5JZEB

Erve virus viral otu domain protease in complex with mouse isg15
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
76
structure length
76
Chain Sequence
PLSILVRNERGHSNIYEVFLTQTVDTLKKKVSQREQVHEDQFWLSFEGRPMEDKELLGEYGLKPQCTVIKHLRLRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ubiquitin-like protein ISG15
publication title Biochemical and Structural Insights into the Preference of Nairoviral DeISGylases for Interferon-Stimulated Gene Product 15 Originating from Certain Species.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 21
structure length 76
sequence length 76
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5jzeB00
1TTNA 1WE7A 3K9PB 1WXVA 4BVUC 3H1UA 1WGHA 2KVRA 4KZ0A 5AEKB 2M8SA 1IP9A 3RYTA 1LXDA 1V2YA 3H7SA 3KYCD 2MQJA 3WA0A 2JY6A 3PVLA 2BWES 1WJ6A 4GU2A 4HK2A 2UYZB 3H6NA 2D10A 3UGBB 2G4DB 4GDLB 4PS8A 4EEWA 3ZDMC 2EMSA 3VH4B 4K7WA 1WI0A 5LLIA 1G6JA 1OQYA 1OEYJ 1P9DU 1UZXB 2JVCA 2KN5A 2LI5A 5C1ZA 4DHJD 5CX3A 3WAOA 2GBNA 2N9PC 3PREA 2HE7A 3HK0A 3DBSA 1RRBA 1VD2A 2KMAA 3AI5A 3K9OB 1GC6A 4FN2A 1WYWB 2LVOA 2MBEA 3L0WB 3EHVA 2JUOA 3ZDTA 4W9CA 4FJZA 3IG3A 3WALA 1Z5SB 4W9IA 3VHTC 1UBIA 3X23A 1GNUA 4NAWB 3V61A 3RZFA 2KMCA 4ANXA 3HHMA 2AWTA 4A3PA 1OTRB 3H9DA 2IO3B 2DYMA 3R7QA 2MBBB 2MX2A 3B1LX 3PS6A 1TBEA 3AU4A 3D32A 3PGEA 3WAMA 2JPHA 3ZO5B 1WMHB 2RSUA 3A9KB 3LJ3A 2LJ5A 3ZW3A 1WXMA 4IWPA 3V62A 3ENEA 5IAAC 2KD0A 3M3JA 3QIJA 2JRHA 2MW5A 1IYFA 1WGGA 2IY0B 2L76A 3UF8A 2GBJA 4P7IA 2CHWA 4AUQC 2LXAA 3ZTCA 2KX3A 4W9LA 1WR1A 2LUEA 3ONSA 1A5RA 3V60A 4DHJB 3APCA 2AEHA 2ZCCA 3WANA 2RGFA 2BYFA 1TZ1A 3R3MA 3W1YA 2LD9A 4HWIB 2LRWA 3I3TB 4JIOU 2DAJA 1Q5WB 2KNBA 2K8HA 1SGHA 3HM6X 3TCAA 4B95A 3CF6E 3ZNGC 5CHFA 1YIWA 3U8ZA 1KOTA 2W9NA 4ZRJA 2CHZA 4GDLA 1C1YB 2CU1A 4KIKB 1P98A 4ZDVA 3RT3B 3UIPB 2DZJA 2REXA 3VTUA 3TJPA 4HXDA 1WIAA 3PT2B 2A5UA 3IVFA 2KDIA 2HTHA 2XBBC 4MGZE 1FXTB 1E90A 4HVBA 4FHJA 2XEWA 1MG8A 1WRDB 2NCNA 4MGYE 4W9DA 2K1FA 3ZUNA 3SU8X 5L95C 2PJHA 5J17A 3QHTA 2BF8B 2KHWB 2KC1A 4DWFA 3VUWA 2GBKA 2DHZA 3VXWA 3H7PB 4DDGD 4K81A 3A4RA 2KLGA 4KV2A 3PPAA 5JZEB 2DENB 4NAWA 4RM9A 4EKUA 4IM0A 1ZGUB 1E8WA 5LXIB 3QC8B 2GOWA 3ZKJC 3A1QB 1E8YA 1OEYA 1WGYA 4MM3A 3ZRFA 5D94A 1WMHA 3KUCB 1LFDA 3A9KA 4ZYNA 3V6EB 1V81A 4LJPB 3N3KB 4GSWA 4WWOA 3DVGX 2K25A 4ICVA 4NJ6A 2GBRA 1GUAB 4FLHA 2K6DB 1F9JA 2FCQA 3KH0A 1V86A 2C60A 1V6EA 1L2NA 3W1SC 4W9EA 2AYOB 4F7ZA 4KZCA 4IM3A 1NBFC 3QK0A 1EF1A 2FUHB 3OLMD 3PTFC 1EUVB 2LVQA 2MWSB 2G3QB 2IO2B 2HJ8A 3ML9A 3DVNV 3DQVA 4NPNA 4KSKC 2OJRA 4WJQA 1WR6E 2C5LC 4BBNF 4MELA 2N7EA 4URKA 4JQWC 5D2MB 4GGQA 4XC2A 1WZ3A 3L10B 2FNJB 2JXXA 5CHVC 2K39A 2KWCA 2KDBA 4KIKA 4BOZB 3QX1A 2MBHA 2GBMA 2BKRB 3QCAA 5DPRA 2V1YA 4X57B 2KWVB 2WX1A 2BYEA 3QJZA 3L54A 2MRPA 1Y8RC 4GB9A 1H8CA 4MGIE 2Y5BB 2KQ7A 2KJHB 4GOCA 2AL6A 4EZKA 2JZZA 1NDDA 2D2QA 3L08A 1WY8A 2UWQA 2V4LA 2N7DA 4TUUA 4F8CB 5LXHA 2RPQA 3OJ3A 2I1JA 3OJ4B 5E6NA 3H7PA 4WQOB 2CKHB 3ZTDA 2RR9A 2IO1B 1CMXB 1KJTA 2PPHA 3DVGY 2HD5B 2KTFA 3R66C 4MSMB 3A1QA 4RMAA 3WIMA 4FA6A 3EECA 3Q3FA 1WXSA 1WX8A 4N9F4 2BKFA 4FJYA 4B6WA 2IO0B 4BKGA 4BKTA 2IZVB 1GG3A 2ZPYA 1UD7A 4ANUA 3L17A 2K8CA 4LJOB 3C0RB 1X1MA 2K6QA 3AU5A 4IWQA 5CHWA 4E74A 4MJSB 1KLVA 2C7MB 2PE9A 1R4NI 4M8NA 3X0WA 3VTVA 3RZWC 1UELA 4KVGB 3PLUA 1RLFA 1LQBA 2KJRA 2M0XA 1E7VA 1PQSA 2LZ6A 2WWZA 3QA8A 4RM8A 3TIXA 3CSFA 2NS5A 4PYUA 2MA9B 4TV3A 2DZIA 2KX0A 5JHAA 3QQ8B 2D11A 2FCNA 4GXBA 3JW0X 1WGRA 5G2NA 2KDEB 3M63B 3VUXA 2C7HA 1HE8A 1ISNA 2N9XA 4EFOA 1V49A 3AULA 3GZNI 1LM8B 4W9HA 2EKEC 4FBJB 5AZFA 3ML8A 3SDLC 1EF5A 2NBWB 1P0RA 4FJVB 4K7UA 3SHQA 2M17A 2NBUA 2YLMA 2ZVOA 2OOBB 3KW5B 4AJWA 3EC8A 4M0WB 3IBEA 4FHKA 5GMVA 3DVNU 4E71A 1TGZB 4LCDE 5C23A 2Z59B 3PHWB 4I6PA 1WM2A 3HIZA 4LDTD 3U7DA 4EZJA 2CHXA 3TMPB 2VRRB 1J0GA 5JHBA 4TKNA 3ZNID 1YX5B 2FIFA 3DBRI 2MBOA 2JRIB 1YQBA 1R4MI 5BO4B 1WJUA 4DXAB 2BPSA 1Q0WB 2DYBA 2IY1B 2XK5B 1K8RB 3MTNB 1WGDA 3A33B 4WJOA 1NI2A 4II2B 2KLCA 2Z0EB 2ZEQA 2WYQA 4G0NB 5DPWA 3B0AA 2KQSA 2FCMA 4HDQA 3L16A 2K8BA 2J0KA 3R7RA 1V9JA 4HJKA 2N1WA 2BYVE 2KK8A 4FADA 4W9FA 5DPTA 1V80A 1P3QU 5J2RA 3B08A 2KO3A 1VCBA 3DDCB 3NS8A 4OVVA 1XQQA 2DYOA 2ZZPB 4MJSA 1S3SG 4NNJB 3DPDA 2CS4A 2YVCA 4DHZB 3PRZA 1SE9A 4JGHB 1C3TA 3ZLZA 2AL3A 2L7RA 2RD0A 4HPLB 4W9GA 3AXCA 4LDTB 3VFKA 3VVWB 1J19A 1UH6A 4WWNA 2ZJDA 4AOFA 2D3GA 4NQLB 2O2VB 3NHEB 2KOXA 4NQKE 4GDKB 1WFYA 3PHXB 4BBNC 3IFWB 2C7NB 1M94A 1WX7A 2KJ6A 2IYDB 4AWJA 4G3XB 4WJNA 1QZEA 4IG7B 2L3ZA 4W9JA 2MSED 4G50A 3ALBA 2LRUA 4EUTA 3VH3B 4ZRIA 2ZNVC 4ANVA 3P2BA 3NOBA 3HM3A 3ZVVA 2L0FA 4I6LB 2O6VA 2KFJA 3A9JB 4JL9A 5AZGA 3PRMB 3JYUA 2PEAA 1E5WA 2KFKB 3PZDA 4KDIC 3S2AA 2BGFA 3UIOB 3PSEB 1GJZA 5CTRC 2G4SA 1WJNA 1WJ4A 1V5TA 4TQ0A 3MJWA 4A20A 4HLEA 5D6JB 1GC7A 2G45B 4BOSC 3UQAA 1JRUA 1WH3A 4PS3A 2MP2A 2R2OA 4K1RB 4CHKA 2XK5A 2Z0DB 2LGYA 2FAZA 4I6NB 1S1QB 2LGXA 4ICUA 2I1KA 4WWPA 5JH5C 4OVUA 2BWFA 3U30A 4FULA 1Z2MA 2JZ3B 3DCGA 4DBGA 4AP4C 1XT9B 2O6VD 1I42A 1ZW7A 4KDLB 1KM7A 3SD5A 2NR2A 4W9KA 3V6CB 3ECIA 2LXCA 3UINB 2JF5A 3W1SA 3NY5A 4XZ4A 2J7QB 1YD8U 3CSTA 1UBQA 2WDTB 3KUZA 3VQIA 3ZNHB 4E3CA 1WF9A 5E6OA 4BKSA 2JWZA 3OAWA 2FCSA 2LVPA 3T9LA 3RULA 4II3B 4YL8A 1OGWA 2DZMA 1P1AA 4G11A 4IWOA 3RD2A 4B9KA 2LWPA 2O2VA 2MCNB 4GDKA 3Q3JA 2ZVNA 3A4SC 4DK5A 1EO6A 2MBQA 3PRPB 3MHSD 3APDA 3JSVB 4MDKE 4J6IA 4MH0E 3RUIB 3UQBA 2KXJA 1U4AA 2NPTB 1L7YA 4MSQB 3O65B 5HKHA 4TQ1A 2CR5A 1E8ZA 5G55A 3CMMB 2J0MA 2KDFB 2NBVB 3BY4B 4EOYA 1E7UA 2L8JA 1WXAA 1UGMA 1WM3A 2A4ZA 2KTRA 2LGDA 3VAWA 4EZLA 2KZRA 2LASA 2ZCBA 3A9JA 4K7SA 2DX5B 3VDZA 3DBHI 3KVFB 4BKSD 2KFKA 1I35A 2O6VB 2KANA 1YX6B 2ASQA 1RFAA 3PV1A 3NZSA 3IHPC 3PLVA 4XX5A 3QAQA 3JVZX 1E8XA 1H4RA 4ASWC 2L0TA 4F1SA 2KWUB 4CYEA 5IA7A 1WZ0A 4PS7A 1IPGA 1J8CA 2MP2B 2WX0A 5L83A 3EFUA 1AARA 3N32A 4IUMB 2DZKA 4GMVA 1WX9A 2ZNVB 4HPMB 2N4FA 3APFA 1BT0A 2ZPNA 3DBLI 2R2QA 3N30A 4HCNB 2J0JA 3M62B 4HDOA 4MEMA 5EDSA 2IBIB 3ZIMA 2D07B 4HCPB 4ZRKA 1RAXA 5KHOA 5KHQA 2KC2A 3QWZB 3L13A 4GN1A 4IM2A 2V3SA 3NZUA 3RCZA 2QHOA 4AJYB 4KSLC 4DDID 2L05A 4WJPA 3ZRCA 4M8MA 1ZKHA 3VTWA 3GOEA 4PYZA 5DPSA 1V5OA 5FR6A 2N9EB 2M4NA 4WAAA 2KKCA 2L00B 3KYDD 2MLBA 4BFRA 1XD3B 4CO7A 4JLCA 4IW0A 4IC7B 3TL5A 5TR5A 5D7GA 2DAFA 2JT4B 4GIVA 3JSVA 2NVUI 3KUDB 5AZHA 1D3ZA 1Q1OA 2B3AA 3LDZE 3QARA 2NPTA 4NJ7A 4NY0A 4DHZE 3T8MA 2GMIC 5J18A 1T0YA 1YJ1A 2EMTA 3M95A 3DOWA 5DCNA 3VUYA 3WAPA 2N1VA 4A3OA 3TBLD 2M1MA 2FIDA 1WE6A 4MGKE 2PE6B 3ZNZB 2C9WB 5E6PA 1SIFA 4ANWA 2KTRB 3BINA
chains in the Genus database with same CATH superfamily
