4KX6B

Plasticity of the quinone-binding site of the complex ii homolog quinol:fumarate reductase
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
243
structure length
243
Chain Sequence
AEMKNLKIEVVRYNPEVDTAPHSAFYEVPYDATTSLLDALGYIKDNLAPDLSYRWSCRMAICGSCGMMVNNVPKLACKTFLRDYTDGMKVEALANFPIERDLVVDMTHFIESLEAIKPYIIGNSRTADQGTNIQTPAQMAKYHQFSGCINCGLCYAACPQFGLNPEFIGPAAITLAHRYNEDSRDHGKKERMAQLNSQNGVWSCTFVGYCSEVCPKHVDPAAAIQQGKVESSKDFLIATLKPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Fumarate reductase flavoprotein subunit
publication title Plasticity of the Quinone-binding Site of the Complex II Homolog Quinol:Fumarate Reductase.
pubmed doi rcsb
source organism Escherichia coli
total genus 66
structure length 243
sequence length 243
chains with identical sequence N
ec nomenclature
pdb deposition date 2013-05-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 4kx6B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4kx6B01
1V97A 1VLBA 1N61A 3L4PA 3LXFA 3DWGC 2CU3A 4N59A 1NI3A 1E0ZA 1N60A 1ZP0B 1JALA 1JROA 4LTUA 1SB3C 2H89B 2FBWB 3AE5B 1JRPA 1TJEA 2M19A 1QT9A 2CJNA 2W55A 1NENB 3CWIA 3AH7A 1T3QA 3ETRA 4JWUC 3W5UB 1L6VA 5AUIA 1FFUA 2LEKA 2Q5WD 2WQYB 3KWLA 5EE3A 4WQMA 1L5PA 1JQ4A 3CF4A 1NVID 3W5VB 3BIID 1V8CA 1WYGA 2WS3B 3AE1B 5H92C 1QLBB 3SFEB 1FXIA 4KX6B 2E3TA 3B2GA 3NVWA 3NS1A 3P4SB 5EE9A 1WWTA 3AE2B 1YQ3B 2PKOA 3AE9B 1ZUD2 3AV8A 3CIRB 3RPFC 1KF6B 1H7WA 1PFDA 2K9XA 2KAJA 1H7XA 3AEGB 4C7ZA 1N63A 1GT8A 5C3JB 2MJEA 2PVGC 2WLBA 3DWMA 4YSYB 3LB8C 3AE8B 3AB5A 1TKYA 1XO3A 4P6VF 3SR6A 4C80A 2WU2B 1RYJA 1PUTA 5G5HA 1RM6C 1TYGB 4JX1C 5GXGB 1E6EB 2BT6A 3EUB2 4ZHOA 2MH7A 2B76B 3HVZA 2DWQA 2QIEB 5MPOA 1DGJA 2W54A 1TKGA 3HRDD 4ZHPA 2N0SB 1KRHA 1E9MA 2JQRB 4HROA 3AECB 1JWBD 4N6EB 1FIQA 2L52A 1FRRA 2EKIA 2HTME 3SFDB 3FAHA 5H8YE 1E10A 3P63A 2W3SA 1N62A 3WCQA 1N5WA 3AE3B 3FC4A 2MJ3A 1N5XA 1YJIA 1L0VB 1EWYC 2KMMA 3HUIA 2Y5CA 3NVYA 1PDXA 1OQRA 4YSZB 1XLNA 2ACZB 1ROEA 1QOBA 2BS2B 3VR8B 1A70A 4FXCA 4IDIA 3NRZA 5AUKA 4ITKA 2CJOA 4A9AA 2BS3B 1CZPA 4YXDB 2WDRB 1GTEA 1NYQA 2WDQB 3AEAB 1TKEA 2JX5A 5G5GA 1AWDA 2QJLA 1B9RA 1ZXIA 3AM9A 1GTHA 1ZOYB 3AEFB 1FXAA 3AEDB 3P4QB 4YSXB 1NEKB 1FRDA 1WGKA 4C7YA 1F0ZA 1DOIA 1UWMA 4HRSA 1DOYA 3ABVB 2W3RA 4US8A 1FM0D 1WXQA 1GPXA 3AE7B 3P4RB 4N58A 4WWMA 2AX5A 1FO4A 1XLOA 3P4PB 4YTPB 5C2TB 1RFKA 2MJDA 1QOGA 3VRAB 2L83A 3VRBB 2PIAA 4YTNB 1AYFA 3NVZA 3P1MA 4YT0B 3PO0A 1QOAA 1OQQA 2BS4B 1L6UA 2M56B 1JWAD 1QOFA 2PVOD 3AN1A 1E7PB 1YQ4B 4US9A 4ZOHC 1XLQA 5EE1A 5EE0A 1YJJA 1RWSA 2H88B 1VJKA 3B9JA 2K5PA 1KFYB 1XLPA 3B2FA 4JWSC 3AE6B 1QF6A 3W9CB 1WRIA 1SIJA 1J7CA 1VDVA 1SF0A 1NYRA 1R7SA 3VR9B 1OFFA 3AEEB 2G1EA 3AE4B 1J7AA 3AMZA 2WDVB 1DOXA 2K22A 1JW9D 3ZYYX 1CJEA 1IUEA 2WU5B 3NVVA 4USAA 1FFVA 1I7HA 2OHFA 3AEBB 2DBYA 1GAQB 1FMAD 4YTMB 2WP9B 1J7BA
chains in the Genus database with same CATH superfamily
2WX0A 4LNFA 3DWGC 3KW5B 3TEZA 3PRMB 3RULA 4MGIE 4BBNC 3AH7A 3W5UB 3PZDA 4RFBA 3GZNB 3WAOA 5D94A 2IY1B 4MH8A 1I4GA 1XF5L 2XK5A 1FCLA 4LNKA 2KMCA 4BFRA 4K3CA 3AE9B 3E9SA 2R2QA 2OOBB 3MHSD 2GI9A 1U4AA 3SEBA 2BT6A 4ZHOA 2JZZA 4ACFA 3PRPB 3P63A 1Q5WB 3C19A 2M1MA 4TQ0A 1GB1A 1ET9A 1KLGD 4FJZA 2M4NA 2W82A 5D6JB 2D5GA 2IJ0A 1GC7A 4M0WA 1FRDA 1WGKA 2N7EA 2K0PA 3VVWB 4N9F4 1V49A 3A1QA 4TV3A 4PS8A 4WJPA 1XCQL 1OGWA 3A1QB 2L3ZA 3L13A 4XWWA 1M94A 3Q8BA 1QOFA 1VZ8A 3AN1A 4CO7A 5EE1A 3OAWA 3C0RB 4F8CB 4WJQA 3UGBB 3DCGA 1GB4A 2EMSA 3CMMB 5G2NA 1WR6E 2GBMA 4IM0A 1WE7A 1SXTA 1JW9D 1R4MB 4USAA 2FAZA 4GGQA 2LUMA 3KUZA 1VZ7A 1LO5D 1I4QA 2K3UA 1OEYA 1P7EA 5IKCM 3B0AA 3U8ZA 2ZNVC 2KC1A 2VH1A 3DBLI 4W9IA 2CU1A 3N20C 4IW0A 5I4DA 2INNE 1YIWA 3K9OB 3UIOB 2LUEA 2NBUA 1HZ6A 3GB1A 2BPSA 1V5OA 1WJUA 1DGJA 1QQRA 2GLSA 4K7WA 1KRHA 3K9PB 3T8MA 1YX5B 4AS1A 4AJWA 1N62A 2K6DB 4RF0A 1YN3A 3KQ4A 4YSZB 2PMVA 1XLNA 4KSLC 1ROEA 1D3ZA 1UNSA 3D32A 3WA0A 2BYEA 5CHVC 5IOIA 3VH3B 2GBRA 1C78A 4L1BA 5LNK1 3ZJTA 4HRSA 4WAAA 4US8A 1N6ZA 1IBXA 2FUHB 2WGSA 1WYWB 4BKGA 5C2TB 4GSWA 1WGYA 3Q14C 4NJ6A 2N9PC 4DHJD 2J52A 1C9FA 3PLUA 4CQNA 4PT5A 3B2FA 2KQSA 2EKEC 3X0WA 4C4VA 5FR3A 4AOFA 1NYRA 3KWVA 2J0JA 2JWUA 3GE3C 2BYTA 1UZXB 3VUYA 5L83A 2WXNA 2DBYA 3RNCC 3BYTB 4EKUA 1V97A 2YEPB 4W9DA 2IPKD 2G4DB 2DZIA 4DQOC 4II3B 3A9KA 1UGMA 3A9KB 2N1VA 1R4NI 4A90A 2I1JA 1TZOA 3KWLA 3CF4A 2JUOA 2PPHA 4RCOA 3B2GA 1K8RB 3P2BA 3P4SB 5EE9A 2MQJA 1UF0A 1Y8RC 2C60A 2KAJA 1MFWA 2N7JA 3VAWA 3DWMA 4KKJA 4LK0M 2WU2B 1WJ6A 2QDFA 4JX1C 3EUB2 4FULA 5DPTA 4GXBA 1F1HA 3N1XC 2KFKB 4ANXA 3HVDA 1FRRA 3SDLC 1KM7A 2PJHA 3V3XA 1PDXA 2ACZB 1EM7A 2KX3A 2PE9A 2L0FA 1RAXA 2X38A 3RI7C 4DK5A 1WJ4A 3OWEB 1ZXIA 3N30A 1T5XD 2KDIA 3DVNU 3QARA 4YSXB 1BMLC 3ABVB 5BYSA 3I63C 2DYOA 4WWMA 3NJTA 3BZDB 2G3QB 3QIJA 4NAMA 1QOGA 1WFYA 1OQQA 2G9HD 3QAQA 4ZOHC 1HQRD 2KDFB 2NTSA 1KLUD 3NUHB 2KJRA 3PTFC 3Q3OC 1SBBB 3ZGZA 4RMAA 2KKCA 1T6BX 3P42A 1TTNA 3PGEA 3Q8EA 5DCNA 3N1YC 1FFVA 4TQ1A 1EO6A 2SEBD 1V86A 1KOTA 4R3DA 2MCNB 2DYMA 3ENEA 3UQBA 3PV1A 4LTUA 1V9JA 3AE5B 4C00A 5AUIA 4DHZE 3SD5A 2LEKA 5EE3A 4RF1A 1E7VA 1ACCA 1E8WA 2V3SA 3R3MA 5C1ZA 4HPLB 1LGRA 3RT3B 3QK0A 5JHAA 2JF5A 1V6EA 2KMAA 3BK1A 1WRDB 1L4DB 2KYWA 2MLBA 2WXKA 5JHBA 2I1KA 3A4SC 4ARIA 1YN4A 2BGFA 3HVZA 2GRIA 2J53A 3IG3A 4FJVB 2CHZA 1EWYC 2V9HA 4TUUA 4PS7A 3KH0A 2KZRA 2PE6B 1L4ZB 1OEYJ 1H8CA 3R7RA 2G45B 3NRZA 4S17A 3DBRB 1GTEA 1V1PA 4LLGM 1V1PB 2MX2A 2IGHA 4EZKA 1NEKB 2DAFA 1I35A 2W3RA 5IP4D 3H7PA 3DBSA 3DDCB 1K51A 1P7FA 3H7PB 3VFKA 5IA7A 3Q3MC 3AULA 1CK1A 2TSSA 2QCZA 1XD3B 4GB9A 4LNIA 3IFWB 1YQ4B 3W2DA 5EE0A 3EHVA 4NPNA 2M17A 4GMVA 3WANA 1CQVA 4LNNA 2WXLA 1AW7A 1MHXA 4JWSC 2QILA 3AE6B 4ARCA 2D11A 1Z2MA 5LXHA 1MG8A 2L76A 1PGBA 2JPHA 1C76A 1V2YA 1WH3A 1IP9A 2L1AA 