3RUIB

Crystal structure of atg7c-atg8 complex
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
113
structure length
113
Chain Sequence
TFKSEYPFEKRKAESERIADRFKNRIPVICEKAEKSDIPEIDKRKYLVPADLTVGQFVYVIRKRIMLPPEKAIFIFVNDTLPPTAALMSAIYQEHKDKDGFLYVTYSGENTFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into noncanonical E1 enzyme activation from the structure of autophagic E1 Atg7 with Atg8.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ligase
molecule keywords Ubiquitin-like modifier-activating enzyme ATG7
total genus 30
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2011-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3ruiB00
2KQ7A 3M63B 5AZHA 3PGEA 1J0GA 2KC2A 2KZRA 3VH3B 2MWSB 2IO2B 4MGYE 4DHZE 1KJTA 3KUDB 3ZNHB 2C60A 5D7GA 3C0RB 3TL5A 4TUUA 2ZPYA 2CS4A 1C3TA 4BKSA 2O2VA 3H7SA 1E8WA 4FJYA 1LQBA 4G50A 2FCNA 2I1KA 4GDLB 1KLVA 1OEYJ 4MH0E 1CMXB 3H1UA 3WA0A 3NOBA 2N1WA 3BINA 2JY6A 4AUQC 5J17A 2KHWB 2PJHA 2YVCA 4JQWC 3UQBA 4KDLB 2Y5BB 2M17A 4II2B 5CHFA 1V6EA 5DPSA 4ANUA 2JUOA 2C7MB 4K7SA 4MSQB 2K6DB 4PS7A 3PRMB 4YL8A 3RUIB 3A9KB 3QJZA 1RLFA 4W9GA 4FULA 4KV2A 1Z5SB 1SGHA 2C7NB 3V6CB 1E8XA 3Q3FA 1V80A 3DVGY 4IM2A 1JRUA 4EZKA 5AEKB 4TKNA 5C23A 5LLIA 4G0NB 4FJZA 2ASQA 2MCNB 5D94A 4BBNC 4HDQA 2MLBA 2ZNVB 4HCNB 1WZ0A 2KANA 3AI5A 3DBHI 1EF5A 3M95A 3TBLD 2MX2A 4BVUC 3TCAA 3H9DA 2G4DB 2L0FA 1EUVB 1P98A 3KUZA 4F8CB 2IO0B 3MTNB 4K81A 4WWNA 3A9JB 2M1MA 2MSED 2PE6B 2YLMA 5G55A 2NS5A 1LM8B 2IY1B 3KYDD 5J2RA 3X23A 4I6PA 3UINB 3IFWB 5L95C 1UZXB 1RFAA 4MJSB 1EF1A 2LVOA 3N32A 4JGHB 1E8ZA 3DBSA 1WYWB 3APFA 3ZW3A 2KX0A 4NY0A 4IM3A 4DDID 2DZMA 1IYFA 2ZPNA 3ML9A 4URKA 4NQKE 2KD0A 1YX5B 2AWTA 1ZW7A 3KVFB 2LRWA 1GC7A 1OQYA 4HPLB 3ZTCA 2K8BA 1R4NI 3A1QA 3DBLI 1WXSA 5E6NA 1ZGUB 3UIOB 1SE9A 2A5UA 5CHVC 4PYUA 4W9LA 5CTRC 1NI2A 4CHKA 4IG7B 2DZIA 4N9F4 4J6IA 1LXDA 1K8RB 3VTWA 4CO7A 4DHZB 4ZDVA 4W9CA 5DPTA 5IA7A 2KXJA 3QQ8B 3EC8A 2LZ6A 4PS3A 3PZDA 3MJWA 4WWPA 3HHMA 4NPNA 2DX5B 4GDKA 2C9WB 2MBBB 3A4SC 2WDTB 4BBNF 4DHJD 4K7WA 1I42A 1WIAA 4FLHA 2KNBA 1WR6E 3ZVVA 2C7HA 2N7DA 3DVNU 1GNUA 4W9EA 3QIJA 4HJKA 1NBFC 2IYDB 2REXA 2ZNVC 3PSEB 2KJHB 2LD9A 1TTNA 3PPAA 3VTVA 4X57B 2O6VB 4KDIC 2G4SA 4GXBA 3K9PB 3PLUA 4HK2A 3PRPB 1YQBA 1P0RA 4HCPB 3CSTA 3DBRI 2L7RA 1A5RA 3DVGX 2KKCA 2JXXA 2KFKB 3HIZA 1WX7A 4DHJB 2KLCA 4XZ4A 4ICUA 2DZJA 1WF9A 4W9DA 4EKUA 1UBQA 3RULA 2LVPA 3OAWA 4MEMA 4LCDE 5AZFA 4IWQA 4MGZE 2ZVOA 2D11A 2JZZA 1RRBA 3EHVA 1V2YA 1P1AA 2EMTA 1QZEA 2KFJA 4ANXA 2W9NA 2N7EA 2R2OA 3R7QA 5L83A 3DQVA 2M0XA 2L76A 3U30A 1D3ZA 1F9JA 2LASA 1WX8A 4NJ7A 1WMHB 2L00B 3WAMA 3ZLZA 4BKTA 2L3ZA 2MP2A 3VUYA 3UIPB 4EZJA 4II3B 3ZRFA 2N1VA 3L08A 2KN5A 1U4AA 2HD5B 1TGZB 1E5WA 3APCA 1WH3A 2MBEA 2JPHA 2V4LA 4ZYNA 2XBBC 2M8SA 2QHOA 2RPQA 3A1QB 4IUMB 3L16A 5TR5A 1WGYA 5GMVA 2IO1B 3SHQA 3R7RA 2JRHA 2BYFA 4FHKA 2FIDA 4FADA 4K1RB 1WR1A 3B08A 2GMIC 2KDBA 3HK0A 1WJNA 2KVRA 1J8CA 3W1YA 4HLEA 1XQQA 3DVNV 4G3XB 3EECA 5AZGA 4KIKA 3JW0X 3QX1A 4WJOA 4WJQA 4FBJB 3DDCB 3QWZB 4DDGD 1J19A 2D10A 2XK5B 3PREA 4GB9A 2WYQA 4NAWA 5JH5C 3ENEA 3HM6X 2FAZA 3R3MA 3RCZA 3VAWA 1LFDA 4B6WA 1XT9B 3PHXB 2KTFA 2NVUI 4GU2A 2K6QA 2GBKA 4GMVA 2D3GA 2OJRA 2KWUB 2XEWA 4EFOA 4DBGA 3GOEA 3ZTDA 1YIWA 2J0MA 4K7UA 4LDTB 4E74A 3DOWA 4G11A 3N30A 3VXWA 1WJ4A 2LUEA 4GIVA 3ZNGC 4XX5A 3ML8A 3P2BA 3QK0A 1GG3A 1WM2A 2R2QA 1VD2A 4HVBA 1Q5WB 4JLCA 3AU5A 1AARA 2FCSA 4WQOB 4ANVA 2NPTA 1YJ1A 4BFRA 2JT4B 1TZ1A 2N4FA 5LXIB 1WRDB 3H7PA 4KVGB 1IP9A 3WAPA 4GN1A 2NR2A 4WJNA 1P9DU 3IHPC 2GBRA 4ZRKA 3RZFA 3KUCB 3MHSD 2CHZA 3ZNZB 1WX9A 3U8ZA 2LGDA 1WY8A 2D07B 5D6JB 1WXVA 2DAJA 1E8YA 2G45B 1P3QU 1OEYA 2N9PC 2JF5A 3NZUA 4IW0A 2GBJA 1TBEA 4P7IA 3A9JA 2MW5A 3PVLA 2PEAA 2CHWA 3RZWC 2KX3A 2L8JA 2DYBA 4KIKB 3ZUNA 4A3OA 3DCGA 2MBHA 3EFUA 4ZRJA 4EEWA 1V9JA 2VRRB 2LJ5A 4JL9A 1MG8A 2FNJB 2O6VD 3CSFA 1H4RA 2KLGA 3L17A 5D2MB 4AOFA 2CKHB 4MJSA 2KFKA 5KHOA 3W1SC 3DPDA 2N9XA 1Q1OA 3IBEA 4XC2A 1UGMA 2V1YA 4HDOA 4B9KA 2D2QA 3AULA 4B95A 3ZDMC 3V60A 1UH6A 2GOWA 2RR9A 3TIXA 1GJZA 5G2NA 4ANWA 4GOCA 4W9IA 5DCNA 2MQJA 2K39A 3M62B 2ZEQA 4NNJB 2FCQA 4PYZA 2KQSA 2LXCA 1S3SG 3ALBA 1WM3A 2MBOA 4HPMB 4OVUA 5BO4B 4BOSC 3BY4B 2JVCA 4MM3A 3ZNID 3O65B 1KM7A 2K8CA 4KSKC 2KJ6A 3NZSA 3ZIMA 1WGHA 2IBIB 2K25A 3UQAA 2EMSA 5DPWA 2NBVB 3LJ3A 3PV1A 2DAFA 2DYOA 4W9JA 4DXAB 1I35A 4I6LB 3VDZA 4TV3A 3V6EB 2GBNA 2K8HA 5KHQA 3SU8X 3Q3JA 2O6VA 4HWIB 2WWZA 4IWOA 1FXTB 2G3QB 2NPTB 5JHBA 1WE6A 3RD2A 2UWQA 2LWPA 3H7PB 4RM8A 1S1QB 2DYMA 3KH0A 2KMCA 4GGQA 4GSWA 3OJ3A 4OVVA 5JZEB 3VUXA 3ONSA 2KMAA 2KDFB 3UGBB 2WX1A 1WXAA 2KK8A 3KYCD 3VHTC 3KW5B 2J0JA 1X1MA 2MP2B 3APDA 4ICVA 3W1SA 3CF6E 4BOZB 2J0KA 2IZVB 4LDTD 1EO6A 2N9EB 2BPSA 3U7DA 5IAAC 3VUWA 2B3AA 1R4MI 4KSLC 4W9KA 3WIMA 4NQLB 1GC6A 3GZNI 2MRPA 2DENB 1UBIA 2KTRB 3OJ4B 3RT3B 2KO3A 4PS8A 2PE9A 2EKEC 1V5OA 3V62A 3L10B 1G6JA 3L54A 2V3SA 2NBUA 3UF8A 3ECIA 1M94A 1XD3B 3QA8A 1WJ6A 4FJVB 2LGYA 2ZJDA 3PHWB 4WAAA 3V61A 3QAQA 4BKGA 4IWPA 2DHZA 4A20A 1C1YB 4EOYA 5LXHA 4LJOB 2L05A 2DZKA 2GBMA 4NAWB 4FA6A 3NS8A 1V81A 3AU4A 3RYTA 2RSUA 2ZCBA 4M8MA 4AWJA 3L0WB 2KTRA 2Z0DB 3NY5A 3PTFC 4TQ1A 4DWFA 3PRZA 1YD8U 3LDZE 4ASWC 4M8NA 5CHWA 2L0TA 1ZKHA 2RD0A 1T0YA 3A4RA 2BGFA 4CYEA 3HM3A 3TMPB 3AXCA 1SIFA 2BYVE 2BKFA 3ZO5B 5JHAA 1NDDA 2J7QB 5CX3A 2BKRB 4HXDA 3VTUA 2JRIB 5C1ZA 1Q0WB 1WGRA 3D32A 4NJ6A 3WALA 4JIOU 3T9LA 2FIFA 3JYUA 2ZZPB 3M3JA 2LVQA 2ZVNA 3JSVB 4MGIE 1WE7A 1E7VA 1Z2MA 4A3PA 2CU1A 4KZCA 3TJPA 2KC1A 1RAXA 3QCAA 3CMMB 4WWOA 3T8MA 2LI5A 2LGXA 4W9HA 4GDKB 1VCBA 3S2AA 1WGDA 1YX6B 3L13A 4RMAA 4EZLA 2Z59B 3SDLC 1Y8RC 4ZRIA 1UELA 4KZ0A 4MDKE 3WAOA 1L7YA 4IC7B 3K9OB 1H8CA 1V86A 4M0WB 4MGKE 1WFYA 1WJUA 2ZCCA 2BYEA 4WJPA 3ZKJC 5J18A 4RM9A 5FR6A 3A9KA 1V49A 2NBWB 2HJ8A 4LJPB 3SD5A 2IY0B 4DK5A 3PLVA 3QHTA 2O2VB 2A4ZA 2LXAA 4E71A 4GDLA 1OTRB 2BF8B 2K1FA 2NCNA 1BT0A 3B0AA 2Z0EB 1IPGA 2AYOB 3VH4B 2I1JA 5HKHA 5DPRA 3QC8B 3PS6A 1L2NA 3NHEB 3QARA 2CHXA 2PPHA 2AEHA 4BKSD 3WANA 4TQ0A 1E7UA 2KOXA 4IM0A 3JSVA 1HE8A 2KWCA 3N3KB 4W9FA 2FUHB 1ISNA 4AJYB 4EUTA 3VFKA 4F1SA 1GUAB 2WX0A 2IO3B 2FCMA 3ZDTA 1V5TA 2JWZA 2UYZB 1WI0A 1UD7A 1OGWA 2KJRA 2MBQA 3VVWB 3ZRCA 3IVFA 4MSMB 4AJWA 1KOTA 2JZ3B 2LRUA 4F7ZA 4AP4C 4MELA 1E90A 3B1LX 5EDSA 3IG3A 2HTHA 1WMHA 3H6NA 2AL6A 2KDIA 3X0WA 2M4NA 3A33B 2OOBB 4FN2A 4E3CA 2AL3A 2BWES 2HE7A 4I6NB 1WXMA 3I3TB 3OLMD 2RGFA 5E6PA 1PQSA 2MA9B 1WZ3A 5E6OA 3VQIA 2BWFA 3JVZX 1WGGA 4FHJA 2XK5A 3PT2B 2KDEB 3R66C 2CR5A 2C5LC 2KWVB
chains in the Genus database with same CATH superfamily
