1WWTA

Solution structure of the tgs domain from human threonyl-trna synthetase
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
88
structure length
88
Chain Sequence
GSSGSSGDSKPIKVTLPDGKQVDAESWKTTPYQIACGISQGLADNTVIAKVNNVVWDLDRPLEEDCTLELLKFEDEEAQAVYSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the TGS domain from human threonyl-tRNA synthetase
rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords Threonyl-tRNA synthetase, cytoplasmic
total genus 11
structure length 88
sequence length 88
ec nomenclature ec 6.1.1.3: Threonine--tRNA ligase.
pdb deposition date 2005-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02824 TGS TGS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1wwtA01
1ZOYB 1YJJA 3AE6B 1N61A 2CU3A 1QOAA 1RM6C 4YT0B 1B9RA 1SF0A 2JX5A 3AB5A 5EE1A 2H89B 2N0SB 1FFUA 2K5PA 1JW9D 1QOBA 1VJKA 2PKOA 4C7YA 4WWMA 1NYRA 5GXGB 1GPXA 2K9XA 4US8A 1ZUD2 3RPFC 1JRPA 3P4PB 4ZOHC 2WU5B 1N62A 1AYFA 3AMZA 3CIRB 1DGJA 3P4QB 3B2GA 5G5GA 1N60A 2K22A 2CJOA 5AUKA 3LB8C 4WQMA 4P6VF 3ZYYX 1N63A 1SB3C 3AEGB 3NVVA 3AE9B 4USAA 1T3QA 3EUB2 1F0ZA 2MJDA 2WDVB 5EE3A 2DWQA 4C80A 1E6EB 2BS2B 1RWSA 2WS3B 3VR8B 1FO4A 1FXIA 4LTUA 1FRRA 3P63A 1E10A 2W3SA 2ACZB 2M56B 4YTNB 3W5UB 4N58A 4A9AA 2WDRB 2QIEB 1GAQB 2WLBA 5AUIA 4YXDB 1E7PB 1I7HA 2MJEA 2PVGC 3P1MA 1JWBD 5C3JB 1OQRA 2LEKA 2KAJA 2WU2B 3AEFB 3NVZA 4KX6B 3SFDB 3PO0A 3AV8A 1WYGA 2BS3B 2PVOD 1PDXA 1OQQA 2E3TA 2KMMA 3LXFA 3NS1A 4YTPB 1ROEA 2Q5WD 4YTMB 1ZP0B 1TKEA 2BT6A 3W5VB 4YSYB 1YQ3B 1PUTA 1L5PA 3NRZA 4US9A 1ZXIA 4YSXB 3P4RB 1L0VB 5EE9A 2G1EA 1XLQA 1NYQA 3AEBB 1XLPA 3AN1A 3CWIA 2AX5A 3AE1B 3DWMA 3AM9A 4N6EB 3B9JA 3KWLA 1FM0D 2L52A 3VRAB 3SR6A 2M19A 5H8YE 2W55A 1KFYB 1FIQA 1JROA 3HRDD 5MPOA 2WDQB 1VDVA 2EKIA 5EE0A 4IDIA 1WGKA 3AEAB 3SFEB 1PFDA 1QOGA 1J7BA 2L83A 2Y5CA 3ETRA 1DOYA 3B2FA 4YSZB 2WQYB 1UWMA 1TJEA 3AH7A 1QLBB 2B76B 2H88B 1OFFA 4FXCA 3AE2B 1E0ZA 5C2TB 3HVZA 1IUEA 1KRHA 1NI3A 1R7SA 1L6VA 1QF6A 2MJ3A 1XO3A 1TKGA 1A70A 1DOIA 3VR9B 1FRDA 1V8CA 1WWTA 2MH7A 1NENB 3ABVB 1XLNA 2W3RA 3NVYA 1NEKB 2OHFA 3FAHA 1JALA 3W9CB 1RFKA 5H92C 3P4SB 3DWGC 1N5WA 3HUIA 3WCQA 2BS4B 3AEEB 1JWAD 1FMAD 1V97A 1J7AA 3BIID 4N59A 2WP9B 5G5HA 3VRBB 4ZHOA 1XLOA 1NVID 2CJNA 1YQ4B 2DBYA 3AE5B 1AWDA 1RYJA 1E9MA 1TYGB 3AE4B 1N5XA 3NVWA 4HROA 1J7CA 1QT9A 4ITKA 1CJEA 1YJIA 1SIJA 1WXQA 4ZHPA 4JX1C 1JQ4A 1TKYA 2W54A 3AE8B 1FFVA 3AEDB 2PIAA 3AECB 4JWUC 2QJLA 3FC4A 3L4PA 1EWYC 1KF6B 2FBWB 1WRIA 3AE3B 1FXAA 4JWSC 1L6UA 1CZPA 1DOXA 3AE7B 4HRSA 2HTME 1QOFA 2JQRB 1VLBA 4C7ZA
chains in the Genus database with same CATH superfamily
2KVRA 3A1QA 2ZNVC 3TSSA 5IKCM 3RPFC 3RNGC 4ZOHC 4ANXA 3GZNB 3R66C 1PQSA 1L7YA 1C4AA 4WWPA 4DXAB 3A9KA 1EU3A 2W9NA 2WLBA 3BYTB 2G4DB 5JZEB 2RGFA 3Q3NC 4IG7B 1YN3A 1OQQA 2N4FA 4HCNB 1YOVB 3W5VB 3IHPC 1L4DB 3ZIMA 4M0WA 4KGTA 2VH2A 4FJVB 1ISNA 3PS6A 1U4AA 1GG3A 3SHQA 3AN1A 3CWIA 1HXYD 2GOWA 4HEA1 1TGZB 3IT6B 1CMXB 4O1NA 3ZLZA 5C1ZA 4QAYA 3U2SC 4TQ1A 3U52E 2FCSA 1TS3A 2A4ZA 4C4VB 3AH7A 2DZJA 1NBFC 4P16A 4ZYNA 1AW7A 2HJ1A 2LXCA 4FLHA 5BYQA 1V8CA 2R2QA 1MFWA 1TS5A 1A5RA 2HJ8A 2C7MB 2ICIA 3QIJA 4URKA 4A20A 1G6JA 3MC9A 1YQ4B 3A9JA 1E9MA 2KWDA 4E71A 2N9XA 3PRMB 4GB9A 1JQ4A 4KDLB 1TKYA 1HTOA 3AE8B 1EF5A 4FHJA 2I2YA 2QJLA 2K8BA 1SE2A 1VLBA 1S3SG 1KM7A 1XF5L 4FN2A 1B9RA 1SF0A 2D3BA 2L0FA 5BYRA 5EE1A 4US8A 1JRPA 1T5XD 2D3GA 2V3PA 1B1ZA 4LNIA 5IO9A 2YEPB 1H4RA 4LLGM 3LB8C 1XT9B 3Q8BA 1WR1A 4C80A 2DYMA 1E6EB 2W3SA 2K0PA 1I4PA 1GJZA 1E7PB 4K7UA 2MW5A 2MX2A 1KLGD 2L8JA 4KVGB 1YQ3B 2MQJA 5EE9A 3RZFA 2N1WA 1NYQA 4HKZE 4IM3A 3APDA 3SR6A 3CF6E 3KYCD 4FA6A 1UNSA 3P2BA 1PGXA 4ANUA 3ETRA 2Y5CA 1UWMA 2NCNA 5GMVA 2BYFA 2I1JA 3DHIC 1TKGA 4TV3A 4B6WA 4DDID 4BVUC 1M94A 3EC8A 4PK1A 1V1OA 4W9KA 4MEMA 3HUIA 4REZA 2YLMA 1J7AA 4XX5A 2ZNVB 2DBYA 3GB1A 1E90A 4NJ6A 2BKRB 3BK2A 4D2KA 2DENB 3L4PA 4M01A 4RFBA 1EWCA 2NS5A 3M63B 4S0RA 1K52A 1ZOYB 4DXFA 1N61A 3WANA 1P98A 4BKGA 3V05A 2H89B 3NZUA 2LHEA 2JWZA 1YN4A 3E56A 1WE6A 3Q8FA 3ALBA 2XN9C 3KUZA 2AQ2B 1QQRA 2RPQA 2OJRA 4JQWC 1Q10A 5IP4D 4JL9A 2J42A 5D94A 4BOZB 1T3QA 1UBIA 2DWQA 1YMHE 4K81A 2LGXA 3RNEC 1TIFA 1FRRA 2M8SA 3M62B 2ZPYA 2M56B 2WXFA 1V1PA 2D07B 4G11A 3SFDB 2VH1A 2MA9B 2LRWA 2WX1A 4MH8A 1WGYA 2E6XA 2KZRA 4NQLB 1FNVA 3LDZE 1F9JA 4M00A 1KTKA 1P7EA 5FR6A 1SE9A 1FM0D 3GP7A 4IWOA 1F2RC 4FBJB 1IYFA 1KFYB 2OEDA 1GC7A 3O13A 4BKSA 3GOEA 2LJIA 5KHQA 1QOGA 1DOYA 3A33B 2LZ6A 3B1LX 1WGGA 3VTUA 1IUEA 3M95A 1L6VA 4W9LA 1FNUA 1ZPSA 1HQRD 3SDLC 3AI5A 1I4QA 3PGEA 3L0WB 3V6CB 1N5WA 3FKYA 2GBKA 4W9FA 4RCOA 2C7NB 4W9DA 3H7PA 1SJED 1WSPA 2MSED 2NBVB 4KKIA 2JXXA 4RGMA 3DBLB 3ZUNA 4NAMA 3O65B 1MHHE 4OVVA 4JLCA 2GLSA 3BYYB 1BT0A 2N0SB 1ZW7A 4DQOC 3ONSA 3CMMB 1WJUA 3KH0A 4BBNF 2LJ5A 1YIWA 4XE0A 1P9DU 3W2DA 2MWSB 3X23A 3A9JB 3P4QB 3RN9C 1F0ZA 3ZDTA 4JGHB 4GDKB 2JRHA 3U7ZA 3URYA 1KOTA 4NAWA 2KVZA 3ML9A 3I9V1 1T0YA 1Z5SB 2R61A 2BYEA 2D10A 3GZNI 4MSMB 1PDXA 2N9KA 3UGBB 1ROEA 3ZW3A 4C4VA 4ZDVA 1D5MC 4US9A 2O6VD 3RNAC 2QDFA 4GDLA 3ZDMC 1T0RC 4E3CA 4C00A 4HCPB 1TS4A 4WAAA 3KWLA 1Y8RC 5IA7A 1LO5D 3EHVA 3ZRFA 4DHJB 2LHDA 4PYUA 2IO1B 3OLMD 4YSZB 5BMHA 1HZ6A 3GE8C 3DQVA 2ZVOA 1WWTA 3OWEB 3RUIB 1YNTE 1XLNA 2O2VB 4AJWA 1NEKB 3N1YC 4PS8A 2NMQA 5HG2A 1E7UA 3EA6A 1FXTB 2V3SA 4WURA 2SAKA 4HDQA 1N5XA 4HWIB 1J0GA 4N9F4 2K6DB 1C77A 3NZSA 1C79A 2K3UA 2K6QA 4IWPA 3RZWC 2INPE 2ZEQA 3EECA 4B95A 3C19A 2BW2A 1QOAA 5JHAA 4LNKA 4AS1A 4MDKE 4WJQA 1JW9D 1VJKA 3N32A 2R2OA 3DCGA 2L1AA 3C0RB 2N9EB 1N6ZA 2V3NA 3KUDB 3BVZA 1KLVA 2QEJC 2OJWA 1E10A 3LYYA 1WMHA 2WXIA 3APFA 4YTNB 4A9AA 3W1SC 5AUIA 4NNJB 3Q8AA 3P1MA 3EGRA 3C8YA 1WXVA 3ZNHB 1STEA 