1K51A

A g55a mutation induces 3d domain swapping in the b1 domain of protein l from peptostreptococcus magnus
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
72
structure length
72
Chain Sequence
MHHHHHHAMEEVTIKANLIFANGSTQTAEFKGTFEKATSEAYAYADTLKKDNGEWTVDVADKAYTLNIKFAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Single-site mutations induce 3D domain swapping in the B1 domain of protein L from Peptostreptococcus magnus.
pubmed doi rcsb
source organism Finegoldia magna
molecule tags Protein binding
molecule keywords Protein L
total genus 11
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2001-10-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1k51A00
5BMGA 1C9FA 2K0PA 1F2RC 1KH0A 5JXVA 4D2KA 4IKGA 1IGDA 2KDMA 5BMIA 1XCTL 1FD6A 2KWDA 3V3XA 1Q10A 1YNTE 1FCCC 2KN4A 5HG2A 2JWUA 2JU6X 4KGSA 2LGIA 2KQ4X 4OZBA 1EM7A 5BMHA 1PGXA 2IGGA 2ZW1A 2GB1A 1IGCA 1MPEA 2QMTA 2NMQA 1D4BA 2PTLA 1ZXHA 2RPVA 3FILB 2ZW0A 1P7EA 1FCLA 5HI1A 2PW9A 2LHEA 1HZ5A 4HJGE 1MHXA 2N7JA 4OZCA 2I38A 3FILA 2LUMA 1PGBA 1GB4A 1QKZA 2JZPA 1HZ6A 1XCQL 5HFYA 1PGAA 2JXTA 2J52A 4IOIE 4KGRA 3UI3A 2ON8A 2LHDA 1F2RI 1K53A 4WH4A 1MHHE 1IBXA 2ONQA 2IGDA 1XF5L 1YMHE 1JMLA 1UWXA 2EELA 4MACA 1IBXB 2N9KA 2N9LA 4OZAA 1K50A 2IGHA 1GB1A 1MVKA 2PLPA 4KGTA 4HKZE 2OEDA 5HHDG 1K52A 2QSDA 2RMMA 3MP9A 2J53A 1P7FA 2KACA 1HEZE 2JSVX 4GLSC 2GI9A 1MI0A 3GB1A 1K51A 2I2YA
chains in the Genus database with same CATH superfamily
1R4MB 2KWCA 2BYVE 2JUOA 4EKUA 4IKGA 2RR9A 3GZNI 1L0VB 3V62A 3BVMA 1R4NB 1WXQA 2KX3A 2KN4A 2LJ5A 3AEDB 4ACFA 2JWUA 4PT5A 4C56C 1D5ZC 3URYA 5DCNA 1TZ1A 3AECB 2KQ4X 3DBLI 3NJTA 2ZNVB 5E6JA 2DAJA 4W9GA 2KD0A 1WXSA 4G3XB 2W55A 4LK0M 2V3NA 4WJNA 2AQ3B 2N0SB 2KKCA 4O1NA 4WJOA 2KVZA 2RPQA 1I35A 1UGMA 2BYEA 1WH3A 3ZRCA 2JYTA 1XXGA 3LYYA 1E10A 4MT5A 4MEMA 3DDCB 4XC2A 4TQ1A 1ZKHA 2LGXA 3Q14C 2DLBA 3N1XC 1SIFA 4TQ0A 2O6VA 3LJ3A 3RCZA 3PRPB 2LJIA 2WX0A 4I6PA 2FBWB 1N60A 2PE9A 3ZJTA 3AU5A 2LMCA 3AE1B 2DHZA 3V61A 2Z8LA 4KKIA 2PPHA 4PK1A 2L7RA 2BS4B 1WM3A 2RDHA 5FK9C 1LO5D 1OQQA 5D94A 2V3SA 3EECA 3A9KA 1FXAA 2AX5A 5FR3A 2WXGA 5GXGB 5IAAC 4DXAB 1NYQA 3KUDB 2I2YA 2PKOA 3TEZA 2MJDA 2ASQA 2IDYA 1LQBA 3FC4A 3NZSA 1E90A 3ZGZA 2M4NA 1IGDA 2WXJA 4ANUA 1I42A 3VXWA 4ZRKA 1MG8A 3CIRB 4JPSA 4S0RA 5HG2A 2ZVOA 5EE3A 4YSXB 3DQVA 1OFFA 1YOVB 2L05A 2IO1B 3WA0A 1EM7A 1V5OA 5BMHA 4MM3B 3ZXVA 1EWCA 2FCSA 3BYYB 3HVDA 3U7DA 2GB1A 5D3DA 1TS3A 3AU4A 4IM0A 1T6BX 3AE4B 3Q3OC 2K5PA 3RUIB 2A5UA 2L8JA 4IWPA 1UD7A 2NCNA 2ZW0A 2BYFA 5AUKA 3K9OB 1P7EA 1OQRA 2JRHA 4IW0A 2E3TA 1QKZA 1ZUD2 4RGNA 2FAZA 4ARCA 1PGAA 1E5WA 4K1RB 1ISNA 4A3OA 3UI3A 3N32A 1KRHA 2ACZB 5BYQA 4BKSA 1F2RI 2JRIB 2QC8A 2RGFA 3RD2A 1XEEA 3WCQA 2C60A 3KH0A 2PMVA 1D5XC 4P7IA 2M8SA 4IDIA 1P98A 3U4EG 2VH2A 1HTQA 1MVKA 4ICVA 1JW9D 3H1UA 1L6UA 4HKZE 2WWZA 3WAMA 1OTRB 3C19A 2NVUI 2ZJDA 2O2VB 1UGJA 2M1MA 3VAWA 1PDXA 1E7UA 3UINB 1WGGA 1Z2MA 2Y5PA 2K39A 2G3QB 2IYDB 4YSYB 4F7ZA 1L7YA 3PO0A 2KDFB 5E6PA 1TT5B 3O13A 5FR6A 3VRAB 2C5LC 2GBMA 3APDA 1SE2A 5CHFA 3P4SB 2WXNA 4HWIB 1EF5A 5EE9A 3HHMA 2SEBD 2J4XA 2CU1A 3OWEB 3P42A 2QCZA 4PS3A 3BK2A 1P9DU 2BS3B 4FJYA 2FE8A 1EWYC 2K9XA 1KLGD 2VZKB 5BYRA 3ZLZA 2N9XA 1WZ0A 2KT7A 4E3CA 1N5XA 3KUZA 1E8YA 5C23A 1P0RA 4A9AA 4NJ6A 2KNBA 2LHEA 3ZO5B 3U2SC 3ZJVA 1UWMA 3DBSA 3AE9B 3DBHI 3Q8CA 3A9JB 4KIKB 3T3NA 1ACCA 2K6QA 4FXCA 4B0MA 2J0MA 3AE3B 3L16A 1HE8A 4ASWC 2V0GA 2L3ZA 2OJWA 3QAQA 3HVZA 2NBWB 3RT3B 1K8RB 2AWTA 2G4SA 1IBXA 2JVCA 2UU7A 2WDQB 3QJZA 2CHZA 4NPNA 2WXKA 2WXHA 4CO7A 1ZXIA 1L5PA 3RNFC 4XX5A 1IBXB 3TCAA 4L2YA 3S2AA 1GB1A 2KMAA 4ANXA 4PS7A 4FJVB 2BYTA 4HPLB 4TSSA 3U30A 2Y5BB 2QSDA 1P7FA 5JZEB 1HEZE 4ANWA 4C00A 2O2VA 1BUIC 2WXRA 2K0PA 1N5WA 1YN4A 1A5RA 1TS4A 2KDMA 2KTRA 5BMIA 3AEFB 1R7SA 2MA9B 4BFRA 1WY8A 4MH0E 1SXTA 2KMCA 3MFGA 1V2YA 5GMVA 1Q1OA 3MHZA 1DOYA 3DVNV 2FIDA 2ZEQA 2W9NA 3I3TB 4WWOA 1FFUA 3LB8C 4G50A 1IGCA 3JYUA 2ZCBA 1F52A 3AE2B 1GJZA 4C7ZA 1D4BA 1C1YB 1JROA 2YEPB 4BOSC 2CKHB 3APCA 3HM6X 1T0SC 2WDRB 4JL9A 4DWFA 1FCLA 1V1PB 4K3CA 2WXIA 1KTKA 3SEBA 4OZCA 5DPWA 1PGBA 2M56B 1BT0A 1M94A 3ZIMA 4NNJB 3UGBB 3Q8BA 5KHQA 1MJDA 1RLFA 2EKEC 4KGRA 2XBBC 3QWZB 5IKCM 2WNMA 1I7HA 4RMAA 2KDIA 2BB6A 2AQ2B 2LVOA 3PT2B 1N61A 1WX7A 4GMVA 2IY0B 2DZIA 3TUOA 1TS5A 5JHAA 1N62A 1T0QC 1L6VA 4ZHPA 1FM0D 1QOFA 3ZTCA 2LWPA 1QOAA 3P4QB 1ZE3D 4R3DA 4ZHOA 3RNAC 1Y8RC 1YJIA 2GI9A 3SFDB 4DQOC 1DOXA 5BMGA 4MDKE 5EDSA 4MGKE 5CHVC 2L32A 2K1FA 4RGMA 1TTNA 5KHOA 1FD6A 1WGHA 4W9IA 4DBGA 1GAQB 3MC0B 2G1EA 4G0NB 3IAS1 1VZ7A 2DZMA 2JU6X 1L0YB 4JIOU 3VUYA 3ZDMC 1C78A 3B2GA 1EU4A 1WR1A 3EUB2 2WGSA 2QILA 4MM3A 2MJ3A 1TKEA 4FA6A 2L52A 1PUTA 1WXMA 2IGGA 2KLGA 1JWBD 2EMTA 4HEA1 1L4DB 4NQKE 1WR6E 4HKQA 4GXBA 2CS4A 5H92C 3P1MA 4P1BC 2WP9B 3A1QA 1J7CA 4KSKC 3GE3C 4FN2A 1GNUA 4US8A 1VLBA 4OHJA 3TEWA 2INPE 3IHPC 3DBLB 2I38A 2LGYA 2KQSA 3U8ZA 3HM3A 5LNK1 3A4RA 1SF0A 2NBVB 3DCGA 4II3B 3VUWA 1WRDB 2MP2B 2R2OA 1E9MA 1ZW7A 2BW2A 1KLVA 1IPGA 3DBRI 4WH4A 3ZNZB 1VCBA 2MBQA 2BF8B 5LXHA 2QHOA 3BVZA 3Q69A 2MW5A 5DPRA 3AEEB 2KTFA 3VTWA 2PLPA 1NDDA 5E6OA 1SE9A 1V9JA 1CZPA 3RNGC 2LGDA 2JSVX 1WE6A 4W9DA 2VH1A 3R2TA 1ZOYB 3AE5B 2LGSA 4IM2A 3BK1A 1FNVA 3MJ5A 4MH8A 3JSVA 2K8CA 3IVFA 3U7ZA 2KWDA 4HRSA 3R8BA 4W9EA 3DVGY 3PRZA 3LDZE 4KGSA 2MP2A 3CWIA 