3BYTB

A complex between a variant of staphylococcal enterotoxin c3 and the variable domain of the murine t cell receptor beta chain 8.2
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
238
structure length
232
Chain Sequence
SQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSTWHGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Manipulating the coupled folding and binding process drives affinity maturation in a protein-protein complex
rcsb
source organism Mus musculus
molecule tags Toxin
molecule keywords T cell receptor beta chain 8.2
total genus 64
structure length 232
sequence length 238
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2008-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
B PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3bytB02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3bytB01
1RDPD 1UNSA 3BYTB 1L0XB 1LO5D 4RGMA 1MD2D 1TS2A 3SEBA 1FNVA 3MC0B 2XN9C 1RCVD 2NTSA 4RGNA 2AQ2B 1TS3A 1AN8A 2RDHA 3OWEB 3BYYB 5I4DA 1V1PB 5ELDA 4RGTA 4Z9CB 1JCKB 4RHRA 3KLSX 5D3IB 1HA5A 1JQYD 3R2TA 1HXYD 5D3DA 1LT3D 1D5ZC 1SXTA 1V1OA 1CT1D 2AQ1B 1LTID 2RDGA 5ELBA 3CHBD 3BVGA 1SEBD 4C56C 2IPKD 5TSSA 1PRTB 1PTOD 1KTKA 1TS4A 1I4GA 1DYQA 5ELEA 1SBBB 2XNAC 1DJRD 1BCPC 2SEBD 1JWUD 3EA6A 1S5CD 1S5FD 2IJ0A 1ET9A 2Z8LA 1JR0D 2TSSA 1I4RA 1SJHD 1D5XC 3BVZA 1STEA 3TSSA 4RHSA 1PRTF 4RH6A 3V05A 1UUPA 1PTOC 1YN4A 2ICIA 3GP7A 1LTRD 3DWQA 1F77A 3BVMA 2XRSD 3URYA 1TS5A 1SE2A 4RCOA 4BWGB 1D6EC 1XTCD 1CK1A 1S5DD 1V1PA 3W2DA 3R8BA 2QILA 1PYWD 1AW7A 1RF2D 1ET6A 2G9HD 5ELFA 5FKAC 1I4QA 1EU3A 1I4XA 1JWMD 4RGOS 1LTAD 1SE3A 4DXGA 4L63B 1CHQD 3DWAA 3BZDB 4O1NA 1ENFA 1M4VA 1TY0A 2WV6D 1BCPF 1HQRD 1T5XD 4OHJA 1YN5A 4RFBA 1S5BD 1LLRD 1FGBD 1PZID 2NTTA 1ESFA 3EFXD 1PTOB 4TSSA 1D5MC 2QEJC 1I4PA 1PRTD 1SJED 4UDUC 1KLGD 1RD9D 1G8ZD 3R2IA 2J4XA 1SE4A 2CHBD 1S5ED 1PTOF 1BCPD 1TY2A 1L0YB 1FD7D 1EU4A 3MFGA 4ZYSA 1LT5D 5FK9C 1LTGD 1PZKD 1CHPD 1I4HA 1LT4D 5ELCA 3DWPA 2AQ3B 1GOZA 1B44D 4NZLB 1PZJD 1EWCA 1B1ZA 1XXGA 4K6LA 1EEFD 1YN3A 1FNWA 1LTSD 1HTLD 1JWSD 3O13A 1LTTD 1BCPB 1EFID 1KLUD 1LTBD 2O2LD 1CQVA 1EEID 1LT6D 1PTOH 1FNUA 4DXFA 2R61A 1QILA 1PRTC 1BXTA 2XRQD 4L6TB
chains in the Genus database with same CATH superfamily
1ZKOA 3HOWB 3S9WA 4WORA 3BYTB 2ZJRA 5DPWA 4GSWA 1WD0A 4RGMA 3EROA 4IM2A 2KT7A 5L37A 2QC8A 1RM6C 3TEWA 1SYDA 3DUZA 4A90A 3PIPA 2KA7A 4MGIE 2ZXPA 1YOVB 3QIAA 2X38A 3QAQA 2CS4A 1KFYB 2MHVA 4HWIB 1FRDA 4A3GB 5L83A 4H7BA 3CC7A 4A3EB 1P98A 1HXYD 1RIPA 3H6MA 2K8CA 2L32A 3SR1A 3UDXA 2F0SA 2Q2HA 2FCNA 2A6ED 1ZKHA 3N32A 5ELEA 4M8AA 3P4PB 3A8KE 1IL8A 5GMVA 2I5MX 4ZLTF 4IUUA 3S14B 4XQQA 2EYJA 1K8GA 4DV7Q 2JRHA 2K6DB 1QOBA 2E74C 4NP5A 1DGSA 1SJHD 1H9MA 4CHKA 4BY1H 4JI6Q 1HR0L 5E6NA 1WTOA 2KMAA 3BZKA 3FKYA 1EY7A 2EXDA 4RAUC 3ULPA 1KLVA 1GUOA 3BJUA 2HUGA 3J80L 1CZWA 1YJ9A 2K22A 2RDFA 2ICIA 3JVZX 2WXKA 4ARIA 4QUCA 4QF4A 2G5DA 1K9MC 2F03A 2WXMA 4MEMA 1L7YA 1KDCA 3N1ZC 1PH6A 3W2DA 4CJ2C 4F7ZA 5BMHA 1PYWD 4S3SA 4MGYE 3TN2A 2G9HD 1WF9A 1EU3A 3CPFA 1TT5B 3H3VH 4L63B 3PREA 2SDFA 1ENFA 5LXHA 1TWCH 1XNRL 4YIJA 2DAJA 3AEFB 1M90C 2WINB 3SVMA 1Y1VG 4DV3L 3GDEA 4IJHA 2KWDA 2RKSA 3QOLA 3QX1A 3PLUA 2D5GA 2NZ1D 1VQ9A 3AQQA 4DUZQ 2QEJC 1SJED 3M63B 3K7AB 1EWHA 2BDOA 3GV3A 2LVPA 5MPOA 3RZWC 1HTQA 1VQCA 1FD7D 1EU4A 1Y8PB 5I2YA 4JPBW 3H09A 3NHHA 2J0MA 1CHPD 1DOKA 3OOCA 3V2TA 1FPYA 1PUTA 2J53A 4ANXA 3QJYA 5IT9E 3JSVB 3EJIA 3I63C 1YQBA 2ZPYA 1A8VA 1QZGA 1XEEA 1B44D 1NEKB 3KUCB 4IOAA 3F8TA 3QWNA 3IFWB 3IVFA 4HJ5A 4DR4L 3A0JA 1E2ZA 3WOEA 3DMUA 3RLOA 1QOFA 3J81E 2JA7B 5J1ZA 4JI6L 1U9RA 1YNTE 4TMAB 3W1SC 1HNZL 2KC2A 4X57B 1LT6D 1L5PA 5IP9H 2DY7A 3A55A 4EQ5A 1R4NB 3KWVA 1YZ6A 3VTVA 3ZNGC 5IYDH 1JC7A 4UHVA 4JI2L 5M5XH 2B2YC 3HS0C 5J22A 3S1QH 2N9XA 2B2VA 2EYLA 2MWSB 3UE0A 1RTOA 2R92B 1X3GA 2XVSA 2LGXA 2VL6A 3J80E 2E2IH 4FJYA 3PUZA 4OZAA 4E3CA 4O0AA 2PQEA 3OIQA 2NVTH 2WAQE 1QUQA 3P1HA 2IHEA 1UE6A 2PI2A 1PLFA 2B2UA 1L2FA 4J6HA 3BWUD 1S1QB 4DR5L 4GDKB 4H2AA 1HNWQ 2F4VQ 2L1BA 1ZE3D 1K3BC 2XTIA 5KHOA 4JI5Q 1N9WA 5LHY1 3W5VB 1QOGA 5C1ZA 2KEEA 2J42A 4MSQB 3DVNU 4PMBA 3G6EA 4R4QA 2BB6A 2DUDA 1WR1A 1JRPA 1FFVA 4KDIC 2L11A 1UEBA 3ZYYX 2HQEA 3A56A 4OO1G 2WIIB 2NBVB 3NY5A 3TEZA 2K5NA 1V86A 1GB1A 2EY1A 1YJJA 1LM8B 3WALA 3EBEA 2QSDA 2JXMB 3HOVH 1NTGA 2IT1A 4KHZA 1YMHE 2BQQA 3TEHB 1G6JA 5I6YA 3BK2A 1BUVT 1WJJA 4NJCA 5C4JH 1S5CD 1KAWA 3MHBA 2O5JC 1Q3LA 1HH2P 2RR9A 4P16A 2Z8LA 5LMNQ 1UBIA 1EYAA 3ULLA 1WYWB 1EQVA 3I2ZA 2JA8G 3Q6SA 1D5XC 3PV0A 1A2TA 2ICEC 1HNZQ 2VZKB 5LMUQ 4DR4Q 2AYOB 2M19A 1YNNC 4BKSA 4MH8A 5G55A 5A35A 2ZNVC 1I94Q 1V80A 3W1YA 3TS2A 4MM3B 2D0PA 3PGZA 5C44B 4C3IG 2M4NA 1G91A 4LNQA 4GKJQ 2XGTA 2FIFA 2C7HA 1XTCD 4ZUIA 1EWIA 4H0LC 2LSSA 4GN3B 1BBWA 4DNTB 2F0WA 2HHHL 1VCBA 1XPUA 4K81A 5IT9L 1TKEA 1I4QA 3OPOA 3TBLD 2D3BA 4BFRA 4PS7A 3K7UC 1S40A 3S1NH 1P7EA 3ZTDA 1Z2MA 3BZDB 1VQOA 3AE4B 3H9DA 3RT3B 1K3RA 1K83H 1V1QA 1PH3A 3AMZA 4ASWC 2LRWA 3UQBA 5FO9B 4B3SL 1WH3A 1OGWA 3DBRI 2JP1A 2K8BA 2LVOA 3OAWA 5C3XA 2LJ5A 4WWOA 2NTTA 1PHJA 2R93B 5JEAG 2C35B 4X62L 2UXBL 4KJOA 1PYSB 2KX0A 1XPRA 1WM3A 1EWYC 1A5RA 3DVGX 4IUVA 