4M00A

Crystal structure of the ligand binding region of staphylococcal adhesion srap
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
501
structure length
501
Chain Sequence
b'TTAVTANTITVNKDNLKQYMTTSGNATYDQSTGIVTLTQDAYSQKGAITLGTRIDSNKSFHFSGKVNLGNKYEGHGNGGDGIGFAFSPGVLGETGLNGAAVGIGGLSNAFGFKLDTYHNTSKPNSAAKANADPSNVAGGGAFGAFVTTDSYGVATTYTSSSTADNAAKLNVQPTNNTFQDFDINYNGDTKVMTVKYAGQTWTRNISDWIAKSGTTNFSLSMTASTGGATNLQQVQFGTFEYTESAVTQVRYVDVTTGKDIIPPKTYSGNVDQVVTIDNQQSALTAKGYNYTSVDSSYASTYNDTNKTVKMTNAGQSVTYYFTDVKAPTVTVGNQTIEVGKTMNPIVLTTTDNGTGTVTNTVTGLPSGLSYDSATNSIIGTPTKIGQSTVTVVSTDQANNKSTTTFTINVVDTTAPTVTPIGDQSSEVYSPISPIKIATQDNSGNAVTNTVTGLPSGLTFDSTNNTISGTPTNIGTSTISIVSTDASGNKTTTTFKYEVTRN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine-rich adhesin for platelets
publication title Structural Insights into SraP-Mediated Staphylococcus aureus Adhesion to Host Cells
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Cell adhesion
total genus 138
structure length 501
sequence length 501
ec nomenclature
pdb deposition date 2013-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18483 Bact_lectin Bacterial lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m00A03
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m00A04
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4m00A01
3.10.20.320 Alpha Beta Roll Ubiquitin-like (UB roll) Putative peptidoglycan bound protein (lpxtg motif) 4m00A02
3IVKB 4PJEA 4P46D 4GOSA 5IFJB 4Y89A 4Z7VB 4NOTA 1G7MB 4XPBH 3LV3A 3FQUB 4KI5C 1BBJA 3ZT7A 3MA9L 4Z77A 1VPOH 2AQ3A 3GSNB 1KTKE 3IFOB 3O3AA 4P2RD 2NZ9A 3QR2A 4FPOB 2VXQH 3BH9B 3LCPA 3SDXB 5E9DE 5D2LA 2VLLB 3DXAB 4POUB 5JPMA 1FC2D 4R4ND 3WHXB 3X3GL 5DGQA 2A3WA 4MD5B 3IJYB 3MROB 1LO4H 1EIBA 3GMQA 3K4ZA 4JCKA 4DKDC 5IWLC 3D39B 1XF2B 1IGYA 4C4KT 5HYIA 3ILQD 3G5ZA 2IPKB 1KCKA 4DFIA 5EIQA 3CLEH 4N90D 4QTIL 3H0OA 4FNLH 5EFIA 4RWYL 1FGNH 5ICZB 1MJ7H 1CESA 1VACB 3I6KA 1FL5B 3LKPB 3LN4A 1GKBA 4P2OB 3IN9A 1I7ZB 1MHHB 1Q8PA 4OV5B 3X12B 1I8LC 1MVEA 3VG0H 4HWZB 3LCYA 3ILQC 1S7TB 5T33H 2AENA 4RRPG 5FB8A 1CDUA 1FCCA 3LVEA 4HWUA 2F54A 1FBIL 1D5ZA 3QDAA 1NDGA 3GMRA 3K0WA 3X13B 1QOOA 3X11B 3BZFB 1LENA 2OR7A 5EO1A 3PJSB 4JFQB 1JPFA 3U1SH 4PRDB 5BV7B 3ILPA 1MCSA 3HLAB 5KSAB 3V4VL 1MI5D 4NO0D 3RDTB 1PQZB 3MW3A 5JO5B 4QXTA 3EYVA 1YYNA 4HXAL 1IC1A 5E6IB 2XQBH 4G5ZH 3TWCH 4K71C 1U8IB 2HYKA 2ICWJ 1GYAA 2GJJA 3POYA 2IBBA 4HS8L 1NFDB 2YMXL 3F7YB 3AC0A 2ATKB 2CK0H 3TA3B 5IMOB 2MSPA 1SVZA 4G6KH 4GG6B 5E8NB 2EEDA 4F83A 1LP9A 1ZS8A 3WXVL 1JF6A 2ZCHL 1HQLA 3WDIA 3MRKB 4LLUA 1DBAL 5DZEA 3QDME 3VRLF 2A1WH 1GANA 2BRRL 3DV6B 1DBBL 3RI5K 1D9KA 1EX0A 2ESVA 1FGVH 4TVPL 3KPPB 4FN0A 3T0DA 1IS5A 4XBQA 1G0XA 4JG1L 3U0PA 2J6EL 3QHTC 5E9DD 3UTOA 1KC5L 3P0GB 4HG4J 2DTML 1IGFL 4ZFZB 1DLFL 3BEVA 4M3CF 2D7QA 2R39A 1AXZA 1RIVL 4HKBA 2ZSWB 1K8DA 3WLWD 5HYQA 3BAEH 1G7QB 5KVEH 3N7MA 5EXOA 4X6DA 3REWB 4JM2A 2DU1A 1OGAE 2F5AL 1SYSB 1LOFC 1JMZA 3QO1A 1H3XA 2E6QA 5ALBH 2P47B 2NY0C 4GRWB 4KROB 5C0FA 4L8QA 1PYWA 3O3EA 1CU4L 1LO2L 4EIZC 4YG0A 4MD0B 2J5LC 3ULVL 3GKZA 2AS5M 1UT9A 3DETD 4M1DH 4R4BB 2ICWI 3I2CH 5JOEA 4I5BA 1IS4A 3FMGH 3O6LL 4D3CL 4JCLA 1N64H 4PY8J 1JWMB 2LABA 3BKJH 3ZE0E 4AWDA 4Q8KA 5IBLD 2B7YA 5E94A 5CJQH 5HD8C 3IFNH 2AK1H 3VXUD 2ZGPA 1UQSB 1A0QH 1NMBH 1QRNE 1ADQL 2AGJL 2GW5A 2W59A 3DETC 1BLNB 5EOCJ 4BKLA 3STZA 2IPTH 5DJAA 3GSNH 2XFXA 4XJZA 4NN5C 2PETA 4NP4H 3RIFF 5EIIA 5JNYB 4CU7A 1BIIB 1Z0MA 5IBLC 3MLWH 3WVJA 3Q3GB 2HMID 3FFDA 3EO9L 2J8UE 1AXSA 4RA3A 2DQEH 2H2PD 4YHPB 4NPYB 5BVPL 2XKUA 1DSFH 1NEZA 25C8L 4JDZA 4G6JL 5JPNB 4R2GB 2Z93A 2WLYA 5CSZB 3TBSA 3BP6B 3ZL4L 5F1NB 2E6VA 3LDBB 4NRYA 5EOTA 2I9LB 1L7TL 3QDMD 4XMAA 2HMIC 4P2QE 4N0UA 1INQB 3MCKA 3ARGA 5DJ6A 3CXDL 5J6GA 3FUOA 1DP0A 3UTTB 4WCYL 3O0RH 4X5XA 1JGLH 3TF7C 2NY3C 1G6VK 1EJOH 3G6JF 1W72H 3GHBL 3SBWC 4OM1H 1JGUH 3CVHL 4CGTA 1RZFL 4HWEL 4U6HA 2RFXB 3CC5B 5F7UA 4JVPA 1U8LA 4XILA 1VENA 2BDNL 2P7TA 