2XN9C

Crystal structure of the ternary complex between human t cell receptor, staphylococcal enterotoxin h and human major histocompatibility complex class ii
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
215
structure length
215
Chain Sequence
b'EDLHDKSELTDLALANAYGQYNHPFIKENIKSDEISGEKDLIFRNQGDSGNDLRVKFATADLAQKFKNKNVDIYGASFYYKCEKISENISECLYGGTTLNSEKLAQERVIGANVWVDGIQKETELIRTNKKNVTLQELDIKIRKILSDKYKIYYKDSEISKGLIEFDMKTPRDYSFDIYDLKGENDYEIDKIYEDNKTLKSDDISHIDVNLYTKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T CELL RECEPTOR ALPHA CHAIN C REGION
publication title The Structure of Superantigen Complexed with Tcr and Mhc Reveals Novel Insights Into Superantigenic T Cell Activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 70
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2010-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
C PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2xn9C02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2xn9C01
1XTCD 1FD7D 1PYWD 1PTOD 4RH6A 4RGTA 3R2IA 3KLSX 1TS2A 1S5CD 1I4XA 1FNUA 1SJHD 1S5ED 2J4XA 2RDHA 5ELFA 4RFBA 2NTTA 1PTOF 1KLGD 1I4HA 4BWGB 1TS4A 3W2DA 1AW7A 1L0YB 1PRTD 2AQ2B 1ET6A 4ZYSA 1EEID 2Z8LA 3DWAA 4C56C 1DJRD 2WV6D 4DXFA 1YN4A 1KTKA 3BYYB 1PRTF 2XN9C 1LTRD 3V05A 1JWMD 5D3DA 1LTBD 1EU4A 3MFGA 1M4VA 3TSSA 3BYTB 1JQYD 1EU3A 1SEBD 1RD9D 3R2TA 1ENFA 1SE2A 2CHBD 4L63B 1UUPA 1EWCA 4UDUC 1L0XB 2XRSD 1TY2A 3R8BA 4TSSA 1JCKB 1D5XC 1BCPD 4RCOA 4RHRA 4Z9CB 1PZKD 2AQ1B 4OHJA 1D5ZC 4RHSA 1SJED 1V1PB 1YN5A 5ELEA 1LT4D 3DWQA 3MC0B 1CHQD 1JWSD 2QEJC 1BCPF 1STEA 5D3IB 1FNVA 2ICIA 1TS3A 2R61A 3EFXD 4RGMA 2IPKD 4NZLB 4RGOS 1HXYD 2AQ3B 5FKAC 1V1OA 3CHBD 1LT6D 1HTLD 2SEBD 1S5BD 1GOZA 1LTTD 1LLRD 1HA5A 5I4DA 1RDPD 1AN8A 1I4GA 1PTOH 1UNSA 3BVGA 1V1PA 4O1NA 1FGBD 1TY0A 1B44D 1JR0D 1MD2D 1JWUD 1D5MC 4RGNA 1ESFA 1SE4A 1EEFD 1EFID 1G8ZD 1LO5D 1LT5D 1LTAD 1PZID 1HQRD 3GP7A 4L6TB 2XNAC 1CK1A 1B1ZA 1FNWA 1TS5A 1LT3D 1RF2D 1DYQA 1D6EC 1PTOB 1RCVD 1I4PA 3EA6A 3DWPA 4DXGA 3BZDB 1SBBB 1LTSD 2XRQD 1S5DD 5ELBA 3BVZA 3SEBA 1S5FD 2NTSA 5FK9C 1PTOC 1QILA 1BCPB 5ELCA 1SE3A 2TSSA 3O13A 1XXGA 5ELDA 1LTGD 1PRTB 1PZJD 1F77A 3URYA 1ET9A 1I4RA 1BCPC 1BXTA 2RDGA 1PRTC 3BVMA 2IJ0A 5TSSA 1LTID 2QILA 1T5XD 1YN3A 2G9HD 1CHPD 2O2LD 1CT1D 1SXTA 4K6LA 3OWEB 1I4QA 1CQVA 1KLUD
chains in the Genus database with same CATH superfamily
1C4QA 4IZ8A 4A3KG 2P5ZX 4A20A 3LYYA 3H7PB 3RLOA 3J80E 2WP9B 5M5YH 3KUZA 5BYQA 1K8OA 4A3DB 3ITPA 5MPOA 5KNDA 4A93H 3MWYW 1FMAD 1IBLL 4QF4A 3P20A 4BOZB 4JV5Q 2KLGA 1IBKL 1Y8OB 4K5WA 4C00A 4GDKA 1KNAA 3FKIH 4ABNA 3GE3C 4NJCA 1G291 4LJPB 2FBWB 4HVBA 2N3SA 2VQFL 3UIOB 5T1GA 2F0UA 1SN8A 4GDKB 4E3CA 1Q82C 2ES2A 1ZYRC 2HDMA 3VR3A 4P1BC 5BN3A 3PT2B 5I9OA 2A8VA 1R4NB 5HG2A 4JI7Q 1U4RA 5AEKB 5HKHA 1QF6A 3EECA 3Q0AA 4JBMA 1QE6A 2YTYA 1TVXA 3L3OC 4HSPA 4GMVA 3SHQA 1MHWC 5EBCA 3I90A 2ASBA 4UDUC 4JW0A 3UDXA 2KWUB 3B2GA 3N20C 1MIUA 5A2QL 3GTJH 3PS6A 2L0CA 5GAEC 1Q1EA 1D5XC 2UWQA 4C3HB 1QT9A 1XJVA 2N1VA 4K5XA 1FJGL 2WXNA 2B2VC 2NS5A 1U5KA 3ECIA 4BBNC 1EY0A 2D5DA 3HOYH 3U4VA 4JI3L 3PF4A 1OEYJ 3ONSA 2KCTA 3AE6B 4YSYB 4X64Q 5A2QE 3C0RB 1PYSB 3T56B 3CHBD 1SNMA 1BBUA 3IL8A 2NVYH 2SEBD 1WY8A 2X6LA 3PIP3 4DR3L 2WWZA 4G11A 5C0XI 2PNHA 4GU2A 1V9JA 3AE1B 3PUXA 1J0GA 1EY8A 1F2LA 4LW1A 1V1PA 3CWIA 1I50H 2MQHA 5M9OA 5EE0A 1JWUD 1TU2B 3MHZA 4MH8A 2B63G 3VQIA 4DAVA 4DR7Q 3KWLA 4YSZB 3AN1A 3V2TA 5I6WA 1K8AC 1V43A 2V3PA 4XQQA 3Q8CA 4GNXA 3K59A 1E7ZA 2VQEL 2F4VL 4LFBQ 3VFKA 4B3TQ 1K51A 3PGEA 2JA6G 3QC8B 1ISNA 2K5HA 3D3RA 2GRIA 1D6EC 1VQNA 3N1XC 5D65A 1PTOB 1RCVD 3QOJA 2J53A 4GNXB 1X65A 1L4DB 3KQ4A 3KYHC 4JI5L 2HDLA 3GTMH 2BWES 2KTFA 1SMYC 1VF5C 4RKLA 3L17A 3CCVA 1UEAB 1JW9D 4MGZE 2B2TA 1HNZQ 3S15H 4AQYQ 1WTQA 4DR5Q 4JBKA 1MG8A 2CWPA 1ET9A 2OHFA 4X66L 4GSWA 1VLBA 2ZM6L 4UP7A 3APCA 1IKMA 3R3MA 1KXLA 5C44G 1F2RC 1TWAB 2IJ0A 4JCVE 2V4IB 3KVFB 3TJPA 1OO9B 3DBHI 3U4ZA 4JI6Q 2GVAA 1C4CA 1N63A 3IKJA 2I5HA 2W54A 3A4RA 2H89B 3BK2A 1KLUD 3RR5A 4YY3L 1FD7D 4BBRG 2D3CA 2PW9A 2Z59B 4WWOA 1QOFA 4DA2A 3KLSX 1PFBA 1XCQL 4OX9L 4AJYB 1WMHA 3SFEB 2RHQB 2RDBC 3AU7A 3HS0C 3CQZB 1WGKA 1PTOF 4L5SA 5I2XA 1L0YB 4A3KB 1WMHB 2LD9A 2LRUA 3GTGH 1ASZA 5J3BA 4POFA 2DYBA 2K1FA 4RWSC 4FJZA 2CQOA 4K1RB 1KTKA 2ZJPA 2WXQA 1T9HA 2MBEA 4CHKA 3NVZA 1SNQA 1W2BA 3UDFA 2EY5A 3HHMA 4WJQA 2WB1E 5KNBA 1R9TB 2ZPNA 2EY2A 4LCDE 4HMIA 4PMBA 2A68C 2V3NA 1XF5L 4TMAB 4JI8Q 1PH6A 4QUCA 3IFTA 3H7SA 2HD3A 1K83B 1STNA 1K8MA 3K58A 2DHZA 4Y7NH 4JK1C 4X65L 2PZTA 3PZ7A 3CW2C 2PW5A 3ND9A 1P8LA 2A6EC 4L2YA 1OXXK 3E0JA 4RHSA 1SJED 5JHBA 2NZOA 2NVQH 2LVPA 2KVMA 5K36H 5ELEA 1DGJA 4F1SA 4RNAA 4IFDI 3PLUA 4HJ7A 2V9HA 4N9PA 2WDTB 1VQGA 1F9JA 1QVCA 3UE1A 1VQ5A 1RJTA 1HTLD 3DLLA 3BZCA 1F2ZA 4UP9A 4J3OD 4OWXB 3AECB 3K7UC 4DU9A 1Y1WG 4ODGA 2KHIA 1HA5A 3UDIA 3S1NB 3PUVA 2WNMA 1XQQA 2K75A 4A3FH 1GVPA 3T9LA 1KAWA 4FF3A 2J0KA 1JR0D 3K5LA 4FP5D 4HN7A 1XPUA 3IVFA 1LT5D 1EM7A 3D6CA 4GZYC 2WXKA 3KLRA 3S14B 2KJHB 2L1BA 3W1YA 2K14A 3J81i 5C3JB 4R3DA 1O7ZA 1WGYA 2N88A 4LFAQ 2BKFA 2MRPA 4GKJQ 1V86A 1ZYRD 2IW3A 2JXTA 2B63B 5FLXc 2IL8A 2WXIA 2ALYB 3L16A 2DNFA 