2QDFA

Structure of n-terminal domain of e. coli yaet
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
332
structure length
318
Chain Sequence
MAEGFVVKDIHFEGLQRVAVGAALLSMPVRTGDTVNDEDISNTIRALFATGNFEDVRVLRDGDTLLVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVRVGESLDRTTIADIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFQEGVSAEIQQINIVGNHAFTTDELISHFQLRQKQKLAGDLETLRSYYLDRGYARFNIDSTQVSLTPDKKGIYVTVNITEGDQYKLSGVEVSGNLAGHSAEIEQLTKIEPGELYNGTKVTKMEDDIKKLLGRYGYAYPRVQSMPEINDADKTVKLRVNVDAGNRFYVRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer membrane protein assembly factor yaeT
publication title Structure and function of an essential component of the outer membrane protein assembly machine.
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Membrane protein, protein transport
total genus 93
structure length 318
sequence length 332
ec nomenclature
pdb deposition date 2007-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07244 POTRA Surface antigen variable number repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 2qdfA04
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 2qdfA03
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 2qdfA02
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 2qdfA01
2VH1A 4C4VB 4BZAA 3NJTA 2QDFA 2QCZA 3EFCA 4K3CA 4PK1A 4C00A 4K3BA 3Q6BA 3MC8A 2V9HA 2X8XX 2VH2A 4C4VA 3OG5A 4QAYA 4XGAB 3MC9A 2MHJA
chains in the Genus database with same CATH superfamily
3DBHI 3KWLA 2L52A 1WY8A 1FCCC 2QDFA 4GN1A 4HEA1 1TZ1A 3H7SA 4B9KA 1WF9A 2KDIA 4M0WA 2ZVNA 2N9LA 4XDCA 2BQQA 2BYEA 3NVYA 2LGSA 1E5WA 4XDDA 2MJEA 2OJWA 1D5ZC 4OVVA 4GXBA 5DPWA 4MGIE 3IT4B 3ZDMC 5BMHA 3ZVVA 4BZAA 1I42A 1E0ZA 4NY0A 2NPTB 3ZRFA 5L83A 4R3DA 3ETRA 3I3TB 3RZFA 2A5UA 4MGYE 1LXDA 2V9HA 2NTTA 3AE4B 2JZPA 3ZUNA 5IP4D 1NI3A 3VDZA 2WU5B 3Q2AC 2UYZB 2IDYA 3P42A 3HIZA 3VQIA 2D3GA 4IM0A 3Q3FA 2BPSA 2K0PA 3DHGC 2AX5A 1XLNA 4JL9A 1WJNA 3DVNV 3MC8A 1ZKHA 1J19A 3IAS1 1DYQA 1CMXB 3HVDA 2BWES 3OG5A 2GRIA 4KGRA 1N6ZA 1Q0WB 3Q8EA 5JHAA 1PUTA 1JRUA 2L05A 3WCQA 3KUDB 4ASWC 4AOFA 2M17A 1KM7A 2KLCA 2GBMA 4RGOS 1RYJA 1YX6B 4YT0B 1J7BA 4KGSA 2WNMA 1K53A 4USAA 4N9F4 2WXHA 5HI1A 1E7UA 2W54A 2MBOA 4FBJB 1SIFA 4HPPA 4MSQB 3SDLC 1HZ5A 4WWNA 3NZSA 3PGEA 2KWDA 3L08A 1KTKA 3H9DA 1F2RC 2JT4B 4ZRPA 2KDEB 5FR3A 1FRRA 4MSMB 2D5GA 2W9NA 1WJUA 4TUUA 2ZNVB 5HKHA 4HDOA 1YNTE 1GNUA 3MTNB 1QOAA 5BMIA 1L6UA 3U2SC 3UQAA 1TY2A 3PHXB 3DBSA 4K3BA 4ANWA 4DK5A 5EDSA 2JRIB 1ESFA 2MRPA 2MW5A 2KAJA 1V97A 2WDTB 4KIKB 3SR6A 1XLPA 1RFAA 1JW9D 5J2RA 1OEYJ 3AMZA 3Q3NC 3DBRB 1I35A 1TJEA 4P1CC 2KC1A 1U4AA 2QEJC 3LDZE 3HRDD 2LJ5A 4M00A 3E56A 3QAQA 2KKCA 2VRRB 1TT5B 4LDTB 4HDQA 1Q10A 1TS3A 4PS3A 1GOZA 4M8MA 2DZIA 2CHZA 3V62A 2L8JA 1EWYC 1GC6A 3N1ZC 1NENB 1TTNA 2WYQA 3B0AA 1C4PA 2C5LC 2R2QA 3MFGA 2FIFA 2LGIA 2NPTA 3N1YC 1E9MA 3V60A 1E7VA 1P1AA 3SEBA 1GPXA 1SXTA 4B6WA 2FE8A 1C4CA 5AUKA 4YSXB 1FCLA 1LQBA 3KYDD 2LRUA 2NVUI 1X1MA 5L95C 1F9JA 5EE0A 2AWTA 3LB8C 1WXQA 3VFKA 3DBHB 2MHJA 4RGTA 1UGJA 2C7MB 2L7RA 2V4IB 2J52A 3PZ8A 5H8YE 5GXGB 2N7JA 2ON8A 1TS5A 2KMMA 1UELA 2L0FA 4C7ZA 5G55A 1CJEA 1XO3A 4P1BC 1IP9A 1WRDB 2W82A 1F2RI 1P3QU 1WXMA 2KVZA 4NQLB 1KLGD 1V5OA 2CHXA 1ACCA 2J0JA 2LGDA 4URKA 2ZEQA 1ZDXA 4AUQC 4GLSC 3ML8A 3CWIA 3KUCB 3BVZA 3MP9A 3WAMA 1PFDA 1WE7A 1AN8A 3VR9B 3AE1B 3EECA 2WXIA 3OAWA 3BY4B 2IY0B 4D2KA 5CX3A 1HZ6A 3AEAB 4W9KA 3OWEB 2NTSA 3EFCA 1UF0A 3M95A 2WXMA 1C78A 3L10B 4BKGA 2AL6A 4ACFA 1WXVA 3IBEA 4ITKA 2JU6X 4JGHB 1C1YB 5D3DA 3VXWA 2DENB 1QOGA 2RR9A 4HJKA 3AV8A 3VAWA 3DDCB 3MHZA 1IBXB 1R4NB 3P4RB 1C3TA 3CSFA 3PRZA 1SBBB 1T0QC 1L4DB 1NVID 4DHJD 1LO5D 2LMCA 2L3ZA 3ZNGC 2ZCBA 4DHJB 4MELA 5CHVC 1V81A 1KLVA 2Z0EB 3NS1A 1HXYD 3U7ZA 1WZ0A 