1WWTA

Solution structure of the tgs domain from human threonyl-trna synthetase
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
88
structure length
88
Chain Sequence
GSSGSSGDSKPIKVTLPDGKQVDAESWKTTPYQIACGISQGLADNTVIAKVNNVVWDLDRPLEEDCTLELLKFEDEEAQAVYSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the TGS domain from human threonyl-tRNA synthetase
rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords Threonyl-tRNA synthetase, cytoplasmic
total genus 11
structure length 88
sequence length 88
ec nomenclature ec 6.1.1.3: Threonine--tRNA ligase.
pdb deposition date 2005-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02824 TGS TGS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1wwtA01
3AE5B 2MH7A 1AYFA 2QIEB 4WWMA 1KFYB 1XLPA 1RWSA 3AECB 3NS1A 3SFDB 2BS2B 3AEAB 2DBYA 1DGJA 3AEFB 4IDIA 2DWQA 1L5PA 1ZXIA 2JQRB 1E7PB 1WYGA 2ACZB 1XLQA 1YQ3B 3AE3B 3DWGC 4KX6B 5EE9A 5H8YE 5H92C 3P1MA 1N61A 2K5PA 3WCQA 1DOYA 1JWBD 4JWUC 3ZYYX 1FXIA 3L4PA 1A70A 1RFKA 4YTPB 2W3RA 4YSXB 1VDVA 3LB8C 1YQ4B 3AE8B 3P4RB 1TKEA 1OQRA 5C2TB 1GAQB 1V8CA 3VR8B 2WP9B 2WQYB 2WU5B 1CZPA 3ETRA 1WRIA 2HTME 1JROA 3W9CB 3DWMA 1FIQA 1TJEA 2W3SA 5EE0A 2H88B 4US8A 2W54A 1R7SA 1N5WA 1FM0D 3CWIA 1ZUD2 4HROA 1QOBA 3VRAB 1QLBB 2B76B 4N58A 5GXGB 4JX1C 2JX5A 1FRDA 1N5XA 1WXQA 1TYGB 2FBWB 3AE2B 1DOIA 3HUIA 3W5VB 1NYRA 3P63A 4ZHOA 3AB5A 2PIAA 3NRZA 1WWTA 2K9XA 3KWLA 1RYJA 1JALA 1FXAA 3NVYA 2M56B 1N63A 1FFUA 1TKGA 3AEGB 3CIRB 1SF0A 1L0VB 2Y5CA 3B2GA 1JRPA 1NVID 1T3QA 3VR9B 1AWDA 1SB3C 3P4PB 4ZOHC 1QOGA 4YXDB 1E6EB 4HRSA 1N60A 2K22A 2WDVB 5C3JB 3RPFC 1IUEA 5AUKA 2CJOA 1VJKA 1PDXA 2EKIA 3HRDD 2Q5WD 3NVWA 3P4SB 1QT9A 4N59A 4P6VF 5EE3A 4A9AA 1DOXA 1GPXA 1XO3A 2WDRB 1J7CA 3AH7A 2N0SB 1V97A 4ZHPA 4C7YA 1OFFA 1JWAD 1CJEA 3ABVB 3BIID 3NVVA 1KRHA 2QJLA 4C80A 1JQ4A 2PKOA 2WDQB 5G5HA 2BS4B 2G1EA 2H89B 4WQMA 2PVGC 1L6UA 3AN1A 1B9RA 4US9A 2M19A 3EUB2 1ZP0B 3P4QB 2LEKA 1WGKA 1QOAA 2WLBA 3NVZA 4C7ZA 1NEKB 2KMMA 3AMZA 4FXCA 1QF6A 1E0ZA 1FMAD 2CU3A 5G5GA 1I7HA 2MJEA 5EE1A 1EWYC 2L52A 3AEEB 3AEBB 1NENB 2PVOD 3FAHA 2KAJA 1F0ZA 1PUTA 2E3TA 3HVZA 1ROEA 1OQQA 3AEDB 1J7BA 4YTMB 5AUIA 3VRBB 1SIJA 1FO4A 1JW9D 3B2FA 4LTUA 1QOFA 1E10A 3AV8A 1J7AA 1YJJA 2MJDA 3SFEB 3AE9B 1UWMA 1RM6C 1NI3A 3B9JA 1PFDA 4YT0B 1FRRA 3PO0A 1L6VA 1YJIA 3AM9A 3AE6B 1NYQA 2W55A 4USAA 3LXFA 3AE7B 4YTNB 1E9MA 4YSZB 5MPOA 4JWSC 1KF6B 3SR6A 1VLBA 2OHFA 1XLOA 1FFVA 2BT6A 3FC4A 4N6EB 2AX5A 1XLNA 2L83A 2MJ3A 2BS3B 3AE1B 1ZOYB 2WS3B 4ITKA 2WU2B 2CJNA 3AE4B 3W5UB 1TKYA 1N62A 4YSYB
chains in the Genus database with same CATH superfamily
1D3ZA 4M8NA 1TS3A 2G3QB 2DLBA 3V60A 3AEAB 1IBXA 4PT5A 2KFKA 4XE0A 4GLSC 3SU8X 2AWTA 2XN9C 3Q8CA 2V3NA 2BWFA 3U7DA 2R2QA 3MP9A 2KC1A 1CZPA 3AU5A 4F8CB 4JGHB 5BYRA 2HE7A 1C3TA 4B95A 4WWPA 2PMVA 1WXQA 3PVLA 3GE3C 2KDMA 4LNFA 4KGTA 4YL8A 1NBFC 1T3QA 3P4PB 4YXDB 3R7RA 1WRDB 3MHSD 4GDKB 5C3JB 4N59A 2MP2B 1WF9A 2PKOA 3IHPC 2BS4B 1PYWD 2DAFA 3ZDMC 3B1LX 1T0SC 1C1YB 3NG0A 2C5LC 2FCQA 3ZVVA 3UF8A 3PRPB 2E3TA 1P7FA 2REXA 3HVZA 1SE3A 4IWOA 1KTKA 3ZLZA 3U7ZA 1J7AA 2MJDA 3ZQ4A 3C0RB 4YT0B 2JPHA 3AE6B 2IJ0A 3RMKC 3LXFA 1Q0WB 1Q10A 3U2SC 2KLCA 2EELA 3DVNV 4IM3A 1I4QA 4GOCA 1AYFA 3IT6B 4TQ1A 1M94A 3NS1A 1XT9B 3TEXA 1F2RC 4QAYA 4HLEA 4HPPA 5G55A 2JQRB 1WJ4A 3U30A 2IZVB 3Q8BA 5H8YE 2I2YA 4A8XC 3PTFC 2J4XA 2X8XX 4S0RA 2KTFA 4ZYNA 4TSSA 4XDDA 1V8CA 3E56A 2LGYA 1FIQA 2AL3A 3IAS1 1R7SA 2BPSA 2NCNA 3C8YA 3VTWA 3L08A 4ZHOA 4AJWA 3VUYA 2JYTA 4W9JA 1YQBA 4EKUA 2IY1B 4K81A 4DQOC 1XQQA 2HJ1A 2LVPA 2IY0B 1BT0A 4LNNA 5T8IA 2WXFA 1N60A 1YNTE 2M4NA 3HRDD 3ZRFA 1GPXA 2G4SA 4E71A 1ZW7A 2KVRA 4A9AA 4ACFA 1XCTL 4ZHPA 2FCSA 4ZRJA 2K8HA 3CF6E 1WMHA 4BKSD 2C7HA 3PSEB 1ET6A 1MHHE 4P1CC 2HTHA 4ARIA 1MFWA 1I42A 2XNAC 2ZNVB 4GU2A 4PS7A 4FBJB 1MPEA 2KMAA 1P1AA 4HK2A 2RSUA 2IO3B 3AEDB 1EU4A 1PGBA 5DPSA 4DK5A 4EUTA 2PEAA 2Y5BB 2B3AA 1L0XB 2MLBA 3KYCD 3NOBA 4FHKA 3AM9A 2K3UA 1TY0A 2MBOA 3R7QA 1VLBA 1WX9A 1VCBA 1YMHE 2GI9A 1C78A 1MJDA 2TSSA 5IKCM 4AWJA 1ENFA 2L83A 2KYWA 2BS3B 4MACA 3BVGA 4YSYB 1T5XD 4RCOA 2XEWA 1XLPA 2BS2B 3Q6BA 2DBYA 1C76A 2Z8LA 2DWQA 4WWNA 2PE9A 1I4XA 3DVGY 2OOBB 5E6NA 1V5OA 2BGFA 4MT5A 1F2RI 3VQIA 3TEWA 3ZYYX 1E7VA 2GMIC 4JIOU 1P3QU 3W9CB 2LXCA 3EFUA 3DWMA 2ZVOA 3B08A 2BB6A 4A55A 2B76B 5DPWA 3GZNB 5BMHA 2MBEA 2V9HA 3APDA 4C56C 5AEKB 5JZEB 2WXPA 5GMVA 1RRBA 2J0KA 1MI0A 4JE3B 3AEGB 5AZHA 4FLHA 3HK0A 3PHWB 4PS3A 4DWFA 2KMCA 5C1ZA 4B9KA 3UIOB 3I57A 5BYSA 4L23A 3ZW3A 5AUKA 1D5MC 3NVWA 1VJKA 2DYBA 3ML8A 3QARA 4P6VF 5FKAC 2LWPA 4C80A 3PZDA 2CS4A 2KTRA 2XK5B 2NBWB 1TZ1A 4KZ0A 3W1SC 3NY5A 4A90A 1Y56A 2JVCA 1F0ZA 1UZXB 4BOZB 4FA6A 3UQAA 1OQQA 5AUIA 1SIJA 2KDIA 3Q8FA 4HKQA 2AL6A 3DHHC 4II3B 2ZCBA 1YJJA 1Q1OA 1HXYD 1L6VA 4ARCA 1I4PA 1HE8A 2OHFA 3MC8A 1TIFA 3OG5A 3U4EG 1KH0A 4N6EB 5D94A 3TIXA 2NR2A 4IM0A 4A3OA 2WU2B 1EUVB 4GDLB 1PQSA 2V0GA 4XYCA 4ANXA 3LJ3A 5DPTA 2Z0DB 3AEFB 4RNAA 1S1QB 3V05A 1WXAA 1ZPSA 4C00A 1MG4A 2KKCA 2K8BA 2VH1A 1D5XC 4NAWB 3N1XC 3DVGX 4CYEA 2Y3AA 2IBIB 3GE8C 1EWCA 1K51A 2JYEA 1N5XA 2JU6X 5HFYA 3I63C 4AP4C 2L00B 4W9EA 2O2VA 2XK5A 4MELA 3ZNGC 2NPTB 3TCAA 2JZPA 3PRZA 5L83A 2KJRA 4BKGA 3PPAA 2BKFA 2WXGA 3Q3NC 3APFA 3BINA 3ZTDA 2FUHB 4B0EA 4J6IA 1JQ4A 2QJLA 5D2MB 2IGHA 1AW7A 1HA5A 2QHOA 1UD7A 5EDSA 4CO7A 2I38A 5IOIA 1HEZE 2KDEB 1L7YA 1NEKB 1EWYC 2HD5B 2QCZA 3QA8A 1FCLA 1ZXHA 2BQQA 1SIFA 2INDC 1J7BA 3CSTA 3H9DA 3VVWB 1I4RA 1OTRB 3JSVA 4MM3B 2NBUA 3EA6A 1NI3A 2JZ3B 2PLPA 2QSDA 1PGXA 2LUEA 2KX0A 2INCC 2Z0EB 2J53A 2Y5PA 3GZNI 5J17A 2CJNA 5D3IB 2INNE 4NAWA 3AE5B 1WE7A 2DX5B 2KFKB 3NZSA 1V80A 2OEDA 4DBGA 4P16A 3AU4A 1UWXA 2YEPB 