4KX6B

Plasticity of the quinone-binding site of the complex ii homolog quinol:fumarate reductase
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
243
structure length
243
Chain Sequence
AEMKNLKIEVVRYNPEVDTAPHSAFYEVPYDATTSLLDALGYIKDNLAPDLSYRWSCRMAICGSCGMMVNNVPKLACKTFLRDYTDGMKVEALANFPIERDLVVDMTHFIESLEAIKPYIIGNSRTADQGTNIQTPAQMAKYHQFSGCINCGLCYAACPQFGLNPEFIGPAAITLAHRYNEDSRDHGKKERMAQLNSQNGVWSCTFVGYCSEVCPKHVDPAAAIQQGKVESSKDFLIATLKPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Plasticity of the Quinone-binding Site of the Complex II Homolog Quinol:Fumarate Reductase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords Fumarate reductase flavoprotein subunit
total genus 66
structure length 243
sequence length 243
chains with identical sequence N
ec nomenclature
pdb deposition date 2013-05-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 4kx6B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4kx6B01
1GAQB 1CZPA 3HUIA 1NENB 3P4RB 1DOIA 1SF0A 2WU5B 2CJOA 3BIID 4USAA 1SIJA 2Y5CA 2B76B 1FRRA 5C3JB 1PFDA 1JROA 1XLPA 3FC4A 4ZHPA 1NEKB 3L4PA 4YTNB 2WS3B 2M19A 4C7ZA 3AE3B 4LTUA 1V8CA 5AUKA 3HVZA 2WQYB 1N63A 3W5VB 1JALA 3CWIA 1JWBD 3ABVB 3AE8B 2BT6A 2BS2B 3AE2B 4YTMB 1PUTA 1VJKA 2CJNA 2MJEA 2L83A 2M56B 3AE5B 4YTPB 1QOAA 1L0VB 2EKIA 3EUB2 1JQ4A 2W3SA 1UWMA 1L6VA 3LB8C 2W54A 5EE0A 4JX1C 1RM6C 1DGJA 3NS1A 5G5GA 1F0ZA 3AECB 1QOFA 2K5PA 2MJDA 1WWTA 1FM0D 1WRIA 1FXAA 4ZOHC 4YT0B 5EE3A 2WDVB 3PO0A 4ZHOA 3CF4A 1OQRA 2N0SB 5AUIA 3ZYYX 1E6EB 3B9JA 1NYQA 2W3RA 2JQRB 2DWQA 1E10A 1AWDA 2PVGC 2W55A 1N5WA 1E0ZA 1N62A 2K22A 5EE9A 2PKOA 3AE6B 3RPFC 1WXQA 1OQQA 1V97A 3SFEB 3VR9B 2KAJA 4N59A 3AV8A 2OHFA 1VLBA 4C80A 2WP9B 2QIEB 1J7AA 2QJLA 2WDQB 5H8YE 3W5UB 1TYGB 3AEDB 1ZOYB 3ETRA 4KX6B 2HTME 2PIAA 2PVOD 1YQ3B 1QLBB 3SFDB 4YXDB 1JRPA 1H7WA 1I7HA 1GTHA 3WCQA 4US8A 4N58A 3AEAB 2MJ3A 3KWLA 1NI3A 2Q5WD 1YJJA 3AE1B 1TKGA 3VRAB 2BS4B 2E3TA 1NYRA 1E7PB 1GTEA 3AE7B 3AEGB 1FFVA 1OFFA 3P4SB 1FFUA 1QOGA 2WLBA 1QOBA 3VRBB 2WDRB 1R7SA 3NVZA 3DWGC 1FRDA 1XLNA 1RFKA 3SR6A 1J7BA 1YQ4B 2K9XA 4YSYB 1T3QA 2WU2B 2LEKA 3AMZA 4FXCA 2KMMA 3AH7A 1H7XA 1IUEA 4A9AA 3P4PB 2DBYA 3P63A 1RYJA 3AE4B 1DOYA 4US9A 3AE9B 3B2FA 2ACZB 3CIRB 1E9MA 5EE1A 2BS3B 1QT9A 5H92C 4HRSA 5G5HA 1WYGA 3HRDD 4ITKA 4YSZB 3FAHA 2L52A 1FMAD 1RWSA 2FBWB 4C7YA 1GPXA 5C2TB 2MH7A 1WGKA 1ROEA 4WQMA 1AYFA 3LXFA 3AEFB 1FXIA 1SB3C 1L6UA 1XLOA 3AN1A 1GT8A 1L5PA 3NVYA 1FO4A 3DWMA 1B9RA 4YSXB 1A70A 1TJEA 1DOXA 1N60A 3NVWA 1ZXIA 1QF6A 2JX5A 1NVID 1PDXA 1VDVA 1KRHA 4IDIA 2AX5A 1YJIA 2H89B 4JWUC 4N6EB 1JWAD 2H88B 3VR8B 4P6VF 1EWYC 1CJEA 3NRZA 4WWMA 5GXGB 1FIQA 1ZP0B 1KF6B 1TKEA 3AEEB 2G1EA 5MPOA 1XO3A 2CU3A 1ZUD2 1XLQA 3B2GA 1JW9D 3P1MA 3AEBB 1TKYA 1KFYB 4JWSC 1N61A 1J7CA 1N5XA 3AM9A 3NVVA 3AB5A 3W9CB 4HROA 3P4QB
chains in the Genus database with same CATH superfamily
4EOYA 4HJKA 2AQ3B 2DZKA 3L4PA 1V49A 4RM8A 3WAOA 2INPE 3I57A 5TR5A 4K3BA 2FUHB 1PUTA 3H7PB 2CJNA 1SE2A 2L1AA 2ICIA 3VAWA 3UQAA 2OJWA 2EKIA 1IP9A 2KN5A 1QOFA 1HZ5A 1CQVA 4MH0E 4KZCA 1CK1A 1MVKA 2NMQA 1L7YA 2WXLA 1WI0A 3I63C 3BK2A 4MJSA 2KMCA 1YNTE 3TEYA 2N4FA 2LRWA 2FCNA 3BK1A 2L76A 1C4PA 1YN5A 2K6DB 3L17A 3Q69A 2M0AA 3VDZA 1G6JA 1FNVA 2MP2A 1TS4A 2PIAA 1JRPA 1UWXA 2KN4A 2C7NB 3ZW3A 3AE1B 3VRAB 5JHBA 1SJHD 1K51A 4KIKA 3VVWB 2M1MA 5JXVA 1GB1A 2M4NA 4GDKB 4NQLB 1WX7A 2BWES 3Q6BA 4CO7A 3SR6A 3DBHB 2K9XA 4YSYB 3D32A 1XD3B 4KVGB 1IBXA 2KVRA 5D3IB 1F9JA 2PEAA 4RGOS 2WXHA 2PE9A 4A8XC 3RYTA 3C19A 2JY6A 4MSQB 2VZKB 1FIQA 2N9EB 4AJWA 4NAWB 3E9SA 2MBHA 1JRUA 3KW5B 1TZ1A 3ZDTA 2LD9A 4HROA 4B0MA 3FILA 3UGBB 2ONQA 3UI3A 4B0EA 3PT2B 4II2B 3NZUA 1D5ZC 2M19A 5CHVC 1I4PA 4QAYA 1RM6C 3GE8C 1L0XB 1KH0A 3H7SA 2MCNB 2KOXA 4LDTB 3UQBA 5TSSA 1Q0WB 4P1BC 4GIVA 4LNOA 2CR5A 4HPMB 3V61A 1WGGA 1N5WA 2K22A 4NPNA 2O2VB 3M62B 3PLVA 1HTQA 3LDZE 2BBCA 3AV8A 3APDA 3VFKA 1WH3A 3HK0A 2QJLA 2WDQB 1Z5SB 4EZLA 4AUQC 1WXVA 2OOBB 4EZJA 2PPHA 1WGYA 2KACA 2V1YA 3ZNZB 3AEAB 2KX3A 5JZEB 1KTKA 1RRBA 3Q3OC 1I42A 1ESFA 1R4MB 1XF5L 1WJ4A 3H7PA 1FCCC 4IC7B 2HDEA 4NJ7A 1WXSA 3MJ5A 2VRRB 2GBMA 4XX5A 2C7MB 4US9A 2WXOA 4HVBA 1Z2MA 2GLSA 1JMLA 4B6WA 2IGHA 1FXIA 3AN1A 4GGQA 2PW9A 3EC8A 1YX6B 4WWNA 1RAXA 1KRHA 3MFGA 2AX5A 4JE3B 1M94A 3EHVA 3HIZA 4KSKC 5MPOA 2R2OA 1ZUD2 2V3PA 1C9FA 2MWSB 3ZQ4A 3W9CB 4M01A 2IO2B 2QSDA 5DPSA 1V1PA 2KDBA 1V5OA 3DDCB 3HVZA 3N1YC 3DVNU 2BT6A 1GOZA 2E6XA 1F77A 5G2NA 3ZXVA 3QQ8B 2TSSA 4E3CA 2JUOA 2K5PA 1F2RC 3TJPA 3DCGA 4AOFA 4GOCA 1MHXA 4GDLB 4FHKA 3PV1A 3ZYYX 3B0AA 3QAQA 4RNAA 1WJ6A 4K3CA 3RNAC 2ASQA 3U7ZA 3CMMB 2L00B 2WXNA 1VZ6A 2CU1A 3VR9B 3WAPA 4C80A 2I2YA 2I1JA 4H2AA 5BMGA 3ETRA 1HXYD 3LYYA 3U52E 1F1HA 4OVZA 3B1LX 4HPLB 1NI3A 1AARA 2DX5B 4IUMB 1FFVA 1OFFA 4KKIA 3ML9A 4JGHB 4HEA1 1WGRA 4BOZB 1XLNA 2LASA 3SEBA 1T3QA 5EDSA 3NHEB 2QDFA 3BVZA 3N32A 4G3XB 1LGRA 3CIRB 4J6IA 4MDKE 1YOVB 3R7QA 4XZ4A 1TY2A 1KLGD 4G50A 4EFOA 4RGNA 1B9RA 2PMVA 1A70A 3NUHB 2DYBA 1ZXIA 1HZ6A 4JWUC 3BWUD 1H4RA 4DXGA 1D3ZA 3CSTA 3RUIB 2D07B 3L0WB 3Q8AA 3L13A 4A3PA 4DXAB 2RPQA 4M0WB 1I4GA 5CTRC 5L95C 3A4RA 3DQVA 1TS3A 4KIKB 3M95A 3DHIC 2QEJC 1HE8A 3DPDA 3Q8BA 4HDQA 2BS2B 2L0TA 2ZVOA 2G45B 2QC8A 3TCAA 2WX0A 2BTEA 1DGJA 5FR6A 2MJDA 2KKCA 2MW5A 5C23A 2GBJA 4YL8A 5AUIA 3RNGC 1BT0A 3DHHC 2I38A 1N62A 2KLCA 4AJYB 4GB9A 3NZ3A 2V3NA 4WQOB 3DVGX 4EUTA 3H8HA 3R66C 2BB5A 2IGGA 4D2KA 1ZOYB 4C4VA 4WH4A 4JLCA 2WGSA 3IAM1 4RGMA 4PS7A 1MG8A 1WSPA 3NS8A 2PJHA 4ZRKA 1FCLA 3C0RB 4REZA 1NYRA 1E7PB 2BWFA 1BXTA 2KTFA 2JWUA 3VRBB 5DPWA 1UBQA 3K9OB 2ON8A 3K9PB 3AMZA 1WZ0A 4ANWA 2MEKA 4DQOC 3H6NA 2HJ8A 3P63A 2WNMA 1LXDA 3GP7A 4HRSA 2INDC 2BYVE 1WM3A 4LK0M 2Z59B 1WE7A 4JPSA 1AYFA 3KUZA 4YSXB 2M8SA 4R3DA 