4NZLB 1Q1OA 1C9FA 1XXGA 3BK2A 3QK0A 3QHTA 2V3NA 1WGHA 2XNAC 2KC2A 4II2B 2MBQA 4LNOA 2B3AA 5D3IB 3VUYA 2B76B 4XE0A 3WALA 1T0SC 1WZ3A 5IKCM 4GDKB 2BS2B 2WDRB 1SIJA 3KH0A 3JVZX 3A9KB 2IBIB 5C23A 3V3XA 2Y5CA 1JQ4A 4FHJA 4BAXA 3WANA 4CO7A 4W9DA 5JZEB 1XLQA 3AH7A 2LVQA 1KLUD 3TSSA 4OZCA 2G9HD 3NVZA 2RDGA 4OZBA 2MSED 4ICVA 2KNBA 4PT5A 3W2DA 5J18A 3L0WB 3ZNZB 3SD5A 2TSSA 4IWQA 3ZJVA 4IM3A 4ZRKA 2WXPA 3RULA 3I57A 2INCC 3VVWB 2O6VB 3PREA 1N5WA 3W1YA 4WWPA 4O1NA 3BYTB 1EF1A 3IG3A 5AZGA 3HM6X 3PZ7A 3L16A 2DBYA 4GMVA 2KMCA 4LK0M 1WR6E 1SE2A 3Q3JA 4KVGB 4WWMA 3Q8BA 2ASQA 1R7SA 1KF6B 4MGKE 3NZUA 1MFWA 2KXJA 3S2AA 3EFUA 1SGHA 3FAHA 4EE2A 2V1YA 4WWOA 3DOWA 2BVCA 4NJ6A 3RNBC 4ARIA 1MI0A 5IAAC 5BYQA 4E71A 4DWFA 4US8A 3BINA 3SHQA 3V05A 1FIQA 4I6LB 1R4MI 4YTPB 1L5PA 1SJHD 4RMAA 2WQYB 3URYA 1MHHE 1EU3A 2FUG1 3CF6E 4NNJB 2MJDA 4K7SA 3A4RA 4IM2A 1WX7A 4HXDA 3VRAB 3UQBA 1DGJA 3PTFC 4EKUA 3ZNID 4WJNA 1HQRD 2BYTA 2N0SB 3QCAA 3AE3B 1I4GA 1J8CA 1WE6A 1N62A 3Q3MC 4NAWB 3RZWC 4NQKE 4GDLB 2WU2B 4WIPA 4MH0E 4HROA 4XX5A 3DBRI 4TQ0A 1LM8B 3AE9B 2K8BA 4M8NA 2BB6A 3AEGB 4YXDB 3WIMA 4ZRIA 2KTFA 5HG2A 4FJVB 1IBXA 1SE4A 1I4HA 5T8IA 1L0XB 1WGRA 2W3SA 2PIAA 1ZXHA 1E90A 2Z8LA 2G45B 2H89B 1M94A 2NBUA 4ANUA 1YD8U 3HK0A 5AUIA 2JPHA 2M0XA 2JXTA 3MJ5A 3WA0A 2INDC 1V5TA 5LXIB 5HHDG 3TEXA 5C3JB 1WJ4A 1VRAB 3E9SA 4ZHOA 4BKSD 1JWMD 4HLEA 1L4ZB 3ZDTA 1QT9A 4ICUA 3ZXRA 3KUZA 2EMTA 5EE9A 3DVGY 4W9HA 2O2VB 4GDKA 4LNFA 5JXVA 3BVGA 4K3CA 1WX8A 2FAZA 3A9KA 2DZMA 1K51A 2BS3B 3OJ3A 2Z59B 3PO0A 4HKQA 1YOVB 4DBGA 2J4XA 3DHHC 1A70A 2DYBA 2K39A 4KDIC 1F77A 3RNCC 1L6VA 4DQOC 1S1QB 3BVMA 2GMIC 1KH0A 2OJRA 3C0RB 1ZUD2 2QCZA 4F8CB 2M56B 1SF0A 1V86A 2K5PA 1VZ6A 2NS5A 2WS3B 4RH6A 3A1QB 2RPQA 4CHKA 1T5XD 3L17A 2GB1A 1XT9B 1TIFA 3QJZA 3W5UB 1T0YA 4FJZA 3ZXVA 2O6VA 4DXAB 1XCQL 5EE3A 2IYDB 2ZPNA 1WX9A 4ZRQA 3Q8FA 1GC7A 3PS6A 4M01A 3NG0A 3TBLD 2LVOA 3U8ZA 4GGQA 3U4EG 4KKJA 1I4QA 4QAYA 5TSSA 3VRBB 3C19A 2L0TA 2G1EA 4YSYB 1QQRA 1C79A 4JIOU 1L7YA 5D94A 1BT0A 3UGBB 2NCNA 5C2TB 4IW0A 4W9CA 4XGAB 1F1HA 2WXKA 2INNE 4LLGM 1YJJA 1YQ4B 3H7PB 4WQOB 4BVUC 2N9KA 2Q5WD 1SB3C 1R4NI 1KOTA 1F0ZA 4G3XB 1EO6A 3R66C 3ZO5B 1F52A 2LJIA 1WXSA 4NAWA 4LJPB 1FRDA 2N7DA 3KW5B 1XF5L 2LGYA 2REXA 2KFKB 4GDLA 4PK1A 1OEYA 2PLPA 5BMGA 2LVPA 1ZP0B 2KO3A 3EGRA 2WGSA 4HJGE 1IGCA 4IG7B 4E74A 2INPE 3J9CA 3FC4A 5FKAC 1KFYB 4A55A 1ROEA 3B08A 2QHOA 4GB9A 2MBHA 2FCMA 3ZNHB 2M4NA 2CJNA 1MG4A 3RMKC 1WJ6A 1R4MB 1YN4A 2FCQA 1JROA 3TJPA 1NDDA 4REZA 5E6PA 3L4PA 3ZIMA 4C7YA 4EZLA 3N20C 3QA8A 2Y5PA 2XK5B 4MEMA 4OHJA 1T3QA 2DX5B 1SE9A 4HWIB 4BKSA 2PPHA 4KX6B 1B1ZA 2O2VA 1P0RA 2JSVX 3Q14C 1EUVB 2K3UA 2NBWB 2BYVE 1TKEA 3QC8B 2ZCCA 4HPMB 3ZJTA 2KHWB 2KQ4X 2V0GA 4IDIA 1JCKB 4KKIA 3N1XC 3RNFC 3AE2B 4HPLB 1V9JA 4LDTD 3M3JA 4EEWA 3KQ4A 1EU4A 2LHDA 4GIVA 1TY0A 2E3TA 2JRHA 1V80A 3U7DA 4K7WA 2MP2B 3HVZA 3A1QA 2RSUA 4ANVA 3TMPB 4ZYSA 3OJ4B 5DPRA 3RNEC 1H4RA 3Q6BA 2WXQA 3W9CB 1SE3A 1RWSA 4IKGA 1E8YA 3APCA 3O13A 5EE1A 2N1VA 4DDID 4C4VB 3DWMA 1FO4A 2UU7A 3IVFA 2GBJA 3AE8B 4FXCA 4E3CA 2HE7A 2BKFA 2AQ3B 2IY1B 2XEWA 3K9OB 2MBBB 1PQSA 2WXNA 1NYRA 2G4SA 3KVFB 1JWUD 4W9GA 2L32A 4G0NB 1FXIA 2GI9A 2KN5A 5E6NA 4N58A 1SJED 2WXLA 1UBIA 5G5GA 5MPOA 1PGXA 4RGMA 3SFDB 1WGKA 1WIAA 1YIWA 3JW0X 2ZPYA 2OOBB 1ISNA 2VH2A 4FHKA 4HRSA 3AB5A 4B95A 2KLGA 3H7PA 2CU3A 3MC0B 1RAXA 2WXRA 1NBFC 1VDVA 2BKRB 2PTLA 3ALBA 4BFRA 3DQVA 2X38A 2FNJB 1E8WA 1E8ZA 3NVWA 4FN2A 2KFKA 2MX2A 1P7EA 4WJPA 5LXHA 2J0KA 2MJ3A 3Q3OC 1QILA 2HTHA 1HTOA 2EKEC 1FXAA 3IHPC 4C56C 4K7UA 4TKNA 1ZOYB 1Z2MA 4W9FA 4B0MA 2GOWA 2LD9A 1UGMA 5DPSA 4L1BA 3C8YA 1Z5SB 3AEDB 3GP7A 3WAOA 1XCTL 3CIRB 2JUOA 2CU1A 2HD5B 3O65B 2C60A 3UIPB 2FCSA 4LNIA 4RGNA 3A4SC 2LHEA 5BO4B 3APFA 1BUIC 4PYZA 3H6NA 1M4VA 2XK5A 1SEBD 