5JZEB

Erve virus viral otu domain protease in complex with mouse isg15
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
76
structure length
76
Chain Sequence
PLSILVRNERGHSNIYEVFLTQTVDTLKKKVSQREQVHEDQFWLSFEGRPMEDKELLGEYGLKPQCTVIKHLRLRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Ubiquitin-like protein ISG15
publication title Biochemical and Structural Insights into the Preference of Nairoviral DeISGylases for Interferon-Stimulated Gene Product 15 Originating from Certain Species.
pubmed doi rcsb
source organism Mus musculus
total genus 21
structure length 76
sequence length 76
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5jzeB00
1E5WA 4TUUA 1WXAA 3PPAA 2IY1B 2GMIC 3ZLZA 1V49A 3EHVA 3T9LA 2DZMA 4OVVA 2G4SA 2LZ6A 4IG7B 4J6IA 2KWCA 1Q5WB 3PVLA 2LWPA 1A5RA 1C3TA 2KJ6A 4W9DA 4FLHA 1GG3A 3H7SA 1TTNA 3PLUA 3TMPB 2V4LA 2J0JA 2JRIB 4JLCA 5IA7A 1IYFA 4IWOA 5KHQA 3EECA 5J2RA 3IVFA 5DCNA 3JYUA 1ZKHA 3HIZA 5AZGA 4ZRKA 3X0WA 2Z0DB 3L10B 1V80A 2D2QA 1C1YB 1WJ4A 2NBUA 3OAWA 4MGKE 5CHFA 1WJUA 1SGHA 2M8SA 5DPSA 5LLIA 3VVWB 3R7QA 4A3PA 4G3XB 5L95C 2PJHA 5C1ZA 3U8ZA 1JRUA 1VCBA 1J8CA 2MWSB 3TIXA 4F1SA 1YX6B 1UBQA 4I6LB 1WF9A 4GU2A 5LXIB 4IM3A 3W1SA 4MGYE 1WX7A 2JVCA 1E8XA 4GDKA 2MX2A 4KSKC 3X23A 3ZRCA 3ZVVA 5D7GA 4K7UA 5AEKB 5HKHA 1M94A 2GBRA 3UGBB 2IYDB 4GB9A 2WDTB 3ZNHB 2KZRA 4GGQA 1P0RA 2KD0A 2KWVB 3ZDMC 1H8CA 2WYQA 1U4AA 3APFA 2BYFA 3PSEB 3R66C 2BYVE 4RMAA 3U7DA 4GXBA 3VFKA 3HM6X 2FIDA 3KUDB 2BKRB 4JGHB 1GJZA 1F9JA 2KDIA 4MSQB 3OLMD 2RGFA 4N9F4 2CU1A 4FN2A 3VUWA 1WGRA 2KMAA 3VH3B 4ZDVA 4FHKA 2L7RA 1LFDA 3DPDA 2M0XA 1WR6E 2KKCA 2KTRA 2EKEC 3PT2B 1RLFA 2C7NB 1R4NI 4EUTA 3HM3A 3C0RB 3UF8A 2ZVOA 2GBMA 4KZCA 1AARA 1WZ0A 2G45B 3VXWA 2RR9A 2DHZA 5JH5C 3ML9A 2ZVNA 5IAAC 2KLCA 4G50A 4PS7A 2KHWB 3VTVA 3PLVA 2YLMA 5D6JB 4KDIC 4I6NB 2O6VB 4ANXA 3ZTDA 1E8WA 2K25A 3VH4B 3A9KA 4WAAA 3QHTA 2JPHA 3A1QA 3DOWA 2MLBA 4AUQC 1T0YA 4BVUC 2FIFA 3CSTA 4M0WB 5GMVA 2N7EA 2KANA 2CS4A 4LJPB 4MM3A 3R7RA 5BO4B 4W9JA 4ANVA 4BBNF 3OJ4B 4BKSA 2PE6B 4GDLA 3V61A 3EC8A 4NPNA 1E7UA 1GC6A 1BT0A 2O6VD 2VRRB 3ML8A 2HD5B 3JSVA 4GN1A 4XZ4A 5G2NA 1UH6A 1RRBA 3JVZX 1Y8RC 2PEAA 2ZJDA 2C7MB 4E3CA 3ENEA 3TJPA 3VAWA 4EZKA 3EFUA 4HK2A 4M8NA 2N4FA 3DCGA 3S2AA 3CSFA 3SDLC 4MELA 3BINA 1NDDA 1KM7A 3A1QB 3A33B 4ICUA 2BPSA 2LI5A 1V9JA 3HK0A 3K9PB 4FHJA 2NCNA 1ZW7A 2ZNVC 3ONSA 2O2VB 3U30A 3ZNZB 5JZEB 1WFYA 2KX0A 2CHWA 2FCQA 4NAWA 3V62A 3BY4B 1UZXB 2C7HA 3V60A 3CMMB 5CX3A 1D3ZA 2KFKB 2JZZA 4PS8A 4HCNB 2KDEB 4W9HA 3ZO5B 4AP4C 1G6JA 3TBLD 3AULA 1P3QU 2DYMA 4MGIE 4WJNA 2JF5A 2HE7A 4X57B 2KDBA 2C60A 1OEYA 4FJYA 1L2NA 1GC7A 4BKSD 4EOYA 3H7PB 2LD9A 1NI2A 2R2OA 2D10A 4II2B 1E7VA 2NBWB 4NJ7A 4AWJA 4GIVA 2DX5B 4XX5A 1YX5B 4URKA 3IFWB 4K7SA 5CTRC 2N9PC 4A3OA 4WWPA 5E6OA 3RUIB 1E90A 3NZUA 3UIOB 4HWIB 3ZNID 3TL5A 3APCA 2MBEA 2MBHA 3DVGY 3KYDD 5FR6A 3UQBA 1VD2A 2KNBA 4NAWB 3DDCB 1I35A 4ICVA 2M4NA 2K8CA 3B0AA 2LASA 3KUCB 3A9JA 4KSLC 2FUHB 4PS3A 2FCNA 3RD2A 3MHSD 2L0FA 3DBLI 4HDQA 4W9KA 3N30A 2K8BA 4CYEA 3KYCD 4KV2A 2GBKA 4MJSB 4DHJB 1YJ1A 1WM3A 3WA0A 5J18A 4DXAB 4KDLB 3AI5A 4MGZE 3VUYA 4CO7A 3QQ8B 3PGEA 2KXJA 4HVBA 3RYTA 4ZRJA 1E8ZA 2KC1A 5AZFA 2G3QB 2GOWA 2IBIB 4DWFA 4DDGD 3L54A 4IUMB 1GNUA 1WGGA 4HPMB 4LCDE 1H4RA 4ASWC 4DHJD 4NQKE 2EMTA 2N1VA 2GBJA 2JY6A 3A9JB 1UGMA 1WMHA 2KO3A 4W9EA 4K81A 4M8MA 2O6VA 4NJ6A 5G55A 1WR1A 1WY8A 3DVNU 3NOBA 5C23A 2LRUA 3IG3A 2BWES 1UELA 4IM2A 4F8CB 3VDZA 2D07B 2NVUI 3WAPA 1UD7A 1WYWB 4YL8A 2L76A 2BWFA 3QA8A 1XD3B 1P1AA 2ASQA 2Z59B 1GUAB 4GSWA 3R3MA 1V6EA 2L0TA 2CHXA 3PREA 4RM8A 2DZJA 2Y5BB 2C5LC 2N9EB 3DBHI 3WIMA 1OEYJ 2IO3B 4JQWC 1Z5SB 4DBGA 4TV3A 3VTUA 2N9XA 5CHVC 3PS6A 1LM8B 4WQOB 2ZPNA 3HHMA 3LDZE 3PRPB 4G0NB 1WH3A 3PHXB 4NNJB 1WMHB 2JT4B 2UWQA 4W9FA 4MDKE 2XK5A 2DZIA 1HE8A 3SU8X 2KFJA 1K8RB 4IM0A 2NS5A 5CHWA 3CF6E 2ZNVB 2AEHA 4NY0A 1WGHA 1EO6A 1V5OA 4B95A 2OOBB 4WJQA 1XT9B 1P98A 2BKFA 4G11A 3VHTC 1LXDA 3ZW3A 1XQQA 1I42A 2J0MA 2O2VA 5J17A 1TZ1A 2RD0A 2JXXA 4K7WA 1J0GA 2FNJB 2QHOA 5JHAA 2KFKA 2AL3A 3MJWA 3AXCA 2AYOB 1WM2A 4W9IA 2L00B 2BGFA 3RZWC 1RAXA 4MEMA 3PRZA 2JRHA 2KQSA 2MCNB 2KOXA 3H7PA 4KZ0A 2XK5B 1J19A 2K6QA 1QZEA 2FCSA 2LUEA 4WJPA 5DPTA 3ZKJC 3KW5B 1WX9A 5EDSA 2G4DB 4DHZB 5L83A 2KJRA 3VUXA 4PYZA 2LXCA 4B6WA 2KX3A 4RM9A 2IO2B 3Q3FA 3QJZA 2JZ3B 2DYBA 4KVGB 3PTFC 5LXHA 3WAOA 2ZCCA 3W1SC 4EFOA 3RULA 2ZZPB 3UIPB 2M17A 4GOCA 4KIKA 4W9GA 4BOZB 4K1RB 3V6CB 2KK8A 1ISNA 2LRWA 4DK5A 3IHPC 3QX1A 4EKUA 3T8MA 4IC7B 4FA6A 2D3GA 2BYEA 3DBRI 2LGDA 4EZLA 4F7ZA 2IY0B 2I1KA 1OQYA 2PE9A 1NBFC 4MJSA 2CHZA 5E6NA 4HLEA 3PRMB 2XEWA 4ANUA 1WJNA 3PV1A 3KUZA 3KVFB 3M62B 2MA9B 4TQ0A 1L7YA 2FCMA 2NPTA 4HDOA 1KJTA 2LGYA 3ALBA 2N7DA 4DDID 2A4ZA 2J0KA 2MBQA 2R2QA 4KIKB 4HXDA 4MSMB 1SE9A 5AZHA 3L0WB 4FADA 4B9KA 3L16A 2L05A 1MG8A 4LDTB 3L13A 1R4MI 1V81A 1PQSA 2RPQA 2L3ZA 1WI0A 2MW5A 4AJYB 1E8YA 5DPRA 2M1MA 2WX1A 2KC2A 3QK0A 4CHKA 2KVRA 4IW0A 1P9DU 2WX0A 1YD8U 3P2BA 2KJHB 1OTRB 1WRDB 2Z0EB 4BOSC 4OVUA 4XC2A 3JW0X 4ZYNA 1V2YA 2MP2B 2MBBB 2NPTB 2ZCBA 3IBEA 4LDTD 2B3AA 5E6PA 3NS8A 2OJRA 4AOFA 2UYZB 3AU4A 5D94A 2DYOA 2HTHA 2DAJA 3PZDA 3M95A 3KH0A 2K6DB 3QC8B 3VQIA 1FXTB 2MSED 4W9LA 2GBNA 2CKHB 1EF1A 2AWTA 3I3TB 4JIOU 2IO1B 2J7QB 3N3KB 4LJOB 2D11A 3RZFA 4TKNA 2ZEQA 4ANWA 3ZDTA 2DENB 2XBBC 1S1QB 3WAMA 3L08A 2KTFA 1WJ6A 3QIJA 3VTWA 2A5UA 2BF8B 3UQAA 2HJ8A 3LJ3A 2IZVB 2V1YA 4P7IA 2L8JA 4JL9A 2LGXA 2IO0B 2AL6A 3ZRFA 1Q1OA 4TQ1A 4HCPB 3SD5A 2K8HA 2NR2A 2LXAA 1TBEA 3H6NA 3OJ3A 3ZNGC 1V86A 3A4SC 4PYUA 4BBNC 4BKGA 3UINB 4BFRA 4E71A 3WALA 3B08A 5D2MB 5TR5A 2KWUB 4GDKB 1V5TA 4AJWA 1IP9A 1WGDA 2I1JA 2JUOA 3ECIA 3M3JA 4WJOA 1ZGUB 2DAFA 1WXMA 2N1WA 4FJZA 1WXSA 3APDA 1WIAA 1CMXB 3AU5A 3ZUNA 5KHOA 5JHBA 1SIFA 3ZIMA 3GZNI 2YVCA 2JWZA 4MH0E 2EMSA 4EEWA 2LJ5A 4W9CA 4A20A 1Z2MA 3D32A 2ZPYA 4HPLB 3B1LX 2KN5A 3K9OB 1IPGA 2W9NA 3W1YA 2KQ7A 3L17A 4FULA 1WX8A 2KDFB 2LVQA 4FBJB 1YQBA 4IWPA 2K39A 3WANA 3A4RA 3MTNB 4NQLB 1EUVB 3QCAA 1EF5A 2KTRB 2DZKA 2NBVB 1OGWA 4I6PA 1WE6A 4DHZE 1KOTA 3O65B 2KMCA 4FJVB 4EZJA 2RSUA 1WGYA 3TCAA 3DVNV 1RFAA 3ZTCA 3N32A 3H9DA 1WZ3A 2LVPA 3NY5A 3V6EB 1UBIA 3QWZB 3NZSA 2PPHA 2K1FA 2WWZA 3GOEA 2MQJA 2C9WB 2MRPA 3DVGX 3PHWB 4WWNA 1X1MA 3SHQA 4ZRIA 4BKTA 2LVOA 3DQVA 3RCZA 1YIWA 3A9KB 2V3SA 4II3B 4IWQA 1WXVA 3QARA 3RT3B 3DBSA 1LQBA 1WE7A 2MBOA 2KLGA 5DPWA 4GDLB 2REXA 2MP2A 3H1UA 3NHEB 1Q0WB 1TGZB 2FAZA 3M63B 4HJKA 3QAQA 4GMVA 3Q3JA 4WWOA 4E74A 1KLVA 3JSVB 2CR5A 1S3SG
chains in the Genus database with same CATH superfamily
