3VR9B

Mitochondrial rhodoquinol-fumarate reductase from the parasitic nematode ascaris suum with the specific inhibitor flutolanil
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
249
structure length
249
Chain Sequence
KRIKTFEIYRFNPEEPGAKPKLQKFDVDLDKCGTMVLDALIKIKNEVDPTLTFRRSCREGICGSCAMNIAGENTLACICNIDQNTSKTTKIYPLPHMFVIKDLVPDMNLFYAQYASIQPWLQKKTKINLGEKQQYQSIKEQEKLDGLYECILCACCSASCPSYWWNADKYLGPAVLMQAYRWIIDSRDDSAAERLARMQDGFSAFKCHTIMNCTKTCPKHLNPARAIGEIKMLLTKMKTKPAPLPTPAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Flavoprotein subunit of complex II
publication title Crystal structure of mitochondrial quinol-fumarate reductase from parasitic nematode Ascaris suum
rcsb
total genus 55
structure length 249
sequence length 249
chains with identical sequence F
ec nomenclature
pdb deposition date 2012-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 3vr9B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3vr9B01
3VR9B 2WU2B 1XLOA 2PIAA 1GT8A 3WCQA 3P4PB 1PDXA 2MJEA 1XLNA 3NVZA 3W5VB 5C3JB 1JW9D 3B2FA 2DWQA 1FFVA 4KX6B 1QOBA 1TJEA 1SIJA 1JALA 1N63A 1RYJA 3P4QB 1ZXIA 3CWIA 4FXCA 1DGJA 3NS1A 4C80A 3CF4A 2KAJA 1J7CA 2MH7A 4ITKA 1FFUA 1UWMA 1KFYB 1RWSA 2L83A 2W55A 1E7PB 4C7ZA 3AE9B 1WYGA 2W3RA 1DOYA 3ETRA 1XLQA 2WP9B 2BT6A 3DWMA 4N59A 3W5UB 1CJEA 2CU3A 1L6UA 3P1MA 5EE3A 5AUKA 3AB5A 1F0ZA 2KMMA 5EE1A 1VJKA 3W9CB 1A70A 1I7HA 1L6VA 1ZOYB 3P63A 1JQ4A 2M56B 2QJLA 5GXGB 1PUTA 1QT9A 3HUIA 3NVYA 3HVZA 5H8YE 1B9RA 1WRIA 2ACZB 2K5PA 2MJDA 4JX1C 1FRRA 1AWDA 4LTUA 2PVOD 1E10A 2H89B 1ZP0B 3SFEB 4YTMB 1NYQA 2CJOA 2BS4B 1NENB 2W3SA 5EE9A 3AN1A 2MJ3A 4HRSA 1ROEA 1FO4A 4US9A 1L5PA 1NVID 4USAA 1DOXA 1GPXA 5H92C 1RFKA 1H7XA 1N60A 3SR6A 1VDVA 1OQRA 3KWLA 5G5HA 1N62A 1NI3A 1AYFA 3NVWA 2PKOA 1IUEA 5C2TB 1T3QA 1V8CA 5MPOA 1YJJA 3VRBB 2K22A 2BS2B 1JWBD 1E9MA 3AEGB 1OFFA 1QOAA 1DOIA 2BS3B 1PFDA 3AMZA 2WDQB 1L0VB 2H88B 4JWSC 1GAQB 2G1EA 4N6EB 1QOGA 1FM0D 3AE1B 1TKGA 3CIRB 1TKEA 2Q5WD 3HRDD 2WU5B 1FXIA 3RPFC 4P6VF 1TKYA 1V97A 3AE5B 2M19A 1EWYC 1OQQA 3LB8C 3AE4B 3AEEB 3FC4A 4IDIA 2DBYA 3NVVA 3P4SB 1WGKA 3AH7A 1KF6B 3AEDB 4ZHPA 1E0ZA 2WLBA 2W54A 3SFDB 1XO3A 3AE8B 1H7WA 4YSXB 1SB3C 2PVGC 3ABVB 1ZUD2 2Y5CA 5G5GA 3AEAB 2N0SB 3BIID 4US8A 1YQ4B 1CZPA 1FMAD 1VLBA 3VRAB 3B9JA 1WXQA 3PO0A 3AECB 3AE3B 4YSZB 2FBWB 3LXFA 2OHFA 3DWGC 4YXDB 1XLPA 1QOFA 1J7BA 3L4PA 1QF6A 4YSYB 2L52A 3AE7B 4HROA 1WWTA 2JQRB 3B2GA 4YT0B 1GTHA 3AE2B 2K9XA 1FXAA 2WDRB 3P4RB 1E6EB 1N5WA 2HTME 4JWUC 4WWMA 1N61A 1FIQA 1GTEA 1FRDA 2LEKA 3VR8B 4N58A 4WQMA 4ZOHC 1NYRA 2WS3B 3FAHA 1J7AA 2E3TA 1QLBB 3AEBB 3AEFB 1JROA 3ZYYX 3EUB2 1TYGB 2B76B 2WDVB 2QIEB 1JRPA 4A9AA 4YTPB 2AX5A 5EE0A 2EKIA 3AM9A 1RM6C 4C7YA 2JX5A 4ZHOA 3AV8A 1JWAD 2WQYB 1N5XA 1NEKB 3NRZA 1KRHA 1YQ3B 1R7SA 1YJIA 5AUIA 3AE6B 1SF0A 2CJNA 4YTNB
chains in the Genus database with same CATH superfamily
3VR9B 1V2YA 3WCQA 4CHKA 3VUXA 1ZE3D 2ICIA 4EE2A 3IHPC 4FADA 2WXRA 1MG8A 1TS2A 2AWTA 2YEPB 3N20C 4NZLB 2KNBA 4KSLC 4PYUA 1FFUA 4QAYA 3KH0A 2D07B 3ZJTA 3A9KA 1C4PA 1WM2A 2CU3A 1L6UA 4W9LA 3PT2B 4GOCA 3DBRI 4J3OD 3D32A 4WIPA 3OAWA 5DPWA 3DQVA 2V3NA 4RH6A 3PLVA 4MELA 1AYFA 4N9F4 1L0XB 4PS3A 5MPOA 1I4GA 1TS3A 4XDDA 2UU7A 2LASA 5D3DA 2JVCA 5D94A 1I4XA 3APCA 2BS3B 1WSPA 2M8SA 2N7DA 3AE1B 1C1YB 2I1KA 4EFOA 2INCC 1M4VA 4LLGM 1EU4A 3URYA 1EU3A 3RULA 3ZUNA 4IM0A 4LCDE 2NMQA 2JRIB 1SB3C 1ZUD2 3BIID 2CHZA 3VRAB 2KDMA 2YLMA 1SE3A 3VH4B 2FUG1 3L4PA 1XLPA 2J0JA 3QC8B 3AE7B 2JQRB 4XGAB 2BYFA 1H8CA 4FHKA 1R4MB 1YX6B 1LM8B 2WS3B 3W1YA 3ZJVA 3H1UA 3Q3NC 3QQ8B 3CSTA 4KZ0A 5JHBA 2WQYB 1KRHA 1P3QU 1TY2A 4NJ6A 5AUIA 3AE6B 4YTNB 3CF6E 1XLOA 3U52E 2JZ3B 3W5VB 2KTFA 1YX5B 4HVBA 1GB4A 4BKSA 2HD5B 2AEHA 2MH7A 3R2TA 5E6PA 4E3CA 3LDZE 2A5UA 1STEA 4URKA 1I4QA 2IY1B 1Y56A 4JPSA 2BYTA 3ZJUA 2PPHA 3NHEB 4JX1C 1WJNA 2H89B 1QQRA 1NENB 1UGJA 3ZW3A 2MBEA 1FNUA 4GGQA 1P7FA 2G4SA 2AQ3B 2N4FA 2DHZA 4HDOA 2QSDA 4HDQA 5J17A 2INPE 2G1EA 1R4NB 2KC1A 5FK9C 1XF5L 1JWMD 5DPTA 1OQQA 2LRUA 3AEEB 3FC4A 3ML9A 3AH7A 2RMMA 4IOIE 4OHJA 5IA7A 2V1YA 1KM7A 1FMAD 4YWGG 2ONQA 4E71A 1VD2A 2OOBB 5CHFA 4ANWA 2GBRA 4A6QA 4W9FA 4IWOA 3KQ4A 1BUIC 1SE9A 2TSSA 3C8YA 3SDLC 2WNMA 1IYFA 4MSMB 1JROA 2HJ1A 1SE2A 2AX5A 4C7YA 1ZDXA 1YQ3B 3GZNI 5G2NA 1H4RA 2BF8B 4HJKA 3NVZA 3U7DA 3DVGX 4FULA 3CWIA 5JHAA 3CF4A 4P1BC 5BYQA 1UH6A 4DHJB 2L00B 3ZTDA 5LXIB 1CJEA 2N7EA 4P1CC 2KMMA 2EELA 1A70A 4K7WA 2L1AA 2ZW1A 4RGMA 1B9RA 3VQIA 1WRIA 2ACZB 2XN9C 2D10A 2DYBA 1NYQA 2LRWA 1F2RI 1WZ0A 2QCZA 2KWUB 2Y5PA 1IUEA 4FJZA 3IXSA 4WQOB 4X57B 5AZGA 2MRPA 2KX0A 2K3UA 4MJSB 1OFFA 1EF5A 1OEYA 3VUYA 3AXCA 3MC9A 4IM2A 3VTVA 3I63C 2Q5WD 2JU6X 4LNOA 2N9EB 5FR6A 1V97A 2RDHA 2CKHB 1DYQA 2W54A 3GP7A 5KHOA 3WAPA 1YQ4B 2KWVB 2K1FA 4M01A 1BT0A 2PTLA 4HWIB 4B95A 2JXXA 5BMGA 2OHFA 4MJSA 2BGFA 2J0MA 3DBRB 4YSYB 2I38A 3QK0A 3AE2B 3DOWA 4JWUC 3RN9C 3L16A 3ZRCA 4EKUA 2LUMA 4S0RA 3TEZA 2DAFA 3EHVA 4ARIA 1T0RC 3TBLD 4MGZE 4MT5A 4K7UA 1E7VA 3IT4B 5HHDG 3V62A 2VRRB 2JYTA 2REXA 2GBMA 2NVUI 1DGJA 3I57A 4IKGA 1J7CA 1UZXB 1KFYB 3E56A 2W3RA 1C4AA 1FEHA 2BQQA 5EE1A 2FCNA 1UGMA 1CK1A 1TY0A 3BWUD 1JQ4A 2ZCCA 3SEBA 3Q8BA 2C5LC 2KMCA 3T9LA 1YOVB 3DVNU 3QAQA 3NG0A 2W3SA 2C7NB 4Q2JA 2MJ3A 2WXQA 5H92C 3TEWA 5JH5C 3DHHC 3ZKJC 2D11A 4RGTA 2KX3A 2PE6B 1EO6A 4ZRIA 1G6JA 5TR5A 5BMIA 1D3ZA 2JY6A 2O2VB 1HE8A 1QILA 3AE4B 3DCGA 3NVVA 4FJYA 1LQBA 3TMPB 2ZPYA 4OW0A 1MFWA 1GUAB 2DYMA 4EZLA 4NPNA 4YSXB 2Y5CA 4IWPA 4K7SA 4I6PA 3DBLI 4XDCA 2WXIA 2B3AA 1L7YA 2G4DB 1V49A 4DHJD 2L52A 4ASWC 4ANVA 3K9PB 1K50A 1GTHA 2LMCA 2KQ7A 3I9V1 3RI7C 5HKHA 2K39A 2O2VA 5FKAC 3H7SA 4JLCA 3ZTCA 1WY8A 3AULA 3OJ4B 3H8HA 3A9JB 1TKYA 1WJUA 3N9YC 1ZKHA 4LNFA 3SU8X 2Y3AA 5C3JB 3H6NA 