3VR9B

Mitochondrial rhodoquinol-fumarate reductase from the parasitic nematode ascaris suum with the specific inhibitor flutolanil
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
249
structure length
249
Chain Sequence
KRIKTFEIYRFNPEEPGAKPKLQKFDVDLDKCGTMVLDALIKIKNEVDPTLTFRRSCREGICGSCAMNIAGENTLACICNIDQNTSKTTKIYPLPHMFVIKDLVPDMNLFYAQYASIQPWLQKKTKINLGEKQQYQSIKEQEKLDGLYECILCACCSASCPSYWWNADKYLGPAVLMQAYRWIIDSRDDSAAERLARMQDGFSAFKCHTIMNCTKTCPKHLNPARAIGEIKMLLTKMKTKPAPLPTPAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Flavoprotein subunit of complex II
publication title Crystal structure of mitochondrial quinol-fumarate reductase from parasitic nematode Ascaris suum
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 55
structure length 249
sequence length 249
chains with identical sequence F
ec nomenclature
pdb deposition date 2012-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 3vr9B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3vr9B01
3ZYYX 4N59A 4YTMB 2L52A 1TKEA 3KWLA 5G5HA 1PUTA 2L83A 1WRIA 1GAQB 4A9AA 3CWIA 4KX6B 2BS2B 1VLBA 1E6EB 3BIID 2CU3A 2WU2B 3W9CB 1OQRA 1H7WA 1QOBA 3B2FA 2B76B 1CZPA 1ZUD2 3ABVB 1QLBB 2BT6A 3LB8C 1L5PA 4YSYB 4YTNB 1I7HA 1FM0D 2M19A 4HRSA 3AE1B 3PO0A 4ZOHC 1WGKA 2G1EA 3HVZA 1L6UA 2PIAA 4YT0B 1JWBD 2E3TA 2W55A 1L6VA 3CIRB 1JALA 1YJIA 3NRZA 5GXGB 2MH7A 2QJLA 5AUIA 5MPOA 3AM9A 1FIQA 1YQ4B 2PVGC 1OQQA 1E0ZA 2WP9B 1FFVA 1L0VB 1FXAA 2KAJA 4YTPB 5C3JB 3VR9B 1J7BA 1IUEA 1CJEA 1PDXA 1UWMA 2M56B 3DWMA 1EWYC 2OHFA 3NS1A 5EE0A 3AE2B 1AYFA 3AN1A 3RPFC 1DOXA 1DOYA 2WDQB 3NVVA 4USAA 3AEAB 5G5GA 3FC4A 2K5PA 2HTME 1A70A 3AE8B 1VJKA 1DGJA 4ZHOA 1XLQA 2WDRB 2WQYB 2CJOA 4P6VF 3CF4A 3AB5A 4US9A 1FXIA 1ZP0B 1QT9A 1R7SA 5H92C 3AEEB 3DWGC 1F0ZA 1QF6A 4JWUC 1N5XA 2EKIA 1ZOYB 1RFKA 5EE1A 1FRRA 1GPXA 3AEBB 4WWMA 2BS4B 3LXFA 2WS3B 1NYQA 5AUKA 1N5WA 3P1MA 1TJEA 3AMZA 2CJNA 1NVID 1QOGA 1GTEA 1ROEA 1KFYB 2N0SB 4N6EB 2W3RA 3SFEB 1E7PB 3AE6B 4N58A 2Q5WD 1T3QA 3B9JA 2PKOA 1GTHA 1SB3C 1KF6B 3NVWA 1N62A 1QOAA 3NVZA 4JWSC 4HROA 3AECB 1ZXIA 4IDIA 1JQ4A 3W5UB 1J7AA 1FRDA 3AH7A 3AE4B 3P63A 1VDVA 3W5VB 1FFUA 3VRBB 1NEKB 3ETRA 1YJJA 2WLBA 4WQMA 2MJEA 2MJDA 1AWDA 2DWQA 1SF0A 5EE9A 3AE5B 1SIJA 3VRAB 1RYJA 1TKYA 1KRHA 3FAHA 2QIEB 4LTUA 4US8A 4ZHPA 1OFFA 1WWTA 2DBYA 2W3SA 4C7ZA 1RM6C 5H8YE 5C2TB 1TKGA 2W54A 1H7XA 2AX5A 2PVOD 1V8CA 4C80A 1B9RA 3SR6A 2MJ3A 2WDVB 4C7YA 1RWSA 1XO3A 3EUB2 3HRDD 1NI3A 2H89B 2K9XA 1TYGB 2ACZB 3SFDB 1E9MA 3AEGB 2LEKA 3AEFB 1FO4A 3P4SB 3AE3B 1QOFA 1N61A 4YSZB 1E10A 2FBWB 2KMMA 1DOIA 1GT8A 2JQRB 4JX1C 4FXCA 3AV8A 3AE9B 1NYRA 1XLNA 2K22A 3P4QB 3P4PB 1JW9D 1N63A 1PFDA 1XLOA 1WYGA 3WCQA 2Y5CA 3L4PA 2H88B 2BS3B 2WU5B 3P4RB 1J7CA 1N60A 1JWAD 1XLPA 3B2GA 3AEDB 3VR8B 4YSXB 1JRPA 1WXQA 3HUIA 5EE3A 4YXDB 3NVYA 1JROA 1V97A 1NENB 4ITKA 2JX5A 1YQ3B 1FMAD 3AE7B
chains in the Genus database with same CATH superfamily
1WX8A 2KK8A 3EGRA 4IC7B 3WAMA 4AS1A 2LGYA 1H7WA 2FCMA 5AZHA 2D10A 2YEPF 1ZUD2 3IBEA 2DYBA 2L3ZA 2WXMA 1Q0WB 3HVZA 2E3TA 2XEWA 2D5GA 2LMCA 2LASA 4TQ0A 3DOWA 4DHJB 3QQ8B 1UH6A 1E0ZA 2YVCA 4IWPA 3RNCC 2N4FA 5HG2A 5C3JB 1ZKHA 4AJWA 3S2AA 2MWSB 1E7VA 5DPSA 5KHOA 1H4RA 2GLSA 1VJKA 1DGJA 1VRAB 5HKHA 3GE8C 3CF4A 2KJHB 5BO4B 1F0ZA 1ZOYB 2IY1B 1RFKA 4NJCA 5BMHA 3TIXA 3EFUA 4WWMA 4TMAB 4IM0A 1YQBA 2JY6A 3ZJUA 2BB5A 2KLCA 2BTEA 2L1AA 1E7PB 3VH3B 3K9PB 4RM9A 3KYDD 2OJRA 5JHAA 4FBJB 4AWJA 4A3PA 4AOFA 4ZHPA 3TEXA 1I4XA 4PK1A 1EO6A 3MC9A 2AX5A 3RNFC 3QX1A 4NPNA 4ICVA 2KFKB 5AZGA 4KGSA 5CTRC 5IO9A 3TEYA 2KACA 3OJ4B 1XLNA 2A4ZA 1MI0A 3KVFB 2KX0A 2IYDB 2VZKD 2DYOA 3TJPA 3TEZA 1D5MC 2ZW0A 4AJYB 1MVKA 4A9AA 3SU8X 1E6EB 2JZZA 4EKUA 1OQRA 3RULA 4P1BC 2B76B 1V5TA 3LB8C 4NNJB 1WRDB 3M95A 4YT0B 3ZO5B 2FCQA 3FKYA 3A9JA 5LLIA 2PLPA 3QA8A 4F8CB 5EE0A 1C4CA 5G5GA 1V81A 2K5PA 3AE8B 3GZNI 3VUWA 1SE2A 1EU4A 4C4VB 4HCPB 1R7SA 2RPQA 3ZIMA 3NHEB 1E8ZA 1F2RI 2JRIB 3AI5A 1YX6B 2W3RA 2M17A 1ACCA 1ESFA 2KMCA 3RI7C 1J7AA 1KLVA 3VAWA 1YJJA 3DDCB 3ZLZA 4K1RB 3ZNGC 1U4AA 2ZNVB 4II2B 3KQ4A 4MH8A 2AL6A 1F2RC 4BVUC 1E8WA 4ZRKA 1RLFA 2DNFA 4CQNA 2R61A 1V5OA 2W9NA 3AEGB 1TBEA 3TEWA 4RCOA 4M0WB 1FO4A 4F7ZA 3OWEB 2O2VA 3KUZA 1JWMD 4XYCA 1YMHE 3MP9A 1DOIA 4WH4A 2K22A 5AEKB 2WXQA 3HUIA 1RFAA 1WXQA 3PLVA 3V60A 3IXSA 1SEBD 2X38A 4W9HA 1TKEA 1EM7A 2GB1A 5TR5A 3P42A 2KYWA 3PHXB 4F1SA 2XN9C 4WJQA 1FM0D 1YX5B 1XCTL 1WZ0A 2G1EA 2LFIA 2D2QA 1JALA 3OG5A 1WF9A 1V80A 2XK5B 4FHJA 3MHZA 3RNAC 2WP9B 4M02A 1L0VB 1FXAA 3OAWA 2J0MA 3VR9B 3APFA 2YEPB 3V05A 3DWMA 2WDQB 3JSVA 1WJ4A 2JF5A 5CHFA 1XD3B 4NY0A 1ZPSA 2A5UA 2WXRA 3AB5A 2KC1A 1LXDA 5DPTA 4BAXA 3MC8A 1JWUD 1P3QU 3PSEB 2L8JA 1WR1A 3W1SA 1R4MB 1TJEA 3BK1A 4N6EB 1ET9A 2KDMA 3DBRI 3GS2A 4NAMA 2KQ7A 2V3NA 4JWSC 5E6OA 1ZE3D 3AH7A 3U4EG 1FFUA 4CO7A 4G11A 1JMLA 2MJDA 5CHWA 1AWDA 3K9OB 2VH2A 3N1YC 1WGGA 2JWUA 2JZPA 2FCSA 3FAHA 2E6XA 2WHIA 4JPSA 3CF6E 5D2MB 1K52A 1FEHA 3IT4B 1OGWA 2W54A 1H7XA 4WIPA 4DDGD 2V1YA 4EZJA 2MJ3A 2MBEA 1TY0A 4RFBA 3HM3A 2BB6A 5D7GA 2KQSA 3V6EB 3AE3B 2KOXA 4LDTD 2V3PA 3NG0A 1HTOA 1E10A 2FBWB 2RDBC 2M8SA 2AQ3B 2V0GA 2QC8A 3C19A 3ZVVA 2Y5CA 1XLPA 2SEBD 1JWAD 2K6DB 2D3CA 3Q14C 4HDQA 3KWLA 4HDOA 2WNMA 1PUTA 2LVOA 3B08A 1IGCA 1K51A 1WXMA 3DCGA 4DHZE 1C78A 3DBHB 1QKZA 3RN9C 1PGBA 1FXTB 1PGXA 4HRSA 3B0AA 1H8CA 4I6NB 5IAAC 2VZKB 2MH7A 3AM9A 5C1ZA 1Z5SB 4ANXA 1XQQA 3EHVA 1IBXB 1EWYC 4ZRQA 4HKQA 1V49A 3AEAB 3RD2A 1WZ3A 2HTME 2L00B 5AZFA 4I6LB 4P6VF 3ZNHB 1TS4A 1N5XA 2EELA 1OEYJ 1ENFA 4IWQA 4WAAA 3P1MA 4REZA 3VXWA 5FK9C 3E56A 2Q5WD 2KFKA 4MJSB 2UWQA 3Q2AC 2QDFA 3VRBB 3TSSA 2LJIA 3I63C 4HJKA 3BYYB 4BKSA 4MSMB 1CMXB 1RM6C 3NY5A 4EOYA 1PGAA 2J0KA 4A55A 2RSUA 4MM3B 1EUVB 2V4LA 3Q3MC 2QSDA 3C0RB 