3BYTB

A complex between a variant of staphylococcal enterotoxin c3 and the variable domain of the murine t cell receptor beta chain 8.2
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
238
structure length
232
Chain Sequence
SQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSTWHGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T cell receptor beta chain 8.2
publication title Manipulating the coupled folding and binding process drives affinity maturation in a protein-protein complex
rcsb
source organism Mus musculus
molecule tags Toxin
total genus 64
structure length 232
sequence length 238
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2008-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
B PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3bytB02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3bytB01
1I4RA 2ICIA 2RDHA 1EEID 1S5ED 3TSSA 1JWSD 2CHBD 1TS5A 5FKAC 3DWPA 1RCVD 1JR0D 5ELFA 1G8ZD 3V05A 1STEA 1FNUA 2G9HD 1M4VA 1PRTF 1JQYD 1LTTD 4TSSA 1CHPD 1V1PB 1T5XD 2IPKD 1F77A 5ELBA 1D5MC 3BZDB 2O2LD 1YN3A 1JWMD 1SE3A 2NTSA 1SXTA 1LTBD 1B44D 1PTOF 2XRSD 2IJ0A 1EU4A 1FNWA 4RGTA 1B1ZA 4DXGA 1UUPA 1L0XB 3BVMA 1KLUD 1RD9D 1FD7D 1V1OA 4UDUC 4RGNA 2QILA 2SEBD 4L63B 3O13A 3BYTB 4BWGB 1EFID 1XTCD 1FGBD 1V1PA 1BXTA 1AN8A 3BYYB 1DYQA 1CT1D 1I4GA 1PZKD 1LT5D 3OWEB 5D3IB 1TS2A 1UNSA 1I4PA 3BVGA 4RHSA 2J4XA 1QILA 1YN5A 5I4DA 4RH6A 2TSSA 3W2DA 3GP7A 4DXFA 1CHQD 1KLGD 2Z8LA 2R61A 5D3DA 2QEJC 1ENFA 1EEFD 1I4QA 5ELEA 1LTSD 5TSSA 5FK9C 2XRQD 4Z9CB 1LT3D 3MC0B 1LLRD 1LTAD 2AQ3B 4L6TB 3R2IA 1EWCA 1S5CD 4ZYSA 3EA6A 1LT6D 1HQRD 1MD2D 1PZJD 1HXYD 3DWQA 3KLSX 1PRTD 1HA5A 1PZID 1SEBD 1SJED 1S5BD 4K6LA 4RHRA 1BCPD 1SBBB 1TS3A 1CQVA 1FNVA 1PTOH 1ET6A 1I4HA 3MFGA 1KTKA 1TY2A 1PRTC 1JCKB 1L0YB 3DWAA 1HTLD 4RGMA 1PTOD 1TY0A 2XNAC 1BCPC 1TS4A 4O1NA 1I4XA 3R8BA 1EU3A 1AW7A 1LT4D 1LO5D 1SE4A 1ESFA 4RCOA 4RGOS 1JWUD 1PTOC 2WV6D 1RF2D 1PYWD 1SE2A 1D5XC 1ET9A 4C56C 1D5ZC 1BCPF 1RDPD 2AQ2B 2RDGA 1PRTB 2XN9C 3BVZA 1D6EC 4NZLB 1CK1A 1S5DD 1GOZA 1LTGD 1BCPB 1LTRD 2AQ1B 5ELCA 1XXGA 3SEBA 4RFBA 1S5FD 1LTID 3URYA 1SJHD 1YN4A 3CHBD 1DJRD 3EFXD 5ELDA 4OHJA 3R2TA 2NTTA 1PTOB
chains in the Genus database with same CATH superfamily
3H0GG 4LF7L 4DQOC 3QA8A 5C5MA 1T9HA 1TS5A 2WP8J 4MTKA 1XNRQ 2A6ED 2AUJD 3UQBA 3SFEB 4QQBX 1RL2A 3OOCA 4TUUA 1F1HA 4HPLB 1B53A 3UINB 5CV5A 1QOBA 2G9HD 1M4VA 1CQFA 1PRTF 5C5LA 2WX0A 1J8CA 1EY7A 4WJNA 3U30A 4LF6L 4KY7A 4N9PA 4YSXB 2JA8H 2K14A 1GO3E 4UP7A 1QNUA 5C44B 1XNRL 5CMDA 2YEPB 3LDZE 3U4EG 4A8XC 1Y8NB 2L1AA 1ROEA 4A6QA 3QJZA 4A3EG 1WGRA 1TGZB 2IGDA 1B9NA 4A3GH 4HCSA 3M85A 5JJIA 4HEA1 1B1ZA 2K75A 3H0GB 2V3PA 4L5RC 3UDIA 1BBWA 2LRUA 5JXVA 4RA8A 1E6EB 4F87A 3DEOA 5KNDA 4ALPA 1GUTA 3AH7A 5EE0A 2LXAA 3CF6E 2XWJB 2YYZA 2Z6BA 3HOWH 2JSOA 1VRAB 4JI7Q 4HWIB 3GTKH 1BUVT 1KNAA 3AFPA 4LUVA 5D3IB 2ES2A 2YEPF 1AARA 2KNBA 1Q46A 4HIOA 2JRIB 4KKTA 1XF5L 2K8HA 2BH2A 4GIVA 2TSSA 4KV6A 1QLBB 2L32A 1CHQD 3H1UA 1JW9D 4FXKC 2ONQA 3G6JB 3R3OA 1EEFD 4DUYQ 3PIO3 4A3EB 1Y1VH 3M7GA 4X65Q 4OELB 2RHQB 3ZUNA 4ARIA 2JWZA 4JI7L 2GLSA 2F0IA 4DR2Q 2K9XA 3NSWA 1B3AA 1ONLA 1VR9A 2OJWA 2B2YA 4EVOA 4MGYE 1HXYD 4IPDA 1PDXA 3P7JA 5NUCA 1WOCA 2OXPA 2NZOA 3L08A 3OG5A 1HNZL 4DUYL 2FUG1 4X65L 3OTOQ 3WOFA 1ASYA 3V60A 5KNCA 3ONSA 2DJFC 1UGMA 3PT2B 2CU3A 1PH9A 1PRTC 3TP5A 4A3LH 2ZTDA 3KDFA 1MVKA 1HTLD 4LJPB 3A4SC 1PTOD 3U7DA 1N8RC 1R4PB 1OTCA 5FR3A 1H9MA 3RNCC 3X3MA 1XNQQ 1K9MC 3DBRB 4XXEA 4L5QA 1V6EA 2JXMB 1K8AC 4MGIE 2F0GA 4JI6L 4URKA 4K6DA 1JWUD 2KMAA 1L1OB 4HJKA 2Z1CA 1V8CA 3F1ZA 2PE6B 2WQYB 3NG0A 4GLAC 5K36H 4C56C 3TL5A 4LNIA 3VR5A 5IP7G 1ZXIA 3BVZA 1N9WA 3OJ4B 2HQEA 1ZPSA 3ZKJC 3W1SA 1S5DD 4R9WA 1KDAA 1VQMA 3RNBC 3ECIA 1XNQL 3CSTA 3SR1A 1K0RA 2FNJB 3URYA 4DKAC 3A0JA 3AEEB 1DJRD 2JA5H 2B2WA 4N8FA 1K51A 2Q2TA 2KD0A 2OEDA 1TTNA 3MAQA 2KJ6A 2RDHA 2V4DA 3H94A 1YHAA 2DGYA 3CCMA 1N36Q 2BE5D 3FHWA 4A20A 2KVRA 3AE5B 1I42A 5DPTA 2K5QA 4EZLA 1EUVB 4EQPA 3VUXA 1UEBA 1BBUA 5EAYA 3RPFC 5J22A 3HM3A 1EZ6A 4TSSA 3RMKC 4HVBA 1QQRA 2OEOA 4JBWA 5CHWA 3QAQA 1N36L 3S1QH 2K33A 2UWQA 4G7ZC 3HKZG 5BR8Q 2LVPA 2C9OA 1TWCB 3W1BA 2M0XA 3P4SB 2KWCA 4LMQD 3CRKC 2B2UC 3PUZA 4K8JA 1FFVA 2I1KA 4KJOA 1EU4A 3K58A 3RZWC 3PRMB 3VXWA 1SSNA 3GV6A 2IDYA 1E7UA 1KLUD 2QC8A 1R4MI 2I0QA 3KWVA 3UDXA 5BMHA 2F4VQ 4RGNA 4B3MQ 5JJLA 2NN6G 3E0EA 5BR8L 1X32A 2KO3A 2WXMA 1O80A 2WXHA 3NENA 1GM5A 4KI0A 1HRJA 1P7EA 4V0BA 2BKFA 3CCLA 2BYEA 3C8YA 1PDQA 2PJHA 2EQSA 1STNA 3VH3B 4DR6Q 4WWPA 1H9KA 4A93H 4LK1C 4DXFA 2AEHA 4FLHA 3HKZB 4F1SA 4C7YA 4YCVA 2F4VL 4X66L 3FKIH 2LXJA 4B3ML 1IBLL 3SHLA 4X64Q 2N9XA 2F0EA 3P4PB 4BZAA 5JPMC 3KFUA 3K5OA 2L5TA 4PG3A 1WTHA 5FOBB 2GN5A 1J7AA 1D3ZA 1VQAA 1TWFB 3S1RH 1EOVA 2SNSA 4KHVA 4GOCA 2F0WA 3DWQA 5M5WB 4FULA 2PZWA 3T53B 2GBMA 3AULA 2RDBC 4N9F4 1L1OC 1Q10A 5AZHA 5IGBA 5COYA 4LFAQ 4X64L 1PTOH 1NYQA 3RLOA 3PVLA 4ITKA 1IP9A 2VQEQ 4LFBL 3QR8A 4FDBA 4KMUC 4B3TQ 2QKIC 2KAJA 4JVZA 3FPUB 1TIID 2R7ZG 4B3RQ 3ZTDA 1DOXA 3A5ZB 1H9RA 4G7HC 2A74C 3HOYG 1C7YA 5BN5A 4ICVA 2L9HA 4LFAL 2I07B 3CCRA 5KHOA 2GOWA 4ACFA 3AEFB 3QX1A 3RFZB 3T3OA 