2XN9C

Crystal structure of the ternary complex between human t cell receptor, staphylococcal enterotoxin h and human major histocompatibility complex class ii
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
215
structure length
215
Chain Sequence
EDLHDKSELTDLALANAYGQYNHPFIKENIKSDEISGEKDLIFRNQGDSGNDLRVKFATADLAQKFKNKNVDIYGASFYYKCEKISENISECLYGGTTLNSEKLAQERVIGANVWVDGIQKETELIRTNKKNVTLQELDIKIRKILSDKYKIYYKDSEISKGLIEFDMKTPRDYSFDIYDLKGENDYEIDKIYEDNKTLKSDDISHIDVNLYTKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords T CELL RECEPTOR ALPHA CHAIN C REGION
publication title The Structure of Superantigen Complexed with Tcr and Mhc Reveals Novel Insights Into Superantigenic T Cell Activation.
pubmed doi rcsb
source organism Homo sapiens
total genus 70
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2010-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
C PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2xn9C02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2xn9C01
1SBBB 3DWAA 4RHSA 1LTSD 1I4QA 1CHQD 1LTID 1GOZA 2QILA 1SE3A 2R61A 4OHJA 4DXGA 3KLSX 2G9HD 1S5BD 1I4XA 1BCPC 4RGMA 1JWUD 4ZYSA 1LTAD 1SEBD 1D5ZC 3MFGA 4C56C 2AQ1B 1PTOH 1DYQA 2RDHA 1EEFD 4NZLB 1I4RA 2SEBD 1JCKB 1BXTA 1HTLD 1LTBD 5ELDA 1RCVD 3BVMA 3R2TA 2WV6D 5ELEA 3BVGA 4RFBA 1TY2A 1TS5A 5FKAC 1I4PA 2AQ3B 3BVZA 5ELCA 3R2IA 1PRTD 1LTTD 4DXFA 4Z9CB 1LT4D 2AQ2B 1D5MC 5TSSA 1D6EC 3EA6A 1YN3A 1PTOD 2XRQD 1FD7D 1S5ED 2ICIA 1B1ZA 1AW7A 1BCPD 1I4GA 1LT6D 2TSSA 1EWCA 1CK1A 1SXTA 3BYTB 1TS2A 2CHBD 4L63B 3TSSA 4O1NA 3BZDB 4BWGB 1XXGA 5ELBA 1S5CD 1MD2D 5ELFA 1STEA 1QILA 3OWEB 1UUPA 1M4VA 1RF2D 3GP7A 2NTSA 1ENFA 1PRTF 1HXYD 1ET6A 1XTCD 2XN9C 3V05A 3DWPA 3R8BA 1CQVA 1D5XC 4UDUC 1JWMD 1EU3A 1PTOF 1PRTB 2QEJC 4K6LA 2J4XA 1LT5D 1PZID 1RDPD 2NTTA 1HQRD 1JR0D 1KLUD 5I4DA 1SJED 1BCPF 1UNSA 1FNUA 4L6TB 3CHBD 4RHRA 1FNVA 1PTOB 4RH6A 2O2LD 1FNWA 1ET9A 1PZKD 1LO5D 1RD9D 1BCPB 1TS3A 1T5XD 1PYWD 3O13A 4TSSA 4RGOS 3W2DA 3DWQA 1LTRD 1KLGD 1V1OA 2IPKD 3URYA 2IJ0A 1EU4A 3BYYB 1JWSD 1L0XB 5FK9C 1ESFA 1CHPD 1KTKA 1LLRD 1TS4A 1FGBD 1PTOC 1SJHD 1F77A 1EFID 1V1PA 4RGTA 5D3DA 1SE4A 1YN4A 1L0YB 1SE2A 2XNAC 1DJRD 4RCOA 1B44D 1EEID 3SEBA 1JQYD 2Z8LA 1S5FD 1CT1D 1TY0A 1HA5A 2XRSD 1YN5A 5D3IB 2RDGA 1S5DD 1G8ZD 1I4HA 1AN8A 3EFXD 1V1PB 1PRTC 1LT3D 3MC0B 1LTGD 4RGNA 1PZJD
chains in the Genus database with same CATH superfamily
4X6AH 1A3TA 1EY6A 1IW7C 2B63B 2R93G 3R93A 1NI3A 1U4PA 2JPHA 1C48A 5DCNA 4OHJA 1P8LA 4GOPC 3SDLC 1MI2A 1UZXB 2CWAA 4GZYC 4IKGA 4EX5A 2H1EA 1WMHB 4NAMA 3JW0X 1T5EA 3ETRA 4A55A 3S1RH 1UE6A 3SK4A 2YU9H 3EUB2 4KHVA 1EEFD 3TCAA 3T8MA 5FOBB 1SNDA 5JEAH 3AV8A 5AUKA 2NVQH 1PH3A 3IT4B 1Y1VH 2Z6BA 4DWFA 2G5DA 1E8WA 3EFCA 5IP4D 3ZIMA 2REXA 1R9TH 1SSNA 4OELB 3CQZB 1X54A 3G6JB 2MW5A 3R7RA 1D8LA 1IBXB 3Q14C 4MDKE 4R9WA 3IAM1 1UD7A 2D3AA 4MM3B 4DR1L 4LF5Q 1CI3M 2W9NA 2X8XX 3KLSA 3I4NB 2IY0B 2DYMA 1FXIA 4QGUA 4DR5Q 2JA6B 4XTCS 2C7HA 4DV2Q 4P74A 3G71A 2F1MA 2K0PA 4XX5A 3ONAB 4HK2A 2B2TA 4BY7H 1I4GA 2TSSA 4DR3L 1WTPA 2VH2A 4L63B 4WJ3M 3ZKJC 4A75A 4FXKC 4NMZA 4JI5L 4DV6L 2YTVA 1EOTA 2GI9A 1Q3LA 3RT3B 1NTGA 5JZEB 5ELBA 1HNZQ 3HKZG 3S2HH 4JQWC 1CA6A 1K50A 1ZW7A 1NI2A 1AH9A 1KNEA 5HFYA 1STEA 4QB4A 2IX1A 4A3GG 2F0DA 3KW5B 3F2UA 2PQAA 2D3GA 2F0FA 4JBMA 1ENFA 2KENA 2UYZB 3ZLZA 1KC8C 2YVCA 3SU8X 1HFGA 2DNEA 1WJNA 1FFVA 3I63C 1IYJB 4LLGM 3W1SC 1PHJA 5EJWA 1TWHH 4UAIA 4DR4L 1T0QC 5CORA 3WAOA 2JA8B 1EO6A 1P7EA 2H89B 2MBBB 4OZBA 1FL0A 2KT7A 2LWPA 2DGYA 2YTXA 5CHFA 1N36L 3BK1A 2K14A 2N3SA 1KL9A 1PZKD 1VD2A 4KIKB 2KDMA 1VQDA 3R7QA 1EQVA 4HEDA 3L17A 4ZRJA 2XBBC 5GADC 4A3DB 5KEEA 1HRJA 4JOIC 1WE7A 1MBYA 2WXPA 4KLKA 3L9AX 1J5EL 3HOUH 4R4IA 1OQYA 3VAWA 2B63H 3QOLA 3J81j 4V190 3L4PA 1EFID 2VW9A 4IO9A 1NAPA 5D3DA 3RZOB 1SE4A 4AJWA 4BY1G 2L00B 2KVRA 1L0YB 4W9LA 4C4VB 1QUQA 4OX9L 3I8ZA 4GNXA 4Q5VA 2YEPF 1YJJA 5IYDH 2E74C 2Z4IA 1U4AA 2KLGA 3DBHI 1WH3A 3E56A 4WAAA 3CW2C 4ARIA 2L5TA 3RD4A 1F9SA 3EN2A 4CDFC 1VQMA 1WMHA 3ZRCA 3P4QB 3H8HA 4I6PA 1V49A 2E75C 4CO7A 5T1GA 4X57B 2L32A 5BYRA 1WTQA 1FMAD 2K5WA 5J18A 4RGNA 4ULLA 1DM0B 5IGBA 3HIZA 4MGKE 1UAPA 1FYCA 4K8IA 2ICEC 4IUTA 5J39A 4WWMA 3KLSX 2Q8TA 4CDEC 2JA5G 3KQ4A 2G9HD 4YWKA 1OGWA 4JI1L 2QCZA 1WVLA 3G7LA 2LI5A 4MM3A 3DWGC 1Q12A 4LNFA 3F1ZA 1K9MC 4DK5A 1YBYA 4GDLA 4F7XA 1Z47A 4FA6A 4YSYB 2OQKA 4HRSA 3RLFA 1HR0Q 1B9RA 4ASWC 4WIPA 3U4VA 1LTBD 3SD5A 1SLJA 2GBKA 3EECA 1VQAA 4CBVA 4WJNA 3D4RA 2K1FA 1G6PA 2F0TA 2FFKB 2PMVA 5IAAC 4JV5Q 2F0GA 4DXFA 3IKJA 2VNUD 5C1ZA 1GM5A 4NJ7A 1DGSA 2WXFA 1ZXIA 2ZCBA 4MGZE 2Z6KC 3ONSA 4C2MB 3GZNB 1JOKA 1S5ED 2JA8H 4QCLA 1RFAA 2KWDA 4NJCA 2BS2B 5FLMG 1QKZA 4IUMB 2N55A 4UP7A 1TS2A 2EZVA 4BWGB 2ZPNA 1XXGA 3NUHB 1LQBA 3TQYA 3MHBA 1C3TA 2PLPA 4XWTA 4LFCL 3AI5A 1I42A 4RKLA 1C4PA 4KIKA 4J8QA 1O80A 4APVA 2KQ3A 3PIO3 4W9DA 1HA6A 3AFQA 4RNAA 1EWIA 2WWZA 4IM0A 1DD2A 2UXBQ 3NELA 2UWQA 1N62A 3PQIA 4HTHA 5KNBA 1NUCA 3DXJC 2PI2A 3CCSA 4JI6L 1KJTA 5HURA 2NVYB 1CTMA 2K01A 2R7ZG 1QOFA 1HQMC 1T0RC 4J6IA 2GMIC 3VA7A 4DUYL 1FCCC 2CVRA 5EE3A 3HRZC 5NUCA 4MN3A 3OTOQ 2LMCA 3Q8AA 4HCPB 3ZTCA 2WXOA 5MPOA 5EPJA 1EY0A 1VMPA 3DWQA 