1WWTA

Solution structure of the tgs domain from human threonyl-trna synthetase
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
88
structure length
88
Chain Sequence
GSSGSSGDSKPIKVTLPDGKQVDAESWKTTPYQIACGISQGLADNTVIAKVNNVVWDLDRPLEEDCTLELLKFEDEEAQAVYSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Threonyl-tRNA synthetase, cytoplasmic
publication title Solution structure of the TGS domain from human threonyl-tRNA synthetase
rcsb
source organism Homo sapiens
total genus 11
structure length 88
sequence length 88
ec nomenclature ec 6.1.1.3: Threonine--tRNA ligase.
pdb deposition date 2005-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02824 TGS TGS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1wwtA01
3P4PB 3SFEB 1JALA 3FC4A 3SFDB 4A9AA 3VRBB 4IDIA 1ZXIA 3ABVB 3BIID 5G5HA 2K5PA 2Y5CA 5AUKA 2L52A 5H92C 1V8CA 2MH7A 4FXCA 4WQMA 1NVID 1TKGA 4YTMB 1TJEA 4N58A 3P4SB 1FXAA 3HUIA 3AV8A 3AE6B 4US9A 3WCQA 2KMMA 1WWTA 4ZHPA 1WYGA 1ROEA 1QOBA 3AE7B 1L6VA 1N60A 1SF0A 3B9JA 1XLQA 3B2FA 3CIRB 4WWMA 1TYGB 1SIJA 1WRIA 1R7SA 1TKYA 3P1MA 3RPFC 3VRAB 2L83A 3VR8B 1PDXA 1T3QA 4YTPB 1KRHA 3AE8B 3W5VB 1QOFA 3ETRA 5C2TB 1RWSA 2ACZB 3AE9B 1E6EB 3AM9A 1A70A 1CZPA 1FMAD 2DWQA 3AE2B 3AEFB 1GPXA 2WDQB 4C7YA 3NVZA 1RM6C 3NVWA 1J7CA 4HROA 1DGJA 4ZOHC 1V97A 1N62A 1RYJA 3AE1B 1QOAA 1XO3A 1YJJA 2DBYA 3HVZA 3L4PA 1XLOA 2N0SB 1FFUA 2H89B 5EE1A 1L0VB 1VJKA 3B2GA 4YSXB 3NS1A 2BS4B 3PO0A 2JQRB 2OHFA 1NENB 1FRDA 2WDVB 5EE3A 2KAJA 1AYFA 3AEBB 3AB5A 5C3JB 2G1EA 1VDVA 3AE5B 2WS3B 2K9XA 1FIQA 3FAHA 5EE9A 1N63A 2WU5B 3P63A 1FO4A 2MJ3A 1L5PA 3AEDB 2CJNA 3AEEB 4N6EB 1F0ZA 5EE0A 3DWGC 4US8A 3NRZA 4YT0B 4C80A 5GXGB 1ZOYB 1XLPA 1DOYA 4JWSC 3VR9B 1N61A 1NI3A 2W3RA 1B9RA 1UWMA 2QIEB 2WQYB 4USAA 1QF6A 5AUIA 1CJEA 2E3TA 1DOIA 4HRSA 1OQQA 1OQRA 3DWMA 1E9MA 4ZHOA 2K22A 1NYQA 3AEGB 3NVYA 1N5XA 1JWAD 2Q5WD 1KF6B 4ITKA 1SB3C 3AECB 1FFVA 1PFDA 1N5WA 2CU3A 1DOXA 2W3SA 2CJOA 1WGKA 2PVGC 2WP9B 4P6VF 2PVOD 2BT6A 4JWUC 2QJLA 4N59A 3AMZA 1RFKA 1JWBD 2MJDA 3LXFA 2PKOA 2BS3B 2HTME 1EWYC 2WDRB 4KX6B 5H8YE 1E10A 1AWDA 2PIAA 5MPOA 2H88B 1YQ3B 2LEKA 4YSYB 1PUTA 3P4QB 3LB8C 1NYRA 4JX1C 1QT9A 3AE3B 2MJEA 3ZYYX 2WU2B 3P4RB 3HRDD 3EUB2 1L6UA 1NEKB 3KWLA 2M19A 4C7ZA 2M56B 1E0ZA 1YQ4B 1YJIA 1FM0D 1TKEA 2B76B 2EKIA 1E7PB 2WLBA 3W5UB 1FXIA 2W54A 1OFFA 1ZUD2 3SR6A 1JROA 1QOGA 1I7HA 2W55A 2BS2B 4YSZB 1FRRA 1GAQB 1WXQA 2FBWB 1ZP0B 1QLBB 3AE4B 3AEAB 4YTNB 1IUEA 5G5GA 1JQ4A 3AN1A 2AX5A 1J7AA 1JRPA 3NVVA 1KFYB 3AH7A 3CWIA 1J7BA 4YXDB 1VLBA 2JX5A 3W9CB 1JW9D 1XLNA 4LTUA
chains in the Genus database with same CATH superfamily
4IWQA 1S1QB 5BMGA 3J9CA 2L8JA 5G5HA 4CQNA 1KH0A 2DNFA 1XT9B 2LUEA 5E6PA 1F2RC 1QOBA 4R3DA 1P1AA 1N60A 4E71A 2WHIA 1PGXA 2LHEA 3V6EB 4YTPB 4I6PA 3Q8FA 2Z59B 4URKA 3AE9B 2M0XA 3AM9A 1CZPA 1GPXA 2ZNVB 4KSKC 1V80A 1ZGUB 1VZ8A 1T5XD 2MP2A 2CHZA 2RDGA 2K8BA 2XK5B 3VUXA 2KDMA 3BVMA 3A9KB 3ZKJC 1WM3A 3DHIC 1YQBA 2ZVNA 4M0WA 1I42A 4L23A 4C80A 4AJWA 3U7ZA 3DBHB 3EFUA 4JWSC 1WI0A 2QCZA 2KJRA 1T0YA 1CJEA 4I6LB 2MBBB 3ZVVA 1GNUA 3IFWB 1JWAD 4XX5A 2ZW0A 3TCAA 2O6VB 3VXWA 4II3B 4KX6B 5H8YE 4DK5A 5MPOA 3P4QB 4BKTA 1YX5B 3KUCB 2IYDB 3DBHI 5JZEB 2QHOA 5BYSA 2MBEA 2M56B 2DHZA 4HPLB 1UGMA 1R4NB 3BY4B 4DDGD 4IM2A 2W55A 1C9FA 1X1MA 2Z0EB 3AEAB 4GLSC 3NUHB 5AZFA 3BYYB 3PVLA 1V2YA 3URYA 4XYCA 3P4PB 3WAPA 3QX1A 3NY5A 2SAKA 5D7GA 1SJHD 3T8MA 4ANVA 3IXSA 1IGCA 1FXAA 3FILB 4A3PA 1XLQA 3B2FA 2CHWA 2IO0B 4IC7B 4REZA 2D10A 2LJ5A 3DHGC 3MJWA 1E6EB 2DWQA 2ZW1A 3M62B 4FA6A 2WDQB 4HROA 1QOAA 2FUG1 4MGKE 1V86A 4P1CC 1WE6A 1EU3A 3PHXB 2JRHA 2K9XA 4KZ0A 3UINB 2D3GA 2WXRA 2W9NA 1E8ZA 4PK1A 1NI2A 1F1HA 1CK1A 3IAM1 2WXMA 4KV2A 3GB1A 4W9LA 2JXTA 2WNMA 2WXLA 1I4HA 4YSYB 4CO7A 4RGOS 3MC9A 2M19A 4C7ZA 4NAWA 3OJ3A 5IO9A 2LGSA 3I57A 3RNEC 3U7DA 1ZP0B 4DBGA 3C19A 2AX5A 1WM2A 3W9CB 3APFA 4LJOB 2MLBA 4GU2A 1JALA 3FC4A 4E74A 5L83A 3OJ4B 2V0GA 3L0WB 1SJED 1DYQA 4GDLB 2OEDA 2AQ2B 1L0XB 3UQBA 3FKYA 2INNE 2BB5A 2INCC 3AE7B 2BF8B 2KX0A 3Q8AA 2A5UA 1PDXA 2DYBA 2RPQA 5C2TB 5BO4B 1FMAD 3V05A 2XN9C 4XE0A 3E56A 3AULA 3ZTDA 2D2QA 2GBRA 3DQVA 4W9JA 1VJKA 2NPTA 4YSXB 2JQRB 3OG5A 1TS2A 1ACCA 2LMCA 2LHDA 2SEBD 3V3XA 2K39A 3DBRI 4B6WA 4EFOA 2ZCBA 4MEMA 4PYUA 2LVPA 3VR9B 1N61A 1NI3A 3A9KA 1GC7A 3R7RA 3Q3JA 4BKGA 4TKNA 2NBVB 1ZXHA 2CKHB 2D11A 1L7YA 2WP9B 3WANA 4QAYA 1JRUA 3WA0A 4LNIA 2O2VB 4RF1A 2JU6X 3N1ZC 2JPHA 3HVDA 1EWYC 1MPEA 2C7HA 3ZNZB 3R2TA 2J52A 4RGTA 1NYRA 1QT9A 1WX7A 2O6VA 4ZYSA 5D2MB 3B0AA 3W1SC 3Q14C 5KHOA 4OZBA 4B0MA 4HEA1 2DX5B 3Q3MC 1ZUD2 3ZO5B 2JT4B 1AW7A 2WXOA 2BW2A 1C78A 2KANA 2G4SA 1VZ7A 3U52E 2OJRA 3ZIMA 2NS5A 2HJ8A 2XNAC 4KGSA 3HUIA 4DHJB 1WGRA 4WWNA 4FHKA 4KKJA 3JYUA 1KRHA 4AQ7A 2J0KA 1GB1A 4TMAB 1T0QC 2BWES 4K7WA 3UI3A 3PHWB 3TIXA 2IY1B 3ZGZA 2G3QB 2KFKB 5EE3A 2K8HA 4KZCA 4WAFA 1AYFA 4KKIA 5KHQA 1XCQL 2KDFB 3P63A 4MJSB 2KLGA 3AEDB 2VH1A 2KWCA 3BINA 4WJOA 2WX1A 4JGHB 4G3XB 2WQYB 4USAA 2KT7A 4HRSA 4HPMB 2ASQA 3QHTA 3MP9A 5IOIA 1C4CA 3RFZB 1BUIC 4XC2A 4JL9A 2FE8A 4O1NA 2QJLA 3QA8A 1V6EA 2J0JA 3LYYA 4DHJD 2BS3B 2HTME 3M95A 1E10A 2KYWA 4MH8A 3TUOA 2V3SA 4HKZE 4N9F4 3DOWA 3EFCA 3H7PA 2EKIA 2GBNA 3W5UB 1F52A 3T3OA 4ICUA 1JRPA 5DPSA 2LFIA 2EMTA 3CWIA 2JX5A 2L3ZA 4W9GA 3CMMB 1FNWA 1IGDA 3O13A 3JSVB 1ZXIA 2KVRA 2LGDA 1D5XC 3Q3NC 3RD2A 1BT0A 5FK9C 3U2SC 4LNNA 1TJEA 3TEZA 1V49A 5FKAC 3Q3OC 4CYEA 3B9JA 2AYOB 4GDLA 4W9FA 5JHBA 1Q5WB 3RUIB 1D5ZC 3NZUA 4DXAB 4W9IA 2V4LA 2PPHA 1E8YA 1N62A 3AE1B 4HJGE 2H89B 1N6ZA 3X23A 2UWQA 2L0FA 5CHFA 4FHJA 1MI0A 2Y5PA 3NZ3A 4F7ZA 1I4PA 4IM3A 3UQAA 1UD7A 1UUPA 1FIQA 4A6QA 3QWZB 2RSUA 2K1FA 3AXCA 4K3BA 4XDCA 2BBCA 