1V6NA 2UZIH 3RY5A 3MOBH 2YA2A 2MQCA 3D87B 4PYGA 4FFYL 3RHWF 4EDXB 1OGAD 4OJFH 4Z7OF 1JNJA 5EZLB 2YD2A 1P4BL 1FH5H 3WDVA 5BV7H 5T1LB 3LKSA 2DD8L 4FPLA 1MFEL 3VWKD 3QNZA 4P4RA 4JO2H 3SKOA 3V6ZB 4LCYB 5DUVA 3PP3H 3HC3L 2JJWA 5C9KA 5ID1A 1B0RA 2YY1A 4XPTH 1ZEAH 4JEGB 4OLYL 4KRPB 5CBAA 1MCOH 3R05A 4P3DB 3K3QA 4NO5B 2E8YA 3FLTA 5EZOL 4GRLD 1KIRB 5DRXB 1I9RL 3LRSB 5CJXA 4LHUB 4M4PA 4EUPG 4LBEB 3T0WA 3HE7D 3TBTB 1MQKL 1NCWH 3PWNB 1N5YH 3QDJA 2NY4B 1BBDL 3VWKC 1SBFA 2YD7A 5D7LA 4NUJA 1ZE3C 4E41B 3IVKA 4GAYB 5DC9B 1DQ1A 2N7AA 4NGHH 1QRND 5IFJA 1MCRA 3CK0L 1G7MA 4ACPA 2AK4B 3QZWA 4X83A 3F7QA 3EYQD 3P77A 1CLZH 2FSEA 4X6CF 5C08B 3U4BL 1A7QL 2GUOA 5TDOB 3HTLX 1L9MA 1UEMA 3HE7C 2OTUA 4PJXE 7FABL 3FQXA 2K1MA 4HWBH 4PJDF 3GI8H 4KGLA 1SCRA 3BH9A 4K2UH 4N0CC 3SDXA 2EIDA 2EC9U 2VLLA 1TJIH 3DXAA 5E4IA 4R26L 3TNNB 4U3CA 4HV8B 4MDJB 4MD5A 1Z9LA 3MROA 3HUJF 3MQIA 1TLKA 4A2MA 4UBDD 3D39A 1XF2A 3SOBH 5DG1A 3ILRA 5FHAH 2YA1A 1YMHB 1FL6B 4HC1L 3S37H 3TV3H 3VD9A 5IK5A 1OSPH 4XMKH 4OV6F 1LU1A 1EDQA 1LEKB 1W0WA 4P2QD 4YDKL 4CJ0A 2DWEB 1RVFH 1UCBL 5D7KE 5HPMB 1MVQA 3X3FL 4BFGA 1ZLUH 5ICZA 1VACA 1HINL 3FO0L 3U9PL 4GRWH 4JFHE 3VFGH 1MHHA 1WZ1H 4OV5A 2NXZC 4GAJL 4KKNA 5CEZE 3GSQB 1JGEA 1XCQB 2IBZX 3FT3B 1NMCB 1S7TA 5AG8A 2YD5A 4KHTL 3SDAA 5MP6L 4PJ7B 4UQ2B 1YZZA 5IBUG 5SWSB 2NY2D 4FG6D 1AR2A 2PNDA 3HR6A 3B5HA 3X13A 1HDMB 3X11A 5LBSL 3R4SA 1JZ6A 3PJSA 4JFQA 2NW3B 2VXUH 3P73B 4FP8H 4XNXH 4FFVD 2OL3H 3VDAA 3ARSA 3MEPA 2Z8VC 2NY2C 3I6LD 4FG6C 3OGGA 1S3KL 2B4CL 4G8EB 2DKSA 5KSBE 4JDVB 1FZJB 2GSGA 1D6EA 2D44A 1SJEA 1AGFB 1NSNL 4NQVA 1ETZA 3F7YA 4DN4H 2ATKA 2KZ1B 3TA3A 3ZLQC 4D0BB 5GGUB 4MXWL 2AJUH 5KJRL 4FFVC 1BFOA 4PJGB 4GG6A 4O02H 5CWSB 3RZCB 4PREA 1IGCH 4IEFB 5F71A 3MRKA 1QBLH 4F8QA 5DURD 5ESVB 3FFCA 3DV6A 1MRDL 4Z7WE 4L4VA 5B8CC 2R8SH 3IS0X 4GW4B 1OP3H 4XWGL 4R8WL 3CFCL 3WDJA 3FTGB 4MA7H 4FFWC 4Y1AE 5IGXH 4OUOA 4WUUA 3VFOA 4M4RA 3O2DL 3O2WL 3TT1L 4BLIA 5BRZE 1MHEB 2JB5H 2LU7A 5EN2B 3QIWB 1MEXH 4OUUA 1ZHBB 1NLSA 2UVFA 3OJDB 2AXHA 4GKOA 4WUKL 4M1CD 1G7QA 1SACA 3REWA 2GJZA 5JOPE 5LCVH 4CU6A 3M8OL 3AYCA 2FX8H 1NFDE 3BFOA 1SYSA 1QLRB 4M1GH 2PN5A 5D7KD 3S4SB 1KPUB 4YPGB 4OI7A 2R56H 3EFFA 3QWOB 3EDJA 5IHLB 5C6PB 2PYFB 1U8JB 1AXKA 3MPPG 5HYSG 1RZ7H 4UB0H 2WWMD 1FSKC 2DN7A 3WFDL 5AUMA 4YDLB 5IBTH 1JW6A 1BIHA 4RA0A 4R4BA 3ZT5A 1K8IA 1JWMA 5C0IA 5C2BH 4WWID 1I8MB 1I9JH 4WU5B 4MMXC 5ACZB 1FO0A 4NZJA 1UWXK 2OP4L 4OCMC 2CLVA 2CTVA 5D72H 3G04A 4M93B 2WT0A 1OW0A 1UQSA 3MCLH 1CXFA 1J1PL 2O61A 4QOKA 5MEQA 5BS0B 3T3PE 3DROA 1NH6A 2GNMA 5E5MA 3N7KA 1PZ5B 4ONGH 2IG2H 5IFHL 1G0YR 1BIIA 3Q3GA 3TCXA 3P0VH 5FF6B 4P2OD 1MFBH 4GRWE 4YHPA 2HJFB 1XMWA 4NPYA 4ZKTB 4Z7NE 2JE9A 3P30L 3U83A 2XA3A 4XXAA 2C1PB 3VRJB 4P23D 5JPNA 1BGXH 4M7KH 3ZYZA 3BP6A 3HZYB 5AWNH 3BGAA 4K21A 5TQ0L 2ZKHL 1UAIA 2I07B 3F7RA 4X7SH 4EN3B 3CFBA 1W6PB 3OBAA 2APTA 4P2OC 3UTTA 5KOMC 2R0WL 4PQ9A 1AQKL 1Q9OB 3KPSB 2YRPA 1NGZB 4Y1AD 4P23C 1FE8L 3KLAA 5KSAD 4ZAKB 5BRZD 3RDTD 5E6ID 3DGCR 1MCEA 4HIEB 5T5JA 4JFEB 1FCGA 2E7MA 2LTNA 1V6OA 4R90L 5JOPD 5K9KA 5JW4R 5EZLA 1FORL 3MO1B 1B09A 5BV7C 1R3LB 4U6TA 5KSAC 2VAAA 1YEKH 3RDTC 1NJ9B 1MY5A 1PKOA 2NY1D 5F7EL 3V6ZA 2HWZL 2FHFA 1WFUA 3OGCA 1QR4A 5E6IC 1UZ6E 4QTIH 4NO3B 3H3PL 3KLHD 1NC4A 5KXEA 4RWYH 4P3DA 1Q56A 1J10A 3HI5H 4NRXB 3FO1B 2LU4A 4L8CA 1HXMB 5DRXA 3LRSA 2A6JA 4LBEA 4Z7UB 5CGTA 3TBTA 4LLDB 5CZVL 1GLHA 1D5BB 1IGTA 1YC7A 1FBIH 4MZ3A 4H20L 2WBJB 4HKJB 5E8EB 2MHAA 4WW1A 4F9PC 4FPYA 3QXAB 3KLHC 1WBYB 4K7PY 4D8PB 2QQNL 3SKJL 1TZHB 1MVFA 3C2SA 5C08A 4G8FB 5GRJL 1INDL 1S9WB 2VISA 4BM8A 12E8L 4ZUWA 3SO3B 4FQ1H 1A3QA 4MB3A 4KU1A 3HHRB 4TZDA 3WSQL 4NC0B 3KQRA 3DMMB 3ZXEA 1UXWB 1DBNA 3QYCA 5IG7B 3JTTB 4Z0XA 3FQRB 2AKRB 4HXAH 4MDJA 4EVNA 3M17B 5D1XB 4OCWH 5EBGA 3BODA 4OZGA 4F2MA 4HS8H 4KDTA 1YN6B 2A77L 1MZ5A 2YMXH 5T50A 4KRLB 3MLUL 1LEKA 5HPMA 2R4SL 2GMPA 4I2XE 3WXVH 1JZ5A 3HPJB 4KROC 2ZCHH 4E41E 1NBVH 1F11B 4Z8FL 2ITCB 2JJSC 5CEXB 5I30L 2BRRH 1DBBH 4HUXB 