2XN9C

Crystal structure of the ternary complex between human t cell receptor, staphylococcal enterotoxin h and human major histocompatibility complex class ii
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
215
structure length
215
Chain Sequence
EDLHDKSELTDLALANAYGQYNHPFIKENIKSDEISGEKDLIFRNQGDSGNDLRVKFATADLAQKFKNKNVDIYGASFYYKCEKISENISECLYGGTTLNSEKLAQERVIGANVWVDGIQKETELIRTNKKNVTLQELDIKIRKILSDKYKIYYKDSEISKGLIEFDMKTPRDYSFDIYDLKGENDYEIDKIYEDNKTLKSDDISHIDVNLYTKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of Superantigen Complexed with Tcr and Mhc Reveals Novel Insights Into Superantigenic T Cell Activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords T CELL RECEPTOR ALPHA CHAIN C REGION
total genus 70
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2010-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
C PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2xn9C02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2xn9C01
1AN8A 1I4GA 4RCOA 5I4DA 1RF2D 4ZYSA 1UUPA 2R61A 1S5DD 1EWCA 2Z8LA 3BYTB 4UDUC 4Z9CB 1SEBD 1AW7A 1YN4A 1B44D 1L0YB 1SE2A 4RGOS 1ET9A 3BVMA 2QILA 1EEFD 1PRTB 2XN9C 1L0XB 1PRTF 3R2TA 1LT3D 1LTGD 3R2IA 3DWQA 1JWSD 1S5CD 1PYWD 3OWEB 1D5XC 4DXFA 3URYA 1B1ZA 3EFXD 1PTOC 1QILA 1S5BD 2SEBD 5D3IB 5ELFA 1CHPD 1TS5A 1CT1D 1LT6D 1UNSA 1CHQD 4RFBA 4RH6A 1BXTA 1KLGD 3EA6A 1HQRD 1DYQA 1I4XA 4L63B 4DXGA 1PTOD 2RDGA 4OHJA 5ELCA 1ET6A 2J4XA 5ELEA 1F77A 1EU4A 1LTSD 1HA5A 1TY2A 3V05A 2XNAC 1FNWA 1TS3A 1BCPD 5FK9C 1YN5A 1KTKA 4BWGB 1JR0D 1KLUD 3O13A 1JCKB 4RHSA 1STEA 1EEID 1BCPF 1BCPB 1HTLD 1FNUA 1I4HA 1RCVD 3DWPA 1ENFA 3TSSA 1PTOF 1GOZA 3BZDB 1SJED 1D5ZC 1HXYD 4C56C 3BVGA 1V1PB 2AQ2B 1SE4A 1FD7D 1BCPC 1MD2D 1T5XD 2NTTA 4RHRA 1LTID 3DWAA 1LTBD 1V1PA 1LT4D 1S5ED 4RGNA 4RGTA 2AQ3B 2G9HD 1XXGA 2QEJC 2AQ1B 2WV6D 3KLSX 1XTCD 2XRSD 3W2DA 5ELBA 1PRTD 1D5MC 1FGBD 1RDPD 3R8BA 2O2LD 4TSSA 1PZID 1LTTD 3CHBD 5TSSA 2IJ0A 1SXTA 2ICIA 1LTAD 1PRTC 1EU3A 1JQYD 4RGMA 1I4RA 1JWUD 1DJRD 1LO5D 1SJHD 3BVZA 4O1NA 1G8ZD 1ESFA 3MFGA 1CK1A 1PZJD 1D6EC 2CHBD 1EFID 4L6TB 4NZLB 1PTOB 1LLRD 4K6LA 3GP7A 1TS4A 1LTRD 1RD9D 1CQVA 1M4VA 5FKAC 2IPKD 2NTSA 5ELDA 1I4PA 5D3DA 3MC0B 1V1OA 3BYYB 3SEBA 1TY0A 1PZKD 1TS2A 1LT5D 1SE3A 1SBBB 1FNVA 2TSSA 1PTOH 1S5FD 1I4QA 2XRQD 2RDHA 1YN3A 1JWMD
chains in the Genus database with same CATH superfamily
2LGDA 1DOLA 3VA7A 4UDUC 2Y5CA 4B3TL 4XXEA 5IE8A 2I5MX 4DV1L 4PS8A 1SE8A 2JJQA 3QHTA 2ZXPA 2PMVA 1XTDA 3I73A 4ANWA 2A1AA 3ETRA 1BBWA 1XYIA 3ONAB 3L13A 1RL2A 2RSOA 1KD1C 3U4VA 2KC2A 2JRHA 1Q86C 1L5PA 1SNPA 1GHKA 2RKSA 1W6KA 4ZRKA 2NUCA 3FKIB 2KK8A 2K50A 1ONLA 5C4JB 1LUZA 1TS5A 2KA7A 1ICWA 2KHSA 1UNSA 4LDTD 2CFMA 5E6NA 4C7YA 4JI2L 4KV2A 4W9HA 1BXTA 3GTOH 1IKMA 4DR7L 3U30A 2L05A 1L6VA 1V86A 3KF6B 3D8GA 1GG3A 2KHWB 2NPTB 3Q6SA 2DNCA 1HNZL 4IFDJ 2A74C 2V3PA 4DV6L 1ZW7A 3DVGX 3PRPB 3P2BA 1E1OA 2HCCA 3Q8AA 3RLNA 1Q1BA 4YSXB 2R6GA 1WE7A 1ZE3D 3NZUA 3F2CA 5KIXA 2F03A 3PO2H 1E8ZA 3D4WA 4IURA 4FF1A 3NOBA 5C3JB 2B2UA 1JE4A 2PTLA 2AWNA 5IA7A 2HTME 5D14A 3TSSA 1N63A 4W9KA 1E0ZA 4DV0L 1X56A 4YTMB 2O4XA 1U4AA 2DNFA 3P7JA 4K7WA 1N5XA 2SNSA 4DV5L 1ICFB 2JRIB 2C7HA 2BGFA 2B2YC 2K39A 2B63H 1QT9A 4HVBA 2DZJA 2V1YA 4USAA 3LWEA 4PQXA 1EY9A 1FL0A 2MPMA 5E6PA 1K3BC 1HTQA 3J81i 4I65A 3AB9A 3PO3B 1P7EA 1V1PA 5CV4A 2EVBA 2GBMA 2O2VA 4HJ7A 1ASZA 3VH4B 1FD6A 1NYRA 4A3JH 4CDFC 5HI1A 3N52A 1Q81C 1NNXA 2KN4A 2ZZPB 2INCC 4J15A 4IUVA 4TRDA 4A55A 2A5HA 5HGQA 3Q8DA 1MFWA 2KXJA 1CKNB 2Q2HA 4DV3Q 4KN4C 2AL6A 2FCNA 5IT9E 1WGKA 1DGJA 1IGCA 1RYJA 1X3GA 2WGSA 2YTXA 2N9EB 4JL9A 4RWSC 3U9SA 3HEJA 4DAYB 1J5EQ 3JW0X 2D0OA 1PRTC 4JC0A 2UU7A 2VQFQ 1JORA 2WXIA 3Q3FA 3SFDB 2E76C 1V5OA 5G3LD 4PMCA 2K22A 3BWUD 1TZOA 4WORA 3TZUA 1B53A 5JJIA 1PZJD 3VR3A 2WDTB 1YHBA 4LK1C 2L0TA 4NQLB 2K25A 2MUYA 2PEAA 2QDLA 3LX0A 1TS4A 5IN7A 1TKWB 2I5HA 4R4TA 1EUJA 1J7CA 3E9SA 1NUCA 5KNDA 2ZJQA 1V1OA 2XEWA 4F88A 3MHZA 3F2BA 3IXSA 1I94Q 3KUZA 3RLOA 1RIPA 2VW9A 2QEXA 4DXAB 1LM0A 5LMNW 3N30A 3HOXB 4DR3L 2E2IH 3CIRB 4FVMA 3OJ3A 2HD3A 1JWMD 4HTHA 1H9MA 3K59A 1XLNA 2D10A 3S24A 3M95A 4S0RA 1QOGA 3FKIH 5GQOA 1EF5A 2N7JA 2WWZA 3FILA 3NZ3A 1S5DD 1VDZA 4N58A 2MFIA 4BAXA 1QUQA 1WCMH 1MGSA 3V6EB 2Z1CA 1YNJD 2O6VB 3HRZC 4KI0A 1PYWD 3DEOA 4KVGB 4F7ZA 3Q14C 4JI7L 2LRUA 1AWDA 3SE0A 2KDBA 1JQ4A 3NK9A 2M1MA 1XO3A 2IGDA 4HCNB 5IP9G 2BA1A 2JQRB 4P2CB 2JT4B 4RFBA 5IGDA 3CQZH 3TZDA 3J80i 5GXGB 1X3QA 2WXLA 2PCFB 3NJTA 5F2DA 2ZTDA 5DPWA 3E0JA 2K01A 2QDFA 3I91A 3EVQA 2BYEA 4GOPC 1F77A 5M3FG 2DHZA 1OXUA 2R93H 5EQ0A 3V05A 4MZ9A 1TS3A 1CJEA 3HP3A 4A3PA 3CCEA 4CBVA 1WJUA 1WY8A 1JR0D 1QVGA 3AEFB 3CCJA 1HHVA 5LLIA 3M4PA 3RZOH 4FJZA 5HY6A 2D62A 1VQ4A 1VLBA 5M5WB 1DCZA 1MJEA 2EKEC 4FF4A 2YVCA 4NDXA 2OQKA 3NQTA 3QX1A 1Z5SB 4OO1H 2J7ZA 2ZNVB 5HHDG 5JHBA 1RTOA 2DAJA 3L17A 1LTBD 2LWPA 2DY8A 4L1BA 3TL5A 4IZ8A 3L9AX 3MP9A 4NJCA 1EQRA 1LQBA 4DPGA 3ULLA 1GKHA 1KHIA 1MVKA 3M3YH 1WH3A 4RAUC 3AEVA 1DOMA 1EYCA 3HOUH 4IDIA 3OIPA 2K05A 3R93A 4NKLA 3MAQA 1EOVA 4C1NK 3G71A 2M2LA 1D1IA 1FFVA 1CM9A 4DGZA 1GUAB 1T5EA 3T16A 1GAQB 5C5MA 4F87A 2LASA 3ZNZB 1F2LA 5D94A 3V96A 1K53A 1SXTA 