3NS1A 1SE3A 2DWQA 4J6IA 2LEKA 1JWAD 2NPTA 4WQMA 1E7VA 1BMLC 2OOBB 1V8CA 2LD9A 2UWQA 1YJ1A 2JPHA 4IWOA 3QCAA 2NMQA 2OJRA 4EUTA 3FILB 3K9PB 3R7QA 2GLSA 1FNWA 4MSMB 3SR6A 1IYFA 5HI1A 4DHJD 4LCDE 4B0EA 3FILA 2M0AA 1HZ6A 1ET9A 2DZJA 5DPSA 2GOWA 3N3KB 2J52A 4IOIE 4FADA 4LNNA 2BVCA 4A55A 3BWUD 1WJ4A 1RFKA 1J19A 2RD0A 2Z59B 4S17A 1YX5B 1UBQA 1V6EA 1TZOA 3PRMB 3ZKJC 1F9JA 2K25A 1AN8A 3QHTA 1WMHB 1YMHE 3ALBA 1TJEA 2KANA 3RN9C 2ZNVC 4C4VB 1PYWD 1SBBB 3AN1A 2L0FA 2H88B 1ROEA 1K52A 3L0WB 2RDGA 2AEHA 2IZVB 2K3UA 3AE7B 4FLHA 4I6LB 2QDFA 1BXTA 4GDKB 3P2BA 3V60A 1KH0A 5JXVA 4N58A 4AS1A 2WS3B 3DVNU 4REZA 2FNJB 3SFEB 1YNTE 3PLVA 1MFWA 3VH4B 1FNUA 2LI5A 4LNOA 4BKGA 2BQQA 3MC8A 3KW5B 3APFA 1VR9A 1QILA 2R61A 2LUEA 1E8ZA 2KFJA 3V6CB 2BKFA 4ICUA 3CSFA 1WSPA 4ZRJA 2FCQA 1DGJA 3NY5A 3DHHC 4M8NA 1R4NI 3PZDA 1H4RA 2IO3B 3OG5A 2N7JA 4NAWA 1SB3C 2D11A 4QAYA 4M01A 2AL3A 3AEBB 2WXLA 1I4QA 1GG3A 4AP4C 4JWUC 4XDCA 1NENB 2BS2B 1B9RA 4USAA 2K8BA 1UF0A 2Y3AA 3ZW3A 4FHKA 1A70A 2QIEB 1KLUD 1JMLA 4HCPB 1ESFA 4EFOA 1V49A 2DYOA 3M63B 2WX1A 3M62B 3HUIA 2N9KA 2FIFA 4LJPB 3PZ8A 3X23A 1M4VA 4J3OD 1X1MA 4ZDVA 4US9A 2MEKA 2YEPF 2MX2A 3VVWB 1D5MC 3GB1A 1KOTA 1TYGB 3IG3A 1UELA 3D32A 4PS8A 3Q8FA 1VJKA 4CQNA 3Q3NC 5IP4D 1WWTA 4P16A 3N30A 1WIAA 2D2QA 4EZKA 4WAFA 1IP9A 2JX5A 3X0WA 2DBYA 1JRUA 3L54A 1WJNA 2LRUA 3PVLA 1L2NA 3NZ3A 4OZBA 1ZPSA 3IT6B 3PTFC 5L95C 1C4CA 3CF6E 2K8HA 1T0YA 2CR5A 2M19A 4HPMB 4WAAA 5D2MB 1VZ8A 1JQ4A 4LNKA 1QF6A 2C7NB 3AI5A 3DWMA 3H9DA 4AJYB 4DHJB 1FPYA 1RWSA 1HZ5A 2IPKD 4HCNB 2D3CA 4GIVA 1V5TA 4L23A 1AARA 5TR5A 2FUG1 4N6EB 1EU3A 2ON8A 2IO2B 2KQ7A 4M8MA 1SGHA 2CJOA 2VRRB 4M02A 2AL6A 2MLBA 1WRIA 2MWSB 4BKTA 1WX9A 3PHXB 4NAMA 1ENFA 2D5GA 3GS2A 2W54A 3HIZA 4WJPA 2WYQA 2HJ8A 1EUVB 1WM2A 5EE0A 1L0XB 2IGHA 2D3GA 3JW0X 3QK0A 4OVVA 2NTTA 4GOCA 2KDEB 2ZZPB 2J53A 3VHTC 3EFCA 1P1AA 1T0RC 2G9HD 2D07B 4FULA 2J0KA 2K22A 1C9FA 2HJ1A 4GU2A 4B6WA 3AE6B 5BYSA 1RYJA 4TV3A 1Q10A 2L76A 3TIXA 4DHZE 2WU5B 1WGDA 3BVGA 4WWMA 3NG0A 4GGQA 4NAWB 1UUPA 1PGXA 3EC8A 2BWFA 4GDLA 1STEA 3SD5A 1I4PA 5AZFA 2I1KA 4Q2JA 3TMPB 2WDVB 1IUEA 1ZXHA 3C8YA 5LLIA 1HQRD 4OW0A 2PE6B 2JT4B 2KDBA 3RULA 5D3IB 1KJTA 4HJGE 4MELA 2KFKB 2JZPA 2H89B 1XCQL 5IOIA 4KZ0A 3EFUA 4W9LA 5G2NA 2JXXA 2DX5B 3KWLA 2HD5B 2INDC 2FCMA 5J17A 4YSZB 1YN5A 4GDKA 2PVOD 4A8XC 4ZYSA 4RNAA 4WWPA 3VFKA 4BAXA 3NRZA 3PPAA 3U52E 3A4SC 1HXYD 4KSLC 5FKAC 2KWUB 1K50A 5I4DA 1XT9B 1TKYA 2IY1B 3CMMB 3KVFB 1FMAD 1C77A 3ETRA 1UZXB 3KLSX 3A9JA 3DBHB 3HRDD 2VZKD 3RFZB 1E6EB 1CMXB 2WHIA 3AM9A 2O6VB 5L83A 2KN5A 4JLCA 4K3BA 1XCTL 4LTUA 2EKIA 3J9CA 1UH6A 4RGTA 2LXAA 1I4HA 4M00A 2WXOA 4XWWA 4EEWA 2CJNA 4GN1A 4HK2A 3O65B 3NUHB 1LGRA 4JGHB 4HXDA 1RFAA 3RNBC 1S1QB 3R3MA 2KX0A 4YTMB 2RDBC 1JRPA 1C4PA 5G55A 3EGRA 2NS5A 1JWUD 1YQ3B 1KFYB 2KJHB 2JYEA 3OJ3A 1MHXA 1WXVA 3H7SA 4W9CA 1GUAB 1GB4A 2BGFA 3QX1A 1WGKA 3VQIA 4DDGD 1JWMD 2JXTA 4H2AA 2BKRB 4BBNF 3Q6BA 3ZUNA 3NS8A 2DYMA 3RNEC 1EF1A 3L13A 1K53A 1SJHD 4F8CB 3JSVB 1WE7A 1YX6B 3N1YC 4A90A 1FXTB 5C1ZA 1H8CA 1WF9A 3AH7A 3QIJA 3PLUA 3UQAA 1SSNA 2XN9C 4WJQA 2KC1A 3T9LA 2V1YA 4WQOB 2MCNB 2EELA 5G5HA 2N9LA 2KMMA 3AMZA 3A33B 4XGAB 1FIQA 2OEDA 3AEAB 3MP9A 4AOFA 1C3TA 4YL8A 1WGRA 2LXCA 1MI0A 2GBNA 1DYQA 4FHJA 3I9V1 2JF5A 2AQ1B 4GSWA 3TL5A 3V05A 3RYTA 4FJZA 1OEYA 3W1YA 4PYZA 1RRBA 2N9PC 2HTME 4ZYNA 2GBRA 1NI3A 4TUUA 5D7GA 4LDTD 3V3XA 3AE8B 3L10B 2LZ6A 1KF6B 1RAXA 2Z0EB 2REXA 5TSSA 2MBEA 3ML8A 1YQ4B 1JCKB 4MJSA 3ONSA 1MG4A 1YD8U 4BZAA 1TS2A 1J0GA 2KZRA 2YLMA 2KO3A 1TIFA 1AWDA 3VUXA 3AB5A 1TBEA 3A1QB 4NJ7A 2PTLA 4RGOS 4EZJA 3V6EB 1VZ6A 3DHGC 4NY0A 5JHBA 1J8CA 2IJ0A 4KVGB 3FKYA 3H8HA 3RZFA 2XK5B 1XLNA 3E9SA 2CHXA 1U4AA 1JALA 3A9KB 2D3AA 4HDOA 3UIOB 5C3JB 1GOZA 3QQ8B 2JQRB 2LHDA 4YT0B 2KHWB 4RF0A 2KJ6A 3BINA 1ET6A 1C76A 5AUIA 1WFYA 4W9JA 2C7MB 4FBJB 5E6NA 2MBBB 4KZCA 1WX8A 4MACA 1FXIA 4KDIC 3RMKC 2MJEA 4LNIA 3T8MA 4N59A 2ZPYA 1VD2A 4IWQA 4K7UA 3E56A 1XLOA 3RZWC 2N1VA 3B0AA 3W1SC 1LM8B 1E8XA 1P3QU 1RM6C 3Q3FA 4XDDA 3UF8A 4WWNA 3BY4B 2GMIC 2KC2A 4F1SA 3MC9A 1F0ZA 1B1ZA 3VDZA 1F1HA 1J7AA 3N9YC 1CQVA 3PHWB 4XYCA 4B9KA 3M3JA 1I4RA 3B2FA 2DAFA 3AEGB 4II2B 4YXDB 2WXPA 4RCOA 1NI2A 3Q3MC 3FAHA 5IA7A 2WLBA 3Q2AC 1AW7A 4AJWA 1VRAB 1V1OA 4BOZB 3VRBB 2FCNA 3WAPA 2SAKA 1QLBB 4OVZA 2C9WB 3KYDD 3R2IA 2MHJA 1PQSA 3HK0A 2RPVA 2JWZA 1QOGA 3KQ4A 2RSUA 1YJJA 3IFWB 4NQLB 1R4MI 2LUMA 4CHKA 1S3SG 1T5XD 1V86A 2W3RA 3NVWA 3ZYYX 4A3PA 2L83A 3OJ4B 1KM7A 2ZVNA 3TEYA 3Q3JA 4ITKA 4RFBA 4RF1A 1I4XA 4TMAB 4KKJA 1XF5L 2BB5A 2MBOA 1NBFC 3ENEA 5CHWA 3DPDA 3IAM1 1UWXA 1WYWB 3RNCC 4C4VA 4AWJA 5J18A 1E0ZA 4JQWC 5D6JB 4W9KA 2BWES 1PFDA 1WMHA 3W5UB 2KLCA 1E7PB 3VR9B 1Y56A 1F2RC 3I5JC 4BVUC 2X38A 1ZDVA 2N9EB 3DBRB 3PGEA 3L4PA 2WXQA 1OGWA 2M17A 2D3BA 2XK5A 1UBIA 3EHVA 4JE3B 3BIID 4X57B 1N63A 2WXMA 5JH5C 4KIKA 1JWSD 2XEWA 1EO6A 4K7SA 4MGZE 3UIPB 1GC7A 1OEYJ 3RI7C 3W2DA 2V4LA 2V9HA 3BYTB 1NVID 2B3AA 2LASA 2QMTA 3SU8X 4KDLB 3N20C 2W3SA 1GPXA 3R66C 4RM8A 2BT6A 2INCC 2HDEA 2KFKA 3UQBA 3TSSA 3MHSD 1E8WA 4W9HA 3VTVA 2NPTB 1XLQA 3DOWA 1HA5A 1FO4A 4PYUA 3VTUA 4MSQB 4A20A 4M0WB 1WGYA 2N7DA 2ZPNA 2MRPA 2PVGC 2WQYB 2JZZA 5CX3A 2C7HA 3R7RA 5EE1A 2DENB 2HTHA 3GZNB 2HE7A 4MGYE 3H7PA 2KVRA 3QARA 4P6VF 3P4PB 3VR8B 2N7EA 4BBNC 2BPSA 2E6XA 2Q5WD 2L0TA 3WANA 1DOIA 5G5GA 3NVVA 