4M00A

Crystal structure of the ligand binding region of staphylococcal adhesion srap
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
501
structure length
501
Chain Sequence
b'TTAVTANTITVNKDNLKQYMTTSGNATYDQSTGIVTLTQDAYSQKGAITLGTRIDSNKSFHFSGKVNLGNKYEGHGNGGDGIGFAFSPGVLGETGLNGAAVGIGGLSNAFGFKLDTYHNTSKPNSAAKANADPSNVAGGGAFGAFVTTDSYGVATTYTSSSTADNAAKLNVQPTNNTFQDFDINYNGDTKVMTVKYAGQTWTRNISDWIAKSGTTNFSLSMTASTGGATNLQQVQFGTFEYTESAVTQVRYVDVTTGKDIIPPKTYSGNVDQVVTIDNQQSALTAKGYNYTSVDSSYASTYNDTNKTVKMTNAGQSVTYYFTDVKAPTVTVGNQTIEVGKTMNPIVLTTTDNGTGTVTNTVTGLPSGLSYDSATNSIIGTPTKIGQSTVTVVSTDQANNKSTTTFTINVVDTTAPTVTPIGDQSSEVYSPISPIKIATQDNSGNAVTNTVTGLPSGLTFDSTNNTISGTPTNIGTSTISIVSTDASGNKTTTTFKYEVTRN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine-rich adhesin for platelets
molecule tags Cell adhesion
source organism Staphylococcus aureus
publication title Structural Insights into SraP-Mediated Staphylococcus aureus Adhesion to Host Cells
pubmed doi rcsb
total genus 138
structure length 501
sequence length 501
ec nomenclature
pdb deposition date 2013-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18483 Bact_lectin Bacterial lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m00A03
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m00A04
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4m00A01
3.10.20.320 Alpha Beta Roll Ubiquitin-like (UB roll) Putative peptidoglycan bound protein (lpxtg motif) 4m00A02
1GOHA 3VCLB 3SCMD 4EUPB 2A3YA 4D9QE 1F02I 1AJ7H 1A6UL 4G8EB 1A1OB 2YHGA 4YJZL 4UAOC 3KVQA 3O3DB 4YQXL 1MS5A 4MNQD 1SEQH 4YE4H 5E5MB 1RZ7L 3C6SB 4W70A 4AL8H 2COQA 2X7LA 1DL7H 4PJ8A 3VWJC 4QRTB 4JM4L 5EORL 3LY6A 4UT7H 3VI4E 1CLYH 4LIQL 4RFNC 4KZEL 2HKFL 1PDKA 2H6PA 5E8EB 2PHFA 2GQHA 3KYMB 3T0EC 1A6WL 1XGPB 4JHZA 4JZNA 1DQQB 3V64A 2D9CA 1MWAH 3ORJA 4N0UA 3O4OB 3LEVH 3M17B 3EDKA 1IS4A 3G6DL 3SDXF 4K7PX 4OBSA 5MEQB 5KSBA 4NDMB 1N3NB 4QHLA 5FB8A 2FATH 1I1AA 4G8GD 1Q94A 5E2VH 3THML 4O51B 4F7CA 2KT7A 1VGEL 4L8SA 1J88A 2H2PC 5C3LD 1BOGB 5TE7H 4MNHB 5IVXF 4KKCD 1KTDB 4Q7DA 4BFBD 5DYOB 2MQ0A 4K3DL 2PHXA 1ADQH 1JZ5A 4AEHL 2CWSA 2VTFA 1J0ZA 1J0KA 5E95B 3UPAA 3AY4A 3CU1A 1MVEA 3G5ZB 1I3GH 4JO4H 4Q6IC 5B8CB 1KTLB 5HVHC 1AXIB 1CICD 1OGTB 3ULUH 4HIHB 3UJTH 4CMMA 3VJ6A 3SBWC 3VXUA 4P3DB 5ADPH 3JTSB 4I9WE 3MA7A 5GS1B 4IMLB 4U1NA 5FCUH 1F90H 4X6BB 2R0FA 2EZ0C 2HMID 1HHIB 1L7TL 4P5TA 1DEEB 4Q58C 4XP4H 3T4YA 5L88H 3VWJD 3F6LA 1CK0H 1EGJA 3JXAA 1S0JA 5DWUH 2NQCA 4F8QA 3D2UD 5CCKL 3QISA 5DJDB 5KVDH 2ZGLA 1Q9KA 3SKMA 1V8HA 3U9UB 5AYQA 1RULL 1YYLH 4I18C 4WTZA 3ZHDA 1EHLH 3DX7A 3RKPA 3JWDL 4F2MB 5HPMA 1HWGB 4RCAA 3FOLB 1HNGA 5BOPA 1GBGA 4UOW1 4MDJA 4ZOEA 5HYJE 3IDUA 1N6QL 5B38A 2PO6A 4FMKA 3RU8L 1DLLA 2GFBA 4TTDD 4RX4A 3G6JA 2ORBH 5ADOL 1CCZA 3GUTA 1IAIL 4HIXL 4LMQI 4JZJA 4TVPL 4GRMB 5C07D 4A6YB 4ZD3H 2BSSB 4HUVB 2Y06H 1N6UA 4D0BA 1IGCL 1Z0MA 5CD5C 3UYPA 5F3BB 4MMXC 2AJZA 1WUVA 2FEEI 3QWQB 4GRLA 1UYWH 1MPAH 1CVNA 4AYUA 3RQ3A 2ZHMA 4GXVL 1G6RL 2A74B 1AR1D 43C9B 1I8MB 1TNMA 5DDHA 1P7HL 4MAYB 4DZ8B 4AL8L 4YM2A 4L3CB 3PGFH 4BK4A 3UTZA 3L5IA 5AAMA 5L7XH 3QUYC 2EDBA 1C1LA 2CPCA 2GMEA 4HGMA 1FN4B 4Q1PA 5HVFB 3WCRA 3MV7A 2Z35A 1PYWB 4PJFB 1FDLH 4NC1E 4Z7VA 2HFTA 4AVVA 4J8RB 3MTRA 5KTEL 3AGVA 2Q7NA 2ZCLL 1QA9B 2APXA 2AEQL 1JWSA 3JZ7A 3VH8B 1C12A 4M43L 1KPVA 1TCRA 4OKVB 1ZLVH 1MI5E 4P9HL 3K2UL 1IGMH 3NACL 5DRWA 1KJ2B 2VWEE 1KN2L 1TZHB 2NZ9C 3K4DA 2BJML 2O5ZH 3BN3B 4X4YB 1FAIH 3M07A 5C09A 3KPTA 3MCKA 3S3JA 1MVQA 3E6FA 3B5HA 3QDGA 1U3HD 2JELL 4XBQA 5GIRA 5C0BD 3LN9A 2VSCA 4PJFE 2OMNA 3NBNA 4N8PA 1AHWC 4OCYH 1QR1A 3ZE0F 1JNNL 2FGZA 4XPBH 5HDQL 1IZJA 2OCFD 2VDNH 4I0PB 2G5BA 4Q6IB 2AEIT 2VDQL 3JUYA 4FTVB 1DN2A 1S0GA 3GK8L 1PQZB 3GSNA 3OGGA 4GSDL 1T2QL 4X4ZA 2FEDD 2ZG3A 5FGCE 4F57L 4C56D 1BWMA 4Z7OE 4L3ED 1DVFC 3H9SD 5ICYA 3NAAH 1KYOK 2OI9B 3T0XA 4HH9B 2QHRL 1B4JL 2BERA 5I8EA 1SJEB 1HSBB 5DUBB 4JO1L 2ICEB 4M7KL 1AZDA 3SDAD 4K1YA 5C7XH 4PJDB 1GYAA 4LSRH 2BOCA 1XCQA 4HC1L 1F6AB 4WNQB 4C83A 2Q6WB 2VZOA 2E9BA 2XT1B 4J6RL 4XJ8A 1P6AB 1YMME 1ZKAA 2YPKB 4MA3A 4ZUWB 5IR1B 4L8CB 4JG1L 4RWYL 3W9EA 3O6KL 5GGRA 1VENA 1UWGH 2GHWB 4U36A 4XPHL 3B9KB 2A7AA 4NZJA 2HYKA 3ULUD 3SKOB 3NCCB 4BQ6A 1ZS8B 1YJDC 4HGKC 3SGJA 3QDGD 1BZ7A 4P4KB 5C70A 3TYGH 3ZSKA 1AGEA 4Z76B 3RBGA 5GZOC 1F97A 4KKLC 1D5ZB 1VESA 1LO5A 3QIUC 2FL5A 4Z95H 3BKCH 1MJ8L 4RMSA 3HZKA 5E8NA 4PRPB 4Y1AB 4RMWA 5I74B 1HILA 4DN3H 1P5UA 1CLYL 3BGMA 5DI8B 5CEXA 3LEYL 3O8XA 4MGXA 5BOZG 3L5XL 1KCSH 4QCIA 4XP5L 5DLMH 2F54B 2HRPH 5AG9A 3BT2L 3NCYS 2HRPL 5D2NC 2Z31C 1BJ1J 2J88H 3O4LE 2VSDA 2J6EL 1MNUL 4MAUL 4HUKB 5FREA 5DTFB 5I71B 4P49A 3GIVB 5HHME 2E27L 4I9WD 2P5ED 4NCC2 1GAFH 2DDQH 4RQQB 3RY4A 2Y23A 3DNKA 3LPWA 3GMOB 4LVEA 1G0DA 2AJSH 5KVFL 1EFQA 1JJUA 3CFKA 2AW2A 5DRZA 1KSRA 5IG7A 3S34L 1YNTA 5DZFA 4J1UB 5IB4A 5T1LB 4DVBB 2IFFH 2ITDA 5ICYB 3UX9B 3F7VB 1W72A 1QSED 5F5QA 3OKOB 4NQSB 3WYRA 5F3HB 4S1SL 1WLHA 2Z93B 1GZPA 3B3QE 2VXQL 2CLZA 4C56B 3ZXFA 4HPYL 2YMXL 1UWGL 3ZYRA 1VFOA 3C5ZA 1NGYA 1CIUA 4FHBD 3WIIL 2XQBL 1T1WA 3GMMA 2CD0A 2ERJC 3AY4C 1XR8A 5FHAL 3SKOA 1MHEB 2C1OB 1AKJB 1J0JA 1ES0B 2Y25A 1UVQA 4OFIA 4FQXC 2NLJA 4DQAA 1HKLL 2I27N 