1K51A

A g55a mutation induces 3d domain swapping in the b1 domain of protein l from peptostreptococcus magnus
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
72
structure length
72
Chain Sequence
MHHHHHHAMEEVTIKANLIFANGSTQTAEFKGTFEKATSEAYAYADTLKKDNGEWTVDVADKAYTLNIKFAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Protein L
publication title Single-site mutations induce 3D domain swapping in the B1 domain of protein L from Peptostreptococcus magnus.
pubmed doi rcsb
source organism Finegoldia magna
total genus 11
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2001-10-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1k51A00
3GB1A 2LHDA 4OZBA 1MPEA 2KN4A 3UI3A 2KWDA 3MP9A 4KGTA 2KACA 2QSDA 4WH4A 1GB4A 2RPVA 2ON8A 1XF5L 1XCQL 1QKZA 1FCLA 1K51A 1IBXB 2ZW0A 2N7JA 1IBXA 1PGBA 1HZ6A 1F2RC 1UWXA 1K53A 2J52A 1XCTL 4KGSA 1Q10A 5BMHA 2ONQA 2QMTA 1C9FA 5HFYA 5JXVA 2RMMA 4OZAA 2JZPA 2JWUA 1HZ5A 1MI0A 2N9LA 1FD6A 4OZCA 1MVKA 1KH0A 1GB1A 2IGDA 2ZW1A 1P7EA 1D4BA 2GI9A 3FILB 1FCCC 3FILA 1EM7A 1K52A 1YNTE 2I38A 2LUMA 2OEDA 1YMHE 1JMLA 5BMGA 1PGXA 2PLPA 1P7FA 2LHEA 2JXTA 2N9KA 4KGRA 2PW9A 4GLSC 1K50A 2IGHA 1MHXA 2EELA 1ZXHA 5BMIA 2LGIA 2GB1A 2JSVX 2KDMA 2JU6X 2KQ4X 5HHDG 2IGGA 2PTLA 4IOIE 1IGCA 1HEZE 4IKGA 2NMQA 1MHHE 1F2RI 2I2YA 1IGDA 2J53A 3V3XA 4D2KA 4HKZE 1PGAA 5HI1A 2K0PA 4HJGE 4MACA 5HG2A
chains in the Genus database with same CATH superfamily
2N4FA 4K1RB 1R4MB 4OZBA 1M4VA 4JLCA 3TEZA 1OQQA 3NVVA 4YL8A 2C9WB 4HEA1 2R2OA 3JVZX 1FNUA 3QAQA 3S2AA 1ACCA 4I6PA 4TQ0A 1QKZA 2G45B 3Q8AA 3BY4B 2KTFA 5J2RA 4HCNB 4HDOA 1VLBA 3UIPB 3AE2B 2DYMA 4B6WA 2KQSA 4HK2A 3ZNID 1YIWA 4KIKB 3AEEB 2MBBB 3WALA 3GE3C 2WDQB 3V05A 2FUG1 2XN9C 3WANA 1XLPA 2IGDA 1P7EA 1YX5B 4MSMB 3ZJUA 2J7QB 2TSSA 4JWSC 1ZP0B 3OWEB 2O6VD 2E6XA 3U7ZA 3Q8CA 1XEEA 2JXTA 5DPSA 3UINB 1FXTB 1KLVA 4M8MA 3ZDTA 4C00A 4ARIA 4ZDVA 4FLHA 2KLCA 2V4IB 3DBSA 1WM2A 1E8WA 4ICVA 3B9JA 2WXLA 2AWTA 3N1YC 2WXNA 2BVCA 2W3RA 1FMAD 2GRIA 4LNIA 1TY2A 1WJ6A 2M0XA 2FIDA 3N1ZC 2QJLA 3X0WA 3EC8A 4HKQA 2RR9A 2W55A 1SF0A 2N7DA 3R8BA 4HJKA 3MP9A 4NNJB 4EOYA 4DWFA 5G55A 3KH0A 4ANUA 2NBUA 2JPHA 2ZNVB 2JZZA 2JZ3B 4EKUA 1Y8RC 3DWMA 2MBQA 1NI3A 1E7VA 4KZCA 1WFYA 1JCKB 1WH3A 2O2VB 4CHKA 2RD0A 2BS3B 2B3AA 3U4EG 2O6VB 4P16A 2MW5A 2KTRB 5JXVA 4HPPA 2IY1B 1MFWA 1I7HA 1V1PA 3IVFA 3AE4B 2AQ2B 1L2NA 3RNGC 3ZRCA 4LDTD 2A4ZA 1L6VA 1RWSA 3BIID 1V9JA 3IT6B 1AYFA 1SB3C 3TEXA 2LWPA 2CJNA 2KDFB 2NTSA 3LXFA 4DHJD 4I6LB 4A3OA 1A70A 3P4RB 2QILA 1FRRA 1WXMA 4IDIA 4H2AA 4KKIA 1SJED 3U2SC 2W82A 4MEMA 3APFA 3ZRFA 1VZ8A 1E10A 2WXHA 3L08A 1RM6C 2PW9A 3WAMA 2IGHA 1LM8B 1ZXHA 4EUTA 4YTNB 1WXVA 1E90A 1L0XB 3W1SA 2EMTA 3DOWA 4A3PA 2GBKA 3BINA 1C79A 2BT6A 2NMQA 3EHVA 3L13A 1WR6E 5D94A 2GOWA 2WGSA 3SDLC 1UNSA 2MHJA 2HD5B 3DWGC 4IM3A 3MHSD 1VJKA 4TQ1A 1F1HA 3N20C 4E3CA 4MT5A 3IT4B 5HG2A 2DYBA 3NG0A 4NPNA 1UGMA 2LVPA 4FJYA 3KQ4A 1DOIA 3W9CB 1ZE3D 2KMMA 4MGIE 4KGTA 4LDTB 4PYZA 2C7HA 2WXMA 2V3SA 4RCOA 4I6NB 4HCPB 1XCQL 4ACFA 1IBXB 2E3TA 1UF0A 2BKFA 2WXIA 1JWMD 3ZJVA 2IO3B 2LVOA 4AJWA 4URKA 5DCNA 4BKTA 1GJZA 3ENEA 3TJPA 3AE8B 5D3DA 2IO2B 3B08A 3MC9A 3NVZA 2JZPA 4NJ7A 3VUXA 3Q8BA 1WIAA 1IP9A 1RFAA 2D2QA 4OZCA 1J19A 2NBWB 2Y5BB 1T0RC 2EKEC 2LXAA 3KW5B 2KWVB 2N9XA 2D3GA 3AU4A 4C4VB 3AEDB 1FNWA 3M63B 1QOBA 3VUYA 4B0MA 1XD3B 2QC8A 1YOVB 1D3ZA 3KUCB 2YEPB 1DOXA 2CHXA 3DVNV 1C4CA 4BBNC 4E74A 4XC2A 3PRMB 3WAOA 3PV1A 3JSVA 4BKSA 3H7PB 4KVGB 3C8YA 5C2TB 1Q1OA 3OG5A 4US9A 4ASWC 1YQ4B 1NEKB 3RNFC 1SJHD 4A8XC 1NYRA 1B1ZA 2V9HA 5TSSA 2KKCA 3D32A 3PRZA 1C4AA 4IG7B 4WJOA 3Q69A 3R7QA 3GZNB 3MFGA 4MSQB 1R4MI 2OJRA 5AZHA 3SFEB 3H1UA 1BXTA 2JYTA 4JQWC 3U52E 3BVGA 3M62B 2DAFA 4A9AA 3GE8C 1I4PA 4DXAB 1XO3A 4CYEA 2KVRA 3DBRI 1RYJA 3A33B 1GUAB 3HIZA 4JE3B 4RMAA 3NVYA 1ZDXA 2REXA 3DHGC 3SU8X 3T8MA 2BS2B 3PO0A 4WIPA 3I9V1 4TSSA 2Z0DB 2KXJA 4ZRKA 5CX3A 4YSYB 4GN1A 1VCBA 3NJTA 3MC0B 4MJSB 2WDTB 1FEHA 4K7WA 3I63C 3OAWA 2AQ1B 2UYZB 5IA7A 2I38A 1YMHE 5BYRA 5BYQA 1I42A 4DBGA 4KDIC 5FR3A 4W9GA 2KC2A 4XX5A 4G11A 2KD0A 1XLNA 4AJYB 3R66C 1SSNA 2JSVX 2LFIA 2NPTA 4DXFA 1AWDA 3M95A 3AE6B 1WWTA 4W9DA 4TUUA 1E6EB 3A9KB 1TS2A 4ARCA 1V2YA 3RYTA 3TBLD 4JWUC 2D3AA 4M0WA 1HTQA 3AECB 5IAAC 1YN4A 2KJHB 2BPSA 2M4NA 2LMCA 3Q3MC 1QZEA 4IM2A 1R4NI 4XWWA 4FADA 3BWUD 4KSKC 3ZNZB 4N58A 4W9FA 1ZGUB 2IO1B 1V81A 2L52A 1J7BA 2D07B 1WE7A 4YWGG 2MJEA 2HJ1A 2Q5WD 2MJ3A 5G5HA 5D7GA 4EZKA 3MC8A 3NS8A 2KX3A 2MLBA 3I3TB 2DZMA 2MH7A 4JX1C 5E6OA 1N6ZA 3Q3FA 4M00A 1PFDA 1YQBA 5DPRA 2L1AA 3TCAA 3R3MA 2PIAA 2W9NA 3ALBA 2LGXA 1E9MA 1V1PB 2KANA 2QDFA 4GDLA 1QOGA 2LXCA 1KJTA 1VDVA 2KMAA 4B0EA 3ZUNA 2L0FA 1EM7A 2Z59B 1FO4A 4M8NA 3PREA 1ROEA 3AI5A 3KVFB 2KQ7A 3K9OB 3ABVB 1JMLA 4FBJB 2Y5CA 3OJ4B 2GBJA 3QA8A 4GLSC 1K50A 2EKIA 3DQVA 4FJZA 2HTHA 2DNFA 4BBNF 2M8SA 3CMMB 1JROA 3W1SC 4DK5A 1OEYA 2XK5A 2BB5A 2JU6X 1I35A 4MH0E 1IGCA 4GGQA 4REZA 1Q5WB 5IN7A 3VAWA 2EMSA 1FPYA 3HUIA 2MCNB 3V3XA 4YSXB 4CO7A 3VTUA 2BWFA 1WGKA 4MACA 1LO5D 4HWIB 3GB1A 4GIVA 1STEA 2OOBB 3AN1A 1N60A 4FHJA 4LNFA 2KFKA 5CHVC 1E7PB 2M19A 2GBRA 4NQLB 4AWJA 2WHIA 3TEYA 1NI2A 3PGEA 3ZYYX 1WGYA 2JY6A 3P4QB 4BKSD 1D6EC 3R7RA 2JRIB 4K81A 3VDZA 4KZ0A 4DHZB 2KAJA 1ET9A 3RD2A 2PVGC 1K53A 2HDEA 5FKAC 5C23A 3HM6X 4BZAA 2HJ8A 2ZPNA 4PS8A 1C9FA 