2ZTEA 3TQYA 4FF2A 2JZZA 4XT3B 2VL6A 3S9WA 2RVLA 2JA6B 1A63A 2FMMA 5E4WC 3KWVA 3J81j 1XXGA 4K0KL 1KC8C 2EXZA 2JK8A 1Q8KA 2MHVA 2CKHB 2QIEB 1ZPSA 5J17A 4M02A 2KJXA 4YCUA 2G4SA 1BR9A 1DOKA 2XGTA 2K33A 2HE7A 3AU4A 4XYCA 2I38A 1BCPC 4KKTA 3W1SC 1GNUA 2LVOA 5HFYA 4FXKC 2LMCA 2KC1A 2RDGA 2LWPA 1PRTC 1J5EL 2HTME 4OELB 4GIVA 4YHHQ 4IM0A 4UP8A 3PO0A 2ENBA 1LGRA 2EKEC 2ZT9C 3J81E 1N9WA 3R7RA 1SFOB 1N62A 5H1SE 1TBEA 2KMAA 4HK2A 4W9FA 1Z6HA 5EDSA 3K8AA 3NSWA 2KLCA 3AEEB 3G4SA 1X3PA 4C3IG 2N9KA 3S17B 3DBRB 4JI0L 4KHPQ 2RSOA 4Q0FA 1WH3A 4IM3A 2ZW0A 5EPJA 3AV8A 3ZKJC 2MPMA 3VH4B 3AE8B 1JQ4A 3P63A 1ASYA 1VQBA 3T4AC 4DV3L 3P42A 2Y3AA 4H7BA 3W2DA 4IFDH 4RA8A 4BBRB 3AEAB 5GXGB 3RN5A 1MHXA 2BE5C 2YYZA 3HG9A 1EWHA 5C6AA 3AB5A 3PSEB 1IBML 1JOKA 1SF0A 3LDZE 2VH2A 5T1IA 4ANWA 4MGKE 3A56A 1A3UA 2H4OA 3OTOL 5D94A 3TP6A 1DOXA 1PA6A 3ZTCA 1X54A 2XVSA 5J18A 4LNNA 4HDQA 2X8XX 1EQVA 4US9A 3PV1A 4NXMQ 4ZKCB 1SMYD 3HEJA 1E5WA 1EOTA 5CX3A 4DAPA 2HUGA 4MZ9A 1P98A 1PFSA 3I4LA 5JEAH 1NJIC 2JRHA 2LZ6A 1II3A 2K25A 3VH3B 1U4PA 1QNKA 3G6JB 3T13A 3RMHA 2KOXA 4M0WA 2IGGA 2K9XA 3AM9A 4RCOA 3TZUA 1PQSA 1FCLA 2XSCA 4OHJA 1D5ZC 1FPYA 2K8HA 1H9KA 4M8AA 3JC66 2L8JA 3QX1A 4M0WB 1TS3A 3DM1A 3KF8A 2LXCA 3PLVA 1TKGA 1I5FA 3S24A 4HCEA 3DBRI 3RN2A 1V1OA 1CSPA 1X32A 1XYIA 2K6AA 2OF1A 3IAYA 3NEMA 5EPLA 3Q3NC 4M00A 1S72A 1C78A 2KO3A 2R7FA 4PNYA 1LTTD 1BO0A 2B2UC 3KF8B 3NS1A 1H8CA 2PEAA 5C3EG 3WAMA 1AN8A 1I4GA 2BYVE 1DOLA 1E1TA 4WURA 2EYOA 3U52E 3SVMA 2DENB 1B44D 2WYQA 4BKGA 3CCRA 1K73C 1Q1BA 1AFPA 1XNRL 2D10A 2MJ3A 1PFDA 1B3AA 3Q23A 3AE7B 3H94A 5IP7H 2MQJA 3FC4A 4MGIE 2IX0A 1Y1WB 3TP8A 1N34L 4PMCA 4XGAB 2JVCA 3AB9A 4I7ZC 1KQSA 3GTPB 3MEFA 4I6PA 3DM3A 3TL5A 1DYQA 4H0LC 2FUHB 3K6OA 3VRBB 4TKNA 4ZRJA 3WALA 3OMGA 1OQQA 5JJZA 2QCPX 4KKSA 2ATWA 2JPHA 1KJTA 1WVLA 1K50A 3M3YB 1V6EA 3HOVH 1EO6A 4WJWA 1D2BA 2C60A 3EFCA 3QWZB 3CRLC 1YNNC 2TMPA 1HZBA 2R93G 1NDDA 2HIXA 1X1MA 2F0GA 1M1KC 2BYEA 4MSMB 4ASWC 3KYCD 2ZTCA 3BG3A 3VYSA 1N36L 1EFWA 4EEWA 2JJQA 3H1UA 4DFAA 5BR8Q 4OO1I 4CHTB 2FE8A 3D8GA 2CU1A 2ASQA 4K5VA 4RM8A 3PO3H 3CD6A 3PHWB 3MTNB 2Z6KA 3MTSA 3NTKA 1HNXL 4G7ZC 2JN4A 5C3WA 3T53B 2F1MA 2NN6H 4BY1G 2R2QA 2O2LD 2O4XA 4K6LA 2CHWA 4GOCA 2EKIA 1FIQA 1YITA 4K81A 4NQLB 2HIVA 2JE6I 5CYUA 4GKKQ 2V0GA 2F0NA 2O5JC 1P1AA 3RUIB 5G2NA 2QA4A 1LACA 2RDHA 1VZ6A 2L12A 4UAIA 2BT6A 1JJ2A 3NZ3A 1Q10A 4A3GG 3KK7A 2N9XA 1MPEA 1EYAA 4A93G 3T1YL 4YWGG 4HPMB 3VYTA 4HIKA 4P72A 4C3IB 1MFWA 3ZNZB 1BDOA 1PH5A 4N8FA 3S16H 1WYGA 4TUUA 2F0KA 4DXFA 1OXVA 2ZJRA 3W5VB 2WQYB 3WA0A 1BUVT 4GOPC 2NWGA 1E8YA 2BB6A 5IGEA 2R6GA 4PS3A 4XYOA 3RNUA 4A3MG 3BYTB 1XMQL 4ZHPA 1GM5A 3I4NH 2LGSA 4UPAA 4WJOA 1WTHA 2KA7A 4QMGA 4N59A 4XT1B 4CKCA 1FFVA 1TYGB 2N4FA 3RN9C 3Q8DA 1OXSC 1BCPD 2YV5A 4W9CA 2PCFB 2EY6A 2WU5B 4HXDA 3VTUA 1XT9B 1ZP0B 3L10B 2E2HB 5E6PA 2YTXA 5FO7B 2LFNA 2AWOA 4WH4A 2E2IH 3HOYG 2ZCCA 5KGUA 3VUXA 1E24A 2YU9H 2FCQA 4X62Q 5M5XB 5TR5A 3ZLZA 1ZXIA 1H95A 4V190 2W55A 3NJTA 4US8A 1STYA 3DPDA 4WWMA 1K8RB 4LUVA 2ZEQA 3KJOA 5J2RA 1D1KA 2NZ1D 3TREA 3VR2A 1SSOA 3PIO3 1ACCA 4HJKA 2C7NB 5M5WH 3NTHA 5IY0A 3DHIC 3D6WA 2UXBL 5DEHA 4RMFA 4LF9Q 1OQRA 2KWVB 3Q14C 4M01A 4OZCA 4A6QA 2KK8A 1MD2D 4P7IA 2DZKA 2KAJA 2MWSB 3V6EB 4DQOC 1ICFB 3P4SB 2ZNVC 2CU3A 1WR6E 2FNJB 1LO5D 2GB1A 1VF7A 4LK0M 4AWJA 1QNUA 5C3EB 2UUBQ 3R3OA 1CK1A 3PMFA 2Q2TA 4MELA 4V0BA 3I2ZA 1DZ1A 5JVG3 3H6MA 1YX5B 3M4OB 2R7ZB 3ZRFA 3CU7A 1VRAB 1K0SA 4R4IA 1SLJA 1TWCH 1EY9A 3NTIA 2D9UA 2KYWA 3A9KA 3BZDB 4I65A 3SK4A 1J7BA 1LTSD 2DGYA 4CKEA 4ZUIA 3I63C 1IXRA 3ZJTA 2K05A 2H1EA 3A9KB 5BN4A 1Z9FA 1YEZA 3K0XA 3PF5A 5BYRA 1I3QH 4AQ7A 3CP0A 1FVIA 1SE8A 1VQPA 2E2JH 1WJ4A 2CS4A 2NPTB 2BTEA 1RFKA 1HZ9A 4WJPA 3BVMA 1C0AA 2R93B 1V5OA 2V4DA 1WGHA 5TSSA 2K3UA 1K0RA 3QARA 3CPFA 1ILQA 2KZRA 1AEXA 4S17A 4PS8A 3QB3A 3MXGA 4A4IA 3V60A 2MO1A 1XTCD 2K5VA 3T51B 2M56B 3E5SA 3ZQ4A 1YNTE 1Y1VG 1WCMB 3PUZA 3I9V1 2F0WA 3K81C 1TWFB 4BY1B 4DR4L 3ZJYC 2NTTA 5HURA 5EJWA 2NVXB 2NVUI 1JB3A 1O78A 2QDLA 4LDTB 2WXRA 1BBWA 1DOYA 1VQHA 1G2TA 2Z4HA 2BS3B 2E2DC 1ZXTA 4WFN3 1BVSA 5EKKA 5M5YB 2N55A 2C7HA 1E7VA 2NBUA 1FO4A 2R3ZA 2L0TA 4A93B 4B3ML 2F0FA 4GN1A 2KJRA 3Q24A 5DPTA 3BU2A 2QDFA 3W3AA 1HZCA 2MNAA 1XMOL 4KSLC 5C0XG 1B70B 4MDKE 1QCBD 2K6DB 2I46A 4MNOA 4DUZQ 1L7YA 4KDIC 2C9WB 5H8YE 1YNND 3AMZA 2LGDA 5BMHA 2CHBD 4DHZB 4YT0B 2N9EB 3P4PB 2N49A 2AL3A 5GROA 1JC7A 2K28A 1WGRA 3HOUH 1B2TA 3DVNU 3DOWA 2CH4A 4A3JH 1F2MA 4XIGS 3UE0A 3KJPA 2JA5G 2JRIB 2PMVA 3EN2A 1JB7A 2G45B 3PRZA 3PPAA 2K5DA 2BDNA 1YHBA 4ILWA 5CV8A 1IBKQ 4BY7H 3TEYA 1H9MA 1RTNA 3APFA 4P1CC 1G6JA 2B2YA 2BF8B 2K39A 4TQUS 4JYAL 1Q46A 3DDCB 4OWWB 2KDIA 3A7LA 3VAWA 3UI3A 2M9VA 2G3QB 3GTJB 3EJIA 2GMIC 5D14A 2EMSA 4DWFA 1WTXA 3BDLA 4A8XC 4F7XA 5AUIA 2IX1A 4KJNA 1GUAB 2N1WA 4DV6Q 3HOYB 3SHLA 3I72A 1WFYA 1L2NA 2REXA 2C35B 4ZAIA 3A4SC 2H88B 3D4DA 4A3FG 2AKWB 1CM9A 2IHEA 2HTHA 1MJEA 1IGCA 1N32Q 1RFAA 2NVYB 2DUDA 3GP7A 1EIHA 3KOJA 3U9SA 1FJGQ 1VQKA 2JA9A 4II2B 3RNBC 1EYDA 3MEHA 5DM73 3AH7A 1RF2D 1PGBA 3SE0A 2B8FA 2K8BA 4MGYE 1E2VA 4KTAA 2AWNA 1HTOA 4K2KA 3U4EG 1S4ZA 4JI3Q 1VQEA 3EA6A 2AUJD 4LF7L 1I50B 2FCMA 3TRZA 2F0OA 1SBBB 1WYDA 4IJHA 