3PLUA 5FR6A 4EZLA 3VH4B 3RFZB 3W2DA 2DX5B 2LXAA 3ZQ4A 1BMLC 1MFWA 3ZDMC 1NENB 1FMAD 3ZGZA 4KDLB 3QHTA 2WX1A 4M8NA 2Z59B 3APDA 1I4GA 2DENB 1NBFC 3UF8A 1YN5A 3BY4B 1CZPA 2K8BA 2M19A 4C4VA 1C9FA 1P98A 3BK2A 4C00A 5LNK1 1AARA 2AEHA 4JE3B 5L83A 4GIVA 1T0SC 1A5RA 2MLBA 3NS1A 2JU6X 2MCNB 3KUDB 4N9F4 2WXNA 3TL5A 1XLQA 1KTKA 1EWCA 3T8MA 1I4HA 1OQYA 1QT9A 2BF8B 4JWUC 3UIOB 3V6CB 1MPEA 1P7FA 1QOGA 3BVZA 2WX0A 1RRBA 3MFGA 3AE6B 1NDDA 4P1CC 1GUAB 2FE8A 1SB3C 1VD2A 1N62A 1L0YB 4HROA 3AECB 4IDIA 4M0WA 4K7SA 4HVBA 2KNBA 2KMAA 1V86A 5HHDG 1GOZA 2DWQA 3HK0A 2NVUI 1HE8A 3QK0A 2O6VD 2DHZA 3PS6A 2KFJA 1TKGA 1V8CA 4KKJA 2Z8LA 3N1ZC 2LWPA 3R7RA 2M0AA 4HXDA 3VFKA 3U2SC 1D4BA 2IBIB 3TMPB 4Q2JA 4R3DA 1BXTA 3AE9B 1NYRA 1XT9B 3PREA 1XLOA 3R7QA 3L4PA 3RMKC 3FC4A 4ZHOA 4OHJA 1CQVA 1V97A 2XK5A 4HKZE 4WWNA 3RNBC 4BBNC 2LD9A 4EFOA 4J3OD 3SD5A 4LDTB 3A4RA 4HK2A 2RDHA 3WANA 1V9JA 2ZVOA 2JPHA 1Y8RC 3HIZA 4EEWA 1QLBB 3ZTCA 1G6JA 2C7MB 1Q1OA 3ZKJC 2DZKA 4GN1A 4HPLB 1TZ1A 2LHEA 1FNUA 2AWTA 3TCAA 1L7YA 2MRPA 3DBSA 1Q10A 3EFCA 3V62A 3PZDA 2Z0EB 3PZ7A 4WWPA 5D3IB 3AE2B 2JXTA 2N9KA 4XWTA 2CHXA 2RGFA 3I3TB 3NOBA 4O1NA 2G4DB 2G3QB 4NAWA 3L54A 4TQ1A 4NJ7A 5DCNA 1SXTA 4LJOB 3Q3NC 1MHXA 3IAS1 3LXFA 3MJWA 3RUIB 2KX3A 5AUKA 1YIWA 2CJNA 4E74A 1KFYB 2KDFB 2BVCA 4B0MA 2KC2A 3ZDTA 5IP4D 1C77A 1C1YB 4MACA 3BVGA 3TUOA 4RGNA 2KTRB 4W9DA 1D5ZC 4WQMA 1NI2A 4M8MA 1C4AA 1SE3A 1RYJA 2QIEB 4C56C 2ZZPB 4JGHB 4IM2A 1QZEA 2JYTA 3L08A 2QCZA 2L76A 2KO3A 3PZ8A 5CX3A 3RYTA 3BYTB 3E9SA 2MW5A 2GI9A 4A90A 1J8CA 2REXA 3C8YA 1HTQA 2NCNA 1V1PB 3AV8A 3UGBB 4RGTA 3DVGY 3IVFA 1VR9A 2JX5A 2DAJA 2I2YA 4NQKE 1MG4A 4ANVA 5G5HA 4GSWA 1ZGUB 3CSTA 4MGZE 4B0EA 4XGAB 4LNNA 4ZYNA 3KLSX 1JRUA 3NZSA 2EKEC 3KUCB 1WGKA 3EECA 1VZ6A 1JWBD 2L7RA 2KQ4X 4BFRA 4GLSC 1J0GA 1P1AA 1HQRD 4UDUC 1T0QC 1S3SG 2DAFA 2JSVX 1X1MA 4USAA 4FLHA 3V3XA 1UELA 4MJSA 2NBUA 3N3KB 1ZXHA 3X23A 4GB9A 3VVWB 4W9JA 2JZ3B 2BYEA 3PRMB 3NJTA 2J4XA 3M3JA 2LGXA 2MBQA 4AQ7A 3GZNB 4K7UA 2N0SB 3N20C 4MM3A 2QEJC 3DVGX 2D3AA 3EC8A 1JQ4A 2Y5PA 2CHWA 2KWUB 3ETRA 4P16A 4IW0A 4DHZB 2WXGA 3DBLB 4KIKB 1SE4A 4G0NB 4W9IA 5DPWA 3QIJA 1TT5B 4GMVA 3LYYA 1NI3A 2K9XA 3DBLI 5LXHA 3L10B 2XBBC 3ZNID 3UQAA 2KDEB 4W9GA 2HDEA 2O6VB 1E5WA 3Q8AA 1R4NI 3URYA 2MBBB 3A33B 1WX7A 2GOWA 2L05A 5EE3A 4YXDB 3NVYA 1KM7A 2N7JA 3MHSD 4KKIA 4WJPA 3WAPA 3CMMB 2LXCA 1K53A 1TS2A 1LO5D 3H6NA 4HEA1 4EZKA 2K0PA 3AU4A 2BS2B 1XEEA 2OJWA 1QOBA 3B2FA 1CK1A 4W9EA 1B1ZA 1L4DB 2IO0B 1T6BX 1WFYA 5BMIA 2CKHB 1K8RB 1GB4A 5GXGB 2MEKA 2QJLA 4S17A 2D07B 2BKRB 2PEAA 3GB1A 2DYMA 1MHHE 2K6QA 1CJEA 2FIFA 3WA0A 2PE9A 2HTHA 3RT3B 4MH0E 2GBMA 2V4IB 1V1OA 1ZP0B 3UI3A 3AEEB 3QC8B 4LNOA 2N9XA 5L95C 3ONSA 2RDGA 3V61A 1GB1A 1C3TA 1T0RC 5JHBA 1I4RA 2CU1A 1GTHA 2LGSA 1KF6B 3HM6X 2IDYA 2LJ5A 3W5UB 2LVQA 2DZIA 1VDVA 4HPPA 1SIJA 3DBRB 2RR9A 2DBYA 4C80A 3SR6A 4BBNF 3AULA 1RWSA 2D3BA 4IM3A 2WGSA 1RAXA 1F9JA 3BVMA 2NTTA 1SIFA 4YSZB 3N30A 3LJ3A 4ACFA 1AN8A 4RMAA 4ANWA 5FKAC 4YSXB 1VZ8A 4FJZA 1YQ3B 2KHWB 3RZFA 3VHTC 3VUYA 4DK5A 3J9CA 2L83A 3L0WB 1Z2MA 1WRIA 3R2TA 1F1HA 1N6ZA 4KX6B 2CU3A 1GG3A 4MELA 1ET6A 1TS5A 1ZDXA 4WQOB 2FUG1 2BT6A 3QAQA 2KWDA 2MBHA 2LZ6A 1WGRA 5IN7A 3PO0A 4JQWC 1L6VA 3SEBA 2KXJA 4ARCA 4RH6A 1Y56A 4B9KA 2BPSA 3FILB 1GC7A 1WH3A 2WDTB 2WXKA 4EE2A 1KLGD 2INPE 2M1MA 2KTRA 4FA6A 1IYFA 2PTLA 2TSSA 4B95A 3OJ3A 3AEBB 2WS3B 4XZ4A 1GTEA 3Q6BA 4KGTA 2R2QA 2PKOA 2IO2B 4OW0A 3A9KB 1JWSD 3AE5B 3IFWB 4ASWC 2MA9B 4MGIE 4RF0A 2R2OA 5J17A 2AQ1B 2WDVB 1L4ZB 1MG8A 1SJHD 4NZLB 2H89B 2PW9A 1DYQA 3U52E 2MP2B 3L16A 4ZYSA 2JRHA 2KMMA 4I6PA 1GT8A 4FADA 4JX1C 4TV3A 3BZDB 1PFDA 2HD5B 4L1BA 4E3CA 3M62B 2KKCA 4LK0M 1JROA 3MTNB 1E90A 3R8BA 4N59A 1T5XD 1GC6A 1C79A 5HFYA 5IA7A 5JXVA 1TTNA 3KWVA 4WJOA 1Q5WB 3VDZA 2LRUA 2BW2A 2K1FA 4MSQB 1WR6E 2SAKA 4YTNB 1I7HA 4GDLB 2V9HA 3A9JB 2KDBA 5D94A 5JH5C 4OZBA 1FIQA 2LHDA 1YQ4B 1UBIA 1HZ6A 2LGDA 4W9FA 1AYFA 1DOXA 4PYUA 3NVVA 1HA5A 3R66C 1A70A 5CHVC 1WGYA 1FXIA 4OVUA 2AL3A 1QF6A 5C23A 3UINB 1GPXA 4KIKA 2WXOA 2L32A 3DHHC 3QJZA 2IGDA 4BKTA 2NMQA 2N9EB 3PPAA 2C7HA 3NVWA 3LDZE 4WAFA 3WIMA 3DQVA 3NVZA 5E6PA 2KTFA 3ZXRA 3P63A 2MQJA 3PT2B 3D32A 2UYZB 2LRWA 4XDDA 4GXBA 3DVNU 2FIDA 5T8IA 2WXIA 2O6VA 3Q3JA 5TSSA 5BYRA 2ZCBA 1FNVA 1BT0A 1SSNA 3ZUNA 1LGRA 2XNAC 1E8YA 3EUB2 5E6JA 4DBGA 4GU2A 4LNFA 2O2VB 2NPTB 1QOFA 2HJ1A 1V6EA 3NZUA 3RZWC 1WE6A 3DHGC 4K7WA 3GE3C 1XXGA 1JCKB 2NR2A 1UD7A 1XCQL 2N9LA 1N60A 3AEDB 2IY0B 5E6NA 1SE9A 2K25A 3ZRFA 1YN3A 1ISNA 4FULA 1WM3A 1I35A 2J42A 1GAQB 1EU3A 3VTVA 2RMMA 1WGHA 2J7QB 1WXAA 1OEYA 2PJHA 5GMVA 3ML8A 2Y3AA 1TZOA 2WXFA 3AE1B 3Q3OC 1F77A 4ZOHC 4L23A 3IT6B 3L13A 3I9V1 2W82A 1YJIA 5AUIA 2PVGC 1FFVA 4KVGB 5HI1A 4DDID 1F52A 2K8CA 3JSVB 2OHFA 2NBWB 2KWCA 2GBRA 3QARA 2WDRB 1WSPA 2ZW1A 4IWOA 1FRRA 5BMGA 3AU5A 4IUMB 4AUQC 3MJ5A 3AMZA 1NVID 2QMTA 3SFEB 4RNAA 1T3QA 3B1LX 1QOAA 2BQQA 2YLMA 4OZCA 4ZRPA 4MGYE 2BYTA 3KYCD 3N1XC 3VUXA 2B3AA 1TKYA 3ML9A 1I42A 2IO3B 3QCAA 1I4PA 4C7ZA 5C2TB 2PVOD 2JT4B 1MJDA 4GDKB 4XWWA 4CYEA 4C7YA 2C60A 1XO3A 3W1SC 3VTUA 4K81A 2OOBB 3ZJTA 2KDIA 1VCBA 4W9LA 2DZJA 3T9LA 2MX2A 3VTWA 3RCZA 2WU5B 1WGDA 5IKCM 4ITKA 3N32A 4OVVA 2MBOA 4TKNA 3UIPB 3FILA 4XDCA 4D2KA 2BWES 3BIID 2AQ2B 3Q8EA 2FAZA 2HJ8A 1L5PA 5G2NA 3A4SC 4OVZA 2NTSA 3CIRB 1FPYA 4RGMA 5DPRA 4LJPB 2GBKA 3IAM1 4IOIE 3JYUA 1STEA 3PV1A 4HLEA 1IBXA 2WQYB 2I1KA 3A9KA 4WURA 4XX5A 2GBJA 5G55A 3L17A 5EE1A 1PQSA 4B6WA 1KJTA 2J52A 3BINA 4PS3A 2KWVB 4N58A 1S1QB 4KDIC 2Z0DB 1WJ6A 1ZXIA 3X0WA 4KSKC 1WI0A 3H7PB 1FRDA 2D3GA 2ZEQA 2MP2A 2MSED 3ALBA 3Q8BA 2VRRB 3N9YC 2WLBA 1SBBB 2KVZA 2LI5A 2KLGA 3U7DA 4E71A 2W3SA 3JVZX 4DXAB 1WJNA 2PPHA 1WX9A 4YL8A 1UBQA 1OTRB 2ACZB 1QQRA 2N9PC 2BYVE 3P4SB 1WJUA 2I38A 