4B0MA 2J52A 4IW0A 3IFWB 3V6EB 1WJNA 3ZO5B 2W3SA 4WAFA 3BK1A 4JX1C 2I1JA 2JX5A 3VTVA 4GIVA 1DOIA 1JMLA 2PJHA 4MSMB 1FFUA 4GDKA 4KZCA 3KH0A 1AWDA 2SEBD 4W9GA 2O6VD 2MBQA 3C19A 3U52E 1PDXA 4IUMB 3BWUD 2KT7A 4C7YA 4AS1A 1A5RA 1BXTA 3MTNB 4LDTD 2G1EA 3OJ4B 4BBNC 3JSVB 1I4HA 2KVZA 3WAOA 4C7ZA 3Q3FA 5G2NA 3H1UA 3FAHA 2V4LA 3ZNZB 4KGRA 2M0XA 3TSSA 4YTMB 3VRBB 4G3XB 1WR6E 1UUPA 1E10A 4W9HA 4HJKA 1VD2A 2ZEQA 1UWMA 1HTQA 3I5JC 1YJIA 1F77A 4WJNA 1UGJA 4ITKA 5E6OA 4RGTA 4N9F4 2DENB 3HVDA 3OLMD 1GC7A 2N9KA 1ZXIA 3GS2A 1R4NI 1LO5D 4M0WA 3FKYA 5EE9A 2ACZB 3S2AA 2MBBB 3PV1A 4ANVA 1JWBD 3BY4B 2L1AA 2FCNA 4K7WA 1YQ4B 3EFCA 3P4RB 5C2TB 1CMXB 1OQRA 4D2KA 4KKIA 3QK0A 5D3DA 1R4MB 3ETRA 1JROA 1WGDA 4W9IA 4DHJB 3CWIA 3B0AA 4CHKA 4LLGM 2GBNA 3RULA 1TZOA 2LUMA 3HUIA 4IM2A 3EC8A 2JF5A 3H7PB 1ZE3D 1ZDVA 3HM3A 1UELA 3RNEC 3KWVA 1VRAB 2KXJA 2KHWB 4K7SA 1DYQA 3IXSA 2BWES 2WDVB 3BYYB 3M62B 4EZKA 1IBXB 2V3PA 3P4SB 1QT9A 3ALBA 3JVZX 1CQVA 3M95A 3ZTCA 4OVZA 3KVFB 3NVVA 5HHDG 2FIDA 2ZZPB 4CQNA 4GSWA 5E6PA 3IBEA 3I9V1 2PE6B 2J0MA 4WQMA 3OAWA 4RGNA 1LM8B 3EUB2 2WX0A 4ANUA 2L52A 3T3NA 1TTNA 1WFYA 2DAJA 1P7EA 3L16A 3NHEB 3V62A 2KQ4X 2LFIA 1YD8U 2LGIA 2KWDA 3QAQA 2YLMA 1UF0A 2CHXA 4HPLB 5D7GA 1YJ1A 1KF6B 4FJYA 3BYTB 3DVNU 2BKRB 4YWGG 2KNBA 1KLUD 3FC4A 2PW9A 1XLNA 4ICUA 2L0FA 3GOEA 2KANA 1WX7A 3T8MA 3FILA 3DHGC 1RLFA 3VUXA 1HQRD 1L5PA 1S3SG 4ASWC 1QQRA 4WJQA 1N61A 2FAZA 1ESFA 2MQJA 1TKEA 2MX2A 3I3TB 1J8CA 3MJWA 1FM0D 3RUIB 2AQ3B 1F1HA 1QOBA 1C9FA 1OQYA 2NS5A 2PPHA 4TKNA 5LLIA 2K1FA 2DZIA 2INPE 5AZGA 2RDBC 1XXGA 1TT5B 4RF1A 4MGIE 1RYJA 3WANA 1JALA 5C23A 2RPQA 1YN3A 2GRIA 3UINB 1LXDA 4HDQA 1FNUA 1L0VB 3PS6A 2WYQA 2GLSA 4NPNA 2CJOA 4BOSC 1XO3A 2KQSA 1CJEA 1XF5L 4MH8A 3TUOA 2RGFA 2M19A 2KQ7A 1YX6B 3DBLB 3Q8AA 3R3MA 2AQ1B 2JT4B 4TUUA 2O6VA 1E5WA 4JLCA 3QIJA 3ZRCA 2M17A 1R4NB 1JW9D 1QOFA 2KC2A 4XDCA 1FNVA 4URKA 2R61A 1RM6C 2WGSA 1FRRA 1FEHA 2W55A 3N20C 3FILB 1D4BA 1R4MI 3HHMA 2D3CA 4GB9A 1V49A 4HCNB 4G50A 2CHZA 1HZ6A 4MDKE 3L13A 4IC7B 2ASQA 2D10A 2W82A 4IDIA 1SE4A 1WGGA 2NVUI 1WYGA 3ML9A 3EHVA 3A9KB 3WCQA 1WH3A 4KIKB 4RM9A 3ZIMA 1VDVA 2DZKA 5LXIB 1V2YA 2QDFA 3VXWA 2IO1B 2EKEC 1P0RA 2JUOA 2ZNVC 4DXGA 1YOVB 1TYGB 3WAPA 2C60A 4F7ZA 3IT4B 3L54A 3P2BA 4NQKE 3CIRB 2R2OA 2DYMA 3B2GA 1JRPA 2WXRA 4HPMB 2BVCA 4HRSA 1SXTA 2L76A 1IUEA 2Q5WD 2O6VB 3AH7A 2N0SB 3SDLC 5G5HA 2H89B 5J18A 4ZDVA 4P7IA 3URYA 4FXCA 3OJ3A 5G5GA 3PREA 1D5ZC 1UBIA 2N1VA 2X38A 1EU3A 4I6NB 1T0QC 4W9LA 3VHTC 3VTUA 2D11A 3R66C 3E9SA 4LTUA 3ZXVA 4HCPB 1NYQA 2LHEA 3H7SA 1C4CA 4YSZB 2KX3A 1C4PA 2ZCCA 3QQ8B 1AN8A 2EMTA 1STEA 1V1OA 2AX5A 4OZAA 1EF5A 4WIPA 3ZXRA 1ZOYB 2MH7A 2QIEB 1KFYB 1T0YA 3A4SC 5JH5C 1HTOA 2L8JA 3DBRB 1G6JA 4AQ7A 1DOYA 3A1QA 1WMHB 4RGOS 4YSXB 3TMPB 1Z2MA 5J2RA 2ZPYA 1SE9A 1WXMA 1TJEA 5IA7A 4HEA1 5EE0A 1N5WA 2IGDA 4EEWA 5KHQA 2JXTA 2PIAA 3R2IA 4WAAA 3BK2A 2CR5A 1FXAA 1D6EC 5IP4D 1SF0A 2WX1A 4AJYB 3SEBA 3QJZA 4KSKC 2WXKA 3MC0B 5EE3A 3P42A 2WDRB 2UYZB 3AI5A 5E6JA 1KRHA 3RZWC 2PVGC 5BMIA 1L6UA 1ACCA 1ZP0B 4X57B 3ZJUA 1FMAD 2CU3A 2MJEA 4G11A 4K7UA 2PVOD 1LGRA 4ZRPA 2ICIA 4I6LB 2WXOA 2GBJA 1HZ5A 1KOTA 3KQ4A 3PO0A 1E8ZA 1BUIC 1RAXA 1E9MA 2N9PC 2D3AA 3HIZA 1FFVA 3QX1A 2LJIA 4MGYE 2N7EA 1EM7A 2VZKB 1YX5B 3A1QB 2IDYA 4ICVA 1TKYA 3W1SA 2LJ5A 4TV3A 2PTLA 2CU1A 2WXMA 3RN9C 2WHIA 4NY0A 3ECIA 3VH4B 1ZKHA 2BYVE 1XLQA 2N9XA 3P1MA 3PZ7A 2KLGA 4FHJA 1FXIA 1A70A 3ZUNA 2LI5A 2IPKD 1YIWA 3WA0A 1ISNA 1JRUA 5LXHA 1WRIA 4LNKA 2KO3A 5CHVC 1KM7A 2L3ZA 2SAKA 4HROA 3H7PA 1Y8RC 5TR5A 1K8RB 1V1PB 4WH4A 2JRIB 4IOIE 3N3KB 5CTRC 4IG7B 4RMAA 2LVQA 3A9JB 1C77A 1QOGA 4PYUA 4BKTA 1T6BX 2MWSB 3KW5B 1NI2A 3HM6X 1TS5A 2JSVX 2V4IB 1J7CA 1GC6A 1V97A 3BVZA 2D07B 2M0AA 2BB5A 1XEEA 1GB4A 3T9LA 2QILA 2D2QA 2KOXA 4US9A 3GB1A 1TY2A 3SD5A 4KSLC 4TQ0A 1WGKA 2C7NB 1QOAA 5EE1A 4MJSA 1NENB 2KWCA 2RPVA 2NBVB 2KJ6A 4KDLB 4C4VB 4OHJA 2KACA 3B9JA 1N6ZA 4I6PA 2BYEA 2D5GA 2LMCA 4JPSA 4RGMA 1XLOA 2JRHA 2N9EB 3DCGA 3WIMA 4PYZA 4MH0E 2NPTA 3Q2AC 4FJVB 1H8CA 3OWEB 3SFDB 2KJHB 2KDBA 2WXHA 3EECA 3RNBC 4HVBA 4P1BC 1I35A 5IO9A 4FJZA 3A9JA 1WX8A 3DWGC 1WR1A 1XCQL 4JWUC 4JQWC 2LGSA 2BYFA 4YTPB 1C79A 4M00A 2K25A 4DHJD 1JWMD 2ZW0A 4MEMA 4US8A 2C9WB 2H88B 2W54A 2RR9A 1SBBB 5JHAA 1FRDA 4KGSA 1NYRA 3N30A 3NRZA 4LJOB 3CMMB 4WJOA 2ZJDA 4MM3A 1TKGA 2RDHA 3BVMA 1GNUA 3DQVA 3VR9B 3O13A 3KYDD 2FUG1 4C4VA 2JWUA 3RI7C 1DOXA 1TS2A 5JHBA 4DHZB 1WXVA 5L95C 4L2YA 1WZ3A 3BIID 4OZBA 3DBSA 3L0WB 3AN1A 1WYWB 3JW0X 4M8MA 2LEKA 2WXJA 3Q3MC 1E0ZA 2E6XA 1M4VA 1SJED 2MEKA 3AEEB 3R8BA 2WWZA 4W9FA 4FN2A 2K8CA 1TBEA 4W9KA 5I4DA 4HXDA 1OEYA 4II2B 5BMGA 1C4AA 2LHDA 4USAA 4F1SA 1WJ6A 3UI3A 2FNJB 3AE4B 2ONQA 4BVUC 2L05A 3V6CB 4LK0M 3QHTA 4GDLA 4H2AA 2GBMA 2Z59B 4ANWA 5JXVA 1WY8A 3AXCA 1WI0A 3UQBA 1WJUA 3VR8B 3QWZB 1JWUD 2MBHA 3RNAC 2VRRB 3Q14C 2V3SA 4E74A 2D3BA 4IWPA 1V6EA 3W5VB 2LD9A 3MHZA 1J0GA 1FNWA 4ZYSA 4EFOA 4DHZE 1F52A 4DXAB 3NVYA 4XX5A 1CK1A 2KDFB 2NTSA 3K9PB 2J7QB 1GUAB 2XBBC 1EO6A 3DDCB 2OJWA 4RH6A 2JWZA 3GP7A 4L1BA 4AUQC 1BMLC 1JWAD 2IYDB 3DBRI 3IG3A 2WDQB 1UGMA 3VUWA 5BYQA 2JY6A 4Q2JA 3NVZA 2KMMA 2HDEA 2MP2A 3DHIC 1QKZA 4REZA 3PLVA 2A5UA 5HI1A 2ZPNA 3B2FA 2WXLA 1WGRA 3AV8A 2BW2A 1K53A 3PLUA 1L4DB 1E7UA 4BKSA 4O1NA 1SE2A 1IGDA 3D32A 4GGQA 4UDUC 4MGKE 4RFBA 4W9DA 1UNSA 2GBKA 1V5TA 2MJ3A 3A9KA 1FXTB 2WS3B 5TSSA 2VZKD 1N62A 3AECB 3KUZA 1U4AA 1DGJA 2RMMA 3RNGC 3SHQA 3PRMB 1GG3A 1E7PB 2N7JA 3AE3B 4KX6B 4EZJA 3R2TA 1IPGA 3WALA 5CHFA 4B6WA 4LJPB 3ZJTA 4MSQB 2N9LA 3U8ZA 4M01A 2WP9B 3A4RA 1GJZA 2HTME 2J42A 2YEPF 1GB1A 5IN7A 4R3DA 1ZUD2 2LZ6A 3ZDTA 4GMVA 1ET9A 1OEYJ 3P63A 2ZVNA 3T3OA 1ZDXA 4K1RB 2K9XA 2AYOB 3KWLA 2KN5A 