3BYTB

A complex between a variant of staphylococcal enterotoxin c3 and the variable domain of the murine t cell receptor beta chain 8.2
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
238
structure length
232
Chain Sequence
b'SQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSTWHGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T cell receptor beta chain 8.2
publication title Manipulating the coupled folding and binding process drives affinity maturation in a protein-protein complex
rcsb
source organism Mus musculus
molecule tags Toxin
total genus 64
structure length 232
sequence length 238
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2008-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
B PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3bytB02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3bytB01
3DWAA 1STEA 4RHRA 1JWMD 1RCVD 3EFXD 2CHBD 1LTID 2R61A 2XN9C 1V1PB 1D6EC 4RCOA 1HA5A 4TSSA 1L0XB 2Z8LA 1D5MC 2AQ3B 1I4RA 1AN8A 5ELCA 3SEBA 1M4VA 5ELEA 1ENFA 1PZKD 3O13A 1KTKA 1EFID 1G8ZD 3TSSA 1TS3A 1TY2A 4RGMA 2NTSA 3BYTB 1LTBD 1GOZA 1RD9D 1F77A 2SEBD 1LT5D 1LT6D 1JCKB 4Z9CB 1PRTD 1LLRD 3KLSX 1I4QA 1SE2A 1B44D 1I4PA 1BCPB 1PTOD 5I4DA 1L0YB 2XNAC 1LO5D 4C56C 1SBBB 1SEBD 1MD2D 5TSSA 1BCPC 1ESFA 1PZID 1JR0D 3BVGA 3R2IA 1DJRD 3EA6A 1B1ZA 1SJED 5ELBA 1JWSD 5FKAC 1XXGA 1KLGD 1D5XC 1JQYD 1PZJD 2RDGA 2G9HD 3V05A 1PTOH 1FGBD 1LTTD 2TSSA 1I4HA 1I4XA 1S5BD 5D3IB 1JWUD 5D3DA 1LTGD 3GP7A 1PRTF 1EEID 1KLUD 1S5ED 2RDHA 3BYYB 4OHJA 1PTOF 2ICIA 4L6TB 1CK1A 1FNWA 2XRQD 1SE4A 3DWQA 1FNUA 4RGOS 4RH6A 1LT3D 1S5DD 2AQ2B 1DYQA 3OWEB 2QILA 2O2LD 1TS4A 2IJ0A 3W2DA 1ET9A 4NZLB 2AQ1B 4K6LA 1CHQD 1EWCA 1TS2A 1PRTC 1EU4A 1SE3A 4RHSA 1YN4A 1HXYD 1UNSA 4O1NA 1LTSD 1RDPD 5FK9C 1SJHD 3CHBD 1RF2D 4RGTA 4RFBA 4ZYSA 1SXTA 1BCPD 1YN3A 1S5CD 1BXTA 3MC0B 2IPKD 3URYA 1CHPD 4L63B 2J4XA 4UDUC 2QEJC 1FNVA 1QILA 1LTAD 2XRSD 1HTLD 1S5FD 3BVMA 3BVZA 4BWGB 5ELDA 1V1PA 1I4GA 1XTCD 1AW7A 1PRTB 1T5XD 1D5ZC 1LTRD 1EEFD 5ELFA 4RGNA 1HQRD 1PTOB 2WV6D 1EU3A 1TY0A 3DWPA 1ET6A 1PYWD 2NTTA 3BZDB 3MFGA 3R2TA 1BCPF 1FD7D 1PTOC 1V1OA 1CQVA 1UUPA 1YN5A 1TS5A 1CT1D 4DXGA 1LT4D 3R8BA 4DXFA
chains in the Genus database with same CATH superfamily
3MHBA 4A3MB 2MJ3A 3N1ZC 4JWSC 2ATWA 1NYRA 4DN4M 4W9CA 2E76C 4GZYC 2HDLA 1RCVD 3EFXD 1N34L 1J5EL 1FMAD 2GVAA 1XQQA 3AB5A 3AXCA 3UIPB 2MRPA 1IBKQ 2RR9A 3EECA 1NJIC 3DBRI 4L5QA 5IKCM 4DK1A 3TMEA 2Q2TA 1F9RA 4JPBW 4DDID 3U9SA 5C44H 3JAML 4A3LG 2R2OA 4DV1Q 4RNAA 4GXBA 3K8AA 1T3QA 1JOKA 5DPSA 1KTKA 1F2LA 3HOYG 4ODGA 4HJAA 4LAAA 2JWUA 2LGSA 2A6HD 3T16A 2QKIC 4EQNA 4EQOA 5IP9G 3TSSA 1N62A 4HTHA 2AX5A 2NTSA 2ZCCA 1KC8C 4OX9L 2IY5B 5C0XG 2KJ6A 3TMPB 4KDIC 4DR6Q 2KQSA 3Q3OC 2VUMH 3PO2H 1M8AA 1HFGA 4YHHQ 4KY6A 4GN4B 2JA5G 2ONQA 2KCMA 3Q6SA 4LF5Q 2B3AA 1SNDA 1IKLA 2N7DA 4ME3A 5K36H 3GZNB 2Y3AA 2FNJB 1CZGA 2I46A 4O2DA 5COYA 4KD4A 2OWOA 3EJIA 1MJDA 1VDVA 4G3XB 1L1OB 1S72A 3ZXRA 3PGZA 1N61A 3NZUA 2LXJA 2D10A 4ANUA 2F03A 2HT1A 1Q86C 2M0AA 4CBVA 4J15A 1YIWA 2JVCA 1VDZA 2KDBA 3B0AA 2BWFA 2KHWB 3NVWA 4M02A 1ZUD2 4DA2A 2FINB 3CMEA 2ZVNA 5CHVC 1EOVA 1GXDC 3N3KB 2IY1B 1X56A 4IZ8A 2JA6G 1S5ED 1STAA 4ZLTF 1K73C 3L54A 3VHTC 1ML0D 5A2QL 2ICEC 3RNUA 4EVOA 2N0SB 3BYYB 3Q0AA 2FHTA 1FNWA 1IPGA 4KI0A 1NBWA 4DBGA 4JI8L 4BBRH 3CCJA 3NVVA 4B3TQ 2RGFA 4CDCC 2AQ2B 1EIFA 3DBSA 2KENA 3W2DA 2B2WC 2B2WA 2AQ1B 1SE3A 2R93H 4RF0A 1SIFA 1R9TH 4DHJD 4YY3L 4HEDA 1BNZA 5C44G 1HZCA 3HZXA 4K3BA 4A93H 1OFFA 3KUCB 4I6PA 4A6QA 1TYGB 5GXGB 4UP9A 4ANXA 1B3AA 1VQGA 1O78A 3I72A 4DR4L 4XZ4A 1NEKB 3OJ4B 1I94Q 3URYA 2A1AA 1VF5C 4DR1Q 2PVOD 4LF6L 2RMMA 1X3GA 1BBWA 1FJGL 3NPPA 1RM6C 2KFJA 5L83A 4IUQA 3X3NA 2DYOA 3AE9B 3OAWA 1X6OA 5ELDA 2ZW0A 1H4RA 2CQAA 1E2VA 3GTKH 2IDYA 3ENEA 5ELOA 1MJEA 1PFDA 2KANA 1I6HH 3EFCA 4NPNA 1JOOA 3OYYA 5KHQA 2R7DA 1OEYA 2SAKA 3ETRA 1EY8A 2WGSA 3K58A 1I5FA 4HSVA 1U4PA 1PTOC 4HIMA 1Z5SB 2KNBA 2A5HA 2F0JA 3QR8A 2DAJA 3VUYA 5JJKA 4ASWC 3U9OA 1BMLC 2NYZD 3GV6A 3ONSA 4LTUA 1NR2A 1P9DU 1II3A 5BN5A 5EE0A 4A8XC 3C1FA 3J80i 4X66Q 3T3OA 1ZDXA 3F2BA 2ENBA 3AE4B 1F0ZA 2HQLA 4PV1C 1V1PB 1K3BC 1YNJD 1SGHA 3IG3A 3GTPH 4LNIA 2E74C 1E8YA 1TGZB 1WGKA 2Q2IA 3VDZA 3JSVA 3PTFC 1WWTA 4QIWE 2YTXA 4BBRG 3G6EA 3ZDMC 1V6EA 3SK5A 2EYHA 3UDXA 4TV3A 4IUPA 4FF2A 4B6WA 3GTLB 4C00A 2KECA 4IJLA 2Y0SB 1WI5A 3A74A 4I65A 2LUMA 3CCQA 1E6EB 2EIFA 2F52A 1QNKA 2KEDA 1VQBA 1Y1WB 4DWFA 1GOZA 1WJJA 4FNFA 4X64Q 4KZ0A 3CCMA 5GAGC 2ZZPB 2QDFA 2BF8B 4JOIC 1MI0A 1GO3E 1ONLA 1CA6A 3GTOB 1JJGA 1MG8A 1QKZA 4GDKB 5LXHA 3TUOA 1ENAA 3I4MH 1NTGA 2V3SA 3A1QA 1B44D 1Y1VG 4RKBA 2FUHB 3HM3A 2XNAC 3GTKB 4C56C 4ACFA 4DV4Q 3T53B 3KF8B 1AZPA 1VQ8A 1I6HB 2DNCA 3AYHB 2HTHA 2K9XA 5JJIA 5BYSA 3L17A 3QG1A 2K5PA 2NUCA 1HZBA 1DOKA 1AWDA 2KLCA 3OTOL 3T13A 2VQEQ 4DXAB 5BMHA 1RFAA 1KRHA 2F0IA 4P1CC 1TWCH 3RZDH 2KYWA 1QNUA 3PUWA 4PZ6A 1LTTD 1WTXA 2QDBA 1HNZQ 2F0TA 2UUAQ 1S5BD 4L5RC 2KCNA 1VRAB 4IUMB 3ONAB 3A5ZB 3VTWA 2ZJPA 1XLNA 1LTGD 2QEXA 1L2NA 2QDLA 1EQQA 3FP9A 3I4LA 1VQCA 3HOWH 1Z2MA 2WDTB 3LXFA 3GTPB 3PO3G 2RHSB 1WIAA 2G4DB 1OXTA 1NMFA 3UE1A 1P98A 1SMYC 4OEMB 