4DWFA

Crystal structure of a hla-b associated transcript 3 (bat3) from homo sapiens at 1.80 a resolution
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
79
structure length
79
Chain Sequence
GEPDSLEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGKVIHLVERAPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a HLA-B associated transcript 3 (BAT3) from Homo sapiens at 1.80 A resolution
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
molecule keywords HLA-B-associated transcript 3
total genus 17
structure length 79
sequence length 79
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4dwfA00
3ZTCA 2DHZA 5J18A 3L0WB 4TV3A 3EHVA 1XQQA 4CYEA 3X23A 4IG7B 5AZGA 2ZPYA 3QHTA 2KK8A 1WH3A 4G50A 3QJZA 2DZIA 3PT2B 3M62B 2LVPA 1QZEA 4ZYNA 5L83A 4MSMB 4FADA 3CMMB 3B1LX 2NVUI 2FAZA 1J19A 2BF8B 3P2BA 2Z59B 4W9HA 3D32A 2KTRB 1E7UA 1OQYA 1YJ1A 4W9FA 4EUTA 2I1KA 2ZEQA 1K8RB 1KM7A 2ZVOA 4I6PA 2D11A 2L0TA 3TJPA 4A3PA 2KKCA 4DBGA 1WZ3A 2C5LC 2ZPNA 1L2NA 3A9KB 2VRRB 4J6IA 2EMSA 2IY0B 4KSLC 4A20A 2AYOB 4EFOA 5JHAA 1E5WA 1V2YA 2LGXA 1WJ6A 4ICVA 3TBLD 1V80A 5E6PA 4JIOU 2MBHA 1EO6A 3ZNHB 3Q3FA 2WX1A 3WA0A 2HE7A 4KV2A 2LVOA 1WRDB 4PS8A 3V6EB 4AJWA 2OOBB 2FCMA 4ZRJA 1WM3A 3DPDA 4GGQA 4W9DA 4XC2A 4F1SA 2ZCCA 4LDTB 4IUMB 2O6VD 1J0GA 2BKFA 1H4RA 2NPTA 3QARA 2BPSA 4WJNA 3T9LA 2L76A 4GMVA 2KFKB 3M63B 4GDKA 5AZFA 5TR5A 4HDOA 3ZUNA 1WJ4A 3QK0A 4AUQC 5E6NA 1VD2A 3MJWA 3PS6A 1SGHA 4WWOA 1UBQA 2FIDA 1G6JA 4ANVA 1GC7A 4HK2A 2D2QA 5L95C 2XK5B 3ZVVA 4HCPB 2KX0A 3PPAA 3QA8A 3QWZB 1P3QU 4W9GA 2N1VA 3EFUA 2KVRA 4BKGA 1Q0WB 1E7VA 2N1WA 1E8XA 1Z2MA 2LRUA 1R4NI 2C7HA 2RR9A 4RMAA 2KDFB 4WWNA 3ZDMC 1KLVA 1MG8A 2WWZA 2WX0A 3ECIA 5KHOA 2DYOA 2IO0B 3ZKJC 3ZTDA 4EKUA 3BY4B 1LFDA 4WAAA 2J0JA 5JHBA 5EDSA 1GJZA 2MP2A 3VFKA 3HHMA 1WGYA 3TIXA 3ZNZB 2RPQA 4W9IA 4NY0A 3NS8A 1XT9B 2CHXA 2JPHA 3DBLI 4GU2A 3IHPC 2R2OA 5J17A 1WR1A 2JVCA 2KDEB 4HWIB 3KVFB 4W9CA 4OVVA 2KC2A 2NPTB 1WE6A 1OEYJ 2L05A 4IC7B 4MSQB 3VQIA 1WYWB 2MA9B 2LI5A 1X1MA 4FHKA 2M0XA 3R3MA 2KANA 2KD0A 2FNJB 5KHQA 4GDLA 4KDLB 3B08A 3TCAA 1TTNA 2JUOA 3N30A 1WXVA 4K7UA 2KOXA 2G45B 4HPLB 5AEKB 1RFAA 1KOTA 3L54A 3A1QA 1UBIA 3A9JB 2LXAA 2LGDA 2JF5A 4GDLB 2JRHA 3M95A 4NQLB 2LXCA 3NHEB 3SD5A 4YL8A 2M4NA 3H7SA 4ICUA 3NZUA 5LXHA 4IW0A 2LRWA 4GXBA 3PRZA 2K8BA 4DHJD 3KUZA 4IM0A 4MJSB 1I35A 4E3CA 4DHZE 4TQ1A 4KZ0A 1RLFA 3JW0X 3V62A 1BT0A 2MBEA 4ANUA 1WGRA 3TMPB 2MLBA 1JRUA 1GUAB 4FULA 4IWOA 3KUDB 2REXA 3QQ8B 4WJQA 1WE7A 2BKRB 3I3TB 3PRPB 1UGMA 2K6DB 1UZXB 4WWPA 3KH0A 4P7IA 3VXWA 4GB9A 1V6EA 2PE9A 4K7WA 5BO4B 4IM2A 2L0FA 4HJKA 3SU8X 3V6CB 4MGZE 2JRIB 2MWSB 4K1RB 4KSKC 2MX2A 1D3ZA 2MRPA 3NZSA 2RSUA 2O2VB 2XBBC 2IO1B 2NR2A 4XZ4A 1S3SG 1WMHB 3WANA 3APFA 3VTWA 1R4MI 2KC1A 2KLGA 3K9OB 4ASWC 1L7YA 2BYFA 3KYCD 1GG3A 1SE9A 4JQWC 1IYFA 4FJZA 2KZRA 3K9PB 3PRMB 1IPGA 3A9JA 2ZNVB 2KO3A 4IWQA 4HVBA 2BWES 4JL9A 3T8MA 2LASA 2WDTB 5D2MB 2FIFA 5AZHA 4CHKA 2JXXA 3VUXA 2IY1B 1T0YA 1LQBA 1RAXA 3PGEA 3CF6E 3KW5B 1YD8U 2V4LA 2NCNA 3A9KA 4MELA 2JT4B 5CTRC 2LGYA 2N4FA 3OJ3A 4FA6A 4ZDVA 3GOEA 3PTFC 3ZO5B 3AU4A 3VTVA 5FR6A 4BKSA 4F8CB 2L8JA 2MBOA 2K1FA 3VUYA 3KUCB 4ZRIA 1UD7A 3PREA 4WJOA 3ZNID 1WX7A 4TQ0A 2HTHA 2V1YA 3VAWA 2MP2B 3RUIB 3A4SC 2GMIC 2R2QA 3QC8B 3DVGY 4KIKB 3RULA 3EECA 2M8SA 1UH6A 1V5TA 3CSFA 3KYDD 4F7ZA 2C7NB 2DX5B 3Q3JA 1WF9A 4BOZB 5J2RA 2A5UA 2AEHA 3QX1A 2MCNB 4LJPB 3IVFA 3OAWA 2UWQA 4OVUA 2KDIA 4KVGB 3X0WA 3A1QB 3L10B 1NDDA 3JSVA 4B6WA 4WQOB 3A33B 2ZJDA 4XX5A 4BFRA 4GOCA 1J8CA 4ZRKA 3CSTA 3IBEA 3UGBB 3V61A 2HJ8A 5D7GA 4EEWA 3PVLA 4LJOB 4EZLA 3UF8A 4AWJA 4TUUA 4BBNF 2JY6A 4HLEA 1V9JA 4MDKE 4GSWA 3MHSD 4M8NA 3R66C 2FCNA 3S2AA 4B9KA 3DBSA 5G2NA 4DK5A 4I6LB 4NJ7A 1S1QB 4FLHA 1TZ1A 1Z5SB 2NBWB 1LXDA 4BBNC 4DDGD 2OJRA 2NBUA 2GBJA 3NY5A 3W1SA 4PS7A 3APDA 4BKTA 3R7QA 1WJUA 4HXDA 4M0WB 3AXCA 4MGYE 2DZJA 2RD0A 3IG3A 4IWPA 4HCNB 4PYZA 3WAPA 3DVGX 3RT3B 1TGZB 3RZWC 3ML9A 5C1ZA 3VUWA 2N7EA 3DQVA 2GBNA 5JZEB 3N32A 2KJRA 3DVNV 1E8WA 4G11A 5C23A 2Z0DB 2JZ3B 1WGHA 2CKHB 2KJHB 3H7PA 3ONSA 2O6VB 1OGWA 3QIJA 2YLMA 5LXIB 4JLCA 5E6OA 3DBHI 3ML8A 3WIMA 3PLVA 3UIOB 2RGFA 5IAAC 1WR6E 4WJPA 3TL5A 2XEWA 1VCBA 1WX9A 4GDKB 2CHZA 3UINB 1OTRB 2ZCBA 1WMHA 3PLUA 4MM3A 3DCGA 2K39A 5D94A 1GC6A 2GOWA 2DZKA 2PJHA 3L08A 4E74A 4EOYA 2KMAA 2KWCA 2W9NA 3L16A 1P9DU 1V81A 1Q5WB 4DHJB 1AARA 2KTRA 3PSEB 2LJ5A 4KDIC 4AP4C 4ANXA 2GBMA 2LWPA 2JZZA 4GIVA 1U4AA 4IM3A 2AL6A 3UQBA 2K8HA 3C0RB 4DXAB 3WAOA 2C60A 4FBJB 1YIWA 3UQAA 4NQKE 2DENB 4K7SA 1ZGUB 1ISNA 4JGHB 3SHQA 1CMXB 1M94A 3ZW3A 4HDQA 3LDZE 2AL3A 2PE6B 4EZKA 4MH0E 3ZIMA 5G55A 2KWUB 3H7PB 3U8ZA 2CR5A 1WM2A 3GZNI 4NJ6A 3ZRCA 1WFYA 1WXAA 2M17A 5DCNA 2EMTA 1KJTA 4RM9A 1WGGA 2MBQA 2HD5B 3QAQA 1GNUA 4MGKE 1E90A 4HPMB 4LCDE 1C3TA 4II2B 1YX5B 2NBVB 2GBKA 4KIKA 4EZJA 4CO7A 2KX3A 1OEYA 2KHWB 3DBRI 1WZ0A 2N9PC 3HIZA 3PHXB 5IA7A 1WXSA 2FUHB 2LZ6A 1E8ZA 2IYDB 5GMVA 4II3B 4K81A 4PYUA 2GBRA 3IFWB 5CX3A 3JSVB 2I1JA 1LM8B 1NI2A 4KZCA 2Y5BB 5HKHA 3OLMD 2K6QA 2CU1A 2PEAA 3WAMA 1XD3B 2G4SA 2N9XA 3L17A 1EUVB 4W9KA 1Q1OA 2Z0EB 1HE8A 3JVZX 3ZLZA 3ZRFA 2ZNVC 2MW5A 2PPHA 3DDCB 2BYVE 4B95A 1WI0A 3VDZA 4BVUC 4LDTD 3VH4B 1PQSA 1A5RA 1WIAA 2A4ZA 1V5OA 5DPRA 3H6NA 4I6NB 1YQBA 2ASQA 1EF5A 2XK5A 1IP9A 4DDID 3W1YA 3BINA 3PV1A 3ZDTA 2ZZPB 3A4RA 2KWVB 3UIPB 1FXTB 4TKNA 3RZFA 3HM3A 1P0RA 3ALBA 4BKSD 1V49A 4FJVB 2KQ7A 1P1AA 4GN1A 3N3KB 3RCZA 2KNBA 1EF1A 2KDBA 3B0AA 5CHFA 2D3GA 2LD9A 2C9WB 4W9LA 2LUEA 2G4DB 4M8MA 5LLIA 5DPSA 2L3ZA 2B3AA 2KJ6A 3VVWB 2V3SA 1RRBA 3SDLC 2L00B 2IBIB 4DHZB 4G0NB 1WJNA 2WYQA 1Y8RC 3QCAA 4NAWA 2ZVNA 1WX8A 4A3OA 2K25A 3OJ4B 2KFKA 2UYZB 2KMCA 4N9F4 3VH3B 2N9EB 3R7RA 2CS4A 4MGIE 4NNJB 5D6JB 3WALA 1SIFA 2BYEA 2IZVB 4E71A 2KXJA 3JYUA 3PHWB 4NAWB 3AI5A 1ZW7A 1F9JA 3MTNB 2BGFA 1TBEA 2YVCA 2J0KA 1ZKHA 3VTUA 2N7DA 3AU5A 3APCA 4PS3A 2KFJA 3U7DA 4BOSC 3AULA 1E8YA 2D10A 2DAFA 2C7MB 2J0MA 3H9DA 2LVQA 2KQSA 5DPWA 2DZMA 2KTFA 3NOBA 1NBFC 4MEMA 2FCSA 4FHJA 1V86A 3RD2A 3LJ3A 4FN2A 2JWZA 1YX6B 2CHWA 2DYBA 4MJSA 4RM8A 2KLCA 4NPNA 4URKA 4AJYB 5DPTA 1I42A 2MSED 2NS5A 2KN5A 2IO3B 4X57B 5JH5C 4W9JA 2J7QB 4DWFA 3PZDA 2FCQA 2EKEC 2MQJA 2O6VA 3M3JA 3ENEA 1WY8A 3O65B 2O2VA 3V60A 2MBBB 3HK0A 3DVNU 2D07B 1WGDA 4ANWA 4FJYA 1WXMA 2AWTA 3ZNGC 3DOWA 5CHWA 5CHVC 2G3QB 2IO2B 3H1UA 2DAJA 3L13A 3VHTC 2BWFA 3EC8A 2M1MA 4AOFA 4W9EA 1H8CA 1UELA 2K8CA 3U30A 3RYTA 3HM6X 2DYMA 2L7RA 3W1SC 1P98A 4G3XB 1C1YB 2QHOA
chains in the Genus database with same CATH superfamily
