5JZEB

Erve virus viral otu domain protease in complex with mouse isg15
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
76
structure length
76
Chain Sequence
PLSILVRNERGHSNIYEVFLTQTVDTLKKKVSQREQVHEDQFWLSFEGRPMEDKELLGEYGLKPQCTVIKHLRLRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ubiquitin-like protein ISG15
publication title Biochemical and Structural Insights into the Preference of Nairoviral DeISGylases for Interferon-Stimulated Gene Product 15 Originating from Certain Species.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 21
structure length 76
sequence length 76
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5jzeB00
2KC2A 2MLBA 5CHFA 1J8CA 2XK5B 3U8ZA 4A3OA 3RZWC 4BOZB 2WX1A 3PREA 3R7RA 1UBIA 3C0RB 3PV1A 3ZIMA 1WZ0A 3QX1A 2DYOA 5DPSA 2BF8B 2KTFA 1TBEA 3MHSD 2NBVB 2JT4B 1A5RA 3VH3B 4BBNF 2CHZA 3KUZA 4IWPA 2K8BA 4M8MA 2CHXA 3ENEA 2KVRA 2C9WB 1SGHA 4IWOA 2KANA 1GNUA 2D07B 1UZXB 2BYFA 1IPGA 3N3KB 2XK5A 3H7SA 1YIWA 3PTFC 4HXDA 4IG7B 4P7IA 4ZRJA 3NZUA 5C1ZA 2LI5A 1KOTA 3QAQA 3W1SC 2DZIA 2MBEA 3HM3A 3HHMA 3NHEB 3RULA 1KJTA 2DZJA 2DAFA 3W1SA 3UQAA 3B0AA 4DK5A 4WJQA 1KLVA 2HD5B 1ZW7A 5CTRC 2KMAA 4ZDVA 3QHTA 5GMVA 2Z0DB 3KH0A 3V62A 1EUVB 2HE7A 1JRUA 4HPLB 1R4NI 4ANWA 2FNJB 3DVGX 1XT9B 2KJ6A 1YQBA 2KXJA 4B95A 2EMTA 2N1WA 4PYZA 3RZFA 4CO7A 1WXVA 3A9KA 3QK0A 4PS8A 2RD0A 2RSUA 3SU8X 1OEYJ 3IFWB 3B08A 2NBWB 1WXAA 2LGDA 5E6NA 1WGHA 1Q1OA 3QCAA 5IAAC 4KDLB 2N1VA 2ZEQA 2ZZPB 3H6NA 2BYEA 5FR6A 4BKTA 5J18A 3QIJA 3IVFA 3DVNU 2M1MA 2N9EB 4AWJA 1WY8A 5AZHA 1ZGUB 3U7DA 1I42A 1Q5WB 2J0MA 2RPQA 5CX3A 4W9EA 3R7QA 3ALBA 4M8NA 3T9LA 2ZPYA 4PYUA 4GDLB 4NQKE 1E8WA 1E7UA 2BPSA 4A20A 5EDSA 4FHKA 5AEKB 1WXMA 2D3GA 3VUYA 4LDTD 5LXHA 2JPHA 2KDEB 3DBRI 4MSMB 4LJPB 4EZLA 4XC2A 4LCDE 3TMPB 4KZCA 3APDA 2MBOA 3R3MA 4B6WA 1C3TA 2L3ZA 2O2VA 3WALA 1WMHA 2O6VA 2CS4A 3VAWA 5JH5C 1WE6A 1WX8A 4GDLA 2K1FA 3QARA 2N9XA 4DHJD 3M95A 2DYMA 2G4SA 3GZNI 3KW5B 4ZRKA 3TCAA 1G6JA 2J0JA 2PEAA 5LLIA 4KIKB 3VVWB 1ISNA 1V5TA 4KV2A 4RM9A 3RUIB 4TKNA 3BINA 3VXWA 2JWZA 3U30A 3VUXA 4E74A 2NPTA 1NDDA 2FIFA 3A9JB 2IY0B 4E71A 3V60A 4W9KA 1T0YA 3ZDMC 2KFKA 2JRIB 2JZZA 3N30A 3DDCB 4JQWC 3UIOB 2KX0A 1CMXB 4KIKA 4GGQA 2DHZA 1GC6A 2KK8A 4FADA 2KKCA 2KMCA 1WGGA 3PT2B 1U4AA 2LRWA 3L0WB 1L2NA 3APCA 2EMSA 4B9KA 2IZVB 2N7DA 3BY4B 3EC8A 3VDZA 2LWPA 4G0NB 5D7GA 2D2QA 1LFDA 1HE8A 2JF5A 3PHWB 3K9PB 2WDTB 4K7SA 2K39A 3ZNID 4DWFA 2CR5A 2WYQA 4GMVA 2N9PC 2KLGA 3DBSA 4GDKB 4DHJB 3DCGA 2KFJA 2CKHB 2LRUA 2NBUA 4DBGA 2MW5A 1V49A 4W9GA 3ZTDA 1XD3B 5JZEB 3B1LX 4BVUC 4MGIE 5IA7A 2R2QA 4NPNA 4K1RB 4GDKA 4EZKA 2V3SA 3WAOA 3ZO5B 4KSKC 4N9F4 1WE7A 2KQ7A 4W9CA 2I1JA 3KYCD 3PS6A 2IBIB 3NOBA 3RD2A 2LVQA 2A5UA 4AP4C 3VTUA 4FULA 2J0KA 5E6PA 3V6CB 2IO3B 1LM8B 2C60A 2DX5B 3D32A 3PPAA 4IC7B 4HVBA 3TBLD 1S3SG 2N7EA 4FHJA 4XZ4A 1WIAA 2RR9A 2FCSA 3L17A 2O6VD 2PPHA 3R66C 1F9JA 1E90A 3A9KB 4PS7A 1E5WA 3QWZB 4TV3A 4BKGA 2ZVNA 4EKUA 4F1SA 5L83A 2A4ZA 2L00B 2MBQA 2R2OA 2N4FA 4MGKE 3L08A 4MSQB 4WAAA 4HWIB 2NCNA 4MGZE 4TQ1A 5DPRA 5DPWA 1GG3A 3UGBB 1TTNA 1RFAA 1KM7A 4K81A 2MCNB 1IP9A 4BOSC 2GBKA 2BYVE 2GBMA 3W1YA 3EECA 3P2BA 3DVGY 4ASWC 2RGFA 4JGHB 1E8YA 2AL3A 3DOWA 4NJ6A 2BGFA 3IG3A 1GC7A 3ZNZB 2FAZA 2G3QB 4DDGD 2IO1B 1V81A 2KN5A 3OLMD 4TQ0A 4IM0A 1WGRA 2JXXA 4OVVA 2L8JA 2O2VB 1WMHB 2O6VB 2NR2A 4J6IA 2Z0EB 2M4NA 4X57B 4WWNA 4MDKE 3VTWA 3KVFB 1WX9A 4NNJB 4EEWA 2LXCA 3DBLI 1P98A 1WYWB 3ECIA 4MELA 1WRDB 2KJRA 1OQYA 2KNBA 3KUDB 1P9DU 3ML9A 3VQIA 3CMMB 4XX5A 4MEMA 1D3ZA 2NPTB 3K9OB 1YJ1A 4FJYA 2DZKA 1WJNA 2FCMA 2KWUB 2D11A 2KFKB 1SIFA 2KWCA 2YLMA 2ZNVB 4RMAA 3RT3B 1LXDA 4AJWA 4K7WA 2XEWA 3M62B 2V4LA 3CSFA 4II2B 4NAWA 4A3PA 3AU4A 2HJ8A 3PZDA 2L0FA 1WF9A 3OJ3A 1WH3A 1WI0A 1NBFC 3PHXB 3VFKA 4W9FA 1Z2MA 2ZNVC 3DVNV 3Q3JA 3Q3FA 4G11A 4NJ7A 1P1AA 3KUCB 4W9HA 2LVOA 3VTVA 1QZEA 2DAJA 2BWFA 2MWSB 3M3JA 4I6PA 4AUQC 4F7ZA 4GN1A 2KTRB 2JVCA 5CHVC 4II3B 4BKSD 3V6EB 3JSVA 2AEHA 1V80A 2IY1B 2ASQA 2V1YA 4KZ0A 2KDBA 1V5OA 2BWES 3VUWA 4HDOA 2LGXA 4W9DA 3X23A 1H8CA 1GUAB 1V2YA 4DDID 2KTRA 2LJ5A 3DBHI 3ZNGC 5J2RA 1OEYA 1RAXA 2ZJDA 2MBHA 3PLUA 3APFA 3UQBA 1YX6B 4G3XB 2KD0A 3CF6E 4AJYB 4JLCA 2KWVB 1WM2A 5JHAA 3JW0X 3ZRCA 4EUTA 1ZKHA 4ICUA 4F8CB 1Q0WB 2ZVOA 4HJKA 5G55A 3LDZE 2D10A 2MX2A 4HCPB 3TJPA 3DPDA 4IWQA 3N32A 3NY5A 2C7MB 4NQLB 3PRMB 3ZVVA 4FBJB 3SD5A 3PVLA 4WWPA 3AI5A 4W9LA 2G45B 1EF1A 4FN2A 4GB9A 4GXBA 1NI2A 1AARA 4RM8A 3PSEB 4EZJA 4GOCA 5J17A 1TZ1A 2CHWA 2KDIA 4JIOU 5C23A 3O65B 1OTRB 4GU2A 3H7PA 1XQQA 1L7YA 2FIDA 3RYTA 3ZNHB 4BKSA 5AZFA 3WAMA 2GMIC 2M8SA 2L05A 4KVGB 2KLCA 2LASA 3NZSA 3TL5A 3VH4B 3X0WA 3ZW3A 3AULA 3AXCA 2IYDB 2B3AA 3HK0A 1WGYA 5D2MB 1RRBA 2PJHA 5KHOA 3SDLC 4FA6A 4MM3A 4ANVA 3A4RA 1EO6A 2ZCBA 4IM2A 4E3CA 3A33B 2C5LC 1M94A 4WQOB 2KX3A 1WR1A 3UIPB 4FJZA 3ZLZA 4NY0A 3H1UA 1Y8RC 4ICVA 2IO2B 1E8ZA 1WJ4A 1RLFA 2FUHB 1P3QU 1EF5A 4GIVA 3TIXA 3WA0A 4ANUA 3HM6X 1X1MA 1S1QB 2LGYA 1YX5B 3A1QB 1V9JA 4URKA 2L7RA 2KHWB 5BO4B 2NS5A 3CSTA 1WJUA 2MA9B 3QC8B 2ZCCA 3A4SC 3I3TB 1GJZA 5JHBA 4DHZE 3AU5A 1R4MI 3PGEA 3M63B 2GBJA 3EFUA 1E8XA 4LJOB 2JUOA 4IM3A 4ANXA 3UF8A 2Y5BB 1UBQA 1WR6E 3OAWA 5AZGA 3V61A 4EOYA 3A1QA 4NAWB 2YVCA 2KZRA 4ZYNA 3L10B 1WFYA 2C7NB 2KQSA 2LVPA 3ML8A 2G4DB 4DXAB 2HTHA 4M0WB 4W9IA 5D6JB 4HLEA 4IW0A 4DHZB 5E6OA 4KDIC 3T8MA 4W9JA 4OVUA 4MH0E 5D94A 4EFOA 2REXA 3UINB 2JRHA 3JSVB 2LUEA 5L95C 1C1YB 1WGDA 2I1KA 2NVUI 1P0RA 3ONSA 4PS3A 2BKFA 1J19A 2KDFB 1WXSA 3L54A 4JL9A 3KYDD 4FJVB 2GBNA 4WJOA 5HKHA 4ZRIA 4GSWA 1WX7A 2UWQA 2MRPA 3LJ3A 2K25A 3OJ4B 2OOBB 4HK2A 3JYUA 1H4RA 2AWTA 2KC1A 2MQJA 4G50A 4TUUA 4I6LB 3JVZX 1Z5SB 2M0XA 3L13A 3GOEA 3QQ8B 5LXIB 4CYEA 2OJRA 1V86A 4WJPA 4MJSB 2L0TA 1E7VA 2MP2B 2ZPNA 2LD9A 2W9NA 4FLHA 3S2AA 1YD8U 1WZ3A 2AYOB 2J7QB 3QA8A 2JY6A 3DQVA 1UELA 4IUMB 2Z59B 5DPTA 3MTNB 4CHKA 5DCNA 3EHVA 2DZMA 2K6DB 2K6QA 1TGZB 1UD7A 1MG8A 2C7HA 2QHOA 2PE9A 2VRRB 3HIZA 4KSLC 5G2NA 3WIMA 3ZDTA 2K8HA 3IHPC 2JZ3B 4BFRA 3WANA 4BBNC 4MJSA 3ZTCA 3L16A 1FXTB 2BKRB 2MP2A 1WM3A 5CHWA 3PLVA 4I6NB 1J0GA 1SE9A 2LXAA 1IYFA 2K8CA 2DYBA 4HPMB 4AOFA 4WWOA 4K7UA 1LQBA 1VCBA 2GBRA 2LZ6A 4HCNB 1OGWA 2GOWA 3SHQA 4HDQA 2FCQA 3QJZA 2AL6A 3MJWA 3IBEA 1WJ6A 4WJNA 5TR5A 3RCZA 2KO3A 3A9JA 2DENB 3NS8A 3ZKJC 2XBBC 1UGMA 2L76A 4LDTB 1I35A 4YL8A 2MSED 3WAPA 2M17A 3H7PB 2KOXA 3ZUNA 4MGYE 3PRZA 1V6EA 1UH6A 3PRPB 3VHTC 1VD2A 1BT0A 2EKEC 2WWZA 1PQSA 2MBBB 5KHQA 2IO0B 2UYZB 1K8RB 2PE6B 2WX0A 2FCNA 3ZRFA 2CU1A 2KJHB 3H9DA
chains in the Genus database with same CATH superfamily
