4KX6B

Plasticity of the quinone-binding site of the complex ii homolog quinol:fumarate reductase
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
243
structure length
243
Chain Sequence
b'AEMKNLKIEVVRYNPEVDTAPHSAFYEVPYDATTSLLDALGYIKDNLAPDLSYRWSCRMAICGSCGMMVNNVPKLACKTFLRDYTDGMKVEALANFPIERDLVVDMTHFIESLEAIKPYIIGNSRTADQGTNIQTPAQMAKYHQFSGCINCGLCYAACPQFGLNPEFIGPAAITLAHRYNEDSRDHGKKERMAQLNSQNGVWSCTFVGYCSEVCPKHVDPAAAIQQGKVESSKDFLIATLKPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fumarate reductase flavoprotein subunit
publication title Plasticity of the Quinone-binding Site of the Complex II Homolog Quinol:Fumarate Reductase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 66
structure length 243
sequence length 243
chains with identical sequence N
ec nomenclature
pdb deposition date 2013-05-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 4kx6B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4kx6B01
1TKGA 2MJ3A 2WDRB 1JROA 1IUEA 3NRZA 2AX5A 1N5WA 3DWMA 3W9CB 1E10A 2PKOA 1FRRA 1RWSA 2WU2B 5EE1A 1L5PA 4JX1C 4WQMA 3LB8C 4LTUA 1E6EB 1QOBA 1VLBA 1XLOA 5AUKA 4C7YA 2Q5WD 1ZOYB 1R7SA 1CZPA 1QF6A 3HRDD 4ZOHC 1JALA 1GT8A 5H8YE 4JWUC 1GTEA 2DWQA 4YTMB 1NEKB 3VRBB 1FRDA 2BS4B 3B2GA 1DOIA 1A70A 1E0ZA 1TYGB 3KWLA 4C7ZA 2H89B 3AEEB 2LEKA 3B2FA 3W5VB 2BS3B 3HUIA 5GXGB 2MJDA 4HRSA 1DOYA 2K9XA 3VR8B 2WU5B 2L52A 2MH7A 2E3TA 1J7BA 4YTPB 1WRIA 4HROA 2W3RA 3NVYA 3NVZA 1J7AA 1GPXA 4YT0B 1ZUD2 4N59A 4USAA 4YSXB 2FBWB 1CJEA 2WS3B 1OFFA 1JRPA 1V97A 1XLQA 3AE8B 2WP9B 1H7WA 1FM0D 5EE0A 5EE3A 5H92C 2JX5A 1N61A 3AE1B 1N62A 2N0SB 1VJKA 5C2TB 3AE2B 3AE9B 4YTNB 1KFYB 1GTHA 1FMAD 2M19A 2QIEB 3AV8A 3NVWA 1QLBB 3VRAB 3AE5B 1VDVA 3AB5A 4WWMA 5EE9A 1RFKA 3AE4B 3SFEB 1NYQA 1OQRA 2QJLA 3FC4A 1J7CA 1OQQA 3P63A 4C80A 4US9A 2K22A 1YQ3B 2BS2B 1QOFA 3AE7B 3RPFC 3SR6A 1WXQA 2HTME 1NENB 1ZXIA 2W3SA 2M56B 3AN1A 3AEGB 1JWAD 1F0ZA 1AWDA 1B9RA 3CIRB 4FXCA 3AE3B 1KRHA 1FIQA 2K5PA 1FXAA 1NI3A 2W54A 3HVZA 1RM6C 3B9JA 1YJJA 2B76B 4US8A 3AH7A 4ZHPA 3FAHA 3CWIA 2H88B 1ZP0B 3SFDB 3AEFB 3L4PA 3P1MA 4ITKA 4YSYB 1QOAA 3W5UB 3VR9B 3ZYYX 3P4SB 2KAJA 1JWBD 1YJIA 3PO0A 3LXFA 1SB3C 1T3QA 3P4RB 3DWGC 1XLNA 2ACZB 1TKYA 3EUB2 1NVID 3BIID 1SF0A 1QOGA 1N5XA 2WLBA 1DGJA 4KX6B 2CJOA 5AUIA 1UWMA 3WCQA 1WGKA 3AM9A 2WDQB 3AEAB 3AECB 4N58A 2CU3A 4A9AA 1FFUA 1KF6B 1QT9A 2JQRB 1YQ4B 2L83A 3AMZA 4N6EB 1E9MA 2WQYB 1L6UA 2PVGC 5G5GA 1RYJA 1TJEA 3ETRA 2DBYA 1PFDA 2MJEA 1ROEA 1PDXA 2EKIA 3AEDB 1SIJA 1FXIA 1WWTA 1EWYC 4P6VF 4JWSC 1L0VB 1N60A 1WYGA 2PIAA 4ZHOA 2PVOD 4YSZB 1NYRA 1V8CA 1H7XA 3AE6B 2WDVB 1XLPA 3CF4A 1I7HA 2KMMA 2OHFA 1FO4A 1TKEA 3ABVB 1JW9D 1E7PB 1GAQB 1L6VA 1N63A 5MPOA 1JQ4A 3P4QB 5G5HA 1PUTA 2CJNA 4IDIA 3NVVA 3AEBB 1XO3A 4YXDB 2W55A 3P4PB 2G1EA 3NS1A 1DOXA 5C3JB 1FFVA 2Y5CA 2BT6A 1AYFA
chains in the Genus database with same CATH superfamily
3L13A 1GUAB 4BKTA 3LB8C 1Q5WB 1WE6A 2JT4B 1R7SA 2D07B 3MC9A 2KDIA 3DBLB 3KWLA 4LNNA 3PGEA 2G4DB 2CHWA 4DK5A 2O6VD 1EO6A 2IY0B 1Q1OA 2QILA 1OGWA 3KVFB 3GE3C 2WS3B 4MELA 3RUIB 4EUTA 1UZXB 4J3OD 4AWJA 2XK5B 1ZDVA 4GU2A 2UWQA 4II3B 2EELA 3Q8AA 1F1HA 1K50A 3AB5A 5E6PA 4E74A 5C1ZA 3A33B 2L7RA 2IO2B 3V60A 4GDKB 2JSVX 1WXQA 4Q2JA 1WX8A 3HM6X 3AN1A 1V5TA 2PW9A 2HTHA 1WR6E 1FNWA 3PZ8A 1AW7A 3L4PA 4ITKA 4GIVA 3DDCB 4DDID 5CX3A 3DWGC 1XLNA 1ZE3D 5J18A 1TKYA 1IGDA 4OVVA 2LGXA 2KJ6A 1GB4A 5DCNA 2L83A 4N6EB 1JCKB 3PHWB 3ZXVA 1ROEA 2KN5A 3Q3MC 1WXVA 1WWTA 2CR5A 2BYTA 4A3OA 1QQRA 1EF5A 2Y5PA 2W82A 2KQSA 4QAYA 4TSSA 1L6VA 2I38A 3N1YC 4IG7B 4NJ7A 3RNGC 3EECA 1AYFA 1UBQA 4WJQA 2XK5A 2BGFA 1HZ5A 1V80A 1EU4A 2KQ7A 1LXDA 4JWUC 4PS7A 4PK1A 2INCC 3V3XA 3BK1A 4GDKA 4WAAA 1VZ6A 4FJVB 2MJDA 4HRSA 2WU5B 1E7UA 2WWZA 4H2AA 5CHWA 4AJYB 2Z59B 4HDOA 4USAA 2WXGA 4NJCA 1V81A 2DZIA 1I4GA 3I3TB 2C7MB 1H4RA 4K7SA 2G4SA 2WXRA 3TBLD 3GZNI 3AE2B 3AV8A 1T0RC 2WGSA 2WXPA 3PTFC 3QC8B 2JYTA 4E3CA 1OQQA 1K8RB 2N1WA 2XN9C 4K7UA 4LNIA 4P16A 4KDLB 2Z8LA 1QKZA 5BYQA 4FJYA 2DAFA 2EMSA 1LO5D 3TL5A 3PV1A 4US8A 2LVOA 1WF9A 3ZYYX 1EM7A 2LGDA 1QILA 2BWFA 2KKCA 2ACZB 4JE3B 1MI0A 1HE8A 2WLBA 3T3NA 1C4CA 3VH4B 3WCQA 5IA7A 1HTOA 1QT9A 1LFDA 4MH0E 1SE2A 2BBCA 4GXBA 3OG5A 4B6WA 3L10B 3WAMA 2MJEA 1SSNA 1SIJA 4HDQA 2DENB 2JY6A 3BZDB 4KVGB 2ZVOA 3GP7A 2KYWA 1ET9A 2SAKA 4OVZA 3UF8A 3X23A 1SXTA 2ASQA 1CMXB 4IKGA 4EEWA 2Y3AA 3N1XC 4NPNA 1GNUA 2R2QA 3TEZA 4W9LA 3MP9A 3RMKC 3I5JC 2AYOB 2INPE 1WE7A 1CZPA 4KZCA 1YOVB 2MBBB 4UDUC 3BYYB 2KFJA 5BYSA 4HKZE 3L54A 2M8SA 1MG4A 2KWVB 2MQJA 4IM3A 2LI5A 4ARIA 1TIFA 2MBEA 2EKEC 3DVNU 2W3RA 2KC1A 3DBHB 3VAWA 4EKUA 2QEJC 4ASWC 1FCLA 1N61A 4RGTA 3IG3A 4GLSC 5LXIB 2HJ8A 1RRBA 3RN9C 2KJRA 4WWMA 2KT7A 3P63A 4G11A 3RPFC 2HTME 2WXNA 2GBMA 3AH7A 3CWIA 2H88B 3RYTA 4HWIB 1IYFA 3FKYA 3QA8A 3LXFA 3N1ZC 2V3PA 4E71A 3BIID 1H8CA 2X8XX 1GC7A 2VH1A 4IWOA 2BKFA 2LGIA 4WAFA 2XNAC 3V62A 2NR2A 2N9XA 4DHJD 1KOTA 1WGRA 2BPSA 2D3BA 3E56A 4WIPA 2IBIB 2L32A 5HI1A 2LXAA 2ZJDA 4GMVA 2KO3A 1FFVA 3H7SA 3U8ZA 4W9FA 2C5LC 3R7QA 3CMMB 1KLVA 1VLBA 1K53A 1PQSA 1UBIA 2WXKA 2K8BA 3K9PB 2LJIA 3R7RA 2O6VB 3B2GA 2OEDA 1A70A 1TYGB 5CHFA 2WXHA 3B2FA 1OQYA 4RM8A 2BYEA 3T8MA 4M8NA 3WA0A 1X1MA 2WDTB 2K8CA 3I57A 4W9JA 4YSXB 2GI9A 1UUPA 3KWVA 4ZRQA 1OEYJ 2V1YA 4KGRA 5EE0A 4LNKA 5H92C 1U4AA 3DVGX 4LDTD 2NBVB 1ENFA 4NAWB 4YTNB 1GTHA 1C3TA 1S3SG 2JWUA 4PYZA 3AE4B 2JRIB 1P1AA 1F2RC 1VRAB 1WYWB 4LNOA 1WXAA 3NHEB 3FAHA 3Q8FA 1ZP0B 4A90A 4JLCA 3ECIA 2GLSA 3Q6BA 3EUB2 1NVID 3DVGY 3IVFA 3NUHB 3UGBB 1KF6B 3BK2A 3EHVA 1EU3A 5G5GA 2ZW0A 3IFWB 3UINB 4XYCA 2K0PA 2DYBA 2O6VA 2DHZA 5AEKB 2BQQA 2DZJA 2ZPNA 1HXYD 1UGMA 2KMMA 4FHKA 2MA9B 3W2DA 5G5HA 1Y56A 5DPRA 3PT2B 2TSSA 2KJHB 4I6LB 2HJ1A 2WDRB 3V6EB 1N5WA 