3RUIB

Crystal structure of atg7c-atg8 complex
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
113
structure length
113
Chain Sequence
TFKSEYPFEKRKAESERIADRFKNRIPVICEKAEKSDIPEIDKRKYLVPADLTVGQFVYVIRKRIMLPPEKAIFIFVNDTLPPTAALMSAIYQEHKDKDGFLYVTYSGENTFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin-like modifier-activating enzyme ATG7
publication title Insights into noncanonical E1 enzyme activation from the structure of autophagic E1 Atg7 with Atg8.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ligase
total genus 30
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2011-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3ruiB00
2PE9A 5D6JB 3B1LX 3L54A 1I35A 4BKSD 2B3AA 4HDOA 3TCAA 4ANXA 4II2B 2IYDB 2V3SA 2N9PC 2L00B 3H7PB 5D2MB 4MSQB 5HKHA 2MSED 5J17A 5JHAA 2AL3A 1WGGA 2O2VB 4MDKE 3Q3FA 3RZWC 3AXCA 3HM3A 3QAQA 3ML9A 4W9IA 4XC2A 3SU8X 4HXDA 2WYQA 2CHZA 2L7RA 2WWZA 4A3PA 1G6JA 2R2QA 1WGYA 4LJOB 3ZRFA 1V86A 4A3OA 1R4MI 2D3GA 4LCDE 5JHBA 2MBOA 3LJ3A 1UBQA 3VTWA 3PVLA 2GBKA 2D10A 1XQQA 2LGDA 1WJ6A 1QZEA 3DBHI 4GDLB 2DZIA 4PYUA 1J8CA 3JVZX 4IW0A 1V9JA 1WZ0A 1OTRB 3I3TB 2JRIB 4G3XB 2BF8B 4IWQA 1KOTA 4K7WA 2VRRB 3MJWA 4TV3A 4ANWA 5CHFA 2BWES 4AJYB 3A9JA 2XEWA 4G11A 2JZZA 1P98A 2DAFA 3X0WA 3T9LA 1TZ1A 1WE7A 2JUOA 3R66C 1TGZB 2LXCA 3QCAA 3L10B 2Z59B 2KFJA 4WWOA 1GG3A 2DYMA 2KK8A 3KUZA 3RYTA 2WX1A 4W9GA 4KVGB 2KXJA 1WM2A 2G4DB 2NCNA 2RSUA 1YQBA 2RD0A 2A5UA 2V4LA 2KVRA 2MRPA 4ZYNA 2PE6B 4NJ7A 4DK5A 1VD2A 3PZDA 1CMXB 2DYOA 3JYUA 4IM3A 3GZNI 2K39A 3RZFA 3V61A 2ZPNA 4EFOA 3WA0A 4MJSB 3WANA 4KZCA 1UELA 2KQ7A 4MEMA 2K8BA 4GU2A 3PRMB 2LVPA 4W9HA 3N3KB 3DCGA 3IBEA 1WXMA 4GN1A 4URKA 4M8MA 5BO4B 2EMSA 2KJRA 4KDIC 2KC2A 3IG3A 1BT0A 2K1FA 5DPRA 3DQVA 4XZ4A 5AEKB 1SGHA 2M8SA 1WXSA 4W9LA 2PPHA 4M0WB 3H6NA 3N32A 1S1QB 2CKHB 4WWPA 1D3ZA 1LM8B 2KWCA 1V5TA 3TMPB 1A5RA 2MCNB 4BFRA 3DVNU 3KW5B 2I1JA 1GUAB 4BOSC 2OOBB 3ZNGC 2LD9A 3PPAA 1RAXA 3BY4B 3APCA 4N9F4 4ZRIA 1GNUA 2ZZPB 2KTRB 4FLHA 5CHVC 3PV1A 3R3MA 5KHQA 4WQOB 2KDEB 1UGMA 2MQJA 1P1AA 4EZLA 4PYZA 4X57B 4K7SA 4IM2A 4OVVA 4MGZE 2HD5B 2RR9A 4ASWC 2KDFB 2I1KA 2M4NA 2BYFA 2NS5A 2V1YA 2ZEQA 4FA6A 3TIXA 2KDBA 2NR2A 1YX5B 3CSTA 4MSMB 5E6OA 3B0AA 3EC8A 4AP4C 5E6NA 3A1QA 3HIZA 3DVGX 4ANUA 3T8MA 3JW0X 1WZ3A 3APDA 1R4NI 2REXA 3UINB 1SE9A 1WXVA 3MTNB 3A9KB 2N9EB 4MM3A 2ZJDA 3WIMA 4IC7B 3NZUA 3VDZA 4A20A 4BOZB 1RLFA 3A9KA 4TQ0A 3W1SA 3ZUNA 3VFKA 3VUYA 3DBSA 3UIOB 5JH5C 1RFAA 2M1MA 4FJZA 4W9KA 2IO1B 3DVNV 3VXWA 1WJNA 4KIKB 2KO3A 3AULA 1WX9A 4G0NB 4JL9A 1YD8U 2IZVB 1T0YA 2WX0A 2JWZA 2NVUI 4NY0A 3ALBA 3H7PA 1Q0WB 2N9XA 2NBUA 2O2VA 4FBJB 2N4FA 3OAWA 1WJ4A 1WRDB 5CHWA 2GBNA 3VHTC 4NNJB 3R7QA 3GOEA 1WX8A 3QARA 3RCZA 2FNJB 2DAJA 2LXAA 4K1RB 4JGHB 3QJZA 4FADA 3ZW3A 2CU1A 2DENB 2JPHA 2L3ZA 3MHSD 4WWNA 2FCNA 2DHZA 5DPWA 5AZGA 2OJRA 2LJ5A 4B6WA 3HHMA 4DHJB 1LFDA 4F1SA 1IP9A 3QC8B 2G45B 2KWUB 4RMAA 2Z0DB 1WXAA 1GJZA 5CX3A 4ZRKA 1KJTA 2XBBC 1WR6E 4GDLA 3RT3B 4JIOU 2L0TA 2MP2B 2ZNVB 4II3B 3CF6E 1F9JA 5E6PA 2FIDA 1L2NA 3SHQA 3CSFA 2LWPA 5G55A 3H9DA 2LVOA 1WGRA 2MP2A 3ZO5B 2O6VD 1X1MA 4ICVA 1GC7A 2C7NB 2DYBA 4WJNA 2KJHB 4GDKB 4AOFA 2GMIC 4EOYA 2CHXA 2GBMA 1Q1OA 4GGQA 1WMHB 5L95C 3UIPB 1PQSA 1WFYA 2R2OA 4GDKA 2DZMA 4ZRJA 4LDTB 1GC6A 5GMVA 3PHWB 1M94A 4I6LB 4FULA 1Z5SB 4PS7A 1I42A 2GBJA 3HM6X 1WMHA 5EDSA 1V81A 3U30A 2FUHB 2ZCCA 4ICUA 3HK0A 2KC1A 3M95A 4AWJA 4RM9A 2C9WB 2JVCA 2BWFA 3P2BA 2K8CA 5C23A 3NS8A 2GBRA 4MGYE 4WJQA 1V2YA 2LZ6A 4K7UA 2ZPYA 5TR5A 1WH3A 2HE7A 2M0XA 3W1SC 3L17A 4MJSA 3PSEB 4MELA 5AZFA 4HLEA 2BGFA 4IWOA 2IO0B 4KSLC 3NOBA 1EF5A 1UD7A 3U8ZA 4KSKC 2G4SA 1WX7A 4HPLB 2LVQA 3WALA 2MBEA 1E8XA 3A4SC 3K9PB 4M8NA 2DZJA 2N7DA 1WE6A 2DZKA 1WGHA 3PLVA 3N30A 2IY1B 4YL8A 3L08A 2ASQA 4AUQC 2C7MB 3PGEA 4W9DA 3ZDTA 2QHOA 3ZLZA 1JRUA 3VVWB 3VUXA 4GMVA 1ZKHA 4HCNB 2JT4B 2LGXA 2ZVNA 5FR6A 3VAWA 3IHPC 3KH0A 1KM7A 3VTUA 3RD2A 2GOWA 4JQWC 2MA9B 4IWPA 3VUWA 1RRBA 1TBEA 4MH0E 4BVUC 1P3QU 2KTRA 2J0MA 4NJ6A 4EZKA 1ISNA 4IUMB 2MLBA 4I6PA 4JLCA 3UGBB 1XD3B 2KLGA 4W9JA 2KWVB 3EHVA 2MBQA 2AWTA 4XX5A 2FCQA 5D7GA 1HE8A 3AU5A 1V49A 2LGYA 3APFA 3KVFB 5L83A 3S2AA 1L7YA 3PTFC 3UQAA 3SD5A 1H4RA 1WIAA 1WYWB 5DPSA 5DCNA 2YLMA 3RULA 1OEYJ 4GIVA 4NAWB 2KOXA 3A4RA 2CR5A 2W9NA 3AI5A 1NDDA 3M63B 1TTNA 2XK5B 4NAWA 2AL6A 3DVGY 4EEWA 1WY8A 2NBWB 1WI0A 3H1UA 3ZKJC 1WGDA 3VH3B 2L8JA 4NQLB 1OEYA 4FN2A 4KV2A 2JZ3B 4P7IA 1EF1A 3EFUA 1AARA 3AU4A 4HCPB 4WJOA 4GOCA 4TUUA 2NPTB 4NQKE 2WDTB 3NHEB 4CHKA 3O65B 3PT2B 3QWZB 5C1ZA 2FAZA 2KX3A 3NZSA 4IG7B 4KIKA 3V60A 4DXAB 4EKUA 3PREA 3R7RA 2IO2B 2D2QA 2M17A 3OLMD 2JY6A 4MGIE 1OGWA 2L05A 3UQBA 3QQ8B 2FCMA 4HPMB 3ZDMC 3L0WB 3W1YA 1E8ZA 2N1WA 3OJ3A 2BYVE 2MBBB 3TL5A 4DWFA 1SIFA 3VQIA 2LUEA 3ZVVA 3A33B 2KQSA 2L0FA 4NPNA 2JXXA 3QX1A 1Q5WB 3U7DA 4AJWA 1LXDA 4EZJA 2A4ZA 1IYFA 2FIFA 2J0JA 2MBHA 4TKNA 3ZNID 1KLVA 2KZRA 4W9EA 2BKRB 4HWIB 3SDLC 3B08A 2EKEC 1OQYA 3ZNHB 4WJPA 3L13A 4DDID 4FHKA 3VH4B 3KYCD 4DHZE 4WAAA 1P9DU 5DPTA 3K9OB 4E74A 2MW5A 4BKTA 1C1YB 2IY0B 2KD0A 1E7UA 4GB9A 4B9KA 3OJ4B 3PRZA 3ONSA 3WAMA 3V6EB 3A9JB 4J6IA 3QHTA 2C5LC 2KHWB 3KUDB 1LQBA 2LRWA 2Y5BB 2BPSA 3ECIA 3DOWA 3BINA 5CTRC 3TBLD 3KYDD 4W9CA 3QIJA 3PS6A 1H8CA 4KZ0A 4DHZB 3V62A 2K25A 2KKCA 2UYZB 4B95A 2KDIA 2JRHA 3V6CB 4F8CB 2D11A 3NY5A 4HVBA 2K8HA 4E71A 5LLIA 1YIWA 4BKSA 3KUCB 2KMAA 2BYEA 3UF8A 2HTHA 3QK0A 1Z2MA 3X23A 2EMTA 1E8YA 5AZHA 3ENEA 3IVFA 3M3JA 3VTVA 1V5OA 2RGFA 4EUTA 1V6EA 2MWSB 1U4AA 2K6QA 3CMMB 4FJVB 2PEAA 4FHJA 2KJ6A 2Z0EB 1FXTB 2MX2A 4BBNC 4ZDVA 2KNBA 3ML8A 4PS8A 4DBGA 2KLCA 4RM8A 5LXIB 3TJPA 1P0RA 3DDCB 1E5WA 2CS4A 4FJYA 4MGKE 5D94A 3H7SA 2KX0A 2RPQA 4TQ1A 3DPDA 3WAOA 1YX6B 2C7HA 2NBVB 1E8WA 5J18A 1UBIA 2N7EA 5J2RA 2KFKB 4DDGD 2KMCA 2DX5B 2LRUA 4PS3A 2LASA 1J19A 1ZW7A 3PRPB 4IM0A 1V80A 3L16A 1VCBA 3C0RB 2J0KA 2ZVOA 3D32A 2KFKA 4BKGA 2O6VB 1C3TA 4HDQA 2HJ8A 1ZGUB 4LJPB 2AYOB 2BKFA 2ZNVC 2ZCBA 2IBIB 2O6VA 3JSVB 5JZEB 2K6DB 1NBFC 4W9FA 3Q3JA 3EECA 2KTFA 3PLUA 2C60A 1MG8A 1XT9B 4HJKA 3RUIB 4DHJD 5IA7A 1Y8RC 4K81A 2D07B 3JSVA 4F7ZA 1IPGA 1NI2A 1E7VA 1UH6A 3DBRI 2UWQA 4GXBA 4OVUA 1WR1A 2AEHA 4G50A 5KHOA 1WJUA 4KDLB 3PHXB 1UZXB 2XK5A 3ZNZB 3ZTDA 2CHWA 4E3CA 1J0GA 2KANA 1YJ1A 3A1QB 3QA8A 5LXHA 4CYEA 2IO3B 3IFWB 2L76A 4HK2A 2G3QB 3M62B 2N1VA 3LDZE 2J7QB 2LI5A 4LDTD 3DBLI 2FCSA 1E90A 2JF5A 2NPTA 3ZIMA 4I6NB 1EO6A 2PJHA 5IAAC 3WAPA 1WM3A 1WF9A 4GSWA 5G2NA 2YVCA 2KN5A 4CO7A 4ANVA 1K8RB 1EUVB 1S3SG 4BBNF 3ZRCA 3ZTCA
chains in the Genus database with same CATH superfamily
