4M00A

Crystal structure of the ligand binding region of staphylococcal adhesion srap
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
501
structure length
501
Chain Sequence
TTAVTANTITVNKDNLKQYMTTSGNATYDQSTGIVTLTQDAYSQKGAITLGTRIDSNKSFHFSGKVNLGNKYEGHGNGGDGIGFAFSPGVLGETGLNGAAVGIGGLSNAFGFKLDTYHNTSKPNSAAKANADPSNVAGGGAFGAFVTTDSYGVATTYTSSSTADNAAKLNVQPTNNTFQDFDINYNGDTKVMTVKYAGQTWTRNISDWIAKSGTTNFSLSMTASTGGATNLQQVQFGTFEYTESAVTQVRYVDVTTGKDIIPPKTYSGNVDQVVTIDNQQSALTAKGYNYTSVDSSYASTYNDTNKTVKMTNAGQSVTYYFTDVKAPTVTVGNQTIEVGKTMNPIVLTTTDNGTGTVTNTVTGLPSGLSYDSATNSIIGTPTKIGQSTVTVVSTDQANNKSTTTFTINVVDTTAPTVTPIGDQSSEVYSPISPIKIATQDNSGNAVTNTVTGLPSGLTFDSTNNTISGTPTNIGTSTISIVSTDASGNKTTTTFKYEVTRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into SraP-Mediated Staphylococcus aureus Adhesion to Host Cells
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Cell adhesion
molecule keywords Serine-rich adhesin for platelets
total genus 138
structure length 501
sequence length 501
ec nomenclature
pdb deposition date 2013-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18483 Bact_lectin Bacterial lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m00A03
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m00A04
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4m00A01
3.10.20.320 Alpha Beta Roll Ubiquitin-like (UB roll) Putative peptidoglycan bound protein (lpxtg motif) 4m00A02
3BW9A 1RK1A 4RMQA 1NBQA 2FIKB 2Z8RA 4N5ED 1VFBB 4ZAKA 4YUEL 4O2EA 2DS4A 1DUYB 1KJ2B 2H32H 5B39A 1BGXH 3DXAE 1NUGA 3N1PC 5DXDA 4KJPD 1G7IB 3MGOB 5FF6A 3VW3H 1KJVB 3JXAA 1FYHB 3LB6C 5FV2A 2ARJA 5IM7A 5F9AC 1SM3L 4EUPA 4I9WE 3RMXA 2FJGB 5DJAA 3DUUB 2ICWB 1B90A 1ZAGA 3SKOA 1DEEA 4JY6A 2L7JA 3JSSA 4Z7VF 4JKPL 3F12B 1FNEB 2W0PA 4WFGE 5IESL 3BKCL 5L8LB 5CZXD 1N47A 3SCMB 4HPOH 4JKPH 4MYWB 4R4FH 3LSEA 4UW6A 2DKMA 1FORH 2YSSA 4NGHL 2W0FA 1EO7A 3RQ3A 3QG6B 3N1GC 4K8RD 3POYA 4LCUA 4OGXL 1KPUB 5IWLA 5TE7L 5IQ7L 4OT1H 4LBKA 3C60B 2ZGPA 3BDXA 2BJMH 2VUOA 9CGTA 3IFNH 3WFEL 1MF2L 4R2GB 5B4MD 5JMRA 3A6BH 1MEXH 4Q6YA 1AXIB 3MJ9L 2X4TB 1G9ML 2AGJH 2MPAL 4PJ9B 4OV6F 2DVGA 1HIMH 2AEPH 2AK4A 1QNZH 5FKPB 3V0BA 3DUSB 1YIFA 4CDGC 4S1QL 2Q20A 5C0ND 1DBKL 3JWOL 3JTSB 1F2QA 1BOYA 3M3OA 1CE1H 1ZS8A 1G9NC 1PSKL 4OJFH 2IMNA 2A75A 1U8MB 5K59E 1OPGH 2ZUVA 1KGCD 4KTEL 1PLGL 3MLVL 2NN8A 3OR7A 3OXRB 1UJ3C 3D39D 5HPMA 1A7NL 1Q9OA 5DZGA 1FNZA 2HFTA 1EA9C 1MCPL 5E2WL 3O9WB 5E8PA 4RRPG 5HDBE 4JO2L 4Q2FA 4XPTH 3BP7B 4KHXL 4YGBA 2P44B 2E6QA 4KROC 1UWEH 1KPUA 5MERA 4JFZL 4JRYD 3T2OA 5IK8A 1FSKC 3BPLB 1N4XH 1K9TA 3VFPA 4J12A 4TPRL 4NKMB 2DQGH 5DMYA 1BLNB 3REVA 2ZMKA 1LHVA 1J05A 1GIGH 4TSBH 1GC1H 2DJ4A 4OFDA 4JHWH 4LSVL 1OVZA 1J87A 4PBOA 1H3WM 2P7TA 4UOW0 5KN5B 3RBGA 1WZLA 5I16A 4M6NH 2H9GB 2CRIA 5D1ZD 2WBWB 3HRPA 5D8JL 5C1MB 4LCWD 4KK5D 5D7JD 1C08B 1PD6A 4TTDC 2R0WH 4X4ME 3GIZH 2XY2A 4M93C 3MROB 1WBXA 1UN1A 1YEDA 3WXVH 4LAJH 5DLMH 2XA8H 5SWZE 3HE6C 3N1MC 1K8DA 2J3SA 1WLDA 5DJZB 3JUZA 4UT6L 3GNML 4HUXA 4X6CA 3VMNA 1BHGA 5JIPA 5HI5C 3PDDA 1UVQA 4LBQA 3MXVL 3AC0A 3TA3C 4IRSC 3IDMB 3CFDB 4DGYL 4GAFB 5I17A 2UWEB 5CIPA 2ARWA 3NMEA 5SX4I 4OZHA 3IDXH 1FN4B 3VXRE 2RFXA 3O6MH 3EYOB 4XXPA 3HPJB 4PBVC 5B39G 3TO2A 1HNFA 2R9HD 4NQXA 4TRPH 2IAMD 4JO3L 2A77H 4LF3B 4KZDH 1HSBB 1ZT4B 2JK5B 4X9BA 3BAEL 1AXTH 5E6ZA 5IJKC 1IOAA 2GSGB 3SISA 4AEIH 4BUHA 4YAQA 3MJ8A 4BM8A 5B4MC 4L4VA 3RSJA 3SDYH 3KPSB 5E9DB 5IB1B 3ALPA 4O00A 4UW5A 4P2RD 1CFNA 3G5ZB 2R0WL 2HVJA 3L6FB 1T2JA 3ETBF 2YRPA 3C09B 3K4ZA 3M8OL 3ARDD 1NCBL 3SDDB 3V8OA 1AE6L 2IADA 2KDGA 2PO6D 3CSYB 4Y5VA 2VLRA 3HZVB 2IBBA 2VLLB 1U8QB 5BJTB 1G7PA 3T2NL 2CJUL 2Y72A 1TCRA 4YZFF 3D48R 1U93A 2X4QB 1K8IB 3KNBB 4QCIA 4JGUA 3GSWA 2LU4A 4FQJL 1E6JH 3AZZA 3PVEA 1PVHA 1CFSA 3MNWA 5KS9A 1U3HC 5IFJA 4JCKA 3RZCB 4HF5H 3H6JA 3LSOB 1GPOL 3H9ZA 4QRSB 1A1NB 1XCQB 2EXKA 1K3ZA 1W0YT 5FO7A 2DIJA 2ZHKA 5DUXA 4LIQH 3SKJH 1W6OB 1Z6JT 1LEDA 1IGIL 3PL6A 3MV11 1GC1C 2IEPA 1TNNA 2DI9A 3KHOA 1MSPA 1BREA 5IEKA 3V6OC 1IGJB 3ZSLA 3CSPA 5F7NC 1GAFH 4FP8L 3HB3C 5HVFB 3MPCA 5D7LD 2Y25A 3ARPA 4YXKL 1EGJL 1UAIA 3RVTD 3FUOA 1IBGL 1LP9F 4PJIB 2EXWD 3DIFB 4LASH 1L7TL 3EJJX 1ORQB 2D6PA 1S7TB 1JV5A 4U1HB 5FDYA 3KYKH 4O9HH 1MJJB 3HLAB 3U0WH 3BXNA 2BNRB 4I0CC 1W0VA 2HN7B 2CIKA 2C4FU 3RNQA 3ARGC 4YDVB 2D31B 2E9BA 4NZRH 2FO4B 2XXMB 4N8VB 3B2VH 2NW2B 4P57A 4FXGB 1J0YA 2E7MA 1LHUA 3MRHB 2AJXL 3HI1B 1S7WA 4WFEE 5F72S 4OQTH 3AY4C 3PWJB 1SHMA 4ZFFA 3OBTA 2Z8VC 3GSOA 4MCZB 4CU7A 4UDUB 5ACLA 3EYVB 4N8VG 2CDGA 4XVUC 1QLFB 3G08B 4D0DA 5JHDB 5DS8A 5IEHA 2OMBA 5BVJB 4KJYB 1MI5E 3TO4B 3SCMD 1UXSB 2O5YH 1JTTA 2GK0B 2NZ9C 3T3MF 4HBQA 1QUNA 3USUA 4HX1A 3JTTB 3V2AR 1MCOL 5EU3B 3FQWA 4PD4K 4F7CA 5IJKA 4NKDB 1IAMA 4J1UA 1KXTB 4M43H 4HPYL 4OJFL 3TPUB 2GN7A 4U7KA 2YMXH 3ARVA 1A6TA 1FCGA 1HH9B 4O2CA 3Q6FB 3HMYA 1OAZL 3O2VL 4UIMA 5FAAA 2VQTA 3TZVB 5FO8B 1S7UB 1RZIB 4XWOC 2AEWA 3PWUA 1YJDL 1G6RH 3TIEB 1MI5D 4JM2B 5JO5B 1AD0A 2Y5EA 1BVKA 1U0AA 4N8VA 5F8RC 3G6JE 3AYAA 3PGDB 1T6VN 2KH2B 3LRGA 1ZXQA 2QSQA 4M4PA 2EE6A 1LK2B 1AGEB 1AGBB 4JRXD 3VWJD 1UEMA 4PJ7E 4MVBD 5IQ7H 5T55A 4UV4H 1Q0XL 3C5JA 4XAWH 2OL3B 3K74B 1O5DT 3WD5H 1W2KT 2VITB 1CDCA 