2BYEA

Nmr solution structure of phospholipase c epsilon ra 1 domain
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
110
structure length
110
Chain Sequence
GEERKCLQTHRVTVHGVPGPEPFTVFTINGGTKAKQLLQQILTNEQDIKPVTTDYFLMEEKYFISKEKNECRKQPFQRAIGPEEEIMQILSSWFPEEGYMGRIVLKTQQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHOLIPASE C, EPSILON 1
publication title Structural and Mechanistic Insights Into Ras Association Domains of Phospholipase C Epsilon.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lipase
total genus 13
structure length 110
sequence length 110
ec nomenclature ec 3.1.4.11: Phosphoinositide phospholipase C.
pdb deposition date 2005-08-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2byeA01
1SGHA 2ZPYA 2NBWB 2M1MA 1YD8U 3H1UA 4M0WB 4ASWC 5AZHA 2KX3A 4KDLB 4ANUA 2JXXA 2LRWA 2ZPNA 3DDCB 3VH4B 4BOZB 2GOWA 3T9LA 3IG3A 2BF8B 2GBRA 2M17A 2JPHA 2MCNB 2JVCA 4IUMB 4BFRA 3EC8A 4HDOA 2ZNVB 2K8CA 2OJRA 2GBKA 1AARA 3PS6A 4HK2A 4JL9A 3NS8A 3QIJA 3KVFB 4ZDVA 1WGDA 2WX0A 4GGQA 3TJPA 4K1RB 2KJ6A 2NPTA 3W1SA 4DHZE 2MP2B 2N7DA 2DYOA 4KSLC 3PLVA 3AI5A 4TUUA 4DWFA 3LJ3A 3KH0A 5CX3A 5FR6A 3W1SC 2KNBA 3IHPC 1R4MI 3WIMA 3HHMA 2RD0A 2BPSA 4LJPB 4NPNA 3RUIB 3ZW3A 2CKHB 4ICVA 3HM6X 2NBUA 3QARA 4K7WA 3DBLI 1D3ZA 1ISNA 1A5RA 4BKTA 3PTFC 4MGYE 4DBGA 3ZRCA 5G55A 2IY0B 3M3JA 1TZ1A 2NCNA 4HVBA 1WMHA 2FCQA 2XBBC 4TQ1A 2DAJA 4RM9A 2KWUB 2PPHA 2R2OA 2IZVB 3VH3B 3WALA 1NI2A 2HE7A 3N32A 4DK5A 3RZFA 3UGBB 2MWSB 3CSFA 4FJVB 2NPTB 5D6JB 2CU1A 1P0RA 3K9OB 4LDTB 2LRUA 2L0FA 2XK5B 4KV2A 3TMPB 2MX2A 2KANA 2IO1B 4HPLB 4W9CA 4EKUA 3X0WA 1WZ3A 2L3ZA 4W9GA 1U4AA 4PS3A 4GSWA 5D2MB 1ZW7A 5JH5C 4AP4C 4KZCA 3ZO5B 3CF6E 3V62A 1EO6A 2AL6A 2JUOA 3ZNID 2D11A 5LXHA 3A33B 4F1SA 4W9DA 4XZ4A 1WMHB 2JZ3B 3DVNV 2WYQA 5CHFA 4NNJB 2RSUA 2JY6A 4I6NB 1WXMA 3ZRFA 2DZMA 2KFJA 3DVGY 4ZRIA 1OGWA 4IM2A 1ZKHA 1LXDA 2UWQA 4XC2A 1XD3B 1MG8A 2DYMA 1H4RA 5IAAC 2WDTB 5JHAA 3A4SC 1YJ1A 2FCSA 2KOXA 3OAWA 4E74A 1NDDA 4X57B 5GMVA 2FCNA 3APDA 2LVOA 2IO2B 1UELA 1G6JA 1S1QB 1GG3A 2RPQA 1GUAB 1I35A 4FHKA 2KD0A 2MSED 3X23A 3PHXB 2L00B 2REXA 2K6DB 3NZSA 2KMAA 4G3XB 1QZEA 1WYWB 2Z0DB 3HK0A 4WJOA 4GMVA 3DPDA 2CHZA 3TCAA 2KVRA 2FCMA 1P9DU 4WWOA 4LDTD 3APFA 4FADA 1WF9A 5D7GA 4B6WA 1L2NA 4JGHB 2LASA 1LQBA 3B08A 2LI5A 2K1FA 5L95C 4E71A 2KN5A 1WGYA 1UBIA 2LGXA 2G3QB 3QAQA 1C1YB 3APCA 1V86A 4MSMB 2ZJDA 4FLHA 2NVUI 3PRMB 2LXAA 5CHWA 2MBBB 4GXBA 4EOYA 2JT4B 3VQIA 1PQSA 3AXCA 1RRBA 5J2RA 3JSVA 2B3AA 3SU8X 2KTFA 2KK8A 3A1QA 2ZZPB 2C7HA 4BKGA 1H8CA 2V4LA 4A20A 1SIFA 1Y8RC 4AJWA 4EZJA 2GBNA 4DHZB 3R7QA 3KUCB 1BT0A 2V1YA 2BYVE 2JZZA 4ANXA 3DVGX 2C9WB 4IC7B 4NQLB 1V49A 2K6QA 1WXSA 4B95A 2KDFB 4JLCA 1J19A 2JRIB 3A4RA 3DVNU 2IYDB 1WH3A 4KVGB 3ZNZB 1V80A 2KMCA 2IO3B 2LVQA 4G11A 4BKSA 3OJ3A 4W9EA 1GNUA 4HCNB 1X1MA 2MA9B 1YQBA 2RGFA 5L83A 1GC7A 3WAMA 2FIFA 1E8XA 1R4NI 3WAOA 2DZIA 1TBEA 4WJQA 3JSVB 2J0MA 4HJKA 2MBOA 1WE7A 3A1QB 2DHZA 4PS7A 2HTHA 1V2YA 3KYDD 2LGDA 3Q3JA 4CYEA 3PRZA 2MBQA 2BGFA 4IWPA 2KLCA 4NY0A 5AZGA 5DPWA 3Q3FA 3UF8A 2GBMA 1JRUA 2VRRB 3DBRI 4ICUA 4CHKA 2M8SA 2WWZA 4G0NB 4I6PA 2AEHA 4K7UA 3QK0A 4PYZA 2CR5A 3VAWA 4DHJB 2DZJA 4AJYB 2KWCA 2EMSA 2C7NB 3JYUA 2Z0EB 3L17A 3V6EB 3DCGA 1M94A 1OEYJ 4FULA 4GDKA 3U8ZA 3ML9A 4JIOU 4WQOB 3T8MA 2A4ZA 2G45B 3DQVA 1XT9B 3ZTDA 3VDZA 2N9EB 2K8BA 2ZEQA 5IA7A 2AWTA 4GB9A 3CMMB 3CSTA 1P98A 3SD5A 2L05A 2QHOA 2ZCBA 2O2VA 1RFAA 3VHTC 1WJUA 5CTRC 3I3TB 4FA6A 2L8JA 3R7RA 3ZNGC 3L16A 1OTRB 4II3B 3R66C 4HXDA 4IW0A 4ZYNA 5TR5A 3A9KA 2LUEA 1UZXB 5DPTA 4GIVA 2DAFA 3DBSA 3EECA 3RULA 3D32A 2PE9A 3RD2A 5C23A 4EUTA 3U30A 4G50A 1HE8A 4GDKB 3UIOB 1SE9A 2I1JA 4EFOA 3QCAA 2J7QB 2KLGA 3QJZA 4KDIC 1V6EA 2KQ7A 4DDID 2N9PC 4LJOB 3L54A 5JHBA 4F8CB 3OJ4B 4KSKC 1V5OA 1TGZB 2N1VA 4M8NA 2CHWA 4FN2A 1I42A 3TIXA 3SDLC 3NY5A 4A3OA 2O2VB 3PRPB 3TBLD 5EDSA 4EZKA 3QA8A 1UD7A 2GBJA 2D3GA 3KW5B 3VVWB 2M4NA 2LD9A 1VD2A 4NQKE 1WGGA 4WWPA 3A9KB 2L7RA 2NS5A 1WJ4A 5C1ZA 4IM3A 4LCDE 2LXCA 2DYBA 1L7YA 4GOCA 4RM8A 1WJNA 3TL5A 3QWZB 5DCNA 2LVPA 1ZGUB 3V60A 2EKEC 2KDIA 1YX5B 1OEYA 1EF5A 2EMTA 5G2NA 2K39A 2KKCA 2BKRB 2ZVNA 1LFDA 1IYFA 1WFYA 4NAWA 5BO4B 2MLBA 3ZIMA 1IPGA 2N9XA 4WAAA 2Y5BB 4EZLA 3EFUA 3BY4B 3PPAA 2KC2A 5E6PA 2BKFA 1XQQA 2FUHB 1FXTB 2DENB 5AZFA 2HD5B 3VTVA 4BVUC 2KJRA 3PLUA 1K8RB 4YL8A 3VXWA 2FAZA 1WXAA 3PHWB 4HWIB 3S2AA 4AUQC 3PZDA 4W9IA 1WGHA 3ALBA 2O6VA 3VTUA 3ZNHB 4URKA 3PVLA 3QHTA 1J8CA 3HIZA 3UQBA 5E6NA 1WM2A 2KX0A 2CHXA 4IM0A 1WGRA 2Z59B 3B0AA 2V3SA 2XEWA 1WIAA 1KJTA 3H7SA 2WX1A 4TV3A 4KIKA 3WA0A 5AEKB 2CS4A 3IBEA 4NAWB 3AULA 2KZRA 3ZTCA 1C3TA 2FNJB 2C60A 4K7SA 3RCZA 3ZDMC 4HDQA 3RZWC 4MM3A 3VUWA 3RT3B 1P1AA 2YLMA 1WI0A 1TTNA 2ZVOA 2KTRA 1E7UA 3U7DA 1CMXB 2K25A 1WR6E 3ZDTA 2R2QA 3AU5A 2G4SA 1GC6A 1WM3A 3V61A 3QQ8B 4GN1A 2JRHA 2KHWB 1WY8A 1Z2MA 2J0KA 2O6VB 2C5LC 2K8HA 3UQAA 2IO0B 3ZKJC 4A3PA 2PE6B 4MGKE 1V81A 1WZ0A 4W9FA 1IP9A 3WANA 1WE6A 3KUDB 2KQSA 4HLEA 5E6OA 2IY1B 3ECIA 4KIKB 1RLFA 2MBHA 4FHJA 2PEAA 4HCPB 2ZCCA 2LWPA 4XX5A 2XK5A 2KXJA 3K9PB 1F9JA 3AU4A 2L76A 4ZRKA 1T0YA 1WXVA 4KZ0A 1WX8A 1UGMA 2BWFA 2JF5A 3DBHI 3PGEA 1J0GA 4MGIE 2N4FA 2GMIC 3A9JA 1WX7A 2KTRB 3L10B 3VUYA 1E90A 2J0JA 4N9F4 2KFKA 4K81A 2DX5B 5J17A 3VFKA 3B1LX 4DXAB 1E8ZA 4NJ7A 4TQ0A 2W9NA 1E8YA 3IVFA 3RYTA 1V5TA 2LGYA 2NBVB 3PV1A 3W1YA 3ZLZA 3GOEA 1Q1OA 3V6CB 5KHQA 3DOWA 2KJHB 2BWES 4NJ6A 4RMAA 2FIDA 2JWZA 1EUVB 2BYEA 3KUZA 3N3KB 4W9KA 2D10A 3P2BA 3H7PA 4W9JA 4MGZE 4WWNA 3M62B 4MJSA 2BYFA 2YVCA 4II2B 4E3CA 4GDLA 3BINA 3MJWA 1E7VA 2G4DB 2NR2A 2O6VD 2DZKA 3HM3A 4AWJA 2A5UA 5LXIB 2MBEA 3ONSA 1YIWA 3QC8B 2KO3A 3QX1A 3R3MA 3SHQA 4DHJD 3C0RB 4WJNA 1V9JA 3PT2B 4BKSD 3A9JB 1WJ6A 2LZ6A 4OVUA 3KYCD 3GZNI 1E8WA 4PS8A 2M0XA 1P3QU 2I1KA 2KFKB 2IBIB 2MQJA 1S3SG 3MHSD 3WAPA 4WJPA 3PSEB 1RAXA 4TKNA 1UBQA 4IG7B 3ENEA 4W9HA 3VUXA 4F7ZA 3MTNB 4FJZA 1VCBA 4MDKE 2D2QA 2L0TA 4MEMA 2AL3A 4BBNC 2N7EA 3UIPB 3JVZX 4I6LB 1WX9A 3H7PB 4IWOA 5DPSA 4MJSB 4EEWA 4BOSC 4B9KA 3OLMD 4GDLB 2KDEB 4DDGD 1E5WA 2MRPA 5KHOA 3M63B 4MH0E 5JZEB 4JQWC 4IWQA 3ML8A 4MSQB 3ZUNA 4ZRJA 2LJ5A 3ZVVA 1EF1A 5D94A 3PREA 3NOBA 4FJYA 1KLVA 2RR9A 2D07B 3L13A 3NHEB 1KM7A 3M95A 1Q5WB 4CO7A 5J18A 5DPRA 2ASQA 3O65B 1Z5SB 4PYUA 4W9LA 1OQYA 4MELA 4M8MA 2PJHA 1LM8B 3EHVA 3VTWA 1WR1A 4OVVA 2HJ8A 2UYZB 4P7IA 2MW5A 4AOFA 2C7MB 3L0WB 3H6NA 2OOBB 1Q0WB 3L08A 3IFWB 4GU2A 2KWVB 3UINB 1GJZA 2AYOB 3LDZE 2KC1A 2ZNVC 4ANWA 3H9DA 4BBNF 1UH6A 5CHVC 5HKHA 2MP2A 1KOTA 2KDBA 4HPMB 3JW0X 1WRDB 2N1WA 4ANVA 3N30A 5LLIA 1NBFC 3NZUA 4FBJB 1YX6B 4J6IA
chains in the Genus database with same CATH superfamily