1LQBA 3L54A 4N59A 1YQ3B 3RZFA 4WWMA 1VR9A 2JWUA 1E7UA 3ZJTA 1P9DU 4WWOA 3DVGY 2V1YA 4BVUC 4WAFA 1J8CA 2KT7A 3ZTCA 1CK1A 1DGJA 2J0MA 4OVUA 3NOBA 1IPGA 1GOZA 3GS2A 1J0GA 3RI7C 1OFFA 2G4DB 1WRDB 4ZOHC 2CS4A 4KGRA 1V5OA 1LFDA 1CQVA 1F52A 1FXAA 2OJWA 2FAZA 4W9LA 3JW0X 3PSEB 1AN8A 3P4PB 3RT3B 1YX6B 2QHOA 3AMZA 1HE8A 2K0PA 4ZHOA 1WJ4A 3GOEA 2AX5A 3N30A 4EE2A 1HXYD 2K8BA 2RDHA 1L6UA 1OQYA 1SIJA 3IXSA 4AQ7A 1OEYJ 1P0RA 3AEBB 4PT5A 5KHQA 1SXTA 1EWYC 5IO9A 5I4DA 2MA9B 1ZUD2 4P6VF 1JWUD 2K6QA 4ZYSA 1WX9A 2CU3A 1BUIC 2JQRB 3EA6A 2JX5A 1S1QB 2PE6B 3A9JA 4HRSA 1MG4A 1SEBD 4NAWB 4MM3B 1WR1A 4FN2A 1YD8U 1KH0A 3SD5A 4WWNA 1FM0D 4XDDA 5AZFA 4F8CB 2ACZB 1TS4A 2IO0B 3MJWA 1YJIA 5G5GA 1CZPA 2NS5A 4GSWA 1PQSA 5J17A 2WWZA 1QOAA 3DBHB 1F0ZA 1KLUD 3KWVA 2C7NB 2KNBA 3RNEC 1MJDA 4IC7B 3E56A 4A90A 4C7ZA 4IKGA 2WXPA 2WX0A 2KJ6A 2A5UA 1TJEA 3DBLI 3DHIC 5JZEB 1F77A 2JRHA 4M0WB 3W1YA 3QCAA 4WURA 1FFUA 5H92C 2KACA 4BFRA 3EUB2 4W9JA 2FCQA 4CQNA 2X8XX 3C0RB 3DDCB 2BBCA 2MBHA 1HA5A 4GDKB 4E71A 2ZCCA 1WYGA 4K3CA 2RDGA 2WXKA 5AEKB 4XDCA 5BMHA 4MGKE 2KOXA 1WE6A 2D10A 3FAHA 4XYCA 2AL6A 3P42A 3V61A 4JIOU 1P1AA 4DHJB 3QJZA 3DVNU 3P2BA 2RGFA 1L0YB 1FD6A 3ETRA 3IBEA 1F9JA 3NZUA 3VH3B 2ZW1A 4L2YA 3JYUA 1KFYB 2L0TA 4K3BA 3U30A 3V6EB 1FCCC 1PDXA 2C7MB 4G0NB 2XBBC 1U4AA 2JWZA 4ZYNA 2LUMA 3L16A 3P63A 2BYVE 5L83A 4A6QA 2KWCA 2KWUB 1ENFA 2MP2A 1TZOA 2Z8LA 1V86A 4DDGD 2UWQA 1NYQA 2DZIA 2KDMA 3DHHC 1WJNA 2INCC 1KF6B 1F2RI 2B76B 1IGDA 2V3NA 4LNNA 1QQRA 3BVZA 2NCNA 4PS3A 3Q8FA 2IBIB 3P4SB 2AQ3B 2I1JA 3O13A 2N9PC 4EEWA 4J3OD 4ICUA 2KFKB 2KWDA 1JWSD 3PHWB 3RFZB 4B9KA 2M0AA 3CSFA 1C77A 3QQ8B 3DVGX 2MBOA 1FCLA 4P1CC 1V6EA 3AU5A 1H4RA 1JQ4A 4OVVA 2LRWA 3I5JC 1XQQA 1XCTL 1WYWB 2KO3A 4RNAA 4AUQC 3Q8EA 5E6NA 3ZVVA 2KDIA 3NY5A 2BQQA 2KFJA 3N3KB 4C56C 2LZ6A 3W2DA 1HTOA 1WM3A 1ZXIA 3PLUA 1AARA 2BB6A 2DYOA 2K5PA 3BVMA 1VZ7A 3K9PB 4HROA 2ZCBA 3T3OA 2L32A 2DX5B 1P98A 2GLSA 2WXGA 3TUOA 3U7DA 4W9IA 2MSED 3SEBA 4ZRIA 3TSSA 1SE2A 2W54A 1YN3A 2LVQA 1KLGD 2FCSA 2FE8A 2XNAC 3ECIA 1GPXA 4UDUC 2KZRA 2C60A 2RDBC 2LGIA 4DXGA 2PJHA 3BYYB 2G1EA 3HM3A 5HHDG 2BKRB 2JXXA 1AW7A 4TMAB 4Q2JA 4LNOA 1SE4A 1N61A 1GC6A 1UBIA 2G9HD 3NUHB 1M94A 1NDDA 2K25A 3V6CB 3Q2AC 4IWOA 4RGOS 3PTFC 1CJEA 4RF0A 2LASA 5D2MB 1OGWA 1ET6A 1T5XD 1YJ1A 5DPTA 1I4GA 3I57A 1S3SG 1V80A 1XF5L 1H8CA 3AH7A 2AEHA 1E0ZA 1NBFC 3VH4B 3LB8C 5EE1A 4MGZE 1PGBA 2GBMA 1QLBB 2J0KA 2YVCA 2CHWA 2FIFA 4WWPA 1UGJA 1FIQA 2CR5A 4L23A 1EU3A 2QMTA 4FXCA 3A9JB 5HFYA 5D6JB 4A55A 4ANWA 5EE0A 1FNVA 4LLGM 5JH5C 5LXHA 2N9LA 3ZTDA 1D5MC 3WA0A 1TKYA 4FHKA 4W9EA 5LNK1 1KTKA 2KMCA 2WX1A 2V0GA 4C7YA 4QAYA 2BYTA 3FILA 5AZGA 2C5LC 1J7CA 2WU2B 2GBNA 1R7SA 1P3QU 1PGXA 5EE3A 4ZRJA 1T3QA 3B0AA 3LJ3A 3VXWA 3ZGZA 3QIJA 3TEWA 5DPWA 2Y5PA 4IOIE 1HEZE 1KRHA 3H9DA 4D2KA 3ZNGC 1VZ6A 3VTVA 3NZ3A 3M3JA 1YJJA 1KOTA 4FULA 5KHOA 1I4QA 2KN4A 3U8ZA 3UI3A 4KDLB 4DQOC 3QX1A 1XLQA 2JT4B 2VRRB 2HTME 3ML8A 1ZKHA 1PYWD 4F1SA 2ZVNA 4C80A 2QSDA 1EWCA 2RPVA 2XEWA 2PPHA 4LTUA 3R2TA 2MQJA 4OHJA 1T6BX 5AUKA 3P1MA 3RNCC 2WP9B 1WI0A 1F2RC 1SGHA 2L05A 3B1LX 2J52A 3Q3OC 3PS6A 2K3UA 4RM9A 5G2NA 4GU2A 2ZEQA 3PZ7A 2WYQA 2QEJC 5H8YE 1NENB 2BYFA 1GNUA 4X57B 4RFBA 2PKOA 2N1VA 1UBQA 2KLGA 2DLBA 3AE3B 3QC8B 2DBYA 4ZRPA 3NRZA 4YXDB 3WAPA 1SBBB 2DHZA 3J9CA 4S17A 3VVWB 3PHXB 4DHZE 4N9F4 1YNTE 2J42A 3PZDA 5MPOA 1FRDA 3AEAB 2INDC 1UWMA 4ZHPA 4IM0A 2MP2B 3FKYA 1T0YA 1UUPA 4YTMB 3VUWA 3TIXA 2D3BA 3QHTA 4KSLC 2EELA 3UQAA 1E8ZA 5CTRC 1HQRD 3C19A 1WXAA 3V62A 2DZKA 3BK2A 3BZDB 2SAKA 3ZXVA 4B95A 3IHPC 1EF1A 4IW0A 5BYSA 1FXIA 2JF5A 1DYQA 1MG8A 1OQRA 1PGAA 3APCA 4G3XB 1BMLC 1RLFA 3DBRB 3AM9A 5J18A 3HVZA 1MPEA 1VD2A 2K8HA 1TTNA 2OHFA 5IKCM 2LGDA 2CU1A 1QT9A 5C3JB 3KYCD 3HHMA 3JSVB 3ZO5B 1Y56A 1GB4A 4G50A 3V60A 2AYOB 3NZSA 5JHBA 2WQYB 3AE5B 3OLMD 2ZW0A 1N63A 3ZLZA 1B9RA 2KDEB 3A1QA 1RAXA 3UIOB 4MJSA 1N62A 4MDKE 5EE9A 4EFOA 3HRDD 1IYFA 5TR5A 3GZNI 3FC4A 2RMMA 1WF9A 1TIFA 2LD9A 2MJDA 4YT0B 5E6JA 2PE9A 3ZIMA 4IWQA 3EFCA 3VR8B 2MBEA 4N6EB 4TKNA 5IP4D 2DAJA 2VZKD 1VRAB 2PMVA 1GB1A 3RZWC 1D4BA 2X38A 2FUHB 2BGFA 1OTRB 3VRBB 3L17A 2KJRA 4S0RA 4WAAA 3A9KA 4J6IA 4FJVB 4HPLB 2PLPA 1L4DB 5CHFA 2WXRA 3PVLA 5C1ZA 3A4RA 1WJUA 5BMIA 1R4NB 2KN5A 1EU4A 3MHZA 2KQ4X 2VH1A 1L5PA 2ZNVC 4XWTA 2I2YA 3BK1A 3H6NA 1ISNA 3PT2B 5L95C 1TS3A 1DOYA 3GP7A 1UZXB 2KC1A 2PEAA 4R3DA 5LLIA 2NPTB 4MH8A 5IOIA 4WH4A 1TT5B 1QOFA 1UH6A 2IPKD 2VZKB 4AOFA 1L0VB 2NTTA 2HE7A 2QCZA 1HZ6A 3AE1B 3AB5A 1XT9B 3UF8A 1L4ZB 3W5UB 1WXQA 2N0SB 4KGSA 4TV3A 4AS1A 4IUMB 2ONQA 3DCGA 3KUDB 4GXBA 4US8A 5EDSA 2KHWB 3KYDD 4AP4C 4WQOB 3ZXRA 2R2QA 4BOSC 1HZ5A 1MI0A 2J0JA 3VHTC 1MVKA 2FNJB 3AULA 2IYDB 2VH2A 4NJ6A 3FILB 3RUIB 4BAXA 1Z2MA 4YTPB 1WMHA 2M1MA 3R2IA 3Q3JA 4FA6A 4GDLB 4BOZB 3RNBC 5T8IA 3SHQA 2K8CA 4M01A 4WJPA 2DZJA 2BYEA 1LXDA 1N5WA 1EF5A 2L3ZA 2CKHB 4ITKA 2KK8A 4OW0A 3T3NA 1WSPA 2BS4B 4L1BA 4EZJA 4BKGA 4LNKA 2KYWA 1J7AA 4LCDE 3AE7B 1GG3A 1I4HA 2V4LA 2IDYA 1V49A 2BW2A 1V97A 2G4SA 1E8XA 1TBEA 1LGRA 2INNE 2XK5B 1WGDA 3B2GA 2LGYA 1EUVB 3OJ3A 4HLEA 4LJPB 3VFKA 3ZKJC 1K51A 4RH6A 1TYGB 2N7JA 2SEBD 4XZ4A 3VR9B 1A5RA 2INPE 4XGAB 2IZVB 3HVDA 4ZRQA 1WZ3A 1T0SC 4MELA 2DENB 3X23A 1GC7A 4EZLA 2N7EA 1SE9A 2YLMA 3RPFC 1Z5SB 2H89B 4KIKA 2L00B 3H7SA 2BF8B 2QIEB 2CHZA 1Q0WB 3RN9C 2MWSB 