4LMQE 3O3AA 3V5KA 5CD5D 4LRIC 1I8KB 2FDBP 5TDNA 1ZVSA 5ADOH 2NZIA 4XMKL 5E2JA 3TF7C 4JFPA 4O5LL 1ORSA 1RZ8A 3HFML 4FQLH 5JDJA 3O8XC 3Q1SH 3F7PC 4WUUD 3RG0A 1KC5H 3DX8A 4X8JB 4JG0H 2DQDL 4OZGE 1UM5H 3IDYB 3I4IA 1F4YH 3SDXE 5IFJB 2LABA 3EJZD 2ICCA 1QP1A 1NCDH 1RULH 1JZ6A 5HI3C 2BCKA 12E8L 4IRZL 4WEUD 2X4RA 1UQSA 2W9LA 2A6IB 4MJIB 2VIRA 3SGEH 4P48A 4MAYD 5JOFB 4LOUC 2NY1D 3QDJE 4LIQE 5IV2A 4OLXL 5BJTA 4NQSA 1U95A 3P11L 3QXAB 3UXFA 5ICZB 5IMOA 5EU7C 4XXAA 5SV3A 4G43B 1LHNA 1WZ1L 4PJCF 3MRRA 3MCKB 4QKXB 2J8OA 3NIFF 5HGBB 3RY4A 3LKSB 1H15B 4LSQH 4TULH 4JB9L 2ZUXA 4GMSL 3R4UA 1CFBA 3MUY1 5D7IB 4XP4L 5ITFB 2B5IC 4TRPL 4LF3A 5KXDA 4A2LA 4HW6A 2AERT 4OI8A 2EH7L 5EBGA 4LCCB 4L8QA 4LCIH 1WTLA 3O6ML 4R2GC 3L3IB 1HXMB 3P3YA 4M3KB 2IPKB 1R3KA 3BDYL 1F3JB 5TGBA 3SPVB 5F6IB 1AKJD 4ZFGL 4GQPH 4ODUA 5FM8A 5IP4A 4FN0A 1MVEA 1R3IL 3CFKA 5IVXB 2X7LB 4YHNA 3ES6A 3SDAB 2OLDA 1IS5A 5AZ2L 3RWFA 5IVZA 2WBJD 3DVNA 3MRBB 2OJZL 3OGCB 4U1JA 2VL5B 4HS8H 3WNNA 4WWKD 2YUXA 4M9PA 3NA4A 5D70H 1MFAL 2WM0A 1OQXA 5DJ2A 1CK0H 5E5UB 5FGCE 3V6BR 2YD9A 4JPWL 4YR6B 1G9EA 3O8XA 5I8CB 1U58A 1AGFA 1YEJH 3VD7A 1AQKH 4GMTL 2VXTH 2EIEA 2R69L 3DXAD 5C0CB 5EIQA 4NHUB 4ATEA 3VXQA 5GGRA 3P4LA 1YEFL 4MB5A 5JOEA 2GAZA 1FH5H 2HKFL 3GUTA 5JIKA 3MBXL 2MQ0A 2GEEA 1MFDH 2R0ZH 2W65B 5F9TA 3BGMA 4WU5A 2HTLC 1GIGL 4OCSL 4NQDB 1CD1A 1RJLB 5I8OL 4HUVB 1CGWA 3MRFB 2B7YA 2VYRE 2XNAA 4HGKC 3DI3B 4D2NA 3NZ8A 3BAEH 1CGVA 3FRPA 4OCYH 2DI8A 2EEAA 3GMQA 4HC1L 4OFIA 5C6WH 1TDQA 1UCBL 3VCLA 1IKNC 4HIHA 4AK1A 2DYPA 4HKBB 4XPTL 4GW1B 3Q9OA 1J9CT 4UILH 4FQHA 3VWJC 3KPRA 3MV8D 3MRKA 4TZDA 3FLRA 5ADPL 5IB4B 1S0CA 5CB7A 5DRZA 1SBFA 2VABA 3C6LC 2B1HL 1WBLA 2P2KA 3VRIA 1IQDB 1T5WB 3O81A 5E8OA 3J7HA 3VJ6B 5KVEL 4J4PA 2BSSB 2BOBB 4ODWB 1QNYA 4S1SL 1I4FB 2AVGA 3RUGE 4X7EC 4PJEF 5L73A 3D5OF 3LQMA 3V7MA 5DEGA 1JF5A 4Y8DC 3DOSA 2ZBJA 1I8MB 3FLPA 5FUCE 2R9HC 3REWA 3PWLB 2C3WA 5EYXA 2BNRD 4YHYB 4UBDC 3RP1A 4JG0L 4PJAB 1KGCE 4KJWC 4XBLA 1GYAA 2ATKA 5JZ7C 4IDJL 4TTGA 2NXZD 3BUYA 3R06A 3FFDB 3RTQA 4E41D 1MNUH 4OZIE 1ACZA 2B4CC 2DUOA 5JDSB 3VRLF 3BT2L 2WBKA 3U6RA 4KKBC 2ZCHL 1X5JA 4LEXH 2ZAAA 3NFSL 1YNLH 1CD0A 4OBRA 1KIPA 3U0TB 4GAGL 1YQVH 4LCUB 1K6QH 3SY0B 3K0WA 3GBMH 1N64H 2ICES 1RSFA 4ZOCA 2A6WA 4KJWD 1MJ8L 3CUPA 3QFJB 4ZAKC 2MOVA 3SDDC 1GZWB 3LHPL 1AY1H 1W72A 2FR4A 4EKXA 3WMSA 5F88B 3VRJB 3UTTA 5ADOL 5DZEA 3J8F7 4UB0L 5D7LB 4YW4A 2FEEL 2J88L 3SKOB 4RAVB 4JZJC 4JY5H 1ZT1B 1QHPA 3MRMB 1P5VA 3SE9L 5LG1A 3S88H 4XXDB 2VN4A 1KN4L 4F58L 3VXMB 1DQQB 3HR5B 1H0DA 1U3HB 2AQ2A 2LVEA 4NKIL 1IGIH 5IHBA 2P5WB 4PJHF 3U36B 4E5XA 1GNZA 1UZ6E 4PS4L 4DZ8B 3B01A 4TNWF 4DQOH 1Q56A 4DAGL 3OKEB 1A6AA 1P6FA 4NM8H 2GT9B 4QHLA 5JTWA 5T1LD 1J5OL 1IGCL 2BXZA 5I76B 1ZKAA 1OTTD 5HI5D 1G9AA 4PJBA 1A6WL 3QEHA 2OCFD 1F00I 1IAIH 3BWAB 4CU8A 3WE6A 1FFNB 3G5XB 4BJLA 5KG9B 4YHOH 5GSVB 5FK9A 5L6YL 5C7XH 3GJFA 1FX5A 1M6OB 1ACYL 4CGTA 2DVDA 1I8LA 4LSSL 1JHTB 2Y7QA 4UMGA 1RZKC 2G4IA 3PHQB 4EN3B 4ZUTA 5GGTL 3VFNA 1KB5L 3KPTA 4NWUH 2EEDA 4U7SA 4LPWA 4I13B 5TF1H 3O4OC 3QCTL 3POWA 3PWLA 2J4WH 4OUOA 3QEUA 4NN7C 3FAXA 2PHXA 1MQ8A 2YPKB 2DD8H 3QXDA 3C60C 1FDLL 2EDEA 4FXKA 3HCVA 5DA4A 2IH1B 4HXAL 5GS3A 1HHJB 5C6PB 2VLKD 4ZQKA 3PWPA 4S1DC 5EUOF 4QT5A 4OD1H 3ZKXC 3QEGL 3DURA 3EYSH 4X6DA 5DEFA 2CO7B 2ZCKH 2G5BA 5SWQA 4DGYH 2OSLB 4MNGA 3LN4B 1LULA 2LTQC 4P23B 3L2YA 2CJUH 4P9HC 1FNYA 2X1QA 3THMH 5MEOA 2F54E 4ZNEE 1QHOA 1YDPB 3CX5J 2VDMH 1WBZA 4K8RC 4DGIL 1BOGB 1OT1A 3V95A 4HIEB 3IFLL 4MA7H 2CK0L 3RL2A 4Z7UF 4HJJH 5T1MB 2XQYK 5GGVH 4DN3L 1VALA 3F5WB 1HSAA 4HK3J 3U46A 2BSTB 4XI5C 3WYRA 4DFIA 4NQDA 1UJ3B 3IB4A 3UDWA 1FHGA 4GXLA 3FT2A 3T08A 3OKNA 2XZQL 2HMID 4E0RB 2VLKE 1F97A 2P8LA 3ZKMC 3CU1A 1DQDH 4O58H 3QPQD 4KROB 3QUKA 4DW2H 4EXPX 3QQ4B 4GRWH 4JG1L 2BVEA 2BVOA 4KI1A 2AI0L 4MNHA 2AK4D 4HMCA 1JN6B 1A7PH 2YZ1A 3OZ9H 4BH7A 4PJFB 4F2MA 5EU6E 1OW0A 2JKBA 3HNVL 2OS7A 2VDPH 1NLSA 3AXDA 3Q6GL 2X6MA 3I02B 4HKJB 5C0EB 3O8XB 5BQ7A 3M8OH 1ZHBA 3ZMRA 2IFFH 1JWUA 1BQUA 4YFLI 2IAMA 1QFWI 3VDCA 3I6LD 3AM8A 3TIDA 2WJSA 3SE8L 3PJSA 5MHSE 1FL3A 3IKKA 4V1DE 2A3WA 1CJPA 1OF2A 4AL8L 4HSQA 4TSAL 2A70A 1IC4L 1LEKA 5CINH 5JNYA 1B0GA 1GCFA 1QOOA 4DFHA 2GTZB 3QFDB 3WDIA 3CDGA 2Y36H 4K7PH 2VTFA 4ODUB 1G9NH 3K4DA 4HS3B 4MA8H 4OLYL 5JW4N 4ZUSB 4M93B 1DBML 4XP9L 2CWMA 2VLRD 3ARQA 3CLEL 2XWJB 5I66A 2DBLH 1AKJB 4PTUA 3QG7L 1NFDA 1EFQA 7CGTA 3NVQA 2FYYB 1U92B 3EGSA 5KXBA 3HMXL 5HYIA 2CK2A 4UAOB 5I1JH 5J8OA 1FAIL 5J9PB 2DU0A 2BOCA 4HUWB 2ZZJA 4F8QA 5GS0L 2XN9D 3P9MB 3GNMH 4BZ2H 3TA3B 5IBLD 3MCKA 4RIRA 4Z7OF 3CCHA 3SOBL 2CY6A 2BVUA 3F62A 3CDCA 1A0QL 2DQEL 4ZUVA 5IMOB 5FV1L 1FFPA 5I71C 3VFWB 4Z9KB 3ALXA 3ULVF 4BFEA 1CPMA 3OYWA 5HVHC 1QSED 5DJDA 5KAQG 1I3GL 1N8ZB 4NRZB 4JZNB 4PG2C 5FDWA 3MMEB 3QI9B 4MJIA 1CGXA 3IFOB 4CVUA 4YHMH 3IAPA 4HULB 3T0WA 2BK8A 5C0RL 3UP1A 2SBAA 2VZVA 3OAZH 3IJHB 5L88L 3O6LL 1H3XA 3N0PB 4PY8J 3INUH 2X4SA 5BRZD 5CSZB 2BMKA 2EH7H 3QZWG 3CMOH 5CAYB 3QAZB 3QUMH 1ORSB 5CSZA 2VDLH 4CADB 3TBVB 4Q6IB 1MCFA 3S4SB 4HJ0D 1W8OA 1BAFH 3KQRA 3QZWB 3QDJD 4JPKL 1A8DA 3HG1D 5I8KH 1NKRA 3JVGA 4M7KL 2IBGA 2EIDA 5D2LA 5DSCB 1ES0A 2C4FT 5GS0D 5FA3B 3MGTB 4NNPL 3V79C 1T89C 2P42B 4JFYA 1ZEAH 1BVKB 1C1EH 