3PHXB 4AUQC 1J7CA 4DK3C 2KLGA 2VQEL 2CVRA 3QG1A 1UAPA 4LUOA 4UHVA 1K0SA 3PV1A 1AZQA 3G6EA 2DUDA 2NVYH 2UUCQ 3SEBA 3RNAC 3VDZA 4BFRA 2ZJQA 2X8XX 2JA9A 2PNHA 5AUKA 3SE0A 3JSVB 3A8IE 3TJPA 1A3UA 2MBHA 3Q3NC 4HIKA 2ASQA 1SYCA 1AYFA 4HTHA 4ZUJA 2MPMA 3HK0A 1S5ED 3GOEA 1G291 5HKHA 3PSEB 1TXYA 1LTLA 4A3JG 5IGFA 2UUCL 1FJGQ 3HOYB 4IUVA 3E5SA 3VH4B 4EE2A 2D11A 1FNUA 1LTTD 1O78A 1LFDA 1QOHA 2KDBA 3SGIA 1E7VA 5C0XI 5ELBA 2KDMA 4OZAA 1WRIA 1NDDA 5GAHC 1F9PA 2F0SA 4DR3Q 3B0AA 3D6CA 3PHWB 2J7ZA 2H1EA 1B9MA 1FJGL 4R4CA 2IW3A 3H3VI 2MLBA 2WXKA 3GE3C 4YWLA 4OVUA 2ZXOA 3H09A 4ZQ3A 4DDID 3OIQA 3KYDD 4OWXB 3UE1A 1GB1A 4A3BG 2AKWB 3HIZA 4DV2Q 1WTWA 1IBXA 2XK5B 4BWGB 3PF5A 2UUBQ 2NVQB 3RT3B 4ZAIA 3QB3A 5C2TB 4L5TA 5DEHA 4WFN3 4HXDA 4BBRG 3D4WA 2JXTA 4WWOA 5GAEC 1I35A 5T1GA 4I7ZC 1WGDA 4OWTB 4W9IA 2JA6G 4NJ7A 3PIOA 5M3MB 2EDGA 1WTXA 1WTQA 3HVZA 4NMZA 3AU5A 1B50A 3CF5A 3ZGZA 4DV2L 3VR9B 1FXAA 2PKOA 2UUBL 3M63B 2AWNA 4EX5A 4Z9CB 5AUIA 4BBSH 3SHQA 4HR7B 1HZBA 3MC0B 1FRRA 4APVA 2E2HH 4BXXG 4JG2A 4NW2A 3U4VA 2R93G 3EA6A 3J80c 3A74A 4K3BA 4A3BB 3JC66 4DN4M 1RM6C 3D32A 5C44H 1SJED 2Q2HA 3PF4A 4GDKA 4HDOA 1IHZA 4EQ5A 1KF6B 2KT7A 1CQVA 4O2DA 4BBRB 1YD8U 3IT4B 2WKCA 2UXBL 2WDTB 1JJ2A 2A69C 4OEMB 3NBHA 3WIMA 2JA6B 3TQYA 3IFWB 4JI8Q 2M9VA 3FDTA 4XQNA 2FIDA 5IOCA 3TMPB 3A9JA 4JBJA 3LYYA 2D3GA 4OZBA 1ZKOA 4GXBA 3RNEC 1NUCA 4GN4B 4W9FA 1WE7A 2Q8RE 4XT3B 4TQ1A 2K22A 3EJIA 3K57A 4W9CA 1I3QB 4MM3B 4CO7A 2CHXA 4G50A 3L3OC 3J7AF 1MPEA 4CJ2C 4JOIC 2IYDB 2XVSA 3RNUA 2R93B 1EIFA 2OT2A 2BYFA 3QHTA 1P8LA 2L8JA 2N7DA 1W2BA 3PTFC 5AZGA 1TIFA 5C4XG 2AL3A 4PS3A 5C4JB 2VW9A 3QK0A 3RD2A 2W82A 5IP9G 1WD1A 1ZYRD 4IJLA 2CQOA 3VYRA 2HTHA 1BF4A 3LWUA 1A6XA 2KDIA 2O6VD 2A5UA 4DUZL 2F3VA 4JI3Q 4MNOA 4A3MG 3Q6BA 2MH7A 1JWSD 1FD6A 2DNFA 2CKZB 3AE9B 4K5VA 4IOAA 2RF4A 1QB5D 1DGSA 3PIP3 2OTJA 1V81A 4X3SA 1BQQT 2FAZA 4KHZA 4CKCA 3D8GA 3APFA 3AE6B 2EYFA 3TBIB 1MKHA 5ELNA 2VUMG 4YHHQ 3J7A5 4W9GA 1QWYA 4D2KA 4JI3L 1F77A 2KK8A 1DOMA 1WYGA 1D5MC 1RJTA 2JQRB 4OO1H 3BINA 3PZDA 1DONA 1ZW7A 1SNMA 5IYDG 4DV1Q 1Z5SB 1NCVA 3U8ZA 4HSVA 3B6YA 1JMCA 1JRUA 5LMUQ 5G3LF 3AEGB 1QZGA 1QUQA 4P7IA 4Q2JA 1AEXA 4QF4A 1WX7A 5BYSA 1K50A 3RUZA 4XWWA 2PVOD 1FNWA 2KCTA 4OX9Q 5IOIA 1IL2A 3CWIA 3H9DA 3EFCA 4X3TA 4ANWA 2K01A 2E2DC 5EQ0A 1X6OA 2Q2UA 4WH4A 2NVTB 5HFYA 4DAPA 4MJSB 3RNFC 2KEDA 1VQFA 4DV1L 5JVG3 1GVPA 2L4NA 1WGKA 2B3AA 3PRPB 5LMUL 4FADA 3L9AX 4E3CA 2FCMA 4GOPA 1XO3A 2A1AA 2VUMB 5HGTA 3ICEA 5BMIA 1EY4A 1QILA 4OX9L 2MW5A 1J5EL 1KLGD 4IW0A 3KLWA 2B2TA 2HUGA 3ND8A 3QO2A 1LACA 2K28A 1L0VB 2D0PA 1OQQA 4NAMA 4RF0A 2XRQD 4YT0B 4ZHOA 1X55A 1HNXQ 1YJIA 4YSZB 3J81E 3PO0A 1C79A 1J9OA 4GMVA 2RDFA 4TRDA 1AFPA 2L11A 1KAWA 4C1NK 1XCQL 1U5KA 3HFZB 1K73C 3OIPA 4RHRA 1BCPD 5J2RA 1UGJA 2ZJDA 3GTJH 2EXDA 4MT5A 4XDDA 3E9SA 1PFMA 1I4HA 4IFDI 3MHBA 1O7ZA 2L00B 1JCKB 3TEHB 4CKBA 2X69A 3S9WA 4BY7B 3A33B 4RGMA 3UDFA 1Y8OB 4HMIA 1KJTA 3N52A 3Q6SA 2MJ3A 3WCQA 3I4MG 4KJNA 1I4XA 1JOKA 4NB3A 4QL5A 2J0TD 2KHSA 1VQ7A 2EYHA 2N3SA 1DCZA 5IWAQ 1OEYA 3D3RA 1XJVA 2KACA 2LD9A 2LRWA 5GXGB 3Q8CA 4WJWA 1NVID 3OW7A 1VZ8A 1GB4A 2JUOA 2N8NA 3Q24A 5I9PA 1AWDA 3M4QA 3KYHC 2EY2A 1F2LA 2WIIB 3GTOB 1NENB 5IAAC 4LCDE 5GADC 3A56A 2HCCA 3ZYYX 5DM73 2QF7A 3V3XA 2VQFL 1BO0A 4RFBA 2EJMA 1PLFA 2AWTA 2BYVE 2V3SA 4LJOB 3NE5B 3OAWA 1C0AA 3DOWA 1H95A 2ZJRA 1HHVA 3Q3MC 4BA2I 1OQRA 5FLXL 4DK0A 3D0FA 3T56B 1PH8A 1WGHA 1GG3A 2BW2A 2PNRC 4DV4L 4PV1C 5M5WH 3I4MB 3ZJVA 2JP1A 2NN6H 4JI4L 4R4QA 1EY5A 1R4MB 4LF4Q 2BDNA 2L55A 4HJ9A 3RUIB 1E2WA 1K8MA 1STEA 1G51A 3A55A 4YWKA 1CHPD 2LZ6A 1V1PB 4GKJQ 1SF0A 3FMCA 3WOEA 3AE1B 2KFKB 4HJ7A 1Q0WB 2E5LQ 4CJ0B 3AM9A 1HUNA 4TVAB 4IG7B 1BVSA 1GD7A 2WU5B 3VHTC 4ANUA 5M3FG 2R92B 2Z6KA 3CQZB 2PI2A 3S2DB 3VR2A 4H13C 2L1BA 2O5IC 1KC8C 2GRIA 2IHFA 2DN8A 3SVMA 2YLMA 4EQOA 2D3AA 2RSUA 4DHZB 2GVBA 3UI2A 3AMZA 5IIFA 5EE9A 2JZZA 1CMXB 1PH7A 2LHDA 4HPPA 2HJ8A 2KCMA 1RD9D 3I4OA 3HGBA 1EQTA 4C1NI 4CDEC 4IUQA 2KDEB 3BYTB 1YITA 4W9EA 1HJPA 2GA4B 2EJGC 2RBMA 5GROA 3EHVA 2QSDA 2F0LA 5JEAG 1I4GA 1XPUA 2LVOA 3QOJA 1E5WA 5FJ8G 2W3SA 2KHJA 1XT9B 3A1QB 3R7QA 3TEYA 4GNXA 2D2CC 4ODGA 5M3FB 3HP3A 1E8ZA 3LB8C 1RLFA 2SDFA 2O6VA 2QW7A 2KZRA 4YIJA 2J0JA 3PUWA 1B2TA 4HJ8A 1UE1A 2L7RA 2NVUI 4OIKA 2X38A 1JJGA 4II2B 3PO2G 2DBYA 4R4OA 4KHPQ 2IY0B 4P74A 5T1IA 1E90A 2J53A 2LSSA 3VYSA 1PGXA 2PQEA 2HHHQ 4W9JA 1ZXHA 4M8MA 2QEXA 5C0XG 1FXIA 2LFIA 3DVGY 4MTNA 5DPRA 3RULA 2KCCA 1PGAA 1SYEA 5CX3A 3KUZA 4YTPB 1Q1EA 3ZJYC 1PH1A 4QCLA 3W1YA 3GE8C 4HCPB 1STAA 2HD5B 4LAAA 2A4ZA 4LUZA 3AEAB 5IT9E 2N1VA 2KVMA 2AYOB 3NUCA 4N8X1 2HHHL 5H8YE 4KSLC 1BDOA 4P2CB 2O5JC 4YXDB 2NVQH 3CMMB 3MC9A 2PPBC 1YX6B 1TKWB 4KDIC 1AW7A 2Z4HA 3KW5B 2K8BA 4LLGM 4RGOS 3ZW3A 3PO2B 2F3WA 2QDFA 4PYUA 3JAME 1FO4A 1V1QA 2MBBB 3NQIA 3DHHC 1RIPA 5M3MH 2XN9C 2D3BA 3AV8A 4ZRKA 4CHTB 5E4WC 3NVZA 1FM0D 5IODA 2C9WB 3A9KA 4FBJB 5ELCA 5I2XA 1X1MA 2BS2B 3JSVA 3MHZA 4LF5L 2PI2E 1D4BA 3EFXD 3HRZC 3APDA 1WCMG 3U9OA 1MBYA 1FMAD 3ER0A 2HE7A 3IBEA 4FHKA 4RAUC 4FNFA 2MNAA 1WR6E 2DZKA 1S4ZA 3PIPA 1EEID 4A3BH 5E7NA 1H9JA 3T4AC 4N6EB 1Q3LA 2KOLA 4X62Q 2L0TA 2RPVA 3FILA 4YSYB 1OXVA 4IUTA 