2QDFA

Structure of n-terminal domain of e. coli yaet
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
332
structure length
318
Chain Sequence
MAEGFVVKDIHFEGLQRVAVGAALLSMPVRTGDTVNDEDISNTIRALFATGNFEDVRVLRDGDTLLVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVRVGESLDRTTIADIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFQEGVSAEIQQINIVGNHAFTTDELISHFQLRQKQKLAGDLETLRSYYLDRGYARFNIDSTQVSLTPDKKGIYVTVNITEGDQYKLSGVEVSGNLAGHSAEIEQLTKIEPGELYNGTKVTKMEDDIKKLLGRYGYAYPRVQSMPEINDADKTVKLRVNVDAGNRFYVRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein, protein transport
molecule keywords Outer membrane protein assembly factor yaeT
publication title Structure and function of an essential component of the outer membrane protein assembly machine.
pubmed doi rcsb
source organism Escherichia coli k12
total genus 93
structure length 318
sequence length 332
ec nomenclature
pdb deposition date 2007-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07244 POTRA Surface antigen variable number repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 2qdfA04
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 2qdfA03
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 2qdfA02
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 2qdfA01
3OG5A 2VH1A 4QAYA 3NJTA 3MC8A 2VH2A 4K3CA 4K3BA 3MC9A 2QCZA 2QDFA 3Q6BA 2X8XX 4C4VA 4C4VB 3EFCA 2MHJA 2V9HA 4PK1A 4C00A 4XGAB 4BZAA
chains in the Genus database with same CATH superfamily
1M4VA 1WGRA 3DHHC 2DZKA 2MA9B 4II3B 5LNK1 3BK1A 2N0SB 3AN1A 4US9A 3LDZE 2LXCA 2K0PA 1STEA 4BOZB 2FAZA 4ZRIA 4WQMA 2SAKA 3QHTA 4WJNA 3KVFB 2N4FA 4EZLA 2FCQA 4JWSC 3URYA 2MX2A 3BYYB 2PJHA 1V6EA 2NMQA 3E56A 3SD5A 3AEAB 4W9IA 5L95C 4KV2A 3Q3MC 1AYFA 3L10B 3W1YA 4ARCA 1L4DB 1YD8U 2WU2B 2Z8LA 1L4ZB 1R4NB 3BIID 2BYVE 3AMZA 3ZUNA 1F77A 3PRMB 1NYRA 1FNWA 1AN8A 4AQ7A 3RD2A 4DHJB 1L0XB 1QKZA 2L76A 4R3DA 1E8WA 3GZNI 3KLSX 3FAHA 1UGJA 3P2BA 1TBEA 4OVVA 1E7PB 5DPRA 3IT4B 1IBXA 5CX3A 4GXBA 1T6BX 1XQQA 5EE3A 1WRIA 2KWUB 1L6UA 2INNE 1I35A 1FD6A 3EFCA 3AXCA 2LGSA 4ZOHC 4JIOU 2W9NA 3D32A 2C60A 2BBCA 4ANWA 3RFZB 2KX0A 3WAPA 1BMLC 2KQSA 2O2VA 4LK0M 4KSKC 4DXGA 5TR5A 3BK2A 1F9JA 4GOCA 4H2AA 3KUDB 4AJYB 2NBWB 2KJRA 3TSSA 2WXPA 2ZVOA 1AWDA 4RGNA 1SE9A 3WA0A 1J7CA 2VRRB 4KVGB 3T3OA 3L16A 1TKYA 1Z2MA 1WXMA 2IO0B 3KWVA 2WXMA 4RCOA 3X23A 1HTOA 2IDYA 2RDGA 3SHQA 2CU1A 2YEPB 3ZTCA 4FHKA 3CF6E 1RAXA 4K3BA 2Q5WD 3Q69A 2V4IB 4PT5A 2L32A 4KKJA 2RMMA 4LNIA 3VUXA 2BT6A 4K7WA 3PRPB 2OJRA 3ZDMC 4WURA 4XDDA 3TEXA 1PDXA 1N5XA 3GE8C 5JHBA 3DQVA 1R4NI 1YX6B 3H7PA 1WE7A 4DHJD 1BUIC 1MG4A 1QF6A 3DVGX 4KGSA 1WFYA 1WMHA 1P7EA 3AE8B 1EM7A 2PMVA 4D2KA 1YN4A 4HCPB 1C3TA 3APCA 1JW9D 2VH2A 3Q3NC 1WX7A 4FJZA 1A70A 3BY4B 1XT9B 4GN1A 3ABVB 4W9FA 5CHWA 1V2YA 4KIKA 4W9CA 2LZ6A 3L0WB 5IOIA 3KUCB 1IBXB 4FJVB 5C2TB 1JCKB 1KLUD 3ECIA 2AL3A 2MCNB 3N20C 1E9MA 4N9F4 3NVYA 4W9LA 2M19A 3LJ3A 2JWUA 1XLQA 2KACA 1F0ZA 3R66C 1WE6A 2KTFA 2KMAA 1C4CA 4ZRJA 2ZEQA 3AEBB 1V1PA 1V5OA 4DXFA 2GBMA 1E8XA 3M63B 1CZPA 3QK0A 3U2SC 2ZCCA 3TEYA 1WGGA 3DVGY 4PS7A 3DOWA 2RDBC 3UGBB 3UIPB 1TS5A 1IYFA 2KK8A 1TIFA 2YEPF 2KN5A 2I2YA 3AV8A 5BYSA 4LNNA 4LJPB 2AQ3B 2OJWA 4AWJA 1I4QA 1YN3A 4S17A 3IT6B 2M17A 4CYEA 4LNKA 1EF5A 3ZNGC 1TGZB 3B1LX 4B6WA 3C0RB 3PHWB 4WJQA 3AM9A 4MELA 1K51A 3NZSA 3CSTA 2RSUA 5D7GA 4M8NA 3VR8B 1F1HA 4OVZA 2LGIA 4WIPA 2KDEB 4IG7B 1FNUA 3C8YA 1I4PA 2MJEA 2CR5A 3NY5A 3ZIMA 4HCNB 5DPWA 2NVUI 2JUOA 3A9KA 1NBFC 1V49A 2MEKA 3HUIA 1SF0A 2WNMA 3ZKJC 1WJ4A 2C5LC 3RULA 4M8MA 2LGDA 4NJCA 2MBQA 4C80A 1KFYB 2D3AA 4GDLA 3SU8X 2KQ7A 1E5WA 2G1EA 3WAOA 3L08A 4NY0A 5G5HA 2JZ3B 1I42A 4CQNA 1Q0WB 4LJOB 1XD3B 1PYWD 1WJ6A 1V80A 4PS8A 2ON8A 1TKGA 1C1YB 4BKTA 5IP4D 1GG3A 3E9SA 