2MCPL 5I15L 3LN4B 4LSUH 3ULVL 1V6JA 3EW3B 1NANH 1PLGL 4FQ4A 4FQIH 3CIQA 1T2QH 4F9LA 3BESR 5JUEL 3MLTB 3LRHA 3QJHB 1HLCA 4GAYB 4XNYH 3NFNA 3VI3E 3SEPA 3TJEL 4X7TA 1R3HB 3GJFK 3HR5B 4HF5L 1C12B 2VLJB 4XNMA 4U0RC 2WLQA 3GSNL 3S37L 3QDMB 5GGVL 4B41A 5D1QC 3PP4H 3A6BL 5FYJH 5CHNA 3P4NA 2B8OT 5J12C 3ZDZE 1IC5H 5FM5O 3TH4T 3ME0A 4KTEL 5LQBL 2K9UA 2V5RA 3UK9A 2DJUA 1CFSB 3UTTB 1T1ZA 5FO8A 4JC1A 2PTVA 1GZCA 1I3HA 3E8UH 3UTZB 3L9RB 1UGNA 5IEKB 5FYJL 1SM3H 4MS8D 1CFNA 1NFDB 4ELMB 5H94B 3BISA 2PHTA 4XWOD 5C0AD 1IKQA 4AGGA 1AH1A 3QHZL 5BXFB 5JORB 4X4YA 4XJAA 1CGSL 3C2SA 4JHWH 4QRRE 4OUUB 3TNNB 4Y19B 1N5YH 1F58H 1J11A 1JWMB 2OJEB 4RBPK 1HQ4B 1OP9A 1A4KB 4LLDB 2R1BA 3ARBB 1G7PA 2VUYA 3ARUA 2O5XL 4HS3B 1OM3H 4ISVA 1A6PA 4CUCA 3FFZA 2X4PA 5CA6A 4X6DE 3FBYA 1MI5D 4HWBA 1I7TA 3HR5A 4Z7VF 1OKQA 3SE3A 3G5YB 3VXSD 1PZ8A 4KMQA 2FRGP 4UILH 2ICCA 3TB0A 2F53B 1IQDB 4LLMA 5KXEA 4P4KC 4XOGA 4P2OA 3QHZH 4MJ5B 1T7WA 3JTSA 1X9QA 5T3XH 4KI5C 5KSVB 4HIHA 1AGFA 1A7RL 4QTIH 4QRUA 1S7VA 4PJBA 3NIFE 1G7PB 5AWNL 4OFPA 1QFPA 4UINH 5EIQA 1F45A 2A70A 1IC5L 3W0WA 5GLTA 5CKGA 1SBFA 3TZVD 4CTEA 2IBBA 4MX7A 1HOCA 3JWOL 4OD1H 1MHCB 4R8WH 4FPEA 1UXSB 5JORA 2W1NA 4L9LB 1MS4A 2XY1A 5FB8B 1MAMH 3ZDXF 2CR3A 4PJ9A 3O3BB 5JIKA 3W2DL 3VG9C 4GQPH 3IFLL 3NCBB 1FZJA 1MLBA 1YQ2A 3BKJL 3I2CL 4R2GB 3P4LA 4P9WA 1T89C 5HPMB 4Z7WB 2XN9D 3PHQA 5ENWB 4LAQL 3NFSH 3CUPA 4YAQB 1BVLA 1IAMA 3ZKNC 2VH5H 2AYHA 3G9VA 4FN0A 5BRZE 1JTPA 5TDNA 1FYTD 4GS7C 3NV4A 4WWKA 3JUUA 1JRHL 1RMFL 4PY8I 4JFDA 1E28B 1QFOA 1RZKC 3TPKA 5T55A 1AO7A 2VW2A 4LARH 2PTTA 4Q8KA 3HFML 1H9VA 4O2FA 4L4TA 5F97E 4PRIB 1P2CA 1ZVSA 2IQ9H 2YA2A 1YEHH 1DLHB 2ADGA 4U6YB 1UKSA 2EDJA 5D7IE 1CR9L 3CXHK 2E51A 1FFPA 1HK6A 2ZCHL 3WHTA 4OF8A 3FLTA 2QTEA 4R97B 3GMOA 4MJ2A 4QHMB 4NOTA 1QFUL 2VR4A 5D1XA 4M7JL 1VAMA 1DCLA 4R2GD 4G80B 1WCBB 1B4JH 3W0WE 2VDLL 5KVMC 1LU1A 1NFIB 4PB9L 4RAHA 3S98A 3P73A 3BPCB 1ZAGA 1OTUD 4KJWC 3GSXA 2PR4L 5KN5A 1IC4H 4K9EL 3TJEH 1AHWA 3O3DA 2LVCA 2WBKA 1A3KA 1TJHH 5FYKH 3SDYH 1X5HA 3ELAT 1GGCL 3P4OB 4YHPA 5IVXA 5I73C 2DVAA 2KBGA 4PJ7A 2EIBA 3DECA 4YEFA 1Q8QA 3HZKB 2CJUL 1BZQK 4WI5A 4Z8BA 1FL5B 4QRPD 3AMLA 1R5WB 2D0HA 4YHOH 5DUML 3N85H 5C2UB 5GJSL 2Y5TA 3MV9B 4FQHB 3D4KA 2GNMA 5BZWB 4Y8DC 5EB9A 3CFKB 5LGKA 2R1DA 4XMKH 4POUB 3PWPD 4FXKA 4G9FA 4PGCA 2AK4A 3QQ9C 1MJ8H 2P5WD 4B7LA 2UWAA 5JMOC 1MCQA 3ABZA 3KPQA 3SKNB 4ONOA 4Y1VA 2G2RA 4ZXKA 1UZ6F 1BVKA 1A6UH 1CGSH 2IANB 5DUPL 5DD6B 2C3VA 2OYPA 3NACH 1I9RH 4QXGH 2FZ3A 3RVUC 1CDHA 1TPXC 2YUWA 4I0PA 2L7JA 3H7BA 4P4RA 5BW7A 4CJ0A 1J8HE 1MI5B 4AM0A 3QUZC 5D8JL 4QRSA 1KB9J 4MQ7B 4HWUA 1ZWIA 4UDTA 3OF6D 2C7UA 3IDIB 4JJ5B 4E42B 2J8HA 3N7JA 5BRZB 4HKBA 1RJZB 3QSKB 5L8LB 1EEYB 1AX2A 3UDWC 5ISZB 3ZPYA 1CXEA 4W4OA 5F6IB 3QFJB 2PW1B 1LK3H 5F1SA 1DBKL 3USUA 2LVEA 1K2DB 4H26A 3CXDL 3WSQL 1LEIA 1MJUL 5FKAA 2XV6B 3V0AA 3GDBA 4TQEL 3BDYL 1DQ0A 1A3RH 4M8VA 4AQ1B 1HE7A 4MYWB 3P73B 4HLZH 4P2YA 5SX5K 4BQ9A 3EFFB 4G5ZH 4ODWA 4WUKL 1MCPL 4OGXL 3EO9L 4OM1L 4FQJL 1SYSB 3VW3H 3MRFA 1AQDB 2OTWA 3OZ9L 5L8JB 4KRNA 4UNVA 3MXVH 2AK4B 3O12A 1I7ZB 3FFCB 2BY0A 2EE9A 4XJZA 2YSSA 4YXLH 1Y6KR 3MW4A 1WW5A 1OLLA 1IARB 2A3WA 1XQNA 2NXZC 4OCLC 5DJYB 2ICES 3ZYIA 2R0LH 4HWBL 3WO4B 1U8LA 2ADGB 5I9QC 1WBYA 2B39A 1S9KC 3RVXD 1BQSA 1IGFH 2C3WA 1YMMA 4YLQT 2GAZB 1IFHH 4DN4L 1VSCA 3QQ3B 3W81A 5MEPA 2GJ6E 3KPMB 5DR5H 4Q2ZB 1QRNA 5IMMA 4PCRA 5ICXA 3ESUF 3FZUC 2I07A 2W52A 5D5MB 3D0VA 4X8XA 2CDGA 4UW6A 1JNLL 4LQFH 3SQOH 4E0RB 4M03A 3DOSA 2PF6A 4YO0B 3DIFB 1E6OL 4GBXB 1R3KB 4J12A 3VGHA 3PHSA 4V1DD 4Z7UA 3NOIA 5I1LB 5HHQA 5ICZB 4PJEE 1SACA 3WCYA 2HJFA 4AVTA 5ITBH 2PETA 1A9BB 5E8AA 2MCG1 3WFDH 5IVZA 4K7PH 1I1AC 5I19H 2FX7L 3MNVB 1X5XA 1C1EL 2HFGL 4NHCH 2X4OA 2FX8L 1ZHLB 2CKNA 3FQTB 5ITFB 2FLBT 4PJEB 1S7UA 5JVVA 2AJZB 5GGQL 3MFGB 2IH3A 4GRWB 4Q9QH 1SCSA 4FP8H 3VKNA 4D0BB 3BDBA 4NO3A 5T1DL 2Z42A 3IAPA 1TITA 3MOBH 4HSQA 5AVAA 4LSSH 1A0QH 3G5VA 4CNIB 5F9TA 4GRMA 3B69A 5KSVA 4JB9L 5SV8A 3MUJA 4XC3L 1FNYA 2ZAAA 3O6FC 1ACYL 3QFDB 3EDFA 3BKCL 5C08B 3MW2A 1Q38A 4P2OB 1CGWA 3RKDC 4PJCF 4G42B 1T83C 1RUAL 1CPMA 1JVKA 3P0VL 3UJOA 1U8OB 3IDJB 3DXAB 4LIQE 3CVHA 1UM6H 4O5LL 2DQDH 2YD4A 4DN4H 3B9AA 2YPLE 5DDHB 1W0OA 1T0MB 1UM5H 2IAMA 5DRNB 1JZ3A 2ZGSA 3VI3F 1ZLUH 1RSFA 3G6DH 4Q2FA 4WUUA 1OGAE 1H3UA 1T5XA 5EU3A 5F9OL 4IIQA 2A6XA 3TBYB 4NZTL 4DFHA 1QFHA 4N0CD 5B21A 5ESQB 1I9IL 4UOJA 2UVEA 1W72L 3DV4B 3HMXH 2I9TB 3DSNA 3Q3GB 2EXIA 5I1AA 3ILNA 5E24E 3QDMA 1KJVB 1JN2P 4MAUH 1CD1B 1IM3B 3SDDC 1RJYB 2AXGB 4XXPA 1W0VB 1IGTB 4KMTH 4POZC 4OZGF 3T2OA 4XZPA 3AYDA 4F57H 1Z9MA 3RWJA 2OL3A 1NDMB 1C1EH 1TVBA 1MH5A 1EO5A 5EU4B 3OTTA 1HQRA 3QCWA 3IXTA 3KNBB 4LPVA 4X6CF 4LOUC 4W6XB 3QNZA 5F7WC 1NMCB 3FCTB 2CDGB 1NLBH 2YD3A 4J4PD 3HNSL 3ILFA 1FC2D 1QNYA 5ICXB 5EZOH 1II4E 2H8PB 4M3KB 2VMFA 5E2WL 2C4FU 3FB6A 1FL3B 3RU8H 3MLVL 1I1RA 4L3EB 2PYEA 4OUUA 1NBVH 4XMPL 1OCWH 1LO0L 4PUBH 3U30B 5EOTA 1BQHB 4XHJC 5I74C 1JGLH 4NJ9L 3CFJB 4X4XA 3LV3B 3IVKA 2B2XL 3QG6A 5D1XC 4XHQA 3RWGA 1U91B 4AVSA 4HUXB 4HUWB 5A2KH 4LBQB 4LFHG 2JK5A 3EYVA 1FBIH 1U3ZA 4R26H 25C8L 3TBVA 3TIDA 4YNYB 4WVWA 5SX4I 1FYUA 3LKPA 4YHOL 5LCVL 1QHPA 5IT2H 3SE4C 4Y5YA 1DQ2A 4HC1A 4ZUTA 4KJYA 5AZEL 1T0NB 