1D5MC 1FPYA 4IG7B 3PVLA 2KJ6A 2DBYA 2J42A 1TTNA 2LGIA 3DBLB 1YN4A 3ZJUA 3JYUA 2D2QA 1C1YB 1WJ4A 4MGKE 5CHFA 3I63C 4A3PA 5DPSA 5AUIA 2PJHA 2L32A 2ZW1A 3BK2A 3U8ZA 1JRUA 1J8CA 2XN9C 5LXIB 2VH2A 1JW9D 5HKHA 3AE3B 3X23A 1B9RA 4A6QA 2GBRA 1WYGA 3ZNHB 1VR9A 2KZRA 1P0RA 3AE1B 1U4AA 4RMAA 3U7DA 3HM6X 2FIDA 2BKRB 1PGAA 3PZ8A 5LNK1 3NVVA 4RGMA 2CU1A 1N61A 3W5VB 3VH3B 1ENFA 2L7RA 2EKEC 2C7NB 3IT6B 1NEKB 2LHEA 3AEBB 3DWGC 1WZ0A 2BB6A 2DHZA 5JH5C 5IAAC 1I7HA 4PS7A 3PLVA 5D3IB 4KDIC 1VZ8A 1UGJA 3ZTDA 1E8WA 4IOIE 3W9CB 3A1QA 4AUQC 2FIFA 2N7EA 2BBCA 4OZAA 1SSNA 2O6VD 2WXGA 2VRRB 3ML8A 1I4RA 3VR8B 4L1BA 3JSVA 3JVZX 4E3CA 2J4XA 3EFUA 3DCGA 3S2AA 2MJ3A 3BK1A 3R2IA 4C4VB 1KM7A 3AE8B 4FHJA 4WWMA 2ZNVC 2O2VB 1MHHE 2L1AA 3ZNZB 1OQRA 2Y3AA 1E10A 3V62A 1QILA 3BY4B 3V60A 5CX3A 2KFKB 2JZZA 1XCTL 1G6JA 3TBLD 3AULA 2DYMA 2JF5A 4X57B 2C60A 4BKSD 2LD9A 1NI2A 1DYQA 1YNTE 4II2B 4NJ7A 4XX5A 1LO5D 1UWXA 2L52A 1YX5B 4URKA 4K7SA 1WWTA 3WCQA 4HWIB 4N59A 4XWTA 3KYDD 5FR6A 3ZQ4A 2NMQA 3AE7B 1MHXA 2K8CA 3B0AA 2LASA 2FUHB 4HDQA 3N30A 2WDVB 2GBKA 4MJSB 1I4QA 4ARIA 4KDLB 2E3TA 4CO7A 2IGHA 3QQ8B 2WGSA 3RYTA 1E8ZA 3NZ3A 4DWFA 4IUMB 4HPMB 4ASWC 2EMTA 2JY6A 4K81A 4NJ6A 1WY8A 4L23A 1VDVA 2BWES 3NVWA 3R2TA 2D07B 3WAPA 4A55A 1UD7A 1VJKA 4YL8A 2AQ2B 4M0WA 3QA8A 1XD3B 2ASQA 2Z59B 4GSWA 5FKAC 2CHXA 2C5LC 3LB8C 1Z5SB 4DBGA 2WHIA 1D6EC 3LDZE 4G0NB 1WMHB 3W5UB 2JT4B 4PK1A 1JQ4A 1PYWD 1I4PA 5CHWA 4XDCA 4L2YA 2ZW0A 2WXIA 3VHTC 4KGTA 2MH7A 1I42A 2KT7A 3AEFB 2QHOA 3RN9C 1FCLA 1GPXA 2FE8A 3RZWC 1RAXA 3PRZA 2KQSA 3ZJVA 4LNIA 1J19A 2K6QA 1QZEA 2FCSA 4XDDA 2QJLA 4B6WA 2IO2B 5BYSA 4XGAB 4KVGB 2Z8LA 3PTFC 3WAOA 2ZCCA 1ROEA 3RULA 2ZZPB 3UIPB 2M17A 4W9GA 1IBXA 1SE2A 3MC0B 5IO9A 4JWUC 1OQYA 1LGRA 2CHZA 2K5PA 2XEWA 2W55A 2WXJA 2MA9B 2NPTA 3AM9A 1XLOA 1KJTA 3ALBA 4M00A 2J0KA 3KLSX 2W82A 2R2QA 4KIKB 4N6EB 1AN8A 1SE9A 2MJDA 3L16A 4KKIA 1PQSA 1TS5A 2MW5A 1N63A 4AJYB 2LGSA 2D3AA 2WX1A 2KC2A 3QK0A 4CHKA 1WRDB 2Z0EB 4OVUA 4XC2A 4ZYNA 2MBBB 2ZCBA 3OG5A 2INPE 2B3AA 2HJ1A 2E6XA 2G1EA 3AU4A 2DAJA 3M95A 3KH0A 2WXHA 3FAHA 4NJCA 5HHDG 3VQIA 2MSED 2D3BA 1TT5B 2AWTA 2IO1B 2J7QB 1KFYB 2ZEQA 4S17A 3L08A 3VTWA 4KX6B 2N0SB 3LJ3A 1C78A 4JE3B 2KACA 2LGXA 2IO0B 3ZRFA 1Q1OA 2NR2A 3H6NA 2ON8A 3ZNGC 1I4XA 1V86A 4PYUA 1FIQA 3WALA 1XO3A 2KWUB 1UUPA 1IP9A 1WGDA 3P4SB 2I1JA 2JUOA 3ECIA 4LTUA 3M3JA 4WJOA 1ZGUB 1QF6A 1F52A 3P1MA 4FJZA 1WXSA 2W3SA 1YJIA 5KHOA 1NI3A 2YVCA 2JWZA 2LJ5A 1Z2MA 1F1HA 3D32A 2KN5A 2W9NA 3W1YA 2INCC 1J7BA 2KDFB 1I4HA 4FBJB 4IWPA 2WXLA 4H2AA 3MTNB 4I6PA 2JX5A 3O65B 2AQ1B 4FJVB 1WGYA 2JZPA 1YOVB 2LVPA 5EE1A 3V6EB 3QWZB 3NZSA 1R7SA 1TKYA 4B0EA 1DOIA 2MQJA 2MRPA 3DVGX 3RFZB 1UF0A 2LFIA 3SHQA 3MFGA 2LVOA 3DQVA 3RI7C 1YIWA 3Q3OC 3DBSA 1LQBA 2G9HD 5DPWA 4FXCA 3NHEB 1TGZB 2WXNA 4YT0B 3JSVB 1S3SG 2NTTA 3J9CA 1QQRA 4KKJA 5BYRA 1IGDA 1HA5A 1V49A 4M02A 1Q5WB 2LWPA 1ACCA 1C3TA 4BZAA 3H7SA 1SIJA 3TMPB 3VR9B 1EWYC 2JRIB 5IA7A 5KHQA 1C76A 2K9XA 2WXRA 5J2RA 3FKYA 3X0WA 1V80A 2NBUA 5LLIA 3U2SC 1SGHA 1ET9A 4G3XB 4NAMA 3AEDB 2JXTA 1ZDXA 1FRDA 1VCBA 2MWSB 4F1SA 1YX6B 1UBQA 5IKCM 3AV8A 3TEXA 3V3XA 4FA6A 2JVCA 3ZRCA 1D5ZC 2I2YA 3UGBB 2IYDB 4GB9A 4GGQA 2KD0A 2KYWA 2WYQA 3R66C 2BYFA 3PSEB 2BYVE 2VZKB 4GXBA 3IAM1 3VFKA 3KUDB 4JGHB 1D4BA 2KDIA 4Q2JA 3OLMD 2RGFA 3N9YC 3GE3C 3MP9A 1L6VA 3GE8C 1ZPSA 4ZDVA 4FHKA 3DHHC 2M0XA 2KKCA 2KTRA 1RLFA 1R4NI 3IXSA 3DWMA 4ZHOA 2N7JA 4LLGM 3TSSA 2GBMA 3U4EG 1TY0A 2M19A 2G45B 2BT6A 2RR9A 4IKGA 1JWBD 2ZVNA 1RWSA 3P42A 2KHWB 1XEEA 2CU3A 1J7CA 1BXTA 4HRSA 2K25A 1FNWA 4WAAA 3NG0A 3DOWA 4BVUC 4C00A 2GRIA 4M0WB 3N20C 2CS4A 4MM3A 5BO4B 4BKSA 3OJ4B 3SR6A 3V61A 1T0QC 1GC6A 1BT0A 4GN1A 4XZ4A 5G2NA 3O13A 1RRBA 1Y8RC 2WU2B 3BVMA 3R8BA 2C7MB 4HK2A 1TY2A 2HDEA 2WDRB 5FK9C 4ZRPA 1NDDA 1E6EB 1ZDVA 4ICUA 1CJEA 1V9JA 2RDHA 1OQQA 1ZW7A 5JZEB 2CHWA 4AQ7A 2D3CA 1UZXB 3RNCC 2KDEB 2HE7A 1KRHA 2KDBA 3MJ5A 4FJYA 1OEYA 1L2NA 1GC7A 3P4RB 4GIVA 2WXMA 3IFWB 4HPPA 2N9PC 1TYGB 4WWPA 5E6OA 3RUIB 1E90A 3LXFA 1KLGD 2KNBA 4NAWB 1I35A 3KUCB 2FUG1 2L0FA 3DBLI 3MHSD 4ARCA 1YJ1A 5J18A 4RF0A 2BTEA 3AI5A 2WDQB 1YJJA 3VUYA 2GLSA 4C56C 5D3DA 3I5JC 2GOWA 2IBIB 3URYA 1GNUA 5HG2A 1CK1A 3A9JB 1UGMA 2KO3A 4OZBA 4M8MA 5C23A 3KWLA 4IM2A 2I38A 4AS1A 4XYCA 2MJEA 2QEJC 1WYWB 1DOXA 1V6EA 1QLBB 2DZJA 3HUIA 2IO3B 4JQWC 4TV3A 2VH1A 3VTUA 1EU4A 1LM8B 4WQOB 2H88B 3AE5B 2ZPNA 3PHXB 1HZ6A 4USAA 4W9FA 3Q3NC 3CF6E 3Q14C 1WGHA 4WJQA 1P98A 3IT4B 2QILA 2V4IB 3ZXVA 2EELA 4K7WA 1NYRA 2R61A 2FNJB 1JROA 3MJWA 2AYOB 1IUEA 2BGFA 4OHJA 2JRHA 2RPVA 3VRAB 3DHGC 3H7PA 4KZ0A 3CWIA 2XK5B 4WJPA 4RFBA 1FCCC 1WX9A 2MHJA 5EDSA 2G4DB 4DHZB 2KJRA 4PYZA 3SFDB 3Q3FA 1KLUD 1YQ3B 2DYBA 3W1SC 4EFOA 2K3UA 4CQNA 3V6CB 1ISNA 2AX5A 2LRWA 3Q2AC 4DK5A 3IHPC 1M4VA 4EKUA 2JQRB 3T8MA 4IC7B 3GS2A 2D3GA 2BYEA 2LGDA 4F7ZA 1NBFC 2J53A 1C4CA 4HLEA 4ANUA 1WJNA 3PV1A 2PVOD 2FCMA 2LGYA 1N6ZA 2N7DA 2MBQA 4MSMB 4RGNA 5AZHA 4FADA 1YN3A 2RPQA 2L3ZA 5H8YE 4ACFA 5EE3A 1YQ4B 1WSPA 2KVRA 3BYYB 3SEBA 1P9DU 3Q8FA 1YD8U 4ZOHC 3P2BA 1FFUA 4REZA 4WH4A 3JW0X 1EU3A 1JWUD 3IBEA 5GXGB 5E6PA 4AOFA 5D94A 4R3DA 2PIAA 2JYTA 4W9LA 2GBNA 2CKHB 3I3TB 1PGBA 1CZPA 2D11A 3UI3A 5C3JB 3EA6A 5G5GA 3ZDTA 1Y56A 2DENB 2XBBC 1E7PB 2KTFA 2A5UA 2IZVB 2V1YA 5G5HA 1K52A 4P7IA 4B0MA 4JL9A 2BB5A 4HCPB 2K8HA 2YEPF 2LXAA 3AH7A 3A4SC 4BBNC 3BZDB 3LYYA 2KQ4X 4E71A 4TMAB 4NZLB 2SEBD 2DLBA 4MH8A 1ZOYB 3APDA 3AU5A 2XNAC 4EEWA 3PO0A 3NVZA 1MG4A 4HPLB 4KGSA 1NYQA 4PT5A 2KQ7A 3L17A 3RNGC 3FC4A 3FILA 4WIPA 4P1BC 2UU7A 4NQLB 4M01A 1EUVB 2WXOA 2KTRB 2DZKA 2NBVB 4DHZE 3DVNV 1RFAA 3KQ4A 3NY5A 1HQRD 1BUIC 1F77A 2WWZA 3GOEA 2C9WB 3PHWB 2D5GA 2V3NA 4YSYB 4RNAA 4II3B 3KWVA 3QARA 4MM3B 1MI0A 2KLGA 2REXA 4E74A 3QAQA 4GMVA 3Q3JA 1KLVA 1WXAA 3PPAA 2IY1B 2GMIC 3EHVA 3T9LA 2DZMA 2JSVX 4OVVA 2KWCA 1SE3A 4RGTA 1A5RA 1F0ZA 2KN4A 3W2DA 2INNE 2J0JA 2Y5PA 4IWOA 1SE4A 2QMTA 2QDFA 3IVFA 5DCNA 1ZKHA 3HIZA 5AZGA 4ZRKA 2KMMA 2JWUA 2Z0DB 1L5PA 3OAWA 3VVWB 3HVDA 3TEYA 3R7QA 5L95C 1FD6A 5C1ZA 3TIXA 1JWAD 4I6LB 1WF9A 4GU2A 4MGYE 1WX7A 3BVZA 1E8XA 4KSKC 3ZVVA 4K7UA 1M94A 1STEA 2WDTB 2WLBA 1TKGA 2KWVB 1H8CA 2K22A 4A8XC 1L0YB 3TEWA 4RGOS 1GJZA 1F9JA 2WXPA 4MSQB 4YXDB 3DBHB 3VUWA 1FXAA 4C7YA 2KMAA 1WR6E 2VZKD 5FR3A 5BMHA 4LNFA 3HM3A 2ZVOA 2GI9A 2QCZA 3P4QB 1FFVA 3ML9A 2PTLA 3VTVA 2YLMA 5D6JB 4I6NB 1L0VB 3VH4B 3A9KA 1QOFA 1T5XD 3QHTA 2JPHA 3TEZA 1T0YA 5JXVA 3CSTA 5GMVA 2KANA 4LJPB 1DOYA 2PE6B 3I57A 1UNSA 4DXGA 3HVZA 3NJTA 1MFWA 2ZJDA 3ENEA 3TJPA 3VAWA 1GAQB 3BINA 4A90A 1TS3A 4C80A 3ZGZA 3A1QB 3A33B 5E6JA 2BPSA 2LI5A 3K9PB 5AUKA 2NCNA 5C2TB 3ONSA 3U52E 3MHZA 1WFYA 2KX0A 2FCQA 3EGRA 4ZRQA 1D3ZA 3DBRB 4W9HA 2L83A 2WXQA 4WJNA 2KDMA 2QC8A 5BMGA 4EOYA 3H7PB 3Q69A 1N60A 1K51A 1E7VA 4AWJA 2DX5B 2WNMA 4A3OA 3AE4B 1VZ7A 1MPEA 4LNNA 3NZUA 3ZNID 3APCA 2MBEA 2MBHA 3DVGY 3UQBA 5MPOA 1VD2A 3RNBC 2GB1A 3DDCB 5H92C 1XCQL 4KSLC 3U7ZA 4CYEA 3KYCD 4DHJB 2NTSA 3WA0A 1WM3A 4DXAB 1JCKB 1ZUD2 4ZRJA 3T3OA 5HI1A 4DDGD 1QKZA 1H4RA 1D5XC 4IDIA 2GBJA 4ZYSA 1WMHA 5EE0A 4W9EA 1XLPA 3NVYA 2O6VA 3IG3A 1UELA 4F8CB 2M0AA 5BMIA 2BWFA 1P1AA 1L0XB 3R3MA 4RM8A 3PREA 2Y5BB 2N9EB 3NUHB 3PS6A 4LK0M 5CHVC 3T3NA 2BYTA 3HHMA 1FM0D 1WH3A 4MT5A 1N62A 3RPFC 4NNJB 2SAKA 4MDKE 2DZIA 1HE8A 1SXTA 3SU8X 1K8RB 4IM0A 2NS5A 2ZNVB 2AEHA 4NY0A 1XF5L 1EO6A 1V5OA 4B95A 2OOBB 4G11A 1C4PA 2BKFA 4P6VF 3ZW3A 2N9LA 1XQQA 3AEGB 2J0MA 1TZ1A 2JXXA 1C79A 2KAJA 1WM2A 4W9IA 4S0RA 2J52A 3N1ZC 2MCNB 5DPTA 4US8A 3KW5B 1JALA 3VUXA 4RM9A 2Y5CA 2BQQA 3QJZA 2JZ3B 3V05A 4GLSC 3Q3MC 3AN1A 3N1XC 1KTKA 2ACZB 4WAFA 4KIKA 4BOZB 2KK8A 3ZJTA 5T8IA 1HZ5A 4XE0A 4EZLA 2IY0B 3ZXRA 5E6NA 3KUZA 2YEPB 3M62B 2JU6X 1L7YA 1SF0A 3EFCA 3ETRA 2PKOA 2A4ZA 1R4MB 2QSDA 3L0WB 4B9KA 1IBXB 4RCOA 3ABVB 4LDTB 3L13A 1R4MI 1V81A 3BIID 5DPRA 2M1MA 3CIRB 1J7AA 3RNFC 2MEKA 1OTRB 3BWUD 4DQOC 2NPTB 1L4DB 4OZCA 1N5WA 2OJRA 1TS2A 2HTHA 3PZDA 3BYTB 1AWDA 1F2RC 2BS2B 1EF1A 2RMMA 3N3KB 3TUOA 1IGCA 1SB3C 3RZFA 