;  1ZDX A;  2X38 A;  1ZUD 2;  4A6Q A;  3AE1 B;  2EKI A;  1QLB B;  2IGD A;  3U2S C;  1FMA D;  3AED B;  3MFG A;  5FK9 C;  1IBX A;  2WXG A;  3ZGZ A;  2G9H D;  1FCC C;  2J4X A;  1N60 A;  2KDM A;  2LJI A;  2Y5P A;  4M0W A;  3U52 E;  1UUP A;  1Y56 A;  1HZ5 A;  3B2G A;  4HRO A;  3SFE B;  1ET9 A;  5BMI A;  2DYM A;  3V3X A;  2LEK A;  1NYR A;  2ONQ A;  2I38 A;  2V0G A;  4KKI A;  4KKJ A;  2FE8 A;  2LGI A;  3AM9 A;  3TEX A;  3R2I A;  2DWQ A;  2FBW B;  1SBB B;  4YTN B;  2SEB D;  3AEC B;  1FFU A;  4OZB A;  1ENF A;  3BYY B;  3BVG A;  1C78 A;  5D3I B;  2RPV A;  1L0X B;  1SXT A;  2AQ1 B;  3ETR A;  3NVY A;  3ZQ4 A;  3GB1 A;  4HKZ E;  1T5X D;  2M56 B;  3P4S B;  4OW0 A;  1JRP A;  3NUH B;  5D3D A;  1YN5 A;  4JWU C;  2WP9 B;  1C9F A;  2Y3A A;  4Q2J A;  4RF0 A;  3CWI A;  4B0M A;  3HVD A;  1RM6 C;  1I4X A;  2Y5C A;  1EU3 A;  1QT9 A;  4GLS C;  3GS2 A;  4WUR A;  1NI3 A;  4L1B A;  3BVZ A;  2QMT A;  2VZK B;  1GB4 A;  2BB5 A;  3Q8E A;  1K51 A;  2J52 A;  3BK1 A;  2WXN A;  5EE1 A;  1I4P A;  3IAS 1;  1NEK B;  1PGA A;  3I9V 1;  1QQR A;  1WXQ A;  2BS3 B;  3R2T A;  3Q8A A;  2MEK A;  3VR9 B;  1TKY A;  2SAK A;  4DXG A;  1F77 A;  3Q8B A;  5G5H A;  2KAC A;  3DWG C;  4AQ7 A;  2B76 B;  1CQV A;  1HA5 A;  4R3D A;  2AQ2 B;  1YN4 A;  5E6J A;  1TY2 A;  3FC4 A;  1D5X C;  2PMV A;  2J42 A;  1JQ4 A;  2XNA C;  1I4Q A;  1N61 A;  4O1N A;  2PVG C;  1C4A A;  2W54 A;  4N58 A;  3AEF B;  1DGJ A;  1ZP0 B;  3E9S A;  3LYY A;  4L23 A;  2W3R A;  2QSD A;  1QOB A;  2Z8L A;  2PW9 A;  1SF0 A;  4OZC A;  2WXI A;  1JWA D;  1FIQ A;  1V97 A;  2TSS A;  5AUK A;  1FNV A;  1PUT A;  1BXT A;  1ET6 A;  2K0P A;  2N9L A;  1FEH A;  3VRA B;  1E7P B;  4TQ1 A;  1IGC A;  1K53 A;  4XE0 A;  1WGK A;  2BB6 A;  4IDI A;  5BMH A;  4RCO A;  2H89 B;  2KN4 A;  4C56 C;  2L52 A;  1TJE A;  3W1S A;  1JML A;  1XLO A;  2N7J A;  1SB3 C;  1BUI C;  1N5X A;  2WLB A;  3CIR B;  1QOG A;  5BYQ A;  2M0A A;  3R8B A;  3PZ8 A;  3TEZ A;  2RDG A;  2OED A;  1XF5 L;  5C3J B;  1V1O A;  4P16 A;  1XCT L;  3C8Y A;  2WXK A;  2LUM A;  2AQ3 B;  4US9 A;  1KFY B;  1ZXH A;  4HEA 1;  3MHZ A;  1FCL A;  5HHD G;  1SSN A;  1PDX A;  1T6B X;  4YSZ B;  1RFK A;  3TEY A;  2QJL A;  3HVZ A;  2WNM A;  3RFZ B;  2WXQ A;  1B9R A;  2WXO A;  2WQY B;  3WCQ A;  1V1P B;  1WRI A;  2WDV B;  1I4R A;  5FKA C;  2HTM E;  1FD6 A;  4YSX B;  2L32 A;  1XLP A;  4KX6 B;  3V05 A;  2CU3 A;  2XN9 C;  4XDD A;  1YJI A;  1UWX A;  1DYQ A;  2GI9 A;  3BWU D;  4NJC A;  1SIJ A;  1OFF A;  1YMH E;  1IGD A;  4UDU C;  2JQR B;  1V1P A;  4WIP A;  1ZXI A;  3IXS A;  1KF6 B;  3KWL A;  3PZ7 A;  3NVV A;  2BS4 B;  1N62 A;  3Q69 A;  1NEN B;  1XLQ A;  1ACC A;  2LFI A;  4CQN A;  1K52 A;  1ZOY B;  1ESF A;  1D4B A;  1JAL A;  4RGO S;  4YSY B;  4RH6 A;  1XEE A;  2RDH A;  2NTS A;  3L4P A;  1STE A;  5G5G A;  1WSP A;  3VRB B;  2QIL A;  1AYF A;  1UWM A;  2LMC A;  1AW7 A;  5T8I A;  3OWE B;  3P4R B;  1FNU A;  3T3O A;  1P7F A;  1B1Z A;  2ICI A;  3MP9 A;  3UI3 A;  4N6E B;  3W5V B;  1TZO A;  4WQM A;  4MAC A;  4YTP B;  4B0E A;  4YTM B;  1SE4 A;  4XDC A;  3LXF A;  3BYT B;  2K9X A;  4A9A A;  2MJD A;  4WAF A;  4OZA A;  1GB1 A;  3SFD B;  3HRD D;  4OHJ A;  2JWU A;  2BT6 A;  2J53 A;  2E3T A;  3AMZ A;  4YT0 B;  2YEP B;  2N0S B;  3B2F A;  2MJE A;  1TS3 A;  4JPS A;  2W82 A;  3AE7 B;  4HJG E;  1ROE A;  3AE9 B;  3FAH A;  2WS3 B;  1HQR D;  1JWB D;  3FIL B;  1FXI A;  1XO3 A;  3SEB A;  3ZJU A;  1WWT A;  1LO5 D;  1L4Z B;  1PFD A;  1QKZ A;  3AV8 A;  2WXL A;  1FM0 D;  2W55 A;  3MJ5 A;  1GAQ B;  2JZP A;  4MT5 A;  3ABV B;  1JWM D;  1KLG D;  2CJN A;  1FNW A;  5D7G A;  1ZE3 D;  2EEL A;  2WDQ B;  3ZJV A;  3EUB 2;  2BTE A;  3FIL A;  3E56 A;  2AX5 A;  3SR6 A;  2YEP F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...