3K9PB 1C4CA 2KVRA 1Y56A 3H7SA 3KYCD 3ZJVA 2MQJA 3PVLA 1T0QC 1K52A 2G4DB 4LNIA 2OJWA 4K7WA 1OQYA 2JVCA 2KN5A 5C1ZA 5BYSA 1GPXA 3Q8FA 4HRSA 1WRIA 3HUIA 2KMAA 5BYRA 2LVOA 1NENB 2D3AA 2JUOA 4N6EB 3W5UB 1Z5SB 4W9IA 1HQRD 3HVDA 3V61A 3RZFA 4ANXA 2I38A 2IO3B 3ZXRA 3R7QA 2MBBB 2MX2A 1JALA 1TBEA 3D32A 1AWDA 1WMHB 2RSUA 2X8XX 3LJ3A 1WGGA 4CQNA 1BXTA 2GBJA 4B0MA 3N1ZC 2ZCCA 1L0VB 3AEBB 2QILA 3R3MA 1ZXIA 3MFGA 3I3TB 4ZRPA 1Q5WB 2E3TA 3HM6X 3TCAA 1SSNA 3CF6E 2INPE 1C1YB 4KIKB 1P98A 4ZDVA 1YJJA 2DZJA 3VTUA 3TJPA 2XBBC 4MGZE 5AUIA 2JZPA 2XEWA 1F77A 4MGYE 2HJ1A 2K1FA 3ZUNA 1ACCA 2IDYA 3W5VB 3A4RA 3BK1A 3AE8B 4YT0B 4A9AA 3GE3C 2GOWA 1FM0D 2K22A 3NRZA 2MJ3A 4YTNB 3ZRFA 3KUCB 3A9KA 1K53A 4FLHA 2QIEB 4KGTA 3AE1B 1V6EA 3AECB 2L1AA 4F7ZA 3PO0A 4IM3A 2FUHB 2MJEA 1EUVB 1XLQA 3BWUD 3O13A 3ML9A 4NPNA 3KQ4A 4BBNF 4MELA 4URKA 4JQWC 1UWXA 5D2MB 3KLSX 1DOXA 3AEAB 2KWCA 2WXQA 2KDBA 4S17A 3P4SB 5DPRA 4X57B 3L54A 1H8CA 4K3BA 4EZKA 2KQ7A 3MC0B 4RF0A 4JX1C 1NDDA 2D2QA 2UWQA 3KWLA 4TUUA 2RPQA 1KLUD 1IUEA 1ZE3D 1JWSD 2KTFA 1TKYA 3BVZA 3A1QA 1MPEA 1WX8A 5C3JB 4B6WA 4BKTA 3L17A 4LJOB 3AEEB 1X1MA 3I63C 2K6QA 3N9YC 5CHWA 4MJSB 1C4PA 2DWQA 1YOVB 2C7MB 1R4NI 1UELA 3U52E 1LQBA 3SR6A 4RH6A 3TIXA 1HTOA 3CSFA 3WCQA 3H8HA 2DZIA 3QQ8B 3VRAB 2BVCA 1HE8A 1ISNA 2N9XA 4TSSA 1V49A 1PUTA 3GZNI 3FILA 5AZFA 2GI9A 1WYGA 2ZVOA 3RNEC 3KW5B 3C19A 4E71A 4LCDE 1FNVA 3PHWB 4EZJA 2VRRB 2PKOA 1CK1A 2BQQA 2K3UA 1L0YB 2BPSA 2XK5B 2Q5WD 1K8RB 3MTNB 1WGDA 1NI2A 4II2B 2ZEQA 2WYQA 1L5PA 2KQSA 2FCMA 2PLPA 4HDQA 1V9JA 2WDQB 4HJKA 4D2KA 2QMTA 3AE5B 5J2RA 2WDVB 2LFIA 1VCBA 3DDCB 3NS8A 4OVVA 1XQQA 2DYOA 2CS4A 1F2RI 1C3TA 2AL3A 3VFKA 1E0ZA 1UH6A 4AOFA 2D3GA 3AV8A 3R8BA 3EFCA 1KH0A 1MFWA 2LUMA 1WX7A 2IYDB 1N60A 4W9JA 4G50A 3ALBA 1C79A 3P2BA 3ZVVA 2L0FA 4I6LB 2O6VA 2KFJA 3A9JB 3CIRB 3NVZA 2PEAA 4JWSC 3PZDA 1ZOYB 3Q14C 1WJNA 3P4PB 3UQAA 4BOSC 3IAM1 1JRUA 1WH3A 4K1RB 2Z0DB 1A70A 2FAZA 2M56B 4I6NB 3ABVB 2KAJA 1PFDA 2N0SB 4ICUA 2I1KA 2BWFA 4JWUC 1IGCA 1Z2MA 3BK2A 3OG5A 1I42A 1B9RA 1N62A 4QAYA 2WXNA 2NR2A 1UNSA 2LXCA 3AE3B 3IAS1 2JYEA 3UINB 2JF5A 3KUZA 3ZNHB 3VQIA 1WF9A 3RNGC 3BVMA 2JWZA 3OAWA 1GB1A 1BMLC 4II3B 1OGWA 4A8XC 5EE9A 4LNKA 4GDKA 1QOBA 1I4HA 5BMHA 2I2YA 4MDKE 3UQBA 1VDVA 2NPTB 3RN9C 4MSQB 4TQ1A 5FKAC 3CMMB 4PK1A 2NBVB 1E7UA 1WWTA 2KTRA 2LGDA 2WS3B 2KFKA 3B9JA 1RFAA 2LJIA 2PTLA 3IHPC 4NJCA 3MJ5A 2L0TA 1WZ0A 1HZ6A 2MP2B 4IUMB 3Q3NC 2WXPA 2N4FA 2ZPNA 4MEMA 4HCNB 2IBIB 1I4XA 5GXGB 5KHQA 5MPOA 4GN1A 4DQOC 1K50A 2V3SA 3RCZA 2QHOA 1SJHD 4M8MA 3GOEA 1XXGA 4PYZA 5FR6A 2N9EB 1LGRA 2MLBA 4BFRA 1XD3B 2L32A 2Z8LA 4IC7B 2DAFA 2JT4B 3GP7A 2LHDA 5J18A 1T0YA 2VZKD 3DOWA 3WAPA 3LXFA 2N1VA 1YQ4B 2FIDA 1WE6A 4MGKE 3AE6B 2C9WB 1VR9A 2ZNVB 3AEGB 1TTNA 3UI3A 2Y5CA 3SFEB 4KZ0A 1TKEA 2BWES 2V3NA 2K0PA 1PGXA 2AQ2B 5H8YE 2WGSA 2EMSA 4O1NA 3VH4B 3RNBC 5CX3A 2GBNA 2N9PC 3HK0A 1IGDA 3K9OB 1VD2A 4A90A 1GC6A 5IOIA 1WYWB 1D5ZC 3L0WB 3EHVA 4RFBA 2VZKB 4FJZA 4KGSA 1HA5A 3WALA 3VHTC 3AE2B 3X23A 3RMKC 3HHMA 3EGRA 1OTRB 3AEFB 3BIID 2DYMA 3AU4A 1QT9A 4MM3B 2RMMA 3RFZB 3ZW3A 1AN8A 5IAAC 2KD0A 3QIJA 2L76A 3FAHA 4P1CC 2CHWA 2LXAA 3ZTCA 4W9LA 1WR1A 3ONSA 3V60A 4XWTA 2RGFA 2BYFA 1M4VA 3FKYA 4HEA1 1TZ1A 2WP9B 3W1YA 1KRHA 2OEDA 3RNAC 2LRWA 4JIOU 4WAFA 2KNBA 1N5WA 4B95A 5BMIA 3P4QB 1PGAA 3ZNGC 2W9NA 4ZRJA 2CHZA 4GDLA 2GB1A 3UIPB 3Q69A 2REXA 3AE7B 1WIAA 3IVFA 2KDIA 1SJED 1TY2A 2KYWA 4HVBA 1TT5B 1T0RC 2GLSA 5FK9C 2PJHA 5J17A 3QHTA 3N1YC 4OZCA 4DWFA 4K81A 3EA6A 3PPAA 5JZEB 4NAWA 4DXGA 1E8WA 1I4GA 1TY0A 1XO3A 4YXDB 3ZKJC 1V97A 2N9KA 1ESFA 1OEYA 2JWUA 1WGYA 2HDEA 1V1PB 2J52A 3NVWA 1UGJA 1JQ4A 4ZYNA 4LJPB 3DVGX 2K25A 4ICVA 1GUAB 1JRPA 2BYTA 2K6DB 4W9EA 2AYOB 4KZCA 3VRBB 3OLMD 3PTFC 2W55A 2MWSB 1F0ZA 3DVNV 3DQVA 4C80A 4KSKC 4REZA 4XC2A 1E7PB 2FNJB 2MBHA 1RWSA 4ARIA 2YEPF 3LB8C 2R61A 4GB9A 4M02A 4GOCA 5HHDG 2JZZA 1WXQA 1WY8A 1SBBB 5LXHA 2I1JA 3OJ4B 3I5JC 3H7PA 5HFYA 4WQOB 2V4IB 4J3OD 2RR9A 3DVGY 4P6VF 4N59A 4MSMB 4HKQA 4RMAA 4WWMA 4P1BC 3EECA 1WXSA 2NTSA 3TUOA 2BKFA 1PYWD 2IZVB 1GG3A 1UD7A 3ZXVA 3C0RB 4IWQA 3RNFC 4E74A 2PE9A 3R2TA 5HI1A 2W3SA 3VTVA 3RZWC 4KVGB 5JXVA 2M0XA 1E7VA 1PQSA 2LZ6A 4YTMB 1DOIA 1VZ6A 2KACA 2V0GA 2ON8A 1JWMD 4ZOHC 2GRIA 3M63B 4EFOA 1B1ZA 3AULA 1UF0A 4IOIE 3ML8A 1EF5A 2NBWB 2H89B 4XWWA 2M17A 2YLMA 3EC8A 4NZLB 1C76A 1QKZA 2BT6A 4RNAA 5C23A 2Z59B 2W3RA 2KWDA 1WM2A 4DXFA 1MI0A 3TMPB 4TKNA 1YX5B 2FIFA 2MBOA 2JRIB 1YQBA 5BO4B 2DYBA 2IY1B 1P7EA 3HVZA 4WJOA 2KLCA 2Z0EB 2JXTA 5DPWA 4A6QA 2K8BA 2JU6X 2N1WA 4RF1A 4YWGG 2KK8A 4W9FA 1FNUA 1QF6A 1V80A 3CWIA 1SE2A 3GS2A 1TS4A 2V3PA 4LLGM 4IKGA 4AS1A 1KTKA 2BB5A 2LEKA 4DHZB 3ZJUA 4RGTA 2G1EA 3VVWB 1J19A 2MJDA 1E6EB 4NQLB 4NQKE 1GOZA 2C7NB 1C77A 1M94A 2KJ6A 4AWJA 1TZOA 4ZHOA 2WXLA 4EUTA 4OVZA 4M0WA 4ZRIA 1J7AA 3NOBA 2FE8A 1YN4A 4LTUA 1I4PA 2BGFA 2G4SA 2J4XA 1ZXHA 5D6JB 2G45B 1CQVA 1AW7A 2MP2A 1YJIA 4WH4A 2LGYA 2CJOA 3TEYA 2NTTA 3Q6BA 3PZ8A 3U30A 3DWMA 3DCGA 5BMGA 4Q2JA 4AP4C 2VH2A 2K9XA 4W9KA 3ECIA 1GB4A 2J7QB 1YD8U 1NYQA 5AUKA 2LVPA 3ETRA 3RD2A 3TEXA 2O2VA 2WLBA 2MCNB 3Q3JA 4DK5A 1EO6A 3PRPB 3MHSD 4MH0E 3RUIB 4MH8A 3RI7C 2KXJA 4ITKA 5HKHA 3MHZA 5G55A 2J0MA 5D3DA 3NVYA 1UGMA 2FUG1 1SE4A 4MT5A 4K7SA 1IBXB 3LYYA 1ET6A 2DX5B 3VDZA 3AMZA 1F2RC 4GLSC 2KANA 3N1XC 4YSYB 3NZSA 2K5PA 1GAQB 4HPPA 3JVZX 1H4RA 4ASWC 3RNCC 1IPGA 1EU4A 3URYA 2MHJA 3R2IA 1QILA 4JPSA 3N32A 4HPMB 3APFA 1BT0A 3N30A 3M62B 4PT5A 2D07B 4C4VB 2ACZB 2KT7A 4HCPB 4ZRKA 5KHOA 3NZ3A 4IM2A 4BZAA 3TSSA 4DDID 2L05A 1QOFA 1ZKHA 4OW0A 1FEHA 4ZYSA 2DLBA 3BYYB 3U7ZA 5DPSA 1V5OA 5I4DA 4CO7A 2IGHA 4JLCA 3W2DA 4USAA 4GIVA 3JSVA 1D3ZA 2BS4B 1T3QA 3QARA 2LMCA 2GMIC 1N61A 2EMTA 3M95A 4A3OA 3NVVA 3TBLD 1FRDA 5E6PA 1YNTE 2YEPB 1WE7A 2JYTA 4BVUC 3H1UA 2WDRB 2M8SA 1IP9A 3BVGA 1LXDA 1V2YA 2JY6A 4GU2A 1WJ6A 2PVGC 4HK2A 2UYZB 4JE3B 1VRAB 4PS8A 3DHGC 3ZDMC 5G5GA 2WHIA 1WI0A 1D6EC 1G6JA 1OEYJ 2LI5A 4XYCA 1RFKA 4DHJD 1OQRA 3J9CA 2BTEA 1OQQA 2HE7A 2IPKD 2N7JA 1RRBA 1VLBA 1ZDVA 1XF5L 2MBEA 3ZDTA 4W9CA 1FD6A 3IG3A 2SAKA 2AWTA 4A55A 3DBRB 3H9DA 3T3NA 2EKIA 3B1LX 1R4MB 1V1PA 3PGEA 3WAMA 2JPHA 4M00A 4L2YA 3A9KB 4WIPA 3V62A 3U2SC 3ENEA 2BBCA 2MW5A 3DHHC 1IYFA 2IY0B 1QQRA 1MVKA 3UF8A 4AUQC 1J7BA 4HKZE 2LUEA 3Q8EA 4L23A 3NUHB 4DHJB 5H92C 2AEHA 1MJDA 2LD9A 3IT6B 2DAJA 2K8HA 4ARCA 3U8ZA 1KOTA 2IJ0A 3RT3B 2XNAC 2M0AA 2A5UA 1L6VA 2HTHA 3P4RB 3SEBA 4FHJA 1WRDB 4W9DA 5L95C 2BF8B 2KHWB 2KC1A 3EUB2 2GBKA 2DHZA 2H88B 2RPVA 4DDGD 1TS3A 2WXGA 2KLGA 4KV2A 2DENB 4RM9A 1JMLA 3AE9B 4EKUA 1ZGUB 5LXIB 2VH1A 3A1QB 4IDIA 1NYRA 4RGMA 1TYGB 1FXIA 1WMHA 3VR8B 1LFDA 1V81A 3N3KB 4GSWA 4NJ6A 4C00A 1SIJA 2FCQA 1STEA 1V86A 3KH0A 1NBFC 2EELA 3QK0A 1EF1A 2G3QB 3AE4B 3NS1A 1VZ7A 2C5LC 4GGQA 1WZ3A 1JWBD 2JXXA 1I4RA 2K39A 4KIKA 3DWGC 3IXSA 2GBMA 4RGNA 1F1HA 2V1YA 2BYEA 2OHFA 2MRPA 1Y8RC 4MGIE 2KJHB 2AL6A 1YQ3B 4C7YA 3SFDB 2JQRB 3L08A 2V4LA 4F8CB 3OJ3A 5E6NA 4ZRQA 2CKHB 3ZTDA 2IO1B 2PPHA 2D3BA 2HD5B 3NJTA 1KFYB 4FJYA 4BKGA 2ZPYA 3AB5A 2RDGA 3AU5A 2L83A 4M8NA 1XCQL 3PLUA 2QC8A 1RLFA 2AQ3B 1QOAA 1DOYA 3C8YA 2NS5A 1CJEA 4PYUA 2MA9B 4TV3A 5JHAA 2TSSA 2C7HA 1SB3C 4FBJB 5T8IA 5EE0A 1P0RA 4FJVB 3P63A 1N6ZA 1L4DB 5GMVA 3IBEA 4FHKA 3BZDB 3DVNU 4I6PA 2WXRA 1WJUA 3TEZA 4DXAB 1Q0WB 4TMAB 5BYQA 4XGAB 3Q8AA 1FXAA 2QSDA 5IP4D 3B0AA 4KX6B 2J0KA 3RPFC 1TS2A 4ZHPA 1RM6C 3Q8CA 1E10A 1FPYA 3B2GA 2ZZPB 4MJSA 1RYJA 1JROA 2RDBC 3DPDA 2X38A 2WXKA 1SE9A 3ZLZA 2RD0A 4HPLB 1EU3A 1BUIC 3Q2AC 4WWNA 1FNWA 1ZP0B 1EWYC 2KOXA 4GDKB 2D5GA 3ZYYX 3IFWB 1WSPA 4G3XB 4WJNA 4IG7B 3T3OA 2L3ZA 2MSED 2LRUA 3VH3B 1L4ZB 4H2AA 4ANVA 2ZW0A 3JYUA 4WURA 4KDIC 1E5WA 2KFKB 4HJGE 1FRRA 3PSEB 5CTRC 4B0EA 1CZPA 3AM9A 4TQ0A 4A20A 2KDMA 4PS3A 4CHKA 2R2OA 2XK5A 3DBHB 1JCKB 2W82A 1S1QB 1YN3A 1VZ8A 5JH5C 4OVUA 3HRDD 4FULA 2PMVA 4C4VA 1C9FA 3Q3MC 1I4QA 2ICIA 3SD5A 3V6CB 2LHEA 2KN4A 2WU2B 3W1SA 4E3CA 4AQ7A 3CSTA 1UBQA 2MEKA 2FCSA 3T9LA 2W54A 2DZMA 4G11A 2D3CA 1DYQA 2NMQA 