4OLEA 5HHXH 1NBVH 5JO5A 4X9FA 2NX5E 4N0UB 5IMMB 4Z76A 1DQTA 4LDLB 3QPQC 4WUUE 3TT1L 1XGUA 2XPGA 3H7LA 3BI9X 1SLAA 3TA3A 5JQ6H 1C5DA 1F11A 2C7UA 1I7UA 2YXSA 3IRPX 5BVPL 5D1QD 1ENQA 1CDHA 2GIYA 5HHOD 2OTWB 3WO4B 4F80A 3QIUC 2PHFA 4YE4H 5JUEH 2NMOA 4OLUH 3FRUB 5E08L 3G5YB 2LALA 3FQRB 2D7TH 2W59A 4AJ0A 5TE6L 4X4YB 5HJ3B 3EO9L 5I1KH 1IC7H 4AEFA 5DC0A 3ZYJA 1EAPA 3U82B 5I66B 4LSUL 2V5RA 3D39A 4Y5XB 5CHNB 3IDNB 4S0SD 5GZCA 3U9PL 4M7ZB 2HJKA 1XF5A 4WHYG 3ULVC 4MQ7B 2O26U 4GQ9L 3FCTA 1EFXA 4DKFH 4O4YL 5JNYB 3VXSD 3HI1A 4UQ2A 5GZEA 1X7QA 3OKDB 4TNVK 1GZCA 1YMHA 3MOBH 3I6KA 2DTSA 4IRJB 5KVGH 3GALA 3PVOA 3G6JB 4AMKH 4L4JA 2JELL 1MFEL 2CRZA 5BQ7B 1N26A 1FVCA 4HG4J 3DTXA 3AREA 1JPFB 1HILA 3L7FA 3P9WB 5EU6B 1T1XB 1MJJA 4F2MB 5IT2L 2EYSB 1R3HB 1EJOL 1RZKL 2VE6B 3ULVD 2HWZH 1HXYA 3AU1B 4URTB 1ONQA 4H5SA 5I1LB 1KRIA 4FP8H 3HAEA 1I1RA 4PJ8C 2YEZB 3NA9L 2VLKB 1KB5B 1TZHA 1D5XB 4RQQA 4YHIA 3ULVE 4KJQD 5ESVB 5H2BA 2A9MH 4JO1H 4X6EB 5GZOC 3EOAA 5E2TH 2XKSA 2FO1A 1XCQA 1HSAB 5T3ZL 3ZE2F 5J6GB 1ULDA 4M8QA 1MOEA 4HH9B 5GRYA 1L0QA 3QXWA 1T04A 4HWEH 4U1MB 3BE1H 1I1FB 1HQLA 1Q9LA 4Z7UB 1IC4H 3MJ7A 2F54B 4N8CL 4JO3H 1KSRA 5CP7B 1ZVHA 3HN3A 5IQ9B 3MXWH 2OJZH 1S0FA 4OQTL 4XP6L 5EU5A 2B7DT 5F1KC 1FVEA 5C07B 1ZANH 1JGUL 5BCAA 3GIVB 1VADB 3QXUA 4LCYB 3FQNB 1E0OB 2AGSA 4NCDA 2MTPA 4Z7WA 3QCWA 2YD5A 4GALA 4HWZA 4L8SC 4LHUG 3EYSL 4L3CB 4Y4HB 3G5ZA 3CFBA 1RUAH 2N56A 4FZEH 4Y20A 3KPSA 5E9DA 3P0YL 5KSBB 3WG2A 3MUGB 2CIIB 1AXKA 3QXDB 3U2SA 4LHUB 3QSKB 2XFXA 2B2XL 3GSNH 4C59B 3MEPA 1WW7A 1R5VB 1UWGL 1X5AA 3ZZ1A 1F6LL 3O3UN 4KRPD 2YXMA 3DUHA 3UJTH 4NRYA 5IJVB 1RURL 4APQC 35C8L 1ULFA 3V6FB 3E0GA 3DO7B 3NCCB 3DVFA 1GGCH 4U1SA 1JXNA 2JD4A 3W2DH 2EYTB 4N0YL 4YW5A 2WINB 1T83A 3P11H 1LE5A 3VGFA 1CZ8H 1A1OA 2CUIA 1RVFL 3QCVL 3T0EE 5C7XL 2CKBH 2NLJB 4K9EL 3ARFA 1A7PL 3VGAB 2PELA 4HCRL 2J8UB 3LZFL 1RVFH 2NY4C 2P8PB 3QCVH 4YDJA 2RAMA 1RY7B 2JKXA 3R4SA 3MXWL 2FGZA 1QO3B 5HI3D 4GA9A 1X5GA 2GT9A 5CBAB 5CP3H 4RBPH 5C9JB 2YD6A 2NZ9A 3MROA 3LKNB 4XJUA 3ZKXB 5FXCH 4KDWA 1G9BA 2FJFA 2C9AA 5F6IC 4HUKB 3IKWA 3ZYPA 5FRAA 1EHLH 4N0CC 3D4KA 1QLEL 4G9FD 3VDAA 5I0ZA 1EJ6A 1Z9SA 1CR9L 5DRNA 2UV3A 3SDAC 4R0LA 4HGWA 3TFKD 2ZKNA 5DK2B 1CICC 2CDFA 5KN5A 1ZT1A 3KPRD 3MV8A 3RWCB 2Z35B 5T5NF 3GGWB 1NGPL 1P7KA 3R8BB 1IGML 4OSUH 3GSQB 2DQJH 4FFZH 2NY4D 1BP3B 3EYUH 4UB0H 3VRJA 4LSPH 5CS7A 4ELKB 5J0BA 3QWOB 1YY9D 3VXOB 3MV9B 2CMRH 4YX2L 5L2JA 1I3UA 4PRAA 2UWEE 1H30A 3B83A 3QFJA 4Q1RA 3ZXFA 2YV8A 4RNRA 1VFAB 1IGTB 3OB0H 4YLZA 2NXZB 3SGJC 5HHNA 4MNGE 1QO3A 1A02N 3C5SB 5A2JH 5CFHA 1NGYB 1A6WH 3MJ9A 4YBQC 1KLUA 2Y5TA 3SE3C 3C6SA 1PY9A 3AYEA 1QRNB 1LDPH 3NAAL 4Y4FC 1LO4H 3QNYB 2DQTH 3Q5YA 4MLIA 5SWZB 4AQ1B 3WFEH 1VGEH 4XC1H 5TE4L 4PUBH 4P2CG 1CFVL 1QSFB 4OLZH 1A3LH 2EYRB 5TE7H 3QR2A 1UCTA 1UKQA 1ZA3B 1SYSB 1BFSA 2GQHA 3V0AB 3UBXB 5TQ0H 4H88H 2XFXB 5C09D 1JHKL 4MCYA 5DI8B 3N7MA 1S7SA 4MDIA 5DWUL 3CFIC 2EC8A 3T09A 4ODTH 3OKKA 5I6XC 1XGTA 3JZ7A 3QEQE 5EDXA 3S7GA 1MHEB 3UBXG 2P45B 2ZWLT 3V4UL 3VRIB 2AJSH 1MIMH 2APVA 4JM4L 1JZ4A 3EJZC 3VUOA 1OP9A 3C5ZC 2VB5A 4NKIH 3D85D 4XJ9A 2ZUTA 3L3DA 1VADA 3B9DA 1AFVH 3VXTA 1AIFA 1SACA 1FVEB 5DZFA 4LRNH 3H0TB 1K4DA 3GHBH 3NPSC 4NZTL 5E03A 4AIXA 1U8KA 4QGYA 5GS1B 2HTKD 1A7NH 4WHTB 1MLBA 2UVEA 4OIIH 4LP4A 5I75C 2W07A 1KDKA 5GQBA 3MRQB 5ALCL 5F96H 3RRDA 1WQVT 1HQ4A 1T20A 3ZDXF 3V0WL 3D3VD 5D7JB 4M01A 5DR5L 1QQDA 1KV3A 4H26A 2MWCA 3TWCL 2WLQA 3BH9A 1MJ8H 3QUZC 5KSAD 3M1HA 5JOXA 1D5XA 4G8GA 5KXEA 2ICWA 3MR9A 1MS4A 5CZKA 1YYLH 2DM2A 4I3RH 2BHZA 2XRAH 1CDUA 5DUVA 3BGFC 5IM7B 4AG4L 3QLQA 5IVOA 1C5BL 3ARBD 4MAYA 3ULUF 1KJVA 1XF1A 4FG6C 4BMBA 2QL1A 4HUUA 3ARZA 2R1DA 5L7XH 5F9OL 2AXJA 4LLAA 3WDVA 1KTLB 2WW8A 3OF6D 3S96A 2QADD 1TTFA 3KXFA 4ZAKB 1U58B 3PL6D 3QAZC 1RJCA 1UMZA 4NWTH 3GFUA 3SDCB 1R0AL 4YK4C 1KPRA 1GZQA 3GI9H 1JK8B 2VY0A 2VLJA 3MRLB 4GW4A 5HHOB 4FNLH 1N5AA 2ZG1A 4V2CB 2WT0A 2NY3B 3OAUL 4FABL 1AO7B 2F8VA 5KSUA 5IVXE 1YMME 1YN7B 2FZ3B 2HJKB 3ARBC 4EIGB 3P40A 4IHOA 3HMXH 4XNXL 4R8WL 1S78C 3D39B 4LSDA 4FZEL 3L3IA 2XQYG 1IEAA 1KCVH 2DBLL 2ZGUA 4ELMF 2FHFA 3WUDA 5CEZL 4MXVE 2DQJL 5L2KA 3X14A 5CSGA 5AYUL 2O5XH 2OXHA 4BZYA 1BKZA 3F7QA 3PDOB 4M7JL 5JW5B 3BOPA 2R4SL 5D7IE 2GSIA 5FB8B 1Q8VA 1MH5A 3E6HB 4LVNC 4I3SL 1ZHNB 3IXTA 3BPOB 1S1AA 4FPKA 1INEL 3BQUD 1A4KA 3L3JA 3TV3L 5T3ZE 1LK3L 1FGVL 3FZUC 3WS3A 4PGZA 4DVRL 4OFPA 5HHOE 1RZJL 1D2SA 5CUSH 3STLB 1OGTB 4XPGH 1M7XA 1A0QH 1NUDA 3DYPA 5EZIL 5EU6D 4Y5XC 1VFUA 4LHUD 4RGMB 4PJCB 4WO4D 3BISA 2CKNA 3NH7L 3QJHB 4G6FB 4BZ2L 5HYJD 5IV2B 1S0BA 3RKDD 3ULSB 3WDXA 1QGLA 3QXTA 3DXAA 2DWEB 3WJLC 1WWCA 2KVZA 4P4KC 1KIQA 5J6HA 4FRWA 1UB6B 1BM3H 3T8XB 2IG2H 1PFCA 2YC1A 2WUBH 1E4KC 1A9BA 4KQ3L 3IDGA 4NSKA 3D18B 3TN0B 4PRDA 5LBSH 3B6SB 4JPVH 3NABH 5F89A 4WZFA 1Q0YH 3CLEH 3HNTH 4RSVA 2VDNH 3QIBA 4YGCA 4OD3H 3H9HA 4DN4L 2VN7A 4Q8LA 4XCFL 1TQCC 4CBPA 1OGAD 4PJ9C 5LGHL 4LLWA 2A73B 5IBUB 4EDXB 4KZDL 5DD6A 5I2IB 1CG9A 2FLBT 2OUJA 4PRPB 2CUHA 5J12B 2Y06H 4RZCA 1FG2B 2JLLA 1N8ZA 4XMLH 2ZGSA 3MOAH 5CILH 3LAFA 4BLJA 1QNWA 4XNYL 5F1IB 3SE4C 1IM3B 4XTRD 4PGEA 1AD0B 4P9HL 1TVBB 1VACA 2V2XA 3TO4D 3TNNB 3QEQB 3P4MB 2XG5A 3MNVB 2I60L 5A2KH 3ZSSA 2D9QB 5I1KL 4OB5H 