2K8HA 3VTVA 3I5JC 2C7NB 2ZW0A 1J7CA 1GJZA 3IT6B 1JWBD 3NS8A 3PV1A 2NMQA 2LI5A 3ENEA 5AZHA 2ZNVC 4G11A 2GBNA 3H8HA 4RFBA 1UNSA 1WGYA 1D6EC 1STEA 2D3CA 3RYTA 5CHFA 3BIID 3DPDA 2SAKA 1ZXIA 1IPGA 4AQ7A 1GG3A 3ABVB 1RRBA 3GE3C 3ZGZA 3NY5A 2K9XA 2KDMA 4HK2A 1Q5WB 1H8CA 1WXAA 2D3BA 2MWSB 4L2YA 3Q69A 2WXGA 1DOYA 2MP2A 4A6QA 1WMHB 4HKZE 3IAM1 1JWAD 1P98A 4B0EA 3LYYA 1FFVA 5BYRA 2DYMA 2RPVA 2XN9C 3SFEB 2IO2B 3W5VB 2LASA 1NEKB 2N9EB 4ANXA 4BOSC 4C4VA 1YMHE 3RUIB 2V3PA 1FNUA 1I4PA 1P7FA 4DHZB 1OFFA 2PVGC 1PDXA 2QILA 2JYTA 2O6VD 4JX1C 2IGGA 1K52A 3D32A 1SSNA 2KDFB 4MH8A 2R2OA 1QKZA 1TGZB 2EELA 1J0GA 3BWUD 2J42A 4GSWA 1QLBB 2KZRA 3PLUA 3UIOB 2MQJA 4MACA 1FMAD 2NR2A 2VZKD 3AE5B 1GB1A 1FPYA 3AECB 2JX5A 2VZKB 1MHXA 5E6JA 2PMVA 3VTWA 4GU2A 2E6XA 2N9XA 3RPFC 2LXAA 3P2BA 1WRIA 2L83A 1N61A 2ZZPB 3W1SC 1T0RC 3I63C 2DWQA 2LWPA 1FEHA 4CYEA 5TR5A 3ZQ4A 3T3NA 1C76A 2QMTA 3P4QB 3NHEB 1HA5A 4TV3A 5KHQA 2G3QB 1NI2A 2WX0A 3M63B 4TQ1A 4WJQA 3UI3A 2D10A 1D4BA 1ZW7A 2HJ8A 3Q8AA 5H92C 4JWUC 1B9RA 3ECIA 3HM3A 4UDUC 4HCNB 2KQ7A 3DHIC 3PVLA 3GE8C 2DAFA 4LTUA 2KVRA 4PYUA 2DNFA 4XYCA 2AEHA 3TCAA 2IJ0A 4N59A 2V4LA 2HJ1A 1V8CA 4ZOHC 2JVCA 1XD3B 1OQYA 2N4FA 4XWWA 4IOIE 2PVOD 3X0WA 4AWJA 4RNAA 3NUHB 4RF0A 3EA6A 2BTEA 4EUTA 4AS1A 2KOXA 2WXOA 4K1RB 4FULA 3NRZA 3RNAC 5D2MB 3MJWA 1AARA 2DYOA 1IGDA 4RCOA 2DZKA 1WYGA 2KYWA 3RT3B 1UWMA 5JHBA 2K25A 3RD2A 1WMHA 1GUAB 2JWZA 1JMLA 4NAMA 2OHFA 3AN1A 3Q8CA 3T9LA 2WDVB 1JWSD 2WHIA 2BS4B 4LCDE 2QJLA 2PE6B 4S0RA 5AZFA 2SEBD 4AJYB 2ZJDA 2C7HA 2WLBA 2KD0A 4YTNB 5CHWA 3R2TA 4I6NB 3OLMD 3QQ8B 3DCGA 1XQQA 1MPEA 2R61A 2IPKD 3FKYA 2ICIA 3JYUA 1PYWD 1TKGA 2L1AA 4AJWA 3JSVB 3HHMA 1E6EB 3N32A 1C77A 3PZDA 2PJHA 2KTRB 1I4XA 2LUMA 3DVNU 2JWUA 4WURA 1V1OA 2N1WA 2V3SA 3APDA 3QARA 4ZDVA 3AEFB 3ONSA 3PLVA 1QF6A 2MBEA 4P6VF 2N7EA 1OQRA 3QIJA 1TS4A 3PSEB 2IO3B 3B9JA 1VZ8A 3VTUA 5D6JB 1HE8A 4MJSB 3ZTCA 2J0MA 5DPTA 2ONQA 2I1JA 2YVCA 1N5XA 2AQ1B 4WJOA 3DBLB 3IXSA 1G6JA 3RI7C 1K50A 2PE9A 1DOIA 4NJCA 4LJOB 1J7AA 3ZJUA 2QSDA 3AXCA 4DXFA 3R8BA 4W9JA 4DHZE 2G4DB 4MGZE 3NVVA 1WM2A 3KWVA 1DOXA 1AYFA 3ZLZA 1MVKA 1OQQA 1L2NA 5C1ZA 3ZTDA 3N30A 2LEKA 5FR6A 4IWPA 2KWUB 1EWCA 1UWXA 1TS2A 3A9JB 2K22A 1YJIA 2JZ3B 4IWOA 2ACZB 2WXJA 3U52E 4F7ZA 4W9EA 3K9PB 3EUB2 4HCPB 4IC7B 3V61A 1VZ7A 2J7QB 3KLSX 2PKOA 2VH1A 4JWSC 1D5XC 5CTRC 1FD6A 3NZ3A 2FCNA 3BZDB 2BF8B 3GB1A 1WFYA 2AL3A 4OZAA 3T3OA 1NYQA 4FA6A 2DAJA 1UD7A 3TEYA 3GS2A 4KSKC 5E6OA 3AI5A 3GOEA 2Y5BB 1KRHA 2KJRA 2Z0DB 4C00A 2LZ6A 2X8XX 4A3OA 1VD2A 4YL8A 5G2NA 3ZW3A 2EKIA 5J17A 1IUEA 1V1PB 2JY6A 1ZDVA 3R3MA 3M62B 4YTMB 3PRMB 4NPNA 2IGDA 2JQRB 1E7PB 1TKYA 3TIXA 1VR9A 2IO0B 1Y8RC 3WAPA 2KJ6A 3JSVA 2AQ2B 4PS8A 3CSTA 5LLIA 4JLCA 3UF8A 2RGFA 2JZZA 2K8CA 2KTRA 1WGGA 4FJYA 3P4PB 2CHWA 2JYEA 4EFOA 2KMAA 3VUWA 5HFYA 4BOZB 2WP9B 2FUHB 4JPSA 2MEKA 3P4SB 4CQNA 2JXXA 1E8XA 2QC8A 1WR1A 4OW0A 2KK8A 2PEAA 2FBWB 1GB4A 2KDBA 3LXFA 2GLSA 3FILB 4RM9A 1VCBA 3DWGC 1VJKA 4MJSA 2D3AA 1ZPSA 3RFZB 2K6QA 4W9LA 4RF1A 4MM3B 4KZCA 2WXFA 2ZW1A 1XLOA 4S17A 1JRPA 2KT7A 3HUIA 3T8MA 2AYOB 1XEEA 5G5HA 1MJDA 2BBCA 4A20A 3SU8X 3ZKJC 3B1LX 3VR8B 3ZYYX 2KX3A 2CS4A 4GOCA 2IZVB 5IOIA 4KDLB 1CZPA 1HEZE 2M1MA 4XWTA 3V6CB 2LGXA 3PPAA 1T6BX 1WGDA 2L00B 3AU4A 4G50A 4BKTA 3DVGX 2OEDA 3A33B 1UBQA 3GZNI 1ZE3D 4ARCA 3TUOA 4WH4A 1I7HA 2A4ZA 1MG8A 2BWFA 3AM9A 1RM6C 3A9JA 3VH3B 4WAAA 4BBNF 4ZRJA 1A5RA 3IFWB 4WQMA 1CK1A 1WI0A 3MHSD 3U30A 2DHZA 3TEWA 4MDKE 4XZ4A 1VLBA 5I4DA 2FIDA 3QWZB 4P7IA 1OGWA 1ZGUB 5IA7A 1I4RA 2MA9B 2MH7A 2IGHA 4JE3B 1IYFA 3EC8A 5GMVA 4OVUA 4WAFA 3AE6B 4I6PA 1FFUA 1FNVA 3R7RA 4KV2A 4W9IA 3VH4B 4LNNA 1BMLC 4J3OD 2GBKA 2W3RA 4EZKA 2M0AA 3R2IA 2J53A 1WH3A 4KGTA 4A8XC 4A90A 1EF5A 5D7GA 1HTQA 3NJTA 2H88B 2CJOA 2WDQB 3ML9A 2MCNB 4TSSA 