2XN9C

Crystal structure of the ternary complex between human t cell receptor, staphylococcal enterotoxin h and human major histocompatibility complex class ii
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
215
structure length
215
Chain Sequence
EDLHDKSELTDLALANAYGQYNHPFIKENIKSDEISGEKDLIFRNQGDSGNDLRVKFATADLAQKFKNKNVDIYGASFYYKCEKISENISECLYGGTTLNSEKLAQERVIGANVWVDGIQKETELIRTNKKNVTLQELDIKIRKILSDKYKIYYKDSEISKGLIEFDMKTPRDYSFDIYDLKGENDYEIDKIYEDNKTLKSDDISHIDVNLYTKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T CELL RECEPTOR ALPHA CHAIN C REGION
publication title The Structure of Superantigen Complexed with Tcr and Mhc Reveals Novel Insights Into Superantigenic T Cell Activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 70
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2010-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
C PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2xn9C02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2xn9C01
2J4XA 1DYQA 4C56C 1I4PA 1RCVD 1DJRD 1RF2D 2XN9C 1BCPF 1JWSD 4BWGB 1EU3A 1YN4A 1FNWA 1HQRD 1FNUA 1D6EC 2AQ1B 1M4VA 5ELFA 3URYA 1LTRD 5ELCA 1L0YB 2QILA 1BXTA 4K6LA 2AQ2B 5FKAC 4DXGA 3SEBA 1AN8A 1SJHD 3KLSX 5ELEA 1BCPB 1F77A 3BVZA 1JR0D 2TSSA 2AQ3B 1V1PA 4RGNA 1TS5A 2QEJC 4RGOS 3EA6A 1V1OA 1EU4A 1V1PB 1LTSD 1LTID 1YN5A 1LT4D 4TSSA 1EEFD 1KLUD 1HTLD 1S5DD 2RDHA 4RGTA 1PYWD 4O1NA 1ET6A 5I4DA 1PRTC 1UNSA 2O2LD 1EWCA 3MFGA 1I4HA 1QILA 2WV6D 1KTKA 1S5FD 4RHRA 1SE2A 1ET9A 1UUPA 3BYYB 3TSSA 1LTTD 1D5ZC 1MD2D 1S5BD 1L0XB 5ELBA 2XRSD 1B44D 2Z8LA 4L6TB 1D5MC 1D5XC 1ESFA 1KLGD 2RDGA 1BCPC 3R2TA 4L63B 3R8BA 1TY2A 1TS4A 1PTOC 1PRTD 3DWPA 1I4XA 1S5ED 2IJ0A 1I4GA 3MC0B 4Z9CB 1GOZA 1CT1D 4DXFA 1STEA 5TSSA 1RDPD 1PZJD 1LTGD 2IPKD 1CHPD 1JWUD 1LT3D 3GP7A 1CQVA 4UDUC 3BVMA 1PRTF 1SE4A 2CHBD 1LLRD 1PTOD 1YN3A 1SBBB 4NZLB 3V05A 1SEBD 1FNVA 1LO5D 2SEBD 3BYTB 1AW7A 1JCKB 2NTTA 2R61A 2NTSA 1EFID 1LT5D 1SE3A 1PRTB 1HXYD 2XNAC 4RHSA 1SXTA 1XXGA 1G8ZD 1LT6D 5FK9C 3O13A 2ICIA 1RD9D 1SJED 1PTOF 4RCOA 3CHBD 1TS2A 3DWAA 3EFXD 4RGMA 2G9HD 4ZYSA 4RH6A 1EEID 3W2DA 1JQYD 4OHJA 1TS3A 1FD7D 1BCPD 5D3DA 4RFBA 1PZKD 1S5CD 5D3IB 1PTOB 1TY0A 1LTBD 1XTCD 1PZID 2XRQD 3OWEB 1T5XD 1JWMD 3BVGA 1B1ZA 1CHQD 1ENFA 3DWQA 1LTAD 3R2IA 5ELDA 1I4RA 1CK1A 1FGBD 1PTOH 3BZDB 1HA5A 1I4QA
chains in the Genus database with same CATH superfamily
3W1GA 2KVRA 2JA9A 3FKIH 1EUVB 3I4MG 1N5WA 5JJZA 2AYOB 5GQOA 1IHZA 2NBUA 1H9KA 4OZBA 4RKBA 2IY0B 2ASQA 3FILA 4B3ML 1L0YB 3U58A 2R7ZG 5CV8A 1BXTA 4KVGB 2SNMA 4WWPA 1AN8A 1ZXTA 1QOHA 2F1MA 2VS1A 4F87A 1JT8A 2K1FA 1ESRA 1VQ4A 5GAEC 1BDOA 3K59A 2GBRA 3FPPA 1C4PA 5IP9H 2KX0A 3WOEA 4C2MB 4P7IA 1XO3A 5E3FA 1L1OA 3H0GB 1Q46A 4MTNA 1WMHA 1WGDA 4IJHA 3FAHA 2G4DB 2F3IA 2KTFA 4C2MH 2Z6BA 1A63A 3VVWB 4L5SA 2CU3A 4Q2JA 2J7QB 5HHDG 3J7ZC 1XNRQ 3KWLA 4W9EA 1N5XA 2DNCA 3KDFB 2LKVA 4DR6L 1N36L 1FEHA 1NBFC 1T6BX 2WDVB 2KDEB 1HZ6A 3E5SA 2EJFC 1UF0A 1ZGUB 1XNRL 2EELA 3KLSA 4N8FA 1D2BA 4L2YA 4ASWC 5C44G 1C77A 2V3PA 4HCEA 4DWFA 4CDDC 3PUYA 3CIRB 2I1JA 2RDGA 4A3PA 1F0ZA 5EDSA 1MI0A 3ML9A 1TS4A 3F2DA 4Y7NH 3I8ZA 2JA7H 3I4NG 3UDGA 1PTOC 2LUEA 4TMAB 5J3BA 2BWES 5AUKA 2EE1A 5IYBG 3CCJA 4RAUC 1NMGA 2N7EA 3R7RA 3Q8FA 5T1IA 4WJNA 3OYYA 2KJ6A 3A8JE 2ZTEA 2KLCA 3NZSA 1QB5D 1RODA 3P75A 1MGSA 2HD3A 3FKYA 3NOBA 2HUGA 4GNXC 4DR3L 2DENB 1Z9FA 1XNQQ 3M4QA 3HOWG 5G2NA 3ZRCA 3W1SA 1Y1WG 4A3GB 1ZUD2 2Y5CA 3DBSA 2L0CA 4NQLB 4ANXA 2LEKA 3G48A 1BMLC 1VQJA 3SK8A 4W9DA 1NSNS 3RZFA 4A3GH 1C79A 2KENA 1JCKB 1ILQA 3AEEB 4JI2Q 1V6EA 3NTIA 3DWGC 4W9HA 4LCDE 3DQVA 3A54A 3JVZX 3QA8A 4MZ9A 5CTRC 1HXYD 3CU7A 1STYA 1VJKA 1PHJA 2MX2A 3V3XA 1NR4A 4MJSB 2BYTA 2UUBL 3J80c 3OJ3A 1VZ8A 3I55A 5FLXc 2EY1A 1V8CA 5HKHA 1RYJA 2ZXRA 2PQAB 3I70A 4EX5A 3STBD 1XYIA 1EM7A 1TS3A 5D3DA 2D3CA 1TU2B 4BY7H 2DYOA 2D0PA 2B63B 1PZKD 1Q1EA 1LGRA 4KSKC 4GDKA 2K8CA 1YMHE 3DOWA 2JVCA 1ASYA 1T0YA 2BYEA 2HTME 2EXZA 2XK5B 2Y0SB 4ZUJA 3WANA 2LXCA 3BZDB 4EKUA 4HCPB 2X8XX 1R4QB 4O2DA 2VQFL 1K73C 3LDZE 1GHJA 2KX3A 1RKNA 4USAA 1HTQA 2K01A 5C3JB 4C3IG 2YEPF 3AEAB 3W3AA 1E0BA 2HIVA 4HR7B 1E2VA 3ZO5B 4D2KA 1M4VA 2XWJB 4RWSC 4A3BH 5ELCA 3TQYA 2Z4HA 4ACFA 4DV5Q 1NY4A 1VMPA 1BNZA 1E90A 3PZ8A 4JI8Q 3CC2A 2HQEA 3A74A 1NEKB 3TEXA 1NR2A 3JYUA 3E0JA 1GUTA 4BS9A 4M00A 1CZWA 1GNUA 2GOWA 4M0WA 2ALYB 2ZM6Q 5DPSA 2K5PA 4MSMB 1I3QH 1YN5A 1LT4D 4FF1A 2MWSB 1KHIA 3X3MA 4G0NB 4X65L 1CSQA 3NTKA 4NJ6A 1VF5C 3R3OA 4O1NA 2R2QA 2GA4B 4HIKA 2G5DA 5IT9E 1B53A 2LGIA 2HT1A 2N1WA 3N1XC 5IP4D 2JZ3B 1PFNA 3C2PA 4L5RC 1X56A 4R8NA 2QF7A 1ZEQX 5MPOA 1S5BD 1L0XB 1KOTA 1K8MA 2CHWA 2NYZD 3GB1A 4DHJB 3C0RB 2L05A 3HKZE 3N32A 1SMYD 3MJWA 1VCBA 1KRSA 4UHVA 1TY2A 2SAKA 2LWPA 1FJGQ 3DVGX 2MHJA 2OTLA 1STGA 2IO1B 3NBHB 1F52A 2LMCA 2JE6I 1IBXA 1SNDA 2WXNA 1PGXA 4DBGA 1U0LA 4DV7Q 2LASA 1CT1D 1HUMA 1XCTL 5BO4B 2E76C 4QUCA 3CCMA 3G7LA 1PZJD 2FCSA 4DV7L 4JI5L 4CJ0B 4LK1C 3HOUH 2NVYH 4HROA 4AYBG 2N7DA 2O6VA 2H88B 1BR9A 2D9UA 3WIMA 3IBEA 2MRPA 4KN7C 3R93A 3Q8AA 1V8QA 3E6ZX 3I4OA 4RMFA 4PS7A 4DHZB 3KVFB 3ZYYX 2L0FA 1K8OA 5CV9A 3K9OB 4HJKA 1U4PA 3M4OH 1HR0W 2DN8A 1OXVA 4BA2I 2K14A 3TEZA 1C3TA 