4LNNA 2B3AA 4HDOA 4TMAB 4RH6A 4ANXA 4II2B 2N9PC 5D2MB 1C76A 1K50A 2O2VB 1PGAA 4MDKE 3Q3NC 3VR9B 4W9IA 4HXDA 3RPFC 2SEBD 2CHZA 3Q8EA 2R2QA 3TEZA 3ZRFA 4P1BC 2D3GA 1TIFA 2LGDA 3ABVB 2DZIA 3JVZX 2M19A 1SE2A 2NMQA 1OTRB 2JRIB 5G5HA 4A9AA 3MJWA 4G11A 2JZZA 1P98A 3P4QB 1XEEA 4XGAB 3CIRB 3L10B 3GB1A 1KH0A 2KK8A 3RYTA 3HVDA 1TKEA 4KVGB 1WM2A 2NCNA 1TKGA 2MRPA 4ZYNA 3JYUA 1B1ZA 3H8HA 3V61A 1VJKA 2RDHA 3NVVA 1WXQA 1UELA 4MEMA 5G5GA 4GU2A 3N3KB 2ONQA 1WXMA 4URKA 1D4BA 4A8XC 1TS2A 1YMHE 1FRDA 2W82A 3AEDB 5AEKB 1WXSA 2BTEA 4H2AA 2KT7A 4M0WB 1R7SA 3H6NA 1S1QB 2XN9C 2CKHB 2V3PA 1V5TA 1A5RA 2MCNB 4C56C 2I1JA 3ZNGC 2GI9A 3APCA 1GNUA 1D5ZC 1UGJA 1UGMA 2MQJA 1SIJA 4K7SA 4MGZE 3IXSA 2M4NA 2V1YA 2ZEQA 3CSTA 4MSMB 4XDDA 3EC8A 4AP4C 1FNVA 4ANUA 3T8MA 3JW0X 1L5PA 1F1HA 1K51A 1SE9A 4IOIE 2B76B 1SJED 3AMZA 5AUKA 1RLFA 3A9KA 2QMTA 3W1SA 3VR8B 2WS3B 1QF6A 3VUYA 3UIOB 5JH5C 1RFAA 1BUIC 4W9KA 1OQQA 1VZ7A 1XLOA 2KVZA 4JL9A 1T0YA 1YN4A 5BYSA 1ACCA 2Y5PA 1YJJA 2N4FA 1ENFA 1WJ4A 5CHWA 2GBNA 4AQ7A 2WXOA 3TSSA 4NNJB 3RCZA 2FNJB 4JGHB 2CU1A 2DENB 2JPHA 3P4SB 2WXRA 5DPWA 5AZGA 1IP9A 3HHMA 1C77A 2IGGA 4DHJB 3QC8B 1C79A 5IOIA 1WXAA 2JXTA 1KJTA 1WR6E 3RT3B 4JIOU 4II3B 4XYCA 1F9JA 3CSFA 1X1MA 3AB5A 1V97A 4NJCA 1V1PB 2YEPB 4RNAA 2G9HD 1WMHB 5L95C 1WFYA 1JROA 2R2OA 1V1OA 4PS7A 5D3DA 2RMMA 1JRPA 3HM6X 3PZ8A 1V81A 2E6XA 4KX6B 4O1NA 2N9KA 5HHDG 2JVCA 2BWFA 2K8CA 4MGYE 4WJQA 2V3NA 2JU6X 2M0XA 5AZFA 4HLEA 1T5XD 2TSSA 1EWYC 2LVQA 2LGSA 1V8CA 1Y56A 3FC4A 2DZJA 1WE6A 1WGHA 1FFUA 2KAJA 3MP9A 4W9DA 3PGEA 4RGTA 1JRUA 3IAS1 2OJWA 2JT4B 3VAWA 3IHPC 3VTUA 3Q6BA 2LGIA 2K22A 4R3DA 1PFDA 1TBEA 3AE1B 2KTRA 4NJ6A 4JLCA 3UGBB 1XD3B 2KLGA 5IP4D 3EHVA 2MBQA 4ITKA 3S2AA 2W55A 4ZHOA 2HJ1A 2GB1A 5MPOA 2YLMA 4RCOA 1QOFA 4NAWB 3IAM1 2W9NA 3N1XC 2WXGA 3Q14C 1WY8A 3LXFA 1WGDA 2WXFA 4YTNB 2L32A 4USAA 3AU4A 3NUHB 2VH2A 4HRSA 4NQKE 2IGHA 4CHKA 1VRAB 3MC9A 2KX3A 3NZSA 4KIKA 5HI1A 4DXAB 4S0RA 2JYEA 4YSYB 2IO2B 3UQBA 4LK0M 3ZDMC 2N1WA 1CJEA 3AEGB 4DWFA 3ZVVA 4C00A 3A33B 4ZHPA 2L0FA 3QX1A 1Q5WB 4AJWA 3U7ZA 2J0JA 1E10A 2VZKB 2EKEC 2M0AA 3L13A 1R4NB 3K9OB 1GB1A 5IO9A 3I9V1 2MW5A 1HA5A 1C1YB 2L83A 5BMGA 4B9KA 3OJ4B 4KKIA 5T8IA 1J7BA 3ONSA 3WAMA 3EUB2 3V6EB 2M56B 3QHTA 1LQBA 3MHZA 4BZAA 3AEEB 1IGCA 2K25A 5HG2A 2UYZB 2D11A 2LHEA 1MJDA 1YIWA 1I4HA 3UF8A 4PK1A 1L4ZB 4ZRQA 2K6QA 3CMMB 4ZRPA 2Z0EB 2MX2A 1JQ4A 4MGKE 2KX0A 4TQ1A 3BYYB 2D3CA 1YOVB 2N7EA 1QQRA 5GXGB 4IM0A 2BW2A 3L16A 1VCBA 2J0KA 2O6VB 4HDQA 3HUIA 2BKFA 3T3OA 2ZCBA 3JSVB 5JZEB 1JWSD 1NBFC 3EECA 2C60A 1MG8A 4DHJD 4XWWA 5IA7A 3O13A 2D07B 2MJ3A 3Q8BA 4K81A 2WXQA 1AN8A 5EE3A 2KACA 2UWQA 4OVUA 4JX1C 2AQ3B 3PHXB 2CHWA 1YJ1A 3A1QB 4KKJA 3QA8A 1SSNA 1WGKA 2IO3B 2K9XA 3LDZE 1XCQL 3DBLI 2GRIA 1EO6A 2WXMA 2FUG1 4CO7A 1K8RB 4ASWC 3ZRCA 3ZTCA 1I35A 2IYDB 3H7PB 4MSQB 5HKHA 1WGGA 3Q3FA 1EWCA 4P1CC 3HM3A 3QAQA 3SU8X 1VZ8A 5C3JB 3Q3MC 2BBCA 2EELA 1KLUD 3PVLA 1FPYA 1QZEA 2G1EA 3DBHI 1J8CA 4JWSC 1WZ0A 4LNFA 3ETRA 2BF8B 4IWQA 1KOTA 4AJYB 1NYQA 1TS4A 2XEWA 2JYTA 4ACFA 1WE7A 3R66C 1TGZB 2LXCA 3QCAA 2WU5B 2D5GA 1FXIA 2KFJA 2BS2B 3T3NA 4W9GA 2RSUA 2A5UA 2JX5A 4NJ7A 3PZDA 1I4PA 3AE2B 3GZNI 3RZFA 4EFOA 4MJSB 3WANA 3V05A 4KZCA 2KQ7A 1FNWA 4W9HA 2BB5A 2EMSA 2WGSA 2KC2A 5DPRA 3EFCA 3OWEB 2X38A 1N63A 4M01A 4WWPA 3MC8A 4M0WA 4BFRA 4BOSC 2N7JA 4LTUA 3PPAA 3BY4B 4N9F4 2ZZPB 4IDIA 5LNK1 3R3MA 4WQOB 1HZ6A 2VZKD 3E56A 1P1AA 1Q10A 4EZLA 1QOAA 1XXGA 4IM2A 4OVVA 1MFWA 4GLSC 2I1KA 3RN9C 2BYFA 1L0YB 2RDBC 3TIXA 3B0AA 4OHJA 3DVGX 1FCCC 1JMLA 3APDA 2REXA 2WDVB 1UNSA 4MM3A 3WIMA 4IC7B 4A20A 3VDZA 1F52A 2V9HA 3Q2AC 4B0EA 4DXGA 2M1MA 1YNTE 3RNBC 3VXWA 4EE2A 2BS3B 2KO3A 2IZVB 2JWZA 4JPSA 2WXIA 2NBUA 4YSXB 2DNFA 2BYTA 3QARA 3Q8CA 1XLPA 2L3ZA 2OJRA 4F1SA 2G45B 2KWUB 4RMAA 2N0SB 1WRIA 3N1YC 4ZRKA 3ZXVA 2XBBC 4GDLA 2I2YA 5E6PA 2FIDA 5G55A 1WGRA 2O6VD 3DHHC 5E6JA 1ZXHA 1SE4A 2DYBA 2KJHB 1IGDA 1MG4A 1Q1OA 4GGQA 1L0VB 3UIPB 2DZMA 4LDTB 4FULA 1I42A 2GBJA 1WMHA 5EDSA 3U30A 1WWTA 3RNCC 2MEKA 3PZ7A 2HE7A 2LEKA 1ET6A 3L17A 3PSEB 1HXYD 3P4RB 1EF5A 1FD6A 3AE6B 3I57A 3BIID 2G4SA 4HPLB 3WALA 5TSSA 3FILB 3DHIC 1E8XA 3PO0A 1ET9A 1PGXA 2MJEA 2N7DA 1WSPA 3N30A 2INPE 1EU4A 1MHHE 4N59A 4AUQC 2WQYB 3ZDTA 1E7PB 2QHOA 4ZOHC 3URYA 1ZKHA 2ZVNA 2KMMA 2V0GA 2GOWA 4UDUC 1P3QU 3NVYA 2J0MA 4EZKA 2MLBA 4I6PA 1NENB 1C78A 4XX5A 2OEDA 2AWTA 3GE3C 4MACA 4WAFA 1V49A 1BMLC 1ZDXA 3APFA 3KVFB 5L83A 3AEFB 1IBXB 4GIVA 1YN5A 1KFYB 1VDVA 4NAWA 3MJ5A 3VH3B 4FN2A 1FM0D 3AN1A 4GOCA 4TUUA 2NPTB 3SR6A 2WDTB 1PGBA 3QWZB 3PT2B 2W3SA 2FAZA 2SAKA 3BVZA 2M17A 2JY6A 2L05A 3W1YA 1BXTA 1E8ZA 3OJ3A 2BYVE 2MBBB 3TL5A 1SIFA 3VQIA 2LUEA 3TEYA 2KQSA 2E3TA 3RNFC 2JXXA 1TY0A 4RGMA 2A4ZA 1F2RI 1FEHA 4TKNA 1JALA 3ZNID 3B08A 2QC8A 4DDID 4DHZE 4WAAA 1P9DU 4E74A 2KD0A 1E7UA 2WLBA 1KTKA 4WIPA 3PRZA 3AE3B 1N62A 1QKZA 2YEPF 3ECIA 1T3QA 1SB3C 3Q8FA 1K52A 1PUTA 1ZE3D 3R2TA 1KRHA 3J9CA 4DHZB 3V62A 4REZA 2JRHA 4F8CB 3NY5A 2K8HA 1GPXA 3VRAB 3QK0A 2V4IB 3X23A 5IKCM 2QSDA 3ENEA 2RGFA 1TYGB 1V6EA 2K5PA 1MHXA 2JQRB 2PEAA 4FHJA 2DBYA 2LJIA 2BT6A 4BBNC 1C4PA 3ML8A 1ZPSA 2ZW0A 5LXIB 3H7SA 2L52A 2RPQA 2WP9B 3DPDA 2NBVB 1E8WA 2ACZB 5J2RA 2KMCA 2LRUA 1ZW7A 3C0RB 1C3TA 3D32A 1VR9A 2FE8A 2HJ8A 1ZGUB 1ZOYB 3NS1A 2IBIB 2O6VA 1SEBD 4A90A 2K6DB 4W9FA 3Q3JA 1ZXIA 1ZP0B 4HJKA 3RUIB 3L4PA 4LNOA 3JSVA 1UH6A 3DBRI 1OQRA 1HQRD 1WR1A 4US9A 1TZOA 1UZXB 2XK5A 3ZTDA 1J0GA 4CYEA 3IFWB 4WH4A 2G3QB 3RFZB 4LDTD 4I6NB 2PJHA 1WM3A 4P16A 4GSWA 5G2NA 2PVOD 2GLSA 3P1MA 2CJOA 1EUVB 1S3SG 2PE9A 3B1LX 3L54A 4BKSD 3TCAA 4MH8A 2MH7A 2V3SA 5JHAA 3AE7B 1I4RA 4XC2A 2WYQA 3SFEB 2KDMA 4A3PA 1G6JA 1RWSA 1V86A 1R4MI 4LCDE 4A55A 3VTWA 2PLPA 2D10A 4HKQA 2ZW1A 1MI0A 1HEZE 1DYQA 4K7WA 2VRRB 3AE4B 4ANWA 4ARCA 5CHFA 3A9JA 2DAFA 3X0WA 3T9LA 1FNUA 2JUOA 4ARIA 4LNIA 4WWOA 1GG3A 2KXJA 4K3CA 1YQBA 2MHJA 2RD0A 4QAYA 4YT0B 2DYOA 4IM3A 2INDC 3WA0A 2K8BA 3RMKC 3PRMB 2LVPA 4L2YA 3DCGA 4M8MA 1LO5D 2QDFA 5BO4B 2KJRA 4KDIC 4LLGM 2K1FA 3DQVA 4XZ4A 2KQ4X 2M8SA 4MT5A 3N32A 1FMAD 1I4GA 3ZJVA 1D3ZA 3BVGA 1LM8B 2KWCA 2JWUA 3W5UB 3TMPB 3W9CB 5HFYA 1GUAB 2OOBB 2LD9A 2KTRB 4FLHA 1ESFA 2KDEB 4PYZA 4X57B 2LHDA 4YWGG 2OHFA 2KDFB 4FA6A 2WXJA 2NR2A 1YX5B 1PDXA 2QJLA 1C4AA 4C80A 1WXVA 1SBBB 3MTNB 4NZLB 1TJEA 2R61A 3NZUA 4BOZB 3UI3A 3DWMA 3ZUNA 3VFKA 2CU3A 4WQMA 4FJZA 4KIKB 1FRRA 1WX9A 1YD8U 3AM9A 2WX0A 2NVUI 1Q0WB 1UF0A 2O2VA 4XDCA 2J42A 4FBJB 3OAWA 5BMHA 4N6EB 3N20C 1WYGA 1WX8A 2J53A 4WWNA 2FCNA 2DHZA 2LJ5A 1D5XC 3NVZA 2Z0DB 2L0TA 2MP2B 1L2NA 3KWLA 3ZO5B 3U4EG 2LUMA 4ICVA 1GC7A 2C7NB 4GDKB 2GMIC 3KWVA 3IT6B 1TT5B 1GC6A 4JWUC 1M94A 4I6LB 1L6UA 2FUHB 2ZCCA 4RM9A 2C9WB 3NS8A 4HJGE 2W54A 4PT5A 3TUOA 1V2YA 2BS4B 2LZ6A 3P42A 4K7UA 3W1SC 4MELA 3NOBA 3U8ZA 1UD7A 1WX7A 1I7HA 2MBEA 1TS3A 3A4SC 3K9PB 4BAXA 2WNMA 1UUPA 3DBHB 1VZ6A 3GE8C 2IY1B 1EM7A 4YL8A 2IJ0A 2C7MB 2INCC 3VUXA 4GMVA 3OG5A 1L6VA 1A70A 5FR6A 1KM7A 1D5MC 2J4XA 2MA9B 3N1ZC 4IWPA 4JQWC 3Q3OC 3ZJTA 1ISNA 4IUMB 1T6BX 4W9JA 2KWVB 1HE8A 3AU5A 2WHIA 3DWGC 1AWDA 3PTFC 3SD5A 3AE5B 1H4RA 3GZNB 2ICIA 5DPSA 3RULA 1OEYJ 2KOXA 3A4RA 1T0SC 3AI5A 1NDDA 1JCKB 1TTNA 2AQ1B 2AL6A 2NBWB 3H1UA 1WI0A 2WDRB 2XNAC 3BK2A 1EF1A 4HCPB 4WJOA 1OFFA 3B2GA 4YSZB 3ZGZA 2QEJC 1YN3A 3HRDD 1T0QC 3O65B 1GOZA 4EKUA 1HTQA 3PREA 3R7RA 2D2QA 3OLMD 2FCMA 4HPMB 3L0WB 3R2IA 1RFKA 1CZPA 2QIEB 3TEXA 1XLQA 4P6VF 3U7DA 1I4QA 4EZJA 3W2DA 3ZYYX 1B9RA 2FIFA 2MBHA 3P63A 2KZRA 4W9EA 4HWIB 1CK1A 1OQYA 4WJPA 3SFDB 2H88B 4BKTA 2IY0B 4YXDB 1E0ZA 2Y5CA 3W5VB 2RDGA 1SXTA 1V1PA 2EKIA 5AUIA 2C5LC 2KHWB 3KUDB 3DHGC 4OZAA 2Y5BB 2FBWB 3DOWA 1ZUD2 3C19A 1E9MA 2LFIA 2KKCA 4B95A 3V6CB 4DQOC 4HVBA 1DOYA 5LLIA 3KUCB 2BYEA 2EMTA 5AZHA 3M3JA 1C4CA 3MC0B 1YQ3B 4FJVB 2KJ6A 2QCZA 1FXTB 1JW9D 2N9LA 1UWXA 2KNBA 4CQNA 4PS8A 4DBGA 2Y3AA 5FKAC 1KF6B 4RM8A 1MPEA 1UWMA 3DDCB 4KGTA 1E5WA 2DWQA 1N60A 1F77A 5J18A 2KFKB 2NTTA 4DDGD 4PS3A 2LASA 3AE9B 3PRPB 5JXVA 4C4VB 1V80A 3Q69A 2AYOB 4YTPB 