1HZ5A 2NBWB 2WXGA 1YD8U 2WDQB 3P4RB 2W55A 2XNAC 2JXXA 3DDCB 3FAHA 2GOWA 3IG3A 1T0QC 2GBRA 4ZHOA 3IAM1 2ZNVB 2LHEA 4HK2A 2QEJC 3SR6A 3QIJA 2LHDA 4GGQA 5JXVA 2KJ6A 4RH6A 4DHZE 2MP2B 4TUUA 3W1SC 3W5VB 2WLBA 3WIMA 2MJEA 2ZW1A 3DWGC 1FXIA 2CKHB 2NBUA 4BZAA 3PTFC 1YOVB 3ZRCA 5G55A 3M3JA 1CJEA 4HVBA 4TQ1A 2R2OA 3VH3B 3OG5A 4RGMA 3RMKC 2MWSB 3CSFA 3E56A 4FJVB 2GRIA 5FR3A 2CU1A 4KV2A 2WXQA 1RM6C 2V3NA 1FNUA 4PS3A 4GSWA 4MH8A 5D2MB 5JH5C 2WU2B 3CF6E 2RSUA 4I6NB 3AEDB 1ZKHA 1MG8A 2FCNA 3APDA 1G6JA 3N1YC 1S1QB 1GG3A 4K3BA 1I35A 2MSED 3X23A 2L00B 1KLGD 1V97A 1QZEA 2EKIA 4GMVA 2CHZA 3EA6A 2KVRA 2KWDA 1HQRD 3ZJVA 5L95C 4KGRA 1WGYA 3QAQA 1V86A 4MSMB 2ZJDA 5AUKA 1D6EC 2LXAA 4US8A 4GXBA 1PQSA 4B0MA 2V4LA 4A20A 1STEA 4EE2A 4DHZB 2D3AA 2CJOA 2JZZA 2QC8A 2C9WB 2IGGA 4ACFA 2KMMA 1MHXA 2QJLA 2KDFB 4JLCA 1J19A 2KYWA 3A4RA 2IYDB 1I4RA 5EE1A 2LVQA 3RFZB 3OJ3A 4HCNB 2WXFA 2WXKA 3U52E 2NTTA 1TBEA 4WJQA 2J0MA 1DOXA 3NVWA 3AB5A 2INPE 3Q2AC 2MBQA 1FEHA 1ZXHA 4IWPA 4C7ZA 4CHKA 2JQRB 1KRHA 2M8SA 4G0NB 4I6PA 4S17A 5EE9A 3W2DA 4K7UA 3AH7A 3Q8AA 2Z0EB 3VRAB 2PTLA 4GDKA 2W3SA 3ML9A 2A4ZA 1B1ZA 1E7PB 2N9EB 2K8BA 4GB9A 3SD5A 1TKYA 3B2FA 4FA6A 1GB1A 3R7RA 3ZNGC 4RF1A 2OEDA 4ZYNA 3A9KA 4LNFA 5DPTA 4GIVA 2DAFA 2PE9A 1ZUD2 4GDKB 3UIOB 2I1JA 2J7QB 5H92C 2KLGA 3U7ZA 2KQ7A 2KQ4X 4MT5A 5JHBA 4F8CB 1C4PA 1TGZB 3SDLC 3NVYA 1L6UA 4N58A 1UD7A 1VD2A 4WWPA 3A9KB 1NYRA 4IM3A 2KN4A 4PK1A 3QWZB 3V60A 2FE8A 2KKCA 2BKRB 2QSDA 1WFYA 4NAWA 2L32A 4HEA1 2Y5BB 3C8YA 4OZBA 2KC2A 1D4BA 1F0ZA 2HD5B 1YQ4B 4YL8A 3U2SC 3VXWA 1WXAA 4HWIB 1BXTA 3RNFC 2WS3B 4URKA 1J8CA 3BVZA 1K53A 2V3SA 4TV3A 1KJTA 5AEKB 4NAWB 4Q2JA 3GS2A 4NAMA 2C60A 4S0RA 3RZWC 2YLMA 2ZVOA 2MH7A 3LB8C 1BMLC 1GC6A 4GN1A 1WY8A 2Y5PA 2ONQA 1N5XA 1C4AA 4A3PA 1PFDA 1V81A 4M02A 3I9V1 1P7FA 1RLFA 3K9PB 2CU3A 1WXVA 4KZ0A 1WX8A 1UGMA 1HEZE 2J0JA 5J17A 3VFKA 4A9AA 3IVFA 1V5TA 1VRAB 3W1YA 5KHQA 3DOWA 2KJHB 1EUVB 3N3KB 1J7BA 2D10A 1FCLA 3AE8B 4WWNA 3M62B 1K51A 4GDLA 3H8HA 1C79A 2G4DB 2A5UA 3ONSA 4DHJD 3C0RB 4OVZA 3PT2B 2M0XA 2SEBD 1XCTL 3WAPA 4WJPA 1RAXA 4TKNA 1IGDA 1MJDA 2INCC 2M19A 1VCBA 4MDKE 5D3IB 2LJIA 1F2RI 1R4NB 3OLMD 2PKOA 4GDLB 5LNK1 3GB1A 4JQWC 5G5HA 3V3XA 4MSQB 5C3JB 3CWIA 3TSSA 1PGXA 1EF1A 4AQ7A 4RCOA 3NOBA 1KLVA 3L13A 3NHEB 2NTSA 4PYUA 2PJHA 1WRIA 2MW5A 4AOFA 3I63C 2C7MB 2PMVA 4GU2A 1C9FA 3UINB 5IKCM 1GJZA 2AYOB 4H2AA 4ARIA 4ANWA 3H9DA 4BBNF 5HKHA 1WRDB 1XLQA 5IOIA 1FRRA 4RGNA 3EGRA 2ZPYA 5AZHA 3T9LA 3ZQ4A 4JX1C 4KX6B 2MCNB 4BFRA 1T6BX 3PS6A 4JL9A 4CQNA 2WX0A 3TJPA 2BTEA 3ZJTA 1T3QA 3P63A 3W1SA 2BS2B 2M56B 1JCKB 3AI5A 4DWFA 1WYGA 1QF6A 2KNBA 2RD0A 4NPNA 1I4XA 3RUIB 1DGJA 4ICVA 4BKTA 3AE5B 4DBGA 2GI9A 3BVMA 2FCQA 2LEKA 2XBBC 5I4DA 1N5WA 2DAJA 5GXGB 2KWUB 2PPHA 3WALA 1EU4A 2HE7A 2V0GA 5BYSA 1WGKA 4L23A 1P0RA 3RPFC 2VZKD 4A6QA 4LDTB 2LRUA 2XK5B 4KGTA 2KANA 2IO1B 4HPLB 3J9CA 4W9CA 4EKUA 2QDFA 1GB4A 4C56C 2L3ZA 4W9GA 1QQRA 2X38A 4XWWA 2HJ1A 4HKZE 1J7AA 4HROA 2TSSA 3ZNID 1EO6A 2JUOA 1V1PA 4W9DA 3URYA 3HUIA 2JY6A 3ZYYX 3ZRFA 4ZRIA 4XC2A 2DYMA 2WDTB 1YJ1A 1NDDA 4WURA 3AE3B 2IO2B 1UELA 3NJTA 3EUB2 3TEZA 2RPQA 2KD0A 1Q10A 1MPEA 3MFGA 4LNKA 2K6DB 4G3XB 2HDEA 2J52A 2Z0DB 3DPDA 2VH2A 4LDTD 2LFIA 3APFA 1V1PB 1WF9A 5D7GA 4B6WA 4FADA 3MP9A 1L2NA 2LASA 1HTOA 1PUTA 2KN5A 1L0VB 3P4SB 3APCA 2NVUI 3ZXVA 1HXYD 4RGTA 5CHWA 4EOYA 2LUMA 3VQIA 4MACA 3AXCA 3TEYA 3SU8X 2YEPF 1N6ZA 4BKGA 1H8CA 4AJWA 4EZJA 3R7QA 2V1YA 2J42A 2BYVE 3I57A 4ANXA 4IC7B 2K6QA 1TT5B 2FUG1 2DBYA 2JRIB 1WH3A 2WXOA 4KVGB 1ET6A 2KMCA 3TEXA 2IO3B 4P16A 3KLSX 3NVVA 4G11A 3AM9A 4BKSA 4W9EA 1GNUA 4JE3B 2ON8A 1YQBA 1D5MC 3BK1A 1R4NI 2DZIA 3IXSA 2AQ2B 1T5XD 5BYRA 3GZNB 2HTHA 1V2YA 3KYDD 2H88B 3PRZA 2KLCA 4NY0A 3Q3FA 3UF8A 2GBMA 2VRRB 4ICUA 2CJNA 3AEFB 3BZDB 4ITKA 2SAKA 2DZJA 4AJYB 3Q3OC 3MC9A 3DCGA 4FULA 4JIOU 2G45B 1SE3A 2KVZA 4ZYSA 2AWTA 5IA7A 3CMMB 2L05A 1JWUD 1WJUA 1YJJA 4II3B 5H8YE 3R66C 4HXDA 1PDXA 3UI3A 1FNWA 3RULA 4EUTA 1ROEA 2AX5A 1A70A 1V6EA 2N9PC 1UWXA 1WSPA 2N9LA 3OJ4B 2N1VA 4M8NA 2PVGC 3NY5A 4A3OA 3BVGA 3TBLD 5EDSA 4EZKA 1FMAD 2GBJA 3VVWB 2M4NA 4NQKE 1V8CA 1TIFA 1WGGA 4OZAA 1WJ4A 1AWDA 4LCDE 1TKEA 1L7YA 1TKGA 4GOCA 1IGCA 4RM8A 5G5GA 2LVPA 3Q6BA 1EF5A 5G2NA 2K39A 4XDCA 1DOIA 2MLBA 1WWTA 1R4MB 2N9XA 1YMHE 2OHFA 3EFUA 3NS1A 3BY4B 3PPAA 3AE1B 5E6PA 2K22A 3DBLB 4NZLB 3VTVA 1FFVA 3PLUA 3O13A 2FAZA 4AUQC 4W9IA 2IGHA 2O6VA 3QHTA 3HIZA 5E6NA 4P6VF 1JROA 3H7SA 2WX1A 2CS4A 2FNJB 4K7SA 3IT6B 1TY2A 3ZDMC 1HZ6A 2N0SB 4HDQA 5IN7A 3VUWA 1ZP0B 3RI7C 5IP4D 3U7DA 1CMXB 1WR6E 2R2QA 3FC4A 2Y3AA 4WH4A 4C80A 4JWSC 3AE6B 4HRSA 2O6VB 2C5LC 2K8HA 1OQRA 2IO0B 1IP9A 3WANA 2RPVA 3KUDB 2KQSA 1QKZA 2IY1B 1YN5A 2UU7A 2MBHA 2WXLA 2ZCCA 1SJHD 1E9MA 2K9XA 2LWPA 2WP9B 3AEGB 1N63A 1F9JA 1OQQA 4XX5A 1T0YA 3MHZA 4D2KA 2JF5A 4MGIE 2N4FA 3A9JA 2E6XA 3VUYA 1YJIA 3B1LX 1N61A 5T8IA 4TQ0A 2W9NA 2GB1A 2NBVB 2K3UA 1SSNA 2OJWA 2FIDA 2BYEA 2W82A 3P2BA 4MGZE 2BYFA 3N1XC 1AN8A 3MJWA 2O6VD 4BAXA 1JRPA 4LTUA 4AWJA 4N59A 1YIWA 3QX1A 3A9JB 1WJ6A 3GZNI 3RNAC 4C4VA 2I1KA 4DXFA 1GOZA 2IBIB 2WXHA 1S3SG 4LK0M 4REZA 3ZXRA 3ABVB 4YSYB 4F7ZA 3MTNB 2L0TA 1KFYB 1JALA 4I6LB 5DPSA 1JQ4A 3I5JC 4EEWA 1KH0A 5BMHA 5KHOA 3BYTB 4A8XC 4MH0E 5JZEB 4NJCA 3MC0B 3ML8A 3ZUNA 4ZRJA 2LJ5A 1TS5A 4JWUC 3AEAB 3DBRB 1QOGA 4FJYA 2D07B 4M0WA 4C4VB 5DPRA 2ASQA 2PLPA 1Z5SB 1OQYA 1LM8B 3VTWA 4OVVA 3DHIC 2HJ8A 4P7IA 3H6NA 1FIQA 3L08A 2KWVB 4A90A 3DHHC 4HJGE 5CHVC 3ZGZA 4RGOS 2BB5A 4HPMB 3JW0X 2AQ1B 3OWEB 1C76A 4J6IA 3SEBA 2MEKA 4ASWC 3H1UA 4M0WB 4KDLB 1C4CA 3GE3C 1VZ6A 1F52A 2MJ3A 1L0YB 2BF8B 4WAFA 3EC8A 2GBKA 1AARA 1R7SA 1F2RC 4ZDVA 1WGDA 4K1RB 4HKQA 1FCCC 2NPTA 1VR9A 2DYOA 2BYTA 5FK9C 3PLVA 3KH0A 1L0XB 1D5XC 3P1MA 1NENB 4M01A 1R4MI 1MFWA 2Q5WD 4LJPB 4LLGM 3ZW3A 3QARA 4IOIE 3CIRB 3DBLI 1D3ZA 2BT6A 1JWMD 1SF0A 1A5RA 2IY0B 1TZ1A 2NCNA 1XEEA 4WWMA 4QAYA 4RM9A 2JSVX 1ZOYB 1NI2A 4DK5A 1VLBA 3RZFA 3IAS1 5FKAC 2NPTB 4YTNB 1XXGA 3K9OB 2L0FA 1ENFA 1ET9A 2MX2A 2WXIA 1WZ3A 3AECB 3Q3MC 3SFDB 1U4AA 4YWGG 1JWAD 2WXRA 5HHDG 4LNOA 3VR8B 1ZXIA 3N9YC 1MI0A 3V62A 2AL6A 2D11A 4XZ4A 2JZ3B 2WYQA 1YQ3B 4NNJB 1RWSA 2DZMA 3DVGY 4IM2A 1H4RA 3P4QB 5JHAA 4E74A 3EFCA 5MPOA 1TJEA 3PHXB 4N6EB 2JZPA 3NZSA 5BYQA 2KMAA 1NVID 3HK0A 2FCMA 1P9DU 4WWOA 2WXPA 4JGHB 1VJKA 3B08A 1ACCA 1TS3A 2LGXA 2G3QB 4OZCA 2BB6A 1C1YB 4ZRPA 4FLHA 1FO4A 1GAQB 4US9A 3PRMB 2JT4B 1RRBA 1I4QA 5J2RA 3JSVA 2KTFA 2KK8A 2ZZPB 2PW9A 4XDDA 1SIFA 1Y8RC 4ZOHC 3AEEB 4NQLB 1V49A 1WXSA 4B95A 3AE2B 1KF6B 3ZNZB 1V80A 3NG0A 1LGRA 2BS4B 2MA9B 4M00A 1E8XA 3WAOA 3JSVB 2MBOA 2DHZA 2KT7A 4PS7A 3AMZA 1L6VA 2LGDA 3Q3JA 4CYEA 2BGFA 4A55A 5AZGA 1I4PA 3DBRI 3PZ8A 2WWZA 2AEHA 3HRDD 2CR5A 3VAWA 4KKJA 2V4IB 2KWCA 2EMSA 3V6EB 1OEYJ 4WQOB 4XE0A 4KKIA 3DQVA 3ZTDA 4UDUC 3VDZA 3VR9B 3CSTA 1P98A 2JXTA 4L2YA 3HVDA 2ZCBA 3LYYA 5CTRC 1OTRB 4IW0A 5TR5A 2LUEA 2JU6X 1QT9A 3EECA 3D32A 5C23A 3U30A 2LMCA 4G50A 1VZ8A 1HE8A 1SE9A 4EFOA 1MG4A 1DOYA 2JYEA 4KDIC 4LJOB 2RMMA 4XYCA 1BUIC 1I42A 4FN2A 3TIXA 1L4ZB 4C00A 3E9SA 3PRPB 4DQOC 3QA8A 2JWUA 2D3GA 1EWCA 3KW5B 2PVOD 1AYFA 2L7RA 4ZHPA 2NS5A 5C1ZA 2LXCA 3W9CB 2EKEC 5D3DA 4KGSA 1OEYA 2YEPB 1IYFA 1HA5A 2ACZB 3V05A 3ZIMA 2BS3B 1IPGA 4WAAA 4LNIA 2L83A 2BKFA 1XQQA 2FUHB 2DENB 5AZFA 5E6JA 2KJRA 3PHWB 3PZDA 3ALBA 3VTUA 1L4DB 3ZNHB 1WM2A 1NI3A 4IM0A 1WGRA 3B0AA 1WIAA 1K52A 4KIKA 3WA0A 1CK1A 3AULA 3ZTCA 4AS1A 4MM3A 3AE9B 1E7UA 1UUPA 2KTRA 1UNSA 2K25A 3ZDTA 1FD6A 2G4SA 1UF0A 3V61A 1P7EA 4RNAA 2WGSA 3BK2A 2KHWB 1TS2A 1Z2MA 2D3CA 3RNCC 2J0KA 1PGBA 2PE6B 4MGKE 4O1NA 4W9FA 2W54A 1ZE3D 4HLEA 1FRDA 3ECIA 4KIKB 4HCPB 1MHHE 2L76A 1V1OA 4MM3B 1Y56A 2BWFA 3PGEA 2GMIC 1WX7A 2KTRB 1GPXA 2D5GA 2BQQA 2KFKA 4K81A 2DX5B 4DXGA 4DXAB 4NJ7A 3Q3NC 1E8YA 3RYTA 1MVKA 2LGYA 3GOEA 2WXMA 4RMAA 3KUZA 2K5PA 4W9KA 1PGAA 3H7PA 2EELA 4W9JA 4MJSA 2YVCA 4II2B 1ZDVA 4C7YA 3BINA 2V9HA 2NR2A 1E10A 1SE4A 2DZKA 2JYTA 3HM3A 