4KX6B

Plasticity of the quinone-binding site of the complex ii homolog quinol:fumarate reductase
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
243
structure length
243
Chain Sequence
AEMKNLKIEVVRYNPEVDTAPHSAFYEVPYDATTSLLDALGYIKDNLAPDLSYRWSCRMAICGSCGMMVNNVPKLACKTFLRDYTDGMKVEALANFPIERDLVVDMTHFIESLEAIKPYIIGNSRTADQGTNIQTPAQMAKYHQFSGCINCGLCYAACPQFGLNPEFIGPAAITLAHRYNEDSRDHGKKERMAQLNSQNGVWSCTFVGYCSEVCPKHVDPAAAIQQGKVESSKDFLIATLKPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fumarate reductase flavoprotein subunit
publication title Plasticity of the Quinone-binding Site of the Complex II Homolog Quinol:Fumarate Reductase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 66
structure length 243
sequence length 243
chains with identical sequence N
ec nomenclature
pdb deposition date 2013-05-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 4kx6B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4kx6B01
4YTNB 1UWMA 1L6UA 2WQYB 3AE6B 4ZOHC 1AYFA 2WP9B 3AE9B 2JQRB 4YTPB 1JRPA 1WRIA 3W5UB 4KX6B 2EKIA 3SR6A 1XLPA 4ZHPA 2PKOA 3RPFC 1WXQA 2BT6A 4ZHOA 3SFDB 1JROA 2PIAA 2Y5CA 1QT9A 3DWMA 3FC4A 4ITKA 1IUEA 3B9JA 5H92C 1GPXA 1J7BA 4LTUA 3ZYYX 4P6VF 3AV8A 4JWSC 2WLBA 3AEDB 1N63A 4N59A 1WGKA 3HUIA 2H89B 4N6EB 1NYQA 2E3TA 3HVZA 1H7WA 1RWSA 1XO3A 4N58A 3P1MA 2W55A 3PO0A 1OQQA 2DWQA 4US8A 1DOXA 4C80A 3NRZA 1GTEA 3P4QB 1FFUA 1FFVA 2WU2B 5C3JB 2G1EA 3AMZA 1DOYA 1ZOYB 1VJKA 2L83A 1FIQA 1E0ZA 1JALA 2PVOD 3AEAB 2CJNA 1FXAA 2KAJA 4A9AA 4YSYB 5C2TB 5EE0A 1E9MA 1ZP0B 3L4PA 2DBYA 1XLQA 1GT8A 3NVZA 1L6VA 5AUKA 1H7XA 5GXGB 1WWTA 3HRDD 1E7PB 3NVYA 1J7CA 3ETRA 3AE3B 3CF4A 4FXCA 5EE9A 2KMMA 4HROA 4WQMA 1KRHA 1ZUD2 1J7AA 3VRAB 1N5WA 2M56B 3ABVB 2CU3A 3CWIA 3AECB 4YXDB 1DOIA 1ROEA 2CJOA 3CIRB 1FRDA 2K5PA 3AEFB 3B2GA 3LXFA 2B76B 1OFFA 2PVGC 1RYJA 3P4SB 1JQ4A 1E6EB 1NEKB 1TKYA 1TYGB 2W54A 1B9RA 4WWMA 1XLNA 3DWGC 5G5GA 3P4RB 3AE1B 1I7HA 1PDXA 4IDIA 2WU5B 1RFKA 1YQ3B 1V97A 2HTME 2Q5WD 5EE1A 1N60A 1CJEA 3P63A 1CZPA 1F0ZA 1VLBA 2W3RA 1WYGA 2W3SA 1GTHA 2OHFA 1L0VB 2BS3B 1N5XA 1SIJA 3VR9B 4YTMB 3BIID 1QOFA 3WCQA 1L5PA 1EWYC 1V8CA 2MJ3A 3NS1A 1QF6A 2MH7A 2AX5A 3AN1A 3AE8B 2N0SB 1DGJA 1R7SA 2MJDA 2K22A 3AH7A 4C7ZA 2WDVB 1N62A 2H88B 1N61A 4HRSA 1QOAA 1VDVA 5G5HA 4C7YA 3NVWA 3FAHA 3AE7B 2K9XA 3EUB2 1NENB 3VR8B 3AE2B 1YQ4B 3AEBB 4USAA 5AUIA 3NVVA 1FXIA 1E10A 1SB3C 2WDQB 1PUTA 3AM9A 1ZXIA 1YJJA 3AEEB 2FBWB 2BS4B 2L52A 2QIEB 2MJEA 2BS2B 1FM0D 1XLOA 3LB8C 3W9CB 1RM6C 3KWLA 4YSZB 1YJIA 1A70A 1OQRA 1JWBD 1KFYB 4US9A 1T3QA 1TKGA 1NI3A 3W5VB 4YT0B 2QJLA 1PFDA 1SF0A 2WS3B 3P4PB 1NVID 1TKEA 2JX5A 3SFEB 1NYRA 1TJEA 3AB5A 4YSXB 2LEKA 1QLBB 1FMAD 5H8YE 1AWDA 2ACZB 1JWAD 2WDRB 1FRRA 3AEGB 1FO4A 3B2FA 3AE4B 1QOGA 2M19A 1GAQB 1KF6B 1JW9D 1QOBA 4JX1C 5MPOA 4JWUC 3VRBB 5EE3A 3AE5B
chains in the Genus database with same CATH superfamily
1UWMA 5IAAC 2I1KA 3J9CA 3H7SA 1WFYA 1GC7A 3AU5A 2J7QB 5GMVA 3GE3C 5H92C 2WXOA 2LGYA 2O2VA 4TV3A 2BB6A 2KN4A 1HZ5A 4FHJA 4LNIA 1R4MB 3H9DA 4OVZA 3TIXA 2XN9C 2W55A 1OQQA 4G11A 3P4QB 3E56A 2LWPA 4K1RB 3JYUA 3EECA 4TKNA 4MDKE 4YSYB 5C2TB 1EM7A 3NVZA 2ZPNA 5FR6A 4HWIB 2KWCA 1WWTA 1ENFA 4XGAB 2QILA 5L95C 4WJQA 4W9GA 2EELA 2QEJC 3P4SB 1JQ4A 1B9RA 1HTOA 4AWJA 3DWGC 4TQ1A 3P4RB 1WX7A 3CMMB 2X38A 2ZVNA 3V6EB 2MX2A 4WJOA 3C19A 4Q2JA 4K3CA 4IKGA 2KLGA 3RULA 4GOCA 2LGXA 2YEPF 3HIZA 1GB1A 4WWNA 2IJ0A 4W9LA 3I5JC 2K6DB 1T0QC 1QOAA 1SXTA 3Q8FA 4C4VB 1EO6A 1I4XA 3IT6B 2KJRA 3TSSA 2GRIA 3I63C 4RM8A 3KUCB 1GNUA 2C9WB 2KK8A 3Q2AC 4US9A 4MH8A 1ET6A 4WAAA 4AQ7A 2IO0B 3NZ3A 5J18A 1FMAD 3IG3A 4UDUC 1RAXA 5D7GA 3NZSA 4EZKA 1KF6B 4NAWA 4BFRA 3KYCD 2IZVB 1JRPA 1WI0A 4KKIA 3SR6A 4OHJA 1L4ZB 2UU7A 4XZ4A 4LK0M 4GDLB 1S1QB 1VD2A 3PSEB 1TS4A 4MSMB 3BYTB 1GG3A 4PT5A 2M4NA 3ZDMC 2INPE 2G1EA 5C3JB 2KVZA 1E0ZA 2K39A 4DXFA 4BBNC 3DPDA 5FR3A 2MSED 1FXAA 2Y5PA 1WJ4A 3B1LX 3Q3JA 3ZXRA 5IOIA 1SE4A 5AUKA 2D2QA 3KQ4A 1WX9A 2N9EB 2IY1B 1ZUD2 1WRDB 3CWIA 5I4DA 1WYWB 2CJOA 4PS7A 1WXAA 2IYDB 2PVGC 1H8CA 5JXVA 3NZUA 3N1ZC 2K6QA 5LNK1 1I4PA 5AZFA 4K7UA 1Q10A 2LFIA 3SD5A 4YTMB 1TBEA 2KWUB 3A4SC 2K3UA 3T8MA 2WXKA 2N0SB 1WGGA 3VXWA 1QILA 2ZVOA 1K8RB 1T5XD 2AQ3B 4F8CB 2N9LA 2KJ6A 1J19A 2O6VA 3TUOA 4JLCA 4HCNB 1PGBA 4ZDVA 3O13A 4NQKE 2BQQA 3UGBB 2QJLA 1TKEA 4A55A 1KJTA 2VZKB 5HKHA 4DWFA 4TMAB 4KSKC 3ZVVA 1ISNA 2PW9A 3VHTC 3ZQ4A 4HLEA 4G3XB 3DBHI 4JX1C 2V9HA 2KDBA 3U52E 1LXDA 4PS8A 3H7PA 3L16A 1R4NI 4ZHPA 3JSVB 4XDDA 3Q3MC 1VRAB 2M0AA 4ZHOA 2WGSA 2KZRA 3PHXB 5D3IB 5IO9A 3V6CB 4MGIE 3OAWA 1J7BA 4HCPB 1N63A 2ON8A 4OW0A 3GB1A 1EUVB 4US8A 3N9YC 4GN1A 1FIQA 2D5GA 4PK1A 2PPHA 2WX1A 2MQJA 4ZRKA 3PS6A 1V49A 1GJZA 3R2IA 5GXGB 1NBFC 1E7PB 1STEA 2UYZB 4PS3A 2R2OA 2K5PA 3Q14C 2LASA 2KDIA 4I6LB 1V86A 2RMMA 2C60A 4DDID 5T8IA 1PDXA 2G45B 2NS5A 2LI5A 4RGTA 3DVNU 1CZPA 2V3SA 3H1UA 2W3RA 1QOFA 2KC1A 4MSQB 3PTFC 1Q0WB 3BWUD 4C00A 2J4XA 2WXHA 4LLGM 1WGYA 2J0MA 3SHQA 2EMTA 1FXIA 4DHJB 3LB8C 1L7YA 5J2RA 4IUMB 1JRUA 4MM3A 3PRZA 1TKGA 2FCQA 1UH6A 4REZA 3T3OA 1TJEA 4YSXB 3DDCB 3I9V1 3PPAA 3DBHB 3Q3OC 5BMHA 1JWAD 1WM3A 1EU4A 1WZ3A 1YMHE 4YWGG 4URKA 2JRHA 1R4NB 3B08A 2ONQA 3WANA 4JGHB 4LJPB 2EKIA 3OWEB 1LO5D 3GP7A 1XLPA 1XQQA 2BYTA 3Q6BA 2KWVB 3S2AA 3APFA 4FJZA 4ZRJA 1RWSA 4C80A 1FFVA 1DOYA 2VRRB 2N9PC 3AEAB 3MP9A 4RH6A 5KHQA 2GBNA 3BVZA 4HKZE 4HROA 4NAWB 1UWXA 3ABVB 2CU3A 2RDHA 4KKJA 1FRDA 1RYJA 1E6EB 4G50A 2N1VA 1SEBD 4LJOB 3PLVA 2W3SA 4ZRQA 2V4LA 3KH0A 3VR9B 1WZ0A 3A9KA 1V80A 1T0YA 4D2KA 3AN1A 1MJDA 5BYRA 2MA9B 1KLVA 4E74A 2KX0A 3HVDA 1WIAA 4GGQA 3UI3A 3UINB 5D3DA 3RNGC 1F52A 1WF9A 4LNKA 3QJZA 3AM9A 1PUTA 3CF6E 1ZXIA 4HXDA 2AL3A 2KXJA 3BK1A 4YSZB 1YJIA 4P16A 2WX0A 1KFYB 3W5VB 2C5LC 2C7MB 4LDTB 