3W5VB 1QT9A 1F77A 2JY6A 4KV2A 3PSEB 3TBLD 2KWVB 4AUQC 3L08A 2M0XA 4KGTA 1Z5SB 3GOEA 2AYOB 3ZNID 3KYCD 4ZRIA 4LLGM 5IO9A 4URKA 2KACA 3ZJUA 4AQ7A 4XE0A 2CHWA 1TY2A 4DXFA 4XZ4A 1WJ6A 3WIMA 5C2TB 3B08A 4IG7B 2WU2B 4LDTB 4JWSC 4UDUC 4YWGG 4OVUA 2BTEA 2FUHB 2DYBA 2QJLA 3IT4B 3ZTDA 4M0WA 1AYFA 2NBUA 2V4IB 2BBCA 4GDLB 3NHEB 3AULA 3NVYA 1WXAA 4TKNA 1TY0A 3AXCA 4ZOHC 3N1ZC 2J7QB 1V80A 4BKSD 2ZW1A 2LVQA 2KTRB 4XWTA 1MPEA 2PJHA 3LXFA 2OHFA 1GC6A 3SHQA 1D6EC 4B95A 4G11A 1T3QA 2JZ3B 3B9JA 4EE2A 4DXGA 2DZKA 1YN3A 3ABVB 3MJWA 1L4ZB 4IM3A 5H8YE 2ICIA 3OAWA 3RPFC 2ZCCA 2WDTB 4NJCA 5HFYA 1WI0A 1C4AA 2N1WA 2O6VD 3Q8EA 3ECIA 3CSTA 3AV8A 4GB9A 1MHHE 1XD3B 4E71A 2KXJA 2EMSA 2PEAA 2G4DB 3BZDB 2J0JA 5MPOA 4ZRPA 4C7YA 4OZAA 4EOYA 1QQRA 5BO4B 1XQQA 4K7WA 1OQYA 3DWGC 1HTOA 1NEKB 3I57A 2LVPA 3T3OA 3H6NA 3L17A 1K51A 2B76B 4MGIE 3NZUA 2GBJA 2XNAC 2GRIA 3EA6A 5HKHA 2KYWA 2LFIA 3P4RB 3GP7A 1J7BA 1V1PA 1N6ZA 4HDQA 3MTNB 1TKGA 2G45B 2K6DB 4A6QA 3H7PB 1UNSA 2DNFA 3SDLC 4ANVA 2LRWA 4DK5A 4RM9A 4ARIA 1D3ZA 1YQBA 3WAOA 5DPTA 3P63A 2CU3A 1WYGA 3PV1A 3ML9A 5LXIB 4DDID 3B1LX 3PZ7A 5CTRC 2NTSA 4L1BA 2PW9A 4HPPA 3GE8C 2GBKA 2INNE 3ZXRA 4EZLA 3ZVVA 3NVZA 3TJPA 1I4GA 3IXSA 1C79A 2J42A 1V81A 4HROA 4KX6B 4NZLB 3KWVA 4N9F4 4JX1C 1XO3A 4ZRQA 1FRRA 3ZDTA 2L1AA 2IO0B 2ONQA 4HLEA 2IGDA 1CK1A 1SJED 4K81A 1TGZB 2X8XX 4IC7B 1FRDA 2N4FA 2QEJC 3JVZX 1CJEA 2PIAA 2KJRA 1SEBD 4C80A 5HHDG 1ZDXA 2I1JA 4GLSC 1G6JA 2Y5CA 3ZQ4A 4HVBA 2TSSA 4CYEA 1ZGUB 3W1SA 2YVCA 1WZ3A 2MH7A 2Z0DB 4D2KA 1FFVA 3OLMD 2KOXA 4W9FA 1FCCC 5IN7A 4YTNB 1SE4A 1LFDA 5AZHA 5T8IA 2LGIA 4E74A 2KK8A 5AZGA 2WXFA 1NYRA 4LJOB 3IBEA 2L00B 3DHIC 1V97A 3DVGX 2W82A 3PS6A 2A4ZA 3ZNHB 2MSED 4DHZB 2MQJA 3KUCB 2V3PA 1QOBA 5AEKB 2UYZB 2MBHA 1XLPA 1YIWA 3QC8B 4WURA 4MJSB 4P1CC 3WALA 1LXDA 3PREA 2D10A 4RH6A 2R2QA 2NR2A 4YTPB 1ZP0B 3ZNGC 5J2RA 3Q8AA 3W9CB 3ZRFA 3C0RB 1SIJA 4I6NB 3M95A 4IUMB 3QA8A 1QZEA 1Q5WB 4HJKA 1VDVA 4LNFA 3TEXA 1Q0WB 4WIPA 2RMMA 3I63C 1FEHA 3NOBA 3VH3B 2KAJA 2IBIB 1WJUA
chains in the Genus database with same CATH topology
5BMGA 1Y56A 2K22A 1C9FA 1F2RC 2X38A 1ZDVA 3L4PA 2L32A 2WXQA 4IKGA 3AE6B 5BYSA 1RYJA 4RGMA 1FD6A 1Q10A 1L0VB 4JE3B 3BIID 1GAQB 3MC0B 2G1EA 3BVMA 1WXQA 3IAS1 1N63A 2KN4A 2WXMA 1VZ7A 3AEDB 2JWUA 2WU5B 2JU6X 1L0YB 3BVGA 4PT5A 1JWSD 1C78A 1EU4A 3B2GA 1D5ZC 4WWMA 4C56C 3EUB2 3URYA 2QILA 3AECB 4NAWB 2KQ4X 2MJ3A 1TKEA 1UUPA 5E6JA 2L52A 1PGXA 3W2DA 1PUTA 2IGGA 4HEA1 1JWBD 1L4DB 4HKQA 3BYTB 1NVID 2W55A 4LK0M 2V3NA 1STEA 2QMTA 5H92C 3P1MA 2AQ3B 2W3SA 1I4PA 1GPXA 4Q2JA 2WP9B 2BT6A 2N0SB 2WDVB 2HDEA 4O1NA 1J7CA 1IUEA 1ZXHA 3TSSA 3C8YA 1HQRD 4US8A 1XLQA 1HA5A 2JYTA 1XXGA 4OW0A 3LYYA 1FO4A 1VLBA 5D3IB 1E10A 4OHJA 4MT5A 2INPE 4HJGE 3TEWA 2I38A 2PVGC 2WQYB 4TQ1A 2JZPA 2DLBA 5LNK1 2H89B 1XCQL 4TQ0A 5EE1A 1SF0A 1E9MA 2LJIA 2BW2A 2FBWB 1N60A 3ZJTA 4P6VF 4WH4A 2LMCA 3AE1B 3P4PB 3VR8B 3KWLA 2E6XA 2Q5WD 4YSZB 1YN5A 2Z8LA 2PVOD 4A8XC 4ZYSA 4RNAA 1DOIA 5G5GA 4KKIA 3NVVA 3W5VB 1QT9A 3NRZA 1F77A 3U52E 1HXYD 5FKAC 3BVZA 3Q69A 2BS4B 1K50A 2RDHA 5FK9C 3AEEB 5I4DA 1LO5D 1OQQA 1TKYA 1FMAD 1C77A 3ETRA 2PLPA 4KGTA 4LLGM 3KLSX 1FXAA 2AX5A 5FR3A 1CZPA 2WXGA 5GXGB 2KACA 2JSVX 3ZJUA 1NYQA 3HRDD 3R2TA 1ZOYB 4XE0A 4AQ7A 2VZKD 1TY2A 3AE5B 4DXFA 2I2YA 2PKOA 3RFZB 3TEZA 5C2TB 1E6EB 3BK1A 1FNVA 3MJ5A 2MJDA 2WU2B 2IDYA 3AM9A 4MH8A 4JWSC 3FC4A 4UDUC 3ZGZA 4YWGG 1IGDA 2WXJA 3U7ZA 1XCTL 2BTEA 2KWDA 4LTUA 2EKIA 4HRSA 3J9CA 4RGTA 2QJLA 3IT4B 3CIRB 4M0WA 1I4HA 1AYFA 4JPSA 5HG2A 3R8BA 2WXOA 4XWWA 2V4IB 2CJNA 2BBCA 4GDLB 5EE3A 4YSXB 1OFFA 3NVYA 4KGSA 3NUHB 3CWIA 3NS1A 1SE3A 2DWQA 1TY0A 1EM7A 5BMHA 2LEKA 4MM3B 4ZOHC 4YTMB 1EWCA 1JWAD 3BYYB 3HVDA 4WQMA 1JRPA 1BMLC 1V8CA 1C4PA 2GB1A 2ZW1A 5D3DA 1TS3A 4XWTA 1MPEA 3EGRA 1T6BX 3LXFA 1JWUD 3AE4B 2K5PA 2OHFA 1YQ3B 2NMQA 1KFYB 1D6EC 3FILB 2ZW0A 1T3QA 5AUKA 1FNWA 1P7EA 2JYEA 3B9JA 3SR6A 4DXGA 1OQRA 4EE2A 1YN3A 3ABVB 1L4ZB 5HI1A 5H8YE 1MHXA 2ICIA 4B0EA 2E3TA 3FILA 2M0AA 3RPFC 1GB4A 1QKZA 1ZUD2 4RGNA 1HZ6A 4NJCA 1WGKA 5HFYA 3VQIA 1ET9A 4ARCA 1PGAA 1C4AA 1JWMD 2JXTA 4H2AA 3Q8EA 2J52A 4IOIE 3UI3A 4A55A 1KRHA 2ACZB 3BWUD 5BYQA 1F2RI 2DYMA 1RFKA 1K53A 1SJHD 1TZOA 1XEEA 1MHHE 3AV8A 3WCQA 4A90A 1AN8A 3AH7A 3BZDB 1YMHE 1SSNA 2PMVA 2XN9C 5MPOA 1D5XC 1TJEA 2EELA 5G5HA 4ZRPA 4C7YA 2N9LA 4OZAA 2KMMA 3AMZA 4IDIA 3U4EG 1QQRA 1PYWD 1MVKA 1SBBB 3AN1A 1JW9D 1L6UA 1FIQA 2H88B 4HKZE 3DWGC 1ROEA 2OEDA 3AEAB 1K52A 3MP9A 1NEKB 2RDGA 3I57A 3T3OA 1UGJA 1MI0A 2K3UA 1DYQA 3AE7B 3I9V1 1PDXA 1K51A 1BXTA 2AQ1B 4GDKB 2B76B 2Y5PA 3V05A 4YSYB 1KH0A 5JXVA 2HTME 3PO0A 4N58A 4AS1A 1NI3A 2WS3B 5D7GA 2XNAC 4REZA 3O13A 2GRIA 3V3XA 3SFEB 3VRAB 3EA6A 1YNTE 3AE8B 1KF6B 1SE2A 2LFIA 3P4RB 5TSSA 1FNUA 3P4SB 3GP7A 1YQ4B 1JCKB 1J7BA 2WXNA 1V1PA 1VR9A 5EE9A 1TKGA 1TS2A 2SEBD 1QILA 4A6QA 2R61A 1UNSA 2J4XA 1AWDA 3OWEB 3P42A 3AB5A 4ARIA 1WSPA 3BK2A 2BS3B 2FE8A 3P63A 1EWYC 2CU3A 2K9XA 2PTLA 1DGJA 4RGOS 1KLGD 2VZKB 5BYRA 1WYGA 1VZ6A 1N5XA 3PZ7A 2IJ0A 2NTSA 3H8HA 4L1BA 4A9AA 2PW9A 2LHEA 3U2SC 3ZJVA 2N7JA 1UWMA 1XLNA 1SB3C 2INNE 3AE9B 3Q8CA 3E9SA 3AEBB 1JALA 3NVZA 2WXLA 3T3NA 1ACCA 4FXCA 1I4QA 1I4GA 4B0MA 3IXSA 1C79A 2J42A 3AE3B 4JWUC 4XDCA 1NENB 2V0GA 4HROA 4KX6B 5C3JB 4NZLB 1GOZA 2BS2B 3HVZA 3KWVA 4YT0B 2JQRB 2LHDA 1B9RA 4RF0A 4JX1C 4USAA 1XO3A 