3MC8A 5LXIB 3QC8B 3R3MA 3GE8C 3Q8EA 4WJNA 1EM7A 1JWBD 1F1HA 1V9JA 4IDIA 4OVUA 4BKSD 1XF5L 1EWYC 2KFKB 3MHSD 1YN4A 1JMLA 2L52A 4XGAB 3ENEA 3VUXA 4YTPB 2AL3A 3UIPB 1LO5D 3H7PB 3Q14C 2MJDA 3U4EG 4MJSB 4YTMB 4XWTA 3ZJUA 4BOSC 4B9KA 1YN3A 1E5WA 1C78A 3L4PA 3M63B 5C2TB 1KLUD 1RFKA 4IWQA 2FBWB 1VDVA 3AV8A 4TMAB 3PREA 3WCQA 2RDBC 1KM7A 4CO7A 3O65B 2IPKD 4MELA 4M8MA 4RFBA 5IO9A 3EHVA 1WR1A 2IDYA 3L0WB 2OOBB 1QLBB 1QILA 3TUOA 2KC1A 2ZNVC 1PYWD 1UH6A 2J4XA 2MHJA 3N30A 5LLIA 4FBJB 1YX6B 2IGDA 1SGHA 2M1MA 2KX3A 2BBCA 4ANUA 2LRWA 2ZPNA 3VH4B 4BOZB 1XLPA 2M17A 2JPHA 1UWMA 2JVCA 4IUMB 4HDOA 2K8CA 2OJRA 1L5PA 3NS8A 3DHGC 3KVFB 1IUEA 1FFUA 2RDHA 4ZRQA 2DNFA 3RNGC 2N7DA 2XN9C 4KSLC 1QOFA 3LJ3A 5CX3A 5FR6A 2WQYB 1SB3C 3IHPC 3HHMA 2BPSA 1XCQL 5EE3A 3HM6X 2KACA 4K7WA 1ISNA 4MGYE 1XLNA 2INDC 4LNNA 1WMHA 2KAJA 1NEKB 2IZVB 2I2YA 3N32A 3UGBB 5D6JB 2GLSA 1JWSD 3TMPB 3PZ7A 3X0WA 3ETRA 2BW2A 1D5ZC 1YNTE 2N9KA 1ZW7A 4AP4C 4KZCA 3ZO5B 2Z8LA 5LXHA 3A33B 4F1SA 1WMHB 3DVNV 5CHFA 3R2IA 1WXMA 2KFJA 2PIAA 1OGWA 2UWQA 1LXDA 3HVZA 5IAAC 1XD3B 3A4SC 3KWLA 2FCSA 2KOXA 3OAWA 4X57B 5GMVA 2LVOA 2QMTA 1GUAB 4FHKA 1EU3A 2REXA 4YXDB 1WYWB 4WJOA 2ZW0A 1JW9D 3TCAA 3BIID 4B0EA 2N7JA 2D3BA 1LQBA 2LI5A 2K1FA 2LGSA 4E71A 1K50A 1UBIA 3NUHB 4P1CC 1TYGB 5HG2A 2MBBB 3Q8FA 2INNE 1TS4A 3DBHB 3LXFA 4FXCA 2B3AA 2WHIA 3A1QA 2C7HA 4YSZB 2GBNA 3P4PB 3KUCB 1BT0A 4YSXB 3AE4B 3DVGX 3DWMA 3DVNU 3B2GA 2G9HD 1C77A 1DYQA 2QILA 1X1MA 1IBXA 2RGFA 5L83A 1GC7A 3WAMA 2FIFA 2IJ0A 2W3RA 3N20C 4HJKA 3FKYA 1WE7A 3A1QB 2WDRB 5BMGA 1TZOA 5DPWA 1JRUA 5AUIA 2ICIA 1ESFA 4PYZA 3QK0A 4DHJB 2RDGA 3GP7A 4J3OD 2C7NB 3JYUA 3L17A 3VRBB 1M94A 3U8ZA 2M0AA 3T8MA 1IBXB 4OHJA 1QOBA 1SJED 1XT9B 2ZEQA 1UGJA 3C19A 2QHOA 2O2VA 1RFAA 3VHTC 3I3TB 2L8JA 4WIPA 3MJ5A 1XLOA 3L16A 2V3PA 2G1EA 3RN9C 4RF0A 1B9RA 1UZXB 1HTQA 1FXAA 3DBSA 5BMIA 2Y5CA 3R2TA 1VZ7A 3QCAA 3QJZA 3KWVA 4DDID 3L54A 3NZ3A 2K0PA 3PO0A 1ZPSA 3B9JA 2VH1A 4KSKC 3KQ4A 1V5OA 1M4VA 2CHWA 2O2VB 2WDVB 1I4HA 1XO3A 3AN1A 2LD9A 1SXTA 1CQVA 2AQ3B 3Q8BA 2DYBA 1RYJA 1WJNA 3TL5A 5DCNA 1ZGUB 2KDIA 1YX5B 1KTKA 1CZPA 2EMTA 2ZVNA 1LFDA 1QOAA 5BO4B 2QIEB 4EZLA 1E6EB 3Q8CA 1FXTB 4BVUC 1K8RB 1F77A 3S2AA 1ZDXA 1WGHA 3Q69A 3PVLA 1FPYA 3UQBA 4YT0B 1NYQA 3SFEB 2HTME 2KX0A 2CHXA 2Z59B 2XEWA 3RNEC 5TSSA 3IBEA 1C3TA 2KZRA 2LGIA 4ARCA 1J7CA 3RCZA 4HPPA 3RNBC 3RT3B 1P1AA 4USAA 3FILA 1WI0A 1TTNA 3BWUD 5HI1A 3T3NA 3AU5A 4IKGA 2L1AA 1WM3A 5HFYA 3QQ8B 2JRHA 1T0RC 2VZKB 1SEBD 3R8BA 3UQAA 4JPSA 3ZKJC 1N62A 1WZ0A 1WE6A 2E3TA 1FNVA 5E6OA 3NVZA 4FHJA 2PEAA 1SE2A 2XK5A 2KXJA 3AU4A 4ZRKA 3AEBB 3DBHI 4R3DA 1J0GA 2H89B 3FILB 1N60A 1T0SC 3L10B 4TSSA 1E90A 1WXQA 4N9F4 1E0ZA 1I7HA 1E8ZA 4WQMA 3IT4B 3ZLZA 3PV1A 2J53A 1Q1OA 3V6CB 4NJ6A 2BWES 2B76B 2DWQA 2JWZA 2X8XX 3TEWA 2DLBA 4P1BC 2I38A 4E3CA 1E7VA 2WNMA 2MBEA 2WXJA 2KO3A 3SHQA 2LZ6A 3KYCD 1E8WA 5EE0A 4PS8A 1P3QU 2MQJA 3N1ZC 3PSEB 1UBQA 4IG7B 4W9HA 1AW7A 4FJZA 3BYYB 2D2QA 4MEMA 4BBNC 2N7EA 4GLSC 3JVZX 1WX9A 4IWOA 1TY0A 2NMQA 2KDEB 4DDGD 4OW0A 2MRPA 1SIJA 1I4GA 4L1BA 1OFFA 2WXNA 3P42A 3T3OA 2QCZA 3ZVVA 5D94A 3W5UB 2RR9A 2R61A 3M95A 1Q5WB 5J18A 1FM0D 4K3CA 4W9LA 2WU5B 1SBBB 2UYZB 4PT5A 2BVCA 1Q0WB 3IFWB 3LDZE 3NRZA 2JX5A 2MP2A 3AE7B 1KOTA 2KDBA 2KDMA 2N1WA 4ANVA 1NBFC 3NZUA 3RD2A
chains in the Genus database with same CATH topology
1SGHA 2ZPYA 2NBWB 2M1MA 1YD8U 3H1UA 4M0WB 4ASWC 5AZHA 2KX3A 4KDLB 4ANUA 2JXXA 2LRWA 2ZPNA 3DDCB 3VH4B 4BOZB 2GOWA 3T9LA 3IG3A 2BF8B 2GBRA 2M17A 2JPHA 2MCNB 2JVCA 4IUMB 4BFRA 3EC8A 4HDOA 2ZNVB 2K8CA 2OJRA 2GBKA 1AARA 3PS6A 4HK2A 4JL9A 3NS8A 3QIJA 3KVFB 4ZDVA 1WGDA 2WX0A 4GGQA 3TJPA 4K1RB 2KJ6A 2NPTA 3W1SA 4DHZE 2MP2B 2N7DA 2DYOA 4KSLC 3PLVA 3AI5A 4TUUA 4DWFA 3LJ3A 3KH0A 5CX3A 5FR6A 3W1SC 2KNBA 3IHPC 1R4MI 3WIMA 3HHMA 2RD0A 2BPSA 4LJPB 4NPNA 3RUIB 3ZW3A 2CKHB 4ICVA 3HM6X 2NBUA 3QARA 4K7WA 3DBLI 1D3ZA 1ISNA 1A5RA 4BKTA 3PTFC 4MGYE 4DBGA 3ZRCA 5G55A 2IY0B 3M3JA 1TZ1A 2NCNA 4HVBA 1WMHA 2FCQA 2XBBC 4TQ1A 2DAJA 4RM9A 2KWUB 2PPHA 2R2OA 2IZVB 3VH3B 3WALA 1NI2A 2HE7A 3N32A 4DK5A 3RZFA 3UGBB 2MWSB 3CSFA 4FJVB 2NPTB 5D6JB 2CU1A 1P0RA 3K9OB 4LDTB 2LRUA 2L0FA 2XK5B 4KV2A 3TMPB 2MX2A 2KANA 2IO1B 4HPLB 4W9CA 4EKUA 3X0WA 1WZ3A 2L3ZA 4W9GA 1U4AA 4PS3A 4GSWA 5D2MB 1ZW7A 5JH5C 4AP4C 4KZCA 3ZO5B 3CF6E 3V62A 1EO6A 2AL6A 2JUOA 3ZNID 2D11A 5LXHA 3A33B 4F1SA 4W9DA 4XZ4A 1WMHB 2JZ3B 3DVNV 2WYQA 5CHFA 4NNJB 2RSUA 2JY6A 4I6NB 1WXMA 3ZRFA 2DZMA 2KFJA 3DVGY 4ZRIA 1OGWA 4IM2A 1ZKHA 1LXDA 2UWQA 4XC2A 1XD3B 1MG8A 2DYMA 1H4RA 5IAAC 2WDTB 5JHAA 3A4SC 1YJ1A 2FCSA 2KOXA 3OAWA 4E74A 1NDDA 4X57B 5GMVA 2FCNA 3APDA 2LVOA 2IO2B 1UELA 1G6JA 1S1QB 1GG3A 2RPQA 1GUAB 1I35A 4FHKA 2KD0A 2MSED 3X23A 3PHXB 2L00B 2REXA 2K6DB 3NZSA 2KMAA 4G3XB 1QZEA 1WYWB 2Z0DB 3HK0A 4WJOA 4GMVA 3DPDA 2CHZA 3TCAA 2KVRA 2FCMA 1P9DU 4WWOA 4LDTD 3APFA 4FADA 1WF9A 5D7GA 4B6WA 1L2NA 4JGHB 2LASA 1LQBA 3B08A 2LI5A 2K1FA 5L95C 4E71A 2KN5A 1WGYA 1UBIA 2LGXA 2G3QB 3QAQA 1C1YB 3APCA 1V86A 4MSMB 2ZJDA 4FLHA 2NVUI 3PRMB 2LXAA 5CHWA 2MBBB 4GXBA 4EOYA 2JT4B 3VQIA 1PQSA 3AXCA 1RRBA 5J2RA 3JSVA 2B3AA 3SU8X 2KTFA 2KK8A 3A1QA 2ZZPB 2C7HA 4BKGA 1H8CA 2V4LA 4A20A 1SIFA 1Y8RC 4AJWA 4EZJA 2GBNA 4DHZB 3R7QA 3KUCB 1BT0A 2V1YA 2BYVE 2JZZA 4ANXA 3DVGX 2C9WB 4IC7B 4NQLB 1V49A 2K6QA 1WXSA 4B95A 2KDFB 4JLCA 1J19A 2JRIB 3A4RA 3DVNU 2IYDB 1WH3A 4KVGB 3ZNZB 1V80A 2KMCA 2IO3B 2LVQA 4G11A 4BKSA 3OJ3A 4W9EA 1GNUA 4HCNB 1X1MA 2MA9B 1YQBA 2RGFA 5L83A 1GC7A 3WAMA 2FIFA 1E8XA 1R4NI 3WAOA 2DZIA 1TBEA 4WJQA 3JSVB 2J0MA 4HJKA 2MBOA 1WE7A 3A1QB 2DHZA 4PS7A 2HTHA 1V2YA 3KYDD 2LGDA 3Q3JA 4CYEA 3PRZA 2MBQA 2BGFA 4IWPA 2KLCA 4NY0A 5AZGA 5DPWA 3Q3FA 3UF8A 2GBMA 1JRUA 2VRRB 3DBRI 4ICUA 4CHKA 2M8SA 2WWZA 4G0NB 4I6PA 2AEHA 4K7UA 3QK0A 4PYZA 2CR5A 3VAWA 4DHJB 2DZJA 4AJYB 2KWCA 2EMSA 2C7NB 3JYUA 2Z0EB 3L17A 3V6EB 3DCGA 1M94A 1OEYJ 4FULA 4GDKA 3U8ZA 3ML9A 4JIOU 4WQOB 3T8MA 2A4ZA 2G45B 3DQVA 1XT9B 3ZTDA 3VDZA 2N9EB 2K8BA 2ZEQA 5IA7A 2AWTA 4GB9A 3CMMB 3CSTA 1P98A 3SD5A 2L05A 2QHOA 2ZCBA 2O2VA 1RFAA 3VHTC 1WJUA 5CTRC 3I3TB 4FA6A 2L8JA 3R7RA 3ZNGC 3L16A 1OTRB 4II3B 3R66C 4HXDA 4IW0A 4ZYNA 5TR5A 3A9KA 2LUEA 1UZXB 5DPTA 4GIVA 2DAFA 3DBSA 3EECA 3RULA 3D32A 2PE9A 3RD2A 5C23A 4EUTA 3U30A 4G50A 1HE8A 4GDKB 3UIOB 1SE9A 2I1JA 4EFOA 3QCAA 2J7QB 2KLGA 3QJZA 4KDIC 1V6EA 2KQ7A 4DDID 2N9PC 4LJOB 3L54A 5JHBA 4F8CB 3OJ4B 4KSKC 1V5OA 1TGZB 2N1VA 4M8NA 2CHWA 4FN2A 1I42A 3TIXA 3SDLC 3NY5A 4A3OA 2O2VB 3PRPB 3TBLD 5EDSA 4EZKA 3QA8A 1UD7A 2GBJA 2D3GA 3KW5B 3VVWB 2M4NA 2LD9A 1VD2A 4NQKE 1WGGA 4WWPA 3A9KB 2L7RA 2NS5A 1WJ4A 5C1ZA 4IM3A 4LCDE 2LXCA 2DYBA 1L7YA 4GOCA 4RM8A 1WJNA 3TL5A 3QWZB 5DCNA 2LVPA 1ZGUB 3V60A 2EKEC 2KDIA 1YX5B 1OEYA 1EF5A 2EMTA 5G2NA 2K39A 2KKCA 2BKRB 2ZVNA 1LFDA 1IYFA 1WFYA 4NAWA 5BO4B 2MLBA 3ZIMA 1IPGA 2N9XA 4WAAA 2Y5BB 4EZLA 3EFUA 3BY4B 3PPAA 2KC2A 5E6PA 2BKFA 1XQQA 2FUHB 1FXTB 2DENB 5AZFA 2HD5B 3VTVA 4BVUC 2KJRA 3PLUA 1K8RB 4YL8A 3VXWA 2FAZA 1WXAA 3PHWB 4HWIB 3S2AA 4AUQC 3PZDA 4W9IA 1WGHA 3ALBA 2O6VA 3VTUA 3ZNHB 4URKA 3PVLA 3QHTA 1J8CA 3HIZA 3UQBA 5E6NA 1WM2A 2KX0A 2CHXA 4IM0A 1WGRA 2Z59B 3B0AA 2V3SA 2XEWA 1WIAA 1KJTA 3H7SA 2WX1A 4TV3A 4KIKA 3WA0A 5AEKB 2CS4A 3IBEA 4NAWB 3AULA 2KZRA 3ZTCA 1C3TA 2FNJB 2C60A 4K7SA 3RCZA 3ZDMC 4HDQA 3RZWC 