3M63B 4FXCA 2KZRA 3VH3B 2H88B 2INDC 2IO2B 2WDRB 3MFGA 4HRSA 3C0RB 1ZPSA 2ZPYA 2K3UA 2O2VA 2FCNA 1KLVA 3AE1B 4C56C 3WA0A 3KWVA 2N1WA 5J17A 2KHWB 2PJHA 4JQWC 4II2B 4M0WA 4PS7A 2C7MB 3PZ8A 2K6DB 3A9KB 3GS2A 1XLQA 3BVZA 4JX1C 4FULA 1DOXA 1SGHA 3Q3FA 2BBCA 2BVCA 1JRUA 5AEKB 5C23A 1ZP0B 2HJ1A 2MJ3A 2B76B 1JMLA 4FJZA 3MHZA 3RPFC 2W54A 4HCNB 1OFFA 4YXDB 3U7ZA 4BVUC 3TCAA 1WXQA 3MTNB 3L4PA 2Y3AA 3DWGC 3A9JB 2YLMA 2WXQA 5J2RA 3P4RB 3UINB 3IFWB 1AW7A 1YOVB 1EF1A 1SEBD 1CZPA 2BW2A 1E8ZA 1WYWB 1B1ZA 2JXTA 4DDID 4PT5A 2ZPNA 3ML9A 4OHJA 4NQKE 4C7YA 2AWTA 1GC7A 4XYCA 1R4NI 2A5UA 1XLOA 2WXRA 4IG7B 4J6IA 3VTWA 4CO7A 4RGOS 1SF0A 1KLGD 5DPTA 1XXGA 3EC8A 2LZ6A 5AUIA 1GAQB 4NPNA 1UWXA 2C9WB 1J7BA 1GB1A 4DHJD 2V3NA 1I42A 1WIAA 3BWUD 4HJKA 3PSEB 3W5VB 1TTNA 2KWDA 4KDIC 3NVZA 4LNKA 4GXBA 4DXGA 1RWSA 4HK2A 2D5GA 4HCPB 1A5RA 2TSSA 1RFKA 3AH7A 4XZ4A 2DZJA 4EKUA 4OZAA 2LVPA 2K22A 1T6BX 2ZVOA 2JZZA 4ZYSA 2JQRB 2WLBA 5L83A 3DBLB 4EE2A 2J42A 1D3ZA 1F9JA 2M19A 2BTEA 1T0RC 2WXOA 4EZJA 3L08A 2KN5A 4WAFA 1E5WA 5IN7A 1ESFA 2JPHA 2QHOA 3DBHB 1WGYA 3NVVA 1PGBA 1NVID 4C80A 2N0SB 4FADA 4FHKA 2WXMA 4XDCA 2KDBA 3HVDA 2JYTA 2KVRA 2KDMA 3EECA 4G3XB 5EE9A 3JW0X 3DDCB 3QWZB 2XK5B 4ZRPA 1KRHA 3HM6X 1FMAD 2GB1A 3VAWA 1T3QA 4B6WA 1XT9B 2KTFA 2K6QA 4GMVA 2KWUB 5HG2A 2IPKD 2XEWA 2AX5A 2BQQA 1YIWA 3BZDB 4K7UA 3RI7C 1Q10A 3N30A 3LXFA 1XEEA 1WJ4A 4RH6A 3P2BA 1GG3A 1WM2A 1VD2A 1Q5WB 1FCCC 1AARA 2FCSA 3EGRA 4WQOB 4ANVA 2N4FA 3WAPA 1VZ6A 4GN1A 1T5XD 1ZDXA 2GBRA 3EUB2 3U8ZA 2YEPB 3P63A 4L2YA 5D6JB 1WXVA 1E8YA 1XCQL 3BYTB 2G45B 1ROEA 3PVLA 2ZW0A 2DYBA 3EFUA 2WXPA 2VRRB 5FKAC 1MG8A 1DGJA 2OEDA 4WURA 1QOAA 4B0MA 3L17A 4A90A 4AOFA 1UF0A 2LHDA 2KFKA 3DPDA 1N62A 2QC8A 1Q1OA 3IBEA 2ACZB 4HEA1 1K51A 1ET6A 2MQJA 2ZEQA 1E7PB 4HPMB 4OVUA 4BOSC 3MC8A 4MM3A 3T3OA 1GPXA 1KM7A 2K8CA 3ZIMA 2BS2B 2PVGC 1D4BA 1ZE3D 3AMZA 1HZ6A 5DPWA 1C77A 1I35A 3KQ4A 4I6LB 1QT9A 2GBNA 2WQYB 3SU8X 2WWZA 4IWOA 1FXTB 2G3QB 2MEKA 2NPTB 2UWQA 4XWTA 3KH0A 4GGQA 1JWUD 1TKGA 2KDFB 3UGBB 1WXAA 3KW5B 2J0JA 3APDA 1KF6B 4BOZB 2N9EB 1E0ZA 2JX5A 3U7DA 1R4MI 2VZKD 2AQ1B 2MRPA 2KTRB 3OJ4B 3V62A 3L54A 3RFZB 2LMCA 5EE1A 4KGRA 1FPYA 3RNFC 1EU4A 1F52A 2N9LA 2DHZA 4EOYA 4LJOB 4NAWB 4RGNA 3NS8A 1V81A 1F2RI 4M8MA 2QSDA 1JWAD 1P7FA 2WDQB 2Z0DB 2Y5PA 2DLBA 4TQ1A 1DYQA 3OG5A 3Q2AC 1T0YA 4KGSA 3I63C 2WXJA 2BGFA 3TMPB 2JSVX 5C1ZA 1Q0WB 3J9CA 3D32A 2FBWB 3T9LA 3JYUA 1WE7A 2JU6X 1MHHE 3V3XA 4A3PA 4D2KA 3QCAA 3Q14C 3CMMB 4C00A 4WWOA 3T8MA 4L23A 3S2AA 4EZLA 5TSSA 3SDLC 4ZRIA 4MDKE 3WAOA 3RN9C 1L7YA 4M0WB 4MGKE 1HTOA 4RFBA 4TMAB 5FR6A 1FCLA 3A9KA 4DK5A 1TT5B 4LJPB 3PLVA 1SJHD 3QHTA 1OTRB 1EWYC 1FM0D 2I1JA 5HKHA 4IOIE 3NHEB 3NUHB 2CHXA 1C4PA 1SIJA 2AEHA 1YN5A 2FUG1 2KWCA 3N3KB 4A9AA 2FUHB 4A55A 2IO3B 2FCMA 2JWUA 1I7HA 5FK9C 3ZDTA 1QOGA 1YN4A 3VVWB 2K5PA 2LRUA 4C7ZA 3B1LX 2SEBD 3IG3A 3H6NA 2JYEA 1FFVA 1TJEA 2M4NA 3A33B 5FR3A 2AL3A 2Y5CA 5C2TB 1UGJA 1L0VB 3VQIA 2BWFA 4FHJA 1NEKB 3PT2B 2RMMA 1TS4A 1GB4A 3L0WB 2KQ7A 4RGTA 2LGSA 1KJTA 3ZNHB 3AV8A 1E8WA 4FJYA 4G50A 4MT5A 4GDLB 1OEYJ 4MH0E 4OZCA 3NOBA 1JWBD 1BXTA 3UQBA 2HDEA 2M17A 2Y5BB 5DPSA 5D3DA 2JUOA 1MFWA 4YL8A 3RUIB 1TYGB 4W9GA 3AEDB 1JWSD 2WU5B 3V6CB 2WS3B 4TKNA 2ASQA 1R4NB 2NMQA 1QLBB 1PGAA 2ZNVB 1WZ0A 3TBLD 3AI5A 2MX2A 4F8CB 1P98A 3AECB 4LLGM 5BMGA 1VZ8A 1QKZA 5G55A 2IY1B 3VRBB 5L95C 3MC9A 1RFAA 4MJSB 2E3TA 1ET9A 3APFA 1Y56A 4NY0A 1IYFA 1YN3A 3DBLI 5E6NA 1QILA 3U2SC 1SE9A 5CHVC 4PYUA 3GE8C 4ZHOA 1PUTA 4ZDVA 4W9CA 2KXJA 4PS3A 3PZDA 3FAHA 2WDTB 4BBNF 4C4VA 2N7DA 4M00A 3DVNU 2MJEA 1GNUA 4W9EA 1DOYA 1YJJA 3AEBB 1N60A 3PPAA 5GXGB 2G4SA 1UWMA 1E6EB 3N1YC 3CSTA 3DBRI 2VH2A 1C76A 4W9DA 3SFEB 2RDBC 3OAWA 3HVZA 3U52E 1RRBA 1FD6A 1L0YB 2WXKA 1V2YA 2KFJA 2W9NA 1JRPA 3PZ7A 1HQRD 2N7EA 3R7QA 4LTUA 2M0XA 1I4PA 2LASA 3WAMA 2MP2A 3KLSX 4GLSC 4II3B 3ZRFA 2N1VA 3BIID 1TGZB 2MBEA 2M8SA 2MH7A 1OQQA 3R7RA 2JRHA 2FIDA 2GMIC 1WJNA 4HLEA 1NYQA 1L4DB 3NG0A 3AE4B 4WJQA 1HXYD 4DDGD 4B0EA 1J19A 2D10A 1CK1A 4DQOC 3ENEA 2WP9B 3ZXVA 3PHXB 4GU2A 4AQ7A 2OJRA 4DBGA 3ZTDA 2J0MA 3IAM1 3RNEC 3N9YC 4G11A 2LUEA 2VH1A 4XX5A 3AEEB 2R2QA 4JLCA 3BYYB 1CQVA 4HROA 2LFIA 2RDHA 2NPTA 4KVGB 2NR2A 4WJNA 4YTMB 3AEFB 4ZRKA 3ZNZB 1WY8A 3NRZA 5HHDG 3DBRB 1SSNA 3I9V1 3RZWC 4A3OA 4R3DA 1V9JA 4JL9A 2LJ5A 2FNJB 2O6VD 2BS4B 1H4RA 1V1OA 4MJSA 5KHOA 4MM3B 1CJEA 4XC2A 2V1YA 4HDOA 3AULA 1N6ZA 3V60A 1UH6A 2GOWA 2RR9A 3TIXA 2PKOA 4ANWA 4A8XC 2WXIA 1MJDA 4YSZB 3NVYA 2FCQA 2KQSA 2LXCA 1TY0A 2WXGA 2HTME 2MBOA 5BO4B 3BY4B 3BVGA 1MVKA 2IBIB 2W82A 2K25A 3BK2A 3O13A 2EMSA 1P7EA 2NBVB 3LJ3A 2DAFA 2DYOA 5KHQA 2BB6A 4HWIB 3URYA 2KAJA 1LO5D 3AE6B 1FFUA 3VUXA 4ARIA 1N5WA 5JXVA 2KK8A 3VHTC 2J53A 3W1SA 4LNOA 3DHIC 2XN9C 1ENFA 2G9HD 3VUWA 1FXAA 2KVZA 4KSLC 4W9KA 4NQLB 2V9HA 2DENB 3ZGZA 1V5OA 5G5GA 1UUPA 4YTPB 2V3SA 3ECIA 4CQNA 2WU2B 1WJ6A 3PHWB 5HFYA 5E6JA 4BKGA 4IWPA 4A20A 1C1YB 5LXHA 2DZKA 3AU4A 2V3PA 3B9JA 4HPPA 2L1AA 3OWEB 2KTRA 4JWUC 4DWFA 3PRZA 3RNCC 1YD8U 3LDZE 2L0TA 3A4RA 2W3RA 3ZO5B 5JHAA 2J7QB 5CX3A 3VTUA 2OHFA 3TSSA 4K3CA 4NJ6A 2LVQA 2WHIA 2ZVNA 3JSVB 2V0GA 1JQ4A 1E7VA 2ONQA 2CU1A 4KZCA 3TJPA 1A70A 3DWMA 1WRIA 1N61A 1N5XA 1VCBA 1YX6B 1J7CA 2Z59B 1Y8RC 1V8CA 2PW9A 3AE5B 3K9OB 1V86A 5J18A 4HKQA 2ZCCA 2BYTA 4JE3B 3SD5A 2O2VB 2IDYA 4YTNB 1D5XC 2K1FA 3B0AA 4QAYA 2WGSA 3PS6A 1L2NA 2PPHA 4BKSD 4TQ0A 1HE8A 1ISNA 4EUTA 3VFKA 2WX0A 2WXNA 1XO3A 2JWZA 2UYZB 1OGWA 4MSMB 3BK1A 2JZ3B 4F7ZA 4AP4C 3PO0A 1R4MB 2HTHA 1PDXA 5IP4D 2KDIA 3IAS1 3X0WA 4E3CA 3AE7B 2INPE 4I6NB 3DHGC 3P42A 3I3TB 1WYGA 1TS3A 5E6OA 3JVZX 3FILA 4UDUC 3RCZA 3DHHC 2KWVB 5AZHA 3PGEA 1J0GA 1I4QA 2MWSB 2PMVA 4TSSA 5D7GA 3TL5A 4TUUA 4BKSA 3RMKC 1LQBA 2I1KA 4MH8A 2KYWA 3BINA 1VR9A 1PGXA 4DXFA 2XNAC 4KDLB 1XLPA 4ANUA 1V6EA 1FRDA 3AM9A 3HRDD 1VRAB 4KV2A 1L4ZB 2WDVB 4XGAB 1E8XA 1V80A 3DVGY 4IM2A 2VZKB 2QIEB 2RDGA 4G0NB 1ZDVA 1FEHA 2D3BA 5D94A 1V97A 4BBNC 1EF5A 1I4XA 3H9DA 2G4DB 4K81A 2M1MA 2MSED 2PE6B 1K53A 3AE9B 3X23A 4I6PA 1TS2A 3MC0B 1UZXB 4JGHB 3ZW3A 1SE4A 2KX0A 2DZMA 3ZJTA 4URKA 1KH0A 1XF5L 2KD0A 1YX5B 2LRWA 2DWQA 2Q5WD 3GB1A 4HPLB 2K8BA 3A1QA 1WXSA 1ZGUB 2Z8LA 2INNE 4W9LA 2WXHA 4CHKA 2DZIA 4N9F4 1K8RB 3P4QB 4OW0A 3TEXA 4DHZB 1KFYB 3MJWA 4WWPA 2DX5B 3A4SC 1YMHE 4P16A 1IBXA 3ZVVA 1WR6E 1T0SC 2C7HA 1ZXIA 2BT6A 1I4HA 2KN4A 3UI3A 3QIJA 1NBFC 2CJOA 2IYDB 2ZNVC 2KJHB 1UNSA 2LD9A 3P4SB 3GZNB 2O6VB 3K9PB 3PLUA 3PRPB 1YQBA 1MHXA 2PTLA 2L7RA 3DVGX 2JXXA 3HIZA 1WX7A 4RGMA 2KLCA 3SEBA 1UBQA 5IOIA 4LCDE 5AZFA 3VR8B 1IGDA 1EWCA 3EHVA 1BUIC 4ANXA 2AQ2B 2R2OA 3DQVA 3BVMA 4XWWA 3U30A 4ZOHC 4NJ7A 4BAXA 5BMHA 4BKTA 1ZUD2 3VUYA 2IGHA 4OVZA 1F0ZA 3TEZA 3CWIA 3ZJUA 1WH3A 2V4LA 2DNFA 2XBBC 4C4VB 4IUMB 5TR5A 5GMVA 2IO1B 2BYFA 1WR1A 3HK0A 1J8CA 3DVNV 1D5MC 4WJOA 3QX1A 5C3JB 1YJIA 1EM7A 2I38A 4NAWA 2WXFA 2FAZA 3R3MA 2H89B 2BS3B 2GBKA 3RNBC 4EFOA 4OZBA 3GOEA 4LDTB 4E74A 3DOWA 3VXWA 4LNFA 1SE3A 4KGTA 3Q8FA 4HVBA 1QOBA 1IUEA 1YJ1A 5LXIB 1WRDB 3H7PA 3SFDB 4K3BA 4NJCA 1P9DU 3RZFA 3KUCB 4NZLB 2LGDA 2DAJA 1P3QU 1OEYA 2JF5A 2GBJA 3Q8CA 4P7IA 3A9JA 2MW5A 3NS1A 2PEAA 2CHWA 4KIKB 2MBHA 4EEWA 4ZRQA 3CSFA 2KLGA 3TEWA 2CKHB 1K50A 4KKIA 1UGMA 2X38A 2D2QA 5G2NA 4PK1A 4GOCA 5BYQA 4W9IA 4MACA 3AEAB 4H2AA 2K39A 3M62B 1SJED 3GE3C 5H92C 1WM3A 3C8YA 1GOZA 2JVCA 3ZNID 3O65B 2IGDA 1NENB 1XLNA 2EKIA 3NZSA 1RM6C 1WGHA 2KT7A 4JWSC 1VZ7A 3UQAA 3B2GA 3R8BA 4W9JA 4WQMA 4DXAB 4TV3A 1JCKB 2K8HA 3Q3JA 3EA6A 5JHBA 1WE6A 3RD2A 1F2RC 3H7PB 3AN1A 4RM8A 2LJIA 1S1QB 2KMCA 5I4DA 2KMAA 2WX1A 1BMLC 1X1MA 2MP2B 4ICVA 3TUOA 2IGGA 3CF6E 4N59A 4LDTD 1EO6A 2V4IB 1E10A 4KKJA 1WSPA 1MPEA 2BPSA 2QEJC 4USAA 3E56A 4YWGG 3WIMA 3P1MA 3GZNI 5LNK1 1UBIA 2PE9A 2EKEC 1G6JA 2FE8A 1I4GA 2NBUA 3UF8A 1JROA 1FNUA 2ON8A 2BB5A 3QA8A 2ZJDA 4WAAA 3NZ3A 3V61A 3LB8C 2W3SA 4FA6A 1VJKA 3LYYA 4AWJA 3RYTA 2RSUA 2ZCBA 3ZYYX 3NY5A 4ASWC 1RYJA 4M8NA 5CHWA 2RD0A 1JW9D 4CYEA 3HM3A 3AXCA 2BYVE 3CIRB 2BKFA 1FIQA 4HXDA 2JRIB 4REZA 