2XN9C

Crystal structure of the ternary complex between human t cell receptor, staphylococcal enterotoxin h and human major histocompatibility complex class ii
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
215
structure length
215
Chain Sequence
EDLHDKSELTDLALANAYGQYNHPFIKENIKSDEISGEKDLIFRNQGDSGNDLRVKFATADLAQKFKNKNVDIYGASFYYKCEKISENISECLYGGTTLNSEKLAQERVIGANVWVDGIQKETELIRTNKKNVTLQELDIKIRKILSDKYKIYYKDSEISKGLIEFDMKTPRDYSFDIYDLKGENDYEIDKIYEDNKTLKSDDISHIDVNLYTKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of Superantigen Complexed with Tcr and Mhc Reveals Novel Insights Into Superantigenic T Cell Activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords T CELL RECEPTOR ALPHA CHAIN C REGION
total genus 70
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2010-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
C PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2xn9C02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2xn9C01
4RGMA 3BYYB 1KLUD 1YN4A 1LT5D 1FD7D 2NTTA 1AN8A 1PTOF 1LTTD 1YN5A 1I4QA 1LTRD 4RHSA 1B1ZA 1RD9D 1EEFD 1TY2A 3EA6A 3R2TA 1LTID 1V1OA 4OHJA 2IPKD 1HTLD 1TY0A 1AW7A 4UDUC 1BXTA 1PZJD 3TSSA 1JWMD 1SE3A 1TS3A 1S5ED 4RGNA 5ELBA 4NZLB 1KTKA 1D6EC 4K6LA 1BCPF 1L0XB 1LT6D 1FNUA 1JWSD 2XNAC 3EFXD 3OWEB 2ICIA 1B44D 2NTSA 2XN9C 1I4XA 1JWUD 3SEBA 1BCPB 1S5FD 1HXYD 2G9HD 1JCKB 1LT4D 1BCPD 4L63B 1KLGD 1EWCA 1I4HA 2O2LD 1ET9A 1LTBD 1RF2D 2RDHA 3MFGA 5ELEA 1FNWA 3W2DA 3R2IA 1JQYD 3BYTB 1ET6A 4O1NA 1UNSA 1CK1A 1XTCD 1I4RA 4RCOA 5D3IB 1T5XD 1SBBB 3CHBD 3O13A 1S5BD 3DWAA 1EFID 3BVZA 5I4DA 1V1PB 1PTOB 1PRTD 4RGOS 4C56C 1EEID 1FNVA 1PRTB 1MD2D 5ELDA 1I4GA 1LTAD 1LTSD 1CHQD 1RCVD 1PTOC 1TS2A 1S5DD 1SJED 3GP7A 1TS5A 4ZYSA 1YN3A 1SXTA 1I4PA 1RDPD 1PTOH 1F77A 2TSSA 1SEBD 1PZKD 1HA5A 1D5MC 2AQ2B 1ESFA 1PZID 1ENFA 1PYWD 1LT3D 4TSSA 4DXFA 1L0YB 3DWPA 4RFBA 4RH6A 1XXGA 3BVGA 3BZDB 1SJHD 2R61A 3V05A 2SEBD 3BVMA 1STEA 3DWQA 5TSSA 1GOZA 4DXGA 2QEJC 1PRTC 1TS4A 5ELCA 5D3DA 1PRTF 1S5CD 1G8ZD 1SE4A 1UUPA 1DJRD 3MC0B 2CHBD 2Z8LA 1CHPD 4L6TB 2AQ1B 1D5ZC 2WV6D 2J4XA 1DYQA 4RGTA 1CQVA 1LTGD 2AQ3B 5FKAC 1QILA 5ELFA 2IJ0A 1HQRD 5FK9C 2RDGA 2XRSD 3URYA 4BWGB 1FGBD 1EU4A 4Z9CB 1JR0D 1V1PA 3R8BA 2QILA 1EU3A 1SE2A 1M4VA 1LO5D 3KLSX 4RHRA 1CT1D 2XRQD 1D5XC 1PTOD 1LLRD 1BCPC
chains in the Genus database with same CATH superfamily
1CM9A 5E4WC 3VQIA 2K28A 5HGTA 5HGQA 1EM7A 3N1XC 3RNBC 4QIWB 3DM3A 1B7YB 5BMHA 2I46A 2VZAA 4DK6C 1GM5A 2WP9B 3M4QA 5C6AA 3KVFB 3MA2B 2L12A 1I42A 3WAOA 4W9KA 2V4IB 3PQIA 4EQOA 3E9HA 2JYEA 3VAWA 3ZDTA 2K5HA 5EBCA 1VJKA 5FO9B 1D8LA 1I5FA 1TWFB 3A9KA 1QQRA 4Q5VA 4XQJA 1I50B 1WX7A 1N36Q 2D3BA 1B4OA 1NMFA 3DLLA 2O5JC 3QB3A 5IOIA 3FPUB 3EFXD 4JOIA 1V80A 4C7ZA 1ASYA 1QOGA 4JI5Q 2HD3A 2NTSA 5AJ3Q 1AYFA 2J7ZA 1E2ZA 4U673 2AL3A 2CHZA 3TEHB 3PCOB 3EQLC 3TL5A 1EL0A 1KJTA 1K8OA 3HM3A 4Q2JA 4EZKA 2BDNA 3AEAB 1JE5A 2KJXA 4P73A 1KF6B 4FF2A 4KZCA 1EOTA 2PW7A 3ZJTA 3N30A 1N36L 1WTQA 2HJ8A 4YXDB 3ZVVA 4YCUA 1BDOA 4NQKE 5C4XH 2BH8A 4KDIC 3VYSA 4JI5L 3RZDB 3PZ8A 1V1PB 2KHIA 4IUUA 4A3MB 4GNXA 3NVZA 1XJVA 4HSVA 4NXNQ 1WZ3A 4DDID 4LJZC 3IG3A 3U8ZA 2IX1A 4DV3Q 2E2IB 2LGSA 4FA6A 2K5PA 2KJRA 2R6GA 4X3TA 2D62A 4IDIA 2CFMA 4B9WA 3ERSX 1LM8B 2LMCB 1KL9A 1J7CA 3U4ZA 5C5LA 3TJPA 3GTJB 4NJCA 1TKWB 5JPMC 3KWLA 3N1YC 5L83A 3RR5A 1EQVA 1EUJA 5FJ8G 2NVQH 1N63A 4A3JB 4B3RL 5LLIA 3EBEA 4DXAB 3N20C 1VMCA 1JW9D 5C0XI 3HOUB 2KWDA 3BVGA 1HHVA 1A2TA 4BY7B 1JALA 1Y1VH 4LFAL 4AQ7A 3RT3B 1VQJA 1V97A 5DPRA 3M7GA 4C3JH 3RNCC 2RGFA 2Z8LA 5I9PA 1KHIA 5E6NA 4DN4M 2A69C 4YSXB 3ML9A 1KAAA 3P63A 3X23A 4REZA 5D14A 1RTNA 4ME3A 1E7PB 4RGTA 3WCQA 2AQ3B 2QDFA 1PH4A 5C4ZA 5M3MH 3CCQA 3F2DA 1WRDB 4HJ5A 1HZBA 2VQEL 2KWVB 3GTOB 3Q69A 3T8MA 2QILA 3GTKH 4HMJA 2WXQA 1WXQA 4GGQA 1F2ZA 3RN5A 4IW0A 4ZUIA 3TRZA 1AFPA 4HPMB 5JJZA 3S16H 2EE1A 4KLKA 4RMAA 1Y8PB 4RAUC 3W1SC 4YIJA 2VB3X 2NZHA 2MJEA 3NUCA 5BMIA 2F0QA 3AE3B 5I2YA 4MHEA 3CF5A 2BB6A 2Z1CA 1NENB 1D1IA 3W5UB 4B9KA 2WDTB 4LJOB 5CTRC 4ME5A 3IT6B 4IFDJ 1YBYA 3T1YL 4PT5A 2KTRB 3V6EB 2RHQB 4A75A 4LWCA 4NP5A 4A3MG 1K83H 2VH1A 4QF4A 3D8GA 2KVRA 2C35B 3OG5A 1P3QU 5H8YE 2KVZA 1UE1A 2UXCL 5BYSA 2HQLA 3U50C 1N33Q 4TMAB 1IKLA 2E5LQ 2PQAA 5FLMH 4BOSC 1FRRA 3P4QB 4AIMA 5HI1A 2GVAA 5C3JB 4PQXA 2YEPB 2BPSA 3DUZA 4LF8L 2L32A 4ICVA 3GTLB 2W3SA 4FDBA 1MHHE 4L8JA 2GBKA 4KIKA 2C7NB 1Q8KA 4ZHOA 3M85A 1OQYA 3CCJA 4NDXA 1SYBA 1BCPD 1U4PA 2JN4A 1B3QA 3K5MA 3LGJA 1Q86C 3J81c 1Q3LA 4A3JG 1K0SA 1MPEA 4HCNB 2RCFA 5EE9A 3UINB 1YJ1A 2INNE 2OTJA 1I50H 1N32L 5ELEA 2I0QA 1L4DB 4PS7A 4QIWE 4QUFA 2M56B 1ET6A 1GJXA 1TGZB 4XT3B 1PFMA 2QDLA 1BQQT 1FVIA 2EYMA 1FYCA 3QIJA 2Z4IA 4NAWB 2VZKB 1JQ4A 1PHJA 3PS6A 4G0NB 4RMFA 4JG2A 4P72A 2QSDA 3SR6A 3KBGA 3K0XA 2WXLA 1PFSA 2KLGA 5JXVA 4A76A 3V60A 1Y8OB 2NVXH 4KKUA 1VQLA 4KKSA 1STNA 3C1EA 3IAYA 4PG3A 3ULJA 1TWHB 5DCNA 4AQYQ 3OJ3A 1E7UA 4JI3Q 3VFKA 3B08A 3GTMH 2AKWB 3A74A 2UXBQ 2INDC 4MACA 2IL8A 1VCIA 5CYUA 4XYOA 3SK6A 2L1AA 3KLRA 4CDEC 4A3FH 2JZZA 5C4XB 1YD8U 4KI0A 5DPWA 1F9QA 2JU6X 1WYWB 5GQOA 2WXOA 4LNFA 2MJDA 1R4PB 3PMFA 3VUWA 4LNQA 3AYHB 3D4RA 4R4OA 4ULLA 1G6PA 1WE6A 