3RNBC 4LF6L 1QB5D 4W9JA 4A3EB 2MJ8A 5GAHC 2NVXH 3UGBB 2BDNA 3PRMB 4KV6A 5LLIA 5FK9C 4DR7L 1CHPD 5M5YB 2PNHA 4BXXH 3P1HA 2MH7A 3KDFA 3GV6A 2G45B 4LAAA 3P4RB 2EXZA 2D3CA 2G4DB 5LMNL 4US8A 5DAUA 3I73A 1W2BA 2JA9A 2KO3A 3TJPA 5E3FA 1C4QA 1ROEA 1U9RA 1SE9A 2HDEA 2L7RA 2O2VB 1GXDC 1HCZA 3BY4B 3J7A5 3FC4A 1EQTA 3BDOA 3PO2H 5FO8B 5IIFA 2O6VD 3A74A 4EZLA 3AU4A 1HH2P 2QCPX 2LGXA 1GVPA 1V8QA 3CIRB 3CCRA 2JXXA 4MT5A 1PH8A 1V1PB 4MJSA 2CQAA 1N34L 1FGUA 1LT3D 3CCUA 3PRZA 2INCC 1O78A 3C8YA 3W9CB 1VQPA 3DWAA 4IALA 4FHKA 4I6NB 3BK2A 1CHQD 5C23A 5C5MA 4B9XA 5BR8L 1SGHA 4JBWA 4C2MH 3PUXA 1I4XA 4RGMA 2BYEA 1IYFA 2E2IB 1U0LA 3NP8A 4LFAQ 5M3FB 2R93H 1XPRA 3WA0A 1J7CA 2UXDL 2INDC 4BKTA 3V96A 2A6ED 1CMXB 2INPE 1S3OA 1FR3A 1WTVA 4G3XB 2N7JA 4K5XA 1IBKQ 1E8ZA 3S2DB 2JY6A 4JK1C 2MRPA 4HJKA 1TY2A 2HD5B 4PS8A 5FKAC 5IYBH 1B9MA 2L9HA 3L3OC 4A3MH 4IG7B 1PRTD 1QNKA 2C5CA 5LMUQ 4CDCC 2J0TD 3M4OH 2XK5B 4WJOA 2K05A 1E6EB 4H13C 2M8SA 2V1YA 1D5MC 1IL8A 4LNOA 3NS8A 1PDQA 5EPLA 5GXGB 2KX0A 3T3NA 1L1OB 1HZCA 1VQBA 4IUQA 1MJEA 4LF4L 2BE5C 5JJIA 4DBGA 2JN4A 1WXQA 2PVGC 1HTQA 3GTOB 3QJZA 1EWCA 1H95A 2UXCL 2FUG1 1DOXA 3E9SA 4ACFA 3TP7A 1N6ZA 4LTUA 1C8CA 4OZAA 2LASA 2IX3A 2IL8A 1WYGA 1MD2D 5JJZA 2EY5A 1MHXA 3CXCA 1DXMA 3U8ZA 3EGRA 5KNCA 3QCAA 4G0NB 1HZBA 3D31A 4IQZA 3K80C 3GP7A 4OL7A 5DLQE 1F9RA 3OW7A 3PZ8A 2MP1A 4IUNA 5AZGA 5M5YH 3UIPB 4YWMA 2XIWA 4RAUC 4KGRA 2I5LX 3VYRA 2KVMA 4GLSC 4NXNL 2PPBC 1EU3A 3TBLD 4K6LA 2NS5A 1RDPD 1HQRD 2KTRB 2QEXA 1JROA 3DEPA 5E6JA 4NPSA 2A6EC 2MHJA 1EYDA 2DENB 2SDFA 2I5HA 2NZHA 3TS0A 4A3FG 3MZ5A 1SFOH 1I94L 1HNXQ 1YI2A 1XD3B 4P1BC 5ELNA 1VDVA 4DK1A 4LJZC 3RI7C 2IT1A 3V3XA 4DAYB 3ABVB 2O2VA 2M1MA 4F88A 5J1ZA 1WTRA 1EU4A 3TP5A 3NBHB 2RCNA 2BOSA 1KOTA 1Q8IA 3KUDB 4W9GA 5DPSA 3BDLA 3ZJYC 1ENCA 1YJIA 2MUYA 1XJVA 1DOKA 3RNCC 1V1PA 4AOFA 3J7AV 2XVSA 1SE2A 4C3JG 1H9SB 1G291 1G2TA 5C2TB 2OWOA 4IDIA 4OWXB 5BN4A 5M5WB 4BY1H 5FR3A 3AQQA 3U58A 2QDBA 2Y5BB 2D9UA 3KLWA 3Q8BA 2WAQB 3ZNHB 2RSUA 4A3IG 3A8KE 3G48A 4WRDA 3NS1A 1M90C 4GN4B 2MX2A 5D2MB 3N30A 4PG3A 2MLBA 3PO0A 3P4PB 1KF6B 2NCNA 3BS1A 2LS01 2M56B 5C44B 4J3OD 2AHOB 2V3NA 1SBBB 1Q81C 4ZUJA 5BMHA 2BA0A 2KC1A 4W9CA 2JA7H 2DYBA 2JE6I 3RUZA 4EVOA 4V0BA 3EQLC 2X6LA 3VRBB 2VY3A 2ZCCA 5EE0A 2F0QA 1ICWA 5C3EB 3NY5A 3EROA 4E71A 4A93G 3VH4B 1CKNB 4IW0A 3Q8CA 2VZKB 1NBFC 2GA4B 3B0AA 3SDZA 2KCNA 1HEZE 4RCNA 5ELEA 5C4JH 3M7GA 2V0GA 1VQ5A 1TIFA 2D11A 4KSLC 4L1BA 4DR1Q 1ASYA 2ZVNA 2N9EB 2WACA 1WR6E 2BYFA 2KCCA 2L0TA 4IM3A 2B2YA 3ERQA 4IUUA 3PUYA 3MXNA 1EF1A 3CMMB 3EA6A 2IO3B 1SRUA 4ZK9B 4NQLB 1P0RA 3GTGH 4C3HB 4DR3Q 5A2QL 1TKWB 1YZ6A 4JI5Q 4DV6Q 1STBA 2LJIA 2HD3A 4JCVE 2ZJRA 4MTNA 1WTOA 5CV4A 3AEVA 1AEXA 2L83A 4O0AA 3H94A 4O1NA 2UUAL 3H3VH 5FLMH 1FD6A 1E8YA 3U7ZA 3NZ3A 3VYTA 4DNRB 3VUXA 4YWGG 3CKIB 4TMAB 2R92B 4TKOB 2WU5B 1KRSA 1U4MA 2BQQA 4ME3A 4CKBA 2CH4A 3CCVA 1AE2A 1PH2A 4DAYA 3SFEB 4DR4Q 2F4IA 4HJ8A 1CQVA 1RODA 2IHFA 4NXML 2EOTA 1PTOF 1Q1EA 1VQHA 1TQOA 3NPPA 3LNNA 3Q0AA 1E5WA 2ZW1A 1N36Q 3DEOA 4TQUS 2N8NA 3CC7A 1L7YA 2PVOD 1UNSA 3Q8FA 4HKQA 4RHRA 4GN1A 3ML9A 2HIVA 1ET9A 2E2HB 4MH0E 3VVWB 4FF3A 4RF1A 3O13A 3PVLA 1B7YB 5IGEA 1QOHA 2Y0SG 1J5EQ 2R2OA 1WYDA 4HIOA 4HDOA 2YYZA 1QCBD 3QA8A 1EUJA 3X3NA 5G3LF 3OW2A 2VUMG 2V3PA 2MBQA 3ZTDA 3WOFA 3Q22A 3GTMH 3L54A 1TGZB 2EMTA 1F2LA 3TEHB 1E8XA 1FGBD 3OLMD 4OX9Q 4A3BG 2JX5A 2M4NA 4M01A 1M1KC 1WI0A 1LFDA 1TIID 1K8RB 4JWUC 1EYGA 3GTPH 3E0JA 1P9DU 2GBNA 3N20C 4JBJA 5G5GA 4A8XC 4OIKA 1Q5WB 3TN2A 3JAMc 3FKYA 1TY0A 1PFBA 2FMCA 1A2TA 1MPEA 3D6CA 3M3YB 5D3IB 1BKBA 2PO4A 1E2ZA 1F9PA 1TYGB 1CKNA 5JHBA 3I91A 4LF9L 4TV3A 4E74A 3W1GA 2A19A 3GTLH 2FIDA 1NCVA 1ZEQX 2MJ3A 3KWLA 4HMIA 3UDGA 1XMOL 3HOVG 2CU1A 1NNXA 4XQJA 5IYCG 3AEEB 4AP4C 4K2LA 4PQXA 4BBRH 2F0EA 1D2BA 1A5RA 1N9WA 3MVVA 1LTSD 4C3IG 2PMZB 4JI1Q 5H1SE 3I4MB 2W54A 2C9OA 3BWUD 4KX6B 2R61A 4A3PA 5D14A 1ICFB 2D07B 4AUQC 2ZT9C 3HVZA 4G7HC 1J9OA 4FLHA 4X66L 3S1NH 3W1YA 2R7DA 3C1FA 2AYOB 1D5ZC 3S9WA 1PTOH 1KNAA 3BZCA 2KMCA 2NBFA 1EY5A 3R3MA 1Y8NB 1I4RA 1JJ2A 3F2CA 4GKKL 4WH4A 1ILPA 1HZ9A 2HDLA 5DM73 1V5TA 4G4KA 4US9A 4M02A 4CHKA 1TS5A 1SNPA 1QVFA 2PKOA 4EE2A 4R4OA 2HHHL 3GTKB 4GSWA 3K5OA 5CV5A 3AMUA 3PLVA 4GS3A 4EZKA 2I38A 1UGMA 4KKJA 1WTXA 4XYCA 4DPGA 3Q8EA 3FKIB 3R66C 2DY7A 3DBHB 4KDLB 2LVQA 4W9EA 2NZ1D 2L76A 1S4ZA 4NQKE 2WB1G 1BCPD 1EY4A 1FM0D 2NN6G 1I35A 5EAYA 2CHBD 3AULA 4MEMA 4FP5D 2IGHA 2DN8A 1OQQA 2E2HH 1PFNA 2NVTH 4LFCQ 2JWUA 1G51A 1VQFA 2B2VC 2BF8B 3AE1B 5E4XA 2WLBA 3LJ3A 3RPFC 3I4NG 3TIXA 4FADA 4ZUIA 1GB4A 1EOVA 1R4PB 3KJPA 2BH2A 3ICEA 1K83B 4KY6A 1HXYD 5DPWA 3M4QA 2LSSA 3DWPA 2NB0A 5KRUA 1F2ZA 5I6WA 2ZM6L 4GB9A 2ACZB 5C3JB 3QX1A 2E5LL 1WJJA 1VQKA 1SYFA 3U50C 1JE4A 1OXSC 3F2DA 2JQOA 3DBSA 4W9HA 4JI6Q 1T3QA 2JQRB 3A1QB 1C9FA 1YNJD 4S3SA 1KIXA 2EMSA 1SJED 2B2WC 4DUYQ 1ZUD2 3VTUA 2K7VA 1XLOA 4OONA 4OWTB 2KQSA 3CCLA 1I3QH 3R3OA 3A4SC 1WGYA 3Q6SA 2YU9B 3P7JA 2X69A 5D94A 1HZ5A 3Q24A 1RD9D 2F3IA 4LF6Q 3MP9A 4HDQA 2NVQB 2GVAA 3KOJA 2O5IC 1RYJA 1Y1VB 1YIJA 3D32A 3ENEA 2BA1A 4CYEA 3JSVA 3KLRA 4DR7Q 1R9TB 3B6YA 2SAKA 1OXUA 2E2JH 2IJ0A 4BVUC 1B70B 1MI0A 3D4DA 5LMNQ 2EKEC 1Q8KA 4ANUA 5CGKA 