1JW9D 1QOBA 4NAWB 1Q5WB 4CYEA 2VH2A 4DXGA 3NZUA 3NJTA 1SJHD 1YD8U 5BMHA 3MFGA 2CHXA 4LNNA 3AE9B 4FJVB 1K8RB 1KJTA 1XQQA 4HJGE 2G3QB 3W5UB 1D6EC 4S17A 1I7HA 4ANUA 2ZCBA 1TIFA 3SD5A 2GMIC 3A9JA 1LGRA 1SJED 3HVZA 4EUTA 1E5WA 5BYRA 2WDTB 2NBVB 1KLVA 3U30A 4NAWA 2KN4A 4A8XC 2G45B 2LVOA 2HJ8A 5IKCM 3NVWA 3JSVB 3C19A 2NR2A 4ZRKA 3QCAA 2WXLA 4KDIC 3AMZA 2IGHA 1WGYA 2H88B 2ZNVB 3L08A 3GZNB 2KO3A 3RPFC 4WWNA 4HK2A 1T6BX 4G11A 4WURA 1V86A 5GMVA 3MHSD 1ACCA 3T3OA 4KZCA 2D2QA 3JSVA 3IAS1 1XXGA 2DAJA 4TQ1A 3PO0A 2C7HA 3LXFA 2WX0A 2BPSA 2JPHA 3W2DA 4HPPA 4BOSC 1Q0WB 3QWZB 3GE3C 2NTSA 2BYVE 1YJ1A 4BBNF 4C56C 3UQAA 4XE0A 1JWAD 4MDKE 1HEZE 1UBIA 2M0AA 3WALA 1JALA 2QEJC 3OG5A 1M94A 2LHEA 3NOBA 3DHIC 1RWSA 2L83A 1E7PB 4OZBA 4BBNC 5EE3A 4B6WA 4L1BA 1UWXA 3RMKC 2IYDB 4JE3B 1HZ5A 1D4BA 2GI9A 3X23A 2JUOA 1I4HA 4EZKA 5CHVC 1BXTA 2PVOD 1RFAA 3W1SA 5IOIA 2AQ2B 3UINB 3AN1A 1BMLC 4US9A 1KLGD 4USAA 1JCKB 3PZDA 1HQRD 2L32A 2J53A 1YJJA 4O1NA 1WGRA 2K6QA 1WH3A 1DOIA 1WX8A 4ACFA 3Q8AA 3NUHB 2W9NA 1WYWB 1YN3A 4N6EB 2ZZPB 4W9IA 1TKEA 3A1QB 2WU5B 4LK0M 3U7ZA 3QJZA 1P0RA 1V80A 2WLBA 3SFDB 2MBOA 3ABVB 4MGYE 4NQLB 2BB6A 2NBUA 2J0KA 5BYSA 3UIPB 1ZDVA 2FCSA 1WE7A 2IO0B 4HROA 1WWTA 2FUHB 3TCAA 4IW0A 1MHHE 1CMXB 3A1QA 3KLSX 2GRIA 3RNGC 3EUB2 1YN5A 1MJDA 4REZA 2LJIA 1ZXHA 2QMTA 1AN8A 2VZKD 1ESFA 1ZGUB 4II2B 1E7UA 2N9PC 2LGYA 3RCZA 1A5RA 1GT8A 4GXBA 2OJRA 2DLBA 5JXVA 2C7MB 4FBJB 3MHZA 1XCTL 3RYTA 4AS1A 1V81A 2O6VB 2W82A 4IM3A 3L13A 2AL6A 1WYGA 4MH0E 4WJOA 3ETRA 2MSED 3C0RB 4KGRA 2J42A 5AUKA 3P2BA 4MSQB 3Q14C 1IBXB 2KDFB 2RDBC 3DBLB 3A33B 1LXDA 3KWVA 3RFZB 3KYCD 4LTUA 1E8WA 5DPRA 1GPXA 1MHXA 2AYOB 5E6JA 2O6VA 1N62A 4HKQA 1JWBD 3VFKA 1WMHB 2LGXA 2V3SA 1IBXA 2WDQB 5HI1A 3ALBA 3EFCA 4JWSC 3OLMD 3H9DA 4KKJA 3VHTC 4P6VF 3MJWA 1EWYC 1K52A 2DX5B 1Y8RC 2DBYA 4XWTA 1KF6B 1E0ZA 2DZJA 5LNK1 4US8A 1VZ6A 1SE4A 1VLBA 3T8MA 1WF9A 3ECIA 1WMHA 4YXDB 4BAXA 1OEYJ 4A55A 1GTEA 2BTEA 4DBGA 3KUDB 2WDVB 1GOZA 1RM6C 3TJPA 2WX1A 4FHJA 3R66C 1NEKB 1U4AA 2JT4B 2HDEA 1GB1A 1F9JA 2N9KA 2KXJA 2CU1A 1SIJA 4PS8A 5T8IA 1E8XA 1RYJA 3P4QB 3WA0A 1HTQA 1ISNA 1ZXIA 4DK5A 4GLSC 2NPTB 3N1ZC 5IO9A 1E8YA 3EC8A 1EF1A 4W9HA 3QA8A 2WXHA 2JRHA 1F0ZA 1X1MA 2K6DB 3PPAA 2QJLA 4E74A 1EUVB 1WZ3A 2MQJA 2K5PA 3Q8EA 1GJZA 5C23A 2BS4B 2KQSA 1NVID 4FLHA 4ICVA 1IGDA 2NPTA 1NI3A 2GLSA 2KTRB 5C2TB 4UDUC 1D5ZC 2K22A 1NBFC 1QOAA 1WE6A 5TSSA 1L0VB 4W9EA 1QOGA 1TGZB 1FPYA 1KLUD 4NAMA 4IC7B 1JWUD 3L17A 4MACA 3NS8A 3AEDB 5G55A 1XO3A 2KTRA 3VVWB 5DPSA 2IGDA 3PV1A 4DWFA 1OGWA 1CZPA 3AECB 3E9SA 3I5JC 4BKSD 1I35A 4ZYSA 1SGHA 1QF6A 2LVPA 5JZEB 2CHWA 3ZRFA 2V9HA 5KHQA 1FRDA 4JL9A 2OEDA 1TTNA 1T0QC 2KK8A 4JIOU 2WXKA 2OJWA 1TS5A 3AV8A 4ZRJA 1C76A 4H2AA 2RPQA 1C3TA 3EA6A 1EWCA 2L0TA 1XD3B 4M8NA 3V6EB 3P4PB 1B1ZA 2MLBA 1NI2A 3HVDA 3ZGZA 5AZFA 2D3AA 3AB5A 3RZFA 2RGFA 3PRZA 3R7RA 4LDTB 4RCOA 4M00A 2LGIA 3ZLZA 2KWCA 3ZXRA 4A90A 5EDSA 5EE9A 4RFBA 2MWSB 2N1WA 1RFKA 2WXGA 3P42A 4G0NB 3M62B 1WXAA 1V8CA 3IFWB 1L4DB 2KKCA 2RSUA 3QARA 2M0XA 3TEXA 3VXWA 1WX7A 4RGOS 3VTWA 2FIDA 2DZMA 3K9OB 3B0AA 4W9KA 3TEYA 4XZ4A 2RPVA 5J2RA 1FNWA 2LGDA 4OVUA 3S2AA 2NCNA 2KJRA 3O13A 4KV2A 3MTNB 3N32A 4GIVA 3Q3FA 1I4PA 2L8JA 1K51A 1FCLA 2IGGA 4TQ0A 4F1SA 2A4ZA 5D3IB 4KGSA 4WQMA 3FAHA 4AOFA 2JWUA 2WXFA 3AEFB 2AQ1B 2Z8LA 4AWJA 2B76B 5D6JB 3OWEB 3V6CB 2LI5A 3AM9A 2JX5A 2BKFA 3Q6BA 3DBHI 3RNFC 3EECA 3ML8A 2EMTA 3GB1A 2K25A 1ZW7A 3N1YC 4KX6B 2BWFA 4P16A 2HTHA 4WWPA 4RGNA 2JZZA 1KOTA 1IPGA 4ITKA 2PEAA 2W55A 1D5MC 1RLFA 4W9GA 2BT6A 3J9CA 3P1MA 3UF8A 4J6IA 2J7QB 3A4RA 3UQBA 1V5OA 1I4RA 1WJ6A 2D3GA 4G3XB 3FILB 2E6XA 4LNKA 2YVCA 2V3PA 4TSSA 3PVLA 4K3BA 2UWQA 1N60A 3KWLA 5G5HA 2MX2A 1EM7A 2ZJDA 1Q1OA 5CHWA 2R2OA 1GNUA 2KLGA 1ET6A 5LXHA 2L05A 3ZNZB 1GG3A 4B0MA 1XT9B 3ZIMA 1NDDA 1GAQB 2FCQA 4B9KA 4XWWA 3FILA 1J19A 2XK5B 2KFJA 1WGHA 3QHTA 3EGRA 2RD0A 1T0YA 3BZDB 4M0WB 2IPKD 2KHWB 1WXQA 4KDLB 1GC7A 1WX9A 5I4DA 4DDGD 1IP9A 2KDIA 5HG2A 3B2GA 4YT0B 2KD0A 3RZWC 2IBIB 3PGEA 4ANXA 2R2QA 2XK5A 2GBNA 1OTRB 1PGBA 1YIWA 4M0WA 3RNAC 3KYDD 2UYZB 3NZ3A 3O65B 2FNJB 2BYEA 2FE8A 4NQKE 1FXTB 2PIAA 3ENEA 3X0WA 1PDXA 2MJEA 2ZVNA 2LGSA 1CQVA 2I1JA 3VDZA 4M8MA 1S1QB 1N63A 2ZNVC 3R3MA 2Z0DB 4C80A 2IO3B 4C00A 1UWMA 2LZ6A 1Z2MA 1FNVA 2EKEC 3PHXB 4AUQC 2XEWA 1YMHE 3HUIA 2KZRA 3ZDTA 2SEBD 4ICUA 4AJYB 1HXYD 5DCNA 1FO4A 4OVVA 3APDA 1PGAA 3IVFA 1V1PB 4L2YA 4P7IA 1H7XA 1VDVA 2JZPA 3RNBC 2FCMA 5FR3A 1FCCC 2D3CA 2R61A 1QZEA 1C9FA 1E9MA 2J4XA 2MCNB 3BVMA 3OJ3A 2X38A 1FM0D 4MGIE 3A4SC 2YEPF 3AE5B 3LB8C 4EOYA 2L3ZA 1YNTE 4IDIA 3P4SB 1V1PA 4TV3A 3APFA 1YN4A 2GOWA 1UUPA 3KUZA 3AEAB 1V9JA 2FBWB 3GE8C 1JWSD 3LYYA 3R7QA 2JF5A 4BOZB 1N6ZA 2DZKA 3BYYB 1PYWD 1FXAA 1N5WA 1L2NA 1J7AA 4M02A 2MBBB 2RR9A 4IWQA 2NBWB 4ZYNA 2KLCA 2NS5A 4YTPB 4RMAA 2GBJA 3PREA 4GMVA 3H7PB 1SF0A 2K0PA 3BVZA 2WXPA 2ZVOA 4K1RB 4RF0A 3B2FA 1P7EA 4FXCA 2INNE 2KAJA 3PSEB 4C7ZA 1PQSA 4NJ7A 1WI0A 4N59A 1I42A 3IAM1 3L0WB 1UNSA 1L6VA 3PLUA 3LJ3A 5L95C 2DENB 5J18A 3H7PA 4BVUC 3M95A 1AWDA 3VH3B 3ZDMC 3Q3JA 4GDKB 4YTMB 4FN2A 2QHOA 3ZQ4A 4HRSA 1ROEA 5IAAC 1OQRA 3L10B 1F77A 1P1AA 2GB1A 1WRDB 3VRBB 2M4NA 3VUWA 3AEGB 2FAZA 1T5XD 4BKTA 2Y5BB 3DBHB 1MVKA 4C4VB 3GOEA 3ZVVA 4GDKA 2KOXA 3WAOA 2V4LA 3M3JA 2WHIA 3DVGY 3TIXA 3AE8B 2BVCA 4WJPA 2LXCA 2NTTA 3EFUA 1HZ6A 1QOFA 4F7ZA 1WM3A 2K9XA 1P9DU 2C60A 4IUMB 4C4VA 3JW0X 2LEKA 2MP2B 2LFIA 1QLBB 1TZ1A 3QIJA 2LXAA 1C77A 4BZAA 2MHJA 1WGDA 2QILA 3UI3A 1D5XC 4W9JA 3PZ8A 1N5XA 1WR1A 3I3TB 1WXMA 3JYUA 1DOXA 3UIOB 2WU2B 2MEKA 3HHMA 4DXAB 2DWQA 1OQYA 2IO2B 3DHGC 3U2SC 1VZ7A 3WANA 3KW5B 2KACA 2MP2A 1DOYA 3U4EG 2EMSA 1VR9A 1WJ4A 3CSFA 3Q2AC 2XNAC 1F52A 4WJNA 5H8YE 4PT5A 3SFEB 2CJOA 3N30A 1TS4A 3ZNGC 1V6EA 2QC8A 3SR6A 