1DOYA 2W3RA 2QIEB 4BOZB 2N7EA 2R2QA 1AARA 1WX9A 2Q5WD 5HFYA 4YWGG 3V61A 2CU3A 2DYOA 4HXDA 2NTSA 2L7RA 3NHEB 2KLCA 2IZVB 1SE2A 4W9HA 2PIAA 4XWTA 2LEKA 1QQRA 1YD8U 4A8XC 1TS3A 4OW0A 1HTQA 2LGYA 2L1AA 4GSWA 1KJTA 3RI7C 1L4ZB 2B3AA 2KTFA 2LGXA 1GOZA 3SR6A 1D4BA 1SE4A 4YTNB 1IUEA 1OEYA 2QMTA 2D3CA 1J7AA 2OJWA 4ANUA 2QC8A 3ENEA 3N3KB 1B1ZA 3PSEB 2KQ4X 2K8CA 1YX6B 2ON8A 2WX0A 1XLNA 1WXAA 4BZAA 4YL8A 4IDIA 1WH3A 3ABVB 2MBQA 5L95C 3RYTA 4NPNA 3QCAA 1WWTA 3NOBA 2MCNB 1E7UA 1LM8B 4DHZE 4P1BC 1JWSD 2KTRB 2UYZB 4J6IA 1J7CA 3ZNHB 4ZOHC 1WGDA 2M17A 5IKCM 2MBOA 4NJCA 3IT4B 3IBEA 1UF0A 1IBXB 3NS1A 2MBHA 2KOXA 3PREA 3AEBB 1VDVA 2MEKA 2PMVA 4N6EB 4A90A 2BVCA 2KFKA 3R66C 1I4GA 4BBNC 4BOSC 5J2RA 2KZRA 2Y5BB 4HWIB 4MJSA 4FLHA 1T0RC 2KQSA 2KN5A 3OAWA 1OGWA 1GB4A 1IPGA 3ECIA 1WFYA 5E6JA 3A9JA 2CJOA 4S0RA 4PS7A 1VRAB 5D3DA 3N1YC 5HI1A 4H2AA 1FNVA 4NNJB 5TR5A 3HIZA 2GRIA 4LNOA 3ZTCA 4BKSD 4G50A 4HDQA 1L4DB 1KOTA 1SGHA 1HA5A 1K8RB 3EGRA 1JROA 1I7HA 1QLBB 3AE4B 2AL6A 2WDTB 2LUMA 4JPSA 1VZ6A 1J19A 1F2RI 2CU1A 2W82A 3SFDB 5FR6A 3V62A 2BB6A 3KYCD 2L52A 3MFGA 4HPPA 1E7VA 3RCZA 1UELA 4TV3A 1XEEA 3WCQA 2N7DA 3JSVA 1L6VA 5FR3A 4F8CB 3P1MA 1TYGB 1WRIA 1R7SA 2NVUI 3TJPA 1HZ6A 2NTTA 3DBLB 3VR8B 1MJDA 3ML9A 4ZDVA 2V3PA 3R3MA 5DPTA 5I4DA 4LCDE 1V97A 1RYJA 3L4PA 2DBYA 1XO3A 4RF0A 1RAXA 3B2GA 3ZRCA 1ESFA 1BMLC 2IGGA 2OOBB 1Y56A 1WX8A 4FULA 1SBBB 4EEWA 2WYQA 4ZRQA 1LFDA 2GB1A 2KJ6A 2AL3A 1YIWA 3DBLI 3EA6A 2ZPNA 1PGBA 3WAOA 3R8BA 5BMIA 3DVNV 4WH4A 2WGSA 2K22A 3NVYA 4M00A 2LXCA 3RZWC 5TSSA 2JY6A 1SB3C 3P2BA 2MA9B 1WGKA 3OLMD 2NBWB 4C56C 3SHQA 4WIPA 2J42A 1WGHA 2NR2A 1J8CA 4NJ7A 3MHZA 1L2NA 2MJEA 4MSMB 3EECA 1ISNA 5AZHA 1WZ0A 3VQIA 3KQ4A 3OWEB 4B95A 3QK0A 3PZDA 4XZ4A 1RFAA 1WZ3A 1E90A 1CMXB 3H8HA 2N7JA 3EHVA 1J7BA 1LGRA 2KWVB 4RGMA 4P7IA 3RT3B 4PT5A 3BK2A 3BZDB 2Y5CA 3CSTA 5AUKA 3GP7A 4N58A 4JQWC 4W9CA 5G55A 3IAS1 1GC6A 2K3UA 4D2KA 3PGEA 2JUOA 4KIKA 1WF9A 3RN9C 5LXHA 3APCA 3TEYA 2BS4B 1TS4A 4EE2A 1V5TA 2G9HD 2ZVOA 1V81A 2PTLA 2WS3B 2YEPF 1PYWD 1FO4A 1L5PA 3DBRB 4MACA 4HVBA 5T8IA 2YLMA 1C1YB 5D6JB 2BYTA 3NRZA 4NZLB 5AEKB 3IVFA 1UZXB 4OVZA 3AU5A 1UBQA 4AUQC 1HE8A 4MELA 3RZFA 1SE9A 3PLVA 1STEA 4M8MA 5D3IB 3SU8X 2XK5A 1V1PB 2KFJA 2N9XA 3O65B 4K7SA 3TEWA 1E0ZA 1ZW7A 2B76B 1E7PB 1EO6A 1PGAA 2DZJA 4S17A 4GB9A 4OZCA 1QOGA 4YSZB 2FBWB 2IJ0A 2L76A 5GMVA 1HEZE 2KX3A 3TMPB 2LI5A 2QDFA 3AI5A 3C0RB 2D07B 2MH7A 1TKGA 3P4SB 1SXTA 4DXGA 2KMCA 2N4FA 2V4IB 4FJZA 3VRAB 2MHJA 1S3SG 2HJ1A 4WURA 4FBJB 3DVNU 3NVZA 2C7NB 2RGFA 3L13A 4KGRA 1FFUA 3DVGY 2KC2A 4HK2A 2JZZA 4EUTA 3KUDB 2FAZA 4E3CA 2GBKA 2KO3A 2CJNA 2LVOA 2DAFA 3E9SA 3ONSA 3VTUA 1GUAB 3V6CB 4ANXA 4RM8A 3FILA 3VFKA 1E5WA 2BPSA 3QIJA 5AUIA 2GOWA 2E3TA 1WE7A 1FXTB 1M4VA 5J18A 2GLSA 1KF6B 1FFVA 2EMSA 3ML8A 2W3SA 3SDLC 1M94A 4HDOA 1C4PA 1LO5D 3TEXA 1RFKA 3UF8A 2C7MB 2IO1B 1OEYJ 3CF6E 2EKEC 3LB8C 4MT5A 4DXFA 1L6UA 2DZKA 1EM7A 4LDTD 3WALA 4HJKA 1BXTA 1SSNA 1FRRA 3NJTA 1TT5B 1YNTE 4OZAA 4DQOC 1JQ4A 2DLBA 1T0SC 2FUHB 4ZRIA 1KFYB 4K3CA 2C9WB 1LXDA 5CTRC 2JRIB 1JWUD 4M01A 2ZJDA 2K25A 4BVUC 3VRBB 4M0WB 1Q1OA 4GN1A 2MW5A 4LNKA 1KLVA 4RNAA 2QSDA 4GGQA 1V1OA 4RM9A 1FCLA 1SIJA 4TSSA 2DZIA 1JWMD 4IG7B 3QC8B 3TBLD 1QOFA 2WXPA 1XCTL 3GS2A 5JHAA 2ZCCA 4AJYB 2K6DB 2JYTA 4P16A 1UWXA 3AE5B 2JYEA 5G2NA 1N63A 2DYMA 4AS1A 1ZDXA 1MG8A 3S2AA 1WR6E 3A33B 5IP4D 1XQQA 4IWOA 4GIVA 1B9RA 3Q8EA 4RCOA 3AU4A 1EF1A 3HHMA 3K9PB 1E8WA 1P7EA 1N5WA 3R2IA 3RMKC 2BT6A 1WRDB 1D5MC 3LXFA 3W1YA 3ALBA 1K51A 1C76A 1AWDA 3WAMA 2KK8A 1D6EC 2JWUA 3ZDTA 3HRDD 2NMQA 1VCBA 1L0YB 3KWLA 2C60A 2YVCA 4NAMA 1FM0D 5LLIA 3NG0A 2BKRB 1G6JA 1ZE3D 3Q69A 2KVZA 3AN1A 2LXAA 1SE3A 3B08A 1E8XA 3NVVA 2QILA 4K1RB 4KDIC 1H8CA 4YXDB 2KKCA 4ARCA 4A9AA 4ZRKA 2G45B 2O2VA 2K5PA 4WQMA 4ZYNA 2RMMA 3H9DA 3AE6B 4C00A 2KMMA 2I38A 1ROEA 5CX3A 4KGTA 3CIRB 4WWMA 1TKYA 2JVCA 1I4XA 4IKGA 1TY0A 2BGFA 1VD2A 3MJ5A 4DWFA 4IWPA 1XLOA 2I1JA 2N0SB 2WXIA 4JIOU 3I5JC 4PS8A 3H1UA 1FRDA 4TUUA 2Z8LA 1P0RA 3KUZA 2K6QA 3CSFA 4RFBA 1XXGA 3GZNI 2INDC 3AEEB 4NAWB 4NY0A 2INPE 5GXGB 2ZEQA 1XLPA 2L00B 3UGBB 5CHWA 3GOEA 1RRBA 3VH4B 4C4VB 1UWMA 4K81A 2KWDA 2WXNA 4BAXA 1NYQA 4AOFA 2XEWA 1WJUA 2WXGA 3AECB 4ASWC 3BK1A 2WXFA 2ZNVC 4ACFA 1ZPSA 4M8NA 2WDRB 4Q2JA 1P9DU 4JX1C 4LNFA 1QZEA 1XD3B 2KNBA 4EZKA 1PQSA 3DPDA 3W2DA 1EUVB 3Q3FA 1TGZB 1WXSA 2WLBA 1FXIA 4IUMB 4W9DA 1OFFA 3VUWA 3PLUA 3IG3A 1UGJA 1R4MB 2X38A 4W9KA 1UBIA 3N1XC 2NPTB 2FCMA 1F9JA 5HKHA 2BWFA 4LK0M 1J0GA 1FCCC 1Z2MA 3SFEB 3L10B 2BYFA 1FEHA 2D3BA 2E6XA 3BIID 5E6OA 2DENB 3KWVA 5D94A 3M63B 4YTMB 2IPKD 1TZOA 4TQ1A 2KC1A 1SF0A 1WMHB 3RULA 5CHVC 3LJ3A 3ZRFA 3AE8B 2AEHA 1R4MI 3W5VB 4FJVB 4WJNA 1KTKA 3AEFB 3MC8A 3N32A 3RNBC 5IAAC 4GDKB 1CQVA 2JXXA 1T6BX 2M0AA 2PLPA 4ZRJA 5EE1A 1YJJA 2N1WA 1JMLA 4HKQA 1L0VB 3PO0A 3DBSA 1NENB 2RDBC 2HE7A 2MSED 4FADA 2CHXA 2WU5B 5DPWA 2R2OA 2JF5A 5BMHA 4US8A 2LRWA 3N30A 1WSPA 1XF5L 3LDZE 3PS6A 3IT6B 2X8XX 3L08A 1H4RA 3DWMA 4MH0E 3AEGB 3TSSA 1VR9A 3M3JA 4JLCA 1YMHE 2PEAA 4PS3A 2HD5B 4F1SA 3I63C 4TQ0A 3ZXRA 1I4QA 3EC8A 1NEKB 1IYFA 1Z5SB 2D3AA 1V5OA 2LJIA 4UDUC 2LZ6A 3B1LX 1WXVA 3U30A 1R4NI 1WXQA 3PPAA 1Q10A 2C5LC 2L32A 1C77A 1Y8RC 2RR9A 3L16A 2BTEA 2IGDA 4GOCA 1YOVB 4EKUA 1SEBD 2O6VD 3PTFC 1KLUD 4NQKE 1MHXA 4XGAB 5AZGA 3D32A 1WYWB 2ZZPB 1WR1A 4A55A 5DCNA 2ZPYA 4ZHPA 3PV1A 1TIFA 2KHWB 1TBEA 2PW9A 3KVFB 1SIFA 5EDSA 2KQ7A 2KDEB 2A4ZA 3IHPC 2IDYA 3I9V1 1HXYD 2FIFA 2PJHA 1Q0WB 2BQQA 2KAJA 3QQ8B 3DVGX 1AN8A 2LASA 2G1EA 3Q8CA 4DDID 3VHTC 1OTRB 3H7PB 3PRPB 3VVWB 3L17A 2R61A 1D3ZA 3VAWA 5EE0A 2N9LA 4KDLB 4YT0B 1U4AA 3ZUNA 1FD6A 5BYRA 1K50A 2KDBA 2AQ1B 1DOIA 1OQQA 1OQRA 3A4SC 4G11A 4KSLC 