1YJ1A 2DZJA 2CR5A 1LGRA 1TZOA 1ET9A 3N9YC 1WYWB 2I38A 4KIKA 1V1PA 4X57B 3KYCD 4P16A 2KFJA 2IO1B 3BK1A 4M02A 4DXGA 3L54A 2YEPB 1N63A 4HVBA 3AEBB 2HTME 2LRWA 1EM7A 3NOBA 2EMSA 1ENFA 1YQBA 1UZXB 4LNKA 1C4AA 3AE7B 1K8RB 2BW2A 3PRPB 2HDEA 2D11A 1JALA 2KANA 3DBLI 1WM3A 1YQ3B 4XC2A 3N3KB 4EZJA 2DLBA 4Q2JA 1L0VB 4YWGG 2YEPF 2XBBC 3PHWB 1P9DU 3QX1A 3FILA 4KZ0A 3RCZA 4TMAB 4N6EB 4F1SA 3X23A 4M0WB 4MM3A 3TL5A 3MC9A 3CMMB 1V2YA 4ZHPA 3ZRCA 2UWQA 2JF5A 3RN9C 1D3ZA 2GBRA 3EHVA 1CQVA 1L0YB 2Y3AA 1OTRB 1AW7A 1D5MC 4FLHA 3B2FA 3UINB 3AULA 3W1SA 1ET6A 3BYYB 4RM8A 1GAQB 2ZVOA 1WSPA 2C9WB 1V6EA 3B2GA 1FM0D 3P1MA 4ZYNA 5KHOA 2D2QA 1AWDA 4H2AA 2D07B 4L23A 2BYFA 2L76A 4BBNC 1FXTB 5IN7A 3L13A 4EOYA 2PW9A 4K81A 1Y56A 1TBEA 3AU5A 2LXCA 2KX0A 1E10A 2BGFA 2KQSA 1V49A 2KJHB 3TEZA 2N9PC 2BT6A 2KN4A 4AP4C 2K1FA 1UUPA 2RD0A 1RLFA 2RDHA 1PGAA 5BYSA 4IUMB 4A9AA 1BXTA 2RDBC 5JH5C 3R7QA 4DDGD 4KSLC 4J6IA 4MT5A 1QZEA 4A3PA 2K6DB 2NBVB 3GZNB 2WX1A 3V6EB 2M19A 4C80A 2I1KA 1UH6A 4YSZB 2M8SA 4PS7A 3P63A 3VHTC 4NJ7A 5FK9C 3AEEB 2LFIA 4FADA 4US9A 3I9V1 5IO9A 5AEKB 1YN5A 3PT2B 2W55A 1KJTA 2KACA 2I2YA 1S3SG 1PGBA 1TYGB 2LUEA 1FNWA 1YX5B 1WWTA 3RNGC 4JQWC 4OVZA 2BB5A 1QOBA 3VUXA 2YLMA 1RFKA 1LFDA 1N60A 4II3B 2KWCA 2CKHB 2QIEB 2MLBA 1QOFA 2KWVB 1YN3A 2WWZA 3LJ3A 5LNK1 3H1UA 5DCNA 2RMMA
chains in the Genus database with same CATH topology
2VH1A 4C4VB 4BZAA 3NJTA 2QDFA 2QCZA 3EFCA 4K3CA 4PK1A 4C00A 4K3BA 3Q6BA 3MC8A 2V9HA 2X8XX 2VH2A 4C4VA 3OG5A 4QAYA 4XGAB 3MC9A 2MHJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VH1 A;  4C4V B;  4BZA A;  3NJT A;  2QDF A;  2QCZ A;  3EFC A;  4K3C A;  4PK1 A;  4C00 A;  4K3B A;  3Q6B A;  3MC8 A;  2V9H A;  2X8X X;  2VH2 A;  4C4V A;  3OG5 A;  4QAY A;  4XGA B;  3MC9 A;  2MHJ A; 
#chains in the Genus database with same CATH topology
 3DBH I;  3KWL A;  2L52 A;  1WY8 A;  1FCC C;  2QDF A;  4GN1 A;  4HEA 1;  1TZ1 A;  3H7S A;  4B9K A;  1WF9 A;  2KDI A;  4M0W A;  2ZVN A;  2N9L A;  4XDC A;  2BQQ A;  2BYE A;  3NVY A;  2LGS A;  1E5W A;  4XDD A;  2MJE A;  2OJW A;  1D5Z C;  4OVV A;  4GXB A;  5DPW A;  4MGI E;  3IT4 B;  3ZDM C;  5BMH A;  3ZVV A;  4BZA A;  1I42 A;  1E0Z A;  4NY0 A;  2NPT B;  3ZRF A;  5L83 A;  4R3D A;  3ETR A;  3I3T B;  3RZF A;  2A5U A;  4MGY E;  1LXD A;  2V9H A;  2NTT A;  3AE4 B;  2JZP A;  3ZUN A;  5IP4 D;  1NI3 A;  3VDZ A;  2WU5 B;  3Q2A C;  2UYZ B;  2IDY A;  3P42 A;  3HIZ A;  3VQI A;  2D3G A;  4IM0 A;  3Q3F A;  2BPS A;  2K0P A;  3DHG C;  2AX5 A;  1XLN A;  4JL9 A;  1WJN A;  3DVN V;  3MC8 A;  1ZKH A;  1J19 A;  3IAS 1;  1DYQ A;  1CMX B;  3HVD A;  2BWE S;  3OG5 A;  2GRI A;  4KGR A;  1N6Z A;  1Q0W B;  3Q8E A;  5JHA A;  1PUT A;  1JRU A;  2L05 A;  3WCQ A;  3KUD B;  4ASW C;  4AOF A;  2M17 A;  1KM7 A;  2KLC A;  2GBM A;  4RGO S;  1RYJ A;  1YX6 B;  4YT0 B;  1J7B A;  4KGS A;  2WNM A;  1K53 A;  4USA A;  4N9F 4;  2WXH A;  5HI1 A;  1E7U A;  2W54 A;  2MBO A;  4FBJ B;  1SIF A;  4HPP A;  4MSQ B;  3SDL C;  1HZ5 A;  4WWN A;  3NZS A;  3PGE A;  2KWD A;  3L08 A;  1KTK A;  3H9D A;  1F2R C;  2JT4 B;  4ZRP A;  2KDE B;  5FR3 A;  1FRR A;  4MSM B;  2D5G A;  2W9N A;  1WJU A;  4TUU A;  2ZNV B;  5HKH A;  4HDO A;  1YNT E;  1GNU A;  3MTN B;  1QOA A;  5BMI A;  1L6U A;  3U2S C;  3UQA A;  1TY2 A;  3PHX B;  3DBS A;  4K3B A;  4ANW A;  4DK5 A;  5EDS A;  2JRI B;  1ESF A;  2MRP A;  2MW5 A;  2KAJ A;  1V97 A;  2WDT B;  4KIK B;  3SR6 A;  1XLP A;  1RFA A;  1JW9 D;  5J2R A;  1OEY J;  3AMZ A;  3Q3N C;  3DBR B;  1I35 A;  1TJE A;  4P1C C;  2KC1 A;  1U4A A;  2QEJ C;  3LDZ E;  3HRD D;  2LJ5 A;  4M00 A;  3E56 A;  3QAQ A;  2KKC A;  2VRR B;  1TT5 B;  4LDT B;  4HDQ A;  1Q10 A;  1TS3 A;  4PS3 A;  1GOZ A;  4M8M A;  2DZI A;  2CHZ A;  3V62 A;  2L8J A;  1EWY C;  1GC6 A;  3N1Z