3VR9B

Mitochondrial rhodoquinol-fumarate reductase from the parasitic nematode ascaris suum with the specific inhibitor flutolanil
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
249
structure length
249
Chain Sequence
b'KRIKTFEIYRFNPEEPGAKPKLQKFDVDLDKCGTMVLDALIKIKNEVDPTLTFRRSCREGICGSCAMNIAGENTLACICNIDQNTSKTTKIYPLPHMFVIKDLVPDMNLFYAQYASIQPWLQKKTKINLGEKQQYQSIKEQEKLDGLYECILCACCSASCPSYWWNADKYLGPAVLMQAYRWIIDSRDDSAAERLARMQDGFSAFKCHTIMNCTKTCPKHLNPARAIGEIKMLLTKMKTKPAPLPTPAN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Flavoprotein subunit of complex II
publication title Crystal structure of mitochondrial quinol-fumarate reductase from parasitic nematode Ascaris suum
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 55
structure length 249
sequence length 249
chains with identical sequence F
ec nomenclature
pdb deposition date 2012-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 3vr9B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3vr9B01
3AE9B 3P4RB 1A70A 3FAHA 1FRDA 3AE4B 1YJIA 2HTME 5G5HA 1UWMA 1TJEA 1ZOYB 1JWBD 2L52A 1DGJA 2PVGC 1I7HA 1N62A 1QOFA 4US8A 1J7CA 3AE5B 1OQQA 1J7AA 2JX5A 3B2FA 1EWYC 1OFFA 3PO0A 1ZP0B 1FO4A 1WWTA 2WDVB 1ROEA 4N58A 2W55A 1QF6A 1L6VA 2QJLA 3P4QB 3NRZA 1F0ZA 2BT6A 1JRPA 3CIRB 1N60A 5H92C 2MJ3A 3W9CB 3W5VB 3LB8C 3AV8A 1WXQA 1PFDA 4YTPB 2E3TA 3AE6B 3P63A 3AEAB 4WQMA 1YJJA 2BS4B 1RWSA 3AMZA 4ZOHC 2Q5WD 5EE9A 1JQ4A 2H89B 4JWUC 1E0ZA 2WDRB 2DWQA 3ZYYX 3VR9B 1ZUD2 4N6EB 1E7PB 1XLPA 1QOBA 4JWSC 1E10A 1QT9A 5EE3A 3L4PA 1KF6B 1XLQA 3W5UB 2W3SA 1L5PA 2FBWB 1NI3A 1L0VB 3VRAB 1NYRA 1T3QA 3B9JA 1TKGA 5AUKA 4YSXB 1DOXA 2KMMA 2LEKA 1GT8A 3AE7B 1FMAD 1OQRA 1TYGB 2MJEA 2AX5A 3B2GA 4USAA 3NVZA 1FFUA 1DOYA 4YT0B 2M19A 2MJDA 1YQ3B 2BS2B 3AH7A 3HRDD 2WU5B 5GXGB 4YTNB 1PDXA 1WYGA 3NVWA 1IUEA 3AECB 2K22A 1TKYA 2M56B 3AE8B 4JX1C 2N0SB 2KAJA 5EE0A 1FRRA 1QLBB 4YXDB 1GPXA 1SF0A 4HRSA 1B9RA 4A9AA 1GTHA 1WGKA 1XLOA 4YSZB 1VDVA 2CU3A 3AE2B 1ZXIA 5C3JB 1YQ4B 4C80A 2WQYB 3AM9A 1TKEA 2G1EA 3FC4A 3NVVA 4FXCA 4N59A 1FFVA 3VR8B 1JWAD 1XLNA 2CJOA 2L83A 2OHFA 3HUIA 1KRHA 2W3RA 2BS3B 1RYJA 5AUIA 2PVOD 5C2TB 2DBYA 3AEGB 3CWIA 3AEFB 2WS3B 4ITKA 2WDQB 1V8CA 3VRBB 1PUTA 2WLBA 1AYFA 3SFDB 3DWGC 3CF4A 1KFYB 1WRIA 4HROA 4US9A 1SB3C 3SR6A 3P4SB 1H7WA 1N5XA 4YSYB 1FXIA 1V97A 3P1MA 1SIJA 3ETRA 4IDIA 1JW9D 4WWMA 5G5GA 2PKOA 1NYQA 1CJEA 1FM0D 1R7SA 3AE3B 4P6VF 1NENB 2K5PA 5H8YE 2B76B 3KWLA 3AE1B 1L6UA 2EKIA 3RPFC 3AEEB 5EE1A 3BIID 4ZHOA 3AB5A 1QOGA 2W54A 1VJKA 3AEDB 1CZPA 3ABVB 1JROA 1XO3A 3SFEB 1FIQA 3AEBB 1N5WA 4KX6B 1N61A 1N63A 2JQRB 2QIEB 2CJNA 2MH7A 1RFKA 3EUB2 2K9XA 1QOAA 1E9MA 3DWMA 4ZHPA 4YTMB 1NVID 5MPOA 1JALA 3AN1A 2H88B 3P4PB 2PIAA 2Y5CA 3WCQA 2WP9B 3NVYA 4LTUA 1AWDA 1J7BA 1NEKB 1FXAA 4C7ZA 4C7YA 2WU2B 1VLBA 1H7XA 2ACZB 3LXFA 1DOIA 1RM6C 3HVZA 3NS1A 1GAQB 1E6EB 1GTEA
chains in the Genus database with same CATH superfamily
3P4RB 1EF5A 4LLGM 2NPTA 2IYDB 4B6WA 2KQSA 2ON8A 1WMHA 2XN9C 3PHWB 3KYDD 2KFJA 1Y8RC 2LI5A 2PW9A 4RH6A 2JZZA 2KC1A 2J0KA 3LJ3A 1E5WA 1BXTA 1IPGA 4DXFA 2AL3A 4WAAA 3AMZA 1JWSD 3MHZA 2Q5WD 4JQWC 5EE9A 3SEBA 2V3PA 2KWUB 4ZRJA 3Q8BA 1P9DU 5FR3A 1KF6B 4RGMA 3VRAB 2LGXA 4HWIB 1SBBB 1SE4A 3ZGZA 4WJNA 2MP2A 1PDXA 2DLBA 1SE9A 1TGZB 1V81A 3R8BA 1FCLA 2INPE 2KD0A 3Q8EA 2IBIB 3KLSX 2D5GA 2PVOD 3ML8A 3CWIA 4EZJA 4ITKA 4TUUA 1WXSA 1KFYB 1H7WA 2EKEC 1WXAA 1N5XA 4MGKE 4BOSC 2WXJA 4NNJB 1JWMD 2I1JA 1L6UA 3ENEA 2BKRB 5EE1A 1QOGA 4IG7B 4PS8A 4MGIE 3KH0A 2KTRB 1N5WA 1N63A 1QOAA 2K0PA 2WNMA 4ANXA 2KNBA 5JZEB 3OLMD 1OQYA 2J7QB 4LNIA 5DPWA 3AE9B 3H9DA 2OJWA 5KHQA 1BMLC 2XBBC 3L54A 3SU8X 1FO4A 4N58A 2PE6B 3P4QB 2HD5B 1F2RC 2DAJA 3IVFA 2PTLA 1VRAB 3P42A 4B95A 2GOWA 4FBJB 1HE8A 2ZVNA 2WXGA 3IT6B 2BBCA 3ZNZB 4E3CA 1L0VB 4D2KA 2REXA 1WRDB 4BKSD 3UI3A 1E8YA 3M63B 3QWZB 2M19A 4XDCA 3IHPC 3AE8B 1V1PB 4GOCA 2N9EB 1V5OA 1FCCC 2BWES 3AM9A 1TKEA 2C5LC 2K1FA 2OHFA 1T0YA 5TR5A 4G50A 1DYQA 3RNAC 4WJOA 3KVFB 3BVMA 3VH4B 3SFDB 4W9KA 4S0RA 2WDTB 1I4PA 5J2RA 2A4ZA 4PYZA 5CHFA 1R4NI 2KMAA 2ZCCA 5HKHA 4DXAB 1NENB 2NS5A 5EDSA 1EU3A 4B0EA 4RM8A 4MM3A 1QZEA 1XD3B 3A1QA 2IPKD 2LVOA 1FEHA 2QIEB 2JWZA 4HPMB 3VVWB 5BYSA 2BB6A 1EUVB 5IAAC 4PT5A 3V60A 2LHEA 1WM3A 1GTEA 2A5UA 4W9GA 1UWMA 1ZDXA 1MHHE 2C7MB 2J42A 1J7AA 4RNAA 1YN4A 4GSWA 2C7NB 3CMMB 2WDVB 1ACCA 4MJSA 1JRPA 1E8ZA 2VRRB 3HIZA 3N1YC 2MCNB 4J6IA 1YJJA 3U7ZA 2BS4B 4HDOA 4DHJD 4F7ZA 1TS2A 4HEA1 3HVDA 1QOBA 4XDDA 1XLQA 4FN2A 1NYRA 4YSXB 3UIPB 2GB1A 4KDIC 2KDIA 1YX5B 3NVZA 2NCNA 4ZRPA 2WXKA 1TKYA 2KDFB 4F8CB 4EKUA 1R4NB 4MSQB 3MFGA 2VZKB 4J3OD 2KHWB 1WH3A 2DBYA 3VTVA 5KHOA 4GN1A 3EC8A 4W9EA 3BZDB 3DWGC 3KUDB 2OOBB 4US9A 4A8XC 4FULA 2PE9A 4ANVA 5H8YE 3ZJVA 3RPFC 3AEEB 2JRIB 2LZ6A 1XEEA 2YVCA 1UD7A 2MBEA 3SD5A 1JMLA 3OJ3A 2AEHA 3RT3B 4RM9A 1ET6A 2LD9A 2CS4A 2MW5A 1KH0A 5MPOA 1UELA 2VZKD 4DQOC 4C7ZA 2E6XA 1H7XA 3APDA 1GAQB 1JCKB 3ECIA 4K1RB 1SJED 2GRIA 4TKNA 1A70A 3GS2A 1TJEA 1P3QU 1ET9A 2L52A 2WXNA 4US8A 1J7CA 1STEA 1BUIC 1YN5A 4L1BA 2FNJB 3PLVA 4NQLB 1WXQA 4M0WA 3R3MA 3P63A 3AE6B 5J18A 2H89B 4YL8A 1E0ZA 4EUTA 3WANA 4RCOA 3LDZE 2X38A 3Q3MC 4GB9A 5J17A 2N4FA 2UU7A 4K7UA 4WWPA 3B1LX 3DBHI 2PPHA 3TL5A 5AUKA 4AUQC 1FMAD 3ONSA 4HDQA 1GJZA 3RNGC 2ZJDA 1J0GA 3HRDD 4OZCA 4NJ6A 3PRPB 4XE0A 3TIXA 3JYUA 2YEPB 2WXFA 4JGHB 1IBXB 2O6VB 2LHDA 3VDZA 1KLVA 4P1CC 2JY6A 3H6NA 3NVVA 2ZEQA 1ZE3D 1FXTB 3AU5A 3PZDA 4IOIE 4B0MA 2EELA 4XWTA 4BZAA 3V6EB 2NBUA 3NS8A 3C8YA 3GZNB 5D6JB 2D3GA 1WE7A 1KTKA 3R7RA 4YSYB 2K8HA 1RAXA 2LGIA 3E9SA 3AULA 1E7UA 2KWVB 3AE1B 4JLCA 2PLPA 1WIAA 4KKJA 1LFDA 3I63C 4WURA 2G4SA 1AN8A 1WE6A 2JQRB 1SGHA 2O6VD 3ZTCA 2QILA 2LGSA 2WU2B 3DDCB 3AE4B 3DBHB 2HJ8A 4K3CA 4BBNF 2OJRA 