3BZDB 1WR1A 4DDGD 2PLPA 3AEGB 2G9HD 3KYDD 2EMSA 2L1AA 1V1PB 2KLCA 1V2YA 1AYFA 4KX6B 1HZ6A 2QSDA 2NBUA 2AQ2B 1ZE3D 1WXQA 3RNFC 3FC4A 4II2B 5CX3A 3B9JA 3N32A 3AEDB 2L05A 1WGKA 2QHOA 3VUWA 3I57A 2LJIA 2WNMA 2HE7A 4W9JA 3Q3FA 2XNAC 4DQOC 2IGGA 4M01A 2KAJA 1VZ6A 5FK9C 4ANUA 3VDZA 1L6VA 3UQBA 1F77A 3VQIA 4ICUA 4DHZB 3RYTA 1BXTA 1P9DU 2NVUI 1XCQL 1YQBA 2LGDA 3LXFA 3ZJVA 4B95A 1I42A 2V0GA 1TY0A 4WWMA 2KT7A 4CQNA 1F0ZA 1YNTE 2CHXA 2V3NA 2GBJA 4BAXA 3TEYA 2MJ3A 2FIDA 2L76A 1R7SA 2I2YA 1XCTL 3W1SC 2WXIA 2KKCA 2HD5B 3DQVA 4HEA1 2WDQB 3K9PB 2QDFA 1FM0D 2Z0EB 2NTSA 3C8YA 2LRWA 1ZPSA 3JSVA 1QLBB 5H8YE 2ACZB 3ZKJC 2JRIB 4W9CA 3ZTCA 3RZFA 4GMVA 4WURA 2FIFA 4AJWA 3BVMA 1A5RA 4L1BA 4ACFA 4B0EA 2ZW0A 3ZO5B 1WRIA 2IBIB 1SGHA 3DCGA 2BYEA 1YX6B 1OEYA 1JMLA 1WXSA 4GB9A 4XWWA 2ZNVB 2JY6A 1L0XB 1OQYA 3HVZA 1XO3A 2M8SA 4LDTD 2WU2B 2X8XX 2L83A 3N3KB 4MM3B 2DAFA 2G4SA 2BWFA 1ZP0B 2DNFA 1I4HA 4MGZE 3CSTA 1XEEA 3VH3B 1D6EC 3Q8AA 1P1AA 3MTNB 3HHMA 1WH3A 1E8XA 2JSVX 1CQVA 3ZJTA 2AQ1B 4IWOA 5G5GA 4K81A 2D3GA 2O6VD 2FAZA 3PRMB 3V3XA 1KLUD 1RRBA 2WXLA 2DLBA 4W9IA 3IBEA 3D32A 2ZNVC 1JCKB 4HPLB 2H88B 4ZRPA 3AU4A 1M94A 3FAHA 1WGHA 2RDBC 3EUB2 4NJCA 2SEBD 1ZGUB 4XYCA 3X23A 4XC2A 1SB3C 3RMKC 1YJJA 1Y56A 3VTWA 1A70A 2ZCCA 3VAWA 1NI3A 4YT0B 3SFEB 3BY4B 5KHOA 1GC6A 1V5TA 2KQSA 1JWUD 3AE4B 1XT9B 2SAKA 1P7EA 3NY5A 3VRBB 4ZYNA 3HUIA 2KJHB 3A9KB 3A4RA 1WJUA 2WWZA 3SEBA 1LQBA 2RD0A 4B9KA 4HPPA 1K52A 1QT9A 4RF1A 3VUXA 1IGDA 1GPXA 2V3PA 2FE8A 2K8BA 3QK0A 2H89B 2C7HA 3L08A 3PO0A 3PZ8A 1IP9A 2DWQA 1FFUA 1FPYA 1X1MA 3KWVA 1PQSA 2M17A 1HQRD 2PTLA 1BT0A 3URYA 2QCZA 3IT4B 3KLSX 3ZRFA 3O65B 1U4AA 1WE6A 2RPVA 2C7NB 1ZDVA 2FUG1 2Q5WD 1C79A 3M62B 2JZ3B 1V1OA 4NAMA 4AJYB 2LJ5A 4BVUC 3BIID 5C1ZA 2Y5BB 4QAYA 3RZWC 4ANVA 1G6JA 2REXA 3JVZX 3RNBC 2J42A 3DVGX 4IC7B 3PGEA 2MRPA 1P0RA 4C7YA 1OGWA 4DBGA 5HI1A 3M95A 4LNOA 4KGSA 3TEXA 3AE2B 4BOZB 2E6XA 2BS4B 2QIEB 2V1YA 2NBWB 3W9CB 1V1PA 3RFZB 3ZJUA 5G2NA 1ESFA 2I38A 1OQRA 4BKGA 3ZNHB 1SF0A 3R7RA 1C1YB 1NVID 3AB5A 2FUHB 2PE6B 4YL8A 3EFUA 2BF8B 3UF8A 3DVGY 5E6OA 5IA7A 1WSPA 2PKOA 4FULA 3SFDB 1JROA 2I1JA 2N9KA 4J6IA 4OZBA 3QARA 2HJ8A 2LUEA 2HDEA 2JF5A 3PVLA 5IN7A 4EE2A 3VUYA 1VJKA 3MHSD 2KTRA 4WWOA 5AZHA 4FJYA 1UBIA 3ML8A 3HRDD 1HTQA 3CF4A 2KMMA 2AWTA 3PV1A 3QIJA 3CIRB 2KQ7A 4IG7B 3ML9A 3PZ7A 3NJTA 4RGOS 4XE0A 1JWSD 3OLMD 1YX5B 3QQ8B 3M3JA 1ACCA 1N60A 2J0JA 2DZIA 2JXXA 2L3ZA 4H2AA 2Z0DB 4FBJB 2IO2B 1ZKHA 4C7ZA 1SJHD 2MBQA 4W9KA 3LDZE 5JH5C 1N6ZA 2MHJA 1K50A 2V4IB 1HE8A 1UGMA 2BS2B 3KWLA 4HPMB 2PMVA 4RFBA 3IAM1 4I6NB 4A6QA 2LEKA 1AWDA 1FO4A 1PYWD 1MPEA 1V9JA 5AEKB 4RGNA 2M0XA 4YTNB 2GBKA 2IGHA 1C76A 4G0NB 2MBEA 4A3PA 4XDCA 2GOWA 2VH1A 4NNJB 2Y5CA 2PIAA 3HM6X 1MG4A 1ET9A 2FCNA 1WE7A 1IBXA 1WR6E 2LMCA 4JQWC 4KSLC 3W2DA 2J0KA 3W1YA 3WALA 3V62A 1WXVA 2CJNA 2DZJA 4HJGE 4MJSB 4A9AA 5EE0A 3QWZB 2K25A 1S3SG 1P3QU 3BINA 2LVOA 2Z59B 4LNNA 4KIKA 3AE3B 4FXCA 4KZCA 1E90A 1E7UA 4A90A 3AECB 5G55A 2JWUA 2YEPB 2LXCA 2CR5A 2VZKD 3RI7C 1UZXB 2MBHA 1UD7A 4IDIA 4OZAA 1TT5B 1NDDA 2OHFA 1SE3A 5BMGA 1EWYC 3N1XC 2KDFB 2MH7A 2INDC 1F1HA 1FEHA 1DGJA 3U7ZA 3V60A 2R2QA 4NJ6A 2RR9A 1Q1OA 4HRSA 5CHVC 5G5HA 3AE7B 1NENB 1YQ4B 1YD8U 2BKFA 2FBWB 1AARA 1XLOA 2N4FA 3V61A 4HDOA 4ARIA 1Q5WB 1NYRA 2KFKB 2DX5B 1KTKA 1P98A 3A9JA 4BKSA 4RGMA 1JW9D 2D10A 3IVFA 2WP9B 2JQRB 2G4DB 3L17A 1WGDA 4M8NA 2D3CA 3EC8A 2JYEA 1UELA 1WX8A 4KDIC 3Q8EA 3ZXVA 1IUEA 2MBBB 3AI5A 1VZ7A 1TIFA 2WLBA 2LD9A 3WIMA 1H7WA 3PLUA 4M0WA 3ZDTA 4MGKE 2N7EA 1L2NA 5D2MB 1E9MA 2DZMA 4PYUA 4WJPA 4GSWA 2WHIA 3NVYA 1J7CA 3ETRA 2K8HA 4DHJD 3NS8A 2QMTA 2KVRA 2BBCA 4GDKA 1E8YA 2MWSB 4JE3B 3AE1B 2GBMA 1V97A 2HTME 4JPSA 4KGRA 5BMIA 2NCNA 3U30A 4EKUA 2YLMA 4TUUA 1J8CA 1RFAA 2BTEA 1GOZA 2DYBA 4N9F4 4DXGA 2KTRB 1N61A 3ALBA 4NPNA 3B0AA 3EHVA 3P42A 5AUIA 2BKRB 2EKEC 2NTTA 4GXBA 4F1SA 1JWBD 3ZGZA 1P7FA 3ZNGC 3AXCA 2WS3B 3GE8C 4K3BA 4E3CA 1FRRA 4ICVA 4CYEA 1R4MI 2LHDA 2ICIA 4W9FA 2NR2A 2WXNA 2WQYB 3AE6B 3MC0B 3N30A 4IM3A 1LGRA 4DK5A 2RDGA 1KLGD 2WXPA 1SJED 3ENEA 3RPFC 3Q8CA 3RN9C 2KX3A 5C23A 2CS4A 2L8JA 1C4CA 2LVPA 1IGCA 4OVUA 4ARCA 3P1MA 3H8HA 1F2RI 3SDLC 1JALA 2XBBC 4NQLB 2D3BA 2TSSA 5LXIB 2HTHA 3GOEA 1C4AA 4L23A 1B1ZA 4LCDE 3MC8A 4BZAA 2UWQA 3N20C 4IWPA 4HJKA 4K7SA 4RMAA 5TSSA 1TKYA 2LZ6A 3WAPA 2KNBA 5FKAC 4OZCA 1TS5A 3P63A 2CHWA 4ANWA 3TL5A 1WYGA 3FILA 3L13A 4II3B 2CU1A 1SIJA 1IBXB 3WCQA 3ZNID 1E8ZA 2BB5A 2DENB 4WQOB 1QF6A 2KD0A 3RNEC 2JVCA 1FNUA 3ZW3A 3AH7A 2MJDA 5CTRC 2LRUA 4P7IA 1TS2A 3AULA 3L0WB 4B0MA 3TCAA 1E10A 4KIKB 3C0RB 4FJVB 2L52A 3EA6A 2FCMA 1BUIC 3GS2A 4P1CC 3TEWA 4BKTA 3RD2A 5IP4D 4IM0A 1PGAA 3U7DA 2MP2A 1C3TA 4RM9A 4S0RA 3NUHB 2GMIC 1YN5A 1V81A 3VVWB 3ZNZB 3TJPA 5EDSA 5EE3A 2XEWA 4IOIE 2KWDA 4KDLB 1E5WA 1HXYD 1WY8A 2KQ4X 1T0SC 2BGFA 1J0GA 4MACA 4MJSA 1KH0A 4OVVA 3T3NA 2N7JA 2GB1A 1TTNA 4P1BC 4W9HA 1DOXA 4WAFA 1GTEA 3AMZA 5HG2A 2M1MA 3UIPB 1SE9A 3TEZA 5DPWA 1FNVA 5LXHA 3H6NA 1Z2MA 2ZCBA 4BOSC 4IW0A 3A9JB 3K9OB 3KVFB 1KRHA 2GLSA 1MVKA 2KDEB 3ZTDA 2CHZA 1E7VA 4EZJA 3KUDB 1NEKB 3M63B 4R3DA 3R7QA 2WU5B 2KN5A 3ECIA 1M4VA 4MEMA 1N5XA 4A20A 1EWCA 1QZEA 2D3AA 1K51A 2D07B 4M0WB 2OJRA 1WJ6A 4KV2A 2IO1B 4HK2A 2L7RA 4IM2A 5CHWA 4ANXA 1K53A 3BK2A 1F2RC 2LHEA 1WM2A 3NVWA 2KFKA 5JHBA 5DPSA 2PEAA 4USAA 1Y8RC 2B3AA 2K1FA 4X57B 5DCNA 4GDKB 4NJ7A 3NOBA 4F7ZA 5J17A 4EOYA 3DHIC 4DXAB 2NBVB 1F9JA 2KANA 3I3TB 2KYWA 1GAQB 5TR5A 3FKYA 1L6UA 2IDYA 3AE9B 3W5UB 2OEDA 3U8ZA 2JZPA 4HDQA 2IPKD 1FCCC 4ITKA 3A33B 3PREA 2GBRA 1D3ZA 3MHZA 3NG0A 4W9DA 1NI2A 1SSNA 1XD3B 1I4GA 1PGXA 1KM7A 1YJ1A 2E3TA 4ZRIA 2LXAA 4WIPA 1ZDXA 3GZNI 2WXQA 3PT2B 2BYFA 2NPTA 2DBYA 1WMHA 1GT8A 1H7XA 2ZW1A 3DBRI 2JYTA 1D5XC 4PYZA 5CHFA 1TS3A 4WQMA 3VRAB 