4TKNA 2FBWB 3PZ7A 1V1PA 3WAMA 4YSZB 2BF8B 2X38A 3SD5A 1TBEA 3B08A 5D2MB 5TR5A 1V5TA 3GZNB 3Q8EA 2IDYA 1WIAA 1CMXB 2DNFA 3AEEB 1SIFA 3ZIMA 3GZNI 2EMSA 1P7EA 4W9CA 4A20A 2ZPYA 3E56A 3B1LX 4HKQA 4ITKA 1IPGA 4FULA 4K3BA 1WX8A 2LVQA 3BVGA 2K39A 3A4RA 1ESFA 3QCAA 5IN7A 1KOTA 3AECB 1T0SC 4EZJA 1SJHD 1C77A 4LNOA 2ONQA 1FXIA 1UBIA 4WWNA 3AE9B 3A9KB 2V3SA 1WXVA 4JWSC 1C9FA 2V9HA 1RM6C 1WE7A 2MBOA 1SJED 2MP2A 2FAZA 3M63B 4HJKA 4WWOA 4HKZE 2WXFA 1E5WA 4TUUA 3ZLZA 4XWWA 2G4SA 2LZ6A 4J6IA 1GOZA 4W9DA 4FLHA 1GG3A 3PLUA 2V4LA 4JLCA 1IYFA 3OWEB 1NENB 3EECA 1HXYD 3HRDD 2IGDA 3L10B 1WJUA 2M8SA 3I9V1 2TSSA 1ZE3D 4RH6A 1EM7A 2V0GA 1UWMA 2KVZA 4IM3A 3W1SA 4ANXA 1SBBB 1A70A 4GDKA 2MX2A 5AEKB 5D7GA 4HJGE 5IOIA 1ZXIA 2LJIA 1Q10A 3ZDMC 3APFA 2CJOA 1FEHA 3RNAC 4K3CA 2N9KA 3AB5A 4N9F4 1RFKA 2RDBC 4FN2A 1QOGA 1WGRA 4N58A 1LFDA 3DPDA 3PT2B 4D2KA 4EUTA 4HEA1 3C0RB 3UF8A 4KZCA 1AARA 3VXWA 3IAS1 2KLCA 4G50A 2OJWA 2O6VB 2WU5B 4WQMA 3AE6B 1FNVA 4LNKA 3B2FA 1GB1A 2MLBA 3R7RA 4ANVA 4BBNF 4W9JA 2HTME 4YWGG 1PDXA 4GDLA 2Q5WD 2INDC 3EC8A 4NPNA 5EE9A 1MJDA 1YMHE 1E7UA 1WGKA 1V97A 3B2GA 5I4DA 2HD5B 4P1CC 1AYFA 1UH6A 3NS1A 2PEAA 4C7ZA 4WURA 1FRRA 4EZKA 4M8NA 2DWQA 2N4FA 3CSFA 3SDLC 4MELA 2K0PA 3MC9A 1PUTA 3C8YA 3HK0A 2LHDA 3U30A 4JPSA 4NAWA 2C7HA 3CMMB 1E9MA 4PS8A 4HCNB 3ZO5B 4AP4C 1P3QU 4MGIE 2OEDA 2PVGC 4JX1C 1V8CA 3AMZA 1KH0A 2LMCA 2R2OA 2D10A 1XXGA 2NBWB 5CTRC 2LUMA 3GP7A 3UIOB 1VZ6A 3TL5A 1C4AA 1TIFA 4ICVA 4EE2A 2M4NA 3A9JA 4PS3A 3RD2A 2FCNA 4W9KA 3VRBB 2K8BA 1JMLA 1VRAB 4KV2A 1TKEA 4J3OD 1JWSD 4MGZE 3PGEA 2KXJA 4HVBA 4YTPB 2KC1A 5AZFA 2G3QB 1L4ZB 1RYJA 1GB4A 3L54A 1WGGA 4LCDE 2OHFA 1V1OA 4DHJD 4NQKE 4QAYA 2N1VA 1SEBD 4YTMB 5G55A 1WR1A 3DVNU 3NOBA 3NRZA 2LRUA 1TS4A 3H8HA 3VDZA 2NVUI 1TJEA 2L76A 1GUAB 2L0TA 1MVKA 1WRIA 3DBHI 3WIMA 1OEYJ 2W54A 2N9XA 3PRPB 1T3QA 1E0ZA 2UWQA 2PLPA 2XK5A 2KFJA 2KWDA 4C4VA 4YSXB 2RDGA 1XT9B 2AQ3B 5HFYA 1LXDA 2O2VA 1V1PB 5J17A 3E9SA 2RD0A 1J0GA 3P63A 2PW9A 1HTOA 2KFKA 5TSSA 5JHAA 2WP9B 2AL3A 2B76B 3AXCA 2L00B 4MEMA 2H89B 1XLNA 1JWMD 3Q8BA 2KOXA 1FMAD 2LUEA 3ZKJC 2V3PA 5L83A 3Q8AA 2LXCA 2KX3A 1WXQA 1NVID 2ICIA 1K50A 5LXHA 2WS3B 2IPKD 4GOCA 4K1RB 1VLBA 1HTQA 3QX1A 2WQYB 1ZXHA 3RNEC 1P7FA 3DHIC 1EWCA 2W3RA 3Q6BA 3DBRI 2PE9A 2I1KA 4MJSA 1F2RI 3AE2B 2EKIA 3PRMB 3KVFB 2PMVA 4OW0A 4TQ0A 4HDOA 4UDUC 4DDID 1QOAA 4HXDA 4YTNB 1B1ZA 4OVZA 4BAXA 2M56B 2L05A 1MG8A 4P16A 2JYEA 1KF6B 1WI0A 1E8YA 4RF1A 4IW0A 2BW2A 2WX0A 2LEKA 2KJHB 4BOSC 1OFFA 4O1NA 2BVCA 1V2YA 2MP2B 1DGJA 4LDTD 3NS8A 3RMKC 1FO4A 2UYZB 1HEZE 2DYOA 1T0RC 2IJ0A 1BMLC 1ET6A 2K6DB 3QC8B 1FXTB 5IP4D 4JIOU 4LJOB 1QOBA 4ANWA 1S1QB 3L4PA 3QIJA 1WJ6A 3UQAA 2HJ8A 3C19A 2CJNA 2L8JA 3Q8CA 4HROA 4A9AA 2AL6A 1TZOA 4TQ1A 3N1YC 3B9JA 3OJ3A 1R4NB 4BKGA 3ZYYX 3UINB 4BFRA 1I4GA 4GDKB 4AJWA 1FNUA 5BYQA 1XLQA 2DAFA 1WXMA 2N1WA 4US9A 2QIEB 1L6UA 5JHBA 3ZUNA 2BS3B 4MH0E 1YN5A 1T6BX 3K9OB 1JRPA 4DXFA 2BS4B 4MACA 1CQVA 4TSSA 1PFDA 1YQBA 1AW7A 3WANA 3AEAB 1EF5A 1QT9A 1OGWA 3SFEB 1WE6A 2IGGA 3GB1A 2KMCA 2RSUA 3TCAA 3ZTCA 3N32A 3H9DA 2X8XX 1WZ3A 3MC8A 2PPHA 4ZHPA 2K1FA 1K53A 1ZP0B 1X1MA 4BKTA 4ZRIA 3P4PB 4KGRA 3RCZA 4IWQA 3FILB 3RT3B 3EUB2 4GDLB 3H1UA 1Q0WB 1PGXA 2WXKA 2CR5A 1N5XA
chains in the Genus database with same CATH topology
1E5WA 4TUUA 1WXAA 3PPAA 2IY1B 2GMIC 3ZLZA 1V49A 3EHVA 3T9LA 2DZMA 4OVVA 2G4SA 2LZ6A 4IG7B 4J6IA 2KWCA 1Q5WB 3PVLA 2LWPA 1A5RA 1C3TA 2KJ6A 4W9DA 4FLHA 1GG3A 3H7SA 1TTNA 3PLUA 3TMPB 2V4LA 2J0JA 2JRIB 4JLCA 5IA7A 1IYFA 4IWOA 5KHQA 3EECA 5J2RA 3IVFA 5DCNA 3JYUA 1ZKHA 3HIZA 5AZGA 4ZRKA 3X0WA 2Z0DB 3L10B 1V80A 2D2QA 1C1YB 1WJ4A 2NBUA 3OAWA 4MGKE 5CHFA 1WJUA 1SGHA 2M8SA 5DPSA 5LLIA 3VVWB 3R7QA 4A3PA 4G3XB 5L95C 2PJHA 5C1ZA 3U8ZA 1JRUA 1VCBA 1J8CA 2MWSB 3TIXA 4F1SA 1YX6B 1UBQA 4I6LB 1WF9A 4GU2A 5LXIB 4IM3A 3W1SA 4MGYE 1WX7A 2JVCA 1E8XA 4GDKA 2MX2A 4KSKC 3X23A 3ZRCA 3ZVVA 5D7GA 4K7UA 5AEKB 5HKHA 1M94A 2GBRA 3UGBB 2IYDB 4GB9A 2WDTB 3ZNHB 2KZRA 4GGQA 1P0RA 2KD0A 2KWVB 3ZDMC 1H8CA 2WYQA 1U4AA 3APFA 2BYFA 3PSEB 3R66C 2BYVE 4RMAA 3U7DA 4GXBA 3VFKA 3HM6X 2FIDA 3KUDB 2BKRB 4JGHB 1GJZA 1F9JA 2KDIA 4MSQB 3OLMD 2RGFA 4N9F4 2CU1A 4FN2A 3VUWA 1WGRA 2KMAA 3VH3B 4ZDVA 4FHKA 2L7RA 1LFDA 3DPDA 2M0XA 1WR6E 2KKCA 2KTRA 2EKEC 3PT2B 1RLFA 2C7NB 1R4NI 4EUTA 3HM3A 3C0RB 3UF8A 2ZVOA 2GBMA 4KZCA 1AARA 1WZ0A 2G45B 3VXWA 2RR9A 2DHZA 5JH5C 3ML9A 2ZVNA 5IAAC 2KLCA 4G50A 4PS7A 2KHWB 3VTVA 3PLVA 2YLMA 5D6JB 4KDIC 4I6NB 2O6VB 4ANXA 3ZTDA 1E8WA 2K25A 3VH4B 3A9KA 4WAAA 3QHTA 2JPHA 3A1QA 3DOWA 2MLBA 4AUQC 1T0YA 4BVUC 2FIFA 3CSTA 4M0WB 5GMVA 2N7EA 2KANA 2CS4A 4LJPB 4MM3A 3R7RA 5BO4B 4W9JA 4ANVA 4BBNF 3OJ4B 4BKSA 2PE6B 4GDLA 3V61A 3EC8A 4NPNA 1E7UA 1GC6A 1BT0A 2O6VD 2VRRB 3ML8A 2HD5B 3JSVA 4GN1A 4XZ4A 5G2NA 1UH6A 1RRBA 3JVZX 1Y8RC 2PEAA 2ZJDA 2C7MB 4E3CA 3ENEA 3TJPA 3VAWA 4EZKA 3EFUA 4HK2A 4M8NA 2N4FA 3DCGA 3S2AA 3CSFA 3SDLC 4MELA 3BINA 1NDDA 1KM7A 3A1QB 3A33B 4ICUA 2BPSA 2LI5A 1V9JA 3HK0A 3K9PB 4FHJA 2NCNA 1ZW7A 2ZNVC 3ONSA 2O2VB 3U30A 3ZNZB 5JZEB 1WFYA 2KX0A 2CHWA 2FCQA 4NAWA 3V62A 3BY4B 1UZXB 2C7HA 3V60A 3CMMB 5CX3A 1D3ZA 2KFKB 2JZZA 4PS8A 4HCNB 2KDEB 4W9HA 3ZO5B 4AP4C 1G6JA 3TBLD 3AULA 1P3QU 2DYMA 4MGIE 4WJNA 2JF5A 2HE7A 4X57B 2KDBA 2C60A 1OEYA 4FJYA 1L2NA 1GC7A 4BKSD 4EOYA 3H7PB 2LD9A 1NI2A 2R2OA 2D10A 4II2B 1E7VA 2NBWB 4NJ7A 4AWJA 4GIVA 2DX5B 4XX5A 1YX5B 4URKA 3IFWB 4K7SA 5CTRC 2N9PC 4A3OA 4WWPA 5E6OA 3RUIB 1E90A 3NZUA 3UIOB 4HWIB 3ZNID 3TL5A 3APCA 2MBEA 2MBHA 3DVGY 3KYDD 5FR6A 3UQBA 1VD2A 2KNBA 4NAWB 3DDCB 1I35A 4ICVA 2M4NA 2K8CA 3B0AA 2LASA 3KUCB 3A9JA 4KSLC 2FUHB 4PS3A 2FCNA 3RD2A 3MHSD 2L0FA 3DBLI 4HDQA 4W9KA 3N30A 2K8BA 4CYEA 3KYCD 4KV2A 2GBKA 4MJSB 4DHJB 1YJ1A 1WM3A 3WA0A 5J18A 4DXAB 4KDLB 3AI5A 4MGZE 3VUYA 4CO7A 3QQ8B 3PGEA 2KXJA 4HVBA 3RYTA 4ZRJA 1E8ZA 2KC1A 5AZFA 2G3QB 2GOWA 2IBIB 4DWFA 4DDGD 3L54A 4IUMB 1GNUA 1WGGA 4HPMB 4LCDE 1H4RA 4ASWC 4DHJD 4NQKE 2EMTA 2N1VA 2GBJA 2JY6A 3A9JB 1UGMA 1WMHA 2KO3A 4W9EA 4K81A 4M8MA 2O6VA 4NJ6A 5G55A 1WR1A 1WY8A 3DVNU 3NOBA 5C23A 2LRUA 3IG3A 2BWES 1UELA 4IM2A 4F8CB 3VDZA 2D07B 2NVUI 3WAPA 1UD7A 1WYWB 4YL8A 2L76A 2BWFA 3QA8A 1XD3B 1P1AA 2ASQA 2Z59B 1GUAB 4GSWA 3R3MA 1V6EA 2L0TA 2CHXA 3PREA 4RM8A 2DZJA 2Y5BB 2C5LC 2N9EB 3DBHI 3WIMA 1OEYJ 2IO3B 4JQWC 1Z5SB 4DBGA 4TV3A 3VTUA 2N9XA 5CHVC 3PS6A 1LM8B 4WQOB 2ZPNA 3HHMA 3LDZE 3PRPB 4G0NB 1WH3A 3PHXB 4NNJB 1WMHB 2JT4B 2UWQA 4W9FA 4MDKE 2XK5A 2DZIA 1HE8A 3SU8X 2KFJA 1K8RB 4IM0A 2NS5A 5CHWA 3CF6E 2ZNVB 2AEHA 4NY0A 1WGHA 1EO6A 1V5OA 4B95A 2OOBB 4WJQA 1XT9B 1P98A 2BKFA 4G11A 3VHTC 1LXDA 3ZW3A 1XQQA 1I42A 2J0MA 2O2VA 5J17A 1TZ1A 2RD0A 2JXXA 4K7WA 1J0GA 2FNJB 2QHOA 5JHAA 2KFKA 2AL3A 3MJWA 3AXCA 2AYOB 1WM2A 4W9IA 2L00B 2BGFA 3RZWC 1RAXA 4MEMA 3PRZA 2JRHA 2KQSA 2MCNB 2KOXA 3H7PA 4KZ0A 2XK5B 1J19A 2K6QA 1QZEA 2FCSA 2LUEA 4WJPA 5DPTA 3ZKJC 3KW5B 1WX9A 5EDSA 2G4DB 4DHZB 5L83A 2KJRA 3VUXA 4PYZA 2LXCA 4B6WA 2KX3A 4RM9A 2IO2B 3Q3FA 3QJZA 2JZ3B 2DYBA 4KVGB 3PTFC 5LXHA 3WAOA 2ZCCA 3W1SC 4EFOA 3RULA 2ZZPB 3UIPB 2M17A 4GOCA 4KIKA 4W9GA 4BOZB 4K1RB 3V6CB 2KK8A 1ISNA 2LRWA 4DK5A 3IHPC 3QX1A 4EKUA 3T8MA 4IC7B 4FA6A 2D3GA 2BYEA 3DBRI 2LGDA 4EZLA 4F7ZA 2IY0B 2I1KA 1OQYA 2PE9A 1NBFC 4MJSA 2CHZA 5E6NA 4HLEA 3PRMB 2XEWA 4ANUA 1WJNA 