1K51A

A g55a mutation induces 3d domain swapping in the b1 domain of protein l from peptostreptococcus magnus
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
72
structure length
72
Chain Sequence
MHHHHHHAMEEVTIKANLIFANGSTQTAEFKGTFEKATSEAYAYADTLKKDNGEWTVDVADKAYTLNIKFAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein L
publication title Single-site mutations induce 3D domain swapping in the B1 domain of protein L from Peptostreptococcus magnus.
pubmed doi rcsb
source organism Finegoldia magna
molecule tags Protein binding
total genus 11
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2001-10-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1k51A00
1C9FA 1PGXA 1F2RC 1GB4A 2ONQA 2PTLA 1YMHE 2QMTA 2JZPA 1XF5L 2KN4A 4OZBA 3MP9A 3V3XA 4IOIE 4KGTA 1K50A 1MHHE 5BMIA 2LUMA 2IGDA 1MVKA 2N9LA 2IGGA 2ON8A 2JWUA 1ZXHA 1XCQL 1HZ6A 2RMMA 5HFYA 1IBXB 5HI1A 2LGIA 3UI3A 2PW9A 2GB1A 3FILA 2KQ4X 1IBXA 2I2YA 4WH4A 1QKZA 2EELA 1FCLA 2J53A 2N7JA 2LHDA 1KH0A 2ZW1A 1JMLA 2KDMA 5HHDG 4KGSA 5BMHA 5HG2A 4D2KA 1EM7A 2LHEA 1MPEA 1HEZE 3FILB 5JXVA 1HZ5A 1UWXA 1IGCA 2NMQA 2KWDA 1GB1A 2I38A 1Q10A 1PGBA 4OZCA 2N9KA 4HJGE 2J52A 1P7FA 2PLPA 1K52A 1D4BA 1XCTL 2IGHA 1K51A 2JSVX 4MACA 2K0PA 2ZW0A 1YNTE 2QSDA 4HKZE 2RPVA 4GLSC 2GI9A 2JU6X 1MHXA 4IKGA 1MI0A 1IGDA 1P7EA 2KACA 1F2RI 5BMGA 1PGAA 2JXTA 1FD6A 4OZAA 4KGRA 2OEDA 3GB1A 1K53A 1FCCC
chains in the Genus database with same CATH superfamily
2LGYA 4F7ZA 1BMLC 3V61A 2J7QB 3ETRA 3MHSD 2N9EB 3RNCC 2JQRB 1I42A 3PREA 2ONQA 1YMHE 3MC8A 4OZBA 1YN5A 4WURA 2QJLA 3A9JB 3AECB 1BXTA 2MP2A 1P98A 2M4NA 1Y56A 4WAFA 3PRPB 3JVZX 3O65B 3TJPA 5HKHA 1T0YA 1WMHB 2BS4B 4A9AA 3SFEB 2FIDA 1V6EA 4DDID 4EZKA 3VRAB 2HTME 4WWOA 5TSSA 2KAJA 4L1BA 3S2AA 3EC8A 2CU1A 1OFFA 2K8BA 2RDHA 3AXCA 1ZXIA 3L10B 2KTFA 1WX9A 2PIAA 3PRMB 2WXOA 3N1YC 2KLCA 3BZDB 4MACA 4HDOA 4BKSD 2R2OA 4G0NB 2D3GA 1VR9A 2PKOA 5L83A 4PK1A 1MI0A 3RZFA 1X1MA 3WAMA 1WM3A 3AMZA 4US8A 2CKHB 4OZAA 3QHTA 2IY1B 3PZ8A 1TS3A 4LCDE 2BB6A 2HD5B 3UQBA 1SE2A 3AE7B 1FXAA 2JX5A 4EOYA 5D7GA 2KDBA 2Y3AA 4CYEA 4W9EA 2KZRA 3Q8BA 1PQSA 4WJOA 1GNUA 3RUIB 1WGYA 1WI0A 4MM3B 2RMMA 3VH3B 1GG3A 5FR3A 1YX5B 2QIEB 1NYRA 1R4MI 3ZXVA 2KTRA 3FAHA 4C56C 4HROA 3ZGZA 2KJRA 3AH7A 2IBIB 2DAFA 5DPWA 4FJVB 1R7SA 2ZEQA 1KLUD 2V3PA 3GZNI 3ONSA 4OVZA 2H88B 1RM6C 1L2NA 5DPTA 3LB8C 4WJPA 4WWNA 1HEZE 1E8XA 5D2MB 1E6EB 3R2TA 2N9KA 3V6CB 2ICIA 5J17A 4W9KA 3QARA 3ZIMA 4XDCA 1XCTL 4ZHPA 1JWBD 1KOTA 4BAXA 2RPVA 1MG4A 4HEA1 2GBMA 1Z2MA 1V1PA 2IDYA 3B08A 4K7SA 1PUTA 3PHXB 3NRZA 3Q2AC 1JCKB 4JWUC 1WRIA 1SIJA 1EWYC 3B2FA 2LVOA 3L13A 1XO3A 3V05A 2MJ3A 1WH3A 4ZRKA 2SAKA 2WX0A 2WU2B 5C2TB 4E71A 2GOWA 1S1QB 3BINA 2AL6A 3P4RB 3JSVA 1UD7A 2O6VA 2V0GA 1GOZA 2RD0A 4XC2A 4DHZE 2VH2A 1WE7A 2MX2A 4C4VB 3UINB 1M94A 4A3PA 4K7UA 4PS3A 3UIOB 2X38A 1RFKA 2R2QA 3EFCA 3DWGC 4OVUA 1IYFA 4HCPB 4YTNB 1ROEA 1TIFA 5I4DA 2G45B 3BWUD 4K1RB 4C80A 1AWDA 5HG2A 4MGZE 3NZ3A 2LI5A 1UUPA 3V62A 3VUYA 4FBJB 2IO2B 5JXVA 3I63C 3AE2B 1XD3B 2KWDA 2MBHA 4G50A 2KX0A 3VVWB 1Q10A 2W82A 3HIZA 3NJTA 3Q8AA 2BB5A 2KJHB 3A4RA 3P4SB 1UELA 3OG5A 5D94A 1SJHD 1UF0A 1MJDA 4HKZE 1N61A 2BS2B 3TCAA 3ZXRA 4AWJA 4HKQA 3PGEA 3JYUA 4KIKB 2FIFA 2A5UA 1FXIA 3BYTB 1TTNA 1UNSA 5LLIA 2LMCA 4FHKA 1RYJA 1AYFA 2XK5A 1PGXA 2MWSB 3BIID 3QCAA 2GLSA 2KT7A 2N0SB 4XGAB 3NVWA 2K6QA 2XBBC 4P6VF 1PFDA 2G9HD 2Z8LA 1HA5A 2JF5A 3QA8A 3SFDB 2DZJA 5TR5A 1RLFA 1GAQB 2KXJA 2O2VB 3J9CA 2ON8A 3N32A 2WNMA 1JWSD 1QZEA 3PV1A 2RGFA 2MBOA 2KWCA 3UGBB 1WXSA 2ZPNA 4XX5A 3L08A 4HXDA 3RN9C 1QKZA 4JE3B 1KJTA 1TKEA 2FAZA 3W9CB 2KO3A 1CZPA 3WIMA 2N1VA 1VJKA 2KC1A 2N4FA 2CHZA 1XLPA 1ZGUB 3DBHB 1C4AA 1SE4A 3L0WB 1QT9A 3QK0A 2G1EA 3AE5B 2NS5A 2QC8A 4RGTA 4LK0M 5FK9C 1GC7A 1XLOA 1C78A 1RWSA 4PYZA 3RNGC 4GGQA 3AN1A 4N9F4 2WDTB 5JHAA 1L4ZB 2AQ1B 3Q6BA 2BYFA 1V86A 3FKYA 1ZUD2 3EHVA 2BBCA 3K9OB 2MBBB 1I4GA 3I3TB 1EF5A 2DENB 5BYRA 3PT2B 3R3MA 4NQKE 1ACCA 2KD0A 3W5VB 4KZCA 4ZOHC 1KFYB 2QCZA 1N5WA 4DHJD 4G11A 1FEHA 1ESFA 1VRAB 2DWQA 1M4VA 1SXTA 2GRIA 2M1MA 1TYGB 2O6VD 2E6XA 4EKUA 4GXBA 4N58A 2KK8A 2M8SA 1YJ1A 1WFYA 3GS2A 2WP9B 3U7ZA 5BO4B 4NY0A 1IBXA 3ZJUA 4M00A 3GP7A 2G4SA 3AEBB 4MT5A 3CIRB 3ZYYX 1C76A 2WX1A 1TS5A 2MW5A 1T3QA 1ZP0B 1FCLA 1C1YB 3KH0A 3VTWA 2ZVNA 2JXXA 2PMVA 3IFWB 5EE1A 5G55A 3A9KA 4AQ7A 4A90A 5AEKB 2IO0B 2D07B 1VD2A 2LWPA 4B9KA 3KWLA 2N9PC 1WXMA 3A1QB 4JX1C 3M62B 2QILA 2INCC 4IWQA 1F52A 3WALA 4RF1A 1TKGA 5KHQA 2LD9A 1MG8A 3N30A 3PS6A 4E74A 1DOXA 1D5MC 4K3BA 1I4QA 5C1ZA 4W9JA 3N3KB 2DZIA 3QWZB 4KGRA 1GB1A 2KLGA 2LGSA 2RR9A 3GOEA 1L0VB 2AEHA 1WJ6A 2OJRA 2WXPA 1LFDA 2JZPA 3N9YC 5GMVA 2WLBA 2K3UA 4BZAA 4GIVA 1ZOYB 3DQVA 3MJ5A 1MVKA 2KMAA 2RDGA 3SD5A 2EKEC 3ZVVA 3MFGA 2JUOA 1F0ZA 1GUAB 4FADA 3KWVA 4NAMA 3VUWA 1LQBA 2AYOB 4MJSB 1E7VA 3E56A 5L95C 2B3AA 1VCBA 2EKIA 1TT5B 5CHWA 4YSXB 2I1JA 3E9SA 1ZDXA 1QILA 2BWES 2LXCA 2UWQA 2NBUA 3ZDTA 2N7JA 3TIXA 2A4ZA 3ZNID 3MC0B 2D11A 3BVGA 2MCNB 4WQMA 1E5WA 4DBGA 3HVDA 2G3QB 4B0EA 1YN3A 1FNUA 5D6JB 3ABVB 4LNIA 3DBRB 4TUUA 4US9A 2HDEA 2ZNVB 4GDKA 2VRRB 3UF8A 1CMXB 2Z0DB 2C7NB 2IGHA 2WXNA 4ASWC 1V97A 4MH0E 3Q8CA 2TSSA 4GDLB 3RNBC 1PDXA 1WJNA 4EEWA 4NAWA 1WY8A 1UBQA 3Q8FA 4QAYA 2GBRA 4DXAB 1SIFA 4TMAB 1FM0D 5DPRA 1V8CA 4IG7B 4AJWA 2IO1B 3NZUA 3NOBA 1J19A 