1N5WA 1UF0A 2IO3B 5HHDG 1JWMD 4FADA 3B2GA 3AEFB 3LYYA 3WAMA 1UNSA 2W54A 5L83A 3W1SA 4JL9A 4GLSC 2HJ1A 2LGIA 3X0WA 1TZ1A 2MBOA 1L0VB 3QHTA 2L0FA 3QAQA 3ONSA 3R2TA 1V5OA 3RNAC 3LJ3A 3AE8B 3ZRCA 1HEZE 2MEKA 3ZLZA 3IHPC 1WGRA 4BKSD 1VDVA 2GI9A 2K8CA 2WXJA 1XF5L 2L32A 4FHKA 3WAOA 4EFOA 3AEBB 1D5MC 3L54A 1RM6C 1SE2A 2WXFA 1FCLA 4KGTA 2JX5A 1I4RA 5LLIA 3MC9A 4MGYE 2WXMA 3R8BA 2N7DA 2WYQA 1XXGA 1LFDA 2BWES 5MPOA 1MG8A 2DHZA 2FNJB 2N9XA 3FILB 1C77A 2OJWA 1C9FA 5BYQA 2KFJA 2BT6A 4IWQA 3BVGA 2L00B 4LTUA 3ZYYX 4P6VF 3AV8A 4JWSC 3PHWB 3DHHC 3HM3A 4DHZE 3R66C 1NYQA 3MJWA 1FNWA 4ZYSA 1WJNA 5IKCM 3GZNB 1ZOYB 3Q69A 2VH2A 2BPSA 5BO4B 3APDA 1CK1A 2W82A 4JIOU 4RCOA 3DVNV 3A1QA 2O2VB 2MCNB 2LUMA 3DBRB 1XLQA 4O1NA 2MP2B 2XK5A 4AUQC 4RF0A 1AN8A 2M56B 1ROEA 1T0RC 1OFFA 3OJ3A 3R3MA 4B6WA 2Z8LA 5AZGA 1TYGB 2FCSA 3PZDA 1Z5SB 2JPHA 2A4ZA 1I7HA 5EE1A 1RFKA 1UBQA 1VCBA 2DYOA 4MT5A 3QC8B 1V8CA 2R61A 4HVBA 3E9SA 3U2SC 4M00A 1MI0A 1V6EA 1SBBB 3OJ4B 1YOVB 3VFKA 1I35A 5HFYA 2DZKA 3BYYB 1TGZB 3IAS1 3ZUNA 2KHWB 2K9XA 3VR8B 3UIOB 4WJNA 2KO3A 2Y3AA 3IXSA 3AEEB 2KACA 2N1WA 2MJEA 1T6BX 4AP4C 4RNAA 5E6JA 1L0YB 1WXMA 4FA6A 3P4PB 4A8XC 4EEWA 1IYFA 3DHGC 4NY0A 4L2YA 4KVGB 2G3QB 1QOGA 2M19A 1QOBA 3NHEB 4CHKA 4CO7A 1BMLC 1DYQA 2WXRA 1QKZA 2LGSA 3KW5B 2IGDA 3QCAA 1GB4A 3DWMA 4EUTA 3P2BA 2ASQA 4N59A 2K0PA 4BBNF 1VZ8A 1UGJA 3VTVA 5JZEB 2W9NA 1LM8B 2JU6X 2RSUA 1ZW7A 4W9EA 3L4PA 3KUZA 4C4VA 2JZZA 3RT3B 2AEHA 5EE9A 4FLHA 4YXDB 1DOIA 1D4BA 3MJ5A 2B76B 3PRPB 3RUIB 1OEYJ 3QA8A 3V05A 4AOFA 1QQRA 4K7WA 4AS1A 3CSFA 1VLBA 1GTHA 1YN3A 1L5PA 1TY2A 2YVCA 4ASWC 1EU3A 2ZZPB 4GDLA 2WDTB 1MHXA 4TQ0A 3EGRA 2PE9A 1MFWA 2RPQA 2KC2A 2LVQA 2ZJDA 3DBLI 4XX5A 2NPTB 2KMAA 1KOTA 1WMHB 2DYMA 2BVCA 1UUPA 2INCC 1RLFA 3QX1A 3TBLD 5D6JB 2JUOA 1YIWA 2D11A 1PFDA 1FD6A 2A5UA 4HKQA 2O6VB 4M8MA 3B2FA 3VTUA 3IFWB 3APCA 1EF5A 2KDMA 3AE5B 3UQAA 2MW5A 4ZOHC 1ZXHA 2MLBA 4YTPB 1AW7A 2J52A 3EFCA 3T9LA 3RCZA 3DOWA 4WWPA 4GU2A 1IPGA 4I6PA 1GUAB 4M02A 2WXGA 2JWZA 2JT4B 3OG5A 4EZLA 3H7PB 3WA0A 3Q3NC 1C4PA 4N6EB 1EF1A 3N1YC 4MELA 3U4EG 4N58A 3DBSA 3NRZA 2ZEQA 4C56C 4J3OD 5D94A 2PVOD 1E8WA 1L4DB 2AL6A 2JXTA 3Q8BA 2INNE 4WH4A 3SU8X 1FXTB 1J7AA 2BW2A 2AYOB 4E71A 2L0TA 5DPTA 3MFGA 5E6PA 1TZOA 2PJHA 1XLNA 4TSSA 1D5ZC 2KTFA 3HK0A 1YQ3B 5JHAA 1OTRB 2DAJA 3TMPB 1CJEA 1YN4A 4XWTA 2KMCA 1VR9A 2BS3B 2CKHB 2J53A 2ZPYA 5E6NA 4NZLB 2IY0B 2KOXA 3NS1A 2OOBB 2AX5A 3DBLB 1H4RA 2K22A 4LNFA 2WDVB 1N62A 3A1QB 1CMXB 4KZ0A 1MHHE 2XK5B 3NVVA 1SIFA 3VH4B 1C78A 3JW0X 3ZIMA 4MH0E 4A3OA 1I4QA 5BYSA 2BYVE 2RGFA 3L10B 1T3QA 4FN2A 4GIVA 1HA5A 3RNCC 2WDRB 2QC8A 2NMQA 4S17A 4JWUC 5DPRA
chains in the Genus database with same CATH topology
4YTNB 1UWMA 1L6UA 2IDYA 1AYFA 3AE9B 2IGHA 1C76A 3W5UB 4KX6B 1HZ6A 2QSDA 3J9CA 2OEDA 2AQ2B 1ZE3D 2JZPA 4XDCA 1WXQA 3FC4A 2IPKD 1FCCC 2PIAA 2Y5CA 4ITKA 1ET9A 3B9JA 5H92C 3MHZA 2WXOA 1SSNA 2BB6A 3AEDB 2KN4A 1IBXA 1HZ5A 1I4GA 2LMCA 1WGKA 1PGXA 2E3TA 3W2DA 4OVZA 3I57A 2XN9C 2LJIA 2W55A 2WNMA 1OQQA 4WIPA 4DQOC 3P4QB 2XNAC 2IGGA 3E56A 1ZDXA 2CJNA 4HJGE 2WXQA 2KAJA 1VZ6A 4A9AA 4YSYB 5FK9C 5C2TB 5EE0A 2DBYA 1GT8A 1EM7A 3NVZA 1L6VA 1H7XA 2ZW1A 1F77A 1WWTA 3VQIA 2JYTA 1D5XC 3AE3B 1ENFA 4FXCA 1BXTA 1TS3A 4WQMA 1XCQL 2QILA 3VRAB 1N5WA 5HHDG 4A90A 1JWMD 3AECB 3LXFA 3B2GA 3ZJVA 3AEFB 3LYYA 2EELA 2JWUA 2QEJC 3P4SB 1JQ4A 2V0GA 1TY0A 1UNSA 2W54A 2YEPB 1B9RA 4WWMA 3W1SA 3DWGC 2VZKD 4TQ1A 3P4RB 4IDIA 4GLSC 4OZAA 2X38A 2LGIA 4CQNA 1F0ZA 1YNTE 2V3NA 2OHFA 1L0VB 1SE3A 3TEYA 5BMGA 1EWYC 4Q2JA 3R2TA 2MJ3A 4IKGA 2MH7A 2YEPF 3AE8B 1FEHA 1DGJA 1R7SA 1GB1A 2IJ0A 2I2YA 1HEZE 2MEKA 3U7ZA 1XCTL 4HRSA 1QOAA 1VDVA 1SXTA 2GI9A 2WXIA 1XF5L 2WXJA 3Q8FA 2L32A 5G5HA 3AE7B 1I4XA 1NENB 3IT6B 1YQ4B 3AEBB 3TSSA 4HEA1 2GRIA 2WDQB 1D5MC 2FBWB 1FM0D 1XLOA 2NTSA 1RM6C 1SE2A 4ARIA 4US9A 2WXFA 4MH8A 3C8YA 1FCLA 1ET6A 4KGTA 2JX5A 1I4RA 1NYRA 1ZPSA 4AQ7A 3NZ3A 1QLBB 1FMAD 2WXMA 5H8YE 2ACZB 1KTKA 3R8BA 4UDUC 5D7GA 1XXGA 4WURA 4RGMA 1KF6B 1JW9D 5MPOA 3BVMA 3FILB 1C77A 4L1BA 1C9FA 4B0EA 2ZW0A 2WP9B 2JQRB 5BYQA 1JRPA 1WRIA 4KKIA 3SR6A 4OHJA 1L4ZB 2JYEA 2BT6A 4LK0M 3Q8EA 4GDLB 1JMLA 4XWWA 1IUEA 3BVGA 4LTUA 1VZ7A 3ZYYX 1TS4A 3AV8A 4P6VF 4JWSC 2WLBA 1L0XB 3BYTB 1NYQA 3HVZA 1FNWA 1H7WA 1XO3A 4PT5A 4ZYSA 4M0WA 2INPE 2G1EA 2WU2B 5C3JB 1ZOYB 2L83A 3Q69A 4MM3B 1E0ZA 4DXFA 1CK1A 5FR3A 2W82A 4RCOA 1FXAA 2Y5PA 2LUMA 1E9MA 1ZP0B 1I4HA 1XLQA 4O1NA 1XEEA 1SE4A 5AUKA 1D6EC 3KQ4A 3Q8AA 3NVYA 1J7CA 3ETRA 4RF0A 1AN8A 1ZUD2 2QMTA 2M56B 3CWIA 5I4DA 1ROEA 2JSVX 2CJOA 1CQVA 3ZJTA 2PVGC 1OFFA 2AQ1B 2BBCA 5JXVA 2Z8LA 1TYGB 4JE3B 5LNK1 5G5GA 3AE1B 1I7HA 1I4PA 5EE1A 1RFKA 1V97A 2HTME 4JPSA 4KGRA 1Q10A 5BMIA 2LFIA 2DYOA 4MT5A 3V3XA 4YTMB 1KLUD 2WXLA 1V8CA 2R61A 2DLBA 2BTEA 1GOZA 2K3UA 3E9SA 3U2SC 2WXKA 2N0SB 1JCKB 4DXGA 1MI0A 1SBBB 2H88B 1N61A 4ZRPA 1QILA 5HFYA 1T5XD 2AQ3B 3BYYB 3IAS1 3FAHA 2K9XA 3EUB2 2SEBD 4NJCA 2N9LA 3VR8B 3P42A 5AUIA 3TUOA 1SB3C 2Y3AA 1PGBA 1YJJA 3AEEB 2KACA 2NTTA 3IXSA 2MJEA 1Y56A 3O13A 1T6BX 1A70A 4RNAA 1JWBD 3ZGZA 1P7FA 5E6JA 1NI3A 4YT0B 2QJLA 1L0YB 2WS3B 3P4PB 1TKEA 4A55A 3SFEB 2VZKB 4A8XC 4TMAB 2PW9A 4L2YA 1FRRA 3ZQ4A 2LHDA 1JWUD 3AE4B 1QOGA 2M19A 1QOBA 2ICIA 4JX1C 2SAKA 1P7EA 3VRBB 3U52E 3HUIA 1BMLC 1DYQA 2WXNA 2WXRA 2WQYB 3AE6B 1QKZA 3MC0B 2RDGA 3SEBA 1KLGD 2IGDA 1SJED 2WXPA 4ZHPA 3RPFC 4XDDA 1GB4A 4ZHOA 1VRAB 2M0AA 3Q8CA 5D3IB 1K52A 1QT9A 3DWMA 4RF1A 1IGDA 1GPXA 1J7BA 2V3PA 2FE8A 1N63A 2ON8A 4N59A 2K0PA 1C4CA 2H89B 1VZ8A 1UGJA 1IGCA 4OW0A 3GB1A 4ARCA 3P1MA 3PO0A 3PZ8A 3H8HA 2DWQA 4US8A 1F2RI 1FFUA 3N9YC 1FIQA 1JALA 2D5GA 2JU6X 3KWVA 2TSSA 3L4PA 1HQRD 1C4AA 4L23A 3R2IA 5GXGB 1B1ZA 2PTLA 1E7PB 1STEA 3URYA 3IT4B 5EE9A 3KLSX 4YXDB 1DOIA 2K5PA 1D4BA 