3PV1A 3KUZA 3KVFB 3M62B 2MA9B 4TQ0A 1L7YA 2FCMA 2NPTA 4HDOA 1KJTA 2LGYA 3ALBA 2N7DA 4DDID 2A4ZA 2J0KA 2MBQA 2R2QA 4KIKB 4HXDA 4MSMB 1SE9A 5AZHA 3L0WB 4FADA 4B9KA 3L16A 2L05A 1MG8A 4LDTB 3L13A 1R4MI 1V81A 1PQSA 2RPQA 2L3ZA 1WI0A 2MW5A 4AJYB 1E8YA 5DPRA 2M1MA 2WX1A 2KC2A 3QK0A 4CHKA 2KVRA 4IW0A 1P9DU 2WX0A 1YD8U 3P2BA 2KJHB 1OTRB 1WRDB 2Z0EB 4BOSC 4OVUA 4XC2A 3JW0X 4ZYNA 1V2YA 2MP2B 2MBBB 2NPTB 2ZCBA 3IBEA 4LDTD 2B3AA 5E6PA 3NS8A 2OJRA 4AOFA 2UYZB 3AU4A 5D94A 2DYOA 2HTHA 2DAJA 3PZDA 3M95A 3KH0A 2K6DB 3QC8B 3VQIA 1FXTB 2MSED 4W9LA 2GBNA 2CKHB 1EF1A 2AWTA 3I3TB 4JIOU 2IO1B 2J7QB 3N3KB 4LJOB 2D11A 3RZFA 4TKNA 2ZEQA 4ANWA 3ZDTA 2DENB 2XBBC 1S1QB 3WAMA 3L08A 2KTFA 1WJ6A 3QIJA 3VTWA 2A5UA 2BF8B 3UQAA 2HJ8A 3LJ3A 2IZVB 2V1YA 4P7IA 2L8JA 4JL9A 2LGXA 2IO0B 2AL6A 3ZRFA 1Q1OA 4TQ1A 4HCPB 3SD5A 2K8HA 2NR2A 2LXAA 1TBEA 3H6NA 3OJ3A 3ZNGC 1V86A 3A4SC 4PYUA 4BBNC 4BKGA 3UINB 4BFRA 4E71A 3WALA 3B08A 5D2MB 5TR5A 2KWUB 4GDKB 1V5TA 4AJWA 1IP9A 1WGDA 2I1JA 2JUOA 3ECIA 3M3JA 4WJOA 1ZGUB 2DAFA 1WXMA 2N1WA 4FJZA 1WXSA 3APDA 1WIAA 1CMXB 3AU5A 3ZUNA 5KHOA 5JHBA 1SIFA 3ZIMA 3GZNI 2YVCA 2JWZA 4MH0E 2EMSA 4EEWA 2LJ5A 4W9CA 4A20A 1Z2MA 3D32A 2ZPYA 4HPLB 3B1LX 2KN5A 3K9OB 1IPGA 2W9NA 3W1YA 2KQ7A 3L17A 4FULA 1WX8A 2KDFB 2LVQA 4FBJB 1YQBA 4IWPA 2K39A 3WANA 3A4RA 3MTNB 4NQLB 1EUVB 3QCAA 1EF5A 2KTRB 2DZKA 2NBVB 1OGWA 4I6PA 1WE6A 4DHZE 1KOTA 3O65B 2KMCA 4FJVB 4EZJA 2RSUA 1WGYA 3TCAA 3DVNV 1RFAA 3ZTCA 3N32A 3H9DA 1WZ3A 2LVPA 3NY5A 3V6EB 1UBIA 3QWZB 3NZSA 2PPHA 2K1FA 2WWZA 3GOEA 2MQJA 2C9WB 2MRPA 3DVGX 3PHWB 4WWNA 1X1MA 3SHQA 4ZRIA 4BKTA 2LVOA 3DQVA 3RCZA 1YIWA 3A9KB 2V3SA 4II3B 4IWQA 1WXVA 3QARA 3RT3B 3DBSA 1LQBA 1WE7A 2MBOA 2KLGA 5DPWA 4GDLB 2REXA 2MP2A 3H1UA 3NHEB 1Q0WB 1TGZB 2FAZA 3M63B 4HJKA 3QAQA 4GMVA 3Q3JA 4WWOA 4E74A 1KLVA 3JSVB 2CR5A 1S3SG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E5W A;  4TUU A;  1WXA A;  3PPA A;  2IY1 B;  2GMI C;  3ZLZ A;  1V49 A;  3EHV A;  3T9L A;  2DZM A;  4OVV A;  2G4S A;  2LZ6 A;  4IG7 B;  4J6I A;  2KWC A;  1Q5W B;  3PVL A;  2LWP A;  1A5R A;  1C3T A;  2KJ6 A;  4W9D A;  4FLH A;  1GG3 A;  3H7S A;  1TTN A;  3PLU A;  3TMP B;  2V4L A;  2J0J A;  2JRI B;  4JLC A;  5IA7 A;  1IYF A;  4IWO A;  5KHQ A;  3EEC A;  5J2R A;  3IVF A;  5DCN A;  3JYU A;  1ZKH A;  3HIZ A;  5AZG A;  4ZRK A;  3X0W A;  2Z0D B;  3L10 B;  1V80 A;  2D2Q A;  1C1Y B;  1WJ4 A;  2NBU A;  3OAW A;  4MGK E;  5CHF A;  1WJU A;  1SGH A;  2M8S A;  5DPS A;  5LLI A;  3VVW B;  3R7Q A;  4A3P A;  4G3X B;  5L95 C;  2PJH A;  5C1Z A;  3U8Z A;  1JRU A;  1VCB A;  1J8C A;  2MWS B;  3TIX A;  4F1S A;  1YX6 B;  1UBQ A;  4I6L B;  1WF9 A;  4GU2 A;  5LXI B;  4IM3 A;  3W1S A;  4MGY E;  1WX7 A;  2JVC A;  1E8X A;  4GDK A;  2MX2 A;  4KSK C;  3X23 A;  3ZRC A;  3ZVV A;  5D7G A;  4K7U A;  5AEK B;  5HKH A;  1M94 A;  2GBR A;  3UGB B;  2IYD B;  4GB9 A;  2WDT B;  3ZNH B;  2KZR A;  4GGQ A;  1P0R A;  2KD0 A;  2KWV B;  3ZDM C;  1H8C A;  2WYQ A;  1U4A A;  3APF A;  2BYF A;  3PSE B;  3R66 C;  2BYV E;  4RMA A;  3U7D A;  4GXB A;  3VFK A;  3HM6 X;  2FID A;  3KUD B;  2BKR B;  4JGH B;  1GJZ A;  1F9J A;  2KDI A;  4MSQ B;  3OLM D;  2RGF A;  4N9F 4;  2CU1 A;  4FN2 A;  3VUW A;  1WGR A;  2KMA A;  3VH3 B;  4ZDV A;  4FHK A;  2L7R A;  1LFD A;  3DPD A;  2M0X A;  1WR6 E;  2KKC A;  2KTR A;  2EKE C;  3PT2 B;  1RLF A;  2C7N B;  1R4N I;  4EUT A;  3HM3 A;  3C0R B;  3UF8 A;  2ZVO A;  2GBM A;  4KZC A;  1AAR A;  1WZ0 A;  2G45 B;  3VXW A;  2RR9 A;  2DHZ A;  5JH5 C;  3ML9 A;  2ZVN A;  5IAA C;  2KLC A;  4G50 A;  4PS7 A;  2KHW B;  3VTV A;  3PLV A;  2YLM A;  5D6J B;  4KDI C;  4I6N B;  2O6V B;  4ANX A;  3ZTD A;  1E8W A;  2K25 A;  3VH4 B;  3A9K A;  4WAA A;  3QHT A;  2JPH A;  3A1Q A;  3DOW A;  2MLB A;  4AUQ C;  1T0Y A;  4BVU C;  2FIF A;  3CST A;  4M0W B;  5GMV A;  2N7E A;  2KAN A;  2CS4 A;  4LJP B;  4MM3 A;  3R7R A;  5BO4 B;  4W9J A;  4ANV A;  4BBN F;  3OJ4 B;  4BKS A;  2PE6 B;  4GDL A;  3V61 A;  3EC8 A;  4NPN A;  1E7U A;  1GC6 A;  1BT0 A;  2O6V D;  2VRR B;  3ML8 A;  2HD5 B;  3JSV A;  4GN1 A;  4XZ4 A;  5G2N A;  1UH6 A;  1RRB A;  3JVZ X;  1Y8R C;  2PEA A;  2ZJD A;  2C7M B;  4E3C A;  3ENE A;  3TJP A;  3VAW A;  4EZK A;  3EFU A;  4HK2 A;  4M8N A;  2N4F A;  3DCG A;  3S2A A;  3CSF A;  3SDL C;  4MEL A;  3BIN A;  1NDD A;  1KM7 A;  3A1Q B;  3A33 B;  4ICU A;  2BPS A;  2LI5 A;  1V9J A;  3HK0 A;  3K9P B;  4FHJ A;  2NCN A;  1ZW7 A;  2ZNV C;  3ONS A;  2O2V B;  3U30 A;  3ZNZ B;  5JZE B;  1WFY A;  2KX0 A;  2CHW A;  2FCQ A;  4NAW A;  3V62 A;  3BY4 B;  1UZX B;  2C7H A;  3V60 A;  3CMM B;  5CX3 A;  1D3Z A;  2KFK B;  2JZZ A;  4PS8 A;  4HCN B;  2KDE B;  4W9H A;  3ZO5 B;  4AP4 C;  1G6J A;  3TBL D;  3AUL A;  1P3Q U;  2DYM A;  4MGI E;  4WJN A;  2JF5 A;  2HE7 A;  4X57 B;  2KDB A;  2C60 A;  1OEY A;  4FJY A;  1L2N A;  1GC7 A;  4BKS D;  4EOY A;  3H7P B;  2LD9 A;  1NI2 A;  2R2O A;  2D10 A;  4II2 B;  1E7V A;  2NBW B;  4NJ7 A;  4AWJ A;  4GIV A;  2DX5 B;  4XX5 A;  1YX5 B;  4URK A;  3IFW B;  4K7S A;  5CTR C;  2N9P C;  4A3O A;  4WWP A;  5E6O A;  3RUI B;  1E90 A;  3NZU A;  3UIO B;  4HWI B;  3ZNI D;  3TL5 A;  3APC A;  2MBE A;  2MBH A;  3DVG Y;  3KYD D;  5FR6 A;  3UQB A;  1VD2 A;  2KNB A;  4NAW B;  3DDC B;  1I35 A;  4ICV A;  2M4N A;  2K8C A;  3B0A A;  2LAS A;  3KUC B;  3A9J A;  4KSL C;  2FUH B;  4PS3 A;  2FCN A;  3RD2 A;  3MHS D;  2L0F A;  3DBL I;  4HDQ A;  4W9K A;  3N30 A;  2K8B A;  4CYE A;  3KYC D;  4KV2 A;  2GBK A;  4MJS B;  4DHJ B;  1YJ1 A;  1WM3 A;  3WA0 A;  5J18 A;  4DXA B;  4KDL B;  3AI5 A;  4MGZ E;  3VUY A;  4CO7 A;  3QQ8 B;  3PGE A;  2KXJ A;  4HVB A;  3RYT A;  4ZRJ A;  1E8Z A;  2KC1 A;  5AZF A;  2G3Q B;  2GOW A;  2IBI B;  4DWF A;  4DDG D;  3L54 A;  4IUM B;  1GNU A;  1WGG A;  4HPM B;  4LCD E;  1H4R A;  4ASW C;  4DHJ D;  4NQK E;  2EMT A;  2N1V A;  2GBJ A;  2JY6 A;  3A9J B;  1UGM A;  1WMH A;  2KO3 A;  4W9E A;  4K81 A;  4M8M A;  2O6V A;  4NJ6 A;  5G55 A;  1WR1 A;  1WY8 A;  3DVN U;  3NOB A;  5C23 A;  2LRU A;  3IG3 A;  2BWE S;  1UEL A;  4IM2 A;  4F8C B;  3VDZ A;  2D07 B;  2NVU I;  3WAP A;  1UD7 A;  1WYW B;  4YL8 A;  2L76 A;  2BWF A;  3QA8 A;  1XD3 B;  1P1A A;  2ASQ A;  2Z59 B;  1GUA B;  4GSW A;  3R3M A;  1V6E A;  2L0T A;  2CHX A;  3PRE A;  4RM8 A;  2DZJ A;  2Y5B B;  2C5L C;  2N9E B;  3DBH I;  3WIM A;  1OEY J;  2IO3 B;  4JQW C;  1Z5S B;  4DBG A;  4TV3 A;  3VTU A;  2N9X A;  5CHV C;  3PS6 A;  1LM8 B;  4WQO B;  2ZPN A;  3HHM A;  3LDZ E;  3PRP B;  4G0N B;  1WH3 A;  3PHX B;  4NNJ B;  1WMH B;  2JT4 B;  2UWQ A;  4W9F A;  4MDK E;  2XK5 A;  2DZI A;  1HE8 A;  3SU8 X;  2KFJ A;  1K8R B;  4IM0 A;  2NS5 A;  5CHW A;  3CF6 E;  2ZNV B;  2AEH A;  4NY0 A;  1WGH A;  1EO6 A;  1V5O A;  4B95 A;  2OOB B;  4WJQ A;  1XT9 B;  1P98 A;  2BKF A;  4G11 A;  3VHT C;  1LXD A;  3ZW3 A;  1XQQ A;  1I42 A;  2J0M A;  2O2V A;  5J17 A;  1TZ1 A;  2RD0 A;  2JXX A;  4K7W A;  1J0G A;  2FNJ B;  2QHO A;  5JHA A;  2KFK A;  2AL3 A;  3MJW A;  3AXC A;  2AYO B;  1WM2 A;  4W9I A;  2L00 B;  2BGF A;  3RZW C;  1RAX A;  4MEM A;  3PRZ A;  2JRH A;  2KQS A;  2MCN B;  2KOX A;  3H7P A;  4KZ0 A;  2XK5 B;  1J19 A;  2K6Q A;  1QZE A;  2FCS A;  2LUE A;  4WJP A;  5DPT A;  3ZKJ C;  3KW5 B;  1WX9 A;  5EDS A;  2G4D