2INPE 4REZA 3U8ZA 3RZWC 3PV1A 1T6BX 1QKZA 5DPSA 2KTFA 1TBEA 1D5XC 3VH3B 4BBNF 2CHZA 2VZKB 2KVRA 3T3NA 1T0QC 1EWYC 3N3KB 4KX6B 2WXGA 5C1ZA 5H8YE 4OZAA 1V1PB 3QAQA 4YSXB 4C7ZA 4OZCA 4HEA1 4DK5A 3DWMA 2X38A 5GMVA 3BWUD 3V62A 3R8BA 2ZW1A 4HPLB 2Y3AA 4TSSA 1ZE3D 1XT9B 2KJ6A 1PFDA 4B95A 2EMTA 3A9KA 2RSUA 3B08A 2MH7A 3Q6BA 1FXAA 3LB8C 3QCAA 5EE1A 2ZZPB 4BKTA 3CWIA 2W3SA 2INNE 4AWJA 5IP4D 1Q5WB 1TKGA 4W9EA 4RGMA 1WSPA 2BPSA 5EDSA 1WXMA 3VUYA 4LDTD 2I38A 1PYWD 1P7FA 4KZCA 4B6WA 1C3TA 2L3ZA 1WMHA 3VAWA 1WE6A 3GE8C 4KKIA 4YTNB 1I4GA 2DYMA 2G4SA 3GZNI 3IAS1 3KW5B 2J0JA 3ZJUA 4KIKB 1MG4A 5C2TB 3VVWB 1SXTA 1V5TA 4KV2A 3RUIB 3W5UB 4TKNA 2JWZA 3VUXA 2NPTA 1NDDA 2JZPA 2BTEA 4W9KA 1HXYD 2JZZA 2AX5A 4JQWC 3UIOB 2L52A 2KX0A 1Q10A 2KK8A 4LNKA 4JWSC 2IZVB 3BY4B 3DHGC 3VDZA 1GB1A 3KLSX 1HE8A 2JXTA 4DWFA 1KFYB 2N9PC 1YOVB 3Q3MC 1VZ8A 2CKHB 2WHIA 4DBGA 3N1YC 2MW5A 3ZTDA 3Q8CA 3B1LX 5IA7A 1HTOA 2W3RA 4GDKA 1XO3A 3WAOA 4KSKC 1WE7A 4W9CA 5BYSA 3R2TA 3AE2B 2IO3B 3AECB 4HVBA 3RNFC 1NYRA 1RM6C 1FRDA 4XZ4A 3EA6A 1SF0A 4HRSA 3L17A 2O6VD 3R66C 1N61A 2PW9A 1TS4A 1FD6A 4BKGA 3AH7A 2L00B 2J53A 2N4FA 4MSQB 4MGZE 4TQ1A 4HKQA 5DPRA 1B9RA 1TTNA 1KM7A 4K81A 1BUIC 2OEDA 3NVYA 2GBMA 1K53A 3W1YA 3P2BA 3AE4B 3FAHA 4JGHB 1E8YA 1WYGA 4NJ6A 1MJDA 1NENB 2GI9A 1GC7A 3PZ8A 2Z8LA 3ZNZB 2FAZA 3AEDB 2G3QB 4ZOHC 4IM0A 4RGOS 4C80A 3R2IA 3HVZA 2O6VB 5G5GA 1IUEA 1E10A 2IGHA 1YN4A 4WWNA 2JYEA 1ZUD2 1UGJA 3KVFB 1WX9A 4NNJB 3GB1A 1P98A 1VR9A 1D3ZA 3K9OB 2ZNVB 2DZKA 2FCMA 3RT3B 2JX5A 1LXDA 1N63A 2V4LA 3CSFA 4ZRPA 5BMIA 2N9LA 3PZDA 2L0FA 2KMMA 1EU4A 3PHXB 1NBFC 3AE6B 3C19A 1ZXHA 1P1AA 2LVOA 4I6PA 2JVCA 5CHVC 3RNCC 3AE7B 3JSVA 3BK2A 1C77A 2KDBA 1V5OA 4YSYB 1K52A 3P4RB 4DDID 3PLUA 2JU6X 2BT6A 2INDC 4JLCA 4ICUA 1IGDA 4ZHPA 5G55A 3LDZE 4K3BA 3N1ZC 1TY2A 4IWQA 3EFCA 3PVLA 2D3AA 1ZPSA 3P4PB 3I5JC 1AW7A 1NI2A 1T5XD 2WGSA 5J17A 3HUIA 1CJEA 3O65B 1RYJA 5IO9A 1NEKB 1XQQA 2PMVA 1STEA 4BKSA 5AZFA 2GMIC 3X0WA 3VH4B 1YJIA 3AULA 1ZXIA 4MM3A 4LTUA 2C5LC 3L4PA 3FILB 2GB1A 4NY0A 3H1UA 3V05A 4ICVA 2J4XA 1WJ4A 4ANUA 2L7RA 2KT7A 1WJUA 3I3TB 3BVMA 3NVWA 1FNVA 3RNEC 1E8XA 2JUOA 4P1CC 1WR6E 5AZGA 4AS1A 2KQSA 4OVZA 3ML8A 1PDXA 5D6JB 2JYTA 5E6OA 4KDIC 1YQ3B 2REXA 3UINB 1UF0A 4HJGE 2LUEA 2I1KA 1VZ7A 2KDFB 1FPYA 4JL9A 3CIRB 4GSWA 3Q8AA 3LJ3A 2R61A 4HK2A 4RF0A 1JWSD 1FCLA 2AWTA 4G50A 1E9MA 3JVZX 1Z5SB 3QQ8B 4DXFA 4WJPA 4J3OD 3V3XA 1ZP0B 2XN9C 1N5WA 3S2AA 1NVID 2J7QB 3QA8A 4CHKA 5DCNA 2QSDA 4ITKA 2K6QA 1TGZB 1HTQA 5FK9C 4M00A 3FKYA 2VH2A 2MEKA 3WANA 2BKRB 5CHWA 2CU3A 1LQBA 1VCBA 5TSSA 2LZ6A 4HCNB 3SHQA 2FCQA 3MJWA 3RCZA 4C7YA 2LMCA 2XBBC 2H88B 2L76A 2MSED 3U7ZA 3PRZA 1UH6A 1VD2A 1BT0A 2MJDA 1PQSA 1QF6A 5KHQA 2XNAC 1XLPA 2IO0B 2KYWA 2UYZB 2WX0A 3NVZA 2KC2A 5CHFA 3H8HA 4LK0M 3PREA 1QT9A 1UBIA 3ZIMA 3QX1A 2NBVB 2JT4B 4RCOA 3ZXVA 2K8BA 2CHXA 3ENEA 4RGTA 1SGHA 4IWOA 4CQNA 1GNUA 2D07B 1UZXB 4N58A 3MC0B 2XK5A 3H7SA 4S17A 1IBXA 3DHHC 2OJWA 2DZIA 3HM3A 3HHMA 1FEHA 3RULA 1KJTA 2DAFA 4FXCA 3UQAA 1ZDXA 1QQRA 2HD5B 3AEBB 5CTRC 2KMAA 4WH4A 1SJHD 3KH0A 2OHFA 2HE7A 4ANWA 4WWMA 4PYZA 3IFWB 1XLNA 2NBWB 2V3NA 5E6NA 1DGJA 2ON8A 3VR9B 5IAAC 1YMHE 3AV8A 2GRIA 2BYEA 2WXPA 1L0YB 5J18A 3DVNU 4XDDA 1ZGUB 3U7DA 5IN7A 1P7EA 2D5GA 3ALBA 3OG5A 4PYUA 2HTME 2AQ2B 3AE1B 4FHKA 2D3GA 5LXHA 2JPHA 4XC2A 4LCDE 3TMPB 2WXFA 2MBOA 1SIJA 2QJLA 3Q8EA 2CS4A 3B9JA 2BQQA 4GDLA 3QARA 3KQ4A 5LLIA 1ZDVA 1ISNA 4P16A 2EELA 3RI7C 2FIFA 4NJCA 1T0YA 1KF6B 2KFKA 2JRIB 5HHDG 1CMXB 4GGQA 4XDCA 1F2RC 4FADA 2KKCA 2CJNA 1WGGA 2LRWA 2KVZA 2EMSA 3APCA 3TUOA 3EC8A 4G0NB 1E0ZA 2QDFA 4ACFA 1IGCA 3PHWB 3K9PB 1L6VA 2PKOA 3ZNID 2CR5A 2RDHA 2D3BA 4GDKB 2IJ0A 2LRUA 4XWTA 5AUIA 3HVDA 4W9GA 1YNTE 4LNIA 2R2QA 5JXVA 1I7HA 4RNAA 3MFGA 2FE8A 2KQ7A 3W9CB 2I1JA 1AN8A 3PS6A 2LVQA 2JQRB 2J42A 1L4ZB 2WXMA 5E6PA 3V6CB 2C60A 2WDQB 3Q14C 4IC7B 2N7EA 4FHJA 5H92C 3N20C 4IKGA 3BVGA 4PS7A 3QWZB 2WXQA 4EKUA 5L83A 2A4ZA 4C00A 1XEEA 4MGKE 3L08A 2BBCA 2NCNA 5DPWA 3SFDB 1GG3A 2MCNB 4OZBA 4BOSC 3DVGY 4LLGM 1SE2A 3AE3B 2BGFA 3IG3A 4YSZB 1C4AA 2JXXA 2L8JA 2O2VB 3ZJTA 4C4VB 2NR2A 4HPPA 4BZAA 2M4NA 2BS3B 2KN4A 1QOAA 4ARCA 1WYWB 3ECIA 2IGDA 4MELA 1OQYA 3ML9A 4XX5A 3GS2A 2KWUB 1WJNA 4X57B 1DOIA 4RMAA 4UDUC 4TMAB 2MHJA 1QILA 1VRAB 4A3PA 2X8XX 2HJ8A 2J52A 3OJ3A 1WI0A 3VFKA 5E6JA 1Z2MA 4A8XC 2IGGA 3M3JA 4F7ZA 4BKSD 1FNUA 4ZYSA 2IY1B 2WU5B 1JW9D 3VUWA 5LNK1 4HDOA 3BYTB 2LGXA 4W9DA 3AM9A 1H8CA 1T0RC 2KTRA 3BK1A 5J2RA 1TKEA 2ZJDA 1N5XA 3UQBA 3APFA 3BZDB 4G3XB 4PK1A 4K3CA 1L4DB 1K51A 3URYA 3JW0X 2ZVOA 3MC8A 1ACCA 3AE9B 1BMLC 2LUMA 2WXNA 3NY5A 4B0EA 4NQLB 1KTKA 4FBJB 3SD5A 4WWPA 3AI5A 2G45B 1SB3C 4ZRQA 3Q3NC 4GB9A 4RM8A 3PSEB 1AYFA 2RMMA 4GOCA 4A90A 4MT5A 4MM3B 1V8CA 5C23A 4GU2A 2FIDA 1ESFA 3W5VB 4KVGB 3NZSA 1J7AA 3HK0A 4YXDB 5KHOA 1D4BA 3A4RA 4E3CA 4GLSC 3RFZB 2KX3A 4D2KA 3ZLZA 1XXGA 1XCTL 4USAA 2IO2B 1E8ZA 3AEGB 1P3QU 3DBRB 4GIVA 1V9JA 4URKA 1V1PA 3ZYYX 3QC8B 2ZCCA 1GJZA 1HZ5A 5JHBA 4DHZE 3PGEA 3LXFA 3U4EG 2L83A 4ANXA 2Y5BB 4JX1C 3OAWA 1VDVA 4NAWB 1KLGD 2KZRA 1QOGA 1WFYA 2C7NB 1JWMD 2LVPA 2WXIA 1OQRA 2G4DB 3IT4B 2HTHA 4IW0A 3AB5A 2G9HD 1MFWA 3T8MA 4OVUA 5D94A 3Q69A 4EFOA 5L95C 2AQ1B 4DQOC 1WGDA 2BKFA 1J19A 3L54A 4M0WA 2GBNA 2WXKA 2MJEA 3OJ4B 3P63A 1WRIA 4TUUA 2M0XA 5LXIB 3GOEA 1C78A 2WXOA 4NAMA 4PT5A 4CYEA 4US9A 1FNWA 1E7VA 2ZPNA 4B0MA 3P42A 4XWWA 5HFYA 1J7BA 1YD8U 1A70A 2JY6A 1UELA 3MTNB 2EKIA 5G2NA 3WIMA 3ZDTA 3AE8B 2K8HA 4JWUC 4BBNC 3ZTCA 4P1BC 3L16A 1WM3A 3PLVA 1SE9A 2LXAA 1IYFA 1KRHA 4XYCA 1GOZA 4WJNA 5TR5A 1E7PB 2L32A 3ZKJC 4YL8A 2M17A 3H7PB 2KOXA 3ZUNA 1V6EA 3T3OA 1MHXA 2L1AA 3NS1A 1EWCA 1K8RB 4IOIE 3ZRFA 3TEZA 2MLBA 4KKJA 2XK5B 1LGRA 2LHDA 2WX1A 2NTSA 3R7RA 1IBXB 2DYOA 3I9V1 2WXHA 2V4IB 2WLBA 1A5RA 4N6EB 4MH8A 3KUZA 2WS3B 4IWPA 1T3QA 5IKCM 2BYFA 1MHHE 4ZRJA 3PTFC 4HXDA 4P7IA 2CJOA 1D5MC 3IXSA 1KOTA 3W1SC 2MBEA 3NHEB 5I4DA 2DZJA 3W1SA 3DBLB 3B0AA 1ZW7A 5FR3A 1JWUD 1SE4A 1SSNA 3MC9A 4ZDVA 2Z0DB 4LNOA 1F77A 1EUVB 1JRUA 1L6UA 3RMKC 2N1WA 3RZFA 4CO7A 1WXVA 3QK0A 1CZPA 2RD0A 4WIPA 3SU8X 1I4QA 1FMAD 1WXAA 2LGDA 2SEBD 2K0PA 3EUB2 5G5HA 4US8A 2N1VA 2BS2B 2ZEQA 3BIID 3H6NA 1ZOYB 3QIJA 3IVFA 1I4RA 2M1MA 5HG2A 2N9EB 5AZHA 2N9KA 1I42A 2RPQA 3V60A 2KACA 4GDLB 4NQKE 1E7UA 4A20A 2RDBC 4MACA 1UNSA 3DBRI 1TZOA 3O13A 4LJPB 4MSMB 3APDA 3WALA 2O6VA 5JH5C 1V97A 5AUKA 1WX8A 4BAXA 2N9XA 4JE3B 2D3CA 2PEAA 4DXGA 3BINA 3U30A 3A9JB 2IY0B 1JROA 1TY0A 1PGXA 4R3DA 2KMCA 1LO5D 3SFEB 3PT2B 1U4AA 3L0WB 4LNFA 2N7DA 1T0SC 2LWPA 1CQVA 2JF5A 5C3JB 2WYQA 1TS2A 4GMVA 3DBSA 1PUTA 2YEPB 3NZ3A 1C4CA 2RPVA 2PIAA 4BVUC 1JRPA 1SE3A 1TS3A 2Y5CA 3TEXA 4EZKA 2V3SA 3ZO5B 3KYCD 3RD2A 2V0GA 3VTUA 3FC4A 2DX5B 3D32A 1ET6A 3Q8FA 2FCSA 2PPHA 3RN9C 1GAQB 3A9KB 2JWUA 1R7SA 3U52E 4F1SA 2MBQA 2LFIA 2LGIA 4HWIB 2V3PA 2ONQA 3UGBB 1PGAA 1RFAA 3Q3OC 2GBKA 3EECA 2W55A 2AL3A 1MVKA 1FM0D 5D3DA 3NJTA 3ETRA 1V81A 1HEZE 1WGRA 3ZJVA 1WMHB 4J6IA 2K3UA 2PTLA 3VTWA 1MPEA 2M0AA 3DBLI 3N1XC 1WRDB 2BS4B 2KJRA 2KNBA 3KUDB 1L0VB 1P9DU 3VQIA 3CMMB 5IOIA 2NPTB 1KH0A 1YJ1A 2Y5PA 5EE0A 4K7WA 5T8IA 2XEWA 2QILA 3M62B 2BB5A 3ABVB 4II2B 4LNNA 1WH3A 4W9FA 2BB6A 1QLBB 3DVNV 5GXGB 3Q3JA 3Q3FA 4NJ7A 3KUCB 4W9HA 2INCC 1QZEA 2BWFA 2MWSB 1YN3A 2KTRB 1XCQL 4II3B 2FBWB 2AEHA 1V80A 2DBYA 2ASQA 2V1YA 2BWES 4L1BA 3B2FA 3X23A 1SEBD 2LJ5A 2QIEB 3ZNGC 3DHIC 1OEYA 1RAXA 2KD0A 3CF6E 1WM2A 1ZKHA 5D3IB 2D10A 2MX2A 3N32A 3TSSA 2C7MB 4ARIA 3ZVVA 1F2RI 1MI0A 1WXQA 4FN2A 2PLPA 1R4NB 2ZW0A 4WAFA 2B76B 2CHWA 2E3TA 1HZ6A 3WAMA 2M56B 2KLCA 2LASA 3MHZA 2V9HA 3AXCA 2LJIA 2B3AA 2W82A 2PJHA 3SDLC 3ZXRA 4ANVA 5EE3A 4IM2A 2ZCBA 1M94A 4YWGG 2BW2A 1JWAD 4WQOB 3UIPB 1Y8RC 3LYYA 2QEJC 2FUHB 1EF5A 3WA0A 3C8YA 3HM6X 1X1MA 1S1QB 3MP9A 1JQ4A 1WWTA 2KHWB 5BO4B 3CSTA 3M63B 4LJOB 3UF8A 2WXRA 1UBQA 3V61A 3A1QA 4JPSA 2YVCA 4DXAB 2AQ3B 4M0WB 4W9IA 4NZLB 4DHZB 1VLBA 4MH0E 2JRHA 4C56C 3JSVB 1C1YB 1D6EC 3ONSA 4PS3A 3KYDD 4FJVB 4WJOA 5HKHA 2PVGC 4ZRIA 2MRPA 