2M56B 2RDGA 1WGHA 3LYYA 5D6JB 1WGYA 2QC8A 2BBCA 1JWSD 3KUDB 4ZOHC 3W2DA 2L32A 1K50A 3RPFC 4E3CA 4XWWA 2CHWA 4NJCA 1P98A 2IGGA 1GOZA 1WM2A 4PS8A 1MHXA 4NJ7A 4KV2A 5AZFA 3QCAA 3MC9A 3WAMA 3AMZA 3M63B 4ZRQA 2D3GA 3J9CA 2MSED 3NUHB 4NZLB 2ZW1A 2I1KA 3ZKJC 2LXAA 3AE9B 1K52A 4ZRIA 3X0WA 4XGAB 1L4ZB 3AE7B 5HKHA 4FULA 2FCMA 3SR6A 1X1MA 2L7RA 3AE1B 3RNCC 4DDID 1KJTA 1L2NA 1UBQA 2BF8B 2G4DB 3V61A 1VZ8A 3PT2B 5IAAC 5H92C 1H4RA 2EMSA 3K9OB 1IYFA 4ZRKA 3X23A 5HG2A 3L4PA 1RFKA 4W9CA 3LB8C 1B1ZA 1OGWA 3AE8B 1QILA 2DYOA 2J0JA 2RD0A 1YN4A 4A6QA 2WQYB 3W1YA 3DBHB 4S17A 1JCKB 1QLBB 4N58A 1RFAA 4NNJB 3N1YC 3ONSA 3AE2B 2OJRA 3PGEA 1V9JA 2KN4A 2WXNA 2WNMA 4LNOA 4A20A 1LFDA 4HWIB 1J19A 2YVCA 4RF0A 2KD0A 2K6DB 2LRWA 3EGRA 2KK8A 1E6EB 1ZGUB 3L17A 1E8XA 5DCNA 2K22A 4WJPA 2LASA 1MG8A 3ZNID 4OVUA 5CHWA 1WXSA 1EF1A 1FD6A 3IAM1 3UGBB 3ABVB 1FPYA 2DHZA 4NAMA 4OZCA 1B9RA 4MJSB 2MRPA 2UWQA 5FR6A 2KWUB 2N7DA 2WLBA 3UIPB 3NZUA 1QF6A 1I7HA 2A4ZA 3AEBB 4MGZE 4KIKA 3DBLI 2ON8A 2GOWA 2L0TA 5KHOA 5DPRA 3TJPA 4HDOA 4WQOB 2DNFA 3TEZA 3A33B 3MFGA 4DXFA 1VZ7A 3PZ8A 5BO4B 1P9DU 2BT6A 3NS8A 3Q8EA 3N9YC 1E8WA 2FIFA 1WM3A 3V3XA 3ZJVA 4WWMA 4A3PA 4EE2A 1TGZB 2KFJA 3JYUA 2K6QA 1YQ3B 2K5PA 1VZ6A 2LRUA 3LDZE 5FK9C 1VR9A 3H6NA 2BYTA 4XZ4A 3NZ3A 2WU5B 4K3CA 3DPDA 4KVGB 2FE8A 1V81A 1V86A 3VRAB 5GXGB 4IKGA 4PK1A 3AB5A 1WWTA 3Q3JA 1Q5WB 3RFZB 1N63A 2JXXA 4NQLB 3ZGZA 1NVID 1WSPA 1SB3C 3IVFA 5FR3A 1NDDA 1E8YA 2M8SA 3CSFA 1UH6A 4LNIA 2MA9B 2MHJA 2DZJA 3P4QB 2KTRB 5CX3A 4BFRA 4FADA 2GBRA 1PUTA 3H8HA 1ROEA 2NTTA 4OW0A 2WXQA 1FO4A 2KZRA 4XWTA 3SFEB 3N32A 2KWVB 1PFDA 4DDGD 1YN5A 4J3OD 4YTNB 1QZEA 3VAWA 5MPOA 1WIAA 1LQBA 4NJ6A 2AEHA 2WXIA 3M3JA 4RM8A 2QMTA 4EOYA 3W5UB 1XD3B 2GB1A 2QEJC 1F9JA 1RWSA 1SSNA 2HJ8A 4TMAB 4G0NB 4OVVA 1SJHD 4EZLA 2JZZA 5LNK1 1SEBD 2IO2B 1TS4A 4KDIC 3QC8B 2W3RA 1GAQB 2UU7A 2N1WA 2LGXA 3RD2A 3NJTA 3TBLD 2NMQA 4M02A 3O65B 2FBWB 3RZFA 3RNFC 1AARA 1Z5SB 4AOFA 3VH3B 2LVOA 4BAXA 3TEYA 4K3BA 2Y5CA 2G45B 4IWQA 3RT3B 2WDTB 3ZNHB 1MVKA 2O2VB 1I4GA 1SGHA 3APCA 1FCCC 2N4FA 3RCZA 4HKZE 2EKIA 3MJ5A 4HJGE 3N1ZC 3DOWA 1WZ0A 3BZDB 3ENEA 4GXBA 1OFFA 2V1YA 4KKJA 2K39A 4LDTB 2MCNB 4WWOA 3L10B 4M0WB 2G9HD 3AULA 2BTEA 2KAJA 2IO0B 4WURA 1E90A 4BZAA 1L0YB 3KUCB 4LCDE 4GN1A 3RYTA 3VDZA 2M1MA 2AQ2B 2VH2A 1IGCA 4JL9A 1KLVA 1WE6A 3TL5A 4XC2A 2C7MB 3VFKA 3Q69A 2K0PA 4JWSC 1KLGD 3Q3OC 2CKHB 1T0RC 2LGDA 1V1PA 2MW5A 2W9NA 3PHXB 3KLSX 4BBNF 1IP9A 3DBHI 2DZMA 1PGAA
chains in the Genus database with same CATH topology
3AE5B 2MH7A 1TS3A 2QIEB 1KFYB 2DLBA 3AECB 3AEAB 1IBXA 1DGJA 2OEDA 4PT5A 2RMMA 1E7PB 4XE0A 2N7JA 3AE3B 4KX6B 4GLSC 3R2TA 4AQ7A 1DOYA 4P16A 2XN9C 3Q8CA 1UWXA 2V3NA 2YEPB 4RGOS 4B0MA 2J52A 4YSXB 3ZJTA 2N9LA 3MP9A 2WP9B 1CZPA 2HTME 2J42A 1TJEA 2W3SA 4HEA1 2YEPF 5EE0A 1GB1A 1N5WA 4R3DA 5BYRA 4WAFA 1ZUD2 2IGDA 3BK1A 4JX1C 2JX5A 2PMVA 1WXQA 1DOIA 1ET9A 2JXTA 3P63A 3T3OA 1JMLA 2PIAA 1ZDXA 2KDMA 3R2IA 2K9XA 3KWLA 3BK2A 4KGTA 1FXAA 2M56B 1FFUA 1D6EC 2RDGA 1SF0A 3LYYA 3SEBA 1T3QA 2BBCA 1JWSD 1AWDA 2SEBD 3P4PB 4ZOHC 3W2DA 2L32A 4YXDB 4GDKB 1K50A 5C3JB 3RPFC 4XWWA 3U52E 4NJCA 2WXKA 1PDXA 3MC0B 4N59A 5EE3A 3P42A 2WDRB 3BWUD 5E6JA 4C7YA 4AS1A 2IGGA 1BXTA 1GOZA 1MHXA 1KRHA 2PKOA 2BS4B 2G1EA 1PYWD 2PVGC 5BMIA 1L6UA 1I4HA 1ACCA 1ZP0B 3ZJUA 4C7ZA 3AMZA 1FMAD 2CU3A 4ZRQA 2MJEA 3FAHA 2PVOD 2E3TA 1P7FA 4KGRA 3HVZA 4ZRPA 3TSSA 3J9CA 1SE3A 2ICIA 2WXOA 4YTMB 3VRBB 1KTKA 1HZ5A 3NUHB 4NZLB 1UUPA 2ZW1A 3U7ZA 1E10A 1J7AA 2MJDA 3AE9B 1UWMA 3ZQ4A 3KQ4A 1K52A 4YT0B 3PO0A 1YJIA 3AE6B 2IJ0A 1L4ZB 1BUIC 3LXFA 3AE7B 1E9MA 1F77A 1Q10A 3SR6A 3U2SC 1FFVA 2LJIA 2EELA 1EM7A 1UGJA 2VZKB 3AE1B 2IDYA 4ITKA 1I4QA 1TKYA 3W1SA 2PTLA 1AYFA 3IT6B 4TQ1A 3NS1A 4RGTA 1VZ8A 3HVDA 2WXMA 3TEXA 1F2RC 2N9KA 1ZXIA 2JQRB 3GS2A 1LO5D 4M0WA 5EE9A 2ACZB 1XLQA 3Q8BA 5H8YE 5H92C 2I2YA 3P1MA 3PZ7A 4A8XC 5HG2A 2J4XA 1JWBD 1FXIA 2L1AA 1A70A 3L4PA 1RFKA 2IPKD 3LB8C 1B1ZA 1YQ4B 3AE8B 3P4RB 5C2TB 1OQRA 1QILA 4TSSA 2DYOA 4KKIA 4XDDA 4D2KA 1V8CA 5D3DA 1YN4A 3E56A 2WQYB 3ETRA 4A6QA 1WRIA 1JROA 1FIQA 3IAS1 1R7SA 3CWIA 1JCKB 2SAKA 4HROA 4LLGM 1QLBB 4N58A 3C8YA 1TZOA 2LUMA 3AE2B 3HUIA 1N62A 4ZHOA 2KN4A 2JYTA 2WXNA 1V1PB 2WNMA 4WH4A 1ZE3D 4IOIE 1ZDVA 4DQOC 3KWVA 4RF0A 1VRAB 3EGRA 1C77A 5T8IA 1QOGA 1E6EB 1DYQA 2WXFA 1N60A 1T6BX 1YNTE 3IXSA 2K22A 2WDVB 3BYYB 1IBXB 3HRDD 2V3PA 3P4SB 1QT9A 1GPXA 1CQVA 1TS5A 2JSVX 4A9AA 2V4IB 1J7CA 1FD6A 4OVZA 1XCTL 3IAM1 1V97A 3BVZA 4ZHPA 2M0AA 2BB5A 1XEEA 3ABVB 3NVVA 5HHDG 1GB4A 4CQNA 3I9V1 4WQMA 1ET6A 2QILA 4NAMA 1MHHE 4OZCA 4ARIA 4US9A 3GB1A 1TY2A 4TQ0A 4RGNA 3EUB2 1B9RA 1WGKA 1QOAA 2WLBA 2XNAC 1QF6A 1I7HA 5EE1A 1MPEA 2L52A 3AEBB 1NENB 3T3NA 1P7EA 2ON8A 2RPVA 3AEDB 1EU4A 1PGBA 2KQ4X 2LFIA 4OHJA 2LGIA 2KWDA 1L0XB 2KACA 3B9JA 3AM9A 3TEZA 3MFGA 2D5GA 4DXFA 1VZ7A 3PZ8A 2K3UA 5D7GA 1TY0A 2LMCA 1KF6B 4JPSA 4RGMA 1VLBA 1XLOA 3BYTB 4YWGG 2BT6A 1YMHE 1KLUD 2GI9A 1C78A 3FC4A 2TSSA 2PW9A 1ENFA 3Q8EA 1XLNA 2L83A 3N9YC 2BS3B 4MACA 3BVGA 4YSYB 3V3XA 3ZJVA 1T5XD 4RCOA 4WWMA 3OWEB 1XLPA 3SFDB 4EE2A 2BS2B 3FILA 2DBYA 2WXHA 1C76A 2Z8LA 2DWQA 1HQRD 1L5PA 1I4XA 1YQ3B 1QQRA 3DWGC 1N61A 2K5PA 4MT5A 1VZ6A 1F2RI 3VQIA 1XCQL 4JWUC 3TEWA 3ZYYX 4YTPB 1ESFA 1C79A 5FK9C 1TKEA 1VR9A 2BYTA 3NZ3A 2WU5B 3W9CB 1JWMD 3DWMA 2ZW0A 2FE8A 4US8A 2H88B 2W54A 1FM0D 2BB6A 4A55A 1SBBB 2AQ3B 1QOBA 1C9FA 3VRAB 2B76B 5GXGB 4IKGA 5BMHA 1FRDA 4KGSA 2INPE 1NYRA 4C56C 3AB5A 3NRZA 1XXGA 1WWTA 2WXPA 4RF1A 1RYJA 1JALA 3RFZB 1MI0A 1YN3A 1N63A 1TKGA 2GRIA 3AEGB 4JE3B 2RDHA 1FNUA 1L0VB 3BVMA 3VR9B 1NVID 3ZGZA 1WSPA 1SB3C 3O13A 3I57A 2FUG1 5BYSA 2JWUA 4L23A 5FR3A 5AUKA 1D5MC 2CJOA 1VJKA 3NVWA 4P6VF 