2VZKD

Structure of the acyl-enzyme complex of an n-terminal nucleophile (ntn) hydrolase, oat2
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
209
structure length
209
Chain Sequence
LLTFFATDARLDPAEQDRLFRRVMDRTFNAVSIDTDTSTSDTAVLFANGLAGEVDAGEFEEALHTAALALVKDIASDGEGAAKLIEVQVTGARDDAQAKRVGKTVVNSPLVKTAVHGCDPNWGRVAMAIGKCSDDTDIDQERVTIRFGEVEVYPPKARGDQADDALRAAVAEHLRGDEVVIGIDLAIADGAFTVYGCDLTEGYVRLNSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLUTAMATE N-ACETYLTRANSFERASE 2 ALPHA CHAIN
publication title Anatomy of a Simple Acyl Intermediate in Enzyme Catalysis: Combined Biophysical and Modeling Studies on Ornithine Acetyl Transferase.
pubmed doi rcsb
source organism Streptomyces clavuligerus
total genus 78
structure length 209
sequence length 209
chains with identical sequence F, H
ec nomenclature ec 2.3.1.35: Glutamate N-acetyltransferase.
pdb deposition date 2008-08-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.340 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2vzkD02
3.30.2330.10 Alpha Beta 2-Layer Sandwich arginine biosynthesis bifunctional protein fold arginine biosynthesis bifunctional protein suprefamily 2vzkD01
2YEPF 1VZ7A 1VZ8A 1VZ6A 2V4IB 2YEPB 3IT4B 3IT6B 2VZKD 1VRAB 2VZKB
chains in the Genus database with same CATH superfamily
1V1PA 2HDEA 5EE9A 2PE9A 3V6EB 4LNNA 3EGRA 2GBNA 2O2VB 2MP2B 3JW0X 2BYFA 4BFRA 2JUOA 2JRIB 2KO3A 4HROA 1KOTA 2RR9A 5JXVA 4C4VA 1WZ3A 3BYYB 3NY5A 1E5WA 2CJNA 1XF5L 2G3QB 3MC8A 3N32A 1ZDVA 1HTOA 3A1QB 1EF1A 3A9KA 2RDHA 2KYWA 1AW7A 2XK5B 3EUB2 1ZKHA 4WWOA 3LB8C 1I4PA 4HK2A 4RM9A 2V3NA 2K8BA 1A70A 5AUIA 4ZYSA 3DWGC 1I4QA 4NJ7A 3NRZA 1TKEA 3BZDB 5D6JB 2LHEA 3NG0A 1FRRA 2OOBB 3VQIA 3MP9A 2N9LA 1ZPSA 4P1BC 4R3DA 2I1KA 4NQLB 4IOIE 2D3BA 4W9HA 1LLQA 4W9FA 2EELA 4B95A 1MJDA 1TY0A 2Q5WD 2QDFA 2Y5PA 3VDZA 3P4PB 4P1CC 4W9JA 3NZSA 4GB9A 5BMGA 3NVVA 4BKTA 4GMVA 4MJSA 4MSQB 4PK1A 4CQNA 5D3IB 2WXHA 1SEBD 2L05A 4TSSA 2WXOA 2UU7A 3L08A 3GOEA 3Q8FA 4WJPA 4ZDVA 2KWUB 4RF1A 1ZXHA 4IKGA 3QC8B 1WSPA 5G55A 2MLBA 2ZCCA 1TZ1A 3QX1A 3X0WA 1DOYA 4LNKA 1Y56A 3NVYA 3KUCB 3RNEC 1WM3A 3BY4B 4LTUA 4BKSA 2GOWA 1M94A 1XT9B 3N1XC 3HVZA 5AZFA 1RFAA 4PS3A 4J3OD 3R3MA 2WMIB 1ET9A 2R61A 1DYQA 3VUWA 3P4QB 2L8JA 2LGXA 4FLHA 2HTHA 3M63B 3I9V1 1MI0A 4G3XB 3CSFA 1FM0D 2AWTA 2IYDB 2KLCA 4HWIB 5IO9A 2L32A 3AU5A 1FD6A 4ZRQA 2D5GA 1CZPA 2QJLA 1ISNA 2L52A 2L76A 4IG7B 4AP4C 2LI5A 2KFJA 2KQSA 2M8SA 3BVGA 4MEMA 3UIPB 3RULA 3PGEA 1NI2A 1CJEA 4OW0A 3R7RA 3U8ZA 2IO0B 2MX2A 1Q0WB 4TV3A 3Q3JA 4HCPB 4RH6A 3V05A 1J0GA 1TBEA 1FEHA 2IO1B 1RRBA 4XE0A 2LEKA 4I6PA 3ZRFA 4D6GA 2WMGA 3UGBB 3H1UA 5G5HA 2R2OA 5D2MB 2L0TA 2LASA 3VRAB 3HK0A 4YSYB 3O13A 4IWQA 2QEJC 2K25A 1UBIA 3WAMA 3RZWC 1OEYA 2D07B 3ML9A 4MGIE 2NTSA 3TEZA 1C3TA 2N9XA 3VUYA 5DPTA 2LMCA 3EFCA 3VR8B 3H7PA 5CHFA 4PYZA 2RPQA 3P2BA 1FIQA 2Z0DB 3FKYA 2KTFA 3B08A 2M4NA 4IM0A 4NPNA 4F8CB 1PYWD 3B9JA 3JYUA 3IAM1 3ETRA 4II2B 3BK1A 4KKIA 4N6EB 2W3SA 2AX5A 2GBRA 2K8HA 3NHEB 2Z0EB 3U4EG 2LJIA 3O65B 1GB4A 1I4XA 2LJ5A 1DGJA 5G2NA 1SB3C 3JSVA 3Q2AC 5DCNA 3B2GA 3EC8A 4WAFA 1UELA 1TJEA 2NPTA 3V6CB 2GBKA 3HUIA 1IBXB 1BMLC 2LVPA 3Q8AA 4D6IA 1TY2A 3I57A 1C1YB 1GC7A 1FNWA 2PKOA 2XNAC 5H8YE 2IY0B 4RGOS 3R7QA 3DHIC 3TEXA 2J53A 1YNTE 1L7YA 2KFKB 3VTWA 4HVBA 4AQ7A 4E74A 2KC1A 4XDDA 2FCQA 3W1YA 1NI3A 4JQWC 4W9CA 1VR9A 4NAMA 1MFWA 3MFGA 3PRZA 2JZ3B 2W55A 2ICIA 3KQ4A 2WXPA 2KJRA 1N5XA 4IM3A 5HI1A 1N6ZA 2SAKA 1WRIA 4EUTA 3A9JB 3OAWA 4WJNA 1J7BA 1ROEA 2AEHA 4HDQA 3V60A 4KIKB 2NBWB 4WWNA 4UDUC 2YEPF 1YQ3B 1C79A 2WU2B 1MPEA 5BYQA 1XEEA 1FNVA 4YWGG 1QOAA 3AMZA 1SE9A 1B1ZA 3RFZB 1FNUA 4RGMA 5BMHA 1K8RB 3OJ3A 4AS1A 1K50A 2M1MA 2V9HA 2RDBC 1S1QB 1TS3A 3DPDA 2UYZB 4EEWA 5HHDG 4GDLB 4MGKE 4W9DA 5JZEB 4LNFA 1V5OA 1GG3A 1P98A 1WIAA 3V62A 4TMAB 2LWPA 2ZJDA 3Q3NC 2WX1A 1WGYA 1T0RC 4XDCA 3MC9A 2WMKA 3B2FA 3J9CA 4GSWA 2EMSA 4RCOA 4A8XC 3FILB 4DBGA 4A20A 1WZ0A 3AE4B 4GU2A 1F9JA 1UWMA 4OVVA 1GOZA 5FKAC 4C00A 2KQ4X 2D11A 3NOBA 1WH3A 3PPAA 4M00A 2VH1A 3M3JA 3VRBB 4A3OA 2BQQA 4H2AA 1C4CA 2KXJA 4FXCA 3Q8EA 5GXGB 3ZNHB 1NDDA 2KC2A 1OGWA 1OQRA 4BVUC 4RM8A 2C7MB 4M8MA 2K6QA 1K52A 1T0YA 5IOIA 2XBBC 4IM2A 5BO4B 3TEWA 3KWLA 5IP4D 2DBYA 1MHHE 3H9DA 4JX1C 4RGNA 3AXCA 4C4VB 4MT5A 2JYTA 1V97A 4HRSA 3IT4B 2LXAA 3SEBA 4BOZB 3UF8A 2A4ZA 3AH7A 2KZRA 1D5XC 2JVCA 3VR9B 4D6HA 3W1SA 1J8CA 4JL9A 3Q3OC 1F77A 1JROA 1UWXA 3WCQA 3N30A 1E9MA 3GZNB 3PS6A 2KANA 1R4NI 4DDID 2BW2A 4BOSC 3KYCD 3QWZB 1R4MB 2Y5CA 2PMVA 4JWUC 1GPXA 3RI7C 3H7SA 2V4IB 4KDIC 2FNJB 1J19A 3NVZA 3AE2B 3RMKC 3V61A 1U4AA 3GE8C 4LNOA 1XLPA 4MJSB 2V3SA 4KX6B 3P63A 2WXKA 1I4HA 1WI0A 1JQ4A 1JRPA 4W9GA 4DDGD 5BYRA 4ZRKA 2PLPA 1TIFA 1WGHA 4XZ4A 1EF5A 1WMHB 3APDA 3Q8CA 3H6NA 3ZLZA 2KX3A 4ITKA 4KV2A 4OZCA 2BS2B 3AECB 3EECA 3ZNID 1X1MA 2B76B 1NYRA 1TS4A 3RPFC 1LGRA 4FBJB 2KT7A 1UF0A 4P6VF 1L4DB 1L0YB 2CHZA 2G9HD 1YMHE 1Q1OA 3HRDD 2INPE 3L4PA 1BT0A 4M8NA 4WWPA 4HKZE 1I4GA 4RNAA 5MPOA 1WJUA 3P42A 3ZGZA 1XXGA 4CO7A 1QLBB 3K9PB 1G6JA 4XYCA 4YTMB 3N3KB 3L17A 4BKGA 1L0VB 4ANWA 2BYEA 1WJ6A 4WWMA 2C60A 4HLEA 1B9RA 2FIDA 4KGRA 2O6VA 4KGSA 1TT5B 1UGMA 1FPYA 3IVFA 4MM3A 4ASWC 2JQRB 3NZUA 1Z5SB 2MWSB 3RNAC 3D32A 5EE3A 1C78A 2ZW0A 2MA9B 3N20C 4IC7B 1SE4A 3AEBB 3TIXA 1V8CA 1WR1A 2DX5B 3GB1A 4OZBA 5JHBA 2PVGC 3PO0A 1JRUA 1KLUD 1RM6C 4B0MA 1KRHA 4ICVA 2MJ3A 3DBRB 2DAFA 3L54A 2BYVE 2PJHA 2I2YA 1T0SC 2FUHB 4DHJB 4US9A 3ZXRA 2QC8A 2ZNVB 1ESFA 1GC6A 2KK8A 2MBHA 1VRAB 1TKYA 4B9KA 4YTNB 1PQSA 2KAJA 1E7UA 2KKCA 3ZIMA 2WXNA 3T9LA 1JWSD 3RNBC 3GP7A 2QMTA 5J18A 3QARA 2BVCA 1N61A 3MJ5A 3TL5A 3RZFA 4XWWA 3TEYA 4NNJB 3E56A 4M0WA 2GI9A 2ZNVC 5FR6A 1ENFA 4RGTA 3ZDTA 1J7CA 2WMJA 5AZHA 4MH0E 4YXDB 3VXWA 2NPTB 4DHJD 2VH2A 5L95C 2C7HA 3W5UB 3DOWA 1XD3B 2WXIA 3KUDB 1E8ZA 5HKHA 3IG3A 3RT3B 3ZXVA 2RMMA 2J52A 4WURA 2D10A 1NENB 2IPKD 1RFKA 3QJZA 1T6BX 5AZGA 3OLMD 2WDVB 4BBNC 1PDXA 3PV1A 1F0ZA 2I1JA 4LNIA 1CK1A 2N0SB 1TKGA 2FBWB 3IXSA 1YJ1A 1WXSA 1ZP0B 4K7SA 4J6IA 1C9FA 1V1OA 4JGHB 1TZOA 2C7NB 3CSTA 2MBOA 4XX5A 2GRIA 2KDIA 3ZRCA 4PS8A 2N7JA 2BGFA 3IHPC 3NJTA 3OWEB 3AE7B 2IGDA 4GDKB 1Z2MA 1E0ZA 3BWUD 4JPSA 1SXTA 2J0JA 3SHQA 2ZZPB 3UIOB 4KSKC 3ALBA 1HZ6A 2JF5A 5IN7A 3SFDB 1T0QC 2PTLA 1R7SA 2D3CA 1PGAA 4D71A 1GUAB 1VZ7A 2O2VA 1RWSA 2MP2A 4NJCA 2WX0A 2RPVA 4A55A 4BBNF 3PRMB 5HG2A 1LM8B 2J4XA 4GLSC 3L10B 4MELA 3OG5A 1J7AA 3RNCC 1IUEA 3RN9C 2MQJA 3HM3A 1PGBA 2KJ6A 3A1QA 2Z8LA 3T8MA 2A5UA 1ZGUB 3R8BA 1UH6A 1D4BA 1WE6A 2XK5A 4M02A 1D5MC 1L2NA 2WXGA 3DBLB 2YEPB 1YX6B 5C3JB 1YJIA 2KWDA 1E6EB 4ZHPA 4B6WA 3ZKJC 1EWYC 3DBHI 5TR5A 4NAWB 3I5JC 4HPPA 3AV8A 1E8WA 3TMPB 3RYTA 2H88B 3BVMA 1E8XA 4KKJA 4JE3B 2INNE 2ZW1A 3TJPA 3AULA 3C19A 2MJEA 4ACFA 1V81A 2FIFA 3U7DA 1ZUD2 1P3QU 5E6OA 2IDYA 2BWFA 1D3ZA 2LUEA 3WANA 3KYDD 4JLCA 5CTRC 1IP9A 2V1YA 3U30A 3R2IA 1KF6B 3MC0B 2JZZA 3RD2A 1SGHA 2L7RA 1YD8U 3A33B 3IFWB 3PZ8A 4FJYA 4I6NB 2LGIA 2KWCA 3DDCB 2LXCA 3UI3A 4W9EA 3IT6B 4C7ZA 3HM6X 2WNMA 3ZYYX 5CHVC 3SR6A 5EDSA 1WFYA 2WMFA 1RAXA 1M4VA 2KHWB 3AEFB 1WJNA 3P4SB 1PGXA 3AEEB 1WY8A 2LUMA 4WAAA 4YTPB 2FCMA 3IAS1 1HA5A 3PRPB 1XCQL 3L0WB 4MGYE 5LXIB 1NEKB 2MBQA 1UUPA 1CQVA 4PS7A 3NVWA 2L0FA 1C4PA 2N7EA 4CHKA 4C56C 4K7WA 3PHWB 1NBFC 4HCNB 3QQ8B 1ZW7A 1SBBB 2QIEB 3AM9A 2RGFA 2D3AA 2KN5A 5LLIA 3T3OA 1QT9A 2JXXA 3ZUNA 4L2YA 4ANVA 3H8HA 2NTTA 1DOXA 4OHJA 1SE2A 1QZEA 1SE3A 4YT0B 2QCZA 2N9KA 2LGDA 1N63A 2N1VA 1UBQA 2DZKA 4YSXB 2X38A 2NVUI 1O0SA 4LDTB 2DWQA 2KACA 3T3NA 1S3SG 3W9CB 4I6LB 2DZJA 2OEDA 3AE3B 1ET6A 5IA7A 2IBIB 1D5ZC 4KZCA 3WAPA 3VTUA 3QHTA 3Q3FA 2KTRA 2HJ8A 3A4RA 1VDVA 2KMAA 3WIMA 1Y8RC 3NS1A 2K6DB 3ZVVA 3PLUA 2WYQA 2E3TA 5AEKB 3IBEA 1YN5A 3QIJA 1YOVB 2RSUA 3GE3C 3NZ3A 1T5XD 2KVRA 3UINB 5EE0A 3MHSD 3DVGX 3EA6A 4REZA 2LHDA 2N9EB 2FE8A 4AJYB 2L1AA 4DK5A 3B1LX 3C0RB 1QF6A 4A90A 5FR3A 2WXLA 4K1RB 4PT5A 4L1BA 4TKNA 2W82A 1IGDA 2BKRB 2PEAA 2BB6A 2CKHB 3VFKA 1UD7A 1V1PB 1FCCC 4NJ6A 5AUKA 2K1FA 1FXTB 1VCBA 3VVWB 1FCLA 1EU4A 1F52A 2O6VB 1NVID 2ZPYA 3ZQ4A 3DHGC 1IBXA 1ZE3D 2GB1A 3VH3B 3N1YC 2M0AA 2JWUA 1I42A 2ZVNA 2WXRA 2K5PA 4LJOB 4K7UA 1VZ8A 1Q10A 2WMHA 3A9KB 2G4DB 4D6DA 1ZDXA 2DAJA 3AI5A 4OZAA 2JY6A 2QHOA 4O1NA 4HKQA 2KFKA 5IKCM 4C80A 4LJPB 2Y3AA 2C5LC 3PREA 3MHZA 1D6EC 5J2RA 5C2TB 4M01A 3SD5A 4ZOHC 4HJKA 1FRDA 4CYEA 2LVQA 1YIWA 2MH7A 2W9NA 4DHZE 2KOXA 3AEDB 2WHIA 2WQYB 2K0PA 3PHXB 1SIJA 4ICUA 4LK0M 4URKA 1YJJA 2WXMA 3HHMA 4E71A 1JWAD 4FHJA 1E8YA 2ZCBA 3A9JA 3KH0A 2OJWA 1PUTA 3KW5B 2I38A 4KIKA 4F1SA 1SSNA 2G4SA 2WDRB 3Q6BA 2JZPA 3CWIA 1P7FA 3L16A 4RFBA 1GB1A 3UQBA 2AL3A 3DVNU 3AE8B 5DPWA 4ZRIA 1MHXA 2K9XA 1QOBA 4TQ1A 2KDEB 3W5VB 3PLVA 4A3PA 1PFDA 4EZJA 3HVDA 5FK9C 2WU5B 2K3UA 2IZVB 1AWDA 3KVFB 5GMVA 1JCKB 3EFUA 2NBUA 3DWMA 2GBMA 2DZMA 2KJHB 4ZYNA 1JMLA 4ARCA 2M0XA 5D94A 4JWSC 4HJGE 2EKIA 4GDLA 2JX5A 4WJOA 3VHTC 1GNUA 3AB5A 1EO6A 2J7QB 2PPHA 1KFYB 4D6EA 4D6FA 2WDQB 3QK0A 4FA6A 1XO3A 4KSLC 2ZEQA 4FN2A 1K53A 1H4RA 1WX8A 3FAHA 3WA0A 4X57B 3M62B 3TSSA 2KD0A 2MEKA 2BTEA 4KDLB 1JW9D 2WS3B 1VZ6A 2KVZA 4EE2A 4W9IA 5HFYA 1XQQA 2ASQA 1NYQA 3ZDMC 1XLQA 3FILA 3ZTDA 2K22A 2QSDA 2BF8B 2WXJA 3TBLD 5BMIA 4MH8A 3U52E 4KGTA 4BKSD 5J17A 1WRDB 3BYTB 1FO4A 2FUG1 2WXQA 1WXMA 4XGAB 2NBVB 2IY1B 3SDLC 2AL6A 1HTQA 2M56B 4OVZA 2MBBB 1E7VA 1ACCA 3KUZA 2VZKB 2KDFB 2EMTA 5DPSA 4II3B 2B3AA 2PIAA 4LCDE 2W54A 2EKEC 1OQQA 4NZLB 2WGSA 2MCNB 1XLNA 2KMMA 4EZLA 3H7PB 2YLMA 2KN4A 1R4NB 1C4AA 3P4RB 4YSZB 3LYYA 1I4RA 1OEYJ 2IO3B 4WH4A 1F2RC 1AARA 4GGQA 3APCA 2DENB 5JH5C 1T3QA 5D3DA 2JRHA 4N58A 3QCAA 1TGZB 5I4DA 4WQMA 4B0EA 3X23A 4GOCA 3I63C 4ZHOA 3JSVB 3DBLI 1L5PA 1YQBA 2WDTB 2REXA 2VZKD 3SU8X 3E9SA 2WLBA 2J0MA 4GN1A 3ZNZB 4HDOA 2BBCA 1TS2A 4P16A 3AE5B 4QAYA 2ZPNA 5D7GA 2ACZB 2LVOA 2L00B 1KM7A 2OJRA 1C76A 2R2QA 3WALA 3ML8A 4K81A 1FMAD 1FFVA 3BINA 2YVCA 4DWFA 2J42A 3AE6B 2K8CA 3QA8A 1WMHA 2BB5A 1P0RA 2Y5BB 1UNSA 3ZNGC 4MGZE 2LZ6A 1V5TA 2K39A 2JWZA 3BIID 5TSSA 5CX3A 2BT6A 3ECIA 1BUIC 4AOFA 1Q5WB 3U7ZA 1HXYD 3DHHC 2V4LA 4D72A 3PZDA 4WJQA 1YN4A 1QKZA 1UZXB 2JYEA 3LDZE 4D6CA 3RNFC 5L83A 1JALA 3URYA 4XC2A 4C7YA 1HQRD 3PVLA 1RYJA 3KLSX 2KWVB 3Q14C 1SJHD 1E90A 1YN3A 1SJED 2DNFA 4K3BA 4PYUA 5E6JA 1LQBA 2CJOA 4XWTA 1WX7A 2WP9B 1WYGA 1P9DU 4MACA 2IGGA 1KH0A 3DVGY 3NS8A 1EU3A 3RNGC 4D2KA 4NY0A 3TCAA 2FCNA 1QILA 2INDC 2LFIA 5LXHA 2V3PA 3PSEB 1GAQB 2KTRB 4DQOC 3N9YC 5E6PA 2BPSA 1WX9A 4IWOA 4JIOU 1LO5D 4FJVB 1XCTL 2XEWA 2AQ1B 2KDMA 3LXFA 