2OOBB 3JYUA 2MQJA 1DYQA 1N60A 2OJRA 1V86A 1EM7A 2M19A 4KGSA 2WXJA 2AYOB 3DQVA 4XGAB 2Z59B 4P6VF 3IAM1 5DPTA 3EHVA 2DZMA 5BMHA 2C7HA 1E6EB 3HIZA 4XE0A 4BFRA 1D5ZC 3OWEB 4MJSA 1FXTB 2MP2A 2WQYB 1YN5A 4I6NB 2KWDA 2GLSA 2K8CA 2DYBA 4WWOA 2GOWA 3QJZA 3IBEA 1N62A 1WJ6A 2KO3A 2DENB 3NS8A 3E56A 1UGMA 1AWDA 4LDTB 1I35A 2N7JA 3WAPA 2E6XA 3VHTC 1F1HA 2EKEC 1WGKA 2WWZA 1TYGB 1FFVA 3GP7A 1UWMA 1SJED 2FCNA 2CU1A 4KGTA 2K5PA 1J8CA 1B1ZA 4A3OA 4BOZB 3C0RB 4HKZE 1WZ0A 2BF8B 2NTTA 3MHSD 1TJEA 1XLQA 3P4SB 1TT5B 3I57A 1FIQA 4M8MA 3IT6B 2C9WB 3DWGC 2LHEA 2KANA 5BYQA 3GE3C 1IPGA 4IG7B 4YTPB 1YIWA 3NZUA 2LI5A 2VH1A 1FXIA 1VZ6A 4ZHOA 4YT0B 2TSSA 4WJQA 3NVVA 1KLVA 1J7CA 2WDRB 2UU7A 3QHTA 2G1EA 1R4NI 4A6QA 1FFUA 2FNJB 3DVGX 1YQBA 2KXJA 3UI3A 3Q2AC 4PS8A 1OEYJ 2KQ4X 3HRDD 1WGHA 3VR8B 1Q1OA 2FUG1 2QMTA 4KDLB 5FR6A 1GPXA 1UUPA 1WY8A 1I4HA 5CX3A 2J0MA 3R7QA 4M8NA 3T9LA 2ZPYA 1E8WA 3DBHB 5AEKB 2K9XA 4L2YA 2KDEB 4RGNA 4EZLA 3R3MA 2O2VA 1I4PA 4C4VA 4M01A 2K1FA 4DHJD 3M95A 1G6JA 4IDIA 4ZRKA 3TCAA 5BMGA 4RM9A 1M4VA 3NG0A 3VXWA 2IPKD 4E74A 3VRBB 4E71A 3ZDMC 4N59A 3N30A 3DDCB 5FKAC 4M02A 3RPFC 4KIKA 2DHZA 3WCQA 1GC6A 2W54A 1CK1A 1L2NA 2KDMA 4B9KA 3W2DA 5D7GA 2D2QA 1JCKB 1LFDA 1VJKA 2WDTB 4K7SA 2K39A 2KLGA 4DHJB 4WQMA 2LEKA 3DCGA 2KFJA 2NBUA 1V49A 1XD3B 3AMZA 5JZEB 2NMQA 4MGIE 1C79A 2DLBA 4K1RB 4NPNA 1V1OA 1RWSA 4N9F4 2WP9B 1C9FA 2IBIB 3NOBA 1YQ4B 3NRZA 2A5UA 1ENFA 4AP4C 2QC8A 4FULA 2J0KA 1R4MB 4KGRA 1LM8B 3PPAA 3TBLD 1S3SG 1F52A 1WIAA 2RR9A 1F9JA 1E90A 3AN1A 1E5WA 1FRRA 2WDVB 4TV3A 2ZVNA 1I4XA 2R2OA 2QCZA 2JSVX 4WAAA 1QOBA 3TEWA 1IP9A 2BYVE 2YEPF 4RF1A 3RNGC 4ASWC 1HA5A 2RGFA 3DOWA 4DDGD 2IO1B 2KN5A 3OLMD 4TQ0A 4OVVA 2Z0EB 4QAYA 3PO0A 4MDKE 4EEWA 2LXCA 4H2AA 2DNFA 2ICIA 3AE5B 1ROEA 3RNBC 4MEMA 4FJYA 2YLMA 2D11A 2KFKB 1SIFA 2KWCA 4AJWA 5MPOA 4NAWA 1N6ZA 3AU4A 1WF9A 4L23A 2KAJA 1XLOA 4A55A 3N9YC 2ZNVC 5EE9A 4G11A 3VTVA 2DAJA 3BYYB 4AUQC 4GN1A 3P1MA 4HROA 3V6EB 2ACZB 2SAKA 2HJ1A 4KZ0A 3KWLA 3E9SA 1BXTA 1YJJA 1GUAB 1V2YA 3PZ7A 1GB4A 1RFKA 1UWXA 1K50A 3DBHI 2MBHA 3U2SC 1YX6B 3RNAC 4AJYB 2KWVB 5JHAA 3MJ5A 3ZRCA 1ET9A 1XF5L 4EUTA 1L5PA 4F8CB 1Q0WB 4HJKA 4HCPB 3TJPA 3DPDA 3B2GA 1TIFA 3PRMB 1OFFA 1NI3A 3EGRA 4W9LA 1EF1A 4GXBA 1AARA 1PGBA 5BYRA 3SR6A 4EZJA 1DOYA 1TZ1A 2KDIA 4JIOU 1OTRB 3H7PA 1L7YA 3RYTA 2N0SB 3ZNHB 2M8SA 2L05A 3TL5A 3ZW3A 1EU3A 2DWQA 2IYDB 4EE2A 3P4QB 1WGYA 3VRAB 5D2MB 1RRBA 1KLUD 4FA6A 5HI1A 2LGSA 1EO6A 3A33B 4OHJA 4OW0A 3J9CA 1WR1A 2H89B 4FJZA 1Y56A 1TS5A 2Q5WD 4AQ7A 1RLFA 3TIXA 3ZGZA 2K22A 2LGYA 3A1QB 1YX5B 3FILA 2PVOD 2NS5A 2MA9B 3A4SC 3AU5A 1R4MI 3GZNB 3AEAB 2GBJA 3EFUA 1L0XB 4IM3A 1F0ZA 1QOFA 4EOYA 4YTMB 1OQQA 4ZYNA 2BVCA 3L10B 4RH6A 2WXLA 2I2YA 4HLEA 3ZQ4A 1C4PA 4W9JA 1FO4A 2MJ3A 1JMLA 2NVUI 1P0RA 2RDGA 1WXSA 1TKYA 1WX7A 2UWQA 2K25A 4RFBA 3TEYA 2WU2B 1H4RA 2KC1A 1HQRD 4I6LB 3KWVA 3L13A 4MJSB 2L0TA 2MP2B 2LD9A 2W9NA 4FLHA 1WZ3A 4IUMB 1JALA 1SBBB 2K6DB 3BVZA 1UD7A 1MG8A 2QHOA 2VRRB 2PE9A 4KSLC 4Q2JA 3IHPC 1FCCC 2JZ3B 3SEBA 3AEEB 2HDEA 1J0GA 4AOFA 4HPMB 1JWBD 4K7UA 4WURA 2GBRA 1DOXA 1OGWA 2VZKD 4HDQA 2AL6A 3A9JA 3Q8BA 4MGYE 1C76A 3PRPB 3NUHB 4A9AA 3AEFB 3I63C 2WNMA 2MBBB 2BYTA 1NYQA 2IDYA 2PE6B 4S0RA 4O1NA 2KJHB 3H9DA
chains in the Genus database with same CATH topology
2KC2A 2MLBA 5CHFA 1J8CA 2XK5B 3U8ZA 4A3OA 3RZWC 4BOZB 2WX1A 3PREA 3R7RA 1UBIA 3C0RB 3PV1A 3ZIMA 1WZ0A 3QX1A 2DYOA 5DPSA 2BF8B 2KTFA 1TBEA 3MHSD 2NBVB 2JT4B 1A5RA 3VH3B 4BBNF 2CHZA 3KUZA 4IWPA 2K8BA 4M8MA 2CHXA 3ENEA 2KVRA 2C9WB 1SGHA 4IWOA 2KANA 1GNUA 2D07B 1UZXB 2BYFA 1IPGA 3N3KB 2XK5A 3H7SA 1YIWA 3PTFC 4HXDA 4IG7B 4P7IA 4ZRJA 3NZUA 5C1ZA 2LI5A 1KOTA 3QAQA 3W1SC 2DZIA 2MBEA 3HM3A 3HHMA 3NHEB 3RULA 1KJTA 2DZJA 2DAFA 3W1SA 3UQAA 3B0AA 4DK5A 4WJQA 1KLVA 2HD5B 1ZW7A 5CTRC 2KMAA 4ZDVA 3QHTA 5GMVA 2Z0DB 3KH0A 3V62A 1EUVB 2HE7A 1JRUA 4HPLB 1R4NI 4ANWA 2FNJB 3DVGX 1XT9B 2KJ6A 1YQBA 2KXJA 4B95A 2EMTA 2N1WA 4PYZA 3RZFA 4CO7A 1WXVA 3A9KA 3QK0A 4PS8A 2RD0A 2RSUA 3SU8X 1OEYJ 3IFWB 3B08A 2NBWB 1WXAA 2LGDA 5E6NA 1WGHA 1Q1OA 3QCAA 5IAAC 4KDLB 2N1VA 2ZEQA 2ZZPB 3H6NA 2BYEA 5FR6A 4BKTA 5J18A 3QIJA 3IVFA 3DVNU 2M1MA 2N9EB 4AWJA 1WY8A 5AZHA 1ZGUB 3U7DA 1I42A 1Q5WB 2J0MA 2RPQA 5CX3A 4W9EA 3R7QA 3ALBA 4M8NA 3T9LA 2ZPYA 4PYUA 4GDLB 4NQKE 1E8WA 1E7UA 2BPSA 4A20A 5EDSA 4FHKA 5AEKB 1WXMA 2D3GA 3VUYA 4LDTD 5LXHA 2JPHA 2KDEB 3DBRI 4MSMB 4LJPB 4EZLA 4XC2A 4LCDE 3TMPB 4KZCA 3APDA 2MBOA 3R3MA 4B6WA 1C3TA 2L3ZA 2O2VA 3WALA 1WMHA 2O6VA 2CS4A 3VAWA 5JH5C 1WE6A 1WX8A 4GDLA 2K1FA 3QARA 2N9XA 4DHJD 3M95A 2DYMA 2G4SA 3GZNI 3KW5B 4ZRKA 3TCAA 1G6JA 2J0JA 2PEAA 5LLIA 4KIKB 3VVWB 1ISNA 1V5TA 4KV2A 4RM9A 3RUIB 4TKNA 3BINA 3VXWA 2JWZA 3U30A 3VUXA 4E74A 2NPTA 1NDDA 2FIFA 3A9JB 2IY0B 4E71A 3V60A 4W9KA 1T0YA 3ZDMC 2KFKA 2JRIB 2JZZA 3N30A 3DDCB 4JQWC 3UIOB 2KX0A 1CMXB 4KIKA 4GGQA 2DHZA 1GC6A 2KK8A 4FADA 2KKCA 2KMCA 1WGGA 3PT2B 1U4AA 2LRWA 3L0WB 1L2NA 3APCA 2EMSA 4B9KA 2IZVB 2N7DA 3BY4B 3EC8A 3VDZA 2LWPA 4G0NB 5D7GA 2D2QA 1LFDA 1HE8A 2JF5A 3PHWB 3K9PB 2WDTB 4K7SA 2K39A 3ZNID 4DWFA 2CR5A 2WYQA 4GMVA 2N9PC 2KLGA 3DBSA 4GDKB 4DHJB 3DCGA 2KFJA 2CKHB 2LRUA 2NBUA 4DBGA 2MW5A 1V49A 4W9GA 3ZTDA 1XD3B 5JZEB 3B1LX 4BVUC 4MGIE 5IA7A 2R2QA 4NPNA 4K1RB 4GDKA 4EZKA 2V3SA 3WAOA 3ZO5B 4KSKC 4N9F4 1WE7A 2KQ7A 4W9CA 2I1JA 3KYCD 3PS6A 2IBIB 3NOBA 3RD2A 2LVQA 2A5UA 4AP4C 3VTUA 4FULA 2J0KA 5E6PA 3V6CB 2IO3B 1LM8B 2C60A 2DX5B 3D32A 3PPAA 4IC7B 4HVBA 3TBLD 1S3SG 2N7EA 4FHJA 4XZ4A 1WIAA 2RR9A 2FCSA 3L17A 2O6VD 2PPHA 3R66C 1F9JA 1E90A 3A9KB 4PS7A 1E5WA 3QWZB 4TV3A 4BKGA 2ZVNA 4EKUA 4F1SA 5L83A 2A4ZA 2L00B 2MBQA 2R2OA 2N4FA 4MGKE 3L08A 4MSQB 4WAAA 4HWIB 2NCNA 4MGZE 4TQ1A 5DPRA 5DPWA 1GG3A 3UGBB 1TTNA 1RFAA 1KM7A 4K81A 2MCNB 1IP9A 4BOSC 2GBKA 2BYVE 2GBMA 3W1YA 3EECA 3P2BA 3DVGY 4ASWC 2RGFA 4JGHB 1E8YA 2AL3A 3DOWA 4NJ6A 2BGFA 3IG3A 1GC7A 3ZNZB 2FAZA 2G3QB 4DDGD 2IO1B 1V81A 2KN5A 3OLMD 4TQ0A 4IM0A 1WGRA 2JXXA 4OVVA 2L8JA 2O2VB 1WMHB 2O6VB 2NR2A 4J6IA 2Z0EB 2M4NA 4X57B 4WWNA 4MDKE 3VTWA 3KVFB 1WX9A 4NNJB 4EEWA 2LXCA 3DBLI 1P98A 1WYWB 3ECIA 4MELA 1WRDB 2KJRA 1OQYA 2KNBA 3KUDB 1P9DU 3ML9A 3VQIA 3CMMB 4XX5A 4MEMA 1D3ZA 2NPTB 3K9OB 1YJ1A 4FJYA 2DZKA 1WJNA 2FCMA 2KWUB 2D11A 2KFKB 1SIFA 2KWCA 2YLMA 2ZNVB 4RMAA 3RT3B 1LXDA 4AJWA 4K7WA 2XEWA 3M62B 2V4LA 3CSFA 4II2B 4NAWA 4A3PA 3AU4A 2HJ8A 3PZDA 2L0FA 1WF9A 3OJ3A 1WH3A 1WI0A 1NBFC 3PHXB 3VFKA 4W9FA 1Z2MA 2ZNVC 3DVNV 3Q3JA 3Q3FA 4G11A 4NJ7A 1P1AA 3KUCB 4W9HA 2LVOA 3VTVA 1QZEA 2DAJA 2BWFA 2MWSB 3M3JA 4I6PA 4AUQC 4F7ZA 4GN1A 2KTRB 2JVCA 5CHVC 4II3B 4BKSD 3V6EB 3JSVA 2AEHA 1V80A 2IY1B 2ASQA 2V1YA 4KZ0A 2KDBA 1V5OA 2BWES 3VUWA 4HDOA 2LGXA 4W9DA 3X23A 1H8CA 1GUAB 1V2YA 4DDID 2KTRA 2LJ5A 3DBHI 3ZNGC 5J2RA 1OEYA 1RAXA 2ZJDA 2MBHA 3PLUA 3APFA 3UQBA 1YX6B 4G3XB 2KD0A 3CF6E 4AJYB 4JLCA 2KWVB 1WM2A 5JHAA 3JW0X 3ZRCA 4EUTA 1ZKHA 4ICUA 4F8CB 1Q0WB 2ZVOA 4HJKA 5G55A 3LDZE 2D10A 2MX2A 4HCPB 3TJPA 3DPDA 4IWQA 3N32A 3NY5A 2C7MB 4NQLB 3PRMB 3ZVVA 4FBJB 3SD5A 3PVLA 4WWPA 3AI5A 4W9LA 2G45B 1EF1A 4FN2A 4GB9A 4GXBA 1NI2A 1AARA 4RM8A 3PSEB 4EZJA 4GOCA 5J17A 1TZ1A 2CHWA 2KDIA 4JIOU 5C23A 3O65B 1OTRB 4GU2A 3H7PA 1XQQA 1L7YA 2FIDA 3RYTA 3ZNHB 4BKSA 5AZFA 3WAMA 2GMIC 2M8SA 2L05A 4KVGB 2KLCA 2LASA 3NZSA 3TL5A 3VH4B 