5I4DA 1HTOA 1P7FA 3PLUA 1XT9B 1AYFA 1Y8RC 1SE3A 1IPGA 1NI2A 1N6ZA 2AEHA 1E6EB 1ZDVA 2L1AA 4KDLB 2PTLA 3SEBA 3M62B 4A6QA 4MM3B 2N1VA 1QOGA 2J7QB 2LI5A 2FCSA 4C7ZA 3ZIMA 4DXFA 3WAPA 5IAAC 3KLSX 2YVCA 1D6EC 3RNAC 5D6JB 5EE0A 1QLBB 1TS5A 2L00B 1T0RC 2MSED 4FXCA 4RF1A 5J17A 2AL3A 4N58A 3VRBB 3RZWC 3AXCA 3GP7A 3ML9A 2KN4A 3B9JA 2L7RA 2WWZA 2H89B 1WGYA 4LJOB 4A3OA 5JHBA 2MBOA 3LJ3A 1UBQA 2GBKA 2LMCA 1XQQA 2PKOA 1WJ6A 4GDLB 4PYUA 4IW0A 1V9JA 2IDYA 1SJHD 1CQVA 3I3TB 3NG0A 4G3XB 1K53A 4TV3A 4HKZE 3RI7C 2BWES 1FFVA 1FO4A 1TZ1A 2NTSA 5BMIA 4YTMB 3NZ3A 1QILA 4ZYSA 2Z59B 2DYMA 3KUZA 2WX1A 5EE1A 2WXLA 1ROEA 2G4DB 3NVWA 2V4LA 2KVRA 3U2SC 2PE6B 3NJTA 1VD2A 3AV8A 4DK5A 1CMXB 2PIAA 5IN7A 3IT4B 2K39A 2ZPNA 2WDQB 5FK9C 3LYYA 2D3BA 1NEKB 1DOXA 3IBEA 1NVID 4GN1A 1GB4A 1QOBA 2INNE 3IG3A 1BT0A 1MVKA 1SGHA 4W9LA 4WURA 2PPHA 3AEBB 3V3XA 4HEA1 2PVGC 3DVNU 3KW5B 4RGOS 2WU2B 1RAXA 4ZRIA 5CHVC 3PV1A 1F0ZA 5KHQA 5C2TB 2MJDA 4NAMA 5BYQA 2HD5B 4JE3B 2RR9A 3TEWA 2NS5A 2I38A 3B2FA 1P7EA 2KDBA 4Q2JA 5D3IB 5E6OA 3NRZA 2QILA 5E6NA 1TKYA 3A1QA 3HIZA 1N5XA 3ZQ4A 3R8BA 1WZ3A 1R4NI 2WXHA 3U52E 4HPPA 3UINB 3A9KB 2N9EB 4XE0A 2ZJDA 5BYRA 4TQ0A 3EGRA 3FAHA 1XO3A 3DBSA 1JWMD 1TY2A 2K0PA 1EU3A 2IO1B 3DVNV 1WJNA 3AULA 4G0NB 1JWUD 4NY0A 3ALBA 3H7PA 1PYWD 3GS2A 2N9XA 3WCQA 1FIQA 1WRDB 3VHTC 3R7QA 3GOEA 2DAJA 1DOIA 2LXAA 4K1RB 3DBRB 3QJZA 1KLGD 4FADA 3ZW3A 3MHSD 1LGRA 4B6WA 1LFDA 1AW7A 1GJZA 1I4XA 5CX3A 2PW9A 2ZNVB 4M00A 1N61A 3AECB 3CF6E 3SHQA 2LWPA 3H9DA 2LVOA 2MP2A 3P4PB 2IGDA 4WJNA 4AOFA 2K3UA 4EOYA 2CHXA 2GBMA 2UU7A 1RM6C 1PQSA 4ZRJA 4GDKA 5GMVA 3PHWB 1Z5SB 2BB6A 1N5WA 3HK0A 4ICUA 2KC1A 3ZJUA 3M95A 4AWJA 2D3AA 3P2BA 2WXNA 5C23A 2GBRA 2ZPYA 5TR5A 1WH3A 1VLBA 4MJSA 2BGFA 4IWOA 2IO0B 1L4DB 3RNEC 4KSLC 4KGRA 4KSKC 4L23A 1R4MB 1L0XB 4OZCA 2JSVX 3BVMA 4M8NA 4B0MA 3EA6A 3HVZA 2DZKA 3PLVA 4LNKA 3L08A 2ASQA 1JWAD 2J52A 3CWIA 3ZLZA 3LB8C 2Z8LA 3VVWB 4HCNB 2LGXA 3RNGC 1XCTL 2W3RA 3KH0A 3RD2A 3MFGA 3VUWA 1RRBA 4BVUC 4MH0E 4IKGA 5D7GA 4HROA 2FCQA 4D2KA 2LGYA 1L7YA 3I5JC 3UQAA 1WIAA 1WYWB 5DCNA 4OVZA 2CR5A 2VH1A 3M63B 2XK5B 3DVGY 4EEWA 3ZKJC 2L8JA 4NQLB 1OEYA 4KV2A 2JZ3B 4P7IA 3EFUA 1AARA 1FXAA 1SF0A 4XWTA 1F2RC 3NHEB 1STEA 4L1BA 1JWBD 3Q8AA 5C1ZA 4C7YA 4IG7B 3V60A 2KWDA 4MGIE 4S17A 1OGWA 3BZDB 3QQ8B 3AE8B 2WXPA 1RYJA 4US8A 2WXKA 4NPNA 1LXDA 1IYFA 2Q5WD 4K3BA 1KLVA 2BKRB 3ZXRA 1NYRA 3SDLC 1XF5L 3AH7A 2BQQA 3ZNHB 4FHKA 3VH4B 3KYCD 5DPTA 3DBLB 4GB9A 1GAQB 2AX5A 4AS1A 3A9JB 4J6IA 2LRWA 2BPSA 3BYTB 1IUEA 2BVCA 3BINA 5CTRC 3TBLD 3KYDD 4W9CA 1FCLA 3QIJA 3PS6A 4OW0A 1H8CA 4KZ0A 5H8YE 2KDIA 2ON8A 3KQ4A 4WWMA 1QT9A 4E71A 4BKSA 2KMAA 2HDEA 2HTHA 1YQ4B 1J7AA 1Z2MA 4RF0A 3FKYA 3BK1A 1E8YA 3IVFA 3VTVA 4EUTA 1V5OA 2MWSB 1U4AA 2HTME 3FILA 4ZDVA 4M02A 2KLCA 3TJPA 4TSSA 1P0RA 2CS4A 4FJYA 5D94A 1YJIA 3E9SA 3WAOA 1YX6B 2C7HA 2IPKD 1UBIA 2CJNA 2DX5B 1J19A 1DGJA 4RFBA 2ZVOA 4KGSA 4BKGA 2AQ2B 2KFKA 1M4VA 1C9FA 4LJPB 4C4VA 2ZNVC 4J3OD 2KTFA 5EE9A 4F7ZA 1E7VA 1IBXA 4GXBA 4RGNA 5KHOA 4G50A 5FR3A 1WJUA 4OZBA 3I63C 3ZNZB 4E3CA 2X8XX 2KANA 5LXHA 3BWUD 2L76A 4HK2A 2JZPA 2RPVA 1XLNA 1J7CA 3AEAB 1HZ5A 2JF5A 1E90A 2NPTA 2PMVA 3C8YA 1WF9A 2KN5A 1NI3A 5H92C 3N9YC 2KYWA 2DLBA 4BBNF 4ANVA
chains in the Genus database with same CATH topology
2PE9A 5D6JB 3B1LX 3L54A 1I35A 4BKSD 2B3AA 4HDOA 3TCAA 4ANXA 4II2B 2IYDB 2V3SA 2N9PC 2L00B 3H7PB 5D2MB 4MSQB 5HKHA 2MSED 5J17A 5JHAA 2AL3A 1WGGA 2O2VB 4MDKE 3Q3FA 3RZWC 3AXCA 3HM3A 3QAQA 3ML9A 4W9IA 4XC2A 3SU8X 4HXDA 2WYQA 2CHZA 2L7RA 2WWZA 4A3PA 1G6JA 2R2QA 1WGYA 4LJOB 3ZRFA 1V86A 4A3OA 1R4MI 2D3GA 4LCDE 5JHBA 2MBOA 3LJ3A 1UBQA 3VTWA 3PVLA 2GBKA 2D10A 1XQQA 2LGDA 1WJ6A 1QZEA 3DBHI 4GDLB 2DZIA 4PYUA 1J8CA 3JVZX 4IW0A 1V9JA 1WZ0A 1OTRB 3I3TB 2JRIB 4G3XB 2BF8B 4IWQA 1KOTA 4K7WA 2VRRB 3MJWA 4TV3A 4ANWA 5CHFA 2BWES 4AJYB 3A9JA 2XEWA 4G11A 2JZZA 1P98A 2DAFA 3X0WA 3T9LA 1TZ1A 1WE7A 2JUOA 3R66C 1TGZB 2LXCA 3QCAA 3L10B 2Z59B 2KFJA 4WWOA 1GG3A 2DYMA 2KK8A 3KUZA 3RYTA 2WX1A 4W9GA 4KVGB 2KXJA 1WM2A 2G4DB 2NCNA 2RSUA 1YQBA 2RD0A 2A5UA 2V4LA 2KVRA 2MRPA 4ZYNA 2PE6B 4NJ7A 4DK5A 1VD2A 3PZDA 1CMXB 2DYOA 3JYUA 4IM3A 3GZNI 2K39A 3RZFA 3V61A 2ZPNA 4EFOA 3WA0A 4MJSB 3WANA 4KZCA 1UELA 2KQ7A 4MEMA 2K8BA 4GU2A 3PRMB 2LVPA 4W9HA 3N3KB 3DCGA 3IBEA 1WXMA 4GN1A 4URKA 4M8MA 5BO4B 2EMSA 2KJRA 4KDIC 2KC2A 3IG3A 1BT0A 2K1FA 5DPRA 3DQVA 4XZ4A 5AEKB 1SGHA 2M8SA 1WXSA 4W9LA 2PPHA 4M0WB 3H6NA 3N32A 1S1QB 2CKHB 4WWPA 1D3ZA 1LM8B 2KWCA 1V5TA 3TMPB 1A5RA 2MCNB 4BFRA 3DVNU 3KW5B 2I1JA 1GUAB 4BOSC 2OOBB 3ZNGC 2LD9A 3PPAA 1RAXA 3BY4B 3APCA 4N9F4 4ZRIA 1GNUA 2ZZPB 2KTRB 4FLHA 5CHVC 3PV1A 3R3MA 5KHQA 4WQOB 2KDEB 1UGMA 2MQJA 1P1AA 4EZLA 4PYZA 4X57B 4K7SA 4IM2A 4OVVA 4MGZE 2HD5B 2RR9A 4ASWC 2KDFB 2I1KA 2M4NA 2BYFA 2NS5A 2V1YA 2ZEQA 4FA6A 3TIXA 2KDBA 2NR2A 1YX5B 3CSTA 4MSMB 5E6OA 3B0AA 3EC8A 4AP4C 5E6NA 3A1QA 3HIZA 3DVGX 4ANUA 3T8MA 3JW0X 1WZ3A 3APDA 1R4NI 2REXA 3UINB 1SE9A 1WXVA 3MTNB 3A9KB 2N9EB 4MM3A 2ZJDA 3WIMA 4IC7B 3NZUA 3VDZA 4A20A 4BOZB 1RLFA 3A9KA 4TQ0A 3W1SA 3ZUNA 3VFKA 3VUYA 3DBSA 3UIOB 5JH5C 1RFAA 2M1MA 4FJZA 4W9KA 2IO1B 3DVNV 3VXWA 1WJNA 4KIKB 2KO3A 3AULA 1WX9A 4G0NB 4JL9A 1YD8U 2IZVB 1T0YA 2WX0A 2JWZA 2NVUI 4NY0A 3ALBA 3H7PA 1Q0WB 2N9XA 2NBUA 2O2VA 4FBJB 2N4FA 3OAWA 1WJ4A 1WRDB 5CHWA 2GBNA 3VHTC 4NNJB 3R7QA 3GOEA 1WX8A 3QARA 3RCZA 2FNJB 2DAJA 2LXAA 4K1RB 4JGHB 3QJZA 4FADA 3ZW3A 2CU1A 2DENB 2JPHA 2L3ZA 3MHSD 4WWNA 2FCNA 2DHZA 5DPWA 5AZGA 2OJRA 2LJ5A 4B6WA 3HHMA 4DHJB 1LFDA 4F1SA 1IP9A 3QC8B 2G45B 2KWUB 4RMAA 2Z0DB 1WXAA 1GJZA 5CX3A 4ZRKA 1KJTA 2XBBC 1WR6E 4GDLA 3RT3B 4JIOU 2L0TA 2MP2B 2ZNVB 4II3B 3CF6E 1F9JA 5E6PA 2FIDA 1L2NA 3SHQA 3CSFA 2LWPA 5G55A 3H9DA 2LVOA 1WGRA 2MP2A 3ZO5B 2O6VD 1X1MA 4ICVA 1GC7A 2C7NB 2DYBA 4WJNA 2KJHB 4GDKB 4AOFA 2GMIC 4EOYA 2CHXA 2GBMA 1Q1OA 4GGQA 1WMHB 5L95C 3UIPB 1PQSA 1WFYA 2R2OA 4GDKA 2DZMA 4ZRJA 4LDTB 1GC6A 5GMVA 3PHWB 1M94A 4I6LB 4FULA 1Z5SB 4PS7A 1I42A 2GBJA 3HM6X 1WMHA 5EDSA 1V81A 3U30A 2FUHB 2ZCCA 4ICUA 3HK0A 2KC1A 3M95A 4AWJA 4RM9A 2C9WB 2JVCA 2BWFA 3P2BA 2K8CA 5C23A 3NS8A 2GBRA 4MGYE 4WJQA 1V2YA 2LZ6A 4K7UA 2ZPYA 5TR5A 1WH3A 2HE7A 2M0XA 3W1SC 3L17A 4MJSA 3PSEB 4MELA 5AZFA 4HLEA 2BGFA 4IWOA 2IO0B 4KSLC 3NOBA 1EF5A 1UD7A 3U8ZA 4KSKC 2G4SA 1WX7A 4HPLB 2LVQA 3WALA 2MBEA 1E8XA 3A4SC 3K9PB 4M8NA 2DZJA 2N7DA 1WE6A 2DZKA 1WGHA 3PLVA 3N30A 2IY1B 4YL8A 3L08A 2ASQA 4AUQC 2C7MB 3PGEA 4W9DA 3ZDTA 2QHOA 3ZLZA 1JRUA 3VVWB 3VUXA 4GMVA 1ZKHA 4HCNB 2JT4B 2LGXA 2ZVNA 5FR6A 3VAWA 3IHPC 3KH0A 1KM7A 3VTUA 3RD2A 2GOWA 4JQWC 2MA9B 4IWPA 3VUWA 1RRBA 1TBEA 4MH0E 4BVUC 1P3QU 2KTRA 2J0MA 4NJ6A 4EZKA 1ISNA 4IUMB 2MLBA 4I6PA 4JLCA 3UGBB 1XD3B 2KLGA 4W9JA 2KWVB 3EHVA 2MBQA 2AWTA 4XX5A 2FCQA 5D7GA 1HE8A 3AU5A 1V49A 2LGYA 3APFA 3KVFB 5L83A 3S2AA 1L7YA 3PTFC 3UQAA 3SD5A 1H4RA 1WIAA 1WYWB 5DPSA 5DCNA 2YLMA 3RULA 1OEYJ 4GIVA 4NAWB 2KOXA 3A4RA 2CR5A 2W9NA 3AI5A 1NDDA 3M63B 1TTNA 2XK5B 4NAWA 2AL6A 3DVGY 4EEWA 1WY8A 2NBWB 1WI0A 3H1UA 3ZKJC 1WGDA 3VH3B 2L8JA 4NQLB 1OEYA 4FN2A 4KV2A 2JZ3B 4P7IA 1EF1A 3EFUA 1AARA 3AU4A 4HCPB 4WJOA 4GOCA 4TUUA 2NPTB 4NQKE 2WDTB 3NHEB 4CHKA 3O65B 3PT2B 3QWZB 5C1ZA 2FAZA 2KX3A 3NZSA 4IG7B 4KIKA 3V60A 4DXAB 4EKUA 3PREA 3R7RA 2IO2B 2D2QA 2M17A 3OLMD 2JY6A 4MGIE 