3BYTB

A complex between a variant of staphylococcal enterotoxin c3 and the variable domain of the murine t cell receptor beta chain 8.2
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
238
structure length
232
Chain Sequence
SQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSTWHGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Manipulating the coupled folding and binding process drives affinity maturation in a protein-protein complex
rcsb
source organism Mus musculus
molecule tags Toxin
molecule keywords T cell receptor beta chain 8.2
total genus 64
structure length 232
sequence length 238
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2008-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
B PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3bytB02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3bytB01
1HXYD 3BVMA 5ELCA 2AQ2B 5D3IB 5ELFA 1L0XB 1AW7A 1I4RA 1JCKB 4RHSA 1FNVA 1S5DD 1JWSD 1LT4D 1S5BD 1SE4A 1B1ZA 1TY2A 1LT3D 1HA5A 1JWMD 1TS4A 1PRTC 1LT5D 1LTAD 1STEA 1PZKD 3W2DA 1L0YB 2R61A 2QEJC 1EEID 1LT6D 4RCOA 4L6TB 1PRTF 1FGBD 1FD7D 3BYTB 1D6EC 1ET9A 1PYWD 1CQVA 1SEBD 1UNSA 1QILA 4BWGB 1PRTB 1PTOD 1LTRD 3BVGA 2IJ0A 1LTGD 3DWPA 4DXFA 1HQRD 1SE3A 1BCPF 1PTOF 4OHJA 4Z9CB 5I4DA 1YN4A 1LO5D 1T5XD 1JQYD 4RGMA 1G8ZD 1BCPD 3EA6A 1UUPA 1M4VA 1I4XA 1I4HA 5ELBA 1PTOC 3R2IA 2XRSD 1PZID 1HTLD 1SJED 4RGNA 2SEBD 3BZDB 1TS5A 4O1NA 3URYA 1YN3A 1D5ZC 1F77A 1DJRD 1FNWA 1V1PB 1LTBD 1KLGD 1I4PA 1KLUD 3V05A 3CHBD 2TSSA 5TSSA 1LTTD 2AQ1B 1RCVD 2XRQD 3O13A 1CT1D 4TSSA 3R8BA 1JWUD 2RDHA 1EU4A 1RD9D 1KTKA 4RGOS 1DYQA 3OWEB 2J4XA 4C56C 1CHPD 1LLRD 2O2LD 2WV6D 1TS3A 4L63B 1CK1A 1YN5A 1D5MC 1MD2D 2ICIA 1TY0A 2XN9C 5ELDA 1EEFD 1PTOB 5D3DA 1S5ED 1EFID 2Z8LA 1SXTA 1CHQD 3MFGA 2NTTA 3MC0B 1S5CD 2RDGA 1ET6A 4RGTA 4RFBA 3DWAA 1ESFA 1V1PA 1LTSD 1AN8A 1XTCD 2IPKD 1GOZA 4DXGA 1SJHD 1BCPC 1S5FD 1PZJD 2NTSA 3EFXD 4K6LA 5FK9C 4UDUC 1PTOH 1I4QA 1LTID 1RDPD 1TS2A 3R2TA 3KLSX 2AQ3B 1EWCA 1ENFA 3DWQA 1V1OA 1D5XC 3BVZA 4RH6A 2CHBD 2G9HD 1PRTD 3BYYB 4ZYSA 1EU3A 1B44D 4RHRA 1RF2D 5ELEA 3SEBA 1SE2A 2QILA 3TSSA 1BXTA 4NZLB 2XNAC 1JR0D 3GP7A 5FKAC 1SBBB 1I4GA 1XXGA 1BCPB 1FNUA
chains in the Genus database with same CATH superfamily
2JXMB 3BVMA 3P4RB 4DHJD 1VQLA 3S24A 4DR3Q 3KBGA 3BS1A 4DR1L 3S1RH 1YI2A 3DBLB 2MBEA 4QUFA 2JE6I 5IWAQ 1TY2A 1LT3D 1SYEA 4DDID 4K7WA 1C4PA 2Q2IA 2Y0SB 4CKBA 3J81E 1KRSA 2WAQB 1P3QU 1EEID 2DUDA 4DN4M 1CZWA 2G5DA 1E10A 2HT1A 2KTFA 4OVZA 2MBBB 2IGGA 3BYTB 4NXNL 3RN5A 2PMVA 3RZWC 5FR6A 5GQOA 4N9TA 1TIFA 3UINB 4WURA 2IO0B 4LF6Q 2PNHA 3CCUA 3CC7A 5AFWA 1AYFA 3OJ3A 4W9HA 1AH9A 3GTKH 1NY4A 5JVH3 1VCBA 3W5VB 4DHZB 4LNQA 3P2BA 3WANA 2GOWA 1BCPD 3NTKA 1OO9B 1QLBB 4JPSA 1MSGA 4MSMB 5E6JA 2FBWB 3H7SA 4DV0Q 1ZYRD 1UF0A 2WGSA 3RI7C 5BMGA 1BUVT 1CI3M 2LMCB 4BY7G 1JOOA 2N3SA 5A35A 1AE2A 3IBEA 1G91A 3DVGY 1XNRQ 5G55A 3VUWA 1EWIA 2BVCA 4JIOU 1T0RC 1NCVA 3D4DA 1WJ6A 1TIID 2LSSA 3RD2A 1BKBA 3BWUD 2OWOA 4HKZE 2JSOA 2F0TA 3MZ5A 4GDLA 2AQ1B 5KGUA 3Q23A 4X64Q 4F7XA 4RWSC 1BO0A 4BBNC 3EROA 3KF8A 1FXIA 5EKIA 4I6LB 3MJ5A 4W9JA 3MEFA 1ONLA 4A3EB 2FCMA 2KUMA 1H9MA 1C77A 3FC4A 3V60A 5EBDA 4WWNA 4DKAC 3MHBA 4NPNA 3IXSA 4A3JH 2ACZB 2LY7A 2I5LX 2J0JA 1E8XA 2HJ8A 4HJ9A 4M8MA 1MG4A 1LV9A 3RD4A 4WRDA 2KWUB 1Y8OB 3AM9A 2D0OA 5I2YA 2VS1A 1YX6B 4X62Q 2KTRA 2IY1B 2Z8LA 3ER0A 4DAMA 4P75A 2G45B 4PV1C 3A9JB 3RULA 1J6QA 2Y0SE 3NQIA 1LTSD 3NVWA 4OIJA 4G4KA 2EJFC 4P1BC 1LTLA 1HNXQ 1WF9A 5FK9C 1XPOA 4TQUS 5CHWA 2ZJQA 4DUZQ 4DR6Q 3R2TA 1PH6A 1V43A 2PI2A 2WXIA 3TMPB 1HA6A 3OMCA 5BR8L 4P6VF 4DHZE 2FCNA 3H91A 4H44C 3APFA 3PUWA 4GN4B 2MHVA 3TN2A 2JXXA 2BWES 2J7QB 4IKGA 2XNAC 1SBBB 2F0GA 4YIJA 1M90C 4JI5L 1YX5B 3AI5A 4X57B 1FNUA 2DNCA 4WJ4A 4XZ4A 4ZYNA 4BS9A 1ZEQX 3SU8X 4A6QA 1AE3A 4ID6A 1K8OA 2ASQA 1SR3A 4LF8L 4MM3B 2GRIA 5BO4B 4IM2A 4M01A 2F0WA 1S5BD 5EE9A 3I55A 3PUZA 4NXMQ 3TZDA 2WXJA 1V8CA 3R3MA 1Z47A 5DAUA 2R2QA 3A33B 3ND9A 5JPNC 2Y3AA 4O2DA 1L0YB 1A70A 2W3RA 3V6CB 3J80E 3ZRFA 3IKJA 4L6TB 4LMQD 5EBCA 2L0FA 1FGBD 5EE0A 4LUOA 2BQQA 3I4MH 3FPPA 4JV5Q 2PJHA 1FL0A 5C44H 3FP9A 4LF7L 2N4FA 4JOIC 2JA6G 1JE4A 1TU2B 2KX0A 2PMZB 3ZYYX 4F8MA 2AL3A 1L0WA 1WMHA 3M7NA 2H1EA 3HP3A 1YN4A 4A3MH 1NDDA 2OJWA 1JQYD 1CA5A 2OT2A 4CDDC 2OTJA 2V4DA 2PE6B 2PO4A 2ATWA 1QNUA 1L4ZB 2D5GA 2EYJA 3LNNA 4WAAA 3ZDMC 1YJIA 4ARCA 5JH5C 1SYBA 5ELBA 1E8ZA 2INCC 1MVKA 2H88B 4KGSA 2KN4A 4KI0A 1ZE3D 2L32A 2MX2A 4JBMA 1E90A 4U673 2MQJA 3I56A 4B3SQ 3T53B 3CU7A 3R93A 4KKTA 5KYLA 1RM6C 4A75A 3OPOA 1VRAB 3QG1A 3C19A 4CJ0B 2LMCA 4HK2A 4JX1C 3SDLC 1JB3A 3Q8CA 2L8JA 2J0MA 1WGHA 3F2DA 5CBEE 3PMFA 3U4ZA 4A93H 4IM0A 4P16A 4IJLA 4N58A 4G50A 1B4OA 3R8BA 3P63A 3RZOB 3QJYA 2MO0A 4E6IA 3GTLH 5JZEB 4XWWA 2Y5BB 2FUG1 3FVQA 5CV9A 2A6EC 1K8MA 1C4CA 1PH2A 2I2YA 4ZRZA 3SHLA 5M3MG 4JI7Q 1IYJB 2UUAQ 2KFJA 1XNQL 5IYBH 1IP9A 2R93G 1RJTA 3VFKA 2ONQA 1JMLA 2JN4A 3GTPB 3WALA 1R4PB 4ME5A 2HD5B 1MSHA 2VB3X 3CQZB 3VR2A 3BK2A 3GZNI 1O7IA 4JWSC 4B9KA 1HQMC 2KAJA 1EWHA 2JU6X 2N9LA 4P1CC 1E2WA 3GTLB 5FO8B 5EPLA 1HZ6A 3T3OA 1S5CD 1SRUA 1ILQA 4BZAA 3EQLC 3NBHA 1A2UA 1QOAA 3RPFC 3WWVA 