1MPEA

Ensemble of 20 structures of the tetrameric mutant of the b1 domain of streptococcal protein g
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
56
structure length
56
Chain Sequence
MQYKVILNGKTLKGETTTEAVDAATFEKVVKQFFNDNGVDGEWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Immunoglobulin G binding protein G
publication title Core mutations switch monomeric protein GB1 into an intertwined tetramer.
pubmed doi rcsb
source organism Streptococcus sp. 'group g'
total genus 5
structure length 56
sequence length 56
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2002-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1mpeA00
2N7JA 5HFYA 5BMGA 2KN4A 4D2KA 2KQ4X 4OZCA 2RPVA 1GB4A 1MHXA 5HHDG 1PGBA 2KDMA 1HEZE 1XCQL 5BMHA 1HZ6A 2JZPA 2K0PA 1YNTE 1D4BA 2KACA 2LGIA 2KWDA 4IKGA 1F2RC 2QMTA 4KGSA 5HI1A 3V3XA 2J53A 2EELA 2NMQA 2ZW1A 4HJGE 2OEDA 1P7EA 2I2YA 1UWXA 1K51A 4OZAA 1IGDA 1IBXA 1JMLA 2I38A 2ONQA 1IBXB 3UI3A 1Q10A 4MACA 1K50A 1K52A 1IGCA 5JXVA 2IGDA 2JSVX 1QKZA 1MHHE 1EM7A 2JWUA 1XCTL 1C9FA 5BMIA 2IGHA 1HZ5A 1YMHE 2QSDA 4WH4A 1PGXA 2PW9A 1MVKA 1ZXHA 2GI9A 2LHDA 3GB1A 2PLPA 2J52A 3MP9A 1MPEA 2RMMA 3FILB 2IGGA 1KH0A 1XF5L 2ZW0A 5HG2A 1FCCC 4KGTA 1FCLA 4HKZE 4GLSC 4IOIE 2LHEA 2GB1A 1F2RI 4OZBA 1P7FA 3FILA 1MI0A 2LUMA 2PTLA 2N9KA 1FD6A 1K53A 1PGAA 2N9LA 2JU6X 2ON8A 4KGRA 2JXTA 1GB1A
chains in the Genus database with same CATH superfamily
2B76B 4J3OD 1RLFA 3KYCD 4MEMA 2KHWB 4LJOB 3ZXRA 4WWPA 2FUHB 4HEA1 2LGDA 1SE3A 1WE6A 3R2TA 2DYMA 1E7VA 1WMHB 3VRAB 4IM3A 4FN2A 4TUUA 2MJ3A 3DVGY 3HRDD 5IOIA 3L13A 1K51A 3AE1B 5D3IB 1WGYA 1JWAD 2WX1A 4FHKA 2WHIA 4ZRQA 3VUYA 2WXJA 1YIWA 1WX9A 3PGEA 2BWFA 2KNBA 3AB5A 3QQ8B 5C2TB 3OWEB 1PGXA 3QARA 3OJ3A 1Q0WB 1V2YA 1R7SA 5DPTA 2R2OA 1MVKA 1UUPA 2JT4B 4US8A 1I7HA 2NVUI 1ZUD2 2UYZB 1ET6A 3GZNB 2EMTA 3VUXA 4DDGD 3ML8A 2KOXA 3HM6X 1E8ZA 4O1NA 4FADA 3VUWA 3N1YC 3IAM1 3P4RB 3QC8B 1UGMA 3QIJA 5D94A 5EE0A 3PSEB 1FM0D 1I4HA 3QHTA 1NDDA 1N60A 3KYDD 4A9AA 2KZRA 2KD0A 1XT9B 4M8NA 1FD6A 1JWMD 4F1SA 2O2VA 1KOTA 3GS2A 3L16A 4WJPA 1XLNA 1WIAA 1QT9A 3EECA 1WR1A 2WXLA 4ZHPA 4MJSB 5E6JA 1MG8A 2G9HD 2LZ6A 2L00B 3A9KB 4NZLB 2I1KA 1MHXA 3AE7B 1XCQL 4YTPB 1I42A 2MRPA 2KX3A 4OW0A 2L7RA 1KJTA 2NTTA 3ZUNA 2D3AA 2CU1A 1NYQA 4KDIC 2MX2A 2M8SA 1ZE3D 4HPMB 1FXIA 5GXGB 3AE6B 2W55A 2E6XA 2VRRB 1IGDA 4KKIA 3VR8B 3T3NA 1B1ZA 1FRDA 3TUOA 3EFCA 5C3JB 2JRHA 5JH5C 4MGIE 5IO9A 5JXVA 3A33B 3GE3C 3TEYA 1H8CA 3ABVB 2NTSA 5EDSA 4UDUC 3HIZA 1QLBB 1L4ZB 2VH1A 3ZTDA 1C9FA 4G11A 3SFEB 1LXDA 4X57B 2WXGA 1KFYB 1HQRD 2MA9B 3GB1A 3NVYA 4HPLB 3L0WB 3UQAA 1Q5WB 3TBLD 1JWUD 1LQBA 1PYWD 3GZNI 1WXQA 5J2RA 1FFUA 2DBYA 5EE9A 1JROA 3GP7A 2QCZA 4US9A 1PFDA 4HKQA 2G1EA 1EU3A 4E71A 5C23A 1D5ZC 4OZBA 1YD8U 1YJ1A 1SE4A 1LO5D 1KF6B 2K39A 2ON8A 3EHVA 1I4PA 4M0WA 4DQOC 2LVPA 1L0YB 4M00A 3R8BA 4F8CB 2DLBA 2KDBA 2KN4A 2MP2A 1FXTB 2ZZPB 1XLOA 2Y5CA 4DHJD 4IWPA 1WM3A 1HTOA 1ZOYB 2KTRA 4RF1A 4LCDE 1WYGA 4W9KA 2AL6A 1QOBA 5LLIA 1ZP0B 3WANA 3A1QA 2FCQA 2KC1A 4A3PA 2J53A 2LD9A 3KWVA 5L95C 4GGQA 2Y5BB 4WWOA 1PQSA 3N20C 4C56C 2I38A 3D32A 2K1FA 4HRSA 4KIKB 1YQ3B 1MFWA 2L0FA 2DAJA 2IGDA 5AZGA 2OHFA 2WXPA 4ZHOA 4HLEA 3FAHA 2DZIA 3PHXB 4K81A 3R7RA 5CTRC 4JGHB 4NPNA 3AV8A 2LMCA 3SFDB 4JPSA 3DBLB 1I35A 1DOXA 4FXCA 4RGNA 3A4SC 3IT4B 1SSNA 3ZTCA 3L4PA 1VRAB 1ACCA 4MSQB 3AXCA 2YEPF 4JL9A 5D2MB 4BVUC 1TZOA 4TQ0A 4CQNA 3P1MA 1WJ4A 2JRIB 1JCKB 2WXMA 1GJZA 3U7ZA 2PVGC 1WJUA 4MELA 1WYWB 1F1HA 3DBHB 1PGAA 2V9HA 4J6IA 2L83A 2WXKA 1UF0A 2VZKB 1J8CA 1HE8A 4PT5A 2LVOA 4I6LB 3FKYA 2V3NA 4URKA 1YJIA 4A6QA 2L3ZA 2K8CA 3RN9C 1D6EC 3Q6BA 5BMHA 3V61A 1FNVA 1WMHA 1C3TA 1WRDB 3UIOB 2D3CA 3A9JB 1UNSA 2CR5A 2WDRB 1RFAA 2D3BA 4EZKA 2KQ7A 4W9IA 1F52A 4C7ZA 3WAMA 3O65B 2IZVB 4H2AA 1N63A 4JE3B 3CF6E 1PDXA 1TIFA 3RZWC 2CHWA 2KVRA 3WAPA 4FULA 1XCTL 3ZW3A 3I57A 3Q3OC 4ZOHC 1FPYA 4LTUA 1TY2A 3A4RA 1DOIA 1A5RA 1QQRA 2CJNA 2AYOB 4FLHA 1YQBA 2PW9A 4PK1A 1TBEA 3R7QA 3AE2B 2J52A 5H92C 2NPTB 1JALA 4HCPB 3VTVA 1XD3B 3DBLI 2EMSA 1RYJA 3K9OB 4AUQC 4W9EA 1LGRA 1WGHA 2FBWB 2GB1A 5E6PA 4ANVA 3VVWB 1P7FA 3PZ8A 1T5XD 4MGZE 3ZRCA 4IM2A 4AOFA 2WXQA 3IFWB 2GBRA 5D7GA 1I4RA 2JU6X 3PVLA 3ZRFA 5BYRA 2H89B 3H7PB 3RFZB 1UBIA 3DBHI 1SJED 3PREA 3PTFC 4REZA 1FRRA 2BS4B 2MBBB 2MBEA 3M62B 1MG4A 1SEBD 1C4CA 3KUDB 3V62A 1TKYA 2IY1B 2WXFA 4DHZE 4QAYA 3AECB 1UGJA 3DQVA 2KLGA 4BBNF 4PS8A 1EO6A 2EELA 3RNFC 1QF6A 1J0GA 4NJ6A 3BVZA 4II3B 2I2YA 1UWXA 1ZXIA 3RYTA 4OZAA 4LK0M 1JRPA 1WGDA 4YL8A 3UI3A 5G55A 5LNK1 3CIRB 4K3BA 3VRBB 3NZ3A 3DBRI 2RDHA 2NR2A 1EM7A 2D07B 3B0AA 4ANUA 2INNE 5EE3A 1S3SG 2QSDA 3TJPA 3NRZA 1FXAA 4KV2A 4K7UA 3IXSA 1GC6A 2WU2B 3LDZE 5CHFA 5DCNA 2FAZA 3P4QB 3MFGA 1WFYA 2N9EB 3B1LX 1E8XA 3ZNHB 1WGRA 4GB9A 2N0SB 3T3OA 1KH0A 3TSSA 2WXIA 4LNIA 1A70A 3UF8A 2MJEA 4FJZA 3BVGA 4HKZE 2V4IB 1ENFA 4KVGB 2QIEB 2J42A 3DWGC 4HWIB 2KTFA 2Y3AA 2WXHA 3AE4B 2WXOA 5JZEB 3RD2A 4YWGG 1TKEA 2G4SA 3BWUD 1MJDA 4TQ1A 1AN8A 1P1AA 2K9XA 4TV3A 5HFYA 1VR9A 2KYWA 1IUEA 2L0TA 2W82A 1R4NI 1QZEA 2JQRB 1WSPA 1AW7A 2MEKA 5HHDG 1E7UA 3MJWA 1GNUA 1V1PB 1WE7A 2KWUB 4XX5A 1CMXB 1F2RC 1YN4A 2I1JA 2LWPA 4HJGE 4K1RB 2WNMA 2DYOA 4NNJB 4DXFA 1VZ6A 2D2QA 3ENEA 4WIPA 3W1SA 2LUEA 5IKCM 4RF0A 2C7MB 2KX0A 4BAXA 4XGAB 2M1MA 4LLGM 4MDKE 2XBBC 3U8ZA 