2DAJA 3I5JC 3PLVA 3DBLB 3AEDB 1C9FA 5DPSA 3EFUA 1Q0WB 2BTEA 2MJEA 2MQJA 5JZEB 3VUXA 3BY4B 1GB4A 4AOFA 5BYQA 1FXTB 1QOGA 5KHOA 4IM3A 4MEMA 3DVNU 4C00A 2W9NA 4KVGB 2KVRA 3PLUA 2WXMA 1NEKB 4OW0A 4FJYA 3A33B 3QC8B 4N59A 1EWCA 2INPE 4HJKA 2NPTA 1E8ZA 2PPHA 4P1CC 2I1KA 2K39A 5IO9A 3TEWA 4RCOA 3VAWA 3KUCB 2FNJB 1IPGA 4OVVA 2KDMA 3P1MA 3RCZA 3HK0A 3NS8A 3H7PB 3T3NA 3FILB 2BF8B 3VTUA 3EGRA 1TGZB 1IGCA 2NMQA 2KKCA 1OQYA 1FIQA 2KQ7A 2KWUB 3DWMA 2WQYB 2D10A 1K52A 4MH8A 1TS4A 3PZDA 2K0PA 4M02A 1C77A 2JU6X 4XWWA 2ACZB 2DZKA 1JRUA 4WWMA 5AZGA 3SDLC 3DHIC 3B0AA 2ZNVC 3IBEA 2B76B 1JQ4A 2PJHA 3Q69A 4HDQA 2KYWA 4HLEA 2ZZPB 1S3SG 4WQOB 1SSNA 5JH5C 5CX3A 3CSTA 1JROA 4MGIE 2V4LA 3DVGY 1L7YA 1YIWA 2GMIC 3HM6X 2V1YA 4YSYB 2KFKA 2REXA 3Q3NC 4IOIE 1YQ3B 3ZDMC 3PVLA 1OTRB 2IGDA 3NZSA 4JL9A 2W54A 4R3DA 2EMTA 1TS2A 2RSUA 4O1NA 1QF6A 3IAS1 1OQQA 2MSED 4PS7A 3P63A 2YEPB 1WYWB 1IBXB 1ZE3D 4ICUA 1L0XB 2V9HA 2GB1A 5FKAC 1SJED 4NQLB 5EE3A 1D5ZC 1DOYA 4HWIB 1HTQA 4M0WA 1N63A 4KSLC 3ZTCA 4KV2A 3OJ4B 4W9IA 3Q3MC 2FCSA 3A9KB 2ZW1A 2WYQA 5HHDG 1NBFC 4HPPA 1NI3A 3ZW3A 4LNKA 1ENFA 3P4PB 1HZ5A 2NTTA 4B0MA 4OZCA 1U4AA 2KX3A 2WGSA 4FA6A 3CSFA 4ZRQA 4BBNC 2C7HA 4P7IA 4DK5A 4J3OD 3D32A 4MGKE 2V3SA 3ZJTA 4IM2A 5IP4D 3Q14C 1I4RA 1E7PB 1SBBB 1WF9A 1J7BA 1LGRA 1WGKA 3CMMB 2LRWA 3PHWB 2MEKA 2WXLA 1R4NI 1V9JA 4YSZB 3A9JA 3RI7C 3VR8B 2OEDA 5EE9A 3AULA 3BK1A 2BYVE 3WA0A 2HE7A 2QEJC 2WDRB 4II2B 3IAM1 4RM9A 3ML8A 4MDKE 1HTOA 2W3SA 3RNEC 2CR5A 2LXAA 5D3IB 3DBHI 1V80A 2L00B 4WIPA 4KZ0A 3CWIA 5C3JB 1XEEA 4IC7B 1WMHA 2WXIA 2WXRA 3KYCD 2N7EA 4LJPB 2KWVB 1YQ4B 1F9JA 4JGHB 5E6NA 3EA6A 5IKCM 5HI1A 4ANXA 4RGNA 4J6IA 4I6NB 1H4RA 4L23A 3KUZA 2L05A 5E6PA 4X57B 3LXFA 2WXFA 1YQBA 2AX5A 4WJNA 2LHDA 1EU4A 4AJYB 2PE6B 2MP2B 1P0RA 1JRPA 5LXIB 2V4IB 1IP9A 4LJOB 1SE3A 2LHEA 3DPDA 4LDTD 2DNFA 3AE1B 1RRBA 1E7UA 2JRHA 2JT4B 5AZFA 2PLPA 3HVZA 2CHXA 2KFJA 3DHHC 2L83A 4A3OA 5E6JA 2MH7A 1CQVA 4DXFA 4GN1A 4HVBA 2KDFB 3BYYB 3NVVA 2D3AA 2D3CA 4EFOA 4ANWA 1AW7A 3B2GA 2BYEA 3Q3FA 3HUIA 3VR9B 3ZTDA 4FXCA 3Q3OC 2FCMA 2L7RA 2JXTA 1EO6A 3IT4B 1FD6A 4F1SA 5LNK1 4NJ7A 2L0FA 3KYDD 2XN9C 3OAWA 3RPFC 4CHKA 3RNFC 4KKJA 5EE0A 1L5PA 3M3JA 3NUHB 4LNNA 3IG3A 5T8IA 5AUKA 1WM2A 4C7YA 3VH4B 4JLCA 1V81A 3BVMA 4MM3A 3ZUNA 2C7MB 2Y5BB 4TQ0A 1WYGA 1T0QC 3H6NA 1FFUA 1P1AA 3N20C 1VZ7A 3A4SC 2K22A 3EECA 4AS1A 4BFRA 1RFAA 1DOIA 3V6EB 2JWUA 2ZVOA 1J7CA 3W5UB 1A70A 3NY5A 4G3XB 2NPTB 4PS8A 4ANVA 1SF0A 2MLBA 2PW9A 2JZ3B 2KQ4X 2FE8A 3DHGC 1C3TA 4RM8A 4EZJA 3APFA 1VZ8A 1QQRA 1Y8RC 4XYCA 1ET6A 4ZYSA 2BQQA 4P1BC 3KVFB 3M95A 4S17A 2KC2A 4W9LA 3T3OA 3ZRCA 3AE9B 2KTRB 1BT0A 2OJWA 4GMVA 1P7FA 1QLBB 1WXVA 1YJIA 2JWZA 4LLGM 1P3QU 2K9XA 2FBWB 1WGDA 2QSDA 4EUTA 4RGMA 2KMCA 1ET9A 1N60A 1J0GA 2L0TA 1QOFA 2W3RA 3VRBB 1RAXA 1P7EA 4DXGA 4NNJB 2D3BA 2QDFA 1DGJA 4K81A 3TUOA 4I6LB 1PGAA 1TJEA 2RDBC 3R66C 3QIJA 2CJOA 5H92C 3MHZA 2LJ5A 1Q5WB 2IPKD 4C4VA 3NVZA 3ZJVA 1V1PB 2KFKB 4ZRJA 2CJNA 1JWAD 2PTLA 3HM3A 3DBRI 1FRDA 2OHFA 3MP9A 3V3XA 3QJZA 2K6DB 4LNFA 5IAAC 2JZZA 1GC6A 1KTKA 4DHJB 2BKFA 4W9DA 2PE9A 1L4DB 5IN7A 5IA7A 1GJZA 3N1XC 4MELA 2BKRB 2LGIA 3JSVB 2FCQA 1QOAA 2O6VB 1T0RC 4TV3A 5FR6A 2I2YA 2LZ6A 4W9GA 2UU7A 4BBNF 1YN4A 1JWMD 1TZOA 2R61A 2D5GA 2CU3A 1JMLA 4KKIA 2J0MA 3DBLI 4BVUC 4KGSA 4S0RA 1LM8B 2ZPYA 1WIAA 1MPEA 4PT5A 4ANUA 2D2QA 3ZNZB 4B6WA 3ZKJC 3ZO5B 3AB5A 4GB9A 2FUG1 2J52A 2M0AA 1FNVA 3QQ8B 1TBEA 2L76A 3PZ7A 1E0ZA 2JVCA 2MJDA 5IOIA 4YXDB 3NG0A 4XWTA 2WXGA 2L8JA 2L3ZA 1J8CA 3RNAC 2KMMA 2INDC 4NJ6A 2LVPA 3PTFC 3U52E 3GE8C 2L52A 2GBJA 2DYOA 1EF1A 1ZDVA 1YJJA 3L16A 2IO3B 3ZQ4A 1D5XC 2WU5B 4YTPB 2XEWA 2O2VA 2H89B 3IHPC 3VTVA 1D3ZA 1PYWD 1NDDA 2M0XA 1WE6A 3LJ3A 4KDLB 3H1UA 2QMTA 3ZLZA 1UGMA 2CHWA 3ZNGC 4KGTA 4BOSC 4ZYNA 1B1ZA 2KOXA 1UWMA 3CF6E 4IW0A 3AE3B 3RZWC 2IY0B 1UGJA 2XK5B 4W9FA 1C79A 3PPAA 2C5LC 2YEPF 2Z59B 5J2RA 2MBEA 1ZXHA 2ZJDA 1GPXA 5HFYA 2KJ6A 4GSWA 4A20A 1I35A 4II3B 1XQQA 3IXSA 4K7WA 2EMSA 4H2AA 5G5HA 1OEYA 1WR1A 4IWOA 1KH0A 3R8BA 1NENB 2AWTA 4IM0A 1WXAA 4C7ZA 2DYMA 1OEYJ 1WX7A 2K8CA 3H9DA 3URYA 1UWXA 2LEKA 4ZRPA 1JALA 1I4HA 2I38A 1PGBA 4KX6B 4HJGE 3W2DA 4URKA 2WXQA 3EUB2 2LGXA 2ZW0A 2PVGC 4I6PA 4P16A 2CS4A 2M19A 5CHFA 3VFKA 2JRIB 3Q8EA 1H8CA 3ALBA 1WJ4A 4IWPA 5H8YE 4GLSC 2IZVB 3OJ3A 3W1SC 2ZCCA 2HJ8A 4FHJA 2WWZA 4DHZB 2W55A 4IKGA 1IGDA 4E3CA 2WXJA 4RMAA 2WXHA 2KACA 2Z0EB 2BGFA 1SE9A 3QX1A 4FULA 1QOBA 1YOVB 2J0JA 1V5OA 1VZ6A 4IUMB 3ZNHB 4RGOS 3VQIA 3HHMA 3PO0A 5GXGB 2DBYA 2M56B 3AU4A 2J42A 2M17A 4CQNA 3AEEB 4RNAA 4YTMB 1FMAD 3AE4B 3R2IA 1E90A 5G5GA 2BS3B 2ASQA 3KQ4A 2KANA 2LUMA 2BW2A 3IT6B 4JWSC 3DBSA 4A6QA 2IGGA 1ISNA 2LFIA 2DYBA 4KDIC 3VHTC 4DQOC 1HXYD 3JW0X 1VLBA 3U7DA 1I4PA 3UI3A 1KRHA 5MPOA 1ZW7A 1T6BX 2WDVB 3MTNB 2IYDB 1FFVA 2JPHA 1WGRA 3C8YA 1TY2A 3AE8B 4M01A 3TBLD 3UIPB 3V60A 1TZ1A 1V5TA 1AN8A 4GU2A 3RFZB 4L2YA 5BMHA 3A1QA 3X0WA 3GE3C 4D2KA 3P2BA 3Q3JA 1JWUD 4LTUA 3RT3B 3SU8X 3ENEA 4JPSA 4TKNA 4TSSA 1UH6A 3AM9A 3LDZE 4YL8A 3ZRFA 4ARCA 1D4BA 3APDA 2JSVX 1YNTE 2YVCA 4MSQB 3TMPB 4AUQC 2G4DB 2GBKA 3WAPA 4JIOU 1MHXA 4NJCA 4REZA 1IUEA 2LRUA 4A55A 4ZDVA 3T8MA 3FC4A 3T9LA 1R4MB 1AARA 4RF0A 1L6UA 4RFBA 4HK2A 1V49A 3BVZA 1F2RI 5AZHA 1FCCC 1SGHA 4BKGA 3TSSA 3GZNB 2Q5WD 3H7SA 1Z5SB 3ML9A 3W1SA 1FNWA 3U30A 1F77A 2KN4A 2GBNA 4MJSA 1NVID 