4DDID 1WGGA 1YN5A 3W5VB 3WIMA 4RM8A 4JL9A 4MGYE 3N9YC 1K52A 2JUOA 4GB9A 2G3QB 2L83A 3AEGB 2OEDA 1KM7A 2K1FA 2M17A 5BMGA 4ANXA 2D11A 4NZLB 3UGBB 2MX2A 1P7FA 1JRPA 2LHEA 2N9KA 1N5XA 2LJ5A 2LI5A 1TZ1A 1MHXA 3ZNHB 1JRUA 1V5TA 2WLBA 3E9SA 3RNAC 2LEKA 2KVZA 4F7ZA 2ZZPB 2N1WA 2NR2A 2PTLA 3NS1A 2K6DB 2LRUA 1MHHE 2DWQA 2NBVB 4HVBA 3EGRA 1V8CA 4LK0M 3DPDA 1WX7A 5HI1A 3VQIA 1WY8A 2LGSA 1WX8A 1RRBA 2JVCA 4WJNA 3IAM1 3IAS1 1NVID 3QWZB 4II2B 3HK0A 1UELA 1TS5A 1RFKA 1CMXB 1XLOA 3MTNB 2ASQA 5BO4B 3ZW3A 4NAWA 1C4PA 2D5GA 3PRPB 4MM3A 4K7UA 1D5ZC 2CJOA 4GOCA 2ZVOA 2WXQA 4P1BC 3B2FA 1TY0A 3A1QB 3Q3NC 2BTEA 1IUEA 5GMVA 4PS7A 1JWAD 2O2VA 1C1YB 1ZW7A 3Q14C 4GMVA 5HKHA 4RGTA 3AXCA 2FBWB 4JPSA 4PYUA 2O6VA 1JALA 5FK9C 1BT0A 3ONSA 3IFWB 2KTRA 3VTWA 5D3IB 1GAQB 4OZAA 1JW9D 2AL3A 5CHWA 3CF6E 2D3CA 3EECA 4RGMA 3APDA 2IY0B 3AE9B 1EO6A 4KX6B 2UU7A 2L76A 1QILA 1PUTA 4NY0A 3TMPB 3KWLA 1ZPSA 2V3PA 2Y3AA 3L4PA 1C78A 3DBLB 3AEFB 4USAA 1C3TA 4W9KA 1V1OA 2NVUI 2RPQA 1WZ0A 3PZ8A 3H8HA 1ZOYB 2M56B 2MEKA 3N32A 3L0WB 1TKEA 2GMIC 3NHEB 4JGHB 1C76A 2GB1A 1X1MA 2PVOD 2RSUA 3WCQA 4NAMA 1WGRA 1SIFA 3L10B 4W9HA 3N1XC 3PPAA 4HKZE 3AV8A 4WQMA 3UQBA 1QF6A 1G6JA 2H88B 1D5XC 4K7SA 4KKJA 3ZDMC 2WXFA 2R61A 4NQKE 2LHDA 2WDRB 4GDKA 4HXDA 3T9LA 2W3SA 3DBHI 4LJOB 3URYA 3LDZE 2WU5B 4NJCA 3IG3A 1I4RA 1WXSA 3MJ5A 3SR6A 5AUIA 2WXOA 4O1NA 4PK1A 2ON8A 5LXIB 2L7RA 3CWIA 1ESFA 1IBXA 3Q6BA 3BYTB 1UWXA 3KUZA 2KDBA 2WDVB 3RMKC 4YSZB 1K8RB 1E5WA 2WXJA 1Q10A 1T0QC 4A20A 1FFVA 1UD7A 2YEPF 4HDQA 2MRPA 2IJ0A 1TGZB 4M02A 4WJQA 5FR6A 1TKGA 5GXGB 2LJIA 3PLVA 3ZQ4A 1JWBD 1E8YA 4W9CA 3LYYA 1WGHA 3CIRB 3KLSX 2ZJDA 2GI9A 1XXGA 2K39A 4OVZA 2N9EB 3O65B 3ML9A 1WRIA 4C4VA 3QARA 2FCNA 2K9XA 3RCZA 1WMHB 2ZPYA 3VRAB 3NVWA 4HPMB 4RGNA 2WS3B 3TL5A 3CSTA 2ICIA 2WNMA 3RULA 2LUEA 1ZDVA 2K22A 2Z0EB 2BWES 1SE3A 2FCMA 5JHAA 1L7YA 2JYEA 2L8JA 3EFUA 4IWPA 2IGGA 3H7PA 2KX0A 4XE0A 4ANVA 2J53A 4KV2A 1I4XA 3A4SC 4P7IA 2I1KA 4HJGE 4RF1A 5E6PA 3SFDB 2J4XA 4II3B 3QK0A
chains in the Genus database with same CATH topology
3O13A 4M0WA 4OZBA 3AECB 1YN4A 4R3DA 4J3OD 1M4VA 3TEZA 1OQQA 2LMCA 3NVVA 2KWDA 1JWSD 4MH8A 3RFZB 4XWWA 2M0AA 3BWUD 4N58A 4WH4A 4HEA1 1QOFA 1C77A 2VZKB 1FNUA 2IPKD 1J7BA 2L52A 1ACCA 4TQ0A 1QKZA 1FCLA 1L0VB 4YWGG 2MJEA 3Q8AA 2Q5WD 2NTTA 2MJ3A 5G5HA 5D7GA 1HZ6A 3AE1B 3AB5A 1JQ4A 2MH7A 4JX1C 1L4ZB 3W5UB 1PFDA 1XCTL 1WXQA 2N0SB 1VLBA 4KGSA 2L1AA 3AE2B 2DYMA 4AS1A 2ONQA 4RNAA 4US8A 2PIAA 3Q8EA 1E9MA 1V1PB 3AEEB 2WDQB 1HZ5A 1MI0A 1QOGA 3V05A 2FUG1 2XN9C 4C56C 3W2DA 1MVKA 1ZXIA 1VDVA 1XLPA 2BB6A 2DYOA 2IGDA 2K5PA 3BVMA 1P7EA 1VZ7A 4B0EA 4HROA 3FILB 3T3OA 3ZJUA 1EM7A 2L32A 1FO4A 2TSSA 4JWSC 1ROEA 1ZP0B 2WXGA 3TUOA 3OWEB 4YTPB 3ABVB 1JMLA 3SEBA 2Y5CA 3R2IA 3TSSA 1SE2A 2W54A 1YN3A 2E6XA 1KLGD 3U7ZA 4GDLB 3Q8CA 1XEEA 2JXTA 2FE8A 2XNAC 1GPXA 4UDUC 4GLSC 1K50A 2EKIA 5T8IA 4ARIA 1JROA 2LGIA 2V4IB 4DXGA 3B9JA 1N5WA 3BYYB 2BB5A 2JU6X 3GP7A 2G1EA 5HHDG 2WXLA 1IGCA 2WXNA 4ITKA 4REZA 2W3RA 3HUIA 4OW0A 1FMAD 1WSPA 3T3NA 2GRIA 2BS4B 1AW7A 4L1BA 1TY2A 4Q2JA 4TMAB 3V3XA 4YSXB 1J7AA 1SE4A 1N61A 3AE7B 1WGKA 1I4HA 4MACA 2G9HD 1LO5D 2IDYA 3GB1A 3NUHB 2BW2A 1V97A 2QJLA 1STEA 4HKQA 3AN1A 4RGOS 1N60A 2W55A 2INNE 1CJEA 1SF0A 4RF0A 3R8BA 1E7PB 2M19A 3MP9A 1ET6A 1T5XD 3B2GA 3TEYA 1I4GA 3I57A 3ZYYX 1XF5L 3P4QB 3AH7A 1E0ZA 1D6EC 1K51A 4RH6A 1TYGB 3LB8C 2N7JA 2SEBD 5EE1A 3VR9B 3DWMA 1NI3A 2INPE 1JCKB 2KAJA 1ET9A 1PGBA 1QLBB 2PVGC 1K53A 2HDEA 5FKAC 1UGJA 3HVDA 1FIQA 4ZRQA 2BS3B 3U4EG 4L23A 1EU3A 2QMTA 4FXCA 4P16A 1C9FA 5HFYA 5JXVA 1I7HA 3RPFC 2H89B 4N59A 4A55A 1V1PA 1YQ3B 5EE0A 3AE4B 4WWMA 1VR9A 2AQ2B 1FNVA 2JWUA 4LLGM 2N9LA 1L6VA 3ZJTA 1RWSA 2QIEB 3BIID 1D5MC 3IT6B 1AYFA 1SB3C 1TKYA 5LNK1 3TEXA 1KTKA 2CJNA 2NTSA 3LXFA 4WAFA 1YN5A 2V0GA 3W5VB 1CK1A 4C7YA 1DGJA 2BYTA 3FILA 1A70A 3P4RB 2QILA 3N9YC 1K52A 1FRRA 4IDIA 1GOZA 3GS2A 4H2AA 4KKIA 2L83A 1J7CA 2WU2B 3AEGB 2OEDA 1R7SA 1SJED 5BMGA 1PGXA 3U2SC 4NZLB 2W82A 1OFFA 1P7FA 5EE3A 1JRPA 1VZ8A 2LHEA 2N9KA 2WXHA 4ZOHC 1E10A 1RM6C 1N5XA 1T3QA 4KGRA 2PW9A 2IGHA 1MHXA 1ZXHA 3ZGZA 1CQVA 4YTNB 1FXAA 2WLBA 3E9SA 3TEWA 1L0XB 2LEKA 3W1SA 2Y5PA 2PTLA 3NS1A 4IOIE 1C79A 1AN8A 1HEZE 2BT6A 3P4PB 2NMQA 1MHHE 2DWQA 1KRHA 3EGRA 1V8CA 1UNSA 4D2KA 4LK0M 1VZ6A 5HI1A 3DWGC 3AMZA 3VQIA 1VJKA 2K0PA 4TQ1A 4ZHOA 3NZ3A 4MT5A 3IT4B 1YJJA 5HG2A 2AX5A 4EE2A 3IAM1 1I4QA 3IAS1 1HXYD 2KN4A 2RDHA 1NVID 3UI3A 4DQOC 3KQ4A 1DOIA 1L6UA 3W9CB 1XLQA 1SIJA 3IXSA 2HTME 4AQ7A 1TS5A 1ZE3D 1RFKA 2KMMA 4PT5A 3AEBB 4KGTA 1PYWD 2WXMA 1XLOA 4C80A 2QSDA 1EWCA 2RPVA 4RCOA 4LTUA 1XCQL 3R2TA 1SXTA 2AQ3B 4OHJA 1T6BX 5AUKA 1C4PA 1EWYC 2D5GA 3P1MA 5I4DA 1D5ZC 2WP9B 2E3TA 1IBXB 1ZUD2 2CJOA 2WXIA 2WXQA 1JWMD 3B2FA 1TY0A 3ZJVA 2BTEA 4P6VF 1IUEA 1JWUD 1F2RC 1JWAD 2J52A 4ZYSA 2CU3A 1BUIC 4RGTA 2K3UA 2FBWB 2JQRB 3EA6A 4JPSA 2JX5A 1JALA 3AE8B 5D3DA 5FK9C 3PZ7A 4HRSA 5D3IB 1GAQB 4OZAA 1JW9D 2QEJC 5H8YE 3NVZA 1SEBD 1NENB 2JZPA 3Q8BA 4NAWB 4RGMA 4MM3B 4RFBA 3AE9B 2PKOA 4OZCA 1KH0A 4KX6B 2DLBA 3AE3B 1FM0D 4XDDA 2ACZB 2DBYA 1QILA 1TS4A 4ZRPA 1PUTA 3NRZA 4YXDB 1YJIA 1SBBB 3J9CA 3KWLA 1ZPSA 3AEDB 2V3PA 2Y3AA 3L4PA 5G5GA 1FNWA 1C78A 1YNTE 2J42A 3AEFB 5MPOA 1QOBA 1CZPA 4USAA 1FRDA 3AEAB 4B0MA 1UWMA 4ZHPA 2YEPB 1V1OA 1DOXA 1QOAA 3PZ8A 3H8HA 1UUPA 1ZOYB 4YTMB 1C4CA 