1DOXA 1TS2A 1XO3A 4L2YA 5FKAC 1CJEA 3BIID 4OZBA 4C80A 1XF5L 4MH8A 3TUOA 3AN1A 2M19A 3P4QB 2LEKA 2WXJA 1E0ZA 2E6XA 1M4VA 1SJED 3Q8AA 2AQ1B 2MEKA 4A90A 3AEEB 3R8BA 1Y56A 1F0ZA 1PUTA 3H8HA 1ROEA 1OQQA 2NTTA 4OW0A 5AUIA 5I4DA 1SIJA 2WXQA 1FO4A 3Q8FA 1JW9D 1QOFA 4XDCA 4HKQA 1FNVA 4XWTA 1YJJA 2R61A 3SFEB 1HXYD 1RM6C 1PFDA 1FRRA 5BMGA 1C4AA 1L6VA 1FEHA 1YN5A 2LHDA 2W55A 4USAA 1I4PA 4ARCA 4J3OD 3FILB 1D4BA 4YTNB 5MPOA 2OHFA 3UI3A 3U4EG 1KH0A 2WXIA 4N6EB 2QMTA 1HZ6A 2WU2B 3W5UB 3AE4B 2ONQA 2GB1A 2QEJC 4GDLB 2V0GA 2W82A 1RWSA 1SSNA 4TMAB 3AEFB 4IDIA 1SE4A 1SJHD 4LK0M 4RNAA 4H2AA 5LNK1 1WYGA 1SEBD 3V05A 5JXVA 1ZPSA 3WCQA 1TS4A 2W3RA 1VDVA 1D5XC 4NAWB 1GAQB 3VR8B 1JWUD 2Y3AA 1EWCA 1K51A 2NMQA 4DXGA 2JYEA 1TYGB 1N5XA 2JU6X 3W5VB 2FBWB 3MHZA 5HFYA 3IT4B 1FNWA 4ZYSA 3NVYA 3CIRB 1CK1A 3TEYA 2NTSA 2DYMA 2Y5CA 3B2GA 1JRPA 2WXRA 2JZPA 1MVKA 4HRSA 4RH6A 1SXTA 1I4GA 1IUEA 1FCCC 2WXGA 4HKZE 2EKIA 3MJ5A 2Q5WD 4HJGE 3AH7A 4B0EA 2N0SB 3BZDB 3GP7A 4L1BA 1BMLC 1OFFA 1JWAD 1JQ4A 2QJLA 2IGHA 1AW7A 1HA5A 2WDQB 4KKJA 5G5HA 2H89B 5BYQA 4Q2JA 2I38A 1HEZE 3URYA 3NVZA 1NEKB 2KMMA 4FXCA 5G5GA 2HDEA 1EWYC 2G9HD 1D5ZC 1FCLA 2BTEA 2KAJA 2X38A 1ZXHA 4WURA 1EU3A 1QKZA 4REZA 1J7BA 1L0YB 5HI1A 3E9SA 3B2FA 4LTUA 1I4RA 2WXLA 3AV8A 2BW2A 1K53A 2AQ2B 1L4DB 3EA6A 4MM3B 1NI3A 2PLPA 2QSDA 1IGCA 1PGXA 4O1NA 1SE2A 1NYQA 2LHEA 1C4CA 1IGDA 4YSZB 3Q69A 2K0PA 4JWSC 1C4PA 1KLGD 1AN8A 4UDUC 1V1PA 1STEA 2J53A 4RFBA 1V1OA 2AX5A 4OZAA 1UNSA 2MJ3A 4WIPA 2Y5PA 3KLSX 1ZOYB 2WS3B 5TSSA 2CJNA 2VZKD 5D3IB 2INNE 1PGAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AE5 B;  2MH7 A;  1AYF A;  2QIE B;  4WWM A;  1KFY B;  1XLP A;  1RWS A;  3AEC B;  3NS1 A;  3SFD B;  2BS2 B;  3AEA B;  2DBY A;  1DGJ A;  3AEF B;  4IDI A;  2DWQ A;  1L5P A;  1ZXI A;  2JQR B;  1E7P B;  1WYG A;  2ACZ B;  1XLQ A;  1YQ3 B;  3AE3 B;  3DWG C;  4KX6 B;  5EE9 A;  5H8Y E;  5H92 C;  3P1M A;  1N61 A;  2K5P A;  3WCQ A;  1DOY A;  1JWB D;  4JWU C;  3ZYY X;  1FXI A;  3L4P A;  1A70 A;  1RFK A;  4YTP B;  2W3R A;  4YSX B;  1VDV A;  3LB8 C;  1YQ4 B;  3AE8 B;  3P4R B;  1TKE A;  1OQR A;  5C2T B;  1GAQ B;  1V8C A;  3VR8 B;  2WP9 B;  2WQY B;  2WU5 B;  1CZP A;  3ETR A;  1WRI A;  2HTM E;  1JRO A;  3W9C B;  3DWM A;  1FIQ A;  1TJE A;  2W3S A;  5EE0 A;  2H88 B;  4US8 A;  2W54 A;  1R7S A;  1N5W A;  1FM0 D;  3CWI A;  1ZUD 2;  4HRO A;  1QOB A;  3VRA B;  1QLB B;  2B76 B;  4N58 A;  5GXG B;  4JX1 C;  2JX5 A;  1FRD A;  1N5X A;  1WXQ A;  1TYG B;  2FBW B;  3AE2 B;  1DOI A;  3HUI A;  3W5V B;  1NYR A;  3P63 A;  4ZHO A;  3AB5 A;  2PIA A;  3NRZ A;  1WWT A;  2K9X A;  3KWL A;  1RYJ A;  1JAL A;  1FXA A;  3NVY A;  2M56 B;  1N63 A;  1FFU A;  1TKG A;  3AEG B;  3CIR B;  1SF0 A;  1L0V B;  2Y5C A;  3B2G A;  1JRP A;  1NVI D;  1T3Q A;  3VR9 B;  1AWD A;  1SB3 C;  3P4P B;  4ZOH C;  1QOG A;  4YXD B;  1E6E B;  4HRS A;  1N60 A;  2K22 A;  2WDV B;  5C3J B;  3RPF C;  1IUE A;  5AUK A;  2CJO A;  1VJK A;  1PDX A;  2EKI A;  3HRD D;  2Q5W D;  3NVW A;  3P4S B;  1QT9 A;  4N59 A;  4P6V F;  5EE3 A;  4A9A A;  1DOX A;  1GPX A;  1XO3 A;  2WDR B;  1J7C A;  3AH7 A;  2N0S B;  1V97 A;  4ZHP A;  4C7Y A;  1OFF A;  1JWA D;  1CJE A;  3ABV B;  3BII D;  3NVV A;  1KRH A;  2QJL A;  4C80 A;  1JQ4 A;  2PKO A;  2WDQ B;  5G5H A;  2BS4 B;  2G1E A;  2H89 B;  4WQM A;  2PVG C;  1L6U A;  3AN1 A;  1B9R A;  4US9 A;  2M19 A;  3EUB 2;  1ZP0 B;  3P4Q B;  2LEK A;  1WGK A;  1QOA A;  2WLB A;  3NVZ A;  4C7Z A;  1NEK B;  2KMM A;  3AMZ A;  4FXC A;  1QF6 A;  1E0Z A;  1FMA D;  2CU3 A;  5G5G A;  1I7H A;  2MJE A;  5EE1 A;  1EWY C;  2L52 A;  3AEE B;  3AEB B;  1NEN B;  2PVO D;  3FAH A;  2KAJ A;  1F0Z A;  1PUT A;  2E3T A;  3HVZ A;  1ROE A;  1OQQ A;  3AED B;  1J7B A;  4YTM B;  5AUI A;  3VRB B;  1SIJ A;  1FO4 A;  1JW9 D;  3B2F A;  4LTU A;  1QOF A;  1E10 A;  3AV8 A;  1J7A A;  1YJJ A;  2MJD A;  3SFE B;  3AE9 B;  1UWM A;  1RM6 C;  1NI3 A;  3B9J A;  1PFD A;  4YT0 B;  1FRR A;  3PO0 A;  1L6V A;  1YJI A;  3AM9 A;  3AE6 B;  1NYQ A;  2W55 A;  4USA A;  3LXF A;  3AE7 B;  4YTN B;  1E9M A;  4YSZ B;  5MPO A;  4JWS C;  1KF6 B;  3SR6 A;  1VLB A;  2OHF A;  1XLO A;  1FFV A;  2BT6 A;  3FC4 A;  4N6E B;  2AX5 A;  1XLN A;  2L83 A;  2MJ3 A;  2BS3 B;  3AE1 B;  1ZOY B;  2WS3 B;  4ITK A;  2WU2 B;  2CJN A;  3AE4 B;  3W5U B;  1TKY A;  1N62 A;  4YSY B; 
#chains in the Genus database with same CATH topology
 1D3Z A;  4M8N A;  1TS3 A;  2G3Q B;  2DLB A;  3V60 A;  3AEA B;  1IBX A;  4PT5 A;  2KFK A;  4XE0 A;  4GLS C;  3SU8 X;  2AWT A;  2XN9 C;  3Q8C A;  2V3N A;  2BWF A;  3U7D A;  2R2Q A;  3MP9 A;  2KC1 A;  1CZP A;  3AU5 A;  4F8C B;  4JGH B;  5BYR A;  2HE7 A;  1C3T A;  4B95 A;  4WWP A;  2PMV A;  1WXQ A;  3PVL A;  3GE3 C;  2KDM A;  4LNF A;  4KGT A;  4YL8 A;  1NBF C;  1T3Q A;  3P4P B;  4YXD B;  3R7R A;  1WRD B;  3MHS D;  4GDK B;  5C3J B;  4N59 A;  2MP2 B;  1WF9 A;  2PKO A;  3IHP C;  2BS4 B;  1PYW D;  2DAF A;  3ZDM C;  3B1L X;  1T0S C;  1C1Y B;  3NG0 A;  2C5L C;  2FCQ A;  3ZVV A;  3UF8 A;  3PRP B;  2E3T A;  1P7F A;  2REX A;  3HVZ A;  1SE3 A;  4IWO A;  1KTK A;  3ZLZ A;  3U7Z A;  1J7A A;  2MJD A;  3ZQ4 A;  3C0R B;  4YT0 B;  2JPH A;  3AE6 B;  2IJ0 A;  3RMK C;  3LXF A;  1Q0W B;  1Q10 A;  3U2S C;  2KLC A;  2EEL A;  3DVN V;  4IM3 A;  1I4Q A;  4GOC A;  1AYF A;  3IT6 B;  4TQ1 A;  1M94 A;  3NS1 A;  1XT9 B;  3TEX A;  1F2R C;  4QAY A;  4HLE A;  4HPP A;  5G55 A;  2JQR B;  1WJ4 A;  3U30 A;  2IZV B;  3Q8B A;  5H8Y E;  2I2Y A;  4A8X C;  3PTF C;  2J4X A;  2X8X X;  4S0R A;  2KTF A;  4ZYN A;  4TSS A;  4XDD A;  1V8C A;  3E56 A;  2LGY A;  1FIQ A;  2AL3 A;  3IAS 1;  1R7S A;  2BPS A;  2NCN A;  3C8Y