2C7HA 2MBBB 3P42A 2EYFA 1LM0A 2V1YA 4W9JA 3MEHA 4PZ8A 2NN6H 4RH6A 4Y7NB 1C77A 2IT1A 1SLJA 3HOVH 2PCFB 3AE1B 2Q2HA 3VR2A 1O7YA 1YJIA 4A3OA 1YNXA 2JEAI 3GTQH 5LHY1 4PMCA 5IT9E 4K0KQ 1CA5A 1B2TA 4DV1Q 4MT5A 3V2TA 1QVCA 1PV4A 3I55A 2FIDA 1X3PA 1WGDA 1IYJB 2GI9A 1JOOA 2QW7A 1YQ3B 3MHZA 2JK8A 4UAIA 1HJPA 1GUGA 1D7QA 3S15H 2KECA 3TQYA 5FLXL 1ZXIA 1TQOA 1PYBA 1UD7A 2FNJB 2WXFA 5FK9C 5IYCG 1QZEA 5C3WA 4LFCL 2D3AA 1Q10A 2JQRB 2ZEQA 3Q3JA 1V1PA 1SMYC 5BO4B 1EQRA 3I7FA 4XWWA 3RI7C 1KNAA 2YTVA 5FO7B 4HPLB 1WH3A 4RF1A 2LKVA 5D94A 4A20A 4C3IB 4MGIE 4AUQC 1ZGUB 3L54A 5A35A 1BCPC 3IL8A 1VQNA 3AE5B 3CD6A 4A3DG 2CKHB 1EYAA 1YI2A 2CJNA 4KJNA 3ZNID 4JI1Q 1MI0A 3AEFB 1HZ5A 3Q14C 2QCZA 5EKLA 2L0TA 2UYZB 4R8IA 1R4QB 2RBMA 3CC2A 1A62A 3EN2A 4GZYC 3BG3A 1LQBA 2WWZA 3M3JA 3PVLA 4MIUA 4JPBW 3RN9C 2DUDA 4F7ZA 3E9SA 2QIEB 3L16A 3N32A 3PLUA 1U4MA 4JBKA 3Q8EA 2JA5H 1S5ED 1II3A 1SYGA 2L1BA 4JVZA 4GKJQ 2ASBA 2LVOA 2IW3A 2Z59B 1Z5SB 4A3PA 1C9FA 1ZYRD 4GSWA 5BYQA 1BR9A 5KHQA 1FO4A 2XN9C 2N7JA 4OXPA 4GOPC 1WJ4A 3NRZA 1PFNA 1KABA 1JWAD 3CKIB 4IUQA 1JOKA 5EBDA 1C76A 4WWMA 2SDFA 1G6ZA 2KDBA 4IPCA 4G7HC 3UI3A 4UPAA 1C8CA 4GNXC 3H0GG 2BYTA 2VW9A 1AWDA 2KFJA 2EYHA 2WAQE 4IOIE 4AS1A 3W5OA 1XPOA 3Q3NC 5IO9A 5IIFA 4KHPQ 1WMHB 4U68A 3CPFA 1C48A 2EMSA 1ZUD2 2DYMA 2UUAL 2OHFA 1F2RC 5IP9G 2FMMA 1N33L 4C56C 4OGQC 1UAPA 3KDFA 3H9DA 1WYGA 3OMGA 5ELDA 3STBD 1TWCB 2CJOA 3U9OA 2MGSA 3Q22A 3E9IA 3M3YH 4LF8Q 4BKSD 4DUYL 1TWFH 2VB2X 3PF5A 3WIMA 5G5HA 3STBC 5C4JH 1R9TB 4KGRA 3IFWB 1WTRA 5M5YB 1TKGA 1QE6A 3MEFA 1BBXC 4FN2A 1J5EL 1WTHA 2LRWA 4W9EA 4M0WB 2LY7A 2MH7A 1E1OA 3NEMA 5BN5A 4NPNA 2K5DA 2K8CA 4WJ4A 4FLHA 2JA6G 4A93B 2EY5A 2Z6KC 3ITPA 1IP9A 2LGDA 1L0YB 3HIZA 5AUIA 2ATWA 2WACA 5J3BA 1QOFA 3BZDB 2DZMA 4KKJA 3BVMA 1WTWA 1STEA 2PQEA 2K5VA 3GTGH 2L55A 3PSIA 1SGHA 4I6NB 3MXNA 1E10A 4DV7Q 2OJRA 5CV8A 3DEOA 4EQ5A 2G3QB 1VQOA 2NCNA 1TWGB 1RHPA 2ZPYA 4ANXA 4LUVA 1KQSA 4ASWC 1NEKB 1JJ2A 2JWZA 3H7SA 4K2KA 3HOZG 3RD2A 2DWQA 1HNWL 4DAPA 1SNCA 2AWTA 4BFRA 1QILA 4R3DA 2HTME 3MXPA 2D11A 4Z9CB 4KDLB 2DNEA 3HFZB 4DV0L 2B63G 1AE3A 3KYDD 1SFOB 4JIOU 4QY7A 4RHRA 5AZFA 2J52A 1SYDA 2YU9B 3B2FA 4FXGC 2LGYA 3NG0A 3SFDB 4C1NI 3I4MG 1KC8C 4NAWA 1YN4A 1KLUD 4FJVB 3VYRA 2LGIA 2BVCA 3MAQA 4W9DA 2TMPA 3A8JE 1ZKOA 5GAEC 3CC7A 4UP8A 1HA6A 1N61A 3S2HB 3HOUH 1GC7A 3HG9A 3VVWB 1PLFA 2IPKD 3MHBA 4FYDA 2PZWA 1GB1A 4HEA1 1UE5A 5D7GA 3TSSA 2JUOA 2OEDA 1JC7A 4C3JB 2ZXRA 4F87A 3PGEA 4HPPA 1G91A 4CDDC 5ELBA 2AUJD 1RLFA 3MJWA 4JI2Q 2PNHA 4WURA 1J7BA 5J22A 1QWYA 1Z9FA 5LMNQ 2H4OA 4MJSA 3X3NA 2A8VA 2PEAA 3DXJC 1BCPB 2Z6BA 3O65B 4W9FA 4L63B 2LXJA 2JA8B 3MC8A 2IDYA 2OXPA 2WDQB 2K7VA 2L11A 1FCCC 1DCZA 3W2DA 3BZCA 1VZ8A 4LNIA 1BUIC 5HG2A 1UNSA 1R4MB 5T8IA 3SHLA 1CUKA 2KMAA 4LF5L 3IFDA 3KOJA 1RYJA 5C4XG 1N60A 2N55A 1SBBB 1PGAA 4W9GA 3L3OC 3QC8B 2B8FA 4DR2L 4FHKA 1I35A 5AZHA 1RWSA 1KXLA 4CJ0B 5IYBH 4C3HG 3IKJA 3EFUA 2GVBA 2O2VA 3WA0A 4P6VF 2H89B 2FAZA 3H0GB 3UI2A 4X64L 1CHQD 2JA7G 2B63B 2D0OA 3K9PB 3QWNA 1EF1A 2W82A 4LF9Q 4B6WA 3C8YA 2A4ZA 2MQJA 3A4SC 1S5DD 2MX2A 4TKNA 2NZ1D 1NTGA 5EPLA 4NXMQ 3ZUNA 5J1ZA 2AQ2B 4HAEA 4GNXB 2E2JB 1K3RA 1ESFA 1HUNA 3P1MA 4GKKQ 1LT3D 2OT2A 2ON8A 3NJTA 5LMUL 3DWPA 3P20A 4OWTB 5DM73 3F2BA 1XMOL 2ENBA 1NI2A 2UUAQ 1EY5A 1XX8A 3VH4B 1STAA 3F8TA 3RUZA 5JJKA 5GMVA 2N9LA 3VR9B 3Q24A 5ELCA 1B9RA 1JB3A 4X57B 2EYPA 3AEVA 2E3TA 3MC0B 4ZRPA 1CQFA 3E5SA 3NVYA 4C3JG 2MWSB 4FULA 3W1YA 1D5ZC 2GLSA 5E7NA 1VQKA 2A1AA 4A3DB 3HP3A 3L7ZC 3A8IE 1E1TA 1RODA 1UEBA 2FINB 2KCCA 3M9BA 3CMAA 2ASQA 4R4CA 3SR1A 4P7IA 4LF7Q 2H5XA 1QCBD 2RDGA 2J0TD 2VL6A 4DUZQ 1L6UA 2DNFA 4IUTA 2NB0A 4R8NA 4JBJA 4C2MH 3S17B 2JYTA 1A3VA 1C7YA 4JW0A 3SGIA 3C2PA 1FRDA 1W3SA 2X38A 1P98A 3TZDA 1OQRA 2R92G 3I4OA 4HIOA 3S1QB 4EOYA 2WINB 3S1RH 4X3KA 4BAXA 4DR5L 3M95A 2BDOA 3QCAA 4XYQA 1ZXHA 3UQBA 3ZYYX 1AP0A 4M8AA 4FADA 4HVBA 1YN5A 4JBMA 1TIFA 4ZLTF 5M3FG 4TRDA 4DR7L 4DV5L 1KRTA 2F03A 3EA6A 3NWSA 2F0NA 5HHDG 2R7ZB 2Y3AA 1AARA 3Q2AC 3VYUA 4OHJA 3Q0AA 2YU9H 4RA8A 3HOVB 3VR4A 1EYGA 2ZNVB 2SOBA 3CQZH 1IBXA 3ZNHB 3AXCA 1B70B 4GOPB 2B2YC 1GC6A 5G3LF 2EZVA 5GROA 1H4RA 5BN3A 3ND9A 3PV0A 4EX5A 2F3WA 1FCLA 4DWFA 4J3OD 4LNNA 2RPVA 2MJ3A 1ISNA 4RNAA 2JPHA 2XNAC 1OTRB 2O6VB 1E0ZA 4JCVE 1UGJA 2ES2A 1EOVA 1Y8RC 2FHTA 3OOCA 4AOFA 5IA7A 2NVQB 2BKRB 5EDSA 2KLCA 2Z9HA 4B95A 1H9KA 4GMVA 1GB4A 1G2SA 3MJ5A 3X0WA 3NBHA 4BBSG 2RDHA 3NZSA 2B2UC 4AP4C 4BBSH 3RUIB 2HTHA 2A5HA 3A55A 3CCSA 1BOSA 4TVAB 4CKBA 2K5NA 1WX8A 5JPNC 4N58A 1GXDC 3KF6A 4DV2Q 4W9LA 1T0QC 2HIXA 3NXWA 2NPTA 1IHZA 1T5XD 4XWTA 1JJGA 2LUMA 1I6HH 5I4DA 1SNOA 4WIPA 1BVSA 2KDFB 4W9IA 1JROA 4ZYNA 1PTOB 3HK0A 3R3MA 1PRTD 4RGOS 2PE6B 1PH8A 3AE7B 5JVG3 1RFAA 2K25A 4YY3L 5I2XA 1BBUA 2JT4B 2EJGC 2KQSA 1DOLA 3I90A 2WNMA 1A15A 2KK8A 1ENAA 3A8KE 3VR5A 3AB5A 2DAJA 1A8VA 2W54A 3H7PB 2BYEA 2L83A 2HCCA 2J53A 4KTAA 4DR3Q 3PO3B 2KX0A 5EE1A 1GPXA 4EUTA 1N9WA 2PW5A 4TQ1A 4A3FG 4B3MQ 3QK0A 5C1ZA 3ZXVA 4K5VA 1PZKD 3DQVA 3K5LA 2C9WB 4W9HA 1STGA 3WWVA 1T0SC 4K81A 1XTDA 1KDBA 3J80c 3RNEC 3VYTA 2FCSA 2M2LA 5COYA 4R4TA 3BDLA 5TSSA 2ZM6Q 4AJYB 3KJOA 2F0SA 5D6JB 3GZNB 1TS4A 1L1OA 4DF7A 2H88B 3EHVA 5IGCA 