1FFVA 1ZPSA 5IP4D 4A8XC 1IGDA 3X23A 4IG7B 3QJZA 2DZIA 3PT2B 2LVPA 4MSMB 4M02A 4FADA 2FAZA 3T3OA 4EUTA 2D11A 1N6ZA 2KKCA 4HKZE 2C5LC 1XLNA 3GP7A 3A9KB 4KSLC 2EMSA 2AYOB 2KAJA 1D5ZC 2DLBA 3GS2A 1E5WA 4US8A 5E6PA 1VZ8A 1EO6A 1L6UA 4OZBA 1WRIA 2J52A 5H92C 1WRDB 4W9DA 3AE6B 4PT5A 4LDTB 1J0GA 1TS2A 2E6XA 3QARA 2BS4B 4UDUC 1FIQA 2SAKA 3N1XC 4AUQC 5E6NA 1CZPA 1RFKA 2FIDA 2DBYA 1YNTE 4ANVA 3NVZA 1PGBA 4HCPB 2KX0A 4USAA 4W9GA 3E56A 1ZDVA 3DBHB 1PGAA 4REZA 2RR9A 2K3UA 1XLOA 2KDFB 1EM7A 3ZDMC 3Q2AC 2FE8A 3VRAB 3ECIA 5KHOA 3ZKJC 3E9SA 5EDSA 3MJ5A 1GJZA 2LHEA 3BWUD 3HHMA 2QILA 3DBLI 1M4VA 1WR1A 4HWIB 4W9CA 3EGRA 1OEYJ 4ARIA 4IC7B 2MA9B 2LI5A 4OVZA 4ACFA 1T6BX 5BMIA 1TTNA 4K7UA 1KTKA 2KYWA 2G45B 2KOXA 4C4VA 4WAFA 2LXAA 3J9CA 3M95A 4NQLB 2WDVB 2LRWA 1GB4A 4DHJD 3KUZA 4IM0A 1RLFA 2MBEA 3TMPB 2MLBA 3QQ8B 1NYRA 3I3TB 2LGSA 2UU7A 2LUMA 3PRPB 1UGMA 3VXWA 3KH0A 5EE3A 3V6CB 1DOXA 3GB1A 2JRIB 2MX2A 1D3ZA 2RSUA 1ACCA 2J53A 3Q8FA 2NR2A 4XZ4A 4JE3B 3L4PA 3KYCD 1SE9A 3K9PB 1NENB 3KWVA 3A9JA 4HVBA 2V9HA 4N6EB 2FIFA 4CHKA 3VUXA 1T0YA 1LQBA 3PGEA 3CF6E 4XDCA 1NI3A 3A9KA 2N4FA 3OJ3A 3PTFC 3ZO5B 3AU4A 2L8JA 2L52A 3PREA 3VAWA 3TEXA 2GMIC 3QC8B 3DVGY 3N1YC 4F7ZA 2C7NB 4WH4A 1FXAA 4BOZB 2AEHA 1E6EB 2W3SA 2WDRB 3AB5A 1HTOA 1K53A 2WXPA 3CSTA 3ZXRA 1DYQA 2KMMA 2PTLA 4BBNF 2YEPB 4HLEA 4B9KA 1JCKB 5G2NA 4J3OD 4NJ7A 1Z5SB 2WXGA 3W1SA 1QILA 3PZ8A 1ET9A 4HXDA 4MGYE 3N1ZC 1YQ3B 2DZJA 3IG3A 2MEKA 4IWPA 4HCNB 5T8IA 3RT3B 1TGZB 3ML9A 3DQVA 1XCTL 3NS1A 3N32A 3ZJTA 1FNVA 2KJRA 3DVNV 4G11A 4OZCA 2JZ3B 2IGGA 1OGWA 1K51A 2GB1A 4O1NA 1MJDA 2QIEB 4ZYSA 3C19A 1BXTA 3UIOB 4KX6B 2WU5B 1WX9A 3UINB 2JXTA 3AE1B 2DZKA 1C78A 2W9NA 2KWCA 3L16A 4S0RA 4HKQA 1U4AA 2AL6A 4DXAB 4FBJB 3UQAA 4NQKE 4K7SA 1ZXIA 4GLSC 1I4PA 3AE4B 4ITKA 4HDQA 3LDZE 4C7ZA 4MH0E 1FRRA 2CR5A 2WLBA 4MH8A 1WXAA 5DCNA 4RM9A 2MBQA 2R61A 3VRBB 3QAQA 5HI1A 3MHZA 4HPMB 3I57A 4II2B 1JW9D 2ICIA 1UUPA 1I4HA 3PHXB 1OEYA 3NRZA 3W5VB 1WXSA 2LZ6A 1E8ZA 5JXVA 4C4VB 5GMVA 3V3XA 4KGRA 4K81A 1V1PB 1GB1A 2I1JA 1YOVB 1LM8B 3SFDB 4KZCA 5HKHA 1L0YB 2PEAA 5C2TB 2N9XA 1EUVB 4W9KA 1Q1OA 2Z0EB 4LNIA 3BK2A 1HE8A 4QAYA 3LB8C 3DDCB 4AS1A 3BYTB 4BVUC 3VH4B 1QT9A 2VZKB 1IP9A 3PO0A 3Q3OC 4AQ7A 1T5XD 4BKSD 1V49A 4JPSA 2BS3B 1P1AA 1SBBB 2LGIA 3RCZA 2KNBA 2JU6X 2NTSA 1FEHA 2G4DB 1MHHE 2QMTA 1FCLA 5DPSA 2L3ZA 1WJNA 1SE3A 1Y8RC 1WX8A 4L23A 1L4ZB 4N9F4 1YN5A 5D6JB 1TS3A 2BYEA 3ZQ4A 3B9JA 2AQ3B 2KXJA 3JYUA 3PHWB 1HZ6A 1VRAB 1F9JA 1GPXA 2YVCA 2G9HD 3BVZA 2J0KA 3VTUA 2N7DA 3FC4A 1E8YA 3NJTA 1CK1A 2LVQA 2KTFA 1NBFC 4MEMA 1V86A 4MT5A 2KLCA 2WXIA 1TY0A 2MSED 4X57B 5JH5C 1UNSA 2J7QB 2AQ1B 4ZHOA 3RNBC 3M3JA 2BVCA 3ENEA 1WY8A 3HK0A 2N7JA 1WXMA 3ZNGC 3DOWA 1C76A 2IO2B 2V3PA 3VHTC 3U52E 3RNGC 3EC8A 1IBXB 1UELA 3U30A 3HM6X 3HVZA 2D3CA 3GE3C 2QHOA 3ZTCA 5J18A 3RFZB 4TV3A 3EHVA 3QHTA 2BTEA 4G50A 4C80A 2QSDA 1LO5D 3CMMB 1V1PA 3D32A 2KTRB 1E7UA 3NVWA 1OQYA 2KT7A 4W9FA 3MC8A 2INDC 2I1KA 2INCC 4I6PA 4DXFA 1XO3A 1A70A 1FD6A 2JWUA 2ZPNA 2VRRB 4J6IA 2FUG1 5JHAA 2LGXA 1WJ6A 4JIOU 2MBHA 5HHDG 3BZDB 2WX1A 1XEEA 3BVGA 2AQ2B 3I63C 4AJWA 2OOBB 4P1CC 2FCMA 2JZPA 3U4EG 3DPDA 1N61A 1H4RA 2NPTA 2TSSA 3T9LA 2L76A 2QEJC 4GMVA 3M63B 1VD2A 3Q8CA 1UBQA 2WNMA 3PPAA 3QA8A 3QWZB 3GZNB 1DOIA 2KVRA 4BKGA 1Z2MA 1E7VA 4WWNA 4LK0M 4JX1C 2LJIA 2WX0A 2DYOA 3AN1A 4C56C 3BY4B 1LFDA 4WAAA 4KGTA 5JHBA 3DBRB 2WXRA 1JWAD 3TIXA 4LNFA 1KRHA 4GU2A 1XT9B 2CHXA 2ONQA 2R2OA 2JVCA 1FRDA 2N0SB 1WYWB 3N20C 1KLUD 1TKGA 4FHKA 2M0XA 3R3MA 1MFWA 1CJEA 1TYGB 4GDLA 3ETRA 3B08A 3TCAA 2JUOA 3N30A 3ZXVA 1KOTA 1UBIA 3A9JB 2JF5A 4GDLB 2JRHA 1HQRD 3BK1A 2M4NA 1VLBA 2M19A 1Q10A 4IW0A 4GXBA 3PRZA 2K8BA 2W55A 2X8XX 4MJSB 4DQOC 4DHZE 1F77A 4KZ0A 3V62A 3JW0X 1L5PA 1F1HA 1UZXB 4GB9A 4TMAB 2PE9A 4K7WA 2WS3B 3CWIA 3R8BA 4K1RB 4KSKC 4P6VF 2IO1B 4IOIE 1SJED 2PVGC 4RH6A 3WANA 2VH1A 1R4MI 2KC1A 2KLGA 4ASWC 1L7YA 1IPGA 4IWQA 2LASA 2WDTB 5AZHA 1YN4A 2H89B 1YD8U 2WHIA 5CTRC 4ZDVA 3GOEA 1EWCA 1B9RA 2MBOA 2K1FA 3HRDD 3KUCB 4ZRIA 1GAQB 2B76B 2MJEA 3V05A 1WX7A 2V1YA 3W2DA 1N5WA 5I4DA 1UH6A 2M8SA 4YWGG 1WF9A 1D6EC 5J2RA 3IT6B 4LJPB 2UWQA 3L10B 3CIRB 3JSVA 2XNAC 3AEEB 2PVOD 4B6WA 3FAHA 3DHHC 3DHIC 1T3QA 5BYQA 1T0RC 4RGMA 2QCZA 4ZOHC 1SB3C 4L2YA 3P4PB 3RNAC 1PGXA 5D7GA 4EEWA 1C4PA 4EZLA 3BIID 2OHFA 1RWSA 4CQNA 3R66C 3DBSA 3Q8AA 1VZ7A 5FR3A 4KGSA 2NBUA 1HA5A 2KDMA 3APDA 3NVVA 2K0PA 3AXCA 2RD0A 4XE0A 3ABVB 3WAPA 1HTQA 3RZWC 5JZEB 1KFYB 1E8WA 2INPE 2Z0DB 1WGHA 2E3TA 2CKHB 2KJHB 4RFBA 3H7PA 3IAS1 3ONSA 3QIJA 4WURA 5LXIB 1SIJA 3DBHI 4RF0A 2CJOA 3WIMA 2NTTA 2RGFA 1WR6E 2JSVX 4YTPB 5AUIA 1KF6B 5IOIA 2CHZA 1OTRB 2V0GA 3MC0B 3PLUA 1F52A 2K39A 2GOWA 2PJHA 1AARA 3VR9B 4KDIC 3DBLB 1DOYA 2GBMA 2C60A 2DENB 1ZGUB 5GXGB 1CMXB 3ZW3A 3T3NA 5FK9C 2PE6B 3FILB 1ZDXA 3VR8B 1WM2A 4YSXB 1WFYA 2M17A 3FILA 2HD5B 4IKGA 1R4NB 4MGKE 3NZ3A 5C3JB 4LCDE 1JWUD 1XF5L 3P4SB 2EELA 2JYTA 2KX3A 3DHGC 1E10A 2KACA 3HIZA 4II3B 5MPOA 4PYUA 1UWXA 2GBRA 3DWMA 1NI2A 3OLMD 3WAMA 1XD3B 1JQ4A 3JVZX 2L1AA 4LDTD 1PQSA 1WIAA 3H6NA 4I6NB 1YQBA 2ASQA 2XK5A 2HDEA 3P42A 1ET6A 3BINA 3AEDB 3TUOA 1NYQA 2KWVB 3A4RA 3UIPB 4A55A 2IDYA 1P0RA 4FJVB 2Q5WD 1L0XB 1J7BA 1FCCC 1XLPA 2D3GA 4W9LA 3EFCA 1V8CA 2V3SA 4XWWA 1FM0D 2ZVNA 4A3OA 2KFKA 2UYZB 4JWSC 1JROA 2OJWA 2CS4A 5D3DA 4NAWB 3AI5A 1ZW7A 3MTNB 2H88B 1KLGD 1ZKHA 4BOSC 2D10A 2ON8A 1D5MC 5DPWA 1EU4A 1OQQA 3RD2A 3Q8EA 4YTNB 4URKA 4PK1A 2NS5A 2KN5A 2IO3B 4JWUC 3AMZA 1VJKA 3O65B 2O2VA 3DVNU 2D07B 1WGDA 4ANWA 4H2AA 2G3QB 2DAJA 3W5UB 1TT5B 5AUKA 2OEDA 4AOFA 2M1MA 4W9EA 1SF0A 3P4QB 2BYTA 3R2TA 3MFGA 2DHZA 3L0WB 1XQQA 4CYEA 3OWEB 5AZGA 2ZPYA 1WH3A 3M62B 4ZYNA 2EKIA 4W9HA 1C9FA 4YTMB 3B2GA 2WXNA 2ZEQA 1K8RB 4HRSA 3ZGZA 2L32A 4A3PA 4DBGA 1WZ3A 1MG4A 4A20A 1EU3A 4ICVA 1V80A 3ZNHB 3Q3FA 2HE7A 2LVOA 4PS8A 1K52A 4ZRJA 4KKJA 4RCOA 3KQ4A 3OG5A 3U7ZA 4F1SA 2ZCCA 4IUMB 2BPSA 5FKAC 4GDKA 5AZFA 5TR5A 4HDOA 3ZUNA 1WJ4A 3QK0A 4ZRPA 1MHXA 1VZ6A 3PS6A 4WWOA 3DWGC 2WU2B 4HK2A 5L95C 2LMCA 2XK5B 1J7AA 3Q3MC 3EFUA 1E8XA 2N1WA 2LRUA 4XWTA 2V3NA 4YSZB 2IO0B 3ZTDA 4EKUA 1QKZA 1B1ZA 2J0JA 2LEKA 1VR9A 2PLPA 4NY0A 3NS8A 4HEA1 2JPHA 2K5PA 1IBXA 2WXLA 3IHPC 5J17A 3AEGB 2KDEB 3KVFB 2KC2A 3BYYB 2BW2A 2L05A 3VQIA 3IT4B 1JMLA 1FO4A 3RNEC 2LFIA 2IJ0A 2KANA 2KD0A 2FNJB 1QLBB 4KDLB 4RGNA 1QOAA 1WXVA 2JX5A 5AEKB 3L54A 4B0EA 2J4XA 2LGDA 2MJDA 5LXHA 2SEBD 1I35A 1YJJA 4E3CA 4TQ1A 2N9KA 1BT0A 4ANUA 4WJQA 4FULA 3KUDB 2REXA 1WE7A 4WQMA 4LTUA 2PKOA 2K6DB 5EE0A 1ROEA 4C7YA 3AE9B 5BO4B 1K50A 4LLGM 4NJCA 2RDHA 1L6VA 3IXSA 4MACA 2ZW0A 2O2VB 3AH7A 2XBBC 1RYJA 1WMHB 3AECB 4LNKA 3TEZA 1GG3A 2KZRA 3PRMB 5EE1A 2BWES 4JL9A 3T8MA 1AW7A 1HZ5A 1FXIA 2JQRB 2XN9C 1WXQA 2BS2B 1RAXA 1YQ4B 3KW5B 2V4LA 2NCNA 1TKYA 2JT4B 4FA6A 2WXMA 4F8CB 1L0VB 1UD7A 4TQ0A 2HTHA 2MP2B 1XXGA 2NMQA 2GI9A 5G5GA 3RULA 3KYDD 5IN7A 1WGKA 2WXFA 3QX1A 1MVKA 3KLSX 4KKIA 2KDIA 3A1QB 4WQOB 1IGCA 4XX5A 3RMKC 3ZJVA 4BFRA 4GOCA 3SFEB 5E6JA 1J8CA 3IBEA 3UGBB 1ZOYB 2HJ8A 3V61A 3PVLA 4LJOB 4EE2A 4TUUA 2Z8LA 2JY6A 2RDGA 2FCNA 3S2AA 1SE4A 4I6LB 4FLHA 1LXDA 4BBNC 4DDGD 4A6QA 1JWMD 3R7QA 1WJUA 3C8YA 4M0WB 3Q8BA 3DVGX 5C1ZA 5D3IB 1HXYD 1IUEA 3VUWA 2N7EA 2GBNA 3HUIA 1UWMA 3P63A 1OQRA 1RM6C 2IGHA 1NVID 5IAAC 4WJPA 3TL5A 1N60A 1SJHD 2XEWA 1UF0A 1WMHA 2KQ4X 4MM3A 2VZKD 5D94A 1GC6A 3U2SC 1V81A 1Q5WB 2KTRA 3PSEB 2LJ5A 4ANXA 3PZ7A 2JZZA 2LWPA 4GIVA 4OZAA 3WAOA 1YIWA 3SHQA 1TJEA 4JGHB 1P7FA 1FPYA 2AL3A 4EZKA 3KWLA 2BB5A 2KWUB 5BYRA 1I4RA 5BMHA 4HROA 1F0ZA 4NJ6A 1ZUD2 1KJTA 2X38A 1WGGA 1E90A 4P1BC 1ZE3D 1C3TA 4FXCA 1YX5B 2ACZB 2I38A 2GBKA 2NBVB 4K3BA 2KHWB 1WZ0A 2N9PC 5IA7A 2FUHB 2IYDB 1FNUA 4B0MA 1SEBD 2K6QA 1I4QA 1JALA 1C77A 1J7CA 1UGJA 2IPKD 4B95A 1WI0A 2WGSA 1A5RA 1V5OA 1EF5A 1PDXA 3IAM1 3ZDTA 3AEFB 3P1MA 2K22A 1TZOA 2ZZPB 1ESFA 1FXTB 3RNCC 3RZFA 3HM3A 1TS5A 1R4MB 3AEBB 2KQ7A 4D2KA 2KDBA 5CHFA 1NEKB 2LUEA 4YSYB 3P4RB 2KJ6A 3RPFC 1RRBA 3SDLC 2L00B 2IBIB 4DHZB 4G0NB 2WYQA 2W54A 4RNAA 2K25A 1SSNA 1JWBD 1YN3A 2N9EB 