3NUHB 1V49A 2BYVE 1M94A 5G5GA 4PS3A 3AE5B 2PJHA 3N9YC 3V6EB 4EFOA 4IWOA 5E6OA 2GI9A 2X38A 2OOBB 2KJ6A 4C7YA 4K7SA 4OVUA 4NY0A 2LRWA 4TKNA 1FEHA 2Y5PA 2ZJDA 1TZ1A 1N5XA 1ET9A 3ZJUA 1NBFC 2N7EA 2XK5A 2PIAA 2ACZB 2M56B 3NHEB 1TS3A 5HG2A 4ASWC 4GLSC 2FNJB 3Q8CA 2H88B 4AS1A 4B0EA 4EUTA 1V81A 2WGSA 2BYFA 4W9GA 3ZJVA 3KQ4A 4RGMA 3AI5A 4DHJB 1Q1OA 3Q3JA 3AEBB 3AM9A 3IHPC 2D3GA 1OEYA 3AE9B 4YT0B 1ZKHA 1AWDA 2KKCA 2C9WB 2KWCA 2FIFA 3AEEB 3ZDTA 4GDLA 4GMVA 5AZHA 1AYFA 1SJHD 1CJEA 1VCBA 2CHXA 2INPE 1Y8RC 4ZRIA 2UWQA 2LFIA 2K6QA 5KHQA 3ZQ4A 2LGIA 1JW9D 1KRHA 1JWSD 2W9NA 2WYQA 1UD7A 2ZPYA 4IUMB 5BO4B 1VD2A 1X1MA 5BYSA 3NVWA 3NS1A 2YEPB 1OFFA 3P2BA 3VTWA 3JSVA 2DHZA 3VR9B 3E56A 1TTNA 4RM8A 1VZ7A 4IW0A 2EKEC 2QEJC 1TJEA 2G4DB 5DPWA 1ISNA 4WH4A 4B6WA 2IO2B 2IBIB 3PZDA 3AU5A 2NPTA 2JX5A 2Z8LA 4N58A 2IGGA 3Q69A 1XLPA 4JWUC 1G6JA 1XLQA 2Z0DB 4ZYNA 2BKRB 3R3MA 4USAA 4ICVA 2RR9A 1L5PA 3AEFB 2CU3A 3DVGX 4IDIA 3UINB 4YSZB 1CQVA 3MC8A 2LI5A 3H7PA 2IPKD 1C1YB 3VAWA 4GDKB 2ZVNA 3AEGB 1ZGUB 4KZ0A 2JY6A 4B0MA 1R4MB 2MWSB 4EOYA 4DK5A 4OHJA 1WWTA 3ZO5B 3GE8C 3QA8A 3RMKC 3HK0A 2KDMA 2ZNVC 1HEZE 4WWNA 1B9RA 2HTME 3BVMA 3HVZA 2WX0A 2TSSA 3RUIB 2BPSA 4DHZB 4KGSA 4P1CC 5L83A 1E8YA 2KWVB 2KFKA 5IA7A 1GUAB 1C4AA 5CX3A 4W9DA 1OQYA 5KHOA 1Z2MA 2NBVB 4NAWA 3ALBA 4C4VB 4MACA 1K52A 2KXJA 3MC9A 3EC8A 1IGCA 2MJDA 2O6VB 2JWUA 2DAFA 3I9V1 1WX7A 2DNFA 1WZ3A 3IT6B 1UWMA 3DPDA 3DDCB 1BXTA 2L52A 1SBBB 1P9DU 2LASA 1ROEA 2RMMA 3FILB 2IO0B 2FUG1 3DOWA 1WXSA 2GOWA 4P1BC 1YN3A 1FNUA 2L32A 1KLUD 2PMVA 4HXDA 1NI2A 1JRUA 2IY0B 3L08A 4N59A 1EWCA 3AH7A 3W5VB 2KFJA 3W9CB 3HVDA 1WF9A 1N62A 4GOCA 4ICUA 4NQKE 2WDTB 5G5HA 4EEWA 1ZW7A 2IO1B 5AEKB 3L54A 2LUMA 2BF8B 2PTLA 1ZDVA 4MGKE 3RNAC 5T8IA 1YX5B 4EKUA 4GXBA 4LNKA 2KO3A 3TIXA 4WQOB 4ANWA 3RULA 3ZKJC 1GB4A 1R4MI 1GPXA 1JQ4A 1V1PA 3H9DA 4HDQA 4CHKA 1YNTE 1E90A 2V3PA 4C00A 2JYTA 1D5MC 2N1WA 2HDEA 2K8BA 4MM3B 4XWTA 3PRMB 3QK0A 1WJNA 3AEDB 1JMLA 5CHVC 1V80A 3N30A 4RMAA 1IBXB 1WR6E 2QDFA 4HK2A 2BVCA 2C7HA 3EA6A 3AU4A 3BIID 3PLVA 1N5WA 2WWZA 1PUTA 2PE9A 1VJKA 5J18A 4GSWA 3M95A 1YN5A 2HTHA 2IO3B 2XEWA 3W1SC 2CHZA 4DWFA 3KW5B 2QHOA 4YTNB 4II2B 3NOBA 2J0MA 4DXAB 4W9JA 2PKOA 2K22A 2BS2B 3ZDMC 1SIJA 2IDYA 2HE7A 3LB8C 4JWSC 2BYEA 2O2VB 1SF0A 1TKGA 1E6EB 4HJKA 2A5UA 3RPFC 1OQRA 2Z59B 1UBQA 2KJRA 1V5TA 1K8RB 3OLMD 4FJVB 2BS3B 2AWTA 2OJWA 1K53A 2MBOA 2KVZA 4BOZB 1E9MA 1TT5B 5TSSA 3AULA 2W3SA 1F77A 3B2FA 3I63C 4Q2JA 3LXFA 2LVQA 5FR3A 4RGTA 2GMIC 4YTMB 1RRBA 2RPVA 2WXRA 2BQQA 3U2SC 2JXXA 1HZ6A 4G0NB 1CK1A 3NJTA 1N6ZA 2QMTA 4DBGA 3TMPB 1WGGA 4MJSA 1RFKA 1T0RC 2ZCBA 1FFVA 2X8XX 3A9KA 1SE9A 3OG5A 3I5JC 2CS4A 3DCGA 3B9JA 1Q10A 4IWQA 4OVVA 3CMMB 2GBKA 1J7CA 4M02A 1FO4A 1V8CA 3IG3A 2IGHA 2J0KA 1WM2A 4M01A 2XN9C 1EF1A 2K8HA 3ONSA 2GBMA 2WDQB 3NZSA 4HDOA 3AE3B 3RNCC 2KMMA 2J0JA 2C5LC 4M0WB 5IN7A 2FE8A 2DZMA 4LNOA 4ZDVA 2MP2B 2Z0EB 2SEBD 4BKSA 2G3QB 2WXNA 3B08A 2VZKD 2N9KA 3JVZX 3TEWA 3PS6A 2V0GA 4GDKA 3DBSA 3BK1A 2V4LA 2BW2A 4KX6B 1J19A 1EU4A 1KTKA 4OZCA 3M3JA 2C7NB 1T0YA 2INCC 2XNAC 2MHJA 4WQMA 4XDCA 2KWDA 3NVZA 1E8WA 3NZUA 1LM8B 4EZLA 4LDTD 1V9JA 3BY4B 2MCNB 1WI0A 4IM0A 2OEDA 4ITKA 3MHZA 3PO0A 1KLGD 3OAWA 5IAAC 2L8JA 2V3SA 4ARCA 1E10A 4PS7A 3DHGC 4C4VA 3TEZA 3W2DA 3URYA 1E5WA 3LJ3A 3CWIA 2O6VA 2N1VA 4N9F4 1STEA 1P3QU 3Q3FA 3C8YA 5LXHA 5JHBA 1IP9A 1QKZA 1VLBA 2DZKA 1EWYC 4XWWA 4LNNA 2R61A 4K3CA 4HPPA 2JVCA 2J7QB 4FBJB 2DX5B 1EF5A 2WDVB 2MSED 4FA6A 4YSYB 1P98A 1TS2A 4KIKA 3E9SA 4WAFA 4L23A 4HCNB 5I4DA 1V6EA 2JUOA 5FR6A 1QOGA 3UQBA 4KZCA 3P63A 2LJIA 2ZW0A 3SU8X 2W54A 1FCCC 4KGTA 4E74A 4AJYB 4BKTA 2LXAA 3BK2A 4A90A 1J7BA 2LHEA 1V86A 2ZPNA 4HVBA 1F2RI 2M0XA 3KVFB 3Q3NC 4KSLC 4KGRA 1DGJA 1E7PB 4R3DA 2N7JA 3NS8A 5BMGA 2JWZA 2M17A 3Q8EA 1UZXB 2GBNA 1WRIA 4GU2A 2EKIA 4RGOS 1Z5SB 1PGBA 1F0ZA 2CJOA 3QCAA 1L0XB 2VH2A 1T0SC 4MM3A 3JW0X 5HI1A 3TCAA 2BTEA 2FCSA 2RSUA 1KLVA 1L6VA 1SE2A 3VH4B 1WXAA 2DZJA 5G2NA 3ML9A 2AX5A 1IBXA 4EE2A 4KDLB 4XE0A 5DPRA 4YXDB 1YX6B 1WXVA 1T6BX 3V6CB 3HM3A 4AQ7A 3TL5A 4F7ZA 4LNFA 5DPSA 3A9JA 3VHTC 3JYUA 1BMLC 1WGKA 1XQQA 3U52E 3VTUA 2WLBA 2BT6A 5IP4D 4OVZA 3DHIC 3IAS1 2JF5A 2QILA 2WP9B 3Q8BA 2LHDA 2M0AA 2N7DA 3FC4A 5AZFA 4S0RA 2NCNA 2M4NA 3DWMA 3HHMA 3H8HA 1D3ZA 1RAXA 1TYGB 4MGYE 3I3TB 2ZNVB 3ZNID 2LGSA 4W9HA 1LFDA 3J9CA 1DYQA 3ZVVA 4ARIA 2KAJA 2ASQA 2J4XA 4P6VF 1TS4A 5MPOA 3Q3MC 4RNAA 4MH8A 4AP4C 2RDBC 1FIQA 2DWQA 2WU5B 2NS5A 3BINA 1TGZB 4RFBA 1CZPA 3UIPB 3ZGZA 4A20A 4NAMA 1ZDXA 2FCMA 2KQ4X 2OJRA 4XZ4A 1XXGA 2JZ3B 2GBJA 2LEKA 2HJ8A 2PE6B 3Q14C 5D6JB 3X23A 1XO3A 2KACA 3K9PB 1WH3A 4IKGA 2FIDA 2HD5B 3V3XA 1V1OA 3PHWB 1DOYA 5C1ZA 1WY8A 1WXMA 3WAOA 3RZFA 2RD0A 2B3AA 3EFUA 3UGBB 4E3CA 2KMCA 1L4DB 2AL3A 4JX1C 2K5PA 2K25A 1L0VB 4BOSC 4ANXA 3DVNV 1AARA 3LYYA 2PEAA 5J17A 2M19A 2UU7A 1IPGA 2K3UA 2N9PC 4JIOU 3AN1A 3P4PB 1QILA 2ICIA 2MBHA 4BZAA 4FJYA 2DYBA 2GRIA 1MPEA 3AE8B 1C76A 1HA5A 1VDVA 1FCLA 4PYZA 2MLBA 3APFA 3V60A 3ZLZA 3IBEA 2KDIA 4L1BA 3U4EG 2BBCA 2L1AA 3PZ7A 1HXYD 5EE1A 3DHHC 3N32A 1C4PA 4ZRPA 4RM9A 4C80A 4IG7B 4A8XC 1NEKB 3VXWA 2JPHA 1RM6C 4K7WA 2W3RA 2WQYB 1WZ0A 4YSXB 3WIMA 3N3KB 5D3DA 2KJHB 1FMAD 4IC7B 1F9JA 2JZPA 3MTNB 1OEYJ 3CSTA 2NMQA 2ZW1A 3N1XC 1RWSA 5AUIA 5HKHA 4RCOA 2L05A 1UELA 2JZZA 2RGFA 4WJQA 3T9LA 2K6DB 1IYFA 2AQ2B 4TSSA 