3ULLA 2G9DA 2KHIA 3MXNB 4GGQA 1CZPA 1N9WA 3KDFA 4LFCQ 4WWMA 5J3BA 1GC7A 3IT6B 3NZ3A 1QOFA 2EVBA 2K5WA 1LACA 2VQFL 1L6UA 5FK9C 2MW5A 1EO6A 1U0LA 4RGTA 4A3BG 4AJWA 3CCUA 1WOCA 1QZEA 1A3VA 4IPHA 3FKIH 3X23A 3MC0B 1DOIA 1FM0D 2SDFA 1GD7A 2L0CA 4IG7B 3J7AV 5EPLA 1HZ5A 4FBJB 4US8A 2OJWA 4OVVA 4WFN3 1IHZA 5C3EH 4OO1H 3MVVA 3FRPB 3AM9A 1ZDVA 2K5HA 2L55A 3NUCA 4V190 4LFAL 4ITKA 4G57A 3AE5B 2CKZB 4A3JG 1D5ZC 1G6ZA 4FVMA 5LMUQ 4RGNA 3RZDB 2I1KA 1HNXQ 1N63A 1T9HA 1P0RA 3K5LA 1CSPA 1ASZA 3M3YH 4H44C 2RKSA 2XEWA 1I3QH 3TDQA 1E7PB 2Y5PA 1ZEQX 1L0VB 1KXLA 5JHBA 2ZJRA 1YBYA 4ZKBB 1IGDA 4JI1Q 4G4KA 3HOWB 4LF4L 3TEHB 3LJ3A 1ZKHA 2BYVE 4GOPB 3AV8A 2WXIA 1UELA 3QAQA 3RD4A 3Q8EA 1LTID 2VL6A 4M0WB 2GBKA 1TQOA 1QOHA 1QG7A 2QW7A 4TRDA 4DV0Q 1OTCA 1HA5A 4KV2A 3CPWA 4IM0A 4IC7B 3EC8A 1UD7A 2AQ3B 2W3RA 2KUMA 1AN8A 2B2TC 4DR3L 4YWGG 2B2TA 4LFBL 4JBMA 4KVGB 4N6EB 2K52A 4XC2A 3NEMA 3RULA 3DOWA 4JI3L 5IYBG 1Q8IA 3ZNGC 3OIQA 1Q1BA 1TT2A 3Q8DA 3ZIMA 1CKNA 1TY2A 4GS3A 1RD9D 4PS7A 2KOLA 4EUTA 4HRSA 1LT6D 1VQDA 1H95A 2AEHA 3IHPC 4MJSB 4AQYQ 3NSWA 3FKIG 2KVRA 2JA8B 4JW0A 2RPQA 3WCQA 1GHJA 2PTLA 1I50B 1HR0Q 2OHFA 4NW2A 4DAMA 5IWAL 5C3EG 4A3IG 1V43A 3KUDB 4HIOA 2DZJA 2HCIA 5E3FA 1EYGA 5L37A 2WWZA 5FKAC 2YU9H 3KYDD 4XDDA 2K0PA 1PZJD 2WB1B 4LF9L 4N9F4 1GM5A 1MGSA 2NVTB 4JBJA 1O80A 4NAWA 2UUBQ 4NJ7A 3VQIA 1XCTL 3GP7A 3HIZA 1PRTF 3W1BA 4PS8A 3ZJUA 4P2CB 2DENB 4IWQA 1T0YA 4S17A 3PZDA 4ZOHC 3STBD 3UF8A 2EY5A 2IO1B 2LD9A 2GBJA 1N6ZA 3L10B 1V97A 2NN6G 3APCA 5JPNC 2E2HH 3KBGA 2LGDA 1HFNA 4MDKE 1EFWA 4LJZC 3U4ZA 1D2BA 3KW5B 4NZLB 2WQYB 5JOBA 1KRTA 1F2RC 4OGQC 2DLBA 3HEJA 1VQHA 4H2AA 3TEWA 2JQOA 1WGYA 1IBLL 1W6JA 2RVLA 1XNQL 2F0PA 3VR6A 1LXDA 5AZFA 1VS0A 4G7HC 4IURA 2MWSB 1HZAA 1N34Q 1YD8U 1J5EQ 2AMCB 1YHAA 4IFDJ 1Q90A 2L9HA 3E9HA 3KF6A 2INNE 3D32A 4A3EG 1EWHA 2WU5B 4KMUC 4OIJA 1S3OA 1VQFA 4A3FH 3S17H 5C5LA 4PNYA 3AE2B 2IGDA 1SSOA 5IT9E 1VQ6A 2FMCA 1PH9A 2YTYA 3G71A 3TP6A 1FGUA 2RBMA 1C4CA 3KOJA 1STBA 1T5XD 2BA0A 3CC4A 4A3DH 1GNUA 3BWUD 2M19A 2KQ3A 2I38A 1VMPA 5HI1A 4HDOA 4OO1I 2WS3B 2C7MB 5IO9A 3STBC 4XXEA 2WXOA 3S16B 4OX9Q 4URKA 2Q2HA 4C3HH 2BA1A 5JAVA 4PZ7A 1CSQA 2WAQE 4BY1G 4ZRKA 2OCEA 3ZLZA 4M8AA 1X3FA 4NJCA 3ICEA 2LXKA 4B3RL 2REXA 4IUTA 1C7YA 2K5VA 3DHQA 2RCFA 1XJVA 1E8ZA 3AE6B 1B7YB 2EXDA 3QQ8B 1P16A 2DNFA 3RZWC 2MO0A 2M17A 4F8CB 1RKNA 4NMZA 2K6DB 1D5MC 3VYSA 3KBXA 2CWPA 2R92H 2ZNVB 5H92C 3RI7C 3QIAA 1UE5A 2JJQA 4HMIA 3M4QA 5IA7A 1TS3A 4K6DA 3RN5A 4B3MQ 4MH0E 4MSMB 1JWBD 2E2JB 2EMSA 3Q6BA 4CDDC 1LTBD 1W6KA 4K8IA 3ZJYC 3AEDB 4Z9CB 2XTIA 2K5DA 4TQUS 1PH6A 5CV5A 4JI8Q 4U673 2WXLA 2N9XA 2WXHA 1BKBA 5CC4A 1HR0W 3OG5A 4JX1C 2EYMA 3PO0A 3NHHA 2D3CA 5TSSA 3AE8B 4W9FA 4WWNA 1DJRD 4IPGA 3E9IA 2I07B 3IKJA 1EZ6A 3SR1A 4YY3Q 1PH4A 2LZ6A 1KLGD 4DR4Q 3NTIA 4NXNQ 3OW7A 4QMGA 1SNCA 4TQ1A 2TSSA 1LM0A 3NP8A 1TWFH 1E7VA 4CJ2C 4LF6Q 4AUQC 2Z1CA 3NBHB 3S2HH 4HMJA 3I90A 5CORA 4HKQA 2WFWA 5DLQE 2KJXA 2CS4A 2BDNA 4K8JA 2BKFA 2KVZA 5FJ8H 3TEZA 3ML8A 1BT0A 2KKCA 3WA0A 1UGMA 4QB4A 1PGXA 2PLPA 1DYQA 4I7AA 2QILA 5GQOA 1L6VA 2QSDA 2E75C 2R92B 1VCIA 5E4XA 1WTQA 3HKZG 4LDTD 1GUOA 3RLNA 2SNMA 2HIXA 5M5WB 4FULA 1WM2A 2A68C 1G6JA 1HPCA 1EY4A 3DBLB 2J0JA 4C3IH 2MBEA 2VZKB 1BOSA 5IP7H 3CHBD 1RF2D 2PJHA 2F0VA 5M5XB 1YX6B 2CHXA 3G48A 2L1BA 3L0WB 2A69D 3KLRA 2KMMA 2LMCA 3DBHB 1PFMA 3DVGY 1SR3A 1ICFB 2NPTA 1MSGA 4LW1A 1WSPA 2Q8TA 4Q5VA 4K0KQ 4JI6L 3BU2A 1PDXA 1J9OA 3S1NB 1HE8A 3FKYA 5JXVA 5JEAJ 1HTPA 2CU1A 1K83H 3HVZA 4DQOC 1QQRA 2AWOA 2PE6B 2IO0B 5M9OA 2WP8J 4ULLA 3S1RH 3D4RA 3DWPA 2A5UA 3ZRCA 4I6LB 2MP1A 5CTRC 2TMPA 4YCUA 1N33L 1NMGA 3L4PA 2GB1A 5JZEB 3RNEC 1WX8A 1GUNA 5M3FH 4AYBE 5EGTA 3R8BA 4BY7G 1DD2A 1EY7A 4DR7L 2IWHA 3RUIB 3HOXH 3H09A 4LLGM 3U30A 5IGGA 5FLMG 3S1QB 1TIFA 2J53A 1JROA 1MHXA 1KHIA 4DV3L 4GSWA 1P8LA 2B2UA 3PCOB 4M1UB 4YWMA 1WMHB 2C9WB 2D3BA 2GMIC 3EHVA 2KO3A 3OTOQ 3K59A 1WXMA 4JLCA 3L9AX 2AUJD 1NSNS 1CM9A 2AKWB 4ALPA 4C3IB 3PRZA 2EKEC 3TREA 3ZNID 4BBNC 1L1OC 2K5NA 1L1OA 3GV3A 3I70A 4XQJA 1BF4A 2KFKB 4CQNA 3APFA 1Q1EA 3SDZA 4R4QA 2JA7H 5IP4D 1H9KA 4RGMA 5M5YH 2KX3A 3U2SC 2EJFC 3BYTB 1EQTA 4XT3B 2D2CC 3ECIA 3DDCB 1HTOA 4ZHOA 4Y7NH 1X55A 3I3CA 2K05A 3L2PA 2A4ZA 2V3PA 1ICWA 5I4DA 4GB9A 3RNCC 5C4XG 4QY7A 1U5KA 3E9SA 3DHIC 1J19A 3E0JA 2PNHA 1K8OA 1WCMG 4S3SA 2VQFQ 2CVRA 2PZTA 4QJFA 1L0WA 3TJPA 5JVG3 1ZXTA 3HOVB 2KQ7A 2L52A 4P74A 1GUWA 1FCLA 2KTFA 2V3NA 3S9WA 3M4OH 1TBEA 1WJ6A 3J81E 5D3IB 1E3PA 2OEOA 2F4IA 3HOXB 1IBMQ 4X62L 4L8JA 3GE8C 1C76A 3FPPA 5FO8B 5M3FG 2GVBA 1DXMA 3D3RA 1RAXA 4AQ7A 2V4LA 3H7PA 2M4NA 1PTOF 1YJNA 4WJQA 4KGTA 2VNUD 1XO3A 2D62A 3HOUB 4LJOB 1WZ3A 2PMZB 5F2DA 1JW9D 1E10A 4OONA 1XLQA 4RWSC 2EY6A 1B4OA 4ICUA 1TIID 1CMXB 4CHKA 4AYBG 1TS2A 3AE1B 3AU4A 4ZDVA 4C3JG 1YN4A 2JA7B 4HJGE 4XYCA 3EN2A 4H02A 4MN3A 1KFYB 1WRIA 2FE8A 2W82A 1JOQA 1GUTA 4KK7A 3HOZG 3TBLD 2XSCA 2NBFA 1NDDA 1F1HA 4K14A 1FEHA 4WJWA 2B8FA 2MBHA 4IUNA 3A54A 1FNVA 2LRWA 2B63H 1ZE3D 4IW0A 4FLHA 1O7YA 1TU2B 2OQ0A 4A3GG 1FIQA 3AN1A 1A6XA 2A19A 1V1PA 2KVMA 4LFBQ 3A7AB 1MG4A 4L23A 3DEOA 4P7IA 5EKIA 4A3LH 2KCCA 2R3ZA 1CJEA 5IAAC 4ARCA 5G3LF 3H6NA 5T1IA 1TWGH 3H8HA 1EU3A 