3IHPC 3S1MH 4OVZA 4PYZA 4G3XB 1XX8A 4B95A 1WTVA 3TMPB 3GTLH 2JYEA 1J7AA 3V96A 1BT0A 4AS1A 2FFKB 2D11A 1LTGD 1SNDA 3C8YA 3A0JA 4DR3Q 1F9PA 4DNRB 2ZPYA 5FLXE 2L11A 1IW7D 2UUAL 3Q3MC 2XEWA 4A55A 1N8RC 2L76A 3I5JC 4AH6A 5HI1A 2UU9Q 2A73B 3GTMB 2DYOA 1T5XD 4QB4A 1JWBD 4EGVA 1KABA 4IUTA 2F4VQ 4ARIA 1I4QA 1CQVA 4GN4B 2N7EA 4HIMA 4B3SQ 4KKJA 4IWOA 3NK9A 3OIQA 3DQVA 1EL0A 4GN3B 1GG3A 5FJ8G 1S5CD 3GTOH 1VZ8A 2XK5B 4JI5Q 2WHIA 2RPVA 2WDQB 2DAFA 1F9RA 3RT3B 1WGDA 4R1JA 5CV7A 4LTUA 3LWUA 1HNWQ 2K5NA 1SNCA 1B9RA 2K04A 4DV2L 3VR5A 4F8MA 1B53A 2K22A 5JZEB 2I5MX 3PVLA 4WJNA 4IFDG 2KX3A 1CKMA 3ZO5B 2JXMB 4IOIE 1WJNA 1HE8A 2L5TA 2MO0A 3NENA 2ZM6Q 2D2QA 1NYRA 4TV3A 4A3CG 4JG2A 1K52A 1J7CA 3U50C 1RHPA 2RCFA 1A8VA 2DBYA 2ZXOA 1SEBD 2MJEA 4JI4Q 1ZE3D 1IUEA 4KJOA 4FBJB 3T8MA 5G3LD 4LF4L 1JJCB 5CGKA 3Q6SA 1L0XB 1V1QA 1VQFA 3K7AH 1NTGA 2HQEA 3S1QH 1YNJC 2F3WA 5JEAG 1JOQA 2NCNA 4YTPB 4W9HA 2B2WA 4EOYA 5KRUA 3OLMD 4F7ZA 3MHSD 3K80C 1GUTA 1B3QA 1STBA 5C4XH 4UY8C 1XLOA 4WWNA 1WI0A 2J0MA 4AYBB 1VQCA 3J9CA 4CO7A 4ANVA 5KHQA 5EAYA 3NY5A 4O2DA 1HHVA 2JA5B 3TIXA 1UE6A 1AWDA 5J22A 2RSNA 4Y7NB 1ZKOA 5JH5C 1GUNA 4FDBA 3NG0A 4OZBA 3GV3A 1GXDC 3P7JA 4NAWB 2MJDA 4P6VF 1EOVA 1UWMA 1NI2A 3WAPA 2PVGC 3AEBB 4RGNA 4C7ZA 4S0RA 5CV6A 1B9NA 4TQ1A 3OW7A 5IODA 1IHZA 4KD4A 2NUCA 4PZ7A 1FR3A 4R4TA 1TKYA 2NR2A 1FNWA 2F52A 2A69C 2XIWA 4LUOA 3OWFA 4QJFA 3Q3OC 1VQLA 4BKSD 1VD2A 1RRBA 1EY7A 4A3FB 2B2TC 4DXGA 3TUOA 5C4ZA 1J19A 2A6HD 2R2OA 1Y69U 4RM9A 1PDQA 5ELBA 2BYFA 1IZ6A 3DBHB 1TKWB 5IGGA 1GC7A 2OJWA 2B8GA 3O13A 3LXFA 2CQAA 5ELDA 1YJNA 3C46A 3HOVG 1C1YB 3A9JA 1YJJA 3HOZG 2WLBA 4HDOA 4N6EB 3SU8X 3A5ZB 5LXIB 2PI2E 3SK6A 3X3MA 1E9MA 1YQ4B 2Q2IA 3NRZA 1V49A 2JWZA 4K8IA 5IT9L 1NBWA 3A9JB 3H3VH 5COYA 3H0GH 1LTID 1JRPA 3PREA 1KIXA 4XZ4A 2LGXA 3ZDMC 1CHPD 3E0EA 2QMTA 1PHJA 1IKLA 3PRPB 2PIAA 1YIJA 2L0FA 2N9LA 4ZOHC 1WXSA 1T5EA 2NN6G 1MJCA 4G7OC 1MI0A 1SB3C 5AUKA 1PYWD 3E3XA 3R2IA 1IYVA 2VZKD 4LNIA 2JZ3B 4ZDVA 3RLFA 1S5ED 2BDOA 4CKBA 1C4AA 2M4NA 4RFBA 1EF5A 2WXFA 2EQSA 2KHWB 4FHJA 1SNOA 3D31A 5CC4A 2NMQA 1DOMA 5LMNQ 2GBKA 1GUSA 5DAUA 3TS2A 4HJAA 5JJKA 2DY7A 3ER0A 1WM2A 1FM0D 5M3MH 2WFWA 3C2PA 5IOIA 3WANA 4HEDA 4DBGA 3VA5A 3GE8C 1VDVA 3HOXH 3QHTA 4NNJB 1OGWA 3B2FA 4OL7A 4A76A 1AE2A 1Y14B 3H15A 2IYDB 2EYJA 1YOVB 4WQOB 3DVNV 2B2VA 4POGA 1TR5A 1R7SA 4Y52H 1H9JA 4NB3A 4BXXG 1OXUA 1NMFA 4L5RC 3L9AX 4DDGD 5HGTA 4DHZE 2F0DA 1HCZA 1QLBB 1YQBA 4XDDA 3QG1A 3BS1A 5CBAE 2HT1A 2B39A 4DV0L 4LF8Q 4JI0Q 2JF5A 2JSOA 3S1RB 4DV4Q 2K5QA 4JGHB 1WR1A 3I4MH 1QZEA 4DV3Q 1UEBA 5I6YA 4IQZA 1U4AA 1E7PB 1CHQD 3NBHB 3AFQA 1P7EA 3VR8B 3M4PA 3VXWA 2IY1B 4IC7B 2IPKD 2JQOA 3AYHB 3ULLA 4N9F4 3A5UA 3RCZA 4KGRA 4OW0A 3TBIB 4HRSA 2NB0A 4DV7L 4F8CB 1S5BD 4BBSH 5KIXA 3TEXA 1Q0WB 1ILPA 1T6BX 1HR0Q 2EYHA 4JV5L 3KBGA 3DHGC 2MCNB 2I2YA 2LUEA 2F3IA 3S2HH 3BVGA 4IG7B 3AQQA 4O1NA 3S2DH 2IO0B 2R92G 4C3JH 4OO1G 1NMGA 4WQMA 4A3BH 1D5MC 5M3FH 4W9GA 1ESFA 1SE4A 4A3DH 2PPHA 3P2BA 4DK5A 4LNKA 4ME5A 5IO9A 5D6JB 2INCC 2BOSA 3A7AB 2PE6B 1T0RC 4LUZA 5EE1A 4BBNF 5E3FA 4L23A 1L1OA 4DR1Q 3QA8A 5IP4D 5EPKA 2KX0A 1MKHA 1Y8NB 5CBEE 1NR4A 1J8CA 3KLWA 3APDA 4BAXA 3DWPA 1E10A 3E6ZX 1L1OB 2WDVB 2KN4A 3G48A 3E9HA 3PZDA 4ZRQA 3JAML 4RCNA 2IX3A 1R4QB 4HJ5A 1SYDA 5ELCA 1MHHE 1SE3A 2UYZB 1K9MC 1A3TA 3DVGX 1BMLC 3OPOA 1YNJD 1YZ6A 3GB1A 1U4LA 1A3VA 3NXWA 4YL8A 2IDYA 1IYFA 3TP5A 1GUOA 1HUNA 2HDEA 4HCNB 2KOLA 4X64L 1SGHA 5GAHC 4JWUC 4XQJA 5JXVA 3MZ5A 3M3JA 1HPCA 2HHHL 1SYCA 1K8GA 1YJ9A 3HOVB 2J0JA 3HOZB 3E9SA 1AH9A 3X0WA 3FDTA 4ICVA 2RSUA 2Z0SA 4X57B 2L1AA 2M1MA 1A6XA 2O6VA 4CQNA 5C4JH 5BN5A 1FFUA 4LLGM 5DCNA 1PTOD 2IY0B 5HHDG 2LHDA 1A70A 3AEFB 2Z0EB 4PT5A 2LXJA 5IYBG 3NUCA 3M7NA 1B50A 2DZIA 2KDBA 4XX5A 1GKHA 3PO3B 1U4MA 4DR7L 4NY0A 2O6VB 2B76B 3T1HQ 4RF0A 3A8KE 1F9SA 3J7YW 4I6NB 2RKSA 4B3TL 1I94Q 4PYUA 2WX0A 5C0XJ 3RFZB 3UQAA 3CF5A 2C9OA 4G57A 1N36Q 4ZYSA 4GGQA 5LLIA 1LYLA 3F2BA 1VQDA 4C4VA 2A69D 1DJRD 3B9JA 2K5WA 2RR9A 1YIWA 1AZQA 4YWLA 4HIDA 2OCEA 4K6DA 1JWMD 1TKEA 3BK1A 5D3DA 2NBVB 2RA4A 1UE5A 1LTBD 4OEMB 2JA7H 3MJ5A 4C4VB 3NBIA 5IN7A 4GS3A 5JPMC 3TSSA 3NZSA 2EJMA 1FCCC 1EU3A 1F2RI 3CKIB 4DR5L 1EIFA 1D3ZA 4R4CA 4EQNA 3S16B 1ZXHA 4X3TA 2Y5PA 3M95A 3WIMA 2EIFA 2JX5A 3OHXC 4QCLA 1L6UA 1EWCA 2UU7A 4HJGE 3GD7A 4IPGA 4ACFA 3O65B 4HCSA 4ID6A 2MP1A 2NBFA 1JCKB 4TSSA 1EYGA 3ICEA 5BMGA 2X69A 1DXMA 4ALPA 1XNQQ 3HOUG 3SR1A 5F2DA 2PKOA 4KSKC 4JI6L 1X3QA 1YQ3B 4K7UA 3T1YQ 4A3JG 2Y0SG 4AYBE 3F2DA 3BDCA 2M2LA 1WSPA 3EFUA 2KQ4X 2Q2HA 1JWSD 1VQOA 3I4NB 1YX6B 1GD7A 3W5UB 1VQ6A 2R61A 1UAPA 4B08A 1C3TA 1YHQA 5FKAC 4WAAA 1OTRB 1XWEA 3RUZA 4YSXB 1AARA 2DLBA 3F8TA 1GOZA 2A1AA 2LXKA 2PZWA 2NN6I 2EYFA 4NMZA 3RNFC 4OGQC 4A3LG 5HGQA 4TQ0A 2UXCQ 1YD8U 4J6HA 5CTRC 1XMQQ 3NPPA 3IT6B 4DHJB 1TY0A 2E2IB 3KBXA 1WX7A 4BOSC 2F0HA 3CMAA 2YU9B 2BQQA 4EZLA 1CSQA 4MSQB 1EEFD 3FMCA 4JOIC 1EFID 1TQOA 4A75A 3MHBA 1LM0A 3CQZH 2V1CC 5D7GA 3NVYA 1WX8A 1TS5A 3RULA 1G6ZA 1N33Q 2LEKA 5M5WB 2M0XA 2R92B 1KF6B 4LNQA 1EUJA 1EZ8A 4XYQA 3W1SA 1FEHA 4IOAA 2GBRA 4JI8L 4ZCKA 2JWUA 3I57A 1KFYB 4FXCA 2XRQD 1O80A 1E8ZA 1JROA 2LGYA 1Q90A 4IUVA 2LSSA 3ZGZA 3K0YA 1F2YA 1BCPB 4F88A 2Z6KC 