1V1OA 4WAFA 3DDCB 4K3CA 4PS7A 1QKZA 1C4CA 3KUCB 2WXOA 2BS2B 3IBEA 2ON8A 4CO7A 3PHWB 1L4ZB 2WXMA 4TUUA 2PW9A 4XX5A 4GB9A 2K8CA 5CX3A 2KDBA 2FIFA 1MG4A 4PYZA 1SIFA 2JXTA 3PZ7A 2KANA 2MBHA 5IP4D 4KVGB 2D5GA 2Z59B 2KDEB 3BK1A 2K8HA 2KT7A 2PVGC 3Q8FA 2BB5A 2LVQA 3AI5A 3VTUA 4HLEA 2CR5A 1AARA 2BKRB 3P4RB 3L54A 4WWMA 1JRUA 4OZCA 4ZOHC 4EZJA 2RDGA 1NYRA 4A3PA 1WXVA 3AEBB 2QDFA 2G9HD 2QIEB 1JRPA 4I6NB 2EKIA 4ZRPA 4WH4A 5D7GA 4DQOC 2WXNA 1YJIA 2O6VD 4JQWC 2CJNA 4GDLB 1MI0A 2MBQA 3AU4A 2BWES 1FFVA 3TL5A 4NNJB 3HK0A 4MM3B 1UD7A 3N3KB 2I2YA 1VRAB 4BFRA 3HM6X 3DWMA 4RM9A 4PK1A 1VJKA 1ET9A 1ZOYB 3P63A 3Q3OC 1F1HA 1QT9A 4GDLA 5AEKB 4TMAB 2PE9A 4B0EA 4MM3A 2IY0B 1HA5A 2KYWA 2KN5A 2M1MA 3MC0B 4RM8A 2L0FA 2JYEA 2DYOA 1ZPSA 1UF0A 1K53A 3HM3A 3CIRB 3HRDD 1TBEA 1FXIA 4WAAA 4CQNA 5E6OA 2M19A 4OVZA 1WGKA 3B1LX 3WIMA 1Q10A 2CS4A 2N1VA 3JVZX 3NZSA 3B08A 3SHQA 1GC6A 2WXJA 3AE3B 3CMMB 1WXSA 4I6LB 1SSNA 2KVZA 2N9LA 3DBSA 4MGKE 3R8BA 2AL3A 1SEBD 2M17A 4HCPB 5L83A 2HTME 1WIAA 1KH0A 3VR8B 2JSVX 3U8ZA 3MC8A 3ZYYX 1TYGB 4EEWA 1J8CA 2KJ6A 4GSWA 4XYCA 5CTRC 2HE7A 3FKYA 4AP4C 4HEA1 1TJEA 2ZEQA 4NJCA 1S3SG 3NS1A 1AW7A 5E6NA 3Q8CA 2Z0EB 5BO4B 4LJOB 4BKGA 3ONSA 4LJPB 3MJ5A 2J52A 4XC2A 1TZOA 2XBBC 3VAWA 1XCQL 4AJWA 3W9CB 2SAKA 2KFKB 3DPDA 2ZPNA 5IN7A 1R4MI 1E10A 1HTOA 3RD2A 3BINA 1ZP0B 1LO5D 5AZHA 4F8CB 1L5PA 3IG3A 2D3BA 4HCNB 4KGTA 2MA9B 1UELA 3PRPB 2IO1B 2PKOA 1T3QA 1SBBB 1TT5B 3ZO5B 3WAMA 1C79A 5HFYA 4W9CA 2KFKA 3KVFB 3ZNID 4D2KA 4JGHB 4MEMA 4GU2A 2LD9A 4A20A 2C9WB 3HIZA 1ENFA 1RAXA 4ZHPA 2LHDA 2N9XA 1H7WA 4MH8A 3DVNV 3GS2A 1E90A 2N0SB 3IT6B 1FD6A 2WYQA 4YSZB 4G50A 1V5TA 3DWGC 3V3XA 3RT3B 1J7BA 3QX1A 4DHZE 4OZAA 2LUEA 2KC2A 2PMVA 1E6EB 1N61A 5LLIA 3PRMB 2K8BA 4N58A 1SXTA 2LWPA 4KIKB 2N7JA 2E3TA 2BW2A 4ZDVA 3UGBB 1C78A 4NY0A 4AQ7A 2V0GA 3BY4B 4DDID 3NRZA 2KVRA 1R7SA 2IDYA 2V4IB 1R4NI 3BYTB 2DNFA 4LNIA 2PLPA 2IJ0A 2L7RA 2KQ4X 1XLNA 1WR6E 3RUIB 2VH1A 2VZKB 3PTFC 2WWZA 1Z5SB 4KIKA 4LDTD 2MW5A 1XLQA 2WP9B 1VZ8A 3V60A 1XEEA 4HPMB 4WJQA 1WGGA 1UBQA 2ASQA 4W9DA 3Q3MC 2M56B 5GXGB 1PUTA 3NVYA 4L23A 2MJDA 1JMLA 4ZRQA 1FRRA 2WGSA 3Q69A 4R3DA 2KMAA 3TSSA 3ZXVA 1PGXA 2L76A 3BVGA 4YL8A 3N1XC 3ZNHB 4TKNA 4RNAA 3PS6A 2PJHA 4DXFA 4IG7B 3V61A 2KWDA 1IGCA 3T3NA 3V05A 4FA6A 3TUOA 4KSKC 4K81A 4ARCA 3RNCC 4RF1A 1TKGA 2IZVB 4HKZE 3BK2A 4A3OA 4KKIA 1LFDA 1L0YB 1VCBA 1MPEA 1T0SC 1YQBA 2JWZA 4HXDA 4HPLB 2GBKA 2INDC 1RRBA 5G5GA 3B9JA 1F2RC 3R2IA 4DHZB 3MP9A 2DZIA 3NY5A 1P98A 2LJ5A 2WDRB 1FIQA 3W1SC 4GN1A 1KTKA 1J0GA 4II3B 5D2MB 3A9KB 4WWOA 4A9AA 1E8ZA 5EE0A 3M63B 3RNEC 2X8XX 3AU5A 4ZHOA 5C1ZA 2KJHB 1WFYA 2ZW0A 2BBCA 1PFDA
chains in the Genus database with same CATH topology
3VR9B 2WU2B 1EWCA 3EA6A 2MEKA 3N9YC 3WCQA 3P4PB 1B1ZA 2Y3AA 5C3JB 1ZE3D 2ICIA 1JW9D 2DWQA 1QOBA 4NAWB 4EE2A 3U2SC 1VZ7A 4DXGA 2WXRA 2YEPB 1TS2A 4NZLB 3HVDA 2KACA 1SJHD 5BMHA 3ZGZA 1FFUA 3MFGA 1DOYA 3U4EG 3AE9B 3ZJTA 4HJGE 1VR9A 1C4PA 3W5UB 2CU3A 1L6UA 3AB5A 1D6EC 1I7HA 2XNAC 4J3OD 4WIPA 4RCOA 1SJED 3HVZA 5H8YE 2LGIA 2V3NA 4A90A 5BYRA 4PT5A 3SFEB 2CJOA 5EE9A 4RFBA 4RH6A 1TS4A 2KN4A 4A8XC 1RFKA 2WXGA 3P42A 3SR6A 1V1OA 4WAFA 1AYFA 3NVWA 1L0XB 1V8CA 5MPOA 1I4GA 1QKZA 1C4CA 1TS3A 4XDDA 1L4DB 2WXOA 5D3DA 2BS2B 2ON8A 2WXLA 1I4XA 2BS3B 1L4ZB 2WXMA 1WSPA 3AMZA 3TEXA 2IGHA 2H88B 2PW9A 4RGOS 3AE1B 3RPFC 3TEYA 2JXTA 1T6BX 3PZ7A 2RPVA 1M4VA 4LLGM 4WURA 2D5GA 1EU4A 1FNWA 3URYA 1EU3A 3BK1A 3T3OA 1ACCA 2NMQA 1SB3C 2PVGC 3Q8FA 1ZUD2 2BB5A 3IAS1 3BIID 1XXGA 3O13A 2KDMA 3VRAB 4TQ1A 3PO0A 1SE3A 1I4PA 3LXFA 2FUG1 1K51A 1XLPA 3L4PA 1FCLA 3W2DA 2IGGA 3AE7B 2JQRB 4TQ0A 5D3IB 2NTSA 3P4RB 4WWMA 4OZCA 4KGSA 4ZOHC 4WQMA 2RDGA 1NYRA 2WS3B 3FAHA 3ZJVA 2JWUA 3AEBB 2WXFA 3AEFB 2AQ1B 2Z8LA 4C56C 2B76B 2G9HD 3OWEB 2QIEB 1JRPA 4XE0A 2EKIA 3AM9A 2JX5A 4ZRPA 1JWAD 2ZW0A 2WQYB 4WH4A 5D7GA 1KRHA 2WXNA 1YJIA 4DQOC 1TY2A 5AUIA 3AE6B 2CJNA 4YTNB 4GDLB 1XLOA 3U52E 1HEZE 1MI0A 3GB1A 3W5VB 1FFVA 4KX6B 4P16A 1GB4A 2M0AA 1JALA 4MM3B 4RGNA 2QEJC 2MH7A 3R2TA 4ITKA 1VRAB 2LHEA 2I2YA 1RWSA 2L83A 2W55A 1E7PB 1D5MC 4OZBA 3DWMA 2BT6A 3J9CA 3P1MA 1STEA 5EE3A 4L1BA 1UWXA 1VJKA 1ET9A 1ZOYB 1HZ5A 1I4RA 3P63A 4JE3B 1D4BA 1I4QA 2GI9A 1Y56A 4JPSA 1QT9A 2BYTA 3ZJUA 1I4HA 4JX1C 3FILB 1BXTA 2E6XA 2PVOD 4TMAB 2H89B 1QQRA 3W1SA 1NENB 2AQ2B 2V3PA 4TSSA 1UGJA 3AN1A 1BMLC 4US9A 4B0EA 1KLGD 4USAA 1JCKB 1FNUA 1N60A 3KWLA 5G5HA 1HQRD 1EM7A 1P7FA 2L32A 2J53A 1YJJA 1HA5A 2AQ3B 4O1NA 3MC0B 1DOIA 1ET6A 4B0MA 3Q8AA 3NUHB 2QSDA 2JYEA 2DYOA 1ZPSA 2INPE 1YN3A 1GAQB 2G1EA 4N6EB 1K53A 3CIRB 1TKEA 3HRDD 4XWWA 3FILA 2WU5B 1FXIA 4LK0M 5FK9C 1XF5L 3U7ZA 4CQNA 2M19A 1JWMD 1OQQA 3EGRA 4OVZA 3AEEB 3FC4A 3BZDB 1WGKA 3AH7A 2RMMA 2WLBA 4IOIE 1Q10A 3SFDB 4OHJA 3ABVB 2IPKD 1FMAD 2BB6A 1WXQA 2WXJA 3AE3B 2ONQA 4YWGG 5BYSA 5I4DA 1SSNA 2N9LA 1ZDVA 3R8BA 4A6QA 1SEBD 4HROA 1WWTA 5HG2A 3B2GA 4YT0B 1DOXA 2HTME 1MHHE 3KQ4A 1BUIC 2TSSA 1KH0A 3C8YA 3VR8B 2WNMA 3KLSX 2JSVX 2GRIA 1JROA 1PGBA 1SE2A 3ZYYX 3EUB2 1TYGB 4M0WA 1YN5A 4REZA 2AX5A 2LJIA 3NZ3A 1ZXHA 2QMTA 4C7YA 1AN8A 1ZDXA 2VZKD 1ESFA 1YQ3B 2FE8A 2PIAA 1GT8A 4HEA1 1PDXA 2MJEA 2DLBA 5JXVA 3NVZA 1TJEA 3MHZA 1XCTL 1CQVA 4AS1A 1N63A 4NJCA 3CWIA 2W82A 3NS1A 4C80A 3CF4A 1AW7A 5BYQA 3Q8CA 1UWMA 1WYGA 1FNVA 3ETRA 3MJ5A 2J52A 1CJEA 4KGRA 2J42A 1TZOA 5AUKA 2KMMA 1XCQL 2EELA 3W9CB 1A70A 1IBXB 2SAKA 1YMHE 2L1AA 2ZW1A 3HUIA 4RGMA 1B9RA 3VQIA 1WRIA 2ACZB 3KWVA 3RFZB 1E10A 4LTUA 2XN9C 2SEBD 1ZP0B 1NYQA 1HXYD 1LO5D 1FO4A 1GPXA 1F2RI 1L5PA 1MHXA 1PGAA 1V1PB 4L2YA 4KGTA 5E6JA 1H7XA 1VDVA 2JZPA 1N62A 5FR3A 1FCCC 2PKOA 1IUEA 2Y5PA 1T3QA 2R61A 3IXSA 4HKQA 1C9FA 1SBBB 1JWBD 1E9MA 2K3UA 2J4XA 1OFFA 3BVMA 1C79A 1IBXA 2WDQB 5HI1A 5HFYA 4JWSC 4D2KA 2X38A 1FM0D 2Q5WD 