4HDOA 3GOEA 5HHDG 4B95A 1VZ6A 1M94A 4NJ6A 1TZ1A 3MJWA 2N7JA 1SIFA 3NRZA 2V3SA 3O13A 3QC8B 1K53A 3T8MA 2L05A 4BBNC 2ZW0A 3ZRFA 2N7DA 2JXTA 1C4PA 2IBIB 2KJ6A 4EE2A 1ZDXA 3AEDB 3GB1A 5LXHA 4C7ZA 1NDDA 3BVMA 3TEWA 1TS2A 2H89B 1EUVB 4MGYE 1AW7A 1WM2A 3V6EB 1E8YA 2BYTA 1KLGD 2DBYA 2R2OA 3PZ8A 1WR6E 1SJED 3A1QA 4KZ0A 1PFDA 3AE7B 2GBJA 3HRDD 3Q6BA 3JSVA 4GDKA 2W3RA 2GBNA 1UZXB 4MJSA 2WXQA 1WXSA 1KF6B 2K22A 2KLGA 5G5GA 3HIZA 3RNGC 3QA8A 2K8HA 2REXA 3RMKC 3Q8BA 4GGQA 1HQRD 2JZZA 2K9XA 2DNFA 2KZRA 4BAXA 5FK9C 5FR3A 3FILA 4ZHOA 3N1XC 1V81A 3Q3OC 3B08A 3A9JA 4BKGA 2L3ZA 2WX1A 3GE3C 4MGIE 5HFYA 3UQAA 2HD5B 4RF0A 1LM8B 5D3IB 2KC2A 3IXSA 3I3TB 1E7UA 4M0WB 2D11A 4G0NB 3UI3A 1SE2A 2C7NB 2NR2A 1F2RC 1FIQA 3RZFA 4A55A 3OG5A 3MP9A 3IVFA 3N1ZC 3NUHB 1GJZA 1P98A 4ARIA 3AB5A 1ISNA 2KN4A 3U8ZA 1D4BA 5BMIA 2KWCA 2KC1A 3I63C 1V97A 5JH5C 1PGAA 2E3TA 3AE3B 4ICUA 1HZ6A 3CMMB 2L52A 3DBHB 2I1KA 1C4AA 5E6NA 4RGTA 2C7HA 4C56C 2QCZA 4MH0E 1FFVA 1SXTA 1WH3A 2ICIA 1QOBA 4C00A 1GNUA 4F8CB 3SFEB 1WJNA 1JMLA 2LEKA 1JRPA 4XWWA 4J3OD 1QZEA 4KDIC 2QEJC 1N60A 2WXKA 3FKYA 5L83A 1I4GA 1UBIA 2BTEA 3QWZB 1ZP0B 2IGGA 1V8CA 2FCMA 2TSSA 3R7QA 3ZGZA 3JSVB 4GDKB 4MSMB 4L23A 1J0GA 2LHDA 1SJHD 2RPVA 4FA6A 2L8JA 2V0GA 1K52A 1GUAB 1R4MB 4YSYB 2LHEA 2GI9A 2WLBA 2BS3B 3QARA 1T5XD 2D2QA 3R7RA 2R2QA 1NVID 3ZNZB 1XXGA 3FILB 2VZKB 3A9JB 1ZGUB 4HK2A 3DBRB 1UF0A 2JSVX 2N9PC 2OEDA 4AP4C 4MT5A 1NENB 4ZYNA 3A4RA 3RNCC 3P1MA 3W1SC 3RUIB 3HVZA 2K3UA 2WXHA 3V05A 3Q8FA 4TQ0A 3ZNID 2M0XA 2FIFA 3WANA 4NZLB 3PLVA 1OEYJ 5E6JA 4P16A 3IBEA 2WX0A 1Q10A 4OVUA 1FXIA 2ACZB 4W9EA 1WXVA 1L5PA 3NS1A 1L2NA 3DBHI 1N61A 2KLCA 1KOTA 2HTHA 5D6JB 3W1SA 2CS4A 5FR6A 2AEHA 3V62A 1WXQA 2YLMA 1JWMD 1HXYD 2IYDB 3AU5A 2Y5BB 2DZMA 1OEYA 2LUMA 3NG0A 1V5TA 1EWYC 2QIEB 5AUKA 2BF8B 1R7SA 1QILA 2QHOA 2C7MB 1P3QU 4USAA 2E6XA 4TQ1A 3N32A 3JYUA 4ANXA 3O65B 3MHSD 4E71A 4YTMB 4YTPB 4P1BC 5GXGB 4BBNF 3VVWB 3OJ4B 2ZNVC 2M8SA 1J7AA 2JT4B 4RM8A 4AUQC 1MFWA 1R4MI 1SBBB 2RR9A 4HJKA 3RPFC 4KDLB 2VZKD 1DOYA 1WF9A 1NEKB 2NPTB 1JWUD 2BS4B 3N3KB 1SE4A 2DENB 1WIAA 2Z59B 1V9JA 2KNBA 3LB8C 1TYGB 2ASQA 3DBRI 4HPPA 4W9GA 3A4SC 3T9LA 3Q8EA 1C76A 4G50A 3R2TA 2M0AA 3M62B 1AARA 4HRSA 4YXDB 1N63A 2V9HA 2OOBB 3K9OB 4HWIB 1ENFA 1Y8RC 3L13A 3RZWC 1VDVA 1JRUA 1HEZE 2KXJA 3RNAC 4DK5A 4NAWA 1Y56A 4JWUC 3AE9B 3P4RB 3P42A 3EHVA 4E3CA 5C1ZA 1OQYA 3ZJUA 2KFKB 3AE4B 1UWXA 1OFFA 5EE1A 5TSSA 1ZXHA 3MHZA 2EMTA 3ONSA 1I4HA 1EWCA 2XNAC 3N9YC 2LVOA 2Z0EB 2BYFA 4W9DA 2KOXA 4ZRKA 5GMVA 1Q1OA 5BYQA 3AI5A 5HKHA 3B2FA 2V3PA 3DHGC 4IUMB 4XZ4A 2BWFA 2MP2B 2DZJA 1F2RI 3BVGA 5LXIB 3ML8A 3ALBA 1WX9A 3JW0X 4IDIA 5T8IA 4XWTA 4DDID 1VJKA 4MGZE 3J9CA 3ZXVA 3P4PB 1ZPSA 4MM3B 3PV1A 1S1QB 4FLHA 2BW2A 1ET6A 2K6QA 2QILA 2L1AA 2INCC 5AUIA 1IPGA 2AQ1B 1YJIA 4YL8A 4IOIE 2IO2B 1UUPA 3AEFB 1MI0A 4A6QA 2WXOA 1HE8A 2MSED 5KHQA 4AJWA 1WYWB 4W9JA 2J0MA 5BMHA 1GC6A 2FCSA 4N6EB 3VTUA 3QQ8B 4XDCA 5AZFA 4A20A 1WRDB 4WQOB 2IO1B 2JWZA 1WGHA 2LJIA 3OWEB 2I1JA 4GB9A 1EU3A 4A90A 1LXDA 4ZRPA 2KDBA 4HEA1 3RYTA 3QX1A 2WDTB 4HPLB 2JQRB 4IM2A 4DWFA 3TEZA 4II2B 3VUYA 2IY0B 1YQ4B 3OLMD 3I5JC 5C3JB 1TY2A 1NI2A 2PPHA 2MJDA 4REZA 2AWTA 1ZDVA 2ZW1A 1H8CA 3P63A 1ZUD2 1J19A 4OHJA 2ZNVB 2XEWA 2QDFA 1YX5B 1WYGA 4JL9A 3H7SA 4WWOA 1Q5WB 1XLOA 2JRIB 2MBEA 5G2NA 3U30A 2OHFA 3VQIA 3ZO5B 3EGRA 1ZE3D 3CSFA 4BZAA 3BYTB 2RPQA 1RWSA 1HA5A 3AE5B 3L54A 1FFUA 4MEMA 2CHXA 1I7HA 5BMGA 1EO6A 2G9HD 4NAWB 1SIJA 4GU2A 2CU3A 2M56B 4FHJA 4NQKE 4KSLC 1GPXA 3MTNB 4BOSC 2BPSA 2J53A 5DPSA 2WDQB 5C23A 2XK5A 3NZUA 4P7IA 3ZW3A 4LCDE 1TY0A 2AX5A 1MVKA 3Q8CA 3LXFA 1C78A 1Z5SB 4M0WA 4GMVA 2LGXA 1FPYA 1HTQA 2KYWA 1N5WA 2JU6X 1WXAA 1XLNA 1VCBA 2J52A 4WWMA 5MPOA 1MJDA 2W54A 1FRRA 2BVCA 2LXAA 4I6PA 4LLGM 3B2GA 1WI0A 4TSSA 3HHMA 4ANUA 