2GBRA 2NBUA 4K14A 3QJYA 3MC8A 1GHJA 2XNAC 1F9JA 3RR5A 3GDEA 1LACA 4KKIA 1EWHA 3NTKA 4EQOA 5BN3A 4BY7B 1GJZA 2Z8LA 2KHWB 1A62A 1IZ6A 2IHEA 2LFIA 2XRSD 4C3JH 2FIFA 4DV1Q 2PQAB 2AUKA 3NWTA 4WURA 1XPUA 2Z1CA 5LXHA 3S2HB 1S5DD 1I4HA 1N34Q 4DR2L 2KJRA 3DVNV 1WZ3A 4G57A 3CPFA 1KXLA 4FXCA 1JJCB 2CW0D 3T1YL 1E24A 3RNFC 1YHAA 4A3IH 5BR8Q 2B8GA 2HIXA 2K52A 4X3KA 1WM2A 3S16H 4FBJB 1YNJC 1RFKA 4KI0A 4XQQA 2F03A 3BJUA 3KBXA 2KQ7A 1ML0D 2A5UA 3SK5A 2UXDQ 1CM9A 2WQYB 1V9JA 4JIOU 5ELOA 3RYTA 3UF8A 2I2YA 2AQ1B 2DLBA 3UIOB 4H2AA 1LUZA 4HAEA 4I7ZC 4NZLB 2R3ZA 2OOBB 3AE2B 3DWMA 1BXTA 2IX0A 3DBLI 2F0KA 4QMGA 1XNRL 4G11A 4GIVA 1K8GA 2NUCA 1TZ1A 4A93H 4JW0A 5KYIA 3E6ZX 1PH9A 1CZPA 2MA9B 1Y56A 2IO1B 3K58A 2INNE 2JSVX 5BMGA 4HCSA 3HOUB 1JB7A 1QUQB 3RMHA 4LFBL 1P7FA 2KHSA 4LF4Q 4WJQA 1MSHA 1X3PA 2B2UC 3HP3A 1I5FA 2JYEA 3DMUA 2BCOA 4OW0A 1BVSA 2UXCQ 3S1MB 5C3WA 1SB3C 4N8FA 1Y1WH 3W3AA 2EXDA 1V81A 1AW7A 2WDQB 2WIIB 3KUZA 3TP6A 5EE9A 3VUWA 2FCSA 4UP8A 2A5HA 5HY6A 2KKCA 1E0ZA 3A1QA 1YHBA 3I55A 1K52A 2I1JA 3K9PB 1Q1BA 1IBLL 4RF0A 2DY8A 2MNAA 2LD9A 4MACA 3RCZA 3VHTC 1RF2D 2N1WA 2WXIA 2MPMA 2XN9C 4E6IA 4IPDA 3K5MA 4GOPA 3F2BA 4NXNQ 2IO0B 1CJEA 3APDA 5JPNC 4IZ8A 2V4LA 1AE3A 1D5XC 1WGKA 4OEMB 4UDUC 2LFNA 3AE3B 2FJ2A 3AE6B 3HKSA 5FO9B 3FVQA 2K6AA 2CHZA 2MJDA 4GDLB 1D3ZA 2MJEA 2AEHA 1JR0D 3CCMA 3WAMA 1I94Q 2LXCA 1XLPA 2QDLA 4AYBB 2G1EA 3EHVA 4M00A 3J80L 3HG9A 3IHPC 2XWBB 1HZAA 2RGFA 3AU7A 2FINB 4USAA 1WJ4A 3CP0A 3QHTA 2D62A 3EBEA 4HJAA 4ANVA 2FMMA 2KOLA 1IYVA 1V5OA 1H9MA 3CF5A 1XLQA 3BIID 1XX8A 5F2DA 2EY2A 2KEDA 4S17A 4KN4C 1G6ZA 4IM2A 3T9LA 1STYA 1VQ8A 3CRLC 2ZTCA 2C7NB 1V43A 1PH5A 1NYQA 1E0BA 1K51A 5AEKB 3U9OA 2PEAA 5BO4B 4WORA 4N6EB 3OHXC 4PZ7A 3Q3JA 2PI2E 3JAME 1PYBA 3J81c 1P16A 2K28A 3VDZA 1XWEA 1NENB 1OXTA 3ZO5B 4A3EG 5M5XH 1E7UA 4KN7C 1PDXA 5IWAL 2OTJA 2KJHB 5JJKA 3DHGC 3L2PA 4IPGA 3W1SA 1CSPA 1VQIA 5FR6A 3I72A 3I5JC 1C9OA 2SNSA 5LHY1 2JZPA 3AEAB 3NWSA 4R4TA 3DBRI 3CAMA 4AWJA 2DYOA 4DV4L 2L8JA 5EGTA 1MSGA 4HSPA 1WGGA 2RDBC 2HTME 4DHJB 3K57A 3UQAA 1G2SA 3KFUA 1M94A 2FCQA 1CZGA 4OXPA 4ZLTF 2NR2A 1JORA 1HE8A 2IY1B 3HOVH 5IYCH 2OT2A 4UHVA 1WGHA 2LMCB 3RNEC 2G4SA 3S1MH 4YY3L 2ASBA 4L2YA 5I2YA 3AEDB 2B3AA 2KEEA 4JOIA 3D3RA 1DOIA 2K8CA 2EYJA 1YITA 1GUGA 4KD3A 2NVUI 2WINB 4A3KH 1N8RC 2RHSB 3GD7A 1EYCA 5HGTA 1SYCA 2VH1A 3KDFB 3MHSD 4HWIB 1TKEA 1T0YA 4AQYL 3A7LA 2NVXB 2GLSA 1I4PA 3BVZA 4OGQC 2WXKA 4Z9CB 5IOCA 1B3QA 4A3JG 4LF7L 4BBNC 3NG0A 5C0XJ 2K8HA 1VCBA 2BYVE 3J81i 1AP0A 1OEYJ 4GLXA 3T56B 4HJ7A 2JYTA 3TEYA 2WP8J 1KLVA 1Y8OB 2C35B 2MGSA 3C0RB 2UUAQ 1OFFA 3BYTB 1SXTA 2FCMA 2PW7A 1VQ9A 1F52A 3ECIA 4GN3B 1GJXA 2RHQB 4GU2A 3VXWA 3PO2B 4MJSB 4BAXA 3AECB 1O7LA 1I7HA 1DOYA 1KDCA 1L5PA 2AWNA 2EKIA 1Q46A 3K8AA 1KM7A 1O7IA 1L0VB 4ZDVA 4YSXB 1GUTA 1K53A 3VR8B 3VYUA 2KDIA 3U30A 3B9JA 4HIKA 3AN1A 4B95A 3IG3A 3P63A 3CC2A 4NXMQ 1HNWL 2K04A 1WCMB 2BWES 2KBNA 3JYUA 1H9KA 3ALBA 4FHJA 1ZDXA 2WXRA 4BKGA 4X65L 2JEBI 3J80c 3H7PA 2NTTA 2M9VA 1BUVT 1OXXK 4PMWA 2A8VA 2V4DA 2ATWA 2R93B 1RLFA 3SR1A 1DOLA 5E7NA 4WQMA 4XT1B 2SOBA 2Q8RE 2F3VA 5EPKA 2ZXRA 3RFZB 3VFKA 4H02A 2UU9L 1VLBA 1VQ4A 3J7AF 1WGDA 5IP7G 2JT4B 2R2QA 4IWPA 2Z6KA 2KA7A 4FF1A 3C19A 3IFWB 1U4LA 4A3MB 5CBEE 4LF8L 1B2TA 4IFDJ 3HOYG 3M4OB 5D7GA 4A3CH 1SJHD 3QO2A 4BZAA 2CHXA 2ID0A 1PH7A 1SIFA 2LZ6A 4ITKA 3MXPA 1UF0A 2EYHA 1A2UA 2HUGA 2ES2A 1IGDA 1YQBA 2ZZPB 4WJPA 1RTNA 1B44D 3K7UC 3E9HA 3A55A 3MHZA 1FFUA 5C4XG 4KDIC 4M8MA 1N32L 4ME5A 1JICA 1D1IA 2CKZB 4HXDA 1R7SA 2KFKB 4LF9Q 1KQSA 3V6EB 3CD6A 1SYGA 3T51B 5EKIA 4MHEA 1XMOQ 2F4VL 4YHHL 2I0QA 3A33B 5AUIA 5JXVA 3QIAA 3UINB 2LRWA 3P2BA 4KY7A 4YT0B 2KHIA 1NMGA 2L05A 2JVCA 2KMMA 4IWOA 4YCUA 1BR9A 4X66Q 5JPMC 3M7NA 3AM9A 2PW5A 4WJ4A 2BDOA 4HCEA 4K7SA 2QKIC 4JI2L 3N6RA 1SSOA 3EVQA 3PHWB 2X6GA 1HUMA 2B29A 2NYZD 3A9KA 1SFOB 1I50H 4GKKQ 4LNQA 2WX0A 2NPTA 4YCWA 4AS1A 2BPSA 1KDBA 1ZPSA 2RBMA 2UUCL 2ZNVB 2HE7A 4XC2A 2RVLA 2N1VA 3L7ZC 5GQOA 2LGDA 3M95A 2HHHQ 2KZRA 4EQNA 3U2SC 5E6PA 4EEWA 2CFMA 3CSFA 2I5MX 5HGQA 5CV6A 3ZJTA 5ELCA 3R2IA 1E3PA 5HHDG 3ZRFA 4GKJL 5C3EG 4XDDA 1WCMH 2M0AA 4R8NA 1JMCA 4EFOA 3IL8A 3ERSX 3MEHA 4P1CC 4BBSH 3LX0A 2KD0A 3PS6A 1Z9FA 4PT5A 1QVCA 3HOWH 1EWYC 3QWNA 3UDFA 4Q0FA 4MELA 1MGSA 1TT5B 1CK1A 1Y8RC 2QSDA 1ZDVA 3RNGC 3ND9A 1F2RC 4L5SA 4BY1B 5CC4A 1UEBA 2DZIA 4OVUA 1GC6A 2F0PA 3QAQA 4P2CB 4YL8A 4DQOC 2VZAA 4FVMA 2AL3A 2EQSA 3BG3A 1ZE3D 2K50A 1QILA 4WJWA 3LDZE 1UUPA 1YVCA 3VUYA 3ZJVA 2ZM6Q 2F3WA 3AE9B 2NTSA 2XWJB 1PRTF 2E5LQ 1ET6A 3ZVVA 4JVZA 5IP9G 2NN6I 1IGCA 4A3LG 4P16A 1C7YA 4UP9A 2CCZA 1HHVA 2CKHB 4ODGA 3FEWX 2KJ6A 4JPBW 2BB5A 1V86A 2JA7B 2K6DB 1VQJA 3GOEA 5IT9L 2N88A 4DAVA 2Y5PA 4MH8A 4BA1I 5I4DA 4QUCA 2K4KA 2D5DA 1FNUA 2KVZA 3CC4A 3AB9A 1VQ6A 1FNVA 3ZUNA 4MIUA 4MNOA 2JA5B 2OEDA 3I4OA 4ZOHC 5LXIB 3A5ZB 4TSSA 1XMQL 4GN5A 1QE6A 2XGTA 2J52A 2BYTA 1EYAA 1LGRA 5C4JB 2OCEA 3MXNB 1XYIA 1VF7A 4L5RC 2F0NA 5C3XA 5L37A 1XNQL 3A5UA 1WY8A 3J81E 2KFKA 2K75A 3B08A 3HRDD 5D6JB 1WR1A 3U52E 3FAHA 2O6VA 4A3GH 3PSIA 3H09A 4R1JA 1E2WA 5I2XA 1B9NA 2RDFA 3GTGB 4CHTB 1PUTA 1PFDA 2A6HD 1STAA 5LL6X 3TZDA 4DU9A 1TVXA 5KGUA 3RD2A 1Q7YC 4Q2JA 1AFPA 5KHOA 1JT8A 