2GI9A 5KHOA 1VQNA 1IKMA 4A3LG 5AEKB 2G4SA 3ZLZA 1MKHA 4CDEC 4BA1I 3U9SA 4GKJQ 4LUVA 3QCAA 3KUPA 1XT9B 1BVSA 2Y0SG 2I1KA 4KY6A 2WXNA 2PVOD 1RFAA 3ZJTA 2DLBA 3NS1A 3TEYA 2JQOA 2WXFA 1RTNA 4M1UB 1IYVA 2IWHA 1PH7A 4BVUC 2KD0A 3AECB 1T5EA 4X62L 1RF2D 1X3GA 4MNOA 1L6UA 1IYFA 3STBD 2GVBA 2QDLA 2O4XA 2VQFQ 3Q8FA 1I4GA 4UHVA 1KD1C 1HNWQ 3L4PA 1X3PA 2BOSA 1Y1VH 4A3FH 5ELFA 2PCFB 1NI2A 1AW7A 1WXSA 3EVQA 1G6JA 4X3KA 1E7ZA 1JWSD 3ZNGC 3MFYA 3GTMB 2NVQH 2MGSA 3KYDD 1SGHA 3T56B 3FDTA 1SF0A 3I9V1 1KF6B 4IWPA 4KKIA 1N5XA 4DXAB 3NP8A 3KBXA 2GBKA 2HUGA 1PZKD 1I35A 1YJWA 1KOTA 4C3JB 1GC7A 3CSFA 2K8CA 3T3NA 2J0TD 5ELNA 2YEPB 1NNXA 2WDQB 2N7DA 2KZRA 1E5WA 3FEWX 2B2UC 3AYHB 4FXKC 2R92H 3RNEC 4JI5Q 2UXCQ 3VVWB 1LM0A 3HM6X 4DXFA 2CQAA 1T9HA 5GADC 2PPHA 3ZXVA 4K6DA 5I4DA 1TWGB 4IUPA 4KSKC 4EVOA 1J5EL 3HOYH 4E74A 4A4IA 2PLPA 2PW7A 3SGIA 5IE8A 5FLMG 3CC2A 2O6VB 1L2NA 5JXVA 3TQYA 3HRDD 4QAYA 1PH9A 3AU5A 4OZBA 2CWPA 1UE1A 2QC8A 3Q3OC 3RNAC 3FILA 3NZUA 1P8LA 2Z4IA 2PQAB 1U5KA 2NVYB 4DV2Q 2QF7A 2NB0A 3D6CA 1STAA 2WP8J 3S2HH 4J6HA 3T16A 3GTQB 4JV5L 1ISNA 1D5ZC 2KX3A 4MDKE 2AWOA 5JPMC 1FNWA 5CHVC 1Q8KA 2UXDQ 3N6RA 2VQEQ 1NEKB 1F9RA 3RUIB 4WJNA 3VQIA 2M2LA 4NAWB 1CA6A 2BH8A 2XIWA 2LVOA 1TWHB 3QR8A 4POFA 1Y1VB 5IIFA 3J7ZC 1GJXA 1R4MI 1S1QB 3PUVA 1L6VA 3EGRA 2C35B 4GOPB 1WTRA 1EO6A 3T1YL 1KTKA 3U4VA 4YY3L 2ZVOA 1JROA 1JORA 5LMUQ 1U4MA 5IT9E 2PKOA 3J80L 1KLVA 3FMCA 4LW1A 4XYOA 4Y7NB 1TBEA 4HCEA 3H0GB 2XSCA 2IZVB 3IAM1 1IHZA 2KJHB 1H9SB 2YYZA 2ZM6Q 1PFNA 3W1BA 4IFDJ 1XLPA 3QC8B 1L1OA 2AUJD 3BDCA 4C2MH 3N32A 3UF8A 1VMCA 1SXTA 4AOFA 5T8IA 4PNYA 1BMLC 3A9JA 1H9KA 2V3SA 3NWSA 3DHQA 3T51B 1PH8A 4ANXA 1TR5A 2MA9B 3I5JC 2B63H 1EM7A 2V4LA 4W9EA 3EFXD 2L00B 2LKVA 2NCNA 4KDLB 4DUYQ 3CCJA 5IYDH 3C1FA 5LMUL 2WXHA 4XGAB 1F9QA 3HOWG 3J81c 3H7PB 2VB2X 2MUYA 3C3LA 1DGSA 1R4QB 3CMEA 1D5XC 3VR3A 3S1QB 1UGJA 1YOVB 3DBHB 2OOBB 3HK0A 2LUEA 5C4XH 3R7QA 3TBIB 4HCPB 1VQ9A 1QQRA 3J80i 4HAEA 2LFIA 1PGXA 1JR0D 4BY7B 4DV4L 3SK4A 3N1ZC 5FO7B 4NNJB 2R7DA 4NJ7A 4J6IA 3CAMA 2M19A 1WXAA 1KNEA 2MFIA 2NUCA 1QZGA 2KMCA 3PHWB 4KVGB 1Z6HA 5IYCG 4MT5A 3TS0A 5GMVA 4CKEA 1I50B 4RHSA 1CSQA 1S72A 1LXDA 4IUMB 4US8A 4B0MA 2K28A 3PTFC 1Q1BA 2DGYA 4DGZA 4BY7H 1KAWA 2Q5WD 2YVCA 1TS4A 1PRTC 2ZNVC 4USAA 1UAPA 4K0KQ 1XPRA 3Q14C 3DLLA 3TEWA 1PFSA 1ZGUB 4XT3B 2A69C 3GV3A 2IT1A 3T13A 3D4RA 1NJIC 4ZUJA 1TKYA 2ZTEA 3UE0A 2SNSA 2WXOA 1ET9A 3P20A 2RSNA 1YNTE 3KLWA 1G6ZA 1UNSA 5GROA 3IAS1 2NWGA 5CV8A 1PTOD 1TZOA 2IJ0A 2Q2UA 1NR2A 3H8HA 2KA7A 4HJ8A 3VTWA 2JZPA 2PPBC 2KHSA 2EYPA 1TWAB 3DXJC 3W3AA 3G71A 2R2OA 1WSPA 2WX1A 3DWGC 2PTLA 2H5XA 5A2QE 1E2VA 3W1SC 2Z59B 3OW7A 3KW5B 2EKEC 3L0OA 1C9OA 2ZTCA 2FE8A 5FR3A 3H6MA 4A76A 3G48A 1I4XA 3H7PA 3TEHB 4F88A 2OEOA 5M3MB 2PEAA 3AFPA 3MXUA 3I4LA 4IURA 1G2SA 4C1NK 2NZOA 1EUVB 4P2CB 3LGJA 4P7IA 1GXDC 4NXNQ 4HCSA 3ULJA 2IX3A 2CW0D 4F1SA 4LCDE 2BKFA 2JYOA 2PZUA 1KJTA 1B8AA 2LXJA 1VLBA 3DMUA 3ML8A 3RMKC 1NYRA 1UH6A 1B53A 4G7HC 3H1UA 4L5TA 4R8NA 1XCQL 2PW5A 1FVIA 2TSSA 1E7UA 3AE8B 4IOIE 4L1BA 3AFQA 4GN5A 2A5HA 4D2KA 2E2JH 2N55A 4BAXA 1H9SA 2V1CC 4AQYQ 4B3TQ 2BH2A 3QHTA 1JWUD 4A3KB 3QIAA 4YHHL 2YV5A 4G3XB 2JA8B 2NPTA 5C4ZA 3DEOA 3OWEB 4YCWA 1CZGA 4DF7A 3DVGX 3OWFA 2D10A 3K8AA 2DHZA 1U4PA 3A4RA 3LWEA 1F9SA 1TT2A 4LF4L 4R8IA 4PYUA 1EFID 4W9CA 1N33Q 5IGBA 4DQOC 3FKIB 2KQ3A 1FRDA 4X64L 4QCLA 4MSQB 2FHTA 3S2AA 3TEZA 3JC66 4M00A 1PH3A 1WI0A 4R4QA 1B9RA 1BCPC 2PQAA 4X3SA 1JB7A 1O7YA 3H94A 3OOCA 2DNEA 4NPSA 3RLNA 4QGUA 2KENA 5C0XG 1OEYA 3B08A 4X6AH 5IA7A 3TREA 1JOKA 2EVBA 3A4SC 1KL9A 4CKCA 1Y1WG 1HFNA 1YQBA 1ZKOA 1WCMG 4F7ZA 3KLRA 4IFDH 1EQRA 4C80A 1BOSA 2WXPA 1WZ0A 2ZM6L 1N61A 5ELEA 2UUBQ 4OWXB 1K73C 4GIVA 2FJ2A 4MH0E 1F9PA 4B9WA 3KYCD 1WZ3A 2OCEA 4WFN3 1YVCA 1JRPA 4JI0Q 1GUGA 1N6ZA 2LJIA 4LAAA 1EY9A 4EQNA 2B2WA 1J5EQ 1VQ5A 2E2IH 2FFKB 2OEDA 4MH8A 4JC0A 2NN6I 2KHIA 3CCVA 2AX5A 3P1HA 5G2NA 3ZUNA 3AU4A 3QOJA 5M3FB 3R3OA 5CC4A 1E1TA 2KN5A 2X8XX 5LL6X 1R9TH 2IO2B 3O65B 4KIKA 2F0QA 4A3JB 2WX0A 4YL8A 4AIMA 3JAMi 3J9CA 1D6EC 3P1MA 4AWJA 1K0RA 1I3QB 4BKSA 1RHPA 4C3JG 2DAJA 3DBHI 1TWCB 1HUMA 1CSPA 3AE4B 4GLAC 2MCNB 2F0MA 4MGYE 4QUCA 1HFGA 3HOZB 1FJGQ 1TWGH 2DZKA 3QARA 2JUOA 2B8FA 2KNBA 2EIFA 2SOBA 4POGA 1J0GA 3SVMA 5CGKA 3EA6A 5JEAG 5CX3A 1NMGA 3D32A 1IXRA 3MXNB 3A54A 4X66Q 4A3MG 5MPOA 1VF5C 2F0VA 4BY1G 2R7FA 2CH4A 5T1GA 2N78A 1L1OB 2KBNA 4B3RQ 4FYDA 2K52A 1Q0WB 2ASBA 3TP6A 4A3DH 1F77A 2MP1A 1LQBA 3NJTA 4AH6A 5T1IA 4C3IG 1SYDA 4HMJA 3GO5A 5TSSA 1FFUA 1YHBA 4DHJB 3KF6B 3W1GA 2X6LA 2Q2TA 5J2RA 3WOFA 1LACA 1JALA 3MC9A 2NVUI 2YLMA 4DV3Q 4KY7A 4RM9A 2UXBL 3EHVA 4ITKA 2KO3A 1EOTA 3A9KB 5D7GA 1LM8B 3GTOH 4HMIA 4DV6Q 1CZPA 1VD2A 2J4XA 2A69D 1PGBA 1CHPD 1EY8A 1WXMA 1ICWA 1EFWA 4DA2A 3B1LX 2EKIA 4AYBG 2JA6H 2FIFA 3ML9A 4XC2A 5M5XH 1YNJD 1S3SG 2A74C 1ZW7A 2A6ED 3A1QA 4JI1Q 4I6NB 3SK6A 3DBRI 5CHFA 1ESRA 4CDFC 1TWFH 2WQYB 3V62A 4DR3L 4XQJA 1A15A 4DK0A 5EKLA 1UBQA 5KYIA 3H9DA 2B76B 1S5FD 2XK5A 1QVCA 3RZFA 2F1MA 1Q90A 2TMPA 4JI4L 1MPEA 1ZYRC 1I4QA 4NQLB 4A3DB 4P71A 2LASA 4LFCQ 2RHQB 4AJWA 5D2MB 2N0SB 2O2VB 4FVMA 1J7AA 3AEBB 4FJVB 3PIOA 5EAYA 2BPSA 1V49A 4NJCA 2LVPA 