3C8YA 5C23A 4W9LA 3IAM1 1EL0A 4KGTA 1PTOF 1BCPD 4UPAA 1J8CA 1R4NI 3S1NB 4K0KL 2WWZA 1Y8OB 1L0VB 5KHQA 2HDLA 5KGUA 1I4HA 1P9DU 2LHEA 1E22A 5M5XB 3AN1A 5ELCA 2W55A 2M0XA 3RNGC 3H3VC 2RPQA 3IAYA 4HEDA 4DV4Q 4YY3L 1WRIA 2LS01 3ICEA 2ZVNA 5H92C 3MAQA 4C1NI 2VQEL 4PS8A 4FLHA 1C48A 4KHVA 4TRDA 2KC1A 5EPLA 4V190 3S2AA 3NWTA 4JE3B 1O7YA 5E4XA 3P63A 2F4IA 3KBGA 3J7YW 1K50A 1J6QA 3FILA 1EYDA 1IGDA 1WOCA 3V62A 4P72A 3EQLC 3ZVVA 4LFCQ 4N9F4 3BZCA 3NWSA 1W2BA 2KLCA 2WXHA 2OWOA 4LF5L 1LYLA 3KF6A 1HA6A 2M56B 1Z47A 1PH2A 4CKEA 2X8XX 3ER0A 1UH6A 3OJ3A 1PDXA 1YHBA 1YIWA 3AYHB 2IDYA 2F0NA 3VR4A 5K5PA 5JJLA 1KAAA 1ZPSA 4XX5A 3S16H 2KTRB 5J17A 3MXPA 1IBMQ 3P42A 3HM3A 2KKCA 2YEPF 4HIOA 3W3AA 3J81i 4LNIA 4MELA 5EDSA 1DOYA 1VQBA 3J80i 4M00A 1QZEA 3K9PB 2Z9HA 4KN7C 4QMGA 2RGFA 3TIXA 3U30A 1VDZA 3W9CB 4GOCA 1O78A 1TTNA 2KHJA 1I3QB 2JA5B 2KWUB 5D7GA 3CCLA 2BWFA 1WRDB 1DJRD 4C3HH 3CSFA 3QCAA 2WFWA 4IPCA 2ZTEA 1JQ4A 3PO2G 1PH8A 5C4XH 3ND9A 1ZYRD 1KABA 1JWBD 1WZ0A 1TWAH 1V43A 3UE1A 1EUVB 1WMHB 1U4MA 5C0XG 3ALBA 4A3IH 3CD6A 3KJPA 3ZO5B 4RWSC 4WFN3 2FE8A 2PIAA 4ITKA 3VA5A 2F0GA 2DZJA 2R92G 4ACFA 1YN4A 2SNSA 3A33B 5M5YB 5LMUL 2XSCA 2YTXA 4UAIA 1F77A 2V1YA 4B9XA 4RCOA 3ZIMA 2B2VC 1NBWA 3GTPH 1AW7A 1RF2D 4GLAC 5DPTA 1PH1A 4NPSA 4CDEC 2EYOA 1NMFA 1STYA 2QMTA 4NAWA 1T0RC 2LASA 2CW0D 4XQJA 2B3AA 3C1EA 3TL5A 1E7VA 3EC8A 3NP8A 2WYQA 3L54A 2KCCA 2JYEA 1ZOYB 3WAPA 4J8QA 1NI3A 3HZXA 1U0LA 5DEHA 5M3FH 4HJAA 2K9XA 2DNCA 4PG3A 5IOCA 4M0WB 4DHZB 3KDFA 5IGEA 3CMAA 4LF4Q 3MHZA 3TMPB 4HKQA 3MXNA 1KLGD 4Y7NH 4WWMA 4N9PA 2MO1A 3G48A 1GNUA 4KJNA 2DLBA 3OG5A 3I4OA 4HEA1 2R92H 3TJPA 3FDTA 4A3DH 3CCSA 3ML8A 4KX6B 5JOBA 2W54A 4FNFA 5COYA 2LGIA 1BO0A 3K81C 1AARA 2MH7A 5H1SE 1B70B 3Q8DA 5AUIA 4CHTB 5HURA 2IY1B 3D4WA 3QWZB 2GMIC 2LRUA 2N9LA 2W3SA 4HSVA 3EIVA 4LNOA 3UDIA 4PYZA 4OVUA 2VB3X 3APDA 2KQSA 1JWSD 1F0ZA 4GDLA 4DA2A 1MGSA 4JWUC 4DWFA 1O7ZA 3CMMB 5GAHC 4L5SA 1E24A 2O2LD 1EEID 1YEZA 2MLBA 1GUAB 3D4DA 1YJWA 1G6ZA 3W1BA 4GB9A 1Q86C 1K53A 4DGZA 3NOBA 4WURA 4GLXA 5FO7B 4XIGS 4BBSH 1E8ZA 2JVCA 3GTOH 3RNEC 1E0BA 4L6TB 4JBMA 1ASYA 2ZM6Q 3MXNB 4JI8Q 1AP0A 2INDC 3J9CA 2L76A 2KWCA 4BY7H 2A74C 4MACA 1DOMA 1XTDA 2DENB 2UYZB 3RD4A 2O5IC 3GZNI 4RMAA 3T9LA 1I35A 5C4HA 1SNMA 4A3MB 4JI4Q 3RFZB 4OELB 3AM9A 2EMTA 1EY8A 3EN2A 2FNJB 2JSOA 2MP1A 1S72A 1Q1EA 3RI7C 3WCQA 2ZPNA 1EIGA 4X66L 3TS0A 2E2HH 1JB3A 4WWNA 2JA7H 1TWGB 4JI0L 2N1VA 1CTMA 1D5ZC 1SXTA 4DR2Q 5CTRC 1DCZA 5IP4D 4I7AA 3BVGA 4IUMB 4MSMB 3B08A 2OQKA 2I5LX 3OTOL 1WM2A 4G0NB 1TZOA 3S1QB 1SMXA 4CO7A 1GUGA 4WJNA 1FCCC 2BYFA 3FMCA 2VUMG 2G3QB 2OEOA 4LF7Q 2WX0A 4MM3A 4DAPA 2GN5A 2K03A 3RLFA 3U9OA 3M85A 3ONSA 3TCAA 5GQOA 3HOZG 2RSOA 4EZJA 1XD3B 1D7QA 2N8NA 1S5FD 3J7AF 3P2BA 4YXDB 5AEKB 3TDQA 3CXCA 3JAMc 2CH4A 4DF7A 1EF1A 2H4OA 1NY4A 5M5WB 1XLQA 2WB1G 4XWTA 3DVNV 3K59A 4DHJB 4MZ9A 2P5ZX 2CQAA 4A3GH 3NS1A 3PCOB 1IBKQ 5IGBA 4DV0L 3V61A 1U5KA 4N6EB 3DWQA 3UQAA 1KDBA 3ITPA 2YV5A 1N32Q 4B9KA 1CK1A 5EGTA 2K39A 3S1RH 3H1UA 1V5OA 3MEHA 2JSVX 5AJ3L 5FKAC 1I6VC 3K58A 2BH2A 1MSHA 4EEWA 2BCOA 2ZZPB 4KSLC 1UWXA 1HHVA 2PMZB 4IPHA 2KHSA 5C4JB 4IQZA 3S17H 1I5FA 3EGRA 1N62A 4K7WA 4MDKE 4RM8A 1WTXA 3J81L 2L0TA 4JI0Q 3R7QA 1SYBA 1X6OA 1SNPA 4JW0A 3NZSA 3E9HA 3T1YQ 1B53A 1EZ8A 2K5HA 1JW9D 4LJZC 2GB1A 3T8MA 1ESFA 2F0QA 1ML0D 3VA7A 1IKLA 4DR5Q 3S1RB 3K0XA 4E6IA 3TP7A 1G8ZD 2EMSA 5BO4B 3SR6A 3Q8AA 3MFYA 5C0XH 1K0RA 3TMEA 4R8IA 1NR4A 5AFWA 3S2HH 1VDVA 4JBWA 4HN7A 4JI1L 3L16A 3CKIB 5EKKA 2PW5A 3F2BA 1VQ4A 4A3LG 1EY6A 2BBCA 2WHIA 1WE6A 2I07B 5FLXc 4KKJA 4M8MA 3AI5A 4DUYQ 4HJGE 2K7VA 2R6GA 3RUZA 2B63H 3TRZA 2JU6X 2L3ZA 4PV1C 4OWXB 4IC7B 2N9KA 4K6LA 4A3OA 2MJEA 1CSPA 3L0OA 2M9VA 3CMEA 4DV7L 1LTTD 2HDMA 4JV5Q 1H9SB 2QIEB 2EXZA 1VQAA 1BCPB 4JI4L 3ND8A 1EM7A 1S3SG 4A76A 3I3CA 2MO0A 3ONAB 3CCRA 1SB3C 2PCFB 1J5EL 4HPPA 5FR3A 5E6PA 1HJPA 1JOQA 3RR5A 2VQFL 4OO1I 5BMIA 3I7FA 4A3BG 4K8IA 3AU5A 1STBA 2HE7A 1WI0A 4ILWA 4KKIA 2N0SB 2NVQH 2DZIA 2WXPA 1FNVA 2H1EA 5IN7A 4A20A 1WFQA 2AWNA 2GI9A 2HHHQ 1L1OB 5KNBA 2MQJA 2C5CA 4ZRQA 2ON8A 3PO2B 1X3FA 3HVDA 4CQNA 4MH0E 4K2LA 3CQZH 2KX3A 3E5SA 1WJNA 1PFMA 2UUCL 3NVVA 3R2TA 4A3CH 3HHMA 4D2KA 1ZW7A 2IGDA 2JX5A 5GXGB 2DYBA 2IY0B 4MT5A 4MIUA 1F9PA 5IP9G 2EDGA 2BTEA 3PO3B 2HTHA 4C3JH 5EE1A 4XQNA 5IKCM 2FXQA 2L52A 2XNAC 2QKIC 2GBKA 4ZRZA 4K0KQ 3VXWA 1JWUD 4GKKQ 2JJQA 3EA6A 4ZYNA 2LJIA 1RODA 5CV5A 2JWZA 3DQVA 5HHDG 2JT4B 3ZJTA 4BBRH 2YVCA 3BDLA 3AEGB 4RF1A 1QOHA 3T51B 3RN9C 2Z6KC 2MBEA 3TSSA 1STHA 1VQJA 3U4VA 2VUMH 3VYSA 2L8JA 1W6JA 3VAWA 5D14A 1C7YA 4GIVA 2I46A 1L4ZB 3GB1A 3S15H 3T4AC 1BBXC 1SYGA 1SE9A 4K14A 4BWGB 4ZCKA 3NG0A 4IW0A 5LLIA 1B4OA 3OYYA 2MPMA 1RWSA 4RCNA 3WAOA 2N49A 4NQLB 4HJ9A 2IYDB 1Q46A 2V4IB 1G291 3UDGA 4IUQA 1TWHH 1SYCA 2EE1A 2RHSB 5IP7G 2Y5CA 3J7A5 3DPDA 3GS2A 4P7IA 3DWAA 4O1NA 1FJGL 4IG7B 4HXDA 4BOSC 4IFDG 4H13C 4LFAL 1PGAA 5CV6A 2ACZB 1BCPF 3NVYA 4NPNA 4YWGG 2BYTA 4O42A 2NPTB 2EYFA 2GVAA 2JN4A 3EFXD 4HCEA 3CF5A 1XNRQ 3A8JE 2PQAB 5GADC 2LUMA 4ME5A 2KQ4X 4C3IH 1RFAA 1CZGA 2JZZA 3APFA 1SLJA 3GTLH 2ALYB 1Y1WG 5CYUA 2BS2B 1WI5A 2A68C 4F8MA 4LF9L 1CQFA 2QDBA 1Q1OA 2QCPX 2B39A 2L15A 