3RUIB

Crystal structure of atg7c-atg8 complex
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
113
structure length
113
Chain Sequence
TFKSEYPFEKRKAESERIADRFKNRIPVICEKAEKSDIPEIDKRKYLVPADLTVGQFVYVIRKRIMLPPEKAIFIFVNDTLPPTAALMSAIYQEHKDKDGFLYVTYSGENTFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Ubiquitin-like modifier-activating enzyme ATG7
publication title Insights into noncanonical E1 enzyme activation from the structure of autophagic E1 Atg7 with Atg8.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 30
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2011-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3ruiB00
3QAQA 3SDLC 1C3TA 4AUQC 2CU1A 2HJ8A 3A9KB 4GOCA 3JYUA 4ICUA 4X57B 1WF9A 3TBLD 2GMIC 3VDZA 2ZPYA 2L0FA 4MGKE 3PS6A 1XT9B 3A33B 3JSVA 2Z0DB 2KZRA 3UIOB 1KM7A 4DDID 3H6NA 3BINA 3KUCB 3A1QB 4RM8A 4ZRKA 2C9WB 5GMVA 2O2VB 3S2AA 3ZTDA 1R4MI 2KFJA 3VXWA 2JT4B 3TL5A 3ZDMC 4JL9A 4BOSC 2DHZA 1TZ1A 4NQKE 4AWJA 4NY0A 4TV3A 2AL6A 2IO2B 4IWPA 1P1AA 3PVLA 2KVRA 1WJNA 1OEYJ 5CHWA 1WFYA 1WMHB 2M1MA 3AU5A 1L7YA 3PGEA 4F7ZA 3W1SC 2D2QA 3R7QA 3I3TB 3PTFC 4J6IA 2G3QB 2KTRA 4K7UA 5D7GA 1H8CA 1M94A 4M0WB 4IM3A 4GB9A 1YD8U 2G4SA 4NQLB 1XQQA 3SD5A 2BYEA 3V6CB 2BWFA 2NPTB 1EF5A 3DPDA 3ZNHB 1Y8RC 3H1UA 4WQOB 2AEHA 3L17A 1Z5SB 2KLCA 4FADA 4LJOB 2J0KA 4MGZE 5CHFA 2N9PC 2XK5B 4JLCA 1WM3A 1J0GA 4MJSB 4IC7B 2DYOA 3KVFB 2KDFB 2KO3A 5C23A 3U8ZA 1YIWA 4FJVB 1LFDA 5C1ZA 2KC1A 1WMHA 5LXHA 2WWZA 3X0WA 2KWVB 2KFKA 2O6VA 2N7DA 2NR2A 3AXCA 1IPGA 2MBHA 3M95A 3NHEB 2WYQA 3NZUA 1KLVA 2DZMA 1V5TA 4G11A 2JUOA 4TQ1A 3DBRI 3PLUA 4FBJB 1R4NI 1WIAA 3APCA 3JVZX 2CHXA 2JXXA 3SU8X 3PV1A 5G55A 1G6JA 2KD0A 4JGHB 3PT2B 2V4LA 3ZIMA 3MJWA 2NCNA 2L05A 3R66C 1RFAA 2DZKA 4PYZA 3QX1A 2AWTA 4HDQA 4BKSD 4WWNA 1ZW7A 1WR6E 3VTWA 4NJ6A 2IO0B 3B08A 3W1SA 3NOBA 3HK0A 4BVUC 1V81A 3DCGA 4N9F4 4DHJB 3APFA 1WXVA 1VCBA 3ZNID 2GOWA 2MRPA 3KYDD 2A4ZA 4KZCA 2DYMA 3ZRCA 4DHZB 2IY1B 2G45B 3OLMD 4DWFA 5KHQA 3UF8A 5L95C 4FA6A 2M8SA 4MH0E 2ZPNA 2LZ6A 2ZJDA 2PE6B 4I6LB 5AZHA 3CF6E 3ZLZA 2ZZPB 1WH3A 2WX0A 5J2RA 3QC8B 1V86A 5E6NA 5LXIB 4MGYE 4DXAB 3ZO5B 5JHBA 3PPAA 2KQSA 1ZKHA 2FNJB 3QCAA 2K6DB 2ZVNA 4KSKC 2KLGA 3PZDA 4GSWA 2CR5A 2KDIA 2KJRA 1OEYA 2XEWA 3NY5A 4LDTD 3R3MA 3JSVB 3HM3A 1YJ1A 3WANA 1L2NA 3VTVA 4W9DA 3TJPA 3RZWC 3JW0X 3K9PB 4PS7A 2MP2A 3N3KB 1EF1A 3UIPB 4GU2A 1TGZB 1WXSA 1KOTA 2GBNA 2IZVB 2MW5A 3V6EB 4A3PA 4BBNF 1YX6B 3RT3B 4BKGA 2D11A 1Z2MA 4WJPA 1OQYA 1AARA 3IFWB 1P3QU 4I6PA 4A3OA 4DBGA 2N1VA 4PYUA 3V61A 1FXTB 2KMAA 3V62A 2GBJA 2EKEC 3CSFA 3V60A 2KTRB 2MCNB 5JH5C 2CHZA 1Q1OA 2BYFA 4PS8A 2KNBA 4CO7A 1E8YA 1WE7A 3AULA 3ENEA 5JZEB 1U4AA 2LGYA 5G2NA 3ZW3A 3A4RA 4EFOA 1MG8A 2JVCA 4B6WA 3DOWA 4K81A 5E6OA 1TBEA 2MBEA 4RMAA 3EC8A 1GUAB 2DX5B 4W9CA 3QA8A 4G50A 4K7WA 4OVUA 4BKTA 2KTFA 3EFUA 4TQ0A 1UELA 2O6VD 4GGQA 3X23A 1NDDA 4FJZA 3UQBA 3GZNI 4IWQA 2BKFA 3ALBA 4HDOA 3N30A 2LGDA 2KWCA 1OGWA 2KFKB 2O6VB 3KH0A 3L08A 4MELA 4BOZB 3ZNZB 2DAJA 1S3SG 5J17A 5JHAA 4DK5A 1WGRA 3PREA 4FLHA 2A5UA 4II3B 5CX3A 2MBBB 2C7MB 2C7NB 5CHVC 1Q0WB 1WGGA 2QHOA 1UGMA 3QJZA 4JIOU 2M17A 4W9IA 1P0RA 4ZYNA 3UINB 1T0YA 4MSMB 4IW0A 2ZVOA 3ONSA 4CYEA 3L0WB 4LJPB 1SIFA 2JZZA 4II2B 2LVOA 4GDKA 4GXBA 4K1RB 4MSQB 4BFRA 1K8RB 2LRUA 2MSED 1P98A 3DVGX 2YVCA 2K8CA 1LXDA 2LWPA 3IHPC 4HXDA 2LGXA 2NBWB 4KV2A 2BKRB 4NAWB 4GDLA 3VH4B 3Q3FA 2HE7A 4HCNB 2Z59B 2W9NA 1YQBA 1WJ4A 2N9EB 2ZCBA 4EUTA 1X1MA 2RGFA 3ZTCA 1WRDB 4GIVA 2I1KA 2KMCA 3KUZA 2BPSA 1E8XA 4W9KA 4WWPA 2PJHA 2I1JA 4IWOA 3C0RB 4BBNC 3ML9A 4IG7B 2L76A 3APDA 4HK2A 1IP9A 3DBLI 3OAWA 4EEWA 2MX2A 4EOYA 5AEKB 1WZ0A 2K1FA 4E3CA 5J18A 2MBQA 2D10A 3TCAA 4KSLC 4DHZE 5IA7A 4DHJD 3Q3JA 4NAWA 1F9JA 3DDCB 2KJHB 4AOFA 3AU4A 4OVVA 1NI2A 2KX0A 3QHTA 3P2BA 3LDZE 4CHKA 4M8NA 1D3ZA 2MP2B 4AJYB 2JF5A 1WX8A 3H9DA 2KK8A 2KQ7A 2BYVE 2N9XA 3MTNB 4W9JA 1GJZA 3ML8A 2ZCCA 1WXAA 3O65B 5E6PA 4HPMB 3VUYA 4ASWC 2LI5A 1UH6A 5DPTA 3VH3B 2RPQA 3TIXA 1VD2A 3TMPB 5D6JB 2RSUA 3WA0A 3DVGY 3LJ3A 3L13A 2IY0B 4HPLB 4B95A 1V2YA 3M3JA 3WAPA 5KHOA 2HD5B 4A20A 4EKUA 3ZNGC 2EMSA 4XC2A 2NVUI 1LQBA 3VFKA 2KC2A 2LJ5A 4KDIC 3U30A 2KN5A 3T8MA 2CS4A 4EZKA 3T9LA 3PRMB 3L54A 2KHWB 2KDEB 5DPWA 4URKA 2L0TA 2KDBA 4IM2A 4W9LA 3ZDTA 3KUDB 3RUIB 1RLFA 2R2QA 2WDTB 2K6QA 3NS8A 2MA9B 3SHQA 4HWIB 1NBFC 2BWES 1E7UA 1V9JA 2WX1A 4TKNA 4ANUA 2C60A 3EECA 1V80A 1TTNA 3EHVA 2JRIB 4EZJA 2OOBB 4WWOA 1WGDA 2KOXA 2VRRB 1E5WA 3ZUNA 2C5LC 2D3GA 3A9JB 1E90A 2KKCA 2LD9A 2IO3B 2PE9A 4FJYA 4W9HA 5CTRC 1BT0A 4MEMA 2B3AA 3VVWB 3RD2A 4ANWA 3VQIA 1S1QB 4FULA 1XD3B 3BY4B 2FAZA 1UZXB 3PSEB 2JRHA 2M0XA 4FN2A 4W9EA 3H7SA 4RM9A 2AL3A 5D94A 2UWQA 5TR5A 3M63B 4ZDVA 1GC7A 4GDKB 1A5RA 1IYFA 4MGIE 1WJUA 3GOEA 3H7PB 4KIKB 3ZRFA 2JY6A 4GDLB 1LM8B 4GMVA 2AYOB 5EDSA 2BGFA 1WE6A 3A9JA 1E8ZA 1H4RA 3U7DA 1C1YB 2ZEQA 3RCZA 3B1LX 5HKHA 1SE9A 3QARA 4JQWC 3OJ4B 3DVNU 3HIZA 3QK0A 2DENB 2L8JA 2MBOA 3PLVA 3QQ8B 1WJ6A 3VUXA 2NBVB 1V49A 2Y5BB 4W9FA 5FR6A 3DVNV 2L7RA 3OJ3A 4I6NB 2R2OA 4PS3A 5DPRA 4AP4C 2K8HA 4WJOA 1I35A 3IVFA 4KZ0A 2EMTA 1GG3A 2BF8B 2JWZA 2Z0EB 3AI5A 3N32A 2CHWA 2V1YA 2RR9A 3A9KA 3H7PA 4KIKA 1ISNA 4IUMB 3RZFA 4ICVA 4EZLA 3UQAA 2N1WA 3KW5B 2KANA 3HHMA 3L16A 3VTUA 2PEAA 1UBQA 1WM2A 4GN1A 2V3SA 2KX3A 3A4SC 2N4FA 3CSTA 3A1QA 2O2VA 3PRZA 4IM0A 4HCPB 2L00B 2PPHA 3IG3A 4M8MA 1EUVB 1P9DU 2IYDB 2CKHB 3L10B 1I42A 2NS5A 4G0NB 1J8CA 1HE8A 1UBIA 2UYZB 3KYCD 1WYWB 1QZEA 2DYBA 2FCSA 2FCNA 2REXA 4KDLB 4ANVA 2ASQA 4YL8A 1UD7A 4MM3A 2MQJA 5AZGA 2XBBC 3B0AA 2JZ3B 3RULA 4E71A 4XX5A 1GC6A 4K7SA 2D07B 3DBSA 3ECIA 2M4NA 2GBMA 3W1YA 2K8BA 2LXCA 2NBUA 2J7QB 2J0JA 1WX9A 1WI0A 2RD0A 4NPNA 4TUUA 3DBHI 1RRBA 5DCNA 2NPTA 3VHTC 3PRPB 1WXMA 4P7IA 2GBKA 2FUHB 4AJWA 4XZ4A 2DZIA 2FCMA 5L83A 3WAOA 3WALA 1OTRB 2LXAA 2C7HA 1V5OA 2IBIB 2XK5A 3RYTA 2FCQA 3VUWA 4NJ7A 4ZRJA 3HM6X 3DQVA 1WR1A 4MJSA 4W9GA 4DDGD 1WGYA 2ZNVC 1ZGUB 4B9KA 3K9OB 3VAWA 1SGHA 4E74A 1J19A 4LCDE 4HVBA 4F1SA 5D2MB 1PQSA 2FIFA 1WX7A 2LVQA 4WJQA 5DPSA 2J0MA 3QWZB 3WAMA 3D32A 4ZRIA 3WIMA 2HTHA 4FHJA 3MHSD 1Q5WB 1YX5B 4MDKE 3M62B 2G4DB 2KJ6A 2LUEA 1E8WA 1WY8A 2DAFA 3PHWB 4ANXA 1CMXB 3R7RA 2K25A 1RAXA 2K39A 2L3ZA 2GBRA 3PHXB 4G3XB 2MWSB 5AZFA 4WAAA 1KJTA 2ZNVB 4KVGB 3ZKJC 4HLEA 4NNJB 2N7EA 4FHKA 2JPHA 4LDTB 2LRWA 3CMMB 3QIJA 2LASA 2IO1B 4BKSA 5IAAC 2YLMA 1JRUA 1V6EA 2DZJA 2FIDA 2OJRA 5LLIA 1E7VA 4HJKA 2MLBA 3ZVVA 2KWUB 1WGHA 3UGBB 3NZSA 1GNUA 3IBEA 1EO6A 2LVPA 5BO4B 1WZ3A 2KXJA 4WJNA 4F8CB
chains in the Genus database with same CATH superfamily