5IO9A 2EY6A 2BS2B 1LXDA 4JLCA 1R4NB 2P5ZX 4JBKA 2ZT9C 2I1KA 1VD2A 2JRIB 1JB7A 2K5DA 3UE1A 4REZA 1IKMA 3HM6X 4W9LA 2E8GA 2L5TA 3ULLA 5IGFA 4OO1H 1JRPA 1TBEA 5M3MG 2B2WC 4A3MG 3NHEB 4DK0A 2NPTA 1CKOA 3KUPA 5CV4A 3HOXH 2MNAA 4A93G 2HJ1A 1KC8C 1T0SC 3GS2A 2PQEA 2L76A 1X32A 3H09A 1EQRA 2EYMA 3GQBA 4PMCA 1R4MB 4KZ0A 4KY5A 2CWPA 1XTCD 3L08A 2K5VA 1A3VA 1ASZA 3BVGA 1V5OA 1J19A 1MI2A 5JZEB 2A69D 1GB1A 4NPNA 1MIUA 2R92B 4JWUC 5GROA 4KGSA 1Z47A 3VR9B 2F0OA 3S1MB 3PO3B 1PVOA 1Q8KA 1SYFA 2R3ZA 2DJFC 2VRRB 2W3RA 2UXDL 3JAMi 3GV3A 3RUZA 2R92H 5A2QE 2NVXH 2N49A 4HIOA 1YOVB 1PH4A 2WWZA 2ATWA 1YNJD 1PXUA 3L54A 2EYFA 2F4IA 2ICEC 2PNHA 3IFDA 1IBKL 1C76A 2FIFA 1UD7A 5EE1A 2KN4A 4LNKA 2WXRA 2ES2A 3AE2B 4NAWA 4DHJD 5FR6A 5C0XG 5GMVA 3TMEA 3VRAB 4ZKBB 1IYUA 3NTHA 1YJWA 3NZ3A 2ONQA 1V1OA 4IPDA 2BDOA 4O42A 1SDFA 1N62A 1EU4A 2FXQA 2PZTA 1PDXA 4M1UB 4DR5L 4A3IB 3B1LX 2F0KA 1RFAA 3VR4A 2B2TC 1F2YA 2KEEA 5IGDA 4AWJA 1PRTC 5IGBA 2WXIA 4RMAA 3NVZA 2UUAQ 1TIFA 4KJOA 1K8GA 2IX1A 4LWCA 2BB5A 2FNJB 2PPHA 5BMGA 1QWYA 3NHHA 1N34Q 2UUAL 1JROA 3F2CA 3CF6E 1WTWA 1N8RC 4IPHA 1OEYJ 3U9OA 2DUDA 3A5ZB 2SOBA 1WX9A 2M19A 3TS2A 4KKIA 1EYDA 2WXJA 3I72A 2KANA 3ZIMA 2QKIC 4YHHL 3VUXA 2RA4A 3BZKA 2JWZA 3H7PB 2C60A 4GXBA 4DR4Q 4TKNA 2KOXA 2KEDA 1VLBA 1A5RA 3CP0A 2N9XA 4LUOA 4KHZA 3CPWA 4Z9CB 3JSVB 4A9AA 3PUZA 4A3EG 2BGFA 3I4MH 1RDPD 5C4XG 1Q3LA 5HGQA 3PT2B 3A7AB 2KACA 3QB3A 2QDLA 2CVRA 2V4LA 3ONAB 3OAWA 2K5NA 2R7ZH 1VQOA 4B3SQ 4XXEA 2WXHA 2CHBD 3MC9A 1T0RC 2C35B 5BMIA 4BBSH 2R6GA 4S3SA 5EKIA 3UIPB 4Q0FA 5C4JB 3AE5B 4P71A 2KQ7A 4NQKE 3L0OA 1P7EA 4OWXB 1VQAA 1AH9A 4GB9A 2UU9Q 4JI0Q 5C4JH 4B0EA 3FKIG 4A55A 4I65A 4LUZA 4S17A 1B7YB 2WIIB 2MJ8A 5KNCA 2UU9L 2FBWB 3PRMB 4N9PA 3KUCB 4J15A 4ZCKA 1K83B 1XTDA 1XF5L 4LF6Q 2A6ED 2ZW1A 3W5UB 1VQNA 3P4PB 3W2DA 1G2TA 1K83H 4LF6L 5C44H 1JOKA 5BN3A 1HZ5A 3A9KA 2ZPNA 1F9PA 5IP9G 1PZID 3QWZB 1UEAB 3KF8A 4KLKA 3I4NB 3EQLC 4JI7Q 3CRLC 1B1ZA 2N78A 1MFWA 3S17B 1ZKOA 4HRSA 4YTNB 2K33A 4MN3A 2KDBA 1UE6A 3NP8A 1YEZA 2E74C 5KIXA 5CV6A 2CCZA 4NXNQ 2J4XA 3I4NH 1XQQA 2C5LC 1QUQA 2IGDA 1EY4A 3S17H 2ZCBA 3PUWA 3NS1A 1WSPA 2JRHA 4HN7A 1A62A 3NBIA 4CBVA 1WD0A 3B08A 3HOWB 3PV1A 1SR3A 5ELFA 1J9OA 2LXKA 4R4IA 1Y1WB 4NMZA 3IAYA 3AULA 4POFA 4JI3Q 1SYDA 4MDKE 2E2JB 1Y1WH 1K51A 4IUTA 3TREA 4JI3L 4HJ5A 4K7UA 1WXSA 4B3TQ 3DBHB 4IC7B 3PGZA 3MXNA 3SXHA 4LF4L 1FPYA 2QEJC 4YY3L 3EA6A 3TZUA 4WJ4A 1L7YA 2JA7G 1P1AA 1FVIA 3RLOA 2AKWB 4OIJA 4I6LB 1TZ1A 2L1BA 4DAYB 3KUDB 4XDCA 1QF6A 2GLSA 1W6KA 2VW9A 1KABA 3T13A 3EHVA 1PV4A 1PYWD 2JEBI 4ZKCB 1N32Q 2KKCA 4HWIB 1XCQL 1DOXA 1Y8OB 1IGCA 5E6JA 4RHRA 1SE2A 3H91A 3MWYW 2YU9B 1EF1A 1WWTA 2W82A 3DXJC 1X54A 2BQQA 3OWFA 4QJFA 1MJCA 4IFDH 1LTTD 2IY1B 4ULLA 2B8GA 3PO2H 1EIFA 2OQ0A 3Q0AA 5EKLA 3DM3A 5M5XB 3U4ZA 3OTOL 4JI4Q 3NWTA 1GJXA 4LJZC 1CKMA 1GUNA 3CRKC 5M5XH 4NKLA 5EE9A 2XVSA 4M8AA 4C3IB 2KQSA 3MC0B 3PO0A 3ULPA 4GGQA 4K8JA 2D2CC 4B6WA 4C4VB 3BK2A 4E71A 4NXMQ 2IGHA 2PE6B 4WJPA 1D4BA 1Y8RC 4POGA 1E7ZA 1CMXB 2NUCA 1GC7A 2M1MA 1NNXA 2IPKD 4G3XB 4YCUA 4WAAA 5IAAC 4NXML 4P72A 4DV0Q 3PRZA 4IWQA 4OW0A 4FVMA 4ANWA 1AE3A 1FO4A 4DR7L 4BY7G 1B3AA 4JPBW 2NZ1D 2NN6I 3RZOB 3DMUA 3EROA 4YWMA 1TT5B 4MGIE 2XGTA 3DEPA 4W9JA 5IP7G 1MG4A 4XGAB 1V43A 5LHY1 4JYAQ 5JJIA 2F0QA 2O2VA 2B2YC 3G6JB 3DVNV 3RZOH 3UF8A 1HQMC 2N55A 3K0XA 4K6DA 4JYAL 5HFYA 1V9PA 2F4VQ 4YTMB 1GAQB 1YD8U 1RD9D 1GKHA 5LMNW 4XWWA 1KRTA 4A3BG 2Q2HA 3A56A 3HKZG 4Q5VA 1DCZA 3IAS1 5EE3A 3LYYA 2ACZB 5KHQA 1BBXC 4RH6A 1GJZA 1J5EL 1VQMA 2K32A 1DOIA 3SDZA 3I5JC 3NZUA 3PCOB 5J17A 3DBRB 4NPSA 2D10A 1SYBA 1WXVA 2EKIA 2HHHL 1NJIC 4NAMA 3ITPA 3U4EG 4CHKA 4DV4Q 1B4OA 4DV1Q 5EQ0A 1S72A 3A8KE 3KQ4A 1HNXQ 1KXLA 4DKAC 2JP1A 1QLBB 1ZP0B 1JWSD 4AYBB 1HUNA 2ZTCA 1O7ZA 3K6OA 3E56A 4GN4B 2KK8A 1VCIA 4A3KG 2BE5D 2MLBA 1KNEA 2WGSA 4OVZA 2AQ2B 4G50A 1HNZQ 1BCPB 2CU1A 1XLQA 5AEKB 1HNZL 1C4AA 4RF1A 3LJ3A 2WFWA 1CA5A 2OJWA 4H44C 4IG7B 1T5EA 5DM73 3U30A 1ZYRD 1OEYA 5AZGA 3TUOA 3M9BA 3QOJA 2J0JA 4YL8A 5A35A 3AEVA 1JB3A 4ZHOA 3CCQA 1VQIA 2XSCA 1IKLA 3NY5A 2WV6D 4NNJB 3I7FA 1VQBA 3TSSA 1EY0A 4A93B 1PFBA 4KJNA 2DGYA 5M3MH 4A3MH 2J42A 4NJCA 2LRUA 1MD2D 4AUQC 2NR2A 4WURA 4XX5A 1M94A 4YTPB 3E3XA 4A93H 3N3KB 4BKGA 4ZRKA 2DNEA 1P9DU 4DAPA 3L2PA 4WJ3M 5JOBA 3RN5A 1VQGA 4LDTB 3U52E 1SNMA 2F0WA 2B2UC 3DHIC 4FP5D 2A6HC 1HZ9A 2K5WA 4OZCA 4ZUIA 3J81c 2KCMA 2DZIA 2LRWA 2R2OA 4IM0A 3T3OA 5DAUA 4YIJA 1QZGA 4KHPQ 1E2WA 4HPMB 4YWGG 1GOZA 5JEAJ 2UYZB 1SF0A 4LF8L 1LTGD 4KHPL 4TKOB 1JJCB 4FO2A 2WAQG 1PH6A 2ZVNA 3Q8DA 2WNMA 2RD0A 1X6OA 3HOXG 3MJ5A 1A6XA 3BVMA 1IGDA 2PYKA 2ZJRA 4KDLB 4NB3A 2M8SA 2OHFA 4PK1A 3F8TA 1WJJA 2J53A 4WJWA 1Q90A 1SE8A 2MPMA 2PIAA 5C0XH 1GPXA 3B2FA 3ZNHB 2PMZE 1QOGA 3BK1A 1WTVA 2DYMA 2IHFA 3EC8A 3PRPB 2KMCA 3VFKA 3KJPA 4DR1Q 5I9PA 5JJLA 3L13A 4LFAL 4MTKA 1L4ZB 2DYBA 2OXPA 4A76A 1EF5A 2LGXA 4IOIE 4JE3B 4E3CA 1ZYRC 2VXWA 3ZLZA 3K9PB 4OVUA 1WFQA 2MJDA 3AE8B 5CX3A 1JQ4A 3K5NA 4R4OA 3GTLB 2LHDA 2D2QA 4IWOA 2E2HB 2EJMA 1K9MC 1I42A 1BCPD 5IWAL 3GTLH 2INPE 2O4XA 2QC8A 3AB5A 5J2RA 3K7AH 3J81j 2UUCQ 4G7OC 4DPGA 1AZQA 4TRDA 2CQAA 3OMGA 2H89B 3H7SA 4H2AA 4WIPA 1F2ZA 1T5XD 2KFJA 2ZJDA 3DVGY 