3LDZE 1PH9A 3P4PB 5I9OA 1G8ZD 3SDLC 1ZYRC 3S1NH 4QGUA 3U58A 4DU9A 5CV4A 5EPJA 3RZDH 4L5QA 3G6EA 1M90C 2LFIA 1QT9A 2J4XA 1JE4A 2K50A 1DYQA 1HNXQ 2KDIA 1CQVA 2CH4W 1X55A 3DMUA 3Q8DA 4DK3C 1CFMA 3JAML 2UU9L 1PH6A 4FHJA 1X54A 3F2UA 4LDTD 1UE7A 2CR5A 1FGBD 2WS3B 3AE2B 1Y1WG 1TU2B 2A73B 2LXKA 2WKDA 1YNNC 2HIVA 1Y1WH 1EU3A 2VUMB 1CTMA 1N32Q 2Y5PA 4JV5Q 1Z2MA 2KWUB 4FJZA 1SYCA 4UHVA 2R7FA 3BYYB 3S14B 3TDQA 2MBOA 4BA1I 4N6EB 2ZJDA 2NBUA 3U52E 1OXVA 1HR0L 2R93H 1KRSA 1PTOF 1IZ6A 4A3EG 1PMRA 5J39A 3EROA 1WXMA 4ZRKA 4BBRB 2V0GA 2HE7A 4JGHB 2F0TA 3MXGA 5K36G 1V1OA 4A90A 4JI0Q 2N7DA 5K36H 4HRSA 1SMYD 3W1SA 2JA8G 2GMIC 3S1QH 4EE2A 2L05A 3RD4A 1BXTA 3K6OA 2O5IC 4C4VA 3H15A 1SDFA 1CA6A 4K3CA 4NZLB 3PZDA 1KTKA 3W9CB 3I56A 4WAFA 3R7QA 4WJQA 5G3LD 2CS4A 1MGSA 3JYUA 4MH8A 1HR0Q 3NHHA 3EFCA 1X3GA 5KGUA 1SF0A 5BMGA 4LLGM 2B2WC 1IYUA 1L2FA 2F1MA 4HJ7A 2OCEA 3A5UA 1QB5D 2PMZB 2KN5A 3PHXB 5IYDG 4II3B 2FJ2A 4KN7C 2JZPA 1CKNA 1KLGD 5G5GA 5IYDH 3KUZA 1EY0A 2MCNB 2BTEA 1IYFA 3CMMB 2I38A 4MTKA 2JSVX 1AZQA 1F52A 3TS2A 1ZKHA 3RZFA 3WOEA 3D4DA 2YTYA 4KHZA 1A6XA 2DJFC 5GXGB 4IJLA 2ZNVC 3HUIA 1TXYA 1ML0D 4NPSA 1U4AA 2KEEA 3O13A 4MZ9A 2BF8B 3GZNI 1A70A 3KDFB 1W2BA 4ZOHC 4JK1C 1NDDA 3UDIA 1VQHA 4XDCA 1MD2D 1E8XA 3ERQA 4BBSB 4EVOA 2PZTA 3T3NA 4NKLA 3SK8A 3IBEA 4KSKC 3KF8B 4XTCS 1EWYC 2WYQA 3AM9A 1D1KA 4K1RB 1X3FA 5MPOA 1ENCA 3FP9A 3KH0A 4HXDA 2AYOB 2N9PC 4ZRIA 2MP2B 1DOKA 2CQAA 2EYOA 2TSSA 1SEBD 2AEHA 1D5MC 1GHKA 5LNK1 5KNDA 3PUZA 5IP9H 4GLXA 4GDLB 3CIRB 2F0GA 3IFTA 1PQSA 1IBMQ 1N34L 2EMTA 3UGBB 2EOTA 1S3OA 4I7ZC 1E0BA 2K05A 2XIWA 4DR4Q 2PE9A 3SFEB 3RMHA 4BA2I 1EYDA 2PIAA 3T1HL 2D5GA 4HKZE 5C2TB 3MZ5A 4YY3Q 2R2OA 1MG4A 3CCLA 4ZKBB 1CHPD 2A68D 4N8X1 1MKHA 1QVGA 3J80E 2KDMA 4ARCA 1H9SA 4MNOA 2LD9A 1E8YA 3W1GA 2NVYH 3MTSA 1L7YA 2VY3A 4XQQA 4QB4A 5FLXc 4WJNA 1WXAA 2G4DB 1VF7A 1HR0W 1Q0WB 4A3BG 3R8BA 2KT7A 4IOCA 1SE2A 1LO5D 3KLSX 1EO6A 2BW2A 4XXEA 2UUCQ 2XVSA 4N9TA 3S1NB 2KXJA 3JSVA 4IWPA 4PS8A 5DLQE 4BKGA 2GOWA 3GDEA 2XK5A 3HRZC 3A9JA 1YJNA 3DWGC 4EKUA 1PH3A 4K5WA 4GDKA 1B9MA 1RAXA 2JWUA 5JOBA 5A2QL 1UELA 3V6CB 4I7AA 1XYIA 3CCEA 4BY1H 3R2TA 2JRIB 1EY4A 2C9OA 2N78A 5IP7H 1KFYB 4ZRZA 5JJLA 2F0DA 1L4ZB 4DFAA 4GS3A 1HTLD 1XQQA 3AU5A 2KA7A 5EGTA 2J0JA 3L4PA 1UZXB 2YLMA 4UDUC 3BS1A 2AL6A 2UUCL 2UU9Q 2IBIB 3RZOB 1OGWA 3J9CA 4EFOA 4DA2A 2IHFA 3C1FA 5CHFA 5LMNW 3T1YQ 4NQLB 2MHVA 2ONQA 1DOMA 5E1FA 1SB3C 2ZW1A 5LXIB 1FNUA 1L0XB 1MI2A 1E2WA 4JQWC 2IGGA 1I4XA 3QJYA 1TVXA 3CXCA 2D2QA 4K7SA 4JPSA 4OX9L 2SAKA 3R66C 3I72A 1EFWA 1LT4D 2V1CC 5E3FA 2HUGA 3H3VI 1GUAB 2O2LD 3WALA 2KCMA 3ZO5B 1HTOA 2WGSA 4HDQA 1MBYA 2K1FA 3RNFC 3TCAA 3R2IA 3AE8B 2DJGC 5GADC 3G71A 1FEHA 2Q2TA 2F0UA 3NTHA 5CR3A 1XTCD 2VZKD 5C3EG 4MJSB 5IN7A 3HVZA 3QARA 2QF7A 1V8QA 5C3EH 1S5BD 1N62A 2MQHA 5CV9A 4IJHA 4YWKA 4ODGA 3C46A 2D10A 3QG1A 3ZDMC 4OX9Q 1EEID 2MP1A 1JOQA 2JEBI 2KC2A 2LGXA 5IYBG 3RFZB 1FFUA 3FHWA 4AYBE 1WFYA 5IT9c 4YSYB 4JE3B 3T9LA 1WJNA 4HEDA 4RM8A 4A3BB 1NNXA 5HY6A 3RZWC 4GLSC 4BKSA 1ESRA 1LTLA 1T6BX 1GKHA 1I94L 4KKTA 2ZJPA 5I6WA 3E0EA 2GBRA 4HIDA 1WSPA 3MTNB 5JEAH 1GUWA 3IT4B 2KCNA 4GB9A 1B3AA 1OQQA 2E2DC 3EUB2 5BYRA 1TR5A 4MEMA 3JW0X 2RVLA 3OYYA 4LNKA 4TSSA 2V3PA 1V43A 1X3EA 3DCGA 3GD7A 4RFBA 2B63H 2K75A 4JI4Q 2R61A 4H13C 4WRDA 5JVH3 4I6LB 4R4IA 1VLBA 4C4VB 2DX5B 1YIWA 3J80i 2ZW0A 2WXRA 5TR5A 2QEJC 3H1UA 1PRTF 3N3KB 1S5CD 1SE4A 5M5WB 2CW0D 4N59A 3DEPA 4K8IA 4NAMA 3TEWA 2AQ1B 5FO8B 5LL6X 1R4MI 3A0JA 3U30A 4JI8Q 1HZ6A 2C7MB 2DHZA 1SSOA 4N9PA 1CSQA 3TBIB 3L0WB 2F0LA 5FKAC 3HOUG 2KKCA 1X1MA 3M3YB 2NUCA 3DBLB 3PO0A 1LYLA 1IBKQ 2JX5A 2WIIB 2EQSA 4ZK9B 2G45B 1VQFA 1NAPA 3RLOA 2R92H 3V62A 1E6EB 1R9TH 1R7SA 3DVNV 3Q6SA 3A9KB 1YNJD 3DWMA 4PZ7A 3QJZA 4IG7B 2OF1A 3Q3MC 2JA6B 1MHWC 4A93G 1D3ZA 2I07B 4B9XA 1HUMA 2OTLA 4XDDA 3Q8FA 2CQOA 1EEFD 3BDOA 4OIKA 1WD0A 5M3MG 4GKJL 3B9JA 5CORA 4X3SA 2BE5D 2ZTCA 2F3IA 3CAMA 1IUEA 2G9DA 1K52A 1TY0A 4LFAQ 3PIP3 1E8WA 3KUPA 4KY6A 4E3CA 4D2KA 2K4KA 1PZJD 1SNMA 3GTMB 2KEDA 3VTUA 1TT2A 2AWOA 2OQKA 2LXAA 4RGNA 1K0RA 4A3KH 3GOEA 1LFDA 4HWIB 1SE9A 2M9VA 3P4RB 4BY1B 4R4QA 1YQ4B 1YVCA 4CKCA 1Q12A 1PA6A 1GHJA 3SEBA 1VQAA 4F7XA 1YNJC 3PIOA 4AWJA 1SR3A 3J7A5 2D3CA 3ULLA 3BK1A 1T5EA 3DBLI 4B3SQ 1BO0A 1LTBD 2VQEQ 3OW7A 4A3MH 2IX3A 1P0RA 2IO3B 3LX0A 1XNQQ 4HJKA 4BS9A 2JA7H 2GA4B 3I4MB 1PH1A 1WGKA 1FD6A 1KIXA 1QUQA 2I5LX 1IW7D 2NYZD 2HT1A 2ALYB 4OZCA 1WR6E 3PO2B 1GNUA 1I4RA 5FLMG 1LACA 2M1MA 2PKOA 2KD0A 3P75A 4HIKA 2DBYA 5JH5C 2MFIA 1V8CA 4KGTA 2CHXA 3CCMA 1ILQA 3DBRI 1SE8A 2KANA 2LI5A 2MBQA 5DAUA 1RKNA 2EXDA 4L23A 5C23A 1PRTB 3NHEB 3H7PA 3I4LA 2HDEA 2CW0C 3RLNA 1MJDA 4XZ4A 4A3JH 1Y1VG 5IGFA 4DBGA 5DNFA 2NR2A 4KMUC 3JVZX 3I4NG 1RCVD 4OO1I 3HZXA 1GVPA 5L95C 3PIPA 1K8GA 3HGBA 4R9WA 4RWSC 3KYHC 3V61A 2A5UA 2RSOA 1FXTB 3Q6BA 2LSSA 3JSVB 3QO2A 2ZZPB 2G4SA 2IO2B 3AMZA 1PDQA 4MSMB 2D9UA 1H95A 3VH3B 3CWIA 4DV7L 3A9JB 3K5OA 3U9SA 3ZRFA 4DR7Q 2K6QA 3HKZB 3RN2A 1KD1C 3E56A 2O6VD 5M3MB 3LYYA 3ZNGC 1RJTA 3DWQA 2WXKA 1EY6A 1NE3A 2WB1G 1K8AC 2LJIA 5C4HA 1SFOH 2FCQA 3GTOH 2HQEA 4OVZA 3T13A 4K6DA 1NI3A 3Q3OC 4L6TB 3HOYG 3OAWA 2NBWB 1WGGA 2JSOA 2C5CA 3BU2A 4HSPA 2N7EA 3B2GA 