4DWFA

Crystal structure of a hla-b associated transcript 3 (bat3) from homo sapiens at 1.80 a resolution
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
79
structure length
79
Chain Sequence
GEPDSLEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGKVIHLVERAPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords HLA-B-associated transcript 3
publication title Crystal structure of a HLA-B associated transcript 3 (BAT3) from Homo sapiens at 1.80 A resolution
rcsb
source organism Homo sapiens
total genus 17
structure length 79
sequence length 79
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4dwfA00
1WJNA 4TUUA 2CHZA 1YX5B 1WFYA 1UZXB 4JLCA 2KDFB 1R4MI 2R2OA 2LGYA 4W9HA 1WXAA 4W9IA 2NCNA 3WAPA 3KUDB 3X23A 2FCNA 1WR1A 4K7SA 2RPQA 2XK5B 1WXSA 2JY6A 5AZHA 4MEMA 2L8JA 1J0GA 2JRHA 1ZKHA 3LJ3A 3IHPC 2KWCA 4GGQA 2KKCA 1KOTA 4X57B 2C60A 2K1FA 2MRPA 4OVVA 4XZ4A 1H4RA 2FIDA 4I6LB 3T9LA 2KNBA 3JW0X 3N32A 2DYOA 2XEWA 4ZRIA 3B1LX 3JSVB 3PT2B 2MW5A 4JQWC 2KTRA 1WR6E 4NJ6A 2CS4A 3ZIMA 2KDBA 3I3TB 2ZZPB 3VTUA 2KLCA 1WY8A 2G45B 2KX0A 2M17A 4BFRA 4WQOB 4IW0A 2KTFA 2KXJA 2LJ5A 3HM6X 4MJSA 3VAWA 3ZNID 3L17A 1WJUA 5L95C 4HWIB 4KV2A 3R66C 3OJ4B 1OQYA 4GIVA 3L16A 5JHAA 2LI5A 4FJVB 1WI0A 2Z0DB 2N4FA 4HLEA 4GDLA 1ISNA 1WIAA 2K8BA 2KWVB 2O6VD 3KUZA 3RZFA 4DHZE 3WANA 1I35A 1RFAA 3DCGA 2V4LA 2ZPYA 4MGZE 2HD5B 3WAMA 3OAWA 2UWQA 3NZSA 2KFKA 2KX3A 1WJ6A 2RD0A 3QQ8B 4DHJD 4EEWA 4PS7A 1R4NI 1JRUA 4GDKB 1NDDA 1S3SG 1Q1OA 3K9PB 2V3SA 4GN1A 2HTHA 2EMTA 3ZTCA 3PS6A 3EHVA 3QA8A 3N30A 3AI5A 3RUIB 4W9CA 1E8YA 3ZDTA 4AWJA 4ANUA 4II2B 4DHZB 2N7EA 1WXMA 4KDLB 3L08A 3PHWB 2YLMA 3QWZB 1V80A 4A3OA 1ZW7A 3HIZA 1U4AA 4B95A 2J7QB 2C7MB 1WH3A 1RLFA 4TKNA 3PZDA 4WWPA 3T8MA 3ZRFA 3IVFA 3L10B 1WXVA 3VQIA 2MBBB 5J2RA 2MP2A 4HJKA 2KO3A 1YD8U 2MQJA 1GNUA 5CX3A 2LVOA 3HK0A 4NAWB 2C7NB 2DZJA 3EC8A 5DCNA 5LLIA 2K39A 4EZJA 2IO1B 2QHOA 5CTRC 2NBWB 4W9DA 2O6VA 5D94A 2K25A 2IY0B 2AL6A 3A4RA 3DVGY 4HXDA 1GC7A 1KJTA 2WX1A 3PRZA 3RYTA 2M4NA 3ML8A 5KHQA 1V6EA 3NHEB 2LD9A 1G6JA 3VTWA 2N9XA 1PQSA 4RM9A 2DAFA 4PYZA 4DBGA 3N3KB 3APFA 1V2YA 4K1RB 4ICUA 4K7WA 2NVUI 3W1SC 3L13A 1TBEA 3NY5A 2HE7A 1P98A 2CKHB 1EF1A 2PJHA 3JVZX 2DAJA 1E5WA 2JWZA 2IYDB 4WJNA 2JXXA 2LRWA 4DK5A 3PSEB 1NI2A 4G11A 5D6JB 3V6CB 3PLVA 3RD2A 4KIKA 2IO0B 2KJHB 2KTRB 3L54A 5DPRA 4DDID 3PPAA 2CU1A 2MA9B 3V61A 2G3QB 2PEAA 4NNJB 2CHWA 2LXAA 1S1QB 4MGIE 2RGFA 3H6NA 4DDGD 3PHXB 1SGHA 3V62A 2KJ6A 3A9JA 5D2MB 2C5LC 2D07B 4MJSB 4AP4C 3ML9A 2BWFA 4IUMB 4ZRKA 4ZDVA 1EF5A 2J0KA 1V5OA 4LDTD 1KM7A 2KMAA 3ECIA 1QZEA 2FIFA 3PREA 4RM8A 4F7ZA 3PTFC 3ZW3A 2N9PC 1XD3B 2KVRA 1WYWB 3AULA 4K7UA 3SDLC 4MELA 4GDLB 3ZNGC 4FA6A 4F1SA 1Q5WB 1RAXA 1T0YA 2KHWB 2NBUA 3L0WB 3MHSD 2LASA 3R3MA 3MTNB 1YIWA 4TV3A 3WA0A 4EKUA 2LVPA 4KSKC 2ZCCA 1OGWA 3KVFB 5JZEB 3AXCA 2KFKB 1TTNA 3UQBA 2EKEC 2JPHA 2D10A 2L0FA 4URKA 1XQQA 2NBVB 2Z0EB 2NPTA 1TZ1A 2M8SA 3QAQA 2FUHB 4MGYE 1FXTB 1WMHA 2MBQA 4FULA 3IG3A 1WGYA 2KC2A 1WM2A 3WAOA 3DOWA 4ZRJA 4EZLA 3DBLI 3CSTA 2OOBB 4ANWA 2LXCA 4KVGB 3TBLD 1P9DU 1EUVB 2HJ8A 4NJ7A 2KWUB 2KQ7A 1H8CA 1L2NA 2AEHA 4EZKA 4KZ0A 4GU2A 2I1JA 4IM3A 2ASQA 5HKHA 1UBQA 2MP2B 4W9FA 1L7YA 2Z59B 1WX9A 3A1QA 4N9F4 4II3B 4W9JA 1C3TA 2ZVOA 2KANA 4GB9A 4XC2A 3ZDMC 3GZNI 2O6VB 4F8CB 4BKGA 1UBIA 1WX7A 1V81A 2M0XA 2MCNB 5J17A 2O2VA 4WWNA 3ZRCA 2N1WA 3DBRI 3JYUA 3CMMB 3Q3FA 2ZCBA 3ZNHB 4A20A 4BOZB 5CHVC 4FBJB 2FAZA 2REXA 4DHJB 1LQBA 3PVLA 3IFWB 4I6NB 4M8MA 4WJPA 2AWTA 4FJYA 4KDIC 3QX1A 4KSLC 1WE7A 1Y8RC 2K6DB 3ZUNA 2KN5A 5IA7A 2KOXA 2D3GA 4CO7A 2GBRA 2KLGA 2KJRA 2ZNVB 2J0MA 2KZRA 3M95A 5TR5A 3UINB 1E7VA 3UF8A 2BPSA 4KIKB 3DVNU 2WDTB 3D32A 3PRMB 3V60A 1V5TA 2ZEQA 3ENEA 4MSQB 4NQLB 1GUAB 3B08A 4M0WB 4P7IA 3ONSA 3EECA 1C1YB 1WGDA 4DXAB 3A9JB 4TQ1A 3DBHI 3A9KA 3APDA 5L83A 1RRBA 2BGFA 5C1ZA 1F9JA 2BWES 2L00B 4PS3A 4WAAA 1WZ0A 2DZIA 4CYEA 1IYFA 1WJ4A 2MX2A 3H1UA 1LM8B 4EFOA 2LGDA 4FHKA 1J8CA 2DZKA 5D7GA 3VH3B 1WZ3A 2AL3A 2N7DA 3KH0A 5DPSA 1WGHA 2A5UA 3RT3B 5JHBA 4MSMB 3BINA 3QC8B 4W9KA 4W9EA 4RMAA 1E90A 3CF6E 2N1VA 4W9LA 4HPMB 3TIXA 4LJPB 2R2QA 4WJOA 2GBMA 3H7PA 3QCAA 1E8ZA 3VHTC 5AEKB 3SU8X 1KLVA 2WWZA 3TMPB 4HVBA 4LCDE 4WJQA 4G50A 1MG8A 3R7RA 4EOYA 5E6OA 2NPTB 3LDZE 4MGKE 3UGBB 2GBJA 2MSED 2KMCA 1WMHB 1CMXB 2JRIB 2L76A 2FCMA 2KQSA 3WIMA 2BYEA 3ZO5B 1A5RA 3QK0A 3ZKJC 2M1MA 3EFUA 2EMSA 5BO4B 3VUWA 3ZNZB 3APCA 1TGZB 5G2NA 3K9OB 1GC6A 3NOBA 4HDOA 2ZVNA 4MDKE 4PYUA 2MBEA 2CR5A 1WRDB 2Y5BB 5JH5C 2NS5A 2KDEB 3QARA 4IC7B 1OEYJ 2BF8B 2LZ6A 2DX5B 4PS8A 4LDTB 5E6PA 3A1QB 1IPGA 4G3XB 1I42A 4BVUC 2JZ3B 4HK2A 1GJZA 4GOCA 1LXDA 3O65B 3OJ3A 1X1MA 4XX5A 2MBOA 2BKRB 4GXBA 4ICVA 2FCQA 4BBNC 1WGGA 2VRRB 2O2VB 2JVCA 2PE9A 1EO6A 5CHFA 4NQKE 1YQBA 2CHXA 3PGEA 3A33B 1P3QU 1WX8A 5EDSA 1J19A 2LUEA 3V6EB 2C7HA 4AJYB 3TJPA 5FR6A 4B6WA 1Z5SB 3R7QA 2D11A 5DPWA 1YJ1A 3DQVA 1GG3A 4LJOB 2OJRA 2L05A 5AZGA 2DENB 4I6PA 2DYBA 3TCAA 4IWQA 4DWFA 4EUTA 2L7RA 4HCPB 1WF9A 3RULA 4GMVA 1WM3A 3QHTA 3KUCB 4JGHB 3ZVVA 3PLUA 2YVCA 4IG7B 2FNJB 2JZZA 2D2QA 1K8RB 2AYOB 5KHOA 3NZUA 3RCZA 2FCSA 2JUOA 2UYZB 1P0RA 4B9KA 3PV1A 5J18A 3VFKA 1NBFC 4MM3A 3ZLZA 4BKSD 3A4SC 4CHKA 1E8XA 1ZGUB 2KFJA 1BT0A 3A9KB 3VUYA 3OLMD 3DVGX 2K8CA 1VCBA 1E8WA 4NPNA 2IO2B 2XK5A 2RSUA 2V1YA 1UD7A 3AU5A 5LXIB 2W9NA 2XBBC 2DYMA 2K6QA 2BKFA 2L0TA 2LGXA 2LRUA 5LXHA 2L3ZA 4HDQA 2IY1B 2KDIA 3SD5A 2KD0A 3HM3A 4IWOA 3UQAA 1IP9A 2C9WB 4BKTA 2I1KA 1UGMA 2BYFA 3JSVA 3SHQA 2JF5A 4MH0E 1SIFA 3H7PB 5AZFA 1XT9B 4ASWC 2GOWA 2RR9A 2WYQA 1E7UA 3U30A 1D3ZA 1V9JA 4YL8A 3B0AA 4G0NB 3RZWC 3DVNV 5E6NA 1WE6A 4ZYNA 1WGRA 4FLHA 4M8NA 4A3PA 3Q3JA 4E3CA 4TQ0A 1SE9A 1LFDA 2IBIB 3P2BA 3S2AA 3VXWA 4FADA 3M3JA 3MJWA 2B3AA 3VTVA 4AOFA 4IWPA 2ZPNA 4HPLB 2LWPA 4IM2A 2GBKA 2NR2A 1VD2A 4IM0A 4NY0A 4W9GA 3GOEA 3UIOB 4BBNF 3KYCD 2J0JA 2DZMA 1UELA 4FN2A 1OEYA 2MWSB 3QIJA 2WX0A 4BKSA 4BOSC 3UIPB 4E74A 3AU4A 2MLBA 3X0WA 1HE8A 2IZVB 2JT4B 1M94A 3DBSA 2BYVE 2G4DB 3W1SA 4GDKA 3PRPB 3U7DA 2K8HA 2IO3B 5IAAC 3VUXA 4FHJA 3H9DA 1Q0WB 2GMIC 5DPTA 2MBHA 4ANVA 3IBEA 4KZCA 5C23A 3VDZA 2G4SA 3BY4B 4HCNB 3U8ZA 4K81A 2ZNVC 3M63B 2KC1A 3W1YA 1Z2MA 4WWOA 2PE6B 2ZJDA 3KW5B 1UH6A 1YX6B 1V86A 4JL9A 4AUQC 4GSWA 3KYDD 4J6IA 3WALA 1V49A 1AARA 2PPHA 3CSFA 3C0RB 5CHWA 5G55A 3ZTDA 4OVUA 3DPDA 3M62B 3VVWB 4FJZA 2LVQA 1P1AA 3DDCB 2DHZA 2A4ZA 2GBNA 3ALBA 4NAWA 1OTRB 3H7SA 4JIOU 2N9EB 3TL5A 3NS8A 3VH4B 3QJZA 4AJWA 4ANXA 4E71A 2KK8A 3HHMA 5GMVA
chains in the Genus database with same CATH superfamily
