3RUIB

Crystal structure of atg7c-atg8 complex
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
113
structure length
113
Chain Sequence
b'TFKSEYPFEKRKAESERIADRFKNRIPVICEKAEKSDIPEIDKRKYLVPADLTVGQFVYVIRKRIMLPPEKAIFIFVNDTLPPTAALMSAIYQEHKDKDGFLYVTYSGENTFG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin-like modifier-activating enzyme ATG7
publication title Insights into noncanonical E1 enzyme activation from the structure of autophagic E1 Atg7 with Atg8.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ligase
total genus 30
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2011-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3ruiB00
4XX5A 3KH0A 2LVPA 2WWZA 1T0YA 2M4NA 4ZRIA 2D2QA 4B9KA 2FCQA 3RYTA 2GBJA 3NZSA 2W9NA 2L3ZA 2XBBC 3DVGX 2PE6B 3KUZA 3ZIMA 2A4ZA 2KX3A 2MBEA 2L7RA 4BKGA 1NI2A 2N9PC 2V1YA 2D3GA 4MJSB 2ZNVC 1C3TA 2KTRB 1CMXB 1UZXB 2KFKA 2G45B 4K81A 1IPGA 2I1KA 4A20A 4GIVA 1WH3A 3KUCB 3ZDTA 1UBQA 2G3QB 5D7GA 1P9DU 1YD8U 3QK0A 3Q3FA 2KDIA 2KMAA 3NS8A 2LRUA 1V5TA 1R4NI 2ZJDA 4HPLB 3QAQA 3IG3A 3WALA 3L16A 2LXAA 3AU4A 4GN1A 2GBRA 3EECA 1WMHB 1WJ6A 1YJ1A 4P7IA 2BKFA 2KVRA 3Q3JA 5J18A 2LI5A 3NHEB 3VUYA 2KDFB 3B0AA 3H7PB 4K7UA 1WXVA 1P98A 4K1RB 4NQKE 1E5WA 2C7MB 2XK5B 4ZRKA 3UINB 3ZNZB 4EKUA 4MEMA 2V4LA 4FBJB 5LXHA 1IP9A 2KXJA 3KYDD 5LXIB 2KX0A 5DCNA 1MG8A 1WXSA 1YX6B 4MDKE 2JF5A 4WQOB 3QA8A 4BKTA 4IM3A 2ZZPB 3PREA 2LRWA 4ASWC 3K9PB 4WJQA 2Y5BB 2DYOA 4TV3A 4BFRA 2BYEA 2C7NB 2IO0B 2RR9A 2KKCA 5G55A 1E8XA 1Z5SB 3W1SC 3HK0A 4RM9A 4TQ0A 3X23A 1C1YB 1GC7A 2LJ5A 1H4RA 4LCDE 3VTUA 2JPHA 1V49A 3QARA 4EUTA 2K8BA 4IM2A 4WJPA 4X57B 1Y8RC 1WE7A 3OJ4B 1GC6A 3W1YA 3OAWA 2K39A 2MBOA 3H9DA 1EF5A 2UWQA 2ZVNA 3R7RA 3S2AA 3TCAA 2KWUB 1FXTB 1V86A 3H1UA 3MJWA 4MSMB 4WJOA 4AJWA 4F8CB 2NBWB 2ZCBA 1S1QB 4GMVA 4MJSA 1LXDA 1Q5WB 1RLFA 2KTRA 4GDKB 3IFWB 4NAWB 4J6IA 2R2OA 5EDSA 3DQVA 1I35A 1P0RA 1K8RB 3DVNU 1V80A 2UYZB 3UIPB 2Z59B 2RD0A 1WFYA 2KWVB 4II2B 1WJNA 2JRHA 1WR6E 3APCA 2I1JA 2LUEA 4HDQA 5D2MB 5D94A 3DBHI 4NJ6A 3U30A 3PHWB 1WMHA 4KIKA 1WX7A 3UQBA 1WYWB 3U7DA 2MX2A 4IWQA 2KN5A 3ZDMC 4DHZB 2NVUI 3H7PA 4ANXA 1G6JA 2IO2B 3AI5A 2MW5A 3HIZA 3PLVA 1RAXA 4DWFA 2CHXA 3N3KB 2J0KA 3ALBA 4IUMB 2FCSA 4NPNA 4JGHB 5CTRC 1TBEA 4NY0A 2XEWA 4FHJA 1WGGA 4JQWC 4HXDA 1KOTA 4RMAA 3LDZE 2KWCA 3QJZA 2DAJA 5IAAC 3SHQA 2KFJA 4FJYA 2NS5A 2B3AA 2ZEQA 3DVNV 4NJ7A 2LZ6A 4PS3A 3ZLZA 1VCBA 2CS4A 2JZ3B 4CYEA 5LLIA 4JLCA 1LM8B 3DDCB 3A9JA 2KNBA 2QHOA 2VRRB 4A3PA 1TZ1A 4N9F4 4W9FA 3WANA 3NY5A 2J0JA 4GDLB 1EUVB 3AULA 5CX3A 1WI0A 2JVCA 2IO3B 3VUXA 3VVWB 1NBFC 1UGMA 1XT9B 2WDTB 3M3JA 3VH4B 3ONSA 1H8CA 2L8JA 3B1LX 1M94A 3PS6A 4HCNB 5HKHA 1ZKHA 4DBGA 1IYFA 4W9CA 5KHOA 3APDA 3RULA 3R7QA 3R66C 3RD2A 3T9LA 4PS7A 5CHVC 3A4RA 1S3SG 1GUAB 2ASQA 4GDKA 4NAWA 4XC2A 4DHJB 4ICUA 2GBMA 2C7HA 4FLHA 2PEAA 3TL5A 3O65B 4FADA 3JYUA 2LVQA 5BO4B 4B6WA 4EZKA 4TKNA 1V6EA 1VD2A 2AWTA 1LFDA 2MLBA 2JUOA 2NR2A 1WJUA 2PE9A 3ML8A 3VH3B 4KSLC 4TQ1A 5IA7A 4WJNA 3KUDB 4GXBA 4KIKB 4HVBA 1J8CA 2C5LC 2L0TA 2KQ7A 4DHJD 1UH6A 4HCPB 4AP4C 1OEYJ 2KJHB 4II3B 4E3CA 3PRMB 4KV2A 1SE9A 3U8ZA 1UD7A 1XD3B 2CHWA 2O6VA 2FNJB 2LGXA 3MHSD 4B95A 1U4AA 2REXA 4HK2A 3VFKA 2GOWA 3TMPB 4F7ZA 4CO7A 3L13A 4I6LB 1P1AA 4ICVA 2KD0A 1WRDB 2D07B 2Z0EB 3IBEA 3RCZA 3ZKJC 2M1MA 5AZFA 2CR5A 4BBNC 2BYFA 3DBRI 2DYBA 1WGHA 1E8YA 3K9OB 3A9JB 4ZDVA 5KHQA 3QCAA 4IWOA 1PQSA 4AWJA 2J0MA 3DCGA 5JH5C 5D6JB 3RUIB 3PHXB 3VHTC 1RFAA 4GDLA 2DAFA 2MA9B 1KM7A 3ENEA 3UF8A 3VTVA 2KK8A 3PV1A 3A33B 4WWNA 3PRPB 5JHBA 2FUHB 3EHVA 1OGWA 5E6OA 5FR6A 4MELA 3ZVVA 2MBQA 1E7UA 3ZRCA 4ANVA 2MP2B 2DYMA 2HJ8A 2KANA 2N7DA 1GJZA 3H6NA 3GZNI 4GGQA 3R3MA 1UELA 3EC8A 1EF1A 1ZGUB 2A5UA 4MGYE 3VAWA 4DDGD 2KOXA 2FCNA 3IHPC 4HLEA 1J0GA 1Q0WB 4MGZE 2FAZA 2KJRA 2MCNB 1V5OA 1WX9A 4RM8A 5CHFA 3UIOB 1Q1OA 3C0RB 3KVFB 5G2NA 2DZKA 2N9XA 3WAPA 3LJ3A 2MRPA 3WIMA 4K7SA 1WIAA 3PT2B 3NOBA 3TBLD 3B08A 3PVLA 3PZDA 1TTNA 3CF6E 2AL3A 2IO1B 4HJKA 3V60A 2MBHA 2RGFA 2L05A 3T8MA 2MBBB 1LQBA 1WGRA 3DOWA 2IBIB 2O6VB 4KDIC 1SGHA 5E6NA 2N9EB 2DZIA 3A4SC 3CSFA 2JT4B 1KLVA 1E8WA 3TIXA 5DPWA 1WR1A 4HDOA 2N1VA 4FA6A 2KDEB 3ZUNA 4G11A 4PYZA 2C9WB 3OLMD 4A3OA 4IC7B 2KLCA 4IWPA 1WGDA 1BT0A 4KVGB 2N4FA 3PRZA 2DZMA 2J7QB 2L00B 4XZ4A 2NPTA 2AEHA 3RZWC 4AUQC 2O6VD 4KSKC 2WX0A 2BPSA 2L76A 4MM3A 2L0FA 4KZ0A 3SDLC 1YX5B 4OVUA 4URKA 4GB9A 2YVCA 4G50A 3V6EB 3I3TB 5E6PA 1WM3A 4DK5A 3ZNGC 4GOCA 3N30A 2GBKA 3VUWA 3M63B 3WAOA 2KMCA 1WXMA 5CHWA 3WA0A 2KJ6A 2CKHB 4KDLB 2O2VB 2MP2A 3JVZX 4KZCA 2LGYA 2NCNA 4MSQB 4PS8A 3TJPA 2OOBB 4JL9A 2EMSA 3AXCA 3M95A 3L10B 5J2RA 3N32A 5TR5A 3JW0X 2CU1A 2Z0DB 1GG3A 4EEWA 3RZFA 3ZRFA 2HD5B 4ANWA 4DHZE 5JZEB 1JRUA 3OJ3A 3P2BA 1SIFA 5C1ZA 2HTHA 2RSUA 5AEKB 3D32A 1XQQA 2LWPA 3RT3B 3PTFC 3SU8X 4EFOA 4TUUA 1OTRB 3L08A 2ZVOA 1E8ZA 3CSTA 1WF9A 2YLMA 1HE8A 3APFA 2WX1A 3ZO5B 2HE7A 4FJZA 4AOFA 2ZPNA 1GNUA 2N7EA 2K1FA 2GBNA 3VXWA 2LVOA 5DPSA 2KDBA 2IY1B 4BKSD 4W9EA 4WWOA 4E74A 1OQYA 3V62A 4I6NB 4BOSC 3A1QB 1WM2A 2NBVB 4WAAA 4EOYA 5GMVA 3PLUA 3HM3A 1WGYA 4GSWA 4PYUA 4YL8A 5L83A 4E71A 2FIFA 1Z2MA 2NPTB 1D3ZA 1E90A 4NNJB 3PSEB 5AZGA 1V2YA 2KC2A 2KC1A 4M0WB 4BVUC 1AARA 4HPMB 2AYOB 2WYQA 3ECIA 3M62B 3H7SA 3QQ8B 4W9JA 2KLGA 2NBUA 2DHZA 3QWZB 3JSVA 3HM6X 2N1WA 4LJOB 2LGDA 4GU2A 3VTWA 3GOEA 2MSED 1WX8A 1UBIA 3A9KB 2FIDA 4W9LA 4IG7B 4G0NB 1WZ0A 4MGIE 2V3SA 1J19A 4EZLA 5L95C 4W9HA 2K6QA 5DPTA 4F1SA 1TGZB 3QIJA 3L0WB 3NZUA 3VDZA 2DZJA 2FCMA 2JZZA 4OVVA 4G3XB 2O2VA 1WZ3A 3L54A 2LASA 3QC8B 1X1MA 2RPQA 3PPAA 3UGBB 3KYCD 5J17A 2MWSB 4FN2A 2ZPYA 3IVFA 2BYVE 2K25A 1F9JA 4MGKE 2K8CA 4DDID 2DENB 2EMTA 2K6DB 3ZNHB 4IM0A 1E7VA 1L7YA 3DPDA 3ZTCA 4BKSA 3ML9A 5JHAA 2KHWB 4IW0A 5C23A 2IZVB 2JXXA 2R2QA 4W9GA 3DBLI 1RRBA 2M0XA 4FJVB 4FHKA 2C60A 2KFKB 2D10A 4LDTB 1ZW7A 4BOZB 1OEYA 2JWZA 1V81A 3W1SA 2KQSA 2LXCA 3CMMB 1ISNA 3MTNB 2JY6A 2GMIC 2IY0B 4AJYB 4I6PA 3BINA 1WJ4A 2D11A 1P3QU 4M8NA 2IYDB 3BY4B 3DBSA 3A1QA 2BF8B 3AU5A 3WAMA 2JRIB 2LD9A 2MQJA 4HWIB 4W9DA 4W9KA 2PJHA 4LDTD 2K8HA 1WE6A 4ZRJA 2KZRA 1WY8A 2ZNVB 4FULA 4DXAB 4ZYNA 2CHZA 4JIOU 3SD5A 1YIWA 4ANUA 4W9IA 2BWES 2G4DB 3KW5B 1V9JA 1KJTA 3ZTDA 2XK5A 2ZCCA 1EO6A 3JSVB 3HHMA 2AL6A 4MH0E 2M8SA 2BKRB 3A9KA 4K7WA 4CHKA 3PGEA 4LJPB 4WWPA 2PPHA 2KTFA 3QX1A 1R4MI 4NQLB 5DPRA 2M17A 5AZHA 1L2NA 2DX5B 2KO3A 3QHTA 2OJRA 3V6CB 2BGFA 1WXAA 2G4SA 3X0WA 1NDDA 1QZEA 1A5RA 3ZW3A 3EFUA 1YQBA 4M8MA 3UQAA 3ZNID 3L17A 1I42A 3DVGY 3VQIA 4EZJA 3V61A 4BBNF 2BWFA 2EKEC
chains in the Genus database with same CATH superfamily