1C77A 3B2GA 1OQQA 2Q5WD 2ONQA 1GG3A 3W5UB 3Q2AC 1K50A 1WJ6A 3TEXA 3SR6A 1BT0A 2JSVX 1HTQA 3QWZB 4NJCA 3PPAA 4S17A 1L7YA 2BWES 4G3XB 2XK5B 1YMHE 3WALA 2GLSA 2KT7A 4HROA 4BKGA 2MW5A 3NG0A 4W9CA 3ZYYX 2BGFA 1ZXHA 3MHSD 4AWJA 2PLPA 1OGWA 4EZJA 4W9FA 2DENB 2V1YA 2NBUA 1GC7A 2KLCA 2REXA 4CO7A 3RNBC 4IOIE 3QAQA 3Q8AA 4BKSD 2A4ZA 1BUIC 2IJ0A 2D11A 4GDLB 2D5GA 3P42A 3NVVA 3KUCB 3C19A 1C79A 5H8YE 1GAQB 1GOZA 1NYRA 4BBNC 3OJ4B 4ACFA 3QJZA 2N9LA 5LXIB 3ECIA 2LGXA 2LJ5A 4I6PA 1QOFA 2YVCA 4XC2A 4B9KA 3H1UA 2N9XA 2YLMA 1FNWA 1L6UA 1UH6A 2NBWB 3GOEA 4D2KA 4LDTB 2CKHB 4MT5A 3VDZA 2E3TA 4ZYSA 3VH3B 1YQ4B 1T3QA 2BYTA 2K0PA 4FHJA 3DBRB 1TY0A 1D4BA 2R2QA 3ZNGC 4KKJA 3RT3B 3Q8FA 3JSVB 3WCQA 3ZIMA 2G45B 1SIFA 2MH7A 3SEBA 3W1YA 1EUVB 2LXCA 3NY5A 5JHAA 1L2NA 3APCA 4CYEA 3KUZA 3EGRA 5GMVA 3QX1A 3L17A 2O6VD 1SGHA 1V5OA 1M4VA 2MQJA 2MBQA 5E6NA 5FK9C 3R2IA 3P4SB 2QC8A 2IYDB 3PT2B 3BYYB 3O13A 2LGYA 1MHHE 1ESFA 3ETRA 2AQ1B 3APDA 1S1QB 3T8MA 1H4RA 1C78A 2KQSA 3H7SA 5BYQA 1QOAA 1ZPSA 2BB6A 3VQIA 2KK8A 2D10A 3BZDB 1I4XA 2PPHA 3WA0A 3MC0B 4WJNA 5TR5A 3MP9A 4JQWC 4W9LA 2KDFB 3X0WA 3N1ZC 4JLCA 4LJPB 4DDID 1YJJA 5AUKA 1R4NB 1U4AA 1J7AA 2N4FA 2LRUA 1E0ZA 3L10B 4KSKC 1YOVB 5CHWA 3RNEC 3R66C 1MI0A 4AJWA 4MSMB 1NENB 3U30A 2SAKA 4NJ7A 3SHQA 2FCNA 2JXTA 1JWBD 3HUIA 1GB1A 3M63B 1KM7A 3RI7C 2KFKB 4A55A 4WAAA 1VZ8A 3AMZA 2AQ3B 2RPQA 2KDEB 2BKFA 4WURA 4MH0E 3KWLA 2PVOD 4NAWB 2L76A 4P16A 2HJ1A 2KTRB 4XYCA 1I4GA 1P0RA 4BFRA 2ZVOA 2BB5A 3PRZA 1SXTA 3KH0A 3PLUA 4TMAB 3A1QB 4A3OA 1NVID 1Y56A 1P7EA 1XEEA 3VFKA 2AEHA 3EUB2 1TS5A 3H6NA 3C0RB 4B95A 1NI3A 3DVNU 4I6NB 3MJ5A 2ZCCA 3PRPB 1N61A 4XDDA 3CSFA 2QJLA 3ZNZB 2KANA 3V05A 3SDLC 2ZEQA 3KLSX 3IVFA 3AEAB 4WWMA 3ZJTA 4NQLB 4ZRJA 5BMIA 1HZ5A 4DXGA 2KC2A 4M8MA 2KMAA 3S2AA 1D5XC 3BYTB 1WX8A 2KN5A 5FKAC 4P7IA 4GN1A 1T0QC 2INDC 1OTRB 2RDGA 1XF5L 1I4QA 4N6EB 4L2YA 4GIVA 3U7DA 3RNGC 1SB3C 4ZRKA 3RCZA 3PV1A 4PYUA 3ZXVA 3FILA 3SD5A 1V97A 2JYEA 2C60A 2WS3B 4G50A 4WJOA 4RH6A
chains in the Genus database with same CATH topology
2B76B 3RFZB 4J3OD 1CZPA 1SJED 4REZA 1FRRA 3ZGZA 4NAMA 2BS4B 1ZDXA 2KQ4X 1SEBD 1GB4A 1XXGA 1C4CA 1GPXA 2LEKA 1JQ4A 1V1PA 1TKYA 4HEA1 1XO3A 1YNTE 2KACA 2V3PA 1SE3A 2WXFA 3R2TA 4IKGA 3AECB 1UGJA 2DYMA 2JYTA 1D5MC 3VRAB 2HDEA 3V3XA 4MM3B 1V1OA 2EELA 4XWTA 2MJ3A 1QF6A 3HRDD 3BVZA 1DOYA 2I2YA 1UWXA 1K51A 3AE1B 5D3IB 1ZXIA 3AEDB 4OZAA 1JWAD 4LK0M 1JMLA 4ZRQA 1L4DB 1JRPA 2WXJA 1IBXB 3UI3A 4JX1C 2K5PA 1L0VB 3EA6A 3BIID 3CIRB 5LNK1 1N5WA 3LYYA 1PUTA 2M19A 3VRBB 1VJKA 3NZ3A 1YN5A 2RDHA 1F0ZA 1EM7A 3AB5A 5C2TB 3OWEB 2INNE 5EE3A 2QSDA 2K3UA 1PGXA 4YTNB 1R7SA 3NRZA 1MVKA 1UUPA 3AN1A 4US8A 1I7HA 1FXAA 3P4PB 1ZUD2 1QILA 2ICIA 2PKOA 3IXSA 2K22A 2BS2B 2WU2B 2GRIA 1ET6A 1MPEA 3AE8B 3MFGA 3P4QB 1SIJA 2IDYA 1C76A 4O1NA 2N0SB 3LB8C 4JWSC 1HA5A 3T3OA 1KH0A 3TSSA 1SF0A 1TKGA 2WXIA 1A70A 1VDVA 1E6EB 3IAM1 3P4RB 2MJEA 3BVGA 5EE0A 3RPFC 1OQRA 1FCLA 4HKZE 1FM0D 1I4HA 1N60A 2V4IB 1ENFA 4L1BA 3U4EG 2BBCA 2L1AA 3PZ7A 4A9AA 2BS3B 2QIEB 1HXYD 2J42A 5EE1A 3DWGC 2Y3AA 1FD6A 2WXHA 1K53A 1JWMD 3AE4B 1C4PA 2WXOA 3GS2A 4ZRPA 4C80A 1E9MA 4YWGG 1XLNA 1TKEA 1QT9A 3BWUD 4A8XC 1NEKB 5TSSA 2W3SA 1F77A 4TQ1A 1AN8A 1RM6C 2K9XA 3B2FA 5HFYA 1VR9A 2W3RA 4Q2JA 1IUEA 2WQYB 2WXLA 4YSXB 4ZHPA 5E6JA 2G9HD 3LXFA 5FR3A 4RGTA 2W82A 4YTMB 2JQRB 2RPVA 1WSPA 2WXRA 4NZLB 1AW7A 5D3DA 2MEKA 1FMAD 1MHXA 3AE7B 5HHDG 3U2SC 1XCQL 4YTPB 1HZ6A 2JZPA 4OW0A 1CK1A 1V1PB 2NTTA 1YN4A 1F2RC 2QMTA 1NYQA 1ZE3D 5AUIA 2NMQA 2ZW1A 4HJGE 1RWSA 1FXIA 2WNMA 2DYOA 3AE6B 1RFKA 4RCOA 5GXGB 4DXFA 1VZ6A 1FFVA 2W55A 2E6XA 1IGDA 4KKIA 4WIPA 2AQ2B 4TSSA 3W1SA 1C77A 3B2GA 1OQQA 2Q5WD 3VR8B 2ONQA 4RF0A 3B9JA 3T3NA 1Q10A 1B1ZA 3W5UB 1FRDA 3TUOA 4LLGM 1K50A 5C3JB 3NUHB 3TEXA 5JXVA 3TEYA 3SR6A 3ABVB 1J7CA 2JSVX 1FO4A 2NTSA 1V8CA 4UDUC 5G5GA 4NJCA 1QLBB 1L4ZB 3AE5B 1C9FA 2IGHA 3N9YC 1YMHE 3SFEB 4HROA 2XN9C 2WXGA 3ZYYX 1ZXHA 2GI9A 2X38A 1KFYB 1HQRD 3GB1A 3NVYA 2PLPA 4C7YA 2WDQB 3AE3B 1FEHA 2Y5PA 2KMMA 1JWUD 1PYWD 1N5XA 1ET9A 3ZJUA 1WXQA 2PIAA 1FFUA 2ACZB 2FE8A 2M56B 2DBYA 5EE9A 1TS3A 5HG2A 4GLSC 4IOIE 1JROA 3GP7A 3Q8AA 4US9A 1BUIC 1PFDA 2IJ0A 3Q8CA 4HKQA 2H88B 2G1EA 1EU3A 4GDLB 4AS1A 4B0EA 2D5GA 3P42A 3NVVA 1D5ZC 2SEBD 4OZBA 1C79A 2WXNA 3ZJVA 3KQ4A 5H8YE 1GAQB 1GOZA 1NYRA 2VZKD 4RGMA 2N9KA 1SE4A 3TEWA 2V0GA 3AEBB 3AM9A 2N9LA 1LO5D 3AE9B 1KF6B 2ON8A 3BK1A 4M0WA 1I4PA 1AWDA 4YT0B 1QOFA 4DQOC 1L0YB 3R8BA 2BW2A 1FNWA 1L6UA 3AEEB 2DLBA 1EU4A 4KX6B 2KN4A 4D2KA 4MT5A 2E3TA 1KTKA 1XLOA 4ZYSA 4OZCA 2Y5CA 1AYFA 1SJHD 1CJEA 1ZOYB 4RF1A 1YQ4B 2INPE 1WYGA 2LFIA 1T3QA 2BYTA 2XNAC 2K0PA 1QOBA 1TY0A 3ZQ4A 1D4BA 2LGIA 4WQMA 4KKJA 4XDCA 2KWDA 3NVZA 1ZP0B 1JW9D 3Q8FA 1KRHA 3WCQA 2MH7A 3SEBA 2J53A 1JWSD 3KWVA 2OEDA 4ITKA 3MHZA 3EGRA 3PO0A 1KLGD 4C56C 4ARCA 1E10A 2I38A 1M4VA 3TEZA 3W2DA 3URYA 5BYSA 3NVWA 4HRSA 5FK9C 3CWIA 3R2IA 3NS1A 3P4SB 2YEPB 1OFFA 1YQ3B 3BYYB 1STEA 3VR9B 2IGDA 3E56A 2OHFA 2WXPA 4ZHOA 3C8YA 1VZ7A 3FAHA 3O13A 1QKZA 3ETRA 1MHHE 1ESFA 2QEJC 1VLBA 2AQ1B 1EWYC 1TJEA 4XWWA 1C78A 2R61A 4WH4A 5BYQA 1QOAA 1ZPSA 2WDVB 2BB6A 3AV8A 4YSYB 2LMCA 3VQIA 3BZDB 1I4XA 1TS2A 3E9SA 2JX5A 2Z8LA 3MC0B 4N58A 4WAFA 3SFDB 4JPSA 4L23A 3MP9A 1DOXA 5I4DA 4FXCA 2IGGA 4RGNA 3Q69A 1XLPA 4JWUC 3IT4B 1SSNA 1YJJA 5AUKA 1QOGA 1XLQA 3P63A 