5HG2A 4ARIA 4B0MA 1WFYA 2LGYA 3KUDB 3AEBB 2FCNA 1WR1A 2GB1A 2JY6A 4MEMA 2L8JA 2JRHA 1ZKHA 4M01A 4GGQA 3AE6B 1JWSD 1ZE3D 2CJNA 4X57B 3L4PA 2JXTA 4ZRIA 3BZDB 3KQ4A 1QLBB 2BBCA 3AN1A 2RDBC 2RPVA 2KLCA 2KX0A 4WQOB 2K0PA 4MJSA 1AWDA 4XWWA 1XCTL 3UI3A 1WJUA 2V4IB 5H92C 5BYRA 1ISNA 2WLBA 4XDDA 4DHZE 1I35A 1QT9A 2HD5B 4C80A 3OAWA 2UWQA 3NZSA 2NMQA 4EEWA 4PS7A 1JRUA 1NDDA 1JWMD 1S3SG 3I9V1 2EMTA 3ZTCA 4D2KA 4C00A 2MEKA 4IOIE 4AWJA 4II2B 3AECB 1JALA 4OVZA 2YLMA 1QILA 1V80A 1AN8A 1WH3A 1I4XA 2MP2A 2BS4B 4HJKA 2KO3A 1YD8U 2MQJA 1GNUA 5DCNA 4EZJA 2IY0B 3PRZA 3AEDB 5KHQA 1V6EA 2BB5A 5G5GA 2N9XA 4PYZA 1V1OA 3FC4A 2WS3B 4ICUA 1AYFA 3W1SC 3L13A 2HE7A 1FFVA 2JQRB 1E5WA 2JWZA 3PSEB 3V6CB 2YEPB 3L54A 2PVGC 5DPRA 3SEBA 4WAFA 4DDID 3PPAA 3V61A 1SJED 1ZP0B 3TEYA 3PHXB 1EM7A 2KJ6A 4AP4C 4MJSB 4ZRQA 3IT4B 3AE4B 1EWYC 1V5OA 4LDTD 2BS3B 4N6EB 3ECIA 4RM8A 2OEDA 3FAHA 4F7ZA 3PTFC 3ZW3A 2N9PC 1XD3B 2FBWB 1WYWB 2LJIA 4MELA 3ZNGC 3R3MA 1RAXA 3Q8CA 2LASA 3R8BA 4EKUA 3P4SB 2L83A 1OGWA 2ZCCA 3KVFB 1TT5B 2JPHA 2D10A 1KH0A 4KKIA 4YTNB 2NBVB 2Z0EB 2TSSA 3SR6A 3RNFC 4A55A 3QAQA 4WIPA 1WMHA 2Q5WD 3WCQA 2H89B 1N63A 3CSTA 2OOBB 3P1MA 1ZUD2 1IGDA 1EUVB 4NJ7A 3B9JA 4TMAB 2OJWA 2I1JA 2RDGA 2JSVX 2MP2B 1L7YA 4N9F4 4WQMA 1C3TA 4P1CC 1RM6C 3NRZA 3BVMA 5J17A 2MCNB 1C79A 3CMMB 3HRDD 4FBJB 3RFZB 1E9MA 5EE1A 4NAMA 3OG5A 1F2RC 1HZ6A 3ZUNA 5BMGA 2ZNVB 5G5HA 2J0MA 2KZRA 3M95A 1E7VA 1MPEA 1ET9A 1L4DB 3AEFB 2ZEQA 3VRAB 4M00A 4LTUA 3B08A 4TQ1A 3APDA 5L83A 2D5GA 2MJ3A 2L00B 4M02A 1N61A 2GI9A 2MX2A 3H1UA 1J8CA 2DZKA 5D7GA 3VH3B 3KH0A 4REZA 3RT3B 5JHBA 4RFBA 4W9EA 2YEPF 3TIXA 3H7PA 3QCAA 1E8ZA 1JWAD 1TIFA 2UU7A 2WWZA 3TMPB 4LCDE 4EOYA 2PW9A 3RNBC 4B0EA 1L0VB 1WMHB 2L76A 3ZO5B 1A5RA 3QK0A 3Q3MC 3DHHC 2M1MA 2BTEA 3VUWA 3ZNZB 3APCA 1CK1A 2INDC 1WRDB 2BF8B 5E6PA 4BVUC 3IAS1 3RPFC 2VZKD 1LXDA 3OJ3A 1TS5A 4ICVA 2FCQA 3ETRA 1KF6B 5EDSA 2AX5A 3V6EB 4AJYB 1Y56A 1Z5SB 5DPWA 2N7JA 2OJRA 2HJ1A 2DENB 5D3DA 4DWFA 1WM3A 2D3AA 3AMZA 3QHTA 4P1BC 4LNIA 3E9SA 4JGHB 3B2FA 2FNJB 2JZZA 2D2QA 2AQ3B 2AYOB 3AE8B 4B9KA 1NBFC 1ZGUB 1I4PA 1E8WA 2X8XX 2RSUA 3Q3NC 2W9NA 2XBBC 1F52A 2K6QA 2KD0A 4IWOA 3EUB2 2BYFA 3SHQA 3H7PB 2INPE 4L2YA 4ASWC 2RR9A 3DVNV 1PGBA 4ZYNA 3Q3JA 1SE9A 2IBIB 3S2AA 4BAXA 3VXWA 4FADA 2WQYB 2JZPA 4RGOS 3VTVA 4AOFA 4IWPA 1CJEA 1KTKA 2LWPA 1VD2A 3AEEB 1I7HA 2BS2B 3GP7A 2W55A 1FCCC 1UELA 2LMCA 3UIPB 2G1EA 2B76B 3DBSA 4GDKA 3PRPB 5FR3A 2IO3B 1QQRA 3H9DA 4EE2A 1R7SA 5DPTA 1I4GA 3GE8C 5C23A 1J7CA 3BY4B 4KGRA 4QAYA 4K81A 3BK2A 1KLGD 3W1YA 3Q2AC 4WWOA 1YX6B 3KYDD 1F77A 1V49A 2V9HA 2PPHA 3CSFA 5CHWA 3ZTDA 3HVDA 3PZ7A 2WDRB 1IUEA 2H88B 1TKEA 2GBNA 3TL5A 3NS8A 4ANXA 4HRSA 1SB3C 1WJNA 2WXKA 2CHZA 1YX5B 4JLCA 2R2OA 4W9HA 3AH7A 1L5PA 1XO3A 3MHZA 3X23A 2M0AA 4L1BA 5AZHA 2IPKD 1SF0A 1J0GA 1XCQL 4OZCA 2C60A 2E6XA 2FIDA 4WWMA 2DYOA 2MW5A 3HUIA 2KTRA 1WR6E 1TKYA 2KDBA 3TEZA 1WY8A 2G45B 1P7EA 1L0YB 2KTFA 2KXJA 2LJ5A 1RFKA 4C7ZA 5L95C 4KV2A 3R66C 2KWDA 4GIVA 5JHAA 4HLEA 4GDLA 1WIAA 2K8BA 3I5JC 3ZXVA 3KUZA 1VR9A 3WANA 2ZPYA 2KFKA 2KX3A 3QQ8B 1R4NI 4GDKB 1TKGA 3K9PB 2V3SA 2HTHA 2NTSA 1STEA 1DYQA 3QA8A 5AUKA 1JQ4A 1N60A 1E8YA 3GB1A 1WXMA 2DWQA 3L08A 3PHWB 4B95A 4WWPA 3L10B 1WXVA 2AQ2B 1VDVA 4N58A 5CX3A 2LVOA 4LNFA 2DZJA 2K39A 2IO1B 2QHOA 2O6VA 2AL6A 3DVGY 1KJTA 1YMHE 1SIJA 3RYTA 5T8IA 4AQ7A 3VTWA 1PQSA 4RM9A 2DAFA 2VH2A 4K1RB 3APFA 5C2TB 1N5WA 2PJHA 3JVZX 4JX1C 2IYDB 4WJNA 2JXXA 3PO0A 2Y5CA 3T3NA 5D6JB 2INNE 3RD2A 4KIKA 5JXVA 2KTRB 3TSSA 1FIQA 2CHWA 1S1QB 3LXFA 4MGIE 2RGFA 2M56B 3V62A 2XN9C 3RNCC 2D07B 3RNEC 4IUMB 1K51A 2KMAA 3PREA 2FIFA 4K7UA 2KVRA 3AULA 3SDLC 4GDLB 5AUIA 1OQRA 1I4RA 1Q5WB 2KHWB 1T0YA 1YIWA 4TV3A 1FD6A 2IDYA 2KFKB 3VR9B 1DOIA 2Y5PA 3BK1A 2MHJA 1F2RI 1WGYA 2ICIA 1K50A 2W82A 2HDEA 2RMMA 4EZLA 2VH1A 3DBLI 3Q8EA 1SJHD 5I4DA 4GU2A 4IM3A 2ASQA 2IGGA 3GZNB 3A1QA 4II3B 1I4HA 2KANA 4GB9A 5H8YE 3ZDMC 2BYTA 1SE2A 2O6VB 1WX7A 3KLSX 1IGCA 4WWNA 4LLGM 2N1WA 3DBRI 3C8YA 3JYUA 4RF0A 4A20A 2FAZA 4DHJB 3PVLA 4I6NB 1V1PA 2AWTA 4FJYA 4KDIC 3QX1A 3NJTA 1Y8RC 3T3OA 2KN5A 4A8XC 5IA7A 1RWSA 4C56C 4FXCA 1HQRD 3N9YC 1FXAA 4KIKB 1ENFA 3NS1A 1RYJA 3MC8A 1HA5A 1JW9D 5LNK1 3NG0A 4MSQB 1GUAB 4P7IA 1MI0A 3EECA 2LUMA 2ZW1A 1WGDA 3DBHI 2SEBD 3A9KA 4K3BA 1L6UA 4PS3A 4WAAA 2J42A 3E56A 2DZIA 3NVWA 3SFEB 4FHKA 2AL3A 2N7DA 1WGHA 3BINA 3QC8B 4W9KA 1EU4A 1GB4A 4RMAA 3CF6E 4W9LA 2WXIA 2QSDA 1FPYA 1KFYB 5AEKB 1KLVA 4G50A 1MG8A 3R7RA 1JWBD 2MSED 2FCMA 4RCOA 3WIMA 5EE9A 3ZKJC 3NVVA 5BO4B 2MJDA 1TGZB 2MH7A 4ACFA 1L6VA 3K9OB 4YTPB 2N0SB 4HDOA 2ZVNA 2Y5BB 2J4XA 2NS5A 2KDEB 4IC7B 2BB6A 1ZDXA 2DX5B 4RGNA 2BVCA 3A1QB 4G3XB 1V8CA 3U2SC 1ESFA 4XX5A 1F0ZA 2CHXA 4P16A 1MFWA 1UWXA 4HKZE 2X38A 1V1PB 3TJPA 4B6WA 3DQVA 3N20C 2WU5B 3MJ5A 1A70A 2LGIA 3TCAA 2QILA 3KUCB 2WXQA 3PLUA 2FCSA 3H8HA 5D3IB 4BKSD 4CHKA 2KFJA 3A9KB 4YSYB 3OLMD 2M19A 4YSZB 4DXFA 3TEXA 2V1YA 3AU5A 5LXIB 1TY2A 2BKFA 2L0TA 2LGXA 2LRUA 1R4NB 4NJCA 3SFDB 2IY1B 1DOXA 1SXTA 3HM3A 3UQAA 1IP9A 1GOZA 2I1KA 4H2AA 2JF5A 1QF6A 1XT9B 2GOWA 3RZWC 5E6NA 1CZPA 1WGRA 4M8NA 3N1YC 3P2BA 3M3JA 1FXIA 4IM0A 4W9GA 4XYCA 3KYCD 1D5XC 1OFFA 2DZMA 3AV8A 4YWGG 3Q69A 1C76A 2WX0A 4JPSA 1LGRA 4WH4A 2OHFA 2G4DB 3U7DA 2K8HA 5IAAC 4KX6B 2GMIC 3P4RB 2IGDA 3BIID 3IBEA 3AE1B 3U8ZA 1Z2MA 2ZJDA 1UH6A 1T0RC 4GSWA 3WALA 3C0RB 5G55A 4OVUA 3IXSA 2D3CA 2LVQA 3DDCB 3AEGB 2A4ZA 3GE3C 4NAWA 1OTRB 2QJLA 4PT5A 4E71A 2KK8A 4OVVA 3HHMA 4XGAB 2KDFB 1R4MI 1WXAA 4W9IA 2NCNA 3WAPA 1Q10A 2MJEA 3MFGA 2RPQA 3ZJTA 1LO5D 3LJ3A 4AS1A 3Q14C 3IHPC 2N9KA 1KOTA 1UUPA 2WDVB 4XZ4A 1H4RA 4I6LB 1GAQB 2KNBA 3JW0X 3N32A 2XEWA 1N62A 3MP9A 3B1LX 3PT2B 3J9CA 4NJ6A 3ZJVA 3I3TB 4XWTA 5BYSA 5IKCM 2G9HD 2M17A 3EFCA 4BFRA 2LGSA 3DBLB 3W5UB 1T6BX 3ZNID 1SEBD 3L17A 1PFDA 4HWIB 4RGMA 4YTMB 1D6EC 4FJVB 2PKOA 1M4VA 2Z0DB 1FM0D 2N4FA 2IJ0A 2KWVB 1V97A 1TS4A 3RZFA 1VRAB 2V4LA 4MGZE 3CWIA 3W9CB 1WJ6A 3DBRB 2EELA 4J3OD 4A6QA 4LK0M 3NVZA 4GN1A 3VR8B 3AB5A 1ZXIA 4LNNA 3PS6A 3AE9B 3RUIB 2ONQA 1L4ZB 1NYQA 4ZHOA 4DHZB 2QC8A 4KDLB 4JE3B 3QWZB 3AE2B 1C9FA 1ZW7A 1U4AA 2C7MB 2GLSA 1ET6A 3T8MA 3ZRFA 3EGRA 2MBBB 5J2RA 4NAWB 2C7NB 5LLIA 1ROEA 5CTRC 4IKGA 4W9DA 2K25A 1GC7A 2WX1A 3ML8A 1PGXA 3NHEB 1G6JA 5EE3A 4C7YA 2N9LA 1XLNA 4DBGA 1V2YA 4K7WA 2NVUI 1TBEA 3NY5A 3NZ3A 1KLUD 1P98A 2BT6A 2CKHB 2DAJA 2KN4A 4DK5A 1L0XB 1WXQA 1WYGA 2EKIA 1NI2A 4G11A 3PLVA 2I38A 2CU1A 4NNJB 4M0WA 3H6NA 4DDGD 2WXRA 1SGHA 2IGHA 3A9JA 2C5LC 5D2MB 3ML9A 1HXYD 4ZRKA 4ZDVA 1EF5A 1SE3A 2J0KA 1KM7A 5HHDG 2KDMA 3L0WB 5IO9A 4KSKC 3DHIC 5JZEB 2WXJA 1TTNA 2L0FA 1E7PB 1UNSA 2ZW0A 4URKA 5TSSA 1UF0A 1YN5A 4YT0B 3ZYYX 4A9AA 2FUHB 4MGYE 1PYWD 1FXTB 2MBQA 3IG3A 1PGAA 2KC2A 3P63A 2WGSA 3WAOA 3DOWA 2WXHA 3TBLD 2KWUB 1H8CA 2AEHA 2JX5A 3I57A 2Z8LA 3V05A 2Z59B 1WX9A 3BYYB 4YXDB 1FO4A 4XC2A 4F8CB 2M0XA 1YNTE 2O2VA 3ZRCA 3Q3FA 5IN7A 4DQOC 2ZCBA 3ZNHB 1AW7A 2LHDA 2REXA 3IFWB 4O1NA 1JROA 1XLPA 1HZ5A 2KOXA 2D3GA 5FKAC 4CO7A 2V3NA 2KLGA 1BMLC 2KJRA 4PK1A 3AM9A 3I63C 3UINB 2FE8A 2BPSA 2DNFA 2WDTB 3D32A 3DVNU 4ZRPA 1V5TA 2QDFA 3NVYA 3AE7B 4M0WB 2K3UA 4ZOHC 1FNVA 1DOYA 1C1YB 4DXAB 3A9JB 1JCKB 2BWES 3BYTB 1IYFA 1WJ4A 1C78A 1LM8B 4EFOA 2LGDA 4ZHPA 5DPSA 4K3CA 2A5UA 4MSMB 4MH8A 1E90A 2N1VA 4LJPB 2BW2A 4WJOA 2GBMA 3ZGZA 1PUTA 1YJJA 4WJQA 2W3RA 1B1ZA 3BVGA 4MGKE 3UGBB 2CJOA 1ZDVA 5GXGB 2KMCA 1CMXB 2FUG1 2JRIB 4OZBA 2BYEA 2W54A 2K5PA 2GRIA 3EFUA 2WDQB 3NOBA 4MDKE 4ZYSA 2MBEA 5JH5C 3QARA 1R4MB 2LZ6A 3IT6B 4LDTB 2JZ3B 1GJZA 4GOCA 1X1MA 2MBOA 2O2VB 2PE9A 1EO6A 5CHFA 1YQBA 3PGEA 1P3QU 1J19A 2LUEA 1B9RA 4UDUC 1WRIA 5FR6A 3R7QA 2D11A 1YJ1A 1GG3A 3LB8C 1PDXA 2DYBA 4IWQA 4EUTA 4HCPB 2L7RA 1WF9A 2D3BA 4GMVA 4RNAA 3RULA 3U4EG 4ITKA 2YVCA 3RCZA 5KHOA 3NZUA 3KWLA 3PV1A 3VFKA 2V0GA 4MM3A 3ZLZA 3A4SC 1C4AA 1BT0A 2LHEA 3VUYA 3DVGX 2K8CA 1VCBA 2L1AA 4NPNA 2ON8A 2XK5A 4ARCA 1UD7A 3TUOA 3B2GA 1ZPSA 3MC9A 4HDQA 3SD5A 2C9WB 4BKTA 4US9A 1UGMA 3JSVA 4MH0E 1SIFA 4S17A 5AZFA 4TSSA 3U30A 1BXTA 3B0AA 4G0NB 