4WWOA 3NG0A 3V60A 3ZIMA 1WMHA 1C76A 3BVMA 3V6EB 1MJDA 2CS4A 3URYA 4KGRA 1XO3A 3DBLB 2PTLA 3KQ4A 1D6EC 4XC2A 3P4QB 3JVZX 2ZVNA 4YWGG 1WYWB 3ML8A 2WU5B 1JWMD 1SIJA 2NPTB 1FRRA 4YTNB 2GBRA 4HJGE 5IN7A 3AE2B 2SAKA 4FULA 3AU5A 2KVZA 5IA7A 4C56C 1UBIA 2LXAA 4AP4C 3DBRB 2WXKA 2QILA 1X1MA 2ZJDA 3R7RA 4JQWC 5IO9A 5BO4B 2R2QA 3V6CB 3CF4A 2N0SB 1C4AA 1FD6A 1E8XA 1LM8B 1DYQA 2KDMA 1WR1A 2Y3AA 3SU8X 2K1FA 3W5UB 3AEDB 4WURA 5DPTA 4M02A 4MEMA 2V9HA 2AWTA 2RDGA 1CMXB 2E3TA 1J0GA 1YJ1A 4TUUA 4FADA 2KO3A 4LCDE 2MSED 1RFKA 2LEKA 4RMAA 2JZPA 2IPKD 3Q3FA 2ACZB 4ZDVA 2G9HD 2D3CA 1YX5B 5H92C 2G4DB 2FBWB 1GPXA 2KDIA 4KDLB 4E71A 1XLOA 1GT8A 2KYWA 4K7UA 4MJSB 1RLFA 5HFYA 1ET9A 3PS6A 2AYOB 2LVOA 1WFYA 3N1ZC 1EWYC 4WWMA 2JXXA 3Q8FA 2J4XA 3I9V1 1XLQA 4BKSA 1JW9D 3AEBB 2XNAC 3DBLI 1L0YB 3ALBA 3U8ZA 4IM2A 4PYUA 1E8YA 3MHSD 2IJ0A 1K53A 4BOSC 1PGXA 2MRPA 2WQYB 3PHWB 4WJNA 4I6NB 1JWBD 1LFDA 2KZRA 2O6VA 3N9YC 3PREA 3AE5B 5EE0A 1F0ZA 2KJ6A 2L7RA 2DYMA 1STEA 4ZOHC 1YN4A 4ZHOA 5IAAC 1E0ZA 3ZNGC 1JWUD 2AQ2B 1WRDB 2KWCA 2KDEB 2KC1A 1J7AA 5H8YE 3R8BA 1YQ3B 4KDIC 4M0WA 2Q5WD 2BB6A 2HE7A 2HJ1A 1MFWA 2K8HA 2RPVA 2N7JA 1XXGA 2GOWA 2V4IB 4BBNF 2JWZA 3AE4B 2REXA 2WXQA 4Q2JA 4TV3A 2LGSA 2MH7A 2N1VA 2V4LA 4WQMA 1R4NI 3ENEA 2BGFA 3DWMA 1N60A 3ZO5B 1VR9A 2H89B 3ZLZA 1NI2A 2X8XX 1IGDA 2CU3A 3R2IA 2DAJA 2KWUB 3PGEA 4NZLB 1EU3A 3VH3B 1SF0A 2K6QA 4USAA 2B3AA 4W9DA 4FA6A 3FC4A 4I6PA 3MJWA 3AE3B 2J52A 2YEPF 4LTUA 3AE8B 1GC6A 1Q5WB 1ZDVA 2M56B 4YTPB 4BVUC 2JYEA 4IWQA 3WIMA 5BYQA 5G5GA 2ZCBA 1UH6A 4HCPB 4A90A 4ZRQA 3ZGZA 2KQ7A 2KTRB 3O65B 5FKAC 2J42A 2JQRB 4PYZA 1UNSA 1SEBD 2PVGC 2KMAA 1TGZB 3Q14C 1TS5A 3IT6B 3AE6B 5LLIA 2IBIB 2PLPA 2LFIA 2NTTA 1VLBA 4KX6B 1HA5A 3VTVA 4XE0A 5CHFA 4EE2A 3N1XC 2MJ3A 4L1BA 3ZRCA 3KWLA 5D2MB 1FFUA 4W9CA 1QOBA 2BW2A 3IHPC 3OG5A 4LJOB 1TT5B 2N9KA 4MGKE 2JF5A 2EELA 5BMHA 2IDYA 1BMLC 2N1WA 2BS3B 3HRDD 1FMAD 3DOWA 1UUPA 2KLGA 1ROEA 3AEFB 1C78A 3WA0A 1P3QU 4MGYE 4W9HA 1TJEA 3HHMA 3ZXRA 3Q3MC 3Q8CA 2GBNA 4BZAA 5CX3A 1WZ3A 1VDVA 2KTRA 1YJIA 5E6NA 3QCAA 1CJEA 3MC0B 1SBBB 4RF0A 5HG2A 3P2BA 4JWSC 4OVVA 1KJTA 3AB5A 4LNNA 2NS5A 1GAQB 4WJQA 3IG3A 4RF1A 1E7UA 1XLPA 3RNEC 4W9LA 4WWPA 2A5UA 1IYFA 3ZKJC 1L6VA 3EECA 3BZDB 3GS2A 3KVFB 3FILB 3BY4B 3M63B 2BVCA 2DENB 1FM0D 4ZRPA 4OVUA 4GMVA 1FXAA 4HKQA 3GB1A 3RULA 4DXFA 1PYWD 2EMSA 2BQQA 1VZ8A 2KANA 3QX1A 4HPPA 5E6OA 1OTRB 3RN9C 3TL5A 3VTUA 2ZNVB 3GE3C 4W9FA 2LI5A 1KM7A 2QIEB 1FNWA 2J0KA 1EF5A 3IXSA 3I5JC 2XK5A 4TQ0A 4US8A 2UYZB 3HM3A 1P1AA 2WXFA 3TBLD 1GTEA 3AEGB 3QJZA 2DNFA 3RI7C 3ZNHB 5BMIA 3UINB 2ZNVC 1J8CA 4ZYSA 1UELA 2D2QA 1XT9B 3KYCD 2QHOA 3A9KA 2ZW0A 3BVGA 4MH8A 3WALA 4A9AA 3T8MA 1V1PB 4IWOA 4XWTA 1MHHE 2ZPYA 2JZZA 4TKNA 2ZPNA 4BKSD 4ANVA 3TSSA 3TEXA 1WMHB 3EGRA 4A3OA 3NVWA 2JX5A 4W9KA 3U2SC 2JRIB 1SJED 2LMCA 4E74A 1E7VA 2WXMA 2DYOA 1TKEA 2N9XA 2LHEA 2O6VD 1RFAA 3HUIA 1V5TA 5D94A 3DBHI 2WXJA 5C3JB 2RDHA 3I3TB 4BBNC 4K7WA 3V05A 4K7SA 2MJEA 4AQ7A 2W54A 4GN1A 2L05A 4FN2A 4JX1C 5KHOA 1WWTA 3GZNB 1TTNA 4EKUA 2KQSA 1E8WA 1OQYA 4HXDA 5KHQA 4C00A 4I6LB 1FEHA 1EM7A 4NQKE 3QIJA 2LGDA 2FIFA 1OQQA 3SHQA 3ZUNA 2Y5PA 4DHZE 1EF1A 2MBEA 2VZKD 2L3ZA 2K8CA 4ASWC 3DBRI 4GSWA 3P4SB 2KJRA 2NVUI 2WLBA 1E8ZA 2WDRB 4DBGA 4WAFA 4ICUA 3J9CA 4PS8A 2CKHB 3QWZB 1HQRD 5IP4D 3DBSA 2JZ3B 1T5XD 1V86A 3TMPB 2V0GA 3KH0A 2Z0DB 4FJVB 4XYCA 3T3OA 2KD0A 1RWSA 1I4XA 1GNUA 4DDID 2UU7A 4ZYNA 4TMAB 1LQBA 4ICVA 4DHJB 1YN3A 1NVID 4GLSC 4S0RA 1ZDXA 5D3DA 2JVCA 1SE4A 3IFWB 2KT7A 3NZSA 2NBWB 1XEEA 3SD5A 5JH5C 3P1MA 1TKYA 4HLEA 1WGDA 2KC2A 1KLVA 1QQRA 1EUVB 1YQBA 1CZPA 3VH4B 4ARIA 2CJOA 2LHDA 2C7HA 2Y5CA 1ZE3D 2V3SA 2FCSA 2DZMA 4G0NB 4KV2A 2INNE 1V8CA 4FJZA 2C60A 3DVGY 3W5VB 2KFKA 2JYTA 3RNFC 3VUYA 3W1SC 1N6ZA 3MTNB 5I4DA 3JYUA 3L08A 4LJPB 5EE3A 1J19A 1P7FA 4OW0A 3RD2A 4AS1A 1ZPSA 3FKYA 1AWDA 1F52A 4FHJA 5T8IA 2PKOA 2DZJA 5JHAA 3KUDB 4GDLA 3APCA 2FAZA 2KWDA 4OHJA 4N59A 2J0MA 3VXWA 5IKCM 4AWJA 4RCOA 3AE7B 3AI5A 2MLBA 4XDDA 1C4CA 5DPRA 1YQ4B 4ACFA 3A9JA 1PGBA 2KMMA 3AH7A 2IO0B 1XCQL 3P4PB 1I35A 3PRMB 1ZW7A 2KWVB 2D3BA 5EE1A 1WYGA 4ITKA 4MM3B 1T0RC 3RFZB 5AZGA 2FE8A 2L8JA 3ZJUA 1L6UA 4M8NA 1QF6A 3OAWA 2LGIA 4IDIA 1QILA 3W1SA 3RMKC 2RR9A 2D5GA 2IZVB 2MQJA 1ZP0B 3SDLC 1WGHA 2JU6X 3NY5A 1I4RA 3B2GA 4ANUA 1P0RA 2J7QB 2NCNA 5AEKB 1N61A 3AM9A 1D4BA 5D6JB 3GOEA 3JSVA 1SGHA 1JROA 3A33B 1S3SG 4ZHPA 2KDFB 3T3NA 1K50A 5J18A 1SSNA 4C7ZA 4XDCA 3KLSX 3T9LA 2M0XA 2BYFA 4YTMB 3MC8A 3V3XA 2SEBD 3NOBA 1UWMA 3LJ3A 3EFCA 3AECB 1K8RB 4DHZB 1U4AA 2BF8B 3ECIA 1TS2A 2LJ5A 2VH1A 1NYQA 2NPTA 2NTSA 5G55A 2Z0EB 4TSSA 4IWPA 1FNUA 5E6JA 3MP9A 4FBJB 5BYSA 1ET6A 2W82A 3W1YA 4BAXA 2ZZPB 3GZNI 4GU2A 4LDTD 2BS4B 2WXRA 2DHZA 5AZFA 1EO6A 2GB1A 3PRPB 4M8MA 1AW7A 2DAFA 3PHXB 3N30A 2A4ZA 2IY1B 1V81A 4PK1A 2WWZA 3B2FA 3KYDD 3ZNID 4NJ6A 4PT5A 1OEYJ 4C7YA 3DHGC 3OJ3A 3VQIA 3ZTCA 2LUMA 3PZ8A 3RCZA 1SB3C 3NVYA 1KLUD 1D5MC 3MC9A 5J17A 2R61A 4W9IA 4ANXA 2JSVX 4P6VF 3JW0X 2G1EA 3AEEB 2GMIC 1V9JA 4C4VB 3ZTDA 4IM3A 2EMTA 4W9JA 4IG7B 3A1QA 1V80A 1Q10A 4L2YA 4BKGA 2DLBA 4A55A 1AN8A 1DOIA 4F1SA 2FCMA 1P7EA 2N7EA 2LGXA 3JSVB 3CWIA 3ABVB 3KUCB 2LWPA 1TY0A 1QOAA 2LVPA 2IO1B 4KZ0A 3NS1A 2X38A 2YEPB 3A4SC 1WRIA 3VUXA 1MG4A 1T0SC 3OWEB 1ISNA 1SIFA 2BKFA 3ZRFA 2WDVB 5FR3A 2I1KA 3BYYB 1YD8U 2MBBB 1UF0A 3EA6A 5D7GA 2RSUA 4EEWA 1TBEA 3AULA 1V97A 3VUWA 3IT4B 2KAJA 3A1QB 3VHTC 2LZ6A 3PVLA 3ZJTA 3SFDB 4YXDB 2KXJA 4N58A 1MI0A 2L0FA 2ZCCA 4K1RB 2HD5B 4NJCA 3X0WA 1R4NB 2WYQA 3DWGC 1D5XC 3Q3NC 1WX8A 2INCC 1VZ7A 1H7XA 3RNCC 3QK0A 1RYJA 3PPAA 1NDDA 1WY8A 2LJIA 3FAHA 5C2TB 3V62A 3L10B 2PE6B 1L4DB 5LXHA 1C3TA 2K8BA 1L2NA 2MBQA 3EFUA 1ZKHA 1EWCA 2LGYA 2K39A 1GG3A 1OGWA 1WIAA 2H88B 1WXAA 4IKGA 1I4QA 1VRAB 4RH6A 1E90A 