3MJ5A 2B76B 5TSSA 2RPVA 1TKYA 3V05A 1ZDVA 2RMMA 5FKAC 4OZCA 1PDXA 1QQRA 1TS5A 2FUG1 2Q5WD 5T8IA 1C79A 4RGTA 3P63A 1CZPA 4AS1A 1VLBA 2W3RA 1V1OA 1WYGA 3FILA 1GTHA 4NAMA 1SIJA 1IBXB 1YN3A 3BIID 1QOFA 3WCQA 1L5PA 1TY2A 2BB5A 1EU3A 1QF6A 1FNUA 3AH7A 2MJDA 3BWUD 1MHXA 4TQ0A 3EGRA 2J4XA 2WXHA 4LLGM 2J42A 1TS2A 4B0MA 4C7YA 5HI1A 2DYMA 4KGSA 3TEXA 3AE2B 1UUPA 1FXIA 1E10A 2E6XA 2L52A 3EA6A 2BS4B 3LB8C 2QIEB 3W9CB 3RFZB 1V1PA 3ZJUA 1BUIC 1ESFA 3GS2A 3TEWA 2I38A 1OQRA 1TKGA 4REZA 1PFDA 1SF0A 1NVID 1FD6A 1PGAA 3T3OA 1TJEA 3AB5A 4YSXB 3I9V1 4HKQA 5BMHA 1JWAD 1YMHE 1EU4A 3NUHB 4YWGG 1YN5A 3B2FA 2ONQA 5EE3A 2KDMA 3AE5B 4ZOHC 1ZXHA 4YTPB 4IOIE 2KWDA 1AW7A 2EKIA 1WSPA 2J52A 3OWEB 1LO5D 3GP7A 1XLPA 2PKOA 1HXYD 3SFDB 1JROA 2KQ4X 2BYTA 2N9KA 4OZBA 2WXGA 4MACA 1KH0A 2HDEA 3T3NA 2N7JA 4RGNA 1C4PA 4N6EB 2GB1A 1RWSA 3U4EG 4N58A 4EE2A 1DOXA 4C80A 3NRZA 1GTEA 1FFVA 3AMZA 4WAFA 5HG2A 4C56C 1DOYA 1VJKA 4J3OD 2PVOD 3AEAB 3MP9A 1L4DB 3TEZA 4RH6A 1FNVA 2JXTA 3Q8BA 2INNE 3BVZA 4WH4A 3HRDD 3CF4A 4HKZE 2KMMA 4HROA 4NAWB 1KRHA 1UWXA 1J7AA 1MVKA 2BW2A 3ABVB 2CU3A 2RDHA 4KKJA 3CIRB 1FRDA 3MFGA 1RYJA 1TZOA 1E6EB 1NEKB 3PZ7A 4RGOS 1XLNA 4XE0A 4R3DA 4TSSA 1SEBD 1D5ZC 1JWSD 2WU5B 1YQ3B 1ACCA 1N60A 1CJEA 1YN4A 4H2AA 4XWTA 1VR9A 2W3SA 4ZRQA 1M4VA 2BS3B 1N5XA 3VR9B 2J53A 1EWCA 1K51A 4NZLB 3NS1A 4D2KA 2AX5A 3AN1A 2K22A 5BYRA 4C7ZA 2WDVB 1N62A 1SJHD 1K53A 3BK2A 1F2RC 3HVDA 2LHEA 3NVWA 3UI3A 1K50A 2V4IB 5D3DA 1MHHE 4USAA 3NVVA 3AM9A 1PUTA 1ZXIA 1C78A 2BS2B 3KWLA 3BK1A 4YSZB 1I4QA 1YJIA 5BYSA 4P16A 1KFYB 1T3QA 2PMVA 4RFBA 3W5VB 3IAM1 4GDKB 1HA5A 3BZDB 4A6QA 2LEKA 2PLPA 1AWDA 2WDRB 3AEGB 1FO4A 1PYWD 2NMQA 1MPEA 2G9HD 1GAQB 2L1AA 1V1PB 4JWUC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YTN B;  1UWM A;  1L6U A;  2WQY B;  3AE6 B;  4ZOH C;  1AYF A;  2WP9 B;  3AE9 B;  2JQR B;  4YTP B;  1JRP A;  1WRI A;  3W5U B;  4KX6 B;  2EKI A;  3SR6 A;  1XLP A;  4ZHP A;  2PKO A;  3RPF C;  1WXQ A;  2BT6 A;  4ZHO A;  3SFD B;  1JRO A;  2PIA A;  2Y5C A;  1QT9 A;  3DWM A;  3FC4 A;  4ITK A;  1IUE A;  3B9J A;  5H92 C;  1GPX A;  1J7B A;  4LTU A;  3ZYY X;  4P6V F;  3AV8 A;  4JWS C;  2WLB A;  3AED B;  1N63 A;  4N59 A;  1WGK A;  3HUI A;  2H89 B;  4N6E B;  1NYQ A;  2E3T A;  3HVZ A;  1H7W A;  1RWS A;  1XO3 A;  4N58 A;  3P1M A;  2W55 A;  3PO0 A;  1OQQ A;  2DWQ A;  4US8 A;  1DOX A;  4C80 A;  3NRZ A;  1GTE A;  3P4Q B;  1FFU A;  1FFV A;  2WU2 B;  5C3J B;  2G1E A;  3AMZ A;  1DOY A;  1ZOY B;  1VJK A;  2L83 A;  1FIQ A;  1E0Z A;  1JAL A;  2PVO D;  3AEA B;  2CJN A;  1FXA A;  2KAJ A;  4A9A A;  4YSY B;  5C2T B;  5EE0 A;  1E9M A;  1ZP0 B;  3L4P A;  2DBY A;  1XLQ A;  1GT8 A;  3NVZ A;  1L6V A;  5AUK A;  1H7X A;  5GXG B;  1WWT A;  3HRD D;  1E7P B;  3NVY A;  1J7C A;  3ETR A;  3AE3 B;  3CF4 A;  4FXC A;  5EE9 A;  2KMM A;  4HRO A;  4WQM A;  1KRH A;  1ZUD 2;  1J7A A;  3VRA B;  1N5W A;  2M56 B;  3ABV B;  2CU3 A;  3CWI A;  3AEC B;  4YXD B;  1DOI A;  1ROE A;  2CJO A;  3CIR B;  1FRD A;  2K5P A;  3AEF B;  3B2G A;  3LXF A;  2B76 B;  1OFF A;  2PVG C;  1RYJ A;  3P4S B;  1JQ4 A;  1E6E B;  1NEK B;  1TKY A;  1TYG B;  2W54 A;  1B9R A;  4WWM A;  1XLN A;  3DWG C;  5G5G A;  3P4R B;  3AE1 B;  1I7H A;  1PDX A;  4IDI A;  2WU5 B;  1RFK A;  1YQ3 B;  1V97 A;  2HTM E;  2Q5W D;  5EE1 A;  1N60 A;  1CJE A;  3P63 A;  1CZP A;  1F0Z A;  1VLB A;  2W3R A;  1WYG A;  2W3S A;  1GTH A;  2OHF A;  1L0V B;  2BS3 B;  1N5X A;  1SIJ A;  3VR9 B;  4YTM B;  3BII D;  1QOF A;  3WCQ A;  1L5P A;  1EWY C;  1V8C A;  2MJ3 A;  3NS1 A;  1QF6 A;  2MH7 A;  2AX5 A;  3AN1 A;  3AE8 B;  2N0S B;  1DGJ A;  1R7S A;  2MJD A;  2K22 A;  3AH7 A;  4C7Z A;  2WDV B;  1N62 A;  2H88 B;  1N61 A;  4HRS A;  1QOA A;  1VDV A;  5G5H A;  4C7Y A;  3NVW A;  3FAH A;  3AE7 B;  2K9X A;  3EUB 2;  1NEN B;  3VR8 B;  3AE2 B;  1YQ4 B;  3AEB B;  4USA A;  5AUI A;  3NVV A;  1FXI A;  1E10 A;  1SB3 C;  2WDQ B;  1PUT A;  3AM9 A;  1ZXI A;  1YJJ A;  3AEE B;  2FBW B;  2BS4 B;  2L52 A;  2QIE B;  2MJE A;  2BS2 B;  1FM0 D;  1XLO A;  3LB8 C;  3W9C B;  1RM6 C;  3KWL A;  4YSZ B;  1YJI A;  1A70 A;  1OQR A;  1JWB D;  1KFY B;  4US9 A;  1T3Q A;  1TKG A;  1NI3 A;  3W5V B;  4YT0 B;  2QJL A;  1PFD A;  1SF0 A;  2WS3 B;  3P4P B;  1NVI D;  1TKE A;  2JX5 A;  3SFE B;  1NYR A;  1TJE A;  3AB5 A;  4YSX B;  2LEK A;  1QLB B;  1FMA D;  5H8Y E;  1AWD A;  2ACZ B;  1JWA D;  2WDR B;  1FRR A;  3AEG B;  1FO4 A;  3B2F A;  3AE4 B;  1QOG A;  2M19 A;  1GAQ B;  1KF6 B;  1JW9 D;  1QOB A;  4JX1 C;  5MPO A;  4JWU C;  3VRB B;  5EE3 A;  3AE5 B; 
#chains in the Genus database with same CATH topology
 1UWM A;  5IAA C;  2I1K A;  3J9C A;  3H7S A;  1WFY A;  1GC7 A;  3AU5 A;  2J7Q B;  5GMV A;  3GE3 C;  5H92 C;  2WXO A;  2LGY A;  2O2V A;  4TV3 A;  2BB6 A;  2KN4 A;  1HZ5 A;  4FHJ A;  4LNI A;  1R4M B;  3H9D A;  4OVZ A;  3TIX A;  2XN9 C;  2W55 A;  1OQQ A;  4G11 A;  3P4Q B;  3E56 A;  2LWP A;  4K1R B;  3JYU A;  3EEC A;  4TKN A;  4MDK E;  4YSY B;  5C2T B;  1EM7 A;  3NVZ A;  2ZPN A;  5FR6 A;  4HWI B;  2KWC A;  1WWT A;  1ENF A;  4XGA B;  2QIL A;  5L95 C;  4WJQ A;  4W9G A;  2EEL A;  2QEJ C;  3P4S B;  1JQ4 A;  1B9R A;  1HTO A;  4AWJ A;  3DWG C;  4TQ1 A;  3P4R B;  1WX7 A;  3CMM B;  2X38 A;  2ZVN A;  3V6E B;  2MX2 A;  4WJO A;  3C19 A;  4Q2J A;  4K3C A;  4IKG A;  2KLG A;  3RUL A;  4GOC A;  2LGX A;  2YEP F;  3HIZ A;  1GB1 A;  4WWN A;  2IJ0 A;  4W9L A;  3I5J C;  2K6D B;  1T0Q C;  1QOA A;  1SXT A;  3Q8F A;  4C4V B;  1EO6 A;  1I4X A;  3IT6 B;  2KJR A;  3TSS A;  2GRI A;  3I63 C;  4RM8 A;  3KUC B;  1GNU A;  2C9W B;  2KK8 A;  3Q2A C;  4US9 A;  4MH8 A;  1ET6 A;  4WAA A;  4AQ7 A;  2IO0 B;  3NZ3 A;  5J18 A;  1FMA D;  3IG3 A;  4UDU C;  1RAX A;  5D7G A;  3NZS