2JU6X 4KKJA 4P6VF 2YEPF 1V97A 3AE5B 2RDHA 1EWYC 3LB8C 1K52A 1YNTE 4IDIA 2DBYA 3P4SB 1DYQA 1ENFA 4XWTA 1V1PA 1KF6B 4ZHPA 1E0ZA 1YN4A 2LHDA 2W54A 1H7WA 1UUPA 3GP7A 4MH8A 5LNK1 3GS2A 3AEAB 2N0SB 3IT6B 4US8A 1FD6A 1YQ4B 1VZ6A 1SE4A 1VLBA 4YSZB 2PTLA 2FBWB 5BMGA 2OHFA 1JWSD 3DWGC 3V3XA 3LYYA 4YXDB 1J7BA 4YSYB 3BYYB 2I38A 4OZAA 1PYWD 3AE2B 1FXAA 2PMVA 1E6EB 1N5WA 4JWUC 1N61A 4A55A 1GTEA 2BTEA 4N58A 1SXTA 1J7AA 2N7JA 2E3TA 2BW2A 2LUMA 2WDVB 1C78A 3TEZA 4YTPB 4ARIA 1GOZA 4AQ7A 2V0GA 1RM6C 4MT5A 1NEKB 3NRZA 1R7SA 2HDEA 2IDYA 2V4IB 1SF0A 2K0PA 3IT4B 5HHDG 3BVZA 2WXPA 3BYTB 1GB1A 2N9KA 2PLPA 2IJ0A 2KQ4X 1XLNA 4RF0A 3B2FA 2JYTA 1P7EA 1SIJA 5T8IA 2VZKB 1RYJA 3P4QB 1ZXIA 4FXCA 2INNE 1DGJA 4GLSC 3I57A 4IKGA 2KAJA 1J7CA 1KFYB 3E56A 4C7ZA 2W3RA 1XLQA 2WP9B 4N59A 1VZ8A 3IAM1 1C4AA 1FEHA 1XEEA 2WXHA 1F0ZA 5EE1A 1UNSA 1L6VA 1CK1A 1TY0A 3BWUD 1JQ4A 2M56B 2QJLA 5GXGB 1PUTA 3SEBA 3NVYA 3Q8BA 4L23A 2K5PA 2MJDA 1JMLA 3Q8EA 4ZRQA 1FRRA 1AWDA 4GDKB 4YTMB 3Q69A 4R3DA 2W3SA 2BS4B 3ZQ4A 4Q2JA 3TSSA 2MJ3A 4HRSA 1ROEA 1NVID 2WXQA 1PGXA 5H92C 3TEWA 3BVGA 1OQRA 1IGDA 1NI3A 1F77A 4RNAA 5C2TB 4UDUC 2GB1A 4DXFA 3VRBB 1D5ZC 2K22A 2KWDA 4RGTA 3AEGB 1IGCA 3T3NA 1QOAA 3V05A 1T5XD 5TSSA 1L0VB 3TUOA 4ARCA 4RF1A 1QOGA 1MVKA 1TKGA 5BMIA 4HKZE 1KLUD 3BK2A 4KKIA 4NAMA 1JWUD 1L0YB 4MACA 1QILA 3AE4B 1MPEA 3NVVA 4OW0A 3AEDB 2DYMA 1XO3A 3AE8B 4YSXB 2Y5CA 5G5GA 2IGDA 1CZPA 3B9JA 4XDCA 2NTTA 3AECB 1F2RC 2WXIA 3E9SA 1HZ6A 4ZYSA 1QOFA 3R2IA 3MP9A 1QF6A 2L52A 1K50A 2K9XA 1GTHA 2LMCA 2WDRB 3I9V1 1FIQA 1FRDA 2LEKA 1KTKA 2LFIA 1QLBB 5FKAC 2OEDA 1C77A 4A9AA 2QILA 5EE0A 3UI3A 1D5XC 2WXKA 1TS5A 3AV8A 4ZHOA 3H8HA 3PZ8A 1N5XA 1C76A 4H2AA 1TKYA 2BBCA 1PFDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VR9 B;  2WU2 B;  1XLO A;  2PIA A;  1GT8 A;  3WCQ A;  3P4P B;  1PDX A;  2MJE A;  1XLN A;  3NVZ A;  3W5V B;  5C3J B;  1JW9 D;  3B2F A;  2DWQ A;  1FFV A;  4KX6 B;  1QOB A;  1TJE A;  1SIJ A;  1JAL A;  1N63 A;  1RYJ A;  3P4Q B;  1ZXI A;  3CWI A;  4FXC A;  1DGJ A;  3NS1 A;  4C80 A;  3CF4 A;  2KAJ A;  1J7C A;  2MH7 A;  4ITK A;  1FFU A;  1UWM A;  1KFY B;  1RWS A;  2L83 A;  2W55 A;  1E7P B;  4C7Z A;  3AE9 B;  1WYG A;  2W3R A;  1DOY A;  3ETR A;  1XLQ A;  2WP9 B;  2BT6 A;  3DWM A;  4N59 A;  3W5U B;  1CJE A;  2CU3 A;  1L6U A;  3P1M A;  5EE3 A;  5AUK A;  3AB5 A;  1F0Z A;  2KMM A;  5EE1 A;  1VJK A;  3W9C B;  1A70 A;  1I7H A;  1L6V A;  1ZOY B;  3P63 A;  1JQ4 A;  2M56 B;  2QJL A;  5GXG B;  1PUT A;  1QT9 A;  3HUI A;  3NVY A;  3HVZ A;  5H8Y E;  1B9R A;  1WRI A;  2ACZ B;  2K5P A;  2MJD A;  4JX1 C;  1FRR A;  1AWD A;  4LTU A;  2PVO D;  1E10 A;  2H89 B;  1ZP0 B;  3SFE B;  4YTM B;  1NYQ A;  2CJO A;  2BS4 B;  1NEN B;  2W3S A;  5EE9 A;  3AN1 A;  2MJ3 A;  4HRS A;  1ROE A;  1FO4 A;  4US9 A;  1L5P A;  1NVI D;  4USA A;  1DOX A;  1GPX A;  5H92 C;  1RFK A;  1H7X A;  1N60 A;  3SR6 A;  1VDV A;  1OQR A;  3KWL A;  5G5H A;  1N62 A;  1NI3 A;  1AYF A;  3NVW A;  2PKO A;  1IUE A;  5C2T B;  1T3Q A;  1V8C A;  5MPO A;  1YJJ A;  3VRB B;  2K22 A;  2BS2 B;  1JWB D;  1E9M A;  3AEG B;  1OFF A;  1QOA A;  1DOI A;  2BS3 B;  1PFD A;  3AMZ A;  2WDQ B;  1L0V B;  2H88 B;  4JWS C;  1GAQ B;  2G1E A;  4N6E B;  1QOG A;  1FM0 D;  3AE1 B;  1TKG A;  3CIR B;  1TKE A;  2Q5W D;  3HRD D;  2WU5 B;  1FXI A;  3RPF C;  4P6V F;  1TKY A;  1V97 A;  3AE5 B;  2M19 A;  1EWY C;  1OQQ A;  3LB8 C;  3AE4 B;  3AEE B;  3FC4 A;  4IDI A;  2DBY A;  3NVV A;  3P4S B;  1WGK A;  3AH7 A;  1KF6 B;  3AED B;  4ZHP A;  1E0Z A;  2WLB A;  2W54 A;  3SFD B;  1XO3 A;  3AE8 B;  1H7W A;  4YSX B;  1SB3 C;  2PVG C;  3ABV B;  1ZUD 2;  2Y5C A;  5G5G A;  3AEA B;  2N0S B;  3BII D;  4US8 A;  1YQ4 B;  1CZP A;  1FMA D;  1VLB A;  3VRA B;  3B9J A;  1WXQ A;  3PO0 A;  3AEC B;  3AE3 B;  4YSZ B;  2FBW B;  3LXF A;  2OHF A;  3DWG C;  4YXD B;  1XLP A;  1QOF A;  1J7B A;  3L4P A;  1QF6 A;  4YSY B;  2L52 A;  3AE7 B;  4HRO A;  1WWT A;  2JQR B;  3B2G A;  4YT0 B;  1GTH A;  3AE2 B;  2K9X A;  1FXA A;  2WDR B;  3P4R B;  1E6E B;  1N5W A;  2HTM E;  4JWU C;  4WWM A;  1N61 A;  1FIQ A;  1GTE A;  1FRD A;  2LEK A;  3VR8 B;  4N58 A;  4WQM A;  4ZOH C;  1NYR A;  2WS3 B;  3FAH A;  1J7A A;  2E3T A;  1QLB B;  3AEB B;  3AEF B;  1JRO A;  3ZYY X;  3EUB 2;  1TYG B;  2B76 B;  2WDV B;  2QIE B;  1JRP A;  4A9A A;  4YTP B;  2AX5 A;  5EE0 A;  2EKI A;  3AM9 A;  1RM6 C;  4C7Y A;  2JX5 A;  4ZHO A;  3AV8 A;  1JWA D;  2WQY B;  1N5X A;  1NEK B;  3NRZ A;  1KRH A;  1YQ3 B;  1R7S A;  1YJI A;  5AUI A;  3AE6 B;  1SF0 A;  2CJN A;  4YTN B; 
#chains in the Genus database with same CATH topology
 3VR9 B;  1V2Y A;  3WCQ A;  4CHK A;  3VUX A;  1ZE3 D;  2ICI A;  4EE2 A;  3IHP C;  4FAD A;  2WXR A;  1MG8 A;  1TS2 A;  2AWT A;  2YEP B;  3N20 C;  4NZL B;  2KNB A;  4KSL C;  4PYU A;  1FFU A;  4QAY A;  3KH0 A;  2D07 B;  3ZJT A;  3A9K A;  1C4P A;  1WM2 A;  2CU3 A;  1L6U A;  4W9L A;  3PT2 B;  4GOC A;  3DBR I;  4J3O D;  3D32 A;  4WIP A;  3OAW A;  5DPW A;  3DQV A;  2V3N A;  4RH6 A;  3PLV A;  4MEL A;  1AYF A;  4N9F 4;  1L0X B;  4PS3 A;  5MPO A;  1I4G A;  1TS3 A;  4XDD A;  2UU7 A;  2LAS A;  5D3D A;  2JVC A;  5D94 A;  1I4X A;  3APC A;  2BS3 B;  1WSP A;  2M8S A;  2N7D A;  3AE1 B;  1C1Y B;  2I1K A;  4EFO A;  2INC C;  1M4V A;  4LLG M;  1EU4 A;  3URY A;  1EU3 A;  3RUL A;  3ZUN A;  4IM0 A;  4LCD E;  2NMQ A;  2JRI B;  1SB3 C;  1ZUD 2;  3BII D;  2CHZ A;  3VRA B;  2KDM A;  2YLM A;  1SE3 A;  3VH4 B;  2FUG 1;  3L4P A;  1XLP A;  2J0J A;  3QC8 B;  3AE7 B;  2JQR B;  4XGA B;  2BYF A;  1H8C A;  4FHK A;  1R4M B;  1YX6 B;  1LM8 B;  2WS3 B;  3W1Y A;  3ZJV A;  3H1U A;  3Q3N C;  3QQ8 B;  3CST A;  4KZ0 A;  5JHB A;  2WQY B;  1KRH A;  1P3Q U;  1TY2 A;  4NJ6 A;  