3BYTB

A complex between a variant of staphylococcal enterotoxin c3 and the variable domain of the murine t cell receptor beta chain 8.2
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
238
structure length
232
Chain Sequence
SQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSTWHGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T cell receptor beta chain 8.2
publication title Manipulating the coupled folding and binding process drives affinity maturation in a protein-protein complex
rcsb
source organism Mus musculus
molecule tags Toxin
total genus 64
structure length 232
sequence length 238
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2008-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
B PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3bytB02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3bytB01
1MD2D 1D6EC 5ELFA 2G9HD 2AQ3B 2QEJC 1UUPA 1SJHD 3EA6A 1PTOD 1B44D 1I4PA 1T5XD 1I4XA 1M4VA 3TSSA 4RGTA 1SBBB 2RDGA 4C56C 1FGBD 2XRQD 1PRTD 1PZKD 1V1PB 4ZYSA 4RH6A 1SEBD 1DYQA 1I4GA 1PTOC 2NTSA 1PYWD 3BVMA 3DWQA 1EEFD 5ELCA 3W2DA 3BYTB 4RGNA 4RGOS 1PRTC 3BVZA 5ELBA 3MC0B 1AW7A 1FNWA 1JR0D 1STEA 1YN5A 2XNAC 4NZLB 1FNVA 4RHRA 1HTLD 4Z9CB 1KTKA 1I4HA 4TSSA 3R2IA 1L0XB 1LT3D 2Z8LA 2AQ1B 1BCPF 1JQYD 1PZJD 2AQ2B 1G8ZD 3EFXD 1LTRD 1V1PA 5ELEA 1PTOB 3KLSX 1JWMD 1LTBD 3V05A 1D5ZC 4DXGA 5D3IB 1XXGA 1PZID 4RGMA 1CQVA 4RHSA 4UDUC 1DJRD 1PRTB 1S5ED 2RDHA 1TS3A 4RFBA 2CHBD 1S5CD 1I4QA 4L63B 1EU3A 1TS2A 4L6TB 1S5FD 1CK1A 1SE2A 3O13A 2WV6D 1EFID 1LTAD 1SE4A 3GP7A 1SXTA 3OWEB 2O2LD 1I4RA 1L0YB 1CHQD 1RCVD 4BWGB 1S5BD 1AN8A 1SJED 2XN9C 1BXTA 1KLUD 1RD9D 3R8BA 1TS4A 3BZDB 1ENFA 4K6LA 1EWCA 3DWAA 5D3DA 1LT6D 1TY2A 1V1OA 4O1NA 1TY0A 2R61A 2NTTA 1BCPD 2IPKD 4RCOA 2QILA 1JWSD 1LTID 2IJ0A 1LLRD 1PTOF 1XTCD 1CT1D 1BCPC 1PRTF 1GOZA 2TSSA 1YN3A 4DXFA 2J4XA 3BVGA 1JCKB 1LO5D 2XRSD 1KLGD 1RDPD 1EEID 3DWPA 1D5MC 2ICIA 5FKAC 1D5XC 1FD7D 1HXYD 1F77A 1JWUD 5TSSA 1RF2D 1LTGD 1ESFA 4OHJA 1B1ZA 1FNUA 1S5DD 1ET6A 1ET9A 1QILA 2SEBD 1EU4A 3SEBA 3URYA 1LTTD 1SE3A 1BCPB 1LTSD 1HQRD 3BYYB 1TS5A 3CHBD 3R2TA 1CHPD 1LT4D 1LT5D 1UNSA 1YN4A 3MFGA 1HA5A 5ELDA 1PTOH 5FK9C 5I4DA
chains in the Genus database with same CATH superfamily
1VS0A 3S1RH 4ZKBB 2UXDQ 5KEEA 3VH3B 2NN6H 3WAPA 4DV6L 1B44D 4E3CA 1F9PA 4II2B 5MPOA 1K8MA 4RGTA 5IGGA 4YTNB 3OJ3A 4HIMA 2ZNVB 3Q0AA 2ES2A 4GN1A 4YHHL 4HKZE 2YLMA 3RUIB 4IWQA 2JRHA 1SSNA 2JPHA 4H7BA 1HZAA 2L15A 4C2MB 2KHJA 5BO4B 2AYOB 1FRDA 4YY3L 1XQQA 4HVBA 1EYAA 2L1AA 4QUFA 1EQRA 3RLNA 5J2RA 3R3OA 2UU9Q 5M3FB 4A3DH 1QOGA 1QUQA 1SFOH 1L4ZB 3P7JA 2VH1A 3AV8A 4C7ZA 2QKIC 1DOLA 1RYJA 3AEDB 1YJWA 1YI2A 3GZNI 1TWHH 4XWWA 1LTBD 5E3FA 4LFCL 1C4CA 3ULJA 2PVOD 1RIPA 1R9TH 3PTFC 5JEAH 5IT9E 4B95A 1SYEA 2K05A 1EY6A 5D14A 3J81i 3TEZA 2QCPX 1JMCA 2CJNA 3M4OB 2MJEA 2KJXA 1R4NB 1EQQA 4JBKA 1WMHA 1B9MA 3U2SC 3QIAA 3N32A 3NVVA 3RULA 3GP7A 4WWPA 2WFWA 2W55A 1UWMA 2JA8B 3IKJA 4D2KA 4AYBE 1PYSB 4HR7B 4KSKC 1XF5L 1JC7A 2KO3A 1STNA 5K36H 3EHVA 2PW7A 1WWTA 3I3CA 4G11A 4RF0A 1BXTA 4Q5VA 1B7YB 4JI5L 1JRUA 3NUCA 1NVID 3MEFA 3BY4B 5HGQA 3PUWA 4KY6A 2CR5A 2NYZD 1HNWL 2B63B 4TQ0A 1H8CA 3NVWA 3KBXA 1LT6D 3Q6BA 2RBMA 4BBRG 1TY2A 2ASQA 4X62Q 5BYQA 2QJLA 3P42A 3ZJUA 1Q12A 2C9OA 1EQTA 2IPKD 3AEBB 2WB1G 1XYIA 4A3GH 1F2ZA 2JX5A 2N7DA 2WDQB 4DAPA 4FHKA 2O5IC 1C76A 4L1BA 4LCDE 1KHIA 2I1KA 4JI1L 1BCPC 4BZAA 4XDCA 3GQBA 3LGJA 1Q82C 1FFVA 4DAYA 1HZ5A 2DYMA 2IGGA 3AEFB 4XQJA 2XTIA 2QC8A 2K28A 1F9JA 1CZGA 2L0TA 4DUYQ 4F7ZA 1QOAA 4YTPB 1DOXA 4AYBB 2UWQA 1FD7D 3CW2C 3HOVH 1TWFB 4OL7A 2ZVNA 1XLQA 2K8BA 4X65L 3ND8A 2TMPA 5DM73 3NTKA 5JPNC 5M3MB 1OO9B 3UDGA 3R66C 1B1ZA 4AQYL 3ONSA 1PA6A 4DUZL 1N9WA 3E9SA 3AEAB 3MXUA 2A68D 5GAHC 2VH2A 5D65A 3KH0A 5AZFA 2NBVB 4JCVE 3HHMA 1HQRD 5KHOA 3A74A 2KCMA 1WFYA 3C2PA 1T0YA 1R4MB 3S16H 3EFUA 3NJTA 5CTRC 1EF1A 1A70A 4B08A 1C3TA 2MNAA 4ME3A 2WXPA 5CV6A 2CH4W 1JE4A 2CQAA 4KJOA 3ZJYC 3NUHB 3I72A 3Q14C 4ILWA 3WAOA 4E74A 2BE5C 2OTLA 1T0SC 2LFIA 2MP1A 2HUGA 3VYRA 4M00A 5FK9C 2FHTA 3H1UA 2G9HD 4XTCS 1FPYA 1K83B 1SF0A 1C4QA 3ML9A 1DZ1A 2K8HA 1HUMA 2BTEA 2WAQE 2EKEC 2R7ZH 1HH2P 3I63C 1CUKA 4RH6A 2JU6X 4GDLB 2XWBB 4TQUS 3KF8B 3S2HB 1PTOC 1RM6C 2NVUI 3C0RB 2NR2A 2J7QB 2N4FA 5C0XJ 2M00A 2P5ZX 4DK5A 1DM0B 4X64Q 2H1EA 2K9XA 3CRKC 1MHHE 1XPOA 5EE3A 4RHRA 4NAWB 4C3IB 1Q5WB 1J7CA 1T5EA 1C9OA 3AQQA 2OHFA 4DR4L 3IAS1 1EUJA 4NMZA 2G3QB 4MGKE 2UYZB 4HJ5A 1JICA 1STHA 3J80i 1WTVA 2AQ2B 2Q2TA 2L55A 2KDBA 2G5DA 1GUAB 2MO0A 3M85A 2O6VD 3KUZA 5DEHA 4DF7A 3S1RB 1YJNA 4B9KA 4XZ4A 2IYDB 2JVCA 2RGFA 2HTME 5DNFA 1A2UA 4L6TB 1LTLA 4JBMA 2C5CA 5GQOA 1CK1A 1E0ZA 4KMUC 4CKBA 2UUAL 1N34Q 1H9MA 5G3LD 5M5WH 2BCOA 2G45B 2GLSA 2BW2A 1SE4A 2INDC 1O7ZA 2D0PA 3ZYYX 1WGGA 2Z0DB 4KKJA 2NZ1D 2RSNA 5BR8Q 2K04A 2O2LD 3D32A 1HR0L 1V80A 2K01A 3QJYA 5CBEE 1OXTA 2F0JA 1HZCA 5C5LA 1KD1C 1CHQD 4A3DB 4KHVA 3S24A 4HROA 4G7ZC 3ERSX 3U9OA 1SFOB 4JWSC 4EEWA 2EY2A 5CV7A 3W3AA 1WE7A 4WJWA 3CCLA 2CS4A 2PKOA 3BZDB 3VYSA 5KRUA 4K6LA 1TWHB 2OOBB 1EWCA 4LNKA 3P4RB 4ZUIA 3GV3A 5C3WA 2Q8RE 3I2ZA 4J1MA 1R9TB 4LF6Q 2OEDA 2N9KA 2F0GA 3WIMA 