2BE5C 4DK1A 3LYYA 3RCZA 4REZA 2F0NA 4X65L 4K5XA 4LF4Q 4XYQA 2L55A 3SEBA 1GKHA 3TSSA 1GPXA 1WE7A 4FF4A 4N6EB 2E2HH 3VXWA 1HXYD 1H9RA 5E6PA 3NPPA 1WGDA 3ZTDA 4FF2A 4XDCA 3QO2A 4DV1L 2O5JC 4QMGA 1FMAD 5IP4D 2K1BA 5BYRA 4URKA 1SNOA 1D4BA 2PW9A 2BYEA 5C0XI 2INDC 1CMXB 4LLGM 1R7SA 4BBNF 5FLXc 4DV0L 3DPDA 4LF5Q 4BBSH 3S2HB 3PZDA 4LFCL 1QE6A 4MACA 4KK7A 5E4XA 2EZVA 5IP7H 4K8IA 2JA5H 1G6PA 1LT6D 3I2ZA 1D2BA 1P7FA 2K6QA 3PPAA 3KOJA 3I73A 2QIEB 2K14A 2EYLA 1DD2A 3VA7A 1OQQA 2WDRB 3N3KB 3KLSA 2HE7A 4AS1A 3K0XA 1HNWL 4HEA1 3MHSD 1EIGA 1STGA 4GNXA 1E24A 1IW7C 4JL9A 4ZUIA 4PG3A 2MNAA 3ZKJC 1WYWB 4EOYA 2XGTA 4AYBB 4KGTA 4B9XA 5LMNL 1F52A 3BZKA 1SFOH 1RAXA 4HJAA 4E71A 3KF6A 3GTQH 3J7AF 5ELOA 1GUWA 2JQRB 3R66C 2ZCCA 2F0LA 4IUVA 5C5LA 2VUMH 1WX8A 3T1HQ 2WXKA 1ZDVA 3QWNA 3G6EA 1PXUA 4FDBA 1HJPA 3HKZE 1HZ9A 4Q5VA 2LXCA 5G3LD 1B50A 1SFOB 1ASZA 3JSVA 1QF6A 3A8KE 1PVOA 3VDZA 1KLUD 1V8QA 4K7SA 3V05A 4LNFA 5L83A 3HOYB 3NOBA 4JYAQ 1FJGL 3ZNHB 1GC6A 5EQ0A 3KJPA 2SAKA 4TSSA 4A55A 2E6XA 1G2TA 2B39A 1JRUA 1A3TA 1HNXL 3HOVH 4NAMA 2JZZA 3W1YA 1C79A 2RDHA 1K83B 4L5QA 1EOVA 3TRZA 4TUUA 3F2CA 1SSNA 2F0JA 2JK8A 3K0YA 3K80C 4JI8Q 5IGDA 4HIMA 4GMVA 4PS7A 3WAMA 1WFQA 2KOLA 4FXDA 3U30A 4B95A 4PZ7A 2WV6D 4DV2L 1XLQA 1MD2D 5EDSA 3KF8B 4EE2A 3KQ4A 1Q8IA 1PH1A 3MXPA 5D3DA 3CMAA 1EWYC 3QK0A 1VQDA 2AEHA 4EKUA 2UXDL 4A3GH 3RZDB 2CKZB 1Q86C 1WJ4A 1ZOYB 1QG7A 4RGTA 4FF3A 2R7ZH 2INPE 2K6DB 3A0JA 3DWAA 2G9DA 3G4SA 1V1PA 2XVSA 5I6WA 4FLHA 4Q0FA 3ULLA 3AB9A 1HRJA 1Y1VG 1EL0A 3AEVA 1MHXA 1ZPSA 4C00A 1TS2A 2F3IA 2AWTA 2FMCA 2B29A 3FHWA 4C3HH 3D0FA 1SROA 3F8TA 2JT4B 5IT9c 4FXGC 2XTIA 1YBYA 5JOBA 1WTWA 4IWOA 4OX9L 2M4NA 2K3UA 2IL8A 4A3CH 1UGMA 1MJDA 1SE2A 2ENBA 3ZVVA 3ZIMA 3VUXA 4HSPA 3CIRB 1U4LA 1XXGA 5C3JB 2KC2A 5KNCA 1IBML 4KHZA 3UE1A 2HCIA 2MJ8A 3VR5A 5GAHC 4F8CB 2E8GA 4ARIA 2C7NB 4GS3A 4C3HG 4HSVA 3BINA 3L16A 1WTHA 4ZRIA 3MC8A 4MIUA 5M5XB 2F4VL 1STEA 1IW7D 3LX0A 1ENCA 1MG8A 3HOVG 1OGWA 4XX5A 1EF1A 4NMZA 3S16B 1WJJA 3PQIA 4HR7B 4RCOA 1VQ4A 2N9PC 4B3RL 3B6YA 4TQ0A 5IOIA 4V190 2D07B 3BIID 4YSYB 3BG3A 4HDOA 4QF4A 3BVGA 1HR0L 1PLFA 1IPGA 3HUIA 3TMEA 2MP2B 3W5UB 4JGHB 3P4PB 4K1RB 2B2WC 1WVLA 1HE8A 2KFKB 3LDZE 1FCCC 1WX9A 2ZXRA 5IYDG 3S2DB 3HHMA 2BS2B 5IGCA 2Z6KA 1V5OA 3NENA 1II3A 4R3DA 3X3NA 2QDBA 3ZRCA 1WI5A 3KWLA 4MTNA 1SNQA 2YTVA 1S40A 2RA4A 2EJGC 1J19A 2E76C 3C46A 2N9KA 5LNK1 4YSZB 3CW2C 4H0LC 3M3JA 4JOIA 3SK8A 1TS5A 1KRHA 3QAQA 1EQTA 5HY6A 4ACFA 1SE8A 1SLJA 5LMNW 1WFYA 3DHIC 1I4PA 2C60A 1YHAA 4FHJA 2RPVA 3AQQA 4KJOA 5C3EG 1Y69U 4DR7Q 4G11A 2F0IA 4A3BH 1FCLA 3OTOQ 3U8ZA 2UYZB 1QOHA 1GVPA 4DR4L 2YTXA 1STYA 4DAYB 5FO9B 1WTXA 2I0QA 3HOZH 1V5TA 2N1WA 1GUTA 3M4QA 3P4SB 3M4OB 1T3QA 2O2VA 4IFDG 1V81A 1KNAA 1WR1A 2ZNVB 3S1MB 3AU7A 3KH0A 1M8AA 5E7NA 2BT6A 2JWZA 3CSTA 1RKNA 1I7HA 1XX8A 3AEAB 3PLVA 3UI2A 5DCNA 5A2QL 3M3YH 4DPGA 4WWOA 2ZW0A 3PO2H 3U58A 1YNJC 2R7ZG 5EKKA 2R93B 2KEDA 3L2PA 3M4OH 2DZJA 1Q12A 2GVAA 2J0KA 1RL2A 2R6GA 2NTTA 5J22A 1O78A 1Q1EA 3ZQ4A 2EXZA 3A1QB 1TGZB 1RODA 1YD8U 2MJ3A 3QOLA 3M62B 3ABVB 4DR4Q 1RRBA 5CTRC 1QUQA 4NP5A 2NVTH 3E0EA 4DR5Q 3DOWA 2WP9B 4K3CA 1PDQA 2WAQG 2JSVX 4LF5L 4DBGA 3PO2G 2E5LQ 3B0AA 5BMIA 5IKCM 1EQQA 2JF5A 4C3JH 2F0UA 1SYGA 3WAPA 3Q6BA 2K4KA 2CHZA 4UPAA 4B3ML 4HEDA 4HCNB 1WCMH 1TKEA 3GP7A 1JC7A 1DOIA 3NTHA 2UXCL 2YU9B 4QIWE 4II3B 5AUKA 4EQOA 3IVFA 2LEKA 2BA1A 1QNKA 3E5SA 3Q3NC 4A3BB 2AL6A 1A3VA 3RN9C 3IFDA 4RKLA 4GNXC 2D0PA 2BW2A 3WA0A 4IZ8A 1XCTL 1ASYA 4NW2A 4XWTA 5G5HA 2B3GA 4DAVA 2VZKB 5K5PA 4A3DG 1A0IA 2R61A 2DY7A 3I4NG 1SYFA 4KGRA 2MPMA 5DM63 2C9OA 2LRWA 2WXLA 2JEBI 3G6JB 1NTGA 4OX9Q 1KFYB 4A20A 3WCQA 4A3OA 4DWFA 4A3EH 3GV6A 3RNFC 2H89B 5IYCH 1OFFA 2GB1A 2NN6H 4G57A 1EY4A 4IDIA 4OVVA 4KLKA 2N7EA 2ZPNA 1VCIA 3SXHA 1IZ6A 1L1OC 1GUOA 2QCPX 1DM0B 4XT1B 1Y8PB 3DM3A 3OW2A 1SB3C 4JW0A 1K51A 1PYBA 1P7EA 4IN3A 2ZCBA 3Q8EA 3H0GG 4L8JA 5IT9L 1VQ7A 2INNE 2FAZA 4GSWA 2N88A 2WWZA 3Q8DA 4NAWA 4K81A 2K5VA 3U50C 4GLXA 2BS3B 3H3VC 4JVZA 2XRSD 1NYQA 4BKTA 1X6OA 4DK5A 2XK5B 4RGNA 4C4VA 4JI3Q 3JYUA 1YN3A 2L4NA 5E4WC 5K36H 5IAAC 5BYQA 4IUTA 3FILB 2K5PA 4R4OA 1N34Q 1U4RA 1SDFA 3L7ZC 1WM2A 1LTTD 2K05A 2Z6KC 5IOCA 1HUNA 2I07B 2D3GA 2LGDA 5KNDA 3CCLA 1CT1D 5KEEA 4EZJA 2WB1E 2R92G 2Y5PA 3ONAB 4DNTB 4LFAQ 2IDYA 3DUZA 2BF8B 2LGSA 2K8HA 5DPTA 3ERQA 2KT7A 3M9BA 2VW9A 2ZEQA 4DU9A 3OIPA 1W2BA 3D3RA 1EZ6A 1O80A 3GTPH 2M56B 3ZTCA 1MI2A 4B3SL 3C2PA 2L05A 3F2UA 1CM9A 2XN9C 5I9OA 4I6PA 2E2DC 3NELA 3U2SC 1PTOB 1YZ6A 3NZSA 3APCA 3KFUA 4DV4Q 4ABNA 4GN1A 1QOGA 3I7FA 3N9YC 2MHJA 5KRUA 5JEAJ 3MC0B 1WR6E 2L5TA 5H8YE 3OTOL 2KHWB 3QWZB 3PUYA 1YEZA 3Q3MC 4KV6A 4DXGA 1C76A 2JWUA 2VZKD 3WAOA 3HGBA 5CMDA 5C4HA 2RDBC 1GB1A 3L54A 2G4DB 1XPUA 3PO0A 2A5UA 4K0KL 3TCAA 1WMHB 1FIQA 1QVGA 4HJGE 1MHWC 2J42A 3HOXB 1F2ZA 4J8QA 3AN1A 2PZWA 2HTME 5C44G 4GOCA 2CHBD 3BYYB 4OO1I 1YNXA 4I65A 1K52A 4LFBL 4P74A 3ENEA 2N49A 4LF6L 4JI1L 5GXGB 5M5YH 2KFKA 1BCPB 3VTUA 4S0RA 3NTIA 4A3IB 2NVXH 4PZ6A 1E7VA 2LFNA 2DAFA 3RFZB 4ZHOA 3ZNZB 4UY8C 1WTVA 2NS5A 4CGYB 4A3GB 3WDNA 2EMSA 1VQ8A 1TWCH 1BBUA 4C2MB 2DY8A 2JA7B 3I63C 4FXCA 2UU7A 4J15A 4N8X1 1DOMA 3OSOA 2WNMA 3Q3FA 