3X0WA 3ZW3A 3AULA 3AXCA 2IYDB 2B3AA 3HK0A 1WGYA 5D2MB 1RRBA 2PJHA 5KHOA 3SDLC 4FA6A 4MM3A 4ANVA 3A4RA 1EO6A 2ZCBA 4IM2A 4E3CA 3A33B 2C5LC 1M94A 4WQOB 2KX3A 1WR1A 3UIPB 4FJZA 3ZLZA 4NY0A 3H1UA 1Y8RC 4ICVA 2IO2B 1E8ZA 1WJ4A 1RLFA 2FUHB 1P3QU 1EF5A 4GIVA 3TIXA 3WA0A 4ANUA 3HM6X 1X1MA 1S1QB 2LGYA 1YX5B 3A1QB 1V9JA 4URKA 2L7RA 2KHWB 5BO4B 2NS5A 3CSTA 1WJUA 2MA9B 3QC8B 2ZCCA 3A4SC 3I3TB 1GJZA 5JHBA 4DHZE 3AU5A 1R4MI 3PGEA 3M63B 2GBJA 3EFUA 1E8XA 4LJOB 2JUOA 4IM3A 4ANXA 3UF8A 2Y5BB 1UBQA 1WR6E 3OAWA 5AZGA 3V61A 4EOYA 3A1QA 4NAWB 2YVCA 2KZRA 4ZYNA 3L10B 1WFYA 2C7NB 2KQSA 2LVPA 3ML8A 2G4DB 4DXAB 2HTHA 4M0WB 4W9IA 5D6JB 4HLEA 4IW0A 4DHZB 5E6OA 4KDIC 3T8MA 4W9JA 4OVUA 4MH0E 5D94A 4EFOA 2REXA 3UINB 2JRHA 3JSVB 2LUEA 5L95C 1C1YB 1WGDA 2I1KA 2NVUI 1P0RA 3ONSA 4PS3A 2BKFA 1J19A 2KDFB 1WXSA 3L54A 4JL9A 3KYDD 4FJVB 2GBNA 4WJOA 5HKHA 4ZRIA 4GSWA 1WX7A 2UWQA 2MRPA 3LJ3A 2K25A 3OJ4B 2OOBB 4HK2A 3JYUA 1H4RA 2AWTA 2KC1A 2MQJA 4G50A 4TUUA 4I6LB 3JVZX 1Z5SB 2M0XA 3L13A 3GOEA 3QQ8B 5LXIB 4CYEA 2OJRA 1V86A 4WJPA 4MJSB 2L0TA 1E7VA 2MP2B 2ZPNA 2LD9A 2W9NA 4FLHA 3S2AA 1YD8U 1WZ3A 2AYOB 2J7QB 3QA8A 2JY6A 3DQVA 1UELA 4IUMB 2Z59B 5DPTA 3MTNB 4CHKA 5DCNA 3EHVA 2DZMA 2K6DB 2K6QA 1TGZB 1UD7A 1MG8A 2C7HA 2QHOA 2PE9A 2VRRB 3HIZA 4KSLC 5G2NA 3WIMA 3ZDTA 2K8HA 3IHPC 2JZ3B 4BFRA 3WANA 4BBNC 4MJSA 3ZTCA 3L16A 1FXTB 2BKRB 2MP2A 1WM3A 5CHWA 3PLVA 4I6NB 1J0GA 1SE9A 2LXAA 1IYFA 2K8CA 2DYBA 4HPMB 4AOFA 4WWOA 4K7UA 1LQBA 1VCBA 2GBRA 2LZ6A 4HCNB 1OGWA 2GOWA 3SHQA 4HDQA 2FCQA 3QJZA 2AL6A 3MJWA 3IBEA 1WJ6A 4WJNA 5TR5A 3RCZA 2KO3A 3A9JA 2DENB 3NS8A 3ZKJC 2XBBC 1UGMA 2L76A 4LDTB 1I35A 4YL8A 2MSED 3WAPA 2M17A 3H7PB 2KOXA 3ZUNA 4MGYE 3PRZA 1V6EA 1UH6A 3PRPB 3VHTC 1VD2A 1BT0A 2EKEC 2WWZA 1PQSA 2MBBB 5KHQA 2IO0B 2UYZB 1K8RB 2PE6B 2WX0A 2FCNA 3ZRFA 2CU1A 2KJHB 3H9DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KC2 A;  2MLB A;  5CHF A;  1J8C A;  2XK5 B;  3U8Z A;  4A3O A;  3RZW C;  4BOZ B;  2WX1 A;  3PRE A;  3R7R A;  1UBI A;  3C0R B;  3PV1 A;  3ZIM A;  1WZ0 A;  3QX1 A;  2DYO A;  5DPS A;  2BF8 B;  2KTF A;  1TBE A;  3MHS D;  2NBV B;  2JT4 B;  1A5R A;  3VH3 B;  4BBN F;  2CHZ A;  3KUZ A;  4IWP A;  2K8B A;  4M8M A;  2CHX A;  3ENE A;  2KVR A;  2C9W B;  1SGH A;  4IWO A;  2KAN A;  1GNU A;  2D07 B;  1UZX B;  2BYF A;  1IPG A;  3N3K B;  2XK5 A;  3H7S A;  1YIW A;  3PTF C;  4HXD A;  4IG7 B;  4P7I A;  4ZRJ A;  3NZU A;  5C1Z A;  2LI5 A;  1KOT A;  3QAQ A;  3W1S C;  2DZI A;  2MBE A;  3HM3 A;  3HHM A;  3NHE B;  3RUL A;  1KJT A;  2DZJ A;  2DAF A;  3W1S A;  3UQA A;  3B0A A;  4DK5 A;  4WJQ A;  1KLV A;  2HD5 B;  1ZW7 A;  5CTR C;  2KMA A;  4ZDV A;  3QHT A;  5GMV A;  2Z0D B;  3KH0 A;  3V62 A;  1EUV B;  2HE7 A;  1JRU A;  4HPL B;  1R4N I;  4ANW A;  2FNJ B;  3DVG X;  1XT9 B;  2KJ6 A;  1YQB A;  2KXJ A;  4B95 A;  2EMT A;  2N1W A;  4PYZ A;  3RZF A;  4CO7 A;  1WXV A;  3A9K A;  3QK0 A;  4PS8 A;  2RD0 A;  2RSU A;  3SU8 X;  1OEY J;  3IFW B;  3B08 A;  2NBW B;  1WXA A;  2LGD A;  5E6N A;  1WGH A;  1Q1O A;  3QCA A;  5IAA C;  4KDL B;  2N1V A;  2ZEQ A;  2ZZP B;  3H6N A;  2BYE A;  5FR6 A;  4BKT A;  5J18 A;  3QIJ A;  3IVF A;  3DVN U;  2M1M A;  2N9E B;  4AWJ A;  1WY8 A;  5AZH A;  1ZGU B;  3U7D A;  1I42 A;  1Q5W B;  2J0M A;  2RPQ A;  5CX3 A;  4W9E A;  3R7Q A;  3ALB A;  4M8N A;  3T9L A;  2ZPY A;  4PYU A;  4GDL B;  4NQK E;  1E8W A;  1E7U A;  2BPS A;  4A20 A;  5EDS A;  4FHK A;  5AEK B;  1WXM A;  2D3G A;  3VUY A;  4LDT D;  5LXH A;  2JPH A;  2KDE B;  3DBR I;  4MSM B;  4LJP B;  4EZL A;  4XC2 A;  4LCD E;  3TMP B;  4KZC A;  3APD A;  2MBO A;  3R3M A;  4B6W A;  1C3T A;  2L3Z A;  2O2V A;  3WAL A;  1WMH A;  2O6V A;  2CS4 A;  3VAW A;  5JH5 C;  1WE6 A;  1WX8 A;  4GDL A;  2K1F A;  3QAR A;  2N9X A;  4DHJ D;  3M95 A;  2DYM A;  2G4S A;  3GZN I;  3KW5 B;  4ZRK A;  3TCA A;  1G6J A;  2J0J A;  2PEA A;  5LLI A;  4KIK B;  3VVW B;  1ISN A;  1V5T A;  4KV2 A;  4RM9 A;  3RUI B;  4TKN A;  3BIN A;  3VXW A;  2JWZ A;  3U30 A;  3VUX A;  4E74 A;  2NPT A;  1NDD A;  2FIF A;  3A9J B;  2IY0 B;  4E71 A;  3V60 A;  4W9K A;  1T0Y A;  3ZDM C;  2KFK A;  2JRI B;  2JZZ A;  3N30 A;  3DDC B;  4JQW C;  3UIO B;  2KX0 A;  1CMX B;  4KIK A;  4GGQ A;  2DHZ A;  1GC6 A;  2KK8 A;  4FAD A;  2KKC A;  2KMC A;  1WGG A;  3PT2 B;  1U4A A;  2LRW A;  3L0W B;  1L2N A;  3APC A;  2EMS A;  4B9K A;  2IZV B;  2N7D A;  3BY4 B;  3EC8 A;  3VDZ A;  2LWP A;  4G0N B;  5D7G A;  2D2Q A;  1LFD A;  1HE8 A;  2JF5 A;  3PHW B;  3K9P B;  2WDT B;  4K7S A;  2K39 A;  3ZNI D;  4DWF A;  2CR5 A;  2WYQ A;  4GMV A;  2N9P C;  2KLG A;  3DBS A;  4GDK B;  4DHJ B;  3DCG A;  2KFJ A;  2CKH B;  2LRU A;  2NBU A;  4DBG A;  2MW5 A;  1V49 A;  4W9G A;  3ZTD A;  1XD3 B;  5JZE B;  3B1L X;  4BVU C;  4MGI E;  5IA7 A;  2R2Q A;  4NPN A;  4K1R B;  4GDK A;  4EZK A;  2V3S A;  3WAO A;  3ZO5 B;  4KSK C;  4N9F 4;  1WE7 A;  2KQ7 A;  4W9C A;  2I1J A;  3KYC D;  3PS6 A;  2IBI B;  3NOB A;  3RD2 A;  2LVQ A;  2A5U A;  4AP4 C;  3VTU A;  4FUL A;  2J0K A;  5E6P A;  3V6C B;  2IO3 B;  1LM8 B;  2C60 A;  2DX5 B;  3D32 A;  3PPA A;  4IC7 B;  4HVB A;  3TBL D;  1S3S G;  2N7E A;  4FHJ A;  4XZ4 A;  1WIA A;  2RR9 A;  2FCS A;  3L17 A;  2O6V D;  2PPH A;  3R66 C;  1F9J A;  1E90 A;  3A9K B;  4PS7 A;  1E5W A;  3QWZ B;  4TV3 A;  4BKG A;  2ZVN A;  4EKU A;  4F1S A;  5L83 A;  2A4Z A;  2L00 B;  2MBQ A;  2R2O A;  2N4F A;  4MGK E;  3L08 A;  4MSQ B;  4WAA A;  4HWI B;  2NCN A;  4MGZ E;  4TQ1 A;  5DPR A;  5DPW A;  1GG3 A;  3UGB B;  1TTN A;  1RFA A;  1KM7 A;  4K81 A;  2MCN B;  1IP9 A;  4BOS C;  2GBK A;  2BYV E;  2GBM A;  3W1Y A;  3EEC A;  3P2B A;  3DVG Y;  4ASW C;  2RGF A;  4JGH B;  1E8Y A;  2AL3 A;  3DOW A;  4NJ6 A;  2BGF A;  3IG3 A;  1GC7 A;  3ZNZ B;  2FAZ A;  2G3Q B;  4DDG D;  2IO1 B;  1V81 A;  2KN5 A;  3OLM D;  4TQ0 A;  4IM0 A;  1WGR A;  2JXX A;  4OVV A;  2L8J A;  2O2V B;  1WMH B;  2O6V B;  2NR2 A;  4J6I A;  2Z0E B;  2M4N A;  4X57 B;  4WWN A;  4MDK E;  3VTW A;  3KVF B;  1WX9 A;  4NNJ B;  4EEW A;  2LXC A;  3DBL I;  1P98 A;  1WYW B;  3ECI A;  4MEL A;  1WRD B;  2KJR A;  1OQY A;  2KNB A;  3KUD B;  1P9D U;  3ML9 A;  3VQI A;  3CMM B;  4XX5 A;  4MEM A;  1D3Z A;  2NPT B;  3K9O B;  1YJ1 A;  4FJY A;  2DZK A;  1WJN A;  2FCM A;  2KWU B;  2D11 A;  2KFK B;  1SIF A;  2KWC A;  2YLM A;  2ZNV B;  4RMA A;  3RT3 B;  1LXD A;  4AJW A;  4K7W A;  2XEW A;  3M62 B;  2V4L A;  3CSF A;  4II2 B;  4NAW A;  4A3P A;  3AU4 A;  2HJ8 A;  3PZD A;  2L0F A;  1WF9 A;  3OJ3 A;  1WH3 A;  1WI0 A;  1NBF C;  3PHX B;  3VFK A;  4W9F A;  1Z2M A;  2ZNV C;  3DVN V;  3Q3J A;  3Q3F A;  4G11 A;  4NJ7 A;  1P1A A;  3KUC B;  4W9H A;  2LVO A;  3VTV A;  1QZE A;  2DAJ A;  2BWF A;  2MWS B;  3M3J A;  4I6P A;  4AUQ C;  4F7Z A;  4GN1 A;  2KTR B;  2JVC A;  5CHV C;  4II3 B;  4BKS D;  3V6E B;  3JSV A;  2AEH A;  1V80 A;  2IY1 B;  2ASQ A;  2V1Y A;  4KZ0 A;  2KDB A;  1V5O A;  2BWE S;  3VUW A;  4HDO A;  2LGX A;  4W9D A;  3X23 A;  1H8C A;  1GUA B;  1V2Y A;  4DDI D;  2KTR A;  2LJ5 A;  3DBH I;  3ZNG C;  5J2R A;  1OEY A;  1RAX A;  2ZJD A;  2MBH A;  3PLU A;  3APF A;  3UQB A;  1YX6 B;  4G3X B;  2KD0 A;  3CF6 E;  4AJY B;  4JLC A;  2KWV B;  1WM2 A;  5JHA A;  3JW0 X;  3ZRC A;  4EUT A;  1ZKH A;  4ICU A;  4F8C B;  1Q0W