2K39A 3ECIA 3I57A 4JLCA 5J2RA 2GMIC 4W9KA 4BKGA 4GDLA 1N63A 1WYGA 4XE0A 1HZ5A 1LQBA 4P7IA 2G45B 4PS7A 4MDKE 2EMSA 5IOIA 1EF1A 3AE7B 3DHIC 2WXHA 2L52A 1ZDVA 2CHZA 1LM8B 1R4NB 3W9CB 2LVPA 4HJGE 1VZ7A 1L6UA 4LNIA 2G9HD 3NRZA 4QAYA 2M0XA 4M01A 4PS8A 2EMTA 4A20A 1KH0A 1YNTE 4GGQA 1FCCC 2M56B 4ZDVA 1IGDA 3HHMA 2ON8A 1LFDA 3PTFC 3ZXVA 1IP9A 1SGHA 3ZJVA 4IKGA 5FR3A 4YWGG 2IGGA 4US9A 2RD0A 2IZVB 2M4NA 4A3OA 1XF5L 2L0FA 2BS4B 3H8HA 3Q8FA 4RF1A 1N5WA 2UU7A 2D11A 3H1UA 2NS5A 4HCNB 2I1JA 4MEMA 1AW7A 2NPTA 4DQOC 2JXXA 2KANA 2PMVA 3Q3FA 3PRPB 3KH0A 3U7ZA 2N1VA 4JIOU 3H9DA 1WMHB 1TY2A 1IPGA 3CSFA 3R3MA 1QILA 3APCA 4WJNA 4XC2A 2HE7A 3HRDD 2ZNVC 1EF5A 2ZPYA 2IPKD 2ZCCA 1D5XC 3MC0B 2JQRB 2N7EA 2WYQA 3PHWB 3P4QB 2NBVB 3WCQA 2H88B 3B9JA 3P4RB 4ZRJA 1JRPA 1D3ZA 4DXGA 1KLUD 1TGZB 1I4QA 4YTMB 3SDLC 3RNEC 1VLBA 4A8XC 3Q8CA 3KW5B 3ZW3A 3A1QB 4PYZA 1GNUA 4YSYB 2LUMA 3ZRCA 3UQBA 2JVCA 4URKA 2CR5A 4J6IA 5MPOA 2WXJA 2KT7A 3PVLA 4DWFA 1J7BA 1DOYA 3AN1A 3RPFC 2BKFA 2WXLA 1HXYD 4NAWB 4LNKA 1R4MI 3IG3A 2CJOA 3O13A 2FUHB 4OZAA 5H92C 3U30A 3PGEA 1WM2A 3DVNV 4FJVB 2Y5BB 4PT5A 4RM8A 1K50A 4DXFA 2GRIA 2AYOB 2INCC 4GDKA 1P9DU 2BYFA 4HPMB 2ZVNA 3GOEA 1SJED 4LLGM 2KVRA 3W5VB 2KD0A 2WXPA 3VRAB 2V3SA 4W9CA 2VH1A 1T0YA 2J0JA 2KZRA 4ANUA 1J19A 1V2YA 4CHKA 3ENEA 2LGIA 1TYGB 1WY8A 2BWFA 4NJ6A 2LEKA 4WWOA 3AEFB 2PE6B 1WYWB 4ICUA 1V1PA 1UNSA 3DBHI 1GJZA 4K3CA 2QHOA 4X57B 4DHJD 3ZYYX 3NS8A 2KJ6A 3CWIA 3GP7A 3EA6A 1L2NA 2FNJB 2FCNA 3JW0X 4M00A 2INNE 3NZ3A 1YD8U 1M4VA 1UWXA 4BOZB 4KGRA 4FHKA 2PIAA 2CS4A 2W55A 1KOTA 1PYWD 3AXCA 1UWMA 4FN2A 2C7NB 1UUPA 3PRZA 3H7PA 5KHQA 3DWGC 4KV2A 1E8XA 2EKIA 4H2AA 3T3NA 1NYQA 3OLMD 2G4SA 1ROEA 2DZMA 2X8XX 3WALA 2JUOA 4A6QA 4NQLB 3AE4B 2BBCA 2MJEA 5EE9A 4BKSD 2ASQA 1KRHA 3H7SA 3NUHB 4BOSC 4US8A 1C76A 4HWIB 1WWTA 2KN4A 5H8YE 5JZEB 1UGJA 4LCDE 2C5LC 3O65B 1YJ1A 1WIAA 3M63B 2J53A 1E9MA 3SHQA 3TBLD 4GOCA 5J18A 5D6JB 2IGHA 1N61A 4G50A 3RNGC 3ZTDA 2K8HA 4KSLC 2KN5A 4FXCA 1YN4A 3P4PB 1JW9D 4S0RA 1J7CA 3QWZB 4RGOS 3VR8B 4JL9A 1D6EC 4MT5A 2L0TA 2BGFA 5D3DA 4K3BA 1L0XB 5I4DA 4BZAA 4MGKE 2WU2B 4IG7B 5EDSA 1WE7A 5LXIB 4TUUA 3ABVB 1FD6A 3BWUD 2N1WA 1P7EA 2RPVA 4KZ0A 2IO1B 1UGMA 1OQQA 5BYSA 2C9WB 2KAJA 2QILA 3DPDA 3I5JC 4YTPB 1IUEA 1PDXA 1HEZE 1WXVA 3IHPC 4TSSA 3P2BA 2ZJDA 2OEDA 3VQIA 2IJ0A 1WMHA 2DLBA 2MHJA 1TS3A 1FNWA 3Q69A 2K3UA 3U8ZA 1YOVB 2N7DA 2ICIA 4AP4C 2INDC 1ZW7A 1TIFA 2JWZA 3T3OA 1NEKB 3ZNZB 1UZXB 4II3B 4FJYA 1SF0A 2GBNA 2LUEA 4LTUA 1OFFA 1E7UA 4ARIA 1B9RA 4ZRIA 4KZCA 1C4PA 1WXSA 3WAOA 2WWZA 3SFDB 4EUTA 2JYEA 1BUIC 4L2YA 4G3XB 1P0RA 3HVDA 1FCLA 3A1QA 2KJRA 3W1YA 1UF0A 1M94A 3R2IA 2BS3B 3B2GA 2ZPNA 5BYQA 2ONQA
chains in the Genus database with same CATH topology
2WXHA 3ZGZA 2L52A 3EGRA 3J9CA 2L83A 1ZDVA 3R2TA 1WRIA 4AS1A 4KX6B 1I4GA 3W9CB 2CU3A 1YN5A 1H7WA 1ET6A 1TS5A 1ZDXA 1CZPA 2YEPF 1ZUD2 2FUG1 2BT6A 4HJGE 2KWDA 1VZ7A 2M19A 1C9FA 3PO0A 2WXMA 3HVZA 1L6UA 2E3TA 1L6VA 3BK2A 2G9HD 3NRZA 5LNK1 3SEBA 4ARCA 2D5GA 2LMCA 4TQ0A 1E0ZA 4JE3B 1KH0A 4RH6A 1Y56A 1YNTE 5HG2A 3FILB 5C3JB 1FCCC 2M56B 3NS1A 2JU6X 1IGDA 2WXKA 2ON8A 4EE2A 1KLGD 2WXNA 1VJKA 1DGJA 1VRAB 1XLQA 2INPE 1KTKA 1EWCA 3ZJVA 3CF4A 1I4HA 4IKGA 2IGGA 4YWGG 4US9A 5FR3A 1QT9A 1F0ZA 2PTLA 4JWUC 1ZOYB 2TSSA 1RFKA 4NJCA 5BMHA 1XF5L 3AEBB 4WWMA 2BS4B 3H8HA 4TMAB 2WS3B 3Q8FA 4RF1A 1MPEA 1P7FA 1N5WA 1QOGA 3ZJUA 1GTEA 3BVZA 2BB5A 4KGTA 2BTEA 2L1AA 3MFGA 1E7PB 3AE6B 2PKOA 2FE8A 1SB3C 4OW0A 1N62A 1L0YB 1AW7A 4HROA 3AECB 4IDIA 4M0WA 4DQOC 2PMVA 5HHDG 3U7ZA 1GOZA 2DWQA 1JWSD 3AE5B 1TY2A 4ZHPA 3TEXA 4RF0A 1I4XA 1TKGA 2AX5A 1QILA 1V8CA 2AQ1B 4KKJA 2WDVB 2Z8LA 1L4ZB 1SJHD 3HRDD 4NZLB 2H89B 2PW9A 2M0AA 4KGSA 3U2SC 1D4BA 1DYQA 3U52E 2IPKD 4ZYSA 1D5XC 2KMMA 3TEYA 2KACA 3MC0B 4Q2JA 1GT8A 2JQRB 4R3DA 4JX1C 1BXTA 3AE9B 1NYRA 1XLNA 3BZDB 3P4QB 1PFDA 1XLOA 4L1BA 3WCQA 3L4PA 2H88B 3B9JA 3P4RB 1MI0A 3FC4A 4ZHOA 1JRPA 4LK0M 4OHJA 1CQVA 1JROA 1V97A 2VZKD 2DYOA 4DXGA 4HKZE 1KLUD 3TEZA 1I4QA 1D5MC 3R8BA 4N59A 4YTMB 1T5XD 2ZW0A 5HFYA 1C79A 1MVKA 4J3OD 5JXVA 4A9AA 3KWVA 1VLBA 1E6EB 4A8XC 1OQRA 3Q8CA 2RDHA 2BW2A 2B76B 1QLBB 2SAKA 3LB8C 4YSYB 4YTNB 1I7HA 4GDLB 2LUMA 4YT0B 2LHEA 1FNUA 4OZBA 5MPOA 1FIQA 2LHDA 1YQ4B 2WXJA 1Q10A 1HZ6A 2PLPA 3PZ7A 1J7BA 5D3IB 5EE0A 3AE2B 1AYFA 2JXTA 2N9KA 3AN1A 1C4CA 3NVVA 2WXLA 4XWTA 5G5GA 3RPFC 2K5PA 1HA5A 1HXYD 1A70A 3AE8B 4NAWB 4O1NA 2CJOA 3O13A 1SE2A 4TQ1A 1EU4A 1FXIA 1SXTA 1R7SA 4OZAA 5H92C 1QF6A 1GPXA 2WXOA 4PT5A 1MHXA 4DXFA 1K50A 2GRIA 2L32A 3IAS1 3LXFA 2IGDA 1F2RI 5AUKA 2CJNA 1KFYB 2NMQA 2W3RA 1ACCA 4B0MA 1ESFA 3NVWA 1C77A 4WAFA 1SJED 3NVZA 4LLGM 4MACA 3BVGA 1J7AA 3TUOA 3W5VB 3P63A 4RGNA 1YJJA 2WXPA 1D5ZC 4WQMA 1C4AA 4XDDA 3VRAB 1SE3A 1RYJA 5T8IA 2QIEB 2WXIA 4C56C 3KQ4A 4MH8A 1F2RC 5TSSA 5BYRA 1FNVA 1SSNA 2JYTA 2XNAC 4CQNA 2R61A 3EUB2 2LGIA 1TYGB 5E6JA 2LEKA 3AEGB 3PZ8A 3TEWA 3AEFB 4RCOA 1FO4A 3OWEB 1QOFA 3BYTB 3E9SA 2GI9A 1JWMD 4A90A 1YMHE 3MP9A 1DOIA 3C8YA 1V1PB 4WH4A 3AV8A 2K22A 1XXGA 1JCKB 1V1PA 1UNSA 1XCQL 2N9LA 1N60A 2WXQA 4RGTA 3HUIA 3AEDB 1WXQA 1VR9A 2JX5A 2I2YA 3IXSA 1YN3A 1SEBD 3ZYYX 2X38A 1TKEA 1EM7A 5G5HA 2J42A 1GAQB 1EU3A 3GP7A 3CWIA 2GB1A 3EA6A 4B0EA 2RMMA 3P42A 2INNE 3NZ3A 3KLSX 2XN9C 2Y3AA 1TZOA 1M4VA 1FM0D 1UWXA 2WXFA 3AE1B 1XCTL 1F77A 4KGRA 4ZOHC 4L23A 1WGKA 2G1EA 2LFIA 2PIAA 1VZ6A 1JWBD 3IT6B 2W55A 3I9V1 1JALA 2KQ4X 1YJIA 2W82A 1PYWD 5AUIA 3MHZA 4GLSC 2PVGC 1DOXA 2WP9B 1FFVA 1L0VB 1FXAA 5HI1A 1HQRD 4UDUC 3VR9B 1UWMA 2YEPB 3V05A 3DWMA 2OHFA 2JSVX 2WDQB 4USAA 3V3XA 1UUPA 1ZXHA 1ZPSA 2WDRB 1WSPA 2WXRA 2ZW1A 3AB5A 1DOYA 3DWGC 2EKIA 4H2AA 1FRRA 5BMGA 1JWUD 2J4XA 3T3NA 4AQ7A 3W1SA 1NYQA 3MJ5A 1TJEA 3AMZA 1NVID 1ROEA 3BK1A 2N0SB 4N6EB 2QMTA 1ET9A 2KDMA 3SFEB 