2WXPA 2MWSB 1GJZA 4ANWA 4KDLB 2RPQA 1HE8A 3RNGC 1N61A 4AUQC 3MTNB 4OW0A 1BUIC 3Q8CA 2H89B 2FBWB 1F77A 3PPAA 3VTVA 4P1CC 4HKQA 2IZVB 3TBLD 4XDCA 4WQMA 2WS3B 3NVWA 1YQBA 5CX3A 2DYBA 3RZFA 3OJ4B 4KKIA 4NJCA 4XZ4A 1C77A 2D07B 1TYGB 2D3GA 2B76B 2MSED 4ZHPA 4GLSC 3IAM1 5H8YE 2DZKA 5BMGA 2MJ3A 5HG2A 2KMMA 4P16A 2WNMA 3WIMA 1ZE3D 1NYQA 1V81A 3AXCA 3DVNV 3RNFC 1WZ0A 4MJSB 4B9KA 1WSPA 1UWMA 2FE8A 5IO9A 1I4RA 1WXQA 4DWFA 4JE3B 4URKA 3ZTCA 4W9EA 1WJNA 4II2B 5LXIB 1ZGUB 3APFA 3HM6X 1WX8A 1TT5B 3L16A 2K5PA 2CR5A 2NS5A 2LFIA 4HDOA 5DPSA 2N9KA 3AMZA 4M8NA 3AE4B 4W9JA 2R2OA 1IUEA 3HHMA 5D3DA 1WGRA 4BOSC 2I2YA 1I7HA 1NENB 1PGXA 2J4XA 3LJ3A 5JXVA 1K53A 3N9YC 5EDSA 1WM2A 3TCAA 4JIOU 3WAPA 1NI3A 4YWGG 1SSNA 2GMIC 2C7MB 3U52E 2O2VA 1JQ4A 3DBHB 3RMKC 3VXWA 2IO2B 2O2VB 4E3CA 4K7SA 3L08A 4I6NB 3UQAA 3HK0A 4LCDE 1J19A 1ESFA 4HVBA 3ML8A 3EECA 2REXA 4B6WA 4YL8A 1KF6B 4MM3A 1JWUD 4S0RA 2KJHB 3AE8B 4MH0E 4MM3B 1PUTA 4W9LA 1WMHA 1E6EB 3BVMA 4FHJA 3R7QA 1WM3A 2JYEA 2J42A 2JQRB 1JWBD 2V0GA 4N6EB 1E10A 3QA8A 2J7QB 2UYZB 1N5WA 1FCCC 2MBEA 1VD2A 2FUG1 2XK5B 3ALBA 1QOBA 5E6OA 1WXSA 2V3PA 1PGAA 1CZPA 4ASWC 5AZFA 1SJED 2JX5A 2RMMA 4XC2A 3TEXA 1F9JA 1E8XA 1ZKHA 1DOIA 3V6CB 4UDUC 3ZO5B 4JGHB 2K1FA 4ZYNA 3VHTC 1GPXA 3P4RB 1WX9A 1UWXA 2YVCA 4YT0B 3BINA 1VZ6A 3EC8A 3NZ3A 3QCAA 5FKAC 5DPWA 1UUPA 4EZLA 4I6PA 4NAWA 3NHEB 3B1LX 4M0WB 1YX6B 1E8YA 3VR9B 3AEEB 4HEA1 3EFUA 2DHZA 4FJYA 2M8SA 2OHFA 5J18A 3ZNHB 5E6PA 4WWNA 2BVCA 4XWTA 4G3XB 3MP9A 5HFYA 2WXHA 5BMHA 4ANUA 2JSVX 2CJNA 3ETRA 1M4VA 4MT5A 5T8IA 1EU3A 1HA5A 4RM9A 1QLBB 2WXFA 2Y5PA 3AV8A 2L00B 1AN8A 1H7XA 4KSKC 3Q8AA 2MJEA 4YSYB 1XO3A 2BWFA 3TMPB 4P7IA 1FPYA 4NZLB 3URYA 5GXGB 1IGDA 2MH7A 2DWQA 3HRDD 3M3JA 2HTME 3FAHA 2PTLA 2W3SA 3KVFB 1D4BA 2NCNA 2I38A 2JVCA 2C7NB 1Q10A 3PVLA 3RCZA 4A9AA 4A8XC 2QSDA 4NJ7A 4OVVA 2INDC 1SE2A 1ZDXA 3ZQ4A 5L95C 4OVUA 1WGDA 4Q2JA 2X8XX 2KDEB 4IC7B 1WR1A 1S1QB 2RR9A 3TJPA 4DHJB 5JZEB 2ON8A 2LJIA 1T0QC 2FCQA 3JSVA 3P1MA 2MBHA 2HJ8A 4JLCA 1QOAA 1E7PB 2AQ1B 1GG3A 1TIFA 2JWZA 3DBLB 3Q2AC 4I6LB 4HKZE 3BWUD 1J7CA 1SF0A 4A3PA 4MGZE 2BKRB 4NQKE 1CJEA 3WALA 3N1ZC 2C5LC 1CMXB 1GOZA 4KVGB 1IBXB 1GAQB 2D3BA 3R8BA 5HI1A 3ZXVA 3RFZB 1C4PA 2K8BA 2V3NA 4XX5A 1K50A 1ZDVA 4C4VB 4AP4C 4OZCA 2WHIA 5LLIA 4ICUA 4K3BA 1YN5A 1JWMD 1ISNA 1L2NA 1FNVA 2KD0A 4CHKA 3CSTA 1D5XC 1RM6C 1XQQA 1WGHA 3T3NA 3Q6BA 1T0YA 2N0SB 4G11A 3APDA 4B0EA 5AEKB 3PREA 3MFGA 3A9JA 1OQRA 3DPDA 2VRRB 4MEMA 2MBQA 2IO1B 1UBQA 1PYWD 4YXDB 4RNAA 4IM3A 2WDQB 1E8ZA 2KQ4X 3BYYB 2IGDA 4C7YA 3IVFA 2LWPA 3ZNID 3W1SA 2DX5B 1JCKB 1X1MA 3U2SC 2JY6A 3VUWA 2ZVOA 1MG4A 2L83A 3VRBB 2G4SA 5AZGA 4CYEA 1ET6A 1YJJA 3GP7A 2GB1A 2L05A 1R4NB 3QC8B 1KFYB 1WXAA 2INPE 3V6EB 2JRIB 1VDVA 2MHJA 3Q3NC 2HTHA 1AARA 1LFDA 4PYZA 2N9XA 2AQ3B 1YMHE 2V4LA 2D3CA 1HXYD 2AL6A 4MSMB 1V5TA 2CU3A 5BYQA 1ZP0B 1TJEA 2L8JA 2RDBC 2W55A 2QMTA 2Q5WD 3ZXRA 2B3AA 1L5PA 5IAAC 1TS3A 4MGKE 4OHJA 1EF5A 4KX6B 1VRAB 2YEPF 1WWTA 3DHHC 2Y5BB 3PT2B 1PQSA 3GS2A 2LHDA 1C79A 3AB5A 2BYVE 3HIZA 5G5HA 1J0GA 4PK1A 3X23A 3N3KB 3UINB 1YD8U 3O13A 5MPOA 2KWCA 3UIPB 3ZRFA 3TL5A 3QWZB 1WX7A 1FIQA 1XT9B 2A5UA 3NZUA 2BS2B 4BZAA 4FXCA 3SHQA 3H7SA 1TKEA 2ZJDA 3RNEC 2QC8A 3P4QB 3EA6A 1SIFA 4GDLA 2LMCA 4IUMB 1BXTA 4GDLB 3ZRCA 1DOYA 4BVUC 2DNFA 2L0TA 2LVQA 3R2IA 4A6QA 3PO0A 2KLCA 4ZYSA 3W1SC 4HWIB 2EMTA 2HDEA 1MVKA 1VCBA 2EELA 4US9A 3ML9A 3LYYA 4OZAA 3V05A 4O1NA 1WRIA 1SIJA 1YJ1A 2J0MA 5CTRC 2LGYA 4B0MA 1QZEA 1NDDA 4J6IA 3C8YA 3U4EG 1JWSD 2WP9B 1ZUD2 2LJ5A 3DVGY 4HK2A 4WJNA 4N59A 2K8CA 1MPEA 2LGDA 4RH6A 4C80A 3W1YA 1TBEA 2KFJA 2OJRA 4HPMB 1WZ3A 1TZ1A 4HLEA 2WXGA 1RRBA 2JXXA 3MHZA 2WXJA 3M63B 1PFDA 1EF1A 5DPRA 2D10A 3LB8C 1RYJA 4BKTA 3MC0B 4E71A 2MEKA 4W9FA 3QX1A 2FCSA 3EGRA 2JZ3B 3O65B 4HROA 4REZA 3PSEB 2L52A 1IYFA 1XXGA 4FA6A 5D2MB 2NMQA 4WH4A 3IT4B 4P1BC 4WQOB 3IAS1 2V4IB 3RNBC 2LZ6A 3IT6B 2NVUI 2RDGA 2CKHB 5C23A 1FXTB 2LHEA 3ECIA 2J0KA 4NNJB 3WAMA 3RUIB 3P4PB 2GOWA 2IY0B 4K1RB 3VRAB 4AQ7A 1UBIA 3OLMD 2PVOD 1RWSA 4HXDA 4IG7B 1BT0A 4NQLB 3W9CB 3A33B 2IBIB 2KT7A 2G1EA 1J7AA 1EWCA 3NVVA 2LGSA 1STEA 1LXDA 2LRUA 1FMAD 1WY8A 4MDKE 4WURA 4IWPA 1RLFA 3PHXB 2IDYA 3ZJUA 2AWTA 3JW0X 1JALA 3H1UA 3NOBA 3I3TB 3FKYA 4EFOA 3U7DA 2WWZA 4ZDVA 2D2QA 3TEWA 4JWUC 4FHKA 2HE7A 4DXFA 3BIID 1V8CA 1P0RA 5H92C 2ZW0A 2KWDA 3KUCB 1UH6A 1YQ3B 3RPFC 2MP2A 3AEGB 4GDKA 4ZRPA 4EEWA 1N63A 2BB6A 4GDKB 4IWQA 4WWOA 3NZSA 1WF9A 1GC6A 1OTRB 2LGXA 3GZNI 2M0AA 2K25A 2KDBA 1SE3A 2AL3A 3RYTA 3L10B 1YJIA 2KJ6A 2MA9B 2NBWB 1P9DU 1WXMA 4GU2A 4K81A 2FCMA 3H8HA 2KTFA 2NBVB 2WDRB 5G5GA 2HJ1A 3AM9A 1ZOYB 4TSSA 1WMHB 3KYCD 4JQWC 3VUXA 1TY0A 2WDTB 4J3OD 1FM0D 3VTWA 2O6VA 5KHOA 1P98A 2MW5A 1F2RC 2KTRA 2O6VB 1RFKA 3RD2A 2KTRB 3NVZA 2KQ7A 2R61A 1TS5A 2XNAC 1VJKA 3B9JA 2Z0EB 1Z5SB 1Y56A 4B95A 1R7SA 1DYQA 1OFFA 3NY5A 1HEZE 3DHGC 3AU5A 3PZ8A 4W9GA 4XGAB 1J7BA 1J8CA 4KZCA 2O6VD 2CHXA 4JL9A 2VZKB 3RZWC 1T0RC 4FADA 2LVPA 1JRPA 2M19A 2JXTA 2BBCA 1I4HA 1IGCA 4NAWB 3VDZA 4E74A 1V1OA 2DENB 1WIAA 3JYUA 1KH0A 5IN7A 1Q0WB 3W5VB 1TS2A 4HCNB 3AE1B 2LASA 1R4MI 2WXOA 4EE2A 3RN9C 1EUVB 3CIRB 4FN2A 3M95A 2PVGC 4C56C 3ZNZB 1TKYA 2Z8LA 5D7GA 1NI2A 2VZKD 2MRPA 3HM3A 5FR6A 4DDGD 3MJWA 1TKGA 1C3TA 5KHQA 1E9MA 3CSFA 3SFDB 2KNBA 3Q3JA 2KX0A 3CF6E 5GMVA 1L0VB 1SEBD 2PEAA 5AUKA 4ITKA 4IM2A 2KC2A 3ZKJC 3AEAB 1AWDA 2NTTA 1E5WA 4HJGE 3V62A 3H6NA 2UWQA 3A4RA 1VR9A 4KGTA 2IGGA 2BF8B 3OJ3A 1MHHE 4KZ0A 3NS8A 1A5RA 4YTPB 1UGJA 3U7ZA 4X57B 2PIAA 1TY2A 5BO4B 2BS4B 3TEYA 2WXMA 2LRWA 1XLQA 3I5JC 4F7ZA 1D5ZC 1XLPA 4XE0A 4K7UA 4A3OA 4IKGA 2WU5B 2KVRA 2LD9A 3Q69A 3AEBB 4LNOA 2LI5A 1OQYA 3JSVB 1E0ZA 4MSQB 1JROA 4ZRJA 3CWIA 2E6XA 2HD5B 1P1AA 3QJZA 4KGRA 4G50A 5AZHA 4KDIC 1EU4A 1L7YA 3SFEB 1L0YB 