4XX5A 3AEBB 5G5GA 1XLOA 2CJOA 2A4ZA 1ZXHA 4A6QA 3SR6A 2L7RA 4BKGA 2N9PC 2KTRB 1UZXB 4K81A 2D3AA 2I1KA 3T3OA 1PYWD 1WH3A 3KUCB 1CQVA 1UBQA 4YWGG 2G3QB 1P9DU 3Q3FA 3AH7A 4YTPB 1TS3A 2ZJDA 1ZOYB 4DQOC 2KQ4X 1WMHB 1YJ1A 2JYTA 2XK5B 3V3XA 3NVWA 2V4LA 4OZCA 3Q8FA 3KYDD 5LXIB 1MG8A 2QILA 4BKTA 3QA8A 4A9AA 3P4RB 4WJQA 4BFRA 1PDXA 2KKCA 3IAM1 3X23A 3P4SB 1HTOA 2LJ5A 1H4RA 4LCDE 2LHEA 4EUTA 2K8BA 4HEA1 5HG2A 1Y8RC 3OJ4B 3ETRA 3OAWA 2QCZA 1MPEA 3TCAA 1NYRA 4OZAA 4AJWA 2ZCBA 4GMVA 2QMTA 4MJSA 1LXDA 4GDKB 1R7SA 4J6IA 1FRRA 1YQ3B 1I35A 3Q14C 2SEBD 3DVNU 2Z59B 1DOIA 2WDRB 1WR6E 2I1JA 5D94A 2QEJC 3J9CA 1BUIC 3U30A 4KIKA 1IGCA 2ONQA 4LK0M 2MX2A 1TY0A 1MJDA 3ZDMC 4DHZB 3H7PA 3AI5A 3HIZA 3PLVA 4DWFA 1RAXA 2CHXA 5CTRC 4JGHB 2MHJA 2KMMA 1TBEA 3AE4B 3MFGA 2WXRA 4RMAA 2KVZA 4YSZB 2KFJA 1QLBB 4PS3A 3AE3B 4JLCA 2RDHA 2QHOA 1TZ1A 4N9F4 4W9FA 3NY5A 3AULA 3I9V1 5CX3A 1UWMA 3VVWB 1L0VB 4WQMA 2XNAC 3M3JA 3ONSA 1KLGD 4DBGA 1B1ZA 3R66C 3BVZA 1V1OA 3T9LA 2LUMA 3W2DA 2VZKD 3OWEB 4DHJB 1FMAD 4ICUA 3TL5A 3O65B 4N58A 2VH2A 4XWTA 2M0AA 2MLBA 1WJUA 4KSLC 1J7BA 3KUDB 3NS1A 1WWTA 2C5LC 2L0TA 4AP4C 1AYFA 1JW9D 4II3B 1V1PA 3PRMB 2W55A 1UD7A 2JYEA 1FIQA 4AQ7A 1U4AA 1L5PA 3R2IA 3VFKA 2GOWA 3L13A 1T3QA 1P1AA 4ICVA 2D07B 3IBEA 3RCZA 2M1MA 3AM9A 3TSSA 3N9YC 1GAQB 1WGKA 3K9OB 5KHQA 4LTUA 4YXDB 3H8HA 2INCC 1RFAA 4O1NA 3KWVA 3UF8A 3VTVA 2FUHB 5E6OA 4KX6B 1DOXA 5FR6A 4MELA 3PO0A 3ZRCA 3N20C 2DYMA 2HJ8A 2N7DA 4GGQA 3EC8A 3GE8C 2FCNA 3HUIA 2FAZA 2KJRA 4RM8A 3C0RB 5G2NA 1B9RA 4HKQA 1C4CA 1E6EB 2DZKA 2N9XA 1QOFA 3WIMA 1K50A 2CU3A 3WCQA 1YN3A 3B08A 3PZDA 1OQRA 1VJKA 3CF6E 3AB5A 5IP4D 2MBHA 2RGFA 3T8MA 2MBBB 2BB5A 3NVYA 2JX5A 2O6VB 2QJLA 3A4SC 2DZIA 3CSFA 1E8WA 2N1VA 3O13A 4A3OA 2C9WB 1WGDA 1BT0A 4A8XC 2PIAA 4AUQC 1ZDVA 3SDLC 2WX0A 2BPSA 4KZ0A 3B9JA 2FBWB 3VR9B 4URKA 5AUKA 3P4QB 1V8CA 3Q8BA 1WM3A 3GZNB 1F2RI 3ZNGC 1E9MA 3N30A 2RDBC 4B0MA 3M63B 2O2VB 3TJPA 2EMSA 3AXCA 3DBLB 3AV8A 5IOIA 1XLNA 3N32A 3MC9A 3JW0X 3NJTA 2AQ1B 3OJ3A 3P2BA 4BAXA 5C1ZA 1FNVA 4XWWA 2I2YA 2LWPA 3SU8X 2V3PA 4C56C 1E8ZA 1WF9A 2YLMA 3APFA 3ZO5B 2WS3B 2KYWA 2IY1B 2J4XA 4E74A 1OQYA 4BOSC 2BS3B 1WM2A 4WAAA 2L32A 5D3IB 1D6EC 2H88B 5L83A 1Z2MA 4NNJB 3PSEB 2KC2A 4M0WB 1AARA 3M62B 3H7SA 3QQ8B 4REZA 2NBUA 2DHZA 2N1WA 3A9KB 1OFFA 4W9HA 2QIEB 3QIJA 3NZUA 1TS4A 2CJNA 2MWSB 2ZPYA 3IVFA 1T0QC 2K8CA 4DDID 3NG0A 3TEWA 3SFEB 1HXYD 5HI1A 1I4HA 3DPDA 4RGMA 5EE9A 2KHWB 2KWDA 5C23A 2V4IB 2R2QA 4W9GA 1RRBA 2C60A 1T6BX 1R4NB 4K3CA 1XLQA 2WXKA 2JWZA 3W1SA 2KQSA 3AE2B 3CMMB 4I6PA 3BINA 2WU5B 4US8A 3A1QA 2JRIB 2N9LA 1F77A 4WIPA 2NTSA 3VR8B 3MP9A 2K8HA 1WE6A 2R61A 4FULA 1ZDXA 4ZYNA 1KF6B 3PZ7A 2CHZA 1KLUD 1YIWA 4ANUA 2BWES 4ZHPA 3AEGB 4MH0E 1BXTA 2M8SA 2BKRB 4K7WA 3NUHB 5BYQA 1L2NA 1R4MI 5DPRA 2M17A 1ZUD2 2DX5B 3V6CB 1XEEA 4XDDA 3UQAA 3V61A 1ET6A 4ZRIA 2D2QA 4B9KA 1ZXIA 4NAMA 4OZBA 3NZSA 2XBBC 3Q69A 2PE6B 5HHDG 3NVVA 2KX3A 1SE2A 2JWUA 2J52A 4MJSB 1QKZA 2KFKA 2G45B 1GB1A 3DBHB 4RF1A 3IAS1 4PK1A 3ZDTA 4YSXB 1YD8U 3QK0A 4M02A 3NS8A 4HPLB 3QAQA 3WALA 3L16A 2LXAA 1QILA 1TS2A 1WJ6A 1JROA 4P7IA 1GOZA 2WXLA 3VUYA 3H7PB 1VR9A 1WXVA 1P98A 4YT0B 4NQKE 1QF6A 1UUPA 3ZNZB 3HVZA 2PVOD 3Q8AA 5LXHA 1IP9A 1WXSA 4ASWC 4Q2JA 2G9HD 2Y5BB 4TV3A 2K9XA 2C7NB 1E8XA 4RM9A 5G5HA 2JZPA 4K3BA 1FRDA 4JPSA 4WJPA 1IBXA 3TUOA 1GC6A 2ACZB 3KLSX 1EU4A 1EF5A 2ZVNA 3R7RA 2KWUB 2NBWB 3C19A 1S1QB 1Q5WB 1RLFA 3EA6A 4C00A 3RFZB 5EDSA 2W3RA 3BYYB 3FILA 1PUTA 4MACA 2RD0A 1WFYA 2KWVB 1WJNA 4HDQA 5D2MB 2H89B 3UQBA 1WYWB 1V1PB 2KN5A 2NVUI 2IO2B 2J53A 2V3NA 2WQYB 1QOBA 3RNAC 3N3KB 1HZ6A 4IOIE 4FHJA 4JQWC 4HXDA 2WHIA 1RFKA 3LDZE 4OHJA 4KGSA 3ZYYX 2DAJA 4US9A 3SHQA 4FJYA 2ZEQA 2LZ6A 4CYEA 1TS5A 1NVID 2KNBA 2KDMA 2VRRB 1CZPA 5EE1A 2VZKB 4TMAB 1KTKA 2J0JA 1JWSD 3NRZA 2IO3B 3VUXA 1NBFC 2L8JA 1IYFA 5HKHA 4W9CA 4PS7A 1FFVA 3A4RA 1GUAB 2ASQA 4NAWA 4XC2A 3SEBA 4NZLB 2LVQA 5BO4B 4TKNA 2ZW0A 1V6EA 1VD2A 4JWUC 1J7CA 1LFDA 2NR2A 2PE9A 4HROA 3VH3B 3ML8A 2BT6A 4TQ1A 4HJGE 4WJNA 1BMLC 4YSYB 3BVMA 1FXAA 4KV2A 1SE9A 3U8ZA 1PGBA 2HJ1A 3RNCC 2BTEA 3U2SC 2V0GA 4A90A 4B95A 4HK2A 3TMPB 4F7ZA 3EFCA 4I6LB 1I7HA 2KAJA 3DHHC 3ZKJC 2HDEA 3A9JB 4L1BA 2B76B 3HRDD 4IWOA 2WP9B 2D3CA 3DCGA 4C80A 2JQRB 2K3UA 3PHXB 3VHTC 2DAFA 1ZPSA 1KM7A 2GRIA 3Q3OC 3ENEA 3BIID 3PV1A 3A33B 1XF5L 1SSNA 2VH1A 3ZVVA 1JQ4A 1GB4A 1Q10A 3GZNI 4IKGA 1J0GA 1C78A 4MGYE 4HLEA 1F0ZA 2I38A 4JE3B 1Q0WB 1TT5B 5CHFA 3UIOB 5BYRA 1P7EA 4N59A 5D3DA 2MRPA 4ZOHC 1F2RC 1WIAA 4LNIA 3NOBA 3TBLD 2BB6A 2AL3A 4HJKA 3V60A 2L05A 4ZYSA 1WGRA 3DOWA 5GXGB 3DBRB 1SGHA 3NZ3A 1TKEA 3URYA 5DPWA 2WXJA 2KDEB 3N1YC 4G11A 2KLCA 4IWPA 2INPE 4KVGB 2L00B 2NPTA 2RMMA 4RGNA 5BYSA 2L76A 1N63A 4OVUA 1HEZE 3V6EB 4DK5A 1L0YB 1TIFA 2KMCA 4D2KA 5CHWA 3WA0A 2WXQA 2CKHB 4PS8A 2OOBB 3M95A 3L10B 2KN4A 5TR5A 2IJ0A 2RPVA 2PTLA 4EEWA 4AS1A 3RZFA 2HD5B 1NENB 3IT4B 5JXVA 1SIFA 3LYYA 3D32A 1FO4A 3RT3B 1P7FA 1QT9A 2HE7A 4FJZA 4MH8A 1IGDA 1ACCA 2LVOA 5DPSA 1E7PB 2IPKD 4WWOA 1FM0D 1F52A 4I6NB 3A1QB 2NBVB 3ZQ4A 5GMVA 4WAFA 4E71A 1D3ZA 1JALA 5AZGA 4MM3B 1FNUA 2KC1A 5H8YE 2WYQA 3ECIA 2KLGA 3QWZB 4LJOB 2LGDA 3VTWA 1WX8A 2FIDA 4MGIE 4G0NB 1WZ0A 2N7JA 1C4AA 3TEXA 2LASA 1JWAD 2RPQA 2LJIA 3IT6B 3UGBB 2BYVE 2K25A 4MGKE 4IM0A 4LNOA 1L7YA 3ZTCA 2E6XA 3ABVB 4RGTA 4IW0A 5I4DA 4FJVB 4FHKA 2M0XA 1MFWA 5AUIA 2KFKB 1ISNA 2JY6A 2IY0B 4AJYB 1P3QU 2IYDB 3DHIC 3BY4B 2NMQA 3U4EG 4J3OD 2BF8B 2LD9A 1K53A 3U52E 2PJHA 4LDTD 1ESFA 4RNAA 2KZRA 1EWYC 3SD5A 2JXTA 3ZJUA 1C79A 3KW5B 1I4QA 2G4DB 1V9JA 2XK5A 4XGAB 4ZHOA 3JSVB 4RFBA 3HHMA 1YN5A 2WXPA 2IGDA 4CHKA 2INNE 2PPHA 3QX1A 2DNFA 3ZJVA 2KO3A 2Y5PA 3T3NA 1WXAA 3DWGC 1YQBA 4M8MA 1TY2A 3L17A 1I4PA 2BWFA 2PVGC 2LVPA 2M4NA 2RDGA 2FCQA 3CWIA 2GBJA 1A70A 3W5VB 2W9NA 3KUZA 3TEZA 3ZIMA 1YN4A 3UI3A 1FNWA 1NI2A 4FXCA 1CMXB 4L23A 2AQ2B 2WNMA 3LXFA 5D7GA 4LNNA 3FILB 2YEPF 2KDIA 1C4PA 3AE5B 3EECA 2BKFA 4XYCA 3GE3C 5J18A 2LI5A 1XCQL 3NHEB 4K1RB 4JWSC 1QOGA 2C7MB 4MEMA 2X8XX 1TKGA 2KXJA 2KX0A 5DCNA 2ZZPB 2LRWA 1JCKB 1L0XB 4P1BC 5G55A 1Z5SB 3W1SC 1VDVA 4TQ0A 1C1YB 1YQ4B 1V49A 4B0EA 1WE7A 1ROEA 1KFYB 2JSVX 4ARIA 1LGRA 2UWQA 3S2AA 4WJOA 1T0SC 1PGAA 4MSMB 4F8CB 3PZ8A 3CIRB 1L4DB 3FC4A 3IFWB 4NAWB 4ACFA 4M00A 1VLBA 1V97A 3N1XC 1P0RA 2AX5A 1PGXA 1K8RB 4L2YA 2WGSA 1V80A 3SFDB 3UIPB 1N61A 4II2B 2JRHA 3APCA 1JWUD 2LUEA 1AW7A 4NJ6A 3U7DA 1HTQA 1DOYA 3Q3MC 3AECB 4ANXA 3AN1A 4IUMB 2HTME 3ALBA 4NY0A 2XEWA 1KOTA 1VZ7A 4WWMA 4H2AA 5IAAC 2L83A 2WXOA 3AE7B 2L1AA 2NS5A 4NJ7A 3ZLZA 1VCBA 2PLPA 1LM8B 2Y5CA 3P4PB 4A3PA 3WANA 1EUVB 1I4RA 1WI0A 3BZDB 4HPPA 1UGMA 2WDTB 3VH4B 3B1LX 4HCNB 3PS6A 1ZKHA 1J7AA 5KHOA 3RNBC 3RULA 3R7QA 3W5UB 2GBMA 2PEAA 4FADA 4EZKA 2AWTA 1QOAA 1NYQA 4XDCA 5IA7A 4GXBA 4KIKB 4HVBA 3KWLA 2KQ7A 1MI0A 1UH6A 1K51A 4HCPB 3Q2AC 2MJDA 1N62A 4RH6A 1XD3B 2YEPB 2CHWA 2O6VA 2LGXA 1N6ZA 2REXA 1YJJA 1FD6A 4CO7A 1EM7A 2W3SA 4UDUC 2KD0A 1WRDB 4OVZA 1EWCA 5AZFA 2BBCA 2CR5A 3DBRI 2ICIA 2DYBA 2QSDA 1PQSA 3N1ZC 4C4VA 3E56A 5JH5C 2Q5WD 1XO3A 1WYGA 4GDLA 1TZOA 2NTTA 3AE6B 1D5MC 2KK8A 4RF0A 4WH4A 1SBBB 4WWNA 5JHBA 3EHVA 2MBQA 2K0PA 4ARCA 1FCLA 1OQQA 1KLVA 1EF1A 1ZGUB 2BW2A 3VAWA 4DDGD 4MGZE 2MCNB 1UGJA 3AE8B 3LJ3A 3PT2B 3PVLA 2IDYA 2XN9C 1LQBA 2IBIB 1JWBD 4KDIC 2JT4B 4N6EB 3TIXA 1WR1A 4HDOA 4DXGA 4FA6A 2D3BA 3RI7C 3ZUNA 3OLMD 1C77A 4IC7B 3PRZA 4XZ4A 2AEHA 1ZE3D 2WXGA 1YX5B 3FKYA 2K22A 4GB9A 2YVCA 5E6PA 1UWXA 1WRIA 2BYTA 4GOCA 1UF0A 3ZJTA 2L52A 3VUWA 4C7ZA 2KJ6A 3AEFB 4MSQB 2MP2A 2LGYA 3AE1B 1JRPA 1I4XA 5J2RA 4MT5A 3P1MA 2CU1A 3NVZA 1SXTA 4ZRQA 4S17A 1N5XA 3PTFC 4EFOA 2D5GA 2OEDA 1T0RC 1JMLA 4NJCA 4LLGM 1I4GA 1GNUA 2N7EA 2GBNA 1ET9A 2KDBA 2FUG1 4W9EA 2G1EA 3V62A 4EOYA 3PLUA 1WGYA 5IN7A 3W9CB 1R4MB 3AE9B 1V2YA 2AYOB 3EGRA 1HA5A 2WXNA 3HM6X 3Q6BA 3ZXRA 2GLSA 3E9SA 1UBIA 1N60A 4P1CC 2V3SA 1J19A 4YTMB 2K6QA 5DPTA 2EELA 1M4VA 1TGZB 1SF0A 2DZJA 2FCMA 4GLSC 4G3XB 1X1MA 3PPAA 3KYCD 4FN2A 3BYTB 2TSSA 1F9JA 3FAHA 2K6DB 3ZNHB 