4MM3A 3VUWA 3RT3B 1P1AA 2YLMA 1WI0A 1TTNA 2ZVOA 2KTRA 1E7UA 3U7DA 1CMXB 2K25A 1WR6E 3ZDTA 2R2QA 3AU5A 2G4SA 1GC6A 1WM3A 3V61A 3QQ8B 4GN1A 2JRHA 2KHWB 1WY8A 1Z2MA 2J0KA 2O6VB 2C5LC 2K8HA 3UQAA 2IO0B 3ZKJC 4A3PA 2PE6B 4MGKE 1V81A 1WZ0A 4W9FA 1IP9A 3WANA 1WE6A 3KUDB 2KQSA 4HLEA 5E6OA 2IY1B 3ECIA 4KIKB 1RLFA 2MBHA 4FHJA 2PEAA 4HCPB 2ZCCA 2LWPA 4XX5A 2XK5A 2KXJA 3K9PB 1F9JA 3AU4A 2L76A 4ZRKA 1T0YA 1WXVA 4KZ0A 1WX8A 1UGMA 2BWFA 2JF5A 3DBHI 3PGEA 1J0GA 4MGIE 2N4FA 2GMIC 3A9JA 1WX7A 2KTRB 3L10B 3VUYA 1E90A 2J0JA 4N9F4 2KFKA 4K81A 2DX5B 5J17A 3VFKA 3B1LX 4DXAB 1E8ZA 4NJ7A 4TQ0A 2W9NA 1E8YA 3IVFA 3RYTA 1V5TA 2LGYA 2NBVB 3PV1A 3W1YA 3ZLZA 3GOEA 1Q1OA 3V6CB 5KHQA 3DOWA 2KJHB 2BWES 4NJ6A 4RMAA 2FIDA 2JWZA 1EUVB 2BYEA 3KUZA 3N3KB 4W9KA 2D10A 3P2BA 3H7PA 4W9JA 4MGZE 4WWNA 3M62B 4MJSA 2BYFA 2YVCA 4II2B 4E3CA 4GDLA 3BINA 3MJWA 1E7VA 2G4DB 2NR2A 2O6VD 2DZKA 3HM3A 4AWJA 2A5UA 5LXIB 2MBEA 3ONSA 1YIWA 3QC8B 2KO3A 3QX1A 3R3MA 3SHQA 4DHJD 3C0RB 4WJNA 1V9JA 3PT2B 4BKSD 3A9JB 1WJ6A 2LZ6A 4OVUA 3KYCD 3GZNI 1E8WA 4PS8A 2M0XA 1P3QU 2I1KA 2KFKB 2IBIB 2MQJA 1S3SG 3MHSD 3WAPA 4WJPA 3PSEB 1RAXA 4TKNA 1UBQA 4IG7B 3ENEA 4W9HA 3VUXA 4F7ZA 3MTNB 4FJZA 1VCBA 4MDKE 2D2QA 2L0TA 4MEMA 2AL3A 4BBNC 2N7EA 3UIPB 3JVZX 4I6LB 1WX9A 3H7PB 4IWOA 5DPSA 4MJSB 4EEWA 4BOSC 4B9KA 3OLMD 4GDLB 2KDEB 4DDGD 1E5WA 2MRPA 5KHOA 3M63B 4MH0E 5JZEB 4JQWC 4IWQA 3ML8A 4MSQB 3ZUNA 4ZRJA 2LJ5A 3ZVVA 1EF1A 5D94A 3PREA 3NOBA 4FJYA 1KLVA 2RR9A 2D07B 3L13A 3NHEB 1KM7A 3M95A 1Q5WB 4CO7A 5J18A 5DPRA 2ASQA 3O65B 1Z5SB 4PYUA 4W9LA 1OQYA 4MELA 4M8MA 2PJHA 1LM8B 3EHVA 3VTWA 1WR1A 4OVVA 2HJ8A 2UYZB 4P7IA 2MW5A 4AOFA 2C7MB 3L0WB 3H6NA 2OOBB 1Q0WB 3L08A 3IFWB 4GU2A 2KWVB 3UINB 1GJZA 2AYOB 3LDZE 2KC1A 2ZNVC 4ANWA 3H9DA 4BBNF 1UH6A 5CHVC 5HKHA 2MP2A 1KOTA 2KDBA 4HPMB 3JW0X 1WRDB 2N1WA 4ANVA 3N30A 5LLIA 1NBFC 3NZUA 4FBJB 1YX6B 4J6IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SGH A;  2ZPY A;  2NBW B;  2M1M A;  1YD8 U;  3H1U A;  4M0W B;  4ASW C;  5AZH A;  2KX3 A;  4KDL B;  4ANU A;  2JXX A;  2LRW A;  2ZPN A;  3DDC B;  3VH4 B;  4BOZ B;  2GOW A;  3T9L A;  3IG3 A;  2BF8 B;  2GBR A;  2M17 A;  2JPH A;  2MCN B;  2JVC A;  4IUM B;  4BFR A;  3EC8 A;  4HDO A;  2ZNV B;  2K8C A;  2OJR A;  2GBK A;  1AAR A;  3PS6 A;  4HK2 A;  4JL9 A;  3NS8 A;  3QIJ A;  3KVF B;  4ZDV A;  1WGD A;  2WX0 A;  4GGQ A;  3TJP A;  4K1R B;  2KJ6 A;  2NPT A;  3W1S A;  4DHZ E;  2MP2 B;  2N7D A;  2DYO A;  4KSL C;  3PLV A;  3AI5 A;  4TUU A;  4DWF A;  3LJ3 A;  3KH0 A;  5CX3 A;  5FR6 A;  3W1S C;  2KNB A;  3IHP C;  1R4M I;  3WIM A;  3HHM A;  2RD0 A;  2BPS A;  4LJP B;  4NPN A;  3RUI B;  3ZW3 A;  2CKH B;  4ICV A;  3HM6 X;  2NBU A;  3QAR A;  4K7W A;  3DBL I;  1D3Z A;  1ISN A;  1A5R A;  4BKT A;  3PTF C;  4MGY E;  4DBG A;  3ZRC A;  5G55 A;  2IY0 B;  3M3J A;  1TZ1 A;  2NCN A;  4HVB A;  1WMH A;  2FCQ A;  2XBB C;  4TQ1 A;  2DAJ A;  4RM9 A;  2KWU B;  2PPH A;  2R2O A;  2IZV B;  3VH3 B;  3WAL A;  1NI2 A;  2HE7 A;  3N32 A;  4DK5 A;  3RZF A;  3UGB B;  2MWS B;  3CSF A;  4FJV B;  2NPT B;  5D6J B;  2CU1 A;  1P0R A;  3K9O B;  4LDT B;  2LRU A;  2L0F A;  2XK5 B;  4KV2 A;  3TMP B;  2MX2 A;  2KAN A;  2IO1 B;  4HPL B;  4W9C A;  4EKU A;  3X0W A;  1WZ3 A;  2L3Z A;  4W9G A;  1U4A A;  4PS3 A;  4GSW A;  5D2M B;  1ZW7 A;  5JH5 C;  4AP4 C;  4KZC A;  3ZO5 B;  3CF6 E;  3V62 A;  1EO6 A;  2AL6 A;  2JUO A;  3ZNI D;  2D11 A;  5LXH A;  3A33 B;  4F1S A;  4W9D A;  4XZ4 A;  1WMH B;  2JZ3 B;  3DVN V;  2WYQ A;  5CHF A;  4NNJ B;  2RSU A;  2JY6 A;  4I6N B;  1WXM A;  3ZRF A;  2DZM A;  2KFJ A;  3DVG Y;  4ZRI A;  1OGW A;  4IM2 A;  1ZKH A;  1LXD A;  2UWQ A;  4XC2 A;  1XD3 B;  1MG8 A;  2DYM A;  1H4R A;  5IAA C;  2WDT B;  5JHA A;  3A4S C;  1YJ1 A;  2FCS A;  2KOX A;  3OAW A;  4E74 A;  1NDD A;  4X57 B;  5GMV A;  2FCN A;  3APD A;  2LVO A;  2IO2 B;  1UEL A;  1G6J A;  1S1Q B;  1GG3 A;  2RPQ A;  1GUA B;  1I35 A;  4FHK A;  2KD0 A;  2MSE D;  3X23 A;  3PHX B;  2L00 B;  2REX A;  2K6D B;  3NZS A;  2KMA A;  4G3X B;  1QZE A;  1WYW B;  2Z0D B;  3HK0 A;  4WJO A;  4GMV A;  3DPD A;  2CHZ A;  3TCA A;  2KVR A;  2FCM A;  1P9D U;  4WWO A;  4LDT D;  3APF A;  4FAD A;  1WF9 A;  5D7G A;  4B6W A;  1L2N A;  4JGH B;  2LAS A;  1LQB A;  3B08 A;  2LI5 A;  2K1F A;  5L95 C;  4E71 A;  2KN5 A;  1WGY A;  1UBI A;  2LGX A;  2G3Q B;  3QAQ A;  1C1Y B;  3APC A;  1V86 A;  4MSM B;  2ZJD A;  4FLH A;  2NVU I;  3PRM B;  2LXA A;  5CHW A;  2MBB B;  4GXB A;  4EOY A;  2JT4 B;  3VQI A;  1PQS A;  3AXC A;  1RRB A;  5J2R A;  3JSV A;  2B3A A;  3SU8 X;  2KTF A;  2KK8 A;  3A1Q A;  2ZZP B;  2C7H A;  4BKG A;  1H8C A;  2V4L A;  4A20 A;  1SIF A;  1Y8R C;  4AJW A;  4EZJ A;  2GBN A;  4DHZ B;  3R7Q A;  3KUC B;  1BT0 A;  2V1Y A;  2BYV E;  2JZZ A;  4ANX A;  3DVG X;  2C9W B;  4IC7 B;  4NQL B;  1V49 A;  2K6Q A;  1WXS A;  4B95 A;  2KDF B;  4JLC A;  1J19 A;  2JRI B;  3A4R A;  3DVN U;  2IYD B;  1WH3 A;  4KVG B;  3ZNZ B;  1V80 A;  2KMC A;  2IO3 B;  2LVQ A;  4G11 A;  4BKS A;  3OJ3 A;  4W9E A;  1GNU A;  4HCN B;  1X1M A;  2MA9 B;  1YQB A;  2RGF A;  5L83 A;  1GC7 A;  3WAM A;  2FIF A;  1E8X A;  1R4N I;  3WAO A;  2DZI A;  1TBE A;  4WJQ A;  3JSV B;  2J0M A;  4HJK A;  2MBO A;  1WE7 A;  3A1Q B;  2DHZ A;  4PS7 A;  2HTH A;  1V2Y A;  3KYD D;  2LGD A;  3Q3J A;  4CYE A;  3PRZ A;  2MBQ A;  2BGF A;  4IWP A;  2KLC A;  4NY0 A;  5AZG A;  5DPW A;  3Q3F A;  3UF8 A;  2GBM A;  1JRU A;  2VRR B;  3DBR I;  4ICU A;  4CHK A;  2M8S A;  2WWZ A;  4G0N B;  4I6P A;  2AEH A;  4K7U A;  3QK0 A;  4PYZ A;  2CR5 A;  3VAW A;  4DHJ B;  2DZJ A;  4AJY B;  2KWC A;  2EMS A;  2C7N B;  3JYU A;  2Z0E B;  3L17 A;  3V6E B;  3DCG A;  1M94 A;  1OEY J;  4FUL A;  4GDK A;  3U8Z A;  3ML9 A;  4JIO U;  4WQO B;  3T8M A;  2A4Z A;  2G45 B;  3DQV A;  1XT9 B;  3ZTD A;  3VDZ A;  2N9E B;  2K8B A;  2ZEQ A;  5IA7 A;  2AWT A;  4GB9 A;  3CMM B;  3CST A;  1P98 A;  3SD5 A;  2L05 A;  2QHO A;  2ZCB A;  2O2V A;  1RFA A;  3VHT C;  1WJU A;  5CTR C;  3I3T B;  4FA6 A;  2L8J A;  3R7R A;  3ZNG C;  3L16 A;  1OTR B;  4II3 B;  3R66 C;  4HXD A;  4IW0 A;  4ZYN A;  5TR5 A;  3A9K A;  2LUE A;  1UZX B;  5DPT A;  4GIV A;  2DAF A;  3DBS A;  3EEC A;  3RUL A;  3D32 A;  2PE9 A;  3RD2 A;  5C23 A;  4EUT A;  3U30 A;  4G50 A;  1HE8 A;  4GDK B;  3UIO B;  1SE9 A;  2I1J A;  4EFO A;  3QCA A;  2J7Q B;  2KLG A;  3QJZ A;  4KDI C;  1V6E A;  2KQ7 A;  4DDI D;  2N9P C;  4LJO B;  3L54 A;  5JHB A;  4F8C B;  3OJ4 B;  4KSK C;  1V5O A;  1TGZ B;  2N1V A;  4M8N A;  2CHW A;  4FN2 A;  1I42 A;  3TIX A;  3SDL C;  3NY5 A;  4A3O A;  2O2V B;  3PRP B;  3TBL D;  5EDS A;  4EZK A;  3QA8 A;  1UD7 A;  2GBJ A;  2D3G A;  3KW5 B;  3VVW B;  2M4N A;  2LD9 A;  1VD2 A;  4NQK E;  1WGG A;  4WWP A;  3A9K B;  2L7R A;  2NS5 A;  1WJ4 A;  5C1Z A;  4IM3 A;  4LCD E;  2LXC A;  2DYB A;  1L7Y A;  4GOC A;  4RM8 A;  1WJN A;  3TL5 A;  3QWZ B;  5DCN A;  2LVP A;  1ZGU B;  3V60 A;  2EKE C;  2KDI A;  1YX5 B;  1OEY A;  1EF5 A;  2EMT A;  5G2N A;  2K39 A;  2KKC A;  2BKR B;  2ZVN A;  1LFD A;  1IYF A;  1WFY A;  4NAW A;  5BO4 B;  2MLB A;  3ZIM A;  1IPG A;  2N9X A;  4WAA A;  2Y5B B;  4EZL A;  3EFU A;  3BY4 B;  3PPA A;  2KC2 A;  5E6P A;  2BKF A;  1XQQ A;  2FUH B;  1FXT B;  2DEN B;  5AZF A;  2HD5 B;  3VTV