2KHWB 3W1YA 1ZKHA 3AU5A 1P9DU 2NR2A 2UYZB 1KLGD 4HCNB 3ECIA 3C19A 3VXWA 2KN5A 3C0RB 1OGWA 2JY6A 1MFWA 3X23A 1FRRA 4AP4C 3AI5A 3U2SC 1EU3A 4WH4A 2MA9B 3SEBA 4BOZB 2FCNA 1D6EC 4F8CB 4ZRIA 4EZLA 3U4EG 1J7AA 1L6VA 4PYUA 1G6JA 2XNAC 2RPQA 3DDCB 2NBVB 2JYTA 3P4QB 1EM7A 4GDLA 5D3DA 2J0KA 1C4CA 1N62A 1FO4A 1LO5D 3BK2A 2DLBA 4ICVA 2N9XA 1E9MA 2E3TA 1NI2A 2K8HA 3APCA 3AEAB 2L32A 5E6OA 2LGDA 3AE6B 2ZCBA 2J4XA 1WZ3A 4WWPA 3TEYA 4DWFA 2GI9A 2N7DA 3DOWA 1XLNA 4Q2JA 4IDIA 4GDKB 3L54A 4W9CA 5EDSA 1UZXB 4B95A 2C60A 5J18A 4JQWC 1I4XA 2BPSA 2YLMA 4ARIA 4HRSA 3GB1A 2BWFA 1WXQA 4YWGG 3PRZA 4NAWB 1E8YA 2KQSA 4M8MA 4CO7A 5AUIA 2L1AA 3AV8A 2C9WB 4FJZA 3WANA 1FPYA 2VH1A 2IJ0A 2K5PA 2VZKD 1CJEA 1K50A 1MHHE 2KDIA 5BMIA 3TEXA 3TL5A 2WXKA 2LVQA 2AL3A 1R4NB 3DVGX 4ITKA 3P42A 1T0SC 2NCNA 1XCQL 1HE8A 5C23A 3H7PA 3VDZA 4EE2A 2BYTA 3FILA 3U8ZA 1DYQA 1UBIA 2PEAA 4XZ4A 1T5XD 3OWEB 1KF6B 1XXGA 3N1ZC 3MJWA 1SB3C 2OOBB 4MGYE 4OHJA 3KLSX 1LXDA 1VDVA 2AQ3B 2AQ2B 2MBQA 2HTHA 4USAA 1BUIC 1JW9D 1F1HA 1KLVA 2LASA 1WJUA 1K51A 4BKSA 1WSPA 2KVZA 4GOCA 4LDTB 4W9HA 3RYTA 1WRDB 2INNE 1E10A 1CK1A 3B9JA 2WHIA 2JYEA 3L4PA 4ACFA 1YD8U 5CHVC 2PVOD 1STEA 3H8HA 4BKTA 2K1FA 3NHEB 1WWTA 4XE0A 3TEZA 4HPMB 1K53A 3NVYA 4UDUC 2DZMA 2QHOA 1F2RC 4YT0B 1V2YA 2VZKB 2LJIA 3NS1A 4ZHOA 3IVFA 4KSKC 1XF5L 3DVNV 1SEBD 4NPNA 3B1LX 2K25A 3MC9A 3WAOA 3R7QA 2Y5CA 2KNBA 5JHBA 2N9LA 3RMKC 5LXHA 4WAAA 1WGHA 2KDEB 1WZ0A 2MHJA 4FLHA 1L0YB 4A8XC 1N5XA 4DDGD 4N6EB 3RULA 3LYYA 1HZ6A 4TQ1A 4WJQA 5BYSA 1B9RA 3AEGB 5G2NA 3AEFB 2WS3B 3QAQA 3RD2A 4NZLB 2X8XX 5DCNA 2MRPA 3I57A 4M8NA 1EUVB 2BVCA 2EELA 3I9V1 2NBWB 2J53A 1N6ZA 1YX6B 1ZPSA 3L17A 4LNOA 2Y5PA 2NVUI 1E8WA 2DX5B 3PSEB 1KM7A 1XLQA 3O13A 1OQRA 4M0WB 3WCQA 1V1OA 1WX8A 2V3NA 2N1WA 4XDDA 3SR6A 2FUHB 2BT6A 3KW5B 2SEBD 1TY0A 2LUEA 1Q1OA 1HQRD 1A5RA 3K9PB 3M63B 4MSMB 1XT9B 4HPLB 1K8RB 2NTSA 2HJ1A 2WDQB 4RH6A 5CTRC 4KIKA 4FN2A 1C4PA 3HRDD 1WGGA 5BMGA 1TKYA 3R7RA 1I7HA 1NYQA 2DHZA 3UQAA 3SHQA 3DCGA 4K3CA 3OLMD 1WR6E 3KUDB
chains in the Genus database with same CATH topology
1ACCA 2J42A 1BMLC 2QEJC 2WDRB 3ETRA 3IAM1 4CQNA 3AEEB 2JQRB 3W5VB 2W3SA 4RNAA 4ZOHC 4YTMB 1KFYB 5D3IB 1FMAD 3AE4B 2ONQA 1N5WA 1YMHE 1FEHA 3R2IA 1ESFA 1VRAB 5G5GA 2BS3B 4OZBA 4WIPA 1YN5A 2DWQA 3CWIA 4WURA 1XEEA 5C3JB 3KQ4A 1M4VA 1SXTA 2GRIA 1TYGB 2LUMA 2QJLA 2BW2A 3IT6B 4JWSC 3AECB 2E6XA 2WXIA 2WXRA 4A6QA 1BXTA 2IGGA 2LFIA 1YQ4B 4DQOC 1HXYD 4N58A 3EA6A 1Y56A 1VLBA 5HI1A 4RGNA 1I4PA 4WAFA 3UI3A 1KRHA 5MPOA 3GS2A 2WP9B 1T6BX 2WDVB 4L23A 3U7ZA 1FFVA 1IBXA 3ZJUA 3C8YA 3LXFA 3GP7A 2BS4B 4A9AA 1TY2A 3AE8B 3AEBB 4MT5A 3CIRB 3ZYYX 1C76A 1TS5A 1T3QA 1ZP0B 2WXFA 3SFEB 1FCLA 1AN8A 2AX5A 2LHDA 1EU4A 2PMVA 3RFZB 3VRAB 2HTME 4L2YA 5BMHA 4D2KA 1JRPA 5EE1A 5TSSA 2V4IB 2KAJA 1JWUD 4LTUA 4L1BA 1SE3A 4AQ7A 2LHEA 4A90A 4JPSA 1OFFA 3AE1B 4TSSA 2RDHA 1ZXIA 3AM9A 2PIAA 2PLPA 3KWLA 3HVZA 2WXOA 4ARCA 1D4BA 2JSVX 2L83A 3BZDB 4MACA 4JX1C 5E6JA 2MH7A 1YNTE 1CQVA 2QILA 4DXFA 3BYYB 3NVVA 1VR9A 2PKOA 1MHXA 1MI0A 4RF1A 1TKGA 1AW7A 4NJCA 1IUEA 4REZA 4A55A 3B2GA 3FC4A 1DOXA 1D5MC 3HUIA 3VR9B 4FXCA 3AMZA 4RF0A 1I4QA 1L6UA 2JXTA 3IT4B 4RFBA 1FD6A 5LNK1 4US8A 2XN9C 4OZAA 3RPFC 3PZ8A 1TS3A 4KGRA 3BVZA 1F2RI 4KKJA 5EE0A 1GB1A 1FCCC 2BB6A 1L5PA 3NUHB 5T8IA 1SE2A 5AUKA 1L0VB 3AE7B 3TSSA 4C7YA 2Q5WD 3W1SA 1FXAA 3BVMA 1FNWA 2JX5A 1F77A 2WXPA 2JZPA 5D7GA 2KN4A 3N9YC 2WLBA 2Y3AA 2K3UA 4TQ0A 1WYGA 1ZOYB 1NVID 1FFUA 3MJ5A 1MVKA 2RDGA 1VZ7A 2K22A 3Q8BA 4AS1A 3MFGA 1F0ZA 1DOIA 2JWUA 3KWVA 4NAMA 1J7CA 3W5UB 1A70A 1KLGD 4MM3B 2RMMA 1SF0A 3E56A 2PW9A 2EKIA 5FR3A 2KQ4X 2QIEB 1NYRA 2FE8A 1FRRA 3U2SC 1EU3A 4WH4A 4YSXB 3SEBA 3FAHA 4C56C 3E9SA 1VZ8A 1QILA 1ZDXA 1QQRA 1D6EC 4HROA 2N7JA 3ZGZA 3U4EG 1J7AA 1ET6A 1L6VA 2XNAC 3MC0B 4ZYSA 3AH7A 2JYTA 1R7SA 3P4QB 1KLUD 2V3PA 1EM7A 3BVGA 4OVZA 2H88B 5D3DA 1RM6C 1C4CA 1N62A 3LB8C 4WQMA 1FO4A 1LO5D 1HEZE 3HVDA 3T3OA 3BK2A 4B0EA 1YN3A 1FNUA 3AE9B 3ABVB 4US9A 1E6EB 2DLBA 3R2TA 2HDEA 2N9KA 2ICIA 1E9MA 1P7FA 1QLBB 1YJIA 2E3TA 4LLGM 2K9XA 4XDCA 1XCTL 2FBWB 2IGHA 2WXNA 4ZHPA 1V97A 1JWBD 3AEAB 2L32A 3Q8CA 2TSSA 2QSDA 4GDLB 4RGMA 1ET9A 1N60A 3AE6B 1PDXA 2RPVA 2J4XA 4HEA1 3TEYA 2GI9A 1QOFA 1XLNA 2W3RA 4Q2JA 3VRBB 1V1PA 2IDYA 4IDIA 1P7EA 4GDKB 4DXGA 3Q8FA 1DGJA 1PUTA 3TUOA 3NRZA 4TMAB 1FM0D 1PGAA 1TJEA 1V8CA 1JCKB 1I4XA 1WRIA 4JWUC 1SIJA 1EWYC 3B2FA 5H92C 2CJOA 3MHZA 4ARIA 1XO3A 4HRSA 3GB1A 1WXQA 3V05A 2MJ3A 3AEDB 2IPKD 4YWGG 1C9FA 3NVZA 4NAWB 3ZJVA 1V1PB 2BTEA 2MJEA 2SAKA 2CJNA 1JWAD 2WU2B 5AUIA 2L1AA 3AV8A 5C2TB 1GB4A 2PTLA 5BYQA 1FRDA 1QOGA 2OHFA 3MP9A 3V3XA 2IJ0A 3P4RB 2K5PA 2VZKD 1CJEA 1K50A 1MHHE 2V0GA 5BMIA 3TEXA 1GOZA 2WXKA 4ITKA 2WXMA 3P42A 1KTKA 1NEKB 1L4DB 4OW0A 1XCQL 2X38A 1RFKA 2LGIA 4N59A 1EWCA 2INPE 3DWGC 1QOAA 4EE2A 2BYTA 3FILA 4YTNB 2I2YA 1ROEA 1DYQA 5I4DA 3TEWA 4RCOA 1T5XD 3OWEB 1KF6B 1XXGA 1YN4A 1JWMD 1TZOA 2R61A 3BWUD 2D5GA 2CU3A 4C80A 1JMLA 2KDMA 4KKIA 3P1MA 4KGSA 1AWDA 5HG2A 1SB3C 3NZ3A 1UUPA 4OHJA 3KLSX 3T3NA 1VDVA 1MPEA 3FILB 5JXVA 3AE2B 3EGRA 1IGCA 2NMQA 4PT5A 2AQ3B 2KWDA 1FIQA 1Q10A 2AQ2B 2W82A 3AB5A 2FUG1 2J52A 2M0AA 3Q8AA 2BB5A 3DWMA 4USAA 1BUIC 1FNVA 2WQYB 3P4SB 1JW9D 1E0ZA 1K52A 3PZ7A 4MH8A 1K51A 1TS4A 2MJDA 2K0PA 1SJHD 1WSPA 4YXDB 4HKZE 1N61A 2WXGA 4XWTA 2INNE 2BS2B 1C77A 1E10A 1CK1A 