3SDLC 1SJED 4AUQC 1L5PA 4ARCA 2HJ8A 2PVOD 1FIQA 3TBLD 3VDZA 2WDRB 2Z0DB 1KM7A 4DDID 3BINA 3KUCB 3AV8A 5GMVA 3Q3MC 4USAA 5AUIA 4BOSC 4NQKE 4AWJA 3AE8B 1GOZA 1T3QA 1ZXHA 1P1AA 3ZXVA 4RGNA 4A6QA 2M1MA 3VR9B 2D2QA 2RPVA 2PTLA 1UF0A 4GB9A 2LFIA 2G4SA 4NQLB 1XQQA 3SD5A 2BYEA 3V6CB 1EF5A 3DPDA 3O13A 4WQOB 2W3SA 5CHFA 2G1EA 1XXGA 4IC7B 1XLOA 3U8ZA 1YIWA 1YN4A 1LFDA 2MEKA 2EELA 2KN4A 2MBHA 3M95A 3NHEB 5AUKA 3FILA 4FBJB 2DWQA 1WIAA 4HKQA 4KKIA 2CHXA 3SU8X 3PV1A 5G55A 3RI7C 3R66C 4PT5A 1KFYB 2DZKA 3QX1A 4KX6B 1SB3C 4HDQA 4BKSD 1C9FA 1ZW7A 2M56B 3RNEC 4BVUC 1V81A 4N9F4 4JWUC 4NJCA 1R7SA 2GOWA 2LJIA 4RCOA 2MRPA 3KYDD 1ZDXA 3ZRCA 4DWFA 2ZPNA 2V9HA 2WDVB 3CF6E 2BQQA 5LXIB 1M4VA 1NVID 3Q8BA 5E6JA 1ZKHA 3I57A 3IT6B 3QCAA 2ZVNA 3PZDA 4GSWA 2WXIA 3JW0X 2NTSA 3K9PB 2MP2A 4UDUC 4OVZA 3ZQ4A 1JROA 1SE2A 4BKGA 2MW5A 3AEAB 1MHXA 1OQYA 4I6PA 5JXVA 2N1VA 4PYUA 3Q14C 3SFDB 4M00A 3V61A 1FXTB 1UWMA 3LB8C 3P42A 3V60A 1WYGA 1JCKB 2CHZA 1QT9A 2BYFA 2W82A 4DQOC 1WE7A 5JZEB 1U4AA 1QOFA 3A4RA 1PYWD 1T5XD 1MG8A 2JVCA 3OWEB 3DOWA 1JRPA 3NZ3A 1FCLA 4W9CA 1GUAB 4BKTA 1XLNA 3AE4B 4TQ0A 3N1ZC 1NDDA 2M19A 4MELA 3E56A 1S3SG 5J17A 1QOGA 1E7PB 4ZRQA 4FLHA 3BVGA 2MBBB 5CHVC 3FILB 1WGGA 1HEZE 3R8BA 1UGMA 3QJZA 4JIOU 2M17A 2PMVA 3NUHB 4DXFA 3ONSA 5IO9A 4LJPB 1SIFA 2JZZA 2QSDA 2WQYB 4LNKA 3DVGX 1N61A 2VZKB 2K8CA 3AE6B 2W55A 2LGXA 4KV2A 1L4ZB 3VH4B 4A8XC 1E6EB 1WJ4A 1AW7A 2N9EB 2ZCBA 3AE7B 2RGFA 2D3CA 4C7ZA 4GIVA 2KMCA 3KUZA 4W9KA 4WWPA 3NRZA 2J4XA 1XF5L 4IOIE 3AECB 1TY0A 1FPYA 5MPOA 2D10A 2KACA 4KSLC 4NAWA 2KJHB 2N9KA 1D3ZA 2KX0A 1T0RC 4CHKA 2MJDA 2MP2B 2JF5A 3MC8A 2KK8A 2NTTA 4ASWC 1TIFA 2LI5A 1UH6A 5DPTA 3VH3B 2RPQA 3TIXA 3BWUD 3DVGY 3L13A 3P1MA 4HPLB 4B95A 3AM9A 4EKUA 3ZNGC 1NEKB 2MJ3A 5EE1A 2NVUI 2LUMA 4XYCA 2KC2A 2OEDA 2LJ5A 3U30A 3MHZA 3P4SB 2CS4A 3T9LA 1SXTA 2KHWB 1FFVA 2KDEB 1I4PA 4URKA 2W54A 4IM2A 3KUDB 2R2QA 3NS8A 1YQ3B 2MA9B 4L2YA 1E7UA 2JSVX 4ANUA 1V80A 4EZJA 2JRIB 2VRRB 3ZUNA 2D3BA 2NMQA 2PE9A 1C78A 3RD2A 4A9AA 2FAZA 3PSEB 4H2AA 2M0XA 3H7SA 4RM9A 1UWXA 4ZDVA 3FC4A 1QF6A 3NVVA 3ZRFA 3FKYA 2AQ2B 4KGSA 3OJ4B 3DVNU 3HIZA 2DENB 3PLVA 2NBVB 5IKCM 4W9FA 3GZNB 4I6NB 5BMIA 2K8HA 3NJTA 3IVFA 4N6EB 2WXGA 1GG3A 3IAS1 4LNIA 3L16A 3VTUA 1UBQA 3A4SC 3TEYA 3C8YA 2PPHA 1XCQL 3IG3A 1P9DU 2WXFA 2MJEA 4FXCA 1I42A 4HRSA 2FCNA 4KDLB 4YL8A 1UD7A 2IGGA 4MM3A 1SJHD 3B0AA 2JZ3B 4REZA 1EU4A 1GC6A 2D07B 3DBSA 2M4NA 1JW9D 2K8BA 2LXCA 2NBUA 4J3OD 1WX9A 2RD0A 3DBLB 1QKZA 2NPTA 2KDMA 2GBKA 2FUHB 3RNFC 4AJWA 5L83A 2LXAA 3B9JA 2XK5A 3RYTA 2FCQA 1MPEA 1WR1A 4DDGD 1D4BA 1UNSA 2AX5A 1J19A 1CZPA 2RMMA 4KGRA 1TKGA 5D2MB 2FIFA 4RGOS 3QWZB 4LNNA 3WAMA 3URYA 3M62B 3CWIA 2RDHA 1WY8A 2DAFA 3PHWB 1CMXB 3R7RA 2K39A 2L3ZA 3PHXB 2XNAC 1T6BX 3LYYA 4HLEA 2BT6A 2JPHA 4LDTB 1XCTL 2LRWA 3CMMB 4BKSA 4OZBA 1IGCA 2KWUB 2QC8A 3TUOA 5BO4B 1WZ3A 1VZ8A 3KWLA 4WJNA 4B9KA 4US8A 4QAYA 2ZW0A 3FAHA 4P1BC 3RNGC 3VRAB 4X57B 2ZPYA 2L0FA 3AE3B 4KKJA 2PW9A 2KZRA 1STEA 4RM8A 4ZRKA 3RPFC 3VXWA 3HVDA 3W5VB 4JL9A 2DHZA 4ZHOA 1F52A 2IO2B 1AN8A 3B2GA 2J53A 2BB6A 1QOBA 1OEYJ 5CHWA 4MM3B 3AU5A 4TSSA 3W1SC 4JX1C 1F2RC 1XLPA 3AN1A 3I3TB 3PTFC 2G3QB 4M0WB 1YD8U 2NPTB 3GB1A 2PLPA 5BYQA 4FADA 3MJ5A 2J0KA 2XK5B 3U4EG 1J0GA 2DYOA 5C23A 1I4GA 2Z8LA 2WWZA 2KFKA 1JMLA 2GRIA 3BVMA 1CK1A 1IPGA 3NZUA 2DZMA 4S0RA 2JUOA 1I4QA 3AE1B 3PLUA 1R4NI 4ITKA 3APCA 1XO3A 2L1AA 3TEZA 2KD0A 2V4LA 3ZIMA 4XWTA 3E9SA 3MJWA 4IKGA 3U52E 2MH7A 2QEJC 2AWTA 3VTWA 1ROEA 4M01A 3OG5A 4DHJB 1BUIC 1WXVA 3BYYB 4D2KA 4KZCA 2G45B 1E9MA 4FA6A 2M8SA 2LZ6A 2ZJDA 4I6LB 5AZHA 1V86A 4PK1A 2K6DB 1N5XA 4RF0A 4LDTD 4XWWA 1OEYA 2WU5B 3DHIC 4LLGM 1YJ1A 3SEBA 3WANA 4W9DA 3RZWC 2E3TA 4PS7A 2WGSA 2H88B 1CJEA 2GBNA 2BS2B 4A3PA 5EE0A 1DYQA 1HTQA 2ZW1A 2D11A 4WJPA 1AARA 2I2YA 4A3OA 1ENFA 2V3PA 1AWDA 1C79A 2EKEC 1Q1OA 4PS8A 3ENEA 2ICIA 3ZW3A 1F0ZA 3MC9A 1A70A 1FMAD 4K81A 5E6OA 2DX5B 3LXFA 4G50A 4OVUA 1WGKA 1ZXIA 2BB5A 1UELA 2O6VD 4GGQA 3AMZA 3RNCC 2BVCA 3GZNI 2KWCA 1OGWA 2KFKB 3KH0A 1ET6A 1ZP0B 1VRAB 5IN7A 1WGRA 4II3B 2IJ0A 1J7CA 2C7MB 4LNFA 2B76B 4ZYNA 1T0YA 4IW0A 1KF6B 3VR8B 2LVOA 3P4RB 2MSED 4W9JA 1P98A 2LWPA 4HXDA 1UUPA 2BKRB 2RDGA 4JE3B 2BBCA 4HCNB 1PDXA 3PO0A 1TS5A 1PGBA 1B1ZA 5IOIA 2INNE 3APDA 4DXGA 2LMCA 1IP9A 3DBLI 4OZCA 5AEKB 3Q69A 1WZ0A 4XGAB 2WXKA 3EA6A 5J18A 2MBQA 1V8CA 3TCAA 4DHJD 1I7HA 3DDCB 3QHTA 1DOIA 4M8NA 4AJYB 3H9DA 1MHHE 2L83A 2Q5WD 5E6PA 1WXAA 4HPMB 1YN5A 1TZOA 3C19A 1VD2A 3TMPB 3WA0A 5C2TB 1XEEA 2IY0B 4WURA 1V2YA 3WAPA 1FXIA 2W3RA 3Q2AC 4XC2A 1LQBA 4KDIC 5HI1A 5DPWA 1LGRA 3Q3NC 2WNMA 3AEGB 4HWIB 1NBFC 3HUIA 2WX1A 1V9JA 3EUB2 2HDEA 1JALA 1WGDA 2C5LC 1E90A 1DOXA 2KKCA 1E10A 5G5HA 5CTRC 4W9HA 4FJYA 2B3AA 2ONQA 2WXJA 3VQIA 1FCCC 1DOYA 3DWGC 1TKEA 1LO5D 1LM8B 4AS1A 4YSXB 4GMVA 2LEKA 5EDSA 1SF0A 2BGFA 1E8ZA 3W2DA 2JX5A 3RCZA 5HKHA 3QARA 2JZPA 1C4AA 3QK0A 3QQ8B 1V49A 2Y5BB 1WRIA 1EWCA 3OJ3A 3BK2A 3TEWA 5DPRA 1ZOYB 3WCQA 4AP4C 2FE8A 1N62A 2EMTA 2JWZA 3AI5A 1JWBD 2QDFA 3RZFA 3MFGA 4EZLA 2KANA 3HHMA 1N60A 4GN1A 3Q8EA 1MJDA 4IM0A 4HCPB 1MG4A 2L00B 1F2RI 1YJIA 2CKHB 2H89B 4L1BA 1KLUD 1HE8A 1UBIA 4C00A 1KTKA 2CJOA 1FNVA 3NVYA 4ANVA 3AB5A 3Q8AA 4E71A 1R4NB 2OHFA 3W1YA 2J7QB 1WI0A 4TUUA 1JQ4A 1RRBA 2G9HD 2FCMA 2L52A 3WAOA 2C7HA 2SAKA 2IBIB 5HHDG 3CIRB 3HM6X 3DQVA 4MJSA 1QILA 2K5PA 1WGYA 4KGTA 1SGHA 4E74A 2AQ3B 2JYEA 4WQMA 3AH7A 4WJQA 5DPSA 2CU3A 4ZRIA 2Y5PA 1WXQA 2FUG1 4FHJA 1YOVB 1YX5B 4MDKE 2G4DB 2LUEA 1E8WA 2PVGC 4EE2A 2GBRA 1RFKA 4KVGB 3RN9C 4NNJB 3NS1A 3BYTB 3TSSA 1AYFA 1JRUA 2WXRA 3ZVVA 4HJKA 1BMLC 1GNUA 3IBEA 4F8CB 3QAQA 1C3TA 3P63A 4B0EA 1L0YB 3JYUA 4ICUA 1WF9A 3L4PA 3P4PB 4MGKE 3PS6A 1XT9B 3A33B 3JSVA 3VRBB 1TS3A 2YEPF 3ZTDA 2JT4B 3TL5A 2X8XX 2AL6A 2BS4B 4IWPA 1OFFA 3ZJTA 2KVRA 1WJNA 1KH0A 1WFYA 1WMHB 3NG0A 1L7YA 1IGDA 1KLGD 1NYRA 3R7QA 1VJKA 4WH4A 3GS2A 5D7GA 1ACCA 1M94A 4IM3A 2BWFA 1Y8RC 2AEHA 3L17A 2KLCA 4OZAA 4JLCA 4P1CC 1J7BA 1WM3A 1EM7A 2HJ1A 2ON8A 4MJSB 1FXAA 2E6XA 4ZOHC 4FJVB 5C1ZA 2KC1A 5LXHA 3X0WA 2WHIA 5BMHA 2O6VA 2R61A 1TY2A 3AXCA 2WDQB 4C56C 4M0WA 2IPKD 1F1HA 4O1NA 4RF1A 3JVZX 1PGXA 2JXXA 4JGHB 3PT2B 4JPSA 4A90A 2NCNA 2L05A 1RFAA 4WWNA 1WR6E 4NJ6A 2IO0B 3B08A 3W1SA 3HK0A 1VCBA 3ZNID 1L6VA 1UGJA 1ZUD2 2A4ZA 3RFZB 2DYMA 1RYJA 1SEBD 4ARIA 4MH0E 2PE6B 3T3OA 4RNAA 2IDYA 2V4IB 3ZLZA 2ZZPB 1WH3A 2WX0A 5E6NA 4M02A 4DXAB 5D3IB 5JHBA 4KSKC 2FNJB 2KLGA 2KDIA 3R3MA 3JSVB 3HM3A 1L2NA 3TJPA 3AE5B 2YEPB 4WAFA 1YJJA 3HVZA 4GU2A 1RM6C 2QJLA 4HROA 3V6EB 4BBNF 3RT3B 3ZJUA 1Z2MA 4C7YA 1MVKA 3UI3A 3V62A 3CSFA 3EGRA 5JH5C 4HJGE 3GE8C 2KNBA 1IUEA 1E8YA 4ZHPA 3AULA 3Q8FA 2K22A 5G2NA 1FRDA 1FNUA 1TJEA 1HZ6A 1TBEA 4RMAA 2V0GA 3QA8A 2KTFA 1FO4A 3X23A 1V1OA 1R4MB 3UQBA 2BKFA 4HDOA 3L08A 2O6VB 4BOZB 2DAJA 4DK5A 5CX3A 4TMAB 2HTME 1Q0WB 4GLSC 3MP9A 3UINB 2VH2A 2OJWA 5FR3A 2ZVOA 4CYEA 2LGSA 3L0WB 4II2B 4GDKA 4BFRA 2WS3B 1K8RB 3U2SC 3IHPC 4LTUA 4S17A 4BAXA 4ZYSA 2WLBA 1K53A 4GDLA 3Q3FA 2HE7A 4RGMA 1FRRA 2W9NA 1YQBA 2WU2B 4EUTA 1X1MA 4A55A 1WSPA 1WRDB 4N58A 4RFBA 2PJHA 3C0RB 4BBNC 3GP7A 3EFCA 2DBYA 4IG7B 2L76A 4HK2A 3ZJVA 3OAWA 4OHJA 1I4HA 4EOYA 4HEA1 3DBRB 5IA7A 4AOFA 4OVVA 1NI2A 2I38A 1WX8A 2KQ7A 4NAMA 2VH1A 2JYTA 3ML8A 3O65B 2WXLA 2RSUA 3LJ3A 4P16A 3M3JA 5KHOA 2HD5B 4A20A 3DHHC 1L4DB 4YTNB 3VFKA 3IAM1 1NYQA 2KN5A 3T8MA 4EZKA 3L54A 2KDBA 4W9LA 3ZXRA 5BMGA 3RUIB 1RLFA 2WDTB 2D5GA 1L6UA 2BWES 3AEFB 2BTEA 4YTMB 3EECA 3AEEB 3EHVA 1HQRD 2KOXA 1E5WA 3A9JB 2D3GA 4P6VF 1TS4A 2IO3B 1BT0A 4MEMA 1MI0A 3VVWB 4ANWA 2XN9C 5BYRA 1I4RA 1XD3B 3BY4B 2JRHA 4RH6A 4FN2A 2DNFA 1V97A 3U7ZA 2AL3A 3DHGC 5TSSA 3M63B 5TR5A 1D5MC 4GDKB 3AE9B 4K3CA 2DLBA 3H7PB 4KIKB 2BW2A 4GDLB 1GB1A 1H4RA 1C1YB 2BS3B 4JQWC 3R2TA 2L8JA 2JXTA 1K50A 3DVNV 2R2OA 4PS3A 2J42A 1I35A 1YN3A 1SSNA 3N32A 2MHJA 2CHWA 3A9KA 2RR9A 1MFWA 4IUMB 3SFEB 3UQAA 3Q3OC 1C4PA 2INPE 2PEAA 2KX3A 2GLSA 2N4FA 3A1QA 2O2VA 3PRZA 4M8MA 1EUVB 3ETRA 2IYDB 3L10B 2NS5A 1J8CA 2L32A 4YWGG 5EE3A 