1F0ZA 2M56B 2MEKA 1TKEA 1KLUD 2EELA 3KWVA 1C76A 2GB1A 1HQRD 2PVOD 3BK2A 3BZDB 3E56A 3WCQA 2SAKA 4A90A 4NAMA 4C7ZA 4IKGA 5C2TB 3C8YA 2WXPA 4US9A 5BYSA 1YQ4B 1FXIA 4HKZE 3AV8A 1DYQA 1PGAA 1NEKB 1OQRA 1TJEA 4WQMA 1QF6A 2H88B 1BMLC 1D5XC 4KKJA 1F77A 1SJHD 4A8XC 2R61A 1NYRA 3AM9A 1B1ZA 2LHDA 5TSSA 2WDRB 4WURA 3HVZA 1MPEA 1C4AA 2W3SA 3Q69A 3URYA 2OHFA 3MFGA 3SFEB 2WU5B 4NJCA 1BXTA 1QT9A 1FFUA 5C3JB 1I4RA 3MJ5A 5H92C 2KACA 5AUIA 2JYTA 3SR6A 3U52E 2WXOA 1Y56A 4O1NA 3EUB2 1GB4A 2ON8A 4CQNA 3BVGA 4A9AA 1I4PA 2WQYB 1XO3A 3AE5B 3CWIA 1ESFA 2ZW0A 1N63A 1IBXA 2BBCA 1B9RA 1HA5A 3BYTB 4GDKB 1UWXA 2WDVB 1N62A 4YSZB 1WYGA 1RYJA 5EE9A 2RDGA 2WXKA 4JE3B 4XDCA 2WXJA 1Q10A 5BMHA 3HRDD 1FFVA 3NVYA 1ZDXA 3FAHA 3FC4A 2RMMA 4YT0B 2MJDA 5E6JA 2YEPF 3P42A 2BS2B 3PO0A 3VR8B 2IJ0A 4WIPA 4N6EB 1TKGA 5GXGB 3I9V1 4TSSA 1FD6A 1L0YB 2LJIA 3ZQ4A 3ETRA 2VZKD 1VRAB 1JWBD 2PMVA 4YSYB 1GB1A 2ZW1A 4L2YA 3LYYA 3CIRB 3KLSX 1KFYB 3MC0B 1D4BA 1FEHA 2X38A 2GI9A 1XXGA 1FCCC 4OVZA 1PDXA 3VRBB 1WRIA 2AQ1B 2I38A 2K9XA 2LUMA 3P63A 1YMHE 5BYRA 4A6QA 5BYQA 3VRAB 1ENFA 2PLPA 3NVWA 1L4DB 4RGNA 2WS3B 1TZOA 5FR3A 2Z8LA 2WXRA 2ICIA 2WNMA 1XLNA 5BMIA 1ZDVA 1NYQA 1EU4A 2K22A 1SSNA 2JSVX 2KDMA 1SE3A 3MHZA 2JYEA 2LFIA 4DXFA 1AWDA 2KQ4X 1L5PA 3AE6B 2IGGA 1KF6B 4XWTA 1WWTA 1F2RI 2B76B 4XE0A 3BK1A 1E6EB 2I2YA 1IGDA 2V3NA 2J53A 1TS2A 4ARCA 1I4XA 1QQRA 3BVZA 1TS3A 3Q8FA 1DOYA 4JWUC 4HJGE 4RF1A 3P4SB 3SFDB 2J4XA 2WXFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GB1 A;  2LHD A;  4OZB A;  1MPE A;  2KN4 A;  3UI3 A;  2KWD A;  3MP9 A;  4KGT A;  2KAC A;  2QSD A;  4WH4 A;  1GB4 A;  2RPV A;  2ON8 A;  1XF5 L;  1XCQ L;  1QKZ A;  1FCL A;  1K51 A;  1IBX B;  2ZW0 A;  2N7J A;  1IBX A;  1PGB A;  1HZ6 A;  1F2R C;  1UWX A;  1K53 A;  2J52 A;  1XCT L;  4KGS A;  1Q10 A;  5BMH A;  2ONQ A;  2QMT A;  1C9F A;  5HFY A;  5JXV A;  2RMM A;  4OZA A;  2JZP A;  2JWU A;  1HZ5 A;  1MI0 A;  2N9L A;  1FD6 A;  4OZC A;  1MVK A;  1KH0 A;  1GB1 A;  2IGD A;  2ZW1 A;  1P7E A;  1D4B A;  2GI9 A;  3FIL B;  1FCC C;  3FIL A;  1EM7 A;  1K52 A;  1YNT E;  2I38 A;  2LUM A;  2OED A;  1YMH E;  1JML A;  5BMG A;  1PGX A;  2PLP A;  1P7F A;  2LHE A;  2JXT A;  2N9K A;  4KGR A;  2PW9 A;  4GLS C;  1K50 A;  2IGH A;  1MHX A;  2EEL A;  1ZXH A;  5BMI A;  2LGI A;  2GB1 A;  2JSV X;  2KDM A;  2JU6 X;  2KQ4 X;  5HHD G;  2IGG A;  2PTL A;  4IOI E;  1IGC A;  1HEZ E;  4IKG A;  2NMQ A;  1MHH E;  1F2R I;  2I2Y A;  1IGD A;  2J53 A;  3V3X A;  4D2K A;  4HKZ E;  1PGA A;  5HI1 A;  2K0P A;  4HJG E;  4MAC A;  5HG2 A; 
#chains in the Genus database with same CATH topology
 2N4F A;  4K1R B;  1R4M B;  4OZB A;  1M4V A;  4JLC A;  3TEZ A;  1OQQ A;  3NVV A;  4YL8 A;  2C9W B;  4HEA 1;  2R2O A;  3JVZ X;  1FNU A;  3QAQ A;  3S2A A;  1ACC A;  4I6P A;  4TQ0 A;  1QKZ A;  2G45 B;  3Q8A A;  3BY4 B;  2KTF A;  5J2R A;  4HCN B;  4HDO A;  1VLB A;  3UIP B;  3AE2 B;  2DYM A;  4B6W A;  2KQS A;  4HK2 A;  3ZNI D;  1YIW A;  4KIK B;  3AEE B;  2MBB B;  3WAL A;  3GE3 C;  2WDQ B;  3V05 A;  2FUG 1;  2XN9 C;  3WAN A;  1XLP A;  2IGD A;  1P7E A;  1YX5 B;  4MSM B;  3ZJU A;  2J7Q B;  2TSS A;  4JWS C;  1ZP0 B;  3OWE B;  2O6V D;  2E6X A;  3U7Z A;  3Q8C A;  1XEE A;  2JXT A;  5DPS A;  3UIN B;  1FXT B;  1KLV A;  4M8M A;  3ZDT A;  4C00 A;  4ARI A;  4ZDV A;  4FLH A;  2KLC A;  2V4I B;  3DBS A;  1WM2 A;  1E8W A;  4ICV A;  3B9J A;  2WXL A;  2AWT A;  3N1Y C;  2WXN A;  2BVC A;  2W3R A;  1FMA D;  2GRI A;  4LNI A;  1TY2 A;  1WJ6 A;  2M0X A;  2FID A;  3N1Z C;  2QJL A;  3X0W A;  3EC8 A;  4HKQ A;  2RR9 A;  2W55 A;  1SF0 A;  2N7D A;  3R8B A;  4HJK A;  3MP9 A;  4NNJ B;  4EOY A;  4DWF A;  5G55 A;  3KH0 A;  4ANU A;  2NBU A;  2JPH A;  2ZNV B;  2JZZ A;  2JZ3 B;  4EKU A;  1Y8R C;  3DWM A;  2MBQ A;  1NI3 A;  1E7V A;  4KZC A;  1WFY A;  1JCK B;  1WH3 A;  2O2V B;  4CHK A;  2RD0 A;  2BS3 B;  2B3A A;  3U4E G;  2O6V B;  4P16 A;  2MW5 A;  2KTR B;  5JXV A;  4HPP A;  2IY1 B;  1MFW A;  1I7H A;  1V1P A;  3IVF A;  3AE4 B;  2AQ2 B;  1L2N A;  3RNG C;  3ZRC A;  4LDT D;  2A4Z A;  1L6V A;  1RWS A;  3BII D;  1V9J A;  3IT6 B;  1AYF A;  1SB3 C;  3TEX A;  2LWP A;  2CJN A;  2KDF B;  2NTS A;  3LXF A;  4DHJ D;  4I6L B;  4A3O A;  1A70 A;  3P4R B;  2QIL A;  1FRR A;  1WXM A;  4IDI A;  4H2A A;  4KKI A;  1SJE D;  3U2S C;  2W82 A;  4MEM A;  3APF A;  3ZRF A;  1VZ8 A;  1E10 A;  2WXH A;  3L08 A;  1RM6 C;  2PW9 A;  3WAM A;  2IGH A;  1LM8 B;  1ZXH A;  4EUT A;  4YTN B;  1WXV A;  1E90 A;  1L0X B;  3W1S A;  2EMT A;  3DOW A;  4A3P A;  2GBK A;  3BIN A;  1C79 A;  2BT6 A;  2NMQ A;  3EHV A;  3L13 A;  1WR6 E;  5D94 A;  2GOW A;  2WGS A;  3SDL C;  1UNS A;  2MHJ A;  2HD5 B;  3DWG C;  4IM3 A;  3MHS D;  1VJK A;  4TQ1 A;  1F1H A;  3N20 C;  4E3C A;  4MT5 A;  3IT4 B;  5HG2 A;  2DYB A;  3NG0 A;  4NPN A;  1UGM A;  2LVP A;  4FJY A;  3KQ4 A;  1DOI A;  3W9C B;  1ZE3 D;  2KMM A;  4MGI E;  4KGT A;  4LDT B;  4PYZ A;  2C7H A;  2WXM A;  2V3S A;  4RCO A;  4I6N B;  4HCP B;  1XCQ L;  4ACF A;  1IBX B;  2E3T A;  1UF0 A;  2BKF A;  2WXI A;  1JWM D;  3ZJV A;  2IO3 B;  2LVO A;  4AJW A;  4URK A;  5DCN A;  4BKT A;  1GJZ A;  3ENE A;  3TJP A;  3AE8 B;  5D3D A;  2IO2 B;  3B08 A;  3MC9 A;  3NVZ A;  2JZP A;  4NJ7 A;  3VUX A;  3Q8B A;  1WIA A;  1IP9 A;  1RFA A;  2D2Q A;  4OZC A;  1J19 