3PLVA 5LNK1 4G4KA 3BDLA 3DWQA 4DUYQ 5JHBA 2OF1A 4GNXA 4CQNA 4FXKC 1EOTA 3GTOB 1E9MA 3GD7A 2KN5A 2XBBC 1E5WA 4A3EB 1RFKA 4GDLA 5C4XB 2NVTH 2D0OA 5I2YA 4PQXA 3J9CA 4H7BA 3WA0A 2V4DA 4EFOA 2ZTDA 1P8LA 1YJ1A 3HOZB 3GDEA 2NS5A 5C4XH 3RULA 5HGTA 2KAJA 2DAJA 1OFFA 3B0AA 4CKEA 4LNFA 3FILB 4K6LA 3IFWB 1WTQA 2JYOA 1XT9B 1QE6A 4OONA 4BKSA 3T9LA 4LDTD 4A3JH 2NZHA 4ZDVA 4CKCA 1KRHA 1TWHH 4MH8A 2UU7A 3FKIB 3P4RB 5CHVC 4X64Q 4WJOA 2GVBA 3AH7A 2E75C 4PT5A 2Z0EB 2M4NA 4JI1L 2UXBL 1L1OB 1KD1C 1E3PA 2RDHA 4RGTA 1WMHB 1KIXA 1ET6A 3KWVA 4A20A 1CUKA 1VS0A 3TJPA 2B39A 1JE4A 2KOLA 1S5FD 3QK0A 1QOAA 1J0GA 4LJOB 4ZRPA 1WTOA 5E7NA 1O78A 2G1EA 1Q0WB 3TIXA 4RM9A 3PPAA 4X3UA 1B9MA 4BBSG 3PS6A 2WXFA 1MVKA 1MPEA 3VUWA 1BCPC 3MTNB 2K03A 3L3OC 5IOIA 2LZ6A 3R8BA 2VH2A 4ZYNA 1STAA 4PS8A 1HA6A 2JQOA 4PMWA 2RDBC 4TV3A 1WYDA 5BYRA 3N9YC 1YNND 1J8CA 1SYEA 1WGGA 4XQNA 2CFMA 2GVAA 1LQBA 2KD0A 4KI0A 2RHQB 3DEOA 3A1QA 4HMJA 4L5TA 1ILPA 1TWGH 2BYFA 3D4WA 1IL8A 1L6UA 1SIJA 3PREA 4RCNA 2MQJA 3H9DA 4IUVA 1TKWB 3TDQA 2MBHA 1WRDB 3H6MA 4KKTA 3T4AC 4WFN3 5AZFA 1WH3A 4PNYA 2KTRA 4UDUC 3E9IA 3HM3A 5CBEE 1KAWA 3NXWA 4HJAA 1PMRA 4LF7Q 1SNPA 2BTEA 2EYJA 4AQ7A 2BDNA 2IYDB 3V05A 1YNXA 4Y7NB 3E9HA 2JA7B 3MHSD 4KIKA 4U673 4JX1C 4J1MA 1JOQA 1VZ7A 1BO0A 2MBEA 1Q82C 2R61A 3SK4A 2A5UA 3CMMB 1HZAA 1WCMG 2QDBA 4RG1A 5CV7A 1SE3A 1PH1A 3H6NA 3ZUNA 5DEHA 3J80L 3HK0A 2KXJA 1Y56A 1TJEA 3MFYA 4QCLA 4HKZE 4MGKE 1XXGA 4LNNA 5FLXL 3N1ZC 1NE3A 1ONLA 2HDMA 3FRPB 3KK7A 4OXPA 4GOPC 4BBRH 5JH5C 2K5QA 1TS2A 3L7ZC 4PG3A 4FF4A 2NCNA 3H15A 2ZNVC 3TCAA 1E0ZA 1I6HB 1EEID 4JG2A 3KJOA 1FD7D 3RI7C 3J80E 4LNQA 2DHZA 2PZWA 2LGDA 1PH9A 4GN1A 1B9NA 1IPGA 3SFDB 3ZNGC 1XNQL 5FLXE 1I6HH 2B76B 2QMTA 1LTBD 1KQSA 4PYUA 4DXAB 1O7LA 1QVCA 3C1EA 1IYJB 1R4NI 1CA6A 1SB3C 4GDKB 4KZCA 4TUUA 2MUYA 1VQ5A 5KGUA 1VQFA 5JXVA 1N33Q 1E8WA 5LXIB 4JI2L 2JA6G 1N6ZA 1YNNC 2LXAA 3TBLD 4HSVA 1V2YA 4HMIA 1EYAA 2E2DC 3S24A 1N33L 2J52A 2ZPYA 1RLFA 1X3QA 1B3QA 4A3OA 4AS1A 4BY7B 1R4MI 2KC2A 4IFDG 5J39A 2REXA 1OXTA 4C00A 2L15A 1OTRB 2N1VA 3PO2G 3NQIA 1C8CA 2PCFB 2KCNA 4RA8A 1V1PA 5DM63 2PKOA 2WU2B 1L2NA 5IP7H 3CCEA 1Q1OA 1LTSD 2B2WA 2L32A 4IUPA 3BDOA 2PVOD 4M0WB 1KLUD 1DGJA 2LHEA 4B9XA 4A3BB 5M5YH 1FXTB 3CAMA 1HTPA 5I4DA 3NJTA 1WM3A 2RBMA 1C48A 2ENBA 1H95A 3VTUA 2KA7A 3NS8A 1JICA 3A9JA 2LJ5A 1VQCA 5DNFA 4XDDA 3ZTDA 2HDLA 3V6EB 3QQ8B 3JC66 4QIWE 2Q8IB 1D5XC 1ESFA 3VAWA 1R7SA 4IW0A 2KDIA 4DV5L 2JN4A 5IT9L 1I3QB 4JI8L 2IX3A 2BKRB 3VTWA 1XLOA 4GKKQ 1O7IA 1M8AA 2Z6KC 4LF9Q 4MJSA 1WXAA 1KM7A 1YJIA 2KJHB 3UDIA 2C9WB 4LFBQ 2V9HA 2ZM6L 1EWHA 2HQLA 5FLMG 3DHGC 2LMCB 4QB4A 4FULA 4DAVA 1IBXB 1V81A 3QJZA 5DPTA 3VH4B 4FA6A 2VZKB 4A3KB 4O0AA 2Y5BB 4BY1G 3UI2A 3X3NA 2KYWA 5IYCG 1TWAH 1JALA 1LM8B 3I63C 4K3BA 4CJ2C 4A3KH 2OJRA 2XK5A 2KNBA 2O6VB 2JK8A 3H3VI 1CJEA 1VR9A 2A5HA 2A68D 1C0AA 4DV3Q 2HD5B 1LO5D 3STBC 2B2TA 4KKUA 2SEBD 4DA2A 3BYTB 1KAAA 5E4XA 1YHAA 3APFA 4WH4A 4W9CA 3TZDA 3VR6A 4M01A 3WAMA 3VA7A 1YZ6A 1SYCA 1HNWQ 1C78A 4RHSA 5T8IA 3Q6SA 5BYSA 2M56B 1FJGL 1LACA 1CM9A 3SHLA 1GUOA 2NVYB 2PW7A 2WB1B 3A55A 2VUMH 1NMFA 3HOUB 3IFTA 5KYIA 4GLXA 1X9NA 1EQQA 1HNWL 1L5PA 1PA6A 2DJGC 2B3AA 2L7RA 3A5UA 1IBMQ 3MC8A 1TWFH 2K3UA 2JU6X 5E6PA 2RCFA 3DCGA 3HZXA 2BYVE 4LK0M 4ID6A 3N30A 2G4SA 4E6IA 1SYGA 1VQEA 2HIXA 4LNOA 2F0GA 1PH3A 1YX6B 3M4OB 2NPTB 5CHFA 1Y14B 4HSPA 1HZBA 1TY0A 2N7JA 1B9RA 1JWMD 1FM0D 1EQVA 4ZRQA 2BT6A 1OO9B 5F2DA 3HHMA 2EDGA 5HG2A 3EIVA 4OEMB 2WXGA 3ENEA 2WAQB 1D1KA 3TMPB 1F2RI 1O80A 3KF6A 3ERQA 3RN2A 3HOXB 1OQQA 3HUIA 1HE8A 2YLMA 4LFCQ 2CWAA 2IO3B 1QJOA 3D8GA 2K6DB 3MTSA 2VL6A 1VQPA 2K4KA 5ELEA 4LFCL 4A3LH 2KLGA 4P73A 4G11A 2J0TD 1VQ9A 2LXJA 4GU2A 4NAWB 5A2QL 2NZOA 4KX6B 4RGOS 3LWEA 2Y5PA 1DONA 4IDIA 3AEDB 1AFPA 4JL9A 1SMYC 1X65A 1V1QA 1LABA 2EIFA 2NVXB 3NK9A 2INNE 1E22A 2L12A 2VZKD 1SRUA 3WOFA 2KJRA 3Q23A 4JIOU 3DUZA 4ITKA 4QY7A 3M4PA 3DBHI 2CS4A 2O6VD 4QL5A 1FMAD 4QAYA 4HAEA 4KKJA 4N58A 3MHZA 1IW7D 2WINB 1UGMA 4HIMA 1D1IA 2KCCA 3NUHB 3SVMA 1EIYB 2L8JA 5DPRA 1UBIA 3CMAA 4UPAA 2I5HA 2GBMA 1DXMA 2YTVA 3Q3FA 3DWPA 3KLRA 3S2HH 3UE0A 1Q8IA 4JV5Q 3MXUA 3HGBA 2Q2UA 1I4GA 4I7AA 2ZW0A 4JC0A 1RHPA 2G9DA 1G2SA 2J0MA 4OWTB 1WOCA 2BWFA 5FJ8G 1EY5A 5I6YA 1KJTA 1PUTA 3SGIA 1YJJA 2K39A 2M0XA 3I57A 3UINB 1YNTE 4K3CA 1M1KC 2L52A 3CF5A 5K36H 2MP2A 5C3WA 3ZQ4A 3GZNB 1SE4A 3PUVA 5T1GA 2IBIB 3S1QB 1SBBB 1I50B 1N34L 1XLPA 5D7GA 4GZYC 1YHBA 1NVID 4IM2A 1WXQA 3ZVVA 1WTXA 3Q3MC 2DZKA 2JA8H 3S1QH 2B8FA 1I50H 3OMCA 2Y3AA 4FNFA 1PQSA 3QR8A 3I4MB 2OEDA 3LNNA 1H9JA 2KCTA 3PGEA 3SR6A 4IO9A 2JYEA 2F0EA 2A69C 1LT6D 4DR4L 2MW5A 1SJED 2K25A 1XPUA 1YITA 4RCOA 4MM3A 3EFXD 4NDXA 1I7HA 2R7ZB 1PYBA 4HJGE 2BVCA 3Q3JA 2CJNA 1EY9A 5AJ3Q 1FR3A 4BBSB 2LVOA 2EMTA 4OELB 5D3IB 5EPLA 4F8CB 1YNJC 4A3JG 3UDXA 5IN7A 3AE7B 3OIQA 2G45B 2QA4A 1GUAB 3NELA 4FXGC 5CYUA 3I4LA 4K7WA 4B3SL 3GTKB 1LTAD 3R2IA 4IOCA 4R4CA 3A9KB 1SN8A 4HKQA 1FGBD 1TIID 3KF8B 3EFCA 4BKTA 4RGNA 1PGAA 3GO5A 1HA5A 2N9PC 3OG5A 1K0RA 1PDQA 3GTKH 5NUCA 4GN3B 5LL6X 1RTNA 4LF5Q 3LB8C 1TXYA 1BCPF 1Z6HA 3BZCA 3EN2A 4XTCS 3HG9A 1U4RA 3VH3B 3T3NA 4JI0L 1HQRD 1QUQB 2BCOA 1AEXA 2FCQA 4ICVA 1MHXA 3DBRI 1I35A 2QGQA 