2MBQA 1LO5D 3O65B 2KDFB 2L8JA 2WQYB 1WM3A 2A4ZA 2UU7A 4EZLA 2KZRA 2LASA 2ZCBA 3A9JA 1K51A 3DBHI 3KVFB 4BKSD 1I35A 1YX6B 2ASQA 3PV1A 1FCCC 3V3XA 3GB1A 4CYEA 5IA7A 4LNNA 1C4AA 5EE3A 4K3CA 2WX0A 1AARA 1FIQA 4GMVA 4KGRA 1SF0A 2R2QA 2J0JA 5EDSA 3ZIMA 2KC2A 2DBYA 4KSLC 4LNOA 2BS3B 2KKCA 4L1BA 2XN9C 4IW0A 1OFFA 1HEZE 1MHXA 1N63A 4C56C 1V1OA 2NVUI 1T6BX 2B3AA 3LDZE 4NJ7A 2NPTA 3ZGZA 1V8CA 2RDHA 4ACFA 3VUYA 2PE6B 1SIFA 4ANWA 3BY4B 2DNFA 1NVID 3KWVA 1TS5A 1WXVA 3TEWA 1WGHA 1R4NB 5AEKB 4FXCA 3RYTA 3WA0A 3H6NA 2D10A 4N58A 3UGBB 4GDLB 2JX5A 4EEWA 2SEBD 5LLIA 2KVZA 1P9DU 1UZXB 3GZNB 3WAOA 3PREA 1VJKA 3DBSA 3AI5A 4FN2A 2AQ1B 2INCC 2AX5A 1UBIA 1GNUA 3I9V1 4NAWB 2KMCA 3NG0A 4A3PA 3PS6A 3I57A 3ZO5B 1XLOA 4KKIA 1WGKA 2LJ5A 1WXMA 1ET9A 4IWPA 3M3JA 3P1MA 2JRHA 2Y3AA 1XEEA 4P7IA 1NEKB 2KX3A 5D3IB 2WXMA 1A5RA 5LNK1 2WU5B 1FO4A 3APCA 3FC4A 3WANA 1C78A 2B76B 4HWIB 1SGHA 3V05A 5CHFA 1YIWA 2CU1A 4XDDA 3W9CB 2BS2B 1XCTL 2E6XA 4KKJA 4UDUC 4HXDA 3PT2B 2PW9A 3VR9B 3OWEB 1FXTB 1UWMA 1E90A 3AEDB 4P16A 1MG8A 2WXIA 4BAXA 2NCNA 1DGJA 3SU8X 1TKGA 3MC8A 3VUWA 1F52A 3VXWA 3H7PB 2G9HD 1JW9D 3B2FA 4IM0A 3AH7A 3QC8B 2INDC 1E8YA 1XLPA 2ONQA 4MM3A 5D94A 3V6EB 1YMHE 4WWOA 3AN1A 2GBRA 1F9JA 2C60A 1L2NA 3W1SC 1JWAD 1N5XA 4WQMA 1AYFA 5G5HA 2LVQA 2IO2B 1FFVA 2HJ8A 2IGDA 2OJRA 1PDXA 1WR6E 4WJQA 2N7EA 2WXJA 3L10B 5CHVC 1HZ5A 2WNMA 4BOZB 3QX1A 1HTQA 3QCAA 2BKRB 2KWVB 2WX1A 3QJZA 3DHIC 1MG4A 4YTPB 2Y5BB 1HXYD 1JWUD 1TJEA 2N7DA 2IGGA 1D4BA 4R3DA 1QLBB 2QDFA 1CMXB 1KJTA 3ZQ4A 2ZW1A 3N20C 3R66C 3WIMA 4FA6A 3Q3FA 4N9F4 1R7SA 3IT4B 2IO0B 4ANUA 2K8CA 3ZJTA 2BB6A 1KLVA 3X0WA 1ENFA 2QJLA 2KJRA 3MP9A 1KF6B 4EE2A 3QA8A 2WWZA 4RM8A 2KX0A 2D11A 2FCNA 4GXBA 3JW0X 1WGRA 5G2NA 1L0XB 2KDEB 2QCZA 3VUXA 1SEBD 4W9HA 1LM8B 2EKEC 3SDLC 4YSZB 4K7UA 3SHQA 2NBUA 2OOBB 2KQ4X 1PGBA 4M0WB 4AJWA 1TGZB 4LNFA 4LDTD 3U7DA 3HIZA 3MC9A 2CHXA 1P7FA 1J0GA 5JHBA 3ZNID 3DBRI 2BW2A 1R4MI 2CU3A 2MH7A 3PZ7A 5FR3A 4HROA 3A33B 4G0NB 1FFUA 3L16A 3R7RA 2BYVE 2LGSA 4FADA 2V9HA 5DPTA 2JSVX 1P3QU 3B08A 2KO3A 2QEJC 1I7HA 4NNJB 1S3SG 2YVCA 4M01A 1ZPSA 3PRZA 4US9A 4JGHB 1E9MA 2L7RA 4W9GA 3AXCA 4LDTB 2ZJDA 4RCOA 2O2VB 3NHEB 1WFYA 3PHXB 4BBNC 1TIFA 1QZEA 1Q10A 5EE1A 3FILB 4XE0A 5IN7A 2WXHA 2L52A 2ZNVC 3HM3A 1SXTA 5AZGA 4JL9A 1FMAD 1EWCA 3PRMB 3S2AA 3UIOB 1GJZA 2J53A 5C2TB 1WJ4A 1V5TA 3MJWA 1T0SC 4HLEA 1GC7A 1KLGD 2KMMA 3L4PA 2WXOA 2LGXA 4NAMA 4WWPA 2JZ3B 4DBGA 2LGIA 1XT9B 2O6VD 4S0RA 1ZUD2 1QOGA 1ZW7A 4KDLB 4YSXB 1KM7A 1ROEA 3DBLB 2WXFA 3NY5A 4XZ4A 5E6JA 1FCLA 2WDTB 5E6OA 4BKSA 1XLNA 4RGOS 3RULA 4YL8A 1D5XC 1P1AA 4C7ZA 3E9SA 4IWOA 4B9KA 1D5MC 2LWPA 5IKCM 2ZVNA 3A4SC 1ZDXA 5TSSA 3APDA 3JSVB 4J6IA 1U4AA 1L7YA 2CR5A 1E8ZA 1NI3A 4EOYA 1WXAA 2M19A 3VAWA 4OHJA 4XDCA 3U4EG 3Q3OC 4LK0M 2O6VB 1UUPA 3BYTB 2Y5PA 1EM7A 3PLVA 2CJNA 4XX5A 3QAQA 1E8XA 4F1SA 2KWUB 4PS7A 2PVOD 3P42A 1J8CA 5HG2A 5L83A 2HTME 3EFUA 1YN5A 2DZKA 1WX9A 2PIAA 4OZBA 4HDOA 3DBLI 4US8A 1RAXA 3QWZB 3L13A 1MHHE 3E56A 3Q8BA 4MACA 3NZUA 4AJYB 2J42A 4WJPA 3ZRCA 1T5XD 3VTWA 1L6UA 4WAAA 2M4NA 2L00B 3KYDD 2INNE 3TL5A 5TR5A 5D7GA 2FBWB 3KUDB 5AZHA 1Q1OA 4NY0A 4DHZE 3T8MA 1SE3A 1YJ1A 5DCNA 1J7CA 3GE8C 2M1MA 5IO9A 3ZNZB 2N9LA 1IBXA 2KTRB 4OZAA 3BINA
chains in the Genus database with same CATH topology
1TTNA 1WE7A 3K9PB 1WXVA 4BVUC 3H1UA 1WGHA 2KVRA 4KZ0A 5AEKB 2M8SA 1IP9A 3RYTA 1LXDA 1V2YA 3H7SA 3KYCD 2MQJA 3WA0A 2JY6A 3PVLA 2BWES 1WJ6A 4GU2A 4HK2A 2UYZB 3H6NA 2D10A 3UGBB 2G4DB 4GDLB 4PS8A 4EEWA 3ZDMC 2EMSA 3VH4B 4K7WA 1WI0A 5LLIA 1G6JA 1OQYA 1OEYJ 1P9DU 1UZXB 2JVCA 2KN5A 2LI5A 5C1ZA 4DHJD 5CX3A 3WAOA 2GBNA 2N9PC 3PREA 2HE7A 3HK0A 3DBSA 1RRBA 1VD2A 2KMAA 3AI5A 3K9OB 1GC6A 4FN2A 1WYWB 2LVOA 2MBEA 3L0WB 3EHVA 2JUOA 3ZDTA 4W9CA 4FJZA 3IG3A 3WALA 1Z5SB 4W9IA 3VHTC 1UBIA 3X23A 1GNUA 4NAWB 3V61A 3RZFA 2KMCA 4ANXA 3HHMA 2AWTA 4A3PA 1OTRB 3H9DA 2IO3B 2DYMA 3R7QA 2MBBB 2MX2A 3B1LX 3PS6A 1TBEA 3AU4A 3D32A 3PGEA 3WAMA 2JPHA 3ZO5B 1WMHB 2RSUA 3A9KB 3LJ3A 2LJ5A 3ZW3A 1WXMA 4IWPA 3V62A 3ENEA 5IAAC 2KD0A 3M3JA 3QIJA 2JRHA 2MW5A 1IYFA 1WGGA 2IY0B 2L76A 3UF8A 2GBJA 4P7IA 2CHWA 4AUQC 2LXAA 3ZTCA 2KX3A 4W9LA 1WR1A 2LUEA 3ONSA 1A5RA 3V60A 4DHJB 3APCA 2AEHA 2ZCCA 3WANA 2RGFA 2BYFA 1TZ1A 3R3MA 3W1YA 2LD9A 4HWIB 2LRWA 3I3TB 4JIOU 2DAJA 1Q5WB 2KNBA 2K8HA 1SGHA 3HM6X 3TCAA 4B95A 3CF6E 3ZNGC 5CHFA 1YIWA 3U8ZA 1KOTA 2W9NA 4ZRJA 2CHZA 4GDLA 1C1YB 2CU1A 4KIKB 1P98A 4ZDVA 3RT3B 3UIPB 2DZJA 2REXA 3VTUA 3TJPA 4HXDA 1WIAA 3PT2B 2A5UA 3IVFA 2KDIA 2HTHA 2XBBC 4MGZE 1FXTB 1E90A 4HVBA 4FHJA 2XEWA 1MG8A 1WRDB 2NCNA 4MGYE 4W9DA 2K1FA 3ZUNA 3SU8X 5L95C 2PJHA 5J17A 3QHTA 2BF8B 2KHWB 2KC1A 4DWFA 3VUWA 2GBKA 2DHZA 3VXWA 3H7PB 4DDGD 4K81A 3A4RA 2KLGA 4KV2A 3PPAA 5JZEB 2DENB 4NAWA 4RM9A 4EKUA 4IM0A 1ZGUB 1E8WA 5LXIB 3QC8B 2GOWA 3ZKJC 3A1QB 1E8YA 1OEYA 1WGYA 4MM3A 3ZRFA 5D94A 1WMHA 3KUCB 1LFDA 3A9KA 4ZYNA 3V6EB 1V81A 4LJPB 3N3KB 4GSWA 4WWOA 3DVGX 2K25A 4ICVA 4NJ6A 2GBRA 1GUAB 4FLHA 2K6DB 1F9JA 2FCQA 3KH0A 1V86A 2C60A 1V6EA 1L2NA 3W1SC 4W9EA 2AYOB 4F7ZA 4KZCA 4IM3A 1NBFC 3QK0A 1EF1A 2FUHB 3OLMD 3PTFC 1EUVB 2LVQA 2MWSB 2G3QB 2IO2B 2HJ8A 3ML9A 3DVNV 3DQVA 4NPNA 4KSKC 2OJRA 4WJQA 1WR6E 2C5LC 4BBNF 4MELA 2N7EA 4URKA 4JQWC 5D2MB 4GGQA 4XC2A 1WZ3A 3L10B 2FNJB 2JXXA 5CHVC 2K39A 2KWCA 2KDBA 4KIKA 4BOZB 3QX1A 2MBHA 2GBMA 2BKRB 3QCAA 5DPRA 2V1YA 4X57B 2KWVB 2WX1A 2BYEA 3QJZA 3L54A 2MRPA 1Y8RC 4GB9A 1H8CA 4MGIE 2Y5BB 2KQ7A 2KJHB 4GOCA 2AL6A 4EZKA 2JZZA 1NDDA 2D2QA 3L08A 1WY8A 2UWQA 2V4LA 2N7DA 4TUUA 4F8CB 5LXHA 2RPQA 3OJ3A 2I1JA 3OJ4B 5E6NA 3H7PA 4WQOB 2CKHB 3ZTDA 2RR9A 2IO1B 1CMXB 1KJTA 2PPHA 3DVGY 2HD5B 2KTFA 3R66C 4MSMB 3A1QA 4RMAA 3WIMA 4FA6A 3EECA 3Q3FA 1WXSA 1WX8A 4N9F4 2BKFA 4FJYA 4B6WA 2IO0B 4BKGA 4BKTA 2IZVB 1GG3A 2ZPYA 1UD7A 4ANUA 3L17A 2K8CA 4LJOB 3C0RB 1X1MA 2K6QA 3AU5A 4IWQA 5CHWA 4E74A 4MJSB 1KLVA 2C7MB 2PE9A 1R4NI 4M8NA 3X0WA 3VTVA 3RZWC 1UELA 4KVGB 3PLUA 1RLFA 1LQBA 2KJRA 2M0XA 1E7VA 1PQSA 2LZ6A 2WWZA 3QA8A 4RM8A 3TIXA 3CSFA 2NS5A 4PYUA 2MA9B 4TV3A 2DZIA 2KX0A 5JHAA 3QQ8B 2D11A 2FCNA 4GXBA 3JW0X 1WGRA 5G2NA 2KDEB 3M63B 3VUXA 2C7HA 1HE8A 1ISNA 2N9XA 4EFOA 1V49A 3AULA 3GZNI 1LM8B 4W9HA 2EKEC 4FBJB 5AZFA 3ML8A 3SDLC 1EF5A 2NBWB 1P0RA 4FJVB 4K7UA 3SHQA 2M17A 2NBUA 2YLMA 2ZVOA 2OOBB 3KW5B 4AJWA 3EC8A 4M0WB 3IBEA 4FHKA 5GMVA 3DVNU 4E71A 1TGZB 4LCDE 5C23A 2Z59B 3PHWB 4I6PA 1WM2A 3HIZA 4LDTD 3U7DA 4EZJA 2CHXA 3TMPB 2VRRB 1J0GA 5JHBA 4TKNA 3ZNID 1YX5B 2FIFA 3DBRI 2MBOA 2JRIB 1YQBA 1R4MI 5BO4B 1WJUA 4DXAB 2BPSA 1Q0WB 2DYBA 2IY1B 2XK5B 1K8RB 3MTNB 1WGDA 3A33B 4WJOA 1NI2A 4II2B 2KLCA 2Z0EB 2ZEQA 2WYQA 4G0NB 5DPWA 3B0AA 2KQSA 2FCMA 4HDQA 3L16A 2K8BA 2J0KA 3R7RA 1V9JA 4HJKA 2N1WA 2BYVE 2KK8A 4FADA 4W9FA 5DPTA 1V80A 1P3QU 5J2RA 3B08A 2KO3A 1VCBA 3DDCB 3NS8A 4OVVA 1XQQA 2DYOA 2ZZPB 4MJSA 1S3SG 4NNJB 3DPDA 2CS4A 2YVCA 4DHZB 3PRZA 1SE9A 4JGHB 1C3TA 3ZLZA 2AL3A 2L7RA 2RD0A 4HPLB 4W9GA 3AXCA 4LDTB 3VFKA 3VVWB 1J19A 1UH6A 4WWNA 2ZJDA 4AOFA 2D3GA 4NQLB 2O2VB 3NHEB 2KOXA 4NQKE 4GDKB 1WFYA 3PHXB 4BBNC 3IFWB 2C7NB 1M94A 1WX7A 2KJ6A 2IYDB 4AWJA 4G3XB 4WJNA 1QZEA 4IG7B 2L3ZA 4W9JA 2MSED 4G50A 3ALBA 2LRUA 4EUTA 3VH3B 4ZRIA 2ZNVC 4ANVA 3P2BA 3NOBA 3HM3A 3ZVVA 2L0FA 4I6LB 2O6VA 2KFJA 3A9JB 4JL9A 5AZGA 3PRMB 3JYUA 2PEAA 