2LGIA 2KVZA 1P3QU 5CHFA 1WE6A 3QHTA 1FNWA 1YOVB 1I42A 4PS3A 4W9CA 4HDQA 4JPSA 4P6VF 3V60A 1K52A 2WXIA 3AI5A 4IWOA 5BYRA 1GUAB 3Q3FA 3BVZA 3UI3A 3DQVA 2INCC 3WCQA 2KN4A 3FC4A 4MGYE 3ZNGC 1N5XA 1QILA 4L2YA 3HUIA 4TMAB 1MI0A 1ENFA 4RGMA 2K39A 3T3OA 3ZIMA 1GNUA 2KDMA 2QJLA 1L0XB 3AEDB 4IOIE 1F0ZA 4XDDA 2QEJC 2WXQA 2KHWB 2KOXA 3ZJVA 1C4AA 2AX5A 3DHIC 3MC8A 4ICVA 3A9JB 3APCA 1WGGA 3I57A 2JZPA 2ONQA 2XN9C 2ZEQA 1G6JA 2KANA 2ZW1A 2N9LA 4ANVA 2YLMA 2WDVB 4OVZA 1DOXA 2Y3AA 4G0NB 3IXSA 1D6EC 2AEHA 1Q1OA 2C7HA 2KN5A 4LDTB 1VLBA 1E7UA 4F1SA 1C1YB 3LXFA 1F52A 3PHWB 1XEEA 1UD7A 5J2RA 4AWJA 1JMLA 2ZPNA 2KFKA 3TIXA 1T3QA 1D5MC 3I9V1 2QHOA 2FNJB 1I4XA 1WXVA 2DZMA 2E3TA 3NS1A 3DOWA 2DLBA 4MELA 4RGOS 4HCPB 4C7ZA 5C3JB 5E6JA 4XYCA 3EFCA 4LDTD 3E56A 2XBBC 3ZW3A 4DBGA 1SGHA 2W54A 2NR2A 4L23A 2CS4A 2GBJA 3AECB 2EKIA 2ZCCA 2V1YA 3VQIA 1FNUA 3IHPC 2Y5CA 2GBKA 4GN1A 5J17A 4IDIA 3ZTDA 2CJOA 4A55A 2PW9A 1QKZA 2IYDB 3MJ5A 1T0SC 2AQ2B 4BKSA 4HJKA 2M0XA 4LJOB 3R66C 3PZ7A 1FO4A 2MJDA 4YTNB 1AYFA 5E6NA 1LQBA 4WJOA 2BB5A 4TKNA 3DBRI 4M8MA 4BOZB 2H88B 2WX1A 4KV2A 4LJPB 4RGNA 2BYFA 4DXGA 2C9WB 5TSSA 4EZJA 5JH5C 2K22A 3V61A 3ZYYX 1KLVA 4HPPA 4BKSD 2WYQA 3ZLZA 4YTMB 1MJDA 3GOEA 5HKHA 4D2KA 1H4RA 4WAFA 1N60A 5CHWA 3B08A 1SB3C 3JVZX 1L6VA 1NBFC 2WQYB 3NG0A 3R2TA 4RGTA 1WYGA 3T9LA 2FIFA 2JU6X 3VH4B 1ZXHA 3AE2B 1ZW7A 2ICIA 2PKOA 2KO3A 3DVGX 2CHWA 1KTKA 1TGZB 2ZZPB 3KYDD 3FILA 3TSSA 4BAXA 3FILB 2JT4B 1JRUA 2RSUA 1IPGA 2K6QA 3M62B 3BVGA 1LM8B 3BY4B 2LVOA 4W9HA 4AJYB 1V80A 2IO3B 1RFAA 4DXAB 1A70A 3VR8B 4MACA 4KIKA 2ZPYA 1B1ZA 2BTEA 4KIKB 2OJWA 1HZ5A 3QQ8B 2RDHA 1B9RA 3OG5A 1GTHA 1FXAA 4RM8A 4W9KA 3TUOA 1F2RI 4DDID 3GE8C 4PYUA 3ONSA 2IO0B 4ZRQA 1XCTL 2LXCA 3RNAC 4N58A 2RPVA 2SAKA 5FK9C 1I4PA 2M56B 1L6UA 1JWAD 1KJTA 1SJHD 2Z0DB 2BW2A 1HTOA 2RGFA 4H2AA 3KLSX 5D3IB 4KGSA 3BK2A 1QF6A 3ZDMC 2W9NA 5BMIA 3Q8FA 4OZBA 1ZPSA 2KWUB 4WWPA 4FBJB 4ZRIA 4ZRKA 5G55A 3AU4A 1UELA 1HTQA 2XEWA 3VTUA 2KWVB 3L4PA 3L54A 1TS4A 3MC9A 2ZVNA 2LXAA 3J9CA 3LDZE 1QT9A 2MBBB 1FFUA 2BQQA 2VH2A 3ZDTA 1NVID 2KK8A 2UU7A 2N4FA 4FLHA 1FD6A 1FXIA 3L17A 2D3AA 2ZCBA 1WI0A 2K9XA 1H7WA 1E90A 1GT8A 2KXJA 2WLBA 3SR6A 1FEHA 4MJSA 2N1WA 3KUDB 2L32A 2K8HA 3L0WB 3DBHI 2QIEB 3SU8X 2FCNA 1SE4A 2DZJA 3ZUNA 4A20A 3IBEA 2JYTA 1SE9A 2JRHA 3AE3B 2GBNA 3NVYA 2MBOA 5HHDG 2AYOB 3PRZA 3U30A 2BS3B 2MP2B 4M02A 1C4CA 2BWES 3AEFB 4EOYA 2A4ZA 2KLGA 1S3SG 3ZVVA 4M00A 5TR5A 3AE7B 2BKFA 2KACA 2PLPA 4GIVA 4EUTA 2DAJA 2NPTA 1XLOA 2NPTB 2ASQA 3PLVA 2RD0A 4QAYA 3PS6A 4DHZB 3UF8A 1YNTE 2OEDA 4M01A 2WXRA 2Z59B 4GOCA 2N9EB 3S2AA 2N7DA 3H9DA 3N32A 4BBNF 2FIDA 2L7RA 4NY0A 2ZNVB 4WIPA
chains in the Genus database with same CATH topology
1N61A 3DWGC 4OW0A 2CU3A 3TEZA 1E0ZA 1BUIC 5BYQA 1ZP0B 1JROA 3Q8CA 2H89B 2FBWB 1TJEA 2E6XA 3CWIA 2W55A 1F77A 3AH7A 3W5UB 4RFBA 4HKQA 2QMTA 2Q5WD 4KGRA 4XDCA 4WQMA 1L5PA 4MH8A 1I4GA 1TS3A 1XF5L 2WS3B 1EU4A 4OHJA 3SFEB 4KX6B 1L0YB 2LGIA 1VRAB 2YEPF 3NVWA 1FCLA 1WWTA 3AE9B 3E9SA 3GS2A 2LHDA 1FNWA 1C79A 4KKIA 3AB5A 4NJCA 4JPSA 4P6VF 1C77A 2GI9A 5G5HA 1TYGB 3SEBA 2BT6A 1K52A 4ZHOA 2WXIA 2B76B 3O13A 5MPOA 5BYRA 4ZHPA 4GLSC 1FIQA 3BVZA 3UI3A 3IAM1 5H8YE 5BMGA 3P63A 3WCQA 2KN4A 3FC4A 2MJ3A 1N5XA 1QILA 4L2YA 2KMMA 3HUIA 5HG2A 4TMAB 4TQ0A 4P16A 1GB1A 1ET9A 2BS2B 1MI0A 2WNMA 4FXCA 1ENFA 1KLGD 4RGMA 1ZE3D 3T3OA 1NYQA 2W82A 2KDMA 1TKEA 2QJLA 2D5GA 1L0XB 2IJ0A 4M0WA 3AEDB 3P4QB 3EA6A 4IOIE 1FRDA 1WGKA 1F0ZA 2LMCA 1WSPA 2K0PA 4XDDA 1UWMA 2FE8A 1BXTA 2QEJC 4GDLB 1DOYA 2WXQA 1I4RA 1WXQA 4JE3B 3ZJVA 1C4AA 2AX5A 1XCQL 3R2IA 4A6QA 3PO0A 4ZYSA 4XWWA 3Q8BA 1QOFA 2HDEA 1VZ8A 1MVKA 2EELA 3AN1A 4US9A 5EE1A 3I57A 2JZPA 2ONQA 3LYYA 4OZAA 2XN9C 2K5PA 1GB4A 3V05A 4O1NA 2LFIA 1WRIA 1SIJA 2ZW1A 2N9KA 4B0MA 2N9LA 3AMZA 3AE4B 2WDVB 4OVZA 3C8YA 1SXTA 2Y3AA 3U4EG 1JW9D 3IXSA 1DOXA 1IUEA 4USAA 5D3DA 1D6EC 2I2YA 1I7HA 1JWSD 1NENB 1ZUD2 1PGXA 2WP9B 1VZ7A 1K53A 2J4XA 1LO5D 2LUMA 3N9YC 1VLBA 5JXVA 1I4QA 3LXFA 4N59A 1NI3A 2K3UA 1XEEA 1P7EA 1MPEA 4YWGG 4RH6A 1SSNA 3U52E 1JMLA 1JQ4A 4C80A 1T3QA 1D5MC 3I9V1 1I4XA 2WXGA 2E3TA 1ESFA 3NS1A 2DLBA 5I4DA 3MHZA 2WXJA 4RGOS 1KF6B 2INNE 1PFDA 4C7ZA 5C3JB 5E6JA 1JWUD 3LB8C 3AE8B 4MM3B 1RYJA 1PUTA 1E6EB 3E56A 3BVMA 3MC0B 1HZ6A 2MEKA 3GB1A 2JYEA 2J42A 1DGJA 1QQRA 2W54A 3EGRA 4L23A 1KRHA 2JQRB 4HROA 4REZA 3AECB 1JWBD 2V0GA 4N6EB 2L52A 2EKIA 4AS1A 1XXGA 1E10A 1N62A 1N5WA 1FCCC 3VQIA 1FNUA 4RF0A 1YN3A 2Y5CA 3KQ4A 2FUG1 4YSZB 2PMVA 1XLNA 2NMQA 1ROEA 1QOBA 4WH4A 4IDIA 2V3PA 1PGAA 1UNSA 2CJOA 1CZPA 3IT4B 3IAS1 2V4IB 1SJED 2JX5A 2RMMA 4A55A 1C78A 2PW9A 1QKZA 4L1BA 3TEXA 3IT6B 5LNK1 3MJ5A 2AQ2B 3ZJTA 1DOIA 2RDGA 4UDUC 4HRSA 4US8A 2LHEA 1GPXA 3P4RB 1IBXA 3PZ7A 1FO4A 1UWXA 3P4PB 5C2TB 2MJDA 3VRAB 4YTNB 1AYFA 4YT0B 2J52A 4AQ7A 1VZ6A 2BB5A 2PVOD 3NZ3A 1C9FA 5FKAC 1RWSA 1UUPA 4CQNA 2H88B 4PT5A 3B2FA 4RGNA 3W9CB 4DXGA 5FR3A 1NYRA 3VR9B 3KWVA 3AEEB 2G1EA 1J7AA 4HEA1 5TSSA 2JWUA 2K22A 1EWCA 3ZYYX 2BYTA 3NVVA 1STEA 2OHFA 2WXNA 2DBYA 3BYTB 1V97A 1FMAD 4YTMB 2YEPB 2IPKD 4WURA 4DQOC 4D2KA 4WAFA 2IDYA 4XWTA 3ZJUA 3MP9A 1N60A 1JALA 5HFYA 2WXHA 5BMHA 1SB3C 3TEWA 2JSVX 2CJNA 4JWUC 3ETRA 4A90A 1L6VA 1M4VA 4MT5A 1TZOA 2WQYB 3KWLA 4DXFA 5T8IA 1EU3A 3R2TA 3CF4A 4RGTA 3BIID 1V8CA 4RCOA 1WYGA 1HA5A 5H92C 2ZW0A 1QLBB 2KWDA 3B2GA 2WXFA 2JU6X 3P4SB 5EE9A 1ZXHA 2Y5PA 3AE2B 1YQ3B 2ICIA 2PKOA 3AV8A 3RPFC 1AN8A 2KAJA 1H7XA 3AEGB 4ZRPA 2N7JA 1N63A 2MJEA 3Q8AA 3DWMA 4KKJA 4YSYB 1KTKA 2BB6A 4GDKB 1XO3A 4LK0M 3FILA 2WU2B 3TSSA 4NZLB 3URYA 4JX1C 5GXGB 3FILB 3EUB2 1IGDA 2MH7A 2DWQA 3HRDD 3HVDA 2M0AA 3BVGA 1FRRA 2HTME 3FAHA 1SE3A 2PTLA 2W3SA 1D4BA 1YJIA 3V3XA 2I38A 1PDXA 2ACZB 1EM7A 1Q10A 1A70A 3VR8B 4MACA 3H8HA 4A9AA 2WDRB 4A8XC 1B1ZA 