A;  2NBW B;  2Y5B B;  1T0R C;  2EKE C;  2LXA A;  3KW5 B;  2KWV B;  2N9X A;  2D3G A;  3AU4 A;  4C4V B;  3AED B;  1FNW A;  3M63 B;  1QOB A;  3VUY A;  4B0M A;  1XD3 B;  2QC8 A;  1YOV B;  1D3Z A;  3KUC B;  2YEP B;  1DOX A;  2CHX A;  3DVN V;  1C4C A;  4BBN C;  4E74 A;  4XC2 A;  3PRM B;  3WAO A;  3PV1 A;  3JSV A;  4BKS A;  3H7P B;  4KVG B;  3C8Y A;  5C2T B;  1Q1O A;  3OG5 A;  4US9 A;  4ASW C;  1YQ4 B;  1NEK B;  3RNF C;  1SJH D;  4A8X C;  1NYR A;  1B1Z A;  2V9H A;  5TSS A;  2KKC A;  3D32 A;  3PRZ A;  1C4A A;  4IG7 B;  4WJO A;  3Q69 A;  3R7Q A;  3GZN B;  3MFG A;  4MSQ B;  1R4M I;  2OJR A;  5AZH A;  3SFE B;  3H1U A;  1BXT A;  2JYT A;  4JQW C;  3U52 E;  3BVG A;  3M62 B;  2DAF A;  4A9A A;  3GE8 C;  1I4P A;  4DXA B;  1XO3 A;  4CYE A;  2KVR A;  3DBR I;  1RYJ A;  3A33 B;  1GUA B;  3HIZ A;  4JE3 B;  4RMA A;  3NVY A;  1ZDX A;  2REX A;  3DHG C;  3SU8 X;  3T8M A;  2BS2 B;  3PO0 A;  4WIP A;  3I9V 1;  4TSS A;  2Z0D B;  2KXJ A;  4ZRK A;  5CX3 A;  4YSY B;  4GN1 A;  1VCB A;  3NJT A;  3MC0 B;  4MJS B;  2WDT B;  1FEH A;  4K7W A;  3I63 C;  3OAW A;  2AQ1 B;  2UYZ B;  5IA7 A;  2I38 A;  1YMH E;  5BYR A;  5BYQ A;  1I42 A;  4DBG A;  4KDI C;  5FR3 A;  4W9G A;  2KC2 A;  4XX5 A;  4G11 A;  2KD0 A;  1XLN A;  4AJY B;  3R66 C;  1SSN A;  2JSV X;  2LFI A;  2NPT A;  4DXF A;  1AWD A;  3M95 A;  3AE6 B;  1WWT A;  4W9D A;  4TUU A;  1E6E B;  3A9K B;  1TS2 A;  4ARC A;  1V2Y A;  3RYT A;  3TBL D;  4JWU C;  2D3A A;  4M0W A;  1HTQ A;  3AEC B;  5IAA C;  1YN4 A;  2KJH B;  2BPS A;  2M4N A;  2LMC A;  3Q3M C;  1QZE A;  4IM2 A;  1R4N I;  4XWW A;  4FAD A;  3BWU D;  4KSK C;  3ZNZ B;  4N58 A;  4W9F A;  1ZGU B;  2IO1 B;  1V81 A;  2L52 A;  1J7B A;  2D07 B;  1WE7 A;  4YWG G;  2MJE A;  2HJ1 A;  2Q5W D;  2MJ3 A;  5G5H A;  5D7G A;  4EZK A;  3MC8 A;  3NS8 A;  2KX3 A;  2MLB A;  3I3T B;  2DZM A;  2MH7 A;  4JX1 C;  5E6O A;  1N6Z A;  3Q3F A;  4M00 A;  1PFD A;  1YQB A;  5DPR A;  2L1A A;  3TCA A;  3R3M A;  2PIA A;  2W9N A;  3ALB A;  2LGX A;  1E9M A;  1V1P B;  2KAN A;  2QDF A;  4GDL A;  1QOG A;  2LXC A;  1KJT A;  1VDV A;  2KMA A;  4B0E A;  3ZUN A;  2L0F A;  1EM7 A;  2Z59 B;  1FO4 A;  4M8N A;  3PRE A;  1ROE A;  3AI5 A;  3KVF B;  2KQ7 A;  3K9O B;  3ABV B;  1JML A;  4FBJ B;  2Y5C A;  3OJ4 B;  2GBJ A;  3QA8 A;  4GLS C;  1K50 A;  2EKI A;  3DQV A;  4FJZ A;  2HTH A;  2DNF A;  4BBN F;  2M8S A;  3CMM B;  1JRO A;  3W1S C;  4DK5 A;  1OEY A;  2XK5 A;  2BB5 A;  2JU6 X;  1I35 A;  4MH0 E;  1IGC A;  4GGQ A;  4REZ A;  1Q5W B;  5IN7 A;  3VAW A;  2EMS A;  1FPY A;  3HUI A;  2MCN B;  3V3X A;  4YSX B;  4CO7 A;  3VTU A;  2BWF A;  1WGK A;  4MAC A;  1LO5 D;  4HWI B;  3GB1 A;  4GIV A;  1STE A;  2OOB B;  3AN1 A;  1N60 A;  4FHJ A;  4LNF A;  2KFK A;  5CHV C;  1E7P B;  2M19 A;  2GBR A;  4NQL B;  4AWJ A;  2WHI A;  3TEY A;  1NI2 A;  3PGE A;  3ZYY X;  1WGY A;  2JY6 A;  3P4Q B;  4BKS D;  1D6E C;  3R7R A;  2JRI B;  4K81 A;  3VDZ A;  4KZ0 A;  4DHZ B;  2KAJ A;  1ET9 A;  3RD2 A;  2PVG C;  1K53 A;  2HDE A;  5FKA C;  5C23 A;  3HM6 X;  4BZA A;  2HJ8 A;  2ZPN A;  4PS8 A;  1C9F A;  1LQB A;  3L54 A;  4N59 A;  1YQ3 B;  3RZF A;  4WWM A;  1VR9 A;  2JWU A;  1E7U A;  3ZJT A;  1P9D U;  4WWO A;  3DVG Y;  2V1Y A;  4BVU C;  4WAF A;  1J8C A;  2KT7 A;  3ZTC A;  1CK1 A;  1DGJ A;  2J0M A;  4OVU A;  3NOB A;  1IPG A;  1GOZ A;  3GS2 A;  1J0G A;  3RI7 C;  1OFF A;  2G4D B;  1WRD B;  4ZOH C;  2CS4 A;  4KGR A;  1V5O A;  1LFD A;  1CQV A;  1F52 A;  1FXA A;  2OJW A;  2FAZ A;  4W9L A;  3JW0 X;  3PSE B;  1AN8 A;  3P4P B;  3RT3 B;  1YX6 B;  2QHO A;  3AMZ A;  1HE8 A;  2K0P A;  4ZHO A;  1WJ4 A;  3GOE A;  2AX5 A;  3N30 A;  4EE2 A;  1HXY D;  2K8B A;  2RDH A;  1L6U A;  1OQY A;  1SIJ A;  3IXS A;  4AQ7 A;  1OEY J;  1P0R A;  3AEB B;  4PT5 A;  5KHQ A;  1SXT A;  1EWY C;  5IO9 A;  5I4D A;  2MA9 B;  1ZUD 2;  4P6V F;  1JWU D;  2K6Q A;  4ZYS A;  1WX9 A;  2CU3 A;  1BUI C;  2JQR B;  3EA6 A;  2JX5 A;  1S1Q B;  2PE6 B;  3A9J A;  4HRS A;  1MG4 A;  1SEB D;  4NAW B;  4MM3 B;  1WR1 A;  4FN2 A;  1YD8 U;  1KH0 A;  3SD5 A;  4WWN A;  1FM0 D;  4XDD A;  5AZF A;  4F8C B;  2ACZ B;  1TS4 A;  2IO0 B;  3MJW A;  1YJI A;  5G5G A;  1CZP A;  2NS5 A;  4GSW A;  1PQS A;  5J17 A;  2WWZ A;  1QOA A;  3DBH B;  1F0Z A;  1KLU D;  3KWV A;  2C7N B;  2KNB A;  3RNE C;  1MJD A;  4IC7 B;  3E56 A;  4A90 A;  4C7Z A;  4IKG A;  2WXP A;  2WX0 A;  2KJ6 A;  2A5U A;  1TJE A;  3DBL I;  3DHI C;  5JZE B;  1F77 A;  2JRH A;  4M0W B;  3W1Y A;  3QCA A;  4WUR A;  1FFU A;  5H92 C;  2KAC A;  4BFR A;  3EUB 2;  4W9J A;  2FCQ A;  4CQN A;  2X8X X;  3C0R B;  3DDC B;  2BBC A;  2MBH A;  1HA5 A;  4GDK B;  4E71 A;  2ZCC A;  1WYG A;  4K3C A;  2RDG A;  2WXK A;  5AEK B;  4XDC A;  5BMH A;  4MGK E;  2KOX A;  1WE6 A;  2D10 A;  3FAH A;  4XYC A;  2AL6 A;  3P42 A;  3V61 A;  4JIO U;  1P1A A;  4DHJ B;  3QJZ A;  3DVN U;  3P2B A;  2RGF A;  1L0Y B;  1FD6 A;  3ETR A;  3IBE A;  1F9J A;  3NZU A;  3VH3 B;  2ZW1 A;  4L2Y A;  3JYU A;  1KFY B;  2L0T A;  4K3B A;  3U30 A;  3V6E B;  1FCC C;  1PDX A;  2C7M B;  4G0N B;  2XBB C;  1U4A A;  2JWZ A;  4ZYN A;  2LUM A;  3L16 A;  3P63 A;  2BYV E;  5L83 A;  4A6Q A;  2KWC A;  2KWU B;  1ENF A;  2MP2 A;  1TZO A;  2Z8L A;  1V86 A;  4DDG D;  2UWQ A;  1NYQ A;  2DZI A;  2KDM A;  3DHH C;  1WJN A;  2INC C;  1KF6 B;  1F2R