4LDTB 1R9TH 3ICEA 4LNFA 4WJ4A 2PIAA 1VQAA 4X62L 1IL8A 1EIHA 5BR8L 4FHJA 4HXDA 3TDQA 3AV8A 3MFGA 3EQLC 4LFAL 2CHBD 4MGIE 4V0BA 1PV4A 1SIJA 5M5YH 4WQOB 3RZDB 2PLPA 5KHOA 2LFNA 1CUKA 1H9JA 5C4XG 1Z2MA 3S1MH 3MJWA 2N55A 1WXQA 2L8JA 3HOZG 1YJNA 1WXAA 3BYYB 3IFWB 4GSWA 1VMPA 2UXBQ 2JA8B 1XLPA 3WIMA 1GM5A 5BN5A 2KT7A 2JYOA 4HIOA 2E74C 2VL6A 1VD2A 2PE9A 2MO0A 3L4PA 1G6ZA 2MRPA 4DR4L 3P75A 4L23A 1X1MA 4JW0A 3N1YC 1L4DB 5FO8B 4JBJA 5C4ZA 1M1KC 4DR5Q 5I4DA 3T3OA 3FPPA 3SDZA 2F0UA 1WX7A 4RGOS 2VZKD 4LWCA 4N9TA 2FHTA 1C0AA 1N9WA 1V9JA 2DWQA 4IPHA 1XF5L 1KIXA 1A62A 2UXDQ 2CKHB 4AJWA 3I4MB 2BTEA 2K6AA 3U58A 1K8AC 5I6YA 1V6EA 1JWSD 2G3QB 3A9KB 4A3CH 4F7XA 4X65L 1YQBA 1GVPA 1FVIA 2W3SA 4ZHOA 2WX1A 3ITPA 1B9NA 1PTOC 2SEBD 3UDXA 4YY3Q 4HJ9A 4R4QA 4K2KA 2JSVX 1LYLA 1MG4A 2ZEQA 5E7NA 4CJ0B 4I7AA 3BIID 2AMCB 4X66Q 1I4XA 1ENCA 4CKEA 4LFBL 4MGKE 4GDKB 4BY7G 1N32Q 4HCPB 2JA9A 2IY0B 2J4XA 2KLGA 2E2HB 2WDQB 3HS0C 2UUCQ 1FEHA 4CDEC 2JA7G 2CS4A 1HPCA 3AE5B 4IFDG 1KM7A 2OEDA 4WIPA 2CHWA 4ZK9B 2EYHA 5M9OA 4C3IH 3UQAA 5BR8Q 4JPSA 3VDZA 4RM8A 4DR7Q 2FJ2A 4K6DA 1F2ZA 4EZLA 4DUZQ 1M94A 3UDGA 3H94A 2PI2E 2JXMB 4JI2Q 1XPUA 2R93G 1YNND 2AUKA 1P98A 4BBNC 2Y5BB 2E8GA 3RLFA 1QNUA 1YVCA 2RSUA 2WXQA 2J0MA 1Q46A 2QC8A 2WX0A 2EZVA 1FD7D 4FP5D 1MD2D 1Q7YC 4H2AA 1T5XD 4HN7A 4RHRA 4RA8A 3ZW3A 4GLAC 2RCNA 3E56A 4DNTB 1HZ6A 2WU2B 3KLSA 4MM3B 1WCMB 1A0IA 3F2UA 2J0TD 3L10B 2BKRB 2KWVB 3JVZX 2NZOA 2JN4A 5T8IA 3R7QA 2QW7A 1SDFA 1J8IA 5IODA 2HD5B 1EYGA 2N1WA 3SGIA 1YBYA 5HFYA 1XTCD 4MJSA 3I4NB 5IYDG 1DOKA 1PFNA 5FLXE 4QY7A 2MP2B 2O2LD 4TSSA 3VR2A 1C4PA 4DV7Q 1V5TA 2BE5C 1ZKOA 4JGHB 4NXMQ 1WCMG 4ACFA 2SNMA 3JAML 1DZ1A 1PGAA 4DV2Q 1F9JA 5IAAC 1Q82C 1JWUD 4I6NB 4EUTA 2M56B 3RN5A 2YYZA 1BF4A 4LF5L 4NPNA 4DAPA 1DD2A 1D6EC 3OJ4B 4NZLB 3P4QB 5LMUQ 2HTHA 3QARA 1EZ8A 2P5ZX 3RUIB 2ONQA 4LNQA 5BN3A 4E71A 3GE8C 1WTHA 3WAMA 2R7DA 2RQXA 5D7GA 2PE6B 4A3FH 4HRSA 5C23A 2NTSA 2WXOA 3GTQH 3KVFB 1VDVA 5BMGA 1HZBA 3HOVG 4JOIA 3M7NA 2KWCA 1YHAA 3PUZA 1FNVA 1FGUA 2WAQG 1WGHA 1NI3A 2R93B 4R4CA 2B2WC 3Q8EA 1B8AA 3C1FA 4XE0A 3IRBA 2R92G 3UIOB 5C4HA 3C19A 3W1SA 1TWCH 2YTVA 3CCLA 1Y14B 1WMHA 4KY5A 4A3JB 1YN4A 2KLCA 1B44D 4C3JG 1GUSA 3VR8B 5ISRA 2FCSA 3HOYB 4NAMA 4J1MA 1RAXA 3DWQA 1UE5A 3MFYA 3WAPA 4DDGD 5IWAL 1KDCA 4IG7B 2I1KA 2A68C 3EFXD 1C79A 5G3LF 3CXCA 4N8FA 3GV6A 4B9KA 3U7ZA 3RNCC 2BVCA 2GA4B 4AWJA 4IQZA 4XT1B 3EA6A 5C44G 4OZBA 1VF7A 3ZO5B 4GXBA 3VH3B 2JA5H 1SYEA 5I9PA 3BINA 3WAOA 4NJ7A 5AUIA 3GTPH 3PO2B 4YWGG 3T9LA 1E8YA 1IKLA 4J6IA 1H9KA 1TZ1A 4M1UB 2CU3A 5IT9L 4LF8Q 1K8MA 3KF6A 1WGRA 3CCUA 3RN9C 1EU4A 4GGQA 1HA5A 1FNWA 1NCVA 4B3SL 4DDID 3RZDH 1XQQA 1STHA 1T3QA 2WP8J 1IYUA 2XWJB 1STEA 2MSED 1PH2A 5CV9A 5FO7B 4JYAQ 4ITKA 3DWPA 5EGTA 2F0GA 3S17H 4WWMA 3K7AB 4EKUA 3BZDB 2F3IA 3S15H 1TXYA 1SYGA 4G57A 1KQSA 4LMQD 4M8NA 3DMUA 4DUYQ 5EPLA 3ZDMC 1PH6A 4PNYA 4LF9Q 2PZWA 2HQEA 1SE4A 4DAMA 3HOUB 4NY0A 4HJGE 3VR9B 2G9DA 3LDZE 4MHEA 5C1ZA 1E24A 3JAMi 3QQ8B 4LUOA 2EMSA 1ESRA 2NWGA 5IGFA 4EX5A 1WTOA 1XMOL 2UXCQ 2A4ZA 3ENEA 4BFRA 1P1AA 3LGJA 3W1GA 4X62Q 2DYOA 1AEXA 2KJXA 2N88A 1S40A 3M3JA 3UF8A 4W9JA 1I6VC 2WAQE 5EDSA 3U9OA 4IM3A 2Q2TA 5C44B 1TT5B 3UI3A 3DOWA 2NCNA 3B6YA 4EVOA 2K5PA 1TWCB 2RR9A 2IJ0A 2LXJA 4A4IA 5K36H 1Y8RC 2LGIA 1EU3A 5J22A 3GD7A 2WU5B 1A15A 2K6QA 1EZ6A 4XQJA 3PRMB 1DJRD 1E10A 2D9UA 2B2TA 3GTQB 2RDBC 2XWBB 3H09A 4NPSA 2ZM6Q 1WTXA 2FXQA 3FC4A 3H7PA 4ZRQA 5JJKA 5A2QE 1ZP0B 1BVSA 1O80A 1OO9B 3PIO3 1N8RC 4ZKBB 1EUVB 2VH2A 5BO4B 1P3QU 2IPKD 3ZLZA 2VZAA 2BH2A 5ELDA 2JA7H 1WFQA 2I07B 4MDKE 3HVDA 1C3TA 3X3NA 5IIFA 4IFDH 1V8CA 2QCZA 2R2QA 4AYBG 4M0WA 5DPRA 1MBYA 2IHEA 1PH9A 4IN3A 3T13A 3IAYA 2CJOA 1A3VA 2KCMA 3RMHA 2RDHA 4B3SQ 2EQSA 4OW0A 2KMAA 2VZKB 2BOSA 3KH0A 2K6DB 4ILWA 4GS3A 4JI3Q 2FBWB 2M8SA 4DR1Q 5C4JH 3CCVA 1R9TB 1SEBD 4LLGM 4R1JA 1GNUA 1A70A 3J81L 1KJTA 1L2FA 5IYDH 4HPMB 4B0EA 2EJFC 4P73A 5EPJA 4DA2A 4UY8C 2NVQH 4GDLB 3CC2A 2KDEB 2A69D 3RZFA 3AQQA 2W54A 2ID0A 4DAVA 2V3SA 2DBYA 2RMMA 4A3LH 3N1ZC 1GUOA 1CHPD 3KJPA 1JOQA 3DWMA 1UWMA 2MJDA 1G2TA 4QIWE 3DHHC 2XVSA 4YCUA 3OPOA 5KYLA 1E7UA 2GBKA 3VTVA 1V9PA 1WTPA 1PUTA 3HHMA 4JI4Q 2ACZB 3CC7A 1CMXB 1VF5C 2KN5A 3T1YL 3ERQA 3ZNID 4BKTA 3FPUB 2JWZA 1NJIC 4L5RC 4WQMA 1J7BA 5BMHA 2JWUA 1WX8A 1OTCA 3KK7A 4FDBA 4ZRPA 4AJYB 5L95C 1D2BA 4K5XA 3L7ZC 1Y56A 1KLUD 1MHWC 2MP1A 2MH7A 3HOWH 4B3RL 5LNK1 1D8LA 1EEID 3NPPA 2DGYA 3GTLH 3ABVB 2WYQA 2K8CA 1QOFA 1VS0A 1QWYA 5C4XB 3HOXG 2CR5A 5C0XJ 4DUYL 4M00A 1J5EL 1H95A 1O7IA 4GLSC 1Y1VH 1V1PB 1QOBA 1VQHA 5CV5A 1J0GA 4MH8A 1YJJA 4HMJA 1S72A 4JI4L 2E2JB 1IP9A 1LGRA 4DV2L 2OXPA 1S5ED 3PT2B 3A55A 1WSPA 3VUXA 1QF6A 3VQIA 3HKZE 2QEJC 2L76A 4DK0A 4GN5A 1LFDA 3D3RA 3TEXA 4H02A 2WINB 4C3JH 4RKLA 3PZ8A 2PYKA 1AE3A 2B39A 4IUNA 1BNZA 3HRDD 4A3IB 2FMMA 4AP4C 1DGSA 5TSSA 1NTGA 4ZLTF 1WTWA 4ANXA 4M8AA 2KTRA 3QK0A 2F0MA 3JAME 2QCPX 4FXGC 1A3TA 1FR3A 1I4RA 2BH8A 5IP7G 2F1MA 3BVZA 5M3MG 1C7YA 2EOTA 4OO1I 3AEDB 1EIFA 2R2OA 3CP0A 1Q0WB 2D2QA 2LI5A 3Q6BA 3C0RB 3GO5A 2UUBL 4KGRA 3STBC 3ZUNA 5K36G 2HHHL 4AYBB 4DBGA 4BBRB 3ND8A 1RD9D 2QDBA 3TEHB 3IG3A 1NY4A 2A5UA 1LTLA 2BPSA 1T0SC 3DVGY 1OXVA 1GUTA 3AECB 