3H9DA 4A20A 1FPYA 1R4MI 4P7IA 1JCKB 1J7CA 3NVVA 3UIPB 3ZVVA 4K81A 5BYRA 2VH2A 3ZDMC 1NENB 5AZHA 3TEZA 3PZDA 3BIID 2EKEC 2B76B 2FUG1 4HCNB 2LRUA 2N9LA 3WAMA 2YVCA 1UZXB 2JT4B 3AXCA 4DK5A 2L83A 4RFBA 2BKRB 3O13A 2K3UA 1NBFC 2KJHB 4MT5A 2MBOA 3PLUA 3PZ7A 4MGZE 4HDOA 3M3JA 1OQRA 3CF6E 1E10A 2KNBA 4B95A 2WXIA 3P42A 1L4ZB 2WXGA 2BYTA 4UDUC 1TYGB 2HTME 4XGAB 3IVFA 3IAS1 2RDBC 4BKTA 4L23A 5GMVA 1TKGA 2NR2A 2QCZA 4MSMB 5FK9C 1C79A 2O6VB 1J7BA 1IUEA 1WJUA 2KQ4X 2QMTA 4CQNA 1P9DU 2AL6A 2BPSA 3LXFA 1S1QB 1L5PA 1QKZA 3PSEB 4HWIB 1GJZA 4JL9A 3RZFA 1GUAB 3KWVA 1OEYA 3WANA 1JWAD 3N3KB 2OJRA 5GXGB 4CHKA 4JIOU 4NY0A 4MELA 3X23A 1M4VA 3W2DA 1UGMA 3CSFA 4F8CB 1V2YA 2C9WB 3RZWC 2WS3B 4ZRIA 2L32A 2W9NA 1JALA 4NNJB 2RD0A 1TZOA 4KSLC 3QC8B 1SE3A 2WX1A 3PTFC 4PS3A 4HKZE 4DWFA 2CHWA 4KKJA 1H8CA 3Q2AC 4HK2A 3PO0A 1T0YA 2DWQA 2J0JA 4RGTA 2FCQA 2G3QB 2KHWB 5EE9A 3SFEB 3U7DA 2KFJA 3DVNV 3Q8EA 3R3MA 1SXTA 3APFA 4X57B 2JPHA 4NAWA 3IBEA 1ZXHA 2PVOD 1I7HA 1H7WA 3WCQA 2XN9C 3HVDA 5HI1A 1YJJA 2BYEA 2K0PA 4IM0A 1I4HA 2Y5BB 1WM2A 4J3OD 1WR6E 1R7SA 2JRHA 1A5RA 1TIFA 2IY0B 4FXCA 5LXIB 1YIWA 1XCTL 3RT3B 4GXBA 1DOYA 2FNJB 1E9MA 1WF9A 2G4SA 1IPGA 1QT9A 5G5HA 4YSZB 4G11A 1T0QC 3PRZA 1WGKA 1YMHE 5IOIA 2FIDA 2AEHA 2IGDA 1T6BX 2NBUA 4OZAA 2DZIA 3ZJVA 2KK8A 1XQQA 1PQSA 3U30A 2MP2B 2KX0A 1UD7A 4EZKA 4IW0A 2Z8LA 4TQ1A 2RGFA 4FLHA 4FJYA 5E6PA 1N5XA 2D3AA 3N20C 1MPEA 2OEDA 5L83A 2LVQA 1NEKB 1B1ZA 3BYTB 4W9EA 3L16A 2CHXA 4KGSA 4II3B 2HTHA 2UWQA 1VJKA 2IO3B 3QHTA 1PGAA 1JQ4A 3LB8C 4O1NA 1VCBA 4WAAA 4YT0B 3OJ4B 3QARA 4KGTA 2MA9B 2GI9A 2W55A 2YLMA 4P1CC 3RPFC 1WJNA 2CHZA 2WP9B 5HKHA 3TIXA 1Y8RC 2AL3A 2GRIA 4S17A 2WXPA 2M17A 1WXMA 1LO5D 4W9GA 4MM3A 4DDGD 1F2RI 5CHWA 5DCNA 3L54A 3E56A 3TUOA 4ZRJA 3A9JB 4BFRA 5LNK1 3AE9B 4LNFA 3S2AA 3MHZA 4NAMA 4WJPA 3ONSA 3OLMD 4LLGM 2ZW1A 1FO4A 2LXCA 1DOXA 1QZEA 1JWSD 3R2TA 4CYEA 1WE6A 2O2VA 2ZEQA 5HHDG 3UF8A 1Y56A 2K25A 4F7ZA 1K52A 4OZCA 1WX9A 1KFYB 2N9PC 4RM9A 3Q3JA 2JXTA 2RMMA 1IGCA 4LNKA 3P4RB 4A6QA 2MHJA 2N7DA 1PFDA 1HEZE 4OZBA 3QA8A 1EU4A 3B08A 5AUKA 1N63A 1GB4A 1V1OA 2W3SA 1E5WA 1V6EA 1L0VB 3EUB2 1C1YB 3NJTA 3UIOB 5J2RA 1SE9A 2GBKA 5C1ZA 1FXTB 2XEWA 1ZGUB 1E6EB 3B9JA 2J53A 2W3RA 4WJOA 4URKA 3AU4A 4DHJD 1WXQA 1Q1OA 2WDTB 3A9KB 2MX2A 2KFKB 2OHFA 2WHIA 3C8YA 2AQ1B 2D3GA 2D11A 4M00A 1QLBB 4IOIE 1GTHA 4B9KA 4MACA 1VD2A 2D10A 4XWWA 1IBXB 3VTWA 1ENFA 1HTOA 2XK5B 1QOGA 3NVZA 4MGIE 3RNBC 1FRDA 4LNIA 2WU2B 4WIPA 2DBYA 2NBVB 2LUEA 3BINA 3H1UA 3U4EG 2L52A 2XBBC 1BUIC 1C77A 3HM6X 2C5LC 4P16A 1PDXA 4N9F4 1UGJA 4ARCA 1GC7A 4N6EB 2IYDB 3VR8B 3NRZA 3TEWA 1KF6B 1ACCA 1P98A 4GDKA 1KOTA
chains in the Genus database with same CATH topology
3HUIA 4YWGG 1NENB 3TEZA 2WU5B 1JWMD 3BIID 1SIJA 2WXJA 2AQ3B 2B76B 1FRRA 5C3JB 2FUG1 2RDHA 3L4PA 4YTNB 2N9LA 4HJGE 3V05A 2INPE 3I57A 1PUTA 3AE2B 2CJNA 1SE2A 2L1AA 2ICIA 2MJEA 2L83A 2SAKA 4AQ7A 2EKIA 2W54A 4RFBA 4JX1C 3O13A 4C56C 1QOFA 2K3UA 1HZ5A 1WWTA 1CQVA 2WXKA 2QILA 4MT5A 1CK1A 3PZ7A 1MVKA 2NMQA 3CF4A 1OQRA 2N0SB 1C4AA 2WXLA 1FD6A 1FEHA 1E10A 3BK2A 1EM7A 2WXIA 1YNTE 3TEYA 3P42A 1L4ZB 3BK1A 1OQQA 1C4PA 1YN5A 2WXGA 2BYTA 1DYQA 2KDMA 2Y3AA 4UDUC 3Q69A 2Y5PA 2M0AA 3W5UB 1TYGB 1FNVA 3AEDB 4WURA 2HTME 2VZKD 1TS4A 2PIAA 1JRPA 1UWXA 3IAS1 2RDGA 2KN4A 4L23A 3AE1B 1TKGA 3VRAB 2E3TA 1SJHD 1K51A 5JXVA 1GB1A 3P4SB 2WLBA 4GDKB 2WDRB 5FK9C 1C79A 3SR6A 1RFKA 1J7BA 2K9XA 4YSYB 2LEKA 4WAFA 3J9CA 2JZPA 1IUEA 1HQRD 2KQ4X 1T5XD 2IPKD 2QMTA 2V0GA 4CQNA 2ACZB 2G9HD 5H92C 3T3OA 1IBXA 1RWSA 2FBWB 1GPXA 1I4XA 5D3IB 4RGOS 3LXFA 2WXHA 1XLOA 1GT8A 1L5PA 1QKZA 4TMAB 5HFYA 1YN3A 1NVID 4A8XC 1ET9A 3KWVA 4GLSC 1JWAD 1EWYC 1ZDXA 4WWMA 5D3DA 5GXGB 2VZKB 1FIQA 3Q8FA 2J4XA 1SE4A 4NAWB 1M4VA 3I9V1 3E9SA 1XLQA 1XEEA 1JW9D 3P1MA 3W2DA 3AEBB 1TKYA 2XNAC 4HROA 1QQRA 4B0MA 1CZPA 1L0YB 4ARIA 2CJOA 2LHDA 3FILA 2Y5CA 2ONQA 1ZE3D 3UI3A 4B0EA 2IJ0A 2WS3B 1D5ZC 2M19A 2L32A 2INNE 1K53A 1PGXA 1V8CA 2WQYB 3W5VB 1JALA 1JWBD 2JYTA 3N9YC 1TZOA 3AE5B 1I4PA 5EE0A 1SE3A 5I4DA 1RM6C 1F0ZA 4HKZE 2DYMA 1L0XB 4KKJA 1STEA 1KH0A 4ZOHC 5EE3A 1P7FA 1YN4A 3PO0A 5TSSA 4ZHOA 4OW0A 2DWQA 4AS1A 1ZPSA 1AWDA 4RGTA 1N5WA 1E0ZA 2K22A 5EE9A 5T8IA 2PKOA 1JWUD 2AQ2B 3SFEB 2KWDA 2BBCA 4N59A 3AV8A 4OHJA 3Q8EA 1J7AA 2QJLA 2WDQB 5H8YE 1SXTA 3R8BA 1ZXHA 2PVOD 1YQ3B 1I7HA 2KACA 1H7WA 3WCQA 4M0WA 3AEAB 2XN9C 3HVDA 2Q5WD 2BB6A 4RCOA 5HI1A 1KTKA 1YJJA 3AE7B 2K0PA 1ESFA 2RPVA 1I4HA 2N7JA 1XXGA 4XDDA 1C4CA 1XF5L 4J3OD 1R7SA 1FCCC 1YQ4B 2HDEA 1PGBA 3MJ5A 4FXCA 2KMMA 3AH7A 1XCQL 2V4IB 3P4PB 1XCTL 3AE4B 1DOYA 4US9A 2WXQA 1E9MA 2WXOA 4Q2JA 5EE1A 1QT9A 5G5HA 1WYGA 4ITKA 4YSZB 4MM3B 3RFZB 1JMLA 2MH7A 1WGKA 2IGHA 1YMHE 4WQMA 2FE8A 1FXIA 3AN1A 1L6UA 3ZJUA 3DWMA 2PW9A 1N60A 2IGDA 1T6BX 1QF6A 1VR9A 2LGIA 1KRHA 4IDIA 3MFGA 2AX5A 4OZAA 4JE3B 2H89B 1QILA 3W1SA 3ZJVA 2D5GA 1ZP0B 5MPOA 1IGDA 2CU3A 2JU6X 1I4RA 1ZUD2 2V3PA 2Z8LA 3B2GA 3R2IA 4TQ1A 1C9FA 1N61A 3AM9A 1N5XA 3W9CB 3ZQ4A 1D4BA 4NZLB 1EU3A 1MPEA 1SF0A 2QSDA 4USAA 2OEDA 1JROA 1V1PA 3FC4A 4ZHPA 1NEKB 1B1ZA 3BYTB 3T3NA 1K50A 1SSNA 4C7ZA 3AE3B 4KGSA 2J52A 4XDCA 2YEPF 4LTUA 3KLSX 3HVZA 3AE8B 2BT6A 4YTMB 1VJKA 1GOZA 1ZDVA 3V3XA 2M56B 4YTPB 1PGAA 1F77A 2E6XA 2SEBD 2JYEA 1JQ4A 1UWMA 3LB8C 2TSSA 4O1NA 5BYQA 5G5GA 3AECB 2K5PA 1F2RC 4A90A 4YT0B 1MHXA 4ZRQA 1TS2A 4GDLB 3ZGZA 3ZYYX 4KGTA 5FKAC 2J42A 1NYQA 4RNAA 2JQRB 1UNSA 1SEBD 2GI9A 2NTSA 2PVGC 2W55A 1TS5A 3IT6B 3AE6B 3RPFC 3U7ZA 2WXNA 1VZ6A 4TSSA 2PLPA 3VR9B 2LFIA 2NTTA 1VLBA 4C80A 2WP9B 1FNUA 5E6JA 3MP9A 2I2YA 4H2AA 5BMGA 2GRIA 5BYSA 3ETRA 1HXYD 4KX6B 1ET6A 1HA5A 3LYYA 2W82A 3U52E 4XE0A 2WXPA 4EE2A 2MJ3A 4L1BA 4OVZA 1LO5D 3KWLA 1NI3A 2BS4B 2WXRA 1F2RI 1FFVA 1OFFA 4KKIA 1FFUA 1QOBA 2BW2A 4HEA1 2GB1A 