4MGIE 1VDVA 4XYCA 3WALA 2IZVB 4E71A 1D4BA 1TBEA 4DXGA 3APCA 1JWSD 3U7DA 3AULA 3H9DA 2C7MB 2J0MA 1STEA 1OFFA 4ZHPA 3NOBA 4FHJA 3LJ3A 2CHWA 2DYBA 2WP9B 4MJSA 3Q69A 2FBWB 1I42A 3PZDA 2FCQA 2EKEC 2MQJA 3NG0A 4FJYA 1QOFA 2AWTA 5IO9A 2BWFA 3Q14C 1H8CA 1PFDA 3W1SC 1P98A 1QOGA 1C1YB 2KK8A 5L83A 1QZEA 2KN4A 2QC8A 3B1LX 2NVUI 1J19A 2BF8B 3H8HA 2Z59B 3P2BA 1YJ1A 4RGOS 1KM7A 2ZVOA 2L0TA 3TJPA 5EE9A 3AE5B 1L2NA 1KLVA 2IY0B 4EFOA 1PUTA 1V2YA 3TBLD 2YEPF 3FKYA 2BT6A 3Q3NC 4M01A 3WA0A 4KV2A 3V6EB 4XDDA 1WM3A 3AEAB 4GGQA 4XC2A 1C79A 2O6VD 1E9MA 2BKFA 2WXJA 1AYFA 1QQRA 4WJNA 5G5HA 1P7EA 2KFKB 1T0QC 2V4IB 3NUHB 3MJWA 1SGHA 1G6JA 1GC7A 2D2QA 3ZVVA 1YMHE 2I2YA 4BZAA 3SEBA 1P3QU 2D5GA 2MH7A 2N1VA 3EA6A 1Q0WB 1R4NI 1YJIA 2C7HA 1I7HA 4RMAA 3I5JC 1MG8A 2WWZA 2PW9A 2MP2A 3AE7B 3MP9A 3VFKA 1WGYA 3ZNZB 2RPQA 4W9IA 1L4DB 1DGJA 3AM9A 2DNFA 4LNNA 4OVVA 2NPTB 1WE6A 2BB6A 4MSQB 1X1MA 2PMVA 1N63A 4YXDB 5KHQA 1FMAD 2D3BA 3HVDA 4HPLB 1RFAA 3A1QA 1V1OA 3SR6A 2LXCA 3NHEB 3SD5A 2HTME 4YL8A 1MPEA 3H7SA 4ICUA 2G1EA 3NZUA 2WXQA 4NAMA 4ARCA 2Y3AA 2W3RA 1WGRA 1JRUA 1GUAB 1AN8A 4IWOA 4RF1A 1FNWA 3R2IA 2BKRB 2KVZA 1TS4A 4M0WA 4WWPA 4P7IA 1V6EA 1WYGA 4IM2A 1QOBA 2L0FA 4HJKA 3AE8B 3SU8X 2MHJA 4MGZE 2MWSB 2MRPA 4BAXA 3NZSA 3GE8C 3LYYA 1LGRA 1S3SG 2J42A 3AV8A 1AWDA 3APFA 3VTWA 2INNE 3K9OB 2BYFA 4JQWC 1IYFA 1TY2A 4FJZA 2ZNVB 2KO3A 2Y5CA 5D2MB 2JXXA 2RDBC 1BMLC 2IY1B 4MELA 2LGYA 3VTVA 2L83A 1ZP0B 5FR6A 4BKSA 3EUB2 1V97A 2M0AA 2GRIA 1PYWD 3VUYA 3ZNID 4WJOA 2LHDA 3RUIB 3A4SC 2CU3A 2R2QA 1I4GA 1E7PB 4KIKB 3EECA 1V5TA 3CSFA 5IKCM 2DX5B 3Q3JA 2A5UA 1CQVA 1D5XC 2MJ3A 2MCNB 3AE2B 3IVFA 3OAWA 4OVUA 3X0WA 4KVGB 4C00A 1NDDA 4LNOA 3A33B 2ZJDA 4RGTA 3Q6BA 3B2FA 4S17A 1HEZE 2ZW1A 1MI0A 4ZRKA 2Y5PA 1N62A 4HJGE 3UF8A 1TKEA 4AWJA 1N5XA 1V9JA 4MDKE 4GSWA 3MHSD 4M8NA 4XGAB 4DK5A 1T0SC 1BUIC 1S1QB 2VH2A 1TZ1A 5BMGA 4L1BA 2NBWB 2M56B 2OJRA 1WSPA 2GBJA 3NY5A 4PS7A 2JYEA 4TSSA 4BKTA 4PYZA 5LNK1 3LXFA 3ZYYX 4K3CA 4M00A 5C23A 2AX5A 2O6VB 2RMMA 2YLMA 3I9V1 4JLCA 5H8YE 5E6OA 3ML8A 3AE3B 3RNFC 3PLVA 2IGDA 1VCBA 4GDKB 2ZCBA 1ENFA 1ZXHA 3DCGA 2DWQA 3N9YC 2D3AA 2N9LA 3L08A 4E74A 4EOYA 2KMAA 1FFUA 2WDQB 1P9DU 4DHJB 4ZRQA 4AP4C 4IM3A 3UQBA 2K8HA 3C0RB 1ISNA 1M94A 4HPPA 2CJNA 1I4XA 3MC9A 3ZIMA 5G55A 3H7PB 3U8ZA 3WCQA 2WXOA 3GZNI 4N58A 3ZRCA 4IDIA 1GOZA 2EMTA 4N59A 2QJLA 1GNUA 1TIFA 4KIKA 2BQQA 4EZJA 4CO7A 4YT0B 3URYA 3NVYA 2HJ1A 3DBRI 1R7SA 2WXHA 4A90A 3IFWB 5CX3A 1SE2A 3JSVB 3W9CB 2RPVA 4MM3B 2Y5BB 4Q2JA 2CU1A 2G4SA 1EWYC 3L17A 3ZLZA 3ZRFA 1Y56A 2ZNVC 2MW5A 2PPHA 2BYVE 3VDZA 5HFYA 1F2RI 2A4ZA 5DPRA 2BBCA 1JRPA 2WXKA 1KH0A 4DDID 3W1YA 3PV1A 4TKNA 3ALBA 4R3DA 4GN1A 3N3KB 1EF1A 3B0AA 4WWMA 2LD9A 3RI7C 2C9WB 2GLSA 2PIAA 4M8MA 5LLIA 1WWTA 2B3AA 3VVWB 1XLQA 3TEWA 3TSSA 3UI3A 3QCAA 4NAWA 3OJ4B 4A9AA 4US9A 1SXTA 2KMCA 3VH3B 3R7RA 2QDFA 4NNJB 1SIFA 2WQYB 2W82A 3ZJUA 2BGFA 2K9XA 4PS3A 3AU5A 2KFJA 2DAFA 3TEYA 2KQSA 1QF6A 2DZMA 1F2RC 2FCSA 4FN2A 2JWZA 1YX6B 3O13A 4RM8A 4NPNA 5HG2A 4NZLB 5DPTA 4AJYB 4W9JA 4DWFA 1C4AA 2O6VA 1XCQL 3V60A 4P16A 1E0ZA 2MBBB 1C4CA 3RN9C 2KWDA 4OHJA 5BYSA 5TSSA 5CHWA 5CHVC 3H1UA 3L13A 4OW0A 4WIPA 2K8CA 3BVMA 3RYTA 2DYMA 2L7RA 4G3XB
chains in the Genus database with same CATH topology
3ZTCA 2DHZA 5J18A 3L0WB 4TV3A 3EHVA 1XQQA 4CYEA 3X23A 4IG7B 5AZGA 2ZPYA 3QHTA 2KK8A 1WH3A 4G50A 3QJZA 2DZIA 3PT2B 3M62B 2LVPA 1QZEA 4ZYNA 5L83A 4MSMB 4FADA 3CMMB 3B1LX 2NVUI 2FAZA 1J19A 2BF8B 3P2BA 2Z59B 4W9HA 3D32A 2KTRB 1E7UA 1OQYA 1YJ1A 4W9FA 4EUTA 2I1KA 2ZEQA 1K8RB 1KM7A 2ZVOA 4I6PA 2D11A 2L0TA 3TJPA 4A3PA 2KKCA 4DBGA 1WZ3A 2C5LC 2ZPNA 1L2NA 3A9KB 2VRRB 4J6IA 2EMSA 2IY0B 4KSLC 4A20A 2AYOB 4EFOA 5JHAA 1E5WA 1V2YA 2LGXA 1WJ6A 4ICVA 3TBLD 1V80A 5E6PA 4JIOU 2MBHA 1EO6A 3ZNHB 3Q3FA 2WX1A 3WA0A 2HE7A 4KV2A 2LVOA 1WRDB 4PS8A 3V6EB 4AJWA 2OOBB 2FCMA 4ZRJA 1WM3A 3DPDA 4GGQA 4W9DA 4XC2A 4F1SA 2ZCCA 4LDTB 4IUMB 2O6VD 1J0GA 2BKFA 1H4RA 2NPTA 3QARA 2BPSA 4WJNA 3T9LA 2L76A 4GMVA 2KFKB 3M63B 4GDKA 5AZFA 5TR5A 4HDOA 3ZUNA 1WJ4A 3QK0A 4AUQC 5E6NA 1VD2A 3MJWA 3PS6A 1SGHA 4WWOA 1UBQA 2FIDA 1G6JA 4ANVA 1GC7A 4HK2A 2D2QA 5L95C 2XK5B 3ZVVA 4HCPB 2KX0A 3PPAA 3QA8A 3QWZB 1P3QU 4W9GA 2N1VA 3EFUA 2KVRA 4BKGA 1Q0WB 1E7VA 2N1WA 1E8XA 1Z2MA 2LRUA 1R4NI 2C7HA 2RR9A 4RMAA 2KDFB 4WWNA 3ZDMC 1KLVA 1MG8A 2WWZA 2WX0A 3ECIA 5KHOA 2DYOA 2IO0B 3ZKJC 3ZTDA 4EKUA 3BY4B 1LFDA 4WAAA 2J0JA 5JHBA 5EDSA 1GJZA 2MP2A 3VFKA 3HHMA 1WGYA 3TIXA 3ZNZB 2RPQA 4W9IA 4NY0A 3NS8A 1XT9B 2CHXA 2JPHA 3DBLI 4GU2A 3IHPC 2R2OA 5J17A 1WR1A 2JVCA 2KDEB 4HWIB 3KVFB 4W9CA 4OVVA 2KC2A 2NPTB 1WE6A 1OEYJ 2L05A 4IC7B 4MSQB 3VQIA 1WYWB 2MA9B 2LI5A 1X1MA 4FHKA 2M0XA 3R3MA 2KANA 2KD0A 2FNJB 5KHQA 4GDLA 4KDLB 3B08A 3TCAA 1TTNA 2JUOA 3N30A 1WXVA 4K7UA 2KOXA 2G45B 4HPLB 5AEKB 1RFAA 1KOTA 3L54A 3A1QA 1UBIA 3A9JB 2LXAA 2LGDA 2JF5A 4GDLB 2JRHA 3M95A 4NQLB 2LXCA 3NHEB 3SD5A 4YL8A 2M4NA 3H7SA 4ICUA 3NZUA 5LXHA 4IW0A 2LRWA 4GXBA 3PRZA 2K8BA 4DHJD 3KUZA 4IM0A 4MJSB 1I35A 4E3CA 4DHZE 4TQ1A 4KZ0A 1RLFA 3JW0X 3V62A 1BT0A 2MBEA 4ANUA 1WGRA 3TMPB 2MLBA 1JRUA 1GUAB 4FULA 4IWOA 3KUDB 2REXA 3QQ8B 4WJQA 1WE7A 2BKRB 3I3TB 3PRPB 1UGMA 2K6DB 1UZXB 4WWPA 3KH0A 4P7IA 3VXWA 4GB9A 1V6EA 2PE9A 4K7WA 5BO4B 4IM2A 2L0FA 4HJKA 3SU8X 3V6CB 4MGZE 2JRIB 2MWSB 4K1RB 4KSKC 2MX2A 1D3ZA 2MRPA 3NZSA 2RSUA 2O2VB 2XBBC 2IO1B 2NR2A 4XZ4A 1S3SG 1WMHB 3WANA 3APFA 3VTWA 1R4MI 2KC1A 2KLGA 3K9OB 4ASWC 1L7YA 2BYFA 3KYCD 1GG3A 1SE9A 4JQWC 1IYFA 4FJZA 2KZRA 3K9PB 3PRMB 1IPGA 3A9JA 2ZNVB 2KO3A 4IWQA 4HVBA 2BWES 4JL9A 3T8MA 2LASA 2WDTB 5D2MB 2FIFA 5AZHA 4CHKA 2JXXA 3VUXA 2IY1B 1T0YA 1LQBA 1RAXA 3PGEA 3CF6E 3KW5B 1YD8U 2V4LA 2NCNA 3A9KA 4MELA 2JT4B 5CTRC 2LGYA 2N4FA 3OJ3A 4FA6A 4ZDVA 3GOEA 3PTFC 3ZO5B 3AU4A 3VTVA 5FR6A 4BKSA 4F8CB 2L8JA 2MBOA 2K1FA 3VUYA 3KUCB 4ZRIA 1UD7A 3PREA 4WJOA 3ZNID 1WX7A 4TQ0A 2HTHA 2V1YA 3VAWA 2MP2B 3RUIB 3A4SC 2GMIC 2R2QA 3QC8B 3DVGY 4KIKB 3RULA 3EECA 2M8SA 1UH6A 1V5TA 3CSFA 3KYDD 4F7ZA 2C7NB 2DX5B 3Q3JA 1WF9A 4BOZB 5J2RA 2A5UA 2AEHA 3QX1A 2MCNB 4LJPB 3IVFA 3OAWA 2UWQA 4OVUA 2KDIA 4KVGB 3X0WA 3A1QB 3L10B 1NDDA 3JSVA 4B6WA 4WQOB 3A33B 2ZJDA 4XX5A 4BFRA 4GOCA 1J8CA 4ZRKA 3CSTA 3IBEA 3UGBB 3V61A 2HJ8A 5D7GA 4EEWA 3PVLA 4LJOB 4EZLA 3UF8A 4AWJA 4TUUA 4BBNF 2JY6A 4HLEA 1V9JA 4MDKE 4GSWA 3MHSD 4M8NA 3R66C 2FCNA 3S2AA 4B9KA 3DBSA 5G2NA 4DK5A 4I6LB 4NJ7A 1S1QB 4FLHA 1TZ1A 1Z5SB 2NBWB 1LXDA 4BBNC 4DDGD 2OJRA 2NBUA 2GBJA 3NY5A 3W1SA 4PS7A 3APDA 4BKTA 3R7QA 1WJUA 4HXDA 4M0WB 3AXCA 4MGYE 2DZJA 2RD0A 3IG3A 4IWPA 4HCNB 4PYZA 3WAPA 3DVGX 3RT3B 1TGZB 3RZWC 3ML9A 5C1ZA 3VUWA 2N7EA 3DQVA 2GBNA 5JZEB 3N32A 2KJRA 3DVNV 1E8WA 4G11A 5C23A 2Z0DB 2JZ3B 1WGHA 2CKHB 2KJHB 3H7PA 3ONSA 2O6VB 1OGWA 3QIJA 2YLMA 5LXIB 4JLCA 5E6OA 3DBHI 3ML8A 3WIMA 3PLVA 3UIOB 2RGFA 5IAAC 1WR6E 4WJPA 3TL5A 2XEWA 1VCBA 1WX9A 4GDKB 2CHZA 3UINB 1OTRB 2ZCBA 1WMHA 3PLUA 4MM3A 3DCGA 2K39A 5D94A 1GC6A 2GOWA 2DZKA 2PJHA 3L08A 4E74A 4EOYA 2KMAA 2KWCA 2W9NA 3L16A 1P9DU 1V81A 1Q5WB 4DHJB 1AARA 2KTRA 3PSEB 2LJ5A 4KDIC 4AP4C 4ANXA 2GBMA 2LWPA 2JZZA 4GIVA 1U4AA 4IM3A 2AL6A 3UQBA 2K8HA 3C0RB 4DXAB 3WAOA 2C60A 4FBJB 1YIWA 3UQAA 4NQKE 2DENB 4K7SA 1ZGUB 1ISNA 4JGHB 3SHQA 1CMXB 1M94A 3ZW3A 4HDQA 3LDZE 2AL3A 2PE6B 4EZKA 4MH0E 3ZIMA 5G55A 