1WE6A 2WP9B 4TQ0A 4XE0A 2L32A 1LFDA 3MJWA 1NYRA 1HEZE 4IM2A 2ZPNA 4NY0A 2NR2A 4BBNF 2J0JA 1OEYA 3QIJA 4BOSC 3VRBB 4E74A 3AU4A 2MLBA 1HE8A 2IZVB 2JT4B 3W1SA 2KYWA 1NENB 2MBHA 3GS2A 4P6VF 3VDZA 2KACA 1YJIA 2WXPA 2ZNVC 3M63B 1E6EB 2PE6B 3KW5B 1V86A 4AUQC 3DWGC 1MHXA 2KVZA 4J6IA 1QOAA 1JWUD 2QEJC 3URYA 4FJZA 1P1AA 1C4CA 3H7SA 3VH4B 4JIOU 4MACA 1HTQA 4TUUA 3P4PB 1UZXB 4MM3B 2I2YA 5HI1A 1IBXA 4K7SA 2WNMA 3V3XA 1JRPA 2XK5B 1WXSA 2QIEB 1VLBA 5BYQA 1FCLA 2VZKB 2KWCA 2KKCA 1UWMA 3HVZA 2K1FA 2MRPA 3T9LA 5BMHA 1FNUA 1ACCA 2ACZB 3JSVB 1YQ3B 4JQWC 1FNWA 4KGSA 3Q3OC 2CS4A 2Y3AA 3ZIMA 2ZZPB 3ABVB 3VTUA 1C77A 3U52E 4GLSC 4IW0A 3HM6X 3VAWA 2R61A 1J7AA 1TY0A 1N6ZA 3OJ4B 1OQYA 1YN4A 2KAJA 3L16A 2LI5A 1WI0A 1OQQA 2O6VD 3CIRB 5EE0A 1RFAA 3DCGA 4R3DA 2LFIA 3WAMA 3EA6A 2QMTA 2RD0A 4DHJD 3RI7C 1Q1OA 2JYEA 3N1ZC 3EHVA 3N30A 3AI5A 3Q8FA 5E6JA 4W9CA 3ZDTA 1GB1A 4ANUA 1QKZA 3RN9C 4HPPA 3N1XC 2N7EA 1EU3A 1JMLA 4A3OA 3HIZA 3FILA 2J7QB 1D4BA 1RLFA 1YQ4B 1T0QC 4HROA 4TKNA 3PZDA 2WXFA 3IVFA 3VQIA 3HK0A 3PZ8A 3EC8A 3O13A 2WXNA 2NBWB 5D94A 3A4RA 4HXDA 2WXLA 1IBXB 2M4NA 4RH6A 1N5XA 2LD9A 3LYYA 3AEAB 4Q2JA 3N3KB 1D5MC 1EF1A 1QOBA 2LRWA 3FKYA 5C3JB 1NEKB 2IO0B 2E3TA 2KJHB 1MG4A 2MA9B 2KT7A 2G3QB 2PEAA 2LXAA 3W2DA 1SE4A 2KMMA 4LNKA 1FEHA 2BWFA 3ZJUA 1QZEA 1QOGA 3MC0B 1MJDA 4FA6A 4F1SA 2NBUA 3MHSD 3OWEB 3MTNB 3WA0A 2LVPA 1SBBB 1WGKA 3AXCA 3ZXRA 3UQBA 2EKEC 1XLOA 3NUHB 1XQQA 1XEEA 2NPTA 1TZ1A 2PIAA 1HTOA 2M8SA 1XF5L 1T3QA 4FULA 3U7ZA 1WM2A 3W5VB 4ZRJA 4ANWA 2PMVA 2LXCA 4OW0A 4KVGB 4HKQA 1P9DU 3DWMA 2HJ8A 3FILB 2KQ7A 1L2NA 4EZKA 4KZ0A 1K52A 5HKHA 1UBQA 4W9FA 2BQQA 4W9JA 3RMKC 2ZVOA 1E0ZA 1TZOA 1WSPA 1MHHE 3GZNI 2J53A 4BKGA 1UBIA 1V81A 1XLQA 4JWUC 1UGJA 4BOZB 5CHVC 1LQBA 4WJPA 1FRRA 4M8MA 4KSLC 1WE7A 2K6DB 2GBRA 2JYTA 4NZLB 5TR5A 3UF8A 1NVID 3PRMB 2V3PA 3V60A 1TJEA 3DBHB 1VZ7A 3ENEA 4NQLB 4RF1A 1DGJA 3ONSA 4DXGA 5HFYA 2QCZA 2K9XA 3BVZA 1RRBA 2BGFA 5C1ZA 1F9JA 4HEA1 2AQ1B 1WZ0A 4CYEA 4US8A 1WZ3A 1VZ6A 2WXGA 1KRHA 2DBYA 1YN3A 2WXOA 4WURA 1CQVA 4HPMB 2R2QA 1QOFA 2WU2B 3SU8X 3VHTC 1FFUA 4HVBA 3BWUD 5E6OA 4OHJA 2NPTB 3LDZE 5FK9C 4CQNA 2GBJA 5IOIA 3P4QB 2KQSA 2DLBA 4L23A 2WXMA 2EMSA 1K53A 2PTLA 5G2NA 1FRDA 3KWVA 1GC6A 4PYUA 2CR5A 2WHIA 2HTME 1OEYJ 4PS8A 1WWTA 1IPGA 1I42A 1TS2A 4HK2A 3O65B 3DHGC 2K22A 4JWSC 2BKRB 4GXBA 4BBNC 1WGGA 2J52A 2VRRB 3RNAC 2JVCA 4NQKE 3A33B 1ZOYB 1WX8A 4N59A 1SSNA 2PLPA 2C7HA 4HJGE 1T0SC 1EWCA 4LJOB 2XNAC 4A90A 1VZ8A 2L05A 1MVKA 5AZGA 3Q8BA 4I6PA 2L52A 3IAM1 1J7BA 1XXGA 4C4VA 3ZVVA 1TS3A 3AE3B 4IG7B 4KGTA 1K8RB 1NI3A 2JUOA 2UYZB 3AE5B 1P0RA 5J18A 3R2IA 4USAA 1E8XA 4YSXB 2IO2B 2JWUA 5MPOA 2NTTA 1BUIC 1I4QA 2DYMA 5LXHA 2L3ZA 2KDIA 1VJKA 2KQ4X 4KKJA 1GPXA 2SAKA 1TYGB 2INCC 2WYQA 1E7UA 1D3ZA 1E10A 1V9JA 4YL8A 3C19A 1P7FA 2PVOD 4FLHA 4S0RA 4A3PA 1FMAD 4E3CA 1D5ZC 3P42A 2RDHA 2B3AA 4HPLB 2GBKA 1T5XD 3GOEA 3UIOB 4XDCA 4BZAA 4FN2A 2MWSB 3ZQ4A 4BKSA 3X0WA 1M94A 2BYVE 4IDIA 2LEKA 2W3SA 4LNOA 3VUXA 4FHJA 3Q8AA 1Q0WB 4ANVA 4KZCA 1C4PA 2G4SA 4HCNB 4RGTA 2JU6X 2KC1A 1ZXHA 4OZAA 1F1HA 4JL9A 2CU3A 3Q6BA 1AARA 4MT5A 3DPDA 3M62B 3VVWB 5IP4D 3R2TA 2DHZA 4C4VB 3ALBA 1YOVB 3RNGC 2N9EB 3TEWA 3QJZA 4AJWA 5BMIA 5GMVA
chains in the Genus database with same CATH topology
1WJNA 4TUUA 2CHZA 1YX5B 1WFYA 1UZXB 4JLCA 2KDFB 1R4MI 2R2OA 2LGYA 4W9HA 1WXAA 4W9IA 2NCNA 3WAPA 3KUDB 3X23A 2FCNA 1WR1A 4K7SA 2RPQA 2XK5B 1WXSA 2JY6A 5AZHA 4MEMA 2L8JA 1J0GA 2JRHA 1ZKHA 3LJ3A 3IHPC 2KWCA 4GGQA 2KKCA 1KOTA 4X57B 2C60A 2K1FA 2MRPA 4OVVA 4XZ4A 1H4RA 2FIDA 4I6LB 3T9LA 2KNBA 3JW0X 3N32A 2DYOA 2XEWA 4ZRIA 3B1LX 3JSVB 3PT2B 2MW5A 4JQWC 2KTRA 1WR6E 4NJ6A 2CS4A 3ZIMA 2KDBA 3I3TB 2ZZPB 3VTUA 2KLCA 1WY8A 2G45B 2KX0A 2M17A 4BFRA 4WQOB 4IW0A 2KTFA 2KXJA 2LJ5A 3HM6X 4MJSA 3VAWA 3ZNID 3L17A 1WJUA 5L95C 4HWIB 4KV2A 3R66C 3OJ4B 1OQYA 4GIVA 3L16A 5JHAA 2LI5A 4FJVB 1WI0A 2Z0DB 2N4FA 4HLEA 4GDLA 1ISNA 1WIAA 2K8BA 2KWVB 2O6VD 3KUZA 3RZFA 4DHZE 3WANA 1I35A 1RFAA 3DCGA 2V4LA 2ZPYA 4MGZE 2HD5B 3WAMA 3OAWA 2UWQA 3NZSA 2KFKA 2KX3A 1WJ6A 2RD0A 3QQ8B 4DHJD 4EEWA 4PS7A 1R4NI 1JRUA 4GDKB 1NDDA 1S3SG 1Q1OA 3K9PB 2V3SA 4GN1A 2HTHA 2EMTA 3ZTCA 3PS6A 3EHVA 3QA8A 3N30A 3AI5A 3RUIB 4W9CA 1E8YA 3ZDTA 4AWJA 4ANUA 4II2B 4DHZB 2N7EA 1WXMA 4KDLB 3L08A 3PHWB 2YLMA 3QWZB 1V80A 4A3OA 1ZW7A 3HIZA 1U4AA 4B95A 2J7QB 2C7MB 1WH3A 1RLFA 4TKNA 3PZDA 4WWPA 3T8MA 3ZRFA 3IVFA 3L10B 1WXVA 3VQIA 2MBBB 5J2RA 2MP2A 4HJKA 2KO3A 1YD8U 2MQJA 1GNUA 5CX3A 2LVOA 3HK0A 4NAWB 2C7NB 2DZJA 3EC8A 5DCNA 5LLIA 2K39A 4EZJA 2IO1B 2QHOA 5CTRC 2NBWB 4W9DA 2O6VA 5D94A 2K25A 2IY0B 2AL6A 3A4RA 3DVGY 4HXDA 1GC7A 1KJTA 2WX1A 3PRZA 3RYTA 2M4NA 3ML8A 5KHQA 1V6EA 3NHEB 2LD9A 1G6JA 3VTWA 2N9XA 1PQSA 4RM9A 2DAFA 4PYZA 4DBGA 3N3KB 3APFA 1V2YA 4K1RB 4ICUA 4K7WA 2NVUI 3W1SC 3L13A 1TBEA 3NY5A 2HE7A 1P98A 2CKHB 1EF1A 2PJHA 3JVZX 2DAJA 1E5WA 2JWZA 2IYDB 4WJNA 2JXXA 2LRWA 4DK5A 3PSEB 1NI2A 4G11A 5D6JB 3V6CB 3PLVA 3RD2A 4KIKA 2IO0B 2KJHB 2KTRB 3L54A 5DPRA 4DDID 3PPAA 2CU1A 2MA9B 3V61A 2G3QB 2PEAA 4NNJB 2CHWA 2LXAA 1S1QB 4MGIE 2RGFA 3H6NA 4DDGD 3PHXB 1SGHA 3V62A 2KJ6A 3A9JA 5D2MB 2C5LC 2D07B 4MJSB 4AP4C 3ML9A 2BWFA 4IUMB 4ZRKA 4ZDVA 1EF5A 2J0KA 1V5OA 4LDTD 1KM7A 2KMAA 3ECIA 1QZEA 2FIFA 3PREA 4RM8A 4F7ZA 3PTFC 3ZW3A 2N9PC 1XD3B 2KVRA 1WYWB 3AULA 4K7UA 3SDLC 4MELA 4GDLB 3ZNGC 4FA6A 4F1SA 1Q5WB 1RAXA 1T0YA 2KHWB 2NBUA 3L0WB 3MHSD 2LASA 3R3MA 3MTNB 1YIWA 4TV3A 3WA0A 4EKUA 2LVPA 4KSKC 2ZCCA 1OGWA 3KVFB 5JZEB 3AXCA 2KFKB 1TTNA 3UQBA 2EKEC 2JPHA 2D10A 2L0FA 4URKA 1XQQA 2NBVB 2Z0EB 2NPTA 1TZ1A 2M8SA 3QAQA 2FUHB 4MGYE 1FXTB 1WMHA 2MBQA 4FULA 3IG3A 1WGYA 2KC2A 1WM2A 3WAOA 3DOWA 4ZRJA 4EZLA 3DBLI 3CSTA 2OOBB 4ANWA 2LXCA 4KVGB 3TBLD 1P9DU 1EUVB 2HJ8A 4NJ7A 2KWUB 2KQ7A 1H8CA 1L2NA 2AEHA 4EZKA 4KZ0A 4GU2A 2I1JA 4IM3A 2ASQA 5HKHA 1UBQA 2MP2B 4W9FA 1L7YA 2Z59B 1WX9A 3A1QA 4N9F4 4II3B 4W9JA 1C3TA 2ZVOA 2KANA 4GB9A 4XC2A 3ZDMC 3GZNI 2O6VB 4F8CB 4BKGA 1UBIA 1WX7A 1V81A 2M0XA 2MCNB 5J17A 2O2VA 4WWNA 3ZRCA 2N1WA 3DBRI 3JYUA 3CMMB 3Q3FA 2ZCBA 3ZNHB 4A20A 4BOZB 5CHVC 4FBJB 2FAZA 2REXA 4DHJB 1LQBA 3PVLA 3IFWB 4I6NB 4M8MA 4WJPA 2AWTA 4FJYA 4KDIC 3QX1A 4KSLC 1WE7A 1Y8RC 2K6DB 3ZUNA 2KN5A 5IA7A 2KOXA 2D3GA 4CO7A 2GBRA 2KLGA 2KJRA 2ZNVB 2J0MA 2KZRA 3M95A 5TR5A 3UINB 1E7VA 3UF8A 2BPSA 4KIKB 3DVNU 2WDTB 3D32A 3PRMB 3V60A 1V5TA 2ZEQA 3ENEA 4MSQB 4NQLB 1GUAB 3B08A 4M0WB 4P7IA 3ONSA 3EECA 1C1YB 1WGDA 4DXAB 3A9JB 4TQ1A 3DBHI 3A9KA 3APDA 5L83A 1RRBA 2BGFA 5C1ZA 1F9JA 2BWES 2L00B 4PS3A 4WAAA 1WZ0A 2DZIA 4CYEA 1IYFA 1WJ4A 2MX2A 3H1UA 1LM8B 4EFOA 2LGDA 4FHKA 1J8CA 2DZKA 5D7GA 3VH3B 1WZ3A 2AL3A 2N7DA 3KH0A 5DPSA 1WGHA 2A5UA 3RT3B 5JHBA 4MSMB 3BINA 3QC8B 4W9KA 4W9EA 4RMAA 1E90A 3CF6E 2N1VA 4W9LA 4HPMB 3TIXA 4LJPB 2R2QA 4WJOA 2GBMA 3H7PA 3QCAA 1E8ZA 3VHTC 5AEKB 3SU8X 1KLVA 2WWZA 3TMPB 4HVBA 4LCDE 4WJQA 4G50A 1MG8A 3R7RA 4EOYA 5E6OA 2NPTB 3LDZE 4MGKE 3UGBB 2GBJA 2MSED 2KMCA 1WMHB 1CMXB 2JRIB 2L76A 2FCMA 2KQSA 3WIMA 2BYEA 3ZO5B 1A5RA 3QK0A 3ZKJC 2M1MA 3EFUA 2EMSA 5BO4B 3VUWA 3ZNZB 3APCA 1TGZB 5G2NA 3K9OB 1GC6A 3NOBA 4HDOA 2ZVNA 4MDKE 4PYUA 2MBEA 2CR5A 1WRDB 2Y5BB 5JH5C 2NS5A 2KDEB 3QARA 4IC7B 1OEYJ 2BF8B 2LZ6A 2DX5B 4PS8A 4LDTB 5E6PA 3A1QB 1IPGA 4G3XB 1I42A 4BVUC 2JZ3B 4HK2A 1GJZA 4GOCA 1LXDA 