2BYEA

Nmr solution structure of phospholipase c epsilon ra 1 domain
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
110
structure length
110
Chain Sequence
GEERKCLQTHRVTVHGVPGPEPFTVFTINGGTKAKQLLQQILTNEQDIKPVTTDYFLMEEKYFISKEKNECRKQPFQRAIGPEEEIMQILSSWFPEEGYMGRIVLKTQQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lipase
molecule keywords PHOSPHOLIPASE C, EPSILON 1
publication title Structural and Mechanistic Insights Into Ras Association Domains of Phospholipase C Epsilon.
pubmed doi rcsb
source organism Homo sapiens
total genus 13
structure length 110
sequence length 110
ec nomenclature ec 3.1.4.11: Phosphoinositide phospholipase C.
pdb deposition date 2005-08-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2byeA01
1SE9A 1V86A 2FCMA 1WR6E 4GN1A 2WX0A 4FHKA 2FAZA 4BKGA 5D7GA 1TBEA 1Z5SB 4GMVA 2WWZA 3H7PB 2KZRA 3HK0A 2GOWA 2Z0EB 3APFA 4EEWA 1WJ6A 1QZEA 1TGZB 1E5WA 1WJNA 3TL5A 3GZNI 4G50A 4KZCA 4KV2A 1I35A 4DBGA 4IM2A 4X57B 4AJYB 1V2YA 1UELA 3VQIA 1MG8A 3PLVA 2FCQA 4FULA 2RD0A 2KDFB 2JT4B 1P98A 2W9NA 2KXJA 3A9JA 4F8CB 4FADA 5DPWA 4JGHB 3TIXA 1WE7A 2EMTA 4MELA 5E6NA 4JL9A 2LVPA 3IBEA 4CHKA 1PQSA 3X23A 1WMHB 3KYCD 1RAXA 3KVFB 4AWJA 1E7VA 3APDA 4GDLA 4KDLB 3DCGA 1IP9A 3JSVB 5JHAA 4HPMB 4F7ZA 2FCSA 2MCNB 3V60A 2NPTB 1C3TA 2L7RA 4DHZE 4MM3A 3LDZE 3M95A 1KJTA 2D11A 2M1MA 4BBNF 4YL8A 5AEKB 3N30A 2C5LC 2N7DA 4URKA 1NBFC 2HTHA 3IFWB 3SDLC 2BYEA 4K81A 3ZUNA 2KTFA 3SU8X 3DBRI 1XT9B 2ASQA 2M4NA 2O6VB 2AL6A 3JYUA 3TCAA 2O2VA 2GBMA 2J0JA 3QWZB 2ZCBA 3VTWA 3QJZA 4IUMB 1RLFA 3K9PB 3PRMB 3DVGY 2MBOA 3WA0A 4TUUA 3VHTC 5BO4B 2DZMA 2KWCA 4RM8A 2CHZA 4B95A 1E8WA 2FIDA 2MA9B 1WJUA 1D3ZA 5HKHA 2Z0DB 4HK2A 2A4ZA 3A1QB 1TTNA 2JXXA 2LUEA 3QARA 5DPTA 4HCNB 2KVRA 4W9JA 4OVVA 1CMXB 4NJ6A 1KOTA 5E6OA 3U8ZA 2IO2B 4I6NB 4TV3A 3ZNHB 2UYZB 5E6PA 3H9DA 5D2MB 1LM8B 2KFKB 3IHPC 2LASA 1UD7A 4WWPA 4W9HA 3OJ4B 5D6JB 3DQVA 2KTRB 2ZJDA 4FJZA 4BKSD 2KC2A 2K8HA 4HLEA 2PE9A 2NCNA 2PPHA 2LJ5A 1H4RA 2HD5B 2GBJA 3AXCA 4NAWB 5DCNA 3V62A 4DHJD 3D32A 4FJVB 4MJSB 2LXCA 1WH3A 5J2RA 4A3PA 2HJ8A 1Q0WB 2MQJA 1WGDA 3RYTA 1WGYA 3VFKA 1NDDA 2G4SA 3R7QA 2GBRA 3HM3A 2KFJA 4W9GA 3SD5A 3W1SA 2C7MB 4NY0A 3ZNGC 2LD9A 4FJYA 2DYOA 4MDKE 4EFOA 4MEMA 3RULA 2MBQA 2LGXA 3QCAA 4N9F4 5C1ZA 1RRBA 1J19A 2RSUA 3SHQA 3HHMA 2BYFA 4KVGB 3DBHI 1WIAA 4WWNA 2RGFA 3U7DA 3UIPB 2LRUA 1E90A 4WJOA 2GMIC 3A9KB 2JUOA 4E3CA 5IA7A 2LVQA 3ZVVA 3KUCB 3OAWA 3VXWA 2CKHB 2B3AA 2BGFA 2KKCA 3A4SC 3ZTCA 4GB9A 1V6EA 4GOCA 4AP4C 2G3QB 5DPSA 1Z2MA 2LZ6A 3VH4B 2GBNA 2KJ6A 4NJ7A 2REXA 2KJRA 3AULA 2CHWA 3V6CB 5EDSA 3PLUA 2NBVB 2BWES 2KOXA 4JIOU 4J6IA 4FN2A 5CHWA 1V5OA 2L3ZA 3DDCB 4GXBA 2MLBA 3VAWA 1WI0A 2KNBA 2KLCA 2IY0B 2BYVE 3CSFA 4BFRA 4BOZB 4WAAA 1GJZA 5CHVC 2BKFA 2RPQA 2KJHB 5DPRA 3L0WB 1WX7A 5L95C 2IZVB 3ZNZB 1J0GA 2L0FA 3EFUA 3GOEA 3ONSA 2KMCA 2NBWB 2JY6A 4IC7B 1E7UA 3VUXA 2PE6B 4KIKA 2FNJB 5JH5C 2D2QA 4G3XB 3W1YA 3JVZX 3VDZA 2M17A 3CF6E 4DDID 3H1UA 2LWPA 3DBSA 1YX6B 3S2AA 2L00B 2AWTA 2KC1A 2V4LA 4LJOB 4GGQA 2ZNVC 3NZSA 3RCZA 2DZKA 3WAPA 4XC2A 3L16A 3QQ8B 4W9CA 3DPDA 1U4AA 2LGDA 3B08A 3PRZA 3RT3B 1WGGA 3H7SA 2YLMA 4E74A 4EZLA 4EKUA 4IM0A 4F1SA 3DBLI 2IY1B 4WJQA 2XK5B 2KLGA 4PS7A 4MSQB 4DHJB 2C7NB 4DDGD 5CTRC 3ENEA 3QAQA 3R66C 3M3JA 5G55A 3TMPB 4MGZE 3RD2A 4WJPA 1EF5A 3N3KB 4EZKA 2L76A 3H7PA 2N9PC 4WJNA 2KQ7A 2V3SA 4FHJA 4KDIC 4TQ1A 4ANUA 3CMMB 1YJ1A 1Y8RC 2FUHB 4IG7B 3C0RB 2YVCA 4K7WA 3WAMA 1BT0A 1Q1OA 3A4RA 2LI5A 1KLVA 3W1SC 4B6WA 3X0WA 4ASWC 1YX5B 2HE7A 2K6QA 1YD8U 2MRPA 3AU5A 4AJWA 1E8ZA 1GC7A 3LJ3A 3ZIMA 3PTFC 4XZ4A 1SIFA 2MP2A 3UINB 4KSLC 3IG3A 1EUVB 2K25A 4PS8A 1WMHA 4GDKB 5LLIA 4W9EA 1FXTB 1WXVA 3ZKJC 2ZVOA 3JSVA 4BBNC 3TJPA 2GBKA 2DX5B 3DVNV 3L08A 1GUAB 2NPTA 4FBJB 1GC6A 2M8SA 2CHXA 1WFYA 1WGRA 1WJ4A 2N1WA 4A20A 4CO7A 4PYZA 4BOSC 1YIWA 5LXHA 3OJ3A 2I1JA 4DWFA 2MBBB 3ML9A 3V6EB 2KK8A 2O6VA 4M8NA 3JW0X 1WXSA 4GSWA 3UGBB 2BKRB 3ZDMC 3UF8A 1NI2A 4KSKC 1IYFA 1UH6A 4II3B 2KX3A 2K8BA 5AZFA 1P9DU 4W9LA 3VVWB 2C9WB 2KDBA 1S1QB 2C7HA 2Z59B 2D3GA 3A9JB 3IVFA 3NOBA 4BVUC 2MX2A 5CHFA 2MSED 1P0RA 5AZHA 1WF9A 4K7UA 2JF5A 1X1MA 4GDLB 3UQBA 2RR9A 4KIKB 4IWOA 1V49A 3OLMD 3DVGX 1OEYJ 2FIFA 4IWQA 5FR6A 3P2BA 3B1LX 3QA8A 2KN5A 3QIJA 4IWPA 1LFDA 2A5UA 2ZPYA 2BPSA 3VUWA 5KHQA 3HIZA 3ZW3A 4LDTD 2ZPNA 2KFKA 2MBHA 1WXAA 1R4NI 4LJPB 4MGIE 4MH0E 3ZNID 3B0AA 3NS8A 1WX9A 2KTRA 2O2VB 4HJKA 2MW5A 2N7EA 1TZ1A 2OJRA 2R2OA 3KUZA 1OGWA 4EZJA 1I42A 3KH0A 1GNUA 2K8CA 4JLCA 2AEHA 2MBEA 4NAWA 5J18A 2Y5BB 1P3QU 1V80A 2XBBC 5KHOA 3PPAA 2NVUI 3ZO5B 2I1KA 4B9KA 1OTRB 5L83A 1HE8A 2LVOA 2CU1A 1LXDA 2ZZPB 5LXIB 3H6NA 1WM2A 1AARA 5GMVA 4ZRKA 2IBIB 3VUYA 2ZNVB 3Q3JA 1WE6A 3AU4A 1R4MI 3PS6A 4HVBA 3ECIA 2VRRB 4II2B 4ANVA 2KX0A 1H8CA 2K6DB 3HM6X 3I3TB 1V5TA 4MGYE 3U30A 3ZRFA 1WR1A 4GU2A 4BKTA 4WQOB 1GG3A 5CX3A 2DAFA 1KM7A 2J7QB 1UBIA 4TQ0A 1WYWB 4HWIB 2EKEC 2DYBA 2K1FA 2OOBB 3A9KA 3T9LA 3RZFA 1XQQA 2MP2B 1OQYA 1F9JA 1LQBA 4PS3A 2KO3A 2WX1A 1UZXB 4P7IA 3DOWA 2DENB 2L8JA 3DVNU 1ZW7A 3M63B 3MTNB 2EMSA 3VH3B 4NQKE 3PT2B 3EC8A 2DZJA 2M0XA 2BWFA 3A33B 4ZRJA 3WAOA 1V81A 1A5RA 2NBUA 4JQWC 3QC8B 4HXDA 4NNJB 3VTVA 2IYDB 4ZDVA 2IO0B 4I6LB 2ZVNA 2BF8B 3KUDB 4K1RB 1V9JA 2FCNA 4MGKE 1WGHA 3M62B 4G0NB 4RMAA 3KW5B 1T0YA 2KD0A 3NY5A 3K9OB 4EUTA 2J0MA 5TR5A 3R3MA 4IM3A 2ZEQA 2ZCCA 2K39A 3NZUA 3TBLD 2MWSB 1WRDB 2N9EB 2LGYA 1G6JA 3NHEB 3L54A 1E8XA 3RZWC 5JZEB 2KDEB 2G45B 4M8MA 3KYDD 3QX1A 2D07B 1S3SG 4DK5A 2KDIA 3PREA 3CSTA 4NPNA 3ZRCA 4NQLB 2D10A 3ALBA 3ZDTA 4ANWA 2IO3B 2LXAA 2UWQA 4I6PA 3ML8A 1ISNA 2O6VD 1EO6A 2C60A 2PJHA 4ICVA 3WANA 2NS5A 3O65B 3PGEA 3PSEB 4HPLB 2AL3A 4TKNA 2L05A 3RUIB 2KWVB 3APCA 5G2NA 2JZZA 1EF1A 5AZGA 2LRWA 4DHZB 2JRHA 1SGHA 4M0WB 4FA6A 2JPHA 2QHOA 4LDTB 4G11A 4K7SA 4MSMB 3WALA 3UQAA 1YQBA 5J17A 1WXMA 2KQSA 3EHVA 4E71A 2N9XA 3N32A 3PHXB 4ZRIA 1IPGA 1ZGUB 3BY4B 4BKSA 1K8RB 1JRUA 2G4DB 4PYUA 2JRIB 1P1AA 4KZ0A 3ZTDA 2XK5A 4AUQC 4W9IA 2KMAA 4ANXA 1J8CA 3AI5A 1C1YB 2KANA 2WYQA 4W9DA 3MHSD 4RM9A 3QHTA 4AOFA 3A1QA 3PV1A 3QK0A 1UBQA 1WZ0A 3PVLA 2JZ3B 4DXAB 4A3OA 4HDOA 2XEWA 4W9FA 1M94A 2N1VA 4HCPB 3WIMA 1Q5WB 1L7YA 4IW0A 2KWUB 3PZDA 2DAJA 2JWZA 3L13A 3Q3FA 3V61A 1WM3A 3BINA 1WZ3A 5D94A 1XD3B 5JHBA 4ZYNA 1OEYA 4CYEA 2V1YA 2WDTB 4ICUA 2CR5A 2L0TA 3PRPB 4WWOA 1UGMA 2PEAA 2KHWB 4GIVA 4HDQA 1RFAA 2R2QA 3MJWA 3PHWB 4W9KA 2NR2A 2J0KA 2JVCA 4FLHA 5C23A 5IAAC 3T8MA 1VCBA 1VD2A 1E8YA 3R7RA 2DHZA 2DZIA 2IO1B 1WY8A 1ZKHA 2AYOB 3VTUA 4GDKA 4MJSA 3L17A 1L2NA 3UIOB 3EECA 2CS4A 1WX8A 3L10B 4OVUA 4XX5A 4EOYA 4LCDE 3ZLZA 2N4FA 2DYMA
chains in the Genus database with same CATH superfamily