1V2YA 4ZRJA 5C23A 1MG4A 1OTRB 2DZIA 1UGJA 3AEAB 3ABVB 4HEA1 5IAAC 3TUOA 4ZRPA 3AE1B 1HEZE 3HIZA 2MJDA 1WGKA 1EUVB 1WXQA 1V6EA 3GS2A 2G1EA 1QQRA 4L23A 4LLGM 1KJTA 3ZJUA 1JWBD 3RUIB 3R2TA 2CHXA 2RD0A 4OVUA 1V9JA 1WXAA 1WGDA 2XN9C 3L13A 2BWES 4Q2JA 3ZTCA 3DBSA 3P1MA 4HPMB 2NS5A 2JSVX 3DVNV 5T8IA 4N9F4 1FFUA 2E6XA 3OJ4B 3DCGA 3U2SC 3JVZX 2V0GA 4G0NB 1IYFA 2UWQA 2HTME 2WMIA 2L83A 2ONQA 4W9LA 4G50A 5KHQA 2N4FA 1IGCA 2D3GA 1WF9A 2LD9A 2H89B 4DHZB 4A6QA 1OFFA 3ONSA 1BXTA 1LFDA 3CIRB 1ZOYB 4USAA 2C9WB 3M95A 3MTNB 5DPRA 4AJWA 2RDGA 1TYGB 3ZW3A 1KTKA 3N1ZC 5KHOA 5H92C 1WM2A 2KDBA 2PE6B 3GZNI 4DXAB 1QOFA 5G5GA 4IWPA 2D2QA 2NCNA 2N9PC 3V3XA 3W1SC 3ZJVA 4S0RA 2ON8A 4F7ZA 2SEBD 4GDKA 4KZ0A 3AE9B 2LRWA 1R4MI 1E10A 3AN1A 5CHWA 4GXBA 4RMAA 4EKUA 4MDKE 2MHJA 1AN8A 2MW5A 2CR5A 2HD5B 2DLBA 5EE1A 2CHWA 3Q69A 4G11A 3AU4A 3NUHB 4ANXA 1L0XB 1K51A 2JPHA 1IPGA 3W2DA 1N60A 3S2AA 2BKFA 4BAXA 2PVOD 2BS4B 1WXVA 3B0AA 4FULA 1OQYA 1WGGA 3DBHB 1WWTA 1TS5A 2N7DA 4LDTD 2J0KA 2MSED 3I3TB 1FXAA 1WE7A 2HJ1A 1QOGA 3BK2A 3Q3MC 1A5RA 4IDIA 2CU3A 1KLGD 2AYOB 2N1WA 3LJ3A 4ANUA 2JU6X 3RCZA 1P7EA 1MVKA 2VRRB 3VAWA 3FC4A 2W3RA 2GMIC 4NAWA 1MG8A 1LXDA 2PW9A 4US8A 2G45B 4TUUA 4MM3B 2INCC 3UQAA 2M17A 1RLFA 2NMQA 3VH4B 1I7HA 3ZO5B 2AQ2B 3BVZA 1AYFA 1I35A 2JXTA 1N5WA 3VTVA 2ZVOA 3AEGB 2DYOA 1DOIA 4A9AA 1E7PB 3SFEB 4N59A 3MJWA 1HZ5A 1HE8A 2KMCA 3DQVA 2WXFA 4P7IA 1VJKA 2GBJA 3PZ7A 1VLBA 1SIFA 5JHAA 2BS3B 3PTFC 3C8YA 2WWZA 4MSMB 1L6VA 2DYBA 1F1HA 2O6VD 1F2RI 1V86A 1CMXB 3DBRI 3R66C 1SF0A 3CF6E 2IGHA 1N62A 4YL8A 2DHZA 1XLOA 1GJZA 4E3CA 2X8XX 2DYMA 2MBEA 4KVGB 2KLGA 2LRUA 4W9KA 2M19A 4D6JA 4FHKA 2KNBA 4M0WB 2FCSA 4EOYA 2IO2B 4AWJA 4AUQC 2KQ7A 5C1ZA 2Z59B 1JWMD 4RF0A 1EWCA 2CU1A 1V49A 3APFA 1H8CA 1YQ4B 2HE7A 1WGRA 2OHFA 4IUMB 2BYTA 1WJ4A 4WIPA 4ARIA 2TSSA 2KX0A 3PT2B 4WQOB 5BYSA 3KWVA 2LGSA 4FJZA 1YX5B 4HXDA 1KLVA 4GIVA 2MRPA 4BZAA 1VD2A 4S17A 2GLSA 1L6UA 2L3ZA 1JWUD 4NQKE 2FAZA 5LNK1 1EM7A 1WR6E 3QAQA 1P1AA 3VUXA 2JT4B 2NR2A 4HPLB 1C77A 2CS4A 4FADA 4DXFA 2AQ3B 3ENEA 4EZKA 2QILA 1ZXIA 1TTNA 3WAOA 2IJ0A 1V80A 3K9OB 3ZJTA 1L4ZB 3CMMB 4TQ0A 5E6NA 3A4SC 1STEA 2LGYA 3EHVA 1WYWB 4IW0A 4EFOA 4DXGA 3Q8BA 1FXIA 4K3CA
chains in the Genus database with same CATH topology
1YN4A 1QKZA 3SR6A 1V1PA 2HDEA 2JYEA 4MT5A 5EE9A 2JYTA 1M4VA 1V97A 3AEFB 3EGRA 3P4SB 1PGXA 1JALA 4HRSA 3AEEB 3IT4B 2LUMA 4YTPB 3SEBA 3URYA 4C7YA 1HQRD 3IAS1 1HA5A 1RYJA 4HROA 3KLSX 1XCQL 1SJHD 5JXVA 1YN3A 1NEKB 1UUPA 3BYYB 1CQVA 1SJED 3NVWA 5E6JA 1C4PA 2CJOA 3AH7A 3VR9B 1D5XC 4C56C 4XWTA 2CJNA 3W1SA 1XF5L 1WYGA 2WP9B 1SBBB 1F77A 1JROA 2QIEB 3AM9A 1ZDVA 4MACA 2IGGA 1KH0A 1UWXA 3T3OA 3WCQA 1QT9A 1E9MA 2RDHA 4L2YA 1AW7A 1EU3A 3EUB2 2NTTA 3H8HA 1DOXA 4OHJA 1SE2A 2BW2A 1SE3A 3LB8C 1I4PA 4D2KA 4YT0B 2N9KA 1N63A 1QILA 2V3NA 1A70A 5AUIA 2Y5CA 4ZYSA 2LFIA 3DWGC 4YSXB 1I4QA 2PMVA 2X38A 4JWUC 1GPXA 2V3PA 3NRZA 1GAQB 1TKEA 3BZDB 2DWQA 2LHEA 1FRRA 2KACA 2V4IB 4DQOC 3T3NA 3VQIA 3N9YC 3MP9A 3W9CB 3NVZA 2N9LA 1ZPSA 3AE2B 4R3DA 2OEDA 3AE3B 1ET6A 4IOIE 1LO5D 1D5ZC 1XCTL 2AQ1B 1XLPA 2KDMA 3LXFA 4KX6B 2EELA 3P63A 2WXKA 1TY0A 1UGJA 1I4HA 1VDVA 1JQ4A 1JRPA 2Q5WD 3AEAB 3ABVB 2Y5PA 3NS1A 4HEA1 3P4PB 5BYRA 3TUOA 5BMGA 3NVVA 4ZRPA 2PLPA 3AE1B 2E3TA 1HEZE 2MJDA 4CQNA 1YN5A 5D3IB 3Q8CA 1WGKA 2WXHA 1WXQA 1SEBD 3GS2A 4TSSA 3NZ3A 1T5XD 2G1EA 2WXOA 1QQRA 5EE0A 4ITKA 4L23A 4LLGM 3Q8FA 3EA6A 3ZJUA 1JWBD 4OZCA 4REZA 2LHDA 2FE8A 3R2TA 2L1AA 4RF1A 2BS2B 3AECB 1QF6A 4A90A 5FR3A 1ZXHA 4IKGA 2WXLA 1WSPA 2B76B 2XN9C 1NYRA 1TS4A 3RPFC 4PT5A 4Q2JA 4L1BA 1DOYA 1Y56A 3NVYA 4P6VF 1L4DB 1L0YB 4LTUA 3P1MA 2G9HD 1YMHE 3HVZA 3HRDD 2INPE 3L4PA 2W82A 1IGDA 4J3OD 4HKZE 2BB6A 1I4GA 2JSVX 4RNAA 1V1PB 1FCCC 1ET9A 5MPOA 2R61A 5AUKA 1DYQA 5T8IA 1EU4A 3P42A 1FFUA 2E6XA 3P4QB 3ZGZA 1FCLA 1XXGA 1QLBB 3I9V1 4YTMB 1NVID 1MI0A 3U2SC 3ZQ4A 1L0VB 2V0GA 1IBXA 1FM0D 1FD6A 1ZE3D 4WWMA 2HTME 2GB1A 2L32A 4ZRQA 2L83A 2D5GA 2ONQA 1B9RA 1CZPA 2M0AA 2QJLA 2JWUA 2L52A 4KGRA 4KGSA 1IGCA 2WXRA 2K5PA 3BVGA 1VZ8A 2H89B 1Q10A 4A6QA 1OFFA 1BXTA 2JQRB 1CJEA 3CIRB 4OW0A 1ZOYB 1ZDXA 4USAA 4OZAA 5EE3A 1C78A 2RDGA 4O1NA 4HKQA 1TYGB 2ZW0A 1SE4A 4RH6A 3V05A 4C80A 2Y3AA 1KTKA 3AEBB 3MHZA 1D6EC 1FEHA 5H92C 5C2TB 1V8CA 3GB1A 4ZOHC 4OZBA 2LEKA 4XE0A 1FRDA 2PVGC 3PO0A 1KLUD 1RM6C 1QOFA 5G5GA 4B0MA 1KRHA 2MH7A 2MJ3A 3AEDB 2WQYB 2K0PA 3V3XA 5G5HA 2I2YA 1SIJA 4LK0M 3ZJVA 2ON8A 1YJJA 2SEBD 2WXMA 3AE9B 1JWAD 4US9A 3VRAB 1E10A 3AN1A 4YSYB 1ESFA 3O13A 2QEJC 1PUTA 1VRAB 2I38A 1SSNA 1TKYA 2NTSA 2WDRB 4YTNB 3TEZA 1AN8A 2JZPA 3CWIA 2KAJA 1P7FA 2WXNA 4RFBA 1GB1A 2LMCA 3VR8B 1JWSD 3GP7A 2QMTA 2DLBA 3AE8B 5EE1A 1MHXA 3Q69A 2K9XA 1FIQA 1N61A 3MJ5A 3NUHB 1QOBA 4TQ1A 4XWWA 3W5VB 3TEYA 1L0XB 1PFDA 1K51A 1PYWD 3B9JA 3HVDA 3IAM1 3W2DA 1N60A 3E56A 3ETRA 4M0WA 5FK9C 2GI9A 1ENFA 2WU5B 2K3UA 4RGTA 2PVOD 2BS4B 3BK1A 4KKIA 4N6EB 1AWDA 1J7CA 1JCKB 2W3SA 2AX5A 3DWMA 3U4EG 4YXDB 1JMLA 2LJIA 4ARCA 1GB4A 4JWSC 4HJGE 2EKIA 1WWTA 1I4XA 2JX5A 1DGJA 1SB3C 1TS5A 3AB5A 3W5UB 1FXAA 1KFYB 3B2GA 3BK2A 1QOGA 4WAFA 2WDQB 1XO3A 2WXIA 4IDIA 2CU3A 1TJEA 1K53A 3FAHA 2RMMA 2J52A 1KLGD 4WURA 3HUIA 3TSSA 2JU6X 1IBXB 1P7EA 1MVKA 2MEKA 1BMLC 2BTEA 1NENB 3FC4A 1JW9D 