1PDXA 1KAAA 3E3XA 4FHKA 1NI3A 1I5FA 1RLFA 1A5RA 2EQSA 1ILPA 4RG1A 4YXDB 4CYEA 1WOCA 4S17A 4KKSA 4W9GA 2QKIC 1FR3A 3VR4A 4A93G 2Z6BA 1U9RA 2CJNA 1PRTB 1LTRD 2Q2HA 1VQCA 3H3VI 1FM0D 3I90A 1GG3A 2V3NA 2LUMA 4QY7A 3HOVB 2WAQE 1Q81C 3RN2A 1IKLA 1I6HB 1GHKA 1QVFA 2EOTA 1BCPF 3K58A 1X3FA 4OHJA 4Z9CB 3EBEA 1SNPA 2VL6A 1UWMA 4WQOB 4RGMA 2FINB 1VS0A 2D2QA 2WXRA 2PI2E 1M4VA 1OXXK 4CHTB 3ECIA 3TJPA 4HKQA 1RWSA 2R93H 4RM8A 4NJ6A 1TQOA 2EELA 3I4MB 3VYSA 1BBXC 3M7GA 3DHGC 2Z0EB 1DXMA 2JA5B 4A3KG 2PVGC 1NBFC 2SEBD 2RSOA 1BNZA 1DZ1A 1E3PA 1EY7A 2FIDA 3PRPB 2SDFA 4C4VB 4K5VA 1HEZE 2RSUA 2CKHB 2GBJA 1PV4A 1CJEA 1CKNB 1KLGD 4GGQA 5AJ3L 5C3EB 1I94Q 4OVUA 1GNUA 2D9UA 3DVNV 4IQZA 1UWXA 2K5WA 1FFVA 4LJOB 3U7DA 1F2LA 1UE5A 1TXYA 2A19A 3NK9A 1NENB 1MJCA 1LUZA 4DAYA 1N36Q 1V80A 1E2ZA 3Q22A 1VQMA 1RTOA 1TVXA 1XF5L 1YMHE 3N52A 4GDLB 5D65A 2N7JA 1KQSA 4C56C 3AMZA 4MTKA 4L2YA 1CKNA 1NUCA 1YJ9A 3ZJUA 1SMXA 2O2LD 4S3SA 1QT9A 2ICIA 1EIYB 2JA8H 1EEFD 3IRBA 3GTOB 1O7LA 3VR6A 5CBAE 1M1KC 1Q1OA 3GTMH 4OONA 2F4IA 3N30A 5D6JB 3GQBA 2DZIA 3IL8A 1ET6A 3AEFB 2K1FA 3RR5A 4LJPB 1XTCD 2N9XA 4R1JA 2ZPYA 2AWNA 2HHHQ 1T0YA 2K5DA 2JRIB 2NTSA 4K6LA 4A3JG 4GLSC 4UDUC 2YTYA 1RDPD 2HQLA 4XDDA 1P98A 3GDEA 1IBKL 2C7HA 1JICA 1XYIA 4V0BA 4PQXA 1C4AA 3L9AX 2M0XA 2Q8IB 4DFAA 4GOPA 2F03A 3DCGA 3UDFA 4K14A 2EYFA 1HNZL 4JI2L 5J18A 3SK5A 1IYUA 5IP7G 2JA5G 1QZHA 4EFOA 5IN7A 4JBJA 2F0OA 4DV7L 1R4NI 1TJEA 2BWFA 1I50H 5ELCA 1VR9A 2KDEB 1C1YB 4RAUC 4I7ZC 3KUZA 3B2GA 4TMAB 2B2UA 2EYOA 1I4RA 1Q82C 1HZBA 1PUTA 1FNVA 1QUQB 2EMTA 5M5WH 4A3FG 3RYTA 4X3UA 2UUCQ 2NZ1D 1LTAD 1XD3B 3HG9A 2WXGA 1E1OA 3JAML 3UI3A 4NKLA 3V2TA 1X32A 2F0SA 2QEJC 2MQHA 4ZRJA 3MXNA 1XJVA 4JI3L 1I42A 3ICEA 3NQTA 1F2RI 2HIXA 4KD4A 1HNZQ 2J53A 4GDKA 2C5CA 3A8JE 3SE0A 1BUIC 2L7RA 4NB3A 2QHOA 3P75A 2FXQA 2PIAA 1X3EA 1MBYA 3GOEA 5IGFA 2IGDA 1Q5WB 2PYKA 1LO5D 3NY5A 1I6VC 2KLGA 1EUJA 3RMHA 4LK0M 3A8IE 4GKKL 4CBVA 4LFAL 4BXXH 2F3WA 1JJCB 1U0LA 2Z1CA 5IWAL 3CF5A 1E6EB 3HRZC 2I5HA 2RCNA 5C5MA 4YY3Q 3GD7A 4KZ0A 3WIMA 4JI7L 2GBRA 4DV6L 2Z0DB 3RLOA 3FPUB 5DNFA 2QJLA 1DOLA 1S4ZA 1SJED 2VH2A 3I3CA 2KECA 3GZNB 3K59A 3K9OB 1E8WA 4UP7A 1EYDA 3ZNID 1Z7TA 4MGZE 5EE3A 4HIDA 5JJIA 2NVTB 4E3CA 4GOPC 4IO9A 3DBSA 3VYUA 4G0NB 4MEMA 2A68C 1F9JA 2R3ZA 3P42A 3BDLA 3TP5A 3HKZG 4QQBX 2HD3A 2IW3A 1JOQA 4RF0A 5C1ZA 1EU4A 2Z4HA 2OHFA 4EZLA 1YJ1A 5DPWA 3Q8AA 1KC8C 3U9OA 3VHTC 1PFMA 4K7UA 5LHY1 1XNRL 2ZJRA 2OTLA 2WYQA 3CKIB 1K8GA 4LFBQ 2RGFA 3PLUA 5KIXA 3UIPB 3NBHB 2UU9Q 3AE9B 1YQ3B 5C4JH 1NSNS 1GAQB 2LRUA 2JPHA 2K50A 2DNFA 2BYFA 1TWHH 4ZKCB 2E2JB 1P0RA 1YITA 1P9DU 4A9AA 1WM3A 2O6VD 1W3SA 2R92B 1JMCA 2I38A 2WIIB 3J81L 2BBCA 4YHHQ 1XWEA 5M9OA 4JQWC 2DZMA 1LTID 1WGRA 3CXCA 2NBUA 4CO7A 1WRIA 2KMMA 1HZCA 4BXXG 1Y8NB 3M3YB 2K5HA 2JA7G 2VUMB 5C6AA 3HZXA 3ERSX 4MGKE 4RH6A 5F2DA 4APVA 3DDCB 4FA6A 2WB1G 5BMHA 1RFKA 4CHKA 4UAIA 1T6BX 4RHRA 1TKGA 2GLSA 2K5QA 1VDVA 1OQRA 3CRLC 2B2VA 4IOCA 2HDEA 2K39A 4NZLB 1AZQA 2MWSB 3HS0C 1N33L 4AQ7A 4BY1B 2XWBB 1WD0A 2YEPF 4WIPA 1Y14B 3J81j 3FRPB 5DPRA 1K9MC 2DYMA 2RKSA 3K81C 3BZCA 2MO1A 4CJ1B 5IP9G 3SD5A 3S15B 4DDGD 3A7AB 3SFEB 2G1EA 4I7AA 3X23A 2PQEA 4EQPA 4L5SA 4M0WB 1HA5A 1JWMD 2LZ6A 2BE5D 4MZ9A 2L76A 4WH4A 1D1KA 4DUZL 3CQZH 1KH0A 4NDXA 3DEPA 1F2RC 4IUQA 4YWLA 1NMFA 3TP8A 4LK1C 3W2DA 4CJ2C 3Q69A 1F2MA 1J9OA 1G51A 2WFWA 1ICFB 5BR8Q 3T1HL 2DYBA 1X54A 3HOXH 1PRTF 1OQYA 1FD7D 5H1SE 3DBLI 2RF4A 1KABA 3AH7A 3L10B 2CCZA 2HIVA 4UP8A 4L23A 1XLOA 4TQ1A 1EY5A 3OYYA 4B3MQ 4IPGA 1PFDA 4BWGB 2KEEA 4YTNB 3AE1B 4GN3B 2V4IB 3DQVA 5AJ3Q 1E22A 3TS2A 1JT8A 3RNBC 3PVLA 4KY5A 1HHVA 4JYAL 5J3BA 4ZK9B 2HCCA 5HFYA 2RVLA 3GTKB 2RCFA 3W5OA 2DENB 3K5LA 1UELA 3MP9A 2RHSB 4IC7B 3VYTA 1YIJA 1N36L 4A3BG 4NQKE 4ZRPA 1OXVA 3T1YQ 1PQSA 4O42A 1B2TA 1PTOC 1Y8RC 5AZFA 3J7A5 4RF1A 2ZJPA 1H95A 2F0PA 2HTHA 3H6NA 1PZID 1PYSB 2EY5A 1BDOA 3BZDB 2GA4B 3NEMA 4O1NA 4WORA 3PHXB 1QWYA 3S14H 1G291 4MM3A 3CCSA 1NAPA 3LJ3A 1LTBD 2Z0SA 1BBWA 1FXAA 2CR5A 4KHVA 1VZ8A 1RCVD 5IGEA 4PS8A 1GM5A 1BR9A 4LF9Q 1WTPA 2EYMA 3PUXA 3PO3G 5FLXL 1TWAH 1JW9D 2K32A 1MFWA 1IBLQ 5IYBG 1HPCA 1HTPA 1AEXA 4GNXB 4HVBA 3FKIG 1WXQA 3PF5A 1YIWA 3K7AH 4DR2L 3DM1A 1QZEA 5DLQE 1VJKA 2L3ZA 3UDIA 2QEXA 1KIXA 3A55A 3PGZA 3CCRA 1L7YA 1Y56A 3ZXRA 5JAVA 2DJGC 2Z9HA 2HJ1A 2L1AA 5M3FH 3TUOA 3N20C 1GO3E 3W1SA 3P7JA 3DWMA 4W9KA 4DV7Q 5BYSA 3T9LA 3S15H 3S17H 1X65A 2NBFA 3EIVA 4RCNA 4G7ZC 4LF8Q 1N62A 2EDGA 3QJZA 4C1NI 2G3QB 3RZDH 1IBLL 4RMFA 1AP0A 3EFCA 4M02A 2K01A 1SIJA 2AQ3B 1EWCA 4OW0A 4OZAA 4YTMB 3U4EG 2NVYH 2Q8RE 1XNQQ 3MTSA 1XEEA 5C0XJ 4HJ7A 1HZ5A 2MRPA 4W9IA 4N9PA 1FO4A 1DOXA 1J8CA 5HGQA 1N32L 4PYZA 4P72A 1EYAA 4JPBW 4GZYC 1EF5A 5HI1A 3NVVA 1QCBD 1WH3A 2QSDA 2WXQA 1RYJA 1T5XD 1ZKHA 2K8BA 2BGFA 5D3IB 3GS2A 4BBRB 3MVVA 1H9JA 2XWJB 1H4RA 5IGGA 3H15A 2ES2A 4BY1H 2KVZA 2D5DA 1SE4A 2K33A 1LT4D 4R9WA 5JJZA 3S1NH 5C4JB 2PNRC 2ZT9C 3K57A 5E1FA 1A63A 4C7ZA 1FD6A 2K04A 2LI5A 1WCMB 2VY3A 3PO3H 2VXWA 1B7YB 2CJOA 2LJ5A 4KHPQ 4QJFA 3PO2B 3IFWB 3S9WA 3R7RA 5CR3A 3SR1A 3OG5A 3KDFB 5JVG3 4KKUA 1E8YA 4K3BA 1MI0A 1MIUA 4OO1G 1W6JA 2FCQA 2M17A 2F3VA 3LXFA 3ZGZA 3EECA 1AFPA 4MJSB 