4MSMB 2L32A 1KDAA 1WJJA 3ZUNA 2ONQA 2X69A 4AOFA 4II3B 4V0BA 4LF4Q 1QB5D 2WXHA 5AEKB 2FNJB 1ZGUB 3G6JB 1SNMA 4KN7C 5AJ3L 1KM7A 2IX3A 3I5JC 1DOYA 2AMCB 3SHLA 3ER0A 4DAVA 4GOPC 1UD7A 4JBWA 4KSLC 4BA2I 3L16A 4MJSB 1VQ5A 3QOLA 1XMOQ 5EE0A 2LVOA 2EPBA 2JXTA 2VW9A 1EEID 1VZ8A 2ZTEA 1WGRA 4YT0B 2MEKA 4MSQB 2EKIA 4NXNL 4E71A 2FCNA 3GV6A 1VZ6A 2SAKA 3AE9B 1IBMQ 1HXYD 1IKLA 1TIID 1JWUD 3NZSA 5TSSA 4A3PA 1QE6A 4MGIE 1AZPA 3S2AA 3CAMA 4GNXB 4IUTA 3OYYA 1I6HH 1VR9A 2WQYB 3U7DA 1R4NI 4A3FG 3R2TA 2MWSB 4LDTD 1U5KA 5IYDH 1WJUA 1K8AC 1C1YB 1FVIA 1TGZB 3BDLA 1VCIA 2WDTB 3QK0A 4CKCA 2AKWB 2FIDA 1NR4A 3SVMA 4A3GB 1WXSA 2PMZB 2V3PA 4HXDA 2XK5B 3RCZA 1O80A 3A5ZB 3DBSA 5C2TB 2F4VQ 3PLUA 4GS3A 2N1WA 1SMXA 1MHWC 1E8XA 4NY0A 3OMGA 4OO1H 3HP3A 4TVAB 5JVG3 1WX8A 2HJ8A 2FCSA 2LGIA 2AL6A 2ON8A 3RNBC 4GOPA 1HNXL 3K9PB 1X1MA 1YNNC 2RDGA 3CC4A 5EDSA 3HKZE 3R93A 1O7YA 5LMUQ 4DV1Q 1NEKB 1UE7A 3PUVA 1U4AA 1K3BC 3KWVA 3RD2A 1D4BA 1FCCC 1K53A 3IFDA 4CJ0B 5ELBA 3I57A 1Z47A 3TL5A 4FADA 2M9VA 4DV0Q 1UBQA 2M19A 1Y1VG 4JI4Q 3S16B 2MBQA 2N1VA 1SDFA 1WFQA 3I56A 1L0XB 3I4MG 1TKWB 2J53A 4IURA 2PW9A 2WNMA 1DCZA 1X55A 2MQJA 4F7XA 5EBDA 3KLSX 3L54A 2N9LA 3Q8EA 1PH6A 4RGMA 1L1OC 1PH1A 2R92H 1QVFA 1JORA 3TP6A 2BA0A 4FULA 4DNIA 2KHWB 1G2SA 3CF6E 4R1JA 1IW7D 4F87A 5IP9G 4IPCA 4IPDA 1I94Q 2R7ZB 1V1QA 1EU3A 1YMHE 1SROA 2FJ2A 4KJNA 1TIFA 3GB1A 1EWHA 1HNZQ 3VR3A 1V8CA 2KNBA 4A93H 3A9JB 3I9V1 4EZJA 1FR3A 1WTPA 4KN4C 1UZXB 3FILB 3W1YA 3ZJVA 3SFEB 5FLMH 3I73A 1PGBA 4IQZA 3TJPA 2PZTA 2X6GA 4BBSG 4WJPA 5IYBG 4IM2A 4MM3B 4WURA 1NNXA 2LVPA 2KJ6A 3NBHB 1CMXB 2O6VB 1SJED 4BY1G 4DV4L 2L4NA 2LXJA 4IUMB 3MTNB 2D9UA 1TS4A 2NBUA 4J3OD 2F0PA 1G6ZA 1U4PA 5GMVA 5D3DA 2KCTA 4US9A 1GG3A 2RKSA 3ZJTA 2LJIA 2E74C 2FIFA 1S72A 4V190 3Q3OC 1LTID 3C3LA 4LAAA 2K5DA 2KEDA 4JG2A 3N1XC 3FHWA 1L1OA 4BVUC 2J0JA 3OSOA 5K5PA 3F2CA 5FO7B 3AE6B 1VQFA 1Q1OA 4JI0Q 4IG7B 4JV5Q 4BS9A 1O7IA 4BBNF 4EQ5A 1QKZA 2QDLA 2IO3B 2K03A 3ZIMA 3MXNA 1BMLC 1JMLA 4LF8L 1ZP0B 5I9OA 2N0SB 1JE5A 2VNUD 2MP2A 4NJCA 1XNQL 3H94A 1KQSA 1I7HA 2MFIA 4IWPA 3DHIC 3HOUG 3BDOA 3ABVB 1HZ9A 3T1YQ 3H3VC 5DAUA 2CU1A 3OLMD 5FJ8G 3OPOA 2IHEA 1MIUA 4A3IG 3PIP3 4KGSA 2J0MA 4Y52H 3L08A 5D6JB 3C19A 1MG8A 4I7ZC 4ZRQA 4OGQC 3TMEA 3CD6A 3AE7B 4F1SA 1F0ZA 3U30A 2F4IA 3B6YA 4KV6A 4PMWA 4P74A 1EFWA 2KCCA 1F2RC 4YWMA 2ZM6L 2I2YA 2I5MX 5EE1A 4OONA 4A3MG 2BB5A 1YX5B 2D10A 4DV5L 1X3FA 4QB4A 4CHTB 1FGBD 3MWYW 1PZKD 2EYFA 1YITA 3C46A 3DMUA 2REXA 4FJYA 2KECA 2EXDA 3IRBA 1IZ6A 3UIOB 1AP0A 1XD3B 2F0WA 5J18A 5LMNW 1ZYRD 3P1HA 4B3SL 3DCGA 1I6HB 4LDTB 3BVZA 4KKIA 1AW7A 1PH7A 4QQBX 1QOFA 2GBMA 2W9NA 4ITKA 4B6WA 1KTKA 4TSSA 2AWNA 2HHHL 4ARCA 2LD9A 3RUZA 3NK9A 1SR3A 4PZ7A 5EKIA 1FFUA 3VTUA 1E1TA 2HDMA 4TKOB 4OZCA 2A6EC 4C1NI 3H3VI 2FUG1 1CQFA 2Z1CA 4BXXG 2JZPA 2KAJA 3CIRB 5KNDA 4HJKA 4EFOA 2KCNA 5C0XI 1WF9A 2MHVA 1VQIA 1YHAA 4X3UA 5BN3A 1LABA 2INNE 2MO1A 2EIFA 2QDBA 3K80C 2KJHB 3BG3A 4F8MA 1MSHA 3X3NA 1S5FD 1HFGA 1RWSA 2KOXA 2HTHA 2MSED 1YNJC 4JGHB 1F2RI 2WV6D 3DBLB 4A3KH 4UY8C 1JOOA 1VF5C 5KYLA 4FF2A 3NG0A 2BWFA 2BBCA 3NTIA 3NZ3A 2B8FA 1AH9A 3M4PA 3ULPA 3NS1A 1XNRL 5EGTA 4IO9A 1LXDA 3A1QB 4ALPA 4POFA 1LV9A 4MTKA 4C3JG 4L5RC 3DWAA 4WFN3 2EZVA 5JJKA 3ZGZA 1VQDA 3PMFA 2JE6I 3AXCA 1ZKHA 4HK2A 2R92B 2VL6A 1WM2A 3FVQA 3AU4A 3CWIA 3L4PA 1UWXA 3PHWB 1BCPD 4QGUA 4C3HH 3OTOL 1LLRD 3EQLC 4J15A 3V3XA 4G50A 4BKSA 4O0AA 5J39A 4M0WB 3G7LA 5DLQE 3PIPA 2E2IH 3EN2A 1XX8A 1STYA 4FP5D 4IUQA 3E56A 1OXUA 5LLIA 1N5WA 5ELOA 2E2JH 4A3LH 3I70A 1UBIA 3TBIB 1EWIA 5FKAC 4U673 3HOVG 2RPQA 1SMYC 4HDQA 3SFDB 2FBWB 4K81A 2EMSA 3OW2A 1N61A 2JZZA 2Z6KC 2LY7A 1F77A 1J5EQ 1XMQQ 3J7AF 1GC6A 1XLNA 1FGUA 1E3PA 1ZXIA 2WP9B 4ICUA 2Q8TA 3DM1A 4HLEA 3KK7A 2PVGC 1EU4A 1WOCA 2JA6H 1IYVA 3BINA 4KDIC 2J0TD 3CSTA 3IG3A 1EYGA 3RN9C 4FXGC 2KX0A 4XDDA 2F0SA 4JI2L 4PS8A 2QA4A 2OXPA 1PLFA 2KN5A 5M5XB 3NRZA 4A3JG 1GB1A 4HEDA 4H02A 4DHZE 3MFGA 3WALA 1LYLA 4KKTA 1OXSC 1XTDA 2ZVOA 4N9PA 1SSOA 4PT5A 4WIPA 1F9SA 1PTOH 2VQEL 2DAJA 3HG9A 2NS5A 3OG5A 3SU8X 5C1ZA 1WD1A 3ZKJC 1QUQB 1AZQA 3V62A 1OQRA 1PTOD 2O4XA 3KQ4A 3GZNB 5E1FA 4RKLA 2BH8A 5GAEC 2MX2A 4OELB 1J0GA 2XVSA 1NAPA 2X8XX 3HOXH 2KDFB 3P4PB 4HN7A 1PFNA 4JYAL 1F9RA 1HZBA 4A3CG 3E5SA 1A8VA 3K0YA 5JJLA 1M90C 4GKKL 3DXJC 2NCNA 1Z5SB 4JWUC 1TYGB 3RYTA 4WJQA 1G2TA 2Z6KA 1JR0D 1ML0D 1VQJA 4OWXB 1Y69U 3RZOH 3Q23A 1LGRA 4A3BG 5CBAE 5C4JH 1WTRA 4RM9A 4YCWA 3CCSA 1TWCH 3N20C 4MGZE 4A76A 4HIKA 4K2LA 1SNQA 4DHZB 3AI5A 2L1BA 4GLVB 3VR2A 2IY0B 2EYOA 4GU2A 1V1PA 5JHAA 3QIJA 2SNSA 3PV0A 4TUUA 2KEEA 4ZKCB 1YIWA 4HIDA 2KT7A 1OQYA 3I4NG 3AE5B 1UWVA 4HCEA 4C7YA 4IFDJ 2FINB 1OFFA 2Y5PA 5H1SE 4DGZA 3DEOA 3FEWX 3NXWA 1GUNA 1A0IA 2IZVB 4N8X1 4G3XB 2J0KA 2Q2HA 2UXDL 1OTRB 2L8JA 2WU2B 4R8IA 2G4SA 2VQFQ 4IPGA 5LL6X 2CCZA 2K5PA 4ASWC 1JQ4A 2B3AA 3QWNA 4HCSA 4L2YA 1CFMA 1UF0A 3TIXA 3PO2G 1E2ZA 4DWFA 1IBXB 3SK5A 4NB3A 3T3NA 4BWGB 3NENA 2EYHA 4NKLA 4DV2Q 1N36Q 2NVTH 2W54A 1WYGA 2K6QA 1EIFA 2CU3A 3H15A 2BS2B 4EQNA 1ASZA 2UXCQ 2KLCA 5C3EH 1Z6HA 1IPGA 2PPBC 3Q8FA 1FXIA 3EC8A 2E75C 3MZ5A 3TZUA 4MIUA 1WH3A 4WQOB 4USAA 3M62B 2KFJA 4LLGM 4BA1I 4ODGA 2D2CC 1VQNA 4ZRKA 