4BKSA 4OVVA 3A1QB 4LLGM 2KTRA 4C4VA 5IA7A 2PVGC 4P6VF 2WWZA 3PZ8A 3ZJVA 2Z0DB 1IBXA 4MM3B 3BWUD 3QARA 3JW0X 2BYVE 2WXQA 2RDHA 2UU7A 3ZYYX 3P4RB 1IP9A 3KW5B 3Q8BA 1YN4A 2FCSA 2KWUB 2LRUA 3PT2B 2JZ3B 2VRRB 3SEBA 1HQRD 3SD5A 1JW9D 2GBJA 2Y3AA 4LTUA 2LGIA 2JSVX 2KN4A 3H7SA 2PE9A 2DZMA 3VUYA 1V8CA 3ZNID 3PRMB 5LXIB 3T3NA 2VZKB 2JWZA 3GE3C 2IO2B 1WYGA 5JH5C 2RD0A 4IW0A 3DDCB 3RNFC 1ET6A 5J17A 4MGIE 4MGZE 1WJ4A 3ETRA 2TSSA 2AWTA 1RWSA 1MFWA 1A70A 3NZSA 4RGNA 2V3NA 1WMHA 2MX2A 2M8SA 4J3OD 3NVWA 4WQOB 1WY8A 4PYZA 2NCNA 4LJPB 4CHKA 2FCNA 2OHFA 2WDVB 4GDKA 2N1VA 2KACA 3AB5A 3BVZA 4MSQB 3RNGC 3VH3B 3QJZA 2DAJA 2BYEA 2KDIA 2GI9A 1UNSA 4LDTB 2HTHA 3R7QA 4WJQA 4WAAA 5E6NA 4ZHOA 1N5XA 2HDEA 4WWPA 4JE3B 2N9KA 1PFDA 4B0EA 4DHZB 2PVOD 4L2YA 4JWUC 3AMZA 4WWOA 2VZKD 1WGYA 2YEPB 3MHSD 1P98A 2J0MA 4OVUA 3AE3B 4M02A 2LD9A 1WJ6A 2GBMA 2LWPA 1YQ4B 4MGYE 5BYQA 1I4RA 3U8ZA 3C8YA 4NQLB 1KM7A 2NBUA 3Q2AC 3ZW3A 5C1ZA 3HK0A 1KLGD 2D5GA 2MWSB 1RLFA 1VLBA 3U4EG 1OQYA 1LQBA 2PE6B 3V60A 1HTOA 4BFRA 4ZRPA 4K7UA 1YJ1A 1ET9A 1NVID 3T9LA 3L54A 2IY0B 2L05A 1ZDVA 3ZJTA 5HHDG 4W9EA 2KJHB 1YN5A 1MG4A 1YN3A 3RPFC 2L83A 2MP2B 1QKZA 2ACZB 3AE2B 3JVZX 4C7YA 3A9JB 3VDZA 1UH6A 5EE9A 5HG2A 1K52A 1EWCA 5LNK1 1C79A 2J7QB 5C3JB 4HCPB 4ICVA 2AQ3B 2V1YA 3FAHA 3N9YC 1F0ZA 4G0NB 3DWGC 1TY2A 4ANWA 1ZOYB 1ZKHA 4HCNB 4A3OA 1K53A 2N9PC 2V9HA 3MC0B 1QF6A 2WXHA 3PZ7A 4GMVA 3ZJUA 2L0TA 3N20C 4II2B 1FPYA 2KXJA 3DCGA 2JZPA 4ITKA 4OHJA 1NBFC 2KMAA 4RH6A 3WIMA 5IN7A 4I6NB 3ZDMC 4N59A 2MJDA 2FCQA 3A1QA 4A20A 2H88B 4AWJA 1PUTA 2WXJA 2ICIA 3QAQA 1EU4A 2GMIC 2CR5A 2WU2B 1TS5A 3EUB2 4MM3A 4X57B 1YJIA 1A5RA 1GJZA 2IO3B 1F77A 2W54A 2CS4A 2XBBC 1WXMA 1JCKB 3ZQ4A 1WGGA 2VH2A 2KD0A 4MDKE 2FIDA 3RNCC 3I3TB 1I35A 4WJPA 5H92C 2WXKA 4FXCA 1TZ1A 1WJNA 2J53A 4US9A 3AV8A 1V1PA 5DPRA 4KVGB 3PRZA 2QEJC 3Q6BA 1P3QU 2M1MA 1T3QA 1WIAA 1QILA 1V9JA 4HLEA 1FNUA 1RM6C 5C23A 2G4DB 1DGJA 3HVZA 2REXA 3ZNGC 3APDA 2I1KA 2J4XA 4EZJA 3BVGA 2I2YA 3GZNB 1C3TA 1TTNA 4EOYA 2MJ3A 3ZXVA 5JXVA 3VTWA 2LVQA 3HM3A 4AP4C 2EELA 3X0WA 4BBNF 4IM0A 2FNJB 2MQJA 1GG3A 3UIPB 4L1BA 2RPVA 1E9MA 3KH0A 3MTNB 1DOXA 1NDDA 2IGHA 3NS8A 4FJYA 4NJ6A 1JWBD 3KLSX 3A4RA 2PKOA 4XWWA 3DHHC 2IBIB 4XDDA 3VTVA 1MHHE 1YQ3B 3W1SA 3H6NA 4B9KA 2BKFA 3TL5A 4RMAA 2N9EB 3P42A 3HM6X 1C4AA 4GXBA 1TKEA 3BYTB 3GE8C 3ZLZA 3KYDD 2BS2B 4KIKB 1GAQB 4FN2A 4IOIE 2MRPA 3UIOB 1EF5A 1HZ5A 2K0PA 1ENFA 4ARIA 1P7FA 3RNAC 1MVKA 3K9OB 4EZLA 3AH7A 5G5GA 2ONQA 2M4NA
chains in the Genus database with same CATH topology
1FNWA 1MHXA 1IGDA 3O13A 5BMGA 3J9CA 1ZXIA 1D5XC 5G5HA 4CQNA 1KH0A 2MH7A 1TKGA 5FK9C 3U2SC 1TJEA 3TEZA 5FKAC 3P4SB 1SXTA 4A55A 4DXGA 1F2RC 4ZHPA 1QOBA 4R3DA 3B9JA 1N60A 2V4IB 1PGXA 2LHEA 3VRAB 2PW9A 1D5ZC 4YTPB 3Q8FA 3AE9B 3AM9A 1CZPA 4WURA 1GPXA 3NVZA 1VZ8A 1T5XD 1N62A 3AE1B 2IDYA 4HJGE 4KGRA 2RDGA 1FFUA 2H89B 3I9V1 1HXYD 1MI0A 2Y5PA 3NZ3A 2KAJA 2KDMA 3BVMA 1I4PA 1AN8A 2G1EA 3Q8CA 1UUPA 1FIQA 4A6QA 4M0WA 2CJNA 4L23A 2R61A 5EE0A 3E9SA 2N9LA 4YT0B 4C80A 4XDCA 2BBCA 3U7ZA 4JWSC 1DOYA 1FD6A 3FILA 2W3RA 5BYRA 2QIEB 5AUIA 1K50A 1CJEA 2AQ1B 2E3TA 1DOIA 1OQQA 1OQRA 1M4VA 4LLGM 1JWAD 2Q5WD 1KF6B 2ZW0A 5HFYA 4YWGG 1FFVA 2CU3A 2DYOA 2W3SA 2PVGC 4P6VF 2NTSA 3PZ8A 3ZJVA 1C4PA 1LO5D 3TEXA 1RFKA 1SE2A 1IBXA 4KX6B 4MM3B 5H8YE 5MPOA 2PIAA 4XWTA 3BWUD 2LEKA 1QQRA 3P4QB 3LB8C 4MT5A 2WXQA 4A8XC 1TS3A 4DXFA 2RDHA 3ZYYX 3P4RB 4OW0A 1L6UA 5BYSA 1EM7A 2L1AA 2M56B 3Q8BA 1YN4A 1L4ZB 1BXTA 1GOZA 3SR6A 1SSNA 2W55A 1FRRA 1C9FA 1D4BA 1SE4A 1YNTE 3AEAB 4OZAA 4YTNB 4DQOC 1IUEA 4GLSC 1JQ4A 2DLBA 3SEBA 2QMTA 3NUHB 1HQRD 1J7AA 3BYYB 3URYA 1B1ZA 1KFYB 2KQ4X 2ON8A 1JW9D 1XLNA 2Y3AA 4LTUA 1JWUD 3P4PB 2LGIA 2SAKA 4IDIA 5D7GA 3VRBB 1SJHD 2JSVX 2KN4A 3ABVB 3IXSA 1V8CA 1IGCA 3T3NA 1FXAA 2VZKB 1WWTA 4RNAA 2QSDA 1WYGA 1V1OA 3FILB 1XLQA 3B2FA 1FCLA 1ET6A 1SIJA 4REZA 4TSSA 1JWMD 1QOFA 2TSSA 2WXPA 3ETRA 1RWSA 1XCTL 1E6EB 1A70A 1JWSD 2DWQA 2ZW1A 4RGNA 3GS2A 2WDQB 2V3NA 4J3OD 3NVWA 1J7CA 4HROA 4ZOHC 4NJCA 1QOAA 2FUG1 3IT4B 1IBXB 3NS1A 2JYTA 2OHFA 2WDVB 2KACA 4P16A 1EU3A 3AEBB 3AB5A 1UWXA 3BVZA 1VDVA 3AE5B 2MEKA 2JYEA 2K9XA 1N63A 2DYMA 2PMVA 4AS1A 4N6EB 1ZDXA 4A90A 1I4GA 2GI9A 1UNSA 2WXRA 1B9RA 3Q8EA 4RCOA 4ZHOA 1CK1A 1GB4A 1N5XA 3IAM1 2HDEA 4JE3B 2N9KA 5E6JA 1P7EA 1PFDA 2WXMA 1N5WA 3R2IA 2CJOA 4B0EA 2PVOD 4L2YA 2BT6A 4JWUC 1VRAB 1D5MC 3AMZA 3LXFA 5D3DA 5HI1A 2VZKD 4H2AA 3GB1A 1FNVA 1K51A 2YEPB 1C76A 1AWDA 2JXTA 2WNMA 2WXLA 1I4HA 4YSYB 2GRIA 1D6EC 2JWUA 3AE3B 3HRDD 4RGOS 2NMQA 1L0YB 1L4DB 3KWLA 2M19A 4C7ZA 1YQ4B 4NAMA 1FM0D 1HA5A 5BYQA 1I4RA 3I57A 3C8YA 3EGRA 1JROA 1I7HA 1ZP0B 1QLBB 3AE4B 1ZE3D 3Q69A 3AN1A 2AX5A 1KLGD 1SE3A 2D5GA 2QILA 2LUMA 3NVVA 4JPSA 1VZ6A 4YXDB 1VLBA 3U4EG 3W9CB 1F2RI 4ARCA 1JALA 3FC4A 2W82A 3SFDB 4A9AA 2V0GA 4ZRPA 1SJED 1DYQA 2BB6A 4GDLB 2OEDA 2K5PA 2L52A 1ET9A 2AQ2B 3MFGA 4WQMA 1NVID 1L0XB 2RMMA 2INNE 2BB5A 3AE6B 1XEEA 2KMMA 3WCQA 2I38A 1ROEA 1ZDVA 4KGTA 3AE7B 1L6VA 3CIRB 4WWMA 5HHDG 5FR3A 3ZJTA 1YN5A 1TYGB 1WRIA 1YN3A 1R7SA 1TKYA 3P1MA 3RPFC 2L83A 1HZ6A 1PDXA 1QKZA 2NTTA 3Q8AA 3VR8B 5C2TB 2ACZB 3AE2B 1FMAD 1I4XA 3V05A 2XN9C 4IKGA 4C7YA 1TY0A 4XE0A 2V3PA 3E56A 5I4DA 1V97A 1RYJA 3L4PA 2DBYA 1XO3A 1K52A 3MJ5A 5EE9A 5HG2A 1XLOA 2N0SB 2WXIA 4RF0A 1VJKA 3B2GA 4YSXB 1EWCA 2JQRB 1FRDA 5LNK1 1ESFA 1BMLC 1TS2A 2IGGA 1ACCA 1C79A 2LMCA 2Z8LA 5C3JB 1Y56A 2LHDA 1SBBB 2AQ3B 4RFBA 3FAHA 1XXGA 4ZRQA 2SEBD 2GB1A 3V3XA 3N9YC 3AEEB 1F0ZA 3DWGC 4NAWB 2INPE 1TY2A 3EA6A 5GXGB 1ZOYB 1PGBA 1XLPA 3R8BA 1K53A 3VR9B 5BMIA 1N61A 3MC0B 1NI3A 1UWMA 1QF6A 2WXHA 3PZ7A 2KWDA 3ZJUA 2WXNA 4WH4A 2K22A 1NYQA 1ZXHA 3NVYA 2JZPA 5TSSA 4ITKA 1SB3C 2WXGA 