1V86A 1YN3A 4BKGA 2WWZA 3H7PB 2KZRA 2Z0EB 4EEWA 1TGZB 4HJGE 3AE9B 4JE3B 3GZNI 4G50A 4RNAA 1I35A 2BT6A 2V3NA 4X57B 4AJYB 2M56B 2RD0A 2JT4B 1P98A 3VR8B 2OHFA 1P7EA 4FADA 1UUPA 3P4RB 1V1PB 5HHDG 3SFEB 1T0SC 3KYCD 3APDA 3DCGA 2INPE 3DBLB 2V3PA 3B2GA 2MCNB 3I9V1 3NJTA 3AN1A 3LDZE 4CQNA 5AEKB 2ICIA 1HQRD 2C5LC 4URKA 2Q5WD 2HTHA 4C4VB 3AE4B 3N1ZC 1XT9B 3JYUA 1F52A 3TCAA 5EE3A 2ZCBA 4IUMB 3ABVB 3PRMB 3C19A 4D2KA 1D5MC 3NUHB 2MBOA 3WA0A 3VHTC 5BO4B 2DZMA 1T5XD 3HRDD 4N59A 3RNBC 4HK2A 1SE3A 1TTNA 2LUEA 1I7HA 3QARA 4YSXB 3AECB 2LFIA 4OZAA 4W9JA 1V1OA 4P1BC 2J42A 4ZYSA 1ZUD2 4WQMA 4RF1A 1MHHE 1C78A 2M19A 2K8HA 1F2RI 1JWAD 2PE9A 2HD5B 3AXCA 4NAWB 4FJVB 3U4EG 5J2RA 4A3PA 2HJ8A 3RNAC 1AW7A 3AE5B 1WYGA 2G1EA 3RYTA 1SXTA 3VFKA 1NDDA 1TJEA 3HM3A 3ZQ4A 3Q8CA 2LD9A 2WXOA 2DYOA 4EFOA 4IKGA 1RRBA 1SE2A 1WIAA 3U7DA 4WJOA 1WXQA 2JUOA 5IA7A 1PGAA 2B3AA 2KKCA 3CIRB 5DPSA 2LZ6A 1XCTL 4FN2A 1SB3C 2MLBA 1HEZE 2WXRA 2BYVE 4HRSA 5G5GA 2BKFA 2RPQA 2IZVB 2PTLA 2BW2A 3CWIA 2WGSA 1JMLA 5FKAC 3RMKC 2JY6A 3VUXA 1E7UA 5JH5C 2FNJB 3JVZX 3VDZA 3DHGC 5IKCM 2LWPA 3DBSA 1TY0A 2AWTA 2KC1A 4LJOB 4GGQA 1ZXHA 2ZNVC 4XC2A 3Q2AC 2XN9C 3DPDA 2LGDA 2J52A 3H7SA 3O13A 4EKUA 1JW9D 4IM0A 5G55A 4RGNA 4GLSC 2EELA 4JWSC 4EZKA 4ITKA 3H7PA 4ANUA 4OW0A 2L83A 1JROA 2FUHB 3C0RB 1CQVA 4K7WA 1Q1OA 3A4RA 1SSNA 1ZOYB 4B6WA 2K6QA 1YD8U 1J7CA 3DHHC 2MP2A 1T0RC 3AE1B 1V1PA 1EUVB 3P42A 1C4CA 4GDKB 1VZ7A 1FXTB 2H89B 4PT5A 3ZKJC 1V97A 1N60A 4BBNC 3TJPA 2L32A 4N6EB 1YJIA 4N58A 2J53A 1WFYA 1WGRA 1WJ4A 4A20A 2OEDA 4C4VA 1D5ZC 2I1JA 4UDUC 3E9SA 4S17A 1ROEA 4GSWA 1HTOA 2WXLA 2BKRB 3ZDMC 1NI2A 1IYFA 1P9DU 3VR9B 3VVWB 3SR6A 3NOBA 2KDBA 3V05A 1YQ4B 2QMTA 1E7PB 3AEGB 1X1MA 2RR9A 1TKEA 2YEPB 1V49A 3DVGX 2FIFA 1ENFA 3P2BA 3QA8A 2KN5A 3GS2A 4A9AA 3QIJA 4IWPA 4MM3B 1MI0A 4C80A 3HIZA 4LDTD 4LJPB 1WXAA 1HZ6A 2ONQA 3NS8A 1R4MB 4YXDB 2K0PA 2O2VB 2IJ0A 2MH7A 1GNUA 2K8CA 1QQRA 1FNUA 4NAWA 1V80A 5KHOA 1HE8A 3P4SB 1WM2A 2ZNVB 1WE6A 1R4MI 2UU7A 3HM6X 3I3TB 4MGYE 4GU2A 1GG3A 1SJED 5CX3A 1KM7A 2NMQA 4HWIB 1WWTA 2OOBB 1YNTE 1GAQB 2AQ3B 1LQBA 2JWUA 1P7FA 3BVGA 1UZXB 2HDEA 1FEHA 5MPOA 3VH3B 3EC8A 2DZJA 3VRBB 2BWFA 4ZRJA 4JQWC 2RDHA 3BVZA 2D3AA 4LTUA 3N9YC 3KW5B 3K9OB 4EUTA 1C4AA 5LNK1 3R3MA 2ZCCA 4BAXA 2JYEA 3AMZA 3I57A 4XWTA 2MWSB 2WXMA 1WRDB 2K22A 2Z8LA 3AEFB 3EGRA 4L2YA 3Q8EA 3L54A 3NS1A 2G45B 4M8MA 4DK5A 1JCKB 2BQQA 4K3BA 4NQLB 1B9RA 2IO3B 2UWQA 2QSDA 1K52A 4I6PA 1BUIC 2PKOA 1VZ6A 4P6VF 4RGMA 1F77A 2O6VD 2BB5A 2PJHA 4ICVA 2NS5A 2L05A 3P1MA 2KWVB 1FM0D 3BYTB 1TKGA 2JPHA 4LDTB 4M01A 3DWMA 2N9XA 3IAS1 1IPGA 1ZGUB 1JRUA 4YSYB 4H2AA 3AI5A 4P1CC 3MHSD 5G5HA 3QHTA 3ZXVA 3QK0A 4DXAB 2JZ3B 4A3OA 1EU4A 4HDOA 4LNOA 4M00A 5EE0A 3PZDA 2JWZA 3V61A 1Y56A 1WZ3A 1XXGA 1OEYA 3DWGC 1XLOA 3U2SC 4ICUA 1TIFA 3PRPB 2L0TA 2PEAA 1JALA 2NR2A 4FLHA 5C23A 1VCBA 2EKIA 1FD6A 2DHZA 2AYOB 3VTUA 4GDKA 3L17A 3UIOB 1HXYD 4EOYA 1WX8A 3C8YA 4XX5A 4HROA 1HA5A 2OJWA 3I63C 3U52E 2N4FA 2VZKD 2DYMA 1CZPA 2WX0A 1TBEA 5AUIA 1F1HA 3HK0A 3TEXA 3FC4A 1KH0A 3UI3A 4KZCA 4DBGA 2JQRB 1V2YA 1UELA 3PLVA 2FCQA 2X8XX 5BMGA 1FXIA 4A55A 2QC8A 4HEA1 2EMTA 5E6NA 4CHKA 1WMHB 4AWJA 1RAXA 3KVFB 2WU5B 5BMIA 2IGDA 3V60A 1C3TA 4MM3A 1KJTA 2D11A 2M1MA 4YL8A 3N30A 3SDLC 2IDYA 2PVGC 3DBRI 1WRIA 2ASQA 2O6VB 1QF6A 2AL6A 4HKQA 2O2VA 3QWZB 2J4XA 1YN5A 3Q8AA 4RM8A 4RCOA 2CHZA 1ACCA 1D3ZA 1MPEA 1WJUA 2A4ZA 3A1QB 2JXXA 5DPTA 2KVRA 2PMVA 4OVVA 1M4VA 3W5VB 4NJ6A 1KOTA 5H8YE 2INDC 5E6OA 3ZNHB 2UYZB 2GRIA 3H9DA 3I5JC 2LASA 4B0EA 1PUTA 5IP4D 1QOFA 5D6JB 1PGXA 2KTRB 2ZJDA 2LGIA 5DCNA 2MJDA 3V62A 1XLPA 3LXFA 2LMCA 4FXCA 4XDCA 1AN8A 1WGYA 2G4SA 1LO5D 3SD5A 4W9GA 4NY0A 2VH1A 2VZKB 1XLNA 2MBQA 2BS3B 1L0YB 4KVGB 5H92C 1NYQA 2WQYB 2JXTA 3UIPB 2LRUA 1VRAB 2GMIC 4E3CA 3ZVVA 3AE7B 3VXWA 2CKHB 3ZTCA 1NVID 4GOCA 4AP4C 2G3QB 1NEKB 1FNVA 2JSVX 5EDSA 5EE1A 3J9CA 1IUEA 4GXBA 2L3ZA 1TS5A 2KNBA 2IY0B 4L23A 3CSFA 4BFRA 4BOZB 3TEWA 2KJHB 3L0WB 2QCZA 1E9MA 3EFUA 1AWDA 4LK0M 2KMCA 2H88B 4KGRA 3W2DA 3W1YA 2M17A 3AE6B 4WAFA 4C56C 1C79A 2L00B 3MJ5A 4WWMA 2V4LA 4USAA 4RGOS 2IGGA 2JYTA 3NVWA 1L6UA 1WGGA 2YLMA 2HTME 1RM6C 4OZBA 2GI9A 3DBLI 2IY1B 1UWMA 2KLGA 4PS7A 5FK9C 1MJDA 4YTMB 4DDGD 4K3CA 2X38A 3M3JA 3VRAB 1UF0A 3RD2A 2JU6X 2N9PC 4KDIC 5TSSA 2BTEA 1BT0A 3X0WA 2MRPA 3BZDB 1E8ZA 3PZ8A 3UINB 4KSLC 5BYQA 3IG3A 4PS8A 1WMHA 3R8BA 5LLIA 1N5XA 1MG4A 2ZVOA 1L4DB 1TT5B 2DX5B 3DVNV 3L08A 4FBJB 3ETRA 4BOSC 1YIWA 5LXHA 1OQRA 2O6VA 3JW0X 1WXSA 2KAJA 5D3IB 4KSKC 2KT7A 1CJEA 1UH6A 4II3B 1JWMD 2KX3A 3Q3MC 2Z59B 3A9JB 1P0RA 1EM7A 1MFWA 4MT5A 4K7UA 4GDLB 4KIKB 4TSSA 2SAKA 1L0VB 4IWOA 1KLGD 3AM9A 3B1LX 1XCQL 2M0AA 1LFDA 4R3DA 5JXVA 3VUWA 5KHQA 3ZW3A 2WNMA 2MBHA 2MJ3A 3B0AA 1MHXA 2KTRA 3Q8BA 3KUZA 3H8HA 1I42A 3KH0A 1T6BX 5J18A 2Y5BB 3SFDB 3R2TA 2XBBC 2NVUI 1XO3A 2I1KA 2ZW0A 1OTRB 2CU1A 1NYRA 1J7AA 3H6NA 4ARIA 2PLPA 5GMVA 2IBIB 3VUYA 2D5GA 4IOIE 4ANVA 2R61A 1H8CA 1V5TA 1N61A 4BKTA 3T3NA 4HPPA 1IGCA 3AEEB 2RMMA 2J7QB 1WYWB 3RZFA 3ZJTA 4S0RA 1F9JA 3NG0A 2AQ1B 2QEJC 2L8JA 3Q14C 3DVNU 1ZW7A 3ZGZA 3PT2B 3A33B 3WAOA 1V81A 1UGJA 5BYSA 4HXDA 4NNJB 3VTVA 4ZDVA 2ZVNA 1V9JA 1WGHA 4G0NB 1T0YA 2LGSA 3ZXRA 4IM3A 2ZEQA 3NZUA 2K39A 4IDIA 1Q10A 3FAHA 2N9EB 1G6JA 5JZEB 3AE2B 3RZWC 3KYDD 2D07B 2V0GA 1STEA 4P16A 4NPNA 3ZDTA 4ANWA 2LXAA 4WIPA 1EO6A 2C60A 3WANA 3PGEA 3PSEB 3HVZA 3APCA 5G2NA 1I4PA 2JZZA 2JX5A 5AZGA 4DHZB 2JRHA 2ZW1A 3GE8C 2YEPF 4MSMB 3WALA 5J17A 3DBHB 3BY4B 2G4DB 3AEDB 2QIEB 2JRIB 2MHJA 3PV1A 1UBQA 3PVLA 1I4QA 2RPVA 3MC8A 4W9FA 5I4DA 2ACZB 2V9HA 1Q5WB 1L7YA 1B1ZA 3L13A 5JHBA 1WM3A 5D94A 1XD3B 3OWEB 2I2YA 1D5XC 2CR5A 1UGMA 4GIVA 1RFAA 2PVOD 3MJWA 4W9KA 1XF5L 1TZOA 5IAAC 3T8MA 2W82A 3R7RA 2IO1B 1ZKHA 1L2NA 1GB1A 2CS4A 3MHZA 3MP9A 4J3OD 3ZLZA 1WR6E 2DLBA 4GMVA 2GOWA 3TUOA 3APFA 1WJ6A 3RNGC 1QZEA 1E5WA 2KMMA 1WJNA 3N20C 3TL5A 3AH7A 3VQIA 1ZP0B 2GB1A 2KDFB 4KKIA 1WGKA 2W9NA 2KXJA 3A9JA 3EA6A 5DPWA 3TIXA 1WE7A 4MELA 4JL9A 2LVPA 3IBEA 1PQSA 3X23A 1E7VA 4GDLA 4KDLB 1RFKA 3JSVB 5JHAA 4HPMB 2FCSA 1F0ZA 2L7RA 4BBNF 2VH2A 4LNNA 1WSPA 2BS4B 2N7DA 1NBFC 3IFWB 4K81A 2QJLA 3ZUNA 3P63A 1SF0A 1IBXB 3QJZA 1RLFA 4TUUA 1JWSD 3IT4B 2KWCA 3KWLA 3DHIC 4B95A 1E8WA 2MA9B 5HKHA 4HCNB 1XEEA 3GP7A 2WXHA 3U8ZA 3NVZA 3P4QB 1YQ3B 1LM8B 4C7ZA 2WDVB 4ZOHC 1UD7A 4W9HA 3OJ4B 4FJZA 4BKSD 2KC2A 4EE2A 1T0QC 2PPHA 1H4RA 2GBJA 4O1NA 4DHJD 3D32A 4MJSB 2Y5PA 1WH3A 2DBYA 1RWSA 4PK1A 2B76B 1WGDA 4DXFA 1FO4A 2C7MB 2V4IB 3ZNGC 5E6JA 1EU3A 2LGXA 3QCAA 5C1ZA 1J19A 2RSUA 3SHQA 1PGBA 2BYFA 4WWNA 2RGFA 1R4NB 3AV8A 1NENB 1V8CA 3OG5A 3KUCB 2WU2B 2WXGA 4XYCA 1XLQA 3A4SC 4US9A 4GB9A 1Z2MA 3AEAB 4A90A 2GBNA 4NJ7A 2REXA 2CHWA 3PLUA 2NBVB 4JIOU 2KOXA 4J6IA 3DDCB 3NVYA 1MVKA 2KLCA 1I4HA 4A6QA 1GJZA 5CHVC 3KQ4A 2LEKA 5L95C 1WX7A 1ZE3D 3URYA 3T3OA 2L0FA 3ONSA 1EWYC 1QLBB 2AQ2B 3CF6E 4ARCA 1FMAD 3H1UA 3SEBA 3NZ3A 3S2AA 1KFYB 2WXPA 4W9CA 1BMLC 3B08A 4EZLA 4E74A 5C2TB 2WXNA 2SEBD 2XK5B 4MSQB 4LNFA 4DHJB 3QAQA 2CJNA 4REZA 3TMPB 4MGZE 4WJPA 1EF5A 1JWBD 3N3KB 3FILB 4FHJA 2LHEA 3CMMB 1YJ1A 1SE4A 4IG7B 1TS2A 2YVCA 4XDDA 2KWDA 2KN4A 3Q8FA 5C3JB 3WAMA 2LI5A 3W1SC 3IXSA 1VJKA 4ASWC 1YX5B 2IGHA 2MEKA 1I4RA 4AJWA 2L1AA 5T8IA 3LJ3A 3ZIMA 3PTFC 4XZ4A 2BVCA 1SIFA 2K25A 4W9EA 1VLBA 2MJEA 3JSVA 3AB5A 3AE3B 4XGAB 4KX6B 4CO7A 4HKZE 4PYZA 1D4BA 4DWFA 1E10A 1IBXA 2WXFA 3UF8A 3RPFC 2C9WB 1S1QB 2C7HA 2D3GA 5CHFA 2MSED 1FIQA 3Q3OC 4DXGA 2JF5A 3UQBA 3OLMD 1OEYJ 3RI7C 3ZJVA 5FR6A 2INCC 1OFFA 2ZPYA 3L4PA 2ZPNA 4MH0E 1FCCC 4MGIE 4YT0B 1WX9A 1KF6B 4HJKA 2N7EA 2OJRA 1TZ1A 1ZPSA 2R2OA 3WCQA 2WXIA 3GZNB 4JLCA 2WXJA 2MBEA 1GB4A 5IOIA 3PPAA 1D6EC 1I4GA 1LXDA 2ZZPB 1BXTA 1FRRA 3Q3JA 3AU4A 1ZXIA 3PS6A 4HVBA 1HZ5A 1L4ZB 3RFZB 2KX0A 2K6DB 2WP9B 5D3DA 3ZJUA 1YN4A 3RNFC 1WR1A 3PO0A 4WQOB 1NI3A 2KACA 2DAFA 1UBIA 2DWQA 2EKEC 2K1FA 1KRHA 2MP2B 4BZAA 1OQYA 4PS3A 4ACFA 2KO3A 2WX1A 3W5UB 4P7IA 3DOWA 