4C2MH 5CMDA 4FO2A 5JJIA 1HRJA 3L4PA 3B1LX 5IGDA 1PRTB 3C1FA 1KRTA 5JPNC 2KHJA 1HA6A 5KEEA 4NKLA 2C5LC 2D2CC 2R7ZG 4HSVA 2FCSA 1WM3A 3E56A 1TWCB 4LAAA 4DR6L 4DV5L 2JEAI 1NENB 4AUQC 1JALA 1UGMA 2DX5B 4TRDA 1PFMA 2EELA 5IYDH 2Q8RE 1YMHE 3FKYA 3NHEB 4R8IA 4FXDA 1Z47A 4KN7C 2IZVB 2CWAA 1LQBA 4K2LA 1WJUA 1C9FA 4HIOA 3VDZA 2KUMA 3PSIA 1IL2A 4KV2A 3I55A 1I3QB 5AFWA 2PTLA 4IFDJ 1OXTA 4RH6A 1TJEA 1K3BC 4P2CB 3Q6BA 4FULA 5IWAQ 2MHJA 3CCSA 2QEXA 1G51A 2AX5A 3SD5A 1I4HA 1TS4A 4KZ0A 1N5WA 3NZUA 3GZNB 1GJXA 2DNCA 1WXMA 4YXDB 1L4ZB 4LFAL 3BY4B 3L54A 3WOFA 3KF6A 4YCWA 1E3PA 1H9SB 4GKJL 1SMXA 2IY5B 5D2MB 3GS2A 4FADA 2WKCA 2PW7A 4HLEA 1NE3A 5IT9c 2WV6D 2W3SA 2D3GA 1WCMG 1QG7A 1LFDA 1A2TA 5DPRA 1PRTF 1C4PA 2PQEA 1F52A 4ZHOA 5JEAJ 1EY6A 3KF6B 5DM63 2JUOA 1TWHH 2K0PA 4MTNA 4LF5L 4L5QA 5E6NA 4WORA 2K7VA 2RD0A 1PDXA 2QW7A 2OTJA 4ZLTF 2N9PC 3HRZC 3ENEA 5IKCM 1HJPA 1RD9D 3Q3FA 3NS8A 2DZMA 4KKIA 3J7AF 5DNFA 2E3TA 2L15A 2B63H 1F1HA 4DXAB 2F4IA 2XRSD 4Q2JA 2CCZA 1DD2A 4KKUA 1WXVA 1WZ0A 2R7DA 2LY7A 4Z9CB 3A55A 4BA2I 4ZQ3A 5ISRA 5FOBB 4IURA 1QVGA 3CMEA 4DN4M 2E76C 5C4XG 4K3BA 3FKIG 3RZDH 2B29A 1ZUD2 2Z9HA 2M0AA 1PMRA 3HOUB 4DDID 4JI2L 1WXQA 1IYJB 3FVQA 1U9RA 4A3JB 2Y0SB 1C79A 4XC2A 1JMLA 3FPUB 4KV6A 1XMOQ 4WWPA 3GZNI 1RDPD 4URKA 1SFOH 2KJ6A 3OOCA 4FLHA 3PTFC 2A74C 4DNTB 1M94A 4JQWC 5C44H 3ML9A 1QB5D 2GVBA 3Q8FA 1P0RA 3D4RA 5EE3A 2D07B 1IW7C 3GOEA 4DAYB 2MX2A 4NPSA 2I0QA 2JSVX 4BBRH 2L3ZA 4P74A 5LMUQ 3FP9A 3H09A 2G4DB 3UINB 3I7FA 1C9OA 4XE0A 3ZDTA 2BVCA 4IOCA 3OYYA 1JRUA 4JYAQ 1DONA 4YTNB 1YBYA 1S5FD 3HKSA 4HR7B 2EXDA 3RLNA 1E90A 3A8JE 1SROA 2LGIA 4LK1C 1CQFA 2BH8A 4S3SA 3PZ8A 4EQPA 5KYLA 4G7HC 3OJ3A 2EOTA 2EPBA 1N60A 2JYOA 3TS0A 3IT4B 2A5HA 4P73A 1SYFA 3F2CA 1KD1C 3PO2H 4JX1C 4HKQA 4DR2L 3S1MB 2AUKA 1HZ5A 2M8SA 4DNIA 5LXHA 3GTLB 1XCTL 1CI3M 1ICWA 2KFJA 4XDCA 2Z0DB 3H0GG 3N1ZC 2ZVOA 1PH1A 4DGZA 1LV9A 2H5XA 5KYIA 4GLVB 3ERQA 1C8CA 4MHEA 2AL6A 1EY4A 4RGTA 4EZKA 1HUMA 2WXOA 5H92C 4LF7Q 1C48A 3DHQA 5CV4A 1VDZA 3JAMc 4GOPA 3R7QA 2NPTA 1K3RA 4JI1Q 2FIFA 4JWSC 3K57A 2PI2A 4HJ9A 1D8LA 3NQTA 3A8IE 1KLGD 2NZHA 4DKAC 4BWGB 1CZGA 1WE7A 4MN3A 1EUVB 2VZAA 4JL9A 2JXXA 5E7NA 2EY1A 3EROA 4GOPB 2AYOB 3J7ZC 1ET6A 3KDFA 2Z8LA 4NXNQ 4FHKA 3Q2AC 3ZJUA 2O2VB 2KDFB 1GHJA 3MAQA 1YI2A 2KQ7A 2EE1A 2GI9A 1E22A 3LJ3A 3F1ZA 2F03A 1L2FA 3HOXG 1Y1WH 5DLQE 2LASA 2PE9A 3KDFB 3KLSA 4B3RL 4O0AA 2K01A 2K32A 3K5MA 3GTPH 2GBJA 4FJYA 2WXHA 1PVOA 2E8GA 3STBC 5BR8L 2KMMA 3UIPB 4N9TA 2UXDL 2I1KA 1EIGA 2L7RA 4NQKE 2FINB 3D0FA 3RNEC 3B0AA 3E9IA 1ZW7A 1C77A 4ME3A 1KM7A 3N32A 2LFIA 1RL2A 3B08A 5AJ3L 3GTKH 4AOFA 2IWHA 1PZKD 1G91A 1I6HH 4WRDA 2GOWA 4DV1L 5E1FA 3H3VC 2QEJC 1YHAA 4LF6L 4RG1A 3J7A5 2DZJA 1S3OA 1F9QA 2RF4A 3CCEA 4G0NB 1HZ6A 3S1QB 1Q3LA 1LT6D 1WF9A 4IKGA 4H2AA 2VXWA 2QJLA 2BPSA 4IUUA 2A6HC 5I2YA 4DK1A 2NYZD 1WJ6A 2BGFA 2ZNVB 4BBSG 5C4XB 2KEEA 3FKIB 2BB5A 2N0SB 3LNNA 3UDGA 3U9OA 2Q8IB 1UE7A 4AYBG 1P9DU 2KACA 4B0EA 3ZYYX 2RGFA 2Q2UA 4LFCL 1XTDA 4LF4Q 4C3JG 5JJLA 2L05A 4N58A 1IBLQ 5M3FG 4A3BG 3NQIA 3IAS1 4QUFA 1XD3B 1B1ZA 4KIKA 3JVZX 3IFWB 3IAM1 1RIPA 4ANUA 1NY4A 1UWVA 5K36G 3AI5A 3CXCA 3SK8A 2MP2B 2G5DA 2WACA 3CC7A 1KOTA 2INNE 1CZWA 3ZJVA 4LWCA 1GUGA 4IPCA 3ETRA 2VQFQ 4KIKB 2F0EA 4PG3A 3UI2A 3HFZB 4ARCA 3QIJA 1EQQA 2N7JA 1KRHA 3L2PA 1BNZA 5GMVA 5CV5A 3RZFA 2VB2X 2Q5WD 4CJ0B 1WTRA 2PQAB 2CHZA 2OOBB 4JIOU 3RD2A 5GQOA 1VQ9A 3V6CB 2LXAA 4IWQA 5CHWA 2VNUD 2OTLA 4BS9A 4IPHA 1M90C 2UUCL 4FXGC 1SYGA 1V81A 2D3BA 3SK5A 3F2UA 2B3GA 3VRAB 1P7FA 2PYKA 2WB1B 4FF4A 4ZRKA 2E2HH 3HM3A 1S40A 4IW0A 4KY6A 5LL6X 3TMEA 3OG5A 3AE2B 1E8WA 2CHXA 1A62A 1FNUA 1SJHD 2EYMA 2E5LL 4ICUA 3QWNA 3H0GB 2FAZA 4RMAA 3AEGB 1PLFA 2RBMA 1K53A 1JICA 2BA1A 4A9AA 1A2UA 1TWGH 4OONA 4KMUC 3KFUA 1WYWB 4KDLB 4CYEA 3WDNA 1XLPA 2YLMA 1RKNA 2GLSA 4IDIA 4KX6B 3NELA 3D32A 3PV0A 1RODA 4R4OA 2SOBA 2L52A 3GTQH 4M8MA 3UF8A 2L4NA 3VUWA 5JOBA 2VQEQ 1SRUA 2XK5A 3ALBA 1O7LA 2A5UA 4NAMA 3S15B 2F3VA 1E7UA 4FN2A 1OTCA 2BH2A 2WKDA 3BJUA 2JA7G 4KVGB 5IA7A 2D0OA 4QY7A 1PFNA 4G4KA 2F0MA 2CW0D 3HOXB 3H9DA 1SYEA 2DY8A 4KY7A 4DAMA 4FYDA 1TIFA 3QJYA 2MBHA 2MH7A 2AQ1B 1QOHA 2N8NA 1YN5A 4LDTD 1KDCA 3AEDB 5K5PA 4B9KA 3G7LA 4KY5A 2CFMA 3LWEA 5D3IB 4APVA 4X66Q 2OT2A 3L0OA 3QCAA 3EGRA 3RZOH 1AE3A 2Z1CA 3EVQA 1JT8A 2MBBB 2Y0SE 4L8JA 4X6AH 3H3VI 2GBMA 3OIPA 3OW2A 3JYUA 4K7SA 1WIAA 1B8AA 1UGJA 3GTGB 1FXAA 3RPFC 4YY3Q 2QSDA 4R8NA 3M7GA 4DUYL 2LJIA 2GN5A 1QOAA 1UH6A 1ML0D 4OX9Q 3ZNGC 1CMXB 4B9WA 1IP9A 2K8CA 3J80L 3OSOA 1EYCA 2OXPA 3N6RA 2K1BA 4BA1I 2SNSA 4BBSB 3FILB 4ANXA 2XNAC 3M4YA 4KD3A 2M17A 3GO5A 1MVKA 1FXIA 1VJKA 1Z5SB 3DCGA 2HJ8A 3P4RB 4DUZL 4C1NK 4CBVA 5C23A 3M85A 1NR2A 2OQKA 2FIDA 3C1EA 3QR8A 4NAWA 3S2DB 4PZ6A 4C3JB 3K5NA 1E0BA 1ZOYB 3CPWA 4REZA 4A3BB 5M3FB 1QJOA 4IALA 2NBWB 1MGSA 4A3GH 3FAHA 1PH8A 4K3CA 2X6GA 3STBD 1D7QA 2KXJA 3EIVA 4DV7Q 1PTOC 4ZUJA 2F0LA 2ZXRA 4GNXC 3ZXRA 1YJWA 2NVQB 4IM2A 4ZKBB 4FJVB 1BQQT 4GXBA 1ZDVA 1Q7YC 5GADC 4P75A 3SR6A 4ITKA 2DJGC 1I4RA 3C19A 1JORA 2IO2B 4PMWA 3FRPB 5IYCH 2F0QA 4A90A 1B9MA 4W9EA 3W9CB 4X65Q 5IP7G 4XTCS 2M00A 4A3MH 3CMMB 1ESRA 5IYDG 3OWEB 4KHZA 4DV6L 1G2SA 4JLCA 2K52A 3SXHA 2JT4B 