3AECB 4OHJA 4RH6A 3BK1A 2WXFA 2WP9B 1WGKA 4N59A 1ZPSA 2MJDA 4RF1A 2JU6X 4C56C 4WIPA 3HVDA 2J42A 2WDRB 1EWYC 1MPEA 4Q2JA 3R2TA 2H88B 2J52A 1PUTA 2WXJA 2ICIA 4RGTA 1NYRA 3MHZA 4JX1C 1QT9A 1EU4A 2MJEA 2WU2B 4ZYSA 1TS5A 3EUB2 3W2DA 4OZBA 1YJIA 3VQIA 4HEA1 4B0MA 3KQ4A 3OWEB 2WLBA 1FXIA 1F77A 2W54A 1OFFA 1ZUD2 1UGJA 3H8HA 1AW7A 2N7JA 2X38A 2WXOA 2BW2A 1C78A 1JCKB 3ZQ4A 1J7BA 4LK0M 1VZ7A 1FCCC 3U52E 4RGMA 3SFEB 1FEHA 2E6XA 4PT5A 3BIID 3BK2A 3BZDB 2Y5CA 5AUKA 3KWVA 5H92C 2WXKA 2XNAC 4FXCA 3GP7A 4YTMB 4N58A 4KGSA 2J53A 2IPKD 1TZOA 3HUIA 3AV8A 4TQ1A 4US9A 1V1PA 3IAS1 1SF0A 2QEJC 2K3UA 4KKJA 4D2KA 1T3QA 1KRHA 3AE8B 3W5VB 1QILA 4AQ7A 1GB1A 1KTKA 4TMAB 3AEFB 1FNUA 4GDKB 1CQVA 1RM6C 3UI3A 1T6BX 2M0AA 2PLPA 1DGJA 5EE1A 1YJJA 3HVZA 1JMLA 4HKQA 1L0VB 3TEYA 2BS4B 2J4XA 3PO0A 3ZGZA 5EE3A 1NENB 1TS4A 4EE2A 4WAFA 1AYFA 4KKIA 2G9HD 3BVGA 2I2YA 2PTLA 2WS3B 1XCQL 2WU5B 1PYWD 2YEPF 3P63A 1FO4A 2MJ3A 1L5PA 3AEDB 4MACA 5JXVA 5T8IA 5BMHA 4US8A 2BYTA 3NRZA 1WSPA 1XF5L 4NZLB 2EELA 3IT6B 2WQYB 4USAA 4L1BA 4HRSA 3DWMA 2RPVA 1E9MA 4OVZA 3AEGB 3TSSA 3MP9A 1C4CA 3RFZB 1BUIC 1DOXA 2IGHA 1VR9A 2FE8A 4O1NA 1YMHE 2QJLA 1JWBD 3KLSX 4XWWA 2PKOA 1STEA 3LYYA 5D3IB 4XDDA 2BS3B 2HTME 1E10A 4TQ0A 1MHHE 4MH8A 1YQ3B 3TUOA 1I4QA 1V1PB 3W1SA 4HKZE 1NEKB 3TEWA 1E0ZA 3P42A 1C4AA 2LJIA 1TKEA 2B76B 2EKIA 1E7PB 3BYTB 1PGAA 3W5UB 4UDUC 4OZCA 1QOGA 4YSZB 2BS2B 1GAQB 1WXQA 2FBWB 4IOIE 5G5GA 1Q10A 1HZ5A 2IJ0A 1ENFA 2K0PA 2L32A 4ARIA 3T3OA 1P7FA 1JRPA 1C77A 1MVKA 2BTEA 2IGDA 1HEZE 2LFIA 3AH7A 3CWIA 1SEBD 2JX5A 2ONQA 1KLUD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P4P B;  3SFE B;  1JAL A;  3FC4 A;  3SFD B;  4A9A A;  3VRB B;  4IDI A;  1ZXI A;  3ABV B;  3BII D;  5G5H A;  2K5P A;  2Y5C A;  5AUK A;  2L52 A;  5H92 C;  1V8C A;  2MH7 A;  4FXC A;  4WQM A;  1NVI D;  1TKG A;  4YTM B;  1TJE A;  4N58 A;  3P4S B;  1FXA A;  3HUI A;  3AV8 A;  3AE6 B;  4US9 A;  3WCQ A;  2KMM A;  1WWT A;  4ZHP A;  1WYG A;  1ROE A;  1QOB A;  3AE7 B;  1L6V A;  1N60 A;  1SF0 A;  3B9J A;  1XLQ A;  3B2F A;  3CIR B;  4WWM A;  1TYG B;  1SIJ A;  1WRI A;  1R7S A;  1TKY A;  3P1M A;  3RPF C;  3VRA B;  2L83 A;  3VR8 B;  1PDX A;  1T3Q A;  4YTP B;  1KRH A;  3AE8 B;  3W5V B;  1QOF A;  3ETR A;  5C2T B;  1RWS A;  2ACZ B;  3AE9 B;  1E6E B;  3AM9 A;  1A70 A;  1CZP A;  1FMA D;  2DWQ A;  3AE2 B;  3AEF B;  1GPX A;  2WDQ B;  4C7Y A;  3NVZ A;  1RM6 C;  3NVW A;  1J7C A;  4HRO A;  1DGJ A;  4ZOH C;  1V97 A;  1N62 A;  1RYJ A;  3AE1 B;  1QOA A;  1XO3 A;  1YJJ A;  2DBY A;  3HVZ A;  3L4P A;  1XLO A;  2N0S B;  1FFU A;  2H89 B;  5EE1 A;  1L0V B;  1VJK A;  3B2G A;  4YSX B;  3NS1 A;  2BS4 B;  3PO0 A;  2JQR B;  2OHF A;  1NEN B;  1FRD A;  2WDV B;  5EE3 A;  2KAJ A;  1AYF A;  3AEB B;  3AB5 A;  5C3J B;  2G1E A;  1VDV A;  3AE5 B;  2WS3 B;  2K9X A;  1FIQ A;  3FAH A;  5EE9 A;  1N63 A;  2WU5 B;  3P63 A;  1FO4 A;  2MJ3 A;  1L5P A;  3AED B;  2CJN A;  3AEE B;  4N6E B;  1F0Z A;  5EE0 A;  3DWG C;  4US8 A;  3NRZ A;  4YT0 B;  4C80 A;  5GXG B;  1ZOY B;  1XLP A;  1DOY A;  4JWS C;  3VR9 B;  1N61 A;  1NI3 A;  2W3R A;  1B9R A;  1UWM A;  2QIE B;  2WQY B;  4USA A;  1QF6 A;  5AUI A;  1CJE A;  2E3T A;  1DOI A;  4HRS A;  1OQQ A;  1OQR A;  3DWM A;  1E9M A;  4ZHO A;  2K22 A;  1NYQ A;  3AEG B;  3NVY A;  1N5X A;  1JWA D;  2Q5W D;  1KF6 B;  4ITK A;  1SB3 C;  3AEC B;  1FFV A;  1PFD A;  1N5W A;  2CU3 A;  1DOX A;  2W3S A;  2CJO A;  1WGK A;  2PVG C;  2WP9 B;  4P6V F;  2PVO D;  2BT6 A;  4JWU C;  2QJL A;  4N59 A;  3AMZ A;  1RFK A;  1JWB D;  2MJD A;  3LXF A;  2PKO A;  2BS3 B;  2HTM E;  1EWY C;  2WDR B;  4KX6 B;  5H8Y E;  1E10 A;  1AWD A;  2PIA A;  5MPO A;  2H88 B;  1YQ3 B;  2LEK A;  4YSY B;  1PUT A;  3P4Q B;  3LB8 C;  1NYR A;  4JX1 C;  1QT9 A;  3AE3 B;  2MJE A;  3ZYY X;  2WU2 B;  3P4R B;  3HRD D;  3EUB 2;  1L6U A;  1NEK B;  3KWL A;  2M19 A;  4C7Z A;  2M56 B;  1E0Z A;  1YQ4 B;  1YJI A;  1FM0 D;  1TKE A;  2B76 B;  2EKI A;  1E7P B;  2WLB A;  3W5U B;  1FXI A;  2W54 A;  1OFF A;  1ZUD 2;  3SR6 A;  1JRO A;  1QOG A;  1I7H A;  2W55 A;  2BS2 B;  4YSZ B;  1FRR A;  1GAQ B;  1WXQ A;  2FBW B;  1ZP0 B;  1QLB B;  3AE4 B;  3AEA B;  4YTN B;  1IUE A;  5G5G A;  1JQ4 A;  3AN1 A;  2AX5 A;  1J7A A;  1JRP A;  3NVV A;  1KFY B;  3AH7 A;  3CWI A;  1J7B A;  4YXD B;  1VLB A;  2JX5 A;  3W9C B;  1JW9 D;  1XLN A;  4LTU A; 
#chains in the Genus database with same CATH topology
 4IWQ A;  1S1Q B;  5BMG A;  3J9C A;  2L8J A;  5G5H A;  4CQN A;  1KH0 A;  2DNF A;  1XT9 B;  2LUE A;  5E6P A;  1F2R C;  1QOB A;  4R3D A;  1P1A A;  1N60 A;  4E71 A;  2WHI A;  1PGX A;  2LHE A;  3V6E B;  4YTP B;  4I6P A;  3Q8F A;  2Z59 B;  4URK A;  3AE9 B;  2M0X A;  3AM9 A;  1CZP A;  1GPX A;  2ZNV B;  4KSK C;  1V80 A;  1ZGU B;  1VZ8 A;  1T5X D;  2MP2 A;  2CHZ A;  2RDG A;  2K8B A;  2XK5 B;  3VUX A;  2KDM A;  3BVM A;  3A9K B;  3ZKJ C;  1WM3 A;  3DHI C;  1YQB A;  2ZVN A;  4M0W A;  1I42 A;  4L23 A;  4C80 A;  4AJW A;  3U7Z A;  3DBH B;  3EFU A;  4JWS C;  1WI0 A;  2QCZ A;  2KJR A;  1T0Y A;  1CJE A;  4I6L B;  2MBB B;  3ZVV A;  1GNU A;  3IFW B;  1JWA D;  4XX5 A;  2ZW0 A;  3TCA A;  2O6V B;  3VXW A;  4II3 B;  4KX6 B;  5H8Y E;  4DK5 A;  5MPO A;  3P4Q B;  4BKT A;  1YX5 B;  3KUC B;  2IYD B;  3DBH I;  5JZE B;  2QHO A;  5BYS A;  2MBE A;  2M56 B;  2DHZ A;  4HPL B;  1UGM A;  1R4N B;  3BY4 B;  4DDG D;  4IM2 A;  2W55 A;  1C9F A;  1X1M A;  2Z0E B;  3AEA B;  4GLS C;  3NUH B;  5AZF A;  3BYY B;  3PVL A;  1V2Y A;  3URY A;  4XYC A;  3P4P B;  3WAP A;  3QX1 A;  3NY5 A;  2SAK A;  5D7G A;  1SJH D;  3T8M A;  4ANV A;  3IXS A;  1IGC A;  1FXA A;  3FIL B;  4A3P A;  1XLQ A;  3B2F A;  2CHW A;  2IO0 