1TBEA 2G4DB 1WR6E 2BYTA 2V4IB 2LASA 1D4BA 4NJ7A 4GMVA 2MJ3A 1YIWA 3W5VB 2V4LA 2HE7A 1C1YB 2C7HA 4FJVB 1L0XB 4HPLB 1H8CA 3GE8C 3DVNV 3BK2A 1D5MC 2LUMA 4JWSC 4DDID 2Y5BB 5DPRA 1WZ3A 1L5PA 2FBWB 3RCZA 1OTRB 4NY0A 3RFZB 3IT4B 1MI0A 2MJEA 4WJQA 2VH1A 3TMPB 5GXGB 1YJ1A 2M56B 4JX1C 3OG5A 1SF0A 4A90A 3VUYA 2WXHA 4HCPB 1WJUA 4GGQA 1I4HA 4S17A 4G3XB 3KUCB 2G45B 4CHKA 4GDKA 4LNNA 4ARCA 1H4RA 4FLHA 4PS3A 3W1YA 2GBMA 4ANWA 2ICIA 1QKZA 4ICUA 1CMXB 1GNUA 1PUTA 2SAKA 3UQBA 2RSUA 1WGHA 3P1MA 2SEBD 1V9JA 1S1QB 1M4VA 1KOTA 1K52A 2FIFA 1UUPA 2W54A 2L05A 2IY0B 3B2GA 3EUB2 2K9XA 2QC8A 1JALA 1Q0WB 3B0AA 1I4XA 4JL9A 3NVYA 1AWDA 2V3NA 3LYYA 3N3KB 2WXRA 4DWFA 4A3PA 2BVCA 5G5HA 1ZOYB 5FKAC 4LK0M 4GXBA 1OQQA 3AE5B 4OVZA 4IC7B 2KJ6A 1L4DB 2LXAA 2QJLA 4ASWC 4KDLB 2L8JA 4OZAA 2Z0EB 3A33B 4AQ7A 1ZUD2 1PQSA 1E7PB 3L4PA 3W5UB 2RGFA 2NTSA 3ZRCA 1FFUA 1IUEA 2K22A 3R2IA 4W9IA 5DPTA 2KAJA 4EFOA 4CO7A 3PLUA 2N9LA 2INDC 4MDKE 3KWVA 2WQYB 3PGEA 3Q8AA 2L83A 3AU4A 2KKCA 4W9LA 3QIJA 3TBLD 5C2TB 2RPVA 1TIFA 4I6NB 1LO5D 3TUOA 2L3ZA 1KJTA 2ZNVB 4TQ1A 4BAXA 4ZRIA 1SB3C 2KTRA 1LQBA 5G5GA 4AP4C 5IA7A 3AE3B 3RI7C 4KSLC 1UGJA 4BKSA 1HZ6A 3QHTA 2Y3AA 3Q14C 1UBIA 4MT5A 3RNFC 3AEDB 2XNAC 1WJ4A 2WXOA 3T8MA 4BKTA 4CQNA 4ZHPA 4YTMB 3ZXVA 1UF0A 4F1SA 2ACZB 2D07B 3LXFA 1DOIA 2IGDA 1E8XA 2UYZB 1WFYA 1D6EC 1YOVB 2LJ5A 2DHZA 3TEXA 1N62A 5I4DA 2W55A 1GB1A 4FHKA 4K81A 4XX5A 2WXLA 3H7SA 1EU4A 2KX0A 1XLPA 4MGZE 1QT9A 2OEDA 1V1PA 3AXCA 3B9JA 1UH6A 2WHIA 2KMMA 5TSSA 3AE7B 1TS4A 4KKIA 1HTQA 3CF6E 3I9V1 1L2NA 3IG3A 2B3AA 3PREA 2FCMA 2FIDA 1GTHA 2C9WB 2DAFA 3BYYB 3A9KB 1YQ4B 2LWPA 4AJYB 2XK5B 3FC4A 4N59A 2JXXA 2KC2A 1S3SG 3HUIA 3QX1A 5AUIA 4E71A 1BT0A 1C76A 4FA6A 3I3TB 3HM6X 4EE2A 1WRIA 1ISNA 1I4RA 4HROA 3VTUA 4K7SA 1FNWA 4P1BC 4KZ0A 3ZTDA 2CHZA 2AL6A 4ZHOA 2JWUA 2M0XA 3NY5A 1TTNA 2MA9B 2ONQA 1MJDA 3ZRFA 4LNOA 3V62A 1WYWB 2UWQA 3WCQA 3WAOA 3V6CB 4C7YA 2MBQA 3EFCA 3IAS1 3BVZA 3TEYA 4BVUC 2N1VA 3GB1A 3VQIA 4RGTA 5LNK1 4G0NB 2K8CA 4WQOB 2PMVA 5E6OA 4DHJB 1JWBD 2QHOA 2DYBA 4M8MA 3ZNID 3Q8CA 2KDBA 2BPSA 3APFA 3QQ8B 3TCAA 1WX8A 3AV8A 3X0WA 4OZBA 5IN7A 2BTEA 4ZOHC 2FUHB 3N1XC 2AWTA 3ZYYX 4N6EB 2IGGA 1E10A 3W1SA 1NI3A 5BMGA 2IGHA 1TS3A 2LEKA 1GT8A 1OQRA 2K25A 4KGSA 1T5XD 3BK1A 1M94A 4L2YA 1L7YA 2NVUI 4KGTA 4A9AA 4KIKB 2CU3A 4A55A 1LXDA 1LGRA 3MJ5A 2LRUA 2CJOA 4EZLA 4DK5A 4LCDE 1D5XC 1TT5B 1WGRA 2J53A 2BKFA 3URYA 1HTOA 3MC9A 1V6EA 2YLMA 1HXYD 5CHWA 3DBRB 4ZRQA 4BFRA 3A4RA 1V97A 1C77A 1SIJA 3ETRA 4GU2A 2PKOA 3Q3OC 2Y5PA 5IKCM 4KV2A 4Q2JA 2KZRA 5C23A 3AB5A 3H8HA 4W9DA 3TEWA 1CZPA 4GDLA 1FPYA 3N1ZC 2M0AA 1I35A 1V86A 4MACA 1K50A 5AEKB 2FCNA 2EMTA 3T3OA 1VCBA 2Z8LA 2V1YA 1NBFC 5D2MB 2JU6X 3L08A 4ZYNA 3FILB 1WGGA 2DENB 4II3B 1QOFA 2QDFA 3CSFA 2KMCA 1CQVA 3PHXB 4M8NA 1ZXHA 3LB8C 1PFDA 2HTHA 3GZNI 1UNSA 3UQAA 1AARA 3EHVA 1RWSA 1T6BX 1KM7A 3GOEA 4GDLB 3NZUA 3RN9C 4OVUA 4ACFA 1XCQL 1R4MB 3R2TA 3ZQ4A 3N32A 3W1SC 1IBXA 2O6VA 3BYTB 5BYQA 4LDTB 1ENFA 2V0GA 4FHJA 3L10B 1YQ3B 3L17A 4YTNB 3AECB 2NBVB 5HG2A 1XQQA 4RFBA 1IGCA 2EMSA 1B9RA 4HKQA 4E74A 4H2AA 1TY0A 2KFKA 5D3IB 4LNFA 5FR6A 3P2BA 2KYWA 3AI5A 3Q8FA 1HA5A 4TV3A 2IO3B 1XCTL 3L13A 2K8BA 3H7PB 2WLBA 3MTNB 3CF4A 2ZCBA 5E6PA 2IDYA 1VD2A 4IDIA 2C60A 4C56C 1WI0A 5E6JA 4DHZE 5BMIA 1KLUD 3SHQA 1G6JA 4LDTD 1WF9A 2K39A 1IYFA 3NG0A 2LMCA 2N9PC 2CHWA 1GG3A 1N61A 2R2OA 2CJNA 2KFKB 2G3QB 4RGNA 3DWMA 1V2YA 3DVGX 2LGDA 4RMAA 2KDMA 2BF8B 3HVZA 4R3DA 2D3AA 4OHJA 3H1UA 3UF8A 3PTFC 1MG8A 3DPDA 3QK0A 4MELA 3WA0A 4K3BA 4XYCA 3PO0A 2KDEB 4NPNA 1L6VA 3T3NA 2BQQA 2L0TA 1N60A 3DOWA 2RR9A 4NAWB 3WAMA 2RMMA 3ALBA 5L83A 2BYFA 3TSSA 4NQKE 5G55A 1FD6A 3QCAA 4C4VB 3UIOB 2KWCA 5LLIA 4YT0B 3M62B 1WYGA 4W9FA 3ZIMA 2N7JA 4KGRA 1FRRA 4YXDB 4WWNA 2TSSA 3ZKJC 1C3TA 1T0SC 2KXJA 5C3JB 1FNVA 2GBNA 1FFVA 2W3RA 2BS3B 3L16A 3AEGB 4BBNC 2MLBA 1YX6B 4WIPA 1SIFA 2D3CA 2GBJA 4HXDA 1SE3A 1V8CA 4JIOU 4P16A 1X1MA 4XGAB 3NOBA 1JW9D 2CKHB 4G11A 1WSPA 4LJOB 3BIID 3NUHB 3ZDMC 1Z5SB 1XO3A 2KANA 1I4GA 1YN3A 3SDLC 3VH3B 2V9HA 2DZJA 1EM7A 3VXWA 2H88B 1QQRA 5G2NA 2MEKA 3BINA 1RM6C 1WX9A 2I1KA 3NS1A 4FJYA 2WWZA 5L95C 2DX5B 4TQ0A 3Q2AC 1ZKHA 1I4QA 1WGDA 2AQ2B 4TSSA 1WM2A 1WXMA 5IP4D 3JW0X 3RULA 1OFFA 1WXVA 5AZHA 3ZNHB 2DZMA 1F0ZA 2BT6A 5CX3A 2ZZPB 1HZ5A 1WR1A 2JPHA 2DNFA 1F1HA 2FAZA 3NJTA 3U30A 3KW5B 1CK1A 1Q1OA 2DWQA 2Z59B 4B9KA 5AZGA 1DOXA 4PYUA 2W9NA 4II2B 2BB5A 1TZOA 4DBGA 2IY1B 3QC8B 2GBKA 5GMVA 2M17A 2QMTA 1YQBA 5D94A 4BKGA 2N0SB 3QA8A 1TS5A 4YSZB 1OEYA 2NBWB 4C80A 5D7GA 2D11A 3EGRA 3VR8B 2FE8A 3ZJTA 3EA6A 1E7VA 3C19A 3DBSA 2Z0DB 2ZPYA 3UGBB 2LVQA 2N9KA 2W82A 3N20C 4FJZA 2O2VB 3SR6A 1FXIA 1RLFA 1IP9A 3JVZX 1CJEA 2R2QA 3A9JB 3C0RB 2EKIA 4IW0A 3UINB 2DZKA 4HJGE 2N9XA 2RPQA 3BWUD 3A4SC 3Q3JA 3Q3NC 1E9MA 1J19A 2J52A 3RD2A 4NJCA 4EOYA 4LTUA 4FADA 2J0MA 2KVRA 1KLGD 1C79A 2MX2A 4HVBA 2BGFA 1WZ0A 2L0FA 3RZFA 3ML9A 2GLSA 1ZGUB 3QAQA 3ZNGC 1C78A 1QF6A 5BMHA 1JWUD 5T8IA 4LNKA 2NPTB 4ANUA 2E3TA 3AEAB 5CTRC 1WMHB 2D2QA 4KVGB 3M95A 2MRPA 4PS7A 4KSKC 4A20A 1T3QA 1XT9B 3PVLA 1J8CA 3Q6BA 1SE2A 2FCQA 4USAA 3A9KA 1DOYA 2IO0B 2XK5A 3VTWA 2ZPNA 2L1AA 2WXPA 1TZ1A 3DHIC 3R66C 3DHHC 4X57B 4ZYSA 5LXHA 1QLBB 1ESFA 1MPEA 1GUAB 4K7WA 1GPXA 4HRSA 1WGYA 3O13A 1XLOA 1ZXIA 2VH2A 2HDEA 3GE3C 4IM0A 2G9HD 2MP2B 2ZNVC 3V3XA 3T9LA 2BW2A 1PGXA 2KN5A 2KQ7A 1WY8A 5D3DA 2JYEA 4RF0A 2JF5A 1NYQA 1R7SA 2K5PA 5JH5C 3U2SC 3IFWB 3CSTA 4RGOS 4ARIA 2KACA 2MQJA 1GC7A 4MGYE 3SFEB 1FIQA 4KX6B 2MH7A 2LGYA 3MJWA 3PSEB 2WYQA 3P4PB 2WGSA 4C00A 3PZ8A 4JPSA 2JYTA 3OJ4B 2KO3A 1XXGA 3HHMA 2GBRA 3FAHA 4IWPA 1YJIA 4MH8A 3X23A 4N9F4 3TEZA 4AWJA 3ZW3A 1U4AA 3N30A 3KYCD 3W2DA 2JX5A 3B2FA 1ZP0B 2D3BA 5FK9C 3V61A 2XEWA 3K9PB 1EO6A 3KQ4A 2IO2B 3DBRI 5BO4B 1RRBA 2JT4B 