1XLNA 3E56A 3TUOA 3SEBA 1T3QA 2N9KA 1AW7A 2EELA 5BMHA 3BVZA 2IDYA 5LNK1 3AE9B 3B2FA 3CIRB 1BMLC 2BS3B 3MHZA 4NAMA 4PT5A 3HRDD 4C7YA 1FMAD 1TY2A 1KLGD 3VQIA 1UUPA 2LUMA 1ROEA 4LLGM 3PZ8A 3AEFB 1SB3C 1C78A 2ZW1A 3NVYA 4RGNA 2PMVA 1TJEA 1A70A 1KLUD 3NUHB 1FO4A 1B9RA 1DOXA 1D5MC 1ZXIA 1HZ6A 3Q8CA 1JWSD 1VDVA 2R61A 3R2TA 1YJIA 4JWUC 2JSVX 3BWUD 4P6VF 1CJEA 3MC0B 4DXGA 5HHDG 2G1EA 3AEEB 1SBBB 1Y56A 3Q8AA 4RF0A 5HG2A 1K52A 4OZCA 1Q10A 1KFYB 4JWSC 4L2YA 3AB5A 2DLBA 2JXTA 4A55A 2RMMA 1IGCA 1GAQB 1AN8A 3P4RB 1DOIA 4A6QA 4RF1A 1I4GA 1PFDA 1XLPA 1HEZE 1P7EA 1TS3A 4OZBA 1EU4A 2QEJC 3Q8BA 5AUKA 1N63A 3CWIA 3ABVB 1GB4A 1V1OA 2BS2B 2W3SA 1TY0A 1QOAA 1L0VB 3EUB2 1L6VA 3BZDB 3NS1A 1DGJA 3GS2A 2BTEA 2MJDA 3FILB 2X38A 2YEPB 1FM0D 1WRIA 4ZRPA 3OWEB 1FXAA 4HKQA 3GB1A 2WDVB 4DXFA 5FR3A 1PYWD 1VZ8A 5AUIA 1E6EB 3B9JA 3BYYB 2J53A 2W3RA 2I38A 1N62A 3EA6A 5D7GA 1WXQA 1V97A 3NZ3A 2V3NA 3IT4B 2KAJA 3H8HA 2OHFA 2QIEB 1FNWA 3C8YA 2BB5A 3IXSA 2IGGA 4D2KA 1ZOYB 2AQ1B 4WH4A 3ZJTA 3SFDB 1QLBB 3IAM1 4YXDB 4IOIE 1GTHA 4RGMA 4N58A 4TQ0A 4US8A 4MACA 1WSPA 1FCLA 1MI0A 4REZA 4XWWA 2WXFA 1NYRA 1E7PB 1IBXB 1GTEA 3AEGB 1ENFA 1BXTA 5BMIA 1QOGA 2JWUA 4NJCA 3VRBB 3NVZA 3DWGC 2ON8A 1FRDA 4ZYSA 1D5XC 2WU2B 3AMZA 1VZ7A 1H7XA 2ZW0A 3BVGA 2MEKA 4MH8A 4DQOC 4A9AA 4WIPA 2DBYA 3P63A 1RYJA 2WNMA 1V1PB 3GP7A 4XWTA 1MHHE 4HRSA 4LK0M 2LJIA 3FAHA 3U4EG 2L52A 5C2TB 4JPSA 3TSSA 1L4DB 3TEXA 1AYFA 1BUIC 1C77A 4YSXB 3EGRA 4R3DA 3NVWA 1EWCA 2JX5A 4P16A 1PDXA 4ARCA 1UGJA 4N6EB 3U2SC 2H88B 3VR8B 1SJED 1C76A 2LMCA 3BVMA 3NRZA 4IKGA 1I4QA 3TEWA 2WXMA 3URYA 1KF6B 1ACCA 1TKEA 2DYOA 2LHEA 4KGRA 1VRAB 4RH6A 1XO3A 2PTLA 3KQ4A 1D6EC 1JCKB 1J7CA 3NVVA 5BYRA 3P4QB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GAQ B;  1CZP A;  3HUI A;  1NEN B;  3P4R B;  1DOI A;  1SF0 A;  2WU5 B;  2CJO A;  3BII D;  4USA A;  1SIJ A;  2Y5C A;  2B76 B;  1FRR A;  5C3J B;  1PFD A;  1JRO A;  1XLP A;  3FC4 A;  4ZHP A;  1NEK B;  3L4P A;  4YTN B;  2WS3 B;  2M19 A;  4C7Z A;  3AE3 B;  4LTU A;  1V8C A;  5AUK A;  3HVZ A;  2WQY B;  1N63 A;  3W5V B;  1JAL A;  3CWI A;  1JWB D;  3ABV B;  3AE8 B;  2BT6 A;  2BS2 B;  3AE2 B;  4YTM B;  1PUT A;  1VJK A;  2CJN A;  2MJE A;  2L83 A;  2M56 B;  3AE5 B;  4YTP B;  1QOA A;  1L0V B;  2EKI A;  3EUB 2;  1JQ4 A;  2W3S A;  1UWM A;  1L6V A;  3LB8 C;  2W54 A;  5EE0 A;  4JX1 C;  1RM6 C;  1DGJ A;  3NS1 A;  5G5G A;  1F0Z A;  3AEC B;  1QOF A;  2K5P A;  2MJD A;  1WWT A;  1FM0 D;  1WRI A;  1FXA A;  4ZOH C;  4YT0 B;  5EE3 A;  2WDV B;  3PO0 A;  4ZHO A;  3CF4 A;  1OQR A;  2N0S B;  5AUI A;  3ZYY X;  1E6E B;  3B9J A;  1NYQ A;  2W3R A;  2JQR B;  2DWQ A;  1E10 A;  1AWD A;  2PVG C;  2W55 A;  1N5W A;  1E0Z A;  1N62 A;  2K22 A;  5EE9 A;  2PKO A;  3AE6 B;  3RPF C;  1WXQ A;  1OQQ A;  1V97 A;  3SFE B;  3VR9 B;  2KAJ A;  4N59 A;  3AV8 A;  2OHF A;  1VLB A;  4C80 A;  2WP9 B;  2QIE B;  1J7A A;  2QJL A;  2WDQ B;  5H8Y E;  3W5U B;  1TYG B;  3AED B;  1ZOY B;  3ETR A;  4KX6 B;  2HTM E;  2PIA A;  2PVO D;  1YQ3 B;  1QLB B;  3SFD B;  4YXD B;  1JRP A;  1H7W A;  1I7H A;  1GTH A;  3WCQ A;  4US8 A;  4N58 A;  3AEA B;  2MJ3 A;  3KWL A;  1NI3 A;  2Q5W D;  1YJJ A;  3AE1 B;  1TKG A;  3VRA B;  2BS4 B;  2E3T A;  1NYR A;  1E7P B;  1GTE A;  3AE7 B;  3AEG B;  1FFV A;  1OFF A;  3P4S B;  1FFU A;  1QOG A;  2WLB A;  1QOB A;  3VRB B;  2WDR B;  1R7S A;  3NVZ A;  3DWG C;  1FRD A;  1XLN A;  1RFK A;  3SR6 A;  1J7B A;  1YQ4 B;  2K9X A;  4YSY B;  1T3Q A;  2WU2 B;  2LEK A;  3AMZ A;  4FXC A;  2KMM A;  3AH7 A;  1H7X A;  1IUE A;  4A9A A;  3P4P B;  2DBY A;  3P63 A;  1RYJ A;  3AE4 B;  1DOY A;  4US9 A;  3AE9 B;  3B2F A;  2ACZ B;  3CIR B;  1E9M A;  5EE1 A;  2BS3 B;  1QT9 A;  5H92 C;  4HRS A;  5G5H A;  1WYG A;  3HRD D;  4ITK A;  4YSZ B;  3FAH A;  2L52 A;  1FMA D;  1RWS A;  2FBW B;  4C7Y A;  1GPX A;  5C2T B;  2MH7 A;  1WGK A;  1ROE A;  4WQM A;  1AYF A;  3LXF A;  3AEF B;  1FXI A;  1SB3 C;  1L6U A;  1XLO A;  3AN1 A;  1GT8 A;  1L5P A;  3NVY A;  1FO4 A;  3DWM A;  1B9R A;  4YSX B;  1A70 A;  1TJE A;  1DOX A;  1N60 A;  3NVW A;  1ZXI A;  1QF6 A;  2JX5 A;  1NVI D;  1PDX A;  1VDV A;  1KRH A;  4IDI A;  2AX5 A;  1YJI A;  2H89 B;  4JWU C;  4N6E B;  1JWA D;  2H88 B;  3VR8 B;  4P6V F;  1EWY C;  1CJE A;  3NRZ A;  4WWM A;  5GXG B;  1FIQ A;  1ZP0 B;  1KF6 B;  1TKE A;  3AEE B;  2G1E A;  5MPO A;  1XO3 A;  2CU3 A;  1ZUD 2;  1XLQ A;  3B2G A;  1JW9 D;  3P1M A;  3AEB B;  1TKY A;  1KFY B;  4JWS C;  1N61 A;  1J7C A;  1N5X A;  3AM9 A;  3NVV A;  3AB5 A;  3W9C B;  4HRO A;  3P4Q B; 
#chains in the Genus database with same CATH topology
 4EOY A;  4HJK A;  2AQ3 B;  2DZK A;  3L4P A;  1V49 A;  4RM8 A;  3WAO A;  2INP E;  3I57 A;  5TR5 A;  4K3B A;  2FUH B;  1PUT A;  3H7P B;  2CJN A;  1SE2 A;  2L1A A;  2ICI A;  3VAW A;  3UQA A;  2OJW A;  2EKI A;  1IP9 A;  2KN5 A;  1QOF A;  1HZ5 A;  1CQV A;  4MH0 E;  4KZC A;  1CK1 A;  1MVK A;  2NMQ A;  1L7Y A;  2WXL A;  1WI0 A;  3I63 C;  3BK2 A;  4MJS A;  2KMC A;  1YNT E;  3TEY A;  2N4F A;  2LRW A;  2FCN A;  3BK1 A;  2L76 A;  1C4P A;  1YN5 A;  2K6D B;  3L17 A;  3Q69 A;  2M0A A;  3VDZ A;  1G6J A;  1FNV A;  2MP2 A;  1TS4 A;  2PIA A;  1JRP A;  1UWX A;  2KN4 A;  2C7N B;  3ZW3 A;  3AE1 B;  3VRA B;  5JHB A;  1SJH D;  1K51 A;  4KIK A;  3VVW B;  2M1M A;  5JXV A;  1GB1 A;  2M4N A;  4GDK B;  4NQL B;  1WX7 A;  2BWE S;  3Q6B A;  4CO7 A;  3SR6 A;  3DBH B;  2K9X A;  4YSY B;  3D32 A;  1XD3 B;  4KVG B;  1IBX A;  2KVR A;  5D3I B;  1F9J A;  2PEA A;  4RGO S;  2WXH A;  2PE9 A;  4A8X C;  3RYT A;  3C19 A;  2JY6 A;  4MSQ B;  2VZK B;  1FIQ A;  2N9E B;  4AJW A;  4NAW B;  3E9S A;  2MBH A;  1JRU A;  3KW5 B;  1TZ1 A;  3ZDT A;  2LD9 A;  4HRO A;  4B0M A;  3FIL A;  3UGB