B;  4IC7 B;  4REZ A;  2D10 A;  2LJ5 A;  3DHG C;  3MJW A;  1E6E B;  2DWQ A;  2ZW1 A;  3M62 B;  4FA6 A;  2WDQ B;  4HRO A;  1QOA A;  2FUG 1;  4MGK E;  1V86 A;  4P1C C;  1WE6 A;  1EU3 A;  3PHX B;  2JRH A;  2K9X A;  4KZ0 A;  3UIN B;  2D3G A;  2WXR A;  2W9N A;  1E8Z A;  4PK1 A;  1NI2 A;  1F1H A;  1CK1 A;  3IAM 1;  2WXM A;  4KV2 A;  3GB1 A;  4W9L A;  2JXT A;  2WNM A;  2WXL A;  1I4H A;  4YSY B;  4CO7 A;  4RGO S;  3MC9 A;  2M19 A;  4C7Z A;  4NAW A;  3OJ3 A;  5IO9 A;  2LGS A;  3I57 A;  3RNE C;  3U7D A;  1ZP0 B;  4DBG A;  3C19 A;  2AX5 A;  1WM2 A;  3W9C B;  3APF A;  4LJO B;  2MLB A;  4GU2 A;  1JAL A;  3FC4 A;  4E74 A;  5L83 A;  3OJ4 B;  2V0G A;  3L0W B;  1SJE D;  1DYQ A;  4GDL B;  2OED A;  2AQ2 B;  1L0X B;  3UQB A;  3FKY A;  2INN E;  2BB5 A;  2INC C;  3AE7 B;  2BF8 B;  2KX0 A;  3Q8A A;  2A5U A;  1PDX A;  2DYB A;  2RPQ A;  5C2T B;  5BO4 B;  1FMA D;  3V05 A;  2XN9 C;  4XE0 A;  3E56 A;  3AUL A;  3ZTD A;  2D2Q A;  2GBR A;  3DQV A;  4W9J A;  1VJK A;  2NPT A;  4YSX B;  2JQR B;  3OG5 A;  1TS2 A;  1ACC A;  2LMC A;  2LHD A;  2SEB D;  3V3X A;  2K39 A;  3DBR I;  4B6W A;  4EFO A;  2ZCB A;  4MEM A;  4PYU A;  2LVP A;  3VR9 B;  1N61 A;  1NI3 A;  3A9K A;  1GC7 A;  3R7R A;  3Q3J A;  4BKG A;  4TKN A;  2NBV B;  1ZXH A;  2CKH B;  2D11 A;  1L7Y A;  2WP9 B;  3WAN A;  4QAY A;  1JRU A;  3WA0 A;  4LNI A;  2O2V B;  4RF1 A;  2JU6 X;  3N1Z C;  2JPH A;  3HVD A;  1EWY C;  1MPE A;  2C7H A;  3ZNZ B;  3R2T A;  2J52 A;  4RGT A;  1NYR A;  1QT9 A;  1WX7 A;  2O6V A;  4ZYS A;  5D2M B;  3B0A A;  3W1S C;  3Q14 C;  5KHO A;  4OZB A;  4B0M A;  4HEA 1;  2DX5 B;  3Q3M C;  1ZUD 2;  3ZO5 B;  2JT4 B;  1AW7 A;  2WXO A;  2BW2 A;  1C78 A;  2KAN A;  2G4S A;  1VZ7 A;  3U52 E;  2OJR A;  3ZIM A;  2NS5 A;  2HJ8 A;  2XNA C;  4KGS A;  3HUI A;  4DHJ B;  1WGR A;  4WWN A;  4FHK A;  4KKJ A;  3JYU A;  1KRH A;  4AQ7 A;  2J0K A;  1GB1 A;  4TMA B;  1T0Q C;  2BWE S;  4K7W A;  3UI3 A;  3PHW B;  3TIX A;  2IY1 B;  3ZGZ A;  2G3Q B;  2KFK B;  5EE3 A;  2K8H A;  4KZC A;  4WAF A;  1AYF A;  4KKI A;  5KHQ A;  1XCQ L;  2KDF B;  3P63 A;  4MJS B;  2KLG A;  3AED B;  2VH1 A;  2KWC A;  3BIN A;  4WJO A;  2WX1 A;  4JGH B;  4G3X B;  2WQY B;  4USA A;  2KT7 A;  4HRS A;  4HPM B;  2ASQ A;  3QHT A;  3MP9 A;  5IOI A;  1C4C A;  3RFZ B;  1BUI C;  4XC2 A;  4JL9 A;  2FE8 A;  4O1N A;  2QJL A;  3QA8 A;  1V6E A;  2J0J A;  3LYY A;  4DHJ D;  2BS3 B;  2HTM E;  3M95 A;  1E10 A;  2KYW A;  4MH8 A;  3TUO A;  2V3S A;  4HKZ E;  4N9F 4;  3DOW A;  3EFC A;  3H7P A;  2EKI A;  2GBN A;  3W5U B;  1F52 A;  3T3O A;  4ICU A;  1JRP A;  5DPS A;  2LFI A;  2EMT A;  3CWI A;  2JX5 A;  2L3Z A;  4W9G A;  3CMM B;  1FNW A;  1IGD A;  3O13 A;  3JSV B;  1ZXI A;  2KVR A;  2LGD A;  1D5X C;  3Q3N C;  3RD2 A;  1BT0 A;  5FK9 C;  3U2S C;  4LNN A;  1TJE A;  3TEZ A;  1V49 A;  5FKA C;  3Q3O C;  4CYE A;  3B9J A;  2AYO B;  4GDL A;  4W9F A;  5JHB A;  1Q5W B;  3RUI B;  1D5Z C;  3NZU A;  4DXA B;  4W9I A;  2V4L A;  2PPH A;  1E8Y A;  1N62 A;  3AE1 B;  4HJG E;  2H89 B;  1N6Z A;  3X23 A;  2UWQ A;  2L0F A;  5CHF A;  4FHJ A;  1MI0 A;  2Y5P A;  3NZ3 A;  4F7Z A;  1I4P A;  4IM3 A;  3UQA A;  1UD7 A;  1UUP A;  1FIQ A;  4A6Q A;  3QWZ B;  2RSU A;  2K1F A;  3AXC A;  4K3B A;  4XDC A;  2BBC A;  1DOY A;  2W3R A;  2QIE B;  4BOZ B;  2N7E A;  2R2Q A;  1AAR A;  1WX9 A;  2Q5W D;  5HFY A;  4YWG G;  3V61 A;  2CU3 A;  2DYO A;  4HXD A;  2NTS A;  2L7R A;  3NHE B;  2KLC A;  2IZV B;  1SE2 A;  4W9H A;  2PIA A;  4XWT A;  2LEK A;  1QQR A;  1YD8 U;  4A8X C;  1TS3 A;  4OW0 A;  1HTQ A;  2LGY A;  2L1A A;  4GSW A;  1KJT A;  3RI7 C;  1L4Z B;  2B3A A;  2KTF A;  2LGX A;  1GOZ A;  3SR6 A;  1D4B A;  1SE4 A;  4YTN B;  1IUE A;  1OEY A;  2QMT A;  2D3C A;  1J7A A;  2OJW A;  4ANU A;  2QC8 A;  3ENE A;  3N3K B;  1B1Z A;  3PSE B;  2KQ4 X;  2K8C A;  1YX6 B;  2ON8 A;  2WX0 A;  1XLN A;  1WXA A;  4BZA A;  4YL8 A;  4IDI A;  1WH3 A;  3ABV B;  2MBQ A;  5L95 C;  3RYT A;  4NPN A;  3QCA A;  1WWT A;  3NOB A;  2MCN B;  1E7U A;  1LM8 B;  4DHZ E;  4P1B C;  1JWS D;  2KTR B;  2UYZ B;  4J6I A;  1J7C A;  3ZNH B;  4ZOH C;  1WGD A;  2M17 A;  5IKC M;  2MBO A;  4NJC A;  3IT4 B;  3IBE A;  1UF0 A;  1IBX B;  3NS1 A;  2MBH A;  2KOX A;  3PRE A;  3AEB B;  1VDV A;  2MEK A;  2PMV A;  4N6E B;  4A90 A;  2BVC A;  2KFK A;  3R66 C;  1I4G A;  4BBN C;  4BOS C;  5J2R A;  2KZR A;  2Y5B B;  4HWI B;  4MJS A;  4FLH A;  1T0R C;  2KQS A;  2KN5 A;  3OAW A;  1OGW A;  1GB4 A;  1IPG A;  3ECI A;  1WFY A;  5E6J A;  3A9J A;  2CJO A;  4S0R A;  4PS7 A;  1VRA B;  5D3D A;  3N1Y C;  5HI1 A;  4H2A A;  1FNV A;  4NNJ B;  5TR5 A;  3HIZ A;  2GRI A;  4LNO A;  3ZTC A;  4BKS D;  4G50 A;  4HDQ A;  1L4D B;  1KOT A;  1SGH A;  1HA5 A;  1K8R B;  3EGR A;  1JRO A;  1I7H A;  1QLB B;  3AE4 B;  2AL6 A;  2WDT B;  2LUM A;  4JPS A;  1VZ6 A;  1J19 A;  1F2R I;  2CU1 A;  2W82 A;  3SFD B;  5FR6 A;  3V62 A;  2BB6 A;  3KYC D;  2L52 A;  3MFG A;  4HPP A;  1E7V A;  3RCZ A;  1UEL A;  4TV3 A;  1XEE A;  3WCQ A;  2N7D A;  3JSV A;  1L6V A;  5FR3 A;  4F8C B;  3P1M A;  1TYG B;  1WRI A;  1R7S A;  2NVU I;  3TJP A;  1HZ6 A;  2NTT A;  3DBL B;  3VR8 B;  1MJD A;  3ML9 A;  4ZDV A;  2V3P A;  3R3M A;  5DPT A;  5I4D A;  4LCD E;  1V97 A;  1RYJ A;  3L4P A;  2DBY A;  1XO3 A;  4RF0 A;  1RAX A;  3B2G A;  3ZRC A;  1ESF A;  1BML C;  2IGG A;  2OOB B;  1Y56 A;  1WX8 A;  4FUL A;  1SBB B;  4EEW A;  2WYQ A;  4ZRQ A;  1LFD A;  2GB1 A;  2KJ6 A;  2AL3 A;  1YIW A;  3DBL I;  3EA6 A;  2ZPN A;  1PGB A;  3WAO A;  3R8B A;  5BMI A;  3DVN V;  4WH4 A;  2WGS A;  2K22 A;  3NVY A;  4M00 A;  2LXC A;  3RZW C;  5TSS A;  2JY6 A;  1SB3 C;  3P2B A;  2MA9 B;  1WGK A;  3OLM D;  