3O65B 3OJ3A 1X1MA 4XX5A 2MBOA 2BKRB 4GXBA 4ICVA 2FCQA 4BBNC 1WGGA 2VRRB 2O2VB 2JVCA 2PE9A 1EO6A 5CHFA 4NQKE 1YQBA 2CHXA 3PGEA 3A33B 1P3QU 1WX8A 5EDSA 1J19A 2LUEA 3V6EB 2C7HA 4AJYB 3TJPA 5FR6A 4B6WA 1Z5SB 3R7QA 2D11A 5DPWA 1YJ1A 3DQVA 1GG3A 4LJOB 2OJRA 2L05A 5AZGA 2DENB 4I6PA 2DYBA 3TCAA 4IWQA 4DWFA 4EUTA 2L7RA 4HCPB 1WF9A 3RULA 4GMVA 1WM3A 3QHTA 3KUCB 4JGHB 3ZVVA 3PLUA 2YVCA 4IG7B 2FNJB 2JZZA 2D2QA 1K8RB 2AYOB 5KHOA 3NZUA 3RCZA 2FCSA 2JUOA 2UYZB 1P0RA 4B9KA 3PV1A 5J18A 3VFKA 1NBFC 4MM3A 3ZLZA 4BKSD 3A4SC 4CHKA 1E8XA 1ZGUB 2KFJA 1BT0A 3A9KB 3VUYA 3OLMD 3DVGX 2K8CA 1VCBA 1E8WA 4NPNA 2IO2B 2XK5A 2RSUA 2V1YA 1UD7A 3AU5A 5LXIB 2W9NA 2XBBC 2DYMA 2K6QA 2BKFA 2L0TA 2LGXA 2LRUA 5LXHA 2L3ZA 4HDQA 2IY1B 2KDIA 3SD5A 2KD0A 3HM3A 4IWOA 3UQAA 1IP9A 2C9WB 4BKTA 2I1KA 1UGMA 2BYFA 3JSVA 3SHQA 2JF5A 4MH0E 1SIFA 3H7PB 5AZFA 1XT9B 4ASWC 2GOWA 2RR9A 2WYQA 1E7UA 3U30A 1D3ZA 1V9JA 4YL8A 3B0AA 4G0NB 3RZWC 3DVNV 5E6NA 1WE6A 4ZYNA 1WGRA 4FLHA 4M8NA 4A3PA 3Q3JA 4E3CA 4TQ0A 1SE9A 1LFDA 2IBIB 3P2BA 3S2AA 3VXWA 4FADA 3M3JA 3MJWA 2B3AA 3VTVA 4AOFA 4IWPA 2ZPNA 4HPLB 2LWPA 4IM2A 2GBKA 2NR2A 1VD2A 4IM0A 4NY0A 4W9GA 3GOEA 3UIOB 4BBNF 3KYCD 2J0JA 2DZMA 1UELA 4FN2A 1OEYA 2MWSB 3QIJA 2WX0A 4BKSA 4BOSC 3UIPB 4E74A 3AU4A 2MLBA 3X0WA 1HE8A 2IZVB 2JT4B 1M94A 3DBSA 2BYVE 2G4DB 3W1SA 4GDKA 3PRPB 3U7DA 2K8HA 2IO3B 5IAAC 3VUXA 4FHJA 3H9DA 1Q0WB 2GMIC 5DPTA 2MBHA 4ANVA 3IBEA 4KZCA 5C23A 3VDZA 2G4SA 3BY4B 4HCNB 3U8ZA 4K81A 2ZNVC 3M63B 2KC1A 3W1YA 1Z2MA 4WWOA 2PE6B 2ZJDA 3KW5B 1UH6A 1YX6B 1V86A 4JL9A 4AUQC 4GSWA 3KYDD 4J6IA 3WALA 1V49A 1AARA 2PPHA 3CSFA 3C0RB 5CHWA 5G55A 3ZTDA 4OVUA 3DPDA 3M62B 3VVWB 4FJZA 2LVQA 1P1AA 3DDCB 2DHZA 2A4ZA 2GBNA 3ALBA 4NAWA 1OTRB 3H7SA 4JIOU 2N9EB 3TL5A 3NS8A 3VH4B 3QJZA 4AJWA 4ANXA 4E71A 2KK8A 3HHMA 5GMVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WJN A;  4TUU A;  2CHZ A;  1YX5 B;  1WFY A;  1UZX B;  4JLC A;  2KDF B;  1R4M I;  2R2O A;  2LGY A;  4W9H A;  1WXA A;  4W9I A;  2NCN A;  3WAP A;  3KUD B;  3X23 A;  2FCN A;  1WR1 A;  4K7S A;  2RPQ A;  2XK5 B;  1WXS A;  2JY6 A;  5AZH A;  4MEM A;  2L8J A;  1J0G A;  2JRH A;  1ZKH A;  3LJ3 A;  3IHP C;  2KWC A;  4GGQ A;  2KKC A;  1KOT A;  4X57 B;  2C60 A;  2K1F A;  2MRP A;  4OVV A;  4XZ4 A;  1H4R A;  2FID A;  4I6L B;  3T9L A;  2KNB A;  3JW0 X;  3N32 A;  2DYO A;  2XEW A;  4ZRI A;  3B1L X;  3JSV B;  3PT2 B;  2MW5 A;  4JQW C;  2KTR A;  1WR6 E;  4NJ6 A;  2CS4 A;  3ZIM A;  2KDB A;  3I3T B;  2ZZP B;  3VTU A;  2KLC A;  1WY8 A;  2G45 B;  2KX0 A;  2M17 A;  4BFR A;  4WQO B;  4IW0 A;  2KTF A;  2KXJ A;  2LJ5 A;  3HM6 X;  4MJS A;  3VAW A;  3ZNI D;  3L17 A;  1WJU A;  5L95 C;  4HWI B;  4KV2 A;  3R66 C;  3OJ4 B;  1OQY A;  4GIV A;  3L16 A;  5JHA A;  2LI5 A;  4FJV B;  1WI0 A;  2Z0D B;  2N4F A;  4HLE A;  4GDL A;  1ISN A;  1WIA A;  2K8B A;  2KWV B;  2O6V D;  3KUZ A;  3RZF A;  4DHZ E;  3WAN A;  1I35 A;  1RFA A;  3DCG A;  2V4L A;  2ZPY A;  4MGZ E;  2HD5 B;  3WAM A;  3OAW A;  2UWQ A;  3NZS A;  2KFK A;  2KX3 A;  1WJ6 A;  2RD0 A;  3QQ8 B;  4DHJ D;  4EEW A;  4PS7 A;  1R4N I;  1JRU A;  4GDK B;  1NDD A;  1S3S G;  1Q1O A;  3K9P B;  2V3S A;  4GN1 A;  2HTH A;  2EMT A;  3ZTC A;  3PS6 A;  3EHV A;  3QA8 A;  3N30 A;  3AI5 A;  3RUI B;  4W9C A;  1E8Y A;  3ZDT A;  4AWJ A;  4ANU A;  4II2 B;  4DHZ B;  2N7E A;  1WXM A;  4KDL B;  3L08 A;  3PHW B;  2YLM A;  3QWZ B;  1V80 A;  4A3O A;  1ZW7 A;  3HIZ A;  1U4A A;  4B95 A;  2J7Q B;  2C7M B;  1WH3 A;  1RLF A;  4TKN A;  3PZD A;  4WWP A;  3T8M A;  3ZRF A;  3IVF A;  3L10 B;  1WXV A;  3VQI A;  2MBB B;  5J2R A;  2MP2 A;  4HJK A;  2KO3 A;  1YD8 U;  2MQJ A;  1GNU A;  5CX3 A;  2LVO A;  3HK0 A;  4NAW B;  2C7N B;  2DZJ A;  3EC8 A;  5DCN A;  5LLI A;  2K39 A;  4EZJ A;  2IO1 B;  2QHO A;  5CTR C;  2NBW B;  4W9D A;  2O6V A;  5D94 A;  2K25 A;  2IY0 B;  2AL6 A;  3A4R A;  3DVG Y;  4HXD A;  1GC7 A;  1KJT A;  2WX1 A;  3PRZ A;  3RYT A;  2M4N A;  3ML8 A;  5KHQ A;  1V6E A;  3NHE B;  2LD9 A;  1G6J A;  3VTW A;  2N9X A;  1PQS A;  4RM9 A;  2DAF A;  4PYZ A;  4DBG A;  3N3K B;  3APF A;  1V2Y A;  4K1R B;  4ICU A;  4K7W A;  2NVU I;  3W1S C;  3L13 A;  1TBE A;  3NY5 A;  2HE7 A;  1P98 A;  2CKH B;  1EF1 A;  2PJH A;  3JVZ X;  2DAJ A;  1E5W A;  2JWZ A;  2IYD B;  4WJN A;  2JXX A;  2LRW A;  4DK5 A;  3PSE B;  1NI2 A;  4G11 A;  5D6J B;  3V6C B;  3PLV A;  3RD2 A;  4KIK A;  2IO0 B;  2KJH B;  2KTR B;  3L54 A;  5DPR A;  4DDI D;  3PPA A;  2CU1 A;  2MA9 B;  3V61 A;  2G3Q B;  2PEA A;  4NNJ B;  2CHW A;  2LXA A;  1S1Q B;  4MGI E;  2RGF A;  3H6N A;  4DDG D;  3PHX B;  1SGH A;  3V62 A;  2KJ6 A;  3A9J A;  5D2M B;  2C5L C;  2D07 B;  4MJS B;  4AP4 C;  3ML9 A;  2BWF A;  4IUM B;  4ZRK A;  4ZDV A;  1EF5 A;  2J0K A;  1V5O A;  4LDT D;  1KM7 A;  2KMA A;  3ECI A;  1QZE A;  2FIF A;  3PRE A;  4RM8 A;  4F7Z A;  3PTF C;  3ZW3 A;  2N9P C;  1XD3 B;  2KVR A;  1WYW B;  3AUL A;  4K7U A;  3SDL C;  4MEL A;  4GDL B;  3ZNG C;  4FA6 A;  4F1S A;  1Q5W B;  1RAX A;  1T0Y A;  2KHW B;  2NBU A;  3L0W B;  3MHS D;  2LAS A;  3R3M A;  3MTN B;  1YIW A;  4TV3 A;  3WA0 A;  4EKU A;  2LVP A;  4KSK C;  2ZCC A;  1OGW A;  3KVF B;  5JZE B;  3AXC A;  2KFK B;  1TTN A;  3UQB A;  2EKE C;  2JPH A;  2D10 A;  2L0F A;  4URK A;  1XQQ A;  2NBV B;  2Z0E B;  2NPT A;  1TZ1 A;  2M8S A;  3QAQ A;  2FUH B;  4MGY E;  1FXT B;  1WMH A;  2MBQ A;  4FUL A;  3IG3 A;  1WGY A;  2KC2 A;  1WM2 A;  3WAO A;  3DOW A;  4ZRJ A;  4EZL A;  3DBL I;  3CST A;  2OOB B;  4ANW A;  2LXC A;  4KVG B;  3TBL D;  1P9D U;  1EUV B;  2HJ8 A;  4NJ7 A;  2KWU B;  2KQ7 A;  1H8C A;  1L2N A;  2AEH A;  4EZK A;  4KZ0 A;  4GU2 A;  2I1J A;  4IM3 A;  2ASQ A;  5HKH A;  1UBQ A;  2MP2 B;  4W9F A;  1L7Y A;  2Z59 B;  1WX9 A;  3A1Q A;  4N9F 4;  4II3 B;  4W9J A;  1C3T A;  2ZVO A;  2KAN A;  4GB9 A;  4XC2 A;  3ZDM C;  3GZN I;  2O6V B;  4F8C B;  4BKG A;  1UBI A;  1WX7 A;  1V81 A;  2M0X A;  2MCN B;  5J17 A;  2O2V A;  4WWN A;  3ZRC A;  2N1W A;  3DBR I;  3JYU A;  3CMM B;  3Q3F A;  2ZCB A;  3ZNH B;  4A20 A;  4BOZ B;  5CHV C;  4FBJ B;  2FAZ A;  2REX A;  4DHJ B;  1LQB A;  3PVL A;  3IFW B;  4I6N B;  4M8M A;  4WJP A;  2AWT A;  4FJY A;  4KDI C;  3QX1 A;  4KSL C;  1WE7 A;  1Y8R C;  2K6D B;  3ZUN A;  2KN5 A;  5IA7 A;  2KOX A;  2D3G A;  4CO7 A;  2GBR A;  2KLG A;  2KJR A;  2ZNV B;  2J0M A;  2KZR A;  3M95 A;  5TR5 A;  3UIN B;  1E7V A;  3UF8 A;  2BPS A;  4KIK B;  3DVN U;  2WDT B;  3D32 A;  3PRM B;  3V60 A;  1V5T A;  2ZEQ A;  3ENE A;  4MSQ B;  4NQL B;  1GUA B;  3B08 A;  4M0W B;  4P7I A;  3ONS A;  3EEC A;  1C1Y B;  1WGD A;  4DXA B;  3A9J B;  4TQ1 A;  3DBH I;  3A9K A;  3APD A;  5L83 A;  1RRB A;  2BGF A;  5C1Z A;  1F9J A;  2BWE S;  2L00 B;  4PS3 A;  4WAA A;  1WZ0 A;  2DZI A;  4CYE A;  1IYF A;  1WJ4 A;  2MX2 A;  3H1U A;  1LM8 B;  4EFO A;  2LGD A;  4FHK A;  1J8C A;  2DZK A;  5D7G A;  3VH3 B;  1WZ3 A;  2AL3 A;  2N7D A;  3KH0 A;  5DPS A;  1WGH A;  2A5U A;  3RT3 B;  5JHB A;  4MSM B;  3BIN A;  3QC8 B;  4W9K A;  4W9E A;  4RMA A;  1E90 A;  3CF6 E;  2N1V A;  4W9L A;  4HPM B;  3TIX A;  4LJP B;  2R2Q A;  4WJO A;  2GBM A;  3H7P A;  3QCA A;  1E8Z A;  3VHT C;  5AEK B;  3SU8 X;  1KLV A;  2WWZ A;  3TMP B;  4HVB A;  4LCD E;  4WJQ A;  4G50 A;  1MG8 A;  3R7R A;  