2WDRB 4M00A 1K51A 2MHJA 2WX1A 2KX3A 2R61A 4KIKA 5DPSA 3EFUA 4HK2A 3IAM1 4XZ4A 2QSDA 2BS2B 1MHXA 2GI9A 1UBQA 3PT2B 5EE0A 3OAWA 4HLEA 2N1WA 1VZ7A 2MBOA 3AE2B 5C1ZA 3ZDTA 4OW0A 4IWQA 1F9JA 2KJHB 2J4XA 4TMAB 1KRHA 2CHXA 1F52A 4M01A 2BWFA 1B1ZA 2DYMA 2WXIA 2X8XX 2WS3B 2L76A 2I38A 2DZIA 1AYFA 1C4AA 2NMQA 3DQVA 2JZPA 3P4SB 2L00B 4OVVA 2LUEA 3L0WB 4AOFA 2B76B 2D10A 1IGDA 1JROA 1R4MI 2L32A 2JXTA 3PRMB 2ASQA 4ZDVA 3MC0B 3Q3FA 4HKZE 1ZPSA 3FILA 4ICVA 1UZXB 3BY4B 1MVKA 4MM3B 1J7BA 5HI1A 1WJNA 5LXIB 2V3SA 3A1QB 4ZRKA 2QCZA 3NHEB 2HTME 1PGAA 3DVNU 2FUG1 1DGJA 3R7QA 2PVGC 3ZUNA 1D5ZC 5AZFA 1TY2A 1EWYC 3J9CA 3QARA 4WJPA 3IXSA 1ROEA 3WAPA 3MHSD 3NRZA 3CIRB 2HJ1A 2MWSB 1I42A 3RMKC 1FNUA 1Z2MA 2KLGA 2M8SA 2AYOB 5IO9A 2JUOA 5JHBA 3DBLI 4MJSB 4IM3A 2W3SA 3PS6A 3IBEA 2KLCA 1C4CA 3D32A 1TYGB 4GIVA 3NVWA 1P1AA 3KUZA 3BVGA 4L23A 2DYOA 1VDVA 1WJ6A 4RF1A 3H7PA 2JVCA 1A5RA 2G1EA 4FXCA 2NR2A 2JRHA 1JWAD 2CR5A 2KVZA 3N9YC 1Q5WB 4CYEA 2FCSA 3VRBB 3OWEB 5E6NA 1C9FA 3HM3A 2BYVE 3U4EG 1EWCA 1YNTE 4DXGA 4WWMA 3U7DA 3ZXRA 2PEAA 3HK0A 4M02A 1MG4A 1AW7A 2LFIA 2MBBB 2RDBC 3NZ3A 4LJPB 3I5JC 5DCNA 4XWWA 4YWGG 1V80A 4W9JA 2GMIC 4GLSC 2M4NA 5JXVA 3PV1A 2ZVOA 2AQ3B 5CHVC 4WWOA 3AN1A 1YMHE 2PIAA 2Y5CA 1NEKB 1WX7A 5HFYA 4UDUC 3DBLB 4WAFA 1GB4A 1E6EB 1PYWD 3QJZA 4EEWA 4NAWA 3RYTA 3DCGA 3JSVA 1GC6A 1T0RC 2INNE 1WWTA 2KWDA 2I2YA 4HPPA 4C4VA 2IO1B 5H92C 1N6ZA 3O65B 1V1OA 4YTPB 4WQMA 5IOIA 1JQ4A 4HJKA 4JWUC 1E8WA 4I6LB 3VR9B 2LJIA 2MSED 5HHDG 5JHAA 5EE3A 1ZDVA 2K6DB 5BYRA 3PPAA 2N7DA 1P0RA 4M0WB 1TKGA 2KT7A 2MJDA 2WU5B 4IUMB 2IZVB 3VAWA 3ZO5B 4PK1A 1VZ6A 2WX0A 2IJ0A 3JSVB 1P98A 3V05A 1Y56A 4IWOA 2J0JA 3RNCC 1SXTA 2ZW1A 1XLNA 2YEPF 3PRZA 1UGMA 2BYEA 3VUWA 3FKYA 4P7IA 1RYJA 2WXQA 2RD0A 1EF1A 1VR9A 4EZKA 1L4ZB 4XC2A 4DHZB 4NZLB 3RUIB 4HCNB 2INCC 2M1MA 1ZW7A 3S2AA 3KWLA 3ZLZA 3TJPA 2L7RA 1V49A 1VJKA 3ABVB 2KN4A 4NAMA 4A6QA 3W9CB 1P7FA 1SJHD 1F77A 1RFKA 1NVID 2K6QA 3RNBC 3RZWC 3MC8A 2WP9B 1XF5L 2LRWA 3MP9A 3Q69A 3E56A 4URKA 1FRDA 2QEJC 3I57A 3VUXA 1I7HA 3WALA 1HQRD 3EECA 1YD8U 1NI2A 1LM8B 3GP7A 1V5TA 1MFWA 3DVGY 1K53A 2KK8A 2RDGA 2AQ1B 1RFAA 4W9CA 1NDDA 3WIMA 3DHGC 2AX5A 1GOZA 1C4PA 3AH7A 4AJWA 1PGBA 2KOXA 3PZ7A 1OEYJ 1K8RB 1Q10A 4W9HA 2CU1A 3K9OB 3M3JA 4MSMB 4KZCA 1WGKA 4IKGA 3ZJUA 3RNEC 4JE3B 2JZ3B 2K3UA 2LXCA 2O2VA 2LVPA 4QAYA 4BOZB 3NZSA 2MBHA 4MH0E 3U8ZA 3A9JA 3AEFB 2N7EA 2WDQB 3VFKA 1T0QC 4GDKB 3B08A 1HEZE 2PJHA 2ZW0A 4O1NA 4AS1A 2WXMA 4REZA 4DDGD 1FM0D 4P6VF 4I6PA 4MEMA 3APCA 2KJRA 3ZVVA 1P7EA 1F2RI 4IM2A 1SEBD 3VHTC 4WH4A 1UWXA 2NTTA 3AEBB 1QILA 1SSNA 1D3ZA 2JSVX 4A3OA 2KTFA 2KQ4X 2RDHA 1FXAA 1E90A 1VLBA 1L0YB 1JRUA 1OGWA 1VZ8A 3U52E
chains in the Genus database with same CATH topology
3P4RB 3FAHA 3AE4B 1YJIA 2JU6X 4MH8A 4LLGM 3TEZA 3FILB 2ON8A 2XN9C 1QOFA 3W2DA 2JX5A 3B2FA 2PW9A 4RH6A 1ZP0B 2BYTA 1CQVA 2V4IB 5FK9C 1D4BA 1ZXHA 2MJ3A 3W5VB 3LB8C 1PFDA 1BXTA 1UNSA 4DXFA 1L0XB 1RWSA 1JWSD 3AMZA 3KQ4A 3MHZA 2Q5WD 5EE9A 1T6BX 3SEBA 2V3PA 2WDRB 4GDLB 3BK2A 1D5MC 3Q8BA 2LUMA 4JWSC 5FR3A 1K51A 1XCQL 1KF6B 3R2TA 4RGMA 3ZQ4A 1L5PA 2FBWB 2R61A 3VRAB 3RFZB 1IBXA 3IT4B 1MI0A 2MJEA 3BYTB 5BYQA 1ENFA 3IAM1 2V0GA 2QSDA 1YQ3B 2BS2B 1SBBB 5GXGB 1SE4A 3ZGZA 4YTNB 1PDXA 1MHXA 3AECB 5HG2A 2GI9A 2M56B 2DLBA 4JX1C 4RFBA 5EE0A 1IGCA 1SF0A 1VZ7A 4A90A 4HKQA 1B9RA 3R8BA 4H2AA 1TY0A 5D3IB 1FCLA 3AE2B 2WXHA 2INPE 1I4HA 4OW0A 3Q8FA 4ARCA 2J4XA 1HA5A 3Q8EA 4TMAB 1KRHA 3KLSX 2D5GA 1B1ZA 2PVOD 2DYMA 1XCTL 2WXIA 3CWIA 2ICIA 1QKZA 2WS3B 2I38A 4ITKA 1PUTA 2SAKA 2WLBA 1AYFA 3CF4A 1KFYB 1C4AA 2NMQA 2IDYA 2JZPA 3P4SB 1H7WA 1N5XA 3P1MA 4IDIA 2SEBD 4C56C 2WXJA 5E6JA 1JWMD 1M4VA 2B76B 5BMIA 1IGDA 1L6UA 1K52A 1KLUD 5EE1A 1UUPA 1QOGA 2W54A 1JROA 2L32A 2JXTA 2LMCA 3B2GA 1N5WA 1N61A 1N63A 2CJNA 4RGNA 3EUB2 3MC0B 2K9XA 1QOAA 2K0PA 3DWMA 4HKZE 1ZPSA 2WNMA 3FILA 1JALA 1I4XA 3NVYA 1MVKA 4MM3B 1AWDA 1J7BA 2V3NA 3LYYA 2WXRA 2KDMA 5HI1A 3HVZA 4R3DA 4OHJA 3AE9B 2HTME 5G5HA 1PGAA 1ZOYB 5FKAC 2FUG1 1DGJA 4LK0M 2PVGC 1D5ZC 1BMLC 1TY2A 1OQQA 3AE5B 4OVZA 1L4DB 1EWYC 3J9CA 3PO0A 1FO4A 3IXSA 1ROEA 4N58A 1L6VA 2QJLA 3P4QB 3NRZA 3T3NA 3CIRB 1F2RC 1N60A 2PTLA 4NAWB 4OZAA 1VRAB 3P42A 1FNUA 2RMMA 3TSSA 4AQ7A 2WXGA 1ZUD2 3IT6B 1E7PB 2BBCA 3L4PA 1FD6A 3W5UB 2W3SA 1L0VB 4D2KA 1C4CA 2NTSA 1TYGB 3UI3A 1FFUA 4YT0B 2M19A 4XDCA 3NVWA 1WYGA 1IUEA 2K22A 3R2IA 3AE8B 2N7JA 4KGRA 2KAJA 1FRRA 1V1PB 4YXDB 3BVGA 2TSSA 4L23A 2DYOA 2N9LA 1VDVA 1FCCC 4RF1A 5C3JB 1FNVA 3KWVA 2WQYB 3AM9A 1TKEA 2G1EA 3Q8AA 4FXCA 1FFVA 1JWAD 2L83A 2OHFA 2W3RA 3N9YC 2BS3B 5C2TB 3AEGB 2RPVA 1DYQA 3TUOA 1LO5D 4WIPA 1SE3A 1V8CA 3VRBB 3BVMA 3OWEB 4TQ1A 1C9FA 3SFDB 4P16A 3U4EG 1I4PA 1EWCA 1SB3C 1YNTE 5G5GA 4DXGA 1JW9D 4WWMA 3AE3B 1NENB 1WSPA 1AW7A 1EU3A 1UGJA 2LFIA 3NZ3A 4B0EA 1HZ6A 2Y3AA 4XWWA 3BIID 4MT5A 4YWGG 3NUHB 3AEDB 1XO3A 2XNAC 1I4GA 1YN3A 2IPKD 4GLSC 5JXVA 1FEHA 2WXOA 2QIEB 2AQ3B 4CQNA 4ZHPA 4YTMB 1EM7A 3AN1A 1YMHE 2H88B 1QQRA 2BB6A 2PIAA 2Y5CA 5BYSA 1NEKB 5HFYA 4PT5A 2MEKA 4UDUC 2ACZB 2LHEA 4WAFA 3LXFA 1DOIA 1RM6C 3NS1A 1GB4A 2IGDA 1E6EB 1GTEA 1PYWD 4TQ0A 1D6EC 1I4QA 1UWMA 1ZDXA 2AQ2B 1MHHE 4TSSA 1N62A 3TEXA 2J42A 1J7AA 4RNAA 5I4DA 1YN4A 2INNE 1OFFA 1WWTA 2WDVB 1ACCA 2W55A 1GB1A 2KWDA 1F0ZA 2I2YA 2BT6A 1JRPA 1HZ5A 5H92C 1V1OA 4YTPB 4WQMA 1YJJA 3U7ZA 2BS4B 2WXLA 1JQ4A 4JWUC 1CK1A 1EU4A 1TS2A 4HEA1 2DWQA 3VR9B 2LJIA 3HVDA 1XLPA 1QOBA 1QT9A 5HHDG 5EE3A 1ZDVA 2OEDA 4XDDA 5BYRA 1XLQA 1V1PA 3B9JA 1NYRA 1TKGA 1DOXA 4YSXB 2KMMA 2GB1A 3AE7B 1TS4A 5TSSA 2BB5A 4KKIA 3NVZA 1TZOA 2MJDA 2WU5B 3I9V1 4ZRPA 2QMTA 2WXKA 1TKYA 1VZ6A 2N0SB 3MFGA 1TS5A 2IJ0A 1GTHA 4YSZB 2VZKB 3V05A 3BYYB 1YQ4B 4J3OD 1Y56A 4C80A 5D7GA 3FC4A 4N59A 1SXTA 2ZW1A 3VR8B 1XLNA 2YEPF 3EGRA 3HUIA 