B;  2ONQ A;  3UI3 A;  4B0E A;  3PT2 B;  4II2 B;  3NZU A;  1D5Z C;  2M19 A;  5CHV C;  1I4P A;  4QAY A;  1RM6 C;  3GE8 C;  1L0X B;  1KH0 A;  3H7S A;  2MCN B;  2KOX A;  4LDT B;  3UQB A;  5TSS A;  1Q0W B;  4P1B C;  4GIV A;  4LNO A;  2CR5 A;  4HPM B;  3V61 A;  1WGG A;  1N5W A;  2K22 A;  4NPN A;  2O2V B;  3M62 B;  3PLV A;  1HTQ A;  3LDZ E;  2BBC A;  3AV8 A;  3APD A;  3VFK A;  1WH3 A;  3HK0 A;  2QJL A;  2WDQ B;  1Z5S B;  4EZL A;  4AUQ C;  1WXV A;  2OOB B;  4EZJ A;  2PPH A;  1WGY A;  2KAC A;  2V1Y A;  3ZNZ B;  3AEA B;  2KX3 A;  5JZE B;  1KTK A;  1RRB A;  3Q3O C;  1I42 A;  1ESF A;  1R4M B;  1XF5 L;  1WJ4 A;  3H7P A;  1FCC C;  4IC7 B;  2HDE A;  4NJ7 A;  1WXS A;  3MJ5 A;  2VRR B;  2GBM A;  4XX5 A;  2C7M B;  4US9 A;  2WXO A;  4HVB A;  1Z2M A;  2GLS A;  1JML A;  4B6W A;  2IGH A;  1FXI A;  3AN1 A;  4GGQ A;  2PW9 A;  3EC8 A;  1YX6 B;  4WWN A;  1RAX A;  1KRH A;  3MFG A;  2AX5 A;  4JE3 B;  1M94 A;  3EHV A;  3HIZ A;  4KSK C;  5MPO A;  2R2O A;  1ZUD 2;  2V3P A;  1C9F A;  2MWS B;  3ZQ4 A;  3W9C B;  4M01 A;  2IO2 B;  2QSD A;  5DPS A;  1V1P A;  2KDB A;  1V5O A;  3DDC B;  3HVZ A;  3N1Y C;  3DVN U;  2BT6 A;  1GOZ A;  2E6X A;  1F77 A;  5G2N A;  3ZXV A;  3QQ8 B;  2TSS A;  4E3C A;  2JUO A;  2K5P A;  1F2R C;  3TJP A;  3DCG A;  4AOF A;  4GOC A;  1MHX A;  4GDL B;  4FHK A;  3PV1 A;  3ZYY X;  3B0A A;  3QAQ A;  4RNA A;  1WJ6 A;  4K3C A;  3RNA C;  2ASQ A;  3U7Z A;  3CMM B;  2L00 B;  2WXN A;  1VZ6 A;  2CU1 A;  3VR9 B;  3WAP A;  4C80 A;  2I2Y A;  2I1J A;  4H2A A;  5BMG A;  3ETR A;  1HXY D;  3LYY A;  3U52 E;  1F1H A;  4OVZ A;  3B1L X;  4HPL B;  1NI3 A;  1AAR A;  2DX5 B;  4IUM B;  1FFV A;  1OFF A;  4KKI A;  3ML9 A;  4JGH B;  4HEA 1;  1WGR A;  4BOZ B;  1XLN A;  2LAS A;  3SEB A;  1T3Q A;  5EDS A;  3NHE B;  2QDF A;  3BVZ A;  3N32 A;  4G3X B;  1LGR A;  3CIR B;  4J6I A;  4MDK E;  1YOV B;  3R7Q A;  4XZ4 A;  1TY2 A;  1KLG D;  4G50 A;  4EFO A;  4RGN A;  1B9R A;  2PMV A;  1A70 A;  3NUH B;  2DYB A;  1ZXI A;  1HZ6 A;  4JWU C;  3BWU D;  1H4R A;  4DXG A;  1D3Z A;  3CST A;  3RUI B;  2D07 B;  3L0W B;  3Q8A A;  3L13 A;  4A3P A;  4DXA B;  2RPQ A;  4M0W B;  1I4G A;  5CTR C;  5L95 C;  3A4R A;  3DQV A;  1TS3 A;  4KIK B;  3M95 A;  3DHI C;  2QEJ C;  1HE8 A;  3DPD A;  3Q8B A;  4HDQ A;  2BS2 B;  2L0T A;  2ZVO A;  2G45 B;  2QC8 A;  3TCA A;  2WX0 A;  2BTE A;  1DGJ A;  5FR6 A;  2MJD A;  2KKC A;  2MW5 A;  5C23 A;  2GBJ A;  4YL8 A;  5AUI A;  3RNG C;  1BT0 A;  3DHH C;  2I38 A;  1N62 A;  2KLC A;  4AJY B;  4GB9 A;  3NZ3 A;  2V3N A;  4WQO B;  3DVG X;  4EUT A;  3H8H A;  3R66 C;  2BB5 A;  2IGG A;  4D2K A;  1ZOY B;  4C4V A;  4WH4 A;  4JLC A;  2WGS A;  3IAM 1;  4RGM A;  4PS7 A;  1MG8 A;  1WSP A;  3NS8 A;  2PJH A;  4ZRK A;  1FCL A;  3C0R B;  4REZ A;  1NYR A;  1E7P B;  2BWF A;  1BXT A;  2KTF A;  2JWU A;  3VRB B;  5DPW A;  1UBQ A;  3K9O B;  2ON8 A;  3K9P B;  3AMZ A;  1WZ0 A;  4ANW A;  2MEK A;  4DQO C;  3H6N A;  2HJ8 A;  3P63 A;  2WNM A;  1LXD A;  3GP7 A;  4HRS A;  2IND C;  2BYV E;  1WM3 A;  4LK0 M;  2Z59 B;  1WE7 A;  4JPS A;  1AYF A;  3KUZ A;  4YSX B;  2M8S A;  4R3D A;  4WWO A;  3NG0 A;  3V60 A;  3ZIM A;  1WMH A;  1C76 A;  3BVM A;  3V6E B;  1MJD A;  2CS4 A;  3URY A;  4KGR A;  1XO3 A;  3DBL B;  2PTL A;  3KQ4 A;  1D6E C;  4XC2 A;  3P4Q B;  3JVZ X;  2ZVN A;  4YWG G;  1WYW B;  3ML8 A;  2WU5 B;  1JWM D;  1SIJ A;  2NPT B;  1FRR A;  4YTN B;  2GBR A;  4HJG E;  5IN7 A;  3AE2 B;  2SAK A;  4FUL A;  3AU5 A;  2KVZ A;  5IA7 A;  4C56 C;  1UBI A;  2LXA A;  4AP4 C;  3DBR B;  2WXK A;  2QIL A;  1X1M A;  2ZJD A;  3R7R A;  4JQW C;  5IO9 A;  5BO4 B;  2R2Q A;  3V6C B;  3CF4 A;  2N0S B;  1C4A A;  1FD6 A;  1E8X A;  1LM8 B;  1DYQ A;  2KDM A;  1WR1 A;  2Y3A A;  3SU8 X;  2K1F A;  3W5U B;  3AED B;  4WUR A;  5DPT A;  4M02 A;  4MEM A;  2V9H A;  2AWT A;  2RDG A;  1CMX B;  2E3T A;  1J0G A;  1YJ1 A;  4TUU A;  4FAD A;  2KO3 A;  4LCD E;  2MSE D;  1RFK A;  2LEK A;  4RMA A;  2JZP A;  2IPK D;  3Q3F A;  2ACZ B;  4ZDV A;  2G9H D;  2D3C A;  1YX5 B;  5H92 C;  2G4D B;  2FBW B;  1GPX A;  2KDI A;  4KDL B;  4E71 A;  1XLO A;  1GT8 A;  2KYW A;  4K7U A;  4MJS B;  1RLF A;  5HFY A;  1ET9 A;  3PS6 A;  2AYO B;  2LVO A;  1WFY A;  3N1Z C;  1EWY C;  4WWM A;  2JXX A;  3Q8F A;  2J4X A;  3I9V 1;  1XLQ A;  4BKS A;  1JW9 D;  3AEB B;  2XNA C;  3DBL I;  1L0Y B;  3ALB A;  3U8Z A;  4IM2 A;  4PYU A;  1E8Y A;  3MHS D;  2IJ0 A;  1K53 A;  4BOS C;  1PGX A;  2MRP A;  2WQY B;  3PHW B;  4WJN A;  4I6N B;  1JWB D;  1LFD A;  2KZR A;  2O6V A;  3N9Y C;  3PRE A;  3AE5 B;  5EE0 A;  1F0Z A;  2KJ6 A;  2L7R A;  2DYM A;  1STE A;  4ZOH C;  1YN4 A;  4ZHO A;  5IAA C;  1E0Z A;  3ZNG C;  1JWU D;  2AQ2 B;  1WRD B;  2KWC A;  2KDE B;  2KC1 A;  1J7A A;  5H8Y E;  3R8B A;  1YQ3 B;  4KDI C;  4M0W A;  2Q5W D;  2BB6 A;  2HE7 A;  2HJ1 A;  1MFW A;  2K8H A;  2RPV A;  2N7J A;  1XXG A;  2GOW A;  2V4I B;  4BBN F;  2JWZ A;  3AE4 B;  2REX A;  2WXQ A;  4Q2J A;  4TV3 A;  2LGS A;  2MH7 A;  2N1V A;  2V4L A;  4WQM A;  1R4N I;  3ENE A;  2BGF A;  3DWM A;  1N60 A;  3ZO5 B;  1VR9 A;  2H89 B;  3ZLZ A;  1NI2 A;  2X8X X;  1IGD A;  2CU3 A;  3R2I A;  2DAJ A;  2KWU B;  3PGE A;  4NZL B;  1EU3 A;  3VH3 B;  1SF0 A;  2K6Q A;  4USA A;  2B3A A;  4W9D A;  4FA6 A;  3FC4 A;  4I6P A;  3MJW A;  3AE3 B;  2J52 A;  2YEP F;  4LTU A;  3AE8 B;  1GC6 A;  1Q5W B;  1ZDV A;  2M56 B;  4YTP B;  4BVU C;  2JYE A;  4IWQ A;  3WIM A;  5BYQ A;  5G5G A;  2ZCB A;  1UH6 A;  4HCP B;  4A90 A;  4ZRQ A;  3ZGZ A;  2KQ7 A;  2KTR B;  3O65 B;  5FKA C;  2J42 A;  2JQR B;  4PYZ A;  1UNS A;  1SEB D;  2PVG C;  2KMA A;  1TGZ B;  3Q14 C;  1TS5 A;  3IT6 B;  3AE6 B;  5LLI A;  2IBI B;  2PLP A;  2LFI A;  2NTT A;  1VLB A;  4KX6 B;  1HA5 A;  3VTV