3BDCA 5T1IA 3T4AC 3ZLZA 2KACA 3IAM1 2IBIB 1SYCA 2AEHA 1OGWA 1GOZA 1HR0W 1QLBB 1HEZE 3NBIA 3IAYA 1JRPA 4W9IA 1J8IA 3HOWG 1JCKB 2JK8A 3K0XA 1C7YA 3L17A 5CV5A 3JYUA 3NVYA 2RVLA 4K0KL 3DWPA 3D31A 4B3RQ 2ICIA 3MP9A 2YU9B 1TWFH 3S15H 2JSVX 1EYDA 5C44H 3ND9A 2V4DA 3RLFA 3V96A 3STBC 3K57A 3NE5B 3I3TB 5JZEB 1L6VA 3L13A 1VRAB 4NPNA 2LXKA 3AFPA 4X66Q 4R4IA 3GTJH 2LEKA 1RKNA 2NPTA 3PZ7A 4ANXA 2V1CC 2E5LQ 1H9JA 2F0LA 2C60A 3UE0A 3G71A 1LTTD 3PF5A 1Y1WG 4R4TA 1ESRA 1UE5A 1BCPB 4K3BA 2EOTA 1YHQA 3ZNZB 2EY1A 1WRIA 4M01A 3H7PB 5AZGA 3WAMA 4C3HB 3DWMA 1TKEA 4RNAA 1OQQA 4EZKA 1LT5D 1HTQA 1L7YA 3HOYG 2CKHB 3G48A 4FF1A 3QCAA 4AQ7A 1WYDA 1VD2A 4X62L 5FOBB 2E2IB 2YVCA 3TEYA 5ELDA 1YNND 1K83H 2E2JB 3PRPB 1IBKQ 1IL2A 1MI0A 2ZXOA 4KVGB 2CWAA 2ID0A 2D0OA 4PS7A 4DXAB 5CR3A 2A19A 3K81C 4DV7L 3AE3B 3DOWA 3EFCA 3KUPA 2M4NA 2KMMA 2XRQD 5IWAL 4FN2A 4EOYA 3QJZA 4DUYL 4OXPA 3VDZA 1PYWD 2A1AA 2LHEA 1BOSA 2EVBA 3W2DA 2MA9B 2OQKA 4WAAA 2EY5A 2FFKB 1KRTA 2JA6B 3DBHI 3IHPC 4MACA 3WOEA 5M9OA 4PYUA 5BMIA 1TBEA 4HPPA 4OW0A 4R3DA 3MC9A 1HTLD 2W3SA 1HUNA 3GD7A 4BBNC 3OMCA 2CQOA 1AARA 2KDIA 3BK1A 5J22A 5EKLA 1VQGA 1D3ZA 1RTOA 1SE9A 4XT1B 3J7A5 3H9DA 3TP8A 1Q3LA 1EY8A 4ZLTF 1VJKA 1Z7TA 3OIQA 3OOCA 1PTOB 4QF4A 1NI2A 1T0QC 2R2OA 3GE3C 5D3IB 2KC1A 3VTWA 3W1GA 4GKJQ 4UDUC 2HQLA 1B50A 3W9CB 3PRZA 2QDFA 1HE8A 2JY6A 1NBFC 4K3CA 4L63B 3SE0A 1GM5A 3HOXB 4EGVA 1AWDA 4MH8A 2K1BA 4KDLB 1K50A 1BBWA 4MEMA 1TZOA 3EIVA 2QHOA 4KTAA 1SN8A 3NPPA 3CC2A 4LFBL 5I9PA 4DBGA 2HJ1A 2PZUA 4K7SA 5FLXL 1QZGA 1E8YA 4L5SA 3RZOB 2PW5A 2NVYH 2F3IA 2LXCA 4WJOA 4JI3Q 5C4JB 3NY5A 1KXLA 4WJNA 2ACZB 1WXAA 1S40A 3GE8C 4G57A 1QWYA 1TWCB 3FKIG 3RMHA 2X38A 3N1ZC 1H4RA 2VUMG 1YZ6A 3S2DH 2G9DA 3UDXA 1KOTA 1KJTA 2LUMA 2OEOA 2KWDA 1E0BA 3AFQA 4UPAA 1X3EA 2KA7A 4LTUA 1Q0WB 4KHPQ 3GO5A 3A8JE 1D7QA 5J17A 2NTTA 3SHQA 2ZCCA 2IJ0A 2BYVE 2DENB 1WTOA 2O2VA 5IYCH 2R2QA 1K0SA 2WYQA 1VQPA 3ZDTA 4OWWB 1PRTF 2QCZA 3E3XA 1WZ3A 4HDOA 3V6EB 3PZDA 3X0WA 3C1EA 4I6NB 2VS1A 3TEHB 2WXNA 1SIFA 2AX5A 3M3YH 3DVNU 3Q69A 4Q0FA 3H3VH 1U9RA 4NPSA 1N34L 4IALA 4DNTB 5EJWA 5C0XH 2NVTB 3G4SA 1WY8A 2IGDA 2JQRB 4REZA 5BR8L 3JAML 1H9SA 1GAQB 4JBJA 2JN4A 3KLRA 1RTNA 4YCVA 3URYA 3SK8A 4CDEC 5C3EB 4GOPB 1LTSD 4GLXA 1W2BA 1VLBA 2JWUA 2NMQA 2BWES 3HIZA 2PTLA 5KIXA 1Q81C 1X3PA 2F0VA 2DJFC 3BS1A 1X32A 4IUPA 1DGJA 3K8AA 1CHPD 3U7ZA 2NZOA 2WP8J 5KYIA 2V9HA 3A55A 4LF6L 2QMTA 2IO1B 2IWHA 5IGDA 4C4VA 2OF1A 2H4OA 3RN5A 3MHBA 3IFTA 1CJEA 1XCTL 2JXXA 3Q8CA 1I35A 5ELNA 5IP7G 3S15B 1J6QA 3UI3A 1T5XD 3H0GH 5C44B 3I4LA 1PH3A 5AUKA 5KGUA 4B3TQ 4N6EB 2Z4HA 1ZPSA 3W5UB 1E90A 1I4GA 5IN7A 4KIKA 3DEPA 3GTJB 3CXCA 3J9CA 3GTQH 2PNHA 1F2LA 4YSXB 3RNAC 4CBVA 1EM7A 3MC0B 2PNRC 3NWSA 1STEA 2KTFA 2XNAC 3I8ZA 1WD0A 2L83A 2R6GA 1VQHA 5IGEA 2MQHA 2A6ED 4ME5A 3ULLA 4BKSD 1WJ6A 1YBYA 2L9HA 2LGSA 1I3QH 1Y14B 2JEBI 2C7NB 1WJNA 1EY7A 1G8ZD 4LNOA 1TU2B 3BWUD 1ZEQX 2WINB 1JWMD 2CH4A 1RAXA 1ENCA 2PIAA 3MHZA 2EJMA 2N9EB 1B8AA 4R4CA 2JA7G 3J81L 2EMTA 2ZZPB 4ICVA 4OWTB 3KBGA 1UH6A 5HFYA 1YNJD 3L3OC 2K39A 4BY7H 1SIJA 1Q46A 3TREA 3CPFA 4F88A 3AYHB 5DPRA 1WJ4A 4LF9L 2BA1A 4A4IA 1P7FA 4NAMA 1KAWA 2A5HA 1DONA 3KYDD 2KWCA 1NSNS 3DHHC 1GHKA 1WE6A 3GOEA 1V97A 4PS3A 4EE2A 2FE8A 4FBJB 3APDA 4P1CC 1TWGH 1LM8B 5LMUL 4NP5A 4ZRJA 2KJRA 2ZXPA 4K2KA 4YCUA 5DPWA 1L1OB 3ZDMC 4IFDI 3Q8BA 5J1ZA 1GO3E 1FO4A 1JW9D 4NXMQ 4YY3Q 2CHWA 3R3MA 1L4DB 1E6EB 3B0AA 3FPPA 4AIMA 3VR9B 5HHDG 1EOTA 2KQ7A 1T9HA 4KD4A 4A3EH 3MXNB 4FJVB 1NENB 2JA9A 4TRDA 2UU7A 2N7EA 2WAQB 1PFSA 1II3A 1E2WA 2A74C 2BKRB 2MP2B 3Q3FA 1ZE3D 1WTWA 4P2CB 4CHKA 1ILQA 2I46A 2BYTA 2Q8IB 3PUZA 5E6OA 1NCVA 1E2VA 1SMYD 5BN4A 4CJ1B 2DN8A 5C4XG 4ANVA 4ZHPA 3BVGA 1RLFA 4ID6A 1WYWB 1CKNA 1I94L 3PO3G 2R93H 1NYRA 4WWMA 2IY5B 2DNCA 1EOVA 4LNNA 2BOSA 2NVYB 1HNZL 3K58A 2LFNA 1E9MA 2KHSA 2DX5B 1EY5A 1BUVT 3N6RA 3VA5A 1PHJA 1RF2D 5E6NA 4OZAA 5BMHA 1AE2A 3SDZA 3S2DB 1QILA 2WXFA 3QO2A 1DOMA 2FUHB 3A8IE 3VR4A 5EE9A 4ZHOA 3D4RA 2XBBC 1DOKA 2RSUA 1ACCA 4JI5Q 2MPMA 2AUKA 1WCMG 1WTQA 1KNEA 1P8LA 3D4WA 3PCOB 4DV3L 1JJ2A 1JALA 1HNWQ 3X3MA 3DWGC 1NJIC 4LFAQ 5C4HA 4IW0A 1MGSA 4FHJA 2HIXA 3J7AV 4IC7B 5CHVC 3U4EG 4JI8Q 3Q22A 3PGZA 1E8ZA 1QOBA 4EZLA 3NEMA 3SR1A 1WVLA 1SJHD 1VQKA 1H9RA 3M3YB 4JI1Q 1K3RA 4DNRB 1KH0A 1SBBB 3CCVA 3M4QA 3GTPH 5A2QL 1SEBD 2JA5H 5IODA 2VZKD 1SNPA 4JI0L 2R7DA 1K8GA 5D7GA 1IKMA 2RF4A 2ZPYA 3BYTB 4RGOS 4N9F4 5DCNA 2VRRB 2EDGA 2MGSA 3KOJA 2OWOA 4X65Q 5M3FG 2KDMA 2SNMA 4PYZA 1NMGA 1W6JA 4GIVA 4WQMA 2RHQB 2L52A 4DUZQ 5DM63 3AULA 1LUZA 3QAQA 3J80L 4LF5Q 4K8JA 4DQOC 2BQQA 1L0VB 3HRDD 3PS6A 3KF6A 3T1YL 1BBXC 2RSOA 2K5QA 4B3MQ 4MH0E 3ZRFA 1VMCA 2F0MA 4YIJA 3V05A 2KD0A 5JPMC 1PUTA 2N7JA 3A4RA 1I5FA 4DA2A 3MAQA 2WXGA 3BIID 1X65A 1EIGA 3DVNV 3H0GB 3Q2AC 4C3JB 1P3QU 4NQLB 3CC7A 1FRRA 4GN3B 5DPSA 1BQQT 1Y56A 2JA8G 1N5XA 1EFID 3GTQB 4FDBA 1LTAD 5I2YA 2LMCA 2A69C 1Y8NB 3QHTA 1Q1EA 4IUVA 4A3OA 2HCCA 3K7UC 1YIJA 3ML8A 3HVDA 1KDBA 3F2BA 1EZ6A 2EE1A 4DR5Q 2LRWA 1I3QB 3UQBA 4FLHA 2B63G 3AEEB 1E22A 4KHZA 3AM9A 1EWYC 4FF4A 2PEAA 4DR6Q 2EYMA 2BVCA 3ZO5B 3H6MA 4M1UB 4DR4Q 3EGRA 4W9GA 4HJ9A 5GADC 2ENBA 3J81c 3K59A 1QOHA 1YX6B 1WGDA 