4QY7A 1P7FA 2PW9A 1NI2A 3KH0A 5G3LD 2E6XA 4AUQC 1WJUA 2W3RA 3FHWA 2ZNVB 5IAAC 3PSIA 5J18A 1P0RA 3H7PB 1B1ZA 4B0EA 5A2QL 3HOWG 1SN8A 3NTHA 1FXIA 2HQLA 3PHWB 1I7HA 3K5OA 3N20C 1PV4A 2AEHA 3VDYA 2NN6H 3BY4B 4J15A 1V97A 4IJLA 4LK0M 2NPTA 5BYQA 3PO3H 4PS3A 4YCVA 1MVKA 2D2QA 2K5DA 3TZUA 3AE1B 4JLCA 1LM0A 1FYCA 2KFKB 1C4CA 3VYUA 2ZJPA 2Q2IA 4QIWB 1UWMA 2FHTA 2RMMA 4W9HA 4FADA 2V1CC 1DGJA 3H91A 3B0AA 3B2GA 1E5WA 1WCMH 5A2QE 4XZ4A 1PMRA 4TVAB 1FO4A 3CCEA 5FR6A 1GC7A 2RPVA 1NAPA 3GV6A 4EQNA 4TKOB 3A7LA 1Y8RC 2ZW0A 4K6DA 4HCSA 3HOZB 5KYLA 5C0XI 4LTUA 1TT2A 1BT0A 4NXNQ 3I4MG 3IG3A 3M9BA 1R4MB 4ZRKA 1ICFB 2JWUA 4ZQ3A 4KK7A 5D2MB 1CT1D 1MPEA 3AH7A 4A3FB 4DV2Q 4DAYA 1S4ZA 4YSYB 4DR7L 2M0AA 2UUBQ 2NBWB 1VQHA 1F2RC 3VH3B 4A3JH 4DV5Q 1IUEA 3SDZA 2LD9A 2ZEQA 1FRRA 5BN3A 1YX6B 3FPPA 1Q81C 1XJVA 4RF0A 4BY7B 1WFYA 3PF4A 2K28A 3QOJA 4KI0A 3CIRB 2RD0A 3L2PA 1UE1A 1V9PA 4YWLA 2D3GA 4HVBA 1Y69U 2JA9A 3BDCA 1FMAD 4GXBA 1KOTA 5AZGA 3KLRA 3HOXB 5CV8A 1SF0A 4IWQA 2MRPA 2JEAI 4CJ1B 4B3TL 4XXEA 2SAKA 4IKGA 1YNND 2NVUI 2WP8J 2OCEA 4C2MB 2ZW1A 5DM63 4GN4B 3URYA 4B3SQ 2B2YA 1STGA 1FEHA 4PT5A 3UF8A 1E7PB 4NAMA 1X55A 2GBRA 1JE5A 1CZPA 3GTLB 1RKNA 4IFDI 4ALPA 2KTFA 4A55A 2VRRB 4LFCL 5EAYA 3NQIA 2F1MA 1WGYA 4AYBE 2MHJA 1XLNA 1I94L 4LF9Q 5K36H 1EY5A 4US9A 4K2KA 4O2DA 1XPOA 2KJXA 1A62A 3VR3A 3AE8B 1HQRD 5EPKA 4C2MH 1VF5C 4USAA 2HDEA 2A6HC 4ULLA 2ZCBA 4JBJA 1PZID 2EYHA 4XTCS 2EIFA 1OTRB 2OJWA 4JGHB 1ZEQX 1PQSA 1SIJA 4M02A 1WVLA 4FA6A 2L83A 4LNFA 5FK9C 5GROA 3R3OA 1OO9B 1IW7C 1K83B 1WTVA 1TWFH 2Z1CA 2W82A 3KVFB 2XWBB 4GU2A 2WXNA 4BOZB 3FKIB 1KRTA 1O7IA 2EJFC 3J80c 1D4BA 3BS1A 3BINA 1XXGA 4IUTA 3L0WB 4R4IA 5EBDA 1FNWA 1M8AA 4JK1C 4C3JG 3HOZH 2DZKA 3NVWA 5CMDA 2Z6KA 3LWUA 3MZ5A 5H8YE 3PF5A 3HM6X 1RL2A 1UEAB 4RMFA 5E6OA 1RLFA 1LTBD 1YIJA 1WTQA 1HZ6A 2LXKA 2Q8IB 2IWHA 2R7ZB 1Q5WB 1DOXA 1GB4A 4A3CG 1I42A 2RSUA 2PE9A 3Q24A 2DAFA 3HOVB 1SDFA 2VZKD 2WDQB 3X3MA 3F1ZA 1J7BA 5LL6X 1JJ2A 2KCNA 3MC0B 1EY4A 1DD2A 4P1CC 3DXJC 2XK5A 1QVFA 4EQOA 4BBRB 4KGSA 3OHXC 1T6BX 4ZHOA 1EUJA 2NZHA 4MJSA 3PZ8A 2IGHA 3X23A 3ZKJC 2KACA 1V1PB 3W5UB 2JUOA 1Q12A 5HI1A 3AEEB 4DHZE 1J19A 1EFWA 1WTWA 5D3IB 2PPHA 1Q90A 1LT3D 2JYOA 4RM9A 2JQOA 5IY0A 3PRZA 3SFDB 2EQSA 3OJ4B 4LF5Q 2LI5A 1SEBD 2IPKD 2PLPA 4BBNF 2CU3A 1KTKA 2E8GA 4RG1A 3RMHA 1MSGA 1AYFA 1N60A 3HRDD 4WH4A 3KF8B 1I4GA 1X32A 1V2YA 5CHWA 1HTPA 2B2TC 3M7NA 4HSPA 2N3SA 3M95A 1WGHA 1SBBB 4KHPL 4KV2A 1N36Q 4B3ML 4DDGD 2DZMA 3QJZA 1WMHA 3I72A 4IURA 1G6PA 4G50A 2L4NA 4ME3A 2J0TD 4DR6Q 1TWGH 4C7YA 1YITA 4JI3Q 4AS1A 1BOSA 1D3ZA 3KFUA 1U4AA 2KOXA 5KYIA 1X54A 2JE6I 2VS1A 1BVSA 3A9KB 4PYUA 4U68A 4IWPA 1QE6A 3DBRB 1ILPA 1Q8IA 3KF8A 3C19A 3GP7A 5JHAA 1TS5A 4B3RQ 4DAYB 4C7ZA 5CBEE 3AEDB 3T13A 2ASBA 2KVRA 1WWTA 2ZM6L 4FJVB 2WAQB 5K36G 1J7AA 1GG3A 1LTAD 4OL7A 1SFOH 3M4YA 4A3DB 4LF6Q 4IFDJ 3PUVA 2D10A 2KO3A 3HUIA 1C9FA 4KD3A 4OGQC 2Y5BB 4J6IA 1E8XA 3NJTA 1LTLA 4OZCA 3TP6A 2FAZA 3MWYW 1HZ9A 3ZRCA 5E3FA 2BYVE 1NUCA 3NPPA 1MHHE 5EJWA 4L5RC 4B6WA 4ZKBB 3P1MA 1L6VA 2OTLA 2VUMB 4HROA 1B9MA 1WXAA 1WY8A 4LJOB 1Z5SB 5EE3A 4KGRA 2YU9H 1SE4A 1OXTA 4JL9A 5LL6S 4PZ7A 2WDRB 2VNUD 1BKBA 4R4CA 1LABA 1K8OA 3VTWA 1LTGD 4A8XC 2CH4W 1C79A 2AWTA 3DOWA 4ARCA 2CU1A 3Q8FA 2N78A 2WAQG 1LXDA 4KY7A 1VQPA 4JI8L 3S16B 2G4DB 1GUTA 3AE6B 1B3QA 3FPUB 3SK5A 4G7ZC 2QHOA 1T3QA 3QC8B 4XYCA 1HTLD 2K32A 3KUZA 4A3MG 4WAAA 4WJQA 5JVH3 4K3BA 1IPGA 1X9NA 2PQAA 2FUHB 2L9HA 1PTOH 5C2TB 1ZGUB 2LKVA 3DEPA 4DXFA 2INPE 5EKLA 3I4MH 1C0AA 4GN1A 1MKHA 3ZW3A 3I3TB 3Q0AA 3N1YC 4XT3B 4DFAA 3RZOH 5G5HA 2DN8A 4I7ZC 4C3HB 4AIMA 1TS2A 4WQOB 4AYBB 1WXVA 3NE5B 4DK1A 2PZTA 4M0WA 1EQQA 2NTSA 5IP7H 1JWAD 2EYPA 1EIFA 2IL8A 1YNJD 3T56B 1XQQA 1NE3A 2UU9L 3ML9A 3LWEA 3AE9B 5JVG3 4F87A 1KQSA 4JX1C 3ZDMC 1KIXA 4LUOA 4PZ6A 4XWWA 3L10B 3TEYA 1JQYD 5IWAQ 2NCNA 5C4XB 4JIOU 2A4ZA 2UXCL 2IGGA 4JBKA 3HKZG 1MIUA 1ZDVA 1OEYA 2ZVOA 1IBLQ 2Y0SB 4US8A 4LJPB 4XDXA 1TQOA 3K0YA 2J7ZA 3QIJA 4EKUA 2D3CA 1SYEA 2NR2A 3RZFA 3U9SA 3V6CB 3HOWH 5G2NA 1VZ8A 4BBRG 3RNCC 2A68D 1O80A 2MGSA 4HMIA 4CGYB 1SR3A 3CCUA 1HZCA 3U52E 1N32L 2JEBI 1E2WA 5BR8Q 4HIDA 4BKSD 4BAXA 1JR0D 3BG3A 2I5HA 4DV6Q 4DR1L 1V9JA 3LDZE 1F2MA 5JPMC 3STBD 3SK6A 1O7LA 4AH6A 3OLMD 4RHSA 5TR5A 4ICVA 1CA5A 2KCMA 4YL8A 4IM3A 5AJ3Q 2DBYA 3E56A 5EE9A 4IUNA 3AB9A 2L55A 4PNYA 3T1YL 1HUNA 4DV1L 4X64Q 1T0YA 2RBMA 4PK1A 4B95A 2BPSA 3PHXB 5DPSA 1ET6A 4Y7NB 3PIOA 3DHQA 3FC4A 5D94A 1SE3A 3A1QA 2KVZA 2UXDL 1AE3A 3MA2B 2KTRA 2HJ8A 1KRSA 1QNKA 1HR0W 1MG4A 2DWQA 4XDCA 3LYYA 3OW2A 3WAMA 2HJ1A 4OHJA 4RFBA 2KECA 4LF6L 3SD5A 4M01A 1OQQA 3PRPB 3HOXH 1EYCA 1WGRA 5I6WA 5ISRA 2KBNA 1TKWB 5JH5C 3NQTA 5FLXL 3DLLA 1H9SA 2J4XA 4QCLA 1UZXB 5CC4A 2CWPA 4YT0B 1TY2A 1L0YB 5CV9A 1C9OA 5C3EG 4DUYL 2ZJQA 3AEBB 4IOIE 3RULA 4BZAA 2B2TA 4DHJD 1PFNA 2MJDA 3B9JA 3JAME 3M3YH 3PVLA 5C4XG 1A15A 1SAPA 2WXIA 1WJ4A 2KHWB 4NZLB 3U2SC 2Y5PA 1FGUA 1GUNA 2H89B 3ABVB 3VR6A 3LXFA 3IAS1 1RFKA 4P6VF 3HK0A 2YYZA 2KZRA 1JALA 4AQYQ 3MEFA 3MTNB 3DWMA 4DV6L 1QWYA 1WIAA 3N9YC 1II3A 4DDID 3AE5B 4C4VB 1M1KC 2V4DA 2WX1A 3MJWA 2CJOA 4HJKA 2WB1B 2N7JA 2R61A 3MXUA 1Y56A 2LZ6A 4LNNA 5KNCA 2B2WA 4GZYC 