4RNAA 1T3QA 2QEJC 3GS2A 4NAMA 1QOAA 2V3NA 4JWSC 1JQ4A 4A6QA 4OZCA 4ZRPA 1ZE3D 3AH7A 3U4EG 3AE4B 2BBCA 2Y5PA 2BYTA 1FFUA 3ETRA 4P16A 1JMLA 2MJEA 2MJDA 1AWDA 2WXGA 5EE9A 2JWUA 1TKYA 2JZPA 1KRHA 3FAHA 3NUHB 4US8A 2E6XA 1SE4A 4JPSA 1C76A 1I4PA 1K52A 1WWTA 1FEHA 2KN4A 3IT4B 4C7ZA 5H8YE 5C2TB 2W54A 1H7XA 4WIPA 2PVOD 1UGJA 2MJ3A 4GDKB 4XWWA 4C7YA 3LYYA 1XO3A 1NI3A 2K9XA 1TY0A 4RFBA 2J53A 1E9MA 2BB6A 5D7GA 3AE3B 2V3PA 2IGHA 1N61A 3ZJTA 1E10A 2FBWB 4FXCA 2AQ3B 1YN4A 2V0GA 2HDEA 3P4PB 1JW9D 2Y5CA 3Q8AA 1J7CA 2WU5B 1XLPA 2SEBD 4RGOS 1JWAD 3URYA 3VR8B 5EE3A 4YXDB 3NVYA 4ITKA 2N7JA 1D6EC 4KKIA 4MT5A 1K53A 1TS2A 1LO5D 3KWLA 2WNMA 1PUTA 3FILA 4HEA1 5D3DA 1IGCA 1K51A 1L0XB 4XDCA 2K0PA 5I4DA 4D2KA 2BS2B 1XEEA 1C78A 3BIID 2WU2B 1QKZA 1QOBA 2AQ2B 3B2FA 1PGBA 3Q8EA 3ABVB 1CK1A 1PGXA 1FD6A 1L5PA 1B1ZA 1L4DB 3BWUD 4HRSA 1T6BX 1P7EA 5BMIA 4OVZA 1GB4A 2RPVA 2NTSA 3CIRB 5GXGB 2MEKA 2VZKB 2MH7A 4RGMA 2QJLA 3AM9A 1OQQA 5BYSA 2KAJA 3GB1A 3IAM1 2QILA 2DYMA 4YTPB 1MHHE 4IOIE 1IUEA 1CJEA 1HEZE 1PDXA 1STEA 1IBXB 1EWYC 4ZRQA 4HKQA 1IBXA 3AEAB 2HTME 4TSSA 2WQYB 4P6VF 4WURA 2OEDA 2V4IB 1V1OA 1ZP0B 3UI3A 3VQIA 3AEEB 2IJ0A 1TS4A 1N5XA 2DLBA 2EELA 5EE1A 1ENFA 1TS3A 2J52A 2RDGA 1FNWA 1GB1A 3P1MA 4REZA 3Q69A 5FK9C 2K3UA 1I4RA 3E56A 2ICIA 4N58A 2Q5WD 1GTHA 1KF6B 1ZXIA 2IDYA 3W5UB 1FRDA 3T3OA 1VDVA 3Q8BA 3VRBB 1NEKB 3N9YC 3TSSA 2WLBA 2LJIA 1SBBB 1SF0A 3BYYB 1SIJA 4LTUA 1OFFA 2DBYA 2W3SA 1RM6C 4C80A 4ARIA 1B9RA 3SR6A 1PGAA 1RWSA 4A55A 4MM3B 1C4PA 2ACZB 3SFDB 1QQRA 2JYEA 1BUIC 3BVMA 4L2YA 2NTTA 3P4SB 2QSDA 2I38A 3HVDA 4YSZB 1FCLA 3I57A 3RFZB 3W2DA 3ZQ4A 1N63A 1WYGA 4XE0A 3R2IA 1AN8A 1HZ5A 2BS3B 3B2GA 5FKAC 4YSXB 1BMLC 5BYQA 1VZ8A 1NENB 1YQ3B 1FMAD 3AE7B 2ONQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZYY X;  4N59 A;  4YTM B;  2L52 A;  1TKE A;  3KWL A;  5G5H A;  1PUT A;  2L83 A;  1WRI A;  1GAQ B;  4A9A A;  3CWI A;  4KX6 B;  2BS2 B;  1VLB A;  1E6E B;  3BII D;  2CU3 A;  2WU2 B;  3W9C B;  1OQR A;  1H7W A;  1QOB A;  3B2F A;  2B76 B;  1CZP A;  1ZUD 2;  3ABV B;  1QLB B;  2BT6 A;  3LB8 C;  1L5P A;  4YSY B;  4YTN B;  1I7H A;  1FM0 D;  2M19 A;  4HRS A;  3AE1 B;  3PO0 A;  4ZOH C;  1WGK A;  2G1E A;  3HVZ A;  1L6U A;  2PIA A;  4YT0 B;  1JWB D;  2E3T A;  2W55 A;  1L6V A;  3CIR B;  1JAL A;  1YJI A;  3NRZ A;  5GXG B;  2MH7 A;  2QJL A;  5AUI A;  5MPO A;  3AM9 A;  1FIQ A;  1YQ4 B;  2PVG C;  1OQQ A;  1E0Z A;  2WP9 B;  1FFV A;  1L0V B;  1FXA A;  2KAJ A;  4YTP B;  5C3J B;  3VR9 B;  1J7B A;  1IUE A;  1CJE A;  1PDX A;  1UWM A;  2M56 B;  3DWM A;  1EWY C;  2OHF A;  3NS1 A;  5EE0 A;  3AE2 B;  1AYF A;  3AN1 A;  3RPF C;  1DOX A;  1DOY A;  2WDQ B;  3NVV A;  4USA A;  3AEA B;  5G5G A;  3FC4 A;  2K5P A;  2HTM E;  1A70 A;  3AE8 B;  1VJK A;  1DGJ A;  4ZHO A;  1XLQ A;  2WDR B;  2WQY B;  2CJO A;  4P6V F;  3CF4 A;  3AB5 A;  4US9 A;  1FXI A;  1ZP0 B;  1QT9 A;  1R7S A;  5H92 C;  3AEE B;  3DWG C;  1F0Z A;  1QF6 A;  4JWU C;  1N5X A;  2EKI A;  1ZOY B;  1RFK A;  5EE1 A;  1FRR A;  1GPX A;  3AEB B;  4WWM A;  2BS4 B;  3LXF A;  2WS3 B;  1NYQ A;  5AUK A;  1N5W A;  3P1M A;  1TJE A;  3AMZ A;  2CJN A;  1NVI D;  1QOG A;  1GTE A;  1ROE A;  1KFY B;  2N0S B;  4N6E B;  2W3R A;  3SFE B;  1E7P B;  3AE6 B;  4N58 A;  2Q5W D;  1T3Q A;  3B9J A;  2PKO A;  1GTH A;  1SB3 C;  1KF6 B;  3NVW A;  1N62 A;  1QOA A;  3NVZ A;  4JWS C;  4HRO A;  3AEC B;  1ZXI A;  4IDI A;  1JQ4 A;  3W5U B;  1J7A A;  1FRD A;  3AH7 A;  3AE4 B;  3P63 A;  1VDV A;  3W5V B;  1FFU A;  3VRB B;  1NEK B;  3ETR A;  1YJJ A;  2WLB A;  4WQM A;  2MJE A;  2MJD A;  1AWD A;  2DWQ A;  1SF0 A;  5EE9 A;  3AE5 B;  1SIJ A;  3VRA B;  1RYJ A;  1TKY A;  1KRH A;  3FAH A;  2QIE B;  4LTU A;  4US8 A;  4ZHP A;  1OFF A;  1WWT A;  2DBY A;  2W3S A;  4C7Z A;  1RM6 C;  5H8Y E;  5C2T B;  1TKG A;  2W54 A;  1H7X A;  2AX5 A;  2PVO D;  1V8C A;  4C80 A;  1B9R A;  3SR6 A;  2MJ3 A;  2WDV B;  4C7Y A;  1RWS A;  1XO3 A;  3EUB 2;  3HRD D;  1NI3 A;  2H89 B;  2K9X A;  1TYG B;  2ACZ B;  3SFD B;  1E9M A;  3AEG B;  2LEK A;  3AEF B;  1FO4 A;  3P4S B;  3AE3 B;  1QOF A;  1N61 A;  4YSZ B;  1E10 A;  2FBW B;  2KMM A;  1DOI A;  1GT8 A;  2JQR B;  4JX1 C;  4FXC A;  3AV8 A;  3AE9 B;  1NYR A;  1XLN A;  2K22 A;  3P4Q B;  3P4P B;  1JW9 D;  1N63 A;  1PFD A;  1XLO A;  1WYG A;  3WCQ A;  2Y5C A;  3L4P A;  2H88 B;  2BS3 B;  2WU5 B;  3P4R B;  1J7C A;  1N60 A;  1JWA D;  1XLP A;  3B2G A;  3AED B;  3VR8 B;  4YSX B;  1JRP A;  1WXQ A;  3HUI A;  5EE3 A;  4YXD B;  3NVY A;  1JRO A;  1V97 A;  1NEN B;  4ITK A;  2JX5 A;  1YQ3 B;  1FMA D;  3AE7 B; 
#chains in the Genus database with same CATH topology
 1WX8 A;  2KK8 A;  3EGR A;  4IC7 B;  3WAM A;  4AS1 A;  2LGY A;  1H7W A;  2FCM A;  5AZH A;  2D10 A;  2YEP F;  1ZUD 2;  3IBE A;  2DYB A;  2L3Z A;  2WXM A;  1Q0W B;  3HVZ A;  2E3T A;  2XEW A;  2D5G A;  2LMC A;  2LAS A;  4TQ0 A;  3DOW A;  4DHJ B;  3QQ8 B;  1UH6 A;  1E0Z A;  2YVC A;  4IWP A;  3RNC C;  2N4F A;  5HG2 A;  5C3J B;  1ZKH A;  4AJW A;  3S2A A;  2MWS B;  1E7V A;  5DPS A;  5KHO A;  1H4R A;  2GLS A;  1VJK A;  1DGJ A;  1VRA B;  5HKH A;  3GE8 C;  3CF4 A;  2KJH B;  5BO4 B;  1F0Z A;  1ZOY B;  2IY1 B;  1RFK A;  4NJC A;  5BMH A;  3TIX A;  3EFU A;  4WWM A;  4TMA B;  4IM0 A;  1YQB A;  2JY6 A;  3ZJU A;  2BB5 A;  2KLC A;  2BTE A;  2L1A A;  1E7P B;  3VH3 B;  3K9P B;  4RM9 A;  3KYD D;  2OJR A;  5JHA A;  4FBJ B;  4AWJ A;  4A3P A;  4AOF A;  4ZHP A;  3TEX A;  1I4X A;  4PK1 A;  1EO6 A;  3MC9 A;  2AX5 A;  3RNF C;  3QX1 A;  4NPN A;  4ICV A;  2KFK B;  5AZG A;  4KGS A;  5CTR C;  5IO9 A;  3TEY A;  2KAC A;  3OJ4 B;  1XLN A;  2A4Z A;  1MI0 A;  3KVF B;  2KX0 A;  2IYD B;  2VZK D;  2DYO A;  3TJP A;  3TEZ A;  1D5M C;  2ZW0 A;  4AJY B;  