1OGWA 2L05A 3UQBA 3QQ8B 2FCMA 4HPMB 3ZDMC 3L0WB 3W1YA 1E8ZA 2N1WA 3OJ3A 2BYVE 2MBBB 3TL5A 4DWFA 1SIFA 3VQIA 2LUEA 3ZVVA 3A33B 2KQSA 2L0FA 4NPNA 2JXXA 3QX1A 1Q5WB 3U7DA 4AJWA 1LXDA 4EZJA 2A4ZA 1IYFA 2FIFA 2J0JA 2MBHA 4TKNA 3ZNID 1KLVA 2KZRA 4W9EA 2BKRB 4HWIB 3SDLC 3B08A 2EKEC 1OQYA 3ZNHB 4WJPA 3L13A 4DDID 4FHKA 3VH4B 3KYCD 4DHZE 4WAAA 1P9DU 5DPTA 3K9OB 4E74A 2MW5A 4BKTA 1C1YB 2IY0B 2KD0A 1E7UA 4GB9A 4B9KA 3OJ4B 3PRZA 3ONSA 3WAMA 3V6EB 3A9JB 4J6IA 3QHTA 2C5LC 2KHWB 3KUDB 1LQBA 2LRWA 2Y5BB 2BPSA 3ECIA 3DOWA 3BINA 5CTRC 3TBLD 3KYDD 4W9CA 3QIJA 3PS6A 1H8CA 4KZ0A 4DHZB 3V62A 2K25A 2KKCA 2UYZB 4B95A 2KDIA 2JRHA 3V6CB 4F8CB 2D11A 3NY5A 4HVBA 2K8HA 4E71A 5LLIA 1YIWA 4BKSA 3KUCB 2KMAA 2BYEA 3UF8A 2HTHA 3QK0A 1Z2MA 3X23A 2EMTA 1E8YA 5AZHA 3ENEA 3IVFA 3M3JA 3VTVA 1V5OA 2RGFA 4EUTA 1V6EA 2MWSB 1U4AA 2K6QA 3CMMB 4FJVB 2PEAA 4FHJA 2KJ6A 2Z0EB 1FXTB 2MX2A 4BBNC 4ZDVA 2KNBA 3ML8A 4PS8A 4DBGA 2KLCA 4RM8A 5LXIB 3TJPA 1P0RA 3DDCB 1E5WA 2CS4A 4FJYA 4MGKE 5D94A 3H7SA 2KX0A 2RPQA 4TQ1A 3DPDA 3WAOA 1YX6B 2C7HA 2NBVB 1E8WA 5J18A 1UBIA 2N7EA 5J2RA 2KFKB 4DDGD 2KMCA 2DX5B 2LRUA 4PS3A 2LASA 1J19A 1ZW7A 3PRPB 4IM0A 1V80A 3L16A 1VCBA 3C0RB 2J0KA 2ZVOA 3D32A 2KFKA 4BKGA 2O6VB 1C3TA 4HDQA 2HJ8A 1ZGUB 4LJPB 2AYOB 2BKFA 2ZNVC 2ZCBA 2IBIB 2O6VA 3JSVB 5JZEB 2K6DB 1NBFC 4W9FA 3Q3JA 3EECA 2KTFA 3PLUA 2C60A 1MG8A 1XT9B 4HJKA 3RUIB 4DHJD 5IA7A 1Y8RC 4K81A 2D07B 3JSVA 4F7ZA 1IPGA 1NI2A 1E7VA 1UH6A 3DBRI 2UWQA 4GXBA 4OVUA 1WR1A 2AEHA 4G50A 5KHOA 1WJUA 4KDLB 3PHXB 1UZXB 2XK5A 3ZNZB 3ZTDA 2CHWA 4E3CA 1J0GA 2KANA 1YJ1A 3A1QB 3QA8A 5LXHA 4CYEA 2IO3B 3IFWB 2L76A 4HK2A 2G3QB 3M62B 2N1VA 3LDZE 2J7QB 2LI5A 4LDTD 3DBLI 2FCSA 1E90A 2JF5A 2NPTA 3ZIMA 4I6NB 1EO6A 2PJHA 5IAAC 3WAPA 1WM3A 1WF9A 4GSWA 5G2NA 2YVCA 2KN5A 4CO7A 4ANVA 1K8RB 1EUVB 1S3SG 4BBNF 3ZRCA 3ZTCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PE9 A;  5D6J B;  3B1L X;  3L54 A;  1I35 A;  4BKS D;  2B3A A;  4HDO A;  3TCA A;  4ANX A;  4II2 B;  2IYD B;  2V3S A;  2N9P C;  2L00 B;  3H7P B;  5D2M B;  4MSQ B;  5HKH A;  2MSE D;  5J17 A;  5JHA A;  2AL3 A;  1WGG A;  2O2V B;  4MDK E;  3Q3F A;  3RZW C;  3AXC A;  3HM3 A;  3QAQ A;  3ML9 A;  4W9I A;  4XC2 A;  3SU8 X;  4HXD A;  2WYQ A;  2CHZ A;  2L7R A;  2WWZ A;  4A3P A;  1G6J A;  2R2Q A;  1WGY A;  4LJO B;  3ZRF A;  1V86 A;  4A3O A;  1R4M I;  2D3G A;  4LCD E;  5JHB A;  2MBO A;  3LJ3 A;  1UBQ A;  3VTW A;  3PVL A;  2GBK A;  2D10 A;  1XQQ A;  2LGD A;  1WJ6 A;  1QZE A;  3DBH I;  4GDL B;  2DZI A;  4PYU A;  1J8C A;  3JVZ X;  4IW0 A;  1V9J A;  1WZ0 A;  1OTR B;  3I3T B;  2JRI B;  4G3X B;  2BF8 B;  4IWQ A;  1KOT A;  4K7W A;  2VRR B;  3MJW A;  4TV3 A;  4ANW A;  5CHF A;  2BWE S;  4AJY B;  3A9J A;  2XEW A;  4G11 A;  2JZZ A;  1P98 A;  2DAF A;  3X0W A;  3T9L A;  1TZ1 A;  1WE7 A;  2JUO A;  3R66 C;  1TGZ B;  2LXC A;  3QCA A;  3L10 B;  2Z59 B;  2KFJ A;  4WWO A;  1GG3 A;  2DYM A;  2KK8 A;  3KUZ A;  3RYT A;  2WX1 A;  4W9G A;  4KVG B;  2KXJ A;  1WM2 A;  2G4D B;  2NCN A;  2RSU A;  1YQB A;  2RD0 A;  2A5U A;  2V4L A;  2KVR A;  2MRP A;  4ZYN A;  2PE6 B;  4NJ7 A;  4DK5 A;  1VD2 A;  3PZD A;  1CMX B;  2DYO A;  3JYU A;  4IM3 A;  3GZN I;  2K39 A;  3RZF A;  3V61 A;  2ZPN A;  4EFO A;  3WA0 A;  4MJS B;  3WAN A;  4KZC A;  1UEL A;  2KQ7 A;  4MEM A;  2K8B A;  4GU2 A;  3PRM B;  2LVP A;  4W9H A;  3N3K B;  3DCG A;  3IBE A;  1WXM A;  4GN1 A;  4URK A;  4M8M A;  5BO4 B;  2EMS A;  2KJR A;  4KDI C;  2KC2 A;  3IG3 A;  1BT0 A;  2K1F A;  5DPR A;  3DQV A;  4XZ4 A;  5AEK B;  1SGH A;  2M8S A;  1WXS A;  4W9L A;  2PPH A;  4M0W B;  3H6N A;  3N32 A;  1S1Q B;  2CKH B;  4WWP A;  1D3Z A;  1LM8 B;  2KWC A;  1V5T A;  3TMP B;  1A5R A;  2MCN B;  4BFR A;  3DVN U;  3KW5 B;  2I1J A;  1GUA B;  4BOS C;  2OOB B;  3ZNG C;  2LD9 A;  3PPA A;  1RAX A;  3BY4 B;  3APC A;  4N9F 4;  4ZRI A;  1GNU A;  2ZZP B;  2KTR B;  4FLH A;  5CHV C;  3PV1 A;  3R3M A;  5KHQ A;  4WQO B;  2KDE B;  1UGM A;  2MQJ A;  1P1A A;  4EZL A;  4PYZ A;  4X57 B;  4K7S A;  4IM2 A;  4OVV A;  4MGZ E;  2HD5 B;  2RR9 A;  4ASW C;  2KDF B;  2I1K A;  2M4N A;  2BYF A;  2NS5 A;  2V1Y A;  2ZEQ A;  4FA6 A;  3TIX A;  2KDB A;  2NR2 A;  1YX5 B;  3CST A;  4MSM B;  5E6O A;  3B0A A;  3EC8 A;  4AP4 C;  5E6N A;  3A1Q A;  3HIZ A;  3DVG X;  4ANU A;  3T8M A;  3JW0 X;  1WZ3 A;  3APD A;  1R4N I;  2REX A;  3UIN B;  1SE9 A;  1WXV A;  3MTN B;  3A9K B;  2N9E B;  4MM3 A;  2ZJD A;  3WIM A;  4IC7 B;  3NZU A;  3VDZ A;  4A20 A;  4BOZ B;  1RLF A;  3A9K A;  4TQ0 A;  3W1S A;  3ZUN A;  3VFK A;  3VUY A;  3DBS A;  3UIO B;  5JH5 C;  1RFA A;  2M1M A;  4FJZ A;  4W9K A;  2IO1 B;  3DVN V;  3VXW A;  1WJN A;  4KIK B;  2KO3 A;  3AUL A;  1WX9 A;  4G0N B;  4JL9 A;  1YD8 U;  2IZV B;  1T0Y A;  2WX0 A;  2JWZ A;  2NVU I;  4NY0 A;  3ALB A;  3H7P A;  1Q0W B;  2N9X A;  2NBU A;  2O2V A;  4FBJ B;  2N4F A;  3OAW A;  1WJ4 A;  1WRD B;  5CHW A;  2GBN A;  3VHT C;  4NNJ B;  3R7Q A;  3GOE A;  1WX8 A;  3QAR A;  3RCZ A;  2FNJ B;  2DAJ A;  2LXA A;  4K1R B;  4JGH B;  3QJZ A;  4FAD A;  3ZW3 A;  2CU1 A;  2DEN B;  2JPH A;  2L3Z A;  3MHS D;  4WWN A;  2FCN A;  2DHZ A;  5DPW A;  5AZG A;  2OJR A;  2LJ5 A;  4B6W A;  3HHM A;  4DHJ B;  1LFD A;  4F1S A;  1IP9 A;  3QC8 B;  2G45 B;  2KWU B;  4RMA A;  2Z0D B;  1WXA A;  1GJZ A;  5CX3 A;  4ZRK A;  1KJT A;  2XBB C;  1WR6 E;  4GDL A;  3RT3 B;  4JIO U;  2L0T A;  2MP2 B;  2ZNV B;  4II3 B;  3CF6 E;  1F9J A;  5E6P A;  2FID A;  1L2N A;  3SHQ A;  3CSF A;  2LWP A;  5G55 A;  3H9D A;  2LVO A;  1WGR A;  2MP2 A;  3ZO5 B;  2O6V D;  1X1M A;  4ICV A;  1GC7 A;  2C7N B;  2DYB A;  4WJN A;  2KJH B;  4GDK B;  4AOF A;  2GMI C;  4EOY A;  2CHX A;  2GBM A;  1Q1O A;  4GGQ A;  1WMH B;  5L95 C;  3UIP B;  1PQS A;  1WFY A;  2R2O A;  4GDK A;  2DZM A;  4ZRJ A;  4LDT B;  1GC6 A;  5GMV A;  3PHW B;  1M94 A;  4I6L B;  4FUL A;  1Z5S B;  4PS7 A;  1I42 A;  2GBJ A;  3HM6 X;  1WMH A;  5EDS A;  1V81 A;  3U30 A;  2FUH B;  2ZCC A;  4ICU A;  3HK0 A;  2KC1 A;  3M95 A;  4AWJ A;  4RM9 A;  2C9W B;  2JVC A;  2BWF A;  3P2B A;  2K8C A;  5C23 A;  3NS8 A;  2GBR A;  4MGY E;  4WJQ A;  1V2Y A;  2LZ6 A;  4K7U A;  2ZPY A;  5TR5 A;  1WH3 A;  2HE7 A;  2M0X A;  3W1S C;  3L17 A;  4MJS A;  3PSE B;  4MEL A;  5AZF A;  4HLE A;  2BGF A;  4IWO A;  2IO0 B;  4KSL C;  3NOB A;  1EF5 A;  1UD7 A;  3U8Z A;  4KSK C;  2G4S A;  1WX7 A;  4HPL B;  2LVQ A;  3WAL A;  2MBE A;  1E8X A;  3A4S C;  3K9P B;  4M8N A;  2DZJ A;  2N7D A;  1WE6 A;  2DZK A;  1WGH A;  3PLV A;  3N30 A;  2IY1 B;  4YL8 A;  3L08 A;  2ASQ A;  4AUQ C;  2C7M B;  3PGE A;  4W9D A;  3ZDT A;  2QHO A;  3ZLZ A;  1JRU A;  3VVW B;  3VUX A;  4GMV A;  1ZKH A;  4HCN B;  2JT4 B;  2LGX A;  2ZVN A;  5FR6 A;  3VAW A;  3IHP C;  3KH0 A;  1KM7 A;  3VTU A;  3RD2 A;  2GOW A;  4JQW C;  2MA9 B;  4IWP A;  3VUW A;  1RRB A;  1TBE A;  4MH0 E;  4BVU C;  1P3Q U;  2KTR A;  2J0M A;  4NJ6 A;  4EZK A;  1ISN A;  4IUM B;  2MLB A;  4I6P A;  4JLC A;  3UGB B;  1XD3 B;  2KLG A;  4W9J A;  2KWV B;  3EHV A;  2MBQ A;  2AWT A;  4XX5 A;  2FCQ A;  5D7G A;  1HE8 A;  3AU5 A;  1V49 A;  2LGY A;  3APF A;  3KVF B;  5L83 A;  3S2A A;  1L7Y A;  3PTF C;  3UQA A;  3SD5 A;  1H4R A;  1WIA A;  1WYW B;  5DPS A;  5DCN A;  2YLM A;  3RUL A;  1OEY J;  4GIV A;  