3KYCD 2FCSA 2REXA 3KQ4A 5AZGA 1JWSD 3RULA 4K7SA 1HTOA 2GBMA 2JQRB 1JWAD 1C4CA 3W9CB 4ZRPA 2N0SB 3PRPB 1HA5A 2DZIA 2Y5CA 3BVZA 3WALA 2WXPA 1OTRB 1V5OA 3R2IA 1HZ5A 1YNTE 1T0QC 1ZDVA 4NJ7A 4ZRJA 2Y3AA 4W9GA 2ZNVC 1PUTA 4F1SA 1GAQB 2LVQA 2J0MA 3W5UB 2KMMA 3WIMA 1VDVA 3MHSD 5BYSA 2KJ6A 1OQQA 1RAXA 1YMHE 4G3XB 1IBXA 4WAAA 2ZNVB 1VR9A 4HKZE 2IO1B 3T3NA 2UU7A 2YLMA 1BXTA 5LLIA 1E7VA 2LHEA 1WGHA 2SEBD 3I9V1 1EO6A 1OQRA 1KRHA 2CU1A 3A9KB 4GOCA 1SE4A 4BZAA 2GMIC 4XDDA 2GB1A 3UIOB 3H6NA 1V1PA 3A1QB 2C9WB 2O2VB 3S2AA 1R4MI 2KFJA 1ESFA 5H8YE 3ZDMC 1TZ1A 4NY0A 4TV3A 2D3AA 3PVLA 4YT0B 1L0XB 2K0PA 3PGEA 4F7ZA 4C4VA 4J6IA 1P7FA 2KTRA 1SIJA 4K7UA 4MACA 5IP4D 1H8CA 2KAJA 2KVZA 2IGHA 3ZNHB 3H1UA 1Z5SB 4LJOB 3IT4B 4MGZE 2N9PC 3KVFB 1VZ7A 2KDFB 2KO3A 2PKOA 1B9RA 1T0SC 1WMHA 2KWVB 1CQVA 2N7DA 2NR2A 1KLVA 2WYQA 1V5TA 4G11A 4TQ1A 1N63A 3DBRI 1NI3A 1D5ZC 1G6JA 1QQRA 3DBHB 1IBXB 1TS2A 2AQ1B 1PGAA 4PYZA 4XE0A 5HFYA 3NOBA 3DCGA 3APFA 3I63C 3Q8CA 3TEXA 4DHZB 2LHDA 2IY1B 3OLMD 5KHQA 2QILA 5L95C 3UF8A 1K51A 4AQ7A 5I4DA 1NENB 4WIPA 5J2RA 3QC8B 2M0AA 4MGYE 3ZO5B 3PPAA 2KQSA 2CR5A 3I5JC 3V05A 2KJRA 3NY5A 2XEWA 1Y56A 2WXQA 2N7JA 3BZDB 3VTVA 1V1PB 1VLBA 2QIEB 1F77A 3N3KB 1EF1A 3UIPB 4YSZB 1HXYD 1TGZB 1WXSA 1KOTA 2IZVB 2KT7A 1YX6B 4C80A 1P7EA 1WWTA 3IFWB 1P3QU 1L0VB 4DBGA 1FFUA 4C4VB 2KMAA 2GBJA 2KTRB 2MCNB 4CO7A 5D3DA 1QOAA 3N9YC 2LGIA 2LGYA 4EFOA 4B6WA 2INCC 4K3BA 2MBEA 1ZPSA 3EC8A 4K7WA 3EFUA 3BIID 4XDCA 4FJZA 2QMTA 4IWQA 3ZKJC 3ALBA 3N30A 2LGDA 3AEDB 3ZNZB 3J9CA 5JHAA 4MH8A 3PREA 2A5UA 1TKYA 2C7NB 2QHOA 4W9IA 1P0RA 3N1XC 3AE2B 3NVZA 4MSMB 2J52A 2VZKD 4YXDB 4MSQB 4GXBA 4K1RB 1TYGB 2LRUA 2YVCA 1LXDA 1FEHA 2NBWB 4NAWB 1GPXA 2V3NA 4YSYB 1ZE3D 1TT5B 2Z59B 2N9LA 2K3UA 2WP9B 4US9A 3ZTCA 2I1KA 3SR6A 2BPSA 1E8XA 2ACZB 2I1JA 4IWOA 4B0MA 5C3JB 3ML9A 3BK1A 4EEWA 2MX2A 1DGJA 2K1FA 4E3CA 4RGTA 1K52A 4DHZE 3Q3JA 1F9JA 4NZLB 3AU4A 2BYTA 1N5WA 3P2BA 3LDZE 2CJNA 2BYVE 2N9XA 1QLBB 3MTNB 1GJZA 1C76A 1EU3A 2FBWB 2ZCCA 3VUYA 3NVWA 3MC0B 5D6JB 4L23A 4ACFA 4Q2JA 2JWUA 1D5XC 3RNAC 5FK9C 2EMSA 4R3DA 1SBBB 1EWYC 2GI9A 3PRMB 4MT5A 2L0TA 3ZDTA 4HPPA 1SE3A 2IGDA 2RDBC 4LNOA 1I4XA 2K6QA 3SHQA 3DWMA 4TKNA 3H8HA 2C60A 1TTNA 2OOBB 4WWOA 1FNWA 2LD9A 1RWSA 2EKIA 1J7AA 5LNK1 1S1QB 5H92C 4FULA 1UZXB 3B2FA 2JU6X 5T8IA 4W9EA 1E0ZA 5D94A 2UWQA 1GC7A 1YQ4B 3GE3C 1A5RA 4OW0A 1IYFA 4MGIE 5FKAC 1WJUA 3GOEA 1FD6A 4WWMA 2JY6A 3Q6BA 2INDC 1GB4A 3RNBC 4LK0M 2WXOA 3ZGZA 2WXHA 2AYOB 1WE6A 2KWDA 3A9JA 2X38A 3U7DA 2ZEQA 3B1LX 1SE9A 2MBOA 1WJ6A 3VUXA 4YTPB 3KLSX 5FR6A 2L7RA 4WJOA 4JWSC 4KZ0A 2BF8B 2Z0EB 2V1YA 3H7PA 4KIKA 1ISNA 4ICVA 2N1WA 3KW5B 1FM0D 1WM2A 1XLQA 5GXGB 2V3SA 3CSTA 2PIAA 5EE9A 3RMKC 4G0NB 3N20C 2UYZB 1WYWB 1Q10A 1QZEA 2DYBA 2ASQA 4CQNA 2MQJA 2XBBC 2KYWA 2TSSA 3KWVA 4XX5A 3P4QB 3ECIA 1N6ZA 3ZYYX 3IXSA 2J0JA 4NPNA 3DBHI 5HG2A 3HRDD 5DCNA 3VHTC 4P7IA 1WXMA 2KQ4X 3V3XA 4XZ4A 1PFDA 3PZ8A 3PZ7A 3VUWA 3ABVB 1D6EC 1ZGUB 3K9OB 3VAWA 4LCDE 4HVBA 4IDIA 3AEBB 3N1YC 1PQSA 1WX7A 3D32A 2HTHA 4N59A 1Q5WB 1JWUD 4ANXA 2WXNA 2K25A 1C77A 1JWMD 2MWSB 1ET9A 5AZFA 1KJTA 2K9XA 2QCZA 2WXMA 2N7EA 4FHKA 3QIJA 2LASA 5IAAC 1V6EA 5G5GA 2DZJA 2FIDA 2OJRA 1VZ6A 2MLBA 3UGBB 3NZSA 2LVPA 2KXJA
chains in the Genus database with same CATH topology
3QAQA 3SDLC 1C3TA 4AUQC 2CU1A 2HJ8A 3A9KB 4GOCA 3JYUA 4ICUA 4X57B 1WF9A 3TBLD 2GMIC 3VDZA 2ZPYA 2L0FA 4MGKE 3PS6A 1XT9B 3A33B 3JSVA 2Z0DB 2KZRA 3UIOB 1KM7A 4DDID 3H6NA 3BINA 3KUCB 3A1QB 4RM8A 4ZRKA 2C9WB 5GMVA 2O2VB 3S2AA 3ZTDA 1R4MI 2KFJA 3VXWA 2JT4B 3TL5A 3ZDMC 4JL9A 4BOSC 2DHZA 1TZ1A 4NQKE 4AWJA 4NY0A 4TV3A 2AL6A 2IO2B 4IWPA 1P1AA 3PVLA 2KVRA 1WJNA 1OEYJ 5CHWA 1WFYA 1WMHB 2M1MA 3AU5A 1L7YA 3PGEA 4F7ZA 3W1SC 2D2QA 3R7QA 3I3TB 3PTFC 4J6IA 2G3QB 2KTRA 4K7UA 5D7GA 1H8CA 1M94A 4M0WB 4IM3A 4GB9A 1YD8U 2G4SA 4NQLB 1XQQA 3SD5A 2BYEA 3V6CB 2BWFA 2NPTB 1EF5A 3DPDA 3ZNHB 1Y8RC 3H1UA 4WQOB 2AEHA 3L17A 1Z5SB 2KLCA 4FADA 4LJOB 2J0KA 4MGZE 5CHFA 2N9PC 2XK5B 4JLCA 1WM3A 1J0GA 4MJSB 4IC7B 2DYOA 3KVFB 2KDFB 2KO3A 5C23A 3U8ZA 1YIWA 4FJVB 1LFDA 5C1ZA 2KC1A 1WMHA 5LXHA 2WWZA 3X0WA 2KWVB 2KFKA 2O6VA 2N7DA 2NR2A 3AXCA 1IPGA 2MBHA 3M95A 3NHEB 2WYQA 3NZUA 1KLVA 2DZMA 1V5TA 4G11A 2JUOA 4TQ1A 3DBRI 3PLUA 4FBJB 1R4NI 1WIAA 3APCA 3JVZX 2CHXA 2JXXA 3SU8X 3PV1A 5G55A 1G6JA 2KD0A 4JGHB 3PT2B 2V4LA 3ZIMA 3MJWA 2NCNA 2L05A 3R66C 1RFAA 2DZKA 4PYZA 3QX1A 2AWTA 4HDQA 4BKSD 4WWNA 1ZW7A 1WR6E 3VTWA 4NJ6A 2IO0B 3B08A 3W1SA 3NOBA 3HK0A 4BVUC 1V81A 3DCGA 4N9F4 4DHJB 3APFA 1WXVA 1VCBA 3ZNID 2GOWA 2MRPA 3KYDD 2A4ZA 4KZCA 2DYMA 3ZRCA 4DHZB 2IY1B 2G45B 3OLMD 4DWFA 5KHQA 3UF8A 5L95C 4FA6A 2M8SA 4MH0E 2ZPNA 2LZ6A 2ZJDA 2PE6B 4I6LB 5AZHA 3CF6E 3ZLZA 2ZZPB 1WH3A 2WX0A 5J2RA 3QC8B 1V86A 5E6NA 5LXIB 4MGYE 4DXAB 3ZO5B 5JHBA 3PPAA 2KQSA 1ZKHA 2FNJB 3QCAA 2K6DB 2ZVNA 4KSKC 2KLGA 3PZDA 4GSWA 2CR5A 2KDIA 2KJRA 1OEYA 2XEWA 3NY5A 4LDTD 3R3MA 3JSVB 3HM3A 1YJ1A 3WANA 1L2NA 3VTVA 4W9DA 3TJPA 3RZWC 3JW0X 3K9PB 4PS7A 2MP2A 3N3KB 1EF1A 3UIPB 4GU2A 1TGZB 1WXSA 1KOTA 2GBNA 2IZVB 2MW5A 3V6EB 4A3PA 4BBNF 1YX6B 3RT3B 4BKGA 2D11A 1Z2MA 4WJPA 1OQYA 1AARA 3IFWB 1P3QU 4I6PA 4A3OA 4DBGA 2N1VA 4PYUA 3V61A 1FXTB 2KMAA 3V62A 2GBJA 2EKEC 3CSFA 3V60A 2KTRB 2MCNB 5JH5C 2CHZA 1Q1OA 2BYFA 4PS8A 2KNBA 4CO7A 1E8YA 1WE7A 3AULA 3ENEA 5JZEB 1U4AA 2LGYA 5G2NA 3ZW3A 3A4RA 4EFOA 1MG8A 2JVCA 4B6WA 3DOWA 4K81A 5E6OA 1TBEA 2MBEA 4RMAA 3EC8A 1GUAB 2DX5B 4W9CA 3QA8A 4G50A 4K7WA 4OVUA 4BKTA 2KTFA 3EFUA 4TQ0A 1UELA 2O6VD 4GGQA 3X23A 1NDDA 4FJZA 3UQBA 3GZNI 4IWQA 2BKFA 3ALBA 4HDOA 3N30A 2LGDA 2KWCA 1OGWA 2KFKB 2O6VB 3KH0A 3L08A 4MELA 4BOZB 3ZNZB 2DAJA 1S3SG 5J17A 5JHAA 4DK5A 1WGRA 3PREA 4FLHA 2A5UA 4II3B 5CX3A 2MBBB 2C7MB 2C7NB 5CHVC 1Q0WB 1WGGA 2QHOA 1UGMA 3QJZA 4JIOU 2M17A 4W9IA 1P0RA 4ZYNA 3UINB 1T0YA 4MSMB 4IW0A 2ZVOA 3ONSA 4CYEA 3L0WB 4LJPB 1SIFA 2JZZA 4II2B 2LVOA 4GDKA 4GXBA 4K1RB 4MSQB 4BFRA 1K8RB 2LRUA 2MSED 1P98A 3DVGX 2YVCA 2K8CA 1LXDA 2LWPA 3IHPC 4HXDA 2LGXA 2NBWB 4KV2A 2BKRB 4NAWB 4GDLA 3VH4B 3Q3FA 2HE7A 4HCNB 2Z59B 2W9NA 1YQBA 1WJ4A 2N9EB 2ZCBA 4EUTA 1X1MA 2RGFA 3ZTCA 1WRDB 4GIVA 2I1KA 2KMCA 3KUZA 2BPSA 1E8XA 4W9KA 4WWPA 2PJHA 2I1JA 4IWOA 3C0RB 4BBNC 3ML9A 4IG7B 2L76A 3APDA 4HK2A 1IP9A 3DBLI 3OAWA 4EEWA 2MX2A 4EOYA 5AEKB 1WZ0A 2K1FA 4E3CA 5J18A 2MBQA 2D10A 3TCAA 4KSLC 4DHZE 5IA7A 4DHJD 3Q3JA 4NAWA 1F9JA 3DDCB 2KJHB 4AOFA 3AU4A 4OVVA 1NI2A 2KX0A 3QHTA 3P2BA 3LDZE 4CHKA 4M8NA 1D3ZA 2MP2B 4AJYB 2JF5A 1WX8A 3H9DA 2KK8A 2KQ7A 2BYVE 2N9XA 3MTNB 4W9JA 1GJZA 3ML8A 2ZCCA 1WXAA 3O65B 5E6PA 4HPMB 3VUYA 4ASWC 2LI5A 1UH6A 5DPTA 3VH3B 2RPQA 3TIXA 1VD2A 3TMPB 5D6JB 2RSUA 3WA0A 3DVGY 3LJ3A 3L13A 2IY0B 4HPLB 4B95A 1V2YA 3M3JA 3WAPA 5KHOA 2HD5B 4A20A 4EKUA 3ZNGC 2EMSA 4XC2A 2NVUI 1LQBA 3VFKA 2KC2A 2LJ5A 4KDIC 3U30A 2KN5A 3T8MA 2CS4A 4EZKA 3T9LA 3PRMB 3L54A 2KHWB 2KDEB 5DPWA 4URKA 2L0TA 2KDBA 4IM2A 4W9LA 3ZDTA 3KUDB 3RUIB 1RLFA 2R2QA 2WDTB 2K6QA 3NS8A 2MA9B 3SHQA 4HWIB 1NBFC 2BWES 1E7UA 1V9JA 2WX1A 4TKNA 4ANUA 2C60A 3EECA 1V80A 1TTNA 3EHVA 2JRIB 4EZJA 2OOBB 4WWOA 1WGDA 2KOXA 2VRRB 1E5WA 3ZUNA 2C5LC 2D3GA 3A9JB 1E90A 2KKCA 2LD9A 2IO3B 2PE9A 4FJYA 4W9HA 5CTRC 1BT0A 4MEMA 2B3AA 3VVWB 3RD2A 4ANWA 3VQIA 1S1QB 4FULA 1XD3B 3BY4B 2FAZA 1UZXB 3PSEB 2JRHA 2M0XA 4FN2A 