1MVK A;  4A9A A;  3SU8 X;  1E6E B;  2JZZ A;  4EKU A;  1OQR A;  3RUL A;  4P1B C;  2B76 B;  1V5T A;  3LB8 C;  4NNJ B;  1WRD B;  3M95 A;  4YT0 B;  3ZO5 B;  2FCQ A;  3FKY A;  3A9J A;  5LLI A;  2PLP A;  3QA8 A;  4F8C B;  5EE0 A;  1C4C A;  5G5G A;  1V81 A;  2K5P A;  3AE8 B;  3GZN I;  3VUW A;  1SE2 A;  1EU4 A;  4C4V B;  4HCP B;  1R7S A;  2RPQ A;  3ZIM A;  3NHE B;  1E8Z A;  1F2R I;  2JRI B;  3AI5 A;  1YX6 B;  2W3R A;  2M17 A;  1ACC A;  1ESF A;  2KMC A;  3RI7 C;  1J7A A;  1KLV A;  3VAW A;  1YJJ A;  3DDC B;  3ZLZ A;  4K1R B;  3ZNG C;  1U4A A;  2ZNV B;  4II2 B;  3KQ4 A;  4MH8 A;  2AL6 A;  1F2R C;  4BVU C;  1E8W A;  4ZRK A;  1RLF A;  2DNF A;  4CQN A;  2R61 A;  1V5O A;  2W9N A;  3AEG B;  1TBE A;  3TEW A;  4RCO A;  4M0W B;  1FO4 A;  4F7Z A;  3OWE B;  2O2V A;  3KUZ A;  1JWM D;  4XYC A;  1YMH E;  3MP9 A;  1DOI A;  4WH4 A;  2K22 A;  5AEK B;  2WXQ A;  3HUI A;  1RFA A;  1WXQ A;  3PLV A;  3V60 A;  3IXS A;  1SEB D;  2X38 A;  4W9H A;  1TKE A;  1EM7 A;  2GB1 A;  5TR5 A;  3P42 A;  2KYW A;  3PHX B;  4F1S A;  2XN9 C;  4WJQ A;  1FM0 D;  1YX5 B;  1XCT L;  1WZ0 A;  2G1E A;  2LFI A;  2D2Q A;  1JAL A;  3OG5 A;  1WF9 A;  1V80 A;  2XK5 B;  4FHJ A;  3MHZ A;  3RNA C;  2WP9 B;  4M02 A;  1L0V B;  1FXA A;  3OAW A;  2J0M A;  3VR9 B;  3APF A;  2YEP B;  3V05 A;  3DWM A;  2WDQ B;  3JSV A;  1WJ4 A;  2JF5 A;  5CHF A;  1XD3 B;  4NY0 A;  1ZPS A;  2A5U A;  2WXR A;  3AB5 A;  2KC1 A;  1LXD A;  5DPT A;  4BAX A;  3MC8 A;  1JWU D;  1P3Q U;  3PSE B;  2L8J A;  1WR1 A;  3W1S A;  1R4M B;  1TJE A;  3BK1 A;  4N6E B;  1ET9 A;  2KDM A;  3DBR I;  3GS2 A;  4NAM A;  2KQ7 A;  2V3N A;  4JWS C;  5E6O A;  1ZE3 D;  3AH7 A;  3U4E G;  1FFU A;  4CO7 A;  4G11 A;  1JML A;  2MJD A;  5CHW A;  1AWD A;  3K9O B;  2VH2 A;  3N1Y C;  1WGG A;  2JWU A;  2JZP A;  2FCS A;  3FAH A;  2E6X A;  2WHI A;  4JPS A;  3CF6 E;  5D2M B;  1K52 A;  1FEH A;  3IT4 B;  1OGW A;  2W54 A;  1H7X A;  4WIP A;  4DDG D;  2V1Y A;  4EZJ A;  2MJ3 A;  2MBE A;  1TY0 A;  4RFB A;  3HM3 A;  2BB6 A;  5D7G A;  2KQS A;  3V6E B;  3AE3 B;  2KOX A;  4LDT D;  2V3P A;  3NG0 A;  1HTO A;  1E10 A;  2FBW B;  2RDB C;  2M8S A;  2AQ3 B;  2V0G A;  2QC8 A;  3C19 A;  3ZVV A;  2Y5C A;  1XLP A;  2SEB D;  1JWA D;  2K6D B;  2D3C A;  3Q14 C;  4HDQ A;  3KWL A;  4HDO A;  2WNM A;  1PUT A;  2LVO A;  3B08 A;  1IGC A;  1K51 A;  1WXM A;  3DCG A;  4DHZ E;  1C78 A;  3DBH B;  1QKZ A;  3RN9 C;  1PGB A;  1FXT B;  1PGX A;  4HRS A;  3B0A A;  1H8C A;  4I6N B;  5IAA C;  2VZK B;  2MH7 A;  3AM9 A;  5C1Z A;  1Z5S B;  4ANX A;  1XQQ A;  3EHV A;  1IBX B;  1EWY C;  4ZRQ A;  4HKQ A;  1V49 A;  3AEA B;  3RD2 A;  1WZ3 A;  2HTM E;  2L00 B;  5AZF A;  4I6L B;  4P6V F;  3ZNH B;  1TS4 A;  1N5X A;  2EEL A;  1OEY J;  1ENF A;  4IWQ A;  4WAA A;  3P1M A;  4REZ A;  3VXW A;  5FK9 C;  3E56 A;  2Q5W D;  2KFK A;  4MJS B;  2UWQ A;  3Q2A C;  2QDF A;  3VRB B;  3TSS A;  2LJI A;  3I63 C;  4HJK A;  3BYY B;  4BKS A;  4MSM B;  1CMX B;  1RM6 C;  3NY5 A;  4EOY A;  1PGA A;  2J0K A;  4A55 A;  2RSU A;  4MM3 B;  1EUV B;  2V4L A;  3Q3M C;  2QSD A;  3C0R B;  3PLU A;  5FR6 A;  4EZL A;  3VH4 B;  3RFZ B;  3W2D A;  2DX5 B;  2LXA A;  3ZQ4 A;  1BML C;  1MFW A;  3ZDM C;  1NEN B;  1FMA D;  3ZGZ A;  4KDL B;  3QHT A;  2WX1 A;  4M8N A;  2Z59 B;  3APD A;  1I4G A;  2DEN B;  1NBF C;  3UF8 A;  1YN5 A;  3BY4 B;  1CZP A;  2K8B A;  2M19 A;  4C4V A;  1C9F A;  1P98 A;  3BK2 A;  4C00 A;  5LNK 1;  1AAR A;  2AEH A;  4JE3 B;  5L83 A;  4GIV A;  1T0S C;  1A5R A;  2MLB A;  3NS1 A;  2JU6 X;  2MCN B;  3KUD B;  4N9F 4;  2WXN A;  3TL5 A;  1XLQ A;  1KTK A;  1EWC A;  3T8M A;  1I4H A;  1OQY A;  1QT9 A;  2BF8 B;  4JWU C;  3UIO B;  3V6C B;  1MPE A;  1P7F A;  1QOG A;  3BVZ A;  2WX0 A;  1RRB A;  3MFG A;  3AE6 B;  1NDD A;  4P1C C;  1GUA B;  2FE8 A;  1SB3 C;  1VD2 A;  1N62 A;  1L0Y B;  4HRO A;  3AEC B;  4IDI A;  4M0W A;  4K7S A;  4HVB A;  2KNB A;  2KMA A;  1V86 A;  5HHD G;  1GOZ A;  2DWQ A;  3HK0 A;  2NVU I;  1HE8 A;  3QK0 A;  2O6V D;  2DHZ A;  3PS6 A;  2KFJ A;  1TKG A;  1V8C A;  4KKJ A;  2Z8L A;  3N1Z C;  2LWP A;  3R7R A;  2M0A A;  4HXD A;  3VFK A;  3U2S C;  1D4B A;  2IBI B;  3TMP B;  4Q2J A;  4R3D A;  1BXT A;  3AE9 B;  1NYR A;  1XT9 B;  3PRE A;  1XLO A;  3R7Q A;  3L4P A;  3RMK C;  3FC4 A;  4ZHO A;  4OHJ A;  1CQV A;  1V97 A;  2XK5 A;  4HKZ E;  4WWN A;  3RNB C;  4BBN C;  2LD9 A;  4EFO A;  4J3O D;  3SD5 A;  4LDT B;  3A4R A;  4HK2 A;  2RDH A;  3WAN A;  1V9J A;  2ZVO A;  2JPH A;  1Y8R C;  3HIZ A;  4EEW A;  1QLB B;  3ZTC A;  1G6J A;  2C7M B;  1Q1O A;  3ZKJ C;  2DZK A;  4GN1 A;  4HPL B;  1TZ1 A;  2LHE A;  1FNU A;  2AWT A;  3TCA A;  1L7Y A;  2MRP A;  3DBS A;  1Q10 A;  3EFC A;  3V62 A;  3PZD A;  2Z0E B;  3PZ7 A;  4WWP A;  5D3I B;  3AE2 B;  2JXT A;  2N9K A;  4XWT A;  2CHX A;  2RGF A;  3I3T B;  3NOB A;  4O1N A;  2G4D B;  2G3Q B;  4NAW A;  3L54 A;  4TQ1 A;  4NJ7 A;  5DCN A;  1SXT A;  4LJO B;  3Q3N C;  1MHX A;  3IAS 1;  3LXF A;  3MJW A;  3RUI B;  2KX3 A;  5AUK A;  1YIW A;  2CJN A;  4E74 A;  1KFY B;  2KDF B;  2BVC A;  4B0M A;  2KC2 A;  3ZDT A;  5IP4 D;  1C77 A;  1C1Y B;  4MAC A;  3BVG A;  3TUO A;  4RGN A;  2KTR B;  4W9D A;  1D5Z C;  4WQM A;  1NI2 A;  4M8M A;  1C4A A;  1SE3 A;  1RYJ A;  2QIE B;  4C56 C;  2ZZP B;  4JGH B;  4IM2 A;  1QZE A;  2JYT A;  3L08 A;  2QCZ A;  2L76 A;  2KO3 A;  3PZ8 A;  5CX3 A;  3RYT A;  3BYT B;  3E9S A;  2MW5 A;  2GI9 A;  4A90 A;  1J8C A;  2REX A;  3C8Y A;  1HTQ A;  2NCN A;  1V1P B;  3AV8 A;  3UGB B;  4RGT A;  3DVG Y;  3IVF A;  1VR9 A;  2JX5 A;  2DAJ A;  2I2Y A;  4NQK E;  1MG4 A;  4ANV A;  5G5H A;  4GSW A;  1ZGU B;  3CST A;  4MGZ E;  4B0E A;  4XGA B;  4LNN A;  4ZYN A;  3KLS X;  1JRU A;  3NZS A;  2EKE C;  3KUC B;  1WGK A;  3EEC