2KWUB 3H7PB 3U8ZA 2CR5A 1WM2A 3GZNI 4NJ6A 3ZRCA 1WFYA 1WXAA 2M17A 5DCNA 2EMTA 1KJTA 4RM9A 1WGGA 2MBQA 2HD5B 3QAQA 1GNUA 4MGKE 1E90A 4HPMB 4LCDE 1C3TA 4II2B 1YX5B 2NBVB 2GBKA 4KIKA 4EZJA 4CO7A 2KX3A 1OEYA 2KHWB 3DBRI 1WZ0A 2N9PC 3HIZA 3PHXB 5IA7A 1WXSA 2FUHB 2LZ6A 1E8ZA 2IYDB 5GMVA 4II3B 4K81A 4PYUA 2GBRA 3IFWB 5CX3A 3JSVB 2I1JA 1LM8B 1NI2A 4KZCA 2Y5BB 5HKHA 3OLMD 2K6QA 2CU1A 2PEAA 3WAMA 1XD3B 2G4SA 2N9XA 3L17A 1EUVB 4W9KA 1Q1OA 2Z0EB 1HE8A 3JVZX 3ZLZA 3ZRFA 2ZNVC 2MW5A 2PPHA 3DDCB 2BYVE 4B95A 1WI0A 3VDZA 4BVUC 4LDTD 3VH4B 1PQSA 1A5RA 1WIAA 2A4ZA 1V5OA 5DPRA 3H6NA 4I6NB 1YQBA 2ASQA 1EF5A 2XK5A 1IP9A 4DDID 3W1YA 3BINA 3PV1A 3ZDTA 2ZZPB 3A4RA 2KWVB 3UIPB 1FXTB 4TKNA 3RZFA 3HM3A 1P0RA 3ALBA 4BKSD 1V49A 4FJVB 2KQ7A 1P1AA 4GN1A 3N3KB 3RCZA 2KNBA 1EF1A 2KDBA 3B0AA 5CHFA 2D3GA 2LD9A 2C9WB 4W9LA 2LUEA 2G4DB 4M8MA 5LLIA 5DPSA 2L3ZA 2B3AA 2KJ6A 3VVWB 2V3SA 1RRBA 3SDLC 2L00B 2IBIB 4DHZB 4G0NB 1WJNA 2WYQA 1Y8RC 3QCAA 4NAWA 2ZVNA 1WX8A 4A3OA 2K25A 3OJ4B 2KFKA 2UYZB 2KMCA 4N9F4 3VH3B 2N9EB 3R7RA 2CS4A 4MGIE 4NNJB 5D6JB 3WALA 1SIFA 2BYEA 2IZVB 4E71A 2KXJA 3JYUA 3PHWB 4NAWB 3AI5A 1ZW7A 1F9JA 3MTNB 2BGFA 1TBEA 2YVCA 2J0KA 1ZKHA 3VTUA 2N7DA 3AU5A 3APCA 4PS3A 2KFJA 3U7DA 4BOSC 3AULA 1E8YA 2D10A 2DAFA 2C7MB 2J0MA 3H9DA 2LVQA 2KQSA 5DPWA 2DZMA 2KTFA 3NOBA 1NBFC 4MEMA 2FCSA 4FHJA 1V86A 3RD2A 3LJ3A 4FN2A 2JWZA 1YX6B 2CHWA 2DYBA 4MJSA 4RM8A 2KLCA 4NPNA 4URKA 4AJYB 5DPTA 1I42A 2MSED 2NS5A 2KN5A 2IO3B 4X57B 5JH5C 4W9JA 2J7QB 4DWFA 3PZDA 2FCQA 2EKEC 2MQJA 2O6VA 3M3JA 3ENEA 1WY8A 3O65B 2O2VA 3V60A 2MBBB 3HK0A 3DVNU 2D07B 1WGDA 4ANWA 4FJYA 1WXMA 2AWTA 3ZNGC 3DOWA 5CHWA 5CHVC 2G3QB 2IO2B 3H1UA 2DAJA 3L13A 3VHTC 2BWFA 3EC8A 2M1MA 4AOFA 4W9EA 1H8CA 1UELA 2K8CA 3U30A 3RYTA 3HM6X 2DYMA 2L7RA 3W1SC 1P98A 4G3XB 1C1YB 2QHOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZTC A;  2DHZ A;  5J18 A;  3L0W B;  4TV3 A;  3EHV A;  1XQQ A;  4CYE A;  3X23 A;  4IG7 B;  5AZG A;  2ZPY A;  3QHT A;  2KK8 A;  1WH3 A;  4G50 A;  3QJZ A;  2DZI A;  3PT2 B;  3M62 B;  2LVP A;  1QZE A;  4ZYN A;  5L83 A;  4MSM B;  4FAD A;  3CMM B;  3B1L X;  2NVU I;  2FAZ A;  1J19 A;  2BF8 B;  3P2B A;  2Z59 B;  4W9H A;  3D32 A;  2KTR B;  1E7U A;  1OQY A;  1YJ1 A;  4W9F A;  4EUT A;  2I1K A;  2ZEQ A;  1K8R B;  1KM7 A;  2ZVO A;  4I6P A;  2D11 A;  2L0T A;  3TJP A;  4A3P A;  2KKC A;  4DBG A;  1WZ3 A;  2C5L C;  2ZPN A;  1L2N A;  3A9K B;  2VRR B;  4J6I A;  2EMS A;  2IY0 B;  4KSL C;  4A20 A;  2AYO B;  4EFO A;  5JHA A;  1E5W A;  1V2Y A;  2LGX A;  1WJ6 A;  4ICV A;  3TBL D;  1V80 A;  5E6P A;  4JIO U;  2MBH A;  1EO6 A;  3ZNH B;  3Q3F A;  2WX1 A;  3WA0 A;  2HE7 A;  4KV2 A;  2LVO A;  1WRD B;  4PS8 A;  3V6E B;  4AJW A;  2OOB B;  2FCM A;  4ZRJ A;  1WM3 A;  3DPD A;  4GGQ A;  4W9D A;  4XC2 A;  4F1S A;  2ZCC A;  4LDT B;  4IUM B;  2O6V D;  1J0G A;  2BKF A;  1H4R A;  2NPT A;  3QAR A;  2BPS A;  4WJN A;  3T9L A;  2L76 A;  4GMV A;  2KFK B;  3M63 B;  4GDK A;  5AZF A;  5TR5 A;  4HDO A;  3ZUN A;  1WJ4 A;  3QK0 A;  4AUQ C;  5E6N A;  1VD2 A;  3MJW A;  3PS6 A;  1SGH A;  4WWO A;  1UBQ A;  2FID A;  1G6J A;  4ANV A;  1GC7 A;  4HK2 A;  2D2Q A;  5L95 C;  2XK5 B;  3ZVV A;  4HCP B;  2KX0 A;  3PPA A;  3QA8 A;  3QWZ B;  1P3Q U;  4W9G A;  2N1V A;  3EFU A;  2KVR A;  4BKG A;  1Q0W B;  1E7V A;  2N1W A;  1E8X A;  1Z2M A;  2LRU A;  1R4N I;  2C7H A;  2RR9 A;  4RMA A;  2KDF B;  4WWN A;  3ZDM C;  1KLV A;  1MG8 A;  2WWZ A;  2WX0 A;  3ECI A;  5KHO A;  2DYO A;  2IO0 B;  3ZKJ C;  3ZTD A;  4EKU A;  3BY4 B;  1LFD A;  4WAA A;  2J0J A;  5JHB A;  5EDS A;  1GJZ A;  2MP2 A;  3VFK A;  3HHM A;  1WGY A;  3TIX A;  3ZNZ B;  2RPQ A;  4W9I A;  4NY0 A;  3NS8 A;  1XT9 B;  2CHX A;  2JPH A;  3DBL I;  4GU2 A;  3IHP C;  2R2O A;  5J17 A;  1WR1 A;  2JVC A;  2KDE B;  4HWI B;  3KVF B;  4W9C A;  4OVV A;  2KC2 A;  2NPT B;  1WE6 A;  1OEY J;  2L05 A;  4IC7 B;  4MSQ B;  3VQI A;  1WYW B;  2MA9 B;  2LI5 A;  1X1M A;  4FHK A;  2M0X A;  3R3M A;  2KAN A;  2KD0 A;  2FNJ B;  5KHQ A;  4GDL A;  4KDL B;  3B08 A;  3TCA A;  1TTN A;  2JUO A;  3N30 A;  1WXV A;  4K7U A;  2KOX A;  2G45 B;  4HPL B;  5AEK B;  1RFA A;  1KOT A;  3L54 A;  3A1Q A;  1UBI A;  3A9J B;  2LXA A;  2LGD A;  2JF5 A;  4GDL B;  2JRH A;  3M95 A;  4NQL B;  2LXC A;  3NHE B;  3SD5 A;  4YL8 A;  2M4N A;  3H7S A;  4ICU A;  3NZU A;  5LXH A;  4IW0 A;  2LRW A;  4GXB A;  3PRZ A;  2K8B A;  4DHJ D;  3KUZ A;  4IM0 A;  4MJS B;  1I35 A;  4E3C A;  4DHZ E;  4TQ1 A;  4KZ0 A;  1RLF A;  3JW0 X;  3V62 A;  1BT0 A;  2MBE A;  4ANU A;  1WGR A;  3TMP B;  2MLB A;  1JRU A;  1GUA B;  4FUL A;  4IWO A;  3KUD B;  2REX A;  3QQ8 B;  4WJQ A;  1WE7 A;  2BKR B;  3I3T B;  3PRP B;  1UGM A;  2K6D B;  1UZX B;  4WWP A;  3KH0 A;  4P7I A;  3VXW A;  4GB9 A;  1V6E A;  2PE9 A;  4K7W A;  5BO4 B;  4IM2 A;  2L0F A;  4HJK A;  3SU8 X;  3V6C B;  4MGZ E;  2JRI B;  2MWS B;  4K1R B;  4KSK C;  2MX2 A;  1D3Z A;  2MRP A;  3NZS A;  2RSU A;  2O2V B;  2XBB C;  2IO1 B;  2NR2 A;  4XZ4 A;  1S3S G;  1WMH B;  3WAN A;  3APF A;  3VTW A;  1R4M I;  2KC1 A;  2KLG A;  3K9O B;  4ASW C;  1L7Y A;  2BYF A;  3KYC D;  1GG3 A;  1SE9 A;  4JQW C;  1IYF A;  4FJZ A;  2KZR A;  3K9P B;  3PRM B;  1IPG A;  3A9J A;  2ZNV B;  2KO3 A;  4IWQ A;  4HVB A;  2BWE S;  4JL9 A;  3T8M A;  2LAS A;  2WDT B;  5D2M B;  2FIF A;  5AZH A;  4CHK A;  2JXX A;  3VUX A;  2IY1 B;  1T0Y A;  1LQB A;  1RAX A;  3PGE A;  3CF6 E;  3KW5 B;  1YD8 U;  2V4L A;  2NCN A;  3A9K A;  4MEL A;  2JT4 B;  5CTR C;  2LGY A;  2N4F A;  3OJ3 A;  4FA6 A;  4ZDV A;  3GOE A;  3PTF C;  3ZO5 B;  3AU4 A;  3VTV A;  5FR6 A;  4BKS A;  4F8C B;  2L8J A;  2MBO A;  2K1F A;  3VUY A;  3KUC B;  4ZRI A;  1UD7 A;  3PRE A;  4WJO A;  3ZNI D;  1WX7 A;  4TQ0 A;  2HTH A;  2V1Y A;  3VAW A;  2MP2 B;  3RUI B;  3A4S C;  2GMI C;  2R2Q A;  3QC8 B;  3DVG Y;  4KIK B;  3RUL A;  3EEC A;  2M8S A;  1UH6 A;  1V5T A;  3CSF A;  3KYD D;  4F7Z A;  2C7N B;  2DX5 B;  3Q3J A;  1WF9 A;  4BOZ B;  5J2R A;  2A5U A;  2AEH A;  3QX1 A;  2MCN B;  4LJP B;  3IVF A;  3OAW A;  2UWQ A;  4OVU A;  2KDI A;  4KVG B;  3X0W A;  3A1Q B;  3L10 B;  1NDD A;  3JSV A;  4B6W A;  4WQO B;  3A33 B;  2ZJD A;  4XX5 A;  4BFR A;  4GOC A;  1J8C A;  4ZRK A;  3CST A;  3IBE A;  3UGB B;  3V61 A;  2HJ8 A;  5D7G A;  4EEW A;  3PVL A;  4LJO B;  4EZL A;  3UF8 A;  4AWJ A;  4TUU A;  4BBN F;  2JY6 A;  4HLE A;  1V9J A;  4MDK E;  4GSW A;  3MHS D;  4M8N A;  3R66 C;  2FCN A;  3S2A A;  4B9K A;  3DBS A;  5G2N A;  4DK5 A;  4I6L B;  4NJ7 A;  1S1Q B;  4FLH A;  1TZ1 A;  1Z5S B;  2NBW B;  1LXD A;  4BBN C;  4DDG D;  2OJR A;  2NBU A;  2GBJ A;  3NY5 A;  3W1S A;  4PS7 A;  3APD A;  4BKT A;  3R7Q A;  1WJU A;  4HXD A;  4M0W B;  3AXC A;  4MGY E;  2DZJ A;  2RD0 A;  3IG3 A;  4IWP A;  4HCN B;  4PYZ A;  3WAP A;  3DVG X;  3RT3 B;  1TGZ B;  3RZW C;  3ML9 A;  5C1Z A;  3VUW A;  2N7E A;  3DQV A;  2GBN A;  5JZE B;  3N32 A;  2KJR A;  3DVN V;  1E8W A;  4G11 A;  5C23 A;  2Z0D B;  2JZ3 B;  1WGH A;  2CKH B;  2KJH B;  3H7P A;  3ONS A;  2O6V B;  1OGW A;  3QIJ A;  2YLM A;  5LXI B;  4JLC A;  5E6O A;  3DBH I;  3ML8 A;  3WIM A;  3PLV A;  3UIO B;  2RGF A;  5IAA C;  1WR6 E;  4WJP A;  3TL5 A;  2XEW A;  1VCB A;  1WX9 A;  4GDK B;  2CHZ A;  3UIN B;  1OTR B;  2ZCB