A;  4EZK A;  1KF6 B;  4NAW A;  4BFR A;  3KYC D;  2IZV B;  1JRP A;  1WI0 A;  4KKI A;  3SR6 A;  4OHJ A;  1L4Z B;  2UU7 A;  4XZ4 A;  4LK0 M;  4GDL B;  1S1Q B;  1VD2 A;  3PSE B;  1TS4 A;  4MSM B;  3BYT B;  1GG3 A;  4PT5 A;  2M4N A;  3ZDM C;  2INP E;  2G1E A;  5C3J B;  2KVZ A;  1E0Z A;  2K39 A;  4DXF A;  4BBN C;  3DPD A;  5FR3 A;  2MSE D;  1FXA A;  2Y5P A;  1WJ4 A;  3B1L X;  3Q3J A;  3ZXR A;  5IOI A;  1SE4 A;  5AUK A;  2D2Q A;  3KQ4 A;  1WX9 A;  2N9E B;  2IY1 B;  1ZUD 2;  1WRD B;  3CWI A;  5I4D A;  1WYW B;  2CJO A;  4PS7 A;  1WXA A;  2IYD B;  2PVG C;  1H8C A;  5JXV A;  3NZU A;  3N1Z C;  2K6Q A;  5LNK 1;  1I4P A;  5AZF A;  4K7U A;  1Q10 A;  2LFI A;  3SD5 A;  4YTM B;  1TBE A;  2KWU B;  3A4S C;  2K3U A;  3T8M A;  2WXK A;  2N0S B;  1WGG A;  3VXW A;  1QIL A;  2ZVO A;  1K8R B;  1T5X D;  2AQ3 B;  4F8C B;  2N9L A;  2KJ6 A;  1J19 A;  2O6V A;  3TUO A;  4JLC A;  4HCN B;  1PGB A;  4ZDV A;  3O13 A;  4NQK E;  2BQQ A;  3UGB B;  2QJL A;  1TKE A;  4A55 A;  1KJT A;  2VZK B;  5HKH A;  4DWF A;  4TMA B;  4KSK C;  3ZVV A;  1ISN A;  2PW9 A;  3VHT C;  3ZQ4 A;  4HLE A;  4G3X B;  3DBH I;  4JX1 C;  2V9H A;  2KDB A;  3U52 E;  1LXD A;  4PS8 A;  3H7P A;  3L16 A;  1R4N I;  4ZHP A;  3JSV B;  4XDD A;  3Q3M C;  1VRA B;  2M0A A;  4ZHO A;  2WGS A;  2KZR A;  3PHX B;  5D3I B;  5IO9 A;  3V6C B;  4MGI E;  3OAW A;  1J7B A;  4HCP B;  1N63 A;  2ON8 A;  4OW0 A;  3GB1 A;  1EUV B;  4US8 A;  3N9Y C;  4GN1 A;  1FIQ A;  2D5G A;  4PK1 A;  2PPH A;  2WX1 A;  2MQJ A;  4ZRK A;  3PS6 A;  1V49 A;  1GJZ A;  3R2I A;  5GXG B;  1NBF C;  1E7P B;  1STE A;  2UYZ B;  4PS3 A;  2R2O A;  2K5P A;  3Q14 C;  2LAS A;  2KDI A;  4I6L B;  1V86 A;  2RMM A;  2C60 A;  4DDI D;  5T8I A;  1PDX A;  2G45 B;  2NS5 A;  2LI5 A;  4RGT A;  3DVN U;  1CZP A;  2V3S A;  3H1U A;  2W3R A;  1QOF A;  2KC1 A;  4MSQ B;  3PTF C;  1Q0W B;  3BWU D;  4C00 A;  2J4X A;  2WXH A;  4LLG M;  1WGY A;  2J0M A;  3SHQ A;  2EMT A;  1FXI A;  4DHJ B;  3LB8 C;  1L7Y A;  5J2R A;  4IUM B;  1JRU A;  4MM3 A;  3PRZ A;  1TKG A;  2FCQ A;  1UH6 A;  4REZ A;  3T3O A;  1TJE A;  4YSX B;  3DDC B;  3I9V 1;  3PPA A;  3DBH B;  3Q3O C;  5BMH A;  1JWA D;  1WM3 A;  1EU4 A;  1WZ3 A;  1YMH E;  4YWG G;  4URK A;  2JRH A;  1R4N B;  3B08 A;  2ONQ A;  3WAN A;  4JGH B;  4LJP B;  2EKI A;  3OWE B;  1LO5 D;  3GP7 A;  1XLP A;  1XQQ A;  2BYT A;  3Q6B A;  2KWV B;  3S2A A;  3APF A;  4FJZ A;  4ZRJ A;  1RWS A;  4C80 A;  1FFV A;  1DOY A;  2VRR B;  2N9P C;  3AEA B;  3MP9 A;  4RH6 A;  5KHQ A;  2GBN A;  3BVZ A;  4HKZ E;  4HRO A;  4NAW B;  1UWX A;  3ABV B;  2CU3 A;  2RDH A;  4KKJ A;  1FRD A;  1RYJ A;  1E6E B;  4G50 A;  2N1V A;  1SEB D;  4LJO B;  3PLV A;  2W3S A;  4ZRQ A;  2V4L A;  3KH0 A;  3VR9 B;  1WZ0 A;  3A9K A;  1V80 A;  1T0Y A;  4D2K A;  3AN1 A;  1MJD A;  5BYR A;  2MA9 B;  1KLV A;  4E74 A;  2KX0 A;  3HVD A;  1WIA A;  4GGQ A;  3UI3 A;  3UIN B;  5D3D A;  3RNG C;  1F52 A;  1WF9 A;  4LNK A;  3QJZ A;  3AM9 A;  1PUT A;  3CF6 E;  1ZXI A;  4HXD A;  2AL3 A;  2KXJ A;  3BK1 A;  4YSZ B;  1YJI A;  4P16 A;  2WX0 A;  1KFY B;  3W5V B;  2C5L C;  2C7M B;  4LDT B;  3BZD B;  1WR1 A;  4DDG D;  2PLP A;  3AEG B;  2G9H D;  3KYD D;  2EMS A;  2L1A A;  1V1P B;  2KLC A;  1V2Y A;  1AYF A;  4KX6 B;  1HZ6 A;  2QSD A;  2NBU A;  2AQ2 B;  1ZE3 D;  1WXQ A;  3RNF C;  3FC4 A;  4II2 B;  5CX3 A;  3B9J A;  3N32 A;  3AED B;  2L05 A;  1WGK A;  2QHO A;  3VUW A;  3I57 A;  2LJI A;  2WNM A;  2HE7 A;  4W9J A;  3Q3F A;  2XNA C;  4DQO C;  2IGG A;  4M01 A;  2KAJ A;  1VZ6 A;  5FK9 C;  4ANU A;  3VDZ A;  1L6V A;  3UQB A;  1F77 A;  3VQI A;  4ICU A;  4DHZ B;  3RYT A;  1BXT A;  1P9D U;  2NVU I;  1XCQ L;  1YQB A;  2LGD A;  3LXF A;  3ZJV A;  4B95 A;  1I42 A;  2V0G A;  1TY0 A;  4WWM A;  2KT7 A;  4CQN A;  1F0Z A;  1YNT E;  2CHX A;  2V3N A;  2GBJ A;  4BAX A;  3TEY A;  2MJ3 A;  2FID A;  2L76 A;  1R7S A;  2I2Y A;  1XCT L;  3W1S C;  2WXI A;  2KKC A;  2HD5 B;  3DQV A;  4HEA 1;  2WDQ B;  3K9P B;  2QDF A;  1FM0 D;  2Z0E B;  2NTS A;  3C8Y A;  2LRW A;  1ZPS A;  3JSV A;  1QLB B;  5H8Y E;  2ACZ B;  3ZKJ C;  2JRI B;  4W9C A;  3ZTC A;  3RZF A;  4GMV A;  4WUR A;  2FIF A;  4AJW A;  3BVM A;  1A5R A;  4L1B A;  4ACF A;  4B0E A;  2ZW0 A;  3ZO5 B;  1WRI A;  2IBI B;  1SGH A;  3DCG A;  2BYE A;  1YX6 B;  1OEY A;  1JML A;  1WXS A;  4GB9 A;  4XWW A;  2ZNV B;  2JY6 A;  1L0X B;  1OQY A;  3HVZ A;  1XO3 A;  2M8S A;  4LDT D;  2WU2 B;  2X8X X;  2L83 A;  3N3K B;  4MM3 B;  2DAF A;  2G4S A;  2BWF A;  1ZP0 B;  2DNF A;  1I4H A;  4MGZ E;  3CST A;  1XEE A;  3VH3 B;  1D6E C;  3Q8A A;  1P1A A;  3MTN B;  3HHM A;  1WH3 A;  1E8X A;  2JSV X;  1CQV A;  3ZJT A;  2AQ1 B;  4IWO A;  5G5G A;  4K81 A;  2D3G A;  2O6V D;  2FAZ A;  3PRM B;  3V3X A;  1KLU D;  1RRB A;  2WXL A;  2DLB A;  4W9I A;  3IBE A;  3D32 A;  2ZNV C;  1JCK B;  4HPL B;  2H88 B;  4ZRP A;  3AU4 A;  1M94 A;  3FAH A;  1WGH A;  2RDB C;  3EUB 2;  4NJC A;  2SEB D;  1ZGU B;  4XYC A;  3X23 A;  4XC2 A;  1SB3 C;  3RMK C;  1YJJ A;  1Y56 A;  3VTW A;  1A70 A;  2ZCC A;  3VAW A;  1NI3 A;  4YT0 B;  3SFE B;  3BY4 B;  5KHO A;  1GC6 A;  1V5T A;  2KQS A;  1JWU D;  3AE4 B;  1XT9 B;  2SAK A;  1P7E A;  3NY5 A;  3VRB B;  4ZYN A;  3HUI A;  2KJH B;  3A9K B;  3A4R A;  1WJU A;  2WWZ A;  3SEB A;  1LQB A;  2RD0 A;  4B9K A;  4HPP A;  1K52 A;  1QT9 A;  4RF1 A;  3VUX A;  1IGD A;  1GPX A;  2V3P A;  2FE8 A;  2K8B A;  3QK0 A;  2H89 B;  2C7H A;  3L08 A;  3PO0 A;  3PZ8 A;  1IP9 A;  2DWQ A;  1FFU A;  1FPY A;  1X1M A;  3KWV A;  1PQS A;  2M17 A;  1HQR D;  2PTL A;  1BT0 A;  3URY A;  2QCZ A;  3IT4 B;  3KLS X;  3ZRF A;  3O65 B;  1U4A A;  1WE6 A;  2RPV A;  2C7N B;  1ZDV A;  2FUG 1;  2Q5W D;  1C79 A;  3M62 B;  2JZ3 B;  1V1O A;  4NAM A;  4AJY