A;  4BVU C;  2KJR A;  3PLU A;  1K8R B;  4YL8 A;  3VXW A;  2FAZ A;  1WXA A;  3PHW B;  4HWI B;  3S2A A;  4AUQ C;  3PZD A;  4W9I A;  1WGH A;  3ALB A;  2O6V A;  3VTU A;  3ZNH B;  4URK A;  3PVL A;  3QHT A;  1J8C A;  3HIZ A;  3UQB A;  5E6N A;  1WM2 A;  2KX0 A;  2CHX A;  4IM0 A;  1WGR A;  2Z59 B;  3B0A A;  2V3S A;  2XEW A;  1WIA A;  1KJT A;  3H7S A;  2WX1 A;  4TV3 A;  4KIK A;  3WA0 A;  5AEK B;  2CS4 A;  3IBE A;  4NAW B;  3AUL A;  2KZR A;  3ZTC A;  1C3T A;  2FNJ B;  2C60 A;  4K7S A;  3RCZ A;  3ZDM C;  4HDQ A;  3RZW C;  4MM3 A;  3VUW A;  3RT3 B;  1P1A A;  2YLM A;  1WI0 A;  1TTN A;  2ZVO A;  2KTR A;  1E7U A;  3U7D A;  1CMX B;  2K25 A;  1WR6 E;  3ZDT A;  2R2Q A;  3AU5 A;  2G4S A;  1GC6 A;  1WM3 A;  3V61 A;  3QQ8 B;  4GN1 A;  2JRH A;  2KHW B;  1WY8 A;  1Z2M A;  2J0K A;  2O6V B;  2C5L C;  2K8H A;  3UQA A;  2IO0 B;  3ZKJ C;  4A3P A;  2PE6 B;  4MGK E;  1V81 A;  1WZ0 A;  4W9F A;  1IP9 A;  3WAN A;  1WE6 A;  3KUD B;  2KQS A;  4HLE A;  5E6O A;  2IY1 B;  3ECI A;  4KIK B;  1RLF A;  2MBH A;  4FHJ A;  2PEA A;  4HCP B;  2ZCC A;  2LWP A;  4XX5 A;  2XK5 A;  2KXJ A;  3K9P B;  1F9J A;  3AU4 A;  2L76 A;  4ZRK A;  1T0Y A;  1WXV A;  4KZ0 A;  1WX8 A;  1UGM A;  2BWF A;  2JF5 A;  3DBH I;  3PGE A;  1J0G A;  4MGI E;  2N4F A;  2GMI C;  3A9J A;  1WX7 A;  2KTR B;  3L10 B;  3VUY A;  1E90 A;  2J0J A;  4N9F 4;  2KFK A;  4K81 A;  2DX5 B;  5J17 A;  3VFK A;  3B1L X;  4DXA B;  1E8Z A;  4NJ7 A;  4TQ0 A;  2W9N A;  1E8Y A;  3IVF A;  3RYT A;  1V5T A;  2LGY A;  2NBV B;  3PV1 A;  3W1Y A;  3ZLZ A;  3GOE A;  1Q1O A;  3V6C B;  5KHQ A;  3DOW A;  2KJH B;  2BWE S;  4NJ6 A;  4RMA A;  2FID A;  2JWZ A;  1EUV B;  2BYE A;  3KUZ A;  3N3K B;  4W9K A;  2D10 A;  3P2B A;  3H7P A;  4W9J A;  4MGZ E;  4WWN A;  3M62 B;  4MJS A;  2BYF A;  2YVC A;  4II2 B;  4E3C A;  4GDL A;  3BIN A;  3MJW A;  1E7V A;  2G4D B;  2NR2 A;  2O6V D;  2DZK A;  3HM3 A;  4AWJ A;  2A5U A;  5LXI B;  2MBE A;  3ONS A;  1YIW A;  3QC8 B;  2KO3 A;  3QX1 A;  3R3M A;  3SHQ A;  4DHJ D;  3C0R B;  4WJN A;  1V9J A;  3PT2 B;  4BKS D;  3A9J B;  1WJ6 A;  2LZ6 A;  4OVU A;  3KYC D;  3GZN I;  1E8W A;  4PS8 A;  2M0X A;  1P3Q U;  2I1K A;  2KFK B;  2IBI B;  2MQJ A;  1S3S G;  3MHS D;  3WAP A;  4WJP A;  3PSE B;  1RAX A;  4TKN A;  1UBQ A;  4IG7 B;  3ENE A;  4W9H A;  3VUX A;  4F7Z A;  3MTN B;  4FJZ A;  1VCB A;  4MDK E;  2D2Q A;  2L0T A;  4MEM A;  2AL3 A;  4BBN C;  2N7E A;  3UIP B;  3JVZ X;  4I6L B;  1WX9 A;  3H7P B;  4IWO A;  5DPS A;  4MJS B;  4EEW A;  4BOS C;  4B9K A;  3OLM D;  4GDL B;  2KDE B;  4DDG D;  1E5W A;  2MRP A;  5KHO A;  3M63 B;  4MH0 E;  5JZE B;  4JQW C;  4IWQ A;  3ML8 A;  4MSQ B;  3ZUN A;  4ZRJ A;  2LJ5 A;  3ZVV A;  1EF1 A;  5D94 A;  3PRE A;  3NOB A;  4FJY A;  1KLV A;  2RR9 A;  2D07 B;  3L13 A;  3NHE B;  1KM7 A;  3M95 A;  1Q5W B;  4CO7 A;  5J18 A;  5DPR A;  2ASQ A;  3O65 B;  1Z5S B;  4PYU A;  4W9L A;  1OQY A;  4MEL A;  4M8M A;  2PJH A;  1LM8 B;  3EHV A;  3VTW A;  1WR1 A;  4OVV A;  2HJ8 A;  2UYZ B;  4P7I A;  2MW5 A;  4AOF A;  2C7M B;  3L0W B;  3H6N A;  2OOB B;  1Q0W B;  3L08 A;  3IFW B;  4GU2 A;  2KWV B;  3UIN B;  1GJZ A;  2AYO B;  3LDZ E;  2KC1 A;  2ZNV C;  4ANW A;  3H9D A;  4BBN F;  1UH6 A;  5CHV C;  5HKH A;  2MP2 A;  1KOT A;  2KDB A;  4HPM B;  3JW0 X;  1WRD B;  2N1W A;  4ANV A;  3N30 A;  5LLI A;  1NBF C;  3NZU A;  4FBJ B;  1YX6 B;  4J6I A; 
#chains in the Genus database with same CATH topology
 1HZ5 A;  2NBW B;  2WXG A;  1YD8 U;  2WDQ B;  3P4R B;  2W55 A;  2XNA C;  2JXX A;  3DDC B;  3FAH A;  2GOW A;  3IG3 A;  1T0Q C;  2GBR A;  4ZHO A;  3IAM 1;  2ZNV B;  2LHE A;  4HK2 A;  2QEJ C;  3SR6 A;  3QIJ A;  2LHD A;  4GGQ A;  5JXV A;  2KJ6 A;  4RH6 A;  4DHZ E;  2MP2 B;  4TUU A;  3W1S C;  3W5V B;  2WLB A;  3WIM A;  2MJE A;  2ZW1 A;  3DWG C;  1FXI A;  2CKH B;  2NBU A;  4BZA A;  3PTF C;  1YOV B;  3ZRC A;  5G55 A;  3M3J A;  1CJE A;  4HVB A;  4TQ1 A;  2R2O A;  3VH3 B;  3OG5 A;  4RGM A;  3RMK C;  2MWS B;  3CSF A;  3E56 A;  4FJV B;  2GRI A;  5FR3 A;  2CU1 A;  4KV2 A;  2WXQ A;  1RM6 C;  2V3N A;  1FNU A;  4PS3 A;  4GSW A;  4MH8 A;  5D2M B;  5JH5 C;  2WU2 B;  3CF6 E;  2RSU A;  4I6N B;  3AED B;  1ZKH A;  1MG8 A;  2FCN A;  3APD A;  1G6J A;  3N1Y C;  1S1Q B;  1GG3 A;  4K3B A;  1I35 A;  2MSE D;  3X23 A;  2L00 B;  1KLG D;  1V97 A;  1QZE A;  2EKI A;  4GMV A;  2CHZ A;  3EA6 A;  2KVR A;  2KWD A;  1HQR D;  3ZJV A;  5L95 C;  4KGR A;  1WGY A;  3QAQ A;  1V86 A;  4MSM B;  2ZJD A;  5AUK A;  1D6E C;  2LXA A;  4US8 A;  4GXB A;  1PQS A;  4B0M A;  2V4L A;  4A20 A;  1STE A;  4EE2 A;  4DHZ B;  2D3A A;  2CJO A;  2JZZ A;  2QC8 A;  2C9W B;  2IGG A;  4ACF A;  2KMM A;  1MHX A;  2QJL A;  2KDF B;  4JLC A;  1J19 A;  2KYW A;  3A4R A;  2IYD B;  1I4R A;  5EE1 A;  2LVQ A;  3RFZ B;  3OJ3 A;  4HCN B;  2WXF A;  2WXK A;  3U52 E;  2NTT A;  1TBE A;  4WJQ A;  2J0M A;  1DOX A;  3NVW A;  3AB5 A;  2INP E;  3Q2A C;  2MBQ A;  1FEH A;  1ZXH A;  4IWP A;  4C7Z A;  4CHK A;  2JQR B;  1KRH A;  2M8S A;  4G0N B;  4I6P A;  4S17 A;  5EE9 A;  3W2D A;  4K7U A;  3AH7 A;  3Q8A A;  2Z0E B;  3VRA B;  2PTL A;  4GDK A;  2W3S A;  3ML9 A;  2A4Z A;  1B1Z A;  1E7P B;  2N9E B;  2K8B A;  4GB9 A;  3SD5 A;  1TKY A;  3B2F A;  4FA6 A;  1GB1 A;  3R7R A;  3ZNG C;  4RF1 A;  2OED A;  4ZYN A;  3A9K A;  4LNF A;  5DPT A;  4GIV A;  2DAF A;  2PE9 A;  1ZUD 2;  4GDK B;  3UIO B;  2I1J A;  2J7Q B;  5H92 C;  2KLG A;  3U7Z A;  2KQ7 A;  2KQ4 X;  4MT5 A;  5JHB A;  4F8C B;  1C4P A;  1TGZ B;  3SDL C;  3NVY A;  1L6U A;  4N58 A;  1UD7 A;  1VD2 A;  4WWP A;  3A9K B;  1NYR A;  4IM3 A;  2KN4 A;  4PK1 A;  3QWZ B;  3V60 A;  2FE8 A;  2KKC A;  2BKR B;  2QSD A;  1WFY A;  4NAW A;  2L32 A;  4HEA 1;  2Y5B B;  3C8Y A;  4OZB A;  2KC2 A;  1D4B A;  1F0Z A;  2HD5 B;  1YQ4 B;  4YL8 A;  3U2S C;  3VXW A;  1WXA A;  4HWI B;  1BXT A;  3RNF C;  2WS3 B;  4URK A;  1J8C A;  3BVZ A;  1K53 A;  2V3S A;  4TV3 A;  1KJT A;  5AEK B;  4NAW B;  4Q2J A;  3GS2 A;  4NAM A;  2C60 A;  4S0R A;  3RZW C;  2YLM A;  2ZVO A;  2MH7 A;  3LB8 C;  1BML C;  1GC6 A;  4GN1 A;  1WY8 A;  2Y5P A;  2ONQ A;  1N5X A;  1C4A A;  4A3P A;  1PFD A;  1V81 A;  4M02 A;  3I9V 1;  1P7F A;  1RLF A;  3K9P B;  2CU3 A;  1WXV A;  4KZ0 A;  1WX8 A;  1UGM A;  1HEZ E;  2J0J A;  5J17 A;  3VFK A;  4A9A A;  3IVF A;  1V5T A;  1VRA B;  3W1Y A;  5KHQ A;  3DOW A;  2KJH B;  1EUV B;  3N3K B;  1J7B A;  2D10 A;  1FCL A;  3AE8 B;  4WWN A;  3M62 B;  1K51 A;  4GDL A;  3H8H A;  1C79 A;  2G4D B;  2A5U A;  3ONS A;  4DHJ D;  3C0R B;  4OVZ A;  3PT2 B;  2M0X A;  2SEB D;  1XCT L;  3WAP A;  4WJP A;  1RAX A;  4TKN A;  1IGD A;  1MJD A;  2INC C;  2M19 A;  1VCB A;  4MDK E;  5D3I B;  2LJI A;  1F2R I;  1R4N B;  3OLM D;  2PKO A;  4GDL B;  5LNK 1;  3GB1 A;  4JQW C;  5G5H A;  3V3X A;  4MSQ B;  5C3J B;  3CWI A;  3TSS A;  1PGX A;  1EF1 A;  4AQ7 A;  4RCO A;  3NOB A;  1KLV A;  3L13 A;  3NHE B;  2NTS A;  4PYU A;  2PJH A;  1WRI A;  2MW5 A;  4AOF A;  3I63 C;  2C7M B;  2PMV A;  4GU2 A;  1C9F A;  3UIN B;  5IKC M;  1GJZ A;  2AYO B;  4H2A A;  4ARI A;  4ANW A;  3H9D A;  4BBN F;  5HKH A;  1WRD B;  1XLQ A;  5IOI A;  1FRR A;  4RGN A;  3EGR A;  2ZPY A;  5AZH A;  3T9L A;  3ZQ4 A;  4JX1 C;  4KX6 B;  2MCN B;  4BFR A;  1T6B X;  3PS6 A;  4JL9 A;  4CQN