C;  1NEN B;  1TTN A;  2WYQ A;  3B0A A;  1C4P A;  2C5L C;  2R2Q A;  3MFG A;  2FIF A;  2LGI A;  2NPT A;  3N1Y C;  1E9M A;  3V60 A;  1E7V A;  1P1A A;  3SEB A;  1GPX A;  1SXT A;  4B6W A;  2FE8 A;  1C4C A;  5AUK A;  4YSX B;  1FCL A;  1LQB A;  3KYD D;  2LRU A;  2NVU I;  1X1M A;  5L95 C;  1F9J A;  5EE0 A;  2AWT A;  3LB8 C;  1WXQ A;  3VFK A;  3DBH B;  2MHJ A;  4RGT A;  1UGJ A;  2C7M B;  2L7R A;  2V4I B;  2J52 A;  3PZ8 A;  5H8Y E;  5GXG B;  2N7J A;  2ON8 A;  1TS5 A;  2KMM A;  1UEL A;  2L0F A;  4C7Z A;  5G55 A;  1CJE A;  1XO3 A;  4P1B C;  1IP9 A;  1WRD B;  2W82 A;  1F2R I;  1P3Q U;  1WXM A;  2KVZ A;  4NQL B;  1KLG D;  1V5O A;  2CHX A;  1ACC A;  2J0J A;  2LGD A;  4URK A;  2ZEQ A;  1ZDX A;  4AUQ C;  4GLS C;  3ML8 A;  3CWI A;  3KUC B;  3BVZ A;  3MP9 A;  3WAM A;  1PFD A;  1WE7 A;  1AN8 A;  3VR9 B;  3AE1 B;  3EEC A;  2WXI A;  3OAW A;  3BY4 B;  2IY0 B;  4D2K A;  5CX3 A;  1HZ6 A;  3AEA B;  4W9K A;  3OWE B;  2NTS A;  3EFC A;  1UF0 A;  3M95 A;  2WXM A;  1C78 A;  3L10 B;  4BKG A;  2AL6 A;  4ACF A;  1WXV A;  3IBE A;  4ITK A;  2JU6 X;  4JGH B;  1C1Y B;  5D3D A;  3VXW A;  2DEN B;  1QOG A;  2RR9 A;  4HJK A;  3AV8 A;  3VAW A;  3DDC B;  3MHZ A;  1IBX B;  1R4N B;  3P4R B;  1C3T A;  3CSF A;  3PRZ A;  1SBB B;  1T0Q C;  1L4D B;  1NVI D;  4DHJ D;  1LO5 D;  2LMC A;  2L3Z A;  3ZNG C;  2ZCB A;  4DHJ B;  4MEL A;  5CHV C;  1V81 A;  1KLV A;  2Z0E B;  3NS1 A;  1HXY D;  3U7Z A;  1WZ0 A;  4NZL B;  1Q1O A;  1C9F A;  1XXG A;  3BK2 A;  3QK0 A;  3QHT A;  2V3N A;  1WGH A;  2XNA C;  2KC2 A;  4II2 B;  2MBQ A;  4LNO A;  2B3A A;  5D3I B;  3VUY A;  2B76 B;  4XE0 A;  3WAL A;  1T0S C;  1WZ3 A;  5IKC M;  4GDK B;  2BS2 B;  2WDR B;  1SIJ A;  3KH0 A;  3JVZ X;  3A9K B;  2IBI B;  5C23 A;  3V3X A;  2Y5C A;  1JQ4 A;  4FHJ A;  4BAX A;  3WAN A;  4CO7 A;  4W9D A;  5JZE B;  1XLQ A;  3AH7 A;  2LVQ A;  1KLU D;  3TSS A;  4OZC A;  2G9H D;  3NVZ A;  2RDG A;  4OZB A;  2MSE D;  4ICV A;  2KNB A;  4PT5 A;  3W2D A;  5J18 A;  3L0W B;  3ZNZ B;  3SD5 A;  2TSS A;  4IWQ A;  3ZJV A;  4IM3 A;  4ZRK A;  2WXP A;  3RUL A;  3I57 A;  2INC C;  3VVW B;  2O6V B;  3PRE A;  1N5W A;  3W1Y A;  4WWP A;  4O1N A;  3BYT B;  1EF1 A;  3IG3 A;  5AZG A;  3HM6 X;  3PZ7 A;  3L16 A;  2DBY A;  4GMV A;  2KMC A;  4LK0 M;  1WR6 E;  1SE2 A;  3Q3J A;  4KVG B;  4WWM A;  3Q8B A;  2ASQ A;  1R7S A;  1KF6 B;  4MGK E;  3NZU A;  1MFW A;  2KXJ A;  3S2A A;  3EFU A;  1SGH A;  3FAH A;  4EE2 A;  2V1Y A;  4WWO A;  3DOW A;  2BVC A;  4NJ6 A;  3RNB C;  4ARI A;  1MI0 A;  5IAA C;  5BYQ A;  4E71 A;  4DWF A;  4US8 A;  3BIN A;  3SHQ A;  3V05 A;  1FIQ A;  4I6L B;  1R4M I;  4YTP B;  1L5P A;  1SJH D;  4RMA A;  2WQY B;  3URY A;  1MHH E;  1EU3 A;  2FUG 1;  3CF6 E;  4NNJ B;  2MJD A;  4K7S A;  3A4R A;  4IM2 A;  1WX7 A;  4HXD A;  3VRA B;  3UQB A;  1DGJ A;  3PTF C;  4EKU A;  3ZNI D;  4WJN A;  1HQR D;  2BYT A;  2N0S B;  3QCA A;  3AE3 B;  1I4G A;  1J8C A;  1WE6 A;  1N62 A;  3Q3M C;  4NAW B;  3RZW C;  4NQK E;  4GDL B;  2WU2 B;  4WIP A;  4MH0 E;  4HRO A;  4XX5 A;  3DBR I;  4TQ0 A;  1LM8 B;  3AE9 B;  2K8B A;  4M8N A;  2BB6 A;  3AEG B;  4YXD B;  3WIM A;  4ZRI A;  2KTF A;  5HG2 A;  4FJV B;  1IBX A;  1SE4 A;  1I4H A;  5T8I A;  1L0X B;  1WGR A;  2W3S A;  2PIA A;  1ZXH A;  1E90 A;  2Z8L A;  2G45 B;  2H89 B;  1M94 A;  2NBU A;  4ANU A;  1YD8 U;  3HK0 A;  5AUI A;  2JPH A;  2M0X A;  2JXT A;  3MJ5 A;  3WA0 A;  2IND C;  1V5T A;  5LXI B;  5HHD G;  3TEX A;  5C3J B;  1WJ4 A;  1VRA B;  3E9S A;  4ZHO A;  4BKS D;  1JWM D;  4HLE A;  1L4Z B;  3ZDT A;  1QT9 A;  4ICU A;  3ZXR A;  3KUZ A;  2EMT A;  5EE9 A;  3DVG Y;  4W9H A;  2O2V B;  4GDK A;  4LNF A;  5JXV A;  3BVG A;  4K3C A;  1WX8 A;  2FAZ A;  3A9K A;  2DZM A;  1K51 A;  2BS3 B;  3OJ3 A;  2Z59 B;  3PO0 A;  4HKQ A;  1YOV B;  4DBG A;  2J4X A;  3DHH C;  1A70 A;  2DYB A;  2K39 A;  4KDI C;  1F77 A;  3RNC C;  1L6V A;  4DQO C;  1S1Q B;  3BVM A;  2GMI C;  1KH0 A;  2OJR A;  3C0R B;  1ZUD 2;  2QCZ A;  4F8C B;  2M56 B;  1SF0 A;  1V86 A;  2K5P A;  1VZ6 A;  2NS5 A;  2WS3 B;  4RH6 A;  3A1Q B;  2RPQ A;  4CHK A;  1T5X D;  3L17 A;  2GB1 A;  1XT9 B;  1TIF A;  3QJZ A;  3W5U B;  1T0Y A;  4FJZ A;  3ZXV A;  2O6V A;  4DXA B;  1XCQ L;  5EE3 A;  2IYD B;  2ZPN A;  1WX9 A;  4ZRQ A;  3Q8F A;  1GC7 A;  3PS6 A;  4M01 A;  3NG0 A;  3TBL D;  2LVO A;  3U8Z A;  4GGQ A;  3U4E G;  4KKJ A;  1I4Q A;  4QAY A;  5TSS A;  3VRB B;  3C19 A;  2L0T A;  2G1E A;  4YSY B;  1QQR A;  1C79 A;  4JIO U;  1L7Y A;  5D94 A;  1BT0 A;  3UGB B;  2NCN A;  5C2T B;  4IW0 A;  4W9C A;  4XGA B;  1F1H A;  2WXK A;  2INN E;  4LLG M;  1YJJ A;  1YQ4 B;  3H7P B;  4WQO B;  4BVU C;  2N9K A;  2Q5W D;  1SB3 C;  1R4N I;  1KOT A;  1F0Z A;  4G3X B;  1EO6 A;  3R66 C;  3ZO5 B;  1F52 A;  2LJI A;  1WXS A;  4NAW A;  4LJP B;  1FRD A;  2N7D A;  3KW5 B;  1XF5 L;  2LGY A;  2REX A;  2KFK B;  4GDL A;  4PK1 A;  1OEY A;  2PLP A;  5BMG A;  2LVP A;  1ZP0 B;  2KO3 A;  3EGR A;  2WGS A;  4HJG E;  1IGC A;  4IG7 B;  4E74 A;  2INP E;  3J9C A;  3FC4 A;  5FKA C;  1KFY B;  4A55 A;  1ROE A;  3B08 A;  2QHO A;  4GB9 A;  2MBH A;  2FCM A;  3ZNH B;  2M4N A;  2CJN A;  1MG4 A;  3RMK C;  1WJ6 A;  1R4M B;  1YN4 A;  2FCQ A;  1JRO A;  3TJP A;  1NDD A;  4REZ A;  5E6P A;  3L4P A;  3ZIM A;  4C7Y A;  4EZL A;  3N20 C;  3QA8 A;  2Y5P A;  2XK5 B;  4MEM A;  4OHJ A;  1T3Q A;  2DX5 B;  1SE9 A;  4HWI B;  4BKS A;  2PPH A;  4KX6 B;  1B1Z A;  2O2V A;  1P0R A;  2JSV X;  3Q14 C;  1EUV B;  2K3U A;  2NBW B;  2BYV E;  1TKE A;  3QC8 B;  2ZCC A;  4HPM B;  3ZJT A;  2KHW B;  2KQ4 X;  2V0G A;  4IDI A;  1JCK B;  4KKI A;  3N1X C;  3RNF C;  3AE2 B;  4HPL B;  1V9J A;  4LDT D;  3M3J A;  4EEW A;  3KQ4 A;  1EU4 A;  2LHD A;  4GIV A;  1TY0 A;  2E3T A;  2JRH A;  1V80 A;  3U7D A;  4K7W A;  2MP2 B;  3HVZ A;  3A1Q A;  2RSU A;  4ANV A;  3TMP B;  4ZYS A;  3OJ4 B;  5DPR A;  3RNE C;  1H4R A;  3Q6B A;  2WXQ A;  3W9C B;  1SE3 A;  1RWS A;  4IKG A;  1E8Y A;  3APC A;  3O13 A;  5EE1 A;  2N1V A;  4DDI D;  4C4V B;  3DWM A;  1FO4 A;  2UU7 A;  3IVF A;  2GBJ A;  3AE8 B;  4FXC A;  4E3C A;  2HE7 A;  2BKF A;  2AQ3 B;  2IY1 B;  2XEW A;  3K9O B;  2MBB B;  1PQS A;  2WXN A;  1NYR A;  2G4S A;  3KVF B;  1JWU D;  4W9G A;  2L32 A;  4G0N B;  1FXI A;  2GI9 A;  2KN5 A;  5E6N A;  4N58 A;  1SJE D;  2WXL A;  1UBI A;  5G5G A;  5MPO A;  1PGX A;  4RGM A;  3SFD B;  1WGK A;  1WIA A;  1YIW A;  3JW0 X;  2ZPY A;  2OOB B;  1ISN A;  2VH2 A;  4FHK A;  4HRS A;  3AB5 A;  4B95 A;  2KLG A;  3H7P A;  2CU3 A;  3MC0 B;  1RAX A;  2WXR A;  1NBF C;  1VDV A;  2BKR B;  2PTL A;  3ALB A;  4BFR A;  3DQV A;  2X38 A;  2FNJ B;  1E8W A;  1E8Z A;  3NVW A;  4FN2 A;  2KFK A;  2MX2 A;  1P7E A;  4WJP A;  5LXH A;  2J0K A;  2MJ3 A;  3Q3O C;  1QIL A;  2HTH A;  1HTO A;  2EKE C;  1FXA A;  3IHP C;  4C56 C;  4K7U A;  4TKN A;  1ZOY B;  1Z2M A;  4W9F A;  4B0M A;  2GOW A;  2LD9 A;  1UGM A;  5DPS A;  4L1B A;  3C8Y A;  1Z5S B;  3AED B;  3GP7 A;  3WAO A;  1XCT L;  3CIR B;  2JUO A;  2CU1 A;  2HD5 B;  3O65 B;  2C60 A;  3UIP B;  2FCS A;  4LNI A;  4RGN A;  3A4S C;  2LHE A;  5BO4 B;  3APF A;  1BUI C;  4PYZ A;  3H6N A;  1M4V A;  2XK5 A;  1SEB D;  2K8H A;  3VTV A;  3I5J C;  2C7N B;  2ZW0 A;  1J7C A;  1GJZ A;  3IT6 B;  1JWB D;  3NS8 A;  3PV1 A;  2NMQ A;  2LI5 A;  3ENE A;  5AZH A;  2ZNV C;  4G11 A;  2GBN A;  3H8H A;  4RFB A;  1UNS A;  1WGY A;  1D6E C;  1STE A;  2D3C A;  3RYT A;  5CHF A;  3BII D;  3DPD A;  2SAK A;  1ZXI A;  1IPG A;  4AQ7 A;  1GG3 A;  3ABV B;  1RRB A;  3GE3 C;  3ZGZ A;  3NY5 A;  2K9X A;  2KDM A;  4HK2 A;  1Q5W B;  1H8C A;  1WXA A;  