3ML9A 3OG5A 1VZ8A 3Q8EA 2JXXA 1YNTE 3DBLI 4HRSA 4LDTB 4BOZB 1OEYA 1TJEA 1AWDA 1FFUA 2LXCA 3MTNB 1FEHA 1WJ4A 4JX1C 4M8NA 1C9FA 3DBSA 3RN9C 4KGTA 2M56B 1MHXA 3AU5A 4HWIB 4W9KA 4QAYA 2IGGA 1RWSA 3ZTDA 2DLBA 3U7ZA 3BWUD 4WWPA 4NQLB 2KTFA 3GS2A 1NEKB 4EE2A 1A5RA 1NDDA 3MC0B 1I42A 2Z8LA 3RNFC 3KH0A 1D4BA 2WWZA 3Q3NC 1T0YA 3RYTA 2WU2B 1F1HA 2L3ZA 3DVGX 2MBEA 1MVKA 3IXSA 2V1YA 2D3GA 2ZNVC 1C3TA 1VZ6A 1IPGA 4A20A 4GIVA 2ON8A 4C7YA 5C3JB 2KMAA 2LRUA 1FXIA 1R4NI 1V5TA 3IG3A 4GN1A 3AU4A 2GBRA 2E3TA 1YOVB 1DGJA 3DWMA 2KVRA 3Q3JA 2KDFB 3B0AA 4K7UA 1E5WA 4ZRKA 4EKUA 3UINB 4TSSA 1JWMD 4FBJB 2ZW1A 2KACA 1YX6B 4MDKE 2JF5A 3BVGA 1EU3A 4WQOB 4IM3A 3PREA 4R3DA 3K9PB 3P63A 3R8BA 2DYOA 2BYEA 2IO0B 2GB1A 2RR9A 3HK0A 1GC7A 1RYJA 3VTUA 2LGIA 2JPHA 3QARA 4IM2A 4X57B 1ENFA 4P16A 3W1YA 2K39A 2MBOA 3H9DA 4USAA 1FXTB 1V86A 3H1UA 3MJWA 2MJ3A 3Q8CA 2KTRA 1FCCC 1SE3A 2R2OA 3DQVA 2LFIA 2UYZB 1L6UA 2WLBA 3DBHI 5MPOA 4S0RA 3I5JC 4CQNA 3PHWB 2AQ3B 1WMHA 3ZXVA 4XE0A 1WX7A 4IWQA 1G6JA 2LEKA 3HVDA 2MW5A 3R2TA 1LO5D 2WDQB 4NPNA 2J0KA 1CK1A 2FCSA 3EUB2 1L6VA 1WGGA 2LGSA 2N0SB 3QJZA 2KWCA 4LNKA 2BQQA 2B3AA 3DVNV 1UNSA 2CS4A 1E10A 2JZ3B 5LLIA 2LHDA 4C4VB 3DDCB 3A9JA 4GDLB 1IBXB 1Y56A 4KKJA 2JVCA 1XT9B 5EE3A 1H8CA 1KH0A 4IDIA 1M94A 4KKIA 3APDA 2WXMA 3RD2A 3AEDB 5CHVC 1S3SG 4GDKA 2C7HA 4FLHA 3JYUA 4B6WA 4LNFA 1C76A 2JUOA 4OW0A 5FR3A 2K5PA 1J8CA 2OJWA 4DHJD 2IGHA 2W82A 1OEYJ 2KJHB 4E3CA 2FNJB 2PW9A 2KT7A 3MHSD 1K52A 1TYGB 2DBYA 2Z0EB 1GPXA 4YTNB 4BBNC 2BYFA 1WGHA 1E8YA 4ZDVA 2PMVA 3QCAA 4AWJA 2J0MA 2INDC 4RCOA 5D6JB 3I57A 2WXHA 3RUIB 3AMZA 2MA9B 3MHZA 2LMCA 3PRPB 1OGWA 3GP7A 1E7UA 3AEEB 4ANVA 2MP2B 3BK2A 1CJEA 2KANA 1GJZA 3H6NA 3R3MA 1UELA 2BVCA 2J42A 2A5UA 4RGOS 2KOXA 2DWQA 3IHPC 1V5OA 2V9HA 1WX9A 1Q1OA 1D5XC 1NI3A 3KVFB 1SB3C 5T8IA 3WAPA 4WURA 1E0ZA 1IUEA 3V05A 4K7SA 2MEKA 1YJIA 1RM6C 1TTNA 1HZ5A 2IO1B 3B2GA 1T5XD 3RNGC 2OHFA 5E6NA 2N9EB 3RPFC 1QQRA 3ZGZA 2MJEA 3C8YA 4PYZA 1AN8A 4M01A 2N4FA 2DZMA 2J7QB 3RZWC 2O6VD 4KSKC 4MM3A 2L0FA 1STEA 1DYQA 1L4ZB 5FK9C 5BMGA 4G50A 1SJED 5EE0A 3I3TB 1MG4A 1XLPA 2M19A 2GBKA 2PKOA 3WAOA 1MHHE 1WXMA 2X38A 2GI9A 4KDLB 3JVZX 4KZCA 2NCNA 4JL9A 2QDFA 1SIJA 4PT5A 2Z0DB 1GG3A 3ZRFA 4DHZE 4ANWA 5JZEB 2BS2B 1JRUA 1TKYA 2HTHA 2RSUA 2SAKA 5AEKB 1XQQA 5HFYA 2WXFA 4TUUA 3P42A 1XXGA 4ZRPA 1D5ZC 1OTRB 3L08A 2ZVOA 3KQ4A 3CSTA 1HE8A 2WX1A 1WSPA 3MC8A 1YMHE 4AOFA 2ZPNA 3LB8C 2K1FA 3VXWA 4BKSD 3RMKC 3DHGC 3HM3A 4GSWA 3MJ5A 4PYUA 4YL8A 5BMIA 2FIFA 2NPTB 1E90A 2MH7A 4BVUC 4HPMB 5C2TB 1WXQA 4W9JA 4BZAA 5LNK1 5IO9A 3JSVA 3TEYA 2FE8A 4GU2A 3GOEA 2MSED 5IKCM 4KGRA 4W9LA 2N9KA 4IG7B 3L4PA 4EZLA 5L95C 3B2FA 3VRAB 3RNEC 2EKIA 4F1SA 3L0WB 3VDZA 2WXIA 2JZZA 4OVVA 2O2VA 5BMHA 1WZ3A 3L54A 3QC8B 1N5WA 1VRAB 5J17A 5TSSA 3VRBB 2DENB 2EMTA 2JU6X 5FKAC 1E7VA 1SE4A 1SEBD 2QC8A 2BS4B 4BKSA 5JHAA 2IZVB 4HKZE 2D10A 1ZW7A 1V81A 2GMIC 1ZP0B 3AEAB 4P6VF 2D11A 3GB1A 1XCTL 2WDVB 3WAMA 2MQJA 4W9DA 2W54A 4ZRJA 1WY8A 2ZNVB 5E6JA 4DXAB 1KRHA 4M0WA 5H92C 4JIOU 4W9IA 1HQRD 1SJHD 1KJTA 2ZCCA 1EO6A 2UU7A 4DXFA 2AL6A 4ITKA 3A9KA 3BK1A 1FPYA 1PFDA 3PGEA 4LJPB 5AZHA 4A55A 3X0WA 3QHTA 2OJRA 2BGFA 2G4SA 1QZEA 2Y3AA 3ZW3A 3EFUA 3I63C 3ZNID 3DVGY 3VQIA 4EZJA 4BBNF 2EKEC
chains in the Genus database with same CATH topology
4XX5A 3KH0A 2LVPA 2WWZA 1T0YA 2M4NA 4ZRIA 2D2QA 4B9KA 2FCQA 3RYTA 2GBJA 3NZSA 2W9NA 2L3ZA 2XBBC 3DVGX 2PE6B 3KUZA 3ZIMA 2A4ZA 2KX3A 2MBEA 2L7RA 4BKGA 1NI2A 2N9PC 2V1YA 2D3GA 4MJSB 2ZNVC 1C3TA 2KTRB 1CMXB 1UZXB 2KFKA 2G45B 4K81A 1IPGA 2I1KA 4A20A 4GIVA 1WH3A 3KUCB 3ZDTA 1UBQA 2G3QB 5D7GA 1P9DU 1YD8U 3QK0A 3Q3FA 2KDIA 2KMAA 3NS8A 2LRUA 1V5TA 1R4NI 2ZJDA 4HPLB 3QAQA 3IG3A 3WALA 3L16A 2LXAA 3AU4A 4GN1A 2GBRA 3EECA 1WMHB 1WJ6A 1YJ1A 4P7IA 2BKFA 2KVRA 3Q3JA 5J18A 2LI5A 3NHEB 3VUYA 2KDFB 3B0AA 3H7PB 4K7UA 1WXVA 1P98A 4K1RB 4NQKE 1E5WA 2C7MB 2XK5B 4ZRKA 3UINB 3ZNZB 4EKUA 4MEMA 2V4LA 4FBJB 5LXHA 1IP9A 2KXJA 3KYDD 5LXIB 2KX0A 5DCNA 1MG8A 1WXSA 1YX6B 4MDKE 2JF5A 4WQOB 3QA8A 4BKTA 4IM3A 2ZZPB 3PREA 2LRWA 4ASWC 3K9PB 4WJQA 2Y5BB 2DYOA 4TV3A 4BFRA 2BYEA 2C7NB 2IO0B 2RR9A 2KKCA 5G55A 1E8XA 1Z5SB 3W1SC 3HK0A 4RM9A 4TQ0A 3X23A 1C1YB 1GC7A 2LJ5A 1H4RA 4LCDE 3VTUA 2JPHA 1V49A 3QARA 4EUTA 2K8BA 4IM2A 4WJPA 4X57B 1Y8RC 1WE7A 3OJ4B 1GC6A 3W1YA 3OAWA 2K39A 2MBOA 3H9DA 1EF5A 2UWQA 2ZVNA 3R7RA 3S2AA 3TCAA 2KWUB 1FXTB 1V86A 3H1UA 3MJWA 4MSMB 4WJOA 4AJWA 4F8CB 2NBWB 2ZCBA 1S1QB 4GMVA 4MJSA 1LXDA 1Q5WB 1RLFA 2KTRA 4GDKB 3IFWB 4NAWB 4J6IA 2R2OA 5EDSA 3DQVA 1I35A 1P0RA 1K8RB 3DVNU 1V80A 2UYZB 3UIPB 2Z59B 2RD0A 1WFYA 2KWVB 4II2B 1WJNA 2JRHA 1WR6E 3APCA 2I1JA 2LUEA 4HDQA 5D2MB 5D94A 3DBHI 4NJ6A 3U30A 3PHWB 1WMHA 4KIKA 1WX7A 3UQBA 1WYWB 3U7DA 2MX2A 4IWQA 2KN5A 3ZDMC 4DHZB 2NVUI 3H7PA 4ANXA 1G6JA 2IO2B 3AI5A 2MW5A 3HIZA 3PLVA 1RAXA 4DWFA 2CHXA 3N3KB 2J0KA 3ALBA 4IUMB 2FCSA 4NPNA 4JGHB 5CTRC 1TBEA 4NY0A 2XEWA 4FHJA 1WGGA 4JQWC 4HXDA 1KOTA 4RMAA 3LDZE 2KWCA 3QJZA 2DAJA 5IAAC 3SHQA 2KFJA 4FJYA 2NS5A 2B3AA 2ZEQA 3DVNV 4NJ7A 2LZ6A 4PS3A 3ZLZA 1VCBA 2CS4A 2JZ3B 4CYEA 5LLIA 4JLCA 1LM8B 3DDCB 3A9JA 2KNBA 2QHOA 2VRRB 4A3PA 1TZ1A 4N9F4 4W9FA 3WANA 3NY5A 2J0JA 4GDLB 1EUVB 3AULA 5CX3A 1WI0A 2JVCA 2IO3B 3VUXA 3VVWB 1NBFC 1UGMA 1XT9B 2WDTB 3M3JA 3VH4B 3ONSA 1H8CA 2L8JA 3B1LX 1M94A 3PS6A 4HCNB 5HKHA 1ZKHA 4DBGA 1IYFA 4W9CA 5KHOA 3APDA 3RULA 3R7QA 3R66C 3RD2A 3T9LA 4PS7A 5CHVC 3A4RA 1S3SG 1GUAB 2ASQA 4GDKA 4NAWA 4XC2A 4DHJB 4ICUA 2GBMA 2C7HA 4FLHA 2PEAA 3TL5A 3O65B 4FADA 3JYUA 2LVQA 5BO4B 4B6WA 4EZKA 4TKNA 1V6EA 1VD2A 2AWTA 1LFDA 2MLBA 2JUOA 2NR2A 1WJUA 2PE9A 3ML8A 3VH3B 4KSLC 4TQ1A 5IA7A 4WJNA 3KUDB 4GXBA 4KIKB 4HVBA 1J8CA 2C5LC 2L0TA 2KQ7A 4DHJD 1UH6A 4HCPB 4AP4C 1OEYJ 2KJHB 4II3B 4E3CA 3PRMB 4KV2A 1SE9A 3U8ZA 1UD7A 1XD3B 2CHWA 2O6VA 2FNJB 2LGXA 3MHSD 4B95A 1U4AA 2REXA 4HK2A 3VFKA 2GOWA 3TMPB 4F7ZA 4CO7A 3L13A 4I6LB 1P1AA 4ICVA 2KD0A 1WRDB 2D07B 2Z0EB 3IBEA 3RCZA 3ZKJC 2M1MA 5AZFA 2CR5A 4BBNC 2BYFA 3DBRI 2DYBA 1WGHA 1E8YA 3K9OB 3A9JB 4ZDVA 5KHQA 3QCAA 4IWOA 1PQSA 4AWJA 2J0MA 3DCGA 5JH5C 5D6JB 3RUIB 3PHXB 3VHTC 1RFAA 4GDLA 2DAFA 2MA9B 1KM7A 3ENEA 3UF8A 3VTVA 2KK8A 3PV1A 3A33B 4WWNA 3PRPB 5JHBA 2FUHB 3EHVA 1OGWA 5E6OA 5FR6A 4MELA 3ZVVA 2MBQA 1E7UA 3ZRCA 4ANVA 2MP2B 2DYMA 2HJ8A 2KANA 2N7DA 1GJZA 3H6NA 3GZNI 4GGQA 3R3MA 1UELA 3EC8A 1EF1A 1ZGUB 2A5UA 4MGYE 3VAWA 4DDGD 2KOXA 2FCNA 3IHPC 4HLEA 1J0GA 1Q0WB 4MGZE 2FAZA 2KJRA 2MCNB 1V5OA 1WX9A 4RM8A 5CHFA 3UIOB 1Q1OA 3C0RB 3KVFB 5G2NA 2DZKA 2N9XA 3WAPA 3LJ3A 2MRPA 3WIMA 4K7SA 1WIAA 3PT2B 3NOBA 3TBLD 3B08A 3PVLA 3PZDA 1TTNA 3CF6E 2AL3A 2IO1B 4HJKA 3V60A 2MBHA 2RGFA 2L05A 3T8MA 2MBBB 1LQBA 1WGRA 3DOWA 2IBIB 2O6VB 4KDIC 1SGHA 5E6NA 2N9EB 2DZIA 3A4SC 3CSFA 2JT4B 1KLVA 1E8WA 3TIXA 5DPWA 1WR1A 4HDOA 2N1VA 4FA6A 2KDEB 3ZUNA 4G11A 4PYZA 2C9WB 3OLMD 4A3OA 4IC7B 2KLCA 4IWPA 1WGDA 1BT0A 4KVGB 2N4FA 3PRZA 2DZMA 2J7QB 2L00B 4XZ4A 2NPTA 2AEHA 3RZWC 4AUQC 2O6VD 4KSKC 2WX0A 2BPSA 2L76A 4MM3A 2L0FA 4KZ0A 3SDLC 1YX5B 4OVUA 4URKA 4GB9A 2YVCA 4G50A 3V6EB 3I3TB 5E6PA 1WM3A 4DK5A 3ZNGC 4GOCA 3N30A 2GBKA 3VUWA 3M63B 3WAOA 2KMCA 1WXMA 5CHWA 3WA0A 2KJ6A 2CKHB 4KDLB 2O2VB 2MP2A 3JVZX 4KZCA 2LGYA 2NCNA 4MSQB 4PS8A 3TJPA 2OOBB 4JL9A 2EMSA 3AXCA 3M95A 3L10B 5J2RA 3N32A 5TR5A 3JW0X 2CU1A 