3BYTB

A complex between a variant of staphylococcal enterotoxin c3 and the variable domain of the murine t cell receptor beta chain 8.2
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
238
structure length
232
Chain Sequence
SQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSTWHGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords T cell receptor beta chain 8.2
publication title Manipulating the coupled folding and binding process drives affinity maturation in a protein-protein complex
rcsb
source organism Mus musculus
total genus 64
structure length 232
sequence length 238
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2008-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
B PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3bytB02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3bytB01
4NZLB 4RGTA 2IPKD 3BZDB 3DWQA 4RGNA 2ICIA 4TSSA 1LLRD 1HQRD 2O2LD 5ELCA 1YN3A 4RGOS 1V1PA 1TS2A 1YN4A 4RHSA 1KLUD 5I4DA 1FNUA 1UUPA 3V05A 1I4HA 1SBBB 3TSSA 1LTID 1V1OA 5FK9C 1HXYD 1AW7A 3BVGA 1JWSD 4DXFA 3DWAA 2XN9C 4O1NA 1D5XC 4L63B 1DYQA 2QILA 3KLSX 1S5FD 4RH6A 4C56C 1RDPD 1FD7D 1PYWD 1I4XA 2IJ0A 3GP7A 4Z9CB 1LT6D 3CHBD 1JQYD 1FGBD 1S5DD 1RD9D 3MC0B 1L0YB 3R2IA 1AN8A 1STEA 3R2TA 1LTBD 1KTKA 1SJED 1SJHD 3BYTB 5ELDA 1ENFA 1FNWA 1S5BD 4DXGA 1SE4A 2AQ2B 1JCKB 3OWEB 1LO5D 3MFGA 1SXTA 4RFBA 2NTSA 1PZID 2AQ3B 1ET9A 4ZYSA 1TS4A 1CHQD 1RCVD 3W2DA 1EEFD 1LT5D 4OHJA 3EFXD 1EU4A 4RGMA 1BCPC 5TSSA 1D6EC 1V1PB 5FKAC 1TY0A 1BCPB 3DWPA 3BVMA 1EWCA 1I4RA 1EU3A 4RCOA 2WV6D 1ET6A 1TS5A 1EFID 3SEBA 1PTOC 1JWUD 1FNVA 4RHRA 1UNSA 1DJRD 2XRSD 5D3IB 1BCPF 1LT3D 1CQVA 1ESFA 1PTOB 1PZJD 2CHBD 2SEBD 1MD2D 2TSSA 3O13A 1RF2D 4L6TB 1BCPD 1LTGD 1G8ZD 1L0XB 1LTSD 2NTTA 1D5MC 1PRTC 2RDHA 1B1ZA 4BWGB 1PRTB 1LT4D 1KLGD 1XTCD 1CT1D 2Z8LA 3URYA 1B44D 2AQ1B 1GOZA 1PTOF 1LTTD 3EA6A 1CHPD 1EEID 1LTAD 1M4VA 2R61A 1YN5A 1SEBD 1I4QA 1PTOD 1SE3A 4K6LA 1I4GA 1TS3A 2XNAC 3BVZA 1HA5A 1S5ED 1HTLD 1XXGA 1PRTF 1QILA 5ELFA 1BXTA 1JR0D 5ELBA 1D5ZC 1PZKD 1TY2A 5ELEA 1CK1A 1PRTD 3R8BA 1T5XD 1SE2A 2XRQD 1F77A 3BYYB 1JWMD 1I4PA 1LTRD 1PTOH 2G9HD 2J4XA 2RDGA 5D3DA 2QEJC 1S5CD 4UDUC
chains in the Genus database with same CATH superfamily
1Q1EA 3G48A 3PPAA 2AWOA 2WXPA 2Z6KC 3GE3C 2JSOA 4PZ6A 3DLLA 3RD4A 2JUOA 1JW9D 3SDLC 5EDSA 1KH0A 4Q2JA 1Y1VH 3SHLA 1NR4A 1V1PA 2OHFA 3SDZA 2ZNVB 3PT2B 3NP8A 5IT9L 3NBHB 2JA6G 1J7BA 5I4DA 1IBMQ 2WGSA 1SMYD 4LTUA 1PH1A 2JX5A 1SDFA 1PV4A 5EQ0A 1EY9A 1N36Q 1WM3A 1YJIA 2OTJA 3NPPA 2BB5A 2Y5BB 1VCIA 2RKSA 3J7AV 3IG3A 1UELA 3BVGA 3KDFB 5C3EG 2KWDA 3P42A 4BKSD 1I6HH 2UUCQ 1Y8OB 1TXYA 2JYOA 1WGHA 4XT3B 4F88A 1WJNA 5BMGA 2N49A 5J18A 1FVIA 3KLSX 3PF5A 2RPVA 2NVUI 4BVUC 2N4FA 3KF6A 3P20A 4FXKC 1SE8A 4G11A 2E2DC 1ILQA 3RN2A 1CI3M 4A3BB 3P4SB 3NVWA 4A3PA 1JE5A 1QUQB 4FLHA 1O7LA 1J7CA 1RFAA 2TMPA 4IOAA 4TRDA 1E7PB 1YNXA 3A8JE 4HSPA 2INDC 3VR2A 1J7AA 1Y14B 1ENCA 5ELDA 3ZUNA 5E4XA 4DXGA 2VUMB 3X3NA 4FF3A 3QAQA 4JI3L 3HOWH 4UAIA 3NBIA 4ZKCB 1DGSA 4NB3A 4OHJA 3ML8A 1NVID 3G71A 3V2TA 1IKLA 4W9EA 3NSWA 2OTLA 4JV5L 3MFYA 2PVOD 3DCGA 4EVOA 3K7AB 4JI1Q 1EIHA 1ZW7A 4JE3B 1QOBA 4CO7A 4F7ZA 5GADC 5A2QE 4GKJL 5I2XA 1WE7A 1L0VB 5FJ8H 1A3TA 4XYQA 3Q22A 3N6RA 2UXCQ 4APVA 5FR6A 2I5MX 4R4QA 2PE9A 1JWAD 1F2RI 4EX5A 1VF5C 1P3QU 1T3QA 1TT5B 3RUZA 2KJ6A 2XGTA 1HZ9A 3TBLD 1YHBA 1MGSA 3AU7A 2UXBQ 3NHEB 3VR3A 1O7IA 1BNZA 2VQEL 5LXHA 4UP8A 1WJUA 1PRTC 1KHIA 1Z7TA 4DUYL 1UWXA 3NVYA 1Y1VB 1TWFH 1BO0A 1XTCD 1UH6A 1V9PA 5ELOA 2EMTA 1A2UA 3BDCA 5AJ3L 4AYBB 2R3ZA 2KCMA 4XZ4A 4ARCA 3E0EA 4RF0A 2PIAA 4BBRB 1RIPA 2B39A 2QIEB 4LF5L 4QJFA 1OTCA 3DOWA 1XNRL 2YVCA 3IHPC 5HGTA 4FXGC 3L2PA 1I6HB 2N88A 5HGQA 2LGXA 4LDTD 1E1OA 1C4PA 2KDEB 4ZRKA 4DWFA 4OVUA 1EUVB 2VH2A 3ZO5B 2V0GA 1ONLA 5ELBA 3FKYA 2R2OA 1V2YA 3OTOL 3RN9C 1TY2A 3R8BA 3IVFA 5DLQE 3Q3NC 2PNRC 1GUWA 2R2QA 1STYA 1JWMD 1MSHA 2CU3A 3VYUA 3K58A 1N60A 3RNFC 4MELA 3GQBA 3HK0A 2AMCB 4PS8A 1XEEA 2QCPX 3MEHA 4B08A 2EYMA 5FO9B 3HOUG 1WF9A 1HFNA 3T3OA 1HQRD 2IL8A 1MG8A 3RR5A 5AUIA 4HVBA 4NXNL 5IA7A 4IUQA 4ODGA 2F0NA 2K05A 4TKNA 2WFWA 3RD2A 1I4HA 3PCOB 3Q24A 1J9OA 2EOTA 4HCPB 3CCJA 2VXWA 5COYA 4J3OD 4MH0E 4B0MA 4C2MH 3PSEB 1A62A 1NI3A 2AYOB 1L2FA 4PYZA 3X0WA 3TEWA 2EJMA 4L2YA 3UDIA 3D6CA 3K80C 3Q6BA 3ZTCA 4A90A 4YWKA 2ACZB 2BWES 4JI2Q 1CKMA 2JA9A 5ISRA 3CMAA 3QARA 4WWPA 3GB1A 1SNQA 4LF7L 1C79A 1CZWA 2JZPA 3MP9A 1PA6A 2KC1A 5C1ZA 3W1BA 3H3VC 2Q5WD 3ULLA 5EBCA 2MFIA 4H0LC 2WXIA 3Q8DA 4GKKQ 4GN3B 4QQBX 3S2DB 3S1RB 4TQUS 4W9HA 4B6WA 1RD9D 5IGEA 4H2AA 3R2IA 2A68D 5A35A 4QCLA 2K33A 2R7ZB 3FPUB 1LABA 4X66Q 2KMAA 2ZXOA 1HZCA 2WXNA 1SE4A 4PNYA 2CW0D 2F4VL 4XE0A 2KANA 3EHVA 3DHGC 4PT5A 2VW9A 1ET9A 4JI8L 1WM2A 2KC2A 2BYTA 3EC8A 1R4PB 1JJCB 1TS4A 1BF4A 3DBLI 3VTUA 2ZW1A 1H8CA 2ZJDA 3W2DA 2DAJA 2M17A 2K6AA 2MJDA 3KLRA 1RODA 1IW7C 2MQHA 1E5WA 1TU2B 2V1CC 1XLQA 1WD0A 3A9JB 3AE6B 2FMMA 3BJUA 1KOTA 2BYEA 4WJ4A 2IGHA 2ZTDA 3KYCD 4A3CH 2IBIB 1C1YB 1YX5B 2K52A 4A3FG 2D10A 3NG0A 3QA8A 4ZRPA 3WOFA 1GJXA 1TGZB 4JI4L 1WTVA 2KWUB 2R7DA 4ACFA 1PZJD 4C1NI 3VDYA 2KAJA 4ARIA 2D3GA 3O13A 1V8CA 4HIDA 1TTNA 