4LW1A 4DR1L 1F1HA 2TSSA 1EQTA 1PTOH 4LUZA 4TVAB 5E6JA 4JI3L 4IALA 2F4VL 2AX5A 2ZM6L 3VUYA 1Y69U 1JROA 2YEPB 2ZTCA 4URKA 3I57A 4TQ1A 3RUZA 4QMGA 4EZJA 4P71A 3BYTB 1NYQA 2G1EA 4CJ1B 3T4AC 1N32L 1KAAA 1FFUA 3AULA 1SFOB 3GTGH 3U4EG 4KJOA 3R2TA 2L11A 2IX1A 1SB3C 4YL8A 3TEWA 2N9LA 1UAPA 1U5KA 4A3BG 1KH0A 1MJCA 1ROEA 3J9CA 1UF0A 4FO2A 5CR3A 2KNBA 2K8HA 4MTKA 1UH6A 4GNXC 3BU2A 1NDDA 2L15A 3HKSA 1WGGA 2N4FA 1AZQA 2H4OA 1V81A 4IFDI 4LNIA 4A20A 4KZ0A 2GVAA 4L63B 3PO3H 1LACA 3HOYG 5IP4D 1IYFA 3M4YA 3KUPA 5ELCA 4FF3A 3B2FA 1JJCB 2IX0A 5AZHA 4GN1A 1VQBA 4ICVA 5M5WH 5IP7H 1V43A 3UDFA 4TUUA 1T0RC 2LGYA 1VQCA 2MHJA 4FLHA 3PHXB 3VR4A 3S2AA 5EPKA 1C8CA 2MX2A 2DX5B 4ASWC 4OELB 4WAAA 1XWEA 2GBRA 2EY2A 4BKGA 2UU9L 4HK2A 4A3EB 2VNUD 3S16B 1TWHB 4IOAA 3VR6A 4YTPB 1D5ZC 1U0LA 1E8WA 4ODGA 2JZ3B 3SU8X 2A69C 2L1BA 1M90C 4GIVA 3NTIA 2GN5A 1XT9B 3OHXC 4LF7Q 2WS3B 2EPBA 3T51B 1N61A 1B50A 1XX8A 2AL3A 3AI5A 1J19A 1EQQA 1O7LA 3ML9A 3KLRA 4A76A 4JBKA 1V1QA 1WI5A 2UXBL 4QAYA 3VFKA 1QB5D 1VQ6A 2KO3A 2F0QA 4BOZB 2ZVOA 3H6NA 1XXGA 1GO3E 3RNBC 2VY3A 1H9RA 4DR2L 3WANA 3M62B 4GN3B 5JPMC 3TS2A 1UD7A 2B8GA 3CAMA 3L0WB 4W9LA 3MEFA 2XRSD 2WXRA 2KWUB 2QGQA 5IWAQ 4CKCA 4A3BH 4ZKCB 1EIGA 2WLBA 1TU2B 1SE9A 5JHAA 2B2UC 3FKIG 1J9OA 4C2MH 5J39A 3K5MA 3QAQA 3Q8CA 2DN8A 1YITA 5CGKA 2JEBI 1D7QA 1QVCA 5KRUA 1L1OB 3B0AA 1AH9A 3NWTA 1VQKA 4KD3A 1N5WA 3LB8C 2Q2IA 2HCIA 3HOWG 3ML8A 1P8LA 3PHWB 3IAS1 1V49A 1WFYA 2KOLA 2A6EC 3RR5A 2H88B 5CV6A 3AH7A 4A6QA 4LF7L 3E0EA 4OWTB 5FKAC 4ZRIA 4IWOA 1HR0W 3RZWC 1SMYD 2OEOA 3GOEA 3I8ZA 5C3EG 1ZKHA 4HJKA 3SEBA 4JV5Q 1BT0A 1FYCA 1TS2A 3M4OB 1X9NA 3AEEB 1I3QH 1VCIA 4WH4A 3VYSA 4L8JA 1RM6C 3AB5A 1C77A 1YN3A 3PZ7A 5FR3A 1VZ6A 4HWIB 3JSVA 1WWTA 1HZAA 4Q5VA 4AUQC 3PLVA 3S1RB 1UUPA 1X3EA 1N36L 3P4RB 5CHVC 3E3XA 1L0YB 3QC8B 5FJ8G 4NXML 1PFSA 1L0XB 2HDLA 3PPAA 3FP9A 1S1QB 1OXTA 1PXUA 4GNXA 4G7OC 3QCAA 4P74A 3CRLC 2NN6G 1WD1A 5ELFA 4OX9L 5LHY1 2N9PC 4UHVA 4RNAA 2KQSA 4KSLC 2GVBA 4H44C 2KFKB 1CHQD 2DY7A 3CRKC 3NENA 5IO9A 4B3ML 4ANVA 1DYQA 4FHKA 5D2MB 1I35A 1EY0A 4QUFA 2SAKA 1HCZA 2A6HC 2BYFA 4KZCA 4NXNL 3SFEB 1WTRA 2K03A 4A3MB 4JWSC 3RPFC 4EQPA 4TMAB 4MGZE 4CO7A 3B1LX 1QQRA 1EOTA 3PIP3 4G7ZC 1PDXA 4JI7Q 4ZOHC 3S17B 2Y3AA 3EROA 2FMCA 3SK4A 2O5IC 2ZPYA 3WOEA 1GB4A 5C2TB 1NSNS 3A56A 1N36Q 2Y0SB 2J7QB 1H8CA 3TP7A 3PF5A 4F1SA 1Q1EA 3HZXA 3BZCA 1PTOF 4XT3B 2B29A 1PH5A 2Z4IA 3VXWA 3HOZH 1WM3A 1WI0A 1SJED 4FA6A 2HQLA 1Y1WH 2L83A 3FEWX 1GJZA 1C4AA 4POFA 5T1IA 4M0WB 2KEDA 3H3VC 3B2GA 1WYWB 3QG1A 2ZPNA 4W9IA 1CQFA 3ONSA 3ZXVA 2D3CA 4C7ZA 4LF4Q 1KFYB 2HE7A 2MWSB 3MXNA 4X3UA 2CCZA 1EIYB 2AKWB 1UELA 3CSFA 3I5JC 3V61A 2B2VA 1YNTE 4XX5A 1I7HA 4LFCL 1B4OA 1EO6A 3H15A 1WZ0A 2XBBC 1XJVA 1KRSA 2DYBA 4JX1C 4IWPA 1N34L 1FCLA 1FXAA 3A9KA 1BMLC 3CPFA 3R8BA 1QKZA 4KMUC 4ZUIA 1R7SA 3ZVVA 4R9WA 3A7AB 1IBKL 4FJYA 2K04A 4MACA 3PGEA 1G91A 5FLXc 1RJTA 2CWPA 4XTCS 1ZXHA 1YJWA 1K0RA 2N7EA 3EUB2 1ASYA 4RGMA 1YJIA 2WKCA 2JUOA 3T53B 3MXPA 3TS0A 3KUDB 4GDKA 1TWHH 1F2RC 1IYVA 4JPBW 3NWSA 1N33Q 4YY3L 3BY4B 4HSPA 5JXVA 3S14B 3K5LA 2BB5A 2IBIB 5J2RA 1WOCA 3CCSA 1BBXC 3RN2A 4P75A 3JYUA 2PZTA 3Q22A 4YT0B 2WB1G 3IAM1 4WJOA 3K0XA 4MT5A 3NS1A 3U7DA 2GOWA 5DM63 1K8OA 2QIEB 5GMVA 3TIXA 2K8BA 1SE3A 4HPLB 1CKOA 4DFAA 1SBBB 1NAPA 4BBNF 3BDLA 1I4QA 2C5CA 4C3HB 2H89B 2J52A 1NR4A 3ECIA 3DUZA 4XYCA 4LFAQ 4P1BC 4ZCKA 3I63C 1XEEA 1JB7A 2BB6A 2N9XA 1TWGB 1E22A 3MEHA 3KQ4A 4KLKA 3UE1A 3PF4A 4RF0A 4Q2JA 2BWES 3H0GG 2XN9C 3VRBB 4UP7A 1PYBA 2KZRA 2FFKB 1BOSA 2K5DA 1IW7D 4IPDA 1IBMQ 4IJLA 3I55A 4QB4A 2B2VC 3I3CA 4RMFA 2DENB 4DXFA 1ZXTA 3A5ZB 1A2UA 1QCBD 1C78A 1D1KA 2L0CA 1MPEA 1WTVA 1UE6A 5C0XI 1ZYRC 2XSCA 1Z9FA 2MQHA 1GUWA 4GN4B 5IYBG 2JA8H 3P42A 5KNCA 2H1EA 3IKJA 1HQRD 1T0QC 4G50A 4AOFA 3QIJA 3M4OH 1TGZB 5FR6A 3PRZA 2KCNA 4OHJA 3J81E 1YJ9A 4DV5Q 2AEHA 5ELEA 1IBLQ 3QWZB 2ZT9C 1HZ9A 2DJGC 3TEZA 1SYCA 4AS1A 4V190 1YN5A 4NP5A 4R8IA 2FIFA 3QO2A 2LJ5A 1E90A 3Q69A 1TJEA 2IW3A 3KBXA 3W5OA 4GOPA 5HG2A 3MA2B 4NQKE 1HJPA 3PREA 1PA6A 4WWNA 2MBOA 1RCVD 1GJXA 4C2MB 1YJ1A 1ENFA 1JWBD 3VTWA 1E2WA 3OOCA 2LZ6A 4LJOB 4OWWB 5D6JB 5M3FB 3GTMH 2ATWA 1HNXQ 4DK3C 1E6EB 1GPXA 2LXKA 1N60A 2F0KA 1HNXL 2K5QA 3K8AA 2IX3A 3VDYA 1YMHE 3AE6B 4JI8Q 3APDA 4MIUA 3OSOA 1A2TA 4JBWA 2ZCCA 2LKVA 3H6MA 4II2B 1I5FA 2MCNB 4G0NB 2H5XA 3M3YB 3AMZA 2B2YA 2D3AA 1JJGA 1C9FA 2XGTA 4J6HA 2ZW0A 4Y7NH 1YX5B 1YNNC 2EKIA 4YSYB 3FDTA 3F8TA 4KHPL 2BCOA 3IT6B 3KLSX 5J18A 1T0YA 3W2DA 2DLBA 2KQ3A 1BBUA 4BA2I 3A5UA 3GTJB 3ZNHB 3BK1A 2EYOA 1AE2A 1K83H 3HGBA 2WP9B 1TWGH 3BG3A 3Q3JA 4G11A 3S16H 4A3OA 1QNKA 2PW5A 1S4ZA 5FJ8H 3G7LA 1FRRA 4B08A 4BBSB 2HUGA 4TKOB 4A3MG 4WJ3M 4OZAA 2A19A 2ZXRA 1FIQA 2WXPA 3IVFA 4KN7C 2R7ZG 2RF4A 1EY4A 1EY7A 1HA6A 3TN2A 1KNAA 3DDCB 4NMZA 1SF0A 4L6TB 4WJNA 3R3MA 3I4LA 1B3AA 5CTRC 3CW2C 4A93H 3FRPB 1ZDVA 3DWGC 4NAWB 3NTKA 1F2RI 3KYDD 3OAWA 2L5TA 1FJGQ 1IBXB 1FO4A 3ZJUA 3DHQA 4B0MA 2NZHA 1WJJA 3MC0B 4YHHL 3DBHI 2YLMA 1PZKD 4N9PA 4POGA 2KDMA 5TR5A 3J7AF 3C8YA 1SYBA 3TEYA 4QL5A 3K0YA 1K8RB 1PFBA 4ULLA 4JE3B 4LNKA 3J7ZC 2INDC 2F0TA 1E3PA 3Q3OC 1WRDB 1B2TA 2MBBB 3CCQA 4PK1A 4ZYSA 1PYSB 4RM9A 1PGBA 4Z9CB 1G51A 4ABNA 3J81j 