5C44B 5FO9B 4XDXA 2B2YA 1YVCA 3JAMc 2K8HA 3D4RA 1YJNA 1E8YA 1F77A 4AH6A 3BVZA 1ZXHA 2JZPA 3W5VB 3N6RA 3ZNID 3TP5A 3H8HA 1NI2A 5E6NA 1E8ZA 4GKJQ 3MXNB 3ALBA 1GC6A 4GLAC 1WCMH 4JI7L 2K9XA 1DOKA 4IPCA 4TVAB 3IT6B 2OOBB 1UE7A 1PFMA 3W5OA 4X57B 3QWNA 4NXNL 1CFMA 3AYHB 4N8X1 4X66Q 4E74A 3AM9A 1VQKA 2PO4A 4XYQA 2MHVA 4QUFA 2NB0A 5FR3A 3MEHA 1HEZE 3RNCC 1N63A 4MH0E 2XEWA 2YVCA 4H0LC 1XJVA 2K5HA 2HDEA 3E0EA 3P42A 2WHIA 2WU5B 4C3JG 2V0GA 1MBYA 4B3TL 3AB9A 2MP1A 3I9V1 1YHQA 2CHXA 3GTGB 1OXXK 5GADC 2BH2A 4R1JA 4MEMA 2JA6H 3UQBA 1WI0A 3T1HQ 4BBRG 2OCEA 4FDBA 5IKCM 2F0UA 4KTAA 3ND9A 1PH5A 1R9TH 3IHPC 5BR8Q 3GTGH 2CR5A 4DNIA 3RLFA 1N32L 2IX0A 1YIWA 3RNBC 1HPCA 3GTJH 3PO2B 4JWSC 4CO7A 1G6ZA 4ZRJA 1XLNA 3HOYG 5GAGC 3PQIA 2A6EC 1PFSA 1ACCA 3P63A 4NZLB 2F0MA 3NQTA 2CHZA 3BDCA 2K6AA 1WJNA 4CJ1B 2NTSA 1JJGA 3MHBA 3C46A 1J7AA 1RRBA 2KFKA 2RSNA 2WDTB 1JMCA 4BXXG 4R9WA 2FINB 2XNAC 2A8VA 4JI4L 1FYCA 1TKEA 2O2VB 1SXTA 2Q2IA 2R93G 3DBLB 3ZJYC 3RLNA 2CQOA 5LMNQ 2I0QA 3L16A 2Q5WD 1AZPA 5E6OA 2F3WA 2H4OA 5C0XI 4HCNB 1X3GA 1TYGB 1HFGA 4CHTB 1L0WA 1WFYA 1ZPSA 3I2ZA 2B2UA 4IQZA 1TGZB 4P1BC 2QHOA 5JPNC 3H94A 1E6EB 4W9KA 2FCMA 3S9WA 2RGFA 5CC4A 4AQYQ 4HPPA 4FJVB 1WI5A 2KHJA 2F0SA 1EIGA 4DV0L 4LAAA 4ICUA 2DX5B 3HOVH 2JXXA 5JEAG 2LVQA 2KVZA 3K58A 2DBYA 2LGSA 1SGHA 3HIZA 2Z1CA 2KMMA 4U68A 1PYSB 3H3VC 3P7JA 2KECA 2WXLA 3D6WA 1WY8A 4WWMA 2BF8B 1U5KA 2K05A 1FCCC 1Q5WB 2ON8A 5H92C 5FLMH 3RYTA 4DV6Q 2K8BA 3U8ZA 2F4VL 1D6EC 1A0IA 2AQ1B 3HRZC 4B9WA 4DNRB 2PZUA 4BY1B 2JYTA 3BY4B 3Q8BA 2PJHA 3M4YA 4DV6L 2RVLA 4PZ6A 4BAXA 3MXGA 2INDC 4M8MA 4BY1H 4DXGA 1C9FA 4JK1C 5IYCH 4KMUC 3Q3NC 1XX8A 4L8JA 4UAIA 5C3EG 4BVUC 3ZJUA 4TQUS 2WXQA 4W9FA 3K0YA 3FMCA 1NDDA 5KRUA 1H9SA 1ICWA 5LXHA 3FHWA 3ZJVA 1G291 3PVLA 1FL0A 1FXIA 2LUMA 5D2MB 3AQQA 4DV4L 2B29A 4DV1L 1IL2A 2JQRB 2D07B 2Z9HA 4L23A 3BG3A 1EWCA 1UAPA 2EXDA 3MFGA 3MVVA 1HNXL 1C1YB 2K0PA 5CBAE 1EIHA 1YJ9A 1EZ8A 2LJIA 3R3MA 2L55A 2EMSA 3AFQA 1SNOA 1F2RC 1E7PB 3MP9A 1EOVA 2E6XA 3J81L 2KUMA 3CCRA 1GG3A 1WR1A 2WDRB 3G6EA 3IG3A 1A2UA 1NTGA 2H5XA 1DOLA 1EY6A 2SNSA 1ZOYB 5C5LA 4UP7A 1Q7YC 2E5LQ 2R7DA 1JORA 3AI5A 3QAQA 4YCVA 4JI6Q 1I4XA 1EY7A 1NI3A 1JE5A 4HJ8A 1HH2P 3MZ5A 2VUMG 1STHA 3HRDD 1OTCA 5H8YE 3ZRFA 2NVQH 2DZJA 4A3FG 3J81E 3P4SB 4AOFA 5M3MB 3IKJA 4A3MB 4MGYE 3C19A 1CI3M 2G3QB 2PMZB 4MNOA 3GP7A 4OX9Q 4QQBX 4OVVA 2EYPA 5D14A 4DN4M 3DDCB 1SNQA 4K8IA 1YI2A 1CZPA 3KYDD 4FYDA 1DZ1A 5JHAA 2F0TA 2M9VA 4DR2Q 1WVLA 3TN2A 3FP9A 1IXRA 1VF7A 5C1ZA 1IBLQ 3G71A 3S2DH 3ERSX 4IJLA 1Y1VH 4OIKA 2AEHA 2KWVB 1LTLA 4P16A 3FPUB 4KY6A 3T51B 1UZXB 4A90A 2C5CA 1XMOQ 4FBJB 5FK9C 1QNKA 1RTOA 2F0LA 2K7VA 3U9SA 1N60A 2KMAA 4GOCA 4F1SA 4N6EB 5GAHC 1I94Q 1Z2MA 1KFYB 3J7AV 4IUQA 3NENA 4UP8A 3PV0A 3GTQH 1FGUA 4H02A 2GBJA 3S1NH 3L9AX 2CH4A 1I94L 1X3EA 4A3LG 4RFBA 1WX8A 3Q69A 3Q8EA 4AYBE 1DM0B 2H1EA 1Y8NB 1Q12A 2I07B 2BE5C 1PTOB 4K2LA 4R4QA 5JVH3 3EVQA 1BVSA 2EJGC 4FADA 1V9JA 4LLGM 4II2B 1I4RA 2HCCA 1CK1A 1PTOH 4RF0A 4LJPB 1GUGA 2HCIA 4DAMA 2JA5H 5JAVA 3SFEB 2XN9C 5COYA 2LFNA 3WWVA 4I7ZC 4EVOA 4DR1L 2KWUB 2WXOA 4GDLB 3ZXRA 4ZOHC 1JJ2A 4ABNA 2V3SA 2ID0A 5BYQA 1EQTA 3PTFC 3J7AF 3K7AB 5FJ8H 4ARCA 3A4RA 3ZXVA 1LFDA 1PH2A 2KQ4X 2KWCA 3C8YA 4MGZE 2LGYA 4BBNF 1SJHD 1UWMA 3TP6A 3UIOB 4JOIC 3UQAA 1YIJA 2TSSA 4ANUA 1EO6A 1TS5A 4ANVA 2UUCL 2QJLA 2WS3B 2O5IC 1SLJA 3SR1A 4GOPA 2B2VC 2MH7A 2NVTB 1Y69U 2KVMA 2D5GA 2NBVB 3CSTA 3ZDMC 3V6CB 3CCLA 3QX1A 3N20C 3HEJA 1EEFD 3AFPA 2VQEQ 4II3B 4DUYL 3A7LA 3Q14C 1K8RB 4B3RQ 3PF4A 1SROA 1A2TA 2EQSA 3I90A 4JBMA 2K75A 4ME5A 1I4HA 3RCZA 1GO3E 5D65A 1YQ3B 1WE6A 2JT4B 3GE8C 1UWXA 3V96A 5K36G 2F0FA 3VUYA 1V49A 1CZGA 4KGRA 4A3JB 2BOSA 4FXDA 2AMCB 4GN5A 4IPGA 5EJWA 4C3HH 2OTJA 1B44D 1TWHB 3D32A 1KLGD 3R2TA 3S16H 3CQZH 4IUUA 3I91A 3K57A 3OIPA 2JA8G 3T16A 4HVBA 1E8XA 5IE8A 3ICEA 3AMZA 1STNA 2EYOA 3DM1A 1LV9A 5EAYA 4A3IG 2MGSA 1Z5SB 3R66C 4X64L 2K28A 3AEGB 4N9F4 3A1QB 1V5TA 5EGTA 1CHPD 1K8AC 5G3LD 3S15H 2UXCQ 1JOOA 2I38A 1CQVA 3RZWC 3VYRA 1VQ8A 3LGJA 4BA1I 1WTHA 2RDFA 1RAXA 3ABVB 5D6JB 4B95A 3HVDA 1BUVT 2WP9B 3AMUA 4K5XA 2KDMA 2VB3X 1PTOD 3OPOA 1WGRA 4P74A 3QHTA 1EFWA 2YTYA 1FNVA 3P4QB 4WQMA 3PF5A 4R4TA 1QCBD 4LW1A 3CXCA 1FRDA 2WX1A 5C5MA 5ISRA 5HI1A 4JCVE 1ZE3D 4JBJA 4KIKB 3PZDA 4FXCA 3J80i 4KD4A 3PZ7A 1TWGB 2A4ZA 2ZXPA 4FJZA 2E2IH 2MO1A 4B3MQ 1OGWA 4FHJA 3FC4A 3L17A 4EE2A 1U9RA 3P20A 1DD2A 3CHBD 2W3SA 3MAQA 1WRIA 2IO2B 4RNAA 1VZ6A 2B3GA 1NBWA 5G5GA 4A6QA 2K04A 3QIJA 3VQIA 2Z6KA 1NAPA 1QOBA 4G7HC 4MIUA 2M17A 1NCVA 3ECIA 2XRQD 3OWEB 1EWYC 2QEXA 4BKSD 4KN4C 1CKNA 1STBA 4C3JB 4LF7L 1TQOA 1VQ6A 3T1YQ 1IYVA 1FRRA 2CJOA 2Z0DB 3M63B 5J18A 5DLQE 2JJQA 1J8IA 4DR6Q 2F0PA 3VA5A 4C3JH 3I56A 3K5LA 3T1YL 1N36Q 3F2BA 2LY7A 1AARA 2QSDA 2V1YA 4BBRB 3H0GH 4N9TA 5G55A 4HLEA 1EYGA 3GTPB 1WXMA 1YN4A 1L6VA 3VR2A 4EZKA 3K7UC 5J1ZA 3WCQA 1VDVA 2RQXA 3CW2C 1ZW7A 3CPFA 4EZJA 3GTPH 3NUCA 2EOTA 4G7ZC 4MACA 2NVUI 5FKAC 3HOYB 2N9LA 4ALPA 3KFUA 5ELNA 1BKBA 1TR5A 3UGBB 2D3GA 2VB2X 4FN2A 1MJDA 4HDQA 4YXDB 3ONSA 3PIP3 1II3A 1QG7A 3HOYH 3D0FA 5EPKA 2MJEA 2I2YA 1F2MA 3SU8X 1KDCA 1NYRA 3PSEB 4OO1I 1E7UA 1V1PB 4AP4C 2R93B 3F2UA 1DGSA 2IT1A 1SSOA 