3MTNB 4KVGB 4P73A 1LTSD 3A74A 4GDLA 1F52A 2L1AA 2F0IA 1K83B 1LT4D 2RCNA 2ONQA 3HRZC 2MBHA 1HJPA 1Q0WB 1C77A 5M3MG 1CHPD 2MP2A 5DAUA 1V6EA 2G3QB 1LTAD 3CKIB 1NBWA 3I7FA 2XNAC 3HP3A 3NXWA 3OYYA 4DV3L 4DV5Q 3FILB 4OZCA 4C2MB 4MM3A 1HQMC 1J0GA 2LJIA 5KIXA 1K8GA 4G50A 3S24A 2CHZA 4TV3A 1TIFA 3PO3B 1H9MA 1HHVA 2PTLA 4TUUA 4TQ1A 3LDZE 4DKAC 3P1MA 5C44G 4JI5Q 1NYQA 5IWAL 2UUBL 3PVLA 1E8ZA 4G0NB 4KK7A 4F8MA 2CH4A 3DBRB 1Z47A 3HFZB 3OJ3A 5GAHC 2N9PC 5E6PA 4KZ0A 3U52E 5C5MA 3QIJA 2ZTEA 1KRSA 4ZRQA 5IP7G 2GLSA 4XQJA 5HI1A 1PDQA 2OQKA 1TWHH 4V0BA 1OGWA 3UE1A 1FO4A 4C00A 1ZE3D 2KVMA 3MXGA 2A5HA 2HT1A 2R7FA 4NY0A 3H0GH 4YY3Q 4CKEA 2V4LA 2BE5D 2EY2A 2JWUA 4HPLB 2K22A 4DHJD 1F9RA 1PH5A 2DNCA 4DA2A 4A3EB 1Q3LA 1A63A 3RUIB 1XNQL 1Y8PB 4KKSA 3CMMB 1NSNS 2DHZA 2ZM6Q 4A3KH 1EFWA 1I94Q 3GZNI 5J22A 2OOBB 4S0RA 2WAQB 1IXRA 3DWAA 4UY8C 4A3LH 3U9OA 1W6KA 3EIVA 2R92B 3OSOA 1KXLA 4ZLTF 5KYLA 1VS0A 2NVXH 1JALA 1F9JA 3ITPA 1TKEA 2D2QA 2RD0A 3Q8AA 1WTQA 2XK5A 1WFQA 4PZ7A 5K36G 1EOVA 4FO2A 2Y0SG 3PZDA 2Q8RE 3IRBA 3CHBD 3RULA 1X56A 5J3BA 4X3SA 1C4AA 2DZKA 4LF6L 2HIXA 4NJCA 3AXCA 2Y5PA 2N7EA 2K5HA 3AE1B 3LYYA 1L1OB 4FJVB 1L6UA 2V3SA 3MJWA 1RL2A 1C8CA 1VQ7A 3OWEB 5GMVA 3ZJYC 2C5LC 3OMCA 1PZID 2XWJB 1UZXB 2KDBA 1B70B 4OL7A 4GDKB 3J80L 2WU5B 3ZNID 1L4ZB 2BDNA 2SOBA 3J81L 5CHVC 4YSYB 4YWGG 2J0JA 3PRZA 4KHZA 1EU4A 5C4JB 1CMXB 3FMCA 1TWAB 1TY0A 1BCPB 2B8GA 4CDFC 2KCNA 2O5IC 1QG7A 1DGJA 3VR6A 2MJ3A 1S3SG 3RZWC 2V3PA 2W55A 4DDGD 1VMPA 4JI3Q 4MGZE 3TCAA 2K8HA 4DNRB 4AQ7A 1UNSA 2KX0A 2VNUD 2HD3A 1BCPF 2JRIB 2F0DA 2BYFA 2WB1B 2N1VA 1A0IA 1KIXA 2WXQA 4JV5Q 4RWSC 1VJKA 1VZ8A 3BK1A 2V1YA 1EY8A 1O78A 4M01A 2K28A 4IUNA 4ZAIA 4P75A 3ZVVA 4DV2L 3H0GB 1A2TA 4KDLB 3AULA 4A3MG 3ERSX 4GKJQ 1A15A 2CHWA 1P7FA 1KDBA 2I1KA 3RNGC 1GOZA 4IPCA 4LLGM 1V80A 2V9HA 2K01A 3VYTA 1Q8IA 1A3VA 4AQYL 2RCFA 1I4QA 1JOKA 2HCCA 1VQIA 2Z4IA 4A3KB 2NVTH 3S1NH 2JRHA 2CJNA 3BVZA 2LY7A 4N9TA 5E4WC 2QGQA 5G3LD 1WMHB 2REXA 1HTLD 2K5VA 2VQEQ 1Q5WB 3PHXB 3GE8C 3NWTA 4DUYQ 2FIDA 4EE2A 1EIGA 3RZFA 5JPNC 2B8FA 3CC2A 1JICA 1BUVT 5AJ3Q 4BKGA 2BH2A 2D9UA 3KBGA 3HOZH 3CCSA 1QT9A 5M5YB 2MPMA 1C9FA 4A9AA 2KENA 2CFMA 3WWVA 4DR3L 4LF5Q 1XNRQ 1DOIA 3DWGC 3ND8A 1WGKA 4HLEA 2E2HH 4PQXA 2F3VA 3FILA 4MNOA 3OTOQ 1C9OA 3TMPB 5EPLA 3C1FA 1WCMB 3GOEA 5CHWA 3VA5A 3IBEA 4W9DA 2SAKA 4C3JH 3V6EB 2WXHA 1KQSA 3B6YA 2PQAA 2PW7A 3W5OA 1XF5L 3L17A 3UIOB 4XYOA 3LWUA 4DK3C 2JF5A 3OHXC 1PH2A 1T0QC 1VQGA 4XDCA 4IURA 3WAOA 2VH1A 3VUYA 2NWGA 2L00B 1H9SA 2XN9C 2KTRA 4O1NA 1DYQA 3M95A 3APCA 1Q12A 1SE9A 1PFNA 3D4DA 3FKIG 2K5NA 4I7AA 4MTKA 1FD7D 4IFDJ 2RA4A 3MVVA 3S9WA 2B3AA 2D07B 2W3RA 1I42A 1EO6A 2O6VB 2JQRB 2KHSA 2H89B 3C3LA 4WAFA 5IYCG 2J0MA 2K0PA 1FXTB 1WZ3A 2P5ZX 2ZCCA 2M2LA 1F2LA 3B1LX 3H3VH 3CW2C 1E1TA 1GHJA 4MIUA 1R9TH 2HDEA 4LF7Q 1LO5D 3MFGA 5CORA 3K0XA 1SXTA 2YTYA 1JRPA 2AEHA 4GMVA 4HCNB 4L5RC 2VQFQ 1WXSA 2DENB 1S4ZA 1Y1WG 3GTJB 3TZDA 4C7YA 1EYGA 1G6ZA 1EEFD 4RGMA 3S1NB 4ANVA 4IPDA 1T0YA 4NNJB 5EPJA 3KJOA 5FOBB 4B9KA 1DXMA 3RMHA 2UUAQ 1LGRA 3E56A 2FAZA 2LVOA 5G5HA 1M8AA 3L13A 2F4VQ 4IUPA 1EWCA 4BKTA 3E0JA 3G7LA 1V43A 4IN3A 1KDCA 5M3FB 2LGIA 2WXGA 4EQPA 4K5VA 2B2YA 4JI8Q 4P7IA 3OIQA 3M3YH 4C3HH 3HOZB 2JPHA 2LGYA 1JWUD 2DNFA 1WXQA 1UGJA 5IODA 1V9JA 2F0WA 1HE8A 1RF2D 4L6TB 2HTME 1STGA 3PRPB 1DOXA 2EY1A 4DF7A 4DPGA 1C78A 4ID6A 1E8YA 2RDHA 2Q2IA 4GOPB 3ZKJC 3QHTA 1L2NA 5J2RA 4KSLC 4US9A 4JI4Q 1PGXA 3U7ZA 3AEEB 4FBJB 5JHAA 1E8WA 4GOCA 5EE3A 5J17A 2NBFA 5EKLA 5KEEA 2L83A 2A6HD 4IUUA 5IGFA 1E90A 3QK0A 1B7YB 2INNE 2IY1B 1PH7A 2JYEA 3TDQA 2X69A 1CK1A 5BYQA 1EWIA 1YVCA 4OWTB 3FDTA 4EQNA 4DV4Q 4BY7B 3STBC 1A6XA 1KRHA 2EVBA 4NPNA 2JA7H 2E2IH 4MH8A 1PTOH 1S3OA 4DV3Q 2JEBI 2OXPA 4A3IB 3ZNHB 4BY1G 1VQEA 2JA8B 4KZCA 4P1CC 4WWNA 5AZFA 2BA0A 2ES2A 2MRPA 2GBMA 1LTLA 1K3RA 2K5WA 2LVQA 2NBUA 1MIUA 1STHA 5D65A 2QHOA 1CKNB 3PLVA 3I56A 3TP7A 4WORA 3KUDB 1OXUA 3P7JA 5IWAQ 2EYFA 2UUBQ 3I90A 1IBKL 3GTGH 4HKZE 3ZGZA 3MHBA 3V05A 3RCZA 2VY3A 3HOXG 2D2CC 1SBBB 1HCZA 1EY5A 2YYZA 2JK8A 1AP0A 2CVRA 3PMFA 3VQIA 2SNSA 4K2KA 2KJXA 1NR2A 1PQSA 3M4PA 2INCC 4XDDA 3VTVA 3UINB 4PK1A 2HE7A 1IL8A 1J19A 3DVGX 1IP9A 1S5FD 1R4MB 1RLFA 3HEJA 1XNQQ 5EKKA 3U8ZA 3HOVG 1EYDA 2N78A 3TEXA 3M3YB 3L16A 3VAWA 2QDLA 5GAGC 5CV9A 4BXXH 3QOJA 2Q8TA 4C3IH 2K75A 4DN4M 3RNBC 2FMCA 3GS2A 1E2ZA 4WURA 5DCNA 2F52A 4DR4L 1G91A 4S3SA 2PE6B 4HDQA 3W5VB 2UU9L 3MXPA 4XQQA 3G6JB 3PO2G 2O2VA 1KTKA 1NDDA 3K6OA 2O5JC 1FYCA 5LL6X 2E74C 1G2TA 1F0ZA 1STBA 2XVSA 2PQEA 1K8RB 2FBWB 3P2BA 2BOSA 3NHHA 1KABA 1RFKA 1YIWA 4LF6Q 3CC7A 1WI0A 4GSWA 1ZEQX 4YSZB 3HOYH 2CCZA 1B4OA 5E3FA 3OLMD 5BN5A 2OF1A 4CJ2C 4AIMA 5KGUA 2D3AA 2GVBA 3BVMA 5FLMH 1XD3B 2ON8A 4HIKA 1SIJA 3DVNV 3GD7A 1AWDA 3QOLA 4KD3A 2WXOA 1Y56A 1EU3A 4GNXB 1SROA 4JYAL 4FHKA 1UEBA 2JP1A 4HR7B 3W9CB 2B29A 3A9KA 4WWOA 2E2IB 4GN4B 3CXCA 5G5GA 1WYGA 1Y8NB 1PTOB 1EQQA 3VTWA 1ESFA 1B9MA 3HG9A 2ZZPB 3DEPA 2BWFA 1F2MA 2B2VA 3FPPA 1UF0A 3N20C 4EEWA 5CV5A 2NTTA 2F3WA 4ANWA 4YSXB 3NVZA 3V62A 1NYRA 4QL5A 3SFDB 1B1ZA 1BMLC 1PH4A 3AEDB 5DPSA 2BCOA 3Q23A 1PTOF 4AOFA 3NZ3A 3LGJA 4HSVA 2NYZD 2R93G 4KKJA 4KX6B 3SU8X 3ZJVA 1TR5A 