4U673 4EOYA 4DR2Q 1EIGA 3K5NA 1PMRA 4LCDE 2EPBA 4KKSA 3T1YQ 1CA5A 1X1MA 2EIFA 1SNQA 2BB6A 1W3SA 3QWZB 3MFYA 1PRTC 2WAQE 3QB3A 4ZHPA 1BF4A 1EIYB 3HOZG 3PRPB 3FP9A 4LNNA 1BNZA 3JC66 1DOMA 1MIUA 2DZJA 4FNFA 2ON8A 4II3B 4HPLB 4URKA 3SFDB 2LVPA 1N63A 3AMZA 2AL6A 5M9OA 3PV0A 1E10A 1KAAA 2E8GA 3CCQA 1K28A 5IE8A 4B3ML 3S15H 1LTAD 4K0KL 4C56C 1MFWA 3NUCA 2Q2TA 1ZXHA 4YIJA 2K03A 1MHHE 1WXMA 1XNRQ 3P42A 3AE4B 3FILB 1EZ6A 1L6UA 4JYAL 5CX3A 3BVMA 4ARCA 1T0SC 4X3SA 3I4MG 3BVGA 1F1HA 2PTLA 4YCVA 1NR4A 1UGJA 4LFBQ 2AQ3B 1PVOA 1AWDA 1P98A 2Z9HA 4MGYE 2ASQA 3GTMB 3PO3G 2DX5B 4WFN3 3W5UB 1A3UA 3DDCB 3Q23A 4DR6L 3HZXA 1FO4A 3HOXG 3HGBA 4EUTA 1QG7A 4N8X1 4TQ0A 2A6HC 2MBEA 1K0RA 1E9MA 3O65B 3GTPB 4ZRKA 3SK6A 4A3JH 4DAMA 2DWQA 1S3SG 2J42A 1GUOA 2JP1A 5JH5C 2E3TA 1EY7A 2F0UA 2DNCA 2JA5H 1IBLQ 2N9KA 2YV5A 2BBCA 1Y69U 4ID6A 1SE8A 4KHZA 3CF6E 4NP5A 2Y5CA 4MSQB 3OWEB 1L1OC 3ULPA 3GTLB 4N9PA 1XTCD 2KOXA 2JUOA 5IT9c 2LHDA 4YSZB 2VXWA 3W5OA 4GMVA 4BBRB 1K3RA 1Z6HA 3CU7A 4G7OC 1F2RI 3WAPA 3DOWA 2BWFA 2ZXOA 1XT9B 2PQEA 1IP9A 1EQRA 3NEMA 3Q6BA 1KLUD 1EZ8A 3S1NB 2EY1A 5GAEC 4GDKA 1X65A 1ZP0B 4IC7B 1PTOB 3V6CB 4GXBA 1WWTA 1L2FA 4E3CA 2WX1A 2CJNA 2GOWA 3AEGB 4PZ8A 3N1ZC 1TS3A 4YTNB 4JI4L 2JZ3B 1X55A 4HJ9A 4G50A 3GB1A 5DPRA 5BMIA 2PNRC 2LKVA 4H7BA 1L0XB 2WXHA 3MEFA 5J17A 1VQCA 1EY8A 4F87A 2PPHA 3PT2B 1STGA 3K6OA 5DM63 2DNFA 1MVKA 1A15A 3CMAA 3TZUA 1QZHA 1AZPA 1YNND 2BT6A 4WAFA 4JBKA 4RCOA 3HOYH 2VZKD 1Y1VG 5IWAQ 2NWGA 4QIWE 4ZQ3A 1QOGA 2Y3AA 4L8JA 3TRZA 1V1QA 3VTVA 3H0GG 1S5FD 2N4FA 2D10A 3S17H 3DHHC 4JLCA 2NVTB 1CFMA 5C4XH 4XYOA 4YTPB 2R7ZH 3SR6A 4DFAA 1EQQA 3TBIB 1D7QA 3EFXD 4XQNA 1WXSA 4DV4Q 4X62L 1JWAD 2JU6X 3P1MA 3FILA 2HTHA 1WD0A 4JI7L 1E1OA 1PZJD 2R6GA 3M9BA 4KD4A 1WX7A 3GO5A 3VR6A 3QC8B 5BYQA 4JG2A 5A35A 1CQFA 1GOZA 1LXDA 2K5VA 5EBDA 1A70A 4X3TA 1K73C 2KAJA 2PW9A 5EDSA 4YY3Q 1J0GA 4QIWB 2GN5A 1WXAA 2WXNA 4DV3L 2QIEB 2PMZE 4ZYSA 1UELA 1SIJA 5M3MG 1UWXA 2IGGA 1IXRA 1J7AA 1I3QB 2MP2A 3JSVB 3CRKC 4ZKBB 3ZXRA 1GC7A 4YXDB 1SN8A 3OPOA 4QY7A 3MJ5A 4AQYQ 3H6NA 3BZKA 2IWHA 4RA8A 3J7ZC 1PH6A 2MQJA 3RZDH 4LDTB 4A6QA 3J9CA 1I6HH 2E2JB 3AB5A 2CU3A 2XEWA 4N9F4 4EGVA 4C80A 2C5LC 5KNDA 4RMAA 4JI3L 2K1BA 4LF7Q 1WF9A 2L4NA 2W55A 3STBD 4IJLA 4PNYA 1YNXA 1ACCA 1C1YB 1SAPA 1YNNC 2AQ2B 2K9XA 4KJNA 3H7SA 2RF4A 4OWWB 3PHXB 2ZJQA 2F0OA 3ZQ4A 4KGSA 3H1UA 3K81C 4K2KA 4X64L 1B1ZA 1E22A 1TTNA 1LT6D 1HFNA 3CMEA 2L12A 3VR4A 2N78A 3M4YA 1DONA 3IFDA 2LXKA 4AJYB 4C3JB 4CJ0B 2MSED 1CUKA 2KDBA 3QOJA 1A63A 3DBRB 3K59A 2B63G 5DEHA 3VQIA 4K5VA 5FLXL 4PK1A 1HNWQ 3NQTA 1A0IA 4X65Q 4R4CA 4A3IB 2QMTA 2W3RA 3N9YC 2KN4A 3U7DA 1K0SA 3BDCA 2KACA 3S16B 2FAZA 2QEJC 4LMQD 5K36G 2B3GA 1LT5D 5IP9H 4HMJA 1YMHE 2CHWA 3GE8C 3J7YW 2A1AA 5CBAE 1EY9A 1LABA 1EF5A 4LUOA 1BCPF 2WYQA 1UWVA 2Q8IB 1R4MI 4LK0M 4PMBA 4PZ6A 5E6OA 2EDGA 1NYRA 2ENBA 1FPYA 3JAMi 5IOIA 3RZWC 3HM6X 2UU9Q 2C7MB 2HDMA 4L5TA 1RWSA 3NRZA 2LXJA 2P5ZX 1VQ7A 1P1AA 4RGOS 1UE5A 1ZKOA 4A93B 3B1LX 5AZFA 4LF8Q 3LB8C 4FO2A 4IPHA 5T1IA 1V6EA 3PUZA 1GD7A 2K3UA 1RJTA 2JA6G 4DKAC 5BN5A 2LUMA 4JI8L 3PGZA 1N60A 1SF0A 2K25A 2WDVB 5G55A 2VQEL 2HCCA 2K6QA 4CQNA 1JE5A 4IURA 2KXJA 4RGTA 2CJOA 2EYOA 3KVFB 1LM0A 4ZCKA 2OQ0A 3UDXA 5T8IA 2KECA 4M8NA 2DJGC 3Q8DA 1N32Q 1J7BA 1Y1WB 2KNBA 2VB2X 2Q5WD 5E6NA 4NNJB 3AYHB 4ANWA 1N61A 1KD1C 4ZHOA 2K5HA 4J6HA 4I6LB 4GOPB 1C76A 1WX8A 2F4VQ 4TUUA 3AE7B 4YHHQ 4B3SL 1BBUA 1UWMA 4FXDA 5EQ0A 2MBHA 3IAYA 3PPAA 4MGIE 3RMKC 3TEWA 1UE1A 4A3FH 3N1XC 3VTWA 3MAQA 3HVDA 5IKCM 4LK1C 2JA8G 4B3TL 3MC0B 2RPQA 4TRDA 4K5WA 2B2WA 3PV1A 4LUZA 1Q90A 4RHSA 1U5KA 2MEKA 4JI2Q 3CSTA 2KCTA 2LEKA 4R8IA 2JRHA 1TWGH 1I6VC 3HOZH 3SHQA 3NHHA 3CPWA 1BCPC 1JJGA 2DAFA 4BOSC 3D6WA 3TMPB 4FJVB 3GS2A 4A3DG 1L4DB 3ITPA 5C0XG 4HJ5A 2UUCQ 2BKRB 1J6QA 2RDHA 3A4RA 2KC2A 3GE3C 2BS4B 1TXYA 1QOAA 1Q10A 3I56A 4MZ9A 1FJGL 1JALA 5C4ZA 3IRBA 5CHWA 3ML8A 1R4NI 1RTOA 3A54A 1PYSB 1C77A 4RFBA 1YJ9A 2JF5A 2G9DA 1E90A 1NMFA 1TR5A 4GKJQ 1TJEA 1QJOA 2A74C 4POFA 4C00A 4OIJA 4KMUC 3HM3A 1LT4D 5JEAJ 1PGAA 2Y0SB 1E7VA 4IUVA 3L08A 4QL5A 1WYWB 1IW7D 2WKCA 2VUMB 1B3AA 2VRRB 2A68D 3KWVA 2F0JA 4M0WA 1H4RA 4ALPA 3PO3H 4QF4A 2EYFA 3NOBA 2ICIA 3ER0A 3GTJH 4Y7NH 3HOXH 5M5XB 1QNUA 4NPNA 3OIPA 3C2PA 2LUEA 5FLXc 3PCOB 3UI3A 1PGXA 1XPOA 1UBQA 3RLNA 3ZYYX 1TWCH 4IJHA 2MHVA 2PZUA 4DGZA 4BXXG 4O42A 2NMQA 2BKFA 1LV9A 5IT9E 2WFWA 2JSOA 1MKHA 4DV7L 5J22A 1AZQA 4DF7A 4CKCA 3NVVA 3QIJA 1VQGA 1ENAA 4BKSA 1TBEA 4HKZE 4HCNB 1J19A 3EC8A 1TWAH 1WTWA 3NBIA 3QARA 5IY0A 4IFDG 3HOVB 1W6JA 5HG2A 3MTNB 1EM7A 3PTFC 1WRDB 1H8CA 3D0FA 4C3IB 1EFWA 1BQQT 1B50A 3EIVA 3K9OB 1IBML 2WXQA 2EJMA 1XMQQ 3NZUA 2RMMA 4AYBE 2FE8A 2HQEA 4A3KB 2DZKA 4ZAIA 4FXGC 3Q3OC 3PUVA 4ANXA 2CW0C 3WWVA 1XNQQ 2B2UA 1ZXTA 3CWIA 1HZ6A 1WIAA 1FEHA 3OJ4B 5CV8A 2JK8A 1TS4A 4LUVA 5HI1A 2Z0SA 3NENA 1BT0A 3KF8B 1WFQA 2A68C 5IODA 4OO1G 2DBYA 1LTLA 4HR7B 3N52A 1F77A 2PE6B 1X56A 2AWOA 1WSPA 3OYYA 2C60A 4QJFA 3Q2AC 3FDTA 1JMLA 3HK0A 1RL2A 4JI0L 1K8OA 1O7ZA 2KLCA 3RNUA 3KUCB 4TKNA 1XLNA 3Q3FA 1FRDA 2JEAI 4XZ4A 1ZKHA 5IYBG 1YJWA 2FBWB 3PF5A 4A3MG 1MHWC 1S40A 4EQPA 2B2TC 1AN8A 2WB1B 3K7AH 4M1UB 1E1TA 3T13A 2LJ5A 3H0GH 3A56A 1C4AA 