2D3B A;  2MWS B;  4L2Y A;  3Q69 A;  2WXG A;  1DOY A;  2MP2 A;  4A6Q A;  1WMH B;  4HKZ E;  3IAM 1;  1JWA D;  1P98 A;  4B0E A;  3LYY A;  1FFV A;  5BYR A;  2DYM A;  2RPV A;  2XN9 C;  3SFE B;  2IO2 B;  3W5V B;  2LAS A;  1NEK B;  2N9E B;  4ANX A;  4BOS C;  4C4V A;  1YMH E;  3RUI B;  2V3P A;  1FNU A;  1I4P A;  1P7F A;  4DHZ B;  1OFF A;  2PVG C;  1PDX A;  2QIL A;  2JYT A;  2O6V D;  4JX1 C;  2IGG A;  1K52 A;  3D32 A;  1SSN A;  2KDF B;  4MH8 A;  2R2O A;  1QKZ A;  1TGZ B;  2EEL A;  1J0G A;  3BWU D;  2J42 A;  4GSW A;  1QLB B;  2KZR A;  3PLU A;  3UIO B;  2MQJ A;  4MAC A;  1FMA D;  2NR2 A;  2VZK D;  3AE5 B;  1GB1 A;  1FPY A;  3AEC B;  2JX5 A;  2VZK B;  1MHX A;  5E6J A;  2PMV A;  3VTW A;  4GU2 A;  2E6X A;  2N9X A;  3RPF C;  2LXA A;  3P2B A;  1WRI A;  2L83 A;  1N61 A;  2ZZP B;  3W1S C;  1T0R C;  3I63 C;  2DWQ A;  2LWP A;  1FEH A;  4CYE A;  5TR5 A;  3ZQ4 A;  3T3N A;  1C76 A;  2QMT A;  3P4Q B;  3NHE B;  1HA5 A;  4TV3 A;  5KHQ A;  2G3Q B;  1NI2 A;  2WX0 A;  3M63 B;  4TQ1 A;  4WJQ A;  3UI3 A;  2D10 A;  1D4B A;  1ZW7 A;  2HJ8 A;  3Q8A A;  5H92 C;  4JWU C;  1B9R A;  3ECI A;  3HM3 A;  4UDU C;  4HCN B;  2KQ7 A;  3DHI C;  3PVL A;  3GE8 C;  2DAF A;  4LTU A;  2KVR A;  4PYU A;  2DNF A;  4XYC A;  2AEH A;  3TCA A;  2IJ0 A;  4N59 A;  2V4L A;  2HJ1 A;  1V8C A;  4ZOH C;  2JVC A;  1XD3 B;  1OQY A;  2N4F A;  4XWW A;  4IOI E;  2PVO D;  3X0W A;  4AWJ A;  4RNA A;  3NUH B;  4RF0 A;  3EA6 A;  2BTE A;  4EUT A;  4AS1 A;  2KOX A;  2WXO A;  4K1R B;  4FUL A;  3NRZ A;  3RNA C;  5D2M B;  3MJW A;  1AAR A;  2DYO A;  1IGD A;  4RCO A;  2DZK A;  1WYG A;  2KYW A;  3RT3 B;  1UWM A;  5JHB A;  2K25 A;  3RD2 A;  1WMH A;  1GUA B;  2JWZ A;  1JML A;  4NAM A;  2OHF A;  3AN1 A;  3Q8C A;  3T9L A;  2WDV B;  1JWS D;  2WHI A;  2BS4 B;  4LCD E;  2QJL A;  2PE6 B;  4S0R A;  5AZF A;  2SEB D;  4AJY B;  2ZJD A;  2C7H A;  2WLB A;  2KD0 A;  4YTN B;  5CHW A;  3R2T A;  4I6N B;  3OLM D;  3QQ8 B;  3DCG A;  1XQQ A;  1MPE A;  2R61 A;  2IPK D;  3FKY A;  2ICI A;  3JYU A;  1PYW D;  1TKG A;  2L1A A;  4AJW A;  3JSV B;  3HHM A;  1E6E B;  3N32 A;  1C77 A;  3PZD A;  2PJH A;  2KTR B;  1I4X A;  2LUM A;  3DVN U;  2JWU A;  4WUR A;  1V1O A;  2N1W A;  2V3S A;  3APD A;  3QAR A;  4ZDV A;  3AEF B;  3ONS A;  3PLV A;  1QF6 A;  2MBE A;  4P6V F;  2N7E A;  1OQR A;  3QIJ A;  1TS4 A;  3PSE B;  2IO3 B;  3B9J A;  1VZ8 A;  3VTU A;  5D6J B;  1HE8 A;  4MJS B;  3ZTC A;  2J0M A;  5DPT A;  2ONQ A;  2I1J A;  2YVC A;  1N5X A;  2AQ1 B;  4WJO A;  3DBL B;  3IXS A;  1G6J A;  3RI7 C;  1K50 A;  2PE9 A;  1DOI A;  4NJC A;  4LJO B;  1J7A A;  3ZJU A;  2QSD A;  3AXC A;  4DXF A;  3R8B A;  4W9J A;  4DHZ E;  2G4D B;  4MGZ E;  3NVV A;  1WM2 A;  3KWV A;  1DOX A;  1AYF A;  3ZLZ A;  1MVK A;  1OQQ A;  1L2N A;  5C1Z A;  3ZTD A;  3N30 A;  2LEK A;  5FR6 A;  4IWP A;  2KWU B;  1EWC A;  1UWX A;  1TS2 A;  3A9J B;  2K22 A;  1YJI A;  2JZ3 B;  4IWO A;  2ACZ B;  2WXJ A;  3U52 E;  4F7Z A;  4W9E A;  3K9P B;  3EUB 2;  4HCP B;  4IC7 B;  3V61 A;  1VZ7 A;  2J7Q B;  3KLS X;  2PKO A;  2VH1 A;  4JWS C;  1D5X C;  5CTR C;  1FD6 A;  3NZ3 A;  2FCN A;  3BZD B;  2BF8 B;  3GB1 A;  1WFY A;  2AL3 A;  4OZA A;  3T3O A;  1NYQ A;  4FA6 A;  2DAJ A;  1UD7 A;  3TEY A;  3GS2 A;  4KSK C;  5E6O A;  3AI5 A;  3GOE A;  2Y5B B;  1KRH A;  2KJR A;  2Z0D B;  4C00 A;  2LZ6 A;  2X8X X;  4A3O A;  1VD2 A;  4YL8 A;  5G2N A;  3ZW3 A;  2EKI A;  5J17 A;  1IUE A;  1V1P B;  2JY6 A;  1ZDV A;  3R3M A;  3M62 B;  4YTM B;  3PRM B;  4NPN A;  2IGD A;  2JQR B;  1E7P B;  1TKY A;  3TIX A;  1VR9 A;  2IO0 B;  1Y8R C;  3WAP A;  2KJ6 A;  3JSV A;  2AQ2 B;  4PS8 A;  3CST A;  5LLI A;  4JLC A;  3UF8 A;  2RGF A;  2JZZ A;  2K8C A;  2KTR A;  1WGG A;  4FJY A;  3P4P B;  2CHW A;  2JYE A;  4EFO A;  2KMA A;  3VUW