2QDFA

Structure of n-terminal domain of e. coli yaet
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
332
structure length
318
Chain Sequence
MAEGFVVKDIHFEGLQRVAVGAALLSMPVRTGDTVNDEDISNTIRALFATGNFEDVRVLRDGDTLLVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVRVGESLDRTTIADIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFQEGVSAEIQQINIVGNHAFTTDELISHFQLRQKQKLAGDLETLRSYYLDRGYARFNIDSTQVSLTPDKKGIYVTVNITEGDQYKLSGVEVSGNLAGHSAEIEQLTKIEPGELYNGTKVTKMEDDIKKLLGRYGYAYPRVQSMPEINDADKTVKLRVNVDAGNRFYVRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer membrane protein assembly factor yaeT
publication title Structure and function of an essential component of the outer membrane protein assembly machine.
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Membrane protein, protein transport
total genus 93
structure length 318
sequence length 332
ec nomenclature
pdb deposition date 2007-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07244 POTRA Surface antigen variable number repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 2qdfA04
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 2qdfA03
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 2qdfA02
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 2qdfA01
4K3CA 2QCZA 4C4VA 3MC9A 4XGAB 2QDFA 4QAYA 4C00A 4C4VB 2VH1A 3OG5A 4PK1A 2MHJA 3Q6BA 3MC8A 2V9HA 2VH2A 3NJTA 4BZAA 3EFCA 4K3BA 2X8XX
chains in the Genus database with same CATH superfamily
2KTRA 1OGWA 5D7GA 3RNFC 1VZ6A 2QSDA 2FCQA 2NCNA 1SBBB 1ZKHA 3R2TA 3RD2A 4TQ1A 3GZNI 2ZPNA 5D3IB 3W5UB 4N6EB 2N9EB 1F1HA 4F1SA 3UIOB 4ZHOA 3QWZB 2O2VA 2RDGA 3AE5B 1WJ4A 1VZ7A 2LI5A 3N3KB 4WQOB 4FHKA 2HDEA 1YJIA 2PMVA 5I4DA 3KWLA 2N1VA 3AE1B 1A5RA 1XD3B 1VRAB 2WXJA 1YN4A 1LXDA 3MJWA 4WIPA 2G4SA 1D6EC 5KHOA 4MGKE 3A1QB 1C9FA 3JVZX 4GGQA 4MGYE 4EZJA 1QLBB 4FN2A 3SDLC 5GXGB 1D3ZA 3VQIA 1WFYA 2QIEB 3CSTA 4II3B 3TIXA 1VLBA 1R4NB 2XEWA 3NG0A 3ZDMC 2GLSA 1QZEA 4W9CA 2J7QB 2ZCBA 3BYTB 2NR2A 3MFGA 2DHZA 4KZ0A 1ZXIA 2JPHA 1E8WA 1TS4A 2LZ6A 5D2MB 2KC2A 2LVOA 3ETRA 5IAAC 4ANVA 1K8RB 1TY0A 3KQ4A 1QILA 4FA6A 2SAKA 5JHAA 3ZQ4A 1A70A 3APCA 2FIDA 4K7WA 3P4RB 1J7BA 1SF0A 2GBKA 4LK0M 1KLGD 1WM3A 4JL9A 3ML8A 1V5OA 1JQ4A 2KJ6A 3P42A 2MJ3A 1GNUA 1SIJA 4YTNB 5DPWA 1QT9A 3GP7A 3T3NA 3A4RA 5GMVA 2KQSA 1BXTA 3UGBB 4DDID 4HCNB 1V6EA 2D3AA 3WAOA 2L0FA 4XWWA 4C4VB 5BO4B 2BB6A 2L32A 3VTWA 2KZRA 1GJZA 1HZ6A 4M0WA 2D3CA 4XDCA 3AE9B 3A9KA 1K51A 1Q10A 4DDGD 2D11A 1X1MA 2IPKD 2WXRA 2BTEA 2LGIA 2LVPA 2M0AA 3N9YC 2M56B 3WANA 3WALA 4IM2A 1PQSA 1SSNA 2K9XA 3AMZA 5DPTA 5FKAC 3DPDA 3DBLI 1PGAA 1UGMA 2KFJA 4MDKE 1V49A 5EDSA 4WJQA 1KTKA 5BYRA 3N1ZC 2HE7A 3OJ3A 2Y5PA 3ZYYX 2WXHA 1F52A 3PLVA 5DPSA 5BYQA 1HXYD 4JPSA 2J0JA 1L0VB 3BIID 2FUG1 5FR3A 2JYTA 1WE6A 1YX6B 2L7RA 2MJEA 2DNFA 3PV1A 3VHTC 5E6OA 2K1FA 2KTRB 5E6NA 3PHWB 2M0XA 3HM3A 5J17A 1JMLA 1Z5SB 3NY5A 2V4LA 4RM9A 5CTRC 5HG2A 1V9JA 3EA6A 4PS7A 1I4PA 4A3PA 2PLPA 2AYOB 3PRZA 3GS2A 1ZE3D 2O6VA 2VZKB 2O2VB 1AWDA 1AN8A 2XNAC 5TR5A 1FFUA 2RD0A 3NJTA 3IAM1 3AV8A 1MFWA 2C5LC 2BYFA 3NVVA 2V3SA 3OWEB 2R2OA 4WJOA 3ZDTA 2WX0A 4WJPA 3HK0A 2GRIA 2MBHA 2XK5B 2WWZA 2KOXA 4B0EA 1XLNA 3Q8AA 1E8YA 1ZDXA 2LHEA 1YJ1A 3VFKA 2RR9A 3HVDA 2MWSB 4GSWA 3H7PA 2K6QA 4KSLC 1UELA 4LTUA 2MP2A 4HXDA 1YX5B 3AN1A 5FK9C 2B3AA 2QMTA 1NDDA 3Q8BA 3U7ZA 4OVZA 2N9XA 3M63B 3M3JA 2CU3A 3ZGZA 4II2B 1EU4A 3DBSA 3HVZA 4O1NA 1YIWA 1OFFA 2GBJA 2JF5A 2KMAA 1MPEA 2KANA 2WXPA 2Y5BB 2KACA 3PO0A 4YWGG 2NBVB 3T8MA 4TKNA 2CHXA 2PW9A 3DBRI 1R7SA 3Q3FA 4ITKA 2J42A 2PEAA 3VR9B 1UUPA 4AS1A 3N32A 1B9RA 2WX1A 1QKZA 1YMHE 3NOBA 2KN4A 1EF1A 5AUKA 1K50A 3AB5A 3AE6B 3ZLZA 3D32A 3OAWA 2ICIA 1JW9D 1YD8U 4A55A 4URKA 4W9DA 1IGCA 2W3SA 2Z59B 3Q3OC 4BBNC 