3B9JA 2JU6X 4HKQA 2JYEA 3L4PA 2KMMA 4XWWA 1FXIA 2ACZB 4WWMA 3U52E 3BYTB 2L52A 2PVOD 1STEA 3H8HA 2DYOA 1UNSA 2B76B 1JQ4A 3Q69A 1ZDVA 1YJJA 3ZQ4A 1WWTA 1D5XC 2LMCA 4XE0A 2WU5B 4YTPB 3TEZA 1SSNA 1RYJA 2H89B 1AYFA 1K53A 3NVYA 4UDUC 1JROA 1PGXA 1F2RC 1PYWD 3BIID 4YT0B 2VZKB 2LJIA 3NS1A 4ZHOA 2N0SB 4YSYB 3NVWA 2QMTA 1XF5L 4P6VF 1PFDA 1SEBD 4IOIE 1YQ3B 4KGTA 2G9HD 2Z8LA 1HA5A 3SFDB 1B1ZA 1UWMA 2IGDA 3AE3B 2Y5CA 1GAQB 3J9CA 2N9LA 1UGJA 2W54A 4R3DA 2ON8A 1C79A 2WNMA 1TS2A 2YEPF 1JWSD 1L0YB 4O1NA 4A8XC 1QF6A 1ZXHA 1OQQA 3IAS1 1N5XA 3P63A 4N6EB 2YEPB 3LYYA 1HZ6A 4TQ1A 5BYSA 5HFYA 1ZE3D 1B9RA 1L0XB 1GPXA 1IBXB 3AEGB 2GB1A 3AEFB 5FKAC 1SJED 2WS3B 3IXSA 5EE3A 1D5ZC 1DOYA 4NZLB 1QKZA 4JE3B 4H2AA 5G5HA 4M0WA 3I57A 1N63A 1TKEA 3W9CB 2EELA 3I9V1 2J53A 1CZPA 1KH0A 2ZW1A 1ZPSA 3R8BA 5HHDG 2Y5PA 1NENB 1NI3A 4C7ZA 1VJKA 1ENFA 2DYMA 1XLQA 3P4PB 1HZ5A 1UWXA 3URYA 1XLPA 2LEKA 2NTTA 3O13A 4ZRPA 1C4AA 1JALA 1I4HA 1OQRA 2I38A 1SE4A 4B0MA 1PGBA 3WCQA 4OZCA 1V1OA 4KX6B 4HJGE 1QT9A 2V3NA 3W2DA 4XDDA 3SR6A 2BT6A 2SEBD 1TY0A 2G1EA 2WXQA 3AE5B 3EUB2 4ZRQA 4RGTA 4LK0M 2ZW0A 2PVGC 4P16A 5FK9C 2M19A 1HQRD 3Q8EA 1XLOA 1C78A 4J3OD 5H8YE 1RWSA 4GLSC 2W55A 3ZJTA 3AN1A 4IKGA 1IGDA 2WXJA 2WXHA 1L4ZB 2KACA 2NTSA 2AQ1B 1I4RA 1E7PB 2WDQB 4RH6A 1SBBB 1C4PA 1J7BA 1WGKA 3HRDD 1ZUD2 5BMGA 1QOBA 1TKYA 2BBCA 1I7HA 1NYQA 1VZ6A 1I4GA 2MEKA 2WXLA 4RGOS 3VQIA 3PO0A 5GXGB 5BYRA 2DBYA 4YSZB 3VR8B 2M56B 2OEDA 5EE9A 3BK1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C9F A;  1PGX A;  1F2R C;  1GB4 A;  2ONQ A;  2PTL A;  1YMH E;  2QMT A;  2JZP A;  1XF5 L;  2KN4 A;  4OZB A;  3MP9 A;  3V3X A;  4IOI E;  4KGT A;  1K50 A;  1MHH E;  5BMI A;  2LUM A;  2IGD A;  1MVK A;  2N9L A;  2IGG A;  2ON8 A;  2JWU A;  1ZXH A;  1XCQ L;  1HZ6 A;  2RMM A;  5HFY A;  1IBX B;  5HI1 A;  2LGI A;  3UI3 A;  2PW9 A;  2GB1 A;  3FIL A;  2KQ4 X;  1IBX A;  2I2Y A;  4WH4 A;  1QKZ A;  2EEL A;  1FCL A;  2J53 A;  2N7J A;  2LHD A;  1KH0 A;  2ZW1 A;  1JML A;  2KDM A;  5HHD G;  4KGS A;  5BMH A;  5HG2 A;  4D2K A;  1EM7 A;  2LHE A;  1MPE A;  1HEZ E;  3FIL B;  5JXV A;  1HZ5 A;  1UWX A;  1IGC A;  2NMQ A;  2KWD A;  1GB1 A;  2I38 A;  1Q10 A;  1PGB A;  4OZC A;  2N9K A;  4HJG E;  2J52 A;  1P7F A;  2PLP A;  1K52 A;  1D4B A;  1XCT L;  2IGH A;  1K51 A;  2JSV X;  4MAC A;  2K0P A;  2ZW0 A;  1YNT E;  2QSD A;  4HKZ E;  2RPV A;  4GLS C;  2GI9 A;  2JU6 X;  1MHX A;  4IKG A;  1MI0 A;  1IGD A;  1P7E A;  2KAC A;  1F2R I;  5BMG A;  1PGA A;  2JXT A;  1FD6 A;  4OZA A;  4KGR A;  2OED A;  3GB1 A;  1K53 A;  1FCC C; 
#chains in the Genus database with same CATH topology
 2LGY A;  4F7Z A;  1BML C;  3V61 A;  2J7Q B;  3ETR A;  3MHS D;  2N9E B;  3RNC C;  2JQR B;  1I42 A;  3PRE A;  2ONQ A;  1YMH E;  3MC8 A;  4OZB A;  1YN5 A;  4WUR A;  2QJL A;  3A9J B;  3AEC B;  1BXT A;  2MP2 A;  1P98 A;  2M4N A;  1Y56 A;  4WAF A;  3PRP B;  3JVZ X;  3O65 B;  3TJP A;  5HKH A;  1T0Y A;  1WMH B;  2BS4 B;  4A9A A;  3SFE B;  2FID A;  1V6E A;  4DDI D;  4EZK A;  3VRA B;  2HTM E;  4WWO A;  5TSS A;  2KAJ A;  4L1B A;  3S2A A;  3EC8 A;  2CU1 A;  1OFF A;  2K8B A;  2RDH A;  3AXC A;  1ZXI A;  3L10 B;  2KTF A;  1WX9 A;  2PIA A;  3PRM B;  2WXO A;  3N1Y C;  2KLC A;  3BZD B;  4MAC A;  4HDO A;  4BKS D;  2R2O A;  4G0N B;  2D3G A;  1VR9 A;  2PKO A;  5L83 A;  4PK1 A;  1MI0 A;  3RZF A;  1X1M A;  3WAM A;  1WM3 A;  3AMZ A;  4US8 A;  2CKH B;  4OZA A;  3QHT A;  2IY1 B;  3PZ8 A;  1TS3 A;  4LCD E;  2BB6 A;  2HD5 B;  3UQB A;  1SE2 A;  3AE7 B;  1FXA A;  2JX5 A;  4EOY A;  5D7G A;  2KDB A;  2Y3A A;  4CYE A;  4W9E A;  2KZR A;  3Q8B A;  1PQS A;  4WJO A;  1GNU A;  3RUI B;  1WGY A;  1WI0 A;  4MM3 B;  2RMM A;  3VH3 B;  1GG3 A;  5FR3 A;  1YX5 B;  2QIE B;  1NYR A;  1R4M I;  3ZXV A;  2KTR A;  3FAH A;  4C56 C;  4HRO A;  3ZGZ A;  2KJR A;  3AH7 A;  2IBI B;  2DAF A;  5DPW A;  4FJV B;  1R7S A;  2ZEQ A;  1KLU D;  2V3P A;  3GZN I;  3ONS A;  4OVZ A;  2H88 B;  1RM6 C;  1L2N A;  5DPT A;  3LB8 C;  4WJP A;  4WWN A;  1HEZ E;  1E8X A;  5D2M B;  1E6E B;  3R2T A;  2N9K A;  3V6C B;  2ICI A;  5J17 A;  4W9K A;  3QAR A;  3ZIM A;  4XDC A;  1XCT L;  4ZHP A;  1JWB D;  1KOT A;  4BAX A;  2RPV A;  1MG4 A;  4HEA 1;  2GBM A;  1Z2M A;  1V1P A;  2IDY A;  3B08 A;  4K7S A;  1PUT A;  3PHX B;  3NRZ A;  3Q2A C;  1JCK B;  4JWU C;  1WRI A;  1SIJ A;  1EWY C;  3B2F A;  2LVO A;  3L13 A;  1XO3 A;  3V05 A;  2MJ3 A;  1WH3 A;  4ZRK A;  2SAK A;  2WX0 A;  2WU2 B;  5C2T B;  4E71 A;  2GOW A;  1S1Q B;  3BIN A;  2AL6 A;  3P4R B;  3JSV A;  1UD7 A;  2O6V A;  2V0G A;  1GOZ A;  2RD0 A;  4XC2 A;  4DHZ E;  2VH2 A;  1WE7 A;  2MX2 A;  4C4V B;  3UIN B;  1M94 A;  4A3P A;  4K7U A;  4PS3 A;  3UIO B;  2X38 A;  1RFK A;  2R2Q A;  3EFC A;  3DWG C;  4OVU A;  1IYF A;  4HCP B;  4YTN B;  1ROE A;  1TIF A;  5I4D A;  2G45 B;  3BWU D;  4K1R B;  4C80 A;  1AWD A;  5HG2 A;  4MGZ E;  3NZ3 A;  2LI5 A;  1UUP A;  3V62 A;  3VUY A;  4FBJ B;  2IO2 B;  5JXV A;  3I63 C;  3AE2 B;  1XD3 B;  2KWD A;  2MBH A;  4G50 A;  2KX0 A;  3VVW B;  1Q10 A;  2W82 A;  3HIZ A;  3NJT A;  3Q8A A;  2BB5 A;  2KJH B;  3A4R A;  3P4S B;  1UEL A;  3OG5 A;  5D94 A;  1SJH D;  1UF0 A;  1MJD A;  4HKZ E;  1N61 A;  2BS2 B;  3TCA A;  3ZXR A;  4AWJ A;  4HKQ A;  3PGE A;  3JYU A;  4KIK B;  2FIF A;  2A5U A;  1FXI A;  