2Z59B 1V86A 2KMMA 2Q5WD 2FUG1 1PUTA 1ZDXA 3WALA 3QQ8B 1MJDA 3AE1B 3AM9A 3QWZB 5IN7A 3OG5A 1GOZA 2EKIA 1BXTA 1K50A 3Q8CA 3N1XC 2EELA 1WX7A 2PMVA 5AZHA 2KTFA 1DOIA 1FRDA 4GOCA 2IPKD 3ZO5B 3T3NA 4MELA 2KLCA 3SEBA 3BIID 3MJ5A 4S17A 2WP9B 1WGRA 1GUAB 2CJNA 4L1BA 2LXAA 1KLUD 3U30A 2LUMA 2Y3AA 3K9OB 4KIKB 2W54A 1FFVA 4ARIA 2JT4B 3R2IA 4AOFA 3AXCA 1YJJA 3L16A 1RM6C 1BUIC 3AB5A 1L0YB 2N7JA 2GMIC 2KWVB 5FR3A 4LNFA 5G5GA 2XBBC 4WQMA 4W9GA 4B0MA 4DK5A 2BS2B 2RDBC 2CS4A 2NPTA 3VTVA 2KO3A 2ACZB 2BB5A 4PT5A 5BMIA 4IUMB 1YQBA 1I4HA 2RPVA 2LEKA 4EKUA 2QC8A 3MHSD 4TQ0A 3ZGZA 1WYGA 3VH4B 4KV2A 1D5XC 2AQ1B 3NS1A 2GBRA 4II3B 2M0AA 5BYSA 2KX3A 4HPPA 2LFIA 2J53A 2M19A 4XGAB 1WGKA 1WXAA 1QILA 5DCNA 1OFFA 1XEEA 2FNJB 2Y5BB 2N7EA 3ECIA 2JWUA 1BMLC 3W1YA 4RMAA 3H1UA 2NR2A 1P7FA 3MJWA 2RDGA 3DBRI 2X38A 1V81A 1ZE3D 2CHWA 4NJ7A 4AP4C 1XLOA 3HM6X 2M0XA 5D3DA 1UELA 2GB1A 1CJEA 3PTFC 3MC0B 2J0KA 5LXIB 2KNBA 3Q8EA 2KWUB 4HRSA 2IZVB 1K8RB 1P1AA 1AARA 2IO2B 2KFKB 2L00B 4MT5A 1GPXA 3NZ3A 5E6JA 2FCQA 1LQBA 1NI2A 1JWUD 3P42A 3IAS1 1UF0A 1C9FA 3UQBA 1WXMA 2L0TA 1D4BA 1OGWA 2KJ6A 2KQSA 2N9PC 1OQRA 3NVZA 4LJPB 1IP9A 5D2MB 5FK9C 1F2RI 2AYOB 3LXFA 4HJGE 3NOBA 1Y56A 3W1SA 2BT6A 3DHGC 1F77A 1L5PA 4LDTB 4F1SA 2MLBA 4PYZA 1SE4A 2J52A 3AEBB 4OW0A 3VRAB 3RNFC 2INDC 3PREA 4MJSA 2ON8A 5LXHA 2KTRB 1OEYJ 1PFDA 2AL3A 4ZRQA 5T8IA 4OVZA 2ASQA 2N1VA 4NZLB 2C60A 4IC7B 5CHWA 3AE2B 3ZXVA 2G4SA 1XO3A 2FCNA 2LGYA 2MCNB 5BMGA 3ABVB 3DBHI 3PT2B 1D5ZC 3H6NA 3A4SC 5G5HA 2KMCA 2FIFA 1D6EC 3B0AA 4RGTA 3AE5B 1RYJA 1TYGB 4ITKA 2LMCA 2WGSA 1EM7A 5E6OA 1QZEA 4NY0A 3AEDB 4ZRJA 4MGIE 3N3KB 4LCDE 2LUEA 4OHJA 3QHTA 2V0GA 1FFUA 3JYUA 2LGDA 1ZUD2 3Q3OC 2BTEA 2D2QA 5J18A 2AL6A 5CHFA 3ZYYX 1L2NA 2NTSA 3TEZA 1N63A 1P3QU 1LGRA 3AE9B 4RNAA 2PTLA 4KZ0A 3PVLA 1E8WA 2WS3B 2WXPA 2M1MA 4I6NB 4RM8A 1OQYA 3ZXRA 3HIZA 1I7HA 5C3JB 1J19A 1WGDA 3SD5A 4AWJA 3HHMA 4M8MA 2REXA 2UYZB 3EFUA 1F1HA 2IYDB 1WYWB 1ZXIA 1XLQA 2CHZA 2XK5A 3RNCC 1C4PA 3JVZX 1GB4A 5H8YE 1CK1A 2GI9A 1VDVA 4IDIA 4WJPA 2K8CA 1WF9A 3TEXA 4LDTD 4ACFA 4I6PA 3B2FA 1DYQA 2WQYB 1YJ1A 1KRHA 1R7SA 2DAFA 3V6EB 2MJ3A 2L32A 2W82A 4GIVA 2K8HA 1V6EA 3UF8A 2OHFA 1JALA 2AQ3B 4L23A 5CHVC 2B3AA 2BGFA 2JVCA 3IAM1 3U4EG 2WXGA 2N7DA 3Q3JA 1GB1A 3A4RA 1WXQA 1WRDB 4MGZE 4G50A 2FBWB 3AE3B 4EZJA 4KDIC 1R4NB 2JQRB 4C7ZA 5CX3A 3S2AA 2CU3A 1PGAA 2V4IB 4BBNC 4OZCA 2DHZA 3VUWA 2KKCA 4BAXA 3BZDB 3QAQA 4HVBA 4WJOA 4G0NB 3QA8A 5HHDG 3LJ3A 3T3OA 4FADA 1JCKB 1RWSA 3UI3A 1FXIA 1K53A 4ICUA 4PS7A 3I57A 3W5UB 3L17A 3N20C 1NDDA 4KX6B 4EE2A 4X57B 3AV8A 5HFYA 4YTPB 4KKJA 1WJ4A 2KLGA 3VTWA 3VVWB 1V5TA 3BVGA 2JPHA 1ESFA 3DWMA 3JW0X 1WXSA 3ZNID 4DHJD 3DBLI 2W55A 2LRUA 1VZ8A 2WXOA 2IO0B 2WWZA 4OVUA 5EE0A 4RF1A 5J17A 2XNAC 2J7QB 2DX5B 2FIDA 1QLBB 4TKNA 4FULA 1E0ZA 2KYWA 5C2TB 1V9JA 3I63C 4K7SA 3OJ4B 2D5GA 3VR9B 3U8ZA 1IBXB 2JZPA 4NJCA 2W3RA 1WI0A 2I38A 2K39A 4P7IA 2IBIB 1V1PB 2IGDA 2RMMA 3L10B 3KQ4A 2KN4A 3PLUA 1AWDA 3NVWA 2AEHA 4WWNA 4RM9A 2X8XX 1YJIA 2XEWA 3VAWA 1ET6A 3DPDA 1FXAA 1QOFA 2MH7A 3VR8B 2YVCA 4YWGG 3DHHC 3RULA 3VUYA 5LLIA 2WXMA 4FJYA 4BKSD 4C7YA 3R7RA 3MC8A 3QK0A 3GE3C 1AYFA 4I6LB 4DWFA 2K22A 2CJOA 1YN5A 3HM3A 2WYQA 2WXKA 2GBJA 3P63A 2WXQA 1HE8A 1ACCA 1C76A 2GRIA 3RI7C 4EOYA 3MTNB 3PZ8A 2MJEA 2BBCA 3TJPA 3PO0A 2L3ZA 4PS3A 2BS3B 2WHIA 2CU1A 4GXBA 3IFWB 1WJ6A 2D3CA 1WGHA 3PRPB 2AX5A 2KMAA 3MHZA 1E8ZA 3WAPA 1X1MA 2WXRA 2JY6A 2BWES 4GGQA 2KDMA 3AU5A 1SEBD 1C3TA 2MRPA 4AQ7A 3L13A 3H7PB 1WH3A 3NJTA 4M02A 4A55A 1RFKA 1SJHD 4J6IA 4B0EA 4IM2A 1JMLA 3CSTA 2QCZA 3FILB 2KDIA 4GN1A 2O6VA 1I42A 4NPNA 3VDZA 2ZCCA 2ZW1A 1LM8B 5DPRA 1V49A 1CZPA 1OTRB 4OZBA 3AE7B 4R3DA 3DBHB 3PZDA 4JPSA 3TEWA 4YT0B 2JX5A 4TUUA 2QSDA 3ZVVA 5FKAC 3VQIA 5GXGB 2J0JA 1MI0A 3Q3MC 3BY4B 1DGJA 3WAOA 1N60A 4CO7A 1H8CA 1SB3C 3HVDA 3NVVA 4USAA 2PJHA 3A1QB 1WR6E 1V2YA 3H9DA 1FD6A 1V80A 2WDRB 3ZJUA 3TUOA 4BFRA 4DHZE 2E3TA 4W9IA 2BWFA 4BOSC 1YX5B 3ZJVA 2CHXA 2KX0A 5AZGA 3R3MA 1MPEA 3Q14C 1XLPA 4K1RB 1VR9A 1HZ5A 3DBSA 2HD5B 2Z0EB 3RFZB 3Q69A 3ZTCA 4KZCA 4GLSC 1SGHA 2ZZPB 2JZ3B 3NG0A 1M4VA 2L83A 3M3JA 4ZRPA 4IOIE 1ENFA 2H88B 4F7ZA 2BPSA 2IDYA 1A70A 2JUOA 4K3BA 3JSVA 2IJ0A 2DLBA 4MJSB 2IGGA 1RAXA 5H92C 1R4MI 2LD9A 3WCQA 3RCZA 4CYEA 4UDUC 3DVNU 1NVID 2JYTA 1SXTA 2HTHA 4ZHPA 2M17A 3L54A 3FC4A 1KF6B 3DOWA 1UD7A 1L6UA 3OAWA 5J2RA 3VFKA 4K7WA 4F8CB 2LI5A 2KXJA 2WXJA 3BK1A 3QJZA 5L95C 2NTTA 2K9XA 1TBEA 3R8BA 2MHJA 1PGBA 2KD0A 4K3CA 4TMAB 1P0RA 5TSSA 1EF1A 2WU5B 3B2GA 5DPSA 2NPTB 4P6VF 3DVNV 3DVGY 4MACA 3EUB2 1GNUA 2MJDA 2FUHB 1JWSD 2MBHA 4XYCA 1Q1OA 3H7SA 2KQ4X 4A6QA 2JZZA 2LVOA 1YD8U 2L7RA 4WQOB 1GAQB 1FCLA 4YXDB 2KFJA 3J9CA 4XWTA 5JHBA 1IPGA 1UGMA 3N30A 2J0MA 4YTMB 2KACA 4XC2A 1TKEA 4C56C 2YEPF 3TEYA 1L0VB 1WIAA 2D3AA 2K25A 3U7DA 3OJ3A 4WJNA 2J4XA 3HK0A 4XDDA 1IGCA 1ZKHA 1JROA 4GU2A 4A8XC 3AU4A 1T0SC 3SFEB 3SU8X 5HKHA 1HA5A 3GS2A 1J7BA 2KOXA 2JRIB 3N9YC 4ARCA 1I4GA 3PPAA 2EMTA 1QF6A 1OEYA 4HLEA 2RD0A 2NBUA 5AEKB 2JSVX 2KT7A 1NENB 4IM0A 3RT3B 2LWPA 3NVYA 3NY5A 2VZKD 3FAHA 3W9CB 4EFOA 1TZ1A 1WFYA 4WAFA 4KSLC 1TS2A 4HKQA 1PYWD 3K9PB 2CR5A 2PE6B 2UU7A 2INCC 3PV1A 3IXSA 2PE9A 2WXNA 1L0XB 4WH4A 2Z0DB 2GBMA 3V62A 1S1QB 4RH6A 3BWUD 3Q3FA 4XZ4A 1QOBA 3PZ7A 5DPWA 1NYRA 4YL8A 2WX0A 2KDEB 2JU6X 2TSSA 1N62A 2MP2B 3Q6BA 3CIRB 1XCQL 4ZRIA 4EZKA 2V9HA 5AUKA 2MBQA 1EUVB 3WA0A 2KN5A 1VCBA 4M0WB 4P1CC 4XDCA 5C23A 4MGYE 2PVGC 2PW9A 1JWBD 1TT5B 3L08A 3AEFB 2C7HA 2G45B 2L76A 5AZFA 2PLPA 2WXHA 3IVFA 1C1YB 4IW0A 4JIOU 2G3QB 3KUCB 3NRZA 4YSXB 3E9SA 1EU4A 3QX1A 1V5OA 4H2AA 4LNNA 5BO4B 1F52A 1TY0A 2EKEC 4NQKE 4A3PA 1ZXHA 2L52A 1EO6A 5MPOA 2O2VA 1VD2A 2IY1B 4W9EA 2O6VB 3VHTC 2KJRA 