A;  1WMH A;  3PLU A;  4MM3 A;  3DCG A;  2K39 A;  5D94 A;  1GC6 A;  2GOW A;  2DZK A;  2PJH A;  3L08 A;  4E74 A;  4EOY A;  2KMA A;  2KWC A;  2W9N A;  3L16 A;  1P9D U;  1V81 A;  1Q5W B;  4DHJ B;  1AAR A;  2KTR A;  3PSE B;  2LJ5 A;  4KDI C;  4AP4 C;  4ANX A;  2GBM A;  2LWP A;  2JZZ A;  4GIV A;  1U4A A;  4IM3 A;  2AL6 A;  3UQB A;  2K8H A;  3C0R B;  4DXA B;  3WAO A;  2C60 A;  4FBJ B;  1YIW A;  3UQA A;  4NQK E;  2DEN B;  4K7S A;  1ZGU B;  1ISN A;  4JGH B;  3SHQ A;  1CMX B;  1M94 A;  3ZW3 A;  4HDQ A;  3LDZ E;  2AL3 A;  2PE6 B;  4EZK A;  4MH0 E;  3ZIM A;  5G55 A;  2KWU B;  3H7P B;  3U8Z A;  2CR5 A;  1WM2 A;  3GZN I;  4NJ6 A;  3ZRC A;  1WFY A;  1WXA A;  2M17 A;  5DCN A;  2EMT A;  1KJT A;  4RM9 A;  1WGG A;  2MBQ A;  2HD5 B;  3QAQ A;  1GNU A;  4MGK E;  1E90 A;  4HPM B;  4LCD E;  1C3T A;  4II2 B;  1YX5 B;  2NBV B;  2GBK A;  4KIK A;  4EZJ A;  4CO7 A;  2KX3 A;  1OEY A;  2KHW B;  3DBR I;  1WZ0 A;  2N9P C;  3HIZ A;  3PHX B;  5IA7 A;  1WXS A;  2FUH B;  2LZ6 A;  1E8Z A;  2IYD B;  5GMV A;  4II3 B;  4K81 A;  4PYU A;  2GBR A;  3IFW B;  5CX3 A;  3JSV B;  2I1J A;  1LM8 B;  1NI2 A;  4KZC A;  2Y5B B;  5HKH A;  3OLM D;  2K6Q A;  2CU1 A;  2PEA A;  3WAM A;  1XD3 B;  2G4S A;  2N9X A;  3L17 A;  1EUV B;  4W9K A;  1Q1O A;  2Z0E B;  1HE8 A;  3JVZ X;  3ZLZ A;  3ZRF A;  2ZNV C;  2MW5 A;  2PPH A;  3DDC B;  2BYV E;  4B95 A;  1WI0 A;  3VDZ A;  4BVU C;  4LDT D;  3VH4 B;  1PQS A;  1A5R A;  1WIA A;  2A4Z A;  1V5O A;  5DPR A;  3H6N A;  4I6N B;  1YQB A;  2ASQ A;  1EF5 A;  2XK5 A;  1IP9 A;  4DDI D;  3W1Y A;  3BIN A;  3PV1 A;  3ZDT A;  2ZZP B;  3A4R A;  2KWV B;  3UIP B;  1FXT B;  4TKN A;  3RZF A;  3HM3 A;  1P0R A;  3ALB A;  4BKS D;  1V49 A;  4FJV B;  2KQ7 A;  1P1A A;  4GN1 A;  3N3K B;  3RCZ A;  2KNB A;  1EF1 A;  2KDB A;  3B0A A;  5CHF A;  2D3G A;  2LD9 A;  2C9W B;  4W9L A;  2LUE A;  2G4D B;  4M8M A;  5LLI A;  5DPS A;  2L3Z A;  2B3A A;  2KJ6 A;  3VVW B;  2V3S A;  1RRB A;  3SDL C;  2L00 B;  2IBI B;  4DHZ B;  4G0N B;  1WJN A;  2WYQ A;  1Y8R C;  3QCA A;  4NAW A;  2ZVN A;  1WX8 A;  4A3O A;  2K25 A;  3OJ4 B;  2KFK A;  2UYZ B;  2KMC A;  4N9F 4;  3VH3 B;  2N9E B;  3R7R A;  2CS4 A;  4MGI E;  4NNJ B;  5D6J B;  3WAL A;  1SIF A;  2BYE A;  2IZV B;  4E71 A;  2KXJ A;  3JYU A;  3PHW B;  4NAW B;  3AI5 A;  1ZW7 A;  1F9J A;  3MTN B;  2BGF A;  1TBE A;  2YVC A;  2J0K A;  1ZKH A;  3VTU A;  2N7D A;  3AU5 A;  3APC A;  4PS3 A;  2KFJ A;  3U7D A;  4BOS C;  3AUL A;  1E8Y A;  2D10 A;  2DAF A;  2C7M B;  2J0M A;  3H9D A;  2LVQ A;  2KQS A;  5DPW A;  2DZM A;  2KTF A;  3NOB A;  1NBF C;  4MEM A;  2FCS A;  4FHJ A;  1V86 A;  3RD2 A;  3LJ3 A;  4FN2 A;  2JWZ A;  1YX6 B;  2CHW A;  2DYB A;  4MJS A;  4RM8 A;  2KLC A;  4NPN A;  4URK A;  4AJY B;  5DPT A;  1I42 A;  2MSE D;  2NS5 A;  2KN5 A;  2IO3 B;  4X57 B;  5JH5 C;  4W9J A;  2J7Q B;  4DWF A;  3PZD A;  2FCQ A;  2EKE C;  2MQJ A;  2O6V A;  3M3J A;  3ENE A;  1WY8 A;  3O65 B;  2O2V A;  3V60 A;  2MBB B;  3HK0 A;  3DVN U;  2D07 B;  1WGD A;  4ANW A;  4FJY A;  1WXM A;  2AWT A;  3ZNG C;  3DOW A;  5CHW A;  5CHV C;  2G3Q B;  2IO2 B;  3H1U A;  2DAJ A;  3L13 A;  3VHT C;  2BWF A;  3EC8 A;  2M1M A;  4AOF A;  4W9E A;  1H8C A;  1UEL A;  2K8C A;  3U30 A;  3RYT A;  3HM6 X;  2DYM A;  2L7R A;  3W1S C;  1P98 A;  4G3X B;  1C1Y B;  2QHO A; 
#chains in the Genus database with same CATH topology
 1FFV A;  1ZPS A;  5IP4 D;  4A8X C;  1IGD A;  3X23 A;  4IG7 B;  3QJZ A;  2DZI A;  3PT2 B;  2LVP A;  4MSM B;  4M02 A;  4FAD A;  2FAZ A;  3T3O A;  4EUT A;  2D11 A;  1N6Z A;  2KKC A;  4HKZ E;  2C5L C;  1XLN A;  3GP7 A;  3A9K B;  4KSL C;  2EMS A;  2AYO B;  2KAJ A;  1D5Z C;  2DLB A;  3GS2 A;  1E5W A;  4US8 A;  5E6P A;  1VZ8 A;  1EO6 A;  1L6U A;  4OZB A;  1WRI A;  2J52 A;  5H92 C;  1WRD B;  4W9D A;  3AE6 B;  4PT5 A;  4LDT B;  1J0G A;  1TS2 A;  2E6X A;  3QAR A;  2BS4 B;  4UDU C;  1FIQ A;  2SAK A;  3N1X C;  4AUQ C;  5E6N A;  1CZP A;  1RFK A;  2FID A;  2DBY A;  1YNT E;  4ANV A;  3NVZ A;  1PGB A;  4HCP B;  2KX0 A;  4USA A;  4W9G A;  3E56 A;  1ZDV A;  3DBH B;  1PGA A;  4REZ A;  2RR9 A;  2K3U A;  1XLO A;  2KDF B;  1EM7 A;  3ZDM C;  3Q2A C;  2FE8 A;  3VRA B;  3ECI A;  5KHO A;  3ZKJ C;  3E9S A;  5EDS A;  3MJ5 A;  1GJZ A;  2LHE A;  3BWU D;  3HHM A;  2QIL A;  3DBL I;  1M4V A;  1WR1 A;  4HWI B;  4W9C A;  3EGR A;  1OEY J;  4ARI A;  4IC7 B;  2MA9 B;  2LI5 A;  4OVZ A;  4ACF A;  1T6B X;  5BMI A;  1TTN A;  4K7U A;  1KTK A;  2KYW A;  2G45 B;  2KOX A;  4C4V A;  4WAF A;  2LXA A;  3J9C A;  3M95 A;  4NQL B;  2WDV B;  2LRW A;  1GB4 A;  4DHJ D;  3KUZ A;  4IM0 A;  1RLF A;  2MBE A;  3TMP B;  2MLB A;  3QQ8 B;  1NYR A;  3I3T B;  2LGS A;  2UU7 A;  2LUM A;  3PRP B;  1UGM A;  3VXW A;  3KH0 A;  5EE3 A;  3V6C B;  1DOX A;  3GB1 A;  2JRI B;  2MX2 A;  1D3Z A;  2RSU A;  1ACC A;  2J53 A;  3Q8F A;  2NR2 A;  4XZ4 A;  4JE3 B;  3L4P A;  3KYC D;  1SE9 A;  3K9P B;  1NEN B;  3KWV A;  3A9J A;  4HVB A;  2V9H A;  4N6E B;  2FIF A;  4CHK A;  3VUX A;  1T0Y A;  1LQB A;  3PGE A;  3CF6 E;  4XDC A;  1NI3 A;  3A9K A;  2N4F A;  3OJ3 A;  3PTF C;  3ZO5 B;  3AU4 A;  2L8J A;  2L52 A;  3PRE A;  3VAW A;  3TEX A;  2GMI C;  3QC8 B;  3DVG Y;  3N1Y C;  4F7Z A;  2C7N B;  4WH4 A;  1FXA A;  4BOZ B;  2AEH A;  1E6E B;  2W3S A;  2WDR B;  3AB5 A;  1HTO A;  1K53 A;  2WXP A;  3CST A;  3ZXR A;  1DYQ A;  2KMM A;  2PTL A;  4BBN F;  2YEP B;  4HLE A;  4B9K A;  1JCK B;  5G2N A;  4J3O D;  4NJ7 A;  1Z5S B;  2WXG A;  3W1S A;  1QIL A;  3PZ8 A;  1ET9 A;  4HXD A;  4MGY E;  3N1Z C;  1YQ3 B;  2DZJ A;  3IG3 A;  2MEK A;  4IWP A;  4HCN B;  5T8I A;  3RT3 B;  1TGZ B;  3ML9 A;  3DQV A;  1XCT L;  3NS1 A;  3N32 A;  3ZJT A;  1FNV A;  2KJR A;  3DVN V;  4G11 A;  4OZC A;  2JZ3 B;  2IGG A;  1OGW A;  1K51 A;  2GB1 A;  4O1N A;  1MJD A;  2QIE B;  4ZYS A;  3C19 A;  1BXT A;  3UIO B;  4KX6 B;  2WU5 B;  1WX9 A;  3UIN B;  2JXT A;  3AE1 B;  2DZK A;  1C78 A;  2W9N A;  2KWC A;  3L16 A;  4S0R A;  4HKQ A;  1U4A A;  2AL6 A;  4DXA B;  4FBJ B;  3UQA A;  4NQK E;  4K7S A;  1ZXI A;  4GLS C;  1I4P A;  3AE4 B;  4ITK A;  4HDQ A;  3LDZ E;  4C7Z A;  4MH0 E;  1FRR A;  2CR5 A;  2WLB A;  4MH8 A;  1WXA A;  5DCN A;  4RM9 A;  2MBQ A;  2R61 A;  3VRB B;  3QAQ A;  5HI1 A;  3MHZ A;  4HPM B;  3I57 A;  4II2 B;  1JW9 D;  2ICI A;  1UUP A;  1I4H A;  3PHX B;  1OEY A;  3NRZ A;  3W5V B;  1WXS A;  2LZ6 A;  1E8Z A;  5JXV A;  4C4V B;  5GMV A;  3V3X A;  4KGR A;  4K81 A;  1V1P B;  1GB1 A;  2I1J A;  1YOV B;  1LM8 B;  3SFD B;  4KZC A;  5HKH A;  1L0Y B;  2PEA A;  5C2T B;  2N9X A;  1EUV B;  4W9K A;  1Q1O A;  2Z0E B;  4LNI A;  3BK2 A;  1HE8 A;  4QAY A;  3LB8 C;  3DDC B;  4AS1 A;  3BYT B;  4BVU C;  3VH4 B;  1QT9 A;  2VZK B;  1IP9 A;  3PO0 A;  3Q3O C;  4AQ7 A;  1T5X D;  4BKS D;  1V49 A;  4JPS A;  2BS3 B;  1P1A A;  1SBB B;  2LGI A;  3RCZ A;  2KNB A;  2JU6 X;  2NTS A;  1FEH A;  2G4D B;  1MHH E;  2QMT A;  1FCL A;  5DPS A;  2L3Z A;  1WJN A;  1SE3 A;  1Y8R C;  1WX8 A;  4L23 A;  1L4Z B;  4N9F 4;  1YN5 A;  5D6J B;  1TS3 A;  2BYE A;  3ZQ4 A;  3B9J A;  2AQ3 B;  2KXJ A;  3JYU A;  3PHW B;  1HZ6 A;  1VRA B;  1F9J A;  1GPX A;  2YVC A;  2G9H D;  3BVZ A;  2J0K A;  3VTU A;  2N7D A;  3FC4 A;  1E8Y A;  3NJT A;  1CK1 A;  2LVQ A;  2KTF A;  