3K81C 3SK6A 2MBBB 2D62A 3KDFA 5E1FA 2BBCA 4BXXH 3S1RB 5H1SE 1GUWA 1SAPA 1S5DD 1MHHE 4XT1B 4QIWB 4DR3Q 1YQBA 2R93H 2WACA 1EYCA 1GM5A 2V3NA 1KDBA 4FF3A 3S1RH 1ET9A 3BYYB 4OWWB 1S1QB 2LI5A 1U4AA 2VZAA 2WXKA 1E24A 1KNAA 2Q8RE 1D5ZC 1B2TA 2CKHB 2GMIC 3S14B 2BA0A 4IOAA 2XRSD 2GB1A 3A9JB 1D5MC 4HTHA 2BA1A 4HJ7A 1I6VC 3B2GA 4L63B 3PHWB 3AE4B 1HCZA 1GXDC 3S14H 2EYLA 5M9OA 1AYFA 5JEAH 3U2SC 1X3PA 2UUBQ 5M5YB 4B9KA 1IZ6A 2LFIA 3AU4A 2IJ0A 3G4SA 2KJXA 4W9GA 3WAPA 5CORA 5TSSA 4DQOC 1QNUA 3HKZB 1ZDXA 1OQYA 3C3LA 2MSED 3DVNU 3OJ4B 1GB4A 4DK1A 1HJPA 2V4IB 4C1NK 4K81A 2KQ3A 1F2LA 2TMPA 3SE0A 3A0JA 4J6HA 1S3OA 5C3EB 3SDLC 1LLRD 1UE1A 2I5LX 4HXDA 3U7ZA 5L83A 3HOVG 2PTLA 4DK6C 4NW2A 1V97A 4XC2A 2B63H 1AW7A 3CD6A 2FMMA 5C3EH 2VQFQ 1PH8A 4XQJA 1QKZA 5EPJA 4KD3A 5KNDA 2JXMB 3HP3A 3T8MA 2W55A 3M85A 1BBUA 1PRTB 3AE9B 3NEMA 2MO0A 5M5WB 5C2TB 3APCA 3MEFA 3TEHB 4GKKL 3N1YC 3ML8A 1A3TA 4LF9L 3O13A 2I5MX 4F8MA 5L95C 2PQAA 2GI9A 1TWAB 5M5WH 4LFBL 1L1OC 3DWAA 4RGMA 4V190 3GZNI 2G9HD 1G51A 1WE7A 3JW0X 3BWUD 1ENCA 1JQYD 1H8CA 2FHTA 4R3DA 4N59A 4ME3A 3ND8A 3NVWA 2DY7A 2KHIA 1A3UA 3GV6A 4K14A 4OGQC 1HR0Q 2INCC 2M0AA 2ZVOA 1CHQD 3FDTA 4J8QA 3Q2AC 4X65Q 3AXCA 2C7NB 2MFIA 4B0MA 1H9RA 4I6NB 1K52A 1HR0L 2JF5A 4XWTA 2VUMB 4DV3L 3ZKJC 1I4QA 2MBQA 2PNRC 4YSXB 1H9MA 2M2LA 2IW3A 5K5PA 4A3FB 3M7NA 3IVFA 2I46A 3X23A 4BZAA 1JWAD 2HJ8A 1TWFB 1Q10A 1KDAA 1EU3A 2ASBA 3CC7A 2RMMA 2FIDA 4FJYA 1FNUA 2X6LA 3KYHC 3PMFA 4FF2A 3ZGZA 3URYA 2Y0SE 4A3FH 3VR3A 3CMEA 4A3CH 1WGKA 4HIDA 2SDFA 3NG0A 5M3FG 2F0HA 2R7FA 5JJKA 3KF6B 5HURA 2BPSA 5FO8B 1IBML 3FEWX 3VTVA 1E1TA 3T53B 4OL7A 1OQRA 2EY2A 3Q24A 3KBGA 4KDIC 1B50A 3F1ZA 3W1SC 4ZHPA 1K28A 4KHVA 5IT9c 5IIFA 4DFAA 4JI5Q 1GUSA 5JVG3 4KV6A 2N0SB 2NMQA 3QOLA 3IAM1 1BBWA 1K0SA 3D3RA 4QMGA 2CKZB 3V2TA 3OW7A 1QZHA 4KKSA 3VYUA 2K50A 4YWKA 2FE8A 3CWIA 3CCUA 4P2CB 3ER0A 1F9JA 1P0RA 3VYTA 2WKCA 3PHXB 4Y52H 2JSOA 4F7ZA 4AJWA 1FFVA 2KO3A 1UWVA 2JXTA 2IDYA 3QO2A 4IFDJ 2EZVA 3ZNZB 4K2KA 4IM3A 3RUIB 4FHKA 3NBHA 1WGYA 4WJQA 1WIAA 1LM0A 1Y1VG 1EY8A 1Q81C 1QVFA 4XIGS 1PRTD 2A68C 4ZQ3A 2PW5A 4F7XA 3QCAA 4QGUA 4HEA1 5J22A 2IZVB 4WQOB 4BFRA 2D11A 3DPDA 1T0QC 4BOZB 2N3SA 5EBCA 4MELA 1QZEA 1LT3D 1WZ0A 3CCSA 1E7VA 2JX5A 4KK7A 1WX7A 4A3DG 4NY0A 2N9KA 4URKA 2A19A 2WB1E 1G91A 3KW5B 2F0DA 1HZCA 3RNEC 1YBYA 3CCVA 1WGHA 2DWQA 1V86A 2GBKA 2MP2B 4IKGA 3SHQA 3S2HB 1HTOA 2E3TA 1X1MA 1D8LA 5KEEA 2LD9A 2K1BA 5D94A 5TR5A 4DK5A 3LWUA 2UXDQ 3K5OA 2CW0D 3V60A 1RJTA 2JA5G 2KHWB 1PH7A 4BOSC 5C4HA 1IUEA 4IURA 4IFDI 5DCNA 4DHZE 1EZ6A 3L10B 3W9CB 4BBNC 4F88A 1IBKQ 3S1MH 3PO3H 2ICIA 2KC1A 3L4PA 4JV5L 5AUIA 3RFZB 4KGTA 2X38A 2ZJPA 4US8A 3I73A 1WJ4A 4ZYSA 3TP7A 1SSNA 1FD6A 1G6JA 2RR9A 2DAFA 4MM3B 1WD1A 3OW2A 4DU9A 3KUZA 2F0NA 5DPWA 2WAQE 3IXSA 3RPFC 4PZ7A 2L9HA 3HFZB 1XMQQ 5FOBB 2JA8B 2MA9B 2W54A 1H4RA 2EYHA 4DR5Q 2NBFA 4CDFC 1XMQL 1BQQT 2AUKA 1R4PB 1QVGA 1VQLA 1ZXIA 1WYGA 2ZXOA 3DBLI 1GHKA 3P1MA 2NN6G 4MHEA 3AE6B 4EOYA 1W3SA 5CV5A 1I4PA 2RSUA 1TVXA 5LMUQ 4UY8C 1RF2D 1W6JA 2MQHA 1UE5A 2QCPX 1ROEA 2KZRA 2N9EB 4A3IH 1FIQA 1WJUA 4BWGB 2AL6A 4X3SA 3QJYA 1P3QU 3JAML 5LMUL 1WYWB 1K3BC 1LTRD 4QF4A 5CR3A 1QOFA 3ZW3A 3M3YB 3DHQA 3AV8A 2QIEB 4ILWA 3KLSX 1RWSA 4YHHQ 4C3HG 2YTXA 1OXSC 2YEPB 3CKIB 3M3YH 2PVGC 5AJ3L 4AJYB 1KL9A 2AQ3B 3BJUA 4HEDA 5AFWA 5BN5A 1W2BA 4HPLB 3JAME 1VDZA 4GLVB 2BB6A 1F9SA 1IW7C 5C4ZA 3Q6BA 5BN4A 1LTID 4S0RA 3H3VH 4IWPA 3V61A 2N4FA 2KDFB 4YSYB 3LXFA 1I5FA 5I9OA 3QC8B 4ZAIA 2CW0C 5IYDG 2V1CC 4AIMA 5IOCA 3CSFA 3HS0C 3SD5A 1KH0A 4WORA 4C7ZA 4LF5L 3I3CA 3HOZG 1HRJA 5AZHA 3NE5B 4K1RB 2BS3B 5JPMC 3APDA 5EKKA 3C1FA 5HY6A 4P1CC 2X6GA 4WWOA 1BT0A 2Z8LA 3H7PA 3H1UA 3TP8A 4HCSA 1TT2A 3ETRA 2A1AA 2RF4A 4K0KQ 1L4DB 1S3SG 1WCMB 4LMQD 1P98A 5I2XA 2BH8A 2K52A 3J7A5 3D31A 3JSVA 2WP8J 4K0KL 3AE3B 3Q3OC 1Z7TA 1FXAA 1JC7A 2QCZA 1HHVA 1RL2A 1STEA 4GKJL 2C9OA 3Q22A 2MEKA 2JEAI 4KSLC 2JWUA 2ZCCA 4PYZA 3N52A 3EBEA 2LSSA 2L4NA 2XTIA 1XWEA 3Q8CA 3OOCA 2KWDA 2F0VA 4X66L 1LYLA 1G6PA 4IN3A 1N61A 4W9IA 2OWOA 4MT5A 1EUJA 1N9WA 1QQRA 2DLBA 3VRBB 4TQ1A 4JQWC 1CTMA 1EFID 4C80A 5C0XJ 1WR6E 1VQ7A 5G3LF 4LTUA 5KNBA 2JA6B 5IYBH 2A74C 3H0GG 2KFKB 3BIID 2EPBA 2FCNA 3KH0A 5ELOA 4RKLA 1R9TB 2LS01 1WZ3A 1PTOF 4JVZA 3GTJB 1UELA 3IL8A 4IUMB 4JGHB 4RM8A 1D3ZA 1TKGA 1SFOB 2OT2A 1A70A 4DF7A 1A15A 3HOWH 3T1HL 1ENAA 2QW7A 4LF4Q 2FFKB 1MJEA 4YY3Q 2WLBA 5BR8L 4K7SA 1SFOH 2MCNB 1X55A 1UH6A 4GIVA 2DY8A 4M8NA 4L1BA 1RIPA 4HJ9A 2E2JH 4FLHA 2FJ2A 2N8NA 3NSWA 5ELDA 1DOMA 4EEWA 4PS3A 2N88A 5EBDA 2GRIA 5C23A 1B70B 5IODA 4V0BA 2ZZPB 1DYQA 1Q1BA 3DWMA 1D7QA 5IY0A 1MSGA 1PFDA 2EKEC 3P2BA 1FNWA 3QIAA 3RR5A 4YCWA 2WKDA 4XYOA 3TEWA 2F03A 2BW2A 2RHSB 5LMNL 2JY6A 4ZRIA 3IRBA 4XT3B 4X3TA 2ZJQA 2YU9H 3WAOA 3OTOQ 3HOVB 4X62Q 1SIFA 1E2ZA 4UP9A 4A3GG 2K6QA 4DUZQ 4P6VF 3DLLA 4GS3A 2AWTA 3I3TB 4EZLA 3KBXA 1JWBD 1YQ4B 1WJ6A 5KHOA 4X62L 4DAYA 4AQYL 1M90C 4DUZL 3TL5A 2F0JA 5LL6S 3V62A 1VQHA 2Z4IA 3VYSA 3NPPA 3NRZA 2AWNA 1H9SB 1HFNA 1C4CA 1XPRA 2F3VA 2C7MB 2MBOA 3WALA 4C7YA 4OZAA 3PIOA 1EL0A 3SK5A 4C3IH 1UNSA 2O2LD 2L0TA 4DR7Q 3DHHC 3VR5A 2DNFA 3IT4B 3L0WB 3M62B 3S2AA 1WTPA 4L5QA 2WX0A 3P1HA 1NYQA 3U50C 5IGGA 5L37A 