1YX6B 1WZ3A 3KVFB 2FAZA 1XQQA 2BYVE 2HE7A 4A90A 2ZPNA 1E8XA 4AUQC 4GSWA 2DYBA 2PEAA 4ZHOA 2DZIA 4ZYSA 4RGNA 3AE4B 2DAJA 4II2B 4MGKE 1JRUA 4JX1C 4CHKA 2BKFA 3AECB 2PIAA 4GDLB 1Q5WB 1DOXA 1TTNA 1LXDA 4IKGA 2KQ7A 2GBNA 2NVUI 3ZNZB 3AE6B 4MM3B 2AWTA 5E6PA 3T9LA 1C78A 5IAAC 2FE8A 3I3TB 4WIPA 2WXLA 3N1ZC 4NAWB 3R7QA 1SBBB 3P4PB 1QKZA 2BB6A 2QMTA 4J3OD 3ML8A 1IGDA 4EEWA 1K51A 2ZJDA 3AEGB 1XD3B 1WM3A 2UWQA 2DYOA 3UQAA 3CSFA 1MG4A 2KDFB 3RNBC 4DDGD 1KJTA 3ZRCA 5HI1A 2KANA 2KAJA 1RLFA 1VRAB 2PVOD 3V61A 2VRRB 3QCAA 4HXDA 4YSYB 2KK8A 2XK5B 4Q2JA 3R2TA 2WNMA 4TSSA 2D11A 1VZ7A 3V60A 2BVCA 1T0QC 1E5WA 1FIQA 3T8MA 4DBGA 1FPYA 3ZKJC 3AEAB 3FILA 4W9CA 1R4MB 4E74A 4LNOA 4DHZB 4FXCA 1T6BX 2LVPA 3HVZA 1E7VA 1JWMD 2QILA 4ICVA 1XXGA 3DVGX 5I4DA 4P1BC 3P4SB 3DWGC 2BS4B 1KH0A 1JWAD 1WX8A 2KWCA 3AEEB 4MSQB 4N59A 1GC6A 2MBEA 1J7CA 3BVMA 2RSUA 2LASA 3KLSX 2MBOA 4JWUC 1D3ZA 1EWYC 1WRIA 4JWSC 2HTME 5JXVA 4W9JA 2C5LC 1MVKA 4LK0M 1FEHA 3APCA 2IY0B 2RDHA 4IWQA 4MM3A 2PKOA 4WWMA 2MP2A 5E6NA 1UBQA 1UWXA 2ONQA 3WAMA 1UGJA 4JE3B 2INNE 2BQQA 4ASWC 1Z2MA 1WMHB 2WDVB 5EE3A 3NS8A 5DPTA 1FO4A 1FCCC 3KWVA 3NUHB 4LTUA 3H8HA 2LGIA 1UH6A 1WJNA 3EFCA 2QIEB 5EDSA 3IBEA 4HPMB 4EZLA 1SIFA 4WWOA 2WU2B 1SE3A 2V4LA 2KTRA 1SSNA 5L83A 4KGSA 3IG3A 1TY2A 2ZVNA 4DXGA 2BYTA 3RD2A 5TR5A 2RR9A 2L05A 2KDBA 5D7GA 3TCAA 2LGSA 3ENEA 3VXWA 1ZGUB 2Z8LA 1VZ6A 3AULA 2HDEA 4W9HA 3HRDD 2WDQB 3ZJTA 3A9KB 4HK2A 5IOIA 3B08A 2K1FA 1TJEA 4CQNA 1UUPA 1TZOA 2V1YA 2KJHB 4HPLB 5G2NA 4LJOB 1XCTL 3ZQ4A 1ET9A 2MBBB 3ZNGC 1J8CA 4A3OA 5LNK1 5D3IB 1FMAD 1V97A 3PHXB 3VH3B 2KFKA 4L2YA 3IT4B 2M4NA 4HROA 1QT9A 2KC1A 2CKHB 1FNWA 1SIJA 2KC2A 2OOBB 1C4CA 3PHWB 3WIMA 4BKTA 1WZ0A 5G55A 3PRZA 3RMKC 3TMPB 4EUTA 3D32A 1L4ZB 5KHOA 1WE7A 5JH5C 2K5PA 3TL5A 3KYDD 4KIKA 2N9LA 3AMZA 2JF5A 4KGRA 4G3XB 3TBLD 3BINA 1MHXA 4RGOS 2NBWB 4HDOA 2KHWB 3TIXA 4ANWA 4FHKA 1AN8A 1RRBA 3MP9A 4M8NA 4N58A 4OZAA 1MG8A 3PSEB 2SEBD 5CTRC 3I5JC 3Q2AC 1E8YA 2C9WB 2G9HD 3PLVA 3NHEB 2ZCBA 1R4NI 1ZP0B 1Q0WB 3V3XA 2PPHA 2IGHA 2BF8B 2WDTB 3P4RB 2G1EA 4XWWA 1WY8A 1LFDA 2DNFA 4N6EB 3JSVB 3UINB 2VZKB 1RFAA 3B9JA 2DZMA 4HJKA 3MFGA 3VUXA 2ZW0A 1HEZE 2MEKA 4KSKC 1I35A 3UIPB 2B76B 2JXTA 4ZRKA 3QARA 4GDKA 3ZTDA 1NI3A 3RYTA 4FJZA 2JYEA 3UIOB 3DDCB 2FCMA 4AJYB 1ZDVA 3X0WA 5D6JB 4BZAA 4RF0A 2Y5PA 4GMVA 4MH0E 2QHOA 1I4XA 3VRBB 4B9KA 2I1KA 1UZXB 2DZKA 1I4RA 2IO3B 3KW5B 3QC8B 4ANVA 2EMSA 1HTQA 1WM2A 1IBXA 2A5UA 1CQVA 2LVQA 1WX9A 3DBRB
chains in the Genus database with same CATH topology
2BW2A 1PGAA 2CU3A 1QOAA 2V4IB 4RH6A 4AS1A 3BWUD 1JW9D 1QOBA 1VJKA 3PZ7A 4OZCA 3TSSA 1NYRA 2L1AA 3RPFC 2JU6X 2TSSA 2V3NA 3BZDB 4ZOHC 1N62A 3BVZA 3CIRB 1XCQL 5AUKA 5HHDG 1C4AA 3T3OA 2QEJC 1JCKB 1RWSA 3UI3A 1FXIA 1K53A 3LYYA 1E10A 2WXIA 4XDCA 1EU3A 3I57A 4YTNB 3W5UB 4A9AA 5AUIA 2WLBA 3BYTB 2PVGC 2PW9A 3P1MA 3EGRA 1JWBD 3C8YA 3Q8AA 3AEFB 4KX6B 4EE2A 3AV8A 5HFYA 1STEA 1YN3A 1OQQA 2KMMA 4YTPB 4KKJA 2Q5WD 2PLPA 2FUG1 2WXHA 3W5VB 1L4DB 1PUTA 3NRZA 4YSXB 3E9SA 1ZDXA 4M0WA 1EU4A 3BVGA 4KGTA 4H2AA 1TY0A 3AN1A 1ZXHA 1ESFA 1HXYD 3AE1B 3CWIA 3DWMA 3AM9A 2L52A 4HEA1 1GOZA 2W55A 3IT6B 1VZ8A 4O1NA 2WXOA 5MPOA 2EKIA 5EE0A 4RF1A 1BXTA 1K50A 3U2SC 4TQ1A 2XNAC 3U52E 1TS3A 3Q8CA 3AH7A 2EELA 1QLBB 2PMVA 1E0ZA 5C2TB 4P16A 1AW7A 1DOIA 2D5GA 3VR9B 5BYQA 1FRDA 1V8CA 1IBXB 2IPKD 1TS5A 2JZPA 4NJCA 2W3RA 2I38A 4A90A 2ICIA 3T3NA 1V1PB 3SEBA 2IGDA 2RMMA 3BIID 3KQ4A 3MJ5A 2WP9B 4ZHOA 2CJNA 1YQ4B 4ZYSA 2KN4A 4L1BA 4RGNA 1AWDA 1KLUD 1E9MA 2KWDA 3AE4B 3NVWA 2LUMA 2Y3AA 1YJIA 1JQ4A 4JX1C 1TKYA 2W54A 3AE8B 1FFVA 3AECB 2PIAA 4GDLB 1ET6A 2QJLA 2I2YA 4ARIA 1FXAA 1DOXA 3R2IA 2MH7A 1QOFA 1SE2A 1VLBA 4IKGA 3VR8B 1YJJA 3AE6B 4YWGG 1XF5L 1RM6C 1B9RA 1BUIC 1SF0A 3AB5A 4MM3B 5BYRA 2WXMA 5EE1A 1C78A 2FE8A 4C7YA 4WIPA 4US8A 2WXLA 1L0YB 4NAWB 2N7JA 1SBBB 1JRPA 1T5XD 2V3PA 1QKZA 3P4PB 1B1ZA 2BB6A 2QMTA 1AYFA 4J3OD 5FR3A 1IGDA 1K51A 2YEPB 4LLGM 5G5GA 2K22A 2CJOA 1YN5A 3LB8C 4WQMA 3AEGB 3Q8BA 4B0MA 2WXKA 4C80A 2DYMA 1E6EB 2BS2B 3P63A 2W3SA 2WXQA 1ACCA 1C76A 2ACZB 1I4PA 2DYOA 2GRIA 2K0PA 2BB5A 4PT5A 5BMIA 3PZ8A 1E7PB 2BBCA 1I4HA 2MJEA 2RPVA 2LEKA 2KAJA 5HI1A 3ZGZA 4TQ0A 3PO0A 1VRAB 1WYGA 2BS3B 2PVOD 1KLGD 1D5XC 2AQ1B 3NS1A 4YSYB 1YQ3B 2M0AA 5BYSA 5EE9A 4Q2JA 3R2TA 2WNMA 2LFIA 1NYQA 2J53A 4HKZE 4TSSA 1VZ7A 2AX5A 3SR6A 2M19A 3MHZA 1FIQA 1UNSA 1WGKA 3AEAB 1PGXA 3FILA 3ETRA 2Y5CA 2WXRA 1QILA 1UWMA 4FXCA 1OFFA 1T6BX 1XEEA 3HVZA 1JWMD 2KDMA 2JWUA 1TKGA 1BMLC 2QILA 1SEBD 1XXGA 4AQ7A 5I4DA 1P7FA 4A55A 1RFKA 1SJHD 3P4SB 3DWGC 1V1OA 4B0EA 3HUIA 2RDGA 2BS4B 1KH0A 1JWAD 2X38A 3AEEB 4REZA 1ZE3D 1J7AA 1JMLA 1XLOA 2DBYA 5D3DA 4N59A 3GB1A 3FILB 1J7CA 2GB1A 3BK2A 3BVMA 1CJEA 3KLSX 4D2KA 3MC0B 4JWUC 2ZW1A 3L4PA 1EWYC 1WRIA 4JWSC 1CZPA 3Q8EA 1EWCA 4OZBA 3AE7B 4HRSA 2HTME 4RFBA 4R3DA 5JXVA 1K52A 1ZOYB 4DXFA 1N61A 1MVKA 4LK0M 1FEHA 4JPSA 3TEWA 4YT0B 2JX5A 3V05A 2QSDA 5FKAC 2H89B 2LHEA 2RDHA 1YN4A 2PKOA 4MT5A 3VQIA 4WWMA 3E56A 3NZ3A 5E6JA 5GXGB 3Q8FA 1GPXA 1UWXA 2ONQA 1UGJA 1MI0A 2XN9C 1JWUD 2AQ2B 3P42A 1QQRA 3IAS1 1DGJA 4JE3B 1Q10A 1N60A 2INNE 2J42A 1C9FA 1SB3C 3HVDA 3NVVA 4USAA 1T3QA 2WDVB 5EE3A 2DWQA 1YMHE 1FO4A 1FCCC 3KWVA 3NUHB 4LTUA 1FRRA 3H8HA 2LGIA 1D4BA 1FD6A 2M56B 2WXFA 1V1PA 2WDRB 2QIEB 3ZJUA 3TUOA 1OQRA 3SFDB 2WU2B 1SE3A 3NVZA 1SSNA 4KGSA 5FK9C 4MH8A 1F2RI 2E3TA 3LXFA 4HJGE 2E6XA 1TY2A 1Y56A 3W1SA 3ZJVA 2BT6A 4DXGA 2BYTA 1F77A 1L5PA 1FNVA 5D7GA 1SE4A 2J52A 1MPEA 3AEBB 1KTKA 1XLPA 1P7EA 1VR9A 1HZ5A 2Z8LA 1VZ6A 4OW0A 1FM0D 3GP7A 2HDEA 1F2RC 3VRAB 1KFYB 2ON8A 3RFZB 3Q69A 2OEDA 3HRDD 2WDQB 3O13A 4GLSC 3ZJTA 1PFDA 4ZRQA 2LJIA 1QOGA 5T8IA 1M4VA 2L83A 4OVZA 1DOYA 4ZRPA 