2FE8A 3ZJTA 3EA6A 1RYJA 2WXQA 5AUIA 2DBYA 1C76A 4EE2A 1VR9A 3BZDB 1L4ZB 3DWGC 1WRIA 2N9KA 4HROA 1I4RA 2W82A 4US9A 3SR6A 4A8XC 4NZLB 1FXIA 1FNWA 1CJEA 3ZJVA 5H8YE 3KWLA 2EKIA 3RPFC 3AEEB 4HJGE 4ZHOA 1XEEA 2JWUA 1VJKA 3ABVB 1JMLA 2KN4A 2ONQA 4NAMA 4A6QA 3W9CB 1P7FA 1SJHD 3BWUD 1ET6A 1F77A 1RFKA 1E9MA 1KH0A 1NVID 2J52A 5MPOA 2VZKD 4NJCA 3WCQA 2WP9B 4LTUA 1XF5L 4DQOC 4C7ZA 4C7YA 1KLGD 1H7XA 2E6XA 1C79A 1GAQB 1JCKB 3BVZA 3IAS1 1SJED 2GRIA 3MP9A 3Q69A 3TEYA 3E56A 1A70A 3GB1A 3GS2A 1FRDA 2QEJC 3I57A 4RGTA 3VQIA 5LNK1 1TJEA 2PMVA 1ET9A 1JWBD 2L52A 2WXNA 1I7HA 4US8A 1J7CA 1STEA 1HQRD 1BUIC 3Q8CA 1YN5A 1QF6A 1C78A 4L1BA 5BMHA 3GP7A 1JWUD 5T8IA 3AV8A 1WXQA 4M0WA 4OZBA 2E3TA 3P63A 3AE6B 3AEAB 2BTEA 4ZOHC 1K53A 2H89B 1E0ZA 2RDGA 4RCOA 3ZYYX 2X38A 4N6EB 2IGGA 1E10A 2AQ1B 3W1SA 1NI3A 5AUKA 1T3QA 5BMGA 2IGHA 1TS3A 2LEKA 1GT8A 1FMAD 1OQRA 4KGSA 1SE2A 1GOZA 1T5XD 2AX5A 3BK1A 4USAA 1DOYA 1C4PA 4L2YA 3AH7A 1PGBA 3HRDD 2L1AA 2WXPA 4OZCA 3PZ7A 4XE0A 4ZYSA 1QLBB 1ESFA 1MPEA 1GPXA 1Q10A 4KGTA 4HRSA 2YEPB 4A9AA 2WXFA 3O13A 1WGKA 1XLOA 2CU3A 1IBXB 2LHDA 1ZXIA 4A55A 4IKGA 2HDEA 3ZJUA 4JE3B 2K3UA 3NVVA 2G9HD 3MJ5A 1ZE3D 2CJOA 3V3XA 4IOIE 1D5XC 4B0MA 2EELA 2BW2A 4XWTA 1PGXA 2J53A 3AEFB 3URYA 2WDQB 3C8YA 4GDKB 1HEZE 1HXYD 5D3DA 2ZW0A 1KTKA 4ZRQA 2JYEA 4O1NA 4RF0A 4YSYB 1C77A 1V97A 1SIJA 3ETRA 4AS1A 2WXMA 4REZA 2PKOA 1NYQA 1R7SA 1FM0D 2LGIA 2Y5PA 4P6VF 3E9SA 2K5PA 4Q2JA 3U2SC 3AE1B 2PLPA 1P7EA 1F2RI 4KKJA 3AB5A 3H8HA 4RGOS 4ARIA 2KACA 1SEBD 3TEWA 1CZPA 4WH4A 4WURA 1UWXA 3SFEB 1AN8A 3AEBB 1FIQA 1SSNA 4KX6B 1QILA 2JQRB 2NTTA 2MH7A 2M0AA 2JSVX 4MACA 1K50A 3P4PB 2KQ4X 3T3OA 2RDHA 2Z8LA 1FXAA 2QILA 3PZ8A 2WU2B 1L0YB 1VLBA 4JPSA 1VZ8A 2JYTA 3U52E 1XXGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AE9 B;  3P4R B;  1A70 A;  3FAH A;  1FRD A;  3AE4 B;  1YJI A;  2HTM E;  5G5H A;  1UWM A;  1TJE A;  1ZOY B;  1JWB D;  2L52 A;  1DGJ A;  2PVG C;  1I7H A;  1N62 A;  1QOF A;  4US8 A;  1J7C A;  3AE5 B;  1OQQ A;  1J7A A;  2JX5 A;  3B2F A;  1EWY C;  1OFF A;  3PO0 A;  1ZP0 B;  1FO4 A;  1WWT A;  2WDV B;  1ROE A;  4N58 A;  2W55 A;  1QF6 A;  1L6V A;  2QJL A;  3P4Q B;  3NRZ A;  1F0Z A;  2BT6 A;  1JRP A;  3CIR B;  1N60 A;  5H92 C;  2MJ3 A;  3W9C B;  3W5V B;  3LB8 C;  3AV8 A;  1WXQ A;  1PFD A;  4YTP B;  2E3T A;  3AE6 B;  3P63 A;  3AEA B;  4WQM A;  1YJJ A;  2BS4 B;  1RWS A;  3AMZ A;  4ZOH C;  2Q5W D;  5EE9 A;  1JQ4 A;  2H89 B;  4JWU C;  1E0Z A;  2WDR B;  2DWQ A;  3ZYY X;  3VR9 B;  1ZUD 2;  4N6E B;  1E7P B;  1XLP A;  1QOB A;  4JWS C;  1E10 A;  1QT9 A;  5EE3 A;  3L4P A;  1KF6 B;  1XLQ A;  3W5U B;  2W3S A;  1L5P A;  2FBW B;  1NI3 A;  1L0V B;  3VRA B;  1NYR A;  1T3Q A;  3B9J A;  1TKG A;  5AUK A;  4YSX B;  1DOX A;  2KMM A;  2LEK A;  1GT8 A;  3AE7 B;  1FMA D;  1OQR A;  1TYG B;  2MJE A;  2AX5 A;  3B2G A;  4USA A;  3NVZ A;  1FFU A;  1DOY A;  4YT0 B;  2M19 A;  2MJD A;  1YQ3 B;  2BS2 B;  3AH7 A;  3HRD D;  2WU5 B;  5GXG B;  4YTN B;  1PDX A;  1WYG A;  3NVW A;  1IUE A;  3AEC B;  2K22 A;  1TKY A;  2M56 B;  3AE8 B;  4JX1 C;  2N0S B;  2KAJ A;  5EE0 A;  1FRR A;  1QLB B;  4YXD B;  1GPX A;  1SF0 A;  4HRS A;  1B9R A;  4A9A A;  1GTH A;  1WGK A;  1XLO A;  4YSZ B;  1VDV A;  2CU3 A;  3AE2 B;  1ZXI A;  5C3J B;  1YQ4 B;  4C80 A;  2WQY B;  3AM9 A;  1TKE A;  2G1E A;  3FC4 A;  3NVV A;  4FXC A;  4N59 A;  1FFV A;  3VR8 B;  1JWA D;  1XLN A;  2CJO A;  2L83 A;  2OHF A;  3HUI A;  1KRH A;  2W3R A;  2BS3 B;  1RYJ A;  5AUI A;  2PVO D;  5C2T B;  2DBY A;  3AEG B;  3CWI A;  3AEF B;  2WS3 B;  4ITK A;  2WDQ B;  1V8C A;  3VRB B;  1PUT A;  2WLB A;  1AYF A;  3SFD B;  3DWG C;  3CF4 A;  1KFY B;  1WRI A;  4HRO A;  4US9 A;  1SB3 C;  3SR6 A;  3P4S B;  1H7W A;  1N5X A;  4YSY B;  1FXI A;  1V97 A;  3P1M A;  1SIJ A;  3ETR A;  4IDI A;  1JW9 D;  4WWM A;  5G5G A;  2PKO A;  1NYQ A;  1CJE A;  1FM0 D;  1R7S A;  3AE3 B;  4P6V F;  1NEN B;  2K5P A;  5H8Y E;  2B76 B;  3KWL A;  3AE1 B;  1L6U A;  2EKI A;  3RPF C;  3AEE B;  5EE1 A;  3BII D;  4ZHO A;  3AB5 A;  1QOG A;  2W54 A;  1VJK A;  3AED B;  1CZP A;  3ABV B;  1JRO A;  1XO3 A;  3SFE B;  1FIQ A;  3AEB B;  1N5W A;  4KX6 B;  1N61 A;  1N63 A;  2JQR B;  2QIE B;  2CJN A;  2MH7 A;  1RFK A;  3EUB 2;  2K9X A;  1QOA A;  1E9M A;  3DWM A;  4ZHP A;  4YTM B;  1NVI D;  5MPO A;  1JAL A;  3AN1 A;  2H88 B;  3P4P B;  2PIA A;  2Y5C A;  3WCQ A;  2WP9 B;  3NVY A;  4LTU A;  1AWD A;  1J7B A;  1NEK B;  1FXA A;  4C7Z A;  4C7Y A;  2WU2 B;  1VLB A;  1H7X A;  2ACZ B;  3LXF A;  1DOI A;  1RM6 C;  3HVZ A;  3NS1 A;  1GAQ B;  1E6E B;  1GTE A; 
#chains in the Genus database with same CATH topology
 3P4R B;  1EF5 A;  4LLG M;  2NPT A;  2IYD B;  4B6W A;  2KQS A;  2ON8 A;  1WMH A;  2XN9 C;  3PHW B;  3KYD D;  2KFJ A;  1Y8R C;  2LI5 A;  2PW9 A;  4RH6 A;  2JZZ A;  2KC1 A;  2J0K A;  3LJ3 A;  1E5W A;  1BXT A;  1IPG A;  4DXF A;  2AL3 A;  4WAA A;  3AMZ A;  1JWS D;  3MHZ A;  2Q5W D;  4JQW C;  5EE9 A;  3SEB A;  2V3P A;  2KWU B;  4ZRJ A;  3Q8B A;  1P9D U;  5FR3 A;  1KF6 B;  4RGM A;  3VRA B;  2LGX A;  4HWI B;  1SBB B;  1SE4 A;  3ZGZ A;  4WJN A;  2MP2 A;  1PDX A;  2DLB A;  1SE9 A;  1TGZ B;  1V81 A;  3R8B A;  1FCL A;  2INP E;  2KD0 A;  3Q8E A;  2IBI B;  3KLS X;  2D5G A;  2PVO D;  3ML8 A;  3CWI A;  4EZJ A;  4ITK A;  4TUU A;  1WXS A;  1KFY B;  1H7W A;  2EKE C;  1WXA A;  1N5X A;  4MGK E;  4BOS C;  2WXJ A;  4NNJ B;  1JWM D;  2I1J A;  1L6U A;  3ENE A;  2BKR B;  5EE1 A;  1QOG A;  4IG7 B;  4PS8 A;  4MGI E;  3KH0 A;  2KTR B;  1N5W A;  1N63 A;  1QOA A;  2K0P A;  2WNM A;  4ANX A;  2KNB A;  5JZE B;  3OLM D;  1OQY A;  2J7Q B;  4LNI A;  5DPW A;  3AE9 B;  3H9D A;  2OJW A;  5KHQ A;  1BML C;  2XBB C;  3L54 A;  3SU8 X;  1FO4 A;  4N58 A;  