2R61A 1HA5A 3WALA 5IO9A 4P1CC 1ZXHA 2FIFA 2LEKA 4MGIE 2L32A 2M0AA 1RAXA 2J52A 2K0PA 2LI5A 2LGXA 1WGDA 4RMAA 3ZQ4A 1UELA 1L0XB 4KZ0A 2INCC 4IC7B 2SAKA 4WJPA 1WFYA 2BYEA 3ZKJC 1QQRA 4RM9A 4RF0A 1V49A 2NBWB 2IY0B 1TY2A 2A4ZA 1M4VA 3AE3B 2NCNA 1BT0A 2Z0EB 2AYOB 3R2IA 1MG4A 3SR6A 3WANA 2KOXA 1PFDA 1XCTL 4W9FA 5D3IB 3Q3NC 2LUMA 1V5TA 1KLUD 4P6VF 1WI0A 4ACFA 1FNVA 1IBXB 3IVFA 2D3CA 4MELA 1E90A 3W2DA 1TKEA 1WMHA 2AL6A 2G1EA 2D3AA 4KX6B 1WXMA 2RGFA 2MA9B 1WZ3A 4LK0M 2KACA 1TS5A 2KDEB 2AQ3B 3B2FA 2CR5A 2KC2A 1IGCA 4MGYE 4DHZE 3KUDB 2C60A 1C3TA 2CS4A 3H7SA 3NJTA 4RF1A 1B9RA 1CMXB 3H1UA 4P1BC 2W55A 1WWTA 2JY6A 4AUQC 3I5JC 2YVCA 3ABVB 5CHFA 3FC4A 4O1NA 4K7SA 4MSQB 3PRMB 2EELA 3QJZA 1RLFA 1Z5SB 2C7NB 1JALA 4EZKA 5LLIA 2KMMA 4J3OD 2MCNB 3V05A 3Q8AA 4HDQA 2MLBA 2KANA 1V1PB 3M95A 3DBHI 1F77A 1FXIA 3GP7A 3KUZA 1E9MA 2L0FA 1EUVB 2IO0B 4WWNA 4YT0B 2NS5A 1LM8B 5H8YE 3KYDD 1C79A 5G5HA 3Q8EA 4WH4A 2LVOA 2WNMA 3N32A 2LHEA 3TEYA 3DBSA 2E6XA 4IM3A 1L6UA 1SBBB 1ZW7A 3KVFB 4YSXB 1OQYA 3ZTCA 1EU3A 1R7SA 3UIOB 5CTRC 1NI2A 1D6EC 1V1PA 1LXDA 3AB5A 4XDDA 5IA7A 3QQ8B 3HHMA 4GDKA 2MBBB 2WXLA 4K7WA 3AE2B 4FLHA 2KNBA 4Q2JA 1C4CA 2REXA 3AEGB 3N20C 1NYRA 3VTVA 4X57B 1P0RA 1HZ5A 1NI3A 1TIFA 2GRIA 2KKCA 2KFKB 4DHJB 4ICUA 1WF9A 3WCQA 1FO4A 3RULA 4MEMA 5T8IA 4IWQA 4MGZE 2D11A 1P1AA 2EMTA 3C19A 1QZEA 2YEPF 3FKYA 3KWLA 2L76A 5AUKA 1WX8A 1WMHB 2L00B 3ZLZA 2L3ZA 3UIPB 1U4AA 2HD5B 3I57A 3APCA 1LGRA 1SE2A 4ZYNA 2RPQA 2GI9A 3A1QB 3L16A 2NTSA 3ZJVA 3SHQA 4IKGA 4K1RB 3B08A 3W1YA 1XQQA 1YQ4B 3FILB 5AZGA 4KIKA 4FBJB 4N6EB 4ZHPA 5BMIA 1VDVA 2X8XX 3PREA 4GB9A 2WYQA 2PIAA 5JH5C 2L52A 1LFDA 2IJ0A 1HEZE 2NVUI 2QJLA 3Q69A 1FNWA 2D3GA 2RPVA 1T0QC 3Q8BA 1OQRA 2PVOD 4GIVA 3ZNGC 2K9XA 3ML8A 3QK0A 1DOIA 3AU5A 2KQ4X 3Q3OC 4BFRA 2JT4B 1TZ1A 2N9KA 1TZOA 1IP9A 4BZAA 1C78A 3IHPC 3MJ5A 3MHSD 2CHZA 1WX9A 2D07B 3Q6BA 2N9PC 2GLSA 3NZUA 4IW0A 4ARCA 1N63A 1TBEA 4LNNA 2QMTA 2KX3A 2L8JA 3ZUNA 3DCGA 4ZRJA 3RNAC 5D2MB 3T3NA 3W1SC 2N9XA 3MP9A 2I2YA 4B9KA 4B95A 3ZDMC 2LGIA 4RCOA 1GJZA 1C9FA 1QOFA 5DCNA 1TKYA 4NNJB 4S0RA 4PYZA 1S3SG 2JZPA 3ALBA 4S17A 4KSKC 2L83A 2KJ6A 4WIPA 3U4EG 3W9CB 4YSYB 5EE3A 3PV1A 3RNGC 3VDZA 3V6EB 4M02A 2O6VA 2QILA 3W5UB 2LWPA 1D5ZC 2OJWA 2DYMA 4GSWA 4OVVA 3OJ3A 5JZEB 4N58A 3ONSA 1SB3C 4RNAA 1I4RA 3HUIA 3KYCD 1FRRA 3R2TA 3IT6B 3N1ZC 5MPOA 2J0KA 5HI1A 2IZVB 3P4PB 1AWDA 5IAAC 1AN8A 2B3AA 4US8A 3IXSA 5BYSA 3ZXRA 3Q3MC 2CU3A 5EE0A 1GC6A 3RT3B 2QCZA 1K52A 2KO3A 4PS8A 2NTTA 2J4XA 3L10B 3E9SA 3N1XC 1ZOYB 4WWMA 1M94A 1XD3B 4FJVB 1AYFA 2LGYA 4LNIA 3QAQA 4HKZE 2L05A 2GBMA 1YQ3B 1YNTE 1VLBA 1F1HA 2DBYA 1JWMD 2UU7A 3PTFC 3H8HA 1ZKHA 4AS1A 1HTQA 1SIFA 4JPSA 1NDDA 2BKRB 3ETRA 1C4AA 1WGRA 1STEA 4JIOU 1SXTA 3M3JA 2ZZPB 3VR9B 1Z2MA 5BYRA 2KC1A 1J7AA 2CJNA 4W9HA 1L5PA 4GDKB 3L13A 4NAMA 5IKCM 1H8CA 1WJUA 2HJ8A 4US9A 3AE8B 2LXAA 4IDIA 3EFCA 4E71A 3NVWA 4GDLA 2M56B 2BF8B 3VH4B 1IPGA 5DPRA 3QC8B 3QARA 1MI0A 1E7UA 4IM0A 3JSVA 1PYWD 4AJYB 1WGKA 4F1SA 4M01A 2QDFA 1GUAB 1QF6A 3VRAB 4XE0A 4A6QA 2ZW1A 2MBQA 1UD7A 2KJRA 2N7JA 3ZRCA 1KOTA 4AJWA 1ACCA 3IT4B 2PLPA 5EDSA 2MJDA 4ITKA 4L1BA 4FN2A 2OOBB 1L6VA 2BWES 2HE7A 1KTKA 2MHJA 3OLMD 4HJGE 5E6PA 1PQSA 2ICIA 1WGGA 2XK5A 3R66C 2C5LC
chains in the Genus database with same CATH topology
2KQ7A 3M63B 5AZHA 3PGEA 1J0GA 2KC2A 2KZRA 3VH3B 2MWSB 2IO2B 4MGYE 4DHZE 1KJTA 3KUDB 3ZNHB 2C60A 5D7GA 3C0RB 3TL5A 4TUUA 2ZPYA 2CS4A 1C3TA 4BKSA 2O2VA 3H7SA 1E8WA 4FJYA 1LQBA 4G50A 2FCNA 2I1KA 4GDLB 1KLVA 1OEYJ 4MH0E 1CMXB 3H1UA 3WA0A 3NOBA 2N1WA 3BINA 2JY6A 4AUQC 5J17A 2KHWB 2PJHA 2YVCA 4JQWC 3UQBA 4KDLB 2Y5BB 2M17A 4II2B 5CHFA 1V6EA 5DPSA 4ANUA 2JUOA 2C7MB 4K7SA 4MSQB 2K6DB 4PS7A 3PRMB 4YL8A 3RUIB 3A9KB 3QJZA 1RLFA 4W9GA 4FULA 4KV2A 1Z5SB 1SGHA 2C7NB 3V6CB 1E8XA 3Q3FA 1V80A 3DVGY 4IM2A 1JRUA 4EZKA 5AEKB 4TKNA 5C23A 5LLIA 4G0NB 4FJZA 2ASQA 2MCNB 5D94A 4BBNC 4HDQA 2MLBA 2ZNVB 4HCNB 1WZ0A 2KANA 3AI5A 3DBHI 1EF5A 3M95A 3TBLD 2MX2A 4BVUC 3TCAA 3H9DA 2G4DB 2L0FA 1EUVB 1P98A 3KUZA 4F8CB 2IO0B 3MTNB 4K81A 4WWNA 3A9JB 2M1MA 2MSED 2PE6B 2YLMA 5G55A 2NS5A 1LM8B 2IY1B 3KYDD 5J2RA 3X23A 4I6PA 3UINB 3IFWB 5L95C 1UZXB 1RFAA 4MJSB 1EF1A 2LVOA 3N32A 4JGHB 1E8ZA 3DBSA 1WYWB 3APFA 3ZW3A 2KX0A 4NY0A 4IM3A 4DDID 2DZMA 1IYFA 2ZPNA 3ML9A 4URKA 4NQKE 2KD0A 1YX5B 2AWTA 1ZW7A 3KVFB 2LRWA 1GC7A 1OQYA 4HPLB 3ZTCA 2K8BA 1R4NI 3A1QA 3DBLI 1WXSA 5E6NA 1ZGUB 3UIOB 1SE9A 2A5UA 5CHVC 4PYUA 4W9LA 5CTRC 1NI2A 4CHKA 4IG7B 2DZIA 4N9F4 4J6IA 1LXDA 1K8RB 3VTWA 4CO7A 4DHZB 4ZDVA 4W9CA 5DPTA 5IA7A 2KXJA 3QQ8B 3EC8A 2LZ6A 4PS3A 3PZDA 3MJWA 4WWPA 3HHMA 4NPNA 2DX5B 4GDKA 2C9WB 2MBBB 3A4SC 2WDTB 4BBNF 4DHJD 4K7WA 1I42A 1WIAA 4FLHA 2KNBA 1WR6E 3ZVVA 2C7HA 2N7DA 3DVNU 1GNUA 4W9EA 3QIJA 4HJKA 1NBFC 2IYDB 2REXA 2ZNVC 3PSEB 2KJHB 2LD9A 1TTNA 3PPAA 3VTVA 4X57B 2O6VB 4KDIC 2G4SA 4GXBA 3K9PB 3PLUA 4HK2A 3PRPB 1YQBA 1P0RA 4HCPB 3CSTA 3DBRI 2L7RA 1A5RA 3DVGX 2KKCA 2JXXA 2KFKB 3HIZA 1WX7A 4DHJB 2KLCA 4XZ4A 4ICUA 2DZJA 1WF9A 4W9DA 4EKUA 1UBQA 3RULA 2LVPA 3OAWA 4MEMA 4LCDE 5AZFA 4IWQA 4MGZE 2ZVOA 2D11A 2JZZA 1RRBA 3EHVA 1V2YA 1P1AA 2EMTA 1QZEA 2KFJA 4ANXA 2W9NA 2N7EA 2R2OA 3R7QA 5L83A 3DQVA 2M0XA 2L76A 3U30A 1D3ZA 1F9JA 2LASA 1WX8A 4NJ7A 1WMHB 2L00B 3WAMA 3ZLZA 4BKTA 2L3ZA 2MP2A 3VUYA 3UIPB 4EZJA 4II3B 3ZRFA 2N1VA 3L08A 2KN5A 1U4AA 2HD5B 1TGZB 1E5WA 3APCA 1WH3A 2MBEA 2JPHA 2V4LA 4ZYNA 2XBBC 2M8SA 2QHOA 2RPQA 3A1QB 4IUMB 3L16A 5TR5A 1WGYA 5GMVA 2IO1B 3SHQA 3R7RA 2JRHA 2BYFA 4FHKA 2FIDA 4FADA 4K1RB 1WR1A 3B08A 2GMIC 2KDBA 3HK0A 1WJNA 2KVRA 1J8CA 3W1YA 4HLEA 1XQQA 3DVNV 4G3XB 3EECA 5AZGA 4KIKA 3JW0X 3QX1A 4WJOA 4WJQA 4FBJB 3DDCB 3QWZB 4DDGD 1J19A 2D10A 2XK5B 3PREA 4GB9A 2WYQA 4NAWA 5JH5C 3ENEA 3HM6X 2FAZA 3R3MA 3RCZA 3VAWA 1LFDA 4B6WA 1XT9B 3PHXB 2KTFA 2NVUI 4GU2A 2K6QA 2GBKA 4GMVA 2D3GA 2OJRA 2KWUB 2XEWA 4EFOA 4DBGA 3GOEA 3ZTDA 1YIWA 2J0MA 4K7UA 4LDTB 4E74A 3DOWA 4G11A 3N30A 3VXWA 1WJ4A 2LUEA 4GIVA 3ZNGC 4XX5A 3ML8A 3P2BA 3QK0A 1GG3A 1WM2A 2R2QA 1VD2A 4HVBA 1Q5WB 4JLCA 3AU5A 1AARA 2FCSA 4WQOB 4ANVA 2NPTA 1YJ1A 4BFRA 2JT4B 1TZ1A 2N4FA 5LXIB 1WRDB 3H7PA 4KVGB 1IP9A 3WAPA 4GN1A 2NR2A 4WJNA 1P9DU 3IHPC 2GBRA 4ZRKA 3RZFA 3KUCB 3MHSD 2CHZA 3ZNZB 1WX9A 3U8ZA 2LGDA 1WY8A 2D07B 5D6JB 1WXVA 2DAJA 1E8YA 2G45B 1P3QU 1OEYA 2N9PC 2JF5A 3NZUA 4IW0A 2GBJA 1TBEA 4P7IA 3A9JA 2MW5A 3PVLA 2PEAA 2CHWA 3RZWC 2KX3A 2L8JA 2DYBA 4KIKB 3ZUNA 4A3OA 3DCGA 2MBHA 3EFUA 4ZRJA 4EEWA 1V9JA 2VRRB 2LJ5A 4JL9A 1MG8A 2FNJB 2O6VD 3CSFA 1H4RA 2KLGA 3L17A 5D2MB 4AOFA 2CKHB 4MJSA 2KFKA 5KHOA 3W1SC 3DPDA 2N9XA 1Q1OA 3IBEA 4XC2A 1UGMA 2V1YA 4HDOA 4B9KA 2D2QA 3AULA 4B95A 3ZDMC 3V60A 1UH6A 2GOWA 2RR9A 3TIXA 1GJZA 5G2NA 4ANWA 4GOCA 4W9IA 5DCNA 2MQJA 2K39A 3M62B 2ZEQA 4NNJB 2FCQA 4PYZA 2KQSA 2LXCA 1S3SG 3ALBA 1WM3A 2MBOA 4HPMB 4OVUA 5BO4B 4BOSC 3BY4B 2JVCA 4MM3A 3ZNID 3O65B 1KM7A 2K8CA 4KSKC 2KJ6A 3NZSA 3ZIMA 1WGHA 2IBIB 2K25A 3UQAA 2EMSA 5DPWA 2NBVB 3LJ3A 3PV1A 2DAFA 2DYOA 4W9JA 4DXAB 1I35A 4I6LB 3VDZA 4TV3A 3V6EB 2GBNA 2K8HA 5KHQA 3SU8X 3Q3JA 2O6VA 4HWIB 2WWZA 4IWOA 1FXTB 2G3QB 2NPTB 5JHBA 1WE6A 3RD2A 2UWQA 2LWPA 3H7PB 4RM8A 1S1QB 2DYMA 3KH0A 2KMCA 4GGQA 4GSWA 3OJ3A 4OVVA 5JZEB 3VUXA 3ONSA 2KMAA 2KDFB 3UGBB 2WX1A 1WXAA 2KK8A 3KYCD 3VHTC 3KW5B 2J0JA 1X1MA 