2NBW B;  4C56 C;  3SHQ A;  4WIP A;  2J42 A;  1WGH A;  2NR2 A;  1J8C A;  4NJ7 A;  3MHZ A;  1L2N A;  2MJE A;  4MSM B;  3EEC A;  1ISN A;  5AZH A;  1WZ0 A;  3VQI A;  3KQ4 A;  3OWE B;  4B95 A;  3QK0 A;  3PZD A;  4XZ4 A;  1RFA A;  1WZ3 A;  1E90 A;  1CMX B;  3H8H A;  2N7J A;  3EHV A;  1J7B A;  1LGR A;  2KWV B;  4RGM A;  4P7I A;  3RT3 B;  4PT5 A;  3BK2 A;  3BZD B;  2Y5C A;  3CST A;  5AUK A;  3GP7 A;  4N58 A;  4JQW C;  4W9C A;  5G55 A;  3IAS 1;  1GC6 A;  2K3U A;  4D2K A;  3PGE A;  2JUO A;  4KIK A;  1WF9 A;  3RN9 C;  5LXH A;  3APC A;  3TEY A;  2BS4 B;  1TS4 A;  4EE2 A;  1V5T A;  2G9H D;  2ZVO A;  1V81 A;  2PTL A;  2WS3 B;  2YEP F;  1PYW D;  1FO4 A;  1L5P A;  3DBR B;  4MAC A;  4HVB A;  5T8I A;  2YLM A;  1C1Y B;  5D6J B;  2BYT A;  3NRZ A;  4NZL B;  5AEK B;  3IVF A;  1UZX B;  4OVZ A;  3AU5 A;  1UBQ A;  4AUQ C;  1HE8 A;  4MEL A;  3RZF A;  1SE9 A;  3PLV A;  1STE A;  4M8M A;  5D3I B;  3SU8 X;  2XK5 A;  1V1P B;  2KFJ A;  2N9X A;  3O65 B;  4K7S A;  3TEW A;  1E0Z A;  1ZW7 A;  2B76 B;  1E7P B;  1EO6 A;  1PGA A;  2DZJ A;  4S17 A;  4GB9 A;  4OZC A;  1QOG A;  4YSZ B;  2FBW B;  2IJ0 A;  2L76 A;  5GMV A;  1HEZ E;  2KX3 A;  3TMP B;  2LI5 A;  2QDF A;  3AI5 A;  3C0R B;  2D07 B;  2MH7 A;  1TKG A;  3P4S B;  1SXT A;  4DXG A;  2KMC A;  2N4F A;  2V4I B;  4FJZ A;  3VRA B;  2MHJ A;  1S3S G;  2HJ1 A;  4WUR A;  4FBJ B;  3DVN U;  3NVZ A;  2C7N B;  2RGF A;  3L13 A;  4KGR A;  1FFU A;  3DVG Y;  2KC2 A;  4HK2 A;  2JZZ A;  4EUT A;  3KUD B;  2FAZ A;  4E3C A;  2GBK A;  2KO3 A;  2CJN A;  2LVO A;  2DAF A;  3E9S A;  3ONS A;  3VTU A;  1GUA B;  3V6C B;  4ANX A;  4RM8 A;  3FIL A;  3VFK A;  1E5W A;  2BPS A;  3QIJ A;  5AUI A;  2GOW A;  2E3T A;  1WE7 A;  1FXT B;  1M4V A;  5J18 A;  2GLS A;  1KF6 B;  1FFV A;  2EMS A;  3ML8 A;  2W3S A;  3SDL C;  1M94 A;  4HDO A;  1C4P A;  1LO5 D;  3TEX A;  1RFK A;  3UF8 A;  2C7M B;  2IO1 B;  1OEY J;  3CF6 E;  2EKE C;  3LB8 C;  4MT5 A;  4DXF A;  1L6U A;  2DZK A;  1EM7 A;  4LDT D;  3WAL A;  4HJK A;  1BXT A;  1SSN A;  1FRR A;  3NJT A;  1TT5 B;  1YNT E;  4OZA A;  4DQO C;  1JQ4 A;  2DLB A;  1T0S C;  2FUH B;  4ZRI A;  1KFY B;  4K3C A;  2C9W B;  1LXD A;  5CTR C;  2JRI B;  1JWU D;  4M01 A;  2ZJD A;  2K25 A;  4BVU C;  3VRB B;  4M0W B;  1Q1O A;  4GN1 A;  2MW5 A;  4LNK A;  1KLV A;  4RNA A;  2QSD A;  4GGQ A;  1V1O A;  4RM9 A;  1FCL A;  1SIJ A;  4TSS A;  2DZI A;  1JWM D;  4IG7 B;  3QC8 B;  3TBL D;  1QOF A;  2WXP A;  1XCT L;  3GS2 A;  5JHA A;  2ZCC A;  4AJY B;  2K6D B;  2JYT A;  4P16 A;  1UWX A;  3AE5 B;  2JYE A;  5G2N A;  1N63 A;  2DYM A;  4AS1 A;  1ZDX A;  1MG8 A;  3S2A A;  1WR6 E;  3A33 B;  5IP4 D;  1XQQ A;  4IWO A;  4GIV A;  1B9R A;  3Q8E A;  4RCO A;  3AU4 A;  1EF1 A;  3HHM A;  3K9P B;  1E8W A;  1P7E A;  1N5W A;  3R2I A;  3RMK C;  2BT6 A;  1WRD B;  1D5M C;  3LXF A;  3W1Y A;  3ALB A;  1K51 A;  1C76 A;  1AWD A;  3WAM A;  2KK8 A;  1D6E C;  2JWU A;  3ZDT A;  3HRD D;  2NMQ A;  1VCB A;  1L0Y B;  3KWL A;  2C60 A;  2YVC A;  4NAM A;  1FM0 D;  5LLI A;  3NG0 A;  2BKR B;  1G6J A;  1ZE3 D;  3Q69 A;  2KVZ A;  3AN1 A;  2LXA A;  1SE3 A;  3B08 A;  1E8X A;  3NVV A;  2QIL A;  4K1R B;  4KDI C;  1H8C A;  4YXD B;  2KKC A;  4ARC A;  4A9A A;  4ZRK A;  2G45 B;  2O2V A;  2K5P A;  4WQM A;  4ZYN A;  2RMM A;  3H9D A;  3AE6 B;  4C00 A;  2KMM A;  2I38 A;  1ROE A;  5CX3 A;  4KGT A;  3CIR B;  4WWM A;  1TKY A;  2JVC A;  1I4X A;  4IKG A;  1TY0 A;  2BGF A;  1VD2 A;  3MJ5 A;  4DWF A;  4IWP A;  1XLO A;  2I1J A;  2N0S B;  2WXI A;  4JIO U;  3I5J C;  4PS8 A;  3H1U A;  1FRD A;  4TUU A;  2Z8L A;  1P0R A;  3KUZ A;  2K6Q A;  3CSF A;  4RFB A;  1XXG A;  3GZN I;  2IND C;  3AEE B;  4NAW B;  4NY0 A;  2INP E;  5GXG B;  2ZEQ A;  1XLP A;  2L00 B;  3UGB B;  5CHW A;  3GOE A;  1RRB A;  3VH4 B;  4C4V B;  1UWM A;  4K81 A;  2KWD A;  2WXN A;  4BAX A;  1NYQ A;  4AOF A;  2XEW A;  1WJU A;  2WXG A;  3AEC B;  4ASW C;  3BK1 A;  2WXF A;  2ZNV C;  4ACF A;  1ZPS A;  4M8N A;  2WDR B;  4Q2J A;  1P9D U;  4JX1 C;  4LNF A;  1QZE A;  1XD3 B;  2KNB A;  4EZK A;  1PQS A;  3DPD A;  3W2D A;  1EUV B;  3Q3F A;  1TGZ B;  1WXS A;  2WLB A;  1FXI A;  4IUM B;  4W9D A;  1OFF A;  3VUW A;  3PLU A;  3IG3 A;  1UGJ A;  1R4M B;  2X38 A;  4W9K A;  1UBI A;  3N1X C;  2NPT B;  2FCM A;  1F9J A;  5HKH A;  2BWF A;  4LK0 M;  1J0G A;  1FCC C;  1Z2M A;  3SFE B;  3L10 B;  2BYF A;  1FEH A;  2D3B A;  2E6X A;  3BII D;  5E6O A;  2DEN B;  3KWV A;  5D94 A;  3M63 B;  4YTM B;  2IPK D;  1TZO A;  4TQ1 A;  2KC1 A;  1SF0 A;  1WMH B;  3RUL A;  5CHV C;  3LJ3 A;  3ZRF A;  3AE8 B;  2AEH A;  1R4M I;  3W5V B;  4FJV B;  4WJN A;  1KTK A;  3AEF B;  3MC8 A;  3N32 A;  3RNB C;  5IAA C;  4GDK B;  1CQV A;  2JXX A;  1T6B X;  2M0A A;  2PLP A;  4ZRJ A;  5EE1 A;  1YJJ A;  2N1W A;  1JML A;  4HKQ A;  1L0V B;  3PO0 A;  3DBS A;  1NEN B;  2RDB C;  2HE7 A;  2MSE D;  4FAD A;  2CHX A;  2WU5 B;  5DPW A;  2R2O A;  2JF5 A;  5BMH A;  4US8 A;  2LRW A;  3N30 A;  1WSP A;  1XF5 L;  3LDZ E;  3PS6 A;  3IT6 B;  2X8X X;  3L08 A;  1H4R A;  3DWM A;  4MH0 E;  3AEG B;  3TSS A;  1VR9 A;  3M3J A;  4JLC A;  1YMH E;  2PEA A;  4PS3 A;  2HD5 B;  4F1S A;  3I63 C;  4TQ0 A;  3ZXR A;  1I4Q A;  3EC8 A;  1NEK B;  1IYF A;  1Z5S B;  2D3A A;  1V5O A;  2LJI A;  4UDU C;  2LZ6 A;  3B1L X;  1WXV A;  3U30 A;  1R4N I;  1WXQ A;  3PPA A;  1Q10 A;  2C5L C;  2L32 A;  1C77 A;  1Y8R C;  2RR9 A;  3L16 A;  2BTE A;  2IGD A;  4GOC A;  1YOV B;  4EKU A;  1SEB D;  2O6V D;  3PTF C;  1KLU D;  4NQK E;  1MHX A;  4XGA B;  5AZG A;  3D32 A;  1WYW B;  2ZZP B;  1WR1 A;  4A55 A;  5DCN A;  2ZPY A;  4ZHP A;  3PV1 A;  1TIF A;  2KHW B;  1TBE A;  2PW9 A;  3KVF B;  1SIF A;  