1CN1A 5FCSH 1XCQA 3FT3A 5DVOA 3BPOB 4GO6B 3QP3A 4LGRB 4Q9CA 3R06A 3F12B 4FQLL 4KPHL 3K4AA 2O26U 5HYEA 4JG1H 1TENA 3WNKA 2J6EH 4WEBL 1UADC 2HRPL 1KC5H 1R6VA 1LP9F 1T6VN 1MAML 2AV7A 3H9ZA 3QUZB 2DTMH 1IGFH 1CL7I 3KPMB 4N0YL 5DJXB 2IFFL 1N1VA 1RIVH 4XPFL 3P4NA 5F93C 5GQBA 4R2GD 5EORL 2DLGA 2XA8L 4NC1C 2EYSB 2F5AH 3GIZL 4G8EA 3MMEB 4OZHE 1CICD 4JDVA 4E42B 2GNBA 3UTSB 4MLSA 2YK1L 4D69A 1CU4H 4XT1C 2B0SH 1LO2H 5E8OB 4JZJA 4QRPA 5GGUA 3WO3B 4QWWD 3GJFK 3D6EA 3ULVH 1S8DB 3RZWA 4PJGA 3NPSB 4R2GC 1HILB 5DRNA 3NIFF 2VDLL 2R9HC 3O9WB 3NIDE 4XNQB 3O6LH 4X6DF 4X9FA 4D3CH 3KS0J 3MV9B 2EECA 4KTEH 1YO8A 3TT3L 5IFAH 1CICC 4Z7QF 4P9ML 2R1XB 2GK0B 5EU4B 4TOYH 4WRLA 1WWCA 2XG4A 1HDKA 4QWWC 3FTGA 2AGJH 2WJSA 1FNHA 3P2TA 1YMMB 3WCYA 2ARJA 1GCFA 4XVTH 2HA1A 3VD3A 3OWEA 1RUML 5D2NE 3QDGB 5EN2A 1IT9L 1F3RB 4LNVA 1ZHBA 4KRPD 3E3QE 1XFPA 3ZYPA 4MNGB 1M05B 5DD3L 3FJTA 5BVPH 2KL6A 1QBAA 3WIHA 25C8H 4X7TB 2SEBB 3M3CA 4YPGA 4G6JH 2X1PA 3FL7A 5F6HJ 4I13B 1NKOA 4KJPD 4E41D 1KCUL 1L7TH 4JFDE 4JFPA 4HX1B 1G9MH 4KRPC 1QHOA 1WWAX 4YH6A 2O93L 3CXDH 3MUY1 4JZOA 1GJIA 4HUKB 4XGZB 4WCYH 2W9LA 1FHGA 4KMLB 3L1OH 4PRAB 5GZEA 3N85H 3BH8B 2VERN 3GHBH 2NY4C 2VLRB 4XAWL 5HPOA 5ACZA 1YEFL 3CVHH 1RZFH 4HWEH 1I7TB 1QFWI 2OJEA 4JLRB 4KJPC 1U91A 4MAUL 5GS0H 2XG3A 1RHFA 3ISWA 2BDNH 1ZA3B 4FOQA 2UUDK 4I9WE 3TZVD 3HB3C 1F3JB 4LVEA 1IQDA 1SHMA 1CXLA 3C8KA 2VR9A 1X4XA 2H1PL 1EHAA 3LKRB 4I48B 4HF5H 2BCKB 1G7YA 1N8ZB 3RWGA 2WUBL 3D18B 2PTTA 2CGRL 1PZ5A 1J12A 4QHLB 3BO8A 2FH6A 1RK1A 2UY6A 1D3CA 2AJSL 1KCRL 2IC2A 2BHUA 1MFEH 3QFDB 1MJUH 1TDQA 2FGZA 5FF6A 3WV6A 2X89D 4BFBD 1KLUB 4XI5D 2D6LX 1FYTB 3HC3H 2HT2D 2DRUA 3TZVC 2YWYA 5INDB 2HJFA 3LS4L 2C1PA 1P7QA 3VRJA 1MIMH 1B3JA 1UA6L 3WDTA 4TVPE 3HZYA 1YEGH 2VZOA 3KDMA 5TQ2L 4U2AA 4HUUA 1MQKH 3T77A 2DQFB 2XACC 2DYPA 2Y72A 3HPLA 1W6PA 4LSUL 1MRFL 1RZ8B 2HT2C 3TBVA 4Y5XB 2HRLA 1Q9OA 3KPSA 4OZIF 3WNOA 3CK0H 5CMAB 1KB9J 1NMCC 4KWUA 4NNPL 5IF0B 1FFRA 3B9KA 3B3QE 5EYXA 3U4BH 1A7QH 1YDPB 5BS0E 2ZBJA 1T04B 3F6IA 4NNYA 4PJAF 1B4JL 4PGCA 2FD6L 1EMTL 5F1IA 1PKQA 1U42A 1CD8A 3L6FA 5F8RC 1YNTB 2D0HA 1LOAA 4Z7VF 4LKCB 4NN6C 1R3LA 2HN7A 2FYYA 2QJDA 3QCTL 3BKCH 3D3VB 1NJ9A 4HC1H 3RZCD 4GXLA 1C08A 3ES6B 4IHOA 2ZOKB 1FIEA 1CFTB 2X4OB 3E0GA 4AM0B 1H8SA 4YDKH 4RISH 1UCBH 4NO3A 3ARDB 3SDXF 2DBJA 3X3FH 3DO7A 3ARBA 4NRXA 1HINH 3FO1A 3MRLB 3GMOB 3UYPA 1UJTA 3UPCA 4IIQC 4GAJH 4JFOB 3T0XA 3DX8B 5LGHL 4LLDA 3THML 3KYMA 5FA3B 3RZCC 4KHTH 5MP6H 1SM3L 5DMGD 2ERFA 1BQHB 2WBJA 4HKJA 4I9WD 1QNWA 1U93A 3QIWD 1RJLA 4M6ML 1GSLA 3WS3A 2KH2B 3O45A 3U7AA 2AEWA 2YZ8A 2YOCA 3JVGA 4G8FA 5LBSH 1NGXA 4PRHA 2OYPA 3VRIB 2V73A 4XIOA 4IJ3C 2ICEA 3WD5L 1GAFL 1JRHL 3B6SB 4JCMA 4M62L 4UDUA 2FO1A 3VCLA 1NCCL 1UXWA 3V6BR 1CFBA 2MQ0A 1UB5A 2XKSA 5DMGC 5MENA 1S3KH 2B4CH 3QIWC 4PGBA 2HTLC 3N1MC 2L7JA 2UWAA 5D1XA 4EZMA 4PBOA 3CSYB 5AYUH 3OJBA 4XJ8A 5I1LA 3HRPA 1NSNH 1YN6A 4TVPD 3P9MB 1F00I 4Y2DA 1TITA 2PW2B 5T5NG 4TUJB 4MXWH 4P2RA 3U9UB 4GRMB 3MTRA 5KJRH 1XF4B 1DQDL 4IMKA 5FK9B 3IDNB 1GZQA 3WKNA 5EULV 1Q8MA 2JJTC 5JUEL 2GN7A 2P8LA 2X4PB 3SCMB 1KJRA 4L9DA 4OCXH 1XIWD 2MJWA 3TEUA 3L3GB 2NTFA 3NV2A 1MRDH 4HUXA 4YDLC 4KGJA 1AKJA 5BS0D 1SY6L 4XWGH 3DIFA 1CLYL 1NFDF 5HGBB 3CFCH 3VGFA 4JO1L 2EDBA 4GXVL 4WEUD 4NQDA 3HMXL 2OQJA 5CP3A 4EUPB 5EDXA 4GG6F 3AP4A 2BVPB 4BH7A 5JZ7C 3O2WH 3TT1H 4FXKA 4M93C 1SYVB 2Q87A 3O5SA 1AX2A 5DJXA 3D4KA 3ALPA 5JW3H 4RCAA 3ULVD 4WUKH 1L0QA 2Q7YA 2YPLE 3BP7B 4U6YB 1KIPB 1TXKA 4LCIH 4XBLA 2A71A 1MS4A 1N3NA 2EF6A 3U30B 4RAHA 4P5MB 3T4YB 3RRQA 1DDHA 4EN3D 1U8NB 1IC7L 1I9IL 5T3XL 2ZWLT 1R5WB 1OTSC 3PDGA 3RS6A 5E8OA 4ELMB 4DKAA 3WFDH 3ULVC 2H32H 5DLML 1N6QL 4ZXBB 4AYUA 1HILA 1XAUA 3O9WA 5DEGB 4XNQA 2NX5B 4ZAKD 2Z8WC 4ZNEA 1MI5A 4NO0A 4YXKL 1DQJA 2PXYA 3AXEA 3NWKA 4Y4HB 4EN3C 5EU4A 4X4ZA 4U6XB 2OP4H 3I9GL 4JFED 2ADIA 4RMWA 2H26A 2XTLA 2X1QA 2BQPA 1J1PH 3SDCD 3QCVH 4XWOD 4KRMB 3VWJB 1WJ3A 1BXHA 1FVCB 5E5RB 4ZAKC 3OF6A 2B2XL 4NQCE 4XJUA 5IFHH 1IRAY 