1NBF C;  4MEM A;  1V86 A;  4MT5 A;  2KLC A;  2WXI A;  1TY0 A;  2MSE D;  4X57 B;  5JH5 C;  1UNS A;  2J7Q B;  2AQ1 B;  4ZHO A;  3RNB C;  3M3J A;  2BVC A;  3ENE A;  1WY8 A;  3HK0 A;  2N7J A;  1WXM A;  3ZNG C;  3DOW A;  1C76 A;  2IO2 B;  2V3P A;  3VHT C;  3U52 E;  3RNG C;  3EC8 A;  1IBX B;  1UEL A;  3U30 A;  3HM6 X;  3HVZ A;  2D3C A;  3GE3 C;  2QHO A;  3ZTC A;  5J18 A;  3RFZ B;  4TV3 A;  3EHV A;  3QHT A;  2BTE A;  4G50 A;  4C80 A;  2QSD A;  1LO5 D;  3CMM B;  1V1P A;  3D32 A;  2KTR B;  1E7U A;  3NVW A;  1OQY A;  2KT7 A;  4W9F A;  3MC8 A;  2IND C;  2I1K A;  2INC C;  4I6P A;  4DXF A;  1XO3 A;  1A70 A;  1FD6 A;  2JWU A;  2ZPN A;  2VRR B;  4J6I A;  2FUG 1;  5JHA A;  2LGX A;  1WJ6 A;  4JIO U;  2MBH A;  5HHD G;  3BZD B;  2WX1 A;  1XEE A;  3BVG A;  2AQ2 B;  3I63 C;  4AJW A;  2OOB B;  4P1C C;  2FCM A;  2JZP A;  3U4E G;  3DPD A;  1N61 A;  1H4R A;  2NPT A;  2TSS A;  3T9L A;  2L76 A;  2QEJ C;  4GMV A;  3M63 B;  1VD2 A;  3Q8C A;  1UBQ A;  2WNM A;  3PPA A;  3QA8 A;  3QWZ B;  3GZN B;  1DOI A;  2KVR A;  4BKG A;  1Z2M A;  1E7V A;  4WWN A;  4LK0 M;  4JX1 C;  2LJI A;  2WX0 A;  2DYO A;  3AN1 A;  4C56 C;  3BY4 B;  1LFD A;  4WAA A;  4KGT A;  5JHB A;  3DBR B;  2WXR A;  1JWA D;  3TIX A;  4LNF A;  1KRH A;  4GU2 A;  1XT9 B;  2CHX A;  2ONQ A;  2R2O A;  2JVC A;  1FRD A;  2N0S B;  1WYW B;  3N20 C;  1KLU D;  1TKG A;  4FHK A;  2M0X A;  3R3M A;  1MFW A;  1CJE A;  1TYG B;  4GDL A;  3ETR A;  3B08 A;  3TCA A;  2JUO A;  3N30 A;  3ZXV A;  1KOT A;  1UBI A;  3A9J B;  2JF5 A;  4GDL B;  2JRH A;  1HQR D;  3BK1 A;  2M4N A;  1VLB A;  2M19 A;  1Q10 A;  4IW0 A;  4GXB A;  3PRZ A;  2K8B A;  2W55 A;  2X8X X;  4MJS B;  4DQO C;  4DHZ E;  1F77 A;  4KZ0 A;  3V62 A;  3JW0 X;  1L5P A;  1F1H A;  1UZX B;  4GB9 A;  4TMA B;  2PE9 A;  4K7W A;  2WS3 B;  3CWI A;  3R8B A;  4K1R B;  4KSK C;  4P6V F;  2IO1 B;  4IOI E;  1SJE D;  2PVG C;  4RH6 A;  3WAN A;  2VH1 A;  1R4M I;  2KC1 A;  2KLG A;  4ASW C;  1L7Y A;  1IPG A;  4IWQ A;  2LAS A;  2WDT B;  5AZH A;  1YN4 A;  2H89 B;  1YD8 U;  2WHI A;  5CTR C;  4ZDV A;  3GOE A;  1EWC A;  1B9R A;  2MBO A;  2K1F A;  3HRD D;  3KUC B;  4ZRI A;  1GAQ B;  2B76 B;  2MJE A;  3V05 A;  1WX7 A;  2V1Y A;  3W2D A;  1N5W A;  5I4D A;  1UH6 A;  2M8S A;  4YWG G;  1WF9 A;  1D6E C;  5J2R A;  3IT6 B;  4LJP B;  2UWQ A;  3L10 B;  3CIR B;  3JSV A;  2XNA C;  3AEE B;  2PVO D;  4B6W A;  3FAH A;  3DHH C;  3DHI C;  1T3Q A;  5BYQ A;  1T0R C;  4RGM A;  2QCZ A;  4ZOH C;  1SB3 C;  4L2Y A;  3P4P B;  3RNA C;  1PGX A;  5D7G A;  4EEW A;  1C4P A;  4EZL A;  3BII D;  2OHF A;  1RWS A;  4CQN A;  3R66 C;  3DBS A;  3Q8A A;  1VZ7 A;  5FR3 A;  4KGS A;  2NBU A;  1HA5 A;  2KDM A;  3APD A;  3NVV A;  2K0P A;  3AXC A;  2RD0 A;  4XE0 A;  3ABV B;  3WAP A;  1HTQ A;  3RZW C;  5JZE B;  1KFY B;  1E8W A;  2INP E;  2Z0D B;  1WGH A;  2E3T A;  2CKH B;  2KJH B;  4RFB A;  3H7P A;  3IAS 1;  3ONS A;  3QIJ A;  4WUR A;  5LXI B;  1SIJ A;  3DBH I;  4RF0 A;  2CJO A;  3WIM A;  2NTT A;  2RGF A;  1WR6 E;  2JSV X;  4YTP B;  5AUI A;  1KF6 B;  5IOI A;  2CHZ A;  1OTR B;  2V0G A;  3MC0 B;  3PLU A;  1F52 A;  2K39 A;  2GOW A;  2PJH A;  1AAR A;  3VR9 B;  4KDI C;  3DBL B;  1DOY A;  2GBM A;  2C60 A;  2DEN B;  1ZGU B;  5GXG B;  1CMX B;  3ZW3 A;  3T3N A;  5FK9 C;  2PE6 B;  3FIL B;  1ZDX A;  3VR8 B;  1WM2 A;  4YSX B;  1WFY A;  2M17 A;  3FIL A;  2HD5 B;  4IKG A;  1R4N B;  4MGK E;  3NZ3 A;  5C3J B;  4LCD E;  1JWU D;  1XF5 L;  3P4S B;  2EEL A;  2JYT A;  2KX3 A;  3DHG C;  1E10 A;  2KAC A;  3HIZ A;  4II3 B;  5MPO A;  4PYU A;  1UWX A;  2GBR A;  3DWM A;  1NI2 A;  3OLM D;  3WAM A;  1XD3 B;  1JQ4 A;  3JVZ X;  2L1A A;  4LDT D;  1PQS A;  1WIA A;  3H6N A;  4I6N B;  1YQB A;  2ASQ A;  2XK5 A;  2HDE A;  3P42 A;  1ET6 A;  3BIN A;  3AED B;  3TUO A;  1NYQ A;  2KWV B;  3A4R A;  3UIP B;  4A55 A;  2IDY A;  1P0R A;  4FJV B;  2Q5W D;  1L0X B;  1J7B A;  1FCC C;  1XLP A;  2D3G A;  4W9L A;  3EFC A;  1V8C A;  2V3S A;  4XWW A;  1FM0 D;  2ZVN A;  4A3O A;  2KFK A;  2UYZ B;  4JWS C;  1JRO A;  2OJW A;  2CS4 A;  5D3D A;  4NAW B;  3AI5 A;  1ZW7 A;  3MTN B;  2H88 B;  1KLG D;  1ZKH A;  4BOS C;  2D10 A;  2ON8 A;  1D5M C;  5DPW A;  1EU4 A;  1OQQ A;  3RD2 A;  3Q8E A;  4YTN B;  4URK A;  4PK1 A;  2NS5 A;  2KN5 A;  2IO3 B;  4JWU C;  3AMZ A;  1VJK A;  3O65 B;  2O2V A;  3DVN U;  2D07 B;  1WGD A;  4ANW A;  4H2A A;  2G3Q B;  2DAJ A;  3W5U B;  1TT5 B;  5AUK A;  2OED A;  4AOF A;  2M1M A;  4W9E A;  1SF0 A;  3P4Q B;  2BYT A;  3R2T A;  3MFG A;  2DHZ A;  3L0W B;  1XQQ A;  4CYE A;  3OWE B;  5AZG A;  2ZPY A;  1WH3 A;  3M62 B;  4ZYN A;  2EKI A;  4W9H A;  1C9F A;  4YTM B;  3B2G A;  2WXN A;  2ZEQ A;  1K8R B;  4HRS A;  3ZGZ A;  2L32 A;  4A3P A;  4DBG A;  1WZ3 A;  1MG4 A;  4A20 A;  1EU3 A;  4ICV A;  1V80 A;  3ZNH B;  3Q3F A;  2HE7 A;  2LVO A;  4PS8 A;  1K52 A;  4ZRJ A;  4KKJ A;  4RCO A;  3KQ4 A;  3OG5 A;  3U7Z A;  4F1S A;  2ZCC A;  4IUM B;  2BPS A;  5FKA C;  4GDK A;  5AZF A;  5TR5 A;  4HDO A;  3ZUN A;  1WJ4 A;  3QK0 A;  4ZRP A;  1MHX A;  1VZ6 A;  3PS6 A;  4WWO A;  3DWG C;  2WU2 B;  4HK2 A;  5L95 C;  2LMC A;  2XK5 B;  1J7A A;  3Q3M C;  3EFU A;  1E8X A;  2N1W A;  2LRU A;  4XWT A;  2V3N A;  4YSZ B;  2IO0 B;  3ZTD A;  4EKU A;  1QKZ A;  1B1Z A;  2J0J A;  2LEK A;  1VR9 A;  2PLP A;  4NY0 A;  3NS8 A;  4HEA 1;  2JPH A;  2K5P A;  1IBX A;  2WXL A;  3IHP C;  5J17 A;  3AEG B;  2KDE B;  3KVF B;  2KC2 A;  3BYY B;  2BW2 A;  2L05 A;  3VQI A;  3IT4 B;  1JML A;  1FO4 A;  3RNE C;  2LFI A;  2IJ0 A;  2KAN A;  2KD0 A;  2FNJ B;  1QLB B;  4KDL B;  4RGN A;  1QOA A;  1WXV A;  2JX5 A;  5AEK B;  3L54 A;  4B0E A;  2J4X A;  2LGD A;  2MJD A;  5LXH A;  2SEB D;  1I35 A;  1YJJ A;  4E3C A;  4TQ1 A;  2N9K A;  1BT0 A;  4ANU A;  4WJQ A;  4FUL A;  3KUD B;  2REX A;  1WE7 A;  4WQM A;  4LTU A;  2PKO A;  2K6D B;  5EE0 A;  1ROE A;  4C7Y A;  3AE9 B;  5BO4 B;  1K50 A;  4LLG M;  4NJC A;  2RDH A;  1L6V A;  3IXS A;  4MAC A;  2ZW0 A;  2O2V B;  3AH7 A;  2XBB C;  1RYJ A;  1WMH B;  3AEC B;  4LNK A;  3TEZ A;  1GG3 A;  2KZR A;  3PRM B;  5EE1 A;  2BWE S;  4JL9 A;  3T8M A;  1AW7 A;  1HZ5 A;  1FXI A;  2JQR B;  2XN9 C;  1WXQ A;  2BS2 B;  1RAX A;  1YQ4 B;  3KW5 B;  2V4L A;  2NCN A;  1TKY A;  2JT4 B;  4FA6 A;  2WXM A;  4F8C B;  1L0V B;  1UD7 A;  4TQ0 A;  2HTH A;  2MP2 B;  1XXG A;  2NMQ A;  2GI9 A;  5G5G A;  3RUL A;  3KYD D;  5IN7 A;  1WGK A;  2WXF A;  3QX1 A;  1MVK A;  3KLS X;  4KKI A;  2KDI A;  3A1Q B;  4WQO B;  1IGC A;  4XX5 A;  3RMK C;  3ZJV A;  4BFR A;  4GOC A;  3SFE B;  5E6J A;  1J8C A;  3IBE A;  3UGB B;  1ZOY B;  2HJ8 A;  3V61 A;  3PVL A;  4LJO B;  4EE2 A;  4TUU A;  2Z8L A;  2JY6 A;  2RDG A;  2FCN A;  3S2A A;  1SE4 A;  4I6L B;  4FLH A;  1LXD A;  4BBN C;  4DDG D;  4A6Q A;  1JWM D;  3R7Q A;  1WJU A;  3C8Y A;  4M0W B;  3Q8B A;  3DVG X;  5C1Z A;  5D3I B;  1HXY D;  1IUE A;  3VUW A;  2N7E A;  2GBN A;  3HUI A;  1UWM A;  3P63 A;  1OQR A;  1RM6 C;  2IGH A;  1NVI D;  5IAA C;  4WJP A;  3TL5 A;  1N60 A;  1SJH D;  2XEW A;  1UF0 A;  1WMH A;  2KQ4 X;  4MM3 A;  2VZK D;  5D94 A;  1GC6 A;  3U2S C;  1V81 A;  1Q5W B;  2KTR A;  3PSE B;  2LJ5 A;  4ANX A;  3PZ7 A;  2JZZ A;  2LWP A;  4GIV A;  4OZA A;  3WAO A;  1YIW A;  3SHQ A;  1TJE A;  4JGH