4GLSC 2AHOB 3KYHC 4TUUA 3I70A 3QA8A 1ICWA 1L4DB 4QUFA 2Q2TA 1WYDA 1H9RA 2G4SA 3WWVA 3CF6E 4DK3C 5T8IA 4LLGM 3OWEB 4IO9A 2CCZA 2CKHB 3A9JA 2K5WA 2C7MB 1M94A 1NENB 4RGTA 4LF4L 4Z9CB 1F2ZA 4DUZL 4H44C 4DK6C 3MHSD 3L3OC 3PIO3 1AZQA 5DNFA 4JYAL 1TIFA 1H8CA 1V1OA 3GTKH 1H9JA 2RDGA 3RUIB 3MVVA 3UINB 4P74A 5IYDG 1IYFA 5JEAJ 2CHZA 3R66C 1WGKA 4HAEA 2H5XA 4BA2I 3FAHA 3FP9A 1E2VA 1TKGA 3M7GA 2CW0C 1E9MA 2N9PC 2Z4IA 3U8ZA 4XGAB 2HD3A 1KH0A 3S17B 4AQYL 2M8SA 2WNMA 4QIWE 3VTUA 5I9PA 2NVTB 1JT8A 4IN3A 3KOJA 5CORA 1SMYD 1C4PA 2JYTA 2UU7A 5CX3A 1S3OA 2WXRA 2L05A 3D32A 3VFKA 4GKJL 2DYOA 1J5EQ 4A3JB 2B29A 3QARA 1HNXQ 3Q3OC 1V49A 3V05A 1N33Q 2KMMA 2VXWA 2IO1B 1HZBA 5IIFA 3UGBB 3KLWA 2QILA 2KD0A 2WXOA 2EELA 1OFFA 1OTCA 3SXHA 4BKGA 2EY5A 4X64L 4LDTD 2B63B 4OZBA 3E0JA 2K01A 4PQXA 4GDKA 2DGYA 2FBWB 3VH4B 2DNFA 4N59A 3PMFA 4YSZB 4JI5L 3GE3C 4JI7Q 2VH2A 4UP8A 3HVZA 1S5BD 2M00A 2G45B 3B1LX 1FGBD 2H88B 1GXDC 1JOOA 1ROEA 4BBSG 2BVCA 3GTMH 2N7EA 1PDQA 1VMCA 2X6GA 1X3PA 2PI2E 5HGTA 3VYRA 2NYZD 4UDUC 3VR2A 5C0XJ 4GGQA 2F52A 1IW7D 3R2IA 2AX5A 2N4FA 1OXXK 2NUCA 4BXXH 1VS0A 1VQDA 4DR3L 5IT9c 5LMNW 2KUMA 2KDBA 2NVQB 2BKFA 4GKKL 1WX9A 2FCQA 2WKCA 1UD7A 3GTPB 2A8VA 2B3GA 2PPBC 2AQ3B 1E1TA 4FF2A 4HRSA 1PH7A 1YBYA 4GOPB 5JJIA 1EWCA 4LDTB 2V3PA 1HNXL 3RN2A 2LFNA 1F9RA 3GTJH 4XYOA 4YCUA 4DAVA 1C3TA 4U673 2RF4A 3GTQB 1QLBB 3GE8C 2Z4HA 5FOBB 2JZ3B 1DOIA 3W1GA 3O65B 3VUYA 4S0RA 3ZLZA 2NMQA 2YU9B 1F9SA 1K8AC 3DBLI 3CCMA 4NJ7A 2BDNA 1Y14B 1B9NA 4F88A 2BT6A 4A3KB 4V0BA 2M1MA 3G71A 4LUVA 3SEBA 1AZPA 3KDFB 2PE6B 3W5OA 3HOUG 1DONA 4GS3A 5CBAE 4ZOHC 4KKTA 2QCZA 2OEDA 1TS3A 1Y8NB 3HP3A 4NXNL 3WDNA 5EQ0A 4HTHA 1N63A 1QQRA 1A70A 2IZVB 5E6JA 4DV2L 4OWTB 2YEPB 4RHRA 5FO8B 3T53B 2Z0SA 5IYBH 1N34L 2A1AA 3VRBB 1KNAA 2ZTCA 2KQ7A 2R2QA 1V8QA 3L9AX 3JYUA 2JA6B 3C1FA 4L23A 2GVBA 1K8RB 4CYEA 2LWPA 3EECA 1PTOD 1IZ6A 2NVYB 4LF8L 1T0SC 1H4RA 2VB2X 1F9QA 1KJTA 1DYQA 3C3LA 4KIKA 2K33A 1EO6A 1HFGA 1QNUA 4II2B 3A9KA 3MP9A 2IY5B 2AL6A 1VZ6A 2BB5A 4G7HC 3K57A 4I6NB 1XLPA 4LFBQ 2MP2B 2IJ0A 2V3SA 1NVID 1YJNA 3U58A 3L13A 3V60A 4XE0A 3PV1A 5G5GA 5BMGA 1J0GA 3BDOA 1ONLA 4A3DG 4I6LB 5T1GA 3GTMB 2NS5A 4NJ6A 5IOIA 2O6VA 1MJCA 2QEXA 4HCPB 3HRZC 1CJEA 1VR9A 3B2FA 2WDTB 3DHIC 3PIP3 4FBJB 4ABNA 3S1MB 3UI2A 2F0MA 4WRDA 1A3VA 1A3TA 3TP5A 3K7AH 2KAJA 1NDDA 2KN5A 1HEZE 1GPXA 1BQQT 2MW5A 1K52A 1VQEA 4C80A 1DZ1A 4KV6A 2V0GA 1AH9A 2WACA 4WQMA 1GJZA 1GAQB 1E3PA 1WXMA 3SU8X 1T5XD 1MI0A 4UP9A 4B9WA 2C9WB 1LLRD 1EOTA 1GD7A 4H02A 4ZAIA 1K51A 1VQLA 4A3BH 5JJKA 2PMVA 1HNWL 2Z59B 4TSSA 2LHDA 2O2VA 1WTRA 1C4AA 1XCTL 2IO3B 1GC6A 3NTKA 3P75A 1QKZA 3GTJB 1RAXA 4XC2A 1XNQQ 2KJHB 3ZNZB 2UUAL 4HLEA 5IYCH 2V3NA 4NB3A 3MFGA 3A9JB 4QAYA 2K04A 1IBLL 3IKJA 4GMVA 2EKEC 3M4OH 4A93B 1U4LA 1X56A 1P3QU 3GO5A 4F1SA 2E2JH 1GOZA 2EOTA 2Q8RE 3D6CA 1WE7A 1EY0A 2HCIA 2PNRC 5HY6A 3F2CA 1GHKA 3JSVA 2KDIA 3TEXA 3NTIA 1ZUD2 1JB7A 3P20A 4OX9Q 5M3MG 3LJ3A 1OXVA 1B7YB 2LGYA 3AMUA 1SNQA 2PVOD 3T16A 1BDOA 3KYDD 1YD8U 4GN5A 1EZ6A 3DM3A 3FVQA 1BNZA 4NKLA 1BUIC 1Q10A 1V8CA 3Q23A 3OMCA 2F4VL 3M4OB 3AB5A 3ERSX 3HIZA 1PRTC 3QQ8B 3RCZA 1HRJA 2GRIA 3P4SB 1UNSA 2DX5B 1X3EA 5C44G 2EY6A 1FR3A 4HR7B 1WD1A 5KRUA 3CPWA 4CKBA 1RCVD 3SFEB 3RZDB 1NNXA 2AQ2B 3AU7A 3P4RB 1F2LA 1Z7TA 2RHQB 1AN8A 2F0DA 2RDHA 2JA5H 1GJXA 2PO4A 4TQ1A 5I4DA 1OQRA 1CUKA 2UXBQ 1J7CA 4I6PA 1UGMA 4KZCA 2UXDQ 4I65A 2A5UA 4K5XA 1GM5A 1N5XA 2MFIA 4DR6L 3DBLB 2K4KA 3I56A 1U4PA 2AQ1B 4LAAA 3PO3G 1TWAB 3PLVA 4QGUA 4Q0FA 2IX0A 4IALA 2C5LC 2K50A 1TS4A 4X3UA 3CCQA 3L4PA 2K5QA 3K6OA 3VRAB 3EFCA 3NUCA 5DM73 1B3AA 2D9UA 3LGJA 1LV9A 2MJ3A 3ZTCA 1SE8A 1BCPC 4ANUA 3UIOB 1D2BA 4LF8Q 4LWCA 1P1AA 1KXLA 3AV8A 5ELNA 1B8AA 2IX1A 1MHWC 1PFSA 2TSSA 3OIPA 4NXMQ 1I4RA 1CKOA 2DY8A 4S17A 2KHIA 4A3BB 1SNCA 2HIVA 4HCNB 4JWSC 1HQMC 4JCVE 3TUOA 4DK5A 3M4PA 4LFBL 3T3OA 4C3IB 5LMNL 2E2HB 2K75A 3A5UA 3D8GA 1PGBA 1QF6A 1OXSC 1UUPA 4KIKB 2Q2UA 1Y1WH 3H6NA 1LTRD 2Z6BA 2XBBC 2JA7G 4IZ8A 1SE2A 4YCWA 4OWWB 2KMCA 2F0LA 1AFPA 2X6LA 4L8JA 4A93H 4X65Q 3R7RA 3L7ZC 3DEOA 4CKCA 4DKAC 5CGKA 1VQNA 4J3OD 4EUTA 1WXSA 4RA8A 1V6EA 2KEDA 4HPLB 5EE0A 1CHQD 2WKDA 3CRKC 5J2RA 3CW2C 1A2UA 1K8MA 1TY0A 1IBKL 1TYGB 2B8FA 1D8LA 3TQYA 2OF1A 2LY7A 3EVQA 4FF4A 1QUQB 3HOUH 2PJHA 4RKLA 2UU9Q 4FULA 1YN5A 1PXUA 1YHQA 5L95C 1E7ZA 2NZOA 4BY7G 3IXSA 4YY3Q 4TQUS 2D0OA 4REZA 3HKSA 3RMKC 3A54A 1PRTD 4GNXB 2KOLA 1RYJA 3CU7A 3TZDA 3DM1A 4X66Q 3KUDB 2DNEA 2K8HA 4UP7A 2L00B 2JF5A 2Y0SG 1SSOA 4L2YA 2HTME 2NBUA 4LNKA 4A3FG 1VQKA 1PH5A 1C4QA 2E2IB 3QO2A 5CR3A 4K7UA 2NB0A 3PUYA 1LT4D 2IBIB 1FD6A 3E9IA 4P73A 3T1HL 2BOSA 1CMXB 4G57A 1PH4A 1YJ1A 3J81c 1QB5D 2QGQA 5D65A 2I0QA 2GBMA 2K3UA 2Z0DB 2F0VA 4GDLB 4IWOA 2MUYA 1PZJD 1CKNB 4A3KG 4X3TA 5IE8A 4K5VA 3DCGA 3ZJVA 4R4OA 3AU4A 4FJZA 2LXAA 2NBFA 2F0TA 4URKA 4IOCA 1A6XA 1YX5B 3RNFC 1DXMA 1QG7A 2MBOA 3M3JA 3ZJUA 2C60A 4OONA 3ZUNA 4OX9L 3PQIA 1HZ5A 4P1BC 2RCFA 1FL0A 1VMPA 2E75C 2EY2A 4MNOA 1ASZA 3X0WA 3NHEB 1FVIA 4IPGA 1BXTA 2KANA 3EUB2 4N9TA 1ENCA 2C7NB 4JPSA 1Q82C 3E0EA 1BF4A 4WJOA 1R7SA 1L0XB 3NBHA 1TIID 4YTMB 1L1OC 3JC66 2BS4B 5KEEA 2GLSA 1MD2D 2V9HA 4W9JA 3SE0A 4ZDVA 4W9FA 