4ZRQA 1ET6A 1FRRA 1IBXA 2L1AA 1C76A 2WDQB 2ONQA 2Y3AA 2IGDA 5AUIA 1CK1A 1SJED 2WXKA 1A70A 2WXHA 2QIEB 1KLUD 1JMLA 1ESFA 1ZXIA 1L5PA 1FRDA 2DYOA 4MACA 1IBXB 1FXIA 2N9KA 3HUIA 2QEJC 4L2YA 2MJEA 3PZ8A 1GB1A 1M4VA 4N59A 1CJEA 4J3OD 2PIAA 1SEBD 4C80A 2BYTA 3E56A 4TSSA 1XLOA 5HHDG 2QSDA 4US9A 1ZDXA 1RM6C 1P7FA 2MEKA 1HEZE 4XDDA 2YEPF 4GLSC 1D5MC 3GB1A 2Y5CA 3ZQ4A 2TSSA 1BUIC 1TYGB 1F0ZA 2WXRA 2K0PA 1B1ZA 3W1SA 1N5WA 1J7AA 3N9YC 3Q8FA 1YN4A 1VJKA 1CQVA 1TS4A 2MH7A 4D2KA 4CQNA 1I4RA 3B2FA 1WWTA 2KDMA 1FFVA 4P16A 5BMIA 3AEFB 4WAFA 1R7SA 3AEGB 2JX5A 1FCCC 4YXDB 2WXPA 4RCOA 2DBYA 4YTNB 1SE4A 1SXTA 3FAHA 3MFGA 5T8IA 2WLBA 2LGIA 1AW7A 3NZ3A 1VRAB 1V1OA 3MHZA 4OZBA 3VRBB 1ZPSA 1DOYA 3IT6B 1FFUA 2SAKA 1C4CA 3LB8C 1QLBB 4OVZA 1IGCA 3R2IA 3AE2B 2WXFA 1NYRA 4C7ZA 1D4BA 2M19A 2RPVA 1JROA 2YEPB 1VZ8A 1JQ4A 1QF6A 2WDRB 1V97A 2W82A 3DWMA 1QOGA 1FCLA 3KQ4A 1V1PB 1YJJA 2WXIA 1KTKA 1RWSA 3SEBA 1HZ5A 2IPKD 4OZCA 2LUMA 1PGBA 2V3PA 2M56B 1QOBA 1T5XD 2W3RA 1XLPA 4WURA 3NVWA 3ZYYX 2L83A 3Q8BA 4L23A 4KGRA 2FUG1 4N6EB 3TEYA 1EU3A 2WNMA 1I7HA 2ON8A 4RH6A 4ITKA 2CJOA 4YTPB 1ZP0B 2BB6A 2AQ2B 3Q8AA 4RFBA 1N61A 4RF1A 3W9CB 1I4XA 1WRIA 4TMAB 4KKJA 1XF5L 2BB5A 1SIJA 1UWXA 3IAM1 4NAMA 3TUOA 1TS5A 1ENFA 2D5GA 3GS2A 2W54A 1N62A 5EE0A 1E0ZA 1L0XB 2IGHA 1L6VA 4ZHPA 1FM0D 1QOFA 1QOAA 1VDVA 3P4QB 1ZE3D 2NTTA 2RMMA 4WIPA 4R3DA 3TEXA 4ZHOA 1PFDA 2J53A 1FEHA 1YJIA 2GI9A 2KAJA 3W5UB 1E7PB 2G9HD 3SFDB 4DQOC 1DOXA 3VR9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BMG A;  1C9F A;  2K0P A;  1F2R C;  1KH0 A;  5JXV A;  4D2K A;  4IKG A;  1IGD A;  2KDM A;  5BMI A;  1XCT L;  1FD6 A;  2KWD A;  3V3X A;  1Q10 A;  1YNT E;  1FCC C;  2KN4 A;  5HG2 A;  2JWU A;  2JU6 X;  4KGS A;  2LGI A;  2KQ4 X;  4OZB A;  1EM7 A;  5BMH A;  1PGX A;  2IGG A;  2ZW1 A;  2GB1 A;  1IGC A;  1MPE A;  2QMT A;  2NMQ A;  1D4B A;  2PTL A;  1ZXH A;  2RPV A;  3FIL B;  2ZW0 A;  1P7E A;  1FCL A;  5HI1 A;  2PW9 A;  2LHE A;  1HZ5 A;  4HJG E;  1MHX A;  2N7J A;  4OZC A;  2I38 A;  3FIL A;  2LUM A;  1PGB A;  1GB4 A;  1QKZ A;  2JZP A;  1HZ6 A;  1XCQ L;  5HFY A;  1PGA A;  2JXT A;  2J52 A;  4IOI E;  4KGR A;  3UI3 A;  2ON8 A;  2LHD A;  1F2R I;  1K53 A;  4WH4 A;  1MHH E;  1IBX A;  2ONQ A;  2IGD A;  1XF5 L;  1YMH E;  1JML A;  1UWX A;  2EEL A;  4MAC A;  1IBX B;  2N9K A;  2N9L A;  4OZA A;  1K50 A;  2IGH A;  1GB1 A;  1MVK A;  2PLP A;  4KGT A;  4HKZ E;  2OED A;  5HHD G;  1K52 A;  2QSD A;  2RMM A;  3MP9 A;  2J53 A;  1P7F A;  2KAC A;  1HEZ E;  2JSV X;  4GLS C;  2GI9 A;  1MI0 A;  3GB1 A;  1K51 A;  2I2Y A; 
#chains in the Genus database with same CATH topology
 1R4M B;  2KWC A;  2BYV E;  2JUO A;  4EKU A;  4IKG A;  2RR9 A;  3GZN I;  1L0V B;  3V62 A;  3BVM A;  1R4N B;  1WXQ A;  2KX3 A;  2KN4 A;  2LJ5 A;  3AED B;  4ACF A;  2JWU A;  4PT5 A;  4C56 C;  1D5Z C;  3URY A;  5DCN A;  1TZ1 A;  3AEC B;  2KQ4 X;  3DBL I;  3NJT A;  2ZNV B;  5E6J A;  2DAJ A;  4W9G A;  2KD0 A;  1WXS A;  4G3X B;  2W55 A;  4LK0 M;  2V3N A;  4WJN A;  2AQ3 B;  2N0S B;  2KKC A;  4O1N A;  4WJO A;  2KVZ A;  2RPQ A;  1I35 A;  1UGM A;  2BYE A;  1WH3 A;  3ZRC A;  2JYT A;  1XXG A;  3LYY A;  1E10 A;  4MT5 A;  4MEM A;  3DDC B;  4XC2 A;  4TQ1 A;  1ZKH A;  2LGX A;  3Q14 C;  2DLB A;  3N1X C;  1SIF A;  4TQ0 A;  2O6V A;  3LJ3 A;  3RCZ A;  3PRP B;  2LJI A;  2WX0 A;  4I6P A;  2FBW B;  1N60 A;  2PE9 A;  3ZJT A;  3AU5 A;  2LMC A;  3AE1 B;  2DHZ A;  3V61 A;  2Z8L A;  4KKI A;  2PPH A;  4PK1 A;  2L7R A;  2BS4 B;  1WM3 A;  2RDH A;  5FK9 C;  1LO5 D;  1OQQ A;  5D94 A;  2V3S A;  3EEC A;  3A9K A;  1FXA A;  2AX5 A;  5FR3 A;  2WXG A;  5GXG B;  5IAA C;  4DXA B;  1NYQ A;  3KUD B;  2I2Y A;  2PKO A;  3TEZ A;  2MJD A;  2ASQ A;  2IDY A;  1LQB A;  3FC4 A;  3NZS A;  1E90 A;  3ZGZ A;  2M4N A;  1IGD A;  2WXJ A;  4ANU A;  1I42 A;  3VXW A;  4ZRK A;  1MG8 A;  3CIR B;  4JPS A;  4S0R A;  5HG2 A;  2ZVO A;  5EE3 A;  4YSX B;  3DQV A;  1OFF A;  1YOV B;  2L05 A;  2IO1 B;  3WA0 A;  1EM7 A;  1V5O A;  5BMH A;  4MM3 B;  3ZXV A;  1EWC A;  2FCS A;  3BYY B;  3HVD A;  3U7D A;  2GB1 A;  5D3D A;  1TS3 A;  3AU4 A;  4IM0 A;  1T6B X;  3AE4 B;  3Q3O C;  2K5P A;  3RUI B;  2A5U A;  2L8J A;  4IWP A;  1UD7 A;  2NCN A;  2ZW0 A;  2BYF A;  5AUK A;  3K9O B;  1P7E A;  1OQR A;  2JRH A;  4IW0 A;  2E3T A;  1QKZ A;  1ZUD 2;  4RGN A;  2FAZ A;  4ARC A;  1PGA A;  1E5W A;  4K1R B;  1ISN A;  4A3O A;  3UI3 A;  3N32 A;  1KRH A;  2ACZ B;  5BYQ A;  4BKS A;  1F2R I;  2JRI B;  2QC8 A;  2RGF A;  3RD2 A;  1XEE A;  3WCQ A;  2C60 A;  3KH0 A;  2PMV A;  1D5X C;  4P7I A;  2M8S A;  4IDI A;  1P98 A;  3U4E G;  2VH2 A;  1HTQ A;  1MVK A;  4ICV A;  1JW9 D;  3H1U A;  1L6U A;  4HKZ E;  2WWZ A;  3WAM A;  1OTR B;  3C19 A;  2NVU I;  2ZJD A;  2O2V B;  1UGJ A;  2M1M A;  3VAW A;  1PDX A;  1E7U A;  3UIN B;  1WGG A;  1Z2M A;  2Y5P A;  2K39 A;  2G3Q B;  2IYD B;  4YSY B;  4F7Z A;  1L7Y A;  3PO0 A;  2KDF B;  5E6P A;  1TT5 B;  3O13 A;  5FR6 A;  3VRA B;  2C5L C;  2GBM A;  3APD A;  1SE2 A;  5CHF A;  3P4S B;  2WXN A;  4HWI B;  1EF5 A;  5EE9 A;  3HHM A;  2SEB D;  2J4X A;  2CU1 A;  3OWE B;  3P42 A;  2QCZ A;  4PS3 A;  3BK2 A;  1P9D U;  2BS3 B;  4FJY A;  2FE8 A;  1EWY C;  2K9X A;  1KLG D;  2VZK B;  5BYR A;  3ZLZ A;  2N9X A;  1WZ0 A;  2KT7 A;  4E3C A;  1N5X A;  3KUZ A;  1E8Y A;  