4ITCA 5D5ME 3MLYL 3M1BB 1UWXH 3QQ3A 3HE6D 1T0MB 3RMXA 1OTTD 3SJVB 1KJ2L 3UTSE 3D5OA 3CFIC 4MNGA 1M05A 3VFSB 3IS1X 2AV1B 2ZNWA 1C1LA 4XWOC 5F89A 1DBKH 3CFDB 4FTVE 1AIFB 2X05A 1BD2B 3ZO0A 1JGDA 1MH5B 4DRRA 5GRZA 2H41A 3V5KB 3EYUL 1FG9C 2YUVA 2H2SD 2ZKHH 5D7JA 3WG4A 4HX1A 1G9MC 4LFHG 3QISA 3HE6C 5F3HB 1IQWL 1I9EA 1OTTC 3LKOB 5HTSA 4UQ3B 3RKPA 3HZVB 3DX6B 2YHGA 2R0WH 4Q2ZA 1AQKH 3GJFB 2WUCH 2Z9TA 3B5GA 4IRZH 4XH2A 4NWTL 2G5BB 4TPRH 3DMMD 4JFXB 4MD4A 2NY6B 1I7TA 1FE8H 4JLRA 1JRHI 4GLRH 5GS0C 3T0EE 2WBJC 5EU7C 4X9GA 2DV9A 1ZA3A 3ZE2E 3EUUA 3QH3B 4LRNL 4F3FB 1JN6B 5SWQA 1GBGA 3LKRA 4PBWD 1LHOA 4R90H 2WSUA 4OFYD 2ZUSA 1XZ0A 3SO3C 1M6OA 2YPLD 4DVBB 1FORH 5IHUL 3DMMC 4WI3A 2J4WL 3KWWA 2UYLB 4Z76A 4LBOA 5F7EH 4LBMA 2HWZH 1FYTA 2ZGUA 2X1OA 2VUOA 1GNHA 2Q76B 1FV1B 3H3PH 4IS6B 1XF5A 4MNQE 4UUJA 4DGIL 5DD6B 1U0AA 3V5HB 1BOYA 5E00B 1EEYA 2PW1A 2YRZA 1R0AL 3SGEI 1U8OA 3EOAA 4ZS6D 5KAQG 1CIDA 4L3EA 2DQFA 2V5RA 1IS6A 3H9YA 2L7UA 1MCJA 4LOUD 3UTQB 3QNXB 1CR7A 1XGUB 5DA4A 1MS3A 1N2RB 5HI3D 1RZ8A 4H20H 3DX7B 3QUZD 4MVBC 3VFUA 3T0AA 5CMAA 5FV1L 1T1XA 2QQNH 3BPOC 4KXZI 3SKJH 2EIZB 5GRYA 1BVLB 5GRJH 1YDPA 4DWHA 1QRKA 4ORZC 4NQCD 4ZS6C 3SY0A 2EH7L 5A16A 3V7AG 1RZKL 3WSQH 2VLKB 1N26A 2NYYD 4U1KA 4Z95H 4OZXA 4LOUC 4Q9RH 2CKNA 1YEDA 4EUPH 1LD9A 4G6AD 4YUEL 3UTSD 1JZ7A 2JB6A 1N6UA 3QUZC 2RQ8A 1YNTA 4FQZA 4KUZL 5T1MB 3V4UL 3OR7B 2Z8SA 4ETQB 3OZ9L 5IIEA 2HP4A 3SDYL 5I8EA 2A77H 4ENEC 4I18C 1RFDL 2ZOKA 4A6YB 5CJOL 2X4OA 4AM0A 5L2KE 3MLUH 4Y7MA 4HIIB 3OL2A 2R4SH 2W9EH 4XP6L 3MRLA 3GMOA 5J12B 1ZT7A 3SQBA 3Q2CA 1HCFX 4Z8FH 3T2OA 5E8AA 2E9WA 5I30H 4BMBA 1OGAA 1GV9A 1YMMD 3BDBA 3NPSC 4V2CB 4ZDHB 3QFJE 4FQLH 1MHPL 4KPHH 2YD9A 3BQUB 5F9DC 3T0ED 2WBKA 5C0EA 1BQHA 3QDGD 5IB5A 1BHGA 1B0GB 1CD0A 5FKAB 1OAUH 4WEBH 4L8DB 1CDYA 4FQXD 1MS5A 1DQ5A 2HRPH 2AYHA 1FX5A 4RMRA 1I4FB 3L3JB 4GKXA 3VRIA 3PF2A 2YEZA 5D1ZA 2VH5L 3VXSB 1KCVL 5DZFA 2ZP0T 4GRLA 4N0YH 3B6SA 3Q6FA 3TCLA 1MCNA 2IFFH 1BZ7B 3REVB 4XPFH 4Q74A 3IMNA 5I17A 1UZ8B 3T0EC 4U05A 3X14B 1YNLH 5AG9A 1WWWX 1U3ZA 3P4MA 4NFCA 4MJIE 3R0NA 2BC4B 2B4CC 3GIZH 4PJ7F 5HDQL 2ADGB 2HT3D 2ADFL 5HHPB 4QYOA 1IGIH 2FWOB 4R0LB 4FQXC 4Y5VA 4X4YB 1QRNA 1EPFA 4MNQD 2YK1H 1ONQB 1DQ2A 3TYFA 5GALA 1I3HA 1RK0A 2PO6B 2PW2A 3K1KC 1A21A 1MFCL 1A1OA 4TUJA 1FNFA 3CDYA 3WJLA 4GRMA 1ENRA 4IMLB 1XF4A 2VLRD 1CD1A 4JY6A 3IDNA 5FK9A 5BOZG 5F7NC 2VDLH 4DN3L 2DLHA 3VI4E 4KVCH 2FNBA 2HT3C 3GGWB 4O00A 3TT3H 4PRPA 2X4PA 3FT2A 3SCMA 4P9MH 3PWPB 4WI4A 1EEZB 4WVRA 1JYNA 1MAKA 3N1FC 3JXAA 3RQ0A 2ZGQA 2CLRB 3OKNB 2OK0L 1TCRB 3MYZA 3GJFH 3C60D 5HGBA 1MJJA 1Q0XL 2JKBA 1NC2B 5JMRA 5DO2D 4PJGF 1T7XA 4HHAB 5F3BB 4P2QA 1Z2KA 1RUMH 4WVVA 1CN4A 4QKXB 2CLZB 1IT9H 2CKBL 1GOFA 3WE6B 4QRRE 3HFML 3WXWH 2CMRL 3RG0A 4F7TA 5EZJA 1ZXQA 1F4HA 4X6EB 4YIQB 4I0KA 4NHCL 3BP7A 1URLA 5L2KD 1KIPA 1IAIL 5EWSA 2EXWD 5DO2C 4OQTL 4P5MA 3ZSLA 5C09E 3ULSA 2CUMA 1CG9B 1U8NA 3EDDA 1B9ZA 1KCUH 5DK2B 3U36B 1YC8A 1R5WA 2Y4SA 1SLBA 3S9DB 1RMFH 5JXED 1PEZA 1T21A 4YK4B 1AGDB 3FOLB 4ZXBA 5F97E 1I3RA 3QFJD 3ZKND 1OY3B 4LLMA 2NX5A 3ROLB 4WO4D 1AX1A 3MRQB 2EXWC 2OMNA 5DSCA 3MLSH 2C3XA 4XAWH 4XNYL 4Y4HA 5ISZB 1YEFH 1YQVL 1XGYL 4XHQA 3QXDA 4IDJL 4MAUH 1T3FB 1QA9B 3I85A 5BJTB 4Y5XC 1I7UB 2PUQT 1GIGH 1L9NA 1KYOJ 2AR6A 2XI9A 3AZZA 4Y22A 3H8NA 3O8XB 2C1OA 3V6OC 3V5DB 1R3JB 3D3VD 1T66C 3AAZA 2WUBH 4C59B 4MJID 4XXDB 4XOGA 4YM1A 1XR9B 3M1BA 1BJ8A 2AJSH 1KCRH 3R4UA 3SPVB 5GM0A 3ARDD 1V05A 3Q48A 3G5YB 3ARUA 4WFFE 4XBEH 2UUDH 1TCMA 3IDIB 2FR4B 3FONA 3VFSA 3ULUL 3LS4H 3RI5F 2AV1A 4PJXA 4AIZB 3B2UD 1WBFA 2HTKD 1ZHKB 1AIFA 5IEKB 1YNKH 1BD2A 2WSKA 5C7XL 1A8DA 3NZ8A 5F7LB 5IW1B 2DL9A 1W0OA 4A6YH 1KITA 1AD9A 5F9OL 3FKUS 2XPGB 1APNA 2V2XB 1Q8QA 3ARDC 3LKOA 5F3HA 3TPKA 3DARA 3JWDL 1UZZA 3HZVA 2F58L 4LSUH 3DX6A 3D9AL 2P8PB 43CAA 1N0XL 2YD6A 4XBNA 2FX9L 3EO1B 4PJFB 3B2UC 3FB8B 5DJYB 1AJKA 3G08B 4NNPH 3OR6B 4JFXA 3ULVF 1IAKB 3K8KA 2VLJB 3FAXA 5FO7B 4D2NA 2VE6B 1B4JH 1MVUB 2FD6H 3QH3A 4QF1A 