4IWOA 2QILA 4RMAA 3HKZB 4BY7B 2INCC 2OQ0A 4CO7A 2UXBQ 4A6QA 2PMVA 1S4ZA 3V60A 4AYBG 4EX5A 2I1JA 1G291 3STBD 3PVLA 2XRSD 3VTVA 4NDXA 2MRPA 3UINB 1TWGB 4HMIA 4P73A 4R4QA 1BO0A 4YWLA 1XCQL 5M3MG 1A5RA 1R4QB 2LGXA 4W9LA 1HQMC 3Q3NC 1UE1A 1TZ1A 2K1FA 4W9EA 1SNDA 2K33A 3LXFA 2BF8B 2KYWA 2AUJD 3A5UA 2K32A 3NP8A 3UIPB 4A3EB 2GRIA 5FO9B 4EQPA 5M5XH 4IOCA 1MHXA 1NTGA 3PGEA 4IUUA 1KAAA 4IJLA 4LJZC 4GSWA 5DPTA 4HAEA 4I7AA 1UNSA 3DBRB 3NHEB 3EROA 2KXJA 3W1SA 4G7OC 3A7LA 2BS4B 5AFWA 4PMBA 4BFRA 3R7QA 1U4MA 1I6VC 2R93B 5AJ3Q 1UUPA 2N49A 1VDVA 3VFKA 1NDDA 3TSSA 1F1HA 3PUYA 5CGKA 3U52E 4X3KA 3MEHA 3OW7A 3QR8A 2Y0SE 3PO0A 1V1PB 3PIO3 1DYQA 3M7NA 5CORA 4NXNQ 2KC2A 4NAWA 1VQLA 1PRTC 4C3IG 1C48A 3NS8A 2JQOA 3HRZC 4TMAB 1J5EL 1BR9A 1XMQL 1AE3A 4JW0A 4JI6Q 2H89B 3HFZB 4KZ0A 4W9KA 3WA0A 1A63A 4LF7L 1I4HA 3TN2A 3HOZG 1BVSA 2V4IB 1XT9B 2BYEA 4EUTA 4DR7L 2LUEA 4QJFA 1ZDXA 2KTRA 3EFXD 4DDGD 1A2TA 2ZXRA 2NN6G 4DN4M 4DXGA 1V43A 4PMCA 1XXGA 3D8GA 3S1NH 1B2TA 5C3JB 1S5ED 1HPCA 2VZKB 1K0RA 4ACFA 4HJAA 1SYDA 3KLSA 2V3SA 2RA4A 1EIHA 3GTPB 2KFKB 4O2DA 4C00A 1TS2A 5HG2A 1IGDA 2JA5B 2Y0SB 2VB2X 3KJPA 3HVZA 4EKUA 1XLOA 2DZIA 1D8LA 5L83A 1U4LA 2V1YA 3RNUA 2DYOA 1W3SA 3MXGA 4A3DG 1ICFB 3BZCA 3D3RA 1YJIA 2E2HH 3DQVA 5NUCA 3ZTCA 4UAIA 3ZTDA 4JI7Q 5L37A 4A8XC 4DK1A 1AN8A 5CYUA 3W5OA 3AB5A 3VDYA 2WXIA 1WTXA 2JEAI 2K22A 3R8BA 1FXAA 3QC8B 2ZTCA 5JEAG 3CCEA 1BUIC 5EAYA 1MG4A 5IGBA 4KY5A 1P7EA 2GBRA 2Z4IA 4KX6B 2L11A 3KLWA 4G0NB 4YSYB 1TY0A 2R3ZA 4A90A 2NPTB 3PPAA 1PXUA 3B08A 2A68C 1J19A 1IBLQ 3V61A 3PZ8A 1VQOA 1UELA 4I6LB 2KWVB 4KGTA 4AH6A 3TEXA 4HKQA 2EY6A 5H92C 1CSPA 2JXMB 1DGSA 2N55A 2XGTA 2YU9H 1AFPA 5K36G 1E1OA 2DNEA 3VHTC 2C7HA 3Q6SA 1OXXK 4GN5A 4CDCC 4XX5A 2UUBL 3LX0A 1CTMA 1L5PA 4W9JA 4BKGA 3QARA 3N3KB 4O42A 1P1AA 3L0OA 2GBNA 2MUYA 4KI0A 4U68A 1WTHA 4DK6C 3CMAA 1SE3A 1WSPA 1KL9A 1P16A 5C3XA 5FR3A 1TS5A 4DV2L 2JF5A 4S0RA 2DY8A 4A3GG 3BU2A 1EF5A 1PDQA 5COYA 2AWOA 4P72A 3CCJA 3DBHB 1YNXA 4KGRA 2UXCL 2OTJA 3S1QH 4GMVA 1ZKOA 3SK4A 2D5DA 3N9YC 1E7PB 4IFDH 1RJTA 5M5YH 3OHXC 1ZW7A 1KRHA 4CDDC 1EUVB 1D6EC 1PH4A 5ELFA 5E6JA 2AQ3B 3WWVA 1M4VA 2C5LC 2MBOA 4UP7A 5HGTA 4H44C 2WX0A 4A55A 5C5MA 4HMJA 1CSQA 2HCIA 3MFYA 2Z9HA 4K5VA 1MPEA 3BVMA 4LMQD 4RM8A 4B3RL 3IL8A 1Q90A 3A8KE 4OX9L 1L0WA 3E0EA 4CQNA 4IOAA 1YN5A 3ENEA 2BE5D 2NBFA 2WKCA 2F1MA 1XNQQ 4X66L 2MJ3A 5TR5A 4IKGA 4ZAIA 5LNK1 2NUCA 1B4OA 1VQ6A 2Z8LA 2AQ1B 2BB6A 2JJQA 2H88B 2HDEA 1YHBA 1GUSA 4HJGE 3PRMB 1B9NA 5ELEA 3S17H 2YEPF 2EYLA 3T1HQ 4P71A 2R7ZG 1IYJB 1P9DU 4TKNA 3NVZA 1TQOA 1TS3A 4XQNA 1AYFA 1ROEA 3A9JA 3DVGY 3A54A 3FILA 1WGYA 2WB1E 5CHFA 4IN3A 1IBKL 4CKEA 1SE2A 2IX0A 4FXKC 3UI2A 1ZXTA 2MCNB 2INPE 2YYZA 1CZPA 4MM3A 2FMMA 4DV5Q 1F52A 2F0DA 3VR8B 1Z2MA 3DBRI 3CU7A 3L2PA 2UUCQ 2CFMA 1VQAA 3NBHA 4DR3Q 1S1QB 2O2VB 1G51A 1WMHB 5IGCA 2D3AA 2NB0A 2A8VA 4NQKE 3EJIA 4IPHA 1C0AA 4QIWE 1UGMA 3P4SB 4L5QA 5IT9L 1EL0A 1IXRA 2F3WA 2D2QA 1PYBA 2I0QA 1X56A 2XN9C 3AMUA 3CF5A 3AE4B 3QWZB 5G5HA 1RD9D 2QSDA 1GXDC 1O7LA 4S17A 2AHOB 4CJ2C 4W9FA 1CI3M 4HSVA 1UAPA 1V6EA 2D3GA 1Y8OB 3S1NB 3VAWA 3QB3A 4O1NA 1D1KA 4ZYNA 2HIVA 4DR1L 4A3FH 3RNFC 1JWBD 1SB3C 3A9KA 5JOBA 4BBRB 3H8HA 3CCUA 4N58A 2B29A 5AUIA 3WANA 1HTOA 1R4PB 1CT1D 2NVXB 2WB1B 4LUVA 4LW1A 3GTLH 4GKJL 3TZDA 1SAPA 2KBNA 4P75A 2L3ZA 4XC2A 3F2DA 1BF4A 1I42A 3TBLD 1M8AA 2F0FA 2E2HB 3NQTA 4DAYB 1TKGA 5EBCA 2LZ6A 4CYEA 4C4VB 4URKA 2WIIB 5CV8A 2GN5A 2I5HA 1E8WA 2L7RA 4IOIE 2N78A 1GUOA 1LTGD 1ET9A 2UU9L 2D3CA 1UGJA 3W1BA 4ANWA 3CHBD 3OIPA 2A6HC 3T51B 1PQSA 4KIKB 2WXJA 4EVOA 4ZUJA 4K7WA 2JYEA 2HD5B 1Y1VH 5EQ0A 3ALBA 3U8ZA 1QZEA 2N3SA 4X6AH 4KD3A 3IVFA 2DZMA 2MBHA 3I4MH 3NELA 1QF6A 5GAGC 2PI2E 3S9WA 4DR2Q 3IT6B 3QOJA 4JK1C 3VA7A 2E2DC 4W9CA 1MSGA 2ZT9C 2RCNA 2K5HA 4GZYC 2SOBA 5IAAC 3FDTA 2Q2IA 4MNOA 1LFDA 5IP9H 4HSPA 2WHIA 4KK7A 3MTSA 1N32Q 5IYDG 2KVZA 2KENA 4HCNB 2K0PA 4A75A 4K6DA 1FNVA 2B2WC 1E7ZA 2PJHA 1VQ7A 2A73B 3NWTA 1ZDVA 3R7RA 3S1QB 3P4QB 1CKMA 1BNZA 4BBSH 1N6ZA 2NZHA 5IYBH 4OO1G 1KIXA 1PZJD 5JJZA 2L76A 4ZRIA 2RDFA 1UEBA 3CKIB 4JI2Q 1TWAH 2WU5B 1NYQA 5M5YB 2F0IA 2KMCA 4ANUA 1CQVA 4UHVA 1DXMA 2EELA 1PFDA 2IW3A 2FCQA 1WM3A 4JIOU 2HDLA 5CMDA 3E9IA 3I90A 3PT2B 1XJVA 1T6BX 2LHDA 2ZCBA 5BN5A 2RR9A 3LWUA 2F52A 4HPLB 1RODA 4J6HA 5KHQA 1F9QA 4HIOA 1K73C 3S1MH 1FL0A 1NBWA 2AWTA 2G1EA 2KWUB 5IIFA 2LRUA 2C9WB 5FR6A 1X54A 1IHZA 1STGA 4B3TL 1YJ9A 2HE7A 3AMZA 3J7YW 3LB8C 3VYTA 1YOVB 4G4KA 1JJCB 2WXKA 1WGKA 2HT1A 2PZWA 1QVGA 3PF4A 4GKKQ 2YTVA 2L5TA 2DWQA 2RQXA 4OIKA 1X9NA 1OTCA 2DBYA 1CKNB 4DFAA 1KLVA 2JSOA 2WXOA 2YTXA 2R92G 2B2WA 2MLBA 3ICEA 1YQ4B 5C4ZA 3S17B 1YQ3B 4HTHA 2CHZA 3OJ4B 1G6JA 1V1OA 2MW5A 4NW2A 3HOUH 3B2FA 1C78A 3CSFA 4MDKE 3DUZA 1Q86C 1STAA 2ZPNA 2RPVA 4A93G 1VQCA 4FXDA 4IM0A 4ZRZA 2YEPB 4ZDVA 5HKHA 2RHSB 1LACA 3M9BA 2K25A 1HJPA 3T16A 3H7SA 5E4WC 4A3IH 5IY0A 4CDFC 1GNUA 3TDQA 5FLMG 2EJFC 2F0HA 4GDKB 3TQYA 2N88A 3PLVA 4GLSC 1SYBA 4XYQA 3JVZX 4X64L 5IT9c 1BT0A 3ZNHB 4A3MH 4QCLA 2PLPA 3P20A 2GVAA 3MXPA 4L5TA 1Y8PB 5JJIA 3UDFA 1PH5A 5JXVA 4XQQA 3FC4A 1IGCA 1HTPA 3S14H 5KNCA 3GS2A 2VZAA 4PQXA 3UQAA 4US8A 4NXML 1ICWA 1VF7A 1OEYA 2BDNA 4A3FB 