4DKAA 1KENL 5EO0A 5DMKA 2A6DB 3D6GA 5IQ7H 5JHDA 4IOIA 1JFQH 3MODH 4G6FB 1KOAA 1Z0HA 1N64L 5DZGA 4R4FL 1XH3B 3HTLX 1Q0XL 4FZEL 1J5OH 1N47A 5GISH 3BJ91 2X42A 4MJIA 4QRSB 1B9ZA 3TFKC 3VE0A 2YSSB 3B9KC 2AJ3A 4FXGA 3LKSB 4NM8H 1RU9L 1ADQL 4IEFB 2A2QT 3NV1A 2CLRB 3QQ4A 4PRHA 3HLAA 4RQQA 1INQB 3ZKXC 1QKQA 1ED3B 4MA1B 5IM7A 2QSCH 5CJQH 1XF4A 1LDPH 5D1ZD 4K20A 2ZGTA 1KCRL 2JJVA 2F54A 1V6MA 1HH6B 1RURL 4WV1C 3OBRA 4XBNA 4LSTH 5FM4A 4NCDA 4HKZA 4JPIA 3QQNA 4BZ1H 1OP3K 5DUWA 2XTJC 4OF5A 2CXGA 1A6WH 2H2SD 3HN3A 5D7IF 4GG6E 3CFEB 1Y6NR 1YMHA 3MRJA 1JV5A 5DD3H 2JIXA 1DUYA 2W0LA 2XQYG 4YHPB 2MOVA 4MJID 3UTQB 5LGHH 3P77A 3WDUA 5EZIH 2UVFA 1HDMA 3HUJA 1URLA 2X9WA 4YHIA 4OCRL 3X11B 5SWSE 4ALAH 3PQYB 4A2LA 1IC7L 3MJ7B 3ARRA 2YRLA 4Q27A 3MBXH 3DUSA 5CINL 3SDDA 3GSNB 2D6MA 1LK3L 4Y5YB 1FZKA 4PGBB 1IT9L 3JTTA 1XR9B 2Z8VC 2HVKA 1WWAX 3RIAF 3CZFB 3O5SA 2ZJSL 3DI3B 1WUNT 2MKLC 3QO1B 1LEGA 1T04B 3RGHA 1ZVSB 3N1GC 5JZ7D 2JK5B 3EYVB 5BVPL 4L8SC 5C07E 1J87A 3SQOL 3QZWB 4RGNE 4LVOC 3D0LA 4LCWD 2D6LX 3NCJL 3VKMA 1CDGA 2Q5TA 4HX1A 4U6HA 1HH6A 4ZUTB 3PNWA 3FO0L 1A6TB 4NNYB 4PG2A 3VWKD 2IADA 1RK0A 1ACYH 3GSXB 5K9QG 4UT6L 1SBDA 15C8L 1S7QB 2E9IA 3AS0A 3OJDB 2CRIA 4U1IA 3LOWA 1HXYA 1YNLH 5DHYB 1LD9A 1WLWA 3H3PH 3VFVA 1JI1A 1RI8A 3V5DB 4OB5H 4BQ1A 1FG9C 2EIZA 4YXLL 3GMLB 4QRRD 4YBLC 3C2AH 4NQEB 4FPCA 3D9AH 5I1IH 3C8KB 1FFNA 4NKDB 4JFPB 2W39A 4FQXB 3I85A 4B50A 4C54A 1NXD1 1JBJA 4XXCC 4O58H 3TBWA 3FN3A 5D72L 3D18B 1BQPA 4U2YA 1U42A 1YN7A 4XVUD 3DHJA 1BD2A 3V0WH 3VXOA 1AO7D 2CRMA 5DJZA 4BMEA 4TQEH 1F4WL 3SE4A 5JW3H 1G9DA 5MENB 4CVXB 3C5JB 2GN3A 3VFMB 2XA8L 3AAZA 2XKNB 3L3KB 1WEJL 4NRYA 3R8BB 3ULUF 3U0TA 3C09C 1S5HB 4K8RL 5IEHA 1WLDA 1KLGB 1UA6L 4Z78B 2E6JA 4TUOA 3ZHLA 1JPFA 1X5AA 1H3TA 1J8HA 3RWEB 3RIAK 4R4BB 3WN5C 4M93C 3L3GA 5CJOH 1ULEA 3NA9H 2DQCH 4WEBH 5JW4N 3MLYL 4WUUD 2ICWA 4HHAA 4Q26A 5HDOA 3K2UH 4GLRH 5ISZD 3RWJB 2IAMB 3QXAB 3S88L 3A6CL 2NY7H 4HS8L 1N4XL 1DZBA 1Q72L 1SY6L 4HZLA 2XZAL 1WZ1L 5EOTB 1PKQE 4OLVH 3DX6A 4QHUA 2A74A 5DMGD 5CBAA 3QXDA 1UWXH 4GKZB 3DYOA 2H32A 3D3VD 1QG3A 2NX5E 4WV1B 3TBYA 4U3XA 2D44A 2H8PA 4S0SD 3H42L 5BJTB 5C0CD 4XPGL 3HNTL 4MA7H 3V79C 3IRPX 1AGFB 2XZZA 1HQWA 4PYHA 1V05A 3PWPE 2ESVA 3GSVB 3N85L 1UACH 5TDPB 4OD2B 4LF3A 5DD0L 3CC5A 1U92B 3HN1A 4S2SB 1WTGT 1VALA 2KPNA 4UT9L 3SGEI 4BOWA 3WKMH 4UW5A 2DLTA 3QCVH 2CL2A 5DJCB 2AEPL 3CDGB 4JR9H 1JZ6A 1MZ6A 5DF0A 4LVHC 5DUVA 4PIRF 3WL9A 1WCQA 3ARWA 3QIWD 5D70H 43C9A 5ELIA 1P84J 4JFEA 1YEFH 3BIKB 1G9NH 5F93C 4O9HL 3U4XA 1OGAA 5FHBH 4CVUA 4GMTL 1GVIA 1BZ9B 3FO1B 3O4OC 2AQ1A 4ZPVB 1DGLA 5IBLD 3SGJC 1WFTA 3D0VB 3FQTA 4ODUB 2AEWA 5ITFA 5J3HD 3HZYB 4LHJB 3C8DA 3VG0L 1OTUC 1PSKH 3MLTA 2PW2B 3PMEA 4LCCB 2BVOB 4HZLB 2EAKA 1ZGLP 4ZFFA 4UT9H 3K4ZA 2GAZA 3WJLA 2JLLA 1T1XB 4YHZH 5I1EL 1E4XH 2NW2B 2NY3C 4XJUA 3MROB 1QLEH 4H5SB 3ISWA 4HHAB 4PRID 4LGPB 1N5AB 4DVRH 3G6JF 4D0DB 5JHDD 1EO8L 5E08H 3PXJA 1IZKA 1CK0L 4HT1L 2Y9RT 2WSUA 2JDZA 1W8NA 2P5WA 1CIWA 1IGIL 4PJBF 4PJ9C 4TUOB 5DA4A 3IU4H 3WUWB 5F89A 4MNHA 4LVOB 3B83A 3E3QE 2EEAA 2B0SH 4ZUSB 4EVNA 2EDEA 5IJKA 1QDOA 2R0KL 3S7GA 3V4PL 1Z9LA 2F74B 2HFEA 1ZLSL 5IUQA 2H41A 1HHIA 2NYYC 5GLZA 2ZP0T 3ES6A 4I3RH 4M02A 4KKAC 3MRKB 4RBPH 4JG1H 3IYLW 5CEZD 1JPST 2UUDH 2VL5A 3HMWH 3DLQR 3LN4A 3RIFF 3VJ6B 4JAMA 2ZCHH 4KKNA 2VXTH 4E5XA 5JZ7C 2WMPA 4EDXA 4YDIH 1AD0B 4AEIL 4YZ1A 1KPRB 1FVEB 3B01A 1G9NL 1HXYB 4GG8B 1LD9B 3C5SB 2WNEA 1AGDA 2DWDA 2GT9B 3GBNL 4RMQA 4P4RB 4YDLC 5D1ZB 2Q8AH 3HAEA 4KI1A 1LEIB 4CMHB 4JJHA 2Q8BH 1KIRA 1HXMB 3SE9H 3T1FA 1N3QA 4RGMB 2E27H 4I13B 1LO2H 5I30H 5CEZE 3TEUA 2C4FT 3RDTA 2PYFA 2FYYB 4Y5VA 4OLWL 1WF5A 2X6MA 4ORGB 5IVNA 1O4YA 2B7DT 5FDWB 5GGRY 4XP5H 3DGGB 4PY7B 4UIMB 4ENED 1BQUA 1RZIA 3JWNC 1R3IH 1NSNH 1EJ6A 3VDAA 3ZSLA 4QRPA 2AV1A 4LLUB 5E8PB 1Y18B 2JJTA 4NJ9H 4WU5A 3QPXL 3OBTA 1CXLA 1FVCA 1SLTA 5D5MF 5DGRA 2RFXA 4ODWB 2W0FA 2BNUA 1D3CA 4HIIA 1GZQA 3ARBD 1NBVL 3D85D 5E9DE 5CGMA 3FRUB 1BEYL 4KFZC 4ZAKD 4UV7H 4P9HH 4MZ3A 5L0QC 1VCAA 4O9HH 1NKOA 3OHXB 1JZ2A 2FO4B 2V17L 4FOVA 4F7MB 1K4CB 2F5AH 4U49A 2V7NA 4PY7A 5AUMA 3AMKA 4JHBA 3QHFL 1MHPL 1V00A 5KXBA 5INDB 4LP4A 4YGVB 1AXZA 1FJ1A 1DVFB 5IB2A 4NNPH 5AD0A 1AXSA 2R9HD 5DFVD 3RUGA 2EDWA 3AU1B 1KIRB 1J8KA 3QXWA 2UWCA 5JQ6L 4OCRH 4WO4B 1VGKB 1NGWA 1G7HA 5KN5B 2HT3D 2GT9A 5JR1L 2XPGA 3EZ8A 3FN0L 3B8SA 3BGFC 1MF2L 2PKDA 4I18A 3TIEB 1ED3A 1ZHNB 5LXGL 1RPQA 1VADA 4KTDH 1WFOA 5LCVH 3RVVC 1JN6B 5HHPA 4PJEF 3V7MA 2IPTL 3CSGA 3SKJH 5IHZA 1ZA3B 3NPSC 2P47B 3T2QA 4YW1A 2L7UA 3GNEA 1DBBH 4RRPG 1J12A 1BF2A 1TZHA 4Y2DC 3DGGA 4PV8A 5J13C 3RI5F 3VWKA 1KB5B 3H9SA 4YXKH 5GS0D 1SBEA 4IRJA 2YPVL 4JFDB 4FQ2H 4KJWD 3ILQC 4OCSL 2QSCL 1JWSB 4ZOBA 4RAVB 3B2UD 4KBBA 3BZFA 2B7YA 1T0NA 4M61A 5DQ9A 3FQNB 1JTTA 1CBVL 3TZVA 1FIEA 2IFFL 1DQ5A 5DXDA 1FZOB 4ONGH 1A1NA 1JWUB 1A14H 3UC0L 4S0TD 2VQUA 2JE7A 4MWFA 4ZXBD 1I8IB 1U0AA 5DRXB 2QHRH 4G6AD 1L7IL 4JPWH 4NQVA 1QSEB 4GBXC 3EO0B 3QB7C 5IQ9A 4HS6B 3O6LH 5JOZA 3O6ML 1RHHB 2BVOA 4U6TA 1A5FL 2P48B 3H9HA 4L4TB 4P2OD 2VH5L 2W91A 1VFAB 1MUJB 2OS7A 5C0GA 1A5FH 3QRGL 4K8RC 3WFBL 1QSFA 2BVPB 3HE6D 1VEMA 5HYJA 3VGBA 4D94A 3POYA 1EEQA 1MFBH 4R0LB 4AGRA 5HGDB 4DW2L 3CGTA 5E8OB 1NAMA 2VDRL 5I15H 