1JN6A 4QRRD 2GAZA 2P42B 1EMTH 1KJ2B 1HSAB 3VGBA 1NCBL 1ORQB 3VI3E 2DVBA 2W0FB 1IGJA 3LZFL 1QP1A 3OKOA 3DVGB 1EEUA 1F6FB 4CVXA 3QPQD 4CBPA 4RDQF 5C09D 3QCTH 3KM5A 2UYLA 2YKLH 4P5KA 3RIAK 3S3SA 1OOAA 2FLRT 4HFUL 4J4PD 5ILTL 5FUCE 2R2EA 1WEJL 2DMCA 3GM0A 3GBNL 3MA7A 4IS6A 5HI5C 1U36A 1ZHLB 2LTQB 3ECBB 2UWEE 5DD6A 1MREL 1PDKA 3V5HA 5E00A 2R1WA 4XP4L 4YXLL 4WTZA 3QPQC 2PHFA 3LD8B 4PP2A 5LGHH 3THMH 4ODTL 4J4PC 3UJJL 1SM3H 3SCMC 1WLDA 4M6MH 3U0WL 3KLDA 5T3ZL 1ULFA 5AZ2H 3WUWG 1RAMA 5I73B 3BIKB 2WQ8A 1BVLA 1IKFH 3SE9L 1WAAE 3OB0K 1GAFH 4M62H 4UT6H 4Z7UF 5LAXB 2RAMA 4U1GB 4FPEA 3UBXG 4OD2B 1MWAA 1NCCH 3G6DL 4ZOEA 4WFFD 4NQXA 1F4WL 4Y4FD 1G0DA 4UIMB 2GSIA 3BXNA 5HDOA 3O3BB 1EAPB 5CGMA 5T1MA 1YA5A 3OR7A 2WLQA 4FQJL 4NM8L 4ZSOB 4ETQA 4DQAA 2OTWA 5EUOE 4UU9A 4X80L 3ZKXC 3MRPA 4HK3N 4NCC2 4A6YA 1MELA 1UB6A 5BRZA 1IKQA 8FABA 4KAQL 3HC4L 3U30C 2KUTA 4M03A 4N0FB 5JQ6L 3FZUD 1N3OA 4NCDA 2RHEA 4Y4FC 3UK9A 5JUEH 2Z31B 2HG5A 4LLWB 1DBJL 3TBYB 2C5DC 1ZHNB 5HHOE 2WT1A 1M7IB 3CX5J 3K2UL 3VWJD 2O5XL 2DOCA 5HSFA 4MWFA 5DI8B 4BM7A 3BQUA 1K85A 2MNUA 4GXVH 5K33A 3EHBD 3HMXH 5KVDL 2VLKE 4TTDD 5DRWA 3TIDA 3WFEL 4L8DA 2A83A 4HUWA 3SJVD 3EYSH 1UWGH 4AG4L 5DJZB 1ZT4B 1I4FA 3L3JA 1T83C 3VXSA 4BPZA 2P3KA 4I3RL 3B01A 3IAPA 1BZ7A 4UT7H 3VWJC 2P24B 2A0LD 3JU9A 1A7OH 3CLFL 3X14A 4APQB 2GY7B 1DL7L 1OSZB 1JJUA 5ID0B 3QWRD 4B41A 4TTDC 4K94L 4L4TB 4X4YA 1AX0A 1K6QL 1ONQA 1IC7H 2EC9T 3IFLL 4YFLF 4C57C 5T3XH 2D3PA 3GIVB 4WU7A 3PGCB 1KNOB 4H0HB 1TIUA 5DLMH 1KB5L 2FEEI 3WLBA 2ITDA 4PTUB 5IHZB 1B6UA 4JQXC 4RZCA 3PWPA 3WKML 2ZMNA 1S0JA 2E5EA 2I25N 3I9GH 3TO2B 5IJVA 4TYSA 1ES0A 2CLRA 3OKNA 2VXSL 1CDIA 4UW3A 2MOVA 1NUGA 4YGCA 2DIAA 3O6FB 5F7DB 5CNAA 3VFRB 3BJ91 5SX4I 5F3BA 5DK3A 1I3UA 2B2XH 2AW2A 1Z9SA 1W6QB 4JANB 3H7BB 3U6RB 2YBRB 4O9HL 3MLYH 3ESVF 2CLZA 3P0YL 4AL8L 3MYJB 5ANMB 3WE6A 2AXFA 1H8OA 1A3KA 1KJ2H 2E27L 3OX8A 1TMCB 1CFQB 2D3VA 2EYRA 4KZEL 4G8IB 4M6NL 3GHEL 4W4OA 5A40E 4DRVA 1FN4B 3FO9A 3QIUD 2G75B 3EYUH 4GG8A 3W81A 1T1WB 1G7IB 3U36A 3VGGA 2HFEA 1D5IH 3W11C 1IQWH 3MGTB 4G42B 1IILE 1OWRM 5HHOD 4WFHE 1J87A 4Y5YB 4OZFB 2GTWB 1ERNA 1JHTB 1AGDA 3FOLA 5DJ2B 5I1KL 3TN0B 3ROLA 1T22B 1K3IA 2JCCE 1PG7W 1QTYT 2XZQL 1F4YH 4JM4L 5J0BA 4NWTH 2VLKD 2DTSA 1MS0A 1T2QL 3QIUC 3UTPD 2BY2A 3H9SB 2N1KA 1T3FA 3OKKA 3H3BC 1W8NA 1I7UA 5AZEH 2BOBB 3UDWA 1ULGA 4LRNH 4N9GB 2CKBB 2V5YA 4ODSH 1CDGA 1FVDB 4YR6B 3MODL 2LAAA 3MNZA 4R9CA 5HCAA 5ECJE 3Q6GL 3QB7C 2XN9B 3PXJA 4HCRH 4KV5E 2FDBP 2V5TA 2WINB 2VDRH 4XXDA 1MAJA 1U9KA 2W52A 3MZTA 5IHUH 1S5IL 5D6CA 5BXFB 1GICA 4YXHL 2J4WH 5EC2A 1IC5L 3SPVA 2A6VA 4GKNB 3R1GL 1FJ1B 3A0NA 4JQIL 4Y16B 3LH2L 3RWHB 5GGTA 2F8VA 3IDIA 2FR4A 1XF3B 1X9QA 4KKBD 1VHPA 3MRHB 1WBXA 5LWYL 4ZTOL 2W91A 3QBTB 5GHWL 4U1NB 4MJ6A 1DJSA 1L4IA 1W6MB 3NCYP 5FM8A 5I1AA 1JWUA 5F72S 1I8IA 5L8LB 2RB8A 2XPGA 4CN6A 4J1UB 5JXAL 1F6AA 5GGQL 1T80A 4YGVB 4X6BB 5ISZE 4QY8A 1FIGL 5CEYA 4HLJA 1A47A 2VU9A 4R3SA 3EZJB 4KK5D 4PJFA 5DMIL 5DJYA 1WC7B 4X7FC 2AEIT 1WT5C 4YJZL 3BESR 1P53A 3BQUC 5J8OA 4XNUL 4I2XA 1RZKH 5C07E 1KLGB 4EI5A 1MVUA 1NBZB 2ZA9A 1KELL 1RHHB 3DO3A 1G1YA 3AZYA 2OZ4L 1FATA 1ORQA 2W0LA 4PG9B 3FLRA 5JHLH 4KK5C 4NQSB 1C7TA 2PO6D 3DVGA 4KUZH 3V4UH 4OLVL 1T0PB 1S9VB 5EC1A 2VMFA 1YY8B 3SDYH 3SDDD 4ZD3L 1DEEB 1JF1A 5MEOB 1II4E 2GITB 6FABL 1F3DJ 1RFDH 5D93B 4R0LC 2V17L 2I26N 4N8VG 4XP6H 2EKJA 4GBXB 3D25B 4HH9B 5EO0B 2DTYA 4YW4A 2Y6SC 3ZDYF 1EO5A 1Y18B 2PO6C 1N1TA 4XCCL 4KMQA 3MBED 1WICA 5I8CA 4K7PL 1MFNA 5F44A 4I8DA 3SDDC 1D0HA 4GALA 4PJCB 1NC2D 5EOCH 3F62A 5CAYB 3CMOH 4K7FA 4QHKJ 1QPPA 3AVEA 2VIRA 2DWRA 5FEBA 1KT2B 3ZSTA 2ICWA 5F6IC 1XH3B 2O5YL 1RJCA 3S36X 1H3PL 3FLPA 4PJHA 3MBEC 1EGJL 1HOCB 3KNBA 2VY0A 1KCVH 3DI2B 4ODUA 1MIEH 5GZFA 2F53B 1MCPH 3SKMB 1KQRA 2ARJQ 4OD2A 3MLZL 2AXJA 4JY4A 5GXBB 5IKCB 2CD0A 2OS7A 4JFYA 3GRWA 4UIMA 3B69A 4DVRL 2EE3A 3O3BA 1EAPA 3VXTB 5FRAA 2WAHA 1O7VA 3EO0A 3PWUA 1NUNB 3WHE1 2ZHMA 4LVNB 1I1AB 2O5ZL 4CADA 1CTNA 1MFCH 4MA8L 