2LJIA 2ZW0A 3L4PA 2W54A 1J7AA 1FCCC 1VRAB 1ACCA 4KGTA 4USAA 3BK2A 4A90A 1E0ZA 1J7BA 2YEPF 1L5PA 2LHEA 2CU3A 3AEFB 1TZOA 4IDIA 4TQ0A 4CQNA 1F2RI 4YSZB 1CQVA 3P1MA 1JCKB 2WXMA 1MI0A 3U7ZA 2PVGC 1NENB 2SAKA 2IPKD 1PGAA 4KGRA 4GDKB 2JXTA 1DGJA 2L83A 1JWBD 1E7PB 3HUIA 1GB1A 2WXKA 3AEGB 2VZKB 4R3DA 4B0MA 2N7JA 4PT5A 5BMGA 4A55A 1VZ8A 3Q8EA 2V3NA 3AMZA 2AQ3B 4OHJA 1WRIA 1WWTA 2EKIA 4RGOS 1YJIA 4A6QA 1PGBA 2KDMA 4WURA 1HEZE 1D6EC 3KWLA 2PVOD 2CJOA 4NAWB 5BMHA 4P16A 2HTME 1L0XB 3BVMA 3HVZA 1B9RA 1I4GA 1FNVA 2TSSA 2BB5A 4KGSA 2BTEA 5HI1A 1SXTA 4TMAB 1UNSA 1NVID 1L6VA 2WDRB 1SE2A 1Y56A 1C4AA 1P7EA 1XEEA 2AX5A 3EUB2 1IBXA 4EE2A 1TS5A 4XE0A 1NI3A 4C7ZA 4YXDB 3MJ5A 1T6BX 4XDDA 1N61A 4MACA 4AQ7A 4H2AA 2QJLA 1K52A 1N63A 4JE3B 3V05A 1IGCA 2MJDA 1PDXA 3KLSX 1BMLC 2JWUA 1XCTL 3ZJTA 3AEAB 4WWMA 3I57A 1WGKA 3U52E 5BMIA 2WLBA 4ZOHC 1HZ5A 3I9V1 4LTUA 4DXGA 2BT6A 1TY2A 1DOIA 4OVZA 1QQRA 2CJNA 1D5XC 2PW9A 3IT6B 1UWMA 3BYTB 3IAS1 2QILA 2WP9B 1BXTA 3Q8BA 2L52A 2LHDA 3AE2B 1SBBB 2J52A 2M0AA 5H92C 5FKAC 3FC4A 1ROEA 2RMMA 3FILB 3DWMA 1JALA 2FUG1 3H8HA 1TYGB 1YN3A 1FNUA 2L32A 2RDGA 1KLUD 1XF5L 1I4QA 2PMVA 1RYJA 4N6EB 3J9CA 4N59A 1EWCA 4L2YA 3AH7A 1DYQA 3W5VB 3W9CB 3HVDA 1SB3C 4ARIA 2KAJA 1N62A 2J4XA 2FBWB 2GB1A 4P6VF 5G5HA 1TS4A 5MPOA 1P7FA 3FILA 3PZ8A 1V97A 1T5XD 2JYEA 2LUMA 2PTLA 2WS3B 4RNAA 1ZDVA 2WXQA 4MH8A 5D7GA 1FIQA 5T8IA 1I4RA 2JU6X 5BYRA 2DWQA 2WU5B 2H89B 4RH6A 4RFBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N7J A;  5HFY A;  5BMG A;  2KN4 A;  4D2K A;  2KQ4 X;  4OZC A;  2RPV A;  1GB4 A;  1MHX A;  5HHD G;  1PGB A;  2KDM A;  1HEZ E;  1XCQ L;  5BMH A;  1HZ6 A;  2JZP A;  2K0P A;  1YNT E;  1D4B A;  2KAC A;  2LGI A;  2KWD A;  4IKG A;  1F2R C;  2QMT A;  4KGS A;  5HI1 A;  3V3X A;  2J53 A;  2EEL A;  2NMQ A;  2ZW1 A;  4HJG E;  2OED A;  1P7E A;  2I2Y A;  1UWX A;  1K51 A;  4OZA A;  1IGD A;  1IBX A;  1JML A;  2I38 A;  2ONQ A;  1IBX B;  3UI3 A;  1Q10 A;  4MAC A;  1K50 A;  1K52 A;  1IGC A;  5JXV A;  2IGD A;  2JSV X;  1QKZ A;  1MHH E;  1EM7 A;  2JWU A;  1XCT L;  1C9F A;  5BMI A;  2IGH A;  1HZ5 A;  1YMH E;  2QSD A;  4WH4 A;  1PGX A;  2PW9 A;  1MVK A;  1ZXH A;  2GI9 A;  2LHD A;  3GB1 A;  2PLP A;  2J52 A;  3MP9 A;  1MPE A;  2RMM A;  3FIL B;  2IGG A;  1KH0 A;  1XF5 L;  2ZW0 A;  5HG2 A;  1FCC C;  4KGT A;  1FCL A;  4HKZ E;  4GLS C;  4IOI E;  2LHE A;  2GB1 A;  1F2R I;  4OZB A;  1P7F A;  3FIL A;  1MI0 A;  2LUM A;  2PTL A;  2N9K A;  1FD6 A;  1K53 A;  1PGA A;  2N9L A;  2JU6 X;  2ON8 A;  4KGR A;  2JXT A;  1GB1 A; 
#chains in the Genus database with same CATH topology
 2B76 B;  4J3O D;  1RLF A;  3KYC D;  4MEM A;  2KHW B;  4LJO B;  3ZXR A;  4WWP A;  2FUH B;  4HEA 1;  2LGD A;  1SE3 A;  1WE6 A;  3R2T A;  2DYM A;  1E7V A;  1WMH B;  3VRA B;  4IM3 A;  4FN2 A;  4TUU A;  2MJ3 A;  3DVG Y;  3HRD D;  5IOI A;  3L13 A;  1K51 A;  3AE1 B;  5D3I B;  1WGY A;  1JWA D;  2WX1 A;  4FHK A;  2WHI A;  4ZRQ A;  3VUY A;  2WXJ A;  1YIW A;  1WX9 A;  3PGE A;  2BWF A;  2KNB A;  3AB5 A;  3QQ8 B;  5C2T B;  3OWE B;  1PGX A;  3QAR A;  3OJ3 A;  1Q0W B;  1V2Y A;  1R7S A;  5DPT A;  2R2O A;  1MVK A;  1UUP A;  2JT4 B;  4US8 A;  1I7H A;  2NVU I;  1ZUD 2;  2UYZ B;  1ET6 A;  3GZN B;  2EMT A;  3VUX A;  4DDG D;  3ML8 A;  2KOX A;  3HM6 X;  1E8Z A;  4O1N A;  4FAD A;  3VUW A;  3N1Y C;  3IAM 1;  3P4R B;  3QC8 B;  1UGM A;  3QIJ A;  5D94 A;  5EE0 A;  3PSE B;  1FM0 D;  1I4H A;  3QHT A;  1NDD A;  1N60 A;  3KYD D;  4A9A A;  2KZR A;  2KD0 A;  1XT9 B;  4M8N A;  1FD6 A;  1JWM D;  4F1S A;  2O2V A;  1KOT A;  3GS2 A;  3L16 A;  4WJP A;  1XLN A;  1WIA A;  1QT9 A;  3EEC A;  1WR1 A;  2WXL A;  4ZHP A;  4MJS B;  5E6J A;  1MG8 A;  2G9H D;  2LZ6 A;  2L00 B;  3A9K B;  4NZL B;  2I1K A;  1MHX A;  3AE7 B;  1XCQ L;  4YTP B;  1I42 A;  2MRP A;  2KX3 A;  4OW0 A;  2L7R A;  1KJT A;  2NTT A;  3ZUN A;  2D3A A;  2CU1 A;  1NYQ A;  4KDI C;  2MX2 A;  2M8S A;  1ZE3 D;  4HPM B;  1FXI A;  5GXG B;  3AE6 B;  2W55 A;  2E6X A;  2VRR B;  1IGD A;  4KKI A;  3VR8 B;  3T3N A;  1B1Z A;  1FRD A;  3TUO A;  3EFC A;  5C3J B;  2JRH A;  5JH5 C;  4MGI E;  5IO9 A;  5JXV A;  3A33 B;  3GE3 C;  3TEY A;  1H8C A;  3ABV B;  2NTS A;  5EDS A;  4UDU C;  3HIZ A;  1QLB B;  1L4Z B;  2VH1 A;  3ZTD A;  1C9F A;  4G11 A;  3SFE B;  1LXD A;  4X57 B;  2WXG A;  1KFY B;  1HQR D;  2MA9 B;  3GB1 A;  3NVY A;  4HPL B;  3L0W B;  3UQA A;  1Q5W B;  3TBL D;  1JWU D;  1LQB A;  1PYW D;  3GZN I;  1WXQ A;  5J2R A;  1FFU A;  2DBY A;  5EE9 A;  1JRO A;  3GP7 A;  2QCZ A;  4US9 A;  1PFD A;  4HKQ A;  2G1E A;  1EU3 A;  4E71 A;  5C23 A;  1D5Z C;  4OZB A;  1YD8 U;  1YJ1 A;  1SE4 A;  1LO5 D;  1KF6 B;  2K39 A;  2ON8 A;  3EHV A;  1I4P A;  4M0W A;  4DQO C;  2LVP A;  1L0Y B;  4M00 A;  3R8B A;  4F8C B;  2DLB A;  2KDB A;  2KN4 A;  2MP2 A;  1FXT B;  2ZZP B;  1XLO A;  2Y5C A;  4DHJ D;  4IWP A;  1WM3 A;  1HTO A;  1ZOY B;  2KTR A;  4RF1 A;  4LCD E;  1WYG A;  4W9K A;  2AL6 A;  1QOB A;  5LLI A;  1ZP0 B;  3WAN A;  3A1Q A;  2FCQ A;  2KC1 A;  4A3P A;  2J53 A;  2LD9 A;  3KWV A;  5L95 C;  4GGQ A;  2Y5B B;  4WWO A;  1PQS A;  3N20 C;  4C56 C;  2I38 A;  3D32 A;  2K1F A;  4HRS A;  4KIK B;  1YQ3 B;  1MFW A;  2L0F A;  2DAJ A;  2IGD A;  5AZG A;  2OHF A;  2WXP A;  4ZHO A;  4HLE A;  3FAH A;  2DZI A;  3PHX B;  4K81 