3KLSA 4A75A 5JH5C 1AE2A 1JQYD 5FO9B 2RGFA 1JT8A 4MACA 5A2QL 4R4IA 3IL8A 4A3FB 4E71A 4U68A 1WX9A 1EFWA 2KA7A 3RLNA 2BB6A 3CRLC 5EKLA 1JWMD 4B0EA 4X62L 1SAPA 1F9QA 4MN3A 1C4QA 1X3QA 2ATWA 2VZKB 4AJWA 1WCMB 1V97A 2HJ1A 1EZ8A 2IT1A 1GUSA 2K5NA 4RGTA 2WNMA 1WMHA 1UUPA 4BOZB 3PZ8A 2PW9A 4M02A 4A3IG 1TWHB 2ZVOA 5AJ3Q 3KBXA 2F52A 1IBKQ 2IY5B 1HTQA 4UDUC 3WWVA 5C3JB 2BOSA 2SEBD 4L63B 3DEPA 5CV8A 5C4JH 3KQ4A 2DZMA 4J15A 1FGBD 4RCNA 1L2FA 5EJWA 2PPHA 4ZRZA 5A2QE 2WP9B 4A3OA 2F0TA 1GHJA 1CT1D 1I94Q 3OW2A 1VQNA 1UWMA 1S3OA 1H9SB 4ZOHC 5M5YH 2LWPA 3NWSA 3L54A 3WALA 1SYDA 1BNZA 4ZHPA 3EQLC 1ZDVA 5AJ3L 4IOIE 1IBKL 4WURA 1HH2P 1N60A 2EKIA 1X9NA 3GV3A 4WRDA 5FK9C 5TSSA 3STBC 2WB1B 2K5VA 2E2JB 1DOIA 2BVCA 4LK0M 3CD6A 3QIJA 3W5OA 3WANA 4H02A 3RZOH 3RZFA 1WE6A 1I94L 2N9EB 1PH5A 3C1EA 2N1WA 5KHQA 4K1RB 1E2ZA 1Y14B 4L6TB 2WXIA 4A3IB 1K83B 1PYBA 4I6LB 1I6VC 2NBVB 3U52E 3VR3A 1P7FA 1WY8A 4KD4A 4F88A 1E8YA 1TS3A 2B8FA 4BVUC 5EDSA 4E74A 1CKNB 3ZRCA 2N55A 1KTKA 2M00A 4RKBA 3PREA 3ZNID 1HZAA 1DZ1A 4QY7A 1TY0A 4CKEA 4X3KA 1M8AA 5EBDA 5EKIA 2KMMA 2W55A 4ANXA 1V49A 1EU3A 1PFDA 5HHDG 3IFTA 1YI2A 4KY5A 3ZJUA 1N62A 1U4PA 1KOTA 3M9BA 2AUKA 3GTLB 3H3VC 1XYIA 4GZYC 2LMCA 3L0WB 3SDLC 1YEZA 3X0WA 4C3JG 4KKJA 2EXZA 2JX5A 3I91A 4JI2Q 5L37A 4DDGD 1NBWA 1SYBA 2JYEA 2O2VB 3NZSA 4KKIA 4ZRQA 1C3TA 5IYDH 2BKRB 4IZ8A 2WGSA 4LNOA 2FCQA 2IO3B 1QKZA 1C1YB 3KJPA 2WLBA 4HDQA 4IKGA 1R7SA 1UZXB 3HKSA 1XLOA 4DAMA 1NAPA 3W1GA 2K1FA 1EOTA 4DR2L 4NQLB 2CW0C 1SSOA 1VQKA 4XQQA 2IY1B 3W5VB 3C1FA 2WAQE 4DAYB 4JI2L 1I6HB 2WXLA 2V0GA 3AE4B 3APCA 3K0XA 3TZDA 1F2YA 1L2NA 3KF8B 1F2RC 1NE3A 4ID6A 2GVAA 2N9KA 2B2VA 2F3IA 3MXGA 3NXWA 3T16A 3OTOL 1R9TB 4JBKA 4HK2A 1TWGH 2JA7H 1SIJA 4TQUS 4C3JB 1BKBA 5KGUA 1T5XD 2IPKD 4BY7H 3CPFA 3NK9A 4FF2A 1D7QA 4IFDG 1NEKB 4Y7NB 3VYUA 1GUOA 3DXJC 3U9SA 1P9DU 1IGDA 3LXFA 4F8MA 1X54A 2FMCA 2KTRA 3PS6A 1LQBA 2A8VA 4DWFA 4KZ0A 4CDFC 5EBCA 4X57B 1MGSA 4M8NA 2Y0SG 2G45B 3CMEA 2K50A 4K8IA 4US8A 5GMVA 1PFNA 2MCNB 3KLRA 4DBGA 1B3QA 1II3A 1TT5B 1C4CA 4G7OC 2EYOA 4XGAB 4M0WB 5IGGA 1RTNA 4DFAA 2G4SA 1HE8A 1CTMA 2EYJA 2JK8A 4HRSA 3IFDA 4GGQA 1WTVA 4I6PA 2HIXA 1GNUA 1A70A 5D3DA 3GTQB 2CKHB 4IUNA 3J7YW 3AE8B 1A62A 2SAKA 2OQKA 1MHHE 2WXNA 1G2TA 4P16A 2Q2IA 4X6AH 2WXJA 4RG1A 3K5LA 3V62A 4N9TA 2FUHB 2Y0SB 1VDVA 3I73A 5BN4A 4YTMB 2PZUA 3HG9A 3S2HB 1T0SC 1BUIC 1V2YA 4K3CA 1WI0A 4M8AA 2R92H 1PRTD 1ILQA 1SEBD 3CQZH 1E1TA 2WYQA 4DGZA 1EQVA 3IXSA 4JC0A 4H2AA 4K7UA 2K25A 1F9RA 4NQKE 2K6QA 2EPBA 5EPJA 2LGDA 1P1AA 5AEKB 1ZDXA 3ND9A 4C3IG 4MSMB 3N32A 4JI1Q 2EJFC 3UDGA 5H92C 1A5RA 4CYEA 1WGGA 1RHPA 1I50B 3BDOA 4HJ5A 1Z2MA 3I3CA 2MJEA 2WDQB 3QWZB 4FJZA 4HMJA 4QUCA 4IPHA 4C2MB 1H8CA 1SMYC 5DCNA 3I63C 3IVFA 2IHEA 4H44C 5JOBA 4JV5Q 1KHIA 4J6HA 2H88B 1SE2A 3LWEA 4LFCQ 3CAMA 4DR6L 1H4RA 1RDPD 2RCNA 2IO1B 1YOVB 2RDGA 3CCEA 1VQ5A 3DBLB 1XLPA 5HG2A 5FLMH 1GOZA 1NR2A 1FIQA 4JE3B 3VRAB 2KJHB 3T3NA 2OTLA 2AMCB 2V4LA 2B29A 4C7ZA 2GBRA 3DLLA 3FRPB 2B63H 1VJKA 4XWTA 1CJEA 2CJNA 5AZFA 4RNAA 4C4VA 4C3IB 3ABVB 1GUNA 2HD3A 3X3NA 4UAIA 4JV5L 1A2TA 2YTYA 2C7HA 4U673 1R4NB 2D10A 4LFCL 2NPTB 4C80A 3RZDB 4XYCA 2D62A 1LGRA 1E3PA 2K3UA 2MX2A 1G2SA 1YJWA 1NNXA 1DOKA 5IYBG 1WTRA 5KYLA 1GHKA 4EZKA 1YIJA 4KIKA 5IGDA 1HZ5A 2LUEA 2XSCA 2QDBA 5GQOA 1WVLA 2KFKA 1ML0D 4ZUIA 5KRUA 5CV7A 5J3BA 4BY1G 3AE2B 2RR9A 1E2VA 1AP0A 4B3TL 2KVZA 4K0KQ 3M3YB 2R2QA 3KVFB 2PQAB 4DK1A 2C7MB 4AP4C 1SNPA 2DYMA 4GN5A 4B3RL 3VQIA 3D4RA 1XPOA 1STBA 5G5GA 1B44D 4J1MA 4HN7A 3PO2H 1E0ZA 2XIWA 4JPBW 1QVCA 5C3XA 4XX5A 3K5MA 3QCAA 1EIHA 1WJUA 1E10A 4KD3A 1L0XB 1PGBA 4S0RA 2R7ZB 1EYAA 3Q8DA 4LDTB 3MC8A 3JYUA 1V9PA 1EYDA 2QGQA 3IKJA 2KBNA 4B9WA 1JALA 4JL9A 3M4OB 2VRRB 3P4QB 3I56A 4FF3A 1YMHE 1LT5D 1Y1WG 4BY1B 1B8AA 2LY7A 4FO2A 5IGCA 4REZA 1C48A 4J8QA 1YJNA 1TWAB 1C4PA 4RH6A 4TMAB 1DD2A 2Z8LA 3CXCA 2R61A 1XMOQ 3L13A 3AB9A 3QC8B 4A3KG 1AH9A 4LF9Q 1TZ1A 3G48A 3L0OA 5JZEB 3DHQA 3Q0AA 3LNNA 5GAGC 1KQSA 4YL8A 1JWAD 4DV0Q 1SDFA 4A3FH 2BDOA 4DNTB 3DMUA 2EVBA 3IAYA 1I7HA 2N0SB 1A2UA 2DJGC 2UYZB 3NVWA 4P75A 4A3JB 3W5UB 3S1MB 1CZPA 4DR3L 3OLMD 4L8JA 1XMOL 1GXDC 1V9JA 1WIAA 2I1JA 2W9NA 1SE8A 2IWHA 1UE6A 4KKUA 1IKLA 1FEHA 1WCMH 5IKCM 3KF6A 3I4NG 2EIFA 1Y1WB 1C76A 2BT6A 3DBHI 1WZ0A 2HIVA 2UU9Q 2ZW1A 4M1UB 3GB1A 4IUPA 1NSNS 2PMZE 4DV0L 2F0VA 4H7BA 2FINB 4ABNA 1BT0A 1ZKHA 4A3KB 2JJQA 2JEAI 3WDNA 1J6QA 3AEDB 3L16A 1VQPA 1V5OA 2KHWB 1MJEA 4NAWA 2CJOA 2JN4A 3MJWA 3NZ3A 2ZEQA 2DYOA 5FR6A 2ICEC 4MHEA 2UU9L 1BCPF 3MXNB 1XPRA 1ACCA 1RWSA 4HCNB 3ZVVA 1D6EC 2K7VA 5CBAE 4JQWC 1LTRD 2IZVB 4N58A 3RNGC 2E2JH 2G4DB 1N5XA 3TZUA 1VQJA 3CW2C 5JHBA 3I4NB 4DR5Q 3S15B 1FPYA 2E6XA 1HZ6A 2OOBB 3H0GH 5E4XA 3R2TA 1NBFC 3ZTCA 2W3RA 4PK1A 4A3IH 1K83H 1IYVA 3C46A 1VZ7A 4IWOA 2FCSA 2P5ZX 4I65A 3J80E 2L76A 2AX5A 4YCUA 1OQYA 3NHHA 5CGKA 3HUIA 4B9KA 1U9RA 3MEFA 1M1KC 1EY6A 1WXAA 4W9LA 4L23A 2X6LA 2INDC 3DVNU 4DR5L 5TR5A 1LXDA 2JF5A 4A3PA 4JI8L 3L7ZC 3B9JA 4TQ0A 4ILWA 3N6RA 1MHXA 3I9V1 3TIXA 4A3EH 2JA8G 4NNJB 2K6AA 2DLBA 3NS8A 3AEVA 2EELA 2KCNA 1ZUD2 2DAJA 3P1MA 3S1NB 4K5WA 3NELA 4GKKQ 4L1BA 2MHJA 1J0GA 2MP1A 1HNWQ 2EY6A 2UUAQ 3GTLH 3NPPA 4G11A 