4HUMB 5D2NA 2Z42A 2AQ1A 5HXMA 3PGFL 3BOPA 5IMMB 5ISZD 4XZPA 4FFZL 4DN3H 4G8GB 4KJYB 3GZKA 2NMNA 2AI0L 1UKQA 3GKWL 4GWNA 2NMOA 2WBWB 3PL6D 2R16A 4LLWA 3V0BB 3I02A 3TBYA 1QMJA 1SMOA 1ZHNA 4YK4C 3O8XD 4TULL 5HGHB 5JORA 5DRZA 3V95A 1ACYL 1A6AB 3MLRL 4P5TB 2OK0H 2HFFB 1P84J 4EDWL 3RWJB 5C07D 1Q0XH 4JFDA 4IOIB 1JZ2A 3RUGA 3OKEB 2YC1A 4JPWL 4HPOL 3MUZ1 2D6KA 1OVZA 5DJZA 1ZT4A 4QGYA 4F58L 1QVOB 1NPUA 2A6DB 5T3XD 4KJWD 3UDWC 3FQWB 3NCFB 2L0DA 2CKBH 4LEXL 3HFMH 3O8XC 4OGAD 2VRAA 1ZLVK 1IE5A 3TLRA 2DDQL 3SQOL 1MHCA 1OSZA 4MGXA 4NHCH 5ID0A 1EZVX 1X7QA 1IAIH 1OAKH 3FRUA 4OI8A 4UV4L 3BZEB 2ZZUT 3PDOB 3C9NB 4OGXL 3GIVA 5I1HL 3WFHA 4NHUB 1S7RB 1TVHB 2Z91A 3P9WB 1MPAL 4XBGB 5DUXA 3AS0A 2VLJD 1OTUC 4PTUA 5IHZA 3KPOA 4GS7C 1BWMA 4FOWA 4J8RA 4OF8A 3AK0A 1CXKA 2R1DA 4XNYH 4K1ZA 1XGYH 2DBLL 2GNDA 3D85B 3TO2A 3AFKA 5GSVB 3E6HB 2EO9A 3NV1A 4ELMF 4GWMA 2KPNA 1KFAL 3N1GC 3O6FA 1JUFA 5F7DA 3HZMA 1FZMA 1ONAA 1U8QB 3MV8B 5L73A 1W6QA 4TUOA 4RAUB 3LQMA 4P4KD 3MYJA 4TSAH 3B9DA 5CP7B 1I3GL 4NZTL 2ERJB 2F9BT 5EWIL 4MDIB 2IALB 3ULUH 3I8TA 4PGDB 1NANH 3GNML 1E6JL 3QQ4B 5FIEA 4G8IA 3S35L 4ZOAA 3W9EB 1P4IL 2WM0A 5C7XH 1YN7A 3AX4A 1DN0B 3VXMB 3JUYA 4K8RL 1PAMA 1G7IA 4MCZA 1JTPA 3MCG1 2D7NA 3RPIB 4G42A 4GFTB 4LBJA 2F58H 2GTWA 3EOBB 4OZFA 5I71C 5DJ2A 3D9AH 1JNHB 1N0XH 3TN0A 3DX9B 4F7PB 4W70A 2FX9H 3LD8C 1WK0A 2ZJSL 2D4FA 3IB4A 4PRIB 3HNTL 3WEXA 5C0AB 4KVNL 3QQ9C 5KN5B 5TPWL 2K3TA 2BOBA 4OLUL 1A1NB 3T3ME 1QNYA 2W1NA 2NXYD 1ULEA 1FVDA 5ANME 4WI7A 4YR6A 5I73C 1C5DA 2FZ3A 1W6OB 1ADQA 1U6AL 2IQ9H 3KYAA 3QEQE 4HK0A 5C0JB 1ACZA 3LZFH 3VFPB 5IM7B 4ZFOL 4XJ9A 4U1GC 3FBYA 4MNHB 4XHBA 4HANA 2BK8A 4GKNA 1FJ1A 4HFUH 5B38A 2D7MA 3RWHA 5ILTH 3HRZB 1ZVSB 2MTPA 3MRHA 1WEJH 1KEMH 4X4MA 1I1YB 3GBNH 2Z31D 3IDMA 3VE0A 5TDPA 3M3EA 2EXIA 3U46B 3ORJA 3SDCA 4D9LH 1MREH 4XXCA 4YXLH 4NKIL 4XP4H 4K55A 1BOGA 5DD1L 4J1UA 2HVKB 1W0VA 3HZKB 4X6BA 1WLCA 3UJJH 1ULVA 3H9SE 1G7HB 4ZOBA 4OF0A 5H94B 3EOYG 3NV4A 1OKQA 2Z31C 2BERA 3U0WH 3L3IB 1VSCA 5T3ZH 5E88A 1WC7A 3O6ML 1KCSL 1MJ8L 4N1EA 4Z8BA 5GIRA 3LMJL 1LDPL 2B7DT 3SE9H 4APQD 1FNSH 1RZKC 3C2UA 3RJDA 1T1ZA 2XKNB 1GZWA 4WI8A 3DGGB 5E2WL 4XNMB 4Z0BL 2UZXB 1NBZA 4LPWA 4MS8D 3RVXC 3O41B 3G6DH 1EAJA 5H9PA 1SLCA 3WJJA 5C3LD 1RUPL 1F4WH 3IDUA 3MLVL 4DAGL 4DQOL 5HHME 4NQSA 1ZANL 5INCB 2GDFA 4RL7A 4NM8H 3TB0A 1S9VA 3MREB 4WHTA 1YY8A 4X80H 3OB0H 1S0IA 1MCCA 4APQC 1E4KC 1HNFA 1NEZG 2GITA 5MEOA 2N4IA 4WW2C 4HAGA 2EKSA 3KPRB 4KAQH 4MS8C 5CIPB 5KVMC 3HC4H 4ZUUB 2DQDH 2DVAA 5JQ6H 1KF9B 4TQEL 4L3CB 3KJ4B 3D25A 4HH9A 5EO0A 2D31B 2E7LC 1N0LA 3W58A 2UY7A 1Y18A 1T89A 1HZHL 2L4OA 4R4FL 5JW4N 5SWZE 1I8KB 4OFYA 2EXJA 1DBJH 3BE1L 3RPKA 5HVGB 2Q20A 3K2UH 4PJCA 2O5XH 3IDGA 3UTZB 1C5CL 3F58L 1NGYA 3VD4A 2AEQL 1OAXH 3SGKA 1DUYB 3FB7B 5KVDH 3IAGC 1KT2A 4OF3A 5TH2A 3WFEH 4AG4H 1XH3A 3FUQA 4HUNB 2GJ6A 3QEQD 1OP5K 2X2YA 2BHYA 3VW3L 5D7IA 3UYRL 1F8TL 4QNPE 1BVKB 1OAZL 5IEHB 1IKNA 1J1XL 2F53A 3LS5L 4I3RH 2VITB 2CR6A 3O6FC 4TSBH 3OQ3B 4XCEA 3BKYH 1QR1B 5IKCA 4XPAL 5T55A 1DL7H 1EPWA 4LASL 3MR9B 3VXTA 3C8HA 15C8L 3BVNB 1V6JA 5LGJB 1IEHA 3KYKL 5DEFB 1K6QH 3IRPX 1OPGL 5F9TA 4UW5A 3MRGA 1QSFA 5D5MA 4WEMB 1KB5H 5IMMA 2IQAA 2NYYA 2I60L 3H9SD 1X5AA 2XY1A 4PB9H 3A0KA 4OLXH 2AABL 3QJHB 1BREA 2C9AA 2VB5A 5TE6L 3HNVL 3WKMH 3RFZC 3HG1B 4Y5YC 3CFJB 2HJLB 1OP9A 1CVRA 2IH1B 4FTVA 3TN0C 4P5TA 3T65A 3QZWG 2W39A 3AP7A 1V3MA 2VXSH 3IF1B 2CYFA 1UZYA 4AH2A 1G9CA 1BZ9B 1QBML 4IOIA 5I1CL 4LMQE 3PQYE 1JWSB 4EQ2A 1P7HL 4CMMA 3UP1A 2EXYD 1HH6B 4XNZB 5HHMD 2A6DA 3W9DA 3AM8C 5LXGL 4O9HH 3ENRA 3FQWA 3P0YH 4AL8H 4X4XB 3MLXH 4WVWA 1T03L 4XPHL 2EEAA 4OAWB 4JRXB 2JK5B 3KYOB 2E27H 4AGRA 1GGIL 4H26B 5E1HB 4BOWA 5DXDA 2HFGL 1CVNA 3WUWB 2GK2A 4YW3A 1LE9B 5HY9A 5LVEA 4HAFA 4IDLA 4M6NH 3GHEH 4WY7L 1SLIA 3WDUA 1B4RA 5IP4A 4PRNA 3PDOA 3C9NA 1IL1B 4LCCC 2EXYC 4Y16C 2K7PA 1E4XH 3CMGA 3LKQB 5J3HD 1N1SA 5SWZD 3E6FB 4LBKA 5BZWB 1V3LA 5KG9B 5T3ZE 4XBGA 4LPUA 3ZDXE 3ALXA 3SGDH 5I18L 1RINA 2XZQH 