1ZYRC 4JPBW 4R8NA 1V86A 4HJ7A 1E10A 3D6CA 4KV2A 2JP1A 2L00B 3GTLB 3GTGH 5A35A 1SLJA 1U0LA 1JB7A 1FJGQ 2KZRA 1EY0A 3P1MA 3W5VB 2OT2A 3EA6A 4BXXH 1PDXA 1K28A 2DY7A 1A3VA 2K52A 3KF6B 2PQEA 4XYCA 1PRTD 4IJHA 4P1BC 1HA6A 4ARIA 5LL6S 1J9OA 4K0KQ 3V2TA 4QL5A 2ZJRA 4NJ6A 4E6IA 3X23A 4RGNA 2CW0C 2QW7A 4A20A 5EPJA 1DOIA 1IUEA 2PQAA 3M95A 3AEGB 1RHPA 3Q8DA 5EPKA 1V9PA 4IUNA 5ISRA 3NQIA 2AL3A 3FAHA 3FP9A 1EYCA 1N60A 1A62A 2K5NA 2VY3A 4OZBA 1LT3D 3AB9A 1Y1VB 3I4OA 5L95C 2LMCB 3VR5A 5C6AA 1NUCA 1S3OA 1ZXHA 2KDEB 2BKFA 1RRBA 2X6LA 1VQ8A 3A56A 3I4MB 4LF4L 4R4OA 1D5ZC 2WDRB 1C9FA 1PZID 1HRJA 2ALYB 4RHSA 1YD8U 4LFAL 4C3JH 2KQSA 1EQVA 2BPSA 2C7MB 1XMOL 3NHHA 4JI8L 2KK8A 1KC8C 3KVFB 1IBXA 1IBML 4DV7Q 1Q10A 2XIWA 4WJ3M 5IWAQ 3MVVA 3WCQA 4QAYA 1JOQA 1H95A 3OWFA 1BBUA 1A3UA 3E9HA 3SD5A 4M8MA 1CM9A 4N9TA 1L0YB 2IGHA 5CV4A 1VQMA 2LVQA 4MT5A 2PYKA 1S5BD 4XXEA 1GJXA 2RMMA 2IHFA 2N9PC 3CP0A 5LMNQ 1HCZA 1D2BA 4BBSB 3ECIA 2CHXA 4PZ6A 1MKHA 2D3BA 4LJOB 4ZQ3A 1TWAB 2BS3B 1NMFA 2DYBA 1JOKA 2LKVA 4BY1B 4LF5L 2MBBB 2KHIA 3N30A 4ULLA 1PV4A 1GC7A 5D2MB 4PNYA 5BYRA 1N33Q 5G55A 2F4VL 2E8GA 2R61A 4H13C 3A33B 4MTNA 2HQEA 3RPFC 4K14A 3KDFA 4XIGS 4B3ML 3VRBB 2G4DB 1ILPA 4A3KG 4GDKA 4RG1A 5JEAJ 4XT3B 4QUCA 2DLBA 4AUQC 4DV6Q 3N1YC 1QCBD 3SXHA 4A3JH 3S1MB 2K50A 2Z59B 1QNUA 3PQIA 1GHJA 4LK1C 1I50H 4DV1L 1C4AA 4YHHQ 2PE9A 1D5MC 1WRDB 1ENAA 2F0QA 3FMCA 4RMFA 1FIQA 2PI2A 1F2MA 4LFBQ 1HFNA 1X3GA 3NOBA 1GD7A 2K14A 4DV0L 2WLBA 1IYFA 3U4VA 4JI4L 1STBA 3F8TA 3H7PA 4B0EA 4A3CH 3AECB 4C3HG 3L9AX 4DR5L 2LWPA 2F0KA 4MELA 3HOUB 3TP7A 5LXHA 5CV9A 4LFCQ 2ZNVC 2K8CA 3VXWA 4DR6L 2NBWB 1PFMA 4KKUA 1WI0A 4A3BH 1YN4A 4A3LG 4IFDG 1MJDA 4A3IB 5LHY1 1VQ9A 3GDEA 4FNFA 3U4ZA 4DAMA 2PPHA 1UE6A 2QGQA 5FLXc 3HOZB 5HURA 4LJPB 4FA6A 3LDZE 3CCRA 2J7ZA 5G3LF 2QEJC 1ASYA 1XLPA 2IO2B 2UXBL 2KTRB 4C80A 1I4PA 1TT2A 3GTOH 1YQBA 2M0AA 1B53A 1G91A 3I4NH 4A3MB 2JA6G 1CA6A 2NTSA 5ELCA 1KABA 5I2XA 1CKOA 5D94A 3RLOA 2IDYA 2A5UA 4F8CB 5J3BA 1FNWA 4APVA 3S14B 4AJWA 2XSCA 2K6DB 5G2NA 3MA2B 3ZQ4A 3CRLC 3GTMH 2LASA 1RFKA 2D11A 1A15A 1JB3A 3PO2H 4WJ4A 4ZCKA 3U58A 4FXCA 2IO0B 1E5WA 2WWZA 4GOCA 2JRIB 5FLXE 3GTGB 3VRAB 2N9XA 1VCBA 5E6PA 2QEXA 1PRTB 2PE6B 3HOXG 2IL8A 1L6UA 3IXSA 3ZVVA 5C23A 5JH5C 2CHBD 4MHEA 1QT9A 1KRSA 1Y8RC 3RR5A 4JV5L 1ISNA 3JW0X 2PMZE 3JAMc 1EIYB 3APCA 1C79A 3EECA 1GKHA 1F2YA 1LQBA 3PSEB 1Z9FA 4LNIA 4AQYQ 2EYJA 1I4RA 3HOWH 1WX9A 4K1RB 4OVZA 1RCVD 2ZW0A 4LUOA 2DAFA 3UDIA 4XDXA 3J81j 3KWLA 1KNAA 1S3SG 3Q24A 1KLUD 2WDVB 3CQZH 4JI6L 3MJWA 3HKSA 1WR1A 1XPRA 4M8AA 4C1NK 3Q3JA 3KUCB 3U9SA 3PV1A 2VB3X 3F2UA 2JYTA 2ZW1A 3TEWA 1Y1WH 4M8NA 2L12A 4KLKA 4G7HC 1JWSD 2KMAA 3KFUA 2Y5CA 2XEWA 2DJGC 3JAME 2K5WA 2WXRA 3M7GA 3T53B 4HRSA 2B76B 1LM0A 3K5LA 2LS01 3TRZA 3T13A 1VQBA 4DXFA 5JVH3 3HOYH 3F1ZA 5HY6A 3SGIA 2GBKA 1IP9A 1BDOA 2BYFA 4LF9Q 3IFWB 3ONAB 1B3QA 1CA5A 3HM6X 3ZXVA 3B1LX 3V6CB 1V49A 3P75A 4JOIC 2B3GA 3HOVB 5IE8A 3RN2A 2O5JC 2KKCA 3ZXRA 5C3EG 1NE3A 4PG3A 4JQWC 4WWOA 2A6HD 3AE8B 3HK0A 1FEHA 3H6NA 3W1SC 3A0JA 2CKZB 2B8GA 4JI7L 2FXQA 3MHSD 1V8QA 3H09A 4ZRPA 1VQEA 2GVBA 4OVUA 4MZ9A 1N63A 3D0FA 1QQRA 2C35B 4EQOA 4HPMB 4RWSC 4A3JB 1HHVA 3DDCB 4RA8A 1ONLA 2YV5A 5C44G 2E6XA 4YSZB 1I50B 1IBLL 1JROA 2UUAQ 2Q2UA 5EPLA 2JWZA 1RL2A 4H0LC 1PH2A 3LYYA 1SRUA 1HR0Q 2M2LA 1V9JA 2M56B 1R4MI 2EXZA 2MBEA 3J81E 3VUXA 1IYUA 2I5LX 4IDIA 4DDID 5GROA 5T1GA 1N62A 3DLLA 1MVKA 4I6PA 3NZUA 1NY4A 3KYHC 4JOIA 1E24A 2D5GA 3AU7A 4BOSC 1C77A 2PCFB 2F0EA 2WXLA 3EBEA 4K8IA 4KY7A 1Q8KA 3P2BA 1YJ1A 4RAUC 4A3BB 5E7NA 1SNOA 1EO6A 3TCAA 3A4SC 3CMEA 1T0RC 3FKIH 4J6IA 2OCEA 4GDLA 4P16A 4DV3Q 2VUMH 3KF8A 1Q7YC 1FM0D 1U4RA 1TVXA 2QIEB 1JT8A 3GTKH 4NNJB 1DJRD 2RDHA 1WXQA 3SDLC 4RFBA 1S5CD 3GTOB 3RZWC 3M3JA 4GB9A 3I4NB 3IBEA 4P7IA 1MJCA 1J7BA 4MN3A 5CHWA 3VVWB 3RD4A 3K7AH 3N52A 3UE1A 3CPWA 5M5WB 3OWEB 3A9KB 2K4KA 2XWJB 1J8CA 3GTMB 4AJYB 3RZDH 3PO2B 2Q5WD 4YWKA 1QG7A 2NN6I 1JWAD 4NJ7A 2DHZA 1K51A 2WAQG 4Y7NH 2OJWA 1NR2A 2WS3B 4R9WA 1TXYA 2F0UA 4BBRH 3D6WA 3TP5A 3DVGX 3TUOA 1GUTA 4IM3A 2NVXH 4K7UA 4GNXC 2DZJA 5JHBA 2E76C 4KKSA 3T1HL 2V3NA 1HNXQ 1SE8A 2J52A 2WXMA 2FAZA 4LWCA 2K7VA 1UEAB 1A3TA 2J4XA 3SK6A 2KANA 1SYGA 4I65A 3H91A 1WI5A 2Y5BB 3T9LA 4HCPB 3RFZB 3J80c 2PO4A 1FCLA 3HOWB 5IKCM 1GUGA 1XPUA 1TTNA 4XGAB 3L10B 3ETRA 5IP7H 1EY9A 2Z0SA 3PSIA 3ITPA 2UUCL 4OHJA 4DR3L 2SEBD 3CQZB 5BMGA 3EVQA 3SEBA 1TT5B 4ZK9B 4FJZA 4JC0A 1YNTE 2JUOA 4BOZB 4FF3A 2B2YC 1GVPA 2LI5A 3QQ8B 4H2AA 5IYCG 3KYCD 5A2QE 1Y1WB 4MJSA 4AWJA 2I07B 4WAFA 2ICEC 2ASBA 1KF6B 1O78A 1FYCA 3G6EA 1LT4D 1WR6E 3HZXA 4K5WA 2LJ5A 3AU5A 5CX3A 3IT4B 1SNCA 1XWEA 2KUMA 2NVQH 1M1KC 2VXWA 2F3VA 5JAVA 1V5TA 2WKDA 3HOYB 4YWGG 2ZJPA 1MD2D 1J7AA 2LGDA 3J80E 3UGBB 1OEYJ 4GNXA 5C0XG 2F0TA 1I4XA 2VQFL 2GOWA 4C56C 2CW0D 2LXAA 2JA7H 4K5XA 2JYOA 3PIOA 3TMPB 3O65B 2GBJA 1SGHA 3DWQA 1ZOYB 1JJGA 4DHJD 1PH9A 2E3TA 1K8RB 3T56B 1N36L 1FD6A 2XK5A 2GI9A 1Q8IA 4DV4Q 3APFA 3HUIA 2A4ZA 1Q1BA 4JX1C 3NSWA 2K75A 4Z9CB 3CCQA 4HWIB 4POGA 1P98A 3D4DA 1N8RC 3E0JA 4X3TA 5CC4A 1BCPF 2EYPA 3BJUA 2B2YA 4QY7A 4UP9A 5E4XA 3P63A 4YXDB 1LTRD 5AZHA 3RNCC 4N8FA 1K8OA 3RZFA 2D62A 5F2DA 