2DENB 3MTNB 2EMSA 1SEBD 1A5RA 3TEYA 4MH8A 3QC8B 1JWUD 4ZRQA 4JX1C 4KGTA 2IO0B 2BYTA 3KUDB 2BF8B 4K1RB 2HJ1A 4MGKE 2FCNA 4RMAA 4ZRPA 3R2IA 4AQ7A 5TR5A 5FR3A 3TBLD 2W55A 4RF0A 4B0MA 1E8XA 3Q6BA 3QX1A 1S3SG 2KDIA 2D10A 2N9KA 3EUB2 2W3SA 3HVDA 1JQ4A 5EE9A 1PFDA 3O65B 2AL3A 1QOBA 2LRWA 4FA6A 4NAMA 4M0WB 2QHOA 2LUMA 4G11A 2N0SB 1YQBA 1WXMA 2KQSA 1AYFA 3EHVA 4E71A 4ZRIA 1DGJA 4BKSA 1K8RB 2K3UA 3BK2A 1C9FA 4PYUA 1P1AA 2XK5A 4W9IA 2KMAA 3BYYB 3U7ZA 2KANA 2WYQA 4W9DA 1N6ZA 1N63A 3A1QA 4YWGG 1DYQA 1WZ0A 3FILA 2N1VA 3NVVA 4NJCA 3Q3FA 3BINA 4CYEA 3KLSX 2V1YA 5AUKA 4WWOA 1RYJA 5BYRA 1L6VA 1QT9A 2R2QA 3PHWB 3Q3NC 3KWVA 1TKYA 5HFYA 1C77A 2WXQA 2LJIA 3EECA 3L10B 2XNAC 2WHIA 4LCDE 1FNWA 3RN9C 2BS2B 3FKYA 1SE9A 2FCMA 1C4PA 4GN1A 4FHKA 2FAZA 5D7GA 1FFVA 1Z5SB 3BVMA 3GE3C 4WURA 3W9CB 4KV2A 4IM2A 3N1XC 2D3CA 4OZCA 1MG8A 4FULA 1ZDXA 1TYGB 4F8CB 4JGHB 1E0ZA 1IP9A 2RDGA 4F7ZA 1FPYA 1LGRA 2D3BA 2NPTB 4DHZE 3M95A 4NZLB 2NTSA 2BYEA 2GLSA 4OHJA 1L5PA 2KTFA 3SU8X 2M4NA 4C00A 3EFCA 4AS1A 2ON8A 2GBMA 2J0JA 3VTWA 3K9PB 4YTPB 2DNFA 3DVGY 4YSZB 1TS4A 2FIDA 1C76A 2FE8A 2Z0DB 1VR9A 1KLUD 1CMXB 2IO2B 4I6NB 4TV3A 1A70A 5E6PA 1FXAA 5D2MB 2KFKB 3IHPC 1N62A 4WWPA 3DQVA 1CK1A 5HI1A 4HLEA 3B2FA 1QILA 2NCNA 2LJ5A 2LXCA 2WLBA 1Q0WB 1UNSA 2MQJA 3AEBB 1K50A 3R7QA 2GBRA 3W1SA 2KFJA 4FJYA 4MDKE 2RDBC 4MEMA 3RULA 1J7BA 5IO9A 1VDVA 4N9F4 2E6XA 1I4XA 3HHMA 1N5WA 3DBHI 4LNIA 1PYWD 1E90A 3A9KB 2BBCA 2LVQA 4OVZA 3OAWA 2FUG1 2G9HD 2BGFA 1V6EA 2TSSA 3N1YC 3VH4B 1FRDA 2KJ6A 2KJRA 3AULA 3V6CB 2BWES 3MFGA 3ZYYX 5CHWA 1V5OA 3VAWA 2K9XA 1ET6A 1WI0A 4M0WA 4WAAA 3P4PB 4US8A 5DPRA 3ZNZB 3BIID 1J0GA 1YOVB 1QOAA 3HUIA 3GOEA 5IN7A 2CU3A 2NBWB 4IC7B 2PE6B 4KIKA 4RH6A 2WDRB 2D2QA 4G3XB 1YJJA 4DDID 4JWUC 1YX6B 3TEZA 3RNEC 3LB8C 3NZSA 4L1BA 3RCZA 4RGTA 2DZKA 3WAPA 4XWWA 3L16A 3QQ8B 3AE8B 1U4AA 3PRZA 3RT3B 3V3XA 4F1SA 4JPSA 2PW9A 4WJQA 1K51A 2C7NB 5CTRC 3ENEA 3R66C 4LLGM 2L76A 4A8XC 1JRPA 4WJNA 2KQ7A 2V3SA 4TQ1A 1YMHE 4WH4A 1Y8RC 1EWCA 1KLVA 1L0XB 1SJHD 2HE7A 3AU5A 1K53A 1GC7A 4QAYA 1TY2A 3E56A 3PZ7A 1QKZA 2L52A 1WXVA 4ZHPA 1PDXA 3RNCC 2GBKA 1GUAB 2NPTA 4TMAB 1GC6A 2M8SA 2CHXA 4KKJA 2N1WA 2I38A 1UWXA 3MC0B 3OJ3A 2MBBB 3ML9A 3V6EB 2KK8A 4M8NA 4RFBA 1ZDVA 2WS3B 3UGBB 2KYWA 2K8BA 5AZFA 4W9LA 4BVUC 3IVFA 2MX2A 4ZHOA 5AZHA 1WF9A 2KQ4X 1DOXA 1GPXA 2KDMA 4IWQA 2NTTA 2KVZA 2A5UA 2BPSA 2N9LA 2KFKA 3ZNID 1R4NI 2W3RA 2Y3AA 2MW5A 4EZJA 1FFUA 1OGWA 4Q2JA 2AEHA 2LHDA 1P3QU 2JZPA 3ZO5B 4B9KA 5L83A 2LVOA 5LXIB 3LYYA 1AARA 1OQQA 2QILA 4ZRKA 3ECIA 2VRRB 4II2B 1IGDA 3B9JA 5HG2A 3U30A 3ZRFA 1DOYA 5BMHA 3DBRB 4TQ0A 2DYBA 3T9LA 3A9KA 1XQQA 1SBBB 2WXKA 4XE0A 4C7YA 1VZ8A 1HTQA 3M63B 2N7JA 1QOGA 2INNE 4MACA 4NQKE 2M0XA 3BWUD 2NBUA 1TS3A 2IYDB 4I6LB 3M62B 1GOZA 2KD0A 1KTKA 3NY5A 2J0MA 2FBWB 3IAM1 1ET9A 2IPKD 2LGYA 3NHEB 2KDEB 3PREA 2W54A 3CSTA 3ZRCA 3ALBA 2E3TA 3ML8A 1ISNA 1T3QA 1F2RC 4M02A 1R7SA 2QDFA 4HPLB 4TKNA 3RUIB 1EF1A 2Y5CA 3GB1A 1SGHA 2K5PA 4K7SA 4LNKA 5GXGB 3UQAA 3BK1A 3N32A 3PHXB 2PIAA 1ESFA 4KZ0A 3ZTDA 2WDQB 4AUQC 4ANXA 1J8CA 1C1YB 4RM9A 3TSSA 4AOFA 2AX5A 4DQOC 1FCLA 2XEWA 3Q69A 1M94A 3WIMA 4HCPB 4YTNB 4IW0A 2KWUB 2DAJA 1SIJA 4ZYNA 2WDTB 4KGSA 2KHWB 4HDQA 2J0KA 2JVCA 1VD2A 3IT6B 1E8YA 3NRZA 2CJOA 2DZIA 1WY8A 2BB6A 4MJSA 1E6EB 4OVUA 1DOIA 3MC9A
chains in the Genus database with same CATH topology
1SE9A 1V86A 2FCMA 1WR6E 4GN1A 2WX0A 4FHKA 2FAZA 4BKGA 5D7GA 1TBEA 1Z5SB 4GMVA 2WWZA 3H7PB 2KZRA 3HK0A 2GOWA 2Z0EB 3APFA 4EEWA 1WJ6A 1QZEA 1TGZB 1E5WA 1WJNA 3TL5A 3GZNI 4G50A 4KZCA 4KV2A 1I35A 4DBGA 4IM2A 4X57B 4AJYB 1V2YA 1UELA 3VQIA 1MG8A 3PLVA 2FCQA 4FULA 2RD0A 2KDFB 2JT4B 1P98A 2W9NA 2KXJA 3A9JA 4F8CB 4FADA 5DPWA 4JGHB 3TIXA 1WE7A 2EMTA 4MELA 5E6NA 4JL9A 2LVPA 3IBEA 4CHKA 1PQSA 3X23A 1WMHB 3KYCD 1RAXA 3KVFB 4AWJA 1E7VA 3APDA 4GDLA 4KDLB 3DCGA 1IP9A 3JSVB 5JHAA 4HPMB 4F7ZA 2FCSA 2MCNB 3V60A 2NPTB 1C3TA 2L7RA 4DHZE 4MM3A 3LDZE 3M95A 1KJTA 2D11A 2M1MA 4BBNF 4YL8A 5AEKB 3N30A 2C5LC 2N7DA 4URKA 1NBFC 2HTHA 3IFWB 3SDLC 2BYEA 4K81A 3ZUNA 2KTFA 3SU8X 3DBRI 1XT9B 2ASQA 2M4NA 2O6VB 2AL6A 3JYUA 3TCAA 2O2VA 2GBMA 2J0JA 3QWZB 2ZCBA 3VTWA 3QJZA 4IUMB 1RLFA 3K9PB 3PRMB 3DVGY 2MBOA 3WA0A 4TUUA 3VHTC 5BO4B 2DZMA 2KWCA 4RM8A 2CHZA 4B95A 1E8WA 2FIDA 2MA9B 1WJUA 1D3ZA 5HKHA 2Z0DB 4HK2A 2A4ZA 3A1QB 1TTNA 2JXXA 2LUEA 3QARA 5DPTA 4HCNB 2KVRA 4W9JA 4OVVA 1CMXB 4NJ6A 1KOTA 5E6OA 3U8ZA 2IO2B 4I6NB 4TV3A 3ZNHB 2UYZB 5E6PA 3H9DA 5D2MB 1LM8B 2KFKB 3IHPC 2LASA 1UD7A 4WWPA 4W9HA 3OJ4B 5D6JB 3DQVA 2KTRB 2ZJDA 4FJZA 4BKSD 2KC2A 2K8HA 4HLEA 2PE9A 2NCNA 2PPHA 2LJ5A 1H4RA 2HD5B 2GBJA 3AXCA 4NAWB 5DCNA 3V62A 4DHJD 3D32A 4FJVB 4MJSB 2LXCA 1WH3A 5J2RA 4A3PA 2HJ8A 1Q0WB 2MQJA 1WGDA 3RYTA 1WGYA 3VFKA 1NDDA 2G4SA 3R7QA 2GBRA 3HM3A 2KFJA 4W9GA 3SD5A 3W1SA 2C7MB 4NY0A 3ZNGC 2LD9A 4FJYA 2DYOA 4MDKE 4EFOA 4MEMA 3RULA 2MBQA 2LGXA 3QCAA 4N9F4 5C1ZA 1RRBA 1J19A 2RSUA 3SHQA 3HHMA 2BYFA 4KVGB 3DBHI 1WIAA 4WWNA 2RGFA 3U7DA 3UIPB 2LRUA 1E90A 4WJOA 2GMIC 3A9KB 2JUOA 4E3CA 5IA7A 2LVQA 3ZVVA 3KUCB 3OAWA 3VXWA 2CKHB 2B3AA 2BGFA 2KKCA 3A4SC 3ZTCA 4GB9A 1V6EA 4GOCA 4AP4C 2G3QB 5DPSA 1Z2MA 2LZ6A 3VH4B 2GBNA 2KJ6A 4NJ7A 2REXA 2KJRA 3AULA 2CHWA 3V6CB 5EDSA 3PLUA 2NBVB 2BWES 2KOXA 4JIOU 4J6IA 4FN2A 5CHWA 1V5OA 2L3ZA 3DDCB 4GXBA 2MLBA 3VAWA 1WI0A 2KNBA 2KLCA 2IY0B 2BYVE 3CSFA 4BFRA 4BOZB 4WAAA 1GJZA 5CHVC 2BKFA 2RPQA 2KJHB 5DPRA 3L0WB 1WX7A 5L95C 2IZVB 3ZNZB 1J0GA 2L0FA 3EFUA 3GOEA 3ONSA 2KMCA 2NBWB 2JY6A 4IC7B 1E7UA 3VUXA 2PE6B 4KIKA 2FNJB 5JH5C 2D2QA 4G3XB 3W1YA 3JVZX 3VDZA 2M17A 3CF6E 4DDID 3H1UA 2LWPA 3DBSA 1YX6B 3S2AA 2L00B 2AWTA 2KC1A 2V4LA 4LJOB 4GGQA 2ZNVC 3NZSA 3RCZA 2DZKA 3WAPA 4XC2A 3L16A 3QQ8B 4W9CA 3DPDA 1U4AA 2LGDA 3B08A 3PRZA 3RT3B 1WGGA 3H7SA 2YLMA 4E74A 4EZLA 4EKUA 4IM0A 4F1SA 3DBLI 2IY1B 4WJQA 2XK5B 2KLGA 4PS7A 4MSQB 4DHJB 2C7NB 4DDGD 5CTRC 3ENEA 3QAQA 3R66C 3M3JA 5G55A 3TMPB 4MGZE 3RD2A 4WJPA 1EF5A 3N3KB 4EZKA 2L76A 3H7PA 2N9PC 4WJNA 2KQ7A 2V3SA 4FHJA 4KDIC 4TQ1A 4ANUA 3CMMB 1YJ1A 1Y8RC 2FUHB 4IG7B 3C0RB 2YVCA 4K7WA 3WAMA 1BT0A 1Q1OA 3A4RA 2LI5A 1KLVA 3W1SC 4B6WA 3X0WA 4ASWC 1YX5B 2HE7A 2K6QA 1YD8U 2MRPA 3AU5A 4AJWA 1E8ZA 1GC7A 3LJ3A 3ZIMA 3PTFC 4XZ4A 1SIFA 2MP2A 3UINB 4KSLC 3IG3A 1EUVB 2K25A 4PS8A 1WMHA 4GDKB 5LLIA 4W9EA 1FXTB 1WXVA 3ZKJC 2ZVOA 3JSVA 4BBNC 3TJPA 2GBKA 2DX5B 3DVNV 3L08A 1GUAB 2NPTA 4FBJB 1GC6A 2M8SA 2CHXA 1WFYA 1WGRA 1WJ4A 2N1WA 4A20A 4CO7A 4PYZA 4BOSC 1YIWA 5LXHA 3OJ3A 2I1JA 4DWFA 2MBBB 3ML9A 3V6EB 2KK8A 2O6VA 4M8NA 3JW0X 1WXSA 4GSWA 3UGBB 2BKRB 3ZDMC 3UF8A 1NI2A 4KSKC 1IYFA 1UH6A 4II3B 2KX3A 2K8BA 5AZFA 1P9DU 4W9LA 3VVWB 2C9WB 2KDBA 1S1QB 2C7HA 2Z59B 2D3GA 3A9JB 3IVFA 3NOBA 4BVUC 2MX2A 5CHFA 2MSED 1P0RA 5AZHA 1WF9A 4K7UA 2JF5A 1X1MA 4GDLB 3UQBA 2RR9A 4KIKB 4IWOA 1V49A 3OLMD 3DVGX 1OEYJ 2FIFA 4IWQA 5FR6A 3P2BA 3B1LX 3QA8A 2KN5A 3QIJA 4IWPA 1LFDA 2A5UA 2ZPYA 2BPSA 3VUWA 5KHQA 3HIZA 3ZW3A 4LDTD 2ZPNA 2KFKA 2MBHA 1WXAA 1R4NI 4LJPB 4MGIE 4MH0E 3ZNID 3B0AA 3NS8A 1WX9A 2KTRA 2O2VB 4HJKA 2MW5A 2N7EA 1TZ1A 2OJRA 2R2OA 3KUZA 1OGWA 4EZJA 1I42A 3KH0A 1GNUA 2K8CA 4JLCA 2AEHA 2MBEA 4NAWA 5J18A 2Y5BB 1P3QU 1V80A 2XBBC 5KHOA 3PPAA 2NVUI 3ZO5B 2I1KA 4B9KA 1OTRB 5L83A 1HE8A 2LVOA 2CU1A 1LXDA 2ZZPB 5LXIB 3H6NA 1WM2A 1AARA 5GMVA 4ZRKA 2IBIB 