A;  2WX0 A;  3TJP A;  2BTE A;  3ZJT A;  1T3Q A;  3P63 A;  3W1S A;  2BS2 B;  2M56 B;  1JCK B;  3AI5 A;  4DWF A;  1WYG A;  1QF6 A;  2KNB A;  2RD0 A;  4NPN A;  1I4X A;  3RUI B;  1DGJ A;  4ICV A;  4BKT A;  3AE5 B;  4DBG A;  2GI9 A;  3BVM A;  2FCQ A;  2LEK A;  2XBB C;  5I4D A;  1N5W A;  2DAJ A;  5GXG B;  2KWU B;  2PPH A;  3WAL A;  1EU4 A;  2HE7 A;  2V0G A;  5BYS A;  1WGK A;  4L23 A;  1P0R A;  3RPF C;  2VZK D;  4A6Q A;  4LDT B;  2LRU A;  2XK5 B;  4KGT A;  2KAN A;  2IO1 B;  4HPL B;  3J9C A;  4W9C A;  4EKU A;  2QDF A;  1GB4 A;  4C56 C;  2L3Z A;  4W9G A;  1QQR A;  2X38 A;  4XWW A;  2HJ1 A;  4HKZ E;  1J7A A;  4HRO A;  2TSS A;  3ZNI D;  1EO6 A;  2JUO A;  1V1P A;  4W9D A;  3URY A;  3HUI A;  2JY6 A;  3ZYY X;  3ZRF A;  4ZRI A;  4XC2 A;  2DYM A;  2WDT B;  1YJ1 A;  1NDD A;  4WUR A;  3AE3 B;  2IO2 B;  1UEL A;  3NJT A;  3EUB 2;  3TEZ A;  2RPQ A;  2KD0 A;  1Q10 A;  1MPE A;  3MFG A;  4LNK A;  2K6D B;  4G3X B;  2HDE A;  2J52 A;  2Z0D B;  3DPD A;  2VH2 A;  4LDT D;  2LFI A;  3APF A;  1V1P B;  1WF9 A;  5D7G A;  4B6W A;  4FAD A;  3MP9 A;  1L2N A;  2LAS A;  1HTO A;  1PUT A;  2KN5 A;  1L0V B;  3P4S B;  3APC A;  2NVU I;  3ZXV A;  1HXY D;  4RGT A;  5CHW A;  4EOY A;  2LUM A;  3VQI A;  4MAC A;  3AXC A;  3TEY A;  3SU8 X;  2YEP F;  1N6Z A;  4BKG A;  1H8C A;  4AJW A;  4EZJ A;  3R7Q A;  2V1Y A;  2J42 A;  2BYV E;  3I57 A;  4ANX A;  4IC7 B;  2K6Q A;  1TT5 B;  2FUG 1;  2DBY A;  2JRI B;  1WH3 A;  2WXO A;  4KVG B;  1ET6 A;  2KMC A;  3TEX A;  2IO3 B;  4P16 A;  3KLS X;  3NVV A;  4G11 A;  3AM9 A;  4BKS A;  4W9E A;  1GNU A;  4JE3 B;  2ON8 A;  1YQB A;  1D5M C;  3BK1 A;  1R4N I;  2DZI A;  3IXS A;  2AQ2 B;  1T5X D;  5BYR A;  3GZN B;  2HTH A;  1V2Y A;  3KYD D;  2H88 B;  3PRZ A;  2KLC A;  4NY0 A;  3Q3F A;  3UF8 A;  2GBM A;  2VRR B;  4ICU A;  2CJN A;  3AEF B;  3BZD B;  4ITK A;  2SAK A;  2DZJ A;  4AJY B;  3Q3O C;  3MC9 A;  3DCG A;  4FUL A;  4JIO U;  2G45 B;  1SE3 A;  2KVZ A;  4ZYS A;  2AWT A;  5IA7 A;  3CMM B;  2L05 A;  1JWU D;  1WJU A;  1YJJ A;  4II3 B;  5H8Y E;  3R66 C;  4HXD A;  1PDX A;  3UI3 A;  1FNW A;  3RUL A;  4EUT A;  1ROE A;  2AX5 A;  1A70 A;  1V6E A;  2N9P C;  1UWX A;  1WSP A;  2N9L A;  3OJ4 B;  2N1V A;  4M8N A;  2PVG C;  3NY5 A;  4A3O A;  3BVG A;  3TBL D;  5EDS A;  4EZK A;  1FMA D;  2GBJ A;  3VVW B;  2M4N A;  4NQK E;  1V8C A;  1TIF A;  1WGG A;  4OZA A;  1WJ4 A;  1AWD A;  4LCD E;  1TKE A;  1L7Y A;  1TKG A;  4GOC A;  1IGC A;  4RM8 A;  5G5G A;  2LVP A;  3Q6B A;  1EF5 A;  5G2N A;  2K39 A;  4XDC A;  1DOI A;  2MLB A;  1WWT A;  1R4M B;  2N9X A;  1YMH E;  2OHF A;  3EFU A;  3NS1 A;  3BY4 B;  3PPA A;  3AE1 B;  5E6P A;  2K22 A;  3DBL B;  4NZL B;  3VTV A;  1FFV A;  3PLU A;  3O13 A;  2FAZ A;  4AUQ C;  4W9I A;  2IGH A;  2O6V A;  3QHT A;  3HIZ A;  5E6N A;  4P6V F;  1JRO A;  3H7S A;  2WX1 A;  2CS4 A;  2FNJ B;  4K7S A;  3IT6 B;  1TY2 A;  3ZDM C;  1HZ6 A;  2N0S B;  4HDQ A;  5IN7 A;  3VUW A;  1ZP0 B;  3RI7 C;  5IP4 D;  3U7D A;  1CMX B;  1WR6 E;  2R2Q A;  3FC4 A;  2Y3A A;  4WH4 A;  4C80 A;  4JWS C;  3AE6 B;  4HRS A;  2O6V B;  2C5L C;  2K8H A;  1OQR A;  2IO0 B;  1IP9 A;  3WAN A;  2RPV A;  3KUD B;  2KQS A;  1QKZ A;  2IY1 B;  1YN5 A;  2UU7 A;  2MBH A;  2WXL A;  2ZCC A;  1SJH D;  1E9M A;  2K9X A;  2LWP A;  2WP9 B;  3AEG B;  1N63 A;  1F9J A;  1OQQ A;  4XX5 A;  1T0Y A;  3MHZ A;  4D2K A;  2JF5 A;  4MGI E;  2N4F A;  3A9J A;  2E6X A;  3VUY A;  1YJI A;  3B1L X;  1N61 A;  5T8I A;  4TQ0 A;  2W9N A;  2GB1 A;  2NBV B;  2K3U A;  1SSN A;  2OJW A;  2FID A;  2BYE A;  2W82 A;  3P2B A;  4MGZ E;  2BYF A;  3N1X C;  1AN8 A;  3MJW A;  2O6V D;  4BAX A;  1JRP A;  4LTU A;  4AWJ A;  4N59 A;  1YIW A;  3QX1 A;  3A9J B;  1WJ6 A;  3GZN I;  3RNA C;  4C4V A;  2I1K A;  4DXF A;  1GOZ A;  2IBI B;  2WXH A;  1S3S G;  4LK0 M;  4REZ A;  3ZXR A;  3ABV B;  4YSY B;  4F7Z A;  3MTN B;  2L0T A;  1KFY B;  1JAL A;  4I6L B;  5DPS A;  1JQ4 A;  3I5J C;  4EEW A;  1KH0 A;  5BMH A;  5KHO A;  3BYT B;  4A8X C;  4MH0 E;  5JZE B;  4NJC A;  3MC0 B;  3ML8 A;  3ZUN A;  4ZRJ A;  2LJ5 A;  1TS5 A;  4JWU C;  3AEA B;  3DBR B;  1QOG A;  4FJY A;  2D07 B;  4M0W A;  4C4V B;  5DPR A;  2ASQ A;  2PLP A;  1Z5S B;  1OQY A;  1LM8 B;  3VTW A;  4OVV A;  3DHI C;  2HJ8 A;  4P7I A;  3H6N A;  1FIQ A;  3L08 A;  2KWV B;  4A90 A;  3DHH C;  4HJG E;  5CHV C;  3ZGZ A;  4RGO S;  2BB5 A;  4HPM B;  3JW0 X;  2AQ1 B;  3OWE B;  1C76 A;  4J6I A;  3SEB A;  2MEK A;  4ASW C;  3H1U A;  4M0W B;  4KDL B;  1C4C A;  3GE3 C;  1VZ6 A;  1F52 A;  2MJ3 A;  1L0Y B;  2BF8 B;  4WAF A;  3EC8 A;  2GBK A;  1AAR A;  1R7S A;  1F2R C;  4ZDV A;  1WGD A;  4K1R B;  4HKQ A;  1FCC C;  2NPT A;  1VR9 A;  2DYO A;  2BYT A;  5FK9 C;  3PLV A;  3KH0 A;  1L0X B;  1D5X C;  3P1M A;  1NEN B;  4M01 A;  1R4M I;  1MFW A;  2Q5W D;  4LJP B;  4LLG M;  3ZW3 A;  3QAR A;  4IOI E;  3CIR B;  3DBL I;  1D3Z A;  2BT6 A;  1JWM D;  1SF0 A;  1A5R A;  2IY0 B;  1TZ1 A;  2NCN A;  1XEE A;  4WWM A;  4QAY A;  4RM9 A;  2JSV X;  1ZOY B;  1NI2 A;  4DK5 A;  1VLB A;  3RZF A;  3IAS 1;  5FKA C;  2NPT B;  4YTN B;  1XXG A;  3K9O B;  2L0F A;  1ENF A;  1ET9 A;  2MX2 A;  2WXI A;  1WZ3 A;  3AEC B;  3Q3M C;  3SFD B;  1U4A A;  4YWG G;  1JWA D;  2WXR A;  5HHD G;  4LNO A;  3VR8 B;  1ZXI A;  3N9Y C;  1MI0 A;  3V62 A;  2AL6 A;  2D11 A;  4XZ4 A;  2JZ3 B;  2WYQ A;  1YQ3 B;  4NNJ B;  1RWS A;  2DZM A;  3DVG Y;  4IM2 A;  1H4R A;  3P4Q B;  5JHA A;  4E74 A;  3EFC A;  5MPO A;  1TJE A;  3PHX B;  4N6E B;  2JZP A;  3NZS A;  5BYQ A;  2KMA A;  1NVI D;  3HK0 A;  2FCM A;  1P9D U;  4WWO A;  2WXP A;  4JGH B;  1VJK A;  3B08 A;  1ACC A;  1TS3 A;  2LGX A;  2G3Q B;  4OZC A;  2BB6 A;  1C1Y B;  4ZRP A;  4FLH A;  1FO4 A;  1GAQ B;  4US9 A;  3PRM B;  2JT4 B;  1RRB A;  1I4Q A;  5J2R A;  3JSV A;  2KTF A;  2KK8 A;  2ZZP B;  2PW9 A;  4XDD A;  1SIF A;  1Y8R C;  4ZOH C;  3AEE B;  4NQL B;  1V49 A;  1WXS A;  4B95 A;  3AE2 B;  1KF6 B;  3ZNZ B;  1V80 A;  3NG0 A;  1LGR A;  2BS4 B;  2MA9 B;  4M00 A;  1E8X A;  3WAO A;  3JSV B;  2MBO A;  2DHZ A;  2KT7 A;  4PS7 A;  3AMZ A;  1L6V A;  2LGD A;  3Q3J A;  4CYE A;  2BGF A;  4A55 A;  5AZG A;  1I4P A;  3DBR I;  3PZ8 A;  2WWZ A;  2AEH A;  3HRD D;  2CR5 A;  3VAW A;  4KKJ A;  2V4I B;  2KWC A;  2EMS A;  3V6E B;  1OEY J;  4WQO B;  4XE0 A;  4KKI A;  3DQV A;  3ZTD A;  4UDU C;  3VDZ A;  3VR9 B;  3CST A;  1P98 A;  2JXT A;  4L2Y A;  3HVD A;  2ZCB A;  3LYY A;  5CTR C;  1OTR B;  4IW0 A;  5TR5 A;  2LUE A;  2JU6 X;  1QT9 A;  3EEC A;  3D32 A;  5C23 A;  3U30 A;  2LMC A;  4G50 A;  1VZ8 A;  1HE8 A;  1SE9 A;  4EFO A;  1MG4 A;  1DOY A;  2JYE A;  4KDI C;  4LJO B;  2RMM A;  4XYC A;  1BUI C;  1I42 A;  4FN2 A;  3TIX A;  1L4Z B;  4C00 A;  3E9S A;  3PRP B;  4DQO C;  3QA8 A;  2JWU A;  2D3G A;  1EWC A;  3KW5 B;  2PVO D;  1AYF A;  2L7R A;  4ZHP A;  2NS5 A;  5C1Z A;  2LXC A;  3W9C B;  2EKE C;  5D3D A;  4KGS A;  1OEY A;  2YEP B;  1IYF A;  1HA5 A;  2ACZ B;  3V05 A;  3ZIM A;  2BS3 B;  1IPG A;  4WAA A;  4LNI A;  2L83 A;  2BKF A;  1XQQ A;  2FUH B;  2DEN B;  5AZF A;  5E6J A;  2KJR A;  3PHW B;  3PZD A;  3ALB A;  3VTU A;  1L4D B;  3ZNH B;  1WM2 A;  1NI3 A;  4IM0 A;  1WGR A;  3B0A A;  1WIA A;  1K52 A;  4KIK A;  3WA0 A;  1CK1 A;  3AUL A;  3ZTC A;  4AS1 A;  4MM3 A;  3AE9 