3MC8A 1WXMA 5LNK1 1QOBA 3MJ5A 3ZW3A 4S17A 3H9DA 4FJZA 1GTEA 2LGYA 1GB1A 4XDDA 4WQOB 3RNCC 4FLHA 3H7PA 1NI2A 4NNJB 1YN5A 3HUIA 4MEMA 4RH6A 5GXGB 4HCNB 3PREA 1MVKA 3GZNB 3EGRA 3JSVA 2JZ3B 4J6IA 1WM3A 3PZ7A 3ENEA 1GPXA 4FN2A 4YT0B 1ZUD2 1CJEA 2WXFA 2JXTA 3NS8A 1D5MC 1JWSD 4RGNA 1E8XA 2JX5A 4IOIE 2UU7A 4RFBA 2R2OA 4HLEA 2GB1A 3SFEB 1J7CA 1WJUA 2O2VA 2PPHA 1FNUA 1QOFA 4K3BA 2W3SA 4JIOU 1I4PA 3CIRB 3ALBA 3AI5A 1FXAA 1I4XA 1NI3A 2Z0EB 2KZRA 2ZNVC 4HJKA 2INNE 3TJPA 2G3QB 2FCMA 1UWMA 4B95A 1HA5A 1R4MI 2MBQA 1OTRB 2MEKA 1L4ZB 1L6UA 4BKSA 1GJZA 2KDBA 2LGSA 2E6XA 4L1BA 1FXIA 3EA6A 1EWYC 3W1SC 4EE2A 3QAQA 1FXTB 4YSZB 2YEPF 3V6CB 4AS1A 1UNSA 1F9JA 3MTNB 2PEAA 3AEBB 1D3ZA 2KOXA 4OHJA 2DZMA 4XWTA 1UELA 5JZEB 5AUKA 1WMHA 3C19A 1I4HA 4MSMB 2V4IB 1C78A 2LWPA 2OJWA 2BS4B 1LM8B 2D3CA 2JZPA 3JW0X 2CS4A 3W5VB 1XD3B 5BMIA 3UIPB 2GBRA 1WRIA 2M1MA 5I4DA 3K9OB 1MG8A 4DXGA 4A20A 2KANA 5J2RA 2C7NB 2QMTA 2MP2B 4ANUA 3AE8B 2J42A 3KYDD 4X57B 1MJDA 4A8XC 2D3GA 2K1FA 3QJZA 1J19A 1CK1A 1SEBD 4C80A 1WIAA 3QIJA 1YNTE 4MGIE 4TQ0A 1VZ8A 4LCDE 2G9HD 1STEA 3JVZX 3WALA 2B76B 2AWTA 2KX0A 2N9PC 3SEBA 1SE4A 4JL9A 3ZDTA 1QOGA 2ZCBA 2L0FA 3DBRB 1TGZB 4AOFA 5JH5C 1WJNA 2CU3A 2JQRB 1JWMD 4RGMA 4WWPA 3GS2A 2KN4A 3AULA 1F52A 4ZRJA 1L0VB 4FULA 1E8YA 1SE9A 1NYRA 2RR9A 3A1QB 4ARCA 1V9JA 4W9IA 4PS8A 4B0EA 4IDIA 3PRZA 2MP2A 3AU4A 3ZTDA 3AEEB 3QQ8B 1TS2A 4EZLA 5AZGA 1E6EB 4C7YA 2Q5WD 1ZOYB 1T0QC 5L95C 1QF6A 4A55A 4YTMB 4XE0A 5JHBA 2BS3B 5FR6A 2L52A 4YTPB 2BF8B 3ZLZA 4LDTB 4CQNA 1JMLA 2KX3A 4KKJA 1FPYA 3WANA 4B9KA 3DHGC 2BB6A 3VHTC 3R3MA 3MFGA 1GC6A 1ISNA 1RAXA 2IO1B 2N4FA 3AE5B 5KHOA 5FR3A 1D6EC 4II2B 1MHXA 1YN4A 3NZUA 4HPLB 3A1QA 4L23A 2MRPA 3W5UB 2ZW1A 1JWBD 3PO0A 3TCAA 4ZRPA 1XXGA 4DBGA 2GOWA 4N58A 1I35A 1S1QB 3R66C 1FFUA 1Q10A 1YQ4B 3AMZA 4HEA1 4P7IA 3SU8X 2B3AA 5IP4D 1WGGA 4PS3A 5IO9A 1WYGA 5IOIA 4ZHOA 2PVOD 2ZEQA 1XLPA 2KDMA 3KW5B 4MSQB 1JQ4A 1LQBA 4EZJA 1J8CA 3NVVA 2MHJA 1EUVB 1PGAA 3NY5A 2N7JA 4RF1A 1JROA 1RFAA 3NRZA 3R2IA 3I9V1 3W9CB 2PKOA 5EE1A 2L76A 1TTNA 3UIOB 3ZNGC 1NDDA 5H8YE 1PGXA 3RZFA 2KDEB 1FEHA 5HFYA 2YLMA 3PHXB 3ML9A 2JVCA 2H89B 4MT5A 1C9FA 2AQ1B 3AU5A 3O65B 2WXOA 3KYCD 2LUEA 2KVRA 4ACFA 4LLGM 4GB9A 1FM0D 4GDLB 3WIMA 3AE1B 1P98A 1J0GA 5C2TB 2FUHB 2WX0A 3RI7C 3JYUA 4ZYNA 4OZCA 1SJHD 3FC4A 2DNFA 4IM0A 2R61A 3AE7B 3U7ZA 4IWPA 2D3AA 4HJGE 5G2NA 4BOSC 3HVZA 1ZGUB 1YJJA 1FNVA 1QOAA 1LGRA 2CHZA 2M17A 3SHQA 1MHHE 5LXHA 2JF5A 3IAS1 2A4ZA 3UI3A 1E7VA 1R4NI 1V1OA 2D11A 3OLMD 2LVPA 4AQ7A 2SEBD 2MCNB 2EKIA 2WXJA 2N9LA 1I4QA 1HQRD 4GN1A 4GOCA 1SGHA 2J4XA 3ZNHB 3FILB 1FO4A 4WWNA 4DXFA 1E5WA 2L05A 3OWEB 3KLSX 3PSEB 5D3IB 1XO3A 2JU6X 2W55A 4FADA 1HTQA 3NS1A 1YN3A 4JPSA 2MJ3A 3QWZB 3IAM1 4FBJB 1KJTA 4ZRIA 1WY8A 3HRDD 4LK0M 3I63C 4HPMB 4KZ0A 1M4VA 4C7ZA 3PPAA 2LVQA 1WZ3A 3E9SA 2K9XA 4HROA 4RM9A 4XGAB 1ZPSA 3N32A 1AARA 1UD7A 2KLGA 4NY0A 3MC0B 3AE9B 1F77A 2BWES 3RFZB 3HIZA 3O13A 2V0GA 3URYA 2FIFA 1E90A 4EFOA 3AEGB 3FILA 1F0ZA 2KWDA 4FXCA 2MW5A 2NTSA 2W54A 3LDZE 3B9JA 4ZHPA 4RF0A 3RNAC 3ZUNA 2MBHA 5E6JA 1T3QA 1IPGA 5EDSA 4ANVA 1Z2MA 2JYEA 4KX6B 1C79A 2K25A 2LRWA 2MWSB 1PYWD 4AUQC 1KLGD 3T3OA 2J7QB 3MHSD 3AEDB 2IDYA 2KXJA 2N1VA 2LFIA 1V8CA 4LJPB 1I7HA 1D5ZC 4M8MA 2K3UA 3IT4B 5CHVC 1L7YA 2FNJB 3Q3JA 2I2YA 1KH0A 3TMPB 5E6NA 1Y8RC 1C77A 2BKRB 2KC2A 2DLBA 1IBXB 3H1UA 2L1AA 4JX1C 4WQMA 1JRUA 1XQQA 3M3JA 2WHIA 1WX9A 4HCPB 3N30A 5FK9C 1C4PA 3RT3B 4BBNC 3ZJTA 2LXCA 2RMMA 2LD9A 3DOWA 2PTLA 3Q3NC 1J7AA 2BW2A 2LZ6A 2FBWB 4NAWA 3KUCB 5D6JB 1XLQA 4N9F4 1H7WA 2NTTA 1HEZE 3TIXA 5EE3A 3WAOA 3U30A 1B1ZA 2N7DA 4AJWA 1VJKA 1ACCA 3TEXA 1GOZA 4D2KA 1TS3A 2QSDA 3ZJUA 2HD5B 5CTRC 3U7DA 1WI0A 3IHPC 5BYRA 1B9RA 3KQ4A 4CYEA 4DXAB 5BMGA 1TY0A 2NCNA 3SFDB 2VH2A 2LASA 4KIKB 3ZTCA 3P4RB 2J52A 3EC8A 5HKHA 5JXVA 1YQBA 1IBXA 4C56C 3UQBA 2AL3A 3B0AA 3AM9A 2BTEA 2RPVA 1E9MA 4B0MA 2PVGC 4S0RA 1PFDA 4A6QA 2KTFA 3W1YA 1ZXHA 1ZW7A 4WWOA 3CF4A 3ZGZA 4EZKA 3P4QB 2D2QA 1DOXA 4A3PA 4NZLB 3DPDA 4C00A 4CO7A 4PT5A 4ANXA 1IUEA 3C8YA 1YJ1A 3V05A 1Q0WB 3BVMA 3KUZA 1L5PA 2W9NA 2WXLA 4P1BC 1IP9A 1GT8A 2DYMA 2KLCA 1WSPA 2IO0B 1E0ZA 3VDZA 3ZO5B 3SD5A 4HVBA 3M62B 2XEWA 2ZVNA 4NQKE 4RGOS 3VR8B 3PVLA 2V4LA 3Q2AC 4M0WB 1WGYA 3CF6E 3NVYA 4LJOB 3ML8A 4KIKA 4KSLC 1ET6A 1WR1A 4RMAA 5TR5A 4NQLB 2I1JA 2N0SB 2KVZA 4MGKE 3VH3B 3VVWB 1T6BX 3NVWA 2XBBC 3VUYA 2MBOA 4FHJA 2UYZB 2QCZA 2L00B 3UQAA 1SJED 1YQ3B 3IXSA 3SR6A 1YX6B 4BKGA 1NENB 1ZXIA 2JXXA 3RZWC 2JWZA 2FCSA 4O1NA 1R4NB 3BWUD 3P4SB 5T8IA 3ZXRA 2RGFA 2ZZPB 3AEAB 2RD0A 1T0SC 4XC2A 1PDXA 2N9KA 3PZDA 3PS6A 1UGJA 1N60A 3Q8BA 1RLFA 1H7XA 2PE9A 4M0WA 1N63A 1E7PB 5LLIA 1BXTA 1PUTA 1WJ6A 3EFUA 4M00A 3L16A 1D4BA 3R2TA 1TKGA 4DHJB 3OAWA 2K6DB 2FCNA 3DWMA 4C4VB 1FRRA 1RWSA 1WJ4A 3RNEC 2KHWB 4LTUA 1F2RI 1WGHA 4HKQA 2AEHA 2OJRA 4ZDVA 2KNBA 5DPTA 2IY1B 2IZVB 2LHDA 1P3QU 1TZ1A 1C1YB 1XCTL 2LEKA 2C60A 2L0TA 4BZAA 2KMAA 4G0NB 2X38A 2E3TA 1J7BA 2RSUA 4JQWC 1XT9B 3ONSA 4K3CA 4N59A 4RCOA 2GBNA 4ZRKA 3BVZA 4OZAA 4GGQA 2MLBA 4YWGG 3VRAB 1FD6A 4F1SA 4BAXA 2K22A 3EFCA 2K39A 3DVNV 2M56B 1JWAD 3L0WB 4MGYE 2CHXA 1GG3A 1SE3A 3P1MA 4IW0A 1G6JA 2KACA 2N9EB 4BBNF 3KH0A 4G50A 4I6NB 3WAPA 1TS5A 3ZIMA 4C4VA 2YVCA 4ICUA 3OJ4B 3MHZA 3AECB 5J17A 2IJ0A 4WJOA 2OOBB 2QDFA 2DBYA 4IM2A 3U4EG 2EMTA 1WZ0A 5IKCM 2HDEA 4OW0A 1V2YA 3APDA 4DDGD 1TT5B 3AE6B 5D3DA 4CHKA 1TKEA 3QX1A 2VZKD 1GAQB 3BY4B 2LUMA 2Z0DB 3RCZA 4BKSD 4GSWA 2J0JA 4YXDB 3MJWA 3VUXA 2QC8A 4W9HA 2IO3B 1EWCA 3H8HA 3IT6B 2FE8A 3TEWA 2KWCA 1FCCC 5DPWA 1E10A 2QHOA 3GE8C 1V6EA 1YMHE 4KV2A 1T5XD 5AZFA 1P7FA 2LJ5A 1TS4A 3N9YC 2WXMA 3PLUA 3ZQ4A 3N3KB 2V9HA 3S2AA 4LNFA 2NMQA 3P2BA 2AQ2B 1DOYA 4MDKE 3BVGA 2DZKA 3VTVA 4MM3B 1XEEA 3ZKJC 5DPSA 3ZNZB 2PLPA 2WP9B 