2K6DB 3VRBB 2RCNA 3ER0A 2IGHA 2WXPA 5D65A 1MFWA 4IN3A 1XEEA 3URYA 4EGVA 2XRSD 2C60A 2W55A 3A1QB 3VA7A 3Q8AA 2I2YA 2NBVB 4DAYA 2UUBQ 1GUTA 4OELB 4YHHL 5JEAJ 3CF6E 4LK0M 1OEYA 5IODA 5M5WH 4ZQ3A 2WXJA 1OXUA 4H02A 1WRIA 3PUVA 5KRUA 1H9RA 1Y56A 4M0WA 4ZUJA 1SMXA 4ZKCB 1S72A 3A7AB 1QZGA 2R93G 2K52A 4LF4L 3ALBA 3ZLZA 1OEYJ 1LTRD 1UEAB 3M4OH 1I6HB 5JJIA 2KYWA 3NZUA 1RL2A 2AHOB 3G7LA 1QNUA 1X6OA 4IO9A 2K22A 4OZAA 2F4IA 3GV3A 5IYCH 1D4BA 1MSGA 5IGDA 2BB5A 2BQQA 1TWCH 2OQ0A 5LXHA 1L5PA 3RNGC 3DBSA 3NVVA 4GU2A 3OIQA 4LF6Q 3AMUA 3P7JA 3H09A 1T3QA 2WHIA 2PZUA 4EZJA 4YTMB 2EY6A 3ETRA 3S14H 4DR2Q 2KACA 4DR3L 2NMQA 3I4NB 3LXFA 3HOXH 1HNZQ 2BOSA 3AE9B 4CKEA 1X9NA 4LF4Q 2KNBA 1WFQA 4B0EA 3APFA 2GRIA 2NWGA 3OLMD 2FMCA 2MO0A 3M4YA 3TP7A 5JAVA 4US8A 1HEZE 1JCKB 2RSUA 1DGJA 2SNSA 5C44B 3VA5A 2WXGA 3NQTA 1ACCA 1LGRA 4X65Q 1IPGA 1RF2D 1EIYB 3PRMB 1JRPA 2F0WA 2KC1A 2Q5WD 3QX1A 3H0GH 1DM0B 2WB1B 1MHXA 1XCTL 1XPUA 3BINA 3RCZA 1SRUA 4M8NA 2WXIA 4KY5A 1HZCA 4NMZA 2ZVOA 5M3FB 2F4VL 2WXNA 2L00B 1SNDA 1EWIA 4ANWA 5E4XA 2MBEA 2R7ZG 1U4RA 1FR3A 2WKCA 3QIAA 2VH2A 2NN6G 4NXML 3K7AB 1A5RA 2LS01 1XLPA 1HH2P 1LTSD 1Y1WB 4NJ6A 2KVMA 2ZXOA 3A4RA 4BXXG 2QCPX 4OVVA 2KX3A 1J6QA 3ZXRA 2A6EC 5HFYA 2E75C 1T0RC 4DUZL 2P5ZX 1GG3A 5CBEE 1XO3A 2A74C 1E9MA 1Q5WB 4ILWA 2N9EB 4IUMB 3I2ZA 4WQOB 1V1QA 4IKGA 3NVWA 1ZDVA 4BBRH 4N9F4 5CBAE 1PUTA 2B2UA 1S1QB 1Q82C 2F0PA 4GDLA 3TEYA 2SEBD 4CDCC 5KEEA 2KTRA 2KO3A 3AEBB 2GB1A 4KJOA 3TMEA 4ARIA 3I3TB 3NS8A 4GKKL 3V96A 4WQMA 3VR6A 4C3IH 5LMUQ 2RF4A 3S24A 2DAFA 2KDEB 3FILB 1OFFA 2FUHB 2VQFQ 3NQIA 1YNND 3GE3C 3DVNU 1ICFB 3Q23A 2M4NA 1WOCA 1DOIA 4FF3A 1C78A 3N9YC 1L1OC 2EJMA 4II2B 4FBJB 3PUWA 5C44G 1MVKA 2GBNA 3S2AA 3AB9A 2GBJA 4Q0FA 1FM0D 5KNBA 4MGZE 4A3BH 4L5RC 3QOJA 3CQZB 4X66L 4RGMA 2XSCA 4IALA 3K59A 5IKCM 2KBNA 2B2YA 2BYFA 1MJCA 4JI6L 2IHEA 2M0AA 1H9MA 2WLBA 2X6LA 2Y0SB 2AUKA 4WORA 4PMWA 5IP7G 2D3GA 1EZ8A 2FXQA 2Q2UA 2V4LA 4LTUA 4DR5Q 4DV0Q 1VQ8A 3TMPB 4IC7B 4WWNA 1AE2A 1AW7A 1H8CA 4X62L 2WU5B 2WDRB 3SK4A 1KLVA 3UE1A 3EVQA 1FPYA 4X66Q 3H3VH 1E3PA 1WJ6A 3B1LX 3NUHB 2KHJA 1JWSD 4K6LA 2DZIA 3A33B 3ONSA 1QOAA 3D0FA 3HEJA 1WMHA 2E2JH 1YX5B 2I1JA 2N49A 1J8IA 2DGYA 2G9HD 1HXYD 1VZ6A 1WCMG 3QWZB 5AZGA 4GIVA 1WCMH 3SDZA 3CRKC 1Z6HA 1KDCA 2K5QA 3MWYW 1PGXA 2LFNA 1QG7A 4X62Q 4EZLA 4LCDE 4DAYB 3MP9A 3OW2A 1YHQA 1M8AA 2CWPA 4PV1C 3UDXA 3CCRA 4A3EB 4DV6Q 2WX0A 3J81i 3PRZA 4A8XC 1YHAA 1NY4A 2Y5BB 3HM6X 5HKHA 3PHWB 4CGYB 1Y14B 2CH4A 4OW0A 5FR6A 4DV2L 4A9AA 4C3HH 3FAHA 4A3GB 2Q8TA 1W6JA 2H1EA 4BZAA 4NJ7A 1Q1OA 1WTXA 1VQPA 4LMQD 3MFYA 1J0GA 2MO1A 1YEZA 3KLSA 4X3UA 1CI3M 1F9RA 2CKZB 3GP7A 2MNAA 4OIJA 1UWXA 1YN3A 1SXTA 1I4PA 5IE8A 1RDPD 2PLPA 3DHIC 3FMCA 2C5LC 3KW5B 3ZW3A 5LMNL 1HA5A 2Z4HA 5ELOA 4HK2A 4NNJB 1DONA 5E6PA 3HOZB 4P16A 3FVQA 1SIJA 1WJUA 2K1BA 1L2NA 2UXDQ 3DHGC 3K9OB 1V9PA 1U5KA 1GAQB 4XX5A 1FL0A 4ANUA 4CDFC 3G6JB 3U7ZA 2Q2IA 1EYCA 1K8MA 4A3IB 3S1MB 3HOWG 2XK5B 4F1SA 3ZTCA 4FXDA 2K8BA 3CSFA 2F0FA 5D3DA 4HJ8A 3DBHI 1NR2A 3I9V1 1SAPA 1UUPA 1V9JA 2YV5A 3NS1A 2JZ3B 2MJ8A 3GV6A 2JXMB 5EQ0A 2RA4A 4IFDG 4A6QA 2ZCBA 2OOBB 4JOIC 1PH2A 4RF0A 1D2BA 1X32A 1BKBA 1VQDA 2EPBA 4B3TQ 4BVUC 1A2UA 3KFUA 4IUNA 2DN8A 5GAGC 2KN4A 1HRJA 3IXSA 4ACFA 3HRDD 1JR0D 3BWUD 2PJHA 4MN3A 1IXRA 4I6PA 3S2DH 4KHVA 4YTNB 3D6CA 1DOYA 4G4KA 3D4WA 3UDGA 2XRQD 2MBHA 4L2YA 5JHAA 2AWNA 1U9RA 2N88A 2KUMA 1FGUA 3NE5B 4PMBA 2EELA 1XLNA 2Q8IB 1B50A 3J81E 3ZKJC 4CO7A 4YWLA 2B2VA 3B0AA 1YHBA 5AJ3L 3AE6B 1V49A 3SD5A 3OMCA 1C4PA 2M00A 1KH0A 2N4FA 2MUYA 4E74A 1WTOA 3H3VC 2KJ6A 2KQ4X 4JI7L 3I63C 2M17A 1PH5A 1S40A 3P2BA 1XT9B 3P4SB 5CC4A 3ONAB 2BH2A 1CZWA 3FC4A 3OTOL 1SE3A 2K5WA 1JJCB 1L0VB 1I94Q 4CHTB 4HJ9A 1RRBA 1WR1A 2NVYB 2K33A 2K3UA 1JWUD 2OWOA 4DV4Q 5DEHA 1WY8A 2MRPA 2KAJA 2N0SB 3AECB 1NMGA 1TWAH 1EWCA 1I4HA 1Z7TA 2XGTA 4LFBQ 2G1EA 3UE0A 4KD3A 1SSNA 4KSLC 4POGA 4JI4L 2HJ1A 1KOTA 2K14A 4DV3L 1C79A 1X3QA 1FNWA 3H6NA 5C3XA 4DK1A 4J6IA 5JZEB 2IO1B 5BR8Q 4P2CB 1OXSC 3HOWB 3TS0A 3KBXA 1CK1A 2WFWA 4DK5A 4OEMB 5D3IB 4A3KG 3H94A 2NVTH 1ROEA 3K5NA 2CHWA 4G11A 2FFKB 2LZ6A 5FJ8H 4TQUS 1YJ9A 1ICWA 2E2HH 2LHEA 5CV6A 4OONA 4LFBL 5IWAQ 4FF4A 4AJWA 3A7LA 3NTKA 1JMCA 2M0XA 1OXTA 3FKIG 2F0IA 3KUCB 1N6ZA 3C0RB 3LNNA 5IT9L 4OL7A 1IBML 3AULA 2B76B 2KQ7A 4DHZB 3H91A 2Y0SE 4GOCA 1JICA 2N3SA 4QL5A 3SHQA 1VMPA 3PGZA 4G7ZC 2K9XA 3RMKC 1J19A 1E8ZA 1GUSA 2IGDA 2A6HD 3T1HQ 3FRPB 2B3GA 1Y8NB 1XF5L 2JRHA 3WANA 4A3GH 2IYDB 3TP5A 2HHHQ 4A3GG 3MC9A 4Y52H 3MHSD 1F1HA 4IM3A 1DXMA 1F2MA 4BBNC 2DYOA 3TUOA 2RD0A 5JHBA 2QGQA 1SYEA 3FPPA 3VXWA 1Q1EA 4ID6A 1QKZA 1ZDXA 1N34Q 3VDYA 2WV6D 1PFBA 4UY8C 2EXZA 3S1RB 3BIID 3RULA 1WXVA 1WYDA 3HKZE 1O7ZA 1K8RB 1KRHA 3AN1A 3PUYA 1VQEA 2NN6I 1EY9A 2D5DA 1KDAA 2Y0SG 2R2QA 2KZRA 4A3IH 3S1MH 1FIQA 2I1KA 3E3XA 1P8LA 1RTOA 2D2CC 1V2YA 4KKIA 3WAMA 1NUCA 2PQAB 5IP4D 3GTQB 3D3RA 1XNQL 3HOVG 4CJ2C 3G48A 4V0BA 5DPSA 1CT1D 2UXCQ 4DGZA 3AEDB 1OTCA 2BYVE 3AE4B 5E6OA 2HCIA 3FDTA 3Q3FA 4DR6L 4IM2A 4M1UB 2B29A 1I7HA 2RDBC 2R3ZA 1T0YA 4NB3A 2B3AA 4OVUA 1CKMA 3KYCD 1SYFA 2A69D 3JAMc 2ZT9C 2L5TA 4LW1A 5H1SE 2KJHB 5EJWA 4O0AA 4M00A 4IZ8A 2L8JA 3Q8BA 3R7RA 4HIMA 2OJWA 3NK9A 