1RRBA 4HK2A 2Y0SE 1PVOA 2MBBB 2AKWB 3PZ7A 1RTNA 5M3MB 2JK8A 4A3PA 2IX3A 1PFDA 2PYKA 3OWFA 2K14A 1GUWA 4A9AA 2EYMA 1YNJC 4P75A 5BN5A 4WIPA 1J9OA 5AUKA 4WJ3M 1E8YA 1SSNA 4FF1A 3MJ5A 1N8RC 5M5YH 4HDOA 4E71A 3ETRA 1E90A 1YQ3B 2JZPA 2K6AA 3T1HQ 4HJ8A 2X69A 3SHLA 4L1BA 5F2DA 4LMQD 1X65A 4JG2A 1C1YB 4A3KH 4WJPA 4ANWA 5I9OA 4R9WA 3J7AV 4KKSA 3PO2H 4NNJB 5IA7A 3SGIA 3QB3A 1FFUA 4FHJA 2WDVB 2ZJDA 3JW0X 3NS8A 1Q8KA 2ZTDA 1CSQA 2GOWA 1HZAA 2JXXA 3ZJYC 2KK8A 3D4RA 4CJ0B 1LQBA 3PGEA 2ENBA 2PZWA 4II3B 2J0JA 4YHHL 2ID0A 2EKIA 2MA9B 3SHQA 4NXML 5FJ8H 1PTOC 4DR1Q 3QK0A 4FN2A 3HKZE 1Q0WB 1UF0A 3Q8CA 1S5DD 1WYGA 2BF8B 1R4QB 2R7ZG 1Y1VH 2KENA 4CDFC 1JORA 2PVGC 3ZNHB 4JI2Q 2AMCB 1WSPA 1JMCA 3PUXA 4KTAA 5ELFA 3TREA 5IGCA 4IFDH 3N1XC 2F0FA 2EZVA 2ONQA 3CP0A 3H0GG 5M5WH 2M17A 3AULA 4W9KA 5IGGA 2PNHA 3LX0A 1VD2A 4KZ0A 3I57A 4X6AH 3AXCA 4HDQA 4W9GA 4MJSB 5IWAL 3Q14C 1RHPA 3CC2A 4EOYA 3IRBA 3HFZB 1OEYJ 2BGFA 4B0MA 1X1MA 2MJ8A 1R4PB 2GBJA 2E5LL 3NEMA 1YI2A 3NBHB 1I4PA 1KRHA 3BU2A 2R93G 3C46A 2OQ0A 2K1FA 2CHWA 3K80C 1ZXHA 1IHZA 3S15B 3DBHI 4LF7L 4ANVA 3J7ZC 1EF5A 5CV4A 3S2DB 1E7UA 1VF7A 4ZYSA 4C4VA 4DAMA 1N6ZA 4JOIA 3ENEA 2V4LA 1VRAB 4LK1C 2A69D 1E1OA 4MGKE 4DK0A 3GD7A 2CR5A 4K7SA 3U7ZA 1EEFD 2EJMA 3CWIA 4CBVA 1B2TA 3O13A 1XF5L 1ILQA 4L5TA 2ASQA 3E9SA 3DVGY 3ZDTA 2L1AA 5M9OA 3RNUA 2PZUA 2FINB 4FF3A 3APCA 1Q1BA 3VR8B 2KYWA 2F3IA 5FLMG 1VQ6A 2IO0B 3ECIA 1VQGA 3KW5B 3NUHB 4RKBA 1RDPD 4A4IA 4C1NK 1Q7YC 4NDXA 5JEAH 2G1EA 1IBXB 1CKMA 4HKZE 2XN9C 5J39A 1I6HB 3H0GH 5JJZA 4RGNA 2E2JB 1C8CA 2N55A 3AFPA 3GQBA 3PUWA 2D11A 1CA6A 5C3EB 1XCQL 2NN6I 1D1IA 2WB1E 2IW3A 1KM7A 2DYMA 1JCKB 3PO0A 3KBXA 1ESRA 3JAML 3HKZB 5D3DA 1NR2A 2O6VB 3GTQH 1WTPA 4W9EA 3CHBD 4FP5D 3WOFA 2BWES 3PZDA 3M62B 2F0UA 5TSSA 4DU9A 1PRTB 1Y1VB 5FLXE 1XMOL 4QB4A 2ES2A 3U4ZA 1NJIC 2XEWA 3R3MA 4DR3Q 2MP2A 2PW7A 1F2RI 2WU2B 2WXLA 4EZKA 3OTOQ 3IT6B 3I5JC 4X3SA 1EOVA 4MTNA 4XDDA 3KUPA 4P2CB 1ZP0B 4B3TQ 4KD4A 2KNBA 4BA1I 2I1JA 2RQXA 3A4SC 2BE5D 3NELA 4POFA 5E7NA 1F2YA 1OXUA 1A0IA 3W1SA 1PRTF 4DBGA 1AE2A 2VQEQ 2BS3B 1PGXA 1UE7A 4A75A 3CAMA 1TR5A 3IFDA 4DV3Q 2FIDA 1K28A 1UAPA 2LUEA 1OQYA 2OOBB 2FMCA 2XRSD 5C3WA 4KDLB 2WP9B 4RNAA 1D6EC 2B2WC 1V1PA 2KVMA 2SNMA 2OHFA 1DOLA 2N9EB 3I4LA 4ID6A 1L1OA 4MHEA 3P4QB 1GVPA 4B08A 2B8GA 3NK9A 3KF6B 1FM0D 4K1RB 4ODGA 3ZRFA 2KFKA 2BKRB 4EVOA 1VJKA 1HE8A 2B2UC 2UUCQ 2L7RA 4YSXB 2QDFA 2XK5B 4C00A 1KC8C 1MG8A 3IHPC 3Q3MC 4AQ7A 1H95A 1JROA 3B6YA 1STNA 3N52A 4ZHPA 2NN6G 3VHTC 1RD9D 1YNXA 3GTOB 4FHKA 3KYCD 4CDDC 4MN3A 1Y1WB 2RA4A 3RZOB 3S24A 4POGA 1TBEA 4M8NA 2R2OA 4FXKC 1FIQA 4DQOC 2IHFA 3H7PA 1MJEA 4GOPA 3V3XA 1XMOQ 2MSED 3WIMA 2CQOA 4A3EG 3LNNA 4NMZA 3DWPA 3RPFC 2BW2A 2CHXA 2RCNA 4ZK9B 3PTFC 2FJ2A 3DHHC 3H8HA 1YN3A 5HGQA 2KDFB 3D6WA 4OEMB 5C5LA 4BS9A 3H0GB 2JY6A 4OW0A 4OVVA 3AEVA 3DBHB 5E4WC 5CHFA 3GTKB 1FXAA 3HG9A 1TXYA 2RVLA 4HJ7A 2K6QA 4G11A 1T9HA 5C6AA 2N7DA 1TWFB 3MC9A 4DPGA 1IXRA 2QF7A 2KLGA 3NENA 4LCDE 2JA8B 1KF6B 2O4XA 4KY5A 2K1BA 3SDLC 2C9OA 1PFBA 3K5MA 1QT9A 2O2VB 4N58A 2MX2A 3HOYG 1IGCA 4EGVA 2WS3B 1BR9A 1NBFC 4DNIA 1IYJB 2PEAA 4OIKA 3A4RA 1LUZA 4JI7L 4YTNB 1MI2A 1JJGA 4P71A 4QJFA 4YWKA 5ELDA 1BBUA 4EX5A 3AE2B 3I4NB 1B50A 2D3AA 2CKZB 1QZHA 1VQ7A 3S14H 4BBNC 2W9NA 1AEXA 4A93G 3N3KB 2JA6G 1K0SA 5D6JB 3D31A 3IBEA 1GHJA 3RNAC 5ELBA 3VDZA 1G2SA 5I2XA 1KDAA 2R3ZA 1VZ7A 1CFMA 2F0OA 3VUXA 4M1UB 2R7FA 1XNQL 1WCMB 4KY6A 1F9JA 2JPHA 4JOIC 3HEJA 3KK7A 2VY3A 3I4NH 4ZRPA 2LEKA 4WJ4A 4DN4M 3NXWA 3I8ZA 1TWCB 4EQPA 1N34Q 5IGFA 2INNE 3P7JA 1PA6A 3Q3JA 4WWPA 1BMLC 1WXQA 3PRMB 1NYQA 2SOBA 1E6EB 1NYRA 2TMPA 4FVMA 3DHGC 3N6RA 2QJLA 3IL8A 3L08A 3ERQA 3TBIB 1PH9A 2HCCA 3AFQA 3V96A 1N5WA 1NMGA 2OJRA 4MTKA 4LFAQ 4TQ0A 4K8JA 2A6HD 2L0CA 3J81j 2PKOA 3S2HB 4WAFA 4HPMB 1XYIA 4N8X1 2OXPA 2LMCA 1L2NA 1D1KA 1WGDA 2R93H 2I1KA 2O6VD 3PPAA 3ZQ4A 1HCZA 3A74A 3T3NA 2BA1A 1QVCA 3M3YB 2B76B 5DCNA 5T1IA 2F3VA 2NVXH 2CJNA 2YTVA 5C4ZA 1JWMD 1I4XA 2F0KA 4RGOS 2ZCCA 4NY0A 3I90A 3RNBC 5DAUA 2UUAQ 2EPBA 3G6JB 2MBQA 1XWEA 2ATWA 2F0IA 2WV6D 1ZXIA 1JICA 3NBIA 4OIJA 2MNAA 4JYAQ 3FKIG 3CC4A 3AECB 5AZHA 2PMZE 2KJ6A 4EFOA 3I73A 3ZNID 1D5MC 3A8IE 4FO2A 5FLMH 4ZUJA 4E74A 3CCVA 4A3IG 2JXTA 1N36L 1SFOB 5JPNC 4B3MQ 3NZUA 1LT5D 1PZKD 2F0HA 3QG1A 4TKNA 1XLOA 2OT2A 4IDIA 5BYSA 2B63G 2VW9A 2KJRA 4APVA 3GTGH 2JA8H 1JRUA 3HGBA 4C3HG 1KD1C 1C76A 4ICUA 2KN4A 2DJGC 1LTSD 2M2LA 2KDMA 4KKUA 4BKTA 5LXIB 1SIFA 5EPJA 3HOUB 2CVRA 4QL5A 1EFID 4KN4C 1IKMA 1KLUD 1ZDXA 1CQVA 3I91A 1PYBA 4YWMA 3MC8A 4G4KA 5GAGC 1R9TH 1SNOA 1DM0B 3K5NA 2NVYH 2I38A 2KFJA 4GLVB 2XRQD 4C3JB 1MBYA 3A7AB 3NZ3A 5JHBA 1ZXTA 3FKIH 2JA6H 4GNXA 3OMGA 3S2DH 1YVCA 1HTOA 3NRZA 3Q69A 2VH1A 1CI3M 3A1QB 1V5TA 1EQTA 4PMCA 4B3RL 4DR7Q 1KNEA 2R7DA 1TVXA 2UWQA 3FRPB 2E76C 4ZKCB 2BE5C 3F2DA 1GO3E 3RLNA 2UXCQ 1SYFA 1SGHA 4IM0A 1R9TB 3DDCB 1HFNA 3U50C 3KLSX 2LMCB 4NAWB 2AL3A 2KQ3A 4HIMA 2KWVB 2J7QB 4F8CB 1Z6HA 2MEKA 1EIHA 2LXJA 4LW1A 5HKHA 4FXGC 3VR5A 1QCBD 2RSNA 3KLSA 4C56C 4A3GG 1YJIA 3VVWB 1EYGA 2A6EC 1L0WA 5DLQE 2GBNA 1ACCA 3Q3NC 3RZDH 1TKYA 3WANA 3UI3A 4GOPC 2JRIB 3ULJA 5J3BA 2LXCA 5JAVA 1ZYRC 2IO2B 3EFUA 4DV5L 3FEWX 3L17A 