3BYT B;  1TTN A;  1UNS A;  5LLI A;  2LMC A;  4FHK A;  1RYJ A;  1AYF A;  2XK5 A;  1PGX A;  2MWS B;  3BII D;  3QCA A;  2GLS A;  2KT7 A;  2N0S B;  4XGA B;  3NVW A;  2K6Q A;  2XBB C;  4P6V F;  1PFD A;  2G9H D;  2Z8L A;  1HA5 A;  2JF5 A;  3QA8 A;  3SFD B;  2DZJ A;  5TR5 A;  1RLF A;  1GAQ B;  2KXJ A;  2O2V B;  3J9C A;  2ON8 A;  3N32 A;  2WNM A;  1JWS D;  1QZE A;  3PV1 A;  2RGF A;  2MBO A;  2KWC A;  3UGB B;  1WXS A;  2ZPN A;  4XX5 A;  3L08 A;  4HXD A;  3RN9 C;  1QKZ A;  4JE3 B;  1KJT A;  1TKE A;  2FAZ A;  3W9C B;  2KO3 A;  1CZP A;  3WIM A;  2N1V A;  1VJK A;  2KC1 A;  2N4F A;  2CHZ A;  1XLP A;  1ZGU B;  3DBH B;  1C4A A;  1SE4 A;  3L0W B;  1QT9 A;  3QK0 A;  2G1E A;  3AE5 B;  2NS5 A;  2QC8 A;  4RGT A;  4LK0 M;  5FK9 C;  1GC7 A;  1XLO A;  1C78 A;  1RWS A;  4PYZ A;  3RNG C;  4GGQ A;  3AN1 A;  4N9F 4;  2WDT B;  5JHA A;  1L4Z B;  2AQ1 B;  3Q6B A;  2BYF A;  1V86 A;  3FKY A;  1ZUD 2;  3EHV A;  2BBC A;  3K9O B;  2MBB B;  1I4G A;  3I3T B;  1EF5 A;  2DEN B;  5BYR A;  3PT2 B;  3R3M A;  4NQK E;  1ACC A;  2KD0 A;  3W5V B;  4KZC A;  4ZOH C;  1KFY B;  2QCZ A;  1N5W A;  4DHJ D;  4G11 A;  1FEH A;  1ESF A;  1VRA B;  2DWQ A;  1M4V A;  1SXT A;  2GRI A;  2M1M A;  1TYG B;  2O6V D;  2E6X A;  4EKU A;  4GXB A;  4N58 A;  2KK8 A;  2M8S A;  1YJ1 A;  1WFY A;  3GS2 A;  2WP9 B;  3U7Z A;  5BO4 B;  4NY0 A;  1IBX A;  3ZJU A;  4M00 A;  3GP7 A;  2G4S A;  3AEB B;  4MT5 A;  3CIR B;  3ZYY X;  1C76 A;  2WX1 A;  1TS5 A;  2MW5 A;  1T3Q A;  1ZP0 B;  1FCL A;  1C1Y B;  3KH0 A;  3VTW A;  2ZVN A;  2JXX A;  2PMV A;  3IFW B;  5EE1 A;  5G55 A;  3A9K A;  4AQ7 A;  4A90 A;  5AEK B;  2IO0 B;  2D07 B;  1VD2 A;  2LWP A;  4B9K A;  3KWL A;  2N9P C;  1WXM A;  3A1Q B;  4JX1 C;  3M62 B;  2QIL A;  2INC C;  4IWQ A;  1F52 A;  3WAL A;  4RF1 A;  1TKG A;  5KHQ A;  2LD9 A;  1MG8 A;  3N30 A;  3PS6 A;  4E74 A;  1DOX A;  1D5M C;  4K3B A;  1I4Q A;  5C1Z A;  4W9J A;  3N3K B;  2DZI A;  3QWZ B;  4KGR A;  1GB1 A;  2KLG A;  2LGS A;  2RR9 A;  3GOE A;  1L0V B;  2AEH A;  1WJ6 A;  2OJR A;  2WXP A;  1LFD A;  2JZP A;  3N9Y C;  5GMV A;  2WLB A;  2K3U A;  4BZA A;  4GIV A;  1ZOY B;  3DQV A;  3MJ5 A;  1MVK A;  2KMA A;  2RDG A;  3SD5 A;  2EKE C;  3ZVV A;  3MFG A;  2JUO A;  1F0Z A;  1GUA B;  4FAD A;  3KWV A;  4NAM A;  3VUW A;  1LQB A;  2AYO B;  4MJS B;  1E7V A;  3E56 A;  5L95 C;  2B3A A;  1VCB A;  2EKI A;  1TT5 B;  5CHW A;  4YSX B;  2I1J A;  3E9S A;  1ZDX A;  1QIL A;  2BWE S;  2LXC A;  2UWQ A;  2NBU A;  3ZDT A;  2N7J A;  3TIX A;  2A4Z A;  3ZNI D;  3MC0 B;  2D11 A;  3BVG A;  2MCN B;  4WQM A;  1E5W A;  4DBG A;  3HVD A;  2G3Q B;  4B0E A;  1YN3 A;  1FNU A;  5D6J B;  3ABV B;  4LNI A;  3DBR B;  4TUU A;  4US9 A;  2HDE A;  2ZNV B;  4GDK A;  2VRR B;  3UF8 A;  1CMX B;  2Z0D B;  2C7N B;  2IGH A;  2WXN A;  4ASW C;  1V97 A;  4MH0 E;  3Q8C A;  2TSS A;  4GDL B;  3RNB C;  1PDX A;  1WJN A;  4EEW A;  4NAW A;  1WY8 A;  1UBQ A;  3Q8F A;  4QAY A;  2GBR A;  4DXA B;  1SIF A;  4TMA B;  1FM0 D;  5DPR A;  1V8C A;  4IG7 B;  4AJW A;  2IO1 B;  3NZU A;  3NOB A;  1J19 A;  2DAJ A;  3I5J C;  3PLV A;  3DBL B;  3AED B;  1C9F A;  5DPS A;  3EFU A;  1Q0W B;  2BTE A;  2MJE A;  2MQJ A;  5JZE B;  3VUX A;  3BY4 B;  1GB4 A;  4AOF A;  5BYQ A;  1FXT B;  1QOG A;  5KHO A;  4IM3 A;  4MEM A;  3DVN U;  4C00 A;  2W9N A;  4KVG B;  2KVR A;  3PLU A;  2WXM A;  1NEK B;  4OW0 A;  4FJY A;  3A33 B;  3QC8 B;  4N59 A;  1EWC A;  2INP E;  4HJK A;  2NPT A;  1E8Z A;  2PPH A;  4P1C C;  2I1K A;  2K39 A;  5IO9 A;  3TEW A;  4RCO A;  3VAW A;  3KUC B;  2FNJ B;  1IPG A;  4OVV A;  2KDM A;  3P1M A;  3RCZ A;  3HK0 A;  3NS8 A;  3H7P B;  3T3N A;  3FIL B;  2BF8 B;  3VTU A;  3EGR A;  1TGZ B;  1IGC A;  2NMQ A;  2KKC A;  1OQY A;  1FIQ A;  2KQ7 A;  2KWU B;  3DWM A;  2WQY B;  2D10 A;  1K52 A;  4MH8 A;  1TS4 A;  3PZD A;  2K0P A;  4M02 A;  1C77 A;  2JU6 X;  4XWW A;  2ACZ B;  2DZK A;  1JRU A;  4WWM A;  5AZG A;  3SDL C;  3DHI C;  3B0A A;  2ZNV C;  3IBE A;  2B76 B;  1JQ4 A;  2PJH A;  3Q69 A;  4HDQ A;  2KYW A;  4HLE A;  2ZZP B;  1S3S G;  4WQO B;  1SSN A;  5JH5 C;  5CX3 A;  3CST A;  1JRO A;  4MGI E;  2V4L A;  3DVG Y;  1L7Y A;  1YIW A;  2GMI C;  3HM6 X;  2V1Y A;  4YSY B;  2KFK A;  2REX A;  3Q3N C;  4IOI E;  1YQ3 B;  3ZDM C;  3PVL A;  1OTR B;  2IGD A;  3NZS A;  4JL9 A;  2W54 A;  4R3D A;  2EMT A;  1TS2 A;  2RSU A;  4O1N A;  1QF6 A;  3IAS 1;  1OQQ A;  2MSE D;  4PS7 A;  3P63 A;  2YEP B;  1WYW B;  1IBX B;  1ZE3 D;  4ICU A;  1L0X B;  2V9H A;  2GB1 A;  5FKA C;  1SJE D;  4NQL B;  5EE3 A;  1D5Z C;  1DOY A;  4HWI B;  1HTQ A;  4M0W A;  1N63 A;  4KSL C;  3ZTC A;  4KV2 A;  3OJ4 B;  4W9I A;  3Q3M C;  2FCS A;  3A9K B;  2ZW1 A;  2WYQ A;  5HHD G;  1NBF C;  4HPP A;  1NI3 A;  3ZW3 A;  4LNK A;  1ENF A;  3P4P B;  1HZ5 A;  2NTT A;  4B0M A;  4OZC A;  1U4A A;  2KX3 A;  2WGS A;  4FA6 A;  3CSF A;  4ZRQ A;  4BBN C;  2C7H A;  4P7I A;  4DK5 A;  4J3O D;  3D32 A;  4MGK E;  2V3S A;  3ZJT A;  4IM2 A;  5IP4 D;  3Q14 C;  1I4R A;  1E7P B;  1SBB B;  1WF9 A;  1J7B A;  1LGR A;  1WGK A;  3CMM B;  2LRW A;  3PHW B;  2MEK A;  2WXL A;  1R4N I;  1V9J A;  4YSZ B;  3A9J A;  3RI7 C;  3VR8 B;  2OED A;  5EE9 A;  3AUL A;  3BK1 A;  2BYV E;  3WA0 A;  2HE7 A;  2QEJ C;  2WDR B;  4II2 B;  3IAM 1;  4RM9 A;  3ML8 A;  4MDK E;  1HTO A;  2W3S A;  3RNE C;  2CR5 