2PE6 B;  3P4Q B;  2HD5 B;  1F2R C;  2DAJ A;  3IVF A;  2PTL A;  1VRA B;  3P42 A;  4B95 A;  2GOW A;  4FBJ B;  1HE8 A;  2ZVN A;  2WXG A;  3IT6 B;  2BBC A;  3ZNZ B;  4E3C A;  1L0V B;  4D2K A;  2REX A;  1WRD B;  4BKS D;  3UI3 A;  1E8Y A;  3M63 B;  3QWZ B;  2M19 A;  4XDC A;  3IHP C;  3AE8 B;  1V1P B;  4GOC A;  2N9E B;  1V5O A;  1FCC C;  2BWE S;  3AM9 A;  1TKE A;  2C5L C;  2K1F A;  2OHF A;  1T0Y A;  5TR5 A;  4G50 A;  1DYQ A;  3RNA C;  4WJO A;  3KVF B;  3BVM A;  3VH4 B;  3SFD B;  4W9K A;  4S0R A;  2WDT B;  1I4P A;  5J2R A;  2A4Z A;  4PYZ A;  5CHF A;  1R4N I;  2KMA A;  2ZCC A;  5HKH A;  4DXA B;  1NEN B;  2NS5 A;  5EDS A;  1EU3 A;  4B0E A;  4RM8 A;  4MM3 A;  1QZE A;  1XD3 B;  3A1Q A;  2IPK D;  2LVO A;  1FEH A;  2QIE B;  2JWZ A;  4HPM B;  3VVW B;  5BYS A;  2BB6 A;  1EUV B;  5IAA C;  4PT5 A;  3V60 A;  2LHE A;  1WM3 A;  1GTE A;  2A5U A;  4W9G A;  1UWM A;  1ZDX A;  1MHH E;  2C7M B;  2J42 A;  1J7A A;  4RNA A;  1YN4 A;  4GSW A;  2C7N B;  3CMM B;  2WDV B;  1ACC A;  4MJS A;  1JRP A;  1E8Z A;  2VRR B;  3HIZ A;  3N1Y C;  2MCN B;  4J6I A;  1YJJ A;  3U7Z A;  2BS4 B;  4HDO A;  4DHJ D;  4F7Z A;  1TS2 A;  4HEA 1;  3HVD A;  1QOB A;  4XDD A;  1XLQ A;  4FN2 A;  1NYR A;  4YSX B;  3UIP B;  2GB1 A;  4KDI C;  2KDI A;  1YX5 B;  3NVZ A;  2NCN A;  4ZRP A;  2WXK A;  1TKY A;  2KDF B;  4F8C B;  4EKU A;  1R4N B;  4MSQ B;  3MFG A;  2VZK B;  4J3O D;  2KHW B;  1WH3 A;  2DBY A;  3VTV A;  5KHO A;  4GN1 A;  3EC8 A;  4W9E A;  3BZD B;  3DWG C;  3KUD B;  2OOB B;  4US9 A;  4A8X C;  4FUL A;  2PE9 A;  4ANV A;  5H8Y E;  3ZJV A;  3RPF C;  3AEE B;  2JRI B;  2LZ6 A;  1XEE A;  2YVC A;  1UD7 A;  2MBE A;  3SD5 A;  1JML A;  3OJ3 A;  2AEH A;  3RT3 B;  4RM9 A;  1ET6 A;  2LD9 A;  2CS4 A;  2MW5 A;  1KH0 A;  5MPO A;  1UEL A;  2VZK D;  4DQO C;  4C7Z A;  2E6X A;  1H7X A;  3APD A;  1GAQ B;  1JCK B;  3ECI A;  4K1R B;  1SJE D;  2GRI A;  4TKN A;  1A70 A;  3GS2 A;  1TJE A;  1P3Q U;  1ET9 A;  2L52 A;  2WXN A;  4US8 A;  1J7C A;  1STE A;  1BUI C;  1YN5 A;  4L1B A;  2FNJ B;  3PLV A;  4NQL B;  1WXQ A;  4M0W A;  3R3M A;  3P63 A;  3AE6 B;  5J18 A;  2H89 B;  4YL8 A;  1E0Z A;  4EUT A;  3WAN A;  4RCO A;  3LDZ E;  2X38 A;  3Q3M C;  4GB9 A;  5J17 A;  2N4F A;  2UU7 A;  4K7U A;  4WWP A;  3B1L X;  3DBH I;  2PPH A;  3TL5 A;  5AUK A;  4AUQ C;  1FMA D;  3ONS A;  4HDQ A;  1GJZ A;  3RNG C;  2ZJD A;  1J0G A;  3HRD D;  4OZC A;  4NJ6 A;  3PRP B;  4XE0 A;  3TIX A;  3JYU A;  2YEP B;  2WXF A;  4JGH B;  1IBX B;  2O6V B;  2LHD A;  3VDZ A;  1KLV A;  4P1C C;  2JY6 A;  3H6N A;  3NVV A;  2ZEQ A;  1ZE3 D;  1FXT B;  3AU5 A;  3PZD A;  4IOI E;  4B0M A;  2EEL A;  4XWT A;  4BZA A;  3V6E B;  2NBU A;  3NS8 A;  3C8Y A;  3GZN B;  5D6J B;  2D3G A;  1WE7 A;  1KTK A;  3R7R A;  4YSY B;  2K8H A;  1RAX A;  2LGI A;  3E9S A;  3AUL A;  1E7U A;  2KWV B;  3AE1 B;  4JLC A;  2PLP A;  1WIA A;  4KKJ A;  1LFD A;  3I63 C;  4WUR A;  2G4S A;  1AN8 A;  1WE6 A;  2JQR B;  1SGH A;  2O6V D;  3ZTC A;  2QIL A;  2LGS A;  2WU2 B;  3DDC B;  3AE4 B;  3DBH B;  2HJ8 A;  4K3C A;  4BBN F;  2OJR A;  1TBE A;  2G4D B;  1WR6 E;  2BYT A;  2V4I B;  2LAS A;  1D4B A;  4NJ7 A;  4GMV A;  2MJ3 A;  1YIW A;  3W5V B;  2V4L A;  2HE7 A;  1C1Y B;  2C7H A;  4FJV B;  1L0X B;  4HPL B;  1H8C A;  3GE8 C;  3DVN V;  3BK2 A;  1D5M C;  2LUM A;  4JWS C;  4DDI D;  2Y5B B;  5DPR A;  1WZ3 A;  1L5P A;  2FBW B;  3RCZ A;  1OTR B;  4NY0 A;  3RFZ B;  3IT4 B;  1MI0 A;  2MJE A;  4WJQ A;  2VH1 A;  3TMP B;  5GXG B;  1YJ1 A;  2M56 B;  4JX1 C;  3OG5 A;  1SF0 A;  4A90 A;  3VUY A;  2WXH A;  4HCP B;  1WJU A;  4GGQ A;  1I4H A;  4S17 A;  4G3X B;  3KUC B;  2G45 B;  4CHK A;  4GDK A;  4LNN A;  4ARC A;  1H4R A;  4FLH A;  4PS3 A;  3W1Y A;  2GBM A;  4ANW A;  2ICI A;  1QKZ A;  4ICU A;  1CMX B;  1GNU A;  1PUT A;  2SAK A;  3UQB A;  2RSU A;  1WGH A;  3P1M A;  2SEB D;  1V9J A;  1S1Q B;  1M4V A;  1KOT A;  1K52 A;  2FIF A;  1UUP A;  2W54 A;  2L05 A;  2IY0 B;  3B2G A;  3EUB 2;  2K9X A;  2QC8 A;  1JAL A;  1Q0W B;  3B0A A;  1I4X A;  4JL9 A;  3NVY A;  1AWD A;  2V3N A;  3LYY A;  3N3K B;  2WXR A;  4DWF A;  4A3P A;  2BVC A;  5G5H A;  1ZOY B;  5FKA C;  4LK0 M;  4GXB A;  1OQQ A;  3AE5 B;  4OVZ A;  4IC7 B;  2KJ6 A;  1L4D B;  2LXA A;  2QJL A;  4ASW C;  4KDL B;  2L8J A;  4OZA A;  2Z0E B;  3A33 B;  4AQ7 A;  1ZUD 2;  1PQS A;  1E7P B;  3L4P A;  3W5U B;  2RGF A;  2NTS A;  3ZRC A;  1FFU A;  1IUE A;  2K22 A;  3R2I A;  4W9I A;  5DPT A;  2KAJ A;  4EFO A;  4CO7 A;  3PLU A;  2N9L A;  2IND C;  4MDK E;  3KWV A;  2WQY B;  3PGE A;  3Q8A A;  2L83 A;  3AU4 A;  2KKC A;  4W9L A;  3QIJ A;  3TBL D;  5C2T B;  2RPV A;  1TIF A;  4I6N B;  1LO5 D;  3TUO A;  2L3Z A;  1KJT A;  2ZNV B;  4TQ1 A;  4BAX A;  4ZRI A;  1SB3 C;  2KTR A;  1LQB A;  5G5G A;  4AP4 C;  5IA7 A;  3AE3 B;  3RI7 C;  4KSL C;  1UGJ A;  4BKS A;  1HZ6 A;  3QHT A;  2Y3A A;  3Q14 C;  1UBI A;  4MT5 A;  3RNF C;  3AED B;  2XNA C;  1WJ4 A;  2WXO A;  3T8M A;  4BKT A;  4CQN A;  4ZHP A;  4YTM B;  3ZXV A;  1UF0 A;  4F1S A;  2ACZ B;  2D07 B;  3LXF A;  1DOI A;  2IGD A;  1E8X A;  2UYZ B;  1WFY A;  1D6E C;  1YOV B;  2LJ5 A;  2DHZ A;  3TEX A;  1N62 A;  5I4D A;  2W55 A;  1GB1 A;  4FHK A;  4K81 A;  4XX5 A;  2WXL A;  3H7S A;  1EU4 A;  2KX0 A;  1XLP A;  4MGZ E;  1QT9 A;  2OED A;  1V1P A;  3AXC A;  3B9J A;  1UH6 A;  2WHI A;  2KMM A;  5TSS A;  3AE7 B;  1TS4 A;  4KKI A;  1HTQ A;  3CF6 E;  3I9V 1;  1L2N A;  3IG3 A;  2B3A A;  3PRE A;  2FCM A;  2FID A;  1GTH A;  2C9W B;  2DAF A;  3BYY B;  3A9K B;  1YQ4 B;  2LWP A;  4AJY B;  2XK5 B;  3FC4 A;  4N59 A;  2JXX A;  2KC2 A;  1S3S G;  3HUI A;  3QX1 A;  5AUI A;  4E71 A;  1BT0 A;  1C76 A;  4FA6 A;  3I3T B;  3HM6 X;  4EE2 A;  1WRI A;  1ISN A;  1I4R A;  4HRO A;  3VTU