1FCLA 3I4NG 4ZRJA 4ZRIA 1ET9A 2K5VA 4J1MA 4K5WA 2NVXB 1E0ZA 1UELA 2LVQA 3RN5A 3I55A 3U4EG 5C3EH 1ENAA 1C77A 1A63A 2WU5B 3KJOA 2HD5B 3NSWA 3C2PA 4JV5L 1WR6E 3TP8A 3U7DA 2D2CC 2WGSA 3AE3B 4X65L 3K5LA 4A3JG 3Q8EA 4JQWC 2QA4A 1VQFA 3BVMA 1GUSA 3BIID 2VZAA 5IYBG 3JAMi 3K9OB 2HT1A 3OSOA 3ZXVA 1WX7A 1VQ8A 1TGZB 3DWGC 3I9V1 1T0QC 4R3DA 2DJFC 3GTGB 1FXTB 3H94A 2ZXOA 1H9KA 2Q8TA 2FMMA 4W9CA 1M4VA 5C5MA 1KL9A 1XX8A 1WCMG 4UY8C 5IODA 4MGZE 3N30A 1B9RA 2XWJB 2EVBA 4R8NA 2A69C 3Q3FA 2RDBC 1SRUA 3R93A 2QW7A 1WJ6A 1EIYB 2FCMA 3X3NA 3E6ZX 4AWJA 2FCSA 2DHZA 3GOEA 1QOAA 3MXGA 2F0JA 2KXJA 2MCNB 5LNK1 3DBSA 3H7SA 3BK1A 2CHBD 1KHIA 1S5ED 2CWAA 2KCTA 3FILB 5JZEB 4BVUC 1IL2A 4NQKE 2ZXRA 1WGGA 1IYVA 1WTHA 4PZ8A 1F52A 4LUZA 4N8FA 5EKIA 3UDFA 4QQBX 1LGRA 4G3XB 2K05A 1WX8A 4BY1G 1ISNA 4A6QA 3OW7A 4KHPQ 4XT1B 2WXJA 3V6EB 1CM9A 3A5ZB 1VQMA 4IPDA 4IUPA 3HOVG 2BA0A 3Q22A 1JJCB 4Q5VA 1I50H 2AUKA 2F0EA 1XMQL 2Y3AA 4BXXG 4OO1H 2LFIA 1JE4A 4KLKA 3RD2A 4A3FH 1AWDA 2K25A 1GKHA 2NWGA 1UWVA 5BN4A 3ZXRA 1MFWA 1K73C 4OXPA 4PMWA 2MBHA 2PTLA 3ZGZA 5ELOA 3EHVA 1I3QH 5M3FG 1UBQA 3CSTA 4EZLA 5C3JB 1LO5D 1STAA 3CRLC 1T5EA 4DV1Q 3KWLA 4FXDA 5AZFA 3QHTA 2JQRB 1MHXA 1I50B 5CV7A 4G7OC 3PSEB 1IP9A 3D0FA 1R4MI 3HOYH 3GZNB 2CFMA 3BYYB 3PT2B 2I2YA 1RJTA 4NW2A 4X62Q 4DR2L 1QVGA 3Q6BA 2ZT9C 3MTSA 1YHAA 4A3IB 3VR9B 1LACA 3SK4A 1FJGQ 4L5QA 1HA5A 2FUG1 2E2DC 1U4RA 5C44H 1SROA 1JOKA 1EQRA 4JI3L 3K8AA 3CCJA 1HPCA 5EBCA 2HIXA 5GAEC 1LTID 1V81A 3KQ4A 1IBXA 3G4SA 1XT9B 4AJWA 2AUJD 4AOFA 1I6HH 3D3RA 4A3MH 2XIWA 1P8LA 3QR8A 2LGDA 2INCC 1A3UA 4DV4L 4WJWA 2KDEB 2LGSA 2WXGA 3PS6A 2A19A 1SNDA 2SEBD 4JI1Q 3RYTA 4XYQA 3Q8BA 2REXA 3VUWA 4A3EH 1G51A 2L12A 3VQIA 4AJYB 5KNDA 5M3FB 3M4QA 2K0PA 3IT4B 4Q2JA 2A5HA 1STEA 3BVZA 3VYTA 3AEAB 1XO3A 2G9DA 1UGJA 1G2TA 1TU2B 4RH6A 3STBC 2WXFA 3Q2AC 4K3CA 1YQ4B 1MJDA 2F0PA 1P16A 2N88A 1WZ3A 2L5TA 2D07B 4YTPB 1F1HA 4CDCC 3R8BA 4GNXC 1VQ5A 4DV0Q 1X3QA 1JMLA 4OVZA 2E3TA 2D5DA 2BYEA 5KIXA 2EJGC 5DPRA 5IO9A 4DXGA 4YHHQ 1IBML 1VLBA 2WQYB 3C0RB 2JA5G 4FYDA 4JVZA 4W9IA 2AWOA 1N33L 3SK8A 2N1WA 3AE7B 1J8IA 2J52A 1TZ1A 4KVGB 4BY1B 5HG2A 3G7LA 1PTOB 4DXAB 2R7ZH 5JXVA 4FXCA 3IFTA 4TV3A 1VCIA 3H3VI 4F7XA 5HFYA 2QDLA 4JC0A 4X3KA 3I4MB 2F3WA 2Q5WD 1IYUA 2OTJA 2WLBA 1TJEA 2YLMA 2FFKB 1TWHB 4DNRB 5FJ8G 3WA0A 3S1MH 2A73B 1LFDA 4EE2A 1CKNA 4Y52H 5IGDA 5BR8L 3H15A 2UUBL 3UIPB 3E3XA 2YTYA 4BBSB 5NUCA 4R4TA 5M3MH 4W9DA 3HOYB 3F2UA 1HR0Q 2BH8A 1Z9FA 2K5PA 2E5LQ 4FDBA 1N61A 1W3SA 2L0FA 2Z0EB 4KMUC 1NCVA 4AP4C 1W6KA 3NVZA 2VQFQ 1E10A 5G3LF 2K52A 1VQIA 1C78A 4R1JA 5E1FA 4A3LH 4AYBG 2WXQA 5BYRA 1SMYC 2GA4B 2J0KA 1QJOA 5CHVC 1EY9A 1UE5A 1FNUA 5IYCG 4HIKA 1NSNS 2MQHA 1XMQQ 1E8WA 4KSKC 3HOXG 3CQZB 4HMJA 1QILA 1L6UA 3LB8C 1HUMA 2D62A
chains in the Genus database with same CATH topology
1ZKOA 3HOWB 3S9WA 4WORA 3BYTB 1WD0A 4RGMA 3EROA 1RM6C 3TEWA 1SYDA 3DUZA 4A90A 2KA7A 2ZXPA 3QIAA 2X38A 1KFYB 2MHVA 1FRDA 4A3GB 4H7BA 4A3EB 1HXYD 3H6MA 2L32A 3SR1A 2F0SA 2A6ED 5ELEA 4M8AA 3P4PB 3A8KE 1IL8A 4ZLTF 4IUUA 3S14B 4XQQA 2EYJA 1QOBA 2E74C 4NP5A 1SJHD 1H9MA 1WTOA 1EY7A 4RAUC 1GUOA 2HUGA 3J80L 1CZWA 2K22A 4ARIA 2RDFA 2ICIA 2WXKA 4QUCA 4QF4A 2F03A 2WXMA 1KDCA 3W2DA 4CJ2C 5BMHA 1PYWD 4S3SA 3TN2A 2G9HD 1EU3A 4L63B 2SDFA 1ENFA 4YIJA 3AEFB 2WINB 3SVMA 2KWDA 2RKSA 3QOLA 2D5GA 2NZ1D 2QEJC 1SJED 3K7AB 1EWHA 2BDOA 3GV3A 5MPOA 1FD7D 1EU4A 1Y8PB 5I2YA 3H09A 3NHHA 2J53A 1CHPD 1DOKA 3OOCA 3V2TA 1PUTA 3QJYA 5IT9E 3EJIA 1XEEA 1B44D 1NEKB 3QWNA 1E2ZA 3WOEA 3DMUA 1QOFA 3J81E 2JA7B 5J1ZA 1U9RA 1YNTE 4TMAB 1LT6D 1L5PA 2DY7A 3A55A 3KWVA 1JC7A 2B2YC 3HS0C 5J22A 2B2VA 2EYLA 1RTOA 2R92B 2XVSA 3J80E 3PUZA 4OZAA 2PQEA 3OIQA 3P1HA 1PLFA 2B2UA 4J6HA 3BWUD 4H2AA 4GDKB 2L1BA 1ZE3D 3W5VB 5LHY1 1QOGA 2KEEA 2J42A 4PMBA 2BB6A 1JRPA 1FFVA 2L11A 3ZYYX 4OO1G 2HQEA 3A56A 2WIIB 3TEZA 1GB1A 2EY1A 1YJJA 2QSDA 2JXMB 2IT1A 4KHZA 1YMHE 5I6YA 3BK2A 1BUVT 4NJCA 1S5CD 3MHBA 2O5JC 1Q3LA 4P16A 2Z8LA 1EYAA 1EQVA 3Q6SA 1D5XC 3PV0A 1A2TA 2ICEC 2VZKB 2M19A 1YNNC 4MH8A 5A35A 4MM3B 5C44B 4C3IG 1G91A 1XTCD 4ZUIA 4H0LC 4DNTB 2F0WA 5IT9L 1TKEA 1I4QA 3OPOA 1P7EA 3BZDB 3AE4B 3AMZA 5FO9B 2JP1A 5C3XA 2NTTA 2R93B 5JEAG 4KJOA 1EWYC 4IUVA 3C8YA 3IAM1 1EL0A 4KGTA 1PTOF 1BCPD 3S1NB 1Y8OB 1L0VB 2HDLA 5KGUA 1I4HA 2LHEA 5M5XB 3AN1A 5ELCA 2W55A 3H3VC 3IAYA 4HEDA 1WRIA 2LS01 5H92C 3MAQA 4C1NI 1C48A 4KHVA 4TRDA 5EPLA 4V190 3NWTA 4JE3B 1O7YA 5E4XA 3P63A 2F4IA 3KBGA 3J7YW 1K50A 3FILA 1EYDA 1IGDA 3EQLC 3NWSA 2WXHA 1HA6A 2M56B 1Z47A 4CKEA 1PDXA 2IDYA 2F0NA 3VR4A 5K5PA 1ZPSA 1KAAA 3MXPA 3P42A 2YEPF 3W3AA 1DOYA 4KN7C 4QMGA 3W9CB 1VDZA 1O78A 2JA5B 1I3QB 5D7GA 1DJRD 1JQ4A 3ND9A 1ZYRD 1KABA 1JWBD 1V43A 1U4MA 5C0XG 4RWSC 4WFN3 2FE8A 2PIAA 4ITKA 3VA5A 2F0GA 1YN4A 2SNSA 5M5YB 2XSCA 4UAIA 1F77A 4B9XA 4RCOA 2B2VC 1AW7A 1RF2D 2QMTA 2EYOA 1STYA 2CW0D 4XQJA 3C1EA 3NP8A 2KCCA 2JYEA 1ZOYB 4J8QA 1NI3A 3HZXA 5DEHA 2K9XA 2DNCA 5IOCA 5IGEA 3MHZA 4HKQA 3MXNA 1KLGD 4WWMA 4N9PA 2DLBA 4KJNA 4HEA1 3FDTA 4KX6B 5JOBA 2W54A 4FNFA 5COYA 2LGIA 1BO0A 2MH7A 5AUIA 4CHTB 5HURA 3D4WA 2W3SA 2N9LA 4HSVA 2VB3X 1JWSD 1F0ZA 4DA2A 1MGSA 4JWUC 1O7ZA 2O2LD 1EEID 3D4DA 