4R1JA 2PKOA 2ATWA 2EYHA 2KDFB 5MPOA 2JA5G 1UBQA 2QEXA 3S1QH 2GRIA 4LNFA 1SYFA 3TS2A 4DV2Q 2K6DB 2B2UA 1WTRA 3T3NA 1YJ9A 1N32L 4B3ML 2JA6H 4CJ1B 3APDA 2K8BA 1H9JA 4XYCA 1SMYC 4KV6A 2YU9H 2MEKA 1XPRA 4PMBA 1Q1OA 2Z4HA 3BYYB 3S15H 1CTMA 4ABNA 4DFAA 4AQYQ 4ITKA 5C3EH 4QGUA 2ALYB 5D3DA 1GM5A 2PVGC 1KRTA 1BQQT 2ASBA 5KHOA 3SK4A 2QEJC 2RBMA 2L32A 2WXRA 4NW2A 3Q14C 2A74C 1FR3A 3FAHA 2BS4B 2Q2UA 3AEAB 1K53A 2XIWA 1IBXA 5LMNW 3RN5A 4R4CA 4IOCA 3QWZB 3SHQA 1NI2A 3Q8EA 4LFAL 4CDDC 1SFOH 2RQXA 2KN5A 3TEYA 1JC7A 3GTKH 1ZXTA 4DR3Q 1NE3A 4LNOA 1UE1A 3T1HL 3PSIA 3HOYB 1JWSD 2JE6I 5HURA 2X8XX 1EL0A 2GMIC 2OEDA 1X32A 3RZDH 1YITA 3VR9B 4P71A 4QB4A 1E7ZA 5IIFA 3JC66 4DK5A 2EYJA 3HZXA 1C4QA 3A0JA 1L7YA 4WWMA 1VCBA 2FXQA 4JI7L 2B63B 2ZEQA 1ZKOA 3RLOA 4HJ8A 3RPFC 1X65A 5C4XH 3AYHB 2D5GA 1E2WA 1WX8A 2JU6X 3H9DA 4NPSA 2J53A 1VDZA 4M8AA 4DGZA 2XSCA 4HJGE 2HUGA 4LMQD 2IY5B 4X57B 1FD6A 1WSPA 5AFWA 1KFYB 2ZJPA 1KNEA 2NZ1D 1C48A 3CRKC 2CU1A 2NPTB 2LMCA 2HCIA 3A7AB 5C0XJ 2GBKA 1U4PA 5TR5A 1D8LA 1TZOA 1MJCA 3DUZA 4A3JB 4R8NA 2WXFA 3KUCB 4BAXA 1D3ZA 1VZ6A 1WJ4A 4JBJA 4L8JA 4CKBA 3CMEA 4PS7A 3CQZB 5JJIA 2E76C 3N52A 4A3BG 1FMAD 4DK6C 1I3QH 2VZKD 3ZTDA 3H15A 1JORA 1WJ6A 1UE6A 2Z0SA 4JC0A 1LM0A 4GZYC 3UGBB 3PF4A 1U5KA 2N9XA 3TEZA 4AH6A 1UGMA 3PUVA 1GAQB 1SLJA 3A4SC 4WH4A 1AE2A 2L4NA 3QIAA 5D3IB 5C3WA 5GAEC 2VUMG 2KDIA 2NVYH 4B0EA 2HJ1A 2H1EA 4DR5Q 4MT5A 3J7ZC 1BCPD 3QCAA 3UI2A 2QW7A 4JI6L 3KDFA 5KNBA 2E3TA 3H6MA 1GUTA 3VXWA 3EA6A 2KEEA 4KKTA 2C9OA 3T8MA 5IO9A 3SR1A 1VQ5A 1KNAA 2LUMA 3DHHC 4FJZA 3S2HH 2FINB 5E6OA 3U58A 2WLBA 1WY8A 4K7WA 2PO4A 3W1GA 3LB8C 1HFGA 3HOUH 3SGIA 2F0QA 3I73A 5CV7A 2WKDA 2EKIA 2F1MA 5EE0A 4BBSB 3I91A 4BBNC 1YZ6A 1TWCH 1QUQA 2BBCA 1BUIC 4IM3A 4NP5A 5D6JB 1WRIA 1WXMA 1EY6A 1Q10A 1TBEA 1PHJA 4M8MA 2CJOA 1V81A 5EJWA 3GTQH 1QOHA 2A5UA 4OZAA 3A33B 1KL9A 4KDIC 2R6GA 1LTRD 1FFUA 4HPPA 5C4XB 3CC4A 2CQAA 1GC7A 2B2YC 3GTPH 4K1RB 4RGTA 4MJSB 4N6EB 3AE4B 1G291 4AYBG 1LLRD 2OT2A 1HNWL 1X6OA 2VRRB 1F2RC 1E7VA 2KHWB 3UF8A 1YN3A 2FCNA 4BBRG 1WIAA 3VRAB 3R7QA 3PLUA 4O2DA 1FXAA 5E7NA 4W9CA 1CZPA 2MJ8A 1AARA 3PZ8A 2KXJA 4EUTA 5C23A 2IX1A 4X65Q 3JAME 4H02A 3BS1A 5H92C 2LXJA 4KY5A 1GXDC 3K0YA 1NAPA 2CW0C 4O0AA 5BN4A 3P4PB 4L63B 4LFCL 3S1MH 4NXML 2L1BA 1IBKQ 1R4NI 4P1BC 4ZK9B 1KC8C 4POGA 2RHSB 5DPTA 1DOMA 3FC4A 3I5JC 1VQJA 3I2ZA 2M56B 4HTHA 4G7ZC 3TREA 1MHXA 3U4EG 2IHFA 1BDOA 3I72A 3VR4A 1NJIC 3DBHI 3KVFB 2F0JA 2L55A 3H91A 2NVYB 2CHXA 2LXAA 4P6VF 5JHBA 4BA2I 5HY6A 4ZYNA 2Z59B 4ANUA 2EYPA 3RYTA 1LTBD 3PIP3 4K3CA 1S40A 3UDGA 3L3OC 1JCKB 3CP0A 4FF2A 1E7UA 3HOWB 1KDAA 4JIOU 4REZA 2G5DA 2L05A 2I2YA 3S17H 2ZT9C 5LHY1 1MSGA 1QZHA 1VQHA 1JT8A 2O6VD 1OO9B 3GTMH 4DR4Q 1FCCC 1PH8A 2QSDA 3TZUA 3NTIA 1IUEA 2UU9Q 2RMMA 2PI2A 3I4MH 4HJ9A 5JOBA 2IZVB 2HTHA 1T5EA 2K5QA 1DOKA 4XXEA 4HJKA 3A56A 3EFCA 1B53A 1RTNA 4WIPA 1U9RA 1EIFA 5M3MH 1CSQA 1YQBA 2WQYB 3KBXA 4B3SL 4G3XB 2DJFC 1GUNA 2R7ZG 4RHRA 3VR5A 2CHBD 1PFSA 3VH4B 2NB0A 5L95C 4KTAA 3RZOH 3I57A 4GU2A 4YCWA 3CSTA 1LQBA 2WYQA 4LUZA 1TWFB 3NWSA 3TP5A 2F0TA 3U4ZA 1AZQA 3ZJUA 2CH4W 3JSVA 2BT6A 5C44H 4HXDA 4JYAQ 2ZVOA 2Q2TA 1BT0A 3OW7A 1ACCA 4OWWB 2BA1A 1UWMA 5IP7H 1SE3A 2IW3A 2G1EA 1I4GA 3QJYA 1K52A 2A69D 3AE2B 3Q8CA 2BE5C 2M9VA 2I0QA 1HTOA 2WXJA 1T0RC 4DBGA 1MPEA 1YHAA 4JPSA 4HAEA 3L54A 2VL6A 3J9CA 5CV4A 1GB4A 4XX5A 2N9EB 3JAMc 3GTLH 3CIRB 3H8HA 1PGAA 4HKQA 4HCEA 2RDGA 2LXKA 3RFZB 2KO3A 4UDUC 1ISNA 4NZLB 5M5WH 3K9PB 1TJEA 2O2LD 4A20A 3IT4B 1N32Q 4B3MQ 1AEXA 1IYUA 4WJWA 2ZVNA 4MN3A 4DUZL 4II2B 5LNK1 1PH3A 1OQQA 5K36H 1NY4A 3A9JA 1A5RA 1WYDA 4R9WA 4ZOHC 2B2VC 2DY8A 3S17B 1WX9A 3PO3G 1V1OA 3KQ4A 3PUWA 4K2LA 1I35A 2PMVA 2E8GA 5FLXE 5CC4A 4H7BA 4JBKA 2MBQA 4JLCA 2MO1A 3H7PB 5LXIB 3I4MB 3QB3A 4B9XA 1RJTA 1GC6A 2GBNA 2F0PA 1NMGA 3KYHC 4LFAQ 4C56C 3G4SA 1E8XA 4U68A 1SAPA 5EBDA 1YJ1A 5IP4D 2C35B 2IJ0A 3NE5B 3GDEA 1WE6A 1WGDA 5IN7A 4G57A 2F4IA 1BVSA 4GS3A 3T1HQ 4DR6L 2B2UC 2MW5A 3CRLC 4RMAA 3NRZA 4GGQA 1VQ9A 4GB9A 4A3EG 4DAYB 1A70A 3RLFA 5GROA 3BDOA 5C5LA 2FCMA 2F0GA 1ENFA 2JQOA 1YEZA 4CDEC 4OX9L 4XGAB 3U30A 3DM3A 2YLMA 2WAQG 3F2UA 4JI7Q 3MA2B 1IW7D 4I6NB 5EAYA 3S2AA 4M02A 1WFYA 1F1HA 3VUWA 1CUKA 5C4ZA 1CHQD 3AFQA 2R92G 4OIJA 3S16H 1K0SA 1ML0D 3DMUA 3T51B 2DYBA 2JWZA 2M0AA 4X6AH 4XDXA 3AE9B 3TP8A 4DR7L 5C6AA 1PDXA 4B3RL 3Q3MC 5C0XI 4LNNA 4A3MH 1QVGA 4J6HA 3VR8B 3QQ8B 3KWVA 3C46A 1QZGA 2K32A 2JSVX 1N5XA 3MHZA 3F8TA 1VQNA 1LFDA 2N7DA 4IUVA 3GTLB 4PMWA 2VZKB 5IT9E 1SSNA 4KIKB 1CA5A 2Z9HA 4LF9L 3L08A 1G8ZD 3D32A 5JVG3 1EWHA 5KHQA 2X38A 2ID0A 3URYA 2KDMA 3ALBA 1SR3A 2ICEC 4O42A 2Q8IB 4WJPA 1EEID 2PW9A 1KLVA 4NJ6A 2R61A 3EGRA 2PMZE 1WXAA 1PTOD 1VD2A 3HKZE 4BKSA 1Q46A 4IWQA 2KWCA 4NQLB 3MWYW 1VZ7A 1A3UA 4C1NK 4W9IA 1E9MA 4K7UA 2BQQA 1X3GA 5LMUL 4II3B 4LUOA 1XMOL 1BXTA 2BPSA 4DR2L 4RNAA 1L1OA 5KNDA 3R66C 2WB1G 4PMCA 4KJNA 5FLXc 4DV6L 2WXKA 1ILPA 3FP9A 5CMDA 2DWQA 1ASYA 1IL2A 1FGUA 3IXSA 1I94L 4M0WB 2E5LL 1TWHB 2N55A 5T8IA 3V6CB 1I4PA 4HIOA 3H0GG 4LWCA 4RM8A 4GDKA 2EE1A 2IYDB 1E0BA 1F2YA 2BH8A 1B2TA 3BZDB 2D0OA 4IFDG 4AUQC 1I5FA 3I4NG 4QUCA 2HJ8A 5IAAC 2ZNVC 5C3JB 1QNUA 3FKIH 4RGOS 4G7HC 