3NV2A 3MRLA 4WHCA 3X12A 5J12B 1JPGB 4X4ME 5DMYA 2X4NB 1B0RA 4U1KA 5DEFA 2MWCA 4K8RD 2DKMA 1TZIA 5EOCL 3RWIA 4M5ZH 3NIGF 4JFEB 1N2RB 4OCWL 3W2DH 4ONGL 4NNXA 2GALA 1D6VH 4PJ5D 3MA9H 4Q9RL 1U0QA 4Z95L 4XCNA 1U9KA 3H6JA 5EOQL 1MH5B 4OZGB 2ZGMA 1Q9WB 2BJMH 3V0BB 3BRGC 4L5FL 1P4IL 4LLWA 3L7FA 4YWGL 3WNNA 3DBXA 1Z9OA 1IS6A 1J0IA 5LAXA 1GIGL 1KLUB 4K94C 4YHYC 2BHUA 2XXMB 2CIKA 5I1DB 5EFIA 1KB5L 3C5ZD 4PJBE 4PB0H 1OWRM 3QULB 1AC0A 3ULUE 3E0GA 3QO0A 1A4KA 3GHEH 1ONQA 2DTYA 3SCMC 2AJVH 3KXFD 1MJJB 3RS6A 2OMBA 5I18L 2P37A 5EO9A 1JXNA 1IC7H 1Z5LB 5HHXH 1IQWL 2KM2A 2PHUA 1RZ7H 1SJHB 2DM3A 1N8ZA 2E3VA 1IEAB 2KUTA 3IETB 3LIZH 4EXPX 5C6WH 4M5YL 1KC5H 1X44A 1UZ8A 2ZZJA 1MRCH 5C9JB 3GM0A 4XVUC 1U58A 1DQJA 3N9GL 4Y22B 3S35L 2DI7A 3L3OB 3MBEC 3SPVA 1GGBH 3RWFA 4JN2A 5EUKB 1RZGB 1N5YL 3NMEA 2DICA 4ZO9A 2XTLA 1SBSL 3TO4C 3U0TB 4D9LH 3LKNA 3E6HA 1S5HA 1MEXH 2EXYC 2FX9H 4R7DA 1I7RB 1ZEAL 5C3TA 3VFMA 5ETUA 1DQ1A 1CN4A 1NUDA 5IK4A 2R23A 3SDCC 2D31A 3RGVC 3VXOB 4FQZA 2GDFA 3ARTA 5KSAA 1REIA 1KN4L 1KQRA 2XB6C 2XKSA 4GRWH 1SYVB 2WWMC 1T22B 4DAGL 2A6WA 1HHHB 1P7QD 3RVTC 4JREB 4JDVB 5IF0A 1MWAL 3L3GB 4ZUUA 2PHWA 2C5DA 1FORL 3QHTC 5CWSB 2AJYL 3D3VA 3TBSA 3MRQA 5E89A 5J13B 5IMKA 3U4BH 1A1OA 4NUJA 1XCTB 4I8DA 5I8OH 5T5FH 4TVSa 1PW3A 5I8KH 5FO9A 1QSZA 4Z5RB 4ZSOB 3BRDA 5DJ2B 5EBMA 4G7VH 2RB8A 5GS3A 3UO1L 2MQCA 5GJTH 2NY3D 2IALA 3FUOA 5D6CB 3F58L 4QOKB 4CN4A 1NCUA 1NUNB 1JYWA 1KGCE 5IJVB 2CR6A 1K8DA 1WZLA 1J8HD 4MA1C 3WHUA 2BDNL 4OF0A 5DJ8B 5ID0A 1NGXB 3HC4L 3HE6B 5CD3A 4ETQB 2VABB 2VU9A 4O00A 1I1CA 2EF6A 3K8KA 4U3HA 1SVZA 1ZVHA 1R3JA 4X9BA 2IQ9L 3GBMH 2YD7A 1NMCC 4ZPTA 1AJKA 2DMCA 1U8KB 1NCCH 1GIGH 4IRSB 5C0BA 3DI2B 4R0LC 3QUML 2BNQE 4OQTH 3BD4A 1CQYA 1HCVA 3WDHA 3P0VH 4P46C 5HY9A 3H8NA 3TCLA 1CE1L 2OK0L 4PRPA 1QSVA 4Y1AA 4H0HB 5K33A 5IW6A 5IGXL 4OZFG 1GZWA 2OP4L 2A38A 1WIOA 5AUMB 1XGYH 3UZQA 2JE8A 1ND0B 1QD0A 2R2HB 2DBJA 4IS6B 5E1HB 2AUYA 3KHOA 3QIBA 4LSSL 1UJ3A 2H9GA 3NTCH 4EKXA 1GYKA 1MI5A 1YEDA 3P2TA 3CZFA 4XIKA 1FIGL 1QLFB 4P23C 2HJKB 4U1LB 5E4EC 2WQRA 2EXHA 1O7SA 1EFXB 3OY8B 3MLWL 1XZ0A 1G7QB 1LEKA 2D3SA 1MPAL 3I6KB 3OG6B 4NNPL 5K9KB 3MGOA 3KYNB 4UB0L 2BFVH 4WFEE 3BP4A 2Q6WA 3IS0X 2V5YA 3DROA 3T08A 3LRSA 3LN5A 2VDLH 3ATGA 4R97C 3MYZA 4M1DL 1S9WB 5IHLB 1HILB 5IK8A 4M48L 4CDGC 3Q5TA 5F1IB 5H9RA 4M4PA 2AXHA 5ESAA 1A6ZA 1RVFH 3DUIA 5JNYA 4Z76A 1CL7L 4KJYB 3O3AA 1TJIH 2VKXA 4O2CA 1GOFA 4BH7A 3C6LB 1XCTA 1UH2A 4XDQA 1PZ5A 1IGJB 1FYHB 4JGJA 3QEQA 2OBGA 4Y4KA 2WSVA 2F5BL 3VXQA 2QBWA 4ZPTB 4F15C 4RX4D 3CSBA 3VH8A 1NSNL 1FGNL 3IJYA 1JHKL 2ZGNA 4LLVA 4DGYL 3SKJL 3GSWA 1OY3B 3ZVXA 1RIUH 3WDYA 2W68A 1PYWA 3N3HA 3LQAC 5EN2B 4HBCH 3MV7B 3R1GL 2NZIA 5C09B 4FP2A 1ENQA 2JKBA 4O2FB 4TNWF 4A6YH 4NRZB 1P2CB 4ZOAA 2B5IB 1C16A 2BCKA 3LAFA 5I1EH 3QXVA 2DTSA 3HI6L 3BEVB 2A9NL 3RA7L 3D2UA 5GRZA 1JHNA 2FR4A 3GBNH 5CGTA 5AYUH 3KPOB 4WWKB 3PWLB 4M93B 4ODSL 2RHPA 5ALBH 3OJVC 2XZQL 4ZG1A 1XGQB 4MB4A 2P24B 1ULGA 4PJFA 5L9DH 3MR9A 2YN5A 1YY8A 4NFBA 1WIUA 1DYPA 1NEZA 2FECI 1F4XH 2DWEA 4Y16B 1E4KC 1AGBB 3BSZL 4ODSH 3SGDI 4QO1A 1NBYA 3BH8A 3X14A 2FJHA 5E1AA 2NXYC 5EULV 4TOYH 4FG6D 3MXWL 4HIEA 2V2TA 1H0DB 1IM3A 3RUGE 1QQDA 3QEQE 5EO1A 2ZKHH 5CP7B 1S7TA 4JDZB 4N68A 1NH6A 3RVVD 3FB6B 4AMKH 4J7RA 1VFBA 2DL2A 2D3VA 2VH9A 3DGTA 2DYPA 5INCA 3QO0B 5HI5D 2BSSA 3BX7C 3NTCL 3FMGL 1WZMA 2R69L 3O6FD 3NCFB 4AG4H 5C07B 3BIKA 4WW2A 3U9PH 2ZHLA 5FRAA 4BH8A 5I1CH 2GI7A 5DC9B 4OUOA 5C0AE 3BZDA 3DTXA 5K9QI 1T1YB 3BPOC 4Y4KC 3KPPB 3Q6GL 2F53A 4LLMB 1U8OA 3IDJA 4JRXD 4NKIL 4XWOC 3GJEB 4TOYL 5FYJD 1O4ZA 4M6AA 1IM9A 4R3SB 3UZEA 1N26A 3DX7B 2DVGA 3MLXL 1UCTA 3ZE2E 1MS8A 4N90E 9CGTA 3INUL 1C08A 1W0WB 4ZXBA 5FUZH 1IAKA 3ZTNL 4TVPH 3UL2A 1CICA 2VL4A 1JGUH 2VZTA 5JHLL 3FKUS 5BV7L 4TRPL 3GSOB 5IKCB 4JZJC 1QEWA 3I9GL 4JO3H 3WO4C 2DYCA 2WP3T 5IHBA 5IB1B 4JM2F 4HUVA 3B00A 3ULVE 1FNHA 1EA9C 3EOAB 3BMWA 4APQA 1QQDB 3CNKA 5TF0A 2EH8H 1PG7H 4MDIB 3I50L 2V2TB 2LABA 4NZDA 3LD8B 1UX6A 4GAFB 3EYOA 3SQBA 4NRXA 3QXAA 3V4UL 2BOBB 4XAWH 2WWKT 3VKLA 3TH3T 1NBYB 2CYFA 5E5UB 3D5OF 5IW3A 4LKCB 3UTTE 3HNTH 3IRZA 3T2TA 2HFFB 3ZKMC 4UV4H 4XBEL 2Q86A 2VXUL 1JPFB 3FRPA 1J8HB 2P24A 5E08L 4NQXA 4PRIE 2R0ZL 4Q6YA 4OZIE 5E8EA 1J1XL 5DYOA 1EX0A 2NCMA 1FNEA 1VPOH 2F19L 3W59A 1S5IL 3X12B 3AAZB 3MRIA 3QDJB 4U3CA 3C6SA 4QHLB 1OSPL 1BGXH 1KCRH 1P9MA 3NZHH 2W9LA 5KANI 1QSFB 5D1XD 1A7OH 4BUGA 3KPSB 4Y1YA 2X4OB 1ORSA 3ALWA 3NCYP 5DD5H 1QO3A 5F88A 5J06A 1DQMH 4EUPA 4I3SH 4ATFA 4IMLA 4G8FA 4N0UB 2R1WA 3JWOC 4F37F 3BEWA 5I71C 3AZZA 3BE1H 3DV6B 4MCYB 3UBXG 1RQ5A 4OZ4B 4Z8FH 3P4MA 5IV2B 2K7QA 1MCDA 4QRTA 1ES0A 3GBLA 4GAGH 5SX4H 2D3PA 1UZ6E 5E5MA 4OF7A 1FG2A 3HI6H 2HH0L 2CK0H 5EUOB 3C2UA 5KOVC 1TCMA 4KY1H 5HDBF 4XP1H 5IOPB 1CXFA 5AZEH 1WVZA 4YDLB 1I9EA 1GHFH 2FD6L 4QHNA 4HFWA 3MACL 3S3SA 4G6ML 1NLDH 2H26A 4K3EH 5JOYA 3TPUB 5J6GB 3CMOL 2HKFH 3O0XA 2IH1A 2M8XA 3M17A 4V1DA 4MQ7A 1RIRA 5DZOA 1NQBA 4IJ3C 4MD4A 3UJQA 2NY3B 5MI0C 2CDFB 1FZKB 2N1KA 4HGWB 2W9EH 1FNSH 3O45A 4XVTH 5DEGA 4EIGB 2LV4A 4AT6A 1LEKB 1MRDL 1YN6A 2FEEL 1FNFA 1YMMD 4HDIB 3EKCA 4NJAL 4CU8A 2ZOLA 3S88H 3B6SA 1NMAL 3TC9A 1HDMB 1QU0A 1MIMH 5DSCB 4JKPL 1P4IH 5K9OB 1KTRL 1KCUH 1CVRA 5GRUH 1NDGA 3VRIB 