B;  2ZVO A;  4HJK A;  5G55 A;  3LDZ E;  2D10 A;  2MX2 A;  4HCP B;  3TJP A;  3DPD A;  4IWQ A;  3N32 A;  3NY5 A;  2C7M B;  4NQL B;  3PRM B;  3ZVV A;  4FBJ B;  3SD5 A;  3PVL A;  4WWP A;  3AI5 A;  4W9L A;  2G45 B;  1EF1 A;  4FN2 A;  4GB9 A;  4GXB A;  1NI2 A;  1AAR A;  4RM8 A;  3PSE B;  4EZJ A;  4GOC A;  5J17 A;  1TZ1 A;  2CHW A;  2KDI A;  4JIO U;  5C23 A;  3O65 B;  1OTR B;  4GU2 A;  3H7P A;  1XQQ A;  1L7Y A;  2FID A;  3RYT A;  3ZNH B;  4BKS A;  5AZF A;  3WAM A;  2GMI C;  2M8S A;  2L05 A;  4KVG B;  2KLC A;  2LAS A;  3NZS A;  3TL5 A;  3VH4 B;  3X0W A;  3ZW3 A;  3AUL A;  3AXC A;  2IYD B;  2B3A A;  3HK0 A;  1WGY A;  5D2M B;  1RRB A;  2PJH A;  5KHO A;  3SDL C;  4FA6 A;  4MM3 A;  4ANV A;  3A4R A;  1EO6 A;  2ZCB A;  4IM2 A;  4E3C A;  3A33 B;  2C5L C;  1M94 A;  4WQO B;  2KX3 A;  1WR1 A;  3UIP B;  4FJZ A;  3ZLZ A;  4NY0 A;  3H1U A;  1Y8R C;  4ICV A;  2IO2 B;  1E8Z A;  1WJ4 A;  1RLF A;  2FUH B;  1P3Q U;  1EF5 A;  4GIV A;  3TIX A;  3WA0 A;  4ANU A;  3HM6 X;  1X1M A;  1S1Q B;  2LGY A;  1YX5 B;  3A1Q B;  1V9J A;  4URK A;  2L7R A;  2KHW B;  5BO4 B;  2NS5 A;  3CST A;  1WJU A;  2MA9 B;  3QC8 B;  2ZCC A;  3A4S C;  3I3T B;  1GJZ A;  5JHB A;  4DHZ E;  3AU5 A;  1R4M I;  3PGE A;  3M63 B;  2GBJ A;  3EFU A;  1E8X A;  4LJO B;  2JUO A;  4IM3 A;  4ANX A;  3UF8 A;  2Y5B B;  1UBQ A;  1WR6 E;  3OAW A;  5AZG A;  3V61 A;  4EOY A;  3A1Q A;  4NAW B;  2YVC A;  2KZR A;  4ZYN A;  3L10 B;  1WFY A;  2C7N B;  2KQS A;  2LVP A;  3ML8 A;  2G4D B;  4DXA B;  2HTH A;  4M0W B;  4W9I A;  5D6J B;  4HLE A;  4IW0 A;  4DHZ B;  5E6O A;  4KDI C;  3T8M A;  4W9J A;  4OVU A;  4MH0 E;  5D94 A;  4EFO A;  2REX A;  3UIN B;  2JRH A;  3JSV B;  2LUE A;  5L95 C;  1C1Y B;  1WGD A;  2I1K A;  2NVU I;  1P0R A;  3ONS A;  4PS3 A;  2BKF A;  1J19 A;  2KDF B;  1WXS A;  3L54 A;  4JL9 A;  3KYD D;  4FJV B;  2GBN A;  4WJO A;  5HKH A;  4ZRI A;  4GSW A;  1WX7 A;  2UWQ A;  2MRP A;  3LJ3 A;  2K25 A;  3OJ4 B;  2OOB B;  4HK2 A;  3JYU A;  1H4R A;  2AWT A;  2KC1 A;  2MQJ A;  4G50 A;  4TUU A;  4I6L B;  3JVZ X;  1Z5S B;  2M0X A;  3L13 A;  3GOE A;  3QQ8 B;  5LXI B;  4CYE A;  2OJR A;  1V86 A;  4WJP A;  4MJS B;  2L0T A;  1E7V A;  2MP2 B;  2ZPN A;  2LD9 A;  2W9N A;  4FLH A;  3S2A A;  1YD8 U;  1WZ3 A;  2AYO B;  2J7Q B;  3QA8 A;  2JY6 A;  3DQV A;  1UEL A;  4IUM B;  2Z59 B;  5DPT A;  3MTN B;  4CHK A;  5DCN A;  3EHV A;  2DZM A;  2K6D B;  2K6Q A;  1TGZ B;  1UD7 A;  1MG8 A;  2C7H A;  2QHO A;  2PE9 A;  2VRR B;  3HIZ A;  4KSL C;  5G2N A;  3WIM A;  3ZDT A;  2K8H A;  3IHP C;  2JZ3 B;  4BFR A;  3WAN A;  4BBN C;  4MJS A;  3ZTC A;  3L16 A;  1FXT B;  2BKR B;  2MP2 A;  1WM3 A;  5CHW A;  3PLV A;  4I6N B;  1J0G A;  1SE9 A;  2LXA A;  1IYF A;  2K8C A;  2DYB A;  4HPM B;  4AOF A;  4WWO A;  4K7U A;  1LQB A;  1VCB A;  2GBR A;  2LZ6 A;  4HCN B;  1OGW A;  2GOW A;  3SHQ A;  4HDQ A;  2FCQ A;  3QJZ A;  2AL6 A;  3MJW A;  3IBE A;  1WJ6 A;  4WJN A;  5TR5 A;  3RCZ A;  2KO3 A;  3A9J A;  2DEN B;  3NS8 A;  3ZKJ C;  2XBB C;  1UGM A;  2L76 A;  4LDT B;  1I35 A;  4YL8 A;  2MSE D;  3WAP A;  2M17 A;  3H7P B;  2KOX A;  3ZUN A;  4MGY E;  3PRZ A;  1V6E A;  1UH6 A;  3PRP B;  3VHT C;  1VD2 A;  1BT0 A;  2EKE C;  2WWZ A;  1PQS A;  2MBB B;  5KHQ A;  2IO0 B;  2UYZ B;  1K8R B;  2PE6 B;  2WX0 A;  2FCN A;  3ZRF A;  2CU1 A;  2KJH B;  3H9D A; 
#chains in the Genus database with same CATH topology
 2INP E;  4REZ A;  3U8Z A;  3RZW C;  3PV1 A;  1T6B X;  1QKZ A;  5DPS A;  2KTF A;  1TBE A;  1D5X C;  3VH3 B;  4BBN F;  2CHZ A;  2VZK B;  2KVR A;  3T3N A;  1T0Q C;  1EWY C;  3N3K B;  4KX6 B;  2WXG A;  5C1Z A;  5H8Y E;  4OZA A;  1V1P B;  3QAQ A;  4YSX B;  4C7Z A;  4OZC A;  4HEA 1;  4DK5 A;  3DWM A;  2X38 A;  5GMV A;  3BWU D;  3V62 A;  3R8B A;  2ZW1 A;  4HPL B;  2Y3A A;  4TSS A;  1ZE3 D;  1XT9 B;  2KJ6 A;  1PFD A;  4B95 A;  2EMT A;  3A9K A;  2RSU A;  3B08 A;  2MH7 A;  3Q6B A;  1FXA A;  3LB8 C;  3QCA A;  5EE1 A;  2ZZP B;  4BKT A;  3CWI A;  2W3S A;  2INN E;  4AWJ A;  5IP4 D;  1Q5W B;  1TKG A;  4W9E A;  4RGM A;  1WSP A;  2BPS A;  5EDS A;  1WXM A;  3VUY A;  4LDT D;  2I38 A;  1PYW D;  1P7F A;  4KZC A;  4B6W A;  1C3T A;  2L3Z A;  1WMH A;  3VAW A;  1WE6 A;  3GE8 C;  4KKI A;  4YTN B;  1I4G A;  2DYM A;  2G4S A;  3GZN I;  3IAS 1;  3KW5 B;  2J0J A;  3ZJU A;  4KIK B;  1MG4 A;  5C2T B;  3VVW B;  1SXT A;  1V5T A;  4KV2 A;  3RUI B;  3W5U B;  4TKN A;  2JWZ A;  3VUX A;  2NPT A;  1NDD A;  2JZP A;  2BTE A;  4W9K A;  1HXY D;  2JZZ A;  2AX5 A;  4JQW C;  3UIO B;  2L52 A;  2KX0 A;  1Q10 A;  2KK8 A;  4LNK A;  4JWS C;  2IZV B;  3BY4 B;  3DHG C;  3VDZ A;  1GB1 A;  3KLS X;  1HE8 A;  2JXT A;  4DWF A;  1KFY B;  2N9P C;  1YOV B;  3Q3M C;  1VZ8 A;  2CKH B;  2WHI A;  4DBG A;  3N1Y C;  2MW5 A;  3ZTD A;  3Q8C A;  3B1L X;  5IA7 A;  1HTO A;  2W3R A;  4GDK A;  1XO3 A;  3WAO A;  4KSK C;  1WE7 A;  4W9C A;  5BYS A;  3R2T A;  3AE2 B;  2IO3 B;  3AEC B;  4HVB A;  3RNF C;  1NYR A;  1RM6 C;  1FRD A;  4XZ4 A;  3EA6 A;  1SF0 A;  4HRS A;  3L17 A;  2O6V D;  3R66 C;  1N61 A;  2PW9 A;  1TS4 A;  1FD6 A;  4BKG A;  3AH7 A;  2L00 B;  2J53 A;  2N4F A;  4MSQ B;  4MGZ E;  4TQ1 A;  4HKQ A;  5DPR A;  1B9R A;  1TTN A;  1KM7 A;  4K81 A;  1BUI C;  2OED A;  3NVY A;  2GBM A;  1K53 A;  3W1Y A;  3P2B A;  3AE4 B;  3FAH A;  4JGH B;  1E8Y A;  1WYG A;  4NJ6 A;  1MJD A;  1NEN B;  2GI9 A;  1GC7 A;  3PZ8 A;  2Z8L A;  3ZNZ B;  2FAZ A;  3AED B;  2G3Q B;  4ZOH C;  4IM0 A;  4RGO S;  4C80 A;  3R2I A;  3HVZ A;  2O6V B;  5G5G A;  1IUE A;  1E10 A;  2IGH A;  1YN4 A;  4WWN A;  2JYE A;  1ZUD 2;  1UGJ A;  3KVF B;  1WX9 A;  4NNJ B;  3GB1 A;  1P98 A;  1VR9 A;  1D3Z A;  3K9O B;  2ZNV B;  2DZK A;  2FCM A;  3RT3 B;  2JX5 A;  1LXD A;  1N63 A;  2V4L A;  3CSF A;  4ZRP A;  5BMI A;  2N9L A;  3PZD A;  2L0F A;  2KMM A;  1EU4 A;  3PHX B;  1NBF C;  3AE6 B;  3C19 A;  1ZXH A;  1P1A A;  2LVO A;  4I6P A;  2JVC A;  5CHV C;  3RNC C;  3AE7 B;  3JSV A;  3BK2 A;  1C77 A;  2KDB A;  1V5O A;  4YSY B;  1K52 A;  3P4R B;  4DDI D;  3PLU A;  2JU6 X;  2BT6 A;  2IND C;  4JLC A;  4ICU A;  1IGD A;  4ZHP A;  5G55 A;  3LDZ E;  4K3B A;  3N1Z C;  1TY2 A;  4IWQ A;  3EFC A;  3PVL A;  2D3A A;  1ZPS A;  3P4P B;  3I5J C;  1AW7 A;  1NI2 A;  1T5X D;  2WGS A;  5J17 A;  3HUI A;  1CJE A;  3O65 B;  1RYJ A;  5IO9 A;  1NEK B;  1XQQ A;  2PMV A;  1STE A;  4BKS A;  5AZF A;  2GMI C;  3X0W A;  3VH4 B;  1YJI A;  3AUL A;  1ZXI A;  4MM3 A;  4LTU A;  2C5L C;  3L4P A;  3FIL B;  2GB1 A;  4NY0 A;  3H1U A;  3V05 A;  4ICV A;  2J4X A;  1WJ4 A;  4ANU A;  2L7R A;  2KT7 A;  1WJU A;  3I3T B;  3BVM A;  3NVW A;  1FNV A;  3RNE C;  1E8X A;  2JUO A;  4P1C C;  1WR6 E;  5AZG A;  4AS1 A;  2KQS A;  4OVZ A;  3ML8 A;  1PDX A;  5D6J B;  2JYT A;  5E6O A;  4KDI C;  1YQ3 B;  2REX A;  3UIN B;  1UF0 A;  4HJG E;  2LUE A;  2I1K A;  1VZ7 A;  2KDF B;  1FPY A;  4JL9 A;  3CIR B;  4GSW A;  3Q8A A;  3LJ3 A;  2R61 A;  4HK2 A;  4RF0 A;  1JWS D;  1FCL A;  2AWT A;  4G50 A;  1E9M A;  3JVZ X;  1Z5S B;  3QQ8 B;  4DXF A;  4WJP A;  4J3O D;  3V3X A;  1ZP0 B;  2XN9 C;  1N5W A;  3S2A A;  1NVI D;  2J7Q B;  3QA8 A;  4CHK A;  5DCN A;  2QSD A;  4ITK A;  2K6Q A;  1TGZ B;  1HTQ A;  5FK9 C;  4M00 A;  3FKY A;  2VH2 A;  2MEK A;  3WAN A;  2BKR B;  5CHW