1YQ4B 1PMRA 1ET9A 3NS8A 4WURA 2YU9B 2M0AA 2LMCB 3HM3A 1MIUA 1VMCA 2JXXA 3R2IA 1CKNA 4K5VA 1Y8NB 3AE3B 4QCLA 1WZ3A 4JIOU 3OWEB 1YX6B 4XZ4A 3RULA 1QILA 3IT4B 4D2KA 3K9PB 1UWXA 2PMZE 3AMUA 4HR7B 3NY5A 5CHFA 2K5HA 4BY1B 3ULJA 1VZ8A 2RDFA 4I7ZC 2R7ZB 2ENBA 2K3UA 5E6OA 2KJ6A 2BDNA 3TBIB 2EY1A 5CORA 1NENB 4KDLB 4BBSG 4O0AA 2MA9B 1MSHA 3NQIA 1TT2A 1MG8A 1F9QA 1P9DU 1TYGB 3KW5B 4FBJB 3APCA 1QOAA 5LL6X 2A6HD 3GDEA 3QB3A 1TQOA 3H1UA 3Q0AA 4CDCC 5IGEA 1NR2A 2IO0B 1AZPA 1CFMA 1PHJA 4WRDA 5M3MH 1WRIA 1I4HA 2F0PA 3GTKH 3KJOA 3EHVA 2KEEA 2IY5B 4A3MH 3OG5A 4CHKA 5BN4A 2RPVA 3PUYA 2L52A 4EQOA 3ZJTA 4RMAA 1RODA 4A3FG 4M02A 1I50B 3NRZA 2O2VB 3BVGA 1PH1A 3C3LA 1YD8U 1U4RA 1OTRB 4OXPA 1BCPC 1X3FA 4IC7B 4C3JB 2YTYA 4DV4Q 4FYDA 2MO1A 3EN2A 1UGJA 1HUMA 2K28A 4IUQA 3HOYH 2O6VD 1V2YA 1TWAB 3D32A 4DHJD 4IUPA 1HQMC 3ZKJC 5EKIA 3NELA 4CYEA 2BE5D 4LF4L 3V62A 2A8VA 1UWVA 1WR6E 2Z4HA 2R92H 2KHJA 3TJPA 1ZDXA 3GZNI 4IOIE 4MH0E 1P7FA 2N0SB 3ZYYX 3AE2B 2B63G 4NXNQ 3D6CA 3WA0A 2OTLA 3DBSA 2IZVB 3RT3B 1E0BA 4XIGS 4XDDA 1NBFC 2F0OA 5M3FH 2JZPA 1MKHA 5EE0A 4JK1C 3B9JA 3IFTA 1G8ZD 1MHHE 1OEYJ 2K32A 2KYWA 2CKZB 4K8JA 1PTOB 3K9OB 1N62A 4JWUC 1LABA 5ELOA 3F2DA 1MSGA 2CQOA 1SRUA 1C9OA 2NB0A 1KXLA 1KDAA 1GXDC 4PMWA 1Q1OA 4AH6A 4C3IG 2Z59B 2QJLA 2R7ZH 4LK0M 4UAIA 4DNRB 4HIMA 2JX5A 3FHWA 4BKSA 4DAYA 3OMGA 1E5WA 3RCZA 3AM9A 2M0XA 1S3SG 4B3MQ 1CA6A 1PLFA 2K5NA 1VQ5A 2IGHA 2VUMB 2KDIA 4HEA1 3MC8A 2M9VA 1OXXK 1F9SA 1XMQL 1UBIA 1XD3B 2JYTA 3PO0A 1VQIA 2QHOA 5HURA 3MTSA 4KHVA 2SOBA 2V4DA 1IHZA 2KCTA 5I2XA 2O6VA 3SD5A 3OIQA 2GBJA 1T9HA 1EEFD 2BDOA 4PZ6A 1PRTF 3AEBB 1KAWA 1OGWA 1WD0A 3N9YC 2JE6I 2KCCA 4A3DH 4CJ2C 1P16A 1VR9A 3GZNB 2LS01 3C2PA 1Q90A 1VQFA 1R4MB 1X55A 2JA6B 4KKUA 3EJIA 5EKKA 2R7FA 3URYA 1K73C 1WR1A 3A33B 3QA8A 4I6PA 2RA4A 4JI6L 1B1ZA 3Q3MC 5D3IB 5C3XA 1GC6A 2KQ7A 1Y1WB 1FMAD 4BA1I 4GOPB 3T1YQ 5JJZA 2WXNA 4JYAL 2I5LX 3A1QA 2I0QA 1E2ZA 5L37A 2MJ3A 2MJ8A 1VQPA 3AEAB 4JI0Q 2BBCA 2L1AA 1JC7A 4ANUA 2CW0D 4K1RB 1K3RA 4QF4A 3E6ZX 3MXNB 2NVYB 3L54A 4OO1G 5FLXL 1SYFA 4OONA 2VQFL 4A3EH 3CF6E 3ER0A 3RNUA 3T3NA 3GE3C 5C4XH 2RD0A 2K75A 1DOXA 2M4NA 4F8MA 5AZGA 1ZGUB 3A9JA 2DZIA 3SR1A 4YCWA 3DPDA 4BBSH 4NNJB 5IP9H 2XTIA 3QJYA 3JAMc 2EXZA 3P63A 3KF8B 3TP5A 1VQGA 1OQQA 3E5SA 4GKJL 2INPE 4WWOA 2CVRA 2RCFA 2AQ2B 2F0HA 4HIDA 2L4NA 3GTJH 3A8KE 1MI2A 3M4QA 2L00B 2RHSB 2L55A 5C0XH 4QIWB 1SSOA 1R4MI 2FIDA 3P4SB 3KDFB 5JAVA 4DR2Q 5JH5C 4ID6A 1K9MC 3DBLB 2J0KA 2ZVNA 2G9HD 2C9WB 3VTUA 1VQJA 4UP8A 1F9RA 3JC66 4FULA 3PS6A 2WQYB 5ELBA 5DAUA 3AFQA 2JP1A 1D5MC 1R4PB 1FGBD 1RDPD 2UUAL 3LYYA 4OL7A 1D4BA 2OCEA 2EJGC 2HIXA 3ERSX 3ZRFA 4IKGA 2IO1B 5EBCA 2WB1B 1LTAD 4DV7L 2BS4B 4EQ5A 4YWMA 1AFPA 4C80A 5AJ3Q 2KOXA 3Q24A 4N59A 2GRIA 1LO5D 4PV1C 2F0IA 1JICA 2NVTH 3VHTC 2JA5G 1QG7A 1IPGA 4JI1L 4A3KB 4K6LA 4OGQC 5A35A 1STGA 1SYDA 3PIOA 2KENA 1LTRD 3PV0A 2ZXOA 1ZPSA 2JVCA 1SN8A 1A63A 1AARA 1TKEA 3X3MA 2B8FA 3G48A 3QOLA 3KLWA 3PTFC 1E9MA 4IUTA 5E3FA 3HFZB 2WNMA 2E3TA 1N6ZA 2NN6H 3M9BA 2F0WA 4MN3A 4A3BB 2K0PA 2K7VA 4B3TQ 2Y5PA 1UEBA 1U4LA 4DNIA 5EE1A 2K5WA 2NYZD 3NUCA 3H0GB 3STBD 1TWFH 4L5TA 1C48A 4LF9L 3EFCA 4WJWA 3LNNA 1XLQA 2LGSA 3HG9A 3MHSD 3H7SA 4W9GA 1UZXB 3H91A 4PT5A 2Z0SA 3H9DA 1IBXA 1MI0A 2QILA 4ME3A 4IO9A 2DAFA 5AUKA 2F3VA 2OT2A 2NBWB 2N7DA 3X23A 4UP9A 1QE6A 2WAQB 3VYRA 2X8XX 1V80A 3U50C 1VQDA 1QVFA 1XLOA 4M8MA 4K7SA 4KKSA 2WXKA 1E7PB 1VJKA 2ALYB 3NTHA 3CD6A 3L3OC 4X66L 1C4CA 3HKZG 3L2PA 1QZHA 2NBVB 5CX3A 4C3HH 2GBNA 2I2YA 4IPGA 4E6IA 3PV1A 4CHTB 1Y1VB 3V2TA 1P0RA 1YHQA 1ZUD2 1ZXIA 3TQYA 4JVZA 1STNA 1JT8A 4ZUJA 1HR0Q 4R3DA 4F8CB 1IGDA 5EJWA 1CA5A 2BKFA 1Q3LA 2Z0DB 1LTSD 4JI5L 3S15B 2UUCL 2AHOB 5M3MB 2HHHQ 1XMOQ 1CZPA 3W1SC 3K7AH 2C60A 2GB1A 2NVYH 1KABA 4OEMB 4W9FA 2PQAB 2KACA 5I9OA 1WGYA 1CSPA 3I90A 2ON8A 2V3NA 3KYHC 1KRTA 4JI0L 3D6WA 1I94L 3R7RA 4FXCA 3GTOB 1JALA 3S1NH 1LM8B 3I7FA 2NVTB 2Z6KA 3PQIA 3I2ZA 3P1HA 2RVLA 3ZDTA 3OW7A 2KECA 2HJ1A 4HLEA 3AE9B 4P16A 1WYGA 2J42A 2VB2X 3SR6A 1DM0B 1JB3A 4AQYQ 4S3SA 2C7NB 1L4ZB 2F0NA 2KJHB 2MEKA 2Q5WD 4WAFA 2EYJA 4FADA 4Y52H 3KWLA 1X6OA 1DOYA 4PYZA 4DU9A 4GKJQ 2DUDA 1SROA 1N34Q 3MC9A 4ALPA 2G4DB 3ZJYC 5L83A 1IW7C 4BBRG 3AU5A 3PUXA 3UQBA 1RHPA 1ENAA 2V1CC 4A3DG 5G2NA 1FRDA 2MBEA 4ARIA 5GADC 4P6VF 3T8MA 4HMIA 2PZUA 3BK2A 2ZW1A 1E1TA 1K50A 3HOZB 2W3RA 1BQQT 2F52A 5NUCA 3E9IA 1YEZA 3E9HA 5KHQA 1ZYRD 1SJHD 2JSOA 4ZYNA 4EFOA 2INNE 4B3RQ 2A73B 5LMNL 5CBAE 2JF5A 1UE1A 3EBEA 3VUWA 2RHQB 4MTNA 4H13C 3NVWA 3KWVA 1AYFA 2REXA 1L1OC 3FMCA 1IYJB 4IUUA 1CQVA 3RZOB 3AU7A 1QUQB 2IHFA 3TMEA 4A3GB 2OQ0A 4OVZA 5H92C 2EYMA 2PKOA 4X64Q 4TKNA 2KVRA 3PGZA 3P20A 2KMMA 4HDOA 2LY7A 4IPCA 4KTAA 4A3JG 4C4VB 1VQEA 3LWUA 5C44H 3B08A 3GB1A 4RCOA 5IYCH 1RF2D 4YTNB 1YIWA 2R61A 1FXTB 2Z8LA 3V60A 4KKTA 2D11A 1G6PA 3N1XC 4N9F4 1PH8A 1A5RA 3P4PB 3RNAC 5KNBA 3HOVB 4X3SA 1PQSA 2DYMA 2MBHA 1NVID 1BUVT 4GB9A 3X0WA 1LV9A 4OX9Q 2B3GA 2HT1A 1ILPA 4GLXA 3SK5A 3S1RH 4G4KA 1PH7A 1SMXA 2HJ8A 2W82A 1A8VA 1SFOH 4NAWA 2NN6I 3Q2AC 3MVVA 2F3WA 3HUIA 1SNOA 4HDQA 1KLGD 3OTOQ 1WVLA 3W1YA 4U68A 3EIVA 3MHBA 2KBNA 5JZEB 3EFUA 3HOWB 3NG0A 4XYQA 2OJWA 1KRHA 4QQBX 4XC2A 3DLLA 5BYRA 