4NZLB 1TJEA 1ENFA 4IOIE 4CQNA 1UUPA 1TZOA 2H88B 3AE2B 1IUEA 1L6VA 2IDYA 1XO3A 1A70A 2IJ0A 1FNUA 1ZPSA 2DLBA 5BMGA 1XCTL 3ABVB 1HQRD 3ZQ4A 1I4QA 1ET9A 2IGGA 5H92C 1D5ZC 1N5WA 5D3IB 5LNK1 3WCQA 1FMAD 1V97A 5G5HA 4UDUC 1D6EC 1NVID 4RGTA 4L2YA 3AE5B 3IT4B 1RYJA 1TYGB 4HROA 2JYTA 4ITKA 1QT9A 2LMCA 4RCOA 1SXTA 1FNWA 1EM7A 1SIJA 4ZHPA 1C4CA 3AEDB 1SJED 1WSPA 3FC4A 1KF6B 1L6UA 4KKIA 4RGMA 4NAMA 1MHHE 1L4ZB 4OHJA 3BYYB 2V0GA 2N0SB 1FFUA 2K5PA 2WXJA 3BK1A 4DQOC 2NTTA 2K9XA 1ZUD2 3R8BA 1PGBA 2BTEA 2N9LA 4TMAB 5TSSA 2WU5B 4XE0A 3AMZA 3W2DA 3P4QB 3B2GA 4KGRA 3ZYYX 2NTSA 4P6VF 3TEZA 1N63A 3AE9B 4MACA 4RNAA 3EUB2 1F0ZA 1MHXA 2MJDA 2PTLA 4RGOS 4GDKB 2WS3B 1JWSD 2KQ4X 4A6QA 2WXPA 1AN8A 3MP9A 3U7ZA 4N58A 3URYA 4OZAA 1GAQB 1FCLA 4YXDB 1I7HA 3J9CA 5C3JB 3I9V1 2SEBD 4XWTA 2R61A 2G9HD 1PDXA 2N9KA 1ROEA 4YTMB 2KACA 1ZP0B 1TKEA 3V3XA 4C56C 1D5MC 2YEPF 4US9A 1ZXIA 2IGHA 3TEYA 3P4RB 1L0VB 2G1EA 1XLQA 4XWWA 2J4XA 4N6EB 4XDDA 1TS4A 2VZKB 3B9JA 1C4PA 3KWLA 1IGCA 3MFGA 1GB4A 1LO5D 5H8YE 1CK1A 2ZW0A 1JROA 1HEZE 2GI9A 2LHDA 4A8XC 1VDVA 4IDIA 3SFEB 2MEKA 3TEXA 1HA5A 3GS2A 1J7BA 3B2FA 4YSZB 1DYQA 2WQYB 5BMHA 2B76B 2JXTA 3N9YC 4ARCA 1HZ6A 1I4GA 1KRHA 1NI3A 1R7SA 1QF6A 2MJ3A 2JYEA 2L32A 1WWTA 2W82A 1ZDVA 2JSVX 3OWEB 1NENB 1YNTE 1XLNA 3NVYA 1NEKB 2VZKD 2OHFA 3FAHA 1JALA 2AQ3B 4RF0A 3W9CB 2Y5PA 4WAFA 2NMQA 5HG2A 1TS2A 4HKQA 3EA6A 1PYWD 4L23A 1I4XA 3VRBB 3IAM1 3U4EG 1I4RA 4WURA 2SAKA 2WXGA 1N5XA 1GB1A 3IXSA 1WXQA 2WXNA 1C77A 1IBXA 2K3UA 1C79A 1CQVA 1L0XB 2FBWB 3AE3B 4WH4A 2INPE 2JQRB 4C7ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZOY B;  1YJJ A;  3AE6 B;  1N61 A;  2CU3 A;  1QOA A;  1RM6 C;  4YT0 B;  1B9R A;  1SF0 A;  2JX5 A;  3AB5 A;  5EE1 A;  2H89 B;  2N0S B;  1FFU A;  2K5P A;  1JW9 D;  1QOB A;  1VJK A;  2PKO A;  4C7Y A;  4WWM A;  1NYR A;  5GXG B;  1GPX A;  2K9X A;  4US8 A;  1ZUD 2;  3RPF C;  1JRP A;  3P4P B;  4ZOH C;  2WU5 B;  1N62 A;  1AYF A;  3AMZ A;  3CIR B;  1DGJ A;  3P4Q B;  3B2G A;  5G5G A;  1N60 A;  2K22 A;  2CJO A;  5AUK A;  3LB8 C;  4WQM A;  4P6V F;  3ZYY X;  1N63 A;  1SB3 C;  3AEG B;  3NVV A;  3AE9 B;  4USA A;  1T3Q A;  3EUB 2;  1F0Z A;  2MJD A;  2WDV B;  5EE3 A;  2DWQ A;  4C80 A;  1E6E B;  2BS2 B;  1RWS A;  2WS3 B;  3VR8 B;  1FO4 A;  1FXI A;  4LTU A;  1FRR A;  3P63 A;  1E10 A;  2W3S A;  2ACZ B;  2M56 B;  4YTN B;  3W5U B;  4N58 A;  4A9A A;  2WDR B;  2QIE B;  1GAQ B;  2WLB A;  5AUI A;  4YXD B;  1E7P B;  1I7H A;  2MJE A;  2PVG C;  3P1M A;  1JWB D;  5C3J B;  1OQR A;  2LEK A;  2KAJ A;  2WU2 B;  3AEF B;  3NVZ A;  4KX6 B;  3SFD B;  3PO0 A;  3AV8 A;  1WYG A;  2BS3 B;  2PVO D;  1PDX A;  1OQQ A;  2E3T A;  2KMM A;  3LXF A;  3NS1 A;  4YTP B;  1ROE A;  2Q5W D;  4YTM B;  1ZP0 B;  1TKE A;  2BT6 A;  3W5V B;  4YSY B;  1YQ3 B;  1PUT A;  1L5P A;  3NRZ A;  4US9 A;  1ZXI A;  4YSX B;  3P4R B;  1L0V B;  5EE9 A;  2G1E A;  1XLQ A;  1NYQ A;  3AEB B;  1XLP A;  3AN1 A;  3CWI A;  2AX5 A;  3AE1 B;  3DWM A;  3AM9 A;  4N6E B;  3B9J A;  3KWL A;  1FM0 D;  2L52 A;  3VRA B;  3SR6 A;  2M19 A;  5H8Y E;  2W55 A;  1KFY B;  1FIQ A;  1JRO A;  3HRD D;  5MPO A;  2WDQ B;  1VDV A;  2EKI A;  5EE0 A;  4IDI A;  1WGK A;  3AEA B;  3SFE B;  1PFD A;  1QOG A;  1J7B A;  2L83 A;  2Y5C A;  3ETR A;  1DOY A;  3B2F A;  4YSZ B;  2WQY B;  1UWM A;  1TJE A;  3AH7 A;  1QLB B;  2B76 B;  2H88 B;  1OFF A;  4FXC A;  3AE2 B;  1E0Z A;  5C2T B;  3HVZ A;  1IUE A;  1KRH A;  1NI3 A;  1R7S A;  1L6V A;  1QF6 A;  2MJ3 A;  1XO3 A;  1TKG A;  1A70 A;  1DOI A;  3VR9 B;  1FRD A;  1V8C A;  1WWT A;  2MH7 A;  1NEN B;  3ABV B;  1XLN A;  2W3R A;  3NVY A;  1NEK B;  2OHF A;  3FAH A;  1JAL A;  3W9C B;  1RFK A;  5H92 C;  3P4S B;  3DWG C;  1N5W A;  3HUI A;  3WCQ A;  2BS4 B;  3AEE B;  1JWA D;  1FMA D;  1V97 A;  1J7A A;  3BII D;  4N59 A;  2WP9 B;  5G5H A;  3VRB B;  4ZHO A;  1XLO A;  1NVI D;  2CJN A;  1YQ4 B;  2DBY A;  3AE5 B;  1AWD A;  1RYJ A;  1E9M A;  1TYG B;  3AE4 B;  1N5X A;  3NVW A;  4HRO A;  1J7C A;  1QT9 A;  4ITK A;  1CJE A;  1YJI A;  1SIJ A;  1WXQ A;  4ZHP A;  4JX1 C;  1JQ4 A;  1TKY A;  2W54 A;  3AE8 B;  1FFV A;  3AED B;  2PIA A;  3AEC B;  4JWU C;  2QJL A;  3FC4 A;  3L4P A;  1EWY C;  1KF6 B;  2FBW B;  1WRI A;  3AE3 B;  1FXA A;  4JWS C;  1L6U A;  1CZP A;  1DOX A;  3AE7 B;  4HRS A;  2HTM E;  1QOF A;  2JQR B;  1VLB A;  4C7Z A; 
#chains in the Genus database with same CATH topology
 2KVR A;  3A1Q A;  2ZNV C;  3TSS A;  5IKC M;  3RPF C;  3RNG C;  4ZOH C;  4ANX A;  3GZN B;  3R66 C;  1PQS A;  1L7Y A;  1C4A A;  4WWP A;  4DXA B;  3A9K A;  1EU3 A;  2W9N A;  2WLB A;  3BYT B;  2G4D B;  5JZE B;  2RGF A;  3Q3N C;  4IG7 B;  1YN3 A;  1OQQ A;  2N4F A;  4HCN B;  1YOV B;  3W5V B;  3IHP C;  1L4D B;  3ZIM A;  4M0W A;  4KGT A;  2VH2 A;  4FJV B;  1ISN A;  3PS6 A;  1U4A A;  1GG3 A;  3SHQ A;  3AN1 A;  3CWI A;  1HXY D;  2GOW A;  4HEA 1;  1TGZ B;  3IT6 B;  1CMX B;  4O1N A;  3ZLZ A;  5C1Z A;  4QAY A;  3U2S C;  4TQ1 A;  3U52 E;  2FCS A;  1TS3 A;  2A4Z A;  4C4V B;  3AH7 A;  2DZJ A;  1NBF C;  4P16 A;  4ZYN A;  1AW7 A;  2HJ1 A;  2LXC A;  4FLH A;  5BYQ A;  1V8C A;  2R2Q A;  1MFW A;  1TS5 A;  1A5R A;  2HJ8 A;  2C7M B;  2ICI A;  3QIJ A;  4URK A;  4A20 A;  1G6J A;  3MC9 A;  1YQ4 B;  3A9J A;  1E9M A;  2KWD A;  4E71 A;  2N9X A;  3PRM B;  4GB9 A;  1JQ4 A;  4KDL B;  1TKY A;  1HTO A;  3AE8 B;  1EF5 A;  4FHJ A;  2I2Y A;  2QJL A;  2K8B A;  1SE2 A;  1VLB A;  1S3S G;  1KM7 A;  1XF5 L;  4FN2 A;  1B9R A;  1SF0 A;  2D3B A;  2L0F A;  5BYR A;  5EE1 A;  4US8 A;  1JRP A;  1T5X D;  2D3G A;  2V3P A;  1B1Z A;  4LNI A;  5IO9 A;  2YEP B;  1H4R A;  4LLG M;  3LB8 C;  1XT9 B;  3Q8B A;  1WR1 A;  4C80 