A;  2CU3 A;  1LQB A;  1VCB A;  5TSS A;  2LZ6 A;  4HCN B;  3SHQ A;  2FCQ A;  3MJW A;  3RCZ A;  4C7Y A;  2LMC A;  2XBB C;  2H88 B;  2L76 A;  2MSE D;  3U7Z A;  3PRZ A;  1UH6 A;  1VD2 A;  1BT0 A;  2MJD A;  1PQS A;  1QF6 A;  5KHQ A;  2XNA C;  1XLP A;  2IO0 B;  2KYW A;  2UYZ B;  2WX0 A;  3NVZ A;  2KC2 A;  5CHF A;  3H8H A;  4LK0 M;  3PRE A;  1QT9 A;  1UBI A;  3ZIM A;  3QX1 A;  2NBV B;  2JT4 B;  4RCO A;  3ZXV A;  2K8B A;  2CHX A;  3ENE A;  4RGT A;  1SGH A;  4IWO A;  4CQN A;  1GNU A;  2D07 B;  1UZX B;  4N58 A;  3MC0 B;  2XK5 A;  3H7S A;  4S17 A;  1IBX A;  3DHH C;  2OJW A;  2DZI A;  3HM3 A;  3HHM A;  1FEH A;  3RUL A;  1KJT A;  2DAF A;  4FXC A;  3UQA A;  1ZDX A;  1QQR A;  2HD5 B;  3AEB B;  5CTR C;  2KMA A;  4WH4 A;  1SJH D;  3KH0 A;  2OHF A;  2HE7 A;  4ANW A;  4WWM A;  4PYZ A;  3IFW B;  1XLN A;  2NBW B;  2V3N A;  5E6N A;  1DGJ A;  2ON8 A;  3VR9 B;  5IAA C;  1YMH E;  3AV8 A;  2GRI A;  2BYE A;  2WXP A;  1L0Y B;  5J18 A;  3DVN U;  4XDD A;  1ZGU B;  3U7D A;  5IN7 A;  1P7E A;  2D5G A;  3ALB A;  3OG5 A;  4PYU A;  2HTM E;  2AQ2 B;  3AE1 B;  4FHK A;  2D3G A;  5LXH A;  2JPH A;  4XC2 A;  4LCD E;  3TMP B;  2WXF A;  2MBO A;  1SIJ A;  2QJL A;  3Q8E A;  2CS4 A;  3B9J A;  2BQQ A;  4GDL A;  3QAR A;  3KQ4 A;  5LLI A;  1ZDV A;  1ISN A;  4P16 A;  2EEL A;  3RI7 C;  2FIF A;  4NJC A;  1T0Y A;  1KF6 B;  2KFK A;  2JRI B;  5HHD G;  1CMX B;  4GGQ A;  4XDC A;  1F2R C;  4FAD A;  2KKC A;  2CJN A;  1WGG A;  2LRW A;  2KVZ A;  2EMS A;  3APC A;  3TUO A;  3EC8 A;  4G0N B;  1E0Z A;  2QDF A;  4ACF A;  1IGC A;  3PHW B;  3K9P B;  1L6V A;  2PKO A;  3ZNI D;  2CR5 A;  2RDH A;  2D3B A;  4GDK B;  2IJ0 A;  2LRU A;  4XWT A;  5AUI A;  3HVD A;  4W9G A;  1YNT E;  4LNI A;  2R2Q A;  5JXV A;  1I7H A;  4RNA A;  3MFG A;  2FE8 A;  2KQ7 A;  3W9C B;  2I1J A;  1AN8 A;  3PS6 A;  2LVQ A;  2JQR B;  2J42 A;  1L4Z B;  2WXM A;  5E6P A;  3V6C B;  2C60 A;  2WDQ B;  3Q14 C;  4IC7 B;  2N7E A;  4FHJ A;  5H92 C;  3N20 C;  4IKG A;  3BVG A;  4PS7 A;  3QWZ B;  2WXQ A;  4EKU A;  5L83 A;  2A4Z A;  4C00 A;  1XEE A;  4MGK E;  3L08 A;  2BBC A;  2NCN A;  5DPW A;  3SFD B;  1GG3 A;  2MCN B;  4OZB A;  4BOS C;  3DVG Y;  4LLG M;  1SE2 A;  3AE3 B;  2BGF A;  3IG3 A;  4YSZ B;  1C4A A;  2JXX A;  2L8J A;  2O2V B;  3ZJT A;  4C4V B;  2NR2 A;  4HPP A;  4BZA A;  2M4N A;  2BS3 B;  2KN4 A;  1QOA A;  4ARC A;  1WYW B;  3ECI A;  2IGD A;  4MEL A;  1OQY A;  3ML9 A;  4XX5 A;  3GS2 A;  2KWU B;  1WJN A;  4X57 B;  1DOI A;  4RMA A;  4UDU C;  4TMA B;  2MHJ A;  1QIL A;  1VRA B;  4A3P A;  2X8X X;  2HJ8 A;  2J52 A;  3OJ3 A;  1WI0 A;  3VFK A;  5E6J A;  1Z2M A;  4A8X C;  2IGG A;  3M3J A;  4F7Z A;  4BKS D;  1FNU A;  4ZYS A;  2IY1 B;  2WU5 B;  1JW9 D;  3VUW A;  5LNK 1;  4HDO A;  3BYT B;  2LGX A;  4W9D A;  3AM9 A;  1H8C A;  1T0R C;  2KTR A;  3BK1 A;  5J2R A;  1TKE A;  2ZJD A;  1N5X A;  3UQB A;  3APF A;  3BZD B;  4G3X B;  4PK1 A;  4K3C A;  1L4D B;  1K51 A;  3URY A;  3JW0 X;  2ZVO A;  3MC8 A;  1ACC A;  3AE9 B;  1BML C;  2LUM A;  2WXN A;  3NY5 A;  4B0E A;  4NQL B;  1KTK A;  4FBJ B;  3SD5 A;  4WWP A;  3AI5 A;  2G45 B;  1SB3 C;  4ZRQ A;  3Q3N C;  4GB9 A;  4RM8 A;  3PSE B;  1AYF A;  2RMM A;  4GOC A;  4A90 A;  4MT5 A;  4MM3 B;  1V8C A;  5C23 A;  4GU2 A;  2FID A;  1ESF A;  3W5V B;  4KVG B;  3NZS A;  1J7A A;  3HK0 A;  4YXD B;  5KHO A;  1D4B A;  3A4R A;  4E3C A;  4GLS C;  3RFZ B;  2KX3 A;  4D2K A;  3ZLZ A;  1XXG A;  1XCT L;  4USA A;  2IO2 B;  1E8Z A;  3AEG B;  1P3Q U;  3DBR B;  4GIV A;  1V9J A;  4URK A;  1V1P A;  3ZYY X;  3QC8 B;  2ZCC A;  1GJZ A;  1HZ5 A;  5JHB A;  4DHZ E;  3PGE A;  3LXF A;  3U4E G;  2L83 A;  4ANX A;  2Y5B B;  4JX1 C;  3OAW A;  1VDV A;  4NAW B;  1KLG D;  2KZR A;  1QOG A;  1WFY A;  2C7N B;  1JWM D;  2LVP A;  2WXI A;  1OQR A;  2G4D B;  3IT4 B;  2HTH A;  4IW0 A;  3AB5 A;  2G9H D;  1MFW A;  3T8M A;  4OVU A;  5D94 A;  3Q69 A;  4EFO A;  5L95 C;  2AQ1 B;  4DQO C;  1WGD A;  2BKF A;  1J19 A;  3L54 A;  4M0W A;  2GBN A;  2WXK A;  2MJE A;  3OJ4 B;  3P63 A;  1WRI A;  4TUU A;  2M0X A;  5LXI B;  3GOE A;  1C78 A;  2WXO A;  4NAM A;  4PT5 A;  4CYE A;  4US9 A;  1FNW A;  1E7V A;  2ZPN A;  4B0M A;  3P42 A;  4XWW A;  5HFY A;  1J7B A;  1YD8 U;  1A70 A;  2JY6 A;  1UEL A;  3MTN B;  2EKI A;  5G2N A;  3WIM A;  3ZDT A;  3AE8 B;  2K8H A;  4JWU C;  4BBN C;  3ZTC A;  4P1B C;  3L16 A;  1WM3 A;  3PLV A;  1SE9 A;  2LXA A;  1IYF A;  1KRH A;  4XYC A;  1GOZ A;  4WJN A;  5TR5 A;  1E7P B;  2L32 A;  3ZKJ C;  4YL8 A;  2M17 A;  3H7P B;  2KOX A;  3ZUN A;  1V6E A;  3T3O A;  1MHX A;  2L1A A;  3NS1 A;  1EWC A;  1K8R B;  4IOI E;  3ZRF A;  3TEZ A;  2MLB A;  4KKJ A;  2XK5 B;  1LGR A;  2LHD A;  2WX1 A;  2NTS A;  3R7R A;  1IBX B;  2DYO A;  3I9V 1;  2WXH A;  2V4I B;  2WLB A;  1A5R A;  4N6E B;  4MH8 A;  3KUZ A;  2WS3 B;  4IWP A;  1T3Q A;  5IKC M;  2BYF A;  1MHH E;  4ZRJ A;  3PTF C;  4HXD A;  4P7I A;  2CJO A;  1D5M C;  3IXS A;  1KOT A;  3W1S C;  2MBE A;  3NHE B;  5I4D A;  2DZJ A;  3W1S A;  3DBL B;  3B0A A;  1ZW7 A;  5FR3 A;  1JWU D;  1SE4 A;  1SSN A;  3MC9 A;  4ZDV A;  2Z0D B;  4LNO A;  1F77 A;  1EUV B;  1JRU A;  1L6U A;  3RMK C;  2N1W A;  3RZF A;  4CO7 A;  1WXV A;  3QK0 A;  1CZP A;  2RD0 A;  4WIP A;  3SU8 X;  1I4Q A;  1FMA D;  1WXA A;  2LGD A;  2SEB D;  2K0P A;  3EUB 2;  5G5H A;  4US8 A;  2N1V A;  2BS2 B;  2ZEQ A;  3BII D;  3H6N A;  1ZOY B;  3QIJ A;  3IVF A;  1I4R A;  2M1M A;  5HG2 A;  2N9E B;  5AZH A;  2N9K A;  1I42 A;  2RPQ A;  3V60 A;  2KAC A;  4GDL B;  4NQK E;  1E7U A;  4A20 A;  2RDB C;  4MAC A;  1UNS A;  3DBR I;  1TZO A;  3O13 A;  4LJP B;  4MSM B;  3APD A;  3WAL A;  2O6V A;  5JH5 C;  1V97 A;  5AUK A;  1WX8 A;  4BAX A;  2N9X A;  4JE3 B;  2D3C A;  2PEA A;  4DXG A;  3BIN A;  3U30 A;  3A9J B;  2IY0 B;  1JRO A;  1TY0 A;  1PGX A;  4R3D A;  2KMC A;  1LO5 D;  3SFE B;  3PT2 B;  1U4A A;  3L0W B;  4LNF A;  2N7D A;  1T0S C;  2LWP A;  1CQV A;  2JF5 A;  5C3J B;  2WYQ A;  1TS2 A;  4GMV A;  3DBS A;  1PUT A;  2YEP B;  3NZ3 A;  1C4C A;  2RPV A;  2PIA A;  4BVU C;  1JRP A;  1SE3 A;  1TS3 A;  2Y5C A;  3TEX A;  4EZK A;  2V3S A;  3ZO5 B;  3KYC D;  3RD2 A;  2V0G A;  3VTU A;  3FC4 A;  2DX5 B;  3D32 A;  1ET6 A;  3Q8F A;  2FCS A;  2PPH A;  3RN9 C;  1GAQ B;  3A9K B;  2JWU A;  1R7S A;  3U52 E;  4F1S A;  2MBQ A;  2LFI A;  2LGI A;  4HWI B;  2V3P A;  2ONQ A;  3UGB B;  1PGA A;  1RFA A;  3Q3O C;  2GBK A;  3EEC A;  2W55 A;  2AL3 A;  1MVK A;  1FM0 D;  5D3D A;  3NJT A;  3ETR A;  1V81 A;  1HEZ E;  1WGR A;  3ZJV A;  1WMH B;  4J6I A;  2K3U A;  2PTL A;  3VTW A;  1MPE A;  2M0A A;  3DBL I;  3N1X C;  1WRD B;  2BS4 B;  2KJR A;  2KNB A;  3KUD B;  1L0V B;  1P9D U;  3VQI A;  3CMM B;  5IOI A;  2NPT B;  1KH0 A;  1YJ1 A;  2Y5P A;  5EE0 A;  4K7W A;  5T8I A;  2XEW A;  2QIL A;  3M62 B;  2BB5 A;  3ABV B;  4II2 B;  4LNN A;  1WH3 A;  4W9F A;  2BB6 A;  1QLB B;  3DVN V;  5GXG B;  3Q3J A;  3Q3F A;  4NJ7 A;  3KUC B;  4W9H A;  2INC C;  1QZE A;  2BWF A;  2MWS B;  1YN3 A;  2KTR B;  1XCQ L;  4II3 B;  2FBW B;  2AEH A;  1V80 A;  2DBY A;  2ASQ A;  2V1Y A;  2BWE S;  4L1B A;  3B2F A;  3X23 A;  1SEB D;  2LJ5 A;  2QIE B;  3ZNG C;  3DHI C;  1OEY A;  1RAX A;  2KD0 A;  3CF6 E;  1WM2 A;  1ZKH A;  5D3I B;  2D10 A;  2MX2 A;  3N32 