B;  1P7F A;  1FPY A;  2AL3 A;  4EZK A;  3KWL A;  2BB5 A;  2KWU B;  5BYR A;  1I4R A;  5BMH A;  4HRO A;  1F0Z A;  4NJ6 A;  1ZUD 2;  1KJT A;  2X38 A;  1WGG A;  1E90 A;  4P1B C;  1ZE3 D;  1C3T A;  4FXC A;  1YX5 B;  2ACZ B;  2I38 A;  2GBK A;  2NBV B;  4K3B A;  2KHW B;  1WZ0 A;  2N9P C;  5IA7 A;  2FUH B;  2IYD B;  1FNU A;  4B0M A;  1SEB D;  2K6Q A;  1I4Q A;  1JAL A;  1C77 A;  1J7C A;  1UGJ A;  2IPK D;  4B95 A;  1WI0 A;  2WGS A;  1A5R A;  1V5O A;  1EF5 A;  1PDX A;  3IAM 1;  3ZDT A;  3AEF B;  3P1M A;  2K22 A;  1TZO A;  2ZZP B;  1ESF A;  1FXT B;  3RNC C;  3RZF A;  3HM3 A;  1TS5 A;  1R4M B;  3AEB B;  2KQ7 A;  4D2K A;  2KDB A;  5CHF A;  1NEK B;  2LUE A;  4YSY B;  3P4R B;  2KJ6 A;  3RPF C;  1RRB A;  3SDL C;  2L00 B;  2IBI B;  4DHZ B;  4G0N B;  2WYQ A;  2W54 A;  4RNA A;  2K25 A;  1SSN A;  1JWB D;  1YN3 A;  2N9E B;  4MGI E;  1VDV A;  4XYC A;  3WAL A;  2IZV B;  4E71 A;  1D4B A;  1TBE A;  4DXG A;  3APC A;  1JWS D;  3U7D A;  3AUL A;  3H9D A;  2C7M B;  2J0M A;  1STE A;  1OFF A;  4ZHP A;  3NOB A;  4FHJ A;  3LJ3 A;  2CHW A;  2DYB A;  2WP9 B;  4MJS A;  3Q69 A;  2FBW B;  1I42 A;  3PZD A;  2FCQ A;  2EKE C;  2MQJ A;  3NG0 A;  4FJY A;  1QOF A;  2AWT A;  5IO9 A;  2BWF A;  3Q14 C;  1H8C A;  1PFD A;  3W1S C;  1P98 A;  1QOG A;  1C1Y B;  2KK8 A;  5L83 A;  1QZE A;  2KN4 A;  2QC8 A;  3B1L X;  2NVU I;  1J19 A;  2BF8 B;  3H8H A;  2Z59 B;  3P2B A;  1YJ1 A;  4RGO S;  1KM7 A;  2ZVO A;  2L0T A;  3TJP A;  5EE9 A;  3AE5 B;  1L2N A;  1KLV A;  2IY0 B;  4EFO A;  1PUT A;  1V2Y A;  3TBL D;  2YEP F;  3FKY A;  2BT6 A;  3Q3N C;  4M01 A;  3WA0 A;  4KV2 A;  3V6E B;  4XDD A;  1WM3 A;  3AEA B;  4GGQ A;  4XC2 A;  1C79 A;  2O6V D;  1E9M A;  2BKF A;  2WXJ A;  1AYF A;  1QQR A;  4WJN A;  5G5H A;  1P7E A;  2KFK B;  1T0Q C;  2V4I B;  3NUH B;  3MJW A;  1SGH A;  1G6J A;  1GC7 A;  2D2Q A;  3ZVV A;  1YMH E;  2I2Y A;  4BZA A;  3SEB A;  1P3Q U;  2D5G A;  2MH7 A;  2N1V A;  3EA6 A;  1Q0W B;  1R4N I;  1YJI A;  2C7H A;  1I7H A;  4RMA A;  3I5J C;  1MG8 A;  2WWZ A;  2PW9 A;  2MP2 A;  3AE7 B;  3MP9 A;  3VFK A;  1WGY A;  3ZNZ B;  2RPQ A;  4W9I A;  1L4D B;  1DGJ A;  3AM9 A;  2DNF A;  4LNN A;  4OVV A;  2NPT B;  1WE6 A;  2BB6 A;  4MSQ B;  1X1M A;  2PMV A;  1N63 A;  4YXD B;  5KHQ A;  1FMA D;  2D3B A;  3HVD A;  4HPL B;  1RFA A;  3A1Q A;  1V1O A;  3SR6 A;  2LXC A;  3NHE B;  3SD5 A;  2HTM E;  4YL8 A;  1MPE A;  3H7S A;  4ICU A;  2G1E A;  3NZU A;  2WXQ A;  4NAM A;  4ARC A;  2Y3A A;  2W3R A;  1WGR A;  1JRU A;  1GUA B;  1AN8 A;  4IWO A;  4RF1 A;  1FNW A;  3R2I A;  2BKR B;  2KVZ A;  1TS4 A;  4M0W A;  4WWP A;  4P7I A;  1V6E A;  1WYG A;  4IM2 A;  1QOB A;  2L0F A;  4HJK A;  3AE8 B;  3SU8 X;  2MHJ A;  4MGZ E;  2MWS B;  2MRP A;  4BAX A;  3NZS A;  3GE8 C;  3LYY A;  1LGR A;  1S3S G;  2J42 A;  3AV8 A;  1AWD A;  3APF A;  3VTW A;  2INN E;  3K9O B;  2BYF A;  4JQW C;  1IYF A;  1TY2 A;  4FJZ A;  2ZNV B;  2KO3 A;  2Y5C A;  5D2M B;  2JXX A;  2RDB C;  1BML C;  2IY1 B;  4MEL A;  2LGY A;  3VTV A;  2L83 A;  1ZP0 B;  5FR6 A;  4BKS A;  3EUB 2;  1V97 A;  2M0A A;  2GRI A;  1PYW D;  3VUY A;  3ZNI D;  4WJO A;  2LHD A;  3RUI B;  3A4S C;  2CU3 A;  2R2Q A;  1I4G A;  1E7P B;  4KIK B;  3EEC A;  1V5T A;  3CSF A;  5IKC M;  2DX5 B;  3Q3J A;  2A5U A;  1CQV A;  1D5X C;  2MJ3 A;  2MCN B;  3AE2 B;  3IVF A;  3OAW A;  4OVU A;  3X0W A;  4KVG B;  4C00 A;  1NDD A;  4LNO A;  3A33 B;  2ZJD A;  4RGT A;  3Q6B A;  3B2F A;  4S17 A;  1HEZ E;  2ZW1 A;  1MI0 A;  4ZRK A;  2Y5P A;  1N62 A;  4HJG E;  3UF8 A;  1TKE A;  4AWJ A;  1N5X A;  1V9J A;  4MDK E;  4GSW A;  3MHS D;  4M8N A;  4XGA B;  4DK5 A;  1T0S C;  1BUI C;  1S1Q B;  2VH2 A;  1TZ1 A;  5BMG A;  4L1B A;  2NBW B;  2M56 B;  2OJR A;  1WSP A;  2GBJ A;  3NY5 A;  4PS7 A;  2JYE A;  4TSS A;  4BKT A;  4PYZ A;  5LNK 1;  3LXF A;  3ZYY X;  4K3C A;  4M00 A;  5C23 A;  2AX5 A;  2O6V B;  2RMM A;  2YLM A;  3I9V 1;  4JLC A;  5H8Y E;  5E6O A;  3ML8 A;  3AE3 B;  3RNF C;  3PLV A;  2IGD A;  1VCB A;  4GDK B;  2ZCB A;  1ENF A;  1ZXH A;  3DCG A;  2DWQ A;  3N9Y C;  2D3A A;  2N9L A;  3L08 A;  4E74 A;  4EOY A;  2KMA A;  1FFU A;  2WDQ B;  1P9D U;  4DHJ B;  4ZRQ A;  4AP4 C;  4IM3 A;  3UQB A;  2K8H A;  3C0R B;  1ISN A;  1M94 A;  4HPP A;  2CJN A;  1I4X A;  3MC9 A;  3ZIM A;  5G55 A;  3H7P B;  3U8Z A;  3WCQ A;  2WXO A;  3GZN I;  4N58 A;  3ZRC A;  4IDI A;  1GOZ A;  2EMT A;  4N59 A;  2QJL A;  1GNU A;  1TIF A;  4KIK A;  2BQQ A;  4EZJ A;  4CO7 A;  4YT0 B;  3URY A;  3NVY A;  2HJ1 A;  3DBR I;  1R7S A;  2WXH A;  4A90 A;  3IFW B;  5CX3 A;  1SE2 A;  3JSV B;  3W9C B;  2RPV A;  4MM3 B;  2Y5B B;  4Q2J A;  2CU1 A;  2G4S A;  1EWY C;  3L17 A;  3ZLZ A;  3ZRF A;  1Y56 A;  2ZNV C;  2MW5 A;  2PPH A;  2BYV E;  3VDZ A;  5HFY A;  1F2R I;  2A4Z A;  5DPR A;  2BBC A;  1JRP A;  2WXK A;  1KH0 A;  4DDI D;  3W1Y A;  3PV1 A;  4TKN A;  3ALB A;  4R3D A;  4GN1 A;  3N3K B;  1EF1 A;  3B0A A;  4WWM A;  2LD9 A;  3RI7 C;  2C9W B;  2GLS A;  2PIA A;  4M8M A;  5LLI A;  1WWT A;  2B3A A;  3VVW B;  1XLQ A;  3TEW A;  3TSS A;  3UI3 A;  3QCA A;  4NAW A;  3OJ4 B;  4A9A A;  4US9 A;  1SXT A;  2KMC A;  3VH3 B;  3R7R A;  2QDF A;  4NNJ B;  1SIF A;  2WQY B;  2W82 A;  3ZJU A;  2BGF A;  2K9X A;  4PS3 A;  3AU5 A;  2KFJ A;  2DAF A;  3TEY A;  2KQS A;  1QF6 A;  2DZM A;  1F2R C;  2FCS A;  4FN2 A;  2JWZ A;  1YX6 B;  3O13 A;  4RM8 A;  4NPN A;  5HG2 A;  4NZL B;  5DPT A;  4AJY B;  4W9J A;  4DWF A;  1C4A A;  2O6V A;  1XCQ L;  3V60 A;  4P16 A;  1E0Z A;  2MBB B;  1C4C A;  3RN9 C;  2KWD A;  4OHJ A;  5BYS A;  5TSS A;  5CHW A;  5CHV C;  3H1U A;  3L13 A;  4OW0 A;  4WIP A;  2K8C A;  3BVM A;  3RYT A;  2DYM A;  2L7R A;  4G3X B; 
#chains in the Genus database with same CATH homology
 3ZTC A;  2DHZ A;  5J18 A;  3L0W B;  4TV3 A;  3EHV A;  1XQQ A;  4CYE A;  3X23 A;  4IG7 B;  5AZG A;  2ZPY A;  3QHT A;  2KK8 A;  1WH3 A;  4G50 A;  3QJZ A;  2DZI A;  3PT2 B;  3M62 B;  2LVP A;  1QZE A;  4ZYN A;  5L83 A;  4MSM B;  4FAD A;  3CMM B;  3B1L X;  2NVU I;  2FAZ A;  1J19 A;  2BF8 B;  3P2B A;  2Z59 B;  4W9H A;  3D32 A;  2KTR B;  1E7U A;  1OQY A;  1YJ1 A;  4W9F A;  4EUT A;  2I1K A;  2ZEQ A;  1K8R B;  1KM7 A;  2ZVO A;  4I6P A;  2D11 A;  2L0T A;  3TJP A;  4A3P A;  2KKC A;  4DBG A;  1WZ3 A;  2C5L C;  2ZPN A;  1L2N A;  3A9K B;  2VRR B;  4J6I A;  2EMS A;  2IY0 B;  4KSL C;  4A20 A;  2AYO B;  4EFO A;  5JHA A;  1E5W A;  1V2Y A;  2LGX A;  1WJ6 A;  4ICV A;  3TBL D;  1V80 A;  5E6P A;  4JIO U;  2MBH A;  1EO6 A;  3ZNH B;  3Q3F A;  2WX1 A;  3WA0 A;  2HE7 A;  4KV2 A;  2LVO A;  1WRD B;  4PS8 A;  3V6E B;  4AJW A;  2OOB B;  2FCM A;  4ZRJ A;  1WM3 A;  3DPD A;  4GGQ A;  4W9D A;  4XC2 A;  4F1S A;  2ZCC A;  4LDT B;  4IUM B;  2O6V D;  1J0G A;  2BKF A;  1H4R A;  2NPT A;  3QAR A;  2BPS A;  4WJN A;  3T9L A;  2L76 A;  4GMV A;  2KFK B;  3M63 B;  4GDK A;  5AZF A;  5TR5 A;  4HDO A;  3ZUN A;  1WJ4 A;  3QK0 A;  4AUQ C;  5E6N A;  1VD2 A;  3MJW A;  3PS6 A;  1SGH A;  4WWO A;  1UBQ A;  2FID A;  1G6J A;  4ANV A;  1GC7 A;  4HK2 A;  2D2Q A;  5L95 C;  2XK5 B;  3ZVV A;  4HCP B;  2KX0 A;  3PPA A;  3QA8 A;  3QWZ B;  1P3Q U;  4W9G A;  2N1V A;  3EFU A;  2KVR A;  4BKG A;  1Q0W B;  1E7V A;  2N1W A;  1E8X A;  1Z2M A;  2LRU A;  1R4N I;  2C7H A;  