2V3NA 2GMIC 2WNMA 1XF5L 1N62A 3NZSA 1YIWA 2G45B 1FMAD 2M19A 5D2MB 5AZHA 3Q14C 3RNBC 1VD2A 1RFKA 2J0KA 1NYQA 4F8CB 2QJLA 2JUOA 4IUMB 2RPQA 1FIQA 1BMLC 1RM6C 4HK2A 3M63B 1UWXA 4YSYB 4ICVA 1YJIA 1M94A 2N7EA 2NS5A 1N5XA 3Q3OC 1QZEA 2CJOA 5AUIA 2WDQB 2I1KA 2VRRB 5G55A 1E8WA 3ZDMC 1P0RA 2WXIA 1E8ZA 2YEPB 2KK8A 1TZOA 4MACA 1R4MB 4EOYA 4JWSC 3GOEA 3NJTA 4ANWA 1BT0A 4M01A 3NG0A 2KQ4X 4MM3A 2FUG1 5IAAC 3P42A 3RNFC 3H6NA 3P4PB 4XDCA 1MPEA 3PRMB 2AX5A 2KMCA 1DYQA 4M02A 2RDBC 1CQVA 2GBKA 2DWQA 1TY2A 3NOBA 1Z5SB 3U2SC 1SIFA 4NAMA 3M95A 1T0YA 2C7HA 4PYUA 1L4DB 2FCQA 3ZRFA 4I6PA 4BOZB 1D5XC 1YD8U 3APCA 3NVZA 4GDLA 4REZA 4HPPA 1JRPA 1WGDA 3DBLI 2V3SA 1JWUD 1P7EA 3OJ3A 4WH4A 3VXWA 1AN8A 4RNAA 1HZ6A 2BYFA 4WURA 3AXCA 1UF0A 3TEYA 2KWUB 3PLVA 1L0XB 4MH8A 4WJPA 5GMVA 2KD0A 4R3DA 1L0YB 4KGSA 3BINA 4L2YA 3AE3B 2K5PA 3DBRI 1ZKHA 4XZ4A 1BUIC 1L2NA 3Q3FA 3A9JB 1SB3C 4G3XB 3C0RB 4XX5A 3L17A 4W9DA 4TKNA 2NBUA 4TQ1A 5TSSA 5KHQA 4A9AA 1K52A 1I4RA 3B08A 3ETRA 1C76A 2BB5A 2MX2A 2KTRB 4P6VF 2J0MA 3QCAA 4AP4C 5L83A 4TUUA 3ZNID 3QHTA 4YL8A 5MPOA 1WRDB 4TV3A 2ON8A 4IWQA 2J53A 1IGCA 3LJ3A 5C3JB 3QARA 2BT6A 2C9WB 2D5GA 4ZYSA 5JHAA 2HE7A 3LYYA 4MJSB 2JZZA 2RDGA 1WH3A 2WU2B 2DAJA 4DHZE 1YX5B 4ZOHC 1FRDA 3T9LA 2LHEA 3PRPB 3CSFA 3DHIC 4XWWA 3HVDA 4DWFA 3APFA 3H7PB 4W9EA 3DBSA 2CKHB 2NVUI 2IYDB 3A9JA 1WFYA 4W9CA 2K8HA 4KGTA 3JSVB 3B1LX 1A5RA 4F7ZA 2ICIA 4TMAB 1TBEA 3NZ3A 1KFYB 2QIEB 3X0WA 2IGGA 1QLBB 3Q8CA 1KM7A 1VR9A 5EE9A 2KTRA 1OQRA 4US9A 2BS2B 3A9KB 1KRHA 2O2VB 2REXA 3TUOA 4DHZB 3DQVA 2RDHA 5C23A 2LRUA 3Q69A 3VR9B 1NBFC 2KFKB 1V5OA 2WXQA 1DGJA 4MJSA 5E6OA 1SBBB 1WGKA 3HK0A 5HG2A 3J9CA 4P1CC 4OZBA 2WQYB 2IGDA 3V61A 2NPTB 1RYJA 1UH6A 1EF1A 5FKAC 3VFKA 2JRHA 2VZKB 3VQIA 1KTKA 2PIAA 3IBEA 4KDIC 1WX7A 3TSSA 3ABVB 1JW9D 3HHMA 2WYQA 5D94A 3L08A 4JGHB 2ZPYA 4MGZE 2IPKD 1WXSA 2JPHA 2BVCA 2ZNVB 2Y5CA 2LMCA 1ZDXA 4OVUA 2GRIA 3N20C 1V1PB 3GB1A 2A5UA 3BYTB 3DCGA 4W9KA 3R8BA 1XLOA 1K51A 1JALA 1NEKB 3VRBB 1DOIA 3DHHC 4IC7B 1OEYA 3D32A 4KKIA 3ZVVA 1WMHB 3VUWA 5IN7A 3A9KA 1XCQL 4URKA 2MH7A 1KLUD 2K6QA 1I42A 3ZJVA 1PGBA 4K7WA 3SDLC 2KFKA 1OFFA 5BO4B 1V97A 1V49A 3RULA 4NJ6A 5BMHA 3Q8EA 4WJNA 2WX1A 2PE6B 2NPTA 2L3ZA 1VDVA 3KUDB 1N6ZA 2PJHA 3DBHI 4K1RB 5D7GA 4KSKC 4W9GA 2KDFB 2D10A 2GBJA 4K81A 1AWDA 2IGHA 2NBWB 2M0AA 3VTWA 2PMVA 1P9DU 1ESFA 1WM2A 3AEFB 3QK0A 2KAJA 3ZRCA 4BVUC 3RD2A 2CU1A 2M0XA 2DX5B 4FA6A 1SF0A 2M4NA 1V1PA 2FAZA 2FIDA 5HHDG 1V86A 2BYVE 1C4AA 1TJEA 4BFRA 2Y5BB 3VTUA 1MFWA 4HXDA 2AL6A 3A4SC 4DQOC 2MSED 3U52E 3W1SA 2WDVB 1VZ7A 2INDC 2OHFA 2DYOA 3CSTA 1VCBA 2CJNA 2ONQA 3HM3A 2ZCCA 2L8JA 2G1EA 2AQ3B 3A4RA
chains in the Genus database with same CATH topology
3TEWA 4JPSA 2MJ3A 2WDRB 1FCCC 3IAM1 1E10A 1N5WA 1YMHE 5LNK1 3LB8C 1T5XD 1QOBA 3MJ5A 1R7SA 1P7FA 3HRDD 4LK0M 1GTEA 1GB1A 4XDDA 1TS4A 1M4VA 2WXMA 3N9YC 3ZQ4A 3KWLA 4C7ZA 1YN5A 2NMQA 3HUIA 4RH6A 3E9SA 2AQ2B 5GXGB 1DOYA 3BVGA 2K9XA 1MVKA 3EGRA 2QILA 4HROA 4MM3B 1XEEA 3PZ7A 1GPXA 4YT0B 1ZUD2 1CJEA 2WS3B 1ZPSA 2WXFA 2JXTA 2PLPA 2WP9B 2V3NA 1D5MC 1JWSD 4RGNA 2JX5A 2WNMA 4IOIE 1XF5L 4J3OD 1N62A 3MC0B 3AE9B 1ZDVA 4RFBA 1FMAD 2M19A 1F77A 3RFZB 2EELA 3O13A 3Q8AA 2V0GA 2GB1A 1K50A 3AB5A 3URYA 1RFKA 1NYQA 3SFEB 2QJLA 1J7CA 1FNUA 1QOFA 4GDKB 2JSVX 1WXQA 4Q2JA 2W3SA 3AN1A 3AEGB 3FILA 1F0ZA 1I4PA 3CIRB 2KWDA 2PW9A 4FXCA 2NTSA 1FIQA 2W54A 1FXAA 1I4XA 1FNWA 1NI3A 1BMLC 1RM6C 3B9JA 3PZ8A 4ZHPA 4RF0A 1AW7A 3L4PA 2INNE 1UWXA 4ITKA 4YSYB 1YJIA 5E6JA 1T3QA 3DWGC 1XLNA 1ZE3D 1TKYA 1IGDA 1N5XA 2JYEA 4KX6B 2CJOA 5AUIA 1C79A 1UWMA 1GB4A 1HA5A 2WDQB 2MEKA 2L83A 1PYWD 1L4ZB 4N6EB 1L6UA 1KLGD 1JCKB 3T3OA 2WXIA 2E6XA 2YEPB 1ROEA 1TZOA 4L1BA 3AEDB 1FXIA 4MACA 1WWTA 3EA6A 1EWYC 2IDYA 4EE2A 2BYTA 4JWSC 1QQRA 2Y5PA 2LFIA 2W82A 4YSZB 2YEPF 1V8CA 4AS1A 1UNSA 4TSSA 1I7HA 1D5ZC 2K3UA 1L6VA 2KQ4X 3IT4B 2FUG1 3P42A 3AEBB 2I38A 2I2YA 3P4PB 1KH0A 4OHJA 4XDCA 1MPEA 1AYFA 4XWTA 1C77A 2AX5A 2DLBA 1IBXB 1DYQA 2L1AA 4JX1C 4WQMA 5AUKA 1HZ5A 1CQVA 1EU4A 1I4HA 4JWUC 2DWQA 2V4IB 1C78A 1TY2A 2BS4B 3V3XA 3BK1A 2JZPA 3U2SC 5FK9C 4NAMA 1C4PA 3W5VB 3ZJTA 2RMMA 1VZ6A 1L4DB 5BMIA 2MJDA 4HRSA 2WU5B 4H2AA 1D5XC 1WRIA 2PTLA 5I4DA 3NVZA 1J7AA 2BW2A 4DXGA 4USAA 2WXGA 4NJCA 4REZA 2FBWB 1I4GA 1JRPA 4WH4A 2QMTA 1XLQA 1JWUD 3AE8B 1P7EA 2J42A 1H7WA 2NTTA 1AN8A 1HEZE 5EE3A 4RNAA 1B1ZA 2WXRA 1HZ6A 4WURA 1VJKA 4A8XC 1ACCA 3AE2B 3TEXA 3AV8A 1GOZA 3TEYA 4D2KA 2WXPA 1TS3A 2QSDA 1CK1A 1SEBD 3ZJUA 2JYTA 1L0XB 4C80A 1OQQA 4MH8A 1YNTE 2XN9C 4TQ0A 4P16A 4R3DA 1L0YB 4KGSA 1VZ8A 1QKZA 2Z8LA 2G9HD 1STEA 5BYRA 3KQ4A 5BYQA 4L2YA 3AE3B 2K5PA 1B9RA 5BMGA 1LO5D 2B76B 4US8A 1TY0A 3SFDB 1BUIC 3SEBA 3ZYYX 1EM7A 1QILA 1SE4A 1SB3C 3P4RB 2J52A 2ACZB 4JE3B 5JXVA 1QOGA 1MI0A 2WLBA 1IBXA 3T3NA 4C56C 1C4CA 3WCQA 4TQ1A 3AM9A 5TSSA 2BTEA 2CU3A 4A9AA 1K52A 1I4RA 1QT9A 2JQRB 1JWMD 2RPVA 1E9MA 1SE2A 4B0MA 2PVGC 2BBCA 4RGMA 3ETRA 1C76A 1PFDA 2MJEA 3GS2A 1SSNA 2BB5A 2KN4A 4A6QA 1SIJA 4P6VF 3BZDB 1ZXHA 1L0VB 3GP7A 1ET9A 1NYRA 2SAKA 3CF4A 4OVZA 3ZGZA 1SXTA 5MPOA 4ARCA 4IKGA 3P4QB 2ON8A 2Y3AA 4B0EA 4IDIA 2J53A 1DOXA 1IGCA 4NZLB 5C3JB 3TEZA 2BT6A 2D5GA 3AEEB 4PT5A 4ZYSA 1IUEA 3C8YA 3MP9A 1TS2A 3LYYA 3V05A 2RDGA 2WU2B 3BVMA 1L5PA 1E6EB 2WXLA 2INPE 4C7YA 2Q5WD 1ZOYB 1CZPA 1QF6A 4ZOHC 4A55A 1GT8A 4UDUC 2DYMA 4YTMB 1FRDA 3BYYB 5BYSA 2LHEA 1WSPA 1E0ZA 4HKZE 4XE0A 2BS3B 4ARIA 4RGOS 4XWWA 3VR8B 2L52A 3HVDA 4YTPB 2W3RA 3NVYA 4CQNA 1ET6A 2QEJC 1JMLA 4KGTA 4KKJA 1FCLA 2BB6A 1N61A 4RGTA 2ICIA 2N0SB 4GLSC 4TMAB 3NZ3A 3MFGA 1KFYB 2QIEB 1T6BX 2IGGA 1QLBB 3NVWA 3Q8CA 1VR9A 3AE5B 4WWMA 5EE9A 1OQRA 3P63A 5FR3A 1SJED 4US9A 1YQ3B 2BS2B 1D6EC 3IXSA 3RPFC 3SR6A 2HTME 1NENB 1ZXIA 1MHXA 1YN4A 2WXNA 4L23A 1KRHA 3TUOA 4O1NA 