2KVZA 2N0SB 2BKRB 3WAMA 3ZO5B 4HJKA 4A3OA 3VTUA 4M0WB 2YEPB 4EZLA 3Q8EA 4US8A 1VR9A 1WY8A 4DBGA 3ZW3A 5G55A 4HPMB 3H7SA 1WX7A 2WLBA 3QAQA 3RCZA 5G5GA 3B2GA 3KUCB 3I57A 4JQWC 1YN3A 3HIZA 3TMPB 1GAQB 4NAWB 4CYEA 3IT6B 2WXLA 3KYDD 3KWVA 2IZVB 2JXXA 2XN9C 4GDKB 1WXAA 2DENB 2AEHA 3TSSA 3NZSA 3DVNV 1TTNA 1P3QU 4AOFA 3L4PA 3DWGC 1WIAA 4B6WA 3RULA 4US9A 3HM6X 1D4BA 2HD5B 5D6JB 3PHXB 3A1QA 4LNFA 3R7QA 2WXIA 3Q6BA 1IBXA 2O6VB 4ZRQA 5C2TB 2KLCA 1S3SG 2KJRA 1ROEA 2TSSA 4M00A 2UYZB 4I6LB 2WQYB 2FIFA 2FBWB 1I7HA 1ZDVA 4PS3A 4AWJA 1L4ZB 1SGHA 2JZPA 4E74A 2JT4B 1CMXB 2DWQA 1C4CA 3SD5A 4C7ZA 2MA9B 2INNE 1FIQA 2Y5CA 2EELA 4LNKA 2L3ZA 1OEYA 1M4VA 2V3PA 3GZNB 3ZJTA 3V6EB 4C00A 1NI2A 4ZRIA 4GB9A 2WXOA 1ET9A 3H8HA 1YQ4B 2B76B 2KMCA 2L1AA 3A4SC 3KUZA 5E6JA 5JZEB 1KLVA 1PFDA 1Q5WB 4GDLA 1ESFA 4FJYA 1NENB 3GB1A 2LFIA 4IG7B 1F2RC 2R61A 3W1SC 1WYWB 3RZFA 3HHMA 3TL5A 3TEWA 2H88B 3AE7B 4DXGA 2D07B 5HI1A 3UINB 2PTLA 4WURA 2V9HA 4GMVA 3B1LX 4K3BA 2C7MB 4OVUA 4YT0B 4N59A 4C4VA 4MELA 3VXWA 4UDUC 3L10B 3TUOA 1NYQA 4P6VF 1DYQA 5C1ZA 3BINA 1ACCA 1RM6C 1ET6A 2N4FA 2EMTA 2FCMA 3QX1A 2KJHB 2DYMA 4A90A 3L54A 3IVFA 1JWSD 1TBEA 3PVLA 1GB4A 1GC6A 5MPOA 1HA5A 1TGZB 2EMSA 3C19A 4IWQA 4IW0A 4DHJB 2KT7A 2RMMA 1TY2A 3P4SB 2LVQA 3VH3B 1KJTA 1RLFA 3Q3MC 1F77A 4QAYA 4DHZB 3RNGC 3EUB2 3IG3A 4J6IA 4PK1A 3B2FA 2REXA 2DAJA 3TEZA 1XO3A 2L8JA 3ZNHB 3JYUA 1Y56A 3DHHC 2CU1A 2MRPA 1UH6A 1PGXA 2MBEA 2K8CA 2MJDA 4JWUC 4DWFA 5AZFA 2I2YA 3FILB 4NJ6A 2G1EA 5BMHA 2LGXA 1FNUA 2C60A 4GIVA 4W9GA 5D94A 2KKCA 3KUDB 4R3DA 3NS1A 1UBQA 1F2RI 4KGTA 2RPVA 4OVVA 1GG3A 4NJCA 3K9PB 1TJEA 4BKSA 1AARA 1T0QC 2A5UA 1V97A 3RFZB 2LGSA 2Z0DB 1PDXA 1E10A 4B95A 1L4DB 3DBLB 1IBXB 2XK5A 4WJNA 2E3TA 2JXTA 3Q69A 1NYRA 2WXNA 1KH0A 1WX9A 2ZEQA 3UIPB 2IJ0A 2MSED 3N1YC 1SE9A 4E71A 1XLQA 1JALA 2LXAA 1T3QA 2WXKA 4JLCA 2J0MA 1WF9A 3ENEA 3WIMA 3PREA 4GU2A 1JRUA 3I63C 2BPSA 1N5XA 5LLIA 3MP9A 1S1QB 4LDTB 3V62A 1WI0A 1YJJA 1FFVA 5JH5C 4TMAB 1E8ZA 3L17A 3VDZA 3LJ3A 3W1YA 3CMMB 4HROA 4IWOA 2RSUA 1AYFA 2IO1B 2L00B 2QEJC 1FNWA 1I4HA 3O65B 5G2NA 3TCAA 3ZVVA 3U8ZA 4EFOA 1L6UA 4ZRKA 2NMQA 1WMHA 2JRIB 1TS5A 4GDLB 2O6VD 1ZUD2 2G4DB 4ZOHC 2SEBD 3NZUA 2NPTB 4MGIE 4H2AA 3ZNID 1WXMA 3OJ4B 1GC7A 2KYWA 1RWSA 3R66C 1JCKB 2KQ7A 3MHZA 4RNAA 1FRDA 4IM3A 4FBJB 1N63A 3SR6A 1WJNA 4Q2JA 4G50A 5CX3A 2KDIA 1WZ0A 5C3JB 3T3OA 1YQBA 2OOBB 4NQLB 2PE6B 2IGDA 2PPHA 2BYTA 4WH4A 4ACFA 1C4AA 4OZAA 3DCGA 2J4XA 3N1XC 2K5PA 5EE9A 1FCCC 3HUIA 4ICUA 4MGZE 4IUMB 5CHWA 5D3DA 4BBNF 4NAWA 5H8YE 3SEBA 4RGMA 3P1MA 1K53A 3QK0A 1WE7A 2YEPF 2AQ1B 3MC0B 1VZ8A 4ZYSA 4K3CA 1OTRB 1UGJA 4ANXA 2MBQA 4GDKA 1EUVB 2CKHB 1TT5B 2WNMA 1P7FA 3AEBB 3DBRB 4K1RB 4ICVA 2KXJA 1E90A 3A9JA 1P1AA 1WGHA 2JZ3B 4MSQB 1C77A 1V1PB 4A8XC 2BKFA 4I6NB 3VRAB 2V4IB 1VCBA 2LGDA 1FEHA 2QILA 1PUTA 1EU3A 4W9IA 2MQJA 1CZPA 5AZGA 2KO3A 1CJEA 2YLMA 1V81A 2ZVOA 3NVWA 2EKEC 3BZDB 1TS3A 1P98A 4PYUA 3EFCA 1VD2A 1XQQA 1QQRA 3IT4B 2ZCCA 2I38A 4LLGM 4S0RA 3VUXA 4BFRA 1XT9B 1FNVA 2BGFA 3AXCA 3U4EG 1NI3A 3NUHB 2MHJA 2ON8A 2WDVB 2JU6X 4AP4C 3NZ3A 3RT3B 1RYJA 4L23A 1ENFA 4BOSC 2K39A 4NJ7A 4DXFA 2LGYA 2MW5A 4CO7A 1MG8A 3KVFB 2KK8A 4EUTA 4MACA 3RYTA 1YOVB 3IXSA 2LUMA 1UF0A 2AX5A 3URYA 2MCNB 3O13A 1LFDA 4FJZA 4MH0E 2WGSA 1FMAD 2G9HD 1P9DU 2N7JA 2IYDB 4BVUC 3LDZE 2BS4B 1ISNA 3W1SA 3ZJUA 4XWTA 2OHFA 3QCAA 1L5PA 1MJDA 4F8CB 3PLUA 1WZ3A 3CWIA 3U52E 3KW5B 2QJLA 4C7YA 1ZGUB 1VDVA 4KGSA 3B0AA 3RNBC 1N62A 2CS4A 2BWES 4EE2A 1WMHB 2KDBA 2C7NB 3QA8A 3MC9A 1I35A 5DPRA 1SXTA 3P2BA 3ZXVA 3VTVA 3U7DA 4RGNA 2M17A 1ZW7A 1D5XC 1FCLA 3BVGA 4W9FA 3ZKJC 2KWCA 2M4NA 4YSYB 3Q3NC 4G0NB 2BT6A 1OQYA 2ZVNA 2KD0A 1CK1A 1V80A 2FCSA 2KVRA 3DVNU 1J7CA 2W3RA 4X57B 2G45B 4LDTD 1M94A 3AULA 4IOIE 3V6CB 3R2IA 3AU5A 1UNSA 4K7SA 4JGHB 4WQMA 