5AUI A;  3AE6 B;  4YTN B;  3CF6 E;  1XLO A;  3U52 E;  2JZ3 B;  3W5V B;  2KTF A;  1YX5 B;  4HVB A;  1GB4 A;  4BKS A;  2HD5 B;  2AEH A;  2MH7 A;  3R2T A;  5E6P A;  4E3C A;  3LDZ E;  2A5U A;  1STE A;  4URK A;  1I4Q A;  2IY1 B;  1Y56 A;  4JPS A;  2BYT A;  3ZJU A;  2PPH A;  3NHE B;  4JX1 C;  1WJN A;  2H89 B;  1QQR A;  1NEN B;  1UGJ A;  3ZW3 A;  2MBE A;  1FNU A;  4GGQ A;  1P7F A;  2G4S A;  2AQ3 B;  2N4F A;  2DHZ A;  4HDO A;  2QSD A;  4HDQ A;  5J17 A;  2INP E;  2G1E A;  1R4N B;  2KC1 A;  5FK9 C;  1XF5 L;  1JWM D;  5DPT A;  1OQQ A;  2LRU A;  3AEE B;  3FC4 A;  3ML9 A;  3AH7 A;  2RMM A;  4IOI E;  4OHJ A;  5IA7 A;  2V1Y A;  1KM7 A;  1FMA D;  4YWG G;  2ONQ A;  4E71 A;  1VD2 A;  2OOB B;  5CHF A;  4ANW A;  2GBR A;  4A6Q A;  4W9F A;  4IWO A;  3KQ4 A;  1BUI C;  1SE9 A;  2TSS A;  3C8Y A;  3SDL C;  2WNM A;  1IYF A;  4MSM B;  1JRO A;  2HJ1 A;  1SE2 A;  2AX5 A;  4C7Y A;  1ZDX A;  1YQ3 B;  3GZN I;  5G2N A;  1H4R A;  2BF8 B;  4HJK A;  3NVZ A;  3U7D A;  3DVG X;  4FUL A;  3CWI A;  5JHA A;  3CF4 A;  4P1B C;  5BYQ A;  1UH6 A;  4DHJ B;  2L00 B;  3ZTD A;  5LXI B;  1CJE A;  2N7E A;  4P1C C;  2KMM A;  2EEL A;  1A70 A;  4K7W A;  2L1A A;  2ZW1 A;  4RGM A;  1B9R A;  3VQI A;  1WRI A;  2ACZ B;  2XN9 C;  2D10 A;  2DYB A;  1NYQ A;  2LRW A;  1F2R I;  1WZ0 A;  2QCZ A;  2KWU B;  2Y5P A;  1IUE A;  4FJZ A;  3IXS A;  4WQO B;  4X57 B;  5AZG A;  2MRP A;  2KX0 A;  2K3U A;  4MJS B;  1OFF A;  1EF5 A;  1OEY A;  3VUY A;  3AXC A;  3MC9 A;  4IM2 A;  3VTV A;  3I63 C;  2Q5W D;  2JU6 X;  4LNO A;  2N9E B;  5FR6 A;  1V97 A;  2RDH A;  2CKH B;  1DYQ A;  2W54 A;  3GP7 A;  5KHO A;  3WAP A;  1YQ4 B;  2KWV B;  2K1F A;  4M01 A;  1BT0 A;  2PTL A;  4HWI B;  4B95 A;  2JXX A;  5BMG A;  2OHF A;  4MJS A;  2BGF A;  2J0M A;  3DBR B;  4YSY B;  2I38 A;  3QK0 A;  3AE2 B;  3DOW A;  4JWU C;  3RN9 C;  3L16 A;  3ZRC A;  4EKU A;  2LUM A;  4S0R A;  3TEZ A;  2DAF A;  3EHV A;  4ARI A;  1T0R C;  3TBL D;  4MGZ E;  4MT5 A;  4K7U A;  1E7V A;  3IT4 B;  5HHD G;  3V62 A;  2VRR B;  2JYT A;  2REX A;  2GBM A;  2NVU I;  1DGJ A;  3I57 A;  4IKG A;  1J7C A;  1UZX B;  1KFY B;  3E56 A;  2W3R A;  1C4A A;  1FEH A;  2BQQ A;  5EE1 A;  2FCN A;  1UGM A;  1CK1 A;  1TY0 A;  3BWU D;  1JQ4 A;  2ZCC A;  3SEB A;  3Q8B A;  2C5L C;  2KMC A;  3T9L A;  1YOV B;  3DVN U;  3QAQ A;  3NG0 A;  2W3S A;  2C7N B;  4Q2J A;  2MJ3 A;  2WXQ A;  5H92 C;  3TEW A;  5JH5 C;  3DHH C;  3ZKJ C;  2D11 A;  4RGT A;  2KX3 A;  2PE6 B;  1EO6 A;  4ZRI A;  1G6J A;  5TR5 A;  5BMI A;  1D3Z A;  2JY6 A;  2O2V B;  1HE8 A;  1QIL A;  3AE4 B;  3DCG A;  3NVV A;  4FJY A;  1LQB A;  3TMP B;  2ZPY A;  4OW0 A;  1MFW A;  1GUA B;  2DYM A;  4EZL A;  4NPN A;  4YSX B;  2Y5C A;  4IWP A;  4K7S A;  4I6P A;  3DBL I;  4XDC A;  2WXI A;  2B3A A;  1L7Y A;  2G4D B;  1V49 A;  4DHJ D;  2L52 A;  4ASW C;  4ANV A;  3K9P B;  1K50 A;  1GTH A;  2LMC A;  2KQ7 A;  3I9V 1;  3RI7 C;  5HKH A;  2K39 A;  2O2V A;  5FKA C;  3H7S A;  4JLC A;  3ZTC A;  1WY8 A;  3AUL A;  3OJ4 B;  3H8H A;  3A9J B;  1TKY A;  1WJU A;  3N9Y C;  1ZKH A;  4LNF A;  3SU8 X;  2Y3A A;  5C3J B;  3H6N A;  1JW9 D;  1QOB A;  4NAW B;  1Q5W B;  4CYE A;  2VH2 A;  4DXG A;  3NZU A;  3NJT A;  1SJH D;  1YD8 U;  5BMH A;  3MFG A;  2CHX A;  4LNN A;  3AE9 B;  4FJV B;  1K8R B;  1KJT A;  1XQQ A;  4HJG E;  2G3Q B;  3W5U B;  1D6E C;  4S17 A;  1I7H A;  4ANU A;  2ZCB A;  1TIF A;  3SD5 A;  2GMI C;  3A9J A;  1LGR A;  1SJE D;  3HVZ A;  4EUT A;  1E5W A;  5BYR A;  2WDT B;  2NBV B;  1KLV A;  3U30 A;  4NAW A;  2KN4 A;  4A8X C;  2G45 B;  2LVO A;  2HJ8 A;  5IKC M;  3NVW A;  3JSV B;  3C19 A;  2NR2 A;  4ZRK A;  3QCA A;  2WXL A;  4KDI C;  3AMZ A;  2IGH A;  1WGY A;  2H88 B;  2ZNV B;  3L08 A;  3GZN B;  2KO3 A;  3RPF C;  4WWN A;  4HK2 A;  1T6B X;  4G11 A;  4WUR A;  1V86 A;  5GMV A;  3MHS D;  1ACC A;  3T3O A;  4KZC A;  2D2Q A;  3JSV A;  3IAS 1;  1XXG A;  2DAJ A;  4TQ1 A;  3PO0 A;  2C7H A;  3LXF A;  2WX0 A;  2BPS A;  2JPH A;  3W2D A;  4HPP A;  4BOS C;  1Q0W B;  3QWZ B;  3GE3 C;  2NTS A;  2BYV E;  1YJ1 A;  4BBN F;  4C56 C;  3UQA A;  4XE0 A;  1JWA D;  4MDK E;  1HEZ E;  1UBI A;  2M0A A;  3WAL A;  1JAL A;  2QEJ C;  3OG5 A;  1M94 A;  2LHE A;  3NOB A;  3DHI C;  1RWS A;  2L83 A;  1E7P B;  4OZB A;  4BBN C;  5EE3 A;  4B6W A;  4L1B A;  1UWX A;  3RMK C;  2IYD B;  4JE3 B;  1HZ5 A;  1D4B A;  2GI9 A;  3X23 A;  2JUO A;  1I4H A;  4EZK A;  5CHV C;  1BXT A;  2PVO D;  1RFA A;  3W1S A;  5IOI A;  2AQ2 B;  3UIN B;  3AN1 A;  1BML C;  4US9 A;  1KLG D;  4USA A;  1JCK B;  3PZD A;  1HQR D;  2L32 A;  2J53 A;  1YJJ A;  4O1N A;  1WGR A;  2K6Q A;  1WH3 A;  1DOI A;  1WX8 A;  4ACF A;  3Q8A A;  3NUH B;  2W9N A;  1WYW B;  1YN3 A;  4N6E B;  2ZZP B;  4W9I A;  1TKE A;  3A1Q B;  2WU5 B;  4LK0 M;  3U7Z A;  3QJZ A;  1P0R A;  1V80 A;  2WLB A;  3SFD B;  2MBO A;  3ABV B;  4MGY E;  4NQL B;  2BB6 A;  2NBU A;  2J0K A;  5BYS A;  3UIP B;  1ZDV A;  2FCS A;  1WE7 A;  2IO0 B;  4HRO A;  1WWT A;  2FUH B;  3TCA A;  4IW0 A;  1MHH E;  1CMX B;  3A1Q A;  3KLS X;  2GRI A;  3RNG C;  3EUB 2;  1YN5 A;  1MJD A;  4REZ A;  2LJI A;  1ZXH A;  2QMT A;  1AN8 A;  2VZK D;  1ESF A;  1ZGU B;  4II2 B;  1E7U A;  2N9P C;  2LGY A;  3RCZ A;  1A5R A;  1GT8 A;  4GXB A;  2OJR A;  2DLB A;  5JXV A;  2C7M B;  4FBJ B;  3MHZ A;  1XCT L;  3RYT A;  4AS1 A;  1V81 A;  2O6V B;  2W82 A;  4IM3 A;  3L13 A;  2AL6 A;  1WYG A;  4MH0 E;  4WJO A;  3ETR A;  2MSE D;  3C0R B;  4KGR A;  2J42 A;  5AUK A;  3P2B A;  4MSQ B;  3Q14 C;  1IBX B;  2KDF B;  2RDB C;  3DBL B;  3A33 B;  1LXD A;  3KWV A;  3RFZ B;  3KYC D;  4LTU A;  1E8W A;  5DPR A;  1GPX A;  1MHX A;  2AYO B;  5E6J A;  2O6V A;  1N62 A;  4HKQ A;  1JWB D;  3VFK A;  1WMH B;  2LGX A;  2V3S A;  1IBX A;  2WDQ B;  5HI1 A;  3ALB A;  3EFC A;  4JWS C;  3OLM D;  3H9D A;  4KKJ A;  3VHT C;  4P6V F;  3MJW A;  1EWY C;  1K52 A;  2DX5 B;  1Y8R C;  2DBY A;  4XWT A;  1KF6 B;  1E0Z A;  2DZJ A;  5LNK 1;  4US8 A;  1VZ6 A;  1SE4 A;  1VLB A;  3T8M A;  1WF9 A;  3ECI A;  1WMH A;  4YXD B;  4BAX A;  1OEY J;  4A55 A;  1GTE A;  2BTE A;  4DBG A;  3KUD B;  2WDV B;  1GOZ A;  1RM6 C;  3TJP A;  2WX1 A;  4FHJ A;  3R66 C;  1NEK B;  1U4A A;  2JT4 B;  2HDE A;  1GB1 A;  1F9J A;  2N9K A;  2KXJ A;  2CU1 A;  1SIJ A;  4PS8 A;  5T8I A;  1E8X A;  1RYJ A;  3P4Q B;  3WA0 A;  1HTQ A;  1ISN A;  1ZXI A;  4DK5 A;  4GLS C;  2NPT B;  3N1Z C;  5IO9 A;  1E8Y A;  3EC8 A;  1EF1 A;  4W9H A;  3QA8 A;  2WXH A;  2JRH A;  1F0Z A;  1X1M A;  2K6D B;  3PPA A;  2QJL A;  4E74 A;  1EUV B;  1WZ3 A;  2MQJ A;  2K5P A;  3Q8E A;  1GJZ A;  5C23 A;  2BS4 B;  2KQS A;  1NVI D;  4FLH A;  4ICV A;  1IGD A;  2NPT A;  1NI3 A;  2GLS A;  2KTR B;  5C2T B;  4UDU C;  1D5Z C;  2K22 A;  1NBF C;  1QOA A;  1WE6 A;  5TSS A;  1L0V B;  4W9E A;  1QOG A;  1TGZ B;  1FPY A;  1KLU D;  4NAM A;  4IC7 B;  1JWU D;  3L17 A;  4MAC A;  3NS8 A;  3AED B;  5G55 A;  1XO3 A;  2KTR A;  3VVW B;  5DPS A;  2IGD A;  3PV1 A;  4DWF A;  1OGW A;  1CZP A;  3AEC B;  3E9S A;  3I5J C;  4BKS D;  1I35 A;  4ZYS A;  1SGH A;  1QF6 A;  2LVP A;  5JZE B;  2CHW A;  3ZRF A;  2V9H A;  5KHQ A;  1FRD A;  4JL9 A;  2OED A;  1TTN A;  1T0Q C;  2KK8 A;  4JIO U;  2WXK A;  2OJW A;  1TS5 A;  3AV8 A;  4ZRJ A;  1C76 A;  4H2A A;  2RPQ A;  1C3T A;  3EA6 A;  1EWC A;  2L0T A;  1XD3 B;  4M8N A;  3V6E B;  3P4P B;  1B1Z A;  2MLB A;  1NI2 A;  3HVD A;  3ZGZ A;  5AZF A;  2D3A A;  3AB5 A;  3RZF A;  2RGF A;  3PRZ A;  3R7R A;  4LDT B;  4RCO A;  4M00 A;  2LGI A;  3ZLZ A;  2KWC A;  3ZXR A;  4A90 A;  5EDS A;  5EE9 A;  4RFB A;  2MWS B;  2N1W A;  1RFK A;  2WXG A;  3P42 A;  4G0N B;  3M62 B;  1WXA A;  1V8C A;  3IFW B;  1L4D B;  2KKC A;  2RSU A;  3QAR A;  2M0X A;  3TEX A;  3VXW A;  1WX7 A;  4RGO S;  3VTW A;  2FID A;  2DZM A;  3K9O B;  3B0A A;  4W9K A;  3TEY A;  4XZ4 A;  2RPV A;  5J2R A;  1FNW A;  2LGD A;  4OVU A;  3S2A A;  2NCN A;  2KJR A;  3O13 A;  4KV2 A;  3MTN B;  3N32 A;  4GIV A;  3Q3F A;  1I4P A;  2L8J A;  1K51 A;  1FCL A;  2IGG A;  4TQ0 A;  4F1S A;  2A4Z A;  5D3I B;  4KGS A;  4WQM A;  3FAH A;  4AOF A;  2JWU A;  2WXF A;  3AEF B;  2AQ1 B;  2Z8L A;  4AWJ A;  2B76 B;  5D6J B;  3OWE B;  3V6C B;  2LI5 A;  3AM9 A;  2JX5 A;  2BKF A;  3Q6B A;  3DBH I;  3RNF C;  3EEC A;  3ML8 A;  2EMT A;  3GB1 A;  2K25 A;  1ZW7 A;  3N1Y C;  4KX6 B;  2BWF A;  4P16 A;  2HTH A;  4WWP A;  4RGN A;  2JZZ A;  1KOT A;  1IPG A;  4ITK A;  2PEA A;  2W55 A;  1D5M C;  1RLF A;  4W9G A;  2BT6 A;  3J9C A;  3P1M A;  3UF8 A;  4J6I A;  2J7Q B;  3A4R A;  3UQB A;  1V5O A;  1I4R A;  1WJ6 A;  2D3G A;  4G3X B;  3FIL B;  2E6X A;  4LNK A;  2YVC A;  2V3P A;  4TSS A;  3PVL A;  4K3B A;  2UWQ A;  1N60 A;  3KWL A;  5G5H A;  2MX2 A;  1EM7 A;  2ZJD A;  1Q1O A;  5CHW A;  2R2O A;  1GNU A;  2KLG A;  1ET6 A;  5LXH A;  2L05 A;  3ZNZ B;  1GG3 A;  4B0M A;  1XT9 B;  3ZIM A;  1NDD A;  1GAQ B;  2FCQ A;  4B9K A;  4XWW A;  3FIL A;  1J19 A;  2XK5 B;  2KFJ A;  1WGH A;  3QHT A;  3EGR A;  2RD0 A;  1T0Y A;  3BZD B;  4M0W B;  2IPK D;  2KHW B;  1WXQ A;  4KDL B;  1GC7 A;  1WX9 A;  5I4D A;  4DDG D;  1IP9 A;  2KDI A;  5HG2 A;  3B2G A;  4YT0 B;  2KD0 A;  3RZW C;  2IBI B;  3PGE A;  4ANX A;  2R2Q A;  2XK5 A;  2GBN A;  1OTR B;  1PGB A;  1YIW A;  4M0W A;  3RNA C;  3KYD D;  2UYZ B;  3NZ3 A;  3O65 B;  2FNJ B;  2BYE A;  2FE8 A;  4NQK E;  1FXT B;  2PIA A;  3ENE A;  3X0W A;  1PDX A;  2MJE A;  2ZVN A;  2LGS A;  1CQV A;  2I1J A;  3VDZ A;  4M8M A;  1S1Q B;  1N63 A;  2ZNV C;  3R3M A;  2Z0D B;  4C80 A;  2IO3 B;  4C00 A;  1UWM A;  2LZ6 A;  1Z2M A;  1FNV A;  2EKE C;  3PHX B;  4AUQ C;  2XEW A;  1YMH E;  3HUI A;  2KZR A;  3ZDT A;  2SEB D;  4ICU A;  4AJY B;  1HXY D;  5DCN A;  1FO4 A;  4OVV A;  3APD A;  1PGA A;  3IVF A;  1V1P B;  4L2Y A;  4P7I A;  1H7X A;  1VDV A;  2JZP A;  3RNB C;  2FCM A;  5FR3 A;  1FCC C;  2D3C A;  2R61 A;  1QZE A;  1C9F A;  1E9M A;  2J4X A;  2MCN B;  3BVM A;  3OJ3 A;  2X38 A;  1FM0 D;  4MGI E;  3A4S C;  2YEP F;  3AE5 B;  3LB8 C;  4EOY A;  2L3Z A;  1YNT E;  4IDI A;  3P4S B;  1V1P A;  4TV3 A;  3APF A;  1YN4 A;  2GOW A;  1UUP A;  3KUZ A;  3AEA B;  1V9J A;  2FBW B;  3GE8 C;  1JWS D;  3LYY A;  3R7Q A;  2JF5 A;  4BOZ B;  1N6Z A;  2DZK A;  3BYY B;  1PYW D;  1FXA A;  1N5W A;  1L2N A;  1J7A A;  4M02 A;  2MBB B;  2RR9 A;  4IWQ A;  2NBW B;  4ZYN A;  2KLC A;  2NS5 A;  4YTP B;  4RMA A;  2GBJ A;  3PRE A;  4GMV A;  3H7P B;  1SF0 A;  2K0P A;  3BVZ A;  2WXP A;  2ZVO A;  4K1R B;  4RF0 A;  3B2F A;  1P7E A;  4FXC A;  2INN E;  2KAJ A;  3PSE B;  4C7Z A;  1PQS A;  4NJ7 A;  1WI0 A;  4N59 A;  1I42 A;  3IAM 1;  3L0W B;  1UNS A;  1L6V A;  3PLU A;  3LJ3 A;  5L95 C;  2DEN B;  5J18 A;  3H7P A;  4BVU C;  3M95 A;  1AWD A;  3VH3 B;  3ZDM C;  3Q3J A;  4GDK B;  4YTM B;  4FN2 A;  2QHO A;  3ZQ4 A;  4HRS A;  1ROE A;  5IAA C;  1OQR A;  3L10 B;  1F77 A;  1P1A A;  2GB1 A;  1WRD B;  3VRB B;  2M4N A;  3VUW A;  3AEG B;  2FAZ A;  1T5X D;  4BKT A;  2Y5B B;  3DBH B;  1MVK A;  4C4V B;  3GOE A;  3ZVV A;  4GDK A;  2KOX A;  3WAO A;  2V4L A;  3M3J A;  2WHI A;  3DVG Y;  3TIX A;  3AE8 B;  2BVC A;  4WJP A;  2LXC A;  2NTT A;  3EFU A;  1HZ6 A;  1QOF A;  4F7Z A;  1WM3 A;  2K9X A;  1P9D U;  2C60 A;  4IUM B;  4C4V A;  3JW0 X;  2LEK A;  2MP2 B;  2LFI A;  1QLB B;  1TZ1 A;  3QIJ A;  2LXA A;  1C77 A;  4BZA A;  2MHJ A;  1WGD A;  2QIL A;  3UI3 A;  1D5X C;  4W9J A;  3PZ8 A;  1N5X A;  1WR1 A;  3I3T B;  1WXM A;  3JYU A;  1DOX A;  3UIO B;  2WU2 B;  2MEK A;  3HHM A;  4DXA B;  2DWQ A;  1OQY A;  2IO2 B;  