2RDHA 3AH7A 3CWIA 2H88B 3BWUD 3W5UB 2ZW1A 3Q69A 3VR9B 3P4SB 1JWBD 3PO0A 3LXFA 5T8IA 2V3PA 4ZRPA 1XXGA 3BIID 2WXQA 1DGJA 1SBBB 1WGKA 3AEAB 5HG2A 4N58A 3J9CA 1FFUA 1Q10A 1YQ4B 2LGIA 3AMZA 4HEA1 2WQYB 2XNAC 2IGDA 4OZBA 4WAFA 1RYJA 1PDXA 2N9KA 5FKAC 2VZKB 3VQIA 1UGJA 1KTKA 1N60A 1WYGA 2PIAA 3Q8BA 2PVOD 4ZHOA 1H7XA 1XLPA 3E56A 4WIPA 2KDMA 4M0WA 3TSSA 3ABVB 1JW9D 1E7PB 1N63A 1JQ4A 2L32A 5HI1A 1BXTA 1PUTA 3NVVA 2IPKD 1PGAA 1D4BA 1FFVA 3R2TA 2Y5CA 2N7JA 2LMCA 1ZDXA 4RF1A 1TKGA 1JROA 3NRZA 2GRIA 3DWMA 3I9V1 3R2IA 3W9CB 2PKOA 1FRRA 1RWSA 5EE1A 1V1PB 4LTUA 3GB1A 3BYTB 3R8BA 1VLBA 1XLOA 1K51A 1F2RI 1K53A 2WXKA 4HKQA 1JALA 1PGXA 5H8YE 1NEKB 3VRBB 2LJIA 3B2GA 1FEHA 2OEDA 1DOIA 1A70A 5HFYA 1TYGB 4KKIA 2LHDA 2WXHA 2H89B 1XCTL 2LEKA 3B2FA 4MT5A 1C9FA 1XCQL 2AQ1B 2X38A 2E3TA 2WXOA 2MH7A 1J7BA 1KLUD 3I57A 3ZJVA 1PGBA 4N59A 4YSXB 2GI9A 4RCOA 1UUPA 3KWVA 4ZRQA 1OFFA 4LLGM 1V97A 1FM0D 4KGRA 5EE0A 5H92C 3BVZA 3IT6B 4GDLB 3AE1B 4OZAA 5BMHA 1ENFA 3Q8EA 4NAWB 5C2TB 4YTNB 1GTHA 4YWGG 3VRAB 4OZCA 1SJHD 1VDVA 2JWUA 1FD6A 3AE4B 3FC4A 2K22A 5D7GA 2R61A 3AE7B 3U7ZA 1F2RC 2M56B 1VRAB 1JWAD 4HJGE 1AWDA 2IGHA 2M0AA 2PMVA 3HVZA 1YJJA 1ESFA 1SE3A 3FAHA 3P1MA 3Q8FA 1ZP0B 3AEFB 1FNVA 1QOAA 2KACA 2KAJA 4A90A 3EUB2 1NVID 1TS5A 1SF0A 1V1PA 3MHZA 3NUHB 3AECB 1MHHE 1KF6B 3BK2A 1EU3A 2IJ0A 5G5GA 5HHDG 2ZW0A 3IAS1 3UI3A 1C4AA 1TJEA 1V1OA 2DBYA 2K0PA 4AQ7A 3U4EG 2SEBD 2EKIA 2HDEA 4OW0A 2WXJA 4DQOC 2N9LA 1I4QA 3U52E 1HQRD 1HXYD 3W1SA 3AE6B 2WDVB 1VZ7A 2J4XA 2KMMA 5D3DA 2OHFA 3FILB 1FO4A 1TKEA 2VZKD 1GAQB 2DYOA 4DXFA 3OWEB 2LUMA 3W2DA 5G5HA 3KLSX 1Y56A 2CJNA 2ONQA 5D3IB 1XO3A 2JU6X 4YXDB 2W55A 2TSSA 2G1EA 3NS1A 2AQ3B 1EWCA 3H8HA 1YN3A 2FE8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TKG A;  2MJ3 A;  2WDR B;  1JRO A;  1IUE A;  3NRZ A;  2AX5 A;  1N5W A;  3DWM A;  3W9C B;  1E10 A;  2PKO A;  1FRR A;  1RWS A;  2WU2 B;  5EE1 A;  1L5P A;  4JX1 C;  4WQM A;  3LB8 C;  4LTU A;  1E6E B;  1QOB A;  1VLB A;  1XLO A;  5AUK A;  4C7Y A;  2Q5W D;  1ZOY B;  1R7S A;  1CZP A;  1QF6 A;  3HRD D;  4ZOH C;  1JAL A;  1GT8 A;  5H8Y E;  4JWU C;  1GTE A;  2DWQ A;  4YTM B;  1NEK B;  3VRB B;  1FRD A;  2BS4 B;  3B2G A;  1DOI A;  1A70 A;  1E0Z A;  1TYG B;  3KWL A;  4C7Z A;  2H89 B;  3AEE B;  2LEK A;  3B2F A;  3W5V B;  2BS3 B;  3HUI A;  5GXG B;  2MJD A;  4HRS A;  1DOY A;  2K9X A;  3VR8 B;  2WU5 B;  2L52 A;  2MH7 A;  2E3T A;  1J7B A;  4YTP B;  1WRI A;  4HRO A;  2W3R A;  3NVY A;  3NVZ A;  1J7A A;  1GPX A;  4YT0 B;  1ZUD 2;  4N59 A;  4USA A;  4YSX B;  2FBW B;  1CJE A;  2WS3 B;  1OFF A;  1JRP A;  1V97 A;  1XLQ A;  3AE8 B;  2WP9 B;  1H7W A;  1FM0 D;  5EE0 A;  5EE3 A;  5H92 C;  2JX5 A;  1N61 A;  3AE1 B;  1N62 A;  2N0S B;  1VJK A;  5C2T B;  3AE2 B;  3AE9 B;  4YTN B;  1KFY B;  1GTH A;  1FMA D;  2M19 A;  2QIE B;  3AV8 A;  3NVW A;  1QLB B;  3VRA B;  3AE5 B;  1VDV A;  3AB5 A;  4WWM A;  5EE9 A;  1RFK A;  3AE4 B;  3SFE B;  1NYQ A;  1OQR A;  2QJL A;  3FC4 A;  1J7C A;  1OQQ A;  3P63 A;  4C80 A;  4US9 A;  2K22 A;  1YQ3 B;  2BS2 B;  1QOF A;  3AE7 B;  3RPF C;  3SR6 A;  1WXQ A;  2HTM E;  1NEN B;  1ZXI A;  2W3S A;  2M56 B;  3AN1 A;  3AEG B;  1JWA D;  1F0Z A;  1AWD A;  1B9R A;  3CIR B;  4FXC A;  3AE3 B;  1KRH A;  1FIQ A;  2K5P A;  1FXA A;  1NI3 A;  2W54 A;  3HVZ A;  1RM6 C;  3B9J A;  1YJJ A;  2B76 B;  4US8 A;  3AH7 A;  4ZHP A;  3FAH A;  3CWI A;  2H88 B;  1ZP0 B;  3SFD B;  3AEF B;  3L4P A;  3P1M A;  4ITK A;  4YSY B;  1QOA A;  3W5U B;  3VR9 B;  3ZYY X;  3P4S B;  2KAJ A;  1JWB D;  1YJI A;  3PO0 A;  3LXF A;  1SB3 C;  1T3Q A;  3P4R B;  3DWG C;  1XLN A;  2ACZ B;  1TKY A;  3EUB 2;  1NVI D;  3BII D;  1SF0 A;  1QOG A;  1N5X A;  2WLB A;  1DGJ A;  4KX6 B;  2CJO A;  5AUI A;  1UWM A;  3WCQ A;  1WGK A;  3AM9 A;  2WDQ B;  3AEA B;  3AEC B;  4N58 A;  2CU3 A;  4A9A A;  1FFU A;  1KF6 B;  1QT9 A;  2JQR B;  1YQ4 B;  2L83 A;  3AMZ A;  4N6E B;  1E9M A;  2WQY B;  1L6U A;  2PVG C;  5G5G A;  1RYJ A;  1TJE A;  3ETR A;  2DBY A;  1PFD A;  2MJE A;  1ROE A;  1PDX A;  2EKI A;  3AED B;  1SIJ A;  1FXI A;  1WWT A;  1EWY C;  4P6V F;  4JWS C;  1L0V B;  1N60 A;  1WYG A;  2PIA A;  4ZHO A;  2PVO D;  4YSZ B;  1NYR A;  1V8C A;  1H7X A;  3AE6 B;  2WDV B;  1XLP A;  3CF4 A;  1I7H A;  2KMM A;  2OHF A;  1FO4 A;  1TKE A;  3ABV B;  1JW9 D;  1E7P B;  1GAQ B;  1L6V A;  1N63 A;  5MPO A;  1JQ4 A;  3P4Q B;  5G5H A;  1PUT A;  2CJN A;  4IDI A;  3NVV A;  3AEB B;  1XO3 A;  4YXD B;  2W55 A;  3P4P B;  2G1E A;  3NS1 A;  1DOX A;  5C3J B;  1FFV A;  2Y5C A;  2BT6 A;  1AYF A; 
#chains in the Genus database with same CATH topology
 3L13 A;  1GUA B;  4BKT A;  3LB8 C;  1Q5W B;  1WE6 A;  2JT4 B;  1R7S A;  2D07 B;  3MC9 A;  2KDI A;  3DBL B;  3KWL A;  4LNN A;  3PGE A;  2G4D B;  2CHW A;  4DK5 A;  2O6V D;  1EO6 A;  2IY0 B;  1Q1O A;  2QIL A;  1OGW A;  3KVF B;  3GE3 C;  2WS3 B;  4MEL A;  3RUI B;  4EUT A;  1UZX B;  4J3O D;  4AWJ A;  2XK5 B;  1ZDV A;  4GU2 A;  2UWQ A;  4II3 B;  2EEL A;  3Q8A A;  1F1H A;  1K50 A;  3AB5 A;  5E6P A;  4E74 A;  5C1Z A;  3A33 B;  2L7R A;  2IO2 B;  3V60 A;  4GDK B;  2JSV X;  1WXQ A;  4Q2J A;  1WX8 A;  3HM6 X;  3AN1 A;  1V5T A;  2PW9 A;  2HTH A;  1WR6 E;  1FNW A;  3PZ8 A;  1AW7 A;  3L4P A;  4ITK A;  4GIV A;  3DDC B;  4DDI D;  5CX3 A;  3DWG C;  1XLN A;  1ZE3 D;  5J18 A;  1TKY A;  1IGD A;  4OVV A;  2LGX A;  2KJ6 A;  1GB4 A;  5DCN A;  2L83 A;  4N6E B;  1JCK B;  3PHW B;  3ZXV A;  1ROE A;  2KN5 A;  3Q3M C;  1WXV A;  1WWT A;  2CR5 A;  2BYT A;  4A3O A;  1QQR A;  1EF5 A;  2Y5P A;  2W82 A;  2KQS A;  4QAY A;  4TSS A;  1L6V A;  2I38 A;  3N1Y C;  4IG7 B;  4NJ7 A;  3RNG C;  3EEC A;  1AYF A;  1UBQ A;  4WJQ A;  2XK5 A;  2BGF A;  1HZ5 A;  1V80 A;  1EU4 A;  