2W3RA 2IPKD 2WS3B 1VZ6A 1RFKA 3Q8AA 4EE2A 2PW9A 5HFYA 1TY2A 1NYQA 3I57A 1FNWA 2PKOA 4US8A 1T6BX 1XLQA 3FILA 2XNAC 2WDVB 5H8YE 1PDXA 2K22A 2QSDA 4RGOS 4MM3B 1F0ZA 2WXJA 1CK1A 2N0SB 1TKGA 5BMIA 4MH8A 3U52E 2FBWB 3IXSA 2NMQA 3TEXA 1I7HA 2J53A 2AQ2B 3BVZA 1AYFA 2JXTA 1YNTE 1ZP0B 1N5WA 4KGTA 1C9FA 1V1OA 1TZOA 3AEGB 2DYOA 3BYTB 1DOIA 4A9AA 1FO4A 1E7PB 3SFEB 4N59A 4AQ7A 2FUG1 1HZ5A 4XDDA 1NI3A 2WXQA 1VR9A 2WXFA 4NAMA 3MFGA 2GRIA 1VJKA 3PZ7A 2W55A 2ICIA 2N7JA 3KQ4A 2M56B 4OVZA 3OWEB 1VLBA 2WXPA 2IGDA 3AE7B 4GDKB 1N5XA 3BWUD 4JPSA 1E0ZA 1SXTA 1ACCA 2BS3B 3C8YA 5HI1A 2SAKA 1WRIA 2VZKB 1J7BA 1HZ6A 1L6VA 1ROEA 3SFDB 2PTLA 1F2RI 1R7SA 2PIAA 1PGAA 4UDUC 2YEPF 1SF0A 1VZ7A 4NJCA 1RWSA 1YQ3B 1C79A 2W54A 2WU2B 2RPVA 2IGHA 4A55A 1OQQA 1MPEA 4NZLB 5BYQA 1N62A 1XEEA 1XLNA 1XLOA 2KMMA 1FNVA 4YWGG 5HG2A 2DYMA 2J4XA 2KN4A 4GLSC 1QOAA 3AMZA 1B1ZA 1C4AA 1J7AA 3RFZB 1FNUA 3P4RB 4RGMA 1IUEA 4YSZB 2M19A 5BMHA 3LYYA 1I4RA 4AS1A 1PGBA 4WH4A 1K50A 1F2RC 2Z8LA 1TS3A 3R8BA 1T3QA 1D4BA 5D3DA 1JWMD 4N58A 1D5MC 4RF0A 5I4DA 2WXGA 4WQMA 5HHDG 4B0EA 4GDLB 1EWCA 1YQ4B 2YEPB 4ZHOA 1L5PA 5C3JB 1YJIA 2KWDA 2OHFA 2VZKD 1E6EB 4ZHPA 3E9SA 2BYTA 2WLBA 4WIPA 4ARIA 2TSSA 1EWYC 2BBCA 1TS2A 4P16A 3AE5B 4TMAB 5BYSA 3KWVA 5D7GA 4NAWB 2ACZB 4XDCA 1L6UA 3AV8A 3B2FA 1JWUD 3J9CA 4RCOA 4A8XC 2H88B 3FILB 3BVMA 1C76A 5LNK1 4KKJA 1EM7A 2INNE 3AE4B 2ZW1A 4JE3B 2MJEA 1FMAD 1FFVA 1UWMA 1C77A 1GOZA 5FKAC 2J42A 4DXFA 2AQ3B 2KQ4X 1ZUD2 3ZYYX 2QILA 3AE6B 1ZXIA 2IDYA 3VRBB 2BB5A 2IJ0A 1UNSA 3R2IA 1KF6B 4H2AA 1C4CA 3MC0B 3BIID 4FXCA 5TSSA 3Q8EA 5GXGB 3ZJTA 1L4ZB 2BT6A 4TQ0A 3PZ8A 1BUIC 1OQRA 1STEA 3U7ZA 1HXYD 2LGIA 1K52A 3UI3A 4DXGA 4C7ZA 3IT6B 3TEWA 3Q8BA 3KWLA 2DBYA 2WNMA 1MHHE 4JX1C 1FXIA 4RGNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YEP F;  1VZ7 A;  1VZ8 A;  1VZ6 A;  2V4I B;  2YEP B;  3IT4 B;  3IT6 B;  2VZK D;  1VRA B;  2VZK B; 
#chains in the Genus database with same CATH topology
 1V1P A;  2HDE A;  5EE9 A;  2PE9 A;  3V6E B;  4LNN A;  3EGR A;  2GBN A;  2O2V B;  2MP2 B;  3JW0 X;  2BYF A;  4BFR A;  2JUO A;  2JRI B;  2KO3 A;  4HRO A;  1KOT A;  2RR9 A;  5JXV A;  4C4V A;  1WZ3 A;  3BYY B;  3NY5 A;  1E5W A;  2CJN A;  1XF5 L;  2G3Q B;  3MC8 A;  3N32 A;  1ZDV A;  1HTO A;  3A1Q B;  1EF1 A;  3A9K A;  2RDH A;  2KYW A;  1AW7 A;  2XK5 B;  3EUB 2;  1ZKH A;  4WWO A;  3LB8 C;  1I4P A;  4HK2 A;  4RM9 A;  2V3N A;  2K8B A;  1A70 A;  5AUI A;  4ZYS A;  3DWG C;  1I4Q A;  4NJ7 A;  3NRZ A;  1TKE A;  3BZD B;  5D6J B;  2LHE A;  3NG0 A;  1FRR A;  2OOB B;  3VQI A;  3MP9 A;  2N9L A;  1ZPS A;  4P1B C;  4R3D A;  2I1K A;  4NQL B;  4IOI E;  2D3B A;  4W9H A;  1LLQ A;  4W9F A;  2EEL A;  4B95 A;  1MJD A;  1TY0 A;  2Q5W D;  2QDF A;  2Y5P A;  3VDZ A;  3P4P B;  4P1C C;  4W9J A;  3NZS A;  4GB9 A;  5BMG A;  3NVV A;  4BKT A;  4GMV A;  4MJS A;  4MSQ B;  4PK1 A;  4CQN A;  5D3I B;  2WXH A;  1SEB D;  2L05 A;  4TSS A;  2WXO A;  2UU7 A;  3L08 A;  3GOE A;  3Q8F A;  4WJP A;  4ZDV A;  2KWU B;  4RF1 A;  1ZXH A;  4IKG A;  3QC8 B;  1WSP A;  5G55 A;  2MLB A;  2ZCC A;  1TZ1 A;  3QX1 A;  3X0W A;  1DOY A;  4LNK A;  1Y56 A;  3NVY A;  3KUC B;  3RNE C;  1WM3 A;  3BY4 B;  4LTU A;  4BKS A;  2GOW A;  1M94 A;  1XT9 B;  3N1X C;  3HVZ A;  5AZF A;  1RFA A;  4PS3 A;  4J3O D;  3R3M A;  2WMI B;  1ET9 A;  2R61 A;  1DYQ A;  3VUW A;  3P4Q B;  2L8J A;  2LGX A;  4FLH A;  2HTH A;  3M63 B;  3I9V 1;  1MI0 A;  4G3X B;  3CSF A;  1FM0 D;  2AWT A;  2IYD B;  2KLC A;  4HWI B;  5IO9 A;  2L32 A;  3AU5 A;  1FD6 A;  4ZRQ A;  2D5G A;  1CZP A;  2QJL A;  1ISN A;  2L52 A;  2L76 A;  4IG7 B;  4AP4 C;  2LI5 A;  2KFJ A;  2KQS A;  2M8S A;  3BVG A;  4MEM A;  3UIP B;  3RUL A;  3PGE A;  1NI2 A;  1CJE A;  4OW0 A;  3R7R A;  3U8Z A;  2IO0 B;  2MX2 A;  1Q0W B;  4TV3 A;  3Q3J A;  4HCP B;  4RH6 A;  3V05 A;  1J0G A;  1TBE A;  1FEH A;  2IO1 B;  1RRB A;  4XE0 A;  2LEK A;  4I6P A;  3ZRF A;  4D6G A;  2WMG A;  3UGB B;  3H1U A;  5G5H A;  2R2O A;  5D2M B;  2L0T A;  2LAS A;  3VRA B;  3HK0 A;  4YSY B;  3O13 A;  4IWQ A;  2QEJ C;  2K25 A;  1UBI A;  3WAM A;  3RZW C;  1OEY A;  2D07 B;  3ML9 A;  4MGI E;  2NTS A;  3TEZ A;  1C3T A;  2N9X A;  3VUY A;  5DPT A;  2LMC A;  3EFC A;  3VR8 B;  3H7P A;  5CHF A;  4PYZ A;  2RPQ A;  3P2B A;  1FIQ A;  2Z0D B;  3FKY A;  2KTF A;  3B08 A;  2M4N A;  4IM0 A;  4NPN A;  4F8C B;  1PYW D;  3B9J A;  3JYU A;  3IAM 1;  3ETR A;  4II2 B;  3BK1 A;  4KKI A;  4N6E B;  2W3S A;  2AX5 A;  2GBR A;  2K8H A;  3NHE B;  2Z0E B;  3U4E G;  2LJI A;  3O65 B;  1GB4 A;  1I4X A;  2LJ5 A;  1DGJ A;  5G2N A;  1SB3 C;  3JSV A;  3Q2A C;  5DCN A;  3B2G A;  3EC8 A;  4WAF A;  1UEL A;  1TJE A;  2NPT A;  3V6C B;  2GBK A;  3HUI A;  1IBX B;  1BML C;  2LVP A;  3Q8A A;  4D6I A;  1TY2 A;  3I57 A;  1C1Y B;  1GC7 A;  1FNW A;  2PKO A;  2XNA C;  5H8Y E;  2IY0 B;  4RGO S;  3R7Q A;  3DHI C;  3TEX A;  2J53 A;  1YNT E;  1L7Y A;  2KFK B;  3VTW A;  4HVB A;  4AQ7 A;  4E74 A;  2KC1 A;  4XDD A;  2FCQ A;  3W1Y A;  1NI3 A;  4JQW C;  4W9C A;  1VR9 A;  4NAM A;  1MFW A;  3MFG A;  3PRZ A;  2JZ3 B;  2W55 A;  2ICI A;  3KQ4 A;  2WXP A;  2KJR A;  1N5X A;  4IM3 A;  5HI1 A;  1N6Z A;  2SAK A;  1WRI A;  4EUT A;  3A9J B;  3OAW A;  