2XIWA 2LEKA 4X64L 5M5YB 1YI2A 2VUMH 2FE8A 2Q2UA 4BY7B 1TY2A 4HJAA 2Q8IB 1IBLL 3KFUA 2CW0C 1BCPD 1Q12A 4LUVA 1E7VA 4BOSC 2D0PA 1Q8IA 1YIJA 2L0FA 3RYTA 4RHSA 5CMDA 3EGRA 3U52E 4EZKA 1PGXA 4XQQA 3ZGZA 2MGSA 2Q8TA 1Z47A 4A3GG 1GOZA 3NSWA 4C3IB 5IOCA 1WJNA 2EYPA 2FUG1 2KMCA 3EECA 4ZQ3A 3CKIB 1IL2A 1HXYD 1H9SB 4XDCA 2KWDA 3EC8A 4DV1Q 5E4WC 4DR4Q 2OTJA 4XQNA 3K5NA 3VVWB 4KSKC 3DXJC 2TMPA 2PW7A 3WWVA 2FUHB 2IDYA 2G5DA 1J6QA 1GUNA 1H9SA 1W6JA 4C1NI 4JBMA 1SIFA 3DBLI 2QA4A 2VQEQ 2LVQA 1WXMA 2I1JA 2KQ4X 1HFGA 4A3CG 1LXDA 4BXXH 3KOJA 4KIKA 1S3OA 4K0KQ 5AJ3L 3TP6A 2EDGA 3A4SC 4GMVA 2KTFA 2KAJA 3RNFC 1WF9A 4DK1A 2NZ1D 2JA6G 1YOVB 4GOCA 3SHQA 2L12A 4EOYA 2ICIA 4B6WA 3F1ZA 3ALBA 5JEAJ 4DHZE 1KDBA 3DEPA 2JA7B 3ZNGC 2E5LQ 1I50H 4HKQA 1B7YB 4E3CA 2A6ED 2FAZA 4HJ8A 1BDOA 3VAWA 1E7ZA 3ZIMA 1FM0D 3AE1B 5FOBB 1CK1A 3SVMA 4KIKB 3UDIA 3PO2G 3NVZA 1TTNA 1RFAA 3UGBB 2CQAA 2J53A 2L3ZA 3AE8B 4LJZC 4JCVE 1M4VA 4KY6A 2N3SA 4HIKA 4LF8L 1STYA 2F0FA 4K0KL 2BYTA 4TQ0A 5J1ZA 1CZWA 5IYBH 4DR5L 4MNOA 3CMAA 1B3QA 4I6LB 2KFJA 4EGVA 4KX6B 1S5FD 3OYYA 2VH1A 1ILQA 4KGTA 5I6WA 3DBHB 4AQ7A 3KYCD 1SNCA 2ZJRA 1QZGA 4KKIA 1AN8A 4KKJA 1NBWA 3H7PB 2X6LA 2PMZB 1TIID 2KVMA 2JA6H 4W9EA 2B3AA 1AW7A 3D31A 4ICUA 4BY1H 2L7RA 5HKHA 3V6CB 1HNWL 1EL0A 1UGMA 3I4NH 2RSNA 1YZ6A 4YWLA 1RTNA 1Y1WG 1ZOYB 3GTGB 2G45B 2NVUI 1TVXA 4Q0FA 1S5CD 2KC1A 1C76A 2YU9H 4DQOC 2UU9Q 1B9RA 5IYCG 3TREA 2WXJA 4AIMA 2V0GA 1JW9D 3GTMB 3NZSA 4DV0Q 2OF1A 5E1FA 3SDLC 2NMQA 2VQEL 3P1MA 4JI6Q 3S2DH 3K57A 2V4IB 3K6OA 4RH6A 2LSSA 5T1GA 3FAHA 1F2YA 5FLMH 5ELNA 1SLJA 1B9MA 1FJGL 3SXHA 1WGDA 2PQEA 2C35B 1PTOD 2RDGA 5G55A 3I56A 2UWQA 2D5GA 2Y0SE 1HE8A 4BVUC 4KJNA 4G7HC 1F52A 1V97A 2LMCA 4DF7A 5LL6S 2JEAI 2PW9A 4OZCA 3UI2A 2NPTA 4W9CA 4W9DA 2EE1A 4US8A 2MLBA 4XWTA 5M5XH 3VR5A 3J80L 2KVZA 2DNEA 3DBRB 2AWTA 3K81C 1RKNA 2VUMG 2C5LC 3VA5A 4MGYE 4YXDB 1F9PA 1J7AA 4MSQB 3I4NG 4QJFA 5LXIB 2UUBQ 2I46A 4DK5A 2K5VA 2PO4A 2EJMA 3OTOL 2KTRB 4LCDE 3ZQ4A 4HAEA 1IZ6A 4IUMB 3DHIC 3BS1A 3NVYA 1ACCA 1LT4D 1SMYC 4RGTA 1SAPA 1R4NB 3JSVB 4ZDVA 3ZJVA 1K83B 3I4MH 1VZ7A 1X54A 2F0JA 3SK8A 2M17A 3DVNV 2WACA 4WWPA 2PNHA 1U4PA 4PG3A 4H0LC 3CCRA 2WIIB 2N1VA 1Y8OB 3IBEA 2E2JH 4N6EB 3TCAA 3LXFA 3K58A 3RNGC 2PPHA 4A75A 3ULPA 4OIJA 4P72A 2L32A 3N32A 1PZID 4K3BA 1G2SA 5H1SE 3A7LA 4JQWC 4US9A 3AFPA 3J7YW 2RGFA 5IT9c 3K7UC 3GTKB 3RD4A 5FO9B 3H0GH 4KK7A 3GTLB 2IWHA 2WFWA 4GZYC 2BYVE 3DCGA 2MHVA 4YWKA 4ME5A 4LFBQ 2ES2A 3HM6X 2LFIA 3MXGA 3S1MB 1HUNA 3U8ZA 4E74A 2XK5B 3WCQA 1WXSA 1UBQA 4ZAIA 1SSNA 3DVNU 1GB1A 3CWIA 1CTMA 2X69A 1GUGA 3J80c 3DBRI 5DCNA 1J8CA 4K8IA 5C6AA 3W5VB 1DXMA 4APVA 2UXDL 1RFKA 1RRBA 3K80C 1I6HB 2KX3A 1TY0A 5LMNQ 2LGXA 4DR3Q 3J80E 5GAEC 1MHXA 4FNFA 4UPAA 2WXMA 2JA5B 4JOIC 3NHEB 2W55A 3VYTA 4PS3A 1R4NI 2YV5A 4DR6Q 3KUCB 2VRRB 5G5GA 4DR6L 1EWCA 5JVH3 2NVQB 2CHXA 2EYLA 1XPOA 1JWAD 1OFFA 1JMCA 2N9KA 1PRTB 1L7YA 1G6JA 3LJ3A 4P1CC 4KV6A 2VXWA 3VYUA 2BT6A 4ZHPA 4OWXB 3G4SA 2G4SA 2ZJDA 4MEMA 1WYDA 3CSTA 4ZRZA 1KLVA 1HRJA 4QUCA 3PUVA 5C0XG 4DV6Q 1WIAA 2KKCA 4IM0A 4FXKC 2PVGC 1RWSA 5C3EH 4X3KA 3I72A 1H4RA 1EWIA 1A3UA 2AYOB 4OVUA 2CJNA 5LMUL 2E5LL 2JU6X 2BS3B 2A68D 3NVVA 5DPTA 3PSEB 1OQYA 5IGBA 2W9NA 1ET6A 5CV8A 1PFMA 1D3ZA 2HDMA 1STBA 1GD7A 4K81A 4B9WA 3SHLA 4U673 1PFDA 1N33L 4XWWA 2BA0A 1VQLA 5JJLA 2QMTA 2DJFC 3ZTCA 5J17A 2BF8B 3I3TB 4A93B 1WX9A 3QIAA 3PVLA 1X3PA 1E2VA 4YIJA 1JMLA 1HFNA 2E2HH 1WE6A 5CV7A 4DWFA 3O13A 3Q23A 2M19A 1C1YB 1WTQA 5EE9A 2KUMA 2ZCBA 4A3FB 5C3WA 4DHZB 2C9OA 3D0FA 5E4XA 4R4IA 1IBKQ 3A1QB 2BS2B 2N49A 2D3GA 2PVOD 3AE7B 4A90A 4A8XC 4BZAA 2MBQA 1CZGA 1PDQA 2EY6A 4JI1Q 2EY5A 5A2QL 3S2HB 1DONA 3NE5B 3WALA 1VQ7A 3PZDA 4LTUA 1LTID 1IUEA 4PYUA 3NBHA 2IT1A 1HZ5A 1SNMA 5DNFA 5BMIA 3AXCA 3A54A 3UINB 1HTOA 2AQ3B 3MJ5A 4LF6L 1JOKA 3PO3G 1B70B 2VS1A 1DOIA 2WV6D 4A3DB 2ZTEA 1ZEQX 3WOFA 4RG1A 2UUAQ 2LXCA 4ARCA 4JI8L 3QOJA 4K2LA 5KYIA 3M85A 4BY1G 3NUHB 3N6RA 2CH4W 3OW2A 2WXGA 1LTTD 3BZKA 2LUMA 2UXCL 2B2TC 2E2IB 2LVOA 1F2MA 4HSVA 2D5DA 4IJHA 3FILB 1FXIA 3QJZA 4KHPQ 2R3ZA 1O78A 2ASQA 3CMMB 1UEAB 1I6HH 4RKBA 2JK8A 5I2YA 1TBEA 1ESFA 4QGUA 4HJ5A 3PMFA 1L1OA 1JE5A 1O7ZA 2EELA 2JYEA 3GP7A 1E8XA 3W5UB 3L08A 3NBIA 4R8NA 4X57B 3RD2A 1R4QB 3I9V1 2RBMA 2ICEC 5D3DA 2UYZB 3HIZA 4P7IA 3R3OA 1II3A 2Y0SG 4MJSB 3S9WA 1JRPA 5JOBA 4JV5L 1K8GA 4LF6Q 4IOCA 1XNQQ 3GV3A 1HNWQ 3PIPA 2LHEA 1F0ZA 2XRQD 3U2SC 4XDXA 4B95A 1FCCC 2FCMA 2KFKA 1XNRQ 3OMCA 3RFZB 1HH2P 2Q8RE 1I4GA 3I4MG 1EYAA 2V4LA 2FINB 4C4VA 3MZ5A 4XGAB 2J0JA 2C7MB 3Q8FA 2F0EA 2IO2B 5D65A 3PSIA 4II3B 1Y1VG 4YCVA 2JA8G 3BJUA 4IWQA 1TWAH 3BDOA 4X65Q 4REZA 1LT3D 1LTGD 1W3SA 4HPPA 4N8X1 3HKZB 3Q8BA 4PS7A 3L0OA 4A3IG 1KL9A 3NXWA 4DN4M 2EYFA 1NMGA 4PMBA 3W1BA 1WJ4A 2DZMA 5COYA 2ZNVC 1K51A 2DZKA 3VRAB 2F0VA 4LAAA 3Q3NC 4KDIC 3U4ZA 1LT6D 2B76B 3WDNA 4AQYL 2I38A 4MELA 3NBHB 4WJPA 4L2YA 4DXGA 2KHIA 5JEAG 1IBML 2PPBC 1A6XA 2BQQA 5J3BA 2K4KA 4A93G 1WM2A 3AEGB 1QJOA 1I3QB 3OWFA 5G5HA 4X6AH 1OEYA 1CKMA 1YNJC 3QR8A 2IO3B 2X38A 4HEDA 2HDEA 1EY5A 1JRUA 3N20C 3ZRCA 1JJ2A 4YHHQ 5FK9C 2NBUA 2CU1A 2LD9A 1EQVA 1KTKA 5K5PA 3IHPC 1STAA 1IXRA 5DLQE 5JPNC 3CU7A 4JG2A 2LRWA 3DM3A 1EF1A 1G291 