3VUYA 2ZNVB 3Q3JA 1WE6A 3AU4A 1R4MI 3PS6A 4HVBA 3ECIA 2VRRB 4II2B 4ANVA 2KX0A 1H8CA 2K6DB 3HM6X 3I3TB 1V5TA 4MGYE 3U30A 3ZRFA 1WR1A 4GU2A 4BKTA 4WQOB 1GG3A 5CX3A 2DAFA 1KM7A 2J7QB 1UBIA 4TQ0A 1WYWB 4HWIB 2EKEC 2DYBA 2K1FA 2OOBB 3A9KA 3T9LA 3RZFA 1XQQA 2MP2B 1OQYA 1F9JA 1LQBA 4PS3A 2KO3A 2WX1A 1UZXB 4P7IA 3DOWA 2DENB 2L8JA 3DVNU 1ZW7A 3M63B 3MTNB 2EMSA 3VH3B 4NQKE 3PT2B 3EC8A 2DZJA 2M0XA 2BWFA 3A33B 4ZRJA 3WAOA 1V81A 1A5RA 2NBUA 4JQWC 3QC8B 4HXDA 4NNJB 3VTVA 2IYDB 4ZDVA 2IO0B 4I6LB 2ZVNA 2BF8B 3KUDB 4K1RB 1V9JA 2FCNA 4MGKE 1WGHA 3M62B 4G0NB 4RMAA 3KW5B 1T0YA 2KD0A 3NY5A 3K9OB 4EUTA 2J0MA 5TR5A 3R3MA 4IM3A 2ZEQA 2ZCCA 2K39A 3NZUA 3TBLD 2MWSB 1WRDB 2N9EB 2LGYA 1G6JA 3NHEB 3L54A 1E8XA 3RZWC 5JZEB 2KDEB 2G45B 4M8MA 3KYDD 3QX1A 2D07B 1S3SG 4DK5A 2KDIA 3PREA 3CSTA 4NPNA 3ZRCA 4NQLB 2D10A 3ALBA 3ZDTA 4ANWA 2IO3B 2LXAA 2UWQA 4I6PA 3ML8A 1ISNA 2O6VD 1EO6A 2C60A 2PJHA 4ICVA 3WANA 2NS5A 3O65B 3PGEA 3PSEB 4HPLB 2AL3A 4TKNA 2L05A 3RUIB 2KWVB 3APCA 5G2NA 2JZZA 1EF1A 5AZGA 2LRWA 4DHZB 2JRHA 1SGHA 4M0WB 4FA6A 2JPHA 2QHOA 4LDTB 4G11A 4K7SA 4MSMB 3WALA 3UQAA 1YQBA 5J17A 1WXMA 2KQSA 3EHVA 4E71A 2N9XA 3N32A 3PHXB 4ZRIA 1IPGA 1ZGUB 3BY4B 4BKSA 1K8RB 1JRUA 2G4DB 4PYUA 2JRIB 1P1AA 4KZ0A 3ZTDA 2XK5A 4AUQC 4W9IA 2KMAA 4ANXA 1J8CA 3AI5A 1C1YB 2KANA 2WYQA 4W9DA 3MHSD 4RM9A 3QHTA 4AOFA 3A1QA 3PV1A 3QK0A 1UBQA 1WZ0A 3PVLA 2JZ3B 4DXAB 4A3OA 4HDOA 2XEWA 4W9FA 1M94A 2N1VA 4HCPB 3WIMA 1Q5WB 1L7YA 4IW0A 2KWUB 3PZDA 2DAJA 2JWZA 3L13A 3Q3FA 3V61A 1WM3A 3BINA 1WZ3A 5D94A 1XD3B 5JHBA 4ZYNA 1OEYA 4CYEA 2V1YA 2WDTB 4ICUA 2CR5A 2L0TA 3PRPB 4WWOA 1UGMA 2PEAA 2KHWB 4GIVA 4HDQA 1RFAA 2R2QA 3MJWA 3PHWB 4W9KA 2NR2A 2J0KA 2JVCA 4FLHA 5C23A 5IAAC 3T8MA 1VCBA 1VD2A 1E8YA 3R7RA 2DHZA 2DZIA 2IO1B 1WY8A 1ZKHA 2AYOB 3VTUA 4GDKA 4MJSA 3L17A 1L2NA 3UIOB 3EECA 2CS4A 1WX8A 3L10B 4OVUA 4XX5A 4EOYA 4LCDE 3ZLZA 2N4FA 2DYMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SE9 A;  1V86 A;  2FCM A;  1WR6 E;  4GN1 A;  2WX0 A;  4FHK A;  2FAZ A;  4BKG A;  5D7G A;  1TBE A;  1Z5S B;  4GMV A;  2WWZ A;  3H7P B;  2KZR A;  3HK0 A;  2GOW A;  2Z0E B;  3APF A;  4EEW A;  1WJ6 A;  1QZE A;  1TGZ B;  1E5W A;  1WJN A;  3TL5 A;  3GZN I;  4G50 A;  4KZC A;  4KV2 A;  1I35 A;  4DBG A;  4IM2 A;  4X57 B;  4AJY B;  1V2Y A;  1UEL A;  3VQI A;  1MG8 A;  3PLV A;  2FCQ A;  4FUL A;  2RD0 A;  2KDF B;  2JT4 B;  1P98 A;  2W9N A;  2KXJ A;  3A9J A;  4F8C B;  4FAD A;  5DPW A;  4JGH B;  3TIX A;  1WE7 A;  2EMT A;  4MEL A;  5E6N A;  4JL9 A;  2LVP A;  3IBE A;  4CHK A;  1PQS A;  3X23 A;  1WMH B;  3KYC D;  1RAX A;  3KVF B;  4AWJ A;  1E7V A;  3APD A;  4GDL A;  4KDL B;  3DCG A;  1IP9 A;  3JSV B;  5JHA A;  4HPM B;  4F7Z A;  2FCS A;  2MCN B;  3V60 A;  2NPT B;  1C3T A;  2L7R A;  4DHZ E;  4MM3 A;  3LDZ E;  3M95 A;  1KJT A;  2D11 A;  2M1M A;  4BBN F;  4YL8 A;  5AEK B;  3N30 A;  2C5L C;  2N7D A;  4URK A;  1NBF C;  2HTH A;  3IFW B;  3SDL C;  2BYE A;  4K81 A;  3ZUN A;  2KTF A;  3SU8 X;  3DBR I;  1XT9 B;  2ASQ A;  2M4N A;  2O6V B;  2AL6 A;  3JYU A;  3TCA A;  2O2V A;  2GBM A;  2J0J A;  3QWZ B;  2ZCB A;  3VTW A;  3QJZ A;  4IUM B;  1RLF A;  3K9P B;  3PRM B;  3DVG Y;  2MBO A;  3WA0 A;  4TUU A;  3VHT C;  5BO4 B;  2DZM A;  2KWC A;  4RM8 A;  2CHZ A;  4B95 A;  1E8W A;  2FID A;  2MA9 B;  1WJU A;  1D3Z A;  5HKH A;  2Z0D B;  4HK2 A;  2A4Z A;  3A1Q B;  1TTN A;  2JXX A;  2LUE A;  3QAR A;  5DPT A;  4HCN B;  2KVR A;  4W9J A;  4OVV A;  1CMX B;  4NJ6 A;  1KOT A;  5E6O A;  3U8Z A;  2IO2 B;  4I6N B;  4TV3 A;  3ZNH B;  2UYZ B;  5E6P A;  3H9D A;  5D2M B;  1LM8 B;  2KFK B;  3IHP C;  2LAS A;  1UD7 A;  4WWP A;  4W9H A;  3OJ4 B;  5D6J B;  3DQV A;  2KTR B;  2ZJD A;  4FJZ A;  4BKS D;  2KC2 A;  2K8H A;  4HLE A;  2PE9 A;  2NCN A;  2PPH A;  2LJ5 A;  1H4R A;  2HD5 B;  2GBJ A;  3AXC A;  4NAW B;  5DCN A;  3V62 A;  4DHJ D;  3D32 A;  4FJV B;  4MJS B;  2LXC A;  1WH3 A;  5J2R A;  4A3P A;  2HJ8 A;  1Q0W B;  2MQJ A;  1WGD A;  3RYT A;  1WGY A;  3VFK A;  1NDD A;  2G4S A;  3R7Q A;  2GBR A;  3HM3 A;  2KFJ A;  4W9G A;  3SD5 A;  3W1S A;  2C7M B;  4NY0 A;  3ZNG C;  2LD9 A;  4FJY A;  2DYO A;  4MDK E;  4EFO A;  4MEM A;  3RUL A;  2MBQ A;  2LGX A;  3QCA A;  4N9F 4;  5C1Z A;  1RRB A;  1J19 A;  2RSU A;  3SHQ A;  3HHM A;  2BYF A;  4KVG B;  3DBH I;  1WIA A;  4WWN A;  2RGF A;  3U7D A;  3UIP B;  2LRU A;  1E90 A;  4WJO A;  2GMI C;  3A9K B;  2JUO A;  4E3C A;  5IA7 A;  2LVQ A;  3ZVV A;  3KUC B;  3OAW A;  3VXW A;  2CKH B;  2B3A A;  2BGF A;  2KKC A;  3A4S C;  3ZTC A;  4GB9 A;  1V6E A;  4GOC A;  4AP4 C;  2G3Q B;  5DPS A;  1Z2M A;  2LZ6 A;  3VH4 B;  2GBN A;  2KJ6 A;  4NJ7 A;  2REX A;  2KJR A;  3AUL A;  2CHW A;  3V6C B;  5EDS A;  3PLU A;  2NBV B;  2BWE S;  2KOX A;  4JIO U;  4J6I A;  4FN2 A;  5CHW A;  1V5O A;  2L3Z A;  3DDC B;  4GXB A;  2MLB A;  3VAW A;  1WI0 A;  2KNB A;  2KLC A;  2IY0 B;  2BYV E;  3CSF A;  4BFR A;  4BOZ B;  4WAA A;  1GJZ A;  5CHV C;  2BKF A;  2RPQ A;  2KJH B;  5DPR A;  3L0W B;  1WX7 A;  5L95 C;  2IZV B;  3ZNZ B;  1J0G A;  2L0F A;  3EFU A;  3GOE A;  3ONS A;  2KMC A;  2NBW B;  2JY6 A;  4IC7 B;  1E7U A;  3VUX A;  2PE6 B;  4KIK A;  2FNJ B;  5JH5 C;  2D2Q A;  4G3X B;  3W1Y A;  3JVZ X;  3VDZ A;  2M17 A;  3CF6 E;  4DDI D;  3H1U A;  2LWP A;  3DBS A;  1YX6 B;  3S2A A;  2L00 B;  2AWT A;  2KC1 A;  2V4L A;  4LJO B;  4GGQ A;  2ZNV C;  3NZS A;  3RCZ A;  2DZK A;  3WAP A;  4XC2 A;  3L16 A;  3QQ8 B;  4W9C A;  3DPD A;  1U4A A;  2LGD A;  3B08 A;  3PRZ A;  3RT3 B;  1WGG A;  3H7S A;  2YLM A;  4E74 A;  4EZL A;  4EKU A;  4IM0 A;  4F1S A;  3DBL I;  2IY1 B;  4WJQ A;  2XK5 B;  2KLG A;  4PS7 A;  4MSQ B;  4DHJ B;  2C7N B;  4DDG D;  5CTR C;  3ENE A;  3QAQ A;  3R66 C;  3M3J A;  5G55 A;  3TMP B;  4MGZ E;  3RD2 A;  4WJP A;  1EF5 A;  3N3K B;  4EZK A;  2L76 A;  3H7P A;  2N9P C;  4WJN A;  2KQ7 A;  2V3S A;  4FHJ A;  4KDI C;  4TQ1 A;  4ANU A;  3CMM B;  1YJ1 A;  1Y8R C;  2FUH B;  4IG7 B;  3C0R B;  2YVC A;  4K7W A;  3WAM A;  1BT0 A;  1Q1O A;  3A4R A;  2LI5 A;  1KLV A;  3W1S C;  4B6W A;  3X0W A;  4ASW C;  1YX5 B;  2HE7 A;  2K6Q A;  1YD8 U;  2MRP A;  3AU5 A;  4AJW A;  1E8Z A;  1GC7 A;  3LJ3 A;  3ZIM A;  3PTF C;  4XZ4 A;  1SIF A;  2MP2 A;  3UIN B;  4KSL C;  3IG3 A;  1EUV B;  2K25 A;  4PS8 A;  1WMH A;  4GDK B;  5LLI A;  4W9E A;  1FXT B;  1WXV A;  3ZKJ C;  2ZVO A;  3JSV A;  4BBN C;  3TJP A;  2GBK A;  2DX5 B;  3DVN V;  3L08 A;  1GUA B;  2NPT A;  4FBJ B;  1GC6 A;  2M8S A;  2CHX A;  1WFY A;  1WGR A;  1WJ4 A;  2N1W A;  4A20 A;  4CO7 A;  4PYZ A;  4BOS C;  1YIW A;  5LXH A;  3OJ3 A;  2I1J A;  4DWF A;  2MBB B;  3ML9 A;  3V6E B;  2KK8 A;  2O6V A;  4M8N A;  3JW0 X;  1WXS A;  4GSW A;  3UGB B;  2BKR B;  3ZDM C;  3UF8 A;  1NI2 A;  4KSK C;  1IYF A;  1UH6 A;  4II3 B;  2KX3 A;  2K8B A;  5AZF A;  1P9D U;  4W9L A;  3VVW B;  2C9W B;  2KDB A;  1S1Q B;  2C7H A;  2Z59 B;  2D3G A;  3A9J B;  3IVF A;  3NOB A;  4BVU C;  2MX2 A;  5CHF A;  2MSE D;  1P0R A;  5AZH A;  1WF9 A;  4K7U A;  2JF5 A;  1X1M A;  4GDL B;  3UQB A;  2RR9 A;  4KIK B;  4IWO A;  1V49 A;  3OLM D;  3DVG X;  1OEY J;  2FIF A;  4IWQ A;  5FR6 A;  3P2B A;  3B1L X;  3QA8 A;  2KN5 A;  3QIJ A;  4IWP A;  1LFD A;  2A5U A;  2ZPY A;  2BPS A;  3VUW A;  5KHQ A;  3HIZ A;  3ZW3 A;  4LDT