4OO1I 1TS2A 3L9AX 2NVQH 4G7OC 3WALA 4JPBW 2H88B 1HTPA 4JOIA 1WGGA 3Q0AA 2N8NA 4GLAC 4DV1L 1X1MA 5HHDG 4A3LG 3AECB 1LTID 3IAS1 5IYCH 1C0AA 4RCNA 2NVXB 1D4BA 3M7GA 1HNWQ 3G6EA 3R93A 1VR9A 1ZUD2 2BKFA 1JWBD 1U4RA 1LXDA 4K0KL 3KLWA 1XTDA 5I6WA 4IO9A 2G4SA 2MJEA 3J80i 3MXNB 3BZCA 3GO5A 4XT1B 4J8QA 1P1AA 4ME5A 2VZAA 1Y1WH 4KHPL 4FULA 3J81i 4IOIE 4ALPA 2PZWA 1OTRB 3S14H 4BA1I 4RG1A 1DZ1A 1WCMG 1EF5A 1YOVB 3EUB2 1GUOA 1S72A 4NDXA 2PPHA 1I50H 1W3SA 3BYTB 5KRUA 4MGIE 2KTRB 4ILWA 3I55A 4NXMQ 3CWIA 1BKBA 4XQNA 1WRDB 1WMHA 4AP4C 4RFBA 5IT9c 1FCLA 2Z0DB 2K1BA 1MJEA 3H09A 1ZGUB 1TVXA 1YJJA 1TQOA 4L5SA 5DPWA 4NXNQ 1YI2A 1Z9FA 3AFPA 1JRUA 1SB3C 2YEPF 3BIID 1TT2A 2FIFA 4FADA 1HUNA 2ZXPA 4UHVA 2RF4A 1SGHA 2K9XA 1JB3A 1IZ6A 4YCVA 4XWWA 3U9SA 4CDCC 4DU9A 2K03A 4FF4A 1IYFA 3KLSA 4JG2A 1QB5D 5CBAE 4NAWB 2G9DA 3A8KE 3BU2A 1QLBB 2PJHA 1ET6A 4JGHB 4C4VB 1ICWA 1F9PA 1ZP0B 2W54A 3KF8A 4KN4C 2INPE 3O65B 2DYOA 2XRSD 2A6HC 4LAAA 1HNXL 1ASZA 3DPDA 1VQFA 1PH9A 2PLPA 5EE1A 1QWYA 1LYLA 4QMGA 1N36L 1GG3A 1WYWB 1PLFA 3CCMA 3ULPA 3SK6A 4LF4L 1B50A 2LS01 4LNKA 3SFEB 1PRTB 2NVTB 1OEYJ 3Q3FA 1EY0A 3ER0A 5EGTA 1JMCA 4B3SQ 4QAYA 2CWPA 4LF8L 1DM0B 2KFKB 2FE8A 1N6ZA 3VA7A 2HDMA 4WFN3 4BY1H 1TZ1A 2DN8A 3KJPA 1YN5A 3HM6X 5BMHA 1EWYC 2MNAA 3NJTA 1E10A 5M3FG 1U4AA 3D0FA 3NENA 5JEAH 5F2DA 1S5ED 4ULLA 2WNMA 3OAWA 1PRTF 5C3XA 3HOZG 3ZQ4A 1NEKB 3PRMB 1D5ZC 1MG4A 4NKLA 2KWVB 3N1ZC 2H4OA 4RMFA 1K73C 5AZHA 1XX8A 5L37A 2BTEA 3DVNU 1MI0A 1RHPA 2E2HB 3KW5B 3KH0A 2RHQB 3MC9A 1ICFB 1EOTA 4WJQA 1STNA 3P63A 4QF4A 5A2QL 2ICIA 2WDQB 4C3JB 1L5PA 1I50B 3A8IE 4FVMA 1K28A 3A7LA 2KK8A 3HOVH 2L9HA 4IC7B 1B9RA 2CQOA 2D62A 4IW0A 4DQOC 2KQ3A 4JVZA 4A3GG 5D2MB 2KD0A 2DY7A 1SN8A 4KJOA 3PIO3 4DV0L 4L5QA 1OXSC 3QWNA 4KI0A 4DXAB 3UDFA 4UP9A 3AQQA 3CCRA 3PO2H 4BY7G 3NZUA 4OW0A 1V49A 1ZKHA 4K14A 3N1XC 4JWSC 3AE8B 4DUZQ 1V5OA 4A3IG 2FFKB 2QILA 2E2JH 1K8OA 2JA8G 5LL6S 1RDPD 1JOOA 5KYIA 1WZ0A 1IHZA 1V1QA 3A54A 4GOPA 2MHVA 2LFIA 2LHDA 1TKWB 3CD6A 1N33L 2GN5A 1R9TB 1XPOA 2MUYA 3TN2A 3K5NA 3ONSA 3M4OH 5JJKA 1VDVA 3K9OB 3HS0C 2FUHB 4E3CA 2K5PA 1QVFA 2IX0A 1GUSA 1PH6A 4A8XC 3T4AC 1YMHE 3B2FA 4DV7L 2Q2HA 1TWGH 3D4RA 3PUXA 4U673 4CHTB 3BZKA 5I6YA 4LK1C 3A5UA 4DR6Q 2N9LA 3AMZA 4JQWC 3D6WA 4DR1L 1RCVD 1PUTA 1FJGL 3BINA 5AUKA 2JZZA 3A1QB 1SSOA 3EFXD 1ZDXA 5IYBH 2BS2B 3K5LA 4IZ8A 4ZUJA 4OX9Q 4A93G 2L15A 3W5UB 3P4QB 3FHWA 3I8ZA 1SNDA 4C3HB 1ZYRD 5BR8L 1FRRA 3J7AF 2KX3A 3Q6SA 4IJLA 3RNEC 3N9YC 1YJNA 1SNOA 2R93H 3OMGA 3E9IA 1AFPA 2IY0B 1I7HA 2QMTA 1CKNA 3DBLB 4LJZC 5GXGB 3C0RB 1MVKA 5I2YA 3H94A 5CV8A 1Q1BA 2JA5H 3DQVA 2FHTA 2FCQA 3EROA 2GBRA 3F2DA 4DR7Q 2KJRA 3DDCB 2EPBA 3GTOH 2L76A 3VUXA 1P16A 3RT3B 3VVWB 3UIPB 4EQ5A 2L52A 3J7A5 2SDFA 1IYVA 4HJ5A 2Z8LA 5EE9A 1CQFA 2WX1A 4DK0A 4NJ7A 5IGBA 4XIGS 1GNUA 4X3UA 1GUAB 3Q69A 1HUMA 4A3DH 3A9KB 1YNND 1J8CA 4IM0A 3DBRI 1SEBD 1J5EL 5C4HA 4LFBL 4QIWE 3AI5A 4HROA 3Q2AC 4LJOB 1Y69U 4LF9Q 2BKRB 2X6LA 1BBXC 4FYDA 1WX7A 3F1ZA 5EKIA 3CPFA 5ELFA 3L7ZC 2JA7B 4FXDA 2IO0B 4TQ0A 1PZKD 4DDID 4I6PA 4ZUIA 4IUTA 1LM8B 1QE6A 3GV3A 5JXVA 3OOCA 2KQ7A 5JJZA 1ROEA 4Y7NH 4LUVA 1F2ZA 1DOYA 2J4XA 3NS8A 5BYSA 3TEHB 3J80E 5JEAJ 4HK2A 3DWQA 3GTGB 2PMZB 1LUZA 3J81E 1XMOQ 3MAQA 3HKZB 1GO3E 3IAYA 2GOWA 2NN6G 4OEMB 3CCQA 4JX1C 4DV6Q 1BBUA 3ZW3A 2IT1A 2WS3B 3ENEA 2ASQA 2E5LQ 1TWGB 1N34L 3F2BA 1GHKA 4ZRIA 3OPOA 2RSUA 4A6QA 1KAWA 5IE8A 4GNXA 5IP9G 2EDGA 3PGEA 1AW7A 1QKZA 4R8IA 2LKVA 4YTPB 2KMMA 3ETRA 2YV5A 2J0TD 5C0XG 3GV6A 2JZ3B 3AU4A 2L12A 2F0OA 5FR3A 3NQIA 4C3IB 4IPHA 1J6QA 3U4VA 1QOAA 4FHJA 4DV1Q 5AZGA 3EBEA 3JW0X 4N8FA 1LT6D 4GLSC 4BFRA 2EJFC 3GZNB 4HDOA 1FGBD 1L1OC 2Z1CA 3FRPB 2KNBA 3MC0B 2HQLA 2JN4A 5H1SE 2MX2A 1F9QA 1YNJD 1AN8A 1P8LA 1YQ3B 2NCNA 4K0KQ 2QDFA 2MGSA 3EJIA 3IL8A 3WDNA 4YTMB 1FNWA 1EM7A 1VF7A 2OWOA 1UE7A 4WAAA 2GA4B 4DV5L 3HOYG 4EZJA 3ND9A 1PFMA 4KHPQ 1DD2A 1HA6A 1MHHE 2AL3A 2VUMH 2HD5B 4A3DB 2QF7A 1HR0L 1T9HA 4YL8A 5T1GA 2L5TA 1BCPC 1N63A 1D1IA 1V1PB 4JOIC 2A6ED 1NNXA 2B63G 4DAMA 5CBEE 1D1KA 3K8AA 3T13A 5IYDG 1OQYA 1O7ZA 3M7NA 3NOBA 4USAA 1ZXIA 1I4RA 3PZ7A 3V3XA 3AEVA 3LXFA 2D11A 2LMCB 2BF8B 3RLNA 5DM63 4EOYA 3VYRA 1MKHA 4YWLA 1EFID 1EIYB 3NZSA 1HRJA 4IFDI 1EYAA 1VQDA 5FO7B 1PFDA 1DJRD 3ZXVA 1LT3D 3TL5A 1P7EA 1IPGA 1CJEA 1QNKA 3NUCA 2J7QB 3KF6B 4A3JG 2L0CA 3TRZA 2QJLA 1GJZA 4OO1G 1TKYA 5CTRC 4BWGB 4EZLA 3J80c 4ME3A 4X64L 3F2CA 1UEAB 1VQMA 2K1FA 3S1QB 2EELA 4TMAB 3J81c 2LRWA 2Y0SE 5EPKA 3B9JA 2LI5A 1HNXQ 2OQ0A 1HZ5A 2L0TA 3PV1A 2JA6B 1JROA 2A8VA 3SE0A 1HA5A 2C7NB 4Q0FA 1FL0A 3AMUA 4RAUC 1MHWC 1G2SA 4BBRH 2YU9B 1X3EA 4LF4Q 2PZTA 5CX3A 3S15B 3EECA 4H44C 1ESRA 1H9RA 2KCTA 5C3EB 1SMXA 3NBHA 4BOZB 2KHIA 4LF8Q 4MDKE 1A8VA 1AZPA 2WHIA 2GI9A 4GIVA 3I4OA 1BBWA 2NPTA 3FEWX 5IY0A 3KFUA 2LXCA 1GD7A 1WH3A 4X3KA 1WOCA 4Z9CB 1NTGA 4A4IA 4WQOB 4GLXA 3PUYA 4JL9A 3EVQA 2K8CA 2LZ6A 2FUG1 2IO2B 3M9BA 1SFOB 2KQSA 4DHZE 3CCEA 1EZ6A 3GTKB 1FEHA 1QJOA 2LSSA 1YN4A 3IAM1 4KSKC 1IYJB 4TVAB 1UUPA 4BBSG 1HZ6A 5NUCA 4N9PA 4CBVA 2WP8J 3RZDB 4AJYB 1FFVA 1YQ4B 1IGDA 1VQBA 2HQEA 3IFTA 1PMRA 1UD7A 3KUZA 3AV8A 3WAPA 2WB1E 2M8SA 3PIPA 1MBYA 3AEGB 1X54A 1XCTL 2W9NA 1XPUA 4DNTB 