4W9EA 3H7SA 4RM9A 2AL3A 5D94A 2UWQA 5TR5A 3M63B 4ZDVA 1GC7A 4GDKB 1A5RA 1IYFA 4MGIE 1WJUA 3GOEA 3H7PB 4KIKB 3ZRFA 2JY6A 4GDLB 1LM8B 4GMVA 2AYOB 5EDSA 2BGFA 1WE6A 3A9JA 1E8ZA 1H4RA 3U7DA 1C1YB 2ZEQA 3RCZA 3B1LX 5HKHA 1SE9A 3QARA 4JQWC 3OJ4B 3DVNU 3HIZA 3QK0A 2DENB 2L8JA 2MBOA 3PLVA 3QQ8B 1WJ6A 3VUXA 2NBVB 1V49A 2Y5BB 4W9FA 5FR6A 3DVNV 2L7RA 3OJ3A 4I6NB 2R2OA 4PS3A 5DPRA 4AP4C 2K8HA 4WJOA 1I35A 3IVFA 4KZ0A 2EMTA 1GG3A 2BF8B 2JWZA 2Z0EB 3AI5A 3N32A 2CHWA 2V1YA 2RR9A 3A9KA 3H7PA 4KIKA 1ISNA 4IUMB 3RZFA 4ICVA 4EZLA 3UQAA 2N1WA 3KW5B 2KANA 3HHMA 3L16A 3VTUA 2PEAA 1UBQA 1WM2A 4GN1A 2V3SA 2KX3A 3A4SC 2N4FA 3CSTA 3A1QA 2O2VA 3PRZA 4IM0A 4HCPB 2L00B 2PPHA 3IG3A 4M8MA 1EUVB 1P9DU 2IYDB 2CKHB 3L10B 1I42A 2NS5A 4G0NB 1J8CA 1HE8A 1UBIA 2UYZB 3KYCD 1WYWB 1QZEA 2DYBA 2FCSA 2FCNA 2REXA 4KDLB 4ANVA 2ASQA 4YL8A 1UD7A 4MM3A 2MQJA 5AZGA 2XBBC 3B0AA 2JZ3B 3RULA 4E71A 4XX5A 1GC6A 4K7SA 2D07B 3DBSA 3ECIA 2M4NA 2GBMA 3W1YA 2K8BA 2LXCA 2NBUA 2J7QB 2J0JA 1WX9A 1WI0A 2RD0A 4NPNA 4TUUA 3DBHI 1RRBA 5DCNA 2NPTA 3VHTC 3PRPB 1WXMA 4P7IA 2GBKA 2FUHB 4AJWA 4XZ4A 2DZIA 2FCMA 5L83A 3WAOA 3WALA 1OTRB 2LXAA 2C7HA 1V5OA 2IBIB 2XK5A 3RYTA 2FCQA 3VUWA 4NJ7A 4ZRJA 3HM6X 3DQVA 1WR1A 4MJSA 4W9GA 4DDGD 1WGYA 2ZNVC 1ZGUB 4B9KA 3K9OB 3VAWA 1SGHA 4E74A 1J19A 4LCDE 4HVBA 4F1SA 5D2MB 1PQSA 2FIFA 1WX7A 2LVQA 4WJQA 5DPSA 2J0MA 3QWZB 3WAMA 3D32A 4ZRIA 3WIMA 2HTHA 4FHJA 3MHSD 1Q5WB 1YX5B 4MDKE 3M62B 2G4DB 2KJ6A 2LUEA 1E8WA 1WY8A 2DAFA 3PHWB 4ANXA 1CMXB 3R7RA 2K25A 1RAXA 2K39A 2L3ZA 2GBRA 3PHXB 4G3XB 2MWSB 5AZFA 4WAAA 1KJTA 2ZNVB 4KVGB 3ZKJC 4HLEA 4NNJB 2N7EA 4FHKA 2JPHA 4LDTB 2LRWA 3CMMB 3QIJA 2LASA 2IO1B 4BKSA 5IAAC 2YLMA 1JRUA 1V6EA 2DZJA 2FIDA 2OJRA 5LLIA 1E7VA 4HJKA 2MLBA 3ZVVA 2KWUB 1WGHA 3UGBB 3NZSA 1GNUA 3IBEA 1EO6A 2LVPA 5BO4B 1WZ3A 2KXJA 4WJNA 4F8CB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QAQ A;  3SDL C;  1C3T A;  4AUQ C;  2CU1 A;  2HJ8 A;  3A9K B;  4GOC A;  3JYU A;  4ICU A;  4X57 B;  1WF9 A;  3TBL D;  2GMI C;  3VDZ A;  2ZPY A;  2L0F A;  4MGK E;  3PS6 A;  1XT9 B;  3A33 B;  3JSV A;  2Z0D B;  2KZR A;  3UIO B;  1KM7 A;  4DDI D;  3H6N A;  3BIN A;  3KUC B;  3A1Q B;  4RM8 A;  4ZRK A;  2C9W B;  5GMV A;  2O2V B;  3S2A A;  3ZTD A;  1R4M I;  2KFJ A;  3VXW A;  2JT4 B;  3TL5 A;  3ZDM C;  4JL9 A;  4BOS C;  2DHZ A;  1TZ1 A;  4NQK E;  4AWJ A;  4NY0 A;  4TV3 A;  2AL6 A;  2IO2 B;  4IWP A;  1P1A A;  3PVL A;  2KVR A;  1WJN A;  1OEY J;  5CHW A;  1WFY A;  1WMH B;  2M1M A;  3AU5 A;  1L7Y A;  3PGE A;  4F7Z A;  3W1S C;  2D2Q A;  3R7Q A;  3I3T B;  3PTF C;  4J6I A;  2G3Q B;  2KTR A;  4K7U A;  5D7G A;  1H8C A;  1M94 A;  4M0W B;  4IM3 A;  4GB9 A;  1YD8 U;  2G4S A;  4NQL B;  1XQQ A;  3SD5 A;  2BYE A;  3V6C B;  2BWF A;  2NPT B;  1EF5 A;  3DPD A;  3ZNH B;  1Y8R C;  3H1U A;  4WQO B;  2AEH A;  3L17 A;  1Z5S B;  2KLC A;  4FAD A;  4LJO B;  2J0K A;  4MGZ E;  5CHF A;  2N9P C;  2XK5 B;  4JLC A;  1WM3 A;  1J0G A;  4MJS B;  4IC7 B;  2DYO A;  3KVF B;  2KDF B;  2KO3 A;  5C23 A;  3U8Z A;  1YIW A;  4FJV B;  1LFD A;  5C1Z A;  2KC1 A;  1WMH A;  5LXH A;  2WWZ A;  3X0W A;  2KWV B;  2KFK A;  2O6V A;  2N7D A;  2NR2 A;  3AXC A;  1IPG A;  2MBH A;  3M95 A;  3NHE B;  2WYQ A;  3NZU A;  1KLV A;  2DZM A;  1V5T A;  4G11 A;  2JUO A;  4TQ1 A;  3DBR I;  3PLU A;  4FBJ B;  1R4N I;  1WIA A;  3APC A;  3JVZ X;  2CHX A;  2JXX A;  3SU8 X;  3PV1 A;  5G55 A;  1G6J A;  2KD0 A;  4JGH B;  3PT2 B;  2V4L A;  3ZIM A;  3MJW A;  2NCN A;  2L05 A;  3R66 C;  1RFA A;  2DZK A;  4PYZ A;  3QX1 A;  2AWT A;  4HDQ A;  4BKS D;  4WWN A;  1ZW7 A;  1WR6 E;  3VTW A;  4NJ6 A;  2IO0 B;  3B08 A;  3W1S A;  3NOB A;  3HK0 A;  4BVU C;  1V81 A;  3DCG A;  4N9F 4;  4DHJ B;  3APF A;  1WXV A;  1VCB A;  3ZNI D;  2GOW A;  2MRP A;  3KYD D;  2A4Z A;  4KZC A;  2DYM A;  3ZRC A;  4DHZ B;  2IY1 B;  2G45 B;  3OLM D;  4DWF A;  5KHQ A;  3UF8 A;  5L95 C;  4FA6 A;  2M8S A;  4MH0 E;  2ZPN A;  2LZ6 A;  2ZJD A;  2PE6 B;  4I6L B;  5AZH A;  3CF6 E;  3ZLZ A;  2ZZP B;  1WH3 A;  2WX0 A;  5J2R A;  3QC8 B;  1V86 A;  5E6N A;  5LXI B;  4MGY E;  4DXA B;  3ZO5 B;  5JHB A;  3PPA A;  2KQS A;  1ZKH A;  2FNJ B;  3QCA A;  2K6D B;  2ZVN A;  4KSK C;  2KLG A;  3PZD A;  4GSW A;  2CR5 A;  2KDI A;  2KJR A;  1OEY A;  2XEW A;  3NY5 A;  4LDT D;  3R3M A;  3JSV B;  3HM3 A;  1YJ1 A;  3WAN A;  1L2N A;  3VTV A;  4W9D A;  3TJP A;  3RZW C;  3JW0 X;  3K9P B;  4PS7 A;  2MP2 A;  3N3K B;  1EF1 A;  3UIP B;  4GU2 A;  1TGZ B;  1WXS A;  1KOT A;  2GBN A;  2IZV B;  2MW5 A;  3V6E B;  4A3P A;  4BBN F;  1YX6 B;  3RT3 B;  4BKG A;  2D11 A;  1Z2M A;  4WJP A;  1OQY A;  1AAR A;  3IFW B;  1P3Q U;  4I6P A;  4A3O A;  4DBG A;  2N1V A;  4PYU A;  3V61 A;  1FXT B;  2KMA A;  3V62 A;  2GBJ A;  2EKE C;  3CSF A;  3V60 A;  2KTR B;  2MCN B;  5JH5 C;  2CHZ A;  1Q1O A;  2BYF A;  4PS8 A;  2KNB A;  4CO7 A;  1E8Y A;  1WE7 A;  3AUL A;  3ENE A;  5JZE B;  1U4A A;  2LGY A;  5G2N A;  3ZW3 A;  3A4R A;  4EFO A;  1MG8 A;  2JVC A;  4B6W A;  3DOW A;  4K81 A;  5E6O A;  1TBE A;  2MBE A;  4RMA A;  3EC8 A;  1GUA B;  2DX5 B;  4W9C A;  3QA8 A;  4G50 A;  4K7W A;  4OVU A;  4BKT A;  2KTF A;  3EFU A;  4TQ0 A;  1UEL A;  2O6V D;  4GGQ A;  3X23 A;  1NDD A;  4FJZ A;  3UQB A;  3GZN I;  4IWQ A;  2BKF A;  3ALB A;  4HDO A;  3N30 A;  2LGD A;  2KWC A;  1OGW A;  2KFK B;  2O6V B;  3KH0 A;  3L08 A;  4MEL A;  4BOZ B;  3ZNZ B;  2DAJ A;  1S3S G;  5J17 A;  5JHA A;  4DK5 A;  1WGR A;  3PRE A;  4FLH A;  2A5U A;  4II3 B;  5CX3 A;  2MBB B;  2C7M B;  2C7N B;  5CHV C;  1Q0W B;  1WGG A;  2QHO A;  1UGM A;  3QJZ A;  4JIO U;  2M17 A;  4W9I A;  1P0R A;  4ZYN A;  3UIN B;  1T0Y A;  4MSM B;  4IW0 A;  2ZVO A;  3ONS A;  4CYE A;  3L0W B;  4LJP B;  1SIF A;  2JZZ A;  4II2 B;  2LVO A;  4GDK A;  4GXB A;  4K1R B;  4MSQ B;  4BFR A;  1K8R B;  2LRU A;  2MSE D;  1P98 A;  3DVG X;  2YVC A;  2K8C A;  1LXD A;  2LWP A;  3IHP C;  4HXD A;  2LGX A;  2NBW B;  4KV2 A;  2BKR B;  4NAW B;  4GDL A;  3VH4 B;  3Q3F A;  2HE7 A;  4HCN B;  2Z59 B;  2W9N A;  1YQB A;  1WJ4 A;  2N9E B;  2ZCB A;  4EUT A;  1X1M A;  2RGF A;  3ZTC A;  1WRD B;  4GIV A;  2I1K A;  2KMC A;  3KUZ A;  2BPS A;  1E8X A;  4W9K A;  4WWP A;  2PJH A;  2I1J A;  4IWO A;  3C0R B;  4BBN C;  3ML9 A;  4IG7 B;  2L76 A;  3APD A;  4HK2 A;  1IP9 A;  3DBL I;  3OAW A;  4EEW A;  2MX2 A;  4EOY A;  5AEK B;  1WZ0 A;  2K1F A;  4E3C A;  5J18 A;  2MBQ A;  2D10 A;  3TCA A;  4KSL C;  4DHZ E;  5IA7 A;  4DHJ D;  3Q3J A;  4NAW A;  1F9J A;  3DDC B;  2KJH B;  4AOF A;  3AU4 A;  4OVV A;  1NI2 A;  2KX0 A;  3QHT A;  3P2B A;  3LDZ E;  4CHK A;  4M8N A;  1D3Z A;  2MP2 B;  4AJY B;  2JF5 A;  1WX8 A;  3H9D A;  2KK8 A;  2KQ7 A;  2BYV E;  2N9X A;  3MTN B;  4W9J A;  1GJZ A;  3ML8 A;  2ZCC A;  1WXA A;  3O65 B;  5E6P A;  4HPM B;  3VUY A;  4ASW C;  2LI5 A;  1UH6 A;  5DPT A;  3VH3 B;  2RPQ A;  3TIX A;  1VD2 A;  3TMP B;  5D6J B;  2RSU A;  3WA0 A;  3DVG Y;  3LJ3 A;  3L13 A;  2IY0 B;  4HPL B;  4B95 A;  1V2Y A;  3M3J A;  3WAP A;  5KHO A;  2HD5 B;  4A20 A;  4EKU A;  3ZNG C;  2EMS A;  4XC2 A;  2NVU I;  1LQB A;  3VFK A;  2KC2 A;  2LJ5 A;  4KDI C;  3U30 A;  2KN5 A;  3T8M A;  2CS4 A;  4EZK A;  3T9L A;  3PRM B;  3L54 A;  2KHW B;  2KDE B;  5DPW A;  4URK A;  2L0T A;  2KDB A;  4IM2 A;  