B;  1E7U A;  1UUP A;  2KTR A;  1UNS A;  2K25 A;  3ZDT A;  1FD6 A;  2G4S A;  1UF0 A;  3V61 A;  1P7E A;  4RNA A;  2WGS A;  3BK2 A;  2KHW B;  1TS2 A;  1Z2M A;  2D3C A;  3RNC C;  2J0K A;  1PGB A;  2PE6 B;  4MGK E;  4O1N A;  4W9F A;  2W54 A;  1ZE3 D;  4HLE A;  1FRD A;  3ECI A;  4KIK B;  4HCP B;  1MHH E;  2L76 A;  1V1O A;  4MM3 B;  1Y56 A;  2BWF A;  3PGE A;  2GMI C;  1WX7 A;  2KTR B;  1GPX A;  2D5G A;  2BQQ A;  2KFK A;  4K81 A;  2DX5 B;  4DXG A;  4DXA B;  4NJ7 A;  3Q3N C;  1E8Y A;  3RYT A;  1MVK A;  2LGY A;  3GOE A;  2WXM A;  4RMA A;  3KUZ A;  2K5P A;  4W9K A;  1PGA A;  3H7P A;  2EEL A;  4W9J A;  4MJS A;  2YVC A;  4II2 B;  1ZDV A;  4C7Y A;  3BIN A;  2V9H A;  2NR2 A;  1E10 A;  1SE4 A;  2DZK A;  2JYT A;  3HM3 A;  3MC8 A;  5LXI B;  3QC8 B;  3R3M A;  3GE8 C;  3Q8E A;  4WJN A;  1EM7 A;  1JWB D;  1F1H A;  1V9J A;  4IDI A;  4OVU A;  4BKS D;  1XF5 L;  1EWY C;  2KFK B;  3MHS D;  1YN4 A;  1JML A;  2L52 A;  4XGA B;  3ENE A;  3VUX A;  4YTP B;  2AL3 A;  3UIP B;  1LO5 D;  3H7P B;  3Q14 C;  2MJD A;  3U4E G;  4MJS B;  4YTM B;  4XWT A;  3ZJU A;  4BOS C;  4B9K A;  1YN3 A;  1E5W A;  1C78 A;  3L4P A;  3M63 B;  5C2T B;  1KLU D;  1RFK A;  4IWQ A;  2FBW B;  1VDV A;  3AV8 A;  4TMA B;  3PRE A;  3WCQ A;  2RDB C;  1KM7 A;  4CO7 A;  3O65 B;  2IPK D;  4MEL A;  4M8M A;  4RFB A;  5IO9 A;  3EHV A;  1WR1 A;  2IDY A;  3L0W B;  2OOB B;  1QLB B;  1QIL A;  3TUO A;  2KC1 A;  2ZNV C;  1PYW D;  1UH6 A;  2J4X A;  2MHJ A;  3N30 A;  5LLI A;  4FBJ B;  1YX6 B;  2IGD A;  1SGH A;  2M1M A;  2KX3 A;  2BBC A;  4ANU A;  2LRW A;  2ZPN A;  3VH4 B;  4BOZ B;  1XLP A;  2M17 A;  2JPH A;  1UWM A;  2JVC A;  4IUM B;  4HDO A;  2K8C A;  2OJR A;  1L5P A;  3NS8 A;  3DHG C;  3KVF B;  1IUE A;  1FFU A;  2RDH A;  4ZRQ A;  2DNF A;  3RNG C;  2N7D A;  2XN9 C;  4KSL C;  1QOF A;  3LJ3 A;  5CX3 A;  5FR6 A;  2WQY B;  1SB3 C;  3IHP C;  3HHM A;  2BPS A;  1XCQ L;  5EE3 A;  3HM6 X;  2KAC A;  4K7W A;  1ISN A;  4MGY E;  1XLN A;  2IND C;  4LNN A;  1WMH A;  2KAJ A;  1NEK B;  2IZV B;  2I2Y A;  3N32 A;  3UGB B;  5D6J B;  2GLS A;  1JWS D;  3TMP B;  3PZ7 A;  3X0W A;  3ETR A;  2BW2 A;  1D5Z C;  1YNT E;  2N9K A;  1ZW7 A;  4AP4 C;  4KZC A;  3ZO5 B;  2Z8L A;  5LXH A;  3A33 B;  4F1S A;  1WMH B;  3DVN V;  5CHF A;  3R2I A;  1WXM A;  2KFJ A;  2PIA A;  1OGW A;  2UWQ A;  1LXD A;  3HVZ A;  5IAA C;  1XD3 B;  3A4S C;  3KWL A;  2FCS A;  2KOX A;  3OAW A;  4X57 B;  5GMV A;  2LVO A;  2QMT A;  1GUA B;  4FHK A;  1EU3 A;  2REX A;  4YXD B;  1WYW B;  4WJO A;  2ZW0 A;  1JW9 D;  3TCA A;  3BII D;  4B0E A;  2N7J A;  2D3B A;  1LQB A;  2LI5 A;  2K1F A;  2LGS A;  4E71 A;  1K50 A;  1UBI A;  3NUH B;  4P1C C;  1TYG B;  5HG2 A;  2MBB B;  3Q8F A;  2INN E;  1TS4 A;  3DBH B;  3LXF A;  4FXC A;  2B3A A;  2WHI A;  3A1Q A;  2C7H A;  4YSZ B;  2GBN A;  3P4P B;  3KUC B;  1BT0 A;  4YSX B;  3AE4 B;  3DVG X;  3DWM A;  3DVN U;  3B2G A;  2G9H D;  1C77 A;  1DYQ A;  2QIL A;  1X1M A;  1IBX A;  2RGF A;  5L83 A;  1GC7 A;  3WAM A;  2FIF A;  2IJ0 A;  2W3R A;  3N20 C;  4HJK A;  3FKY A;  1WE7 A;  3A1Q B;  2WDR B;  5BMG A;  1TZO A;  5DPW A;  1JRU A;  5AUI A;  2ICI A;  1ESF A;  4PYZ A;  3QK0 A;  4DHJ B;  2RDG A;  3GP7 A;  4J3O D;  2C7N B;  3JYU A;  3L17 A;  3VRB B;  1M94 A;  3U8Z A;  2M0A A;  3T8M A;  1IBX B;  4OHJ A;  1QOB A;  1SJE D;  1XT9 B;  2ZEQ A;  1UGJ A;  3C19 A;  2QHO A;  2O2V A;  1RFA A;  3VHT C;  3I3T B;  2L8J A;  4WIP A;  3MJ5 A;  1XLO A;  3L16 A;  2V3P A;  2G1E A;  3RN9 C;  4RF0 A;  1B9R A;  1UZX B;  1HTQ A;  1FXA A;  3DBS A;  5BMI A;  2Y5C A;  3R2T A;  1VZ7 A;  3QCA A;  3QJZ A;  3KWV A;  4DDI D;  3L54 A;  3NZ3 A;  2K0P A;  3PO0 A;  1ZPS A;  3B9J A;  2VH1 A;  4KSK C;  3KQ4 A;  1V5O A;  1M4V A;  2CHW A;  2O2V B;  2WDV B;  1I4H A;  1XO3 A;  3AN1 A;  2LD9 A;  1SXT A;  1CQV A;  2AQ3 B;  3Q8B A;  2DYB A;  1RYJ A;  1WJN A;  3TL5 A;  5DCN A;  1ZGU B;  2KDI A;  1YX5 B;  1KTK A;  1CZP A;  2EMT A;  2ZVN A;  1LFD A;  1QOA A;  5BO4 B;  2QIE B;  4EZL A;  1E6E B;  3Q8C A;  1FXT B;  4BVU C;  1K8R B;  1F77 A;  3S2A A;  1ZDX A;  1WGH A;  3Q69 A;  3PVL A;  1FPY A;  3UQB A;  4YT0 B;  1NYQ A;  3SFE B;  2HTM E;  2KX0 A;  2CHX A;  2Z59 B;  2XEW A;  3RNE C;  5TSS A;  3IBE A;  1C3T A;  2KZR A;  2LGI A;  4ARC A;  1J7C A;  3RCZ A;  4HPP A;  3RNB C;  3RT3 B;  1P1A A;  4USA A;  3FIL A;  1WI0 A;  1TTN A;  3BWU D;  5HI1 A;  3T3N A;  3AU5 A;  4IKG A;  2L1A A;  1WM3 A;  5HFY A;  3QQ8 B;  2JRH A;  1T0R C;  2VZK B;  1SEB D;  3R8B A;  3UQA A;  4JPS A;  3ZKJ C;  1N62 A;  1WZ0 A;  1WE6 A;  2E3T A;  1FNV A;  5E6O A;  3NVZ A;  4FHJ A;  2PEA A;  1SE2 A;  2XK5 A;  2KXJ A;  3AU4 A;  4ZRK A;  3AEB B;  3DBH I;  4R3D A;  1J0G A;  2H89 B;  3FIL B;  1N60 A;  1T0S C;  3L10 B;  4TSS A;  1E90 A;  1WXQ A;  4N9F 4;  1E0Z A;  1I7H A;  1E8Z A;  4WQM A;  3IT4 B;  3ZLZ A;  3PV1 A;  2J53 A;  1Q1O A;  3V6C B;  4NJ6 A;  2BWE S;  2B76 B;  2DWQ A;  2JWZ A;  2X8X X;  3TEW A;  2DLB A;  4P1B C;  2I38 A;  4E3C A;  1E7V A;  2WNM A;  2MBE A;  2WXJ A;  2KO3 A;  3SHQ A;  2LZ6 A;  3KYC D;  1E8W A;  5EE0 A;  4PS8 A;  1P3Q U;  2MQJ A;  3N1Z C;  3PSE B;  1UBQ A;  4IG7 B;  4W9H A;  1AW7 A;  4FJZ A;  3BYY B;  2D2Q A;  4MEM A;  4BBN C;  2N7E A;  4GLS C;  3JVZ X;  1WX9 A;  4IWO A;  1TY0 A;  2NMQ A;  2KDE B;  4DDG D;  4OW0 A;  2MRP A;  1SIJ A;  1I4G A;  4L1B A;  1OFF A;  2WXN A;  3P42 A;  3T3O A;  2QCZ A;  3ZVV A;  5D94 A;  3W5U B;  2RR9 A;  2R61 A;  3M95 A;  1Q5W B;  5J18 A;  1FM0 D;  4K3C A;  4W9L A;  2WU5 B;  1SBB B;  2UYZ B;  4PT5 A;  2BVC A;  1Q0W B;  3IFW B;  3LDZ E;  3NRZ A;  2JX5 A;  2MP2 A;  3AE7 B;  1KOT A;  2KDB A;  2KDM A;  2N1W A;  4ANV A;  1NBF C;  3NZU A;  3RD2 A; 
#chains in the Genus database with same CATH homology
 1SGH A;  2ZPY A;  2NBW B;  2M1M A;  1YD8 U;  3H1U A;  4M0W B;  4ASW C;  5AZH A;  2KX3 A;  4KDL B;  4ANU A;  2JXX A;  2LRW A;  2ZPN A;  3DDC B;  3VH4 B;  4BOZ B;  2GOW A;  3T9L A;  3IG3 A;  2BF8 B;  2GBR A;  2M17 A;  2JPH A;  2MCN B;  2JVC A;  4IUM B;  4BFR A;  3EC8 A;  4HDO A;  2ZNV B;  2K8C A;  2OJR A;  2GBK A;  1AAR A;  3PS6 A;  4HK2 A;  4JL9 A;  3NS8 A;  3QIJ A;  3KVF B;  4ZDV A;  1WGD A;  2WX0 A;  4GGQ A;  3TJP A;  4K1R B;  2KJ6 A;  2NPT A;  3W1S A;  4DHZ E;  2MP2 B;  2N7D A;  2DYO A;  4KSL C;  3PLV A;  3AI5 A;  4TUU A;  4DWF A;  3LJ3 A;  3KH0 A;  5CX3 A;  5FR6 A;  3W1S C;  2KNB A;  3IHP C;  1R4M I;  3WIM A;  3HHM A;  2RD0 A;  2BPS A;  4LJP B;  4NPN A;  3RUI B;  3ZW3 A;  2CKH B;  4ICV A;  3HM6 X;  2NBU A;  3QAR A;  4K7W A;  3DBL I;  1D3Z A;  1ISN A;  1A5R A;  4BKT A;  3PTF C;  4MGY E;  4DBG A;  3ZRC A;  5G55 A;  2IY0 B;  3M3J A;  1TZ1 A;  2NCN A;  4HVB A;  1WMH A;  2FCQ A;  2XBB C;  4TQ1 A;  2DAJ A;  4RM9 A;  2KWU B;  2PPH A;  2R2O A;  2IZV B;  3VH3 B;  3WAL A;  1NI2 A;  2HE7 A;  3N32 A;  4DK5 A;  3RZF A;  3UGB B;  2MWS B;  3CSF A;  4FJV B;  2NPT B;  5D6J B;  2CU1 A;  1P0R A;  3K9O B;  4LDT B;  2LRU A;  2L0F A;  2XK5 B;  4KV2 A;  3TMP B;  2MX2 A;  2KAN A;  2IO1 B;  4HPL B;  4W9C A;  4EKU A;  3X0W A;  1WZ3 A;  2L3Z A;  4W9G A;  1U4A A;  4PS3 A;  4GSW A;  5D2M B;  1ZW7 A;  5JH5 C;  4AP4 C;  4KZC A;  3ZO5 B;  3CF6 E;  3V62 A;  1EO6 A;  2AL6 A;  2JUO A;  3ZNI D;  2D11 A;  5LXH A;  3A33 