1E5WA 2KFKB 3PZDA 4KDIC 3S2AA 2BGFA 3UIOB 3PSEB 1GJZA 5CTRC 2G4SA 1WJNA 1WJ4A 1V5TA 4TQ0A 3MJWA 4A20A 4HLEA 5D6JB 1GC7A 2G45B 4BOSC 3UQAA 1JRUA 1WH3A 4PS3A 2MP2A 2R2OA 4K1RB 4CHKA 2XK5A 2Z0DB 2LGYA 2FAZA 4I6NB 1S1QB 2LGXA 4ICUA 2I1KA 4WWPA 5JH5C 4OVUA 2BWFA 3U30A 4FULA 1Z2MA 2JZ3B 3DCGA 4DBGA 4AP4C 1XT9B 2O6VD 1I42A 1ZW7A 4KDLB 1KM7A 3SD5A 2NR2A 4W9KA 3V6CB 3ECIA 2LXCA 3UINB 2JF5A 3W1SA 3NY5A 4XZ4A 2J7QB 1YD8U 3CSTA 1UBQA 2WDTB 3KUZA 3VQIA 3ZNHB 4E3CA 1WF9A 5E6OA 4BKSA 2JWZA 3OAWA 2FCSA 2LVPA 3T9LA 3RULA 4II3B 4YL8A 1OGWA 2DZMA 1P1AA 4G11A 4IWOA 3RD2A 4B9KA 2LWPA 2O2VA 2MCNB 4GDKA 3Q3JA 2ZVNA 3A4SC 4DK5A 1EO6A 2MBQA 3PRPB 3MHSD 3APDA 3JSVB 4MDKE 4J6IA 4MH0E 3RUIB 3UQBA 2KXJA 1U4AA 2NPTB 1L7YA 4MSQB 3O65B 5HKHA 4TQ1A 2CR5A 1E8ZA 5G55A 3CMMB 2J0MA 2KDFB 2NBVB 3BY4B 4EOYA 1E7UA 2L8JA 1WXAA 1UGMA 1WM3A 2A4ZA 2KTRA 2LGDA 3VAWA 4EZLA 2KZRA 2LASA 2ZCBA 3A9JA 4K7SA 2DX5B 3VDZA 3DBHI 3KVFB 4BKSD 2KFKA 1I35A 2O6VB 2KANA 1YX6B 2ASQA 1RFAA 3PV1A 3NZSA 3IHPC 3PLVA 4XX5A 3QAQA 3JVZX 1E8XA 1H4RA 4ASWC 2L0TA 4F1SA 2KWUB 4CYEA 5IA7A 1WZ0A 4PS7A 1IPGA 1J8CA 2MP2B 2WX0A 5L83A 3EFUA 1AARA 3N32A 4IUMB 2DZKA 4GMVA 1WX9A 2ZNVB 4HPMB 2N4FA 3APFA 1BT0A 2ZPNA 3DBLI 2R2QA 3N30A 4HCNB 2J0JA 3M62B 4HDOA 4MEMA 5EDSA 2IBIB 3ZIMA 2D07B 4HCPB 4ZRKA 1RAXA 5KHOA 5KHQA 2KC2A 3QWZB 3L13A 4GN1A 4IM2A 2V3SA 3NZUA 3RCZA 2QHOA 4AJYB 4KSLC 4DDID 2L05A 4WJPA 3ZRCA 4M8MA 1ZKHA 3VTWA 3GOEA 4PYZA 5DPSA 1V5OA 5FR6A 2N9EB 2M4NA 4WAAA 2KKCA 2L00B 3KYDD 2MLBA 4BFRA 1XD3B 4CO7A 4JLCA 4IW0A 4IC7B 3TL5A 5TR5A 5D7GA 2DAFA 2JT4B 4GIVA 3JSVA 2NVUI 3KUDB 5AZHA 1D3ZA 1Q1OA 2B3AA 3LDZE 3QARA 2NPTA 4NJ7A 4NY0A 4DHZE 3T8MA 2GMIC 5J18A 1T0YA 1YJ1A 2EMTA 3M95A 3DOWA 5DCNA 3VUYA 3WAPA 2N1VA 4A3OA 3TBLD 2M1MA 2FIDA 1WE6A 4MGKE 2PE6B 3ZNZB 2C9WB 5E6PA 1SIFA 4ANWA 2KTRB 3BINA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TTN A;  1WE7 A;  3K9P B;  1WXV A;  4BVU C;  3H1U A;  1WGH A;  2KVR A;  4KZ0 A;  5AEK B;  2M8S A;  1IP9 A;  3RYT A;  1LXD A;  1V2Y A;  3H7S A;  3KYC D;  2MQJ A;  3WA0 A;  2JY6 A;  3PVL A;  2BWE S;  1WJ6 A;  4GU2 A;  4HK2 A;  2UYZ B;  3H6N A;  2D10 A;  3UGB B;  2G4D B;  4GDL B;  4PS8 A;  4EEW A;  3ZDM C;  2EMS A;  3VH4 B;  4K7W A;  1WI0 A;  5LLI A;  1G6J A;  1OQY A;  1OEY J;  1P9D U;  1UZX B;  2JVC A;  2KN5 A;  2LI5 A;  5C1Z A;  4DHJ D;  5CX3 A;  3WAO A;  2GBN A;  2N9P C;  3PRE A;  2HE7 A;  3HK0 A;  3DBS A;  1RRB A;  1VD2 A;  2KMA A;  3AI5 A;  3K9O B;  1GC6 A;  4FN2 A;  1WYW B;  2LVO A;  2MBE A;  3L0W B;  3EHV A;  2JUO A;  3ZDT A;  4W9C A;  4FJZ A;  3IG3 A;  3WAL A;  1Z5S B;  4W9I A;  3VHT C;  1UBI A;  3X23 A;  1GNU A;  4NAW B;  3V61 A;  3RZF A;  2KMC A;  4ANX A;  3HHM A;  2AWT A;  4A3P A;  1OTR B;  3H9D A;  2IO3 B;  2DYM A;  3R7Q A;  2MBB B;  2MX2 A;  3B1L X;  3PS6 A;  1TBE A;  3AU4 A;  3D32 A;  3PGE A;  3WAM A;  2JPH A;  3ZO5 B;  1WMH B;  2RSU A;  3A9K B;  3LJ3 A;  2LJ5 A;  3ZW3 A;  1WXM A;  4IWP A;  3V62 A;  3ENE A;  5IAA C;  2KD0 A;  3M3J A;  3QIJ A;  2JRH A;  2MW5 A;  1IYF A;  1WGG A;  2IY0 B;  2L76 A;  3UF8 A;  2GBJ A;  4P7I A;  2CHW A;  4AUQ C;  2LXA A;  3ZTC A;  2KX3 A;  4W9L A;  1WR1 A;  2LUE A;  3ONS A;  1A5R A;  3V60 A;  4DHJ B;  3APC A;  2AEH A;  2ZCC A;  3WAN A;  2RGF A;  2BYF A;  1TZ1 A;  3R3M A;  3W1Y A;  2LD9 A;  4HWI B;  2LRW A;  3I3T B;  4JIO U;  2DAJ A;  1Q5W B;  2KNB A;  2K8H A;  1SGH A;  3HM6 X;  3TCA A;  4B95 A;  3CF6 E;  3ZNG C;  5CHF A;  1YIW A;  3U8Z A;  1KOT A;  2W9N A;  4ZRJ A;  2CHZ A;  4GDL A;  1C1Y B;  2CU1 A;  4KIK B;  1P98 A;  4ZDV A;  3RT3 B;  3UIP B;  2DZJ A;  2REX A;  3VTU A;  3TJP A;  4HXD A;  1WIA A;  3PT2 B;  2A5U A;  3IVF A;  2KDI A;  2HTH A;  2XBB C;  4MGZ E;  1FXT B;  1E90 A;  4HVB A;  4FHJ A;  2XEW A;  1MG8 A;  1WRD B;  2NCN A;  4MGY E;  4W9D A;  2K1F A;  3ZUN A;  3SU8 X;  5L95 C;  2PJH A;  5J17 A;  3QHT A;  2BF8 B;  2KHW B;  2KC1 A;  4DWF A;  3VUW A;  2GBK A;  2DHZ A;  3VXW A;  3H7P B;  4DDG D;  4K81 A;  3A4R A;  2KLG A;  4KV2 A;  3PPA A;  5JZE B;  2DEN B;  4NAW A;  4RM9 A;  4EKU A;  4IM0 A;  1ZGU B;  1E8W A;  5LXI B;  3QC8 B;  2GOW A;  3ZKJ C;  3A1Q B;  1E8Y A;  1OEY A;  1WGY A;  4MM3 A;  3ZRF A;  5D94 A;  1WMH A;  3KUC B;  1LFD A;  3A9K A;  4ZYN A;  3V6E B;  1V81 A;  4LJP B;  3N3K B;  4GSW A;  4WWO A;  3DVG X;  2K25 A;  4ICV A;  4NJ6 A;  2GBR A;  1GUA B;  4FLH A;  2K6D B;  1F9J A;  2FCQ A;  3KH0 A;  1V86 A;  2C60 A;  1V6E A;  1L2N A;  3W1S C;  4W9E A;  2AYO B;  4F7Z A;  4KZC A;  4IM3 A;  1NBF C;  3QK0 A;  1EF1 A;  2FUH B;  3OLM D;  3PTF C;  1EUV B;  2LVQ A;  2MWS B;  2G3Q B;  2IO2 B;  2HJ8 A;  3ML9 A;  3DVN V;  3DQV A;  4NPN A;  4KSK C;  2OJR A;  4WJQ A;  1WR6 E;  2C5L C;  4BBN F;  4MEL A;  2N7E A;  4URK A;  4JQW C;  5D2M B;  4GGQ A;  4XC2 A;  1WZ3 A;  3L10 B;  2FNJ B;  2JXX A;  5CHV C;  2K39 A;  2KWC A;  2KDB A;  4KIK A;  4BOZ B;  3QX1 A;  2MBH A;  2GBM A;  2BKR B;  3QCA A;  5DPR A;  2V1Y A;  4X57 B;  2KWV B;  2WX1 A;  2BYE A;  3QJZ A;  3L54 A;  2MRP A;  1Y8R C;  4GB9 A;  1H8C A;  4MGI E;  2Y5B B;  2KQ7 A;  2KJH B;  4GOC A;  2AL6 A;  4EZK A;  2JZZ A;  1NDD A;  2D2Q A;  3L08 A;  1WY8 A;  2UWQ A;  2V4L A;  2N7D A;  4TUU A;  4F8C B;  5LXH A;  2RPQ A;  3OJ3 A;  2I1J A;  3OJ4 B;  5E6N A;  3H7P A;  4WQO B;  2CKH B;  3ZTD A;  2RR9 A;  2IO1 B;  1CMX B;  1KJT A;  2PPH A;  3DVG Y;  2HD5 B;  2KTF A;  3R66 C;  4MSM B;  3A1Q A;  4RMA A;  3WIM A;  4FA6 A;  3EEC A;  3Q3F A;  1WXS A;  1WX8 A;  4N9F 4;  2BKF A;  4FJY A;  4B6W A;  2IO0 B;  4BKG A;  4BKT A;  2IZV B;  1GG3 A;  2ZPY A;  1UD7 A;  4ANU A;  3L17 A;  2K8C A;  4LJO B;  3C0R B;  1X1M A;  2K6Q A;  3AU5 A;  4IWQ A;  5CHW A;  4E74 A;  4MJS B;  1KLV A;  2C7M B;  2PE9 A;  1R4N I;  4M8N A;  3X0W A;  3VTV A;  3RZW C;  1UEL A;  4KVG B;  3PLU A;  1RLF A;  1LQB A;  2KJR A;  2M0X A;  1E7V A;  1PQS A;  2LZ6 A;  2WWZ A;  3QA8 A;  4RM8 A;  3TIX A;  3CSF A;  2NS5 A;  4PYU A;  2MA9 B;  4TV3 A;  2DZI A;  2KX0 A;  5JHA A;  3QQ8 B;  2D11 A;  2FCN A;  4GXB A;  3JW0 X;  1WGR A;  5G2N A;  2KDE B;  3M63 B;  3VUX A;  2C7H A;  1HE8 A;  1ISN A;  2N9X A;  4EFO A;  1V49 A;  3AUL A;  3GZN I;  1LM8 B;  4W9H A;  2EKE C;  4FBJ B;  5AZF A;  3ML8 A;  3SDL C;  1EF5 A;  2NBW B;  1P0R A;  4FJV B;  4K7U A;  3SHQ A;  2M17 A;  2NBU A;  2YLM A;  2ZVO A;  2OOB B;  3KW5 B;  4AJW A;  3EC8 A;  4M0W B;  3IBE A;  4FHK A;  5GMV A;  3DVN U;  4E71 A;  1TGZ B;  4LCD E;  5C23 A;  2Z59 B;  3PHW B;  4I6P A;  1WM2 A;  3HIZ A;  4LDT D;  3U7D A;  4EZJ A;  2CHX A;  3TMP B;  2VRR B;  1J0G A;  5JHB A;  4TKN A;  3ZNI D;  1YX5 B;  2FIF A;  3DBR I;  2MBO A;  2JRI B;  1YQB A;  1R4M I;  5BO4 B;  1WJU A;  4DXA B;  2BPS A;  1Q0W B;  2DYB A;  2IY1 B;  2XK5 B;  1K8R B;  3MTN B;  1WGD A;  3A33 B;  4WJO A;  1NI2 A;  4II2 B;  2KLC A;  2Z0E B;  2ZEQ A;  2WYQ A;  4G0N B;  5DPW A;  3B0A A;  2KQS A;  2FCM A;  4HDQ A;  3L16 A;  2K8B A;  2J0K A;  3R7R A;  1V9J A;  4HJK A;  2N1W A;  2BYV E;  2KK8 A;  4FAD A;  4W9F A;  5DPT A;  1V80 A;  1P3Q U;  5J2R A;  3B08 A;  2KO3 A;  1VCB A;  3DDC B;  3NS8 A;  4OVV A;  1XQQ A;  2DYO A;  2ZZP B;  4MJS A;  1S3S G;  4NNJ B;  3DPD A;  2CS4 A;  2YVC A;  4DHZ B;  3PRZ A;  1SE9 A;  4JGH B;  1C3T A;  3ZLZ A;  2AL3 A;  2L7R A;  2RD0 A;  4HPL B;  4W9G A;  3AXC A;  4LDT B;  3VFK A;  3VVW B;  1J19 A;  1UH6 A;  4WWN A;  2ZJD A;  4AOF A;  2D3G A;  4NQL B;  2O2V B;  3NHE B;  2KOX A;  4NQK E;  4GDK B;  1WFY A;  3PHX B;  4BBN C;  3IFW B;  2C7N B;  1M94 A;  1WX7 A;  2KJ6 A;  2IYD B;  4AWJ A;  4G3X B;  4WJN A;  1QZE A;  4IG7 B;  2L3Z A;  4W9J A;  2MSE D;  4G50 A;  3ALB A;  2LRU A;  4EUT A;  3VH3 B;  4ZRI A;  2ZNV C;  4ANV A;  3P2B A;  3NOB A;  3HM3 A;  3ZVV A;  2L0F A;  4I6L B;  2O6V A;  2KFJ A;  3A9J B;  4JL9 A;  5AZG A;  3PRM B;  3JYU A;  2PEA A;  1E5W A;  2KFK B;  3PZD A;  4KDI C;  3S2A A;  2BGF A;  3UIO B;  3PSE B;  1GJZ A;  5CTR C;  2G4S A;  1WJN A;  1WJ4 A;  1V5T A;  4TQ0 A;  3MJW A;  4A20 A;  4HLE A;  5D6J B;  1GC7 A;  2G45 B;  4BOS C;  3UQA A;  1JRU A;  1WH3 A;  4PS3 A;  2MP2 A;  2R2O A;  4K1R B;  4CHK A;  2XK5 A;  2Z0D B;  2LGY A;  2FAZ A;  4I6N B;  1S1Q B;  2LGX A;  4ICU A;  2I1K A;  4WWP A;  5JH5 C;  4OVU A;  2BWF A;  3U30 A;  4FUL A;  1Z2M A;  2JZ3 B;  3DCG A;  4DBG A;  4AP4 C;  1XT9 B;  2O6V D;  1I42 A;  1ZW7 A;  4KDL B;  1KM7 A;  3SD5 A;  2NR2 A;  4W9K A;  3V6C B;  3ECI A;  2LXC A;  3UIN B;  2JF5 A;  3W1S A;  3NY5 A;  4XZ4 A;  2J7Q B;  1YD8 U;  3CST A;  1UBQ A;  2WDT B;  3KUZ A;  3VQI A;  3ZNH B;  4E3C A;  1WF9 A;  5E6O A;  4BKS A;  2JWZ A;  3OAW A;  2FCS A;  2LVP A;  3T9L A;  3RUL A;  4II3 B;  4YL8 A;  1OGW A;  2DZM A;  1P1A A;  4G11 A;  4IWO A;  3RD2 A;  4B9K A;  2LWP A;  2O2V A;  2MCN B;  4GDK A;  3Q3J A;  2ZVN A;  3A4S C;  4DK5 A;  1EO6 A;  2MBQ A;  3PRP B;  3MHS D;  3APD A;  3JSV B;  4MDK E;  4J6I A;  4MH0 E;  3RUI B;  3UQB A;  2KXJ A;  1U4A A;  2NPT B;  1L7Y A;  4MSQ B;  3O65 B;  5HKH A;  4TQ1 A;  2CR5 A;  1E8Z A;  5G55 A;  3CMM B;  2J0M A;  2KDF B;  2NBV B;  3BY4 B;  4EOY A;  1E7U A;  2L8J A;  1WXA A;  1UGM A;  1WM3 A;  2A4Z A;  2KTR A;  2LGD A;  3VAW A;  4EZL A;  2KZR A;  2LAS A;  2ZCB A;  3A9J A;  4K7S A;  2DX5 B;  3VDZ A;  3DBH I;  3KVF B;  4BKS D;  2KFK A;  1I35 A;  2O6V B;  2KAN A;  1YX6 B;  2ASQ A;  1RFA A;  3PV1 A;  3NZS A;  3IHP C;  3PLV A;  4XX5 A;  3QAQ A;  3JVZ X;  1E8X A;  1H4R A;  4ASW C;  2L0T A;  4F1S A;  2KWU B;  4CYE A;  5IA7 A;  1WZ0 A;  4PS7 A;  1IPG A;  1J8C A;  2MP2 B;  2WX0 A;  5L83 A;  3EFU A;  1AAR A;  3N32 A;  4IUM B;  2DZK A;  4GMV A;  1WX9 A;  2ZNV B;  4HPM B;  2N4F A;  3APF A;  1BT0 A;  2ZPN A;  3DBL I;  2R2Q A;  3N30 A;  4HCN B;  2J0J A;  3M62 B;  4HDO A;  4MEM A;  5EDS A;  2IBI B;  3ZIM A;  2D07 B;  4HCP B;  4ZRK A;  1RAX A;  5KHO A;  5KHQ A;  2KC2 A;  3QWZ B;  3L13 A;  4GN1 A;  4IM2 A;  2V3S A;  3NZU A;  3RCZ A;  2QHO A;  4AJY B;  4KSL C;  4DDI D;  2L05 A;  4WJP A;  3ZRC A;  4M8M A;  1ZKH A;  3VTW A;  3GOE A;  4PYZ A;  5DPS A;  1V5O A;  5FR6 A;  2N9E B;  2M4N A;  4WAA A;  2KKC A;  2L00 B;  3KYD D;  2MLB A;  4BFR A;  1XD3 B;  4CO7 A;  4JLC A;  4IW0 A;  4IC7 B;  3TL5 A;  5TR5 A;  5D7G A;  2DAF A;  2JT4 B;  4GIV A;  3JSV A;  2NVU I;  3KUD B;  5AZH A;  1D3Z A;  1Q1O A;  2B3A A;  3LDZ E;  3QAR A;  2NPT A;  4NJ7 A;  4NY0 A;  4DHZ E;  3T8M A;  2GMI C;  5J18 A;  1T0Y A;  1YJ1 A;  2EMT A;  3M95 A;  3DOW A;  5DCN A;  3VUY A;  3WAP A;  2N1V A;  4A3O A;  3TBL D;  2M1M A;  2FID A;  1WE6 A;  4MGK E;  2PE6 B;  3ZNZ B;  2C9W B;  5E6P A;  1SIF A;  4ANW A;  2KTR B;  3BIN A; 
#chains in the Genus database with same CATH topology
 3K9P B;  1C4C A;  2KVR A;  1Y56 A;  3H7S A;  3KYC D;  3ZJV A;  2MQJ A;  3PVL A;  1T0Q C;  1K52 A;  2G4D B;  4LNI A;  2OJW A;  4K7W A;  1OQY A;  2JVC A;  2KN5 A;  5C1Z A;  5BYS A;  1GPX A;  3Q8F A;  4HRS A;  1WRI A;  3HUI A;  2KMA A;  5BYR A;  2LVO A;  1NEN B;  2D3A A;  2JUO A;  4N6E B;  3W5U B;  1Z5S B;  4W9I A;  1HQR D;  3HVD A;  3V61 A;  3RZF A;  4ANX A;  2I38 A;  2IO3 B;  3ZXR A;  3R7Q A;  2MBB B;  2MX2 A;  1JAL A;  1TBE A;  3D32 A;  1AWD A;  1WMH B;  2RSU A;  2X8X X;  3LJ3 A;  1WGG A;  4CQN A;  1BXT A;  2GBJ A;  4B0M A;  3N1Z C;  2ZCC A;  1L0V B;  3AEB B;  2QIL A;  3R3M A;  1ZXI A;  3MFG A;  3I3T B;  4ZRP A;  1Q5W B;  2E3T A;  3HM6 X;  3TCA A;  1SSN A;  3CF6 E;  2INP E;  1C1Y B;  4KIK B;  1P98 A;  4ZDV A;  1YJJ A;  2DZJ A;  3VTU A;  3TJP A;  2XBB C;  4MGZ E;  5AUI A;  2JZP A;  2XEW A;  1F77 A;  4MGY E;  2HJ1 A;  2K1F A;  3ZUN A;  1ACC A;  2IDY A;  3W5V B;  3A4R A;  3BK1 A;  3AE8 B;  4YT0 B;  4A9A A;  3GE3 C;  2GOW A;  1FM0 D;  2K22 A;  3NRZ A;  2MJ3 A;  4YTN B;  3ZRF A;  3KUC B;  3A9K A;  1K53 A;  4FLH A;  2QIE B;  4KGT A;  3AE1 B;  1V6E A;  3AEC B;  2L1A A;  4F7Z A;  3PO0 A;  4IM3 A;  2FUH B;  2MJE A;  1EUV B;  1XLQ A;  3BWU D;  3O13 A;  3ML9 A;  4NPN A;  3KQ4 A;  4BBN F;  4MEL A;  4URK A;  4JQW C;  1UWX A;  5D2M B;  3KLS X;  1DOX A;  3AEA B;  2KWC A;  2WXQ A;  2KDB A;  4S17 A;  3P4S B;  5DPR A;  4X57 B;  3L54 A;  1H8C A;  4K3B A;  4EZK A;  2KQ7 A;  3MC0 B;  4RF0 A;  4JX1 C;  1NDD A;  2D2Q A;  2UWQ A;  3KWL A;  4TUU A;  2RPQ A;  1KLU D;  1IUE A;  1ZE3 D;  1JWS D;  2KTF A;  1TKY A;  3BVZ A;  3A1Q A;  1MPE A;  1WX8 A;  5C3J B;  4B6W A;  4BKT A;  3L17 A;  4LJO B;  3AEE B;  1X1M A;  3I63 C;  2K6Q A;  3N9Y C;  5CHW A;  4MJS B;  1C4P A;  2DWQ A;  1YOV B;  2C7M B;  1R4N I;  1UEL A;  3U52 E;  1LQB A;  3SR6 A;  4RH6 A;  3TIX A;  1HTO A;  3CSF A;  3WCQ A;  3H8H A;  2DZI A;  3QQ8 B;  3VRA B;  2BVC A;  1HE8 A;  1ISN A;  2N9X A;  4TSS A;  1V49 A;  1PUT A;  3GZN I;  3FIL A;  5AZF A;  2GI9 A;  1WYG A;  2ZVO A;  3RNE C;  3KW5 B;  3C19 A;  4E71 A;  4LCD E;  1FNV A;  3PHW B;  4EZJ A;  2VRR B;  2PKO A;  1CK1 A;  2BQQ A;  2K3U A;  1L0Y B;  2BPS A;  2XK5 B;  2Q5W D;  1K8R B;  3MTN B;  1WGD A;  1NI2 A;  4II2 B;  2ZEQ A;  2WYQ A;  1L5P A;  2KQS A;  2FCM A;  2PLP A;  4HDQ A;  1V9J A;  2WDQ B;  4HJK A;  4D2K A;  2QMT A;  3AE5 B;  5J2R A;  2WDV B;  2LFI A;  1VCB A;  3DDC B;  3NS8 A;  4OVV A;  1XQQ A;  2DYO A;  2CS4 A;  1F2R I;  1C3T A;  2AL3 A;  3VFK A;  1E0Z A;  1UH6 A;  4AOF A;  2D3G A;  3AV8 A;  3R8B A;  3EFC A;  1KH0 A;  1MFW A;  2LUM A;  1WX7 A;  2IYD B;  1N60 A;  4W9J A;  4G50 A;  3ALB A;  1C79 A;  3P2B A;  3ZVV A;  2L0F A;  4I6L B;  2O6V A;  2KFJ A;  3A9J B;  3CIR B;  3NVZ A;  2PEA A;  4JWS C;  3PZD A;  1ZOY B;  3Q14 C;  1WJN A;  3P4P B;  3UQA A;  4BOS C;  3IAM 1;  1JRU A;  1WH3 A;  4K1R B;  2Z0D B;  1A70 A;  2FAZ A;  2M56 B;  4I6N B;  3ABV B;  2KAJ A;  1PFD A;  2N0S B;  4ICU A;  2I1K A;  2BWF A;  4JWU C;  1IGC A;  1Z2M A;  3BK2 A;  3OG5 A;  1I42 A;  1B9R A;  1N62 A;  4QAY A;  2WXN A;  2NR2 A;  1UNS A;  2LXC A;  3AE3 B;  3IAS 1;  2JYE A;  3UIN B;  2JF5 A;  3KUZ A;  3ZNH B;  3VQI A;  1WF9 A;  3RNG C;  3BVM A;  2JWZ A;  3OAW A;  1GB1 A;  1BML C;  4II3 B;  1OGW A;  4A8X C;  5EE9 A;  4LNK A;  4GDK A;  1QOB A;  1I4H A;  5BMH A;  2I2Y A;  4MDK E;  3UQB A;  1VDV A;  2NPT B;  3RN9 C;  4MSQ B;  4TQ1 A;  5FKA C;  3CMM B;  4PK1 A;  2NBV B;  1E7U A;  1WWT A;  2KTR A;  2LGD A;  2WS3 B;  2KFK A;  3B9J A;  1RFA A;  2LJI A;  2PTL A;  3IHP C;  4NJC A;  3MJ5 A;  2L0T A;  1WZ0 A;  1HZ6 A;  2MP2 B;  4IUM B;  3Q3N C;  2WXP A;  2N4F A;  2ZPN A;  4MEM A;  4HCN B;  2IBI B;  1I4X A;  5GXG B;  5KHQ A;  5MPO A;  4GN1 A;  4DQO C;  1K50 A;  2V3S A;  3RCZ A;  2QHO A;  1SJH D;  4M8M A;  3GOE