A;  3VTW A;  3L08 A;  4ZHO A;  4AJW A;  3VUY A;  2JYT A;  4W9J A;  1YQB A;  4EKU A;  2IY1 B;  4K81 A;  4DQO C;  1XQQ A;  2HJ1 A;  2LVP A;  2IY0 B;  1BT0 A;  4LNN A;  5T8I A;  2WXF A;  1N60 A;  1YNT E;  2M4N A;  3HRD D;  3ZRF A;  1GPX A;  2G4S A;  4E71 A;  1ZW7 A;  2KVR A;  4A9A A;  4ACF A;  1XCT L;  4ZHP A;  2FCS A;  4ZRJ A;  2K8H A;  3CF6 E;  1WMH A;  4BKS D;  2C7H A;  3PSE B;  1ET6 A;  1MHH E;  4P1C C;  2HTH A;  4ARI A;  1MFW A;  1I42 A;  2XNA C;  2ZNV B;  4GU2 A;  4PS7 A;  4FBJ B;  1MPE A;  2KMA A;  1P1A A;  4HK2 A;  2RSU A;  2IO3 B;  3AED B;  1EU4 A;  1PGB A;  5DPS A;  4DK5 A;  4EUT A;  2PEA A;  2Y5B B;  2B3A A;  1L0X B;  2MLB A;  3KYC D;  3NOB A;  4FHK A;  3AM9 A;  2K3U A;  1TY0 A;  2MBO A;  3R7Q A;  1VLB A;  1WX9 A;  1VCB A;  1YMH E;  2GI9 A;  1C78 A;  1MJD A;  2TSS A;  5IKC M;  4AWJ A;  1ENF A;  2L83 A;  2KYW A;  2BS3 B;  4MAC A;  3BVG A;  4YSY B;  1T5X D;  4RCO A;  2XEW A;  1XLP A;  2BS2 B;  3Q6B A;  2DBY A;  1C76 A;  2Z8L A;  2DWQ A;  4WWN A;  2PE9 A;  1I4X A;  3DVG Y;  2OOB B;  5E6N A;  1V5O A;  2BGF A;  4MT5 A;  1F2R I;  3VQI A;  3TEW A;  3ZYY X;  1E7V A;  2GMI C;  4JIO U;  1P3Q U;  3W9C B;  2LXC A;  3EFU A;  3DWM A;  2ZVO A;  3B08 A;  2BB6 A;  4A55 A;  2B76 B;  5DPW A;  3GZN B;  5BMH A;  2MBE A;  2V9H A;  3APD A;  4C56 C;  5AEK B;  5JZE B;  2WXP A;  5GMV A;  1RRB A;  2J0K A;  1MI0 A;  4JE3 B;  3AEG B;  5AZH A;  4FLH A;  3HK0 A;  3PHW B;  4PS3 A;  4DWF A;  2KMC A;  5C1Z A;  4B9K A;  3UIO B;  3I57 A;  5BYS A;  4L23 A;  3ZW3 A;  5AUK A;  1D5M C;  3NVW A;  1VJK A;  2DYB A;  3ML8 A;  3QAR A;  4P6V F;  5FKA C;  2LWP A;  4C80 A;  3PZD A;  2CS4 A;  2KTR A;  2XK5 B;  2NBW B;  1TZ1 A;  4KZ0 A;  3W1S C;  3NY5 A;  4A90 A;  1Y56 A;  2JVC A;  1F0Z A;  1UZX B;  4BOZ B;  4FA6 A;  3UQA A;  1OQQ A;  5AUI A;  1SIJ A;  2KDI A;  3Q8F A;  4HKQ A;  2AL6 A;  3DHH C;  4II3 B;  2ZCB A;  1YJJ A;  1Q1O A;  1HXY D;  1L6V A;  4ARC A;  1I4P A;  1HE8 A;  2OHF A;  3MC8 A;  1TIF A;  3OG5 A;  3U4E G;  1KH0 A;  4N6E B;  5D94 A;  3TIX A;  2NR2 A;  4IM0 A;  4A3O A;  2WU2 B;  1EUV B;  4GDL B;  1PQS A;  2V0G A;  4XYC A;  4ANX A;  3LJ3 A;  5DPT A;  2Z0D B;  3AEF B;  4RNA A;  1S1Q B;  3V05 A;  1WXA A;  1ZPS A;  4C00 A;  1MG4 A;  2KKC A;  2K8B A;  2VH1 A;  1D5X C;  4NAW B;  3N1X C;  3DVG X;  4CYE A;  2Y3A A;  2IBI B;  3GE8 C;  1EWC A;  1K51 A;  2JYE A;  1N5X A;  2JU6 X;  5HFY A;  3I63 C;  4AP4 C;  2L00 B;  4W9E A;  2O2V A;  2XK5 A;  4MEL A;  3ZNG C;  2NPT B;  3TCA A;  2JZP A;  3PRZ A;  5L83 A;  2KJR A;  4BKG A;  3PPA A;  2BKF A;  2WXG A;  3Q3N C;  3APF A;  3BIN A;  3ZTD A;  2FUH B;  4B0E A;  4J6I A;  1JQ4 A;  2QJL A;  5D2M B;  2IGH A;  1AW7 A;  1HA5 A;  2QHO A;  1UD7 A;  5EDS A;  4CO7 A;  2I38 A;  5IOI A;  1HEZ E;  2KDE B;  1L7Y A;  1NEK B;  1EWY C;  2HD5 B;  2QCZ A;  3QA8 A;  1FCL A;  1ZXH A;  2BQQ A;  1SIF A;  2IND C;  1J7B A;  3CST A;  3H9D A;  3VVW B;  1I4R A;  1OTR B;  3JSV A;  4MM3 B;  2NBU A;  3EA6 A;  1NI3 A;  2JZ3 B;  2PLP A;  2QSD A;  1PGX A;  2LUE A;  2KX0 A;  2INC C;  2Z0E B;  2J53 A;  2Y5P A;  3GZN I;  5J17 A;  2CJN A;  5D3I B;  2INN E;  4NAW A;  3AE5 B;  1WE7 A;  2DX5 B;  2KFK B;  3NZS A;  1V80 A;  2OED A;  4DBG A;  4P16 A;  3AU4 A;  1UWX A;  2YEP B;  4B0M A;  2J52 A;  4IW0 A;  3IFW B;  3V6E B;  1WJN A;  3ZO5 B;  2W3S A;  4WAF A;  3BK1 A;  4JX1 C;  2I1J A;  2JX5 A;  3VTV A;  4GIV A;  1DOI A;  1JML A;  2PJH A;  4MSM B;  1FFU A;  4GDK A;  4KZC A;  3KH0 A;  1AWD A;  2SEB D;  4W9G A;  2O6V D;  2MBQ A;  3C19 A;  3U52 E;  1PDX A;  4IUM B;  3BWU D;  2KT7 A;  4C7Y A;  4AS1 A;  1A5R A;  1BXT A;  3MTN B;  4LDT D;  2G1E A;  3OJ4 B;  4BBN C;  3JSV B;  1I4H A;  2KVZ A;  3WAO A;  4C7Z A;  3Q3F A;  5G2N A;  3H1U A;  3FAH A;  2V4L A;  3ZNZ B;  4KGR A;  2M0X A;  3TSS A;  4YTM B;  3VRB B;  4G3X B;  1WR6 E;  1UUP A;  1E10 A;  4W9H A;  4HJK A;  1VD2 A;  2ZEQ A;  1UWM A;  1HTQ A;  3I5J C;  1YJI A;  1F77 A;  4WJN A;  1UGJ A;  4ITK A;  5E6O A;  4RGT A;  4N9F 4;  2DEN B;  3HVD A;  3OLM D;  1GC7 A;  2N9K A;  1ZXI A;  3GS2 A;  1R4N I;  1LO5 D;  4M0W A;  3FKY A;  5EE9 A;  2ACZ B;  3S2A A;  2MBB B;  3PV1 A;  4ANV A;  1JWB D;  3BY4 B;  2L1A A;  2FCN A;  4K7W A;  1YQ4 B;  3EFC A;  3P4R B;  5C2T B;  1CMX B;  1OQR A;  4D2K A;  4KKI A;  3QK0 A;  5D3D A;  1R4M B;  3ETR A;  1JRO A;  1WGD A;  4W9I A;  4DHJ B;  3CWI A;  3B0A A;  4CHK A;  4LLG M;  2GBN A;  3RUL A;  1TZO A;  2LUM A;  3HUI A;  4IM2 A;  3EC8 A;  2JF5 A;  3H7P B;  1ZE3 D;  1ZDV A;  3HM3 A;  1UEL A;  3RNE C;  3KWV A;  1VRA B;  2KXJ A;  2KHW B;  4K7S A;  1DYQ A;  3IXS A;  2BWE S;  2WDV B;  3BYY B;  3M62 B;  4EZK A;  1IBX B;  2V3P A;  3P4S B;  1QT9 A;  3ALB A;  3JVZ X;  1CQV A;  3M95 A;  3ZTC A;  4OVZ A;  3KVF B;  3NVV A;  5HHD G;  2FID A;  2ZZP B;  4CQN A;  4GSW A;  5E6P A;  3IBE A;  3I9V 1;  2PE6 B;  2J0M A;  4WQM A;  3OAW A;  4RGN A;  1LM8 B;  3EUB 2;  2WX0 A;  4ANU A;  2L52 A;  3T3N A;  1TTN A;  1WFY A;  2DAJ A;  1P7E A;  3L16 A;  3NHE B;  3V62 A;  2KQ4 X;  2LFI A;  1YD8 U;  2LGI A;  2KWD A;  3QAQ A;  2YLM A;  1UF0 A;  2CHX A;  4HPL B;  5D7G A;  1YJ1 A;  1KF6 B;  4FJY A;  3BYT B;  3DVN U;  2BKR B;  4YWG G;  2KNB A;  1KLU D;  3FC4 A;  2PW9 A;  1XLN A;  4ICU A;  2L0F A;  3GOE A;  2KAN A;  1WX7 A;  3T8M A;  3FIL A;  3DHG C;  1RLF A;  3VUX A;  1HQR D;  1L5P A;  1S3S G;  4ASW C;  1QQR A;  4WJQ A;  1N61 A;  2FAZ A;  1ESF A;  2MQJ A;  1TKE A;  2MX2 A;  3I3T B;  1J8C A;  3MJW A;  1FM0 D;  3RUI B;  2AQ3 B;  1F1H A;  1QOB A;  1C9F A;  1OQY A;  2NS5 A;  2PPH A;  4TKN A;  5LLI A;  2K1F A;  2DZI A;  2INP E;  5AZG A;  2RDB C;  1XXG A;  1TT5 