A;  4K7S A;  1FNW A;  4P1B C;  4KZ0 A;  3ZTD A;  2CHZ A;  2AL6 A;  4ZHO A;  2JWU A;  2M0X A;  3NY5 A;  1TTN A;  2MA9 B;  2ONQ A;  1MJD A;  3ZRF A;  4LNO A;  3V62 A;  1WYW B;  2UWQ A;  3WCQ A;  3WAO A;  3V6C B;  4C7Y A;  2MBQ A;  3EFC A;  3IAS 1;  3BVZ A;  3TEY A;  4BVU C;  2N1V A;  3GB1 A;  3VQI A;  4RGT A;  5LNK 1;  4G0N B;  2K8C A;  4WQO B;  2PMV A;  5E6O A;  4DHJ B;  1JWB D;  2QHO A;  2DYB A;  4M8M A;  3ZNI D;  3Q8C A;  2KDB A;  2BPS A;  3APF A;  3QQ8 B;  3TCA A;  1WX8 A;  3AV8 A;  3X0W A;  4OZB A;  5IN7 A;  2BTE A;  4ZOH C;  2FUH B;  3N1X C;  2AWT A;  3ZYY X;  4N6E B;  2IGG A;  1E10 A;  3W1S A;  1NI3 A;  5BMG A;  2IGH A;  1TS3 A;  2LEK A;  1GT8 A;  1OQR A;  2K25 A;  4KGS A;  1T5X D;  3BK1 A;  1M94 A;  4L2Y A;  1L7Y A;  2NVU I;  4KGT A;  4A9A A;  4KIK B;  2CU3 A;  4A55 A;  1LXD A;  1LGR A;  3MJ5 A;  2LRU A;  2CJO A;  4EZL A;  4DK5 A;  4LCD E;  1D5X C;  1TT5 B;  1WGR A;  2J53 A;  2BKF A;  3URY A;  1HTO A;  3MC9 A;  1V6E A;  2YLM A;  1HXY D;  5CHW A;  3DBR B;  4ZRQ A;  4BFR A;  3A4R A;  1V97 A;  1C77 A;  1SIJ A;  3ETR A;  4GU2 A;  2PKO A;  3Q3O C;  2Y5P A;  5IKC M;  4KV2 A;  4Q2J A;  2KZR A;  5C23 A;  3AB5 A;  3H8H A;  4W9D A;  3TEW A;  1CZP A;  4GDL A;  1FPY A;  3N1Z C;  2M0A A;  1I35 A;  1V86 A;  4MAC A;  1K50 A;  5AEK B;  2FCN A;  2EMT A;  3T3O A;  1VCB A;  2Z8L A;  2V1Y A;  1NBF C;  5D2M B;  2JU6 X;  3L08 A;  4ZYN A;  3FIL B;  1WGG A;  2DEN B;  4II3 B;  1QOF A;  2QDF A;  3CSF A;  2KMC A;  1CQV A;  3PHX B;  4M8N A;  1ZXH A;  3LB8 C;  1PFD A;  2HTH A;  3GZN I;  1UNS A;  3UQA A;  1AAR A;  3EHV A;  1RWS A;  1T6B X;  1KM7 A;  3GOE A;  4GDL B;  3NZU A;  3RN9 C;  4OVU A;  4ACF A;  1XCQ L;  1R4M B;  3R2T A;  3ZQ4 A;  3N32 A;  3W1S C;  1IBX A;  2O6V A;  3BYT B;  5BYQ A;  4LDT B;  1ENF A;  2V0G A;  4FHJ A;  3L10 B;  1YQ3 B;  3L17 A;  4YTN B;  3AEC B;  2NBV B;  5HG2 A;  1XQQ A;  4RFB A;  1IGC A;  2EMS A;  1B9R A;  4HKQ A;  4E74 A;  4H2A A;  1TY0 A;  2KFK A;  5D3I B;  4LNF A;  5FR6 A;  3P2B A;  2KYW A;  3AI5 A;  3Q8F A;  1HA5 A;  4TV3 A;  2IO3 B;  1XCT L;  3L13 A;  2K8B A;  3H7P B;  2WLB A;  3MTN B;  3CF4 A;  2ZCB A;  5E6P A;  2IDY A;  1VD2 A;  4IDI A;  2C60 A;  4C56 C;  1WI0 A;  5E6J A;  4DHZ E;  5BMI A;  1KLU D;  3SHQ A;  1G6J A;  4LDT D;  1WF9 A;  2K39 A;  1IYF A;  3NG0 A;  2LMC A;  2N9P C;  2CHW A;  1GG3 A;  1N61 A;  2R2O A;  2CJN A;  2KFK B;  2G3Q B;  4RGN A;  3DWM A;  1V2Y A;  3DVG X;  2LGD A;  4RMA A;  2KDM A;  2BF8 B;  3HVZ A;  4R3D A;  2D3A A;  4OHJ A;  3H1U A;  3UF8 A;  3PTF C;  1MG8 A;  3DPD A;  3QK0 A;  4MEL A;  3WA0 A;  4K3B A;  4XYC A;  3PO0 A;  2KDE B;  4NPN A;  1L6V A;  3T3N A;  2BQQ A;  2L0T A;  1N60 A;  3DOW A;  2RR9 A;  4NAW B;  3WAM A;  2RMM A;  3ALB A;  5L83 A;  2BYF A;  3TSS A;  4NQK E;  5G55 A;  1FD6 A;  3QCA A;  4C4V B;  3UIO B;  2KWC A;  5LLI A;  4YT0 B;  3M62 B;  1WYG A;  4W9F A;  3ZIM A;  2N7J A;  4KGR A;  1FRR A;  4YXD B;  4WWN A;  2TSS A;  3ZKJ C;  1C3T A;  1T0S C;  2KXJ A;  5C3J B;  1FNV A;  2GBN A;  1FFV A;  2W3R A;  2BS3 B;  3L16 A;  3AEG B;  4BBN C;  2MLB A;  1YX6 B;  4WIP A;  1SIF A;  2D3C A;  2GBJ A;  4HXD A;  1SE3 A;  1V8C A;  4JIO U;  4P16 A;  1X1M A;  4XGA B;  3NOB A;  1JW9 D;  2CKH B;  4G11 A;  1WSP A;  4LJO B;  3BII D;  3NUH B;  3ZDM C;  1Z5S B;  1XO3 A;  2KAN A;  1I4G A;  1YN3 A;  3SDL C;  3VH3 B;  2V9H A;  2DZJ A;  1EM7 A;  3VXW A;  2H88 B;  1QQR A;  5G2N A;  2MEK A;  3BIN A;  1RM6 C;  1WX9 A;  2I1K A;  3NS1 A;  4FJY A;  2WWZ A;  5L95 C;  2DX5 B;  4TQ0 A;  3Q2A C;  1ZKH A;  1I4Q A;  1WGD A;  2AQ2 B;  4TSS A;  1WM2 A;  1WXM A;  5IP4 D;  3JW0 X;  3RUL A;  1OFF A;  1WXV A;  5AZH A;  3ZNH B;  2DZM A;  1F0Z A;  2BT6 A;  5CX3 A;  2ZZP B;  1HZ5 A;  1WR1 A;  2JPH A;  2DNF A;  1F1H A;  2FAZ A;  3NJT A;  3U30 A;  3KW5 B;  1CK1 A;  1Q1O A;  2DWQ A;  2Z59 B;  4B9K A;  5AZG A;  1DOX A;  4PYU A;  2W9N A;  4II2 B;  2BB5 A;  1TZO A;  4DBG A;  2IY1 B;  3QC8 B;  2GBK A;  5GMV A;  2M17 A;  2QMT A;  1YQB A;  5D94 A;  4BKG A;  2N0S B;  3QA8 A;  1TS5 A;  4YSZ B;  1OEY A;  2NBW B;  4C80 A;  5D7G A;  2D11 A;  3EGR A;  3VR8 B;  2FE8 A;  3ZJT A;  3EA6 A;  1E7V A;  3C19 A;  3DBS A;  2Z0D B;  2ZPY A;  3UGB B;  2LVQ A;  2N9K A;  2W82 A;  3N20 C;  4FJZ A;  2O2V B;  3SR6 A;  1FXI A;  1RLF A;  1IP9 A;  3JVZ X;  1CJE A;  2R2Q A;  3A9J B;  3C0R B;  2EKI A;  4IW0 A;  3UIN B;  2DZK A;  4HJG E;  2N9X A;  2RPQ A;  3BWU D;  3A4S C;  3Q3J A;  3Q3N C;  1E9M A;  1J19 A;  2J52 A;  3RD2 A;  4NJC A;  4EOY A;  4LTU A;  4FAD A;  2J0M A;  2KVR A;  1KLG D;  1C79 A;  2MX2 A;  4HVB A;  2BGF A;  1WZ0 A;  2L0F A;  3RZF A;  3ML9 A;  2GLS A;  1ZGU B;  3QAQ A;  3ZNG C;  1C78 A;  1QF6 A;  5BMH A;  1JWU D;  5T8I A;  4LNK A;  2NPT B;  4ANU A;  2E3T A;  3AEA B;  5CTR C;  1WMH B;  2D2Q A;  4KVG B;  3M95 A;  2MRP A;  4PS7 A;  4KSK C;  4A20 A;  1T3Q A;  1XT9 B;  3PVL A;  1J8C A;  3Q6B A;  1SE2 A;  2FCQ A;  4USA A;  3A9K A;  1DOY A;  2IO0 B;  2XK5 A;  3VTW A;  2ZPN A;  2L1A A;  2WXP A;  1TZ1 A;  3DHI C;  3R66 C;  3DHH C;  4X57 B;  4ZYS A;  5LXH A;  1QLB B;  1ESF A;  1MPE A;  1GUA B;  4K7W A;  1GPX A;  4HRS A;  1WGY A;  3O13 A;  1XLO A;  1ZXI A;  2VH2 A;  2HDE A;  3GE3 C;  4IM0 A;  2G9H D;  2MP2 B;  2ZNV C;  3V3X A;  3T9L A;  2BW2 A;  1PGX A;  2KN5 A;  2KQ7 A;  1WY8 A;  5D3D A;  2JYE A;  4RF0 A;  2JF5 A;  1NYQ A;  1R7S A;  2K5P A;  5JH5 C;  3U2S C;  3IFW B;  3CST A;  4RGO S;  4ARI A;  2KAC A;  2MQJ A;  1GC7 A;  4MGY E;  3SFE B;  1FIQ A;  4KX6 B;  2MH7 A;  2LGY A;  3MJW A;  3PSE B;  2WYQ A;  3P4P B;  2WGS A;  4C00 A;  3PZ8 A;  4JPS A;  2JYT A;  3OJ4 B;  2KO3 A;  1XXG A;  3HHM A;  2GBR A;  3FAH A;  4IWP A;  1YJI A;  4MH8 A;  3X23 A;  