3NG0A 2L0TA 4BFRA 4YWMA 4IOAA 1PMRA 2K5NA 1A8VA 1K50A 1QKZA 3GE3C 2L1BA 3KYHC 4XQQA 5D94A 2MBHA 3PZ7A 1PTOF 4FN2A 3S17B 3D4WA 2JJQA 2E2HB 2F0HA 2Y5CA 2UXBQ 3I4NH 4GB9A 5CV6A 3EC8A 4TVAB 1IGDA 1VQ6A 5IO9A 2WU5B 2UUAL 2JA8G 4N8FA 3C0RB 3ETRA 4UP9A 2KWCA 4M0WA 1QB5D 1XQQA 1BQQT 3K7AB 4ANVA 3VA5A 1VQGA 1ZXTA 2QGQA 1DJRD 2UU9L 3EN2A 3HOXG 4WWMA 2MLBA 3PREA 3VH3B 5BN5A 5L95C 4TV3A 3L17A 2DBYA 4KMUC 2OQ0A 4LNKA 2XRQD 1TYGB 3BK1A 2AMCB 2D62A 2KJ6A 2OJRA 2IY5B 1WGYA 1QOBA 1H8CA 1RD9D 3CD6A 4GU2A 3K5NA 2CU3A 2K25A 2BYTA 2IO1B 3AE6B 3PRZA 4M8AA 2L83A 1T0QC 2NYZD 2K75A 3AEGB 4K2KA 2QCZA 4WQMA 1YN5A 3UIOB 1R4MB 3J80c 2W3SA 3GTGH 3S1MH 2LVQA 3KUDB 1S3OA 4DK3C 4HN7A 1Q7YC 1S5ED 2KCCA 4NY0A 1QJOA 4GXBA 2MJDA 1CHQD 2QA4A 2KDMA 3MFGA 4IFDI 2ZXOA 2K22A 3VTVA 1Q10A 4YWKA 1ESFA 5C3WA 4FO2A 3HVDA 5CYUA 1GOZA 4A93B 1C7YA 1CQFA 1PGAA 1XLNA 4ZLTF 1ZDXA 2NR2A 4HJ5A 2I5MX 1J8IA 3M4YA 4B3TL 2M1MA 1FRRA 1PA6A 4PMWA 1PZJD 1BT0A 1N8RC 1PTOH 5JJLA 1GHJA 3GTGB 1NBWA 2ZXPA 2WHIA 4LNNA 2GBMA 3VYRA 2WDVB 1SN8A 3Q2AC 3J7YW 4QIWB 1SE9A 4AP4C 3NUCA 4QB4A 4IPDA 1YHQA 1PRTD 1D8LA 1X9NA 1B44D 2A6HC 2LHEA 5DPSA 3J7AV 3FAHA 2BKRB 1E9MA 2MEKA 1DGJA 2KKCA 1B70B 1PHJA 1ZXHA 1V9PA 2A1AA 4CQNA 4KX6B 1UEAB 2IHFA 2WACA 1D7QA 5H92C 4FADA 5J17A 3V3XA 1TWFB 4EX5A 1S5DD 4JK1C 5CORA 2HHHL 1J7BA 1WYGA 1V2YA 5ISRA 5JJKA 1EZ8A 2K6AA 5C44B 2MH7A 1YQ4B 4ZOHC 2KOXA 2KWVB 1C4QA 3AULA 1WX7A 3VAWA 4DR6L 4YT0B 3M95A 2L52A 3QIJA 3PSIA 1D1IA 1SNCA 1UBIA 1T0SC 2GMIC 2W82A 3S16H 1VQHA 1WTQA 3CCQA 1HTOA 4OELB 2CVRA 4XDXA 2IY0B 1CQVA 2I46A 4K8JA 2P5ZX 1SNDA 3NXWA 2B2YA 3X3MA 1N34L 4IG7B 2VQEL 1JWAD 2JA9A 4RKBA 2KJRA 3NRZA 1CTMA 4W9DA 4JI0L 2KCTA 2QMTA 4ZRQA 3Q3JA 4KD3A 2KLCA 4C3IH 4ZRKA 3I91A 4H02A 4N59A 5J1ZA 2YU9H 4DV3L 1SNMA 3AE2B 3JVZX 2NBWB 4NXML 2O5IC 2PMZE 1KXLA 2RQXA 4U68A 3PCOB 4JCVE 4ODGA 1TTNA 4ZQ3A 1GD7A 2F0KA 1WE6A 3M85A 2B2VC 1E7PB 4HIKA 4OWWB 2J52A 3JSVB 5BN3A 5C0XH 4TKNA 3QQ8B 1VQJA 1X56A 2AHOB 1NR4A 3PS6A 2JEAI 2WB1B 3PO3B 4H7BA 3AV8A 2M9VA 3IHPC 2CFMA 4EQ5A 2VUMG 1K83H 1IBXA 4LF7Q 3CCMA 3PV1A 4DNIA 1GUNA 1K3BC 5JHBA 4KTAA 4A3LH 4H2AA 4IJHA 1L5PA 3O13A 3A9KA 1WIAA 1VQAA 4GKKQ 2JYTA 2C7MB 5AZHA 2ICEC 2RD0A 4HPLB 3X0WA 1V6EA 1DYQA 3TL5A 1C0AA 3NBIA 4PMCA 1EY6A 2ZW1A 4C7YA 3I4MG 2JX5A 3K5MA 4R4IA 5DM73 4M8NA 1IBXB 3MAQA 1LLRD 3ZJVA 4EZKA 1R9TB 2WU2B 1TS3A 1B9MA 2IHEA 2L15A 3LWUA 2LXKA 4P73A 3CPWA 3T4AC 4X65Q 1OXUA 2NZHA 3HOUB 4KSLC 5C2TB 4BOZB 2JRHA 3TDQA 3Q0AA 1WJNA 2V0GA 3ND8A 3M4PA 1UD7A 3BU2A 1IBMQ 4W9LA 2CWAA 2E2IB 1VZ6A 1STBA 1ZP0B 4BKSD 2B3AA 3MEHA 4HWIB 1AN8A 2L11A 4DR1Q 2KK8A 2IX0A 1MJEA 2B2YC 4XQNA 4JG2A 2RPQA 4ALPA 1LFDA 1UE6A 3HEJA 4OIKA 1PH5A 5EE1A 2KQ4X 2RMMA 3VDYA 2F0EA 4OWTB 2A4ZA 3NVYA 3L3OC 1N9WA 3VH4B 2AKWB 3A74A 3NSWA 3DWQA 1Q3LA 4AJYB 3BVZA 2LS01 1EYGA 2D3AA 4ZYSA 4YCUA 1EU3A 2IX1A 5L37A 1BXTA 4IPHA 4KIKB 4FP5D 1KM7A 5HURA 4A3KH 1VF7A 5I9PA 5FJ8G 3KLSX 2JY6A 5E6NA 1UE7A 3NHHA 4PT5A 1PFBA 3D8GA 4BBRH 1L0XB 3H09A 1A2TA 5EGTA 4HRSA 4GDKB 4LTUA 4A3IH 2EY2A 1EY0A 2IYDB 1L4DB 1VQOA 1XMQL 2WDTB 3PSEB 1F1HA 4OZCA 2ID0A 1HTQA 1P1AA 4B0EA 4O0AA 1A62A 1Z5SB 3NWTA 4KJNA 2LGXA 4WAFA 3QX1A 4MN3A 2KJXA 2JA6B 3TZUA 4TKOB 2VNUD 2WKCA 2FUHB 3GE8C 3KUCB 1VQKA 2OQKA 2PZTA 1SAPA 1SSOA 1OTRB 1JJ2A 2V3PA 2MW5A 2VH1A 4HPPA 2LGIA 3VUYA 2VQFL 5M5WB 1R4NB 4OEMB 4ZDVA 4MHEA 4XIGS 3APDA 4RNAA 5LL6S 3SR6A 1SE3A 3E9IA 4GLVB 4LNIA 3EJIA 2X38A 1STHA 4DV1Q 3D6WA 4A3FB 1TZ1A 2R7ZB 1RIPA 4BBSG 4AQYL 1G8ZD 1SIFA 3E9SA 1IGCA 2KQ7A 2HDLA 2JVCA 4XE0A 4LNOA 1KHIA 3S14B 3NS8A 1AWDA 3UQBA 3N1XC 4Q2JA 1DCZA 4LUZA 3PV0A 2B2TA 2CS4A 4LDTB 4BKGA 1BF4A 2MBOA 3D31A 5GAEC 5KNBA 1EQVA 1C78A 4ULLA 1VQPA 2B63G 5IP9H 1ROEA 2V1YA 1VQFA 5CV7A 2RDFA 4TRDA 3EUB2 2LD9A 5G3LF 2VRRB 5HGTA 1Z2MA 3NVZA 2MBQA 2XBBC 3MTNB 1JE5A 4IALA 4J3OD 2GBNA 1UEBA 1K53A 2WXMA 5C3EH 3Q24A 1P16A 4HIOA 3Q6SA 3U7ZA 4OGQC 3TBLD 3VR9B 2OF1A 2C5LC 4HXDA 5IODA 2W9NA 3RNGC 1IBKQ 5FOBB 5C4XG 3I57A 5COYA 4WJWA 1SYCA 3ULPA 4R4CA 5NUCA 1GUSA 1KDBA 5LXHA 3B9JA 3OLMD 3KK7A 5IY0A 1HH2P 1STNA 4DK6C 1DOKA 1TY0A 2E75C 1FPYA 1OTCA 2UUBL 3HIZA 1TKWB 1A6XA 4MELA 1VZ7A 2EPBA 3ZDTA 3OHXC 3TEXA 3S1RB 4ZAIA 5HG2A 4US9A 2L12A 4HDQA 3J81i 2IPKD 3L08A 1L0VB 4KKJA 3V61A 4N9F4 2W55A 2EYHA 1WXVA 3UDGA 4IW0A 3V6EB 4FNFA 4YSXB 4FBJB 1GJZA 1GB4A 2WINB 2XEWA 3ONSA 4JI8L 2A68D 3WOEA 4CDCC 1IL8A 2ZTDA 4Y7NH 1ACCA 3L13A 2NN6G 4KN4C 3I3TB 1HCZA 4JI6L 1EIFA 4IUUA 1KRTA 4W9FA 2QILA 2KDIA 5LLIA 2M0AA 5G5GA 3I4OA 4WJPA 4AYBE 2B2TC 3S1NB 2N9EB 1LGRA 2A6HD 2MP2A 2AQ2B 3RLFA 3CF6E 2DWQA 4ILWA 2NVXB 1JCKB 1WGGA 1Z9FA 1YNNC 3FKIH 3A5UA 3CC4A 3OAWA 3PRMB 1PH4A 1AZPA 2KCNA 2SNMA 1K8RB 1B1ZA 1QOFA 2LWPA 2X6GA 2J7ZA 2BB5A 4JI4Q 3GB1A 3KWVA 1NVID 5HKHA 4X66L 2NMQA 2IO3B 2L9HA 4IM3A 4ANUA 5KHQA 3AEEB 4A3CG 2GN5A 1NE3A 3ALBA 3K9PB 2CW0C 3MJWA 3RUZA 3FKYA 2WLBA 1VQIA 1N32Q 2BDNA 1SEBD 1C3TA 1VMPA 2EXDA 4B6WA 1QILA 2NVQB 2H4OA 1V1QA 3DWPA 3P4QB 3RNCC 3UDXA 2KCMA 2CQOA 1M94A 2NPTB 2FMMA 3AXCA 1VDZA 4DR7L 3BJUA 1WWTA 3E6ZX 3OMGA 2K0PA 3E56A 2I1JA 4ZCKA 2E74C 5FJ8H 4A3GG 4KDIC 4LDTD 1N63A 1ZXIA 5EPKA 3CPFA 1UUPA 2N1VA 2KQSA 4BBRG 4YTPB 5AUIA 