2RR9 A;  4RMA A;  2KDF B;  4WWN A;  3ZDM C;  1KLV A;  1MG8 A;  2WWZ A;  2WX0 A;  3ECI A;  5KHO A;  2DYO A;  2IO0 B;  3ZKJ C;  3ZTD A;  4EKU A;  3BY4 B;  1LFD A;  4WAA A;  2J0J A;  5JHB A;  5EDS A;  1GJZ A;  2MP2 A;  3VFK A;  3HHM A;  1WGY A;  3TIX A;  3ZNZ B;  2RPQ A;  4W9I A;  4NY0 A;  3NS8 A;  1XT9 B;  2CHX A;  2JPH A;  3DBL I;  4GU2 A;  3IHP C;  2R2O A;  5J17 A;  1WR1 A;  2JVC A;  2KDE B;  4HWI B;  3KVF B;  4W9C A;  4OVV A;  2KC2 A;  2NPT B;  1WE6 A;  1OEY J;  2L05 A;  4IC7 B;  4MSQ B;  3VQI A;  1WYW B;  2MA9 B;  2LI5 A;  1X1M A;  4FHK A;  2M0X A;  3R3M A;  2KAN A;  2KD0 A;  2FNJ B;  5KHQ A;  4GDL A;  4KDL B;  3B08 A;  3TCA A;  1TTN A;  2JUO A;  3N30 A;  1WXV A;  4K7U A;  2KOX A;  2G45 B;  4HPL B;  5AEK B;  1RFA A;  1KOT A;  3L54 A;  3A1Q A;  1UBI A;  3A9J B;  2LXA A;  2LGD A;  2JF5 A;  4GDL B;  2JRH A;  3M95 A;  4NQL B;  2LXC A;  3NHE B;  3SD5 A;  4YL8 A;  2M4N A;  3H7S A;  4ICU A;  3NZU A;  5LXH A;  4IW0 A;  2LRW A;  4GXB A;  3PRZ A;  2K8B A;  4DHJ D;  3KUZ A;  4IM0 A;  4MJS B;  1I35 A;  4E3C A;  4DHZ E;  4TQ1 A;  4KZ0 A;  1RLF A;  3JW0 X;  3V62 A;  1BT0 A;  2MBE A;  4ANU A;  1WGR A;  3TMP B;  2MLB A;  1JRU A;  1GUA B;  4FUL A;  4IWO A;  3KUD B;  2REX A;  3QQ8 B;  4WJQ A;  1WE7 A;  2BKR B;  3I3T B;  3PRP B;  1UGM A;  2K6D B;  1UZX B;  4WWP A;  3KH0 A;  4P7I A;  3VXW A;  4GB9 A;  1V6E A;  2PE9 A;  4K7W A;  5BO4 B;  4IM2 A;  2L0F A;  4HJK A;  3SU8 X;  3V6C B;  4MGZ E;  2JRI B;  2MWS B;  4K1R B;  4KSK C;  2MX2 A;  1D3Z A;  2MRP A;  3NZS A;  2RSU A;  2O2V B;  2XBB C;  2IO1 B;  2NR2 A;  4XZ4 A;  1S3S G;  1WMH B;  3WAN A;  3APF A;  3VTW A;  1R4M I;  2KC1 A;  2KLG A;  3K9O B;  4ASW C;  1L7Y A;  2BYF A;  3KYC D;  1GG3 A;  1SE9 A;  4JQW C;  1IYF A;  4FJZ A;  2KZR A;  3K9P B;  3PRM B;  1IPG A;  3A9J A;  2ZNV B;  2KO3 A;  4IWQ A;  4HVB A;  2BWE S;  4JL9 A;  3T8M A;  2LAS A;  2WDT B;  5D2M B;  2FIF A;  5AZH A;  4CHK A;  2JXX A;  3VUX A;  2IY1 B;  1T0Y A;  1LQB A;  1RAX A;  3PGE A;  3CF6 E;  3KW5 B;  1YD8 U;  2V4L A;  2NCN A;  3A9K A;  4MEL A;  2JT4 B;  5CTR C;  2LGY A;  2N4F A;  3OJ3 A;  4FA6 A;  4ZDV A;  3GOE A;  3PTF C;  3ZO5 B;  3AU4 A;  3VTV A;  5FR6 A;  4BKS A;  4F8C B;  2L8J A;  2MBO A;  2K1F A;  3VUY A;  3KUC B;  4ZRI A;  1UD7 A;  3PRE A;  4WJO A;  3ZNI D;  1WX7 A;  4TQ0 A;  2HTH A;  2V1Y A;  3VAW A;  2MP2 B;  3RUI B;  3A4S C;  2GMI C;  2R2Q A;  3QC8 B;  3DVG Y;  4KIK B;  3RUL A;  3EEC A;  2M8S A;  1UH6 A;  1V5T A;  3CSF A;  3KYD D;  4F7Z A;  2C7N B;  2DX5 B;  3Q3J A;  1WF9 A;  4BOZ B;  5J2R A;  2A5U A;  2AEH A;  3QX1 A;  2MCN B;  4LJP B;  3IVF A;  3OAW A;  2UWQ A;  4OVU A;  2KDI A;  4KVG B;  3X0W A;  3A1Q B;  3L10 B;  1NDD A;  3JSV A;  4B6W A;  4WQO B;  3A33 B;  2ZJD A;  4XX5 A;  4BFR A;  4GOC A;  1J8C A;  4ZRK A;  3CST A;  3IBE A;  3UGB B;  3V61 A;  2HJ8 A;  5D7G A;  4EEW A;  3PVL A;  4LJO B;  4EZL A;  3UF8 A;  4AWJ A;  4TUU A;  4BBN F;  2JY6 A;  4HLE A;  1V9J A;  4MDK E;  4GSW A;  3MHS D;  4M8N A;  3R66 C;  2FCN A;  3S2A A;  4B9K A;  3DBS A;  5G2N A;  4DK5 A;  4I6L B;  4NJ7 A;  1S1Q B;  4FLH A;  1TZ1 A;  1Z5S B;  2NBW B;  1LXD A;  4BBN C;  4DDG D;  2OJR A;  2NBU A;  2GBJ A;  3NY5 A;  3W1S A;  4PS7 A;  3APD A;  4BKT A;  3R7Q A;  1WJU A;  4HXD A;  4M0W B;  3AXC A;  4MGY E;  2DZJ A;  2RD0 A;  3IG3 A;  4IWP A;  4HCN B;  4PYZ A;  3WAP A;  3DVG X;  3RT3 B;  1TGZ B;  3RZW C;  3ML9 A;  5C1Z A;  3VUW A;  2N7E A;  3DQV A;  2GBN A;  5JZE B;  3N32 A;  2KJR A;  3DVN V;  1E8W A;  4G11 A;  5C23 A;  2Z0D B;  2JZ3 B;  1WGH A;  2CKH B;  2KJH B;  3H7P A;  3ONS A;  2O6V B;  1OGW A;  3QIJ A;  2YLM A;  5LXI B;  4JLC A;  5E6O A;  3DBH I;  3ML8 A;  3WIM A;  3PLV A;  3UIO B;  2RGF A;  5IAA C;  1WR6 E;  4WJP A;  3TL5 A;  2XEW A;  1VCB A;  1WX9 A;  4GDK B;  2CHZ A;  3UIN B;  1OTR B;  2ZCB A;  1WMH A;  3PLU A;  4MM3 A;  3DCG A;  2K39 A;  5D94 A;  1GC6 A;  2GOW A;  2DZK A;  2PJH A;  3L08 A;  4E74 A;  4EOY A;  2KMA A;  2KWC A;  2W9N A;  3L16 A;  1P9D U;  1V81 A;  1Q5W B;  4DHJ B;  1AAR A;  2KTR A;  3PSE B;  2LJ5 A;  4KDI C;  4AP4 C;  4ANX A;  2GBM A;  2LWP A;  2JZZ A;  4GIV A;  1U4A A;  4IM3 A;  2AL6 A;  3UQB A;  2K8H A;  3C0R B;  4DXA B;  3WAO A;  2C60 A;  4FBJ B;  1YIW A;  3UQA A;  4NQK E;  2DEN B;  4K7S A;  1ZGU B;  1ISN A;  4JGH B;  3SHQ A;  1CMX B;  1M94 A;  3ZW3 A;  4HDQ A;  3LDZ E;  2AL3 A;  2PE6 B;  4EZK A;  4MH0 E;  3ZIM A;  5G55 A;  2KWU B;  3H7P B;  3U8Z A;  2CR5 A;  1WM2 A;  3GZN I;  4NJ6 A;  3ZRC A;  1WFY A;  1WXA A;  2M17 A;  5DCN A;  2EMT A;  1KJT A;  4RM9 A;  1WGG A;  2MBQ A;  2HD5 B;  3QAQ A;  1GNU A;  4MGK E;  1E90 A;  4HPM B;  4LCD E;  1C3T A;  4II2 B;  1YX5 B;  2NBV B;  2GBK A;  4KIK A;  4EZJ A;  4CO7 A;  2KX3 A;  1OEY A;  2KHW B;  3DBR I;  1WZ0 A;  2N9P C;  3HIZ A;  3PHX B;  5IA7 A;  1WXS A;  2FUH B;  2LZ6 A;  1E8Z A;  2IYD B;  5GMV A;  4II3 B;  4K81 A;  4PYU A;  2GBR A;  3IFW B;  5CX3 A;  3JSV B;  2I1J A;  1LM8 B;  1NI2 A;  4KZC A;  2Y5B B;  5HKH A;  3OLM D;  2K6Q A;  2CU1 A;  2PEA A;  3WAM A;  1XD3 B;  2G4S A;  2N9X A;  3L17 A;  1EUV B;  4W9K A;  1Q1O A;  2Z0E B;  1HE8 A;  3JVZ X;  3ZLZ A;  3ZRF A;  2ZNV C;  2MW5 A;  2PPH A;  3DDC B;  2BYV E;  4B95 A;  1WI0 A;  3VDZ A;  4BVU C;  4LDT D;  3VH4 B;  1PQS A;  1A5R A;  1WIA A;  2A4Z A;  1V5O A;  5DPR A;  3H6N A;  4I6N B;  1YQB A;  2ASQ A;  1EF5 A;  2XK5 A;  1IP9 A;  4DDI D;  3W1Y A;  3BIN A;  3PV1 A;  3ZDT A;  2ZZP B;  3A4R A;  2KWV B;  3UIP B;  1FXT B;  4TKN A;  3RZF A;  3HM3 A;  1P0R A;  3ALB A;  4BKS D;  1V49 A;  4FJV B;  2KQ7 A;  1P1A A;  4GN1 A;  3N3K B;  3RCZ A;  2KNB A;  1EF1 A;  2KDB A;  3B0A A;  5CHF A;  2D3G A;  2LD9 A;  2C9W B;  4W9L A;  2LUE A;  2G4D B;  4M8M A;  5LLI A;  5DPS A;  2L3Z A;  2B3A A;  2KJ6 A;  3VVW B;  2V3S A;  1RRB A;  3SDL C;  2L00 B;  2IBI B;  4DHZ B;  4G0N B;  1WJN A;  2WYQ A;  1Y8R C;  3QCA A;  4NAW A;  2ZVN A;  1WX8 A;  4A3O A;  2K25 A;  3OJ4 B;  2KFK A;  2UYZ B;  2KMC A;  4N9F 4;  3VH3 B;  2N9E B;  3R7R A;  2CS4 A;  4MGI E;  4NNJ B;  5D6J B;  3WAL A;  1SIF A;  2BYE A;  2IZV B;  4E71 A;  2KXJ A;  3JYU A;  3PHW B;  4NAW B;  3AI5 A;  1ZW7 A;  1F9J A;  3MTN B;  2BGF A;  1TBE A;  2YVC A;  2J0K A;  1ZKH A;  3VTU A;  2N7D A;  3AU5 A;  3APC A;  4PS3 A;  2KFJ A;  3U7D A;  4BOS C;  3AUL A;  1E8Y A;  2D10 A;  2DAF A;  2C7M B;  2J0M A;  3H9D A;  2LVQ A;  2KQS A;  5DPW A;  2DZM A;  2KTF A;  3NOB A;  1NBF C;  4MEM A;  2FCS A;  4FHJ A;  1V86 A;  3RD2 A;  3LJ3 A;  4FN2 A;  2JWZ A;  1YX6 B;  2CHW A;  2DYB A;  4MJS A;  4RM8 A;  2KLC A;  4NPN A;  4URK A;  4AJY B;  5DPT A;  1I42 A;  2MSE D;  2NS5 A;  2KN5 A;  2IO3 B;  4X57 B;  5JH5 C;  4W9J A;  2J7Q B;  4DWF A;  3PZD A;  2FCQ A;  2EKE C;  2MQJ A;  2O6V A;  3M3J A;  3ENE A;  1WY8 A;  3O65 B;  2O2V A;  3V60 A;  2MBB B;  3HK0 A;  3DVN U;  2D07 B;  1WGD A;  4ANW A;  4FJY A;  1WXM A;  2AWT A;  3ZNG C;  3DOW A;  5CHW A;  5CHV C;  2G3Q B;  2IO2 B;  3H1U A;  2DAJ A;  3L13 A;  3VHT C;  2BWF A;  3EC8 A;  2M1M A;  4AOF A;  4W9E A;  1H8C A;  1UEL A;  2K8C A;  3U30 A;  3RYT A;  3HM6 X;  2DYM A;  2L7R A;  3W1S C;  1P98 A;  4G3X B;  1C1Y B;  2QHO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...