3NE5B 2J7ZA 2ZTEA 1DZ1A 4DK0A 1L4ZB 3H7PB 4REZA 5L83A 3M85A 1L2NA 1JB3A 4A76A 1RRBA 4B3MQ 1SE3A 2VUMH 4K0KQ 2N7EA 5FO7B 1PLFA 3RN2A 4BBNF 1IHZA 1GAQB 4ZRPA 5IA7A 4X3UA 2NBWB 2CS4A 4JYAQ 4A3BH 1U4RA 2PZWA 3MWYW 3DHQA 2KWCA 4TQ1A 2HCIA 3OMGA 4DK3C 5M3MH 2YEPB 1QLBB 3T3OA 2Q2UA 3OWFA 1GO3E 2M0XA 2LGIA 2TMPA 3DPDA 2B76B 4NDXA 1SNOA 4DR6Q 5AJ3L 3S1QH 1PFMA 3W1BA 5AZHA 1RKNA 3CCJA 4IOIE 1PFSA 1VQLA 3A9JB 4DV0L 2LGYA 1WFYA 4P7IA 1EUVB 3PZDA 4HEA1 4K81A 1X3FA 1JWBD 2K5QA 2KMAA 4C3IH 1MG8A 3AH7A 3NVWA 1NBWA 4DV5L 2MFIA 4NKLA 4KTAA 4CDDC 4WWNA 2D2QA 3APCA 3T16A 4DUZL 1HTPA 4GNXC 1YX6B 4ICUA 4ZRZA 1SMXA 2F0IA 4U68A 2IDYA 5IO9A 5GROA 2CR5A 5EE1A 1F2MA 1NY4A 3IT6B 3RNAC 5CMDA 5A2QE 1FXTB 3VYSA 3ZNID 4LWCA 2KWUB 1SYDA 2IO2B 1LYLA 4BOZB 1MJCA 2E6XA 3S14B 3SXHA 2ZJDA 3AE5B 5M3FG 2VL6A 5LMNW 2UUBL 3G6EA 4RM9A 3FHWA 4C1NI 4DAPA 3H9DA 3A9KB 5COYA 2EVBA 2WHIA 2NPTB 2KDFB 2QJLA 3M63B 3ZDTA 2O4XA 3KF8A 3V62A 1IL2A 4JE3B 3WOEA 3H6MA 5IGDA 5K36H 4JI4Q 1I50B 1FNWA 3MTSA 4ZKCB 1LO5D 2D0OA 4QQBX 1PYWD 1Y8PB 1BDOA 1JRPA 2XSCA 2DJFC 2LVOA 3M62B 5HKHA 4DHJD 1KLGD 2NN6H 5CV7A 3CQZH 4XYQA 3KYDD 2JA7G 3DVGY 1VR9A 1PXUA 2IY5B 3MJWA 2K33A 2UU7A 1L6VA 3ZW3A 4DXAB 1F9QA 2JJQA 1YX5B 3G4SA 5IGFA 3P20A 4LW1A 3I4NH 4NJ6A 1VQNA 3E0EA 1C79A 1R4QB 2KTFA 5C4HA 4BBSB 2EY6A 2JA6H 3ZJUA 3NQIA 1IBXA 2HJ8A 2J0MA 2OEOA 2BTEA 3HOWB 4XIGS 4W9KA 1DCZA 1CSQA 1JW9D 3UQBA 3ZNGC 2KHJA 2V4IB 1JQYD 1S72A 1HPCA 2QF7A 1V8CA 2KFJA 3L13A 4WQOB 3I7FA 2RDGA 2WNMA 4KHPL 3QQ8B 5H92C 3T1HL 4X62Q 1WM3A 5AFWA 2GBJA 2MCNB 1KH0A 1GUAB 1KHIA 1VRAB 3ZXVA 3VR3A 3FMCA 4JI7Q 2R7FA 3AXCA 4EZJA 4KJOA 1T6BX 1UH6A 2WXLA 5IN7A 4QAYA 5ISRA 4PS7A 1H9RA 2K39A 3Q69A 2I07B 2L55A 3ULJA 1I4QA 4DV3Q 4ZYNA 3HKZE 4DXGA 2KCMA 1S5BD 1QOBA 3RN9C 2ZPYA 1X32A 4RKBA 3BU2A 2CWPA 3QK0A 1BMLC 1DYQA 3NTHA 3TMEA 3RZFA 1A3VA 1TU2B 1NJIC 3A9JA 4DDID 2SEBD 1F0ZA 1GHKA 2W82A 1BOSA 4A3DH 1EL0A 5C0XH 2VQFL 2LY7A 5DPTA 2OXPA 3FRPB 3SK8A 4JI3Q 1ONLA 1N5WA 2O6VB 1Z7TA 4R3DA 2G3QB 2HT1A 5EKLA 4FDBA 1LTTD 2PYKA 1HTOA 2DAJA 2KN5A 1E7ZA 3HKZB 4CGYB 3S14H 3KK7A 5E1FA 3WCQA 4P72A 1OEYA 3NJTA 1ILQA 1SROA 2H5XA 3RZOH 1D6EC 4X64Q 3K5LA 1ZYRD 3J80i 4CJ2C 4A3GB 2XRQD 4KKTA 1PQSA 4NW2A 4NAWB 5FLXE 2WAQG 3VDYA 1MG4A 1K3BC 2GBMA 1NVID 3ZGZA 3H15A 1QF6A 3K0XA 3L10B 4N58A 3W5VB 1YQ3B 3TSSA 4PV1C 2X38A 2Z59B 4C4VA 1QWYA 2LGSA 3BZDB 5C5LA 2F0VA 3AEFB 4AIMA 3KJOA 5C44G 1G6JA 1YIWA 4IOAA 4HLEA 3ND8A 3U4EG 2Z0DB 3CCEA 3HHMA 1FCLA 1M4VA 3HFZB 3V60A 1B8AA 1SDFA 1YEZA 3PSEB 5G5HA 1JOOA 5I6YA 2MBOA 1XCQL 3T53B 3DUZA 1PRTB 1ESRA 2SNMA 1A6XA 2J4XA 2IW3A 3OMCA 2BS3B 2NZOA 5CR3A 3PIPA 2PJHA 5KYLA 2RA4A 2L0FA 1JOQA 1YJNA 1IKLA 3SGIA 1Q0WB 1YJ1A 2WDTB 1BBXC 3S15B 1RHPA 2D5GA 4ZRIA 2BE5D 1FXAA 1GUSA 3HUIA 1AYFA 4J15A 4RH6A 5EKKA 2N9XA 2BW2A 4IFDH 4UY8C 4KVGB 2N49A 2ZXPA 4FJYA 5CYUA 4DV1L 1T5XD 3W2DA 4P71A 4BBRG 2V3SA 2DHZA 3AU5A 4PYUA 4L5QA 4CJ1B 1N33L 4JI8Q 1PH4A 5CV9A 1XTDA 3BYYB 2VQEQ 1VZ6A 4C3HG 2Z0EB 4IOCA 1ZYRC 1ASZA 3A8IE 4B3RL 1XF5L 1V9PA 4EQ5A 3LXFA 1YN4A 3EFUA 2ZTDA 5IGCA 1PH1A 2RR9A 2I46A 1UBIA 2J7QB 2K8BA 4OO1H 1EEID 1YD8U 4B9KA 1OXVA 2D0PA 4K8JA 3U9SA 4A3JB 4KZ0A 4B0EA 3KUPA 1X3QA 3SVMA 1CT1D 3RLOA 4B3SQ 2R92G 1X6OA 5J3BA 4BA2I 1ISNA 4JWSC 1TZOA 5TR5A 3UE1A 2FHTA 4FN2A 3P75A 1DGJA 1RAXA 4H0LC 1V2YA 4MTKA 4B3TQ 1KAWA 3OSOA 2DUDA 5I9PA 3DLLA 1LTGD 1VCIA 2RKSA 5DNFA 4JL9A 2L1BA 3EJIA 3Q3MC 1AARA 1J8IA 4GDKB 2HQLA 1LTID 3PREA 1H9JA 1GKHA 1B4OA 1R4MB 1UEAB 4HVBA 4W9IA 4XDCA 1JC7A 2Q2IA 4GGQA 4YWLA 2ZJPA 4C7ZA 1QZEA 5KIXA 3B2GA 2NVYH 4LJOB 2PCFB 1SEBD 3BINA 2RPVA 4ABNA 5J2RA 1WOCA 1FJGQ 2F0LA 1TKGA 1Z5SB 2M19A 2WDRB 2K32A 4NAWA 1D4BA 3DCGA 1NEKB 2K5DA 4KV2A 4N59A 3L16A 1RCVD 3R2TA 2E76C 1HR0W 4A3EH 3X23A 1SR3A 1TT2A 2IBIB 2F0HA 2JWZA 3QR8A 2EYPA 5C0XI 1HJPA 3I57A 2EYMA 3I2ZA 1B53A 4LF5L 2ZNVC 2JZZA 4BFRA 5KHQA 2JXTA 1FD7D 1SNMA 2KUMA 2MO0A 3NVYA 2OF1A 3DM3A 3HOYB 2QHOA 4DR5L 4CKEA 4DV2L 4W9FA 4F1SA 2PE9A 4A20A 5FJ8G 1CZWA 3DM1A 2QW7A 1QQRA 2KDEB 3S17B 2MQHA 4B08A 4DV7Q 1HUNA 2B8FA 2F0SA 1YOVB 2GB1A 2I1KA 5C4XB 2J0JA 4DN4M 2R7ZB 5L95C 1HNZL 1KRTA 1CKMA 5IGGA 1S1QB 3V05A 3PGEA 3ZDMC 1JRUA 4HIMA 1A8VA 3V61A 4H44C 1OQRA 1JWMD 1X3GA 3VR5A 2MP2B 3SE0A 1IBMQ 2RCFA 4I7AA 4C1NK 4WWPA 2E2IH 2JYOA 5M3FH 3VA5A 1LM8B 3PLUA 1BBWA 3DHIC 2OTLA 3GTQB 1TKYA 2YTYA 1R4NB 2BH8A 3LWUA 3S2DH 3JAML 1Q82C 1WGRA 4B0MA 4TVAB 4MSMB 2MO1A 3RZDB 3URYA 4IFDI 4WWOA 2CQOA 3I4LA 1I6HB 1IKMA 1VZ8A 3FKIG 3M4PA 3OAWA 4IN3A 1KTKA 3DVNU 3MA2B 3J80E 4GOCA 3H91A 5EBCA 5I9OA 1V80A 4JI0Q 4FF4A 1FRRA 2XK5A 3MC9A 1DJRD 2PZTA 3NXWA 4C7YA 2RD0A 5JHAA 2B2YC 3GTOH 2RQXA 1G91A 4XXEA 3N1YC 3GZNI 3NZSA 3DBLB 1L1OA 2L11A 2OJWA 4OO1I 4DNTB 2W3SA 3TP8A 1YN5A 1GG3A 1WJ6A 4A3OA 2KWVB 4D2KA 4DNIA 1SNCA 4RG1A 3GV3A 2KX3A 2MWSB 1TWFB 1RIPA 4LNKA 2WKDA 1Y1WG 3Q3NC 1EIFA 1GUWA 2GVBA 1NR2A 2LHEA 3OJ3A 2QA4A 5IP7H 3L0OA 2RSNA 3H3VC 1KRHA 1C78A 2WU2B 3OG5A 4HIDA 5JEAG 3A7AB 5K5PA 3E5SA 3IFTA 3OIQA 3KYCD 1YNTE 3KF6B 1QZGA 1D1KA 3C3LA 1FIQA 2KTRA 1GNUA 2L15A 1HTLD 3MXUA 5ELDA 4NY0A 1HR0L 4UPAA 4K1RB 4GLVB 2WV6D 2ZVOA 3GQBA 3I3TB 2LRUA 1X3EA 1WZ0A 1W6KA 5AJ3Q 2ZW0A 5GAGC 1PV4A 2BVCA 2Q2HA 