4JM4H 3TO4D 3RJQB 4X98B 4CNIB 5KS9E 4M43L 4L8BB 1OF2B 2JJVA 1HYSD 2H8PA 3D85A 2JF1A 5J3HC 2BMKA 4MNQA 3MOQA 3ULUD 3UPRA 2ZG3A 2XG5A 1OD7A 5EZIL 2PHRA 4Z6AT 3VDCA 3MODH 3Q6GH 5ACMA 2UWCA 3V0VA 1PX3A 1HQRB 3MV8A 3TO4C 1S5IH 2X4NA 2BNUA 4RAUA 3O2DA 3IETA 4YXHH 4W81A 1IC5H 1HYSC 3R1GH 5CP7A 2YWZA 3A6BL 4JQIH 3LH2H 1A7RL 3ULUC 1MLBB 3NFPB 5LJYH 5LWYH 4Y19B 1CQ9A 1A6UL 3MNVA 1UJ3B 1H0DB 35C8H 3W9EA 2VXVH 3WS6C 4KFZC 4WZFA 1DN0A 2MPAL 1HE7A 5EPMB 4WJ5B 3VXMA 5B21A 1WTGT 3EGSA 4RMSA 3ZE1F 5JXAH 2CQVA 5T1KB 1JV5A 5CIPH 3RPIA 3NOIA 4LBQB 3A0OA 5GGQH 4D0DB 3UZVB 4GBXC 3EOBA 5AD0B 2NY5C 3HR5A 1JNHA 4CN1A 2CL2A 4F7PA 3UAJC 2FB4H 3T1FB 4LLVB 1ZSDB 3BWAA 4XHXA 2CRZA 5DMIH 4BUGA 1AD0B 3PQYD 3ZDZE 5L2KA 2GT9A 4X6CB 4PRIA 1O0VA 1LHWA 1NGWA 4U6VL 3WG3A 5E8PB 1FNGB 4HIXL 2IFGA 2V9TA 4FXGA 4EI6B 4F15B 1CK0L 3QI9D 1KELH 1PZ7A 1ZMYA 2D6MA 5IVXB 5JXEA 3W39B 3Q9OA 3CVIH 4DOHE 4WNQB 4RSVA 1I1AD 2APXA 1JOJA 4NQTA 3VFPA 3SE4A 1RU9L 5GLTA 4PJFF 1A6VL 1T5WB 4OLVH 1G7LB 4W4NA 3MPCA 4WO4A 2ZAAA 3RGVA 4R9BA 3V65A 3WZ1A 4YDJA 5E2UL 4RWHA 3HRZA 3DRQA 2QQKH 2VUAA 1FFOA 1FFNA 3LSOB 2ZSVB 3QI9C 5KANG 5T3ZD 2V17H 1JP5A 1HI6A 3D0LA 3QNYB 5CA6A 4Y26A 4U0QB 1I1AC 5CZKA 5I16A 3GUTB 4XCCH 2DS4A 1LK2A 1LO4L 1ZTXL 2HVKA 4MJIA 4KDVA 3HZKA 4U49A 1AC6A 8CGTA 2FBOJ 1XT5A 1RURL 1AVBA 5H94A 1DQQB 3AMKA 5C0AE 4NDMB 5FKPB 1OB1A 2XTJB 3L3IA 3CLEL 1AC0A 1RZIB 4ODWB 4NIKB 3ARFA 4YZFF 1V3JA 1Y6KR 1LO0L 1I85C 2FO4A 5HVHC 1QOTA 2PTVA 4P5TC 2GTZB 1EGJH 2V2TA 2ZGOA 5CINL 5D1QB 1AQDB 2XKNA 4XNMA 2MCG1 4TNVK 2BVEA 5IQ9B 3MLZH 2V7HA 4I3GA 3BP4B 1V6KA 5DHVB 1QKZL 1G7PB 4CW1B 2BNRB 4DVRH 5A2IH 3KG5A 1U58A 1J86A 4F9LA 2EDRA 1KPRB 3ROOB 2IPUG 3MREA 4QRSB 5IT2H 1L0XA 4R7DA 4PJHF 4MA8H 3O11A 2IMMA 2XY2A 1Q8SA 3PGFH 4Y1VA 4P57A 1NAMA 1U3JA 2VABB 3H0TB 4FFZH 4L3CA 2W38A 3OPZA 1P9MA 3RTQA 2Q3ZA 2BVYA 3GKWH 2G9HB 1CE6A 2XQBL 1I8KA 3TWCL 5I9QB 2ZKNA 4TULH 4POZD 4FPCA 2H6PB 5IB1B 1ACYH 4JKWA 2HVJB 3MRCA 3UTZA 5C09A 4EDWH 4UNTA 1ZM1A 2ENYA 4FPKA 5GZND 4PJ8B 5DQDL 1DUYA 3AXLB 4F80A 4JPWH 2C3VB 4HPOH 4RNRA 4YHIA 1F9KA 3W5NA 4F58H 1GL4B 4HZLB 5GGRB 5C70A 2PHTA 3O4LB 1BVKA 4J3VA 4LEXH 4PJ5B 5IVZA 2A1WL 2ENSA 4X0KB 3ZVXA 1TJHL 1FGVL 3FN9A 3SQOH 5C6TL 5HDBF 4J3SA 4HBCL 3MRNA 3MR9A 3R8BB 3RUGF 4QHMB 4UV4H 2GCYB 4OGXH 2ERJC 2Y25A 3PHOA 1HK6A 1SFYA 1F5FA 3IXTB 4V1DA 2OSLB 2YUZA 5I1HH 1ZLVH 3QSKB 1H3WM 1QQDA 3GSWB 1PW3A 1MPAH 4GH7B 3VRLE 1LTEA 5B39B 1D7FA 4U1LB 3IDJB 5C0AD 1FFQA 5HHVL 1WZMA 3QJHA 3HG1A 3AYAA 3MXVH 1SEBA 4NZUH 2DBLH 3VXRE 3DUHA 3MRJA 2NR6C 4LP4A 2XZCL 4N8VB 1G7JB 4LIQL 4J3TA 1H5BB 1C16A 4M3CE 1KFAH 1MCIA 3O81A 4NZRL 4JJHA 3PJQA 1T0NA 1F4XH 1PFCA 3DTXB 5F9AC 2Z8RA 4JZNB 5DUML 3I2CL 3FMGL 2WZPD 3MV7E 4IRSA 2Q1EA 1RIHL 1J0HA 4JDTH 4LDLB 1QSEE 4M7ZB 3RWIB 1LMKA 4GUPB 4I0PD 1I3GH 2JK5A 3BOVA 4D9RE 4NZTH 3KYOA 1MQ8A 5EWIH 5HI4C 5CJQL 3IFNL 5I0DA 3W0WE 4YZ1A 1E6JH 1QLFA 2CDEB 4LCWE 3EJYD 5D9SA 3KXFB 3MX0A 1P4IH 4AQ1B 2AREA 2B5IB 4GMSL 1U8KB 2PELA 3GSNL 5TF0A 5FUZL 1LJ7A 5C0BA 3CZFB 3CPLA 4MQSB 4I0PC 5KG9A 5TGBB 4JVUA 4PJ9B 3TIEB 5A2FA 3QG6B 1KCLA 5M94B 4X6FB 1QO3A 2DQEL 3DOSA 3EJYC 2ZJSH 4X98A 1FRGL 3VXNB 4L8BA 3U2SA 4XZUB 3HNTH 1VEPA 4KVNH 5TPWH 4OLUH 1JYCA 3QUYB 4JRXE 1U6AH 4PJEB 1HQRA 2PF6A 1JGLL 1WTLA 2VWEC 2EDFA 2VAJA 1N47A 4OD1H 3TVMD 3KPRD 4NKOB 4RFEA 3DYOA 5I2IB 4LHJB 4HMEA 1JGUL 5DHVH 4RFNB 1MLBA 3VU2A 3F8UB 4Y19A 1X4YA 5JHDE 1JTTA 2UZIL 4M5ZL 1H0DA 1WAAA 3QUKA 3QUXA 5D2LB 3MOBL 1AY1L 1U3YA 2WMPA 3TJEL 1HHHA 1WFOA 5JPMB 5EPMA 1PG7X 4PLOB 2WQRA 4DK6A 4OJFL 3TVMC 2QTEA 5IW3A 2DM7A 4J3WA 3GMQB 4LBQA 1A7PH 3G6JE 4D0DA 5BV7L 3KJ4C 5AD0A 3RNKA 3VXRD 2D0FA 2D6PA 5EUOA 2WT2A 3DGTA 1WBLA 3T1FA 4LLVA 4RBPK 5FO8B 1AD0A 1KCSH 1F6LL 5EFIB 3LMJH 5DS8A 3OV6A 3LN4B 4HULB 5IROA 4Z7OE 5E2WH 2EE2A 1QSED 3UO1L 4Z0BH 4EI6A 1NCWL 1FNYA 2BXYA 4LSPL 2WLZA 4LSDA 4D9RD 3LSDA 1U8MB 5IVXA 1RUPH 3W39A 4WNQA 5FB8B 3MLVH 4DAGH 1DVFD 4DQOH 1ZANH 1VFBB 2F8OA 4NGHL 3STBA 3MUHL 4LCWD 3VUOA 