D;  2ZPN A;  2KFK A;  2MBH A;  1WXA A;  1R4N I;  4LJP B;  4MGI E;  4MH0 E;  3ZNI D;  3B0A A;  3NS8 A;  1WX9 A;  2KTR A;  2O2V B;  4HJK A;  2MW5 A;  2N7E A;  1TZ1 A;  2OJR A;  2R2O A;  3KUZ A;  1OGW A;  4EZJ A;  1I42 A;  3KH0 A;  1GNU A;  2K8C A;  4JLC A;  2AEH A;  2MBE A;  4NAW A;  5J18 A;  2Y5B B;  1P3Q U;  1V80 A;  2XBB C;  5KHO A;  3PPA A;  2NVU I;  3ZO5 B;  2I1K A;  4B9K A;  1OTR B;  5L83 A;  1HE8 A;  2LVO A;  2CU1 A;  1LXD A;  2ZZP B;  5LXI B;  3H6N A;  1WM2 A;  1AAR A;  5GMV A;  4ZRK A;  2IBI B;  3VUY A;  2ZNV B;  3Q3J A;  1WE6 A;  3AU4 A;  1R4M I;  3PS6 A;  4HVB A;  3ECI A;  2VRR B;  4II2 B;  4ANV A;  2KX0 A;  1H8C A;  2K6D B;  3HM6 X;  3I3T B;  1V5T A;  4MGY E;  3U30 A;  3ZRF A;  1WR1 A;  4GU2 A;  4BKT A;  4WQO B;  1GG3 A;  5CX3 A;  2DAF A;  1KM7 A;  2J7Q B;  1UBI A;  4TQ0 A;  1WYW B;  4HWI B;  2EKE C;  2DYB A;  2K1F A;  2OOB B;  3A9K A;  3T9L A;  3RZF A;  1XQQ A;  2MP2 B;  1OQY A;  1F9J A;  1LQB A;  4PS3 A;  2KO3 A;  2WX1 A;  1UZX B;  4P7I A;  3DOW A;  2DEN B;  2L8J A;  3DVN U;  1ZW7 A;  3M63 B;  3MTN B;  2EMS A;  3VH3 B;  4NQK E;  3PT2 B;  3EC8 A;  2DZJ A;  2M0X A;  2BWF A;  3A33 B;  4ZRJ A;  3WAO A;  1V81 A;  1A5R A;  2NBU A;  4JQW C;  3QC8 B;  4HXD A;  4NNJ B;  3VTV A;  2IYD B;  4ZDV A;  2IO0 B;  4I6L B;  2ZVN A;  2BF8 B;  3KUD B;  4K1R B;  1V9J A;  2FCN A;  4MGK E;  1WGH A;  3M62 B;  4G0N B;  4RMA A;  3KW5 B;  1T0Y A;  2KD0 A;  3NY5 A;  3K9O B;  4EUT A;  2J0M A;  5TR5 A;  3R3M A;  4IM3 A;  2ZEQ A;  2ZCC A;  2K39 A;  3NZU A;  3TBL D;  2MWS B;  1WRD B;  2N9E B;  2LGY A;  1G6J A;  3NHE B;  3L54 A;  1E8X A;  3RZW C;  5JZE B;  2KDE B;  2G45 B;  4M8M A;  3KYD D;  3QX1 A;  2D07 B;  1S3S G;  4DK5 A;  2KDI A;  3PRE A;  3CST A;  4NPN A;  3ZRC A;  4NQL B;  2D10 A;  3ALB A;  3ZDT A;  4ANW A;  2IO3 B;  2LXA A;  2UWQ A;  4I6P A;  3ML8 A;  1ISN A;  2O6V D;  1EO6 A;  2C60 A;  2PJH A;  4ICV A;  3WAN A;  2NS5 A;  3O65 B;  3PGE A;  3PSE B;  4HPL B;  2AL3 A;  4TKN A;  2L05 A;  3RUI B;  2KWV B;  3APC A;  5G2N A;  2JZZ A;  1EF1 A;  5AZG A;  2LRW A;  4DHZ B;  2JRH A;  1SGH A;  4M0W B;  4FA6 A;  2JPH A;  2QHO A;  4LDT B;  4G11 A;  4K7S A;  4MSM B;  3WAL A;  3UQA A;  1YQB A;  5J17 A;  1WXM A;  2KQS A;  3EHV A;  4E71 A;  2N9X A;  3N32 A;  3PHX B;  4ZRI A;  1IPG A;  1ZGU B;  3BY4 B;  4BKS A;  1K8R B;  1JRU A;  2G4D B;  4PYU A;  2JRI B;  1P1A A;  4KZ0 A;  3ZTD A;  2XK5 A;  4AUQ C;  4W9I A;  2KMA A;  4ANX A;  1J8C A;  3AI5 A;  1C1Y B;  2KAN A;  2WYQ A;  4W9D A;  3MHS D;  4RM9 A;  3QHT A;  4AOF A;  3A1Q A;  3PV1 A;  3QK0 A;  1UBQ A;  1WZ0 A;  3PVL A;  2JZ3 B;  4DXA B;  4A3O A;  4HDO A;  2XEW A;  4W9F A;  1M94 A;  2N1V A;  4HCP B;  3WIM A;  1Q5W B;  1L7Y A;  4IW0 A;  2KWU B;  3PZD A;  2DAJ A;  2JWZ A;  3L13 A;  3Q3F A;  3V61 A;  1WM3 A;  3BIN A;  1WZ3 A;  5D94 A;  1XD3 B;  5JHB A;  4ZYN A;  1OEY A;  4CYE A;  2V1Y A;  2WDT B;  4ICU A;  2CR5 A;  2L0T A;  3PRP B;  4WWO A;  1UGM A;  2PEA A;  2KHW B;  4GIV A;  4HDQ A;  1RFA A;  2R2Q A;  3MJW A;  3PHW B;  4W9K A;  2NR2 A;  2J0K A;  2JVC A;  4FLH A;  5C23 A;  5IAA C;  3T8M A;  1VCB A;  1VD2 A;  1E8Y A;  3R7R A;  2DHZ A;  2DZI A;  2IO1 B;  1WY8 A;  1ZKH A;  2AYO B;  3VTU A;  4GDK A;  4MJS A;  3L17 A;  1L2N A;  3UIO B;  3EEC A;  2CS4 A;  1WX8 A;  3L10 B;  4OVU A;  4XX5 A;  4EOY A;  4LCD E;  3ZLZ A;  2N4F A;  2DYM A; 
#chains in the Genus database with same CATH topology
 1V86 A;  1YN3 A;  4BKG A;  2WWZ A;  3H7P B;  2KZR A;  2Z0E B;  4EEW A;  1TGZ B;  4HJG E;  3AE9 B;  4JE3 B;  3GZN I;  4G50 A;  4RNA A;  1I35 A;  2BT6 A;  2V3N A;  4X57 B;  4AJY B;  2M56 B;  2RD0 A;  2JT4 B;  1P98 A;  3VR8 B;  2OHF A;  1P7E A;  4FAD A;  1UUP A;  3P4R B;  1V1P B;  5HHD G;  3SFE B;  1T0S C;  3KYC D;  3APD A;  3DCG A;  2INP E;  3DBL B;  2V3P A;  3B2G A;  2MCN B;  3I9V 1;  3NJT A;  3AN1 A;  3LDZ E;  4CQN A;  5AEK B;  2ICI A;  1HQR D;  2C5L C;  4URK A;  2Q5W D;  2HTH A;  4C4V B;  3AE4 B;  3N1Z C;  1XT9 B;  3JYU A;  1F52 A;  3TCA A;  5EE3 A;  2ZCB A;  4IUM B;  3ABV B;  3PRM B;  3C19 A;  4D2K A;  1D5M C;  3NUH B;  2MBO A;  3WA0 A;  3VHT C;  5BO4 B;  2DZM A;  1T5X D;  3HRD D;  4N59 A;  3RNB C;  4HK2 A;  1SE3 A;  1TTN A;  2LUE A;  1I7H A;  3QAR A;  4YSX B;  3AEC B;  2LFI A;  4OZA A;  4W9J A;  1V1O A;  4P1B C;  2J42 A;  4ZYS A;  1ZUD 2;  4WQM A;  4RF1 A;  1MHH E;  1C78 A;  2M19 A;  2K8H A;  1F2R I;  1JWA D;  2PE9 A;  2HD5 B;  3AXC A;  4NAW B;  4FJV B;  3U4E G;  5J2R A;  4A3P A;  2HJ8 A;  3RNA C;  1AW7 A;  3AE5 B;  1WYG A;  2G1E A;  3RYT A;  1SXT A;  3VFK A;  1NDD A;  1TJE A;  3HM3 A;  3ZQ4 A;  3Q8C A;  2LD9 A;  2WXO A;  2DYO A;  4EFO A;  4IKG A;  1RRB A;  1SE2 A;  1WIA A;  3U7D A;  4WJO A;  1WXQ A;  2JUO A;  5IA7 A;  1PGA A;  2B3A A;  2KKC A;  3CIR B;  5DPS A;  2LZ6 A;  1XCT L;  4FN2 A;  1SB3 C;  2MLB A;  1HEZ E;  2WXR A;  2BYV E;  4HRS A;  5G5G A;  2BKF A;  2RPQ A;  2IZV B;  2PTL A;  2BW2 A;  3CWI A;  2WGS A;  1JML A;  5FKA C;  3RMK C;  2JY6 A;  3VUX A;  1E7U A;  5JH5 C;  2FNJ B;  3JVZ X;  3VDZ A;  3DHG C;  5IKC M;  2LWP A;  3DBS A;  1TY0 A;  2AWT A;  2KC1 A;  4LJO B;  4GGQ A;  1ZXH A;  2ZNV C;  4XC2 A;  3Q2A C;  2XN9 C;  3DPD A;  2LGD A;  2J52 A;  3H7S A;  3O13 A;  4EKU A;  1JW9 D;  4IM0 A;  5G55 A;  4RGN A;  4GLS C;  2EEL A;  4JWS C;  4EZK A;  4ITK A;  3H7P A;  4ANU A;  4OW0 A;  2L83 A;  1JRO A;  2FUH B;  3C0R B;  1CQV A;  4K7W A;  1Q1O A;  3A4R A;  1SSN A;  1ZOY B;  4B6W A;  2K6Q A;  1YD8 U;  1J7C A;  3DHH C;  2MP2 A;  1T0R C;  3AE1 B;  1V1P A;  1EUV B;  3P42 A;  1C4C A;  4GDK B;  1VZ7 A;  1FXT B;  2H89 B;  4PT5 A;  3ZKJ C;  1V97 A;  1N60 A;  4BBN C;  3TJP A;  2L32 A;  4N6E B;  1YJI A;  4N58 A;  2J53 A;  1WFY A;  1WGR A;  1WJ4 A;  4A20 A;  2OED A;  4C4V A;  1D5Z C;  2I1J A;  4UDU C;  3E9S A;  4S17 A;  1ROE A;  4GSW A;  1HTO A;  2WXL A;  2BKR B;  3ZDM C;  1NI2 A;  1IYF A;  1P9D U;  3VR9 B;  3VVW B;  3SR6 A;  3NOB A;  2KDB A;  3V05 A;  1YQ4 B;  2QMT A;  1E7P B;  3AEG B;  1X1M A;  2RR9 A;  1TKE A;  2YEP B;  1V49 A;  3DVG X;  2FIF A;  1ENF A;  3P2B A;  3QA8 A;  2KN5 A;  3GS2 A;  4A9A A;  3QIJ A;  4IWP A;  4MM3 B;  1MI0 A;  4C80 A;  3HIZ A;  4LDT D;  4LJP B;  1WXA A;  1HZ6 A;  2ONQ A;  3NS8 A;  1R4M B;  4YXD B;  2K0P A;  2O2V B;  2IJ0 A;  2MH7 A;  1GNU A;  2K8C A;  1QQR A;  1FNU A;  4NAW A;  1V80 A;  5KHO A;  1HE8 A;  3P4S B;  1WM2 A;  2ZNV B;  1WE6 A;  1R4M I;  2UU7 A;  3HM6 X;  3I3T B;  4MGY E;  4GU2 A;  1GG3 A;  1SJE D;  5CX3 A;  1KM7 A;  2NMQ A;  4HWI B;  1WWT A;  2OOB B;  1YNT E;  1GAQ B;  2AQ3 B;  1LQB A;  2JWU A;  1P7F A;  3BVG A;  1UZX B;  2HDE A;  1FEH A;  5MPO A;  3VH3 B;  3EC8 A;  2DZJ A;  3VRB B;  2BWF A;  4ZRJ A;  4JQW C;  2RDH A;  3BVZ A;  2D3A A;  4LTU A;  3N9Y C;  3KW5 B;  3K9O B;  4EUT A;  1C4A A;  5LNK 1;  3R3M A;  2ZCC A;  4BAX A;  2JYE A;  3AMZ A;  3I57 A;  4XWT A;  2MWS B;  2WXM A;  1WRD B;  2K22 A;  2Z8L A;  3AEF B;  3EGR A;  4L2Y A;  3Q8E A;  3L54 A;  3NS1 A;  2G45 B;  4M8M A;  4DK5 A;  1JCK B;  2BQQ A;  4K3B A;  4NQL B;  1B9R A;  2IO3 B;  2UWQ A;  2QSD A;  1K52 A;  4I6P A;  1BUI C;  2PKO A;  1VZ6 A;  4P6V F;  4RGM A;  1F77 A;  2O6V D;  2BB5 A;  2PJH A;  4ICV A;  2NS5 A;  2L05 A;  3P1M A;  