2MP2B 3APDA 4ICVA 3W1SA 3CF6E 4BOZB 2J0KA 2IZVB 4LDTD 1EO6A 2N9EB 2BPSA 3U7DA 5IAAC 3VUWA 2B3AA 1R4MI 4KSLC 4W9KA 3WIMA 4NQLB 1GC6A 3GZNI 2MRPA 2DENB 1UBIA 2KTRB 3OJ4B 3RT3B 2KO3A 4PS8A 2PE9A 2EKEC 1V5OA 3V62A 3L10B 1G6JA 3L54A 2V3SA 2NBUA 3UF8A 3ECIA 1M94A 1XD3B 3QA8A 1WJ6A 4FJVB 2LGYA 2ZJDA 3PHWB 4WAAA 3V61A 3QAQA 4BKGA 4IWPA 2DHZA 4A20A 1C1YB 4EOYA 5LXHA 4LJOB 2L05A 2DZKA 2GBMA 4NAWB 4FA6A 3NS8A 1V81A 3AU4A 3RYTA 2RSUA 2ZCBA 4M8MA 4AWJA 3L0WB 2KTRA 2Z0DB 3NY5A 3PTFC 4TQ1A 4DWFA 3PRZA 1YD8U 3LDZE 4ASWC 4M8NA 5CHWA 2L0TA 1ZKHA 2RD0A 1T0YA 3A4RA 2BGFA 4CYEA 3HM3A 3TMPB 3AXCA 1SIFA 2BYVE 2BKFA 3ZO5B 5JHAA 1NDDA 2J7QB 5CX3A 2BKRB 4HXDA 3VTUA 2JRIB 5C1ZA 1Q0WB 1WGRA 3D32A 4NJ6A 3WALA 4JIOU 3T9LA 2FIFA 3JYUA 2ZZPB 3M3JA 2LVQA 2ZVNA 3JSVB 4MGIE 1WE7A 1E7VA 1Z2MA 4A3PA 2CU1A 4KZCA 3TJPA 2KC1A 1RAXA 3QCAA 3CMMB 4WWOA 3T8MA 2LI5A 2LGXA 4W9HA 4GDKB 1VCBA 3S2AA 1WGDA 1YX6B 3L13A 4RMAA 4EZLA 2Z59B 3SDLC 1Y8RC 4ZRIA 1UELA 4KZ0A 4MDKE 3WAOA 1L7YA 4IC7B 3K9OB 1H8CA 1V86A 4M0WB 4MGKE 1WFYA 1WJUA 2ZCCA 2BYEA 4WJPA 3ZKJC 5J18A 4RM9A 5FR6A 3A9KA 1V49A 2NBWB 2HJ8A 4LJPB 3SD5A 2IY0B 4DK5A 3PLVA 3QHTA 2O2VB 2A4ZA 2LXAA 4E71A 4GDLA 1OTRB 2BF8B 2K1FA 2NCNA 1BT0A 3B0AA 2Z0EB 1IPGA 2AYOB 3VH4B 2I1JA 5HKHA 5DPRA 3QC8B 3PS6A 1L2NA 3NHEB 3QARA 2CHXA 2PPHA 2AEHA 4BKSD 3WANA 4TQ0A 1E7UA 2KOXA 4IM0A 3JSVA 1HE8A 2KWCA 3N3KB 4W9FA 2FUHB 1ISNA 4AJYB 4EUTA 3VFKA 4F1SA 1GUAB 2WX0A 2IO3B 2FCMA 3ZDTA 1V5TA 2JWZA 2UYZB 1WI0A 1UD7A 1OGWA 2KJRA 2MBQA 3VVWB 3ZRCA 3IVFA 4MSMB 4AJWA 1KOTA 2JZ3B 2LRUA 4F7ZA 4AP4C 4MELA 1E90A 3B1LX 5EDSA 3IG3A 2HTHA 1WMHA 3H6NA 2AL6A 2KDIA 3X0WA 2M4NA 3A33B 2OOBB 4FN2A 4E3CA 2AL3A 2BWES 2HE7A 4I6NB 1WXMA 3I3TB 3OLMD 2RGFA 5E6PA 1PQSA 2MA9B 1WZ3A 5E6OA 3VQIA 2BWFA 3JVZX 1WGGA 4FHJA 2XK5A 3PT2B 2KDEB 3R66C 2CR5A 2C5LC 2KWVB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KQ7 A;  3M63 B;  5AZH A;  3PGE A;  1J0G A;  2KC2 A;  2KZR A;  3VH3 B;  2MWS B;  2IO2 B;  4MGY E;  4DHZ E;  1KJT A;  3KUD B;  3ZNH B;  2C60 A;  5D7G A;  3C0R B;  3TL5 A;  4TUU A;  2ZPY A;  2CS4 A;  1C3T A;  4BKS A;  2O2V A;  3H7S A;  1E8W A;  4FJY A;  1LQB A;  4G50 A;  2FCN A;  2I1K A;  4GDL B;  1KLV A;  1OEY J;  4MH0 E;  1CMX B;  3H1U A;  3WA0 A;  3NOB A;  2N1W A;  3BIN A;  2JY6 A;  4AUQ C;  5J17 A;  2KHW B;  2PJH A;  2YVC A;  4JQW C;  3UQB A;  4KDL B;  2Y5B B;  2M17 A;  4II2 B;  5CHF A;  1V6E A;  5DPS A;  4ANU A;  2JUO A;  2C7M B;  4K7S A;  4MSQ B;  2K6D B;  4PS7 A;  3PRM B;  4YL8 A;  3RUI B;  3A9K B;  3QJZ A;  1RLF A;  4W9G A;  4FUL A;  4KV2 A;  1Z5S B;  1SGH A;  2C7N B;  3V6C B;  1E8X A;  3Q3F A;  1V80 A;  3DVG Y;  4IM2 A;  1JRU A;  4EZK A;  5AEK B;  4TKN A;  5C23 A;  5LLI A;  4G0N B;  4FJZ A;  2ASQ A;  2MCN B;  5D94 A;  4BBN C;  4HDQ A;  2MLB A;  2ZNV B;  4HCN B;  1WZ0 A;  2KAN A;  3AI5 A;  3DBH I;  1EF5 A;  3M95 A;  3TBL D;  2MX2 A;  4BVU C;  3TCA A;  3H9D A;  2G4D B;  2L0F A;  1EUV B;  1P98 A;  3KUZ A;  4F8C B;  2IO0 B;  3MTN B;  4K81 A;  4WWN A;  3A9J B;  2M1M A;  2MSE D;  2PE6 B;  2YLM A;  5G55 A;  2NS5 A;  1LM8 B;  2IY1 B;  3KYD D;  5J2R A;  3X23 A;  4I6P A;  3UIN B;  3IFW B;  5L95 C;  1UZX B;  1RFA A;  4MJS B;  1EF1 A;  2LVO A;  3N32 A;  4JGH B;  1E8Z A;  3DBS A;  1WYW B;  3APF A;  3ZW3 A;  2KX0 A;  4NY0 A;  4IM3 A;  4DDI D;  2DZM A;  1IYF A;  2ZPN A;  3ML9 A;  4URK A;  4NQK E;  2KD0 A;  1YX5 B;  2AWT A;  1ZW7 A;  3KVF B;  2LRW A;  1GC7 A;  1OQY A;  4HPL B;  3ZTC A;  2K8B A;  1R4N I;  3A1Q A;  3DBL I;  1WXS A;  5E6N A;  1ZGU B;  3UIO B;  1SE9 A;  2A5U A;  5CHV C;  4PYU A;  4W9L A;  5CTR C;  1NI2 A;  4CHK A;  4IG7 B;  2DZI A;  4N9F 4;  4J6I A;  1LXD A;  1K8R B;  3VTW A;  4CO7 A;  4DHZ B;  4ZDV A;  4W9C A;  5DPT A;  5IA7 A;  2KXJ A;  3QQ8 B;  3EC8 A;  2LZ6 A;  4PS3 A;  3PZD A;  3MJW A;  4WWP A;  3HHM A;  4NPN A;  2DX5 B;  4GDK A;  2C9W B;  2MBB B;  3A4S C;  2WDT B;  4BBN F;  4DHJ D;  4K7W A;  1I42 A;  1WIA A;  4FLH A;  2KNB A;  1WR6 E;  3ZVV A;  2C7H A;  2N7D A;  3DVN U;  1GNU A;  4W9E A;  3QIJ A;  4HJK A;  1NBF C;  2IYD B;  2REX A;  2ZNV C;  3PSE B;  2KJH B;  2LD9 A;  1TTN A;  3PPA A;  3VTV A;  4X57 B;  2O6V B;  4KDI C;  2G4S A;  4GXB A;  3K9P B;  3PLU A;  4HK2 A;  3PRP B;  1YQB A;  1P0R A;  4HCP B;  3CST A;  3DBR I;  2L7R A;  1A5R A;  3DVG X;  2KKC A;  2JXX A;  2KFK B;  3HIZ A;  1WX7 A;  4DHJ B;  2KLC A;  4XZ4 A;  4ICU A;  2DZJ A;  1WF9 A;  4W9D A;  4EKU A;  1UBQ A;  3RUL A;  2LVP A;  3OAW A;  4MEM A;  4LCD E;  5AZF A;  4IWQ A;  4MGZ E;  2ZVO A;  2D11 A;  2JZZ A;  1RRB A;  3EHV A;  1V2Y A;  1P1A A;  2EMT A;  1QZE A;  2KFJ A;  4ANX A;  2W9N A;  2N7E A;  2R2O A;  3R7Q A;  5L83 A;  3DQV A;  2M0X A;  2L76 A;  3U30 A;  1D3Z A;  1F9J A;  2LAS A;  1WX8 A;  4NJ7 A;  1WMH B;  2L00 B;  3WAM A;  3ZLZ A;  4BKT A;  2L3Z A;  2MP2 A;  3VUY A;  3UIP B;  4EZJ A;  4II3 B;  3ZRF A;  2N1V A;  3L08 A;  2KN5 A;  1U4A A;  2HD5 B;  1TGZ B;  1E5W A;  3APC A;  1WH3 A;  2MBE A;  2JPH A;  2V4L A;  4ZYN A;  2XBB C;  2M8S A;  2QHO A;  2RPQ A;  3A1Q B;  4IUM B;  3L16 A;  5TR5 A;  1WGY A;  5GMV A;  2IO1 B;  3SHQ A;  3R7R A;  2JRH A;  2BYF A;  4FHK A;  2FID A;  4FAD A;  4K1R B;  1WR1 A;  3B08 A;  2GMI C;  2KDB A;  3HK0 A;  1WJN A;  2KVR A;  1J8C A;  3W1Y A;  4HLE A;  1XQQ A;  3DVN V;  4G3X B;  3EEC A;  5AZG A;  4KIK A;  3JW0 X;  3QX1 A;  4WJO A;  4WJQ A;  4FBJ B;  3DDC B;  3QWZ B;  4DDG D;  1J19 A;  2D10 A;  2XK5 B;  3PRE A;  4GB9 A;  2WYQ A;  4NAW A;  5JH5 C;  3ENE A;  3HM6 X;  2FAZ A;  3R3M A;  3RCZ A;  3VAW A;  1LFD A;  4B6W A;  1XT9 B;  3PHX B;  2KTF A;  2NVU I;  4GU2 A;  2K6Q A;  2GBK A;  4GMV A;  2D3G A;  2OJR A;  2KWU B;  2XEW A;  4EFO A;  4DBG A;  3GOE A;  3ZTD A;  1YIW A;  2J0M A;  4K7U A;  4LDT B;  4E74 A;  3DOW A;  4G11 A;  3N30 A;  3VXW A;  1WJ4 A;  2LUE A;  4GIV A;  3ZNG C;  4XX5 A;  3ML8 A;  3P2B A;  3QK0 A;  1GG3 A;  1WM2 A;  2R2Q A;  1VD2 A;  4HVB A;  1Q5W B;  4JLC A;  3AU5 A;  1AAR A;  2FCS A;  4WQO B;  4ANV A;  2NPT A;  1YJ1 A;  4BFR A;  2JT4 B;  1TZ1 A;  2N4F A;  5LXI B;  1WRD B;  3H7P A;  4KVG B;  1IP9 A;  3WAP A;  4GN1 A;  2NR2 A;  4WJN A;  1P9D U;  3IHP C;  2GBR A;  4ZRK A;  3RZF A;  3KUC B;  3MHS D;  2CHZ A;  3ZNZ B;  1WX9 A;  3U8Z A;  2LGD A;  1WY8 A;  2D07 B;  5D6J B;  1WXV A;  2DAJ A;  1E8Y A;  2G45 B;  1P3Q U;  1OEY A;  2N9P C;  2JF5 A;  3NZU A;  4IW0 A;  2GBJ A;  1TBE A;  4P7I A;  3A9J A;  2MW5 A;  3PVL A;  2PEA A;  2CHW A;  3RZW C;  2KX3 A;  2L8J A;  2DYB A;  4KIK B;  3ZUN A;  4A3O A;  3DCG A;  2MBH A;  3EFU A;  4ZRJ A;  4EEW A;  1V9J A;  2VRR B;  2LJ5 A;  4JL9 A;  1MG8 A;  2FNJ B;  2O6V D;  3CSF A;  1H4R A;  2KLG A;  3L17 A;  5D2M B;  4AOF A;  2CKH B;  4MJS A;  2KFK A;  5KHO A;  3W1S C;  3DPD A;  2N9X A;  1Q1O A;  3IBE A;  4XC2 A;  1UGM A;  2V1Y A;  4HDO A;  4B9K A;  2D2Q A;  3AUL A;  4B95 A;  3ZDM C;  3V60 A;  1UH6 A;  2GOW A;  2RR9 A;  3TIX A;  1GJZ A;  5G2N A;  4ANW A;  4GOC A;  4W9I A;  5DCN A;  2MQJ A;  2K39 A;  3M62 B;  2ZEQ A;  4NNJ B;  2FCQ A;  4PYZ A;  2KQS A;  2LXC A;  1S3S G;  3ALB A;  1WM3 A;  2MBO A;  4HPM B;  4OVU A;  5BO4 B;  4BOS C;  3BY4 B;  2JVC A;  4MM3 A;  3ZNI D;  3O65 B;  1KM7 A;  2K8C A;  4KSK C;  2KJ6 A;  3NZS