2Z0DB 1GG3A 4EEWA 3RZFA 3ZRFA 2HD5B 4ANWA 4DHZE 5JZEB 1JRUA 3OJ3A 3P2BA 1SIFA 5C1ZA 2HTHA 2RSUA 5AEKB 3D32A 1XQQA 2LWPA 3RT3B 3PTFC 3SU8X 4EFOA 4TUUA 1OTRB 3L08A 2ZVOA 1E8ZA 3CSTA 1WF9A 2YLMA 1HE8A 3APFA 2WX1A 3ZO5B 2HE7A 4FJZA 4AOFA 2ZPNA 1GNUA 2N7EA 2K1FA 2GBNA 3VXWA 2LVOA 5DPSA 2KDBA 2IY1B 4BKSD 4W9EA 4WWOA 4E74A 1OQYA 3V62A 4I6NB 4BOSC 3A1QB 1WM2A 2NBVB 4WAAA 4EOYA 5GMVA 3PLUA 3HM3A 1WGYA 4GSWA 4PYUA 4YL8A 5L83A 4E71A 2FIFA 1Z2MA 2NPTB 1D3ZA 1E90A 4NNJB 3PSEB 5AZGA 1V2YA 2KC2A 2KC1A 4M0WB 4BVUC 1AARA 4HPMB 2AYOB 2WYQA 3ECIA 3M62B 3H7SA 3QQ8B 4W9JA 2KLGA 2NBUA 2DHZA 3QWZB 3JSVA 3HM6X 2N1WA 4LJOB 2LGDA 4GU2A 3VTWA 3GOEA 2MSED 1WX8A 1UBIA 3A9KB 2FIDA 4W9LA 4IG7B 4G0NB 1WZ0A 4MGIE 2V3SA 1J19A 4EZLA 5L95C 4W9HA 2K6QA 5DPTA 4F1SA 1TGZB 3QIJA 3L0WB 3NZUA 3VDZA 2DZJA 2FCMA 2JZZA 4OVVA 4G3XB 2O2VA 1WZ3A 3L54A 2LASA 3QC8B 1X1MA 2RPQA 3PPAA 3UGBB 3KYCD 5J17A 2MWSB 4FN2A 2ZPYA 3IVFA 2BYVE 2K25A 1F9JA 4MGKE 2K8CA 4DDID 2DENB 2EMTA 2K6DB 3ZNHB 4IM0A 1E7VA 1L7YA 3DPDA 3ZTCA 4BKSA 3ML9A 5JHAA 2KHWB 4IW0A 5C23A 2IZVB 2JXXA 2R2QA 4W9GA 3DBLI 1RRBA 2M0XA 4FJVB 4FHKA 2C60A 2KFKB 2D10A 4LDTB 1ZW7A 4BOZB 1OEYA 2JWZA 1V81A 3W1SA 2KQSA 2LXCA 3CMMB 1ISNA 3MTNB 2JY6A 2GMIC 2IY0B 4AJYB 4I6PA 3BINA 1WJ4A 2D11A 1P3QU 4M8NA 2IYDB 3BY4B 3DBSA 3A1QA 2BF8B 3AU5A 3WAMA 2JRIB 2LD9A 2MQJA 4HWIB 4W9DA 4W9KA 2PJHA 4LDTD 2K8HA 1WE6A 4ZRJA 2KZRA 1WY8A 2ZNVB 4FULA 4DXAB 4ZYNA 2CHZA 4JIOU 3SD5A 1YIWA 4ANUA 4W9IA 2BWES 2G4DB 3KW5B 1V9JA 1KJTA 3ZTDA 2XK5A 2ZCCA 1EO6A 3JSVB 3HHMA 2AL6A 4MH0E 2M8SA 2BKRB 3A9KA 4K7WA 4CHKA 3PGEA 4LJPB 4WWPA 2PPHA 2KTFA 3QX1A 1R4MI 4NQLB 5DPRA 2M17A 5AZHA 1L2NA 2DX5B 2KO3A 3QHTA 2OJRA 3V6CB 2BGFA 1WXAA 2G4SA 3X0WA 1NDDA 1QZEA 1A5RA 3ZW3A 3EFUA 1YQBA 4M8MA 3UQAA 3ZNID 3L17A 1I42A 3DVGY 3VQIA 4EZJA 3V61A 4BBNF 2BWFA 2EKEC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XX5 A;  3KH0 A;  2LVP A;  2WWZ A;  1T0Y A;  2M4N A;  4ZRI A;  2D2Q A;  4B9K A;  2FCQ A;  3RYT A;  2GBJ A;  3NZS A;  2W9N A;  2L3Z A;  2XBB C;  3DVG X;  2PE6 B;  3KUZ A;  3ZIM A;  2A4Z A;  2KX3 A;  2MBE A;  2L7R A;  4BKG A;  1NI2 A;  2N9P C;  2V1Y A;  2D3G A;  4MJS B;  2ZNV C;  1C3T A;  2KTR B;  1CMX B;  1UZX B;  2KFK A;  2G45 B;  4K81 A;  1IPG A;  2I1K A;  4A20 A;  4GIV A;  1WH3 A;  3KUC B;  3ZDT A;  1UBQ A;  2G3Q B;  5D7G A;  1P9D U;  1YD8 U;  3QK0 A;  3Q3F A;  2KDI A;  2KMA A;  3NS8 A;  2LRU A;  1V5T A;  1R4N I;  2ZJD A;  4HPL B;  3QAQ A;  3IG3 A;  3WAL A;  3L16 A;  2LXA A;  3AU4 A;  4GN1 A;  2GBR A;  3EEC A;  1WMH B;  1WJ6 A;  1YJ1 A;  4P7I A;  2BKF A;  2KVR A;  3Q3J A;  5J18 A;  2LI5 A;  3NHE B;  3VUY A;  2KDF B;  3B0A A;  3H7P B;  4K7U A;  1WXV A;  1P98 A;  4K1R B;  4NQK E;  1E5W A;  2C7M B;  2XK5 B;  4ZRK A;  3UIN B;  3ZNZ B;  4EKU A;  4MEM A;  2V4L A;  4FBJ B;  5LXH A;  1IP9 A;  2KXJ A;  3KYD D;  5LXI B;  2KX0 A;  5DCN A;  1MG8 A;  1WXS A;  1YX6 B;  4MDK E;  2JF5 A;  4WQO B;  3QA8 A;  4BKT A;  4IM3 A;  2ZZP B;  3PRE A;  2LRW A;  4ASW C;  3K9P B;  4WJQ A;  2Y5B B;  2DYO A;  4TV3 A;  4BFR A;  2BYE A;  2C7N B;  2IO0 B;  2RR9 A;  2KKC A;  5G55 A;  1E8X A;  1Z5S B;  3W1S C;  3HK0 A;  4RM9 A;  4TQ0 A;  3X23 A;  1C1Y B;  1GC7 A;  2LJ5 A;  1H4R A;  4LCD E;  3VTU A;  2JPH A;  1V49 A;  3QAR A;  4EUT A;  2K8B A;  4IM2 A;  4WJP A;  4X57 B;  1Y8R C;  1WE7 A;  3OJ4 B;  1GC6 A;  3W1Y A;  3OAW A;  2K39 A;  2MBO A;  3H9D A;  1EF5 A;  2UWQ A;  2ZVN A;  3R7R A;  3S2A A;  3TCA A;  2KWU B;  1FXT B;  1V86 A;  3H1U A;  3MJW A;  4MSM B;  4WJO A;  4AJW A;  4F8C B;  2NBW B;  2ZCB A;  1S1Q B;  4GMV A;  4MJS A;  1LXD A;  1Q5W B;  1RLF A;  2KTR A;  4GDK B;  3IFW B;  4NAW B;  4J6I A;  2R2O A;  5EDS A;  3DQV A;  1I35 A;  1P0R A;  1K8R B;  3DVN U;  1V80 A;  2UYZ B;  3UIP B;  2Z59 B;  2RD0 A;  1WFY A;  2KWV B;  4II2 B;  1WJN A;  2JRH A;  1WR6 E;  3APC A;  2I1J A;  2LUE A;  4HDQ A;  5D2M B;  5D94 A;  3DBH I;  4NJ6 A;  3U30 A;  3PHW B;  1WMH A;  4KIK A;  1WX7 A;  3UQB A;  1WYW B;  3U7D A;  2MX2 A;  4IWQ A;  2KN5 A;  3ZDM C;  4DHZ B;  2NVU I;  3H7P A;  4ANX A;  1G6J A;  2IO2 B;  3AI5 A;  2MW5 A;  3HIZ A;  3PLV A;  1RAX A;  4DWF A;  2CHX A;  3N3K B;  2J0K A;  3ALB A;  4IUM B;  2FCS A;  4NPN A;  4JGH B;  5CTR C;  1TBE A;  4NY0 A;  2XEW A;  4FHJ A;  1WGG A;  4JQW C;  4HXD A;  1KOT A;  4RMA A;  3LDZ E;  2KWC A;  3QJZ A;  2DAJ A;  5IAA C;  3SHQ A;  2KFJ A;  4FJY A;  2NS5 A;  2B3A A;  2ZEQ A;  3DVN V;  4NJ7 A;  2LZ6 A;  4PS3 A;  3ZLZ A;  1VCB A;  2CS4 A;  2JZ3 B;  4CYE A;  5LLI A;  4JLC A;  1LM8 B;  3DDC B;  3A9J A;  2KNB A;  2QHO A;  2VRR B;  4A3P A;  1TZ1 A;  4N9F 4;  4W9F A;  3WAN A;  3NY5 A;  2J0J A;  4GDL B;  1EUV B;  3AUL A;  5CX3 A;  1WI0 A;  2JVC A;  2IO3 B;  3VUX A;  3VVW B;  1NBF C;  1UGM A;  1XT9 B;  2WDT B;  3M3J A;  3VH4 B;  3ONS A;  1H8C A;  2L8J A;  3B1L X;  1M94 A;  3PS6 A;  4HCN B;  5HKH A;  1ZKH A;  4DBG A;  1IYF A;  4W9C A;  5KHO A;  3APD A;  3RUL A;  3R7Q A;  3R66 C;  3RD2 A;  3T9L A;  4PS7 A;  5CHV C;  3A4R A;  1S3S G;  1GUA B;  2ASQ A;  4GDK A;  4NAW A;  4XC2 A;  4DHJ B;  4ICU A;  2GBM A;  2C7H A;  4FLH A;  2PEA A;  3TL5 A;  3O65 B;  4FAD A;  3JYU A;  2LVQ A;  5BO4 B;  4B6W A;  4EZK A;  4TKN A;  1V6E A;  1VD2 A;  2AWT A;  1LFD A;  2MLB A;  2JUO A;  2NR2 A;  1WJU A;  2PE9 A;  3ML8 A;  3VH3 B;  4KSL C;  4TQ1 A;  5IA7 A;  4WJN A;  3KUD B;  4GXB A;  4KIK B;  4HVB A;  1J8C A;  2C5L C;  2L0T A;  2KQ7 A;  4DHJ D;  1UH6 A;  4HCP B;  4AP4 C;  1OEY J;  2KJH B;  4II3 B;  4E3C A;  3PRM B;  4KV2 A;  1SE9 A;  3U8Z A;  1UD7 A;  1XD3 B;  2CHW A;  2O6V A;  2FNJ B;  2LGX A;  3MHS D;  4B95 A;  1U4A A;  2REX A;  4HK2 A;  3VFK A;  2GOW A;  3TMP B;  4F7Z A;  4CO7 A;  3L13 A;  4I6L B;  1P1A A;  4ICV A;  2KD0 A;  1WRD B;  2D07 B;  2Z0E B;  3IBE A;  3RCZ A;  3ZKJ C;  2M1M A;  5AZF A;  2CR5 A;  4BBN C;  2BYF A;  3DBR I;  2DYB A;  1WGH A;  1E8Y A;  3K9O B;  3A9J B;  4ZDV A;  5KHQ A;  3QCA A;  4IWO A;  1PQS A;  4AWJ A;  2J0M A;  3DCG A;  5JH5 C;  5D6J B;  3RUI B;  3PHX B;  3VHT C;  1RFA A;  4GDL A;  2DAF A;  2MA9 B;  1KM7 A;  3ENE A;  3UF8 A;  3VTV A;  2KK8 A;  3PV1 A;  3A33 B;  4WWN A;  3PRP B;  5JHB A;  2FUH B;  3EHV A;  1OGW A;  5E6O A;  5FR6 A;  4MEL A;  3ZVV A;  2MBQ A;  1E7U A;  3ZRC A;  4ANV A;  2MP2 B;  2DYM A;  2HJ8 A;  2KAN A;  2N7D A;  1GJZ A;  3H6N A;  3GZN I;  4GGQ A;  3R3M A;  1UEL A;  3EC8 A;  1EF1 A;  1ZGU B;  2A5U A;  4MGY E;  3VAW A;  4DDG D;  2KOX A;  2FCN A;  3IHP C;  4HLE A;  1J0G A;  1Q0W B;  4MGZ E;  2FAZ A;  2KJR A;  2MCN B;  1V5O A;  1WX9 A;  4RM8 A;  5CHF A;  3UIO B;  1Q1O A;  3C0R B;  3KVF B;  5G2N A;  2DZK A;  2N9X A;  3WAP A;  3LJ3 A;  2MRP A;  3WIM A;  4K7S A;  1WIA A;  3PT2 B;  3NOB A;  3TBL D;  3B08 A;  3PVL A;  3PZD A;  1TTN A;  3CF6 E;  2AL3 A;  2IO1 B;  4HJK A;  3V60 A;  2MBH A;  2RGF A;  2L05 A;  3T8M A;  2MBB B;  1LQB A;  1WGR A;  3DOW A;  2IBI B;  2O6V B;  4KDI C;  1SGH A;  5E6N A;  2N9E B;  2DZI A;  3A4S C;  3CSF A;  2JT4 B;  1KLV A;  1E8W A;  3TIX A;  5DPW A;  1WR1 A;  4HDO A;  2N1V A;  4FA6 A;  2KDE B;  3ZUN A;  4G11 A;  4PYZ A;  2C9W B;  3OLM D;  4A3O A;  4IC7 B;  2KLC A;  4IWP A;  1WGD A;  1BT0 A;  4KVG B;  2N4F A;  3PRZ A;  2DZM A;  