3PMFA 2O5JC 2N0SB 2M17A 4ZRQA 3DVGX 4L23A 3LYYA 4OVZA 3OOCA 5JOBA 3VRAB 4Y52H 3WIMA 4YTMB 4JV5L 4DV0Q 4BY7G 2WXMA 5TSSA 3RN5A 3TEZA 3NBHA 4EKUA 1PTOD 2B39A 4RM8A 4HROA 3K0YA 4HPMB 1Y14B 4DV5Q 4HJGE 5M5WH 2Z4HA 4DUZQ 4KGTA 4XT3B 2JXMB 3QG1A 3GTQH 4N9TA 1H9SA 1WE6A 3AFPA 1OTCA 4I65A 3I3CA 3NSWA 5ELFA 2N7DA 3TL5A 1GB1A 3TDQA 1WTHA 2H4OA 3VH3B 4HSVA 3U4ZA 4AH6A 4A3FB 2OJRA 3UDIA 1BUIC 3APFA 5G3LD 1VJKA 1L0WA 2EELA 5C44H 3LWEA 2UUBQ 3PUWA 2BGFA 4FF2A 1WX9A 4P75A 3D4WA 4G7ZC 1WD1A 2FUHB 3KBGA 4IPCA 1TWGB 3HOZB 3RULA 1PZID 4XWWA 3I90A 2A69D 2ONQA 2UXBL 2AUJD 4A4IA 1E7PB 2CH4W 4DHZE 5C3EH 2KK8A 3P4SB 4L6TB 4GLAC 1WJUA 4AQ7A 2O2LD 3AE8B 2IYDB 1BCPB 2M00A 3UE0A 3HOUG 3TS2A 2NBVB 3OTOL 4M8AA 1LTRD 2WXGA 2N9PC 2M2LA 2IPKD 3PF4A 2QGQA 5LL6S 1IUEA 2K5PA 3L0WB 1ESFA 1E2VA 4M0WB 1LLRD 5LNK1 1TWFH 1PTOC 3TEXA 1UE7A 2F52A 5IYDG 4PMCA 1C4CA 4ICVA 4DHZB 4O2DA 4C3HH 1PA6A 2A4ZA 4A3KG 3PO3B 4A3LH 3PIP3 1STNA 3GTJB 4Y7NB 3AEBB 2VB3X 2EJFC 3HS0C 3HOXB 4IWQA 4K3BA 1F2YA 4KHPQ 2K5NA 4LDTD 3T1HQ 3TREA 3X3MA 3HEJA 3NTIA 1X9NA 1TWCB 5JJLA 1G8ZD 1K8MA 2KQ4X 5C6AA 1N5XA 4RMFA 4BS9A 2FCNA 1VDZA 5JVG3 2LXAA 4OVVA 3KF6A 4JC0A 1XO3A 2R92H 2V9HA 3S2AA 2IZVB 4LJPB 2FNJB 4R4QA 1VZ7A 3STBC 2EJGC 1Z2MA 1S5CD 1WXVA 4KK7A 2A73B 3I70A 4AYBG 4OZCA 1O7YA 1GUNA 2A69C 1TWAB 4IUPA 4K7UA 4DA2A 1FVIA 2QILA 1SYBA 1J8CA 2D2CC 4KY5A 4FULA 4HN7A 2EE1A 5D65A 1MJDA 1ZOYB 2DZMA 1JWUD 1GPXA 4A9AA 1RM6C 3MFGA 1IPGA 2B2VA 3FPPA 1VF5C 4LFAL 1SYEA 2VQFQ 3A8JE 2AWTA 1JCKB 2RSOA 5BYSA 4S0RA 4KKUA 2WS3B 1NE3A 4J1MA 3S24A 4XE0A 3H3VI 4QUFA 1Q86C 1OO9B 1XCTL 1IBKL 3VR2A 1NSNS 1XQQA 1VMCA 2D3BA 1T9HA 2L1AA 1Q1OA 3IXSA 3IVFA 3PIOA 3NHEB 2C9WB 4XGAB 4PS3A 1K8AC 1WI5A 4B9WA 2F0MA 5JAVA 2H88B 3IBEA 5CHVC 2AMCB 1P3QU 3N32A 5LMUL 5H8YE 3PZ7A 1SMYD 1YN3A 4F8MA 3DQVA 1WRIA 4JX1C 2Y0SE 4BKSD 3E9IA 3T4AC 3S1RB 4A90A 2KANA 1PGBA 3NK9A 4K7WA 1YHQA 4XDXA 3IAS1 1VQEA 3M3YH 5G2NA 2L52A 3M3JA 4JPSA 1II3A 2F0WA 4ILWA 3KH0A 3K7AB 4A3CG 1KDAA 2AX5A 2J0KA 5E4WC 2GRIA 2KJXA 3H0GB 5FJ8H 3KYHC 4DDGD 4DK6C 3LGJA 3JVZX 1QT9A 3RUIB 3WDNA 3R8BA 1JQ4A 3C1EA 3C46A 4HPPA 4FJZA 2L0CA 3I4MH 4F8CB 1IYUA 3FPUB 3ZNZB 4K3CA 4KZCA 4POGA 3SHLA 2FXQA 3ULLA 3V2TA 2JRIB 2PIAA 2WP9B 2XTIA 2WGSA 3F8TA 4II2B 3CHBD 3J81L 4A3BB 3X0WA 1STHA 3UI2A 4RWSC 4FYDA 3A0JA 1NDDA 1N33Q 1HNXL 4JGHB 5M3MB 3WANA 2AKWB 5JVH3 2L3ZA 1VQOA 1V1OA 1XEEA 2E2DC 2EYLA 2QC8A 3GTKH 3MXGA 1JWSD 2IGDA 4B3RQ 1SMYC 1VS0A 3TUOA 4F7ZA 3S1QB 1YQ4B 2V1CC 4PYZA 1TWHB 5CTRC 2J53A 4NB3A 3FKIH 1CKOA 3PO2G 2ZEQA 2K22A 2VS1A 1BO0A 2QDFA 3VR9B 1KABA 4K6DA 3SEBA 5GMVA 4P73A 1ZGUB 2WXJA 2OHFA 1HA5A 1C0AA 3I9V1 4P6VF 3E3XA 1QVGA 2HJ1A 3WALA 1EIHA 4LNIA 4B6WA 1WCMG 2N9LA 1M8AA 3B2FA 3N3KB 2KYWA 2YLMA 4BBSG 4KSKC 1OTRB 3D8GA 2ALYB 1KFYB 1K83H 2WB1E 3HOWG 1V97A 3NVZA 4GNXB
chains in the Genus database with same CATH topology
1A3TA 1EY6A 1IW7C 2B63B 3R93A 1NI3A 1U4PA 1C48A 4OHJA 1MI2A 4GZYC 4IKGA 2H1EA 4NAMA 1T5EA 3ETRA 4A55A 3SK4A 3EUB2 4KHVA 1EEFD 5FOBB 1SNDA 5JEAH 3AV8A 5AUKA 3IT4B 1SSNA 3CQZB 3G6JB 1IBXB 4R9WA 3IAM1 4MM3B 1CI3M 3KLSA 3I4NB 2DYMA 1FXIA 2JA6B 4XTCS 2K0PA 2F1MA 3ONAB 2B2TA 1I4GA 2TSSA 1WTPA 4L63B 4FXKC 4NMZA 2GI9A 1EOTA 1Q3LA 5ELBA 1CA6A 1K50A 1KNEA 5HFYA 1STEA 4QB4A 2IX1A 2F0DA 3F2UA 2F0FA 1ENFA 1HFGA 2DNEA 1FFVA 4LLGM 5EJWA 4UAIA 5CORA 2JA8B 1P7EA 2H89B 4OZBA 3BK1A 1PZKD 2KDMA 1EQVA 4HEDA 4A3DB 5KEEA 1HRJA 1MBYA 2WXPA 3L9AX 3QOLA 4V190 3L4PA 1EFID 1NAPA 5D3DA 3RZOB 1SE4A 1L0YB 3I8ZA 4Q5VA 2YEPF 1YJJA 2E74C 2Z4IA 3E56A 4ARIA 2L5TA 3RD4A 1F9SA 3P4QB 3H8HA 2E75C 5T1GA 2L32A 5BYRA 1WTQA 1FMAD 2K5WA 4RGNA 5IGBA 1DM0B 4ULLA 1UAPA 1FYCA 4K8IA 2ICEC 4IUTA 5J39A 4WWMA 3KLSX 2Q8TA 3KQ4A 2G9HD 1WVLA 3G7LA 3DWGC 1Q12A 4F7XA 1Z47A 4YSYB 4HRSA 3RLFA 1B9RA 4WIPA 1LTBD 4CBVA 3D4RA 2F0TA 2FFKB 2PMVA 2F0GA 4DXFA 3IKJA 2VNUD 2WXFA 1ZXIA 4C2MB 1JOKA 1S5ED 4QCLA 2KWDA 4NJCA 2BS2B 1QKZA 2N55A 1TS2A 2EZVA 4BWGB 1XXGA 3NUHB 3MHBA 2PLPA 4XWTA 4RKLA 1C4PA 4J8QA 1O80A 2KQ3A 3PIO3 1HA6A 4RNAA 1DD2A 1N62A 4HTHA 5KNBA 1NUCA 3DXJC 5HURA 2NVYB 1CTMA 2K01A 1QOFA 1HQMC 3VA7A 1FCCC 2CVRA 5EE3A 3HRZC 5NUCA 4MN3A 2LMCA 3Q8AA 5MPOA 2WXOA 5EPJA 1EY0A 1VMPA 3DWQA 1QB5D 4A3EB 2MJ8A 2BDNA 4KV6A 5FK9C 1CHPD 5M5YB 2MH7A 3P1HA 3GV6A 4LAAA 3P4RB 2EXZA 4US8A 5DAUA 3I73A 5E3FA 1C4QA 1ROEA 1U9RA 2HDEA 1GXDC 1HCZA 3FC4A 1EQTA 3BDOA 5FO8B 5IIFA 3CIRB 2QCPX 1V8QA 4MT5A 1V1PB 2CQAA 1LT3D 1O78A 3C8YA 3W9CB 3DWAA 4IALA 3BK2A 1CHQD 5C5MA 4B9XA 4JBWA 3PUXA 1I4XA 4RGMA 2E2IB 3NP8A 5M3FB 1J7CA 3V96A 2A6ED 2INPE 1FR3A 1WTVA 2N7JA 4K5XA 3S2DB 4JK1C 1TY2A 5FKAC 1B9MA 2L9HA 3L3OC 1PRTD 1QNKA 2C5CA 2J0TD 2K05A 1E6EB 4H13C 1D5MC 1IL8A 5GXGB 1PDQA 5EPLA 3T3NA 4IUQA 2BE5C 1WXQA 2PVGC 3GTOB 1EWCA 2FUG1 1DOXA 3E9SA 3TP7A 4LTUA 1C8CA 4OZAA 2IX3A 2IL8A 1WYGA 1MD2D 5JJZA 2EY5A 1MHXA 1DXMA 3EGRA 5KNCA 3D31A 4IQZA 3GP7A 4OL7A 3PZ8A 1F9RA 3OW7A 2MP1A 4IUNA 2XIWA 4RAUC 4KGRA 3VYRA 2KVMA 4GLSC 2PPBC 1EU3A 4K6LA 1RDPD 1HQRD 1JROA 3DEPA 5E6JA 2A6EC 1EYDA 2SDFA 3MZ5A 1VDVA 4DK1A 4LJZC 2IT1A 3V3XA 3ABVB 4F88A 5J1ZA 1WTRA 1EU4A 3TP5A 2BOSA 1Q8IA 3BDLA 1ENCA 1YJIA 2MUYA 1DOKA 1V1PA 3J7AV 2XVSA 1SE2A 4C3JG 