5C23 A;  1P0R A;  4A9A A;  4NJ6 A;  2KNB A;  2LHE A;  3ZO5 B;  3U2S C;  3ZJV A;  1UWM A;  3DBS A;  3AE9 B;  3DBH I;  3Q8C A;  3A9J B;  4KIK B;  3T3N A;  1ACC A;  2K6Q A;  4FXC A;  4B0M A;  2J0M A;  3AE3 B;  3L16 A;  1HE8 A;  4ASW C;  2V0G A;  2L3Z A;  2OJW A;  3QAQ A;  3HVZ A;  2NBW B;  3RT3 B;  1K8R B;  2AWT A;  2G4S A;  1IBX A;  2JVC A;  2UU7 A;  2WDQ B;  3QJZ A;  2CHZ A;  4NPN A;  2WXK A;  2WXH A;  4CO7 A;  1ZXI A;  1L5P A;  3RNF C;  4XX5 A;  1IBX B;  3TCA A;  4L2Y A;  3S2A A;  1GB1 A;  2KMA A;  4ANX A;  4PS7 A;  4FJV B;  2BYT A;  4HPL B;  4TSS A;  3U30 A;  2Y5B B;  2QSD A;  1P7F A;  5JZE B;  1HEZ E;  4ANW A;  4C00 A;  2O2V A;  1BUI C;  2WXR A;  2K0P A;  1N5W A;  1YN4 A;  1A5R A;  1TS4 A;  2KDM A;  2KTR A;  5BMI A;  3AEF B;  1R7S A;  2MA9 B;  4BFR A;  1WY8 A;  4MH0 E;  1SXT A;  2KMC A;  3MFG A;  1V2Y A;  5GMV A;  1Q1O A;  3MHZ A;  1DOY A;  3DVN V;  2FID A;  2ZEQ A;  2W9N A;  3I3T B;  4WWO A;  1FFU A;  3LB8 C;  4G50 A;  1IGC A;  3JYU A;  2ZCB A;  1F52 A;  3AE2 B;  1GJZ A;  4C7Z A;  1D4B A;  1C1Y B;  1JRO A;  2YEP B;  4BOS C;  2CKH B;  3APC A;  3HM6 X;  1T0S C;  2WDR B;  4JL9 A;  4DWF A;  1FCL A;  1V1P B;  4K3C A;  2WXI A;  1KTK A;  3SEB A;  4OZC A;  5DPW A;  1PGB A;  2M56 B;  1BT0 A;  1M94 A;  3ZIM A;  4NNJ B;  3UGB B;  3Q8B A;  5KHQ A;  1MJD A;  1RLF A;  2EKE C;  4KGR A;  2XBB C;  3QWZ B;  5IKC M;  2WNM A;  1I7H A;  4RMA A;  2KDI A;  2BB6 A;  2AQ2 B;  2LVO A;  3PT2 B;  1N61 A;  1WX7 A;  4GMV A;  2IY0 B;  2DZI A;  3TUO A;  1TS5 A;  5JHA A;  1N62 A;  1T0Q C;  1L6V A;  4ZHP A;  1FM0 D;  1QOF A;  3ZTC A;  2LWP A;  1QOA A;  3P4Q B;  1ZE3 D;  4R3D A;  4ZHO A;  3RNA C;  1Y8R C;  1YJI A;  2GI9 A;  3SFD B;  4DQO C;  1DOX A;  5BMG A;  4MDK E;  5EDS A;  4MGK E;  5CHV C;  2L32 A;  2K1F A;  4RGM A;  1TTN A;  5KHO A;  1FD6 A;  1WGH A;  4W9I A;  4DBG A;  1GAQ B;  3MC0 B;  2G1E A;  4G0N B;  3IAS 1;  1VZ7 A;  2DZM A;  2JU6 X;  1L0Y B;  4JIO U;  3VUY A;  3ZDM C;  1C78 A;  3B2G A;  1EU4 A;  1WR1 A;  3EUB 2;  2WGS A;  2QIL A;  4MM3 A;  2MJ3 A;  1TKE A;  4FA6 A;  2L52 A;  1PUT A;  1WXM A;  2IGG A;  2KLG A;  1JWB D;  2EMT A;  4HEA 1;  1L4D B;  4NQK E;  1WR6 E;  4HKQ A;  4GXB A;  2CS4 A;  5H92 C;  3P1M A;  4P1B C;  2WP9 B;  3A1Q A;  1J7C A;  4KSK C;  3GE3 C;  4FN2 A;  1GNU A;  4US8 A;  1VLB A;  4OHJ A;  3TEW A;  2INP E;  3IHP C;  3DBL B;  2I38 A;  2LGY A;  2KQS A;  3U8Z A;  3HM3 A;  5LNK 1;  3A4R A;  1SF0 A;  2NBV B;  3DCG A;  4II3 B;  3VUW A;  1WRD B;  2MP2 B;  2R2O A;  1E9M A;  1ZW7 A;  2BW2 A;  1KLV A;  1IPG A;  3DBR I;  4WH4 A;  3ZNZ B;  1VCB A;  2MBQ A;  2BF8 B;  5LXH A;  2QHO A;  3BVZ A;  3Q69 A;  2MW5 A;  5DPR A;  3AEE B;  2KTF A;  3VTW A;  2PLP A;  1NDD A;  5E6O A;  1SE9 A;  1V9J A;  1CZP A;  3RNG C;  2LGD A;  2JSV X;  1WE6 A;  4W9D A;  2VH1 A;  3R2T A;  1ZOY B;  3AE5 B;  2LGS A;  4IM2 A;  3BK1 A;  1FNV A;  3MJ5 A;  4MH8 A;  3JSV A;  2K8C A;  3IVF A;  3U7Z A;  2KWD A;  4HRS A;  3R8B A;  4W9E A;  3DVG Y;  3PRZ A;  3LDZ E;  4KGS A;  2MP2 A;  3CWI A;  3NS1 A;  1SE3 A;  2DWQ A;  4J6I A;  2LEK A;  1JWA D;  2NPT A;  4WQM A;  1E7V A;  1BML C;  2OOB B;  1V8C A;  2LD9 A;  2UWQ A;  1YJ1 A;  2JPH A;  4IWO A;  3QCA A;  2NMQ A;  2OJR A;  4EUT A;  3FIL B;  3K9P B;  3R7Q A;  2GLS A;  1FNW A;  4MSM B;  3SR6 A;  1IYF A;  5HI1 A;  4DHJ D;  4LCD E;  4B0E A;  3FIL A;  2M0A A;  1HZ6 A;  1ET9 A;  2DZJ A;  5DPS A;  2GOW A;  3N3K B;  2J52 A;  4IOI E;  4FAD A;  4LNN A;  2BVC A;  4A55 A;  3BWU D;  1WJ4 A;  1RFK A;  1J19 A;  2RD0 A;  2Z59 B;  4S17 A;  1YX5 B;  1UBQ A;  1V6E A;  1TZO A;  3PRM B;  3ZKJ C;  1F9J A;  2K25 A;  1AN8 A;  3QHT A;  1WMH B;  1YMH E;  3ALB A;  1TJE A;  2KAN A;  3RN9 C;  2ZNV C;  4C4V B;  1PYW D;  1SBB B;  3AN1 A;  2L0F A;  2H88 B;  1ROE A;  1K52 A;  3L0W B;  2RDG A;  2AEH A;  2IZV B;  2K3U A;  3AE7 B;  4FLH A;  4I6L B;  2QDF A;  1BXT A;  4GDK B;  3P2B A;  3V60 A;  1KH0 A;  5JXV A;  4N58 A;  4AS1 A;  2WS3 B;  3DVN U;  4REZ A;  2FNJ B;  3SFE B;  1YNT E;  3PLV A;  1MFW A;  3VH4 B;  1FNU A;  2LI5 A;  4LNO A;  4BKG A;  2BQQ A;  3MC8 A;  3KW5 B;  3APF A;  1VR9 A;  1QIL A;  2R61 A;  2LUE A;  1E8Z A;  2KFJ A;  3V6C B;  2BKF A;  4ICU A;  3CSF A;  1WSP A;  4ZRJ A;  2FCQ A;  1DGJ A;  3NY5 A;  3DHH C;  4M8N A;  1R4N I;  3PZD A;  1H4R A;  2IO3 B;  3OG5 A;  2N7J A;  4NAW A;  1SB3 C;  2D11 A;  4QAY A;  4M01 A;  2AL3 A;  3AEB B;  2WXL A;  1I4Q A;  1GG3 A;  4AP4 C;  4JWU C;  4XDC A;  1NEN B;  2BS2 B;  1B9R A;  4USA A;  2K8B A;  1UF0 A;  2Y3A A;  3ZW3 A;  4FHK A;  1A70 A;  2QIE B;  1KLU D;  1JML A;  4HCP B;  1ESF A;  4EFO A;  1V49 A;  2DYO A;  3M63 B;  2WX1 A;  3M62 B;  3HUI A;  2N9K A;  2FIF A;  4LJP B;  3PZ8 A;  3X23 A;  1M4V A;  4J3O D;  1X1M A;  4ZDV A;  4US9 A;  2MEK A;  2YEP F;  2MX2 A;  3VVW B;  1D5M C;  3GB1 A;  1KOT A;  1TYG B;  3IG3 A;  1UEL A;  3D32 A;  4PS8 A;  3Q8F A;  1VJK A;  4CQN A;  3Q3N C;  5IP4 D;  1WWT A;  4P16 A;  3N30 A;  1WIA A;  2D2Q A;  4EZK A;  4WAF A;  1IP9 A;  2JX5 A;  3X0W A;  2DBY A;  1JRU A;  3L54 A;  1WJN A;  2LRU A;  3PVL A;  1L2N A;  3NZ3 A;  4OZB A;  1ZPS A;  3IT6 B;  3PTF C;  5L95 C;  1C4C A;  3CF6 E;  2K8H A;  1T0Y A;  2CR5 A;  2M19 A;  4HPM B;  4WAA A;  5D2M B;  1VZ8 A;  1JQ4 A;  4LNK A;  1QF6 A;  2C7N B;  