A;  3ZIM A;  1WGH A;  2IBI B;  2K25 A;  3UQA A;  2EMS A;  5DPW A;  2NBV B;  3LJ3 A;  3PV1 A;  2DAF A;  2DYO A;  4W9J A;  4DXA B;  1I35 A;  4I6L B;  3VDZ A;  4TV3 A;  3V6E B;  2GBN A;  2K8H A;  5KHQ A;  3SU8 X;  3Q3J A;  2O6V A;  4HWI B;  2WWZ A;  4IWO A;  1FXT B;  2G3Q B;  2NPT B;  5JHB A;  1WE6 A;  3RD2 A;  2UWQ A;  2LWP A;  3H7P B;  4RM8 A;  1S1Q B;  2DYM A;  3KH0 A;  2KMC A;  4GGQ A;  4GSW A;  3OJ3 A;  4OVV A;  5JZE B;  3VUX A;  3ONS A;  2KMA A;  2KDF B;  3UGB B;  2WX1 A;  1WXA A;  2KK8 A;  3KYC D;  3VHT C;  3KW5 B;  2J0J A;  1X1M A;  2MP2 B;  3APD A;  4ICV A;  3W1S A;  3CF6 E;  4BOZ B;  2J0K A;  2IZV B;  4LDT D;  1EO6 A;  2N9E B;  2BPS A;  3U7D A;  5IAA C;  3VUW A;  2B3A A;  1R4M I;  4KSL C;  4W9K A;  3WIM A;  4NQL B;  1GC6 A;  3GZN I;  2MRP A;  2DEN B;  1UBI A;  2KTR B;  3OJ4 B;  3RT3 B;  2KO3 A;  4PS8 A;  2PE9 A;  2EKE C;  1V5O A;  3V62 A;  3L10 B;  1G6J A;  3L54 A;  2V3S A;  2NBU A;  3UF8 A;  3ECI A;  1M94 A;  1XD3 B;  3QA8 A;  1WJ6 A;  4FJV B;  2LGY A;  2ZJD A;  3PHW B;  4WAA A;  3V61 A;  3QAQ A;  4BKG A;  4IWP A;  2DHZ A;  4A20 A;  1C1Y B;  4EOY A;  5LXH A;  4LJO B;  2L05 A;  2DZK A;  2GBM A;  4NAW B;  4FA6 A;  3NS8 A;  1V81 A;  3AU4 A;  3RYT A;  2RSU A;  2ZCB A;  4M8M A;  4AWJ A;  3L0W B;  2KTR A;  2Z0D B;  3NY5 A;  3PTF C;  4TQ1 A;  4DWF A;  3PRZ A;  1YD8 U;  3LDZ E;  4ASW C;  4M8N A;  5CHW A;  2L0T A;  1ZKH A;  2RD0 A;  1T0Y A;  3A4R A;  2BGF A;  4CYE A;  3HM3 A;  3TMP B;  3AXC A;  1SIF A;  2BYV E;  2BKF A;  3ZO5 B;  5JHA A;  1NDD A;  2J7Q B;  5CX3 A;  2BKR B;  4HXD A;  3VTU A;  2JRI B;  5C1Z A;  1Q0W B;  1WGR A;  3D32 A;  4NJ6 A;  3WAL A;  4JIO U;  3T9L A;  2FIF A;  3JYU A;  2ZZP B;  3M3J A;  2LVQ A;  2ZVN A;  3JSV B;  4MGI E;  1WE7 A;  1E7V A;  1Z2M A;  4A3P A;  2CU1 A;  4KZC A;  3TJP A;  2KC1 A;  1RAX A;  3QCA A;  3CMM B;  4WWO A;  3T8M A;  2LI5 A;  2LGX A;  4W9H A;  4GDK B;  1VCB A;  3S2A A;  1WGD A;  1YX6 B;  3L13 A;  4RMA A;  4EZL A;  2Z59 B;  3SDL C;  1Y8R C;  4ZRI A;  1UEL A;  4KZ0 A;  4MDK E;  3WAO A;  1L7Y A;  4IC7 B;  3K9O B;  1H8C A;  1V86 A;  4M0W B;  4MGK E;  1WFY A;  1WJU A;  2ZCC A;  2BYE A;  4WJP A;  3ZKJ C;  5J18 A;  4RM9 A;  5FR6 A;  3A9K A;  1V49 A;  2NBW B;  2HJ8 A;  4LJP B;  3SD5 A;  2IY0 B;  4DK5 A;  3PLV A;  3QHT A;  2O2V B;  2A4Z A;  2LXA A;  4E71 A;  4GDL A;  1OTR B;  2BF8 B;  2K1F A;  2NCN A;  1BT0 A;  3B0A A;  2Z0E B;  1IPG A;  2AYO B;  3VH4 B;  2I1J A;  5HKH A;  5DPR A;  3QC8 B;  3PS6 A;  1L2N A;  3NHE B;  3QAR A;  2CHX A;  2PPH A;  2AEH A;  4BKS D;  3WAN A;  4TQ0 A;  1E7U A;  2KOX A;  4IM0 A;  3JSV A;  1HE8 A;  2KWC A;  3N3K B;  4W9F A;  2FUH B;  1ISN A;  4AJY B;  4EUT A;  3VFK A;  4F1S A;  1GUA B;  2WX0 A;  2IO3 B;  2FCM A;  3ZDT A;  1V5T A;  2JWZ A;  2UYZ B;  1WI0 A;  1UD7 A;  1OGW A;  2KJR A;  2MBQ A;  3VVW B;  3ZRC A;  3IVF A;  4MSM B;  4AJW A;  1KOT A;  2JZ3 B;  2LRU A;  4F7Z A;  4AP4 C;  4MEL A;  1E90 A;  3B1L X;  5EDS A;  3IG3 A;  2HTH A;  1WMH A;  3H6N A;  2AL6 A;  2KDI A;  3X0W A;  2M4N A;  3A33 B;  2OOB B;  4FN2 A;  4E3C A;  2AL3 A;  2BWE S;  2HE7 A;  4I6N B;  1WXM A;  3I3T B;  3OLM D;  2RGF A;  5E6P A;  1PQS A;  2MA9 B;  1WZ3 A;  5E6O A;  3VQI A;  2BWF A;  3JVZ X;  1WGG A;  4FHJ A;  2XK5 A;  3PT2 B;  2KDE B;  3R66 C;  2CR5 A;  2C5L C;  2KWV B; 
#chains in the Genus database with same CATH topology
 3M63 B;  4FXC A;  2KZR A;  3VH3 B;  2H88 B;  2IND C;  2IO2 B;  2WDR B;  3MFG A;  4HRS A;  3C0R B;  1ZPS A;  2ZPY A;  2K3U A;  2O2V A;  2FCN A;  1KLV A;  3AE1 B;  4C56 C;  3WA0 A;  3KWV A;  2N1W A;  5J17 A;  2KHW B;  2PJH A;  4JQW C;  4II2 B;  4M0W A;  4PS7 A;  2C7M B;  3PZ8 A;  2K6D B;  3A9K B;  3GS2 A;  1XLQ A;  3BVZ A;  4JX1 C;  4FUL A;  1DOX A;  1SGH A;  3Q3F A;  2BBC A;  2BVC A;  1JRU A;  5AEK B;  5C23 A;  1ZP0 B;  2HJ1 A;  2MJ3 A;  2B76 B;  1JML A;  4FJZ A;  3MHZ A;  3RPF C;  2W54 A;  4HCN B;  1OFF A;  4YXD B;  3U7Z A;  4BVU C;  3TCA A;  1WXQ A;  3MTN B;  3L4P A;  2Y3A A;  3DWG C;  3A9J B;  2YLM A;  2WXQ A;  5J2R A;  3P4R B;  3UIN B;  3IFW B;  1AW7 A;  1YOV B;  1EF1 A;  1SEB D;  1CZP A;  2BW2 A;  1E8Z A;  1WYW B;  1B1Z A;  2JXT A;  4DDI D;  4PT5 A;  2ZPN A;  3ML9 A;  4OHJ A;  4NQK E;  4C7Y A;  2AWT A;  1GC7 A;  4XYC A;  1R4N I;  2A5U A;  1XLO A;  2WXR A;  4IG7 B;  4J6I A;  3VTW A;  4CO7 A;  4RGO S;  1SF0 A;  1KLG D;  5DPT A;  1XXG A;  3EC8 A;  2LZ6 A;  5AUI A;  1GAQ B;  4NPN A;  1UWX A;  2C9W B;  1J7B A;  1GB1 A;  4DHJ D;  2V3N A;  1I42 A;  1WIA A;  3BWU D;  4HJK A;  3PSE B;  3W5V B;  1TTN A;  2KWD A;  4KDI C;  3NVZ A;  4LNK A;  4GXB A;  4DXG A;  1RWS A;  4HK2 A;  2D5G A;  4HCP B;  1A5R A;  2TSS A;  1RFK A;  3AH7 A;  4XZ4 A;  2DZJ A;  4EKU A;  4OZA A;  2LVP A;  2K22 A;  1T6B X;  2ZVO A;  2JZZ A;  4ZYS A;  2JQR B;  2WLB A;  5L83 A;  3DBL B;  4EE2 A;  2J42 A;  1D3Z A;  1F9J A;  2M19 A;  2BTE A;  1T0R C;  2WXO A;  4EZJ A;  3L08 A;  2KN5 A;  4WAF A;  1E5W A;  5IN7 A;  1ESF A;  2JPH A;  2QHO A;  3DBH B;  1WGY A;  3NVV A;  1PGB A;  1NVI D;  4C80 A;  2N0S B;  4FAD A;  4FHK A;  2WXM A;  4XDC A;  2KDB A;  3HVD A;  2JYT A;  2KVR A;  2KDM A;  3EEC A;  4G3X B;  5EE9 A;  3JW0 X;  3DDC B;  3QWZ B;  2XK5 B;  4ZRP A;  1KRH A;  3HM6 X;  1FMA D;  2GB1 A;  3VAW A;  1T3Q A;  4B6W A;  1XT9 B;  2KTF A;  2K6Q A;  4GMV A;  2KWU B;  5HG2 A;  2IPK D;  2XEW A;  2AX5 A;  2BQQ A;  1YIW A;  3BZD B;  4K7U A;  3RI7 C;  1Q10 A;  3N30 A;  3LXF A;  1XEE A;  1WJ4 A;  4RH6 A;  3P2B A;  1GG3 A;  1WM2 A;  1VD2 A;  1Q5W B;  1FCC C;  1AAR A;  2FCS A;  3EGR A;  4WQO B;  4ANV A;  2N4F A;  3WAP A;  1VZ6 A;  4GN1 A;  1T5X D;  1ZDX A;  2GBR A;  3EUB 2;  3U8Z A;  2YEP B;  3P63 A;  4L2Y A;  5D6J B;  1WXV A;  1E8Y A;  1XCQ L;  3BYT B;  2G45 B;  1ROE A;  3PVL A;  2ZW0 A;  2DYB A;  3EFU A;  2WXP A;  2VRR B;  5FKA C;  1MG8 A;  1DGJ A;  2OED A;  4WUR A;  1QOA A;  4B0M A;  3L17 A;  4A90 A;  4AOF A;  1UF0 A;  2LHD A;  2KFK A;  3DPD A;  1N62 A;  2QC8 A;  1Q1O A;  3IBE A;  2ACZ B;  4HEA 1;  1K51 A;  1ET6 A;  2MQJ A;  2ZEQ A;  1E7P B;  4HPM B;  4OVU A;  4BOS C;  3MC8 A;  4MM3 A;  3T3O A;  1GPX A;  1KM7 A;  2K8C A;  3ZIM A;  2BS2 B;  2PVG C;  1D4B A;  1ZE3 D;  3AMZ A;  1HZ6 A;  5DPW A;  1C77 A;  1I35 A;  3KQ4 A;  4I6L B;  1QT9 A;  2GBN A;  2WQY B;  3SU8 X;  2WWZ A;  4IWO A;  1FXT B;  2G3Q B;  2MEK A;  2NPT B;  2UWQ A;  4XWT A;  3KH0 A;  4GGQ A;  1JWU D;  1TKG A;  2KDF B;  3UGB B;  1WXA A;  3KW5 B;  2J0J A;  3APD A;  1KF6 B;  4BOZ B;  2N9E B;  1E0Z A;  2JX5 A;  3U7D A;  1R4M I;  2VZK D;  2AQ1 B;  2MRP A;  2KTR B;  3OJ4 B;  3V62 A;  3L54 A;  3RFZ B;  2LMC A;  5EE1 A;  4KGR A;  1FPY A;  3RNF C;  1EU4 A;  1F52 A;  2N9L A;  2DHZ A;  4EOY A;  4LJO B;  4NAW B;  4RGN A;  3NS8 A;  1V81 A;  1F2R I;  4M8M A;  2QSD A;  1JWA D;  1P7F A;  2WDQ B;  2Z0D B;  2Y5P A;  2DLB A;  4TQ1 A;  1DYQ A;  3OG5 A;  3Q2A C;  1T0Y A;  4KGS A;  3I63 C;  2WXJ A;  2BGF A;  3TMP B;  2JSV X;  5C1Z A;  1Q0W B;  3J9C A;  3D32 A;  2FBW B;  3T9L A;  3JYU A;  1WE7 A;  2JU6 X;  1MHH E;  3V3X A;  4A3P A;  4D2K A;  3QCA A;  3Q14 C;  3CMM B;  4C00 A;  4WWO A;  3T8M A;  4L23 A;  3S2A A;  4EZL A;  5TSS A;  3SDL C;  4ZRI A;  4MDK E;  3WAO A;  3RN9 