2PO6D 4S11A 1WWWX 1NGQL 3P0GB 3PDDA 1ZXQA 4OLYL 4F83A 5SV4A 3V0VB 5A16A 5BS0A 6CGTA 4P9MH 3AM8A 1KG0A 3P4OA 5ALBL 3S37H 3JVGA 1AO7E 1UB6B 3CMOH 3BWAB 4C55A 2ZUQC 1S0EA 4YC2C 2PXYA 3LMJH 3LQZA 2FB4L 1PEZA 2YXMA 1I4FB 1G6RH 4X7DC 3CFDB 4G9DA 5JOWA 4CADB 4XNXL 1SJXA 5IROA 2EE3A 4P5TD 1T21A 1EPFA 5GSRA 3HE6A 3PWJA 4PGCB 5I0ZA 5J1SC 12E8L 5CSZA 2OP4H 4XCEA 4CU6A 3DURA 4JPKH 4JO2L 5MEOB 4HK0B 1KDKA 5BO1H 5D7LD 2OUHA 1WICA 5F88B 3UAJD 4ZNCD 1P6FA 4PRIA 3AJYA 1S3KL 2QKIA 3ZKXB 3QUMA 4R96B 1P69B 2H26B 1RUMH 3GSRB 3RUGF 5TDOB 2DQDL 4DUXA 3TBTB 3M8OH 5E94A 4PLKC 4Z5RA 1RIVH 2PYFB 3RNQA 5DJ2A 2XN9E 2FYYA 2JF1A 2NZ9D 3VFWB 3U7WH 5DO2C 2D7TL 3MV8D 4HGWA 2ZGKA 2DM4A 2Y36H 1BVLB 4WVRA 5GXBB 2CMRH 3HC4H 3BKML 3BPCA 1YIFA 3H7LA 1RZ8B 1ZGLM 4M5ZL 2WINB 5JLVA 4Y4FA 3LS4L 1FVEA 5E2UH 4YFDB 1Q0XH 4FZEH 5H35A 1T4KB 1IKFH 2NXZD 2ZUTA 3VXRE 2KQNA 2NY6C 3N9GH 4AIZB 3I3DA 4M6NH 4PJCA 1S0CA 1CG9A 4HWZA 4C1XA 4YDKL 1UH3A 3X13A 2MPAL 3CLEH 1I8LC 2H45A 5IFHH 1QSFD 3AFLA 4X0KB 1I3RA 3KR3L 3M3CA 3ROLA 3STZB 3G5XA 1F8TH 5E0QA 2DBLH 3QDJA 1KPVB 1TCRB 1VEOA 4D3CH 1B0GB 5GS2H 4NWTL 4OQTA 4QTHA 4OI8A 3ULUL 4L9LC 4YPGB 2HWZH 5EU5B 1RZGA 1Z9SA 2Q87A 5DVMA 5H9PA 5CD5D 4XP9H 4FQCL 3VWJB 1P5VA 3HAEH 1H9WA 3FAXA 4U1SA 4HWEH 2WWMD 1G1YA 1N5AA 1QOSA 3BOVA 5EDXA 1L9MA 1UCBL 3MSPA 4DTGL 4TULL 3FFDB 1CDBA 5FV1L 1NMAH 3BKYH 1IMHC 2HT4D 3D39E 3MO1A 4QHKJ 2QHLA 5TDPA 2AXGA 1Z5LA 4GS7B 4XPHH 1IBGH 5I75B 3B5TA 3MREA 1MCOL 4QRQA 3IF1A 1MLCA 4LPWA 1WBZA 3W11D 4XCYB 4U4BA 4OZIF 4YZ4A 2EDKA 3SJVE 3KPLA 5HJ3B 5L6YH 5D6DA 5IKCA 3QQ9D 4KROD 1S0DA 5MI0B 1NUFA 2WAHA 5C9KA 4XAKE 1I8KA 3AP4A 3DUUA 3QUKA 3S6CA 3OXSA 4M00A 1HHJA 4XPFH 1JFQL 1H3XA 3MODL 4XP4L 4RA0C 3KJ6H 1P4BL 1FX5A 1XF3A 4K7FB 2MHAB 5B38B 3FFDA 4BSWB 2PO6B 3VXTB 5F71A 1J0YA 1JGDA 4LKXB 2VDQH 4JRWA 1NEZB 4HJGB 4GRLC 2IGFL 3DTXB 4Z6AT 1MFCH 2FSEA 4XBLA 4OQ1A 3BP7A 3HZMB 1GNZA 2ZGQA 4Y5XC 4HFUL 4GKSA 4HKXA 3QEUA 4NUGL 2V2XB 2CTVA 2XG5A 4XPTL 5ANME 4N9GB 1KCKA 2DYPB 5HDBE 4OAWB 2A6IB 1BWWA 3RTQB 1YN7B 1MLCB 3TA3C 1MCWW 5EU6D 5KZCD 3ZT5A 4AENB 2IEPA 3D85A 4S1RL 4XNUL 4NHUB 2WANA 4FFVC 5EZLB 2Z8WC 4TUKL 4F7EA 3C8KA 5DJAA 5ECJE 3SE8L 4Q9RH 3X14B 4YM1A 1A9BA 2WM0A 1JZ8A 1E4XI 2OZ4H 4JVWA 4WW2B 3O6FA 4HCRH 2APTA 3CDFA 5IMLB 3NABL 1OGTA 1PY9A 2GSGA 1WGOA 4YO0A 1FZMB 1NAML 4ETYA 1JGEA 3T3PE 3NIDE 4OZIA 5CP7A 1KJLA 4KPHL 3WD5H 3CLEL 1AXTL 2VZUA 3C5ZB 5LKNA 4YXHL 1KC5L 1X5IA 5GLWA 3VD5A 3FO2B 3SE9L 3T0BA 5IB5A 1LTEA 2VY0A 4JANA 4JFDE 3O6LL 3PABB 1Q9OA 4H1LH 2FJHB 3RZCC 1KEMH 5T1LA 4DKDC 4DVBA 3RMYA 4GAYA 3LH2L 3UYRL 5HGBA 4UU9B 4GRLD 5D7SL 3HR9A 1DBKH 1YECL 5CBEA 3ZDYE 1D5IL 1DQDL 5C09D 5KW9H 4GG6F 1I9IH 1DQQA 1NCAH 2GKIA 3V65A 4WI8A 3HMWL 2DIJA 5DHVB 4EOWL 5F7NC 3TCXA 3C08L 2GNTA 1KN2H 1EZVX 1B0WA 1UM4H 4Z7WE 1ZMYA 1Q1JL 5A2IH 3CLFH 4OCSH 3TV3H 2Z92B 5HHVL 4HKJA 2R8SH 3BP5B 3O11B 1BGXL 1KEGL 3UYOD 1N7ML 3QEQB 3F7YA 1T83A 5AD0B 4Z7OF 1S7RA 3VD4A 1M7XA 1NUGA 1OAYH 2FHBA 1DN0A 2NX5D 4LNVA 4L1HA 1FDLL 3S5LA 4LAJH 4LOUD 5DT1H 4CU7A 5EU6E 5FIEA 2DQJH 4M1GL 1EEYA 3AJZA 4QHKI 4IOSD 5DK2A 4N5EC 3CFBA 1MQKL 3B2VL 3N1QC 5F1KC 4RGND 3KJ4B 4WCYL 1ZA6B 1SEQL 2ZSVA 4YE4L 1YO8A 3KYKH 3TN0B 4I0KA 4ONHA 5TFSL 3WFBH 2VITB 2ZKHL 2W0FB 3CXDH 4RFEA 3SDDB 3WSQH 1F90L 4E41B 5MENE 2X4SA 3WXWL 1N7MH 5ESAB 3SKNA 1OPGH 5FAAA 3QWOA 1UG9A 4BZ2L 1HYSD 4HUNB 4JY5L 3HUJB 4KQ4H 1HSBA 4ZD3L 3F65A 5ACZB 2ICEA 1FYTB 3OBAA 3F62A 2ZUYA 2YC1B 3MLYH 4TPRL 3LHPH 2BXYA 5SWSD 2E7LA 5I8EB 2Y5TB 2FJFA 3C6LC 4K71B 3OAYK 5CLWA 4UIKL 5DHXB 5EOCJ 4HV8A 4LHUB 2DLFH 2AV7B 4U2ZA 1YEHL 4QLRA 3B9VA 3BGFB 1WV7T 1ULVA 1H15A 2VLLB 1JYVA 1IFHL 1BD2E 4K94L 4HJJL 4WHDA 4OI9A 5FYLL 1JRHI 3D39D 3HG1D 4DGIL 3QIBD 4U6VL 4MA7L 5IB3B 1AE6H 5IF0B 5HYJD 3VMNA 4YGEA 2VABA 5HVGB 3QEQD 1G9BA 4MLIA 3ARSA 5B38G 3MFFA 4O02H 3MOQA 1T0PB 4X4XB 1YQVH 1F58L 4E41E 4PJ8D 3QEGL 5CZVL 3HG1E 3TVMB 3INAA 2RGSA 1XH3A 4Y16D 1RFDH 2P1YA 3PGCB 3T2NH 2ZHNA 3WUWG 1PZUB 4UUJB 3V5HA 3DARA 4H20L 3NFPA 4RGOL 3SE8H 2YS4A 3Q6FA 3SN6N 5I66B 3EZJB 4YFZA 3RY5A 3RGVD 4Z8FL 2V5TA 3OV6A 3VFNA 4ZOCA 1V3KA 2VXTL 3LB6D 5CWSA 2NY5C 4FS0A 1PX4A 2X89D 4EXKA 2CWMA 1FN4A 4AEFA 2IMMA 2E6VA 4CRPA 4CMHC 2WUCH 5FF6A 4X80H 2BHZA 3VXRD 1VGEH 2E8ZA 2BNQB 3O6FB 1P7QB 5BW7C 3H2WA 1VFMA 2XA3A 2IAMD 4NOBA 4FQQB 2A6JB 2Q76A 3V4PH 1EERB 1G7MB 4M4RA 4LQ1A 1EDQA 3AUVA 5JPMB 3QRFM 4Q9CA 3O2VL 3K8LA 1VPOL 1PBYA 2F19H 5FK9A 5SWZD 1IGYA 4LCWB 3KYOA 1A64A 1QBLL 2YA1A 5L73A 4FABH 5HJ3A 1QFWH 3GSOA 2ADFH 5IK3A 3MLSH 4XBEH 2XWBA 4X6FA 4JG0H 3ZXEA 2VKWA 3MRMB 4JM4H 5EORH 3DO3A 2QADB 2DUPA 5IMLA 1KJ2L 2AJVL 2X4QB 3FT2B 3ULVF 3L3OA 3RNKA 4O4YL 1Q8SA 4JQIL 4TSAL 1IAOB 3POWA 1L0XA 2X1PA 3WIIH 5I1KL 1KB5H 1PG7L 3K1DA 3QIUD 3ZYZA 3M3OA 4JRXA 1DBAH 3RTQA 3S9DB 3VD7A 3G5YA 1AF9A 1SJHA 4AJ0A 4GXUN 3KPRD 3QFDA 1I8MA 5MERA 4OD2A 2NTSP 1OF2B 1D6EA 4MDIA 3U9UA 1Y0LA 4MSWB 5EC2A 3L95B 2VLKE 2IPUG 4NWUL 1HSAB 4ERSH 3INUH 5DJDA 4I1NB 3ARBA 1TJGH 3UTPE 1YEIH 5ESQA 2RBLA 3ARFA 4PBVC 3IPVB 2BSTA 3CSPA 1UEYA 4X6DF 2GW5A 3RP1A 4U1HB 1I3RB 4XX1E 1GC1H 4YHML 1CJPA 1LODA 2ID5A 5I1GH 2G75B 1KFAH 4RFNB 5BXFA 1N8ZB 4P0DA 3R4SA 1F11B 5FYLE 4EZMA 1EK3A 3QP3A 3ZDYF 3BH8B 5BQ7B 3T2NL 3JUZA 3O9WD 