1A5RA 4RKBA 4NP5A 5EBDA 3UGBB 2KFKA 5C5MA 1PYBA 4TKOB 3WWVA 4A3PA 4FA6A 1N32L 1UELA 5EQ0A 3PCOB 3BDOA 4DK3C 1SE9A 5LMNW 1LUZA 3TBLD 2IGDA 3HGBA 3T3OA 4HCPB 2MSED 1SSNA 2F0IA 5I9PA 2KFKB 4BZAA 2JP1A 2LKVA 2Z6BA 2DNEA 4JVZA 3ZUNA 5C4JB 3H6NA 1OQYA 4KK7A 4A3IH 2KENA 1MSHA 4X3SA 1WFQA 2XN9C 1LTRD 4QGUA 3PO3G 3HVZA 4O42A 1X9NA 1VQ8A 2HHHQ 1ONLA 4MTKA 2AHOB 3S2AA 3MFGA 4W9LA 2VS1A 4FF1A 1SIFA 2K50A 3HRDD 1ENFA 5IGFA 5IT9E 2C5CA 3PHXB 1ZKHA 4L63B 1JWAD 1HQMC 2CJNA 1Z7TA 2UU9L 1S3SG 1VQJA 2KNBA 2FJ2A 1TY2A 3M62B 3HOWH 3H8HA 1V8QA 3U2SC 2ONQA 1V9PA 4K0KQ 1X6OA 2JA7B 4W9KA 5IAAC 1I42A 1V1PB 1PH3A 1CTMA 4B3SL 3ZW3A 2NVTH 4OWTB 3VR6A 4A3EH 1AYFA 1Q5WB 1R4NI 3N3KB 2BBCA 5G5HA 3RD4A 2WXMA 2DJFC 4EFOA 1GB1A 2W9NA 4NW2A 1J5EQ 3K9PB 3ZXVA 1KAAA 1TIID 4WAFA 3DWGC 2PJHA 5C2TB 4ZK9B 3HP3A 5LNK1 1GB4A 1NVID 1HR0W 1HNWL 3RNCC 3VA7A 3VUYA 5J1ZA 3GQBA 5L83A 2KTRA 1N6ZA 3A74A 1NNXA 2ZCBA 3I3TB 4JPSA 4ZRIA 2KDEB 1LTLA 2WS3B 4PQXA 3I4NG 1L1OC 4AP4C 3BZKA 3NBHA 3I3CA 3QQ8B 2KTRB 4L1BA 2MA9B 5LL6S 4ULLA 2J52A 1SYBA 4AIMA 3ZIMA 3TZDA 1X3EA 1H9RA 3ABVB 4PV1C 2VW9A 1K28A 5FLMH 1IBMQ 2VUMH 2G9DA 1XPOA 4JI4L 1Y1VH 1W6KA 3PIOA 3CCJA 2MLBA 4BFRA 3OTOQ 3H91A 2A19A 2N78A 2JA8H 3NOBA 1BOSA 3RNGC 1QUQA 4N8X1 3SEBA 3BIID 3VTVA 2ZJDA 1DOIA 5BMIA 1E1OA 4XDXA 5C4HA 4IUMB 1CUKA 2ZZPB 1WGGA 3RYTA 3IXSA 3WAOA 1I6VC 1EWYC 5CHVC 1CKNA 1VR9A 1EZ6A 2F0TA 4CGYB 2PLPA 3K9OB 1QUQB 3T16A 3JAMi 1EF1A 1UF0A 4W9JA 1ENCA 3V62A 1UE1A 1WD0A 1CKNB 2CR5A 4J8QA 1T0YA 5ELOA 3PO2G 2FCNA 5C0XH 1ZEQX 1V8CA 4C2MB 1CT1D 2D0PA 4JI7L 3IBEA 3W5OA 2EJFC 4LMQD 4L5TA 5EKIA 2INPE 4EE2A 2W3RA 2L83A 2LI5A 1VZ7A 1Y8RC 3MXPA 5CR3A 1T3QA 1TGZB 1SDFA 2RMMA 2BA0A 1E6EB 3Q22A 1N61A 4GLSC 3RMKC 2JA5H 3VYRA 1PH2A 2A4ZA 1WD1A 2WXJA 3DWMA 2BYTA 2F0SA 1CZPA 4OIKA 1UBQA 1AW7A 3OMCA 2IGHA 3EC8A 1IBXA 3EUB2 3FPPA 1WRIA 4HEA1 1Q86C 4A3OA 3JAME 3VDYA 1XNRQ 2K6QA 1IBXB 1A0IA 4DR6Q 1WE6A 4W9DA 3CC2A 1YNXA 4DV5Q 1N34Q 5EE9A 4C3HH 5JVH3 2RHSB 3HKZG 2XWJB 1UZXB 2EYPA 1ENAA 3K5OA 1ZGUB 1TT5B 1VQIA 1JQYD 2INDC 1BBXC 3NWTA 3MJWA 4JE3B 4OZAA 3W1BA 2HCIA 4HJ8A 5E6OA 2EYLA 2QF7A 3EBEA 1EIYB 4EQOA 2IBIB 1AP0A 2KANA 4LFBL 5G55A 1TWHB 4B6WA 2KCNA 5KNCA 3AMUA 3BWUD 2XBBC 2KVZA 3DWQA 4IPDA 1E2ZA 2PZUA 1STEA 2D5GA 1GUWA 1YJIA 4NJ6A 4IWPA 1HNXQ 4MT5A 3M4QA 2KBNA 3I91A 1ZDXA 2ZW1A 3TEWA 2HD5B 2PMZB 3CC4A 3W1GA 5KHOA 1HNZL 2KHSA 3I73A 2E6XA 4AQYL 5LMNL 3CCLA 4LF5Q 1HFNA 2WXGA 3MP9A 4NPNA 2LVQA 1PTOH 3J81L 3QO2A 1NSNS 2D3AA 2MEKA 1Q1OA 1L5PA 1PXUA 4IUNA 2K4KA 1VQMA 1UBIA 3CF6E 1B4OA 2L55A 1CKOA 3ULJA 5FO9B 3RZDB 1KHIA 2HJ1A 2N7DA 2VB3X 1J6QA 4II3B 4IN3A 1LTAD 1PH7A 1QVFA 1RLFA 4L6TB 1HQRD 1PGXA 1G6PA 1J9OA 1BF4A 5DPSA 3EHVA 3TP7A 2KKCA 3Q8BA 3DUZA 1KH0A 2LMCB 5FJ8H 4BY7G 2JQRB 3SFDB 4IJLA 1X56A 2WAQG 4QIWB 5C44B 4QQBX 2C7MB 3P75A 3LB8C 2I1JA 1TWAH 4LF8L 1NI3A 1B7YB 5NUCA 1QILA 4JI2Q 5LHY1 2TSSA 4DV4L 2ZXPA 5T8IA 5JAVA 1X3GA 5AZHA 3CSFA 1V97A 1WRDB 5IP9H 4CDEC 1EY5A 1Y8PB 2PNRC 2BKRB 3A1QA 1D1IA 3J80c 4A3CH 3OJ4B 1MBYA 1SIJA 4EQ5A 1A15A 1BKBA 3TDQA 3S1RH 3NVVA 3LGJA 4A3KH 1HR0L 1N5XA 1V5TA 2JY6A 3A1QB 4ZRPA 1CA5A 1UWXA 1JMCA 2EMTA 5AZFA 2XWBB 1IGDA 1GPXA 2PPBC 1JOOA 1TS2A 1QWYA 3PO2B 2RPQA 3U7DA 2WINB 2L00B 2L32A 3JW0X 1JE4A 1WOCA 3N52A 1R9TH 2KQ3A 2DWQA 3MC9A 5FR3A 2WP8J 4DR1L 4U673 1VQ4A 2UXBQ 1FXTB 1E2WA 5IIFA 1YJ1A 4MH0E 2M19A 3IRBA 4C56C 3MXUA 3RNAC 4H13C 3LX0A 1YN4A 1K83H 3BYYB 1D4BA 2KC2A 3AE4B 3NE5B 5CORA 3V05A 4EVOA 3AEVA 4DR2Q 3L08A 3TN2A 4OVUA 1EU4A 1WJJA 1M4VA 1IL8A 4LJZC 4R9WA 3RZWC 2HCCA 3I70A 2E2JB 4D2KA 1FRDA 1SE2A 1STGA 2OWOA 1R4MB 3Q8EA 4EUTA 1WTWA 5G5GA 2MGSA 1H9SA 3HKZB 2K03A 5E4XA 1KL9A 2MFIA 1KDAA 3B6YA 1L0WA 3R8BA 4C1NI 3PUYA 3DXJC 5J39A 5A35A 4X3UA 3CCMA 2ID0A 1AZPA 2JZPA 4K8JA 1P3QU 2O6VD 4AJWA 5FR6A 3KUPA 3S1NH 4CDDC 4KN4C 1BCPF 1MI2A 1RTOA 2MJ8A 1IYUA 3IFDA 1FL0A 3U8ZA 3J7AV 4M1UB 3AU5A 4JOIA 4OXPA 2EDGA 3TEHB 3G71A 5L37A 2KCMA 4QL5A 2MBOA 2A68D 2Z4IA 5AZGA 3QK0A 3S14H 1VS0A 4NDXA 4IO9A 3T1HL 3GTKB 2IO3B 2IO1B 3HVDA 3HOZH 3HM6X 1I6HB 1R4PB 1I94L 1ROEA 4B3RQ 1UNSA 1V80A 2JYTA 2LRWA 4H44C 1FGBD 4HAEA 1Q81C 2A6ED 1Z2MA 4GN5A 2PVOD 4GB9A 4MIUA 4DR4Q 2SDFA 4YHHL 2UXDQ 4HTHA 3ONAB 4WIPA 2B2UA 4YWKA 3T3NA 2JA6H 2V4LA 1Q12A 1MSGA 5ELNA 5AJ3Q 1VQAA 4J1MA 3L13A 4DV1Q 2IT1A 4H02A 3FHWA 2J7QB 2KN5A 3Q8AA 3HUIA 4MM3A 3ZNHB 2VRRB 1VCIA 4KHPL 3G6EA 1R4MI 3CIRB 3V3XA 4LF6Q 1W6JA 1DCZA 5E6JA 3V61A 2FUG1 2IHFA 4GDLA 1HFGA 1YVCA 4JC0A 1XPRA 3CCQA 4B3MQ 1RYJA 4MM3B 3C3LA 1KDBA 1XNQL 3DEOA 4DAYA 4BY7B 1OFFA 1F77A 1W3SA 2WAQB 1PV4A 1PH4A 1HEZE 1STHA 4GDLB 1NAPA 1GAQB 2KWDA 4P16A 3ZTDA 4C80A 4U68A 1KNEA 3D4WA 3S17H 4DHJD 1I35A 4IUPA 2E75C 2K5PA 2ZJQA 3QOLA 2O5IC 1Y56A 5L95C 4LFCQ 2DYMA 1EQRA 4I7AA 2RQXA 4NXML 4BXXH 5IYCG 2ZVNA 1SXTA 1TZOA 3AXCA 3U7ZA 3TCAA 2QDBA 2UXCL 3N9YC 3PIPA 1TTNA 2BCOA 1VMCA 2F0PA 3GV6A 3SDLC 3U30A 2KEDA 2WXPA 1PUTA 2ACZB 1FYCA 2AWTA 3R66C 2JU6X 2RCNA 3MVVA 5C1ZA 1HTPA 2EZVA 1JJGA 2WXLA 1HZAA 3QJZA 1TT2A 2KD0A 2CW0C 2FHTA 1N33L 1UD7A 1PRTD 2AQ2B 2WB1G 4W9IA 1WXAA 4ZYNA 3MFYA 4CDCC 3DWAA 2MBQA 1SR3A 2WX1A 1E0ZA 3PRMB 4A3IG 3AE3B 2SAKA 3OAWA 1NBFC 2F0VA 2GA4B 2UUCQ 2WGSA 3KUCB 