2VB3X 2HIVA 3A0JA 4GKKQ 2GLSA 1HTLD 2LVPA 4NW2A 1PH4A 3A8IE 1Y8PB 4DKAC 4IW0A 3J7AV 3CC4A 1ML0D 1GC7A 2WDRB 4G3XB 5AZFA 1O7YA 4C56C 3MWYW 3I70A 2K9XA 2WXHA 3S2DB 2IL8A 3PCOB 1XMQQ 3ZXRA 3PLUA 1C4QA 1SR3A 4K14A 4CQNA 2IGGA 2PI2A 1BKBA 3FKYA 4HROA 1VQOA 3IFDA 4RGNA 2SDFA 5C5LA 4LFCQ 5FLMG 4O2DA 2WXFA 3APFA 3C1EA 3N3KB 4LJPB 2KANA 5EE3A 3GQBA 4CGYB 1VQ9A 4GLVB 2GMIC 4FN2A 1K0SA 1EY8A 2EXDA 2N78A 2KDFB 3J7A5 5CYUA 5DEHA 5BYSA 1BUIC 1PRTD 3A74A 3MXUA 2JY6A 4C00A 1EWHA 3R66C 4JI5Q 1ISNA 2FNJB 3MTNB 2JXTA 4KHZA 5CC4A 4KY7A 2NVXH 4GDLA 1U9RA 3ZTDA 3FVQA 1KF6B 1BR9A 1KOTA 4PZ7A 2LUEA 1BO0A 3S1QB 1JQYD 2K33A 4LF5Q 1Q5WB 3RNEC 4O1NA 2QF7A 3CMEA 1Z7TA 3HK0A 4OIKA 3S2HH 4NJ6A 5DPSA 2V9HA 4EQNA 1EFID 2E2DC 2ZJPA 4GNXB 3G6JB 2EIFA 1W2BA 3AYHB 5CBEE 1VQ8A 1OQRA 3NEMA 3L16A 3O65B 1VQNA 1I42A 4LNNA 4XYOA 2M00A 4J8QA 2K1FA 1V8QA 2N8NA 1QZEA 2B2WA 1YNXA 4C3HG 4LNOA 4FJVB 2KX0A 4CKBA 1L0VB 1LT5D 5JEAH 5DM73 3S14H 3PUWA 4DV4L 1Z6HA 2OJRA 5GROA 4K3CA 1CSQA 2L9HA 3AN1A 5GAHC 1L2NA 4NB3A 3NP8A 3CF5A 1PVOA 1EM7A 2PJHA 2FCQA 1NI2A 3KDFA 5EAYA 1HTPA 3S1QH 2LJIA 1K52A 3KBGA 2JZZA 1EY6A 4RCNA 2LHDA 4YSZB 3H3VH 2OOBB 1SE2A 3HOUG 4HKZE 4JLCA 3BVMA 5EBDA 4Y7NB 1SNQA 3W3AA 1FPYA 4ZRJA 4K7UA 3A8JE 2F4VQ 1L0WA 2F0DA 2Z6BA 4H7BA 1TR5A 1D5XC 3TRZA 1TKGA 2NR2A 2B63B 1GHJA 3J81c 2F0SA 1XCQL 1S5BD 4HCEA 5EKLA 2QSDA 1SGHA 4BKSD 1VQMA 1CT1D 3A9JB 3OLMD 5IOIA 2BWFA 4BXXG 2K52A 2NBFA 4DK6C 5HGTA 3AE4B 3DM1A 1VRAB 1OXSC 2CH4A 4HCSA 1EWYC 5LXHA 4GKKL 1X65A 2Z0EB 4KD4A 3HOXH 4A3KH 2RPQA 3S1NB 2PNRC 3DQVA 5JVG3 2XNAC 3GS2A 1KC8C 4FF2A 2BW2A 2NS5A 3I4OA 1JOOA 4M01A 4IM2A 4BWGB 4DUZL 2K14A 4L5SA 4BY7H 3CPWA 2KD0A 2JQOA 1JCKB 2MP2A 4BBRH 2O5JC 4AYBE 3SK6A 1TIFA 4GU2A 4DV3L 2K1BA 1BCPF 1PH3A 1BCPB 2AUJD 1FNUA 3T56B 3GTPB 1YQ3B 2WB1E 1XCTL 2IYDB 2CHZA 1M8AA 3QWNA 4WFN3 3K5OA 3C46A 1Q8KA 3M7GA 2WHIA 5MPOA 5CHWA 5IY0A 1XPRA 1XNRL 3RI7C 1WXVA 4TV3A 4L5QA 2NTTA 2MW5A 4DHJB 5GAGC 3DWAA 1XNQL 1U4MA 4BS9A 3UE0A 1TKYA 3HVZA 3DHGC 3UIPB 5AFWA 2R92B 3T1HQ 4EEWA 1AP0A 4A3IH 3AU4A 5KEEA 4RF1A 3TMPB 2EMTA 5IGCA 4KGSA 3T1HL 1L6UA 2Z6KC 2AQ1B 2D07B 1NE3A 3HOVH 4FXDA 4A3LG 3H8HA 3W9CB 1NMFA 2LXAA 2OWOA 4EE2A 1VCBA 5H8YE 1SNDA 1HEZE 1WJ6A 3CHBD 3H3VI 1RLFA 3TUOA 4TQUS 2Z9HA 4X3TA 3IL8A 3TBLD 4B9XA 1HZCA 2MJEA 3A4RA 2AWOA 3NHHA 2ASBA 2F0LA 3G6EA 1HR0L 1TWFB 2GI9A 2KJRA 4O42A 2WDVB 1K28A 2F4IA 4K5WA 5KGUA 2X6GA 4A3GH 1Q10A 5IGGA 3V3XA 4R4OA 2PQAA 2WKDA 1LLRD 4CDDC 1KNEA 2D2CC 3D4DA 3TP8A 2D3BA 2CWAA 2XK5A 4PZ8A 5M5XB 4MM3A 3ND9A 2IY1B 4MSMB 3BDCA 2E75C 2QKIC 1NEKB 1T6BX 2JPHA 4A3EG 3RMKC 5AEKB 1EFWA 4J3OD 1QLBB 1EYDA 3D4RA 1I4PA 2OHFA 3M63B 4OVVA 5IKCM 3CQZB 2E6XA 4WJQA 3CCMA 1HNZQ 5BYQA 4S17A 1QOHA 1MJDA 2MQJA 5C3EB 1CI3M 1X32A 2NVXB 1WMHB 2YEPF 4A3KG 4A9AA 2MNAA 3KF8A 1UE7A
chains in the Genus database with same CATH topology
1DOLA 3VA7A 4UDUC 2Y5CA 4XXEA 2ZXPA 2PMVA 3I73A 3ETRA 1XYIA 3ONAB 2RSOA 1L5PA 1SNPA 1GHKA 2RKSA 1W6KA 2NUCA 3FKIB 1ONLA 5C4JB 1TS5A 2KA7A 1ICWA 2KHSA 1UNSA 4C7YA 1BXTA 1IKMA 1L6VA 3D8GA 3Q6SA 2DNCA 2V3PA 4IFDJ 2A74C 2HCCA 3Q8AA 1Q1BA 4YSXB 2R6GA 1ZE3D 5KIXA 2F03A 3D4WA 4IURA 4FF1A 5C3JB 2B2UA 1JE4A 2PTLA 2AWNA 2HTME 5D14A 3TSSA 1N63A 1E0ZA 4YTMB 2O4XA 3P7JA 1N5XA 2SNSA 2B2YC 1QT9A 4USAA 3LWEA 4PQXA 1EY9A 2MPMA 4I65A 3AB9A 3PO3B 1P7EA 1V1PA 5CV4A 2EVBA 1FD6A 1NYRA 5HI1A 3N52A 2KN4A 4TRDA 4IUVA 4A55A 2A5HA 4KN4C 5IT9E 1WGKA 1DGJA 1IGCA 1RYJA 4RWSC 3U9SA 3HEJA 3Q8FA 3SFDB 1PRTC 2WXIA 1JORA 2E76C 5G3LD 4PMCA 2K22A 3BWUD 1TZOA 4WORA 3TZUA 1B53A 1PZJD 3VR3A 4LK1C 2MUYA 3LX0A 1TS4A 1TKWB 3E9SA 1J7CA 1NUCA 5KNDA 1V1OA 3MHZA 4F88A 3IXSA 3HOXB 3CIRB 4FVMA 1JWMD 4HTHA 1H9MA 3K59A 1XLNA 1QOGA 2N7JA 3FILA 3NZ3A 1S5DD 1VDZA 4N58A 1MGSA 2Z1CA 1YNJD 3HRZC 4KI0A 1PYWD 3DEOA 1JQ4A 1AWDA 3SE0A 3NK9A 1XO3A 2IGDA 2BA1A 2JQRB 4P2CB 4RFBA 5IGDA 3TZDA 5GXGB 1X3QA 2WXLA 2PCFB 5F2DA 3E0JA 2K01A 3I91A 3EVQA 1F77A 1OXUA 5EQ0A 3V05A 1CJEA 1TS3A 3HP3A 4CBVA 1JR0D 3AEFB 1HHVA 2D62A 1VLBA 5M5WB 1DCZA 4FF4A 4NDXA 3NQTA 4OO1H 2J7ZA 5HHDG 1RTOA 1LTBD 2DY8A 4L1BA 4IZ8A 3L9AX 3MP9A 4NJCA 1MVKA 4RAUC 1DOMA 1EYCA 4IDIA 3OIPA 2K05A 3R93A 4NKLA 3MAQA 4C1NK 2M2LA 1D1IA 1FFVA 1CM9A 4DGZA 1T5EA 3T16A 1GAQB 5C5MA 4F87A 1F2LA 3V96A 1K53A 1SXTA 2PIAA 1IL8A 1EIHA 3TDQA 3AV8A 3MFGA 3EQLC 2CHBD 4V0BA 1SIJA 3RZDB 2PLPA 2LFNA 1H9JA 2N55A 1WXQA 3BYYB 1VMPA 2JA8B 1XLPA 5BN5A 2JYOA 2E74C 3L4PA 1G6ZA 3P75A 4L23A 1L4DB 5FO8B 5C4ZA 3T3OA 5I4DA 3FPPA 3SDZA 2F0UA 4RGOS 2VZKD 4N9TA 2FHTA 2DWQA 2BTEA 1XF5L 3I4MB 2K6AA 5I6YA 1JWSD 4F7XA 2W3SA 4ZHOA 3ITPA 1B9NA 1PTOC 2SEBD 2JSVX 4K2KA 4CJ0B 3BIID 1I4XA 1ENCA 4CKEA 4GDKB 2J4XA 2WDQB 2E2HB 3HS0C 1FEHA 1HPCA 3AE5B 4IFDG 2OEDA 4WIPA 4ZK9B 2EYHA 5M9OA 4JPSA 2FJ2A 4K6DA 1F2ZA 3H94A 2JXMB 1YNND 2AUKA 3RLFA 1QNUA 2WXQA 2EZVA 1FD7D 4FP5D 1MD2D 4H2AA 1T5XD 4HN7A 4RHRA 4RA8A 3E56A 4DNTB 1HZ6A 2WU2B 3KLSA 4MM3B 1WCMB 3F2UA 2J0TD 5T8IA 1SDFA 1J8IA 5IODA 5HFYA 1XTCD 3I4NB 1DOKA 1PFNA 5FLXE 2O2LD 4TSSA 3VR2A 1C4PA 2BE5C 1ZKOA 2SNMA 3JAML 1DZ1A 1PGAA 1JWUD 2M56B 2YYZA 1BF4A 4DAPA 1DD2A 1D6EC 4NZLB 3P4QB 1EZ8A 2ONQA 5BN3A 2RQXA 5D7GA 4HRSA 2NTSA 2WXOA 1VDVA 