2J7Q B;  2L00 B;  4XZ4 A;  2NPT A;  2AEH A;  3RZW C;  4AUQ C;  2O6V D;  4KSK C;  2WX0 A;  2BPS A;  2L76 A;  4MM3 A;  2L0F A;  4KZ0 A;  3SDL C;  1YX5 B;  4OVU A;  4URK A;  4GB9 A;  2YVC A;  4G50 A;  3V6E B;  3I3T B;  5E6P A;  1WM3 A;  4DK5 A;  3ZNG C;  4GOC A;  3N30 A;  2GBK A;  3VUW A;  3M63 B;  3WAO A;  2KMC A;  1WXM A;  5CHW A;  3WA0 A;  2KJ6 A;  2CKH B;  4KDL B;  2O2V B;  2MP2 A;  3JVZ X;  4KZC A;  2LGY A;  2NCN A;  4MSQ B;  4PS8 A;  3TJP A;  2OOB B;  4JL9 A;  2EMS A;  3AXC A;  3M95 A;  3L10 B;  5J2R A;  3N32 A;  5TR5 A;  3JW0 X;  2CU1 A;  2Z0D B;  1GG3 A;  4EEW A;  3RZF A;  3ZRF A;  2HD5 B;  4ANW A;  4DHZ E;  5JZE B;  1JRU A;  3OJ3 A;  3P2B A;  1SIF A;  5C1Z A;  2HTH A;  2RSU A;  5AEK B;  3D32 A;  1XQQ A;  2LWP A;  3RT3 B;  3PTF C;  3SU8 X;  4EFO A;  4TUU A;  1OTR B;  3L08 A;  2ZVO A;  1E8Z A;  3CST A;  1WF9 A;  2YLM A;  1HE8 A;  3APF A;  2WX1 A;  3ZO5 B;  2HE7 A;  4FJZ A;  4AOF A;  2ZPN A;  1GNU A;  2N7E A;  2K1F A;  2GBN A;  3VXW A;  2LVO A;  5DPS A;  2KDB A;  2IY1 B;  4BKS D;  4W9E A;  4WWO A;  4E74 A;  1OQY A;  3V62 A;  4I6N B;  4BOS C;  3A1Q B;  1WM2 A;  2NBV B;  4WAA A;  4EOY A;  5GMV A;  3PLU A;  3HM3 A;  1WGY A;  4GSW A;  4PYU A;  4YL8 A;  5L83 A;  4E71 A;  2FIF A;  1Z2M A;  2NPT B;  1D3Z A;  1E90 A;  4NNJ B;  3PSE B;  5AZG A;  1V2Y A;  2KC2 A;  2KC1 A;  4M0W B;  4BVU C;  1AAR A;  4HPM B;  2AYO B;  2WYQ A;  3ECI A;  3M62 B;  3H7S A;  3QQ8 B;  4W9J A;  2KLG A;  2NBU A;  2DHZ A;  3QWZ B;  3JSV A;  3HM6 X;  2N1W A;  4LJO B;  2LGD A;  4GU2 A;  3VTW A;  3GOE A;  2MSE D;  1WX8 A;  1UBI A;  3A9K B;  2FID A;  4W9L A;  4IG7 B;  4G0N B;  1WZ0 A;  4MGI E;  2V3S A;  1J19 A;  4EZL A;  5L95 C;  4W9H A;  2K6Q A;  5DPT A;  4F1S A;  1TGZ B;  3QIJ A;  3L0W B;  3NZU A;  3VDZ A;  2DZJ A;  2FCM A;  2JZZ A;  4OVV A;  4G3X B;  2O2V A;  1WZ3 A;  3L54 A;  2LAS A;  3QC8 B;  1X1M A;  2RPQ A;  3PPA A;  3UGB B;  3KYC D;  5J17 A;  2MWS B;  4FN2 A;  2ZPY A;  3IVF A;  2BYV E;  2K25 A;  1F9J A;  4MGK E;  2K8C A;  4DDI D;  2DEN B;  2EMT A;  2K6D B;  3ZNH B;  4IM0 A;  1E7V A;  1L7Y A;  3DPD A;  3ZTC A;  4BKS A;  3ML9 A;  5JHA A;  2KHW B;  4IW0 A;  5C23 A;  2IZV B;  2JXX A;  2R2Q A;  4W9G A;  3DBL I;  1RRB A;  2M0X A;  4FJV B;  4FHK A;  2C60 A;  2KFK B;  2D10 A;  4LDT B;  1ZW7 A;  4BOZ B;  1OEY A;  2JWZ A;  1V81 A;  3W1S A;  2KQS A;  2LXC A;  3CMM B;  1ISN A;  3MTN B;  2JY6 A;  2GMI C;  2IY0 B;  4AJY B;  4I6P A;  3BIN A;  1WJ4 A;  2D11 A;  1P3Q U;  4M8N A;  2IYD B;  3BY4 B;  3DBS A;  3A1Q A;  2BF8 B;  3AU5 A;  3WAM A;  2JRI B;  2LD9 A;  2MQJ A;  4HWI B;  4W9D A;  4W9K A;  2PJH A;  4LDT D;  2K8H A;  1WE6 A;  4ZRJ A;  2KZR A;  1WY8 A;  2ZNV B;  4FUL A;  4DXA B;  4ZYN A;  2CHZ A;  4JIO U;  3SD5 A;  1YIW A;  4ANU A;  4W9I A;  2BWE S;  2G4D B;  3KW5 B;  1V9J A;  1KJT A;  3ZTD A;  2XK5 A;  2ZCC A;  1EO6 A;  3JSV B;  3HHM A;  2AL6 A;  4MH0 E;  2M8S A;  2BKR B;  3A9K A;  4K7W A;  4CHK A;  3PGE A;  4LJP B;  4WWP A;  2PPH A;  2KTF A;  3QX1 A;  1R4M I;  4NQL B;  5DPR A;  2M17 A;  5AZH A;  1L2N A;  2DX5 B;  2KO3 A;  3QHT A;  2OJR A;  3V6C B;  2BGF A;  1WXA A;  2G4S A;  3X0W A;  1NDD A;  1QZE A;  1A5R A;  3ZW3 A;  3EFU A;  1YQB A;  4M8M A;  3UQA A;  3ZNI D;  3L17 A;  1I42 A;  3DVG Y;  3VQI A;  4EZJ A;  3V61 A;  4BBN F;  2BWF A;  2EKE C; 
#chains in the Genus database with same CATH topology
 4XX5 A;  3AEB B;  5G5G A;  1XLO A;  2CJO A;  2A4Z A;  1ZXH A;  4A6Q A;  3SR6 A;  2L7R A;  4BKG A;  2N9P C;  2KTR B;  1UZX B;  4K81 A;  2D3A A;  2I1K A;  3T3O A;  1PYW D;  1WH3 A;  3KUC B;  1CQV A;  1UBQ A;  4YWG G;  2G3Q B;  1P9D U;  3Q3F A;  3AH7 A;  4YTP B;  1TS3 A;  2ZJD A;  1ZOY B;  4DQO C;  2KQ4 X;  1WMH B;  1YJ1 A;  2JYT A;  2XK5 B;  3V3X A;  3NVW A;  2V4L A;  4OZC A;  3Q8F A;  3KYD D;  5LXI B;  1MG8 A;  2QIL A;  4BKT A;  3QA8 A;  4A9A A;  3P4R B;  4WJQ A;  4BFR A;  1PDX A;  2KKC A;  3IAM 1;  3X23 A;  3P4S B;  1HTO A;  2LJ5 A;  1H4R A;  4LCD E;  2LHE A;  4EUT A;  2K8B A;  4HEA 1;  5HG2 A;  1Y8R C;  3OJ4 B;  3ETR A;  3OAW A;  2QCZ A;  1MPE A;  3TCA A;  1NYR A;  4OZA A;  4AJW A;  2ZCB A;  4GMV A;  2QMT A;  4MJS A;  1LXD A;  4GDK B;  1R7S A;  4J6I A;  1FRR A;  1YQ3 B;  1I35 A;  3Q14 C;  2SEB D;  3DVN U;  2Z59 B;  1DOI A;  2WDR B;  1WR6 E;  2I1J A;  5D94 A;  2QEJ C;  3J9C A;  1BUI C;  3U30 A;  4KIK A;  1IGC A;  2ONQ A;  4LK0 M;  2MX2 A;  1TY0 A;  1MJD A;  3ZDM C;  4DHZ B;  3H7P A;  3AI5 A;  3HIZ A;  3PLV A;  4DWF A;  1RAX A;  2CHX A;  5CTR C;  4JGH B;  2MHJ A;  2KMM A;  1TBE A;  3AE4 B;  3MFG A;  2WXR A;  4RMA A;  2KVZ A;  4YSZ B;  2KFJ A;  1QLB B;  4PS3 A;  3AE3 B;  4JLC A;  2RDH A;  2QHO A;  1TZ1 A;  4N9F 4;  4W9F A;  3NY5 A;  3AUL A;  3I9V 1;  5CX3 A;  1UWM A;  3VVW B;  1L0V B;  4WQM A;  2XNA C;  3M3J A;  3ONS A;  1KLG D;  4DBG A;  1B1Z A;  3R66 C;  3BVZ A;  1V1O A;  3T9L A;  2LUM A;  3W2D A;  2VZK D;  3OWE B;  4DHJ B;  1FMA D;  4ICU A;  3TL5 A;  3O65 B;  4N58 A;  2VH2 A;  4XWT A;  2M0A A;  2MLB A;  1WJU A;  4KSL C;  1J7B A;  3KUD B;  3NS1 A;  1WWT A;  2C5L C;  2L0T A;  4AP4 C;  1AYF A;  1JW9 D;  4II3 B;  1V1P A;  3PRM B;  2W55 A;  1UD7 A;  2JYE A;  1FIQ A;  4AQ7 A;  1U4A A;  1L5P A;  3R2I A;  3VFK A;  2GOW A;  3L13 A;  1T3Q A;  1P1A A;  4ICV A;  2D07 B;  3IBE A;  3RCZ A;  2M1M A;  3AM9 A;  3TSS A;  3N9Y C;  1GAQ B;  1WGK A;  3K9O B;  5KHQ A;  4LTU A;  4YXD B;  3H8H A;  2INC C;  1RFA A;  4O1N A;  3KWV A;  3UF8 A;  3VTV A;  2FUH B;  5E6O A;  4KX6 B;  1DOX A;  5FR6 A;  4MEL A;  3PO0 A;  3ZRC A;  3N20 C;  2DYM A;  2HJ8 A;  2N7D A;  4GGQ A;  3EC8 A;  3GE8 C;  2FCN A;  3HUI A;  2FAZ A;  2KJR A;  4RM8 A;  3C0R B;  5G2N A;  1B9R A;  4HKQ A;  1C4C A;  1E6E B;  2DZK A;  2N9X A;  1QOF A;  3WIM A;  1K50 A;  2CU3 A;  3WCQ A;  1YN3 A;  3B08 A;  3PZD A;  1OQR A;  1VJK A;  3CF6 E;  3AB5 A;  5IP4 D;  2MBH A;  2RGF A;  3T8M A;  2MBB B;  2BB5 A;  3NVY A;  2JX5 A;  2O6V B;  2QJL A;  3A4S C;  2DZI A;  3CSF A;  1E8W A;  2N1V A;  3O13 A;  4A3O A;  2C9W B;  1WGD A;  1BT0 A;  4A8X C;  2PIA A;  4AUQ C;  1ZDV A;  3SDL C;  2WX0 A;  2BPS A;  4KZ0 A;  3B9J A;  2FBW B;  3VR9 B;  4URK A;  5AUK A;  3P4Q B;  1V8C A;  3Q8B A;  1WM3 A;  3GZN B;  1F2R I;  3ZNG C;  1E9M A;  3N30 A;  2RDB C;  4B0M A;  3M63 B;  2O2V B;  3TJP A;  2EMS A;  3AXC A;  3DBL B;  3AV8 A;  5IOI A;  1XLN A;  3N32 A;  3MC9 A;  3JW0 X;  3NJT A;  2AQ1 B;  3OJ3 A;  3P2B A;  4BAX A;  5C1Z A;  1FNV A;  4XWW A;  2I2Y A;  2LWP A;  3SU8 X;  2V3P A;  4C56 C;  1E8Z A;  1WF9 A;  2YLM A;  3APF A;  3ZO5 B;  2WS3 B;  2KYW A;  2IY1 B;  2J4X A;  4E74 A;  1OQY A;  4BOS C;  2BS3 B;  1WM2 A;  4WAA A;  2L32 A;  5D3I B;  1D6E C;  2H88 B;  5L83 A;  1Z2M A;  4NNJ B;  3PSE B;  2KC2 A;  4M0W B;  1AAR A;  3M62 B;  3H7S A;  3QQ8 B;  4REZ A;  2NBU A;  2DHZ A;  2N1W A;  3A9K B;  1OFF A;  4W9H A;  2QIE B;  3QIJ A;  3NZU A;  1TS4 A;  2CJN A;  2MWS B;  2ZPY A;  3IVF A;  1T0Q C;  2K8C A;  4DDI D;  3NG0 A;  3TEW A;  3SFE B;  1HXY D;  5HI1 A;  1I4H A;  3DPD A;  4RGM A;  5EE9 A;  2KHW B;  2KWD A;  5C23 A;  2V4I B;  2R2Q A;  4W9G A;  1RRB A;  2C60 A;  1T6B X;  1R4N B;  4K3C A;  1XLQ A;  2WXK A;  2JWZ A;  3W1S A;  2KQS A;  3AE2 B;  3CMM B;  4I6P