1G6JA 1L6VA 1YNTE 1TS3A 1ZKHA 4DXAB 3CWIA 3QCAA 2W3SA 4NNJB 1K50A 3ZTDA 3ZVVA 1L7YA 4FADA 3NVZA 4EFOA 3KUZA 1IUEA 2PE9A 2MHJA 3DPDA 4FBJB 1BXTA 3I9V1 2CHZA 3NJTA 2WXNA 2BWES 3AU4A 5G55A 1WZ0A 1K8RB 2FIDA 2KX3A 1P0RA 2JF5A 4RGOS 3ZYYX 1ROEA 2A5UA 1YMHE 2CJOA 3AEEB 3DWGC 3H8HA 1UNSA 2D3BA 4LNOA 5CHVC 4WJPA 4BVUC 1VRAB 1JALA 3ZJVA 1H4RA 3VRAB 1LO5D 4N58A 2M1MA 2WDRB 1E7VA 2KDMA 4EUTA 1L0YB 1YOVB 3PT2B 4MACA 2PVOD 5DPTA 2PTLA 2NTTA 1P7FA 4LNFA 3MJ5A 4UDUC 1CK1A 1XEEA 2WYQA 3W2DA 1DOIA 2KWDA 2V1YA 4LTUA 5I4DA 2M4NA 3IAM1 3QJZA 3TL5A 2LMCA 3WIMA 4TMAB 1XCTL 1BT0A 3SR6A 1JQ4A 3KW5B 2LI5A 1A5RA 1MHHE 2X8XX 4K81A 2W82A 4HLEA 1D5XC 1YJJA 3DDCB 5D3DA 1U4AA 4HDQA 4XGAB 4HPMB 2XK5B 3MFGA 3BVZA 2G45B 2O6VB 1F52A 1SB3C 2J0JA 4S0RA 4YSXB 1TZOA 1ZXIA 4BKSD 1PGBA 1N6ZA 2MBBB 2CKHB 4JE3B 2PEAA 4E74A 2MBHA 3M95A 4A9AA 4PK1A 1MG8A 1QT9A 4G3XB 3IAS1 3VTVA 3VTWA 1LFDA 2INDC 1FNVA 2J4XA 2L0FA 1RFAA 2WXJA 2WHIA 1OQQA 4RMAA 1E90A 1P9DU 3PSEB 2K1FA 1WGYA 5D94A 1PGXA 1UBQA 3ZJTA 4IW0A 1RM6C 2WWZA 3P4SB 1YN5A 4CHKA 2ZVNA 4I6NB 3QAQA 3VH4B 1IGCA 3VR9B 2G4DB 3PLUA 3VFKA 1NI3A 1V86A 3R2IA 2KVZA 5CTRC 2AL6A 2JYTA 5IN7A 1WM3A 2DYMA 1QOAA 4ZRQA 2MRPA 5BO4B 4HKQA 2A4ZA 1T0QC 1WGKA 3N30A 4AOFA 2HJ1A 3P4QB 1UELA 5BYRA 4P1CC 2DAFA 5IO9A 1T0YA 2WS3B 3VXWA 2NS5A 3APFA 1GB4A 1L0VB 2FUG1 2J7QB 4FXCA 2NPTA 3DHIC 3ZQ4A 4M00A 1YQ3B 4J6IA 3PGEA 2O6VD 4HXDA 1D6EC 2RDHA 4K7UA 2N7EA 4DBGA 3AECB 2GOWA 2IZVB 5EDSA 3U52E 4PYZA 2IGDA 3NOBA 3AULA 2KT7A 1WX8A 1QLBB 4EEWA 2PW9A 3B9JA 3PVLA 2KDIA 4B0EA 4ANVA 3TMPB 3DWMA 3HM3A 4DQOC 2MJ3A 3PHXB 2UU7A 4HKZE 2KFKA 2KTRB 2LJ5A 3H1UA 5EE9A 3NHEB 4G11A 2K8BA 2IPKD 3UF8A 2NBVB 2EKIA 2K6DB 4ZHPA 2H88B 4AS1A 2PKOA 3WAMA 4K1RB 1KTKA 1DYQA 2MP2A 5CHFA 1UH6A 1OTRB 2BQQA 5J17A 2JYEA 4EOYA 1ESFA 4OZBA 4TKNA 2HJ8A 2V4LA 4MM3A 2Z0DB 2IO3B 3ZXRA 3RT3B 1JWBD 2INPE 4IC7B 1X1MA 2ZPYA 2N1VA 1CQVA 4ASWC 4ICVA 2XBBC 4XE0A 2LASA 1E6EB 1UGMA 1KJTA 4WAFA 4FN2A 4IM0A 3H6NA 1SGHA 2KVRA 1FRDA 2JY6A 2B3AA 4EKUA 1LGRA 5EE0A 5LLIA 4QAYA 4IM3A 1P1AA 2PLPA 1FCCC 4DHZB 1QOFA 3MC0B 4C4VA 2AQ2B 3NS8A 2YVCA 2L7RA 2K8CA 1B1ZA 4A3PA 3LYYA 3V61A 1JWSD 2J0KA 1RLFA 4M02A 3IG3A 2WXFA 1FEHA 2HE7A 1VR9A 1D5MC 1UD7A 4M01A 3RNBC 2DZIA 1DOXA 4CO7A 2DX5B 2ZJDA 3AEGB 1EU4A 2NBUA 2KDFB 1ZOYB 4RGMA 2BB5A 3W5UB 3NVWA 3KH0A 3KWLA 2KHWB 4JGHB 4PS3A 2GRIA 4O1NA 1KM7A 1D5ZC 4L1BA 2L00B 3AH7A 5JZEB 4PYUA 1FXTB 3PTFC 2N1WA 2R61A 4IKGA 2D10A 2K25A 3U4EG 3L4PA 3AE2B 3VH3B 4NQLB 2LWPA 3UQBA 4KGTA 4ZYSA 2AYOB 1B9RA 4GIVA 3SEBA 3U7ZA 4C7YA 3A33B 1NYQA 1VZ8A 2JRHA 3ETRA 3TBLD 2J42A 4X57B 4OZAA 4L2YA 3UINB 1C9FA 4HVBA 4BKSA 3BINA 4RM9A 3MC9A 2LRUA 1XF5L 1V1OA 1N62A 2CHWA 2LUEA 3GP7A 4NPNA 2MLBA 2RD0A 2GB1A 3EECA 1TT5B 3VUWA 4F1SA 3ZLZA 3TJPA 2D5GA 4DHZE 4EZKA 3RCZA 4LDTB 1XO3A 2W55A 1WR1A 2K5PA 2PVGC 4ZDVA 2NCNA 2WU5B 1HZ5A 4C4VB 4KGRA 3OJ3A 1C79A 4TUUA 4JLCA 2G3QB 3V6CB 5D2MB 3FC4A 5IKCM 3B0AA 4KKIA 3S2AA 2O2VB 2FE8A 1D3ZA 2D3CA 3W5VB 2K39A 2FCNA 4F7ZA 1YQBA 4YTNB 3WALA 4IWPA 2KANA 3W9CB 3RNEC 2IY1B 2Y3AA 1MPEA 2C9WB 2JPHA 2BKRB 3SFDB 2JZPA 3UIOB 1XLPA 3HVDA 2KFJA 2DWQA 1ZW7A 4BFRA 1YIWA 1FCLA 4RFBA 4FULA 2D3GA 4W9KA 4RH6A 3Q3JA 3AE1B 2V3NA 3KQ4A 2GBKA 3IHPC 1I4RA 1UWMA 4MSQB 3RN9C 3PZ7A 5J2RA 1T3QA 2O6VA 2DAJA 4NAMA 1CJEA 2X38A 3WCQA 2MBOA 2QMTA 1GAQB 2L0TA 3H7PB 1PQSA 1C77A 3VRBB 4YWGG 3PREA 5JHAA 5AZGA 5IA7A 3CIRB 2FNJB 3PPAA 1WMHB 2WDVB 2QC8A 4MDKE 2N9EB 3V3XA 2Y5PA 4WH4A 4WJOA 3RNFC 3K9PB 2UWQA 3U7DA 3TUOA 4LDTD 3EFUA 4WWPA 1J7BA 2N9LA 5H8YE 4EZJA 4Q2JA 4KZCA 4K3CA 1CMXB 2KO3A 3DCGA 1FO4A 4XYCA 5AZHA 1TS4A 2KKCA 3KYCD 2EKEC 2EMSA 4KIKB 4IWQA 4MGKE 4A3OA 4HROA 1GC7A 2EELA 3ZNHB 3NZ3A 4RNAA 3R3MA 3I57A 1S3SG 4RF1A 3ML9A 4JX1C 2GBRA 1RRBA 3PS6A 3Q8AA 4P6VF 3IFWB 2BKFA 1QOGA 