3AI5 A;  3DWM A;  3H9D A;  4AJY B;  4DHJ B;  1FPY A;  1RWS A;  1HZ5 A;  2IPK D;  4HCN B;  2D3C A;  4GIV A;  1V5T A;  4L23 A;  1AAR A;  5TR5 A;  2FUG 1;  4N6E B;  1EU3 A;  2ON8 A;  2IO2 B;  2KQ7 A;  4M8M A;  1SGH A;  2CJO A;  2VRR B;  4M02 A;  2AL6 A;  2MLB A;  1WRI A;  2MWS B;  4BKT A;  1WX9 A;  3PHX B;  4NAM A;  1ENF A;  2D5G A;  3GS2 A;  2W54 A;  3HIZ A;  4WJP A;  2WYQ A;  2HJ8 A;  1EUV B;  1WM2 A;  5EE0 A;  1L0X B;  2IGH A;  2D3G A;  3JW0 X;  3QK0 A;  4OVV A;  2NTT A;  4GOC A;  2KDE B;  2ZZP B;  2J53 A;  3VHT C;  3EFC A;  1P1A A;  1T0R C;  2G9H D;  2D07 B;  4FUL A;  2J0K A;  2K22 A;  1C9F A;  2HJ1 A;  4GU2 A;  4B6W A;  3AE6 B;  5BYS A;  1RYJ A;  4TV3 A;  1Q10 A;  2L76 A;  3TIX A;  4DHZ E;  2WU5 B;  1WGD A;  3BVG A;  4WWM A;  3NG0 A;  4GGQ A;  4NAW B;  1UUP A;  1PGX A;  3EC8 A;  2BWF A;  4GDL A;  1STE A;  3SD5 A;  1I4P A;  5AZF A;  2I1K A;  4Q2J A;  3TMP B;  2WDV B;  1IUE A;  1ZXH A;  3C8Y A;  5LLI A;  1HQR D;  4OW0 A;  2PE6 B;  2JT4 B;  2KDB A;  3RUL A;  5D3I B;  1KJT A;  4HJG E;  4MEL A;  2KFK B;  2JZP A;  2H89 B;  1XCQ L;  5IOI A;  4KZ0 A;  3EFU A;  4W9L A;  5G2N A;  2JXX A;  2DX5 B;  3KWL A;  2HD5 B;  2IND C;  2FCM A;  5J17 A;  4YSZ B;  1YN5 A;  4GDK A;  2PVO D;  4A8X C;  4ZYS A;  4RNA A;  4WWP A;  3VFK A;  4BAX A;  3NRZ A;  3PPA A;  3U52 E;  3A4S C;  1HXY D;  4KSL C;  5FKA C;  2KWU B;  1K50 A;  5I4D A;  1XT9 B;  1TKY A;  2IY1 B;  3CMM B;  3KVF B;  1FMA D;  1C77 A;  3ETR A;  1UZX B;  3KLS X;  3A9J A;  3DBH B;  3HRD D;  2VZK D;  3RFZ B;  1E6E B;  1CMX B;  2WHI A;  3AM9 A;  2O6V B;  5L83 A;  2KN5 A;  4JLC A;  4K3B A;  1XCT L;  4LTU A;  2EKI A;  3J9C A;  1UH6 A;  4RGT A;  2LXA A;  1I4H A;  4M00 A;  2WXO A;  4XWW A;  4EEW A;  2CJN A;  4GN1 A;  4HK2 A;  3O65 B;  3NUH B;  1LGR A;  4JGH B;  4HXD A;  1RFA A;  3RNB C;  1S1Q B;  3R3M A;  2KX0 A;  4YTM B;  2RDB C;  1JRP A;  1C4P A;  5G55 A;  3EGR A;  2NS5 A;  1JWU D;  1YQ3 B;  1KFY B;  2KJH B;  2JYE A;  3OJ3 A;  1MHX A;  1WXV A;  3H7S A;  4W9C A;  1GUA B;  1GB4 A;  2BGF A;  3QX1 A;  1WGK A;  3VQI A;  4DDG D;  1JWM D;  2JXT A;  4H2A A;  2BKR B;  4BBN F;  3Q6B A;  3ZUN A;  3NS8 A;  2DYM A;  3RNE C;  1EF1 A;  3L13 A;  1K53 A;  1SJH D;  4F8C B;  3JSV B;  1WE7 A;  1YX6 B;  3N1Y C;  4A90 A;  1FXT B;  5C1Z A;  1H8C A;  1WF9 A;  3AH7 A;  3QIJ A;  3PLU A;  3UQA A;  1SSN A;  2XN9 C;  4WJQ A;  2KC1 A;  3T9L A;  2V1Y A;  4WQO B;  2MCN B;  2EEL A;  5G5H A;  2N9L A;  2KMM A;  3AMZ A;  3A33 B;  4XGA B;  1FIQ A;  2OED A;  3AEA B;  3MP9 A;  4AOF A;  1C3T A;  4YL8 A;  1WGR A;  2LXC A;  1MI0 A;  2GBN A;  1DYQ A;  4FHJ A;  3I9V 1;  2JF5 A;  2AQ1 B;  4GSW A;  3TL5 A;  3V05 A;  3RYT A;  4FJZ A;  1OEY A;  3W1Y A;  4PYZ A;  1RRB A;  2N9P C;  2HTM E;  4ZYN A;  2GBR A;  1NI3 A;  4TUU A;  5D7G A;  4LDT D;  3V3X A;  3AE8 B;  3L10 B;  2LZ6 A;  1KF6 B;  1RAX A;  2Z0E B;  2REX A;  5TSS A;  2MBE A;  3ML8 A;  1YQ4 B;  1JCK B;  4MJS A;  3ONS A;  1MG4 A;  1YD8 U;  4BZA A;  1TS2 A;  1J0G A;  2KZR A;  2YLM A;  2KO3 A;  1TIF A;  1AWD A;  3VUX A;  3AB5 A;  1TBE A;  3A1Q B;  4NJ7 A;  2PTL A;  4RGO S;  4EZJ A;  3V6E B;  1VZ6 A;  3DHG C;  4NY0 A;  5JHB A;  1J8C A;  2IJ0 A;  4KVG B;  3FKY A;  3H8H A;  3RZF A;  2XK5 B;  1XLN A;  3E9S A;  2CHX A;  1U4A A;  1JAL A;  3A9K B;  2D3A A;  4HDO A;  3UIO B;  5C3J B;  1GOZ A;  3QQ8 B;  2JQR B;  2LHD A;  4YT0 B;  2KHW B;  4RF0 A;  2KJ6 A;  3BIN A;  1ET6 A;  1C76 A;  5AUI A;  1WFY A;  4W9J A;  2C7M B;  4FBJ B;  5E6N A;  2MBB B;  4KZC A;  1WX8 A;  4MAC A;  1FXI A;  4KDI C;  3RMK C;  2MJE A;  4LNI A;  3T8M A;  4N59 A;  2ZPY A;  1VD2 A;  4IWQ A;  4K7U A;  3E56 A;  1XLO A;  3RZW C;  2N1V A;  3B0A A;  3W1S C;  1LM8 B;  1E8X A;  1P3Q U;  1RM6 C;  3Q3F A;  4XDD A;  3UF8 A;  4WWN A;  3BY4 B;  2GMI C;  2KC2 A;  4F1S A;  3MC9 A;  1F0Z A;  1B1Z A;  3VDZ A;  1F1H A;  1J7A A;  3N9Y C;  1CQV A;  3PHW B;  4XYC A;  4B9K A;  3M3J A;  1I4R A;  3B2F A;  2DAF A;  3AEG B;  4II2 B;  4YXD B;  2WXP A;  4RCO A;  1NI2 A;  3Q3M C;  3FAH A;  5IA7 A;  2WLB A;  3Q2A C;  1AW7 A;  4AJW A;  1VRA B;  1V1O A;  4BOZ B;  3VRB B;  2FCN A;  3WAP A;  2SAK A;  1QLB B;  4OVZ A;  2C9W B;  3KYD D;  3R2I A;  2MHJ A;  1PQS A;  3HK0 A;  2RPV A;  2JWZ A;  1QOG A;  3KQ4 A;  2RSU A;  1YJJ A;  3IFW B;  4NQL B;  1R4M I;  2LUM A;  4CHK A;  1S3S G;  1T5X D;  1V86 A;  2W3R A;  3NVW A;  3ZYY X;  4A3P A;  2L83 A;  3OJ4 B;  1KM7 A;  2ZVN A;  3TEY A;  3Q3J A;  4ITK A;  4RFB A;  4RF1 A;  1I4X A;  4TMA B;  4KKJ A;  1XF5 L;  2BB5 A;  2MBO A;  1NBF C;  3ENE A;  5CHW A;  3DPD A;  3IAM 1;  1UWX A;  1WYW B;  3RNC C;  4C4V A;  4AWJ A;  5J18 A;  1E0Z A;  4JQW C;  5D6J B;  4W9K A;  2BWE S;  1PFD A;  1WMH A;  3W5U B;  2KLC A;  1E7P B;  3VR9 B;  1Y56 A;  1F2R C;  3I5J C;  4BVU C;  2X38 A;  1ZDV A;  2N9E B;  3DBR B;  3PGE A;  3L4P A;  2WXQ A;  1OGW A;  2M17 A;  2D3B A;  2XK5 A;  1UBI A;  3EHV A;  4JE3 B;  3BII D;  4X57 B;  1N63 A;  2WXM A;  5JH5 C;  4KIK A;  1JWS D;  2XEW A;  1EO6 A;  4K7S A;  4MGZ E;  3UIP B;  1GC7 A;  1OEY J;  3RI7 C;  3W2D A;  2V4L A;  2V9H A;  3BYT B;  1NVI D;  2B3A A;  2LAS A;  2QMT A;  3SU8 X;  4KDL B;  3N20 C;  2W3S A;  1GPX A;  3R66 C;  4RM8 A;  2BT6 A;  2INC C;  2HDE A;  2KFK A;  3UQB A;  3TSS A;  3MHS D;  1E8W A;  4W9H