1DGJA 4M01A 1WX8A 3EECA 2WXFA 2FCNA 4REZA 2NS5A 2KDEB 1PGBA 3H1UA 4OHJA 1JWAD 2GBNA 2JSVX 2AL3A 5FR6A 2E6XA 3TBLD 4KSKC 3AE2B 1UZXB 4XDDA 2K0PA 3R7RA 3VUYA 3AEFB 4P7IA 4LNIA 3FILA 3SHQA 4HLEA 5HHDG 1SIFA 1WGKA 1GPXA 4FJVB 3ZRCA 3A9JB 2I1JA 2LXCA 1F9JA 1MG4A 2H89B 2DBYA 1C79A 4MJSB 2DYOA 4ARIA 2OJWA 1P7EA 3A33B 1TKGA 2LJIA 3IBEA 2INDC 3DDCB 3OG5A 3LB8C 1BT0A 3M95A 1SJHD 1WGRA 2AQ3B 3AEEB 3L0WB 4WWOA 2PJHA 1JWUD 1WR6E 3Q2AC 3MJ5A 1T0YA 4LNOA 2KTFA 3WA0A 2DLBA 3T9LA 4TQ0A 4LJPB 2KX3A 3AE8B 2OEDA 3DBHI 4DK5A 2J53A 1YNTE 3PSEB 3NVZA 3AECB 4B9KA 5H92C 5CHVC 3MHSD 4W9LA 2QC8A 1I4QA 1GB1A 3DVGY 2ZNVB 2PIAA 2ZNVC 2N9PC 1F0ZA 2BBCA 2NBWB 5HFYA 2XBBC 2NVUI 3UI3A 1E6EB 1E7VA 4NY0A 2KX0A 2HTME 1XLPA 4LCDE 4MSMB 4NAMA 4NQKE 4IDIA 1BUIC 2OJRA 2D5GA 2NTTA 1XCQL 1L0XB 1JROA 1N6ZA 4RF0A 1C1YB 1YN5A 2X38A 2VZKD 1UD7A 2NPTA 1ZXHA 2BWFA 2ZPYA 4HPPA 4A9AA 2PE9A 1R4MI 4HDOA 2VH2A 1FXTB 2W55A 1IPGA 2ONQA 3V61A 5IKCM 1VJKA 3GE8C 5LXHA 2GOWA 4M8MA 1E0ZA 1PYWD 3DQVA 1IP9A 3AM9A 2A4ZA 4ZRPA 3NRZA 2KDFB 2JY6A 4BKSD 2D2QA 4EZKA 4USAA 2Y3AA 1OQRA 3HRDD 5EE3A 1ZP0B 2N7EA 3ZNGC 3X0WA 1IGDA 3ECIA 4KKJA 2BB5A 2M19A 4IC7B 1FO4A 2J52A 2KNBA 3V60A 4JIOU 5IOIA 1KM7A 2JUOA 2LEKA 3EGRA 1U4AA 3ZUNA 4FHJA 3SU8X 1QOFA 4RCOA 3S2AA 2G3QB 1MHHE 2Z8LA 4EKUA 1H8CA 1KRHA 2V3NA 4HCPB 2NTSA 2DZIA 3C8YA 3BYYB 4JE3B 4HVBA 4XYCA 1J0GA 1WR1A 3Q3JA 2N7DA 2WP9B 1XEEA 3ML9A 2KQ4X 2BVCA 5HKHA 3P4QB 3P4PB 1OEYJ 1V1PA 4KIKA 2HTHA 4EOYA 3W5VB 2DAFA 2ACZB 5E6PA 1T6BX 4FULA 2IBIB 3AEGB 2JWZA 3V3XA 3I5JC 5J2RA 4OZBA 2C9WB 2DZKA 4KDIC 2IY0B 1CQVA 3NS8A 4W9JA 3W2DA 1I4GA 1Z2MA 2I1KA 4RF1A 1C3TA 3V05A 1V8CA 3QIJA 5L95C 1QF6A 2IGHA 3JSVB 3RPFC 3X23A 1I4XA 1HTOA 2INPE 2GBRA 3ALBA 1FXAA 2K6DB 2LWPA 4KV2A 5C23A 3VR8B 4KX6B 2QHOA 4MM3B 3IAS1 1LM8B 2JVCA 5IA7A 5JXVA 2JX5A 1N61A 2MX2A 4W9EA 3QHTA 1XXGA 4W9KA 5EE1A 3Q8FA 3K9OB 1IYFA 1E7PB 3J9CA 1I4RA 4NNJB 3RNEC 2BW2A 2MBBB 4HK2A 1WM2A 5BMIA 3ZRFA 4GOCA 4WAAA 3BWUD 1C4PA 2M8SA 3UQAA 3R8BA 1QOBA 3E9SA 4L2YA 4RM8A 1KOTA 1GOZA 2BS2B 3C0RB 3AI5A 2IGGA 2UU7A 3RNAC 4ANUA 1V1OA 2D3BA 1RFKA 1C76A 4P1CC 5DCNA 3AU4A 2GI9A 4LNNA 3DOWA 2N9KA 4DXAB 1L0YB 2ZW1A 4L1BA 3VAWA 2DX5B 2PVOD 1DOIA 1HZ5A 4A20A 4XZ4A 4BZAA 3DWMA 4TV3A 3N30A 3RI7C 2BYVE 4NZLB 3L13A 1EO6A 5G5HA 1QOGA 4BKTA 4DHZE 1LO5D 4F7ZA 3KYCD 3U30A 2RDBC 3NVYA 5CHFA 3CSFA 5BMGA 5AZHA 2W9NA 4J3OD 4XC2A 1WXSA 2RGFA 1EWCA 2Q5WD 3WCQA 1KFYB 4FLHA 4W9HA 5IP4D 3IFWB 5LXIB 4AJYB 2IO2B 3PZ7A 2ASQA 1WH3A 1STEA 2GB1A 4IM0A 3FAHA 2KC1A 4EEWA 2MBOA 3EC8A 4IKGA 4HDQA 3ZIMA 2JQRB 3DVGX 3PT2B 2D10A 3QQ8B 4RMAA 1DOYA 2CR5A 1WGDA 1E9MA 1E5WA 4YTPB 4XE0A 2AWTA 1B1ZA 3NHEB 5KHQA 3PZ8A 1RAXA 2WHIA 1L7YA 2VRRB 4MJSA 4M02A 4JWSC 2R2QA 1R4NI 3ZTDA 2HJ8A 1G6JA 3L08A 4KIKB 3UQBA 4K81A 1N5WA 3E56A 3BY4B 1HE8A 3KLSX 3RUIB 5TSSA 5LNK1 2KWDA 2LHDA 4YL8A 2KFKA 1MHXA 2LUEA 2FNJB 2M1MA 3BVZA 4YSXB 1FM0D 1JRPA 1TZ1A 4MH8A 3BK1A 1XLOA 2L76A 2K3UA 2BS3B 2GMIC 3PTFC 2IO0B 3PS6A 2K25A 3Q8CA 4N58A 2KWVB 4A6QA 3ZNZB 3VH4B 4DQOC 2V1YA 4WWPA 1FRRA 4WWMA 3MTNB 1XCTL 2PVGC 4DHJD 3B9JA 5IO9A 1FD6A 2N1WA 3QC8B 4P16A 5IN7A 2WXQA 3DHIC 2K8BA 2WU5B 4AQ7A 4XX5A 2L52A 4GLSC 2KHWB 3TJPA 1EM7A 4ZDVA 4FADA 5J18A 1WRIA 2INCC 3BK2A 3MC8A 4RGOS 5L83A 1WGGA 3IHPC 4S17A 4RH6A 3ZJVA 1SEBD 1E7UA 3AE4B 2CHZA 2CHWA 1T0RC 5AUIA 3QARA 3PRPB 2L0TA 2IDYA 1LQBA 2CJNA 2FE8A 5EE0A 4G3XB 1UWXA 4CHKA 2L05A 4TUUA 4C56C 3LXFA 3WAPA 1RFAA 4HRSA 4HKQA 3Q14C 4HEA1 2BF8B 3CF6E 3DBHB 1SB3C 4KZCA 2IY1B 2KDMA 2FAZA 1TKEA 3RZWC 1SE3A 3TEYA 1HEZE 4D2KA 1FPYA 1EWYC 3PGEA 1TYGB 2UWQA 1P0RA 2LASA 3JW0X 1BMLC 4GN1A 1T5XD 3CIRB 3M62B 3DHGC 2IO3B 4HJGE 1XF5L 2JRHA 3PRMB 4I6PA 4ANWA 4YXDB 5JHBA 2AQ2B 1WWTA 4KKIA 3VUWA 2PKOA 2WDRB 3P63A 3ZXRA 1FXIA 1Y8RC 4OZCA 3N20C 1KF6B 2J0KA 2WXGA 4N9F4 1C78A 4AJWA 4WWNA 1YQ3B 2LD9A 3AEAB 1TZOA 3H9DA 2DZJA 2WDQB 4YSZB 3A9KB 1R4MB 1H4RA 4MEMA 2LJ5A 3GE3C 2RDHA 1AW7A 1SJED 3OLMD 1LGRA 2AL6A 2WYQA 2LRUA 2DYBA 2FUHB 3QJZA 3APFA 4PS8A 4ARCA 1GUAB 3JSVA 2CJOA 1J19A 1DOXA 3B08A 1V5TA 2KWUB 1KLUD 2BQQA 4B0MA 1IUEA 3RMKC 3L16A 2WXMA 4ZHPA 1JWMD 2ZZPB 1D5MC 3LYYA 3U2SC 1ZOYB 1T0SC 2WU2B 4LJOB 4MM3A 4KGRA 2KFKB 4OW0A 4JX1C 4GXBA 2V0GA 4BOZB 3I3TB 1WXVA 3EHVA 2WDTB 3KH0A 2D3GA 1K52A 1N60A 4ZYNA 3H6NA 4RFBA 3ABVB 2W54A 1WYGA 2HJ1A 1NVID 1WGYA 4ZRJA 1I42A 3W9CB 2QDFA 3EFUA 1MI0A 2L83A 2WS3B 4PT5A 2MLBA 1UBIA 1NEKB 1WSPA 2KN5A 2W82A 1WJUA 3VRBB 3AEDB 3SFEB 1TKYA 3SFDB 2KAJA 4AUQC 3FC4A 2BYEA 5AEKB 4KVGB 4IWPA 2LMCA 1E8XA 2NBUA 1EF5A 2C7HA 2Z0EB 1SE4A 5T8IA 4M8NA 1UWMA 1HTQA 3H7PB 4PYZA 3APDA 1J8CA 3RNCC 3UF8A 2MP2B 4G11A 2MEKA 4TSSA 3AE3B 1L6VA 3TEXA 4BAXA 1JWBD 1NBFC 3I9V1 2KMMA 1Q1OA 1WRDB 4FXCA 2LRWA 3FKYA 4BKGA 1D5ZC 2EKIA 4KDLB 1WJ6A 4HKZE 4NPNA 2X8XX 2K8HA 2JZZA 2QCZA 2MH7A 4XGAB 1V86A 2RPQA 1TS2A 1SE2A 1J7AA 1TIFA 3BVMA 4MT5A 2VH1A 4HWIB 3ZTCA 2DZMA 4E3CA 2JWUA 5BYSA 4K7UA 1Q0WB 4RGTA 4P1BC 2JYEA 1OQQA 3RN9C 2ZW0A 2KLGA 3AH7A 4C80A 1QOAA 2GBMA 1RRBA 3PZDA 2K22A 4YTMB 2N9LA 3GOEA 3PPAA 2YVCA 4CQNA 3VVWB 4ASWC 1MVKA 1WXQA 4WAFA 3R3MA 2ZJDA 1V2YA 4HPLB 3ONSA 1L2NA 1HQRD 1ZPSA
chains in the Genus database with same CATH topology
4K3CA 2QCZA 4C4VA 3MC9A 4XGAB 2QDFA 4QAYA 4C00A 4C4VB 2VH1A 3OG5A 4PK1A 2MHJA 3Q6BA 3MC8A 2V9HA 2VH2A 3NJTA 4BZAA 3EFCA 4K3BA 2X8XX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K3C A;  2QCZ A;  4C4V A;  3MC9 A;  4XGA B;  2QDF A;  4QAY A;  4C00 A;  4C4V B;  2VH1 A;  3OG5 A;  4PK1 A;  2MHJ A;  3Q6B A;  3MC8 A;  2V9H A;  2VH2 A;  3NJT A;  4BZA A;  3EFC A;  4K3B A;  2X8X X; 
#chains in the Genus database with same CATH topology
 2KTR A;  1OGW A;  5D7G A;  3RNF C;  1VZ6 A;  2QSD A;  2FCQ A;  2NCN A;  1SBB B;  1ZKH A;  3R2T A;  3RD2 A;  4TQ1 A;  3GZN I;  2ZPN A;  5D3I B;  3W5U B;  4N6E B;  2N9E B;  1F1H A;  4F1S A;  3UIO B;  4ZHO A;  3QWZ B;  2O2V A;  2RDG A;  3AE5 B;  1WJ4 A;  1VZ7 A;  2LI5 A;  3N3K B;  4WQO B;  4FHK A;  2HDE A;  1YJI A;  2PMV A;  5I4D A;  3KWL A;  2N1V A;  3AE1 B;  1A5R A;  1XD3 B;  1VRA B;  2WXJ A;  1YN4 A;  1LXD A;  3MJW A;  4WIP A;  2G4S A;  1D6E C;  5KHO A;  4MGK E;  3A1Q B;  1C9F A;  3JVZ X;  4GGQ A;  4MGY E;  4EZJ A;  1QLB B;  4FN2 A;  3SDL C;  5GXG B;  1D3Z A;  3VQI A;  1WFY A;  2QIE B;  3CST A;  4II3 B;  3TIX A;  1VLB A;  1R4N B;  2XEW A;  3NG0 A;  3ZDM C;  2GLS A;  1QZE A;  4W9C A;  2J7Q B;  2ZCB A;  3BYT B;  2NR2 A;  3MFG A;  2DHZ A;  4KZ0 A;  1ZXI A;  2JPH A;  1E8W A;  1TS4 A;  2LZ6 A;  5D2M B;  2KC2 A;  2LVO A;  3ETR A;  5IAA C;  4ANV A;  1K8R B;  1TY0 A;  3KQ4 A;  1QIL A;  4FA6 A;  2SAK A;  5JHA A;  3ZQ4 A;  1A70 A;  3APC A;  2FID A;  4K7W A;  3P4R B;  1J7B A;  1SF0 A;  2GBK A;  4LK0 M;  1KLG D;  1WM3 A;  4JL9 A;  3ML8 A;  1V5O A;  1JQ4 A;  2KJ6 A;  3P42 A;  2MJ3 A;  1GNU A;  1SIJ A;  4YTN B;  5DPW A;  1QT9 A;  3GP7 A;  3T3N A;  3A4R A;  5GMV A;  2KQS A;  1BXT A;  3UGB B;  4DDI D;  4HCN B;  1V6E A;  2D3A A;  3WAO A;  2L0F A;  4XWW A;  4C4V B;  5BO4 B;  2BB6 A;  2L32 A;  3VTW A;  2KZR A;  1GJZ A;  1HZ6 A;  4M0W A;  2D3C A;  4XDC A;  3AE9 B;  3A9K A;  1K51 A;  1Q10 A;  4DDG D;  2D11 A;  1X1M A;  2IPK D;  2WXR A;  2BTE A;  2LGI A;  2LVP A;  2M0A A;  3N9Y C;  2M56 B;  3WAN A;  3WAL A;  4IM2 A;  1PQS A;  1SSN A;  2K9X A;  3AMZ A;  5DPT A;  5FKA C;  3DPD A;  3DBL I;  1PGA A;  1UGM A;  2KFJ A;  4MDK E;  1V49 A;  5EDS A;  4WJQ A;  1KTK A;  5BYR A;  3N1Z C;  2HE7 A;  3OJ3 A;  2Y5P A;  3ZYY X;  2WXH A;  1F52 A;  3PLV A;  5DPS A;  5BYQ A;  1HXY D;  4JPS A;  2J0J A;  1L0V B;  3BII D;  2FUG 1;  5FR3 