2KWV B;  1FM0 D;  3BYT B;  1TKG A;  2JPH A;  4LDT B;  4M01 A;  3DWM A;  2N9X A;  3IAS 1;  1IPG A;  1ZGU B;  1JRU A;  4YSY B;  4H2A A;  3AI5 A;  4P1C C;  3MHS D;  5G5H A;  3QHT A;  3ZXV A;  3QK0 A;  4DXA B;  2JZ3 B;  4A3O A;  1EU4 A;  4HDO A;  4LNO A;  4M00 A;  5EE0 A;  3PZD A;  2JWZ A;  3V61 A;  1Y56 A;  1WZ3 A;  1XXG A;  1OEY A;  3DWG C;  1XLO A;  3U2S C;  4ICU A;  1TIF A;  3PRP B;  2L0T A;  2PEA A;  1JAL A;  2NR2 A;  4FLH A;  5C23 A;  1VCB A;  2EKI A;  1FD6 A;  2DHZ A;  2AYO B;  3VTU A;  4GDK A;  3L17 A;  3UIO B;  1HXY D;  4EOY A;  1WX8 A;  3C8Y A;  4XX5 A;  4HRO A;  1HA5 A;  2OJW A;  3I63 C;  3U52 E;  2N4F A;  2VZK D;  2DYM A;  1CZP A;  2WX0 A;  1TBE A;  5AUI A;  1F1H A;  3HK0 A;  3TEX A;  3FC4 A;  1KH0 A;  3UI3 A;  4KZC A;  4DBG A;  2JQR B;  1V2Y A;  1UEL A;  3PLV A;  2FCQ A;  2X8X X;  5BMG A;  1FXI A;  4A55 A;  2QC8 A;  4HEA 1;  2EMT A;  5E6N A;  4CHK A;  1WMH B;  4AWJ A;  1RAX A;  3KVF B;  2WU5 B;  5BMI A;  2IGD A;  3V60 A;  1C3T A;  4MM3 A;  1KJT A;  2D11 A;  2M1M A;  4YL8 A;  3N30 A;  3SDL C;  2IDY A;  2PVG C;  3DBR I;  1WRI A;  2ASQ A;  2O6V B;  1QF6 A;  2AL6 A;  4HKQ A;  2O2V A;  3QWZ B;  2J4X A;  1YN5 A;  3Q8A A;  4RM8 A;  4RCO A;  2CHZ A;  1ACC A;  1D3Z A;  1MPE A;  1WJU A;  2A4Z A;  3A1Q B;  2JXX A;  5DPT A;  2KVR A;  2PMV A;  4OVV A;  1M4V A;  3W5V B;  4NJ6 A;  1KOT A;  5H8Y E;  2IND C;  5E6O A;  3ZNH B;  2UYZ B;  2GRI A;  3H9D A;  3I5J C;  2LAS A;  4B0E A;  1PUT A;  5IP4 D;  1QOF A;  5D6J B;  1PGX A;  2KTR B;  2ZJD A;  2LGI A;  5DCN A;  2MJD A;  3V62 A;  1XLP A;  3LXF A;  2LMC A;  4FXC A;  4XDC A;  1AN8 A;  1WGY A;  2G4S A;  1LO5 D;  3SD5 A;  4W9G A;  4NY0 A;  2VH1 A;  2VZK B;  1XLN A;  2MBQ A;  2BS3 B;  1L0Y B;  4KVG B;  5H92 C;  1NYQ A;  2WQY B;  2JXT A;  3UIP B;  2LRU A;  1VRA B;  2GMI C;  4E3C A;  3ZVV A;  3AE7 B;  3VXW A;  2CKH B;  3ZTC A;  1NVI D;  4GOC A;  4AP4 C;  2G3Q B;  1NEK B;  1FNV A;  2JSV X;  5EDS A;  5EE1 A;  3J9C A;  1IUE A;  4GXB A;  2L3Z A;  1TS5 A;  2KNB A;  2IY0 B;  4L23 A;  3CSF A;  4BFR A;  4BOZ B;  3TEW A;  2KJH B;  3L0W B;  2QCZ A;  1E9M A;  3EFU A;  1AWD A;  4LK0 M;  2KMC A;  2H88 B;  4KGR A;  3W2D A;  3W1Y A;  2M17 A;  3AE6 B;  4WAF A;  4C56 C;  1C79 A;  2L00 B;  3MJ5 A;  4WWM A;  2V4L A;  4USA A;  4RGO S;  2IGG A;  2JYT A;  3NVW A;  1L6U A;  1WGG A;  2YLM A;  2HTM E;  1RM6 C;  4OZB A;  2GI9 A;  3DBL I;  2IY1 B;  1UWM A;  2KLG A;  4PS7 A;  5FK9 C;  1MJD A;  4YTM B;  4DDG D;  4K3C A;  2X38 A;  3M3J A;  3VRA B;  1UF0 A;  3RD2 A;  2JU6 X;  2N9P C;  4KDI C;  5TSS A;  2BTE A;  1BT0 A;  3X0W A;  2MRP A;  3BZD B;  1E8Z A;  3PZ8 A;  3UIN B;  4KSL C;  5BYQ A;  3IG3 A;  4PS8 A;  1WMH A;  3R8B A;  5LLI A;  1N5X A;  1MG4 A;  2ZVO A;  1L4D B;  1TT5 B;  2DX5 B;  3DVN V;  3L08 A;  4FBJ B;  3ETR A;  4BOS C;  1YIW A;  5LXH A;  1OQR A;  2O6V A;  3JW0 X;  1WXS A;  2KAJ A;  5D3I B;  4KSK C;  2KT7 A;  1CJE A;  1UH6 A;  4II3 B;  1JWM D;  2KX3 A;  3Q3M C;  2Z59 B;  3A9J B;  1P0R A;  1EM7 A;  1MFW A;  4MT5 A;  4K7U A;  4GDL B;  4KIK B;  4TSS A;  2SAK A;  1L0V B;  4IWO A;  1KLG D;  3AM9 A;  3B1L X;  1XCQ L;  2M0A A;  1LFD A;  4R3D A;  5JXV A;  3VUW A;  5KHQ A;  3ZW3 A;  2WNM A;  2MBH A;  2MJ3 A;  3B0A A;  1MHX A;  2KTR A;  3Q8B A;  3KUZ A;  3H8H A;  1I42 A;  3KH0 A;  1T6B X;  5J18 A;  2Y5B B;  3SFD B;  3R2T A;  2XBB C;  2NVU I;  1XO3 A;  2I1K A;  2ZW0 A;  1OTR B;  2CU1 A;  1NYR A;  1J7A A;  3H6N A;  4ARI A;  2PLP A;  5GMV A;  2IBI B;  3VUY A;  2D5G A;  4IOI E;  4ANV A;  2R61 A;  1H8C A;  1V5T A;  1N61 A;  4BKT A;  3T3N A;  4HPP A;  1IGC A;  3AEE B;  2RMM A;  2J7Q B;  1WYW B;  3RZF A;  3ZJT A;  4S0R A;  1F9J A;  3NG0 A;  2AQ1 B;  2QEJ C;  2L8J A;  3Q14 C;  3DVN U;  1ZW7 A;  3ZGZ A;  3PT2 B;  3A33 B;  3WAO A;  1V81 A;  1UGJ A;  5BYS A;  4HXD A;  4NNJ B;  3VTV A;  4ZDV A;  2ZVN A;  1V9J A;  1WGH A;  4G0N B;  1T0Y A;  2LGS A;  3ZXR A;  4IM3 A;  2ZEQ A;  3NZU A;  2K39 A;  4IDI A;  1Q10 A;  3FAH A;  2N9E B;  1G6J A;  5JZE B;  3AE2 B;  3RZW C;  3KYD D;  2D07 B;  2V0G A;  1STE A;  4P16 A;  4NPN A;  3ZDT A;  4ANW A;  2LXA A;  4WIP A;  1EO6 A;  2C60 A;  3WAN A;  3PGE A;  3PSE B;  3HVZ A;  3APC A;  5G2N A;  1I4P A;  2JZZ A;  2JX5 A;  5AZG A;  4DHZ B;  2JRH A;  2ZW1 A;  3GE8 C;  2YEP F;  4MSM B;  3WAL A;  5J17 A;  3DBH B;  3BY4 B;  2G4D B;  3AED B;  2QIE B;  2JRI B;  2MHJ A;  3PV1 A;  1UBQ A;  3PVL A;  1I4Q A;  2RPV A;  3MC8 A;  4W9F A;  5I4D A;  2ACZ B;  2V9H A;  1Q5W B;  1L7Y A;  1B1Z A;  3L13 A;  5JHB A;  1WM3 A;  5D94 A;  1XD3 B;  3OWE B;  2I2Y A;  1D5X C;  2CR5 A;  1UGM A;  4GIV A;  1RFA A;  2PVO D;  3MJW A;  4W9K A;  1XF5 L;  1TZO A;  5IAA C;  3T8M A;  2W82 A;  3R7R A;  2IO1 B;  1ZKH A;  1L2N A;  1GB1 A;  2CS4 A;  3MHZ A;  3MP9 A;  4J3O D;  3ZLZ A;  1WR6 E;  2DLB A;  4GMV A;  2GOW A;  3TUO A;  3APF A;  1WJ6 A;  3RNG C;  1QZE A;  1E5W A;  2KMM A;  1WJN A;  3N20 C;  3TL5 A;  3AH7 A;  3VQI A;  1ZP0 B;  2GB1 A;  2KDF B;  4KKI A;  1WGK A;  2W9N A;  2KXJ A;  3A9J A;  3EA6 A;  5DPW A;  3TIX A;  1WE7 A;  4MEL A;  4JL9 A;  2LVP A;  3IBE A;  1PQS A;  3X23 A;  1E7V A;  4GDL A;  4KDL B;  1RFK A;  3JSV B;  5JHA A;  4HPM B;  2FCS A;  1F0Z A;  2L7R A;  4BBN F;  2VH2 A;  4LNN A;  1WSP A;  2BS4 B;  2N7D A;  1NBF C;  3IFW B;  4K81 A;  2QJL A;  3ZUN A;  3P63 A;  1SF0 A;  1IBX B;  3QJZ A;  1RLF A;  4TUU A;  1JWS D;  3IT4 B;  2KWC A;  3KWL A;  3DHI C;  4B95 A;  1E8W A;  2MA9 B;  5HKH A;  4HCN B;  1XEE A;  3GP7 A;  2WXH A;  3U8Z A;  3NVZ A;  3P4Q B;  1YQ3 B;  1LM8 B;  4C7Z A;  2WDV B;  4ZOH C;  1UD7 A;  4W9H A;  3OJ4 B;  4FJZ A;  4BKS D;  2KC2 A;  4EE2 A;  1T0Q C;  2PPH A;  1H4R A;  2GBJ A;  4O1N A;  4DHJ D;  3D32 A;  4MJS B;  2Y5P A;  1WH3 A;  2DBY A;  1RWS A;  4PK1 A;  2B76 B;  1WGD A;  4DXF A;  1FO4 A;  2C7M B;  2V4I B;  3ZNG C;  5E6J A;  1EU3 A;  2LGX A;  3QCA A;  5C1Z A;  1J19 A;  2RSU A;  3SHQ A;  1PGB A;  2BYF A;  4WWN A;  2RGF A;  1R4N B;  3AV8 A;  1NEN B;  1V8C A;  3OG5 A;  3KUC B;  2WU2 B;  2WXG A;  4XYC A;  1XLQ A;  3A4S C;  4US9 A;  4GB9 A;  1Z2M A;  3AEA B;  4A90 A;  2GBN A;  4NJ7 A;  2REX A;  2CHW A;  3PLU A;  2NBV B;  4JIO U;  2KOX A;  4J6I A;  3DDC B;  3NVY A;  1MVK A;  2KLC A;  1I4H A;  4A6Q A;  1GJZ A;  5CHV C;  3KQ4 A;  2LEK A;  5L95 C;  1WX7 A;  1ZE3 D;  3URY A;  3T3O A;  2L0F A;  3ONS A;  1EWY C;  1QLB B;  2AQ2 B;  3CF6 E;  4ARC A;  1FMA D;  3H1U A;  3SEB A;  3NZ3 A;  3S2A A;  1KFY B;  2WXP A;  4W9C A;  1BML C;  3B08 A;  4EZL A;  4E74 A;  5C2T B;  2WXN A;  2SEB D;  2XK5 B;  4MSQ B;  4LNF A;  4DHJ B;  3QAQ A;  2CJN A;  4REZ A;  3TMP B;  4MGZ E;  4WJP A;  1EF5 A;  1JWB D;  3N3K B;  3FIL B;  4FHJ A;  2LHE A;  3CMM B;  1YJ1 A;  1SE4 A;  4IG7 B;  1TS2 A;  2YVC A;  4XDD A;  2KWD A;  2KN4 A;  3Q8F A;  5C3J B;  3WAM A;  2LI5 A;  3W1S C;  3IXS A;  1VJK A;  4ASW C;  1YX5 B;  2IGH A;  2MEK A;  1I4R A;  4AJW A;  2L1A A;  5T8I A;  3LJ3 A;  3ZIM A;  3PTF C;  4XZ4 A;  2BVC A;  1SIF A;  2K25 A;  4W9E A;  1VLB A;  2MJE A;  3JSV A;  3AB5 A;  3AE3 B;  4XGA B;  4KX6 B;  4CO7 A;  4HKZ E;  4PYZ A;  1D4B A;  4DWF A;  1E10 A;  1IBX A;  2WXF A;  3UF8 A;  3RPF C;  2C9W B;  1S1Q B;  2C7H A;  2D3G A;  5CHF A;  2MSE D;  