A;  2LXA A;  5D3I B;  3DBH I;  1V80 A;  2L00 B;  4WIP A;  4KZ0 A;  3CWI A;  5C3J B;  1XEE A;  4IC7 B;  1WMH A;  2WXI A;  2WXR A;  3KYC D;  2N7E A;  4LJP B;  2KWV B;  1YQ4 B;  1F9J A;  4JGH B;  5E6N A;  3EA6 A;  5IKC M;  5HI1 A;  4ANX A;  4RGN A;  4J6I A;  4I6N B;  1H4R A;  4L23 A;  3KUZ A;  2L05 A;  5E6P A;  4X57 B;  3LXF A;  2WXF A;  1YQB A;  2AX5 A;  4WJN A;  2LHD A;  1EU4 A;  4AJY B;  2PE6 B;  2MP2 B;  1P0R A;  1JRP A;  5LXI B;  2V4I B;  1IP9 A;  4LJO B;  1SE3 A;  2LHE A;  3DPD A;  4LDT D;  2DNF A;  3AE1 B;  1RRB A;  1E7U A;  2JRH A;  2JT4 B;  5AZF A;  2PLP A;  3HVZ A;  2CHX A;  2KFJ A;  3DHH C;  2L83 A;  4A3O A;  5E6J A;  2MH7 A;  1CQV A;  4DXF A;  4GN1 A;  4HVB A;  2KDF B;  3BYY B;  3NVV A;  2D3A A;  2D3C A;  4EFO A;  4ANW A;  1AW7 A;  3B2G A;  2BYE A;  3Q3F A;  3HUI A;  3VR9 B;  3ZTD A;  4FXC A;  3Q3O C;  2FCM A;  2L7R A;  2JXT A;  1EO6 A;  3IT4 B;  1FD6 A;  4F1S A;  5LNK 1;  4NJ7 A;  2L0F A;  3KYD D;  2XN9 C;  3OAW A;  3RPF C;  4CHK A;  3RNF C;  4KKJ A;  5EE0 A;  1L5P A;  3M3J A;  3NUH B;  4LNN A;  3IG3 A;  5T8I A;  5AUK A;  1WM2 A;  4C7Y A;  3VH4 B;  4JLC A;  1V81 A;  3BVM A;  4MM3 A;  3ZUN A;  2C7M B;  2Y5B B;  4TQ0 A;  1WYG A;  1T0Q C;  3H6N A;  1FFU A;  1P1A A;  3N20 C;  1VZ7 A;  3A4S C;  2K22 A;  3EEC A;  4AS1 A;  4BFR A;  1RFA A;  1DOI A;  3V6E B;  2JWU A;  2ZVO A;  1J7C A;  3W5U B;  1A70 A;  3NY5 A;  4G3X B;  2NPT B;  4PS8 A;  4ANV A;  1SF0 A;  2MLB A;  2PW9 A;  2JZ3 B;  2KQ4 X;  2FE8 A;  3DHG C;  1C3T A;  4RM8 A;  4EZJ A;  3APF A;  1VZ8 A;  1QQR A;  1Y8R C;  4XYC A;  1ET6 A;  4ZYS A;  2BQQ A;  4P1B C;  3KVF B;  3M95 A;  4S17 A;  2KC2 A;  4W9L A;  3T3O A;  3ZRC A;  3AE9 B;  2KTR B;  1BT0 A;  2OJW A;  4GMV A;  1P7F A;  1QLB B;  1WXV A;  1YJI A;  2JWZ A;  4LLG M;  1P3Q U;  2K9X A;  2FBW B;  1WGD A;  2QSD A;  4EUT A;  4RGM A;  2KMC A;  1ET9 A;  1N60 A;  1J0G A;  2L0T A;  1QOF A;  2W3R A;  3VRB B;  1RAX A;  1P7E A;  4DXG A;  4NNJ B;  2D3B A;  2QDF A;  1DGJ A;  4K81 A;  3TUO A;  4I6L B;  1PGA A;  1TJE A;  2RDB C;  3R66 C;  3QIJ A;  2CJO A;  5H92 C;  3MHZ A;  2LJ5 A;  1Q5W B;  2IPK D;  4C4V A;  3NVZ A;  3ZJV A;  1V1P B;  2KFK B;  4ZRJ A;  2CJN A;  1JWA D;  2PTL A;  3HM3 A;  3DBR I;  1FRD A;  2OHF A;  3MP9 A;  3V3X A;  3QJZ A;  2K6D B;  4LNF A;  5IAA C;  2JZZ A;  1GC6 A;  1KTK A;  4DHJ B;  2BKF A;  4W9D A;  2PE9 A;  1L4D B;  5IN7 A;  5IA7 A;  1GJZ A;  3N1X C;  4MEL A;  2BKR B;  2LGI A;  3JSV B;  2FCQ A;  1QOA A;  2O6V B;  1T0R C;  4TV3 A;  5FR6 A;  2I2Y A;  2LZ6 A;  4W9G A;  2UU7 A;  4BBN F;  1YN4 A;  1JWM D;  1TZO A;  2R61 A;  2D5G A;  2CU3 A;  1JML A;  4KKI A;  2J0M A;  3DBL I;  4BVU C;  4KGS A;  4S0R A;  1LM8 B;  2ZPY A;  1WIA A;  1MPE A;  4PT5 A;  4ANU A;  2D2Q A;  3ZNZ B;  4B6W A;  3ZKJ C;  3ZO5 B;  3AB5 A;  4GB9 A;  2FUG 1;  2J52 A;  2M0A A;  1FNV A;  3QQ8 B;  1TBE A;  2L76 A;  3PZ7 A;  1E0Z A;  2JVC A;  2MJD A;  5IOI A;  4YXD B;  3NG0 A;  4XWT A;  2WXG A;  2L8J A;  2L3Z A;  1J8C A;  3RNA C;  2KMM A;  2IND C;  4NJ6 A;  2LVP A;  3PTF C;  3U52 E;  3GE8 C;  2L52 A;  2GBJ A;  2DYO A;  1EF1 A;  1ZDV A;  1YJJ A;  3L16 A;  2IO3 B;  3ZQ4 A;  1D5X C;  2WU5 B;  4YTP B;  2XEW A;  2O2V A;  2H89 B;  3IHP C;  3VTV A;  1D3Z A;  1PYW D;  1NDD A;  2M0X A;  1WE6 A;  3LJ3 A;  4KDL B;  3H1U A;  2QMT A;  3ZLZ A;  1UGM A;  2CHW A;  3ZNG C;  4KGT A;  4BOS C;  4ZYN A;  1B1Z A;  2KOX A;  1UWM A;  3CF6 E;  4IW0 A;  3AE3 B;  3RZW C;  2IY0 B;  1UGJ A;  2XK5 B;  4W9F A;  1C79 A;  3PPA A;  2C5L C;  2YEP F;  2Z59 B;  5J2R A;  2MBE A;  1ZXH A;  2ZJD A;  1GPX A;  5HFY A;  2KJ6 A;  4GSW A;  4A20 A;  1I35 A;  4II3 B;  1XQQ A;  3IXS A;  4K7W A;  2EMS A;  4H2A A;  5G5H A;  1OEY A;  1WR1 A;  4IWO A;  1KH0 A;  3R8B A;  1NEN B;  2AWT A;  4IM0 A;  1WXA A;  4C7Z A;  2DYM A;  1OEY J;  1WX7 A;  2K8C A;  3H9D A;  3URY A;  1UWX A;  2LEK A;  4ZRP A;  1JAL A;  1I4H A;  2I38 A;  1PGB A;  4KX6 B;  4HJG E;  3W2D A;  4URK A;  2WXQ A;  3EUB 2;  2LGX A;  2ZW0 A;  2PVG C;  4I6P A;  4P16 A;  2CS4 A;  2M19 A;  5CHF A;  3VFK A;  2JRI B;  3Q8E A;  1H8C A;  3ALB A;  1WJ4 A;  4IWP A;  5H8Y E;  4GLS C;  2IZV B;  3OJ3 A;  3W1S C;  2ZCC A;  2HJ8 A;  4FHJ A;  2WWZ A;  4DHZ B;  2W55 A;  4IKG A;  1IGD A;  4E3C A;  2WXJ A;  4RMA A;  2WXH A;  2KAC A;  2Z0E B;  2BGF A;  1SE9 A;  3QX1 A;  4FUL A;  1QOB A;  1YOV B;  2J0J A;  1V5O A;  1VZ6 A;  4IUM B;  3ZNH B;  4RGO S;  3VQI A;  3HHM A;  3PO0 A;  5GXG B;  2DBY A;  2M56 B;  3AU4 A;  2J42 A;  2M17 A;  4CQN A;  3AEE B;  4RNA A;  4YTM B;  1FMA D;  3AE4 B;  3R2I A;  1E90 A;  5G5G A;  2BS3 B;  2ASQ A;  3KQ4 A;  2KAN A;  2LUM A;  2BW2 A;  3IT6 B;  4JWS C;  3DBS A;  4A6Q A;  2IGG A;  1ISN A;  2LFI A;  2DYB A;  4KDI C;  3VHT C;  4DQO C;  1HXY D;  3JW0 X;  1VLB A;  3U7D A;  1I4P A;  3UI3 A;  1KRH A;  5MPO A;  1ZW7 A;  1T6B X;  2WDV B;  3MTN B;  2IYD B;  1FFV A;  2JPH A;  1WGR A;  3C8Y A;  1TY2 A;  3AE8 B;  4M01 A;  3TBL D;  3UIP B;  3V60 A;  1TZ1 A;  1V5T A;  1AN8 A;  4GU2 A;  3RFZ B;  4L2Y A;  5BMH A;  3A1Q A;  3X0W A;  3GE3 C;  4D2K A;  3P2B A;  3Q3J A;  1JWU D;  4LTU A;  3RT3 B;  3SU8 X;  3ENE A;  4JPS A;  4TKN A;  4TSS A;  1UH6 A;  3AM9 A;  3LDZ E;  4YL8 A;  3ZRF A;  4ARC A;  1D4B A;  3APD A;  2JSV X;  1YNT E;  2YVC A;  4MSQ B;  3TMP B;  4AUQ C;  2G4D B;  2GBK A;  3WAP A;  4JIO U;  1MHX A;  4NJC A;  4REZ A;  1IUE A;  2LRU A;  4A55 A;  4ZDV A;  3T8M A;  3FC4 A;  3T9L A;  1R4M B;  1AAR A;  4RF0 A;  1L6U A;  4RFB A;  4HK2 A;  1V49 A;  3BVZ A;  1F2R I;  5AZH A;  1FCC C;  1SGH A;  4BKG A;  3TSS A;  3GZN B;  2Q5W D;  3H7S A;  1Z5S B;  3ML9 A;  3W1S A;  1FNW A;  3U30 A;  1F77 A;  2KN4 A;  2GBN A;  4MJS A;  1NVI D;  2KHW B;  3W1Y A;  1ZKH A;  3AU5 A;  1P9D U;  2NR2 A;  2UYZ B;  1KLG D;  4HCN B;  3ECI A;  3C19 A;  3VXW A;  2KN5 A;  3C0R B;  1OGW A;  2JY6 A;  1MFW A;  3X23 A;  1FRR A;  4AP4 C;  3AI5 A;  3U2S C;  1EU3 A;  4WH4 A;  2MA9 B;  3SEB A;  4BOZ B;  2FCN A;  1D6E C;  4F8C B;  4ZRI A;  4EZL A;  3U4E G;  1J7A A;  1L6V A;  4PYU A;  1G6J A;  2XNA C;  2RPQ A;  3DDC B;  2NBV B;  2JYT A;  3P4Q B;  1EM7 A;  4GDL A;  5D3D A;  2J0K A;  1C4C A;  1N62 A;  1FO4 A;  1LO5 D;  3BK2 A;  2DLB A;  4ICV A;  2N9X A;  1E9M A;  2E3T A;  1NI2 A;  2K8H A;  3APC A;  3AEA B;  2L32 A;  5E6O A;  2LGD A;  3AE6 B;  2ZCB A;  2J4X A;  1WZ3 A;  4WWP A;  3TEY A;  4DWF A;  2GI9 A;  2N7D A;  3DOW A;  1XLN A;  4Q2J A;  4IDI A;  4GDK B;  3L54 A;  4W9C A;  5EDS A;  1UZX B;  4B95 A;  2C60 A;  5J18 A;  4JQW C;  1I4X A;  2BPS A;  2YLM A;  4ARI A;  4HRS A;  3GB1 A;  2BWF A;  1WXQ A;  4YWG G;  3PRZ A;  4NAW B;  1E8Y A;  2KQS A;  4M8M A;  4CO7 A;  5AUI A;  2L1A A;  3AV8 A;  2C9W B;  4FJZ A;  3WAN A;  1FPY A;  2VH1 A;  2IJ0 A;  2K5P A;  2VZK D;  1CJE A;  1K50 A;  1MHH E;  2KDI A;  5BMI A;  3TEX A;  3TL5 A;  2WXK A;  2LVQ A;  2AL3 A;  1R4N B;  3DVG X;  4ITK A;  3P42 A;  1T0S C;  2NCN A;  1XCQ L;  1HE8 A;  5C23 A;  3H7P A;  3VDZ A;  4EE2 A;  2BYT A;  3FIL A;  3U8Z A;  1DYQ A;  1UBI A;  2PEA A;  4XZ4 A;  1T5X D;  3OWE B;  1KF6 B;  1XXG A;  3N1Z C;  3MJW A;  1SB3 C;  2OOB B;  4MGY E;  4OHJ A;  3KLS X;  1LXD A;  1VDV A;  2AQ3 B;  2AQ2 B;  2MBQ A;  2HTH A;  4USA A;  1BUI C;  1JW9 D;  1F1H A;  1KLV A;  2LAS A;  1WJU A;  1K51 A;  4BKS A;  1WSP A;  2KVZ A;  4GOC A;  4LDT B;  4W9H A;  3RYT A;  1WRD B;  2INN E;  1E10 A;  1CK1 A;  3B9J A;  2WHI A;  2JYE A;  3L4P A;  4ACF A;  1YD8 U;  5CHV C;  2PVO D;  1STE A;  3H8H A;  4BKT A;  2K1F A;  3NHE B;  1WWT A;  4XE0 A;  3TEZ A;  4HPM B;  1K53 A;  3NVY A;  4UDU C;  2DZM A;  2QHO A;  1F2R C;  4YT0 B;  1V2Y A;  2VZK B;  2LJI A;  3NS1 A;  4ZHO A;  3IVF A;  4KSK C;  1XF5 L;  3DVN V;  1SEB D;  4NPN A;  3B1L X;  2K25 A;  3MC9 A;  3WAO A;  3R7Q A;  2Y5C A;  2KNB A;  5JHB A;  2N9L A;  3RMK C;  5LXH A;  4WAA A;  1WGH A;  2KDE B;  1WZ0 A;  2MHJ A;  4FLH A;  1L0Y B;  4A8X C;  1N5X A;  4DDG D;  4N6E B;  3RUL A;  3LYY A;  1HZ6 A;  4TQ1 A;  4WJQ A;  5BYS A;  1B9R A;  3AEG B;  5G2N A;  3AEF B;  2WS3 B;  3QAQ A;  3RD2 A;  4NZL B;  2X8X X;  5DCN A;  2MRP A;  3I57 A;  4M8N A;  1EUV B;  2BVC A;  2EEL A;  3I9V 1;  2NBW B;  2J53 A;  1N6Z A;  1YX6 B;  1ZPS A;  3L17 A;  4LNO A;  2Y5P A;  2NVU I;  1E8W A;  2DX5 B;  3PSE B;  1KM7 A;  1XLQ A;  3O13 A;  1OQR A;  4M0W B;  3WCQ A;  1V1O A;  1WX8 A;  2V3N A;  2N1W A;  4XDD A;  3SR6 A;  2FUH B;  2BT6 A;  3KW5 B;  2SEB D;  1TY0 A;  2LUE A;  1Q1O A;  1HQR D;  1A5R A;  3K9P B;  3M63 B;  4MSM B;  1XT9 B;  4HPL B;  1K8R B;  2NTS A;  2HJ1 A;  2WDQ B;  4RH6 A;  5CTR C;  4KIK A;  4FN2 A;  1C4P A;  3HRD D;  1WGG A;  5BMG A;  1TKY A;  3R7R A;  1I7H A;  1NYQ A;  2DHZ A;  3UQA A;  3SHQ A;  3DCG A;  4K3C A;  3OLM D;  1WR6 E;  3KUD B; 
#chains in the Genus database with same CATH homology
 1ACC A;  2J42 A;  1BML C;  2QEJ C;  2WDR B;  3ETR A;  3IAM 1;  4CQN A;  3AEE B;  2JQR B;  3W5V B;  2W3S A;  4RNA A;  4ZOH C;  4YTM B;  1KFY B;  5D3I B;  1FMA D;  3AE4 B;  2ONQ A;  1N5W A;  1YMH E;  1FEH A;  3R2I A;  1ESF A;  1VRA B;  5G5G A;  2BS3 B;  4OZB A;  4WIP A;  1YN5 A;  2DWQ A;  3CWI A;  4WUR A;  1XEE A;  5C3J B;  3KQ4 A;  1M4V A;  1SXT A;  2GRI A;  1TYG B;  2LUM A;  2QJL A;  2BW2 A;  3IT6 B;  4JWS C;  3AEC B;  2E6X A;  2WXI A;  2WXR A;  4A6Q A;  1BXT A;  2IGG A;  2LFI A;  1YQ4 B;  4DQO C;  1HXY D;  4N58 A;  3EA6 A;  1Y56 A;  1VLB A;  5HI1 A;  4RGN A;  1I4P A;  4WAF A;  3UI3 A;  1KRH A;  5MPO A;  3GS2 A;  2WP9 B;  1T6B X;  2WDV B;  4L23 A;  3U7Z A;  1FFV A;  1IBX A;  3ZJU A;  3C8Y A;  3LXF A;  3GP7 A;  2BS4 B;  4A9A A;  1TY2 A;  3AE8 B;  3AEB B;  4MT5 A;  3CIR B;  3ZYY X;  1C76 A;  1TS5 A;  1T3Q A;  1ZP0 B;  2WXF A;  3SFE B;  1FCL A;  1AN8 A;  2AX5 A;  2LHD A;  1EU4 A;  2PMV A;  3RFZ B;  3VRA B;  2HTM E;  4L2Y A;  5BMH A;  4D2K A;  1JRP A;  5EE1 A;  5TSS A;  2V4I B;  2KAJ A;  1JWU D;  4LTU A;  4L1B A;  1SE3 A;  4AQ7 A;  2LHE A;  4A90 A;  4JPS A;  1OFF A;  3AE1 B;  4TSS A;  2RDH A;  1ZXI A;  3AM9 A;  2PIA A;  2PLP A;  3KWL A;  3HVZ A;  2WXO A;  4ARC A;  1D4B A;  2JSV X;  2L83 A;  3BZD B;  4MAC A;  4JX1 C;  5E6J A;  2MH7 A;  1YNT E;  1CQV A;  2QIL A;  4DXF A;  3BYY B;  3NVV A;  1VR9 A;  2PKO A;  1MHX A;  1MI0 A;  4RF1 A;  1TKG A;  1AW7 A;  4NJC A;  1IUE A;  4REZ A;  4A55 A;  3B2G A;  3FC4 A;  1DOX A;  1D5M C;  3HUI A;  3VR9 B;  4FXC A;  3AMZ A;  4RF0 A;  1I4Q A;  1L6U A;  2JXT A;  3IT4 B;  4RFB A;  1FD6 A;  5LNK 1;  4US8 A;  2XN9 C;  4OZA A;  3RPF C;  3PZ8 A;  1TS3 A;  4KGR A;  3BVZ A;  1F2R I;  4KKJ A;  5EE0 A;  1GB1 A;  1FCC C;  2BB6 A;  1L5P A;  3NUH