A;  2JYT A;  1WE6 A;  1YX6 B;  2L7R A;  2MJE A;  2DNF A;  3PV1 A;  3VHT C;  5E6O A;  2K1F A;  2KTR B;  5E6N A;  3PHW B;  2M0X A;  3HM3 A;  5J17 A;  1JML A;  1Z5S B;  3NY5 A;  2V4L A;  4RM9 A;  5CTR C;  5HG2 A;  1V9J A;  3EA6 A;  4PS7 A;  1I4P A;  4A3P A;  2PLP A;  2AYO B;  3PRZ A;  3GS2 A;  1ZE3 D;  2O6V A;  2VZK B;  2O2V B;  1AWD A;  1AN8 A;  2XNA C;  5TR5 A;  1FFU A;  2RD0 A;  3NJT A;  3IAM 1;  3AV8 A;  1MFW A;  2C5L C;  2BYF A;  3NVV A;  2V3S A;  3OWE B;  2R2O A;  4WJO A;  3ZDT A;  2WX0 A;  4WJP A;  3HK0 A;  2GRI A;  2MBH A;  2XK5 B;  2WWZ A;  2KOX A;  4B0E A;  1XLN A;  3Q8A A;  1E8Y A;  1ZDX A;  2LHE A;  1YJ1 A;  3VFK A;  2RR9 A;  3HVD A;  2MWS B;  4GSW A;  3H7P A;  2K6Q A;  4KSL C;  1UEL A;  4LTU A;  2MP2 A;  4HXD A;  1YX5 B;  3AN1 A;  5FK9 C;  2B3A A;  2QMT A;  1NDD A;  3Q8B A;  3U7Z A;  4OVZ A;  2N9X A;  3M63 B;  3M3J A;  2CU3 A;  3ZGZ A;  4II2 B;  1EU4 A;  3DBS A;  3HVZ A;  4O1N A;  1YIW A;  1OFF A;  2GBJ A;  2JF5 A;  2KMA A;  1MPE A;  2KAN A;  2WXP A;  2Y5B B;  2KAC A;  3PO0 A;  4YWG G;  2NBV B;  3T8M A;  4TKN A;  2CHX A;  2PW9 A;  3DBR I;  1R7S A;  3Q3F A;  4ITK A;  2J42 A;  2PEA A;  3VR9 B;  1UUP A;  4AS1 A;  3N32 A;  1B9R A;  2WX1 A;  1QKZ A;  1YMH E;  3NOB A;  2KN4 A;  1EF1 A;  5AUK A;  1K50 A;  3AB5 A;  3AE6 B;  3ZLZ A;  3D32 A;  3OAW A;  2ICI A;  1JW9 D;  1YD8 U;  4A55 A;  4URK A;  4W9D A;  1IGC A;  2W3S A;  2Z59 B;  3Q3O C;  4BBN C;  2KVZ A;  2N0S B;  2BKR B;  3WAM A;  3ZO5 B;  4HJK A;  4A3O A;  3VTU A;  4M0W B;  2YEP B;  4EZL A;  3Q8E A;  4US8 A;  1VR9 A;  1WY8 A;  4DBG A;  3ZW3 A;  5G55 A;  4HPM B;  3H7S A;  1WX7 A;  2WLB A;  3QAQ A;  3RCZ A;  5G5G A;  3B2G A;  3KUC B;  3I57 A;  4JQW C;  1YN3 A;  3HIZ A;  3TMP B;  1GAQ B;  4NAW B;  4CYE A;  3IT6 B;  2WXL A;  3KYD D;  3KWV A;  2IZV B;  2JXX A;  2XN9 C;  4GDK B;  1WXA A;  2DEN B;  2AEH A;  3TSS A;  3NZS A;  3DVN V;  1TTN A;  1P3Q U;  4AOF A;  3L4P A;  3DWG C;  1WIA A;  4B6W A;  3RUL A;  4US9 A;  3HM6 X;  1D4B A;  2HD5 B;  5D6J B;  3PHX B;  3A1Q A;  4LNF A;  3R7Q A;  2WXI A;  3Q6B A;  1IBX A;  2O6V B;  4ZRQ A;  5C2T B;  2KLC A;  1S3S G;  2KJR A;  1ROE A;  2TSS A;  4M00 A;  2UYZ B;  4I6L B;  2WQY B;  2FIF A;  2FBW B;  1I7H A;  1ZDV A;  4PS3 A;  4AWJ A;  1L4Z B;  1SGH A;  2JZP A;  4E74 A;  2JT4 B;  1CMX B;  2DWQ A;  1C4C A;  3SD5 A;  4C7Z A;  2MA9 B;  2INN E;  1FIQ A;  2Y5C A;  2EEL A;  4LNK A;  2L3Z A;  1OEY A;  1M4V A;  2V3P A;  3GZN B;  3ZJT A;  3V6E B;  4C00 A;  1NI2 A;  4ZRI A;  4GB9 A;  2WXO A;  1ET9 A;  3H8H A;  1YQ4 B;  2B76 B;  2KMC A;  2L1A A;  3A4S C;  3KUZ A;  5E6J A;  5JZE B;  1KLV A;  1PFD A;  1Q5W B;  4GDL A;  1ESF A;  4FJY A;  1NEN B;  3GB1 A;  2LFI A;  4IG7 B;  1F2R C;  2R61 A;  3W1S C;  1WYW B;  3RZF A;  3HHM A;  3TL5 A;  3TEW A;  2H88 B;  3AE7 B;  4DXG A;  2D07 B;  5HI1 A;  3UIN B;  2PTL A;  4WUR A;  2V9H A;  4GMV A;  3B1L X;  4K3B A;  2C7M B;  4OVU A;  4YT0 B;  4N59 A;  4C4V A;  4MEL A;  3VXW A;  4UDU C;  3L10 B;  3TUO A;  1NYQ A;  4P6V F;  1DYQ A;  5C1Z A;  3BIN A;  1ACC A;  1RM6 C;  1ET6 A;  2N4F A;  2EMT A;  2FCM A;  3QX1 A;  2KJH B;  2DYM A;  4A90 A;  3L54 A;  3IVF A;  1JWS D;  1TBE A;  3PVL A;  1GB4 A;  1GC6 A;  5MPO A;  1HA5 A;  1TGZ B;  2EMS A;  3C19 A;  4IWQ A;  4IW0 A;  4DHJ B;  2KT7 A;  2RMM A;  1TY2 A;  3P4S B;  2LVQ A;  3VH3 B;  1KJT A;  1RLF A;  3Q3M C;  1F77 A;  4QAY A;  4DHZ B;  3RNG C;  3EUB 2;  3IG3 A;  4J6I A;  4PK1 A;  3B2F A;  2REX A;  2DAJ A;  3TEZ A;  1XO3 A;  2L8J A;  3ZNH B;  3JYU A;  1Y56 A;  3DHH C;  2CU1 A;  2MRP A;  1UH6 A;  1PGX A;  2MBE A;  2K8C A;  2MJD A;  4JWU C;  4DWF A;  5AZF A;  2I2Y A;  3FIL B;  4NJ6 A;  2G1E A;  5BMH A;  2LGX A;  1FNU A;  2C60 A;  4GIV A;  4W9G A;  5D94 A;  2KKC A;  