A;  3BIN A;  2WU5 B;  4US8 A;  3A1Q A;  2JRI B;  2N9L A;  1F77 A;  4WIP A;  2NTS A;  3VR8 B;  3MP9 A;  2K8H A;  1WE6 A;  2R61 A;  4FUL A;  1ZDX A;  4ZYN A;  1KF6 B;  3PZ7 A;  2CHZ A;  1KLU D;  1YIW A;  4ANU A;  2BWE S;  4ZHP A;  3AEG B;  4MH0 E;  1BXT A;  2M8S A;  2BKR B;  4K7W A;  3NUH B;  5BYQ A;  1L2N A;  1R4M I;  5DPR A;  2M17 A;  1ZUD 2;  2DX5 B;  3V6C B;  1XEE A;  4XDD A;  3UQA A;  3V61 A;  1ET6 A;  4ZRI A;  2D2Q A;  4B9K A;  1ZXI A;  4NAM A;  4OZB A;  3NZS A;  2XBB C;  3Q69 A;  2PE6 B;  5HHD G;  3NVV A;  2KX3 A;  1SE2 A;  2JWU A;  2J52 A;  4MJS B;  1QKZ A;  2KFK A;  2G45 B;  1GB1 A;  3DBH B;  4RF1 A;  3IAS 1;  4PK1 A;  3ZDT A;  4YSX B;  1YD8 U;  3QK0 A;  4M02 A;  3NS8 A;  4HPL B;  3QAQ A;  3WAL A;  3L16 A;  2LXA A;  1QIL A;  1TS2 A;  1WJ6 A;  1JRO A;  4P7I A;  1GOZ A;  2WXL A;  3VUY A;  3H7P B;  1VR9 A;  1WXV A;  1P98 A;  4YT0 B;  4NQK E;  1QF6 A;  1UUP A;  3ZNZ B;  3HVZ A;  2PVO D;  3Q8A A;  5LXH A;  1IP9 A;  1WXS A;  4ASW C;  4Q2J A;  2G9H D;  2Y5B B;  4TV3 A;  2K9X A;  2C7N B;  1E8X A;  4RM9 A;  5G5H A;  2JZP A;  4K3B A;  1FRD A;  4JPS A;  4WJP A;  1IBX A;  3TUO A;  1GC6 A;  2ACZ B;  3KLS X;  1EU4 A;  1EF5 A;  2ZVN A;  3R7R A;  2KWU B;  2NBW B;  3C19 A;  1S1Q B;  1Q5W B;  1RLF A;  3EA6 A;  4C00 A;  3RFZ B;  5EDS A;  2W3R A;  3BYY B;  3FIL A;  1PUT A;  4MAC A;  2RD0 A;  1WFY A;  2KWV B;  1WJN A;  4HDQ A;  5D2M B;  2H89 B;  3UQB A;  1WYW B;  1V1P B;  2KN5 A;  2NVU I;  2IO2 B;  2J53 A;  2V3N A;  2WQY B;  1QOB A;  3RNA C;  3N3K B;  1HZ6 A;  4IOI E;  4FHJ A;  4JQW C;  4HXD A;  2WHI A;  1RFK A;  3LDZ E;  4OHJ A;  4KGS A;  3ZYY X;  2DAJ A;  4US9 A;  3SHQ A;  4FJY A;  2ZEQ A;  2LZ6 A;  4CYE A;  1TS5 A;  1NVI D;  2KNB A;  2KDM A;  2VRR B;  1CZP A;  5EE1 A;  2VZK B;  4TMA B;  1KTK A;  2J0J A;  1JWS D;  3NRZ A;  2IO3 B;  3VUX A;  1NBF C;  2L8J A;  1IYF A;  5HKH A;  4W9C A;  4PS7 A;  1FFV A;  3A4R A;  1GUA B;  2ASQ A;  4NAW A;  4XC2 A;  3SEB A;  4NZL B;  2LVQ A;  5BO4 B;  4TKN A;  2ZW0 A;  1V6E A;  1VD2 A;  4JWU C;  1J7C A;  1LFD A;  2NR2 A;  2PE9 A;  4HRO A;  3VH3 B;  3ML8 A;  2BT6 A;  4TQ1 A;  4HJG E;  4WJN A;  1BML C;  4YSY B;  3BVM A;  1FXA A;  4KV2 A;  1SE9 A;  3U8Z A;  1PGB A;  2HJ1 A;  3RNC C;  2BTE A;  3U2S C;  2V0G A;  4A90 A;  4B95 A;  4HK2 A;  3TMP B;  4F7Z A;  3EFC A;  4I6L B;  1I7H A;  2KAJ A;  3DHH C;  3ZKJ C;  2HDE A;  3A9J B;  4L1B A;  2B76 B;  3HRD D;  4IWO A;  2WP9 B;  2D3C A;  3DCG A;  4C80 A;  2JQR B;  2K3U A;  3PHX B;  3VHT C;  2DAF A;  1ZPS A;  1KM7 A;  2GRI A;  3Q3O C;  3ENE A;  3BII D;  3PV1 A;  3A33 B;  1XF5 L;  1SSN A;  2VH1 A;  3ZVV A;  1JQ4 A;  1GB4 A;  1Q10 A;  3GZN I;  4IKG A;  1J0G A;  1C78 A;  4MGY E;  4HLE A;  1F0Z A;  2I38 A;  4JE3 B;  1Q0W B;  1TT5 B;  5CHF A;  3UIO B;  5BYR A;  1P7E A;  4N59 A;  5D3D A;  2MRP A;  4ZOH C;  1F2R C;  1WIA A;  4LNI A;  3NOB A;  3TBL D;  2BB6 A;  2AL3 A;  4HJK A;  3V60 A;  2L05 A;  4ZYS A;  1WGR A;  3DOW A;  5GXG B;  3DBR B;  1SGH A;  3NZ3 A;  1TKE A;  3URY A;  5DPW A;  2WXJ A;  2KDE B;  3N1Y C;  4G11 A;  2KLC A;  4IWP A;  2INP E;  4KVG B;  2L00 B;  2NPT A;  2RMM A;  4RGN A;  5BYS A;  2L76 A;  1N63 A;  4OVU A;  1HEZ E;  3V6E B;  4DK5 A;  1L0Y B;  1TIF A;  2KMC A;  4D2K A;  5CHW A;  3WA0 A;  2WXQ A;  2CKH B;  4PS8 A;  2OOB B;  3M95 A;  3L10 B;  2KN4 A;  5TR5 A;  2IJ0 A;  2RPV A;  2PTL A;  4EEW A;  4AS1 A;  3RZF A;  2HD5 B;  1NEN B;  3IT4 B;  5JXV A;  1SIF A;  3LYY A;  3D32 A;  1FO4 A;  3RT3 B;  1P7F A;  1QT9 A;  2HE7 A;  4FJZ A;  4MH8 A;  1IGD A;  1ACC A;  2LVO A;  5DPS A;  1E7P B;  2IPK D;  4WWO A;  1FM0 D;  1F52 A;  4I6N B;  3A1Q B;  2NBV B;  3ZQ4 A;  5GMV A;  4WAF A;  4E71 A;  1D3Z A;  1JAL A;  5AZG A;  4MM3 B;  1FNU A;  2KC1 A;  5H8Y E;  2WYQ A;  3ECI A;  2KLG A;  3QWZ B;  4LJO B;  2LGD A;  3VTW A;  1WX8 A;  2FID A;  4MGI E;  4G0N B;  1WZ0 A;  2N7J A;  1C4A A;  3TEX A;  2LAS A;  1JWA D;  2RPQ A;  2LJI A;  3IT6 B;  3UGB B;  2BYV E;  2K25 A;  4MGK E;  4IM0 A;  4LNO A;  1L7Y A;  3ZTC A;  2E6X A;  3ABV B;  4RGT A;  4IW0 A;  5I4D A;  4FJV B;  4FHK A;  2M0X A;  1MFW A;  5AUI A;  2KFK B;  1ISN A;  2JY6 A;  2IY0 B;  4AJY B;  1P3Q U;  2IYD B;  3DHI C;  3BY4 B;  2NMQ A;  3U4E G;  4J3O D;  2BF8 B;  2LD9 A;  1K53 A;  3U52 E;  2PJH A;  4LDT D;  1ESF A;  4RNA A;  2KZR A;  1EWY C;  3SD5 A;  2JXT A;  3ZJU A;  1C79 A;  3KW5 B;  1I4Q A;  2G4D B;  1V9J A;  2XK5 A;  4XGA B;  4ZHO A;  3JSV B;  4RFB A;  3HHM A;  1YN5 A;  2WXP A;  2IGD A;  4CHK A;  2INN E;  2PPH A;  3QX1 A;  2DNF A;  3ZJV A;  2KO3 A;  2Y5P A;  3T3N A;  1WXA A;  3DWG C;  1YQB A;  4M8M A;  1TY2 A;  3L17 A;  1I4P A;  2BWF A;  2PVG C;  2LVP A;  2M4N A;  2RDG A;  2FCQ A;  3CWI A;  2GBJ A;  1A70 A;  3W5V B;  2W9N A;  3KUZ A;  3TEZ A;  3ZIM A;  1YN4 A;  3UI3 A;  1FNW A;  1NI2 A;  4FXC A;  1CMX B;  4L23 A;  2AQ2 B;  2WNM A;  3LXF A;  5D7G A;  4LNN A;  3FIL B;  2YEP F;  2KDI A;  1C4P A;  3AE5 B;  3EEC A;  2BKF A;  4XYC A;  3GE3 C;  5J18 A;  2LI5 A;  1XCQ L;  3NHE B;  4K1R B;  4JWS C;  1QOG A;  2C7M B;  4MEM A;  2X8X X;  1TKG A;  2KXJ A;  2KX0 A;  5DCN A;  2ZZP B;  2LRW A;  1JCK B;  1L0X B;  4P1B C;  5G55 A;  1Z5S B;  3W1S C;  1VDV A;  4TQ0 A;  1C1Y B;  1YQ4 B;  1V49 A;  4B0E A;  1WE7 A;  1ROE A;  1KFY B;  2JSV X;  4ARI A;  1LGR A;  2UWQ A;  3S2A A;  4WJO A;  1T0S C;  1PGA A;  4MSM B;  4F8C B;  3PZ8 A;  3CIR B;  1L4D B;  3FC4 A;  3IFW B;  4NAW B;  4ACF A;  4M00 A;  1VLB A;  1V97 A;  3N1X C;  1P0R A;  2AX5 A;  1PGX A;  1K8R B;  4L2Y A;  2WGS A;  1V80 A;  3SFD B;  3UIP B;  1N61 A;  4II2 B;  2JRH A;  3APC A;  1JWU D;  2LUE A;  1AW7 A;  4NJ6 A;  3U7D A;  1HTQ A;  1DOY A;  3Q3M C;  3AEC B;  4ANX A;  3AN1 A;  4IUM B;  2HTM E;  3ALB A;  4NY0 A;  2XEW A;  1KOT A;  1VZ7 A;  4WWM A;  4H2A A;  5IAA C;  2L83 A;  2WXO A;  3AE7 B;  2L1A A;  2NS5 A;  4NJ7 A;  3ZLZ A;  1VCB A;  2PLP A;  1LM8 B;  2Y5C A;  3P4P B;  4A3P A;  3WAN A;  1EUV B;  1I4R A;  1WI0 A;  3BZD B;  4HPP A;  1UGM A;  2WDT B;  3VH4 B;  3B1L X;  4HCN B;  3PS6 A;  1ZKH A;  1J7A A;  5KHO A;  3RNB C;  3RUL A;  3R7Q A;  3W5U B;  2GBM A;  2PEA A;  4FAD A;  4EZK A;  2AWT A;  1QOA A;  1NYQ A;  4XDC A;  5IA7 A;  4GXB A;  4KIK B;  4HVB A;  3KWL A;  2KQ7 A;  1MI0 A;  1UH6 A;  1K51 A;  4HCP B;  3Q2A C;  2MJD A;  1N62 A;  4RH6 A;  1XD3 B;  2YEP B;  2CHW A;  2O6V A;  2LGX A;  1N6Z A;  2REX A;  1YJJ A;  1FD6 A;  4CO7 A;  1EM7 A;  2W3S A;  4UDU C;  2KD0 A;  1WRD B;  4OVZ A;  1EWC A;  5AZF A;  2BBC A;  2CR5 A;  3DBR I;  2ICI A;  2DYB A;  2QSD A;  1PQS A;  3N1Z C;  4C4V A;  3E56 A;  5JH5 C;  2Q5W D;  1XO3 A;  1WYG A;  4GDL A;  1TZO A;  2NTT A;  3AE6 B;  1D5M C;  2KK8 A;  4RF0 A;  4WH4 A;  1SBB B;  4WWN A;  5JHB A;  3EHV A;  2MBQ A;  2K0P A;  4ARC A;  1FCL A;  1OQQ A;  1KLV A;  1EF1 A;  1ZGU B;  2BW2 A;  3VAW A;  4DDG D;  4MGZ E;  2MCN B;  1UGJ A;  3AE8 B;  3LJ3 A;  3PT2 B;  3PVL A;  2IDY A;  2XN9 C;  1LQB A;  2IBI B;  1JWB D;  4KDI C;  2JT4 B;  4N6E B;  3TIX A;  1WR1 A;  4HDO A;  4DXG A;  4FA6 A;  2D3B A;  3RI7 C;  3ZUN A;  3OLM D;  1C77 A;  4IC7 B;  3PRZ A;  4XZ4 A;  2AEH A;  1ZE3 D;  2WXG A;  1YX5 B;  3FKY A;  2K22 A;  4GB9 A;  2YVC A;  5E6P A;  1UWX A;  1WRI