1FIQ A;  3Q3O C;  4DXG A;  2JF5 A;  3UQB A;  3OLM D;  1OEY J;  3RI7 C;  3ZJV A;  5FR6 A;  2INC C;  1OFF A;  2ZPY A;  3L4P A;  2ZPN A;  4MH0 E;  1FCC C;  4MGI E;  4YT0 B;  1WX9 A;  1KF6 B;  4HJK A;  2N7E A;  2OJR A;  1TZ1 A;  1ZPS A;  2R2O A;  3WCQ A;  2WXI A;  3GZN B;  4JLC A;  2WXJ A;  2MBE A;  1GB4 A;  5IOI A;  3PPA A;  1D6E C;  1I4G A;  1LXD A;  2ZZP B;  1BXT A;  1FRR A;  3Q3J A;  3AU4 A;  1ZXI A;  3PS6 A;  4HVB A;  1HZ5 A;  1L4Z B;  3RFZ B;  2KX0 A;  2K6D B;  2WP9 B;  5D3D A;  3ZJU A;  1YN4 A;  3RNF C;  1WR1 A;  3PO0 A;  4WQO B;  1NI3 A;  2KAC A;  2DAF A;  1UBI A;  2DWQ A;  2EKE C;  2K1F A;  1KRH A;  2MP2 B;  4BZA A;  1OQY A;  4PS3 A;  4ACF A;  2KO3 A;  2WX1 A;  3W5U B;  4P7I A;  3DOW A;  2DEN B;  3MTN B;  2EMS A;  1SEB D;  1A5R A;  3TEY A;  4MH8 A;  3QC8 B;  1JWU D;  4ZRQ A;  4JX1 C;  4KGT A;  2IO0 B;  2BYT A;  3KUD B;  2BF8 B;  4K1R B;  2HJ1 A;  4MGK E;  2FCN A;  4RMA A;  4ZRP A;  3R2I A;  4AQ7 A;  5TR5 A;  5FR3 A;  3TBL D;  2W55 A;  4RF0 A;  4B0M A;  1E8X A;  3Q6B A;  3QX1 A;  1S3S G;  2KDI A;  2D10 A;  2N9K A;  3EUB 2;  2W3S A;  3HVD A;  1JQ4 A;  5EE9 A;  1PFD A;  3O65 B;  2AL3 A;  1QOB A;  2LRW A;  4FA6 A;  4NAM A;  4M0W B;  2QHO A;  2LUM A;  4G11 A;  2N0S B;  1YQB A;  1WXM A;  2KQS A;  1AYF A;  3EHV A;  4E71 A;  4ZRI A;  1DGJ A;  4BKS A;  1K8R B;  2K3U A;  3BK2 A;  1C9F A;  4PYU A;  1P1A A;  2XK5 A;  4W9I A;  2KMA A;  3BYY B;  3U7Z A;  2KAN A;  2WYQ A;  4W9D A;  1N6Z A;  1N63 A;  3A1Q A;  4YWG G;  1DYQ A;  1WZ0 A;  3FIL A;  2N1V A;  3NVV A;  4NJC A;  3Q3F A;  3BIN A;  4CYE A;  3KLS X;  2V1Y A;  5AUK A;  4WWO A;  1RYJ A;  5BYR A;  1L6V A;  1QT9 A;  2R2Q A;  3PHW B;  3Q3N C;  3KWV A;  1TKY A;  5HFY A;  1C77 A;  2WXQ A;  2LJI A;  3EEC A;  3L10 B;  2XNA C;  2WHI A;  4LCD E;  1FNW A;  3RN9 C;  2BS2 B;  3FKY A;  1SE9 A;  2FCM A;  1C4P A;  4GN1 A;  4FHK A;  2FAZ A;  5D7G A;  1FFV A;  1Z5S B;  3BVM A;  3GE3 C;  4WUR A;  3W9C B;  4KV2 A;  4IM2 A;  3N1X C;  2D3C A;  4OZC A;  1MG8 A;  4FUL A;  1ZDX A;  1TYG B;  4F8C B;  4JGH B;  1E0Z A;  1IP9 A;  2RDG A;  4F7Z A;  1FPY A;  1LGR A;  2D3B A;  2NPT B;  4DHZ E;  3M95 A;  4NZL B;  2NTS A;  2BYE A;  2GLS A;  4OHJ A;  1L5P A;  2KTF A;  3SU8 X;  2M4N A;  4C00 A;  3EFC A;  4AS1 A;  2ON8 A;  2GBM A;  2J0J A;  3VTW A;  3K9P B;  4YTP B;  2DNF A;  3DVG Y;  4YSZ B;  1TS4 A;  2FID A;  1C76 A;  2FE8 A;  2Z0D B;  1VR9 A;  1KLU D;  1CMX B;  2IO2 B;  4I6N B;  4TV3 A;  1A70 A;  5E6P A;  1FXA A;  5D2M B;  2KFK B;  3IHP C;  1N62 A;  4WWP A;  3DQV A;  1CK1 A;  5HI1 A;  4HLE A;  3B2F A;  1QIL A;  2NCN A;  2LJ5 A;  2LXC A;  2WLB A;  1Q0W B;  1UNS A;  2MQJ A;  3AEB B;  1K50 A;  3R7Q A;  2GBR A;  3W1S A;  2KFJ A;  4FJY A;  4MDK E;  2RDB C;  4MEM A;  3RUL A;  1J7B A;  5IO9 A;  1VDV A;  4N9F 4;  2E6X A;  1I4X A;  3HHM A;  1N5W A;  3DBH I;  4LNI A;  1PYW D;  1E90 A;  3A9K B;  2BBC A;  2LVQ A;  4OVZ A;  3OAW A;  2FUG 1;  2G9H D;  2BGF A;  1V6E A;  2TSS A;  3N1Y C;  3VH4 B;  1FRD A;  2KJ6 A;  2KJR A;  3AUL A;  3V6C B;  2BWE S;  3MFG A;  3ZYY X;  5CHW A;  1V5O A;  3VAW A;  2K9X A;  1ET6 A;  1WI0 A;  4M0W A;  4WAA A;  3P4P B;  4US8 A;  5DPR A;  3ZNZ B;  3BII D;  1J0G A;  1YOV B;  1QOA A;  3HUI A;  3GOE A;  5IN7 A;  2CU3 A;  2NBW B;  4IC7 B;  2PE6 B;  4KIK A;  4RH6 A;  2WDR B;  2D2Q A;  4G3X B;  1YJJ A;  4DDI D;  4JWU C;  1YX6 B;  3TEZ A;  3RNE C;  3LB8 C;  3NZS A;  4L1B A;  3RCZ A;  4RGT A;  2DZK A;  3WAP A;  4XWW A;  3L16 A;  3QQ8 B;  3AE8 B;  1U4A A;  3PRZ A;  3RT3 B;  3V3X A;  4F1S A;  4JPS A;  2PW9 A;  4WJQ A;  1K51 A;  2C7N B;  5CTR C;  3ENE A;  3R66 C;  4LLG M;  2L76 A;  4A8X C;  1JRP A;  4WJN A;  2KQ7 A;  2V3S A;  4TQ1 A;  1YMH E;  4WH4 A;  1Y8R C;  1EWC A;  1KLV A;  1L0X B;  1SJH D;  2HE7 A;  3AU5 A;  1K53 A;  1GC7 A;  4QAY A;  1TY2 A;  3E56 A;  3PZ7 A;  1QKZ A;  2L52 A;  1WXV A;  4ZHP A;  1PDX A;  3RNC C;  2GBK A;  1GUA B;  2NPT A;  4TMA B;  1GC6 A;  2M8S A;  2CHX A;  4KKJ A;  2N1W A;  2I38 A;  1UWX A;  3MC0 B;  3OJ3 A;  2MBB B;  3ML9 A;  3V6E B;  2KK8 A;  4M8N A;  4RFB A;  1ZDV A;  2WS3 B;  3UGB B;  2KYW A;  2K8B A;  5AZF A;  4W9L A;  4BVU C;  3IVF A;  2MX2 A;  4ZHO A;  5AZH A;  1WF9 A;  2KQ4 X;  1DOX A;  1GPX A;  2KDM A;  4IWQ A;  2NTT A;  2KVZ A;  2A5U A;  2BPS A;  2N9L A;  2KFK A;  3ZNI D;  1R4N I;  2W3R A;  2Y3A A;  2MW5 A;  4EZJ A;  1FFU A;  1OGW A;  4Q2J A;  2AEH A;  2LHD A;  1P3Q U;  2JZP A;  3ZO5 B;  4B9K A;  5L83 A;  2LVO A;  5LXI B;  3LYY A;  1AAR A;  1OQQ A;  2QIL A;  4ZRK A;  3ECI A;  2VRR B;  4II2 B;  1IGD A;  3B9J A;  5HG2 A;  3U30 A;  3ZRF A;  1DOY A;  5BMH A;  3DBR B;  4TQ0 A;  2DYB A;  3T9L A;  3A9K A;  1XQQ A;  1SBB B;  2WXK A;  4XE0 A;  4C7Y A;  1VZ8 A;  1HTQ A;  3M63 B;  2N7J A;  1QOG A;  2INN E;  4MAC A;  4NQK E;  2M0X A;  3BWU D;  2NBU A;  1TS3 A;  2IYD B;  4I6L B;  3M62 B;  1GOZ A;  2KD0 A;  1KTK A;  3NY5 A;  2J0M A;  2FBW B;  3IAM 1;  1ET9 A;  2IPK D;  2LGY A;  3NHE B;  2KDE B;  3PRE A;  2W54 A;  3CST A;  3ZRC A;  3ALB A;  2E3T A;  3ML8 A;  1ISN A;  1T3Q A;  1F2R C;  4M02 A;  1R7S A;  2QDF A;  4HPL B;  4TKN A;  3RUI B;  1EF1 A;  2Y5C A;  3GB1 A;  1SGH A;  2K5P A;  4K7S A;  4LNK A;  5GXG B;  3UQA A;  3BK1 A;  3N32 A;  3PHX B;  2PIA A;  1ESF A;  4KZ0 A;  3ZTD A;  2WDQ B;  4AUQ C;  4ANX A;  1J8C A;  1C1Y B;  4RM9 A;  3TSS A;  4AOF A;  2AX5 A;  4DQO C;  1FCL A;  2XEW A;  3Q69 A;  1M94 A;  3WIM A;  4HCP B;  4YTN B;  4IW0 A;  2KWU B;  2DAJ A;  1SIJ A;  4ZYN A;  2WDT B;  4KGS A;  2KHW B;  4HDQ A;  2J0K A;  2JVC A;  1VD2 A;  3IT6 B;  1E8Y A;  3NRZ A;  2CJO A;  2DZI A;  1WY8 A;  2BB6 A;  4MJS A;  1E6E B;  4OVU A;  1DOI A;  3MC9 A; 
#chains in the Genus database with same CATH homology
 1SE9 A;  1V86 A;  2FCM A;  1WR6 E;  4GN1 A;  2WX0 A;  4FHK A;  2FAZ A;  4BKG A;  5D7G A;  1TBE A;  1Z5S B;  4GMV A;  2WWZ A;  3H7P B;  2KZR A;  3HK0 A;  2GOW A;  2Z0E B;  3APF A;  4EEW A;  1WJ6 A;  1QZE A;  1TGZ B;  1E5W A;  1WJN A;  3TL5 A;  3GZN I;  4G50 A;  4KZC A;  4KV2 A;  1I35 A;  4DBG A;  4IM2 A;  4X57 B;  4AJY B;  1V2Y A;  1UEL A;  3VQI A;  1MG8 A;  3PLV A;  2FCQ A;  4FUL A;  2RD0 A;  2KDF B;  2JT4 B;  1P98 A;  2W9N A;  2KXJ A;  3A9J A;  4F8C B;  4FAD A;  5DPW A;  4JGH B;  3TIX A;  1WE7 A;  2EMT A;  4MEL A;  5E6N A;  4JL9 A;  2LVP A;  3IBE A;  4CHK A;  1PQS A;  3X23 A;  1WMH B;  3KYC D;  1RAX A;  3KVF B;  4AWJ A;  1E7V A;  3APD A;  4GDL A;  4KDL B;  3DCG A;  1IP9 A;  3JSV B;  5JHA A;  4HPM B;  4F7Z A;  2FCS A;  2MCN B;  3V60 A;  2NPT B;  1C3T A;  2L7R A;  4DHZ E;  4MM3 A;  3LDZ E;  3M95 A;  1KJT A;  2D11 A;  2M1M A;  4BBN F;  4YL8 A;  5AEK B;  3N30 A;  2C5L C;  2N7D A;  4URK A;  1NBF C;  2HTH A;  3IFW B;  3SDL C;  2BYE A;  4K81 A;  3ZUN A;  2KTF A;  3SU8 X;  3DBR I;  1XT9 B;  2ASQ A;  2M4N A;  2O6V B;  2AL6 A;  3JYU A;  3TCA A;  2O2V A;  2GBM A;  2J0J A;  3QWZ B;  2ZCB A;  3VTW A;  3QJZ A;  4IUM B;  1RLF A;  3K9P B;  3PRM B;  3DVG Y;  2MBO A;  3WA0 A;  4TUU A;  3VHT C;  5BO4 B;  2DZM A;  2KWC A;  4RM8 A;  2CHZ A;  4B95 A;  1E8W A;  2FID A;  2MA9 B;  1WJU A;  1D3Z A;  5HKH A;  2Z0D B;  4HK2 A;  2A4Z A;  3A1Q B;  1TTN A;  2JXX A;  2LUE A;  3QAR A;  5DPT A;  4HCN B;  2KVR A;  4W9J