A;  1VZ6 A;  1JWB D;  2L7R A;  2KQ4 X;  4BFR A;  4GLS C;  1J0G A;  1P1A A;  1HQR D;  4UDU C;  1T0Q C;  1S3S G;  2DAF A;  2JSV X;  1X1M A;  4USA A;  4FLH A;  3V3X A;  1UEL A;  4MJS A;  2NBU A;  3N3K B;  1ZXH A;  3X23 A;  4GB9 A;  3VVW B;  4W9J A;  2JZ3 B;  2BYE A;  3PRM B;  3NJT A;  2J4X A;  3M3J A;  2LGX A;  2MBQ A;  4AQ7 A;  3GZN B;  4K7U A;  2N0S B;  3N20 C;  4MM3 A;  2QEJ C;  3DVG X;  2D3A A;  3EC8 A;  1JQ4 A;  2Y5P A;  2CHW A;  2KWU B;  3ETR A;  4P16 A;  4IW0 A;  4DHZ B;  2WXG A;  3DBL B;  4KIK B;  1SE4 A;  4G0N B;  4W9I A;  5DPW A;  3QIJ A;  1TT5 B;  4GMV A;  3LYY A;  1NI3 A;  2K9X A;  3DBL I;  5LXH A;  3L10 B;  2XBB C;  3ZNI D;  3UQA A;  2KDE B;  4W9G A;  2HDE A;  2O6V B;  1E5W A;  3Q8A A;  1R4N I;  3URY A;  2MBB B;  3A33 B;  1WX7 A;  2GOW A;  2L05 A;  5EE3 A;  4YXD B;  3NVY A;  1KM7 A;  2N7J A;  3MHS D;  4KKI A;  4WJP A;  3WAP A;  3CMM B;  2LXC A;  1K53 A;  1TS2 A;  1LO5 D;  3H6N A;  4HEA 1;  4EZK A;  2K0P A;  3AU4 A;  2BS2 B;  1XEE A;  2OJW A;  1QOB A;  3B2F A;  1CK1 A;  4W9E A;  1B1Z A;  1L4D B;  2IO0 B;  1T6B X;  1WFY A;  5BMI A;  2CKH B;  1K8R B;  1GB4 A;  5GXG B;  2MEK A;  2QJL A;  4S17 A;  2D07 B;  2BKR B;  2PEA A;  3GB1 A;  2DYM A;  1MHH E;  2K6Q A;  1CJE A;  2FIF A;  3WA0 A;  2PE9 A;  2HTH A;  3RT3 B;  4MH0 E;  2GBM A;  2V4I B;  1V1O A;  1ZP0 B;  3UI3 A;  3AEE B;  3QC8 B;  4LNO A;  2N9X A;  5L95 C;  3ONS A;  2RDG A;  3V61 A;  1GB1 A;  1C3T A;  1T0R C;  5JHB A;  1I4R A;  2CU1 A;  1GTH A;  2LGS A;  1KF6 B;  3HM6 X;  2IDY A;  2LJ5 A;  3W5U B;  2LVQ A;  2DZI A;  1VDV A;  4HPP A;  1SIJ A;  3DBR B;  2RR9 A;  2DBY A;  4C80 A;  3SR6 A;  4BBN F;  3AUL A;  1RWS A;  2D3B A;  4IM3 A;  2WGS A;  1RAX A;  1F9J A;  3BVM A;  2NTT A;  1SIF A;  4YSZ B;  3N30 A;  3LJ3 A;  4ACF A;  1AN8 A;  4RMA A;  4ANW A;  5FKA C;  4YSX B;  1VZ8 A;  4FJZ A;  1YQ3 B;  2KHW B;  3RZF A;  3VHT C;  3VUY A;  4DK5 A;  3J9C A;  2L83 A;  3L0W B;  1Z2M A;  1WRI A;  3R2T A;  1F1H A;  1N6Z A;  4KX6 B;  2CU3 A;  1GG3 A;  4MEL A;  1ET6 A;  1TS5 A;  1ZDX A;  4WQO B;  2FUG 1;  2BT6 A;  3QAQ A;  2KWD A;  2MBH A;  2LZ6 A;  1WGR A;  5IN7 A;  3PO0 A;  4JQW C;  1L6V A;  3SEB A;  2KXJ A;  4ARC A;  4RH6 A;  1Y56 A;  4B9K A;  2BPS A;  3FIL B;  1GC7 A;  1WH3 A;  2WDT B;  2WXK A;  4EE2 A;  1KLG D;  2INP E;  2M1M A;  2KTR A;  4FA6 A;  1IYF A;  2PTL A;  2TSS A;  4B95 A;  3OJ3 A;  3AEB B;  2WS3 B;  4XZ4 A;  1GTE A;  3Q6B A;  4KGT A;  2R2Q A;  2PKO A;  2IO2 B;  4OW0 A;  3A9K B;  1JWS D;  3AE5 B;  3IFW B;  4ASW C;  2MA9 B;  4MGI E;  4RF0 A;  2R2O A;  5J17 A;  2AQ1 B;  2WDV B;  1L4Z B;  1MG8 A;  1SJH D;  4NZL B;  2H89 B;  2PW9 A;  1DYQ A;  3U52 E;  2MP2 B;  3L16 A;  4ZYS A;  2JRH A;  2KMM A;  4I6P A;  1GT8 A;  4FAD A;  4JX1 C;  4TV3 A;  3BZD B;  1PFD A;  2HD5 B;  4L1B A;  4E3C A;  3M62 B;  2KKC A;  4LK0 M;  1JRO A;  3MTN B;  1E90 A;  3R8B A;  4N59 A;  1T5X D;  1GC6 A;  1C79 A;  5HFY A;  5IA7 A;  5JXV A;  1TTN A;  3KWV A;  4WJO A;  1Q5W B;  3VDZ A;  2LRU A;  2BW2 A;  2K1F A;  4MSQ B;  1WR6 E;  2SAK A;  4YTN B;  1I7H A;  4GDL B;  2V9H A;  3A9J B;  2KDB A;  5D94 A;  5JH5 C;  4OZB A;  1FIQ A;  2LHD A;  1YQ4 B;  1UBI A;  1HZ6 A;  2LGD A;  4W9F A;  1AYF A;  1DOX A;  4PYU A;  3NVV A;  1HA5 A;  3R66 C;  1A70 A;  5CHV C;  1WGY A;  1FXI A;  4OVU A;  2AL3 A;  1QF6 A;  5C23 A;  3UIN B;  1GPX A;  4KIK A;  2WXO A;  2L32 A;  3DHH C;  3QJZ A;  2IGD A;  4BKT A;  2NMQ A;  2N9E B;  3PPA A;  2C7H A;  3NVW A;  3LDZ E;  4WAF A;  3WIM A;  3DQV A;  3NVZ A;  5E6P A;  2KTF A;  3ZXR A;  3P63 A;  2MQJ A;  3PT2 B;  3D32 A;  2UYZ B;  2LRW A;  4XDD A;  4GXB A;  3DVN U;  2FID A;  5T8I A;  2WXI A;  2O6V A;  3Q3J A;  5TSS A;  5BYR A;  2ZCB A;  1FNV A;  1BT0 A;  1SSN A;  3ZUN A;  1LGR A;  2XNA C;  1E8Y A;  3EUB 2;  5E6J A;  4DBG A;  4GU2 A;  4LNF A;  2O2V B;  2NPT B;  1QOF A;  2HJ1 A;  1V6E A;  3NZU A;  3RZW C;  1WE6 A;  3DHG C;  4K7W A;  3GE3 C;  1XXG A;  1JCK B;  2NR2 A;  1UD7 A;  1XCQ L;  2N9L A;  1N60 A;  3AED B;  2IY0 B;  5E6N A;  1SE9 A;  2K25 A;  3ZRF A;  1YN3 A;  1ISN A;  4FUL A;  1WM3 A;  1I35 A;  2J42 A;  1GAQ B;  1EU3 A;  3VTV A;  2RMM A;  1WGH A;  2J7Q B;  1WXA A;  1OEY A;  2PJH A;  5GMV A;  3ML8 A;  2Y3A A;  1TZO A;  2WXF A;  3AE1 B;  3Q3O C;  1F77 A;  4ZOH C;  4L23 A;  3IT6 B;  3L13 A;  3I9V 1;  2W82 A;  1YJI A;  5AUI A;  2PVG C;  1FFV A;  4KVG B;  5HI1 A;  4DDI D;  1F52 A;  2K8C A;  3JSV B;  2OHF A;  2NBW B;  2KWC A;  2GBR A;  3QAR A;  2WDR B;  1WSP A;  2ZW1 A;  4IWO A;  1FRR A;  5BMG A;  3AU5 A;  4IUM B;  4AUQ C;  3MJ5 A;  3AMZ A;  1NVI D;  2QMT A;  3SFE B;  4RNA A;  1T3Q A;  3B1L X;  1QOA A;  2BQQ A;  2YLM A;  4OZC A;  4ZRP A;  4MGY E;  2BYT A;  3KYC D;  3N1X C;  3VUX A;  2B3A A;  1TKY A;  3ML9 A;  1I42 A;  2IO3 B;  3QCA A;  1I4P A;  4C7Z A;  5C2T B;  2PVO D;  2JT4 B;  1MJD A;  4GDK B;  4XWW A;  4CYE A;  4C7Y A;  2C60 A;  1XO3 A;  3W1S C;  3VTU A;  4K81 A;  2OOB B;  3ZJT A;  2KDI A;  1VCB A;  4W9L A;  2DZJ A;  3T9L A;  2MX2 A;  3VTW A;  3RCZ A;  2WU5 B;  1WGD A;  5IKC M;  4ITK A;  3N32 A;  4OVV A;  2MBO A;  4TKN A;  3UIP B;  3FIL A;  4XDC A;  4D2K A;  2BWE S;  3BII D;  2AQ2 B;  3Q8E A;  2FAZ A;  2HJ8 A;  1L5P A;  5G2N A;  3A4S C;  4OVZ A;  2NTS A;  3CIR B;  1FPY A;  4RGM A;  5DPR A;  4LJP B;  2GBK A;  3IAM 1;  4IOI E;  3JYU A;  1STE A;  3PV1 A;  4HLE A;  1IBX A;  2WQY B;  2I1K A;  3A9K A;  4WUR A;  4XX5 A;  2GBJ A;  5G55 A;  3L17 A;  5EE1 A;  1PQS A;  4B6W A;  1KJT A;  2J52 A;  3BIN A;  4PS3 A;  2KWV B;  4N58 A;  1S1Q B;  4KDI C;  2Z0D B;  1WJ6 A;  1ZXI A;  3X0W A;  4KSK C;  1WI0 A;  3H7P B;  1FRD A;  2D3G A;  2ZEQ A;  2MP2 A;  2MSE D;  3ALB A;  3Q8B A;  2VRR B;  3N9Y C;  