2KQ7 A;  1LXD A;  4JWU C;  4PS7 A;  4PK1 A;  2INC C;  3V3X A;  3BK1 A;  4GDK A;  4WAA A;  1VZ6 A;  4FJV B;  2MJD A;  4HRS A;  2WU5 B;  1E7U A;  2WWZ A;  4H2A A;  5CHW A;  4AJY B;  2Z59 B;  4HDO A;  4USA A;  2WXG A;  4NJC A;  1V81 A;  2DZI A;  1I4G A;  3I3T B;  2C7M B;  1H4R A;  4K7S A;  2G4S A;  2WXR A;  3TBL D;  3GZN I;  3AE2 B;  3AV8 A;  1T0R C;  2WGS A;  2WXP A;  3PTF C;  3QC8 B;  2JYT A;  4E3C A;  1OQQ A;  1K8R B;  2N1W A;  2XN9 C;  4K7U A;  4LNI A;  4P16 A;  4KDL B;  2Z8L A;  1QKZ A;  5BYQ A;  4FJY A;  2DAF A;  2EMS A;  1LO5 D;  3TL5 A;  3PV1 A;  4US8 A;  2LVO A;  1WF9 A;  3ZYY X;  1EM7 A;  2LGD A;  1QIL A;  2BWF A;  2KKC A;  2ACZ B;  4JE3 B;  1MI0 A;  1HE8 A;  2WLB A;  3T3N A;  1C4C A;  3VH4 B;  3WCQ A;  5IA7 A;  1HTO A;  1QT9 A;  1LFD A;  4MH0 E;  1SE2 A;  2BBC A;  4GXB A;  3OG5 A;  4B6W A;  3L10 B;  3WAM A;  2MJE A;  1SSN A;  1SIJ A;  4HDQ A;  2DEN B;  2JY6 A;  3BZD B;  4KVG B;  2ZVO A;  3GP7 A;  2KYW A;  1ET9 A;  2SAK A;  4OVZ A;  3UF8 A;  3X23 A;  1SXT A;  2ASQ A;  1CMX B;  4IKG A;  4EEW A;  2Y3A A;  3N1X C;  4NPN A;  1GNU A;  2R2Q A;  3TEZ A;  4W9L A;  3MP9 A;  3RMK C;  3I5J C;  2AYO B;  2INP E;  1WE7 A;  1CZP A;  4KZC A;  1YOV B;  2MBB B;  4UDU C;  3BYY B;  2KFJ A;  5BYS A;  4HKZ E;  3L54 A;  2M8S A;  1MG4 A;  2KWV B;  2MQJ A;  4IM3 A;  2LI5 A;  4ARI A;  1TIF A;  2MBE A;  2EKE C;  3DVN U;  2W3R A;  2KC1 A;  3DBH B;  3VAW A;  4EKU A;  2QEJ C;  4ASW C;  1FCL A;  1N61 A;  4RGT A;  3IG3 A;  4GLS C;  5LXI B;  2HJ8 A;  1RRB A;  3RN9 C;  2KJR A;  4WWM A;  2KT7 A;  3P63 A;  4G11 A;  3RPF C;  2HTM E;  2WXN A;  2GBM A;  3AH7 A;  3CWI A;  2H88 B;  3RYT A;  4HWI B;  1IYF A;  3FKY A;  3QA8 A;  3LXF A;  3N1Z C;  2V3P A;  4E71 A;  3BII D;  1H8C A;  2X8X X;  1GC7 A;  2VH1 A;  4IWO A;  2BKF A;  2LGI A;  4WAF A;  2XNA C;  3V62 A;  2NR2 A;  2N9X A;  4DHJ D;  1KOT A;  1WGR A;  2BPS A;  2D3B A;  3E56 A;  4WIP A;  2IBI B;  2L32 A;  5HI1 A;  2LXA A;  2ZJD A;  4GMV A;  2KO3 A;  1FFV A;  3H7S A;  3U8Z A;  4W9F A;  2C5L C;  3R7Q A;  3CMM B;  1KLV A;  1VLB A;  1K53 A;  1PQS A;  1UBI A;  2WXK A;  2K8B A;  3K9P B;  2LJI A;  3R7R A;  2O6V B;  3B2G A;  2OED A;  1A70 A;  1TYG B;  5CHF A;  2WXH A;  3B2F A;  1OQY A;  4RM8 A;  2BYE A;  3T8M A;  4M8N A;  3WA0 A;  1X1M A;  2WDT B;  2K8C A;  3I57 A;  4W9J A;  4YSX B;  2GI9 A;  1UUP A;  3KWV A;  4ZRQ A;  1OEY J;  2V1Y A;  4KGR A;  5EE0 A;  4LNK A;  5H92 C;  1U4A A;  3DVG X;  4LDT D;  2NBV B;  1ENF A;  4NAW B;  4YTN B;  1GTH A;  1C3T A;  1S3S G;  2JWU A;  4PYZ A;  3AE4 B;  2JRI B;  1P1A A;  1F2R C;  1VRA B;  1WYW B;  4LNO A;  1WXA A;  3NHE B;  3FAH A;  3Q8F A;  1ZP0 B;  4A90 A;  4JLC A;  3ECI A;  2GLS A;  3Q6B A;  3EUB 2;  1NVI D;  3DVG Y;  3IVF A;  3NUH B;  3UGB B;  1KF6 B;  3BK2 A;  3EHV A;  1EU3 A;  5G5G A;  2ZW0 A;  3IFW B;  3UIN B;  4XYC A;  2K0P A;  2DYB A;  2O6V A;  2DHZ A;  5AEK B;  2BQQ A;  2DZJ A;  2ZPN A;  1HXY D;  1UGM A;  2KMM A;  4FHK A;  2MA9 B;  3W2D A;  5G5H A;  1Y56 A;  5DPR A;  3PT2 B;  2TSS A;  2KJH B;  4I6L B;  2HJ1 A;  2WDR B;  3V6E B;  1N5W A;  3MC8 A;  1WXM A;  5LNK 1;  1QOB A;  3MJ5 A;  3ZW3 A;  4S17 A;  3H9D A;  4FJZ A;  1GTE A;  2LGY A;  1GB1 A;  4XDD A;  4WQO B;  3RNC C;  4FLH A;  3H7P A;  1NI2 A;  4NNJ B;  1YN5 A;  3HUI A;  4MEM A;  4RH6 A;  5GXG B;  4HCN B;  3PRE A;  1MVK A;  3GZN B;  3EGR A;  3JSV A;  2JZ3 B;  4J6I A;  1WM3 A;  3PZ7 A;  3ENE A;  1GPX A;  4FN2 A;  4YT0 B;  1ZUD 2;  1CJE A;  2WXF A;  2JXT A;  3NS8 A;  1D5M C;  1JWS D;  4RGN A;  1E8X A;  2JX5 A;  4IOI E;  2UU7 A;  4RFB A;  2R2O A;  4HLE A;  2GB1 A;  3SFE B;  1J7C A;  1WJU A;  2O2V A;  2PPH A;  1FNU A;  1QOF A;  4K3B A;  2W3S A;  4JIO U;  1I4P A;  3CIR B;  3ALB A;  3AI5 A;  1FXA A;  1I4X A;  1NI3 A;  2Z0E B;  2KZR A;  2ZNV C;  4HJK A;  2INN E;  3TJP A;  2G3Q B;  2FCM A;  1UWM A;  4B95 A;  1HA5 A;  1R4M I;  2MBQ A;  1OTR B;  2MEK A;  1L4Z B;  1L6U A;  4BKS A;  1GJZ A;  2KDB A;  2LGS A;  2E6X A;  4L1B A;  1FXI A;  3EA6 A;  1EWY C;  3W1S C;  4EE2 A;  3QAQ A;  1FXT B;  4YSZ B;  2YEP F;  3V6C B;  4AS1 A;  1UNS A;  1F9J A;  3MTN B;  2PEA A;  3AEB B;  1D3Z A;  2KOX A;  4OHJ A;  2DZM A;  4XWT A;  1UEL A;  5JZE B;  5AUK A;  1WMH A;  3C19 A;  1I4H A;  4MSM B;  2V4I B;  1C78 A;  2LWP A;  2OJW A;  2BS4 B;  1LM8 B;  2D3C A;  2JZP A;  3JW0 X;  2CS4 A;  3W5V B;  1XD3 B;  5BMI A;  3UIP B;  2GBR A;  1WRI A;  2M1M A;  5I4D A;  3K9O B;  1MG8 A;  4DXG A;  4A20 A;  2KAN A;  5J2R A;  2C7N B;  2QMT A;  2MP2 B;  4ANU A;  3AE8 B;  2J42 A;  3KYD D;  4X57 B;  1MJD A;  4A8X C;  2D3G A;  2K1F A;  3QJZ A;  1J19 A;  1CK1 A;  1SEB D;  4C80 A;  1WIA A;  3QIJ A;  1YNT E;  4MGI E;  4TQ0 A;  1VZ8 A;  4LCD E;  2G9H D;  1STE A;  3JVZ X;  3WAL A;  2B76 B;  2AWT A;  2KX0 A;  2N9P C;  3SEB A;  1SE4 A;  4JL9 A;  3ZDT A;  1QOG A;  2ZCB A;  2L0F A;  3DBR B;  1TGZ B;  4AOF A;  5JH5 C;  1WJN A;  2CU3 A;  2JQR B;  1JWM D;  4RGM A;  4WWP A;  3GS2 A;  2KN4 A;  3AUL A;  1F52 A;  4ZRJ A;  1L0V B;  4FUL A;  1E8Y A;  1SE9 A;  1NYR A;  2RR9 A;  3A1Q B;  4ARC A;  1V9J A;  4W9I A;  4PS8 A;  4B0E A;  4IDI A;  3PRZ A;  2MP2 A;  3AU4 A;  3ZTD A;  3AEE B;  3QQ8 B;  1TS2 A;  4EZL A;  5AZG A;  1E6E B;  4C7Y A;  2Q5W D;  1ZOY B;  1T0Q C;  5L95 C;  1QF6 A;  4A55 A;  4YTM B;  4XE0 A;  5JHB A;  2BS3 B;  5FR6 A;  2L52 A;  4YTP B;  2BF8 B;  3ZLZ A;  4LDT B;  4CQN A;  1JML A;  2KX3 A;  4KKJ A;  1FPY A;  3WAN A;  4B9K A;  3DHG C;  2BB6 A;  3VHT C;  3R3M A;  3MFG A;  1GC6 A;  1ISN A;  1RAX A;  2IO1 B;  2N4F A;  3AE5 B;  5KHO A;  5FR3 A;  1D6E C;  4II2 B;  1MHX A;  1YN4 A;  3NZU A;  4HPL B;  3A1Q A;  4L23 A;  2MRP A;  3W5U B;  2ZW1 A;  1JWB D;  3PO0 A;  