3KUD B;  4R3D A;  3NS1 A;  1UBQ A;  1F2R I;  4KGT A;  2RPV A;  4OVV A;  1GG3 A;  4NJC A;  3K9P B;  1TJE A;  4BKS A;  1AAR A;  1T0Q C;  2A5U A;  1V97 A;  3RFZ B;  2LGS A;  2Z0D B;  1PDX A;  1E10 A;  4B95 A;  1L4D B;  3DBL B;  1IBX B;  2XK5 A;  4WJN A;  2E3T A;  2JXT A;  3Q69 A;  1NYR A;  2WXN A;  1KH0 A;  1WX9 A;  2ZEQ A;  3UIP B;  2IJ0 A;  2MSE D;  3N1Y C;  1SE9 A;  4E71 A;  1XLQ A;  1JAL A;  2LXA A;  1T3Q A;  2WXK A;  4JLC A;  2J0M A;  1WF9 A;  3ENE A;  3WIM A;  3PRE A;  4GU2 A;  1JRU A;  3I63 C;  2BPS A;  1N5X A;  5LLI A;  3MP9 A;  1S1Q B;  4LDT B;  3V62 A;  1WI0 A;  1YJJ A;  1FFV A;  5JH5 C;  4TMA B;  1E8Z A;  3L17 A;  3VDZ A;  3LJ3 A;  3W1Y A;  3CMM B;  4HRO A;  4IWO A;  2RSU A;  1AYF A;  2IO1 B;  2L00 B;  2QEJ C;  1FNW A;  1I4H A;  3O65 B;  5G2N A;  3TCA A;  3ZVV A;  3U8Z A;  4EFO A;  1L6U A;  4ZRK A;  2NMQ A;  1WMH A;  2JRI B;  1TS5 A;  4GDL B;  2O6V D;  1ZUD 2;  2G4D B;  4ZOH C;  2SEB D;  3NZU A;  2NPT B;  4MGI E;  4H2A A;  3ZNI D;  1WXM A;  3OJ4 B;  1GC7 A;  2KYW A;  1RWS A;  3R66 C;  1JCK B;  2KQ7 A;  3MHZ A;  4RNA A;  1FRD A;  4IM3 A;  4FBJ B;  1N63 A;  3SR6 A;  1WJN A;  4Q2J A;  4G50 A;  5CX3 A;  2KDI A;  1WZ0 A;  5C3J B;  3T3O A;  1YQB A;  2OOB B;  4NQL B;  2PE6 B;  2IGD A;  2PPH A;  2BYT A;  4WH4 A;  4ACF A;  1C4A A;  4OZA A;  3DCG A;  2J4X A;  3N1X C;  2K5P A;  5EE9 A;  1FCC C;  3HUI A;  4ICU A;  4MGZ E;  4IUM B;  5CHW A;  5D3D A;  4BBN F;  4NAW A;  5H8Y E;  3SEB A;  4RGM A;  3P1M A;  1K53 A;  3QK0 A;  1WE7 A;  2YEP F;  2AQ1 B;  3MC0 B;  1VZ8 A;  4ZYS A;  4K3C A;  1OTR B;  1UGJ A;  4ANX A;  2MBQ A;  4GDK A;  1EUV B;  2CKH B;  1TT5 B;  2WNM A;  1P7F A;  3AEB B;  3DBR B;  4K1R B;  4ICV A;  2KXJ A;  1E90 A;  3A9J A;  1P1A A;  1WGH A;  2JZ3 B;  4MSQ B;  1C77 A;  1V1P B;  4A8X C;  2BKF A;  4I6N B;  3VRA B;  2V4I B;  1VCB A;  2LGD A;  1FEH A;  2QIL A;  1PUT A;  1EU3 A;  4W9I A;  2MQJ A;  1CZP A;  5AZG A;  2KO3 A;  1CJE A;  2YLM A;  1V81 A;  2ZVO A;  3NVW A;  2EKE C;  3BZD B;  1TS3 A;  1P98 A;  4PYU A;  3EFC A;  1VD2 A;  1XQQ A;  1QQR A;  3IT4 B;  2ZCC A;  2I38 A;  4LLG M;  4S0R A;  3VUX A;  4BFR A;  1XT9 B;  1FNV A;  2BGF A;  3AXC A;  3U4E G;  1NI3 A;  3NUH B;  2MHJ A;  2ON8 A;  2WDV B;  2JU6 X;  4AP4 C;  3NZ3 A;  3RT3 B;  1RYJ A;  4L23 A;  1ENF A;  4BOS C;  2K39 A;  4NJ7 A;  4DXF A;  2LGY A;  2MW5 A;  4CO7 A;  1MG8 A;  3KVF B;  2KK8 A;  4EUT A;  4MAC A;  3RYT A;  1YOV B;  3IXS A;  2LUM A;  1UF0 A;  2AX5 A;  3URY A;  2MCN B;  3O13 A;  1LFD A;  4FJZ A;  4MH0 E;  2WGS A;  1FMA D;  2G9H D;  1P9D U;  2N7J A;  2IYD B;  4BVU C;  3LDZ E;  2BS4 B;  1ISN A;  3W1S A;  3ZJU A;  4XWT A;  2OHF A;  3QCA A;  1L5P A;  1MJD A;  4F8C B;  3PLU A;  1WZ3 A;  3CWI A;  3U52 E;  3KW5 B;  2QJL A;  4C7Y A;  1ZGU B;  1VDV A;  4KGS A;  3B0A A;  3RNB C;  1N62 A;  2CS4 A;  2BWE S;  4EE2 A;  1WMH B;  2KDB A;  2C7N B;  3QA8 A;  3MC9 A;  1I35 A;  5DPR A;  1SXT A;  3P2B A;  3ZXV A;  3VTV A;  3U7D A;  4RGN A;  2M17 A;  1ZW7 A;  1D5X C;  1FCL A;  3BVG A;  4W9F A;  3ZKJ C;  2KWC A;  2M4N A;  4YSY B;  3Q3N C;  4G0N B;  2BT6 A;  1OQY A;  2ZVN A;  2KD0 A;  1CK1 A;  1V80 A;  2FCS A;  2KVR A;  3DVN U;  1J7C A;  2W3R A;  4X57 B;  2G45 B;  4LDT D;  1M94 A;  3AUL A;  4IOI E;  3V6C B;  3R2I A;  3AU5 A;  1UNS A;  4K7S A;  4JGH B;  4WQM A;  1DGJ A;  4M01 A;  1WX8 A;  3EEC A;  2WXF A;  2FCN A;  4REZ A;  2NS5 A;  2KDE B;  1PGB A;  3H1U A;  4OHJ A;  1JWA D;  2GBN A;  2JSV X;  2AL3 A;  5FR6 A;  2E6X A;  3TBL D;  4KSK C;  3AE2 B;  1UZX B;  4XDD A;  2K0P A;  3R7R A;  3VUY A;  3AEF B;  4P7I A;  4LNI A;  3FIL A;  3SHQ A;  4HLE A;  5HHD G;  1SIF A;  1WGK A;  1GPX A;  4FJV B;  3ZRC A;  3A9J B;  2I1J A;  2LXC A;  1F9J A;  1MG4 A;  2H89 B;  2DBY A;  