2WLB A;  1SBB B;  2KVZ A;  2LI5 A;  2KLG A;  3U7D A;  4E71 A;  2W3S A;  3JVZ X;  4DXA B;  1WJN A;  2PPH A;  1WX9 A;  4YL8 A;  1UBQ A;  1OTR B;  2ACZ B;  1QQR A;  2N9P C;  2BYV E;  3P4S B;  1WJU A;  2I38 A;  2K39 A;  3ECI A;  3I57 A;  4JLC A;  5J2R A;  2GMI C;  4W9K A;  4BKG A;  4GDL A;  1N63 A;  1WYG A;  4XE0 A;  1HZ5 A;  1LQB A;  4P7I A;  2G45 B;  4PS7 A;  4MDK E;  2EMS A;  5IOI A;  1EF1 A;  3AE7 B;  3DHI C;  2WXH A;  2L52 A;  1ZDV A;  2CHZ A;  1LM8 B;  1R4N B;  3W9C B;  2LVP A;  4HJG E;  1VZ7 A;  1L6U A;  4LNI A;  2G9H D;  3NRZ A;  4QAY A;  2M0X A;  4M01 A;  4PS8 A;  2EMT A;  4A20 A;  1KH0 A;  1YNT E;  4GGQ A;  1FCC C;  2M56 B;  4ZDV A;  1IGD A;  3HHM A;  2ON8 A;  1LFD A;  3PTF C;  3ZXV A;  1IP9 A;  1SGH A;  3ZJV A;  4IKG A;  5FR3 A;  4YWG G;  2IGG A;  4US9 A;  2RD0 A;  2IZV B;  2M4N A;  4A3O A;  1XF5 L;  2L0F A;  2BS4 B;  3H8H A;  3Q8F A;  4RF1 A;  1N5W A;  2UU7 A;  2D11 A;  3H1U A;  2NS5 A;  4HCN B;  2I1J A;  4MEM A;  1AW7 A;  2NPT A;  4DQO C;  2JXX A;  2KAN A;  2PMV A;  3Q3F A;  3PRP B;  3KH0 A;  3U7Z A;  2N1V A;  4JIO U;  3H9D A;  1WMH B;  1TY2 A;  1IPG A;  3CSF A;  3R3M A;  1QIL A;  3APC A;  4WJN A;  4XC2 A;  2HE7 A;  3HRD D;  2ZNV C;  1EF5 A;  2ZPY A;  2IPK D;  2ZCC A;  1D5X C;  3MC0 B;  2JQR B;  2N7E A;  2WYQ A;  3PHW B;  3P4Q B;  2NBV B;  3WCQ A;  2H88 B;  3B9J A;  3P4R B;  4ZRJ A;  1JRP A;  1D3Z A;  4DXG A;  1KLU D;  1TGZ B;  1I4Q A;  4YTM B;  3SDL C;  3RNE C;  1VLB A;  4A8X C;  3Q8C A;  3KW5 B;  3ZW3 A;  3A1Q B;  4PYZ A;  1GNU A;  4YSY B;  2LUM A;  3ZRC A;  3UQB A;  2JVC A;  4URK A;  2CR5 A;  4J6I A;  5MPO A;  2WXJ A;  2KT7 A;  3PVL A;  4DWF A;  1J7B A;  1DOY A;  3AN1 A;  3RPF C;  2BKF A;  2WXL A;  1HXY D;  4NAW B;  4LNK A;  1R4M I;  3IG3 A;  2CJO A;  3O13 A;  2FUH B;  4OZA A;  5H92 C;  3U30 A;  3PGE A;  1WM2 A;  3DVN V;  4FJV B;  2Y5B B;  4PT5 A;  4RM8 A;  1K50 A;  4DXF A;  2GRI A;  2AYO B;  2INC C;  4GDK A;  1P9D U;  2BYF A;  4HPM B;  2ZVN A;  3GOE A;  1SJE D;  4LLG M;  2KVR A;  3W5V B;  2KD0 A;  2WXP A;  3VRA B;  2V3S A;  4W9C A;  2VH1 A;  1T0Y A;  2J0J A;  2KZR A;  4ANU A;  1J19 A;  1V2Y A;  4CHK A;  3ENE A;  2LGI A;  1TYG B;  1WY8 A;  2BWF A;  4NJ6 A;  2LEK A;  4WWO A;  3AEF B;  2PE6 B;  1WYW B;  4ICU A;  1V1P A;  1UNS A;  3DBH I;  1GJZ A;  4K3C A;  2QHO A;  4X57 B;  4DHJ D;  3ZYY X;  3NS8 A;  2KJ6 A;  3CWI A;  3GP7 A;  3EA6 A;  1L2N A;  2FNJ B;  2FCN A;  3JW0 X;  4M00 A;  2INN E;  3NZ3 A;  1YD8 U;  1M4V A;  1UWX A;  4BOZ B;  4KGR A;  4FHK A;  2PIA A;  2CS4 A;  2W55 A;  1KOT A;  1PYW D;  3AXC A;  1UWM A;  4FN2 A;  2C7N B;  1UUP A;  3PRZ A;  3H7P A;  5KHQ A;  3DWG C;  4KV2 A;  1E8X A;  2EKI A;  4H2A A;  3T3N A;  1NYQ A;  3OLM D;  2G4S A;  1ROE A;  2DZM A;  2X8X X;  3WAL A;  2JUO A;  4A6Q A;  4NQL B;  3AE4 B;  2BBC A;  2MJE A;  5EE9 A;  4BKS D;  2ASQ A;  1KRH A;  3H7S A;  3NUH B;  4BOS C;  4US8 A;  1C76 A;  4HWI B;  1WWT A;  2KN4 A;  5H8Y E;  5JZE B;  1UGJ A;  4LCD E;  2C5L C;  3O65 B;  1YJ1 A;  1WIA A;  3M63 B;  2J53 A;  1E9M A;  3SHQ A;  3TBL D;  4GOC A;  5J18 A;  5D6J B;  2IGH A;  1N61 A;  4G50 A;  3RNG C;  3ZTD A;  2K8H A;  4KSL C;  2KN5 A;  4FXC A;  1YN4 A;  3P4P B;  1JW9 D;  4S0R A;  1J7C A;  3QWZ B;  4RGO S;  3VR8 B;  4JL9 A;  1D6E C;  4MT5 A;  2L0T A;  2BGF A;  5D3D A;  4K3B A;  1L0X B;  5I4D A;  4BZA A;  4MGK E;  2WU2 B;  4IG7 B;  5EDS A;  1WE7 A;  5LXI B;  4TUU A;  3ABV B;  1FD6 A;  3BWU D;  2N1W A;  1P7E A;  2RPV A;  4KZ0 A;  2IO1 B;  1UGM A;  1OQQ A;  5BYS A;  2C9W B;  2KAJ A;  2QIL A;  3DPD A;  3I5J C;  4YTP B;  1IUE A;  1PDX A;  1HEZ E;  1WXV A;  3IHP C;  4TSS A;  3P2B A;  2ZJD A;  2OED A;  3VQI A;  2IJ0 A;  1WMH A;  2DLB A;  2MHJ A;  1TS3 A;  1FNW A;  3Q69 A;  2K3U A;  3U8Z A;  1YOV B;  2N7D A;  2ICI A;  4AP4 C;  2IND C;  1ZW7 A;  1TIF A;  2JWZ A;  3T3O A;  1NEK B;  3ZNZ B;  1UZX B;  4II3 B;  4FJY A;  1SF0 A;  2GBN A;  2LUE A;  4LTU A;  1OFF A;  1E7U A;  4ARI A;  1B9R A;  4ZRI A;  4KZC A;  1C4P A;  1WXS A;  3WAO A;  2WWZ A;  3SFD B;  4EUT A;  2JYE A;  1BUI C;  4L2Y A;  4G3X B;  1P0R A;  3HVD A;  1FCL A;  3A1Q A;  2KJR A;  3W1Y A;  1UF0 A;  1M94 A;  3R2I A;  2BS3 B;  3B2G A;  2ZPN A;  5BYQ A;  2ONQ A; 
#chains in the Genus database with same CATH homology
 2WXH A;  3ZGZ A;  2L52 A;  3EGR A;  3J9C A;  2L83 A;  1ZDV A;  3R2T A;  1WRI A;  4AS1 A;  4KX6 B;  1I4G A;  3W9C B;  2CU3 A;  1YN5 A;  1H7W A;  1ET6 A;  1TS5 A;  1ZDX A;  1CZP A;  2YEP F;  1ZUD 2;  2FUG 1;  2BT6 A;  4HJG E;  2KWD A;  1VZ7 A;  2M19 A;  1C9F A;  3PO0 A;  2WXM A;  3HVZ A;  1L6U A;  2E3T A;  1L6V A;  3BK2 A;  2G9H D;  3NRZ A;  5LNK 1;  3SEB A;  4ARC A;  2D5G A;  2LMC A;  4TQ0 A;  1E0Z A;  4JE3 B;  1KH0 A;  4RH6 A;  1Y56 A;  1YNT E;  5HG2 A;  3FIL B;  5C3J B;  1FCC C;  2M56 B;  3NS1 A;  2JU6 X;  1IGD A;  2WXK A;  2ON8 A;  4EE2 A;  1KLG D;  2WXN A;  1VJK A;  1DGJ A;  1VRA B;  1XLQ A;  2INP E;  1KTK A;  1EWC A;  3ZJV A;  3CF4 A;  1I4H A;  4IKG A;  2IGG A;  4YWG G;  4US9 A;  5FR3 A;  1QT9 A;  1F0Z A;  2PTL A;  4JWU C;  1ZOY B;  2TSS A;  1RFK A;  4NJC A;  5BMH A;  1XF5 L;  3AEB B;  4WWM A;  2BS4 B;  3H8H A;  4TMA B;  2WS3 B;  3Q8F A;  4RF1 A;  1MPE A;  1P7F A;  1N5W A;  1QOG A;  3ZJU A;  1GTE A;  3BVZ A;  2BB5 A;  4KGT A;  2BTE A;  2L1A A;  3MFG A;  1E7P B;  3AE6 B;  2PKO A;  2FE8 A;  1SB3 C;  4OW0 A;  1N62 A;  1L0Y B;  1AW7 A;  4HRO A;  3AEC B;  4IDI A;  4M0W A;  4DQO C;  2PMV A;  5HHD G;  3U7Z A;  1GOZ A;  2DWQ A;  1JWS D;  3AE5 B;  1TY2 A;  4ZHP A;  3TEX A;  4RF0 A;  1I4X A;  1TKG A;  2AX5 A;  1QIL A;  1V8C A;  2AQ1 B;  4KKJ A;  2WDV B;  2Z8L A;  1L4Z B;  1SJH D;  3HRD D;  4NZL B;  2H89 B;  2PW9 A;  2M0A A;  