3DBSA 1T0RC 2JVCA 3PRZA 1GOZA 3ENEA 2WGSA 1KH0A 1GB1A 2WXGA 4XX5A 4GSWA 1WJUA 3V60A 1IP9A 2ONQA 1FM0D 3DBLB 1VD2A 2NTSA 2KQ4X 2JXXA 3Q3FA 4I6LB 1V1PB 5FKAC 2IGHA 5E6OA 2QJLA 1J8CA 4HJGE 2DLBA 2BS2B 1RYJA 1VLBA 3BWUD 1E8ZA 1LQBA 4WWNA 2CJNA 5HG2A 2WP9B 2KMMA 1WGDA 1TKEA 3OAWA 2PIAA 1MHXA 4FJYA 2KAJA 4KX6B 1DGJA 2ZZPB 1SSNA 2BYEA 3ZDTA 2BB6A 2FBWB 3L17A 1WY8A 2D07B 2PE6B 4XC2A 2DYOA 1YJ1A 2B76B 4MH8A 5AEKB 2VH1A 1OQRA 1FXAA 4DDGD 3MC8A 1TJEA 1QQRA 2N9KA 4NJ7A 1OGWA 2MW5A 1JROA 3EC8A 2LGYA 2LRWA 2WXLA 4WAAA 5IAAC 2KTRA 4N59A 2FUHB 4YSZB 2WQYB 3A9KB 1KRHA 3H9DA 2SEBD 1SEBD 1EF1A 4IWOA 3VAWA 1WZ3A 3HM6X 4K7SA 2WXRA 2DHZA 1KLVA 4ACFA 2ZPNA 1TTNA 4GDLB 2LVPA 3X0WA 2BGFA 1VZ7A 2WXIA 3BZDB 2L83A 3C19A 1E0ZA 1ET9A 1RFKA 4W9HA 1WWTA 4GLSC 3AE6B 1IGDA 3NVVA 4B0MA 3PO0A 3DBLI 1SE3A 2QSDA 2JX5A 3M3JA 3VDZA 3SDLC 3ZRCA 5H92C 2G4SA 4TV3A 1I4XA 2I38A 1ACCA 2KWVB 2MQJA 4B9KA 4A8XC 2DYBA 2XN9C 5KHOA 3HK0A 4URKA 3DVNU 2IJ0A 4JPSA 3GZNB 3PZDA 4OW0A 3T3NA 1FMAD 5J18A 5E6PA 5DCNA 4JQWC 4ITKA 5HI1A 1WSPA 3N1YC 4YT0B 1T0SC 2HDEA 2KMCA 2Y5CA 3VHTC 3KYDD 3GS2A 2GMIC 3APDA 2MWSB 4US8A 1JWAD 3TIXA 3EA6A 3EUB2 3Q2AC 1PUTA 3A1QB 1XCQL 2UYZB 2RGFA 3JVZX 2MH7A 5JXVA 3Q14C 2ZCBA 3TCAA 3DVNV 2LVQA 4MJSB 1E10A 2GLSA 2N9XA 2KJHB 2KD0A 4OZCA 3RI7C 2HTME 2LFIA 3R8BA 3QIJA 2LD9A
chains in the Genus database with same CATH topology
3OG5A 2VH1A 4QAYA 3NJTA 3MC8A 2VH2A 4K3CA 4K3BA 3MC9A 2QCZA 2QDFA 3Q6BA 2X8XX 4C4VA 4C4VB 3EFCA 2MHJA 2V9HA 4PK1A 4C00A 4XGAB 4BZAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OG5 A;  2VH1 A;  4QAY A;  3NJT A;  3MC8 A;  2VH2 A;  4K3C A;  4K3B A;  3MC9 A;  2QCZ A;  2QDF A;  3Q6B A;  2X8X X;  4C4V A;  4C4V B;  3EFC A;  2MHJ A;  2V9H A;  4PK1 A;  4C00 A;  4XGA B;  4BZA A; 
#chains in the Genus database with same CATH topology
 1M4V A;  1WGR A;  3DHH C;  2DZK A;  2MA9 B;  4II3 B;  5LNK 1;  3BK1 A;  2N0S B;  3AN1 A;  4US9 A;  3LDZ E;  2LXC A;  2K0P A;  1STE A;  4BOZ B;  2FAZ A;  4ZRI A;  4WQM A;  2SAK A;  3QHT A;  4WJN A;  3KVF B;  2N4F A;  4EZL A;  2FCQ A;  4JWS C;  3URY A;  2MX2 A;  3BYY B;  2PJH A;  1V6E A;  2NMQ A;  3E56 A;  3SD5 A;  3AEA B;  4W9I A;  5L95 C;  4KV2 A;  3Q3M C;  1AYF A;  3L10 B;  3W1Y A;  4ARC A;  1L4D B;  1YD8 U;  2WU2 B;  2Z8L A;  1L4Z B;  1R4N B;  3BII D;  2BYV E;  3AMZ A;  3ZUN A;  1F77 A;  3PRM B;  1NYR A;  1FNW A;  1AN8 A;  4AQ7 A;  3RD2 A;  4DHJ B;  1L0X B;  1QKZ A;  2L76 A;  4R3D A;  1E8W A;  3GZN I;  3KLS X;  3FAH A;  1UGJ A;  3P2B A;  1TBE A;  4OVV A;  1E7P B;  5DPR A;  3IT4 B;  1IBX A;  5CX3 A;  4GXB A;  1T6B X;  1XQQ A;  5EE3 A;  1WRI A;  2KWU B;  1L6U A;  2INN E;  1I35 A;  1FD6 A;  3EFC A;  3AXC A;  2LGS A;  4ZOH C;  4JIO U;  2W9N A;  3D32 A;  2C60 A;  2BBC A;  4ANW A;  3RFZ B;  2KX0 A;  3WAP A;  1BML C;  2KQS A;  2O2V A;  4LK0 M;  4KSK C;  4DXG A;  5TR5 A;  3BK2 A;  1F9J A;  4GOC A;  4H2A A;  3KUD B;  4AJY B;  2NBW B;  2KJR A;  3TSS A;  2WXP A;  2ZVO A;  1AWD A;  4RGN A;  1SE9 A;  3WA0 A;  1J7C A;  2VRR B;  4KVG B;  3T3O A;  3L16 A;  1TKY A;  1Z2M A;  1WXM A;  2IO0 B;  3KWV A;  2WXM A;  4RCO A;  3X23 A;  1HTO A;  2IDY A;  2RDG A;  3SHQ A;  2CU1 A;  2YEP B;  3ZTC A;  4FHK A;  3CF6 E;  1RAX A;  4K3B A;  2Q5W D;  3Q69 A;  2V4I B;  4PT5 A;  2L32 A;  4KKJ A;  2RMM A;  4LNI A;  3VUX A;  2BT6 A;  4K7W A;  3PRP B;  2OJR A;  3ZDM C;  4WUR A;  4XDD A;  3TEX A;  1PDX A;  1N5X A;  3GE8 C;  5JHB A;  3DQV A;  1R4N I;  1YX6 B;  3H7P A;  1WE7 A;  4DHJ D;  1BUI C;  1MG4 A;  1QF6 A;  3DVG X;  4KGS A;  1WFY A;  1WMH A;  1P7E A;  3AE8 B;  1EM7 A;  2PMV A;  4D2K A;  1YN4 A;  4HCP B;  1C3T A;  3APC A;  1JW9 D;  2VH2 A;  3Q3N C;  1WX7 A;  4FJZ A;  1A70 A;  3BY4 B;  1XT9 B;  4GN1 A;  3ABV B;  4W9F A;  