3DHG C;  3U2S C;  1VZ7 A;  3WAN A;  3KW5 B;  2KAC A;  2MP2 A;  1DOY A;  3U4E G;  2EMS A;  1VR9 A;  1WJ4 A;  3CSF A;  3Q2A C;  2XNA C;  1F52 A;  4WJN A;  5H8Y E;  4PT5 A;  3SFE B;  2CJO A;  3N30 A;  1TS4 A;  3ZNG C;  1V6E A;  2QC8 A;  3SR6 A;  1V1O A;  4WAF A;  3DDC B;  4K3C A;  4PS7 A;  1QKZ A;  1C4C A;  3KUC B;  2WXO A;  2BS2 B;  3IBE A;  2ON8 A;  4CO7 A;  3PHW B;  1L4Z B;  2WXM A;  4TUU A;  2PW9 A;  4XX5 A;  4GB9 A;  2K8C A;  5CX3 A;  2KDB A;  2FIF A;  1MG4 A;  4PYZ A;  1SIF A;  2JXT A;  3PZ7 A;  2KAN A;  2MBH A;  5IP4 D;  4KVG B;  2D5G A;  2Z59 B;  2KDE B;  3BK1 A;  2K8H A;  2KT7 A;  2PVG C;  3Q8F A;  2BB5 A;  2LVQ A;  3AI5 A;  3VTU A;  4HLE A;  2CR5 A;  1AAR A;  2BKR B;  3P4R B;  3L54 A;  4WWM A;  1JRU A;  4OZC A;  4ZOH C;  4EZJ A;  2RDG A;  1NYR A;  4A3P A;  1WXV A;  3AEB B;  2QDF A;  2G9H D;  2QIE B;  1JRP A;  4I6N B;  2EKI A;  4ZRP A;  4WH4 A;  5D7G A;  4DQO C;  2WXN A;  1YJI A;  2O6V D;  4JQW C;  2CJN A;  4GDL B;  1MI0 A;  2MBQ A;  3AU4 A;  2BWE S;  1FFV A;  3TL5 A;  4NNJ B;  3HK0 A;  4MM3 B;  1UD7 A;  3N3K B;  2I2Y A;  1VRA B;  4BFR A;  3HM6 X;  3DWM A;  4RM9 A;  4PK1 A;  1VJK A;  1ET9 A;  1ZOY B;  3P63 A;  3Q3O C;  1F1H A;  1QT9 A;  4GDL A;  5AEK B;  4TMA B;  2PE9 A;  4B0E A;  4MM3 A;  2IY0 B;  1HA5 A;  2KYW A;  2KN5 A;  2M1M A;  3MC0 B;  4RM8 A;  2L0F A;  2JYE A;  2DYO A;  1ZPS A;  1UF0 A;  1K53 A;  3HM3 A;  3CIR B;  3HRD D;  1TBE A;  1FXI A;  4WAA A;  4CQN A;  5E6O A;  2M19 A;  4OVZ A;  1WGK A;  3B1L X;  3WIM A;  1Q10 A;  2CS4 A;  2N1V A;  3JVZ X;  3NZS A;  3B08 A;  3SHQ A;  1GC6 A;  2WXJ A;  3AE3 B;  3CMM B;  1WXS A;  4I6L B;  1SSN A;  2KVZ A;  2N9L A;  3DBS A;  4MGK E;  3R8B A;  2AL3 A;  1SEB D;  2M17 A;  4HCP B;  5L83 A;  2HTM E;  1WIA A;  1KH0 A;  3VR8 B;  2JSV X;  3U8Z A;  3MC8 A;  3ZYY X;  1TYG B;  4EEW A;  1J8C A;  2KJ6 A;  4GSW A;  4XYC A;  5CTR C;  2HE7 A;  3FKY A;  4AP4 C;  4HEA 1;  1TJE A;  2ZEQ A;  4NJC A;  1S3S G;  3NS1 A;  1AW7 A;  5E6N A;  3Q8C A;  2Z0E B;  5BO4 B;  4LJO B;  4BKG A;  3ONS A;  4LJP B;  3MJ5 A;  2J52 A;  4XC2 A;  1TZO A;  2XBB C;  3VAW A;  1XCQ L;  4AJW A;  3W9C B;  2SAK A;  2KFK B;  3DPD A;  2ZPN A;  5IN7 A;  1R4M I;  1E10 A;  1HTO A;  3RD2 A;  3BIN A;  1ZP0 B;  1LO5 D;  5AZH A;  4F8C B;  1L5P A;  3IG3 A;  2D3B A;  4HCN B;  4KGT A;  2MA9 B;  1UEL A;  3PRP B;  2IO1 B;  2PKO A;  1T3Q A;  1SBB B;  1TT5 B;  3ZO5 B;  3WAM A;  1C79 A;  5HFY A;  4W9C A;  2KFK A;  3KVF B;  3ZNI D;  4D2K A;  4JGH B;  4MEM A;  4GU2 A;  2LD9 A;  4A20 A;  2C9W B;  3HIZ A;  1ENF A;  1RAX A;  4ZHP A;  2LHD A;  2N9X A;  1H7W A;  4MH8 A;  3DVN V;  3GS2 A;  1E90 A;  2N0S B;  3IT6 B;  1FD6 A;  2WYQ A;  4YSZ B;  4G50 A;  1V5T A;  3DWG C;  3V3X A;  3RT3 B;  1J7B A;  3QX1 A;  4DHZ E;  4OZA A;  2LUE A;  2KC2 A;  2PMV A;  1E6E B;  1N61 A;  5LLI A;  3PRM B;  2K8B A;  4N58 A;  1SXT A;  2LWP A;  4KIK B;  2N7J A;  2E3T A;  2BW2 A;  4ZDV A;  3UGB B;  1C78 A;  4NY0 A;  4AQ7 A;  2V0G A;  3BY4 B;  4DDI D;  3NRZ A;  2KVR A;  1R7S A;  2IDY A;  2V4I B;  1R4N I;  3BYT B;  2DNF A;  4LNI A;  2PLP A;  2IJ0 A;  2L7R A;  2KQ4 X;  1XLN A;  1WR6 E;  3RUI B;  2VH1 A;  2VZK B;  3PTF C;  2WWZ A;  1Z5S B;  4KIK A;  4LDT D;  2MW5 A;  1XLQ A;  2WP9 B;  1VZ8 A;  3V60 A;  1XEE A;  4HPM B;  4WJQ A;  1WGG A;  1UBQ A;  2ASQ A;  4W9D A;  3Q3M C;  2M56 B;  5GXG B;  1PUT A;  3NVY A;  4L23 A;  2MJD A;  1JML A;  4ZRQ A;  1FRR A;  2WGS A;  3Q69 A;  4R3D A;  2KMA A;  3TSS A;  3ZXV A;  1PGX A;  2L76 A;  3BVG A;  4YL8 A;  3N1X C;  3ZNH B;  4TKN A;  4RNA A;  3PS6 A;  2PJH A;  4DXF A;  4IG7 B;  3V61 A;  2KWD A;  1IGC A;  3T3N A;  3V05 A;  4FA6 A;  3TUO A;  4KSK C;  4K81 A;  4ARC A;  3RNC C;  4RF1 A;  1TKG A;  2IZV B;  4HKZ E;  3BK2 A;  4A3O A;  4KKI A;  1LFD A;  1L0Y B;  1VCB A;  1MPE A;  1T0S C;  1YQB A;  2JWZ A;  4HXD A;  4HPL B;  2GBK A;  2IND C;  1RRB A;  5G5G A;  3B9J A;  1F2R C;  3R2I A;  4DHZ B;  3MP9 A;  2DZI A;  3NY5 A;  1P98 A;  2LJ5 A;  2WDR B;  1FIQ A;  3W1S C;  4GN1 A;  1KTK A;  1J0G A;  4II3 B;  5D2M B;  3A9K B;  4WWO A;  4A9A A;  1E8Z A;  5EE0 A;  3M63 B;  3RNE C;  2X8X X;  3AU5 A;  4ZHO A;  5C1Z A;  2KJH B;  1WFY A;  2ZW0 A;  2BBC A;  1PFD A; 
#chains in the Genus database with same CATH homology
 3VR9 B;  2WU2 B;  1EWC A;  3EA6 A;  2MEK A;  3N9Y C;  3WCQ A;  3P4P B;  1B1Z A;  2Y3A A;  5C3J B;  1ZE3 D;  2ICI A;  1JW9 D;  2DWQ A;  1QOB A;  4NAW B;  4EE2 A;  3U2S C;  1VZ7 A;  4DXG A;  2WXR A;  2YEP B;  1TS2 A;  4NZL B;  3HVD A;  2KAC A;  1SJH D;  5BMH A;  3ZGZ A;  1FFU A;  3MFG A;  1DOY A;  3U4E G;  3AE9 B;  3ZJT A;  4HJG E;  1VR9 A;  1C4P A;  3W5U B;  2CU3 A;  1L6U A;  3AB5 A;  1D6E C;  1I7H A;  2XNA C;  4J3O D;  4WIP A;  4RCO A;  1SJE D;  3HVZ A;  5H8Y E;  2LGI A;  2V3N A;  4A90 A;  5BYR A;  4PT5 A;  3SFE B;  2CJO A;  5EE9 A;  4RFB A;  4RH6 A;  1TS4 A;  2KN4 A;  4A8X C;  1RFK A;  2WXG A;  3P42 A;  3SR6 A;  1V1O A;  4WAF A;  1AYF A;  3NVW A;  1L0X B;  1V8C A;  5MPO A;  1I4G A;  1QKZ A;  1C4C A;  1TS3 A;  4XDD A;  1L4D B;  2WXO A;  5D3D A;  2BS2 B;  2ON8 A;  2WXL A;  1I4X A;  2BS3 B;  1L4Z B;  2WXM A;  1WSP A;  3AMZ A;  3TEX A;  2IGH A;  2H88 B;  2PW9 A;  4RGO S;  3AE1 B;  3RPF C;  3TEY A;  2JXT A;  1T6B X;  3PZ7 A;  2RPV A;  1M4V A;  4LLG M;  4WUR A;  2D5G A;  1EU4 A;  1FNW A;  3URY A;  1EU3 A;  3BK1 A;  3T3O A;  1ACC A;  2NMQ A;  1SB3 C;  2PVG C;  3Q8F A;  1ZUD 2;  2BB5 A;  3IAS 1;  3BII D;  1XXG A;  3O13 A;  2KDM A;  3VRA B;  4TQ1 A;  3PO0 A;  1SE3 A;  1I4P A;  3LXF A;  2FUG 1;  1K51 A;  1XLP A;  3L4P A;  1FCL A;  3W2D A;  2IGG A;  3AE7 B;  2JQR B;  4TQ0 A;  5D3I B;  2NTS A;  3P4R B;  4WWM A;  4OZC A;  4KGS A;  4ZOH