I;  2B76 B;  1IGD A;  2V3N A;  4LNN A;  1QQR A;  3BVZ A;  2NCN A;  4PS3 A;  3Q8F A;  2IBI B;  3P4S B;  2AQ3 B;  2I1J A;  3O13 A;  2N9P C;  4EEW A;  4J3O D;  4ICU A;  2KFK B;  2KWD A;  1JWS D;  3PHW B;  3RFZ B;  4B9K A;  2M0A A;  3CSF A;  1C77 A;  3QQ8 B;  3DVG X;  2MBO A;  1FCL A;  4P1C C;  1V6E A;  3AU5 A;  1H4R A;  1JQ4 A;  4OVV A;  2LRW A;  3I5J C;  1XQQ A;  1XCT L;  1WYW B;  2KO3 A;  4RNA A;  4AUQ C;  3Q8E A;  5E6N A;  3ZVV A;  2KDI A;  3NY5 A;  2BQQ A;  2KFJ A;  3N3K B;  4C56 C;  2LZ6 A;  3W2D A;  1HTO A;  1WM3 A;  1ZXI A;  3PLU A;  1AAR A;  2BB6 A;  2DYO A;  2K5P A;  3BVM A;  1VZ7 A;  3K9P B;  4HRO A;  2ZCB A;  3T3O A;  2L32 A;  2DX5 B;  1P98 A;  2GLS A;  2WXG A;  3TUO A;  3U7D A;  4W9I A;  2MSE D;  3SEB A;  4ZRI A;  3TSS A;  1SE2 A;  2W54 A;  1YN3 A;  2LVQ A;  1KLG D;  2FCS A;  2FE8 A;  2XNA C;  3ECI A;  1GPX A;  4UDU C;  2KZR A;  2C60 A;  2RDB C;  2LGI A;  4DXG A;  2PJH A;  3BYY B;  2G1E A;  3HM3 A;  5HHD G;  2BKR B;  2JXX A;  1AW7 A;  4TMA B;  4Q2J A;  4LNO A;  1SE4 A;  1N61 A;  1GC6 A;  1UBI A;  2G9H D;  3NUH B;  1M94 A;  1NDD A;  2K25 A;  3V6C B;  3Q2A C;  4IWO A;  4RGO S;  3PTF C;  1CJE A;  4RF0 A;  2LAS A;  5D2M B;  1OGW A;  1ET6 A;  1T5X D;  1YJ1 A;  5DPT A;  1I4G A;  3I57 A;  1S3S G;  1V80 A;  1XF5 L;  1H8C A;  3AH7 A;  2AEH A;  1E0Z A;  1NBF C;  3VH4 B;  3LB8 C;  5EE1 A;  4MGZ E;  1PGB A;  2GBM A;  1QLB B;  2J0K A;  2YVC A;  2CHW A;  2FIF A;  4WWP A;  1UGJ A;  1FIQ A;  2CR5 A;  4L23 A;  1EU3 A;  2QMT A;  4FXC A;  3A9J B;  5HFY A;  5D6J B;  4A55 A;  4ANW A;  5EE0 A;  1FNV A;  4LLG M;  5JH5 C;  5LXH A;  2N9L A;  3ZTD A;  1D5M C;  3WA0 A;  1TKY A;  4FHK A;  4W9E A;  5LNK 1;  1KTK A;  2KMC A;  2WX1 A;  2V0G A;  4C7Y A;  4QAY A;  2BYT A;  3FIL A;  5AZG A;  2C5L C;  1J7C A;  2WU2 B;  2GBN A;  1R7S A;  1P3Q U;  1PGX A;  5EE3 A;  4ZRJ A;  1T3Q A;  3B0A A;  3LJ3 A;  3VXW A;  3ZGZ A;  3QIJ A;  3TEW A;  5DPW A;  2Y5P A;  4IOI E;  1HEZ E;  1KRH A;  3H9D A;  4D2K A;  3ZNG C;  1VZ6 A;  3VTV A;  3NZ3 A;  3M3J A;  1YJJ A;  1KOT A;  4FUL A;  5KHO A;  1I4Q A;  2KN4 A;  3U8Z A;  3UI3 A;  4KDL B;  4DQO C;  3QX1 A;  1XLQ A;  2JT4 B;  2VRR B;  2HTM E;  3ML8 A;  1ZKH A;  1PYW D;  4F1S A;  2ZVN A;  4C80 A;  2QSD A;  1EWC A;  2RPV A;  2XEW A;  2PPH A;  4LTU A;  3R2T A;  2MQJ A;  4OHJ A;  1T6B X;  5AUK A;  3P1M A;  3RNC C;  2WP9 B;  1WI0 A;  1F2R C;  1SGH A;  2L05 A;  3B1L X;  2J52 A;  3Q3O C;  3PS6 A;  2K3U A;  4RM9 A;  5G2N A;  4GU2 A;  2ZEQ A;  3PZ7 A;  2WYQ A;  2QEJ C;  5H8Y E;  1NEN B;  2BYF A;  1GNU A;  4X57 B;  4RFB A;  2PKO A;  2N1V A;  1UBQ A;  2KLG A;  2DLB A;  3AE3 B;  3QC8 B;  2DBY A;  4ZRP A;  3NRZ A;  4YXD B;  3WAP A;  1SBB B;  2DHZ A;  3J9C A;  4S17 A;  3VVW B;  3PHX B;  4DHZ E;  4N9F 4;  1YNT E;  2J42 A;  3PZD A;  5MPO A;  1FRD A;  3AEA B;  2IND C;  1UWM A;  4ZHP A;  4IM0 A;  2MP2 B;  3FKY A;  1T0Y A;  1UUP A;  4YTM B;  3VUW A;  3TIX A;  2D3B A;  3QHT A;  4KSL C;  2EEL A;  3UQA A;  1E8Z A;  5CTR C;  1HQR D;  3C19 A;  1WXA A;  3V62 A;  2DZK A;  3BK2 A;  3BZD B;  2SAK A;  3ZXV A;  4B95 A;  3IHP C;  1EF1 A;  4IW0 A;  5BYS A;  1FXI A;  2JF5 A;  1DYQ A;  1MG8 A;  1OQR A;  1PGA A;  3APC A;  4G3X B;  1BML C;  1RLF A;  3DBR B;  3AM9 A;  5J18 A;  3HVZ A;  1MPE A;  1VD2 A;  2K8H A;  1TTN A;  2OHF A;  5IKC M;  2LGD A;  2CU1 A;  1QT9 A;  5C3J B;  3KYC D;  3HHM A;  3JSV B;  3ZO5 B;  1Y56 A;  1GB4 A;  4G50 A;  3V60 A;  2AYO B;  3NZS A;  5JHB A;  2WQY B;  3AE5 B;  3OLM D;  2ZW0 A;  1N63 A;  3ZLZ A;  1B9R A;  2KDE B;  3A1Q A;  1RAX A;  3UIO B;  4MJS A;  1N62 A;  4MDK E;  5EE9 A;  4EFO A;  3HRD D;  1IYF A;  5TR5 A;  3GZN I;  3FC4 A;  2RMM A;  1WF9 A;  1TIF A;  2LD9 A;  2MJD A;  4YT0 B;  5E6J A;  2PE9 A;  3ZIM A;  4IWQ A;  3EFC A;  3VR8 B;  2MBE A;  4N6E B;  4TKN A;  5IP4 D;  2DAJ A;  2VZK D;  1VRA B;  2PMV A;  1GB1 A;  3RZW C;  1D4B A;  2X38 A;  2FUH B;  2BGF A;  1OTR B;  3VRB B;  3L17 A;  2KJR A;  4S0R A;  4WAA A;  3A9K A;  4J6I A;  4FJV B;  4HPL B;  2PLP A;  1L4D B;  5CHF A;  2WXR A;  3PVL A;  5C1Z A;  3A4R A;  1WJU A;  5BMI A;  1R4N B;  2KN5 A;  1EU4 A;  3MHZ A;  2KQ4 X;  2VH1 A;  1L5P A;  2ZNV C;  4XWT A;  2I2Y A;  3BK1 A;  3H6N A;  1ISN A;  3PT2 B;  5L95 C;  1TS3 A;  1DOY A;  3GP7 A;  1UZX B;  2KC1 A;  2PEA A;  4R3D A;  5LLI A;  2NPT B;  4MH8 A;  5IOI A;  4WH4 A;  1TT5 B;  1QOF A;  1UH6 A;  2IPK D;  2VZK B;  4AOF A;  1L0V B;  2NTT A;  2HE7 A;  2QCZ A;  1HZ6 A;  3AE1 B;  3AB5 A;  1XT9 B;  3UF8 A;  1L4Z B;  3W5U B;  1WXQ A;  2N0S B;  4KGS A;  4TV3 A;  4AS1 A;  4IUM B;  2ONQ A;  3DCG A;  3KUD B;  4GXB A;  4US8 A;  5EDS A;  2KHW B;  3KYD D;  4AP4 C;  4WQO B;  3ZXR A;  2R2Q A;  4BOS C;  1HZ5 A;  1MI0 A;  2J0J A;  3VHT C;  1MVK A;  2FNJ B;  3AUL A;  2IYD B;  2VH2 A;  4NJ6 A;  3FIL B;  3RUI B;  4BAX A;  1Z2M A;  4YTP B;  1WMH A;  2M1M A;  3R2I A;  3Q3J A;  4FA6 A;  4GDL B;  4BOZ B;  3RNB C;  5T8I A;  3SHQ A;  2K8C A;  4M01 A;  4WJP A;  2DZJ A;  2BYE A;  1LXD A;  1N5W A;  1EF5 A;  2L3Z A;  2CKH B;  4ITK A;  2KK8 A;  4OW0 A;  3T3N A;  1WSP A;  2BS4 B;  4L1B A;  4EZJ A;  4BKG A;  4LNK A;  2KYW A;  1J7A A;  4LCD E;  3AE7 B;  1GG3 A;  1I4H A;  2V4L A;  2IDY A;  1V49 A;  2BW2 A;  1V97 A;  2G4S A;  1E8X A;  1TBE A;  1LGR A;  