A;  3TSS A;  2C7M B;  4ARI A;  3ZVV A;  1F2R I;  1MI0 A;  1WXQ A;  4FN2 A;  2PLP A;  1R4N B;  2ZW0 A;  4WAF A;  2B76 B;  2CHW A;  2E3T A;  1HZ6 A;  3WAM A;  2M56 B;  2KLC A;  2LAS A;  3MHZ A;  2V9H A;  3AXC A;  2LJI A;  2B3A A;  2W82 A;  2PJH A;  3SDL C;  3ZXR A;  4ANV A;  5EE3 A;  4IM2 A;  2ZCB A;  1M94 A;  4YWG G;  2BW2 A;  1JWA D;  4WQO B;  3UIP B;  1Y8R C;  3LYY A;  2QEJ C;  2FUH B;  1EF5 A;  3WA0 A;  3C8Y A;  3HM6 X;  1X1M A;  1S1Q B;  3MP9 A;  1JQ4 A;  1WWT A;  2KHW B;  5BO4 B;  3CST A;  3M63 B;  4LJO B;  3UF8 A;  2WXR A;  1UBQ A;  3V61 A;  3A1Q A;  4JPS A;  2YVC A;  4DXA B;  2AQ3 B;  4M0W B;  4W9I A;  4NZL B;  4DHZ B;  1VLB A;  4MH0 E;  2JRH A;  4C56 C;  3JSV B;  1C1Y B;  1D6E C;  3ONS A;  4PS3 A;  3KYD D;  4FJV B;  4WJO A;  5HKH A;  2PVG C;  4ZRI A;  2MRP A;  2OOB B;  3JYU A;  2MQJ A;  1DYQ A;  1N60 A;  2OJR A;  1V86 A;  1EM7 A;  2M19 A;  4KGS A;  2WXJ A;  2AYO B;  3DQV A;  4XGA B;  2Z59 B;  4P6V F;  3IAM 1;  5DPT A;  3EHV A;  2DZM A;  5BMH A;  2C7H A;  1E6E B;  3HIZ A;  4XE0 A;  4BFR A;  1D5Z C;  3OWE B;  4MJS A;  1FXT B;  2MP2 A;  2WQY B;  1YN5 A;  4I6N B;  2KWD A;  2GLS A;  2K8C A;  2DYB A;  4WWO A;  2GOW A;  3QJZ A;  3IBE A;  1N62 A;  1WJ6 A;  2KO3 A;  2DEN B;  3NS8 A;  3E56 A;  1UGM A;  1AWD A;  4LDT B;  1I35 A;  2N7J A;  3WAP A;  2E6X A;  3VHT C;  1F1H A;  2EKE C;  1WGK A;  2WWZ A;  1TYG B;  1FFV A;  3GP7 A;  1UWM A;  1SJE D;  2FCN A;  2CU1 A;  4KGT A;  2K5P A;  1J8C A;  1B1Z A;  4A3O A;  4BOZ B;  3C0R B;  4HKZ E;  1WZ0 A;  2BF8 B;  2NTT A;  3MHS D;  1TJE A;  1XLQ A;  3P4S B;  1TT5 B;  3I57 A;  1FIQ A;  4M8M A;  3IT6 B;  2C9W B;  3DWG C;  2LHE A;  2KAN A;  5BYQ A;  3GE3 C;  1IPG A;  4IG7 B;  4YTP B;  1YIW A;  3NZU A;  2LI5 A;  2VH1 A;  1FXI A;  1VZ6 A;  4ZHO A;  4YT0 B;  2TSS A;  4WJQ A;  3NVV A;  1KLV A;  1J7C A;  2WDR B;  2UU7 A;  3QHT A;  2G1E A;  1R4N I;  4A6Q A;  1FFU A;  2FNJ B;  3DVG X;  1YQB A;  2KXJ A;  3UI3 A;  3Q2A C;  4PS8 A;  1OEY J;  2KQ4 X;  3HRD D;  1WGH A;  3VR8 B;  1Q1O A;  2FUG 1;  2QMT A;  4KDL B;  5FR6 A;  1GPX A;  1UUP A;  1WY8 A;  1I4H A;  5CX3 A;  2J0M A;  3R7Q A;  4M8N A;  3T9L A;  2ZPY A;  1E8W A;  3DBH B;  5AEK B;  2K9X A;  4L2Y A;  2KDE B;  4RGN A;  4EZL A;  3R3M A;  2O2V A;  1I4P A;  4C4V A;  4M01 A;  2K1F A;  4DHJ D;  3M95 A;  1G6J A;  4IDI A;  4ZRK A;  3TCA A;  5BMG A;  4RM9 A;  1M4V A;  3NG0 A;  3VXW A;  2IPK D;  4E74 A;  3VRB B;  4E71 A;  3ZDM C;  4N59 A;  3N30 A;  3DDC B;  5FKA C;  4M02 A;  3RPF C;  4KIK A;  2DHZ A;  3WCQ A;  1GC6 A;  2W54 A;  1CK1 A;  1L2N A;  2KDM A;  4B9K A;  3W2D A;  5D7G A;  2D2Q A;  1JCK B;  1LFD A;  1VJK A;  2WDT B;  4K7S A;  2K39 A;  2KLG A;  4DHJ B;  4WQM A;  2LEK A;  3DCG A;  2KFJ A;  2NBU A;  1V49 A;  1XD3 B;  3AMZ A;  5JZE B;  2NMQ A;  4MGI E;  1C79 A;  2DLB A;  4K1R B;  4NPN A;  1V1O A;  1RWS A;  4N9F 4;  2WP9 B;  1C9F A;  2IBI B;  3NOB A;  1YQ4 B;  3NRZ A;  2A5U A;  1ENF A;  4AP4 C;  2QC8 A;  4FUL A;  2J0K A;  1R4M B;  4KGR A;  1LM8 B;  3PPA A;  3TBL D;  1S3S G;  1F52 A;  1WIA A;  2RR9 A;  1F9J A;  1E90 A;  3AN1 A;  1E5W A;  1FRR A;  2WDV B;  4TV3 A;  2ZVN A;  1I4X A;  2R2O A;  2QCZ A;  2JSV X;  4WAA A;  1QOB A;  3TEW A;  1IP9 A;  2BYV E;  2YEP F;  4RF1 A;  3RNG C;  4ASW C;  1HA5 A;  2RGF A;  3DOW A;  4DDG D;  2IO1 B;  2KN5 A;  3OLM D;  4TQ0 A;  4OVV A;  2Z0E B;  4QAY A;  3PO0 A;  4MDK E;  4EEW A;  2LXC A;  4H2A A;  2DNF A;  2ICI A;  3AE5 B;  1ROE A;  3RNB C;  4MEM A;  4FJY A;  2YLM A;  2D11 A;  2KFK B;  1SIF A;  2KWC A;  4AJW A;  5MPO A;  4NAW A;  1N6Z A;  3AU4 A;  1WF9 A;  4L23 A;  2KAJ A;  1XLO A;  4A55 A;  3N9Y C;  2ZNV C;  5EE9 A;  4G11 A;  3VTV A;  2DAJ A;  3BYY B;  4AUQ C;  4GN1 A;  3P1M A;  4HRO A;  3V6E B;  2ACZ B;  2SAK A;  2HJ1 A;  4KZ0 A;  3KWL A;  3E9S A;  1BXT A;  1YJJ A;  1GUA B;  1V2Y A;  3PZ7 A;  1GB4 A;  1RFK A;  1UWX A;  1K50 A;  3DBH I;  2MBH A;  3U2S C;  1YX6 B;  3RNA C;  4AJY B;  2KWV B;  5JHA A;  3MJ5 A;  3ZRC A;  1ET9 A;  1XF5 L;  4EUT A;  1L5P A;  4F8C B;  1Q0W B;  4HJK A;  4HCP B;  3TJP A;  3DPD A;  3B2G A;  1TIF A;  3PRM B;  1OFF A;  1NI3 A;  3EGR A;  4W9L A;  1EF1 A;  4GXB A;  1AAR A;  1PGB A;  5BYR A;  3SR6 A;  4EZJ A;  1DOY A;  1TZ1 A;  2KDI A;  4JIO U;  1OTR B;  3H7P A;  1L7Y A;  3RYT A;  2N0S B;  3ZNH B;  2M8S A;  2L05 A;  3TL5 A;  3ZW3 A;  1EU3 A;  2DWQ A;  2IYD B;  4EE2 A;  3P4Q B;  1WGY A;  3VRA B;  5D2M B;  1RRB A;  1KLU D;  4FA6 A;  5HI1 A;  2LGS A;  1EO6 A;  3A33 B;  4OHJ A;  4OW0 A;  3J9C A;  1WR1 A;  2H89 B;  4FJZ A;  1Y56 A;  1TS5 A;  2Q5W D;  4AQ7 A;  1RLF A;  3TIX A;  3ZGZ A;  2K22 A;  2LGY A;  3A1Q B;  1YX5 B;  3FIL A;  2PVO D;  2NS5 A;  2MA9 B;  3A4S C;  3AU5 A;  1R4M I;  3GZN B;  3AEA B;  2GBJ A;  3EFU A;  1L0X B;  4IM3 A;  1F0Z A;  1QOF A;  4EOY A;  4YTM B;  1OQQ A;  4ZYN A;  2BVC A;  3L10 B;  4RH6 A;  2WXL A;  2I2Y A;  4HLE A;  3ZQ4 A;  1C4P A;  4W9J A;  1FO4 A;  2MJ3 A;  1JML A;  2NVU I;  1P0R A;  2RDG A;  1WXS A;  1TKY A;  1WX7 A;  2UWQ A;  2K25 A;  4RFB A;  3TEY A;  2WU2 B;  1H4R A;  2KC1 A;  1HQR D;  4I6L B;  3KWV A;  3L13 A;  4MJS B;  2L0T A;  2MP2 B;  2LD9 A;  2W9N A;  4FLH A;  1WZ3 A;  4IUM B;  1JAL A;  1SBB B;  2K6D B;  3BVZ A;  1UD7 A;  1MG8 A;  2QHO A;  2VRR B;  2PE9 A;  4KSL C;  4Q2J A;  3IHP C;  1FCC C;  2JZ3 B;  3SEB A;  3AEE B;  2HDE A;  1J0G A;  4AOF A;  4HPM B;  1JWB D;  4K7U A;  4WUR A;  2GBR A;  1DOX A;  1OGW A;  2VZK D;  4HDQ A;  2AL6 A;  3A9J A;  3Q8B A;  4MGY E;  1C76 A;  3PRP B;  3NUH B;  4A9A A;  3AEF B;  3I63 C;  2WNM A;  2MBB B;  2BYT A;  1NYQ A;  2IDY A;  2PE6 B;  4S0R A;  4O1N A;  2KJH B;  3H9D A; 
#chains in the Genus database with same CATH homology
 2KC2 A;  2MLB A;  5CHF A;  1J8C A;  2XK5 B;  3U8Z A;  4A3O A;  3RZW C;  4BOZ B;  2WX1 A;  3PRE A;  3R7R A;  1UBI A;  3C0R B;  3PV1 A;  3ZIM A;  1WZ0 A;  3QX1 A;  2DYO A;  5DPS A;  2BF8 B;  2KTF A;  1TBE A;  3MHS D;  2NBV B;  2JT4 B;  1A5R A;  3VH3 B;  4BBN F;  2CHZ A;  3KUZ A;  4IWP A;  2K8B A;  4M8M A;  2CHX A;  3ENE A;  2KVR A;  2C9W B;  1SGH A;  4IWO A;  2KAN A;  1GNU A;  2D07 B;  1UZX B;  2BYF A;  1IPG A;  3N3K B;  2XK5 A;  3H7S A;  1YIW A;  3PTF C;  4HXD A;  4IG7 B;  4P7I A;  4ZRJ A;  3NZU A;  5C1Z A;  2LI5 A;  1KOT A;  3QAQ A;  3W1S C;  2DZI A;  2MBE A;  3HM3 A;  3HHM A;  3NHE B;  3RUL A;  1KJT A;  2DZJ A;  2DAF A;  3W1S A;  3UQA A;  3B0A A;  4DK5 A;  4WJQ A;  1KLV A;  2HD5 B;  1ZW7 A;  5CTR C;  2KMA A;  4ZDV A;  3QHT A;  5GMV A;  2Z0D B;  3KH0 A;  3V62 A;  1EUV B;  2HE7 A;  1JRU A;  4HPL B;  1R4N I;  4ANW A;  2FNJ B;  3DVG X;  1XT9 B;  2KJ6 A;  1YQB A;  2KXJ A;  4B95 A;  2EMT A;  2N1W A;  4PYZ A;  3RZF A;  4CO7 A;  1WXV A;  3A9K A;  3QK0 A;  4PS8 A;  2RD0 A;  2RSU A;  3SU8 X;  1OEY J;  3IFW B;  3B08 A;  2NBW B;  1WXA A;  2LGD A;  5E6N A;  1WGH A;  1Q1O A;  3QCA A;  5IAA C;  4KDL B;  2N1V A;  2ZEQ A;  2ZZP B;  3H6N A;  2BYE A;  5FR6 A;  4BKT A;  5J18 A;  3QIJ A;  3IVF A;  3DVN U;  2M1M A;  2N9E B;  4AWJ A;  1WY8 A;  5AZH A;  1ZGU B;  3U7D A;  1I42 A;  1Q5W B;  2J0M A;  2RPQ A;  5CX3 A;  4W9E A;  3R7Q A;  3ALB A;  4M8N A;  3T9L A;  2ZPY A;  4PYU A;  4GDL B;  4NQK E;  1E8W A;  1E7U A;  2BPS