2QSDA 2X38A 2BTEA 3OWEB 5G5GA 1HZ5A 1B9RA 2RDHA 1ZXIA 3AM9A 1GTHA 1ZOYB 1FXAA 1T5XD 3TUOA 4TSSA 1F2RI 4YSXB 1SE2A 1ZDXA 3ZQ4A 1TY0A 1BMLC 3ABVB 5BYSA 4J3OD 2DYOA 1FM0D 4Q2JA 4WWMA 3BZDB 1F2RC 4ZRQA 4NAMA 1RFKA 2ON8A 1QOGA 1XCTL 2LJIA 4N58A 3NVZA 2RPVA 3P1MA 2SAKA 5FK9C 1I4PA 1QOAA 1OQQA 1L6UA 2M56B 1JWAD 2G9HD 2R61A 1E7PB 2AQ1B 4ZOHC 1SJHD 1HQRD 2NTSA 1KLUD 1TS5A 3NUHB 2XNAC 2BW2A 1VJKA 3B9JA 4H2AA 5D3IB 3KLSX 4KGSA 3BK2A 1QF6A 4HKZE 1Y56A 5BMIA 3BWUD 1J7CA 3Q8FA 1SF0A 1SBBB 1DYQA 1R7SA 1OFFA 4OZBA 1ZPSA 3ZGZA 1T6BX 3P42A 1CJEA 3Q8EA 1FFVA 4TQ1A 1GOZA 2SEBD 1IBXB 1GAQB 1HEZE 3PZ8A 1J7BA 4R3DA 3R8BA 5HI1A 3L4PA 1TS4A 2DYMA 2VZKB 4LTUA 3RFZB 3J9CA 1C4PA 3AE5B 1JRPA 2M19A 1QT9A 2JXTA 2BBCA 2V3NA 5AUIA 1I4HA 1FFUA 1IGCA 1K50A 2LEKA 4NAWB 1ZDVA 1V1OA 5EE3A 4RF1A 1KH0A 4OZCA 1NVID 1ACCA 3W5VB 1TS2A 3AE1B 1FD6A 1FXIA 2WXOA 1YN5A 4EE2A 1JWMD 3CIRB 2K9XA 1H7WA 2WLBA 1GT8A 1FNVA 2PVGC 3BK1A 4C56C 1D5XC 1TKYA 2Z8LA 5D7GA 1FEHA 3SR6A 1L4DB 1RM6C 2WXKA 3T3NA 2VZKD 2L32A 4ARIA 1YN4A 3HVZA 2QIEB 1TKGA 2N0SB 1E9MA 2GRIA 1SE4A 4B0EA 3SFDB 2J53A 2JYTA 3MFGA 3AE3B 3NVYA 1L0VB 1EWYC 1SEBD 5HHDG 1L4ZB 1OQRA 5AUKA 3NRZA 1PYWD 4ITKA 2BS3B 4YXDB 4RNAA 1GTEA 2WDQB 1V1PA 3AEAB 1C4CA 1AWDA 4LLGM 2KQ4X 1V1PB 2NTTA 3BYYB 3AEFB 4HJGE 2IGHA 1NEKB 2IGDA 4C7YA 1VR9A 4KGTA 2IGGA 3W1SA 2W3RA 1JCKB 3AE7B 2KACA 2PLPA 1MHHE 3U2SC 1XLOA 4YTPB 1K51A 1P7FA 1UGJA 3U7ZA 2L83A 2PIAA 3VRBB 1CK1A 1TY2A 2TSSA 2BS4B 3TEYA 2WXMA 1YQ4B 1XLQA 3W2DA 1ET6A 5EE0A 1YJJA 3GP7A 2GB1A 1CQVA 1D5ZC 2WXLA 1KFYB 1XLPA 1AW7A 1MHXA 1YNTE 4JWSC 2QILA 3AE6B 4XE0A 2OEDA 2INPE 4ARCA 1VDVA 2WXRA 1PGBA 1C76A 1YMHE 2AQ3B 4IKGA 2WU5B 2L1AA 2WXPA 3Q69A 3AEBB 1HXYD 4WIPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V97 A;  1VLB A;  1N61 A;  3L4P A;  3LXF A;  3DWG C;  2CU3 A;  4N59 A;  1NI3 A;  1E0Z A;  1N60 A;  1ZP0 B;  1JAL A;  1JRO A;  4LTU A;  1SB3 C;  2H89 B;  2FBW B;  3AE5 B;  1JRP A;  1TJE A;  2M19 A;  1QT9 A;  2CJN A;  2W55 A;  1NEN B;  3CWI A;  3AH7 A;  1T3Q A;  3ETR A;  4JWU C;  3W5U B;  1L6V A;  5AUI A;  1FFU A;  2LEK A;  2Q5W D;  2WQY B;  3KWL A;  5EE3 A;  4WQM A;  1L5P A;  1JQ4 A;  3CF4 A;  1NVI D;  3W5V B;  3BII D;  1V8C A;  1WYG A;  2WS3 B;  3AE1 B;  5H92 C;  1QLB B;  3SFE B;  1FXI A;  4KX6 B;  2E3T A;  3B2G A;  3NVW A;  3NS1 A;  3P4S B;  5EE9 A;  1WWT A;  3AE2 B;  1YQ3 B;  2PKO A;  3AE9 B;  1ZUD 2;  3AV8 A;  3CIR B;  3RPF C;  1KF6 B;  1H7W A;  1PFD A;  2K9X A;  2KAJ A;  1H7X A;  3AEG B;  4C7Z A;  1N63 A;  1GT8 A;  5C3J B;  2MJE A;  2PVG C;  2WLB A;  3DWM A;  4YSY B;  3LB8 C;  3AE8 B;  3AB5 A;  1TKY A;  1XO3 A;  4P6V F;  3SR6 A;  4C80 A;  2WU2 B;  1RYJ A;  1PUT A;  5G5H A;  1RM6 C;  1TYG B;  4JX1 C;  5GXG B;  1E6E B;  2BT6 A;  3EUB 2;  4ZHO A;  2MH7 A;  2B76 B;  3HVZ A;  2DWQ A;  2QIE B;  5MPO A;  1DGJ A;  2W54 A;  1TKG A;  3HRD D;  4ZHP A;  2N0S B;  1KRH A;  1E9M A;  2JQR B;  4HRO A;  3AEC B;  1JWB D;  4N6E B;  1FIQ A;  2L52 A;  1FRR A;  2EKI A;  2HTM E;  3SFD B;  3FAH A;  5H8Y E;  1E10 A;  3P63 A;  2W3S A;  1N62 A;  3WCQ A;  1N5W A;  3AE3 B;  3FC4 A;  2MJ3 A;  1N5X A;  1YJI A;  1L0V B;  1EWY C;  2KMM A;  3HUI A;  2Y5C A;  3NVY A;  1PDX A;  1OQR A;  4YSZ B;  1XLN A;  2ACZ B;  1ROE A;  1QOB A;  2BS2 B;  3VR8 B;  1A70 A;  4FXC A;  4IDI A;  3NRZ A;  5AUK A;  4ITK A;  2CJO A;  4A9A A;  2BS3 B;  1CZP A;  4YXD B;  2WDR B;  1GTE A;  1NYQ A;  2WDQ B;  3AEA B;  1TKE A;  2JX5 A;  5G5G A;  1AWD A;  2QJL A;  1B9R A;  1ZXI A;  3AM9 A;  1GTH A;  1ZOY B;  3AEF B;  1FXA A;  3AED B;  3P4Q B;  4YSX B;  1NEK B;  1FRD A;  1WGK A;  4C7Y A;  1F0Z A;  1DOI A;  1UWM A;  4HRS A;  1DOY A;  3ABV B;  2W3R A;  4US8 A;  1FM0 D;  1WXQ A;  1GPX A;  3AE7 B;  3P4R B;  4N58 A;  4WWM A;  2AX5 A;  1FO4 A;  1XLO A;  3P4P B;  4YTP B;  5C2T B;  1RFK A;  2MJD A;  1QOG A;  3VRA B;  2L83 A;  3VRB B;  2PIA A;  4YTN B;  1AYF A;  3NVZ A;  3P1M A;  4YT0 B;  3PO0 A;  1QOA A;  1OQQ A;  2BS4 B;  1L6U A;  2M56 B;  1JWA D;  1QOF A;  2PVO D;  3AN1 A;  1E7P B;  1YQ4 B;  4US9 A;  4ZOH C;  1XLQ A;  5EE1 A;  5EE0 A;  1YJJ A;  1RWS A;  2H88 B;  1VJK A;  3B9J A;  2K5P A;  1KFY B;  1XLP A;  3B2F A;  4JWS C;  3AE6 B;  1QF6 A;  3W9C B;  1WRI A;  1SIJ A;  1J7C A;  1VDV A;  1SF0 A;  1NYR A;  1R7S A;  3VR9 B;  1OFF A;  3AEE B;  2G1E A;  3AE4 B;  1J7A A;  3AMZ A;  2WDV B;  1DOX A;  2K22 A;  1JW9 D;  3ZYY X;  1CJE A;  1IUE A;  2WU5 B;  3NVV A;  4USA A;  1FFV A;  1I7H A;  2OHF A;  3AEB B;  2DBY A;  1GAQ B;  1FMA D;  4YTM B;  2WP9 B;  1J7B A; 
#chains in the Genus database with same CATH topology
 2WX0 A;  4LNF A;  3DWG C;  3KW5 B;  3TEZ A;  3PRM B;  3RUL A;  4MGI E;  4BBN C;  3AH7 A;  3W5U B;  3PZD A;  4RFB A;  3GZN B;  3WAO A;  5D94 A;  2IY1 B;  4MH8 A;  1I4G A;  1XF5 L;  2XK5 A;  1FCL A;  4LNK A;  2KMC A;  4BFR A;  4K3C A;  3AE9 B;  3E9S A;  2R2Q A;  2OOB B;  3MHS D;  2GI9 A;  1U4A A;  3SEB A;  2BT6 A;  4ZHO A;  2JZZ A;  4ACF A;  3PRP B;  3P63 A;  1Q5W B;  3C19 A;  2M1M A;  4TQ0 A;  1GB1 A;  1ET9 A;  1KLG D;  4FJZ A;  2M4N A;  2W82 A;  5D6J B;  2D5G A;  2IJ0 A;  1GC7 A;  4M0W A;  1FRD A;  1WGK A;  2N7E A;  2K0P A;  3VVW B;  4N9F 4;  1V49 A;  3A1Q A;  4TV3 A;  4PS8 A;  4WJP A;  1XCQ L;  1OGW A;  3A1Q B;  2L3Z A;  3L13 A;  4XWW A;  1M94 A;  3Q8B A;  1QOF A;  1VZ8 A;  3AN1 A;  4CO7 A;  5EE1 A;  3OAW A;  3C0R B;  4F8C B;  4WJQ A;  3UGB B;  3DCG A;  1GB4 A;  2EMS A;  3CMM B;  5G2N A;  1WR6 E;  2GBM A;  4IM0 A;  1WE7 A;  1SXT A;  1JW9 D;  1R4M B;  4USA A;  2FAZ A;  4GGQ A;  2LUM A;  3KUZ A;  1VZ7 A;  1LO5 D;  1I4Q A;  2K3U A;  1OEY A;  1P7E A;  5IKC M;  3B0A A;  3U8Z A;  2ZNV C;  2KC1 A;  2VH1 A;  3DBL I;  4W9I A;  2CU1 A;  