5EDS A;  2KQ7 A;  2KDE B;  2A4Z A;  3IHP C;  2IDY A;  3I9V 1;  1HXY D;  2FIF A;  2PJH A;  1Q0W B;  2BQQ A;  2KAJ A;  3QQ8 B;  3DVG X;  1AN8 A;  2LAS A;  2G1E A;  3Q8C A;  4DDI D;  3VHT C;  1OTR B;  3H7P B;  3PRP B;  3VVW B;  3L17 A;  2R61 A;  1D3Z A;  3VAW A;  5EE0 A;  2N9L A;  4KDL B;  4YT0 B;  1U4A A;  3ZUN A;  1FD6 A;  5BYR A;  1K50 A;  2KDB A;  2AQ1 B;  1DOI A;  1OQQ A;  1OQR A;  3A4S C;  4G11 A;  4KSL C;  4BKS A;  4OVV A;  3A1Q B;  4LLG M;  2KTR A;  4C4V A;  5IA7 A;  2PVG C;  4P6V F;  2WWZ A;  3PZ8 A;  3ZJV A;  2Z0D B;  1IBX A;  4MM3 B;  3BWU D;  3QAR A;  3JW0 X;  2BYV E;  2WXQ A;  2RDH A;  2UU7 A;  3ZYY X;  3P4R B;  1IP9 A;  3KW5 B;  3Q8B A;  1YN4 A;  2FCS A;  2KWU B;  2LRU A;  3PT2 B;  2JZ3 B;  2VRR B;  3SEB A;  1HQR D;  3SD5 A;  1JW9 D;  2GBJ A;  2Y3A A;  4LTU A;  2LGI A;  2JSV X;  2KN4 A;  3H7S A;  2PE9 A;  2DZM A;  3VUY A;  1V8C A;  3ZNI D;  3PRM B;  5LXI B;  3T3N A;  2VZK B;  2JWZ A;  3GE3 C;  2IO2 B;  1WYG A;  5JH5 C;  2RD0 A;  4IW0 A;  3DDC B;  3RNF C;  1ET6 A;  5J17 A;  4MGI E;  4MGZ E;  1WJ4 A;  3ETR A;  2TSS A;  2AWT A;  1RWS A;  1MFW A;  1A70 A;  3NZS A;  4RGN A;  2V3N A;  1WMH A;  2MX2 A;  2M8S A;  4J3O D;  3NVW A;  4WQO B;  1WY8 A;  4PYZ A;  2NCN A;  4LJP B;  4CHK A;  2FCN A;  2OHF A;  2WDV B;  4GDK A;  2N1V A;  2KAC A;  3AB5 A;  3BVZ A;  4MSQ B;  3RNG C;  3VH3 B;  3QJZ A;  2DAJ A;  2BYE A;  2KDI A;  2GI9 A;  1UNS A;  4LDT B;  2HTH A;  3R7Q A;  4WJQ A;  4WAA A;  5E6N A;  4ZHO A;  1N5X A;  2HDE A;  4WWP A;  4JE3 B;  2N9K A;  1PFD A;  4B0E A;  4DHZ B;  2PVO D;  4L2Y A;  4JWU C;  3AMZ A;  4WWO A;  2VZK D;  1WGY A;  2YEP B;  3MHS D;  1P98 A;  2J0M A;  4OVU A;  3AE3 B;  4M02 A;  2LD9 A;  1WJ6 A;  2GBM A;  2LWP A;  1YQ4 B;  4MGY E;  5BYQ A;  1I4R A;  3U8Z A;  3C8Y A;  4NQL B;  1KM7 A;  2NBU A;  3Q2A C;  3ZW3 A;  5C1Z A;  3HK0 A;  1KLG D;  2D5G A;  2MWS B;  1RLF A;  1VLB A;  3U4E G;  1OQY A;  1LQB A;  2PE6 B;  3V60 A;  1HTO A;  4BFR A;  4ZRP A;  4K7U A;  1YJ1 A;  1ET9 A;  1NVI D;  3T9L A;  3L54 A;  2IY0 B;  2L05 A;  1ZDV A;  3ZJT A;  5HHD G;  4W9E A;  2KJH B;  1YN5 A;  1MG4 A;  1YN3 A;  3RPF C;  2L83 A;  2MP2 B;  1QKZ A;  2ACZ B;  3AE2 B;  3JVZ X;  4C7Y A;  3A9J B;  3VDZ A;  1UH6 A;  5EE9 A;  5HG2 A;  1K52 A;  1EWC A;  5LNK 1;  1C79 A;  2J7Q B;  5C3J B;  4HCP B;  4ICV A;  2AQ3 B;  2V1Y A;  3FAH A;  3N9Y C;  1F0Z A;  4G0N B;  3DWG C;  1TY2 A;  4ANW A;  1ZOY B;  1ZKH A;  4HCN B;  4A3O A;  1K53 A;  2N9P C;  2V9H A;  3MC0 B;  1QF6 A;  2WXH A;  3PZ7 A;  4GMV A;  3ZJU A;  2L0T A;  3N20 C;  4II2 B;  1FPY A;  2KXJ A;  3DCG A;  2JZP A;  4ITK A;  4OHJ A;  1NBF C;  2KMA A;  4RH6 A;  3WIM A;  5IN7 A;  4I6N B;  3ZDM C;  4N59 A;  2MJD A;  2FCQ A;  3A1Q A;  4A20 A;  2H88 B;  4AWJ A;  1PUT A;  2WXJ A;  2ICI A;  3QAQ A;  1EU4 A;  2GMI C;  2CR5 A;  2WU2 B;  1TS5 A;  3EUB 2;  4MM3 A;  4X57 B;  1YJI A;  1A5R A;  1GJZ A;  2IO3 B;  1F77 A;  2W54 A;  2CS4 A;  2XBB C;  1WXM A;  1JCK B;  3ZQ4 A;  1WGG A;  2VH2 A;  2KD0 A;  4MDK E;  2FID A;  3RNC C;  3I3T B;  1I35 A;  4WJP A;  5H92 C;  2WXK A;  4FXC A;  1TZ1 A;  1WJN A;  2J53 A;  4US9 A;  3AV8 A;  1V1P A;  5DPR A;  4KVG B;  3PRZ A;  2QEJ C;  3Q6B A;  1P3Q U;  2M1M A;  1T3Q A;  1WIA A;  1QIL A;  1V9J A;  4HLE A;  1FNU A;  1RM6 C;  5C23 A;  2G4D B;  1DGJ A;  3HVZ A;  2REX A;  3ZNG C;  3APD A;  2I1K A;  2J4X A;  4EZJ A;  3BVG A;  2I2Y A;  3GZN B;  1C3T A;  1TTN A;  4EOY A;  2MJ3 A;  3ZXV A;  5JXV A;  3VTW A;  2LVQ A;  3HM3 A;  4AP4 C;  2EEL A;  3X0W A;  4BBN F;  4IM0 A;  2FNJ B;  2MQJ A;  1GG3 A;  3UIP B;  4L1B A;  2RPV A;  1E9M A;  3KH0 A;  3MTN B;  1DOX A;  1NDD A;  2IGH A;  3NS8 A;  4FJY A;  4NJ6 A;  1JWB D;  3KLS X;  3A4R A;  2PKO A;  4XWW A;  3DHH C;  2IBI B;  4XDD A;  3VTV A;  1MHH E;  1YQ3 B;  3W1S A;  3H6N A;  4B9K A;  2BKF A;  3TL5 A;  4RMA A;  2N9E B;  3P42 A;  3HM6 X;  1C4A A;  4GXB A;  1TKE A;  3BYT B;  3GE8 C;  3ZLZ A;  3KYD D;  2BS2 B;  4KIK B;  1GAQ B;  4FN2 A;  4IOI E;  2MRP A;  3UIO B;  1EF5 A;  1HZ5 A;  2K0P A;  1ENF A;  4ARI A;  1P7F A;  3RNA C;  1MVK A;  3K9O B;  4EZL A;  3AH7 A;  5G5G A;  2ONQ A;  2M4N A; 
#chains in the Genus database with same CATH homology
 1FNW A;  1MHX A;  1IGD A;  3O13 A;  5BMG A;  3J9C A;  1ZXI A;  1D5X C;  5G5H A;  4CQN A;  1KH0 A;  2MH7 A;  1TKG A;  5FK9 C;  3U2S C;  1TJE A;  3TEZ A;  5FKA C;  3P4S B;  1SXT A;  4A55 A;  4DXG A;  1F2R C;  4ZHP A;  1QOB A;  4R3D A;  3B9J A;  1N60 A;  2V4I B;  1PGX A;  2LHE A;  3VRA B;  2PW9 A;  1D5Z C;  4YTP B;  3Q8F A;  3AE9 B;  3AM9 A;  1CZP A;  4WUR A;  1GPX A;  3NVZ A;  1VZ8 A;  1T5X D;  1N62 A;  3AE1 B;  2IDY A;  4HJG E;  4KGR A;  2RDG A;  1FFU A;  2H89 B;  3I9V 1;  1HXY D;  1MI0 A;  2Y5P A;  3NZ3 A;  2KAJ A;  2KDM A;  3BVM A;  1I4P A;  1AN8 A;  2G1E A;  3Q8C A;  1UUP A;  1FIQ A;  4A6Q A;  4M0W A;  2CJN A;  4L23 A;  2R61 A;  5EE0 A;  3E9S A;  2N9L A;  4YT0 B;  4C80 A;  4XDC A;  2BBC A;  3U7Z A;  4JWS C;  1DOY A;  1FD6 A;  3FIL A;  2W3R A;  5BYR A;  2QIE B;  5AUI A;  1K50 A;  1CJE A;  2AQ1 B;  2E3T A;  1DOI A;  1OQQ A;  1OQR A;  1M4V A;  4LLG M;  1JWA D;  2Q5W D;  1KF6 B;  2ZW0 A;  5HFY A;  4YWG G;  1FFV A;  2CU3 A;  2DYO A;  2W3S A;  2PVG C;  4P6V F;  2NTS A;  3PZ8 A;  3ZJV A;  1C4P A;  1LO5 D;  3TEX A;  1RFK A;  1SE2 A;  1IBX A;  4KX6 B;  4MM3 B;  5H8Y E;  5MPO A;  2PIA A;  4XWT A;  3BWU D;  2LEK A;  1QQR A;  3P4Q B;  3LB8 C;  4MT5 A;  2WXQ A;  4A8X C;  1TS3 A;  4DXF A;  2RDH A;  3ZYY X;  3P4R B;  4OW0 A;  1L6U A;  5BYS A;  1EM7 A;  2L1A A;  2M56 B;  3Q8B A;  1YN4 A;  1L4Z B;  1BXT A;  1GOZ A;  3SR6 A;  1SSN A;  2W55 A;  1FRR