A;  4XE0 A;  5CHF A;  4EE2 A;  3N1X C;  2MJ3 A;  4L1B A;  3ZRC A;  3KWL A;  5D2M B;  1FFU A;  4W9C A;  1QOB A;  2BW2 A;  3IHP C;  3OG5 A;  4LJO B;  1TT5 B;  2N9K A;  4MGK E;  2JF5 A;  2EEL A;  5BMH A;  2IDY A;  1BML C;  2N1W A;  2BS3 B;  3HRD D;  1FMA D;  3DOW A;  1UUP A;  2KLG A;  1ROE A;  3AEF B;  1C78 A;  3WA0 A;  1P3Q U;  4MGY E;  4W9H A;  1TJE A;  3HHM A;  3ZXR A;  3Q3M C;  3Q8C A;  2GBN A;  4BZA A;  5CX3 A;  1WZ3 A;  1VDV A;  2KTR A;  1YJI A;  5E6N A;  3QCA A;  1CJE A;  3MC0 B;  1SBB B;  4RF0 A;  5HG2 A;  3P2B A;  4JWS C;  4OVV A;  1KJT A;  3AB5 A;  4LNN A;  2NS5 A;  1GAQ B;  4WJQ A;  3IG3 A;  4RF1 A;  1E7U A;  1XLP A;  3RNE C;  4W9L A;  4WWP A;  2A5U A;  1IYF A;  3ZKJ C;  1L6V A;  3EEC A;  3BZD B;  3GS2 A;  3KVF B;  3FIL B;  3BY4 B;  3M63 B;  2BVC A;  2DEN B;  1FM0 D;  4ZRP A;  4OVU A;  4GMV A;  1FXA A;  4HKQ A;  3GB1 A;  3RUL A;  4DXF A;  1PYW D;  2EMS A;  2BQQ A;  1VZ8 A;  2KAN A;  3QX1 A;  4HPP A;  5E6O A;  1OTR B;  3RN9 C;  3TL5 A;  3VTU A;  2ZNV B;  3GE3 C;  4W9F A;  2LI5 A;  1KM7 A;  2QIE B;  1FNW A;  2J0K A;  1EF5 A;  3IXS A;  3I5J C;  2XK5 A;  4TQ0 A;  4US8 A;  2UYZ B;  3HM3 A;  1P1A A;  2WXF A;  3TBL D;  1GTE A;  3AEG B;  3QJZ A;  2DNF A;  3RI7 C;  3ZNH B;  5BMI A;  3UIN B;  2ZNV C;  1J8C A;  4ZYS A;  1UEL A;  2D2Q A;  1XT9 B;  3KYC D;  2QHO A;  3A9K A;  2ZW0 A;  3BVG A;  4MH8 A;  3WAL A;  4A9A A;  3T8M A;  1V1P B;  4IWO A;  4XWT A;  1MHH E;  2ZPY A;  2JZZ A;  4TKN A;  2ZPN A;  4BKS D;  4ANV A;  3TSS A;  3TEX A;  1WMH B;  3EGR A;  4A3O A;  3NVW A;  2JX5 A;  4W9K A;  3U2S C;  2JRI B;  1SJE D;  2LMC A;  4E74 A;  1E7V A;  2WXM A;  2DYO A;  1TKE A;  2N9X A;  2LHE A;  2O6V D;  1RFA A;  3HUI A;  1V5T A;  5D94 A;  3DBH I;  2WXJ A;  5C3J B;  2RDH A;  3I3T B;  4BBN C;  4K7W A;  3V05 A;  4K7S A;  2MJE A;  4AQ7 A;  2W54 A;  4GN1 A;  2L05 A;  4FN2 A;  4JX1 C;  5KHO A;  1WWT A;  3GZN B;  1TTN A;  4EKU A;  2KQS A;  1E8W A;  1OQY A;  4HXD A;  5KHQ A;  4C00 A;  4I6L B;  1FEH A;  1EM7 A;  4NQK E;  3QIJ A;  2LGD A;  2FIF A;  1OQQ A;  3SHQ A;  3ZUN A;  2Y5P A;  4DHZ E;  1EF1 A;  2MBE A;  2VZK D;  2L3Z A;  2K8C A;  4ASW C;  3DBR I;  4GSW A;  3P4S B;  2KJR A;  2NVU I;  2WLB A;  1E8Z A;  2WDR B;  4DBG A;  4WAF A;  4ICU A;  3J9C A;  4PS8 A;  2CKH B;  3QWZ B;  1HQR D;  5IP4 D;  3DBS A;  2JZ3 B;  1T5X D;  1V86 A;  3TMP B;  2V0G A;  3KH0 A;  2Z0D B;  4FJV B;  4XYC A;  3T3O A;  2KD0 A;  1RWS A;  1I4X A;  1GNU A;  4DDI D;  2UU7 A;  4ZYN A;  4TMA B;  1LQB A;  4ICV A;  4DHJ B;  1YN3 A;  1NVI D;  4GLS C;  4S0R A;  1ZDX A;  5D3D A;  2JVC A;  1SE4 A;  3IFW B;  2KT7 A;  3NZS A;  2NBW B;  1XEE A;  3SD5 A;  5JH5 C;  3P1M A;  1TKY A;  4HLE A;  1WGD A;  2KC2 A;  1KLV A;  1QQR A;  1EUV B;  1YQB A;  1CZP A;  3VH4 B;  4ARI A;  2CJO A;  2LHD A;  2C7H A;  2Y5C A;  1ZE3 D;  2V3S A;  2FCS A;  2DZM A;  4G0N B;  4KV2 A;  2INN E;  1V8C A;  4FJZ A;  2C60 A;  3DVG Y;  3W5V B;  2KFK A;  2JYT A;  3RNF C;  3VUY A;  3W1S C;  1N6Z A;  3MTN B;  5I4D A;  3JYU A;  3L08 A;  4LJP B;  5EE3 A;  1J19 A;  1P7F A;  4OW0 A;  3RD2 A;  4AS1 A;  1ZPS A;  3FKY A;  1AWD A;  1F52 A;  4FHJ A;  5T8I A;  2PKO A;  2DZJ A;  5JHA A;  3KUD B;  4GDL A;  3APC A;  2FAZ A;  2KWD A;  4OHJ A;  4N59 A;  2J0M A;  3VXW A;  5IKC M;  4AWJ A;  4RCO A;  3AE7 B;  3AI5 A;  2MLB A;  4XDD A;  1C4C A;  5DPR A;  1YQ4 B;  4ACF A;  3A9J A;  1PGB A;  2KMM A;  3AH7 A;  2IO0 B;  1XCQ L;  3P4P B;  1I35 A;  3PRM B;  1ZW7 A;  2KWV B;  2D3B A;  5EE1 A;  1WYG A;  4ITK A;  4MM3 B;  1T0R C;  3RFZ B;  5AZG A;  2FE8 A;  2L8J A;  3ZJU A;  1L6U A;  4M8N A;  1QF6 A;  3OAW A;  2LGI A;  4IDI A;  1QIL A;  3W1S A;  3RMK C;  2RR9 A;  2D5G A;  2IZV B;  2MQJ A;  1ZP0 B;  3SDL C;  1WGH A;  2JU6 X;  3NY5 A;  1I4R A;  3B2G A;  4ANU A;  1P0R A;  2J7Q B;  2NCN A;  5AEK B;  1N61 A;  3AM9 A;  1D4B A;  5D6J B;  3GOE A;  3JSV A;  1SGH A;  1JRO A;  3A33 B;  1S3S G;  4ZHP A;  2KDF B;  3T3N A;  1K50 A;  5J18 A;  1SSN A;  4C7Z A;  4XDC A;  3KLS X;  3T9L A;  2M0X A;  2BYF A;  4YTM B;  3MC8 A;  3V3X A;  2SEB D;  3NOB A;  1UWM A;  3LJ3 A;  3EFC A;  3AEC B;  1K8R B;  4DHZ B;  1U4A A;  2BF8 B;  3ECI A;  1TS2 A;  2LJ5 A;  2VH1 A;  1NYQ A;  2NPT A;  2NTS A;  5G55 A;  2Z0E B;  4TSS A;  4IWP A;  1FNU A;  5E6J A;  3MP9 A;  4FBJ B;  5BYS A;  1ET6 A;  2W82 A;  3W1Y A;  4BAX A;  2ZZP B;  3GZN I;  4GU2 A;  4LDT D;  2BS4 B;  2WXR A;  2DHZ A;  5AZF A;  1EO6 A;  2GB1 A;  3PRP B;  4M8M A;  1AW7 A;  2DAF A;  3PHX B;  3N30 A;  2A4Z A;  2IY1 B;  1V81 A;  4PK1 A;  2WWZ A;  3B2F A;  3KYD D;  3ZNI D;  4NJ6 A;  4PT5 A;  1OEY J;  4C7Y A;  3DHG C;  3OJ3 A;  3VQI A;  3ZTC A;  2LUM A;  3PZ8 A;  3RCZ A;  1SB3 C;  3NVY A;  1KLU D;  1D5M C;  3MC9 A;  5J17 A;  2R61 A;  4W9I A;  4ANX A;  2JSV X;  4P6V F;  3JW0 X;  2G1E A;  3AEE B;  2GMI C;  1V9J A;  4C4V B;  3ZTD A;  4IM3 A;  2EMT A;  4W9J A;  4IG7 B;  3A1Q A;  1V80 A;  1Q10 A;  4L2Y A;  4BKG A;  2DLB A;  4A55 A;  1AN8 A;  1DOI A;  4F1S A;  2FCM A;  1P7E A;  2N7E A;  2LGX A;  3JSV B;  3CWI A;  3ABV B;  3KUC B;  2LWP A;  1TY0 A;  1QOA A;  2LVP A;  2IO1 B;  4KZ0 A;  3NS1 A;  2X38 A;  2YEP B;  3A4S C;  1WRI A;  3VUX A;  1MG4 A;  1T0S C;  3OWE B;  1ISN A;  1SIF A;  2BKF A;  3ZRF A;  2WDV B;  5FR3 A;  2I1K A;  3BYY B;  1YD8 U;  2MBB B;  1UF0 A;  3EA6 A;  5D7G A;  2RSU A;  4EEW A;  1TBE A;  3AUL A;  1V97 A;  3VUW A;  3IT4 B;  2KAJ A;  3A1Q B;  3VHT C;  2LZ6 A;  3PVL A;  3ZJT A;  3SFD B;  4YXD B;  2KXJ A;  4N58 A;  1MI0 A;  2L0F A;  2ZCC A;  4K1R B;  2HD5 B;  4NJC A;  3X0W A;  1R4N B;  2WYQ A;  3DWG C;  1D5X C;  3Q3N C;  1WX8 A;  2INC C;  1VZ7 A;  1H7X A;  3RNC C;  3QK0 A;  1RYJ A;  3PPA A;  1NDD A;  