3PGDA 1YJDH 2WNGA 1P7QA 4JRYE 1RD6A 1MS9A 2D3RA 2P4AB 3FOLA 3OG4B 2P43B 1IL1A 1ULCA 1UEMA 4NBYB 1T6VN 3HI5L 4PJ5B 2XG3A 1C5DA 1DFBH 4JVUA 2Y7QA 4YDVA 3V6FA 5DJXA 1H30A 3HC3L 3DO7B 4IRSD 4HQQH 4HL0A 1AI1H 2GTWA 4G6JL 3IF1B 25C8H 4HG4K 3I84A 1QLEL 4U1GB 3U0PB 4TSCH 1SY6A 3TZVC 2XACC 4XAWL 3I02A 1PG7W 1CD0A 2G9HB 3QQ3A 5MEPB 3GFUA 4X0KA 1S7TB 4JDZA 1ZHKB 5ALCL 3AVEA 2QLVB 1T7YA 4S1RH 1JYXA 3SLIA 1O5DT 1GGIL 4OCXL 1LO0H 4IRJC 5IQ9B 1IM9D 2EICA 1IAOA 4YEEA 4J6RH 4JM2B 4MLSA 3OKLB 4M48H 2PYED 1PEWA 2D6NA 5GLVA 4YC2B 5C0DB 3WDWA 5DHYA 1LOFA 3WJJC 3PHOA 1FZOA 1HHGB 2RR3A 2YK1H 4JFFB 1K5NB 1LO3H 2J8UB 3MJ9A 4D0CB 1G7IB 1NGYB 3E1F1 4J4PA 4FA8A 4Y20B 4U6HB 1MFDL 2NNAA 1YY9D 1OVZA 4C56E 1GZPB 2Z91A 3VRLF 2O5YH 1OHQA 5E9DA 5DQJA 1CU4L 1E6JL 4JQXC 4XI5C 3C60B 1E27B 4XCFH 2HVJB 3EBAA 3DVNB 4W68A 4DPNA 4YFLI 4NP4H 2H3NB 2P49B 3A0KA 1AP2B 3GJFB 4G6FD 4YX2L 5F70A 5E6IA 2OTPA 3FQUA 2FH8A 3BYTA 4XNUH 5D96C 2FWOB 1CE1H 3W39B 4HANA 3VGDA 3T3PF 4WENB 5ANMA 3RX7A 1ZT7A 3O0VA 3TJHC 4YHLL 4QGTA 2W60B 2OR9L 1KEGH 4YHIB 1PKQA 4ZAKC 1NGWB 3BWAA 3GZKA 3RUGB 2ZUVA 1U3JA 5B4MD 4BH7B 1NJ9A 1MFAH 2R4RH 3QFJA 1RZIB 5E2TL 1DUYB 2WBJB 4M1DH 4J2XA 2VC2L 3AP5A 4HV8B 4UMGA 5E8DH 5INDA 1JN6A 4NZUL 4EN3C 1MY5A 3LPFA 2VLRD 4YBLB 4F7PA 1TTFA 3OPZA 3ALXA 4WRLA 3IFPB 1A0QL 5DURD 5K59F 4XCFL 4KGLA 3PGFL 5CUSL 3KXFE 1QSFE 4OBRA 5TF1H 1NLDL 5FECB 5J9PA 1YI7A 4F37K 1EUTA 2UZYB 4OZHB 4N0RA 1GOGA 5T1KD 1DLFL 2A9ML 3P11L 4LLYA 4PP2A 5F96L 3U36A 4HK3N 5B22A 1FNGB 3TT3L 5I19L 2WW8A 5E6IB 2ZSVB 4WI6A 2DQJL 5ESVA 3KDMB 2GJZB 3ZSJA 1JGVH 5FOBA 5KSUA 2DTML 2R4SL 2VISB 5FA3A 5HGBB 1U2CA 1K9TA 1R24B 4BSJA 4CJ1A 3OKMB 3T65B 1LE9A 1EBAA 5I9QB 2ITCA 2VLMD 4EVNB 5FO9B 5B3NA 3GI8H 4K23L 2NTFA 1KJMB 4F3FA 1QSEE 3U7WL 5ID1B 3W9DA 5FCSH 4H88H 1KITA 2X4RB 3UPRB 5CEYB 3RPIA 2D7QA 3JV0A 5T1KA 4LBNA 4XPTH 2E7CA 1X50A 4D0DA 4V1DB 4G80A 1BM3H 1G7LA 3TFKD 1Q0YH 1UMZA 4HUWA 2J5LB 1H5BA 4LBQA 1MELA 2J2ZA 4YG6A 4EI5D 3ARDC 5HDLA 1SMAA 5E9DB 3MCKB 4YZ5A 3CFJA 1XGRB 3LV3A 1L7TH 2A77L 4L9LA 1EO8H 1I9JL 4U6YA 1BREA 1V6OA 4XB8A 5KSAD 4AEEA 3T0DA 1I9JH 5TFSH 1FATA 3N35A 3GIZL 2X09A 4L9DA 4GXLA 2NR6C 2PTTB 2D7FA 4OKVA 4OJFH 4XGZB 2EC8A 1X4ZA 2A6KB 4OCMC 4M8QB 4GMSL 4KKLD 3T09A 3HCVB 4OM0H 3FFCE 3ZXJA 3CH1A 3G08B 2Q7YB 5HCAA 2OXGA 4Z7VB 3EJJX 2ZACA 4PR5A 4Y7MA 4JAMB 4XMLH 4LASH 1I3UA 4TNVF 1AXYA 1D9KD 1FSKB 1C5DB 2E7LC 1WCSA 2VC2H 5I2IA 5F9DC 2VXVH 5CJ8A 3LRGA 4KHXH 4PRBB 3MRNB 1BFVL 3EOBB 3VXTA 5JLZB 2X2YA 43CAB 3MV8A 3WLUA 3OR7A 3QI9D 3AP6A 2VLME 2DF3A 4GO6B 2ERJB 3EYQC 3O81A 1UM4L 1KNOB 3FRPG 3V4VH 1I8KB 1MRDH 3DV4A 1RZJL 5HYQB 3ARPA 5I1AB 4BKLB 2SBAA 1PVHA 3DO7A 4KRPD 4FZ8H 1Q8MA 3OJ2C 4RMVA 1BZ9A 1F42A 3H9YA 3LKQA 4HC1H 2MKWA 5EZJB 3WG1A 1B3JA 5F8QC 1W0WA 4RMTA 2O93L 4ZXBB 3MYJA 1A47A 3BPOB 5DC4B 2A0LD 1KJ3L 2CY6A 3AXLA 5GJTL 5GGQH 2IPKA 1RHFA 1KACB 4XPFL 3VGFA 5I1JH 5GZCA 4OF3A 2J1KA 5BMFH 2BNQA 5SV3A 3EYFB 5L0QB 3NVQA 1T1ZB 2A73A 5D71H 2HH0H 4OZFH 4F2MA 3SBWA 4UQ3A 4GKNB 1BOYA 1K4DA 2YROA 5E8DL 5HYFA 2YBRB 5GZOD 4PB0L 1U41A 5JOFB 1V7NL 4HS3A 4OV6F 4YPGA 5GRUL 3O2DH 3VU2A 2DQFB 4LSVL 5ABDE 2QQNL 4AWDA 4K3HA 4LQFL 4MAYD 4XB7A 4OIIH 2X1WL 4BFEA 4K23H 4Y19A 3GMRA 1T66D 5JA8B 3VXNA 2XWTA 4XMPH 1V3LA 5DD5L 4KKBC 1W6PA 3VV1A 5AZ2H 3RJQB 1RIHH 2QQNH 2D9QB 1PY4A 1QSEA 2BNQD 4XC3H 4YDJA 3UTSE 1S5IH 3MYJB 2XNAB 5HHQB 4JLRB 5ICZA 2Q20A 3WNMA 1DBBL 2ZUSA 3S4SB 1FCGA 1JCKA 3BXNB 3EJYC 3LSDA 1GGBL 3O0RL 3HC3H 4HH8A 2R0ZH 1E6JH 1T89A 3KPLB 4GKYA 3CNAA 1ITCA 5DJ6B 2HT2C 2FMDA 1WW6A 4M01A 3RZCB 4MXQD 5FK9B 5GPRA 2UV3A 1RUQH 1XGQA 1WBLA 4OD3L 4HIJB 5BCAA 4P9XA 2X9XA 5DEFB 4FFWD 3BD3A 4KVNH 3MO1B 1WBFA 3WUCA 4M7LH 1U6AH 1D9KA 1ZM1A 1HIMH 3PWPB 3OKOA 4NQSA 2J4WL 1FFQA 3NN8A 5L2KA 3WFDL 3MBED 4OZFB 2BVEA 4ZDHB 1WBXA 1CD9B 2BMKB 3CDYA 4PRBA 1VKXB 4FOMA 1IS3A 2IBGA 3ARGD 3KDMA 5IHZB 1Z78A 2BY3A 3LZFL 2AXFA 2F5AL 4GKOA 3K80A 1MFAL 2QQKL 3MRFB 3B3IA 4M9PA 3D39B 1U93A 5GQBA 1MIML 3OKDB 4PJGA 3GMPB 4JGMA 3QIBC 1FC1A 1RK0B 4NO2A 1INEL 3CZJA 5JOPD 2F9BT 4XTRD 4PV9A 4MVBD 4P2RB 2DQIH 2UYLA 5EPMA 3QAZB 1SLIA 1UCBH 2WIMA 1WAAA 2DL9A 3BRFA 5AEAA 4R90H 2AENA 1J1XH 4J3UA 5TQ2H 5C0IA 4JPVH 4X7CC 2HMIC 4O4YH 3P9MB 3WE6B 1C7TA 4F7MA 3U9PL 3NPSB 5FYKU 1YEGH 2LTQB 5F96H 2GN7A 4PJ5E 5ACZA 4NQCA 5DMJB 3LRSB 1KIQB 2DQUH 5DWUL 2NW3B 1QFWL 2C4XA 1LHWA 2F15A 1A3RL 4GQ9H 5IGXH 5K9KA 4X6EA 5D9SB 4JKWA 3MGOB 5IFHL 3QRGH 1F31A 2AI0H 1GZQB 2R29L 4HD9A 4AT6B 2B20A 5C09E 2A6YA 1EBPA 3HLAB 3N1MC 3O3EA 4PBWD 3TT1H 5BV7C 5FGBC 1OQXA 2NY1B 4M1CD 3X3GH 1TQBC 1UB6A 2QKIB 5B3JE 1G9FA 4PJDA 3E8UL 2UZXB 2K7PA 2IG2L 3EFDL 2FDBP 2UZIH 2QSVA 4FQHA 4KGJA 2AAVA 4ZUVA 3NN8B 1U3HA 1U8PB 3AROA 4RDQG 2JCCF 1QR4A 1WT5A 2EYSA 4XC1L 5IVXB 1D5ZA 4JGUA 3TCLB 1LOFC 3GSUA 4UILL 2BP3A 1BZ7B 4DGVH 5J8OA 4I4WB 3X11A 1OSZA 4QRRA 1AC6A 5IMKB 2G5BB 5JW3L 2ZOKB 3FB5A 4LPYA 3D3VB 1U6AL 2VDOL 5CNAA 4XNZB 1U93B 1ZANL 3TWCH 3UTOA 2R69H 2CUHA 5K9JL 1N59B 4ZUWA 1KV3A 4FQIL 4RSVA 1MAKA 1T7VA 4OFVA 1R6VA 4KTDL 1LOBA 1XIWC 3WNXA 3HE7C 1X5LA 1NC4A 1OD9A 1ZHBB 1YZZA 4XVJH 3AZXA 1ZANH 5D6DC 1FGNH 4PFEA 3FB8B 1XAUA 2X44D 1DDHA 2EYTB 2NY7L 4HKJB 4HS8H 1WISA 4LLQA 3MGTA 3GMPA 1TPXB 4DK6A 4XTMA 3B9DA 4BMBA 