4N9F 4;  3TEZ A;  4AWJ A;  3ZW3 A;  1U4A A;  3N30 A;  3KYC D;  3W2D A;  2JX5 A;  3B2F A;  1ZP0 B;  2D3B A;  5FK9 C;  3V61 A;  2XEW A;  3K9P B;  1EO6 A;  3KQ4 A;  2IO2 B;  3DBR I;  5BO4 B;  1RRB A;  2JT4 B;  2WDR B;  4M00 A;  1K51 A;  2MHJ A;  2WX1 A;  2KX3 A;  2R61 A;  4KIK A;  5DPS A;  3EFU A;  4HK2 A;  3IAM 1;  4XZ4 A;  2QSD A;  2BS2 B;  1MHX A;  2GI9 A;  1UBQ A;  3PT2 B;  5EE0 A;  3OAW A;  4HLE A;  2N1W A;  1VZ7 A;  2MBO A;  3AE2 B;  5C1Z A;  3ZDT A;  4OW0 A;  4IWQ A;  1F9J A;  2KJH B;  2J4X A;  4TMA B;  1KRH A;  2CHX A;  1F52 A;  4M01 A;  2BWF A;  1B1Z A;  2DYM A;  2WXI A;  2X8X X;  2WS3 B;  2L76 A;  2I38 A;  2DZI A;  1AYF A;  1C4A A;  2NMQ A;  3DQV A;  2JZP A;  3P4S B;  2L00 B;  4OVV A;  2LUE A;  3L0W B;  4AOF A;  2B76 B;  2D10 A;  1IGD A;  1JRO A;  1R4M I;  2L32 A;  2JXT A;  3PRM B;  2ASQ A;  4ZDV A;  3MC0 B;  3Q3F A;  4HKZ E;  1ZPS A;  3FIL A;  4ICV A;  1UZX B;  3BY4 B;  1MVK A;  4MM3 B;  1J7B A;  5HI1 A;  1WJN A;  5LXI B;  2V3S A;  3A1Q B;  4ZRK A;  2QCZ A;  3NHE B;  2HTM E;  1PGA A;  3DVN U;  2FUG 1;  1DGJ A;  3R7Q A;  2PVG C;  3ZUN A;  1D5Z C;  5AZF A;  1TY2 A;  1EWY C;  3J9C A;  3QAR A;  4WJP A;  3IXS A;  1ROE A;  3WAP A;  3MHS D;  3NRZ A;  3CIR B;  2HJ1 A;  2MWS B;  1I42 A;  3RMK C;  1FNU A;  1Z2M A;  2KLG A;  2M8S A;  2AYO B;  5IO9 A;  2JUO A;  5JHB A;  3DBL I;  4MJS B;  4IM3 A;  2W3S A;  3PS6 A;  3IBE A;  2KLC A;  1C4C A;  3D32 A;  1TYG B;  4GIV A;  3NVW A;  1P1A A;  3KUZ A;  3BVG A;  4L23 A;  2DYO A;  1VDV A;  1WJ6 A;  4RF1 A;  3H7P A;  2JVC A;  1A5R A;  2G1E A;  4FXC A;  2NR2 A;  2JRH A;  1JWA D;  2CR5 A;  2KVZ A;  3N9Y C;  1Q5W B;  4CYE A;  2FCS A;  3VRB B;  3OWE B;  5E6N A;  1C9F A;  3HM3 A;  2BYV E;  3U4E G;  1EWC A;  1YNT E;  4DXG A;  4WWM A;  3U7D A;  3ZXR A;  2PEA A;  3HK0 A;  4M02 A;  1MG4 A;  1AW7 A;  2LFI A;  2MBB B;  2RDB C;  3NZ3 A;  4LJP B;  3I5J C;  5DCN A;  4XWW A;  4YWG G;  1V80 A;  4W9J A;  2GMI C;  4GLS C;  2M4N A;  5JXV A;  3PV1 A;  2ZVO A;  2AQ3 B;  5CHV C;  4WWO A;  3AN1 A;  1YMH E;  2PIA A;  2Y5C A;  1NEK B;  1WX7 A;  5HFY A;  4UDU C;  3DBL B;  4WAF A;  1GB4 A;  1E6E B;  1PYW D;  3QJZ A;  4EEW A;  4NAW A;  3RYT A;  3DCG A;  3JSV A;  1GC6 A;  1T0R C;  2INN E;  1WWT A;  2KWD A;  2I2Y A;  4HPP A;  4C4V A;  2IO1 B;  5H92 C;  1N6Z A;  3O65 B;  1V1O A;  4YTP B;  4WQM A;  5IOI A;  1JQ4 A;  4HJK A;  4JWU C;  1E8W A;  4I6L B;  3VR9 B;  2LJI A;  2MSE D;  5HHD G;  5JHA A;  5EE3 A;  1ZDV A;  2K6D B;  5BYR A;  3PPA A;  2N7D A;  1P0R A;  4M0W B;  1TKG A;  2KT7 A;  2MJD A;  2WU5 B;  4IUM B;  2IZV B;  3VAW A;  3ZO5 B;  4PK1 A;  1VZ6 A;  2WX0 A;  2IJ0 A;  3JSV B;  1P98 A;  3V05 A;  1Y56 A;  4IWO A;  2J0J A;  3RNC C;  1SXT A;  2ZW1 A;  1XLN A;  2YEP F;  3PRZ A;  1UGM A;  2BYE A;  3VUW A;  3FKY A;  4P7I A;  1RYJ A;  2WXQ A;  2RD0 A;  1EF1 A;  1VR9 A;  4EZK A;  1L4Z B;  4XC2 A;  4DHZ B;  4NZL B;  3RUI B;  4HCN B;  2INC C;  2M1M A;  1ZW7 A;  3S2A A;  3KWL A;  3ZLZ A;  3TJP A;  2L7R A;  1V49 A;  1VJK A;  3ABV B;  2KN4 A;  4NAM A;  4A6Q A;  3W9C B;  1P7F A;  1SJH D;  1F77 A;  1RFK A;  1NVI D;  2K6Q A;  3RNB C;  3RZW C;  3MC8 A;  2WP9 B;  1XF5 L;  2LRW A;  3MP9 A;  3Q69 A;  3E56 A;  4URK A;  1FRD A;  2QEJ C;  3I57 A;  3VUX A;  1I7H A;  3WAL A;  1HQR D;  3EEC A;  1YD8 U;  1NI2 A;  1LM8 B;  3GP7 A;  1V5T A;  1MFW A;  3DVG Y;  1K53 A;  2KK8 A;  2RDG A;  2AQ1 B;  1RFA A;  4W9C A;  1NDD A;  3WIM A;  3DHG C;  2AX5 A;  1GOZ A;  1C4P A;  3AH7 A;  4AJW A;  1PGB A;  2KOX A;  3PZ7 A;  1OEY J;  1K8R B;  1Q10 A;  4W9H A;  2CU1 A;  3K9O B;  3M3J A;  4MSM B;  4KZC A;  1WGK A;  4IKG A;  3ZJU A;  3RNE C;  4JE3 B;  2JZ3 B;  2K3U A;  2LXC A;  2O2V A;  2LVP A;  4QAY A;  4BOZ B;  3NZS A;  2MBH A;  4MH0 E;  3U8Z A;  3A9J A;  3AEF B;  2N7E A;  2WDQ B;  3VFK A;  1T0Q C;  4GDK B;  3B08 A;  1HEZ E;  2PJH A;  2ZW0 A;  4O1N A;  4AS1 A;  2WXM A;  4REZ A;  4DDG D;  1FM0 D;  4P6V F;  4I6P A;  4MEM A;  3APC A;  2KJR A;  3ZVV A;  1P7E A;  1F2R I;  4IM2 A;  1SEB D;  3VHT C;  4WH4 A;  1UWX A;  2NTT A;  3AEB B;  1QIL A;  1SSN A;  1D3Z A;  2JSV X;  4A3O A;  2KTF A;  2KQ4 X;  2RDH A;  1FXA A;  1E90 A;  1VLB A;  1L0Y B;  1JRU A;  1OGW A;  1VZ8 A;  3U52 E; 
#chains in the Genus database with same CATH homology
 3P4R B;  3FAH A;  3AE4 B;  1YJI A;  2JU6 X;  4MH8 A;  4LLG M;  3TEZ A;  3FIL B;  2ON8 A;  2XN9 C;  1QOF A;  3W2D A;  2JX5 A;  3B2F A;  2PW9 A;  4RH6 A;  1ZP0 B;  2BYT A;  1CQV A;  2V4I B;  5FK9 C;  1D4B A;  1ZXH A;  2MJ3 A;  3W5V B;  3LB8 C;  1PFD A;  1BXT A;  1UNS A;  4DXF A;  1L0X B;  1RWS A;  1JWS D;  3AMZ A;  3KQ4 A;  3MHZ A;  2Q5W D;  5EE9 A;  1T6B X;  3SEB A;  2V3P A;  2WDR B;  4GDL B;  3BK2 A;  1D5M C;  3Q8B A;  2LUM A;  4JWS C;  5FR3 A;  1K51 A;  1XCQ L;  1KF6 B;  3R2T A;  4RGM A;  3ZQ4 A;  1L5P A;  2FBW B;  2R61 A;  3VRA B;  3RFZ B;  1IBX A;  3IT4 B;  1MI0 A;  2MJE A;  3BYT B;  5BYQ A;  1ENF A;  3IAM 1;  2V0G A;  2QSD A;  1YQ3 B;  2BS2 B;  1SBB B;  5GXG B;  1SE4 A;  3ZGZ A;  4YTN B;  1PDX A;  1MHX A;  3AEC B;  5HG2 A;  2GI9 A;  2M56 B;  2DLB A;  4JX1 C;  4RFB A;  5EE0 A;  1IGC A;  1SF0 A;  1VZ7 A;  4A90 A;  4HKQ A;  1B9R A;  3R8B A;  4H2A A;  1TY0 A;  5D3I B;  1FCL A;  3AE2 B;  2WXH A;  2INP E;  1I4H A;  4OW0 A;  3Q8F A;  4ARC A;  2J4X A;  1HA5 A;  3Q8E A;  4TMA B;  1KRH A;  3KLS X;  2D5G A;  1B1Z A;  2PVO D;  2DYM A;  1XCT L;  2WXI A;  3CWI A;  2ICI A;  1QKZ A;  2WS3 B;  2I38 A;  4ITK A;  1PUT A;  2SAK A;  2WLB A;  1AYF A;  3CF4 A;  1KFY B;  1C4A A;  2NMQ A;  2IDY A;  2JZP A;  3P4S B;  1H7W A;  1N5X A;  3P1M A;  4IDI A;  2SEB D;  4C56 C;  2WXJ A;  5E6J A;  1JWM D;  1M4V A;  2B76 B;  5BMI A;  1IGD A;  1L6U A;  