A;  2BYT A;  4GOC A;  1UF0 A;  3ZJT A;  2L52 A;  3VUW A;  4C7Z A;  2KJ6 A;  3AEF B;  4MSQ B;  2MP2 A;  2LGY A;  3AE1 B;  1JRP A;  1I4X A;  5J2R A;  4MT5 A;  3P1M A;  2CU1 A;  3NVZ A;  1SXT A;  4ZRQ A;  4S17 A;  1N5X A;  3PTF C;  4EFO A;  2D5G A;  2OED A;  1T0R C;  1JML A;  4NJC A;  4LLG M;  1I4G A;  1GNU A;  2N7E A;  2GBN A;  1ET9 A;  2KDB A;  2FUG 1;  4W9E A;  2G1E A;  3V62 A;  4EOY A;  3PLU A;  1WGY A;  5IN7 A;  3W9C B;  1R4M B;  3AE9 B;  1V2Y A;  2AYO B;  3EGR A;  1HA5 A;  2WXN A;  3HM6 X;  3Q6B A;  3ZXR A;  2GLS A;  3E9S A;  1UBI A;  1N60 A;  4P1C C;  2V3S A;  1J19 A;  4YTM B;  2K6Q A;  5DPT A;  2EEL A;  1M4V A;  1TGZ B;  1SF0 A;  2DZJ A;  2FCM A;  4GLS C;  4G3X B;  1X1M A;  3PPA A;  3KYC D;  4FN2 A;  3BYT B;  2TSS A;  1F9J A;  3FAH A;  2K6D B;  3ZNH B;  3ML9 A;  3OG5 A;  1VZ8 A;  3Q8E A;  2JXX A;  1YNT E;  3DBL I;  4HRS A;  4LDT B;  4BOZ B;  1OEY A;  1TJE A;  1AWD A;  1FFU A;  2LXC A;  3MTN B;  1FEH A;  1WJ4 A;  4JX1 C;  4M8N A;  1C9F A;  3DBS A;  3RN9 C;  4KGT A;  2M56 B;  1MHX A;  3AU5 A;  4HWI B;  4W9K A;  4QAY A;  2IGG A;  1RWS A;  3ZTD A;  2DLB A;  3U7Z A;  3BWU D;  4WWP A;  4NQL B;  2KTF A;  3GS2 A;  1NEK B;  4EE2 A;  1A5R A;  1NDD A;  3MC0 B;  1I42 A;  2Z8L A;  3RNF C;  3KH0 A;  1D4B A;  2WWZ A;  3Q3N C;  1T0Y A;  3RYT A;  2WU2 B;  1F1H A;  2L3Z A;  3DVG X;  2MBE A;  1MVK A;  3IXS A;  2V1Y A;  2D3G A;  2ZNV C;  1C3T A;  1VZ6 A;  1IPG A;  4A20 A;  4GIV A;  2ON8 A;  4C7Y A;  5C3J B;  2KMA A;  2LRU A;  1FXI A;  1R4N I;  1V5T A;  3IG3 A;  4GN1 A;  3AU4 A;  2GBR A;  2E3T A;  1YOV B;  1DGJ A;  3DWM A;  2KVR A;  3Q3J A;  2KDF B;  3B0A A;  4K7U A;  1E5W A;  4ZRK A;  4EKU A;  3UIN B;  4TSS A;  1JWM D;  4FBJ B;  2ZW1 A;  2KAC A;  1YX6 B;  4MDK E;  2JF5 A;  3BVG A;  1EU3 A;  4WQO B;  4IM3 A;  3PRE A;  4R3D A;  3K9P B;  3P63 A;  3R8B A;  2DYO A;  2BYE A;  2IO0 B;  2GB1 A;  2RR9 A;  3HK0 A;  1GC7 A;  1RYJ A;  3VTU A;  2LGI A;  2JPH A;  3QAR A;  4IM2 A;  4X57 B;  1ENF A;  4P16 A;  3W1Y A;  2K39 A;  2MBO A;  3H9D A;  4USA A;  1FXT B;  1V86 A;  3H1U A;  3MJW A;  2MJ3 A;  3Q8C A;  2KTR A;  1FCC C;  1SE3 A;  2R2O A;  3DQV A;  2LFI A;  2UYZ B;  1L6U A;  2WLB A;  3DBH I;  5MPO A;  4S0R A;  3I5J C;  4CQN A;  3PHW B;  2AQ3 B;  1WMH A;  3ZXV A;  4XE0 A;  1WX7 A;  4IWQ A;  1G6J A;  2LEK A;  3HVD A;  2MW5 A;  3R2T A;  1LO5 D;  2WDQ B;  4NPN A;  2J0K A;  1CK1 A;  2FCS A;  3EUB 2;  1L6V A;  1WGG A;  2LGS A;  2N0S B;  3QJZ A;  2KWC A;  4LNK A;  2BQQ A;  2B3A A;  3DVN V;  1UNS A;  2CS4 A;  1E10 A;  2JZ3 B;  5LLI A;  2LHD A;  4C4V B;  3DDC B;  3A9J A;  4GDL B;  1IBX B;  1Y56 A;  4KKJ A;  2JVC A;  1XT9 B;  5EE3 A;  1H8C A;  1KH0 A;  4IDI A;  1M94 A;  4KKI A;  3APD A;  2WXM A;  3RD2 A;  3AED B;  5CHV C;  1S3S G;  4GDK A;  2C7H A;  4FLH A;  3JYU A;  4B6W A;  4LNF A;  1C76 A;  2JUO A;  4OW0 A;  5FR3 A;  2K5P A;  1J8C A;  2OJW A;  4DHJ D;  2IGH A;  2W82 A;  1OEY J;  2KJH B;  4E3C A;  2FNJ B;  2PW9 A;  2KT7 A;  3MHS D;  1K52 A;  1TYG B;  2DBY A;  2Z0E B;  1GPX A;  4YTN B;  4BBN C;  2BYF A;  1WGH A;  1E8Y A;  4ZDV A;  2PMV A;  3QCA A;  4AWJ A;  2J0M A;  2IND C;  4RCO A;  5D6J B;  3I57 A;  2WXH A;  3RUI B;  3AMZ A;  2MA9 B;  3MHZ A;  2LMC A;  3PRP B;  1OGW A;  3GP7 A;  1E7U A;  3AEE B;  4ANV A;  2MP2 B;  3BK2 A;  1CJE A;  2KAN A;  1GJZ A;  3H6N A;  3R3M A;  1UEL A;  2BVC A;  2J42 A;  2A5U A;  4RGO S;  2KOX A;  2DWQ A;  3IHP C;  1V5O A;  2V9H A;  1WX9 A;  1Q1O A;  1D5X C;  1NI3 A;  3KVF B;  1SB3 C;  5T8I A;  3WAP A;  4WUR A;  1E0Z A;  1IUE A;  3V05 A;  4K7S A;  2MEK A;  1YJI A;  1RM6 C;  1TTN A;  1HZ5 A;  2IO1 B;  3B2G A;  1T5X D;  3RNG C;  2OHF A;  5E6N A;  2N9E B;  3RPF C;  1QQR A;  3ZGZ A;  2MJE A;  3C8Y A;  4PYZ A;  1AN8 A;  4M01 A;  2N4F A;  2DZM A;  2J7Q B;  3RZW C;  2O6V D;  4KSK C;  4MM3 A;  2L0F A;  1STE A;  1DYQ A;  1L4Z B;  5FK9 C;  5BMG A;  4G50 A;  1SJE D;  5EE0 A;  3I3T B;  1MG4 A;  1XLP A;  2M19 A;  2GBK A;  2PKO A;  3WAO A;  1MHH E;  1WXM A;  2X38 A;  2GI9 A;  4KDL B;  3JVZ X;  4KZC A;  2NCN A;  4JL9 A;  2QDF A;  1SIJ A;  4PT5 A;  2Z0D B;  1GG3 A;  3ZRF A;  4DHZ E;  4ANW A;  5JZE B;  2BS2 B;  1JRU A;  1TKY A;  2HTH A;  2RSU A;  2SAK A;  5AEK B;  1XQQ A;  5HFY A;  2WXF A;  4TUU A;  3P42 A;  1XXG A;  4ZRP A;  1D5Z C;  1OTR B;  3L08 A;  2ZVO A;  3KQ4 A;  3CST A;  1HE8 A;  2WX1 A;  1WSP A;  3MC8 A;  1YMH E;  4AOF A;  2ZPN A;  3LB8 C;  2K1F A;  3VXW A;  4BKS D;  3RMK C;  3DHG C;  3HM3 A;  4GSW A;  3MJ5 A;  4PYU A;  4YL8 A;  5BMI A;  2FIF A;  2NPT B;  1E90 A;  2MH7 A;  4BVU C;  4HPM B;  5C2T B;  1WXQ A;  4W9J A;  4BZA A;  5LNK 1;  5IO9 A;  3JSV A;  3TEY A;  2FE8 A;  4GU2 A;  3GOE A;  2MSE D;  5IKC M;  4KGR A;  4W9L A;  2N9K A;  4IG7 B;  3L4P A;  4EZL A;  5L95 C;  3B2F A;  3VRA B;  3RNE C;  2EKI A;  4F1S A;  3L0W B;  3VDZ A;  2WXI A;  2JZZ A;  4OVV A;  2O2V A;  5BMH A;  1WZ3 A;  3L54 A;  3QC8 B;  1N5W A;  1VRA B;  5J17 A;  5TSS A;  3VRB B;  2DEN B;  2EMT A;  2JU6 X;  5FKA C;  1E7V A;  1SE4 A;  1SEB D;  2QC8 A;  2BS4 B;  4BKS A;  5JHA A;  2IZV B;  4HKZ E;  2D10 A;  1ZW7 A;  1V81 A;  2GMI C;  1ZP0 B;  3AEA B;  4P6V F;  2D11 A;  3GB1 A;  1XCT L;  2WDV B;  3WAM A;  2MQJ A;  4W9D A;  2W54 A;  4ZRJ A;  1WY8 A;  2ZNV B;  5E6J A;  4DXA B;  1KRH A;  4M0W A;  5H92 C;  4JIO U;  4W9I A;  1HQR D;  1SJH D;  1KJT A;  2ZCC A;  1EO6 A;  2UU7 A;  4DXF A;  2AL6 A;  4ITK A;  3A9K A;  3BK1 A;  1FPY A;  1PFD A;  3PGE A;  4LJP B;  5AZH A;  4A55 A;  3X0W A;  3QHT A;  2OJR A;  2BGF A;  2G4S A;  1QZE A;  2Y3A A;  3ZW3 A;  3EFU A;  3I63 C;  3ZNI D;  3DVG Y;  3VQI A;  4EZJ A;  4BBN F;  2EKE C; 
#chains in the Genus database with same CATH homology
 4XX5 A;  3KH0 A;  2LVP A;  2WWZ A;  1T0Y A;  2M4N A;  4ZRI A;  2D2Q A;  4B9K A;  2FCQ A;  3RYT A;  2GBJ A;  3NZS A;  2W9N A;  2L3Z A;  2XBB C;  3DVG X;  2PE6 B;  3KUZ A;  3ZIM A;  2A4Z A;  2KX3 A;  2MBE A;  2L7R A;  4BKG A;  1NI2 A;  2N9P C;  2V1Y A;  2D3G A;  4MJS B;  2ZNV C;  1C3T A;  2KTR B;  1CMX B;  1UZX B;  2KFK A;  2G45 B;  4K81 A;  1IPG A;  2I1K A;  4A20 A;  4GIV A;  1WH3 A;  3KUC B;  3ZDT A;  1UBQ A;  2G3Q B;  5D7G A;  1P9D U;  1YD8 U;  3QK0 A;  3Q3F A;  2KDI A;  2KMA A;  3NS8 A;  2LRU A;  1V5T A;  1R4N I;  2ZJD A;  4HPL B;  3QAQ A;  3IG3 A;  3WAL A;  3L16 A;  2LXA A;  3AU4 A;  4GN1 A;  2GBR A;  3EEC A;  1WMH B;  1WJ6 A;  1YJ1 A;  4P7I A;  2BKF A;  2KVR A;  3Q3J A;  5J18 A;  2LI5 A;  3NHE B;  3VUY A;  2KDF B;  3B0A A;  3H7P B;  4K7U A;  1WXV A;  1P98 A;  4K1R B;  4NQK E;  1E5W A;  2C7M B;  2XK5 B;  4ZRK A;  3UIN B;  3ZNZ B;  4EKU A;  4MEM A;  2V4L A;  4FBJ B;  5LXH A;  1IP9 A;  2KXJ A;  3KYD D;  5LXI B;  2KX0 A;  5DCN A;  1MG8 A;  1WXS A;  1YX6 B;  4MDK E;  2JF5 A;  4WQO B;  3QA8 A;  4BKT A;  4IM3 A;  2ZZP B;  3PRE A;  2LRW A;  4ASW C;  3K9P B;  4WJQ A;  2Y5B B;  2DYO A;  4TV3 A;  4BFR A;  2BYE A;  2C7N B;  2IO0 B;  2RR9 A;  2KKC A;  5G55 A;  1E8X A;  1Z5S B;  3W1S C;  3HK0 A;  4RM9 A;  4TQ0 A;  3X23 A;  1C1Y B;  1GC7 A;  2LJ5 A;  1H4R A;  4LCD E;  3VTU A;  2JPH A;  1V49 A;  3QAR A;  4EUT A;  2K8B A;  4IM2 A;  4WJP A;  4X57 B;  1Y8R C;  1WE7 A;  3OJ4 B;  1GC6 A;  3W1Y A;  3OAW A;  2K39 