1EF5A 2Y5CA 3K57A 4DR1Q 4GLVB 1EY7A 1M94A 2M8SA 2REXA 1YJWA 1I3QB 3I5JC 2WXHA 3CP0A 1PGBA 4AQYL 4P1BC 1IKMA 3ML8A 1JWBD 3K0YA 3HOXG 3HVDA 1JWMD 4HCEA 2J0MA 4XYCA 4FVMA 4E6IA 1TS3A 5T1IA 2WXMA 4POFA 1J9OA 1WVLA 2PTLA 2F0KA 3ULPA 1P9DU 3DHQA 1ZE3D 1WGYA 4MDKE 3ZRCA 1P7EA 5C0XG 4JI0L 5CHVC 3C3LA 3EJIA 3GTKB 3K8AA 3I4NH 3L2PA 2OEOA 4QQBX 2R92B 4IUVA 4A4IA 1VQ4A 1Q46A 3MVVA 4H7BA 1VQCA 3S16B 1KM7A 1SIFA 5EE3A 3GO5A 2WP8J 4LUZA 2JA5G 4K0KL 2EKEC 2LRUA 2LXCA 3CCVA 1WJJA 3HOYB 2QDBA 3R93A 2ICEC 2N9KA 3T3OA 2EDGA 4QUCA 5FR3A 2A68C 4ZRJA 2BS4B 3DM1A 4V190 2EY2A 2QA4A 2Q8RE 4X6AH 4YCWA 1LTAD 2EIFA 4ZAIA 4JWUC 3ZJVA 3NY5A 2KTFA 1VR9A 5NUCA 3LWEA 2RQXA 4XC2A 1F77A 4PS3A 2FIFA 1L1OB 1NBFC 5KNCA 3U7DA 4KV2A 4IOAA 1PXUA 1UE6A 2Z0DB 3BK2A 2MEKA 1G291 1STHA 5ISRA 2K6AA 1KNEA 1PYSB 4UP7A 5BR8L 1FFVA 2CU3A 4P74A 3AEGB 3KJPA 2WAQG 2CCZA 1FJGQ 2RR9A 1QLBB 1YJJA 3H8HA 4DHJB 5C4JB 2XBBC 1W6KA 3F1ZA 4LF6L 1WX9A 4XE0A 1E7ZA 2VUMG 3PO2H 1HTPA 1PRTC 4CHKA 1VQIA 3SXHA 4C3IG 3GTJH 2VUMH 3VUXA 1DJRD 3HOXB 2XEWA 4DQOC 3QOLA 1CJEA 1WZ0A 1K73C 4WWPA 1LABA 4EEWA 3FILA 2O2VB 3CU7A 4RG1A 2O6VA 1HQRD 4HJAA 2B2VC 4CYEA 4BBRG 2BKFA 2F52A 1DOXA 1ZPSA 3PO3G 3NSWA 4DNIA 4DR4L 1C0AA 3KQ4A 2WQYB 1SN8A 4RKLA 4WWOA 4A3FB 1PTOD 3M63B 1VS0A 3OHXC 3RLFA 1O78A 1WWTA 4XIGS 2FBWB 4USAA 4TQ0A 1FD7D 1YZ6A 3ND8A 4QJFA 3IAM1 3UF8A 1LTTD 2JJQA 2XWBB 3HOZH 4F8MA 1JRUA 3ZQ4A 4WFN3 3HKZG 3T4AC 4C80A 4CQNA 1TY2A 1DGSA 1FXIA 2J42A 1LTID 2K32A 2MPMA 3BZKA 3UIOB 4MGKE 1EIGA 1NJIC 1VZ7A 1EIFA 1TZ1A 4DUYQ 3ZJUA 1PDXA 4KN4C 2L9HA 4ALPA 2JY6A 4OZBA 1VDVA 2JA7B 3E0JA 4R1JA 3NELA 4C00A 4KV6A 4URKA 2ID0A 3EIVA 1D6EC 3LB8C 1L6VA 2QC8A 1AZPA 4AYBG 1E22A 3S2HH 2FCMA 1B44D 4XQNA 1RFKA 3K7UC 4US9A 2N8NA 1UGMA 4OO1H 3AH7A 5L37A 1VF5C 1K83B 4DR6Q 4WJOA 1B53A 4OWXB 2BGFA 2K0PA 1ET9A 4ITKA 3PIO3 3S2DB 1UF0A 1XCQL 3A56A 2EJFC 1PFDA 1YOVB 2A6HC 3WAPA 4BY7G 1TKYA 1JQYD 4QMGA 3J7ZC 4G50A 1GUNA 1HZ9A 1H9JA 2ZTDA 3AQQA 4KD4A 4K5XA 5T1GA 4IPGA 4DKAC 4ZRQA 2B2WA 2AX5A 2V3SA 2VS1A 2D0PA 3DBHB 4B3SL 3FEWX 3CHBD 2JXXA 4YCVA 1IYVA 3L08A 2VQFL 2ZPNA 2WDVB 4GLAC 2E5LL 4G57A 2J0KA 3PT2B 1EIHA 5J18A 4JWSC 3V3XA 4C7YA 1BBWA 3QAQA 3UDFA 3L9AX 3H6MA 3CMEA 3N1ZC 2JXTA 1FXAA 3PZ7A 4MM3B 3ZTDA 4B0MA 1OO9B 2V9HA 2LVPA 1TS2A 2G5DA 1WM3A 3JC66 2JA5B 3D31A 1P1AA 2BCOA 1VQ6A 2RKSA 4IUPA 1UH6A 2EKIA 4K14A 3KF6B 5AFWA 2Z0EB 1TJEA 4JI3L 1FMAD 2PPHA 1TZOA 2JA6H 3TREA 4HDOA 2NS5A 1PYWD 1JT8A 4ZHPA 1CMXB 3VR3A 1MIUA 1TWAB 4DXFA 5CV7A 2VRRB 1LV9A 4FNFA 3DHHC 2F0MA 1QZHA 1EQQA 4K8JA 2B8GA 1GOZA 3HOWH 4GN5A 1Z47A 3TEZA 5C5MA 2NVTB 1C1YB 3SVMA 3I3CA 4JI2L 2I5HA 3I8ZA 2WU2B 3K80C 3TP8A 4NY0A 5JEAG 1NBWA 3NENA 2FE8A 1LTGD 3U2SC 2E2HB 3D32A 1C9OA 2IJ0A 5ELFA 4BWGB 3M4OB 3TBLD 2BE5C 4W9CA 4A3LH 3CRLC 1WCMB 3BY4B 1QOHA 4ABNA 2PNRC 2E2IH 4A3LG 3DDCB 2BBCA 4OWWB 1E7VA 2BWFA 2CU1A 4HROA 4DPGA 3I4MH 1D5XC 3OPOA 1IGCA 3FKYA 4M02A 4IPHA 4L5TA 4P75A 5KYIA 1F0ZA 2KOLA 1MSHA 2PYKA 4FP5D 3W1BA 1MJEA 1LT5D 4J6HA 4LUOA 4G7OC 1R4NB 1AN8A 4IURA 3NOBA 4YSZB 4IFDH 1I4QA 3J80L 4TUUA 3M62B 4A93H 1CKNB 1BF4A 4HKQA 3ZIMA 1K53A 3A54A 3S17H 5FLXE 4DV1L 1WTVA 1IBKL 2NVXB 1E90A 2DLBA 2N1WA 3SE0A 3GTPB 1I6VC 4RCNA 4X64Q 1Q8IA 2L0FA 2DY8A 1HZAA 5DPTA 3TP6A 2KMCA 3QA8A 1R4NI 1GUOA 1XPRA 5IGBA 4BBNF 3AFPA 4YT0B 2K04A 2CWAA 1E5WA 4FXKC 3VDZA 4ZCKA 1UWMA 4JI8L 3QHTA 4F8CB 2LHDA 4TV3A 2ICIA 2LWPA 1UBQA 1WD1A 3J7YW 1XMQL 2JP1A 4EQPA 1ONLA 1ILPA 5M3FH 1IBXB 2JE6I 3ZJYC 2F0EA 3ZNZB 2FCNA 1HNZL 1AH9A 4WJ3M 2CVRA 1DZ1A 2L3ZA 3PLVA 1Q81C 3TN2A 3E6ZX 3QR8A 1XMOQ 2UWQA 1LUZA 1IL8A 3K7AH 5FOBB 3APDA 2KHWB 4S17A 1WGHA 3RYTA 2E8GA 1Q90A 2W3RA 4P1CC 4M8MA 4RCOA 2IX0A 3VUYA 2FUG1 2K8HA 3VHTC 1K3BC 3OJ4B 4PNYA 3DWAA 4GXBA 3I70A 2PW9A 4DDGD 2M19A 3DPDA 1IBLL 1XD3B 1FNVA 5HURA 1QOBA 5CGKA 5E6JA 1J5EQ 4KIKB 3W3AA 4HTHA 1I3QH 2WAQB 3X3MA 4QCLA 2YYZA 5BN4A 5AEKB 2IWHA 1VQGA 1WF9A 4J15A 1VQ5A 2IY0B 1YMHE 1J7AA 1U0LA 1HFNA 4IWQA 2PVOD 4MH0E 1C4CA 2EVBA 3BJUA 4NW2A 5M5XH 3JAME 4WH4A 1PZID 1G51A 2BA0A 4DNRB 1K50A 3AFQA 4LF7L 4IQZA 4P71A 4JI7Q 5D2MB 4DAMA 1K51A 1UWVA 1VQBA 3SK5A 4WJPA 3FKIH 4O2DA 5CV5A 4A3CG 3APCA 1GO3E 1N8RC 4A3CH 1C4QA 4DK0A 3ICEA 1GJZA 1RM6C 5EKIA 2QMTA 4KGSA 2MHJA 3HOYH 2F0VA 3NP8A 2ZVNA 4JLCA 1O7LA 3NPPA 4QAYA 3OIPA 1Q7YC 2HDMA 1JORA 1WTPA 1WE7A 3LJ3A 4ICUA 2DZKA 1KAWA 2A6ED 4TKOB 4GOPA 1NR4A 1F9JA 3EECA 3L13A 5J17A 5AUKA 4DNTB 4PZ6A 2XWJB 3ABVB 1X56A 1QNKA 2X8XX 2W9NA 2INPE 1TWGH 2UXBL 3PREA 1XNRL 4DHZE 3KK7A 4K3BA 1HNWQ 3VR8B 3ECIA 3I91A 4KK7A 2YVCA 2JF5A 2INCC 5EKKA 2LUEA 5EAYA 1V6EA 1O80A 4WAAA 1WM2A 1F9PA 2NZOA 3P1HA 1BMLC 4FO2A 2MP2A 1NVID 4A3KB 1V81A 1VCBA 2MW5A 2ZJRA 2KMMA 4IWOA 4RHSA 1Y69U 2IY5B 4HJGE 1B1ZA 1U4LA 5C0XJ 4J8QA 1CZPA 2KFKA 1J8CA 3ENEA 3U4EG 3PRPB 2V3NA 4A3IG 3CC4A 3K58A 1VQ7A 2UUBL 5IWAL 5CHWA 4YWMA 4GN3B 2QJLA 1P7FA 3A1QA 5KIXA 4B08A 2LASA 4XT1B 5KYLA 1O7IA 2RHSB 1H9SB 4KZ0A 4PYUA 2B2TA 2L0CA 2QKIC 2R93B 1DD2A 4HCPB 2D07B 1QUQB 4S0RA 1BCPF 1E24A 1LT6D 2KOXA 3OWEB 4A3DH 3GS2A 3I73A 1ZEQX 4FXCA 3DVGY 5DM63 2MA9B 2ZTEA 3QQ8B 4GDKB 4A3EH 1VQMA 4BKTA 2YEPF 1B9NA 2EYJA 1ZP0B 4LNOA 4LFCQ 3GTPH 1CSPA 1V5TA 2X6GA 4LDTB 