3N1XC 4XWWA 1F52A 3ND8A 5I6YA 1CQFA 5IP9H 1Y8PB 2K50A 4GNXB 2AUKA 2JYTA 2IGGA 3KUZA 5C0XH 1JT8A 3SFDB 4HN7A 3C1EA 1UUPA 3BDLA 3J7ZC 3CF5A 3CCRA 5IOCA 3FPUB 1JMCA 4JQWC 2E6XA 5DPTA 2M1MA 2JA5H 4JI5L 1JRPA 3I63C 3L16A 3UDGA 4D2KA 4WQOB 1R4QB 2P5ZX 3PUZA 2K22A 3WAMA 3V2TA 2K1FA 1P7FA 4FXGC 2QIEB 5EE9A 2ASBA 4WIPA 1S4ZA 4GDKA 4IFDG 4K81A 3DM3A 3R7QA 3VR3A 3KH0A 4CJ1B 3OWFA 4FHJA 4MHEA 3KF8A 1Q5WB 4IM2A 1I4RA 4LNNA 1Q7YC 2NZHA 2YVCA 3W3AA 2ACZB 4KKUA 3E56A 1ENFA 1PZKD 1WFQA 3MA2B 3KJPA 2KMCA 2WU2B 4BAXA 2MJEA 2L0FA 1MBYA 2OTJA 1VQ9A 1L5PA 3K7UC 2H1EA 4MZ9A 1Y8RC 2QGQA 1YJJA 3IFWB 3RD2A 2JA6H 3SFEB 1L4DB 3HHMA 5G5HA 4B9KA 3DHHC 1M1KC 1YNNC 2CWAA 2Y5CA 4YCVA 2GI9A 1SE2A 4EE2A 4J6IA 5GROA 4UP7A 1GG3A 1Z47A 1FYCA 3N52A 3TRZA 4MTKA 3CXCA 2B63G 1BCPC 3QIJA 4IOCA 2ALYB 3HOYB 1NNXA 1TWGB 3VR8B 3MXNA 4PYZA 1GUSA 5KIXA 1IBLQ 1JWSD 5JJLA 3MFYA 3K57A 1D5XC 1LTLA 4G7ZC 2G9HD 3EROA 5FLXE 4WORA 3HKSA 2JA5B 1FRDA 4E74A 2EJMA 1JICA 3L7ZC 4N8X1 1C4PA 1PVOA 2BE5D 1ZW7A 4LDTB 4LCDE 3ZXVA 4N9TA 1Y56A 2LVOA 3SDLC 1CKOA 2C5CA 3AFPA 2E3TA 5BN3A 2DY7A 2M8SA 4DUZQ 1FCCC 4F8MA 4NAMA 2XK5B 3K6OA 1A70A 4L2YA 3ZUNA 1SE4A 4RA8A 2JF5A 2I5LX 4RGOS 1NCVA 1S1QB 1XLOA 2ZTDA 2B2YC 3OWEB 2B2YA 4J1MA 1RIPA 1OEYJ 2KAJA 2J0MA 1D1IA 2BW2A 3VTVA 1I7HA 1EWCA 5C3XA 1WXAA 4EX5A 4G11A 4HJ5A 3SU8X 5IYDG 3K80C 1RDPD 2JA6B 2D07B 4ZCKA 4H0LC 4IM3A 3G4SA 4TKOB 5CV9A 3JYUA 1S5CD 3T4AC 4B3RQ 1T0SC 1KDBA 3EBEA 2PKOA 3S2AA 2JU6X 4UY8C 1CHPD 1UWMA 1UE6A 1J7AA 1J8IA 3GTQH 5EPJA 1SNOA 4JIOU 4PMBA 2XRSD 4GOPA 1FXAA 2BGFA 2C5LC 2Z6BA 2LGIA 2FBWB 3IAS1 4AWJA 1TWHH 2ZPNA 2A6HC 4Q0FA 4M0WA 3CQZH 1I4GA 4BA1I 1QUQA 4P72A 2BE5C 4DV6L 2NVXH 1PRTB 5C44B 3J81i 2IBIB 4YT0B 1J8CA 4UHVA 2BWES 1PGBA 2CFMA 2K04A 2JRHA 2XBBC 2GA4B 5J18A 3W1GA 2F0QA 4C2MH 1T6BX 3V3XA 1TS5A 2VUMB 2YYZA 3PO2B 2LVPA 5FR6A 3ALBA 3I9V1 1U4RA 2QA4A 2I2YA 2H4OA 3JAME 2HTME 3E0EA 4Y52H 1Y1VH 3S15H 2LFIA 3KUPA 5C0XI 2R61A 2XN9C 1JQ4A 1N36L 3AEAB 3H15A 4MJSA 4IDIA 2Y0SE 5JJZA 3IAYA 1UBQA 2PQAB 4FJYA 2OXPA 2V4DA 3W5VB 2ZEQA 1WYGA 4BKGA 4ARIA 2AWNA 1LV9A 3IL8A 5JEAG 4WJ3M 3SEBA 2MP2B 4DNRB 5ELEA 1EQRA 1XMQQ 1WE7A 2ZJQA 4ME5A 4XDCA 1G8ZD 2D5GA 3VR4A 4A3OA 4HEA1 4E6IA 4TKNA 4NB3A 2LEKA 3T1HL 5FO7B 5T1GA 1KF6B 3GTQB 1YQ3B 1MHWC 1RHPA 2NZ1D 3VTUA 3F1ZA 4TVAB 1HNWL 3PO3H 3Q23A 2Z6KC 1VQ5A 3PPAA 2X6GA 2Z6KA 3TZDA 1WY8A 4YL8A 1I4PA 3CQZB 4BBRB 1STGA 1WTOA 1E8WA 2IO2B 2NVXB 3AH7A 2DGYA 1MD2D 1OGWA 3S14H 2F0OA 2N9EB 2KHSA 3PIO3 3I57A 3BZKA 5A2QE 2G3QB 2R93B 1L4ZB 5ELBA 1R9TB 1HA6A 3PRPB 4M00A 2B8GA 4DAPA 1KAWA 5G3LD 2HE7A 4A93B 4R1JA 4C2MB 2RDGA 4A3BH 2C9OA 2CJNA 3J7A5 2ZVOA 3SD5A 2KDMA 1LM8B 4ABNA 3J81j 1J7CA 1LQBA 2F0DA 2KWUB 2QMTA 1MSHA 4HSPA 4ID6A 4HCSA 4DAVA 1AYFA 3UI3A 1E1OA 3MTNB 3ML9A 1AFPA 3S15B 3EVQA 1P7EA 2EOTA 4EKUA 4JI6Q 5EBCA 4DFAA 3H3VC 3LYYA 4R4CA 1JE4A 4B08A 1A15A 1EYCA 4KSLC 4KHVA 1FNUA 2F0HA 4A3JH 2FMMA 1EWYC 5G5GA 1NVID 1WXVA 2WXGA 4IALA 3M63B 2PQEA 4YTMB 4P6VF 4FF3A 1N33Q 1TZOA 4MM3B 3RFZB 5H1SE 4F87A 3A33B 2EE1A 3NG0A 1E24A 2MJDA 1VZ7A 1YNJC 4RFBA 4DR7Q 1L7YA 4NY0A 3FVQA 5FO9B 2MQHA 2K33A 1EY5A 1WTPA 4W9DA 3UQBA 2JK8A 4DV3Q 2ZCBA 4MNOA 1Y1WG 3T51B 3BJUA 2B3GA 2KHJA 3NTHA 2N9KA 4XIGS 1QB5D 1V9JA 3OJ3A 3JC66 3OOCA 1IW7D 3Q3JA 2KK8A 1AE3A 1YVCA 4RMAA 2O6VB 3H0GG 1C1YB 4BKSD 5IYBH 4A3BB 1FRRA 3A8JE 3PQIA 4X3SA 2RA4A 2MPMA 1CQVA 2HDEA 4NXMQ 2D0PA 4BOSC 3A8IE 1K0RA 3AMUA 1OQYA 4DXFA 2DUDA 3S1MH 3K0YA 3DLLA 3I4MB 2KDFB 3BIID 2JX5A 1XNRL 1V80A 2BVCA 4BXXG 4A3JB 4A3IH 1D6EC 1SFOH 4FXDA 2JQRB 3T1YL 1JWAD 1SNQA 2B39A 2VZKD 3GB1A 3KYCD 2KOXA 4DKAC 3BDCA 2Z8LA 3KLWA 4A4IA 3U7ZA 1WRDB 1IYFA 2KTRA 3NBIA 1KL9A 2A74C 3ZJTA 1EYDA 2IL8A 1M4VA 1ZXHA 5KYIA 1TWCB 3NJTA 3K9OB 1T5EA 5I2XA 1C78A 3ZW3A 4X62Q 3WIMA 1IW7C 1WM3A 4HPLB 4OWWB 4DV7Q 3N1YC 2KX0A 5AZGA 4C4VB 4JI0L 4DUYL 3PUXA 5HKHA 3AU5A 4IWOA 2JZZA 3KLSX 3NBHA 3IAM1 4AH6A 3MXUA 2NN6H 3FAHA 4HJ8A 2IX0A 2WB1E 3DWMA 3D31A 1SBBB 5AJ3L 4DHZB 1PH8A 2WKCA 2K39A 5G55A 2XIWA 1VQAA 3K5NA 1DOYA 4GLAC 4N58A 5KHOA 1JJCB 2HIVA 1YHBA 4X3TA 4J8QA 2MHJA 4MIUA 1KRSA 1NUCA 4UAIA 2IHEA 3Q24A 2OTLA 4QCLA 2KWDA 3EGRA 2INDC 3WALA 3V05A 1C8CA 1PTOH 4JCVE 1ESRA 4X57B 3UI2A 4DNIA 4KGSA 5DCNA 4BBSH 4OWXB 3PREA 3FKIB 1XF5L 3Q8BA 4HCPB 5ISRA 5KYLA 4LUOA 4A3EH 3AEEB 2XVSA 1ZKOA 1VCBA 4ZRQA 2PZUA 4KKTA 1TVXA 3NY5A 1LUZA 5EKKA 4US9A 3TBIB 4A3IB 2D9UA 2JA9A 5C3EB 4HPMB 1CK1A 2K5QA 1XCQL 3V6EB 4IWPA 4A55A 1Y8OB 5DM73 1ZXIA 3RZOH 3C8YA 1VZ8A 2IW3A 1D8LA 1A5RA 1WXQA 2HD3A 1QOAA 3CU7A 1U4MA 2F0SA 3MXPA 2JE6I 2N1VA 2MUYA 3EFUA 3AE3B 3M3YB 1RJTA 3MJ5A 4K7UA 1I3QB 2K32A 1SB3C 3VUXA 5M3MH 4YTPB 1YJIA 2DN8A 4BY1H 4JI5Q 3BK1A 2NBVB 3H7SA 2GN5A 2G5DA 3OMGA 1XMOL 2KC1A 5J1ZA 1F9JA 3TIXA 4BBNF 1AE2A 2IPKD 3OPOA 2DX5B 5L95C 1A63A 1QILA 3UDFA 4L1BA 1NAPA 1TR5A 1YEZA 2ZM6Q 1VQPA 1HQMC 1C79A 3RT3B 1X3PA 3BVZA 3H6MA 2HD5B 4BWGB 2O2VB 2NVQH 3DM1A 1WMHA 1RWSA 2JA8G 4FJVB 3E6ZX 2WDVB 1LTRD 4MACA 2I5MX 1EEFD 4H7BA 3N30A 2OEDA 1PTOB 3DVGX 4ZK9B 4CYEA 2ID0A 4HIKA 1R4NI 4J6HA 5IIFA 4NJ6A 3QJZA 1FD7D 2M00A 4DDGD 2KFKA 4XYOA 2K4KA 4KN7C 4PQXA 3QWZB 4A3EB 1Q3LA 5AUIA 3G7LA 2WB1G 4R4IA 