2DN8A 2LHEA 5DPWA 2ICEC 1QQRA 1TWGB 2EJGC 2OEOA 3JSVA 3R2TA 2L9HA 2R92H 4OO1H 4X3KA 3VYUA 4KI0A 3M63B 1DM0B 1BUIC 3U58A 4FNFA 5BO4B 3GTQB 2BE5D 3QAQA 2O2VA 2E5LQ 3CSTA 1MG4A 1PH9A 4F87A 3JSVB 3MC8A 4RF1A 4RHRA 4XQNA 4GLAC 1WWTA 2KECA 3HOWG 4J15A 1RAXA 2KWCA 4B9XA 1C7YA 3N1YC 4XWTA 1WZ3A 3MC0B 1EWIA 2UUAQ 2J42A 5BYSA 1NEKB 1STAA 1FNVA 3GTOB 4C7YA 3NUHB 5M3MG 2ON8A 3NVWA 3WOEA 1KLVA 1HXYD 4A3EG 2HQLA 5IWAL 1GC6A 4HWIB 2PMZE 2MW5A 1MJDA 3A33B 3KUDB 2MUYA 2DAJA 4WJ4A 3SDZA 1S1QB 3AE5B 2I07B 3VHTC 5I4DA 3ERSX 2ZTDA 2J7ZA 2YVCA 4K14A 4R4QA 2KVRA 4WJ3M 1OEYA 4KGSA 3M9BA 1CA6A 3RZOB 1T0SC 3CAMA 2AEHA 2B2YC 3DMUA 4FVMA 3M3YH 1V2YA 4G50A 1G8ZD 2KMCA 1H4RA 2VY3A 1XLQA 4K7WA 4DV2Q 3P1HA 2KCCA 3UQBA 3L0WB 4M8NA 3ZRCA 3I4MG 1X3FA 4GKKL 2D62A 2LS01 2WU2B 3CRKC 4QIWE 1X55A 5IYBH 2AMCB 3MA2B 5FLMG 3K7AB 2VUMG 2LJ5A 2W82A 3HZXA 2GBNA 1S5DD 4MACA 3BVZA 1SAPA 1DGSA 4HMJA 5FK9C 5CHFA 2JA8G 4BVUC 4OVVA 3NHHA 4UHVA 3DBLB 4KLKA 5C5LA 3J81c 3I4OA 4TVAB 3URYA 2QKIC 4NJ7A 2BW2A 4MJSA 1WTOA 1QZHA 5C3XA 4DUYQ 2RDFA 3X3NA 3A54A 1BXTA 1Q8IA 3PUWA 2MP2A 4A3GB 4A3DG 1FGUA 1LABA 3DEPA 2FMCA 3L7ZC 3HIZA 3NP8A 1WI5A 3AFPA 1QOGA 2LUMA 3AULA 4MJSB 2FXQA 2CKZB 5EKLA 4C3IH 2CVRA 2Y5CA 4E71A 1FD6A 4E6IA 1CFMA 2QCZA 5CV9A 1SNPA 5JHAA 1O7IA 4IUQA 2PQAA 5EGTA 1I4XA 4JBWA 3GDEA 2J4XA 3R93A 4GLXA 2PO4A 5ELFA 2BWFA 1HH2P 3ULPA 1FRRA 4P71A 4ZRZA 5IGCA 4A3MB 4KHVA 5HY6A 1NCVA 5LMUL 4PK1A 3DVGY 1EEID 3IG3A 4X62L 3MXNA 4J6IA 3WCQA 2F0JA 4OIJA 5IOCA 1XO3A 3I56A 3VR9B 2JEBI 1VMPA 4LJOB 1WX9A 4A3LH 3MXNB 1O7YA 1XLNA 4USAA 4YTMB 4C3HG 5FO8B 4RAUC 2Y5BB 4LF9L 3DBLI 3AE9B 3ND8A 3DBSA 1WTPA 2X38A 2WIIB 3ML8A 3CCUA 4A3IB 3HKZE 4EZJA 1UUPA 5M5XH 2XTIA 4BKSA 4KGTA 1RWSA 2KDMA 2UUBL 3VVWB 4DPGA 1GHKA 4LNFA 3KYDD 2BS4B 5G3LF 1CJEA 3P4QB 3KH0A 4CJ2C 2QHOA 1LT4D 1NUCA 4JBJA 2WDRB 3Q69A 4E74A 4HPPA 2ICIA 3EFXD 4CDFC 2G1EA 2CJOA 4RGMA 4Q5VA 4NZLB 4RGOS 1KRSA 5FLXL 1E8XA 3ZVVA 2AQ3B 4EX5A 2J0TD 4JI1L 3QIAA 4PS7A 4EKUA 3HOWB 5C3EH 2YEPB 2B2WC 3RI7C 4YIJA 1LLRD 1L6VA 1TXYA 4LNOA 4JPBW 2KT7A 3M4OH 2R7ZH 4PZ8A 1RM6C 5M3MB 1GJZA 3ZNID 2NVTB 1HTQA 4A3EB 3PQIA 1LXDA 2CH4W 3VTWA 4NXNL 3BINA 3I8ZA 1M8AA 2OEDA 5IGBA 1T0QC 2I5LX 1I7HA 1PZID 4HROA 4XWWA 2QGQA 1GO3E 2YTVA 1TZ1A 2V3SA 1LT3D 2QC8A 2VH1A 3N30A 1QZGA 1VQ7A 2OJRA 1F0ZA 1I4PA 1L0VB 2VZKB 1XEEA 3J80i 5IE8A 1EQTA 4CJ1B 2V1YA 4YCVA 1PGAA 1LM8B 2R93H 1U0LA 2SNMA 2NTSA 1VCBA 1QKZA 2B3AA 3I4MB 1C76A 3SGIA 4I6LB 5GAGC 2WAQE 4DF7A 3KW5B 4QAYA 3FILA 2Q8TA 4YWMA 1PZJD 4XXEA 4BKTA 4HPLB 3NWSA 2KQSA 2E74C 2EVBA 3FEWX 2VUMB 3VR4A 1NYQA 4B0MA 2OQ0A 1P16A 1Y1VB 1WCMH 2YEPF 3PGZA 1TWFH 4DK6C 4DV0Q 5IP9G 4BY1H 3Q3JA 4KZCA 4DK0A 3HK0A 4HKZE 2JA8B 2NVXH 1IPGA 3X23A 3TEZA 3H7PA 3DHHC 1JE5A 2QILA 1YN3A 1J8IA 3P1MA 2G9HD 2BS2B 3EQLC 3S2HB 4MEMA 1QOBA
chains in the Genus database with same CATH topology
1C4QA 4IZ8A 3LYYA 5BYQA 3J80E 2WP9B 1K8OA 4A3DB 3ITPA 5MPOA 5KNDA 3MWYW 1FMAD 4QF4A 3P20A 1Y8OB 4K5WA 1KNAA 4ABNA 4NJCA 1G291 2FBWB 5T1GA 2F0UA 4GDKB 1ZYRC 2HDMA 3VR3A 5BN3A 5I9OA 5HG2A 1QF6A 1U4RA 3Q0AA 1QE6A 1TVXA 3L3OC 4HSPA 4TQ1A 5EBCA 3I90A 4UDUC 3B2GA 5A2QL 2L0CA 1Q1EA 1D5XC 4C3HB 1QT9A 4K5XA 2WXNA 2B2VC 1EY0A 2D5DA 3AE6B 4YSYB 5A2QE 3T56B 3CHBD 1SNMA 3IL8A 2SEBD 2X6LA 3PIP3 5C0XI 3AE1B 3PUXA 1EY8A 1F2LA 3CWIA 1V1PA 5M9OA 5EE0A 1JWUD 1TU2B 3MHZA 4MH8A 3VQIA 4YSZB 4DAVA 3KWLA 3AN1A 3V2TA 5I6WA 1V43A 2V3PA 4XQQA 3Q8CA 3K59A 1K51A 3D3RA 2GRIA 1D6EC 5D65A 1PTOB 1RCVD 3QOJA 2J53A 1L4DB 3KQ4A 2HDLA 1SMYC 1VF5C 4RKLA 1UEAB 1JW9D 2B2TA 1WTQA 2OHFA 1ET9A 1VLBA 1IKMA 1F2RC 1TWAB 2IJ0A 2V4IB 1OO9B 1C4CA 1N63A 3IKJA 2W54A 3BK2A 2H89B 1KLUD 1FD7D 2PW9A 1QOFA 4DA2A 3KLSX 1PFBA 1XCQL 3SFEB 3AU7A 3HS0C 3CQZB 1WGKA 1PTOF 5I2XA 1L0YB 4A3KB 4RWSC 1KTKA 2WXQA 3NVZA 1SNQA 2EY5A 5KNBA 1R9TB 2EY2A 4HMIA 4PMBA 2A68C 2V3NA 1XF5L 4TMAB 4QUCA 3IFTA 1K83B 1STNA 1K8MA 3K58A 4JK1C 2PZTA 3PZ7A 2PW5A 3ND9A 4L2YA 2A6EC 1OXXK 3E0JA 4RHSA 1SJED 2KVMA 5K36H 5ELEA 1DGJA 4RNAA 4IFDI 4N9PA 1RJTA 1HTLD 4J3OD 1F2ZA 3AECB 4DU9A 4ODGA 1HA5A 3S1NB 3PUVA 2WNMA 4FF3A 1JR0D 3K5LA 4FP5D 4HN7A 1LT5D 1EM7A 3D6CA 4GZYC 2WXKA 3KLRA 3S14B 5C3JB 2L1BA 4R3DA 1O7ZA 2N88A 1ZYRD 2IW3A 2JXTA 2B63B 2IL8A 2WXIA 4FF2A 4XT3B 3S9WA 2RVLA 2JA6B 2FMMA 5E4WC 3KWVA 1XXGA 2EXZA 2MHVA 2QIEB 1ZPSA 2KJXA 1BR9A 1DOKA 2K33A 5HFYA 2I38A 1BCPC 4KKTA 4FXKC 2LMCA 2RDGA 1PRTC 2HTME 3PO0A 2ENBA 2ZT9C 3J81E 1SFOB 1N62A 1Z6HA 3NSWA 3AEEB 1X3PA 4C3IG 2N9KA 3S17B 2RSOA 4Q0FA 2ZW0A 5EPJA 3AV8A 2MPMA 3AE8B 1JQ4A 3P63A 3T4AC 3P42A 2Y3AA 4H7BA 3W2DA 4IFDH 4RA8A 4BBRB 3AEAB 5GXGB 1MHXA 2BE5C 2YYZA 3HG9A 1EWHA 5C6AA 3AB5A 1JOKA 1SF0A 5T1IA 3A56A 1A3UA 2H4OA 1DOXA 3TP6A 2XVSA 1EQVA 4US9A 4ZKCB 1SMYD 3HEJA 1EOTA 4DAPA 2HUGA 3I4LA 5JEAH 1II3A 1U4PA 1QNKA 3G6JB 3T13A 3RMHA 4M0WA 2IGGA 2K9XA 3AM9A 4RCOA 3TZUA 1FCLA 2XSCA 4OHJA 1D5ZC 1H9KA 4M8AA 1TS3A 3DM1A 3KF8A 1TKGA 4HCEA 1V1OA 1X32A 1XYIA 2K6AA 2OF1A 3IAYA 5EPLA 1C78A 4PNYA 1LTTD 1BO0A 2B2UC 3NS1A 1AN8A 1I4GA 1DOLA 4WURA 2EYOA 3U52E 3SVMA 1B44D 1Q1BA 1AFPA 2MJ3A 1PFDA 1B3AA 3Q23A 3AE7B 3H94A 3FC4A 2IX0A 1Y1WB 3TP8A 4PMCA 3AB9A 4I7ZC 3GTPB 3VRBB 1DYQA 4H0LC 3K6OA 