1FO0H 3GMPB 4XP4H 3DRQA 4KRPB 5DMIH 4MS8D 4EI5A 1RULL 2H2PD 4V2BA 4FABH 1E4XH 3QXVA 2J4WL 2DOCA 2VC2H 3PDOA 4U6HA 1S5HA 4PJEA 1UA6L 3UTSD 2YY1A 4MX7B 4L8SB 2AGJL 4LEOB 3S5LB 4XP1L 4HWBL 1CFVH 4OLZL 2XI9A 4XMKH 3JTTA 4GBXA 4PY8I 4MXWH 1KN4H 5MI0C 3QPXH 2DWDA 1X4ZA 4P9YA 3WHTA 3RX8A 2J88H 4J6RH 1RZ7L 3QHZL 4D9RE 4X6CE 5DRXA 2QSCH 3KVQA 5DRXB 2VJXA 5E6IB 1N5YL 2W08A 2YPLE 5F6HI 4OCWL 4POUB 1BF8A 4QRQA 1A3QA 2NX5D 5DD1H 3RZCD 2NQCA 4APQB 2VLJB 4JRXE 4TYSA 5MEQA 4WV1A 2PYEB 2ZSWA 4PGBB 1N1TA 2G9HA 3LEYH 4BSJA 5JZ7D 5BXFA 4WU7A 1MCDA 1L9MA 4YO0A 4PYHA 5KSVB 4J3TA 2ENRA 2X1WL 3HLAA 1S5HB 4PJEB 3VI4E 5D7KE 4UAOC 1I7RA 1ORQA 1LJ7A 3O6KL 1DVFB 1EUUA 1XEDA 2OI9C 3QCTH 3QQ4A 1FFOB 5EORL 2CO6B 5ID1A 4B41A 4HMDA 4ONFH 4ZTOL 1UC6A 3QFJD 4G8GB 4MWFA 4LGSB 1CBVH 1LTEA 4PUBL 2JCCB 1DP0A 4IRSB 4NM4H 1N7MH 5IHUL 4P5MA 1KPVB 4K1ZA 5I71B 1TVBA 1NGXB 4ODBD 5CNAA 1HZHL 5T1MA 4XCNA 3HZYA 3MNWB 1F5WA 3EDJA 4NO5A 5D5MB 4XNMB 3BWUC 5B3NA 1JZ3A 4YHZH 5HGDB 1K8IA 1GICA 4QXUL 2A83B 5EUKA 3H0TA 4GKNB 3HZKB 1S9WB 4KTYA 4RGOH 3T0EB 1KB9K 4PBWD 5D5ME 2VLLA 2G5BB 4IDLA 2ZUWA 4Y5VB 4E41E 5CEXA 1MF2H 1GRWA 2HVJB 1JN2P 1LODA 2XKUA 4YXLL 1B2WH 1SVZA 1JGLL 5BMFL 4Q6IC 5GGSA 1YJDC 2O5YL 3H9SD 3U4BL 4MDIB 2E6PA 5GS2D 4Z7OE 3B00A 5FYKU 3VH8G 5IOPB 1LO4L 4M5ZL 1MS9A 1T2XA 2AW2A 2F53A 4RAHA 3QEUB 4LBLA 1LU1A 1XGRB 4ALAH 4TOYH 1P7QD 4OD3L 1A6PA 4DWHA 2MCPH 4M8VA 2G5RA 1HOCB 2I9LB 2ZJSH 3FOLA 4Y1XA 1R3LA 1MS3A 2ZGKA 3OHXA 1MRFL 2R2CA 3L3OB 5FO9B 4JRXB 2VLJE 4R4BB 3GJFB 4QWWD 2A7AA 5F71A 4KK9D 4GXUM 1CL7H 5CBEB 3IGAB 2DMBA 3WO4C 3LV3A 3C6SB 1EVTC 4Y1AE 1ZHNA 3IXTB 4X6CB 2VZSA 3QEHB 4DZBB 3S36H 1UCBH 4GG8A 3DSFL 2BVQA 5I76A 5HHNB 1J8HB 4OZGF 1BZ9A 5FYKL 3X14B 3C8KB 2ZNXA 3WLBB 2YA2A 4WY7H 4HWBH 1KJRA 1WEJL 4HAFA 3LY6A 4PRAB 3OR6A 5GS0C 3WKMH 3GKWH 2GCYB 3ZKND 1TVDA 1IAKB 4AENB 5JW4R 2HVKA 4N0RA 4XWGL 3RJQB 3UTZA 4FQJH 2P47B 3U30C 5HVGB 1EIBA 4AIZB 1W0OA 3LCYA 5GSRB 2P7TB 3ILQC 1A1MB 1NANH 3N9GL 4ISVB 3RVWC 3AXEA 1EO8H 1ZM1A 5HHOA 3DX6B 4XCCL 4ZAKD 3M2MA 2FHCA 1CFTA 2OMNA 1JK8A 4MD0A 4LCIL 1N59B 1GGTA 4FQ2L 3SDCA 5HHVH 1FNHA 1I9IL 2OQJB 4DTGL 2D6NA 5MENA 3AYCA 3F8UB 3G04A 3FQXB 1VB9A 1R24A 1CESA 1F31A 3HI6L 3SY0A 4LSQL 3GSRB 4GFTB 4OCLC 4DVRH 5KSBF 1FNLA 5CEYB 5KS9F 4NUGH 4P59L 4WW2A 2XOTA 3U4AA 4K2UH 1AF9A 1H3UA 3MW2A 4ZDHB 3GI9L 4G6KL 2ZOKB 1H9VA 4EI6B 4FFVC 1RV6X 1BZ7B 2BQPA 4U1SB 3SDCC 1PZ5A 1XQNA 3LEVH 3T1WA 4JDVA 2ZABA 5HYSG 4K55A 2OBGA 3IU4H 5DA0B 5T1KD 1G0YR 1J1OL 3IRZA 3AB0B 4GRLD 3RU8L 4XJ8A 4I3RL 1OLZA 5BZWB 5DQDL 4AY0A 3V0BB 1FZKB 4G6JH 3FUQA 2NY6B 2CIIA 4C56E 3DGGA 1B3JA 2NX5B 4N0UE 1J5OH 4FOMA 2YK1H 4L8DA 5KVGL 1MHEA 3TJEH 1CXFA 3F7YA 2XWBB 3OKKB 5DHVA 1INQA 3MRIA 4ODSL 43C9B 1LK3H 3IFPA 1E6OH 2CGRL 3WHXA 4OCRL 4PLJC 1FZKA 1J0KA 3CAFA 4JRYE 5DVLA 2DDQL 4RMRA 4WI7A 3LKRB 3P77B 4HJGA 3VXPB 1DUZA 1JYWA 1A22B 3NZ8B 1JPTL 2FL5B 2GJ6A 3PVNA 4F7TA 5EZJA 3K7UA 4NQUA 5JXAH 2E51A 2ZJSL 1PZ5B 5BS0E 4U1GB 1CXLA 1RJLA 4HUVA 3D39E 2PTTB 5CA6A 3VKLA 5E8DL 4K3GA 4I2XE 5ESVA 5H2BB 3CMGA 5E94B 3BKYL 3IJSB 1MUJA 4P4KB 3U9UB 1I8IB 4C56D 4PRHD 2PKDA 4M3JA 4JE4B 1ONQB 4MAYC 4ZSOE 4HK0B 4EQ3A 4YBLB 2MKLC 4LARL 2FBJL 4PRNA 2DB8A 3BOVA 4Y5YA 3TN0C 3QQ9D 3QUYC 3SGJA 4D3CL 1KB5H 1T1XA 1SJEA 1KJ2A 5B39B 2ATPB 1JPFA 3INAA 1FVCB 3GHEH 1SQ2N 1UH4A 5IT6A 1T0MB 4ODXA 3L5WA 5BZDA 2YK1L 3AS2A 4HS6A 4G80A 4FPGA 1N0LA 2CLVA 5F9OH 1ULEA 1F90L 4XE9A 3T2TA 1CLOL 1LO3H 4AM0B 1X7QB 4HQQL 4TNVF 3EJYC 1A9EA 3FQUA 4QRTA 4KUCF 5EBLB 3GRWL 2E7LC 1DSFL 5C09A 5I8KL 4RAUB 4RGNE 5J12C 5DK2A 3F58L 1UZ6F 2Q3ZA 1U2HA 3O9WD 5I1JL 5MEPA 1MPAL 1KCSL 4R2GD 4PRHE 5BVPH 2SEBB 1VAMA 1CE6A 5JW4Q 2VAAA 1N1YA 4HKXA 3V0WH 4HHAB 1A3LL 1Y6MR 1A5FL 2BNQA 5I1IL 4O51B 2NXZC 1SBBA 4Z18A 1ZTXH 5AZEL 3WCSA 1QRKA 2AJUL 1YEGH 5TDPB 4LBQD 2BJML 2PCPA 1Q8SA 1MVUA 3QISA 4BZ1L 5AAMA 2NMSA 3WFDH 3EHBC 5DURD 2OP4H 4Y4FB 3LKOA 3T65A 2O61A 5IVNA 2JE8A 4LLQB 4PRBA 5GJSL 3VFGH 3T4YB 1A7QH 1XGUB 1MIML 3M1BA 1P7HL 1JNHA 2YBRA 1R3LB 4LPYA 4MAUL 4KVCL 1G8WA 3DO7A 2PW2B 1DBAL 4D9QE 3OY8A 4NQSB 1J7VR 3L3GA 2I2SA 4K94L 5DSCA 4OCWH 5K59F 4NQEA 5JA9A 5D71H 1D5BA 5E6IC 2BCKB 4N1HB 3AGVA 1QF3A 2XQBH 1G1YA 1QU0A 4HPYH 4NPYA 3PGCB 5KSBA 1QSFE 1IL1B 1LOCA 4XJZA 4YUEH 2BMKB 1T22A 2APFA 2IWGA 3UAJD 1EEYB 4MJ6B 3C5ZB 2V9QA 1RHFA 4OLWH 5E0QA 3ZXLA 2CPCA 4DGIH 3CIQA 4D8PB 1P9MC 1KCUL 1DIWA 2EO9A 1J0HA 5M95B 2A83A 5EUKB 3NPSB 4YC2C 1UXWA 3CZFB 4D0BA 3EFFA 4Z7QE 2YA0A 4YHYC 1B88A 4XNMA 3LS4H 4KJPC 2A6VA 5F9DC 1SBSH 3OJBA 1FLTX 2HJLA 2HFEA 2Z9TA 4XNYH 1VGKA 5D7JC 2DF3A 4WI8A 3KPSD 4OZFA 1CTOA 1II4E 5E9DD 1IQWL 1LD9B 1M4KA 2MQCA 3WFHA 4W6XB 1QPXA 4RQQB 4Y16D 4YHIB 5AG8A 3HG1A 1SEQL 5JPNB 2N4IA 1GBGA 3DX9B 3RL1A 3QQ9C 3QUYD 3TZVA 5FOBB 5H9RA 3PNWB 1HXYB 1FFOA 3AU1A 4K2UL 3SE3A 3Q6FA 2VE6A 1NAMA 5FUOH 2IQ9H 4PJHB 2A38A 3T0EC 3ZO0A 3ALWA 5IW6A 3BZDA 4U6YA 1JGVL 4LIQL 5EU6A 1JYXA 5H94B 1H8OA 3TVMD 2XTLA 1DQML 1X5ZA 3GJFK 4WO4A 3OKOA 2WZPD 5EU3A 2XWJA 1QR4A 5KBNC 4L4TE 2ED9A 2W9DL 4Z7WE 4U1IB 3BP5A 4JFEA 3VFMA 3OKDA 5HY9B 5IEHB 1GYKA 5F1SA 4UI2A 4OLXH 4ELMB 2ADGB 1BWMA 1NC2A 4OFYA 4M3CB 4Z0BL 1OAYL 1NGZA 1EO8L 4BELD 1B0GB 1D6EA 2AI0H 2KZWA 3C8HA 4F8TA 2E8ZA 3GJEB 4Y1YA 