1K52 A;  1KLU D;  5EE1 A;  1UUP A;  1QOG A;  2W54 A;  1JRO A;  2L32 A;  2JXT A;  2LMC A;  3B2G A;  1N5W A;  1N61 A;  1N63 A;  2CJN A;  4RGN A;  3EUB 2;  3MC0 B;  2K9X A;  1QOA A;  2K0P A;  3DWM A;  4HKZ E;  1ZPS A;  2WNM A;  3FIL A;  1JAL A;  1I4X A;  3NVY A;  1MVK A;  4MM3 B;  1AWD A;  1J7B A;  2V3N A;  3LYY A;  2WXR A;  2KDM A;  5HI1 A;  3HVZ A;  4R3D A;  4OHJ A;  3AE9 B;  2HTM E;  5G5H A;  1PGA A;  1ZOY B;  5FKA C;  2FUG 1;  1DGJ A;  4LK0 M;  2PVG C;  1D5Z C;  1BML C;  1TY2 A;  1OQQ A;  3AE5 B;  4OVZ A;  1L4D B;  1EWY C;  3J9C A;  3PO0 A;  1FO4 A;  3IXS A;  1ROE A;  4N58 A;  1L6V A;  2QJL A;  3P4Q B;  3NRZ A;  3T3N A;  3CIR B;  1F2R C;  1N60 A;  2PTL A;  4NAW B;  4OZA A;  1VRA B;  3P42 A;  1FNU A;  2RMM A;  3TSS A;  4AQ7 A;  2WXG A;  1ZUD 2;  3IT6 B;  1E7P B;  2BBC A;  3L4P A;  1FD6 A;  3W5U B;  2W3S A;  1L0V B;  4D2K A;  1C4C A;  2NTS A;  1TYG B;  3UI3 A;  1FFU A;  4YT0 B;  2M19 A;  4XDC A;  3NVW A;  1WYG A;  1IUE A;  2K22 A;  3R2I A;  3AE8 B;  2N7J A;  4KGR A;  2KAJ A;  1FRR A;  1V1P B;  4YXD B;  3BVG A;  2TSS A;  4L23 A;  2DYO A;  2N9L A;  1VDV A;  1FCC C;  4RF1 A;  5C3J B;  1FNV A;  3KWV A;  2WQY B;  3AM9 A;  1TKE A;  2G1E A;  3Q8A A;  4FXC A;  1FFV A;  1JWA D;  2L83 A;  2OHF A;  2W3R A;  3N9Y C;  2BS3 B;  5C2T B;  3AEG B;  2RPV A;  1DYQ A;  3TUO A;  1LO5 D;  4WIP A;  1SE3 A;  1V8C A;  3VRB B;  3BVM A;  3OWE B;  4TQ1 A;  1C9F A;  3SFD B;  4P16 A;  3U4E G;  1I4P A;  1EWC A;  1SB3 C;  1YNT E;  5G5G A;  4DXG A;  1JW9 D;  4WWM A;  3AE3 B;  1NEN B;  1WSP A;  1AW7 A;  1EU3 A;  1UGJ A;  2LFI A;  3NZ3 A;  4B0E A;  1HZ6 A;  2Y3A A;  4XWW A;  3BII D;  4MT5 A;  4YWG G;  3NUH B;  3AED B;  1XO3 A;  2XNA C;  1I4G A;  1YN3 A;  2IPK D;  4GLS C;  5JXV A;  1FEH A;  2WXO A;  2QIE B;  2AQ3 B;  4CQN A;  4ZHP A;  4YTM B;  1EM7 A;  3AN1 A;  1YMH E;  2H88 B;  1QQR A;  2BB6 A;  2PIA A;  2Y5C A;  5BYS A;  1NEK B;  5HFY A;  4PT5 A;  2MEK A;  4UDU C;  2ACZ B;  2LHE A;  4WAF A;  3LXF A;  1DOI A;  1RM6 C;  3NS1 A;  1GB4 A;  2IGD A;  1E6E B;  1GTE A;  1PYW D;  4TQ0 A;  1D6E C;  1I4Q A;  1UWM A;  1ZDX A;  2AQ2 B;  1MHH E;  4TSS A;  1N62 A;  3TEX A;  2J42 A;  1J7A A;  4RNA A;  5I4D A;  1YN4 A;  2INN E;  1OFF A;  1WWT A;  2WDV B;  1ACC A;  2W55 A;  1GB1 A;  2KWD A;  1F0Z A;  2I2Y A;  2BT6 A;  1JRP A;  1HZ5 A;  5H92 C;  1V1O A;  4YTP B;  4WQM A;  1YJJ A;  3U7Z A;  2BS4 B;  2WXL A;  1JQ4 A;  4JWU C;  1CK1 A;  1EU4 A;  1TS2 A;  4HEA 1;  2DWQ A;  3VR9 B;  2LJI A;  3HVD A;  1XLP A;  1QOB A;  1QT9 A;  5HHD G;  5EE3 A;  1ZDV A;  2OED A;  4XDD A;  5BYR A;  1XLQ A;  1V1P A;  3B9J A;  1NYR A;  1TKG A;  1DOX A;  4YSX B;  2KMM A;  2GB1 A;  3AE7 B;  1TS4 A;  5TSS A;  2BB5 A;  4KKI A;  3NVZ A;  1TZO A;  2MJD A;  2WU5 B;  3I9V 1;  4ZRP A;  2QMT A;  2WXK A;  1TKY A;  1VZ6 A;  2N0S B;  3MFG A;  1TS5 A;  2IJ0 A;  1GTH A;  4YSZ B;  2VZK B;  3V05 A;  3BYY B;  1YQ4 B;  4J3O D;  1Y56 A;  4C80 A;  5D7G A;  3FC4 A;  4N59 A;  1SXT A;  2ZW1 A;  3VR8 B;  1XLN A;  2YEP F;  3EGR A;  3HUI A;  2FE8 A;  3ZJT A;  3EA6 A;  1RYJ A;  2WXQ A;  5AUI A;  2DBY A;  1C76 A;  4EE2 A;  1VR9 A;  3BZD B;  1L4Z B;  3DWG C;  1WRI A;  2N9K A;  4HRO A;  1I4R A;  2W82 A;  4US9 A;  3SR6 A;  4A8X C;  4NZL B;  1FXI A;  1FNW A;  1CJE A;  3ZJV A;  5H8Y E;  3KWL A;  2EKI A;  3RPF C;  3AEE B;  4HJG E;  4ZHO A;  1XEE A;  2JWU A;  1VJK A;  3ABV B;  1JML A;  2KN4 A;  2ONQ A;  4NAM A;  4A6Q A;  3W9C B;  1P7F A;  1SJH D;  3BWU D;  1ET6 A;  1F77 A;  1RFK A;  1E9M A;  1KH0 A;  1NVI D;  2J52 A;  5MPO A;  2VZK D;  4NJC A;  3WCQ A;  2WP9 B;  4LTU A;  1XF5 L;  4DQO C;  4C7Z A;  4C7Y A;  1KLG D;  1H7X A;  2E6X A;  1C79 A;  1GAQ B;  1JCK B;  3BVZ A;  3IAS 1;  1SJE D;  2GRI A;  3MP9 A;  3Q69 A;  3TEY A;  3E56 A;  1A70 A;  3GB1 A;  3GS2 A;  1FRD A;  2QEJ C;  3I57 A;  4RGT A;  3VQI A;  5LNK 1;  1TJE A;  2PMV A;  1ET9 A;  1JWB D;  2L52 A;  2WXN A;  1I7H A;  4US8 A;  1J7C A;  1STE A;  1HQR D;  1BUI C;  3Q8C A;  1YN5 A;  1QF6 A;  1C78 A;  4L1B A;  5BMH A;  3GP7 A;  1JWU D;  5T8I A;  3AV8 A;  1WXQ A;  4M0W A;  4OZB A;  2E3T A;  3P63 A;  3AE6 B;  3AEA B;  2BTE A;  4ZOH C;  1K53 A;  2H89 B;  1E0Z A;  2RDG A;  4RCO A;  3ZYY X;  2X38 A;  4N6E B;  2IGG A;  1E10 A;  2AQ1 B;  3W1S A;  1NI3 A;  5AUK A;  1T3Q A;  5BMG A;  2IGH A;  1TS3 A;  2LEK A;  1GT8 A;  1FMA D;  1OQR A;  4KGS A;  1SE2 A;  1GOZ A;  1T5X D;  2AX5 A;  3BK1 A;  4USA A;  1DOY A;  1C4P A;  4L2Y A;  3AH7 A;  1PGB A;  3HRD D;  2L1A A;  2WXP A;  4OZC A;  3PZ7 A;  4XE0 A;  4ZYS A;  1QLB B;  1ESF A;  1MPE A;  1GPX A;  1Q10 A;  4KGT A;  4HRS A;  2YEP B;  4A9A A;  2WXF A;  3O13 A;  1WGK A;  1XLO A;  2CU3 A;  1IBX B;  2LHD A;  1ZXI A;  4A55 A;  4IKG A;  2HDE A;  3ZJU A;  4JE3 B;  2K3U A;  3NVV A;  2G9H D;  3MJ5 A;  1ZE3 D;  2CJO A;  3V3X A;  4IOI E;  1D5X C;  4B0M A;  2EEL A;  2BW2 A;  4XWT A;  1PGX A;  2J53 A;  3AEF B;  3URY A;  2WDQ B;  3C8Y A;  4GDK B;  1HEZ E;  1HXY D;  5D3D A;  2ZW0 A;  1KTK A;  4ZRQ A;  2JYE A;  4O1N A;  4RF0 A;  4YSY B;  1C77 A;  1V97 A;  1SIJ A;  3ETR A;  4AS1 A;  2WXM A;  4REZ A;  2PKO A;  1NYQ A;  1R7S A;  1FM0 D;  2LGI A;  2Y5P A;  4P6V F;  3E9S A;  2K5P A;  4Q2J A;  3U2S C;  3AE1 B;  2PLP A;  1P7E A;  1F2R I;  4KKJ A;  3AB5 A;  3H8H A;  4RGO S;  4ARI A;  2KAC A;  1SEB D;  3TEW A;  1CZP A;  4WH4 A;  4WUR A;  1UWX A;  3SFE B;  1AN8 A;  3AEB B;  1FIQ A;  1SSN A;  4KX6 B;  1QIL A;  2JQR B;  2NTT A;  2MH7 A;  2M0A A;  2JSV X;  4MAC A;  1K50 A;  3P4P B;  2KQ4 X;  3T3O A;  2RDH A;  2Z8L A;  1FXA A;  2QIL A;  3PZ8 A;  2WU2 B;  1L0Y B;  1VLB A;  4JPS A;  1VZ8 A;  2JYT A;  3U52 E;  1XXG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...