B;  4DHZ B;  5L83 A;  2KJR A;  3VUX A;  4PYZ A;  2LXC A;  4B6W A;  2KX3 A;  4RM9 A;  2IO2 B;  3Q3F A;  3QJZ A;  2JZ3 B;  2DYB A;  4KVG B;  3PTF C;  5LXH A;  3WAO A;  2ZCC A;  3W1S C;  4EFO A;  3RUL A;  2ZZP B;  3UIP B;  2M17 A;  4GOC A;  4KIK A;  4W9G A;  4BOZ B;  4K1R B;  3V6C B;  2KK8 A;  1ISN A;  2LRW A;  4DK5 A;  3IHP C;  3QX1 A;  4EKU A;  3T8M A;  4IC7 B;  4FA6 A;  2D3G A;  2BYE A;  3DBR I;  2LGD A;  4EZL A;  4F7Z A;  2IY0 B;  2I1K A;  1OQY A;  2PE9 A;  1NBF C;  4MJS A;  2CHZ A;  5E6N A;  4HLE A;  3PRM B;  2XEW A;  4ANU A;  1WJN A;  3PV1 A;  3KUZ A;  3KVF B;  3M62 B;  2MA9 B;  4TQ0 A;  1L7Y A;  2FCM A;  2NPT A;  4HDO A;  1KJT A;  2LGY A;  3ALB A;  2N7D A;  4DDI D;  2A4Z A;  2J0K A;  2MBQ A;  2R2Q A;  4KIK B;  4HXD A;  4MSM B;  1SE9 A;  5AZH A;  3L0W B;  4FAD A;  4B9K A;  3L16 A;  2L05 A;  1MG8 A;  4LDT B;  3L13 A;  1R4M I;  1V81 A;  1PQS A;  2RPQ A;  2L3Z A;  1WI0 A;  2MW5 A;  4AJY B;  1E8Y A;  5DPR A;  2M1M A;  2WX1 A;  2KC2 A;  3QK0 A;  4CHK A;  2KVR A;  4IW0 A;  1P9D U;  2WX0 A;  1YD8 U;  3P2B A;  2KJH B;  1OTR B;  1WRD B;  2Z0E B;  4BOS C;  4OVU A;  4XC2 A;  3JW0 X;  4ZYN A;  1V2Y A;  2MP2 B;  2MBB B;  2NPT B;  2ZCB A;  3IBE A;  4LDT D;  2B3A A;  5E6P A;  3NS8 A;  2OJR A;  4AOF A;  2UYZ B;  3AU4 A;  5D94 A;  2DYO A;  2HTH A;  2DAJ A;  3PZD A;  3M95 A;  3KH0 A;  2K6D B;  3QC8 B;  3VQI A;  1FXT B;  2MSE D;  4W9L A;  2GBN A;  2CKH B;  1EF1 A;  2AWT A;  3I3T B;  4JIO U;  2IO1 B;  2J7Q B;  3N3K B;  4LJO B;  2D11 A;  3RZF A;  4TKN A;  2ZEQ A;  4ANW A;  3ZDT A;  2DEN B;  2XBB C;  1S1Q B;  3WAM A;  3L08 A;  2KTF A;  1WJ6 A;  3QIJ A;  3VTW A;  2A5U A;  2BF8 B;  3UQA A;  2HJ8 A;  3LJ3 A;  2IZV B;  2V1Y A;  4P7I A;  2L8J A;  4JL9 A;  2LGX A;  2IO0 B;  2AL6 A;  3ZRF A;  1Q1O A;  4TQ1 A;  4HCP B;  3SD5 A;  2K8H A;  2NR2 A;  2LXA A;  1TBE A;  3H6N A;  3OJ3 A;  3ZNG C;  1V86 A;  3A4S C;  4PYU A;  4BBN C;  4BKG A;  3UIN B;  4BFR A;  4E71 A;  3WAL A;  3B08 A;  5D2M B;  5TR5 A;  2KWU B;  4GDK B;  1V5T A;  4AJW A;  1IP9 A;  1WGD A;  2I1J A;  2JUO A;  3ECI A;  3M3J A;  4WJO A;  1ZGU B;  2DAF A;  1WXM A;  2N1W A;  4FJZ A;  1WXS A;  3APD A;  1WIA A;  1CMX B;  3AU5 A;  3ZUN A;  5KHO A;  5JHB A;  1SIF A;  3ZIM A;  3GZN I;  2YVC A;  2JWZ A;  4MH0 E;  2EMS A;  4EEW A;  2LJ5 A;  4W9C A;  4A20 A;  1Z2M A;  3D32 A;  2ZPY A;  4HPL B;  3B1L X;  2KN5 A;  3K9O B;  1IPG A;  2W9N A;  3W1Y A;  2KQ7 A;  3L17 A;  4FUL A;  1WX8 A;  2KDF B;  2LVQ A;  4FBJ B;  1YQB A;  4IWP A;  2K39 A;  3WAN A;  3A4R A;  3MTN B;  4NQL B;  1EUV B;  3QCA A;  1EF5 A;  2KTR B;  2DZK A;  2NBV B;  1OGW A;  4I6P A;  1WE6 A;  4DHZ E;  1KOT A;  3O65 B;  2KMC A;  4FJV B;  4EZJ A;  2RSU A;  1WGY A;  3TCA A;  3DVN V;  1RFA A;  3ZTC A;  3N32 A;  3H9D A;  1WZ3 A;  2LVP A;  3NY5 A;  3V6E B;  1UBI A;  3QWZ B;  3NZS A;  2PPH A;  2K1F A;  2WWZ A;  3GOE A;  2MQJ A;  2C9W B;  2MRP A;  3DVG X;  3PHW B;  4WWN A;  1X1M A;  3SHQ A;  4ZRI A;  4BKT A;  2LVO A;  3DQV A;  3RCZ A;  1YIW A;  3A9K B;  2V3S A;  4II3 B;  4IWQ A;  1WXV A;  3QAR A;  3RT3 B;  3DBS A;  1LQB A;  1WE7 A;  2MBO A;  2KLG A;  5DPW A;  4GDL B;  2REX A;  2MP2 A;  3H1U A;  3NHE B;  1Q0W B;  1TGZ B;  2FAZ A;  3M63 B;  4HJK A;  3QAQ A;  4GMV A;  3Q3J A;  4WWO A;  4E74 A;  1KLV A;  3JSV B;  2CR5 A;  1S3S G; 
#chains in the Genus database with same CATH topology
 1D5M C;  1FPY A;  4IG7 B;  3PVL A;  2KJ6 A;  2DBY A;  2J42 A;  1TTN A;  2LGI A;  3DBL B;  1YN4 A;  3ZJU A;  3JYU A;  2D2Q A;  1C1Y B;  1WJ4 A;  4MGK E;  5CHF A;  3I63 C;  4A3P A;  5DPS A;  5AUI A;  2PJH A;  2L32 A;  2ZW1 A;  3BK2 A;  3U8Z A;  1JRU A;  1J8C A;  2XN9 C;  5LXI B;  2VH2 A;  1JW9 D;  5HKH A;  3AE3 B;  3X23 A;  1B9R A;  4A6Q A;  2GBR A;  1WYG A;  3ZNH B;  1VR9 A;  2KZR A;  1P0R A;  3AE1 B;  1U4A A;  4RMA A;  3U7D A;  3HM6 X;  2FID A;  2BKR B;  1PGA A;  3PZ8 A;  5LNK 1;  3NVV A;  4RGM A;  2CU1 A;  1N61 A;  3W5V B;  3VH3 B;  1ENF A;  2L7R A;  2EKE C;  2C7N B;  3IT6 B;  1NEK B;  2LHE A;  3AEB B;  3DWG C;  1WZ0 A;  2BB6 A;  2DHZ A;  5JH5 C;  5IAA C;  1I7H A;  4PS7 A;  3PLV A;  5D3I B;  4KDI C;  1VZ8 A;  1UGJ A;  3ZTD A;  1E8W A;  4IOI E;  3W9C B;  3A1Q A;  4AUQ C;  2FIF A;  2N7E A;  2BBC A;  4OZA A;  1SSN A;  2O6V D;  2WXG A;  2VRR B;  3ML8 A;  1I4R A;  3VR8 B;  4L1B A;  3JSV A;  3JVZ X;  4E3C A;  2J4X A;  3EFU A;  3DCG A;  3S2A A;  2MJ3 A;  3BK1 A;  3R2I A;  4C4V B;  1KM7 A;  3AE8 B;  4FHJ A;  4WWM A;  2ZNV C;  2O2V B;  1MHH E;  2L1A A;  3ZNZ B;  1OQR A;  2Y3A A;  1E10 A;  3V62 A;  1QIL A;  3BY4 B;  3V60 A;  5CX3 A;  2KFK B;  2JZZ A;  1XCT L;  1G6J A;  3TBL D;  3AUL A;  2DYM A;  2JF5 A;  4X57 B;  2C60 A;  4BKS D;  2LD9 A;  1NI2 A;  1DYQ A;  1YNT E;  4II2 B;  4NJ7 A;  4XX5 A;  1LO5 D;  1UWX A;  2L52 A;  1YX5 B;  4URK A;  4K7S A;  1WWT A;  3WCQ A;  4HWI B;  4N59 A;  4XWT A;  3KYD D;  5FR6 A;  3ZQ4 A;  2NMQ A;  3AE7 B;  1MHX A;  2K8C A;  3B0A A;  2LAS A;  2FUH B;  4HDQ A;  3N30 A;  2WDV B;  2GBK A;  4MJS B;  1I4Q A;  4ARI A;  4KDL B;  2E3T A;  4CO7 A;  2IGH A;  3QQ8 B;  2WGS A;  3RYT A;  1E8Z A;  3NZ3 A;  4DWF A;  4IUM B;  4HPM B;  4ASW C;  2EMT A;  2JY6 A;  4K81 A;  4NJ6 A;  1WY8 A;  4L23 A;  1VDV A;  2BWE S;  3NVW A;  3R2T A;  2D07 B;  3WAP A;  4A55 A;  1UD7 A;  1VJK A;  4YL8 A;  2AQ2 B;  4M0W A;  3QA8 A;  1XD3 B;  2ASQ A;  2Z59 B;  4GSW A;  5FKA C;  2CHX A;  2C5L C;  3LB8 C;  1Z5S B;  4DBG A;  2WHI A;  1D6E C;  3LDZ E;  4G0N B;  1WMH B;  3W5U B;  2JT4 B;  4PK1 A;  1JQ4 A;  1PYW D;  1I4P A;  5CHW A;  4XDC A;  4L2Y A;  2ZW0 A;  2WXI A;  3VHT C;  4KGT A;  2MH7 A;  1I42 A;  2KT7 A;  3AEF B;  2QHO A;  3RN9 C;  1FCL A;  1GPX A;  2FE8 A;  3RZW C;  1RAX A;  3PRZ A;  2KQS A;  3ZJV A;  4LNI A;  1J19 A;  2K6Q A;  1QZE A;  2FCS A;  4XDD A;  2QJL A;  4B6W A;  2IO2 B;  5BYS A;  4XGA B;  4KVG B;  2Z8L A;  3PTF C;  3WAO A;  2ZCC A;  1ROE A;  3RUL A;  2ZZP B;  3UIP B;  2M17 A;  4W9G A;  1IBX A;  1SE2 A;  3MC0 B;  5IO9 A;  4JWU C;  1OQY A;  1LGR A;  2CHZ A;  2K5P A;  2XEW A;  2W55 A;  2WXJ A;  2MA9 B;  2NPT A;  3AM9 A;  1XLO A;  1KJT A;  3ALB A;  4M00 A;  2J0K A;  3KLS X;  2W82 A;  2R2Q A;  4KIK B;  4N6E B;  1AN8 A;  1SE9 A;  2MJD A;  3L16 A;  4KKI A;  1PQS A;  1TS5 A;  2MW5 A;  1N63 A;  4AJY B;  2LGS A;  2D3A A;  2WX1 A;  2KC2 A;  3QK0 A;  4CHK A;  1WRD B;  2Z0E B;  4OVU A;  4XC2 A;  4ZYN A;  2MBB B;  2ZCB A;  3OG5 A;  2INP E;  2B3A A;  2HJ1 A;  2E6X A;  2G1E A;  3AU4 A;  2DAJ A;  3M95 A;  3KH0 A;  2WXH A;  3FAH A;  4NJC A;  5HHD G;  3VQI A;  2MSE D;  2D3B A;  1TT5 B;  2AWT A;  2IO1 B;  2J7Q B;  1KFY B;  2ZEQ A;  4S17 A;  3L08 A;  3VTW A;  4KX6 B;  2N0S B;  3LJ3 A;  1C78 A;  4JE3 B;  2KAC A;  2LGX A;  2IO0 B;  3ZRF A;  1Q1O A;  2NR2 A;  3H6N A;  2ON8 A;  3ZNG C;  1I4X A;  1V86 A;  4PYU A;  1FIQ A;  3WAL A;  1XO3 A;  2KWU B;  1UUP A;  1IP9 A;  1WGD A;  3P4S B;  2I1J A;  2JUO A;  3ECI A;  4LTU A;  3M3J A;  4WJO A;  1ZGU B;  1QF6 A;  1F52 A;  3P1M A;  4FJZ A;  1WXS A;  2W3S A;  1YJI A;  5KHO A;  1NI3 A;  2YVC A;  2JWZ A;  2LJ5 A;  1Z2M A;  1F1H A;  3D32 A;  2KN5 A;  2W9N A;  3W1Y A;  2INC C;  1J7B A;  2KDF B;  1I4H A;  4FBJ B;  4IWP A;  2WXL A;  4H2A A;  3MTN