5CHW A;  1V2Y A;  4KIK A;  4W9C A;  2LZ6 A;  3L0W B;  5IOI A;  3KUC B;  1IBX B;  4FJV B;  5C2T B;  1JCK B;  1KLU D;  3ECI A;  2AL3 A;  2MCN B;  3N20 C;  1E9M A;  4N9F 4;  3NVY A;  4W9L A;  2M19 A;  3LJ3 A;  2JWU A;  1XLQ A;  2KAC A;  1F0Z A;  3R66 C;  1WE6 A;  2KTF A;  2KMA A;  1C4C A;  4ZRJ A;  2ZEQ A;  3AEB B;  1V1P A;  1V5O A;  4DXF A;  2GBM A;  1E8X A;  3M63 B;  1CZP A;  3QK0 A;  3U2S C;  2ZCC A;  3TEY A;  1WGG A;  3DVG Y;  4PS7 A;  3DOW A;  2RDB C;  3UGB B;  3UIP B;  1TS5 A;  1IYF A;  2KK8 A;  1TIF A;  2YEP F;  2KN5 A;  2I2Y A;  3AV8 A;  5BYS A;  4LNN A;  4LJP B;  2AQ3 B;  2OJW A;  4AWJ A;  1I4Q A;  1YN3 A;  4S17 A;  3IT6 B;  2M17 A;  4CYE A;  4LNK A;  1EF5 A;  3ZNG C;  1TGZ B;  3B1L X;  4B6W A;  3C0R B;  3PHW B;  4WJQ A;  3AM9 A;  4MEL A;  1K51 A;  3NZS A;  3CST A;  2RSU A;  5D7G A;  4M8N A;  3VR8 B;  1F1H A;  4OVZ A;  2LGI A;  4WIP A;  2KDE B;  4IG7 B;  1FNU A;  3C8Y A;  1I4P A;  2MJE A;  2CR5 A;  3NY5 A;  3ZIM A;  4HCN B;  5DPW A;  2NVU I;  2JUO A;  3A9K A;  1NBF C;  1V49 A;  2MEK A;  3HUI A;  1SF0 A;  2WNM A;  3ZKJ C;  1WJ4 A;  2C5L C;  3RUL A;  4M8M A;  2LGD A;  4NJC A;  2MBQ A;  4C80 A;  1KFY B;  2D3A A;  4GDL A;  3SU8 X;  2KQ7 A;  1E5W A;  2G1E A;  3WAO A;  3L08 A;  4NY0 A;  5G5H A;  2JZ3 B;  1I42 A;  4CQN A;  1Q0W B;  4LJO B;  1XD3 B;  1PYW D;  1WJ6 A;  1V80 A;  4PS8 A;  2ON8 A;  1TKG A;  1C1Y B;  4BKT A;  5IP4 D;  1GG3 A;  3E9S A;  4HDO A;  3GOE A;  5HHD G;  4B95 A;  1VZ6 A;  1M94 A;  4NJ6 A;  1TZ1 A;  3MJW A;  2N7J A;  1SIF A;  3NRZ A;  2V3S A;  3O13 A;  3QC8 B;  1K53 A;  3T8M A;  2L05 A;  4BBN C;  2ZW0 A;  3ZRF A;  2N7D A;  2JXT A;  1C4P A;  2IBI B;  2KJ6 A;  4EE2 A;  1ZDX A;  3AED B;  3GB1 A;  5LXH A;  4C7Z A;  1NDD A;  3BVM A;  3TEW A;  1TS2 A;  2H89 B;  1EUV B;  4MGY E;  1AW7 A;  1WM2 A;  3V6E B;  1E8Y A;  2BYT A;  1KLG D;  2DBY A;  2R2O A;  3PZ8 A;  1WR6 E;  1SJE D;  3A1Q A;  4KZ0 A;  1PFD A;  3AE7 B;  2GBJ A;  3HRD D;  3Q6B A;  3JSV A;  4GDK A;  2W3R A;  2GBN A;  1UZX B;  4MJS A;  2WXQ A;  1WXS A;  1KF6 B;  2K22 A;  2KLG A;  5G5G A;  3HIZ A;  3RNG C;  3QA8 A;  2K8H A;  2REX A;  3RMK C;  3Q8B A;  4GGQ A;  1HQR D;  2JZZ A;  2K9X A;  2DNF A;  2KZR A;  4BAX A;  5FK9 C;  5FR3 A;  3FIL A;  4ZHO A;  3N1X C;  1V81 A;  3Q3O C;  3B08 A;  3A9J A;  4BKG A;  2L3Z A;  2WX1 A;  3GE3 C;  4MGI E;  5HFY A;  3UQA A;  2HD5 B;  4RF0 A;  1LM8 B;  5D3I B;  2KC2 A;  3IXS A;  3I3T B;  1E7U A;  4M0W B;  2D11 A;  4G0N B;  3UI3 A;  1SE2 A;  2C7N B;  2NR2 A;  1F2R C;  1FIQ A;  3RZF A;  4A55 A;  3OG5 A;  3MP9 A;  3IVF A;  3N1Z C;  3NUH B;  1GJZ A;  1P98 A;  4ARI A;  3AB5 A;  1ISN A;  2KN4 A;  3U8Z A;  1D4B A;  5BMI A;  2KWC A;  2KC1 A;  3I63 C;  1V97 A;  5JH5 C;  1PGA A;  2E3T A;  3AE3 B;  4ICU A;  1HZ6 A;  3CMM B;  2L52 A;  3DBH B;  2I1K A;  1C4A A;  5E6N A;  4RGT A;  2C7H A;  4C56 C;  2QCZ A;  4MH0 E;  1FFV A;  1SXT A;  1WH3 A;  2ICI A;  1QOB A;  4C00 A;  1GNU A;  4F8C B;  3SFE B;  1WJN A;  1JML A;  2LEK A;  1JRP A;  4XWW A;  4J3O D;  1QZE A;  4KDI C;  2QEJ C;  1N60 A;  2WXK A;  3FKY A;  5L83 A;  1I4G A;  1UBI A;  2BTE A;  3QWZ B;  1ZP0 B;  2IGG A;  1V8C A;  2FCM A;  2TSS A;  3R7Q A;  3ZGZ A;  3JSV B;  4GDK B;  4MSM B;  4L23 A;  1J0G A;  2LHD A;  1SJH D;  2RPV A;  4FA6 A;  2L8J A;  2V0G A;  1K52 A;  1GUA B;  1R4M B;  4YSY B;  2LHE A;  2GI9 A;  2WLB A;  2BS3 B;  3QAR A;  1T5X D;  2D2Q A;  3R7R A;  2R2Q A;  1NVI D;  3ZNZ B;  1XXG A;  3FIL B;  2VZK B;  3A9J B;  1ZGU B;  4HK2 A;  3DBR B;  1UF0 A;  2JSV X;  2N9P C;  2OED A;  4AP4 C;  4MT5 A;  1NEN B;  4ZYN A;  3A4R A;  3RNC C;  3P1M A;  3W1S C;  3RUI B;  3HVZ A;  2K3U A;  2WXH A;  3V05 A;  3Q8F A;  4TQ0 A;  3ZNI D;  2M0X A;  2FIF A;  3WAN A;  4NZL B;  3PLV A;  1OEY