B;  2LJ5 A;  4BVU C;  3BII D;  5C1Z A;  2Y5B B;  4QAY A;  3RZW C;  4ANV A;  1G6J A;  2REX A;  3JVZ X;  3RNB C;  2J42 A;  3DVG X;  4IC7 B;  3PGE A;  2MRP A;  1P0R A;  4C7Y A;  1OGW A;  4DBG A;  5HI1 A;  3M95 A;  4LNO A;  4KGS A;  3TEX A;  3AE2 B;  4BOZ B;  2E6X A;  2BS4 B;  2QIE B;  2V1Y A;  2NBW B;  3W9C B;  1V1P A;  3RFZ B;  3ZJU A;  5G2N A;  1ESF A;  2I38 A;  1OQR A;  4BKG A;  3ZNH B;  1SF0 A;  3R7R A;  1C1Y B;  1NVI D;  3AB5 A;  2FUH B;  2PE6 B;  4YL8 A;  3EFU A;  2BF8 B;  3UF8 A;  3DVG Y;  5E6O A;  5IA7 A;  1WSP A;  2PKO A;  4FUL A;  3SFD B;  1JRO A;  2I1J A;  2N9K A;  4J6I A;  4OZB A;  3QAR A;  2HJ8 A;  2LUE A;  2HDE A;  2JF5 A;  3PVL A;  5IN7 A;  4EE2 A;  3VUY A;  1VJK A;  3MHS D;  2KTR A;  4WWO A;  5AZH A;  4FJY A;  1UBI A;  3ML8 A;  3HRD D;  1HTQ A;  3CF4 A;  2KMM A;  2AWT A;  3PV1 A;  3QIJ A;  3CIR B;  2KQ7 A;  4IG7 B;  3ML9 A;  3PZ7 A;  3NJT A;  4RGO S;  4XE0 A;  1JWS D;  3OLM D;  1YX5 B;  3QQ8 B;  3M3J A;  1ACC A;  1N60 A;  2J0J A;  2DZI A;  2JXX A;  2L3Z A;  4H2A A;  2Z0D B;  4FBJ B;  2IO2 B;  1ZKH A;  4C7Z A;  1SJH D;  2MBQ A;  4W9K A;  3LDZ E;  5JH5 C;  1N6Z A;  2MHJ A;  1K50 A;  2V4I B;  1HE8 A;  1UGM A;  2BS2 B;  3KWL A;  4HPM B;  2PMV A;  4RFB A;  3IAM 1;  4I6N B;  4A6Q A;  2LEK A;  1AWD A;  1FO4 A;  1PYW D;  1MPE A;  1V9J A;  5AEK B;  4RGN A;  2M0X A;  4YTN B;  2GBK A;  2IGH A;  1C76 A;  4G0N B;  2MBE A;  4A3P A;  4XDC A;  2GOW A;  2VH1 A;  4NNJ B;  2Y5C A;  2PIA A;  3HM6 X;  1MG4 A;  1ET9 A;  2FCN A;  1WE7 A;  1IBX A;  1WR6 E;  2LMC A;  4JQW C;  4KSL C;  3W2D A;  2J0K A;  3W1Y A;  3WAL A;  3V62 A;  1WXV A;  2CJN A;  2DZJ A;  4HJG E;  4MJS B;  4A9A A;  5EE0 A;  3QWZ B;  2K25 A;  1S3S G;  1P3Q U;  3BIN A;  2LVO A;  2Z59 B;  4LNN A;  4KIK A;  3AE3 B;  4FXC A;  4KZC A;  1E90 A;  1E7U A;  4A90 A;  3AEC B;  5G55 A;  2JWU A;  2YEP B;  2LXC A;  2CR5 A;  2VZK D;  3RI7 C;  1UZX B;  2MBH A;  1UD7 A;  4IDI A;  4OZA A;  1TT5 B;  1NDD A;  2OHF A;  1SE3 A;  5BMG A;  1EWY C;  3N1X C;  2KDF B;  2MH7 A;  2IND C;  1F1H A;  1FEH A;  1DGJ A;  3U7Z A;  3V60 A;  2R2Q A;  4NJ6 A;  2RR9 A;  1Q1O A;  4HRS A;  5CHV C;  5G5H A;  3AE7 B;  1NEN B;  1YQ4 B;  1YD8 U;  2BKF A;  2FBW B;  1AAR A;  1XLO A;  2N4F A;  3V61 A;  4HDO A;  4ARI A;  1Q5W B;  1NYR A;  2KFK B;  2DX5 B;  1KTK A;  1P98 A;  3A9J A;  4BKS A;  4RGM A;  1JW9 D;  2D10 A;  3IVF A;  2WP9 B;  2JQR B;  2G4D B;  3L17 A;  1WGD A;  4M8N A;  2D3C A;  3EC8 A;  2JYE A;  1UEL A;  1WX8 A;  4KDI C;  3Q8E A;  3ZXV A;  1IUE A;  2MBB B;  3AI5 A;  1VZ7 A;  1TIF A;  2WLB A;  2LD9 A;  3WIM A;  1H7W A;  3PLU A;  4M0W A;  3ZDT A;  4MGK E;  2N7E A;  1L2N A;  5D2M B;  1E9M A;  2DZM A;  4PYU A;  4WJP A;  4GSW A;  2WHI A;  3NVY A;  1J7C A;  3ETR A;  2K8H A;  4DHJ D;  3NS8 A;  2QMT A;  2KVR A;  2BBC A;  4GDK A;  1E8Y A;  2MWS B;  4JE3 B;  3AE1 B;  2GBM A;  1V97 A;  2HTM E;  4JPS A;  4KGR A;  5BMI A;  2NCN A;  3U30 A;  4EKU A;  2YLM A;  4TUU A;  1J8C A;  1RFA A;  2BTE A;  1GOZ A;  2DYB A;  4N9F 4;  4DXG A;  2KTR B;  1N61 A;  3ALB A;  4NPN A;  3B0A A;  3EHV A;  3P42 A;  5AUI A;  2BKR B;  2EKE C;  2NTT A;  4GXB A;  4F1S A;  1JWB D;  3ZGZ A;  1P7F A;  3ZNG C;  3AXC A;  2WS3 B;  3GE8 C;  4K3B A;  4E3C A;  1FRR A;  4ICV A;  4CYE A;  1R4M I;  2LHD A;  2ICI A;  4W9F A;  2NR2 A;  2WXN A;  2WQY B;  3AE6 B;  3MC0 B;  3N30 A;  4IM3 A;  1LGR A;  4DK5 A;  2RDG A;  1KLG D;  2WXP A;  1SJE D;  3ENE A;  3RPF C;  3Q8C A;  3RN9 C;  2KX3 A;  5C23 A;  2CS4 A;  2L8J A;  1C4C A;  2LVP A;  1IGC A;  4OVU A;  4ARC A;  3P1M A;  3H8H A;  1F2R I;  3SDL C;  1JAL A;  2XBB C;  4NQL B;  2D3B A;  2TSS A;  5LXI B;  2HTH A;  3GOE A;  1C4A A;  4L23 A;  1B1Z A;  4LCD E;  3MC8 A;  4BZA A;  2UWQ A;  3N20 C;  4IWP A;  4HJK A;  4K7S A;  4RMA A;  5TSS A;  1TKY A;  2LZ6 A;  3WAP A;  2KNB A;  5FKA C;  4OZC A;  1TS5 A;  3P63 A;  2CHW A;  4ANW A;  3TL5 A;  1WYG A;  3FIL A;  3L13 A;  4II3 B;  2CU1 A;  1SIJ A;  1IBX B;  3WCQ A;  3ZNI D;  1E8Z A;  2BB5 A;  2DEN B;  4WQO B;  1QF6 A;  2KD0 A;  3RNE C;  2JVC A;  1FNU A;  3ZW3 A;  3AH7 A;  2MJD A;  5CTR C;  2LRU A;  4P7I A;  1TS2 A;  3AUL A;  3L0W B;  4B0M A;  3TCA A;  1E10 A;  4KIK B;  3C0R B;  4FJV B;  2L52 A;  3EA6 A;  2FCM A;  1BUI C;  3GS2 A;  4P1C C;  3TEW A;  4BKT A;  3RD2 A;  5IP4 D;  4IM0 A;  1PGA A;  3U7D A;  2MP2 A;  1C3T A;  4RM9 A;  4S0R A;  3NUH B;  2GMI C;  1YN5 A;  1V81 A;  3VVW B;  3ZNZ B;  3TJP A;  5EDS A;  5EE3 A;  2XEW A;  4IOI E;  2KWD A;  4KDL B;  1E5W A;  1HXY D;  1WY8 A;  2KQ4 X;  1T0S C;  2BGF A;  1J0G A;  4MAC A;  4MJS A;  1KH0 A;  4OVV A;  3T3N A;  2N7J A;  2GB1 A;  1TTN A;  4P1B C;  4W9H A;  1DOX A;  4WAF A;  1GTE A;  3AMZ A;  5HG2 A;  2M1M A;  3UIP B;  1SE9 A;  3TEZ A;  5DPW A;  1FNV A;  5LXH A;  3H6N A;  1Z2M A;  2ZCB A;  4BOS C;  4IW0 A;  3A9J B;  3K9O B;  3KVF B;  1KRH A;  2GLS A;  1MVK A;  2KDE B;  3ZTD A;  2CHZ A;  1E7V A;  4EZJ A;  3KUD B;  1NEK B;  3M63 B;  4R3D A;  3R7Q A;  2WU5 B;  2KN5 A;  3ECI A;  1M4V A;  4MEM A;  1N5X A;  4A20 A;  1EWC A;  1QZE A;  2D3A A;  1K51 A;  2D07 B;  4M0W B;  2OJR A;  1WJ6 A;  4KV2 A;  2IO1 B;  4HK2 A;  2L7R A;  4IM2 A;  5CHW A;  4ANX A;  1K53 A;  3BK2 A;  1F2R C;  2LHE A;  1WM2 A;  3NVW A;  2KFK A;  5JHB A;  5DPS A;  2PEA A;  4USA A;  1Y8R C;  2B3A A;  2K1F A;  4X57 B;  5DCN A;  4GDK B;  4NJ7 A;  3NOB A;  4F7Z A;  5J17 A;  4EOY A;  3DHI C;  4DXA B;  2NBV B;  1F9J A;  2KAN A;  3I3T B;  2KYW A;  1GAQ B;  5TR5 A;  3FKY A;  1L6U A;  2IDY A;  3AE9 B;  3W5U B;  2OED A;  3U8Z A;  2JZP A;  4HDQ A;  2IPK D;  1FCC C;  4ITK A;  3A33 B;  3PRE A;  2GBR A;  1D3Z A;  3MHZ A;  3NG0 A;  4W9D A;  1NI2 A;  1SSN A;  1XD3 B;  