4W9L A;  3ZDT A;  3KUD B;  3RUI B;  1RLF A;  2R2Q A;  2WDT B;  2K6Q A;  3NS8 A;  2MA9 B;  3SHQ A;  4HWI B;  1NBF C;  2BWE S;  1E7U A;  1V9J A;  2WX1 A;  4TKN A;  4ANU A;  2C60 A;  3EEC A;  1V80 A;  1TTN A;  3EHV A;  2JRI B;  4EZJ A;  2OOB B;  4WWO A;  1WGD A;  2KOX A;  2VRR B;  1E5W A;  3ZUN A;  2C5L C;  2D3G A;  3A9J B;  1E90 A;  2KKC A;  2LD9 A;  2IO3 B;  2PE9 A;  4FJY A;  4W9H A;  5CTR C;  1BT0 A;  4MEM A;  2B3A A;  3VVW B;  3RD2 A;  4ANW A;  3VQI A;  1S1Q B;  4FUL A;  1XD3 B;  3BY4 B;  2FAZ A;  1UZX B;  3PSE B;  2JRH A;  2M0X A;  4FN2 A;  4W9E A;  3H7S A;  4RM9 A;  2AL3 A;  5D94 A;  2UWQ A;  5TR5 A;  3M63 B;  4ZDV A;  1GC7 A;  4GDK B;  1A5R A;  1IYF A;  4MGI E;  1WJU A;  3GOE A;  3H7P B;  4KIK B;  3ZRF A;  2JY6 A;  4GDL B;  1LM8 B;  4GMV A;  2AYO B;  5EDS A;  2BGF A;  1WE6 A;  3A9J A;  1E8Z A;  1H4R A;  3U7D A;  1C1Y B;  2ZEQ A;  3RCZ A;  3B1L X;  5HKH A;  1SE9 A;  3QAR A;  4JQW C;  3OJ4 B;  3DVN U;  3HIZ A;  3QK0 A;  2DEN B;  2L8J A;  2MBO A;  3PLV A;  3QQ8 B;  1WJ6 A;  3VUX A;  2NBV B;  1V49 A;  2Y5B B;  4W9F A;  5FR6 A;  3DVN V;  2L7R A;  3OJ3 A;  4I6N B;  2R2O A;  4PS3 A;  5DPR A;  4AP4 C;  2K8H A;  4WJO A;  1I35 A;  3IVF A;  4KZ0 A;  2EMT A;  1GG3 A;  2BF8 B;  2JWZ A;  2Z0E B;  3AI5 A;  3N32 A;  2CHW A;  2V1Y A;  2RR9 A;  3A9K A;  3H7P A;  4KIK A;  1ISN A;  4IUM B;  3RZF A;  4ICV A;  4EZL A;  3UQA A;  2N1W A;  3KW5 B;  2KAN A;  3HHM A;  3L16 A;  3VTU A;  2PEA A;  1UBQ A;  1WM2 A;  4GN1 A;  2V3S A;  2KX3 A;  3A4S C;  2N4F A;  3CST A;  3A1Q A;  2O2V A;  3PRZ A;  4IM0 A;  4HCP B;  2L00 B;  2PPH A;  3IG3 A;  4M8M A;  1EUV B;  1P9D U;  2IYD B;  2CKH B;  3L10 B;  1I42 A;  2NS5 A;  4G0N B;  1J8C A;  1HE8 A;  1UBI A;  2UYZ B;  3KYC D;  1WYW B;  1QZE A;  2DYB A;  2FCS A;  2FCN A;  2REX A;  4KDL B;  4ANV A;  2ASQ A;  4YL8 A;  1UD7 A;  4MM3 A;  2MQJ A;  5AZG A;  2XBB C;  3B0A A;  2JZ3 B;  3RUL A;  4E71 A;  4XX5 A;  1GC6 A;  4K7S A;  2D07 B;  3DBS A;  3ECI A;  2M4N A;  2GBM A;  3W1Y A;  2K8B A;  2LXC A;  2NBU A;  2J7Q B;  2J0J A;  1WX9 A;  1WI0 A;  2RD0 A;  4NPN A;  4TUU A;  3DBH I;  1RRB A;  5DCN A;  2NPT A;  3VHT C;  3PRP B;  1WXM A;  4P7I A;  2GBK A;  2FUH B;  4AJW A;  4XZ4 A;  2DZI A;  2FCM A;  5L83 A;  3WAO A;  3WAL A;  1OTR B;  2LXA A;  2C7H A;  1V5O A;  2IBI B;  2XK5 A;  3RYT A;  2FCQ A;  3VUW A;  4NJ7 A;  4ZRJ A;  3HM6 X;  3DQV A;  1WR1 A;  4MJS A;  4W9G A;  4DDG D;  1WGY A;  2ZNV C;  1ZGU B;  4B9K A;  3K9O B;  3VAW A;  1SGH A;  4E74 A;  1J19 A;  4LCD E;  4HVB A;  4F1S A;  5D2M B;  1PQS A;  2FIF A;  1WX7 A;  2LVQ A;  4WJQ A;  5DPS A;  2J0M A;  3QWZ B;  3WAM A;  3D32 A;  4ZRI A;  3WIM A;  2HTH A;  4FHJ A;  3MHS D;  1Q5W B;  1YX5 B;  4MDK E;  3M62 B;  2G4D B;  2KJ6 A;  2LUE A;  1E8W A;  1WY8 A;  2DAF A;  3PHW B;  4ANX A;  1CMX B;  3R7R A;  2K25 A;  1RAX A;  2K39 A;  2L3Z A;  2GBR A;  3PHX B;  4G3X B;  2MWS B;  5AZF A;  4WAA A;  1KJT A;  2ZNV B;  4KVG B;  3ZKJ C;  4HLE A;  4NNJ B;  2N7E A;  4FHK A;  2JPH A;  4LDT B;  2LRW A;  3CMM B;  3QIJ A;  2LAS A;  2IO1 B;  4BKS A;  5IAA C;  2YLM A;  1JRU A;  1V6E A;  2DZJ A;  2FID A;  2OJR A;  5LLI A;  1E7V A;  4HJK A;  2MLB A;  3ZVV A;  2KWU B;  1WGH A;  3UGB B;  3NZS A;  1GNU A;  3IBE A;  1EO6 A;  2LVP A;  5BO4 B;  1WZ3 A;  2KXJ A;  4WJN A;  4F8C B; 
#chains in the Genus database with same CATH topology
 3SDL C;  1SJE D;  4AUQ C;  1L5P A;  4ARC A;  2HJ8 A;  2PVO D;  1FIQ A;  3TBL D;  3VDZ A;  2WDR B;  2Z0D B;  1KM7 A;  4DDI D;  3BIN A;  3KUC B;  3AV8 A;  5GMV A;  3Q3M C;  4USA A;  5AUI A;  4BOS C;  4NQK E;  4AWJ A;  3AE8 B;  1GOZ A;  1T3Q A;  1ZXH A;  1P1A A;  3ZXV A;  4RGN A;  4A6Q A;  2M1M A;  3VR9 B;  2D2Q A;  2RPV A;  2PTL A;  1UF0 A;  4GB9 A;  2LFI A;  2G4S A;  4NQL B;  1XQQ A;  3SD5 A;  2BYE A;  3V6C B;  1EF5 A;  3DPD A;  3O13 A;  4WQO B;  2W3S A;  5CHF A;  2G1E A;  1XXG A;  4IC7 B;  1XLO A;  3U8Z A;  1YIW A;  1YN4 A;  1LFD A;  2MEK A;  2EEL A;  2KN4 A;  2MBH A;  3M95 A;  3NHE B;  5AUK A;  3FIL A;  4FBJ B;  2DWQ A;  1WIA A;  4HKQ A;  4KKI A;  2CHX A;  3SU8 X;  3PV1 A;  5G55 A;  3RI7 C;  3R66 C;  4PT5 A;  1KFY B;  2DZK A;  3QX1 A;  4KX6 B;  1SB3 C;  4HDQ A;  4BKS D;  1C9F A;  1ZW7 A;  2M56 B;  3RNE C;  4BVU C;  1V81 A;  4N9F 4;  4JWU C;  4NJC A;  1R7S A;  2GOW A;  2LJI A;  4RCO A;  2MRP A;  3KYD D;  1ZDX A;  3ZRC A;  4DWF A;  2ZPN A;  2V9H A;  2WDV B;  3CF6 E;  2BQQ A;  5LXI B;  1M4V A;  1NVI D;  3Q8B A;  5E6J A;  1ZKH A;  3I57 A;  3IT6 B;  3QCA A;  2ZVN A;  3PZD A;  4GSW A;  2WXI A;  3JW0 X;  2NTS A;  3K9P B;  2MP2 A;  4UDU C;  4OVZ A;  3ZQ4 A;  1JRO A;  1SE2 A;  4BKG A;  2MW5 A;  3AEA B;  1MHX A;  1OQY A;  4I6P A;  5JXV A;  2N1V A;  4PYU A;  3Q14 C;  3SFD B;  4M00 A;  3V61 A;  1FXT B;  1UWM A;  3LB8 C;  3P42 A;  3V60 A;  1WYG A;  1JCK B;  2CHZ A;  1QT9 A;  2BYF A;  2W82 A;  4DQO C;  1WE7 A;  5JZE B;  1U4A A;  1QOF A;  3A4R A;  1PYW D;  1T5X D;  1MG8 A;  2JVC A;  3OWE B;  3DOW A;  1JRP A;  3NZ3 A;  1FCL A;  4W9C A;  1GUA B;  4BKT A;  1XLN A;  3AE4 B;  4TQ0 A;  3N1Z C;  1NDD A;  2M19 A;  4MEL A;  3E56 A;  1S3S G;  5J17 A;  1QOG A;  1E7P B;  4ZRQ A;  4FLH A;  3BVG A;  2MBB B;  5CHV C;  3FIL B;  1WGG A;  1HEZ E;  3R8B A;  1UGM A;  3QJZ A;  4JIO U;  2M17 A;  2PMV A;  3NUH B;  4DXF A;  3ONS A;  5IO9 A;  4LJP B;  1SIF A;  2JZZ A;  2QSD A;  2WQY B;  4LNK A;  3DVG X;  1N61 A;  2VZK B;  2K8C A;  3AE6 B;  2W55 A;  2LGX A;  4KV2 A;  1L4Z B;  3VH4 B;  4A8X C;  1E6E B;  1WJ4 A;  1AW7 A;  2N9E B;  2ZCB A;  3AE7 B;  2RGF A;  2D3C A;  4C7Z A;  4GIV A;  2KMC A;  3KUZ A;  4W9K A;  4WWP A;  3NRZ A;  2J4X A;  1XF5 L;  4IOI E;  3AEC B;  1TY0 A;  1FPY A;  5MPO A;  2D10 A;  2KAC A;  4KSL C;  4NAW A;  2KJH B;  2N9K A;  1D3Z A;  2KX0 A;  1T0R C;  4CHK A;  2MJD A;  2MP2 B;  2JF5 A;  3MC8 A;  2KK8 A;  2NTT A;  4ASW C;  1TIF A;  2LI5 A;  1UH6 A;  5DPT A;  3VH3 B;  2RPQ A;  3TIX A;  3BWU D;  3DVG Y;  3L13 A;  3P1M A;  4HPL B;  4B95 A;  3AM9 A;  4EKU A;  3ZNG C;  1NEK B;  2MJ3 A;  5EE1 A;  2NVU I;  2LUM A;  4XYC A;  2KC2 A;  2OED A;  2LJ5 A;  3U30 A;  3MHZ A;  3P4S B;  2CS4 A;  3T9L A;  1SXT A;  2KHW B;  1FFV A;  2KDE B;  1I4P A;  4URK A;  2W54 A;  4IM2 A;  3KUD B;  2R2Q A;  3NS8 A;  1YQ3 B;  2MA9 B;  4L2Y A;  1E7U A;  2JSV X;  4ANU A;  1V80 A;  4EZJ A;  2JRI B;  2VRR B;  3ZUN A;  2D3B A;  2NMQ A;  2PE9 A;  1C78 A;  3RD2 A;  4A9A A;  2FAZ A;  3PSE B;  4H2A A;  2M0X A;  3H7S A;  4RM9 A;  1UWX A;  4ZDV A;  3FC4 A;  1QF6 A;  3NVV A;  3ZRF A;  3FKY A;  2AQ2 B;  4KGS A;  3OJ4 B;  3DVN U;  3HIZ A;  2DEN B;  3PLV A;  2NBV B;  5IKC M;  4W9F A;  3GZN B;  4I6N B;  5BMI A;  2K8H A;  3NJT A;  3IVF A;  4N6E B;  2WXG A;  1GG3 A;  3IAS 1;  4LNI A;  3L16 A;  3VTU A;  1UBQ A;  3A4S C;  3TEY A;  3C8Y A;  2PPH A;  1XCQ L;  3IG3 A;  1P9D U;  2WXF A;  2MJE A;  4FXC A;  1I42 A;  4HRS A;  2FCN A;  4KDL B;  4YL8 A;  1UD7 A;  2IGG A;  4MM3 A;  1SJH D;  3B0A A;  2JZ3 B;  4REZ A;  1EU4 A;  1GC6 A;  2D07 B;  3DBS A;  2M4N A;  1JW9 D;  2K8B A;  2LXC A;  2NBU A;  4J3O D;  1WX9 A;  2RD0 A;  3DBL B;  1QKZ A;  2NPT A;  2KDM A;  2GBK A;  2FUH B;  3RNF C;  4AJW A;  5L83 A;  2LXA A;  3B9J A;  2XK5 A;  3RYT A;  