C;  1L7Y A;  4M0W B;  4MGK E;  1HTO A;  4RFB A;  4TMA B;  5FR6 A;  1FCL A;  3A9K A;  4DK5 A;  1TT5 B;  4LJP B;  3PLV A;  1SJH D;  3QHT A;  1OTR B;  1EWY C;  1FM0 D;  2I1J A;  5HKH A;  4IOI E;  3NHE B;  3NUH B;  2CHX A;  1C4P A;  1SIJ A;  2AEH A;  1YN5 A;  2FUG 1;  2KWC A;  3N3K B;  4A9A A;  2FUH B;  4A55 A;  2IO3 B;  2FCM A;  2JWU A;  1I7H A;  5FK9 C;  3ZDT A;  1QOG A;  1YN4 A;  3VVW B;  2K5P A;  2LRU A;  4C7Z A;  3B1L X;  2SEB D;  3IG3 A;  3H6N A;  2JYE A;  1FFV A;  1TJE A;  2M4N A;  3A33 B;  5FR3 A;  2AL3 A;  2Y5C A;  5C2T B;  1UGJ A;  1L0V B;  3VQI A;  2BWF A;  4FHJ A;  1NEK B;  3PT2 B;  2RMM A;  1TS4 A;  1GB4 A;  3L0W B;  2KQ7 A;  4RGT A;  2LGS A;  1KJT A;  3ZNH B;  3AV8 A;  1E8W A;  4FJY A;  4G50 A;  4MT5 A;  4GDL B;  1OEY J;  4MH0 E;  4OZC A;  3NOB A;  1JWB D;  1BXT A;  3UQB A;  2HDE A;  2M17 A;  2Y5B B;  5DPS A;  5D3D A;  2JUO A;  1MFW A;  4YL8 A;  3RUI B;  1TYG B;  4W9G A;  3AED B;  1JWS D;  2WU5 B;  3V6C B;  2WS3 B;  4TKN A;  2ASQ A;  1R4N B;  2NMQ A;  1QLB B;  1PGA A;  2ZNV B;  1WZ0 A;  3TBL D;  3AI5 A;  2MX2 A;  4F8C B;  1P98 A;  3AEC B;  4LLG M;  5BMG A;  1VZ8 A;  1QKZ A;  5G55 A;  2IY1 B;  3VRB B;  5L95 C;  3MC9 A;  1RFA A;  4MJS B;  2E3T A;  1ET9 A;  3APF A;  1Y56 A;  4NY0 A;  1IYF A;  1YN3 A;  3DBL I;  5E6N A;  1QIL A;  3U2S C;  1SE9 A;  5CHV C;  4PYU A;  3GE8 C;  4ZHO A;  1PUT A;  4ZDV A;  4W9C A;  2KXJ A;  4PS3 A;  3PZD A;  3FAH A;  2WDT B;  4BBN F;  4C4V A;  2N7D A;  4M00 A;  3DVN U;  2MJE A;  1GNU A;  4W9E A;  1DOY A;  1YJJ A;  3AEB B;  1N60 A;  3PPA A;  5GXG B;  2G4S A;  1UWM A;  1E6E B;  3N1Y C;  3CST A;  3DBR I;  2VH2 A;  1C76 A;  4W9D A;  3SFE B;  2RDB C;  3OAW A;  3HVZ A;  3U52 E;  1RRB A;  1FD6 A;  1L0Y B;  2WXK A;  1V2Y A;  2KFJ A;  2W9N A;  1JRP A;  3PZ7 A;  1HQR D;  2N7E A;  3R7Q A;  4LTU A;  2M0X A;  1I4P A;  2LAS A;  3WAM A;  2MP2 A;  3KLS X;  4GLS C;  4II3 B;  3ZRF A;  2N1V A;  3BII D;  1TGZ B;  2MBE A;  2M8S A;  2MH7 A;  1OQQ A;  3R7R A;  2JRH A;  2FID A;  2GMI C;  1WJN A;  4HLE A;  1NYQ A;  1L4D B;  3NG0 A;  3AE4 B;  4WJQ A;  1HXY D;  4DDG D;  4B0E A;  1J19 A;  2D10 A;  1CK1 A;  4DQO C;  3ENE A;  2WP9 B;  3ZXV A;  3PHX B;  4GU2 A;  4AQ7 A;  2OJR A;  4DBG A;  3ZTD A;  2J0M A;  3IAM 1;  3RNE C;  3N9Y C;  4G11 A;  2LUE A;  2VH1 A;  4XX5 A;  3AEE B;  2R2Q A;  4JLC A;  3BYY B;  1CQV A;  4HRO A;  2LFI A;  2RDH A;  2NPT A;  4KVG B;  2NR2 A;  4WJN A;  4YTM B;  3AEF B;  4ZRK A;  3ZNZ B;  1WY8 A;  3NRZ A;  5HHD G;  3DBR B;  1SSN A;  3I9V 1;  3RZW C;  4A3O A;  4R3D A;  1V9J A;  4JL9 A;  2LJ5 A;  2FNJ B;  2O6V D;  2BS4 B;  1H4R A;  1V1O A;  4MJS A;  5KHO A;  4MM3 B;  1CJE A;  4XC2 A;  2V1Y A;  4HDO A;  3AUL A;  1N6Z A;  3V60 A;  1UH6 A;  2GOW A;  2RR9 A;  3TIX A;  2PKO A;  4ANW A;  4A8X C;  2WXI A;  1MJD A;  4YSZ B;  3NVY A;  2FCQ A;  2KQS A;  2LXC A;  1TY0 A;  2WXG A;  2HTM E;  2MBO A;  5BO4 B;  3BY4 B;  3BVG A;  1MVK A;  2IBI B;  2W82 A;  2K25 A;  3BK2 A;  3O13 A;  2EMS A;  1P7E A;  2NBV B;  3LJ3 A;  2DAF A;  2DYO A;  5KHQ A;  2BB6 A;  4HWI B;  3URY A;  2KAJ A;  1LO5 D;  3AE6 B;  1FFU A;  3VUX A;  4ARI A;  1N5W A;  5JXV A;  2KK8 A;  3VHT C;  2J53 A;  3W1S A;  4LNO A;  3DHI C;  2XN9 C;  1ENF A;  2G9H D;  3VUW A;  1FXA A;  2KVZ A;  4KSL C;  4W9K A;  4NQL B;  2V9H A;  2DEN B;  3ZGZ A;  1V5O A;  5G5G A;  1UUP A;  4YTP B;  2V3S A;  3ECI A;  4CQN A;  2WU2 B;  1WJ6 A;  3PHW B;  5HFY A;  5E6J A;  4BKG A;  4IWP A;  4A20 A;  1C1Y B;  5LXH A;  2DZK A;  3AU4 A;  2V3P A;  3B9J A;  4HPP A;  2L1A A;  3OWE B;  2KTR A;  4JWU C;  4DWF A;  3PRZ A;  3RNC C;  1YD8 U;  3LDZ E;  2L0T A;  3A4R A;  2W3R A;  3ZO5 B;  5JHA A;  2J7Q B;  5CX3 A;  3VTU A;  2OHF A;  3TSS A;  4K3C A;  4NJ6 A;  2LVQ A;  2WHI A;  2ZVN A;  3JSV B;  2V0G A;  1JQ4 A;  1E7V A;  2ONQ A;  2CU1 A;  4KZC A;  3TJP A;  1A70 A;  3DWM A;  1WRI A;  1N61 A;  1N5X A;  1VCB A;  1YX6 B;  1J7C A;  2Z59 B;  1Y8R C;  1V8C A;  2PW9 A;  3AE5 B;  3K9O B;  1V86 A;  5J18 A;  4HKQ A;  2ZCC A;  2BYT A;  4JE3 B;  3SD5 A;  2O2V B;  2IDY A;  4YTN B;  1D5X C;  2K1F A;  3B0A A;  4QAY A;  2WGS A;  3PS6 A;  1L2N A;  2PPH A;  4BKS D;  4TQ0 A;  1HE8 A;  1ISN A;  4EUT A;  3VFK A;  2WX0 A;  2WXN A;  1XO3 A;  2JWZ A;  2UYZ B;  1OGW A;  4MSM B;  3BK1 A;  2JZ3 B;  4F7Z A;  4AP4 C;  3PO0 A;  1R4M B;  2HTH A;  1PDX A;  5IP4 D;  2KDI A;  3IAS 1;  3X0W A;  4E3C A;  3AE7 B;  2INP E;  4I6N B;  3DHG C;  3P42 A;  3I3T B;  1WYG A;  1TS3 A;  5E6O A;  3JVZ X;  3FIL A;  4UDU C;  3RCZ A;  3DHH C;  2KWV B;  5AZH A;  3PGE A;  1J0G A;  1I4Q A;  2MWS B;  2PMV A;  4TSS A;  5D7G A;  3TL5 A;  4TUU A;  4BKS A;  3RMK C;  1LQB A;  2I1K A;  4MH8 A;  2KYW A;  3BIN A;  1VR9 A;  1PGX A;  4DXF A;  2XNA C;  4KDL B;  1XLP A;  4ANU A;  1V6E A;  1FRD A;  3AM9 A;  3HRD D;  1VRA B;  4KV2 A;  1L4Z B;  2WDV B;  4XGA B;  1E8X A;  1V80 A;  3DVG Y;  4IM2 A;  2VZK B;  2QIE B;  2RDG A;  4G0N B;  1ZDV A;  1FEH A;  2D3B A;  5D94 A;  1V97 A;  4BBN C;  1EF5 A;  1I4X A;  3H9D A;  2G4D B;  4K81 A;  2M1M A;  2MSE D;  2PE6 B;  1K53 A;  3AE9 B;  3X23 A;  4I6P A;  1TS2 A;  3MC0 B;  1UZX B;  4JGH B;  3ZW3 A;  1SE4 A;  2KX0 A;  2DZM A;  3ZJT A;  4URK A;  1KH0 A;  1XF5 L;  2KD0 A;  1YX5 B;  2LRW A;  2DWQ A;  2Q5W D;  3GB1 A;  4HPL B;  2K8B A;  3A1Q A;  1WXS A;  1ZGU B;  2Z8L A;  2INN E;  4W9L A;  2WXH A;  4CHK A;  2DZI A;  4N9F 4;  1K8R B;  3P4Q B;  4OW0 A;  3TEX A;  4DHZ B;  1KFY B;  3MJW A;  4WWP A;  2DX5 B;  3A4S C;  1YMH E;  4P16 A;  1IBX A;  3ZVV A;  1WR6 E;  1T0S C;  2C7H A;  1ZXI A;  2BT6 A;  1I4H A;  2KN4 A;  3UI3 A;  3QIJ A;  1NBF C;  2CJO A;  2IYD B;  2ZNV C;  2KJH B;  1UNS A;  2LD9 A;  3P4S B;  3GZN B;  2O6V B;  3K9P B;  3PLU A;  3PRP B;  1YQB A;  1MHX A;  2PTL A;  2L7R A;  3DVG X;  2JXX A;  3HIZ A;  1WX7 A;  4RGM A;  2KLC A;  3SEB A;  1UBQ A;  5IOI A;  4LCD E;  5AZF A;  3VR8 B;  1IGD A;  1EWC A;  3EHV A;  1BUI C;  4ANX A;  2AQ2 B;  2R2O A;  3DQV A;  3BVM A;  4XWW A;  3U30 A;  4ZOH C;  4NJ7 A;  4BAX A;  5BMH A;  4BKT A;  1ZUD 2;  3VUY A;  2IGH A;  4OVZ A;  1F0Z A;  3TEZ A;  3CWI A;  3ZJU A;  1WH3 A;  2V4L A;  2DNF A;  2XBB C;  4C4V B;  4IUM B;  5TR5 A;  5GMV A;  2IO1 B;  2BYF A;  1WR1 A;  3HK0 A;  1J8C A;  3DVN V;  1D5M C;  4WJO A;  3QX1 A;  5C3J B;  1YJI A;  1EM7 A;  2I38 A;  4NAW A;  2WXF A;  2FAZ A;  3R3M A;  2H89 B;  2BS3 B;  2GBK A;  3RNB C;  4EFO A;  4OZB A;  3GOE A;  4LDT B;  4E74 A;  3DOW A;  3VXW A;  4LNF A;  1SE3 A;  4KGT A;  3Q8F A;  4HVB A;  1QOB A;  1IUE A;  1YJ1 A;  5LXI B;  1WRD B;  3H7P A;  3SFD B;  4K3B A;  4NJC A;  1P9D U;  3RZF A;  3KUC B;  4NZL B;  2LGD A;  2DAJ A;  1P3Q U;  1OEY A;  2JF5 A;  2GBJ A;  3Q8C A;  4P7I A;  3A9J A;  2MW5 A;  3NS1 A;  2PEA A;  2CHW A;  4KIK B;  2MBH A;  4EEW A;  4ZRQ A;  3CSF A;  2KLG A;  3TEW A;  2CKH B;  1K50 A;  4KKI A;  1UGM A;  2X38 A;  2D2Q A;  5G2N A;  4PK1 A;  4GOC A;  5BYQ A;  4W9I A;  4MAC A;  3AEA B;  4H2A A;  2K39 A;  3M62 B;  1SJE D;  3GE3 C;  5H92 C;  1WM3 A;  3C8Y A;  1GOZ A;  2JVC A;  3ZNI D;  3O65 B;  2IGD A;  1NEN B;  1XLN A;  2EKI A;  3NZS A;  1RM6 C;  1WGH A;  2KT7 A;  4JWS C;  1VZ7 A;  3UQA A;  3B2G A;  3R8B A;  4W9J A;  4WQM A;  4DXA