3AYAA 4U31A 3VGAC 2IAND 5JTWA 4OFKA 2YMXH 4XX1G 2P8LA 3NA9L 1EHAA 3GB7B 4ZAKA 2J8UE 4JN2B 5EUKA 2P5WB 3WS3B 4GKNA 4KROC 1ZTXL 3ULSA 4Z0XB 5GGVH 4BLJA 2DRUA 3EFDH 4QT5B 1BHGA 4MCZA 4H5SA 2FIRT 2VDMH 2SEBA 2VLRB 3REWA 3H0TB 2CKBB 3WN5B 5HYEA 2E7QA 4XWGL 2D6KA 3PABA 3S35H 2VW0A 3BVNB 4PGEB 2G75A 4ELME 4ODXA 3POSA 2A6DA 4WEUD 3S4SG 5TQ0L 5JPNB 1S9XA 4FOYA 3RL1A 5C0BE 4POZD 3D25B 1EVUA 2CUIA 2HN7B 3ZKND 3N7MA 4Z7NE 1YEEH 3LKPB 3L3HB 4CRQA 2DQFA 3I3BA 1OP5K 3IFOA 4K3GA 5BS0D 3WHXA 1OGAD 3QDGE 1HH9A 1V6NA 3QWRD 1I1FB 4HUXA 3L5HA 1YJDL 2MJWA 3WS6A 4GALA 5MERB 4I30A 2FSEB 1R5IB 3HNVH 1A9EB 4OT1H 1C57A 4P99A 4OLUH 2YXSA 4UNUA 3L7FB 5CP3A 4RNRA 1QUNA 3QUZB 3ZTJH 2WUBL 4UDUA 5L2KB 1N4XH 5C0JA 4OLXL 2YK1L 4NQDB 1D9KB 5DMIL 2Z8SA 5IFAH 3W5NA 3BQUB 3RZWA 2NY6D 2X4PB 3S34H 2WUCL 3PIQA 2DQCL 3PL6C 1NMBH 3HZYA 2VQ1B 2XKUA 1YEFL 2RCSH 1SVCP 1F3JA 2ZMKA 5L9DL 4XGZA 4GA9A 4H1LA 1W6OB 3FJTA 5F9AC 5KAQF 5F6HJ 2HA1A 5GRYA 5J0BA 5K93A 2OM5A 1U8MB 4JR9L 4NO0D 3OYWA 3KPSE 4JY6B 5EO1B 2R39A 1P1ZB 4GW4A 3WDTA 4P4KD 5CEZH 5HCFA 1FV1A 4NKMA 1T0MA 2ZGOA 5EBGA 1EH9A 1IM9B 3CVHB 3UJIH 4UDUB 1QLRA 1Z6JT 1KCSL 3UXFA 4XPGH 5B8CA 4KKAD 5C08A 3KPRA 1CE6A 1R5IA 3QAZC 3V6OA 3VD3A 5MHSD 3IDXL 4IIQB 1D5XA 4PRDB 5ITBL 2AK4E 1QGLA 4JFEE 4KDVA 1GZ9A 2D03L 3F5WB 3QIUA 1Q9KB 4OCYL 3SKMB 5BS0E 2LQRA 5I1HH 1GNHA 2XZAH 4YHZL 4U33A 1EHXA 4NQDA 1JUIA 3NFPB 4P5TB 3QUMB 4R96A 1PX3A 2AKRA 3BPLB 2BNRE 3I6GA 4WHYH 4D2NA 1FNLA 1U8LB 4Z0BH 1LHUA 4S1SH 5IBUG 1FO0B 1A4JB 4GMTH 1P84K 2I9LB 4YFEA 4HEPG 2M1KA 2AEQH 3NV3A 4ODTL 3PL6D 4HWBH 1A1NB 4OLEA 1WEJH 4JY5H 4GLRI 4P2QE 2B5IC 3FQNA 2UWBA 4BKLA 4PJHA 3LSEA 2ZNXA 3B5GA 7CGTA 3C6LA 5IEHB 4U0RB 3MRCA 1AD9A 3QDJE 1OP3H 2J88L 3KPMA 3VGAB 5JR1H 2J4WH 5F3HA 3PP3H 3R1GH 1UN1A 4Z9KB 3D0LB 1YMMB 4KMTL 1KB5A 3QJFB 3A0OA 4AK1A 2ATPA 1WLCA 2G4IA 4PRAB 2EXWD 5FF6B 3GSQB 3H3PL 3WIHH 5TE4L 1NJ9B 2GJZA 3UAJC 4JFPA 4PG9B 1X3DA 5C0RL 5J57B 3HZVB 3MRDA 1FRGL 2F5BH 2B4CH 3UTSB 3AREA 5F9OH 2X4SB 3QUXB 1NAKH 3U36B 1JHLH 2V9TA 5DEGB 3CX5J 4I2XA 4JFYA 1DFQA 4Q2ZA 5D8JH 4GUPB 1CFQB 5HYIA 5JHDE 2FCBA 3TM6A 5IHUH 1UM5L 4ZNEE 1T80A 5EUOE 1NGPH 2EYTA 1NCCL 1CGVA 4NC2B 4XH2B 3SOBH 2ENRA 3UPCA 3MRRB 3KWWA 3TA3D 1LK2A 3PDOA 1BIHA 3CK0H 1MACA 5DMGC 3QLQA 5GGTL 1Q9LA 4HUUA 1SCRA 4ZUVB 3GGWA 4WO4D 1P7KB 4KUCD 2AJXL 3PL6B 5IB3A 3TYFA 5MP6L 1I7UA 5IOPA 5HY9B 1JPTH 5BVJA 2J6EA 35C8H 4KROB 2P8MB 3MRBB 3HB3C 1J1PH 3C9NA 5D5ME 3V9FA 4KXZH 1B90A 4KVNL 4F9PA 4NN5C 3GIZH 5HTSA 3VFGH 2IANE 1G9ML 5GGRB 3D39A 2YUZA 1YQVL 2A77H 2DD8L 3WIFA 4FNLL 4L3AA 4JM2A 5TQ2L 4YK4C 3MC0A 3OF6A 2CLVA 4PBOA 4R2GC 4ZKTB 2YC1A 5KJRL 32C2A 1VKXA 4IHOB 1RUKH 5JDBA 1ZHKA 1G86A 3H7BB 3APBA 4YR6A 3DWTA 1CFQA 2ARBA 2ARJQ 2C3VB 2BNUB 2UWEF 2BY2A 4YM0A 4XBGB 4Z0BL 3QCUH 2E9WA 2QV2A 3QUXA 1G7QA 3LZFH 3CPLA 4WWKC 4TYUA 5GZFA 1NL0H 2KKQA 1NPUA 1WAAE 4JFOA 1H3PL 3HRPA 5T5JA 2H3NA 3DRQA 2D03H 5D7SH 2GJJA 1LOAA 1IGIH 2QL1A 4RAUB 2V5MA 1PJ9A 4WHTB 1A2YB 4QY8A 4Y16C 1MFBL 1FAKT 3WHE1 4JKKA 3TAYA 3MEPA 1DLFH 4FFWC 3KPSD 3VFRA 4PLOB 3CH8A 4P2RA 4ODUA 2PYEB 2WLYA 4P59L 2NPLX 3MRPA 1YRZA 3FZUD 1MR5A 1KJ3H 5EBMB 1BQLL 2XYCA 5IB5B 4K71C 3LKNB 4OD1L 2WIIA 1INDH 2A83B 2X4UB 1NL0L 2Y6SC 2JELH 3OR6B 3GJFA 4Z7WA 3KPRB 2VZSA 3PHQB 3DGCR 5FGSA 3TNMA 4ISQA 5AWNH 3LQMA 1MCEA 4G9FE 1NMBL 4PRHD 3MLRL 1W0YT 1QTYT 3SISA 1BBDL 4P5MB 1W6PB 3K0WA 1EAPB 2DTMH 4X8JA 1U36A 1CD8A 4TNWK 5T1MB 3GRWH 3JWDH 1UL9A 1S8DB 4Z77B 3PV6A 4X7FC 2EYRB 1RJLB 1QBAA 2ZUXA 4ZS6C 1OARH 2V2XA 1KRIA 4JG0L 4ZO8A 3QUXC 4M5YH 2QQLL 1ROWA 3PGDB 2DVFA 5JQHC 4N0FB 4A2MA 4R7NB 2D7MA 5L88L 5J6HB 1DBNA 1JNJA 4HEME 1GHFL 2FD6H 1O7VA 4LBLA 2PYEE 4G3YL 1BKZA 1AR1C 3GK8H 1QNZL 1WD3A 1K3ZA 2QEJA 2YRZA 4OZGA 2F8XC 3U4BL 3O6MH 5C0FA 4KQ3L 3RVUD 1T1YA 1Q72H 3WFHA 3T4AA 3FT3B 4PF5A 4HJ0D 1NGQH 3OXRB 3P4NB 4KRPC 1BECA 5GGSA 1I8LA 5BJTA 4OIAA 3RWFB 4LBJA 4LCCC 2XFXA 1WC7A 4GKZA 1JGLL 4U05A 4HZAA 1FNAA 3JV5A 5CB7A 2EO9A 4LPCA 2NY0B 4QRQB 3X3FH 3THMH 2W38A 1CI5A 1FSKC 3MV9D 1UADC 1HHKA 5T33L 1KCVL 3VDCA 4LF3B 3AYCA 1OWWA 2BK8A 1B09A 4P9HC 2DI8A 2SEBB 5SX5H 1GKBA 1V6IA 1MEXL 2FX9L 2ZCLH 5T54A 1JPSH 2B0SL 1JHLL 2GY5A 3ZT6A 2EYRA 4OLUL 3WDIA 3FUQA 2ENYA 2ED8A 4YHYB 1EGJL 4TYSA 5F7KC 4IDJL 5T1MA 4U1JA 1KTDA 2DLEA 4HXBH 3S36H 1H8SA 1KCLA 5D7KD 3N1FC 5EU5A 4CNIA 2FX8H 4LDLB 5AAWA 1KPUA 4QYOB 2VLJE 3UTPD 3TBTA 1IC4L 5E8OA 1R3HA 1CFNB 2DU0A 1HN1A 4LVHB 2ICWI 1IKFL 1G9NC 2F53E 4KAQH 1FLRL 3FOMB 3LPGA 3RGVA 3QPQC 1KIPA 8FABB 5HI4C 4WEMB 1LP9A 1OW0A 1MFNA 4PJDF 1A6VL 4F33A 3QEHB 3WIFB 5D2NE 5HD8D 1I1FA 3BI9X 3EOTH 3VXSA 1L0QA 2G5RA 4Y4FB 3VFVB 2PCPB 4I3RL 2P5EE 1MCIA 4PJ8B 3VA2C 3BKYL 3D2UB 3HE6C 4JQVA 4UV7L 3IXAA 2JCCA 3KYOB 3RRDA 5IIEA 4P2OC 2OR9H 4LEOB 4M7LT 4ODVL 4QRRB 1A6TA 1QFWM 3RWHA 3ENRA 2OUJA 2M26A 4S1DC 5TH2A 3TBWB 3FLPA 1XIWB 4HWEL 4CL7A 3QIBB 2Z31D 3VCLA 3WKML 4F7PB 2FBJL 3OKMA 2VRAA 3BMVA 5I8CB 1X5YA 5I1HL 1LOCA 1KJ2H 1LO5B 3PV7A 4LEXH 1LEGB 4BQBA 1XIWD 3T3ME 2CLVB 1BLNA 1YPZB 3T1LA 1QRKA 2DBLL 4Z7UE 4D3CL 4NM4L 2X4RA 1BX2B 3UPRA 3TZVB 5HSFA 3MPPG 3OQ3B 5F7UA 3BP4B 1TNNA 5SWSA 3ILQD 2DQEL 5C6PB 2YPLA 1HYRC 2VR5A 1JK8A 4ODVH 3T65A 1IE5A 3OGCA 4PJ7F 1SEBB 1G7JB 4XWGH 4J1UA 5I1GL 