5BMGA 3M7NA 3PUZA 1FNVA 1NI3A 2R93B 2B2WC 3Q8EA 3C1FA 4XE0A 5C4HA 3W1SA 4KY5A 4A3JB 1YN4A 1B44D 4C3JG 1GUSA 3VR8B 5ISRA 4NAMA 3HOYB 4J1MA 3DWQA 3MFYA 1KDCA 2A68C 3EFXD 1C79A 5G3LF 3GV6A 3U7ZA 2GA4B 4IQZA 4XT1B 3EA6A 4OZBA 1VF7A 1SYEA 5I9PA 5AUIA 3PO2B 4YWGG 1IKLA 1H9KA 4M1UB 2CU3A 5IT9L 1K8MA 1EU4A 1HA5A 1FNWA 1NCVA 1STHA 1T3QA 2WP8J 1IYUA 2XWJB 1STEA 5CV9A 5FO7B 4ITKA 3DWPA 5EGTA 2F0GA 4WWMA 3K7AB 3BZDB 1SYGA 4G57A 4LMQD 3DMUA 5EPLA 4PNYA 2PZWA 2HQEA 1SE4A 3HOUB 4HJGE 3VR9B 2G9DA 4MHEA 1ESRA 2NWGA 5IGFA 1WTOA 2DYOA 1AEXA 2KJXA 2N88A 1I6VC 3U9OA 5C44B 3UI3A 4EVOA 2K5PA 1TWCB 2IJ0A 5K36H 2LGIA 1EU3A 5J22A 3GD7A 2WU5B 1A15A 1EZ6A 4XQJA 1DJRD 1E10A 2D9UA 3GTQB 2B2TA 4ZRQA 2XWBB 1WTXA 3H09A 3FC4A 5A2QE 1ZP0B 1O80A 1OO9B 3PIO3 4ZKBB 2IPKD 5ELDA 2I07B 3HVDA 3X3NA 5IIFA 4IFDH 1V8CA 4M0WA 1MBYA 4IN3A 3T13A 3IAYA 2CJOA 1A3VA 3RMHA 2RDHA 4OW0A 2VZKB 2BOSA 4ILWA 2FBWB 1R9TB 1SEBD 4LLGM 1A70A 3J81L 4B0EA 2EJFC 4DA2A 5EPJA 4GDLB 2A69D 2W54A 2ID0A 4DAVA 2DBYA 2RMMA 1GUOA 1CHPD 1JOQA 3DWMA 1UWMA 2MJDA 1G2TA 2XVSA 3OPOA 5KYLA 1WTPA 1PUTA 2ACZB 1VF5C 3ERQA 3FPUB 5BMHA 4WQMA 1J7BA 2JWUA 3KK7A 4ZRPA 1D2BA 4K5XA 3L7ZC 1Y56A 1KLUD 2MP1A 2MH7A 5LNK1 1EEID 3NPPA 3ABVB 1QOFA 1QWYA 5C4XB 5C0XJ 4GLSC 1V1PB 1QOBA 5CV5A 4MH8A 1YJJA 4HMJA 2E2JB 2OXPA 1S5ED 3A55A 1WSPA 1QF6A 3VQIA 2QEJC 4DK0A 3D3RA 3TEXA 2WINB 4RKLA 3PZ8A 2PYKA 2B39A 4IUNA 3HRDD 1BNZA 4A3IB 2FMMA 5TSSA 1WTWA 4ZLTF 4M8AA 2F0MA 3JAME 2QCPX 4FXGC 1A3TA 1FR3A 1I4RA 2F1MA 3BVZA 2EOTA 4OO1I 3AEDB 4KGRA 3GO5A 5K36G 4AYBB 4BBRB 3ND8A 1RD9D 2QDBA 1OXVA 1GUTA 3AECB 2TSSA 1EQTA 1PTOH 5E6JA 4IALA 2AX5A 1Y69U 1JROA 2YEPB 3I57A 4TQ1A 3RUZA 4QMGA 3BYTB 1NYQA 2G1EA 4CJ1B 3T4AC 1FFUA 1KAAA 3U4EG 1SFOB 4KJOA 3R2TA 2L11A 2IX1A 1SB3C 2N9LA 1UAPA 1KH0A 3J9CA 1ROEA 4FO2A 5CR3A 1AZQA 2H4OA 4IFDI 4L63B 1LACA 3M4YA 3KUPA 4FF3A 5ELCA 3B2FA 2IX0A 1V43A 3VR4A 5EPKA 1C8CA 1XWEA 2EY2A 4A3EB 2VNUD 3S16B 1TWHB 3VR6A 4YTPB 1D5ZC 4ODGA 2A69C 2L1BA 3NTIA 3OHXC 2WS3B 2EPBA 3T51B 1N61A 1B50A 1XX8A 1O7LA 3KLRA 1QB5D 2F0QA 1XXGA 3TEWA 1H9RA 5JPMC 2B8GA 2XRSD 2WXRA 4CKCA 4ZKCB 1EIGA 2WLBA 1TU2B 2B2UC 5J39A 3K5MA 1J9OA 3Q8CA 2DN8A 5CGKA 2JEBI 5KRUA 3NWTA 4KD3A 1N5WA 3LB8C 2HCIA 3IAS1 2KOLA 2A6EC 2H88B 5CV6A 3AH7A 4A6QA 5FKAC 1SMYD 2OEOA 3I8ZA 3SEBA 1FYCA 1TS2A 3M4OB 3AEEB 1VCIA 4WH4A 3VYSA 4L8JA 1RM6C 3AB5A 1C77A 1YN3A 3PZ7A 5FR3A 1VZ6A 1WWTA 4Q5VA 3S1RB 1UUPA 3P4RB 1L0YB 1L0XB 2HDLA 1OXTA 1PXUA 4G7OC 3CRLC 2NN6G 1WD1A 5ELFA 5LHY1 4RNAA 4H44C 1CHQD 2DY7A 3CRKC 1DYQA 1EY0A 4QUFA 2SAKA 1HCZA 2A6HC 3SFEB 1WTRA 2K03A 4A3MB 4JWSC 3RPFC 4EQPA 4TMAB 1QQRA 1EOTA 3PIP3 4G7ZC 1PDXA 4ZOHC 3S17B 2Y3AA 3EROA 2FMCA 3SK4A 2O5IC 3WOEA 1GB4A 5C2TB 1NSNS 3A56A 2Y0SB 3TP7A 1Q1EA 3HZXA 1PTOF 4XT3B 2Z4IA 1SJED 2L83A 3FEWX 1C4AA 5T1IA 2KEDA 3H3VC 3B2GA 3QG1A 1CQFA 4C7ZA 1KFYB 3MXNA 4X3UA 2B2VA 1YNTE 1I7HA 1B4OA 4JX1C 1FCLA 1FXAA 1BMLC 3R8BA 1QKZA 4KMUC 4ZUIA 1R7SA 4R9WA 3A7AB 2K04A 4MACA 1G91A 1RJTA 4XTCS 1ZXHA 3EUB2 4RGMA 1YJIA 2WKCA 3T53B 3MXPA 1F2RC 1IYVA 3NWSA 5JXVA 4HSPA 3S14B 3K5LA 2BB5A 1BBXC 2PZTA 3Q22A 4YT0B 3IAM1 4MT5A 3NS1A 2QIEB 5DM63 1K8OA 1SE3A 4DFAA 1SBBB 1NAPA 3BDLA 1I4QA 2C5CA 4C3HB 2H89B 2J52A 1NR4A 3DUZA 1XEEA 2BB6A 1TWGB 3MEHA 3KQ4A 4RF0A 4Q2JA 2XN9C 3VRBB 2FFKB 1BOSA 2K5DA 1IW7D 4QB4A 2B2VC 3I3CA 4DXFA 1ZXTA 1A2UA 1QCBD 1C78A 1D1KA 2L0CA 1MPEA 1WTVA 5C0XI 1ZYRC 2XSCA 1GUWA 3P42A 5KNCA 2H1EA 3IKJA 1HQRD 2KCNA 4OHJA 3J81E 5ELEA 2ZT9C 3TEZA 1SYCA 4AS1A 4V190 1YN5A 4NP5A 4R8IA 3QO2A 3Q69A 1TJEA 2IW3A 3KBXA 5HG2A 3MA2B 1RCVD 1GJXA 4C2MB 1ENFA 1JWBD 1E2WA 3OOCA 5M3FB 1E6EB 1GPXA 1N60A 2F0KA 1YMHE 2K5QA 2IX3A 3AE6B 4MIUA 3OSOA 1A2TA 4JBWA 2LKVA 3H6MA 3M3YB 3AMZA 2B2YA 1C9FA 2ZW0A 4J6HA 4YSYB 1YNNC 2EKIA 3FDTA 2BCOA 3IT6B 3KLSX 3W2DA 2DLBA 2KQ3A 4BA2I 3GTJB 3BK1A 2EYOA 3HGBA 2WP9B 3BG3A 1QNKA 2PW5A 1S4ZA 3G7LA 1FRRA 4B08A 4BBSB 2HUGA 4TKOB 4OZAA 2ZXRA 1FIQA 2WXPA 4KN7C 1EY4A 1EY7A 1HA6A 3TN2A 1KNAA 4NMZA 1SF0A 4L6TB 3I4LA 1B3AA 1ZDVA 3FRPB 3DWGC 4NAWB 3NTKA 1F2RI 2L5TA 1IBXB 1FO4A 3ZJUA 3DHQA 4B0MA 3MC0B 1PZKD 4N9PA 2KDMA 3J7AF 3C8YA 1SYBA 3TEYA 3K0YA 1PFBA 4ULLA 4JE3B 2F0TA 1B2TA 4ZYSA 1PGBA 4Z9CB 4ABNA 1YQ4B 1PMRA 1ET9A 4WURA 2YU9B 2M0AA 2LMCB 1VMCA 3R2IA 4K5VA 1Y8NB 3AE3B 4QCLA 3OWEB 1QILA 3IT4B 4D2KA 1UWXA 3AMUA 4HR7B 4BY1B 1VZ8A 2RDFA 4I7ZC 2R7ZB 2ENBA 2K3UA 2BDNA 3TBIB 2EY1A 5CORA 1NENB 1MSHA 3NQIA 1TT2A 1F9QA 1TYGB 1QOAA 5LL6X 2A6HD 3QB3A 1TQOA 3Q0AA 5IGEA 1NR2A 1AZPA 1CFMA 4WRDA 1WRIA 1I4HA 2F0PA 2KEEA 5BN4A 2RPVA 3PUYA 2L52A 4EQOA 3ZJTA 1RODA 1I50B 3NRZA 3BVGA 3C3LA 1U4RA 1BCPC 4C3JB 4FYDA 1UGJA 1HUMA 2K28A 4IUQA 1TWAB 4IUPA 1HQMC 5EKIA 2BE5D 2Z4HA 1ZDXA 4IOIE 1P7FA 2N0SB 3ZYYX 3AE2B 3D6CA 1E0BA 4XIGS 4XDDA 2F0OA 2JZPA 5EE0A 4JK1C 3B9JA 3IFTA 1G8ZD 1MHHE 2K32A 4K8JA 1PTOB 1N62A 4JWUC 1LABA 1MSGA 2NB0A 1KDAA 1GXDC 4PMWA 4C3IG 2QJLA 4LK0M 4UAIA 4DNRB 2JX5A 4DAYA 3OMGA 3AM9A 1CA6A 1PLFA 2IGHA 2VUMB 4HEA1 2M9VA 1OXXK 1F9SA 2JYTA 3PO0A 5HURA 3MTSA 4KHVA 2SOBA 2V4DA 1IHZA 5I2XA 3OIQA 2BDOA 1EEFD 1PRTF 3AEBB 3N9YC 1WD0A 2JE6I 2KCCA 1VR9A 4CJ2C 2LS01 3C2PA 1Q90A 2JA6B 4KKUA 3EJIA 5EKKA 3URYA 2RA4A 