A;  1XXG A;  4PYZ A;  5FR6 A;  2N9E B;  1LGR A;  2MLB A;  4BFR A;  1XD3 B;  2L32 A;  2Z8L A;  4IC7 B;  2DAF A;  2JT4 B;  3GP7 A;  2LHD A;  5J18 A;  1T0Y A;  2VZK D;  3DOW A;  3WAP A;  3LXF A;  2N1V A;  1YQ4 B;  2FID A;  1WE6 A;  4MGK E;  3AE6 B;  2C9W B;  1VR9 A;  2ZNV B;  3AEG B;  1TTN A;  3UI3 A;  2Y5C A;  3SFE B;  4KZ0 A;  1TKE A;  2BWE S;  2V3N A;  2K0P A;  1PGX A;  2AQ2 B;  5H8Y E;  2WGS A;  2EMS A;  4O1N A;  3VH4 B;  3RNB C;  5CX3 A;  2GBN A;  2N9P C;  3HK0 A;  1IGD A;  3K9O B;  1VD2 A;  4A90 A;  1GC6 A;  5IOI A;  1WYW B;  1D5Z C;  3L0W B;  3EHV A;  4RFB A;  2VZK B;  4FJZ A;  4KGS A;  1HA5 A;  3WAL A;  3VHT C;  3AE2 B;  3X23 A;  3RMK C;  3HHM A;  3EGR A;  1OTR B;  3AEF B;  3BII D;  2DYM A;  3AU4 A;  1QT9 A;  4MM3 B;  2RMM A;  3RFZ B;  3ZW3 A;  1AN8 A;  5IAA C;  2KD0 A;  3QIJ A;  2L76 A;  3FAH A;  4P1C C;  2CHW A;  2LXA A;  3ZTC A;  4W9L A;  1WR1 A;  3ONS A;  3V60 A;  4XWT A;  2RGF A;  2BYF A;  1M4V A;  3FKY A;  4HEA 1;  1TZ1 A;  2WP9 B;  3W1Y A;  1KRH A;  2OED A;  3RNA C;  2LRW A;  4JIO U;  4WAF A;  2KNB A;  1N5W A;  4B95 A;  5BMI A;  3P4Q B;  1PGA A;  3ZNG C;  2W9N A;  4ZRJ A;  2CHZ A;  4GDL A;  2GB1 A;  3UIP B;  3Q69 A;  2REX A;  3AE7 B;  1WIA A;  3IVF A;  2KDI A;  1SJE D;  1TY2 A;  2KYW A;  4HVB A;  1TT5 B;  1T0R C;  2GLS A;  5FK9 C;  2PJH A;  5J17 A;  3QHT A;  3N1Y C;  4OZC A;  4DWF A;  4K81 A;  3EA6 A;  3PPA A;  5JZE B;  4NAW A;  4DXG A;  1E8W A;  1I4G A;  1TY0 A;  1XO3 A;  4YXD B;  3ZKJ C;  1V97 A;  2N9K A;  1ESF A;  1OEY A;  2JWU A;  1WGY A;  2HDE A;  1V1P B;  2J52 A;  3NVW A;  1UGJ A;  1JQ4 A;  4ZYN A;  4LJP B;  3DVG X;  2K25 A;  4ICV A;  1GUA B;  1JRP A;  2BYT A;  2K6D B;  4W9E A;  2AYO B;  4KZC A;  3VRB B;  3OLM D;  3PTF C;  2W55 A;  2MWS B;  1F0Z A;  3DVN V;  3DQV A;  4C80 A;  4KSK C;  4REZ A;  4XC2 A;  1E7P B;  2FNJ B;  2MBH A;  1RWS A;  4ARI A;  2YEP F;  3LB8 C;  2R61 A;  4GB9 A;  4M02 A;  4GOC A;  5HHD G;  2JZZ A;  1WXQ A;  1WY8 A;  1SBB B;  5LXH A;  2I1J A;  3OJ4 B;  3I5J C;  3H7P A;  5HFY A;  4WQO B;  2V4I B;  4J3O D;  2RR9 A;  3DVG Y;  4P6V F;  4N59 A;  4MSM B;  4HKQ A;  4RMA A;  4WWM A;  4P1B C;  3EEC A;  1WXS A;  2NTS A;  3TUO A;  2BKF A;  1PYW D;  2IZV B;  1GG3 A;  1UD7 A;  3ZXV A;  3C0R B;  4IWQ A;  3RNF C;  4E74 A;  2PE9 A;  3R2T A;  5HI1 A;  2W3S A;  3VTV A;  3RZW C;  4KVG B;  5JXV A;  2M0X A;  1E7V A;  1PQS A;  2LZ6 A;  4YTM B;  1DOI A;  1VZ6 A;  2KAC A;  2V0G A;  2ON8 A;  1JWM D;  4ZOH C;  2GRI A;  3M63 B;  4EFO A;  1B1Z A;  3AUL A;  1UF0 A;  4IOI E;  3ML8 A;  1EF5 A;  2NBW B;  2H89 B;  4XWW A;  2M17 A;  2YLM A;  3EC8 A;  4NZL B;  1C76 A;  1QKZ A;  2BT6 A;  4RNA A;  5C23 A;  2Z59 B;  2W3R A;  2KWD A;  1WM2 A;  4DXF A;  1MI0 A;  3TMP B;  4TKN A;  1YX5 B;  2FIF A;  2MBO A;  2JRI B;  1YQB A;  5BO4 B;  2DYB A;  2IY1 B;  1P7E A;  3HVZ A;  4WJO A;  2KLC A;  2Z0E B;  2JXT A;  5DPW A;  4A6Q A;  2K8B A;  2JU6 X;  2N1W A;  4RF1 A;  4YWG G;  2KK8 A;  4W9F A;  1FNU A;  1QF6 A;  1V80 A;  3CWI A;  1SE2 A;  3GS2 A;  1TS4 A;  2V3P A;  4LLG M;  4IKG A;  4AS1 A;  1KTK A;  2BB5 A;  2LEK A;  4DHZ B;  3ZJU A;  4RGT A;  2G1E A;  3VVW B;  1J19 A;  2MJD A;  1E6E B;  4NQL B;  4NQK E;  1GOZ A;  2C7N B;  1C77 A;  1M94 A;  2KJ6 A;  4AWJ A;  1TZO A;  4ZHO A;  2WXL A;  4EUT A;  4OVZ A;  4M0W A;  4ZRI A;  1J7A A;  3NOB A;  2FE8 A;  1YN4 A;  4LTU A;  1I4P A;  2BGF A;  2G4S A;  2J4X A;  1ZXH A;  5D6J B;  2G45 B;  1CQV A;  1AW7 A;  2MP2 A;  1YJI A;  4WH4 A;  2LGY A;  2CJO A;  3TEY A;  2NTT A;  3Q6B A;  3PZ8 A;  3U30 A;  3DWM A;  3DCG A;  5BMG A;  4Q2J A;  4AP4 C;  2VH2 A;  2K9X A;  4W9K A;  3ECI A;  1GB4 A;  2J7Q B;  1YD8 U;  1NYQ A;  5AUK A;  2LVP A;  3ETR A;  3RD2 A;  3TEX A;  2O2V A;  2WLB A;  2MCN B;  3Q3J A;  4DK5 A;  1EO6 A;  3PRP B;  3MHS D;  4MH0 E;  3RUI B;  4MH8 A;  3RI7 C;  2KXJ A;  4ITK A;  5HKH A;  3MHZ A;  5G55 A;  2J0M A;  5D3D A;  3NVY A;  1UGM A;  2FUG 1;  1SE4 A;  4MT5 A;  4K7S A;  1IBX B;  3LYY A;  1ET6 A;  2DX5 B;  3VDZ A;  3AMZ A;  1F2R C;  4GLS C;  2KAN A;  3N1X C;  4YSY B;  3NZS A;  2K5P A;  1GAQ B;  4HPP A;  3JVZ X;  1H4R A;  4ASW C;  3RNC C;  1IPG A;  1EU4 A;  3URY A;  2MHJ A;  3R2I A;  1QIL A;  4JPS A;  3N32 A;  4HPM B;  3APF A;  1BT0 A;  3N30 A;  3M62 B;  4PT5 A;  2D07 B;  4C4V B;  2ACZ B;  2KT7 A;  4HCP B;  4ZRK A;  5KHO A;  3NZ3 A;  4IM2 A;  4BZA A;  3TSS A;  4DDI D;  2L05 A;  1QOF A;  1ZKH A;  4OW0 A;  1FEH A;  4ZYS A;  2DLB A;  3BYY B;  3U7Z A;  5DPS A;  1V5O A;  5I4D A;  4CO7 A;  2IGH A;  4JLC A;  3W2D A;  4USA A;  4GIV A;  3JSV A;  1D3Z A;  2BS4 B;  1T3Q A;  3QAR A;  2LMC A;  2GMI C;  1N61 A;  2EMT A;  3M95 A;  4A3O A;  3NVV A;  3TBL D;  1FRD A;  5E6P A;  1YNT E;  2YEP B;  1WE7 A;  2JYT A;  4BVU C;  3H1U A;  2WDR B;  2M8S A;  1IP9 A;  3BVG A;  1LXD A;  1V2Y A;  2JY6 A;  4GU2 A;  1WJ6 A;  2PVG C;  4HK2 A;  2UYZ B;  4JE3 B;  1VRA B;  4PS8 A;  3DHG C;  3ZDM C;  5G5G A;  2WHI A;  1WI0 A;  1D6E C;  1G6J A;  1OEY J;  2LI5 A;  4XYC A;  1RFK A;  4DHJ D;  1OQR A;  3J9C A;  2BTE A;  1OQQ A;  2HE7 A;  2IPK D;  2N7J A;  1RRB A;  1VLB A;  1ZDV A;  1XF5 L;  2MBE A;  3ZDT A;  4W9C A;  1FD6 A;  3IG3 A;  2SAK A;  2AWT A;  4A55 A;  3DBR B;  3H9D A;  3T3N A;  2EKI A;  3B1L X;  1R4M B;  1V1P A;  3PGE A;  3WAM A;  2JPH A;  4M00 A;  4L2Y A;  3A9K B;  4WIP A;  3V62 A;  3U2S C;  3ENE A;  2BBC A;  2MW5 A;  3DHH C;  1IYF A;  2IY0 B;  1QQR A;  1MVK A;  3UF8 A;  4AUQ C;  1J7B A;  4HKZ E;  2LUE A;  3Q8E A;  4L23 A;  3NUH B;  4DHJ B;  5H92 C;  2AEH A;  1MJD A;  2LD9 A;  3IT6 B;  2DAJ A;  2K8H A;  4ARC A;  3U8Z A;  1KOT A;  2IJ0 A;  3RT3 B;  2XNA C;  2M0A A;  2A5U A;  1L6V A;  2HTH A;  3P4R B;  3SEB A;  4FHJ A;  1WRD B;  4W9D A;  5L95 C;  2BF8 B;  2KHW B;  2KC1 A;  3EUB 2;  2GBK A;  2DHZ A;  2H88 B;  2RPV A;  4DDG D;  1TS3 A;  2WXG A;  2KLG A;  4KV2 A;  2DEN B;  4RM9 A;  1JML A;  3AE9 B;  4EKU A;  1ZGU B;  5LXI B;  2VH1 A;  3A1Q B;  4IDI A;  1NYR A;  4RGM A;  1TYG B;  1FXI A;  1WMH A;  3VR8 B;  1LFD A;  1V81 A;  3N3K B;  4GSW A;  4NJ6 A;  4C00 A;  1SIJ A;  2FCQ A;  1STE A;  1V86 A;  3KH0 A;  1NBF C;  2EEL A;  3QK0 A;  1EF1 A;  2G3Q B;  3AE4 B;  3NS1 A;  1VZ7 A;  2C5L C;  4GGQ A;  1WZ3 A;  1JWB D;  2JXX A;  1I4R A;  2K39 A;  4KIK A;  3DWG C;  3IXS A;  2GBM A;  4RGN A;  1F1H A;  2V1Y A;  2BYE A;  2OHF A;  2MRP A;  1Y8R C;  4MGI E;  2KJH B;  2AL6 A;  1YQ3 B;  4C7Y A;  3SFD B;  2JQR B;  3L08 A;  2V4L A;  4F8C B;  3OJ3 A;  5E6N A;  4ZRQ A;  2CKH B;  3ZTD A;  2IO1 B;  2PPH A;  2D3B A;  2HD5 B;  3NJT A;  1KFY B;  4FJY A;  4BKG A;  2ZPY A;  3AB5 A;  2RDG A;  3AU5 A;  2L83 A;  4M8N A;  1XCQ L;  3PLU A;  2QC8 A;  1RLF A;  2AQ3 B;  1QOA A;  1DOY A;  3C8Y A;  2NS5 A;  1CJE A;  4PYU A;  2MA9 B;  4TV3 A;  5JHA A;  2TSS A;  2C7H A;  1SB3 C;  4FBJ B;  5T8I A;  5EE0 A;  1P0R A;  4FJV B;  3P63 A;  1N6Z A;  1L4D B;  5GMV A;  3IBE A;  4FHK A;  3BZD B;  3DVN U;  4I6P A;  2WXR A;  1WJU A;  3TEZ A;  4DXA B;  1Q0W B;  4TMA B;  5BYQ A;  4XGA B;  3Q8A A;  1FXA A;  2QSD A;  5IP4 D;  3B0A A;  4KX6 B;  2J0K A;  3RPF C;  1TS2 A;  4ZHP A;  1RM6 C;  3Q8C A;  1E10 A;  1FPY A;  3B2G A;  2ZZP B;  4MJS A;  1RYJ A;  1JRO A;  2RDB