B;  4TV3 A;  1JCK B;  2K8H A;  3Q3J A;  3EA6 A;  5JHB A;  1WE6 A;  3RD2 A;  1F2R C;  3H7P B;  3AN1 A;  4RM8 A;  2LJI A;  1S1Q B;  2KMC A;  5I4D A;  2KMA A;  2WX1 A;  1BML C;  1X1M A;  2MP2 B;  4ICV A;  3TUO A;  2IGG A;  3CF6 E;  4N59 A;  4LDT D;  1EO6 A;  2V4I B;  1E10 A;  4KKJ A;  1WSP A;  1MPE A;  2BPS A;  2QEJ C;  4USA A;  3E56 A;  4YWG G;  3WIM A;  3P1M A;  3GZN I;  5LNK 1;  1UBI A;  2PE9 A;  2EKE C;  1G6J A;  2FE8 A;  1I4G A;  2NBU A;  3UF8 A;  1JRO A;  1FNU A;  2ON8 A;  2BB5 A;  3QA8 A;  2ZJD A;  4WAA A;  3NZ3 A;  3V61 A;  3LB8 C;  2W3S A;  4FA6 A;  1VJK A;  3LYY A;  4AWJ A;  3RYT A;  2RSU A;  2ZCB A;  3ZYY X;  3NY5 A;  4ASW C;  1RYJ A;  4M8N A;  5CHW A;  2RD0 A;  1JW9 D;  4CYE A;  3HM3 A;  3AXC A;  2BYV E;  3CIR B;  2BKF A;  1FIQ A;  4HXD A;  2JRI B;  4REZ A;  2R61 A;  1HA5 A;  3WAL A;  5IO9 A;  4P1C C;  1ZXH A;  2FIF A;  2LEK A;  4MGI E;  2L32 A;  2M0A A;  1RAX A;  2J52 A;  2K0P A;  2LI5 A;  2LGX A;  1WGD A;  4RMA A;  3ZQ4 A;  1UEL A;  1L0X B;  4KZ0 A;  2INC C;  4IC7 B;  2SAK A;  4WJP A;  1WFY A;  2BYE A;  3ZKJ C;  1QQR A;  4RM9 A;  4RF0 A;  1V49 A;  2NBW B;  2IY0 B;  1TY2 A;  2A4Z A;  1M4V A;  3AE3 B;  2NCN A;  1BT0 A;  2Z0E B;  2AYO B;  3R2I A;  1MG4 A;  3SR6 A;  3WAN A;  2KOX A;  1PFD A;  1XCT L;  4W9F A;  5D3I B;  3Q3N C;  2LUM A;  1V5T A;  1KLU D;  4P6V F;  1WI0 A;  4ACF A;  1FNV A;  1IBX B;  3IVF A;  2D3C A;  4MEL A;  1E90 A;  3W2D A;  1TKE A;  1WMH A;  2AL6 A;  2G1E A;  2D3A A;  4KX6 B;  1WXM A;  2RGF A;  2MA9 B;  1WZ3 A;  4LK0 M;  2KAC A;  1TS5 A;  2KDE B;  2AQ3 B;  3B2F A;  2CR5 A;  2KC2 A;  1IGC A;  4MGY E;  4DHZ E;  3KUD B;  2C60 A;  1C3T A;  2CS4 A;  3H7S A;  3NJT A;  4RF1 A;  1B9R A;  1CMX B;  3H1U A;  4P1B C;  2W55 A;  1WWT A;  2JY6 A;  4AUQ C;  3I5J C;  2YVC A;  3ABV B;  5CHF A;  3FC4 A;  4O1N A;  4K7S A;  4MSQ B;  3PRM B;  2EEL A;  3QJZ A;  1RLF A;  1Z5S B;  2C7N B;  1JAL A;  4EZK A;  5LLI A;  2KMM A;  4J3O D;  2MCN B;  3V05 A;  3Q8A A;  4HDQ A;  2MLB A;  2KAN A;  1V1P B;  3M95 A;  3DBH I;  1F77 A;  1FXI A;  3GP7 A;  3KUZ A;  1E9M A;  2L0F A;  1EUV B;  2IO0 B;  4WWN A;  4YT0 B;  2NS5 A;  1LM8 B;  5H8Y E;  3KYD D;  1C79 A;  5G5H A;  3Q8E A;  4WH4 A;  2LVO A;  2WNM A;  3N32 A;  2LHE A;  3TEY A;  3DBS A;  2E6X A;  4IM3 A;  1L6U A;  1SBB B;  1ZW7 A;  3KVF B;  4YSX B;  1OQY A;  3ZTC A;  1EU3 A;  1R7S A;  3UIO B;  5CTR C;  1NI2 A;  1D6E C;  1V1P A;  1LXD A;  3AB5 A;  4XDD A;  5IA7 A;  3QQ8 B;  3HHM A;  4GDK A;  2MBB B;  2WXL A;  4K7W A;  3AE2 B;  4FLH A;  2KNB A;  4Q2J A;  1C4C A;  2REX A;  3AEG B;  3N20 C;  1NYR A;  3VTV A;  4X57 B;  1P0R A;  1HZ5 A;  1NI3 A;  1TIF A;  2GRI A;  2KKC A;  2KFK B;  4DHJ B;  4ICU A;  1WF9 A;  3WCQ A;  1FO4 A;  3RUL A;  4MEM A;  5T8I A;  4IWQ A;  4MGZ E;  2D11 A;  1P1A A;  2EMT A;  3C19 A;  1QZE A;  2YEP F;  3FKY A;  3KWL A;  2L76 A;  5AUK A;  1WX8 A;  1WMH B;  2L00 B;  3ZLZ A;  2L3Z A;  3UIP B;  1U4A A;  2HD5 B;  3I57 A;  3APC A;  1LGR A;  1SE2 A;  4ZYN A;  2RPQ A;  2GI9 A;  3A1Q B;  3L16 A;  2NTS A;  3ZJV A;  3SHQ A;  4IKG A;  4K1R B;  3B08 A;  3W1Y A;  1XQQ A;  1YQ4 B;  3FIL B;  5AZG A;  4KIK A;  4FBJ B;  4N6E B;  4ZHP A;  5BMI A;  1VDV A;  2X8X X;  3PRE A;  4GB9 A;  2WYQ A;  2PIA A;  5JH5 C;  2L52 A;  1LFD A;  2IJ0 A;  1HEZ E;  2NVU I;  2QJL A;  3Q69 A;  1FNW A;  2D3G A;  2RPV A;  1T0Q C;  3Q8B A;  1OQR A;  2PVO D;  4GIV A;  3ZNG C;  2K9X A;  3ML8 A;  3QK0 A;  1DOI A;  3AU5 A;  2KQ4 X;  3Q3O C;  4BFR A;  2JT4 B;  1TZ1 A;  2N9K A;  1TZO A;  1IP9 A;  4BZA A;  1C78 A;  3IHP C;  3MJ5 A;  3MHS D;  2CHZ A;  1WX9 A;  2D07 B;  3Q6B A;  2N9P C;  2GLS A;  3NZU A;  4IW0 A;  4ARC A;  1N63 A;  1TBE A;  4LNN A;  2QMT A;  2KX3 A;  2L8J A;  3ZUN A;  3DCG A;  4ZRJ A;  3RNA C;  5D2M B;  3T3N A;  3W1S C;  2N9X A;  3MP9 A;  2I2Y A;  4B9K A;  4B95 A;  3ZDM C;  2LGI A;  4RCO A;  1GJZ A;  1C9F A;  1QOF A;  5DCN A;  1TKY A;  4NNJ B;  4S0R A;  4PYZ A;  1S3S G;  2JZP A;  3ALB A;  4S17 A;  4KSK C;  2L83 A;  2KJ6 A;  4WIP A;  3U4E G;  3W9C B;  4YSY B;  5EE3 A;  3PV1 A;  3RNG C;  3VDZ A;  3V6E B;  4M02 A;  2O6V A;  2QIL A;  3W5U B;  2LWP A;  1D5Z C;  2OJW A;  2DYM A;  4GSW A;  4OVV A;  3OJ3 A;  5JZE B;  4N58 A;  3ONS A;  1SB3 C;  4RNA A;  1I4R A;  3HUI A;  3KYC D;  1FRR A;  3R2T A;  3IT6 B;  3N1Z C;  5MPO A;  2J0K A;  5HI1 A;  2IZV B;  3P4P B;  1AWD A;  5IAA C;  1AN8 A;  2B3A A;  4US8 A;  3IXS A;  5BYS A;  3ZXR A;  3Q3M C;  2CU3 A;  5EE0 A;  1GC6 A;  3RT3 B;  2QCZ A;  1K52 A;  2KO3 A;  4PS8 A;  2NTT A;  2J4X A;  3L10 B;  3E9S A;  3N1X C;  1ZOY B;  4WWM A;  1M94 A;  1XD3 B;  4FJV B;  1AYF A;  2LGY A;  4LNI A;  3QAQ A;  4HKZ E;  2L05 A;  2GBM A;  1YQ3 B;  1YNT E;  1VLB A;  1F1H A;  2DBY A;  1JWM D;  2UU7 A;  3PTF C;  3H8H A;  1ZKH A;  4AS1 A;  1HTQ A;  1SIF A;  4JPS A;  1NDD A;  2BKR B;  3ETR A;  1C4A A;  1WGR A;  1STE A;  4JIO U;  1SXT A;  3M3J A;  2ZZP B;  3VR9 B;  1Z2M A;  5BYR A;  2KC1 A;  1J7A A;  2CJN A;  4W9H A;  1L5P A;  4GDK B;  3L13 A;  4NAM A;  5IKC M;  1H8C A;  1WJU A;  2HJ8 A;  4US9 A;  3AE8 B;  2LXA A;  4IDI A;  3EFC A;  4E71 A;  3NVW A;  4GDL A;  2M56 B;  2BF8 B;  3VH4 B;  1IPG A;  5DPR A;  3QC8 B;  3QAR A;  1MI0 A;  1E7U A;  4IM0 A;  3JSV A;  1PYW D;  4AJY B;  1WGK A;  4F1S A;  4M01 A;  2QDF A;  1GUA B;  1QF6 A;  3VRA B;  4XE0 A;  4A6Q A;  2ZW1 A;  2MBQ A;  1UD7 A;  2KJR A;  2N7J A;  3ZRC A;  1KOT A;  4AJW A;  1ACC A;  3IT4 B;  2PLP A;  5EDS A;  2MJD A;  4ITK A;  4L1B A;  4FN2 A;  2OOB B;  1L6V A;  2BWE S;  2HE7 A;  1KTK A;  2MHJ A;  3OLM D;  4HJG E;  5E6P A;  1PQS A;  2ICI A;  1WGG A;  2XK5 A;  3R66 C;  2C5L C; 
#chains in the Genus database with same CATH homology
 2KQ7 A;  3M63 B;  5AZH A;  3PGE A;  1J0G A;  2KC2 A;  2KZR A;  3VH3 B;  2MWS B;  2IO2 B;  4MGY E;  4DHZ E;  1KJT A;  3KUD B;  3ZNH B;  2C60 A;  5D7G A;  3C0R B;  3TL5 A;  4TUU A;  2ZPY A;  2CS4 A;  1C3T A;  4BKS A;  2O2V A;  3H7S A;  1E8W A;  4FJY A;  1LQB A;  4G50 A;  2FCN A;  2I1K A;  4GDL B;  1KLV A;  1OEY J;  4MH0 E;  1CMX B;  3H1U A;  3WA0 A;  3NOB A;  2N1W A;  3BIN A;  2JY6 A;  4AUQ C;  5J17 A;  2KHW B;  2PJH A;  2YVC A;  4JQW C;  3UQB A;  4KDL B;  2Y5B B;  2M17 A;  4II2 B;  5CHF A;  1V6E A;  5DPS A;  4ANU A;  2JUO A;  2C7M B;  4K7S A;  4MSQ B;  2K6D B;  4PS7 A;  3PRM B;  4YL8 A;  3RUI B;  3A9K B;  3QJZ A;  1RLF A;  4W9G A;  4FUL A;  4KV2 A;  1Z5S B;  1SGH A;  2C7N B;  3V6C B;  1E8X A;  3Q3F A;  1V80 A;  3DVG Y;  4IM2 A;  1JRU A;  4EZK A;  5AEK B;  4TKN A;  5C23 A;  5LLI A;  4G0N B;  4FJZ A;  2ASQ A;  2MCN B;  5D94 A;  4BBN C;  4HDQ A;  2MLB A;  2ZNV B;  4HCN B;  1WZ0 A;  2KAN A;  3AI5 A;  3DBH I;  1EF5 A;  3M95 A;  3TBL D;  2MX2 A;  4BVU C;  3TCA A;  3H9D A;  2G4D B;  2L0F A;  1EUV B;  1P98 A;  3KUZ A;  4F8C B;  2IO0 B;  3MTN B;  4K81 A;  4WWN A;  3A9J B;  2M1M A;  2MSE D;  2PE6 B;  2YLM A;  5G55 A;  2NS5 A;  1LM8 B;  2IY1 B;  3KYD D;  5J2R A;  3X23 A;  4I6P A;  3UIN B;  3IFW B;  5L95 C;  1UZX B;  1RFA A;  4MJS B;  1EF1 A;  2LVO A;  3N32 A;  4JGH B;  1E8Z A;  3DBS A;  1WYW B;  3APF A;  3ZW3 A;  2KX0 A;  4NY0 A;  4IM3 A;  4DDI D;  2DZM A;  1IYF A;  2ZPN A;  3ML9 A;  4URK A;  4NQK E;  2KD0 