1I4G A;  1PGX A;  1KM7 A;  1YJ1 A;  2E3T A;  4ZRI A;  2LXA A;  4WIP A;  1ZDX A;  3GZN I;  2WXQ A;  3PT2 B;  2BYF A;  2NPT A;  2DBY A;  1WMH A;  1GT8 A;  1H7X A;  2ZW1 A;  3DBR I;  2JYT A;  1D5X C;  4PYZ A;  5CHF A;  1TS3 A;  4WQM A;  3VRA B;  1N5W A;  1UF0 A;  2IO3 B;  5HHD G;  1JWM D;  4FAD A;  3B2G A;  3AEF B;  3LYY A;  3WAM A;  1UNS A;  2W54 A;  5L83 A;  3W1S A;  4JL9 A;  4GLS C;  2HJ1 A;  2LGI A;  3X0W A;  1TZ1 A;  2MBO A;  1L0V B;  3QHT A;  2L0F A;  3QAQ A;  3ONS A;  3R2T A;  1V5O A;  3RNA C;  3LJ3 A;  3AE8 B;  3ZRC A;  1HEZ E;  2MEK A;  3ZLZ A;  3IHP C;  1WGR A;  4BKS D;  1VDV A;  2GI9 A;  2K8C A;  2WXJ A;  1XF5 L;  2L32 A;  4FHK A;  3WAO A;  4EFO A;  3AEB B;  1D5M C;  3L54 A;  1RM6 C;  1SE2 A;  2WXF A;  1FCL A;  4KGT A;  2JX5 A;  1I4R A;  5LLI A;  3MC9 A;  4MGY E;  2WXM A;  3R8B A;  2N7D A;  2WYQ A;  1XXG A;  1LFD A;  2BWE S;  5MPO A;  1MG8 A;  2DHZ A;  2FNJ B;  2N9X A;  3FIL B;  1C77 A;  2OJW A;  1C9F A;  5BYQ A;  2KFJ A;  2BT6 A;  4IWQ A;  3BVG A;  2L00 B;  4LTU A;  3ZYY X;  4P6V F;  3AV8 A;  4JWS C;  3PHW B;  3DHH C;  3HM3 A;  4DHZ E;  3R66 C;  1NYQ A;  3MJW A;  1FNW A;  4ZYS A;  1WJN A;  5IKC M;  3GZN B;  1ZOY B;  3Q69 A;  2VH2 A;  2BPS A;  5BO4 B;  3APD A;  1CK1 A;  2W82 A;  4JIO U;  4RCO A;  3DVN V;  3A1Q A;  2O2V B;  2MCN B;  2LUM A;  3DBR B;  1XLQ A;  4O1N A;  2MP2 B;  2XK5 A;  4AUQ C;  4RF0 A;  1AN8 A;  2M56 B;  1ROE A;  1T0R C;  1OFF A;  3OJ3 A;  3R3M A;  4B6W A;  2Z8L A;  5AZG A;  1TYG B;  2FCS A;  3PZD A;  1Z5S B;  2JPH A;  2A4Z A;  1I7H A;  5EE1 A;  1RFK A;  1UBQ A;  1VCB A;  2DYO A;  4MT5 A;  3QC8 B;  1V8C A;  2R61 A;  4HVB A;  3E9S A;  3U2S C;  4M00 A;  1MI0 A;  1V6E A;  1SBB B;  3OJ4 B;  1YOV B;  3VFK A;  1I35 A;  5HFY A;  2DZK A;  3BYY B;  1TGZ B;  3IAS 1;  3ZUN A;  2KHW B;  2K9X A;  3VR8 B;  3UIO B;  4WJN A;  2KO3 A;  2Y3A A;  3IXS A;  3AEE B;  2KAC A;  2N1W A;  2MJE A;  1T6B X;  4AP4 C;  4RNA A;  5E6J A;  1L0Y B;  1WXM A;  4FA6 A;  3P4P B;  4A8X C;  4EEW A;  1IYF A;  3DHG C;  4NY0 A;  4L2Y A;  4KVG B;  2G3Q B;  1QOG A;  2M19 A;  1QOB A;  3NHE B;  4CHK A;  4CO7 A;  1BML C;  1DYQ A;  2WXR A;  1QKZ A;  2LGS A;  3KW5 B;  2IGD A;  3QCA A;  1GB4 A;  3DWM A;  4EUT A;  3P2B A;  2ASQ A;  4N59 A;  2K0P A;  4BBN F;  1VZ8 A;  1UGJ A;  3VTV A;  5JZE B;  2W9N A;  1LM8 B;  2JU6 X;  2RSU A;  1ZW7 A;  4W9E A;  3L4P A;  3KUZ A;  4C4V A;  2JZZ A;  3RT3 B;  2AEH A;  5EE9 A;  4FLH A;  4YXD B;  1DOI A;  1D4B A;  3MJ5 A;  2B76 B;  3PRP B;  3RUI B;  1OEY J;  3QA8 A;  3V05 A;  4AOF A;  1QQR A;  4K7W A;  4AS1 A;  3CSF A;  1VLB A;  1GTH A;  1YN3 A;  1L5P A;  1TY2 A;  2YVC A;  4ASW C;  1EU3 A;  2ZZP B;  4GDL A;  2WDT B;  1MHX A;  4TQ0 A;  3EGR A;  2PE9 A;  1MFW A;  2RPQ A;  2KC2 A;  2LVQ A;  2ZJD A;  3DBL I;  4XX5 A;  2NPT B;  2KMA A;  1KOT A;  1WMH B;  2DYM A;  2BVC A;  1UUP A;  2INC C;  1RLF A;  3QX1 A;  3TBL D;  5D6J B;  2JUO A;  1YIW A;  2D11 A;  1PFD A;  1FD6 A;  2A5U A;  4HKQ A;  2O6V B;  4M8M A;  3B2F A;  3VTU A;  3IFW B;  3APC A;  1EF5 A;  2KDM A;  3AE5 B;  3UQA A;  2MW5 A;  4ZOH C;  1ZXH A;  2MLB A;  4YTP B;  1AW7 A;  2J52 A;  3EFC A;  3T9L A;  3RCZ A;  3DOW A;  4WWP A;  4GU2 A;  1IPG A;  4I6P A;  1GUA B;  4M02 A;  2WXG A;  2JWZ A;  2JT4 B;  3OG5 A;  4EZL A;  3H7P B;  3WA0 A;  3Q3N C;  1C4P A;  4N6E B;  1EF1 A;  3N1Y C;  4MEL A;  3U4E G;  4N58 A;  3DBS A;  3NRZ A;  2ZEQ A;  4C56 C;  4J3O D;  5D94 A;  2PVO D;  1E8W A;  1L4D B;  2AL6 A;  2JXT A;  3Q8B A;  2INN E;  4WH4 A;  3SU8 X;  1FXT B;  1J7A A;  2BW2 A;  2AYO B;  4E71 A;  2L0T A;  5DPT A;  3MFG A;  5E6P A;  1TZO A;  2PJH A;  1XLN A;  4TSS A;  1D5Z C;  2KTF A;  3HK0 A;  1YQ3 B;  5JHA A;  1OTR B;  2DAJ A;  3TMP B;  1CJE A;  1YN4 A;  4XWT A;  2KMC A;  1VR9 A;  2BS3 B;  2CKH B;  2J53 A;  2ZPY A;  5E6N A;  4NZL B;  2IY0 B;  2KOX A;  3NS1 A;  2OOB B;  2AX5 A;  3DBL B;  1H4R A;  2K22 A;  4LNF A;  2WDV B;  1N62 A;  3A1Q B;  1CMX B;  4KZ0 A;  1MHH E;  2XK5 B;  3NVV A;  1SIF A;  3VH4 B;  1C78 A;  3JW0 X;  3ZIM A;  4MH0 E;  4A3O A;  1I4Q A;  5BYS A;  2BYV E;  2RGF A;  3L10 B;  1T3Q A;  4FN2 A;  4GIV A;  1HA5 A;  3RNC C;  2WDR B;  2QC8 A;  2NMQ A;  4S17 A;  4JWU C;  5DPR A; 
#chains in the Genus database with same CATH homology
 4YTN B;  1UWM A;  1L6U A;  2IDY A;  1AYF A;  3AE9 B;  2IGH A;  1C76 A;  3W5U B;  4KX6 B;  1HZ6 A;  2QSD A;  3J9C A;  2OED A;  2AQ2 B;  1ZE3 D;  2JZP A;  4XDC A;  1WXQ A;  3FC4 A;  2IPK D;  1FCC C;  2PIA A;  2Y5C A;  4ITK A;  1ET9 A;  3B9J A;  5H92 C;  3MHZ A;  2WXO A;  1SSN A;  2BB6 A;  3AED B;  2KN4 A;  1IBX A;  1HZ5 A;  1I4G A;  2LMC A;  1WGK A;  1PGX A;  2E3T A;  3W2D A;  4OVZ A;  3I57 A;  2XN9 C;  2LJI A;  2W55 A;  2WNM A;  1OQQ A;  4WIP A;  4DQO C;  3P4Q B;  2XNA C;  2IGG A;  3E56 A;  1ZDX A;  2CJN A;  4HJG E;  2WXQ A;  2KAJ A;  1VZ6 A;  4A9A A;  4YSY B;  5FK9 C;  5C2T B;  5EE0 A;  2DBY A;  1GT8 A;  1EM7 A;  3NVZ A;  1L6V A;  1H7X A;  2ZW1 A;  1F77 A;  1WWT A;  3VQI A;  2JYT A;  1D5X C;  3AE3 B;  1ENF A;  4FXC A;  1BXT A;  1TS3 A;  4WQM A;  1XCQ L;  2QIL A;  3VRA B;  1N5W A;  5HHD G;  4A90 A;  1JWM D;  3AEC B;  3LXF A;  3B2G A;  3ZJV A;  3AEF B;  3LYY A;  2EEL A;  2JWU A;  2QEJ C;  3P4S B;  1JQ4 A;  2V0G A;  1TY0 A;  1UNS A;  2W54 A;  2YEP B;  1B9R A;  4WWM A;  3W1S A;  3DWG C;  2VZK D;  4TQ1 A;  3P4R B;  4IDI A;  4GLS C;  4OZA A;  2X38 A;  2LGI A;  4CQN A;  1F0Z A;  1YNT E;  2V3N A;  2OHF A;  1L0V B;  1SE3 A;  3TEY A;  5BMG A;  1EWY C;  4Q2J A;  3R2T A;  2MJ3 A;  4IKG A;  2MH7 A;  2YEP F;  3AE8 B;  1FEH A;  1DGJ A;  1R7S A;  1GB1 A;  2IJ0 A;  2I2Y A;  1HEZ E;  2MEK A;  3U7Z A;  1XCT L;  4HRS A;  1QOA A;  1VDV A;  1SXT A;  