A;  2MBO A;  3H9D A;  1EF5 A;  2UWQ A;  2ZVN A;  3R7R A;  3S2A A;  3TCA A;  2KWU B;  1FXT B;  1V86 A;  3H1U A;  3MJW A;  4MSM B;  4WJO A;  4AJW A;  4F8C B;  2NBW B;  2ZCB A;  1S1Q B;  4GMV A;  4MJS A;  1LXD A;  1Q5W B;  1RLF A;  2KTR A;  4GDK B;  3IFW B;  4NAW B;  4J6I A;  2R2O A;  5EDS A;  3DQV A;  1I35 A;  1P0R A;  1K8R B;  3DVN U;  1V80 A;  2UYZ B;  3UIP B;  2Z59 B;  2RD0 A;  1WFY A;  2KWV B;  4II2 B;  1WJN A;  2JRH A;  1WR6 E;  3APC A;  2I1J A;  2LUE A;  4HDQ A;  5D2M B;  5D94 A;  3DBH I;  4NJ6 A;  3U30 A;  3PHW B;  1WMH A;  4KIK A;  1WX7 A;  3UQB A;  1WYW B;  3U7D A;  2MX2 A;  4IWQ A;  2KN5 A;  3ZDM C;  4DHZ B;  2NVU I;  3H7P A;  4ANX A;  1G6J A;  2IO2 B;  3AI5 A;  2MW5 A;  3HIZ A;  3PLV A;  1RAX A;  4DWF A;  2CHX A;  3N3K B;  2J0K A;  3ALB A;  4IUM B;  2FCS A;  4NPN A;  4JGH B;  5CTR C;  1TBE A;  4NY0 A;  2XEW A;  4FHJ A;  1WGG A;  4JQW C;  4HXD A;  1KOT A;  4RMA A;  3LDZ E;  2KWC A;  3QJZ A;  2DAJ A;  5IAA C;  3SHQ A;  2KFJ A;  4FJY A;  2NS5 A;  2B3A A;  2ZEQ A;  3DVN V;  4NJ7 A;  2LZ6 A;  4PS3 A;  3ZLZ A;  1VCB A;  2CS4 A;  2JZ3 B;  4CYE A;  5LLI A;  4JLC A;  1LM8 B;  3DDC B;  3A9J A;  2KNB A;  2QHO A;  2VRR B;  4A3P A;  1TZ1 A;  4N9F 4;  4W9F A;  3WAN A;  3NY5 A;  2J0J A;  4GDL B;  1EUV B;  3AUL A;  5CX3 A;  1WI0 A;  2JVC A;  2IO3 B;  3VUX A;  3VVW B;  1NBF C;  1UGM A;  1XT9 B;  2WDT B;  3M3J A;  3VH4 B;  3ONS A;  1H8C A;  2L8J A;  3B1L X;  1M94 A;  3PS6 A;  4HCN B;  5HKH A;  1ZKH A;  4DBG A;  1IYF A;  4W9C A;  5KHO A;  3APD A;  3RUL A;  3R7Q A;  3R66 C;  3RD2 A;  3T9L A;  4PS7 A;  5CHV C;  3A4R A;  1S3S G;  1GUA B;  2ASQ A;  4GDK A;  4NAW A;  4XC2 A;  4DHJ B;  4ICU A;  2GBM A;  2C7H A;  4FLH A;  2PEA A;  3TL5 A;  3O65 B;  4FAD A;  3JYU A;  2LVQ A;  5BO4 B;  4B6W A;  4EZK A;  4TKN A;  1V6E A;  1VD2 A;  2AWT A;  1LFD A;  2MLB A;  2JUO A;  2NR2 A;  1WJU A;  2PE9 A;  3ML8 A;  3VH3 B;  4KSL C;  4TQ1 A;  5IA7 A;  4WJN A;  3KUD B;  4GXB A;  4KIK B;  4HVB A;  1J8C A;  2C5L C;  2L0T A;  2KQ7 A;  4DHJ D;  1UH6 A;  4HCP B;  4AP4 C;  1OEY J;  2KJH B;  4II3 B;  4E3C A;  3PRM B;  4KV2 A;  1SE9 A;  3U8Z A;  1UD7 A;  1XD3 B;  2CHW A;  2O6V A;  2FNJ B;  2LGX A;  3MHS D;  4B95 A;  1U4A A;  2REX A;  4HK2 A;  3VFK A;  2GOW A;  3TMP B;  4F7Z A;  4CO7 A;  3L13 A;  4I6L B;  1P1A A;  4ICV A;  2KD0 A;  1WRD B;  2D07 B;  2Z0E B;  3IBE A;  3RCZ A;  3ZKJ C;  2M1M A;  5AZF A;  2CR5 A;  4BBN C;  2BYF A;  3DBR I;  2DYB A;  1WGH A;  1E8Y A;  3K9O B;  3A9J B;  4ZDV A;  5KHQ A;  3QCA A;  4IWO A;  1PQS A;  4AWJ A;  2J0M A;  3DCG A;  5JH5 C;  5D6J B;  3RUI B;  3PHX B;  3VHT C;  1RFA A;  4GDL A;  2DAF A;  2MA9 B;  1KM7 A;  3ENE A;  3UF8 A;  3VTV A;  2KK8 A;  3PV1 A;  3A33 B;  4WWN A;  3PRP B;  5JHB A;  2FUH B;  3EHV A;  1OGW A;  5E6O A;  5FR6 A;  4MEL A;  3ZVV A;  2MBQ A;  1E7U A;  3ZRC A;  4ANV A;  2MP2 B;  2DYM A;  2HJ8 A;  2KAN A;  2N7D A;  1GJZ A;  3H6N A;  3GZN I;  4GGQ A;  3R3M A;  1UEL A;  3EC8 A;  1EF1 A;  1ZGU B;  2A5U A;  4MGY E;  3VAW A;  4DDG D;  2KOX A;  2FCN A;  3IHP C;  4HLE A;  1J0G A;  1Q0W B;  4MGZ E;  2FAZ A;  2KJR A;  2MCN B;  1V5O A;  1WX9 A;  4RM8 A;  5CHF A;  3UIO B;  1Q1O A;  3C0R B;  3KVF B;  5G2N A;  2DZK A;  2N9X A;  3WAP A;  3LJ3 A;  2MRP A;  3WIM A;  4K7S A;  1WIA A;  3PT2 B;  3NOB A;  3TBL D;  3B08 A;  3PVL A;  3PZD A;  1TTN A;  3CF6 E;  2AL3 A;  2IO1 B;  4HJK A;  3V60 A;  2MBH A;  2RGF A;  2L05 A;  3T8M A;  2MBB B;  1LQB A;  1WGR A;  3DOW A;  2IBI B;  2O6V B;  4KDI C;  1SGH A;  5E6N A;  2N9E B;  2DZI A;  3A4S C;  3CSF A;  2JT4 B;  1KLV A;  1E8W A;  3TIX A;  5DPW A;  1WR1 A;  4HDO A;  2N1V A;  4FA6 A;  2KDE B;  3ZUN A;  4G11 A;  4PYZ A;  2C9W B;  3OLM D;  4A3O A;  4IC7 B;  2KLC A;  4IWP A;  1WGD A;  1BT0 A;  4KVG B;  2N4F A;  3PRZ A;  2DZM A;  2J7Q B;  2L00 B;  4XZ4 A;  2NPT A;  2AEH A;  3RZW C;  4AUQ C;  2O6V D;  4KSK C;  2WX0 A;  2BPS A;  2L76 A;  4MM3 A;  2L0F A;  4KZ0 A;  3SDL C;  1YX5 B;  4OVU A;  4URK A;  4GB9 A;  2YVC A;  4G50 A;  3V6E B;  3I3T B;  5E6P A;  1WM3 A;  4DK5 A;  3ZNG C;  4GOC A;  3N30 A;  2GBK A;  3VUW A;  3M63 B;  3WAO A;  2KMC A;  1WXM A;  5CHW A;  3WA0 A;  2KJ6 A;  2CKH B;  4KDL B;  2O2V B;  2MP2 A;  3JVZ X;  4KZC A;  2LGY A;  2NCN A;  4MSQ B;  4PS8 A;  3TJP A;  2OOB B;  4JL9 A;  2EMS A;  3AXC A;  3M95 A;  3L10 B;  5J2R A;  3N32 A;  5TR5 A;  3JW0 X;  2CU1 A;  2Z0D B;  1GG3 A;  4EEW A;  3RZF A;  3ZRF A;  2HD5 B;  4ANW A;  4DHZ E;  5JZE B;  1JRU A;  3OJ3 A;  3P2B A;  1SIF A;  5C1Z A;  2HTH A;  2RSU A;  5AEK B;  3D32 A;  1XQQ A;  2LWP A;  3RT3 B;  3PTF C;  3SU8 X;  4EFO A;  4TUU A;  1OTR B;  3L08 A;  2ZVO A;  1E8Z A;  3CST A;  1WF9 A;  2YLM A;  1HE8 A;  3APF A;  2WX1 A;  3ZO5 B;  2HE7 A;  4FJZ A;  4AOF A;  2ZPN A;  1GNU A;  2N7E A;  2K1F A;  2GBN A;  3VXW A;  2LVO A;  5DPS A;  2KDB A;  2IY1 B;  4BKS D;  4W9E A;  4WWO A;  4E74 A;  1OQY A;  3V62 A;  4I6N B;  4BOS C;  3A1Q B;  1WM2 A;  2NBV B;  4WAA A;  4EOY A;  5GMV A;  3PLU A;  3HM3 A;  1WGY A;  4GSW A;  4PYU A;  4YL8 A;  5L83 A;  4E71 A;  2FIF A;  1Z2M A;  2NPT B;  1D3Z A;  1E90 A;  4NNJ B;  3PSE B;  5AZG A;  1V2Y A;  2KC2 A;  2KC1 A;  4M0W B;  4BVU C;  1AAR A;  4HPM B;  2AYO B;  2WYQ A;  3ECI A;  3M62 B;  3H7S A;  3QQ8 B;  4W9J A;  2KLG A;  2NBU A;  2DHZ A;  3QWZ B;  3JSV A;  3HM6 X;  2N1W A;  4LJO B;  2LGD A;  4GU2 A;  3VTW A;  3GOE A;  2MSE D;  1WX8 A;  1UBI A;  3A9K B;  2FID A;  4W9L A;  4IG7 B;  4G0N B;  1WZ0 A;  4MGI E;  2V3S A;  1J19 A;  4EZL A;  5L95 C;  4W9H A;  2K6Q A;  5DPT A;  4F1S A;  1TGZ B;  3QIJ A;  3L0W B;  3NZU A;  3VDZ A;  2DZJ A;  2FCM A;  2JZZ A;  4OVV A;  4G3X B;  2O2V A;  1WZ3 A;  3L54 A;  2LAS A;  3QC8 B;  1X1M A;  2RPQ A;  3PPA A;  3UGB B;  3KYC D;  5J17 A;  2MWS B;  4FN2 A;  2ZPY A;  3IVF A;  2BYV E;  2K25 A;  1F9J A;  4MGK E;  2K8C A;  4DDI D;  2DEN B;  2EMT A;  2K6D B;  3ZNH B;  4IM0 A;  1E7V A;  1L7Y A;  3DPD A;  3ZTC A;  4BKS A;  3ML9 A;  5JHA A;  2KHW B;  4IW0 A;  5C23 A;  2IZV B;  2JXX A;  2R2Q A;  4W9G A;  3DBL I;  1RRB A;  2M0X A;  4FJV B;  4FHK A;  2C60 A;  2KFK B;  2D10 A;  4LDT B;  1ZW7 A;  4BOZ B;  1OEY A;  2JWZ A;  1V81 A;  3W1S A;  2KQS A;  2LXC A;  3CMM B;  1ISN A;  3MTN B;  2JY6 A;  2GMI C;  2IY0 B;  4AJY B;  4I6P A;  3BIN A;  1WJ4 A;  2D11 A;  1P3Q U;  4M8N A;  2IYD B;  3BY4 B;  3DBS A;  3A1Q A;  2BF8 B;  3AU5 A;  3WAM A;  2JRI B;  2LD9 A;  2MQJ A;  4HWI B;  4W9D A;  4W9K A;  2PJH A;  4LDT D;  2K8H A;  1WE6 A;  4ZRJ A;  2KZR A;  1WY8 A;  2ZNV B;  4FUL A;  4DXA B;  4ZYN A;  2CHZ A;  4JIO U;  3SD5 A;  1YIW A;  4ANU A;  4W9I A;  2BWE S;  2G4D B;  3KW5 B;  1V9J A;  1KJT A;  3ZTD A;  2XK5 A;  2ZCC A;  1EO6 A;  3JSV B;  3HHM A;  2AL6 A;  4MH0 E;  2M8S A;  2BKR B;  3A9K A;  4K7W A;  4CHK A;  3PGE A;  4LJP B;  4WWP A;  2PPH A;  2KTF A;  3QX1 A;  1R4M I;  4NQL B;  5DPR A;  2M17 A;  5AZH A;  1L2N A;  2DX5 B;  2KO3 A;  3QHT A;  2OJR A;  3V6C B;  2BGF A;  1WXA A;  2G4S A;  3X0W A;  1NDD A;  1QZE A;  1A5R A;  3ZW3 A;  3EFU A;  1YQB A;  4M8M A;  3UQA A;  3ZNI D;  3L17 A;  1I42 A;  3DVG Y;  3VQI A;  4EZJ A;  3V61 A;  4BBN F;  2BWF A;  2EKE C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...