3M85A 5C4XG 4IWPA 3DM1A 1WXVA 2F0EA 1Y1VG 3D4WA 2WINB 1K51A 4DV0Q 1R7SA 2EMSA 2Y3AA 4M1UB 1SYDA 2X6GA 4LNQA 1G51A 1JQYD 4E71A 2JXMB 1M94A 2KVZA 2UYZB 1L0YB 3PQIA 2CR5A 3IKJA 1STEA 4EZKA 1M1KC 3OW2A 3S2DH 3S1RH 1N61A 1E22A 2WDVB 2NBVB 2KJHB 2WX0A 1TIID 3AEFB 4RF1A 1K9MC 3ML9A 2A68C 2AQ3B 2R7ZH 2DLBA 1RYJA 3AB9A 3AH7A 1WGRA 1B9NA 1N62A 1CZGA 1EY4A 5CR3A 1QVCA 2WIIB 1N33Q 5DPRA 4HMIA 5IOIA 1I3QB 1FPYA 2DX5B 2QC8A 4R4OA 4HN7A 2KHJA 2B2TA 4J15A 3BY4B 4J1MA 2DBYA 1VQAA 3QX1A 2V4DA 1XQQA 1Q86C 3WCQA 4KKIA 5JPMC 3RNAC 4MJSA 5G55A 4DV7Q 4IALA 3UI3A 3SK5A 1TS5A 1FXIA 4RA8A 1VMCA 4DR1Q 1FJGQ 4ZKBB 1D7QA 1E0ZA 2GBJA 5AEKB 2A69C 4A3FH 1XWEA 3HOWG 4YXDB 3CCLA 5K5PA 1SNMA 2K3UA 3ECIA 3AE3B 4A75A 2KVRA 4GOPC 1GKHA 5BR8Q 5LMNL 1P0RA 2MWSB 1D5MC 4UPAA 4PS3A 3S2HB 1KLGD 1L6VA 3N30A 3LNNA 2PW5A 1B44D 1HPCA 2LEKA 3ZIMA 3HOUB 1CKOA 5I9OA 1BR9A 4URKA 2VS1A 1IBLL 3K81C 1SIFA 5FJ8G 3H6NA 4IJHA 2YTXA 1K83H 1NUCA 4MSMB 1TWCB 2I46A 3HM3A 2MH7A 1EQVA 2MCNB 2DZMA 2IGDA 3N3KB 2NZHA 3AU5A 4PG3A 1V8QA 2WU2B 4HWIB 3V60A 1PFBA 1QILA 3UE0A 1VQ6A 1H95A 2AL6A 3GTQB 3JSVB 3H3VI 1H4RA 3M3JA 4MHEA 5D94A 3SD5A 1PRTD 4P72A 1C3TA 2B2WA 1LACA 2XRQD 2PEAA 4YHHL 4BS9A 1RWSA 4M00A 4RKBA 3PO3H 3GTPB 4WRDA 5IOCA 2N0SB 1J5EQ 3C8YA 2L3ZA 4L1BA 4LFBQ 1PYBA 3ABVB 5ELNA 3BK2A 3FVQA 3CF5A 4RGNA 1VQ4A 2ZJRA 3RNUA 4QIWB 2VQFL 2PPBC 3R3MA 4EGVA 3T1YL 4N59A 4E74A 2WDRB 2Z6BA 1CM9A 1TYGB 1R4MI 2KUMA 4RHSA 1EQTA 1QCBD 1UE5A 2D5DA 1WVLA 1KJTA 1UBIA 1V86A 2UUAL 2BW2A 2V4IB 4K5WA 4GXBA 2RR9A 4WJOA 4ZQ3A 2AUJD 4KY7A 4A3EH 1NENB 4GDLB 3S1MB 3TS0A 2XEWA 3KWLA 1OXTA 2WKCA 4JBWA 2F0VA 2MP2B 4RH6A 4FDBA 4I6LB 2K14A 3NUHB 3NY5A 2G45B 1GVPA 1N34Q 2QDBA 4IKGA 3QG1A 2R92H 2AWTA 4ICVA 4MM3B 3ZJTA 4CYEA 4OGQC 2A4ZA 1KAAA 1K0RA 1RRBA 2ZJQA 4W9FA 4A3FB 1EUJA 4LCDE 4I7ZC 1QQRA 2XTIA 1Q7YC 2RSOA 1V5TA 3NVVA 3GTMB 1OQRA 3W1SA 1VLBA 3I4MG 2VB2X 3K59A 1B3QA 2IDYA 2DUDA 2GB1A 1E2VA 2CS4A 4FXCA 2QKIC 1JOQA 4YT0B 2EKEC 1SRUA 2G4DB 1AE3A 4KGRA 1XMQL 4DV4L 5M3MB 4JW0A 3NQTA 4QY7A 3DWPA 2JXTA 4AS1A 3TP6A 3H7SA 5GQOA 1W2BA 4B95A 1VQPA 5C4JH 3VDZA 4GNXC 4H13C 4RM9A 4OVZA 1TWAH 3E3XA 4BZAA 2JEAI 4EFOA 2WV6D 1N8RC 2NMQA 3CF6E 3RZOB 2KKCA 3QJZA 3M4YA 3T53B 1HR0Q 1PTOC 1FNVA 3P4RB 1CSPA 2OJWA 2NN6I 2TSSA 3I3TB 4K81A 5C44B 1SYBA 1K3BC 4N8X1 4F8CB 1LTGD 2XK5B 1L0XB 2KEDA 5KNCA 1W6JA 4Y52H 5BYRA 3LJ3A 3RI7C 4IUMB 3H7PA 2IO3B 2A19A 1GUGA 2K04A 1HZBA 1L4DB 1CT1D 3RMKC 3CPWA 1F9SA 2AQ1B 2XWBB 4A3CG 2KLGA 2ZW0A 4FN2A 1EF1A 1PXUA 3C2PA 2UU7A 1M4VA 4KGTA 1T0SC 2NBWB 1IGCA 1TS3A 4IFDH 5IGDA 2WP9B 3I4NH 5E6JA 1XXGA 1WI5A 2J52A 4K7SA 3ZRFA 1O7YA 1X55A 4DAYA 4R4TA 3N32A 4TKOB 4M8NA 1YBYA 3IT6B 4X64Q 2BVCA 3U50C 2EXDA 1UAPA 5M5WB 1T6BX 3WIMA 3K5OA 1QF6A 2A73B 3I4LA 3VH3B 3IFDA 3TIXA 2AX5A 2F0KA 2HHHL 2LASA 5M5YH 2RVLA 3VYSA 4FF1A 2C60A 2Y0SB 3ZRCA 4KN7C 3HHMA 2JY6A 2KOLA 2A1AA 4X62L 1RTOA 1VQCA 1Z2MA 1XCQL 3HUIA 1KLUD 4A76A 2FJ2A 3WOEA 4P74A 3J81j 2KOXA 3A5ZB 4XC2A 4JI6Q 2DAFA 1WCMH 3TSSA 1U4MA 3NEMA 1IKMA 1R4QB 1HXYD 4ANXA 1WTHA 1WR1A 3ONAB 1WWTA 2F0MA 1K8AC 4OVVA 1FRDA 4PYUA 1Q82C 2M00A 2Y5CA 4KIKA 1EY7A 4ASWC 2KQ4X 2AWNA 1WTWA 1JB7A 1I6VC 1XLOA 4DHZB 2LVPA 2WWZA 5JJLA 5E1FA 3GP7A 2WXMA 1JQ4A 5L83A 2J42A 1WTXA 2JYTA 4B3TL 1XT9B 4A3OA 4IPGA 2UXDL 4A3KG 4ICUA 3W1YA 4OXPA 2E6XA 5D14A 1JJ2A 1SJED 4W9LA 3BDLA 1S5BD 1SYEA 4DAPA 2M0XA 2AQ2B 2NS5A 3K5MA 4W9GA 1OXVA 2KT7A 3S16B 2NTSA 2BB6A 5DNFA 1O80A 3PS6A 2JT4B 1GB1A 3AB5A 2MHJA 4A3MB 3D8GA 1OXXK 1LT5D 1UWVA 2I07B 2B3GA 4RKLA 1P9DU 5TSSA 2KYWA 1D6EC 2LGSA 3A4RA 3HVDA 3I63C 4M0WA 4OZBA 3D31A 3I4NB 3DXJC 4NQKE 3GTJH 2D3CA 2N7JA 2V3NA 3B0AA 2EJGC 1HEZE 1XYIA 1XLPA 2DZIA 4JBMA 4YCUA 1X9NA 2PQAB 1OFFA 1AH9A 4HJ7A 4JI0L 5IKCM 1ENAA 1U4LA 2Z6KA 2MBBB 2UWQA 4HEDA 4PV1C 3M62B 1Q90A 3V96A 4XTCS 2YEPB 5M3FH 3VHTC 1H9SB 2L11A 4LFCQ 2J7ZA 1YIJA 1N5WA 2OEOA 3E5SA 2BS3B 5IGCA 2BYVE 3AM9A 4ZRJA 2MBEA 3HIZA 4HJAA 4LDTB 5G2NA 4WJ3M 2IGGA 4ZDVA 3CSFA 3OG5A 2KA7A 3MXUA 3WA0A 1DONA 3OIPA 4HEA1 4KLKA 3ZNZB 4KV2A 5LLIA 4ZCKA 4V190 4MACA 3K7UC 1SYGA 2BDOA 2CWAA 1YJWA 2F0FA 3KF8B 2DYMA 2WXLA 2B76B 4F1SA 1XLNA 3ZYYX 4K6LA 3KYDD 3MXNA 1OEYA 3Q3OC 3T56B 1X3PA 1YNTE 3ZDMC 1HNZL 2KACA 4MTNA 1ZDVA 5LMNQ 5BO4B 5I9PA 1ZPSA 1G6PA 1PGBA 3DBSA 4BOSC 1S1QB 5CV6A 2I1JA 3C19A 1YX6B 3T9LA 3CU7A 3M63B 3QR8A 3HGBA 4A3GH 1T5XD 1SE2A 2B2TC 4LJPB 4XWTA 1QOGA 1IBLQ 5JVH3 5BN3A 2ZCBA 1E24A 1IBML 3PIOA 5DM73 3L4PA 2K5DA 4LW1A 3P75A 4BY7H 4AWJA 3HRDD 3PUZA 3FKIB 4J6IA 1S5CD 5JH5C 4BBNF 2NVQB 2I5LX 2IPKD 4TSSA 2W3SA 2F03A 3I3CA 4A3IH 3WAMA 2UUCL 1YD8U 2XBBC 1STAA 2MQJA 5ELCA 2JVCA 2JA8H 4F7XA 1GPXA 3SR6A 3Q3JA 1CA6A 1LV9A 4YHHQ 4KGSA 2WACA 4K5XA 5DEHA 3DHQA 3CAMA 2OCEA 1C4CA 2O6VA 2HIVA 1KM7A 2EIFA 2I38A 4P2CB 4CHKA 4NAWA 3D3RA 5FK9C 2EY5A 3QO2A 4C4VA 5FO8B 4KD4A 5CYUA 1VQOA 3HOXH 1KD1C 4KKUA 1WTOA 2W82A 3U2SC 3T1YQ 2MBOA 3HKSA 2NUCA 3PTFC 2K4KA 3K57A 1Y1WB 3DEOA 1D5XC 1HZAA 2BGFA 1DOLA 2LD9A 3AN1A 2JJQA 2F0LA 2WDTB 3ICEA 3M4QA 3S14B 4DR5L 1P98A 3PHWB 2KN4A 3IFWB 1I4XA 3UQAA 2OJRA 5HG2A 1HH2P 4N9F4 4C3JG 4YTNB 3MEFA 1Z5SB 1L0WA 4GN5A 1WJJA 2KFJA 4KMUC 4ZHPA 3E9SA 2KFKA 4POFA 