2A3XA 2ZCKL 1UEYA 3T0DA 4UDTA 4Q27A 2WSVA 4ELME 3UYRL 1NC4B 1TZIA 5CWSB 4ZPVA 2ZGOA 1GGUA 1QBBA 2ZCLL 1CS6A 1QBLH 2ZGLA 1NXD1 1GGCL 1PG7X 2F15A 1ZHBB 4L4TB 1G7YA 1ITBB 2D31A 1IKFH 3VXRA 4IOIA 6FABL 4MNQD 2FD6L 3KYAA 4BH7B 1CBVL 4GAJL 1JN6A 3LIZH 1J12A 4LVNB 3WIHH 3NBNA 4KZEL 3NV3A 3EZ8A 2BVOB 2A77L 4JFFD 4XC3H 3ARFC 3K2UH 2R4SH 1J0JA 3GM0A 5DO2C 1MI5A 1RIHL 1F11B 1B0RB 1C7TA 3HG1B 5JPNA 5D2NB 8CGTA 5KSBE 4HBCH 3UO1L 4D9RD 1I9EA 4R9BA 3JUYA 4QRUB 5LQBL 1VACB 2V2XB 3V7AG 1MAKA 1CQKA 4YH6A 3T1FB 2FEDD 5JORA 2H6PA 5K33A 4EN3C 4YM0A 2HT4D 3EOBA 4TVSa 3KR3L 5E08H 4OGAC 5D2LB 3GNEA 1KCUH 3R8QA 1FYUA 4NNXB 4ZTPL 3QZWA 1H3VA 5D1QB 1N1SA 1GVIA 1WUVA 3ROLA 2VLRB 5C71A 2AXHA 2DKUA 4F37F 1CVRA 3UPCA 3L6FA 2FH8A 2Z31C 5T1KB 4BFIA 4OZIB 4WGWB 3ARRA 1Y6NR 2D03L 4GRLA 5C0BE 1B2WL 1FP5A 3CH1A 3LKPA 5DMGD 4WNQB 1OQ1A 4L29A 3GK8L 2EXHA 4YAQB 3P30L 4QXWA 2VZTA 3DLQR 5EORH 1Y0LA 5JHDD 1A14H 2LTQB 2XRAL 1NCUA 1TENA 5FKAB 5B22A 5CD5C 5JUEL 4YE4L 1GC1L 4HIJA 3ZXKA 4NCC2 2LFGA 4M5YH 2PXYC 4JQVA 3PGFH 3TWCH 3UJJH 5DJDB 3RFZC 5DJXB 5JQ6L 2R2EB 4KVCH 3OQ3B 4MD4A 5ALCH 1XIWC 1ERNA 4PP2A 5DQ9A 5CJQH 1G86A 2N7BA 1JNHB 1AXSB 1BFOB 1YO8A 1WCQA 4Z0XB 4KFZC 2EDNA 4U31A 4QOKB 5IK3A 3GBML 5ADPH 4NM4L 1MHHA 2RJMA 3RDTB 2HFFB 4KRPC 3ZTNH 5I9QC 4NHCL 1IFHH 4YBHA 3M3CA 3S34H 4FTVB 1MJ7L 3QDHA 2WLZA 3EGSB 3K4AA 1F4WL 3RRQA 4BUGA 4OCNC 1AKJA 3O4LB 1UM6H 1YEDB 5H37H 5LJYH 4XTMA 5B8CC 2VAJA 4EQ2A 3E6FA 1XIWD 4I9WD 1MRCH 2VDNL 1P4LA 2X42A 3O41A 4PJDB 4W81A 4BK5A 3TVMC 4IHOB 3JV6A 1WWWX 2FZ3A 1DBKH 2ZMNA 4G8IA 5DK3A 1SVCP 4M4RA 1F02I 1CN1A 4Y0GA 4C4KO 3AJYA 3MLYH 3FN0L 5F7DB 4M7LL 2A6DA 3IVKB 1ADQH 2NR6C 4JCLA 3TIDB 4RMSA 1W72B 4WUUB 2Q76B 2GY5A 3MJ6A 4G80B 2ADFH 4PJ7F 2FR4B 4R9CA 2Q8BH 1T0MA 4U1NA 5GGSY 4U1GC 3TNMA 4G42B 2DQTL 4WJ5B 2C5DA 4X6DE 3EOYG 4O02H 2A6KA 1CGYA 4NQVA 4RMTA 3KLHC 1DVFC 4PTTA 2VZUA 3DI2B 3GDBA 1S7QB 4MAYB 4S2SA 4XXCA 4HK0A 1KIPB 3WFBH 5BOPA 2NY1B 4FMKA 4KKLD 4ORGB 3QUYB 4KXZI 5DUBB 3BN3B 4U6VL 4I2XB 3ZT6A 1ZLSL 3QUML 4PGDB 4TQEH 1NJ9A 4KVNH 5AUMA 3MBEC 1IQWH 5D72L 3L3HB 5GRUH 3ZLQC 4X6BB 1QR1A 1KT2B 5IW1B 1L9NA 1MLBB 5HVHB 4WHTA 2AS5M 4XVUD 3V5HA 1J8KA 3MPPG 2MCG1 5IGXH 4D0CA 3REWB 3HZMA 2D6LX 3ASIA 2A71A 4CJ1A 3BIBX 4LPXA 5DC9B 4R7DB 4ZUWB 4Z8FL 4K3JH 1MR5A 5HGAB 5A16B 2Z31D 1D9KD 4Y5VC 2D3RA 1HHGA 3DURB 4X6DB 4DKAA 4ZO7A 3T0AA 5E4EB 3PWNA 1NKOA 1T5WA 2P34A 4Q8KA 4BFGA 3PWNB 5I8OH 2JIXD 5J3HC 4Y19D 2Y07H 4R9DA 3WDTA 5HGAA 4LLDB 3LQAH 4Z7VE 2A6ZA 4K9EH 5BZWA 5D93C 1BQLL 3V0AA 3HUJF 6CGTA 1TIUA 3RTQD 4E41A 1FYTE 2KPNA 1GGYA 4P46C 3TBWA 3BDYH 2NY7H 1SY6H 1FPTL 2XZAH 2CKBA 2X5PA 3SLIA 2R2BA 2DN7A 3Q1SL 1YC7A 3WFCH 2Q7NA 2QHRH 1EV2E 3KJ6L 4P9WA 1B4JH 4DJMA 3L5XL 1H9WA 4QLRA 1N4XL 1T03H 4XIKA 1V5JA 2X4NA 1RMFH 4KK8C 2H8PB 2EDOA 1PQZA 3MV7B 3MRNA 1IE5A 2DAVA 5FYLL 2AEIT 4PB0H 1PYWB 1N6UA 1P9MA 1WCBA 2B4CL 3OWEA 5EBMB 4Y89A 4X4MA 3CD4A 3C5SA 1WAAE 5EPMB 2IANA 4S1DD 4UU9A 4PV9A 4TNWK 3RX5A 3OMZA 3I75A 1K4CB 3WDUA 3MLVH 1FRGL 2VXSL 1KIUA 3MV9A 3OJVC 1XT5A 1DR9A 4OTXL 5H37G 3BYTA 3VI3F 3V4UH 3W9DB 4AGRA 5I19L 3D87B 1BFVH 3H7BA 4JQIH 4P4RB 1G6RL 4C55A 1J1TA 3HR5A 3DX6A 2A6DB 1AI1H 1H3PH 1MAJA 3PHOA 4PJGA 1MIEH 4DVBB 15C8L 1GZPB 4GG6F 1PAMA 4UT6H 2N7AA 3SKMB 4BPZA 1KYOK 3MV8B 3RWCA 4AGGA 3ECBB 2BSED 3BRGC 1YYLL 4KI5E 4AIZA 4UV7H 4K71C 1T21B 1BVLB 1DLFH 4I0PD 1EZVX 3DV4B 2DJUA 5F88A 5DR5H 3GRWH 3ARDA 2G75B 3RA7L 4DN3H 4IRJC 5C0BB 5IHUH 3FO1B 3MJ9H 1I1YA 1DQJB 2VQ1A 4XPBL 5C6TH 3MFFB 4ZD3H 4LCCA 1G7MB 3DETD 1MJUL 4M02A 3MLSH 1JNNL 1L0YA 1HQRA 4OIAA 5DT1L 3VFSA 5DFTA 1CD8A 2QQQA 4MYEA 4F7PA 1U91B 4LSVH 4YDLB 4OT1L 4ETYA 1JL8A 1CL7L 4EI5C 1Z78A 2Q87A 4AG4H 4BSVA 4PJ8B 4LVHB 1LO0L 5D2LE 4OM0H 4P2OA 1MLCB 5ENWA 5BV7C 4NFBA 2VR4A 5GM0A 2ERFA 5JDSA 4G8FA 3GSVA 4YEEA 5GRZA 5DQ9B 1MRCL 4H0GA 3NIGF 1KXQE 3GEWB 4Q7DA 5C8JA 5DUPL 1NCNA 1A7QL 5T3ZD 3WCRA 5DWUH 3BX7C 2GI7A 4N90D 3BN9C 4UZGA 1RUMH 4LKXA 4JJ5B 4ZNEA 3FZUD 2ZUQC 1F3DH 5ACZB 1NMCB 3MLZH 4XMAA 1R5VA 1MJ7H 5E5MB 1SCSA 1OP3K 4KK5C 1Z9MA 2AP2A 5GRJH 3MUGA 1FJ1A 4KTEH 1HDMB 5J13C 3HUJB 4OCMC 4L3CA 4Y4HA 4BFIB 1AVBA 1SMAA 2DMCA 4HCRA 5IMKB 1MWAB 1CDGA 1KN2H 3OL2A 1AP2B 4BH8B 4JKMA 4UUJA 5EOTB 5T5PA 1CCZA 1TZGL 3MLXH 1I8KA 3ROLB 1UPSA 4JN1H 1V8HA 5CZVH 5AYQA 5ICXA 3WLWD 3UJJL 4PJ5D 3IXAA 3PGFL 4HIHB 4WWKA 3C5JB 3NV4A 1Z9LA 4GUPA 1W6NB 1WLWA 4J2XA 2DLGA 1AJKA 1JUFB 1T04B 4NO5B 3RIFF 2EXYC 3D5OA 3QNXB 4ENEC 4GXVH 4G7VH 3VH8A 5FUZH 4Y4FD 5EOCJ 3GMNB 5ECJE 1PEZA 3KPPA 2COQA 3MRFA 2OL3H 1TLKA 1CD1B 5B38G 1PKQB 4XBGA 3TYGH 3RGVC 5BW7A 5A43C 2IMMA 3FB8A 5FGSA 4WW2F 1DBMH 1RIHH 3A4UA 3VXME 1Z0HA 3UTPE 1RJZA 5EYYA 4PJHE 1VKXB 3IDJA 4UT9H 2Y36L 4K7PL 4P3CH 1LEIA 4KZEH 3VGAC 2ESVA 5ISZE 3BKYH 5K9KA 2VW2A 1QLEH 5EUOE 5HVWA 3VD9A 4GJTB 5EUOA 4ONGL 5HDQH 4LGRB 5DUPH 4X9HA 1RU9H 1ZK9A 3KWWB 1A21A 1GH7A 3D2UD 5CJ5A 2PTUA 4TUOA 1GPOH 3TJHC 3VXRB 1CN4A 2R0LH 2Z31B 1OP5K 4HX1B 2QQNH 1X4YA 1NBZB 3O45B 3CVIH 4GT7A 4FVVA 4F37K 4ZPVB 2V17L 1OCWL 4OZ4B 5F70A 2DYCA 1P7QB 4WTXA 5LCVH 3NV1A 2PO6B 4OZHF 3GSOB 2CGRH 4MCZA 4YW1A 4ZFFB 1H5BB 1NGZB 4Q1PA 5FECA 4XP6H 2KUTA 1EO5A 5JPMA 2Q7YB 2E7TA 4XVSL 3OX8B 5DMJB 1XGYL 2ZA9A 1SEBB 2K3TA 4BK4A 