2Z6KA 3IAS1 2VNUD 4YHHQ 1IGDA 2XTIA 3MFGA 3G4SA 1Y1VB 4E71A 2DZJA 3GTGB 4WJWA 1TWHH 3BYTB 4LAAA 2ZM6L 2KQ3A 2K03A 5EPKA 2JA9A 4HCSA 3AEEB 5ELNA 4HR7B 1JMLA 3GB1A 1S3SG 3I57A 4MSQB 3VRAB 2K39A 5LL6S 4IPDA 2I5MX 1EFID 3BVZA 4JI1L 4J1MA 2LJ5A 3A5ZB 1L0WA 4IFDI 2IY1B 4KX6B 1F2YA 2LEKA 4K7UA 4LF5Q 2HDLA 5J2RA 3TEXA 3T51B 3N52A 1BT0A 1PVOA 2MLBA 3OWFA 4JC0A 5IAAC 3AV8A 1G6JA 1PTOC 2B2TC 1XMQQ 4JV5L 1YIJA 4Y7NH 2UXDL 2IZVB 1EQTA 3N6RA 1TS5A 4KY7A 1XWEA 4ZYSA 2O4XA 1NCVA 2QHOA 3WDNA 2PMZE 1UBIA 2ZJQA 4FJYA 3EGRA 2AMCB 5G55A 1EUVB 4M01A 1NSNS 1V5OA 2J7QB 2QEXA 1EWHA 1TT5B 1F9SA 2EYLA 1SNQA 4HN7A 4BOZB 4X65L 5IOCA 5IY0A 4DR1L 3L0OA 1N5WA 3V05A 1TYGB 1Q1BA 2MSED 3PO2G 2ZCCA 2BA1A 2F0OA 4HLEA 1F2LA 4DXGA 1YQBA 1IBLQ 1SNPA 2RDFA 3J81L 1X65A 3HKSA 2L4NA 3WOFA 3RNUA 4KHPL 2PI2A 5M5XB 1NYQA 1G2TA 1NYRA 1WI0A 3KWVA 2E74C 4MTNA 2F4VQ 5A2QE 3TZUA 1HFGA 3GTLH 3PPAA 3RPFC 2BT6A 2L52A 4LF9L 2VXWA 1WXSA 4A55A 3BDCA 1EZ6A 5F2DA 4AH6A 1STYA 3PF4A 2DENB 2HD5B 3NWTA 3FKIB 2L76A 3CW2C 4K2LA 2KENA 4N8FA 2JA8H 2RPQA 3R3OA 4GN1A 2KCTA 5GAHC 1A3TA 3PO3H 4CBVA 3NBIA 4DV5Q 4H2AA 4ZDVA 3IHPC 2N1VA 1LLRD 1ASZA 1VDZA 3CSTA 5CX3A 4B3TL 3NTIA 1VRAB 3B6YA 4JL9A 1YNTE 2F0JA 1VD2A 1P16A 1WGRA 4H0LC 1T9HA 2V4DA 2EY1A 2NTTA 4S3SA 2GN5A 3KUDB 1ZXTA 2RSNA 4CJ1B 3ZGZA 3SU8X 2BS2B 4O42A 2WX1A 4PK1A 1E2VA 3OTOQ 1RD9D 1QF6A 4C2MB 2UU7A 1A63A 3C19A 1TTNA 3GQBA 5C0XH 4DAVA 3GE8C 4JX1C 4K7WA 4C3HB 1STBA 2A19A 5C44H 2PMVA 2E6XA 2LMCA 3T53B 1YITA 1CZGA 4DV4L 5I6YA 2ACZB 2DY7A 4L5SA 1QJOA 1N5XA 2SNMA 1ZOYB 4ANVA 1HTQA 3VTVA 4NXNL 3OSOA 3T56B 3T16A 4APVA 2PO4A 4JI6Q 2BWES 1JB7A 2RMMA 1XNRQ 3UIPB 2R7ZH 1S5FD 5K5PA 4OO1G 3L10B 4IM0A 3PV1A 3DVGX 3NZ3A 1PH7A 4RM9A 2PPBC 1FJGL 1YX6B 3RZOH 1TIID 2NVUI 1EY8A 2L7RA 1C3TA 4BXXH 1F2RI 3D6WA 4O1NA 4B3RQ 1CKOA 4LJPB 1HPCA 2YTXA 5G2NA 3F2CA 1TKEA 5M5YH 3U4VA 1V86A 4XGAB 1HCZA 3L17A 3S9WA 3S15B 3DOWA 3KF8A 3KLWA 4G3XB 1RIPA 4KVGB 3RNAC 4YWGG 2JQOA 3LWUA 4PYZA 3J7AF 3AI5A 1K28A 1GD7A 1C4AA 3CCUA 1I4GA 4JYAL 1SROA 1BNZA 2NBFA 2DYBA 4BY7H 3VTWA 1IL2A 4MGYE 4MM3A 4F88A 5C3EB 2BS3B 4HMIA 1SJED 3CPWA 2F3VA 3MXNB 4DHJD 1PTOH 2JYOA 2N9XA 5M9OA 3PTFC 1S4ZA 4FF1A 2K01A 3DBRB 1ENFA 4H44C 3J81j 1M1KC 2LVQA 4C1NK 5EE0A 1IW7C 2X69A 2KWCA 2GBMA 3M4PA 3UQAA 3MXUA 1XXGA 3JAMi 1AEXA 4JBWA 5CMDA 1SJHD 2E76C 3M7NA 1TBEA 2PVGC 4JYAQ 2KFKB 1MG8A 1A3UA 1WIAA 3EC8A 4L1BA 4YTPB 4I65A 4YL8A 4MELA 1HQMC 5KHOA 1WI5A 1OXXK 3K81C 3NBHB 5IGGA 1LXDA 3HHMA 3TIXA 2CHBD 1QVFA 1BUVT 2HHHL 1XLQA 3PUXA 2ZXPA 4DV6L 3AU7A 2R7DA 4XDXA 1VQ9A 1A0IA 4GN4B 3HS0C 4AYBB 1XLOA 3Q8CA 4UP9A 4BY1G 2NPTB 3PSEB 3IVFA 3W5VB 3AU4A 4B3ML 2PI2E 4EQNA 1EU4A 2DNCA 1K9MC 2WB1E 1ZW7A 2KHSA 5H92C 1B8AA 5IGEA 2Z0SA 1HE8A 2L15A 1M4VA 4RKBA 1HNXL 2F0HA 2JVCA 2B39A 3J7AV 3IRBA 4LK1C 2IO0B
chains in the Genus database with same CATH topology
1CM9A 5E4WC 3VQIA 2K28A 5HGTA 1EM7A 4QIWB 5BMHA 2I46A 2WP9B 5C6AA 3MA2B 2L12A 2V4IB 4EQOA 2JYEA 1VJKA 5EBCA 5FO9B 1TWFB 1QQRA 4Q5VA 4XQJA 1I50B 1B4OA 2O5JC 3QB3A 3FPUB 3EFXD 4C7ZA 1QOGA 2NTSA 1AYFA 2J7ZA 1E2ZA 4U673 3EQLC 1EL0A 1K8OA 4Q2JA 2BDNA 3AEAB 2KJXA 1KF6B 4FF2A 1EOTA 2PW7A 3ZJTA 1WTQA 4YXDB 1BDOA 3VYSA 3RZDB 3PZ8A 1V1PB 4IUUA 4A3MB 3NVZA 4HSVA 4LJZC 2IX1A 2E2IB 2K5PA 2R6GA 4X3TA 2D62A 4IDIA 4B9WA 2LMCB 1J7CA 5C5LA 3GTJB 4NJCA 1TKWB 5JPMC 3KWLA 1EQVA 1N63A 4A3JB 1VMCA 1JW9D 5C0XI 3HOUB 2KWDA 3BVGA 1HHVA 1A2TA 4BY7B 1JALA 4AQ7A 1V97A 3M7GA 2Z8LA 5I9PA 4DN4M 2A69C 4YSXB 1KAAA 3P63A 4REZA 5D14A 1RTNA 1E7PB 4RGTA 3WCQA 2AQ3B 5C4ZA 3Q69A 3GTOB 2QILA 4HMJA 2WXQA 1WXQA 1F2ZA 4ZUIA 1AFPA 5JJZA 2EE1A 1Y8PB 4RAUC 4YIJA 2VB3X 5BMIA 2MJEA 3NUCA 2F0QA 3AE3B 5I2YA 4MHEA 2BB6A 2Z1CA 1NENB 1D1IA 3W5UB 4ME5A 3IT6B 4IFDJ 4PT5A 4NP5A 4QF4A 3D8GA 5H8YE 5BYSA 4TMAB 1IKLA 1FRRA 3P4QB 5HI1A 5C3JB 4PQXA 2YEPB 3DUZA 2L32A 3GTLB 2W3SA 1MHHE 4L8JA 4ZHOA 3M85A 4NDXA 1SYBA 1BCPD 1U4PA 3K5MA 1Q3LA 1MPEA 5EE9A 2INNE 5ELEA 1L4DB 4QUFA 2M56B 1ET6A 1GJXA 4XT3B 1PFMA 1BQQT 2EYMA 1FYCA 1JQ4A 2Z4IA 4NAWB 2VZKB 2QSDA 3SR6A 3KBGA 2WXLA 5JXVA 1Y8OB 4KKUA 4KKSA 1STNA 3C1EA 3IAYA 1TWHB 4MACA 2IL8A 1VCIA 5CYUA 4XYOA 3SK6A 2L1AA 3KLRA 5C4XB 4KI0A 1F9QA 2JU6X 2WXOA 2MJDA 1R4PB 3PMFA 4ULLA 3D4RA 3P42A 2EYFA 3MEHA 4RH6A 2NN6H 4Y7NB 1C77A 2IT1A 2PCFB 3AE1B 3VR2A 1O7YA 1YJIA 2JEAI 5LHY1 4PMCA 5IT9E 1CA5A 1B2TA 4MT5A 3V2TA 1X3PA 2GI9A 1JOOA 1YQ3B 3MHZA 4UAIA 1GUGA 2KECA 1ZXIA 5FLXL 1TQOA 2WXFA 5FK9C 5C3WA 1Q10A 2JQRB 1V1PA 1SMYC 4XWWA 1KNAA 5FO7B 4RF1A 2LKVA 4C3IB 5A35A 1BCPC 3IL8A 3AE5B 1EYAA 2CJNA 4KJNA 1MI0A 3AEFB 1HZ5A 5EKLA 4R8IA 1R4QB 2RBMA 4GZYC 3BG3A 4MIUA 3E9SA 2QIEB 1U4MA 3Q8EA 1S5ED 1II3A 1SYGA 2L1BA 2IW3A 1C9FA 1ZYRD 5BYQA 1BR9A 1FO4A 2XN9C 2N7JA 3NRZA 1PFNA 1KABA 1JWAD 3CKIB 4IUQA 1JOKA 5EBDA 1C76A 4WWMA 2SDFA 1G6ZA 4G7HC 3UI3A 2BYTA 1C8CA 1AWDA 2EYHA 4AS1A 4IOIE 5IIFA 4U68A 1C48A 1ZUD2 2DYMA 2OHFA 1F2RC 2FMMA 4C56C 4OGQC 1UAPA 1WYGA 3OMGA 5ELDA 1TWCB 2CJOA 3U9OA 2MGSA 3Q22A 2VB2X 5G5HA 1R9TB 4KGRA 1WTRA 5M5YB 1TKGA 1BBXC 1QE6A 2LY7A 2MH7A 5BN5A 2K5DA 4A93B 2EY5A 3ITPA 1L0YB 5AUIA 2WACA 1QOFA 3BZDB 4KKJA 3BVMA 1WTWA 1STEA 2PQEA 2L55A 1E10A 3MXNA 5CV8A 3DEOA 