A;  3R7R A;  5CTR C;  4JGH B;  4NPN A;  3AV8 A;  2LMC A;  3SFD B;  4JPS A;  3DBL B;  1I35 A;  1DOX A;  4FXC A;  4RGN A;  3A4S C;  3IT4 B;  1SSN A;  3ZTC A;  3L4P A;  1VRA B;  1ACC A;  4MSQ B;  3AXC A;  2YEP F;  4JL9 A;  5D2M B;  4BVU C;  1TZO A;  4TQ0 A;  4CQN A;  3P1M A;  1WJ4 A;  2JRI B;  1JCK B;  2WXM A;  1GJZ A;  3U7Z A;  2PVG C;  1WJU A;  4MEL A;  1WYW B;  1F1H A;  3DBH B;  1PGA A;  2V9H A;  4J6I A;  2L83 A;  2WXK A;  1UF0 A;  2VZK B;  1J8C A;  1HE8 A;  4PT5 A;  2LVO A;  4I6L B;  3FKY A;  2V3N A;  4URK A;  1YJI A;  4A6Q A;  2L3Z A;  2K8C A;  3RN9 C;  1D6E C;  3Q6B A;  5BMH A;  3V61 A;  1FNV A;  1WMH A;  1C3T A;  1WRD B;  3UIO B;  2D3C A;  3A9J B;  1UNS A;  2CR5 A;  2WDR B;  1RFA A;  2D3B A;  4EZK A;  2KQ7 A;  4W9I A;  1F52 A;  4C7Z A;  3WAM A;  3O65 B;  2IZV B;  4H2A A;  1N63 A;  4JE3 B;  3CF6 E;  1PDX A;  1TIF A;  3RZW C;  2CHW A;  2KVR A;  3WAP A;  4FUL A;  1XCT L;  3ZW3 A;  3I57 A;  3Q3O C;  4ZOH C;  1FPY A;  4LTU A;  1TY2 A;  3A4R A;  1DOI A;  1A5R A;  1QQR A;  2CJN A;  2AYO B;  4FLH A;  1YQB A;  2PW9 A;  4PK1 A;  1TBE A;  3R7Q A;  3AE2 B;  2J52 A;  5H92 C;  2NPT B;  1JAL A;  4HCP B;  3VTV A;  1XD3 B;  3DBL I;  2EMS A;  1RYJ A;  3K9O B;  4AUQ C;  4W9E A;  1LGR A;  1WGH A;  2FBW B;  2GB1 A;  5E6P A;  4ANV A;  3VVW B;  1P7F A;  3PZ8 A;  1T5X D;  4MGZ E;  3ZRC A;  4IM2 A;  4AOF A;  2WXQ A;  3IFW B;  2GBR A;  5D7G A;  1I4R A;  2JU6 X;  3PVL A;  3ZRF A;  5BYR A;  2H89 B;  3H7P B;  3RFZ B;  1UBI A;  3DBH I;  1SJE D;  3PRE A;  3PTF C;  4REZ A;  1FRR A;  2BS4 B;  2MBB B;  2MBE A;  3M62 B;  1MG4 A;  1SEB D;  1C4C A;  3KUD B;  3V62 A;  1TKY A;  2IY1 B;  2WXF A;  4DHZ E;  4QAY A;  3AEC B;  1UGJ A;  3DQV A;  2KLG A;  4BBN F;  4PS8 A;  1EO6 A;  2EEL A;  3RNF C;  1QF6 A;  1J0G A;  4NJ6 A;  3BVZ A;  4II3 B;  2I2Y A;  1UWX A;  1ZXI A;  3RYT A;  4OZA A;  4LK0 M;  1JRP A;  1WGD A;  4YL8 A;  3UI3 A;  5G55 A;  5LNK 1;  3CIR B;  4K3B A;  3VRB B;  3NZ3 A;  3DBR I;  2RDH A;  2NR2 A;  1EM7 A;  2D07 B;  3B0A A;  4ANU A;  2INN E;  5EE3 A;  1S3S G;  2QSD A;  3TJP A;  3NRZ A;  1FXA A;  4KV2 A;  4K7U A;  3IXS A;  1GC6 A;  2WU2 B;  3LDZ E;  5CHF A;  5DCN A;  2FAZ A;  3P4Q B;  3MFG A;  1WFY A;  2N9E B;  3B1L X;  1E8X A;  3ZNH B;  1WGR A;  4GB9 A;  2N0S B;  3T3O A;  1KH0 A;  3TSS A;  2WXI A;  4LNI A;  1A70 A;  3UF8 A;  2MJE A;  4FJZ A;  3BVG A;  4HKZ E;  2V4I B;  1ENF A;  4KVG B;  2QIE B;  2J42 A;  3DWG C;  4HWI B;  2KTF A;  2Y3A A;  2WXH A;  3AE4 B;  2WXO A;  5JZE B;  3RD2 A;  4YWG G;  1TKE A;  2G4S A;  3BWU D;  1MJD A;  4TQ1 A;  1AN8 A;  1P1A A;  2K9X A;  4TV3 A;  5HFY A;  1VR9 A;  2KYW A;  1IUE A;  2L0T A;  2W82 A;  1R4N I;  1QZE A;  2JQR B;  1WSP A;  1AW7 A;  2MEK A;  5HHD G;  1E7U A;  3MJW A;  1GNU A;  1V1P B;  1WE7 A;  2KWU B;  4XX5 A;  1CMX B;  1F2R C;  1YN4 A;  2I1J A;  2LWP A;  4HJG E;  4K1R B;  2WNM A;  2DYO A;  4NNJ B;  4DXF A;  1VZ6 A;  2D2Q A;  3ENE A;  4WIP A;  3W1S A;  2LUE A;  5IKC M;  4RF0 A;  2C7M B;  2KX0 A;  4BAX A;  4XGA B;  2M1M A;  4LLG M;  4MDK E;  2XBB C;  3U8Z A;  3NUH B;  1V49 A;  2BYV E;  1M94 A;  5G5G A;  4PS3 A;  3AE5 B;  2PJH A;  3N9Y C;  3V6E B;  4EFO A;  4IWO A;  5E6O A;  2GI9 A;  2X38 A;  2OOB B;  2KJ6 A;  4C7Y A;  4K7S A;  4OVU A;  4NY0 A;  2LRW A;  4TKN A;  1FEH A;  2Y5P A;  2ZJD A;  1TZ1 A;  1N5X A;  1ET9 A;  3ZJU A;  1NBF C;  2N7E A;  2XK5 A;  2PIA A;  2ACZ B;  2M56 B;  3NHE B;  1TS3 A;  5HG2 A;  4ASW C;  4GLS C;  2FNJ B;  3Q8C A;  2H88 B;  4AS1 A;  4B0E A;  4EUT A;  1V81 A;  2WGS A;  2BYF A;  4W9G A;  3ZJV A;  3KQ4 A;  4RGM A;  3AI5 A;  4DHJ B;  1Q1O A;  3Q3J A;  3AEB B;  3AM9 A;  3IHP C;  2D3G A;  1OEY A;  3AE9 B;  4YT0 B;  1ZKH A;  1AWD A;  2KKC A;  2C9W B;  2KWC A;  2FIF A;  3AEE B;  3ZDT A;  4GDL A;  4GMV A;  5AZH A;  1AYF A;  1SJH D;  1CJE A;  1VCB A;  2CHX A;  2INP E;  1Y8R C;  4ZRI A;  2UWQ A;  2LFI A;  2K6Q A;  5KHQ A;  3ZQ4 A;  2LGI A;  1JW9 D;  1KRH A;  1JWS D;  2W9N A;  2WYQ A;  1UD7 A;  2ZPY A;  4IUM B;  5BO4 B;  1VD2 A;  1X1M A;  5BYS A;  3NVW A;  3NS1 A;  2YEP B;  1OFF A;  3P2B A;  3VTW A;  3JSV A;  2DHZ A;  3VR9 B;  3E56 A;  1TTN A;  4RM8 A;  1VZ7 A;  4IW0 A;  2EKE C;  2QEJ C;  1TJE A;  2G4D B;  5DPW A;  1ISN A;  4WH4 A;  4B6W A;  2IO2 B;  2IBI B;  3PZD A;  3AU5 A;  2NPT A;  2JX5 A;  2Z8L A;  4N58 A;  2IGG A;  3Q69 A;  1XLP A;  4JWU C;  1G6J A;  1XLQ A;  2Z0D B;  4ZYN A;  2BKR B;  3R3M A;  4USA A;  4ICV A;  2RR9 A;  1L5P A;  3AEF B;  2CU3 A;  3DVG X;  4IDI A;  3UIN B;  4YSZ B;  1CQV A;  3MC8 A;  2LI5 A;  3H7P A;  2IPK D;  1C1Y B;  3VAW A;  4GDK B;  2ZVN A;  3AEG B;  1ZGU B;  4KZ0 A;  2JY6 A;  4B0M A;  1R4M B;  2MWS B;  4EOY A;  4DK5 A;  4OHJ A;  1WWT A;  3ZO5 B;  3GE8 C;  3QA8 A;  3RMK C;  3HK0 A;  2KDM A;  2ZNV C;  1HEZ E;  4WWN A;  1B9R A;  2HTM E;  3BVM A;  3HVZ A;  2WX0 A;  2TSS A;  3RUI B;  2BPS A;  4DHZ B;  4KGS A;  4P1C C;  5L83 A;  1E8Y A;  2KWV B;  2KFK A;  5IA7 A;  1GUA B;  1C4A A;  5CX3 A;  4W9D A;  1OQY A;  5KHO A;  1Z2M A;  2NBV B;  4NAW A;  3ALB A;  4C4V B;  4MAC A;  1K52 A;  2KXJ A;  3MC9 A;  3EC8 A;  1IGC A;  2MJD A;  2O6V B;  2JWU A;  2DAF A;  3I9V 1;  1WX7 A;  2DNF A;  1WZ3 A;  3IT6 B;  1UWM A;  3DPD A;  3DDC B;  1BXT A;  2L52 A;  1SBB B;  1P9D U;  2LAS A;  1ROE