1EY9A 2EY5A 1TKYA 3DPDA 2QMTA 4UY8C 2K04A 3E6ZX 5E1FA 2LI5A 3RN9C 1FD7D 4AYBE 5JHAA 2QILA 3KUPA 3MEHA 3CC4A 4ZLTF 2ZTEA 1YX5B 4IO9A 1AN8A 3ENEA 4IC7B 1WTPA 4KZCA 4GKKL 1MHWC 1X56A 4C3HG 2CHZA 3HOWG 1WWTA 2MQJA 1UNSA 3BVGA 3NZUA 2J4XA 3B1LX 2KX3A 4LNKA 1I6HH 5C4XB 3H7PB 4QIWE 1UWVA 1Z47A 1XQQA 3K5NA 5DM63 1PFBA 2QEJC 3KDFB 1XLQA 2A6HC 3K7AB 4IDIA 4BKTA 2FJ2A 3R7RA 1KDBA 3IRBA 1Y1VG 3QJYA 1VD2A 5C23A 4A3MB 1MIUA 4ZK9B 4YHHL 4A3CG 3J7ZC 3CIRB 1EWCA 3J81L 5E6NA 2A69D 4OWWB 1E0BA 1HQRD 3VA5A 3HEJA 5BMGA 4JWUC 3UIOB 1X3FA 1CKNA 1S3SG 2MEKA 4OZCA 2B2UA 5DPSA 3ML8A 2NBFA 1FVIA 2G1EA 1KDCA 2E74C 1IYJB 3KBGA 1SE9A 2F0KA 1VDZA 3ML9A 2EE1A 4C3HB 3HOWB 1TZOA 3EIVA 1EWIA 1L0YB 4O42A 1WXSA 2M1MA 3RLFA 3HOZG 3GDEA 5KYIA 4OO1I 3DBRI 2DHZA 2E2IB 1DOLA 4J3OD 5HGQA 2KENA 1KIXA 1N6ZA 2WV6D 1Y1VB 2ACZB 3HOXG 4GN1A 2DNEA 1JOQA 3NBIA 5IP7H 2RMMA 3ZQ4A 3E56A 3S17B 1YNTE 1Q81C 1HEZE 5T8IA 2F0QA 4NZLB 1TWCH 5K36G 3GTQH 5M5XB 3EECA 4TKNA 5D94A 5IA7A 5J18A 2CHWA 3M95A 4FF1A 1K8GA 1VQ8A 3VR8B 4PMBA 1T0QC 1KABA 5CC4A 3VDYA 1SJHD 2KQ3A 4FF4A 3CHBD 3SFDB 1HNXL 1CFMA 5CR3A 2J42A 1M94A 5LL6X 2EYMA 1L4ZB 1BOSA 3TUOA 2PIAA 3GO5A 3HOZB 4QUFA 1RFKA 1VQHA 3ALBA 2K05A 5M9OA 2J0KA 3T13A 3S16B 1G6ZA 2HDEA 3AU4A 4XC2A 1L1OA 1YHBA 1Z9FA 1RAXA 2K1BA 2NR2A 3WAOA 1WR1A 3M4PA 3KH0A 4DV5Q 3MJ5A 1VLBA 3UIPB 3A7AB 2K5DA 2SOBA 3I4LA 5EKKA 3HOXB 1EF1A 1WXVA 3A8JE 2L0FA 5HURA 3CPWA 3K7UC 3KUDB 4BAXA 1P3QU 2F0UA 1F9JA 4C2MH 2B2YC 1WYDA 3DVNV 1UEAB 3DHGC 1UE7A 1FL0A 3L10B 5IWAL 1YNNC 3AQQA 3N9YC 5I2YA 3PRZA 3NUHB 1WJNA 5CV9A 4DV5L 4XZ4A 2K8CA 3HZXA 1E8WA 4FN2A 1TWFH 2MBEA 1ZOYB 3VVWB 4JYAQ 4HPMB 1OXXK 1VF5C 1QVGA 3KOJA 3PUXA 4YCWA 3IG3A 3VFKA 4JWSC 4KY6A 1K8RB 1SLJA 3DBSA 1CKMA 1EFID 1XTCD 3A7LA 1FYCA 1LUZA 3CMAA 1VQEA 4C3IH 3NP8A 1ASZA 2FBWB 3DWMA 1K3BC 1PXUA 2M19A 3T9LA 1C4AA 1EQQA 2ID0A 1W3SA 2F0OA 3DM1A 3VYTA 4CJ1B 1WH3A 1XLNA 3O65B 5KNBA 3FPPA 3OMGA 1J19A 1WD0A 1ZXTA 2OQ0A 3KK7A 4JYAL 2IGHA 4R8IA 4XE0A 3RZDH 1NY4A 1OFFA 3W1SC 3S1QB 4ZRIA 3F2UA 1MJDA 1F2MA 4LF4L 1LTSD 2HCIA 5FLXc 4R1JA 4J6IA 3I90A 5CV6A 2G3QB 5G5HA 3FKIG 1YJ1A 2M56B 4GKJL 2CCZA 2IO0B 2B2WC 4CGYB 1QZHA 2A68D 3L17A 1IW7C 2E5LL 4WJOA 1SMXA 4ZYSA 3M3YH 3J9CA 4WAAA 1MD2D 3OWFA 4DR7Q 2NN6I 1XCTL 1GJZA 2KDFB 1SB3C 1FNVA 4A9AA 4FYDA 3H8HA 4A4IA 4OVVA 1BR9A 1P16A 1LM0A 3GTMB 4P73A 3HOVG 1GC7A 4XQJA 4JPSA 2R7DA 2MJ8A 1SRUA 3EROA 5LHY1 1PV4A 5ELOA 2MUYA 2R7ZH 2LVQA 4LF8Q 5G3LD 5IT9L 3M7NA 1SNCA 1E22A 4AIMA 4Y52H 2WDVB 1U4RA 3HOYH 4QAYA 3UI3A 1UD7A 1D1IA 1HTPA 3R8BA 3Q14C 4MH0E 5C3WA 1M90C 3M4OH 1CSQA 2PZTA 1J8IA 2E8GA 4ZKBB 2H89B 2OF1A 4BY1H 3BY4B 3K0YA 1N34Q 4BBNF 5ISRA 3NRZA 2NCNA 3NVYA 1YNJD 3NQTA 1IXRA 5JEAJ 1D5ZC 5LL6S 1TWAH 3VA7A 3JAML 2REXA 4K2LA 5FO7B 4US9A 3MFYA 1UWXA 4LF8L 2LUMA 3G71A 1QT9A 2JYOA 4R8NA 4WWMA 1MFWA 1RYJA 2K39A 1EYCA 2KJXA 3HOVB 4KHPL 4NXMQ 3QWNA 1JJCB 4K2KA 1PTOB 4P1CC 2LXKA 2NZHA 2XGTA 1N34L 1SNDA 2QCPX 3BDLA 3C3LA 4XT1B 1L7YA 4A3JH 1KL9A 2B39A 5FKAC 4NPNA 2M8SA 2KJRA 4WWNA 2N88A 2NWGA 4DAVA 2D9UA 1VF7A 5C0XJ 2XBBC 1IBXB 1PYSB 4O0AA 1Y1WH 4MSQB 5BO4B 4G3XB 3CCQA 2M4NA 4NXML 1YVCA 2A6EC 3E0JA 3PUYA 3T51B 3ITPA 2F4IA 1PQSA 1TJEA 1ISNA 1JB3A 3C2PA 4JIOU 4DK6C 4E6IA 3WAPA 4UP9A 1YHQA 3AB5A 4DV3Q 2C5LC 2QJLA 1PTOF 2LEKA 2NVYB 2RKSA 3H15A 1SIFA 2YVCA 2VZAA 4JOIA 3Q3JA 3CCUA 2CU1A 3TMEA 4DXGA 5D14A 4G4KA 2L05A 3ZIMA 4WJQA 3ZNHB 2D0OA 3IHPC 3U50C 3Q8EA 4DNIA 2V1CC 3ZXRA 1SROA 3BS1A 3AYHB 4BBRH 3C0RB 4P6VF 3I55A 3P1HA 4DV3L 1BXTA 1V43A 2WXQA 1PA6A 4ASWC 3I4NH 3P42A 2JA6H 2UXDQ 4GDKB 4KDLB 4P1BC 3PQIA 1IYFA 1TS2A 4QB4A 4OONA 2MQHA 4KTAA 3W9CB 4BBNC 5G2NA 5I4DA 1JICA 3HKZE 3PGZA 3U4ZA 1B70B 2MP2B 5KIXA 5D2MB 1VS0A 3A9JB 1I3QH 3J81i 3TS0A 4HROA 2IBIB 5G55A 2V3NA 3VUYA 2ASBA 4KKSA 3OJ3A 2VL6A 2YTXA 1TVXA 2EOTA 2FMMA 4BXXH 5JAVA 2R93H 2HDLA 5CYUA 4A3DG 4BBSG 2KC2A 3UQAA 4IQZA 2XK5A 1JOOA 2DZJA 2LJIA 3KYCD 4LF7Q 4JGHB 4OGQC 5BYRA 4HJGE 4EZJA 1T0YA 3ULPA 3KLSX 3GTGB 3FAHA 1Y56A 1PZID 2X6GA 1S5BD 2K5WA 1EQRA 4DR1Q 1Q86C 2PW7A 1Q12A 2KFJA 3S1NH 1A3VA 2BB5A 2JVCA 2N78A 3Q3FA 3VTUA 4K5XA 3RCZA 3SU8X 4POFA 3BZCA 1QF6A 4GLVB 2XEWA 4P71A 4V190 3R93A 5I6WA 1STGA 3EGRA 4OVZA 3VR4A 4GB9A 2KX0A 3DDCB 4O1NA 1L6VA 4BOSC 1JRPA 4DR1L 1VQ9A 1T5EA 3CC7A 4IM2A 4RCOA 1C8CA 2WXFA 4DXAB 1PTOC 3F8TA 1RF2D 2CH4A 5C3EG 2JSVX 2GBKA 3JW0X 4EKUA 4EOYA 3MXNA 4A3DB 1P98A 2ENBA 4BBSB 4W9HA 1ET9A 3R66C 1FGUA 1R4QB 4BKGA 2IX1A 1SFOB 2F0PA 4PZ8A 5C4XH 4ULLA 2E2HB 2VNUD 3X23A 5IP9H 1A15A 3K7AH 1E8XA 2ZCCA 4LNFA 2NYZD 3QOLA 1Z7TA 3J81j 4NXNQ 1S5FD 3SK5A 3MVVA 1S1QB 1EUJA 2AWOA 4B3SQ 1YJJA 4FVMA 4AJYB 3S14B 5J1ZA 2RA4A 2VXWA 3AU7A 4A3MH 4AS1A 1I5FA 2BH8A 1TBEA 3I2ZA 5A35A 1A63A 2ICIA 1JORA 4F8CB 4G57A 1QUQB 2NVTH 1F9SA 3TSSA 4PMCA 2PMVA 4A90A 5J39A 1A8VA 4MM3A 2MWSB 2R3ZA 1JR0D 2D2QA 1G8ZD 2D3CA 1NR4A 4AQYQ 3V05A 3AE3B 1WZ3A 1OTRB 4NXNL 2BTEA 1HQMC 2XTIA 3EUB2 1PH4A 4B3SL 1WGYA 5C3EB 4MEMA 4C3HH 2VUMH 1V5TA 2BE5C 1VQGA 3U58A 1N61A 1CM9A 1DXMA 2ZW0A 3NTKA 3TEXA 1PH2A 5D6JB 3UGBB 4A76A 4GOPB 3V6EB 2GBJA 2G9DA 2E2IH 3MTSA 2F0JA 2CR5A 2Y5BB 5EPLA 1GUWA 3WA0A 1FCLA 4OO1G 4IJHA 4MDKE 1JC7A 1HNZQ 