3BDOA 1WGRA 3RYTA 3HVDA 3DWAA 4BBSG 1EQVA 1HEZE 5C1ZA 4WJPA 1JWMD 2VRRB 5KNDA 3SHQA 4JK1C 2A8VA 2WDRB 4R8NA 5NUCA 5HHDG 3QCAA 4IUVA 1BBUA 3LX0A 3NWTA 4N9PA 3OIPA 2NCNA 2LASA 4NDXA 1NYQA 4WWOA 1HZ9A 3A55A 1K8GA 4FXKC 4LNFA 4JV5L 2DWQA 4LMQD 1KNAA 3CD6A 5BMGA 1EF5A 5AUKA 4FADA 3IT4B 1G6PA 4ZRPA 2YU9B 3ND9A 4BZAA 5IGEA 2D0OA 4RMFA 4BY1B 2LKVA 1MKHA 4B9XA 5TR5A 4DV1L 1EFID 4W9LA 1GJXA 3T8MA 3VFKA 3HFZB 2L15A 5MPOA 3C2PA 2PO4A 5M3MG 5LNK1 2Z0SA 1DOLA 1E2WA 2LFNA 1GPXA 2SEBD 5I2YA 3V61A 4OXPA 1I4QA 4YHHL 2JZPA 3AI5A 2MLBA 4R4OA 2BT6A 3HM6X 4POFA 1UAPA 4EGVA 2E2HB 4HK2A 2KCTA 2MO1A 2XWJB 2Z4HA 1ESFA 2K8BA 3ZYYX 3BG3A 3DUZA 3NE5B 1P1AA 1FVIA 2NN6I 1WD0A 1A3TA 2EQSA 2KEEA 2PCFB 1AZQA 3BK2A 4MELA 2R7ZH 2RD0A 3V6CB 1UWVA 1V8QA 2KZRA 2WXPA 4CDEC 2RPVA 2VH1A 1K8RB 2MA9B 1KH0A 2PNRC 3Q8AA 3PT2B 1V5TA 3R93A 1FR3A 4FN2A 4JI4L 4DF7A 3I5JC 1KLUD 4KKIA 3LDZE 4LNKA 5HGQA 4OHJA 3S17B 4A3FB 1K50A 3M62B 1WYDA 3U50C 1IGCA 3UE0A 4LNOA 1KD1C 4DV6Q 4C1NK 1Q12A 4HWIB 1VLBA 4MGKE 3PHWB 3TEXA 5HG2A 4A3DB 4B3TL 2PPBC 3T9LA 2JXXA 1E1TA 1TKWB 1CHQD 1XTDA 1QLBB 5E6JA 2VS1A 3K5OA 1KQSA 3P1HA 1HXYD 1X3QA 3DVNV 4C3HB 4ZYNA 1KLVA 1PUTA 1VZ6A 1QVGA 3GD7A 4YSXB 2EPBA 3FILB 4GNXC 4BY7H 2DAFA 5C4JH 4GNXA 3WOFA 1YN3A 2MBOA 2KDEB 2JXMB 2LWPA 5FLMH 1DOMA 4WJNA 3NOBA 1ZOYB 4GOCA 1FXIA 4QGUA 2GRIA 1FJGQ 4UDUC 1TKEA 2WXMA 3RN9C 4PMCA 3J7AF 3E5SA 3CSFA 1EY6A 4CKCA 2RDFA 5DPWA 2EYPA 3HKZB 5IGDA 5JHAA 3SVMA 3UQAA 4EQ5A 1DOXA 1PQSA 1B9NA 2AL3A 3APDA 3J9CA 3LWEA 3VAWA 2ZTEA 2DJFC 5EE3A 3P20A 5C3WA 1RYJA 2WAQG 1E9MA 3G6JB 1H9RA 3TZUA 3X3MA 4J3OD 1X54A 4KN4C 3T1HQ 1ZPSA 4OELB 5D14A 1BCPF 2R7ZG 1J7BA 1N60A 1JMLA 3GS2A 3C19A 3FHWA 1HNWQ 2GOWA 4LJPB 4ZUJA 3GTMH 1HUMA 4LUZA 2G1EA 4WAAA 1Q10A 1HJPA 1DGSA 1STEA 2EY2A 4IN3A 1WTVA 3D4DA 2VB2X 3N6RA 4NNJB 5CBEE 3I7FA 3I4NH 1PFSA 5C4XH 4X66L 2E2DC 1AEXA 1SN8A 1G51A 5KNCA 1UEBA 1UE1A 2SNSA 4A3KG 5C4HA 1SYGA 1WCMH 2ZXOA 3EQLC 1N5WA 1EY9A 3KWVA 3N32A 4KX6B 4HJKA 4AS1A 4K7WA 4XX5A 3VR2A 2BYEA 1WFYA 1CKNB 4XE0A 4HJ7A 1EL0A 2YV5A 2UXDL 3I56A 4BY7B 5C4JB 1EIHA 1TWFB 5CMDA 2J7QB 3IVFA 1YNXA 4XQQA 1PH5A 1XPOA 3S2HB 2K28A 3SK8A 3J80c 4O42A 1KOTA 4YWLA 3D6WA 2C35B 1EZ8A 1PRTD 1Q1OA 1DONA 3GE3C 1XLPA 5HFYA 4U68A 3VA7A 4KIKB 2B2UC 2BYFA 1SEBD 2XK5A 1SE9A 2A69C 4JBWA 3TL5A 5IGFA 3K5MA 4C3JH 2I0QA 3GOEA 3EA6A 1B1ZA 1SJED 2IO3B 1K3RA 1K53A 1BR9A 5EQ0A 4M01A 2VQEL 3HOZH 1F9SA 4BVUC 4W9JA 2MNAA 4P1BC 1PA6A 2UUAL 3CCVA 2ZJDA 3ZNZB 4GLVB 3NRZA 3PZ7A 2L1AA 3K9PB 1EEID 3P42A 1EWIA 4TUUA 1OXVA 4OIKA 3AMZA 1IXRA 2ICIA 2FUG1 3WOEA 4A3GH 4WRDA 1K83B 5CR3A 3WDNA 1HZ6A 3CCLA 2W9NA 4RF1A 3I4NG 5GADC 1LT3D 2IY0B 2F3IA 3K7AH 4L5SA 3C46A 3S1RB 1KIXA 2D2QA 3AEVA 1PRTC 4DAYB 1F9PA 3PUYA 1Q0WB 3RN2A 4LFCL 1X1MA 1R4MB 4GDLB 2FXQA 3MTSA 4DK0A 3IFTA 3HS0C 4KY7A 4QUFA 5M3FB 1VQIA 4DK5A 4JGHB 2FCSA 1G291 3BZCA 1EYAA 1XNRQ 3SE0A 1BVSA 1HH2P 2O4XA 2M9VA 3J80L 1V5OA 4RM9A 4YSYB 1K28A 1WZ0A 2HHHL 2QCZA 3T1YQ 1K52A 4IFDH 1WR1A 2KN5A 1G2SA 4LFAQ 1YQ4B 2OF1A 1SDFA 4A76A 4C3JB 1IYVA 1H9SB 1OTRB 2UUCL 4IOAA 2N7JA 2X38A 3B08A 1F2YA 4OZAA 2PQAA 2KQ4X 1RL2A 2INCC 2L5TA 1GUAB 3RNAC 3W1YA 2LXAA 2OT2A 4LF8L 3HOZB 2JZ3B 5CV6A 2WXJA 1HQRD 1TY0A 1T0QC 1PYWD 3CSTA 2F0LA 2MP2A 2H5XA 4MEMA 3CC7A 5LMNL 5M5YB 3IRBA 2CQOA 5EKLA 2MHVA 4LF4Q 4DK3C 3MXGA 4LWCA 1N32L 4GIVA 4REZA 1EY0A 5BR8L 2IGHA 2AHOB 3A56A 4JI1L 3GTGH 3U58A 4A3GB 4Y7NB 3C3LA 4XQNA 5AJ3Q 1V86A 2K6QA 2X8XX 3O65B 4K1RB 3PSIA 4YCWA 5C4ZA 3K7AB 2O5JC 1LGRA 3KWLA 3F8TA 4TSSA 4XT1B 1W2BA 4DR3Q 4KJOA 1GKHA 2YLMA 3HOUG 1LFDA 2E8GA 5ELCA 3L08A 2J0TD 2Q2UA 4JI3Q 1Y69U 2IT1A 2N88A 3ZO5B 4IOIE 5CYUA 3TP8A 2JYEA 4GN3B 2FCNA 3O13A 3MEHA 3M4OB 2GBNA 2L00B 2G45B 2F3WA 4OL7A 3PV1A 3UGBB 2NVYH 4G0NB 3V62A 2RHQB 4HDQA 2N3SA 1F2RI 1WTHA 3CMAA 4GN1A 4KLKA 4NKLA 4UP8A 4QL5A 2O6VD 5EE1A 1EUJA 1TKYA 2VZAA 3MWYW 3TEYA 3M7NA 1R4MI 5IWAQ 4GKKL 2H89B 2PEAA 2N1WA 4LNQA 2LI5A 4NQKE 3Q14C 5BYQA 1CFMA 1HR0L 2UXCL 2F3VA 3PMFA 3DEPA 3NQTA 2JEBI 1GHKA 3A9KB 3I3TB 5IYDH 3ITPA 4ZRIA 2FAZA 1TJEA 3RCZA 4MT5A 1OQQA 2I5HA 4LF9Q 3B6YA 1E2ZA 1XMOQ 1W3SA 1HHVA 2J0KA 4MM3A 2UXBL 2FCMA 1YI2A 3SR6A 3Q22A 4G50A 1UWXA 1JWUD 2KA7A 4HAEA 4JPSA 3DCGA 1OXSC 3GTGB 4EZLA 1LYLA 3GTJH 3NVZA 1SSNA 1C3TA 4YXDB 2QF7A 1WJ4A 2N9LA 2B63B 4IO9A 1G91A 1PFBA 4HXDA 1IL2A 3PLUA 3A7LA 1X9NA 4P16A 1BUVT 3X0WA 1HRJA 2JUOA 4DR2L 4K3CA 4RM8A 4P73A 1PDQA 1Q81C 5EAYA 1S5DD 5CBAE 1G2TA 1MHHE 3NK9A 4E71A 5J2RA 4E3CA 1WVLA 2B2VC 2PYKA 3D0FA 2B2VA 4ZRZA 1IYJB 1CKMA 5C23A 1SYDA 3M4PA 2ZPYA 1O7IA 2F0FA 1XNQQ 3PF5A 4JE3B 2NVYB 4F7ZA 1E7ZA 3SHLA 3TP7A 2WXQA 2K6AA 1QOBA 3DXJC 3V60A 2GLSA 1WGHA 5J17A 3RUZA 1RTOA 4M8MA 1BXTA 4LUVA 4CO7A 1WYWB 4WURA 5HGTA 3RPFC 4KV6A 4NPSA 2FIDA 1J6QA 3M7GA 3R7RA 1HTLD 4JV5Q 4XTCS 4A3MG 1XD3B 2PE9A 4LF7L 1NI3A 1Z9FA 3N9YC 3P4PB 1UH6A 3H94A 2D3AA 3FMCA 2KDIA 2F0WA 4HKZE 1AW7A 5JEAH 1PGAA 4A3CG 4IFDI 4AJYB 5ELFA 1WGDA 3KQ4A 2XWBB 1NENB 3R2TA 3BZDB 2F0KA 2R6GA 4KY5A 3SK6A 2WHIA 4WJOA 4CDFC 2WLBA 3RR5A 4DV5L 2BS3B 3GTJB 4OZCA 2LSSA 3OHXC 2HUGA 2MEKA 2N4FA 3Q3FA 1LT4D 3R3MA 2PW9A 1B70B 4W9KA 3IFDA 3SXHA 1BBXC 4C4VA 3PIOA 2N9PC 1ILQA 3CCSA 