A;  2DYM A;  1E6E B;  2W3S A;  2K0P A;  1I4P A;  1GJZ A;  1E7P B;  4K7U A;  2MW5 A;  2MX2 A;  1KLG D;  2L8J A;  4KVG B;  1YQ3 B;  2MQJ A;  5EE9 A;  3RZF A;  2N1W A;  1NYQ A;  4HKZ E;  4IM3 A;  3APD A;  3SR6 A;  3CF6 E;  3KYC D;  4FA6 A;  1UNS A;  3P2B A;  1PGX A;  4ANU A;  3ETR A;  2Y5C A;  1UWM A;  2NCN A;  5GMV A;  2BYF A;  2I1J A;  3DHI C;  1TKG A;  4TV3 A;  4B6W A;  4DDI D;  4BVU C;  1M94 A;  3EC8 A;  4PK1 A;  1V1O A;  4W9K A;  4MEM A;  3HUI A;  4REZ A;  2YLM A;  1J7A A;  4XX5 A;  2ZNV B;  2DBY A;  3GB1 A;  1E90 A;  4NJ6 A;  2BKR B;  3BK2 A;  4D2K A;  2DEN B;  3L4P A;  4M01 A;  4RFB A;  1EWC A;  2NS5 A;  3M63 B;  4S0R A;  1K52 A;  1ZOY B;  4DXF A;  1N61 A;  3WAN A;  1P98 A;  4BKG A;  3V05 A;  2H89 B;  3NZU A;  2LHE A;  2JWZ A;  1YN4 A;  3E56 A;  1WE6 A;  3Q8F A;  3ALB A;  2XN9 C;  3KUZ A;  2AQ2 B;  1QQR A;  2RPQ A;  2OJR A;  4JQW C;  1Q10 A;  5IP4 D;  4JL9 A;  2J42 A;  5D94 A;  4BOZ B;  1T3Q A;  1UBI A;  2DWQ A;  1YMH E;  4K81 A;  2LGX A;  3RNE C;  1TIF A;  1FRR A;  2M8S A;  3M62 B;  2ZPY A;  2M56 B;  2WXF A;  1V1P A;  2D07 B;  4G11 A;  3SFD B;  2VH1 A;  2MA9 B;  2LRW A;  2WX1 A;  4MH8 A;  1WGY A;  2E6X A;  2KZR A;  4NQL B;  1FNV A;  3LDZ E;  1F9J A;  4M00 A;  1KTK A;  1P7E A;  5FR6 A;  1SE9 A;  1FM0 D;  3GP7 A;  4IWO A;  1F2R C;  4FBJ B;  1IYF A;  1KFY B;  2OED A;  1GC7 A;  3O13 A;  4BKS A;  3GOE A;  2LJI A;  5KHQ A;  1QOG A;  1DOY A;  3A33 B;  2LZ6 A;  3B1L X;  1WGG A;  3VTU A;  1IUE A;  3M95 A;  1L6V A;  4W9L A;  1FNU A;  1ZPS A;  1HQR D;  3SDL C;  3AI5 A;  1I4Q A;  3PGE A;  3L0W B;  3V6C B;  1N5W A;  3FKY A;  2GBK A;  4W9F A;  4RCO A;  2C7N B;  4W9D A;  3H7P A;  1SJE D;  1WSP A;  2MSE D;  2NBV B;  4KKI A;  2JXX A;  4RGM A;  3DBL B;  3ZUN A;  4NAM A;  3O65 B;  1MHH E;  4OVV A;  4JLC A;  2GLS A;  3BYY B;  1BT0 A;  2N0S B;  1ZW7 A;  4DQO C;  3ONS A;  3CMM B;  1WJU A;  3KH0 A;  4BBN F;  2LJ5 A;  1YIW A;  4XE0 A;  1P9D U;  3W2D A;  2MWS B;  3X23 A;  3A9J B;  3P4Q B;  3RN9 C;  1F0Z A;  3ZDT A;  4JGH B;  4GDK B;  2JRH A;  3U7Z A;  3URY A;  1KOT A;  4NAW A;  2KVZ A;  3ML9 A;  3I9V 1;  1T0Y A;  1Z5S B;  2R61 A;  2BYE A;  2D10 A;  3GZN I;  4MSM B;  1PDX A;  2N9K A;  3UGB B;  1ROE A;  3ZW3 A;  4C4V A;  4ZDV A;  1D5M C;  4US9 A;  2O6V D;  3RNA C;  2QDF A;  4GDL A;  3ZDM C;  1T0R C;  4E3C A;  4C00 A;  4HCP B;  1TS4 A;  4WAA A;  3KWL A;  1Y8R C;  5IA7 A;  1LO5 D;  3EHV A;  3ZRF A;  4DHJ B;  2LHD A;  4PYU A;  2IO1 B;  3OLM D;  4YSZ B;  5BMH A;  1HZ6 A;  3GE8 C;  3DQV A;  2ZVO A;  1WWT A;  3OWE B;  3RUI B;  1YNT E;  1XLN A;  2O2V B;  4AJW A;  1NEK B;  3N1Y C;  4PS8 A;  2NMQ A;  5HG2 A;  1E7U A;  3EA6 A;  1FXT B;  2V3S A;  4WUR A;  2SAK A;  4HDQ A;  1N5X A;  4HWI B;  1J0G A;  4N9F 4;  2K6D B;  1C77 A;  3NZS A;  1C79 A;  2K3U A;  2K6Q A;  4IWP A;  3RZW C;  2INP E;  2ZEQ A;  3EEC A;  4B95 A;  3C19 A;  2BW2 A;  1QOA A;  5JHA A;  4LNK A;  4AS1 A;  4MDK E;  4WJQ A;  1JW9 D;  1VJK A;  3N32 A;  2R2O A;  3DCG A;  2L1A A;  3C0R B;  2N9E B;  1N6Z A;  2V3N A;  3KUD B;  3BVZ A;  1KLV A;  2QEJ C;  2OJW A;  1E10 A;  3LYY A;  1WMH A;  2WXI A;  3APF A;  4YTN B;  4A9A A;  3W1S C;  5AUI A;  4NNJ B;  3Q8A A;  3P1M A;  3EGR A;  3C8Y A;  1WXV A;  3ZNH B;  1STE A;  2Z59 B;  1V86 A;  2KMM A;  2Q5W D;  2FUG 1;  1PUT A;  1ZDX A;  3WAL A;  3QQ8 B;  1MJD A;  3AE1 B;  3AM9 A;  3QWZ B;  5IN7 A;  3OG5 A;  1GOZ A;  2EKI A;  1BXT A;  1K50 A;  3Q8C A;  3N1X C;  2EEL A;  1WX7 A;  2PMV A;  5AZH A;  2KTF A;  1DOI A;  1FRD A;  4GOC A;  2IPK D;  3ZO5 B;  3T3N A;  4MEL A;  2KLC A;  3SEB A;  3BII D;  3MJ5 A;  4S17 A;  2WP9 B;  1WGR A;  1GUA B;  2CJN A;  4L1B A;  2LXA A;  1KLU D;  3U30 A;  2LUM A;  2Y3A A;  3K9O B;  4KIK B;  2W54 A;  1FFV A;  4ARI A;  2JT4 B;  3R2I A;  4AOF A;  3AXC A;  1YJJ A;  3L16 A;  1RM6 C;  1BUI C;  3AB5 A;  1L0Y B;  2N7J A;  2GMI C;  2KWV B;  5FR3 A;  4LNF A;  5G5G A;  2XBB C;  4WQM A;  4W9G A;  4B0M A;  4DK5 A;  2BS2 B;  2RDB C;  2CS4 A;  2NPT A;  3VTV A;  2KO3 A;  2ACZ B;  2BB5 A;  4PT5 A;  5BMI A;  4IUM B;  1YQB A;  1I4H A;  2RPV A;  2LEK A;  4EKU A;  2QC8 A;  3MHS D;  4TQ0 A;  3ZGZ A;  1WYG A;  3VH4 B;  4KV2 A;  1D5X C;  2AQ1 B;  3NS1 A;  2GBR A;  4II3 B;  2M0A A;  5BYS A;  2KX3 A;  4HPP A;  2LFI A;  2J53 A;  2M19 A;  4XGA B;  1WGK A;  1WXA A;  1QIL A;  5DCN A;  1OFF A;  1XEE A;  2FNJ B;  2Y5B B;  2N7E A;  3ECI A;  2JWU A;  1BML C;  3W1Y A;  4RMA A;  3H1U A;  2NR2 A;  1P7F A;  3MJW A;  2RDG A;  3DBR I;  2X38 A;  1V81 A;  1ZE3 D;  2CHW A;  4NJ7 A;  4AP4 C;  1XLO A;  3HM6 X;  2M0X A;  5D3D A;  1UEL A;  2GB1 A;  1CJE A;  3PTF C;  3MC0 B;  2J0K A;  5LXI B;  2KNB A;  3Q8E A;  2KWU B;  4HRS A;  2IZV B;  1K8R B;  1P1A A;  1AAR A;  2IO2 B;  2KFK B;  2L00 B;  4MT5 A;  1GPX A;  3NZ3 A;  5E6J A;  2FCQ A;  1LQB A;  1NI2 A;  1JWU D;  3P42 A;  3IAS 1;  1UF0 A;  1C9F A;  3UQB A;  1WXM A;  2L0T A;  1D4B A;  1OGW A;  2KJ6 A;  2KQS A;  2N9P C;  1OQR A;  3NVZ A;  4LJP B;  1IP9 A;  5D2M B;  5FK9 C;  1F2R I;  2AYO B;  3LXF A;  4HJG E;  3NOB A;  1Y56 A;  3W1S A;  2BT6 A;  3DHG C;  1F77 A;  1L5P A;  4LDT B;  4F1S A;  2MLB A;  4PYZ A;  1SE4 A;  2J52 A;  3AEB B;  4OW0 A;  3VRA B;  3RNF C;  2IND C;  3PRE A;  4MJS A;  2ON8 A;  5LXH A;  2KTR B;  1OEY J;  1PFD A;  2AL3 A;  4ZRQ A;  5T8I A;  4OVZ A;  2ASQ A;  2N1V A;  4NZL B;  2C60 A;  4IC7 B;  5CHW A;  3AE2 B;  3ZXV A;  2G4S A;  1XO3 A;  2FCN A;  2LGY A;  2MCN B;  5BMG A;  3ABV B;  3DBH I;  3PT2 B;  1D5Z C;  3H6N A;  3A4S C;  5G5H A;  2KMC A;  2FIF A;  1D6E C;  3B0A A;  4RGT A;  3AE5 B;  1RYJ A;  1TYG B;  4ITK A;  2LMC A;  2WGS A;  1EM7 