4GMVA 1JRUA 4LNIA 1IP9A 4US9A 1E10A 3AE1B 1IYFA 2IO0B 1S40A 1MHWC 3RMHA 5ELBA 3J81i 3AU7A 4JW0A 4B08A 5E4WC 2WXPA 3B9JA 3A4SC 2BS4B 2PPBC 4APVA 2B63G 5C3XA 1WTRA 1WM2A 4WWNA 3B6YA 3D6CA 2WQYB 2VNUD 4EQ5A 3M7GA 2VY3A 1OXUA 1UGJA 2Y0SG 4C4VA 3RD2A 2ZEQA 2AUJD 3VDYA 1SE9A 3RN9C 1CQFA 3EFUA 3RD4A 1CSPA 1J5EQ 4XE0A 1KF6B 4JOIA 4I6PA 5M3FB 2YYZA 2OQKA 1JW9D 4DDGD 1MG8A 2NBWB 5I6WA 2HHHQ 1C7YA 4XYCA 1JMLA 2B2VA 5M3FH 1VMCA 2M00A 1NENB 2WDQB 2A6HD 3BINA 5G5HA 1AP0A 4ARIA 2F52A 1YN3A 5BMHA 4YSZB 1SEBD 1TWCB 3FVQA 3OHXC 4X3KA 4K5WA 3VR8B 1XEEA 3PSIA 2NTTA 3VDZA 4CDCC 4MSQB 2BKFA 2Q2TA 3HVZA 2FAZA 1TWCH 3VXWA 4CYEA 2O5JC 2NVQB 3W1BA 5GXGB 2AL3A 4DK3C 2E5LL 5IA7A 2L11A 4JI6L 3T56B 3K5MA 2RCNA 1AWDA 3AU5A 1T3QA 1T9HA 4A3CG 3R7QA 1DOYA 4H13C 3A8IE 3NVYA 3AEFB 1Y8PB 3PIPA 1O7YA 4EQNA 1XPOA 2L1AA 3UDFA 4OX9L 2GN5A 1UEBA 3S2DB 2KT7A 2IHEA 1BF4A 1ICFB 1Y1VB 3KYCD 3D4DA 2D3AA 4EGVA 3ZJTA 2PMVA 1U4LA 3QG1A 4CGYB 3W1YA 3OSOA 2GBNA 4DR2L 1B8AA 4YWLA 4C56C 1J7BA 2J7ZA 1RCVD 1IBLL 1DJRD 2L83A 2WXMA 5CMDA 3NWSA 2X69A 3EUB2 3GE3C 2YV5A 2WB1G 1Q86C 2PI2A 3MA2B 3HOUG 3GTQB 2IL8A 3TRZA 1RM6C 3S1NB 4A3DB 2HE7A 3A33B 4M02A 1K3RA 5C6AA 2L3ZA 1PLFA 4C1NI 1XMOL 3AECB 2QILA 1FFUA 1K50A 4NJ7A 3PUXA 4X6AH 2F0IA 3O65B 3BS1A 3SEBA 4A3DH 1BUIC 4KV2A 1L2FA 1E1OA 2Q8TA 4JPSA 5IGCA 2EVBA 4YT0B 1GVPA 1JR0D 1P16A 2FMCA 3E9SA 4EQOA 4PV1C 3X0WA 1TKYA 2XWBB 3HKSA 3EJIA 2JA5B 2RPQA 1ZKHA 3K8AA 1AE2A 2PI2E 2KBNA 2AWOA 4NP5A 4LF8Q 3EECA 4TQ0A 3TBIB 4GSWA 4TSSA 3ULJA 2PW9A 4GOPB 3AN1A 2MJ3A 4G57A 3KOJA 4GNXB 1HTLD 2D5DA 4JBWA 4CDEC 2ZNVB 4OO1G 1F9QA 2IWHA 2AX5A 5LLIA 3TS0A 1QILA 1P7FA 2AHOB 1F9RA 2C7HA 1KTKA 2XIWA 3CC4A 2FUHB 4GLSC 1UUPA 4IALA 3U7DA 1MKHA 4IUNA 2PLPA 1MSHA 1SMXA 2DZMA 4J3OD 3RNFC 4DGZA 4L6TB 1C9OA 1SNCA 1WF9A 1J7CA 2J0KA 4LFAQ 3VHTC 1A8VA 3LX0A 3RNGC 2KHSA 4ZRZA 3UI3A 3TEYA 1NUCA 2JPHA 5CHWA 3PLUA 4A8XC 3J7YW 1S5ED 1LUZA 1L0VB 2IY5B 4J6IA 4LUVA 2NN6H 3RMKC 2R92G 2WYQA 1BOSA 4DXFA 3ZTCA 3PO3G 1X3FA 2D3BA 5IWAQ 2VQEL 1U4MA 3K80C 1JWUD 3BU2A 4ZLTF 4XZ4A 1VQDA 5CGKA 4B3RL 2Z59B 3AEBB 4WAFA 4C3HB 4EQPA 1ISNA 2EY5A 4IZ8A 4P75A 3WDNA 3S16B 2CH4W 3OLMD 3QARA 2RPVA 1PRTF 4ZK9B 1J6QA 5KYLA 3CQZB 2E2HH 2HTHA 2K22A 1GD7A 2JZZA 4ODGA 4A4IA 1F1HA 4WRDA 2A73B 3M3JA 1PGBA 2L00B 1KLVA 1QT9A 2UWQA 4PZ8A 1S4ZA 3RT3B 1LT5D 4HDOA 5FO7B 2VH1A 2JUOA 1XD3B 1TTNA 3GTOH 2JSVX 1G8ZD 4EUTA 3S15B 4A3EH 4DV2Q 3GTMB 4DNTB 2RKSA 2LVPA 1FCLA 5IYDH 4A75A 3ZDTA 1V80A 2PE9A 3KLWA 2IGGA 1K53A 2W9NA 4DV2L 4K5VA 3RZDB 2RSOA 2NWGA 3EGRA 3GTMH 3HOZH 4OHJA 1VRAB 1ZDVA 1ML0D 1UBQA 3PIO3 1C4QA 4HK2A 2UXCL 1S5CD 3NVVA 3U4VA 5EE0A 3RZDH 4CKBA 2KTRB 2PEAA 3GOEA 4KY7A 1ENFA 2Z0SA 4PMBA 4XQQA 4JI1Q 2UXBQ 1YX5B 3RNAC 4DDID 3M95A 2OEOA 3MXPA 2E2IB 5IGEA 1EWIA 2QDFA 2FUG1 1TZOA 1CKNB 4R8IA 3RNUA
chains in the Genus database with same CATH topology
1N5WA 5JJZA 1IHZA 1H9KA 4OZBA 4RKBA 3FILA 1L0YB 5CV8A 1BXTA 2SNMA 1AN8A 1ZXTA 1QOHA 2F1MA 4F87A 1ESRA 1BDOA 3K59A 3FPPA 1C4PA 3WOEA 4C2MB 1XO3A 5E3FA 3H0GB 3FAHA 2CU3A 4Q2JA 5HHDG 3KWLA 1N5XA 2DNCA 1T6BX 2LKVA 1FEHA 2WDVB 1HZ6A 3E5SA 2EJFC 2EELA 3KLSA 1D2BA 4L2YA 1C77A 2V3PA 4HCEA 3CIRB 3PUYA 2RDGA 1F0ZA 1MI0A 1TS4A 3I8ZA 4TMAB 1PTOC 5AUKA 2EE1A 4RAUC 3Q8FA 5T1IA 3A8JE 1QB5D 1RODA 3P75A 1MGSA 2HUGA 3W1SA 1ZUD2 4A3GB 2L0CA 2LEKA 1BMLC 3SK8A 1NSNS 1C79A 1JCKB 1ILQA 3AEEB 3DWGC 3NTIA 3A54A 1HXYD 3CU7A 1STYA 1VJKA 3V3XA 1NR4A 2BYTA 1VZ8A 2EY1A 1V8CA 1RYJA 2ZXRA 3I70A 1XYIA 1EM7A 1TS3A 5D3DA 1TU2B 2DYOA 2B63B 1PZKD 1Q1EA 1YMHE 2HTME 2EXZA 2Y0SB 4ZUJA 3BZDB 1R4QB 1GHJA 1RKNA 4USAA 2K01A 5C3JB 4C3IG 2YEPF 3AEAB 3W3AA 1E0BA 4HR7B 1E2VA 4D2KA 1M4VA 2XWJB 4RWSC 5ELCA 2Z4HA 3PZ8A 1VMPA 1BNZA 2HQEA 1NEKB 3TEXA 1NR2A 3E0JA 1GUTA 4BS9A 1CZWA 4M0WA 2K5PA 1YN5A 1LT4D 4FF1A 3X3MA 3NTKA 1VF5C 3R3OA 4O1NA 2GA4B 5IT9E 1B53A 2LGIA 1PFNA 3C2PA 4R8NA 2QF7A 1ZEQX 5MPOA 1S5BD 1L0XB 1K8MA 3GB1A 2NYZD 1SMYD 1TY2A 2SAKA 1STGA 2LMCA 2JE6I 1IBXA 1SNDA 2WXNA 1PGXA 1CT1D 1HUMA 1XCTL 2E76C 4QUCA 3G7LA 1PZJD 4CJ0B 4LK1C 4HROA 2H88B 1BR9A 2D9UA 4KN7C 3R93A 3Q8AA 1V8QA 3E6ZX 3ZYYX 1K8OA 5CV9A 1U4PA 4BA2I 2DN8A 1OXVA 3TEZA 2EY6A 2BS2B 2ZT9C 2K5DA 4REZA 1IKMA 2L5TA 4OO1H 1JRPA 5IGFA 2B2WC 4DK0A 3KUPA 5CV4A 3GS2A 2PQEA 1X32A 3H09A 2EYMA 3GQBA 4PMCA 4KY5A 1XTCD 1A3VA 3BVGA 1MI2A 2A69D 1GB1A 4JWUC 2R92B 4KGSA 1Z47A 3VR9B 2F0OA 3S1MB 3PO3B 2R3ZA 1SYFA 2W3RA 3GV3A 3RUZA 5A2QE 1YNJD 1PXUA 2EYFA 2F4IA 2ICEC 1C76A 3IFDA 5EE1A 2KN4A 2WXRA 3AE2B 5C0XG 3TMEA 3VRAB 4ZKBB 1IYUA 3NTHA 3NZ3A 2ONQA 1V1OA 2BDOA 4O42A 1SDFA 1N62A 1EU4A 1PDXA 2PZTA 4M1UB 4A3IB 2F0KA 3VR4A 2B2TC 1F2YA 2KEEA 5IGDA 1PRTC 5IGBA 2WXIA 3NVZA 4KJOA 2IX1A 2BB5A 5BMGA 1QWYA 3NHHA 1JROA 1WTWA 4KKIA 3U9OA 2M19A 2SOBA 1EYDA 2WXJA 3I72A 2QKIC 2RA4A 2KEDA 1VLBA 4KHZA 4Z9CB 4A9AA 3PUZA 1RDPD 1Q3LA 3A7AB 2KACA 3QB3A 2CVRA 3ONAB 2WXHA 4XXEA 2CHBD 5BMIA 4S3SA 2R6GA 5EKIA 4Q0FA 5C4JB 3AE5B 1P7EA 4B0EA 4A55A 4I65A 2WIIB 5KNCA 2MJ8A 2FBWB 4N9PA 1K83B 1XF5L 2ZW1A 2A6ED 3W5UB 3P4PB 3W2DA 1G2TA 1JOKA 5BN3A 1HZ5A 1F9PA 1PZID 1UEAB 3KF8A 3I4NB 3EQLC 3CRLC 1B1ZA 3S17B 1ZKOA 4HRSA 4YTNB 2K33A 4MN3A 3NP8A 2E74C 5KIXA 5CV6A 2J4XA 