A;  2RMM A;  3FIL B;  2IO0 B;  2FUG 1;  3DOW A;  1WXS A;  2GOW A;  4P1B C;  1YN3 A;  1FNU A;  2L32 A;  1KLU D;  2PMV A;  4HXD A;  1NI2 A;  1JRU A;  2IY0 B;  3L08 A;  4N59 A;  1EWC A;  3AH7 A;  3W5V B;  2KFJ A;  3W9C B;  3HVD A;  1WF9 A;  1N62 A;  4GOC A;  4ICU A;  4NQK E;  2WDT B;  5G5H A;  4EEW A;  1ZW7 A;  2IO1 B;  5AEK B;  3L54 A;  2LUM A;  2BF8 B;  2PTL A;  1ZDV A;  4MGK E;  3RNA C;  5T8I A;  1YX5 B;  4EKU A;  4GXB A;  4LNK A;  2KO3 A;  3TIX A;  4WQO B;  4ANW A;  3RUL A;  3ZKJ C;  1GB4 A;  1R4M I;  1GPX A;  1JQ4 A;  1V1P A;  3H9D A;  4HDQ A;  4CHK A;  1YNT E;  1E90 A;  2V3P A;  4C00 A;  2JYT A;  1D5M C;  2N1W A;  2HDE A;  2K8B A;  4MM3 B;  4XWT A;  3PRM B;  3QK0 A;  1WJN A;  3AED B;  1JML A;  5CHV C;  1V80 A;  3N30 A;  4RMA A;  1IBX B;  1WR6 E;  2QDF A;  4HK2 A;  2BVC A;  2C7H A;  3EA6 A;  3AU4 A;  3BII D;  3PLV A;  1N5W A;  2WWZ A;  1PUT A;  2PE9 A;  1VJK A;  5J18 A;  4GSW A;  3M95 A;  1YN5 A;  2HTH A;  2IO3 B;  2XEW A;  3W1S C;  2CHZ A;  4DWF A;  3KW5 B;  2QHO A;  4YTN B;  4II2 B;  3NOB A;  2J0M A;  4DXA B;  4W9J A;  2PKO A;  2K22 A;  2BS2 B;  3ZDM C;  1SIJ A;  2IDY A;  2HE7 A;  3LB8 C;  4JWS C;  2BYE A;  2O2V B;  1SF0 A;  1TKG A;  1E6E B;  4HJK A;  2A5U A;  3RPF C;  1OQR A;  2Z59 B;  1UBQ A;  2KJR A;  1V5T A;  1K8R B;  3OLM D;  4FJV B;  2BS3 B;  2AWT A;  2OJW A;  1K53 A;  2MBO A;  2KVZ A;  4BOZ B;  1E9M A;  1TT5 B;  5TSS A;  3AUL A;  2W3S A;  1F77 A;  3B2F A;  3I63 C;  4Q2J A;  3LXF A;  2LVQ A;  5FR3 A;  4RGT A;  2GMI C;  4YTM B;  1RRB A;  2RPV A;  2WXR A;  2BQQ A;  3U2S C;  2JXX A;  1HZ6 A;  4G0N B;  1CK1 A;  3NJT A;  1N6Z A;  2QMT A;  4DBG A;  3TMP B;  1WGG A;  4MJS A;  1RFK A;  1T0R C;  2ZCB A;  1FFV A;  2X8X X;  3A9K A;  1SE9 A;  3OG5 A;  3I5J C;  2CS4 A;  3DCG A;  3B9J A;  1Q10 A;  4IWQ A;  4OVV A;  3CMM B;  2GBK A;  1J7C A;  4M02 A;  1FO4 A;  1V8C A;  3IG3 A;  2IGH A;  2J0K A;  1WM2 A;  4M01 A;  2XN9 C;  1EF1 A;  2K8H A;  3ONS A;  2GBM A;  2WDQ B;  3NZS A;  4HDO A;  3AE3 B;  3RNC C;  2KMM A;  2J0J A;  2C5L C;  4M0W B;  5IN7 A;  2FE8 A;  2DZM A;  4LNO A;  4ZDV A;  2MP2 B;  2Z0E B;  2SEB D;  4BKS A;  2G3Q B;  2WXN A;  3B08 A;  2VZK D;  2N9K A;  3JVZ X;  3TEW A;  3PS6 A;  2V0G A;  4GDK A;  3DBS A;  3BK1 A;  2V4L A;  2BW2 A;  4KX6 B;  1J19 A;  1EU4 A;  1KTK A;  4OZC A;  3M3J A;  2C7N B;  1T0Y A;  2INC C;  2XNA C;  2MHJ A;  4WQM A;  4XDC A;  2KWD A;  3NVZ A;  1E8W A;  3NZU A;  1LM8 B;  4EZL A;  4LDT D;  1V9J A;  3BY4 B;  2MCN B;  1WI0 A;  4IM0 A;  2OED A;  4ITK A;  3MHZ A;  3PO0 A;  1KLG D;  3OAW A;  5IAA C;  2L8J A;  2V3S A;  4ARC A;  1E10 A;  4PS7 A;  3DHG C;  4C4V A;  3TEZ A;  3W2D A;  3URY A;  1E5W A;  3LJ3 A;  3CWI A;  2O6V A;  2N1V A;  4N9F 4;  1STE A;  1P3Q U;  3Q3F A;  3C8Y A;  5LXH A;  5JHB A;  1IP9 A;  1QKZ A;  1VLB A;  2DZK A;  1EWY C;  4XWW A;  4LNN A;  2R61 A;  4K3C A;  4HPP A;  2JVC A;  2J7Q B;  4FBJ B;  2DX5 B;  1EF5 A;  2WDV B;  2MSE D;  4FA6 A;  4YSY B;  1P98 A;  1TS2 A;  4KIK A;  3E9S A;  4WAF A;  4L23 A;  4HCN B;  5I4D A;  1V6E A;  2JUO A;  5FR6 A;  1QOG A;  3UQB A;  4KZC A;  3P63 A;  2LJI A;  2ZW0 A;  3SU8 X;  2W54 A;  1FCC C;  4KGT A;  4E74 A;  4AJY B;  4BKT A;  2LXA A;  3BK2 A;  4A90 A;  1J7B A;  2LHE A;  1V86 A;  2ZPN A;  4HVB A;  1F2R I;  2M0X A;  3KVF B;  3Q3N C;  4KSL C;  4KGR A;  1DGJ A;  1E7P B;  4R3D A;  2N7J A;  3NS8 A;  5BMG A;  2JWZ A;  2M17 A;  3Q8E A;  1UZX B;  2GBN A;  1WRI A;  4GU2 A;  2EKI A;  4RGO S;  1Z5S B;  1PGB A;  1F0Z A;  2CJO A;  3QCA A;  1L0X B;  2VH2 A;  1T0S C;  4MM3 A;  3JW0 X;  5HI1 A;  3TCA A;  2BTE A;  2FCS A;  2RSU A;  1KLV A;  1L6V A;  1SE2 A;  3VH4 B;  1WXA A;  2DZJ A;  5G2N A;  3ML9 A;  2AX5 A;  1IBX A;  4EE2 A;  4KDL B;  4XE0 A;  5DPR A;  4YXD B;  1YX6 B;  1WXV A;  1T6B X;  3V6C B;  3HM3 A;  4AQ7 A;  3TL5 A;  4F7Z A;  4LNF A;  5DPS A;  3A9J A;  3VHT C;  3JYU A;  1BML C;  1WGK A;  1XQQ A;  3U52 E;  3VTU A;  2WLB A;  2BT6 A;  5IP4 D;  4OVZ A;  3DHI C;  3IAS 1;  2JF5 A;  2QIL A;  2WP9 B;  3Q8B A;  2LHD A;  2M0A A;  2N7D A;  3FC4 A;  5AZF A;  4S0R A;  2NCN A;  2M4N A;  3DWM A;  3HHM A;  3H8H A;  1D3Z A;  1RAX A;  1TYG B;  4MGY E;  3I3T B;  2ZNV B;  3ZNI D;  2LGS A;  4W9H A;  1LFD A;  3J9C A;  1DYQ A;  3ZVV A;  4ARI A;  2KAJ A;  2ASQ A;  2J4X A;  4P6V F;  1TS4 A;  5MPO A;  3Q3M C;  4RNA A;  4MH8 A;  4AP4 C;  2RDB C;  1FIQ A;  2DWQ A;  2WU5 B;  2NS5 A;  3BIN A;  1TGZ B;  4RFB A;  1CZP A;  3UIP B;  3ZGZ A;  4A20 A;  4NAM A;  1ZDX A;  2FCM A;  2KQ4 X;  2OJR A;  4XZ4 A;  1XXG A;  2JZ3 B;  2GBJ A;  2LEK A;  2HJ8 A;  2PE6 B;  3Q14 C;  5D6J B;  3X23 A;  1XO3 A;  2KAC A;  3K9P B;  1WH3 A;  4IKG A;  2FID A;  2HD5 B;  3V3X A;  1V1O A;  3PHW B;  1DOY A;  5C1Z A;  1WY8 A;  1WXM A;  3WAO A;  3RZF A;  2RD0 A;  2B3A A;  3EFU A;  3UGB B;  4E3C A;  2KMC A;  1L4D B;  2AL3 A;  4JX1 C;  2K5P A;  2K25 A;  1L0V B;  4BOS C;  4ANX A;  3DVN V;  1AAR A;  3LYY A;  2PEA A;  5J17 A;  2M19 A;  2UU7 A;  1IPG A;  2K3U A;  2N9P C;  4JIO U;  3AN1 A;  3P4P B;  1QIL A;  2ICI A;  2MBH A;  4BZA A;  4FJY A;  2DYB A;  2GRI A;  1MPE A;  3AE8 B;  1C76 A;  1HA5 A;  1VDV A;  1FCL A;  4PYZ A;  2MLB A;  3APF A;  3V60 A;  3ZLZ A;  3IBE A;  2KDI A;  4L1B A;  3U4E G;  2BBC A;  2L1A A;  3PZ7 A;  