A;  3VTV A;  2NPT B;  1XLQ A;  3DOW A;  1HA5 A;  1FO4 A;  4PYU A;  3VTU A;  4MSQ B;  4A20 A;  4M0W B;  1WGY A;  2N7D A;  2ZPN A;  2MRP A;  2PVG C;  2WQY B;  2JZZ A;  5CX3 A;  2C7H A;  3R7R A;  5EE1 A;  2DEN B;  2HTH A;  3GZN B;  2HE7 A;  4MGY E;  3H7P A;  2KVR A;  3QAR A;  4P6V F;  3P4P B;  3VR8 B;  2N7E A;  4BBN C;  2BPS A;  2E6X A;  2Q5W D;  2L0T A;  3WAN A;  1DOI A;  5G5G A;  3NVV A;  3W5V B;  1QT9 A;  1F77 A;  2JY6 A;  4KV2 A;  3PSE B;  3TBL D;  2KWV B;  4AUQ C;  3L08 A;  2M0X A;  4KGT A;  1Z5S B;  3GOE A;  2AYO B;  3ZNI D;  3KYC D;  4ZRI A;  4LLG M;  5IO9 A;  4URK A;  2KAC A;  3ZJU A;  4AQ7 A;  4XE0 A;  2CHW A;  1TY2 A;  4DXF A;  4XZ4 A;  1WJ6 A;  3WIM A;  5C2T B;  3B08 A;  4IG7 B;  2WU2 B;  4LDT B;  4JWS C;  4UDU C;  4YWG G;  4OVU A;  2BTE A;  2FUH B;  2DYB A;  2QJL A;  3IT4 B;  3ZTD A;  4M0W A;  1AYF A;  2NBU A;  2V4I B;  2BBC A;  4GDL B;  3NHE B;  3AUL A;  3NVY A;  1WXA A;  4TKN A;  1TY0 A;  3AXC A;  4ZOH C;  3N1Z C;  2J7Q B;  1V80 A;  4BKS D;  2ZW1 A;  2LVQ A;  2KTR B;  4XWT A;  1MPE A;  2PJH A;  3LXF A;  2OHF A;  1GC6 A;  3SHQ A;  1D6E C;  4B95 A;  4G11 A;  1T3Q A;  2JZ3 B;  3B9J A;  4EE2 A;  4DXG A;  2DZK A;  1YN3 A;  3ABV B;  3MJW A;  1L4Z B;  4IM3 A;  5H8Y E;  2ICI A;  3OAW A;  3RPF C;  2ZCC A;  2WDT B;  4NJC A;  5HFY A;  1WI0 A;  1C4A A;  2N1W A;  2O6V D;  3Q8E A;  3ECI A;  3CST A;  3AV8 A;  4GB9 A;  1MHH E;  1XD3 B;  4E71 A;  2KXJ A;  2EMS A;  2PEA A;  2G4D B;  3BZD B;  2J0J A;  5MPO A;  4ZRP A;  4C7Y A;  4OZA A;  4EOY A;  1QQR A;  5BO4 B;  1XQQ A;  4K7W A;  1OQY A;  3DWG C;  1HTO A;  1NEK B;  3I57 A;  2LVP A;  3T3O A;  3H6N A;  3L17 A;  1K51 A;  2B76 B;  4MGI E;  3NZU A;  2GBJ A;  2XNA C;  2GRI A;  3EA6 A;  5HKH A;  2KYW A;  2LFI A;  3P4R B;  3GP7 A;  1J7B A;  1V1P A;  1N6Z A;  4HDQ A;  3MTN B;  1TKG A;  2G45 B;  2K6D B;  4A6Q A;  3H7P B;  1UNS A;  2DNF A;  3SDL C;  4ANV A;  2LRW A;  4DK5 A;  4RM9 A;  4ARI A;  1D3Z A;  1YQB A;  3WAO A;  5DPT A;  3P63 A;  2CU3 A;  1WYG A;  3PV1 A;  3ML9 A;  5LXI B;  4DDI D;  3B1L X;  3PZ7 A;  5CTR C;  2NTS A;  4L1B A;  2PW9 A;  4HPP A;  3GE8 C;  2GBK A;  2INN E;  3ZXR A;  4EZL A;  3ZVV A;  3NVZ A;  3TJP A;  1I4G A;  3IXS A;  1C79 A;  2J42 A;  1V81 A;  4HRO A;  4KX6 B;  4NZL B;  3KWV A;  4N9F 4;  4JX1 C;  1XO3 A;  4ZRQ A;  1FRR A;  3ZDT A;  2L1A A;  2IO0 B;  2ONQ A;  4HLE A;  2IGD A;  1CK1 A;  1SJE D;  4K81 A;  1TGZ B;  2X8X X;  4IC7 B;  1FRD A;  2N4F A;  2QEJ C;  3JVZ X;  1CJE A;  2PIA A;  2KJR A;  1SEB D;  4C80 A;  5HHD G;  1ZDX A;  2I1J A;  4GLS C;  1G6J A;  2Y5C A;  3ZQ4 A;  4HVB A;  2TSS A;  4CYE A;  1ZGU B;  3W1S A;  2YVC A;  1WZ3 A;  2MH7 A;  2Z0D B;  4D2K A;  1FFV A;  3OLM D;  2KOX A;  4W9F A;  1FCC C;  5IN7 A;  4YTN B;  1SE4 A;  1LFD A;  5AZH A;  5T8I A;  2LGI A;  4E74 A;  2KK8 A;  5AZG A;  2WXF A;  1NYR A;  4LJO B;  3IBE A;  2L00 B;  3DHI C;  1V97 A;  3DVG X;  2W82 A;  3PS6 A;  2A4Z A;  3ZNH B;  2MSE D;  4DHZ B;  2MQJ A;  3KUC B;  2V3P A;  1QOB A;  5AEK B;  2UYZ B;  2MBH A;  1XLP A;  1YIW A;  3QC8 B;  4WUR A;  4MJS B;  4P1C C;  3WAL A;  1LXD A;  3PRE A;  2D10 A;  4RH6 A;  2R2Q A;  2NR2 A;  4YTP B;  1ZP0 B;  3ZNG C;  5J2R A;  3Q8A A;  3W9C B;  3ZRF A;  3C0R B;  1SIJ A;  4I6N B;  3M95 A;  4IUM B;  3QA8 A;  1QZE A;  1Q5W B;  4HJK A;  1VDV A;  4LNF A;  3TEX A;  1Q0W B;  4WIP A;  2RMM A;  3I63 C;  1FEH A;  3NOB A;  3VH3 B;  2KAJ A;  2IBI B;  1WJU A; 
#chains in the Genus database with same CATH homology
 5BMG A;  1Y56 A;  2K22 A;  1C9F A;  1F2R C;  2X38 A;  1ZDV A;  3L4P A;  2L32 A;  2WXQ A;  4IKG A;  3AE6 B;  5BYS A;  1RYJ A;  4RGM A;  1FD6 A;  1Q10 A;  1L0V B;  4JE3 B;  3BII D;  1GAQ B;  3MC0 B;  2G1E A;  3BVM A;  1WXQ A;  3IAS 1;  1N63 A;  2KN4 A;  2WXM A;  1VZ7 A;  3AED B;  2JWU A;  2WU5 B;  2JU6 X;  1L0Y B;  3BVG A;  4PT5 A;  1JWS D;  1C78 A;  1EU4 A;  3B2G A;  1D5Z C;  4WWM A;  4C56 C;  3EUB 2;  3URY A;  2QIL A;  3AEC B;  4NAW B;  2KQ4 X;  2MJ3 A;  1TKE A;  1UUP A;  5E6J A;  2L52 A;  1PGX A;  3W2D A;  1PUT A;  2IGG A;  4HEA 1;  1JWB D;  1L4D B;  4HKQ A;  3BYT B;  1NVI D;  2W55 A;  4LK0 M;  2V3N A;  1STE A;  2QMT A;  5H92 C;  3P1M A;  2AQ3 B;  2W3S A;  1I4P A;  1GPX A;  4Q2J A;  2WP9 B;  2BT6 A;  2N0S B;  2WDV B;  2HDE A;  4O1N A;  1J7C A;  1IUE A;  1ZXH A;  3TSS A;  3C8Y A;  1HQR D;  4US8 A;  1XLQ A;  1HA5 A;  2JYT A;  1XXG A;  4OW0 A;  3LYY A;  1FO4 A;  1VLB A;  5D3I B;  1E10 A;  4OHJ A;  4MT5 A;  2INP E;  4HJG E;  3TEW A;  2I38 A;  2PVG C;  2WQY B;  4TQ1 A;  2JZP A;  2DLB A;  5LNK 1;  2H89 B;  1XCQ L;  4TQ0 A;  5EE1 A;  1SF0 A;  1E9M A;  2LJI A;  2BW2 A;  2FBW B;  1N60 A;  3ZJT A;  4P6V F;  4WH4 A;  2LMC A;  3AE1 B;  3P4P B;  3VR8 B;  3KWL A;  2E6X A;  2Q5W D;  4YSZ B;  1YN5 A;  2Z8L A;  2PVO D;  4A8X C;  4ZYS A;  4RNA A;  1DOI A;  5G5G A;  4KKI A;  3NVV A;  3W5V B;  1QT9 A;  3NRZ A;  1F77 A;  3U52 E;  1HXY D;  5FKA C;  3BVZ A;  3Q69 A;  2BS4 B;  1K50 A;  2RDH A;  5FK9 C;  3AEE B;  5I4D A;  1LO5 D;  1OQQ A;  1TKY A;  1FMA D;  1C77 A;  3ETR A;  2PLP A;  4KGT A;  4LLG M;  3KLS X;  1FXA A;  2AX5 A;  5FR3 A;  1CZP A;  2WXG A;  5GXG B;  2KAC A;  2JSV X;  3ZJU A;  1NYQ A;  3HRD D;  3R2T A;  1ZOY B;  4XE0 A;  4AQ7 A;  2VZK D;  1TY2 A;  3AE5 B;  4DXF A;  2I2Y