A;  4OVV A;  1CMX B;  4NJ6 A;  1KOT A;  5E6O A;  3U8Z A;  2IO2 B;  4I6N B;  4TV3 A;  3ZNH B;  2UYZ B;  5E6P A;  3H9D A;  5D2M B;  1LM8 B;  2KFK B;  3IHP C;  2LAS A;  1UD7 A;  4WWP A;  4W9H A;  3OJ4 B;  5D6J B;  3DQV A;  2KTR B;  2ZJD A;  4FJZ A;  4BKS D;  2KC2 A;  2K8H A;  4HLE A;  2PE9 A;  2NCN A;  2PPH A;  2LJ5 A;  1H4R A;  2HD5 B;  2GBJ A;  3AXC A;  4NAW B;  5DCN A;  3V62 A;  4DHJ D;  3D32 A;  4FJV B;  4MJS B;  2LXC A;  1WH3 A;  5J2R A;  4A3P A;  2HJ8 A;  1Q0W B;  2MQJ A;  1WGD A;  3RYT A;  1WGY A;  3VFK A;  1NDD A;  2G4S A;  3R7Q A;  2GBR A;  3HM3 A;  2KFJ A;  4W9G A;  3SD5 A;  3W1S A;  2C7M B;  4NY0 A;  3ZNG C;  2LD9 A;  4FJY A;  2DYO A;  4MDK E;  4EFO A;  4MEM A;  3RUL A;  2MBQ A;  2LGX A;  3QCA A;  4N9F 4;  5C1Z A;  1RRB A;  1J19 A;  2RSU A;  3SHQ A;  3HHM A;  2BYF A;  4KVG B;  3DBH I;  1WIA A;  4WWN A;  2RGF A;  3U7D A;  3UIP B;  2LRU A;  1E90 A;  4WJO A;  2GMI C;  3A9K B;  2JUO A;  4E3C A;  5IA7 A;  2LVQ A;  3ZVV A;  3KUC B;  3OAW A;  3VXW A;  2CKH B;  2B3A A;  2BGF A;  2KKC A;  3A4S C;  3ZTC A;  4GB9 A;  1V6E A;  4GOC A;  4AP4 C;  2G3Q B;  5DPS A;  1Z2M A;  2LZ6 A;  3VH4 B;  2GBN A;  2KJ6 A;  4NJ7 A;  2REX A;  2KJR A;  3AUL A;  2CHW A;  3V6C B;  5EDS A;  3PLU A;  2NBV B;  2BWE S;  2KOX A;  4JIO U;  4J6I A;  4FN2 A;  5CHW A;  1V5O A;  2L3Z A;  3DDC B;  4GXB A;  2MLB A;  3VAW A;  1WI0 A;  2KNB A;  2KLC A;  2IY0 B;  2BYV E;  3CSF A;  4BFR A;  4BOZ B;  4WAA A;  1GJZ A;  5CHV C;  2BKF A;  2RPQ A;  2KJH B;  5DPR A;  3L0W B;  1WX7 A;  5L95 C;  2IZV B;  3ZNZ B;  1J0G A;  2L0F A;  3EFU A;  3GOE A;  3ONS A;  2KMC A;  2NBW B;  2JY6 A;  4IC7 B;  1E7U A;  3VUX A;  2PE6 B;  4KIK A;  2FNJ B;  5JH5 C;  2D2Q A;  4G3X B;  3W1Y A;  3JVZ X;  3VDZ A;  2M17 A;  3CF6 E;  4DDI D;  3H1U A;  2LWP A;  3DBS A;  1YX6 B;  3S2A A;  2L00 B;  2AWT A;  2KC1 A;  2V4L A;  4LJO B;  4GGQ A;  2ZNV C;  3NZS A;  3RCZ A;  2DZK A;  3WAP A;  4XC2 A;  3L16 A;  3QQ8 B;  4W9C A;  3DPD A;  1U4A A;  2LGD A;  3B08 A;  3PRZ A;  3RT3 B;  1WGG A;  3H7S A;  2YLM A;  4E74 A;  4EZL A;  4EKU A;  4IM0 A;  4F1S A;  3DBL I;  2IY1 B;  4WJQ A;  2XK5 B;  2KLG A;  4PS7 A;  4MSQ B;  4DHJ B;  2C7N B;  4DDG D;  5CTR C;  3ENE A;  3QAQ A;  3R66 C;  3M3J A;  5G55 A;  3TMP B;  4MGZ E;  3RD2 A;  4WJP A;  1EF5 A;  3N3K B;  4EZK A;  2L76 A;  3H7P A;  2N9P C;  4WJN A;  2KQ7 A;  2V3S A;  4FHJ A;  4KDI C;  4TQ1 A;  4ANU A;  3CMM B;  1YJ1 A;  1Y8R C;  2FUH B;  4IG7 B;  3C0R B;  2YVC A;  4K7W A;  3WAM A;  1BT0 A;  1Q1O A;  3A4R A;  2LI5 A;  1KLV A;  3W1S C;  4B6W A;  3X0W A;  4ASW C;  1YX5 B;  2HE7 A;  2K6Q A;  1YD8 U;  2MRP A;  3AU5 A;  4AJW A;  1E8Z A;  1GC7 A;  3LJ3 A;  3ZIM A;  3PTF C;  4XZ4 A;  1SIF A;  2MP2 A;  3UIN B;  4KSL C;  3IG3 A;  1EUV B;  2K25 A;  4PS8 A;  1WMH A;  4GDK B;  5LLI A;  4W9E A;  1FXT B;  1WXV A;  3ZKJ C;  2ZVO A;  3JSV A;  4BBN C;  3TJP A;  2GBK A;  2DX5 B;  3DVN V;  3L08 A;  1GUA B;  2NPT A;  4FBJ B;  1GC6 A;  2M8S A;  2CHX A;  1WFY A;  1WGR A;  1WJ4 A;  2N1W A;  4A20 A;  4CO7 A;  4PYZ A;  4BOS C;  1YIW A;  5LXH A;  3OJ3 A;  2I1J A;  4DWF A;  2MBB B;  3ML9 A;  3V6E B;  2KK8 A;  2O6V A;  4M8N A;  3JW0 X;  1WXS A;  4GSW A;  3UGB B;  2BKR B;  3ZDM C;  3UF8 A;  1NI2 A;  4KSK C;  1IYF A;  1UH6 A;  4II3 B;  2KX3 A;  2K8B A;  5AZF A;  1P9D U;  4W9L A;  3VVW B;  2C9W B;  2KDB A;  1S1Q B;  2C7H A;  2Z59 B;  2D3G A;  3A9J B;  3IVF A;  3NOB A;  4BVU C;  2MX2 A;  5CHF A;  2MSE D;  1P0R A;  5AZH A;  1WF9 A;  4K7U A;  2JF5 A;  1X1M A;  4GDL B;  3UQB A;  2RR9 A;  4KIK B;  4IWO A;  1V49 A;  3OLM D;  3DVG X;  1OEY J;  2FIF A;  4IWQ A;  5FR6 A;  3P2B A;  3B1L X;  3QA8 A;  2KN5 A;  3QIJ A;  4IWP A;  1LFD A;  2A5U A;  2ZPY A;  2BPS A;  3VUW A;  5KHQ A;  3HIZ A;  3ZW3 A;  4LDT D;  2ZPN A;  2KFK A;  2MBH A;  1WXA A;  1R4N I;  4LJP B;  4MGI E;  4MH0 E;  3ZNI D;  3B0A A;  3NS8 A;  1WX9 A;  2KTR A;  2O2V B;  4HJK A;  2MW5 A;  2N7E A;  1TZ1 A;  2OJR A;  2R2O A;  3KUZ A;  1OGW A;  4EZJ A;  1I42 A;  3KH0 A;  1GNU A;  2K8C A;  4JLC A;  2AEH A;  2MBE A;  4NAW A;  5J18 A;  2Y5B B;  1P3Q U;  1V80 A;  2XBB C;  5KHO A;  3PPA A;  2NVU I;  3ZO5 B;  2I1K A;  4B9K A;  1OTR B;  5L83 A;  1HE8 A;  2LVO A;  2CU1 A;  1LXD A;  2ZZP B;  5LXI B;  3H6N A;  1WM2 A;  1AAR A;  5GMV A;  4ZRK A;  2IBI B;  3VUY A;  2ZNV B;  3Q3J A;  1WE6 A;  3AU4 A;  1R4M I;  3PS6 A;  4HVB A;  3ECI A;  2VRR B;  4II2 B;  4ANV A;  2KX0 A;  1H8C A;  2K6D B;  3HM6 X;  3I3T B;  1V5T A;  4MGY E;  3U30 A;  3ZRF A;  1WR1 A;  4GU2 A;  4BKT A;  4WQO B;  1GG3 A;  5CX3 A;  2DAF A;  1KM7 A;  2J7Q B;  1UBI A;  4TQ0 A;  1WYW B;  4HWI B;  2EKE C;  2DYB A;  2K1F A;  2OOB B;  3A9K A;  3T9L A;  3RZF A;  1XQQ A;  2MP2 B;  1OQY A;  1F9J A;  1LQB A;  4PS3 A;  2KO3 A;  2WX1 A;  1UZX B;  4P7I A;  3DOW A;  2DEN B;  2L8J A;  3DVN U;  1ZW7 A;  3M63 B;  3MTN B;  2EMS A;  3VH3 B;  4NQK E;  3PT2 B;  3EC8 A;  2DZJ A;  2M0X A;  2BWF A;  3A33 B;  4ZRJ A;  3WAO A;  1V81 A;  1A5R A;  2NBU A;  4JQW C;  3QC8 B;  4HXD A;  4NNJ B;  3VTV A;  2IYD B;  4ZDV A;  2IO0 B;  4I6L B;  2ZVN A;  2BF8 B;  3KUD B;  4K1R B;  1V9J A;  2FCN A;  4MGK E;  1WGH A;  3M62 B;  4G0N B;  4RMA A;  3KW5 B;  1T0Y A;  2KD0 A;  3NY5 A;  3K9O B;  4EUT A;  2J0M A;  5TR5 A;  3R3M A;  4IM3 A;  2ZEQ A;  2ZCC A;  2K39 A;  3NZU A;  3TBL D;  2MWS B;  1WRD B;  2N9E B;  2LGY A;  1G6J A;  3NHE B;  3L54 A;  1E8X A;  3RZW C;  5JZE B;  2KDE B;  2G45 B;  4M8M A;  3KYD D;  3QX1 A;  2D07 B;  1S3S G;  4DK5 A;  2KDI A;  3PRE A;  3CST A;  4NPN A;  3ZRC A;  4NQL B;  2D10 A;  3ALB A;  3ZDT A;  4ANW A;  2IO3 B;  2LXA A;  2UWQ A;  4I6P A;  3ML8 A;  1ISN A;  2O6V D;  1EO6 A;  2C60 A;  2PJH A;  4ICV A;  3WAN A;  2NS5 A;  3O65 B;  3PGE A;  3PSE B;  4HPL B;  2AL3 A;  4TKN A;  2L05 A;  3RUI B;  2KWV B;  3APC A;  5G2N A;  2JZZ A;  1EF1 A;  5AZG A;  2LRW A;  4DHZ B;  2JRH A;  1SGH A;  4M0W B;  4FA6 A;  2JPH A;  2QHO A;  4LDT B;  4G11 A;  4K7S A;  4MSM B;  3WAL A;  3UQA A;  1YQB A;  5J17 A;  1WXM A;  2KQS A;  3EHV A;  4E71 A;  2N9X A;  3N32 A;  3PHX B;  4ZRI A;  1IPG A;  1ZGU B;  3BY4 B;  4BKS A;  1K8R B;  1JRU A;  2G4D B;  4PYU A;  2JRI B;  1P1A A;  4KZ0 A;  3ZTD A;  2XK5 A;  4AUQ C;  4W9I A;  2KMA A;  4ANX A;  1J8C A;  3AI5 A;  1C1Y B;  2KAN A;  2WYQ A;  4W9D A;  3MHS D;  4RM9 A;  3QHT A;  4AOF A;  3A1Q A;  3PV1 A;  3QK0 A;  1UBQ A;  1WZ0 A;  3PVL A;  2JZ3 B;  4DXA B;  4A3O A;  4HDO A;  2XEW A;  4W9F A;  1M94 A;  2N1V A;  4HCP B;  3WIM A;  1Q5W B;  1L7Y A;  4IW0 A;  2KWU B;  3PZD A;  2DAJ A;  2JWZ A;  3L13 A;  3Q3F A;  3V61 A;  1WM3 A;  3BIN A;  1WZ3 A;  5D94 A;  1XD3 B;  5JHB A;  4ZYN A;  1OEY A;  4CYE A;  2V1Y A;  2WDT B;  4ICU A;  2CR5 A;  2L0T A;  3PRP B;  4WWO A;  1UGM A;  2PEA A;  2KHW B;  4GIV A;  4HDQ A;  1RFA A;  2R2Q A;  3MJW A;  3PHW B;  4W9K A;  2NR2 A;  2J0K A;  2JVC A;  4FLH A;  5C23 A;  5IAA C;  3T8M A;  1VCB A;  1VD2 A;  1E8Y A;  3R7R A;  2DHZ A;  2DZI A;  2IO1 B;  1WY8 A;  1ZKH A;  2AYO B;  3VTU A;  4GDK A;  4MJS A;  3L17 A;  1L2N A;  3UIO B;  3EEC A;  2CS4 A;  1WX8 A;  3L10 B;  4OVU A;  4XX5 A;  4EOY A;  4LCD E;  3ZLZ A;  2N4F A;  2DYM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...