2I9TB 2FWOA 1XIWB 4XPGL 3T1LA 5A3IC 5KSAB 2Q5TA 3O2WL 1HHIA 4NRXB 1C12B 3FQTB 3V5DB 4FQCL 4X4YA 2XZZA 2Q6WB 5IW6B 1E4XL 4PJAE 5DVKA 1S7TA 3RDTC 2XN9A 1ZGLA 4YFDB 2OTWA 4Y7MA 4YM1A 3F6LA 3WUWA 1WW5A 2R0KL 1CDJA 1XGPB 2FSEB 4UTBL 1JRHI 3MRRB 1EBPA 3QG7H 3PL6B 1FV2A 3SDCD 2EDXA 4TSBL 1JNLL 4QXTA 5SV8A 2J12B 1AE6H 2X09A 3LH2L 2W92A 4H1LH 4XHQA 5K9OB 4JFYB 3W2DL 2JJSA 3ILFA 3TVMB 3TCXA 1F9KA 4PIRF 2ES3A 4IM8A 1C7SA 4G5ZL 2HKHH 4J7RA 5I74C 1T0PB 3ESVF 3QDMD 3KYMB 1DANT 4JAMB 1BEYH 4LVEA 5K9QI 3TVMA 3L1OL 4PRIA 5IG7B 1WZ1H 5F1NA 2QBWA 2ZUSA 3TBVA 3NZHL 4X7SL 1ENRA 4R0LC 1AR1C 4PY7B 1UADC 5CEZH 1ULCA 1BJ8A 4YGEA 5F9JA 2AJZA 3HE6B 3TH4T 3WUWB 3D9AL 1WSST 4FOWA 1NGQL 3WIIL 3PGCA 4XNXH 2DQCL 5D1XC 4GSDL 1G6RA 3MA9L 5DD3L 2CTVA 2VITA 1DQDL 5D7SH 4KRLB 1XF3A 4YC2B 1NH6A 3FAWA 3W59A 3O6FD 3D6GA 4BKLA 4XB8A 5AAWA 4L3ED 2ZG2A 3OV6A 3V5DA 4FPFA 5MP6L 2VUYA 3ULSA 3TO2B 4I48A 3BE1L 1JI1A 1NCTA 3NACH 32C2B 1FO0A 1Q9WB 3NCYS 4PJ8D 3PQYA 3VWKB 2O5ZL 3BIAX 4ZUVB 3TESA 3IKCA 3EYFB 3WXVL 1TTUA 2CDEA 3ELAT 3H9YA 3DV6B 3IDMA 4AT6B 2GNTA 3DSNA 1FIGL 3QUZB 5HYQB 4DFSA 4Z8FH 43CAB 4I5BB 5IF0B 1P7QA 4UIMB 1M05B 4F57L 4O2CB 4QXGL 1MH5B 4P3WA 3O45A 4FP3A 3O2DH 2ZGQA 2EC9T 4JHZA 1Z2KA 5CJ8A 4MXQD 4KQ4L 4TUOB 5C0JA 4U6XB 4WUKL 2YN5A 1D0HA 1F4AA 1AR2A 4IRSD 4GOSA 1IKQA 1TFHA 4ONHA 4EOWL 3LCPA 2SEBA 5KTEH 1V6MA 3CK0L 4JDTH 2MQ3A 5MEPB 3QDME 3DBXB 4OLUL 2W0LA 4PRPD 1JZ5A 2ADJA 1YMMB 3P4NA 4TULL 1VKXA 4NOTA 5D93B 2NY3C 1WC7A 4WGVB 3LQZB 3LS5H 5CAZA 2OP4L 5DMKA 4F7EA 1BJ1J 3PJSB 4GW4B 4FXGA 5E2WH 1K3IA 4WDIB 4HZLB 1RIVL 2OL3L 4LBEB 3T0ED 1INDL 3BFOA 4FQQA 3MLSL 3REVB 2CL2A 1U42A 1BLNA 4XRCA 2F9BT 1JUFA 5GLVA 2AJSL 4BM7A 3O3BB 4LSUH 4C56B 2XKNB 5IB3B 4YHLL 5D9SB 2VUAA 4U1HA 2R1XB 3I50H 2R4RL 4MJIE 1XF2B 1KJ3H 5EBWB 1IAOA 2ADIB 2P48B 5DRWB 2P46B 3O9WA 3SHSA 1BQPA 5C0GA 5DFVC 3AXLA 4KKAD 3RU8H 1P4IL 5E94A 1QNZL 2GJZB 1DSFH 3I6GB 4OZGB 5IFAH 5C2BL 4YXHH 5MEND 3ARGB 1YEIH 4YHLH 5LGJA 1F3DJ 4K7FA 4KQ4H 3VXUB 1HH6B 5CSBA 5TE4H 5FGRA 3SO3B 1HCVA 1OL0A 1IVLA 5HHPB 4NZUH 4DCQA 4MJ4A 2B1AL 2ZNWA 2VXRA 5DZNA 4QNPE 3SE9H 3BQUC 3CC5A 2FNBA 3WZ1A 1JGEB 4NDMB 3JVGC 2OZ4A 5D1QC 5HYSB 4K71B 4S1RH 1OT2A 3WL9A 4JCMA 4P14A 5SWQB 1KENH 3NIFE 4NP4H 4EJ1C 1QMJA 4G5ZH 2VDOH 1MZ5A 3GSVB 1AHWB 2AXFA 2YS4A 1ZA4A 4WO4C 4DN4H 4JR9L 4L8DB 4XAKE 4Q97A 4PJBF 1LGCA 3VGGA 4I4WA 3V0VB 3MRGB 3MYJB 5K93A 4E42A 4OGYL 1YY9C 4W4OA 4BYHA 4L4VB 2Y4SA 1BBJA 5FA4A 3VXSB 1TQCB 4P5KA 3PIQB 2GSGA 1FFRA 4F3FB 4OV5B 4F7PB 2BDNL 4LBJA 5D7SL 3UTOA 3UBXA 1HSBA 3TZVC 3IETA 3P30H 5L9DH 3LN5A 4L9LA 1LESA 1B0WA 4LVHC 1NCWL 3QB7C 1LMKA 3HPJA 5BV7B 3FO9B 1DEDA 1MQKH 1KCKA 2G75A 3RA7H 3F12A 1U8JB 3DRTA 1BVLA 2BY2A 2VWEC 2V9TA 4JY6B 4PJ5B 1J8HE 1RIUL 5FK9B 4ZDHA 3DUUA 1MFBH 1I1AB 2Y23A 3NOIA 2ZCLH 3G5XA 4YIQB 5FYKH 2KQNA 3S37X 3AFLA 4H55A 5EZOH 1AC6A 2NY2B 2Q8AH 1A6UL 1V6JA 5F7MC 4K3JL 3BWAA 2ARJB 2AQ1A 5I18L 1DFBH 2YUZA 1INEH 3V6OE 3H7BB 4P4RA 2HLFC 2ZUUA 5B3JE 1FV1A 3RVXD 4MQXC 3LOWA 4M7JH 5L8KB 3W58A 4LCWE 4YFWA 1GJIA 5E2UL 1KYOJ 5IUSA 4O2FA 4MQTB 1EPWA 3DMMD 2P5WA 4AVSA 1PKOA 4XNUH 2Z8WC 4X7SH 3QHTC 2H9GA 5MI0B 3FB7A 5GALA 4ISRA 4J3XA 3AZXA 5C0FB 1DCLA 2ESVE 4WFFE 1CGSH 4NUGL 4Q2ZA 5EZLB 5D6CA 4TVPD 1FYTD 3GI8H 4NKOB 3QUXB 1YN6A 2FRGP 4AENA 4HJ0C 3UTTB 3R0MA 4OZHE 2D2OA 2FX8L 1EHNA 4F33A 1PZUB 3O0WA 2W68A 3OR6B 5E2TL 3T04D 5E2VL 1MQKL 5C9JA 3TBWB 2HRPL 2GITB 1SY6L 1BJ1H 3T4AA 4E41B 3LN5B 4L9LB 1VPOL 1BZ9B 5E00A 4DUWA 3HC3H 4HIXH 3RQ0A 2D43A 1T1ZA 2P8PA 4LFHD 2NY1C 3U0TA 3TT3H 4PLNC 1UL9A 2OI9B 3EDKA 1WFUA 1MS1A 3N9GH 1C8PA 4CDHA 1NEZG 1NUFA 5A2IH 4YFLF 3QIBC 4I4WB 2J8HA 2MMXA 4R4BA 1CQYA 1SFYA 2J6EA 1CDIA 1GOFA 4HWUA 2R0FA 5JVVA 2WMPA 5ACMA 4Y1UA 3FOLB 4DQOL 3WJJA 1JRHL 1NEZB 1KTDA 5A16A 3WL9B 4MNQA 2OTUB 3BP4A 3W11C 3V64A 4Z95H 1EGJA 1FDLH 4JFXB 4JFZH 4Y2DB 4NRYB 3MREA 4KKLC 1NEUA 4DEPC 3DYMA 3JTSA 4NDMA 2PO6C 4DKFL 3V5HB 2A9NL 3TB0A 4JFEE 3R4DA 2B2XH 3VKFC 4NKQB 1G7LB 4XVJL 1I8MA 1G0DA 3ILPB 3THML 2YPVH 3U4BH 3DGTA 4DCQB 2O5XL 2VISA 2DQUH 1ZLWK 4ZXBA 4PJ9A 4NQCD 1L0XA 3M17A 1I4FA 4CMMA 5CGYC 5LGJB 5FHAL 3WV0A 2CRMA 3LD8C 4XPAL 3VXMD 4PGDA 1IQDA 4HFWA 5SV4A 3EO9H 2LTNA 3AP7A 3UPRA 3MUZ1 3A6CL 5I1CH 4UW4A 2ZHLA 2TEPA 1CL7I 3C60A 3KPRB 5DVOA 3H3PH 2VDOL 4M3CF 1QZ1A 3EZJB 1PY4A 3P4OA 1G9DA 1QSFD 2DI7A 2R1XA 5EZOL 5CP7A 5IQ9A 4RMVA 3QG6A 5D9SA 3V6ZA 1N5YH 3MJ7B 4KPHL 3V52L 1A4JB 1JF6A 3T3ME 3MLXL 1GSLA 2GTWA 1MS8A 4PJ5E 1R0AH 3QPXL 4PS4H 1WT5A 1DL7H 5I1DB 3HE6D 5T3ZH 1UX6A 4X80L 4ZOAA 2DTMH 1A3RH 2UYLA 2CR6A 4F7EB 3ARGD 3NN8B 5DZLA 2W65A 5C09E 4MWFB 4LNRB 1CONA 1KB5A 4P46A 2XQBL 1WC7B 2NY0D 2YEZA 3M07A 4PGCA 3OKMA 4CKVX 4XXCC 4MQXD 4G3YH 1WF5A 1UM5L 1JJUA 3O41B 3VWJB 4ZXKA 4M1GH 2ZG3A 3L9RA 3RKPA 1HILB 1RIRA 1KQRA 5KOVC 4U6XA 3WNOA 4LHJB 1DLHB 4FQLL 3C6LB 3HFMH 1AGFB 1OTSC 3PQYE 4NM8L 4YR6A 3I6LE 3AJZA 4JZOB 1C1EL 2GK2A 3FN3A 4YM3A 1NFIA 1YNTA 5JMCA 4XCEA 2HG5A 2AKRA 4F9LA 1HINH 1Q9KA 1QEWB 1YYML 4PQ9A 4JO2H 5IF0A 3U30B 1RZ7H 3RWFB 3H42H 3MA7A 4MD5A 3W9EA 4AT6A 3LPWA 5CGTA 1GAFL 2R2HA 4FQIH 5AZEH 2YD2A 4BFBD 3WG1A 5DD0H 1ND0A 3NCFB 4PP2B 3BHBB 3NTCH 5L2KD 3U7YL 2R2EA 2ZZUT 2AEQL 4FXLA 1S9YB 4LMQI 4IIQA 3UCRA 3CMOL 1JRHH 