4DNTB 4MTNA 3K81C 4GOPC 2M0XA 1CA5A 1TTNA 2Z9HA 1GB1A 2YTVA 3UIOB 2PI2A 3I73A 3MEFA 4RCNA 3ABVB 2K03A 2JRIB 4FJZA 1V9PA 2K14A 4ZQ3A 1WI0A 2F4VL 3VR5A 3A8KE 1WR6E 4JI4Q 1E5WA 4X3UA 2BH8A 4CJ0B 4N8FA 3LWUA 1PYSB 4B3ML 2O5IC 2UU9L 2FJ2A 2W54A 4A3PA 3KVFB 1JCKB 4B9WA 2FIFA 2WXFA 3QX1A 4TMAB 3ERQA 1VQ7A 2SOBA 5EJWA 4B95A 1PTOD 5E1FA 3P75A 1PFNA 1LO5D 1C9OA 5LL6X 2IZVB 2L05A 3BY4B 4C7YA 3WAPA 2MBQA 2EDGA 3P7JA 2MFIA 3OSOA 4W9GA 4GLXA 3P4RB 2F0NA 1B8AA 3HGBA 2D11A 3D8GA 5FR3A 1XXGA 2LXCA 1XEEA 3PRMB 4DR5L 2E5LL 3NZSA 1SRUA 1C9FA 4WJ4A 3GTLH 1FD6A 1FGBD 5IGBA 3VRAB 2L11A 3E3XA 2A73B 4FYDA 2PZWA 2K7VA 3NXWA 3PUVA 4NXNL 4GKJL 2CU3A 2EELA 4ZHPA 3NTKA 4R9WA 3H7PB 3MHSD 4EEWA 2ON8A 4GMVA 1Y1WH 3A9JB 3AQQA 4UPAA 2VUMG 3PO2G 4USAA 4FA6A 1WTWA 3Q3NC 3GTOH 4CKEA 1TWHB 2XRQD 5HY6A 4S0RA 1EIYB 2V0GA 4IPCA 5K36G 3PHXB 1EOTA 3H0GH 2X6LA 3RMKC 4B3SL 1OXUA 1Z6HA 1TS4A 1WGGA 2RDBC 5DNFA 3CRKC 2O2VA 3I55A 1XPRA 3AE7B 4BOZB 2JWZA 2IX1A 5C3JB 2JP1A 1WE6A 1EU4A 3QJYA 2KXJA 3U4EG 1GC6A 2PIAA 2ZXRA 5DPRA 2C60A 1STHA 2R7FA 3GZNI 3K0XA 4CGYB 1UE7A 4KZCA 4EFOA 2RQXA 3S24A 4JL9A 2NB0A 4MGIE 1D1KA 2A6ED 1Y1VB 4LK1C 2J4XA 4BXXH 1NBFC 3QOJA 2X69A 1YJWA 1LTAD 3I91A 5I9PA 2VW9A 1S5FD 2ZT9C 1RLFA 2R2QA 3DQVA 2BS4B 3PGEA 2CW0D 1SAPA 3CPFA 4K0KL 1VQEA 3DHGC 1ISNA 5EPKA 3M9BA 1A2UA 4LK0M 2JYOA 1OO9B 3UINB 1JJ2A 4PYUA 1SNPA 2UXDQ 1VQ4A 1Y14B 5CHWA 3NENA 4B0EA 1IBXB 2F0GA 1GUGA 2NTTA 3MFGA 4PK1A 4FP5D 3KFUA 2R93G 2LS01 1KDCA 1SMYD 2DZIA 2WINB 5C6AA 4A93G 5IY0A 5D65A 3M85A 2K75A 1C4QA 1TWAH 2HJ8A 1SYFA 3B2GA 3NHEB 1N5XA 2Y0SG 3GDEA 4JI2L 3PO3B 3W1SA 2MGSA 3W1SC 4JOIA 3F2DA 2L3ZA 2VXWA 3PLVA 1SE8A 1DZ1A 3H0GB 3B1LX 1YIJA 2JEAI 2Z4IA 3S14B 3CKIB 3U52E 4RCOA 3DMUA 1VR9A 5KGUA 1JC7A 3F2CA 3VYRA 1MI2A 4M8NA 2A6EC 4K5VA 1A62A 1DCZA 4CKBA 2NWGA 1H9MA 4BKTA 4YSZB 3AFQA 4QUCA 2PI2E 2MJ8A 2ZNVC 2CW0C 2F0EA 3KK7A 4RAUC 4FDBA 1JRUA 4QIWB 2UU7A 3PSEB 4DHZE 2MCNB 2L4NA 1F77A 2KLGA 3I4OA 2DZMA 1VJKA 4K5XA 2C7HA 2VY3A 2BDOA 3D4WA 2NR2A 1Y8NB 4X65L 1BCPB 1C48A 2EJGC 4ZAIA 4EZJA 1FFVA 2V1YA 1MVKA 3U7DA 1PLFA 4K2KA 4A20A 3ZGZA 3PV0A 2KJRA 1K0SA 5E7NA 1JR0D 1C4AA 4ZUIA 2YEPF 4R8IA 3A5UA 3C0RB 4MSQB 5IE8A 2MSED 3Q3MC 4F1SA 1HTQA 5EBDA 5CX3A 2J52A 1XX8A 3EUB2 1TWAB 1D4BA 1QOGA 5IT9c 1MFWA 1WJUA 1HCZA 2N49A 2HHHQ 4WAFA 1KAAA 3FILA 2KWCA 5T8IA 1J0GA 1IBML 1SROA 1YJ9A 1Q82C 3ZVVA 4BKSA 1XPUA 3AULA 2BPSA 4A90A 2VH2A 2UUCQ 1R4NB 3I4MG 5CHFA 4DV2L 1KNEA 2JA8H 1WX7A 4OWTB 4RH6A 1ILPA 4FF1A 3N20C 1PYBA 1I50H 4LF8Q 4BFRA 2KD0A 4JC0A 1D7QA 1U4LA 3LB8C 5E6NA 3VRBB 3Q2AC 4FF4A 1WF9A 5LMNQ 3ZJVA 2HJ1A 4RHSA 1IUEA 2K8CA 2L0TA 2WACA 1GAQB 3AEFB 3H9DA 3JAMi 3L0OA 1SYEA 4HIDA 2LHEA 1N32Q 4KHPL 1SJHD 2RSNA 2KBNA 4MGYE 2FCQA 5DAUA 5BR8Q 2L76A 3ULJA 1PV4A 2NVTH 3S1MB 1VQJA 1NI2A 1R7SA 3J7YW 1SYCA 1M90C 1TKGA 1V1QA 2EXZA 1SNMA 2DZKA 2QEJC 1CUKA 2VB3X 4JYAL 2V4IB 3VYTA 1FXTB 3HOWG 1SFOB 1QUQB 1B3QA 2KJHB 4MGZE 3AECB 2M56B 3CF6E 4F7XA 1MIUA 3ZTDA 3PZ8A 4DPGA 1QZHA 1O7ZA 2WXKA 3AEBB 1VQNA 1AARA 3A4SC 3MP9A 3MZ5A 1ZGUB 3NVYA 4JG2A 2E2IH 4DGZA 1RFKA 3CWIA 1STNA 4JI7L 5CV8A 2IHFA 4HJ9A 1NE3A 1YN5A 5IT9L 2BBCA 2EYOA 5JVH3 1F9QA 1YHQA 1YJ1A 4B0MA 1I42A 3QO2A 4RHRA 3H3VH 2DYMA 1KDAA 3CAMA 2WKDA 4GKKQ 1VF7A 1UZXB 1K8AC 3P2BA 4KKJA 2CHBD 1ENCA 4K5WA 3U4VA 2K3UA 2UXCQ 3P4QB 1YX5B 3ZQ4A 2I1JA 4OO1G 5ELNA 1BDOA 4F88A 5I9OA 4KIKA 2JT4B 1V81A 4QF4A 1XT9B 2DNEA 5K5PA 2UXBQ 1ROEA 4KJNA 3DPDA 2BB5A 3OLMD 4BBSB 5FOBB 3S16H 1E7UA 3W5OA 1PH7A 1FFUA 5I6WA 4P71A 4H13C 1S40A 1X3EA 3D6CA 2OJRA 3H1UA 4DHJB 4DR2Q 1KM7A 1FL0A 3CCEA 1H8CA 2K01A 1K8MA 3IBEA 3VH4B 3AB9A 2LY7A 3RZOB 4XGAB 5BN4A 1SF0A 4PT5A 5BO4B 3JSVB 2DYBA 1F2ZA 2PVGC 3LGJA 1IBKL 2DY8A 2JSOA 3BVGA 1WTRA 3R2IA 2K8HA 2Z0DB 4WH4A 2V1CC 3MAQA 2RSOA 1OXXK 2E2IB 3P63A 1I35A 2AWTA 2EY1A 3ER0A 5M3MB 5GAEC 1L2FA 2BQQA 5D2MB 3BS1A 4DAYA 1VQLA 3NELA 1BO0A 1I4XA 1VQOA 3QC8B 3VVWB 4GDLA 1TXYA 1O7LA 1KABA 2QCPX 3WANA 3MC9A 5AEKB 4YWKA 2E2JH 4IKGA 3GQBA 1WD1A 2RDHA 3TS2A 3A1QB 2LJ5A 1U9RA 1WJNA 4DK6C 4DR6L 3H91A 4LF7Q 4XYQA 2EZVA 3TS0A 4II3B 1GB4A 4DUZL 2LRUA 2NVQB 4LF5L 1E90A 3NUHB 3KJOA 5C2TB 2UYZB 1ET9A 1H9SA 1A8VA 4K6LA 3LNNA 4RG1A 5LMNW 1VQMA 1RRBA 2Y5BB 5D94A 3ZTCA 1VQKA 2L83A 5IYCH 4DV5Q 1JALA 4KDLB 3OMCA 4A9AA 4ANVA 4O1NA 5CV4A 2MBBB 4KHZA 2QC8A 1WXSA 3NQIA 1QZGA 1YNTE 3T56B 3NS8A 2F0UA 2OOBB 3HKZE 2F1MA 3NS1A 3VXWA 1YQBA 4W9EA 5IGCA 1SMXA 4L63B 1B9RA 1FO4A 3L13A 1QE6A 1UEAB 3HG9A 1MPEA 1XYIA 4XDXA 4YIJA 4A3KH 3PF4A 2BTEA 1WX9A 2DJGC 1E0ZA 3VUWA 3U8ZA 5E6PA 3KDFB 2WXRA 1QCBD 3MC8A 2ZXPA 4ZRJA 5LL6S 4IUUA 1K9MC 2F4VQ 1TT5B 1ZP0B 2PW5A 3DVNU 5C0XJ 5M5WH 5KEEA 4KGRA 5GAHC 1PMRA 2LJIA 1F2MA 2UU9Q 1H9JA 4X6AH 2KC2A 5M5XH 5G2NA 3PS6A 2W55A 2EKIA 2ZTCA 4FHKA 1N36Q 2A68D 1KJTA 3AEGB 3B9JA 2BYTA 1JB3A 1E0BA 5AZHA 2EYLA 2BB6A 1JE5A 1I94L 1E22A 4BS9A 2QHOA 4DR1L 4A3FG 2WAQB 3VDYA 3S1NH 1S3SG 2KTRB 3RNGC 4HPPA 1N8RC 3J81c 3NWSA 4POGA 3H3VI 3L3OC 5JPMC 2EYJA 4DR5Q 2E5LQ 4QAYA 3FEWX 2R7ZB 4K7SA 1X32A 4K2LA 1PHJA 3S2DH 4A3DG 3MJWA 4OW0A 4HVBA 3VR9B 3ZDTA 1SLJA 4GKJQ 3A9KA 4Q2JA 1QF6A 1P3QU 3QOLA 3ERSX 5IYCG 1XMQL 2RSUA 3RMHA 2LHDA 1UGJA 4C3HG 