3CCVA 4A93H 3V61A 2B2WC 3ZXRA 4AJWA 3R2TA 2DJGC 3KK7A 3DHIC 3ZNGC 1SJHD 1ZYRC 2K39A 3I70A 1Y8RC 4NMZA 1R4NB 4JCVE 4JI1L 3QC8B 3ULJA 2YTVA 1AYFA 4W9KA 1V97A 3EFUA 5M5XH 3Q8FA 1D2BA 4WJNA 4US8A 2UXCL 2KBNA 4K8JA 2DZJA 3DBHB 4HRSA 1EZ8A 3WANA 4GLVB 1XJVA 2Z0EB 2EZVA 4N58A 3Q8BA 4LK0M 2ENBA 4L23A 3J7YW 4FNFA 2UXBL 3OJ4B 4AYBE 1VRAB 1HR0W 1WD1A 3L0OA 1TKGA 1U0LA 3BWUD 4FJYA 3T16A 2K25A 4HPMB 1Z6HA 4A3GB 1EQRA 3NTKA 3PGZA 1YNNC 3JAML 2F0UA 3NELA 3U7DA 1EYCA 3VFKA 1XMQQ 1MFWA 3JYUA 2SEBD 2MO0A 2ZPYA 5JAVA 1K50A 4IQZA 2EXZA 1G6JA 4QUFA 5H8YE 4F87A 2H5XA 2RDBC 2PI2E 3E9HA 4I65A 4HIMA 1J8IA 3PO0A 4BY1B 2KLCA 2KMCA 1QOFA 1NCVA 4DNIA 4X3TA 2F0SA 1SNPA 4X65L 2C9WB 2MA9B 1LTTD 3E6ZX 2VB3X 5JEAG 2LGDA 4LNIA 3W3AA 2K50A 4C3HG 2O2VB 3B2GA 2PYKA 1CFMA 2C5CA 2M19A 3W1SC 4MZ9A 1BOSA 1MJDA 3KUPA 2RPQA 2NN6H 3HOXB 1NMFA 4GN1A 1JR0D 1SNCA 3SXHA 3AEBB 2FCSA 2MSED 2LWPA 1VQLA 2PZUA 5M9OA 4DHJB 5IGGA 2AUKA 1F77A 3OWFA 2ZXRA 2SNMA 4B3RQ 2F3IA 3MZ5A 3EN2A 4KHVA 3TMEA 5IP9H 2G9HD 2RGFA 4DAVA 1Q81C 2K6QA 3AE7B 3L0WB 5C0XH 3HOVB 4A93B 1K8MA 4OWXB 3A1QA 4UP7A 4OELB 4JI2L 4S17A 2IO1B 3CCUA 3NS1A 4FP5D 3X23A 4EQOA 3UDXA 1RAXA 1FNUA 3PO2B 3KOJA 2EY6A 2L8JA 5M5XB 4MGYE 2EYLA 3STBD 3MJ5A 4OONA 2JA7G 4C7ZA 4GKKL 1YNJC 2KCCA 4K8IA 2ZPNA 2HHHQ 3JAMi 1X3QA 3ZLZA 2E2JB 2IWHA 4MSQB 3ZDTA 4DXFA 2KZRA 2FNJB 3MC8A 4X62Q 2MP1A 1DCZA 1MI2A 4K6DA 2JXXA 4JK1C 4X66L 3JVZX 4P16A 1NBFC 2EQSA 3X3MA 5J1ZA 1PYWD 1FM0D 4C80A 3TBIB 5LMUQ 3APFA 3MHSD 2IX3A 2K7VA 3M4OB 5BMIA 3HKZG 1SF0A 4IG7B 4DR2Q 4YIJA 2LFNA 1B8AA 1S5DD 1C7YA 2A6EC 5HFYA 2IHEA 2NR2A 3UQBA 2B63H 2C7HA 2LJ5A 5E6NA 5IYDH 3L10B 4NAMA 4CQNA 2C7MB 2MLBA 4EKUA 3TUOA 3DVGY 3R7RA 3TJPA 5D7GA 4D2KA 1ZXHA 3NTHA 2LHEA 2CKZB 4IM2A 2DNEA 2E75C 5IYBG 1JJGA 1VQKA 3I9V1 4DK1A 4ZYSA 3PREA 1JMLA 4B3TQ 2ZTCA 2UXDQ 5CGKA 1YHQA 1X3FA 2O4XA 4BXXG 4WQMA 4C3IG 2M4NA 1WTPA 1IBXB 2EYOA 2N3SA 1RKNA 5FKAC 5T1IA 4B9WA 4A3JH 1VQ8A 2J0KA 3HVZA 4W9JA 2R93B 1II3A 4OO1H 4HMJA 1WR6E 4R3DA 1Q8KA 1PVOA 2KECA 3NK9A 3RNCC 2DGYA 4G4KA 5CHFA 3BG3A 2JA5B 2M1MA 4RCOA 5FLXL 3CQZH 4MGKE 3SVMA 3SEBA 1SYCA 4CGYB 4A3BH 3GTOB 1XO3A 2RSNA 4HCSA 4CJ0B 3B08A 1CQVA 2L7RA 1JE4A 1MD2D 4PZ8A 4IWOA 2PNHA 4YWMA 2LRUA 5JZEB 2RDFA 3A55A 4A3DG 4ZRZA 1ZOYB 3P1HA 4L5TA 2HDLA 1HTQA 5FLMG 5HKHA 2D0PA 1KF6B 4Q5VA 4JI0Q 3SK8A 2QA4A 4JWUC 2CKHB 2N9KA 3EQLC 4JI5L 3DWMA 2F0HA 2L0FA 3LWEA 1QZEA 3LX0A 2N1WA 2GVAA 5G3LF 1H9KA 4E6IA 2AHOB 4KY6A 2PCFB 3R3OA 5C2TB 4R4IA 1C76A 3ERQA 2LUEA 4A55A 3VRBB 3C1EA 1E6EB 5J39A 2I5HA 2AKWB 1WGYA 3K7AH 3AE5B 2KTFA 4IDIA 4Y7NB 1E3PA 4YY3L 3N1YC 1N9WA 3MTSA 5ELEA 1RM6C 2QCZA 2NZOA 4BBSH 2D3BA 4CKCA 2WAQE 3H1UA 4K3BA 4MEMA 3TQYA 1M90C 1FIQA 3PV0A 4OIKA 4FA6A 2ZM6L 1PYSB 1HNZQ 4ZHOA 1B3AA
chains in the Genus database with same CATH topology
1Q1EA 2AWOA 2WXPA 2JSOA 3RD4A 1JW9D 1KH0A 4Q2JA 3SHLA 1NR4A 1V1PA 2OHFA 3SDZA 3NP8A 5IT9L 1J7BA 5I4DA 1SMYD 4LTUA 2JX5A 1SDFA 1YJIA 5EQ0A 1EY9A 3NPPA 2BB5A 1VCIA 2RKSA 3J7AV 3BVGA 2KWDA 3P42A 1Y8OB 2JYOA 4XT3B 4F88A 5BMGA 3KLSX 2RPVA 3P20A 4FXKC 2E2DC 1ILQA 4A3BB 1CI3M 3P4SB 3NVWA 1O7LA 1J7CA 2TMPA 1E7PB 4TRDA 3A8JE 4HSPA 3VR2A 1J7AA 1ENCA 5ELDA 5E4XA 4DXGA 2VUMB 3X3NA 4FF3A 4UAIA 3NBIA 4ZKCB 4OHJA 1NVID 3V2TA 1IKLA 3NSWA 3MFYA 2PVOD 4EVOA 3K7AB 1EIHA 4JE3B 1QOBA 5A2QE 5I2XA 1L0VB 3Q22A 1A3TA 4XYQA 3N6RA 1JWAD 1F2RI 1VF5C 1T3QA 3RUZA 1MGSA 3AU7A 3VR3A 1BNZA 1PRTC 1Z7TA 1UWXA 3NVYA 1Y1VB 1BO0A 1XTCD 1A2UA 3BDCA 4AYBB 2R3ZA 4ARCA 4RF0A 2PIAA 4BBRB 2B39A 2QIEB 5HGTA 4FXGC 1I6HB 2N88A 1C4PA 1ONLA 5ELBA 1TY2A 3R8BA 2PNRC 1GUWA 1STYA 1JWMD 1MSHA 2CU3A 3VYUA 3K58A 1N60A 3GQBA 1XEEA 2QCPX 3MEHA 4B08A 2EYMA 5FO9B 1HFNA 3T3OA 1HQRD 2IL8A 5AUIA 4IUQA 4ODGA 2F0NA 2K05A 1I4HA 3Q24A 1J9OA 2EOTA 2VXWA 5COYA 4J3OD 4B0MA 3TEWA 1NI3A 2EJMA 4L2YA 4A90A 3D6CA 2ACZB 5ISRA 3GB1A 1SNQA 1C79A 1CZWA 2JZPA 3MP9A 3H3VC 2Q5WD 5EBCA 4H0LC 2WXIA 3S2DB 3S1RB 4TQUS 1RD9D 5IGEA 4H2AA 3R2IA 2A68D 5A35A 4QCLA 2K33A 2R7ZB 3FPUB 1LABA 2WXNA 2ZXOA 1SE4A 4PNYA 2CW0D 4XE0A 4PT5A 1ET9A 2BYTA 1R4PB 1TS4A 1BF4A 2ZW1A 3W2DA 2K6AA 2MJDA 3KLRA 1RODA 1IW7C 1TU2B 1XLQA 1WD0A 3AE6B 2FMMA 2IGHA 4ZRPA 3WOFA 1GJXA 1WTVA 1PZJD 4C1NI 2KAJA 4ARIA 3O13A 1V8CA 1LTSD 2L1AA 2F0IA 1K83B 1LT4D 2ONQA 3HRZC 1C77A 1CHPD 5DAUA 1LTAD 3CKIB 2XNAC 3HP3A 3NXWA 4OZCA 4C2MB 1HQMC 2LJIA 5KIXA 3PO3B 1H9MA 1HHVA 2PTLA 4TQ1A 3P1MA 1NYQA 4KK7A 4F8MA 1Z47A 3U52E 5C5MA 4ZRQA 4XQJA 5HI1A 1PDQA 4V0BA 1FO4A 1ZE3D 2KVMA 3MXGA 2A5HA 4CKEA 2BE5D 2EY2A 2JWUA 2K22A 1F9RA 2DNCA 4DA2A 4A3EB 1Q3LA 1Y8PB 4KKSA 1NSNS 5J22A 2WAQB 3DWAA 3U9OA 1W6KA 2R92B 3OSOA 4ZLTF 5KYLA 1JALA 3ITPA 1TKEA 3Q8AA 1WTQA 5K36G 4FO2A 2Q8RE 3CHBD 4NJCA 1C4AA 4X3SA 2Y5PA 3AE1B 3LYYA 1L6UA 1C8CA 3OWEB 3OMCA 1PZID 2XWJB 4OL7A 4GDKB 3J80L 2WU5B 1L4ZB 2BDNA 2SOBA 3J81L 4YSYB 4YWGG 4KHZA 1EU4A 5C4JB 3FMCA 1TWAB 1TY0A 1BCPB 2B8GA 2KCNA 2O5IC 1QG7A 1DGJA 3VR6A 2MJ3A 2V3PA 2W55A 1VMPA 4DNRB 4AQ7A 1UNSA 2VNUD 1BCPF 2F0DA 2WB1B 2WXQA 4RWSC 1VJKA 1VZ8A 3BK1A 1EY8A 1O78A 2K28A 4IUNA 4ZAIA 3H0GB 1A2TA 1A15A 1P7FA 1KDBA 1GOZA 4LLGM 2K01A 3VYTA 1Q8IA 1A3VA 3LXFA 1I4QA 1JOKA 2HCCA 2Z4IA 4A3KB 