4A3IG 1WYDA 1I4HA 2KMAA 5HHDG 3R2IA 3AEDB 3KVFB 3DBRB 2QDFA 4Y52H 2C9WB 4RA8A 1WY8A 4ME3A 1FYCA 1VQEA 2KTRB 2A73B 2UWQA 4ZHPA 2HQEA 1UZXB 2AUKA 2JA7H 1V1PB 2FCSA 1CKMA 1XTDA 3LB8C 3HOYG 3MXGA 1X1MA 3CHBD 4OXPA 2ZZPB 3PGEA 2EY6A 3JW0X 1SMYC 1B3AA 4FF1A 3VRAB 1D3ZA 5AZGA 4DNRB 1L2FA 3BDOA 3HFZB 1XMOQ 1OEYJ 1TT5B 2MSED 3IT6B 4WWPA 3E9HA 3G7LA 4DR5L 1WGKA 3U52E 2JXTA 1LYLA 4K5WA 5LMNQ 2N8NA 3HM3A 4GKJL 2E5LL 4FULA 2KC1A 1F2YA 3PIP3 3HVZA 3OJ4B 2BYVE 4FJYA 2IGHA 3UQAA 3SDZA 3HOUG 3C8YA 2HDMA 4MJSA 1D5MC 2Q8TA 2JYEA 5ELDA 3HOWH 3Q8BA 2M00A 2E3TA 5J39A 3IG3A 3ZJYC 2KHJA 1OXSC 3KDFA 2AYOB 2KANA 2EJMA 4EUTA 1KDCA 1I94L 2RR9A 4FJZA 1FEHA 2LGYA 2D3BA 3I72A 5C23A 2RDGA 3S2DH 4HJKA 4RFBA 2EE1A 3MA2B 1YJJA 2EY1A 1E0BA 2DX5B 2JZ3B 3ZW3A 4PK1A 1DOYA 1N5WA 4IUNA 2O6VA 3TIXA 2K7VA 2RBMA 1XMQQ 3PF4A 4ICVA 1CKOA 1HZAA 1K0SA 1K28A 3MHZA 3DHHC 4A8XC 1VQBA 4YCVA 4QL5A 2CHXA 1F0ZA 2NBVB 3A5ZB 1EYCA 2LXAA 1ENFA 1V1OA 5E3FA 1B3QA 2W54A 1C48A 4PMBA 4C3HB 5M3MH 2D2CC 4DAPA 1CUKA 5FKAC 2KDFB 3VRBB 1EIHA 5C3XA 3ZO5B 1WJUA 4A3MB 1KDAA 1IL2A 2FNJB 3PZ8A 3CCEA 5EPJA 4B08A 1C9FA 3JAMc 3PIO3 2A8VA 3ITPA 4HPMB 2IBIB 1V9JA 3DVNU 5CV5A 3AE5B 1W6KA 1LT5D 3I70A 3HOZG 3HOWB 1I3QH 1B9NA 1WD1A 1IUEA 2PE9A 3W9CB 3CP0A 5I2XA 4PS3A 1MHHE 2ON8A 3CWIA 4KN7C 5GAGC 2DN8A 4AUQC 3H0GH 3F1ZA 2V9HA 4LWCA 3I8ZA 3PIPA 3QA8A 1GUAB 2KACA 1K3RA 4JI6Q 1PYWD 3E0JA 4JI2Q 1N60A 1U4AA 2ZJDA 3BY4B 1C8CA 1V86A 3L0WB 2CH4W 5LXIB 2X69A 3I4NB 1LTGD 3CMMB 4HLEA 1V97A 2KDBA 2WKDA 5FLMH 1HQRD 3RZOH 5M3FG 2K03A 5JHAA 3JAME 4IWQA 2JP1A 2ZVNA 4LF9L 5BN4A 3NZ3A 4OL7A 2BCOA 2BB6A 2BDOA 3C1EA 4H13C 4R4TA 1Y1WH 1AARA 2D3CA 3TP7A 3AB5A 3AE7B 4BA2I 2D11A 4OO1H 1HR0W 3RNUA 3EFUA 4DV5Q 2F0FA 1YJNA 4DR2Q 5C4XB 3NHEB 4JWUC 3KJOA 4BOSC 3S1QH 3B2FA 1ZUD2 1HTLD 4X3TA 3IT4B 4ICUA 5FLXE 3GTJB 5DEHA 2BS4B 4XYCA 3HKSA 2MJEA 3URYA 2KWDA 4KZCA 1WTOA 4L5RC 2CHWA 1SMYD 4ASWC 2VZAA 3IAYA 4JLCA 2REXA 2K9XA 3RT3B 1Y1WB 3F2BA 5E6OA 5I6YA 2DJFC 1J7CA 2DYOA 4C3IB 4J1MA 5EJWA 2B8GA 2B63B 4EEWA 4YWGG 5CV4A 4WJQA 1XO3A 2KVRA 1I6HH 4JBWA 3NE5B 3OIQA 4F87A 4EGVA 3M63B 4WJ3M 3MWYW 4RGOS 4DUYL 3T8MA 1E0ZA 3HOUH 4DV5L 3A56A 1ENAA 1JJGA 3STBC 5K36G 3H3VH 4JE3B 1MGSA 4LJZC 4L63B 4PZ8A 2LHDA 1CK1A 1O7ZA 4IPCA 4BBSB 4KV2A 4RMAA 2BTEA 4XTCS 2CU1A 1FGUA 1LABA 3QB3A 4II2B 4MGIE 3NUHB 1K8AC 4A90A 3AE3B 5TR5A 4WJOA 1X55A 2F52A 5JEAH 4G7OC 4ZKBB 1UWVA 4A3EG 3PT2B 2KYWA 3V96A 3SHQA 1XMOL 1OXTA 3IFTA 3HKZB 1SJHD 4JBKA 1WRDB 5M5YB 2BA0A 1DONA 3UGBB 1Q46A 1CFMA 3AMUA 2M8SA 3VR8B 2UUCL 4ANWA 2KXJA 3N1YC 2QW7A 2ALYB 2F4VQ 3K5OA 4KHPL 4HROA 3GTJH 1JQ4A 2L0CA 2OXPA 1YNND 3K7UC 4XXEA 2G9HD 4K2LA 2F0DA 1X3QA 1A3UA 2KVMA 5D14A 4HTHA 1ML0D 1FXTB 3CRKC 1HR0Q 3K6OA 3SFDB 3A7LA 4A3PA 1JWBD 2WS3B
chains in the Genus database with same CATH topology
2JXMB 3BVMA 3P4RB 3KBGA 3BS1A 4QUFA 2JE6I 1TY2A 1LT3D 1SYEA 1C4PA 2Y0SB 4CKBA 3J81E 2WAQB 1E10A 1EEID 4DN4M 1CZWA 4OVZA 2IGGA 3BYTB 2PMVA 4N9TA 4WURA 5AFWA 1AYFA 5JVH3 3W5VB 1BCPD 3NTKA 1OO9B 1QLBB 4JPSA 1MSGA 5E6JA 2FBWB 1ZYRD 5BMGA 1BUVT 1CI3M 2LMCB 1JOOA 5A35A 1G91A 1NCVA 3D4DA 1TIID 3BWUD 4HKZE 2JSOA 2F0TA 3MZ5A 2AQ1B 5KGUA 3Q23A 4F7XA 4RWSC 1BO0A 3EROA 3KF8A 1FXIA 5EKIA 3MJ5A 4A3EB 1ONLA 2KUMA 1H9MA 1C77A 3FC4A 5EBDA 3MHBA 3IXSA 2ACZB 2LY7A 1LV9A 3RD4A 4WRDA 3AM9A 1Y8OB 3AN1A 5I2YA 2Z8LA 4PV1C 3NQIA 1LTSD 3NVWA 4OIJA 4G4KA 2EJFC 5FK9C 4TQUS 3R2TA 1V43A 2WXIA 1HA6A 3OMCA 4P6VF 3H91A 4H44C 3TN2A 3PUWA 2MHVA 4IKGA 2XNAC 1SBBB 2F0GA 4YIJA 1FNUA 2DNCA 4A6QA 4BS9A 1ZEQX 4ID6A 1K8OA 4MM3B 2GRIA 2F0WA 1S5BD 5EE9A 3PUZA 3TZDA 2WXJA 1V8CA 1Z47A 5DAUA 3ND9A 5JPNC 2Y3AA 1L0YB 1A70A 2W3RA 3J80E 3IKJA 4L6TB 4LMQD 5EBCA 1FGBD 5EE0A 3FPPA 1JE4A 1TU2B 2PMZB 3ZYYX 4F8MA 3M7NA 2H1EA 3HP3A 1YN4A 1JQYD 1CA5A 2OT2A 3KWVA 2V4DA 2PO4A 1L4ZB 1QNUA 2D5GA 2EYJA 3LNNA 1YJIA 4ARCA 1SYBA 5ELBA 1MVKA 2H88B 4KGSA 2KN4A 4KI0A 1ZE3D 2L32A 4U673 3T53B 3CU7A 3R93A 4KKTA 5KYLA 1RM6C 3OPOA 1VRAB 3QG1A 4CJ0B 2LMCA 4JX1C 1JB3A 3Q8CA 5CBEE 3PMFA 4P16A 4N58A 1B4OA 3R8BA 3P63A 3RZOB 3QJYA 4E6IA 4XWWA 2FUG1 3FVQA 5CV9A 2A6EC 1K8MA 1C4CA 2I2YA 4ZRZA 3SHLA 1RJTA 2ONQA 1JMLA 3GTPB 1R4PB 4ME5A 1MSHA 2VB3X 3CQZB 3VR2A 3BK2A 4JWSC 1HQMC 2KAJA 1EWHA 2JU6X 2N9LA 1E2WA 3GTLB 5FO8B 5EPLA 1HZ6A 3T3OA 1S5CD 1ILQA 3EQLC 3NBHA 1A2UA 1QOAA 3RPFC 2GI9A 1IKMA 4BA1I 3U9SA 3KUPA 4KY6A 2WXNA 2PVOD 3ZJTA 2DLBA 3NS1A 3TEYA 2WXFA 1RTNA 4M1UB 1IYVA 2IWHA 3AECB 1T5EA 1RF2D 1L6UA 2O4XA 3Q8FA 1I4GA 3L4PA 1X3PA 2BOSA 5ELFA 2PCFB 1AW7A 3EVQA 4X3KA 1JWSD 3MFYA 3GTMB 2MGSA 3T56B 3FDTA 1SF0A 3I9V1 1KF6B 4KKIA 1N5XA 3NP8A 3KBXA 2HUGA 1PZKD 4C3JB 3T3NA 2J0TD 2YEPB 2WDQB 3FEWX 2B2UC 4FXKC 4DXFA 2CQAA 4K6DA 5I4DA 1TWGB 4IUPA 4EVOA 2PLPA 2PW7A 5JXVA 3HRDD 4OZBA 3FILA 2Z4IA 2NVYB 2QF7A 2NB0A 3D6CA 1STAA 2WP8J 4DQOC 4J6HA 3GTQB 3T16A 1D5ZC 2AWOA 5JPMC 1FNWA 3N6RA 1NEKB 1F9RA 3VQIA 2M2LA 4NAWB 1CA6A 2XIWA 1TWHB 5IIFA 1Y1VB 1GJXA 3PUVA 1L6VA 3EGRA 1WTRA 1KTKA 1JROA 1JORA 1U4MA 5IT9E 2PKOA 3J80L 3FMCA 4XYOA 4Y7NB 4HCEA 3H0GB 2XSCA 3IAM1 1IHZA 1H9SB 2YYZA 4IFDJ 1PFNA 1XLPA 3BDCA 2AUJD 1VMCA 1SXTA 4PNYA 1BMLC 1H9KA 3NWSA 3DHQA 3T51B 1TR5A 