B;  4RF1 A;  4MGI E;  1RYJ A;  3WAN A;  1JAL A;  5C23 A;  2RPQ A;  1YN3 A;  2GRI A;  3UIN B;  1LXD A;  4HDQ A;  1FNU A;  1L0V B;  3PS6 A;  2WYQ A;  2GLS A;  4NPN A;  2CJO A;  4BOS C;  1XO3 A;  2KQS A;  1CJE A;  1XF5 L;  4MH8 A;  3TUO A;  2RGF A;  2M19 A;  2KQ7 A;  1YX6 B;  3DBL B;  3Q8A A;  3R3M A;  2AQ1 B;  2JT4 B;  4TUU A;  2O6V A;  1E5W A;  4JLC A;  3QIJ A;  3ZRC A;  2M17 A;  1R4N B;  1JW9 D;  1QOF A;  2KC2 A;  4XDC A;  1FNV A;  4URK A;  2R61 A;  1RM6 C;  2WGS A;  1FRR A;  1FEH A;  2W55 A;  3N20 C;  3FIL B;  1D4B A;  1R4M I;  3HHM A;  2D3C A;  4GB9 A;  1V49 A;  4HCN B;  4G50 A;  2CHZ A;  1HZ6 A;  4MDK E;  3L13 A;  4IC7 B;  2ASQ A;  2D10 A;  2W82 A;  4IDI A;  1SE4 A;  1WGG A;  2NVU I;  1WYG A;  3ML9 A;  3EHV A;  3A9K B;  3WCQ A;  1WH3 A;  4KIK B;  4RM9 A;  3ZIM A;  1VDV A;  2DZK A;  5LXI B;  1V2Y A;  2QDF A;  3VXW A;  2IO1 B;  2EKE C;  1P0R A;  2JUO A;  2ZNV C;  4DXG A;  1YOV B;  1TYG B;  3WAP A;  2C60 A;  4F7Z A;  3IT4 B;  3L54 A;  3P2B A;  4NQK E;  3CIR B;  2R2O A;  2DYM A;  3B2G A;  1JRP A;  2WXR A;  4HPM B;  2BVC A;  4HRS A;  1SXT A;  2L76 A;  1IUE A;  2Q5W D;  2O6V B;  3AH7 A;  2N0S B;  3SDL C;  5G5H A;  2H89 B;  5J18 A;  4ZDV A;  4P7I A;  3URY A;  4FXC A;  3OJ3 A;  5G5G A;  3PRE A;  1D5Z C;  1UBI A;  2N1V A;  2X38 A;  1EU3 A;  4I6N B;  1T0Q C;  4W9L A;  3VHT C;  3VTU A;  2D11 A;  3R66 C;  3E9S A;  4LTU A;  3ZXV A;  4HCP B;  1NYQ A;  2LHE A;  3H7S A;  1C4C A;  4YSZ B;  2KX3 A;  1C4P A;  2ZCC A;  3QQ8 B;  1AN8 A;  2EMT A;  1STE A;  1V1O A;  2AX5 A;  4OZA A;  1EF5 A;  4WIP A;  3ZXR A;  1ZOY B;  2MH7 A;  2QIE B;  1KFY B;  1T0Y A;  3A4S C;  5JH5 C;  1HTO A;  2L8J A;  3DBR B;  1G6J A;  4AQ7 A;  1DOY A;  3A1Q A;  1WMH B;  4RGO S;  4YSX B;  3TMP B;  1Z2M A;  5J2R A;  2ZPY A;  1SE9 A;  1WXM A;  1TJE A;  5IA7 A;  4HEA 1;  5EE0 A;  1N5W A;  2IGD A;  4EEW A;  5KHQ A;  2JXT A;  2PIA A;  3R2I A;  4WAA A;  3BK2 A;  2CR5 A;  1FXA A;  1D6E C;  5IP4 D;  1SF0 A;  2WX1 A;  4AJY B;  3SEB A;  3QJZ A;  4KSK C;  2WXK A;  3MC0 B;  5EE3 A;  3P42 A;  2WDR B;  2UYZ B;  3AI5 A;  5E6J A;  1KRH A;  3RZW C;  2PVG C;  5BMI A;  1L6U A;  1ACC A;  1ZP0 B;  4X57 B;  3ZJU A;  1FMA D;  2CU3 A;  2MJE A;  4G11 A;  4K7U A;  2PVO D;  1LGR A;  4ZRP A;  2ICI A;  4I6L B;  2WXO A;  2GBJ A;  1HZ5 A;  1KOT A;  3KQ4 A;  3PO0 A;  1E8Z A;  1BUI C;  1RAX A;  1E9M A;  2N9P C;  2D3A A;  3HIZ A;  1FFV A;  3QX1 A;  2LJI A;  4MGY E;  2N7E A;  1EM7 A;  2VZK B;  1YX5 B;  3A1Q B;  2IDY A;  4ICV A;  1TKY A;  3W1S A;  2LJ5 A;  4TV3 A;  2PTL A;  2CU1 A;  2WXM A;  3RN9 C;  2WHI A;  4NY0 A;  3ECI A;  3VH4 B;  1ZKH A;  2BYV E;  1XLQ A;  2N9X A;  3P1M A;  3PZ7 A;  2KLG A;  4FHJ A;  1FXI A;  1A70 A;  3ZUN A;  2LI5 A;  2IPK D;  1YIW A;  3WA0 A;  1ISN A;  1JRU A;  5LXH A;  1WRI A;  4LNK A;  2KO3 A;  5CHV C;  1KM7 A;  2L3Z A;  2SAK A;  4HRO A;  3H7P A;  1Y8R C;  5TR5 A;  1K8R B;  1V1P B;  4WH4 A;  2JRI B;  4IOI E;  3N3K B;  5CTR C;  4IG7 B;  4RMA A;  2LVQ A;  3A9J B;  1C77 A;  1QOG A;  4PYU A;  4BKT A;  1T6B X;  2MWS B;  3KW5 B;  1NI2 A;  3HM6 X;  1TS5 A;  2JSV X;  2V4I B;  1J7C A;  1GC6 A;  1V97 A;  3BVZ A;  2D07 B;  2M0A A;  2BB5 A;  1XEE A;  1GB4 A;  3T9L A;  2QIL A;  2D2Q A;  2KOX A;  4US9 A;  3GB1 A;  1TY2 A;  3SD5 A;  4KSL C;  4TQ0 A;  1WGK A;  2C7N B;  1QOA A;  5EE1 A;  4MJS A;  1NEN B;  2KWC A;  2RPV A;  2NBV B;  2KJ6 A;  4KDL B;  4C4V B;  4OHJ A;  2KAC A;  3B9J A;  1N6Z A;  4I6P A;  2BYE A;  2D5G A;  2LMC A;  4JPS A;  4RGM A;  1XLO A;  2JRH A;  2N9E B;  3DCG A;  3WIM A;  4PYZ A;  4MH0 E;  2NPT A;  3Q2A C;  4FJV B;  1H8C A;  3OWE B;  3SFD B;  2KJH B;  2KDB A;  2WXH A;  3EEC A;  3RNB C;  4HVB A;  4P1B C;  1I35 A;  5IO9 A;  4FJZ A;  3A9J A;  1WX8 A;  3DWG C;  1WR1 A;  1XCQ L;  4JWU C;  4JQW C;  2LGS A;  2BYF A;  4YTP B;  1C79 A;  4M00 A;  2K25 A;  4DHJ D;  1JWM D;  2ZW0 A;  4MEM A;  4US8 A;  2C9W B;  2H88 B;  2W54 A;  2RR9 A;  1SBB B;  5JHA A;  1FRD A;  4KGS A;  1NYR A;  3N30 A;  3NRZ A;  4LJO B;  3CMM B;  4WJO A;  2ZJD A;  4MM3 A;  1TKG A;  2RDH A;  3BVM A;  1GNU A;  3DQV A;  3VR9 B;  3O13 A;  3KYD D;  2FUG 1;  4C4V A;  2JWU A;  3RI7 C;  1DOX A;  1TS2 A;  5JHB A;  4DHZ B;  1WXV A;  5L95 C;  4L2Y A;  1WZ3 A;  3BII D;  4OZB A;  3DBS A;  3L0W B;  3AN1 A;  1WYW B;  3JW0 X;  4M8M A;  2LEK A;  2WXJ A;  3Q3M C;  1E0Z A;  2E6X A;  1M4V A;  1SJE D;  2MEK A;  3AEE B;  3R8B A;  2WWZ A;  4W9F A;  4FN2 A;  2K8C A;  1TBE A;  4W9K A;  5I4D A;  4HXD A;  1OEY A;  4II2 B;  5BMG A;  1C4A A;  2LHD A;  4USA A;  4F1S A;  1WJ6 A;  3UI3 A;  2FNJ B;  3AE4 B;  2ONQ A;  4BVU C;  2L05 A;  3V6C B;  4LK0 M;  3QHT A;  4GDL A;  4H2A A;  2GBM A;  2Z59 B;  4ANW A;  5JXV A;  1WY8 A;  3AXC A;  1WI0 A;  3UQB A;  1WJU A;  3VR8 B;  3QWZ B;  1JWU D;  2MBH A;  3RNA C;  2VRR B;  3Q14 C;  2V3S A;  4E74 A;  2D3B A;  4IWP A;  1V6E A;  3W5V B;  2LD9 A;  3MHZ A;  1J0G A;  1FNW A;  4ZYS A;  4EFO A;  4DHZ E;  1F52 A;  4DXA B;  3NVY A;  4XX5 A;  1CK1 A;  2KDF B;  2NTS A;  3K9P B;  2J7Q B;  1GUA B;  2XBB C;  1EO6 A;  3DDC B;  2OJW A;  4RH6 A;  2JWZ A;  3GP7 A;  4L1B A;  4AUQ C;  1BML C;  1JWA D;  2IYD B;  3DBR I;  3IG3 A;  2WDQ B;  1UGM A;  3VUW A;  5BYQ A;  2JY6 A;  4Q2J A;  3NVZ A;  2KMM A;  2HDE A;  2MP2 A;  3DHI C;  1QKZ A;  4REZ A;  3PLV A;  2A5U A;  5HI1 A;  2ZPN A;  3B2F A;  2WXL A;  1WGR A;  3AV8 A;  2BW2 A;  1K53 A;  3PLU A;  1L4D B;  1E7U A;  4BKS A;  4O1N A;  1SE2 A;  1IGD A;  3D32 A;  4GGQ A;  4UDU C;  4MGK E;  4RFB A;  4W9D A;  1UNS A;  2GBK A;  1V5T A;  2MJ3 A;  3A9K A;  1FXT B;  2WS3 B;  5TSS A;  2VZK D;  1N62 A;  3AEC B;  3KUZ A;  1U4A A;  1DGJ A;  2RMM A;  3RNG C;  3SHQ A;  3PRM B;  1GG3 A;  1E7P B;  2N7J A;  3AE3 B;  4KX6 B;  4EZJ A;  3R2T A;  1IPG A;  3WAL A;  5CHF A;  4B6W A;  4LJP B;  3ZJT A;  4MSQ B;  2N9L A;  3U8Z A;  4M01 A;  2WP9 B;  3A4R A;  1GJZ A;  2HTM E;  2J42 A;  2YEP F;  1GB1 A;  5IN7 A;  4R3D A;  1ZUD 2;  2LZ6 A;  3ZDT A;  4GMV A;  1ET9 A;  1OEY J;  3P63 A;  2ZVN A;  3T3O A;  1ZDX A;  4K1R B;  2K9X A;  2AYO B;  3KWL A;  2KN5 A;  2M56 B;  2RDG A;  1WGH A;  3LYY A;  5D6J B;  1WGY A;  2QC8 A;  2BBC A;  1JWS D;  3KUD B;  4ZOH C;  3W2D A;  2L32 A;  1K50 A;  3RPF C;  4E3C A;  4XWW A;  2CHW A;  4NJC A;  1P98 A;  2IGG A;  1GOZ A;  1WM2 A;  4PS8 A;  1MHX A;  4NJ7 A;  4KV2 A;  5AZF A;  3QCA A;  3MC9 A;  3WAM A;  3AMZ A;  3M63 B;  4ZRQ A;  2D3G A;  3J9C A;  2MSE D;  3NUH B;  4NZL B;  2ZW1 A;  2I1K A;  3ZKJ C;  2LXA A;  3AE9 B;  1K52 A;  4ZRI A;  3X0W A;  4XGA B;  1L4Z B;  3AE7 B;  5HKH A;  4FUL A;  2FCM A;  3SR6 A;  1X1M A;  2L7R A;  3AE1 B;  3RNC C;  4DDI D;  1KJT A;  1L2N A;  1UBQ A;  2BF8 B;  2G4D B;  3V61 A;  1VZ8 A;  3PT2 B;  5IAA C;  5H92 C;  1H4R A;  2EMS A;  3K9O B;  1IYF A;  4ZRK A;  3X23 A;  5HG2 A;  3L4P A;  1RFK A;  4W9C A;  3LB8 C;  1B1Z A;  1OGW A;  3AE8 B;  1QIL A;  2DYO A;  2J0J A;  2RD0 A;  1YN4 A;  4A6Q A;  2WQY B;  3W1Y A;  3DBH B;  4S17 A;  1JCK B;  1QLB B;  4N58 A;  1RFA A;  4NNJ B;  3N1Y C;  3ONS A;  3AE2 B;  2OJR A;  3PGE A;  1V9J A;  2KN4 A;  2WXN A;  2WNM A;  4LNO A;  4A20 A;  1LFD A;  4HWI B;  1J19 A;  2YVC A;  4RF0 A;  2KD0 A;  2K6D B;  2LRW A;  3EGR A;  2KK8 A;  1E6E B;  1ZGU B;  3L17 A;  1E8X A;  5DCN A;  2K22 A;  4WJP A;  2LAS A;  1MG8 A;  3ZNI D;  4OVU A;  5CHW A;  1WXS A;  1EF1 A;  1FD6 A;  3IAM 1;  3UGB B;  3ABV B;  1FPY A;  2DHZ A;  4NAM A;  4OZC A;  1B9R A;  4MJS B;  2MRP A;  2UWQ A;  5FR6 A;  2KWU B;  2N7D A;  2WLB A;  3UIP B;  3NZU A;  1QF6 A;  1I7H A;  2A4Z A;  3AEB B;  4MGZ E;  4KIK A;  3DBL I;  2ON8 A;  2GOW A;  2L0T A;  5KHO A;  5DPR A;  3TJP A;  4HDO A;  4WQO B;  2DNF A;  3TEZ A;  3A33 B;  3MFG A;  4DXF A;  1VZ7 A;  3PZ8 A;  5BO4 B;  1P9D U;  2BT6 A;  3NS8 A;  3Q8E A;  3N9Y C;  1E8W A;  2FIF A;  1WM3 A;  3V3X A;  3ZJV A;  4WWM A;  4A3P A;  4EE2 A;  1TGZ B;  2KFJ A;  3JYU A;  2K6Q A;  1YQ3 B;  2K5P A;  1VZ6 A;  2LRU A;  3LDZ E;  5FK9 C;  1VR9 A;  3H6N A;  2BYT A;  4XZ4 A;  3NZ3 A;  2WU5 B;  4K3C A;  3DPD A;  4KVG B;  2FE8 A;  1V81 A;  1V86 A;  3VRA B;  5GXG B;  4IKG A;  4PK1 A;  3AB5 A;  1WWT A;  3Q3J A;  1Q5W B;  3RFZ B;  1N63 A;  2JXX A;  4NQL B;  3ZGZ A;  1NVI D;  1WSP A;  1SB3 C;  3IVF A;  5FR3 A;  1NDD A;  1E8Y A;  2M8S A;  3CSF A;  1UH6 A;  4LNI A;  2MA9 B;  2MHJ A;  2DZJ A;  3P4Q B;  2KTR B;  5CX3 A;  4BFR A;  4FAD A;  2GBR A;  1PUT A;  3H8H A;  1ROE A;  2NTT A;  4OW0 A;  2WXQ A;  1FO4 A;  2KZR A;  4XWT A;  3SFE B;  3N32 A;  2KWV B;  1PFD A;  4DDG D;  1YN5 A;  4J3O D;  4YTN B;  1QZE A;  3VAW A;  5MPO A;  1WIA A;  1LQB A;  4NJ6 A;  2AEH A;  2WXI A;  3M3J A;  4RM8 A;  2QMT A;  4EOY A;  3W5U B;  1XD3 B;  2GB1 A;  2QEJ C;  1F9J A;  1RWS A;  1SSN A;  2HJ8 A;  4TMA B;  4G0N B;  4OVV A;  1SJH D;  4EZL A;  2JZZ A;  5LNK 1;  1SEB D;  2IO2 B;  1TS4 A;  4KDI C;  3QC8 B;  2W3R A;  1GAQ B;  2UU7 A;  2N1W A;  2LGX A;  3RD2 A;  3NJT A;  3TBL D;  2NMQ A;  4M02 A;  3O65 B;  2FBW B;  3RZF A;  3RNF C;  1AAR A;  1Z5S B;  4AOF A;  3VH3 B;  2LVO A;  4BAX A;  3TEY A;  4K3B A;  2Y5C A;  2G45 B;  4IWQ A;  3RT3 B;  2WDT B;  3ZNH B;  1MVK A;  2O2V B;  1I4G A;  1SGH A;  3APC A;  1FCC C;  2N4F A;  3RCZ A;  4HKZ E;  2EKI A;  3MJ5 A;  4HJG E;  3N1Z C;  3DOW A;  1WZ0 A;  3BZD B;  3ENE A;  4GXB A;  1OFF A;  2V1Y A;  4KKJ A;  2K39 A;  4LDT B;  2MCN B;  4WWO A;  3L10 B;  4M0W B;  2G9H D;  3AUL A;  2BTE A;  2KAJ A;  2IO0 B;  4WUR A;  1E90 A;  4BZA A;  1L0Y B;  3KUC B;  4LCD E;  4GN1 A;  3RYT A;  3VDZ A;  2M1M A;  2AQ2 B;  2VH2 A;  1IGC A;  4JL9 A;  1KLV A;  1WE6 A;  3TL5 A;  4XC2 A;  2C7M B;  3VFK A;  3Q69 A;  2K0P A;  4JWS C;  1KLG D;  3Q3O C;  2CKH B;  1T0R C;  2LGD A;  1V1P A;  2MW5 A;  2W9N A;  3PHX B;  3KLS X;  4BBN F;  1IP9 A;  3DBH I;  2DZM A;  1PGA A; 
#chains in the Genus database with same CATH homology
 3AE5 B;  2MH7 A;  1TS3 A;  2QIE B;  1KFY B;  2DLB A;  3AEC B;  3AEA B;  1IBX A;  1DGJ A;  2OED A;  4PT5 A;  2RMM A;  1E7P B;  4XE0 A;  2N7J A;  3AE3 B;  4KX6 B;  4GLS C;  3R2T A;  4AQ7 A;  1DOY A;  4P16 A;  2XN9 C;  3Q8C A;  1UWX A;  2V3N A;  2YEP B;  4RGO S;  4B0M A;  2J52 A;  4YSX B;  3ZJT A;  2N9L A;  3MP9 A;  2WP9 B;  1CZP A;  2HTM E;  2J42 A;  1TJE A;  2W3S A;  4HEA 1;  2YEP F;  5EE0 A;  1GB1 A;  1N5W A;  4R3D A;  5BYR A;  4WAF A;  1ZUD 2;  2IGD A;  3BK1 A;  4JX1 C;  2JX5 A;  2PMV A;  1WXQ A;  1DOI A;  1ET9 A;  2JXT A;  3P63 A;  3T3O A;  1JML A;  2PIA A;  1ZDX A;  2KDM A;  3R2I A;  2K9X A;  3KWL A;  3BK2 A;  4KGT A;  1FXA A;  2M56 B;  1FFU A;  1D6E C;  2RDG A;  1SF0 A;  3LYY A;  3SEB A;  1T3Q A;  2BBC A;  1JWS D;  1AWD A;  2SEB D;  3P4P B;  4ZOH C;  3W2D A;  2L32 A;  4YXD B;  4GDK B;  1K50 A;  5C3J B;  3RPF C;  4XWW A;  3U52 E;  4NJC A;  2WXK A;  1PDX A;  3MC0 B;  4N59 A;  5EE3 A;  3P42 A;  2WDR B;  3BWU D;  5E6J A;  4C7Y A;  4AS1 A;  2IGG A;  1BXT A;  1GOZ A;  1MHX A;  1KRH A;  2PKO A;  2BS4 B;  2G1E A;  1PYW D;  2PVG C;  5BMI A;  1L6U A;  1I4H A;  1ACC A;  1ZP0 B;  3ZJU A;  4C7Z A;  3AMZ A;  1FMA D;  2CU3 A;  4ZRQ A;  2MJE A;  3FAH A;  2PVO D;  2E3T A;  1P7F A;  4KGR A;  3HVZ A;  4ZRP A;  3TSS A;  3J9C A;  1SE3 A;  2ICI A;  2WXO A;  4YTM B;  3VRB B;  1KTK A;  1HZ5 A;  3NUH B;  4NZL B;  1UUP A;  2ZW1 A;  3U7Z A;  1E10 A;  1J7A