4NAW B;  2KOX A;  3A4R A;  2CR5 A;  2W9N A;  3AI5 A;  1NDD A;  3M63 B;  1TTN A;  2XK5 B;  4NAW A;  2AL6 A;  3DVG Y;  4EEW A;  1WY8 A;  2NBW B;  1WI0 A;  3H1U A;  3ZKJ C;  1WGD A;  3VH3 B;  2L8J A;  4NQL B;  1OEY A;  4FN2 A;  4KV2 A;  2JZ3 B;  4P7I A;  1EF1 A;  3EFU A;  1AAR A;  3AU4 A;  4HCP B;  4WJO A;  4GOC A;  4TUU A;  2NPT B;  4NQK E;  2WDT B;  3NHE B;  4CHK A;  3O65 B;  3PT2 B;  3QWZ B;  5C1Z A;  2FAZ A;  2KX3 A;  3NZS A;  4IG7 B;  4KIK A;  3V60 A;  4DXA B;  4EKU A;  3PRE A;  3R7R A;  2IO2 B;  2D2Q A;  2M17 A;  3OLM D;  2JY6 A;  4MGI E;  1OGW A;  2L05 A;  3UQB A;  3QQ8 B;  2FCM A;  4HPM B;  3ZDM C;  3L0W B;  3W1Y A;  1E8Z A;  2N1W A;  3OJ3 A;  2BYV E;  2MBB B;  3TL5 A;  4DWF A;  1SIF A;  3VQI A;  2LUE A;  3ZVV A;  3A33 B;  2KQS A;  2L0F A;  4NPN A;  2JXX A;  3QX1 A;  1Q5W B;  3U7D A;  4AJW A;  1LXD A;  4EZJ A;  2A4Z A;  1IYF A;  2FIF A;  2J0J A;  2MBH A;  4TKN A;  3ZNI D;  1KLV A;  2KZR A;  4W9E A;  2BKR B;  4HWI B;  3SDL C;  3B08 A;  2EKE C;  1OQY A;  3ZNH B;  4WJP A;  3L13 A;  4DDI D;  4FHK A;  3VH4 B;  3KYC D;  4DHZ E;  4WAA A;  1P9D U;  5DPT A;  3K9O B;  4E74 A;  2MW5 A;  4BKT A;  1C1Y B;  2IY0 B;  2KD0 A;  1E7U A;  4GB9 A;  4B9K A;  3OJ4 B;  3PRZ A;  3ONS A;  3WAM A;  3V6E B;  3A9J B;  4J6I A;  3QHT A;  2C5L C;  2KHW B;  3KUD B;  1LQB A;  2LRW A;  2Y5B B;  2BPS A;  3ECI A;  3DOW A;  3BIN A;  5CTR C;  3TBL D;  3KYD D;  4W9C A;  3QIJ A;  3PS6 A;  1H8C A;  4KZ0 A;  4DHZ B;  3V62 A;  2K25 A;  2KKC A;  2UYZ B;  4B95 A;  2KDI A;  2JRH A;  3V6C B;  4F8C B;  2D11 A;  3NY5 A;  4HVB A;  2K8H A;  4E71 A;  5LLI A;  1YIW A;  4BKS A;  3KUC B;  2KMA A;  2BYE A;  3UF8 A;  2HTH A;  3QK0 A;  1Z2M A;  3X23 A;  2EMT A;  1E8Y A;  5AZH A;  3ENE A;  3IVF A;  3M3J A;  3VTV A;  1V5O A;  2RGF A;  4EUT A;  1V6E A;  2MWS B;  1U4A A;  2K6Q A;  3CMM B;  4FJV B;  2PEA A;  4FHJ A;  2KJ6 A;  2Z0E B;  1FXT B;  2MX2 A;  4BBN C;  4ZDV A;  2KNB A;  3ML8 A;  4PS8 A;  4DBG A;  2KLC A;  4RM8 A;  5LXI B;  3TJP A;  1P0R A;  3DDC B;  1E5W A;  2CS4 A;  4FJY A;  4MGK E;  5D94 A;  3H7S A;  2KX0 A;  2RPQ A;  4TQ1 A;  3DPD A;  3WAO A;  1YX6 B;  2C7H A;  2NBV B;  1E8W A;  5J18 A;  1UBI A;  2N7E A;  5J2R A;  2KFK B;  4DDG D;  2KMC A;  2DX5 B;  2LRU A;  4PS3 A;  2LAS A;  1J19 A;  1ZW7 A;  3PRP B;  4IM0 A;  1V80 A;  3L16 A;  1VCB A;  3C0R B;  2J0K A;  2ZVO A;  3D32 A;  2KFK A;  4BKG A;  2O6V B;  1C3T A;  4HDQ A;  2HJ8 A;  1ZGU B;  4LJP B;  2AYO B;  2BKF A;  2ZNV C;  2ZCB A;  2IBI B;  2O6V A;  3JSV B;  5JZE B;  2K6D B;  1NBF C;  4W9F A;  3Q3J A;  3EEC A;  2KTF A;  3PLU A;  2C60 A;  1MG8 A;  1XT9 B;  4HJK A;  3RUI B;  4DHJ D;  5IA7 A;  1Y8R C;  4K81 A;  2D07 B;  3JSV A;  4F7Z A;  1IPG A;  1NI2 A;  1E7V A;  1UH6 A;  3DBR I;  2UWQ A;  4GXB A;  4OVU A;  1WR1 A;  2AEH A;  4G50 A;  5KHO A;  1WJU A;  4KDL B;  3PHX B;  1UZX B;  2XK5 A;  3ZNZ B;  3ZTD A;  2CHW A;  4E3C A;  1J0G A;  2KAN A;  1YJ1 A;  3A1Q B;  3QA8 A;  5LXH A;  4CYE A;  2IO3 B;  3IFW B;  2L76 A;  4HK2 A;  2G3Q B;  3M62 B;  2N1V A;  3LDZ E;  2J7Q B;  2LI5 A;  4LDT D;  3DBL I;  2FCS A;  1E90 A;  2JF5 A;  2NPT A;  3ZIM A;  4I6N B;  1EO6 A;  2PJH A;  5IAA C;  3WAP A;  1WM3 A;  1WF9 A;  4GSW A;  5G2N A;  2YVC A;  2KN5 A;  4CO7 A;  4ANV A;  1K8R B;  1EUV B;  1S3S G;  4BBN F;  3ZRC A;  3ZTC A; 
#chains in the Genus database with same CATH topology
 4LNN A;  2B3A A;  4HDO A;  4TMA B;  4RH6 A;  4ANX A;  4II2 B;  2N9P C;  5D2M B;  1C76 A;  1K50 A;  2O2V B;  1PGA A;  4MDK E;  3Q3N C;  3VR9 B;  4W9I A;  4HXD A;  3RPF C;  2SEB D;  2CHZ A;  3Q8E A;  2R2Q A;  3TEZ A;  3ZRF A;  4P1B C;  2D3G A;  1TIF A;  2LGD A;  3ABV B;  2DZI A;  3JVZ X;  2M19 A;  1SE2 A;  2NMQ A;  1OTR B;  2JRI B;  5G5H A;  4A9A A;  3MJW A;  4G11 A;  2JZZ A;  1P98 A;  3P4Q B;  1XEE A;  4XGA B;  3CIR B;  3L10 B;  3GB1 A;  1KH0 A;  2KK8 A;  3RYT A;  3HVD A;  1TKE A;  4KVG B;  1WM2 A;  2NCN A;  1TKG A;  2MRP A;  4ZYN A;  3JYU A;  1B1Z A;  3H8H A;  3V61 A;  1VJK A;  2RDH A;  3NVV A;  1WXQ A;  1UEL A;  4MEM A;  5G5G A;  4GU2 A;  3N3K B;  2ONQ A;  1WXM A;  4URK A;  1D4B A;  4A8X C;  1TS2 A;  1YMH E;  1FRD A;  2W82 A;  3AED B;  5AEK B;  1WXS A;  2BTE A;  4H2A A;  2KT7 A;  4M0W B;  1R7S A;  3H6N A;  1S1Q B;  2XN9 C;  2CKH B;  2V3P A;  1V5T A;  1A5R A;  2MCN B;  4C56 C;  2I1J A;  3ZNG C;  2GI9 A;  3APC A;  1GNU A;  1D5Z C;  1UGJ A;  1UGM A;  2MQJ A;  1SIJ A;  4K7S A;  4MGZ E;  3IXS A;  2M4N A;  2V1Y A;  2ZEQ A;  3CST A;  4MSM B;  4XDD A;  3EC8 A;  4AP4 C;  1FNV A;  4ANU A;  3T8M A;  3JW0 X;  1L5P A;  1F1H A;  1K51 A;  1SE9 A;  4IOI E;  2B76 B;  1SJE D;  3AMZ A;  5AUK A;  1RLF A;  3A9K A;  2QMT A;  3W1S A;  3VR8 B;  2WS3 B;  1QF6 A;  3VUY A;  3UIO B;  5JH5 C;  1RFA A;  1BUI C;  4W9K A;  1OQQ A;  1VZ7 A;  1XLO A;  2KVZ A;  4JL9 A;  1T0Y A;  1YN4 A;  5BYS A;  1ACC A;  2Y5P A;  1YJJ A;  2N4F A;  1ENF A;  1WJ4 A;  5CHW A;  2GBN A;  4AQ7 A;  2WXO A;  3TSS A;  4NNJ B;  3RCZ A;  2FNJ B;  4JGH B;  2CU1 A;  2DEN B;  2JPH A;  3P4S B;  2WXR A;  5DPW A;  5AZG A;  1IP9 A;  3HHM A;  1C77 A;  2IGG A;  4DHJ B;  3QC8 B;  1C79 A;  5IOI A;  1WXA A;  2JXT A;  1KJT A;  1WR6 E;  3RT3 B;  4JIO U;  4II3 B;  4XYC A;  1F9J A;  3CSF A;  1X1M A;  3AB5 A;  1V97 A;  4NJC A;  1V1P B;  2YEP B;  4RNA A;  2G9H D;  1WMH B;  5L95 C;  1WFY A;  1JRO A;  2R2O A;  1V1O A;  4PS7 A;  5D3D A;  2RMM A;  1JRP A;  3HM6 X;  3PZ8 A;  1V81 A;  2E6X A;  4KX6 B;  4O1N A;  2N9K A;  5HHD G;  2JVC A;  2BWF A;  2K8C A;  4MGY E;  4WJQ A;  2V3N A;  2JU6 X;  2M0X A;  5AZF A;  4HLE A;  1T5X D;  2TSS A;  1EWY C;  2LVQ A;  2LGS A;  1V8C A;  1Y56 A;  3FC4 A;  2DZJ A;  1WE6 A;  1WGH A;  1FFU A;  2KAJ A;  3MP9 A;  4W9D A;  3PGE A;  4RGT A;  1JRU A;  3IAS 1;  2OJW A;  2JT4 B;  3VAW A;  3IHP C;  3VTU A;  3Q6B A;  2LGI A;  2K22 A;  4R3D A;  1PFD A;  1TBE A;  3AE1 B;  2KTR A;  4NJ6 A;  4JLC A;  3UGB B;  1XD3 B;  2KLG A;  5IP4 D;  3EHV A;  2MBQ A;  4ITK A;  3S2A A;  2W55 A;  4ZHO A;  2HJ1 A;  2GB1 A;  5MPO A;  2YLM A;  4RCO A;  1QOF A;  4NAW B;  3IAM 1;  2W9N A;  3N1X C;  2WXG A;  3Q14 C;  1WY8 A;  3LXF A;  1WGD A;  2WXF A;  4YTN B;  2L32 A;  4USA A;  3AU4 A;  3NUH B;  2VH2 A;  4HRS A;  4NQK E;  2IGH A;  4CHK A;  1VRA B;  3MC9 A;  2KX3 A;  3NZS A;  4KIK A;  5HI1 A;  4DXA B;  4S0R A;  2JYE A;  4YSY B;  2IO2 B;  3UQB A;  4LK0 M;  3ZDM C;  2N1W A;  1CJE A;  3AEG B;  4DWF A;  3ZVV A;  4C00 A;  3A33 B;  4ZHP A;  2L0F A;  3QX1 A;  1Q5W B;  4AJW A;  3U7Z A;  2J0J A;  1E10 A;  2VZK B;  2EKE C;  2M0A A;  3L13 A;  1R4N B;  3K9O B;  1GB1 A;  5IO9 A;  3I9V 1;  2MW5 A;  1HA5 A;  1C1Y B;  2L83 A;  5BMG A;  4B9K A;  3OJ4 B;  4KKI A;  5T8I A;  1J7B A;  3ONS A;  3WAM A;  3EUB 2;  3V6E B;  2M56 B;  3QHT A;  1LQB A;  3MHZ A;  4BZA A;  3AEE B;  1IGC A;  2K25 A;  5HG2 A;  2UYZ B;  2D11 A;  2LHE A;  1MJD A;  1YIW A;  1I4H A;  3UF8 A;  4PK1 A;  1L4Z B;  4ZRQ A;  2K6Q A;  3CMM B;  4ZRP A;  2Z0E B;  2MX2 A;  1JQ4 A;  4MGK E;  2KX0 A;  4TQ1 A;  3BYY B;  2D3C A;  1YOV B;  2N7E A;  1QQR A;  5GXG B;  4IM0 A;  2BW2 A;  3L16 A;  1VCB A;  2J0K A;  2O6V B;  4HDQ A;  3HUI A;  2BKF A;  3T3O A;  2ZCB A;  3JSV B;  5JZE B;  1JWS D;  1NBF C;  3EEC