4WJN A;  1J7B A;  1ROE A;  2AEH A;  4HDQ A;  3V60 A;  4KIK B;  2NBW B;  4WWN A;  4UDU C;  2YEP F;  1YQ3 B;  1C79 A;  2WU2 B;  1MPE A;  5BYQ A;  1XEE A;  1FNV A;  4YWG G;  1QOA A;  3AMZ A;  1SE9 A;  1B1Z A;  3RFZ B;  1FNU A;  4RGM A;  5BMH A;  1K8R B;  3OJ3 A;  4AS1 A;  1K50 A;  2M1M A;  2V9H A;  2RDB C;  1S1Q B;  1TS3 A;  3DPD A;  2UYZ B;  4EEW A;  5HHD G;  4GDL B;  4MGK E;  4W9D A;  5JZE B;  4LNF A;  1V5O A;  1GG3 A;  1P98 A;  1WIA A;  3V62 A;  4TMA B;  2LWP A;  2ZJD A;  3Q3N C;  2WX1 A;  1WGY A;  1T0R C;  4XDC A;  3MC9 A;  2WMK A;  3B2F A;  3J9C A;  4GSW A;  2EMS A;  4RCO A;  4A8X C;  3FIL B;  4DBG A;  4A20 A;  1WZ0 A;  3AE4 B;  4GU2 A;  1F9J A;  1UWM A;  4OVV A;  1GOZ A;  5FKA C;  4C00 A;  2KQ4 X;  2D11 A;  3NOB A;  1WH3 A;  3PPA A;  4M00 A;  2VH1 A;  3M3J A;  3VRB B;  4A3O A;  2BQQ A;  4H2A A;  1C4C A;  2KXJ A;  4FXC A;  3Q8E A;  5GXG B;  3ZNH B;  1NDD A;  2KC2 A;  1OGW A;  1OQR A;  4BVU C;  4RM8 A;  2C7M B;  4M8M A;  2K6Q A;  1K52 A;  1T0Y A;  5IOI A;  2XBB C;  4IM2 A;  5BO4 B;  3TEW A;  3KWL A;  5IP4 D;  2DBY A;  1MHH E;  3H9D A;  4JX1 C;  4RGN A;  3AXC A;  4C4V B;  4MT5 A;  2JYT A;  1V97 A;  4HRS A;  3IT4 B;  2LXA A;  3SEB A;  4BOZ B;  3UF8 A;  2A4Z A;  3AH7 A;  2KZR A;  1D5X C;  2JVC A;  3VR9 B;  4D6H A;  3W1S A;  1J8C A;  4JL9 A;  3Q3O C;  1F77 A;  1JRO A;  1UWX A;  3WCQ A;  3N30 A;  1E9M A;  3GZN B;  3PS6 A;  2KAN A;  1R4N I;  4DDI D;  2BW2 A;  4BOS C;  3KYC D;  3QWZ B;  1R4M B;  2Y5C A;  2PMV A;  4JWU C;  1GPX A;  3RI7 C;  3H7S A;  2V4I B;  4KDI C;  2FNJ B;  1J19 A;  3NVZ A;  3AE2 B;  3RMK C;  3V61 A;  1U4A A;  3GE8 C;  4LNO A;  1XLP A;  4MJS B;  2V3S A;  4KX6 B;  3P63 A;  2WXK A;  1I4H A;  1WI0 A;  1JQ4 A;  1JRP A;  4W9G A;  4DDG D;  5BYR A;  4ZRK A;  2PLP A;  1TIF A;  1WGH A;  4XZ4 A;  1EF5 A;  1WMH B;  3APD A;  3Q8C A;  3H6N A;  3ZLZ A;  2KX3 A;  4ITK A;  4KV2 A;  4OZC A;  2BS2 B;  3AEC B;  3EEC A;  3ZNI D;  1X1M A;  2B76 B;  1NYR A;  1TS4 A;  3RPF C;  1LGR A;  4FBJ B;  2KT7 A;  1UF0 A;  4P6V F;  1L4D B;  1L0Y B;  2CHZ A;  2G9H D;  1YMH E;  1Q1O A;  3HRD D;  2INP E;  3L4P A;  1BT0 A;  4M8N A;  4WWP A;  4HKZ E;  1I4G A;  4RNA A;  5MPO A;  1WJU A;  3P42 A;  3ZGZ A;  1XXG A;  4CO7 A;  1QLB B;  3K9P B;  1G6J A;  4XYC A;  4YTM B;  3N3K B;  3L17 A;  4BKG A;  1L0V B;  4ANW A;  2BYE A;  1WJ6 A;  4WWM A;  2C60 A;  4HLE A;  1B9R A;  2FID A;  4KGR A;  2O6V A;  4KGS A;  1TT5 B;  1UGM A;  1FPY A;  3IVF A;  4MM3 A;  4ASW C;  2JQR B;  3NZU A;  1Z5S B;  2MWS B;  3RNA C;  3D32 A;  5EE3 A;  1C78 A;  2ZW0 A;  2MA9 B;  3N20 C;  4IC7 B;  1SE4 A;  3AEB B;  3TIX A;  1V8C A;  1WR1 A;  2DX5 B;  3GB1 A;  4OZB A;  5JHB A;  2PVG C;  3PO0 A;  1JRU A;  1KLU D;  1RM6 C;  4B0M A;  1KRH A;  4ICV A;  2MJ3 A;  3DBR B;  2DAF A;  3L54 A;  2BYV E;  2PJH A;  2I2Y A;  1T0S C;  2FUH B;  4DHJ B;  4US9 A;  3ZXR A;  2QC8 A;  2ZNV B;  1ESF A;  1GC6 A;  2KK8 A;  2MBH A;  1VRA B;  1TKY A;  4B9K A;  4YTN B;  1PQS A;  2KAJ A;  1E7U A;  2KKC A;  3ZIM A;  2WXN A;  3T9L A;  1JWS D;  3RNB C;  3GP7 A;  2QMT A;  5J18 A;  3QAR A;  2BVC A;  1N61 A;  3MJ5 A;  3TL5 A;  3RZF A;  4XWW A;  3TEY A;  4NNJ B;  3E56 A;  4M0W A;  2GI9 A;  2ZNV C;  5FR6 A;  1ENF A;  4RGT A;  3ZDT A;  1J7C A;  2WMJ A;  5AZH A;  4MH0 E;  4YXD B;  3VXW A;  2NPT B;  4DHJ D;  2VH2 A;  5L95 C;  2C7H A;  3W5U B;  3DOW A;  1XD3 B;  2WXI A;  3KUD B;  1E8Z A;  5HKH A;  3IG3 A;  3RT3 B;  3ZXV A;  2RMM A;  2J52 A;  4WUR A;  2D10 A;  1NEN B;  2IPK D;  1RFK A;  3QJZ A;  1T6B X;  5AZG A;  3OLM D;  2WDV B;  4BBN C;  1PDX A;  3PV1 A;  1F0Z A;  2I1J A;  4LNI A;  1CK1 A;  2N0S B;  1TKG A;  2FBW B;  3IXS A;  1YJ1 A;  1WXS A;  1ZP0 B;  4K7S A;  4J6I A;  1C9F A;  1V1O A;  4JGH B;  1TZO A;  2C7N B;  3CST A;  2MBO A;  4XX5 A;  2GRI A;  2KDI A;  3ZRC A;  4PS8 A;  2N7J A;  2BGF A;  3IHP C;  3NJT A;  3OWE B;  3AE7 B;  2IGD A;  4GDK B;  1Z2M A;  1E0Z A;  3BWU D;  4JPS A;  1SXT A;  2J0J A;  3SHQ A;  2ZZP B;  3UIO B;  4KSK C;  3ALB A;  1HZ6 A;  2JF5 A;  5IN7 A;  3SFD B;  1T0Q C;  2PTL A;  1R7S A;  2D3C A;  1PGA A;  4D71 A;  1GUA B;  1VZ7 A;  2O2V A;  1RWS A;  2MP2 A;  4NJC A;  2WX0 A;  2RPV A;  4A55 A;  4BBN F;  3PRM B;  5HG2 A;  1LM8 B;  2J4X A;  4GLS C;  3L10 B;  4MEL A;  3OG5 A;  1J7A A;  3RNC C;  1IUE A;  3RN9 C;  2MQJ A;  3HM3 A;  1PGB A;  2KJ6 A;  3A1Q A;  2Z8L A;  3T8M A;  2A5U A;  1ZGU B;  3R8B A;  1UH6 A;  1D4B A;  1WE6 A;  2XK5 A;  4M02 A;  1D5M C;  1L2N A;  2WXG A;  3DBL B;  2YEP B;  1YX6 B;  5C3J B;  1YJI A;  2KWD A;  1E6E B;  4ZHP A;  4B6W A;  3ZKJ C;  1EWY C;  3DBH I;  5TR5 A;  4NAW B;  3I5J C;  4HPP A;  3AV8 A;  1E8W A;  3TMP B;  3RYT A;  2H88 B;  3BVM A;  1E8X A;  4KKJ A;  4JE3 B;  2INN E;  2ZW1 A;  3TJP A;  3AUL A;  3C19 A;  2MJE A;  4ACF A;  1V81 A;  2FIF A;  3U7D A;  1ZUD 2;  1P3Q U;  5E6O A;  2IDY A;  2BWF A;  1D3Z A;  2LUE A;  3WAN A;  3KYD D;  4JLC A;  5CTR C;  1IP9 A;  2V1Y A;  3U30 A;  3R2I A;  1KF6 B;  3MC0 B;  2JZZ A;  3RD2 A;  1SGH A;  2L7R A;  1YD8 U;  3A33 B;  3IFW B;  3PZ8 A;  4FJY A;  4I6N B;  2LGI A;  2KWC A;  3DDC B;  2LXC A;  3UI3 A;  4W9E A;  3IT6 B;  4C7Z A;  3HM6 X;  2WNM A;  3ZYY X;  