1WY8 A;  2LJI A;  3FAH A;  5C2T B;  3V62 A;  3L10 B;  2PE6 B;  1L4D B;  5LXH A;  1C3T A;  2K8B A;  1L2N A;  2MBQ A;  3EFU A;  1ZKH A;  1EWC A;  2LGY A;  2K39 A;  1GG3 A;  1OGW A;  1WIA A;  2H88 B;  1WXA A;  4IKG A;  1I4Q A;  1VRA B;  4RH6 A;  1E90 A;  3H9D A;  4A20 A;  1FPY A;  1R4M I;  4P7I A;  1JCK B;  1J7C A;  3NVV A;  3UIP B;  3ZVV A;  4K81 A;  5BYR A;  2VH2 A;  3ZDM C;  1NEN B;  5AZH A;  3TEZ A;  3PZD A;  3BII D;  2EKE C;  2B76 B;  2FUG 1;  4HCN B;  2LRU A;  2N9L A;  3WAM A;  2YVC A;  1UZX B;  2JT4 B;  3AXC A;  4DK5 A;  2L83 A;  4RFB A;  2BKR B;  3O13 A;  2K3U A;  1NBF C;  2KJH B;  4MT5 A;  2MBO A;  3PLU A;  3PZ7 A;  4MGZ E;  4HDO A;  3M3J A;  1OQR A;  3CF6 E;  1E10 A;  2KNB A;  4B95 A;  2WXI A;  3P42 A;  1L4Z B;  2WXG A;  2BYT A;  4UDU C;  1TYG B;  2HTM E;  4XGA B;  3IVF A;  3IAS 1;  2RDB C;  4BKT A;  4L23 A;  5GMV A;  1TKG A;  2NR2 A;  2QCZ A;  4MSM B;  5FK9 C;  1C79 A;  2O6V B;  1J7B A;  1IUE A;  1WJU A;  2KQ4 X;  2QMT A;  4CQN A;  1P9D U;  2AL6 A;  2BPS A;  3LXF A;  1S1Q B;  1L5P A;  1QKZ A;  3PSE B;  4HWI B;  1GJZ A;  4JL9 A;  3RZF A;  1GUA B;  3KWV A;  1OEY A;  3WAN A;  1JWA D;  3N3K B;  2OJR A;  5GXG B;  4CHK A;  4JIO U;  4NY0 A;  4MEL A;  3X23 A;  1M4V A;  3W2D A;  1UGM A;  3CSF A;  4F8C B;  1V2Y A;  2C9W B;  3RZW C;  2WS3 B;  4ZRI A;  2L32 A;  2W9N A;  1JAL A;  4NNJ B;  2RD0 A;  1TZO A;  4KSL C;  3QC8 B;  1SE3 A;  2WX1 A;  3PTF C;  4PS3 A;  4HKZ E;  4DWF A;  2CHW A;  4KKJ A;  1H8C A;  3Q2A C;  4HK2 A;  3PO0 A;  1T0Y A;  2DWQ A;  2J0J A;  4RGT A;  2FCQ A;  2G3Q B;  2KHW B;  5EE9 A;  3SFE B;  3U7D A;  2KFJ A;  3DVN V;  3Q8E A;  3R3M A;  1SXT A;  3APF A;  4X57 B;  2JPH A;  4NAW A;  3IBE A;  1ZXH A;  2PVO D;  1I7H A;  1H7W A;  3WCQ A;  2XN9 C;  3HVD A;  5HI1 A;  1YJJ A;  2BYE A;  2K0P A;  4IM0 A;  1I4H A;  2Y5B B;  1WM2 A;  4J3O D;  1WR6 E;  1R7S A;  2JRH A;  1A5R A;  1TIF A;  2IY0 B;  4FXC A;  5LXI B;  1YIW A;  1XCT L;  3RT3 B;  4GXB A;  1DOY A;  2FNJ B;  1E9M A;  1WF9 A;  2G4S A;  1IPG A;  1QT9 A;  5G5H A;  4YSZ B;  4G11 A;  1T0Q C;  3PRZ A;  1WGK A;  1YMH E;  5IOI A;  2FID A;  2AEH A;  2IGD A;  1T6B X;  2NBU A;  4OZA A;  2DZI A;  3ZJV A;  2KK8 A;  1XQQ A;  1PQS A;  3U30 A;  2MP2 B;  2KX0 A;  1UD7 A;  4EZK A;  4IW0 A;  2Z8L A;  4TQ1 A;  2RGF A;  4FLH A;  4FJY A;  5E6P A;  1N5X A;  2D3A A;  3N20 C;  1MPE A;  2OED A;  5L83 A;  2LVQ A;  1NEK B;  1B1Z A;  3BYT B;  4W9E A;  3L16 A;  2CHX A;  4KGS A;  4II3 B;  2HTH A;  2UWQ A;  1VJK A;  2IO3 B;  3QHT A;  1PGA A;  1JQ4 A;  3LB8 C;  4O1N A;  1VCB A;  4WAA A;  4YT0 B;  3OJ4 B;  3QAR A;  4KGT A;  2MA9 B;  2GI9 A;  2W55 A;  2YLM A;  4P1C C;  3RPF C;  1WJN A;  2CHZ A;  2WP9 B;  5HKH A;  3TIX A;  1Y8R C;  2AL3 A;  2GRI A;  4S17 A;  2WXP A;  2M17 A;  1WXM A;  1LO5 D;  4W9G A;  4MM3 A;  4DDG D;  1F2R I;  5CHW A;  5DCN A;  3L54 A;  3E56 A;  3TUO A;  4ZRJ A;  3A9J B;  4BFR A;  5LNK 1;  3AE9 B;  4LNF A;  3S2A A;  3MHZ A;  4NAM A;  4WJP A;  3ONS A;  3OLM D;  4LLG M;  2ZW1 A;  1FO4 A;  2LXC A;  1DOX A;  1QZE A;  1JWS D;  3R2T A;  4CYE A;  1WE6 A;  2O2V A;  2ZEQ A;  5HHD G;  3UF8 A;  1Y56 A;  2K25 A;  4F7Z A;  1K52 A;  4OZC A;  1WX9 A;  1KFY B;  2N9P C;  4RM9 A;  3Q3J A;  2JXT A;  2RMM A;  1IGC A;  4LNK A;  3P4R B;  4A6Q A;  2MHJ A;  2N7D A;  1PFD A;  1HEZ E;  4OZB A;  3QA8 A;  1EU4 A;  3B08 A;  5AUK A;  1N63 A;  1GB4 A;  1V1O A;  2W3S A;  1E5W A;  1V6E A;  1L0V B;  3EUB 2;  1C1Y B;  3NJT A;  3UIO B;  5J2R A;  1SE9 A;  2GBK A;  5C1Z A;  1FXT B;  2XEW A;  1ZGU B;  1E6E B;  3B9J A;  2J53 A;  2W3R A;  4WJO A;  4URK A;  3AU4 A;  4DHJ D;  1WXQ A;  1Q1O A;  2WDT B;  3A9K B;  2MX2 A;  2KFK B;  2OHF A;  2WHI A;  3C8Y A;  2AQ1 B;  2D3G A;  2D11 A;  4M00 A;  1QLB B;  4IOI E;  1GTH A;  4B9K A;  4MAC A;  1VD2 A;  2D10 A;  4XWW A;  1IBX B;  3VTW A;  1ENF A;  1HTO A;  2XK5 B;  1QOG A;  3NVZ A;  4MGI E;  3RNB C;  1FRD A;  4LNI A;  2WU2 B;  4WIP A;  2DBY A;  2NBV B;  2LUE A;  3BIN A;  3H1U A;  3U4E G;  2L52 A;  2XBB C;  1BUI C;  1C77 A;  3HM6 X;  2C5L C;  4P16 A;  1PDX A;  4N9F 4;  1UGJ A;  4ARC A;  1GC7 A;  4N6E B;  2IYD B;  3VR8 B;  3NRZ A;  3TEW A;  1KF6 B;  1ACC A;  1P98 A;  4GDK A;  1KOT A; 
#chains in the Genus database with same CATH homology
 3HUI A;  4YWG G;  1NEN B;  3TEZ A;  2WU5 B;  1JWM D;  3BII D;  1SIJ A;  2WXJ A;  2AQ3 B;  2B76 B;  1FRR A;  5C3J B;  2FUG 1;  2RDH A;  3L4P A;  4YTN B;  2N9L A;  4HJG E;  3V05 A;  2INP E;  3I57 A;  1PUT A;  3AE2 B;  2CJN A;  1SE2 A;  2L1A A;  2ICI A;  2MJE A;  2L83 A;  2SAK A;  4AQ7 A;  2EKI A;  2W54 A;  4RFB A;  4JX1 C;  3O13 A;  4C56 C;  1QOF A;  2K3U A;  1HZ5 A;  1WWT A;  1CQV A;  2WXK A;  2QIL A;  4MT5 A;  1CK1 A;  3PZ7 A;  1MVK A;  2NMQ A;  3CF4 A;  1OQR A;  2N0S B;  1C4A A;  2WXL A;  1FD6 A;  1FEH A;  1E10 A;  3BK2 A;  1EM7 A;  2WXI A;  1YNT E;  3TEY A;  3P42 A;  1L4Z B;  3BK1 A;  1OQQ A;  1C4P A;  1YN5 A;  2WXG A;  2BYT A;  1DYQ A;  2KDM A;  2Y3A A;  4UDU C;  3Q69 A;  2Y5P A;  2M0A A;  3W5U B;  1TYG B;  1FNV A;  3AED B;  4WUR A;  2HTM E;  2VZK D;  1TS4 A;  2PIA A;  1JRP A;  1UWX A;  3IAS 1;  2RDG A;  2KN4 A;  4L23 A;  3AE1 B;  1TKG A;  3VRA B;  2E3T A;  1SJH D;  1K51 A;  5JXV A;  1GB1 A;  3P4S B;  2WLB A;  4GDK B;  2WDR B;  5FK9 C;  1C79 A;  3SR6 A;  1RFK A;  1J7B A;  2K9X A;  4YSY B;  2LEK A;  4WAF A;  3J9C A;  2JZP A;  1IUE A;  1HQR D;  2KQ4 X;  1T5X D;  2IPK D;  2QMT A;  2V0G A;  4CQN A;  2ACZ B;  2G9H D;  5H92 C;  3T3O A;  1IBX A;  1RWS A;  2FBW B;  1GPX A;  1I4X A;  5D3I B;  4RGO S;  3LXF A;  2WXH A;  1XLO A;  1GT8 A;  1L5P A;  1QKZ A;  4TMA B;  5HFY A;  1YN3 A;  1NVI D;  4A8X C;  1ET9 A;  3KWV A;  4GLS C;  1JWA D;  