A;  5HFY A;  4BOZ B;  2WP9 B;  2FUH B;  4JPS A;  2MEK A;  3P4S B;  4CQN A;  2JXX A;  1E8X A;  2QC8 A;  1WR1 A;  4OW0 A;  2KK8 A;  2PEA A;  2FBW B;  1GB4 A;  2KDB A;  3LXF A;  2GLS A;  3FIL B;  4RM9 A;  1VCB A;  3DWG C;  1VJK A;  4MJS A;  2D3A A;  1ZPS A;  3RFZ B;  2K6Q A;  4W9L A;  4RF1 A;  4MM3 B;  4KZC A;  2WXF A;  2ZW1 A;  1XLO A;  4S17 A;  1JRP A;  2KT7 A;  3HUI A;  3T8M A;  2AYO B;  1XEE A;  5G5H A;  1MJD A;  2BBC A;  4A20 A;  3SU8 X;  3ZKJ C;  3B1L X;  3VR8 B;  3ZYY X;  2KX3 A;  2CS4 A;  4GOC A;  2IZV B;  5IOI A;  4KDL B;  1CZP A;  1HEZ E;  2M1M A;  4XWT A;  3V6C B;  2LGX A;  3PPA A;  1T6B X;  1WGD A;  2L00 B;  3AU4 A;  4G50 A;  4BKT A;  3DVG X;  2OED A;  3A33 B;  1UBQ A;  3GZN I;  1ZE3 D;  4ARC A;  3TUO A;  4WH4 A;  1I7H A;  2A4Z A;  1MG8 A;  2BWF A;  3AM9 A;  1RM6 C;  3A9J A;  3VH3 B;  4WAA A;  4BBN F;  4ZRJ A;  1A5R A;  3IFW B;  4WQM A;  1CK1 A;  1WI0 A;  3MHS D;  3U30 A;  2DHZ A;  3TEW A;  4MDK E;  4XZ4 A;  1VLB A;  5I4D A;  2FID A;  3QWZ B;  4P7I A;  1OGW A;  1ZGU B;  5IA7 A;  1I4R A;  2MA9 B;  2MH7 A;  2IGH A;  4JE3 B;  1IYF A;  3EC8 A;  5GMV A;  4OVU A;  4WAF A;  3AE6 B;  4I6P A;  1FFU A;  1FNV A;  3R7R A;  4KV2 A;  4W9I A;  3VH4 B;  4LNN A;  1BML C;  4J3O D;  2GBK A;  2W3R A;  4EZK A;  2M0A A;  3R2I A;  2J53 A;  1WH3 A;  4KGT A;  4A8X C;  4A90 A;  1EF5 A;  5D7G A;  1HTQ A;  3NJT A;  2H88 B;  2CJO A;  2WDQ B;  3ML9 A;  2MCN B;  4TSS A;  1YJ1 A;  2DZJ A;  2CR5 A;  1LGR A;  1TZO A;  1ET9 A;  3N9Y C;  1WYW B;  2I38 A;  4KIK A;  1V1P A;  4X57 B;  3KYC D;  4P16 A;  2KFJ A;  2IO1 B;  3BK1 A;  4M02 A;  4DXG A;  3L54 A;  2YEP B;  1N63 A;  4HVB A;  3AEB B;  2HTM E;  2LRW A;  1EM7 A;  3NOB A;  2EMS A;  1ENF A;  1YQB A;  1UZX B;  4LNK A;  1C4A A;  3AE7 B;  1K8R B;  2BW2 A;  3PRP B;  2HDE A;  2D11 A;  1JAL A;  2KAN A;  3DBL I;  1WM3 A;  1YQ3 B;  4XC2 A;  3N3K B;  4EZJ A;  2DLB A;  4Q2J A;  1L0V B;  4YWG G;  2YEP F;  2XBB C;  3PHW B;  1P9D U;  3QX1 A;  3FIL A;  4KZ0 A;  3RCZ A;  4TMA B;  4N6E B;  4F1S A;  3X23 A;  4M0W B;  4MM3 A;  3TL5 A;  3MC9 A;  3CMM B;  1V2Y A;  4ZHP A;  3ZRC A;  2UWQ A;  2JF5 A;  3RN9 C;  1D3Z A;  2GBR A;  3EHV A;  1CQV A;  1L0Y B;  2Y3A A;  1OTR B;  1AW7 A;  1D5M C;  4FLH A;  3B2F A;  3UIN B;  3AUL A;  3W1S A;  1ET6 A;  3BYY B;  4RM8 A;  1GAQ B;  2ZVO A;  1WSP A;  2C9W B;  1V6E A;  3B2G A;  1FM0 D;  3P1M A;  4ZYN A;  5KHO A;  2D2Q A;  1AWD A;  4H2A A;  2D07 B;  4L23 A;  2BYF A;  2L76 A;  4BBN C;  1FXT B;  5IN7 A;  3L13 A;  4EOY A;  2PW9 A;  4K81 A;  1Y56 A;  1TBE A;  3AU5 A;  2LXC A;  2KX0 A;  1E10 A;  2BGF A;  2KQS A;  1V49 A;  2KJH B;  3TEZ A;  2N9P C;  2BT6 A;  2KN4 A;  4AP4 C;  2K1F A;  1UUP A;  2RD0 A;  1RLF A;  2RDH A;  1PGA A;  5BYS A;  4IUM B;  4A9A A;  1BXT A;  2RDB C;  5JH5 C;  3R7Q A;  4DDG D;  4KSL C;  4J6I A;  4MT5 A;  1QZE A;  4A3P A;  2K6D B;  2NBV B;  3GZN B;  2WX1 A;  3V6E B;  2M19 A;  4C80 A;  2I1K A;  1UH6 A;  4YSZ B;  2M8S A;  4PS7 A;  3P63 A;  3VHT C;  4NJ7 A;  5FK9 C;  3AEE B;  2LFI A;  4FAD A;  4US9 A;  3I9V 1;  5IO9 A;  5AEK B;  1YN5 A;  3PT2 B;  2W55 A;  1KJT A;  2KAC A;  2I2Y A;  1S3S G;  1PGB A;  1TYG B;  2LUE A;  1FNW A;  1YX5 B;  1WWT A;  3RNG C;  4JQW C;  4OVZ A;  2BB5 A;  1QOB A;  3VUX A;  2YLM A;  1RFK A;  1LFD A;  1N60 A;  4II3 B;  2KWC A;  2CKH B;  2QIE B;  2MLB A;  1QOF A;  2KWV B;  1YN3 A;  2WWZ A;  3LJ3 A;  5LNK 1;  3H1U A;  5DCN A;  2RMM A; 
#chains in the Genus database with same CATH homology
 2VH1 A;  4C4V B;  4BZA A;  3NJT A;  2QDF A;  2QCZ A;  3EFC A;  4K3C A;  4PK1 A;  4C00 A;  4K3B A;  3Q6B A;  3MC8 A;  2V9H A;  2X8X X;  2VH2 A;  4C4V A;  3OG5 A;  4QAY A;  4XGA B;  3MC9 A;  2MHJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...