B;  4I6P A;  2JX5 A;  3O65 B;  2AQ1 B;  4FJV B;  1WGY A;  2JZP A;  1YOV B;  2LVP A;  5EE1 A;  3V6E B;  3QWZ B;  3NZS A;  1R7S A;  1TKY A;  4B0E A;  1DOI A;  2MQJ A;  2MRP A;  3DVG X;  3RFZ B;  1UF0 A;  2LFI A;  3SHQ A;  3MFG A;  2LVO A;  3DQV A;  3RI7 C;  1YIW A;  3Q3O C;  3DBS A;  1LQB A;  2G9H D;  5DPW A;  4FXC A;  3NHE B;  1TGZ B;  2WXN A;  4YT0 B;  3JSV B;  1S3S G;  2NTT A;  3J9C A;  1QQR A;  4KKJ A;  5BYR A;  1IGD A;  1HA5 A;  1V49 A;  4M02 A;  1Q5W B;  2LWP A;  1ACC A;  1C3T A;  4BZA A;  3H7S A;  1SIJ A;  3TMP B;  3VR9 B;  1EWY C;  2JRI B;  5IA7 A;  5KHQ A;  1C76 A;  2K9X A;  2WXR A;  5J2R A;  3FKY A;  3X0W A;  1V80 A;  2NBU A;  5LLI A;  3U2S C;  1SGH A;  1ET9 A;  4G3X B;  4NAM A;  3AED B;  2JXT A;  1ZDX A;  1FRD A;  1VCB A;  2MWS B;  4F1S A;  1YX6 B;  1UBQ A;  5IKC M;  3AV8 A;  3TEX A;  3V3X A;  4FA6 A;  2JVC A;  3ZRC A;  1D5Z C;  2I2Y A;  3UGB B;  2IYD B;  4GB9 A;  4GGQ A;  2KD0 A;  2KYW A;  2WYQ A;  3R66 C;  2BYF A;  3PSE B;  2BYV E;  2VZK B;  4GXB A;  3IAM 1;  3VFK A;  3KUD B;  4JGH B;  1D4B A;  2KDI A;  4Q2J A;  3OLM D;  2RGF A;  3N9Y C;  3GE3 C;  3MP9 A;  1L6V A;  3GE8 C;  1ZPS A;  4ZDV A;  4FHK A;  3DHH C;  2M0X A;  2KKC A;  2KTR A;  1RLF A;  1R4N I;  3IXS A;  3DWM A;  4ZHO A;  2N7J A;  4LLG M;  3TSS A;  2GBM A;  3U4E G;  1TY0 A;  2M19 A;  2G45 B;  2BT6 A;  2RR9 A;  4IKG A;  1JWB D;  2ZVN A;  1RWS A;  3P42 A;  2KHW B;  1XEE A;  2CU3 A;  1J7C A;  1BXT A;  4HRS A;  2K25 A;  1FNW A;  4WAA A;  3NG0 A;  3DOW A;  4BVU C;  4C00 A;  2GRI A;  4M0W B;  3N20 C;  2CS4 A;  4MM3 A;  5BO4 B;  4BKS A;  3OJ4 B;  3SR6 A;  3V61 A;  1T0Q C;  1GC6 A;  1BT0 A;  4GN1 A;  4XZ4 A;  5G2N A;  3O13 A;  1RRB A;  1Y8R C;  2WU2 B;  3BVM A;  3R8B A;  2C7M B;  4HK2 A;  1TY2 A;  2HDE A;  2WDR B;  5FK9 C;  4ZRP A;  1NDD A;  1E6E B;  1ZDV A;  4ICU A;  1CJE A;  1V9J A;  2RDH A;  1OQQ A;  1ZW7 A;  5JZE B;  2CHW A;  4AQ7 A;  2D3C A;  1UZX B;  3RNC C;  2KDE B;  2HE7 A;  1KRH A;  2KDB A;  3MJ5 A;  4FJY A;  1OEY A;  1L2N A;  1GC7 A;  3P4R B;  4GIV A;  2WXM A;  3IFW B;  4HPP A;  2N9P C;  1TYG B;  4WWP A;  5E6O A;  3RUI B;  1E90 A;  3LXF A;  1KLG D;  2KNB A;  4NAW B;  1I35 A;  3KUC B;  2FUG 1;  2L0F A;  3DBL I;  3MHS D;  4ARC A;  1YJ1 A;  5J18 A;  4RF0 A;  2BTE A;  3AI5 A;  2WDQ B;  1YJJ A;  3VUY A;  2GLS A;  4C56 C;  5D3D A;  3I5J C;  2GOW A;  2IBI B;  3URY A;  1GNU A;  5HG2 A;  1CK1 A;  3A9J B;  1UGM A;  2KO3 A;  4OZB A;  4M8M A;  5C23 A;  3KWL A;  4IM2 A;  2I38 A;  4AS1 A;  4XYC A;  2MJE A;  2QEJ C;  1WYW B;  1DOX A;  1V6E A;  1QLB B;  2DZJ A;  3HUI A;  2IO3 B;  4JQW C;  4TV3 A;  2VH1 A;  3VTU A;  1EU4 A;  1LM8 B;  4WQO B;  2H88 B;  3AE5 B;  2ZPN A;  3PHX B;  1HZ6 A;  4USA A;  4W9F A;  3Q3N C;  3CF6 E;  3Q14 C;  1WGH A;  4WJQ A;  1P98 A;  3IT4 B;  2QIL A;  2V4I B;  3ZXV A;  2EEL A;  4K7W A;  1NYR A;  2R61 A;  2FNJ B;  1JRO A;  3MJW A;  2AYO B;  1IUE A;  2BGF A;  4OHJ A;  2JRH A;  2RPV A;  3VRA B;  3DHG C;  3H7P A;  4KZ0 A;  3CWI A;  2XK5 B;  4WJP A;  4RFB A;  1FCC C;  1WX9 A;  2MHJ A;  5EDS A;  2G4D B;  4DHZ B;  2KJR A;  4PYZ A;  3SFD B;  3Q3F A;  1KLU D;  1YQ3 B;  2DYB A;  3W1S C;  4EFO A;  2K3U A;  4CQN A;  3V6C B;  1ISN A;  2AX5 A;  2LRW A;  3Q2A C;  4DK5 A;  3IHP C;  1M4V A;  4EKU A;  2JQR B;  3T8M A;  4IC7 B;  3GS2 A;  2D3G A;  2BYE A;  2LGD A;  4F7Z A;  1NBF C;  2J53 A;  1C4C A;  4HLE A;  4ANU A;  1WJN A;  3PV1 A;  2PVO D;  2FCM A;  2LGY A;  1N6Z A;  2N7D A;  2MBQ A;  4MSM B;  4RGN A;  5AZH A;  4FAD A;  1YN3 A;  2RPQ A;  2L3Z A;  5H8Y E;  4ACF A;  5EE3 A;  1YQ4 B;  1WSP A;  2KVR A;  3BYY B;  3SEB A;  1P9D U;  3Q8F A;  1YD8 U;  4ZOH C;  3P2B A;  1FFU A;  4REZ A;  4WH4 A;  3JW0 X;  1EU3 A;  1JWU D;  3IBE A;  5GXG B;  5E6P A;  4AOF A;  5D94 A;  4R3D A;  2PIA A;  2JYT A;  4W9L A;  2GBN A;  2CKH B;  3I3T B;  1PGB A;  1CZP A;  2D11 A;  3UI3 A;  5C3J B;  3EA6 A;  5G5G A;  3ZDT A;  1Y56 A;  2DEN B;  2XBB C;  1E7P B;  2KTF A;  2A5U A;  2IZV B;  2V1Y A;  5G5H A;  1K52 A;  4P7I A;  4B0M A;  4JL9 A;  2BB5 A;  4HCP B;  2K8H A;  2YEP F;  2LXA A;  3AH7 A;  3A4S C;  4BBN C;  3BZD B;  3LYY A;  2KQ4 X;  4E71 A;  4TMA B;  4NZL B;  2SEB D;  2DLB A;  4MH8 A;  1ZOY B;  3APD A;  3AU5 A;  2XNA C;  4EEW A;  3PO0 A;  3NVZ A;  1MG4 A;  4HPL B;  4KGS A;  1NYQ A;  4PT5 A;  2KQ7 A;  3L17 A;  3RNG C;  3FC4 A;  3FIL A;  4WIP A;  4P1B C;  2UU7 A;  4NQL B;  4M01 A;  1EUV B;  2WXO A;  2KTR B;  2DZK A;  2NBV B;  4DHZ E;  3DVN V;  1RFA A;  3KQ4 A;  3NY5 A;  1HQR D;  1BUI C;  1F77 A;  2WWZ A;  3GOE A;  2C9W B;  3PHW B;  2D5G A;  2V3N A;  4YSY B;  4RNA A;  4II3 B;  3KWV A;  3QAR A;  4MM3 B;  1MI0 A;  2KLG A;  2REX A;  4E74 A;  3QAQ A;  4GMV A;  3Q3J A;  1KLV A;  1WXA A;  3PPA A;  2IY1 B;  2GMI C;  3EHV A;  3T9L A;  2DZM A;  2JSV X;  4OVV A;  2KWC A;  1SE3 A;  4RGT A;  1A5R A;  1F0Z A;  2KN4 A;  3W2D A;  2INN E;  2J0J A;  2Y5P A;  4IWO A;  1SE4 A;  2QMT A;  2QDF A;  3IVF A;  5DCN A;  1ZKH A;  3HIZ A;  5AZG A;  4ZRK A;  2KMM A;  2JWU A;  2Z0D B;  1L5P A;  3OAW A;  3VVW B;  3HVD A;  3TEY A;  3R7Q A;  5L95 C;  1FD6 A;  5C1Z A;  3TIX A;  1JWA D;  4I6L B;  1WF9 A;  4GU2 A;  4MGY E;  1WX7 A;  3BVZ A;  1E8X A;  4KSK C;  3ZVV A;  4K7U A;  1M94 A;  1STE A;  2WDT B;  2WLB A;  1TKG A;  2KWV B;  1H8C A;  2K22 A;  4A8X C;  1L0Y B;  3TEW A;  4RGO S;  1GJZ A;  1F9J A;  2WXP A;  4MSQ B;  4YXD B;  3DBH B;  3VUW A;  1FXA A;  4C7Y A;  2KMA A;  1WR6 E;  2VZK D;  5FR3 A;  5BMH A;  4LNF A;  3HM3 A;  2ZVO A;  2GI9 A;  2QCZ A;  3P4Q B;  1FFV A;  3ML9 A;  2PTL A;  3VTV A;  2YLM A;  5D6J B;  4I6N B;  1L0V B;  3VH4 B;  3A9K A;  1QOF A;  1T5X D;  3QHT A;  2JPH A;  3TEZ A;  1T0Y A;  5JXV A;  3CST A;  5GMV A;  2KAN A;  4LJP B;  1DOY A;  2PE6 B;  3I57 A;  1UNS A;  4DXG A;  3HVZ A;  3NJT A;  1MFW A;  2ZJD A;  3ENE A;  3TJP A;  3VAW A;  1GAQ B;  3BIN A;  4A90 A;  1TS3 A;  4C80 A;  3ZGZ A;  3A1Q B;  3A33 B;  5E6J A;  2BPS A;  2LI5 A;  3K9P B;  5AUK A;  2NCN A;  5C2T B;  3ONS A;  3U52 E;  3MHZ A;  1WFY A;  2KX0 A;  2FCQ A;  3EGR A;  4ZRQ A;  1D3Z A;  3DBR B;  4W9H A;  2L83 A;  2WXQ A;  4WJN A;  2KDM A;  2QC8 A;  5BMG A;  4EOY A;  3H7P B;  3Q69 A;  1N60 A;  1K51 A;  1E7V A;  4AWJ A;  2DX5 B;  2WNM A;  4A3O A;  3AE4 B;  1VZ7 A;  1MPE A;  4LNN A;  3NZU A;  3ZNI D;  3APC A;  2MBE A;  2MBH A;  3DVG Y;  3UQB A;  5MPO A;  1VD2 A;  3RNB C;  2GB1 A;  3DDC B;  5H92 C;  1XCQ L;  4KSL C;  3U7Z A;  4CYE A;  3KYC D;  4DHJ B;  2NTS A;  3WA0 A;  1WM3 A;  4DXA B;  1JCK B;  1ZUD 2;  4ZRJ A;  3T3O A;  5HI1 A;  4DDG D;  1QKZ A;  1H4R A;  1D5X C;  4IDI A;  2GBJ A;  4ZYS A;  1WMH A;  5EE0 A;  4W9E A;  1XLP A;  3NVY A;  2O6V A;  3IG3 A;  1UEL A;  4F8C B;  2M0A A;  5BMI A;  2BWF A;  1P1A A;  1L0X B;  3R3M A;  4RM8 A;  3PRE A;  2Y5B B;  2N9E B;  3NUH B;  3PS6 A;  4LK0 M;  5CHV C;  3T3N A;  2BYT A;  3HHM A;  1FM0 D;  1WH3 A;  4MT5 A;  1N62 A;  3RPF C;  4NNJ B;  2SAK A;  4MDK E;  2DZI A;  1HE8 A;  1SXT A;  3SU8 X;  1K8R B;  4IM0 A;  2NS5 A;  2ZNV B;  2AEH A;  4NY0 A;  1XF5 L;  1EO6 A;  1V5O A;  4B95 A;  2OOB B;  4G11 A;  1C4P A;  2BKF A;  4P6V F;  3ZW3 A;  2N9L A;  1XQQ A;  3AEG B;  2J0M A;  1TZ1 A;  2JXX A;  1C79 