C;  4WQM A;  2RDG A;  1NYR A;  2WS3 B;  3FAH A;  3ZJV A;  2JWU A;  3AEB B;  2WXF A;  3AEF B;  2AQ1 B;  2Z8L A;  4C56 C;  2B76 B;  2G9H D;  3OWE B;  2QIE B;  1JRP A;  4XE0 A;  2EKI A;  3AM9 A;  2JX5 A;  4ZRP A;  1JWA D;  2ZW0 A;  2WQY B;  4WH4 A;  5D7G A;  1KRH A;  2WXN A;  1YJI A;  4DQO C;  1TY2 A;  5AUI A;  3AE6 B;  2CJN A;  4YTN B;  4GDL B;  1XLO A;  3U52 E;  1HEZ E;  1MI0 A;  3GB1 A;  3W5V B;  1FFV A;  4KX6 B;  4P16 A;  1GB4 A;  2M0A A;  1JAL A;  4MM3 B;  4RGN A;  2QEJ C;  2MH7 A;  3R2T A;  4ITK A;  1VRA B;  2LHE A;  2I2Y A;  1RWS A;  2L83 A;  2W55 A;  1E7P B;  1D5M C;  4OZB A;  3DWM A;  2BT6 A;  3J9C A;  3P1M A;  1STE A;  5EE3 A;  4L1B A;  1UWX A;  1VJK A;  1ET9 A;  1ZOY B;  1HZ5 A;  1I4R A;  3P63 A;  4JE3 B;  1D4B A;  1I4Q A;  2GI9 A;  1Y56 A;  4JPS A;  1QT9 A;  2BYT A;  3ZJU A;  1I4H A;  4JX1 C;  3FIL B;  1BXT A;  2E6X A;  2PVO D;  4TMA B;  2H89 B;  1QQR A;  3W1S A;  1NEN B;  2AQ2 B;  2V3P A;  4TSS A;  1UGJ A;  3AN1 A;  1BML C;  4US9 A;  4B0E A;  1KLG D;  4USA A;  1JCK B;  1FNU A;  1N60 A;  3KWL A;  5G5H A;  1HQR D;  1EM7 A;  1P7F A;  2L32 A;  2J53 A;  1YJJ A;  1HA5 A;  2AQ3 B;  4O1N A;  3MC0 B;  1DOI A;  1ET6 A;  4B0M A;  3Q8A A;  3NUH B;  2QSD A;  2JYE A;  2DYO A;  1ZPS A;  2INP E;  1YN3 A;  1GAQ B;  2G1E A;  4N6E B;  1K53 A;  3CIR B;  1TKE A;  3HRD D;  4XWW A;  3FIL A;  2WU5 B;  1FXI A;  4LK0 M;  5FK9 C;  1XF5 L;  3U7Z A;  4CQN A;  2M19 A;  1JWM D;  1OQQ A;  3EGR A;  4OVZ A;  3AEE B;  3FC4 A;  3BZD B;  1WGK A;  3AH7 A;  2RMM A;  2WLB A;  4IOI E;  1Q10 A;  3SFD B;  4OHJ A;  3ABV B;  2IPK D;  1FMA D;  2BB6 A;  1WXQ A;  2WXJ A;  3AE3 B;  2ONQ A;  4YWG G;  5BYS A;  5I4D A;  1SSN A;  2N9L A;  1ZDV A;  3R8B A;  4A6Q A;  1SEB D;  4HRO A;  1WWT A;  5HG2 A;  3B2G A;  4YT0 B;  1DOX A;  2HTM E;  1MHH E;  3KQ4 A;  1BUI C;  2TSS A;  1KH0 A;  3C8Y A;  3VR8 B;  2WNM A;  3KLS X;  2JSV X;  2GRI A;  1JRO A;  1PGB A;  1SE2 A;  3ZYY X;  3EUB 2;  1TYG B;  4M0W A;  1YN5 A;  4REZ A;  2AX5 A;  2LJI A;  3NZ3 A;  1ZXH A;  2QMT A;  4C7Y A;  1AN8 A;  1ZDX A;  2VZK D;  1ESF A;  1YQ3 B;  2FE8 A;  2PIA A;  1GT8 A;  4HEA 1;  1PDX A;  2MJE A;  2DLB A;  5JXV A;  3NVZ A;  1TJE A;  3MHZ A;  1XCT L;  1CQV A;  4AS1 A;  1N63 A;  4NJC A;  3CWI A;  2W82 A;  3NS1 A;  4C80 A;  3CF4 A;  1AW7 A;  5BYQ A;  3Q8C A;  1UWM A;  1WYG A;  1FNV A;  3ETR A;  3MJ5 A;  2J52 A;  1CJE A;  4KGR A;  2J42 A;  1TZO A;  5AUK A;  2KMM A;  1XCQ L;  2EEL A;  3W9C B;  1A70 A;  1IBX B;  2SAK A;  1YMH E;  2L1A A;  2ZW1 A;  3HUI A;  4RGM A;  1B9R A;  3VQI A;  1WRI A;  2ACZ B;  3KWV A;  3RFZ B;  1E10 A;  4LTU A;  2XN9 C;  2SEB D;  1ZP0 B;  1NYQ A;  1HXY D;  1LO5 D;  1FO4 A;  1GPX A;  1F2R I;  1L5P A;  1MHX A;  1PGA A;  1V1P B;  4L2Y A;  4KGT A;  5E6J A;  1H7X A;  1VDV A;  2JZP A;  1N62 A;  5FR3 A;  1FCC C;  2PKO A;  1IUE A;  2Y5P A;  1T3Q A;  2R61 A;  3IXS A;  4HKQ A;  1C9F A;  1SBB B;  1JWB D;  1E9M A;  2K3U A;  2J4X A;  1OFF A;  3BVM A;  1C79 A;  1IBX A;  2WDQ B;  5HI1 A;  5HFY A;  4JWS C;  4D2K A;  2X38 A;  1FM0 D;  2Q5W D;  2JU6 X;  4KKJ A;  4P6V F;  2YEP F;  1V97 A;  3AE5 B;  2RDH A;  1EWY C;  3LB8 C;  1K52 A;  1YNT E;  4IDI A;  2DBY A;  3P4S B;  1DYQ A;  1ENF A;  4XWT A;  1V1P A;  1KF6 B;  4ZHP A;  1E0Z A;  1YN4 A;  2LHD A;  2W54 A;  1H7W A;  1UUP A;  3GP7 A;  4MH8 A;  5LNK 1;  3GS2 A;  3AEA B;  2N0S B;  3IT6 B;  4US8 A;  1FD6 A;  1YQ4 B;  1VZ6 A;  1SE4 A;  1VLB A;  4YSZ B;  2PTL A;  2FBW B;  5BMG A;  2OHF A;  1JWS D;  3DWG C;  3V3X A;  3LYY A;  4YXD B;  1J7B A;  4YSY B;  3BYY B;  2I38 A;  4OZA A;  1PYW D;  3AE2 B;  1FXA A;  2PMV A;  1E6E B;  1N5W A;  4JWU C;  1N61 A;  4A55 A;  1GTE A;  2BTE A;  4N58 A;  1SXT A;  1J7A A;  2N7J A;  2E3T A;  2BW2 A;  2LUM A;  2WDV B;  1C78 A;  3TEZ A;  4YTP B;  4ARI A;  1GOZ A;  4AQ7 A;  2V0G A;  1RM6 C;  4MT5 A;  1NEK B;  3NRZ A;  1R7S A;  2HDE A;  2IDY A;  2V4I B;  1SF0 A;  2K0P A;  3IT4 B;  5HHD G;  3BVZ A;  2WXP A;  3BYT B;  1GB1 A;  2N9K A;  2PLP A;  2IJ0 A;  2KQ4 X;  1XLN A;  4RF0 A;  3B2F A;  2JYT A;  1P7E A;  1SIJ A;  5T8I A;  2VZK B;  1RYJ A;  3P4Q B;  1ZXI A;  4FXC A;  2INN E;  1DGJ A;  4GLS C;  3I57 A;  4IKG A;  2KAJ A;  1J7C A;  1KFY B;  3E56 A;  4C7Z A;  2W3R A;  1XLQ A;  2WP9 B;  4N59 A;  1VZ8 A;  3IAM 1;  1C4A A;  1FEH A;  1XEE A;  2WXH A;  1F0Z A;  5EE1 A;  1UNS A;  1L6V A;  1CK1 A;  1TY0 A;  3BWU D;  1JQ4 A;  2M56 B;  2QJL A;  5GXG B;  1PUT A;  3SEB A;  3NVY A;  3Q8B A;  4L23 A;  2K5P A;  2MJD A;  1JML A;  3Q8E A;  4ZRQ A;  1FRR A;  1AWD A;  4GDK B;  4YTM B;  3Q69 A;  4R3D A;  2W3S A;  2BS4 B;  3ZQ4 A;  4Q2J A;  3TSS A;  2MJ3 A;  4HRS A;  1ROE A;  1NVI D;  2WXQ A;  1PGX A;  5H92 C;  3TEW A;  3BVG A;  1OQR A;  1IGD A;  1NI3 A;  1F77 A;  4RNA A;  5C2T B;  4UDU C;  2GB1 A;  4DXF A;  3VRB B;  1D5Z C;  2K22 A;  2KWD A;  4RGT A;  3AEG B;  1IGC A;  3T3N A;  1QOA A;  3V05 A;  1T5X D;  5TSS A;  1L0V B;  3TUO A;  4ARC A;  4RF1 A;  1QOG A;  1MVK A;  1TKG A;  5BMI A;  4HKZ E;  1KLU D;  3BK2 A;  4KKI A;  4NAM A;  1JWU D;  1L0Y B;  4MAC A;  1QIL A;  3AE4 B;  1MPE A;  3NVV A;  4OW0 A;  3AED B;  2DYM A;  1XO3 A;  3AE8 B;  4YSX B;  2Y5C A;  5G5G A;  2IGD A;  1CZP A;  3B9J A;  4XDC A;  2NTT A;  3AEC B;  1F2R C;  2WXI A;  3E9S A;  1HZ6 A;  4ZYS A;  1QOF A;  3R2I A;  3MP9 A;  1QF6 A;  2L52 A;  1K50 A;  2K9X A;  1GTH A;  2LMC A;  2WDR B;  3I9V 1;  1FIQ A;  1FRD A;  2LEK A;  1KTK A;  2LFI A;  1QLB B;  5FKA C;  2OED A;  1C77 A;  4A9A A;  2QIL A;  5EE0 A;  3UI3 A;  1D5X C;  2WXK A;  1TS5 A;  3AV8 A;  4ZHO A;  3H8H A;  3PZ8 A;  1N5X A;  1C76 A;  4H2A A;  1TKY A;  2BBC A;  1PFD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...