A;  2C60 A;  1MG8 A;  4DHJ D;  4XWW A;  5IA7 A;  3O13 A;  2D07 B;  2MJ3 A;  3Q8B A;  4K81 A;  2WXQ A;  1AN8 A;  5EE3 A;  2KAC A;  2UWQ A;  4OVU A;  4JX1 C;  2AQ3 B;  3PHX B;  2CHW A;  1YJ1 A;  3A1Q B;  4KKJ A;  3QA8 A;  1SSN A;  1WGK A;  2IO3 B;  2K9X A;  3LDZ E;  1XCQ L;  3DBL I;  2GRI A;  1EO6 A;  2WXM A;  2FUG 1;  4CO7 A;  1K8R B;  4ASW C;  3ZRC A;  3ZTC A;  1I35 A;  2IYD B;  3H7P B;  4MSQ B;  5HKH A;  1WGG A;  3Q3F A;  1EWC A;  4P1C C;  3HM3 A;  3QAQ A;  3SU8 X;  1VZ8 A;  5C3J B;  3Q3M C;  2BBC A;  2EEL A;  1KLU D;  3PVL A;  1FPY A;  1QZE A;  2G1E A;  3DBH I;  1J8C A;  4JWS C;  1WZ0 A;  4LNF A;  3ETR A;  2BF8 B;  4IWQ A;  1KOT A;  4AJY B;  1NYQ A;  1TS4 A;  2XEW A;  2JYT A;  4ACF A;  1WE7 A;  3R66 C;  1TGZ B;  2LXC A;  3QCA A;  2WU5 B;  2D5G A;  1FXI A;  2KFJ A;  2BS2 B;  3T3N A;  4W9G A;  2RSU A;  2A5U A;  2JX5 A;  4NJ7 A;  3PZD A;  1I4P A;  3AE2 B;  3GZN I;  3RZF A;  4EFO A;  4MJS B;  3WAN A;  3V05 A;  4KZC A;  2KQ7 A;  1FNW A;  4W9H A;  2BB5 A;  2EMS A;  2WGS A;  2KC2 A;  5DPR A;  3EFC A;  3OWE B;  2X38 A;  1N63 A;  4M01 A;  4WWP A;  3MC8 A;  4M0W A;  4BFR A;  4BOS C;  2N7J A;  4LTU A;  3PPA A;  3BY4 B;  4N9F 4;  2ZZP B;  4IDI A;  5LNK 1;  3R3M A;  4WQO B;  1HZ6 A;  2VZK D;  3E56 A;  1P1A A;  1Q10 A;  4EZL A;  1QOA A;  1XXG A;  4IM2 A;  4OVV A;  1MFW A;  4GLS C;  2I1K A;  3RN9 C;  2BYF A;  1L0Y B;  2RDB C;  3TIX A;  3B0A A;  4OHJ A;  3DVG X;  1FCC C;  1JML A;  3APD A;  2REX A;  2WDV B;  1UNS A;  4MM3 A;  3WIM A;  4IC7 B;  4A20 A;  3VDZ A;  1F52 A;  2V9H A;  3Q2A C;  4B0E A;  4DXG A;  2M1M A;  1YNT E;  3RNB C;  3VXW A;  4EE2 A;  2BS3 B;  2KO3 A;  2IZV B;  2JWZ A;  4JPS A;  2WXI A;  2NBU A;  4YSX B;  2DNF A;  2BYT A;  3QAR A;  3Q8C A;  1XLP A;  2L3Z A;  2OJR A;  4F1S A;  2G45 B;  2KWU B;  4RMA A;  2N0S B;  1WRI A;  3N1Y C;  4ZRK A;  3ZXV A;  2XBB C;  4GDL A;  2I2Y A;  5E6P A;  2FID A;  5G55 A;  1WGR A;  2O6V D;  3DHH C;  5E6J A;  1ZXH A;  1SE4 A;  2DYB A;  2KJH B;  1IGD A;  1MG4 A;  1Q1O A;  4GGQ A;  1L0V B;  3UIP B;  2DZM A;  4LDT B;  4FUL A;  1I42 A;  2GBJ A;  1WMH A;  5EDS A;  3U30 A;  1WWT A;  3RNC C;  2MEK A;  3PZ7 A;  2HE7 A;  2LEK A;  1ET6 A;  3L17 A;  3PSE B;  1HXY D;  3P4R B;  1EF5 A;  1FD6 A;  3AE6 B;  3I57 A;  3BII D;  2G4S A;  4HPL B;  3WAL A;  5TSS A;  3FIL B;  3DHI C;  1E8X A;  3PO0 A;  1ET9 A;  1PGX A;  2MJE A;  2N7D A;  1WSP A;  3N30 A;  2INP E;  1EU4 A;  1MHH E;  4N59 A;  4AUQ C;  2WQY B;  3ZDT A;  1E7P B;  2QHO A;  4ZOH C;  3URY A;  1ZKH A;  2ZVN A;  2KMM A;  2V0G A;  2GOW A;  4UDU C;  1P3Q U;  3NVY A;  2J0M A;  4EZK A;  2MLB A;  4I6P A;  1NEN B;  1C78 A;  4XX5 A;  2OED A;  2AWT A;  3GE3 C;  4MAC A;  4WAF A;  1V49 A;  1BML C;  1ZDX A;  3APF A;  3KVF B;  5L83 A;  3AEF B;  1IBX B;  4GIV A;  1YN5 A;  1KFY B;  1VDV A;  4NAW A;  3MJ5 A;  3VH3 B;  4FN2 A;  1FM0 D;  3AN1 A;  4GOC A;  4TUU A;  2NPT B;  3SR6 A;  2WDT B;  1PGB A;  3QWZ B;  3PT2 B;  2W3S A;  2FAZ A;  2SAK A;  3BVZ A;  2M17 A;  2JY6 A;  2L05 A;  3W1Y A;  1BXT A;  1E8Z A;  3OJ3 A;  2BYV E;  2MBB B;  3TL5 A;  1SIF A;  3VQI A;  2LUE A;  3TEY A;  2KQS A;  2E3T A;  3RNF C;  2JXX A;  1TY0 A;  4RGM A;  2A4Z A;  1F2R I;  1FEH A;  4TKN A;  1JAL A;  3ZNI D;  3B08 A;  2QC8 A;  4DDI D;  4DHZ E;  4WAA A;  1P9D U;  4E74 A;  2KD0 A;  1E7U A;  2WLB A;  1KTK A;  4WIP A;  3PRZ A;  3AE3 B;  1N62 A;  1QKZ A;  2YEP F;  3ECI A;  1T3Q A;  1SB3 C;  3Q8F A;  1K52 A;  1PUT A;  1ZE3 D;  3R2T A;  1KRH A;  3J9C A;  4DHZ B;  3V62 A;  4REZ A;  2JRH A;  4F8C B;  3NY5 A;  2K8H A;  1GPX A;  3VRA B;  3QK0 A;  2V4I B;  3X23 A;  5IKC M;  2QSD A;  3ENE A;  2RGF A;  1TYG B;  1V6E A;  2K5P A;  1MHX A;  2JQR B;  2PEA A;  4FHJ A;  2DBY A;  2LJI A;  2BT6 A;  4BBN C;  1C4P A;  3ML8 A;  1ZPS A;  2ZW0 A;  5LXI B;  3H7S A;  2L52 A;  2RPQ A;  2WP9 B;  3DPD A;  2NBV B;  1E8W A;  2ACZ B;  5J2R A;  2KMC A;  2LRU A;  1ZW7 A;  3C0R B;  1C3T A;  3D32 A;  1VR9 A;  2FE8 A;  2HJ8 A;  1ZGU B;  1ZOY B;  3NS1 A;  2IBI B;  2O6V A;  1SEB D;  4A90 A;  2K6D B;  4W9F A;  3Q3J A;  1ZXI A;  1ZP0 B;  4HJK A;  3RUI B;  3L4P A;  4LNO A;  3JSV A;  1UH6 A;  3DBR I;  1OQR A;  1HQR D;  1WR1 A;  4US9 A;  1TZO A;  1UZX B;  2XK5 A;  3ZTD A;  1J0G A;  4CYE A;  3IFW B;  4WH4 A;  2G3Q B;  3RFZ B;  4LDT D;  4I6N B;  2PJH A;  1WM3 A;  4P16 A;  4GSW A;  5G2N A;  2PVO D;  2GLS A;  3P1M A;  2CJO A;  1EUV B;  1S3S G;  2PE9 A;  3B1L X;  3L54 A;  4BKS D;  3TCA A;  4MH8 A;  2MH7 A;  2V3S A;  5JHA A;  3AE7 B;  1I4R A;  4XC2 A;  2WYQ A;  3SFE B;  2KDM A;  4A3P A;  1G6J A;  1RWS A;  1V86 A;  1R4M I;  4LCD E;  4A55 A;  3VTW A;  2PLP A;  2D10 A;  4HKQ A;  2ZW1 A;  1MI0 A;  1HEZ E;  1DYQ A;  4K7W A;  2VRR B;  3AE4 B;  4ANW A;  4ARC A;  5CHF A;  3A9J A;  2DAF A;  3X0W A;  3T9L A;  1FNU A;  2JUO A;  4ARI A;  4LNI A;  4WWO A;  1GG3 A;  2KXJ A;  4K3C A;  1YQB A;  2MHJ A;  2RD0 A;  4QAY A;  4YT0 B;  2DYO A;  4IM3 A;  2IND C;  3WA0 A;  2K8B A;  3RMK C;  3PRM B;  2LVP A;  4L2Y A;  3DCG A;  4M8M A;  1LO5 D;  2QDF A;  5BO4 B;  2KJR A;  4KDI C;  4LLG M;  2K1F A;  3DQV A;  4XZ4 A;  2KQ4 X;  2M8S A;  4MT5 A;  3N32 A;  1FMA D;  1I4G A;  3ZJV A;  1D3Z A;  3BVG A;  1LM8 B;  2KWC A;  2JWU A;  3W5U B;  3TMP B;  3W9C B;  5HFY A;  1GUA B;  2OOB B;  2LD9 A;  2KTR B;  4FLH A;  1ESF A;  2KDE B;  4PYZ A;  4X57 B;  2LHD A;  4YWG G;  2OHF A;  2KDF B;  4FA6 A;  2WXJ A;  2NR2 A;  1YX5 B;  1PDX A;  2QJL A;  1C4A A;  4C80 A;  1WXV A;  1SBB B;  3MTN B;  4NZL B;  1TJE A;  2R61 A;  3NZU A;  4BOZ B;  3UI3 A;  3DWM A;  3ZUN A;  3VFK A;  2CU3 A;  4WQM A;  4FJZ A;  4KIK B;  1FRR A;  1WX9 A;  1YD8 U;  3AM9 A;  2WX0 A;  2NVU I;  1Q0W B;  1UF0 A;  2O2V A;  4XDC A;  2J42 A;  4FBJ B;  3OAW A;  5BMH A;  4N6E B;  3N20 C;  1WYG A;  1WX8 A;  2J53 A;  4WWN A;  2FCN A;  2DHZ A;  2LJ5 A;  1D5X C;  3NVZ A;  2Z0D B;  2L0T A;  2MP2 B;  1L2N A;  3KWL A;  3ZO5 B;  3U4E G;  2LUM A;  4ICV A;  1GC7 A;  2C7N B;  4GDK B;  2GMI C;  3KWV A;  3IT6 B;  1TT5 B;  1GC6 A;  4JWU C;  1M94 A;  4I6L B;  1L6U A;  2FUH B;  2ZCC A;  4RM9 A;  2C9W B;  3NS8 A;  4HJG E;  2W54 A;  4PT5 A;  3TUO A;  1V2Y A;  2BS4 B;  2LZ6 A;  3P42 A;  4K7U A;  3W1S C;  4MEL A;  3NOB A;  3U8Z A;  1UD7 A;  1WX7 A;  1I7H A;  2MBE A;  1TS3 A;  3A4S C;  3K9P B;  4BAX A;  2WNM A;  1UUP A;  3DBH B;  1VZ6 A;  3GE8 C;  2IY1 B;  1EM7 A;  4YL8 A;  2IJ0 A;  2C7M B;  2INC C;  3VUX A;  4GMV A;  3OG5 A;  1L6V A;  1A70 A;  5FR6 A;  1KM7 A;  1D5M C;  2J4X A;  2MA9 B;  3N1Z C;  4IWP A;  4JQW C;  3Q3O C;  3ZJT A;  1ISN A;  4IUM B;  1T6B X;  4W9J A;  2KWV B;  1HE8 A;  3AU5 A;  2WHI A;  3DWG C;  1AWD A;  3PTF C;  3SD5 A;  3AE5 B;  1H4R A;  3GZN B;  2ICI A;  5DPS A;  3RUL A;  1OEY J;  2KOX A;  3A4R A;  1T0S C;  3AI5 A;  1NDD A;  1JCK B;  1TTN A;  2AQ1 B;  2AL6 A;  2NBW B;  3H1U A;  1WI0 A;  2WDR B;  2XNA C;  3BK2 A;  1EF1 A;  4HCP B;  4WJO A;  1OFF A;  3B2G A;  4YSZ B;  3ZGZ A;  2QEJ C;  1YN3 A;  3HRD D;  1T0Q C;  3O65 B;  1GOZ A;  4EKU A;  1HTQ A;  3PRE A;  3R7R A;  2D2Q A;  3OLM D;  2FCM A;  4HPM B;  3L0W B;  3R2I A;  1RFK A;  1CZP A;  2QIE B;  3TEX A;  1XLQ A;  4P6V F;  3U7D A;  1I4Q A;  4EZJ A;  3W2D A;  3ZYY X;  1B9R