1HXY D;  5EE1 A;  3DHH C;  3N32 A;  1C4P A;  4ZRP A;  4RM9 A;  4C80 A;  4IG7 B;  4A8X C;  1NEK B;  3VXW A;  2JPH A;  1RM6 C;  4K7W A;  2W3R A;  2WQY B;  1WZ0 A;  4YSX B;  3WIM A;  3N3K B;  5D3D A;  2KJH B;  1FMA D;  4IC7 B;  1F9J A;  2JZP A;  3MTN B;  1OEY J;  3CST A;  2NMQ A;  2ZW1 A;  3N1X C;  1RWS A;  5AUI A;  5HKH A;  4RCO A;  2L05 A;  1UEL A;  2JZZ A;  2RGF A;  4WJQ A;  3T9L A;  2K6D B;  1IYF A;  2AQ2 B;  4TSS A;  1C77 A;  3B2G A;  1OQQ A;  2Q5W D;  2ONQ A;  1GG3 A;  3W5U B;  3Q2A C;  1K50 A;  1WJ6 A;  3TEX A;  3SR6 A;  1BT0 A;  2JSV X;  1HTQ A;  3QWZ B;  4NJC A;  3PPA A;  4S17 A;  1L7Y A;  2BWE S;  4G3X B;  2XK5 B;  1YMH E;  3WAL A;  2GLS A;  2KT7 A;  4HRO A;  4BKG A;  2MW5 A;  3NG0 A;  4W9C A;  3ZYY X;  2BGF A;  1ZXH A;  3MHS D;  4AWJ A;  2PLP A;  1OGW A;  4EZJ A;  4W9F A;  2DEN B;  2V1Y A;  2NBU A;  1GC7 A;  2KLC A;  2REX A;  4CO7 A;  3RNB C;  4IOI E;  3QAQ A;  3Q8A A;  4BKS D;  2A4Z A;  1BUI C;  2IJ0 A;  2D11 A;  4GDL B;  2D5G A;  3P42 A;  3NVV A;  3KUC B;  3C19 A;  1C79 A;  5H8Y E;  1GAQ B;  1GOZ A;  1NYR A;  4BBN C;  3OJ4 B;  4ACF A;  3QJZ A;  2N9L A;  5LXI B;  3ECI A;  2LGX A;  2LJ5 A;  4I6P A;  1QOF A;  2YVC A;  4XC2 A;  4B9K A;  3H1U A;  2N9X A;  2YLM A;  1FNW A;  1L6U A;  1UH6 A;  2NBW B;  3GOE A;  4D2K A;  4LDT B;  2CKH B;  4MT5 A;  3VDZ A;  2E3T A;  4ZYS A;  3VH3 B;  1YQ4 B;  1T3Q A;  2BYT A;  2K0P A;  4FHJ A;  3DBR B;  1TY0 A;  1D4B A;  2R2Q A;  3ZNG C;  4KKJ A;  3RT3 B;  3Q8F A;  3JSV B;  3WCQ A;  3ZIM A;  2G45 B;  1SIF A;  2MH7 A;  3SEB A;  3W1Y A;  1EUV B;  2LXC A;  3NY5 A;  5JHA A;  1L2N A;  3APC A;  4CYE A;  3KUZ A;  3EGR A;  5GMV A;  3QX1 A;  3L17 A;  2O6V D;  1SGH A;  1V5O A;  1M4V A;  2MQJ A;  2MBQ A;  5E6N A;  5FK9 C;  3R2I A;  3P4S B;  2QC8 A;  2IYD B;  3PT2 B;  3BYY B;  3O13 A;  2LGY A;  1MHH E;  1ESF A;  3ETR A;  2AQ1 B;  3APD A;  1S1Q B;  3T8M A;  1H4R A;  1C78 A;  2KQS A;  3H7S A;  5BYQ A;  1QOA A;  1ZPS A;  2BB6 A;  3VQI A;  2KK8 A;  2D10 A;  3BZD B;  1I4X A;  2PPH A;  3WA0 A;  3MC0 B;  4WJN A;  5TR5 A;  3MP9 A;  4JQW C;  4W9L A;  2KDF B;  3X0W A;  3N1Z C;  4JLC A;  4LJP B;  4DDI D;  1YJJ A;  5AUK A;  1R4N B;  1U4A A;  1J7A A;  2N4F A;  2LRU A;  1E0Z A;  3L10 B;  4KSK C;  1YOV B;  5CHW A;  3RNE C;  3R66 C;  1MI0 A;  4AJW A;  4MSM B;  1NEN B;  3U30 A;  2SAK A;  4NJ7 A;  3SHQ A;  2FCN A;  2JXT A;  1JWB D;  3HUI A;  1GB1 A;  3M63 B;  1KM7 A;  3RI7 C;  2KFK B;  4A55 A;  4WAA A;  1VZ8 A;  3AMZ A;  2AQ3 B;  2RPQ A;  2KDE B;  2BKF A;  4WUR A;  4MH0 E;  3KWL A;  2PVO D;  4NAW B;  2L76 A;  4P16 A;  2HJ1 A;  2KTR B;  4XYC A;  1I4G A;  1P0R A;  4BFR A;  2ZVO A;  2BB5 A;  3PRZ A;  1SXT A;  3KH0 A;  3PLU A;  4TMA B;  3A1Q B;  4A3O A;  1NVI D;  1Y56 A;  1P7E A;  1XEE A;  3VFK A;  2AEH A;  3EUB 2;  1TS5 A;  3H6N A;  3C0R B;  4B95 A;  1NI3 A;  3DVN U;  4I6N B;  3MJ5 A;  2ZCC A;  3PRP B;  1N61 A;  4XDD A;  3CSF A;  2QJL A;  3ZNZ B;  2KAN A;  3V05 A;  3SDL C;  2ZEQ A;  3KLS X;  3IVF A;  3AEA B;  4WWM A;  3ZJT A;  4NQL B;  4ZRJ A;  5BMI A;  1HZ5 A;  4DXG A;  2KC2 A;  4M8M A;  2KMA A;  3S2A A;  1D5X C;  3BYT B;  1WX8 A;  2KN5 A;  5FKA C;  4P7I A;  4GN1 A;  1T0Q C;  2IND C;  1OTR B;  2RDG A;  1XF5 L;  1I4Q A;  4N6E B;  4L2Y A;  4GIV A;  3U7D A;  3RNG C;  1SB3 C;  4ZRK A;  3RCZ A;  3PV1 A;  4PYU A;  3ZXV A;  3FIL A;  3SD5 A;  1V97 A;  2JYE A;  2C60 A;  2WS3 B;  4G50 A;  4WJO A;  4RH6 A; 
#chains in the Genus database with same CATH homology
 2B76 B;  3RFZ B;  4J3O D;  1CZP A;  1SJE D;  4REZ A;  1FRR A;  3ZGZ A;  4NAM A;  2BS4 B;  1ZDX A;  2KQ4 X;  1SEB D;  1GB4 A;  1XXG A;  1C4C A;  1GPX A;  2LEK A;  1JQ4 A;  1V1P A;  1TKY A;  4HEA 1;  1XO3 A;  1YNT E;  2KAC A;  2V3P A;  1SE3 A;  2WXF A;  3R2T A;  4IKG A;  3AEC B;  1UGJ A;  2DYM A;  2JYT A;  1D5M C;  3VRA B;  2HDE A;  3V3X A;  4MM3 B;  1V1O A;  2EEL A;  4XWT A;  2MJ3 A;  1QF6 A;  3HRD D;  3BVZ A;  1DOY A;  2I2Y A;  1UWX A;  1K51 A;  3AE1 B;  5D3I B;  1ZXI A;  3AED B;  4OZA A;  1JWA D;  4LK0 M;  1JML A;  4ZRQ A;  1L4D B;  1JRP A;  2WXJ A;  1IBX B;  3UI3 A;  4JX1 C;  2K5P A;  1L0V B;  3EA6 A;  3BII D;  3CIR B;  5LNK 1;  1N5W A;  3LYY A;  1PUT A;  2M19 A;  3VRB B;  1VJK A;  3NZ3 A;  1YN5 A;  2RDH A;  1F0Z A;  1EM7 A;  3AB5 A;  5C2T B;  3OWE B;  2INN E;  5EE3 A;  2QSD A;  2K3U A;  1PGX A;  4YTN B;  1R7S A;  3NRZ A;  1MVK A;  1UUP A;  3AN1 A;  4US8 A;  1I7H A;  1FXA A;  3P4P B;  1ZUD 2;  1QIL A;  2ICI A;  2PKO A;  3IXS A;  2K22 A;  2BS2 B;  2WU2 B;  2GRI A;  1ET6 A;  1MPE A;  3AE8 B;  3MFG A;  3P4Q B;  1SIJ A;  2IDY A;  1C76 A;  4O1N A;  2N0S B;  3LB8 C;  4JWS C;  1HA5 A;  3T3O A;  1KH0 A;  3TSS A;  1SF0 A;  1TKG A;  2WXI A;  1A70 A;  1VDV A;  1E6E B;  3IAM 1;  3P4R B;  2MJE A;  3BVG A;  5EE0 A;  3RPF C;  1OQR A;  1FCL A;  4HKZ E;  1FM0 D;  1I4H A;  1N60 A;  2V4I B;  1ENF A;  4L1B A;  3U4E G;  2BBC A;  2L1A A;  3PZ7 A;  4A9A A;  2BS3 B;  2QIE B;  1HXY D;  2J42 A;  5EE1 A;  3DWG C;  2Y3A A;  1FD6 A;  2WXH A;  1K53 A;  1JWM D;  3AE4 B;  1C4P A;  2WXO A;  3GS2 A;  4ZRP A;  4C80 A;  1E9M A;  4YWG G;  1XLN A;  1TKE A;  1QT9 A;  3BWU D;  4A8X C;  1NEK B;  5TSS A;  2W3S A;  1F77 A;  4TQ1 A;  1AN8 A;  1RM6 C;  2K9X A;  3B2F A;  5HFY A;  1VR9 A;  2W3R A;  4Q2J A;  