B;  4F1S A;  4W9D A;  4XZ4 A;  1WMH B;  2JZ3 B;  3DVN V;  2WYQ A;  5CHF A;  4NNJ B;  2RSU A;  2JY6 A;  4I6N B;  1WXM A;  3ZRF A;  2DZM A;  2KFJ A;  3DVG Y;  4ZRI A;  1OGW A;  4IM2 A;  1ZKH A;  1LXD A;  2UWQ A;  4XC2 A;  1XD3 B;  1MG8 A;  2DYM A;  1H4R A;  5IAA C;  2WDT B;  5JHA A;  3A4S C;  1YJ1 A;  2FCS A;  2KOX A;  3OAW A;  4E74 A;  1NDD A;  4X57 B;  5GMV A;  2FCN A;  3APD A;  2LVO A;  2IO2 B;  1UEL A;  1G6J A;  1S1Q B;  1GG3 A;  2RPQ A;  1GUA B;  1I35 A;  4FHK A;  2KD0 A;  2MSE D;  3X23 A;  3PHX B;  2L00 B;  2REX A;  2K6D B;  3NZS A;  2KMA A;  4G3X B;  1QZE A;  1WYW B;  2Z0D B;  3HK0 A;  4WJO A;  4GMV A;  3DPD A;  2CHZ A;  3TCA A;  2KVR A;  2FCM A;  1P9D U;  4WWO A;  4LDT D;  3APF A;  4FAD A;  1WF9 A;  5D7G A;  4B6W A;  1L2N A;  4JGH B;  2LAS A;  1LQB A;  3B08 A;  2LI5 A;  2K1F A;  5L95 C;  4E71 A;  2KN5 A;  1WGY A;  1UBI A;  2LGX A;  2G3Q B;  3QAQ A;  1C1Y B;  3APC A;  1V86 A;  4MSM B;  2ZJD A;  4FLH A;  2NVU I;  3PRM B;  2LXA A;  5CHW A;  2MBB B;  4GXB A;  4EOY A;  2JT4 B;  3VQI A;  1PQS A;  3AXC A;  1RRB A;  5J2R A;  3JSV A;  2B3A A;  3SU8 X;  2KTF A;  2KK8 A;  3A1Q A;  2ZZP B;  2C7H A;  4BKG A;  1H8C A;  2V4L A;  4A20 A;  1SIF A;  1Y8R C;  4AJW A;  4EZJ A;  2GBN A;  4DHZ B;  3R7Q A;  3KUC B;  1BT0 A;  2V1Y A;  2BYV E;  2JZZ A;  4ANX A;  3DVG X;  2C9W B;  4IC7 B;  4NQL B;  1V49 A;  2K6Q A;  1WXS A;  4B95 A;  2KDF B;  4JLC A;  1J19 A;  2JRI B;  3A4R A;  3DVN U;  2IYD B;  1WH3 A;  4KVG B;  3ZNZ B;  1V80 A;  2KMC A;  2IO3 B;  2LVQ A;  4G11 A;  4BKS A;  3OJ3 A;  4W9E A;  1GNU A;  4HCN B;  1X1M A;  2MA9 B;  1YQB A;  2RGF A;  5L83 A;  1GC7 A;  3WAM A;  2FIF A;  1E8X A;  1R4N I;  3WAO A;  2DZI A;  1TBE A;  4WJQ A;  3JSV B;  2J0M A;  4HJK A;  2MBO A;  1WE7 A;  3A1Q B;  2DHZ A;  4PS7 A;  2HTH A;  1V2Y A;  3KYD D;  2LGD A;  3Q3J A;  4CYE A;  3PRZ A;  2MBQ A;  2BGF A;  4IWP A;  2KLC A;  4NY0 A;  5AZG A;  5DPW A;  3Q3F A;  3UF8 A;  2GBM A;  1JRU A;  2VRR B;  3DBR I;  4ICU A;  4CHK A;  2M8S A;  2WWZ A;  4G0N B;  4I6P A;  2AEH A;  4K7U A;  3QK0 A;  4PYZ A;  2CR5 A;  3VAW A;  4DHJ B;  2DZJ A;  4AJY B;  2KWC A;  2EMS A;  2C7N B;  3JYU A;  2Z0E B;  3L17 A;  3V6E B;  3DCG A;  1M94 A;  1OEY J;  4FUL A;  4GDK A;  3U8Z A;  3ML9 A;  4JIO U;  4WQO B;  3T8M A;  2A4Z A;  2G45 B;  3DQV A;  1XT9 B;  3ZTD A;  3VDZ A;  2N9E B;  2K8B A;  2ZEQ A;  5IA7 A;  2AWT A;  4GB9 A;  3CMM B;  3CST A;  1P98 A;  3SD5 A;  2L05 A;  2QHO A;  2ZCB A;  2O2V A;  1RFA A;  3VHT C;  1WJU A;  5CTR C;  3I3T B;  4FA6 A;  2L8J A;  3R7R A;  3ZNG C;  3L16 A;  1OTR B;  4II3 B;  3R66 C;  4HXD A;  4IW0 A;  4ZYN A;  5TR5 A;  3A9K A;  2LUE A;  1UZX B;  5DPT A;  4GIV A;  2DAF A;  3DBS A;  3EEC A;  3RUL A;  3D32 A;  2PE9 A;  3RD2 A;  5C23 A;  4EUT A;  3U30 A;  4G50 A;  1HE8 A;  4GDK B;  3UIO B;  1SE9 A;  2I1J A;  4EFO A;  3QCA A;  2J7Q B;  2KLG A;  3QJZ A;  4KDI C;  1V6E A;  2KQ7 A;  4DDI D;  2N9P C;  4LJO B;  3L54 A;  5JHB A;  4F8C B;  3OJ4 B;  4KSK C;  1V5O A;  1TGZ B;  2N1V A;  4M8N A;  2CHW A;  4FN2 A;  1I42 A;  3TIX A;  3SDL C;  3NY5 A;  4A3O A;  2O2V B;  3PRP B;  3TBL D;  5EDS A;  4EZK A;  3QA8 A;  1UD7 A;  2GBJ A;  2D3G A;  3KW5 B;  3VVW B;  2M4N A;  2LD9 A;  1VD2 A;  4NQK E;  1WGG A;  4WWP A;  3A9K B;  2L7R A;  2NS5 A;  1WJ4 A;  5C1Z A;  4IM3 A;  4LCD E;  2LXC A;  2DYB A;  1L7Y A;  4GOC A;  4RM8 A;  1WJN A;  3TL5 A;  3QWZ B;  5DCN A;  2LVP A;  1ZGU B;  3V60 A;  2EKE C;  2KDI A;  1YX5 B;  1OEY A;  1EF5 A;  2EMT A;  5G2N A;  2K39 A;  2KKC A;  2BKR B;  2ZVN A;  1LFD A;  1IYF A;  1WFY A;  4NAW A;  5BO4 B;  2MLB A;  3ZIM A;  1IPG A;  2N9X A;  4WAA A;  2Y5B B;  4EZL A;  3EFU A;  3BY4 B;  3PPA A;  2KC2 A;  5E6P A;  2BKF A;  1XQQ A;  2FUH B;  1FXT B;  2DEN B;  5AZF A;  2HD5 B;  3VTV A;  4BVU C;  2KJR A;  3PLU A;  1K8R B;  4YL8 A;  3VXW A;  2FAZ A;  1WXA A;  3PHW B;  4HWI B;  3S2A A;  4AUQ C;  3PZD A;  4W9I A;  1WGH A;  3ALB A;  2O6V A;  3VTU A;  3ZNH B;  4URK A;  3PVL A;  3QHT A;  1J8C A;  3HIZ A;  3UQB A;  5E6N A;  1WM2 A;  2KX0 A;  2CHX A;  4IM0 A;  1WGR A;  2Z59 B;  3B0A A;  2V3S A;  2XEW A;  1WIA A;  1KJT A;  3H7S A;  2WX1 A;  4TV3 A;  4KIK A;  3WA0 A;  5AEK B;  2CS4 A;  3IBE A;  4NAW B;  3AUL A;  2KZR A;  3ZTC A;  1C3T A;  2FNJ B;  2C60 A;  4K7S A;  3RCZ A;  3ZDM C;  4HDQ A;  3RZW C;  4MM3 A;  3VUW A;  3RT3 B;  1P1A A;  2YLM A;  1WI0 A;  1TTN A;  2ZVO A;  2KTR A;  1E7U A;  3U7D A;  1CMX B;  2K25 A;  1WR6 E;  3ZDT A;  2R2Q A;  3AU5 A;  2G4S A;  1GC6 A;  1WM3 A;  3V61 A;  3QQ8 B;  4GN1 A;  2JRH A;  2KHW B;  1WY8 A;  1Z2M A;  2J0K A;  2O6V B;  2C5L C;  2K8H A;  3UQA A;  2IO0 B;  3ZKJ C;  4A3P A;  2PE6 B;  4MGK E;  1V81 A;  1WZ0 A;  4W9F A;  1IP9 A;  3WAN A;  1WE6 A;  3KUD B;  2KQS A;  4HLE A;  5E6O A;  2IY1 B;  3ECI A;  4KIK B;  1RLF A;  2MBH A;  4FHJ A;  2PEA A;  4HCP B;  2ZCC A;  2LWP A;  4XX5 A;  2XK5 A;  2KXJ A;  3K9P B;  1F9J A;  3AU4 A;  2L76 A;  4ZRK A;  1T0Y A;  1WXV A;  4KZ0 A;  1WX8 A;  1UGM A;  2BWF A;  2JF5 A;  3DBH I;  3PGE A;  1J0G A;  4MGI E;  2N4F A;  2GMI C;  3A9J A;  1WX7 A;  2KTR B;  3L10 B;  3VUY A;  1E90 A;  2J0J A;  4N9F 4;  2KFK A;  4K81 A;  2DX5 B;  5J17 A;  3VFK A;  3B1L X;  4DXA B;  1E8Z A;  4NJ7 A;  4TQ0 A;  2W9N A;  1E8Y A;  3IVF A;  3RYT A;  1V5T A;  2LGY A;  2NBV B;  3PV1 A;  3W1Y A;  3ZLZ A;  3GOE A;  1Q1O A;  3V6C B;  5KHQ A;  3DOW A;  2KJH B;  2BWE S;  4NJ6 A;  4RMA A;  2FID A;  2JWZ A;  1EUV B;  2BYE A;  3KUZ A;  3N3K B;  4W9K A;  2D10 A;  3P2B A;  3H7P A;  4W9J A;  4MGZ E;  4WWN A;  3M62 B;  4MJS A;  2BYF A;  2YVC A;  4II2 B;  4E3C A;  4GDL A;  3BIN A;  3MJW A;  1E7V A;  2G4D B;  2NR2 A;  2O6V D;  2DZK A;  3HM3 A;  4AWJ A;  2A5U A;  5LXI B;  2MBE A;  3ONS A;  1YIW A;  3QC8 B;  2KO3 A;  3QX1 A;  3R3M A;  3SHQ A;  4DHJ D;  3C0R B;  4WJN A;  1V9J A;  3PT2 B;  4BKS D;  3A9J B;  1WJ6 A;  2LZ6 A;  4OVU A;  3KYC D;  3GZN I;  1E8W A;  4PS8 A;  2M0X A;  1P3Q U;  2I1K A;  2KFK B;  2IBI B;  2MQJ A;  1S3S G;  3MHS D;  3WAP A;  4WJP A;  3PSE B;  1RAX A;  4TKN A;  1UBQ A;  4IG7 B;  3ENE A;  4W9H A;  3VUX A;  4F7Z A;  3MTN B;  4FJZ A;  1VCB A;  4MDK E;  2D2Q A;  2L0T A;  4MEM A;  2AL3 A;  4BBN C;  2N7E A;  3UIP B;  3JVZ X;  4I6L B;  1WX9 A;  3H7P B;  4IWO A;  5DPS A;  4MJS B;  4EEW A;  4BOS C;  4B9K A;  3OLM D;  4GDL B;  2KDE B;  4DDG D;  1E5W A;  2MRP A;  5KHO A;  3M63 B;  4MH0 E;  5JZE B;  4JQW C;  4IWQ A;  3ML8 A;  4MSQ B;  3ZUN A;  4ZRJ A;  2LJ5 A;  3ZVV A;  1EF1 A;  5D94 A;  3PRE A;  3NOB A;  4FJY A;  1KLV A;  2RR9 A;  2D07 B;  3L13 A;  3NHE B;  1KM7 A;  3M95 A;  1Q5W B;  4CO7 A;  5J18 A;  5DPR A;  2ASQ A;  3O65 B;  1Z5S B;  4PYU A;  4W9L A;  1OQY A;  4MEL A;  4M8M A;  2PJH A;  1LM8 B;  3EHV A;  3VTW A;  1WR1 A;  4OVV A;  2HJ8 A;  2UYZ B;  4P7I A;  2MW5 A;  4AOF A;  2C7M B;  3L0W B;  3H6N A;  2OOB B;  1Q0W B;  3L08 A;  3IFW B;  4GU2 A;  2KWV B;  3UIN B;  1GJZ A;  2AYO B;  3LDZ E;  2KC1 A;  2ZNV C;  4ANW A;  3H9D A;  4BBN F;  1UH6 A;  5CHV C;  5HKH A;  2MP2 A;  1KOT A;  2KDB A;  4HPM B;  3JW0 X;  1WRD B;  2N1W A;  4ANV A;  3N30 A;  5LLI A;  1NBF C;  3NZU A;  4FBJ B;  1YX6 B;  4J6I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...