4KGS A;  3U2S C;  1D4B A;  1DYQ A;  3U52 E;  2IPK D;  4ZYS A;  1D5X C;  2KMM A;  3TEY A;  2KAC A;  3MC0 B;  4Q2J A;  1GT8 A;  2JQR B;  4R3D A;  4JX1 C;  1BXT A;  3AE9 B;  1NYR A;  1XLN A;  3BZD B;  3P4Q B;  1PFD A;  1XLO A;  4L1B A;  3WCQ A;  3L4P A;  2H88 B;  3B9J A;  3P4R B;  1MI0 A;  3FC4 A;  4ZHO A;  1JRP A;  4LK0 M;  4OHJ A;  1CQV A;  1JRO A;  1V97 A;  2VZK D;  2DYO A;  4DXG A;  4HKZ E;  1KLU D;  3TEZ A;  1I4Q A;  1D5M C;  3R8B A;  4N59 A;  4YTM B;  1T5X D;  2ZW0 A;  5HFY A;  1C79 A;  1MVK A;  4J3O D;  5JXV A;  4A9A A;  3KWV A;  1VLB A;  1E6E B;  4A8X C;  1OQR A;  3Q8C A;  2RDH A;  2BW2 A;  2B76 B;  1QLB B;  2SAK A;  3LB8 C;  4YSY B;  4YTN B;  1I7H A;  4GDL B;  2LUM A;  4YT0 B;  2LHE A;  1FNU A;  4OZB A;  5MPO A;  1FIQ A;  2LHD A;  1YQ4 B;  2WXJ A;  1Q10 A;  1HZ6 A;  2PLP A;  3PZ7 A;  1J7B A;  5D3I B;  5EE0 A;  3AE2 B;  1AYF A;  2JXT A;  2N9K A;  3AN1 A;  1C4C A;  3NVV A;  2WXL A;  4XWT A;  5G5G A;  3RPF C;  2K5P A;  1HA5 A;  1HXY D;  1A70 A;  3AE8 B;  4NAW B;  4O1N A;  2CJO A;  3O13 A;  1SE2 A;  4TQ1 A;  1EU4 A;  1FXI A;  1SXT A;  1R7S A;  4OZA A;  5H92 C;  1QF6 A;  1GPX A;  2WXO A;  4PT5 A;  1MHX A;  4DXF A;  1K50 A;  2GRI A;  2L32 A;  3IAS 1;  3LXF A;  2IGD A;  1F2R I;  5AUK A;  2CJN A;  1KFY B;  2NMQ A;  2W3R A;  1ACC A;  4B0M A;  1ESF A;  3NVW A;  1C77 A;  4WAF A;  1SJE D;  3NVZ A;  4LLG M;  4MAC A;  3BVG A;  1J7A A;  3TUO A;  3W5V B;  3P63 A;  4RGN A;  1YJJ A;  2WXP A;  1D5Z C;  4WQM A;  1C4A A;  4XDD A;  3VRA B;  1SE3 A;  1RYJ A;  5T8I A;  2QIE B;  2WXI A;  4C56 C;  3KQ4 A;  4MH8 A;  1F2R C;  5TSS A;  5BYR A;  1FNV A;  1SSN A;  2JYT A;  2XNA C;  4CQN A;  2R61 A;  3EUB 2;  2LGI A;  1TYG B;  5E6J A;  2LEK A;  3AEG B;  3PZ8 A;  3TEW A;  3AEF B;  4RCO A;  1FO4 A;  3OWE B;  1QOF A;  3BYT B;  3E9S A;  2GI9 A;  1JWM D;  4A90 A;  1YMH E;  3MP9 A;  1DOI A;  3C8Y A;  1V1P B;  4WH4 A;  3AV8 A;  2K22 A;  1XXG A;  1JCK B;  1V1P A;  1UNS A;  1XCQ L;  2N9L A;  1N60 A;  2WXQ A;  4RGT A;  3HUI A;  3AED B;  1WXQ A;  1VR9 A;  2JX5 A;  2I2Y A;  3IXS A;  1YN3 A;  1SEB D;  3ZYY X;  2X38 A;  1TKE A;  1EM7 A;  5G5H A;  2J42 A;  1GAQ B;  1EU3 A;  3GP7 A;  3CWI A;  2GB1 A;  3EA6 A;  4B0E A;  2RMM A;  3P42 A;  2INN E;  3NZ3 A;  3KLS X;  2XN9 C;  2Y3A A;  1TZO A;  1M4V A;  1FM0 D;  1UWX A;  2WXF A;  3AE1 B;  1XCT L;  1F77 A;  4KGR A;  4ZOH C;  4L23 A;  1WGK A;  2G1E A;  2LFI A;  2PIA A;  1VZ6 A;  1JWB D;  3IT6 B;  2W55 A;  3I9V 1;  1JAL A;  2KQ4 X;  1YJI A;  2W82 A;  1PYW D;  5AUI A;  3MHZ A;  4GLS C;  2PVG C;  1DOX A;  2WP9 B;  1FFV A;  1L0V B;  1FXA A;  5HI1 A;  1HQR D;  4UDU C;  3VR9 B;  1UWM A;  2YEP B;  3V05 A;  3DWM A;  2OHF A;  2JSV X;  2WDQ B;  4USA A;  3V3X A;  1UUP A;  1ZXH A;  1ZPS A;  2WDR B;  1WSP A;  2WXR A;  2ZW1 A;  3AB5 A;  1DOY A;  3DWG C;  2EKI A;  4H2A A;  1FRR A;  5BMG A;  1JWU D;  2J4X A;  3T3N A;  4AQ7 A;  3W1S A;  1NYQ A;  3MJ5 A;  1TJE A;  3AMZ A;  1NVI D;  1ROE A;  3BK1 A;  2N0S B;  4N6E B;  2QMT A;  1ET9 A;  2KDM A;  3SFE B;  4RNA A;  1T3Q A;  2QEJ C;  3GS2 A;  4NAM A;  1QOA A;  2V3N A;  4JWS C;  1JQ4 A;  4A6Q A;  4OZC A;  4ZRP A;  1ZE3 D;  3AH7 A;  3U4E G;  3AE4 B;  2BBC A;  2Y5P A;  2BYT A;  1FFU A;  3ETR A;  4P16 A;  1JML A;  2MJE A;  2MJD A;  1AWD A;  2WXG A;  5EE9 A;  2JWU A;  1TKY A;  2JZP A;  1KRH A;  3FAH A;  3NUH B;  4US8 A;  2E6X A;  1SE4 A;  4JPS A;  1C76 A;  1I4P A;  1K52 A;  1WWT A;  1FEH A;  2KN4 A;  3IT4 B;  4C7Z A;  5H8Y E;  5C2T B;  2W54 A;  1H7X A;  4WIP A;  2PVO D;  1UGJ A;  2MJ3 A;  4GDK B;  4XWW A;  4C7Y A;  3LYY A;  1XO3 A;  1NI3 A;  2K9X A;  1TY0 A;  4RFB A;  2J53 A;  1E9M A;  2BB6 A;  5D7G A;  3AE3 B;  2V3P A;  2IGH A;  1N61 A;  3ZJT A;  1E10 A;  2FBW B;  4FXC A;  2AQ3 B;  1YN4 A;  2V0G A;  2HDE A;  3P4P B;  1JW9 D;  2Y5C A;  3Q8A A;  1J7C A;  2WU5 B;  1XLP A;  2SEB D;  4RGO S;  1JWA D;  3URY A;  3VR8 B;  5EE3 A;  4YXD B;  3NVY A;  4ITK A;  2N7J A;  1D6E C;  4KKI A;  4MT5 A;  1K53 A;  1TS2 A;  1LO5 D;  3KWL A;  2WNM A;  1PUT A;  3FIL A;  4HEA 1;  5D3D A;  1IGC A;  1K51 A;  1L0X B;  4XDC A;  2K0P A;  5I4D A;  4D2K A;  2BS2 B;  1XEE A;  1C78 A;  3BII D;  2WU2 B;  1QKZ A;  1QOB A;  2AQ2 B;  3B2F A;  1PGB A;  3Q8E A;  3ABV B;  1CK1 A;  1PGX A;  1FD6 A;  1L5P A;  1B1Z A;  1L4D B;  3BWU D;  4HRS A;  1T6B X;  1P7E A;  5BMI A;  4OVZ A;  1GB4 A;  2RPV A;  2NTS A;  3CIR B;  5GXG B;  2MEK A;  2VZK B;  2MH7 A;  4RGM A;  2QJL A;  3AM9 A;  1OQQ A;  5BYS A;  2KAJ A;  3GB1 A;  3IAM 1;  2QIL A;  2DYM A;  4YTP B;  1MHH E;  4IOI E;  1IUE A;  1CJE A;  1HEZ E;  1PDX A;  1STE A;  1IBX B;  1EWY C;  4ZRQ A;  4HKQ A;  1IBX A;  3AEA B;  2HTM E;  4TSS A;  2WQY B;  4P6V F;  4WUR A;  2OED A;  2V4I B;  1V1O A;  1ZP0 B;  3UI3 A;  3VQI A;  3AEE B;  2IJ0 A;  1TS4 A;  1N5X A;  2DLB A;  2EEL A;  5EE1 A;  1ENF A;  1TS3 A;  2J52 A;  2RDG A;  1FNW A;  1GB1 A;  3P1M A;  4REZ A;  3Q69 A;  5FK9 C;  2K3U A;  1I4R A;  3E56 A;  2ICI A;  4N58 A;  2Q5W D;  1GTH A;  1KF6 B;  1ZXI A;  2IDY A;  3W5U B;  1FRD A;  3T3O A;  1VDV A;  3Q8B A;  3VRB B;  1NEK B;  3N9Y C;  3TSS A;  2WLB A;  2LJI A;  1SBB B;  1SF0 A;  3BYY B;  1SIJ A;  4LTU A;  1OFF A;  2DBY A;  2W3S A;  1RM6 C;  4C80 A;  4ARI A;  1B9R A;  3SR6 A;  1PGA A;  1RWS A;  4A55 A;  4MM3 B;  1C4P A;  2ACZ B;  3SFD B;  1QQR A;  2JYE A;  1BUI C;  3BVM A;  4L2Y A;  2NTT A;  3P4S B;  2QSD A;  2I38 A;  3HVD A;  4YSZ B;  1FCL A;  3I57 A;  3RFZ B;  3W2D A;  3ZQ4 A;  1N63 A;  1WYG A;  4XE0 A;  3R2I A;  1AN8 A;  1HZ5 A;  2BS3 B;  3B2G A;  5FKA C;  4YSX B;  1BML C;  5BYQ A;  1VZ8 A;  1NEN B;  1YQ3 B;  1FMA D;  3AE7 B;  2ONQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...