1LV9A 2VB3X 4AQYL 3N1YC 1DGJA 2L83A 3ZDTA 3MTNB 4PT5A 3TEZA 1EY8A 2MO0A 4KLKA 4QMGA 4FA6A 5J17A 2BCOA 3OYYA 4JBMA 3S17H 4A3CH 2KWUB 2E3TA 4DA2A 5DNFA 3BVMA 4DK5A 1RTOA 4DPGA 1HZ9A 2KN5A 5M5XH 1HTOA 4B6WA 1O7IA 2ZXPA 3O13A 1N33Q 3S2AA 3TBLD 1U4LA 4JI6Q 5DAUA 1E7PB 1DYQA 1PUTA 2LGXA 2NS5A 3RYTA 3STBD 4LW1A 2C60A 2KOXA 3H7PA 3ZXVA 1EY0A 1GKHA 3HOZH 5BN3A 2ZJPA 2IX0A 3IAM1 4FJYA 1F0ZA 4G0NB 1ENAA 3ZNGC 3S16H 5CHVC 2MGSA 1K53A 2BS3B 1OEYJ 2GBNA 2WXOA 4S3SA 1N33L 2WU2B 4HJAA 3ETRA 1QG7A 1Q1OA 4JCVE 4HKQA 2MRPA 3HOXH 1LT3D 1VQ6A 4DHJB 3GTOH 3TRZA 3DVGX 5HY6A 4WJPA 2ZNVB 4MJSA 1SNOA 1OXTA 1CA5A 1ENCA 1S5CD 3V2TA 1XX8A 1TKGA 2N9LA 1LT6D 3P75A 1PZJD 2NBWB 3CP0A 5HI1A 1UELA 1U4AA 4JW0A 1HA5A 1K52A 1OXUA 2XWBB 4IALA 4K6LA 4IFDJ 1G6PA 2FIFA 2V4IB 3Q8FA 1Q5WB 1Q82C 1RFAA 4HAEA 2DX5B 2BYTA 1HR0Q 2WX1A 4LNNA 4JI0Q 3TN2A 2FE8A 1ZEQX 2V9HA 4M01A 2AHOB 3I4MH 4FP5D 3Q22A 1VQLA 1F52A 1NYRA 2KQ4X 3JAMi 3VR6A 1JROA 5IYCG 4IURA 4AQ7A 2IGGA 5L83A 1HR0L 1F2ZA 4JI0L 3TP7A 1BBXC 2LGIA 1CZWA 3P63A 5C4HA 1P0RA 2EKEC 2KQSA 1VQCA 5LMNQ 2FFKB 3S2DH 1Q90A 3DCGA 2VB2X 2CW0D 5DLQE 1SYGA 2AQ1B 3N20C 3AI5A 1OGWA 1CUKA 2Z59B 3I8ZA 3SK4A 4RWSC 3AMUA 2JPHA 1ESRA 1B4OA 2F0DA 2LFNA 2VZKD 4YWGG 2CFMA 3GTJB 2JU6X 2IX3A 4PZ7A 4GOPC 3N30A 5LLIA 1RRBA 1KRTA 3EVQA 2DAFA 1PMRA 2R2OA 2CHBD 2TMPA 1KH0A 2ZPYA 5LMNL 3N3KB 3TP8A 1RCVD 2WDRB 4PS8A 4R3DA 2K4KA 4L5SA 4X66Q 2B2TC 2MBQA 3PZ7A 2DY8A 4ZYNA 1IBLQ 4WORA 1WYWB 3TCAA 3GTMH 1QOGA 1G6JA 4JI1L 3I70A 4GLXA 1HPCA 1WI5A 1EM7A 2BWFA 5H1SE 1B9RA 5M3FH 2KXJA 2UXCQ 4JX1C 2UU7A 3PO3G 2NB0A 1KRSA 1YN3A 2VH1A 5E3FA 3VRBB 2HDMA 4DV7Q 4GNXB 4CHKA 3F2DA 3PGEA 1XWEA 4KX6B 4GS3A 1DM0B 4PNYA 2O6VB 2WHIA 1S72A 4PYZA 2WACA 3M3JA 4RMFA 3RN5A 3GTPB 4GN3B 3TDQA 1KXLA 2RSNA 1Q8IA 4LFBQ 2UXCL 1JWBD 3RN2A 1OXSC 5I9OA 1IKMA 4DV7L 1V1PA 1STYA 5JEAH 1FR3A 3R3MA 3L2PA 1SYFA 4ZDVA 5FJ8H 1VQOA 3HOVH 1S40A 2ZNVC 3FVQA 4RHSA 1L4DB 3G4SA 1RKNA 3PO3B 3ULJA 1VZ6A 3GP7A 3I7FA 2KWVB 1YQ4B 2ZVNA 1I4QA 4GDLB 2E76C 4GU2A 1KD1C 1WSPA 4H0LC 3G7LA 2MHVA 2ON8A 4IWPA 2IO2B 1VQ4A 2OJRA 1MSHA 2NVXB 4L2YA 4B08A 3NEMA 5E6PA 4K0KL 4ZKCB 3A54A 5C0XH 3Q8AA 3SR6A 1QVFA 5EGTA 2VH2A 3AXCA 4IPCA 2Z0SA 1QOFA 5LXIB 3RD4A 4IUMB 2C35B 3A1QA 2F0NA 3A9KB 2W54A 1OO9B 1SMYD 3TREA 1Y8PB 3H3VH 3PPAA 3VUWA 4POGA 3U7ZA 4EFOA 3AECB 4HIMA 3DWAA 2FHTA 2RQXA 5JVH3 1Q7YC 2K5HA 1N5WA 2INCC 3FKYA 3GZNI 2LHEA 4PMWA 1ICWA 1TS4A 2WAQG 4YWMA 1QZEA 3MXPA 4NKLA 2Z6KC 3LGJA 3PLVA 4HLEA 4X3UA 1LO5D 5IN7A 1AE3A 3CSFA 3V61A 5JPNC 3FILB 1PYWD 4XYQA 3CCVA 1MG8A 2YU9B 2QCZA 1A0IA 4PQXA 3HRDD 1KLVA 5D65A 1WFYA 4II3B 4MH8A 1C9OA 5M3MG 1BCPB 3P4RB 2LS01 3AFQA 4LF9L 3ERSX 2I5LX 4IOCA 3B2GA 3PMFA 1KRHA 3PLUA 4MELA 1LTID 3VTWA 5IO9A 3HOUG 2VY3A 1YN4A 1TYGB 3K9OB 3F2BA 4KN7C 3A5UA 2JYTA 4NDXA 1WJ6A 2BQQA 3WAMA 1TWHH 4XDXA 2DENB 2D5DA 3OHXC 4DHJD 4HEDA 3T1HQ 4GNXC 2LGSA 3GTGH 1ZYRC 3CKIB 1WMHB 2WAQB 5K5PA 3J80L 3MHSD 1ILPA 5AFWA 1J7BA 4CBVA 2PW5A 3K80C 1CZGA 1A3TA 3NS1A 2G5DA 1XEEA 1DOYA 1WXMA 3AN1A 3T8MA 4CDCC 1X3GA 2IL8A 4GLSC 4ZCKA 2A73B 3T1HL 1GUGA 1PVOA 4IM3A 2JWUA 1VQIA 1T6BX 3V96A 1LTBD 1ZGUB 4WQMA 3HOUB 3K8AA 3ULLA 2J0MA 3H6NA 1F2RI 1ZE3D 2KLCA 2Y5CA 4DHZE 2RVLA 3F2CA 2UXBQ 3ERQA 4A3DH 4S17A 3IT6B 4KV2A 1SFOH 3SDZA 4KK7A 1L0WA 1Q1BA 2ZXRA 2CS4A 1YNXA 1Z6HA 1UF0A 1XMQQ 1QJOA 4FXGC 1IUEA 4RMAA 4WIPA 2PCFB 5JJZA 1FRDA 4K7WA 3IAS1 1PZKD 2Z9HA 3S14H 3M4YA 1HFGA 3BU2A 4LNQA 4K7SA 4B95A 4FJVB 1YN5A 2MP2A 1GPXA 4JLCA 1YBYA 3HM6X 4ANVA 1PFSA 2H4OA 1WXQA 2F1MA 1JQ4A 1STHA 2L3ZA 2RCFA 3RMHA 3N1XC 1FXTB 5ELEA 1K28A 2NUCA 1XMQL 1SGHA 3V6CB 3TEWA 4ME5A 5C3EH 3QARA 4PZ6A 4A3GG 3I3TB 2ZTCA 1IGCA 4KGRA 2I2YA 2AQ3B 2A5HA 4DUZQ 3PSIA 1TU2B 1JE5A 2WFWA 3E9HA 4OL7A 2LMCB 1YZ6A 3FEWX 3EBEA 3RI7C 2OWOA 4KGSA 2KEEA 5CBEE 1C78A 1H9SA 1N32Q 3PCOB 1T3QA 1SR3A 3FP9A 3TS2A 1VCBA 4CQNA 1MG4A 2EY1A 4C00A 1JB7A 1HNWL 3BK2A 2UUAL 3M62B 2KHIA 1ET6A 3CU7A 2K0PA 2KN4A 2LGYA 2LJ5A 2WXPA 2Q5WD 4BA1I 1X3EA 4NJCA 1CSPA 4TV3A 1X3PA 2XNAC 1BCPC 5M5YB 2JA8B 1EF5A 1WRDB 3UF8A 2N7JA 2L12A 3DWGC 4MGZE 2KANA 4RM8A 4NPSA 2BA1A 1R9TH 4FXCA 2I5MX 2N7EA 1N32L 4IN3A 1ESFA 4FHJA 5CHFA 4C3JH 4A3GB 2BF8B 3SK6A 4EQNA 1UBIA 1JMLA 1L6UA 3S24A 4XIGS 3RZOB 4Y7NH 1QNKA 1GJXA 1EIGA 3I5JC 2A19A 1G91A 1EWYC 1ZP0B 2ZCBA 2L0CA 1U0LA 1CK1A 2MO1A 1LTGD 2Q8TA 4KVGB 1E24A 2MA9B 3J7AV 3ZNZB 2FCNA 1XXGA 3B2FA 2M17A 1E7ZA 4WJ4A 1YIWA 3A4RA 3B08A 2OCEA 1EL0A 3GS2A 2GI9A 4HCEA 5ELDA 4DU9A 3I72A 1LM8B 4B0MA 3GTKB 2KTRB 1NI3A 1W6JA 1RODA 1VMPA 1YJ9A 2ZZPB 2WKDA 1K8OA 4Q5VA 2Y3AA 1I4RA 4A3LG 4MGKE 4ZRJA 1WF9A 5EE3A 1VMCA 3VTVA 1FCCC 1NMGA 2EYLA 3UE0A 1J5EQ 1YQ3B 4MIUA 1UBQA 4LDTD 4ME3A 1D8LA 3PV0A 5ELFA 4KGTA 3MA2B 5CTRC 3W3AA 3J81c 1MSGA 2ALYB 4B9XA 2O2VA 4IFDH 3OMCA 1VCIA 4WQOB 2JA7G 3D4DA 3KUCB 4Q0FA 4BY7G 5JJKA 2O2LD 1YQBA 2DYBA 4AH6A 4UPAA 1PH3A 1SE3A 2NTSA 2AL6A 2DZIA 3L4PA 4NY0A 2KC1A 1UE5A 2XRSD 2SNMA 2QIEB 3T1YQ 3H91A 2JA5G 2B3GA 4DAYA 1HFNA 2EMTA 3S2HH 2EMSA 1B7YB 3QIAA 4LJZC 2K03A 2YTVA 3KF8A 4OXPA 4BKSD 2WINB 4OIJA 5CV4A 4WJ3M 1D2BA 3I57A 2INPE 4MZ9A 3BYYB 2R6GA 3Q69A 3E9IA 2MJDA 2A68C 2A6HD 1CA6A 3T1YL 3U2SC 4W9DA 