3OMGA 1OQQA 5JJZA 2QCPX 4KKSA 1WVLA 1K50A 3M3YB 4A6QA 4WJWA 1D2BA 3CRLC 1YNNC 2TMPA 2F0GA 3BG3A 3VYSA 4DFAA 4OO1I 4CHTB 2FE8A 3D8GA 4K5VA 3MTSA 3NTKA 4G7ZC 5C3WA 3T53B 2F1MA 2NN6H 2O2LD 2O4XA 4K6LA 2EKIA 1FIQA 2JE6I 5CYUA 2V0GA 2F0NA 2O5JC 1LACA 2RDHA 1VZ6A 2L12A 4UAIA 2BT6A 3NZ3A 1Q10A 3KK7A 1MPEA 1EYAA 4YWGG 3VYTA 4C3IB 1BDOA 1WYGA 2F0KA 4DXFA 1OXVA 3W5VB 2WQYB 1BUVT 2NWGA 2BB6A 5IGEA 2R6GA 4XYOA 3BYTB 4ZHPA 2KA7A 4QMGA 4N59A 4XT1B 4CKCA 1FFVA 1TYGB 1OXSC 1BCPD 2PCFB 2EY6A 2WU5B 1ZP0B 2E2HB 5FO7B 2LFNA 2AWOA 4WH4A 5KGUA 5M5XB 1ZXIA 4US8A 4V190 2W55A 1STYA 4WWMA 1D1KA 2NZ1D 3VR2A 3PIO3 1SSOA 1ACCA 3NTHA 3D6WA 5DEHA 1OQRA 4OZCA 1MD2D 2KAJA 4DQOC 3P4SB 2CU3A 1LO5D 2GB1A 1VF7A 4LK0M 1QNUA 5C3EB 3R3OA 1CK1A 3PMFA 4V0BA 1DZ1A 5JVG3 3H6MA 3M4OB 2R7ZB 3CU7A 1VRAB 1EY9A 3NTIA 2D9UA 3BZDB 4I65A 3SK4A 1J7BA 1LTSD 4CKEA 4ZUIA 3ZJTA 2K05A 2H1EA 5BN4A 5BYRA 4AQ7A 2BTEA 1RFKA 3BVMA 2R93B 2V4DA 2K3UA 5TSSA 1ILQA 1AEXA 3QB3A 3MXGA 1XTCD 3T51B 2M56B 3E5SA 3ZQ4A 1YNTE 1WCMB 3PUZA 3I9V1 2F0WA 1TWFB 4BY1B 2NTTA 5HURA 5EJWA 2NVXB 1JB3A 1O78A 2WXRA 1DOYA 1G2TA 2Z4HA 2BS3B 2E2DC 1ZXTA 4WFN3 5EKKA 5M5YB 2N55A 1FO4A 2R3ZA 4A93B 2F0FA 3Q24A 3W3AA 5C0XG 1QCBD 2I46A 5H8YE 1YNND 3AMZA 5BMHA 2CHBD 4YT0B 3P4PB 1JC7A 2K28A 1B2TA 1F2MA 4XIGS 2PMVA 2K5DA 2BDNA 4ILWA 5CV8A 3TEYA 1H9MA 1RTNA 2B2YA 4TQUS 3A7LA 3UI3A 2M9VA 3GTJB 3EJIA 5D14A 1WTXA 3BDLA 4A8XC 4F7XA 5AUIA 2IX1A 4KJNA 3HOYB 3SHLA 3I72A 4ZAIA 2H88B 3D4DA 1CM9A 1IGCA 2NVYB 3GP7A 1EIHA 3U9SA 1EYDA 3MEHA 5DM73 3AH7A 1RF2D 1PGBA 3SE0A 2B8FA 1E2VA 4KTAA 2AWNA 4K2KA 3U4EG 1S4ZA 3EA6A 2AUJD 1I50B 2F0OA 1SBBB 4OVZA 1XX8A 1WTVA 2JYEA 1J7AA 3V96A 4AS1A 2FFKB 1LTGD 1SNDA 3C8YA 1F9PA 4DNRB 5FLXE 2L11A 1IW7D 4A55A 5HI1A 2A73B 3GTMB 2DYOA 1T5XD 4QB4A 1JWBD 4EGVA 1KABA 4IUTA 4ARIA 1I4QA 1CQVA 4KKJA 3NK9A 3OIQA 1EL0A 1S5CD 1VZ8A 2RPVA 2WDQB 1F9RA 5CV7A 4LTUA 3LWUA 1SNCA 1B9RA 2K04A 3VR5A 4F8MA 1B53A 2K22A 4IFDG 2JXMB 4IOIE 2L5TA 1NYRA 1K52A 1J7CA 1RHPA 2DBYA 2ZXOA 1SEBD 2MJEA 1ZE3D 1IUEA 4KJOA 5G3LD 5CGKA 3Q6SA 1L0XB 1GHKA 1JOQA 2HQEA 4YTPB 1YNJC 2F3WA 5JEAG 2B2WA 5KRUA 1GUTA 1STBA 1XLOA 4AYBB 3J9CA 1HHVA 2JA5B 1AWDA 5J22A 2RSNA 4Y7NB 1ZKOA 1GUNA 4OZBA 3GV3A 1GXDC 3P7JA 4NAWB 2MJDA 4P6VF 1UWMA 2PVGC 3AEBB 4RGNA 4C7ZA 5CV6A 1B9NA 3OW7A 5IODA 1IHZA 4KD4A 2NUCA 1FR3A 1TKYA 1FNWA 2A69C 2XIWA 3OWFA 1EY7A 4A3FB 2B2TC 4DXGA 3TUOA 5C4ZA 2A6HD 1Y69U 1PDQA 5ELBA 1TKWB 5IGGA 2B8GA 3O13A 3LXFA 2CQAA 5ELDA 3C46A 4N6EB 1YJJA 2WLBA 3SK6A 3X3MA 1E9MA 1YQ4B 3NRZA 4K8IA 5IT9L 5COYA 1LTID 1JRPA 1CHPD 2QMTA 1IKLA 2PIAA 2N9LA 4ZOHC 1T5EA 2NN6G 4G7OC 1MI0A 1SB3C 5AUKA 1PYWD 3R2IA 1IYVA 2VZKD 4CKBA 1S5ED 2BDOA 3RLFA 1C4AA 4RFBA 2WXFA 1SNOA 3D31A 5CC4A 2NMQA 1DOMA 1GUSA 5DAUA 2DY7A 1FM0D 3C2PA 4HEDA 3VA5A 1VDVA 3B2FA 4OL7A 2EYJA 2B2VA 1TR5A 1R7SA 1H9JA 1OXUA 3L9AX 5HGTA 2F0DA 1HCZA 1QLBB 4XDDA 3QG1A 3BS1A 5CBAE 2B39A 2JSOA 3S1RB 2K5QA 5I6YA 4IQZA 1E7PB 1CHQD 1P7EA 3VR8B 2IPKD 4KGRA 4OW0A 3TBIB 4HRSA 2NB0A 1S5BD 5KIXA 3TEXA 1ILPA 1T6BX 2EYHA 3KBGA 2I2YA 3BVGA 4O1NA 4OO1G 4WQMA 1D5MC 1ESFA 1SE4A 4ME5A 2BOSA 3A7AB 5EE1A 5E3FA 4L23A 5EPKA 1Y8NB 5CBEE 1NR4A 3DWPA 1E10A 3E6ZX 2WDVB 2KN4A 4ZRQA 3JAML 4RCNA 2IX3A 1R4QB 1SYDA 5ELCA 1MHHE 1SE3A 1A3TA 1BMLC 3OPOA 1YNJD 3GB1A 1U4LA 1A3VA 3NXWA 2IDYA 3TP5A 1GUOA 1HUNA 2HDEA 4JWUC 2KOLA 4XQJA 5JXVA 3MZ5A 1HPCA 1SYCA 3HOVB 3HOZB 3E9SA 3FDTA 2L1AA 1A6XA 4CQNA 5BN5A 1FFUA 4LLGM 5HHDG 1PTOD 2LHDA 1A70A 3AEFB 4PT5A 3M7NA 3NUCA 1B50A 3PO3B 1U4MA 2B76B 4RF0A 3A8KE 1F9SA 3J7YW 2RKSA 3RFZB 5C0XJ 2C9OA 4G57A 4ZYSA 2A69D 1DJRD 3B9JA 2K5WA 1AZQA 4K6DA 1JWMD 1TKEA 3BK1A 5D3DA 2RA4A 1LTBD 3MJ5A 3NBIA 5JPMC 3TSSA 2EJMA 1FCCC 1EU3A 1F2RI 3CKIB 4EQNA 3S16B 1ZXHA 4X3TA 2Y5PA 2JX5A 3OHXC 4QCLA 1L6UA 1EWCA 4HJGE 3GD7A 4HCSA 4ID6A 2MP1A 2NBFA 1JCKB 4TSSA 5BMGA 2X69A 1DXMA 2PKOA 3SR1A 5F2DA 1X3QA 1YQ3B 3BDCA 2M2LA 1WSPA 2KQ4X 1JWSD 3I4NB 3W5UB 2R61A 1UAPA 4B08A 5FKAC 1XWEA 3RUZA 4YSXB 2DLBA 1GOZA 2PZWA 2NN6I 2EYFA 4NMZA 4OGQC 4TQ0A 4J6HA 3NPPA 3IT6B 1TY0A 2E2IB 3KBXA 2F0HA 2YU9B 1EEFD 3FMCA 1EFID 1TQOA 3MHBA 5D7GA 3NVYA 1TS5A 1G6ZA 2LEKA 5M5WB 2R92B 1KF6B 1EZ8A 4XYQA 3W1SA 1FEHA 2JWUA 3I57A 1KFYB 4FXCA 1O80A 2XRQD 1JROA 1Q90A 4IUVA 3ZGZA 3K0YA 1F2YA 1BCPB 4F88A 5CMDA 4FO2A 1HRJA 3L4PA 5IGDA 1PRTB 3C1FA 5JPNC 1HA6A 5KEEA 4NKLA 2D2CC 3E56A 4HSVA 1TWCB 4LAAA 2JEAI 1NENB 1JALA 2EELA 4TRDA 1PFMA 2Q8RE 1YMHE 4R8IA 4FXDA 1Z47A 4KN7C 4K2LA 2KUMA 1I3QB 5AFWA 2PTLA 4IFDJ 1OXTA 4RH6A 1TJEA 4P2CB 2AX5A 1I4HA 1TS4A 1N5WA 1GJXA 2DNCA 4YXDB 1L4ZB 3WOFA 1H9SB 3GS2A 2WKCA 2PW7A 2WV6D 2W3SA 1QG7A 1A2TA 1PRTF 1C4PA 2PQEA 4ZHOA 5JEAJ 1EY6A 5DM63 2K0PA 4WORA 2K7VA 1PDXA 4ZLTF 3HRZC 1RD9D 4KKIA 3J7AF 5DNFA 2E3TA 2F4IA 2XRSD 4Q2JA 1DD2A 4KKUA 2LY7A 4Z9CB 3A55A 4BA2I 4ZQ3A 5ISRA 5FOBB 4IURA 4DN4M 2E76C 1ZUD2 2M0AA 1PMRA 3HOUB 1WXQA 3FVQA 1U9RA 4A3JB 2Y0SB 1C79A 1JMLA 3FPUB 4KV6A 1RDPD 3OOCA 2A74C 4DNTB 1QB5D 3Q8FA 3D4RA 5EE3A 1IW7C 2JSVX 3H09A 4XE0A 1DONA 4YTNB 1S5FD 4HR7B 3A8JE 2LGIA 4LK1C 1CQFA 4S3SA 3PZ8A 4EQPA 5KYLA 4G7HC 2EOTA 2EPBA 1N60A 2JYOA 3IT4B 2A5HA 1SYFA 4JX1C 4HKQA 3S1MB 2AUKA 1HZ5A 3GTLB 