J;  5E6J A;  4P16 A;  3IBE A;  2WX0 A;  1Q10 A;  4OVU A;  1FXI A;  2ACZ B;  4W9E A;  1WXV A;  1L5P A;  3NS1 A;  1L2N A;  3DBH I;  1N61 A;  2KLC A;  1KOT A;  2HTH A;  5D6J B;  3W1S A;  2CS4 A;  5FR6 A;  2AEH A;  3V62 A;  1WXQ A;  2YLM A;  1JWM D;  1HXY D;  2IYD B;  3AU5 A;  2Y5B B;  2DZM A;  1OEY A;  2LUM A;  3NG0 A;  1V5T A;  1EWY C;  2QIE B;  5AUK A;  2BF8 B;  1R7S A;  1QIL A;  2QHO A;  2C7M B;  1P3Q U;  4USA A;  2E6X A;  4TQ1 A;  3N32 A;  3JYU A;  4ANX A;  3O65 B;  3MHS D;  4E71 A;  4YTM B;  4YTP B;  4P1B C;  5GXG B;  4BBN F;  3VVW B;  3OJ4 B;  2ZNV C;  2M8S A;  1J7A A;  2JT4 B;  4RM8 A;  4AUQ C;  1MFW A;  1R4M I;  1SBB B;  2RR9 A;  4HJK A;  3RPF C;  4KDL B;  2VZK D;  1DOY A;  1WF9 A;  1NEK B;  2NPT B;  1JWU D;  2BS4 B;  3N3K B;  1SE4 A;  2DEN B;  1WIA A;  2Z59 B;  1V9J A;  2KNB A;  3LB8 C;  1TYG B;  2ASQ A;  3DBR I;  4HPP A;  4W9G A;  3A4S C;  3T9L A;  3Q8E A;  1C76 A;  4G50 A;  3R2T A;  2M0A A;  3M62 B;  1AAR A;  4HRS A;  4YXD B;  1N63 A;  2V9H A;  2OOB B;  3K9O B;  4HWI B;  1ENF A;  1Y8R C;  3L13 A;  3RZW C;  1VDV A;  1JRU A;  1HEZ E;  2KXJ A;  3RNA C;  4DK5 A;  4NAW A;  1Y56 A;  4JWU C;  3AE9 B;  3P4R B;  3P42 A;  3EHV A;  4E3C A;  5C1Z A;  1OQY A;  3ZJU A;  2KFK B;  3AE4 B;  1UWX A;  1OFF A;  5EE1 A;  5TSS A;  1ZXH A;  3MHZ A;  2EMT A;  3ONS A;  1I4H A;  1EWC A;  2XNA C;  3N9Y C;  2LVO A;  2Z0E B;  2BYF A;  4W9D A;  2KOX A;  4ZRK A;  5GMV A;  1Q1O A;  5BYQ A;  3AI5 A;  5HKH A;  3B2F A;  2V3P A;  3DHG C;  4IUM B;  4XZ4 A;  2BWF A;  2MP2 B;  2DZJ A;  1F2R I;  3BVG A;  5LXI B;  3ML8 A;  3ALB A;  1WX9 A;  3JW0 X;  4IDI A;  5T8I A;  4XWT A;  4DDI D;  1VJK A;  4MGZ E;  3J9C A;  3ZXV A;  3P4P B;  1ZPS A;  4MM3 B;  3PV1 A;  1S1Q B;  4FLH A;  2BW2 A;  1ET6 A;  2K6Q A;  2QIL A;  2L1A A;  2INC C;  5AUI A;  1IPG A;  2AQ1 B;  1YJI A;  4YL8 A;  4IOI E;  2IO2 B;  1UUP A;  3AEF B;  1MI0 A;  4A6Q A;  2WXO A;  1HE8 A;  2MSE D;  5KHQ A;  4AJW A;  1WYW B;  4W9J A;  2J0M A;  5BMH A;  1GC6 A;  2FCS A;  4N6E B;  3VTU A;  3QQ8 B;  4XDC A;  5AZF A;  4A20 A;  1WRD B;  4WQO B;  2IO1 B;  2JWZ A;  1WGH A;  2LJI A;  3OWE B;  2I1J A;  4GB9 A;  1EU3 A;  4A90 A;  1LXD A;  4ZRP A;  2KDB A;  4HEA 1;  3RYT A;  3QX1 A;  2WDT B;  4HPL B;  2JQR B;  4IM2 A;  4DWF A;  3TEZ A;  4II2 B;  3VUY A;  2IY0 B;  1YQ4 B;  3OLM D;  3I5J C;  5C3J B;  1TY2 A;  1NI2 A;  2PPH A;  2MJD A;  4REZ A;  2AWT A;  1ZDV A;  2ZW1 A;  1H8C A;  3P63 A;  1ZUD 2;  1J19 A;  4OHJ A;  2ZNV B;  2XEW A;  2QDF A;  1YX5 B;  1WYG A;  4JL9 A;  3H7S A;  4WWO A;  1Q5W B;  1XLO A;  2JRI B;  2MBE A;  5G2N A;  3U30 A;  2OHF A;  3VQI A;  3ZO5 B;  3EGR A;  1ZE3 D;  3CSF A;  4BZA A;  3BYT B;  2RPQ A;  1RWS A;  1HA5 A;  3AE5 B;  3L54 A;  1FFU A;  4MEM A;  2CHX A;  1I7H A;  5BMG A;  1EO6 A;  2G9H D;  4NAW B;  1SIJ A;  4GU2 A;  2CU3 A;  2M56 B;  4FHJ A;  4NQK E;  4KSL C;  1GPX A;  3MTN B;  4BOS C;  2BPS A;  2J53 A;  5DPS A;  2WDQ B;  5C23 A;  2XK5 A;  3NZU A;  4P7I A;  3ZW3 A;  4LCD E;  1TY0 A;  2AX5 A;  1MVK A;  3Q8C A;  3LXF A;  1C78 A;  1Z5S B;  4M0W A;  4GMV A;  2LGX A;  1FPY A;  1HTQ A;  2KYW A;  1N5W A;  2JU6 X;  1WXA A;  1XLN A;  1VCB A;  2J52 A;  4WWM A;  5MPO A;  1MJD A;  2W54 A;  1FRR A;  2BVC A;  2LXA A;  4I6P A;  4LLG M;  3B2G A;  1WI0 A;  4TSS A;  3HHM A;  4ANU A;  1G6J A;  1L6V A;  1YNT E;  1TS3 A;  1ZKH A;  4DXA B;  3CWI A;  3QCA A;  2W3S A;  4NNJ B;  1K50 A;  3ZTD A;  3ZVV A;  1L7Y A;  4FAD A;  3NVZ A;  4EFO A;  3KUZ A;  1IUE A;  2PE9 A;  2MHJ A;  3DPD A;  4FBJ B;  1BXT A;  3I9V 1;  2CHZ A;  3NJT A;  2WXN A;  2BWE S;  3AU4 A;  5G55 A;  1WZ0 A;  1K8R B;  2FID A;  2KX3 A;  1P0R A;  2JF5 A;  4RGO S;  3ZYY X;  1ROE A;  2A5U A;  1YMH E;  2CJO A;  3AEE B;  3DWG C;  3H8H A;  