C;  3DPD A;  2X38 A;  2WXK A;  1SE9 A;  3ZLZ A;  2RD0 A;  4HPL B;  1EU3 A;  1BUI C;  3Q2A C;  4WWN A;  1FNW A;  1ZP0 B;  1EWY C;  2KOX A;  4GDK B;  2D5G A;  3ZYY X;  3IFW B;  1WSP A;  4G3X B;  4WJN A;  4IG7 B;  3T3O A;  2L3Z A;  2MSE D;  2LRU A;  3VH3 B;  1L4Z B;  4H2A A;  4ANV A;  2ZW0 A;  3JYU A;  4WUR A;  4KDI C;  1E5W A;  2KFK B;  4HJG E;  1FRR A;  3PSE B;  5CTR C;  4B0E A;  1CZP A;  3AM9 A;  4TQ0 A;  4A20 A;  2KDM A;  4PS3 A;  4CHK A;  2R2O A;  2XK5 A;  3DBH B;  1JCK B;  2W82 A;  1S1Q B;  1YN3 A;  1VZ8 A;  5JH5 C;  4OVU A;  3HRD D;  4FUL A;  2PMV A;  4C4V A;  1C9F A;  3Q3M C;  1I4Q A;  2ICI A;  3SD5 A;  3V6C B;  2LHE A;  2KN4 A;  2WU2 B;  3W1S A;  4E3C A;  4AQ7 A;  3CST A;  1UBQ A;  2MEK A;  2FCS A;  3T9L A;  2W54 A;  2DZM A;  4G11 A;  2D3C A;  1DYQ A;  2NMQ A;  2MBQ A;  1LO5 D;  3O65 B;  2KDF B;  2L8J A;  2WQY B;  1WM3 A;  2A4Z A;  2UU7 A;  4EZL A;  2KZR A;  2LAS A;  2ZCB A;  3A9J A;  1K51 A;  3DBH I;  3KVF B;  4BKS D;  1I35 A;  1YX6 B;  2ASQ A;  3PV1 A;  1FCC C;  3V3X A;  3GB1 A;  4CYE A;  5IA7 A;  4LNN A;  1C4A A;  5EE3 A;  4K3C A;  2WX0 A;  1AAR A;  1FIQ A;  4GMV A;  4KGR A;  1SF0 A;  2R2Q A;  2J0J A;  5EDS A;  3ZIM A;  2KC2 A;  2DBY A;  4KSL C;  4LNO A;  2BS3 B;  2KKC A;  4L1B A;  2XN9 C;  4IW0 A;  1OFF A;  1HEZ E;  1MHX A;  1N63 A;  4C56 C;  1V1O A;  2NVU I;  1T6B X;  2B3A A;  3LDZ E;  4NJ7 A;  2NPT A;  3ZGZ A;  1V8C A;  2RDH A;  4ACF A;  3VUY A;  2PE6 B;  1SIF A;  4ANW A;  3BY4 B;  2DNF A;  1NVI D;  3KWV A;  1TS5 A;  1WXV A;  3TEW A;  1WGH A;  1R4N B;  5AEK B;  4FXC A;  3RYT A;  3WA0 A;  3H6N A;  2D10 A;  4N58 A;  3UGB B;  4GDL B;  2JX5 A;  4EEW A;  2SEB D;  5LLI A;  2KVZ A;  1P9D U;  1UZX B;  3GZN B;  3WAO A;  3PRE A;  1VJK A;  3DBS A;  3AI5 A;  4FN2 A;  2AQ1 B;  2INC C;  2AX5 A;  1UBI A;  1GNU A;  3I9V 1;  4NAW B;  2KMC A;  3NG0 A;  4A3P A;  3PS6 A;  3I57 A;  3ZO5 B;  1XLO A;  4KKI A;  1WGK A;  2LJ5 A;  1WXM A;  1ET9 A;  4IWP A;  3M3J A;  3P1M A;  2JRH A;  2Y3A A;  1XEE A;  4P7I A;  1NEK B;  2KX3 A;  5D3I B;  2WXM A;  1A5R A;  5LNK 1;  2WU5 B;  1FO4 A;  3APC A;  3FC4 A;  3WAN A;  1C78 A;  2B76 B;  4HWI B;  1SGH A;  3V05 A;  5CHF A;  1YIW A;  2CU1 A;  4XDD A;  3W9C B;  2BS2 B;  1XCT L;  2E6X A;  4KKJ A;  4UDU C;  4HXD A;  3PT2 B;  2PW9 A;  3VR9 B;  3OWE B;  1FXT B;  1UWM A;  1E90 A;  3AED B;  4P16 A;  1MG8 A;  2WXI A;  4BAX A;  2NCN A;  1DGJ A;  3SU8 X;  1TKG A;  3MC8 A;  3VUW A;  1F52 A;  3VXW A;  3H7P B;  2G9H D;  1JW9 D;  3B2F A;  4IM0 A;  3AH7 A;  3QC8 B;  2IND C;  1E8Y A;  1XLP A;  2ONQ A;  4MM3 A;  5D94 A;  3V6E B;  1YMH E;  4WWO A;  3AN1 A;  2GBR A;  1F9J A;  2C60 A;  1L2N A;  3W1S C;  1JWA D;  1N5X A;  4WQM A;  1AYF A;  5G5H A;  2LVQ A;  2IO2 B;  1FFV A;  2HJ8 A;  2IGD A;  2OJR A;  1PDX A;  1WR6 E;  4WJQ A;  2N7E A;  2WXJ A;  3L10 B;  5CHV C;  1HZ5 A;  2WNM A;  4BOZ B;  3QX1 A;  1HTQ A;  3QCA A;  2BKR B;  2KWV B;  2WX1 A;  3QJZ A;  3DHI C;  1MG4 A;  4YTP B;  2Y5B B;  1HXY D;  1JWU D;  1TJE A;  2N7D A;  2IGG A;  1D4B A;  4R3D A;  1QLB B;  2QDF A;  1CMX B;  1KJT A;  3ZQ4 A;  2ZW1 A;  3N20 C;  3R66 C;  3WIM A;  4FA6 A;  3Q3F A;  4N9F 4;  1R7S A;  3IT4 B;  2IO0 B;  4ANU A;  2K8C A;  3ZJT A;  2BB6 A;  1KLV A;  3X0W A;  1ENF A;  2QJL A;  2KJR A;  3MP9 A;  1KF6 B;  4EE2 A;  3QA8 A;  2WWZ A;  4RM8 A;  2KX0 A;  2D11 A;  2FCN A;  4GXB A;  3JW0 X;  1WGR A;  5G2N A;  1L0X B;  2KDE B;  2QCZ A;  3VUX A;  1SEB D;  4W9H A;  1LM8 B;  2EKE C;  3SDL C;  4YSZ B;  4K7U A;  3SHQ A;  2NBU A;  2OOB B;  2KQ4 X;  1PGB A;  4M0W B;  4AJW A;  1TGZ B;  4LNF A;  4LDT D;  3U7D A;  3HIZ A;  3MC9 A;  2CHX A;  1P7F A;  1J0G A;  5JHB A;  3ZNI D;  3DBR I;  2BW2 A;  1R4M I;  2CU3 A;  2MH7 A;  3PZ7 A;  5FR3 A;  4HRO A;  3A33 B;  4G0N B;  1FFU A;  3L16 A;  3R7R A;  2BYV E;  2LGS A;  4FAD A;  2V9H A;  5DPT A;  2JSV X;  1P3Q U;  3B08 A;  2KO3 A;  2QEJ C;  1I7H A;  4NNJ B;  1S3S G;  2YVC A;  4M01 A;  1ZPS A;  3PRZ A;  4US9 A;  4JGH B;  1E9M A;  2L7R A;  4W9G A;  3AXC A;  4LDT B;  2ZJD A;  4RCO A;  2O2V B;  3NHE B;  1WFY A;  3PHX B;  4BBN C;  1TIF A;  1QZE A;  1Q10 A;  5EE1 A;  3FIL B;  4XE0 A;  5IN7 A;  2WXH A;  2L52 A;  2ZNV C;  3HM3 A;  1SXT A;  5AZG A;  4JL9 A;  1FMA D;  1EWC A;  3PRM B;  3S2A A;  3UIO B;  1GJZ A;  2J53 A;  5C2T B;  1WJ4 A;  1V5T A;  3MJW A;  1T0S C;  4HLE A;  1GC7 A;  1KLG D;  2KMM A;  3L4P A;  2WXO A;  2LGX A;  4NAM A;  4WWP A;  2JZ3 B;  4DBG A;  2LGI A;  1XT9 B;  2O6V D;  4S0R A;  1ZUD 2;  1QOG A;  1ZW7 A;  4KDL B;  4YSX B;  1KM7 A;  1ROE A;  3DBL B;  2WXF A;  3NY5 A;  4XZ4 A;  5E6J A;  1FCL A;  2WDT B;  5E6O A;  4BKS A;  1XLN A;  4RGO S;  3RUL A;  4YL8 A;  1D5X C;  1P1A A;  4C7Z A;  3E9S A;  4IWO A;  4B9K A;  1D5M C;  2LWP A;  5IKC M;  2ZVN A;  3A4S C;  1ZDX A;  5TSS A;  3APD A;  3JSV B;  4J6I A;  1U4A A;  1L7Y A;  2CR5 A;  1E8Z A;  1NI3 A;  4EOY A;  1WXA A;  2M19 A;  3VAW A;  4OHJ A;  4XDC A;  3U4E G;  3Q3O C;  4LK0 M;  2O6V B;  1UUP A;  3BYT B;  2Y5P A;  1EM7 A;  3PLV A;  2CJN A;  4XX5 A;  3QAQ A;  1E8X A;  4F1S A;  2KWU B;  4PS7 A;  2PVO D;  3P42 A;  1J8C A;  5HG2 A;  5L83 A;  2HTM E;  3EFU A;  1YN5 A;  2DZK A;  1WX9 A;  2PIA A;  4OZB A;  4HDO A;  3DBL I;  4US8 A;  1RAX A;  3QWZ B;  3L13 A;  1MHH E;  3E56 A;  3Q8B A;  4MAC A;  3NZU A;  4AJY B;  2J42 A;  4WJP A;  3ZRC A;  1T5X D;  3VTW A;  1L6U A;  4WAA A;  2M4N A;  2L00 B;  3KYD D;  2INN E;  3TL5 A;  5TR5 A;  5D7G A;  2FBW B;  3KUD B;  5AZH A;  1Q1O A;  4NY0 A;  4DHZ E;  3T8M A;  1SE3 A;  1YJ1 A;  5DCN A;  1J7C A;  3GE8 C;  2M1M A;  5IO9 A;  3ZNZ B;  2N9L A;  1IBX A;  2KTR B;  4OZA A;  3BIN A; 
#chains in the Genus database with same CATH homology
 1TTN A;  1WE7 A;  3K9P B;  1WXV A;  4BVU C;  3H1U A;  1WGH A;  2KVR A;  4KZ0 A;  5AEK B;  2M8S A;  1IP9 A;  3RYT A;  1LXD A;  1V2Y A;  3H7S A;  3KYC D;  2MQJ A;  3WA0 A;  2JY6 A;  3PVL A;  2BWE S;  1WJ6 A;  4GU2 A;  4HK2 A;  2UYZ B;  3H6N A;  2D10 A;  3UGB B;  2G4D B;  4GDL B;  4PS8 A;  4EEW A;  3ZDM C;  2EMS A;  3VH4 B;  4K7W A;  1WI0 A;  5LLI A;  1G6J A;  1OQY A;  1OEY J;  1P9D U;  1UZX B;  2JVC A;  2KN5 A;  2LI5 A;  5C1Z A;  4DHJ D;  5CX3 A;  3WAO A;  2GBN A;  2N9P C;  3PRE A;  2HE7 A;  3HK0 A;  3DBS A;  1RRB A;  1VD2 A;  2KMA A;  3AI5 A;  3K9O B;  1GC6 A;  4FN2 A;  1WYW B;  2LVO A;  2MBE A;  3L0W B;  3EHV A;  2JUO A;  3ZDT A;  4W9C A;  4FJZ A;  3IG3 A;  3WAL A;  1Z5S B;  4W9I A;  3VHT C;  1UBI A;  3X23 A;  1GNU A;  4NAW B;  3V61 A;  3RZF A;  2KMC A;  4ANX A;  3HHM A;  2AWT A;  4A3P A;  1OTR B;  3H9D A;  2IO3 B;  2DYM A;  3R7Q A;  2MBB B;  2MX2 A;  3B1L X;  3PS6 A;  1TBE A;  3AU4 A;  3D32 A;  3PGE A;  3WAM A;  2JPH A;  3ZO5 B;  1WMH B;  2RSU A;  3A9K B;  3LJ3 A;  2LJ5 A;  3ZW3 A;  1WXM A;  4IWP A;  3V62 A;  3ENE A;  5IAA C;  2KD0 A;  3M3J A;  3QIJ A;  2JRH A;  2MW5 A;  1IYF A;  1WGG A;  2IY0 B;  2L76 A;  3UF8 A;  2GBJ A;  4P7I A;  2CHW A;  4AUQ C;  2LXA A;  3ZTC A;  2KX3 A;  4W9L A;  1WR1 A;  2LUE A;  3ONS A;  1A5R A;  3V60 A;  4DHJ B;  3APC A;  2AEH A;  2ZCC A;  3WAN A;  2RGF A;  2BYF A;  1TZ1 A;  3R3M A;  3W1Y A;  2LD9 A;  4HWI B;  2LRW A;  3I3T B;  4JIO U;  2DAJ A;  1Q5W B;  2KNB A;  2K8H