3TCA A;  4ZRP A;  1XXG A;  4DBG A;  2GOW A;  4N58 A;  1I35 A;  1S1Q B;  3R66 C;  1FFU A;  1Q10 A;  1YQ4 B;  3AMZ A;  4HEA 1;  4P7I A;  3SU8 X;  2B3A A;  5IP4 D;  1WGG A;  4PS3 A;  5IO9 A;  1WYG A;  5IOI A;  4ZHO A;  2PVO D;  2ZEQ A;  1XLP A;  2KDM A;  3KW5 B;  4MSQ B;  1JQ4 A;  1LQB A;  4EZJ A;  1J8C A;  3NVV A;  2MHJ A;  1EUV B;  1PGA A;  3NY5 A;  2N7J A;  4RF1 A;  1JRO A;  1RFA A;  3NRZ A;  3R2I A;  3I9V 1;  3W9C B;  2PKO A;  5EE1 A;  2L76 A;  1TTN A;  3UIO B;  3ZNG C;  1NDD A;  5H8Y E;  1PGX A;  3RZF A;  2KDE B;  1FEH A;  5HFY A;  2YLM A;  3PHX B;  3ML9 A;  2JVC A;  2H89 B;  4MT5 A;  1C9F A;  2AQ1 B;  3AU5 A;  3O65 B;  2WXO A;  3KYC D;  2LUE A;  2KVR A;  4ACF A;  4LLG M;  4GB9 A;  1FM0 D;  4GDL B;  3WIM A;  3AE1 B;  1P98 A;  1J0G A;  5C2T B;  2FUH B;  2WX0 A;  3RI7 C;  3JYU A;  4ZYN A;  4OZC A;  1SJH D;  3FC4 A;  2DNF A;  4IM0 A;  2R61 A;  3AE7 B;  3U7Z A;  4IWP A;  2D3A A;  4HJG E;  5G2N A;  4BOS C;  3HVZ A;  1ZGU B;  1YJJ A;  1FNV A;  1QOA A;  1LGR A;  2CHZ A;  2M17 A;  3SHQ A;  1MHH E;  5LXH A;  2JF5 A;  3IAS 1;  2A4Z A;  3UI3 A;  1E7V A;  1R4N I;  1V1O A;  2D11 A;  3OLM D;  2LVP A;  4AQ7 A;  2SEB D;  2MCN B;  2EKI A;  2WXJ A;  2N9L A;  1I4Q A;  1HQR D;  4GN1 A;  4GOC A;  1SGH A;  2J4X A;  3ZNH B;  3FIL B;  1FO4 A;  4WWN A;  4DXF A;  1E5W A;  2L05 A;  3OWE B;  3KLS X;  3PSE B;  5D3I B;  1XO3 A;  2JU6 X;  2W55 A;  4FAD A;  1HTQ A;  3NS1 A;  1YN3 A;  4JPS A;  2MJ3 A;  3QWZ B;  3IAM 1;  4FBJ B;  1KJT A;  4ZRI A;  1WY8 A;  3HRD D;  4LK0 M;  3I63 C;  4HPM B;  4KZ0 A;  1M4V A;  4C7Z A;  3PPA A;  2LVQ A;  1WZ3 A;  3E9S A;  2K9X A;  4HRO A;  4RM9 A;  4XGA B;  1ZPS A;  3N32 A;  1AAR A;  1UD7 A;  2KLG A;  4NY0 A;  3MC0 B;  3AE9 B;  1F77 A;  2BWE S;  3RFZ B;  3HIZ A;  3O13 A;  2V0G A;  3URY A;  2FIF A;  1E90 A;  4EFO A;  3AEG B;  3FIL A;  1F0Z A;  2KWD A;  4FXC A;  2MW5 A;  2NTS A;  2W54 A;  3LDZ E;  3B9J A;  4ZHP A;  4RF0 A;  3RNA C;  3ZUN A;  2MBH A;  5E6J A;  1T3Q A;  1IPG A;  5EDS A;  4ANV A;  1Z2M A;  2JYE A;  4KX6 B;  1C79 A;  2K25 A;  2LRW A;  2MWS B;  1PYW D;  4AUQ C;  1KLG D;  3T3O A;  2J7Q B;  3MHS D;  3AED B;  2IDY A;  2KXJ A;  2N1V A;  2LFI A;  1V8C A;  4LJP B;  1I7H A;  1D5Z C;  4M8M A;  2K3U A;  3IT4 B;  5CHV C;  1L7Y A;  2FNJ B;  3Q3J A;  2I2Y A;  1KH0 A;  3TMP B;  5E6N A;  1Y8R C;  1C77 A;  2BKR B;  2KC2 A;  2DLB A;  1IBX B;  3H1U A;  2L1A A;  4JX1 C;  4WQM A;  1JRU A;  1XQQ A;  3M3J A;  2WHI A;  1WX9 A;  4HCP B;  3N30 A;  5FK9 C;  1C4P A;  3RT3 B;  4BBN C;  3ZJT A;  2LXC A;  2RMM A;  2LD9 A;  3DOW A;  2PTL A;  3Q3N C;  1J7A A;  2BW2 A;  2LZ6 A;  2FBW B;  4NAW A;  3KUC B;  5D6J B;  1XLQ A;  4N9F 4;  1H7W A;  2NTT A;  1HEZ E;  3TIX A;  5EE3 A;  3WAO A;  3U30 A;  1B1Z A;  2N7D A;  4AJW A;  1VJK A;  1ACC A;  3TEX A;  1GOZ A;  4D2K A;  1TS3 A;  2QSD A;  3ZJU A;  2HD5 B;  5CTR C;  3U7D A;  1WI0 A;  3IHP C;  5BYR A;  1B9R A;  3KQ4 A;  4CYE A;  4DXA B;  5BMG A;  1TY0 A;  2NCN A;  3SFD B;  2VH2 A;  2LAS A;  4KIK B;  3ZTC A;  3P4R B;  2J52 A;  3EC8 A;  5HKH A;  5JXV A;  1YQB A;  1IBX A;  4C56 C;  3UQB A;  2AL3 A;  3B0A A;  3AM9 A;  2BTE A;  2RPV A;  1E9M A;  4B0M A;  2PVG C;  4S0R A;  1PFD A;  4A6Q A;  2KTF A;  3W1Y A;  1ZXH A;  1ZW7 A;  4WWO A;  3CF4 A;  3ZGZ A;  4EZK A;  3P4Q B;  2D2Q A;  1DOX A;  4A3P A;  4NZL B;  3DPD A;  4C00 A;  4CO7 A;  4PT5 A;  4ANX A;  1IUE A;  3C8Y A;  1YJ1 A;  3V05 A;  1Q0W B;  3BVM A;  3KUZ A;  1L5P A;  2W9N A;  2WXL A;  4P1B C;  1IP9 A;  1GT8 A;  2DYM A;  2KLC A;  1WSP A;  2IO0 B;  1E0Z A;  3VDZ A;  3ZO5 B;  3SD5 A;  4HVB A;  3M62 B;  2XEW A;  2ZVN A;  4NQK E;  4RGO S;  3VR8 B;  3PVL A;  2V4L A;  3Q2A C;  4M0W B;  1WGY A;  3CF6 E;  3NVY A;  4LJO B;  3ML8 A;  4KIK A;  4KSL C;  1ET6 A;  1WR1 A;  4RMA A;  5TR5 A;  4NQL B;  2I1J A;  2N0S B;  2KVZ A;  4MGK E;  3VH3 B;  3VVW B;  1T6B X;  3NVW A;  2XBB C;  3VUY A;  2MBO A;  4FHJ A;  2UYZ B;  2QCZ A;  2L00 B;  3UQA A;  1SJE D;  1YQ3 B;  3IXS A;  3SR6 A;  1YX6 B;  4BKG A;  1NEN B;  1ZXI A;  2JXX A;  3RZW C;  2JWZ A;  2FCS A;  4O1N A;  1R4N B;  3BWU D;  3P4S B;  5T8I A;  3ZXR A;  2RGF A;  2ZZP B;  3AEA B;  2RD0 A;  1T0S C;  4XC2 A;  1PDX A;  2N9K A;  3PZD A;  3PS6 A;  1UGJ A;  1N60 A;  3Q8B A;  1RLF A;  1H7X A;  2PE9 A;  4M0W A;  1N63 A;  1E7P B;  5LLI A;  1BXT A;  1PUT A;  1WJ6 A;  3EFU A;  4M00 A;  3L16 A;  1D4B A;  3R2T A;  1TKG A;  4DHJ B;  3OAW A;  2K6D B;  2FCN A;  3DWM A;  4C4V B;  1FRR A;  1RWS A;  1WJ4 A;  3RNE C;  2KHW B;  4LTU A;  1F2R I;  1WGH A;  4HKQ A;  2AEH A;  2OJR A;  4ZDV A;  2KNB A;  5DPT A;  2IY1 B;  2IZV B;  2LHD A;  1P3Q U;  1TZ1 A;  1C1Y B;  1XCT L;  2LEK A;  2C60 A;  2L0T A;  4BZA A;  2KMA A;  4G0N B;  2X38 A;  2E3T A;  1J7B A;  2RSU A;  4JQW C;  1XT9 B;  3ONS A;  4K3C A;  4N59 A;  4RCO A;  2GBN A;  4ZRK A;  3BVZ A;  4OZA A;  4GGQ A;  2MLB A;  4YWG G;  3VRA B;  1FD6 A;  4F1S A;  4BAX A;  2K22 A;  3EFC A;  2K39 A;  3DVN V;  2M56 B;  1JWA D;  3L0W B;  4MGY E;  2CHX A;  1GG3 A;  1SE3 A;  3P1M A;  4IW0 A;  1G6J A;  2KAC A;  2N9E B;  4BBN F;  3KH0 A;  4G50 A;  4I6N B;  3WAP A;  1TS5 A;  3ZIM A;  4C4V A;  2YVC A;  4ICU A;  3OJ4 B;  3MHZ A;  3AEC B;  5J17 A;  2IJ0 A;  4WJO A;  2OOB B;  2QDF A;  2DBY A;  4IM2 A;  3U4E G;  2EMT A;  1WZ0 A;  5IKC M;  2HDE A;  4OW0 A;  1V2Y A;  3APD A;  4DDG D;  1TT5 B;  3AE6 B;  5D3D A;  4CHK A;  1TKE A;  3QX1 A;  2VZK D;  1GAQ B;  3BY4 B;  2LUM A;  2Z0D B;  3RCZ A;  4BKS D;  4GSW A;  2J0J A;  4YXD B;  3MJW A;  3VUX A;  2QC8 A;  4W9H A;  2IO3 B;  1EWC A;  3H8H A;  3IT6 B;  2FE8 A;  3TEW A;  2KWC A;  1FCC C;  5DPW A;  1E10 A;  2QHO A;  3GE8 C;  1V6E A;  1YMH E;  4KV2 A;  1T5X D;  