1H9SB 1G291 1G2TA 5C2TB 4IDIA 5BN4A 5M5WB 5FR3A 2QDBA 2D9UA 3Q8BA 2WAQB 3A8KE 4WRDA 3NS1A 3PO0A 3P4PB 1KF6B 3BS1A 2LS01 2M56B 5C44B 4J3OD 2V3NA 1SBBB 5BMHA 4ZUJA 2BA0A 2JE6I 3RUZA 4EVOA 4V0BA 3EQLC 2X6LA 3VRBB 5EE0A 2F0QA 1ICWA 5C3EB 3EROA 3Q8CA 2VZKB 2GA4B 3SDZA 2KCNA 1HEZE 4RCNA 5ELEA 3M7GA 2V0GA 4L1BA 2WACA 2KCCA 2B2YA 3ERQA 4IUUA 3PUYA 3MXNA 3EA6A 4ZK9B 4C3HB 5A2QL 1TKWB 1STBA 2LJIA 1WTOA 5CV4A 2L83A 1AEXA 4O1NA 3H94A 1FD6A 3U7ZA 3NZ3A 3VYTA 4DNRB 4YWGG 3CKIB 4TMAB 2R92B 4TKOB 2WU5B 1U4MA 4CKBA 4DAYA 3SFEB 2F4IA 1CQVA 1RODA 2EOTA 1PTOF 1Q1EA 1TQOA 3NPPA 3LNNA 3Q0AA 2ZW1A 3DEOA 4TQUS 2PVOD 3Q8FA 1UNSA 4HKQA 4RHRA 1ET9A 2E2HB 4FF3A 4RF1A 3O13A 5IGEA 1QOHA 2YYZA 1QCBD 3X3NA 2V3PA 5G3LF 3WOFA 3Q22A 1F2LA 1FGBD 2JX5A 1TIID 4JWUC 3E0JA 5G5GA 4A8XC 4OIKA 3TN2A 1TY0A 1PFBA 2FMCA 1A2TA 1MPEA 3D6CA 3M3YB 5D3IB 2PO4A 1E2ZA 1F9PA 1TYGB 3I91A 3KWLA 1NCVA 1ZEQX 2MJ3A 4HMIA 3AEEB 4XQJA 4K2LA 4PQXA 2F0EA 1D2BA 3MVVA 1LTSD 4C3IG 2PMZB 3I4MB 3BWUD 2W54A 2C9OA 4KX6B 2R61A 5D14A 2ZT9C 3HVZA 4G7HC 1J9OA 3C1FA 1D5ZC 3S9WA 1PTOH 1KNAA 2NBFA 1EY5A 1Y8NB 1I4RA 4WH4A 1ILPA 2HDLA 5DM73 4US9A 4G4KA 1TS5A 1SNPA 2PKOA 4EE2A 3GTKB 3K5OA 5CV5A 3AMUA 2I38A 4KKJA 1WTXA 3Q8EA 3FKIB 2DY7A 2NZ1D 1S4ZA 1BCPD 1EY4A 1FM0D 2NN6G 2CHBD 4FP5D 2IGHA 2DN8A 1OQQA 1PFNA 2JWUA 3AE1B 2B2VC 3RPFC 5E4XA 2WLBA 4ZUIA 1GB4A 1R4PB 1K83B 4KY6A 1HXYD 3DWPA 2NB0A 5KRUA 1F2ZA 5I6WA 2ACZB 5C3JB 1SYFA 1JE4A 1OXSC 1T3QA 2JQRB 1C9FA 1YNJD 4S3SA 1SJED 2B2WC 1ZUD2 2K7VA 1XLOA 3R3OA 3Q6SA 2YU9B 3P7JA 2X69A 1HZ5A 3Q24A 1RD9D 3MP9A 2NVQB 1RYJA 2O5IC 1Y1VB 2BA1A 3KLRA 1R9TB 2SAKA 1OXUA 2IJ0A 1MI0A 3D4DA 5CGKA 4K14A 3QJYA 1GHJA 2XNAC 4KKIA 1LACA 1EWHA 3NTKA 4EQOA 5BN3A 4BY7B 2Z8LA 2LFIA 2XRSD 3NWTA 2AUKA 4WURA 2Z1CA 3S2HB 1S5DD 1I4HA 4G57A 4FXCA 2CW0D 2B8GA 4X3KA 1YNJC 1RFKA 4KI0A 4XQQA 2F03A 3KBXA 1ML0D 3SK5A 2WQYB 1CM9A 2I2YA 2AQ1B 2DLBA 4H2AA 4HAEA 4I7ZC 4NZLB 2R3ZA 3AE2B 3DWMA 1BXTA 2IX0A 2F0KA 4QMGA 2NUCA 5KYIA 3E6ZX 1CZPA 1Y56A 3K58A 2INNE 2JSVX 5BMGA 4HCSA 3HOUB 3RMHA 1P7FA 2KHSA 1MSHA 1X3PA 2B2UC 3HP3A 2JYEA 3DMUA 2BCOA 4OW0A 3S1MB 5C3WA 1SB3C 3W3AA 1AW7A 2WDQB 2WIIB 3TP6A 5EE9A 2A5HA 1E0ZA 1K52A 1Q1BA 4RF0A 2DY8A 4MACA 1RF2D 2WXIA 2MPMA 2XN9C 4E6IA 3K5MA 1CJEA 5JPNC 4IZ8A 1D5XC 1WGKA 4UDUC 2LFNA 3AE3B 2FJ2A 3AE6B 5FO9B 4GDLB 3FVQA 2K6AA 2MJDA 2MJEA 1JR0D 1XLPA 4AYBB 2G1EA 3J80L 3HG9A 2XWBB 3AU7A 2FINB 4USAA 2D62A 2FMMA 2KOLA 1IYVA 1H9MA 1XLQA 3BIID 1XX8A 5F2DA 2EY2A 2KEDA 4KN4C 1G6ZA 1STYA 3CRLC 1V43A 1NYQA 1E0BA 1K51A 3U9OA 4WORA 4N6EB 3OHXC 3JAME 2K28A 1XWEA 1NENB 1OXTA 4KN7C 1PDXA 3W1SA 3I72A 2SNSA 5LHY1 2JZPA 3AEAB 3NWSA 2DYOA 5EGTA 1MSGA 4HSPA 2HTME 3K57A 1G2SA 1CZGA 4ZLTF 1JORA 2OT2A 2LMCB 4L2YA 5I2YA 3AEDB 2KEEA 3D3RA 1DOIA 2EYJA 1GUGA 4KD3A 2WINB 3GD7A 1EYCA 5HGTA 1SYCA 1TKEA 3A7LA 2NVXB 1I4PA 3BVZA 4OGQC 2WXKA 4Z9CB 5IOCA 5C0XJ 1AP0A 3T56B 3TEYA 2JYTA 2WP8J 1Y8OB 2MGSA 1OFFA 3BYTB 1SXTA 2PW7A 1GJXA 3PO2B 3AECB 1O7LA 1I7HA 1DOYA 1KDCA 1L5PA 2AWNA 2EKIA 1L0VB 4YSXB 1GUTA 1K53A 3VR8B 3VYUA 3B9JA 3AN1A 3P63A 2K04A 1WCMB 1H9KA 1ZDXA 2WXRA 2JEBI 2NTTA 2M9VA 1OXXK 1BUVT 4PMWA 2V4DA 2R93B 3SR1A 1DOLA 4WQMA 4XT1B 2SOBA 2Q8RE 2F3VA 5EPKA 2ZXRA 3RFZB 1VLBA 3J7AF 2KA7A 4FF1A 1U4LA 4A3MB 5CBEE 1B2TA 4IFDJ 3M4OB 5D7GA 1SJHD 3QO2A 2ID0A 4ITKA 3MXPA 2EYHA 1A2UA 2HUGA 1IGDA 1RTNA 1B44D 3A55A 3MHZA 1FFUA 4ME5A 1JICA 1D1IA 1R7SA 1SYGA 3T51B 5EKIA 4MHEA 5AUIA 5JXVA 3QIAA 4KY7A 4YT0B 2KMMA 1BR9A 5JPMC 3M7NA 3AM9A 2PW5A 2BDOA 4HCEA 2QKIC 3N6RA 1SSOA 3EVQA 2X6GA 1HUMA 2NYZD 1SFOB 4AS1A 1KDBA 1ZPSA 2RBMA 2RVLA 3L7ZC 3U2SC 4EQNA 5CV6A 3ZJTA 5ELCA 3R2IA 5HHDG 4XDDA 2M0AA 4R8NA 3IL8A 3MEHA 3LX0A 4PT5A 1EWYC 3QWNA 4Q0FA 1MGSA 1CK1A 2QSDA 1ZDVA 3ND9A 1F2RC 4BY1B 5CC4A 2F0PA 4P2CB 4DQOC 4FVMA 3BG3A 1ZE3D 1QILA 4WJWA 1UUPA 3ZJVA 2F3WA 3AE9B 2NTSA 2XWJB 1PRTF 1ET6A 2NN6I 1IGCA 4P16A 1HHVA 4ODGA 3FEWX 2BB5A 2JA7B 5IT9L 2N88A 4DAVA 2Y5PA 4MH8A 4BA1I 5I4DA 4QUCA 2D5DA 1FNUA 3AB9A 1FNVA 4MIUA 2JA5B 2OEDA 4ZOHC 4TSSA 1QE6A 2BYTA 2J52A 1EYAA 5C4JB 1XYIA 1VF7A 2F0NA 5C3XA 3HRDD 3J81E 3U52E 3FAHA 3H09A 5I2XA 1E2WA 1B9NA 2RDFA 3GTGB 4CHTB 1PUTA 1PFDA 2A6HD 1STAA 5LL6X 3TZDA 4DU9A 1TVXA 5KGUA 4Q2JA 1AFPA 4U673 1EIGA 3K5NA 1PMRA 2EPBA 4KKSA 1CA5A 1SNQA 2BB6A 1PRTC 3MFYA 3QB3A 4ZHPA 1BF4A 1BNZA 1DOMA 4FNFA 2ON8A 3SFDB 1N63A 3AMZA 5M9OA 3PV0A 1E10A 1KAAA 1LTAD 4C56C 3NUCA 1ZXHA 4YIJA 2K03A 1MHHE 3P42A 3AE4B 3FILB 1EZ6A 1L6UA 3BVMA 4ARCA 4X3SA 3BVGA 2PTLA 1NR4A 1UGJA 2AQ3B 1AWDA 3GTMB 4WFN3 3W5UB 1A3UA 3Q23A 3HZXA 1FO4A 3HGBA 4TQ0A 1QG7A 2A6HC 1E9MA 3GTPB 3SK6A 2DWQA 2J42A 1GUOA 2JP1A 2E3TA 1EY7A 2F0UA 2DNCA 2N9KA 2BBCA 1Y69U 4ID6A 4KHZA 4NP5A 2Y5CA 3OWEB 3GTLB 4N9PA 1XTCD 2LHDA 4YSZB 2VXWA 4BBRB 1Z6HA 3CU7A 4G7OC 1F2RI 2ZXOA 2PQEA 1KLUD 1EZ8A 3S1NB 2EY1A 1ZP0B 1PTOB 1WWTA 2CJNA 3AEGB 1TS3A 4YTNB 3GB1A 5BMIA 2PNRC 2LKVA 4H7BA 1L0XB 2WXHA 1EY8A 4F87A 1STGA 3K6OA 5DM63 1MVKA 1A15A 3TZUA 1AZPA 1YNND 2BT6A 4WAFA 4RCOA 2VZKD 2NWGA 4ZQ3A 1QOGA 2Y3AA 4L8JA 1S5FD 2NVTB 1CFMA 4YTPB 4XYOA 3SR6A 4DFAA 3TBIB 3EFXD 4XQNA 1JWAD 2JU6X 3P1MA 3FILA 1WD0A 1PZJD 2R6GA 5BYQA 4KD4A 3GO5A 3VR6A 5A35A 