3N20 C;  4IW0 A;  5I4D A;  2INN E;  1YIW A;  3K9O B;  3UIO B;  2LUE A;  2NBU A;  1HZ6 A;  3GB1 A;  2BPS A;  1V5O A;  1WJU A;  1DGJ A;  1QQR A;  2GLS A;  4K7W A;  1KRH A;  3K9P B;  3T8M A;  1YX5 B;  4AS1 A;  4AJW A;  1N62 A;  2K6D B;  4RF0 A;  1YN3 A;  3KQ4 A;  4YSZ B;  2PMV A;  1XLN A;  4KSL C;  1ROE A;  1D3Z A;  1UNS A;  3D32 A;  3WA0 A;  2BYE A;  5CHV C;  5IOI A;  3VH3 B;  2GBR A;  1C78 A;  4L1B A;  5LNK 1;  3ZJT A;  4HRS A;  4WAA A;  4US8 A;  1N6Z A;  1IBX A;  2FUH B;  2WGS A;  1WYW B;  4BKG A;  5C2T B;  4GSW A;  1WGY A;  3Q14 C;  4NJ6 A;  2N9P C;  4DHJ D;  2J52 A;  1C9F A;  3PLU A;  4CQN A;  4PT5 A;  3B2F A;  2KQS A;  2EKE C;  3X0W A;  4C4V A;  5FR3 A;  4AOF A;  1NYR A;  3KWV A;  2J0J A;  2JWU A;  3GE3 C;  2BYT A;  1UZX B;  3VUY A;  5L83 A;  2WXN A;  2DBY A;  3RNC C;  3BYT B;  4EKU A;  1V97 A;  2YEP B;  4W9D A;  2IPK D;  2G4D B;  2DZI A;  4DQO C;  4II3 B;  3A9K A;  1UGM A;  3A9K B;  2N1V A;  1R4N I;  4A90 A;  2I1J A;  1TZO A;  3KWL A;  3CF4 A;  2JUO A;  2PPH A;  4RCO A;  3B2G A;  1K8R B;  3P2B A;  3P4S B;  5EE9 A;  2MQJ A;  1UF0 A;  1Y8R C;  2C60 A;  2KAJ A;  1MFW A;  2N7J A;  3VAW A;  3DWM A;  4KKJ A;  4LK0 M;  2WU2 B;  1WJ6 A;  2QDF A;  4JX1 C;  3EUB 2;  4FUL A;  5DPT A;  4GXB A;  1F1H A;  3N1X C;  2KFK B;  4ANX A;  3HVD A;  1FRR A;  3SDL C;  1KM7 A;  2PJH A;  3V3X A;  1PDX A;  2ACZ B;  1EM7 A;  2KX3 A;  2PE9 A;  2L0F A;  1RAX A;  2X38 A;  3RI7 C;  4DK5 A;  1WJ4 A;  3OWE B;  1ZXI A;  3N30 A;  1T5X D;  2KDI A;  3DVN U;  3QAR A;  4YSX B;  1BML C;  3ABV B;  5BYS A;  3I63 C;  2DYO A;  4WWM A;  3NJT A;  3BZD B;  2G3Q B;  3QIJ A;  4NAM A;  1QOG A;  1WFY A;  1OQQ A;  2G9H D;  3QAQ A;  4ZOH C;  1HQR D;  2KDF B;  2NTS A;  1KLU D;  3NUH B;  2KJR A;  3PTF C;  3Q3O C;  1SBB B;  3ZGZ A;  4RMA A;  2KKC A;  1T6B X;  3P42 A;  1TTN A;  3PGE A;  3Q8E A;  5DCN A;  3N1Y C;  1FFV A;  4TQ1 A;  1EO6 A;  2SEB D;  1V86 A;  1KOT A;  4R3D A;  2MCN B;  2DYM A;  3ENE A;  3UQB A;  3PV1 A;  4LTU A;  1V9J A;  3AE5 B;  4C00 A;  5AUI A;  4DHZ E;  3SD5 A;  2LEK A;  5EE3 A;  4RF1 A;  1E7V A;  1ACC A;  1E8W A;  2V3S A;  3R3M A;  5C1Z A;  4HPL B;  1LGR A;  3RT3 B;  3QK0 A;  5JHA A;  2JF5 A;  1V6E A;  2KMA A;  3BK1 A;  1WRD B;  1L4D B;  2KYW A;  2MLB A;  2WXK A;  5JHB A;  2I1K A;  3A4S C;  4ARI A;  1YN4 A;  2BGF A;  3HVZ A;  2GRI A;  2J53 A;  3IG3 A;  4FJV B;  2CHZ A;  1EWY C;  2V9H A;  4TUU A;  4PS7 A;  3KH0 A;  2KZR A;  2PE6 B;  1L4Z B;  1OEY J;  1H8C A;  3R7R A;  2G45 B;  3NRZ A;  4S17 A;  3DBR B;  1GTE A;  1V1P A;  4LLG M;  1V1P B;  2MX2 A;  2IGH A;  4EZK A;  1NEK B;  2DAF A;  1I35 A;  2W3R A;  5IP4 D;  3H7P A;  3DBS A;  3DDC B;  1K51 A;  1P7F A;  3H7P B;  3VFK A;  5IA7 A;  3Q3M C;  3AUL A;  1CK1 A;  2TSS A;  2QCZ A;  1XD3 B;  4GB9 A;  4LNI A;  3IFW B;  1YQ4 B;  3W2D A;  5EE0 A;  3EHV A;  4NPN A;  2M17 A;  4GMV A;  3WAN A;  1CQV A;  4LNN A;  2WXL A;  1AW7 A;  1MHX A;  4JWS C;  2QIL A;  3AE6 B;  4ARC A;  2D11 A;  1Z2M A;  5LXH A;  1MG8 A;  2L76 A;  1PGB A;  2JPH A;  1C76 A;  1V2Y A;  1WH3 A;  1IP9 A;  2L1A A;  2WXP A;  2MWS B;  1GJZ A;  4ANW A;  4KDL B;  2RPQ A;  1HE8 A;  3RNG C;  1N61 A;  4AUQ C;  3MTN B;  4OW0 A;  1BUI C;  3Q8C A;  2H89 B;  2FBW B;  1F77 A;  3PPA A;  3VTV A;  4P1C C;  4HKQ A;  2IZV B;  3TBL D;  4XDC A;  4WQM A;  2WS3 B;  3NVW A;  1YQB A;  5CX3 A;  2DYB A;  3RZF A;  3OJ4 B;  4KKI A;  4NJC A;  4XZ4 A;  1C77 A;  2D07 B;  1TYG B;  2D3G A;  2B76 B;  2MSE D;  4ZHP A;  4GLS C;  3IAM 1;  5H8Y E;  2DZK A;  5BMG A;  2MJ3 A;  5HG2 A;  2KMM A;  4P16 A;  2WNM A;  3WIM A;  1ZE3 D;  1NYQ A;  1V81 A;  3AXC A;  3DVN V;  3RNF C;  1WZ0 A;  4MJS B;  4B9K A;  1WSP A;  1UWM A;  2FE8 A;  5IO9 A;  1I4R A;  1WXQ A;  4DWF A;  4JE3 B;  4URK A;  3ZTC A;  4W9E A;  1WJN A;  4II2 B;  5LXI B;  1ZGU B;  3APF A;  3HM6 X;  1WX8 A;  1TT5 B;  3L16 A;  2K5P A;  2CR5 A;  2NS5 A;  2LFI A;  4HDO A;  5DPS A;  2N9K A;  3AMZ A;  4M8N A;  3AE4 B;  4W9J A;  2R2O A;  1IUE A;  3HHM A;  5D3D A;  1WGR A;  4BOS C;  2I2Y A;  1I7H A;  1NEN B;  1PGX A;  2J4X A;  3LJ3 A;  5JXV A;  1K53 A;  3N9Y C;  5EDS A;  1WM2 A;  3TCA A;  4JIO U;  3WAP A;  1NI3 A;  4YWG G;  1SSN A;  2GMI C;  2C7M B;  3U52 E;  2O2V A;  1JQ4 A;  3DBH B;  3RMK C;  3VXW A;  2IO2 B;  2O2V B;  4E3C A;  4K7S A;  3L08 A;  4I6N B;  3UQA A;  3HK0 A;  4LCD E;  1J19 A;  1ESF A;  4HVB A;  3ML8 A;  3EEC A;  2REX A;  4B6W A;  4YL8 A;  1KF6 B;  4MM3 A;  1JWU D;  4S0R A;  2KJH B;  3AE8 B;  4MH0 E;  4MM3 B;  1PUT A;  4W9L A;  1WMH A;  1E6E B;  3BVM A;  4FHJ A;  3R7Q A;  1WM3 A;  2JYE A;  2J42 A;  2JQR B;  1JWB D;  2V0G A;  4N6E B;  1E10 A;  3QA8 A;  2J7Q B;  2UYZ B;  1N5W A;  1FCC C;  2MBE A;  1VD2 A;  2FUG 1;  2XK5 B;  3ALB A;  1QOB A;  5E6O A;  1WXS A;  2V3P A;  1PGA A;  1CZP A;  4ASW C;  5AZF A;  1SJE D;  2JX5 A;  2RMM A;  4XC2 A;  3TEX A;  1F9J A;  1E8X A;  1ZKH A;  1DOI A;  3V6C B;  4UDU C;  3ZO5 B;  4JGH B;  2K1F A;  4ZYN A;  3VHT C;  1GPX A;  3P4R B;  1WX9 A;  1UWX A;  2YVC A;  4YT0 B;  3BIN A;  1VZ6 A;  3EC8 A;  3NZ3 A;  3QCA A;  5FKA C;  5DPW A;  1UUP A;  4EZL A;  4I6P A;  4NAW A;  3NHE B;  3B1L X;  4M0W B;  1YX6 B;  1E8Y A;  3VR9 B;  3AEE B;  4HEA 1;  3EFU A;  2DHZ A;  4FJY A;  2M8S A;  2OHF A;  5J18 A;  3ZNH B;  5E6P A;  4WWN A;  2BVC A;  4XWT A;  4G3X B;  3MP9 A;  5HFY A;  2WXH A;  5BMH A;  4ANU A;  2JSV X;  2CJN A;  3ETR A;  1M4V A;  4MT5 A;  5T8I A;  1EU3 A;  1HA5 A;  4RM9 A;  1QLB B;  2WXF A;  2Y5P A;  3AV8 A;  2L00 B;  1AN8 A;  1H7X A;  4KSK C;  3Q8A A;  2MJE A;  4YSY B;  1XO3 A;  2BWF A;  3TMP B;  4P7I A;  1FPY A;  4NZL B;  3URY A;  5GXG B;  1IGD A;  2MH7 A;  2DWQ A;  3HRD D;  3M3J A;  2HTM E;  