2INN E;  2XK5 B;  1WGD A;  3B2G A;  2LGY A;  1EUV B;  3OJ3 A;  4HLE A;  4LJP B;  3VFK A;  3ZKJ C;  1K51 A;  4RH6 A;  1TYG B;  2N7J A;  2SEB D;  4XZ4 A;  3VR9 B;  1A5R A;  2INP E;  4XGA B;  2IZV B;  3HVD A;  4ZRQ A;  1WZ3 A;  1T0S C;  4MEL A;  2DEN B;  3X23 A;  1GC7 A;  4EZL A;  2N7E A;  1SE9 A;  2YLM A;  3RPF C;  1Z5S B;  2H89 B;  4KIK A;  2L00 B;  3H7S A;  2BF8 B;  2QIE B;  2CHZ A;  1Q0W B;  3RN9 C;  2MWS B;  4DDI D;  1WGG A;  1YN5 A;  3W5V B;  3WIM A;  4RM8 A;  4JL9 A;  4MGY E;  3N9Y C;  1K52 A;  2JUO A;  4GB9 A;  2G3Q B;  2L83 A;  3AEG B;  2OED A;  1KM7 A;  2K1F A;  2M17 A;  5BMG A;  4ANX A;  2D11 A;  4NZL B;  3UGB B;  2MX2 A;  1P7F A;  1JRP A;  2LHE A;  2N9K A;  1N5X A;  2LJ5 A;  2LI5 A;  1TZ1 A;  1MHX A;  3ZNH B;  1JRU A;  1V5T A;  2WLB A;  3E9S A;  3RNA C;  2LEK A;  2KVZ A;  4F7Z A;  2ZZP B;  2N1W A;  2NR2 A;  2PTL A;  3NS1 A;  2K6D B;  2LRU A;  1MHH E;  2DWQ A;  2NBV B;  4HVB A;  3EGR A;  1V8C A;  4LK0 M;  3DPD A;  1WX7 A;  5HI1 A;  3VQI A;  1WY8 A;  2LGS A;  1WX8 A;  1RRB A;  2JVC A;  4WJN A;  3IAM 1;  3IAS 1;  1NVI D;  3QWZ B;  4II2 B;  3HK0 A;  1UEL A;  1TS5 A;  1RFK A;  1CMX B;  1XLO A;  3MTN B;  2ASQ A;  5BO4 B;  3ZW3 A;  4NAW A;  1C4P A;  2D5G A;  3PRP B;  4MM3 A;  4K7U A;  1D5Z C;  2CJO A;  4GOC A;  2ZVO A;  2WXQ A;  4P1B C;  3B2F A;  1TY0 A;  3A1Q B;  3Q3N C;  2BTE A;  1IUE A;  5GMV A;  4PS7 A;  1JWA D;  2O2V A;  1C1Y B;  1ZW7 A;  3Q14 C;  4GMV A;  5HKH A;  4RGT A;  3AXC A;  2FBW B;  4JPS A;  4PYU A;  2O6V A;  1JAL A;  5FK9 C;  1BT0 A;  3ONS A;  3IFW B;  2KTR A;  3VTW A;  5D3I B;  1GAQ B;  4OZA A;  1JW9 D;  2AL3 A;  5CHW A;  3CF6 E;  2D3C A;  3EEC A;  4RGM A;  3APD A;  2IY0 B;  3AE9 B;  1EO6 A;  4KX6 B;  2UU7 A;  2L76 A;  1QIL A;  1PUT A;  4NY0 A;  3TMP B;  3KWL A;  1ZPS A;  2V3P A;  2Y3A A;  3L4P A;  1C78 A;  3DBL B;  3AEF B;  4USA A;  1C3T A;  4W9K A;  1V1O A;  2NVU I;  2RPQ A;  1WZ0 A;  3PZ8 A;  3H8H A;  1ZOY B;  2M56 B;  2MEK A;  3N32 A;  3L0W B;  1TKE A;  2GMI C;  3NHE B;  4JGH B;  1C76 A;  2GB1 A;  1X1M A;  2PVO D;  2RSU A;  3WCQ A;  4NAM A;  1WGR A;  1SIF A;  3L10 B;  4W9H A;  3N1X C;  3PPA A;  4HKZ E;  3AV8 A;  4WQM A;  3UQB A;  1QF6 A;  1G6J A;  2H88 B;  1D5X C;  4K7S A;  4KKJ A;  3ZDM C;  2WXF A;  2R61 A;  4NQK E;  2LHD A;  2WDR B;  4GDK A;  4HXD A;  3T9L A;  2W3S A;  3DBH I;  4LJO B;  3URY A;  3LDZ E;  2WU5 B;  4NJC A;  3IG3 A;  1I4R A;  1WXS A;  3MJ5 A;  3SR6 A;  5AUI A;  2WXO A;  4O1N A;  4PK1 A;  2ON8 A;  5LXI B;  2L7R A;  3CWI A;  1ESF A;  1IBX A;  3Q6B A;  3BYT B;  1UWX A;  3KUZ A;  2KDB A;  2WDV B;  3RMK C;  4YSZ B;  1K8R B;  1E5W A;  2WXJ A;  1Q10 A;  1T0Q C;  4A20 A;  1FFV A;  1UD7 A;  2YEP F;  4HDQ A;  2MRP A;  2IJ0 A;  1TGZ B;  4M02 A;  4WJQ A;  5FR6 A;  1TKG A;  5GXG B;  2LJI A;  3PLV A;  3ZQ4 A;  1JWB D;  1E8Y A;  4W9C A;  3LYY A;  1WGH A;  3CIR B;  3KLS X;  2ZJD A;  2GI9 A;  1XXG A;  2K39 A;  4OVZ A;  2N9E B;  3O65 B;  3ML9 A;  1WRI A;  4C4V A;  3QAR A;  2FCN A;  2K9X A;  3RCZ A;  1WMH B;  2ZPY A;  3VRA B;  3NVW A;  4HPM B;  4RGN A;  2WS3 B;  3TL5 A;  3CST A;  2ICI A;  2WNM A;  3RUL A;  2LUE A;  1ZDV A;  2K22 A;  2Z0E B;  2BWE S;  1SE3 A;  2FCM A;  5JHA A;  1L7Y A;  2JYE A;  2L8J A;  3EFU A;  4IWP A;  2IGG A;  3H7P A;  2KX0 A;  4XE0 A;  4ANV A;  2J53 A;  4KV2 A;  1I4X A;  3A4S C;  4P7I A;  2I1K A;  4HJG E;  4RF1 A;  5E6P A;  3SFD B;  2J4X A;  4II3 B;  3QK0 A; 
#chains in the Genus database with same CATH homology
 3O13 A;  4M0W A;  4OZB A;  3AEC B;  1YN4 A;  4R3D A;  4J3O D;  1M4V A;  3TEZ A;  1OQQ A;  2LMC A;  3NVV A;  2KWD A;  1JWS D;  4MH8 A;  3RFZ B;  4XWW A;  2M0A A;  3BWU D;  4N58 A;  4WH4 A;  4HEA 1;  1QOF A;  1C77 A;  2VZK B;  1FNU A;  2IPK D;  1J7B A;  2L52 A;  1ACC A;  4TQ0 A;  1QKZ A;  1FCL A;  1L0V B;  4YWG G;  2MJE A;  3Q8A A;  2Q5W D;  2NTT A;  2MJ3 A;  5G5H A;  5D7G A;  1HZ6 A;  3AE1 B;  3AB5 A;  1JQ4 A;  2MH7 A;  4JX1 C;  1L4Z B;  3W5U B;  1PFD A;  1XCT L;  1WXQ A;  2N0S B;  1VLB A;  4KGS A;  2L1A A;  3AE2 B;  2DYM A;  4AS1 A;  2ONQ A;  4RNA A;  4US8 A;  2PIA A;  3Q8E A;  1E9M A;  1V1P B;  3AEE B;  2WDQ B;  1HZ5 A;  1MI0 A;  1QOG A;  3V05 A;  2FUG 1;  2XN9 C;  4C56 C;  3W2D A;  1MVK A;  1ZXI A;  1VDV A;  1XLP A;  2BB6 A;  2DYO A;  2IGD A;  2K5P A;  3BVM A;  1P7E A;  1VZ7 A;  4B0E A;  4HRO A;  3FIL B;  3T3O A;  3ZJU A;  1EM7 A;  2L32 A;  1FO4 A;  2TSS A;  4JWS C;  1ROE A;  1ZP0 B;  2WXG A;  3TUO A;  3OWE B;  4YTP B;  3ABV B;  1JML A;  3SEB A;  2Y5C A;  3R2I A;  3TSS A;  1SE2 A;  2W54 A;  1YN3 A;  2E6X A;  1KLG D;  3U7Z A;  4GDL B;  3Q8C A;  1XEE A;  2JXT A;  2FE8 A;  2XNA C;  1GPX A;  4UDU C;  4GLS C;  1K50 A;  2EKI A;  5T8I A;  4ARI A;  1JRO A;  2LGI A;  2V4I B;  4DXG A;  3B9J A;  1N5W A;  3BYY B;  2BB5 A;  2JU6 X;  3GP7 A;  2G1E A;  5HHD G;  2WXL A;  1IGC A;  2WXN A;  4ITK A;  4REZ A;  2W3R A;  3HUI A;  4OW0 A;  1FMA D;  1WSP A;  3T3N A;  2GRI A;  2BS4 B;  1AW7 A;  4L1B A;  1TY2 A;  4Q2J A;  4TMA B;  3V3X A;  4YSX B;  1J7A A;  1SE4 A;  1N61 A;  3AE7 B;  1WGK A;  1I4H A;  4MAC A;  2G9H D;  1LO5 D;  2IDY A;  3GB1 A;  3NUH B;  2BW2 A;  1V97 A;  2QJL A;  1STE A;  4HKQ A;  3AN1 A;  4RGO S;  1N60 A;  2W55 A;  2INN E;  1CJE A;  1SF0 A;  4RF0 A;  3R8B A;  1E7P B;  