2CJNA 5G3LD 2LY7A 3BVZA 4N9TA 5E4WC 1HTLD 3NWTA 4EE2A 1EIGA 5JPNC 2B8FA 1JICA 1BUVT 2D9UA 3KBGA 1QT9A 5M5YB 2MPMA 1C9FA 4A9AA 1DOIA 3DWGC 3ND8A 1WGKA 4PQXA 2F3VA 3FILA 5EPLA 3C1FA 1WCMB 3VA5A 2SAKA 2WXHA 2PW7A 1XF5L 4XYOA 3LWUA 4XDCA 3OHXC 4HKQA 4IURA 2NWGA 1H9SA 2XN9C 4O1NA 1DYQA 1Q12A 1PFNA 3D4DA 4IFDJ 1FD7D 2RA4A 3MVVA 3S9WA 2W3RA 2JQRB 2KHSA 2H89B 3C3LA 4WAFA 2K0PA 2M2LA 1F2LA 1GHJA 4MIUA 2HDEA 1LO5D 3MFGA 5CORA 1SXTA 1JRPA 1S4ZA 3GTJB 4C7YA 3TZDA 1G6ZA 1EEFD 4RGMA 3S1NB 5EPJA 5FOBB 1DXMA 3RMHA 3E56A 5G5HA 1M8AA 4IUPA 1EWCA 3E0JA 3G7LA 1V43A 4IN3A 1KDCA 5M3FB 2LGIA 2WXGA 4EQPA 4K5VA 2B2YA 3OIQA 3HOZB 1JWUD 1WXQA 1UGJA 5IODA 2F0WA 1RF2D 4L6TB 2HTME 1STGA 1DOXA 2EY1A 4DF7A 1C78A 4ID6A 2RDHA 4US9A 1PGXA 3U7ZA 3AEEB 5EE3A 2NBFA 5EKLA 5KEEA 2L83A 2A6HD 4IUUA 5IGFA 2INNE 2JYEA 3TDQA 2X69A 1CK1A 5BYQA 4EQNA 4BY7B 1A6XA 3FDTA 1KRHA 2EVBA 4MH8A 1PTOH 4A3IB 2JEBI 2OXPA 2JA8B 2BA0A 2K5WA 1STHA 5D65A 3TP7A 4WORA 1OXUA 3P7JA 2EYFA 3ZGZA 3I90A 4HKZE 3MHBA 3V05A 2D2CC 1SBBB 1HCZA 1EY5A 2YYZA 1AP0A 2CVRA 3PMFA 3VQIA 2SNSA 4K2KA 2KJXA 1NR2A 4XDDA 1IL8A 1S5FD 3HEJA 5EKKA 1EYDA 3TEXA 3M3YB 5CV9A 3QOJA 2Q8TA 4DN4M 2FMCA 3GS2A 1E2ZA 4WURA 1G91A 4S3SA 3W5VB 3MXPA 4XQQA 3G6JB 1KTKA 3K6OA 2O5JC 1FYCA 5LL6X 2E74C 1G2TA 1F0ZA 1STBA 2XVSA 2PQEA 2FBWB 2BOSA 3NHHA 1KABA 1RFKA 1ZEQX 4YSZB 1B4OA 5E3FA 5BN5A 2OF1A 4CJ2C 5KGUA 3BVMA 2ON8A 1SIJA 3GD7A 1AWDA 3QOLA 4KD3A 2WXOA 1Y56A 1EU3A 2JP1A 4HR7B 3W9CB 2E2IB 5G5GA 1WYGA 1Y8NB 1PTOB 1ESFA 1B9MA 3HG9A 3DEPA 1F2MA 2B2VA 3FPPA 5CV5A 2NTTA 2F3WA 4YSXB 3NVZA 1NYRA 3SFDB 1B1ZA 1BMLC 3AEDB 2BCOA 3Q23A 1PTOF 3NZ3A 4HSVA 3ZJVA 2NYZD 4KX6B 4KKJA 1TR5A 2PKOA 2EYHA 5MPOA 2GRIA 1SYFA 2B2UA 1WTRA 3T3NA 4CJ1B 1H9JA 1SMYC 4KV6A 2MEKA 4PMBA 2Z4HA 3BYYB 1CTMA 4ABNA 4DFAA 4ITKA 5D3DA 2PVGC 1BQQT 3SK4A 2QEJC 2RBMA 2L32A 2WXRA 4NW2A 2A74C 1FR3A 3FAHA 2BS4B 3AEAB 1K53A 2XIWA 1IBXA 3Q8EA 2RQXA 3TEYA 1JC7A 1ZXTA 3HOYB 1JWSD 2JE6I 5HURA 1EL0A 2OEDA 1X32A 3VR9B 4QB4A 5IIFA 2EYJA 3HZXA 1C4QA 4WWMA 2B63B 1ZKOA 3RPFC 2D5GA 1E2WA 2JU6X 2J53A 1VDZA 4M8AA 4DGZA 2XSCA 4HJGE 2HUGA 4LMQD 1FD6A 1WSPA 5AFWA 1KFYB 1KNEA 2NZ1D 1C48A 3CRKC 2LMCA 2HCIA 3A7AB 5C0XJ 1U4PA 1TZOA 3DUZA 4A3JB 4R8NA 2WXFA 1VZ6A 4L8JA 4CKBA 3CQZB 2E76C 3N52A 2VZKD 1FMAD 1JORA 4GZYC 3TEZA 3PUVA 1GAQB 4WH4A 2L4NA 5D3IB 5C3WA 3QIAA 4B0EA 2H1EA 4MT5A 1BCPD 3UI2A 5KNBA 2E3TA 3H6MA 1GUTA 3EA6A 2KEEA 4KKTA 2C9OA 3SR1A 1KNAA 2LUMA 2FINB 2WLBA 2PO4A 3LB8C 1HFGA 2F0QA 3I73A 5CV7A 2WKDA 2EKIA 2F1MA 5EE0A 4BBSB 3I91A 2BBCA 1BUIC 4NP5A 1WRIA 1EY6A 1Q10A 2CJOA 5EJWA 1QOHA 4OZAA 2R6GA 1LTRD 1FFUA 5C4XB 2CQAA 2B2YC 4RGTA 4N6EB 3AE4B 1G291 1LLRD 2OT2A 1F2RC 1YN3A 3VRAB 1FXAA 1CZPA 2MJ8A 3PZ8A 2IX1A 3JAME 3BS1A 5H92C 4KY5A 5BN4A 1GXDC 1NAPA 2CW0C 3K0YA 3P4PB 4L63B 2L1BA 4ZK9B 1DOMA 3FC4A 2M56B 4HTHA 4G7ZC 1MHXA 3U4EG 1BDOA 3VR4A 3I72A 4P6VF 2F0JA 2L55A 3H91A 2NVYB 4BA2I 2EYPA 1LTBD 3PIP3 3L3OC 1JCKB 4FF2A 3HOWB 1KDAA 4REZA 2I2YA 2ZT9C 5LHY1 1MSGA 1OO9B 1FCCC 2QSDA 3TZUA 3NTIA 1IUEA 2RMMA 5JOBA 1T5EA 2K5QA 1DOKA 4XXEA 3A56A 1B53A 1RTNA 4WIPA 1U9RA 2WQYB 3KBXA 1GUNA 4RHRA 3VR5A 2CHBD 2NB0A 4KTAA 3I57A 1TWFB 3NWSA 3TP5A 2F0TA 1AZQA 3ZJUA 2BT6A 3OW7A 1ACCA 2BA1A 1UWMA 1SE3A 2IW3A 2G1EA 1I4GA 3QJYA 1K52A 2A69D 3AE2B 3Q8CA 2BE5C 2M9VA 2WXJA 1MPEA 4JPSA 4HAEA 3J9CA 5CV4A 1GB4A 3CIRB 3H8HA 1PGAA 4HCEA 2RDGA 3RFZB 4UDUC 4NZLB 1TJEA 2O2LD 3IT4B 1AEXA 1IYUA 4WJWA 4MN3A 5LNK1 1OQQA 5K36H 4R9WA 4ZOHC 2B2VC 2DY8A 3S17B 1V1OA 3KQ4A 3PUWA 4K2LA 2PMVA 5FLXE 5CC4A 4H7BA 3I4MB 3QB3A 4B9XA 1RJTA 2F0PA 4C56C 4U68A 1SAPA 5EBDA 2IJ0A 3NE5B 4G57A 2F4IA 2B2UC 3CRLC 3NRZA 1A70A 3RLFA 3BDOA 5C5LA 2F0GA 1ENFA 3F2UA 3MA2B 1IW7D 5C4ZA 1CHQD 4OIJA 1ML0D 3DMUA 3T51B 2M0AA 4XDXA 3AE9B 3TP8A 5C6AA 1PDXA 5C0XI 3VR8B 4J6HA 3KWVA 3C46A 2K32A 2JSVX 1N5XA 3MHZA 4IUVA 3GTLB 4PMWA 2VZKB 5IT9E 1SSNA 1CA5A 1G8ZD 5JVG3 1EWHA 2X38A 2ID0A 3URYA 2KDMA 2ICEC 4O42A 2Q8IB 1EEID 2PW9A 2R61A 3EGRA 1PTOD 3MWYW 1VZ7A 1A3UA 4C1NK 1E9MA 1BXTA 4RNAA 5KNDA 4PMCA 4KJNA 2WXKA 1ILPA 5CMDA 2DWQA 3IXSA 1TWHB 2N55A 5T8IA 1I4PA 2EE1A 1E0BA 1F2YA 1B2TA 3BZDB 4IFDG 4QUCA 5C3JB 1QNUA 4RGOS 4OO1I 4G7HC 4G7OC 1TS2A 3L9AX 2H88B 1HTPA 3Q0AA 5HHDG 3AECB 1LTID 3IAS1 4RCNA 2NVXB 1D4BA 3M7GA 3R93A 1VR9A 1ZUD2 1JWBD 1U4RA 5I6WA 2MJEA 3GO5A 4XT1B 4J8QA 4ME5A 4IOIE 2PZWA 4BA1I 1DZ1A 3EUB2 1GUOA 4NDXA 3BYTB 5KRUA 4ILWA 3CWIA 4XQNA 1FCLA 4RFBA 2K1BA 3H09A 1TVXA 1YJJA 1TQOA 1SB3C 2YEPF 3BIID 1TT2A 1HUNA 2ZXPA 2K9XA 1JB3A 4XWWA 3U9SA 4DU9A 2K03A 4FF4A 3KLSA 1QB5D 5CBAE 4NAWB 2G9DA 3A8KE 1QLBB 1ET6A 1ICWA 1F9PA 1ZP0B 2W54A 3KF8A 4KN4C 2INPE 2DYOA 2XRSD 2A6HC 4LAAA 2PLPA 5EE1A 1QWYA 4QMGA 1PLFA 3SK6A 1B50A 2LS01 3SFEB 1PRTB 2NVTB 1EY0A 5EGTA 1DM0B 2FE8A 3VA7A 2HDMA 4WFN3 1YN5A 5BMHA 2DN8A 1E10A 1EWYC 5JEAH 5F2DA 1S5ED 4ULLA 2WNMA 1PRTF 5C3XA 3ZQ4A 1NEKB 1D5ZC 4NKLA 2H4OA 1XX8A 2BTEA 1MI0A 1RHPA 2E2HB 1EOTA 1STNA 3P63A 4QF4A 5A2QL 2ICIA 2WDQB 4C3JB 1L5PA 1I50B 3A8IE 4FVMA 3A7LA 2L9HA 1B9RA 2D62A 4DQOC 2KQ3A 2DY7A 4KJOA 3PIO3 1OXSC 3QWNA 4KI0A 4OW0A 4K14A 4JWSC 3AE8B 2FFKB 2QILA 1K8OA 5LL6S 1RDPD 1JOOA 5KYIA 