A;  4A20 A;  5EDS A;  4FHK A;  5AEK B;  1WXM A;  2D3G A;  3VUY A;  4LDT D;  5LXH A;  2JPH A;  2KDE B;  3DBR I;  4MSM B;  4LJP B;  4EZL A;  4XC2 A;  4LCD E;  3TMP B;  4KZC A;  3APD A;  2MBO A;  3R3M A;  4B6W A;  1C3T A;  2L3Z A;  2O2V A;  3WAL A;  1WMH A;  2O6V A;  2CS4 A;  3VAW A;  5JH5 C;  1WE6 A;  1WX8 A;  4GDL A;  2K1F A;  3QAR A;  2N9X A;  4DHJ D;  3M95 A;  2DYM A;  2G4S A;  3GZN I;  3KW5 B;  4ZRK A;  3TCA A;  1G6J A;  2J0J A;  2PEA A;  5LLI A;  4KIK B;  3VVW B;  1ISN A;  1V5T A;  4KV2 A;  4RM9 A;  3RUI B;  4TKN A;  3BIN A;  3VXW A;  2JWZ A;  3U30 A;  3VUX A;  4E74 A;  2NPT A;  1NDD A;  2FIF A;  3A9J B;  2IY0 B;  4E71 A;  3V60 A;  4W9K A;  1T0Y A;  3ZDM C;  2KFK A;  2JRI B;  2JZZ A;  3N30 A;  3DDC B;  4JQW C;  3UIO B;  2KX0 A;  1CMX B;  4KIK A;  4GGQ A;  2DHZ A;  1GC6 A;  2KK8 A;  4FAD A;  2KKC A;  2KMC A;  1WGG A;  3PT2 B;  1U4A A;  2LRW A;  3L0W B;  1L2N A;  3APC A;  2EMS A;  4B9K A;  2IZV B;  2N7D A;  3BY4 B;  3EC8 A;  3VDZ A;  2LWP A;  4G0N B;  5D7G A;  2D2Q A;  1LFD A;  1HE8 A;  2JF5 A;  3PHW B;  3K9P B;  2WDT B;  4K7S A;  2K39 A;  3ZNI D;  4DWF A;  2CR5 A;  2WYQ A;  4GMV A;  2N9P C;  2KLG A;  3DBS A;  4GDK B;  4DHJ B;  3DCG A;  2KFJ A;  2CKH B;  2LRU A;  2NBU A;  4DBG A;  2MW5 A;  1V49 A;  4W9G A;  3ZTD A;  1XD3 B;  5JZE B;  3B1L X;  4BVU C;  4MGI E;  5IA7 A;  2R2Q A;  4NPN A;  4K1R B;  4GDK A;  4EZK A;  2V3S A;  3WAO A;  3ZO5 B;  4KSK C;  4N9F 4;  1WE7 A;  2KQ7 A;  4W9C A;  2I1J A;  3KYC D;  3PS6 A;  2IBI B;  3NOB A;  3RD2 A;  2LVQ A;  2A5U A;  4AP4 C;  3VTU A;  4FUL A;  2J0K A;  5E6P A;  3V6C B;  2IO3 B;  1LM8 B;  2C60 A;  2DX5 B;  3D32 A;  3PPA A;  4IC7 B;  4HVB A;  3TBL D;  1S3S G;  2N7E A;  4FHJ A;  4XZ4 A;  1WIA A;  2RR9 A;  2FCS A;  3L17 A;  2O6V D;  2PPH A;  3R66 C;  1F9J A;  1E90 A;  3A9K B;  4PS7 A;  1E5W A;  3QWZ B;  4TV3 A;  4BKG A;  2ZVN A;  4EKU A;  4F1S A;  5L83 A;  2A4Z A;  2L00 B;  2MBQ A;  2R2O A;  2N4F A;  4MGK E;  3L08 A;  4MSQ B;  4WAA A;  4HWI B;  2NCN A;  4MGZ E;  4TQ1 A;  5DPR A;  5DPW A;  1GG3 A;  3UGB B;  1TTN A;  1RFA A;  1KM7 A;  4K81 A;  2MCN B;  1IP9 A;  4BOS C;  2GBK A;  2BYV E;  2GBM A;  3W1Y A;  3EEC A;  3P2B A;  3DVG Y;  4ASW C;  2RGF A;  4JGH B;  1E8Y A;  2AL3 A;  3DOW A;  4NJ6 A;  2BGF A;  3IG3 A;  1GC7 A;  3ZNZ B;  2FAZ A;  2G3Q B;  4DDG D;  2IO1 B;  1V81 A;  2KN5 A;  3OLM D;  4TQ0 A;  4IM0 A;  1WGR A;  2JXX A;  4OVV A;  2L8J A;  2O2V B;  1WMH B;  2O6V B;  2NR2 A;  4J6I A;  2Z0E B;  2M4N A;  4X57 B;  4WWN A;  4MDK E;  3VTW A;  3KVF B;  1WX9 A;  4NNJ B;  4EEW A;  2LXC A;  3DBL I;  1P98 A;  1WYW B;  3ECI A;  4MEL A;  1WRD B;  2KJR A;  1OQY A;  2KNB A;  3KUD B;  1P9D U;  3ML9 A;  3VQI A;  3CMM B;  4XX5 A;  4MEM A;  1D3Z A;  2NPT B;  3K9O B;  1YJ1 A;  4FJY A;  2DZK A;  1WJN A;  2FCM A;  2KWU B;  2D11 A;  2KFK B;  1SIF A;  2KWC A;  2YLM A;  2ZNV B;  4RMA A;  3RT3 B;  1LXD A;  4AJW A;  4K7W A;  2XEW A;  3M62 B;  2V4L A;  3CSF A;  4II2 B;  4NAW A;  4A3P A;  3AU4 A;  2HJ8 A;  3PZD A;  2L0F A;  1WF9 A;  3OJ3 A;  1WH3 A;  1WI0 A;  1NBF C;  3PHX B;  3VFK A;  4W9F A;  1Z2M A;  2ZNV C;  3DVN V;  3Q3J A;  3Q3F A;  4G11 A;  4NJ7 A;  1P1A A;  3KUC B;  4W9H A;  2LVO A;  3VTV A;  1QZE A;  2DAJ A;  2BWF A;  2MWS B;  3M3J A;  4I6P A;  4AUQ C;  4F7Z A;  4GN1 A;  2KTR B;  2JVC A;  5CHV C;  4II3 B;  4BKS D;  3V6E B;  3JSV A;  2AEH A;  1V80 A;  2IY1 B;  2ASQ A;  2V1Y A;  4KZ0 A;  2KDB A;  1V5O A;  2BWE S;  3VUW A;  4HDO A;  2LGX A;  4W9D A;  3X23 A;  1H8C A;  1GUA B;  1V2Y A;  4DDI D;  2KTR A;  2LJ5 A;  3DBH I;  3ZNG C;  5J2R A;  1OEY A;  1RAX A;  2ZJD A;  2MBH A;  3PLU A;  3APF A;  3UQB A;  1YX6 B;  4G3X B;  2KD0 A;  3CF6 E;  4AJY B;  4JLC A;  2KWV B;  1WM2 A;  5JHA A;  3JW0 X;  3ZRC A;  4EUT A;  1ZKH A;  4ICU A;  4F8C B;  1Q0W B;  2ZVO A;  4HJK A;  5G55 A;  3LDZ E;  2D10 A;  2MX2 A;  4HCP B;  3TJP A;  3DPD A;  4IWQ A;  3N32 A;  3NY5 A;  2C7M B;  4NQL B;  3PRM B;  3ZVV A;  4FBJ B;  3SD5 A;  3PVL A;  4WWP A;  3AI5 A;  4W9L A;  2G45 B;  1EF1 A;  4FN2 A;  4GB9 A;  4GXB A;  1NI2 A;  1AAR A;  4RM8 A;  3PSE B;  4EZJ A;  4GOC A;  5J17 A;  1TZ1 A;  2CHW A;  2KDI A;  4JIO U;  5C23 A;  3O65 B;  1OTR B;  4GU2 A;  3H7P A;  1XQQ A;  1L7Y A;  2FID A;  3RYT A;  3ZNH B;  4BKS A;  5AZF A;  3WAM A;  2GMI C;  2M8S A;  2L05 A;  4KVG B;  2KLC A;  2LAS A;  3NZS A;  3TL5 A;  3VH4 B;  3X0W A;  3ZW3 A;  3AUL A;  3AXC A;  2IYD B;  2B3A A;  3HK0 A;  1WGY A;  5D2M B;  1RRB A;  2PJH A;  5KHO A;  3SDL C;  4FA6 A;  4MM3 A;  4ANV A;  3A4R A;  1EO6 A;  2ZCB A;  4IM2 A;  4E3C A;  3A33 B;  2C5L C;  1M94 A;  4WQO B;  2KX3 A;  1WR1 A;  3UIP B;  4FJZ A;  3ZLZ A;  4NY0 A;  3H1U A;  1Y8R C;  4ICV A;  2IO2 B;  1E8Z A;  1WJ4 A;  1RLF A;  2FUH B;  1P3Q U;  1EF5 A;  4GIV A;  3TIX A;  3WA0 A;  4ANU A;  3HM6 X;  1X1M A;  1S1Q B;  2LGY A;  1YX5 B;  3A1Q B;  1V9J A;  4URK A;  2L7R A;  2KHW B;  5BO4 B;  2NS5 A;  3CST A;  1WJU A;  2MA9 B;  3QC8 B;  2ZCC A;  3A4S C;  3I3T B;  1GJZ A;  5JHB A;  4DHZ E;  3AU5 A;  1R4M I;  3PGE A;  3M63 B;  2GBJ A;  3EFU A;  1E8X A;  4LJO B;  2JUO A;  4IM3 A;  4ANX A;  3UF8 A;  2Y5B B;  1UBQ A;  1WR6 E;  3OAW A;  5AZG A;  3V61 A;  4EOY A;  3A1Q A;  4NAW B;  2YVC A;  2KZR A;  4ZYN A;  3L10 B;  1WFY A;  2C7N B;  2KQS A;  2LVP A;  3ML8 A;  2G4D B;  4DXA B;  2HTH A;  4M0W B;  4W9I A;  5D6J B;  4HLE A;  4IW0 A;  4DHZ B;  5E6O A;  4KDI C;  3T8M A;  4W9J A;  4OVU A;  4MH0 E;  5D94 A;  4EFO A;  2REX A;  3UIN B;  2JRH A;  3JSV B;  2LUE A;  5L95 C;  1C1Y B;  1WGD A;  2I1K A;  2NVU I;  1P0R A;  3ONS A;  4PS3 A;  2BKF A;  1J19 A;  2KDF B;  1WXS A;  3L54 A;  4JL9 A;  3KYD D;  4FJV B;  2GBN A;  4WJO A;  5HKH A;  4ZRI A;  4GSW A;  1WX7 A;  2UWQ A;  2MRP A;  3LJ3 A;  2K25 A;  3OJ4 B;  2OOB B;  4HK2 A;  3JYU A;  1H4R A;  2AWT A;  2KC1 A;  2MQJ A;  4G50 A;  4TUU A;  4I6L B;  3JVZ X;  1Z5S B;  2M0X A;  3L13 A;  3GOE A;  3QQ8 B;  5LXI B;  4CYE A;  2OJR A;  1V86 A;  4WJP A;  4MJS B;  2L0T A;  1E7V A;  2MP2 B;  2ZPN A;  2LD9 A;  2W9N A;  4FLH A;  3S2A A;  1YD8 U;  1WZ3 A;  2AYO B;  2J7Q B;  3QA8 A;  2JY6 A;  3DQV A;  1UEL A;  4IUM B;  2Z59 B;  5DPT A;  3MTN B;  4CHK A;  5DCN A;  3EHV A;  2DZM A;  2K6D B;  2K6Q A;  1TGZ B;  1UD7 A;  1MG8 A;  2C7H A;  2QHO A;  2PE9 A;  2VRR B;  3HIZ A;  4KSL C;  5G2N A;  3WIM A;  3ZDT A;  2K8H A;  3IHP C;  2JZ3 B;  4BFR A;  3WAN A;  4BBN C;  4MJS A;  3ZTC A;  3L16 A;  1FXT B;  2BKR B;  2MP2 A;  1WM3 A;  5CHW A;  3PLV A;  4I6N B;  1J0G A;  1SE9 A;  2LXA A;  1IYF A;  2K8C A;  2DYB A;  4HPM B;  4AOF A;  4WWO A;  4K7U A;  1LQB A;  1VCB A;  2GBR A;  2LZ6 A;  4HCN B;  1OGW A;  2GOW A;  3SHQ A;  4HDQ A;  2FCQ A;  3QJZ A;  2AL6 A;  3MJW A;  3IBE A;  1WJ6 A;  4WJN A;  5TR5 A;  3RCZ A;  2KO3 A;  3A9J A;  2DEN B;  3NS8 A;  3ZKJ C;  2XBB C;  1UGM A;  2L76 A;  4LDT B;  1I35 A;  4YL8 A;  2MSE D;  3WAP A;  2M17 A;  3H7P B;  2KOX A;  3ZUN A;  4MGY E;  3PRZ A;  1V6E A;  1UH6 A;  3PRP B;  3VHT C;  1VD2 A;  1BT0 A;  2EKE C;  2WWZ A;  1PQS A;  2MBB B;  5KHQ A;  2IO0 B;  2UYZ B;  1K8R B;  2PE6 B;  2WX0 A;  2FCN A;  3ZRF A;  2CU1 A;  2KJH B;  3H9D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...