A;  2KAJ A;  1WM2 A;  4W9I A;  4S0R A;  2J52 A;  3N1Z C;  2MCN B;  5DPT A;  4US8 A;  3KW5 B;  1JAL A;  3VUX A;  4RM9 A;  2Y5C A;  2BQQ A;  3QJZ A;  2JZ3 B;  3V05 A;  4GLS C;  3Q3M C;  3AN1 A;  3N1X C;  1KTK A;  2ACZ B;  4WAF A;  4KIK A;  4BOZ B;  2KK8 A;  3ZJT A;  5T8I A;  1HZ5 A;  4XE0 A;  4EZL A;  2IY0 B;  3ZXR A;  5E6N A;  3KUZ A;  2YEP B;  3M62 B;  2JU6 X;  1L7Y A;  1SF0 A;  3EFC A;  3ETR A;  2PKO A;  2A4Z A;  1R4M B;  2QSD A;  3L0W B;  4B9K A;  1IBX B;  4RCO A;  3ABV B;  4LDT B;  3L13 A;  1R4M I;  1V81 A;  3BII D;  5DPR A;  2M1M A;  3CIR B;  1J7A A;  3RNF C;  2MEK A;  1OTR B;  3BWU D;  4DQO C;  2NPT B;  1L4D B;  4OZC A;  1N5W A;  2OJR A;  1TS2 A;  2HTH A;  3PZD A;  3BYT B;  1AWD A;  1F2R C;  2BS2 B;  1EF1 A;  2RMM A;  3N3K B;  3TUO A;  1IGC A;  1SB3 C;  3RZF A;  4TKN A;  2FBW B;  3PZ7 A;  1V1P A;  3WAM A;  4YSZ B;  2BF8 B;  2X38 A;  3SD5 A;  1TBE A;  3B08 A;  5D2M B;  5TR5 A;  1V5T A;  3GZN B;  3Q8E A;  2IDY A;  1WIA A;  1CMX B;  2DNF A;  3AEE B;  1SIF A;  3ZIM A;  3GZN I;  2EMS A;  1P7E A;  4W9C A;  4A20 A;  2ZPY A;  3E56 A;  3B1L X;  4HKQ A;  4ITK A;  1IPG A;  4FUL A;  4K3B A;  1WX8 A;  2LVQ A;  3BVG A;  2K39 A;  3A4R A;  1ESF A;  3QCA A;  5IN7 A;  1KOT A;  3AEC B;  1T0S C;  4EZJ A;  1SJH D;  1C77 A;  4LNO A;  2ONQ A;  1FXI A;  1UBI A;  4WWN A;  3AE9 B;  3A9K B;  2V3S A;  1WXV A;  4JWS C;  1C9F A;  2V9H A;  1RM6 C;  1WE7 A;  2MBO A;  1SJE D;  2MP2 A;  2FAZ A;  3M63 B;  4HJK A;  4WWO A;  4HKZ E;  2WXF A;  1E5W A;  4TUU A;  3ZLZ A;  4XWW A;  2G4S A;  2LZ6 A;  4J6I A;  1GOZ A;  4W9D A;  4FLH A;  1GG3 A;  3PLU A;  2V4L A;  4JLC A;  1IYF A;  3OWE B;  1NEN B;  3EEC A;  1HXY D;  3HRD D;  2IGD A;  3L10 B;  1WJU A;  2M8S A;  3I9V 1;  2TSS A;  1ZE3 D;  4RH6 A;  1EM7 A;  2V0G A;  1UWM A;  2KVZ A;  4IM3 A;  3W1S A;  4ANX A;  1SBB B;  1A70 A;  4GDK A;  2MX2 A;  5AEK B;  5D7G A;  4HJG E;  5IOI A;  1ZXI A;  2LJI A;  1Q10 A;  3ZDM C;  3APF A;  2CJO A;  1FEH A;  3RNA C;  4K3C A;  2N9K A;  3AB5 A;  4N9F 4;  1RFK A;  2RDB C;  4FN2 A;  1QOG A;  1WGR A;  4N58 A;  1LFD A;  3DPD A;  3PT2 B;  4D2K A;  4EUT A;  4HEA 1;  3C0R B;  3UF8 A;  4KZC A;  1AAR A;  3VXW A;  3IAS 1;  2KLC A;  4G50 A;  2OJW A;  2O6V B;  2WU5 B;  4WQM A;  3AE6 B;  1FNV A;  4LNK A;  3B2F A;  1GB1 A;  2MLB A;  3R7R A;  4ANV A;  4BBN F;  4W9J A;  2HTM E;  4YWG G;  1PDX A;  4GDL A;  2Q5W D;  2IND C;  3EC8 A;  4NPN A;  5EE9 A;  1MJD A;  1YMH E;  1E7U A;  1WGK A;  1V97 A;  3B2G A;  5I4D A;  2HD5 B;  4P1C C;  1AYF A;  1UH6 A;  3NS1 A;  2PEA A;  4C7Z A;  4WUR A;  1FRR A;  4EZK A;  4M8N A;  2DWQ A;  2N4F A;  3CSF A;  3SDL C;  4MEL A;  2K0P A;  3MC9 A;  1PUT A;  3C8Y A;  3HK0 A;  2LHD A;  3U30 A;  4JPS A;  4NAW A;  2C7H A;  3CMM B;  1E9M A;  4PS8 A;  4HCN B;  3ZO5 B;  4AP4 C;  1P3Q U;  4MGI E;  2OED A;  2PVG C;  4JX1 C;  1V8C A;  3AMZ A;  1KH0 A;  2LMC A;  2R2O A;  2D10 A;  1XXG A;  2NBW B;  5CTR C;  2LUM A;  3GP7 A;  3UIO B;  1VZ6 A;  3TL5 A;  1C4A A;  1TIF A;  4ICV A;  4EE2 A;  2M4N A;  3A9J A;  4PS3 A;  3RD2 A;  2FCN A;  4W9K A;  3VRB B;  2K8B A;  1JML A;  1VRA B;  4KV2 A;  1TKE A;  4J3O D;  1JWS D;  4MGZ E;  3PGE A;  2KXJ A;  4HVB A;  4YTP B;  2KC1 A;  5AZF A;  2G3Q B;  1L4Z B;  1RYJ A;  1GB4 A;  3L54 A;  1WGG A;  4LCD E;  2OHF A;  1V1O A;  4DHJ D;  4NQK E;  4QAY A;  2N1V A;  1SEB D;  4YTM B;  5G55 A;  1WR1 A;  3DVN U;  3NOB A;  3NRZ A;  2LRU A;  1TS4 A;  3H8H A;  3VDZ A;  2NVU I;  1TJE A;  2L76 A;  1GUA B;  2L0T A;  1MVK A;  1WRI A;  3DBH I;  3WIM A;  1OEY J;  2W54 A;  2N9X A;  3PRP B;  1T3Q A;  1E0Z A;  2UWQ A;  2PLP A;  2XK5 A;  2KFJ A;  2KWD A;  4C4V A;  4YSX B;  2RDG A;  1XT9 B;  2AQ3 B;  5HFY A;  1LXD A;  2O2V A;  1V1P B;  5J17 A;  3E9S A;  2RD0 A;  1J0G A;  3P63 A;  2PW9 A;  1HTO A;  2KFK A;  5TSS A;  5JHA A;  2WP9 B;  2AL3 A;  2B76 B;  3AXC A;  2L00 B;  4MEM A;  2H89 B;  1XLN A;  1JWM D;  3Q8B A;  2KOX A;  1FMA D;  2LUE A;  3ZKJ C;  2V3P A;  5L83 A;  3Q8A A;  2LXC A;  2KX3 A;  1WXQ A;  1NVI D;  2ICI A;  1K50 A;  5LXH A;  2WS3 B;  2IPK D;  4GOC A;  4K1R B;  1VLB A;  1HTQ A;  3QX1 A;  2WQY B;  1ZXH A;  3RNE C;  1P7F A;  3DHI C;  1EWC A;  2W3R A;  3Q6B A;  3DBR I;  2PE9 A;  2I1K A;  4MJS A;  1F2R I;  3AE2 B;  2EKI A;  3PRM B;  3KVF B;  2PMV A;  4OW0 A;  4TQ0 A;  4HDO A;  4UDU C;  4DDI D;  1QOA A;  4HXD A;  4YTN B;  1B1Z A;  4OVZ A;  4BAX A;  2M56 B;  2L05 A;  1MG8 A;  4P16 A;  2JYE A;  1KF6 B;  1WI0 A;  1E8Y A;  4RF1 A;  4IW0 A;  2BW2 A;  2WX0 A;  2LEK A;  2KJH B;  4BOS C;  1OFF A;  4O1N A;  2BVC A;  1V2Y A;  2MP2 B;  1DGJ A;  4LDT D;  3NS8 A;  3RMK C;  1FO4 A;  2UYZ B;  1HEZ E;  2DYO A;  1T0R C;  2IJ0 A;  1BML C;  1ET6 A;  2K6D B;  3QC8 B;  1FXT B;  5IP4 D;  4JIO U;  4LJO B;  1QOB A;  4ANW A;  1S1Q B;  3L4P A;  3QIJ A;  1WJ6 A;  3UQA A;  2HJ8 A;  3C19 A;  2CJN A;  2L8J A;  3Q8C A;  4HRO A;  4A9A A;  2AL6 A;  1TZO A;  4TQ1 A;  3N1Y C;  3B9J A;  3OJ3 A;  1R4N B;  4BKG A;  3ZYY X;  3UIN B;  4BFR A;  1I4G A;  4GDK B;  4AJW A;  1FNU A;  5BYQ A;  1XLQ A;  2DAF A;  1WXM A;  2N1W A;  4US9 A;  2QIE B;  1L6U A;  5JHB A;  3ZUN A;  2BS3 B;  4MH0 E;  1YN5 A;  1T6B X;  3K9O B;  1JRP A;  4DXF A;  2BS4 B;  4MAC A;  1CQV A;  4TSS A;  1PFD A;  1YQB A;  1AW7 A;  3WAN A;  3AEA B;  1EF5 A;  1QT9 A;  1OGW A;  3SFE B;  1WE6 A;  2IGG A;  3GB1 A;  2KMC A;  2RSU A;  3TCA A;  3ZTC A;  3N32 A;  3H9D A;  2X8X X;  1WZ3 A;  3MC8 A;  2PPH A;  4ZHP A;  2K1F A;  1K53 A;  1ZP0 B;  1X1M A;  4BKT A;  4ZRI A;  3P4P B;  4KGR A;  3RCZ A;  4IWQ A;  3FIL B;  3RT3 B;  3EUB 2;  4GDL B;  3H1U A;  1Q0W B;  1PGX A;  2WXK A;  2CR5 A;  1N5X A; 
#chains in the Genus database with same CATH homology
 1E5W A;  4TUU A;  1WXA A;  3PPA A;  2IY1 B;  2GMI C;  3ZLZ A;  1V49 A;  3EHV A;  3T9L A;  2DZM A;  4OVV A;  2G4S A;  2LZ6 A;  4IG7 B;  4J6I A;  2KWC A;  1Q5W B;  3PVL A;  2LWP A;  1A5R A;  1C3T A;  2KJ6 A;  4W9D A;  4FLH A;  1GG3 A;  3H7S A;  1TTN A;  3PLU A;  3TMP B;  2V4L A;  2J0J A;  2JRI B;  4JLC A;  5IA7 A;  1IYF A;  4IWO A;  5KHQ A;  3EEC A;  5J2R A;  3IVF A;  5DCN A;  3JYU A;  1ZKH A;  3HIZ A;  5AZG A;  4ZRK A;  3X0W A;  2Z0D B;  3L10 B;  1V80 A;  2D2Q A;  1C1Y B;  1WJ4 A;  2NBU A;  3OAW A;  4MGK E;  5CHF A;  1WJU A;  1SGH A;  2M8S A;  5DPS A;  5LLI A;  3VVW B;  3R7Q A;  4A3P A;  4G3X B;  5L95 C;  2PJH A;  5C1Z A;  3U8Z A;  1JRU A;  1VCB A;  1J8C A;  2MWS B;  3TIX A;  4F1S A;  1YX6 B;  1UBQ A;  4I6L B;  1WF9 A;  4GU2 A;  5LXI B;  4IM3 A;  3W1S A;  4MGY E;  1WX7 A;  2JVC A;  1E8X A;  4GDK A;  2MX2 A;  4KSK C;  3X23 A;  3ZRC A;  3ZVV A;  5D7G A;  4K7U A;  5AEK B;  5HKH A;  1M94 A;  2GBR A;  3UGB B;  2IYD B;  4GB9 A;  2WDT B;  3ZNH B;  2KZR A;  4GGQ A;  1P0R A;  2KD0 A;  2KWV B;  3ZDM C;  1H8C A;  2WYQ A;  1U4A A;  3APF A;  2BYF A;  3PSE B;  3R66 C;  2BYV E;  4RMA A;  3U7D A;  4GXB A;  3VFK A;  3HM6 X;  2FID A;  3KUD B;  2BKR B;  4JGH B;  1GJZ A;  1F9J A;  2KDI A;  4MSQ B;  3OLM D;  2RGF A;  4N9F 4;  2CU1 A;  4FN2 A;  3VUW A;  1WGR A;  2KMA A;  3VH3 B;  4ZDV A;  4FHK A;  2L7R A;  1LFD A;  3DPD A;  2M0X A;  1WR6 E;  2KKC A;  2KTR A;  2EKE C;  3PT2 B;  1RLF A;  2C7N B;  1R4N I;  4EUT A;  3HM3 