1C79 A;  4MJS B;  2DYO A;  4ARI A;  2OJW A;  1P7E A;  3A33 B;  1TKG A;  2LJI A;  3IBE A;  2IND C;  3DDC B;  3OG5 A;  3LB8 C;  1BT0 A;  3M95 A;  1SJH D;  1WGR A;  2AQ3 B;  3AEE B;  3L0W B;  4WWO A;  2PJH A;  1JWU D;  1WR6 E;  3Q2A C;  3MJ5 A;  1T0Y A;  4LNO A;  2KTF A;  3WA0 A;  2DLB A;  3T9L A;  4TQ0 A;  4LJP B;  2KX3 A;  3AE8 B;  2OED A;  3DBH I;  4DK5 A;  2J53 A;  1YNT E;  3PSE B;  3NVZ A;  3AEC B;  4B9K A;  5H92 C;  5CHV C;  3MHS D;  4W9L A;  2QC8 A;  1I4Q A;  1GB1 A;  3DVG Y;  2ZNV B;  2PIA A;  2ZNV C;  2N9P C;  1F0Z A;  2BBC A;  2NBW B;  5HFY A;  2XBB C;  2NVU I;  3UI3 A;  1E6E B;  1E7V A;  4NY0 A;  2KX0 A;  2HTM E;  1XLP A;  4LCD E;  4MSM B;  4NAM A;  4NQK E;  4IDI A;  1BUI C;  2OJR A;  2D5G A;  2NTT A;  1XCQ L;  1L0X B;  1JRO A;  1N6Z A;  4RF0 A;  1C1Y B;  1YN5 A;  2X38 A;  2VZK D;  1UD7 A;  2NPT A;  1ZXH A;  2BWF A;  2ZPY A;  4HPP A;  4A9A A;  2PE9 A;  1R4M I;  4HDO A;  2VH2 A;  1FXT B;  2W55 A;  1IPG A;  2ONQ A;  3V61 A;  5IKC M;  1VJK A;  3GE8 C;  5LXH A;  2GOW A;  4M8M A;  1E0Z A;  1PYW D;  3DQV A;  1IP9 A;  3AM9 A;  2A4Z A;  4ZRP A;  3NRZ A;  2KDF B;  2JY6 A;  4BKS D;  2D2Q A;  4EZK A;  4USA A;  2Y3A A;  1OQR A;  3HRD D;  5EE3 A;  1ZP0 B;  2N7E A;  3ZNG C;  3X0W A;  1IGD A;  3ECI A;  4KKJ A;  2BB5 A;  2M19 A;  4IC7 B;  1FO4 A;  2J52 A;  2KNB A;  3V60 A;  4JIO U;  5IOI A;  1KM7 A;  2JUO A;  2LEK A;  3EGR A;  1U4A A;  3ZUN A;  4FHJ A;  3SU8 X;  1QOF A;  4RCO A;  3S2A A;  2G3Q B;  1MHH E;  2Z8L A;  4EKU A;  1H8C A;  1KRH A;  2V3N A;  4HCP B;  2NTS A;  2DZI A;  3C8Y A;  3BYY B;  4JE3 B;  4HVB A;  4XYC A;  1J0G A;  1WR1 A;  3Q3J A;  2N7D A;  2WP9 B;  1XEE A;  3ML9 A;  2KQ4 X;  2BVC A;  5HKH A;  3P4Q B;  3P4P B;  1OEY J;  1V1P A;  4KIK A;  2HTH A;  4EOY A;  3W5V B;  2DAF A;  2ACZ B;  5E6P A;  1T6B X;  4FUL A;  2IBI B;  3AEG B;  2JWZ A;  3V3X A;  3I5J C;  5J2R A;  4OZB A;  2C9W B;  2DZK A;  4KDI C;  2IY0 B;  1CQV A;  3NS8 A;  4W9J A;  3W2D A;  1I4G A;  1Z2M A;  2I1K A;  4RF1 A;  1C3T A;  3V05 A;  1V8C A;  3QIJ A;  5L95 C;  1QF6 A;  2IGH A;  3JSV B;  3RPF C;  3X23 A;  1I4X A;  1HTO A;  2INP E;  2GBR A;  3ALB A;  1FXA A;  2K6D B;  2LWP A;  4KV2 A;  5C23 A;  3VR8 B;  4KX6 B;  2QHO A;  4MM3 B;  3IAS 1;  1LM8 B;  2JVC A;  5IA7 A;  5JXV A;  2JX5 A;  1N61 A;  2MX2 A;  4W9E A;  3QHT A;  1XXG A;  4W9K A;  5EE1 A;  3Q8F A;  3K9O B;  1IYF A;  1E7P B;  3J9C A;  1I4R A;  4NNJ B;  3RNE C;  2BW2 A;  2MBB B;  4HK2 A;  1WM2 A;  5BMI A;  3ZRF A;  4GOC A;  4WAA A;  3BWU D;  1C4P A;  2M8S A;  3UQA A;  3R8B A;  1QOB A;  3E9S A;  4L2Y A;  4RM8 A;  1KOT A;  1GOZ A;  2BS2 B;  3C0R B;  3AI5 A;  2IGG A;  2UU7 A;  3RNA C;  4ANU A;  1V1O A;  2D3B A;  1RFK A;  1C76 A;  4P1C C;  5DCN A;  3AU4 A;  2GI9 A;  4LNN A;  3DOW A;  2N9K A;  4DXA B;  1L0Y B;  2ZW1 A;  4L1B A;  3VAW A;  2DX5 B;  2PVO D;  1DOI A;  1HZ5 A;  4A20 A;  4XZ4 A;  4BZA A;  3DWM A;  4TV3 A;  3N30 A;  3RI7 C;  2BYV E;  4NZL B;  3L13 A;  1EO6 A;  5G5H A;  1QOG A;  4BKT A;  4DHZ E;  1LO5 D;  4F7Z A;  3KYC D;  3U30 A;  2RDB C;  3NVY A;  5CHF A;  3CSF A;  5BMG A;  5AZH A;  2W9N A;  4J3O D;  4XC2 A;  1WXS A;  2RGF A;  1EWC A;  2Q5W D;  3WCQ A;  1KFY B;  4FLH A;  4W9H A;  5IP4 D;  3IFW B;  5LXI B;  4AJY B;  2IO2 B;  3PZ7 A;  2ASQ A;  1WH3 A;  1STE A;  2GB1 A;  4IM0 A;  3FAH A;  2KC1 A;  4EEW A;  2MBO A;  3EC8 A;  4IKG A;  4HDQ A;  3ZIM A;  2JQR B;  3DVG X;  3PT2 B;  2D10 A;  3QQ8 B;  4RMA A;  1DOY A;  2CR5 A;  1WGD A;  1E9M A;  1E5W A;  4YTP B;  4XE0 A;  2AWT A;  1B1Z A;  3NHE B;  5KHQ A;  3PZ8 A;  1RAX A;  2WHI A;  1L7Y A;  2VRR B;  4MJS A;  4M02 A;  4JWS C;  2R2Q A;  1R4N I;  3ZTD A;  2HJ8 A;  1G6J A;  3L08 A;  4KIK B;  3UQB A;  4K81 A;  1N5W A;  3E56 A;  3BY4 B;  1HE8 