2FCQ A;  1MPE A;  1WR1 A;  4DDG D;  1D4B A;  1UNS A;  2AX5 A;  1J19 A;  1CZP A;  2RMM A;  4KGR A;  1TKG A;  5D2M B;  2FIF A;  4RGO S;  3QWZ B;  4LNN A;  3WAM A;  3URY A;  3M62 B;  3CWI A;  2RDH A;  1WY8 A;  2DAF A;  3PHW B;  1CMX B;  3R7R A;  2K39 A;  2L3Z A;  3PHX B;  2XNA C;  1T6B X;  3LYY A;  4HLE A;  2BT6 A;  2JPH A;  4LDT B;  1XCT L;  2LRW A;  3CMM B;  4BKS A;  4OZB A;  1IGC A;  2KWU B;  2QC8 A;  3TUO A;  5BO4 B;  1WZ3 A;  1VZ8 A;  3KWL A;  4WJN A;  4B9K A;  4US8 A;  4QAY A;  2ZW0 A;  3FAH A;  4P1B C;  3RNG C;  3VRA B;  4X57 B;  2ZPY A;  2L0F A;  3AE3 B;  4KKJ A;  2PW9 A;  2KZR A;  1STE A;  4RM8 A;  4ZRK A;  3RPF C;  3VXW A;  3HVD A;  3W5V B;  4JL9 A;  2DHZ A;  4ZHO A;  1F52 A;  2IO2 B;  1AN8 A;  3B2G A;  2J53 A;  2BB6 A;  1QOB A;  1OEY J;  5CHW A;  4MM3 B;  3AU5 A;  4TSS A;  3W1S C;  4JX1 C;  1F2R C;  1XLP A;  3AN1 A;  3I3T B;  3PTF C;  2G3Q B;  4M0W B;  1YD8 U;  2NPT B;  3GB1 A;  2PLP A;  5BYQ A;  4FAD A;  3MJ5 A;  2J0K A;  2XK5 B;  3U4E G;  1J0G A;  2DYO A;  5C23 A;  1I4G A;  2Z8L A;  2WWZ A;  2KFK A;  1JML A;  2GRI A;  3BVM A;  1CK1 A;  1IPG A;  3NZU A;  2DZM A;  4S0R A;  2JUO A;  1I4Q A;  3AE1 B;  3PLU A;  1R4N I;  4ITK A;  3APC A;  1XO3 A;  2L1A A;  3TEZ A;  2KD0 A;  2V4L A;  3ZIM A;  4XWT A;  3E9S A;  3MJW A;  4IKG A;  3U52 E;  2MH7 A;  2QEJ C;  2AWT A;  3VTW A;  1ROE A;  4M01 A;  3OG5 A;  4DHJ B;  1BUI C;  1WXV A;  3BYY B;  4D2K A;  4KZC A;  2G45 B;  1E9M A;  4FA6 A;  2M8S A;  2LZ6 A;  2ZJD A;  4I6L B;  5AZH A;  1V86 A;  4PK1 A;  2K6D B;  1N5X A;  4RF0 A;  4LDT D;  4XWW A;  1OEY A;  2WU5 B;  3DHI C;  4LLG M;  1YJ1 A;  3SEB A;  3WAN A;  4W9D A;  3RZW C;  2E3T A;  4PS7 A;  2WGS A;  2H88 B;  1CJE A;  2GBN A;  2BS2 B;  4A3P A;  5EE0 A;  1DYQ A;  1HTQ A;  2ZW1 A;  2D11 A;  4WJP A;  1AAR A;  2I2Y A;  4A3O A;  1ENF A;  2V3P A;  1AWD A;  1C79 A;  2EKE C;  1Q1O A;  4PS8 A;  3ENE A;  2ICI A;  3ZW3 A;  1F0Z A;  3MC9 A;  1A70 A;  1FMA D;  4K81 A;  5E6O A;  2DX5 B;  3LXF A;  4G50 A;  4OVU A;  1WGK A;  1ZXI A;  2BB5 A;  1UEL A;  2O6V D;  4GGQ A;  3AMZ A;  3RNC C;  2BVC A;  3GZN I;  2KWC A;  1OGW A;  2KFK B;  3KH0 A;  1ET6 A;  1ZP0 B;  1VRA B;  5IN7 A;  1WGR A;  4II3 B;  2IJ0 A;  1J7C A;  2C7M B;  4LNF A;  2B76 B;  4ZYN A;  1T0Y A;  4IW0 A;  1KF6 B;  3VR8 B;  2LVO A;  3P4R B;  2MSE D;  4W9J A;  1P98 A;  2LWP A;  4HXD A;  1UUP A;  2BKR B;  2RDG A;  4JE3 B;  2BBC A;  4HCN B;  1PDX A;  3PO0 A;  1TS5 A;  1PGB A;  1B1Z A;  5IOI A;  2INN E;  3APD A;  4DXG A;  2LMC A;  1IP9 A;  3DBL I;  4OZC A;  5AEK B;  3Q69 A;  1WZ0 A;  4XGA B;  2WXK A;  3EA6 A;  5J18 A;  2MBQ A;  1V8C A;  3TCA A;  4DHJ D;  1I7H A;  3DDC B;  3QHT A;  1DOI A;  4M8N A;  4AJY B;  3H9D A;  1MHH E;  2L83 A;  2Q5W D;  5E6P A;  1WXA A;  4HPM B;  1YN5 A;  1TZO A;  3C19 A;  1VD2 A;  3TMP B;  3WA0 A;  5C2T B;  1XEE A;  2IY0 B;  4WUR A;  1V2Y A;  3WAP A;  1FXI A;  2W3R A;  3Q2A C;  4XC2 A;  1LQB A;  4KDI C;  5HI1 A;  5DPW A;  1LGR A;  3Q3N C;  2WNM A;  3AEG B;  4HWI B;  1NBF C;  3HUI A;  2WX1 A;  1V9J A;  3EUB 2;  2HDE A;  1JAL A;  1WGD A;  2C5L C;  1E90 A;  1DOX A;  2KKC A;  1E10 A;  5G5H A;  5CTR C;  4W9H A;  4FJY A;  2B3A A;  2ONQ A;  2WXJ A;  3VQI A;  1FCC C;  1DOY A;  3DWG C;  1TKE A;  1LO5 D;  1LM8 B;  4AS1 A;  4YSX B;  4GMV A;  2LEK A;  5EDS A;  1SF0 A;  2BGF A;  1E8Z A;  3W2D A;  2JX5 A;  3RCZ A;  5HKH A;  3QAR A;  2JZP A;  1C4A A;  3QK0 A;  3QQ8 B;  1V49 A;  2Y5B B;  1WRI A;  1EWC A;  3OJ3 A;  3BK2 A;  3TEW A;  5DPR A;  1ZOY B;  3WCQ A;  4AP4 C;  2FE8 A;  1N62 A;  2EMT A;  2JWZ A;  3AI5 A;  1JWB D;  2QDF A;  3RZF A;  3MFG A;  4EZL A;  2KAN A;  3HHM A;  1N60 A;  4GN1 A;  3Q8E A;  1MJD A;  4IM0 A;  4HCP B;  1MG4 A;  2L00 B;  1F2R I;  1YJI A;  2CKH B;  2H89 B;  4L1B A;  1KLU D;  1HE8 A;  1UBI A;  4C00 A;  1KTK A;  2CJO A;  1FNV A;  3NVY A;  4ANV A;  3AB5 A;  3Q8A A;  4E71 A;  1R4N B;  2OHF A;  3W1Y A;  2J7Q B;  1WI0 A;  4TUU A;  1JQ4 A;  1RRB A;  2G9H D;  2FCM A;  2L52 A;  3WAO A;  2C7H A;  2SAK A;  2IBI B;  5HHD G;  3CIR B;  3HM6 X;  3DQV A;  4MJS A;  1QIL A;  2K5P A;  1WGY A;  4KGT A;  1SGH A;  4E74 A;  2AQ3 B;  2JYE A;  4WQM A;  3AH7 A;  4WJQ A;  5DPS A;  2CU3 A;  4ZRI A;  2Y5P A;  1WXQ A;  2FUG 1;  4FHJ A;  1YOV B;  1YX5 B;  4MDK E;  2G4D B;  2LUE A;  1E8W A;  2PVG C;  4EE2 A;  2GBR A;  1RFK A;  4KVG B;  3RN9 C;  4NNJ B;  3NS1 A;  3BYT B;  3TSS A;  1AYF A;  1JRU A;  2WXR A;  3ZVV A;  4HJK A;  1BML C;  1GNU A;  3IBE A;  4F8C B;  3QAQ A;  1C3T A;  3P63 A;  4B0E A;  1L0Y B;  3JYU A;  4ICU A;  1WF9 A;  3L4P A;  3P4P B;  4MGK E;  3PS6 A;  1XT9 B;  3A33 B;  3JSV A;  3VRB B;  1TS3 A;  2YEP F;  3ZTD A;  2JT4 B;  3TL5 A;  2X8X X;  2AL6 A;  2BS4 B;  4IWP A;  1OFF A;  3ZJT A;  2KVR A;  1WJN A;  1KH0 A;  1WFY A;  1WMH B;  3NG0 A;  1L7Y A;  1IGD A;  1KLG D;  1NYR A;  3R7Q A;  1VJK A;  4WH4 A;  3GS2 A;  5D7G A;  1ACC A;  1M94 A;  4IM3 A;  2BWF A;  1Y8R C;  2AEH A;  3L17 A;  2KLC A;  4OZA A;  4JLC A;  4P1C C;  1J7B A;  1WM3 A;  1EM7 A;  2HJ1 A;  2ON8 A;  4MJS B;  1FXA A;  2E6X A;  4ZOH C;  4FJV B;  5C1Z A;  2KC1 A;  5LXH A;  3X0W A;  2WHI A;  5BMH A;  2O6V A;  2R61 A;  1TY2 A;  3AXC A;  2WDQ B;  4C56 C;  4M0W A;  2IPK D;  1F1H A;  4O1N A;  4RF1 A;  3JVZ X;  1PGX A;  2JXX A;  4JGH B;  3PT2 B;  4JPS A;  4A90 A;  2NCN A;  2L05 A;  1RFA A;  4WWN A;  1WR6 E;  4NJ6 A;  2IO0 B;  3B08 A;  3W1S A;  3HK0 A;  1VCB A;  3ZNI D;  1L6V A;  1UGJ A;  1ZUD 2;  2A4Z A;  3RFZ B;  2DYM A;  1RYJ A;  1SEB D;  4ARI A;  4MH0 E;  2PE6 B;  3T3O A;  4RNA A;  2IDY A;  2V4I B;  3ZLZ A;  2ZZP B;  1WH3 A;  2WX0 A;  5E6N A;  4M02 A;  4DXA B;  5D3I B;  5JHB A;  4KSK C;  2FNJ B;  2KLG A;  2KDI A;  3R3M A;  3JSV B;  3HM3 A;  1L2N A;  3TJP A;  3AE5 B;  2YEP B;  4WAF A;  1YJJ A;  3HVZ A;  4GU2 A;  1RM6 C;  2QJL A;  4HRO A;  3V6E B;  4BBN F;  3RT3 B;  3ZJU A;  1Z2M A;  4C7Y A;  1MVK A;  3UI3 A;  3V62 A;  3CSF A;  3EGR A;  5JH5 C;  4HJG E;  3GE8 C;  2KNB A;  1IUE A;  1E8Y A;  4ZHP A;  3AUL A;  3Q8F A;  2K22 A;  5G2N A;  1FRD A;  1FNU A;  1TJE A;  1HZ6 A;  1TBE A;  4RMA A;  2V0G A;  3QA8 A;  2KTF A;  1FO4 A;  3X23 A;  1V1O A;  1R4M B;  3UQB A;  2BKF A;  4HDO A;  3L08 A;  2O6V B;  4BOZ B;  2DAJ A;  4DK5 A;  5CX3 A;  4TMA B;  2HTM E;  1Q0W B;  4GLS C;  3MP9 A;  3UIN B;  2VH2 A;  2OJW A;  5FR3 A;  2ZVO A;  4CYE A;  2LGS A;  3L0W B;  4II2 B;  4GDK A;  4BFR A;  2WS3 B;  1K8R B;  3U2S C;  3IHP C;  4LTU A;  4S17 A;  4BAX A;  4ZYS A;  2WLB A;  1K53 A;  4GDL A;  3Q3F A;  2HE7 A;  4RGM A;  1FRR A;  2W9N A;  1YQB A;  2WU2 B;  4EUT A;  1X1M A;  4A55 A;  1WSP A;  1WRD B;  4N58 A;  4RFB A;  2PJH A;  3C0R B;  4BBN C;  3GP7 A;  3EFC A;  2DBY A;  4IG7 B;  2L76 A;  4HK2 A;  3ZJV A;  3OAW A;  4OHJ A;  1I4H A;  4EOY A;  4HEA 1;  3DBR B;  5IA7 A;  4AOF A;  4OVV A;  1NI2 A;  2I38 A;  1WX8 A;  2KQ7 A;  4NAM A;  2VH1 A;  2JYT A;  3ML8 A;  3O65 B;  2WXL A;  2RSU A;  3LJ3 A;  4P16 A;  3M3J A;  5KHO A;  2HD5 B;  4A20 A;  3DHH C;  1L4D B;  4YTN B;  3VFK A;  3IAM 1;  1NYQ A;  2KN5 A;  3T8M A;  4EZK A;  3L54 A;  2KDB A;  4W9L A;  3ZXR A;  5BMG A;  3RUI B;  1RLF A;  2WDT B;  2D5G A;  1L6U A;  2BWE S;  3AEF B;  2BTE A;  