3FAH A;  2PTL A;  2W3S A;  3KVF B;  1D4B A;  2NCN A;  2I38 A;  2JVC A;  2C7N B;  1Q10 A;  3PVL A;  3RCZ A;  4A9A A;  4A8X C;  2QSD A;  4NJ7 A;  4OVV A;  2IND C;  1SE2 A;  1ZDX A;  3ZQ4 A;  5L95 C;  4OVU A;  1WGD A;  4Q2J A;  2X8X X;  2KDE B;  4IC7 B;  1WR1 A;  1S1Q B;  2RR9 A;  3TJP A;  4DHJ B;  5JZE B;  2ON8 A;  2LJI A;  1T0Q C;  2FCQ A;  3JSV A;  3P1M A;  2MBH A;  2HJ8 A;  4JLC A;  1QOA A;  1E7P B;  2AQ1 B;  1GG3 A;  1TIF A;  2JWZ A;  3DBL B;  3Q2A C;  4I6L B;  4HKZ E;  3BWU D;  1J7C A;  1SF0 A;  4A3P A;  4MGZ E;  2BKR B;  4NQK E;  1CJE A;  3WAL A;  3N1Z C;  2C5L C;  1CMX B;  1GOZ A;  4KVG B;  1IBX B;  1GAQ B;  2D3B A;  3R8B A;  5HI1 A;  3ZXV A;  3RFZ B;  1C4P A;  2K8B A;  2V3N A;  4XX5 A;  1K50 A;  1ZDV A;  4C4V B;  4AP4 C;  4OZC A;  2WHI A;  5LLI A;  4ICU A;  4K3B A;  1YN5 A;  1JWM D;  1ISN A;  1L2N A;  1FNV A;  2KD0 A;  4CHK A;  3CST A;  1D5X C;  1RM6 C;  1XQQ A;  1WGH A;  3T3N A;  3Q6B A;  1T0Y A;  2N0S B;  4G11 A;  3APD A;  4B0E A;  5AEK B;  3PRE A;  3MFG A;  3A9J A;  1OQR A;  3DPD A;  2VRR B;  4MEM A;  2MBQ A;  2IO1 B;  1UBQ A;  1PYW D;  4YXD B;  4RNA A;  4IM3 A;  2WDQ B;  1E8Z A;  2KQ4 X;  3BYY B;  2IGD A;  4C7Y A;  3IVF A;  2LWP A;  3ZNI D;  3W1S A;  2DX5 B;  1JCK B;  1X1M A;  3U2S C;  2JY6 A;  3VUW A;  2ZVO A;  1MG4 A;  2L83 A;  3VRB B;  2G4S A;  5AZG A;  4CYE A;  1ET6 A;  1YJJ A;  3GP7 A;  2GB1 A;  2L05 A;  1R4N B;  3QC8 B;  1KFY B;  1WXA A;  2INP E;  3V6E B;  2JRI B;  1VDV A;  2MHJ A;  3Q3N C;  2HTH A;  1AAR A;  1LFD A;  4PYZ A;  2N9X A;  2AQ3 B;  1YMH E;  2V4L A;  2D3C A;  1HXY D;  2AL6 A;  4MSM B;  1V5T A;  2CU3 A;  5BYQ A;  1ZP0 B;  1TJE A;  2L8J A;  2RDB C;  2W55 A;  2QMT A;  2Q5W D;  3ZXR A;  2B3A A;  1L5P A;  5IAA C;  1TS3 A;  4MGK E;  4OHJ A;  1EF5 A;  4KX6 B;  1VRA B;  2YEP F;  1WWT A;  3DHH C;  2Y5B B;  3PT2 B;  1PQS A;  3GS2 A;  2LHD A;  1C79 A;  3AB5 A;  2BYV E;  3HIZ A;  5G5H A;  1J0G A;  4PK1 A;  3X23 A;  3N3K B;  3UIN B;  1YD8 U;  3O13 A;  5MPO A;  2KWC A;  3UIP B;  3ZRF A;  3TL5 A;  3QWZ B;  1WX7 A;  1FIQ A;  1XT9 B;  2A5U A;  3NZU A;  2BS2 B;  4BZA A;  4FXC A;  3SHQ A;  3H7S A;  1TKE A;  2ZJD A;  3RNE C;  2QC8 A;  3P4Q B;  3EA6 A;  1SIF A;  4GDL A;  2LMC A;  4IUM B;  1BXT A;  4GDL B;  3ZRC A;  1DOY A;  4BVU C;  2DNF A;  2L0T A;  2LVQ A;  3R2I A;  4A6Q A;  3PO0 A;  2KLC A;  4ZYS A;  3W1S C;  4HWI B;  2EMT A;  2HDE A;  1MVK A;  1VCB A;  2EEL A;  4US9 A;  3ML9 A;  3LYY A;  4OZA A;  3V05 A;  4O1N A;  1WRI A;  1SIJ A;  1YJ1 A;  2J0M A;  5CTR C;  2LGY A;  4B0M A;  1QZE A;  1NDD A;  4J6I A;  3C8Y A;  3U4E G;  1JWS D;  2WP9 B;  1ZUD 2;  2LJ5 A;  3DVG Y;  4HK2 A;  4WJN A;  4N59 A;  2K8C A;  1MPE A;  2LGD A;  4RH6 A;  4C80 A;  3W1Y A;  1TBE A;  2KFJ A;  2OJR A;  4HPM B;  1WZ3 A;  1TZ1 A;  4HLE A;  2WXG A;  1RRB A;  2JXX A;  3MHZ A;  2WXJ A;  3M63 B;  1PFD A;  1EF1 A;  5DPR A;  2D10 A;  3LB8 C;  1RYJ A;  4BKT A;  3MC0 B;  4E71 A;  2MEK A;  4W9F A;  3QX1 A;  2FCS A;  3EGR A;  2JZ3 B;  3O65 B;  4HRO A;  4REZ A;  3PSE B;  2L52 A;  1IYF A;  1XXG A;  4FA6 A;  5D2M B;  2NMQ A;  4WH4 A;  3IT4 B;  4P1B C;  4WQO B;  3IAS 1;  2V4I B;  3RNB C;  2LZ6 A;  3IT6 B;  2NVU I;  2RDG A;  2CKH B;  5C23 A;  1FXT B;  2LHE A;  3ECI A;  2J0K A;  4NNJ B;  3WAM A;  3RUI B;  3P4P B;  2GOW A;  2IY0 B;  4K1R B;  3VRA B;  4AQ7 A;  1UBI A;  3OLM D;  2PVO D;  1RWS A;  4HXD A;  4IG7 B;  1BT0 A;  4NQL B;  3W9C B;  3A33 B;  2IBI B;  2KT7 A;  2G1E A;  1J7A A;  1EWC A;  3NVV A;  2LGS A;  1STE A;  1LXD A;  2LRU A;  1FMA D;  1WY8 A;  4MDK E;  4WUR A;  4IWP A;  1RLF A;  3PHX B;  2IDY A;  3ZJU A;  2AWT A;  3JW0 X;  1JAL A;  3H1U A;  3NOB A;  3I3T B;  3FKY A;  4EFO A;  3U7D A;  2WWZ A;  4ZDV A;  2D2Q A;  3TEW A;  4JWU C;  4FHK A;  2HE7 A;  4DXF A;  3BII D;  1V8C A;  1P0R A;  5H92 C;  2ZW0 A;  2KWD A;  3KUC B;  1UH6 A;  1YQ3 B;  3RPF C;  2MP2 A;  3AEG B;  4GDK A;  4ZRP A;  4EEW A;  1N63 A;  2BB6 A;  4GDK B;  4IWQ A;  4WWO A;  3NZS A;  1WF9 A;  1GC6 A;  1OTR B;  2LGX A;  3GZN I;  2M0A A;  2K25 A;  2KDB A;  1SE3 A;  2AL3 A;  3RYT A;  3L10 B;  1YJI A;  2KJ6 A;  2MA9 B;  2NBW B;  1P9D U;  1WXM A;  4GU2 A;  4K81 A;  2FCM A;  3H8H A;  2KTF A;  2NBV B;  2WDR B;  5G5G A;  2HJ1 A;  3AM9 A;  1ZOY B;  4TSS A;  1WMH B;  3KYC D;  4JQW C;  3VUX A;  1TY0 A;  2WDT B;  4J3O D;  1FM0 D;  3VTW A;  2O6V A;  5KHO A;  1P98 A;  2MW5 A;  1F2R C;  2KTR A;  2O6V B;  1RFK A;  3RD2 A;  2KTR B;  3NVZ A;  2KQ7 A;  2R61 A;  1TS5 A;  2XNA C;  1VJK A;  3B9J A;  2Z0E B;  1Z5S B;  1Y56 A;  4B95 A;  1R7S A;  1DYQ A;  1OFF A;  3NY5 A;  1HEZ E;  3DHG C;  3AU5 A;  3PZ8 A;  4W9G A;  4XGA B;  1J7B A;  1J8C A;  4KZC A;  2O6V D;  2CHX A;  4JL9 A;  2VZK B;  3RZW C;  1T0R C;  4FAD A;  2LVP A;  1JRP A;  2M19 A;  2JXT A;  2BBC A;  1I4H A;  1IGC A;  4NAW B;  3VDZ A;  4E74 A;  1V1O A;  2DEN B;  1WIA A;  3JYU A;  1KH0 A;  5IN7 A;  1Q0W B;  3W5V B;  1TS2 A;  4HCN B;  3AE1 B;  2LAS A;  1R4M I;  2WXO A;  4EE2 A;  3RN9 C;  1EUV B;  3CIR B;  4FN2 A;  3M95 A;  2PVG C;  4C56 C;  3ZNZ B;  1TKY A;  2Z8L A;  5D7G A;  1NI2 A;  2VZK D;  2MRP A;  3HM3 A;  5FR6 A;  4DDG D;  3MJW A;  1TKG A;  1C3T A;  5KHQ A;  1E9M A;  3CSF A;  3SFD B;  2KNB A;  3Q3J A;  2KX0 A;  3CF6 E;  5GMV A;  1L0V B;  1SEB D;  2PEA A;  5AUK A;  4ITK A;  4IM2 A;  2KC2 A;  3ZKJ C;  3AEA B;  1AWD A;  2NTT A;  1E5W A;  4HJG E;  3V62 A;  3H6N A;  2UWQ A;  3A4R A;  1VR9 A;  4KGT A;  2IGG A;  2BF8 B;  3OJ3 A;  1MHH E;  4KZ0 A;  3NS8 A;  1A5R A;  4YTP B;  1UGJ A;  3U7Z A;  4X57 B;  2PIA A;  1TY2 A;  5BO4 B;  2BS4 B;  3TEY A;  2WXM A;  2LRW A;  1XLQ A;  3I5J C;  4F7Z A;  1D5Z C;  1XLP A;  4XE0 A;  4K7U A;  4A3O A;  4IKG A;  