A;  3KLS X;  3RUI B;  5TSS A;  5LNK 1;  2KWD A;  2LHD A;  4YL8 A;  2KFK A;  1MHX A;  2LUE A;  2FNJ B;  2M1M A;  3BVZ A;  4YSX B;  1FM0 D;  1JRP A;  1TZ1 A;  4MH8 A;  3BK1 A;  1XLO A;  2L76 A;  2K3U A;  2BS3 B;  2GMI C;  3PTF C;  2IO0 B;  3PS6 A;  2K25 A;  3Q8C A;  4N58 A;  2KWV B;  4A6Q A;  3ZNZ B;  3VH4 B;  4DQO C;  2V1Y A;  4WWP A;  1FRR A;  4WWM A;  3MTN B;  1XCT L;  2PVG C;  4DHJ D;  3B9J A;  5IO9 A;  1FD6 A;  2N1W A;  3QC8 B;  4P16 A;  5IN7 A;  2WXQ A;  3DHI C;  2K8B A;  2WU5 B;  4AQ7 A;  4XX5 A;  2L52 A;  4GLS C;  2KHW B;  3TJP A;  1EM7 A;  4ZDV A;  4FAD A;  5J18 A;  1WRI A;  2INC C;  3BK2 A;  3MC8 A;  4RGO S;  5L83 A;  1WGG A;  3IHP C;  4S17 A;  4RH6 A;  3ZJV A;  1SEB D;  1E7U A;  3AE4 B;  2CHZ A;  2CHW A;  1T0R C;  5AUI A;  3QAR A;  3PRP B;  2L0T A;  2IDY A;  1LQB A;  2CJN A;  2FE8 A;  5EE0 A;  4G3X B;  1UWX A;  4CHK A;  2L05 A;  4TUU A;  4C56 C;  3LXF A;  3WAP A;  1RFA A;  4HRS A;  4HKQ A;  3Q14 C;  4HEA 1;  2BF8 B;  3CF6 E;  3DBH B;  1SB3 C;  4KZC A;  2IY1 B;  2KDM A;  2FAZ A;  1TKE A;  3RZW C;  1SE3 A;  3TEY A;  1HEZ E;  4D2K A;  1FPY A;  1EWY C;  3PGE A;  1TYG B;  2UWQ A;  1P0R A;  2LAS A;  3JW0 X;  1BML C;  4GN1 A;  1T5X D;  3CIR B;  3M62 B;  3DHG C;  2IO3 B;  4HJG E;  1XF5 L;  2JRH A;  3PRM B;  4I6P A;  4ANW A;  4YXD B;  5JHB A;  2AQ2 B;  1WWT A;  4KKI A;  3VUW A;  2PKO A;  2WDR B;  3P63 A;  3ZXR A;  1FXI A;  1Y8R C;  4OZC A;  3N20 C;  1KF6 B;  2J0K A;  2WXG A;  4N9F 4;  1C78 A;  4AJW A;  4WWN A;  1YQ3 B;  2LD9 A;  3AEA B;  1TZO A;  3H9D A;  2DZJ A;  2WDQ B;  4YSZ B;  3A9K B;  1R4M B;  1H4R A;  4MEM A;  2LJ5 A;  3GE3 C;  2RDH A;  1AW7 A;  1SJE D;  3OLM D;  1LGR A;  2AL6 A;  2WYQ A;  2LRU A;  2DYB A;  2FUH B;  3QJZ A;  3APF A;  4PS8 A;  4ARC A;  1GUA B;  3JSV A;  2CJO A;  1J19 A;  1DOX A;  3B08 A;  1V5T A;  2KWU B;  1KLU D;  2BQQ A;  4B0M A;  1IUE A;  3RMK C;  3L16 A;  2WXM A;  4ZHP A;  1JWM D;  2ZZP B;  1D5M C;  3LYY A;  3U2S C;  1ZOY B;  1T0S C;  2WU2 B;  4LJO B;  4MM3 A;  4KGR A;  2KFK B;  4OW0 A;  4JX1 C;  4GXB A;  2V0G A;  4BOZ B;  3I3T B;  1WXV A;  3EHV A;  2WDT B;  3KH0 A;  2D3G A;  1K52 A;  1N60 A;  4ZYN A;  3H6N A;  4RFB A;  3ABV B;  2W54 A;  1WYG A;  2HJ1 A;  1NVI D;  1WGY A;  4ZRJ A;  1I42 A;  3W9C B;  2QDF A;  3EFU A;  1MI0 A;  2L83 A;  2WS3 B;  4PT5 A;  2MLB A;  1UBI A;  1NEK B;  1WSP A;  2KN5 A;  2W82 A;  1WJU A;  3VRB B;  3AED B;  3SFE B;  1TKY A;  3SFD B;  2KAJ A;  4AUQ C;  3FC4 A;  2BYE A;  5AEK B;  4KVG B;  4IWP A;  2LMC A;  1E8X A;  2NBU A;  1EF5 A;  2C7H A;  2Z0E B;  1SE4 A;  5T8I A;  4M8N A;  1UWM A;  1HTQ A;  3H7P B;  4PYZ A;  3APD A;  1J8C A;  3RNC C;  3UF8 A;  2MP2 B;  4G11 A;  2MEK A;  4TSS A;  3AE3 B;  1L6V A;  3TEX A;  4BAX A;  1JWB D;  1NBF C;  3I9V 1;  2KMM A;  1Q1O A;  1WRD B;  4FXC A;  2LRW A;  3FKY A;  4BKG A;  1D5Z C;  2EKI A;  4KDL B;  1WJ6 A;  4HKZ E;  4NPN A;  2X8X X;  2K8H A;  2JZZ A;  2QCZ A;  2MH7 A;  4XGA B;  1V86 A;  2RPQ A;  1TS2 A;  1SE2 A;  1J7A A;  1TIF A;  3BVM A;  4MT5 A;  2VH1 A;  4HWI B;  3ZTC A;  2DZM A;  4E3C A;  2JWU A;  5BYS A;  4K7U A;  1Q0W B;  4RGT A;  4P1B C;  2JYE A;  1OQQ A;  3RN9 C;  2ZW0 A;  2KLG A;  3AH7 A;  4C80 A;  1QOA A;  2GBM A;  1RRB A;  3PZD A;  2K22 A;  4YTM B;  2N9L A;  3GOE A;  3PPA A;  2YVC A;  4CQN A;  3VVW B;  4ASW C;  1MVK A;  1WXQ A;  4WAF A;  3R3M A;  2ZJD A;  1V2Y A;  4HPL B;  3ONS A;  1L2N A;  1HQR D;  1ZPS A; 
#chains in the Genus database with same CATH homology
 4K3C A;  2QCZ A;  4C4V A;  3MC9 A;  4XGA B;  2QDF A;  4QAY A;  4C00 A;  4C4V B;  2VH1 A;  3OG5 A;  4PK1 A;  2MHJ A;  3Q6B A;  3MC8 A;  2V9H A;  2VH2 A;  3NJT A;  4BZA A;  3EFC A;  4K3B A;  2X8X X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...