1IUE A;  2WQY B;  2WXL A;  4YSX B;  4ZHP A;  5E6J A;  2G9H D;  3LXF A;  5FR3 A;  4RGT A;  2W82 A;  4YTM B;  2JQR B;  2RPV A;  1WSP A;  2WXR A;  4NZL B;  1AW7 A;  5D3D A;  2MEK A;  1FMA D;  1MHX A;  3AE7 B;  5HHD G;  3U2S C;  1XCQ L;  4YTP B;  1HZ6 A;  2JZP A;  4OW0 A;  1CK1 A;  1V1P B;  2NTT A;  1YN4 A;  1F2R C;  2QMT A;  1NYQ A;  1ZE3 D;  5AUI A;  2NMQ A;  2ZW1 A;  4HJG E;  1RWS A;  1FXI A;  2WNM A;  2DYO A;  3AE6 B;  1RFK A;  4RCO A;  5GXG B;  4DXF A;  1VZ6 A;  1FFV A;  2W55 A;  2E6X A;  1IGD A;  4KKI A;  4WIP A;  2AQ2 B;  4TSS A;  3W1S A;  1C77 A;  3B2G A;  1OQQ A;  2Q5W D;  3VR8 B;  2ONQ A;  4RF0 A;  3B9J A;  3T3N A;  1Q10 A;  1B1Z A;  3W5U B;  1FRD A;  3TUO A;  4LLG M;  1K50 A;  5C3J B;  3NUH B;  3TEX A;  5JXV A;  3TEY A;  3SR6 A;  3ABV B;  1J7C A;  2JSV X;  1FO4 A;  2NTS A;  1V8C A;  4UDU C;  5G5G A;  4NJC A;  1QLB B;  1L4Z B;  3AE5 B;  1C9F A;  2IGH A;  3N9Y C;  1YMH E;  3SFE B;  4HRO A;  2XN9 C;  2WXG A;  3ZYY X;  1ZXH A;  2GI9 A;  2X38 A;  1KFY B;  1HQR D;  3GB1 A;  3NVY A;  2PLP A;  4C7Y A;  2WDQ B;  3AE3 B;  1FEH A;  2Y5P A;  2KMM A;  1JWU D;  1PYW D;  1N5X A;  1ET9 A;  3ZJU A;  1WXQ A;  2PIA A;  1FFU A;  2ACZ B;  2FE8 A;  2M56 B;  2DBY A;  5EE9 A;  1TS3 A;  5HG2 A;  4GLS C;  4IOI E;  1JRO A;  3GP7 A;  3Q8A A;  4US9 A;  1BUI C;  1PFD A;  2IJ0 A;  3Q8C A;  4HKQ A;  2H88 B;  2G1E A;  1EU3 A;  4GDL B;  4AS1 A;  4B0E A;  2D5G A;  3P42 A;  3NVV A;  1D5Z C;  2SEB D;  4OZB A;  1C79 A;  2WXN A;  3ZJV A;  3KQ4 A;  5H8Y E;  1GAQ B;  1GOZ A;  1NYR A;  2VZK D;  4RGM A;  2N9K A;  1SE4 A;  3TEW A;  2V0G A;  3AEB B;  3AM9 A;  2N9L A;  1LO5 D;  3AE9 B;  1KF6 B;  2ON8 A;  3BK1 A;  4M0W A;  1I4P A;  1AWD A;  4YT0 B;  1QOF A;  4DQO C;  1L0Y B;  3R8B A;  2BW2 A;  1FNW A;  1L6U A;  3AEE B;  2DLB A;  1EU4 A;  4KX6 B;  2KN4 A;  4D2K A;  4MT5 A;  2E3T A;  1KTK A;  1XLO A;  4ZYS A;  4OZC A;  2Y5C A;  1AYF A;  1SJH D;  1CJE A;  1ZOY B;  4RF1 A;  1YQ4 B;  2INP E;  1WYG A;  2LFI A;  1T3Q A;  2BYT A;  2XNA C;  2K0P A;  1QOB A;  1TY0 A;  3ZQ4 A;  1D4B A;  2LGI A;  4WQM A;  4KKJ A;  4XDC A;  2KWD A;  3NVZ A;  1ZP0 B;  1JW9 D;  3Q8F A;  1KRH A;  3WCQ A;  2MH7 A;  3SEB A;  2J53 A;  1JWS D;  3KWV A;  2OED A;  4ITK A;  3MHZ A;  3EGR A;  3PO0 A;  1KLG D;  4C56 C;  4ARC A;  1E10 A;  2I38 A;  1M4V A;  3TEZ A;  3W2D A;  3URY A;  5BYS A;  3NVW A;  4HRS A;  5FK9 C;  3CWI A;  3R2I A;  3NS1 A;  3P4S B;  2YEP B;  1OFF A;  1YQ3 B;  3BYY B;  1STE A;  3VR9 B;  2IGD A;  3E56 A;  2OHF A;  2WXP A;  4ZHO A;  3C8Y A;  1VZ7 A;  3FAH A;  3O13 A;  1QKZ A;  3ETR A;  1MHH E;  1ESF A;  2QEJ C;  1VLB A;  2AQ1 B;  1EWY C;  1TJE A;  4XWW A;  1C78 A;  2R61 A;  4WH4 A;  5BYQ A;  1QOA A;  1ZPS A;  2WDV B;  2BB6 A;  3AV8 A;  4YSY B;  2LMC A;  3VQI A;  3BZD B;  1I4X A;  1TS2 A;  3E9S A;  2JX5 A;  2Z8L A;  3MC0 B;  4N58 A;  4WAF A;  3SFD B;  4JPS A;  4L23 A;  3MP9 A;  1DOX A;  5I4D A;  4FXC A;  2IGG A;  4RGN A;  3Q69 A;  1XLP A;  4JWU C;  3IT4 B;  1SSN A;  1YJJ A;  5AUK A;  1QOG A;  1XLQ A;  3P63 A;  2LJI A;  2ZW0 A;  3L4P A;  2W54 A;  1J7A A;  1FCC C;  1VRA B;  1ACC A;  4KGT A;  4USA A;  3BK2 A;  4A90 A;  1E0Z A;  1J7B A;  2YEP F;  1L5P A;  2LHE A;  2CU3 A;  3AEF B;  1TZO A;  4IDI A;  4TQ0 A;  4CQN A;  1F2R I;  4YSZ B;  1CQV A;  3P1M A;  1JCK B;  2WXM A;  1MI0 A;  3U7Z A;  2PVG C;  1NEN B;  2SAK A;  2IPK D;  1PGA A;  4KGR A;  4GDK B;  2JXT A;  1DGJ A;  2L83 A;  1JWB D;  1E7P B;  3HUI A;  1GB1 A;  2WXK A;  3AEG B;  2VZK B;  4R3D A;  4B0M A;  2N7J A;  4PT5 A;  5BMG A;  4A55 A;  1VZ8 A;  3Q8E A;  2V3N A;  3AMZ A;  2AQ3 B;  4OHJ A;  1WRI A;  1WWT A;  2EKI A;  4RGO S;  1YJI A;  4A6Q A;  1PGB A;  2KDM A;  4WUR A;  1HEZ E;  1D6E C;  3KWL A;  2PVO D;  2CJO A;  4NAW B;  5BMH A;  4P16 A;  2HTM E;  1L0X B;  3BVM A;  3HVZ A;  1B9R A;  1I4G A;  1FNV A;  2TSS A;  2BB5 A;  4KGS A;  2BTE A;  5HI1 A;  1SXT A;  4TMA B;  1UNS A;  1NVI D;  1L6V A;  2WDR B;  1SE2 A;  1Y56 A;  1C4A A;  1P7E A;  1XEE A;  2AX5 A;  3EUB 2;  1IBX A;  4EE2 A;  1TS5 A;  4XE0 A;  1NI3 A;  4C7Z A;  4YXD B;  3MJ5 A;  1T6B X;  4XDD A;  1N61 A;  4MAC A;  4AQ7 A;  4H2A A;  2QJL A;  1K52 A;  1N63 A;  4JE3 B;  3V05 A;  1IGC A;  2MJD A;  1PDX A;  3KLS X;  1BML C;  2JWU A;  1XCT L;  3ZJT A;  3AEA B;  4WWM A;  3I57 A;  1WGK A;  3U52 E;  5BMI A;  2WLB A;  4ZOH C;  1HZ5 A;  3I9V 1;  4LTU A;  4DXG A;  2BT6 A;  1TY2 A;  1DOI A;  4OVZ A;  1QQR A;  2CJN A;  1D5X C;  2PW9 A;  3IT6 B;  1UWM A;  3BYT B;  3IAS 1;  2QIL A;  2WP9 B;  1BXT A;  3Q8B A;  2L52 A;  2LHD A;  3AE2 B;  1SBB B;  2J52 A;  2M0A A;  5H92 C;  5FKA C;  3FC4 A;  1ROE A;  2RMM A;  3FIL B;  3DWM A;  1JAL A;  2FUG 1;  3H8H A;  1TYG B;  1YN3 A;  1FNU A;  2L32 A;  2RDG A;  1KLU D;  1XF5 L;  1I4Q A;  2PMV A;  1RYJ A;  4N6E B;  3J9C A;  4N59 A;  1EWC A;  4L2Y A;  3AH7 A;  1DYQ A;  3W5V B;  3W9C B;  3HVD A;  1SB3 C;  4ARI A;  2KAJ A;  1N62 A;  2J4X A;  2FBW B;  2GB1 A;  4P6V F;  5G5H A;  1TS4 A;  5MPO A;  1P7F A;  3FIL A;  3PZ8 A;  1V97 A;  1T5X D;  2JYE A;  2LUM A;  2PTL A;  2WS3 B;  4RNA A;  1ZDV A;  2WXQ A;  4MH8 A;  5D7G A;  1FIQ A;  5T8I A;  1I4R A;  2JU6 X;  5BYR A;  2DWQ A;  2WU5 B;  2H89 B;  4RH6 A;  4RFB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...