5CHV C;  3SR6 A;  5EDS A;  1WFY A;  2WMF A;  1RAX A;  1M4V A;  2KHW B;  3AEF B;  1WJN A;  3P4S B;  1PGX A;  3AEE B;  1WY8 A;  2LUM A;  4WAA A;  4YTP B;  2FCM A;  3IAS 1;  1HA5 A;  3PRP B;  1XCQ L;  3L0W B;  4MGY E;  5LXI B;  1NEK B;  2MBQ A;  1UUP A;  1CQV A;  4PS7 A;  3NVW A;  2L0F A;  1C4P A;  2N7E A;  4CHK A;  4C56 C;  4K7W A;  3PHW B;  1NBF C;  4HCN B;  3QQ8 B;  1ZW7 A;  1SBB B;  2QIE B;  3AM9 A;  2RGF A;  2D3A A;  2KN5 A;  5LLI A;  3T3O A;  1QT9 A;  2JXX A;  3ZUN A;  4L2Y A;  4ANV A;  3H8H A;  2NTT A;  1DOX A;  4OHJ A;  1SE2 A;  1QZE A;  1SE3 A;  4YT0 B;  2QCZ A;  2N9K A;  2LGD A;  1N63 A;  2N1V A;  1UBQ A;  2DZK A;  4YSX B;  2X38 A;  2NVU I;  1O0S A;  4LDT B;  2DWQ A;  2KAC A;  3T3N A;  1S3S G;  3W9C B;  4I6L B;  2DZJ A;  2OED A;  3AE3 B;  1ET6 A;  5IA7 A;  2IBI B;  1D5Z C;  4KZC A;  3WAP A;  3VTU A;  3QHT A;  3Q3F A;  2KTR A;  2HJ8 A;  3A4R A;  1VDV A;  2KMA A;  3WIM A;  1Y8R C;  3NS1 A;  2K6D B;  3ZVV A;  3PLU A;  2WYQ A;  2E3T A;  5AEK B;  3IBE A;  1YN5 A;  3QIJ A;  1YOV B;  2RSU A;  3GE3 C;  3NZ3 A;  1T5X D;  2KVR A;  3UIN B;  5EE0 A;  3MHS D;  3DVG X;  3EA6 A;  4REZ A;  2LHD A;  2N9E B;  2FE8 A;  4AJY B;  2L1A A;  4DK5 A;  3B1L X;  3C0R B;  1QF6 A;  4A90 A;  5FR3 A;  2WXL A;  4K1R B;  4PT5 A;  4L1B A;  4TKN A;  2W82 A;  1IGD A;  2BKR B;  2PEA A;  2BB6 A;  2CKH B;  3VFK A;  1UD7 A;  1V1P B;  1FCC C;  4NJ6 A;  5AUK A;  2K1F A;  1FXT B;  1VCB A;  3VVW B;  1FCL A;  1EU4 A;  1F52 A;  2O6V B;  1NVI D;  2ZPY A;  3ZQ4 A;  3DHG C;  1IBX A;  1ZE3 D;  2GB1 A;  3VH3 B;  3N1Y C;  2M0A A;  2JWU A;  1I42 A;  2ZVN A;  2WXR A;  2K5P A;  4LJO B;  4K7U A;  1VZ8 A;  1Q10 A;  2WMH A;  3A9K B;  2G4D B;  4D6D A;  1ZDX A;  2DAJ A;  3AI5 A;  4OZA A;  2JY6 A;  2QHO A;  4O1N A;  4HKQ A;  2KFK A;  5IKC M;  4C80 A;  4LJP B;  2Y3A A;  2C5L C;  3PRE A;  3MHZ A;  1D6E C;  5J2R A;  5C2T B;  4M01 A;  3SD5 A;  4ZOH C;  4HJK A;  1FRD A;  4CYE A;  2LVQ A;  1YIW A;  2MH7 A;  2W9N A;  4DHZ E;  2KOX A;  3AED B;  2WHI A;  2WQY B;  2K0P A;  3PHX B;  1SIJ A;  4ICU A;  4LK0 M;  4URK A;  1YJJ A;  2WXM A;  3HHM A;  4E71 A;  1JWA D;  4FHJ A;  1E8Y A;  2ZCB A;  3A9J A;  3KH0 A;  2OJW A;  1PUT A;  3KW5 B;  2I38 A;  4KIK A;  4F1S A;  1SSN A;  2G4S A;  2WDR B;  3Q6B A;  2JZP A;  3CWI A;  1P7F A;  3L16 A;  4RFB A;  1GB1 A;  3UQB A;  2AL3 A;  3DVN U;  3AE8 B;  5DPW A;  4ZRI A;  1MHX A;  2K9X A;  1QOB A;  4TQ1 A;  2KDE B;  3W5V B;  3PLV A;  4A3P A;  1PFD A;  4EZJ A;  3HVD A;  5FK9 C;  2WU5 B;  2K3U A;  2IZV B;  1AWD A;  3KVF B;  5GMV A;  1JCK B;  3EFU A;  2NBU A;  3DWM A;  2GBM A;  2DZM A;  2KJH B;  4ZYN A;  1JML A;  4ARC A;  2M0X A;  5D94 A;  4JWS C;  4HJG E;  2EKI A;  4GDL A;  2JX5 A;  4WJO A;  3VHT C;  1GNU A;  3AB5 A;  1EO6 A;  2J7Q B;  2PPH A;  1KFY B;  4D6E A;  4D6F A;  2WDQ B;  3QK0 A;  4FA6 A;  1XO3 A;  4KSL C;  2ZEQ A;  4FN2 A;  1K53 A;  1H4R A;  1WX8 A;  3FAH A;  3WA0 A;  4X57 B;  3M62 B;  3TSS A;  2KD0 A;  2MEK A;  2BTE A;  4KDL B;  1JW9 D;  2WS3 B;  1VZ6 A;  2KVZ A;  4EE2 A;  4W9I A;  5HFY A;  1XQQ A;  2ASQ A;  1NYQ A;  3ZDM C;  1XLQ A;  3FIL A;  3ZTD A;  2K22 A;  2QSD A;  2BF8 B;  2WXJ A;  3TBL D;  5BMI A;  4MH8 A;  3U52 E;  4KGT A;  4BKS D;  5J17 A;  1WRD B;  3BYT B;  1FO4 A;  2FUG 1;  2WXQ A;  1WXM A;  4XGA B;  2NBV B;  2IY1 B;  3SDL C;  2AL6 A;  1HTQ A;  2M56 B;  4OVZ A;  2MBB B;  1E7V A;  1ACC A;  3KUZ A;  2VZK B;  2KDF B;  2EMT A;  5DPS A;  4II3 B;  2B3A A;  2PIA A;  4LCD E;  2W54 A;  2EKE C;  1OQQ A;  4NZL B;  2WGS A;  2MCN B;  1XLN A;  2KMM A;  4EZL A;  3H7P B;  2YLM A;  2KN4 A;  1R4N B;  1C4A A;  3P4R B;  4YSZ B;  3LYY A;  1I4R A;  1OEY J;  2IO3 B;  4WH4 A;  1F2R C;  1AAR A;  4GGQ A;  3APC A;  2DEN B;  5JH5 C;  1T3Q A;  5D3D A;  2JRH A;  4N58 A;  3QCA A;  1TGZ B;  5I4D A;  4WQM A;  4B0E A;  3X23 A;  4GOC A;  3I63 C;  4ZHO A;  3JSV B;  3DBL I;  1L5P A;  1YQB A;  2WDT B;  2REX A;  2VZK D;  3SU8 X;  3E9S A;  2WLB A;  2J0M A;  4GN1 A;  3ZNZ B;  4HDO A;  2BBC A;  1TS2 A;  4P16 A;  3AE5 B;  4QAY A;  2ZPN A;  5D7G A;  2ACZ B;  2LVO A;  2L00 B;  1KM7 A;  2OJR A;  1C76 A;  2R2Q A;  3WAL A;  3ML8 A;  4K81 A;  1FMA D;  1FFV A;  3BIN A;  2YVC A;  4DWF A;  2J42 A;  3AE6 B;  2K8C A;  3QA8 A;  1WMH A;  2BB5 A;  1P0R A;  2Y5B B;  1UNS A;  3ZNG C;  4MGZ E;  2LZ6 A;  1V5T A;  2K39 A;  2JWZ A;  3BII D;  5TSS A;  5CX3 A;  2BT6 A;  3ECI A;  1BUI C;  4AOF A;  1Q5W B;  3U7Z A;  1HXY D;  3DHH C;  2V4L A;  4D72 A;  3PZD A;  4WJQ A;  1YN4 A;  1QKZ A;  1UZX B;  2JYE A;  3LDZ E;  4D6C A;  3RNF C;  5L83 A;  1JAL A;  3URY A;  4XC2 A;  4C7Y A;  1HQR D;  3PVL A;  1RYJ A;  3KLS X;  2KWV B;  3Q14 C;  1SJH D;  1E90 A;  1YN3 A;  1SJE D;  2DNF A;  4K3B A;  4PYU A;  5E6J A;  1LQB A;  2CJO A;  4XWT A;  1WX7 A;  2WP9 B;  1WYG A;  1P9D U;  4MAC A;  2IGG A;  1KH0 A;  3DVG Y;  3NS8 A;  1EU3 A;  3RNG C;  4D2K A;  4NY0 A;  3TCA A;  2FCN A;  1QIL A;  2IND C;  2LFI A;  5LXH A;  2V3P A;  3PSE B;  1GAQ B;  2KTR B;  4DQO C;  3N9Y C;  5E6P A;  2BPS A;  1WX9 A;  4IWO A;  4JIO U;  1LO5 D;  4FJV B;  1XCT L;  2XEW A;  2AQ1 B;  2KDM A;  3LXF A;  1V2Y A;  4ZRJ A;  5C23 A;  1MG4 A;  1OTR B;  2DZI A;  