1TWGB 1RHPA 1NEKB 4K2KA 2DWQA 4DAPA 1SNCA 1QILA 4R3DA 2HTME 3MXPA 4Z9CB 2DNEA 1SFOB 4RHRA 2J52A 1SYDA 2YU9B 3B2FA 4FXGC 3SFDB 4C1NI 1YN4A 1KLUD 3VYRA 2LGIA 3MAQA 2TMPA 3A8JE 1ZKOA 1HA6A 1N61A 3S2HB 3HG9A 1PLFA 2IPKD 3MHBA 4FYDA 2PZWA 1GB1A 4HEA1 5D7GA 3TSSA 2OEDA 1JC7A 4C3JB 2ZXRA 4F87A 1G91A 5ELBA 2AUJD 4WURA 1J7BA 5J22A 1QWYA 2H4OA 3X3NA 3DXJC 1BCPB 4L63B 2JA8B 2IDYA 2OXPA 2WDQB 2K7VA 2L11A 1FCCC 1DCZA 3W2DA 1VZ8A 5HG2A 1BUIC 1UNSA 5T8IA 3SHLA 3IFDA 1RYJA 1N60A 2N55A 1SBBB 1PGAA 3L3OC 2B8FA 1RWSA 4CJ0B 4C3HG 3IKJA 4P6VF 2H89B 3H0GB 3UI2A 1CHQD 2B63B 3QWNA 2W82A 1S5DD 2NZ1D 5EPLA 5J1ZA 2AQ2B 4HAEA 2E2JB 1ESFA 1HUNA 3P1MA 1LT3D 2OT2A 2ON8A 3DWPA 3P20A 5DM73 2ENBA 1EY5A 1XX8A 1STAA 3RUZA 2N9LA 3Q24A 5ELCA 1B9RA 1JB3A 4ZRPA 2EYPA 2E3TA 3MC0B 1CQFA 3E5SA 3NVYA 4C3JG 1D5ZC 4A3DB 3HP3A 3L7ZC 3A8IE 1RODA 2FINB 2KCCA 3SR1A 1QCBD 2RDGA 2J0TD 1L6UA 4IUTA 2NB0A 4R8NA 2JYTA 3S17B 1A3VA 3C2PA 1FRDA 2X38A 3TZDA 1OQRA 3S1QB 2WINB 4X3KA 2BDOA 4XYQA 1ZXHA 3ZYYX 1AP0A 4M8AA 1YN5A 4ZLTF 4TRDA 2F03A 3EA6A 3NWSA 2F0NA 5HHDG 2R7ZB 2Y3AA 3VYUA 4OHJA 3Q0AA 4RA8A 3HOVB 3VR4A 1IBXA 2SOBA 2B2YC 5G3LF 2EZVA 5BN3A 3ND9A 3PV0A 2F3WA 1FCLA 4J3OD 2RPVA 2MJ3A 4RNAA 2XNAC 1E0ZA 1UGJA 2FHTA 3OOCA 2NVQB 1H9KA 1GB4A 1G2SA 3NBHA 2RDHA 2B2UC 2A5HA 3A55A 1BOSA 4CKBA 4N58A 5JPNC 1GXDC 3NXWA 1IHZA 1T5XD 4XWTA 2LUMA 4WIPA 5I4DA 1SNOA 1JROA 1PTOB 1PRTD 4RGOS 3AE7B 5JVG3 5I2XA 2EJGC 1DOLA 3I90A 2WNMA 1A15A 1ENAA 3A8KE 3VR5A 3AB5A 2W54A 2L83A 2HCCA 2J53A 4KTAA 3PO3B 5EE1A 1GPXA 2PW5A 4TQ1A 4K5VA 1PZKD 3K5LA 1STGA 1KDBA 3VYTA 2M2LA 5COYA 3BDLA 5TSSA 2F0SA 1TS4A 4DF7A 2H88B 5IGCA 3P4PB 5I9OA 1G8ZD 1ZYRC 4DU9A 5CV4A 5EPJA 2LFIA 1QT9A 2J4XA 1JE4A 1DYQA 1CQVA 3DMUA 4M0WA 3JAML 1CFMA 3F2UA 1FGBD 2WS3B 3AE2B 1TU2B 2A73B 2WKDA 1YNNC 1EU3A 2VUMB 1CTMA 2Y5PA 1SYCA 3BYYB 3S14B 3TDQA 4N6EB 4BA1I 3U52E 1OXVA 1PTOF 1PMRA 5J39A 3EROA 4BBRB 2V0GA 2F0TA 3MXGA 5K36G 1V1OA 4A90A 4HRSA 5K36H 3W1SA 1SMYD 4EE2A 3RD4A 1BXTA 3K6OA 2O5IC 1SDFA 1CA6A 4NZLB 1KTKA 3W9CB 4WAFA 5G3LD 1MGSA 4MH8A 3NHHA 5KGUA 5BMGA 1SF0A 4LLGM 2B2WC 1IYUA 2F1MA 1QB5D 2PMZB 2FJ2A 4KN7C 2JZPA 1KLGD 5G5GA 1EY0A 2BTEA 2I38A 2JSVX 1AZQA 3WOEA 3D4DA 4KHZA 1A6XA 5GXGB 3HUIA 1ML0D 2KEEA 3O13A 4ZOHC 1A70A 4JK1C 4XDCA 1MD2D 3ERQA 4BBSB 4EVOA 2PZTA 3T3NA 4NKLA 3SK8A 4XTCS 1EWYC 3AM9A 1D1KA 5MPOA 1ENCA 1DOKA 2CQAA 2EYOA 2TSSA 1SEBD 1D5MC 1GHKA 5LNK1 5KNDA 3PUZA 4GDLB 3CIRB 2F0GA 3IFTA 2EOTA 4I7ZC 1E0BA 2K05A 2XIWA 3SFEB 3RMHA 4BA2I 1EYDA 2PIAA 2D5GA 4HKZE 5C2TB 3MZ5A 4ZKBB 1CHPD 2A68D 3J80E 2KDMA 4ARCA 1H9SA 3MTSA 4XQQA 4QB4A 1VF7A 3R8BA 1SE2A 1LO5D 3KLSX 2BW2A 4XXEA 2XVSA 4N9TA 3S1NB 3HRZC 3DWGC 4K5WA 1B9MA 2JWUA 5JOBA 5A2QL 1XYIA 3R2TA 1EY4A 2C9OA 1KFYB 4ZRZA 2F0DA 1L4ZB 4DFAA 1HTLD 2KA7A 5EGTA 3L4PA 4UDUC 3BS1A 3RZOB 3J9CA 4DA2A 3C1FA 2MHVA 2ONQA 1DOMA 5E1FA 1SB3C 2ZW1A 1FNUA 1L0XB 1MI2A 1E2WA 2IGGA 1I4XA 3QJYA 1TVXA 4JPSA 2SAKA 3I72A 1LT4D 5E3FA 2HUGA 2O2LD 1MBYA 3R2IA 3AE8B 1FEHA 2F0UA 3NTHA 5CR3A 1XTCD 2VZKD 3HVZA 2QF7A 1V8QA 1S5BD 1N62A 5CV9A 3C46A 4ODGA 3QG1A 1EEID 2MP1A 1JOQA 2JEBI 3RFZB 1FFUA 4YSYB 4JE3B 4HEDA 4A3BB 4GLSC 1ESRA 1T6BX 4KKTA 5I6WA 1WSPA 5JEAH 1GUWA 3IT4B 2KCNA 5BYRA 1B3AA 1OQQA 2E2DC 3EUB2 1TR5A 2RVLA 4TSSA 2V3PA 1V43A 3GD7A 4RFBA 2R61A 4H13C 4WRDA 5JVH3 1VLBA 2ZW0A 2WXRA 2QEJC 1PRTF 1S5CD 1SE4A 5M5WB 2CW0D 3DEPA 4K8IA 4NAMA 3TEWA 2AQ1B 5FO8B 5LL6X 1HZ6A 1SSOA 4N9PA 3TBIB 2F0LA 5FKAC 3M3YB 2NUCA 3PO0A 2JX5A 2WIIB 4ZK9B 1NAPA 1E6EB 1R7SA 3Q6SA 1YNJD 3DWMA 2OF1A 2JA6B 2I07B 4B9XA 1HUMA 4XDDA 3Q8FA 1EEFD 3BDOA 4OIKA 1WD0A 3B9JA 5CORA 4X3SA 2BE5D 1IUEA 2G9DA 1K52A 1TY0A 3PIP3 3KUPA 4KY6A 4D2KA 3GTMB 1PZJD 1SNMA 2KEDA 1TT2A 2AWOA 4RGNA 2M9VA 3P4RB 4BY1B 1YQ4B 4CKCA 1Q12A 1GHJA 3SEBA 4F7XA 1YNJC 3BK1A 1T5EA 1BO0A 1LTBD 3OW7A 2IX3A 3LX0A 4BS9A 3I4MB 2GA4B 1WGKA 1FD6A 1IW7D 2NYZD 4OZCA 3PO2B 1I4RA 1LACA 2PKOA 3P75A 2DBYA 1V8CA 4KGTA 1ILQA 5DAUA 1RKNA 4L23A 1PRTB 3I4LA 2HDEA 2CW0C 5IGFA 5DNFA 4KMUC 1RCVD 4OO1I 3HZXA 3HGBA 4R9WA 4RWSC 2RSOA 3QO2A 3AMZA 1PDQA 2D9UA 3CWIA 3K5OA 3U9SA 3HKZB 3E56A 5M3MB 3LYYA 1RJTA 3DWQA 2WXKA 1EY6A 2LJIA 5C4HA 2HQEA 4OVZA 3T13A 4K6DA 1NI3A 4L6TB 2JSOA 2C5CA 4HSPA 3B2GA 3VRBB 2IGHA 2WXPA 5D65A 4IN3A 1XEEA 3URYA 4EGVA 2XRSD 3Q8AA 2W55A 2I2YA 3VA7A 4DAYA 1GUTA 5JEAJ 4LK0M 5IODA 4ZQ3A 2WXJA 1OXUA 1WRIA 3PUVA 5KRUA 1H9RA 1Y56A 4ZUJA 4ZKCB 3A7AB 1LTRD 1UEAB 1I6HB 3G7LA 1QNUA 2K22A 4OZAA 2F4IA 3GV3A 1D4BA 1MSGA 5IGDA 2BB5A 1L5PA 3NVVA 3OIQA 3AMUA 1T3QA 3P7JA 3H09A 4YTMB 2PZUA 2EY6A 3ETRA 2KACA 2NMQA 3I4NB 3LXFA 2BOSA 3AE9B 4CKEA 4B0EA 2GRIA 2NWGA 2FMCA 3M4YA 3TP7A 5JAVA 4US8A 1HEZE 1JCKB 1DGJA 2SNSA 5C44B 3VA5A 2WXGA 3NQTA 1ACCA 1RF2D 1JRPA 2F0WA 2Q5WD 1DM0B 2WB1B 1MHXA 1XCTL 2WXIA 4KY5A 4NMZA 5M3FB 2WXNA 1SNDA 5E4XA 1U4RA 1FR3A 2WKCA 3QIAA 2NN6G 3K7AB 2LS01 1XLPA 1LTSD 1Y1WB 2KVMA 2ZXOA 2QCPX 2A6EC 5HFYA 2E75C 5CBEE 1XO3A 2A74C 1E9MA 4ILWA 4IKGA 3NVWA 1ZDVA 5CBAE 1PUTA 2B2UA 2F0PA 3TEYA 2SEBD 5KEEA 3AEBB 2GB1A 4KJOA 3TMEA 4ARIA 3V96A 4WQMA 3VR6A 3FILB 1OFFA 3NQIA 1YNND 3Q23A 1DOIA 4FF3A 1C78A 3N9YC 2EJMA 3PUWA 1MVKA 3AB9A 4Q0FA 1FM0D 5KNBA 3QOJA 3CQZB 