1B1ZA 5D3IB 5C3XA 1Y1WB 1FMAD 4BA1I 5JJZA 2WXNA 2MJ3A 1E2ZA 3AEAB 2MJ8A 2BBCA 2L1AA 1JC7A 2CW0D 4QF4A 3E6ZX 2NVYB 4OO1G 5FLXL 1SYFA 3T3NA 1DOXA 4F8MA 3SR1A 3QJYA 2EXZA 3P63A 3TP5A 1OQQA 3E5SA 2INPE 2CVRA 2AQ2B 2F0HA 2L4NA 3A8KE 1MI2A 2L55A 5C0XH 4QIWB 1SSOA 3P4SB 5JAVA 4ID6A 2G9HD 1F9RA 2WQYB 5ELBA 5DAUA 2JP1A 1D5MC 1R4PB 1FGBD 1RDPD 3LYYA 4OL7A 1D4BA 2EJGC 4IKGA 5EBCA 2WB1B 1LTAD 2BS4B 4C80A 1AFPA 3Q24A 4N59A 2GRIA 1LO5D 4PV1C 2F0IA 1JICA 1QG7A 4A3KB 4K6LA 4OGQC 5A35A 1STGA 1SYDA 3PV0A 1LTRD 1ZPSA 2ZXOA 1TKEA 3X3MA 2B8FA 3QOLA 1E9MA 4IUTA 5E3FA 2WNMA 2E3TA 2NN6H 2F0WA 4MN3A 4A3BB 2K0PA 2K7VA 2Y5PA 1U4LA 5EE1A 2K5WA 2NYZD 3NUCA 3H0GB 1C48A 4WJWA 3LNNA 1XLQA 3HG9A 3H91A 4PT5A 1IBXA 1MI0A 2QILA 5AUKA 2F3VA 2OT2A 3VYRA 1QE6A 2WAQB 1XLOA 4KKSA 2WXKA 1E7PB 1VJKA 3NTHA 3L3OC 1C4CA 2I2YA 4E6IA 4CHTB 1Y1VB 3V2TA 1ZUD2 1ZXIA 1STNA 4ZUJA 4R3DA 1IGDA 5EJWA 1CA5A 1Q3LA 1LTSD 3S15B 5M3MB 1CZPA 2GB1A 1KABA 2KACA 5I9OA 3I90A 2ON8A 2V3NA 3D6WA 4FXCA 3GTOB 1JALA 2NVTB 3P1HA 2RVLA 3OW7A 2KECA 3AE9B 4P16A 1WYGA 2J42A 2VB2X 3SR6A 1DM0B 1JB3A 4S3SA 1L4ZB 2F0NA 2MEKA 2Q5WD 4WAFA 2EYJA 3KWLA 1DOYA 4DU9A 1IW7C 3PUXA 1RHPA 1ENAA 4ARIA 1FRDA 4P6VF 4HMIA 2PZUA 3BK2A 2ZW1A 1K50A 3HOZB 2W3RA 1BQQT 5NUCA 1ZYRD 1SJHD 2JSOA 2INNE 2A73B 5CBAE 4H13C 3NVWA 3KWVA 1AYFA 3FMCA 4IUUA 1CQVA 3RZOB 3AU7A 4A3GB 5H92C 3TMEA 4OVZA 2EYMA 2PKOA 3P20A 2KMMA 2LY7A 4KTAA 3LWUA 3GB1A 4RCOA 1RF2D 4YTNB 2R61A 2Z8LA 4KKTA 3P4PB 5KNBA 3HOVB 4X3SA 2DYMA 1NVID 1BUVT 1LV9A 1ILPA 3SK5A 4G4KA 2W82A 2NN6I 3MVVA 2F3WA 3HUIA 1SNOA 1KLGD 1WVLA 4U68A 3MHBA 3HOWB 4XYQA 5BYRA 1KRHA 2XIWA 2LEKA 5M5YB 2FE8A 4BY7B 1TY2A 2Q8IB 2CW0C 1BCPD 1Q12A 1Q8IA 4RHSA 5CMDA 3EGRA 3U52E 1PGXA 4XQQA 3ZGZA 2MGSA 2Q8TA 1Z47A 1GOZA 3NSWA 4C3IB 5IOCA 2FUG1 2EYPA 4ZQ3A 3CKIB 1HXYD 1H9SB 4XDCA 2KWDA 5E4WC 4XQNA 3K5NA 3DXJC 2TMPA 2PW7A 2IDYA 1GUNA 1H9SA 1W6JA 4C1NI 2KQ4X 1HFGA 3TP6A 2EDGA 2KAJA 4DK1A 2NZ1D 2L12A 2ICIA 5JEAJ 1KDBA 3DEPA 2JA7B 4HKQA 2A6ED 1BDOA 1FM0D 3AE1B 5FOBB 1CK1A 3SVMA 3NVZA 2CQAA 2J53A 3AE8B 4LJZC 1M4VA 4KY6A 1STYA 2F0FA 2BYTA 4TQ0A 5J1ZA 1CZWA 4EGVA 4KX6B 1S5FD 4KGTA 1ILQA 5I6WA 4AQ7A 1SNCA 4KKIA 1AN8A 4KKJA 2X6LA 2PMZB 1TIID 2KVMA 1AW7A 3D31A 1EL0A 2RSNA 1RTNA 1ZOYB 3GTGB 1TVXA 4Q0FA 1S5CD 1C76A 4DQOC 1B9RA 2WXJA 2V0GA 1JW9D 3GTMB 2OF1A 5E1FA 2NMQA 3P1MA 3K57A 2V4IB 3K6OA 4RH6A 5T1GA 3FAHA 1F2YA 1B9MA 3SXHA 2PQEA 1PTOD 2RDGA 2D5GA 4KJNA 4G7HC 1V97A 2LMCA 4DF7A 5LL6S 2JEAI 2PW9A 4OZCA 3UI2A 2EE1A 4US8A 4XWTA 3VR5A 3J80L 2DNEA 1RKNA 3VA5A 4YXDB 1F9PA 1J7AA 2I46A 2PO4A 2EJMA 3ZQ4A 4HAEA 3BS1A 3NVYA 1ACCA 1LT4D 1SMYC 4RGTA 1SAPA 3ZJVA 1K83B 1VZ7A 2F0JA 3SK8A 2WACA 1U4PA 4N6EB 4H0LC 2WIIB 1Y8OB 3LXFA 3K58A 4OIJA 2L32A 1PZID 1G2SA 3A7LA 4US9A 3J7YW 3GTKB 3RD4A 5FO9B 4KK7A 3GTLB 2IWHA 4GZYC 2MHVA 4ME5A 2LFIA 3MXGA 3S1MB 1HUNA 3WCQA 4ZAIA 1SSNA 1GB1A 3CWIA 1CTMA 2X69A 1GUGA 4K8IA 5C6AA 3W5VB 1DXMA 1RFKA 1I6HB 1TY0A 3J80E 1MHXA 4FNFA 2WXMA 2JA5B 2W55A 3VYTA 5G5GA 5JVH3 1EWCA 2NVQB 2EYLA 1OFFA 1JWAD 2N9KA 1PRTB 4KV6A 2VXWA 3VYUA 2BT6A 4ZHPA 4ZRZA 1HRJA 4QUCA 3PUVA 5C0XG 4FXKC 2PVGC 1RWSA 4X3KA 3I72A 1A3UA 2CJNA 2JU6X 2BS3B 2A68D 3NVVA 5IGBA 1ET6A 5CV8A 1PFMA 2HDMA 1STBA 4B9WA 3SHLA 4U673 1PFDA 4XWWA 2BA0A 2QMTA 4A93B 3QIAA 1X3PA 1E2VA 4YIJA 1JMLA 1HFNA 5CV7A 3O13A 3Q23A 2M19A 1WTQA 5EE9A 2KUMA 4A3FB 5C3WA 2C9OA 5E4XA 4A90A 2BS2B 2PVOD 4A8XC 3AE7B 1CZGA 1PDQA 2EY6A 5A2QL 2EY5A 3S2HB 1DONA 3NE5B 4LTUA 1LTID 1IUEA 3NBHA 2IT1A 1HZ5A 1SNMA 5DNFA 5BMIA 3A54A 2AQ3B 3MJ5A 1JOKA 1DOIA 2WV6D 4A3DB 4ARCA 1ZEQX 3WOFA 3QOJA 4K2LA 5KYIA 3M85A 3NUHB 3N6RA 2WXGA 1LTTD 2LUMA 2B2TC 2E2IB 1F2MA 4HSVA 2D5DA 3FILB 1FXIA 2R3ZA 1O78A 1UEAB 4RKBA 5I2YA 1ESFA 3PMFA 1O7ZA 2EELA 2JYEA 3GP7A 3W5UB 3NBIA 4R8NA 1R4QB 3I9V1 2RBMA 2ICEC 5D3DA 3R3OA 1II3A 3S9WA 1JRPA 5JOBA 3GV3A 2LHEA 1F0ZA 2XRQD 3U2SC 4XDXA 1FCCC 3OMCA 3RFZB 2Q8RE 1I4GA 1EYAA 2FINB 3MZ5A 2F0EA 5D65A 4REZA 3BDOA 1LT3D 1LTGD 3HKZB 3Q8BA 3NXWA 4DN4M 2EYFA 4PMBA 5COYA 1K51A 3VRAB 2F0VA 4LAAA 1LT6D 2B76B 3WDNA 2I38A 4L2YA 4DXGA 5JEAG 2PPBC 1A6XA 3AEGB 1QJOA 1I3QB 3OWFA 5G5HA 1YNJC 2X38A 4HEDA 2HDEA 1EY5A 5FK9C 1EQVA 1KTKA 5K5PA 1STAA 5JPNC 3CU7A 1G291 2VB3X 1HTLD 4NW2A 3A8IE 1Y8PB 3J7AV 1ML0D 2WDRB 1O7YA 4C56C 3MWYW 3I70A 2K9XA 2WXHA 3S2DB 2IL8A 1C4QA 4K14A 4CQNA 2IGGA 4HROA 3IFDA 4RGNA 2SDFA 5C5LA 2WXFA 3C1EA 5EE3A 3GQBA 4CGYB 1EY8A 5CYUA 5DEHA 5BYSA 1BUIC 1PRTD 3MXUA 1EWHA 2JXTA 4KHZA 5CC4A 4KY7A 1U9RA 3FVQA 1KF6B 1BR9A 1BO0A 3S1QB 1JQYD 2K33A 4O1NA 2QF7A 1Z7TA 4OIKA 4EQNA 1EFID 2E2DC 1OQRA 3G6JB 5CBEE 4XYOA 2M00A 4J8QA 1V8QA 2B2WA 4C3HG 4CKBA 1L0VB 1LT5D 5JEAH 5DM73 3PUWA 1Z6HA 2L9HA 3AN1A 1EM7A 3NP8A 1HTPA 2LJIA 1K52A 3KBGA 1EY6A 4RCNA 2LHDA 4YSZB 1SE2A 4HKZE 3BVMA 5EBDA 4Y7NB 1SNQA 3W3AA 3A8JE 2F0DA 4H7BA 1TR5A 1D5XC 1TKGA 2B63B 1GHJA 2F0SA 1XCQL 1S5BD 4HCEA 5EKLA 2QSDA 1CT1D 2NBFA 5HGTA 3AE4B 3DM1A 1VRAB 1OXSC 4HCSA 1EWYC 4KD4A 3S1NB 2PNRC 5JVG3 2XNAC 3GS2A 4FF2A 2BW2A 1JOOA 4BWGB 1JCKB 2O5JC 3SK6A 2K1BA 1BCPF 1BCPB 2AUJD 3GTPB 1FNUA 3T56B 1YQ3B 1XCTL 1M8AA 3QWNA 4WFN3 3K5OA 3C46A 3M7GA 5MPOA 2NTTA 3DWAA 1U4MA 4BS9A 1TKYA