5AZF A;  1P7F A;  2LJ5 A;  1TS4 A;  3N9Y C;  2WXM A;  3PLU A;  3ZQ4 A;  3N3K B;  2V9H A;  3S2A A;  4LNF A;  2NMQ A;  3P2B A;  2AQ2 B;  1DOY A;  4MDK E;  3BVG A;  2DZK A;  3VTV A;  4MM3 B;  1XEE A;  3ZKJ C;  5DPS A;  3ZNZ B;  2PLP A;  2WP9 B;  2V3N A;  2GMI C;  2WNM A;  1XF5 L;  1N62 A;  3NZS A;  1YIW A;  2G45 B;  1FMA D;  2M19 A;  5D2M B;  5AZH A;  3Q14 C;  3RNB C;  1VD2 A;  1RFK A;  2J0K A;  1NYQ A;  4F8C B;  2QJL A;  2JUO A;  4IUM B;  2RPQ A;  1FIQ A;  1BML C;  1RM6 C;  4HK2 A;  3M63 B;  1UWX A;  4YSY B;  4ICV A;  1YJI A;  1M94 A;  2N7E A;  2NS5 A;  1N5X A;  3Q3O C;  1QZE A;  2CJO A;  5AUI A;  2WDQ B;  2I1K A;  2VRR B;  5G55 A;  1E8W A;  3ZDM C;  1P0R A;  2WXI A;  1E8Z A;  2YEP B;  2KK8 A;  1TZO A;  4MAC A;  1R4M B;  4EOY A;  4JWS C;  3GOE A;  3NJT A;  4ANW A;  1BT0 A;  4M01 A;  3NG0 A;  2KQ4 X;  4MM3 A;  2FUG 1;  5IAA C;  3P42 A;  3RNF C;  3H6N A;  3P4P B;  4XDC A;  1MPE A;  3PRM B;  2AX5 A;  2KMC A;  1DYQ A;  4M02 A;  2RDB C;  1CQV A;  2GBK A;  2DWQ A;  1TY2 A;  3NOB A;  1Z5S B;  3U2S C;  1SIF A;  4NAM A;  3M95 A;  1T0Y A;  2C7H A;  4PYU A;  1L4D B;  2FCQ A;  3ZRF A;  4I6P A;  4BOZ B;  1D5X C;  1YD8 U;  3APC A;  3NVZ A;  4GDL A;  4REZ A;  4HPP A;  1JRP A;  1WGD A;  3DBL I;  2V3S A;  1JWU D;  1P7E A;  3OJ3 A;  4WH4 A;  3VXW A;  1AN8 A;  4RNA A;  1HZ6 A;  2BYF A;  4WUR A;  3AXC A;  1UF0 A;  3TEY A;  2KWU B;  3PLV A;  1L0X B;  4MH8 A;  4WJP A;  5GMV A;  2KD0 A;  4R3D A;  1L0Y B;  4KGS A;  3BIN A;  4L2Y A;  3AE3 B;  2K5P A;  3DBR I;  1ZKH A;  4XZ4 A;  1BUI C;  1L2N A;  3Q3F A;  3A9J B;  1SB3 C;  4G3X B;  3C0R B;  4XX5 A;  3L17 A;  4W9D A;  4TKN A;  2NBU A;  4TQ1 A;  5TSS A;  5KHQ A;  4A9A A;  1K52 A;  1I4R A;  3B08 A;  3ETR A;  1C76 A;  2BB5 A;  2MX2 A;  2KTR B;  4P6V F;  2J0M A;  3QCA A;  4AP4 C;  5L83 A;  4TUU A;  3ZNI D;  3QHT A;  4YL8 A;  5MPO A;  1WRD B;  4TV3 A;  2ON8 A;  4IWQ A;  2J53 A;  1IGC A;  3LJ3 A;  5C3J B;  3QAR A;  2BT6 A;  2C9W B;  2D5G A;  4ZYS A;  5JHA A;  2HE7 A;  3LYY A;  4MJS B;  2JZZ A;  2RDG A;  1WH3 A;  2WU2 B;  2DAJ A;  4DHZ E;  1YX5 B;  4ZOH C;  1FRD A;  3T9L A;  2LHE A;  3PRP B;  3CSF A;  3DHI C;  4XWW A;  3HVD A;  4DWF A;  3APF A;  3H7P B;  4W9E A;  3DBS A;  2CKH B;  2NVU I;  2IYD B;  3A9J A;  1WFY A;  4W9C A;  2K8H A;  4KGT A;  3JSV B;  3B1L X;  1A5R A;  4F7Z A;  2ICI A;  4TMA B;  1TBE A;  3NZ3 A;  1KFY B;  2QIE B;  3X0W A;  2IGG A;  1QLB B;  3Q8C A;  1KM7 A;  1VR9 A;  5EE9 A;  2KTR A;  1OQR A;  4US9 A;  2BS2 B;  3A9K B;  1KRH A;  2O2V B;  2REX A;  3TUO A;  4DHZ B;  3DQV A;  2RDH A;  5C23 A;  2LRU A;  3Q69 A;  3VR9 B;  1NBF C;  2KFK B;  1V5O A;  2WXQ A;  1DGJ A;  4MJS A;  5E6O A;  1SBB B;  1WGK A;  3HK0 A;  5HG2 A;  3J9C A;  4P1C C;  4OZB A;  2WQY B;  2IGD A;  3V61 A;  2NPT B;  1RYJ A;  1UH6 A;  1EF1 A;  5FKA C;  3VFK A;  2JRH A;  2VZK B;  3VQI A;  1KTK A;  2PIA A;  3IBE A;  4KDI C;  1WX7 A;  3TSS A;  3ABV B;  1JW9 D;  3HHM A;  2WYQ A;  5D94 A;  3L08 A;  4JGH B;  2ZPY A;  4MGZ E;  2IPK D;  1WXS A;  2JPH A;  2BVC A;  2ZNV B;  2Y5C A;  2LMC A;  1ZDX A;  4OVU A;  2GRI A;  3N20 C;  1V1P B;  3GB1 A;  2A5U A;  3BYT B;  3DCG A;  4W9K A;  3R8B A;  1XLO A;  1K51 A;  1JAL A;  1NEK B;  3VRB B;  1DOI A;  3DHH C;  4IC7 B;  1OEY A;  3D32 A;  4KKI A;  3ZVV A;  1WMH B;  3VUW A;  5IN7 A;  3A9K A;  1XCQ L;  4URK A;  2MH7 A;  1KLU D;  2K6Q A;  1I42 A;  3ZJV A;  1PGB A;  4K7W A;  3SDL C;  2KFK A;  1OFF A;  5BO4 B;  1V97 A;  1V49 A;  3RUL A;  4NJ6 A;  5BMH A;  3Q8E A;  4WJN A;  2WX1 A;  2PE6 B;  2NPT A;  2L3Z A;  1VDV A;  3KUD B;  1N6Z A;  2PJH A;  3DBH I;  4K1R B;  5D7G A;  4KSK C;  4W9G A;  2KDF B;  2D10 A;  2GBJ A;  4K81 A;  1AWD A;  2IGH A;  2NBW B;  2M0A A;  3VTW A;  2PMV A;  1P9D U;  1ESF A;  1WM2 A;  3AEF B;  3QK0 A;  2KAJ A;  3ZRC A;  4BVU C;  3RD2 A;  2CU1 A;  2M0X A;  2DX5 B;  4FA6 A;  1SF0 A;  2M4N A;  1V1P A;  2FAZ A;  2FID A;  5HHD G;  1V86 A;  2BYV E;  1C4A A;  1TJE A;  4BFR A;  2Y5B B;  3VTU A;  1MFW A;  4HXD A;  2AL6 A;  3A4S C;  4DQO C;  2MSE D;  3U52 E;  3W1S A;  2WDV B;  1VZ7 A;  2IND C;  2OHF A;  2DYO A;  3CST A;  1VCB A;  2CJN A;  2ONQ A;  3HM3 A;  2ZCC A;  2L8J A;  2G1E A;  2AQ3 B;  3A4R A; 
#chains in the Genus database with same CATH homology
 3TEW A;  4JPS A;  2MJ3 A;  2WDR B;  1FCC C;  3IAM 1;  1E10 A;  1N5W A;  1YMH E;  5LNK 1;  3LB8 C;  1T5X D;  1QOB A;  3MJ5 A;  1R7S A;  1P7F A;  3HRD D;  4LK0 M;  1GTE A;  1GB1 A;  4XDD A;  1TS4 A;  1M4V A;  2WXM A;  3N9Y C;  3ZQ4 A;  3KWL A;  4C7Z A;  1YN5 A;  2NMQ A;  3HUI A;  4RH6 A;  3E9S A;  2AQ2 B;  5GXG B;  1DOY A;  3BVG A;  2K9X A;  1MVK A;  3EGR A;  2QIL A;  4HRO A;  4MM3 B;  1XEE A;  3PZ7 A;  1GPX A;  4YT0 B;  1ZUD 2;  1CJE A;  2WS3 B;  1ZPS A;  2WXF A;  2JXT A;  2PLP A;  2WP9 B;  2V3N A;  1D5M C;  1JWS D;  4RGN A;  2JX5 A;  2WNM A;  4IOI E;  1XF5 L;  4J3O D;  1N62 A;  3MC0 B;  3AE9 B;  1ZDV A;  4RFB A;  1FMA D;  2M19 A;  1F77 A;  3RFZ B;  2EEL A;  3O13 A;  3Q8A A;  2V0G A;  2GB1 A;  1K50 A;  3AB5 A;  3URY A;  1RFK A;  1NYQ A;  3SFE B;  2QJL A;  1J7C A;  1FNU A;  1QOF A;  4GDK B;  2JSV X;  1WXQ A;  4Q2J A;  2W3S A;  3AN1 A;  3AEG B;  3FIL A;  1F0Z A;  1I4P A;  3CIR B;  2KWD A;  2PW9 A;  4FXC A;  2NTS A;  1FIQ A;  2W54 A;  1FXA A;  1I4X A;  1FNW A;  1NI3 A;  1BML C;  1RM6 C;  3B9J A;  3PZ8 A;  4ZHP A;  4RF0 A;  1AW7 A;  3L4P A;  2INN E;  1UWX A;  4ITK A;  4YSY B;  1YJI A;  5E6J A;  1T3Q A;  3DWG C;  1XLN A;  1ZE3 D;  1TKY A;  1IGD A;  1N5X A;  2JYE A;  4KX6 B;  2CJO A;  5AUI A;  1C79 A;  1UWM A;  1GB4 A;  1HA5 A;  2WDQ B;  2MEK A;  2L83 A;  1PYW D;  1L4Z B;  4N6E B;  1L6U A;  1KLG D;  1JCK B;  3T3O A;  2WXI A;  2E6X