1I50H 5LXHA 1LYLA 2B8GA 5IY0A 1I4PA 1TWGB 2JA7B 2Y5PA 4YY3Q 3VAWA 2N9PC 3N1ZC 4N59A 2WWZA 5E6OA 3SD5A 1EWHA 2KTFA 3ZO5B 4DF7A 1ENFA 4IWQA 4WAFA 3FC4A 1TT2A 2WB1E 3LX0A 2VQFQ 3DHIC 5IYCH 4F7ZA 2Z4IA 1WFQA 4NP5A 5F2DA 3EFUA 2JA5B 1XTDA 4UP8A 1LLRD 2JZ3B 2CWPA 3NTHA 2JRHA 2PYKA 3R2IA 5LNK1 1PH6A 2NMQA 4IUUA 4M0WA 3NWTA 4DV4Q 4YY3L 2MFIA 1VQDA 2BS4B 2DWQA 3EC8A 3A8KE 2PEAA 4JI4Q 2R92G 3CCSA 1NI2A 4DNRB 2D5GA 4I7AA 4XTCS 2I5HA 1HUMA 2B2VC 1YNJC 3DUZA 3MFGA 3MXUA 1TY2A 4R4TA 4DR4Q 3NHEB 4AOFA 4C4VB 3GTPH 4I6NB 3KWLA 1JE4A 2MBOA 5FO8B 4GSWA 2RSOA 1Y8RC 3BIID 2PMZB 1NJIC 1QCBD 4A93G 4ARCA 5EPKA 2CWAA 3SXHA 3ZJTA 1LT4D 1NMFA 4JK1C 1SE4A 1WM2A 2JEBI 3BDCA 1HA6A 1NTGA 1L5PA 2BBCA 3HHMA 3E3XA 2L52A 2N4FA 3NVVA 2BWES 4NJ6A 4AWJA 3DBLI 3KJOA 4DR4L 2LXCA 3JVZX 4KIKB 3ZDMC 5C1ZA 4RF1A 3PO3H 1T0RC 1IZ6A 2NZ1D 4FXDA 1BMLC 3Q3OC 1WX8A 1C9FA 2LASA 3P2BA 4M00A 3AE7B 1MJCA 1V80A 5FLMG 3SK8A 2VS1A 2GMIC 2QDLA 4F7XA 3NJTA 2F0HA 5EE1A 5FLXE 4OHJA 5I6YA 2B63G 1X65A 1XD3B 2PVGC 3ZLZA 2NTTA 3J80i 3CCJA 2NVXH 1R4NI 3MP9A 1IYUA 3MZ5A 2H5XA 1ICFB 1QE6A 4KN4C 2EZVA 1WJ4A 2KYWA 3QQ8B 4A93B 5IYBH 4DR7L 2KECA 1EYGA 2Z0DB 2F0FA 3DWPA 4RKLA 3H7SA 4PS7A 4KSKC 2QHOA 2HTME 4AYBG 3FKIB 4IPGA 1GAQB 1GUAB 2B76B 3BJUA 3GQBA 2DY7A 1IPGA 2R7FA 4QJFA 2M0AA 3EN2A 3K81C 1WTOA 2CH4W 2J52A 1YNND 2D07B 3C19A 2BA0A 2M2LA 4YTNB 1E9MA 4LWCA 3S1RB 2K52A 3NTIA 2N49A 1MI0A 3K59A 1IL8A 3BZDB 2WS3B 1SNQA 1K3RA 1LABA 1CKOA 1SXTA 4JI5Q 1N63A 3TP6A 2FXQA 3OPOA 1HZCA 2F03A 2IJ0A 1U4MA 2JY6A 3DM3A 3K6OA 2B63B 2Z0EB 2NPTA 5IT9c 2YU9H 4BS9A 3NOBA 4DV6Q 1VQBA 3RR5A 3S1MH 2GB1A 4EEWA 2K5PA 2DNCA 3HVDA 1TQOA 1V1OA 3HS0C 2ZPNA 4OW0A 2LKVA 4AYBB 1EO6A 4JI5L 5C4ZA 1GC6A 3JAMc 2V1YA 3ZRFA 3K9PB 2JXXA 4K81A 2PQAA 5IGEA 5D7GA 3OWEB 2ZM6Q 3BK1A 5MPOA 4HSPA 2C7NB 2BGFA 3KF6B 1WM3A 2KUMA 2BPSA 1E1OA 4DV6L 1PHJA 4A3KH 3GD7A 2F0MA 5E6JA 2PLPA 4GDLA 4TKOB 5DPWA 4QIWB 1IW7D 3GZNB 1AZPA 3PUVA 1FFUA 3ONAB 1MI2A 3D6WA 2OHFA 1O7LA 4LF5Q 5CORA 2Y0SE 2INNE 1D1KA 2KKCA 1UH6A 2KQ7A 4QGUA 2K6DB 1LTAD 2KWDA 2ZM6L 3AEBB 1WJJA 5KEEA 2K32A 3Q2AC 3H6MA 4NAWB 4CDDC 1EIYB 3MWYW 4A3FG 2RPQA 4XYOA 3OSOA 1HCZA 2Q8IB 1HR0W 2JE6I 1SBBB 3S15H 2J7QB 3HOUH 4HIDA 2NBUA 4P72A 2KMCA 1KNEA 4ICUA 1C77A 1IBMQ 2PTLA 3NY5A 5C6AA 3P20A 3Q8BA 3DBHB 4K14A 1CI3M 4EGVA 3NBHB 1KAAA 1QOAA 5IP4D 2CQAA 3Q23A 3DQVA 2ZT9C 5L95C 1TR5A 2JT4B 1Q8KA 2QA4A 2PO4A 1O7YA 4EUTA 2YV5A 4XDCA 4USAA 1V86A 2E75C 3BWUD 2O4XA 2EYPA 2UXDL 2I46A 5LMNW 3LJ3A 4RM9A 4BKSA 2WXGA 1IBML 3BZKA 1D5XC 3BG3A 5BYQA 3D31A 1V8QA 2AQ2B 1PRTB 3CC2A 1KFYB 2PE9A 4HKZE 2RD0A 2WXRA 2HQLA 4LTUA 1Y69U 5C44G 2RHSB 4ZRPA 1W6KA 1TKEA 2C5CA 2I38A 2L15A 2MSED 2WB1G 4LF6Q 1SN8A 1KM7A 4IM0A 4W9KA 4A55A 5IE8A 3W2DA 2JQOA 2JZPA 2HT1A
chains in the Genus database with same CATH topology
4DQOC 5C5MA 1TS5A 2WP8J 2A6ED 2AUJD 3SFEB 3OOCA 1B53A 5CV5A 1QOBA 2G9HD 1M4VA 1CQFA 1PRTF 5C5LA 1EY7A 4KY7A 4N9PA 4YSXB 1QNUA 5C44B 2YEPB 5CMDA 4A8XC 3U4EG 4A6QA 1Y8NB 2L1AA 1ROEA 2IGDA 1B9NA 4HCSA 3M85A 4HEA1 1B1ZA 3H0GB 2V3PA 5JXVA 4RA8A 1E6EB 4F87A 3DEOA 5KNDA 1GUTA 3AH7A 5EE0A 2XWJB 2YYZA 2JSOA 1VRAB 1BUVT 1KNAA 5D3IB 2YEPF 4KKTA 1XF5L 2TSSA 4KV6A 1QLBB 2L32A 1CHQD 1JW9D 4FXKC 2ONQA 3G6JB 3R3OA 1EEFD 3PIO3 4A3EB 3M7GA 4ARIA 2F0IA 2K9XA 3NSWA 1B3AA 1ONLA 1VR9A 2B2YA 4EVOA 1HXYD 1PDXA 3P7JA 5NUCA 2OXPA 2FUG1 3WOFA 5KNCA 2CU3A 1PRTC 3TP5A 1MVKA 1HTLD 1PTOD 5FR3A 1R4PB 1H9MA 3X3MA 4XXEA 2JXMB 2F0GA 4K6DA 1JWUD 2Z1CA 1V8CA 2WQYB 5K36H 4C56C 3VR5A 1ZXIA 3BVZA 2HQEA 1ZPSA 3W1SA 1S5DD 4R9WA 1KDAA 3SR1A 3URYA 3AEEB 1DJRD 2B2WA 1K51A 2OEDA 3MAQA 2RDHA 2V4DA 3H94A 2BE5D 3AE5B 2K5QA 4EQPA 3RPFC 5J22A 1EZ6A 4TSSA 1QQRA 2OEOA 4JBWA 2K33A 4G7ZC 2C9OA 1TWCB 3P4SB 4LMQD 3CRKC 2B2UC 3PUZA 4K8JA 1FFVA 4KJOA 1EU4A 3K58A 1SSNA 3GV6A 2IDYA 1KLUD 3KWVA 5BMHA 4RGNA 2NN6G 2WXMA 2WXHA 1X32A 1O80A 1HRJA 4KI0A 1P7EA 4V0BA 3C8YA 1PDQA 1STNA 1H9KA 4LK1C 4DXFA 3HKZB 4C7YA 3SHLA 2F0EA 3P4PB 5JPMC 3K5OA 2L5TA 5FOBB 1J7AA 1TWFB 2SNSA 4KHVA 2F0WA 3DWQA 5M5WB 2PZWA 3T53B 1Q10A 5IGBA 5COYA 1PTOH 1NYQA 4ITKA 4KMUC 2QKIC 2KAJA 3FPUB 1TIID 1DOXA 1H9RA 4G7HC 2A74C 5BN5A 2L9HA 2I07B 3RFZB 3AEFB 3T3OA 1J7CA 2CVRA 3QG1A 1UAPA 1AZQA 3SEBA 5AUKA 3SE0A 3A8IE 1A3UA 1SYCA 1AYFA 4HTHA 4ZUJA 2MPMA 1S5ED 1G291 5IGFA 3HOYB 4IUVA 3E5SA 4EE2A 1FNUA 1LTTD 1O78A 1QOHA 5C0XI 5ELBA 2KDMA 4OZAA 1WRIA 1F9PA 2F0SA 3D6CA 2J7ZA 2H1EA 1B9MA 2IW3A 2WXKA 2ZXOA 3H09A 4ZQ3A 3OIQA 1GB1A 1WTWA 1IBXA 4BWGB 2NVQB 4ZAIA 3QB3A 5C2TB 4WFN3 5DEHA 3D4WA 2JXTA 5T1GA 4I7ZC 5M3MB 2EDGA 1WTXA 1WTQA 3HVZA 4NMZA 1B50A 3ZGZA 3VR9B 1FXAA 2PKOA 2AWNA 4Z9CB 5AUIA 4HR7B 3MC0B 1FRRA 4NW2A 3EA6A 4A3BB 4DN4M 1RM6C 1SJED 1IHZA 1KF6B 1CQVA 4BBRB 3IT4B 2WKCA 2A69C 3NBHA 2JA6B 4XQNA 2M9VA 3FDTA 5IOCA 3LYYA 4OZBA 1ZKOA 1NUCA 4TQ1A 2Q8RE 4XT3B 2K22A 3EJIA 3K57A 1I3QB 4MM3B 3L3OC 3J7AF 1MPEA 4CJ2C 2XVSA 2R93B 2OT2A 5C4JB 2W82A 1WD1A 1ZYRD 3VYRA 1BF4A 3LWUA 1A6XA 2F3VA 2MH7A 1JWSD 1FD6A 3AE9B 4K5VA 1QB5D 3PIP3 4X3SA 1BQQT 4KHZA 4CKCA 3D8GA 3AE6B 2EYFA 3TBIB 1QWYA 4D2KA 1F77A 1DOMA 1WYGA 1D5MC 1RJTA 2JQRB 4OO1H 4XE0A 1DONA 1SNMA 1NCVA 4HSVA 3AEGB 5G3LF 