5IB4B 4EN3D 4N0YH 2BNRA 5IJVA 2W0KA 2H1PH 4Y0GA 4WHTA 4Q97A 1ND0A 2R2HA 4XCEB 5IBTH 1IOAA 2JJ6A 3OSKA 5CJXC 4HG4J 4Y26A 2ARWA 2KVZA 3RL2A 1FNGA 3ZLQC 5IWLC 3HE7A 1WWCA 4JPIB 1XIWA 3OPZL 3KWWB 3QCVL 1FFOB 3BFOA 3RWHB 5DMIH 2CIIB 2OQJB 1YEKL 2ZPKH 4X7SL 1CDYA 3PVOA 2WT0A 4NO2B 1JGEB 1DUZB 3FLRA 3VXMD 1RY7B 2J8UF 2VUAA 3UTQA 1G6VK 1INQA 1TLKA 5EUOF 3H9ZA 5T5FL 4GSDH 2ESVD 3CFEA 3KPQB 3OKNB 4Y4KD 1LP9F 2B1HL 5IK7A 1A1MB 2BOCB 2HAZA 4WNQA 4C83B 5IW6B 4XI5D 1E4JA 1MQ8A 4F7EB 3O0WA 2YKLH 3F12B 5E2JA 4UT7L 2BHYA 4IM8A 4PRAA 3MUHL 3F7RA 1QPXA 3O4LB 1U3HC 3O41B 4ELMF 4RA3A 1TJHL 4J3OC 3AYEA 5F7LB 2IPUK 4LVNB 1SEBA 4OAWA 5H9QA 1J1PL 1AO7B 2YN3A 3PJSA 4N9GA 4DZBA 3MRIB 5HGGS 4YG0A 4ZS7L 2VAAB 5DZNA 4Z7NF 5I6XC 1G0YR 5HYSB 3AREB 3FHQA 4RFOH 4OGYL 3O3UN 3EDDA 3BP7B 3L1OH 4I77H 1NGXA 4YHNA 5JIPA 3HI1A 1AP2A 3GMQB 3KNBA 3CK0L 1GICA 4NQCB 4ENEC 5FHBL 3M1BB 4LNRA 3MV11 5IV2A 5GS1C 3V7AG 2ATKB 3BZEA 4UU9A 2VLKB 1OAUL 4UQ2A 1YNKH 2DLGA 1VDGA 2Z91B 3IDYB 3QR2A 4KRPB 4L29B 3PDOB 1FV1B 4HLZG 4WU7A 5DC0A 3MGAA 1TTUA 3FB7A 3MUGB 2R56L 5DFTA 1MCKA 4MJ4A 1CXHA 3IU4L 3K74B 2OTUA 3LKRA 1LO4H 2D2OA 4ODBD 2GSGB 3EDJA 4XCYA 2IJ0C 1U8QA 3I4IA 1HSAA 4N5UA 1AR2A 3BQUA 4JN1H 3UTSD 2VUOA 4FPHA 4K3EL 5EBWA 4GH7B 5E99H 1T22A 3IT8D 2ESVE 5GGVY 5ERWA 1LP9B 3EYSH 4LL9A 4MJ5A 2ED9A 2IBZY 3MRGA 2D7OA 5DFWH 4GW1A 4R8WL 2C1PA 5H37G 3L5WA 4BELD 3R4DA 5J7CC 4P48A 4HXAH 3R0MA 2EO1A 1T20A 2PO6C 5FGCB 4KKBD 4NKMB 2WT1A 4OSUH 1XMWA 3VFSA 3G9AB 1KELH 1Q1JH 4GW4B 3X3FL 1UXSA 1N6QH 4TPRH 3FQWB 5B8CC 4KHXL 1IKNA 3O6KH 4J8RA 3DX8B 4QTHB 4YGAB 2J5LC 3IDNB 3L1OL 4EI6B 5EC1B 1OPGL 5HGDA 1WSST 2BFVL 3M2MA 4PJEA 4XIOA 1YECH 4APQD 5GISL 4KQ4L 5KVDL 4LSQL 2GMPA 1D6EB 3BUTA 2DVDA 1XF3B 4K7FA 4EUPH 3W58A 1K8IB 2IPKB 3T0EE 3WL9B 1HHKB 4Q9QL 4P3CL 1R0AH 3ESVF 5CJXA 3GJEA 3B2VH 3JV6A 4HUMB 3L5XH 4H0IA 2R29H 4APQB 3U2SA 3FMGH 1KTLA 4IQPA 4LPTA 5D7JA 1RUQL 4XZUB 3ARVA 3SO3B 3TNMB 4XCNB 3WNKA 1S7SA 2JB5H 3WFEL 3QDHA 3MZTA 4ZODA 4FFYL 3BYYA 4K3JH 2LU4A 1TDQA 3Q48A 5EG6C 1K6QL 5C07A 2PELA 1MCHA 3IJHB 1ENSA 4R26L 4ODHH 4Y1UA 4HCRA 3U0WH 4JFXB 1BP3B 3MXWH 1OAKH 2CK2A 2R1YA 4LLDA 4ZO6A 1HKFA 1DEEA 2LE9A 2VZ1A 5TE6H 4CAGA 2EKSA 1VHPA 2JE9A 3RL1B 3OJMB 4DEPB 4PS4L 3RY6C 4P46D 3AX4A 5GS1A 4PJCB 3IKKA 4U1NB 3QYCA 2A6JA 2Q76B 2V6HA 2LU3A 1IGFL 4X6CA 2A83A 2VLRA 1RUKL 3MLRH 3IM0A 2AJUH 4EJ1C 1D5IH 1DQDH 5I1LA 4OI7A 1MCFA 4WY7H 1OTTC 1B0GA 3T0ED 2GNDA 3FAWA 2CQVA 4NFDA 5TPWH 4KK5C 3KJ4C 1UKQA 5IQ7L 5CHNB 4KQ3H 3KXFA 5LXGH 2I25N 5HI3D 5CIPA 5IESH 2W9DL 2A9MH 3P11H 1S9XB 2YV8A 1FE8L 1L9NA 2EXWC 4C58B 2KYWA 3VFGL 1BFOA 3WKNA 2BNRD 1C5BH 2AJYH 4GWNA 4UUJA 3V5HB 5EZIL 3U79A 4LPXA 5I73B 1AJ7L 4UW3A 1X6NA 4L8BB 3OL2A 3MFFB 4M1GH 5HHOD 4OGAC 3IKCB 4X6DB 1EGJH 1UJTA 2QSQA 4F9PC 1HZHL 1A3LH 1PKOA 4LK4A 1UWEH 3DRTB 2I07B 4MMZC 2I5YL 5MHSE 5E2TH 3CCHA 1MCLA 1ZSDB 2P5EA 1VA9A 5IMMB 2DN7A 5DTFA 1AKJA 1BJMA 3WIHA 1N3NA 4OIIL 3H9SB 1N3PA 3IN9A 4JRYA 4NJAH 4AY0A 5BVJB 4IHOA 1ZHBA 4BM8A 5ACMA 3SCMB 1DVFD 3BPNB 4ATEA 4M6MH 2I5YH 5DK2B 1ZTXH 1RU9H 2QADC 3RL2B 2FEDC 3UP1A 4KMLB 1TMCB 4XMLL 2Z4QA 3VFPA 2ATKA 3BZEB 4JJ5A 5KVEH 4JB9H 3ZXLA 3RDTB 4EDWH 4NN5B 1GH7A 4FRWA 4QEGA 4QXTA 3SGDH 1J05B 1T7XA 4KAQL 4XMIA 5FM8A 4K55A 4W4NA 3RWCB 1H3WM 4YH6A 3WS3A 3LIZL 5FECA 5J9PB 4X98B 2EECA 3WFCL 3RMXA 1CGYA 2FLRT 3QWOB 4G6MH 4WHYG 4NC1C 5L2JB 1ULDA 2E8YA 1T3FA 1N3OA 3NH7L 5J89A 3D5OA 1KG0B 3PQYE 1F9KA 3L7EA 2CLRA 4LLQB 3P30L 2CKBH 5F9WB 2VLRE 3SH5A 3ULVH 2X1QA 1F6AA 1FGVH 2XRAH 2AXJA 2CO6B 3CDCA 4N90D 2VWEC 1JPTL 3K7UA 3BGAA 4NBXB 2AABL 3CVIH 2BC4B 4OIBA 2Y1VA 1XF1A 3F12A 3BIBX 2NXYD 4IS6A 2BVUA 3DURB 1R5WA 1TVHB 4Y19E 2WSKA 1KTKE 5I8CA 2R8SL 3LVEA 3ZE1E 2XQBH 3QT2A 5JHDB 1NANI 2BX5A 4YWGH 1KN4H 2O5ZL 4PS4H 4G7YL 4YFWA 4LVNC 3O45B 4HWNA 1AGEB 3TVMD 1ZVYA 4KI5F 1ONAA 4FTVA 1BD2D 2ZOKA 5D93B 2J8UA 3BDXA 3HC0A 3I6LE 5CMAB 2OR7A 1EHLL 1KULA 1WCBA 3WCSA 5FEBA 5I6XB 1NFIA 4QXTB 4LBEA 2CRYA 3VXME 1AI1L 4G6JH 3BHBA 4MNQA 2AXFB 4JO2H 5FDWA 3ZTJG 5JMCA 1HI6A 4FXGB 4PTUB 1MCCA 4NRXB 4ORZC 3E6FB 4WDIA 4HAFA 1X4YA 1MRCL 1U8IA 4H1LG 3HG1A 5I8KL 3VUOA 2BMKA 3AFKA 5D1ZC 1A7QL 1LHOA 1C5BL 4CW1A 5LK5A 2DLHA 4P59H 2R1YB 2QQLH 4RGMC 5CEZL 5E2UL 5IMOA 3CCHB 3BTAA 5SWSB 4X5WA 2FWOA 2EEBA 3U7AA 4AH2A 1UPSA 1I3GL 3BQUD 4JO4L 2NY5L 3IJSA 4MCYA 1EFXD 2EDRA 1YA5A 3K46A 1EXUB 1MVUA 2Z35B 3EO1B 4G8GB 4PG9A 4NQDD 4Y22A 4K3DH 3QPQD 4FQPA 4ZQKB 4ZUUB 1Q0YL 3LS4H 4G6AC 5EU4A 4KXZI 4LKCA 1QO3B 3LS5L 1DQ6A 5I16B 2D0GA 4CN6A 3GM8A 4HIXH 2DM2A 5C0IB 1CZ8H 2R2EB 4FP3A 1MIEH 5DXWA 4GRWF 4YBQD 1CZ8L 3G6AB 5CP3H 3KLSA 2BRRL 1I9RL 4QXGL 2X5PA 2NNAB 1P4LB 2I26N 1P1ZA 2YOCA 4ISVB 2W9EL 1HOCB 2HTKD 2ARXA 2OXHA 4L3EA 2EDLA 2ZGPA 5GZDA 2VW1A 3VXPA 4LSRL 1YYLL 3IDNA 4YX2H 1BBJB 5DD0H 2X89A 1S3KH 2JIXD 4MHHI 5IP4A 4JN1L 3A67H 4ZFGL 4XNXH 2H0BA 2Q3ZA 5D96B 1D5MB 3H42H 4QRPE 1DL7L 1S0IA 1FO0A 3FCTA 3U4EB 1CICC 3LCYA 4LRIC 3IXTB 1GSLA 2ADIA 3KLAB 5HHXL 3OYWB 3GMRB 4U7MA 3T0WA 4FXLA 4KY1L 3EOYG 4LCYA 1NFKA 2NY0D 4K7PL 4KKCC 2HT3C 4KK6C 5TPWL 2Q8AL 1VERA 2QJDA 4JQXA 5DJ0A 4O2EB 1OAUH 3FONA 4PB9H 2X1OA 1U95B 5EO9B 5KVEL 2F53D 3BJLA 1QP1A 2DUOA 2ICWJ 3WG3A 3Q9OA 4OLYH 4XRCB 2PNDA 1JNLH 1GGTA