2WU5 B;  2KVR A;  2LD9 A;  3Q69 A;  3AEB B;  4LNO A;  2LI5 A;  1OQY A;  3JSV B;  1E0Z A;  4MSQ B;  1JRO A;  4ZRJ A;  3CWI A;  2E6X A;  2HD5 B;  1P1A A;  3QJZ A;  4KGR A;  4G50 A;  5AZH A;  4KDI C;  1EU4 A;  1L7Y A;  3SFE B;  1L0Y B;  2LGI A;  2KVZ A;  1P3Q U;  5CHF A;  1WE6 A;  3QHT A;  1FNW A;  1YOV B;  1I42 A;  4PS3 A;  4W9C A;  4HDQ A;  4JPS A;  4P6V F;  3V60 A;  1K52 A;  2WXI A;  3AI5 A;  4IWO A;  5BYR A;  1GUA B;  3Q3F A;  3BVZ A;  3UI3 A;  3DQV A;  2INC C;  3WCQ A;  2KN4 A;  3FC4 A;  4MGY E;  3ZNG C;  1N5X A;  1QIL A;  4L2Y A;  3HUI A;  4TMA B;  1MI0 A;  1ENF A;  4RGM A;  2K39 A;  3T3O A;  3ZIM A;  1GNU A;  2KDM A;  2QJL A;  1L0X B;  3AED B;  4IOI E;  1F0Z A;  4XDD A;  2QEJ C;  2WXQ A;  2KHW B;  2KOX A;  3ZJV A;  1C4A A;  2AX5 A;  3DHI C;  3MC8 A;  4ICV A;  3A9J B;  3APC A;  1WGG A;  3I57 A;  2JZP A;  2ONQ A;  2XN9 C;  2ZEQ A;  1G6J A;  2KAN A;  2ZW1 A;  2N9L A;  4ANV A;  2YLM A;  2WDV B;  4OVZ A;  1DOX A;  2Y3A A;  4G0N B;  3IXS A;  1D6E C;  2AEH A;  1Q1O A;  2C7H A;  2KN5 A;  4LDT B;  1VLB A;  1E7U A;  4F1S A;  1C1Y B;  3LXF A;  1F52 A;  3PHW B;  1XEE A;  1UD7 A;  5J2R A;  4AWJ A;  1JML A;  2ZPN A;  2KFK A;  3TIX A;  1T3Q A;  1D5M C;  3I9V 1;  2QHO A;  2FNJ B;  1I4X A;  1WXV A;  2DZM A;  2E3T A;  3NS1 A;  3DOW A;  2DLB A;  4MEL A;  4RGO S;  4HCP B;  4C7Z A;  5C3J B;  5E6J A;  4XYC A;  3EFC A;  4LDT D;  3E56 A;  2XBB C;  3ZW3 A;  4DBG A;  1SGH A;  2W54 A;  2NR2 A;  4L23 A;  2CS4 A;  2GBJ A;  3AEC B;  2EKI A;  2ZCC A;  2V1Y A;  3VQI A;  1FNU A;  3IHP C;  2Y5C A;  2GBK A;  4GN1 A;  5J17 A;  4IDI A;  3ZTD A;  2CJO A;  4A55 A;  2PW9 A;  1QKZ A;  2IYD B;  3MJ5 A;  1T0S C;  2AQ2 B;  4BKS A;  4HJK A;  2M0X A;  4LJO B;  3R66 C;  3PZ7 A;  1FO4 A;  2MJD A;  4YTN B;  1AYF A;  5E6N A;  1LQB A;  4WJO A;  2BB5 A;  4TKN A;  3DBR I;  4M8M A;  4BOZ B;  2H88 B;  2WX1 A;  4KV2 A;  4LJP B;  4RGN A;  2BYF A;  4DXG A;  2C9W B;  5TSS A;  4EZJ A;  5JH5 C;  2K22 A;  3V61 A;  3ZYY X;  1KLV A;  4HPP A;  4BKS D;  2WYQ A;  3ZLZ A;  4YTM B;  1MJD A;  3GOE A;  5HKH A;  4D2K A;  1H4R A;  4WAF A;  1N60 A;  5CHW A;  3B08 A;  1SB3 C;  3JVZ X;  1L6V A;  1NBF C;  2WQY B;  3NG0 A;  3R2T A;  4RGT A;  1WYG A;  3T9L A;  2FIF A;  2JU6 X;  3VH4 B;  1ZXH A;  3AE2 B;  1ZW7 A;  2ICI A;  2PKO A;  2KO3 A;  3DVG X;  2CHW A;  1KTK A;  1TGZ B;  2ZZP B;  3KYD D;  3FIL A;  3TSS A;  4BAX A;  3FIL B;  2JT4 B;  1JRU A;  2RSU A;  1IPG A;  2K6Q A;  3M62 B;  3BVG A;  1LM8 B;  3BY4 B;  2LVO A;  4W9H A;  4AJY B;  1V80 A;  2IO3 B;  1RFA A;  4DXA B;  1A70 A;  3VR8 B;  4MAC A;  4KIK A;  2ZPY A;  1B1Z A;  2BTE A;  4KIK B;  2OJW A;  1HZ5 A;  3QQ8 B;  2RDH A;  1B9R A;  3OG5 A;  1GTH A;  1FXA A;  4RM8 A;  4W9K A;  3TUO A;  1F2R I;  4DDI D;  3GE8 C;  4PYU A;  3ONS A;  2IO0 B;  4ZRQ A;  1XCT L;  2LXC A;  3RNA C;  4N58 A;  2RPV A;  2SAK A;  5FK9 C;  1I4P A;  2M56 B;  1L6U A;  1JWA D;  1KJT A;  1SJH D;  2Z0D B;  2BW2 A;  1HTO A;  2RGF A;  4H2A A;  3KLS X;  5D3I B;  4KGS A;  3BK2 A;  1QF6 A;  3ZDM C;  2W9N A;  5BMI A;  3Q8F A;  4OZB A;  1ZPS A;  2KWU B;  4WWP A;  4FBJ B;  4ZRI A;  4ZRK A;  5G55 A;  3AU4 A;  1UEL A;  1HTQ A;  2XEW A;  3VTU A;  2KWV B;  3L4P A;  3L54 A;  1TS4 A;  3MC9 A;  2ZVN A;  2LXA A;  3J9C A;  3LDZ E;  1QT9 A;  2MBB B;  1FFU A;  2BQQ A;  2VH2 A;  3ZDT A;  1NVI D;  2KK8 A;  2UU7 A;  2N4F A;  4FLH A;  1FD6 A;  1FXI A;  3L17 A;  2D3A A;  2ZCB A;  1WI0 A;  2K9X A;  1H7W A;  1E90 A;  1GT8 A;  2KXJ A;  2WLB A;  3SR6 A;  1FEH A;  4MJS A;  2N1W A;  3KUD B;  2L32 A;  2K8H A;  3L0W B;  3DBH I;  2QIE B;  3SU8 X;  2FCN A;  1SE4 A;  2DZJ A;  3ZUN A;  4A20 A;  3IBE A;  2JYT A;  1SE9 A;  2JRH A;  3AE3 B;  2GBN A;  3NVY A;  2MBO A;  5HHD G;  2AYO B;  3PRZ A;  3U30 A;  2BS3 B;  2MP2 B;  4M02 A;  1C4C A;  2BWE S;  3AEF B;  4EOY A;  2A4Z A;  2KLG A;  1S3S G;  3ZVV A;  4M00 A;  5TR5 A;  3AE7 B;  2BKF A;  2KAC A;  2PLP A;  4GIV A;  4EUT A;  2DAJ A;  2NPT A;  1XLO A;  2NPT B;  2ASQ A;  3PLV A;  2RD0 A;  4QAY A;  3PS6 A;  4DHZ B;  3UF8 A;  1YNT E;  2OED A;  4M01 A;  2WXR A;  2Z59 B;  4GOC A;  2N9E B;  3S2A A;  2N7D A;  3H9D A;  3N32 A;  4BBN F;  2FID A;  2L7R A;  4NY0 A;  2ZNV B;  4WIP A; 
#chains in the Genus database with same CATH homology
 1N61 A;  3DWG C;  4OW0 A;  2CU3 A;  3TEZ A;  1E0Z A;  1BUI C;  5BYQ A;  1ZP0 B;  1JRO A;  3Q8C A;  2H89 B;  2FBW B;  1TJE A;  2E6X A;  3CWI A;  2W55 A;  1F77 A;  3AH7 A;  3W5U B;  4RFB A;  4HKQ A;  2QMT A;  2Q5W D;  4KGR A;  4XDC A;  4WQM A;  1L5P A;  4MH8 A;  1I4G A;  1TS3 A;  1XF5 L;  2WS3 B;  1EU4 A;  4OHJ A;  3SFE B;  4KX6 B;  1L0Y B;  2LGI A;  1VRA B;  2YEP F;  3NVW A;  1FCL A;  1WWT A;  3AE9 B;  3E9S A;  3GS2 A;  2LHD A;  1FNW A;  1C79 A;  4KKI A;  3AB5 A;  4NJC A;  4JPS A;  4P6V F;  1C77 A;  2GI9 A;  5G5H A;  1TYG B;  3SEB A;  2BT6 A;  1K52 A;  4ZHO A;  2WXI A;  2B76 B;  3O13 A;  5MPO A;  5BYR A;  4ZHP A;  4GLS C;  1FIQ A;  3BVZ A;  3UI3 A;  3IAM 1;  5H8Y E;  5BMG A;  3P63 A;  3WCQ A;  2KN4 A;  3FC4 A;  2MJ3 A;  1N5X A;  1QIL A;  4L2Y A;  2KMM A;  3HUI A;  5HG2 A;  4TMA B;  4TQ0 A;  4P16 A;  1GB1 A;  1ET9 A;  2BS2 B;  1MI0 A;  2WNM A;  4FXC A;  1ENF A;  1KLG D;  4RGM A;  1ZE3 D;  3T3O A;  1NYQ A;  2W82 A;  2KDM A;  1TKE A;  2QJL A;  2D5G A;  1L0X B;  2IJ0 A;  4M0W A;  3AED B;  3P4Q B;  3EA6 A;  4IOI E;  1FRD A;  1WGK A;  1F0Z A;  2LMC A;  1WSP A;  2K0P A;  4XDD A;  1UWM A;  2FE8 A;  1BXT A;  2QEJ C;  4GDL B;  1DOY A;  2WXQ A;  1I4R A;  1WXQ A;  4JE3 B;  3ZJV A;  1C4A A;  2AX5 A;  1XCQ L;  3R2I A;  4A6Q A;  3PO0 A;  4ZYS A;  4XWW A;  3Q8B A;  1QOF A;  2HDE A;  1VZ8 A;  1MVK A;  2EEL A;  3AN1 A;  4US9 A;  5EE1 A;  3I57 