1YEZA 3K5NA 1ZUD2 3H0GG 2YTYA 4Q2JA 2KVMA 1V81A 1PFBA 3TS0A 1EY4A 2CWPA 4WRDA 3LNNA 2Z0EB 4L23A 4A9AA 1I4QA 3JSVA 4WWNA 1CZWA 4DR2L 5IOCA 2KQ4X 2MJ8A 4ZOHC 1IL8A 3FPUB 2ZEQA 2K5VA 3HS0C 4A93B 4LF8Q 2WGSA 1SXTA 1B9RA 1QJOA 2V4LA 5C4XH 2E5LL 2FMCA 2H5XA 1KFYB 1RFAA 1TKYA 4JPSA 4P6VF 3RNEC 1D1IA 3PO3H 3VUYA 3ZNGC 1N32L 2QF7A 4TQ1A 2KQ3A 1NI3A 2KVRA 3PUXA 1ENFA 4ABNA 3FKIB 4LF7Q 4WH4A 5KNBA 3I55A 2VUMB 4LK0M 3T3OA 3HKZG 4BY7G 3DM3A 1KDCA 4DR7Q 2ZTDA 3GTKB 1P0RA 2K3UA 1C8CA 2W3RA 3AE2B 1V5OA 4RCOA 3B2GA 3C1FA 2MHJA 2ZM6Q 2MH7A 1PTOF 1XTCD 5T8IA 1WCMH 3TS2A 4M02A 2HD3A 4MGYE 1YN3A 2TSSA 1WXVA 3C8YA 4S3SA 3E6ZX 1K9MC 3K7AB 1HZ6A 2O6VA 4YL8A 1WZ0A 1KLGD 3ZNID 1PVOA 4B3SQ 2BT6A 3K9OB 1D5XC 3NTHA 2V0GA 3MC8A 5I6YA 3CMMB 3KJOA 3RZDB 2WXQA 2IT1A 1PGXA 2LSSA 1TR5A 2CVRA 1ESFA 4B9XA 1S5DD 3AE1B 1ET6A 4A3EG 1VZ7A 4UP8A 2HHHQ 2ZJQA 1R7SA 5H8YE 3I7FA 4KZCA 4GXBA 4C2MH 3BYYB 4Y7NB 3QA8A 1L2NA 3UF8A 2RCFA 1H9KA 4FO2A 1L2FA 3QG1A 3B9JA 4FVMA 1H9SB 4PK1A 5IO9A 3BZKA 5M3FH 2D07B 4FYDA 1B70B 4HJ8A 2L0FA 3DHGC 3BK2A 2L05A 3K5MA 2PQAB 2M1MA 3KUDB 5HI1A 2R93G 3M63B 2RDBC 4BAXA 1YJJA 1E7UA 4WORA 5I4DA 2B2TC 4DPGA 5GXGB 2OJRA 2Y3AA 4QIWB 1FMAD 1EZ8A 2IY1B 2W82A 4ZYSA 5IP4D 3M4OH 1GB4A 2F0NA 2Z6BA 4W9DA 4RF1A 4JI3L 1EEFD 4BKTA 2DUDA 5IOIA 2UUBQ 2FCMA 4X57B 3ZW3A 3CCMA 2JA8H 1E7VA 2F0OA 1XNRQ 3EUB2 3VQIA 4NZLB 1WGHA 1MFWA 1WIAA 1T3QA 3KW5B 3Q3MC 3ZRCA 3L7ZC 3VR6A 2JZ3B 3R2IA 2M17A 4JLCA 5BYSA 2B2VC 3VH4B 4KHPL 4LUZA 1JQYD 1PMRA 3QX1A 3WOFA 3OTOQ 1A6XA 2NVQB 1GJZA 4GN4B 2RD0A 2B63H 2KFKA 1XO3A 3RT3B 3AH7A 3JSVB 3T8MA 4QMGA 1K52A 2JA5G 2Y0SG 2GB1A 3PHXB 2L0CA 2IX1A 3K6OA 2JA7B 3VUWA 4DHJB 1XEEA 1FJGL 3ERQA 1TJEA 2KX3A 4YTMB 4OIJA 2R7FA 2B2TA 4CGYB 4J8QA 3VYUA 2F03A 4JE3B 3O13A 2WACA 2B2UC 4AP4C 1IW7C 2DZKA 3DHQA 3HEJA 3KDFB 4A3KB 2LGYA 3J7ZC 3PREA 4RCNA 3FKYA 1SYFA 4JVZA 1MI2A 4RKBA 4OEMB 4X3SA 1VDZA 3L0WB 4OX9Q 1BKBA 4B9WA 4OO1I 5I6WA 5M3MH 5G5GA 4IZ8A 1WXMA 3Q8AA 2K6AA 1M94A 2I38A 3RNGC 1AEXA 5EKKA 4BY1H 2JT4B 4N59A 3RI7C 1C4PA 2EJGC 3LWEA 4DK3C 2B2VA 1X6OA 2BDOA 2DGYA 1DD2A 1PGAA 2VQEQ 2SDFA 3HGBA 1FXTB 3DBLI 2A69D 4HEA1 4DKAC 2KOLA 1W6KA 4LNQA 2J42A 2ZJDA 5IGFA 3SR6A 1MJEA 3MJ5A 3DPDA 3FRPB 4JYAQ 3I91A 1V2YA 5LXIB 1LO5D 1WX7A 3RMKC 1RDPD 3A1QA 2BGFA 3U50C 1X3QA 5C4XB 1VQ4A 2M8SA 1QZHA 2BH2A 2KN4A 2CJOA 3K5OA 5IA7A 5FO8B 1PH8A 3PO3B 4B0MA 2B2UA 4JL9A 1VMPA 3AEVA 3M4YA 4XE0A 3S2HH 4AS1A 1YVCA 1FNUA 2EQSA 3AN1A 3LJ3A 3A7AB 3OAWA 4M0WA 4L8JA 1B3AA 2N8NA 4PV1C 1QNKA 1QVCA 3WDNA 2WX1A 3JAMi 1GUWA 4OVVA 5LMNL 2GMIC 4GLAC 4C3IH 4TV3A 2DNFA 2GA4B 1OXVA 5FJ8H 4DK0A 4XYOA 4W9HA 1MBYA 4DU9A 2ATWA 2KLGA 4LNFA 2MJDA 1GPXA 2M0XA 1G6PA 1WCMB 4XWTA 3JC66 3HOZH 1HA5A 3HM3A 2NWGA 4DR1Q 1N33L 2B39A 4PZ8A 4GGQA
chains in the Genus database with same CATH topology
4ZKBB 5KEEA 2NN6H 1B44D 1F9PA 5MPOA 1K8MA 4RGTA 5IGGA 4YTNB 3Q0AA 4HKZE 1SSNA 4H7BA 4C2MB 1FRDA 1EYAA 2L1AA 4QUFA 3R3OA 5M3FB 1QOGA 1L4ZB 3P7JA 3AV8A 4C7ZA 2QKIC 1DOLA 1RYJA 3AEDB 4XWWA 1LTBD 5E3FA 1C4CA 2PVOD 5JEAH 5IT9E 1SYEA 2K05A 1EY6A 5D14A 3TEZA 2QCPX 2CJNA 3M4OB 2MJEA 2KJXA 1B9MA 3U2SC 3QIAA 3NVVA 3GP7A 2W55A 1UWMA 2JA8B 3IKJA 4D2KA 4HR7B 1XF5L 1JC7A 1STNA 5K36H 2PW7A 1WWTA 3I3CA 4RF0A 1BXTA 4Q5VA 3NUCA 1NVID 3PUWA 4KY6A 2NYZD 4TQ0A 2B63B 3NVWA 3KBXA 1LT6D 2RBMA 1TY2A 5BYQA 2QJLA 3P42A 3ZJUA 1Q12A 2C9OA 1EQTA 2IPKD 3AEBB 1XYIA 4L1BA 1F2ZA 2JX5A 2WDQB 4DAPA 2O5IC 1C76A 1BCPC 4XDCA 3GQBA 1FFVA 4DAYA 1HZ5A 2DYMA 2IGGA 3AEFB 4XQJA 2K28A 1CZGA 1QOAA 4YTPB 1DOXA 4AYBB 1FD7D 1TWFB 4OL7A 1XLQA 3ND8A 2TMPA 5DM73 3NTKA 5JPNC 5M3MB 1OO9B 1B1ZA 3E9SA 3AEAB 3MXUA 2A68D 5D65A 1HQRD 3C2PA 1A70A 4B08A 2WXPA 5CV6A 1JE4A 2CQAA 4KJOA 3NUHB 3I72A 4ILWA 2BE5C 2LFIA 2MP1A 2HUGA 3VYRA 5FK9C 2FHTA 2G9HD 4XTCS 1K83B 1SF0A 1C4QA 1DZ1A 1HUMA 2BTEA 4RH6A 2JU6X 4GDLB 2XWBB 4TQUS 3S2HB 1PTOC 1RM6C 5C0XJ 2M00A 1DM0B 2K9XA 2H1EA 3CRKC 1MHHE 5EE3A 4RHRA 4NAWB 4C3IB 1J7CA 1T5EA 2OHFA 3IAS1 4NMZA 1JICA 1STHA 1WTVA 2AQ2B 2L55A 3M85A 5DEHA 4DF7A 3S1RB 2HTME 5DNFA 1A2UA 4L6TB 2C5CA 1E0ZA 1CK1A 4KMUC 4CKBA 1H9MA 5G3LD 2BCOA 2BW2A 1SE4A 1O7ZA 3ZYYX 4KKJA 2NZ1D 2RSNA 2K04A 2O2LD 2K01A 3QJYA 5CBEE 1OXTA 2F0JA 5C5LA 1CHQD 4A3DB 4KHVA 4HROA 4G7ZC 3U9OA 1SFOB 4JWSC 2EY2A 5CV7A 3W3AA 4WJWA 2PKOA 3BZDB 3VYSA 5KRUA 4K6LA 1TWHB 1EWCA 3P4RB 4ZUIA 3GV3A 5C3WA 2Q8RE 4J1MA 1R9TB 2OEDA 2N9KA 2F0GA 2L32A 1KDAA 2ONQA 2X69A 4V0BA 1QB5D 2WXHA 3G6JB 1SNMA 4KN7C 2IX3A 1DOYA 3SHLA 4DAVA 4JBWA 4BA2I 3QOLA 5EE0A 2EPBA 2JXTA 1EEID 1VZ8A 4YT0B 2MEKA 2EKIA 3GV6A 1VZ6A 2SAKA 3AE9B 1HXYD 1IKLA 1TIID 1JWUD 5TSSA 1QE6A 1AZPA 4IUTA 1VR9A 2WQYB 3R2TA 3BDLA 1VCIA 4CKCA 1NR4A 3SVMA 4A3GB 2PMZB 2V3PA 1O80A 5C2TB 3OMGA 4OO1H 3HP3A 5JVG3 2LGIA 2ON8A 1YNNC 2RDGA 3R93A 1O7YA 1NEKB 3PUVA 1D4BA 3KWVA 1FCCC 1K53A 3IFDA 4CJ0B 5ELBA 3I57A 1Z47A 2M9VA 2M19A 3S16B 1SDFA 1L0XB 1TKWB 2J53A 4IURA 2PW9A 2WNMA 1DCZA 4F7XA 5EBDA 3KLSX 2N9LA 3Q8EA 4RGMA 1JORA 3TP6A 2BA0A 1G2SA 1IW7D 4F87A 2R7ZB 1YMHE 1EU3A 2FJ2A 4KJNA 3GB1A 1EWHA 3VR3A 1V8CA 3I9V1 1FR3A 1WTPA 4KN4C 3FILB 3ZJVA 3SFEB 1PGBA 3I73A 4IQZA 2PZTA 2X6GA 4MM3B 4WURA 1SJED 2L4NA 2D9UA 