1G6ZA 1K53A 4DGZA 4WURA 5FO7B 4XIGS 1E0BA 4L6TB 1AP0A 3J9CA 2A74C 4MACA 1DOMA 3RD4A 2O5IC 5C4HA 1SNMA 4A3MB 3RFZB 3AM9A 1EY8A 2JSOA 2MP1A 1Q1EA 3WCQA 1EIGA 1JB3A 1TWGB 1CTMA 1D5ZC 1SXTA 1DCZA 3BVGA 1TZOA 3S1QB 1GUGA 1FCCC 3FMCA 2OEOA 4DAPA 2K03A 3RLFA 3U9OA 3M85A 2RSOA 1S5FD 3J7AF 4YXDB 3TDQA 4DF7A 2H4OA 5M5WB 1XLQA 4XWTA 3K59A 2CQAA 3NS1A 5IGBA 4N6EB 3DWQA 1KDBA 3ITPA 1CK1A 5EGTA 3MEHA 2JSVX 5FKAC 1I6VC 3K58A 1MSHA 2BCOA 1UWXA 1HHVA 2PMZB 3EGRA 2KHSA 5C4JB 4IQZA 1N62A 1WTXA 3J81L 1SYBA 1SNPA 1B53A 1EZ8A 1JW9D 2GB1A 4LJZC 1ESFA 2F0QA 1ML0D 3VA7A 1IKLA 3S1RB 4E6IA 3TP7A 1G8ZD 3SR6A 3Q8AA 3MFYA 5C0XH 4R8IA 3TMEA 1VDVA 1NR4A 5AFWA 4JBWA 4HN7A 3CKIB 5EKKA 2PW5A 1EY6A 2BBCA 2I07B 4KKJA 4HJGE 2K7VA 2R6GA 3RUZA 2JU6X 4PV1C 2N9KA 4K6LA 2MJEA 2M9VA 1LTTD 2HDMA 1H9SB 2QIEB 2EXZA 1BCPB 3ND8A 1EM7A 3I3CA 1SB3C 3ONAB 5FR3A 2PCFB 1JOQA 4OO1I 5BMIA 4K8IA 1STBA 4ILWA 4KKIA 2N0SB 2WXPA 1FNVA 2H1EA 2AWNA 2GI9A 5KNBA 2C5CA 4ZRQA 2ON8A 3PO2B 3HVDA 4CQNA 4K2LA 3E5SA 1PFMA 3NVVA 3R2TA 4D2KA 5GXGB 2IGDA 2JX5A 4MT5A 4MIUA 1F9PA 2EDGA 2BTEA 3PO3B 5EE1A 4XQNA 2L52A 2XNAC 2QKIC 4ZRZA 1JWUD 3EA6A 2LJIA 1RODA 5CV5A 5HHDG 3ZJTA 3BDLA 3AEGB 4RF1A 1QOHA 3T51B 3TSSA 1STHA 3VYSA 1W6JA 5D14A 2I46A 1L4ZB 3GB1A 3T4AC 1BBXC 1SYGA 4K14A 4BWGB 1B4OA 2MPMA 1RWSA 4RCNA 2V4IB 1G291 4IUQA 1SYCA 2EE1A 2Y5CA 3GS2A 3DWAA 4O1NA 4IFDG 4H13C 1PGAA 2ACZB 5CV6A 1BCPF 3NVYA 4YWGG 2BYTA 4O42A 2EYFA 3EFXD 4HCEA 3A8JE 2LUMA 4ME5A 2KQ4X 1CZGA 5CYUA 2BS2B 2A68C 4F8MA 1CQFA 2QDBA 2QCPX 2B39A 1P7FA 2PW9A 5G3LD 2E6XA 2W3RA 1B1ZA 4B0EA 5A2QL 3NTHA 1FXIA 1I7HA 3K5OA 2NN6H 1V97A 4LK0M 5BYQA 1MVKA 2K5DA 3TZUA 3AE1B 1FYCA 1C4CA 3VYUA 1UWMA 4QIWB 2RMMA 2FHTA 1DGJA 3H91A 3B2GA 5A2QE 1FO4A 1PMRA 2RPVA 1NAPA 3GV6A 4EQNA 4TKOB 3A7LA 2ZW0A 4K6DA 4HCSA 3HOZB 5KYLA 5C0XI 4LTUA 1TT2A 2JWUA 4ZQ3A 4KK7A 1CT1D 1MPEA 3AH7A 4A3FB 4DAYA 1S4ZA 4YSYB 2M0AA 1F2RC 1IUEA 3SDZA 1FRRA 5BN3A 3FPPA 4RF0A 4BY7B 2K28A 3QOJA 4KI0A 3CIRB 1Y69U 3BDCA 1FMAD 3KLRA 3HOXB 5CV8A 1SF0A 2JEAI 4CJ1B 4XXEA 2SAKA 4IKGA 1YNND 2WP8J 4C2MB 2ZW1A 5DM63 3URYA 2B2YA 1STGA 1FEHA 4PT5A 1E7PB 4NAMA 1CZPA 3GTLB 1RKNA 4IFDI 4A55A 3NQIA 2F1MA 1XLNA 5K36H 1EY5A 4US9A 4K2KA 2KJXA 3VR3A 3AE8B 1HQRD 5EPKA 1VF5C 4USAA 2HDEA 2A6HC 4ULLA 1PZID 2EYHA 4XTCS 1ZEQX 1SIJA 1WVLA 2L83A 5FK9C 3R3OA 1OO9B 1IW7C 1K83B 1WTVA 2Z1CA 2W82A 2XWBB 2WXNA 3FKIB 2EJFC 1D4BA 3BS1A 1XXGA 4IUTA 5EBDA 1FNWA 1M8AA 4JK1C 4C3JG 3NVWA 5CMDA 3LWUA 3MZ5A 5H8YE 1UEAB 1LTBD 1WTQA 1HZ6A 2Q8IB 1GB4A 2IWHA 2R7ZB 1DOXA 3Q24A 3HOVB 1SDFA 2VZKD 2WDQB 3X3MA 1J7BA 5LL6X 2KCNA 3MC0B 1EY4A 1DD2A 3DXJC 4EQOA 4BBRB 4KGSA 3OHXC 1T6BX 4ZHOA 3PZ8A 2IGHA 1V1PB 3W5UB 1Q12A 5HI1A 3AEEB 1WTWA 5D3IB 1Q90A 1LT3D 2JYOA 3SFDB 1SEBD 2IPKD 2PLPA 2CU3A 1KTKA 1AYFA 3RMHA 1MSGA 1N60A 3HRDD 4WH4A 1I4GA 1X32A 1HTPA 2B2TC 3M7NA 4HSPA 1SBBB 3I72A 4IURA 2L4NA 2J0TD 4AS1A 1BOSA 5KYIA 2JE6I 4U68A 1QE6A 1ILPA 1Q8IA 3KF8A 3GP7A 1TS5A 4C7ZA 5CBEE 3T13A 1WWTA 2WAQB 5K36G 1J7AA 2B76B 1LTAD 4OL7A 4IFDJ 3M4YA 4A3DB 3AEDB 3HUIA 3PUVA 1C9FA 4KD3A 4OGQC 4OZCA 3TP6A 3MWYW 5E3FA 1NUCA 3NPPA 1MHHE 5EJWA 4ZKBB 3P1MA 1L6VA 2VUMB 4HROA 1B9MA 5EE3A 4KGRA 1SE4A 1OXTA 5LL6S 2WDRB 2VNUD 1LABA 1K8OA 1LTGD 4A8XC 1C79A 4ARCA 3Q8FA 4KY7A 3S16B 1GUTA 3AE6B 3FPUB 3SK5A 4G7ZC 1T3QA 1HTLD 2K32A 5JVH3 2L9HA 1PTOH 5C2TB 2LKVA 3DEPA 4DXFA 2INPE 5EKLA 3Q0AA 4XT3B 4DFAA 5G5HA 2DN8A 4I7ZC 4C3HB 1TS2A 4AYBB 3NE5B 4DK1A 2PZTA 4M0WA 1JWAD 2NTSA 2EYPA 2IL8A 3T56B 1YNJD 3LWEA 3AE9B 5JVG3 4F87A 4JX1C 4XWWA 3TEYA 1JQYD 5C4XB 2IGGA 1ZDVA 2Y0SB 4US8A 4XDXA 1TQOA 3K0YA 2J7ZA 1SYEA 3U9SA 1VZ8A 2A68D 1O80A 2MGSA 4HMIA 4CGYB 3U52E 2JEBI 1E2WA 1JR0D 3BG3A 1F2MA 5JPMC 3SK6A 1O7LA 4RHSA 1CA5A 5EE9A 2DBYA 3E56A 4IUNA 3AB9A 2L55A 4PNYA 1HUNA 2RBMA 1ET6A 4Y7NB 3DHQA 3FC4A 1SE3A 3MA2B 1QNKA 2DWQA 4XDCA 3LYYA 4OHJA 4RFBA 2KECA 1OQQA 1EYCA 5I6WA 5ISRA 1TKWB 3NQTA 5FLXL 1H9SA 2J4XA 4QCLA 5CC4A 4YT0B 1TY2A 1L0YB 5CV9A 3AEBB 4IOIE 2B2TA 1PFNA 2MJDA 3B9JA 3JAME 1A15A 1SAPA 2WXIA 4NZLB 3U2SC 2Y5PA 1GUNA 2H89B 3ABVB 3LXFA 3VR6A 3IAS1 1RFKA 4P6VF 2YYZA 1JALA 3DWMA 1QWYA 3N9YC 1II3A 3AE5B 2V4DA 2CJOA 2WB1B 2N7JA 2R61A 3MXUA 1Y56A 5KNCA 2B2WA 4GZYC 4GLSC 3I70A 1ICWA 1L4DB 4QUFA 1H9RA 5T8IA 4LLGM 3OWEB 2K5WA 1NENB 4RGTA 4Z9CB 1F2ZA 4H44C 3L3OC 3PIO3 1AZQA 5DNFA 1V1OA 1H9JA 2RDGA 3MVVA 5JEAJ 1WGKA 4HAEA 4BA2I 3FAHA 1E2VA 1TKGA 3M7GA 2CW0C 1E9MA 2Z4IA 1KH0A 3S17B 2WNMA 5I9PA 2NVTB 2JYTA 4IN3A 5CORA 1C4PA 1SMYD 2WXRA 2DYOA 4A3JB 3V05A 2KMMA 2VXWA 5IIFA 2QILA 2WXOA 2EELA 1OFFA 3SXHA 2EY5A 2B63B 4OZBA 3E0JA 2K01A 4PQXA 2FBWB 4N59A 3PMFA 4YSZB 3HVZA 1S5BD 2M00A 1FGBD 2H88B 1GXDC 1JOOA 1ROEA 1PDQA 1VMCA 2X6GA 1X3PA 1IBXA 5HGTA 3VYRA 2NYZD 4UDUC 3VR2A 5C0XJ 1IW7D 3R2IA 2AX5A 1OXXK 2NUCA 2KUMA 2NVQB 2WKCA 3GTPB 2PPBC 2AQ3B 4FF2A 4HRSA 1EWCA 2V3PA 2LFNA 1F9RA 4XYOA 4DAVA 4U673 3GTQB 1QLBB 2Z4HA 5FOBB 1DOIA 2NMQA 2YU9B 1F9SA 2BDNA 4F88A 1B9NA 2BT6A 4A3KB 4V0BA 3SEBA 1AZPA 1DONA 5CBAE 4ZOHC 4KKTA 2OEDA 1TS3A 1Y8NB 3HP3A 3WDNA 5EQ0A 4HTHA 1N63A 1QQRA 1A70A 5E6JA 2YEPB 4RHRA 5FO8B 3T53B 1KNAA 1V8QA 3L9AX 2JA6B 3C1FA 4L23A 1PTOD 2NVYB 