A;  2PKO A;  3RFZ B;  3TEZ A;  5C2T B;  1E6E B;  3BK1 A;  1FNV A;  3MJ5 A;  2MJD A;  2WU2 B;  2IDY A;  3AM9 A;  4MH8 A;  4JWS C;  3FC4 A;  4UDU C;  3ZGZ A;  4YWG G;  1IGD A;  2WXJ A;  3U7Z A;  1XCT L;  2BTE A;  2KWD A;  4LTU A;  2EKI A;  4HRS A;  3J9C A;  4RGT A;  2QJL A;  3IT4 B;  3CIR B;  4M0W A;  1I4H A;  1AYF A;  4JPS A;  5HG2 A;  3R8B A;  2WXO A;  4XWW A;  2V4I B;  2CJN A;  2BBC A;  4GDL B;  5EE3 A;  4YSX B;  1OFF A;  3NVY A;  4KGS A;  3NUH B;  3CWI A;  3NS1 A;  1SE3 A;  2DWQ A;  1TY0 A;  1EM7 A;  5BMH A;  2LEK A;  4MM3 B;  4ZOH C;  4YTM B;  1EWC A;  1JWA D;  3BYY B;  3HVD A;  4WQM A;  1JRP A;  1BML C;  1V8C A;  1C4P A;  2GB1 A;  2ZW1 A;  5D3D A;  1TS3 A;  4XWT A;  1MPE A;  3EGR A;  1T6B X;  3LXF A;  1JWU D;  3AE4 B;  2K5P A;  2OHF A;  1YQ3 B;  2NMQ A;  1KFY B;  1D6E C;  3FIL B;  2ZW0 A;  1T3Q A;  5AUK A;  1FNW A;  1P7E A;  2JYE A;  3B9J A;  3SR6 A;  4DXG A;  1OQR A;  4EE2 A;  1YN3 A;  3ABV B;  1L4Z B;  5HI1 A;  5H8Y E;  1MHX A;  2ICI A;  4B0E A;  2E3T A;  3FIL A;  2M0A A;  3RPF C;  1GB4 A;  1QKZ A;  1ZUD 2;  4RGN A;  1HZ6 A;  4NJC A;  1WGK A;  5HFY A;  3VQI A;  1ET9 A;  4ARC A;  1PGA A;  1C4A A;  1JWM D;  2JXT A;  4H2A A;  3Q8E A;  2J52 A;  4IOI E;  3UI3 A;  4A55 A;  1KRH A;  2ACZ B;  3BWU D;  5BYQ A;  1F2R I;  2DYM A;  1RFK A;  1K53 A;  1SJH D;  1TZO A;  1XEE A;  1MHH E;  3AV8 A;  3WCQ A;  4A90 A;  1AN8 A;  3AH7 A;  3BZD B;  1YMH E;  1SSN A;  2PMV A;  2XN9 C;  5MPO A;  1D5X C;  1TJE A;  2EEL A;  5G5H A;  4ZRP A;  4C7Y A;  2N9L A;  4OZA A;  2KMM A;  3AMZ A;  4IDI A;  3U4E G;  1QQR A;  1PYW D;  1MVK A;  1SBB B;  3AN1 A;  1JW9 D;  1L6U A;  1FIQ A;  2H88 B;  4HKZ E;  3DWG C;  1ROE A;  2OED A;  3AEA B;  1K52 A;  3MP9 A;  1NEK B;  2RDG A;  3I57 A;  3T3O A;  1UGJ A;  1MI0 A;  2K3U A;  1DYQ A;  3AE7 B;  3I9V 1;  1PDX A;  1K51 A;  1BXT A;  2AQ1 B;  4GDK B;  2B76 B;  2Y5P A;  3V05 A;  4YSY B;  1KH0 A;  5JXV A;  2HTM E;  3PO0 A;  4N58 A;  4AS1 A;  1NI3 A;  2WS3 B;  5D7G A;  2XNA C;  4REZ A;  3O13 A;  2GRI A;  3V3X A;  3SFE B;  3VRA B;  3EA6 A;  1YNT E;  3AE8 B;  1KF6 B;  1SE2 A;  2LFI A;  3P4R B;  5TSS A;  1FNU A;  3P4S B;  3GP7 A;  1YQ4 B;  1JCK B;  1J7B A;  2WXN A;  1V1P A;  1VR9 A;  5EE9 A;  1TKG A;  1TS2 A;  2SEB D;  1QIL A;  4A6Q A;  2R61 A;  1UNS A;  2J4X A;  1AWD A;  3OWE B;  3P42 A;  3AB5 A;  4ARI A;  1WSP A;  3BK2 A;  2BS3 B;  2FE8 A;  3P63 A;  1EWY C;  2CU3 A;  2K9X A;  2PTL A;  1DGJ A;  4RGO S;  1KLG D;  2VZK B;  5BYR A;  1WYG A;  1VZ6 A;  1N5X A;  3PZ7 A;  2IJ0 A;  2NTS A;  3H8H A;  4L1B A;  4A9A A;  2PW9 A;  2LHE A;  3U2S C;  3ZJV A;  2N7J A;  1UWM A;  1XLN A;  1SB3 C;  2INN E;  3AE9 B;  3Q8C A;  3E9S A;  3AEB B;  1JAL A;  3NVZ A;  2WXL A;  3T3N A;  1ACC A;  4FXC A;  1I4Q A;  1I4G A;  4B0M A;  3IXS A;  1C79 A;  2J42 A;  3AE3 B;  4JWU C;  4XDC A;  1NEN B;  2V0G A;  4HRO A;  4KX6 B;  5C3J B;  4NZL B;  1GOZ A;  2BS2 B;  3HVZ A;  3KWV A;  4YT0 B;  2JQR B;  2LHD A;  1B9R A;  4RF0 A;  4JX1 C;  4USA A;  1XO3 A;  4ZRQ A;  1ET6 A;  1FRR A;  1IBX A;  2L1A A;  1C76 A;  2WDQ B;  2ONQ A;  2Y3A A;  2IGD A;  5AUI A;  1CK1 A;  1SJE D;  2WXK A;  1A70 A;  2WXH A;  2QIE B;  1KLU D;  1JML A;  1ESF A;  1ZXI A;  1L5P A;  1FRD A;  2DYO A;  4MAC A;  1IBX B;  1FXI A;  2N9K A;  3HUI A;  2QEJ C;  4L2Y A;  2MJE A;  3PZ8 A;  1GB1 A;  1M4V A;  4N59 A;  1CJE A;  4J3O D;  2PIA A;  1SEB D;  4C80 A;  2BYT A;  3E56 A;  4TSS A;  1XLO A;  5HHD G;  2QSD A;  4US9 A;  1ZDX A;  1RM6 C;  1P7F A;  2MEK A;  1HEZ E;  4XDD A;  2YEP F;  4GLS C;  1D5M C;  3GB1 A;  2Y5C A;  3ZQ4 A;  2TSS A;  1BUI C;  1TYG B;  1F0Z A;  2WXR A;  2K0P A;  1B1Z A;  3W1S A;  1N5W A;  1J7A A;  3N9Y C;  3Q8F A;  1YN4 A;  1VJK A;  1CQV A;  1TS4 A;  2MH7 A;  4D2K A;  4CQN A;  1I4R A;  3B2F A;  1WWT A;  2KDM A;  1FFV A;  4P16 A;  5BMI A;  3AEF B;  4WAF A;  1R7S A;  3AEG B;  2JX5 A;  1FCC C;  4YXD B;  2WXP A;  4RCO A;  2DBY A;  4YTN B;  1SE4 A;  1SXT A;  3FAH A;  3MFG A;  5T8I A;  2WLB A;  2LGI A;  1AW7 A;  3NZ3 A;  1VRA B;  1V1O A;  3MHZ A;  4OZB A;  3VRB B;  1ZPS A;  1DOY A;  3IT6 B;  1FFU A;  2SAK A;  1C4C A;  3LB8 C;  1QLB B;  4OVZ A;  1IGC A;  3R2I A;  3AE2 B;  2WXF A;  1NYR A;  4C7Z A;  1D4B A;  2M19 A;  2RPV A;  1JRO A;  2YEP B;  1VZ8 A;  1JQ4 A;  1QF6 A;  2WDR B;  1V97 A;  2W82 A;  3DWM A;  1QOG A;  1FCL A;  3KQ4 A;  1V1P B;  1YJJ A;  2WXI A;  1KTK A;  1RWS A;  3SEB A;  1HZ5 A;  2IPK D;  4OZC A;  2LUM A;  1PGB A;  2V3P A;  2M56 B;  1QOB A;  1T5X D;  2W3R A;  1XLP A;  4WUR A;  3NVW A;  3ZYY X;  2L83 A;  3Q8B A;  4L23 A;  4KGR A;  2FUG 1;  4N6E B;  3TEY A;  1EU3 A;  2WNM A;  1I7H A;  2ON8 A;  4RH6 A;  4ITK A;  2CJO A;  4YTP B;  1ZP0 B;  2BB6 A;  2AQ2 B;  3Q8A A;  4RFB A;  1N61 A;  4RF1 A;  3W9C B;  1I4X A;  1WRI A;  4TMA B;  4KKJ A;  1XF5 L;  2BB5 A;  1SIJ A;  1UWX A;  3IAM 1;  4NAM A;  3TUO A;  1TS5 A;  1ENF A;  2D5G A;  3GS2 A;  2W54 A;  1N62 A;  5EE0 A;  1E0Z A;  1L0X B;  2IGH A;  1L6V A;  4ZHP A;  1FM0 D;  1QOF A;  1QOA A;  1VDV A;  3P4Q B;  1ZE3 D;  2NTT A;  2RMM A;  4WIP A;  4R3D A;  3TEX A;  4ZHO A;  1PFD A;  2J53 A;  1FEH A;  1YJI A;  2GI9 A;  2KAJ A;  3W5U B;  1E7P B;  2G9H D;  3SFD B;  4DQO C;  1DOX A;  3VR9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...