1XCTL 1CI3M 1ICWA 4XDCA 4DGZA 1LV9A 5KYIA 3ERQA 1C8CA 4MHEA 1EY4A 4RGTA 1HUMA 2WXOA 5H92C 1C48A 3DHQA 5CV4A 1VDZA 4JWSC 3K57A 3NQTA 3A8IE 1KLGD 4BWGB 1CZGA 4MN3A 2EY1A 3EROA 1ET6A 2Z8LA 3ZJUA 1GHJA 3MAQA 2EE1A 2GI9A 2F03A 3KLSA 2K01A 2K32A 3K5MA 2WXHA 2KMMA 4N9TA 1EIGA 2FINB 1C77A 2LFIA 2IWHA 1PZKD 1G91A 4WRDA 5E1FA 3H3VC 2QEJC 1F9QA 1HZ6A 3S1QB 1Q3LA 1LT6D 4IKGA 4H2AA 2VXWA 2QJLA 4IUUA 2A6HC 5I2YA 4DK1A 2NYZD 5C4XB 2KEEA 3FKIB 2BB5A 2N0SB 3LNNA 3U9OA 2Q8IB 2KACA 4B0EA 3ZYYX 4C3JG 4N58A 3IAS1 3NQIA 4QUFA 1B1ZA 3IAM1 5K36G 3SK8A 2WACA 2INNE 1CZWA 3ZJVA 1GUGA 3ETRA 2F0EA 3UI2A 4ARCA 2N7JA 1KRHA 1BNZA 5CV5A 2VB2X 2Q5WD 4CJ0B 1WTRA 2VNUD 4BS9A 4FXGC 1SYGA 3SK5A 3F2UA 3VRAB 1P7FA 2PYKA 2WB1B 4FF4A 4KY6A 5LL6X 3TMEA 3AE2B 1FNUA 1SJHD 2EYMA 3QWNA 3H0GB 3AEGB 1PLFA 2RBMA 1K53A 1JICA 2BA1A 4A9AA 1A2UA 4KMUC 3WDNA 1XLPA 4IDIA 1RKNA 4KX6B 3PV0A 1RODA 2SOBA 2L52A 2L4NA 5JOBA 1O7LA 4NAMA 3S15B 2F3VA 2WKDA 1PFNA 4G4KA 2F0MA 2CW0D 3HOXB 1SYEA 2DY8A 4KY7A 4FYDA 3QJYA 2MH7A 2AQ1B 1QOHA 1YN5A 1KDCA 3AEDB 5K5PA 3G7LA 4KY5A 3LWEA 5D3IB 2OT2A 3EGRA 2Z1CA 3EVQA 4L8JA 3OIPA 1UGJA 3GTGB 1FXAA 3RPFC 2QSDA 4R8NA 3M7GA 2LJIA 1QOAA 1ML0D 4B9WA 3J80L 3OSOA 1EYCA 2OXPA 3N6RA 2K1BA 4BA1I 2SNSA 4BBSB 3FILB 2XNAC 3M4YA 4KD3A 3GO5A 1MVKA 1FXIA 1VJKA 3P4RB 4C1NK 4CBVA 3M85A 1NR2A 3C1EA 3S2DB 4C3JB 3K5NA 1E0BA 1ZOYB 4REZA 4A3BB 5M3FB 1QJOA 4IALA 1MGSA 3FAHA 2X6GA 1PTOC 4ZUJA 2F0LA 2ZXRA 2NVQB 4ZKBB 1BQQT 1ZDVA 3SR6A 4ITKA 1I4RA 1JORA 4PMWA 3FRPB 2F0QA 4A90A 1B9MA 3W9CB 4XTCS 2M00A 1ESRA 3OWEB 4KHZA 1G2SA 3SXHA 4RKBA 4NP5A 5EBDA 5C5MA 4TKOB 5EQ0A 3BDOA 2IGDA 3HGBA 3T3OA 1SSNA 2F0IA 5I9PA 2JP1A 2LKVA 2DNEA 5C4JB 4KK7A 1MSHA 4X3SA 2XN9C 1LTRD 3HVZA 4O42A 1ONLA 3MFGA 4FF1A 3HRDD 1ENFA 5IGFA 5IT9E 2C5CA 4L63B 1JWAD 1HQMC 2CJNA 1Z7TA 2FJ2A 1TY2A 3H8HA 3U2SC 1V8QA 2ONQA 2JA7B 1V1PB 1CTMA 3VR6A 1AYFA 2BBCA 5G5HA 3RD4A 2WXMA 1GB1A 4NW2A 1KAAA 1TIID 4WAFA 3DWGC 5C2TB 5LNK1 4ZK9B 3HP3A 1GB4A 1NVID 3VA7A 5J1ZA 3GQBA 4JPSA 2WS3B 4PQXA 3NBHA 3I3CA 4L1BA 5LL6S 4ULLA 2J52A 1SYBA 3TZDA 1H9RA 3ABVB 4PV1C 2G9DA 1W6KA 3H91A 1BOSA 3SEBA 3BIID 1DOIA 5BMIA 1C9FA 4XDXA 5C4HA 3IXSA 1I6VC 1EWYC 1VR9A 1EZ6A 2F0TA 4CGYB 2PLPA 3T16A 1ENCA 1WD0A 4J8QA 5C0XH 1ZEQX 1V8CA 4C2MB 1CT1D 2EJFC 5EKIA 4LMQD 2INPE 4EE2A 2W3RA 2L83A 1VZ7A 3MXPA 5CR3A 1T3QA 1SDFA 2RMMA 2BA0A 1E6EB 3Q22A 1N61A 4GLSC 3VYRA 1WD1A 2WXJA 3DWMA 2BYTA 2F0SA 1CZPA 4OIKA 2IGHA 1AW7A 3OMCA 1IBXA 3EUB2 3FPPA 1WRIA 4HEA1 3JAME 1IBXB 5EE9A 5JVH3 2XWJB 2EYPA 1ENAA 3K5OA 1JQYD 1BBXC 3NWTA 4JE3B 4OZAA 2HCIA 2EYLA 2QF7A 4EQOA 1AP0A 1TWHB 2KCNA 5KNCA 3AMUA 3BWUD 3DWQA 1E2ZA 2PZUA 1STEA 2D5GA 1GUWA 1YJIA 4MT5A 3I91A 1ZDXA 2ZW1A 3TEWA 2PMZB 2E6XA 2KHSA 3I73A 1HFNA 2WXGA 3MP9A 1PTOH 3J81L 3QO2A 1NSNS 2MEKA 1L5PA 1PXUA 4IUNA 1B4OA 2L55A 5FO9B 3RZDB 2VB3X 4IN3A 1LTAD 4L6TB 1HQRD 1PGXA 1J9OA 1BF4A 3TP7A 3Q8BA 3DUZA 1KH0A 2LMCB 2JQRB 3SFDB 4QIWB 5C44B 3P75A 3LB8C 1NI3A 5NUCA 1QILA 5LHY1 2TSSA 5T8IA 2ZXPA 5JAVA 1V97A 1EY5A 1Y8PB 2PNRC 1D1IA 1MBYA 1SIJA 1A15A 3TDQA 3NVVA 1N5XA 4ZRPA 1CA5A 1UWXA 2XWBB 1IGDA 1GPXA 2PPBC 1JOOA 1TS2A 1QWYA 3PO2B 2WINB 2L32A 1JE4A 3N52A 2DWQA 5FR3A 2KQ3A 2WP8J 4U673 1E2WA 5IIFA 2M19A 4C56C 3MXUA 4H13C 3LX0A 1YN4A 3BYYB 1D4BA 3AE4B 3NE5B 5CORA 3V05A 4EVOA 3TN2A 1EU4A 4LJZC 1M4VA 1IL8A 4R9WA 2HCCA 3I70A 2E2JB 4D2KA 1FRDA 1SE2A 1STGA 3Q8EA 1WTWA 5G5GA 2MGSA 1H9SA 3HKZB 2K03A 5E4XA 1KDAA 5J39A 3R8BA 4C1NI 3PUYA 3DXJC 2JZPA 5A35A 4X3UA 1AZPA 2ID0A 4K8JA 3KUPA 4KN4C 1BCPF 1MI2A 1RTOA 2MJ8A 1IYUA 3IFDA 3J7AV 4M1UB 2EDGA 2A68D 2Z4IA 4NDXA 3GTKB 3HVDA 1I6HB 1R4PB 1ROEA 1UNSA 2JYTA 4H44C 1FGBD 4HAEA 2A6ED 2PVOD 4MIUA 2SDFA 4WIPA 4HTHA 3ONAB 2B2UA 3T3NA 1Q12A 1MSGA 4J1MA 2IT1A 3Q8AA 3HUIA 1VCIA 3CIRB 3V3XA 1W6JA 1DCZA 5E6JA 2FUG1 1HFGA 1RYJA 4MM3B 3C3LA 1KDBA 3DEOA 4DAYA 4BY7B 1OFFA 1F77A 2WAQB 1HEZE 4C80A 1STHA 4GDLB 1NAPA 1GAQB 2KWDA 4P16A 4U68A 1KNEA 3D4WA 4IUPA 2E75C 2K5PA 3QOLA 2O5IC 1Y56A 2DYMA 2RQXA 1SXTA 1TZOA 3U7ZA 2QDBA 3N9YC 2BCOA 1VMCA 2F0PA 3GV6A 2KEDA 2WXPA 1PUTA 2ACZB 1FYCA 2JU6X 3MVVA 1HTPA 2EZVA 2WXLA 1TT2A 2CW0C 2FHTA 1PRTD 2AQ2B 3MFYA 3DWAA 1E0ZA 3AE3B 2SAKA 2F0VA 2GA4B 2DN8A 2LHEA 2ICEC 1QQRA 1TWGB 2EJGC 2OEOA 3R2TA 2L9HA 4OO1H 4X3KA 3VYUA 4KI0A 1DM0B 1BUIC 4FNFA 3GTQB 2BE5D 4F87A 4RF1A 4RHRA 4XQNA 1WWTA 2KECA 4XWTA 4B9XA 3MC0B 2J42A 5BYSA 1NEKB 1STAA 1FNVA 3GTOB 4C7YA 3NUHB 3NVWA 2ON8A 3WOEA 1HXYD 2MUYA 3SDZA 3AE5B 2I07B 5I4DA 2J7ZA 4K14A 4KGSA 1CA6A 3RZOB 2B2YC 3DMUA 4FVMA 1G8ZD 1XLQA 3P1HA 2KCCA 2D62A 2LS01 2WU2B 3CRKC 3MA2B 3K7AB 2W82A 3HZXA 4MACA 1S5DD 3BVZA 1SAPA 4HMJA 5FK9C 3NHHA 5C5LA 3URYA 2QKIC 2BW2A 1WTOA 5C3XA 2RDFA 3X3NA 3A54A 1BXTA 1Q8IA 3PUWA 4A3GB 1LABA 3DEPA 2FMCA 3L7ZC 3NP8A 1QOGA 2LUMA 5EKLA 2Y5CA 2CVRA 1FD6A 4E6IA 1CFMA 5CV9A 1SNPA 4IUQA 5EGTA 1I4XA 4JBWA 2J4XA 3R93A 2PO4A 5ELFA 1FRRA 4ZRZA 5IGCA 4A3MB 4KHVA 1NCVA 1EEID 3MXNA 3WCQA 2F0JA 4OIJA 5IOCA 1XO3A 3VR9B 2JEBI 1VMPA 1XLNA 4USAA 1O7YA 4YTMB 4C3HG 5FO8B 4RAUC 3AE9B 3ND8A 1WTPA 2X38A 2WIIB 4A3IB 1UUPA 4KGTA 1RWSA 2KDMA 2BS4B 5G3LF 1CJEA 3P4QB 4CJ2C 1LT4D 1NUCA 2WDRB 3Q69A 2ICIA 3EFXD 2G1EA 2CJOA