2IGDA 1EY4A 3NS1A 3PUWA 1WSPA 4HN7A 3NBIA 4CBVA 1WD0A 3HOWB 5ELFA 1J9OA 3IAYA 1Y1WB 4NMZA 1SYDA 2E2JB 1K51A 4IUTA 3MXNA 3SXHA 2QEJC 3EA6A 3TZUA 4OIJA 2L1BA 4XDCA 1QF6A 1W6KA 1KABA 3T13A 1PYWD 2JEBI 4ZKCB 1XCQL 1DOXA 1Y8OB 1IGCA 5E6JA 4RHRA 1SE2A 3H91A 3MWYW 2YU9B 1WWTA 2W82A 3DXJC 3OWFA 4IFDH 1LTTD 4ULLA 2B8GA 3Q0AA 5EKLA 5M5XB 3NWTA 1GJXA 4LJZC 1GUNA 3CRKC 4NKLA 5EE9A 2XVSA 4M8AA 4C3IB 3PO0A 3MC0B 4K8JA 2D2CC 3BK2A 1D4BA 2IGHA 2NUCA 2IPKD 4OW0A 4FVMA 1FO4A 1B3AA 2NZ1D 2NN6I 3RZOB 3DMUA 3EROA 3DEPA 1V43A 5LHY1 2F0QA 2B2YC 3G6JB 1HQMC 2N55A 4K6DA 5HFYA 4YTMB 1GAQB 1RD9D 4XWWA 3A56A 4Q5VA 1DCZA 3IAS1 5EE3A 3LYYA 2ACZB 1BBXC 4RH6A 2K32A 1DOIA 3SDZA 1SYBA 2EKIA 4NAMA 3ITPA 3U4EG 1B4OA 5EQ0A 3A8KE 3KQ4A 2JP1A 1QLBB 1ZP0B 1JWSD 4AYBB 1HUNA 1O7ZA 3K6OA 3E56A 1VCIA 2BE5D 1KNEA 4OVZA 2AQ2B 1BCPB 1XLQA 1C4AA 4RF1A 1CA5A 4H44C 1T5EA 5DM73 1ZYRD 3TUOA 3QOJA 5A35A 4ZHOA 1JB3A 2XSCA 1IKLA 2WV6D 3TSSA 1EY0A 4A93B 1PFBA 4KJNA 2J42A 4NJCA 1MD2D 2DNEA 4DAPA 5JOBA 3U52E 1SNMA 2F0WA 2B2UC 4FP5D 2A6HC 2K5WA 4OZCA 4ZUIA 3T3OA 5DAUA 4YIJA 1E2WA 4YWGG 1GOZA 5JEAJ 1SF0A 1LTGD 4TKOB 4FO2A 2WNMA 3MJ5A 1A6XA 3BVMA 1IGDA 2PYKA 2OHFA 2J53A 4WJWA 1Q90A 2MPMA 2PIAA 5C0XH 1GPXA 3B2FA 1QOGA 3BK1A 1WTVA 2DYMA 5BYSA 5I9PA 4JE3B 1L4ZB 4IOIE 2OXPA 1ZYRC 2VXWA 3AE8B 2MJDA 1JQ4A 3K5NA 3GTLB 2LHDA 2E2HB 2EJMA 1BCPD 3AB5A 2INPE 2O4XA 4G7OC 1AZQA 4TRDA 2CQAA 3OMGA 2H89B 4H2AA 4WIPA 1T5XD 1F2ZA 5LNK1 4G4KA 3BDLA 3DWQA 2OF1A 4CQNA 4FXKC 1EOTA 3GTOB 1E9MA 3GD7A 4A3EB 1RFKA 5C4XB 5I2YA 4PQXA 3J9CA 4H7BA 2V4DA 3HOZB 5HGTA 2KAJA 1OFFA 4CKEA 3FILB 4K6LA 1WTQA 2JYOA 1QE6A 4CKCA 1KRHA 4MH8A 3FKIB 3P4RB 3AH7A 2E75C 4PT5A 2RDHA 4RGTA 1ET6A 3KWVA 2B39A 1JE4A 2KOLA 1S5FD 1QOAA 4ZRPA 1WTOA 1O78A 2G1EA 4X3UA 1B9MA 2WXFA 1MVKA 1MPEA 1BCPC 2K03A 3L3OC 3R8BA 1STAA 1HA6A 4PMWA 5BYRA 3N9YC 1YNND 1SYEA 4XQNA 4KI0A 3DEOA 4HMJA 1ILPA 3D4WA 1IL8A 1L6UA 1SIJA 4RCNA 4IUVA 1TKWB 3TDQA 3H6MA 4KKTA 3T4AC 4WFN3 4PNYA 4UDUC 5CBEE 2BTEA 3NXWA 1PMRA 1SNPA 2EYJA 4AQ7A 2BDNA 3V05A 4Y7NB 2JA7B 4U673 4JX1C 4J1MA 1JOQA 1VZ7A 1BO0A 2R61A 3SK4A 2QDBA 5CV7A 1SE3A 5DEHA 3J80L 4HKZE 1Y56A 1TJEA 3MFYA 4QCLA 1XXGA 5FLXL 1ONLA 2HDMA 3FRPB 3KK7A 2K5QA 1TS2A 3L7ZC 4FF4A 1E0ZA 1I6HB 1EEID 1FD7D 3J80E 3SFDB 2PZWA 1B9NA 5FLXE 2B76B 2QMTA 1LTBD 1O7LA 3C1EA 1CA6A 1SB3C 4GDKB 2MUYA 5KGUA 5JXVA 1YNNC 4HSVA 4HMIA 1EYAA 2E2DC 2J52A 1X3QA 4AS1A 4BY7B 4IFDG 5J39A 1OXTA 3NQIA 1C8CA 2PCFB 2KCNA 4RA8A 1V1PA 5DM63 2PKOA 2WU2B 1LTSD 2B2WA 2L32A 4IUPA 3BDOA 2PVOD 1KLUD 1DGJA 2LHEA 4B9XA 4A3BB 1HTPA 5I4DA 2RBMA 1C48A 2ENBA 2KA7A 1JICA 5DNFA 4XDDA 2HDLA 2Q8IB 1D5XC 1ESFA 1R7SA 5IT9L 1I3QB 2IX3A 1XLOA 1M8AA 1YJIA 1EWHA 2LMCB 4QB4A 4DAVA 1IBXB 2VZKB 4A3KB 3X3NA 3UI2A 1JALA 4CJ2C 1CJEA 1VR9A 2A5HA 2A68D 1LO5D 4DA2A 2B2TA 4KKUA 2SEBD 2Y5CA 3BYTB 1KAAA 5E4XA 4WH4A 3TZDA 3VR6A 3VA7A 1C78A 1SYCA 5T8IA 4RHSA 3Q6SA 2M56B 1LACA 1CM9A 3SHLA 1GUOA 2NVYB 2PW7A 2WB1B 3A55A 3HOUB 3IFTA 5KYIA 1L5PA 2K3UA 2JU6X 3HZXA 4LK0M 4ID6A 4E6IA 1SYGA 2F0GA 3M4OB 4HSPA 2N7JA 1TY0A 1B9RA 1JWMD 1FM0D 1EQVA 4ZRQA 2BT6A 1OO9B 5F2DA 2EDGA 5HG2A 2WXGA 2WAQB 1D1KA 1F2RI 1O80A 3ERQA 3HOXB 1OQQA 3HUIA 1QJOA 3D8GA 3MTSA 5ELEA 2J0TD 4NAWB 5A2QL 4KX6B 4RGOS 3LWEA 2Y5PA 1DONA 4IDIA 3AEDB 1AFPA 1SMYC 1LABA 2NVXB 3NK9A 2INNE 2L12A 2VZKD 3WOFA 3Q23A 3DUZA 4ITKA 1FMAD 4HAEA 4KKJA 4N58A 1IW7D 2WINB 1D1IA 2KCCA 3NUHB 3SVMA 1DXMA 3DWPA 3KLRA 1Q8IA 3MXUA 3HGBA 1I4GA 2ZW0A 1RHPA 2G9DA 1G2SA 1EY5A 5I6YA 1PUTA 1YJJA 3I57A 1YNTE 2L52A 5K36H 5C3WA 3ZQ4A 1SE4A 3PUVA 5T1GA 3S1QB 1SBBB 1I50B 1XLPA 5D7GA 4GZYC 1NVID 1WXQA 1WTXA 2B8FA 3OMCA 4FNFA 3I4MB 2OEDA 3LNNA 1H9JA 3SR6A 2JYEA 2F0EA 2A69C 1LT6D 1SJED 4RCOA 3EFXD 4NDXA 1I7HA 2R7ZB 4HJGE 2CJNA 1EY9A 1FR3A 4BBSB 5D3IB 5EPLA 1YNJC 3AE7B 3OIQA 4FXGC 5CYUA 3I4LA 3GTKB 1LTAD 3R2IA 4HKQA 1FGBD 1TIID 4RGNA 1PGAA 3GO5A 1HA5A 1PDQA 5NUCA 5LL6X 3LB8C 1RTNA 4XTCS 1BCPF 1Z6HA 3HG9A 1U4RA 3T3NA 1HQRD 2BCOA 1AEXA 1MHXA 5C44B 5FO9B 4XDXA 2B2YA 3D4RA 1F77A 1ZXHA 3BVZA 2JZPA 3W5VB 3N6RA 3TP5A 3H8HA 2K9XA 1DOKA 3IT6B 1PFMA 3QWNA 1CFMA 3AM9A 2PO4A 4XYQA 2MHVA 4QUFA 2NB0A 5FR3A 3MEHA 1HEZE 1N63A 4H0LC 2HDEA 3P42A 2WU5B 4C3JG 2V0GA 1MBYA 3AB9A 2MP1A 3I9V1 3GTGB 1OXXK 2F0UA 4KTAA 3ND9A 3RLFA 2IX0A 1HPCA 3PO2B 4JWSC 1G6ZA 1XLNA 3P63A 2A6EC 4NZLB 1ACCA 2F0MA 3NQTA 3BDCA 2K6AA 4CJ1B 2NTSA 3MHBA 3C46A 1J7AA 2RSNA 4R9WA 2FINB 2XNAC 1TKEA 1FYCA 1SXTA 2Q5WD 1AZPA 2F3WA 2H4OA 5C0XI 1TYGB 1HFGA 4CHTB 1ZPSA 2B2UA 4IQZA 5JPNC 3H94A 1E6EB 3S9WA 5CC4A 2F0SA 1EIGA 4LAAA 5JEAG 3K58A 2DBYA 2Z1CA 2KMMA 4U68A 3H3VC 3P7JA 2KECA 2WXLA 3D6WA 4WWMA 1FCCC 2K05A 2ON8A 5H92C 4WAFA 1D6EC 2AQ1B 3HRZC 4B9WA 4DNRB 4BY1B 2PZUA 2JYTA 3Q8BA 3M4YA 2RVLA 3MXGA 4DXGA 1C9FA 4JK1C 4KMUC 1XX8A 4L8JA 4UAIA 3ZJUA 4TQUS 2WXQA 3K0YA 3FMCA 5KRUA 1H9SA 1ICWA 3ZJVA 1G291 1FXIA 2LUMA 2JQRB 4L23A 3BG3A 1EWCA 1UAPA 3MFGA 3MVVA 2K0PA 5CBAE 1EIHA 1EZ8A 2LJIA 2L55A 1SNOA 1F2RC 1E7PB 3MP9A 2E6XA 3J81L 2KUMA 2WDRB 1A2UA 2SNSA 1DOLA 1EY6A 1ZOYB 5C5LA 1JORA 1I4XA 1EY7A 1NI3A 3MZ5A 1STHA 3HRDD 5H8YE 3J81E 3P4SB 5M3MB 3IKJA 4A3MB 1CI3M 2PMZB 3GP7A 2EYPA 5D14A 4DN4M 1SNQA 