B;  5T8I A;  1SE2 A;  5AUK A;  1L0V B;  3AE7 B;  3TSS A;  4C7Y A;  2Q5W D;  3W1S A;  1FXA A;  3BVM A;  1FNW A;  2JX5 A;  1F77 A;  2WXP A;  2JZP A;  5D7G A;  2KN4 A;  3N9Y C;  2WLB A;  2Y3A A;  2K3U A;  4TQ0 A;  1WYG A;  1ZOY B;  1NVI D;  1FFU A;  3MJ5 A;  1MVK A;  2RDG A;  1VZ7 A;  2K22 A;  3Q8B A;  4AS1 A;  3MFG A;  1F0Z A;  1DOI A;  2JWU A;  3KWV A;  4NAM A;  1J7C A;  3W5U B;  1A70 A;  1KLG D;  4MM3 B;  2RMM A;  1SF0 A;  3E56 A;  2PW9 A;  2EKI A;  5FR3 A;  2KQ4 X;  2QIE B;  1NYR A;  2FE8 A;  1FRR A;  3U2S C;  1EU3 A;  4WH4 A;  4YSX B;  3SEB A;  3FAH A;  4C56 C;  3E9S A;  1VZ8 A;  1QIL A;  1ZDX A;  1QQR A;  1D6E C;  4HRO A;  2N7J A;  3ZGZ A;  3U4E G;  1J7A A;  1ET6 A;  1L6V A;  2XNA C;  3MC0 B;  4ZYS A;  3AH7 A;  2JYT A;  1R7S A;  3P4Q B;  1KLU D;  2V3P A;  1EM7 A;  3BVG A;  4OVZ A;  2H88 B;  5D3D A;  1RM6 C;  1C4C A;  1N62 A;  3LB8 C;  4WQM A;  1FO4 A;  1LO5 D;  1HEZ E;  3HVD A;  3T3O A;  3BK2 A;  4B0E A;  1YN3 A;  1FNU A;  3AE9 B;  3ABV B;  4US9 A;  1E6E B;  2DLB A;  3R2T A;  2HDE A;  2N9K A;  2ICI A;  1E9M A;  1P7F A;  1QLB B;  1YJI A;  2E3T A;  4LLG M;  2K9X A;  4XDC A;  1XCT L;  2FBW B;  2IGH A;  2WXN A;  4ZHP A;  1V97 A;  1JWB D;  3AEA B;  2L32 A;  3Q8C A;  2TSS A;  2QSD A;  4GDL B;  4RGM A;  1ET9 A;  1N60 A;  3AE6 B;  1PDX A;  2RPV A;  2J4X A;  4HEA 1;  3TEY A;  2GI9 A;  1QOF A;  1XLN A;  2W3R A;  4Q2J A;  3VRB B;  1V1P A;  2IDY A;  4IDI A;  1P7E A;  4GDK B;  4DXG A;  3Q8F A;  1DGJ A;  1PUT A;  3TUO A;  3NRZ A;  4TMA B;  1FM0 D;  1PGA A;  1TJE A;  1V8C A;  1JCK B;  1I4X A;  1WRI A;  4JWU C;  1SIJ A;  1EWY C;  3B2F A;  5H92 C;  2CJO A;  3MHZ A;  4ARI A;  1XO3 A;  4HRS A;  3GB1 A;  1WXQ A;  3V05 A;  2MJ3 A;  3AED B;  2IPK D;  4YWG G;  1C9F A;  3NVZ A;  4NAW B;  3ZJV A;  1V1P B;  2BTE A;  2MJE A;  2SAK A;  2CJN A;  1JWA D;  2WU2 B;  5AUI A;  2L1A A;  3AV8 A;  5C2T B;  1GB4 A;  2PTL A;  5BYQ A;  1FRD A;  1QOG A;  2OHF A;  3MP9 A;  3V3X A;  2IJ0 A;  3P4R B;  2K5P A;  2VZK D;  1CJE A;  1K50 A;  1MHH E;  2V0G A;  5BMI A;  3TEX A;  1GOZ A;  2WXK A;  4ITK A;  2WXM A;  3P42 A;  1KTK A;  1NEK B;  1L4D B;  4OW0 A;  1XCQ L;  2X38 A;  1RFK A;  2LGI A;  4N59 A;  1EWC A;  2INP E;  3DWG C;  1QOA A;  4EE2 A;  2BYT A;  3FIL A;  4YTN B;  2I2Y A;  1ROE A;  1DYQ A;  5I4D A;  3TEW A;  4RCO A;  1T5X D;  3OWE B;  1KF6 B;  1XXG A;  1YN4 A;  1JWM D;  1TZO A;  2R61 A;  3BWU D;  2D5G A;  2CU3 A;  4C80 A;  1JML A;  2KDM A;  4KKI A;  3P1M A;  4KGS A;  1AWD A;  5HG2 A;  1SB3 C;  3NZ3 A;  1UUP A;  4OHJ A;  3KLS X;  3T3N A;  1VDV A;  1MPE A;  3FIL B;  5JXV A;  3AE2 B;  3EGR A;  1IGC A;  2NMQ A;  4PT5 A;  2AQ3 B;  2KWD A;  1FIQ A;  1Q10 A;  2AQ2 B;  2W82 A;  3AB5 A;  2FUG 1;  2J52 A;  2M0A A;  3Q8A A;  2BB5 A;  3DWM A;  4USA A;  1BUI C;  1FNV A;  2WQY B;  3P4S B;  1JW9 D;  1E0Z A;  1K52 A;  3PZ7 A;  4MH8 A;  1K51 A;  1TS4 A;  2MJD A;  2K0P A;  1SJH D;  1WSP A;  4YXD B;  4HKZ E;  1N61 A;  2WXG A;  4XWT A;  2INN E;  2BS2 B;  1C77 A;  1E10 A;  1CK1 A;  3B9J A;  2JU6 X;  4HKQ A;  2JYE A;  3L4P A;  2KMM A;  4XWW A;  1FXI A;  2ACZ B;  4WWM A;  3U52 E;  3BYT B;  2L52 A;  2PVO D;  1STE A;  3H8H A;  2DYO A;  1UNS A;  2B76 B;  1JQ4 A;  3Q69 A;  1ZDV A;  1YJJ A;  3ZQ4 A;  1WWT A;  1D5X C;  2LMC A;  4XE0 A;  2WU5 B;  4YTP B;  3TEZ A;  1SSN A;  1RYJ A;  2H89 B;  1AYF A;  1K53 A;  3NVY A;  4UDU C;  1JRO A;  1PGX A;  1F2R C;  1PYW D;  3BII D;  4YT0 B;  2VZK B;  2LJI A;  3NS1 A;  4ZHO A;  2N0S B;  4YSY B;  3NVW A;  2QMT A;  1XF5 L;  4P6V F;  1PFD A;  1SEB D;  4IOI E;  1YQ3 B;  4KGT A;  2G9H D;  2Z8L A;  1HA5 A;  3SFD B;  1B1Z A;  1UWM A;  2IGD A;  3AE3 B;  2Y5C A;  1GAQ B;  3J9C A;  2N9L A;  1UGJ A;  2W54 A;  4R3D A;  2ON8 A;  1C79 A;  2WNM A;  1TS2 A;  2YEP F;  1JWS D;  1L0Y B;  4O1N A;  4A8X C;  1QF6 A;  1ZXH A;  1OQQ A;  3IAS 1;  1N5X A;  3P63 A;  4N6E B;  2YEP B;  3LYY A;  1HZ6 A;  4TQ1 A;  5BYS A;  5HFY A;  1ZE3 D;  1B9R A;  1L0X B;  1GPX A;  1IBX B;  3AEG B;  2GB1 A;  3AEF B;  5FKA C;  1SJE D;  2WS3 B;  3IXS A;  5EE3 A;  1D5Z C;  1DOY A;  4NZL B;  1QKZ A;  4JE3 B;  4H2A A;  5G5H A;  4M0W A;  3I57 A;  1N63 A;  1TKE A;  3W9C B;  2EEL A;  3I9V 1;  2J53 A;  1CZP A;  1KH0 A;  2ZW1 A;  1ZPS A;  3R8B A;  5HHD G;  2Y5P A;  1NEN B;  1NI3 A;  4C7Z A;  1VJK A;  1ENF A;  2DYM A;  1XLQ A;  3P4P B;  1HZ5 A;  1UWX A;  3URY A;  1XLP A;  2LEK A;  2NTT A;  3O13 A;  4ZRP A;  1C4A A;  1JAL A;  1I4H A;  1OQR A;  2I38 A;  1SE4 A;  4B0M A;  1PGB A;  3WCQ A;  4OZC A;  1V1O A;  4KX6 B;  4HJG E;  1QT9 A;  2V3N A;  3W2D A;  4XDD A;  3SR6 A;  2BT6 A;  2SEB D;  1TY0 A;  2G1E A;  2WXQ A;  3AE5 B;  3EUB 2;  4ZRQ A;  4RGT A;  4LK0 M;  2ZW0 A;  2PVG C;  4P16 A;  5FK9 C;  2M19 A;  1HQR D;  3Q8E A;  1XLO A;  1C78 A;  4J3O D;  5H8Y E;  1RWS A;  4GLS C;  2W55 A;  3ZJT A;  3AN1 A;  4IKG A;  1IGD A;  2WXJ A;  2WXH A;  1L4Z B;  2KAC A;  2NTS A;  2AQ1 B;  1I4R A;  1E7P B;  2WDQ B;  4RH6 A;  1SBB B;  1C4P A;  1J7B A;  1WGK A;  3HRD D;  1ZUD 2;  5BMG A;  1QOB A;  1TKY A;  2BBC A;  1I7H A;  1NYQ A;  1VZ6 A;  1I4G A;  2MEK A;  2WXL A;  4RGO S;  3VQI A;  3PO0 A;  5GXG B;  5BYR A;  2DBY A;  4YSZ B;  3VR8 B;  2M56 B;  2OED A;  5EE9 A;  3BK1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...