A;  1C9F A;  1D4B A;  1SE4 A;  1YNT E;  3AEA B;  4OZA A;  4YTN B;  4DQO C;  1IUE A;  4GLS C;  1JQ4 A;  2DLB A;  3SEB A;  2QMT A;  3NUH B;  1HQR D;  1J7A A;  3BYY B;  3URY A;  1B1Z A;  1KFY B;  2KQ4 X;  2ON8 A;  1JW9 D;  1XLN A;  2Y3A A;  4LTU A;  1JWU D;  3P4P B;  2LGI A;  2SAK A;  4IDI A;  5D7G A;  3VRB B;  1SJH D;  2JSV X;  2KN4 A;  3ABV B;  3IXS A;  1V8C A;  1IGC A;  3T3N A;  1FXA A;  2VZK B;  1WWT A;  4RNA A;  2QSD A;  1WYG A;  1V1O A;  3FIL B;  1XLQ A;  3B2F A;  1FCL A;  1ET6 A;  1SIJ A;  4REZ A;  4TSS A;  1JWM D;  1QOF A;  2TSS A;  2WXP A;  3ETR A;  1RWS A;  1XCT L;  1E6E B;  1A70 A;  1JWS D;  2DWQ A;  2ZW1 A;  4RGN A;  3GS2 A;  2WDQ B;  2V3N A;  4J3O D;  3NVW A;  1J7C A;  4HRO A;  4ZOH C;  4NJC A;  1QOA A;  2FUG 1;  3IT4 B;  1IBX B;  3NS1 A;  2JYT A;  2OHF A;  2WDV B;  2KAC A;  4P16 A;  1EU3 A;  3AEB B;  3AB5 A;  1UWX A;  3BVZ A;  1VDV A;  3AE5 B;  2MEK A;  2JYE A;  2K9X A;  1N63 A;  2DYM A;  2PMV A;  4AS1 A;  4N6E B;  1ZDX A;  4A90 A;  1I4G A;  2GI9 A;  1UNS A;  2WXR A;  1B9R A;  3Q8E A;  4RCO A;  4ZHO A;  1CK1 A;  1GB4 A;  1N5X A;  3IAM 1;  2HDE A;  4JE3 B;  2N9K A;  5E6J A;  1P7E A;  1PFD A;  2WXM A;  1N5W A;  3R2I A;  2CJO A;  4B0E A;  2PVO D;  4L2Y A;  2BT6 A;  4JWU C;  1VRA B;  1D5M C;  3AMZ A;  3LXF A;  5D3D A;  5HI1 A;  2VZK D;  4H2A A;  3GB1 A;  1FNV A;  1K51 A;  2YEP B;  1C76 A;  1AWD A;  2JXT A;  2WNM A;  2WXL A;  1I4H A;  4YSY B;  2GRI A;  1D6E C;  2JWU A;  3AE3 B;  3HRD D;  4RGO S;  2NMQ A;  1L0Y B;  1L4D B;  3KWL A;  2M19 A;  4C7Z A;  1YQ4 B;  4NAM A;  1FM0 D;  1HA5 A;  5BYQ A;  1I4R A;  3I57 A;  3C8Y A;  3EGR A;  1JRO A;  1I7H A;  1ZP0 B;  1QLB B;  3AE4 B;  1ZE3 D;  3Q69 A;  3AN1 A;  2AX5 A;  1KLG D;  1SE3 A;  2D5G A;  2QIL A;  2LUM A;  3NVV A;  4JPS A;  1VZ6 A;  4YXD B;  1VLB A;  3U4E G;  3W9C B;  1F2R I;  4ARC A;  1JAL A;  3FC4 A;  2W82 A;  3SFD B;  4A9A A;  2V0G A;  4ZRP A;  1SJE D;  1DYQ A;  2BB6 A;  4GDL B;  2OED A;  2K5P A;  2L52 A;  1ET9 A;  2AQ2 B;  3MFG A;  4WQM A;  1NVI D;  1L0X B;  2RMM A;  2INN E;  2BB5 A;  3AE6 B;  1XEE A;  2KMM A;  3WCQ A;  2I38 A;  1ROE A;  1ZDV A;  4KGT A;  3AE7 B;  1L6V A;  3CIR B;  4WWM A;  5HHD G;  5FR3 A;  3ZJT A;  1YN5 A;  1TYG B;  1WRI A;  1YN3 A;  1R7S A;  1TKY A;  3P1M A;  3RPF C;  2L83 A;  1HZ6 A;  1PDX A;  1QKZ A;  2NTT A;  3Q8A A;  3VR8 B;  5C2T B;  2ACZ B;  3AE2 B;  1FMA D;  1I4X A;  3V05 A;  2XN9 C;  4IKG A;  4C7Y A;  1TY0 A;  4XE0 A;  2V3P A;  3E56 A;  5I4D A;  1V97 A;  1RYJ A;  3L4P A;  2DBY A;  1XO3 A;  1K52 A;  3MJ5 A;  5EE9 A;  5HG2 A;  1XLO A;  2N0S B;  2WXI A;  4RF0 A;  1VJK A;  3B2G A;  4YSX B;  1EWC A;  2JQR B;  1FRD A;  5LNK 1;  1ESF A;  1BML C;  1TS2 A;  2IGG A;  1ACC A;  1C79 A;  2LMC A;  2Z8L A;  5C3J B;  1Y56 A;  2LHD A;  1SBB B;  2AQ3 B;  4RFB A;  3FAH A;  1XXG A;  4ZRQ A;  2SEB D;  2GB1 A;  3V3X A;  3N9Y C;  3AEE B;  1F0Z A;  3DWG C;  4NAW B;  2INP E;  1TY2 A;  3EA6 A;  5GXG B;  1ZOY B;  1PGB A;  1XLP A;  3R8B A;  1K53 A;  3VR9 B;  5BMI A;  1N61 A;  3MC0 B;  1NI3 A;  1UWM A;  1QF6 A;  2WXH A;  3PZ7 A;  2KWD A;  3ZJU A;  2WXN A;  4WH4 A;  2K22 A;  1NYQ A;  1ZXH A;  3NVY A;  2JZP A;  5TSS A;  4ITK A;  1SB3 C;  2WXG A;  3AEC B;  4OHJ A;  4RH6 A;  3BK1 A;  2WXF A;  2WP9 B;  1WGK A;  4N59 A;  1ZPS A;  2MJD A;  4RF1 A;  2JU6 X;  4C56 C;  4WIP A;  3HVD A;  2J42 A;  2WDR B;  1EWY C;  1MPE A;  4Q2J A;  3R2T A;  2H88 B;  2J52 A;  1PUT A;  2WXJ A;  2ICI A;  4RGT A;  1NYR A;  3MHZ A;  4JX1 C;  1QT9 A;  1EU4 A;  2MJE A;  2WU2 B;  4ZYS A;  1TS5 A;  3EUB 2;  3W2D A;  4OZB A;  1YJI A;  3VQI A;  4HEA 1;  4B0M A;  3KQ4 A;  3OWE B;  2WLB A;  1FXI A;  1F77 A;  2W54 A;  1OFF A;  1ZUD 2;  1UGJ A;  3H8H A;  1AW7 A;  2N7J A;  2X38 A;  2WXO A;  2BW2 A;  1C78 A;  1JCK B;  3ZQ4 A;  1J7B A;  4LK0 M;  1VZ7 A;  1FCC C;  3U52 E;  4RGM A;  3SFE B;  1FEH A;  2E6X A;  4PT5 A;  3BII D;  3BK2 A;  3BZD B;  2Y5C A;  5AUK A;  3KWV A;  5H92 C;  2WXK A;  2XNA C;  4FXC A;  3GP7 A;  4YTM B;  4N58 A;  4KGS A;  2J53 A;  2IPK D;  1TZO A;  3HUI A;  3AV8 A;  4TQ1 A;  4US9 A;  1V1P A;  3IAS 1;  1SF0 A;  2QEJ C;  2K3U A;  4KKJ A;  4D2K A;  1T3Q A;  1KRH A;  3AE8 B;  3W5V B;  1QIL A;  4AQ7 A;  1GB1 A;  1KTK A;  4TMA B;  3AEF B;  1FNU A;  4GDK B;  1CQV A;  1RM6 C;  3UI3 A;  1T6B X;  2M0A A;  2PLP A;  1DGJ A;  5EE1 A;  1YJJ A;  3HVZ A;  1JML A;  4HKQ A;  1L0V B;  3TEY A;  2BS4 B;  2J4X A;  3PO0 A;  3ZGZ A;  5EE3 A;  1NEN B;  1TS4 A;  4EE2 A;  4WAF A;  1AYF A;  4KKI A;  2G9H D;  3BVG A;  2I2Y A;  2PTL A;  2WS3 B;  1XCQ L;  2WU5 B;  1PYW D;  2YEP F;  3P63 A;  1FO4 A;  2MJ3 A;  1L5P A;  3AED B;  4MAC A;  5JXV A;  5T8I A;  5BMH A;  4US8 A;  2BYT A;  3NRZ A;  1WSP A;  1XF5 L;  4NZL B;  2EEL A;  3IT6 B;  2WQY B;  4USA A;  4L1B A;  4HRS A;  3DWM A;  2RPV A;  1E9M A;  4OVZ A;  3AEG B;  3TSS A;  3MP9 A;  1C4C A;  3RFZ B;  1BUI C;  1DOX A;  2IGH A;  1VR9 A;  2FE8 A;  4O1N A;  1YMH E;  2QJL A;  1JWB D;  3KLS X;  4XWW A;  2PKO A;  1STE A;  3LYY A;  5D3I B;  4XDD A;  2BS3 B;  2HTM E;  1E10 A;  4TQ0 A;  1MHH E;  4MH8 A;  1YQ3 B;  3TUO A;  1I4Q A;  1V1P B;  3W1S A;  4HKZ E;  1NEK B;  3TEW A;  1E0Z A;  3P42 A;  1C4A A;  2LJI A;  1TKE A;  2B76 B;  2EKI A;  1E7P B;  3BYT B;  1PGA A;  3W5U B;  4UDU C;  4OZC A;  1QOG A;  4YSZ B;  2BS2 B;  1GAQ B;  1WXQ A;  2FBW B;  4IOI E;  5G5G A;  1Q10 A;  1HZ5 A;  2IJ0 A;  1ENF A;  2K0P A;  2L32 A;  4ARI A;  3T3O A;  1P7F A;  1JRP A;  1C77 A;  1MVK A;  2BTE A;  2IGD A;  1HEZ E;  2LFI A;  3AH7 A;  3CWI A;  1SEB D;  2JX5 A;  2ONQ A;  1KLU D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...