4EOY A;  5E6O A;  2NPT B;  3LDZ E;  4MGK E;  3UGB B;  2GBJ A;  2MSE D;  2KMC A;  1WMH B;  1CMX B;  2JRI B;  2L76 A;  2FCM A;  2KQS A;  3WIM A;  2BYE A;  3ZO5 B;  1A5R A;  3QK0 A;  3ZKJ C;  2M1M A;  3EFU A;  2EMS A;  5BO4 B;  3VUW A;  3ZNZ B;  3APC A;  1TGZ B;  5G2N A;  3K9O B;  1GC6 A;  3NOB A;  4HDO A;  2ZVN A;  4MDK E;  4PYU A;  2MBE A;  2CR5 A;  1WRD B;  2Y5B B;  5JH5 C;  2NS5 A;  2KDE B;  3QAR A;  4IC7 B;  1OEY J;  2BF8 B;  2LZ6 A;  2DX5 B;  4PS8 A;  4LDT B;  5E6P A;  3A1Q B;  1IPG A;  4G3X B;  1I42 A;  4BVU C;  2JZ3 B;  4HK2 A;  1GJZ A;  4GOC A;  1LXD A;  3O65 B;  3OJ3 A;  1X1M A;  4XX5 A;  2MBO A;  2BKR B;  4GXB A;  4ICV A;  2FCQ A;  4BBN C;  1WGG A;  2VRR B;  2O2V B;  2JVC A;  2PE9 A;  1EO6 A;  5CHF A;  4NQK E;  1YQB A;  2CHX A;  3PGE A;  3A33 B;  1P3Q U;  1WX8 A;  5EDS A;  1J19 A;  2LUE A;  3V6E B;  2C7H A;  4AJY B;  3TJP A;  5FR6 A;  4B6W A;  1Z5S B;  3R7Q A;  2D11 A;  5DPW A;  1YJ1 A;  3DQV A;  1GG3 A;  4LJO B;  2OJR A;  2L05 A;  5AZG A;  2DEN B;  4I6P A;  2DYB A;  3TCA A;  4IWQ A;  4DWF A;  4EUT A;  2L7R A;  4HCP B;  1WF9 A;  3RUL A;  4GMV A;  1WM3 A;  3QHT A;  3KUC B;  4JGH B;  3ZVV A;  3PLU A;  2YVC A;  4IG7 B;  2FNJ B;  2JZZ A;  2D2Q A;  1K8R B;  2AYO B;  5KHO A;  3NZU A;  3RCZ A;  2FCS A;  2JUO A;  2UYZ B;  1P0R A;  4B9K A;  3PV1 A;  5J18 A;  3VFK A;  1NBF C;  4MM3 A;  3ZLZ A;  4BKS D;  3A4S C;  4CHK A;  1E8X A;  1ZGU B;  2KFJ A;  1BT0 A;  3A9K B;  3VUY A;  3OLM D;  3DVG X;  2K8C A;  1VCB A;  1E8W A;  4NPN A;  2IO2 B;  2XK5 A;  2RSU A;  2V1Y A;  1UD7 A;  3AU5 A;  5LXI B;  2W9N A;  2XBB C;  2DYM A;  2K6Q A;  2BKF A;  2L0T A;  2LGX A;  2LRU A;  5LXH A;  2L3Z A;  4HDQ A;  2IY1 B;  2KDI A;  3SD5 A;  2KD0 A;  3HM3 A;  4IWO A;  3UQA A;  1IP9 A;  2C9W B;  4BKT A;  2I1K A;  1UGM A;  2BYF A;  3JSV A;  3SHQ A;  2JF5 A;  4MH0 E;  1SIF A;  3H7P B;  5AZF A;  1XT9 B;  4ASW C;  2GOW A;  2RR9 A;  2WYQ A;  1E7U A;  3U30 A;  1D3Z A;  1V9J A;  4YL8 A;  3B0A A;  4G0N B;  3RZW C;  3DVN V;  5E6N A;  1WE6 A;  4ZYN A;  1WGR A;  4FLH A;  4M8N A;  4A3P A;  3Q3J A;  4E3C A;  4TQ0 A;  1SE9 A;  1LFD A;  2IBI B;  3P2B A;  3S2A A;  3VXW A;  4FAD A;  3M3J A;  3MJW A;  2B3A A;  3VTV A;  4AOF A;  4IWP A;  2ZPN A;  4HPL B;  2LWP A;  4IM2 A;  2GBK A;  2NR2 A;  1VD2 A;  4IM0 A;  4NY0 A;  4W9G A;  3GOE A;  3UIO B;  4BBN F;  3KYC D;  2J0J A;  2DZM A;  1UEL A;  4FN2 A;  1OEY A;  2MWS B;  3QIJ A;  2WX0 A;  4BKS A;  4BOS C;  3UIP B;  4E74 A;  3AU4 A;  2MLB A;  3X0W A;  1HE8 A;  2IZV B;  2JT4 B;  1M94 A;  3DBS A;  2BYV E;  2G4D B;  3W1S A;  4GDK A;  3PRP B;  3U7D A;  2K8H A;  2IO3 B;  5IAA C;  3VUX A;  4FHJ A;  3H9D A;  1Q0W B;  2GMI C;  5DPT A;  2MBH A;  4ANV A;  3IBE A;  4KZC A;  5C23 A;  3VDZ A;  2G4S A;  3BY4 B;  4HCN B;  3U8Z A;  4K81 A;  2ZNV C;  3M63 B;  2KC1 A;  3W1Y A;  1Z2M A;  4WWO A;  2PE6 B;  2ZJD A;  3KW5 B;  1UH6 A;  1YX6 B;  1V86 A;  4JL9 A;  4AUQ C;  4GSW A;  3KYD D;  4J6I A;  3WAL A;  1V49 A;  1AAR A;  2PPH A;  3CSF A;  3C0R B;  5CHW A;  5G55 A;  3ZTD A;  4OVU A;  3DPD A;  3M62 B;  3VVW B;  4FJZ A;  2LVQ A;  1P1A A;  3DDC B;  2DHZ A;  2A4Z A;  2GBN A;  3ALB A;  4NAW A;  1OTR B;  3H7S A;  4JIO U;  2N9E B;  3TL5 A;  3NS8 A;  3VH4 B;  3QJZ A;  4AJW A;  4ANX A;  4E71 A;  2KK8 A;  3HHM A;  5GMV A; 
#chains in the Genus database with same CATH topology
 5HG2 A;  4ARI A;  4B0M A;  1WFY A;  2LGY A;  3KUD B;  3AEB B;  2FCN A;  1WR1 A;  2GB1 A;  2JY6 A;  4MEM A;  2L8J A;  2JRH A;  1ZKH A;  4M01 A;  4GGQ A;  3AE6 B;  1JWS D;  1ZE3 D;  2CJN A;  4X57 B;  3L4P A;  2JXT A;  4ZRI A;  3BZD B;  3KQ4 A;  1QLB B;  2BBC A;  3AN1 A;  2RDB C;  2RPV A;  2KLC A;  2KX0 A;  4WQO B;  2K0P A;  4MJS A;  1AWD A;  4XWW A;  1XCT L;  3UI3 A;  1WJU A;  2V4I B;  5H92 C;  5BYR A;  1ISN A;  2WLB A;  4XDD A;  4DHZ E;  1I35 A;  1QT9 A;  2HD5 B;  4C80 A;  3OAW A;  2UWQ A;  3NZS A;  2NMQ A;  4EEW A;  4PS7 A;  1JRU A;  1NDD A;  1JWM D;  1S3S G;  3I9V 1;  2EMT A;  3ZTC A;  4D2K A;  4C00 A;  2MEK A;  4IOI E;  4AWJ A;  4II2 B;  3AEC B;  1JAL A;  4OVZ A;  2YLM A;  1QIL A;  1V80 A;  1AN8 A;  1WH3 A;  1I4X A;  2MP2 A;  2BS4 B;  4HJK A;  2KO3 A;  1YD8 U;  2MQJ A;  1GNU A;  5DCN A;  4EZJ A;  2IY0 B;  3PRZ A;  3AED B;  5KHQ A;  1V6E A;  2BB5 A;  5G5G A;  2N9X A;  4PYZ A;  1V1O A;  3FC4 A;  2WS3 B;  4ICU A;  1AYF A;  3W1S C;  3L13 A;  2HE7 A;  1FFV A;  2JQR B;  1E5W A;  2JWZ A;  3PSE B;  3V6C B;  2YEP B;  3L54 A;  2PVG C;  5DPR A;  3SEB A;  4WAF A;  4DDI D;  3PPA A;  3V61 A;  1SJE D;  1ZP0 B;  3TEY A;  3PHX B;  1EM7 A;  2KJ6 A;  4AP4 C;  4MJS B;  4ZRQ A;  3IT4 B;  3AE4 B;  1EWY C;  1V5O A;  4LDT D;  2BS3 B;  4N6E B;  3ECI A;  4RM8 A;  2OED A;  3FAH A;  4F7Z A;  3PTF C;  3ZW3 A;  2N9P C;  1XD3 B;  2FBW B;  1WYW B;  2LJI A;  4MEL A;  3ZNG C;  3R3M A;  1RAX A;  3Q8C A;  2LAS A;  3R8B A;  4EKU A;  3P4S B;  2L83 A;  1OGW A;  2ZCC A;  3KVF B;  1TT5 B;  2JPH A;  2D10 A;  1KH0 A;  4KKI A;  4YTN B;  2NBV B;  2Z0E B;  2TSS A;  3SR6 A;  3RNF C;  4A55 A;  3QAQ A;  4WIP A;  1WMH A;  2Q5W D;  3WCQ A;  2H89 B;  1N63 A;  3CST A;  2OOB B;  3P1M A;  1ZUD 2;  1IGD A;  1EUV B;  4NJ7 A;  3B9J A;  4TMA B;  2OJW A;  2I1J A;  2RDG A;  2JSV X;  2MP2 B;  1L7Y A;  4N9F 4;  4WQM A;  1C3T A;  4P1C C;  1RM6 C;  3NRZ A;  3BVM A;  5J17 A;  2MCN B;  1C79 A;  3CMM B;  3HRD D;  4FBJ B;  3RFZ B;  1E9M A;  5EE1 A;  4NAM A;  3OG5 A;  1F2R C;  1HZ6 A;  3ZUN A;  5BMG A;  2ZNV B;  5G5H A;  2J0M A;  2KZR A;  3M95 A;  1E7V A;  1MPE A;  1ET9 A;  1L4D B;  3AEF B;  2ZEQ A;  3VRA B;  4M00 A;  4LTU A;  3B08 A;  4TQ1 A;  3APD A;  5L83 A;  2D5G A;  2MJ3 A;  2L00 B;  4M02 A;  1N61 A;  2GI9 A;  2MX2 A;  3H1U A;  1J8C A;  2DZK A;  5D7G A;  3VH3 B;  3KH0 A;  4REZ A;  3RT3 B;  5JHB A;  4RFB A;  4W9E A;  2YEP F;  3TIX A;  3H7P A;  3QCA A;  1E8Z A;  1JWA D;  1TIF A;  2UU7 A;  2WWZ A;  3TMP B;  4LCD E;  4EOY A;  2PW9 A;  3RNB C;  4B0E A;  1L0V B;  1WMH B;  2L76 A;  3ZO5 B;  1A5R A;  3QK0 A;  3Q3M C;  3DHH C;  2M1M A;  2BTE A;  3VUW A;  3ZNZ B;  3APC A;  1CK1 A;  2IND C;  1WRD B;  2BF8 B;  5E6P A;  4BVU C;  3IAS 1;  3RPF C;  2VZK D;  1LXD A;  3OJ3 A;  1TS5 A;  4ICV A;  2FCQ A;  3ETR A;  1KF6 B;  5EDS A;  2AX5 A;  3V6E B;  4AJY B;  1Y56 A;  1Z5S B;  5DPW A;  2N7J A;  2OJR A;  2HJ1 A;  2DEN B;  5D3D A;  4DWF A;  1WM3 A;  2D3A A;  3AMZ A;  3QHT A;  4P1B C;  4LNI A;  3E9S A;  4JGH B;  3B2F A;  2FNJ B;  2JZZ A;  2D2Q A;  2AQ3 B;  2AYO B;  3AE8 B;  4B9K A;  1NBF C;  1ZGU B;  1I4P A;  1E8W A;  2X8X X;  2RSU A;  3Q3N C;  2W9N A;  2XBB C;  1F52 A;  2K6Q A;  2KD0 A;  4IWO A;  3EUB 2;  2BYF A;  3SHQ A;  3H7P B;  2INP E;  4L2Y A;  4ASW C;  2RR9 A;  3DVN V;  1PGB A;  4ZYN A;  3Q3J A;  1SE9 A;  2IBI B;  3S2A A;  4BAX A;  3VXW A;  4FAD A;  2WQY B;  2JZP A;  4RGO S;  3VTV A;  4AOF A;  4IWP A;  1CJE A;  1KTK A;  2LWP A;  1VD2 A;  3AEE B;  1I7H A;  2BS2 B;  3GP7 A;  2W55 A;  1FCC C;  1UEL A;  2LMC A;  3UIP B;  2G1E A;  2B76 B;  3DBS A;  4GDK A;  3PRP B;  5FR3 A;  2IO3 B;  1QQR A;  3H9D A;  4EE2 A;  1R7S A;  5DPT A;  1I4G A;  3GE8 C;  5C23 A;  1J7C A;  3BY4 B;  4KGR A;  4QAY A;  4K81 A;  3BK2 A;  1KLG D;  3W1Y A;  3Q2A C;  4WWO