1UNS A;  2D3B A;  4LNO A;  5CHV C;  4WJP A;  4BVU C;  1VRA B;  1JAL A;  3ZJV A;  1H4R A;  3VRA B;  1LO5 D;  4N58 A;  2M1M A;  2WDR B;  1E7V A;  2KDM A;  4EUT A;  1L0Y B;  1YOV B;  3PT2 B;  4MAC A;  2PVO D;  5DPT A;  2PTL A;  2NTT A;  1P7F A;  4LNF A;  3MJ5 A;  4UDU C;  1CK1 A;  1XEE A;  2WYQ A;  3W2D A;  1DOI A;  2KWD A;  2V1Y A;  4LTU A;  5I4D A;  2M4N A;  3IAM 1;  3QJZ A;  3TL5 A;  2LMC A;  3WIM A;  4TMA B;  1XCT L;  1BT0 A;  3SR6 A;  1JQ4 A;  3KW5 B;  2LI5 A;  1A5R A;  1MHH E;  2X8X X;  4K81 A;  2W82 A;  4HLE A;  1D5X C;  1YJJ A;  3DDC B;  5D3D A;  1U4A A;  4HDQ A;  4XGA B;  4HPM B;  2XK5 B;  3MFG A;  3BVZ A;  2G45 B;  2O6V B;  1F52 A;  1SB3 C;  2J0J A;  4S0R A;  4YSX B;  1TZO A;  1ZXI A;  4BKS D;  1PGB A;  1N6Z A;  2MBB B;  2CKH B;  4JE3 B;  2PEA A;  4E74 A;  2MBH A;  3M95 A;  4A9A A;  4PK1 A;  1MG8 A;  1QT9 A;  4G3X B;  3IAS 1;  3VTV A;  3VTW A;  1LFD A;  2IND C;  1FNV A;  2J4X A;  2L0F A;  1RFA A;  2WXJ A;  2WHI A;  1OQQ A;  4RMA A;  1E90 A;  1P9D U;  3PSE B;  2K1F A;  1WGY A;  5D94 A;  1PGX A;  1UBQ A;  3ZJT A;  4IW0 A;  1RM6 C;  2WWZ A;  3P4S B;  1YN5 A;  4CHK A;  2ZVN A;  4I6N B;  3QAQ A;  3VH4 B;  1IGC A;  3VR9 B;  2G4D B;  3PLU A;  3VFK A;  1NI3 A;  1V86 A;  3R2I A;  2KVZ A;  5CTR C;  2AL6 A;  2JYT A;  5IN7 A;  1WM3 A;  2DYM A;  1QOA A;  4ZRQ A;  2MRP A;  5BO4 B;  4HKQ A;  2A4Z A;  1T0Q C;  1WGK A;  3N30 A;  4AOF A;  2HJ1 A;  3P4Q B;  1UEL A;  5BYR A;  4P1C C;  2DAF A;  5IO9 A;  1T0Y A;  2WS3 B;  3VXW A;  2NS5 A;  3APF A;  1GB4 A;  1L0V B;  2FUG 1;  2J7Q B;  4FXC A;  2NPT A;  3DHI C;  3ZQ4 A;  4M00 A;  1YQ3 B;  4J6I A;  3PGE A;  2O6V D;  4HXD A;  1D6E C;  2RDH A;  4K7U A;  2N7E A;  4DBG A;  3AEC B;  2GOW A;  2IZV B;  5EDS A;  3U52 E;  4PYZ A;  2IGD A;  3NOB A;  3AUL A;  2KT7 A;  1WX8 A;  1QLB B;  4EEW A;  2PW9 A;  3B9J A;  3PVL A;  2KDI A;  4B0E A;  4ANV A;  3TMP B;  3DWM A;  3HM3 A;  4DQO C;  2MJ3 A;  3PHX B;  2UU7 A;  4HKZ E;  2KFK A;  2KTR B;  2LJ5 A;  3H1U A;  5EE9 A;  3NHE B;  4G11 A;  2K8B A;  2IPK D;  3UF8 A;  2NBV B;  2EKI A;  2K6D B;  4ZHP A;  2H88 B;  4AS1 A;  2PKO A;  3WAM A;  4K1R B;  1KTK A;  1DYQ A;  2MP2 A;  5CHF A;  1UH6 A;  1OTR B;  2BQQ A;  5J17 A;  2JYE A;  4EOY A;  1ESF A;  4OZB A;  4TKN A;  2HJ8 A;  2V4L A;  4MM3 A;  2Z0D B;  2IO3 B;  3ZXR A;  3RT3 B;  1JWB D;  2INP E;  4IC7 B;  1X1M A;  2ZPY A;  2N1V A;  1CQV A;  4ASW C;  4ICV A;  2XBB C;  4XE0 A;  2LAS A;  1E6E B;  1UGM A;  1KJT A;  4WAF A;  4FN2 A;  4IM0 A;  3H6N A;  1SGH A;  2KVR A;  1FRD A;  2JY6 A;  2B3A A;  4EKU A;  1LGR A;  5EE0 A;  5LLI A;  4QAY A;  4IM3 A;  1P1A A;  2PLP A;  1FCC C;  4DHZ B;  1QOF A;  3MC0 B;  4C4V A;  2AQ2 B;  3NS8 A;  2YVC A;  2L7R A;  2K8C A;  1B1Z A;  4A3P A;  3LYY A;  3V61 A;  1JWS D;  2J0K A;  1RLF A;  4M02 A;  3IG3 A;  2WXF A;  1FEH A;  2HE7 A;  1VR9 A;  1D5M C;  1UD7 A;  4M01 A;  3RNB C;  2DZI A;  1DOX A;  4CO7 A;  2DX5 B;  2ZJD A;  3AEG B;  1EU4 A;  2NBU A;  2KDF B;  1ZOY B;  4RGM A;  2BB5 A;  3W5U B;  3NVW A;  3KH0 A;  3KWL A;  2KHW B;  4JGH B;  4PS3 A;  2GRI A;  4O1N A;  1KM7 A;  1D5Z C;  4L1B A;  2L00 B;  3AH7 A;  5JZE B;  4PYU A;  1FXT B;  3PTF C;  2N1W A;  2R61 A;  4IKG A;  2D10 A;  2K25 A;  3U4E G;  3L4P A;  3AE2 B;  3VH3 B;  4NQL B;  2LWP A;  3UQB A;  4KGT A;  4ZYS A;  2AYO B;  1B9R A;  4GIV A;  3SEB A;  3U7Z A;  4C7Y A;  3A33 B;  1NYQ A;  1VZ8 A;  2JRH A;  3ETR A;  3TBL D;  2J42 A;  4X57 B;  4OZA A;  4L2Y A;  3UIN B;  1C9F A;  4HVB A;  4BKS A;  3BIN A;  4RM9 A;  3MC9 A;  2LRU A;  1XF5 L;  1V1O A;  1N62 A;  2CHW A;  2LUE A;  3GP7 A;  4NPN A;  2MLB A;  2RD0 A;  2GB1 A;  3EEC A;  1TT5 B;  3VUW A;  4F1S A;  3ZLZ A;  3TJP A;  2D5G A;  4DHZ E;  4EZK A;  3RCZ A;  4LDT B;  1XO3 A;  2W55 