2VB2X 1F9QA 1DYQA 3C3LA 2K33A 1HFGA 1QNUA 3MP9A 1VZ6A 2BB5A 4G7HC 3K57A 1XLPA 2IJ0A 1NVID 4XE0A 5G5GA 5BMGA 3BDOA 1ONLA 5T1GA 3GTMB 3HRZC 1CJEA 1VR9A 3B2FA 3PIP3 4ABNA 3S1MB 3UI2A 2F0MA 4WRDA 1A3VA 1A3TA 3TP5A 2KAJA 1HEZE 1GPXA 1BQQT 1K52A 4C80A 1DZ1A 4KV6A 2V0GA 2WACA 4WQMA 1GAQB 1T5XD 1MI0A 4B9WA 1LLRD 1EOTA 2PMVA 4ZAIA 1K51A 4TSSA 2LHDA 1WTRA 1C4AA 1XCTL 3NTKA 3P75A 1QKZA 3GTJB 2V3NA 3MFGA 2K04A 3IKJA 4A93B 1U4LA 3GO5A 1GOZA 2EOTA 2Q8RE 3D6CA 1EY0A 2HCIA 2PNRC 1GHKA 3TEXA 3NTIA 1ZUD2 3P20A 1OXVA 3AMUA 1SNQA 2PVOD 3T16A 1BDOA 1EZ6A 3FVQA 1BNZA 1BUIC 4NKLA 1Q10A 1V8CA 2KACA 3Q23A 3OMCA 3M4OB 3AB5A 5HG2A 1PRTC 1HRJA 2GRIA 3P4SB 1UNSA 2EY6A 1FR3A 4HR7B 1WD1A 5KRUA 4CKBA 1RCVD 3SFEB 3RZDB 2AQ2B 3AU7A 3P4RB 1F2LA 1Z7TA 1AN8A 2F0DA 2RDHA 1GJXA 4TQ1A 2PO4A 5I4DA 1OQRA 1J7CA 4I65A 4K5XA 1N5XA 1U4PA 2AQ1B 4LAAA 1TWAB 4Q0FA 2IX0A 4IALA 1TS4A 4X3UA 3L4PA 2K5QA 3K6OA 3VRAB 3NUCA 5DM73 1B3AA 2D9UA 1LV9A 2MJ3A 1BCPC 1D2BA 3AV8A 2IX1A 2TSSA 3OIPA 1I4RA 2DY8A 4A3BB 1SNCA 4JWSC 1HQMC 3T3OA 3TUOA 4C3IB 2E2HB 1PGBA 3D8GA 1QF6A 1OXSC 1UUPA 1LTRD 4IZ8A 1SE2A 2F0LA 1AFPA 2X6LA 4L8JA 3L7ZC 3DEOA 4CKCA 5CGKA 4J3OD 4RA8A 2KEDA 5EE0A 1CHQD 2WKDA 3CRKC 1A2UA 1K8MA 1TY0A 1TYGB 2B8FA 2OF1A 2LY7A 3EVQA 4FF4A 4RKLA 1YN5A 1PXUA 3IXSA 4REZA 4TQUS 3A54A 1PRTD 2KOLA 1RYJA 3CU7A 3TZDA 3DM1A 2DNEA 4L2YA 1SSOA 2HTME 1C4QA 2E2IB 3QO2A 5CR3A 2NB0A 3PUYA 1LT4D 1FD6A 4C7YA 2BOSA 4G57A 5BYRA 1QB5D 5D65A 2K3UA 4GDLB 2F0VA 2MUYA 1PZJD 4X3TA 4K5VA 3ZJVA 2NBFA 2F0TA 1A6XA 1DXMA 1QG7A 3ZJUA 1HZ5A 1VMPA 2E75C 2EY2A 1BXTA 3EUB2 4N9TA 1ENCA 4JPSA 1BF4A 1R7SA 1L0XB 3NBHA 1TIID 4YTMB 2BS4B 5KEEA 1MD2D 3SE0A 3PZ7A 1RTNA 5M3MB 2IX3A 1PFDA 2PYKA 3OWFA 1GUWA 4A9AA 2EYMA 1YNJC 5BN5A 4WIPA 1J9OA 5AUKA 1SSNA 4FF1A 3MJ5A 3ETRA 1YQ3B 2JZPA 2K6AA 4L1BA 2X69A 3SHLA 5F2DA 4LMQD 5I9OA 4R9WA 3J7AV 4KKSA 3QB3A 1FFUA 2WDVB 4CJ0B 3D4RA 2ENBA 2PZWA 2ID0A 2EKIA 1PTOC 3Q8CA 1S5DD 1WYGA 1R4QB 1JORA 2PVGC 1WSPA 3PUXA 4KTAA 5ELFA 5IGCA 4IFDH 2F0FA 2EZVA 2ONQA 5IGGA 3LX0A 3I57A 1RHPA 4B0MA 2MJ8A 1R4PB 1I4PA 1KRHA 3C46A 1ZXHA 1IHZA 3S15B 5CV4A 3S2DB 1VF7A 4ZYSA 1VRAB 4LK1C 2A69D 4DK0A 3GD7A 3U7ZA 1EEFD 2EJMA 3CWIA 4CBVA 1B2TA 3O13A 1XF5L 1ILQA 3E9SA 2L1AA 5M9OA 2PZUA 2FINB 4FF3A 1Q1BA 3VR8B 3NUHB 4RKBA 1RDPD 4C1NK 4NDXA 5JEAH 2G1EA 1IBXB 4HKZE 2XN9C 5J39A 1I6HB 5JJZA 4RGNA 2E2JB 1C8CA 2N55A 3GQBA 3PUWA 1CA6A 5C3EB 1XCQL 2NN6I 1D1IA 2IW3A 3PO0A 2DYMA 1JCKB 3KBXA 1ESRA 3JAML 3HKZB 5D3DA 1NR2A 1WTPA 3CHBD 4FP5D 3WOFA 2F0UA 5TSSA 4DU9A 1PRTB 1Y1VB 5FLXE 4QB4A 2PW7A 1F2RI 2WU2B 2WXLA 3IT6B 4X3SA 4XDDA 3KUPA 4P2CB 1ZP0B 4KD4A 4BA1I 2RQXA 2BE5D 1F2YA 1OXUA 3W1SA 1PRTF 2BS3B 1PGXA 3VRBB 3IFDA 1TR5A 1UAPA 2FMCA 2XRSD 5C3WA 4RNAA 2WP9B 1D6EC 2B2WC 1V1PA 2KVMA 2SNMA 2OHFA 1DOLA 3I4LA 4ID6A 4MHEA 3P4QB 4B08A 2B8GA 3NK9A 1FM0D 4ODGA 4EVOA 1VJKA 2B2UC 4YSXB 4AQ7A 1JROA 3N52A 1STNA 4ZHPA 2NN6G 1RD9D 3GTOB 4MN3A 1Y1WB 2RA4A 3RZOB 4FXKC 1FIQA 4DQOC 3V3XA 3LNNA 4NMZA 3DWPA 3RPFC 2BW2A 4ZK9B 2FJ2A 3H8HA 1YN3A 3D6WA 5C5LA 4BS9A 3H0GB 4OW0A 5E4WC 3GTKB 1FXAA 3HG9A 2RVLA 5C6AA 1TWFB 2QF7A 2JA8B 1KF6B 2O4XA 4KY5A 2K1BA 2C9OA 1PFBA 3K5MA 1QT9A 4N58A 1IGCA 4EGVA 2WS3B 1BR9A 4OIKA 4YTNB 1MI2A 5ELDA 3AE2B 3I4NB 1B50A 1AEXA 3D31A 1GHJA 5ELBA 1G2SA 5I2XA 1KDAA 2R3ZA 1VZ7A 1CFMA 2F0OA 4M1UB 1WCMB 4KY6A 3HEJA 3KK7A 4ZRPA 2LEKA 4DN4M 3NXWA 3I8ZA 1TWCB 4EQPA 2INNE 5IGFA 3P7JA 1BMLC 1WXQA 1NYQA 2SOBA 1E6EB 1NYRA 2TMPA 4FVMA 3N6RA 2QJLA 3IL8A 3ERQA 3TBIB 2HCCA 3V96A 1N5WA 4TQ0A 4K8JA 2A6HD 2L0CA 2PKOA 4WAFA 3S2HB 1XYIA 2LMCA 2OXPA 1D1KA 3T3NA 3ZQ4A 1HCZA 2BA1A 3M3YB 5T1IA 2F3VA 2CJNA 5C4ZA 1JWMD 1I4XA 2F0KA 4RGOS 3I90A 5DAUA 2EPBA 3G6JB 1XWEA 2F0IA 2WV6D 1ZXIA 1JICA 3NBIA 4OIJA 3AECB 3I73A 1D5MC 3A8IE 4FO2A 4ZUJA 2JXTA 1SFOB 5JPNC 1LT5D 1PZKD 2F0HA 3QG1A 1XLOA 2OT2A 4IDIA 5BYSA 3HGBA 4C3HG 1C76A 2KN4A 2M2LA 1LTSD 2KDMA 4KKUA 5EPJA 3HOUB 2CVRA 1EFID 4KN4C 1IKMA 1KLUD 1ZDXA 1CQVA 3I91A 4G4KA 1SNOA 1DM0B 3K5NA 2I38A 2XRQD 4C3JB 1MBYA 3A7AB 3NZ3A 1ZXTA 3OMGA 3Q69A 3NRZA 1CI3M 1EQTA 4PMCA 1KNEA 1TVXA 3FRPB 2E76C 4ZKCB 2BE5C 1SYFA 1R9TB 1HFNA 3KLSX 2LMCB 4NAWB 2KQ3A 1Z6HA 2MEKA 1EIHA 3ZGZA 4FXGC 3VR5A 1QCBD 2RSNA 3KLSA 4C56C 1YJIA 2A6EC 1ACCA 1TKYA 3UI3A 5JAVA 1ZYRC 3FEWX 1FCLA 1ET9A 4K5WA 4J1MA 2NVXB 1E0ZA 3U4EG 1ENAA 1C77A 2WU5B 3NSWA 3C2PA 3TP8A 2D2CC 3AE3B 3K5LA 3Q8EA 3BVMA 1GUSA 3BIID 3OSOA 3DWGC 3I9V1 4R3DA 3GTGB 3H94A 2ZXOA 1H9KA 2Q8TA 2FMMA 1M4VA 5C5MA 1XX8A 1B9RA 5IODA 2XWJB 2EVBA 4R8NA 2A69C 3R93A 3X3NA 3E6ZX 1QOAA 3MXGA 2F0JA 5LNK1 3BK1A 2CHBD 1S5ED 3FILB 2ZXRA 1IYVA 5EKIA 2K05A 4A6QA 3OW7A 4XT1B 2WXJA 1CM9A 4IUPA 2BA0A 3Q22A 4Q5VA 2AUKA 2F0EA 2Y3AA 4OO1H 2LFIA 1JE4A 1AWDA 2NWGA 5BN4A 4PMWA 2PTLA 5C3JB 1LO5D 1STAA 3CRLC 1T5EA 3KWLA 4FXDA 2JQRB 1MHXA 1I50B 5CV7A 4G7OC 2I2YA 3BYYB 1RJTA 4NW2A 2ZT9C 3MTSA 4A3IB 3VR9B 1LACA 3SK4A 1HA5A 2FUG1 2E2DC 1U4RA 1JOKA 3KQ4A 1HPCA 5EBCA 1LTID 2AUJD 3D3RA 2XIWA 1A3UA 4WJWA 2WXGA 1SNDA 2SEBD 4XYQA 3Q8BA 2L12A 3VQIA 5KNDA 5M3FB 2K0PA 3IT4B 4Q2JA 2A5HA 1STEA 3BVZA 3VYTA 3AEAB 1XO3A 2G9DA 1UGJA 1G2TA 1TU2B 4RH6A 2WXFA 1YQ4B 2F0PA 2N88A 2L5TA