A;  3C0R B;  3UF8 A;  2ZVO A;  2GBM A;  4KZC A;  1AAR A;  1WZ0 A;  2G45 B;  3VXW A;  2RR9 A;  2DHZ A;  5JH5 C;  3ML9 A;  2ZVN A;  5IAA C;  2KLC A;  4G50 A;  4PS7 A;  2KHW B;  3VTV A;  3PLV A;  2YLM A;  5D6J B;  4KDI C;  4I6N B;  2O6V B;  4ANX A;  3ZTD A;  1E8W A;  2K25 A;  3VH4 B;  3A9K A;  4WAA A;  3QHT A;  2JPH A;  3A1Q A;  3DOW A;  2MLB A;  4AUQ C;  1T0Y A;  4BVU C;  2FIF A;  3CST A;  4M0W B;  5GMV A;  2N7E A;  2KAN A;  2CS4 A;  4LJP B;  4MM3 A;  3R7R A;  5BO4 B;  4W9J A;  4ANV A;  4BBN F;  3OJ4 B;  4BKS A;  2PE6 B;  4GDL A;  3V61 A;  3EC8 A;  4NPN A;  1E7U A;  1GC6 A;  1BT0 A;  2O6V D;  2VRR B;  3ML8 A;  2HD5 B;  3JSV A;  4GN1 A;  4XZ4 A;  5G2N A;  1UH6 A;  1RRB A;  3JVZ X;  1Y8R C;  2PEA A;  2ZJD A;  2C7M B;  4E3C A;  3ENE A;  3TJP A;  3VAW A;  4EZK A;  3EFU A;  4HK2 A;  4M8N A;  2N4F A;  3DCG A;  3S2A A;  3CSF A;  3SDL C;  4MEL A;  3BIN A;  1NDD A;  1KM7 A;  3A1Q B;  3A33 B;  4ICU A;  2BPS A;  2LI5 A;  1V9J A;  3HK0 A;  3K9P B;  4FHJ A;  2NCN A;  1ZW7 A;  2ZNV C;  3ONS A;  2O2V B;  3U30 A;  3ZNZ B;  5JZE B;  1WFY A;  2KX0 A;  2CHW A;  2FCQ A;  4NAW A;  3V62 A;  3BY4 B;  1UZX B;  2C7H A;  3V60 A;  3CMM B;  5CX3 A;  1D3Z A;  2KFK B;  2JZZ A;  4PS8 A;  4HCN B;  2KDE B;  4W9H A;  3ZO5 B;  4AP4 C;  1G6J A;  3TBL D;  3AUL A;  1P3Q U;  2DYM A;  4MGI E;  4WJN A;  2JF5 A;  2HE7 A;  4X57 B;  2KDB A;  2C60 A;  1OEY A;  4FJY A;  1L2N A;  1GC7 A;  4BKS D;  4EOY A;  3H7P B;  2LD9 A;  1NI2 A;  2R2O A;  2D10 A;  4II2 B;  1E7V A;  2NBW B;  4NJ7 A;  4AWJ A;  4GIV A;  2DX5 B;  4XX5 A;  1YX5 B;  4URK A;  3IFW B;  4K7S A;  5CTR C;  2N9P C;  4A3O A;  4WWP A;  5E6O A;  3RUI B;  1E90 A;  3NZU A;  3UIO B;  4HWI B;  3ZNI D;  3TL5 A;  3APC A;  2MBE A;  2MBH A;  3DVG Y;  3KYD D;  5FR6 A;  3UQB A;  1VD2 A;  2KNB A;  4NAW B;  3DDC B;  1I35 A;  4ICV A;  2M4N A;  2K8C A;  3B0A A;  2LAS A;  3KUC B;  3A9J A;  4KSL C;  2FUH B;  4PS3 A;  2FCN A;  3RD2 A;  3MHS D;  2L0F A;  3DBL I;  4HDQ A;  4W9K A;  3N30 A;  2K8B A;  4CYE A;  3KYC D;  4KV2 A;  2GBK A;  4MJS B;  4DHJ B;  1YJ1 A;  1WM3 A;  3WA0 A;  5J18 A;  4DXA B;  4KDL B;  3AI5 A;  4MGZ E;  3VUY A;  4CO7 A;  3QQ8 B;  3PGE A;  2KXJ A;  4HVB A;  3RYT A;  4ZRJ A;  1E8Z A;  2KC1 A;  5AZF A;  2G3Q B;  2GOW A;  2IBI B;  4DWF A;  4DDG D;  3L54 A;  4IUM B;  1GNU A;  1WGG A;  4HPM B;  4LCD E;  1H4R A;  4ASW C;  4DHJ D;  4NQK E;  2EMT A;  2N1V A;  2GBJ A;  2JY6 A;  3A9J B;  1UGM A;  1WMH A;  2KO3 A;  4W9E A;  4K81 A;  4M8M A;  2O6V A;  4NJ6 A;  5G55 A;  1WR1 A;  1WY8 A;  3DVN U;  3NOB A;  5C23 A;  2LRU A;  3IG3 A;  2BWE S;  1UEL A;  4IM2 A;  4F8C B;  3VDZ A;  2D07 B;  2NVU I;  3WAP A;  1UD7 A;  1WYW B;  4YL8 A;  2L76 A;  2BWF A;  3QA8 A;  1XD3 B;  1P1A A;  2ASQ A;  2Z59 B;  1GUA B;  4GSW A;  3R3M A;  1V6E A;  2L0T A;  2CHX A;  3PRE A;  4RM8 A;  2DZJ A;  2Y5B B;  2C5L C;  2N9E B;  3DBH I;  3WIM A;  1OEY J;  2IO3 B;  4JQW C;  1Z5S B;  4DBG A;  4TV3 A;  3VTU A;  2N9X A;  5CHV C;  3PS6 A;  1LM8 B;  4WQO B;  2ZPN A;  3HHM A;  3LDZ E;  3PRP B;  4G0N B;  1WH3 A;  3PHX B;  4NNJ B;  1WMH B;  2JT4 B;  2UWQ A;  4W9F A;  4MDK E;  2XK5 A;  2DZI A;  1HE8 A;  3SU8 X;  2KFJ A;  1K8R B;  4IM0 A;  2NS5 A;  5CHW A;  3CF6 E;  2ZNV B;  2AEH A;  4NY0 A;  1WGH A;  1EO6 A;  1V5O A;  4B95 A;  2OOB B;  4WJQ A;  1XT9 B;  1P98 A;  2BKF A;  4G11 A;  3VHT C;  1LXD A;  3ZW3 A;  1XQQ A;  1I42 A;  2J0M A;  2O2V A;  5J17 A;  1TZ1 A;  2RD0 A;  2JXX A;  4K7W A;  1J0G A;  2FNJ B;  2QHO A;  5JHA A;  2KFK A;  2AL3 A;  3MJW A;  3AXC A;  2AYO B;  1WM2 A;  4W9I A;  2L00 B;  2BGF A;  3RZW C;  1RAX A;  4MEM A;  3PRZ A;  2JRH A;  2KQS A;  2MCN B;  2KOX A;  3H7P A;  4KZ0 A;  2XK5 B;  1J19 A;  2K6Q A;  1QZE A;  2FCS A;  2LUE A;  4WJP A;  5DPT A;  3ZKJ C;  3KW5 B;  1WX9 A;  5EDS A;  2G4D B;  4DHZ B;  5L83 A;  2KJR A;  3VUX A;  4PYZ A;  2LXC A;  4B6W A;  2KX3 A;  4RM9 A;  2IO2 B;  3Q3F A;  3QJZ A;  2JZ3 B;  2DYB A;  4KVG B;  3PTF C;  5LXH A;  3WAO A;  2ZCC A;  3W1S C;  4EFO A;  3RUL A;  2ZZP B;  3UIP B;  2M17 A;  4GOC A;  4KIK A;  4W9G A;  4BOZ B;  4K1R B;  3V6C B;  2KK8 A;  1ISN A;  2LRW A;  4DK5 A;  3IHP C;  3QX1 A;  4EKU A;  3T8M A;  4IC7 B;  4FA6 A;  2D3G A;  2BYE A;  3DBR I;  2LGD A;  4EZL A;  4F7Z A;  2IY0 B;  2I1K A;  1OQY A;  2PE9 A;  1NBF C;  4MJS A;  2CHZ A;  5E6N A;  4HLE A;  3PRM B;  2XEW A;  4ANU A;  1WJN A;  3PV1 A;  3KUZ A;  3KVF B;  3M62 B;  2MA9 B;  4TQ0 A;  1L7Y A;  2FCM A;  2NPT A;  4HDO A;  1KJT A;  2LGY A;  3ALB A;  2N7D A;  4DDI D;  2A4Z A;  2J0K A;  2MBQ A;  2R2Q A;  4KIK B;  4HXD A;  4MSM B;  1SE9 A;  5AZH A;  3L0W B;  4FAD A;  4B9K A;  3L16 A;  2L05 A;  1MG8 A;  4LDT B;  3L13 A;  1R4M I;  1V81 A;  1PQS A;  2RPQ A;  2L3Z A;  1WI0 A;  2MW5 A;  4AJY B;  1E8Y A;  5DPR A;  2M1M A;  2WX1 A;  2KC2 A;  3QK0 A;  4CHK A;  2KVR A;  4IW0 A;  1P9D U;  2WX0 A;  1YD8 U;  3P2B A;  2KJH B;  1OTR B;  1WRD B;  2Z0E B;  4BOS C;  4OVU A;  4XC2 A;  3JW0 X;  4ZYN A;  1V2Y A;  2MP2 B;  2MBB B;  2NPT B;  2ZCB A;  3IBE A;  4LDT D;  2B3A A;  5E6P A;  3NS8 A;  2OJR A;  4AOF A;  2UYZ B;  3AU4 A;  5D94 A;  2DYO A;  2HTH A;  2DAJ A;  3PZD A;  3M95 A;  3KH0 A;  2K6D B;  3QC8 B;  3VQI A;  1FXT B;  2MSE D;  4W9L A;  2GBN A;  2CKH B;  1EF1 A;  2AWT A;  3I3T B;  4JIO U;  2IO1 B;  2J7Q B;  3N3K B;  4LJO B;  2D11 A;  3RZF A;  4TKN A;  2ZEQ A;  4ANW A;  3ZDT A;  2DEN B;  2XBB C;  1S1Q B;  3WAM A;  3L08 A;  2KTF A;  1WJ6 A;  3QIJ A;  3VTW A;  2A5U A;  2BF8 B;  3UQA A;  2HJ8 A;  3LJ3 A;  2IZV B;  2V1Y A;  4P7I A;  2L8J A;  4JL9 A;  2LGX A;  2IO0 B;  2AL6 A;  3ZRF A;  1Q1O A;  4TQ1 A;  4HCP B;  3SD5 A;  2K8H A;  2NR2 A;  2LXA A;  1TBE A;  3H6N A;  3OJ3 A;  3ZNG C;  1V86 A;  3A4S C;  4PYU A;  4BBN C;  4BKG A;  3UIN B;  4BFR A;  4E71 A;  3WAL A;  3B08 A;  5D2M B;  5TR5 A;  2KWU B;  4GDK B;  1V5T A;  4AJW A;  1IP9 A;  1WGD A;  2I1J A;  2JUO A;  3ECI A;  3M3J A;  4WJO A;  1ZGU B;  2DAF A;  1WXM A;  2N1W A;  4FJZ A;  1WXS A;  3APD A;  1WIA A;  1CMX B;  3AU5 A;  3ZUN A;  5KHO A;  5JHB A;  1SIF A;  3ZIM A;  3GZN I;  2YVC A;  2JWZ A;  4MH0 E;  2EMS A;  4EEW A;  2LJ5 A;  4W9C A;  4A20 A;  1Z2M A;  3D32 A;  2ZPY A;  4HPL B;  3B1L X;  2KN5 A;  3K9O B;  1IPG A;  2W9N A;  3W1Y A;  2KQ7 A;  3L17 A;  4FUL A;  1WX8 A;  2KDF B;  2LVQ A;  4FBJ B;  1YQB A;  4IWP A;  2K39 A;  3WAN A;  3A4R A;  3MTN B;  4NQL B;  1EUV B;  3QCA A;  1EF5 A;  2KTR B;  2DZK A;  2NBV B;  1OGW A;  4I6P A;  1WE6 A;  4DHZ E;  1KOT A;  3O65 B;  2KMC A;  4FJV B;  4EZJ A;  2RSU A;  1WGY A;  3TCA A;  3DVN V;  1RFA A;  3ZTC A;  3N32 A;  3H9D A;  1WZ3 A;  2LVP A;  3NY5 A;  3V6E B;  1UBI A;  3QWZ B;  3NZS A;  2PPH A;  2K1F A;  2WWZ A;  3GOE A;  2MQJ A;  2C9W B;  2MRP A;  3DVG X;  3PHW B;  4WWN A;  1X1M A;  3SHQ A;  4ZRI A;  4BKT A;  2LVO A;  3DQV A;  3RCZ A;  1YIW A;  3A9K B;  2V3S A;  4II3 B;  4IWQ A;  1WXV A;  3QAR A;  3RT3 B;  3DBS A;  1LQB A;  1WE7 A;  2MBO A;  2KLG A;  5DPW A;  4GDL B;  2REX A;  2MP2 A;  3H1U A;  3NHE B;  1Q0W B;  1TGZ B;  2FAZ A;  3M63 B;  4HJK A;  3QAQ A;  4GMV A;  3Q3J A;  4WWO A;  4E74 A;  1KLV A;  3JSV B;  2CR5 A;  1S3S G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...