A;  2YEP B;  1ROE A;  1TZO A;  4L1B A;  3AED B;  1FXI A;  4MAC A;  1WWT A;  3EA6 A;  1EWY C;  2IDY A;  4EE2 A;  2BYT A;  4JWS C;  1QQR A;  2Y5P A;  2LFI A;  2W82 A;  4YSZ B;  2YEP F;  1V8C A;  4AS1 A;  1UNS A;  4TSS A;  1I7H A;  1D5Z C;  2K3U A;  1L6V A;  2KQ4 X;  3IT4 B;  2FUG 1;  3P42 A;  3AEB B;  2I38 A;  2I2Y A;  3P4P B;  1KH0 A;  4OHJ A;  4XDC A;  1MPE A;  1AYF A;  4XWT A;  1C77 A;  2AX5 A;  2DLB A;  1IBX B;  1DYQ A;  2L1A A;  4JX1 C;  4WQM A;  5AUK A;  1HZ5 A;  1CQV A;  1EU4 A;  1I4H A;  4JWU C;  2DWQ A;  2V4I B;  1C78 A;  1TY2 A;  2BS4 B;  3V3X A;  3BK1 A;  2JZP A;  3U2S C;  5FK9 C;  4NAM A;  1C4P A;  3W5V B;  3ZJT A;  2RMM A;  1VZ6 A;  1L4D B;  5BMI A;  2MJD A;  4HRS A;  2WU5 B;  4H2A A;  1D5X C;  1WRI A;  2PTL A;  5I4D A;  3NVZ A;  1J7A A;  2BW2 A;  4DXG A;  4USA A;  2WXG A;  4NJC A;  4REZ A;  2FBW B;  1I4G A;  1JRP A;  4WH4 A;  2QMT A;  1XLQ A;  1JWU D;  3AE8 B;  1P7E A;  2J42 A;  1H7W A;  2NTT A;  1AN8 A;  1HEZ E;  5EE3 A;  4RNA A;  1B1Z A;  2WXR A;  1HZ6 A;  4WUR A;  1VJK A;  4A8X C;  1ACC A;  3AE2 B;  3TEX A;  3AV8 A;  1GOZ A;  3TEY A;  4D2K A;  2WXP A;  1TS3 A;  2QSD A;  1CK1 A;  1SEB D;  3ZJU A;  2JYT A;  1L0X B;  4C80 A;  1OQQ A;  4MH8 A;  1YNT E;  2XN9 C;  4TQ0 A;  4P16 A;  4R3D A;  1L0Y B;  4KGS A;  1VZ8 A;  1QKZ A;  2Z8L A;  2G9H D;  1STE A;  5BYR A;  3KQ4 A;  5BYQ A;  4L2Y A;  3AE3 B;  2K5P A;  1B9R A;  5BMG A;  1LO5 D;  2B76 B;  4US8 A;  1TY0 A;  3SFD B;  1BUI C;  3SEB A;  3ZYY X;  1EM7 A;  1QIL A;  1SE4 A;  1SB3 C;  3P4R B;  2J52 A;  2ACZ B;  4JE3 B;  5JXV A;  1QOG A;  1MI0 A;  2WLB A;  1IBX A;  3T3N A;  4C56 C;  1C4C A;  3WCQ A;  4TQ1 A;  3AM9 A;  5TSS A;  2BTE A;  2CU3 A;  4A9A A;  1K52 A;  1I4R A;  1QT9 A;  2JQR B;  1JWM D;  2RPV A;  1E9M A;  1SE2 A;  4B0M A;  2PVG C;  2BBC A;  4RGM A;  3ETR A;  1C76 A;  1PFD A;  2MJE A;  3GS2 A;  1SSN A;  2BB5 A;  2KN4 A;  4A6Q A;  1SIJ A;  4P6V F;  3BZD B;  1ZXH A;  1L0V B;  3GP7 A;  1ET9 A;  1NYR A;  2SAK A;  3CF4 A;  4OVZ A;  3ZGZ A;  1SXT A;  5MPO A;  4ARC A;  4IKG A;  3P4Q B;  2ON8 A;  2Y3A A;  4B0E A;  4IDI A;  2J53 A;  1DOX A;  1IGC A;  4NZL B;  5C3J B;  3TEZ A;  2BT6 A;  2D5G A;  3AEE B;  4PT5 A;  4ZYS A;  1IUE A;  3C8Y A;  3MP9 A;  1TS2 A;  3LYY A;  3V05 A;  2RDG A;  2WU2 B;  3BVM A;  1L5P A;  1E6E B;  2WXL A;  2INP E;  4C7Y A;  2Q5W D;  1ZOY B;  1CZP A;  1QF6 A;  4ZOH C;  4A55 A;  1GT8 A;  4UDU C;  2DYM A;  4YTM B;  1FRD A;  3BYY B;  5BYS A;  2LHE A;  1WSP A;  1E0Z A;  4HKZ E;  4XE0 A;  2BS3 B;  4ARI A;  4RGO S;  4XWW A;  3VR8 B;  2L52 A;  3HVD A;  4YTP B;  2W3R A;  3NVY A;  4CQN A;  1ET6 A;  2QEJ C;  1JML A;  4KGT A;  4KKJ A;  1FCL A;  2BB6 A;  1N61 A;  4RGT A;  2ICI A;  2N0S B;  4GLS C;  4TMA B;  3NZ3 A;  3MFG A;  1KFY B;  2QIE B;  1T6B X;  2IGG A;  1QLB B;  3NVW A;  3Q8C A;  1VR9 A;  3AE5 B;  4WWM A;  5EE9 A;  1OQR A;  3P63 A;  5FR3 A;  1SJE D;  4US9 A;  1YQ3 B;  2BS2 B;  1D6E C;  3IXS A;  3RPF C;  3SR6 A;  2HTM E;  1NEN B;  1ZXI A;  1MHX A;  1YN4 A;  2WXN A;  4L23 A;  1KRH A;  3TUO A;  4O1N A;  2RDH A;  3AH7 A;  3CWI A;  2H88 B;  3BWU D;  3W5U B;  2ZW1 A;  3Q69 A;  3VR9 B;  3P4S B;  1JWB D;  3PO0 A;  3LXF A;  5T8I A;  2V3P A;  4ZRP A;  1XXG A;  3BII D;  2WXQ A;  1DGJ A;  1SBB B;  1WGK A;  3AEA B;  5HG2 A;  4N58 A;  3J9C A;  1FFU A;  1Q10 A;  1YQ4 B;  2LGI A;  3AMZ A;  4HEA 1;  2WQY B;  2XNA C;  2IGD A;  4OZB A;  4WAF A;  1RYJ A;  1PDX A;  2N9K A;  5FKA C;  2VZK B;  3VQI A;  1UGJ A;  1KTK A;  1N60 A;  1WYG A;  2PIA A;  3Q8B A;  2PVO D;  4ZHO A;  1H7X A;  1XLP A;  3E56 A;  4WIP A;  2KDM A;  4M0W A;  3TSS A;  3ABV B;  1JW9 D;  1E7P B;  1N63 A;  1JQ4 A;  2L32 A;  5HI1 A;  1BXT A;  1PUT A;  3NVV A;  2IPK D;  1PGA A;  1D4B A;  1FFV A;  3R2T A;  2Y5C A;  2N7J A;  2LMC A;  1ZDX A;  4RF1 A;  1TKG A;  1JRO A;  3NRZ A;  2GRI A;  3DWM A;  3I9V 1;  3R2I A;  3W9C B;  2PKO A;  1FRR A;  1RWS A;  5EE1 A;  1V1P B;  4LTU A;  3GB1 A;  3BYT B;  3R8B A;  1VLB A;  1XLO A;  1K51 A;  1F2R I;  1K53 A;  2WXK A;  4HKQ A;  1JAL A;  1PGX A;  5H8Y E;  1NEK B;  3VRB B;  2LJI A;  3B2G A;  1FEH A;  2OED A;  1DOI A;  1A70 A;  5HFY A;  1TYG B;  4KKI A;  2LHD A;  2WXH A;  2H89 B;  1XCT L;  2LEK A;  3B2F A;  4MT5 A;  1C9F A;  1XCQ L;  2AQ1 B;  2X38 A;  2E3T A;  2WXO A;  2MH7 A;  1J7B A;  1KLU D;  3I57 A;  3ZJV A;  1PGB A;  4N59 A;  4YSX B;  2GI9 A;  4RCO A;  1UUP A;  3KWV A;  4ZRQ A;  1OFF A;  4LLG M;  1V97 A;  1FM0 D;  4KGR A;  5EE0 A;  5H92 C;  3BVZ A;  3IT6 B;  4GDL B;  3AE1 B;  4OZA A;  5BMH A;  1ENF A;  3Q8E A;  4NAW B;  5C2T B;  4YTN B;  1GTH A;  4YWG G;  3VRA B;  4OZC A;  1SJH D;  1VDV A;  2JWU A;  1FD6 A;  3AE4 B;  3FC4 A;  2K22 A;  5D7G A;  2R61 A;  3AE7 B;  3U7Z A;  1F2R C;  2M56 B;  1VRA B;  1JWA D;  4HJG E;  1AWD A;  2IGH A;  2M0A A;  2PMV A;  3HVZ A;  1YJJ A;  1ESF A;  1SE3 A;  3FAH A;  3P1M A;  3Q8F A;  1ZP0 B;  3AEF B;  1FNV A;  1QOA A;  2KAC A;  2KAJ A;  4A90 A;  3EUB 2;  1NVI D;  1TS5 A;  1SF0 A;  1V1P A;  3MHZ A;  3NUH B;  3AEC B;  1MHH E;  1KF6 B;  3BK2 A;  1EU3 A;  2IJ0 A;  5G5G A;  5HHD G;  2ZW0 A;  3IAS 1;  3UI3 A;  1C4A A;  1TJE A;  1V1O A;  2DBY A;  2K0P A;  4AQ7 A;  3U4E G;  2SEB D;  2EKI A;  2HDE A;  4OW0 A;  2WXJ A;  4DQO C;  2N9L A;  1I4Q A;  3U52 E;  1HQR D;  1HXY D;  3W1S A;  3AE6 B;  2WDV B;  1VZ7 A;  2J4X A;  2KMM A;  5D3D A;  2OHF A;  3FIL B;  1FO4 A;  1TKE A;  2VZK D;  1GAQ B;  2DYO A;  4DXF A;  3OWE B;  2LUM A;  3W2D A;  5G5H A;  3KLS X;  1Y56 A;  2CJN A;  2ONQ A;  5D3I B;  1XO3 A;  2JU6 X;  4YXD B;  2W55 A;  2TSS A;  2G1E A;  3NS1 A;  2AQ3 B;  1EWC A;  3H8H A;  1YN3 A;  2FE8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...