1UGJ A;  3AEA B;  3ABV B;  4HEA 1;  5IAA C;  3TUO A;  4ZRP A;  3AE1 B;  1HEZ E;  3HIZ A;  2MJD A;  1WGK A;  1EUV B;  1WXQ A;  1V6E A;  3GS2 A;  2G1E A;  1QQR A;  4L23 A;  4LLG M;  1KJT A;  3ZJU A;  1JWB D;  3RUI B;  3R2T A;  2CHX A;  2RD0 A;  4OVU A;  1V9J A;  1WXA A;  1WGD A;  2XN9 C;  3L13 A;  2BWE S;  4Q2J A;  3ZTC A;  3DBS A;  3P1M A;  4HPM B;  2NS5 A;  2JSV X;  3DVN V;  5T8I A;  4N9F 4;  1FFU A;  2E6X A;  3OJ4 B;  3DCG A;  3U2S C;  3JVZ X;  2V0G A;  4G0N B;  1IYF A;  2UWQ A;  2HTM E;  2WMI A;  2L83 A;  2ONQ A;  4W9L A;  4G50 A;  5KHQ A;  2N4F A;  1IGC A;  2D3G A;  1WF9 A;  2LD9 A;  2H89 B;  4DHZ B;  4A6Q A;  1OFF A;  3ONS A;  1BXT A;  1LFD A;  3CIR B;  1ZOY B;  4USA A;  2C9W B;  3M95 A;  3MTN B;  5DPR A;  4AJW A;  2RDG A;  1TYG B;  3ZW3 A;  1KTK A;  3N1Z C;  5KHO A;  5H92 C;  1WM2 A;  2KDB A;  2PE6 B;  3GZN I;  4DXA B;  1QOF A;  5G5G A;  4IWP A;  2D2Q A;  2NCN A;  2N9P C;  3V3X A;  3W1S C;  3ZJV A;  4S0R A;  2ON8 A;  4F7Z A;  2SEB D;  4GDK A;  4KZ0 A;  3AE9 B;  2LRW A;  1R4M I;  1E10 A;  3AN1 A;  5CHW A;  4GXB A;  4RMA A;  4EKU A;  4MDK E;  2MHJ A;  1AN8 A;  2MW5 A;  2CR5 A;  2HD5 B;  2DLB A;  5EE1 A;  2CHW A;  3Q69 A;  4G11 A;  3AU4 A;  3NUH B;  4ANX A;  1L0X B;  1K51 A;  2JPH A;  1IPG A;  3W2D A;  1N60 A;  3S2A A;  2BKF A;  4BAX A;  2PVO D;  2BS4 B;  1WXV A;  3B0A A;  4FUL A;  1OQY A;  1WGG A;  3DBH B;  1WWT A;  1TS5 A;  2N7D A;  4LDT D;  2J0K A;  2MSE D;  3I3T B;  1FXA A;  1WE7 A;  2HJ1 A;  1QOG A;  3BK2 A;  3Q3M C;  1A5R A;  4IDI A;  2CU3 A;  1KLG D;  2AYO B;  2N1W A;  3LJ3 A;  4ANU A;  2JU6 X;  3RCZ A;  1P7E A;  1MVK A;  2VRR B;  3VAW A;  3FC4 A;  2W3R A;  2GMI C;  4NAW A;  1MG8 A;  1LXD A;  2PW9 A;  4US8 A;  2G45 B;  4TUU A;  4MM3 B;  2INC C;  3UQA A;  2M17 A;  1RLF A;  2NMQ A;  3VH4 B;  1I7H A;  3ZO5 B;  2AQ2 B;  3BVZ A;  1AYF A;  1I35 A;  2JXT A;  1N5W A;  3VTV A;  2ZVO A;  3AEG B;  2DYO A;  1DOI A;  4A9A A;  1E7P B;  3SFE B;  4N59 A;  3MJW A;  1HZ5 A;  1HE8 A;  2KMC A;  3DQV A;  2WXF A;  4P7I A;  1VJK A;  2GBJ A;  3PZ7 A;  1VLB A;  1SIF A;  5JHA A;  2BS3 B;  3PTF C;  3C8Y A;  2WWZ A;  4MSM B;  1L6V A;  2DYB A;  1F1H A;  2O6V D;  1F2R I;  1V86 A;  1CMX B;  3DBR I;  3R66 C;  1SF0 A;  3CF6 E;  2IGH A;  1N62 A;  4YL8 A;  2DHZ A;  1XLO A;  1GJZ A;  4E3C A;  2X8X X;  2DYM A;  2MBE A;  4KVG B;  2KLG A;  2LRU A;  4W9K A;  2M19 A;  4D6J A;  4FHK A;  2KNB A;  4M0W B;  2FCS A;  4EOY A;  2IO2 B;  4AWJ A;  4AUQ C;  2KQ7 A;  5C1Z A;  2Z59 B;  1JWM D;  4RF0 A;  1EWC A;  2CU1 A;  1V49 A;  3APF A;  1H8C A;  1YQ4 B;  2HE7 A;  1WGR A;  2OHF A;  4IUM B;  2BYT A;  1WJ4 A;  4WIP A;  4ARI A;  2TSS A;  2KX0 A;  3PT2 B;  4WQO B;  5BYS A;  3KWV A;  2LGS A;  4FJZ A;  1YX5 B;  4HXD A;  1KLV A;  4GIV A;  2MRP A;  4BZA A;  1VD2 A;  4S17 A;  2GLS A;  1L6U A;  2L3Z A;  1JWU D;  4NQK E;  2FAZ A;  5LNK 1;  1EM7 A;  1WR6 E;  3QAQ A;  1P1A A;  3VUX A;  2JT4 B;  2NR2 A;  4HPL B;  1C77 A;  2CS4 A;  4FAD A;  4DXF A;  2AQ3 B;  3ENE A;  4EZK A;  2QIL A;  1ZXI A;  1TTN A;  3WAO A;  2IJ0 A;  1V80 A;  3K9O B;  3ZJT A;  1L4Z B;  3CMM B;  4TQ0 A;  5E6N A;  3A4S C;  1STE A;  2LGY A;  3EHV A;  1WYW B;  4IW0 A;  4EFO A;  4DXG A;  3Q8B A;  1FXI A;  4K3C A; 
#chains in the Genus database with same CATH homology
 1YN4 A;  1QKZ A;  3SR6 A;  1V1P A;  2HDE A;  2JYE A;  4MT5 A;  5EE9 A;  2JYT A;  1M4V A;  1V97 A;  3AEF B;  3EGR A;  3P4S B;  1PGX A;  1JAL A;  4HRS A;  3AEE B;  3IT4 B;  2LUM A;  4YTP B;  3SEB A;  3URY A;  4C7Y A;  1HQR D;  3IAS 1;  1HA5 A;  1RYJ A;  4HRO A;  3KLS X;  1XCQ L;  1SJH D;  5JXV A;  1YN3 A;  1NEK B;  1UUP A;  3BYY B;  1CQV A;  1SJE D;  3NVW A;  5E6J A;  1C4P A;  2CJO A;  3AH7 A;  3VR9 B;  1D5X C;  4C56 C;  4XWT A;  2CJN A;  3W1S A;  1XF5 L;  1WYG A;  2WP9 B;  1SBB B;  1F77 A;  1JRO A;  2QIE B;  3AM9 A;  1ZDV A;  4MAC A;  2IGG A;  1KH0 A;  1UWX A;  3T3O A;  3WCQ A;  1QT9 A;  1E9M A;  2RDH A;  4L2Y A;  1AW7 A;  1EU3 A;  3EUB 2;  2NTT A;  3H8H A;  1DOX A;  4OHJ A;  1SE2 A;  2BW2 A;  1SE3 A;  3LB8 C;  1I4P A;  4D2K A;  4YT0 B;  2N9K A;  1N63 A;  1QIL A;  2V3N A;  1A70 A;  5AUI A;  2Y5C A;  4ZYS A;  2LFI A;  3DWG C;  4YSX B;  1I4Q A;  2PMV A;  2X38 A;  4JWU C;  1GPX A;  2V3P A;  3NRZ A;  1GAQ B;  1TKE A;  3BZD B;  2DWQ A;  2LHE A;  1FRR A;  2KAC A;  2V4I B;  4DQO C;  3T3N A;  3VQI A;  3N9Y C;  3MP9 A;  3W9C B;  3NVZ A;  2N9L A;  1ZPS A;  3AE2 B;  4R3D A;  2OED A;  3AE3 B;  1ET6 A;  4IOI E;  1LO5 D;  1D5Z C;  1XCT L;  2AQ1 B;  1XLP A;  2KDM A;  3LXF A;  4KX6 B;  2EEL A;  3P63 A;  2WXK A;  1TY0 A;  1UGJ A;  1I4H A;  1VDV A;  1JQ4 A;  1JRP A;  2Q5W D;  3AEA B;  3ABV B;  2Y5P A;  3NS1 A;  4HEA 1;  3P4P B;  5BYR A;  3TUO A;  5BMG A;  3NVV A;  4ZRP A;  2PLP A;  3AE1 B;  2E3T A;  1HEZ E;  2MJD A;  4CQN A;  1YN5 A;  5D3I B;  3Q8C A;  1WGK A;  2WXH A;  1WXQ A;  1SEB D;  3GS2 A;  4TSS A;  3NZ3 A;  1T5X D;  2G1E A;  2WXO A;  1QQR A;  5EE0 A;  4ITK A;  4L23 A;  4LLG M;  3Q8F A;  3EA6 A;  3ZJU A;  1JWB D;  4OZC A;  4REZ A;  2LHD A;  2FE8 A;  3R2T A;  2L1A A;  4RF1 A;  2BS2 B;  3AEC B;  1QF6 A;  4A90 A;  5FR3 A;  1ZXH A;  4IKG A;  2WXL A;  1WSP A;  2B76 