4RGMA 2XSCA 4IALA 3K59A 2B2YA 2M0AA 1H9MA 2WLBA 2X6LA 2Y0SB 2AUKA 4WORA 4PMWA 1EZ8A 4LTUA 1AW7A 2WU5B 2WDRB 3SK4A 3EVQA 3NUHB 4K6LA 1JWSD 1QOAA 3HEJA 1J8IA 2G9HD 1HXYD 1VZ6A 3SDZA 3CRKC 1Z6HA 1KDCA 2K5QA 3MWYW 1PGXA 2LFNA 1QG7A 3MP9A 1M8AA 4PV1C 4A3EB 4A8XC 4CGYB 4OW0A 4A9AA 3FAHA 4A3GB 2Q8TA 1W6JA 2H1EA 1WTXA 4LMQD 3MFYA 3KLSA 4X3UA 1CI3M 1F9RA 3GP7A 1UWXA 1YN3A 4OIJA 3MJ5A 2PLPA 1SXTA 1I4PA 1RDPD 3FMCA 1HA5A 2Z4HA 1DONA 3HOZB 4P16A 3FVQA 1SIJA 2K1BA 1GAQB 3G6JB 3U7ZA 1EYCA 1K8MA 4A3IB 3S1MB 4FXDA 3I9V1 2F0FA 5D3DA 1NR2A 1SAPA 1UUPA 3NS1A 2MJ8A 3GV6A 2JXMB 5EQ0A 2RA4A 4IFDG 4A6QA 4RF0A 1D2BA 1X32A 2EPBA 1A2UA 4IUNA 2DN8A 2KN4A 3IXSA 1HRJA 3HRDD 1JR0D 3BWUD 4MN3A 4KHVA 4YTNB 3D6CA 1DOYA 4G4KA 3D4WA 2XRQD 4L2YA 2AWNA 1U9RA 2N88A 2KUMA 3NE5B 4PMBA 2EELA 1XLNA 2Q8IB 1B50A 3J81E 2B2VA 3AE6B 3OMCA 1C4PA 2M00A 1KH0A 2MUYA 1WTOA 3H3VC 2KQ4X 3P4SB 5CC4A 3ONAB 1CZWA 3FC4A 1SE3A 2K5WA 1L0VB 4CHTB 2NVYB 2K33A 2K3UA 1JWUD 5DEHA 2KAJA 2N0SB 3AECB 1EWCA 1I4HA 1Z7TA 2G1EA 4KD3A 1SSNA 1C79A 1X3QA 1FNWA 5C3XA 4DK1A 3HOWB 4P2CB 1OXSC 3KBXA 1CK1A 5D3IB 3H94A 1ROEA 3K5NA 2FFKB 4TQUS 1ICWA 2LHEA 5CV6A 4FF4A 3A7LA 3NTKA 1OXTA 2F0IA 3LNNA 5IT9L 4OL7A 2B76B 3H91A 1JICA 1VMPA 4G7ZC 2K9XA 1GUSA 2IGDA 2A6HD 3FRPB 1Y8NB 1XF5L 3TP5A 1DXMA 1F2MA 2DYOA 3TUOA 1SYEA 3FPPA 1Q1EA 4ID6A 1QKZA 1ZDXA 2WV6D 1PFBA 2EXZA 3S1RB 3BIID 1O7ZA 1KRHA 3AN1A 3PUYA 2NN6I 1EY9A 2D5DA 1KDAA 1FIQA 1RTOA 2D2CC 4KKIA 1NUCA 3GTQB 3D3RA 4CJ2C 4V0BA 1CT1D 4DGZA 3AEDB 3AE4B 3VR9B 2HCIA 3FDTA 4M1UB 1I7HA 2R3ZA 1SYFA 2A69D 2ZT9C 2L5TA 5EJWA 4IZ8A 3Q8BA 3NK9A 2Y5CA 3K57A 1EY7A 1I3QB 2WXHA 1PGBA 1IKMA 1JWBD 3K0YA 3HVDA 1JWMD 4HCEA 4FVMA 4E6IA 1TS3A 5T1IA 2WXMA 1J9OA 1WVLA 2PTLA 2F0KA 3DHQA 1ZE3D 1P7EA 5C0XG 3GTKB 3C3LA 3EJIA 2R92B 2OEOA 3C8YA 4IUVA 5EE3A 3MVVA 4H7BA 3S16B 3GO5A 2WP8J 3HOYB 2QDBA 3R93A 2ICEC 2N9KA 3T3OA 2EDGA 4QUCA 5FR3A 2A68C 2BS4B 3DM1A 4V190 2EY2A 2Q8RE 1LTAD 4ZAIA 4JWUC 3ZJVA 1VR9A 5NUCA 3LWEA 2RQXA 1F77A 5KNCA 1PXUA 3BK2A 2MEKA 1G291 1STHA 5ISRA 2K6AA 1KNEA 2CU3A 3AEGB 1FFVA 1QLBB 1YJJA 3H8HA 5C4JB 1W6KA 4XE0A 1HTPA 1PRTC 3SXHA 4C3IG 1DJRD 3HOXB 4DQOC 3QOLA 1CJEA 1LABA 3FILA 3CU7A 1HQRD 2B2VC 1DOXA 1ZPSA 3KQ4A 3NSWA 2WQYB 4RKLA 4A3FB 1PTOD 3OHXC 3RLFA 1O78A 1WWTA 4XIGS 2FBWB 4USAA 4TQ0A 1FD7D 3ND8A 3IAM1 1LTTD 2XWBB 3ZQ4A 4F8MA 4WFN3 3T4AC 4C80A 4CQNA 1TY2A 1FXIA 2J42A 1LTID 2K32A 2MPMA 1EIGA 1VZ7A 3ZJUA 1PDXA 4KN4C 2L9HA 4OZBA 1VDVA 2JA7B 3E0JA 4KV6A 2ID0A 1D6EC 3LB8C 1L6VA 1AZPA 1B44D 4XQNA 1RFKA 4US9A 4OO1H 3AH7A 1VF5C 1K83B 1B53A 2K0PA 1ET9A 4ITKA 3PIO3 3S2DB 1XCQL 3A56A 2EJFC 1PFDA 2A6HC 1TKYA 1JQYD 4QMGA 1GUNA 4N59A 1H9JA 4KD4A 4K5XA 5T1GA 4ZRQA 2B2WA 2AX5A 3FEWX 3CHBD 1IYVA 2WDVB 4G57A 1EIHA 4JWSC 3V3XA 4C7YA 3L9AX 3H6MA 4B0MA 2JXTA 1FXAA 3PZ7A 4MM3B 1OO9B 1TS2A 2JA5B 3D31A 2BCOA 2RKSA 4IUPA 2EKIA 4K14A 5AFWA 1TJEA 1FMAD 1TZOA 1PYWD 4ZHPA 3VR3A 1TWAB 4DXFA 5CV7A 1LV9A 4FNFA 2F0MA 4K8JA 2B8GA 1GOZA 1Z47A 3TEZA 5C5MA 2NVTB 3SVMA 3I3CA 3I8ZA 2WU2B 3TP8A 5JEAG 2FE8A 1LTGD 3U2SC 2E2HB 5ELFA 2IJ0A 4BWGB 3M4OB 2BE5C 3CRLC 1WCMB 4ABNA 1QOHA 2PNRC 2BBCA 4HROA 1D5XC 3OPOA 1IGCA 5KYIA 1F0ZA 2KOLA 1MSHA 2PYKA 4FP5D 1LT5D 4J6HA 4G7OC 1AN8A 4IURA 4YSZB 4IFDH 1I4QA 3J80L 1BF4A 4HKQA 1K53A 3A54A 5FLXE 1WTVA 2NVXB 2DLBA 3SE0A 3GTPB 1I6VC 4RCNA 1Q8IA 2DY8A 3TP6A 1GUOA 5IGBA 4YT0B 2K04A 4FXKC 1UWMA 2LHDA 2ICIA 1WD1A 3J7YW 1ILPA 2JP1A 4EQPA 1ONLA 1IBXB 2JE6I 2F0EA 2CVRA 1DZ1A 3TN2A 3E6ZX 1IL8A 5FOBB 2W3RA 1Q90A 4RCOA 2IX0A 2FUG1 4PNYA 3DWAA 3I70A 2PW9A 2M19A 1FNVA 5HURA 1QOBA 5CGKA 5E6JA 3W3AA 4HTHA 2WAQB 3X3MA 4QCLA 2YYZA 5BN4A 2IWHA 1YMHE 1J7AA 1HFNA 2PVOD 1C4CA 2EVBA 4NW2A 4WH4A 3JAME 1PZID 2BA0A 4DNRB 1K50A 4IQZA 1K51A 3SK5A 5CV5A 1C4QA 4DK0A 1RM6C 5EKIA 2QMTA 4KGSA 2F0VA 3NP8A 1O7LA 3NPPA 3OIPA 2HDMA 1JORA 1WTPA 2A6ED 4TKOB 1NR4A 5AUKA 4DNTB 2XWJB 3ABVB 1QNKA 2INPE 3KK7A 3VR8B 3I91A 4KK7A 5EKKA 1O80A 1F9PA 3P1HA 1BMLC 4FO2A 1NVID 4A3KB 2KMMA 4RHSA 1Y69U 4HJGE 1B1ZA 1U4LA 5C0XJ 4J8QA 1CZPA 3U4EG 2V3NA 3K58A 2QJLA 1P7FA 5KIXA 4B08A 4XT1B 5KYLA 1H9SB 2B2TA 2L0CA 2QKIC 2R93B 1DD2A 1BCPF 1LT6D 3OWEB 3GS2A 3I73A 1ZEQX 4FXCA 5DM63 4GDKB 2YEPF 1B9NA 2EYJA 1ZP0B 2X6GA 3IAS1 2VNUD 1IGDA 3MFGA 1Y1VB 3GTGB 4WJWA 3BYTB 4LAAA 2KQ3A 2K03A 5EPKA 4HCSA 3GB1A 3AEEB 4HR7B 1JMLA 3I57A 3VRAB 5LL6S 1EFID 3BVZA 4J1MA 4IFDI 4KX6B 1F2YA 2LEKA 2HDLA 3TEXA 3T51B 3N52A 3OWFA 3AV8A 1PTOC 2B2TC 1EQTA 3N6RA 1TS5A 4KY7A 1XWEA 4ZYSA 2O4XA 1NCVA 3WDNA 3EGRA 1NSNS 1EWHA 1F9SA 2EYLA 1SNQA 4HN7A 5IOCA 1N5WA 3V05A 1TYGB 1Q1BA 2BA1A 2F0OA 1F2LA 4DXGA 1SNPA 2RDFA 3J81L 3WOFA 2L4NA 5M5XB 1NYQA 1G2TA 1NYRA 3KWVA 2E74C 5A2QE 3TZUA 1HFGA 3RPFC 2BT6A 2L52A 2VXWA 4A55A 3BDCA 1EZ6A 5F2DA 1STYA 3FKIB 3NWTA 4K2LA 3R3OA 1A3TA 4CBVA 3NBIA 4H2AA 1LLRD 1VDZA 3NTIA 1VRAB 1YNTE 2F0JA 4H0LC 2V4DA 2EY1A 2NTTA 4S3SA 1ZXTA 2RSNA 4CJ1B 3ZGZA 2BS2B 4O42A 1E2VA 1RD9D 1QF6A 4C2MB 3GQBA 5C0XH 4DAVA 4JX1C 4C3HB 1STBA 2PMVA 2E6XA 2LMCA 3T53B 1CZGA 5I6YA 2ACZB 2DY7A 1QJOA 1N5XA 2SNMA 1ZOYB 3T56B 3OSOA 3T16A 2PO4A 2RMMA 1S5FD 5K5PA 4OO1G 3NZ3A 2PPBC 1TIID 1EY8A 1F2RI 3D6WA 4O1NA 1HPCA 1TKEA 1HCZA