A;  1YX6 B;  3KYD D;  1F77 A;  1V49 A;  2V9H A;  2PPH A;  3CSF A;  5CHW A;  3ZTD A;  3HVD A;  3PZ7 A;  2WDR B;  1IUE A;  2H88 B;  1TKE A;  2GBN A;  3TL5 A;  3NS8 A;  4ANX A;  4HRS A;  1SB3 C;  1WJN A;  2WXK A;  2CHZ A;  1YX5 B;  4JLC A;  2R2O A;  4W9H A;  3AH7 A;  1L5P A;  1XO3 A;  3MHZ A;  3X23 A;  2M0A A;  4L1B A;  5AZH A;  2IPK D;  1SF0 A;  1J0G A;  1XCQ L;  4OZC A;  2C60 A;  2E6X A;  2FID A;  4WWM A;  2DYO A;  2MW5 A;  3HUI A;  2KTR A;  1WR6 E;  1TKY A;  2KDB A;  3TEZ A;  1WY8 A;  2G45 B;  1P7E A;  1L0Y B;  2KTF A;  2KXJ A;  2LJ5 A;  1RFK A;  4C7Z A;  5L95 C;  4KV2 A;  3R66 C;  2KWD A;  4GIV A;  5JHA A;  4HLE A;  4GDL A;  1WIA A;  2K8B A;  3I5J C;  3ZXV A;  3KUZ A;  1VR9 A;  3WAN A;  2ZPY A;  2KFK A;  2KX3 A;  3QQ8 B;  1R4N I;  4GDK B;  1TKG A;  3K9P B;  2V3S A;  2HTH A;  2NTS A;  1STE A;  1DYQ A;  3QA8 A;  5AUK A;  1JQ4 A;  1N60 A;  1E8Y A;  3GB1 A;  1WXM A;  2DWQ A;  3L08 A;  3PHW B;  4B95 A;  4WWP A;  3L10 B;  1WXV A;  2AQ2 B;  1VDV A;  4N58 A;  5CX3 A;  2LVO A;  4LNF A;  2DZJ A;  2K39 A;  2IO1 B;  2QHO A;  2O6V A;  2AL6 A;  3DVG Y;  1KJT A;  1YMH E;  1SIJ A;  3RYT A;  5T8I A;  4AQ7 A;  3VTW A;  1PQS A;  4RM9 A;  2DAF A;  2VH2 A;  4K1R B;  3APF A;  5C2T B;  1N5W A;  2PJH A;  3JVZ X;  4JX1 C;  2IYD B;  4WJN A;  2JXX A;  3PO0 A;  2Y5C A;  3T3N A;  5D6J B;  2INN E;  3RD2 A;  4KIK A;  5JXV A;  2KTR B;  3TSS A;  1FIQ A;  2CHW A;  1S1Q B;  3LXF A;  4MGI E;  2RGF A;  2M56 B;  3V62 A;  2XN9 C;  3RNC C;  2D07 B;  3RNE C;  4IUM B;  1K51 A;  2KMA A;  3PRE A;  2FIF A;  4K7U A;  2KVR A;  3AUL A;  3SDL C;  4GDL B;  5AUI A;  1OQR A;  1I4R A;  1Q5W B;  2KHW B;  1T0Y A;  1YIW A;  4TV3 A;  1FD6 A;  2IDY A;  2KFK B;  3VR9 B;  1DOI A;  2Y5P A;  3BK1 A;  2MHJ A;  1F2R I;  1WGY A;  2ICI A;  1K50 A;  2W82 A;  2HDE A;  2RMM A;  4EZL A;  2VH1 A;  3DBL I;  3Q8E A;  1SJH D;  5I4D A;  4GU2 A;  4IM3 A;  2ASQ A;  2IGG A;  3GZN B;  3A1Q A;  4II3 B;  1I4H A;  2KAN A;  4GB9 A;  5H8Y E;  3ZDM C;  2BYT A;  1SE2 A;  2O6V B;  1WX7 A;  3KLS X;  1IGC A;  4WWN A;  4LLG M;  2N1W A;  3DBR I;  3C8Y A;  3JYU A;  4RF0 A;  4A20 A;  2FAZ A;  4DHJ B;  3PVL A;  4I6N B;  1V1P A;  2AWT A;  4FJY A;  4KDI C;  3QX1 A;  3NJT A;  1Y8R C;  3T3O A;  2KN5 A;  4A8X C;  5IA7 A;  1RWS A;  4C56 C;  4FXC A;  1HQR D;  3N9Y C;  1FXA A;  4KIK B;  1ENF A;  3NS1 A;  1RYJ A;  3MC8 A;  1HA5 A;  1JW9 D;  5LNK 1;  3NG0 A;  4MSQ B;  1GUA B;  4P7I A;  1MI0 A;  3EEC A;  2LUM A;  2ZW1 A;  1WGD A;  3DBH I;  2SEB D;  3A9K A;  4K3B A;  1L6U A;  4PS3 A;  4WAA A;  2J42 A;  3E56 A;  2DZI A;  3NVW A;  3SFE B;  4FHK A;  2AL3 A;  2N7D A;  1WGH A;  3BIN A;  3QC8 B;  4W9K A;  1EU4 A;  1GB4 A;  4RMA A;  3CF6 E;  4W9L A;  2WXI A;  2QSD A;  1FPY A;  1KFY B;  5AEK B;  1KLV A;  4G50 A;  1MG8 A;  3R7R A;  1JWB D;  2MSE D;  2FCM A;  4RCO A;  3WIM A;  5EE9 A;  3ZKJ C;  3NVV A;  5BO4 B;  2MJD A;  1TGZ B;  2MH7 A;  4ACF A;  1L6V A;  3K9O B;  4YTP B;  2N0S B;  4HDO A;  2ZVN A;  2Y5B B;  2J4X A;  2NS5 A;  2KDE B;  4IC7 B;  2BB6 A;  1ZDX A;  2DX5 B;  4RGN A;  2BVC A;  3A1Q B;  4G3X B;  1V8C A;  3U2S C;  1ESF A;  4XX5 A;  1F0Z A;  2CHX A;  4P16 A;  1MFW A;  1UWX A;  4HKZ E;  2X38 A;  1V1P B;  3TJP A;  4B6W A;  3DQV A;  3N20 C;  2WU5 B;  3MJ5 A;  1A70 A;  2LGI A;  3TCA A;  2QIL A;  3KUC B;  2WXQ A;  3PLU A;  2FCS A;  3H8H A;  5D3I B;  4BKS D;  4CHK A;  2KFJ A;  3A9K B;  4YSY B;  3OLM D;  2M19 A;  4YSZ B;  4DXF A;  3TEX A;  2V1Y A;  3AU5 A;  5LXI B;  1TY2 A;  2BKF A;  2L0T A;  2LGX A;  2LRU A;  1R4N B;  4NJC A;  3SFD B;  2IY1 B;  1DOX A;  1SXT A;  3HM3 A;  3UQA A;  1IP9 A;  1GOZ A;  2I1K A;  4H2A A;  2JF5 A;  1QF6 A;  1XT9 B;  2GOW A;  3RZW C;  5E6N A;  1CZP A;  1WGR A;  4M8N A;  3N1Y C;  3P2B A;  3M3J A;  1FXI A;  4IM0 A;  4W9G A;  4XYC A;  3KYC D;  1D5X C;  1OFF A;  2DZM A;  3AV8 A;  4YWG G;  3Q69 A;  1C76 A;  2WX0 A;  4JPS A;  1LGR A;  4WH4 A;  2OHF A;  2G4D B;  3U7D A;  2K8H A;  5IAA C;  4KX6 B;  2GMI C;  3P4R B;  2IGD A;  3BII D;  3IBE A;  3AE1 B;  3U8Z A;  1Z2M A;  2ZJD A;  1UH6 A;  1T0R C;  4GSW A;  3WAL A;  3C0R B;  5G55 A;  4OVU A;  3IXS A;  2D3C A;  2LVQ A;  3DDC B;  3AEG B;  2A4Z A;  3GE3 C;  4NAW A;  1OTR B;  2QJL A;  4PT5 A;  4E71 A;  2KK8 A;  4OVV A;  3HHM A;  4XGA B;  2KDF B;  1R4M I;  1WXA A;  4W9I A;  2NCN A;  3WAP A;  1Q10 A;  2MJE A;  3MFG A;  2RPQ A;  3ZJT A;  1LO5 D;  3LJ3 A;  4AS1 A;  3Q14 C;  3IHP C;  2N9K A;  1KOT A;  1UUP A;  2WDV B;  4XZ4 A;  1H4R A;  4I6L B;  1GAQ B;  2KNB A;  3JW0 X;  3N32 A;  2XEW A;  1N62 A;  3MP9 A;  3B1L X;  3PT2 B;  3J9C A;  4NJ6 A;  3ZJV A;  3I3T B;  4XWT A;  5BYS A;  5IKC M;  2G9H D;  2M17 A;  3EFC A;  4BFR A;  2LGS A;  3DBL B;  3W5U B;  1T6B X;  3ZNI D;  1SEB D;  3L17 A;  1PFD A;  4HWI B;  4RGM A;  4YTM B;  1D6E C;  4FJV B;  2PKO A;  1M4V A;  2Z0D B;  1FM0 D;  2N4F A;  2IJ0 A;  2KWV B;  1V97 A;  1TS4 A;  3RZF A;  1VRA B;  2V4L A;  4MGZ E;  3CWI A;  3W9C B;  1WJ6 A;  3DBR B;  2EEL A;  4J3O D;  4A6Q A;  4LK0 M;  3NVZ A;  4GN1 A;  3VR8 B;  3AB5 A;  1ZXI A;  4LNN A;  3PS6 A;  3AE9 B;  3RUI B;  2ONQ A;  1L4Z B;  1NYQ A;  4ZHO A;  4DHZ B;  2QC8 A;  4KDL B;  4JE3 B;  3QWZ B;  3AE2 B;  1C9F A;  1ZW7 A;  1U4A A;  2C7M B;  2GLS A;  1ET6 A;  3T8M A;  3ZRF A;  3EGR A;  2MBB B;  5J2R A;  4NAW B;  2C7N B;  5LLI A;  1ROE A;  5CTR C;  4IKG A;  4W9D A;  2K25 A;  1GC7 A;  2WX1 A;  3ML8 A;  1PGX A;  3NHE B;  1G6J A;  5EE3 A;  4C7Y A;  2N9L A;  1XLN A;  4DBG A;  1V2Y A;  4K7W A;  2NVU I;  1TBE A;  3NY5 A;  3NZ3 A;  1KLU D;  1P98 A;  2BT6 A;  2CKH B;  2DAJ A;  2KN4 A;  4DK5 A;  1L0X B;  1WXQ A;  1WYG A;  2EKI A;  1NI2 A;  4G11 A;  3PLV A;  2I38 A;  2CU1 A;  4NNJ B;  4M0W A;  3H6N A;  4DDG D;  2WXR A;  1SGH A;  2IGH A;  3A9J A;  2C5L C;  5D2M B;  3ML9 A;  1HXY D;  4ZRK A;  4ZDV A;  1EF5 A;  1SE3 A;  2J0K A;  1KM7 A;  5HHD G;  2KDM A;  3L0W B;  5IO9 A;  4KSK C;  3DHI C;  5JZE B;  2WXJ A;  1TTN A;  2L0F A;  1E7P B;  1UNS A;  2ZW0 A;  4URK A;  5TSS A;  1UF0 A;  1YN5 A;  4YT0 B;  3ZYY X;  4A9A A;  2FUH B;  4MGY E;  1PYW D;  1FXT B;  2MBQ A;  3IG3 A;  1PGA A;  2KC2 A;  3P63 A;  2WGS A;  3WAO A;  3DOW A;  2WXH A;  3TBL D;  2KWU B;  1H8C A;  2AEH A;  2JX5 A;  3I57 A;  2Z8L A;  3V05 A;  2Z59 B;  1WX9 A;  3BYY B;  4YXD B;  1FO4 A;  4XC2 A;  4F8C B;  2M0X A;  1YNT E;  2O2V A;  3ZRC A;  3Q3F A;  5IN7 A;  4DQO C;  2ZCB A;  3ZNH B;  1AW7 A;  2LHD A;  2REX A;  3IFW B;  4O1N A;  1JRO A;  1XLP A;  1HZ5 A;  2KOX A;  2D3G A;  5FKA C;  4CO7 A;  2V3N A;  2KLG A;  1BML C;  2KJR A;  4PK1 A;  3AM9 A;  3I63 C;  3UIN B;  2FE8 A;  2BPS A;  2DNF A;  2WDT B;  3D32 A;  3DVN U;  4ZRP A;  1V5T A;  2QDF A;  3NVY A;  3AE7 B;  4M0W B;  2K3U A;  4ZOH C;  1FNV A;  1DOY A;  1C1Y B;  4DXA B;  3A9J B;  1JCK B;  2BWE S;  3BYT B;  1IYF A;  1WJ4 A;  1C78 A;  1LM8 B;  4EFO A;  2LGD A;  4ZHP A;  5DPS A;  4K3C A;  2A5U A;  4MSM B;  4MH8 A;  1E90 A;  2N1V A;  4LJP B;  2BW2 A;  4WJO A;  2GBM A;  3ZGZ A;  1PUT A;  1YJJ A;  4WJQ A;  2W3R A;  1B1Z A;  3BVG A;  4MGK E;  3UGB B;  2CJO A;  1ZDV A;  5GXG B;  2KMC A;  1CMX B;  2FUG 1;  2JRI B;  4OZB A;  2BYE A;  2W54 A;  2K5P A;  2GRI A;  3EFU A;  2WDQ B;  3NOB