1HNGA 4RA0A 5K9JL 1DANU 4HIJB 4QHNA 5HJ3A 4U6HB 4OAWB 5DQDH 4YDLC 3L7EB 4S1QH 2HLAA 2VZOA 5DMIL 4AEEA 1Q94B 3DRQB 5DD3H 4EI5B 4JHAH 3P73A 1OP3H 1J1OH 1C16A 2BHUA 4WNQA 1DJSA 2QKIA 3NIGE 2NY3D 5JLZA 4YQXH 1EHAA 2XPGB 4PV8A 1IKPA 4PY7A 1JBJA 2Y07L 4IS6B 3C2AH 3RWIB 1FIGH 4PJCE 2VLMD 4R26L 4U1LA 3ZPYA 1D6VH 4PGEB 3QXAA 5ESQA 5ICZA 1UH3A 5F1IA 4HIIB 1U95B 4L5FH 2NYYC 2O5ZH 4HKZA 4PRIB 3D2UB 1BBDH 2OX5A 3GO1L 2Y6SC 1ES0B 2E6JA 4LLYA 1MFAH 4JFFA 2A6YA 4JO4L 1FG2A 3DMMB 4L8CB 4P3DA 5E8EA 3AB0C 1F58H 5GRVL 2A6IA 3MCG1 4P3DB 3S5LG 5GS0H 1CG9B 5E24E 1T66D 3D2UA 8FABB 2WLYA 2ED7A 3C87A 1P1ZB 1I3VA 4NO0A 4P5TA 4GSDH 5FOJA 2R1YB 2F19H 1CICA 3QUXD 4HEPG 5T5FL 3MCLL 4L8CA 4LOUD 1UZZA 3FFCE 2EDKA 4DUXA 1LP9E 1MFNA 2MKWA 2X4OB 4HKZB 1MFDL 4UTBH 1BQHB 1T7ZA 2KQMA 2FH6A 4G9DA 1KITA 1VLNA 1CLYH 1SBSL 2PHWA 1NLBL 3RBSA 1RITA 1HLCA 4GLRH 3WIHL 5J6HB 5MHSD 3VW3L 3UTQA 3VA6A 1BQHG 5IIEB 1OSZA 2HP4A 4ONOA 3DXAB 3VG0L 3S35L 4G6ML 3VFVB 1V00A 2Z4QA 5EWSA 4CN6A 3SO3C 1OGTA 1A2YB 1I9IH 3PWUB 4IOSD 4NWTL 3RGVB 5JPMB 1FZMB 1T5XB 4UOW1 2M2DA 3HC0A 1FFQA 4N1CA 1D5MB 4GKZB 5HHME 2DL2A 5SWSA 4I0KA 3BHBA 1HHHA 4HFUL 1K5NA 3GSXA 1OCWH 1DQ5A 1GHFL 1UT9A 2R2HB 4TUKL 3TCLA 3UYPA 1RUPL 2KYWA 4JZOA 3A0OA 5C0AE 3WIIH 5CEZD 3NCJL 3AFKA 4NBXB 2H3NB 4J1UB 1YNKH 4WO4B 3C6LA 3WXWL 5HYJB 4FQCH 4RBPK 4TUJA 4H0HB 1DBBH 1RU9L 1JGDB 1YNTB 5IKCB 4XBNA 3KPMA 5EO0A 3ULVH 2CSPA 5BVJA 4FQXB 3P9LB 2PW1A 3MOBL 2OJEB 4P23C 5FOBA 4NP4L 2AK1L 1G9FA 3NGBC 1IC5H 3DX9A 4HD9A 3RL1B 3L9RB 1E4WL 4NZTH 4Y4KA 3CNKA 4AH2A 5KXCA 4NWUL 4BZ1H 4JRYA 5TH2B 4L8BA 1TXKA 5I1AB 1SJHA 3VFRA 4FQ2H 3G9AB 3VG9B 4YDVA 4HKJA 5FUZL 2BVPA 5IW3A 2V73A 4AYUA 4RWHA 4NN6B 3NN8A 4EUPH 3VXNB 3MV7D 2EH8H 4GUPB 4M9OA 5DJ8B 1I1AC 5IFAL 5I1DA 3DECA 4D8PA 2NY2C 5GIRA 4A6YH 3RHWF 3QUKB 1RUKL 4LGPB 2ZSVB 4L3EE 4P3CL 4UUJB 2P8LB 3MACH 1TZGH 3PL6C 3Q5TA 4OUUB 2C5DC 2EXJA 3I50L 4H26B 2EDYA 3P4OB 2D0HA 1LO3L 1IL1A 3KLAB 5D7JA 1A1NA 3F5WA 1HQ4B 1T20B 2HFGL 5GGTH 2DM4A 4L5FL 3BJ91 1JFQL 5GRJL 4W6WB 1WBZB 3ARUA 4TYUA 5HPOA 3S34L 2VOTA 1RIVH 4QCIB 4FQ4A 2HWZL 5I74B 1ZLWH 1IT9L 1QOKA 3BGAA 4XOGA 3OKLB 2HMIC 1HI6A 5LCVL 1H3TA 5TJWK 3ABZA 1AIFB 2EDHA 4JQXA 3QUXC 2OTUA 4MS8C 2OSLA 4MNGB 4OGYH 1OKQA 2BVYA 3S37H 3FOMB 3T0XA 1R3JB 1S7VB 3V9FA 5I1CL 4TPRH 4ZQKB 4G9FA 4DAGH 3P0GB 1HHJA 3LVEA 3MV9E 1CFNB 4KUCD 3MZTA 5E6YA 3UBXI 3VE0B 2G60H 1KELH 5C08A 4QYOB 3WLWC 4QTHB 3U7YH 1HKLH 3GBNH 4S10A 4LRIA 3SKNA 3VD5A 1DZQA 2R1WB 3W11D 1KNOB 1U91A 1T1ZB 5L8JB 3O6LH 3ZYOA 4LAQH 1D9KC 1MCWM 5EG6C 1ZT4A 4FQIL 2JK5A 3MRPA 3NCEB 1IKNA 4KDTA 3GM8A 5E00B 2AH2A 2VZ1A 5I1HH 3RI5F 2B1AH 4LAQL 5C0AA 4O51A 2X1XR 1DQ1A 2P5EE 1F4HA 4WTWA 4K07A 3RVTC 1PKQE 1KELL 3BD4A 4N9OB 5CIPB 4C1XA 1VFOA 1JHTA 4EBQH 1O7VA 2GITA 4HF5L 1KJLA 4HEME 2LU3A 5DJ0B 5F7FA 3QNYA 1NL0H 3HMWL 1YJDH 4DEPB 2D3PA 1ROWA 5C0FA 3KM5A 3H2WA 2ZUYA 3QULA 4IQPA 2Y5TB 1G7HA 1Y18A 1QFPA 2J8UE 4OI9A 4KU1A 5IB2A 2UZYB 2F54D 4NKOA 3ULUH 4HS6B 4MLSA 2W38A 3W9DA 1OAYH 4N5EC 1UB5B 5FYJE 3MODH 3O6FA 1K8DB 4OTXH 2A1WH 3GSNA 4L3EA 4JFHE 5BO1L 4R9HA 4P2QD 1ZGLM 4M43L 1OAUH 2IANB 4M48L 5L2JB 4N0YH 5TF0A 1FVDB 1FZOA 2AREA 1D5ZA 4QRPD 5F7WC 1AGDA 4PYGA 1FZOB 1UKTA 4FFZL 4KK9C 1DQQA 4QGTA 1IBGH 5CKGA 2DMKA 1WICA 2H8PA 2QQLL 1PEWA 3RS6A 1DLFL 1ONAA 3IJSA 4HC1H 4JKKA 3HNSL 2RGSA 2CWSA 2P3JA 2YHGA 1JTOA 3BD3A 4JREC 5ILTH 5D7LA 3KPLB 4KK6D 4X4XA 1FO0L 3F7VA 5EZJB 3LKNA 3SBWC 1DYKA 1RUAL 1KTKE 3FJTA 2M8XA 1T0NA 3WHUA 3EO0B 3QH3A 4P2YA 1FAKT 1SM3H 2X4PB 1WT5C 1BM3L 4F3FA 2R1WA 2J8UA 1IT9H 3T2NH 5T50A 4LPTA 3B3QE 5HGGS 3ARFB 2WV3A 3VE0A 1INQB 2UWCA 4Z7UE 1UZYA 2CD0A 3I84A 4XX1E 2W9EL 4LEXL 1V7MH 4NO3B 1CR9H 5D2NC 5ELIA 5HPMB 1W72H 5TFSL 4XHJD 4Z7NE 1NCAL 2OW4A 5BS0A 5DLML 2AJ3A 3EOTH 1MHPL 2QLVB 2A74A 2HT2C 3MRGA 4KKCD 5HYSA 1S0EA 3ARBA 2CK0H 4LBNA 1ZS8B 5FHBL 1VA9A 4JEGB 4EI5D 2VH9A 4U6TA 3WO3B 4TVPH 1AHWA 2AXFB 1GV9A 2W9EH 3OF6A 4ZSOA 1J8HD 1T1WB 1FH5L 2HKFH 5D1ZA 2UWEF 4I18B 1KT2A 5IW1A 2G2RB 3HE7A 4PJBE 1NGQH 3CH8A 2ARXA 3RUGB 5I19H 3SN6N 1FE8H 5KAQF 4GBXD 2VXUL 5KVMC 1WCSA 2VKWA 4ZS6D 3PP3H 5DRZB 5KS9E 3APBA 3WNXA 4WW2B 1HCFX 3UC0L 3FQNA 1MFCH 1SY6A 2P8MA 5CCKH 1EEZB 1IAOB 2ADIA 5DVMA 3BD5A 4S2SB 1KEMH 3HI5H 5EU5B 3VG0H 5CJXA 2FECI 3VCLB 4P5TD 5FM4A 4X0KA 1JP5A 1MWAL 3FHAA 3N35A 5AVAA 4LBOA 3AMKA 1XF2A 1XAUA 4M62H 5I1AA 3LH2H 4MD0B 4AYFA 2DQFA 2XG3A 2EDFA 1JGLH 1FAYA 4NQDE 2VW0A 4C56A 3VXNA 2R0ZL 1T7WA 5F7DA 5DMKB 2X9WA 3HR6A 1DEEB 3LQZA 1F13A 1TZHB 4TQEL 1R5WB 1S0IA 1SJHB 4RL7A 5D71L 2WANA 4WDIA 5B38B 5CJXC 2VQUA 4YM2A 2EDBA 4NHUA 5T5OA 2A2QT 1KACB 4J3VA 2R69H 2RQ8A 4Z7VB 1P4LB 4KDVA 3S3SA 3KPMB 1A6UH 2C3XA 3KG5A 3L7FB 3PQYD 5HYJA 4OQTA 4HWEL 1YMMA 3U48A 2OJEA 5ANME 5I8CA 4D9LH 1C5CH 2RCSH 1EAJA 4RMWA 2DICA 3B9KA 3EUUA 1A64A 5EFIA 2X05A 5DTFB 4PFEA 2A9ML 3O11A 1JYVA 4QTIH 4D3CH 1A47A 5CBEA 5T52A 1S8DA 1Y6KR 4ONFL 4ZTOH 3D85B 4QHUB 4NQCA 4Y88A 1CYGA 4JFDD 4JZJA 4YDIH 4IRZH 5HCAA 5A2FA 4CN1A 3QEGH 4R6UA 3SPVA 2ZGNA 3GMRB 1WBYA 4RFOL 2EE2A 5JHLL 5EA0H 1Q9WA 4YEFA 3JU9A 3S4SG 3V4VH 4ZFOB 4FQXD 4LLUA 2APXA 4L9LC 4PJGE 3P0VH 2QV2A 5TE6H 4NQEE 2FHRA 3FQRA 3M3EA 2F53B 1FO0B 2VSCA 2M26A 1A14L 1DLLA 2NY4B 5GGSB 2NY0B 