1TS4A 4J3OD 2F0PA 1G6ZA 1U4PA 5D3DA 4US9A 2RKSA 3ZJTA 2LJIA 2E74C 4V190 1LTID 3C3LA 4LAAA 2K5DA 2KEDA 3OSOA 5K5PA 5FO7B 3AE6B 4BS9A 1QKZA 2K03A 3MXNA 1BMLC 1JMLA 1ZP0B 5I9OA 2N0SB 2VNUD 4NJCA 3H94A 1I7HA 3BDOA 3ABVB 3H3VC 5DAUA 3OPOA 3PIP3 4KGSA 4ZRQA 4I7ZC 4OGQC 3TMEA 3AE7B 1F0ZA 2F4IA 4KV6A 4PMWA 2KCCA 1F2RC 2I2YA 5EE1A 2BB5A 4QB4A 4CHTB 1FGBD 3MWYW 1PZKD 2EYFA 3C46A 3DMUA 2KECA 1AP0A 2F0WA 1ZYRD 3P1HA 1I6HB 3BVZA 4KKIA 1AW7A 1QOFA 4ITKA 1KTKA 4TSSA 2AWNA 4ARCA 3RUZA 3NK9A 5EKIA 1FFUA 4TKOB 2HDMA 4OZCA 2A6EC 4C1NI 2JZPA 2FUG1 1CQFA 2Z1CA 2KAJA 3CIRB 5KNDA 2KCNA 5C0XI 2MHVA 4X3UA 5BN3A 1LABA 2INNE 2QDBA 3BG3A 4F8MA 1MSHA 3X3NA 1S5FD 1HFGA 1RWSA 1YNJC 1F2RI 2WV6D 1JOOA 1VF5C 5KYLA 4FF2A 2BBCA 3NTIA 3NZ3A 2B8FA 3NS1A 5EGTA 1LV9A 4C3JG 3DWAA 4WFN3 2EZVA 3ZGZA 3PMFA 2JE6I 2R92B 3FVQA 3CWIA 3L4PA 1UWXA 1BCPD 1LLRD 3EQLC 3V3XA 5J39A 3G7LA 1XX8A 1STYA 4FP5D 4IUQA 3E56A 1OXUA 1N5WA 3I70A 3TBIB 5FKAC 4U673 1SMYC 3SFDB 2FBWB 1N61A 3J7AF 2LY7A 1F77A 2WP9B 1XLNA 1ZXIA 2Q8TA 3DM1A 3KK7A 2PVGC 1EU4A 1IYVA 2J0TD 4FXGC 4XDDA 2F0SA 2OXPA 1PLFA 5M5XB 3NRZA 1GB1A 4HEDA 3MFGA 4KKTA 1OXSC 4N9PA 1SSOA 4PT5A 4WIPA 1F9SA 1PTOH 3HG9A 1WD1A 1AZQA 1OQRA 1PTOD 2O4XA 3KQ4A 5E1FA 4RKLA 2XVSA 1NAPA 3P4PB 4HN7A 1PFNA 1F9RA 3E5SA 3K0YA 3DXJC 4JWUC 1TYGB 1G2TA 1JR0D 1ML0D 1Y69U 3Q23A 5CBAE 1WTRA 4K2LA 1SNQA 2L1BA 3VR2A 2EYOA 1V1PA 2SNSA 3PV0A 2KEEA 4ZKCB 4C7YA 3AE5B 4HCEA 4IFDJ 2FINB 1OFFA 2Y5PA 4DGZA 3DEOA 3FEWX 3NXWA 1GUNA 2WU2B 4R8IA 5LL6X 2K5PA 1JQ4A 3QWNA 4HCSA 4L2YA 1CFMA 1E2ZA 1IBXB 3SK5A 3T3NA 4BWGB 2W54A 2EYHA 4NKLA 1WYGA 2CU3A 2BS2B 4EQNA 1Z6HA 3Q8FA 2PPBC 1FXIA 2E75C 3MZ5A 3TZUA 4MIUA 4USAA 4LLGM 4BA1I 4ODGA 2D2CC 3BDCA 5T1IA 3T4AC 2KACA 3IAM1 1SYCA 1GOZA 1QLBB 1HEZE 3NBIA 3IAYA 1JRPA 1J8IA 1JCKB 3NVYA 4GDKB 5CV5A 2RVLA 3DWPA 3D31A 2ICIA 3MP9A 2YU9B 2JSVX 1EYDA 3ND9A 2V4DA 3RLFA 3V96A 3K57A 3NE5B 1L6VA 1VRAB 2LEKA 3PZ7A 1RKNA 3ETRA 1H9JA 2F0LA 1LTTD 1ESRA 1BCPB 2EOTA 2EY1A 1WRIA 4C3HB 3DWMA 1TKEA 4RNAA 1OQQA 1LT5D 4FF1A 4AQ7A 3TEYA 2E2IB 5FOBB 5ELDA 1YNND 2E2JB 1MI0A 2ZXOA 2ID0A 5CR3A 3AE3B 3KUPA 2KMMA 2XRQD 1PYWD 2LHEA 1BOSA 2EVBA 3W2DA 2EY5A 2FFKB 2JA6B 4MACA 3WOEA 5M9OA 5BMIA 4R3DA 4OW0A 1HTLD 2W3SA 1HUNA 3GD7A 3OMCA 3BK1A 5J22A 5EKLA 1RTOA 4XT1B 3TP8A 1Q3LA 1EY8A 4ZLTF 1VJKA 1Z7TA 3OIQA 3OOCA 1PTOB 4QF4A 5D3IB 1B50A 3W9CB 4UDUC 4L63B 3SE0A 1AWDA 3HOXB 4EGVA 4MH8A 2K1BA 1K50A 1TZOA 4KTAA 3NPPA 5I9PA 2PZUA 5FLXL 3RZOB 2PW5A 5C4JB 2ACZB 4G57A 1QWYA 1TWCB 3RMHA 2X38A 2G9DA 2LUMA 2OEOA 2KWDA 1E0BA 4LTUA 2KA7A 3GO5A 3A8JE 2NTTA 2IJ0A 1WTOA 1PRTF 3C1EA 2WXNA 2AX5A 3Q69A 4Q0FA 1U9RA 4IALA 4DNTB 5EJWA 5C0XH 2NVTB 2IGDA 2JQRB 4REZA 3JAML 1H9SA 1GAQB 3URYA 3KLRA 1RTNA 3VR8B 3SK8A 5C3EB 1VLBA 2NMQA 1LTSD 2JWUA 2PTLA 5KIXA 1X3PA 2F0VA 3BS1A 1X32A 4IUPA 1DGJA 1CHPD 3U7ZA 2WP8J 5KYIA 3A55A 2QMTA 2IWHA 5IGDA 2OF1A 2H4OA 3MHBA 3IFTA 1CJEA 1XCTL 3Q8CA 3S15B 3UI3A 1T5XD 5C44B 3I4LA 5AUKA 5KGUA 4N6EB 2Z4HA 1ZPSA 3W5UB 1I4GA 3DEPA 3GTJB 3J9CA 4YSXB 1F2LA 4CBVA 1EM7A 3MC0B 2PNRC 3NWSA 1STEA 2XNAC 3I8ZA 1WD0A 2L83A 2R6GA 5IGEA 2A6ED 4ME5A 2L9HA 2JEBI 1EY7A 1G8ZD 1TU2B 3BWUD 1ZEQX 2WINB 1JWMD 3MHZA 1ENCA 2PIAA 2EJMA 3J81L 3KBGA 5HFYA 1YNJD 3L3OC 1SIJA 4F88A 2BA1A 1P7FA 4NAMA 2A5HA 1DONA 1NSNS 1GHKA 4EE2A 1V97A 2FE8A 4NP5A 2ZXPA 4K2KA 4IFDI 3Q8BA 5J1ZA 1FO4A 1JW9D 1L4DB 1E6EB 3FPPA 3VR9B 5HHDG 1EOTA 4KD4A 1NENB 4TRDA 2WAQB 1II3A 1E2WA 2A74C 1ZE3D 1WTWA 4P2CB 1ILQA 2I46A 2BYTA 2Q8IB 3PUZA 1NCVA 1E2VA 1SMYD 5BN4A 4CJ1B 2DN8A 4ZHPA 3BVGA 4ID6A 1NYRA 4WWMA 2DNCA 2BOSA 2NVYB 3K58A 2LFNA 1E9MA 2KHSA 1EY5A 1BUVT 3N6RA 3VA5A 1RF2D 5BMHA 4OZAA 3SDZA 3S2DB 1QILA 2WXFA 3QO2A 1DOMA 3A8IE 3VR4A 5EE9A 4ZHOA 3D4RA 1DOKA 1ACCA 2MPMA 2AUKA 1WTQA 1KNEA 3D4WA 1JALA 3X3MA 3DWGC 5C4HA 1MGSA 3J7AV 3U4EG 3Q22A 1QOBA 3SR1A 1WVLA 1SJHD 1H9RA 3M3YB 4DNRB 1KH0A 1SBBB 5A2QL 1SEBD 2VZKD 5IODA 1SNPA 5D7GA 1IKMA 3BYTB 4RGOS 2EDGA 2MGSA 2KDMA 2SNMA 1W6JA 4WQMA 2L52A 5DM63 3J80L 4K8JA 4DQOC 1L0VB 3HRDD 1BBXC 2RSOA 2K5QA 1VMCA 2F0MA 4YIJA 3V05A 2N7JA 5JPMC 1PUTA 4DA2A 3MAQA 2WXGA 3BIID 1EIGA 3H0GB 4C3JB 1FRRA 1BQQT 1Y56A 1N5XA 1EFID 3GTQB 1LTAD 5I2YA 2LMCA 2A69C 1Y8NB 1Q1EA 4IUVA 2HCCA 3HVDA 1KDBA 1EZ6A 2EE1A 1I3QB 3AEEB 4KHZA 3AM9A 1EWYC 4FF4A 2EYMA 3H6MA 4M1UB 3EGRA 2ENBA 3K59A 1QOHA 2QILA 3HKZB 4BY7B 4A6QA 2PMVA 1S4ZA 1G291 2XRSD 4NDXA 1TWGB 4HMIA 1BO0A 1XCQL 1R4QB 1HQMC 1SNDA 2K33A 3LXFA 2AUJD 2K32A 3NP8A 4A3EB 2GRIA 5FO9B 4EQPA 1MHXA 4IUUA 1KAAA 4LJZC 4HAEA 1UNSA 3EROA 3W1SA 4G7OC 3A7LA 2BS4B 5AFWA 4PMBA 1U4MA 1I6VC 2R93B 1UUPA 1VDVA 3TSSA 3PUYA 5CGKA 3U52E 4X3KA 3MEHA 3OW7A 3PO0A 1V1PB 3PIO3 1DYQA 3M7NA 5CORA 1PRTC 4C3IG 1C48A 3HRZC 4TMAB 1BR9A 2H89B 1I4HA 3TN2A 2V4IB 1ZDXA 3EFXD 1A2TA 2ZXRA 2NN6G 4DN4M 4DXGA 1V43A 4PMCA 1XXGA 3D8GA 1B2TA 5C3JB 1S5ED 1HPCA 2VZKB 1SYDA 3KLSA 2RA4A 1EIHA 3GTPB 1TS2A 5HG2A 1IGDA 2JA5B 2Y0SB 2VB2X 3HVZA 1XLOA 1U4LA 2DYOA 3MXGA 3D3RA 1YJIA 5NUCA 4UAIA 4A8XC 4DK1A 1AN8A 5CYUA 3AB5A 2WXIA 1WTXA 2JEAI 2K22A 3R8BA 1FXAA 5JEAG 1BUIC 5IGBA 4KY5A 1P7EA 2Z4IA 4KX6B 2L11A 4YSYB 1TY0A 2R3ZA 4A90A 1PXUA 2A68C 3PZ8A 3TEXA 