2M19 A;  3MP9 A;  1ET6 A;  1T5X D;  3B2G A;  3TEY A;  1I4G A;  3I57 A;  3ZYY X;  1XF5 L;  3P4Q B;  3AH7 A;  1E0Z A;  1D6E C;  1K51 A;  4RH6 A;  1TYG B;  3LB8 C;  2N7J A;  2SEB D;  5EE1 A;  3VR9 B;  3DWM A;  1NI3 A;  2INP E;  1JCK B;  2KAJ A;  1ET9 A;  1PGB A;  1QLB B;  2PVG C;  1K53 A;  2HDE A;  5FKA C;  1UGJ A;  3HVD A;  1FIQ A;  4ZRQ A;  2BS3 B;  3U4E G;  4L23 A;  1EU3 A;  2QMT A;  4FXC A;  4P16 A;  1C9F A;  5HFY A;  5JXV A;  1I7H A;  3RPF C;  2H89 B;  4N59 A;  4A55 A;  1V1P A;  1YQ3 B;  5EE0 A;  3AE4 B;  4WWM A;  1VR9 A;  2AQ2 B;  1FNV A;  2JWU A;  4LLG M;  2N9L A;  1L6V A;  3ZJT A;  1RWS A;  2QIE B;  3BII D;  1D5M C;  3IT6 B;  1AYF A;  1SB3 C;  1TKY A;  5LNK 1;  3TEX A;  1KTK A;  2CJN A;  2NTS A;  3LXF A;  4WAF A;  1YN5 A;  2V0G A;  3W5V B;  1CK1 A;  4C7Y A;  1DGJ A;  2BYT A;  3FIL A;  1A70 A;  3P4R B;  2QIL A;  3N9Y C;  1K52 A;  1FRR A;  4IDI A;  1GOZ A;  3GS2 A;  4H2A A;  4KKI A;  2L83 A;  1J7C A;  2WU2 B;  3AEG B;  2OED A;  1R7S A;  1SJE D;  5BMG A;  1PGX A;  3U2S C;  4NZL B;  2W82 A;  1OFF A;  1P7F A;  5EE3 A;  1JRP A;  1VZ8 A;  2LHE A;  2N9K A;  2WXH A;  4ZOH C;  1E10 A;  1RM6 C;  1N5X A;  1T3Q A;  4KGR A;  2PW9 A;  2IGH A;  1MHX A;  1ZXH A;  3ZGZ A;  1CQV A;  4YTN B;  1FXA A;  2WLB A;  3E9S A;  3TEW A;  1L0X B;  2LEK A;  3W1S A;  2Y5P A;  2PTL A;  3NS1 A;  4IOI E;  1C79 A;  1AN8 A;  1HEZ E;  2BT6 A;  3P4P B;  2NMQ A;  1MHH E;  2DWQ A;  1KRH A;  3EGR A;  1V8C A;  1UNS A;  4D2K A;  4LK0 M;  1VZ6 A;  5HI1 A;  3DWG C;  3AMZ A;  3VQI A;  1VJK A;  2K0P A;  4TQ1 A;  4ZHO A;  3NZ3 A;  4MT5 A;  3IT4 B;  1YJJ A;  5HG2 A;  2AX5 A;  4EE2 A;  3IAM 1;  1I4Q A;  3IAS 1;  1HXY D;  2KN4 A;  2RDH A;  1NVI D;  3UI3 A;  4DQO C;  3KQ4 A;  1DOI A;  1L6U A;  3W9C B;  1XLQ A;  1SIJ A;  3IXS A;  2HTM E;  4AQ7 A;  1TS5 A;  1ZE3 D;  1RFK A;  2KMM A;  4PT5 A;  3AEB B;  4KGT A;  1PYW D;  2WXM A;  1XLO A;  4C80 A;  2QSD A;  1EWC A;  2RPV A;  4RCO A;  4LTU A;  1XCQ L;  3R2T A;  1SXT A;  2AQ3 B;  4OHJ A;  1T6B X;  5AUK A;  1C4P A;  1EWY C;  2D5G A;  3P1M A;  5I4D A;  1D5Z C;  2WP9 B;  2E3T A;  1IBX B;  1ZUD 2;  2CJO A;  2WXI A;  2WXQ A;  1JWM D;  3B2F A;  1TY0 A;  3ZJV A;  2BTE A;  4P6V F;  1IUE A;  1JWU D;  1F2R C;  1JWA D;  2J52 A;  4ZYS A;  2CU3 A;  1BUI C;  4RGT A;  2K3U A;  2FBW B;  2JQR B;  3EA6 A;  4JPS A;  2JX5 A;  1JAL A;  3AE8 B;  5D3D A;  5FK9 C;  3PZ7 A;  4HRS A;  5D3I B;  1GAQ B;  4OZA A;  1JW9 D;  2QEJ C;  5H8Y E;  3NVZ A;  1SEB D;  1NEN B;  2JZP A;  3Q8B A;  4NAW B;  4RGM A;  4MM3 B;  4RFB A;  3AE9 B;  2PKO A;  4OZC A;  1KH0 A;  4KX6 B;  2DLB A;  3AE3 B;  1FM0 D;  4XDD A;  2ACZ B;  2DBY A;  1QIL A;  1TS4 A;  4ZRP A;  1PUT A;  3NRZ A;  4YXD B;  1YJI A;  1SBB B;  3J9C A;  3KWL A;  1ZPS A;  3AED B;  2V3P A;  2Y3A A;  3L4P A;  5G5G A;  1FNW A;  1C78 A;  1YNT E;  2J42 A;  3AEF B;  5MPO A;  1QOB A;  1CZP A;  4USA A;  1FRD A;  3AEA B;  4B0M A;  1UWM A;  4ZHP A;  2YEP B;  1V1O A;  1DOX A;  1QOA A;  3PZ8 A;  3H8H A;  1UUP A;  1ZOY B;  4YTM B;  1C4C A;  1F0Z A;  2M56 B;  2MEK A;  1TKE A;  1KLU D;  2EEL A;  3KWV A;  1C76 A;  2GB1 A;  1HQR D;  2PVO D;  3BK2 A;  3BZD B;  3E56 A;  3WCQ A;  2SAK A;  4A90 A;  4NAM A;  4C7Z A;  4IKG A;  5C2T B;  3C8Y A;  2WXP A;  4US9 A;  5BYS A;  1YQ4 B;  1FXI A;  4HKZ E;  3AV8 A;  1DYQ A;  1PGA A;  1NEK B;  1OQR A;  1TJE A;  4WQM A;  1QF6 A;  2H88 B;  1BML C;  1D5X C;  4KKJ A;  1F77 A;  1SJH D;  4A8X C;  2R61 A;  1NYR A;  3AM9 A;  1B1Z A;  2LHD A;  5TSS A;  2WDR B;  4WUR A;  3HVZ A;  1MPE A;  1C4A A;  2W3S A;  3Q69 A;  3URY A;  2OHF A;  3MFG A;  3SFE B;  2WU5 B;  4NJC A;  1BXT A;  1QT9 A;  1FFU A;  5C3J B;  1I4R A;  3MJ5 A;  5H92 C;  2KAC A;  5AUI A;  2JYT A;  3SR6 A;  3U52 E;  2WXO A;  1Y56 A;  4O1N A;  3EUB 2;  1GB4 A;  2ON8 A;  4CQN A;  3BVG A;  4A9A A;  1I4P A;  2WQY B;  1XO3 A;  3AE5 B;  3CWI A;  1ESF A;  2ZW0 A;  1N63 A;  1IBX A;  2BBC A;  1B9R A;  1HA5 A;  3BYT B;  4GDK B;  1UWX A;  2WDV B;  1N62 A;  4YSZ B;  1WYG A;  1RYJ A;  5EE9 A;  2RDG A;  2WXK A;  4JE3 B;  4XDC A;  2WXJ A;  1Q10 A;  5BMH A;  3HRD D;  1FFV A;  3NVY A;  1ZDX A;  3FAH A;  3FC4 A;  2RMM A;  4YT0 B;  2MJD A;  5E6J A;  2YEP F;  3P42 A;  2BS2 B;  3PO0 A;  3VR8 B;  2IJ0 A;  4WIP A;  4N6E B;  1TKG A;  5GXG B;  3I9V 1;  4TSS A;  1FD6 A;  1L0Y B;  2LJI A;  3ZQ4 A;  3ETR A;  2VZK D;  1VRA B;  1JWB D;  2PMV A;  4YSY B;  1GB1 A;  2ZW1 A;  4L2Y A;  3LYY A;  3CIR B;  3KLS X;  1KFY B;  3MC0 B;  1D4B A;  1FEH A;  2X38 A;  2GI9 A;  1XXG A;  1FCC C;  4OVZ A;  1PDX A;  3VRB B;  1WRI A;  2AQ1 B;  2I38 A;  2K9X A;  2LUM A;  3P63 A;  1YMH E;  5BYR A;  4A6Q A;  5BYQ A;  3VRA B;  1ENF A;  2PLP A;  3NVW A;  1L4D B;  4RGN A;  2WS3 B;  1TZO A;  5FR3 A;  2Z8L A;  2WXR A;  2ICI A;  2WNM A;  1XLN A;  5BMI A;  1ZDV A;  1NYQ A;  1EU4 A;  2K22 A;  1SSN A;  2JSV X;  2KDM A;  1SE3 A;  3MHZ A;  2JYE A;  2LFI A;  4DXF A;  1AWD A;  2KQ4 X;  1L5P A;  3AE6 B;  2IGG A;  1KF6 B;  4XWT A;  1WWT A;  1F2R I;  2B76 B;  4XE0 A;  3BK1 A;  1E6E B;  2I2Y A;  1IGD A;  2V3N A;  2J53 A;  1TS2 A;  4ARC A;  1I4X A;  1QQR A;  3BVZ A;  1TS3 A;  3Q8F A;  1DOY A;  4JWU C;  4HJG E;  4RF1 A;  3P4S B;  3SFD B;  2J4X A;  2WXF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...