1IHZA 3A54A 2MHVA 2LFIA 2LHDA 1TKWB 1R9TB 2MUYA 3TN2A 3K5NA 1VDVA 3HS0C 2K5PA 2IX0A 1GUSA 4A8XC 3T4AC 1YMHE 3B2FA 4U673 3D4RA 3PUXA 4CHTB 2N9LA 5I6YA 4LK1C 3AMZA 3D6WA 1PUTA 1RCVD 5AUKA 1SSOA 3EFXD 1ZDXA 2BS2B 3K5LA 4IZ8A 4ZUJA 3W5UB 3P4QB 3I8ZA 1SNDA 4C3HB 1ZYRD 1FRRA 3J7AF 3Q6SA 3N9YC 1SNOA 3OMGA 1AFPA 2QMTA 1I7HA 4LJZC 5GXGB 1MVKA 5I2YA 3H94A 5CV8A 1Q1BA 2FHTA 3EROA 2EPBA 2L52A 2SDFA 1IYVA 5EE9A 2Z8LA 1CQFA 4DK0A 5IGBA 4XIGS 4X3UA 3Q69A 1HUMA 1YNND 1SEBD 5C4HA 4HROA 1Y69U 2X6LA 1BBXC 4FYDA 5EKIA 5ELFA 3L7ZC 2JA7B 4FXDA 4TQ0A 1PZKD 4ZUIA 4IUTA 1QE6A 3GV3A 5JXVA 3OOCA 5JJZA 1ROEA 1F2ZA 1DOYA 2J4XA 5BYSA 3J80E 5JEAJ 3DWQA 3GTGB 2PMZB 3J81E 3MAQA 3HKZB 3IAYA 2NN6G 4JX1C 2IT1A 2WS3B 1TWGB 1GHKA 3OPOA 4A6QA 2EDGA 1AW7A 1QKZA 4R8IA 2LKVA 4YTPB 2KMMA 3ETRA 2J0TD 5C0XG 3GV6A 2L12A 2F0OA 5FR3A 3NQIA 4C3IB 1QOAA 1LT6D 4GLSC 2EJFC 1FGBD 2Z1CA 3FRPB 3MC0B 1F9QA 1YNJD 1AN8A 1YQ3B 2MGSA 3EJIA 3IL8A 3WDNA 4YTMB 1FNWA 1EM7A 1VF7A 2GA4B 3ND9A 1PFMA 1DD2A 1HA6A 1MHHE 4A3DB 2QF7A 5T1GA 2L5TA 1BCPC 1N63A 1D1IA 1V1PB 2A6ED 5CBEE 1D1KA 3T13A 4USAA 1O7ZA 3M7NA 1ZXIA 1I4RA 3PZ7A 3V3XA 2LMCB 5DM63 3VYRA 1EFID 1HRJA 4IFDI 1EYAA 5FO7B 1PFDA 1DJRD 1LT3D 1P7EA 1CJEA 1QNKA 3NUCA 2L0CA 2QJLA 4OO1G 1TKYA 4BWGB 1UEAB 3S1QB 2EELA 4TMAB 3B9JA 5EPKA 1HZ5A 2JA6B 1JROA 3SE0A 1HA5A 4Q0FA 3AMUA 4RAUC 2YU9B 1G2SA 2PZTA 3S15B 4H44C 1ESRA 1H9RA 5C3EB 3NBHA 1AZPA 2GI9A 3FEWX 4X3KA 4Z9CB 3PUYA 3EVQA 2FUG1 1SFOB 1EZ6A 3GTKB 1FEHA 1QJOA 1YN4A 3IAM1 1UUPA 1HZ6A 5NUCA 4N9PA 4CBVA 2WP8J 3RZDB 1FFVA 1YQ4B 1IGDA 2HQEA 3IFTA 1PMRA 3AV8A 1MBYA 3AEGB 1XCTL 4DNTB 3M85A 3DM1A 2F0EA 3D4WA 2WINB 1K51A 1R7SA 2Y3AA 4M1UB 1SYDA 2X6GA 1JQYD 2JXMB 1L0YB 3IKJA 1STEA 1N61A 2WDVB 1TIID 3AEFB 4RF1A 2A68C 2AQ3B 2DLBA 1RYJA 3AB9A 3AH7A 1B9NA 1N62A 1CZGA 1EY4A 5CR3A 2WIIB 4HMIA 1I3QB 4HN7A 2B2TA 4J1MA 2DBYA 2V4DA 3WCQA 4KKIA 5JPMC 4IALA 3UI3A 3SK5A 1TS5A 1FXIA 4RA8A 1VMCA 4ZKBB 1E0ZA 2A69C 1XWEA 4YXDB 5K5PA 1SNMA 2K3UA 3AE3B 1D5MC 3S2HB 1KLGD 1L6VA 3LNNA 2PW5A 1B44D 1HPCA 2LEKA 3HOUB 5I9OA 1BR9A 1NUCA 1TWCB 2I46A 2MH7A 1EQVA 2IGDA 1V8QA 2WU2B 1PFBA 1QILA 3GTQB 4MHEA 1PRTD 2B2WA 1LACA 2XRQD 1RWSA 4BS9A 4RKBA 3GTPB 4WRDA 5IOCA 2N0SB 3C8YA 4L1BA 3ABVB 3BK2A 3FVQA 4RGNA 4QIWB 2PPBC 4EGVA 4N59A 2WDRB 1CM9A 1TYGB 2KUMA 4RHSA 1EQTA 1QCBD 1WVLA 2D5DA 2BW2A 2V4IB 4K5WA 4ZQ3A 2AUJD 4KY7A 1NENB 4GDLB 3S1MB 3KWLA 1OXTA 2WKCA 4JBWA 2F0VA 4RH6A 3NUHB 4IKGA 2QDBA 3QG1A 3ZJTA 4MM3B 4OGQC 1KAAA 4A3FB 4I7ZC 1QQRA 2RSOA 3NVVA 3GTMB 1OQRA 3W1SA 1VLBA 2VB2X 3K59A 2IDYA 4FXCA 2GB1A 1E2VA 2QKIC 1JOQA 4KGRA 5M3MB 3NQTA 3DWPA 2JXTA 4AS1A 3TP6A 4H13C 4OVZA 2JEAI 2WV6D 2NMQA 3RZOB 3M4YA 3T53B 1PTOC 1FNVA 3P4RB 2NN6I 2TSSA 5C44B 1SYBA 1LTGD 1L0XB 2KEDA 5KNCA 1W6JA 5BYRA 1GUGA 2K04A 1L4DB 1CT1D 1F9SA 2AQ1B 2XWBB 2ZW0A 1PXUA 3C2PA 1M4VA 4KGTA 1IGCA 1TS3A 4IFDH 5IGDA 2WP9B 5E6JA 1XXGA 2J52A 1O7YA 4DAYA 4TKOB 3IT6B 1UAPA 5M5WB 1T6BX 3K5OA 1QF6A 2A73B 3I4LA 3IFDA 2AX5A 2F0KA 2RVLA 3VYSA 4FF1A 2Y0SB 4KN7C 2KOLA 1RTOA 1XCQL 3HUIA 1KLUD 2FJ2A 3WOEA 3TSSA 1IKMA 1U4MA 1R4QB 1HXYD 3ONAB 1WWTA 2F0MA 1FRDA 2M00A 2Y5CA 1EY7A 2KQ4X 2AWNA 1WTWA 1I6VC 1XLOA 5E1FA 3GP7A 2WXMA 1JQ4A 2J42A 1WTXA 2JYTA 2E6XA 5D14A 1SJED 3BDLA 1S5BD 1SYEA 4DAPA 2AQ2B 3K5MA 1OXVA 3S16B 2NTSA 2BB6A 5DNFA 1O80A 1GB1A 3AB5A 4A3MB 3D8GA 1OXXK 1LT5D 2I07B 3FILB 4RKLA 5TSSA 1D6EC 3HVDA 4M0WA 4OZBA 3D31A 3I4NB 3DXJC 2N7JA 2V3NA 2EJGC 1HEZE 1XYIA 1XLPA 1OFFA 1ENAA 1U4LA 4HEDA 4PV1C 1Q90A 3V96A 4XTCS 2YEPB 1H9SB 2L11A 2J7ZA 1N5WA 2OEOA 3E5SA 2BS3B 5IGCA 3AM9A 2IGGA 2KA7A 3MXUA 1DONA 3OIPA 4HEA1 4V190 4MACA 1SYGA 2BDOA 2DYMA 2WXLA 2F0FA 2V0GA 2B76B 1XLNA 3ZYYX 4K6LA 3MXNA 3T56B 1X3PA 1YNTE 2KACA 1ZDVA 5I9PA 1ZPSA 1PGBA 5CV6A 3CU7A 3HGBA 1T5XD 1SE2A 2B2TC 4XWTA 1QOGA 5JVH3 5BN3A 5DM73 3L4PA 2K5DA 3P75A 3HRDD 3PUZA 3FKIB 1S5CD 2NVQB 2IPKD 4TSSA 2W3SA 2F03A 3I3CA 1STAA 5ELCA 4F7XA 1GPXA 3SR6A 1CA6A 1LV9A 4KGSA 2WACA 4K5XA 5DEHA 3DHQA 1C4CA 2I38A 4P2CB 3D3RA 5FK9C 2EY5A 3QO2A 5FO8B 4KD4A 5CYUA 4KKUA 1WTOA 2W82A 3U2SC 2NUCA 4YT0B 3K57A 1Y1WB 3DEOA 1D5XC 1DOLA 3AN1A 2F0LA 3S14B 2KN4A 1I4XA 5HG2A 4C3JG 4YTNB 4KMUC 4ZHPA 3E9SA 2B2WC 3R2TA 3KK7A 1SJHD 1ZYRC 3I70A 4NMZA 1AYFA 1V97A 3Q8FA 1D2BA 4US8A 4HRSA 4K8JA 1EZ8A 2EZVA 4N58A 3Q8BA 4LK0M 2ENBA 4L23A 3J7YW 4FNFA 1VRAB 1WD1A 1TKGA 3BWUD 3T16A 1Z6HA 4A3GB 3NTKA 1YNNC 3JAML 2F0UA 1EYCA 2SEBD 5JAVA 1K50A 4IQZA 2EXZA 4QUFA 5H8YE 4F87A 3PO0A 4I65A 1J8IA 4BY1B 1QOFA 1NCVA 4X3TA 2F0SA 1SNPA 1LTTD 3E6ZX 2VB3X 5JEAG 3W3AA 4C3HG 3B2GA 2PYKA 1CFMA 2C5CA 2M19A 1BOSA 3KUPA 2NN6H 3HOXB 1JR0D 1SNCA 3SXHA 3AEBB 2PZUA 5M9OA 5IGGA 2AUKA 1F77A 3OWFA 2ZXRA 2SNMA 3MZ5A 4KHVA 3TMEA 2G9HD 4DAVA 3AE7B 5C0XH 3HOVB 4A93B 1K8MA 3NS1A 4FP5D 4EQOA 1FNUA 3PO2B 2EY6A 5M5XB 2EYLA 3MJ5A 4C7ZA 1YNJC 2KCCA 4K8IA 1X3QA 2E2JB 2IWHA 4DXFA 2MP1A 1DCZA 1MI2A 4K6DA 4JK1C 4P16A 3X3MA 5J1ZA 1PYWD 1FM0D 4C80A 3TBIB 2IX3A 2K7VA 3M4OB 5BMIA 1SF0A 4YIJA 2LFNA 1S5DD 2A6EC 5HFYA 4NAMA 4CQNA 3TUOA 5D7GA 4D2KA 1ZXHA 3NTHA 2LHEA 2DNEA 2E75C 3I9V1 4DK1A 4ZYSA 1JMLA 5CGKA 2O4XA 4WQMA 4C3IG 1WTPA 1IBXB 2EYOA 5T1IA 1RKNA 5FKA