A;  1SGH A;  3HM6 X;  3TCA A;  4B95 A;  3CF6 E;  3ZNG C;  5CHF A;  1YIW A;  3U8Z A;  1KOT A;  2W9N A;  4ZRJ A;  2CHZ A;  4GDL A;  1C1Y B;  2CU1 A;  4KIK B;  1P98 A;  4ZDV A;  3RT3 B;  3UIP B;  2DZJ A;  2REX A;  3VTU A;  3TJP A;  4HXD A;  1WIA A;  3PT2 B;  2A5U A;  3IVF A;  2KDI A;  2HTH A;  2XBB C;  4MGZ E;  1FXT B;  1E90 A;  4HVB A;  4FHJ A;  2XEW A;  1MG8 A;  1WRD B;  2NCN A;  4MGY E;  4W9D A;  2K1F A;  3ZUN A;  3SU8 X;  5L95 C;  2PJH A;  5J17 A;  3QHT A;  2BF8 B;  2KHW B;  2KC1 A;  4DWF A;  3VUW A;  2GBK A;  2DHZ A;  3VXW A;  3H7P B;  4DDG D;  4K81 A;  3A4R A;  2KLG A;  4KV2 A;  3PPA A;  5JZE B;  2DEN B;  4NAW A;  4RM9 A;  4EKU A;  4IM0 A;  1ZGU B;  1E8W A;  5LXI B;  3QC8 B;  2GOW A;  3ZKJ C;  3A1Q B;  1E8Y A;  1OEY A;  1WGY A;  4MM3 A;  3ZRF A;  5D94 A;  1WMH A;  3KUC B;  1LFD A;  3A9K A;  4ZYN A;  3V6E B;  1V81 A;  4LJP B;  3N3K B;  4GSW A;  4WWO A;  3DVG X;  2K25 A;  4ICV A;  4NJ6 A;  2GBR A;  1GUA B;  4FLH A;  2K6D B;  1F9J A;  2FCQ A;  3KH0 A;  1V86 A;  2C60 A;  1V6E A;  1L2N A;  3W1S C;  4W9E A;  2AYO B;  4F7Z A;  4KZC A;  4IM3 A;  1NBF C;  3QK0 A;  1EF1 A;  2FUH B;  3OLM D;  3PTF C;  1EUV B;  2LVQ A;  2MWS B;  2G3Q B;  2IO2 B;  2HJ8 A;  3ML9 A;  3DVN V;  3DQV A;  4NPN A;  4KSK C;  2OJR A;  4WJQ A;  1WR6 E;  2C5L C;  4BBN F;  4MEL A;  2N7E A;  4URK A;  4JQW C;  5D2M B;  4GGQ A;  4XC2 A;  1WZ3 A;  3L10 B;  2FNJ B;  2JXX A;  5CHV C;  2K39 A;  2KWC A;  2KDB A;  4KIK A;  4BOZ B;  3QX1 A;  2MBH A;  2GBM A;  2BKR B;  3QCA A;  5DPR A;  2V1Y A;  4X57 B;  2KWV B;  2WX1 A;  2BYE A;  3QJZ A;  3L54 A;  2MRP A;  1Y8R C;  4GB9 A;  1H8C A;  4MGI E;  2Y5B B;  2KQ7 A;  2KJH B;  4GOC A;  2AL6 A;  4EZK A;  2JZZ A;  1NDD A;  2D2Q A;  3L08 A;  1WY8 A;  2UWQ A;  2V4L A;  2N7D A;  4TUU A;  4F8C B;  5LXH A;  2RPQ A;  3OJ3 A;  2I1J A;  3OJ4 B;  5E6N A;  3H7P A;  4WQO B;  2CKH B;  3ZTD A;  2RR9 A;  2IO1 B;  1CMX B;  1KJT A;  2PPH A;  3DVG Y;  2HD5 B;  2KTF A;  3R66 C;  4MSM B;  3A1Q A;  4RMA A;  3WIM A;  4FA6 A;  3EEC A;  3Q3F A;  1WXS A;  1WX8 A;  4N9F 4;  2BKF A;  4FJY A;  4B6W A;  2IO0 B;  4BKG A;  4BKT A;  2IZV B;  1GG3 A;  2ZPY A;  1UD7 A;  4ANU A;  3L17 A;  2K8C A;  4LJO B;  3C0R B;  1X1M A;  2K6Q A;  3AU5 A;  4IWQ A;  5CHW A;  4E74 A;  4MJS B;  1KLV A;  2C7M B;  2PE9 A;  1R4N I;  4M8N A;  3X0W A;  3VTV A;  3RZW C;  1UEL A;  4KVG B;  3PLU A;  1RLF A;  1LQB A;  2KJR A;  2M0X A;  1E7V A;  1PQS A;  2LZ6 A;  2WWZ A;  3QA8 A;  4RM8 A;  3TIX A;  3CSF A;  2NS5 A;  4PYU A;  2MA9 B;  4TV3 A;  2DZI A;  2KX0 A;  5JHA A;  3QQ8 B;  2D11 A;  2FCN A;  4GXB A;  3JW0 X;  1WGR A;  5G2N A;  2KDE B;  3M63 B;  3VUX A;  2C7H A;  1HE8 A;  1ISN A;  2N9X A;  4EFO A;  1V49 A;  3AUL A;  3GZN I;  1LM8 B;  4W9H A;  2EKE C;  4FBJ B;  5AZF A;  3ML8 A;  3SDL C;  1EF5 A;  2NBW B;  1P0R A;  4FJV B;  4K7U A;  3SHQ A;  2M17 A;  2NBU A;  2YLM A;  2ZVO A;  2OOB B;  3KW5 B;  4AJW A;  3EC8 A;  4M0W B;  3IBE A;  4FHK A;  5GMV A;  3DVN U;  4E71 A;  1TGZ B;  4LCD E;  5C23 A;  2Z59 B;  3PHW B;  4I6P A;  1WM2 A;  3HIZ A;  4LDT D;  3U7D A;  4EZJ A;  2CHX A;  3TMP B;  2VRR B;  1J0G A;  5JHB A;  4TKN A;  3ZNI D;  1YX5 B;  2FIF A;  3DBR I;  2MBO A;  2JRI B;  1YQB A;  1R4M I;  5BO4 B;  1WJU A;  4DXA B;  2BPS A;  1Q0W B;  2DYB A;  2IY1 B;  2XK5 B;  1K8R B;  3MTN B;  1WGD A;  3A33 B;  4WJO A;  1NI2 A;  4II2 B;  2KLC A;  2Z0E B;  2ZEQ A;  2WYQ A;  4G0N B;  5DPW A;  3B0A A;  2KQS A;  2FCM A;  4HDQ A;  3L16 A;  2K8B A;  2J0K A;  3R7R A;  1V9J A;  4HJK A;  2N1W A;  2BYV E;  2KK8 A;  4FAD A;  4W9F A;  5DPT A;  1V80 A;  1P3Q U;  5J2R A;  3B08 A;  2KO3 A;  1VCB A;  3DDC B;  3NS8 A;  4OVV A;  1XQQ A;  2DYO A;  2ZZP B;  4MJS A;  1S3S G;  4NNJ B;  3DPD A;  2CS4 A;  2YVC A;  4DHZ B;  3PRZ A;  1SE9 A;  4JGH B;  1C3T A;  3ZLZ A;  2AL3 A;  2L7R A;  2RD0 A;  4HPL B;  4W9G A;  3AXC A;  4LDT B;  3VFK A;  3VVW B;  1J19 A;  1UH6 A;  4WWN A;  2ZJD A;  4AOF A;  2D3G A;  4NQL B;  2O2V B;  3NHE B;  2KOX A;  4NQK E;  4GDK B;  1WFY A;  3PHX B;  4BBN C;  3IFW B;  2C7N B;  1M94 A;  1WX7 A;  2KJ6 A;  2IYD B;  4AWJ A;  4G3X B;  4WJN A;  1QZE A;  4IG7 B;  2L3Z A;  4W9J A;  2MSE D;  4G50 A;  3ALB A;  2LRU A;  4EUT A;  3VH3 B;  4ZRI A;  2ZNV C;  4ANV A;  3P2B A;  3NOB A;  3HM3 A;  3ZVV A;  2L0F A;  4I6L B;  2O6V A;  2KFJ A;  3A9J B;  4JL9 A;  5AZG A;  3PRM B;  3JYU A;  2PEA A;  1E5W A;  2KFK B;  3PZD A;  4KDI C;  3S2A A;  2BGF A;  3UIO B;  3PSE B;  1GJZ A;  5CTR C;  2G4S A;  1WJN A;  1WJ4 A;  1V5T A;  4TQ0 A;  3MJW A;  4A20 A;  4HLE A;  5D6J B;  1GC7 A;  2G45 B;  4BOS C;  3UQA A;  1JRU A;  1WH3 A;  4PS3 A;  2MP2 A;  2R2O A;  4K1R B;  4CHK A;  2XK5 A;  2Z0D B;  2LGY A;  2FAZ A;  4I6N B;  1S1Q B;  2LGX A;  4ICU A;  2I1K A;  4WWP A;  5JH5 C;  4OVU A;  2BWF A;  3U30 A;  4FUL A;  1Z2M A;  2JZ3 B;  3DCG A;  4DBG A;  4AP4 C;  1XT9 B;  2O6V D;  1I42 A;  1ZW7 A;  4KDL B;  1KM7 A;  3SD5 A;  2NR2 A;  4W9K A;  3V6C B;  3ECI A;  2LXC A;  3UIN B;  2JF5 A;  3W1S A;  3NY5 A;  4XZ4 A;  2J7Q B;  1YD8 U;  3CST A;  1UBQ A;  2WDT B;  3KUZ A;  3VQI A;  3ZNH B;  4E3C A;  1WF9 A;  5E6O A;  4BKS A;  2JWZ A;  3OAW A;  2FCS A;  2LVP A;  3T9L A;  3RUL A;  4II3 B;  4YL8 A;  1OGW A;  2DZM A;  1P1A A;  4G11 A;  4IWO A;  3RD2 A;  4B9K A;  2LWP A;  2O2V A;  2MCN B;  4GDK A;  3Q3J A;  2ZVN A;  3A4S C;  4DK5 A;  1EO6 A;  2MBQ A;  3PRP B;  3MHS D;  3APD A;  3JSV B;  4MDK E;  4J6I A;  4MH0 E;  3RUI B;  3UQB A;  2KXJ A;  1U4A A;  2NPT B;  1L7Y A;  4MSQ B;  3O65 B;  5HKH A;  4TQ1 A;  2CR5 A;  1E8Z A;  5G55 A;  3CMM B;  2J0M A;  2KDF B;  2NBV B;  3BY4 B;  4EOY A;  1E7U A;  2L8J A;  1WXA A;  1UGM A;  1WM3 A;  2A4Z A;  2KTR A;  2LGD A;  3VAW A;  4EZL A;  2KZR A;  2LAS A;  2ZCB A;  3A9J A;  4K7S A;  2DX5 B;  3VDZ A;  3DBH I;  3KVF B;  4BKS D;  2KFK A;  1I35 A;  2O6V B;  2KAN A;  1YX6 B;  2ASQ A;  1RFA A;  3PV1 A;  3NZS A;  3IHP C;  3PLV A;  4XX5 A;  3QAQ A;  3JVZ X;  1E8X A;  1H4R A;  4ASW C;  2L0T A;  4F1S A;  2KWU B;  4CYE A;  5IA7 A;  1WZ0 A;  4PS7 A;  1IPG A;  1J8C A;  2MP2 B;  2WX0 A;  5L83 A;  3EFU A;  1AAR A;  3N32 A;  4IUM B;  2DZK A;  4GMV A;  1WX9 A;  2ZNV B;  4HPM B;  2N4F A;  3APF A;  1BT0 A;  2ZPN A;  3DBL I;  2R2Q A;  3N30 A;  4HCN B;  2J0J A;  3M62 B;  4HDO A;  4MEM A;  5EDS A;  2IBI B;  3ZIM A;  2D07 B;  4HCP B;  4ZRK A;  1RAX A;  5KHO A;  5KHQ A;  2KC2 A;  3QWZ B;  3L13 A;  4GN1 A;  4IM2 A;  2V3S A;  3NZU A;  3RCZ A;  2QHO A;  4AJY B;  4KSL C;  4DDI D;  2L05 A;  4WJP A;  3ZRC A;  4M8M A;  1ZKH A;  3VTW A;  3GOE A;  4PYZ A;  5DPS A;  1V5O A;  5FR6 A;  2N9E B;  2M4N A;  4WAA A;  2KKC A;  2L00 B;  3KYD D;  2MLB A;  4BFR A;  1XD3 B;  4CO7 A;  4JLC A;  4IW0 A;  4IC7 B;  3TL5 A;  5TR5 A;  5D7G A;  2DAF A;  2JT4 B;  4GIV A;  3JSV A;  2NVU I;  3KUD B;  5AZH A;  1D3Z A;  1Q1O A;  2B3A A;  3LDZ E;  3QAR A;  2NPT A;  4NJ7 A;  4NY0 A;  4DHZ E;  3T8M A;  2GMI C;  5J18 A;  1T0Y A;  1YJ1 A;  2EMT A;  3M95 A;  3DOW A;  5DCN A;  3VUY A;  3WAP A;  2N1V A;  4A3O A;  3TBL D;  2M1M A;  2FID A;  1WE6 A;  4MGK E;  2PE6 B;  3ZNZ B;  2C9W B;  5E6P A;  1SIF A;  4ANW A;  2KTR B;  3BIN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...