1YOVB 4NQLB 3BINA 2CR5A 3JVZX 2N55A 1LLRD 4A3KB 1FPYA 2BCOA 3S1QH 1UBIA 1DGJA 2JPHA 4PZ8A 3HUIA 3B2FA 2PMVA 4B3SQ 2NVUI 4W9IA 3CW2C 1L0YB 3SK4A 2NBWB 1ZYRD 1QWYA 1NY4A 3CP0A 1D3ZA 1PZID 5H8YE 5HURA 5BYRA 1X65A 2L8JA 2K25A 2Q8RE 5J22A 2R92G 2QJLA 2FFKB 2F0MA 2M2LA 1BQQT 1IL8A 1MJCA 1I4HA 4HCEA 1IYUA 3P1MA 1CTMA 2WYQA 5D6JB 5D3DA 1CZWA 2B29A 2OQKA 4R4TA 2Q8IB 3WWVA 4C1NI 4TQ0A 1EUVB 1YZ6A 4X64L 3CC2A 2INPE 2BKRB 4AIMA 3RNFC 1B9MA 3DWQA 2WXNA 1HUNA 1IZ6A 4G7OC 2ASQA 2LVQA 3TN2A 1RTNA 2O2LD 3J81L 1C0AA 4I6NB 4WWPA 3S2DB 5IOIA 1M94A 1K51A 3TCAA 4DV4L 3R3OA 4BA2I 2C7NB 3R66C 2CHWA 1SIJA 2DHZA 4HCNB 4OZBA 1E8XA 1YMHE 1LTSD 3HOVH 4NAWB 2BH2A 2PPHA 2B76B 3PIPA 1V49A 4ICVA 4P75A 1ZYRC 4JI2Q 4R3DA 4ZYSA 5J39A 3GTMB 1TZ1A 4IQZA 4OVUA 5GMVA 4A75A 2LGXA 1HNZL 2PMZE 5LLIA 3QARA 1EIGA 5DM63 2NBUA 2NMQA 1PH2A 4JBKA 3I4NB 1OQRA 1NR4A 5C4XB 4FO2A 2D3GA 4PS3A 3BVMA 4I7ZC 2J42A 2XGTA 1DM0B 1WCMB 2N8NA 5FJ8G 5E4WC 3HOUH 2K1BA 4QQBX 1Q8KA 1XTCD 2AL6A 2LGYA 3IXSA 3RZFA 2CKHB 2CH4W 3VA5A 1B53A 4W9HA 2HCCA 2WNMA 1U4AA 3T3NA 3ZRFA 2AYOB 4ZKCB 3QK0A 4KD3A 4C3IG 1V1OA 3SGIA 2W3SA 3CIRB 5IP7G 1A3UA 1PH1A 4DXGA 2N7EA 3GO5A 3EIVA 3KF6B 1QJOA 4NXML 1IKMA 4NP5A 2Z59B 3QA8A 4X65Q 2ES2A 1QVFA 3KLSA 1QT9A 4IJHA 3DBLI 5KNBA 1SYBA 1T0RC 2WX1A 2N78A 2WP9B 3V96A 3RNBC 1RODA 3HK0A 1Q46A 5FLXc 3DBHI 4AYBB 5LXIB 2JSVX 1EF1A 3Q8FA 4O0AA 1L0XB 3RLFA 3CMMB 5DEHA 1JB7A 2G4SA 4HLEA 1A2TA 5BMIA 2L12A 3ZKJC 2PW7A 4DU9A 3HRZC 5CV7A 5LMUL 4V0BA 1R4PB 1HNXL 1VD2A 1WH3A 4KTAA 4KSKC 2JY6A 4II2B 3Q8CA 3HOVG 4JI0Q 4DUYQ 2JXTA 1B2TA 2BS2B 3AU7A 3OW2A 2MX2A 4HR7B 4DV7L 2KACA 2JN4A 2Z0EB 1LT5D 1C77A 4HROA 3A0JA 3PIP3 3HOXG 4XWTA 4DV2Q 3A9JA 4CHTB 2L32A 2EMTA 4RKLA 2MH7A 4EQPA 1STYA 3TQYA 4GU2A 1QVCA 4GN5A 4KKSA 3F2UA 4DV0L 2D5DA 3CRLC 4FXCA 5D7GA 2CJOA 3RLOA 2DBYA 3DWGC 3VH3B 3FC4A 4PG3A 4KHPQ 2ZW1A 3W5UB 3HRDD 4PMWA 5EDSA 1CI3M 1JQYD 2GBMA 1LABA 1EM7A 2NS5A 3DBRB 3TP5A 2NZOA 1JORA 2KMAA 4JWUC 2JA7G 4C7ZA 2HQEA 5IODA 4JYAQ 2UWQA 1I6VC 4L5TA 2IX3A 3A4RA 4C80A 3UDIA 4X3KA 4A3MH 4L6TB 1ASYA 3QWNA 4N59A 1Z7TA 3ULPA 4GLSC 5IN7A 3W9CB 5JH5C 4AQYL 3WAOA 3P4SB 5FLXL 1GJZA 4IPDA 2RCNA 3FDTA 1XWEA 4AOFA 4A3CH 2IJ0A 3J80E 3QHTA 4MH8A 1YITA 3JAMc 1YNND 3HOYH 3I8ZA 5E6OA 4JI7Q 1UNSA 4OVZA 2RF4A 1IBXA 3M95A 5LHY1 1ACCA 3QB3A 1V8CA 1SXTA 2V9HA 1BCPD 4EOYA 4YTNB 2YEPB 3JW0X 2L7RA 2WDQB 2IYDB 2UUBL 2CCZA 1PH3A 2KT7A 3I2ZA 3KYHC 4APVA 2KN4A 2MQJA 3M3JA 1UF0A 4ANWA 1PXUA 1IP9A 1AH9A 3HP3A 2H88B 2ZM6L 1AP0A 2LUEA 2WIIB 1V2YA 3PVLA 4WQMA 2BOSA 3ZNHB 4AP4C 5C5MA 5AFWA 2KWVB 4EZKA 2WV6D 2GBRA 5A35A 1A0IA 1ET6A 3M4YA 2CHZA 4ILWA 2O6VA 1VMCA 2LMCB 2CH4A 1GVPA 5KRUA 1B50A 2NPTB 3Q69A 5CGKA 1CT1D 1BUIC 2HDMA 3MHZA 4JVZA 2J7ZA 3VYUA 2Q5WD 2WX0A 2EYFA
chains in the Genus database with same CATH topology
3MHBA 4A3MB 2MJ3A 4JWSC 1NYRA 4DN4M 2E76C 4GZYC 2HDLA 1RCVD 3EFXD 1FMAD 3AB5A 4DK1A 3TMEA 1F9RA 3U9SA 3JAML 4RNAA 1JOKA 1KTKA 1F2LA 2JWUA 4ODGA 4LAAA 3SR6A 2A6HD 3T16A 2QKIC 4EQNA 4EQOA 1N62A 3TSSA 2AX5A 4HTHA 2NTSA 5C0XG 1M8AA 1HFGA 4KY6A 2ONQA 3Q6SA 1SNDA 1IKLA 5K36H 2Y3AA 1CZGA 2I46A 5COYA 4KD4A 1VDVA 3EJIA 1N61A 2F03A 3ZJTA 2M0AA 4CBVA 1VDZA 3NVWA 1ZUD2 4DA2A 2FINB 1GXDC 4IZ8A 1S5ED 1STAA 4ZLTF 1ML0D 5A2QL 2ICEC 4EVOA 2N0SB 3BYYB 3Q0AA 2FHTA 1FNWA 4KI0A 3NVVA 2AQ2B 3W2DA 2B2WC 2B2WA 2AQ1B 1SE3A 4HEDA 1BNZA 3HZXA 4A6QA 1OFFA 1TYGB 5GXGB 1B3AA 3I72A 1O78A 1NEKB 3URYA 1VF5C 2PVOD 2RMMA 1RM6C 3NPPA 4IUQA 3X3NA 2DYOA 3AE9B 5ELDA 2ZW0A 2CQAA 1E2VA 2IDYA 1PFDA 1JOOA 2SAKA 3ETRA 1EY8A 3K58A 4HSVA 1U4PA 1PTOC 2A5HA 2F0JA 3U9OA 1BMLC 2NYZD 3GV6A 4LTUA 1NR2A 1II3A 5BN5A 5EE0A 4A8XC 3C1FA 3T3OA 1ZDXA 3AE4B 2ENBA 1F0ZA 4PV1C 1V1PB 1YNJD 2E74C 1WGKA 1WWTA 3SK5A 2EYHA 4IUPA 4FF2A 3GTLB 2KECA 2Y0SB 4I65A 2LUMA 1E6EB 1QNKA 2KEDA 1Y1WB 1GOZA 4FNFA 1MI0A 1ONLA 1CA6A 3GTOB 1QKZA 4GDKB 3TUOA 1ENAA 1B44D 4RKBA 2XNAC 3GTKB 4C56C 1AZPA 3T53B 1I6HB 2DNCA 5BYSA 2K9XA 3QG1A 2K5PA 2NUCA 1DOKA 1AWDA 3T13A 5BMHA 1KRHA 2F0IA 1QNUA 3PUWA 1WTXA 1LTTD 2QDBA 2F0TA 1VRAB 1S5BD 2KCNA 3ONAB 1XLNA 1LTGD 3I4LA 3LXFA 3GTPB 1OXTA 1SMYC 2G9DA 1CZPA 4WWMA 3IT6B 3NZ3A 1QOFA 2EVBA 2K5WA 1LACA 1L6UA 5FK9C 4RGTA 1A3VA 3MC0B 1DOIA 1FM0D 2SDFA 2L0CA 3J7AV 5EPLA 1HZ5A 4US8A 4WFN3 1IHZA 4OO1H 3MVVA 3FRPB 3AM9A 1ZDVA 2L55A 3NUCA 4V190 4ITKA 4G57A 3AE5B 1D5ZC 1G6ZA 4FVMA 4RGNA 3RZDB 1N63A 3K5LA 4H44C 2RKSA 3TDQA 1E7PB 2Y5PA 1ZEQX 1L0VB 4ZKBB 1IGDA 4G4KA 3HOWB 3AV8A 2WXIA 3RD4A 3Q8EA 1LTID 1TQOA 1QOHA 1QG7A 4TRDA 1HA5A 2W3RA 2AQ3B 4YWGG 2KUMA 1AN8A 2B2TC 2B2TA 4N6EB 1Q8IA 3OIQA 1Q1BA 1TT2A 1TY2A 1RD9D 2KOLA 4HRSA 1LT6D 3NSWA 2JA8B 3WCQA 1GHJA 2PTLA 1I50B 2OHFA 4NW2A 1V43A 2HCIA 5E3FA 5FKAC 4XDDA 2K0PA 1PZJD 2WB1B 2NVTB 1MGSA 1O80A 3VQIA 1XCTL 3GP7A 1PRTF 3ZJUA 4P2CB 4ZOHC 2EY5A 1V97A 2NN6G 5JPNC 3KBGA 1HFNA 4LJZC 4NZLB 1D2BA 2WQYB 5JOBA 1F2RC 4OGQC 2DLBA 3HEJA 4H2AA 3TEWA 1W6JA 2RVLA 2F0PA 3VR6A 4G7HC 4IURA 4IFDJ 1Q90A 2L9HA 2INNE 1EWHA 2WU5B 4KMUC 4OIJA 5C5LA 4PNYA 3AE2B 2IGDA 1SSOA 5IT9E 2FMCA 3TP6A 2RBMA 1C4CA 1STBA 1T5XD 2BA0A 3BWUD 2M19A 2KQ3A 2I38A 1VMPA 5HI1A 4OO1I 2WS3B 4XXEA 2WXOA 3S16B 2BA1A 5JAVA 