4Q2JA 1AEXA 4QF4A 5BYSA 1K50A 3RUZA 4XWWA 2PVOD 1FNWA 3CWIA 4X3TA 2K01A 2E2DC 5EQ0A 4WH4A 2NVTB 5HFYA 4DAPA 2KEDA 1WGKA 5JVG3 2L4NA 3L9AX 1XO3A 2VUMB 5HGTA 5BMIA 1EY4A 1QILA 1KLGD 2B2TA 2HUGA 3ND8A 3QO2A 1LACA 2K28A 1L0VB 1OQQA 4NAMA 4RF0A 4YT0B 2XRQD 4ZHOA 1YJIA 4YSZB 3J81E 3PO0A 1C79A 1J9OA 2RDFA 4TRDA 1AFPA 2L11A 4C1NK 1XCQL 3OIPA 4RHRA 1BCPD 1UGJA 4MT5A 4XDDA 3E9SA 1PFMA 1I4HA 4IFDI 3MHBA 1O7ZA 1JCKB 4CKBA 3S9WA 2X69A 4BY7B 4RGMA 1Y8OB 4HMIA 3N52A 3Q6SA 2MJ3A 3WCQA 4KJNA 1I4XA 1JOKA 2J0TD 2KHSA 2KACA 2EYHA 1DCZA 3D3RA 5GXGB 3Q8CA 4WJWA 1NVID 3OW7A 1VZ8A 1GB4A 3Q24A 5I9PA 1AWDA 2EY2A 2WIIB 1NENB 1F2LA 3GTOB 3A56A 2HCCA 3ZYYX 5DM73 2QF7A 3V3XA 1BO0A 4RFBA 2EJMA 1PLFA 3NE5B 1HHVA 4BA2I 1OQRA 5FLXL 4DK0A 3T56B 2BW2A 2PNRC 4PV1C 3I4MB 3ZJVA 2JP1A 2NN6H 1EY5A 2BDNA 2L55A 1E2WA 1K8MA 1STEA 3A55A 1CHPD 1V1PB 1SF0A 3FMCA 3WOEA 3AE1B 3AM9A 4CJ0B 1HUNA 2WU5B 2R92B 3CQZB 3S2DB 3VR2A 4H13C 2L1BA 2O5IC 2GRIA 2DN8A 3SVMA 4EQOA 3AMZA 3UI2A 5EE9A 5IIFA 2LHDA 1RD9D 3HGBA 1EQTA 4C1NI 4IUQA 3BYTB 2GA4B 2EJGC 2RBMA 2QSDA 2F0LA 5JEAG 1I4GA 3QOJA 2W3SA 3TEYA 2D2CC 4ODGA 5M3FB 3HP3A 3LB8C 2SDFA 4YIJA 3PUWA 1B2TA 4OIKA 2X38A 2DBYA 5T1IA 2J53A 3VYSA 1PGXA 2PQEA 1ZXHA 1FXIA 5C0XG 2LFIA 2KCCA 1PGAA 1SYEA 4YTPB 1Q1EA 4QCLA 1STAA 4LAAA 3AEAB 5IT9E 2KVMA 3NUCA 5H8YE 1BDOA 4P2CB 2O5JC 4YXDB 2PPBC 1TKWB 1AW7A 2Z4HA 4LLGM 4RGOS 3PO2B 2F3WA 3JAME 1FO4A 3NQIA 2XN9C 3AV8A 4CHTB 5E4WC 3NVZA 1FM0D 5IODA 5ELCA 5I2XA 2BS2B 3MHZA 1D4BA 3EFXD 3HRZC 3U9OA 1MBYA 1FMAD 4RAUC 4FNFA 1S4ZA 1EEID 1H9JA 3T4AC 4N6EB 1Q3LA 2KOLA 2RPVA 3FILA 4YSYB 1OXVA 4IUTA 3KLSA 1JQYD 5FO9B 4MACA 5A2QL 3IL8A 4A3FB 4U68A 2KA7A 2BB6A 3CRLC 5EKLA 1JWMD 4B0EA 1SAPA 1F9QA 4MN3A 1C4QA 1X3QA 2VZKB 1WCMB 1V97A 1EZ8A 2IT1A 1GUSA 4RGTA 2WNMA 1UUPA 3PZ8A 2PW9A 1TWHB 3KBXA 4UDUC 5C3JB 2BOSA 2SEBD 4L63B 3DEPA 5CV8A 3KQ4A 1FGBD 4RCNA 5EJWA 4ZRZA 5A2QE 2WP9B 2F0TA 1GHJA 1CT1D 1UWMA 1H9SB 4ZOHC 3NWSA 1SYDA 1BNZA 4ZHPA 3EQLC 1ZDVA 4IOIE 4WURA 1N60A 2EKIA 3GV3A 4WRDA 5FK9C 5TSSA 2E2JB 2WB1B 1DOIA 4LK0M 3C1EA 1E2ZA 4L6TB 2WXIA 4A3IB 1K83B 1I6VC 3U52E 3VR3A 1P7FA 4KD4A 4F88A 1TS3A 2B8FA 2N55A 1KTKA 2M00A 4RKBA 1DZ1A 1TY0A 4CKEA 4X3KA 1M8AA 5EBDA 5EKIA 2KMMA 2W55A 1EU3A 1PFDA 5HHDG 3IFTA 4KY5A 3ZJUA 1N62A 1U4PA 2AUKA 3GTLB 3H3VC 1XYIA 4GZYC 2LMCA 4C3JG 4KKJA 2EXZA 2JX5A 3I91A 1SYBA 2JYEA 4KKIA 4ZRQA 4IZ8A 1QKZA 2WLBA 4IKGA 1R7SA 1XLOA 1NAPA 1EOTA 2CW0C 1SSOA 4XQQA 3W5VB 3C1FA 1I6HB 2WXLA 2V0GA 3AE4B 3TZDA 1F2YA 1F2RC 2N9KA 4ID6A 2B2VA 3MXGA 3T16A 3NXWA 1R9TB 1SIJA 4TQUS 4C3JB 5KGUA 1T5XD 2IPKD 3NK9A 4FF2A 1NEKB 4IFDG 4Y7NB 3VYUA 1GUOA 3DXJC 3U9SA 1IGDA 3LXFA 4F8MA 2FMCA 5EBCA 1MGSA 4K8IA 4US8A 1PFNA 3KLRA 1II3A 1C4CA 4G7OC 2EYOA 5IGGA 1RTNA 4DFAA 1CTMA 2EYJA 4HRSA 3IFDA 1WTVA 1A70A 5D3DA 3GTQB 4IUNA 3J7YW 3AE8B 2SAKA 1MHHE 2WXNA 1G2TA 4P16A 2WXJA 3K5LA 4N9TA 2Y0SB 1VDVA 3I73A 5BN4A 4YTMB 2PZUA 3HG9A 3S2HB 1BUIC 4M8AA 1PRTD 1ILQA 1SEBD 3IXSA 4DGZA 1EQVA 4H2AA 1F9RA 2EPBA 5EPJA 1ZDXA 3ND9A 4C3IG 2EJFC 5H92C 1RHPA 1I50B 3BDOA 3I3CA 2MJEA 2WDQB 4HMJA 4QUCA 4C2MB 1SMYC 4H44C 5JOBA 4J6HA 2H88B 1SE2A 3LWEA 1RDPD 2RDGA 1XLPA 5HG2A 1GOZA 1NR2A 1FIQA 4JE3B 3VRAB 3T3NA 4C7ZA 3FRPB 1VJKA 4XWTA 1CJEA 2CJNA 4RNAA 4C3IB 3ABVB 1GUNA 3X3NA 4UAIA 1A2TA 4U673 4C80A 3RZDB 2D62A 2K3UA 1G2SA 1DOKA 1WTRA 5KYLA 1GHKA 5IGDA 1HZ5A 2XSCA 2QDBA 1WVLA 1ML0D 4ZUIA 5KRUA 5CV7A 3AE2B 1E2VA 1AP0A 3M3YB 4DK1A 1SNPA 2DYMA 3VQIA 3D4RA 1STBA 5G5GA 1B44D 4J1MA 4HN7A 1E0ZA 2XIWA 5C3XA 3K5MA 1EIHA 1E10A 4KD3A 1L0XB 1PGBA 2R7ZB 1EYAA 1EYDA 3IKJA 4B9WA 1JALA 3M4OB 3P4QB 4FF3A 1YMHE 1LT5D 4BY1B 2LY7A 4FO2A 5IGCA 4REZA 1C48A 4J8QA 1TWAB 1C4PA 4RH6A 4TMAB 1DD2A 2Z8LA 2R61A 3AB9A 3DHQA 3Q0AA 3LNNA 1JWAD 1SDFA 2BDOA 4DNTB 3DMUA 2EVBA 3IAYA 1I7HA 2N0SB 1A2UA 3NVWA 3W5UB 4A3JB 3S1MB 1CZPA 4L8JA 1GXDC 2IWHA 4KKUA 1IKLA 1FEHA 1C76A 1Y1WB 2BT6A 2ZW1A 3GB1A 4M1UB 4IUPA 1NSNS 2F0VA 4H7BA 2FINB 4ABNA 4A3KB 2JEAI 3WDNA 3AEDB 2CJOA 3NZ3A 2DYOA 4MHEA 2ICEC 1BCPF 1ACCA 1RWSA 1D6EC 5CBAE 2K7VA 1LTRD 4N58A 1N5XA 3TZUA 3I4NB 3S15B 2E6XA 1HZ6A 5E4XA 3R2TA 2W3RA 1IYVA 3C46A 1VZ7A 4I65A 3J80E 2AX5A 3NHHA 5CGKA 3HUIA 1U9RA 1EY6A 4L23A 2X6LA 3L7ZC 3B9JA 4TQ0A 4ILWA 3N6RA 1MHXA 3I9V1 2K6AA 2DLBA 2EELA 2KCNA 1ZUD2 3P1MA 3S1NB 4K5WA 4L1BA 2MP1A 2EY6A 3NPPA 1EY9A 2EY5A 1TKYA 2QMTA 2K04A 3E6ZX 5E1FA 1FD7D 2QILA 3KUPA 3MEHA 4ZLTF 1AN8A 1WTPA 4C3HG 1WWTA 1UNSA 3BVGA 2J4XA 5C4XB 1Z47A 3K5NA 5DM63 1PFBA 2QEJC 1XLQA 2A6HC 3K7AB 4IDIA 2FJ2A 1KDBA 3QJYA 4A3MB 4ZK9B 3CIRB 1EWCA 3J81L 2A69D 1E0BA 1HQRD 3VA5A 3HEJA 5BMGA 4JWUC 2MEKA 4OZCA 2B2UA 2NBFA 2G1EA 1KDCA 2E74C 3KBGA 2F0KA 1VDZA 2EE1A 4C3HB 3HOWB 1TZOA 1L0YB 4O42A 3RLFA 5KYIA 4OO1I 2E2IB 1DOLA 4J3OD 2WV6D 1Y1VB 2ACZB 2DNEA 1JOQA 3NBIA 2RMMA 3ZQ4A 3E56A 3S17B 1YNTE 1HEZE 5T8IA 2F0QA 4NZLB 5K36G 5M5XB 4FF1A 3VR8B 4PMBA 1KABA 5CC4A 4FF4A 1SJHD 2KQ3A 3SFDB 3CHBD 1CFMA 5CR3A 2J42A 5LL6X 2EYMA 1L4ZB 1BOSA 3TUOA 2PIAA 3GO5A 3HOZB 4QUFA 1RFKA 2K05A 5M9OA 3T13A 3S16B 1G6ZA 2HDEA 2K1BA 3MJ5A 1VLBA 3A7AB 2K5DA 2SOBA 3I4LA 5EKKA 3HOXB 3A8JE 5HURA 2F0UA 2B2YC 1UEAB 1YNNC 3N9YC 5I2YA 3NUHB 