A;  2FIF A;  2MBH A;  3P63 A;  2KZR A;  4W9E A;  4HWI B;  1CK1 A;  1OQY A;  4WJP A;  3SFD B;  2H88 B;  4BKT A;  2IY0 B;  4YXD B;  1E0Z A;  2Y5C A;  3W5V B;  2RDG A;  1SXT A;  1V1P A;  2EKI A;  5AUI A;  2C5L C;  2KHW B;  3KUD B;  3DHG C;  4OZA A;  2Y5B B;  2FBW B;  3DOW A;  1ZUD 2;  3C19 A;  1E9M A;  2LFI A;  2KKC A;  4B95 A;  3V6C B;  4DQO C;  4HVB A;  1DOY A;  5LLI A;  3KUC B;  2BYE A;  2EMT A;  5AZH A;  3M3J A;  1C4C A;  3MC0 B;  1YQ3 B;  4FJV B;  2KJ6 A;  2QCZ A;  1FXT B;  1JW9 D;  2N9L A;  1UWX A;  2KNB A;  4CQN A;  4PS8 A;  4DBG A;  2Y3A A;  5FKA C;  1KF6 B;  4RM8 A;  1MPE A;  1UWM A;  3DDC B;  4KGT A;  1E5W A;  2DWQ A;  1N60 A;  1F77 A;  5J18 A;  2KFK B;  2NTT A;  4DDG D;  4PS3 A;  2LAS A;  3AE9 B;  3PRP B;  5JXV A;  4C4V B;  1V80 A;  3Q69 A;  2AYO B;  4YTP B;  5I4D A;  1HTO A;  1P7F A;  3PLU A;  1XT9 B;  1AYF A;  1Y8R C;  1SE3 A;  1IPG A;  1NI2 A;  1N6Z A;  2AEH A;  1E6E B;  1ZDV A;  2L1A A;  4KDL B;  2PTL A;  3SEB A;  3M62 B;  4A6Q A;  4MM3 B;  2N1V A;  1QOG A;  2J7Q B;  2LI5 A;  2FCS A;  4C7Z A;  3ZIM A;  4DXF A;  3WAP A;  5IAA C;  3KLS X;  2YVC A;  1D6E C;  3RNA C;  5D6J B;  5EE0 A;  1QLB B;  1TS5 A;  2L00 B;  1T0R C;  2MSE D;  4FXC A;  4RF1 A;  5J17 A;  2AL3 A;  4N58 A;  3VRB B;  3RZW C;  3AXC A;  3GP7 A;  3ML9 A;  2KN4 A;  3B9J A;  2L7R A;  2WWZ A;  2H89 B;  1WGY A;  4LJO B;  4A3O A;  5JHB A;  2MBO A;  3LJ3 A;  1UBQ A;  2GBK A;  2LMC A;  1XQQ A;  2PKO A;  1WJ6 A;  4GDL B;  4PYU A;  4IW0 A;  1V9J A;  2IDY A;  1SJH D;  1CQV A;  3I3T B;  3NG0 A;  4G3X B;  1K53 A;  4TV3 A;  4HKZ E;  3RI7 C;  2BWE S;  1FFV A;  1FO4 A;  1TZ1 A;  2NTS A;  5BMI A;  4YTM B;  3NZ3 A;  1QIL A;  4ZYS A;  2Z59 B;  2DYM A;  3KUZ A;  2WX1 A;  5EE1 A;  2WXL A;  1ROE A;  2G4D B;  3NVW A;  2V4L A;  2KVR A;  3U2S C;  2PE6 B;  3NJT A;  1VD2 A;  3AV8 A;  4DK5 A;  1CMX B;  2PIA A;  5IN7 A;  3IT4 B;  2K39 A;  2ZPN A;  2WDQ B;  5FK9 C;  3LYY A;  2D3B A;  1NEK B;  1DOX A;  3IBE A;  1NVI D;  4GN1 A;  1GB4 A;  1QOB A;  2INN E;  3IG3 A;  1BT0 A;  1MVK A;  1SGH A;  4W9L A;  4WUR A;  2PPH A;  3AEB B;  3V3X A;  4HEA 1;  2PVG C;  3DVN U;  3KW5 B;  4RGO S;  2WU2 B;  1RAX A;  4ZRI A;  5CHV C;  3PV1 A;  1F0Z A;  5KHQ A;  5C2T B;  2MJD A;  4NAM A;  5BYQ A;  2HD5 B;  4JE3 B;  2RR9 A;  3TEW A;  2NS5 A;  2I38 A;  3B2F A;  1P7E A;  2KDB A;  4Q2J A;  5D3I B;  5E6O A;  3NRZ A;  2QIL A;  5E6N A;  1TKY A;  3A1Q A;  3HIZ A;  1N5X A;  3ZQ4 A;  3R8B A;  1WZ3 A;  1R4N I;  2WXH A;  3U52 E;  4HPP A;  3UIN B;  3A9K B;  2N9E B;  4XE0 A;  2ZJD A;  5BYR A;  4TQ0 A;  3EGR A;  3FAH A;  1XO3 A;  3DBS A;  1JWM D;  1TY2 A;  2K0P A;  1EU3 A;  2IO1 B;  3DVN V;  1WJN A;  3AUL A;  4G0N B;  1JWU D;  4NY0 A;  3ALB A;  3H7P A;  1PYW D;  3GS2 A;  2N9X A;  3WCQ A;  1FIQ A;  1WRD B;  3VHT C;  3R7Q A;  3GOE A;  2DAJ A;  1DOI A;  2LXA A;  4K1R B;  3DBR B;  3QJZ A;  1KLG D;  4FAD A;  3ZW3 A;  3MHS D;  1LGR A;  4B6W A;  1LFD A;  1AW7 A;  1GJZ A;  1I4X A;  5CX3 A;  2PW9 A;  2ZNV B;  4M00 A;  1N61 A;  3AEC B;  3CF6 E;  3SHQ A;  2LWP A;  3H9D A;  2LVO A;  2MP2 A;  3P4P B;  2IGD A;  4WJN A;  4AOF A;  2K3U A;  4EOY A;  2CHX A;  2GBM A;  2UU7 A;  1RM6 C;  1PQS A;  4ZRJ A;  4GDK A;  5GMV A;  3PHW B;  1Z5S B;  2BB6 A;  1N5W A;  3HK0 A;  4ICU A;  2KC1 A;  3ZJU A;  3M95 A;  4AWJ A;  2D3A A;  3P2B A;  2WXN A;  5C23 A;  2GBR A;  2ZPY A;  5TR5 A;  1WH3 A;  1VLB A;  4MJS A;  2BGF A;  4IWO A;  2IO0 B;  1L4D B;  3RNE C;  4KSL C;  4KGR A;  4KSK C;  4L23 A;  1R4M B;  1L0X B;  4OZC A;  2JSV X;  3BVM A;  4M8N A;  4B0M A;  3EA6 A;  3HVZ A;  2DZK A;  3PLV A;  4LNK A;  3L08 A;  2ASQ A;  1JWA D;  2J52 A;  3CWI A;  3ZLZ A;  3LB8 C;  2Z8L A;  3VVW B;  4HCN B;  2LGX A;  3RNG C;  1XCT L;  2W3R A;  3KH0 A;  3RD2 A;  3MFG A;  3VUW A;  1RRB A;  4BVU C;  4MH0 E;  4IKG A;  5D7G A;  4HRO A;  2FCQ A;  4D2K A;  2LGY A;  1L7Y A;  3I5J C;  3UQA A;  1WIA A;  1WYW B;  5DCN A;  4OVZ A;  2CR5 A;  2VH1 A;  3M63 B;  2XK5 B;  3DVG Y;  4EEW A;  3ZKJ C;  2L8J A;  4NQL B;  1OEY A;  4KV2 A;  2JZ3 B;  4P7I A;  3EFU A;  1AAR A;  1FXA A;  1SF0 A;  4XWT A;  1F2R C;  3NHE B;  1STE A;  4L1B A;  1JWB D;  3Q8A A;  5C1Z A;  4C7Y A;  4IG7 B;  3V60 A;  2KWD A;  4MGI E;  4S17 A;  1OGW A;  3BZD B;  3QQ8 B;  3AE8 B;  2WXP A;  1RYJ A;  4US8 A;  2WXK A;  4NPN A;  1LXD A;  1IYF A;  2Q5W D;  4K3B A;  1KLV A;  2BKR B;  3ZXR A;  1NYR A;  3SDL C;  1XF5 L;  3AH7 A;  2BQQ A;  3ZNH B;  4FHK A;  3VH4 B;  3KYC D;  5DPT A;  3DBL B;  4GB9 A;  1GAQ B;  2AX5 A;  4AS1 A;  3A9J B;  4J6I A;  2LRW A;  2BPS A;  3BYT B;  1IUE A;  2BVC A;  3BIN A;  5CTR C;  3TBL D;  3KYD D;  4W9C A;  1FCL A;  3QIJ A;  3PS6 A;  4OW0 A;  1H8C A;  4KZ0 A;  5H8Y E;  2KDI A;  2ON8 A;  3KQ4 A;  4WWM A;  1QT9 A;  4E71 A;  4BKS A;  2KMA A;  2HDE A;  2HTH A;  1YQ4 B;  1J7A A;  1Z2M A;  4RF0 A;  3FKY A;  3BK1 A;  1E8Y A;  3IVF A;  3VTV A;  4EUT A;  1V5O A;  2MWS B;  1U4A A;  2HTM E;  3FIL A;  4ZDV A;  4M02 A;  2KLC A;  3TJP A;  4TSS A;  1P0R A;  2CS4 A;  4FJY A;  5D94 A;  1YJI A;  3E9S A;  3WAO A;  1YX6 B;  2C7H A;  2IPK D;  1UBI A;  2CJN A;  2DX5 B;  1J19 A;  1DGJ A;  4RFB A;  2ZVO A;  4KGS A;  4BKG A;  2AQ2 B;  2KFK A;  1M4V A;  1C9F A;  4LJP B;  4C4V A;  2ZNV C;  4J3O D;  2KTF A;  5EE9 A;  4F7Z A;  1E7V A;  1IBX A;  4GXB A;  4RGN A;  5KHO A;  4G50 A;  5FR3 A;  1WJU A;  4OZB A;  3I63 C;  3ZNZ B;  4E3C A;  2X8X X;  2KAN A;  5LXH A;  3BWU D;  2L76 A;  4HK2 A;  2JZP A;  2RPV A;  1XLN A;  1J7C A;  3AEA B;  1HZ5 A;  2JF5 A;  1E90 A;  2NPT A;  2PMV A;  3C8Y A;  1WF9 A;  2KN5 A;  1NI3 A;  5H92 C;  3N9Y C;  2KYW A;  2DLB A;  4BBN F;  4ANV A; 
#chains in the Genus database with same CATH homology
 2PE9 A;  5D6J B;  3B1L X;  3L54 A;  1I35 A;  4BKS D;  2B3A A;  4HDO A;  3TCA A;  4ANX A;  4II2 B;  2IYD B;  2V3S A;  2N9P C;  2L00 B;  3H7P B;  5D2M B;  4MSQ B;  5HKH A;  2MSE D;  5J17 A;  5JHA A;  2AL3 A;  1WGG A;  2O2V B;  4MDK E;  3Q3F A;  3RZW C;  3AXC A;  3HM3 A;  3QAQ A;  3ML9 A;  4W9I A;  4XC2 A;  3SU8 X;  4HXD A;  2WYQ A;  2CHZ A;  2L7R A;  2WWZ A;  4A3P A;  1G6J A;  2R2Q A;  1WGY A;  4LJO B;  3ZRF A;  1V86 A;  4A3O A;  1R4M I;  2D3G A;  4LCD E;  5JHB A;  2MBO A;  3LJ3 A;  1UBQ A;  3VTW A;  3PVL A;  2GBK A;  2D10 A;  1XQQ A;  2LGD A;  1WJ6 A;  1QZE A;  3DBH I;  4GDL B;  2DZI A;  4PYU A;  1J8C A;  3JVZ X;  4IW0 A;  1V9J A;  1WZ0 A;  1OTR B;  3I3T B;  2JRI B;  4G3X B;  2BF8 B;  4IWQ A;  1KOT A;  4K7W A;  2VRR B;  3MJW A;  4TV3 A;  4ANW A;  5CHF A;  2BWE S;  4AJY B;  3A9J A;  2XEW A;  4G11 A;  2JZZ A;  1P98 A;  2DAF A;  3X0W A;  3T9L A;  1TZ1 A;  1WE7 A;  2JUO A;  3R66 C;  1TGZ B;  2LXC A;  3QCA A;  3L10 B;  2Z59 B;  2KFJ A;  4WWO A;  1GG3 A;  2DYM A;  2KK8 A;  3KUZ A;  3RYT A;  2WX1 A;  4W9G A;  4KVG B;  2KXJ A;  1WM2 A;  2G4D B;  2NCN A;  2RSU A;  1YQB A;  2RD0 A;  2A5U A;  2V4L A;  2KVR A;  2MRP A;  4ZYN A;  2PE6 B;  4NJ7 A;  4DK5 A;  1VD2 A;  3PZD A;  1CMX B;  2DYO A;  3JYU A;  4IM3 A;  3GZN I;  2K39 A;  3RZF A;  3V61 A;  2ZPN A;  4EFO A;  3WA0 A;  4MJS B;  3WAN A;  4KZC A;  1UEL A;  2KQ7 A;  4MEM A;  2K8B A;  4GU2 A;  3PRM B;  2LVP A;  4W9H A;  3N3K B;  3DCG A;  3IBE A;  1WXM A;  4GN1 