4M8AA 4NJCA 4IUTA 3DHQA 3AE6B 1RKNA 4NMZA 1D5MC 3VYSA 3KBXA 5H92C 3QIAA 4HMIA 1TS3A 4K6DA 1JWBD 2E2JB 1LTBD 1W6KA 4K8IA 3AEDB 4Z9CB 4TQUS 2K5DA 5CV5A 4U673 2WXLA 2WXHA 5CC4A 4JX1C 2EYMA 3PO0A 3NHHA 5TSSA 3AE8B 1DJRD 3IKJA 2I07B 3SR1A 1EZ6A 1KLGD 3NTIA 3OW7A 4QMGA 1SNCA 4TQ1A 2TSSA 3NP8A 4CJ2C 2Z1CA 4HMJA 3I90A 5CORA 4HKQA 2KJXA 2BDNA 4K8JA 3TEZA 4QB4A 1PGXA 2PLPA 1DYQA 2QILA 1L6VA 2QSDA 2E75C 2R92B 1VCIA 5E4XA 1WTQA 1GUOA 2SNMA 5M5WB 2A68C 1HPCA 1EY4A 2VZKB 1BOSA 3CHBD 1RF2D 2F0VA 5M5XB 2L1BA 2A69D 3KLRA 2KMMA 2LMCA 1PFMA 1MSGA 1WSPA 2Q8TA 4Q5VA 1PDXA 1J9OA 3S1NB 5JXVA 5JEAJ 1HTPA 3HVZA 4DQOC 1QQRA 2AWOA 5M9OA 2WP8J 4ULLA 3D4RA 3DWPA 2MP1A 2TMPA 3L4PA 2GB1A 1GUNA 5EGTA 3R8BA 1DD2A 1EY7A 2IWHA 3H09A 4LLGM 5IGGA 3S1QB 2J53A 1JROA 1MHXA 2B2UA 4M1UB 3K59A 3L9AX 2AUJD 1NSNS 1CM9A 4C3IB 3GV3A 3I70A 4XQJA 1BF4A 4CQNA 1Q1EA 3SDZA 1H9KA 4RGMA 3U2SC 2EJFC 3BYTB 1EQTA 4XT3B 2D2CC 4ZHOA 3I3CA 2K05A 2V3PA 1ICWA 5I4DA 3E9SA 3E0JA 1K8OA 4S3SA 2CVRA 2PZTA 5JVG3 1ZXTA 3HOVB 2L52A 1GUWA 1FCLA 2V3NA 3S9WA 3J81E 5D3IB 2OEOA 2F4IA 3HOXB 4L8JA 1C76A 3FPPA 5FO8B 1DXMA 3D3RA 4AQ7A 1PTOF 4KGTA 2VNUD 1XO3A 2D62A 3HOUB 2PMZB 5F2DA 1JW9D 1E10A 1XLQA 4RWSC 2EY6A 1B4OA 1TIID 3AE1B 1TS2A 4C3JG 1YN4A 2JA7B 4HJGE 4MN3A 1KFYB 1WRIA 2FE8A 2W82A 1JOQA 1GUTA 4KK7A 2XSCA 2NBFA 4K14A 1FEHA 4WJWA 2B8FA 4IUNA 3A54A 1FNVA 1ZE3D 1O7YA 1TU2B 1FIQA 3AN1A 1A6XA 1V1PA 2KVMA 3A7AB 4L23A 3DEOA 5EKIA 1CJEA 2KCCA 2R3ZA 4ARCA 5G3LF 5T1IA 3H8HA 1EU3A 4XWWA 3ND8A 5I6YA 1CQFA 1Y8PB 3SFDB 2JYTA 2AUKA 2IGGA 5C0XH 4HN7A 3C1EA 1UUPA 3BDLA 5IOCA 3FPUB 2E6XA 4D2KA 1JRPA 1R4QB 3PUZA 2K22A 3V2TA 1P7FA 4FXGC 2QIEB 5EE9A 4WIPA 1S4ZA 4IFDG 3VR3A 4CJ1B 3OWFA 4MHEA 3KF8A 1I4RA 3W3AA 2ACZB 4KKUA 3E56A 1ENFA 1PZKD 2WU2B 3MA2B 2MJEA 1MBYA 1L5PA 2H1EA 1YJJA 3SFEB 1L4DB 5G5HA 1YNNC 2Y5CA 2GI9A 1SE2A 4EE2A 1Z47A 1FYCA 3N52A 1BCPC 3HOYB 3VR8B 1TWGB 3MXNA 1GUSA 5KIXA 1JWSD 3MFYA 3K57A 1D5XC 4G7ZC 2G9HD 3EROA 5FLXE 4WORA 2JA5B 1FRDA 2EJMA 1JICA 3L7ZC 1C4PA 2BE5D 4N9TA 1Y56A 2C5CA 2E3TA 5BN3A 2DY7A 1FCCC 4F8MA 4NAMA 3K6OA 1A70A 4L2YA 1SE4A 4RA8A 4RGOS 1NCVA 1XLOA 2B2YC 3OWEB 2B2YA 4J1MA 2KAJA 1D1IA 2BW2A 1I7HA 1EWCA 5C3XA 1RDPD 2JA6B 4H0LC 4TKOB 5CV9A 1S5CD 3T4AC 1KDBA 2PKOA 2JU6X 1CHPD 1UWMA 1J7AA 1J8IA 5EPJA 1SNOA 4PMBA 2XRSD 4RF0A 1FXAA 2LGIA 3IAS1 2FBWB 4M0WA 2A6HC 4Q0FA 1I4GA 4BA1I 2BE5C 1PRTB 5C44B 4YT0B 1PGBA 2K04A 2GA4B 2F0QA 1T6BX 3V3XA 1TS5A 2VUMB 2YYZA 3PO2B 3I9V1 1U4RA 2I2YA 2H4OA 3JAME 2HTME 2LFIA 3KUPA 5C0XI 2R61A 2XN9C 1JQ4A 3AEAB 4IDIA 5JJZA 3IAYA 2OXPA 2V4DA 3W5VB 1WYGA 4ARIA 2AWNA 1LV9A 3IL8A 5JEAG 3SEBA 4DNRB 5ELEA 4ME5A 4XDCA 1G8ZD 2D5GA 3VR4A 4HEA1 4E6IA 2LEKA 5FO7B 5T1GA 1KF6B 3GTQB 1YQ3B 1RHPA 2NZ1D 3Q23A 2X6GA 3TZDA 1I4PA 3CQZB 4BBRB 1STGA 1WTOA 2NVXB 3AH7A 1MD2D 2F0OA 2KHSA 3PIO3 3I57A 5A2QE 2R93B 1L4ZB 5ELBA 1R9TB 1HA6A 2B8GA 4DAPA 5G3LD 4A93B 4C2MB 2RDGA 2C9OA 2CJNA 2KDMA 4ABNA 2QMTA 1J7CA 2F0DA 1MSHA 4HSPA 4ID6A 4HCSA 4DAVA 1AYFA 3UI3A 1AFPA 3S15B 3EVQA 1P7EA 2EOTA 5EBCA 4DFAA 3H3VC 3LYYA 1JE4A 4B08A 1A15A 1EYCA 4KHVA 1FNUA 2F0HA 2FMMA 1EWYC 5G5GA 1NVID 2WXGA 4IALA 2PQEA 4YTMB 4P6VF 4FF3A 1TZOA 4MM3B 3RFZB 4F87A 2EE1A 2MJDA 1VZ7A 1YNJC 4RFBA 3FVQA 5FO9B 1WTPA 2K33A 1EY5A 3T51B 3NTHA 2N9KA 4XIGS 1QB5D 3OOCA 1IW7D 4A3BB 1FRRA 3A8JE 4X3SA 2RA4A 2MPMA 1CQVA 2HDEA 3A8IE 3AMUA 4DXFA 3K0YA 3I4MB 3BIID 2JX5A 4A3JB 4FXDA 1D6EC 2JQRB 1JWAD 1SNQA 2B39A 2VZKD 3GB1A 3BDCA 2Z8LA 3U7ZA 3NBIA 2A74C 1EYDA 2IL8A 1M4VA 1ZXHA 5KYIA 1TWCB 1T5EA 5I2XA 1C78A 1IW7C 3PUXA 3KLSX 3NBHA 3IAM1 3MXUA 2NN6H 3FAHA 2IX0A 3DWMA 3D31A 1SBBB 2WKCA 2XIWA 3K5NA 1DOYA 4N58A 4X3TA 4J8QA 4MIUA 1NUCA 4UAIA 3Q24A 4QCLA 3EGRA 1FO4A 2KWDA 3V05A 1C8CA 1PTOH 1ESRA 3UI2A 4KGSA 3FKIB 1XF5L 3Q8BA 5ISRA 5KYLA 3AEEB 4ZRQA 2XVSA 1ZKOA 2PZUA 4KKTA 1TVXA 4US9A 5EKKA 3TBIB 4A3IB 2D9UA 5C3EB 1CK1A 2K5QA 1XCQL 4A55A 1Y8OB 5DM73 1ZXIA 3C8YA 1VZ8A 2IW3A 1WXQA 1QOAA 3CU7A 1U4MA 2F0SA 3MXPA 2JE6I 2MUYA 3AE3B 3M3YB 1RJTA 3MJ5A 1I3QB 2K32A 1SB3C 4YTPB 1YJIA 2DN8A 3BK1A 3OMGA 5J1ZA 2IPKD 3OPOA 1QILA 4L1BA 1NAPA 1TR5A 1C79A 1HQMC 1X3PA 3BVZA 3H6MA 4BWGB 3DM1A 1RWSA 3E6ZX 2WDVB 1LTRD 4MACA 1EEFD 4H7BA 2OEDA 1PTOB 4ZK9B 2ID0A 5IIFA 4J6HA 1FD7D 2M00A 4XYOA 4KN7C 4PQXA 4A3EB 1Q3LA 5AUIA 3G7LA 3BDOA 3HVDA 3DWAA 1EQVA 1HEZE 1JWMD 5KNDA 4JK1C 2WDRB 4R8NA 5NUCA 5HHDG 4IUVA 3LX0A 3NWTA 4N9PA 3OIPA 4NDXA 1NYQA 3A55A 4FXKC 2DWQA 4LMQD 1KNAA 5BMGA 5AUKA 3IT4B 4ZRPA 2YU9B 3ND9A 5IGEA 4BY1B 2LKVA 4B9XA 1EFID 1GJXA 5MPOA 3C2PA 2PO4A 5LNK1 1DOLA 1E2WA 2LFNA 1GPXA 2SEBD 5I2YA 1I4QA 2JZPA 2BT6A 1UAPA 4EGVA 2E2HB 2XWJB 2Z4HA 1ESFA 3ZYYX 3BG3A 3DUZA 3NE5B 1T3QA 2NN6I 1WD0A 3BK2A 1A3TA 2PCFB 2KEEA 1AZQA 1V8QA 2WXPA 2RPVA 1KH0A 2PNRC 3Q8AA 3R93A 1FR3A 4DF7A 1KLUD 4KKIA 4OHJA 3S17B 4A3FB 1K50A 1IGCA 4C1NK 1Q12A 1VLBA 3TEXA 5HG2A 4A3DB 2PPBC 1TKWB 1CHQD 1QLBB 5E6JA 3K5OA 3P1HA 1HXYD 1X3QA 4C3HB 1PUTA 1VZ6A 3GD7A 4YSXB 2EPBA 3FILB 1YN3A 3WOFA 2JXMB 1DOMA 1ZOYB 1FXIA 2GRIA 4UDUC 1TKEA 2WXMA 4PMCA 3J7AF 3E5SA 1EY6A 4CKCA 2RDFA 2EYPA 3HKZB 5IGDA 3SVMA 1DOXA 1B9NA 3J9CA 3LWEA 5EE3A 3P20A 5C3WA 1RYJA 1E9MA 3G6JB 