5CV9A 3HZXA 1ZOYB 1OXXK 1VF5C 3PUXA 4JWSC 4KY6A 1EFID 1XTCD 3A7LA 1FYCA 3DWMA 3NP8A 2FBWB 1PXUA 2M19A 1C4AA 2ID0A 3DM1A 2F0OA 3VYTA 4CJ1B 1XLNA 5KNBA 3FPPA 3OMGA 1WD0A 1ZXTA 3KK7A 2IGHA 4R8IA 1OFFA 3S1QB 3F2UA 1F2MA 1LTSD 2HCIA 3I90A 5CV6A 5G5HA 2M56B 2B2WC 4CGYB 2A68D 1IW7C 4ZYSA 3J9CA 1MD2D 3OWFA 2NN6I 1XCTL 1SB3C 1FNVA 4A9AA 4FYDA 3H8HA 1BR9A 3GTMB 4XQJA 4JPSA 2MJ8A 3EROA 5LHY1 2MUYA 5G3LD 5IT9L 3M7NA 1SNCA 2WDVB 1U4RA 3UI3A 1D1IA 1HTPA 3R8BA 5C3WA 2PZTA 1J8IA 4ZKBB 2H89B 2OF1A 3K0YA 5ISRA 3NRZA 3NVYA 1YNJD 3NQTA 3VA7A 5JEAJ 1D5ZC 5LL6S 3JAML 4K2LA 5FO7B 4US9A 3MFYA 1UWXA 2LUMA 1QT9A 2JYOA 4R8NA 4WWMA 1RYJA 1EYCA 2KJXA 3HOVB 3QWNA 4K2KA 1PTOB 1SNDA 2QCPX 3BDLA 3C3LA 4XT1B 2B39A 5FKAC 2N88A 2NWGA 4DAVA 2D9UA 1VF7A 5C0XJ 1IBXB 2A6EC 3E0JA 3PUYA 3T51B 3ITPA 2F4IA 1TJEA 1JB3A 3C2PA 4E6IA 3AB5A 2QJLA 1PTOF 2LEKA 2NVYB 2RKSA 3TMEA 4DXGA 5D14A 4G4KA 3Q8EA 3BS1A 4P6VF 3P1HA 1BXTA 1V43A 2WXQA 3P42A 4GDKB 1TS2A 4QB4A 4KTAA 3W9CB 5I4DA 1JICA 5KIXA 4HROA 2V3NA 4KKSA 1TVXA 2EOTA 2FMMA 5JAVA 2HDLA 5CYUA 4IQZA 1JOOA 5BYRA 2LJIA 4OGQC 4HJGE 3KLSX 3GTGB 3FAHA 1Y56A 1PZID 2X6GA 1S5BD 2K5WA 2PW7A 1Q12A 1A3VA 2BB5A 4K5XA 1QF6A 4V190 3R93A 5I6WA 1STGA 3EGRA 4OVZA 3VR4A 4O1NA 1L6VA 1JRPA 1T5EA 4RCOA 1C8CA 2WXFA 1PTOC 1RF2D 2JSVX 3MXNA 4A3DB 2ENBA 4BBSB 1ET9A 1R4QB 2IX1A 1SFOB 2F0PA 4ULLA 2E2HB 2VNUD 1A15A 4ZRPA 2NYZD 3QOLA 1Z7TA 2PLPA 1S5FD 3SK5A 3MVVA 2AWOA 1YJJA 4FVMA 3S14B 5J1ZA 2RA4A 2VXWA 3AU7A 4AS1A 5A35A 1JORA 2ICIA 4G57A 1F9SA 3TSSA 4PMCA 2PMVA 4A90A 5J39A 2R3ZA 1JR0D 1G8ZD 1NR4A 3V05A 3AE3B 2BTEA 1HQMC 3EUB2 5C3EB 2BE5C 1N61A 1CM9A 1DXMA 2ZW0A 3NTKA 3TEXA 2G9DA 3MTSA 2F0JA 1FCLA 5EPLA 1GUWA 4OO1G 1JC7A 1LV9A 2VB3X 1DGJA 2L83A 4PT5A 3TEZA 1EY8A 4QMGA 2BCOA 2E3TA 4DA2A 5DNFA 3BVMA 1RTOA 2ZXPA 3O13A 1U4LA 5DAUA 1E7PB 1DYQA 1PUTA 1EY0A 5BN3A 2IX0A 3IAM1 1F0ZA 1ENAA 2MGSA 1K53A 2BS3B 2WXOA 4S3SA 2WU2B 3ETRA 1QG7A 4HKQA 1LT3D 1SNOA 1OXTA 1CA5A 1ENCA 1S5CD 3V2TA 1XX8A 1TKGA 2N9LA 1PZJD 1LT6D 3P75A 5HI1A 1HA5A 1K52A 1OXUA 2XWBB 4IALA 4K6LA 4IFDJ 3Q8FA 2V4IB 4HAEA 2BYTA 3TN2A 2FE8A 1ZEQX 4FP5D 3Q22A 1NYRA 2KQ4X 3VR6A 1JROA 4AQ7A 4IURA 2IGGA 1F2ZA 3TP7A 1BBXC 2LGIA 1CZWA 3P63A 5C4HA 2FFKB 1Q90A 2VB2X 2CW0D 1SYGA 2AQ1B 3I8ZA 3SK4A 4RWSC 3AMUA 1ESRA 1B4OA 2F0DA 2LFNA 2VZKD 4YWGG 3GTJB 2JU6X 2IX3A 3EVQA 1PMRA 2CHBD 2TMPA 1KH0A 3TP8A 1RCVD 2WDRB 4R3DA 2B2TC 3PZ7A 2DY8A 4WORA 1QOGA 3I70A 1HPCA 1EM7A 1B9RA 4JX1C 2NB0A 1YN3A 5E3FA 3VRBB 2HDMA 1XWEA 4KX6B 1DM0B 4PNYA 2WACA 3GTPB 3TDQA 2RSNA 1Q8IA 1JWBD 1OXSC 5I9OA 1IKMA 1V1PA 1STYA 5JEAH 1FR3A 1SYFA 3FVQA 4RHSA 1L4DB 1RKNA 3PO3B 1VZ6A 3GP7A 1YQ4B 1I4QA 4GDLB 2E76C 1WSPA 4H0LC 3G7LA 2MHVA 2ON8A 1MSHA 2NVXB 4L2YA 4B08A 4ZKCB 3A54A 5C0XH 3Q8AA 3SR6A 5EGTA 1QOFA 3RD4A 2F0NA 2W54A 1OO9B 1SMYD 1Y8PB 3U7ZA 3AECB 3DWAA 2FHTA 2RQXA 5JVH3 1N5WA 2LHEA 4PMWA 1ICWA 1TS4A 3MXPA 4NKLA 4X3UA 1LO5D 5JPNC 3FILB 1PYWD 4XYQA 2YU9B 3HRDD 4PQXA 5D65A 4MH8A 3P4RB 1BCPB 2LS01 3B2GA 3PMFA 1KRHA 1LTID 1YN4A 1TYGB 4KN7C 2JYTA 4NDXA 4XDXA 2D5DA 3OHXC 4HEDA 1ZYRC 3CKIB 2WAQB 5K5PA 3J80L 1ILPA 5AFWA 1J7BA 4CBVA 2PW5A 3NS1A 1CZGA 1A3TA 1XEEA 1DOYA 3AN1A 4GLSC 2IL8A 2A73B 1GUGA 2JWUA 1T6BX 3V96A 1LTBD 4WQMA 3HOUB 1F2RI 1ZE3D 2Y5CA 2RVLA 3ERQA 3IT6B 3SDZA 4KK7A 1Q1BA 2ZXRA 1Z6HA 1QJOA 4FXGC 1IUEA 4WIPA 2PCFB 5JJZA 1FRDA 3IAS1 1PZKD 3M4YA 1HFGA 1YN5A 1GPXA 2H4OA 1WXQA 2F1MA 1JQ4A 1STHA 3RMHA 5ELEA 2NUCA 3TEWA 4ME5A 1IGCA 4KGRA 2I2YA 2AQ3B 2A5HA 1TU2B 4OL7A 2LMCB 3FEWX 4KGSA 2KEEA 5CBEE 1C78A 1H9SA 1T3QA 4CQNA 2EY1A 3BK2A 1ET6A 3CU7A 2K0PA 2KN4A 2WXPA 2Q5WD 4BA1I 4NJCA 1X3PA 2XNAC 1BCPC 5M5YB 2JA8B 2N7JA 2L12A 3DWGC 2BA1A 4FXCA 4IN3A 1ESFA 4A3GB 3SK6A 4EQNA 1JMLA 1L6UA 4XIGS 3RZOB 1QNKA 1GJXA 1EIGA 1G91A 1EWYC 1ZP0B 2L0CA 1CK1A 1LTGD 2Q8TA 3J7AV 1XXGA 3B2FA 1EL0A 3GS2A 2GI9A 4HCEA 5ELDA 4DU9A 3I72A 4B0MA 3GTKB 1NI3A 1W6JA 1RODA 1VMPA 2WKDA 1K8OA 4Q5VA 2Y3AA 1I4RA 5EE3A 1VMCA 1FCCC 2EYLA 1YQ3B 4MIUA 3PV0A 5ELFA 4KGTA 3MA2B 3W3AA 1MSGA 4B9XA 4IFDH 3OMCA 1VCIA 3D4DA 4Q0FA 2O2LD 3L4PA 1SE3A 2NTSA 2XRSD 2SNMA 2QIEB 3H91A 4DAYA 1HFNA 3QIAA 4LJZC 2K03A 3KF8A 2WINB 4OIJA 5CV4A 1D2BA 3I57A 2INPE 3BYYB 2R6GA 3Q69A 2MJDA 2A68C 2A6HD 1CA6A 3U2SC 2B8GA 1I4PA 1TWGB 2JA7B 2Y5PA 4N59A 1EWHA 4DF7A 1ENFA 4WAFA 3FC4A 1TT2A 3LX0A 2Z4IA 4NP5A 5F2DA 2JA5B 1LLRD 3NTHA 2PYKA 3R2IA 5LNK1 2NMQA 4IUUA 4M0WA 3NWTA 2BS4B 2DWQA 3A8KE 4DNRB 2D5GA 4XTCS 1HUMA 2B2VC 1YNJC 3DUZA 3MFGA 3MXUA 1TY2A 3KWLA 1JE4A 5FO8B 2RSOA 3BIID 2PMZB 1QCBD 4ARCA 5EPKA 3SXHA 3ZJTA 1LT4D 4JK1C 1SE4A 2JEBI 3BDCA 1HA6A 1L5PA 2BBCA 2L52A 3NVVA 4RF1A 2NZ1D 4FXDA 1BMLC 1C9FA 3AE7B 3SK8A 4F7XA 5EE1A 2F0HA 5FLXE 4OHJA 5I6YA 2PVGC 2NTTA 3MP9A 1IYUA 3MZ5A 4KN4C 1QE6A 2EZVA 4A93B 2KECA 2F0FA 3DWPA 4RKLA 2HTME 1GAQB 3FKIB 2B76B 3GQBA 2DY7A 2M0AA 1WTOA 2J52A 1YNND 2BA0A 2M2LA 4YTNB 1E9MA 3S1RB 3NTIA 1MI0A 3K59A 1IL8A 3BZDB 2WS3B 1SNQA 1LABA 1SXTA 1N63A 3TP6A 3OPOA 2F03A 2IJ0A 1U4MA 2B63B 3K6OA 4BS9A 2GB1A 2K5PA 2DNCA 3HVDA 1TQOA 1V1OA 3HS0C 4OW0A 2LKVA 4AYBB 5C4ZA 5D7GA 5IGEA 3OWEB 3BK1A 5MPOA 4HSPA 2KUMA 3GD7A 2F0MA 5E6JA 4TKOB 4QIWB 1IW7D 1AZPA</