A;  5E6O A;  1QZE A;  4NY0 A;  3AED B;  4ZRJ A;  4MGI E;  3N3K B;  4LCD E;  2LUE A;  4OHJ A;  3QHT A;  2V0G A;  1FFU A;  3JYU A;  2LGD A;  1ZUD 2;  3Q3O C;  2BTE A;  2D2Q A;  5J18 A;  2AL6 A;  5CHF A;  3ZYY X;  1L2N A;  2NTS A;  3TEZ A;  1N63 A;  1P3Q U;  1LGR A;  3AE9 B;  4RNA A;  2PTL A;  4KZ0 A;  3PVL A;  1E8W A;  2WS3 B;  2WXP A;  2M1M A;  4I6N B;  4RM8 A;  1OQY A;  3ZXR A;  3HIZ A;  1I7H A;  5C3J B;  1J19 A;  1WGD A;  3SD5 A;  4AWJ A;  3HHM A;  4M8M A;  2REX A;  2UYZ B;  3EFU A;  1F1H A;  2IYD B;  1WYW B;  1ZXI A;  1XLQ A;  2CHZ A;  2XK5 A;  3RNC C;  1C4P A;  3JVZ X;  1GB4 A;  5H8Y E;  1CK1 A;  2GI9 A;  1VDV A;  4IDI A;  4WJP A;  2K8C A;  1WF9 A;  3TEX A;  4LDT D;  4ACF A;  4I6P A;  3B2F A;  1DYQ A;  2WQY B;  1YJ1 A;  1KRH A;  1R7S A;  2DAF A;  3V6E B;  2MJ3 A;  2L32 A;  2W82 A;  4GIV A;  2K8H A;  1V6E A;  3UF8 A;  2OHF A;  1JAL A;  2AQ3 B;  4L23 A;  5CHV C;  2B3A A;  2BGF A;  2JVC A;  3IAM 1;  3U4E G;  2WXG A;  2N7D A;  3Q3J A;  1GB1 A;  3A4R A;  1WXQ A;  1WRD B;  4MGZ E;  4G50 A;  2FBW B;  3AE3 B;  4EZJ A;  4KDI C;  1R4N B;  2JQR B;  4C7Z A;  5CX3 A;  3S2A A;  2CU3 A;  1PGA A;  2V4I B;  4BBN C;  4OZC A;  2DHZ A;  3VUW A;  2KKC A;  4BAX A;  3BZD B;  3QAQ A;  4HVB A;  4WJO A;  4G0N B;  3QA8 A;  5HHD G;  3LJ3 A;  3T3O A;  4FAD A;  1JCK B;  1RWS A;  3UI3 A;  1FXI A;  1K53 A;  4ICU A;  4PS7 A;  3I57 A;  3W5U B;  3L17 A;  3N20 C;  1NDD A;  4KX6 B;  4EE2 A;  4X57 B;  3AV8 A;  5HFY A;  4YTP B;  4KKJ A;  1WJ4 A;  2KLG A;  3VTW A;  3VVW B;  1V5T A;  3BVG A;  2JPH A;  1ESF A;  3DWM A;  3JW0 X;  1WXS A;  3ZNI D;  4DHJ D;  3DBL I;  2W55 A;  2LRU A;  1VZ8 A;  2WXO A;  2IO0 B;  2WWZ A;  4OVU A;  5EE0 A;  4RF1 A;  5J17 A;  2XNA C;  2J7Q B;  2DX5 B;  2FID A;  1QLB B;  4TKN A;  4FUL A;  1E0Z A;  2KYW A;  5C2T B;  1V9J A;  3I63 C;  4K7S A;  3OJ4 B;  2D5G A;  3VR9 B;  3U8Z A;  1IBX B;  2JZP A;  4NJC A;  2W3R A;  1WI0 A;  2I38 A;  2K39 A;  4P7I A;  2IBI B;  1V1P B;  2IGD A;  2RMM A;  3L10 B;  3KQ4 A;  2KN4 A;  3PLU A;  1AWD A;  3NVW A;  2AEH A;  4WWN A;  4RM9 A;  2X8X X;  1YJI A;  2XEW A;  3VAW A;  1ET6 A;  3DPD A;  1FXA A;  1QOF A;  2MH7 A;  3VR8 B;  2YVC A;  4YWG G;  3DHH C;  3RUL A;  3VUY A;  5LLI A;  2WXM A;  4FJY A;  4BKS D;  4C7Y A;  3R7R A;  3MC8 A;  3QK0 A;  3GE3 C;  1AYF A;  4I6L B;  4DWF A;  2K22 A;  2CJO A;  1YN5 A;  3HM3 A;  2WYQ A;  2WXK A;  2GBJ A;  3P63 A;  2WXQ A;  1HE8 A;  1ACC A;  1C76 A;  2GRI A;  3RI7 C;  4EOY A;  3MTN B;  3PZ8 A;  2MJE A;  2BBC A;  3TJP A;  3PO0 A;  2L3Z A;  4PS3 A;  2BS3 B;  2WHI A;  2CU1 A;  4GXB A;  3IFW B;  1WJ6 A;  2D3C A;  1WGH A;  3PRP B;  2AX5 A;  2KMA A;  3MHZ A;  1E8Z A;  3WAP A;  1X1M A;  2WXR A;  2JY6 A;  2BWE S;  4GGQ A;  2KDM A;  3AU5 A;  1SEB D;  1C3T A;  2MRP A;  4AQ7 A;  3L13 A;  3H7P B;  1WH3 A;  3NJT A;  4M02 A;  4A55 A;  1RFK A;  1SJH D;  4J6I A;  4B0E A;  4IM2 A;  1JML A;  3CST A;  2QCZ A;  3FIL B;  2KDI A;  4GN1 A;  2O6V A;  1I42 A;  4NPN A;  3VDZ A;  2ZCC A;  2ZW1 A;  1LM8 B;  5DPR A;  1V49 A;  1CZP A;  1OTR B;  4OZB A;  3AE7 B;  4R3D A;  3DBH B;  3PZD A;  4JPS A;  3TEW A;  4YT0 B;  2JX5 A;  4TUU A;  2QSD A;  3ZVV A;  5FKA C;  3VQI A;  5GXG B;  2J0J A;  1MI0 A;  3Q3M C;  3BY4 B;  1DGJ A;  3WAO A;  1N60 A;  4CO7 A;  1H8C A;  1SB3 C;  3HVD A;  3NVV A;  4USA A;  2PJH A;  3A1Q B;  1WR6 E;  1V2Y A;  3H9D A;  1FD6 A;  1V80 A;  2WDR B;  3ZJU A;  3TUO A;  4BFR A;  4DHZ E;  2E3T A;  4W9I A;  2BWF A;  4BOS C;  1YX5 B;  3ZJV A;  2CHX A;  2KX0 A;  5AZG A;  3R3M A;  1MPE A;  3Q14 C;  1XLP A;  4K1R B;  1VR9 A;  1HZ5 A;  3DBS A;  2HD5 B;  2Z0E B;  3RFZ B;  3Q69 A;  3ZTC A;  4KZC A;  4GLS C;  1SGH A;  2ZZP B;  2JZ3 B;  3NG0 A;  1M4V A;  2L83 A;  3M3J A;  4ZRP A;  4IOI E;  1ENF A;  2H88 B;  4F7Z A;  2BPS A;  2IDY A;  1A70 A;  2JUO A;  4K3B A;  3JSV A;  2IJ0 A;  2DLB A;  4MJS B;  2IGG A;  1RAX A;  5H92 C;  1R4M I;  2LD9 A;  3WCQ A;  3RCZ A;  4CYE A;  4UDU C;  3DVN U;  1NVI D;  2JYT A;  1SXT A;  2HTH A;  4ZHP A;  2M17 A;  3L54 A;  3FC4 A;  1KF6 B;  3DOW A;  1UD7 A;  1L6U A;  3OAW A;  5J2R A;  3VFK A;  4K7W A;  4F8C B;  2LI5 A;  2KXJ A;  2WXJ A;  3BK1 A;  3QJZ A;  5L95 C;  2NTT A;  2K9X A;  1TBE A;  3R8B A;  2MHJ A;  1PGB A;  2KD0 A;  4K3C A;  4TMA B;  1P0R A;  5TSS A;  1EF1 A;  2WU5 B;  3B2G A;  5DPS A;  2NPT B;  4P6V F;  3DVN V;  3DVG Y;  4MAC A;  3EUB 2;  1GNU A;  2MJD A;  2FUH B;  1JWS D;  2MBH A;  4XYC A;  1Q1O A;  3H7S A;  2KQ4 X;  4A6Q A;  2JZZ A;  2LVO A;  1YD8 U;  2L7R A;  4WQO B;  1GAQ B;  1FCL A;  4YXD B;  2KFJ A;  3J9C A;  4XWT A;  5JHB A;  1IPG A;  1UGM A;  3N30 A;  2J0M A;  4YTM B;  2KAC A;  4XC2 A;  1TKE A;  4C56 C;  2YEP F;  3TEY A;  1L0V B;  1WIA A;  2D3A A;  2K25 A;  3U7D A;  3OJ3 A;  4WJN A;  2J4X A;  3HK0 A;  4XDD A;  1IGC A;  1ZKH A;  1JRO A;  4GU2 A;  4A8X C;  3AU4 A;  1T0S C;  3SFE B;  3SU8 X;  5HKH A;  1HA5 A;  3GS2 A;  1J7B A;  2KOX A;  2JRI B;  3N9Y C;  4ARC A;  1I4G A;  3PPA A;  2EMT A;  1QF6 A;  1OEY A;  4HLE A;  2RD0 A;  2NBU A;  5AEK B;  2JSV X;  2KT7 A;  1NEN B;  4IM0 A;  3RT3 B;  2LWP A;  3NVY A;  3NY5 A;  2VZK D;  3FAH A;  3W9C B;  4EFO A;  1TZ1 A;  1WFY A;  4WAF A;  4KSL C;  1TS2 A;  4HKQ A;  1PYW D;  3K9P B;  2CR5 A;  2PE6 B;  2UU7 A;  2INC C;  3PV1 A;  3IXS A;  2PE9 A;  2WXN A;  1L0X B;  4WH4 A;  2Z0D B;  2GBM A;  3V62 A;  1S1Q B;  4RH6 A;  3BWU D;  3Q3F A;  4XZ4 A;  1QOB A;  3PZ7 A;  5DPW A;  1NYR A;  4YL8 A;  2WX0 A;  2KDE B;  2JU6 X;  2TSS A;  1N62 A;  2MP2 B;  3Q6B A;  3CIR B;  1XCQ L;  4ZRI A;  4EZK A;  2V9H A;  5AUK A;  2MBQ A;  1EUV B;  3WA0 A;  2KN5 A;  1VCB A;  4M0W