4YTM B;  3EEC A;  3AEE B;  3EHV A;  1HQR D;  2KOX A;  1E5W A;  3A9J B;  2D3G A;  4P6V F;  1TS4 A;  2IO3 B;  1BT0 A;  4MEM A;  1MI0 A;  3VVW B;  4ANW A;  2XN9 C;  5BYR A;  1I4R A;  1XD3 B;  3BY4 B;  2JRH A;  4RH6 A;  4FN2 A;  2DNF A;  1V97 A;  3U7Z A;  2AL3 A;  3DHG C;  5TSS A;  3M63 B;  5TR5 A;  1D5M C;  4GDK B;  3AE9 B;  4K3C A;  2DLB A;  3H7P B;  4KIK B;  2BW2 A;  4GDL B;  1GB1 A;  1H4R A;  1C1Y B;  2BS3 B;  4JQW C;  3R2T A;  2L8J A;  2JXT A;  1K50 A;  3DVN V;  2R2O A;  4PS3 A;  2J42 A;  1I35 A;  1YN3 A;  1SSN A;  3N32 A;  2MHJ A;  2CHW A;  3A9K A;  2RR9 A;  1MFW A;  4IUM B;  3SFE B;  3UQA A;  3Q3O C;  1C4P A;  2INP E;  2PEA A;  2KX3 A;  2GLS A;  2N4F A;  3A1Q A;  2O2V A;  3PRZ A;  4M8M A;  1EUV B;  3ETR A;  2IYD B;  3L10 B;  2NS5 A;  1J8C A;  2L32 A;  4YWG G;  5EE3 A;  3KYC D;  2FCS A;  2REX A;  3KQ4 A;  5AZG A;  1JWS D;  3RUL A;  4K7S A;  1HTO A;  2GBM A;  2JQR B;  1JWA D;  1C4C A;  3W9C B;  4ZRP A;  2N0S B;  3PRP B;  1HA5 A;  2DZI A;  2Y5C A;  3BVZ A;  3WAL A;  2WXP A;  1OTR B;  1V5O A;  3R2I A;  1HZ5 A;  1YNT E;  1T0Q C;  1ZDV A;  4NJ7 A;  4ZRJ A;  2Y3A A;  4W9G A;  2ZNV C;  1PUT A;  4F1S A;  1GAQ B;  2LVQ A;  2J0M A;  3W5U B;  2KMM A;  3WIM A;  1VDV A;  3MHS D;  5BYS A;  2KJ6 A;  1OQQ A;  1RAX A;  1YMH E;  4G3X B;  1IBX A;  4WAA A;  2ZNV B;  1VR9 A;  4HKZ E;  2IO1 B;  3T3N A;  2UU7 A;  2YLM A;  1BXT A;  5LLI A;  1E7V A;  2LHE A;  1WGH A;  2SEB D;  3I9V 1;  1EO6 A;  1OQR A;  1KRH A;  2CU1 A;  3A9K B;  4GOC A;  1SE4 A;  4BZA A;  2GMI C;  4XDD A;  2GB1 A;  3UIO B;  3H6N A;  1V1P A;  3A1Q B;  2C9W B;  2O2V B;  3S2A A;  1R4M I;  2KFJ A;  1ESF A;  5H8Y E;  3ZDM C;  1TZ1 A;  4NY0 A;  4TV3 A;  2D3A A;  3PVL A;  4YT0 B;  1L0X B;  2K0P A;  3PGE A;  4F7Z A;  4C4V A;  4J6I A;  1P7F A;  2KTR A;  1SIJ A;  4K7U A;  4MAC A;  5IP4 D;  1H8C A;  2KAJ A;  2KVZ A;  2IGH A;  3ZNH B;  3H1U A;  1Z5S B;  4LJO B;  3IT4 B;  4MGZ E;  2N9P C;  3KVF B;  1VZ7 A;  2KDF B;  2KO3 A;  2PKO A;  1B9R A;  1T0S C;  1WMH A;  2KWV B;  1CQV A;  2N7D A;  2NR2 A;  1KLV A;  2WYQ A;  1V5T A;  4G11 A;  4TQ1 A;  1N63 A;  3DBR I;  1NI3 A;  1D5Z C;  1G6J A;  1QQR A;  3DBH B;  1IBX B;  1TS2 A;  2AQ1 B;  1PGA A;  4PYZ A;  4XE0 A;  5HFY A;  3NOB A;  3DCG A;  3APF A;  3I63 C;  3Q8C A;  3TEX A;  4DHZ B;  2LHD A;  2IY1 B;  3OLM D;  5KHQ A;  2QIL A;  5L95 C;  3UF8 A;  1K51 A;  4AQ7 A;  5I4D A;  1NEN B;  4WIP A;  5J2R A;  3QC8 B;  2M0A A;  4MGY E;  3ZO5 B;  3PPA A;  2KQS A;  2CR5 A;  3I5J C;  3V05 A;  2KJR A;  3NY5 A;  2XEW A;  1Y56 A;  2WXQ A;  2N7J A;  3BZD B;  3VTV A;  1V1P B;  1VLB A;  2QIE B;  1F77 A;  3N3K B;  1EF1 A;  3UIP B;  4YSZ B;  1HXY D;  1TGZ B;  1WXS A;  1KOT A;  2IZV B;  2KT7 A;  1YX6 B;  4C80 A;  1P7E A;  1WWT A;  3IFW B;  1P3Q U;  1L0V B;  4DBG A;  1FFU A;  4C4V B;  2KMA A;  2GBJ A;  2KTR B;  2MCN B;  4CO7 A;  5D3D A;  1QOA A;  3N9Y C;  2LGI A;  2LGY A;  4EFO A;  4B6W A;  2INC C;  4K3B A;  2MBE A;  1ZPS A;  3EC8 A;  4K7W A;  3EFU A;  3BII D;  4XDC A;  4FJZ A;  2QMT A;  4IWQ A;  3ZKJ C;  3ALB A;  3N30 A;  2LGD A;  3AED B;  3ZNZ B;  3J9C A;  5JHA A;  4MH8 A;  3PRE A;  2A5U A;  1TKY A;  2C7N B;  2QHO A;  4W9I A;  1P0R A;  3N1X C;  3AE2 B;  3NVZ A;  4MSM B;  2J52 A;  2VZK D;  4YXD B;  4MSQ B;  4GXB A;  4K1R B;  1TYG B;  2LRU A;  2YVC A;  1LXD A;  1FEH A;  2NBW B;  4NAW B;  1GPX A;  2V3N A;  4YSY B;  1ZE3 D;  1TT5 B;  2Z59 B;  2N9L A;  2K3U A;  2WP9 B;  4US9 A;  3ZTC A;  2I1K A;  3SR6 A;  2BPS A;  1E8X A;  2ACZ B;  2I1J A;  4IWO A;  4B0M A;  5C3J B;  3ML9 A;  3BK1 A;  4EEW A;  2MX2 A;  1DGJ A;  2K1F A;  4E3C A;  4RGT A;  1K52 A;  4DHZ E;  3Q3J A;  1F9J A;  4NZL B;  3AU4 A;  2BYT A;  1N5W A;  3P2B A;  3LDZ E;  2CJN A;  2BYV E;  2N9X A;  1QLB B;  3MTN B;  1GJZ A;  1C76 A;  1EU3 A;  2FBW B;  2ZCC A;  3VUY A;  3NVW A;  3MC0 B;  5D6J B;  4L23 A;  4ACF A;  4Q2J A;  2JWU A;  1D5X C;  3RNA C;  5FK9 C;  2EMS A;  4R3D A;  1SBB B;  1EWY C;  2GI9 A;  3PRM B;  4MT5 A;  2L0T A;  3ZDT A;  4HPP A;  1SE3 A;  2IGD A;  2RDB C;  4LNO A;  1I4X A;  2K6Q A;  3SHQ A;  3DWM A;  4TKN A;  3H8H A;  2C60 A;  1TTN A;  2OOB B;  4WWO A;  1FNW A;  2LD9 A;  1RWS A;  2EKI A;  1J7A A;  5LNK 1;  1S1Q B;  5H92 C;  4FUL A;  1UZX B;  3B2F A;  2JU6 X;  5T8I A;  4W9E A;  1E0Z A;  5D94 A;  2UWQ A;  1GC7 A;  1YQ4 B;  3GE3 C;  1A5R A;  4OW0 A;  1IYF A;  4MGI E;  5FKA C;  1WJU A;  3GOE A;  1FD6 A;  4WWM A;  2JY6 A;  3Q6B A;  2IND C;  1GB4 A;  3RNB C;  4LK0 M;  2WXO A;  3ZGZ A;  2WXH A;  2AYO B;  1WE6 A;  2KWD A;  3A9J A;  2X38 A;  3U7D A;  2ZEQ A;  3B1L X;  1SE9 A;  2MBO A;  1WJ6 A;  3VUX A;  4YTP B;  3KLS X;  5FR6 A;  2L7R A;  4WJO A;  4JWS C;  4KZ0 A;  2BF8 B;  2Z0E B;  2V1Y A;  3H7P A;  4KIK A;  1ISN A;  4ICV A;  2N1W A;  3KW5 B;  1FM0 D;  1WM2 A;  1XLQ A;  5GXG B;  2V3S A;  3CST A;  2PIA A;  5EE9 A;  3RMK C;  4G0N B;  3N20 C;  2UYZ B;  1WYW B;  1Q10 A;  1QZE A;  2DYB A;  2ASQ A;  4CQN A;  2MQJ A;  2XBB C;  2KYW A;  2TSS A;  3KWV A;  4XX5 A;  3P4Q B;  3ECI A;  1N6Z A;  3ZYY X;  3IXS A;  2J0J A;  4NPN A;  3DBH I;  5HG2 A;  3HRD D;  5DCN A;  3VHT C;  4P7I A;  1WXM A;  2KQ4 X;  3V3X A;  4XZ4 A;  1PFD A;  3PZ8 A;  3PZ7 A;  3VUW A;  3ABV B;  1D6E C;  1ZGU B;  3K9O B;  3VAW A;  4LCD E;  4HVB A;  4IDI A;  3AEB B;  3N1Y C;  1PQS A;  1WX7 A;  3D32 A;  2HTH A;  4N59 A;  1Q5W B;  1JWU D;  4ANX A;  2WXN A;  2K25 A;  1C77 A;  1JWM D;  2MWS B;  1ET9 A;  5AZF A;  1KJT A;  2K9X A;  2QCZ A;  2WXM A;  2N7E A;  4FHK A;  3QIJ A;  2LAS A;  5IAA C;  1V6E A;  5G5G A;  2DZJ A;  2FID A;  2OJR A;  1VZ6 A;  2MLB A;  3UGB B;  3NZS A;  2LVP A;  2KXJ A; 
#chains in the Genus database with same CATH homology
 3QAQ A;  3SDL C;  1C3T A;  4AUQ C;  2CU1 A;  2HJ8 A;  3A9K B;  4GOC A;  3JYU A;  4ICU A;  4X57 B;  1WF9 A;  3TBL D;  2GMI C;  3VDZ A;  2ZPY A;  2L0F A;  4MGK E;  3PS6 A;  1XT9 B;  3A33 B;  3JSV A;  2Z0D B;  2KZR A;  3UIO B;  1KM7 A;  4DDI D;  3H6N A;  3BIN A;  3KUC B;  3A1Q B;  4RM8 A;  4ZRK A;  2C9W B;  5GMV A;  2O2V B;  3S2A A;  3ZTD A;  1R4M I;  2KFJ A;  3VXW A;  2JT4 B;  3TL5 A;  3ZDM C;  4JL9 A;  4BOS C;  2DHZ A;  1TZ1 A;  4NQK E;  4AWJ A;  4NY0 A;  4TV3 A;  2AL6 A;  2IO2 B;  4IWP A;  1P1A A;  3PVL A;  2KVR A;  1WJN A;  1OEY J;  5CHW A;  1WFY A;  1WMH B;  2M1M A;  3AU5 A;  1L7Y A;  3PGE A;  4F7Z A;  3W1S C;  2D2Q A;  3R7Q A;  3I3T B;  3PTF C;  4J6I A;  2G3Q B;  2KTR A;  4K7U A;  5D7G A;  1H8C A;  1M94 A;  4M0W B;  4IM3 A;  4GB9 A;  1YD8 U;  2G4S A;  4NQL B;  1XQQ A;  3SD5 A;  2BYE A;  3V6C B;  2BWF A;  2NPT B;  1EF5 A;  3DPD A;  3ZNH B;  1Y8R C;  3H1U A;  4WQO B;  2AEH A;  3L17 A;  1Z5S B;  2KLC A;  4FAD A;  4LJO B;  2J0K A;  4MGZ E;  5CHF A;  2N9P C;  2XK5 B;  4JLC A;  1WM3 A;  1J0G A;  4MJS B;  4IC7 B;  2DYO A;  3KVF B;  2KDF B;  2KO3 A;  5C23 A;  3U8Z A;  1YIW A;  4FJV B;  1LFD A;  5C1Z A;  2KC1 A;  1WMH A;  5LXH A;  2WWZ A;  3X0W A;  2KWV B;  2KFK A;  2O6V A;  2N7D A;  2NR2 A;  3AXC A;  1IPG A;  2MBH A;  3M95 A;  3NHE B;  2WYQ A;  3NZU A;  1KLV A;  2DZM A;  1V5T A;  4G11 A;  2JUO A;  4TQ1 A;  3DBR I;  3PLU A;  4FBJ B;  1R4N I;  1WIA A;  3APC A;  3JVZ X;  2CHX A;  2JXX A;  3SU8 X;  3PV1 A;  5G55 A;  1G6J A;  2KD0 A;  4JGH B;  3PT2 B;  2V4L A;  3ZIM A;  3MJW A;  2NCN A;  2L05 A;  3R66 C;  1RFA A;  2DZK A;  4PYZ A;  3QX1 A;  2AWT A;  4HDQ A;  4BKS D;  4WWN A;  1ZW7 A;  1WR6 E;  3VTW A;  4NJ6 A;  2IO0 B;  3B08 A;  3W1S A;  3NOB A;  3HK0 A;  4BVU C;  1V81 A;  3DCG A;  4N9F 4;  4DHJ B;  3APF A;  1WXV A;  1VCB A;  3ZNI D;  2GOW A;  2MRP A;  3KYD D;  2A4Z A;  4KZC A;  2DYM A;  3ZRC A;  4DHZ B;  2IY1 B;  2G45 B;  3OLM D;  4DWF A;  5KHQ A;  3UF8 A;  5L95 C;  4FA6 A;  2M8S A;  4MH0 E;  2ZPN A;  2LZ6 A;  2ZJD A;  2PE6 B;  4I6L B;  5AZH A;  3CF6 E;  3ZLZ A;  2ZZP B;  1WH3 A;  2WX0 A;  5J2R A;  3QC8 B;  1V86 A;  5E6N A;  5LXI B;  4MGY E;  4DXA B;  3ZO5 B;  5JHB A;  3PPA A;  2KQS A;  1ZKH A;  2FNJ B;  3QCA A;  2K6D B;  2ZVN A;  4KSK C;  2KLG A;  3PZD A;  4GSW A;  2CR5 A;  2KDI A;  2KJR A;  1OEY A;  2XEW A;  3NY5 A;  4LDT D;  3R3M A;  3JSV B;  3HM3 A;  1YJ1 A;  3WAN A;  1L2N A;  3VTV A;  4W9D A;  3TJP A;  3RZW C;  3JW0 X;  3K9P B;  4PS7 A;  2MP2 A;  3N3K B;  1EF1 A;  3UIP B;  4GU2 A;  1TGZ B;  1WXS A;  1KOT A;  2GBN A;  2IZV B;  2MW5 A;  3V6E B;  4A3P A;  4BBN F;  1YX6 B;  3RT3 B;  4BKG A;  2D11 A;  1Z2M A;  4WJP A;  1OQY A;  1AAR A;  3IFW B;  1P3Q U;  4I6P A;  4A3O A;  4DBG A;  2N1V A;  4PYU A;  3V61 A;  1FXT B;  2KMA A;  3V62 A;  2GBJ A;  2EKE C;  3CSF A;  3V60 A;  2KTR B;  2MCN B;  5JH5 C;  2CHZ A;  1Q1O A;  2BYF A;  4PS8 A;  2KNB A;  4CO7 A;  1E8Y A;  1WE7 A;  3AUL A;  3ENE A;  5JZE B;  1U4A A;  2LGY A;  5G2N A;  3ZW3 A;  3A4R A;  4EFO A;  1MG8 A;  2JVC A;  4B6W A;  3DOW A;  4K81 A;  5E6O A;  1TBE A;  2MBE A;  4RMA A;  3EC8 A;  1GUA B;  2DX5 B;  4W9C A;  3QA8 A;  4G50 A;  4K7W A;  4OVU A;  4BKT A;  2KTF A;  3EFU A;  4TQ0 A;  1UEL A;  2O6V D;  4GGQ A;  3X23 A;  1NDD A;  4FJZ A;  3UQB A;  3GZN I;  4IWQ A;  2BKF A;  3ALB A;  4HDO A;  3N30 A;  2LGD A;  2KWC A;  1OGW A;  2KFK B;  2O6V B;  3KH0 A;  3L08 A;  4MEL A;  4BOZ B;  3ZNZ B;  2DAJ A;  1S3S G;  5J17 A;  5JHA A;  4DK5 A;  1WGR A;  3PRE A;  4FLH A;  2A5U A;  4II3 B;  5CX3 A;  2MBB B;  2C7M B;  2C7N B;  5CHV C;  1Q0W B;  1WGG A;  2QHO A;  1UGM A;  3QJZ A;  4JIO U;  2M17 A;  4W9I A;  1P0R A;  4ZYN A;  3UIN B;  1T0Y A;  4MSM B;  4IW0 A;  2ZVO A;  3ONS A;  4CYE A;  3L0W B;  4LJP B;  1SIF A;  2JZZ A;  4II2 B;  2LVO A;  4GDK A;  4GXB A;  4K1R B;  4MSQ B;  4BFR A;  1K8R B;  2LRU A;  2MSE D;  1P98 A;  3DVG X;  2YVC A;  2K8C A;  1LXD A;  2LWP A;  3IHP C;  4HXD A;  2LGX A;  2NBW B;  4KV2 A;  2BKR B;  4NAW B;  4GDL A;  3VH4 B;  3Q3F A;  2HE7 A;  4HCN B;  2Z59 B;  2W9N A;  1YQB A;  1WJ4 A;  2N9E B;  2ZCB A;  4EUT A;  1X1M A;  2RGF A;  3ZTC A;  1WRD B;  4GIV A;  2I1K A;  2KMC A;  3KUZ A;  2BPS A;  1E8X A;  4W9K A;  4WWP A;  2PJH A;  2I1J A;  4IWO A;  3C0R B;  4BBN C;  3ML9 A;  4IG7 B;  2L76 A;  3APD A;  4HK2 A;  1IP9 A;  3DBL I;  3OAW A;  4EEW A;  2MX2 A;  4EOY A;  5AEK B;  1WZ0 A;  2K1F A;  4E3C A;  5J18 A;  2MBQ A;  2D10 A;  3TCA A;  4KSL C;  4DHZ E;  5IA7 A;  4DHJ D;  3Q3J A;  4NAW A;  1F9J A;  3DDC B;  2KJH B;  4AOF A;  3AU4 A;  4OVV A;  1NI2 A;  2KX0 A;  3QHT A;  3P2B A;  3LDZ E;  4CHK A;  4M8N A;  1D3Z A;  2MP2 B;  4AJY B;  2JF5 A;  1WX8 A;  3H9D A;  2KK8 A;  2KQ7 A;  2BYV E;  2N9X A;  3MTN B;  4W9J A;  1GJZ A;  3ML8 A;  2ZCC A;  1WXA A;  3O65 B;  5E6P A;  4HPM B;  3VUY A;  4ASW C;  2LI5 A;  1UH6 A;  5DPT A;  3VH3 B;  2RPQ A;  3TIX A;  1VD2 A;  3TMP B;  5D6J B;  2RSU A;  3WA0 A;  3DVG Y;  3LJ3 A;  3L13 A;  2IY0 B;  4HPL B;  4B95 A;  1V2Y A;  3M3J A;  3WAP A;  5KHO A;  2HD5 B;  4A20 A;  4EKU A;  3ZNG C;  2EMS A;  4XC2 A;  2NVU I;  1LQB A;  3VFK A;  2KC2 A;  2LJ5 A;  4KDI C;  3U30 A;  2KN5 A;  3T8M A;  2CS4 A;  4EZK A;  3T9L A;  3PRM B;  3L54 A;  2KHW B;  2KDE B;  5DPW A;  4URK A;  2L0T A;  2KDB A;  4IM2 A;  4W9L A;  3ZDT A;  3KUD B;  3RUI B;  1RLF A;  2R2Q A;  2WDT B;  2K6Q A;  3NS8 A;  2MA9 B;  3SHQ A;  4HWI B;  1NBF C;  2BWE S;  1E7U A;  1V9J A;  2WX1 A;  4TKN A;  4ANU A;  2C60 A;  3EEC A;  1V80 A;  1TTN A;  3EHV A;  2JRI B;  4EZJ A;  2OOB B;  4WWO A;  1WGD A;  2KOX A;  2VRR B;  1E5W A;  3ZUN A;  2C5L C;  2D3G A;  3A9J B;  1E90 A;  2KKC A;  2LD9 A;  2IO3 B;  2PE9 A;  4FJY A;  4W9H A;  5CTR C;  1BT0 A;  4MEM A;  2B3A A;  3VVW B;  3RD2 A;  4ANW A;  3VQI A;  1S1Q B;  4FUL A;  1XD3 B;  3BY4 B;  2FAZ A;  1UZX B;  3PSE B;  2JRH A;  2M0X A;  4FN2 A;  4W9E A;  3H7S A;  4RM9 A;  2AL3 A;  5D94 A;  2UWQ A;  5TR5 A;  3M63 B;  4ZDV A;  1GC7 A;  4GDK B;  1A5R A;  1IYF A;  4MGI E;  1WJU A;  3GOE A;  3H7P B;  4KIK B;  3ZRF A;  2JY6 A;  4GDL B;  1LM8 B;  4GMV A;  2AYO B;  5EDS A;  2BGF A;  1WE6 A;  3A9J A;  1E8Z A;  1H4R A;  3U7D A;  1C1Y B;  2ZEQ A;  3RCZ A;  3B1L X;  5HKH A;  1SE9 A;  3QAR A;  4JQW C;  3OJ4 B;  3DVN U;  3HIZ A;  3QK0 A;  2DEN B;  2L8J A;  2MBO A;  3PLV A;  3QQ8 B;  1WJ6 A;  3VUX A;  2NBV B;  1V49 A;  2Y5B B;  4W9F A;  5FR6 A;  3DVN V;  2L7R A;  3OJ3 A;  4I6N B;  2R2O A;  4PS3 A;  5DPR A;  4AP4 C;  2K8H A;  4WJO A;  1I35 A;  3IVF A;  4KZ0 A;  2EMT A;  1GG3 A;  2BF8 B;  2JWZ A;  2Z0E B;  3AI5 A;  3N32 A;  2CHW A;  2V1Y A;  2RR9 A;  3A9K A;  3H7P A;  4KIK A;  1ISN A;  4IUM B;  3RZF A;  4ICV A;  4EZL A;  3UQA A;  2N1W A;  3KW5 B;  2KAN A;  3HHM A;  3L16 A;  3VTU A;  2PEA A;  1UBQ A;  1WM2 A;  4GN1 A;  2V3S A;  2KX3 A;  3A4S C;  2N4F A;  3CST A;  3A1Q A;  2O2V A;  3PRZ A;  4IM0 A;  4HCP B;  2L00 B;  2PPH A;  3IG3 A;  4M8M A;  1EUV B;  1P9D U;  2IYD B;  2CKH B;  3L10 B;  1I42 A;  2NS5 A;  4G0N B;  1J8C A;  1HE8 A;  1UBI A;  2UYZ B;  3KYC D;  1WYW B;  1QZE A;  2DYB A;  2FCS A;  2FCN A;  2REX A;  4KDL B;  4ANV A;  2ASQ A;  4YL8 A;  1UD7 A;  4MM3 A;  2MQJ A;  5AZG A;  2XBB C;  3B0A A;  2JZ3 B;  3RUL A;  4E71 A;  4XX5 A;  1GC6 A;  4K7S A;  2D07 B;  3DBS A;  3ECI A;  2M4N A;  2GBM A;  3W1Y A;  2K8B A;  2LXC A;  2NBU A;  2J7Q B;  2J0J A;  1WX9 A;  1WI0 A;  2RD0 A;  4NPN A;  4TUU A;  3DBH I;  1RRB A;  5DCN A;  2NPT A;  3VHT C;  3PRP B;  1WXM A;  4P7I A;  2GBK A;  2FUH B;  4AJW A;  4XZ4 A;  2DZI A;  2FCM A;  5L83 A;  3WAO A;  3WAL A;  1OTR B;  2LXA A;  2C7H A;  1V5O A;  2IBI B;  2XK5 A;  3RYT A;  2FCQ A;  3VUW A;  4NJ7 A;  4ZRJ A;  3HM6 X;  3DQV A;  1WR1 A;  4MJS A;  4W9G A;  4DDG D;  1WGY A;  2ZNV C;  1ZGU B;  4B9K A;  3K9O B;  3VAW A;  1SGH A;  4E74 A;  1J19 A;  4LCD E;  4HVB A;  4F1S A;  5D2M B;  1PQS A;  2FIF A;  1WX7 A;  2LVQ A;  4WJQ A;  5DPS A;  2J0M A;  3QWZ B;  3WAM A;  3D32 A;  4ZRI A;  3WIM A;  2HTH A;  4FHJ A;  3MHS D;  1Q5W B;  1YX5 B;  4MDK E;  3M62 B;  2G4D B;  2KJ6 A;  2LUE A;  1E8W A;  1WY8 A;  2DAF A;  3PHW B;  4ANX A;  1CMX B;  3R7R A;  2K25 A;  1RAX A;  2K39 A;  2L3Z A;  2GBR A;  3PHX B;  4G3X B;  2MWS B;  5AZF A;  4WAA A;  1KJT A;  2ZNV B;  4KVG B;  3ZKJ C;  4HLE A;  4NNJ B;  2N7E A;  4FHK A;  2JPH A;  4LDT B;  2LRW A;  3CMM B;  3QIJ A;  2LAS A;  2IO1 B;  4BKS A;  5IAA C;  2YLM A;  1JRU A;  1V6E A;  2DZJ A;  2FID A;  2OJR A;  5LLI A;  1E7V A;  4HJK A;  2MLB A;  3ZVV A;  2KWU B;  1WGH A;  3UGB B;  3NZS A;  1GNU A;  3IBE A;  1EO6 A;  2LVP A;  5BO4 B;  1WZ3 A;  2KXJ A;  4WJN A;  4F8C B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...