A;  4URK A;  4M8M A;  5BO4 B;  2EMS A;  2KJR A;  4KDI C;  2KC2 A;  3IG3 A;  1BT0 A;  2K1F A;  5DPR A;  3DQV A;  4XZ4 A;  5AEK B;  1SGH A;  2M8S A;  1WXS A;  4W9L A;  2PPH A;  4M0W B;  3H6N A;  3N32 A;  1S1Q B;  2CKH B;  4WWP A;  1D3Z A;  1LM8 B;  2KWC A;  1V5T A;  3TMP B;  1A5R A;  2MCN B;  4BFR A;  3DVN U;  3KW5 B;  2I1J A;  1GUA B;  4BOS C;  2OOB B;  3ZNG C;  2LD9 A;  3PPA A;  1RAX A;  3BY4 B;  3APC A;  4N9F 4;  4ZRI A;  1GNU A;  2ZZP B;  2KTR B;  4FLH A;  5CHV C;  3PV1 A;  3R3M A;  5KHQ A;  4WQO B;  2KDE B;  1UGM A;  2MQJ A;  1P1A A;  4EZL A;  4PYZ A;  4X57 B;  4K7S A;  4IM2 A;  4OVV A;  4MGZ E;  2HD5 B;  2RR9 A;  4ASW C;  2KDF B;  2I1K A;  2M4N A;  2BYF A;  2NS5 A;  2V1Y A;  2ZEQ A;  4FA6 A;  3TIX A;  2KDB A;  2NR2 A;  1YX5 B;  3CST A;  4MSM B;  5E6O A;  3B0A A;  3EC8 A;  4AP4 C;  5E6N A;  3A1Q A;  3HIZ A;  3DVG X;  4ANU A;  3T8M A;  3JW0 X;  1WZ3 A;  3APD A;  1R4N I;  2REX A;  3UIN B;  1SE9 A;  1WXV A;  3MTN B;  3A9K B;  2N9E B;  4MM3 A;  2ZJD A;  3WIM A;  4IC7 B;  3NZU A;  3VDZ A;  4A20 A;  4BOZ B;  1RLF A;  3A9K A;  4TQ0 A;  3W1S A;  3ZUN A;  3VFK A;  3VUY A;  3DBS A;  3UIO B;  5JH5 C;  1RFA A;  2M1M A;  4FJZ A;  4W9K A;  2IO1 B;  3DVN V;  3VXW A;  1WJN A;  4KIK B;  2KO3 A;  3AUL A;  1WX9 A;  4G0N B;  4JL9 A;  1YD8 U;  2IZV B;  1T0Y A;  2WX0 A;  2JWZ A;  2NVU I;  4NY0 A;  3ALB A;  3H7P A;  1Q0W B;  2N9X A;  2NBU A;  2O2V A;  4FBJ B;  2N4F A;  3OAW A;  1WJ4 A;  1WRD B;  5CHW A;  2GBN A;  3VHT C;  4NNJ B;  3R7Q A;  3GOE A;  1WX8 A;  3QAR A;  3RCZ A;  2FNJ B;  2DAJ A;  2LXA A;  4K1R B;  4JGH B;  3QJZ A;  4FAD A;  3ZW3 A;  2CU1 A;  2DEN B;  2JPH A;  2L3Z A;  3MHS D;  4WWN A;  2FCN A;  2DHZ A;  5DPW A;  5AZG A;  2OJR A;  2LJ5 A;  4B6W A;  3HHM A;  4DHJ B;  1LFD A;  4F1S A;  1IP9 A;  3QC8 B;  2G45 B;  2KWU B;  4RMA A;  2Z0D B;  1WXA A;  1GJZ A;  5CX3 A;  4ZRK A;  1KJT A;  2XBB C;  1WR6 E;  4GDL A;  3RT3 B;  4JIO U;  2L0T A;  2MP2 B;  2ZNV B;  4II3 B;  3CF6 E;  1F9J A;  5E6P A;  2FID A;  1L2N A;  3SHQ A;  3CSF A;  2LWP A;  5G55 A;  3H9D A;  2LVO A;  1WGR A;  2MP2 A;  3ZO5 B;  2O6V D;  1X1M A;  4ICV A;  1GC7 A;  2C7N B;  2DYB A;  4WJN A;  2KJH B;  4GDK B;  4AOF A;  2GMI C;  4EOY A;  2CHX A;  2GBM A;  1Q1O A;  4GGQ A;  1WMH B;  5L95 C;  3UIP B;  1PQS A;  1WFY A;  2R2O A;  4GDK A;  2DZM A;  4ZRJ A;  4LDT B;  1GC6 A;  5GMV A;  3PHW B;  1M94 A;  4I6L B;  4FUL A;  1Z5S B;  4PS7 A;  1I42 A;  2GBJ A;  3HM6 X;  1WMH A;  5EDS A;  1V81 A;  3U30 A;  2FUH B;  2ZCC A;  4ICU A;  3HK0 A;  2KC1 A;  3M95 A;  4AWJ A;  4RM9 A;  2C9W B;  2JVC A;  2BWF A;  3P2B A;  2K8C A;  5C23 A;  3NS8 A;  2GBR A;  4MGY E;  4WJQ A;  1V2Y A;  2LZ6 A;  4K7U A;  2ZPY A;  5TR5 A;  1WH3 A;  2HE7 A;  2M0X A;  3W1S C;  3L17 A;  4MJS A;  3PSE B;  4MEL A;  5AZF A;  4HLE A;  2BGF A;  4IWO A;  2IO0 B;  4KSL C;  3NOB A;  1EF5 A;  1UD7 A;  3U8Z A;  4KSK C;  2G4S A;  1WX7 A;  4HPL B;  2LVQ A;  3WAL A;  2MBE A;  1E8X A;  3A4S C;  3K9P B;  4M8N A;  2DZJ A;  2N7D A;  1WE6 A;  2DZK A;  1WGH A;  3PLV A;  3N30 A;  2IY1 B;  4YL8 A;  3L08 A;  2ASQ A;  4AUQ C;  2C7M B;  3PGE A;  4W9D A;  3ZDT A;  2QHO A;  3ZLZ A;  1JRU A;  3VVW B;  3VUX A;  4GMV A;  1ZKH A;  4HCN B;  2JT4 B;  2LGX A;  2ZVN A;  5FR6 A;  3VAW A;  3IHP C;  3KH0 A;  1KM7 A;  3VTU A;  3RD2 A;  2GOW A;  4JQW C;  2MA9 B;  4IWP A;  3VUW A;  1RRB A;  1TBE A;  4MH0 E;  4BVU C;  1P3Q U;  2KTR A;  2J0M A;  4NJ6 A;  4EZK A;  1ISN A;  4IUM B;  2MLB A;  4I6P A;  4JLC A;  3UGB B;  1XD3 B;  2KLG A;  4W9J A;  2KWV B;  3EHV A;  2MBQ A;  2AWT A;  4XX5 A;  2FCQ A;  5D7G A;  1HE8 A;  3AU5 A;  1V49 A;  2LGY A;  3APF A;  3KVF B;  5L83 A;  3S2A A;  1L7Y A;  3PTF C;  3UQA A;  3SD5 A;  1H4R A;  1WIA A;  1WYW B;  5DPS A;  5DCN A;  2YLM A;  3RUL A;  1OEY J;  4GIV A;  4NAW B;  2KOX A;  3A4R A;  2CR5 A;  2W9N A;  3AI5 A;  1NDD A;  3M63 B;  1TTN A;  2XK5 B;  4NAW A;  2AL6 A;  3DVG Y;  4EEW A;  1WY8 A;  2NBW B;  1WI0 A;  3H1U A;  3ZKJ C;  1WGD A;  3VH3 B;  2L8J A;  4NQL B;  1OEY A;  4FN2 A;  4KV2 A;  2JZ3 B;  4P7I A;  1EF1 A;  3EFU A;  1AAR A;  3AU4 A;  4HCP B;  4WJO A;  4GOC A;  4TUU A;  2NPT B;  4NQK E;  2WDT B;  3NHE B;  4CHK A;  3O65 B;  3PT2 B;  3QWZ B;  5C1Z A;  2FAZ A;  2KX3 A;  3NZS A;  4IG7 B;  4KIK A;  3V60 A;  4DXA B;  4EKU A;  3PRE A;  3R7R A;  2IO2 B;  2D2Q A;  2M17 A;  3OLM D;  2JY6 A;  4MGI E;  1OGW A;  2L05 A;  3UQB A;  3QQ8 B;  2FCM A;  4HPM B;  3ZDM C;  3L0W B;  3W1Y A;  1E8Z A;  2N1W A;  3OJ3 A;  2BYV E;  2MBB B;  3TL5 A;  4DWF A;  1SIF A;  3VQI A;  2LUE A;  3ZVV A;  3A33 B;  2KQS A;  2L0F A;  4NPN A;  2JXX A;  3QX1 A;  1Q5W B;  3U7D A;  4AJW A;  1LXD A;  4EZJ A;  2A4Z A;  1IYF A;  2FIF A;  2J0J A;  2MBH A;  4TKN A;  3ZNI D;  1KLV A;  2KZR A;  4W9E A;  2BKR B;  4HWI B;  3SDL C;  3B08 A;  2EKE C;  1OQY A;  3ZNH B;  4WJP A;  3L13 A;  4DDI D;  4FHK A;  3VH4 B;  3KYC D;  4DHZ E;  4WAA A;  1P9D U;  5DPT A;  3K9O B;  4E74 A;  2MW5 A;  4BKT A;  1C1Y B;  2IY0 B;  2KD0 A;  1E7U A;  4GB9 A;  4B9K A;  3OJ4 B;  3PRZ A;  3ONS A;  3WAM A;  3V6E B;  3A9J B;  4J6I A;  3QHT A;  2C5L C;  2KHW B;  3KUD B;  1LQB A;  2LRW A;  2Y5B B;  2BPS A;  3ECI A;  3DOW A;  3BIN A;  5CTR C;  3TBL D;  3KYD D;  4W9C A;  3QIJ A;  3PS6 A;  1H8C A;  4KZ0 A;  4DHZ B;  3V62 A;  2K25 A;  2KKC A;  2UYZ B;  4B95 A;  2KDI A;  2JRH A;  3V6C B;  4F8C B;  2D11 A;  3NY5 A;  4HVB A;  2K8H A;  4E71 A;  5LLI A;  1YIW A;  4BKS A;  3KUC B;  2KMA A;  2BYE A;  3UF8 A;  2HTH A;  3QK0 A;  1Z2M A;  3X23 A;  2EMT A;  1E8Y A;  5AZH A;  3ENE A;  3IVF A;  3M3J A;  3VTV A;  1V5O A;  2RGF A;  4EUT A;  1V6E A;  2MWS B;  1U4A A;  2K6Q A;  3CMM B;  4FJV B;  2PEA A;  4FHJ A;  2KJ6 A;  2Z0E B;  1FXT B;  2MX2 A;  4BBN C;  4ZDV A;  2KNB A;  3ML8 A;  4PS8 A;  4DBG A;  2KLC A;  4RM8 A;  5LXI B;  3TJP A;  1P0R A;  3DDC B;  1E5W A;  2CS4 A;  4FJY A;  4MGK E;  5D94 A;  3H7S A;  2KX0 A;  2RPQ A;  4TQ1 A;  3DPD A;  3WAO A;  1YX6 B;  2C7H A;  2NBV B;  1E8W A;  5J18 A;  1UBI A;  2N7E A;  5J2R A;  2KFK B;  4DDG D;  2KMC A;  2DX5 B;  2LRU A;  4PS3 A;  2LAS A;  1J19 A;  1ZW7 A;  3PRP B;  4IM0 A;  1V80 A;  3L16 A;  1VCB A;  3C0R B;  2J0K A;  2ZVO A;  3D32 A;  2KFK A;  4BKG A;  2O6V B;  1C3T A;  4HDQ A;  2HJ8 A;  1ZGU B;  4LJP B;  2AYO B;  2BKF A;  2ZNV C;  2ZCB A;  2IBI B;  2O6V A;  3JSV B;  5JZE B;  2K6D B;  1NBF C;  4W9F A;  3Q3J A;  3EEC A;  2KTF A;  3PLU A;  2C60 A;  1MG8 A;  1XT9 B;  4HJK A;  3RUI B;  4DHJ D;  5IA7 A;  1Y8R C;  4K81 A;  2D07 B;  3JSV A;  4F7Z A;  1IPG A;  1NI2 A;  1E7V A;  1UH6 A;  3DBR I;  2UWQ A;  4GXB A;  4OVU A;  1WR1 A;  2AEH A;  4G50 A;  5KHO A;  1WJU A;  4KDL B;  3PHX B;  1UZX B;  2XK5 A;  3ZNZ B;  3ZTD A;  2CHW A;  4E3C A;  1J0G A;  2KAN A;  1YJ1 A;  3A1Q B;  3QA8 A;  5LXH A;  4CYE A;  2IO3 B;  3IFW B;  2L76 A;  4HK2 A;  2G3Q B;  3M62 B;  2N1V A;  3LDZ E;  2J7Q B;  2LI5 A;  4LDT D;  3DBL I;  2FCS A;  1E90 A;  2JF5 A;  2NPT A;  3ZIM A;  4I6N B;  1EO6 A;  2PJH A;  5IAA C;  3WAP A;  1WM3 A;  1WF9 A;  4GSW A;  5G2N A;  2YVC A;  2KN5 A;  4CO7 A;  4ANV A;  1K8R B;  1EUV B;  1S3S G;  4BBN F;  3ZRC A;  3ZTC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...