B;  4P1C C;  4XDC A;  5C23 A;  4MGY E;  2PVG C;  2PW9 A;  1JWB D;  1TT5 B;  3L08 A;  3AEF B;  2C7H A;  2G45 B;  2L76 A;  5AZF A;  2PLP A;  2WXH A;  3IVF A;  1C1Y B;  4IW0 A;  4JIO U;  2G3Q B;  3KUC B;  3NRZ A;  4YSX B;  3E9S A;  1EU4 A;  3QX1 A;  1V5O A;  4H2A A;  4LNN A;  5BO4 B;  1F52 A;  1TY0 A;  2EKE C;  4NQK E;  4A3P A;  1ZXH A;  2L52 A;  1EO6 A;  5MPO A;  2O2V A;  1VD2 A;  2IY1 B;  4W9E A;  2O6V B;  3VHT C;  2KJR A;  1YX6 B;  1WZ3 A;  3KVF B;  2FAZ A;  1XQQ A;  2BYV E;  2HE7 A;  4A90 A;  2ZPN A;  1E8X A;  4AUQ C;  4GSW A;  2DYB A;  2PEA A;  4ZHO A;  2DZI A;  4ZYS A;  4RGN A;  3AE4 B;  2DAJ A;  4II2 B;  4MGK E;  1JRU A;  4JX1 C;  4CHK A;  2BKF A;  3AEC B;  2PIA A;  4GDL B;  1Q5W B;  1DOX A;  1TTN A;  1LXD A;  4IKG A;  2KQ7 A;  2GBN A;  2NVU I;  3ZNZ B;  3AE6 B;  4MM3 B;  2AWT A;  5E6P A;  3T9L A;  1C78 A;  5IAA C;  2FE8 A;  3I3T B;  4WIP A;  2WXL A;  3N1Z C;  4NAW B;  3R7Q A;  1SBB B;  3P4P B;  1QKZ A;  2BB6 A;  2QMT A;  4J3O D;  3ML8 A;  1IGD A;  4EEW A;  1K51 A;  2ZJD A;  3AEG B;  1XD3 B;  1WM3 A;  2UWQ A;  2DYO A;  3UQA A;  3CSF A;  1MG4 A;  2KDF B;  3RNB C;  4DDG D;  1KJT A;  3ZRC A;  5HI1 A;  2KAN A;  2KAJ A;  1RLF A;  1VRA B;  2PVO D;  3V61 A;  2VRR B;  3QCA A;  4HXD A;  4YSY B;  2KK8 A;  2XK5 B;  4Q2J A;  3R2T A;  2WNM A;  4TSS A;  2D11 A;  1VZ7 A;  3V60 A;  2BVC A;  1T0Q C;  1E5W A;  1FIQ A;  3T8M A;  4DBG A;  1FPY A;  3ZKJ C;  3AEA B;  3FIL A;  4W9C A;  1R4M B;  4E74 A;  4LNO A;  4DHZ B;  4FXC A;  1T6B X;  2LVP A;  3HVZ A;  1E7V A;  1JWM D;  2QIL A;  4ICV A;  1XXG A;  3DVG X;  5I4D A;  4P1B C;  3P4S B;  3DWG C;  2BS4 B;  1KH0 A;  1JWA D;  1WX8 A;  2KWC A;  3AEE B;  4MSQ B;  4N59 A;  1GC6 A;  2MBE A;  1J7C A;  3BVM A;  2RSU A;  2LAS A;  3KLS X;  2MBO A;  4JWU C;  1D3Z A;  1EWY C;  1WRI A;  4JWS C;  2HTM E;  5JXV A;  4W9J A;  2C5L C;  1MVK A;  4LK0 M;  1FEH A;  3APC A;  2IY0 B;  2RDH A;  4IWQ A;  4MM3 A;  2PKO A;  4WWM A;  2MP2 A;  5E6N A;  1UBQ A;  1UWX A;  2ONQ A;  3WAM A;  1UGJ A;  4JE3 B;  2INN E;  2BQQ A;  4ASW C;  1Z2M A;  1WMH B;  2WDV B;  5EE3 A;  3NS8 A;  5DPT A;  1FO4 A;  1FCC C;  3KWV A;  3NUH B;  4LTU A;  3H8H A;  2LGI A;  1UH6 A;  1WJN A;  3EFC A;  2QIE B;  5EDS A;  3IBE A;  4HPM B;  4EZL A;  1SIF A;  4WWO A;  2WU2 B;  1SE3 A;  2V4L A;  2KTR A;  1SSN A;  5L83 A;  4KGS A;  3IG3 A;  1TY2 A;  2ZVN A;  4DXG A;  2BYT A;  3RD2 A;  5TR5 A;  2RR9 A;  2L05 A;  2KDB A;  5D7G A;  3TCA A;  2LGS A;  3ENE A;  3VXW A;  1ZGU B;  2Z8L A;  1VZ6 A;  3AUL A;  2HDE A;  4W9H A;  3HRD D;  2WDQ B;  3ZJT A;  3A9K B;  4HK2 A;  5IOI A;  3B08 A;  2K1F A;  1TJE A;  4CQN A;  1UUP A;  1TZO A;  2V1Y A;  2KJH B;  4HPL B;  5G2N A;  4LJO B;  1XCT L;  3ZQ4 A;  1ET9 A;  2MBB B;  3ZNG C;  1J8C A;  4A3O A;  5LNK 1;  5D3I B;  1FMA D;  1V97 A;  3PHX B;  3VH3 B;  2KFK A;  4L2Y A;  3IT4 B;  2M4N A;  4HRO A;  1QT9 A;  2KC1 A;  2CKH B;  1FNW A;  1SIJ A;  2KC2 A;  2OOB B;  1C4C A;  3PHW B;  3WIM A;  4BKT A;  1WZ0 A;  5G55 A;  3PRZ A;  3RMK C;  3TMP B;  4EUT A;  3D32 A;  1L4Z B;  5KHO A;  1WE7 A;  5JH5 C;  2K5P A;  3TL5 A;  3KYD D;  4KIK A;  2N9L A;  3AMZ A;  2JF5 A;  4KGR A;  4G3X B;  3TBL D;  3BIN A;  1MHX A;  4RGO S;  2NBW B;  4HDO A;  2KHW B;  3TIX A;  4ANW A;  4FHK A;  1AN8 A;  1RRB A;  3MP9 A;  4M8N A;  4N58 A;  4OZA A;  1MG8 A;  3PSE B;  2SEB D;  5CTR C;  3I5J C;  3Q2A C;  1E8Y A;  2C9W B;  2G9H D;  3PLV A;  3NHE B;  2ZCB A;  1R4N I;  1ZP0 B;  1Q0W B;  3V3X A;  2PPH A;  2IGH A;  2BF8 B;  2WDT B;  3P4R B;  2G1E A;  4XWW A;  1WY8 A;  1LFD A;  2DNF A;  4N6E B;  3JSV B;  3UIN B;  2VZK B;  1RFA A;  3B9J A;  2DZM A;  4HJK A;  3MFG A;  3VUX A;  2ZW0 A;  1HEZ E;  2MEK A;  4KSK C;  1I35 A;  3UIP B;  2B76 B;  2JXT A;  4ZRK A;  3QAR A;  4GDK A;  3ZTD A;  1NI3 A;  3RYT A;  4FJZ A;  2JYE A;  3UIO B;  3DDC B;  2FCM A;  4AJY B;  1ZDV A;  3X0W A;  5D6J B;  4BZA A;  4RF0 A;  2Y5P A;  4GMV A;  4MH0 E;  2QHO A;  1I4X A;  3VRB B;  4B9K A;  2I1K A;  1UZX B;  2DZK A;  1I4R A;  2IO3 B;  3KW5 B;  3QC8 B;  4ANV A;  2EMS A;  1HTQ A;  1WM2 A;  1IBX A;  2A5U A;  1CQV A;  2LVQ A;  1WX9 A;  3DBR B; 
#chains in the Genus database with same CATH homology
 2BW2 A;  1PGA A;  2CU3 A;  1QOA A;  2V4I B;  4RH6 A;  4AS1 A;  3BWU D;  1JW9 D;  1QOB A;  1VJK A;  3PZ7 A;  4OZC A;  3TSS A;  1NYR A;  2L1A A;  3RPF C;  2JU6 X;  2TSS A;  2V3N A;  3BZD B;  4ZOH C;  1N62 A;  3BVZ A;  3CIR B;  1XCQ L;  5AUK A;  5HHD G;  1C4A A;  3T3O A;  2QEJ C;  1JCK B;  1RWS A;  3UI3 A;  1FXI A;  1K53 A;  3LYY A;  1E10 A;  2WXI A;  4XDC A;  1EU3 A;  3I57 A;  4YTN B;  3W5U B;  4A9A A;  5AUI A;  2WLB A;  3BYT B;  2PVG C;  2PW9 A;  3P1M A;  3EGR A;  1JWB D;  3C8Y A;  3Q8A A;  3AEF B;  4KX6 B;  4EE2 A;  3AV8 A;  5HFY A;  1STE A;  1YN3 A;  1OQQ A;  2KMM A;  4YTP B;  4KKJ A;  2Q5W D;  2PLP A;  2FUG 1;  2WXH A;  3W5V B;  1L4D B;  1PUT A;  3NRZ A;  4YSX B;  3E9S A;  1ZDX A;  4M0W A;  1EU4 A;  3BVG A;  4KGT A;  4H2A A;  1TY0 A;  3AN1 A;  1ZXH A;  1ESF A;  1HXY D;  3AE1 B;  3CWI A;  3DWM A;  3AM9 A;  2L52 A;  4HEA 1;  1GOZ A;  2W55 A;  3IT6 B;  1VZ8 A;  4O1N A;  2WXO A;  5MPO A;  2EKI A;  5EE0 A;  4RF1 A;  1BXT A;  1K50 A;  3U2S C;  4TQ1 A;  2XNA C;  3U52 E;  1TS3 A;  3Q8C A;  3AH7 A;  2EEL A;  1QLB B;  2PMV A;  1E0Z A;  5C2T B;  4P16 A;  1AW7 A;  1DOI A;  2D5G A;  3VR9 B;  5BYQ A;  1FRD A;  1V8C A;  1IBX B;  2IPK D;  1TS5 A;  2JZP A;  4NJC A;  2W3R A;  2I38 A;  4A90 A;  2ICI A;  3T3N A;  1V1P B;  3SEB A;  2IGD A;  2RMM A;  3BII D;  3KQ4 A;  3MJ5 A;  2WP9 B;  4ZHO A;  2CJN A;  1YQ4 B;  4ZYS A;  2KN4 A;  4L1B A;  4RGN A;  1AWD