A;  2MJD A;  3AE9 B;  1UWM A;  3ZQ4 A;  3KQ4 A;  1K52 A;  4YT0 B;  3PO0 A;  1YJI A;  3AE6 B;  2IJ0 A;  1L4Z B;  1BUI C;  3LXF A;  3AE7 B;  1E9M A;  1F77 A;  1Q10 A;  3SR6 A;  3U2S C;  1FFV A;  2LJI A;  2EEL A;  1EM7 A;  1UGJ A;  2VZK B;  3AE1 B;  2IDY A;  4ITK A;  1I4Q A;  1TKY A;  3W1S A;  2PTL A;  1AYF A;  3IT6 B;  4TQ1 A;  3NS1 A;  4RGT A;  1VZ8 A;  3HVD A;  2WXM A;  3TEX A;  1F2R C;  2N9K A;  1ZXI A;  2JQR B;  3GS2 A;  1LO5 D;  4M0W A;  5EE9 A;  2ACZ B;  1XLQ A;  3Q8B A;  5H8Y E;  5H92 C;  2I2Y A;  3P1M A;  3PZ7 A;  4A8X C;  5HG2 A;  2J4X A;  1JWB D;  1FXI A;  2L1A A;  1A70 A;  3L4P A;  1RFK A;  2IPK D;  3LB8 C;  1B1Z A;  1YQ4 B;  3AE8 B;  3P4R B;  5C2T B;  1OQR A;  1QIL A;  4TSS A;  2DYO A;  4KKI A;  4XDD A;  4D2K A;  1V8C A;  5D3D A;  1YN4 A;  3E56 A;  2WQY B;  3ETR A;  4A6Q A;  1WRI A;  1JRO A;  1FIQ A;  3IAS 1;  1R7S A;  3CWI A;  1JCK B;  2SAK A;  4HRO A;  4LLG M;  1QLB B;  4N58 A;  3C8Y A;  1TZO A;  2LUM A;  3AE2 B;  3HUI A;  1N62 A;  4ZHO A;  2KN4 A;  2JYT A;  2WXN A;  1V1P B;  2WNM A;  4WH4 A;  1ZE3 D;  4IOI E;  1ZDV A;  4DQO C;  3KWV A;  4RF0 A;  1VRA B;  3EGR A;  1C77 A;  5T8I A;  1QOG A;  1E6E B;  1DYQ A;  2WXF A;  1N60 A;  1T6B X;  1YNT E;  3IXS A;  2K22 A;  2WDV B;  3BYY B;  1IBX B;  3HRD D;  2V3P A;  3P4S B;  1QT9 A;  1GPX A;  1CQV A;  1TS5 A;  2JSV X;  4A9A A;  2V4I B;  1J7C A;  1FD6 A;  4OVZ A;  1XCT L;  3IAM 1;  1V97 A;  3BVZ A;  4ZHP A;  2M0A A;  2BB5 A;  1XEE A;  3ABV B;  3NVV A;  5HHD G;  1GB4 A;  4CQN A;  3I9V 1;  4WQM A;  1ET6 A;  2QIL A;  4NAM A;  1MHH E;  4OZC A;  4ARI A;  4US9 A;  3GB1 A;  1TY2 A;  4TQ0 A;  4RGN A;  3EUB 2;  1B9R A;  1WGK A;  1QOA A;  2WLB A;  2XNA C;  1QF6 A;  1I7H A;  5EE1 A;  1MPE A;  2L52 A;  3AEB B;  1NEN B;  3T3N A;  1P7E A;  2ON8 A;  2RPV A;  3AED B;  1EU4 A;  1PGB A;  2KQ4 X;  2LFI A;  4OHJ A;  2LGI A;  2KWD A;  1L0X B;  2KAC A;  3B9J A;  3AM9 A;  3TEZ A;  3MFG A;  2D5G A;  4DXF A;  1VZ7 A;  3PZ8 A;  2K3U A;  5D7G A;  1TY0 A;  2LMC A;  1KF6 B;  4JPS A;  4RGM A;  1VLB A;  1XLO A;  3BYT B;  4YWG G;  2BT6 A;  1YMH E;  1KLU D;  2GI9 A;  1C78 A;  3FC4 A;  2TSS A;  2PW9 A;  1ENF A;  3Q8E A;  1XLN A;  2L83 A;  3N9Y C;  2BS3 B;  4MAC A;  3BVG A;  4YSY B;  3V3X A;  3ZJV A;  1T5X D;  4RCO A;  4WWM A;  3OWE B;  1XLP A;  3SFD B;  4EE2 A;  2BS2 B;  3FIL A;  2DBY A;  2WXH A;  1C76 A;  2Z8L A;  2DWQ A;  1HQR D;  1L5P A;  1I4X A;  1YQ3 B;  1QQR A;  3DWG C;  1N61 A;  2K5P A;  4MT5 A;  1VZ6 A;  1F2R I;  3VQI A;  1XCQ L;  4JWU C;  3TEW A;  3ZYY X;  4YTP B;  1ESF A;  1C79 A;  5FK9 C;  1TKE A;  1VR9 A;  2BYT A;  3NZ3 A;  2WU5 B;  3W9C B;  1JWM D;  3DWM A;  2ZW0 A;  2FE8 A;  4US8 A;  2H88 B;  2W54 A;  1FM0 D;  2BB6 A;  4A55 A;  1SBB B;  2AQ3 B;  1QOB A;  1C9F A;  3VRA B;  2B76 B;  5GXG B;  4IKG A;  5BMH A;  1FRD A;  4KGS A;  2INP E;  1NYR A;  4C56 C;  3AB5 A;  3NRZ A;  1XXG A;  1WWT A;  2WXP A;  4RF1 A;  1RYJ A;  1JAL A;  3RFZ B;  1MI0 A;  1YN3 A;  1N63 A;  1TKG A;  2GRI A;  3AEG B;  4JE3 B;  2RDH A;  1FNU A;  1L0V B;  3BVM A;  3VR9 B;  1NVI D;  3ZGZ A;  1WSP A;  1SB3 C;  3O13 A;  3I57 A;  2FUG 1;  5BYS A;  2JWU A;  4L23 A;  5FR3 A;  5AUK A;  1D5M C;  2CJO A;  1VJK A;  3NVW A;  4P6V F;  1DOX A;  1TS2 A;  1XO3 A;  4L2Y A;  5FKA C;  1CJE A;  3BII D;  4OZB A;  4C80 A;  1XF5 L;  4MH8 A;  3TUO A;  3AN1 A;  2M19 A;  3P4Q B;  2LEK A;  2WXJ A;  1E0Z A;  2E6X A;  1M4V A;  1SJE D;  3Q8A A;  2AQ1 B;  2MEK A;  4A90 A;  3AEE B;  3R8B A;  1Y56 A;  1F0Z A;  1PUT A;  3H8H A;  1ROE A;  1OQQ A;  2NTT A;  4OW0 A;  5AUI A;  5I4D A;  1SIJ A;  2WXQ A;  1FO4 A;  3Q8F A;  1JW9 D;  1QOF A;  4XDC A;  4HKQ A;  1FNV A;  4XWT A;  1YJJ A;  2R61 A;  3SFE B;  1HXY D;  1RM6 C;  1PFD A;  1FRR A;  5BMG A;  1C4A A;  1L6V A;  1FEH A;  1YN5 A;  2LHD A;  2W55 A;  4USA A;  1I4P A;  4ARC A;  4J3O D;  3FIL B;  1D4B A;  4YTN B;  5MPO A;  2OHF A;  3UI3 A;  3U4E G;  1KH0 A;  2WXI A;  4N6E B;  2QMT A;  1HZ6 A;  2WU2 B;  3W5U B;  3AE4 B;  2ONQ A;  2GB1 A;  2QEJ C;  4GDL B;  2V0G A;  2W82 A;  1RWS A;  1SSN A;  4TMA B;  3AEF B;  4IDI A;  1SE4 A;  1SJH D;  4LK0 M;  4RNA A;  4H2A A;  5LNK 1;  1WYG A;  1SEB D;  3V05 A;  5JXV A;  1ZPS A;  3WCQ A;  1TS4 A;  2W3R A;  1VDV A;  1D5X C;  4NAW B;  1GAQ B;  3VR8 B;  1JWU D;  2Y3A A;  1EWC A;  1K51 A;  2NMQ A;  4DXG A;  2JYE A;  1TYG B;  1N5X A;  2JU6 X;  3W5V B;  2FBW B;  3MHZ A;  5HFY A;  3IT4 B;  1FNW A;  4ZYS A;  3NVY A;  3CIR B;  1CK1 A;  3TEY A;  2NTS A;  2DYM A;  2Y5C A;  3B2G A;  1JRP A;  2WXR A;  2JZP A;  1MVK A;  4HRS A;  4RH6 A;  1SXT A;  1I4G A;  1IUE A;  1FCC C;  2WXG A;  4HKZ E;  2EKI A;  3MJ5 A;  2Q5W D;  4HJG E;  3AH7 A;  4B0E A;  2N0S B;  3BZD B;  3GP7 A;  4L1B A;  1BML C;  1OFF A;  1JWA D;  1JQ4 A;  2QJL A;  2IGH A;  1AW7 A;  1HA5 A;  2WDQ B;  4KKJ A;  5G5H A;  2H89 B;  5BYQ A;  4Q2J A;  2I38 A;  1HEZ E;  3URY A;  3NVZ A;  1NEK B;  2KMM A;  4FXC A;  5G5G A;  2HDE A;  1EWY C;  2G9H D;  1D5Z C;  1FCL A;  2BTE A;  2KAJ A;  2X38 A;  1ZXH A;  4WUR A;  1EU3 A;  1QKZ A;  4REZ A;  1J7B A;  1L0Y B;  5HI1 A;  3E9S A;  3B2F A;  4LTU A;  1I4R A;  2WXL A;  3AV8 A;  2BW2 A;  1K53 A;  2AQ2 B;  1L4D B;  3EA6 A;  4MM3 B;  1NI3 A;  2PLP A;  2QSD A;  1IGC A;  1PGX A;  4O1N A;  1SE2 A;  1NYQ A;  2LHE A;  1C4C A;  1IGD A;  4YSZ B;  3Q69 A;  2K0P A;  4JWS C;  1C4P A;  1KLG D;  1AN8 A;  4UDU C;  1V1P A;  1STE A;  2J53 A;  4RFB A;  1V1O A;  2AX5 A;  4OZA A;  1UNS A;  2MJ3 A;  4WIP A;  2Y5P A;  3KLS X;  1ZOY B;  2WS3 B;  5TSS A;  2CJN A;  2VZK D;  5D3I B;  2INN E;  1PGA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...