A;  4MDK E;  4ZYS A;  2MBE A;  5JH5 C;  3QAR A;  1R4M B;  2LZ6 A;  3IT6 B;  4LDT B;  2JZ3 B;  1GJZ A;  4GOC A;  1X1M A;  2MBO A;  2O2V B;  2PE9 A;  1EO6 A;  5CHF A;  1YQB A;  3PGE A;  1P3Q U;  1J19 A;  2LUE A;  1B9R A;  4UDU C;  1WRI A;  5FR6 A;  3R7Q A;  2D11 A;  1YJ1 A;  1GG3 A;  3LB8 C;  1PDX A;  2DYB A;  4IWQ A;  4EUT A;  4HCP B;  2L7R A;  1WF9 A;  2D3B A;  4GMV A;  4RNA A;  3RUL A;  3U4E G;  4ITK A;  2YVC A;  3RCZ A;  5KHO A;  3NZU A;  3KWL A;  3PV1 A;  3VFK A;  2V0G A;  4MM3 A;  3ZLZ A;  3A4S C;  1C4A A;  1BT0 A;  2LHE A;  3VUY A;  3DVG X;  2K8C A;  1VCB A;  2L1A A;  4NPN A;  2ON8 A;  2XK5 A;  4ARC A;  1UD7 A;  3TUO A;  3B2G A;  1ZPS A;  3MC9 A;  4HDQ A;  3SD5 A;  2C9W B;  4BKT A;  4US9 A;  1UGM A;  3JSV A;  4MH0 E;  1SIF A;  4S17 A;  5AZF A;  4TSS A;  3U30 A;  1BXT A;  3B0A A;  4G0N B;  1WE6 A;  2WP9 B;  4TQ0 A;  4XE0 A;  2L32 A;  1LFD A;  3MJW A;  1NYR A;  1HEZ E;  4IM2 A;  2ZPN A;  4NY0 A;  2NR2 A;  4BBN F;  2J0J A;  1OEY A;  3QIJ A;  4BOS C;  3VRB B;  4E74 A;  3AU4 A;  2MLB A;  1HE8 A;  2IZV B;  2JT4 B;  3W1S A;  2KYW A;  1NEN B;  2MBH A;  3GS2 A;  4P6V F;  3VDZ A;  2KAC A;  1YJI A;  2WXP A;  2ZNV C;  3M63 B;  1E6E B;  2PE6 B;  3KW5 B;  1V86 A;  4AUQ C;  3DWG C;  1MHX A;  2KVZ A;  4J6I A;  1QOA A;  1JWU D;  2QEJ C;  3URY A;  4FJZ A;  1P1A A;  1C4C A;  3H7S A;  3VH4 B;  4JIO U;  4MAC A;  1HTQ A;  4TUU A;  3P4P B;  1UZX B;  4MM3 B;  2I2Y A;  5HI1 A;  1IBX A;  4K7S A;  2WNM A;  3V3X A;  1JRP A;  2XK5 B;  1WXS A;  2QIE B;  1VLB A;  5BYQ A;  1FCL A;  2VZK B;  2KWC A;  2KKC A;  1UWM A;  3HVZ A;  2K1F A;  2MRP A;  3T9L A;  5BMH A;  1FNU A;  1ACC A;  2ACZ B;  3JSV B;  1YQ3 B;  4JQW C;  1FNW A;  4KGS A;  3Q3O C;  2CS4 A;  2Y3A A;  3ZIM A;  2ZZP B;  3ABV B;  3VTU A;  1C77 A;  3U52 E;  4GLS C;  4IW0 A;  3HM6 X;  3VAW A;  2R61 A;  1J7A A;  1TY0 A;  1N6Z A;  3OJ4 B;  1OQY A;  1YN4 A;  2KAJ A;  3L16 A;  2LI5 A;  1WI0 A;  1OQQ A;  2O6V D;  3CIR B;  5EE0 A;  1RFA A;  3DCG A;  4R3D A;  2LFI A;  3WAM A;  3EA6 A;  2QMT A;  2RD0 A;  4DHJ D;  3RI7 C;  1Q1O A;  2JYE A;  3N1Z C;  3EHV A;  3N30 A;  3AI5 A;  3Q8F A;  5E6J A;  4W9C A;  3ZDT A;  1GB1 A;  4ANU A;  1QKZ A;  3RN9 C;  4HPP A;  3N1X C;  2N7E A;  1EU3 A;  1JML A;  4A3O A;  3HIZ A;  3FIL A;  2J7Q B;  1D4B A;  1RLF A;  1YQ4 B;  1T0Q C;  4HRO A;  4TKN A;  3PZD A;  2WXF A;  3IVF A;  3VQI A;  3HK0 A;  3PZ8 A;  3EC8 A;  3O13 A;  2WXN A;  2NBW B;  5D94 A;  3A4R A;  4HXD A;  2WXL A;  1IBX B;  2M4N A;  4RH6 A;  1N5X A;  2LD9 A;  3LYY A;  3AEA B;  4Q2J A;  3N3K B;  1D5M C;  1EF1 A;  1QOB A;  2LRW A;  3FKY A;  5C3J B;  1NEK B;  2IO0 B;  2E3T A;  2KJH B;  1MG4 A;  2MA9 B;  2KT7 A;  2G3Q B;  2PEA A;  2LXA A;  3W2D A;  1SE4 A;  2KMM A;  4LNK A;  1FEH A;  2BWF A;  3ZJU A;  1QZE A;  1QOG A;  3MC0 B;  1MJD A;  4FA6 A;  4F1S A;  2NBU A;  3MHS D;  3OWE B;  3MTN B;  3WA0 A;  2LVP A;  1SBB B;  1WGK A;  3AXC A;  3ZXR A;  3UQB A;  2EKE C;  1XLO A;  3NUH B;  1XQQ A;  1XEE A;  2NPT A;  1TZ1 A;  2PIA A;  1HTO A;  2M8S A;  1XF5 L;  1T3Q A;  4FUL A;  3U7Z A;  1WM2 A;  3W5V B;  4ZRJ A;  4ANW A;  2PMV A;  2LXC A;  4OW0 A;  4KVG B;  4HKQ A;  1P9D U;  3DWM A;  2HJ8 A;  3FIL B;  2KQ7 A;  1L2N A;  4EZK A;  4KZ0 A;  1K52 A;  5HKH A;  1UBQ A;  4W9F A;  2BQQ A;  4W9J A;  3RMK C;  2ZVO A;  1E0Z A;  1TZO A;  1WSP A;  1MHH E;  3GZN I;  2J53 A;  4BKG A;  1UBI A;  1V81 A;  1XLQ A;  4JWU C;  1UGJ A;  4BOZ B;  5CHV C;  1LQB A;  4WJP A;  1FRR A;  4M8M A;  4KSL C;  1WE7 A;  2K6D B;  2GBR A;  2JYT A;  4NZL B;  5TR5 A;  3UF8 A;  1NVI D;  3PRM B;  2V3P A;  3V60 A;  1TJE A;  3DBH B;  1VZ7 A;  3ENE A;  4NQL B;  4RF1 A;  1DGJ A;  3ONS A;  4DXG A;  5HFY A;  2QCZ A;  2K9X A;  3BVZ A;  1RRB A;  2BGF A;  5C1Z A;  1F9J A;  4HEA 1;  2AQ1 B;  1WZ0 A;  4CYE A;  4US8 A;  1WZ3 A;  1VZ6 A;  2WXG A;  1KRH A;  2DBY A;  1YN3 A;  2WXO A;  4WUR A;  1CQV A;  4HPM B;  2R2Q A;  1QOF A;  2WU2 B;  3SU8 X;  3VHT C;  1FFU A;  4HVB A;  3BWU D;  5E6O A;  4OHJ A;  2NPT B;  3LDZ E;  5FK9 C;  4CQN A;  2GBJ A;  5IOI A;  3P4Q B;  2KQS A;  2DLB A;  4L23 A;  2WXM A;  2EMS A;  1K53 A;  2PTL A;  5G2N A;  1FRD A;  3KWV A;  1GC6 A;  4PYU A;  2CR5 A;  2WHI A;  2HTM E;  1OEY J;  4PS8 A;  1WWT A;  1IPG A;  1I42 A;  1TS2 A;  4HK2 A;  3O65 B;  3DHG C;  2K22 A;  4JWS C;  2BKR B;  4GXB A;  4BBN C;  1WGG A;  2J52 A;  2VRR B;  3RNA C;  2JVC A;  4NQK E;  3A33 B;  1ZOY B;  1WX8 A;  4N59 A;  1SSN A;  2PLP A;  2C7H A;  4HJG E;  1T0S C;  1EWC A;  4LJO B;  2XNA C;  4A90 A;  1VZ8 A;  2L05 A;  1MVK A;  5AZG A;  3Q8B A;  4I6P A;  2L52 A;  3IAM 1;  1J7B A;  1XXG A;  4C4V A;  3ZVV A;  1TS3 A;  3AE3 B;  4IG7 B;  4KGT A;  1K8R B;  1NI3 A;  2JUO A;  2UYZ B;  3AE5 B;  1P0R A;  5J18 A;  3R2I A;  4USA A;  1E8X A;  4YSX B;  2IO2 B;  2JWU A;  5MPO A;  2NTT A;  1BUI C;  1I4Q A;  2DYM A;  5LXH A;  2L3Z A;  2KDI A;  1VJK A;  2KQ4 X;  4KKJ A;  1GPX A;  2SAK A;  1TYG B;  2INC C;  2WYQ A;  1E7U A;  1D3Z A;  1E10 A;  1V9J A;  4YL8 A;  3C19 A;  1P7F A;  2PVO D;  4FLH A;  4S0R A;  4A3P A;  1FMA D;  4E3C A;  1D5Z C;  3P42 A;  2RDH A;  2B3A A;  4HPL B;  2GBK A;  1T5X D;  3GOE A;  3UIO B;  4XDC A;  4BZA A;  4FN2 A;  2MWS B;  3ZQ4 A;  4BKS A;  3X0W A;  1M94 A;  2BYV E;  4IDI A;  2LEK A;  2W3S A;  4LNO A;  3VUX A;  4FHJ A;  3Q8A A;  1Q0W B;  4ANV A;  4KZC A;  1C4P A;  2G4S A;  4HCN B;  4RGT A;  2JU6 X;  2KC1 A;  1ZXH A;  4OZA A;  1F1H A;  4JL9 A;  2CU3 A;  3Q6B A;  1AAR A;  4MT5 A;  3DPD A;  3M62 B;  3VVW B;  5IP4 D;  3R2T A;  2DHZ A;  4C4V B;  3ALB A;  1YOV B;  3RNG C;  2N9E B;  3TEW A;  3QJZ A;  4AJW A;  5BMI A;  5GMV A; 
#chains in the Genus database with same CATH homology
 1WJN A;  4TUU A;  2CHZ A;  1YX5 B;  1WFY A;  1UZX B;  4JLC A;  2KDF B;  1R4M I;  2R2O A;  2LGY A;  4W9H A;  1WXA A;  4W9I A;  2NCN A;  3WAP A;  3KUD B;  3X23 A;  2FCN A;  1WR1 A;  4K7S A;  2RPQ A;  2XK5 B;  1WXS A;  2JY6 A;  5AZH A;  4MEM A;  2L8J A;  1J0G A;  2JRH A;  1ZKH A;  3LJ3 A;  3IHP C;  2KWC A;  4GGQ A;  2KKC A;  1KOT A;  4X57 B;  2C60 A;  2K1F A;  2MRP A;  4OVV A;  4XZ4 A;  1H4R A;  2FID A;  4I6L B;  3T9L A;  2KNB A;  3JW0 X;  3N32 A;  2DYO A;  2XEW A;  4ZRI A;  3B1L X;  3JSV B;  3PT2 B;  2MW5 A;  4JQW C;  2KTR A;  1WR6 E;  4NJ6 A;  2CS4 A;  3ZIM A;  2KDB A;  3I3T B;  2ZZP B;  3VTU A;  2KLC A;  1WY8 A;  2G45 B;  2KX0 A;  2M17 A;  4BFR A;  4WQO B;  4IW0 A;  2KTF A;  2KXJ A;  2LJ5 A;  3HM6 X;  4MJS A;  3VAW A;  3ZNI D;  3L17 A;  1WJU A;  5L95 C;  4HWI B;  4KV2 A;  3R66 C;  3OJ4 B;  1OQY A;  4GIV A;  3L16 A;  5JHA A;  2LI5 A;  4FJV B;  1WI0 A;  2Z0D B;  2N4F A;  4HLE A;  4GDL A;  1ISN A;  1WIA A;  2K8B A;  2KWV B;  2O6V D;  3KUZ A;  3RZF A;  4DHZ E;  3WAN A;  1I35 A;  1RFA A;  3DCG A;  2V4L A;  2ZPY A;  4MGZ E;  2HD5 B;  3WAM A;  3OAW A;  2UWQ A;  3NZS A;  2KFK A;  2KX3 A;  1WJ6 A;  2RD0 A;  3QQ8 B;  4DHJ D;  4EEW A;  4PS7 A;  1R4N I;  1JRU A;  4GDK B;  1NDD A;  1S3S G;  1Q1O A;  3K9P B;  2V3S A;  4GN1 A;  2HTH A;  2EMT A;  3ZTC A;  3PS6 A;  3EHV A;  3QA8 A;  3N30 A;  3AI5 A;  3RUI B;  4W9C A;  1E8Y A;  3ZDT A;  4AWJ A;  4ANU A;  4II2 B;  4DHZ B;  2N7E A;  1WXM A;  4KDL B;  3L08 A;  3PHW B;  