1CQFA 1GOZA 1A70A 5EBDA 4X3TA 2KAJA 2PW9A 4QIWB 2WXNA 2QIEB 4ZYSA 1SIJA 1UWXA 2IGGA 1J7AA 1I3QB 3CRKC 4ZKBB 4YXDB 3OPOA 3MJ5A 2IWHA 4RA8A 4A6QA 3J9CA 2E2JB 3AB5A 2CU3A 4EGVA 4C80A 5KNDA 2K1BA 2L4NA 2W55A 4PNYA 1ACCA 2K9XA 1SAPA 1YNNC 2AQ2B 4KJNA 2F0OA 3ZQ4A 4KGSA 4K2KA 1B1ZA 1LT6D 1HFNA 2L12A 3VR4A 3M4YA 1DONA 3IFDA 4C3JB 4CJ0B 3QOJA 3K59A 5DEHA 3VQIA 4K5VA 5FLXL 3NQTA 4A3IB 2QMTA 2W3RA 3N9YC 2KN4A 3BDCA 2KACA 3S16B 2QEJC 4LMQD 5K36G 1LT5D 1YMHE 4HMJA 3J7YW 5CBAE 1EY9A 1LABA 1BCPF 2Q8IB 4LK0M 4PMBA 2EDGA 1NYRA 2ENBA 2HDMA 1RWSA 3NRZA 4RGOS 1ZKOA 4A93B 3LB8C 4FO2A 5T1IA 3PUZA 2K3UA 1RJTA 5BN5A 2LUMA 1N60A 1SF0A 2WDVB 2HCCA 4CQNA 4IURA 4RGTA 2CJOA 2EYOA 5T8IA 2KECA 1J7BA 1Y1WB 2Q5WD 2VB2X 1N61A 4ZHOA 4J6HA 1C76A 3AE7B 1UWMA 4FXDA 5EQ0A 3IAYA 3TEWA 3MAQA 4LK1C 3MC0B 4TRDA 4K5WA 2B2WA 4RHSA 1Q90A 2MEKA 2LEKA 4R8IA 1I6VC 3NHHA 1BCPC 3D6WA 3GS2A 1L4DB 3ITPA 5C0XG 2RDHA 2BS4B 1QOAA 1Q10A 1JALA 5C4ZA 1RTOA 3A54A 1C77A 4RFBA 2G9DA 1TR5A 1TJEA 1QJOA 2A74C 4OIJA 4KMUC 1LT4D 5JEAJ 1PGAA 2Y0SB 4IUVA 3KWVA 1IW7D 2WKCA 2VUMB 1B3AA 2A68D 4M0WA 2F0JA 4QF4A 2EYFA 2ICIA 5M5XB 1QNUA 3OIPA 3C2PA 3UI3A 1PGXA 3ZYYX 2MHVA 2PZUA 4DGZA 2NMQA 4O42A 1LV9A 5IT9E 2JSOA 1AZQA 5J22A 4DF7A 4CKCA 1ENAA 4HKZE 1WTWA 3NBIA 4IFDG 3HOVB 1W6JA 5HG2A 1EM7A 4C3IB 1B50A 1BQQT 2WXQA 2EJMA 2RMMA 2FE8A 2HQEA 4A3KB 4ZAIA 4FXGC 3PUVA 2CW0C 2B2UA 1ZXTA 3CWIA 1HZ6A 1FEHA 5CV8A 5HI1A 1TS4A 2DBYA 2A68C 5IODA 4OO1G 4HR7B 3N52A 1F77A 2AWOA 1WSPA 3FDTA 1JMLA 1K8OA 1O7ZA 1XLNA 1FRDA 2JEAI 2FBWB 4EQPA 2B2TC 1AN8A 2WB1B 4M1UB 3T13A 3A56A 1C4AA 3NE5B 2J7ZA 1DZ1A 4DK0A 1L4ZB 4REZA 3M85A 1JB3A 1SE3A 5FO7B 1PLFA 1IHZA 1GAQB 4ZRPA 4X3UA 1U4RA 2PZWA 3MWYW 3DHQA 4TQ1A 2HCIA 3OMGA 2YEPB 1QLBB 3T3OA 3OWFA 2LGIA 2TMPA 2B76B 4NDXA 1SNOA 1PFMA 1RKNA 4IOIE 4HEA1 1JWBD 2K5QA 3AH7A 3NVWA 4NKLA 4KTAA 3T16A 1HTPA 4ZRZA 2F0IA 4U68A 2IDYA 5EE1A 1F2MA 3IT6B 5CMDA 5A2QE 3VYSA 1SYDA 2E6XA 3S14B 3SXHA 3AE5B 4C1NI 4DAPA 5COYA 2EVBA 2QJLA 2O4XA 3KF8A 4JE3B 3WOEA 3H6MA 5IGDA 5K36H 1I50B 1FNWA 3MTSA 4ZKCB 1LO5D 1PYWD 1Y8PB 1BDOA 1JRPA 2XSCA 1KLGD 2NN6H 5CV7A 4XYQA 1VR9A 1PXUA 2K33A 1L6VA 1F9QA 5IGFA 3P20A 1C79A 1R4QB 3ZJUA 5C4HA 4BBSB 2EY6A 1IBXA 3NQIA 2OEOA 2BTEA 3HOWB 4XIGS 1DCZA 1JW9D 2V4IB 1JQYD 1HPCA 2QF7A 1V8CA 2RDGA 2WNMA 5H92C 5AFWA 1KH0A 1VRAB 3VR3A 3FMCA 4KJOA 1T6BX 2WXLA 5ISRA 1H9RA 3Q69A 2I07B 2L55A 1I4QA 4DXGA 1S5BD 1QOBA 1X32A 4RKBA 1BMLC 1DYQA 3NTHA 3TMEA 1A3VA 1TU2B 2SEBD 1F0ZA 1GHKA 2W82A 1BOSA 1EL0A 5C0XH 2LY7A 2OXPA 3FRPB 3SK8A 1N5WA 1ONLA 1Z7TA 4R3DA 5EKLA 1LTTD 2PYKA 3HKZB 4CGYB 3KK7A 5E1FA 3WCQA 1ILQA 4A3GB 1D6EC 3K5LA 1ZYRD 4CJ2C 4NAWB 2XRQD 4KKTA 4NW2A 5FLXE 1NVID 3ZGZA 1QF6A 4N58A 3W5VB 1YQ3B 3TSSA 4PV1C 2X38A 1QWYA 3BZDB 5C5LA 2F0VA 3AEFB 3ND8A 3U4EG 1FCLA 1M4VA 1SDFA 5G5HA 1JOOA 5I6YA 1XCQL 3T53B 3DUZA 1PRTB 1ESRA 2SNMA 1A6XA 2J4XA 2IW3A 3OMCA 2BS3B 5CR3A 5KYLA 2RA4A 1JOQA 1IKLA 1BBXC 3S15B 1RHPA 2D5GA 2BE5D 1FXAA 1GUSA 3HUIA 1AYFA 4RH6A 5EKKA 2BW2A 4IFDH 2ZXPA 5CYUA 1T5XD 3W2DA 4CJ1B 5CV9A 3BYYB 1VZ6A 4C3HG 1ZYRC 3A8IE 1XF5L 3LXFA 1YN4A 5IGCA 2I46A 4OO1H 1EEID 1OXVA 4K8JA 3U9SA 4A3JB 4B0EA 3KUPA 1X3QA 3SVMA 1CT1D 4BA2I 4JWSC 1TZOA 2FHTA 3P75A 1DGJA 4H0LC 3OSOA 5I9PA 1LTGD 1VCIA 2RKSA 5DNFA 2L1BA 3EJIA 1J8IA 4GDKB 1LTID 1H9JA 1B4OA 1UEAB 4XDCA 1JC7A 4C7ZA 5KIXA 3B2GA 2PCFB 1SEBD 2RPVA 4ABNA 2F0LA 1TKGA 2M19A 2WDRB 2K32A 1D4BA 1NEKB 2K5DA 4N59A 1RCVD 3R2TA 2E76C 1TT2A 2F0HA 2EYPA 5C0XI 3I57A 2EYMA 1B53A 2JXTA 1FD7D 1SNMA 2KUMA 3NVYA 2OF1A 3HOYB 4CKEA 1CZWA 3DM1A 1QQRA 3S17B 4B08A 1HUNA 2B8FA 2F0SA 2GB1A 5C4XB 4DN4M 2R7ZB 5IGGA 3V05A 4H44C 1OQRA 1JWMD 3VR5A 3SE0A 4C1NK 2JYOA 3VA5A 3GTQB 1TKYA 3LWUA 3JAML 4B0MA 4IFDI 3RZDB 3URYA 3I4LA 1I6HB 1IKMA 1VZ8A 4IN3A 1KTKA 3MA2B 3J80E 3H91A 5EBCA 5I9OA 4FF4A 1FRRA 1DJRD 2PZTA 3NXWA 4C7YA 2B2YC 2RQXA 1G91A 4XXEA 2L11A 4OO1I 4DNTB 2W3SA 3TP8A 1YN5A 4D2KA 1SNCA 3GV3A 1TWFB 2WKDA 1GUWA 1NR2A 2LHEA 2RSNA 3H3VC 1KRHA 1C78A 2WU2B 5JEAG 3A7AB 5K5PA 3E5SA 3IFTA 3OIQA 1YNTE 1D1KA 3C3LA 1FIQA 1HTLD 3MXUA 5ELDA 2WV6D 3GQBA 2ZW0A 1W6KA 3PMFA 2O5JC 2N0SB 4ZRQA 4L23A 3LYYA 4OVZA 3OOCA 5JOBA 3VRAB 4YTMB 2WXMA 5TSSA 3TEZA 3NBHA 1PTOD 2B39A 4HROA 3K0YA 4HJGE 2Z4HA 4KGTA 4XT3B 2JXMB 3QG1A 4N9TA 1H9SA 4I65A 3I3CA 3NSWA 5ELFA 1GB1A 3TDQA 2H4OA 4HSVA 4A3FB 1BUIC 5G3LD 1VJKA 2EELA 3LWEA 3PUWA 4FF2A 4G7ZC 3D4WA 1WD1A 3KBGA 1TWGB 3HOZB 1PZID 4XWWA 3I90A 2A69D 2ONQA 2AUJD 1E7PB 3P4SB 4L6TB 4AQ7A 2O2LD 3AE8B 1BCPB 2M00A 4M8AA 1LTRD 2WXGA 2M2LA 2IPKD 5LL6S 1IUEA 2K5PA 1ESFA 1E2VA 1LLRD 5LNK1 1PTOC 3TEXA 4PMCA 1C4CA 3PO3B 3PIP3 1STNA 3GTJB 4Y7NB 3AEBB 2VB3X 2EJFC 3HS0C 3HOXB 1F2YA 3X3MA 3HEJA 3NTIA 1TWCB 1G8ZD 1K8MA 2KQ4X 5C6AA 1N5XA 4BS9A 1VDZA 5JVG3 1XO3A 1VZ7A 2EJGC 1S5CD 4KK7A 2A73B 3I70A 4OZCA 1O7YA 1GUNA 2A69C 1TWAB 4IUPA 4DA2A 2QILA 1SYBA 2D2CC 4KY5A 4HN7A 2EE1A 5D65A 1ZOYB 1GPXA 1JWUD 4A9AA 1RM6C 3MFGA 2B2VA 3FPPA 1VF5C 1SYEA 3A8JE 5BYSA 1JCKB 2RSOA 4KKUA 2WS3B 4J1MA 4XE0A 4QUFA 1XCTL 1OO9B 3HVDA 3NVVA 3VR2A 1NSNS 2L1AA 1VMCA 3IXSA 4B9WA 2F0MA 5JAVA 2H88B 5H8YE 3PZ7A 1SMYD 1YN3A 4F8MA 1WRIA 4JX1C 3T4AC 3S1RB 4A90A 1PGBA 3NK9A