1OSZB 4KK8D 2YD3A 4XB7A 2AJYH 3D0VA 2QSCL 5IIEA 2AJZB 1C5DB 1BFTA 3HE6A 2WBJA 4JHBA 3UTQB 1WAAA 1LE9B 3TYGL 2B0SH 4GQ9H 5GLZA 1YPZB 4DKEL 2KKQA 4KKCC 4M48H 3ZKNC 1D6VL 4G8EB 2ZCHH 3MBEB 3X3FH 3D6EA 5LK5A 3TP4A 5C92A 4ATFA 5IG7A 3QDGB 8FABA 2DQEH 4YQXL 1LO5A 3HMXA 2FB4L 4FQXC 5DYOB 4M7LH 3FN0H 5E7FA 4BSWA 3EBAA 4F9PC 1CICB 4KUZL 1IAIL 5L2KE 5E8EB 1AQDB 1ZLUK 2X10A 4ZS7L 4TSCL 4JLRA 4EDWL 4Z77B 1LO2H 1DBNA 1UYWH 2E27L 5E95B 4WWID 4XCNB 4IOFC 3KYMA 5E8DH 4Q6IA 2UUDK 2R4RH 3KYNA 1WZMA 4S11A 3MSPA 4U1LB 5K9QG 5KW9H 2LE9A 1Q8MA 3D9AH 5EIIB 2BVTA 2PR4L 3SJVD 3O4LE 1B0RA 2D03H 3AX4A 4OIIL 3QDGA 4IRJD 5DD0L 2B1HH 2L7UA 5ID1B 4X80H 2X1OA 2ORBL 1SMOA 1NGPH 3ARSA 3BVNB 5F9WB 4WI5A 1G1CA 3QDMA 4EZMA 3PUCA 4YPGB 4MA8L 3DETC 3MLZL 4IS6A 1YPZA 3BESR 1I7RB 3RWIA 2NM1A 3JWDC 2OL3A 3IFOA 3WUWG 4QHNB 4LARH 4PJ7B 3D0VB 4FFVD 1C16B 2V9RA 4HAGA 3SDAD 3M3QA 4WU7B 4YO0B 4WI4A 4L4TA 1G84A 5DFVD 2ZSWB 3L7EA 3HA0A 5DEZA 3ZVXA 1CLZL 1PG7W 1FFPB 1SEBA 1BIIB 2DLFH 3BEWA 4X4ZA 4C57C 4XBPA 4NO4A 4QRQB 4YBQD 3MA7B 4PJFE 3SGDI 5DURB 1RZIA 1V3LA 4FQ1H 1QD0A 4NBZB 3O2VH 2I9TA 4HG4K 4J6RL 1X5IA 2DWDB 5J9PA 3MA9H 1JPSH 4XCEB 2Q7YA 1A7OL 3NCMA 5C0CD 1UJTA 5E70A 1YXWA 1DQ6A 4X5XA 4YHPA 5HGHB 3DVGA 4W4OC 5EN2A 1Z5LA 3OKOB 1F6AB 2VXTL 2PO6A 2ZPKL 3O11B 4WI9A 1NSNH 1Q9KB 4KGLA 4XP9H 3CNAA 3OXSA 4HV8A 3USUB 3SEPA 2BZDA 4GRWE 2RB8A 3RMYA 4UT7H 4DQAA 3CFCH 5IWLC 2WQ8A 1RHHB 1MREL 4HS3A 3L1OH 5FUOL 4UV7L 5DS8B 3DNKA 3G6AB 5JHDE 1DLHA 3OKMB 1LEKB 1ZSDB 1NBYB 1FCCA 3PWJA 4OKVB 4IMLB 4JM2F 3VWJA 3MTRA 4FPEA 3D25A 5CCKL 5T5LA 2UYLB 2V5MA 1NLBH 4HIXL 1VGKB 3C2UA 3NPZB 4WEBL 1YUHB 5C0EA 4LNRA 2JJTC 2XTJB 5JIIA 5LVEA 1W6NA 5DHXB 4PJFA 3VGHA 1FQ9C 1YY8A 1JV5B 4M62L 1LQSR 4LU5H 5I1GL 5FCUH 4EDXA 1TMCB 2DD8L 2HYMA 4QRRD 1MWAH 1T1YB 2ENYA 4P99A 2BC4A 4RA3A 4UTAL 3C5ZA 4MJ6A 1ZWIA 1WFOA 4LLVA 3ILRA 4Q26A 1QYGH 2PTVA 1FC1A 3SE4A 3B6SA 2D7PA 3LSOA 4YK4B 4YXLH 5GS2H 2OR9H 4JPVL 1T7YA 4NSKB 3TN0A 5EOTA 1NQBA 3NCJH 3NV2A 5SWSD 1S5IL 2MSPA 3RVUD 4CL7A 1XGQA 2ADFL 3OAZK 3ARFD 4H8WL 4XCCH 1WD3A 3ILNA 1U93B 2Q3AA 1UENA 4XJWA 1TJGL 1NMCC 4L1HA 3WIFA 3MLYL 4H8WH 4JFXA 4Y2DA 4M61B 3LKQB 5B21A 3OY8B 4O58L 4QEGA 4S0TD 2IGFH 3I2CL 5DEFB 2WSUA 1I9JH 3UZVB 4X9IA 5J13B 2E7BA 2XA8L 2GKIA 3T4YA 4GG6A 2R56L 3BP4B 5E88A 1NEZA 1A4KB 3L3JB 3GIZL 3MJ8B 5IMLB 2ZOLA 2W60B 2Z42A 5EU4A 4Q9BA 1NCWH 4QF1A 5J56B 1VEMA 2QQLH 3ROOB 3GHBL 4PJDF 1KB9J 4XPHL 3T4AB 4XAWL 2C1OA 2VERN 2EDDA 1HINL 1NFDE 1KULA 2APTA 4FMFA 1A7RH 4YXHL 1U3HD 3PV6A 4YZ4A 1RD6A 4LPVA 3QUXA 4MQSB 4RX4D 5D6CB 1U3JA 3MBED 1SLIA 5KG9A 1E4JA 5C0BA 1DFBL 3SKMA 3ZDZF 3RZWA 3FLTA 4DVBA 5T5NG 5DD1L 3WE6B 1F58L 4HUXB 1JHKH 1DZBA 2V5SA 4ALAL 5DGRA 3MRLA 2FB4H 1GZQB 1UM4H 1P53A 3QIWB 2H32A 1LEGA 2AAVA 1U8OB 3JWDL 1Y7BA 1ETZA 3KXFB 1ZEAL 1VDGA 1INDH 4DZ8A 2ITCB 1WBXB 2X41A 1YYNA 2JB6B 2RHEA 4FP2A 4WCYH 1AGDB 1MACA 3ZSKA 2VRAA 3B4NA 4PRNB 5KW9L 3RWJA 4EN3D 3VD4A 1LGBA 2VC2L 4L3EB 4PGJA 3ZE2E 3MO1A 1F45A 1W6QB 3H9SB 3QIWA 2BSRA 1H5BC 1MZ6A 4HT1L 3DRTB 1QQDB 1WVZA 2PTTA 4YGVA 5BV7H 4JC1A 4YLQT 4HXBL 3RTQC 1GL4B 4FTVD 5TQ2H 2AEQH 1S3KL 3IF1B 4NKMA 3S6CA 1EPFA 1JIBA 2UWAA 1IAII 4NJAH 5FIEA 1DHKB 3S3PA 3QNZB 4OV5A 1YQ2A 4LLDA 4OCRH 3BP7A 4M7KH 1L7TH 1GNHA 2P24A 1A6ZB 2R29H 2V2TB 2I5YL 3IETB 5IHZB 1FL5B 1JWSB 1P4BL 3FO2B 2KL6A 4Y4KD 5E8NB 1Q9OB 3ARYA 3AP9A 5LGHH 1RUML 5EU4B 2FX9H 5DG2A 2W60A 3S98A 2NYYD 5L0QB 1J88A 1I9RL 3L95A 3VFUA 1W6MB 5C70A 3JV5A 3MYJA 1RPQA 4ZUWA 2ATKB 2VKXA 3WNLA 4ZPTB 1QBAA 2IQAB 1LO2L 1JPTH 1SYSA 2EDTA 1T4KB 1NAKL 1W6PA 4X5LA 5GGUA 2IG2L 3E3QC 5FKPA 1W0PA 3AUVA 3LKQA 4YHML 4X6BA 5HHPA 1G9MH 4Q9RL 3LMJH 3X13B 2BOBA 4ODWA 3G6DH 2RBLA 3ESUF 3CC5B 1PDKA 1BD2E 1J11A 4I2XA 4WVRA 1IS3A 4H25B 2J1KA 4R96B 5DUBA 1Z9OA 5LKNA 4ORGA 1C4RA 4YHKL 1F5FA 4HANA 1YEHH 4JJHA 5HD8D 3B9AA 3KLAA 3TH2T 4ETQB 3I6GA 4OZGA 1OAKL 3EKCA 1R24B 2AJXH 2XKNA 3QUYA 5HXMA 5MENB 1U9KA 2BC4B 4X7DC 1S0JA 1CVSC 4K7PY 2W91A 4MMXC 5GZNC 2EXWC 1MCHA 1BZQK 1CF8L 1LP9B 4HZLA 4PJIF 4CVXB 3VWKC 5JR1H 4GAYB 1KG0B 3O3BA 1P7KB 4NC0B 5HTSA 4XRCB 2Z35A 2F19L 4FQQB 5BOZG 3SH3A 3P4NB 2ADJB 3AROA 5DRNB 4WUUA 4XBQA 4R97C 3B3IB 4JRYB 3SH4A 2YRLA 5GGRB 3BP6B 2M1KA 1HQWA 2YWYA 3FB5A 3A0KA 3UPAA 3D25B 3CLFH 5FHBH 5BS0D 1YA5A 3G6JF 4NJ9L 4J4PD 3OGGA 1N0XH 5GGVL 2X44D 4G8IB 2F8OA 2WNEA 2FIKA 2NW3A 3BPNB 3ZYIA 1N0XL 3ZYRA 1EMTH 5EO0B 3T2PA 4HS8L 5F9WC 4JKWA 3S36L 1IAIM 5C0JB 3HE7D 2HFFA 4E9LA 3NA9H 4IEFB 4OCXH 3FT3B 3FT4A 4JREB 1OM3L 3NFPA 4U3CA 1OSPL 4WFHD 1M1SA 4KRMB 5GGRY 3TCLB 4U05A 4YJZL 4NC2B 1MRFH 1M05A 1F3JA 5TGBB 3WEXB 4HL0A 4G6AD 5SWSB 5IBUG 4GKZA 4KVNL 4Y19B 3BH8A 3EW3B 5FGBC 3RWGB 1TJIH 2DJSA 3IJYA 5IK3B 4XWOD 4DUVA 4QOKA 5HDQL 4Z0XA 1MFEH 3IKCB 4JY4A 4ZYKA 1KJ2H 4TOYL 2RR3A 4XZPA 2BY3A 1JHLH 2J6EH 5IOPA 1UWXK 5C0IB 4P2OD 1IFHL 4KI5C 1URLA 4OLVL 3BZEA 2AK4E 5LGKA 4WFHE 5BMFH 2UY6A 3RWHB 1NCCL 2EE3A 3B5TA 4KK6C 1KIRB 5BO1H 1XCTB 4LLMB 3X12A 5H9SA 1BQHA 4WRLA 2VDKH 1ADQL 1IZKA 2DQIL 4Q9QH 2FLRT 3ARWA 4FPHA 3WV6A 3TBSB 4M6MH 3MRDB 4QY8B 4RISH 2D9CA 3JUUA 1IC1A 5DGQA 3QT2A 4OF3A 2F58H 4QXUH 1SLBA 4YWGH 1NDGA 5GRVK 1UFUA 2X4RB 4M5YL 4N9GB 4ODVL 3T77A 3GMLB 4HT1H 1P69B 4TVPL 2EZ0D 3HNSH 2P5EA