1H9RA 3TZUA 3X3MA 4J3OD 4KN4C 1ZPSA 5D14A 1BCPF 1J7BA 1N60A 1JMLA 3GS2A 4ZUJA 2G1EA 1HUMA 1Q10A 1STEA 2EY2A 1WTVA 4IN3A 3D4DA 2VB2X 3N6RA 5CBEE 2E2DC 1AEXA 5KNCA 2SNSA 5C4HA 1SYGA 2ZXOA 3EQLC 3KWVA 1N5WA 1EY9A 4KX6B 4AS1A 3VR2A 4XE0A 1EL0A 4BY7B 1EIHA 5C4JB 1TWFB 5CMDA 4XQQA 3S2HB 2K28A 3SK8A 4O42A 3D6WA 1EZ8A 1PRTD 1DONA 1XLPA 5HFYA 4U68A 3VA7A 2B2UC 1SEBD 2A69C 4JBWA 5IGFA 3K5MA 3EA6A 1B1ZA 1SJED 1K53A 1BR9A 5EQ0A 1F9SA 3NRZA 3PZ7A 2L1AA 1EEID 3P42A 1OXVA 4OIKA 3AMZA 2ICIA 2FUG1 3WOEA 4WRDA 1K83B 5CR3A 3WDNA 1HZ6A 4RF1A 1LT3D 3C46A 3S1RB 1PRTC 1F9PA 3PUYA 4GDLB 3MTSA 4DK0A 3IFTA 3HS0C 4KY7A 4QUFA 5M3FB 1G291 1EYAA 3SE0A 2O4XA 2M9VA 3J80L 4YSYB 1K52A 4IFDH 1G2SA 1YQ4B 2OF1A 1SDFA 1IYVA 4C3JB 2N7JA 1H9SB 4OZAA 2X38A 1F2YA 2KQ4X 2L5TA 2OT2A 3HOZB 2WXJA 5CV6A 1HQRD 1TY0A 1PYWD 2F0LA 5M5YB 5EKLA 2MHVA 3MXGA 4REZA 1EY0A 2IGHA 3A56A 4A3GB 4Y7NB 3C3LA 4XQNA 5C4ZA 3K7AB 2O5JC 3KWLA 4TSSA 4XT1B 4KJOA 5ELCA 2J0TD 1Y69U 2IT1A 2N88A 4IOIE 5CYUA 3TP8A 2JYEA 3O13A 3MEHA 3M4OB 2F3WA 4OL7A 1F2RI 4NKLA 5EE1A 1TKYA 3MWYW 3TEYA 3M7NA 2H89B 5BYQA 1CFMA 2F3VA 3PMFA 3DEPA 3NQTA 2JEBI 1GHKA 3ITPA 1TJEA 4MT5A 1OQQA 1E2ZA 1HHVA 3Q22A 1UWXA 1JWUD 2KA7A 4HAEA 4JPSA 1OXSC 3GTGB 3NVZA 1SSNA 4YXDB 2QF7A 2N9LA 2B63B 1G91A 1PFBA 4P16A 3A7LA 1BUVT 1HRJA 1PDQA 5CBAE 1S5DD 1MHHE 1G2TA 3NK9A 1WVLA 2B2VC 2PYKA 2B2VA 4ZRZA 1SYDA 2F0FA 4JE3B 2NVYB 3SHLA 3TP7A 2WXQA 2K6AA 1QOBA 3DXJC 3RUZA 1RTOA 1BXTA 4WURA 5HGTA 3RPFC 4KV6A 3M7GA 1HTLD 4XTCS 1NI3A 3N9YC 3P4PB 3H94A 3FMCA 4HKZE 2F0WA 1AW7A 5JEAH 1PGAA 4IFDI 5ELFA 3KQ4A 2XWBB 1NENB 3R2TA 3BZDB 2F0KA 2R6GA 4KY5A 3SK6A 2WLBA 2BS3B 3GTJB 4OZCA 3OHXC 2HUGA 2MEKA 1LT4D 2PW9A 3IFDA 3SXHA 1BBXC 1ILQA 4DNTB 1CA5A 1GB1A 3I73A 4RCNA 3ABVB 2K03A 4ZQ3A 3VR5A 3A8KE 4X3UA 4CJ0B 3LWUA 2O5IC 2FJ2A 2W54A 1JCKB 4B9WA 2WXFA 4TMAB 3ERQA 2SOBA 5EJWA 1PTOD 5E1FA 3P75A 1PFNA 1LO5D 5LL6X 4C7YA 2EDGA 3P7JA 3OSOA 3P4RB 2F0NA 3HGBA 5FR3A 3D8GA 1XXGA 1XEEA 1C9FA 1FD6A 5IGBA 1FGBD 3VRAB 2L11A 2A73B 4FYDA 2PZWA 2K7VA 3NXWA 3PUVA 2CU3A 2EELA 4ZHPA 3NTKA 4R9WA 2ON8A 4USAA 1WTWA 4CKEA 1TWHB 2XRQD 2V0GA 5K36G 1EOTA 2X6LA 1OXUA 1Z6HA 1TS4A 5DNFA 3CRKC 3AE7B 5C3JB 2IX1A 2JP1A 1EU4A 3QJYA 3U4EG 2PIAA 2ZXRA 1STHA 4CGYB 2RQXA 2NB0A 1D1KA 2A6ED 1Y1VB 4LK1C 2J4XA 3QOJA 2X69A 1LTAD 3I91A 5I9PA 1S5FD 2ZT9C 2BS4B 2CW0D 1SAPA 5EPKA 1A2UA 4LK0M 2JYOA 1OO9B 1SNPA 4B0EA 1IBXB 2F0GA 1GUGA 2NTTA 3MFGA 4FP5D 2LS01 1KDCA 1SMYD 2WINB 5C6AA 5D65A 3M85A 1C4QA 3B2GA 1SYFA 1N5XA 3W1SA 3PO3B 2MGSA 2VXWA 1DZ1A 3H0GB 2JEAI 2Z4IA 3S14B 3CKIB 3U52E 4RCOA 3DMUA 1VR9A 5KGUA 1JC7A 3VYRA 1MI2A 2A6EC 4K5VA 1DCZA 4CKBA 2NWGA 1H9MA 4YSZB 4QUCA 2MJ8A 2CW0C 2F0EA 3KK7A 4RAUC 4QIWB 2L4NA 1F77A 1VJKA 4K5XA 2BDOA 3D4WA 1Y8NB 1BCPB 1C48A 2EJGC 4ZAIA 1FFVA 1MVKA 3ZGZA 1PLFA 4K2KA 3PV0A 1JR0D 1C4AA 4ZUIA 2YEPF 4R8IA 5EBDA 2J52A 1XX8A 3EUB2 1TWAB 1D4BA 1QOGA 1HCZA 4WAFA 1KAAA 3FILA 5T8IA 4A90A 1KNEA 4RH6A 1ILPA 4FF1A 3VRBB 3LB8C 1U4LA 4FF4A 3ZJVA 4RHSA 1IUEA 2WACA 1GAQB 3AEFB 2LHEA 1SYEA 1SJHD 2RSNA 5DAUA 3S1MB 1R7SA 3J7YW 1SYCA 1TKGA 2EXZA 1SNMA 2QEJC 2VB3X 2V4IB 3VYTA 1SFOB 3AECB 2M56B 4F7XA 3PZ8A 1O7ZA 2WXKA 3AEBB 3MP9A 3MZ5A 3NVYA 4DGZA 1RFKA 3CWIA 1STNA 5CV8A 1YN5A 2BBCA 5IT9L 2EYOA 5JVH3 1F9QA 4B0MA 3QO2A 4RHRA 2DYMA 1KDAA 2WKDA 1VF7A 4KKJA 2CHBD 1ENCA 4K5WA 2K3UA 3P4QB 3ZQ4A 4OO1G 1BDOA 4F88A 5I9OA 4QF4A 2DNEA 5K5PA 1ROEA 4KJNA 2BB5A 4BBSB 5FOBB 1FFUA 5I6WA 4H13C 3D6CA 2K01A 1K8MA 3AB9A 2LY7A 3RZOB 5BN4A 1SF0A 4PT5A 1F2ZA 2PVGC 2DY8A 2JSOA 3BVGA 1WTRA 3R2IA 4WH4A 3MAQA 2RSOA 1OXXK 2E2IB 3P63A 2EY1A 5M3MB 3BS1A 4DAYA 1BO0A 1I4XA 1O7LA 1KABA 2QCPX 4IKGA 3GQBA 1WD1A 2RDHA 1U9RA 3H91A 4XYQA 2EZVA 1GB4A 2NVQB 3NUHB 5C2TB 1ET9A 1H9SA 4K6LA 3LNNA 2L83A 4A9AA 1JALA 3OMCA 4O1NA 5CV4A 4KHZA 3NQIA 1YNTE 3T56B 2F0UA 2F1MA 3NS1A 5IGCA 4L63B 1B9RA 1QE6A 1UEAB 3HG9A 1MPEA 1XYIA 4XDXA 4YIJA 2BTEA 1E0ZA 2WXRA 1QCBD 2ZXPA 5LL6S 4IUUA 1ZP0B 2PW5A 5C0XJ 5KEEA 4KGRA 2LJIA 1PMRA 1F2MA 1H9JA 2W55A 2EKIA 2A68D 3AEGB 2BYTA 3B9JA 1JB3A 1E0BA 2EYLA 2BB6A 4BS9A 2WAQB 3NWSA 3L3OC 5JPMC 2EYJA 3FEWX 2R7ZB 1X32A 4K2LA 4OW0A 3VR9B 4Q2JA 1QF6A 3QOLA 3RMHA 2LHDA 1UGJA 4C3HG 2N55A 1LLRD 4A3KB 2BCOA 3HUIA 1DGJA 3B2FA 2PMVA 1L0YB 3SK4A 1ZYRD 1QWYA 1PZID 5H8YE 5HURA 5BYRA 2Q8RE 5J22A 2QJLA 2FFKB 2F0MA 2M2LA 1BQQT 1IL8A 4HCEA 1I4HA 1IYUA 3P1MA 1CTMA 5D3DA 1CZWA 2Q8IB 4TQ0A 4C1NI 2INPE 1B9MA 3DWQA 2WXNA 1HUNA 4G7OC 3TN2A 1RTNA 2O2LD 3J81L 3S2DB 1K51A 3R3OA 4BA2I 4OZBA 1SIJA 1YMHE 1LTSD 4NAWB 2B76B 4R3DA 1ZYRC 4ZYSA 5J39A 3GTMB 4IQZA 1EIGA 5DM63 2NMQA 3I4NB 1OQRA 1NR4A 5C4XB 4FO2A 3BVMA 4I7ZC 2J42A 1DM0B 1WCMB 5E4WC 2K1BA 1XTCD 3IXSA 3VA5A 1B53A 2HCCA 2WNMA 3T3NA 4ZKCB 4KD3A 4C3IG 1V1OA 2W3SA 3CIRB 1A3UA 4DXGA 3GO5A 1QJOA 1IKMA 4NP5A 1QT9A 3KLSA 5KNBA 1SYBA 2WP9B 3V96A 1RODA 4AYBB 2JSVX 3Q8FA 1L0XB 3RLFA 5DEHA 1A2TA 5BMIA 2L12A 2PW7A 4DU9A 3HRZC 5CV7A 4V0BA 1R4PB 4KTAA 3Q8CA 2JXTA 1B2TA 2BS2B 3AU7A 4HR7B 2KACA 1LT5D 1C77A 4HROA 3PIP3 4XWTA 4CHTB 2L32A 4RKLA 2MH7A 4EQPA 1STYA 4KKSA 3F2UA 4FXCA 2D5DA 3CRLC 5D7GA 2CJOA 2DBYA 3DWGC 3FC4A 2ZW1A 3W5UB 3HRDD 4PMWA 1CI3M 1JQY