4KGTA 4HKQA 2EY6A 5H92C 2JXMB 2N55A 1AFPA 5K36G 2DNEA 3Q6SA 1OXXK 3LX0A 1CTMA 1L5PA 4O42A 2MUYA 4KI0A 4U68A 1SE3A 1WSPA 5C3XA 5FR3A 1TS5A 2DY8A 1PDQA 5COYA 2AWOA 4KGRA 1ZKOA 3SK4A 2D5DA 3N9YC 1E7PB 4IFDH 1RJTA 3OHXC 1KRHA 1D6EC 5E6JA 5ELFA 2AQ3B 1M4VA 5HGTA 4H44C 4A55A 5C5MA 4HMJA 2HCIA 3MFYA 4K5VA 1MPEA 3BVMA 4LMQD 3IL8A 1Q90A 3A8KE 4CQNA 1YN5A 2BE5D 2NBFA 2WKCA 2F1MA 2MJ3A 4IKGA 4ZAIA 5LNK1 2NUCA 1B4OA 2Z8LA 2AQ1B 2BB6A 2H88B 2HDEA 4HJGE 1GUSA 1B9NA 5ELEA 2YEPF 2EYLA 3NVZA 1TQOA 1TS3A 4XQNA 1AYFA 1ROEA 3A54A 3FILA 4IN3A 4CKEA 1SE2A 2IX0A 4FXKC 3UI2A 1ZXTA 2INPE 2YYZA 1CZPA 2FMMA 2F0DA 3CU7A 3NBHA 5IGCA 2NB0A 3EJIA 3P4SB 5IT9L 1EL0A 2F3WA 2XN9C 3AMUA 3AE4B 5G5HA 1RD9D 2QSDA 1GXDC 1O7LA 4CJ2C 1CI3M 4HSVA 1UAPA 1Y8OB 3S1NB 3QB3A 4O1NA 1D1KA 1JWBD 1SB3C 5AUIA 5JOBA 4BBRB 3H8HA 4N58A 1R4PB 1CT1D 2NVXB 2WB1B 3TZDA 1SAPA 1BF4A 1M8AA 2F0FA 2E2HB 3NQTA 1TKGA 5EBCA 2WIIB 5CV8A 4IOIE 1GUOA 1LTGD 1ET9A 1UGJA 3CHBD 3OIPA 2A6HC 3T51B 2WXJA 4EVOA 4ZUJA 2JYEA 5EQ0A 4KD3A 1QF6A 3S9WA 3IT6B 3QOJA 4JK1C 3VA7A 2E2DC 1MSGA 2ZT9C 4GZYC 2SOBA 3FDTA 4HSPA 4KK7A 3MTSA 2K0PA 4K6DA 1FNVA 2B2WC 2A73B 3NWTA 1ZDVA 3S1QB 3P4QB 1BNZA 4OO1G 1PZJD 5JJZA 2RDFA 3CKIB 2WU5B 1NYQA 5M5YB 2F0IA 1CQVA 1DXMA 2EELA 1PFDA 2IW3A 2HDLA 5CMDA 3I90A 1T6BX 2LHDA 5BN5A 3LWUA 1RODA 4J6HA 1F9QA 2G1EA 5IIFA 1IHZA 1STGA 3AMZA 3J7YW 3LB8C 3VYTA 4G4KA 2WXKA 1WGKA 2PZWA 2DWQA 2L5TA 2RQXA 4OIKA 2DBYA 4DFAA 2JSOA 2WXOA 2B2WA 1YQ4B 5C4ZA 3S17B 1YQ3B 4HTHA 1V1OA 4NW2A 3B2FA 1C78A 3DUZA 1STAA 2RPVA 4FXDA 4ZRZA 2YEPB 1LACA 3T16A 5E4WC 3TDQA 2EJFC 2F0HA 2N88A 4GLSC 1SYBA 4XYQA 4QCLA 2PLPA 3P20A 3MXPA 1Y8PB 5JXVA 4XQQA 3FC4A 1IGCA 1HTPA 3GS2A 5KNCA 4PQXA 4US8A 1ICWA 1VF7A 2BDNA 4A3FB 1ZYRC 4R8NA 1E10A 3D6CA 2JP1A 3GTLB 5A35A 1EY0A 3P1MA 3W5VB 2OT2A 3EA6A 1PDXA 2DY7A 1A3VA 2PQEA 1PRTD 1HA6A 4ARIA 5LL6S 1J9OA 3V2TA 4E6IA 4RGNA 2CW0C 5EPJA 1DOIA 1IUEA 3AEGB 1RHPA 3FAHA 5EPKA 5ISRA 4IUNA 3NQIA 1EYCA 1N60A 4OZBA 1LT3D 3AB9A 1Y1VB 2LMCB 3VR5A 5C6AA 1NUCA 1ZXHA 2X6LA 3A56A 3I4MB 1D5ZC 2WDRB 1C9FA 1PZID 1HRJA 4RHSA 1EQVA 3NHHA 1IBXA 1Q10A 2XIWA 3MVVA 3WCQA 1JOQA 3OWFA 1A3UA 1CM9A 4N9TA 1L0YB 2IGHA 5CV4A 4MT5A 2PYKA 1S5BD 4XXEA 1GJXA 2RMMA 1D2BA 1HCZA 4BBSB 4ZQ3A 1TWAB 2BS3B 1JOKA 2LKVA 4BY1B 4ULLA 4PNYA 5BYRA 2R61A 4H13C 3RPFC 2HQEA 4K14A 4XIGS 3VRBB 1ILPA 5JEAJ 4XT3B 4QUCA 2DLBA 1QCBD 3SXHA 3S1MB 1QNUA 1GHJA 4LK1C 1C4AA 1D5MC 1ENAA 2F0QA 3FMCA 1FIQA 1F2MA 1HFNA 2WLBA 1STBA 4B0EA 3AECB 4C3HG 3L9AX 2F0KA 3HOUB 3TP7A 5CV9A 1PFMA 4KKUA 1YN4A 4IFDG 4A3IB 5LHY1 4FNFA 3HOZB 5HURA 2J7ZA 5G3LF 2QEJC 1XLPA 4C80A 1I4PA 1TT2A 2M0AA 1B53A 1G91A 4A3MB 1CA6A 2NTSA 5ELCA 1KABA 5I2XA 2IDYA 1FNWA 3S14B 2XSCA 3MA2B 3ZQ4A 3CRLC 1RFKA 1A15A 1JB3A 4FXCA 5FLXE 3GTGB 3VRAB 1PRTB 3IXSA 2IL8A 1L6UA 2CHBD 4MHEA 1QT9A 1C79A 1F2YA 2EYJA 1I4RA 4OVZA 1RCVD 2ZW0A 3KWLA 4XDXA 1KNAA 3Q24A 1KLUD 2WDVB 4M8AA 4C1NK 3U9SA 2VB3X 3F2UA 2JYTA 2ZW1A 3TEWA 2L12A 4G7HC 1JWSD 2Y5CA 3JAME 2K5WA 2WXRA 3M7GA 3T53B 4HRSA 2B76B 3K5LA 2LS01 3T13A 4DXFA 5JVH3 1BDOA 3ONAB 1CA5A 3P75A 2O5JC 3HOVB 2A6HD 3AE8B 1FEHA 2B8GA 1V8QA 3H09A 4ZRPA 1N63A 1QQRA 4EQOA 4RWSC 4A3JB 1HHVA 4RA8A 1ONLA 2E6XA 4YSZB 1I50B 1JROA 5EPLA 4H0LC 3LYYA 2M2LA 2M56B 2EXZA 3J81E 1IYUA 4IDIA 1N62A 5T1GA 1MVKA 2D5GA 3AU7A 1C77A 2PCFB 2F0EA 2WXLA 4K8IA 4KY7A 4RAUC 4A3BB 1SNOA 4P16A 3KF8A 1FM0D 1U4RA 1TVXA 2QIEB 1DJRD 2RDHA 1WXQA 4RFBA 1S5CD 3GTOB 3I4NB 1J7BA 4MN3A 3RD4A 3N52A 5M5WB 3OWEB 2XWJB 3GTMB 3PO2B 2Q5WD 1QG7A 2NN6I 1JWAD 1K51A 1NR2A 2WS3B 4R9WA 2F0UA 3D6WA 3TP5A 3TUOA 1GUTA 2E76C 4KKSA 2V3NA 2J52A 2WXMA 2K7VA 1UEAB 1A3TA 2J4XA 3SK6A 1SYGA 4I65A 3H91A 3RFZB 2PO4A 1FCLA 3HOWB 1GUGA 1EY9A 3ITPA 4OHJA 2SEBD 3CQZB 5BMGA 3EVQA 3SEBA 4ZK9B 1YNTE 4FF3A 2B2YC 4H2AA 5A2QE 1Y1WB 2I07B 4WAFA 2ICEC 1KF6B 1O78A 1FYCA 1LT4D 3HZXA 4K5WA 3IT4B 1SNCA 1XWEA 2KUMA 2VXWA 2F3VA 5JAVA 2WKDA 3HOYB 4YWGG 1MD2D 1J7AA 3J80E 5C0XG 2F0TA 1I4XA 4C56C 2CW0D 4K5XA 2JYOA 3DWQA 1ZOYB 2E3TA 3T56B 1FD6A 2GI9A 1Q8IA 3HUIA 1Q1BA 4JX1C 3NSWA 4Z9CB 3D4DA 3E0JA 4X3TA 5CC4A 1BCPF 2EYPA 2B2YA 5E4XA 3P63A 4YXDB 1LTRD 1K8OA 2D62A 5F2DA 1ZUD2 3K5NA 4Q2JA 2KVMA 1PFBA 1EY4A 4WRDA 3LNNA 4L23A 4A9AA 1I4QA 1CZWA 5IOCA 2KQ4X 2MJ8A 4ZOHC 1IL8A 3FPUB 3HS0C 4A93B 1SXTA 1B9RA 1QJOA 2FMCA 1KFYB 1TKYA 4JPSA 4P6VF 1D1IA 2QF7A 4TQ1A 2KQ3A 1NI3A 3PUXA 1ENFA 4ABNA 3FKIB 4WH4A 5KNBA 2VUMB 4LK0M 3T3OA 1KDCA 3GTKB 2W3RA 2K3UA 1C8CA 3AE2B 4RCOA 3B2GA 3C1FA 2MH7A 1PTOF 1XTCD 5T8IA 1YN3A 2TSSA 3C8YA 4S3SA 3E6ZX 3K7AB 1HZ6A 1KLGD 2BT6A 1D5XC 3NTHA 2V0GA 5I6YA 3RZDB 2WXQA 2IT1A 1PGXA 1TR5A 2CVRA 1ESFA 4B9XA 1S5DD 3AE1B 1ET6A 1VZ7A 5H8YE 1R7SA 3BYYB 4Y7NB 1H9KA 4FO2A 3QG1A 3B9JA 1H9SB 4FVMA 4FYDA 3BK2A 3K5MA 5HI1A 1YJJA 4WORA 5I4DA 2B2TC 5GXGB 2Y3AA 4QIWB 1FMAD 1EZ8A 2W82A 4ZYSA 1GB4A 2F0NA 4RF1A 1EEFD 2F0OA 3EUB2 3VQIA 4NZLB 1T3QA 3L7ZC 3VR6A 3R2IA 5BYSA 2B2VC 1JQYD 1PMRA 3WOFA 1A6XA 2NVQB 1XO3A 3AH7A 4QMGA 1K52A 2GB1A 2L0CA 2IX1A 3K6OA 2JA7B 1XEEA 3ERQA 1TJEA 4YTMB 4OIJA 2B2TA 4CGYB 4J8QA 3VYUA 2F03A 4JE3B 3O13A 2WACA 2B2UC 1IW7C 3DHQA 3HEJA 4A3KB 4RCNA 1SYFA 4RKBA 1MI2A 4X3SA 1VDZA</