4K8IA 1CZPA 4FYDA 1DZ1A 2F0TA 2M9VA 1WVLA 3TN2A 1VF7A 4OIKA 4P16A 3FPUB 4KY6A 3T51B 4A90A 2C5CA 5FK9C 1QNKA 1RTOA 2F0LA 2K7VA 3U9SA 1N60A 4N6EB 1KFYB 3J7AV 4IUQA 3PV0A 3L9AX 4RFBA 3Q69A 3Q8EA 1DM0B 2H1EA 1Y8NB 1Q12A 2I07B 2BE5C 1PTOB 4K2LA 5JVH3 3EVQA 2EJGC 4LLGM 1I4RA 2HCCA 1CK1A 1PTOH 4RF0A 1GUGA 2HCIA 5JAVA 3SFEB 2XN9C 5COYA 2LFNA 4EVOA 4I7ZC 4GDLB 4ZOHC 4ABNA 2ID0A 5BYQA 1EQTA 3J7AF 3K7AB 4ARCA 2KQ4X 3C8YA 1SJHD 1UWMA 3TP6A 2TSSA 1TS5A 2WS3B 2QJLA 2O5IC 4YTPB 3SR1A 2B2VC 2MH7A 2NVTB 1Y69U 2KVMA 2D5GA 3HEJA 1EEFD 3A7LA 1A2TA 3I90A 4ME5A 1I4HA 1YQ3B 5D65A 1UWXA 3V96A 5K36G 2F0FA 1CZGA 4KGRA 4A3JB 2BOSA 4FXDA 5EJWA 1B44D 1TWHB 1KLGD 3R2TA 4IUUA 3I91A 3K57A 3OIPA 3T16A 3AMZA 1STNA 2EYOA 3DM1A 1LV9A 2MGSA 2K28A 3AEGB 5EGTA 1CHPD 5G3LD 2I38A 1JOOA 1CQVA 3VYRA 4BA1I 3ABVB 2RDFA 3HVDA 1BUVT 2WP9B 3AMUA 4K5XA 2KDMA 2VB3X 1PTOD 3OPOA 3P4QB 4WQMA 1FNVA 5HI1A 1QCBD 1FRDA 5C5MA 5ISRA 1ZE3D 4FXCA 4KD4A 3PZ7A 1TWGB 2ZXPA 3FC4A 4EE2A 1U9RA 3P20A 1DD2A 3CHBD 2W3SA 3MAQA 1WRIA 4RNAA 1VZ6A 5G5GA 4A6QA 2K04A 3VQIA 1NAPA 1QOBA 4G7HC 4MIUA 1NCVA 2XRQD 3OWEB 1EWYC 4KN4C 1STBA 4C3JB 1IYVA 1TQOA 2CJOA 1FRRA 1J8IA 2F0PA 3VA5A 2QSDA 3K5LA 4R3DA 3MHZA 4WURA 2LY7A 4BBRB 4N9TA 3GTPB 1YN4A 1L6VA 3VR2A 5J1ZA 3WCQA 1VDVA 2RQXA 3NUCA 2EOTA 4G7ZC 4MACA 5FKAC 3HOYB 2N9LA 1TR5A 2VB2X 4YXDB 3PIP3 1II3A 1QG7A 5EPKA 2MJEA 2I2YA 1F2MA 1KDCA 1NYRA 4OO1I 1V1PB 2R93B 3F2UA 3SK6A 2IT1A 1SSOA 2D62A 5E1FA 2BBCA 3S1RB 1GUWA 1MHHE 1SAPA 1S5DD 2Y3AA 4XT1B 4QIWB 2WACA 1EYCA 2V3NA 1KDBA 4FF3A 1ET9A 3BYYB 2WXKA 1KNAA 2Q8RE 1D5ZC 1B2TA 3S14B 2BA0A 2XRSD 2GB1A 1D5MC 4HTHA 2BA1A 1I6VC 3B2GA 4L63B 3AE4B 1HCZA 1GXDC 2EYLA 5M9OA 1AYFA 5JEAH 3U2SC 1X3PA 5M5YB 2LFIA 2IJ0A 2KJXA 5CORA 5TSSA 4DQOC 1QNUA 3HKZB 1ZDXA 3C3LA 1GB4A 4DK1A 2V4IB 4C1NK 2KQ3A 1F2LA 2TMPA 3SE0A 4J6HA 5C3EB 1LLRD 3U7ZA 2PTLA 4NW2A 1V97A 1AW7A 2FMMA 4XQJA 1QKZA 5EPJA 4KD3A 5KNDA 2JXMB 3HP3A 2W55A 3M85A 1PRTB 3AE9B 5M5WB 5C2TB 1A3TA 3O13A 4F8MA 2GI9A 1TWAB 3DWAA 4RGMA 4V190 2G9HD 3BWUD 1ENCA 1JQYD 2FHTA 4N59A 3ND8A 3NVWA 2DY7A 4K14A 1A3UA 3GV6A 4OGQC 2M0AA 1CHQD 3FDTA 4J8QA 4B0MA 1H9RA 1K52A 4XWTA 2VUMB 1I4QA 2PNRC 4YSXB 1H9MA 2M2LA 2IW3A 5K5PA 4A3FB 3M7NA 2I46A 1JWAD 1TWFB 1Q10A 1KDAA 1EU3A 2RMMA 1FNUA 2X6LA 3PMFA 4FF2A 3ZGZA 3URYA 1WGKA 3VR3A 2SDFA 2F0HA 5HURA 5FO8B 3FEWX 3T53B 1OQRA 4OL7A 2EY2A 3Q24A 3KBGA 1B50A 4ZHPA 4KHVA 5IIFA 4DFAA 1GUSA 5JVG3 4KV6A 2N0SB 2NMQA 3QOLA 3IAM1 3D3RA 4QMGA 3V2TA 3OW7A 2FE8A 4KKSA 3VYUA 3CWIA 4P2CB 3VYTA 2WKCA 2JSOA 1FFVA 2JXTA 2IDYA 3QO2A 4IFDJ 2EZVA 4K2KA 3NBHA 1EY8A 4XIGS 1PRTD 2A68C 4ZQ3A 2PW5A 4F7XA 4HEA1 5J22A 5EBCA 1LT3D 2JX5A 4KK7A 2N9KA 1G91A 2F0DA 4IKGA 2DWQA 3S2HB 2E3TA 5KEEA 2K1BA 3LWUA 3K5OA 2CW0D 1RJTA 5C4HA 1IUEA 4IURA 4IFDI 1EZ6A 3W9CB 4F88A 3RFZB 2ICIA 3L4PA 5AUIA 4KGTA 2X38A 4US8A 3I73A 4ZYSA 3TP7A 1SSNA 1FD6A 4MM3B 1WD1A 4DU9A 2F0NA 3IXSA 3RPFC 2L9HA 5FOBB 2JA8B 2W54A 2EYHA 2NBFA 1BQQT 2AUKA 1R4PB 1ZXIA 1WYGA 2ZXOA 3P1MA 1GHKA 2NN6G 4MHEA 3AE6B 5CV5A 1I4PA 1TVXA 1RF2D 1W6JA 2QCPX 1ROEA 1FIQA 4BWGB 4X3SA 3QJYA 3JAML 1QOFA 1LTRD 4QF4A 5CR3A 3M3YB 3DHQA 3AV8A 2QIEB 4ILWA 3KLSX 1RWSA 4C3HG 1OXSC 2YEPB 3CKIB 2PVGC 2AQ3B 5AFWA 4HEDA 5BN5A 3JAME 1VDZA 2BB6A 1F9SA 1IW7C 5C4ZA 5BN4A 1LTID 4YSYB 3LXFA 5I9OA 4ZAIA 2CW0C 5IOCA 3HS0C 1KH0A 4WORA 4C7ZA 3I3CA 1HRJA 3NE5B 2BS3B 5JPMC 5EKKA 3C1FA 2X6GA 2Z8LA 3TP8A 4HCSA 1TT2A 3ETRA 1L4DB 1WCMB 4LMQD 5I2XA 3D31A 2WP8J 3AE3B 1Z7TA 1FXAA 1JC7A 1HHVA 1STEA 2C9OA 3Q22A 2MEKA 2JEAI 2JWUA 3N52A 2L4NA 1XWEA 3Q8CA 3OOCA 2KWDA 2F0VA 4IN3A 1N61A 4MT5A 2DLBA 1QQRA 3VRBB 4TQ1A 1CTMA 1EFID 4C80A 5C0XJ 5G3LF 4LTUA 5KNBA 2JA6B 2A74C 3BIID 2EPBA 4RKLA 1R9TB 2LS01 1PTOF 3GTJB 3IL8A 1TKGA 1SFOB 2OT2A 1A70A 4DF7A 1A15A 1ENAA 2FFKB 2WLBA 2DY8A 4L1BA 2FJ2A 3NSWA 5ELDA 1DOMA 2N88A 5EBDA 2GRIA 5IODA 4V0BA 1DYQA 1Q1BA 3DWMA 1MSGA 1PFDA 1FNWA 3QIAA 2WKDA 4XYOA 3TEWA 2F03A 2BW2A 4XT3B 4X3TA 3HOVB 1E2ZA 4P6VF 3KBXA 1JWBD 1YQ4B 4DAYA 2F0JA 5LL6S 2Z4IA 3VYSA 3NPPA 3NRZA 2AWNA 1H9SB 1HFNA 1C4CA 2F3VA 4C7YA 4OZAA 1EL0A 3SK5A 1UNSA 2O2LD 3IT4B 3VR5A 1WTPA 3P1HA 1NYQA 5IGGA 4US9A 1E10A 3AE1B 3RMHA 5ELBA 2WXPA 3AU7A 4B08A 5E4WC 3B9JA 2BS4B 2PPBC 5C3XA 1WTRA 3D6CA 2WQYB 2VNUD 3M7GA 1OXUA 1UGJA 2AUJD 1CQFA 3RD4A 4XE0A 1KF6B 5M3FB 2YYZA 1JW9D 5I6WA 1JMLA 2B2VA 1NENB 1VMCA 2M00A 2WDQB 5G5HA 2A6HD 4ARIA 1AP0A 1YN3A 5BMHA 4YSZB 1SEBD 1TWCB 3FVQA 3OHXC 4X3KA 4K5WA 3VR8B 1XEEA 2NTTA 3HVZA 2O5JC 2NVQB 5GXGB 2L11A 3T56B 3K5MA 1AWDA 1T3QA 1DOYA 4H13C 3A8IE 3NVYA 3AEFB 1Y8PB 1O7YA 4EQNA 2L1AA 3S2DB 1BF4A 1Y1VB 3D4DA 4EGVA 3ZJTA 2PMVA 1U4LA 3QG1A 4CGYB 3OSOA 4C56C 1J7BA 2J7ZA 1RCVD 1DJRD 2L83A 2WXMA 5CMDA 3NWSA 2X69A 3EUB2 1RM6C 3MA2B 3GTQB 2IL8A 3S1NB 4A3DB 5C6AA 1PLFA 4C1NI 3AECB 2QILA 1FFUA 1K50A 3PUXA 2F0IA 3BS1A 3SEBA 1BUIC 2Q8TA 4JPSA 5IGCA 2EVBA 4YT0B 1JR0D 2FMCA 3E9SA 4EQOA 4PV1C 1TKYA 2XWBB 3EJIA 2JA5B 2AWOA 4NP5A 4TQ0A 3TBIB 4TSSA 2PW9A 3AN1A 2MJ3A 4G57A 1HTLD 2D5DA 4JBWA 4OO1G 1F9QA 2IWHA 2AX5A 2WXOA 1QILA 1P7FA 1F9RA 1KTKA 2XIWA 4GLSC 1UUPA 4IALA 4IUNA 2PLPA 1MSHA 4J3OD 4DGZA 4L6TB 1SNCA 1J7CA 3LX0A 3UI3A 2KHSA 4ZRZA 3TEYA