A;  1WR1 A;  2K5P A;  2PVG C;  4ZDV A;  2NCN A;  2WU5 B;  1HZ5 A;  4C4V B;  4KGR A;  3OJ3 A;  1C79 A;  4TUU A;  4JLC A;  2G3Q B;  3V6C B;  5D2M B;  3FC4 A;  5IKC M;  3B0A A;  4KKI A;  3S2A A;  2O2V B;  2FE8 A;  1D3Z A;  2D3C A;  3W5V B;  2K39 A;  2FCN A;  4F7Z A;  1YQB A;  4YTN B;  3WAL A;  4IWP A;  2KAN A;  3W9C B;  3RNE C;  2IY1 B;  2Y3A A;  1MPE A;  2C9W B;  2JPH A;  2BKR B;  3SFD B;  2JZP A;  3UIO B;  1XLP A;  3HVD A;  2KFJ A;  2DWQ A;  1ZW7 A;  4BFR A;  1YIW A;  1FCL A;  4RFB A;  4FUL A;  2D3G A;  4W9K A;  4RH6 A;  3Q3J A;  3AE1 B;  2V3N A;  3KQ4 A;  2GBK A;  3IHP C;  1I4R A;  1UWM A;  4MSQ B;  3RN9 C;  3PZ7 A;  5J2R A;  1T3Q A;  2O6V A;  2DAJ A;  4NAM A;  1CJE A;  2X38 A;  3WCQ A;  2MBO A;  2QMT A;  1GAQ B;  2L0T A;  3H7P B;  1PQS A;  1C77 A;  3VRB B;  4YWG G;  3PRE A;  5JHA A;  5AZG A;  5IA7 A;  3CIR B;  2FNJ B;  3PPA A;  1WMH B;  2WDV B;  2QC8 A;  4MDK E;  2N9E B;  3V3X A;  2Y5P A;  4WH4 A;  4WJO A;  3RNF C;  3K9P B;  2UWQ A;  3U7D A;  3TUO A;  4LDT D;  3EFU A;  4WWP A;  1J7B A;  2N9L A;  5H8Y E;  4EZJ A;  4Q2J A;  4KZC A;  4K3C A;  1CMX B;  2KO3 A;  3DCG A;  1FO4 A;  4XYC A;  5AZH A;  1TS4 A;  2KKC A;  3KYC D;  2EKE C;  2EMS A;  4KIK B;  4IWQ A;  4MGK E;  4A3O A;  4HRO A;  1GC7 A;  2EEL A;  3ZNH B;  3NZ3 A;  4RNA A;  3R3M A;  3I57 A;  1S3S G;  4RF1 A;  3ML9 A;  4JX1 C;  2GBR A;  1RRB A;  3PS6 A;  3Q8A A;  4P6V F;  3IFW B;  2BKF A;  1QOG A;  3DBS A;  1T0R C;  2JVC A;  3PRZ A;  1GOZ A;  3ENE A;  2WGS A;  1KH0 A;  1GB1 A;  2WXG A;  4XX5 A;  4GSW A;  1WJU A;  3V60 A;  1IP9 A;  2ONQ A;  1FM0 D;  3DBL B;  1VD2 A;  2NTS A;  2KQ4 X;  2JXX A;  3Q3F A;  4I6L B;  1V1P B;  5FKA C;  2IGH A;  5E6O A;  2QJL A;  1J8C A;  4HJG E;  2DLB A;  2BS2 B;  1RYJ A;  1VLB A;  3BWU D;  1E8Z A;  1LQB A;  4WWN A;  2CJN A;  5HG2 A;  2WP9 B;  2KMM A;  1WGD A;  1TKE A;  3OAW A;  2PIA A;  1MHX A;  4FJY A;  2KAJ A;  4KX6 B;  1DGJ A;  2ZZP B;  1SSN A;  2BYE A;  3ZDT A;  2BB6 A;  2FBW B;  3L17 A;  1WY8 A;  2D07 B;  2PE6 B;  4XC2 A;  2DYO A;  1YJ1 A;  2B76 B;  4MH8 A;  5AEK B;  2VH1 A;  1OQR A;  1FXA A;  4DDG D;  3MC8 A;  1TJE A;  1QQR A;  2N9K A;  4NJ7 A;  1OGW A;  2MW5 A;  1JRO A;  3EC8 A;  2LGY A;  2LRW A;  2WXL A;  4WAA A;  5IAA C;  2KTR A;  4N59 A;  2FUH B;  4YSZ B;  2WQY B;  3A9K B;  1KRH A;  3H9D A;  2SEB D;  1SEB D;  1EF1 A;  4IWO A;  3VAW A;  1WZ3 A;  3HM6 X;  4K7S A;  2WXR A;  2DHZ A;  1KLV A;  4ACF A;  2ZPN A;  1TTN A;  4GDL B;  2LVP A;  3X0W A;  2BGF A;  1VZ7 A;  2WXI A;  3BZD B;  2L83 A;  3C19 A;  1E0Z A;  1ET9 A;  1RFK A;  4W9H A;  1WWT A;  4GLS C;  3AE6 B;  1IGD A;  3NVV A;  4B0M A;  3PO0 A;  3DBL I;  1SE3 A;  2QSD A;  2JX5 A;  3M3J A;  3VDZ A;  3SDL C;  3ZRC A;  5H92 C;  2G4S A;  4TV3 A;  1I4X A;  2I38 A;  1ACC A;  2KWV B;  2MQJ A;  4B9K A;  4A8X C;  2DYB A;  2XN9 C;  5KHO A;  3HK0 A;  4URK A;  3DVN U;  2IJ0 A;  4JPS A;  3GZN B;  3PZD A;  4OW0 A;  3T3N A;  1FMA D;  5J18 A;  5E6P A;  5DCN A;  4JQW C;  4ITK A;  5HI1 A;  1WSP A;  3N1Y C;  4YT0 B;  1T0S C;  2HDE A;  2KMC A;  2Y5C A;  3VHT C;  3KYD D;  3GS2 A;  2GMI C;  3APD A;  2MWS B;  4US8 A;  1JWA D;  3TIX A;  3EA6 A;  3EUB 2;  3Q2A C;  1PUT A;  3A1Q B;  1XCQ L;  2UYZ B;  2RGF A;  3JVZ X;  2MH7 A;  5JXV A;  3Q14 C;  2ZCB A;  3TCA A;  3DVN V;  2LVQ A;  4MJS B;  1E10 A;  2GLS A;  2N9X A;  2KJH B;  2KD0 A;  4OZC A;  3RI7 C;  2HTM E;  2LFI A;  3R8B A;  3QIJ A;  2LD9 A; 
#chains in the Genus database with same CATH homology
 3OG5 A;  2VH1 A;  4QAY A;  3NJT A;  3MC8 A;  2VH2 A;  4K3C A;  4K3B A;  3MC9 A;  2QCZ A;  2QDF A;  3Q6B A;  2X8X X;  4C4V A;  4C4V B;  3EFC A;  2MHJ A;  2V9H A;  4PK1 A;  4C00 A;  4XGA B;  4BZA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...