A;  1KLU D;  1E9M A;  2KWD A;  3AE4 B;  3NVW A;  2LUM A;  2Y3A A;  1YJI A;  1JQ4 A;  4JX1 C;  1TKY A;  2W54 A;  3AE8 B;  1FFV A;  3AEC B;  2PIA A;  4GDL B;  1ET6 A;  2QJL A;  2I2Y A;  4ARI A;  1FXA A;  1DOX A;  3R2I A;  2MH7 A;  1QOF A;  1SE2 A;  1VLB A;  4IKG A;  3VR8 B;  1YJJ A;  3AE6 B;  4YWG G;  1XF5 L;  1RM6 C;  1B9R A;  1BUI C;  1SF0 A;  3AB5 A;  4MM3 B;  5BYR A;  2WXM A;  5EE1 A;  1C78 A;  2FE8 A;  4C7Y A;  4WIP A;  4US8 A;  2WXL A;  1L0Y B;  4NAW B;  2N7J A;  1SBB B;  1JRP A;  1T5X D;  2V3P A;  1QKZ A;  3P4P B;  1B1Z A;  2BB6 A;  2QMT A;  1AYF A;  4J3O D;  5FR3 A;  1IGD A;  1K51 A;  2YEP B;  4LLG M;  5G5G A;  2K22 A;  2CJO A;  1YN5 A;  3LB8 C;  4WQM A;  3AEG B;  3Q8B A;  4B0M A;  2WXK A;  4C80 A;  2DYM A;  1E6E B;  2BS2 B;  3P63 A;  2W3S A;  2WXQ A;  1ACC A;  1C76 A;  2ACZ B;  1I4P A;  2DYO A;  2GRI A;  2K0P A;  2BB5 A;  4PT5 A;  5BMI A;  3PZ8 A;  1E7P B;  2BBC A;  1I4H A;  2MJE A;  2RPV A;  2LEK A;  2KAJ A;  5HI1 A;  3ZGZ A;  4TQ0 A;  3PO0 A;  1VRA B;  1WYG A;  2BS3 B;  2PVO D;  1KLG D;  1D5X C;  2AQ1 B;  3NS1 A;  4YSY B;  1YQ3 B;  2M0A A;  5BYS A;  5EE9 A;  4Q2J A;  3R2T A;  2WNM A;  2LFI A;  1NYQ A;  2J53 A;  4HKZ E;  4TSS A;  1VZ7 A;  2AX5 A;  3SR6 A;  2M19 A;  3MHZ A;  1FIQ A;  1UNS A;  1WGK A;  3AEA B;  1PGX A;  3FIL A;  3ETR A;  2Y5C A;  2WXR A;  1QIL A;  1UWM A;  4FXC A;  1OFF A;  1T6B X;  1XEE A;  3HVZ A;  1JWM D;  2KDM A;  2JWU A;  1TKG A;  1BML C;  2QIL A;  1SEB D;  1XXG A;  4AQ7 A;  5I4D A;  1P7F A;  4A55 A;  1RFK A;  1SJH D;  3P4S B;  3DWG C;  1V1O A;  4B0E A;  3HUI A;  2RDG A;  2BS4 B;  1KH0 A;  1JWA D;  2X38 A;  3AEE B;  4REZ A;  1ZE3 D;  1J7A A;  1JML A;  1XLO A;  2DBY A;  5D3D A;  4N59 A;  3GB1 A;  3FIL B;  1J7C A;  2GB1 A;  3BK2 A;  3BVM A;  1CJE A;  3KLS X;  4D2K A;  3MC0 B;  4JWU C;  2ZW1 A;  3L4P A;  1EWY C;  1WRI A;  4JWS C;  1CZP A;  3Q8E A;  1EWC A;  4OZB A;  3AE7 B;  4HRS A;  2HTM E;  4RFB A;  4R3D A;  5JXV A;  1K52 A;  1ZOY B;  4DXF A;  1N61 A;  1MVK A;  4LK0 M;  1FEH A;  4JPS A;  3TEW A;  4YT0 B;  2JX5 A;  3V05 A;  2QSD A;  5FKA C;  2H89 B;  2LHE A;  2RDH A;  1YN4 A;  2PKO A;  4MT5 A;  3VQI A;  4WWM A;  3E56 A;  3NZ3 A;  5E6J A;  5GXG B;  3Q8F A;  1GPX A;  1UWX A;  2ONQ A;  1UGJ A;  1MI0 A;  2XN9 C;  1JWU D;  2AQ2 B;  3P42 A;  1QQR A;  3IAS 1;  1DGJ A;  4JE3 B;  1Q10 A;  1N60 A;  2INN E;  2J42 A;  1C9F A;  1SB3 C;  3HVD A;  3NVV A;  4USA A;  1T3Q A;  2WDV B;  5EE3 A;  2DWQ A;  1YMH E;  1FO4 A;  1FCC C;  3KWV A;  3NUH B;  4LTU A;  1FRR A;  3H8H A;  2LGI A;  1D4B A;  1FD6 A;  2M56 B;  2WXF A;  1V1P A;  2WDR B;  2QIE B;  3ZJU A;  3TUO A;  1OQR A;  3SFD B;  2WU2 B;  1SE3 A;  3NVZ A;  1SSN A;  4KGS A;  5FK9 C;  4MH8 A;  1F2R I;  2E3T A;  3LXF A;  4HJG E;  2E6X A;  1TY2 A;  1Y56 A;  3W1S A;  3ZJV A;  2BT6 A;  4DXG A;  2BYT A;  1F77 A;  1L5P A;  1FNV A;  5D7G A;  1SE4 A;  2J52 A;  1MPE A;  3AEB B;  1KTK A;  1XLP A;  1P7E A;  1VR9 A;  1HZ5 A;  2Z8L A;  1VZ6 A;  4OW0 A;  1FM0 D;  3GP7 A;  2HDE A;  1F2R C;  3VRA B;  1KFY B;  2ON8 A;  3RFZ B;  3Q69 A;  2OED A;  3HRD D;  2WDQ B;  3O13 A;  4GLS C;  3ZJT A;  1PFD A;  4ZRQ A;  2LJI A;  1QOG A;  5T8I A;  1M4V A;  2L83 A;  4OVZ A;  1DOY A;  4ZRP A;  4NZL B;  1TJE A;  1ENF A;  4IOI E;  4CQN A;  1UUP A;  1TZO A;  2H88 B;  3AE2 B;  1IUE A;  1L6V A;  2IDY A;  1XO3 A;  1A70 A;  2IJ0 A;  1FNU A;  1ZPS A;  2DLB A;  5BMG A;  1XCT L;  3ABV B;  1HQR D;  3ZQ4 A;  1I4Q A;  1ET9 A;  2IGG A;  5H92 C;  1D5Z C;  1N5W A;  5D3I B;  5LNK 1;  3WCQ A;  1FMA D;  1V97 A;  5G5H A;  4UDU C;  1D6E C;  1NVI D;  4RGT A;  4L2Y A;  3AE5 B;  3IT4 B;  1RYJ A;  1TYG B;  4HRO A;  2JYT A;  4ITK A;  1QT9 A;  2LMC A;  4RCO A;  1SXT A;  1FNW A;  1EM7 A;  1SIJ A;  4ZHP A;  1C4C A;  3AED B;  1SJE D;  1WSP A;  3FC4 A;  1KF6 B;  1L6U A;  4KKI A;  4RGM A;  4NAM A;  1MHH E;  1L4Z B;  4OHJ A;  3BYY B;  2V0G A;  2N0S B;  1FFU A;  2K5P A;  2WXJ A;  3BK1 A;  4DQO C;  2NTT A;  2K9X A;  1ZUD 2;  3R8B A;  1PGB A;  2BTE A;  2N9L A;  4TMA B;  5TSS A;  2WU5 B;  4XE0 A;  3AMZ A;  3W2D A;  3P4Q B;  3B2G A;  4KGR A;  3ZYY X;  2NTS A;  4P6V F;  3TEZ A;  1N63 A;  3AE9 B;  4MAC A;  4RNA A;  3EUB 2;  1F0Z A;  1MHX A;  2MJD A;  2PTL A;  4RGO S;  4GDK B;  2WS3 B;  1JWS D;  2KQ4 X;  4A6Q A;  2WXP A;  1AN8 A;  3MP9 A;  3U7Z A;  4N58 A;  3URY A;  4OZA A;  1GAQ B;  1FCL A;  4YXD B;  1I7H A;  3J9C A;  5C3J B;  3I9V 1;  2SEB D;  4XWT A;  2R61 A;  2G9H D;  1PDX A;  2N9K A;  1ROE A;  4YTM B;  2KAC A;  1ZP0 B;  1TKE A;  3V3X A;  4C56 C;  1D5M C;  2YEP F;  4US9 A;  1ZXI A;  2IGH A;  3TEY A;  3P4R B;  1L0V B;  2G1E A;  1XLQ A;  4XWW A;  2J4X A;  4N6E B;  4XDD A;  1TS4 A;  2VZK B;  3B9J A;  1C4P A;  3KWL A;  1IGC A;  3MFG A;  1GB4 A;  1LO5 D;  5H8Y E;  1CK1 A;  2ZW0 A;  1JRO A;  1HEZ E;  2GI9 A;  2LHD A;  4A8X C;  1VDV A;  4IDI A;  3SFE B;  2MEK A;  3TEX A;  1HA5 A;  3GS2 A;  1J7B A;  3B2F A;  4YSZ B;  1DYQ A;  2WQY B;  5BMH A;  2B76 B;  2JXT A;  3N9Y C;  4ARC A;  1HZ6 A;  1I4G A;  1KRH A;  1NI3 A;  1R7S A;  1QF6 A;  2MJ3 A;  2JYE A;  2L32 A;  1WWT A;  2W82 A;  1ZDV A;  2JSV X;  3OWE B;  1NEN B;  1YNT E;  1XLN A;  3NVY A;  1NEK B;  2VZK D;  2OHF A;  3FAH A;  1JAL A;  2AQ3 B;  4RF0 A;  3W9C B;  2Y5P A;  4WAF A;  2NMQ A;  5HG2 A;  1TS2 A;  4HKQ A;  3EA6 A;  1PYW D;  4L23 A;  1I4X A;  3VRB B;  3IAM 1;  3U4E G;  1I4R A;  4WUR A;  2SAK A;  2WXG A;  1N5X A;  1GB1 A;  3IXS A;  1WXQ A;  2WXN A;  1C77 A;  1IBX A;  2K3U A;  1C79 A;  1CQV A;  1L0X B;  2FBW B;  3AE3 B;  4WH4 A;  2INP E;  2JQR B;  4C7Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...