2YLM A;  3QWZ B;  1V80 A;  4A3O A;  1ZW7 A;  3HIZ A;  1U4A A;  4B95 A;  2J7Q B;  2C7M B;  1WH3 A;  1RLF A;  4TKN A;  3PZD A;  4WWP A;  3T8M A;  3ZRF A;  3IVF A;  3L10 B;  1WXV A;  3VQI A;  2MBB B;  5J2R A;  2MP2 A;  4HJK A;  2KO3 A;  1YD8 U;  2MQJ A;  1GNU A;  5CX3 A;  2LVO A;  3HK0 A;  4NAW B;  2C7N B;  2DZJ A;  3EC8 A;  5DCN A;  5LLI A;  2K39 A;  4EZJ A;  2IO1 B;  2QHO A;  5CTR C;  2NBW B;  4W9D A;  2O6V A;  5D94 A;  2K25 A;  2IY0 B;  2AL6 A;  3A4R A;  3DVG Y;  4HXD A;  1GC7 A;  1KJT A;  2WX1 A;  3PRZ A;  3RYT A;  2M4N A;  3ML8 A;  5KHQ A;  1V6E A;  3NHE B;  2LD9 A;  1G6J A;  3VTW A;  2N9X A;  1PQS A;  4RM9 A;  2DAF A;  4PYZ A;  4DBG A;  3N3K B;  3APF A;  1V2Y A;  4K1R B;  4ICU A;  4K7W A;  2NVU I;  3W1S C;  3L13 A;  1TBE A;  3NY5 A;  2HE7 A;  1P98 A;  2CKH B;  1EF1 A;  2PJH A;  3JVZ X;  2DAJ A;  1E5W A;  2JWZ A;  2IYD B;  4WJN A;  2JXX A;  2LRW A;  4DK5 A;  3PSE B;  1NI2 A;  4G11 A;  5D6J B;  3V6C B;  3PLV A;  3RD2 A;  4KIK A;  2IO0 B;  2KJH B;  2KTR B;  3L54 A;  5DPR A;  4DDI D;  3PPA A;  2CU1 A;  2MA9 B;  3V61 A;  2G3Q B;  2PEA A;  4NNJ B;  2CHW A;  2LXA A;  1S1Q B;  4MGI E;  2RGF A;  3H6N A;  4DDG D;  3PHX B;  1SGH A;  3V62 A;  2KJ6 A;  3A9J A;  5D2M B;  2C5L C;  2D07 B;  4MJS B;  4AP4 C;  3ML9 A;  2BWF A;  4IUM B;  4ZRK A;  4ZDV A;  1EF5 A;  2J0K A;  1V5O A;  4LDT D;  1KM7 A;  2KMA A;  3ECI A;  1QZE A;  2FIF A;  3PRE A;  4RM8 A;  4F7Z A;  3PTF C;  3ZW3 A;  2N9P C;  1XD3 B;  2KVR A;  1WYW B;  3AUL A;  4K7U A;  3SDL C;  4MEL A;  4GDL B;  3ZNG C;  4FA6 A;  4F1S A;  1Q5W B;  1RAX A;  1T0Y A;  2KHW B;  2NBU A;  3L0W B;  3MHS D;  2LAS A;  3R3M A;  3MTN B;  1YIW A;  4TV3 A;  3WA0 A;  4EKU A;  2LVP A;  4KSK C;  2ZCC A;  1OGW A;  3KVF B;  5JZE B;  3AXC A;  2KFK B;  1TTN A;  3UQB A;  2EKE C;  2JPH A;  2D10 A;  2L0F A;  4URK A;  1XQQ A;  2NBV B;  2Z0E B;  2NPT A;  1TZ1 A;  2M8S A;  3QAQ A;  2FUH B;  4MGY E;  1FXT B;  1WMH A;  2MBQ A;  4FUL A;  3IG3 A;  1WGY A;  2KC2 A;  1WM2 A;  3WAO A;  3DOW A;  4ZRJ A;  4EZL A;  3DBL I;  3CST A;  2OOB B;  4ANW A;  2LXC A;  4KVG B;  3TBL D;  1P9D U;  1EUV B;  2HJ8 A;  4NJ7 A;  2KWU B;  2KQ7 A;  1H8C A;  1L2N A;  2AEH A;  4EZK A;  4KZ0 A;  4GU2 A;  2I1J A;  4IM3 A;  2ASQ A;  5HKH A;  1UBQ A;  2MP2 B;  4W9F A;  1L7Y A;  2Z59 B;  1WX9 A;  3A1Q A;  4N9F 4;  4II3 B;  4W9J A;  1C3T A;  2ZVO A;  2KAN A;  4GB9 A;  4XC2 A;  3ZDM C;  3GZN I;  2O6V B;  4F8C B;  4BKG A;  1UBI A;  1WX7 A;  1V81 A;  2M0X A;  2MCN B;  5J17 A;  2O2V A;  4WWN A;  3ZRC A;  2N1W A;  3DBR I;  3JYU A;  3CMM B;  3Q3F A;  2ZCB A;  3ZNH B;  4A20 A;  4BOZ B;  5CHV C;  4FBJ B;  2FAZ A;  2REX A;  4DHJ B;  1LQB A;  3PVL A;  3IFW B;  4I6N B;  4M8M A;  4WJP A;  2AWT A;  4FJY A;  4KDI C;  3QX1 A;  4KSL C;  1WE7 A;  1Y8R C;  2K6D B;  3ZUN A;  2KN5 A;  5IA7 A;  2KOX A;  2D3G A;  4CO7 A;  2GBR A;  2KLG A;  2KJR A;  2ZNV B;  2J0M A;  2KZR A;  3M95 A;  5TR5 A;  3UIN B;  1E7V A;  3UF8 A;  2BPS A;  4KIK B;  3DVN U;  2WDT B;  3D32 A;  3PRM B;  3V60 A;  1V5T A;  2ZEQ A;  3ENE A;  4MSQ B;  4NQL B;  1GUA B;  3B08 A;  4M0W B;  4P7I A;  3ONS A;  3EEC A;  1C1Y B;  1WGD A;  4DXA B;  3A9J B;  4TQ1 A;  3DBH I;  3A9K A;  3APD A;  5L83 A;  1RRB A;  2BGF A;  5C1Z A;  1F9J A;  2BWE S;  2L00 B;  4PS3 A;  4WAA A;  1WZ0 A;  2DZI A;  4CYE A;  1IYF A;  1WJ4 A;  2MX2 A;  3H1U A;  1LM8 B;  4EFO A;  2LGD A;  4FHK A;  1J8C A;  2DZK A;  5D7G A;  3VH3 B;  1WZ3 A;  2AL3 A;  2N7D A;  3KH0 A;  5DPS A;  1WGH A;  2A5U A;  3RT3 B;  5JHB A;  4MSM B;  3BIN A;  3QC8 B;  4W9K A;  4W9E A;  4RMA A;  1E90 A;  3CF6 E;  2N1V A;  4W9L A;  4HPM B;  3TIX A;  4LJP B;  2R2Q A;  4WJO A;  2GBM A;  3H7P A;  3QCA A;  1E8Z A;  3VHT C;  5AEK B;  3SU8 X;  1KLV A;  2WWZ A;  3TMP B;  4HVB A;  4LCD E;  4WJQ A;  4G50 A;  1MG8 A;  3R7R A;  4EOY A;  5E6O A;  2NPT B;  3LDZ E;  4MGK E;  3UGB B;  2GBJ A;  2MSE D;  2KMC A;  1WMH B;  1CMX B;  2JRI B;  2L76 A;  2FCM A;  2KQS A;  3WIM A;  2BYE A;  3ZO5 B;  1A5R A;  3QK0 A;  3ZKJ C;  2M1M A;  3EFU A;  2EMS A;  5BO4 B;  3VUW A;  3ZNZ B;  3APC A;  1TGZ B;  5G2N A;  3K9O B;  1GC6 A;  3NOB A;  4HDO A;  2ZVN A;  4MDK E;  4PYU A;  2MBE A;  2CR5 A;  1WRD B;  2Y5B B;  5JH5 C;  2NS5 A;  2KDE B;  3QAR A;  4IC7 B;  1OEY J;  2BF8 B;  2LZ6 A;  2DX5 B;  4PS8 A;  4LDT B;  5E6P A;  3A1Q B;  1IPG A;  4G3X B;  1I42 A;  4BVU C;  2JZ3 B;  4HK2 A;  1GJZ A;  4GOC A;  1LXD A;  3O65 B;  3OJ3 A;  1X1M A;  4XX5 A;  2MBO A;  2BKR B;  4GXB A;  4ICV A;  2FCQ A;  4BBN C;  1WGG A;  2VRR B;  2O2V B;  2JVC A;  2PE9 A;  1EO6 A;  5CHF A;  4NQK E;  1YQB A;  2CHX A;  3PGE A;  3A33 B;  1P3Q U;  1WX8 A;  5EDS A;  1J19 A;  2LUE A;  3V6E B;  2C7H A;  4AJY B;  3TJP A;  5FR6 A;  4B6W A;  1Z5S B;  3R7Q A;  2D11 A;  5DPW A;  1YJ1 A;  3DQV A;  1GG3 A;  4LJO B;  2OJR A;  2L05 A;  5AZG A;  2DEN B;  4I6P A;  2DYB A;  3TCA A;  4IWQ A;  4DWF A;  4EUT A;  2L7R A;  4HCP B;  1WF9 A;  3RUL A;  4GMV A;  1WM3 A;  3QHT A;  3KUC B;  4JGH B;  3ZVV A;  3PLU A;  2YVC A;  4IG7 B;  2FNJ B;  2JZZ A;  2D2Q A;  1K8R B;  2AYO B;  5KHO A;  3NZU A;  3RCZ A;  2FCS A;  2JUO A;  2UYZ B;  1P0R A;  4B9K A;  3PV1 A;  5J18 A;  3VFK A;  1NBF C;  4MM3 A;  3ZLZ A;  4BKS D;  3A4S C;  4CHK A;  1E8X A;  1ZGU B;  2KFJ A;  1BT0 A;  3A9K B;  3VUY A;  3OLM D;  3DVG X;  2K8C A;  1VCB A;  1E8W A;  4NPN A;  2IO2 B;  2XK5 A;  2RSU A;  2V1Y A;  1UD7 A;  3AU5 A;  5LXI B;  2W9N A;  2XBB C;  2DYM A;  2K6Q A;  2BKF A;  2L0T A;  2LGX A;  2LRU A;  5LXH A;  2L3Z A;  4HDQ A;  2IY1 B;  2KDI A;  3SD5 A;  2KD0 A;  3HM3 A;  4IWO A;  3UQA A;  1IP9 A;  2C9W B;  4BKT A;  2I1K A;  1UGM A;  2BYF A;  3JSV A;  3SHQ A;  2JF5 A;  4MH0 E;  1SIF A;  3H7P B;  5AZF A;  1XT9 B;  4ASW C;  2GOW A;  2RR9 A;  2WYQ A;  1E7U A;  3U30 A;  1D3Z A;  1V9J A;  4YL8 A;  3B0A A;  4G0N B;  3RZW C;  3DVN V;  5E6N A;  1WE6 A;  4ZYN A;  1WGR A;  4FLH A;  4M8N A;  4A3P A;  3Q3J A;  4E3C A;  4TQ0 A;  1SE9 A;  1LFD A;  2IBI B;  3P2B A;  3S2A A;  3VXW A;  4FAD A;  3M3J A;  3MJW A;  2B3A A;  3VTV A;  4AOF A;  4IWP A;  2ZPN A;  4HPL B;  2LWP A;  4IM2 A;  2GBK A;  2NR2 A;  1VD2 A;  4IM0 A;  4NY0 A;  4W9G A;  3GOE A;  3UIO B;  4BBN F;  3KYC D;  2J0J A;  2DZM A;  1UEL A;  4FN2 A;  1OEY A;  2MWS B;  3QIJ A;  2WX0 A;  4BKS A;  4BOS C;  3UIP B;  4E74 A;  3AU4 A;  2MLB A;  3X0W A;  1HE8 A;  2IZV B;  2JT4 B;  1M94 A;  3DBS A;  2BYV E;  2G4D B;  3W1S A;  4GDK A;  3PRP B;  3U7D A;  2K8H A;  2IO3 B;  5IAA C;  3VUX A;  4FHJ A;  3H9D A;  1Q0W B;  2GMI C;  5DPT A;  2MBH A;  4ANV A;  3IBE A;  4KZC A;  5C23 A;  3VDZ A;  2G4S A;  3BY4 B;  4HCN B;  3U8Z A;  4K81 A;  2ZNV C;  3M63 B;  2KC1 A;  3W1Y A;  1Z2M A;  4WWO A;  2PE6 B;  2ZJD A;  3KW5 B;  1UH6 A;  1YX6 B;  1V86 A;  4JL9 A;  4AUQ C;  4GSW A;  3KYD D;  4J6I A;  3WAL A;  1V49 A;  1AAR A;  2PPH A;  3CSF A;  3C0R B;  5CHW A;  5G55 A;  3ZTD A;  4OVU A;  3DPD A;  3M62 B;  3VVW B;  4FJZ A;  2LVQ A;  1P1A A;  3DDC B;  2DHZ A;  2A4Z A;  2GBN A;  3ALB A;  4NAW A;  1OTR B;  3H7S A;  4JIO U;  2N9E B;  3TL5 A;  3NS8 A;  3VH4 B;  3QJZ A;  4AJW A;  4ANX A;  4E71 A;  2KK8 A;  3HHM A;  5GMV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...