1EM7A 3EFXD 2LKVA 3C1FA 2WXHA 1F9QA 2VB2X 2MUYA 3C3LA 1R4QB 3S1QB 1UGJA 1D5XC 3VR3A 3TBIB 1QQRA 4HAEA 2LFIA 1PGXA 1JR0D 4BY7B 3SK4A 5FO7B 2M19A 1KNEA 2NUCA 1Z6HA 4MT5A 4CKEA 1I50B 4RHSA 4US8A 4B0MA 2K28A 1Q1BA 4DGZA 4USAA 2Q5WD 1TS4A 1PRTC 1UAPA 3TEWA 4XT3B 2A69C 3GV3A 2IT1A 3T13A 3D4RA 4ZUJA 1TKYA 2SNSA 2WXOA 1ET9A 3P20A 2RSNA 1YNTE 1G6ZA 1UNSA 3IAS1 2NWGA 5CV8A 1PTOD 1TZOA 2IJ0A 3H8HA 1NR2A 2KA7A 2JZPA 2PPBC 2KHSA 2EYPA 1TWAB 3DXJC 3W3AA 1WSPA 3DWGC 2PTLA 5A2QE 1E2VA 3OW7A 2FE8A 5FR3A 3H6MA 1I4XA 4F88A 2OEOA 5M3MB 3MXUA 3I4LA 4IURA 1G2SA 4C1NK 4P2CB 1GXDC 4HCSA 2IX3A 2CW0D 2JYOA 2PZUA 1VLBA 3DMUA 1NYRA 1B53A 4G7HC 4R8NA 1XCQL 2PW5A 2TSSA 3AE8B 4IOIE 4L1BA 4D2KA 2A5HA 2N55A 1H9SA 1JWUD 4A3KB 3QIAA 2JA8B 5C4ZA 3DEOA 3OWEB 4DF7A 1CZGA 3OWFA 1U4PA 3LWEA 1TT2A 1F9SA 4R8IA 1EFID 5IGBA 3FKIB 2KQ3A 1FRDA 4QCLA 2FHTA 3TEZA 1B9RA 1BCPC 4X3SA 1O7YA 3H94A 3OOCA 2DNEA 5C0XG 1JOKA 2EVBA 4CKCA 1HFNA 1ZKOA 3KLRA 4IFDH 4C80A 1BOSA 2WXPA 1N61A 5ELEA 2FJ2A 1F9PA 4B9WA 4WFN3 1JRPA 1GUGA 2LJIA 4LAAA 1EY9A 4EQNA 2B2WA 2OEDA 4MH8A 2FFKB 2NN6I 2AX5A 3P1HA 3QOJA 5M3FB 3R3OA 5CC4A 5LL6X 2F0QA 4A3JB 3J9CA 1D6EC 3P1MA 1I3QB 1RHPA 4C3JG 1TWCB 1HUMA 3AE4B 2F0MA 4QUCA 1HFGA 3HOZB 2B8FA 2SOBA 3SVMA 5CGKA 3EA6A 5JEAG 3A54A 5MPOA 1VF5C 2F0VA 5T1GA 4FYDA 3TP6A 1F77A 2MP1A 5T1IA 4C3IG 1SYDA 4HMJA 3GO5A 5TSSA 1FFUA 2X6LA 3WOFA 1LACA 1JALA 4KY7A 4ITKA 1EOTA 5D7GA 4HMIA 1CZPA 2J4XA 2A69D 1PGBA 1CHPD 1EY8A 1ICWA 4DA2A 2EKIA 1YNJD 2A74C 2A6ED 3SK6A 1ESRA 2WQYB 4XQJA 1A15A 4DK0A 5EKLA 5KYIA 2B76B 1S5FD 2F1MA 1Q90A 2TMPA 1MPEA 1ZYRC 1I4QA 4A3DB 2N0SB 4FVMA 1J7AA 3AEBB 4NJCA 2BE5C 4DK1A 3LYYA 4REZA 2F0NA 4K5XA 4XYQA 2L55A 3SEBA 3TSSA 1GPXA 4FF4A 4N6EB 1HXYD 1H9RA 3NPPA 4FF2A 4XDCA 3QO2A 2O5JC 1FMAD 4QMGA 2K1BA 5BYRA 1SNOA 1D4BA 2PW9A 5C0XI 4LLGM 1R7SA 3S2HB 1QE6A 4MACA 4KK7A 2EZVA 5E4XA 4K8IA 1LT6D 1D2BA 1P7FA 3I73A 2QIEB 2EYLA 1DD2A 3VA7A 1OQQA 2WDRB 3KLSA 4AS1A 4HEA1 1EIGA 1STGA 1IW7C 4ZUIA 4AYBB 4KGTA 4B9XA 3J7AF 1GUWA 2JQRB 2F0LA 4IUVA 5C5LA 2WXKA 1ZDVA 3QWNA 1PXUA 4Q5VA 5G3LD 1B50A 1SFOB 1QF6A 3A8KE 1KLUD 1V8QA 3V05A 3HOYB 5EQ0A 2SAKA 4TSSA 4A55A 2E6XA 1G2TA 2B39A 1A3TA 4NAMA 1C79A 2RDHA 1K83B 1SSNA 2F0JA 3K0YA 5IGDA 2KOLA 4FXDA 2WV6D 1XLQA 1MD2D 4EE2A 3KQ4A 1Q8IA 3MXPA 5D3DA 1EWYC 3RZDB 1ZOYB 1QG7A 4RGTA 4FF3A 2INPE 3DWAA 2G9DA 1V1PA 2XVSA 5I6WA 4Q0FA 3AB9A 1HRJA 1EL0A 1MHXA 1ZPSA 1TS2A 2FMCA 4FXGC 5JOBA 1WTWA 2K3UA 2IL8A 1SE2A 2ENBA 4HSPA 3CIRB 1U4LA 1XXGA 5C3JB 5KNCA 4KHZA 2HCIA 2MJ8A 3VR5A 4ARIA 4C3HG 4HSVA 4MIUA 5M5XB 1STEA 1IW7D 3LX0A 1ENCA 4NMZA 3S16B 4HR7B 4RCOA 4TQ0A 4V190 3BIID 4YSYB 3BG3A 4QF4A 3BVGA 1PLFA 3HUIA 3TMEA 3W5UB 3P4PB 2B2WC 1WVLA 1FCCC 2ZXRA 3S2DB 2BS2B 5IGCA 1II3A 4R3DA 3X3NA 2QDBA 3KWLA 1SNQA 2RA4A 2EJGC 2E76C 3C46A 2N9KA 5LNK1 4YSZB 4H0LC 3SK8A 1TS5A 1KRHA 1EQTA 1I4PA 2RPVA 4KJOA 1Y69U 2F0IA 1FCLA 1QOHA 5FO9B 1STYA 1WTXA 1GUTA 3P4SB 3M4OB 1T3QA 4IFDG 1KNAA 3S1MB 3AU7A 1M8AA 2BT6A 1RKNA 1I7HA 1XX8A 3AEAB 3UI2A 5A2QL 2ZW0A 1YNJC 5EKKA 2R93B 2KEDA 1Q12A 2R6GA 5J22A 2NTTA 1O78A 1Q1EA 3ZQ4A 2EXZA 2MJ3A 1RODA 3QOLA 3ABVB 4NP5A 2WP9B 1PDQA 2JSVX 5BMIA 2F0UA 1SYGA 4HEDA 1TKEA 3GP7A 1JC7A 1DOIA 3NTHA 2YU9B 5AUKA 4EQOA 2LEKA 2BA1A 1QNKA 3E5SA 4A3BB 1A3VA 3IFDA 4RKLA 2BW2A 4IZ8A 1XCTL 4NW2A 4XWTA 5G5HA 4DAVA 2VZKB 5K5PA 2R61A 2DY7A 1SYFA 4KGRA 2MPMA 5DM63 2C9OA 2WXLA 2JEBI 3G6JB 1KFYB 3WCQA 3GV6A 2H89B 1OFFA 2GB1A 2NN6H 4G57A 1EY4A 4IDIA 1VCIA 3SXHA 1GUOA 2QCPX 1DM0B 4XT1B 1Y8PB 1SB3C 1K51A 1P7EA 3Q8EA 4IN3A 4L8JA 5IT9L 2INNE 2N88A 2BS3B 3H3VC 2XRSD 1NYQA 4RGNA 1YN3A 2L4NA 5E4WC 5K36H 5BYQA 4IUTA 3FILB 2K5PA 1U4RA 1SDFA 3L7ZC 5IOCA 1LTTD 2K05A 1HUNA 2I07B 5KNDA 1CT1D 5KEEA 2Y5PA 3ONAB 4DNTB 2IDYA 3DUZA 3ERQA 4DU9A 3OIPA 3D3RA 1EZ6A 1O80A 2M56B 1MI2A 3C2PA 3F2UA 1CM9A 2XN9C 5I9OA 2E2DC 3U2SC 1PTOB 4ABNA 1QOGA 3N9YC 5KRUA 5JEAJ 3MC0B 2L5TA 5H8YE 3PUYA 4KV6A 4DXGA 1C76A 2JWUA 2VZKD 3HGBA 5CMDA 5C4HA 1GB1A 3PO0A 1FIQA 4HJGE 2J42A 3HOXB 1F2ZA 4J8QA 2PZWA 2HTME 2CHBD 3BYYB 4OO1I 4I65A 1K52A 5GXGB 1BCPB 3NTIA 4A3IB 2LFNA 3RFZB 4ZHOA 1WTVA 4CGYB 4A3GB 3WDNA 4C2MB 2DY8A 2JA7B 4FXCA 2WNMA 1DOMA 3OSOA 1PDXA 1KAAA 1NI3A 1ILPA 4YXDB 4KKSA 2QKIC 1FR3A 3VR4A 2CJNA 1U9RA 1PRTB 1LTRD 1FM0D 3I90A 2V3NA 2LUMA 3HOVB 1IKLA 1I6HB 1GHKA 2EOTA 1BCPF 3K58A 4OHJA 4Z9CB 1SNPA 1UWMA 4RGMA 2FINB 2WXRA 1M4VA 1OXXK 4CHTB 4HKQA 1RWSA 1TQOA 2EELA 3I4MB 3VYSA 1BBXC 3M7GA 1DXMA 2JA5B 2PVGC 2SEBD 2RSOA 1BNZA 1DZ1A 1EY7A 2SDFA 4K5VA 1HEZE 1CJEA 1KLGD 5C3EB 2D9UA 4IQZA 1UWXA 2K5WA 1FFVA 1F2LA 3NK9A 1NENB 4DAYA 1E2ZA 3Q22A 1XF5L 1RTOA 1TVXA 1YMHE 4GDLB 3N52A 5D65A 2N7JA 4C56C 3AMZA 4L2YA 1NUCA 3ZJUA 4S3SA 2O2LD 1QT9A 2ICIA 1EEFD 3GTOB 1O7LA 3VR6A 5CBAE 2F4IA 3GQBA 3IL8A 1ET6A 3AEFB 1XTCD 2AWNA 2K5DA 2NTSA 4K6LA 4GLSC 4UDUC 1RDPD 4XDDA 1JICA 1XYIA 4V0BA 4PQXA 1C4AA 3L9AX 2Q8IB 4DFAA 2F03A 4K14A 2EYFA 3SK5A 1IYUA 2F0OA 1TJEA 5ELCA 1VR9A 4RAUC 4I7ZC 3B2GA 4TMAB 2B2UA 2EYOA 1I4RA 1PUTA 1FNVA 4X3UA 2NZ1D 1LTAD 3HG9A 2WXGA 3JAML 3UI3A 4NKLA 3V2TA 1X32A 2F0SA 2QEJC 3MXNA 3NQTA 1F2RI 4KD4A 2J53A 2C5CA 3A8JE 3SE0A 1BUIC 3P75A 2PIAA 1MBYA 