1EWY C;  1ZDX A;  4WWM A;  5D3D A;  5GXG B;  2VZK B;  1FIQ A;  3Q8F A;  2J4X A;  1SE4 A;  4NAW B;  1M4V A;  3I9V 1;  3E9S A;  1XLQ A;  1XEE A;  1JW9 D;  3P1M A;  3W2D A;  3AEB B;  1TKY A;  2XNA C;  4HRO A;  1QQR A;  4B0M A;  1CZP A;  1L0Y B;  4ARI A;  2CJO A;  2LHD A;  3FIL A;  2Y5C A;  2ONQ A;  1ZE3 D;  3UI3 A;  4B0E A;  2IJ0 A;  2WS3 B;  1D5Z C;  2M19 A;  2L32 A;  2INN E;  1K53 A;  1PGX A;  1V8C A;  2WQY B;  3W5V B;  1JAL A;  1JWB D;  2JYT A;  3N9Y C;  1TZO A;  3AE5 B;  1I4P A;  5EE0 A;  1SE3 A;  5I4D A;  1RM6 C;  1F0Z A;  4HKZ E;  2DYM A;  1L0X B;  4KKJ A;  1STE A;  1KH0 A;  4ZOH C;  5EE3 A;  1P7F A;  1YN4 A;  3PO0 A;  5TSS A;  4ZHO A;  4OW0 A;  2DWQ A;  4AS1 A;  1ZPS A;  1AWD A;  4RGT A;  1N5W A;  1E0Z A;  2K22 A;  5EE9 A;  5T8I A;  2PKO A;  1JWU D;  2AQ2 B;  3SFE B;  2KWD A;  2BBC A;  4N59 A;  3AV8 A;  4OHJ A;  3Q8E A;  1J7A A;  2QJL A;  2WDQ B;  5H8Y E;  1SXT A;  3R8B A;  1ZXH A;  2PVO D;  1YQ3 B;  1I7H A;  2KAC A;  1H7W A;  3WCQ A;  4M0W A;  3AEA B;  2XN9 C;  3HVD A;  2Q5W D;  2BB6 A;  4RCO A;  5HI1 A;  1KTK A;  1YJJ A;  3AE7 B;  2K0P A;  1ESF A;  2RPV A;  1I4H A;  2N7J A;  1XXG A;  4XDD A;  1C4C A;  1XF5 L;  4J3O D;  1R7S A;  1FCC C;  1YQ4 B;  2HDE A;  1PGB A;  3MJ5 A;  4FXC A;  2KMM A;  3AH7 A;  1XCQ L;  2V4I B;  3P4P B;  1XCT L;  3AE4 B;  1DOY A;  4US9 A;  2WXQ A;  1E9M A;  2WXO A;  4Q2J A;  5EE1 A;  1QT9 A;  5G5H A;  1WYG A;  4ITK A;  4YSZ B;  4MM3 B;  3RFZ B;  1JML A;  2MH7 A;  1WGK A;  2IGH A;  1YMH E;  4WQM A;  2FE8 A;  1FXI A;  3AN1 A;  1L6U A;  3ZJU A;  3DWM A;  2PW9 A;  1N60 A;  2IGD A;  1T6B X;  1QF6 A;  1VR9 A;  2LGI A;  1KRH A;  4IDI A;  3MFG A;  2AX5 A;  4OZA A;  4JE3 B;  2H89 B;  1QIL A;  3W1S A;  3ZJV A;  2D5G A;  1ZP0 B;  5MPO A;  1IGD A;  2CU3 A;  2JU6 X;  1I4R A;  1ZUD 2;  2V3P A;  2Z8L A;  3B2G A;  3R2I A;  4TQ1 A;  1C9F A;  1N61 A;  3AM9 A;  1N5X A;  3W9C B;  3ZQ4 A;  1D4B A;  4NZL B;  1EU3 A;  1MPE A;  1SF0 A;  2QSD A;  4USA A;  2OED A;  1JRO A;  1V1P A;  3FC4 A;  4ZHP A;  1NEK B;  1B1Z A;  3BYT B;  3T3N A;  1K50 A;  1SSN A;  4C7Z A;  3AE3 B;  4KGS A;  2J52 A;  4XDC A;  2YEP F;  4LTU A;  3KLS X;  3HVZ A;  3AE8 B;  2BT6 A;  4YTM B;  1VJK A;  1GOZ A;  1ZDV A;  3V3X A;  2M56 B;  4YTP B;  1PGA A;  1F77 A;  2E6X A;  2SEB D;  2JYE A;  1JQ4 A;  1UWM A;  3LB8 C;  2TSS A;  4O1N A;  5BYQ A;  5G5G A;  3AEC B;  2K5P A;  1F2R C;  4A90 A;  4YT0 B;  1MHX A;  4ZRQ A;  1TS2 A;  4GDL B;  3ZGZ A;  3ZYY X;  4KGT A;  5FKA C;  2J42 A;  1NYQ A;  4RNA A;  2JQR B;  1UNS A;  1SEB D;  2GI9 A;  2NTS A;  2PVG C;  2W55 A;  1TS5 A;  3IT6 B;  3AE6 B;  3RPF C;  3U7Z A;  2WXN A;  1VZ6 A;  4TSS A;  2PLP A;  3VR9 B;  2LFI A;  2NTT A;  1VLB A;  4C80 A;  2WP9 B;  1FNU A;  5E6J A;  3MP9 A;  2I2Y A;  4H2A A;  5BMG A;  2GRI A;  5BYS A;  3ETR A;  1HXY D;  4KX6 B;  1ET6 A;  1HA5 A;  3LYY A;  2W82 A;  3U52 E;  4XE0 A;  2WXP A;  4EE2 A;  2MJ3 A;  4L1B A;  4OVZ A;  1LO5 D;  3KWL A;  1NI3 A;  2BS4 B;  2WXR A;  1F2R I;  1FFV A;  1OFF A;  4KKI A;  1FFU A;  1QOB A;  2BW2 A;  4HEA 1;  2GB1 A;  1XLN A;  3E56 A;  3TUO A;  3SEB A;  1T3Q A;  2N9K A;  1AW7 A;  2EEL A;  5BMH A;  3BVZ A;  2IDY A;  5LNK 1;  3AE9 B;  3B2F A;  3CIR B;  1BML C;  2BS3 B;  3MHZ A;  4NAM A;  4PT5 A;  3HRD D;  4C7Y A;  1FMA D;  1TY2 A;  1KLG D;  3VQI A;  1UUP A;  2LUM A;  1ROE A;  4LLG M;  3PZ8 A;  3AEF B;  1SB3 C;  1C78 A;  2ZW1 A;  3NVY A;  4RGN A;  2PMV A;  1TJE A;  1A70 A;  1KLU D;  3NUH B;  1FO4 A;  1B9R A;  1DOX A;  1D5M C;  1ZXI A;  1HZ6 A;  3Q8C A;  1JWS D;  1VDV A;  2R61 A;  3R2T A;  1YJI A;  4JWU C;  2JSV X;  3BWU D;  4P6V F;  1CJE A;  3MC0 B;  4DXG A;  5HHD G;  2G1E A;  3AEE B;  1SBB B;  1Y56 A;  3Q8A A;  4RF0 A;  5HG2 A;  1K52 A;  4OZC A;  1Q10 A;  1KFY B;  4JWS C;  4L2Y A;  3AB5 A;  2DLB A;  2JXT A;  4A55 A;  2RMM A;  1IGC A;  1GAQ B;  1AN8 A;  3P4R B;  1DOI A;  4A6Q A;  4RF1 A;  1I4G A;  1PFD A;  1XLP A;  1HEZ E;  1P7E A;  1TS3 A;  4OZB A;  1EU4 A;  2QEJ C;  3Q8B A;  5AUK A;  1N63 A;  3CWI A;  3ABV B;  1GB4 A;  1V1O A;  2BS2 B;  2W3S A;  1TY0 A;  1QOA A;  1L0V B;  3EUB 2;  1L6V A;  3BZD B;  3NS1 A;  1DGJ A;  3GS2 A;  2BTE A;  2MJD A;  3FIL B;  2X38 A;  2YEP B;  1FM0 D;  1WRI A;  4ZRP A;  3OWE B;  1FXA A;  4HKQ A;  3GB1 A;  2WDV B;  4DXF A;  5FR3 A;  1PYW D;  1VZ8 A;  5AUI A;  1E6E B;  3B9J A;  3BYY B;  2J53 A;  2W3R A;  2I38 A;  1N62 A;  3EA6 A;  5D7G A;  1WXQ A;  1V97 A;  3NZ3 A;  2V3N A;  3IT4 B;  2KAJ A;  3H8H A;  2OHF A;  2QIE B;  1FNW A;  3C8Y A;  2BB5 A;  3IXS A;  2IGG A;  4D2K A;  1ZOY B;  2AQ1 B;  4WH4 A;  3ZJT A;  3SFD B;  1QLB B;  3IAM 1;  4YXD B;  4IOI E;  1GTH A;  4RGM A;  4N58 A;  4TQ0 A;  4US8 A;  4MAC A;  1WSP A;  1FCL A;  1MI0 A;  4REZ A;  4XWW A;  2WXF A;  1NYR A;  1E7P B;  1IBX B;  1GTE A;  3AEG B;  1ENF A;  1BXT A;  5BMI A;  1QOG A;  2JWU A;  4NJC A;  3VRB B;  3NVZ A;  3DWG C;  2ON8 A;  1FRD A;  4ZYS A;  1D5X C;  2WU2 B;  3AMZ A;  1VZ7 A;  1H7X A;  2ZW0 A;  3BVG A;  2MEK A;  4MH8 A;  4DQO C;  4A9A A;  4WIP A;  2DBY A;  3P63 A;  1RYJ A;  2WNM A;  1V1P B;  3GP7 A;  4XWT A;  1MHH E;  4HRS A;  4LK0 M;  2LJI A;  3FAH A;  3U4E G;  2L52 A;  5C2T B;  4JPS A;  3TSS A;  1L4D B;  3TEX A;  1AYF A;  1BUI C;  1C77 A;  4YSX B;  3EGR A;  4R3D A;  3NVW A;  1EWC A;  2JX5 A;  4P16 A;  1PDX A;  4ARC A;  1UGJ A;  4N6E B;  3U2S C;  2H88 B;  3VR8 B;  1SJE D;  1C76 A;  2LMC A;  3BVM A;  3NRZ A;  4IKG A;  1I4Q A;  3TEW A;  2WXM A;  3URY A;  1KF6 B;  1ACC A;  1TKE A;  2DYO A;  2LHE A;  4KGR A;  1VRA B;  4RH6 A;  1XO3 A;  2PTL A;  3KQ4 A;  1D6E C;  1JCK B;  1J7C A;  3NVV A;  5BYR A;  3P4Q B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...