2GI9 A;  2WXI A;  1XF5 L;  2WXJ A;  3Q8F A;  2L32 A;  5G5H A;  3AE7 B;  1I4X A;  1NEN B;  3IT6 B;  1YQ4 B;  3AEB B;  3TSS A;  4HEA 1;  2GRI A;  2WDQ B;  1D5M C;  2FBW B;  1FM0 D;  1XLO A;  2NTS A;  1RM6 C;  1SE2 A;  4ARI A;  4US9 A;  2WXF A;  4MH8 A;  3C8Y A;  1FCL A;  1ET6 A;  4KGT A;  2JX5 A;  1I4R A;  1NYR A;  1ZPS A;  4AQ7 A;  3NZ3 A;  1QLB B;  1FMA D;  2WXM A;  5H8Y E;  2ACZ B;  1KTK A;  3R8B A;  4UDU C;  5D7G A;  1XXG A;  4WUR A;  4RGM A;  1KF6 B;  1JW9 D;  5MPO A;  3BVM A;  3FIL B;  1C77 A;  4L1B A;  1C9F A;  4B0E A;  2ZW0 A;  2WP9 B;  2JQR B;  5BYQ A;  1JRP A;  1WRI A;  4KKI A;  3SR6 A;  4OHJ A;  1L4Z B;  2JYE A;  2BT6 A;  4LK0 M;  3Q8E A;  4GDL B;  1JML A;  4XWW A;  1IUE A;  3BVG A;  4LTU A;  1VZ7 A;  3ZYY X;  1TS4 A;  3AV8 A;  4P6V F;  4JWS C;  2WLB A;  1L0X B;  3BYT B;  1NYQ A;  3HVZ A;  1FNW A;  1H7W A;  1XO3 A;  4PT5 A;  4ZYS A;  4M0W A;  2INP E;  2G1E A;  2WU2 B;  5C3J B;  1ZOY B;  2L83 A;  3Q69 A;  4MM3 B;  1E0Z A;  4DXF A;  1CK1 A;  5FR3 A;  2W82 A;  4RCO A;  1FXA A;  2Y5P A;  2LUM A;  1E9M A;  1ZP0 B;  1I4H A;  1XLQ A;  4O1N A;  1XEE A;  1SE4 A;  5AUK A;  1D6E C;  3KQ4 A;  3Q8A A;  3NVY A;  1J7C A;  3ETR A;  4RF0 A;  1AN8 A;  1ZUD 2;  2QMT A;  2M56 B;  3CWI A;  5I4D A;  1ROE A;  2JSV X;  2CJO A;  1CQV A;  3ZJT A;  2PVG C;  1OFF A;  2AQ1 B;  2BBC A;  5JXV A;  2Z8L A;  1TYG B;  4JE3 B;  5LNK 1;  5G5G A;  3AE1 B;  1I7H A;  1I4P A;  5EE1 A;  1RFK A;  1V97 A;  2HTM E;  4JPS A;  4KGR A;  1Q10 A;  5BMI A;  2LFI A;  2DYO A;  4MT5 A;  3V3X A;  4YTM B;  1KLU D;  2WXL A;  1V8C A;  2R61 A;  2DLB A;  2BTE A;  1GOZ A;  2K3U A;  3E9S A;  3U2S C;  2WXK A;  2N0S B;  1JCK B;  4DXG A;  1MI0 A;  1SBB B;  2H88 B;  1N61 A;  4ZRP A;  1QIL A;  5HFY A;  1T5X D;  2AQ3 B;  3BYY B;  3IAS 1;  3FAH A;  2K9X A;  3EUB 2;  2SEB D;  4NJC A;  2N9L A;  3VR8 B;  3P42 A;  5AUI A;  3TUO A;  1SB3 C;  2Y3A A;  1PGB A;  1YJJ A;  3AEE B;  2KAC A;  2NTT A;  3IXS A;  2MJE A;  1Y56 A;  3O13 A;  1T6B X;  1A70 A;  4RNA A;  1JWB D;  3ZGZ A;  1P7F A;  5E6J A;  1NI3 A;  4YT0 B;  2QJL A;  1L0Y B;  2WS3 B;  3P4P B;  1TKE A;  4A55 A;  3SFE B;  2VZK B;  4A8X C;  4TMA B;  2PW9 A;  4L2Y A;  1FRR A;  3ZQ4 A;  2LHD A;  1JWU D;  3AE4 B;  1QOG A;  2M19 A;  1QOB A;  2ICI A;  4JX1 C;  2SAK A;  1P7E A;  3VRB B;  3U52 E;  3HUI A;  1BML C;  1DYQ A;  2WXN A;  2WXR A;  2WQY B;  3AE6 B;  1QKZ A;  3MC0 B;  2RDG A;  3SEB A;  1KLG D;  2IGD A;  1SJE D;  2WXP A;  4ZHP A;  3RPF C;  4XDD A;  1GB4 A;  4ZHO A;  1VRA B;  2M0A A;  3Q8C A;  5D3I B;  1K52 A;  1QT9 A;  3DWM A;  4RF1 A;  1IGD A;  1GPX A;  1J7B A;  2V3P A;  2FE8 A;  1N63 A;  2ON8 A;  4N59 A;  2K0P A;  1C4C A;  2H89 B;  1VZ8 A;  1UGJ A;  1IGC A;  4OW0 A;  3GB1 A;  4ARC A;  3P1M A;  3PO0 A;  3PZ8 A;  3H8H A;  2DWQ A;  4US8 A;  1F2R I;  1FFU A;  3N9Y C;  1FIQ A;  1JAL A;  2D5G A;  2JU6 X;  3KWV A;  2TSS A;  3L4P A;  1HQR D;  1C4A A;  4L23 A;  3R2I A;  5GXG B;  1B1Z A;  2PTL A;  1E7P B;  1STE A;  3URY A;  3IT4 B;  5EE9 A;  3KLS X;  4YXD B;  1DOI A;  2K5P A;  1D4B A;  3MJ5 A;  2B76 B;  5TSS A;  2RPV A;  1TKY A;  3V05 A;  1ZDV A;  2RMM A;  5FKA C;  4OZC A;  1PDX A;  1QQR A;  1TS5 A;  2FUG 1;  2Q5W D;  5T8I A;  1C79 A;  4RGT A;  3P63 A;  1CZP A;  4AS1 A;  1VLB A;  2W3R A;  1V1O A;  1WYG A;  3FIL A;  1GTH A;  4NAM A;  1SIJ A;  1IBX B;  1YN3 A;  3BII D;  1QOF A;  3WCQ A;  1L5P A;  1TY2 A;  2BB5 A;  1EU3 A;  1QF6 A;  1FNU A;  3AH7 A;  2MJD A;  3BWU D;  1MHX A;  4TQ0 A;  3EGR A;  2J4X A;  2WXH A;  4LLG M;  2J42 A;  1TS2 A;  4B0M A;  4C7Y A;  5HI1 A;  2DYM A;  4KGS A;  3TEX A;  3AE2 B;  1UUP A;  1FXI A;  1E10 A;  2E6X A;  2L52 A;  3EA6 A;  2BS4 B;  3LB8 C;  2QIE B;  3W9C B;  3RFZ B;  1V1P A;  3ZJU A;  1BUI C;  1ESF A;  3GS2 A;  3TEW A;  2I38 A;  1OQR A;  1TKG A;  4REZ A;  1PFD A;  1SF0 A;  1NVI D;  1FD6 A;  1PGA A;  3T3O A;  1TJE A;  3AB5 A;  4YSX B;  3I9V 1;  4HKQ A;  5BMH A;  1JWA D;  1YMH E;  1EU4 A;  3NUH B;  4YWG G;  1YN5 A;  3B2F A;  2ONQ A;  5EE3 A;  2KDM A;  3AE5 B;  4ZOH C;  1ZXH A;  4YTP B;  4IOI E;  2KWD A;  1AW7 A;  2EKI A;  1WSP A;  2J52 A;  3OWE B;  1LO5 D;  3GP7 A;  1XLP A;  2PKO A;  1HXY D;  3SFD B;  1JRO A;  2KQ4 X;  2BYT A;  2N9K A;  4OZB A;  2WXG A;  4MAC A;  1KH0 A;  2HDE A;  3T3N A;  2N7J A;  4RGN A;  1C4P A;  4N6E B;  2GB1 A;  1RWS A;  3U4E G;  4N58 A;  4EE2 A;  1DOX A;  4C80 A;  3NRZ A;  1GTE A;  1FFV A;  3AMZ A;  4WAF A;  5HG2 A;  4C56 C;  1DOY A;  1VJK A;  4J3O D;  2PVO D;  3AEA B;  3MP9 A;  1L4D B;  3TEZ A;  4RH6 A;  1FNV A;  2JXT A;  3Q8B A;  2INN E;  3BVZ A;  4WH4 A;  3HRD D;  3CF4 A;  4HKZ E;  2KMM A;  4HRO A;  4NAW B;  1KRH A;  1UWX A;  1J7A A;  1MVK A;  2BW2 A;  3ABV B;  2CU3 A;  2RDH A;  4KKJ A;  3CIR B;  1FRD A;  3MFG A;  1RYJ A;  1TZO A;  1E6E B;  1NEK B;  3PZ7 A;  4RGO S;  1XLN A;  4XE0 A;  4R3D A;  4TSS A;  1SEB D;  1D5Z C;  1JWS D;  2WU5 B;  1YQ3 B;  1ACC A;  1N60 A;  1CJE A;  1YN4 A;  4H2A A;  4XWT A;  1VR9 A;  2W3S A;  4ZRQ A;  1M4V A;  2BS3 B;  1N5X A;  3VR9 B;  2J53 A;  1EWC A;  1K51 A;  4NZL B;  3NS1 A;  4D2K A;  2AX5 A;  3AN1 A;  2K22 A;  5BYR A;  4C7Z A;  2WDV B;  1N62 A;  1SJH D;  1K53 A;  3BK2 A;  1F2R C;  3HVD A;  2LHE A;  3NVW A;  3UI3 A;  1K50 A;  2V4I B;  5D3D A;  1MHH E;  4USA A;  3NVV A;  3AM9 A;  1PUT A;  1ZXI A;  1C78 A;  2BS2 B;  3KWL A;  3BK1 A;  4YSZ B;  1I4Q A;  1YJI A;  5BYS A;  4P16 A;  1KFY B;  1T3Q A;  2PMV A;  4RFB A;  3W5V B;  3IAM 1;  4GDK B;  1HA5 A;  3BZD B;  4A6Q A;  2LEK A;  2PLP A;  1AWD A;  2WDR B;  3AEG B;  1FO4 A;  1PYW D;  2NMQ A;  1MPE A;  2G9H D;  1GAQ B;  2L1A A;  1V1P B;  4JWU C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...