B;  2XN9 C;  1NYR A;  1TS4 A;  3RPF C;  4PT5 A;  4Q2J A;  4L1B A;  1DOY A;  1Y56 A;  3NVY A;  4P6V F;  1L4D B;  1L0Y B;  4LTU A;  3P1M A;  2G9H D;  1YMH E;  3HVZ A;  3HRD D;  2INP E;  3L4P A;  2W82 A;  1IGD A;  4J3O D;  4HKZ E;  2BB6 A;  1I4G A;  2JSV X;  4RNA A;  1V1P B;  1FCC C;  1ET9 A;  5MPO A;  2R61 A;  5AUK A;  1DYQ A;  5T8I A;  1EU4 A;  3P42 A;  1FFU A;  2E6X A;  3P4Q B;  3ZGZ A;  1FCL A;  1XXG A;  1QLB B;  3I9V 1;  4YTM B;  1NVI D;  1MI0 A;  3U2S C;  3ZQ4 A;  1L0V B;  2V0G A;  1IBX A;  1FM0 D;  1FD6 A;  1ZE3 D;  4WWM A;  2HTM E;  2GB1 A;  2L32 A;  4ZRQ A;  2L83 A;  2D5G A;  2ONQ A;  1B9R A;  1CZP A;  2M0A A;  2QJL A;  2JWU A;  2L52 A;  4KGR A;  4KGS A;  1IGC A;  2WXR A;  2K5P A;  3BVG A;  1VZ8 A;  2H89 B;  1Q10 A;  4A6Q A;  1OFF A;  1BXT A;  2JQR B;  1CJE A;  3CIR B;  4OW0 A;  1ZOY B;  1ZDX A;  4USA A;  4OZA A;  5EE3 A;  1C78 A;  2RDG A;  4O1N A;  4HKQ A;  1TYG B;  2ZW0 A;  1SE4 A;  4RH6 A;  3V05 A;  4C80 A;  2Y3A A;  1KTK A;  3AEB B;  3MHZ A;  1D6E C;  1FEH A;  5H92 C;  5C2T B;  1V8C A;  3GB1 A;  4ZOH C;  4OZB A;  2LEK A;  4XE0 A;  1FRD A;  2PVG C;  3PO0 A;  1KLU D;  1RM6 C;  1QOF A;  5G5G A;  4B0M A;  1KRH A;  2MH7 A;  2MJ3 A;  3AED B;  2WQY B;  2K0P A;  3V3X A;  5G5H A;  2I2Y A;  1SIJ A;  4LK0 M;  3ZJV A;  2ON8 A;  1YJJ A;  2SEB D;  2WXM A;  3AE9 B;  1JWA D;  4US9 A;  3VRA B;  1E10 A;  3AN1 A;  4YSY B;  1ESF A;  3O13 A;  2QEJ C;  1PUT A;  1VRA B;  2I38 A;  1SSN A;  1TKY A;  2NTS A;  2WDR B;  4YTN B;  3TEZ A;  1AN8 A;  2JZP A;  3CWI A;  2KAJ A;  1P7F A;  2WXN A;  4RFB A;  1GB1 A;  2LMC A;  3VR8 B;  1JWS D;  3GP7 A;  2QMT A;  2DLB A;  3AE8 B;  5EE1 A;  1MHX A;  3Q69 A;  2K9X A;  1FIQ A;  1N61 A;  3MJ5 A;  3NUH B;  1QOB A;  4TQ1 A;  4XWW A;  3W5V B;  3TEY A;  1L0X B;  1PFD A;  1K51 A;  1PYW D;  3B9J A;  3HVD A;  3IAM 1;  3W2D A;  1N60 A;  3E56 A;  3ETR A;  4M0W A;  5FK9 C;  2GI9 A;  1ENF A;  2WU5 B;  2K3U A;  4RGT A;  2PVO D;  2BS4 B;  3BK1 A;  4KKI A;  4N6E B;  1AWD A;  1J7C A;  1JCK B;  2W3S A;  2AX5 A;  3DWM A;  3U4E G;  4YXD B;  1JML A;  2LJI A;  4ARC A;  1GB4 A;  4JWS C;  4HJG E;  2EKI A;  1WWT A;  1I4X A;  2JX5 A;  1DGJ A;  1SB3 C;  1TS5 A;  3AB5 A;  3W5U B;  1FXA A;  1KFY B;  3B2G A;  3BK2 A;  1QOG A;  4WAF A;  2WDQ B;  1XO3 A;  2WXI A;  4IDI A;  2CU3 A;  1TJE A;  1K53 A;  3FAH A;  2RMM A;  2J52 A;  1KLG D;  4WUR A;  3HUI A;  3TSS A;  2JU6 X;  1IBX B;  1P7E A;  1MVK A;  2MEK A;  1BML C;  2BTE A;  1NEN B;  3FC4 A;  1JW9 D;  2W3R A;  2IPK D;  2WS3 B;  1VZ6 A;  1RFK A;  3Q8A A;  4EE2 A;  2PW9 A;  5HFY A;  1TY2 A;  1NYQ A;  3I57 A;  1FNW A;  2PKO A;  4US8 A;  1T6B X;  1XLQ A;  3FIL A;  2XNA C;  2WDV B;  5H8Y E;  1PDX A;  2K22 A;  2QSD A;  4RGO S;  4MM3 B;  1F0Z A;  2WXJ A;  1CK1 A;  2N0S B;  1TKG A;  5BMI A;  4MH8 A;  3U52 E;  2FBW B;  3IXS A;  2NMQ A;  3TEX A;  1I7H A;  2J53 A;  2AQ2 B;  3BVZ A;  1AYF A;  2JXT A;  1YNT E;  1ZP0 B;  1N5W A;  4KGT A;  1C9F A;  1V1O A;  1TZO A;  3AEG B;  2DYO A;  3BYT B;  1DOI A;  4A9A A;  1FO4 A;  1E7P B;  3SFE B;  4N59 A;  4AQ7 A;  2FUG 1;  1HZ5 A;  4XDD A;  1NI3 A;  2WXQ A;  1VR9 A;  2WXF A;  4NAM A;  3MFG A;  2GRI A;  1VJK A;  3PZ7 A;  2W55 A;  2ICI A;  2N7J A;  3KQ4 A;  2M56 B;  4OVZ A;  3OWE B;  1VLB A;  2WXP A;  2IGD A;  3AE7 B;  4GDK B;  1N5X A;  3BWU D;  4JPS A;  1E0Z A;  1SXT A;  1ACC A;  2BS3 B;  3C8Y A;  5HI1 A;  2SAK A;  1WRI A;  2VZK B;  1J7B A;  1HZ6 A;  1L6V A;  1ROE A;  3SFD B;  2PTL A;  1F2R I;  1R7S A;  2PIA A;  1PGA A;  4UDU C;  2YEP F;  1SF0 A;  1VZ7 A;  4NJC A;  1RWS A;  1YQ3 B;  1C79 A;  2W54 A;  2WU2 B;  2RPV A;  2IGH A;  4A55 A;  1OQQ A;  1MPE A;  4NZL B;  5BYQ A;  1N62 A;  1XEE A;  1XLN A;  1XLO A;  2KMM A;  1FNV A;  4YWG G;  5HG2 A;  2DYM A;  2J4X A;  2KN4 A;  4GLS C;  1QOA A;  3AMZ A;  1B1Z A;  1C4A A;  1J7A A;  3RFZ B;  1FNU A;  3P4R B;  4RGM A;  1IUE A;  4YSZ B;  2M19 A;  5BMH A;  3LYY A;  1I4R A;  4AS1 A;  1PGB A;  4WH4 A;  1K50 A;  1F2R C;  2Z8L A;  1TS3 A;  3R8B A;  1T3Q A;  1D4B A;  5D3D A;  1JWM D;  4N58 A;  1D5M C;  4RF0 A;  5I4D A;  2WXG A;  4WQM A;  5HHD G;  4B0E A;  4GDL B;  1EWC A;  1YQ4 B;  2YEP B;  4ZHO A;  1L5P A;  5C3J B;  1YJI A;  2KWD A;  2OHF A;  2VZK D;  1E6E B;  4ZHP A;  3E9S A;  2BYT A;  2WLB A;  4WIP A;  4ARI A;  2TSS A;  1EWY C;  2BBC A;  1TS2 A;  4P16 A;  3AE5 B;  4TMA B;  5BYS A;  3KWV A;  5D7G A;  4NAW B;  2ACZ B;  4XDC A;  1L6U A;  3AV8 A;  3B2F A;  1JWU D;  3J9C A;  4RCO A;  4A8X C;  2H88 B;  3FIL B;  3BVM A;  1C76 A;  5LNK 1;  4KKJ A;  1EM7 A;  2INN E;  3AE4 B;  2ZW1 A;  4JE3 B;  2MJE A;  1FMA D;  1FFV A;  1UWM A;  1C77 A;  1GOZ A;  5FKA C;  2J42 A;  4DXF A;  2AQ3 B;  2KQ4 X;  1ZUD 2;  3ZYY X;  2QIL A;  3AE6 B;  1ZXI A;  2IDY A;  3VRB B;  2BB5 A;  2IJ0 A;  1UNS A;  3R2I A;  1KF6 B;  4H2A A;  1C4C A;  3MC0 B;  3BII D;  4FXC A;  5TSS A;  3Q8E A;  5GXG B;  3ZJT A;  1L4Z B;  2BT6 A;  4TQ0 A;  3PZ8 A;  1BUI C;  1OQR A;  1STE A;  3U7Z A;  1HXY D;  2LGI A;  1K52 A;  3UI3 A;  4DXG A;  4C7Z A;  3IT6 B;  3TEW A;  3Q8B A;  3KWL A;  2DBY A;  2WNM A;  1MHH E;  4JX1 C;  1FXI A;  4RGN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...