A;  1YX5 B;  2AWT A;  1ZW7 A;  3KVF B;  2LRW A;  1GC7 A;  1OQY A;  4HPL B;  3ZTC A;  2K8B A;  1R4N I;  3A1Q A;  3DBL I;  1WXS A;  5E6N A;  1ZGU B;  3UIO B;  1SE9 A;  2A5U A;  5CHV C;  4PYU A;  4W9L A;  5CTR C;  1NI2 A;  4CHK A;  4IG7 B;  2DZI A;  4N9F 4;  4J6I A;  1LXD A;  1K8R B;  3VTW A;  4CO7 A;  4DHZ B;  4ZDV A;  4W9C A;  5DPT A;  5IA7 A;  2KXJ A;  3QQ8 B;  3EC8 A;  2LZ6 A;  4PS3 A;  3PZD A;  3MJW A;  4WWP A;  3HHM A;  4NPN A;  2DX5 B;  4GDK A;  2C9W B;  2MBB B;  3A4S C;  2WDT B;  4BBN F;  4DHJ D;  4K7W A;  1I42 A;  1WIA A;  4FLH A;  2KNB A;  1WR6 E;  3ZVV A;  2C7H A;  2N7D A;  3DVN U;  1GNU A;  4W9E A;  3QIJ A;  4HJK A;  1NBF C;  2IYD B;  2REX A;  2ZNV C;  3PSE B;  2KJH B;  2LD9 A;  1TTN A;  3PPA A;  3VTV A;  4X57 B;  2O6V B;  4KDI C;  2G4S A;  4GXB A;  3K9P B;  3PLU A;  4HK2 A;  3PRP B;  1YQB A;  1P0R A;  4HCP B;  3CST A;  3DBR I;  2L7R A;  1A5R A;  3DVG X;  2KKC A;  2JXX A;  2KFK B;  3HIZ A;  1WX7 A;  4DHJ B;  2KLC A;  4XZ4 A;  4ICU A;  2DZJ A;  1WF9 A;  4W9D A;  4EKU A;  1UBQ A;  3RUL A;  2LVP A;  3OAW A;  4MEM A;  4LCD E;  5AZF A;  4IWQ A;  4MGZ E;  2ZVO A;  2D11 A;  2JZZ A;  1RRB A;  3EHV A;  1V2Y A;  1P1A A;  2EMT A;  1QZE A;  2KFJ A;  4ANX A;  2W9N A;  2N7E A;  2R2O A;  3R7Q A;  5L83 A;  3DQV A;  2M0X A;  2L76 A;  3U30 A;  1D3Z A;  1F9J A;  2LAS A;  1WX8 A;  4NJ7 A;  1WMH B;  2L00 B;  3WAM A;  3ZLZ A;  4BKT A;  2L3Z A;  2MP2 A;  3VUY A;  3UIP B;  4EZJ A;  4II3 B;  3ZRF A;  2N1V A;  3L08 A;  2KN5 A;  1U4A A;  2HD5 B;  1TGZ B;  1E5W A;  3APC A;  1WH3 A;  2MBE A;  2JPH A;  2V4L A;  4ZYN A;  2XBB C;  2M8S A;  2QHO A;  2RPQ A;  3A1Q B;  4IUM B;  3L16 A;  5TR5 A;  1WGY A;  5GMV A;  2IO1 B;  3SHQ A;  3R7R A;  2JRH A;  2BYF A;  4FHK A;  2FID A;  4FAD A;  4K1R B;  1WR1 A;  3B08 A;  2GMI C;  2KDB A;  3HK0 A;  1WJN A;  2KVR A;  1J8C A;  3W1Y A;  4HLE A;  1XQQ A;  3DVN V;  4G3X B;  3EEC A;  5AZG A;  4KIK A;  3JW0 X;  3QX1 A;  4WJO A;  4WJQ A;  4FBJ B;  3DDC B;  3QWZ B;  4DDG D;  1J19 A;  2D10 A;  2XK5 B;  3PRE A;  4GB9 A;  2WYQ A;  4NAW A;  5JH5 C;  3ENE A;  3HM6 X;  2FAZ A;  3R3M A;  3RCZ A;  3VAW A;  1LFD A;  4B6W A;  1XT9 B;  3PHX B;  2KTF A;  2NVU I;  4GU2 A;  2K6Q A;  2GBK A;  4GMV A;  2D3G A;  2OJR A;  2KWU B;  2XEW A;  4EFO A;  4DBG A;  3GOE A;  3ZTD A;  1YIW A;  2J0M A;  4K7U A;  4LDT B;  4E74 A;  3DOW A;  4G11 A;  3N30 A;  3VXW A;  1WJ4 A;  2LUE A;  4GIV A;  3ZNG C;  4XX5 A;  3ML8 A;  3P2B A;  3QK0 A;  1GG3 A;  1WM2 A;  2R2Q A;  1VD2 A;  4HVB A;  1Q5W B;  4JLC A;  3AU5 A;  1AAR A;  2FCS A;  4WQO B;  4ANV A;  2NPT A;  1YJ1 A;  4BFR A;  2JT4 B;  1TZ1 A;  2N4F A;  5LXI B;  1WRD B;  3H7P A;  4KVG B;  1IP9 A;  3WAP A;  4GN1 A;  2NR2 A;  4WJN A;  1P9D U;  3IHP C;  2GBR A;  4ZRK A;  3RZF A;  3KUC B;  3MHS D;  2CHZ A;  3ZNZ B;  1WX9 A;  3U8Z A;  2LGD A;  1WY8 A;  2D07 B;  5D6J B;  1WXV A;  2DAJ A;  1E8Y A;  2G45 B;  1P3Q U;  1OEY A;  2N9P C;  2JF5 A;  3NZU A;  4IW0 A;  2GBJ A;  1TBE A;  4P7I A;  3A9J A;  2MW5 A;  3PVL A;  2PEA A;  2CHW A;  3RZW C;  2KX3 A;  2L8J A;  2DYB A;  4KIK B;  3ZUN A;  4A3O A;  3DCG A;  2MBH A;  3EFU A;  4ZRJ A;  4EEW A;  1V9J A;  2VRR B;  2LJ5 A;  4JL9 A;  1MG8 A;  2FNJ B;  2O6V D;  3CSF A;  1H4R A;  2KLG A;  3L17 A;  5D2M B;  4AOF A;  2CKH B;  4MJS A;  2KFK A;  5KHO A;  3W1S C;  3DPD A;  2N9X A;  1Q1O A;  3IBE A;  4XC2 A;  1UGM A;  2V1Y A;  4HDO A;  4B9K A;  2D2Q A;  3AUL A;  4B95 A;  3ZDM C;  3V60 A;  1UH6 A;  2GOW A;  2RR9 A;  3TIX A;  1GJZ A;  5G2N A;  4ANW A;  4GOC A;  4W9I A;  5DCN A;  2MQJ A;  2K39 A;  3M62 B;  2ZEQ A;  4NNJ B;  2FCQ A;  4PYZ A;  2KQS A;  2LXC A;  1S3S G;  3ALB A;  1WM3 A;  2MBO A;  4HPM B;  4OVU A;  5BO4 B;  4BOS C;  3BY4 B;  2JVC A;  4MM3 A;  3ZNI D;  3O65 B;  1KM7 A;  2K8C A;  4KSK C;  2KJ6 A;  3NZS A;  3ZIM A;  1WGH A;  2IBI B;  2K25 A;  3UQA A;  2EMS A;  5DPW A;  2NBV B;  3LJ3 A;  3PV1 A;  2DAF A;  2DYO A;  4W9J A;  4DXA B;  1I35 A;  4I6L B;  3VDZ A;  4TV3 A;  3V6E B;  2GBN A;  2K8H A;  5KHQ A;  3SU8 X;  3Q3J A;  2O6V A;  4HWI B;  2WWZ A;  4IWO A;  1FXT B;  2G3Q B;  2NPT B;  5JHB A;  1WE6 A;  3RD2 A;  2UWQ A;  2LWP A;  3H7P B;  4RM8 A;  1S1Q B;  2DYM A;  3KH0 A;  2KMC A;  4GGQ A;  4GSW A;  3OJ3 A;  4OVV A;  5JZE B;  3VUX A;  3ONS A;  2KMA A;  2KDF B;  3UGB B;  2WX1 A;  1WXA A;  2KK8 A;  3KYC D;  3VHT C;  3KW5 B;  2J0J A;  1X1M A;  2MP2 B;  3APD A;  4ICV A;  3W1S A;  3CF6 E;  4BOZ B;  2J0K A;  2IZV B;  4LDT D;  1EO6 A;  2N9E B;  2BPS A;  3U7D A;  5IAA C;  3VUW A;  2B3A A;  1R4M I;  4KSL C;  4W9K A;  3WIM A;  4NQL B;  1GC6 A;  3GZN I;  2MRP A;  2DEN B;  1UBI A;  2KTR B;  3OJ4 B;  3RT3 B;  2KO3 A;  4PS8 A;  2PE9 A;  2EKE C;  1V5O A;  3V62 A;  3L10 B;  1G6J A;  3L54 A;  2V3S A;  2NBU A;  3UF8 A;  3ECI A;  1M94 A;  1XD3 B;  3QA8 A;  1WJ6 A;  4FJV B;  2LGY A;  2ZJD A;  3PHW B;  4WAA A;  3V61 A;  3QAQ A;  4BKG A;  4IWP A;  2DHZ A;  4A20 A;  1C1Y B;  4EOY A;  5LXH A;  4LJO B;  2L05 A;  2DZK A;  2GBM A;  4NAW B;  4FA6 A;  3NS8 A;  1V81 A;  3AU4 A;  3RYT A;  2RSU A;  2ZCB A;  4M8M A;  4AWJ A;  3L0W B;  2KTR A;  2Z0D B;  3NY5 A;  3PTF C;  4TQ1 A;  4DWF A;  3PRZ A;  1YD8 U;  3LDZ E;  4ASW C;  4M8N A;  5CHW A;  2L0T A;  1ZKH A;  2RD0 A;  1T0Y A;  3A4R A;  2BGF A;  4CYE A;  3HM3 A;  3TMP B;  3AXC A;  1SIF A;  2BYV E;  2BKF A;  3ZO5 B;  5JHA A;  1NDD A;  2J7Q B;  5CX3 A;  2BKR B;  4HXD A;  3VTU A;  2JRI B;  5C1Z A;  1Q0W B;  1WGR A;  3D32 A;  4NJ6 A;  3WAL A;  4JIO U;  3T9L A;  2FIF A;  3JYU A;  2ZZP B;  3M3J A;  2LVQ A;  2ZVN A;  3JSV B;  4MGI E;  1WE7 A;  1E7V A;  1Z2M A;  4A3P A;  2CU1 A;  4KZC A;  3TJP A;  2KC1 A;  1RAX A;  3QCA A;  3CMM B;  4WWO A;  3T8M A;  2LI5 A;  2LGX A;  4W9H A;  4GDK B;  1VCB A;  3S2A A;  1WGD A;  1YX6 B;  3L13 A;  4RMA A;  4EZL A;  2Z59 B;  3SDL C;  1Y8R C;  4ZRI A;  1UEL A;  4KZ0 A;  4MDK E;  3WAO A;  1L7Y A;  4IC7 B;  3K9O B;  1H8C A;  1V86 A;  4M0W B;  4MGK E;  1WFY A;  1WJU A;  2ZCC A;  2BYE A;  4WJP A;  3ZKJ C;  5J18 A;  4RM9 A;  5FR6 A;  3A9K A;  1V49 A;  2NBW B;  2HJ8 A;  4LJP B;  3SD5 A;  2IY0 B;  4DK5 A;  3PLV A;  3QHT A;  2O2V B;  2A4Z A;  2LXA A;  4E71 A;  4GDL A;  1OTR B;  2BF8 B;  2K1F A;  2NCN A;  1BT0 A;  3B0A A;  2Z0E B;  1IPG A;  2AYO B;  3VH4 B;  2I1J A;  5HKH A;  5DPR A;  3QC8 B;  3PS6 A;  1L2N A;  3NHE B;  3QAR A;  2CHX A;  2PPH A;  2AEH A;  4BKS D;  3WAN A;  4TQ0 A;  1E7U A;  2KOX A;  4IM0 A;  3JSV A;  1HE8 A;  2KWC A;  3N3K B;  4W9F A;  2FUH B;  1ISN A;  4AJY B;  4EUT A;  3VFK A;  4F1S A;  1GUA B;  2WX0 A;  2IO3 B;  2FCM A;  3ZDT A;  1V5T A;  2JWZ A;  2UYZ B;  1WI0 A;  1UD7 A;  1OGW A;  2KJR A;  2MBQ A;  3VVW B;  3ZRC A;  3IVF A;  4MSM B;  4AJW A;  1KOT A;  2JZ3 B;  2LRU A;  4F7Z A;  4AP4 C;  4MEL A;  1E90 A;  3B1L X;  5EDS A;  3IG3 A;  2HTH A;  1WMH A;  3H6N A;  2AL6 A;  2KDI A;  3X0W A;  2M4N A;  3A33 B;  2OOB B;  4FN2 A;  4E3C A;  2AL3 A;  2BWE S;  2HE7 A;  4I6N B;  1WXM A;  3I3T B;  3OLM D;  2RGF A;  5E6P A;  1PQS A;  2MA9 B;  1WZ3 A;  5E6O A;  3VQI A;  2BWF A;  3JVZ X;  1WGG A;  4FHJ A;  2XK5 A;  3PT2 B;  2KDE B;  3R66 C;  2CR5 A;  2C5L C;  2KWV B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...