5IGFA 2IGDA 2PYKA 1LO5D 1I6VC 3RMHA 4LK0M 3A8IE 4CBVA 2F3WA 2Z1CA 1E6EB 3HRZC 5C5MA 3GD7A 3FPUB 5DNFA 2QJLA 1DOLA 1S4ZA 1SJED 3I3CA 2KECA 3K59A 1EYDA 1Z7TA 5EE3A 2NVTB 3VYUA 2A68C 2R3ZA 3P42A 3BDLA 3TP5A 2IW3A 1JOQA 4RF0A 1EU4A 2Z4HA 2OHFA 3Q8AA 3U9OA 1PFMA 5LHY1 3CKIB 5KIXA 3AE9B 1YQ3B 1NSNS 1GAQB 4ZKCB 2E2JB 4A9AA 2R92B 2I38A 2WIIB 3J81L 2BBCA 1XWEA 5M9OA 1LTID 1WRIA 2KMMA 1Y8NB 3M3YB 2VUMB 5C6AA 3HZXA 5BMHA 4RH6A 5F2DA 1RFKA 4UAIA 1T6BX 4RHRA 1TKGA 2K5QA 1VDVA 1OQRA 3CRLC 2B2VA 2HDEA 4NZLB 1AZQA 3HS0C 4AQ7A 4BY1B 2XWBB 1WD0A 2YEPF 4WIPA 3FRPB 2DYMA 2RKSA 4CJ1B 3S15B 3A7AB 3SFEB 2G1EA 2PQEA 4EQPA 1HA5A 1JWMD 2BE5D 4WH4A 1D1KA 1KH0A 4NDXA 3DEPA 1F2RC 4IUQA 3TP8A 3W2DA 4LK1C 3Q69A 4CJ2C 1F2MA 1J9OA 1PRTF 1FD7D 4WQMA 3AH7A 1KABA 5T8IA 4L23A 1XLOA 4TQ1A 1EY5A 4YTNB 1PFDA 4BWGB 2KEEA 3AE1B 2V4IB 4KY5A 1HHVA 4ZK9B 2HCCA 5HFYA 2RVLA 3GTKB 3MP9A 3K5LA 3VYTA 4ZRPA 1OXVA 4O42A 1B2TA 1PTOC 4RF1A 2F0PA 1PZID 2EY5A 1BDOA 3BZDB 2GA4B 4O1NA 4WORA 1QWYA 1G291 1NAPA 1LTBD 1FXAA 4KHVA 1VZ8A 1RCVD 5IGEA 1BR9A 1WTPA 2EYMA 3PUXA 5FLXL 1JW9D 2K32A 1HPCA 1HTPA 1AEXA 1WXQA 3DM1A 1VJKA 3A55A 1Y56A 5JAVA 2L1AA 3TUOA 3W1SA 3P7JA 3DWMA 5BYSA 2NBFA 4RCNA 4G7ZC 1N62A 2EDGA 4C1NI 1AP0A 2K01A 1SIJA 2AQ3B 1EWCA 4OW0A 4OZAA 4YTMB 3U4EG 2Q8RE 3MTSA 1XEEA 5C0XJ 1HZ5A 4N9PA 1FO4A 1DOXA 1EYAA 4GZYC 5HI1A 3NVVA 1QCBD 2QSDA 2WXQA 1RYJA 1T5XD 5D3IB 3GS2A 4BBRB 3MVVA 1H9JA 2XWJB 5IGGA 2D5DA 1SE4A 2K33A 1LT4D 4R9WA 5JJZA 4C7ZA 5C4JB 2PNRC 2ZT9C 3K57A 5E1FA 1FD6A 2K04A 1WCMB 2VXWA 2CJOA 3PO2B 3S9WA 5CR3A 3SR1A 5JVG3 4KKUA 1MI0A 4OO1G 3LXFA 1W6JA 2F3VA 3ZGZA 1AFPA 1PMRA 1K50A 1QKZA 2L1BA 4XQQA 3PZ7A 1PTOF 3S17B 3D4WA 2E2HB 2F0HA 2Y5CA 5CV6A 1IGDA 2WU5B 3ETRA 4M0WA 1QB5D 1BQQT 3K7AB 3VA5A 1ZXTA 1DJRD 4WWMA 5BN5A 2DBYA 4KMUC 2XRQD 1TYGB 3BK1A 2D62A 1QOBA 1RD9D 3K5NA 2CU3A 2BYTA 3AE6B 4M8AA 2L83A 2NYZD 3AEGB 4K2KA 1YN5A 2W3SA 4HN7A 1S5ED 2KCCA 1QJOA 2MJDA 1CHQD 2KDMA 3MFGA 4IFDI 2ZXOA 2K22A 1Q10A 3HVDA 1ESFA 5C3WA 4FO2A 5CYUA 1GOZA 4A93B 1XLNA 1CQFA 1PGAA 4ZLTF 1ZDXA 1J8IA 3M4YA 1FRRA 4PMWA 1PZJD 1PTOH 1GHJA 3GTGB 2ZXPA 3VYRA 2WDVB 3J7YW 4QIWB 3NUCA 4QB4A 1PRTD 1B44D 2A6HC 2LHEA 3J7AV 3FAHA 1E9MA 2MEKA 1DGJA 1ZXHA 4CQNA 4KX6B 1UEAB 2WACA 5H92C 3V3XA 1TWFB 1S5DD 4JK1C 5CORA 1J7BA 1WYGA 5ISRA 2MH7A 1EZ8A 2K6AA 5C44B 4ZRQA 1YQ4B 4ZOHC 1C4QA 4YT0B 2L52A 1D1IA 1SNCA 2W82A 1WTQA 2CVRA 4XDXA 1CQVA 2I46A 4K8JA 1SNDA 3NXWA 2B2YA 3X3MA 1JWAD 4RKBA 3NRZA 1CTMA 2QMTA 4KD3A 3I91A 4N59A 5J1ZA 1SNMA 3AE2B 2O5IC 2RQXA 4U68A 4ODGA 4ZQ3A 2F0KA 3M85A 2B2VC 1E7PB 2J52A 5BN3A 5C0XH 1NR4A 2JEAI 2WB1B 3PO3B 4H7BA 3AV8A 2M9VA 1IBXA 1GUNA 4KTAA 4H2AA 1L5PA 3O13A 2JYTA 2ICEC 1DYQA 2ZW1A 3NBIA 4PMCA 1EY6A 4C7YA 2JX5A 3K5MA 5DM73 1IBXB 3MAQA 1LLRD 3ZJVA 1R9TB 2WU2B 1TS3A 1B9MA 3LWUA 3T4AC 1OXUA 3HOUB 5C2TB 3TDQA 3Q0AA 2V0GA 3ND8A 2E2IB 1VZ6A 1STBA 1ZP0B 3MEHA 1AN8A 2L11A 2IX0A 2B2YC 4XQNA 3HEJA 4OIKA 5EE1A 2KQ4X 2RMMA 2F0EA 3NVYA 3L3OC 3NSWA 3DWQA 1Q3LA 3BVZA 2LS01 4ZYSA 1EU3A 2IX1A 1BXTA 4FP5D 5HURA 1VF7A 5I9PA 3KLSX 3NHHA 4PT5A 1PFBA 3D8GA 1L0XB 3H09A 1A2TA 5EGTA 4HRSA 4GDKB 4LTUA 2EY2A 1EY0A 1L4DB 4OZCA 2ID0A 4B0EA 3NWTA 4KJNA 4WAFA 4MN3A 2JA6B 2KJXA 3TZUA 4TKOB 2VNUD 2WKCA 2PZTA 1SAPA 1SSOA 2V3PA 2LGIA 5M5WB 4MHEA 4XIGS 4RNAA 5LL6S 3SR6A 1SE3A 3EJIA 2X38A 1STHA 3D6WA 4A3FB 2R7ZB 1G8ZD 3E9SA 1IGCA 2HDLA 4XE0A 3S14B 1AWDA 4Q2JA 1DCZA 3PV0A 2B2TA 1BF4A 3D31A 5KNBA 1EQVA 1C78A 4ULLA 1ROEA 5CV7A 2RDFA 4TRDA 3EUB2 5G3LF 5HGTA 3NVZA 4IALA 4J3OD 2WXMA 1K53A 3Q24A 3Q6SA 3U7ZA 4OGQC 3VR9B 2OF1A 5IODA 5FOBB 3I57A 5COYA 4WJWA 1SYCA 5NUCA 1GUSA 1KDBA 3B9JA 3KK7A 1STNA 1DOKA 1TY0A 2E75C 1TKWB 1A6XA 1VZ7A 2EPBA 3OHXC 3TEXA 3S1RB 4ZAIA 5HG2A 4US9A 2L12A 2IPKD 1L0VB 4KKJA 2W55A 2EYHA 4FNFA 4YSXB 1GB4A 2WINB 2A68D 3WOEA 1IL8A 1ACCA 2NN6G 4KN4C 1HCZA 4IUUA 2QILA 2M0AA 5G5GA 2B2TC 3S1NB 2A6HD 2AQ2B 3RLFA 2DWQA 4ILWA 2NVXB 1JCKB 1YNNC 1AZPA 2KCNA 2SNMA 1QOFA 1B1ZA 2X6GA 2J7ZA 2BB5A 3GB1A 1NVID 2NMQA 2L9HA 3AEEB 2CW0C 3RUZA 2WLBA 2BDNA 1SEBD 1VMPA 1QILA 2NVQB 2H4OA 3DWPA 3P4QB 2FMMA 1VDZA 1WWTA 3E6ZX 3OMGA 2K0PA 3E56A 2E74C 1N63A 1ZXIA 5EPKA 1UUPA 4YTPB 5AUIA 1I4HA 5HHDG 3R2IA 3AEDB 4RA8A 1FYCA 4ZHPA 2A73B 2HQEA 2AUKA 1V1PB 3LB8C 3MXGA 3CHBD 2EY6A 1SMYC 1B3AA 4FF1A 3VRAB 4DNRB 3BDOA 3IT6B 3G7LA 1WGKA 3U52E 2JXTA 4K5WA 1F2YA 3PIP3 3HVZA 2IGHA 3SDZA 3C8YA 2HDMA 1D5MC 2Q8TA 2JYEA 5ELDA 3Q8BA 2M00A 2E3TA 5J39A 1OXSC 2EJMA 1KDCA 1FEHA 3I72A 2RDGA 4RFBA 2EE1A 3MA2B 1YJJA 2EY1A 1E0BA 1DOYA 1N5WA 4IUNA 2K7VA 2RBMA 3MHZA 4A8XC 1F0ZA 1EYCA 1ENFA 1V1OA 5E3FA 2W54A 1C48A 4PMBA 4C3HB 2D2CC 4DAPA 5FKAC 3VRBB 1EIHA 5C3XA 4A3MB 1KDAA 3PZ8A 5EPJA 4B08A 1C9FA 3PIO3 3ITPA 5CV5A 3AE5B 1W6KA 1LT5D 3I70A 3HOWB 1IUEA 3W9CB 1B9NA 1WD1A 5I2XA 1MHHE 2ON8A 3CWIA 4KN7C 2DN8A 3I8ZA 2KACA 1PYWD 3E0JA 1N60A 1C8CA 2X69A 3I4NB 1LTGD 1V97A 2WKDA 1HQRD 2K03A 3JAME 2JP1A 5BN4A 3NZ3A 4OL7A 2BCOA 2BB6A 2BDOA 3C1EA 4H13C 3TP7A 3AB5A 3AE7B 4BA2I 4OO1H 2F0FA 5C4XB 4JWUC 3B2FA 1ZUD2 1HTLD 4X3TA 3IT4B 5FLXE 3GTJB 5DEHA 2BS4B 2MJEA 3URYA 2KWDA 1WTOA 1SMYD 3IAYA 2K9XA 1Y1WB 5I6YA 1J7CA 2DYOA 4C3IB 4J1MA