A;  2JZP A;  2ONQ A;  3LYY A;  4OZA A;  2XN9 C;  2K5P A;  1GB4 A;  3V05 A;  4O1N A;  2LFI A;  1WRI A;  1SIJ A;  2ZW1 A;  2N9K A;  4B0M A;  2N9L A;  3AMZ A;  3AE4 B;  2WDV B;  4OVZ A;  3C8Y A;  1SXT A;  2Y3A A;  3U4E G;  1JW9 D;  3IXS A;  1DOX A;  1IUE A;  4USA A;  5D3D A;  1D6E C;  2I2Y A;  1I7H A;  1JWS D;  1NEN B;  1ZUD 2;  1PGX A;  2WP9 B;  1VZ7 A;  1K53 A;  2J4X A;  1LO5 D;  2LUM A;  3N9Y C;  1VLB A;  5JXV A;  1I4Q A;  3LXF A;  4N59 A;  1NI3 A;  2K3U A;  1XEE A;  1P7E A;  1MPE A;  4YWG G;  4RH6 A;  1SSN A;  3U52 E;  1JML A;  1JQ4 A;  4C80 A;  1T3Q A;  1D5M C;  3I9V 1;  1I4X A;  2WXG A;  2E3T A;  1ESF A;  3NS1 A;  2DLB A;  5I4D A;  3MHZ A;  2WXJ A;  4RGO S;  1KF6 B;  2INN E;  1PFD A;  4C7Z A;  5C3J B;  5E6J A;  1JWU D;  3LB8 C;  3AE8 B;  4MM3 B;  1RYJ A;  1PUT A;  1E6E B;  3E56 A;  3BVM A;  3MC0 B;  1HZ6 A;  2MEK A;  3GB1 A;  2JYE A;  2J42 A;  1DGJ A;  1QQR A;  2W54 A;  3EGR A;  4L23 A;  1KRH A;  2JQR B;  4HRO A;  4REZ A;  3AEC B;  1JWB D;  2V0G A;  4N6E B;  2L52 A;  2EKI A;  4AS1 A;  1XXG A;  1E10 A;  1N62 A;  1N5W A;  1FCC C;  3VQI A;  1FNU A;  4RF0 A;  1YN3 A;  2Y5C A;  3KQ4 A;  2FUG 1;  4YSZ B;  2PMV A;  1XLN A;  2NMQ A;  1ROE A;  1QOB A;  4WH4 A;  4IDI A;  2V3P A;  1PGA A;  1UNS A;  2CJO A;  1CZP A;  3IT4 B;  3IAS 1;  2V4I B;  1SJE D;  2JX5 A;  2RMM A;  4A55 A;  1C78 A;  2PW9 A;  1QKZ A;  4L1B A;  3TEX A;  3IT6 B;  5LNK 1;  3MJ5 A;  2AQ2 B;  3ZJT A;  1DOI A;  2RDG A;  4UDU C;  4HRS A;  4US8 A;  2LHE A;  1GPX A;  3P4R B;  1IBX A;  3PZ7 A;  1FO4 A;  1UWX A;  3P4P B;  5C2T B;  2MJD A;  3VRA B;  4YTN B;  1AYF A;  4YT0 B;  2J52 A;  4AQ7 A;  1VZ6 A;  2BB5 A;  2PVO D;  3NZ3 A;  1C9F A;  5FKA C;  1RWS A;  1UUP A;  4CQN A;  2H88 B;  4PT5 A;  3B2F A;  4RGN A;  3W9C B;  4DXG A;  5FR3 A;  1NYR A;  3VR9 B;  3KWV A;  3AEE B;  2G1E A;  1J7A A;  4HEA 1;  5TSS A;  2JWU A;  2K22 A;  1EWC A;  3ZYY X;  2BYT A;  3NVV A;  1STE A;  2OHF A;  2WXN A;  2DBY A;  3BYT B;  1V97 A;  1FMA D;  4YTM B;  2YEP B;  2IPK D;  4WUR A;  4DQO C;  4D2K A;  4WAF A;  2IDY A;  4XWT A;  3ZJU A;  3MP9 A;  1N60 A;  1JAL A;  5HFY A;  2WXH A;  5BMH A;  1SB3 C;  3TEW A;  2JSV X;  2CJN A;  4JWU C;  3ETR A;  4A90 A;  1L6V A;  1M4V A;  4MT5 A;  1TZO A;  2WQY B;  3KWL A;  4DXF A;  5T8I A;  1EU3 A;  3R2T A;  3CF4 A;  4RGT A;  3BII D;  1V8C A;  4RCO A;  1WYG A;  1HA5 A;  5H92 C;  2ZW0 A;  1QLB B;  2KWD A;  3B2G A;  2WXF A;  2JU6 X;  3P4S B;  5EE9 A;  1ZXH A;  2Y5P A;  3AE2 B;  1YQ3 B;  2ICI A;  2PKO A;  3AV8 A;  3RPF C;  1AN8 A;  2KAJ A;  1H7X A;  3AEG B;  4ZRP A;  2N7J A;  1N63 A;  2MJE A;  3Q8A A;  3DWM A;  4KKJ A;  4YSY B;  1KTK A;  2BB6 A;  4GDK B;  1XO3 A;  4LK0 M;  3FIL A;  2WU2 B;  3TSS A;  4NZL B;  3URY A;  4JX1 C;  5GXG B;  3FIL B;  3EUB 2;  1IGD A;  2MH7 A;  2DWQ A;  3HRD D;  3HVD A;  2M0A A;  3BVG A;  1FRR A;  2HTM E;  3FAH A;  1SE3 A;  2PTL A;  2W3S A;  1D4B A;  1YJI A;  3V3X A;  2I38 A;  1PDX A;  2ACZ B;  1EM7 A;  1Q10 A;  1A70 A;  3VR8 B;  4MAC A;  3H8H A;  4A9A A;  2WDR B;  4A8X C;  1B1Z A;  2QSD A;  2X38 A;  2BTE A;  3OWE B;  5G5G A;  1HZ5 A;  1B9R A;  2RDH A;  1ZXI A;  3AM9 A;  1GTH A;  1ZOY B;  1FXA A;  1T5X D;  3TUO A;  4TSS A;  1F2R I;  4YSX B;  1SE2 A;  1ZDX A;  3ZQ4 A;  1TY0 A;  1BML C;  3ABV B;  5BYS A;  4J3O D;  2DYO A;  1FM0 D;  4Q2J A;  4WWM A;  3BZD B;  1F2R C;  4ZRQ A;  4NAM A;  1RFK A;  2ON8 A;  1QOG A;  1XCT L;  2LJI A;  4N58 A;  3NVZ A;  2RPV A;  3P1M A;  2SAK A;  5FK9 C;  1I4P A;  1QOA A;  1OQQ A;  1L6U A;  2M56 B;  1JWA D;  2G9H D;  2R61 A;  1E7P B;  2AQ1 B;  4ZOH C;  1SJH D;  1HQR D;  2NTS A;  1KLU D;  1TS5 A;  3NUH B;  2XNA C;  2BW2 A;  1VJK A;  3B9J A;  4H2A A;  5D3I B;  3KLS X;  4KGS A;  3BK2 A;  1QF6 A;  4HKZ E;  1Y56 A;  5BMI A;  3BWU D;  1J7C A;  3Q8F A;  1SF0 A;  1SBB B;  1DYQ A;  1R7S A;  1OFF A;  4OZB A;  1ZPS A;  3ZGZ A;  1T6B X;  3P42 A;  1CJE A;  3Q8E A;  1FFV A;  4TQ1 A;  1GOZ A;  2SEB D;  1IBX B;  1GAQ B;  1HEZ E;  3PZ8 A;  1J7B A;  4R3D A;  3R8B A;  5HI1 A;  3L4P A;  1TS4 A;  2DYM A;  2VZK B;  4LTU A;  3RFZ B;  3J9C A;  1C4P A;  3AE5 B;  1JRP A;  2M19 A;  1QT9 A;  2JXT A;  2BBC A;  2V3N A;  5AUI A;  1I4H A;  1FFU A;  1IGC A;  1K50 A;  2LEK A;  4NAW B;  1ZDV A;  1V1O A;  5EE3 A;  4RF1 A;  1KH0 A;  4OZC A;  1NVI D;  1ACC A;  3W5V B;  1TS2 A;  3AE1 B;  1FD6 A;  1FXI A;  2WXO A;  1YN5 A;  4EE2 A;  1JWM D;  3CIR B;  2K9X A;  1H7W A;  2WLB A;  1GT8 A;  1FNV A;  2PVG C;  3BK1 A;  4C56 C;  1D5X C;  1TKY A;  2Z8L A;  5D7G A;  1FEH A;  3SR6 A;  1L4D B;  1RM6 C;  2WXK A;  3T3N A;  2VZK D;  2L32 A;  4ARI A;  1YN4 A;  3HVZ A;  2QIE B;  1TKG A;  2N0S B;  1E9M A;  2GRI A;  1SE4 A;  4B0E A;  3SFD B;  2J53 A;  2JYT A;  3MFG A;  3AE3 B;  3NVY A;  1L0V B;  1EWY C;  1SEB D;  5HHD G;  1L4Z B;  1OQR A;  5AUK A;  3NRZ A;  1PYW D;  4ITK A;  2BS3 B;  4YXD B;  4RNA A;  1GTE A;  2WDQ B;  1V1P A;  3AEA B;  1C4C A;  1AWD A;  4LLG M;  2KQ4 X;  1V1P B;  2NTT A;  3BYY B;  3AEF B;  4HJG E;  2IGH A;  1NEK B;  2IGD A;  4C7Y A;  1VR9 A;  4KGT A;  2IGG A;  3W1S A;  2W3R A;  1JCK B;  3AE7 B;  2KAC A;  2PLP A;  1MHH E;  3U2S C;  1XLO A;  4YTP B;  1K51 A;  1P7F A;  1UGJ A;  3U7Z A;  2L83 A;  2PIA A;  3VRB B;  1CK1 A;  1TY2 A;  2TSS A;  2BS4 B;  3TEY A;  2WXM A;  1YQ4 B;  1XLQ A;  3W2D A;  1ET6 A;  5EE0 A;  1YJJ A;  3GP7 A;  2GB1 A;  1CQV A;  1D5Z C;  2WXL A;  1KFY B;  1XLP A;  1AW7 A;  1MHX A;  1YNT E;  4JWS C;  2QIL A;  3AE6 B;  4XE0 A;  2OED A;  2INP E;  4ARC A;  1VDV A;  2WXR A;  1PGB A;  1C76 A;  1YMH E;  2AQ3 B;  4IKG A;  2WU5 B;  2L1A A;  2WXP A;  3Q69 A;  3AEB B;  1HXY D;  4WIP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...