1EHLL 2FRGP 2DQGL 4J23A 3DBXB 4XCYB 1CLZL 1I7RB 3BUTA 4GT7A 5EU3B 5EO1B 4HWBL 3N06B 2A74B 2P5EB 4TQEH 3ILPB 2EO1A 3QNYA 1DVFC 1TJIL 1HZHH 3L5WA 3ULUF 1LEGB 3I6GA 1BZWA 4LF3A 3BE1H 5GS2H 1ZGLB 2BSRB 3CDCA 3SOBL 5C8JB 4X6CE 1YECL 1XGPB 3MV01 3HR9A 3OJMB 4X8XA 3CFEA 2AEQH 1NDMA 4PJDE 5DJ0A 1LE5B 4UZGA 3M07A 1RZIA 4ODWA 4PV8B 1RVFL 2ZUYA 4J3XA 4GKSA 4JRXD 4GW5B 1ZS8B 1J7VR 4CZSA 1QLEH 3VW3H 5D1QA 3VFGL 2ZHKA 4LLUB 1J1XH 3LS5H 1AFVL 3HUJE 1AGEB 2I5YH 4PJCF 3BP4A 1U3HD 2V5MA 4D9QE 4XNZC 2BNRA 4LASH 4C56E 2NPLX 4EXKA 1OP5H 2X41A 3KYKH 2Q8BL 5T5FL 1OPGH 4QRSA 2WANA 3BPCB 1GXEA 3LAFA 5EG6C 5D7IF 5EBWA 5JOYA 4TNWK 4JHAH 4JY5H 2VXUL 3KPNA 2CDFB 1OAYH 4XNXL 4HKBB 2IPUK 4HJJH 4NYLA 4OFPA 4PTTA 2I60H 3AREB 5HYQB 4JM2B 4F7EA 4ONHA 2G9HA 4DKFL 2PKDA 3T1WA 3QXVA 2AABH 3BD5A 5TE6H 3VGAB 5ICXA 1MRCL 3HNVH 3QO1B 2XTJE 5IMKB 2E6PA 3NACL 2H6PA 5IB1A 1BAFL 1S7UA 3WNPA 4DJMA 2FHRA 4RDQG 5C0FB 2NLJB 2A6KA 4FPJA 4JFFB 1PYWB 1T20A 2R2HA 4NM4H 4PJ8A 4DN4L 1QBMH 3AXLA 3RIAF 2LALA 2ZUTA 4XX1G 1RJZA 1IZJA 1AGCA 3VGEA 5EU6B 4DEPB 5GGRA 4RFOH 4XMLH 5LXGH 1OARL 4AVVA 4G9FE 3GSRA 4PJ5A 4XPHH 2R29L 3ARYA 3DSNA 1F2XK 1NBYA 3NIGF 3OMZA 2HFGH 2RHPA 2DIJA 1EO8L 1S7XB 3GMNB 1J11A 1JYVA 4MA7L 3DYPA 5T1KD 1DHKB 1Z9MA 4GKZA 4BKLB 5ESQB 3N1QC 5DJAB 1G84A 5DYOA 3LHPL 3OKYA 2F74A 1CDCA 4JRYB 1CONA 1UJ3C 5DVNA 4M48L 4IRJD 5ICYA 4QT5A 3T4AB 5B39A 3FFDB 2DQCL 4MXQD 4U1LA 4AK1A 4Z9KB 4OCYL 1KDKA 3M3QA 1BVZA 2FX8L 2PR4L 1NXD1 2JLLA 4MJ4A 2Z93B 5E70A 4NRYB 2D9CA 4IRJC 5DTFA 2BVQB 5EZIH 1H5BA 1VGKB 4ZYKA 1SY6A 4N90E 3DRTB 4N0UB 3WV0A 4HWNA 5IUSA 4MXQC 5DJ6B 3JV0A 1F45A 1UKSA 4D9QD 4O2EB 4JZNA 4X5XB 3V6FA 4K8RD 4X7EC 1MSPA 1BFTA 4C56D 5C2BL 3RWIA 2VL5A 1I9JL 3PL6A 4JN2A 43C9B 3A6BH 1A7RH 5TF1L 4AEFA 1KSRA 4YM2A 1CR9L 5D72L 1SJXA 4OLEA 4YE4L 1OQXA 1U2HA 5FDWB 2MPAH 2LU3A 4GQPH 3SKNB 1Q8OA 3CZFA 1OAQL 2P5WE 2XTJD 1QEWA 1WCBB 4K1YA 4FQCL 3LKSB 4WHYG 2D7PA 2XNAB 5TGBA 2YN3A 4L8SA 4PJ9A 3TIEA 4P4RB 3QG6A 3SKOB 1EFXD 4RX4A 5F9JA 1JMXA 5ID1B 1B0RB 4BZ2H 3VXNA 1M4KA 4U3HA 4XZUA 1BGXL 4HIXH 2MMXA 1NL0L 1P5UA 1KEGH 2XTJC 4G9FD 1M7XA 1LEIA 1CK0H 3QUYA 4X7SL 1D6VL 3MXWH 5TFSL 3W82A 1R5IA 1EUTA 4NUJB 4CDHA 5D1QC 5F96L 1QD0A 4YO0A 4YDIL 1RU9H 1A6VH 2LFGA 4NKQB 1P84K 3L3HB 4NKOA 5I2IA 3QZWB 3VKNA 5E2UH 3P77B 2FSEB 3ALWA 2GUOB 4HGMA 1E0OB 2OTUB 3FQXB 3QHZH 2NY7L 4Q27A 3FO2A 3RRDA 1WISA 1FNZA 4P14A 5J7CC 1ZTXH 4PJIB 1QFWM 4HS6A 3C8DA 1RURH 1YEKL 2J8OA 4HBQA 2IJ0C 3BZDA 4CVUA 5J89A 4EKXA 5K9JL 5FO8A 1RIRA 5I9QC 1W0WB 4Q58C 4OIBA 1LO0H 5C6WH 1CGUA 3S96B 4LLYB 2YXMA 3HI5L 3IDXH 1D5XB 3HA0A 5CINH 3ZSSA 2WQZC 3L7FA 5CS7A 1J05A 1JGEB 4Q97A 5KVFL 5FYJU 1U8MA 1QKZH 1LU2A 3SDAB 4DUXA 2WKKA 1VFBA 1T5XB 4P0DA 3EYFA 4ZO6A 3V0AA 1ZV5A 3B2VL 4XCYA 3DBXA 5HHXL 4FQHA 3C5JB 1JXNA 1I7RA 3U7YL 5EU3A 4OTXL 4DKEL 4YG3A 3VXUE 5H9QA 4FQ1L 2P5WD 1CIWA 1JIBA 1YQ2A 2A74A 2P5EA 2Y9RT 3BUYA 3QEGH 1VAMA 1LEGA 3B3IA 1A6WL 2OMBA 3H7LA 3WL9A 5CGYC 1LGVA 4OCWL 1T7WA 1D6EB 2DJUA 2GSGB 1ZGLA 2BSRA 2DUOA 5C8JA 4U1SA 1SJEB 2VXRA 1MUJB 1XGPA 3WFZA 2H3NB 4NQVB 1ETZB 4GXUM 4HJ0C 3CSGA 5GZCA 2VQ1B 5DQDH 1CQYA 3WIHL 1LE5A 1EBPA 1WCSA 4H1LB 4F57H 4PV8A 1BFOB 1CDJA 4YBLB 4Y1ZA 4GW5A 4PREB 3WUCA 2IAMD 2COQA 4LLQA 3WFCL 4G9DA 1NBVL 3ZZ1A 2F54E 1H5BC 3Q0HA 1A4KB 2Z4QA 3FFCB 1AGEA 3KXFD 3RU8L 2F15A 4L4VB 1AH1A 1TJHH 3H2WA 3N3HA 2B1HH 5C6TH 1PJ9A 4HBCH 2QQQA 5L88L 1RUQL 1NGQH 2YSSA 4P9YA 5HDLA 3CDFA 1K2DA 4WUUB 3NH7H 1D2SA 3VFOB 1DR9A 2IAMC 3BPCA 1WUVA 1YRZA 1GZPA 1KDMA 5JIIA 2NY0D 5K59F 2FATL 4HJGA 4CL7A 4XVUD 1ZGLP 1DQ4A 2YMZA 1YYLH 4OUUB 4B7IA 2CDFA 2B5IC 3AREA 2DI9A 4M61A 2EDTA 2GJZB 1OM3L 2X1WL 5HHVH 4N9OB 3I3BA 5IMKA 3NBNA 3BSZL 5EH1A 1VLNA 2DYCA 3KHQA 3EFFB 2NLJA 1LP9E 2XZCH 5HD8D 4JFFA 4LIQH 4XVUC 2B0SL 1J8HA 3STLB 4WHCA 4NZRH 2VNCA 5AUMB 4YQXH 5D71L 5DUMH 2ESVE 5EUKA 5EU6A 1IM9A 3ZXJA 4IOSD 4I77L 1ZOXA 1ITCA 4NC2B 1K8IB 4BK4A 2NZ9D 1RIHH 4KTEL 5C0IB 3DURB 1Q9KB 5IFAL 1L7IL 1FO0B 1YXWA 1HH9A 4TOYL 2FJGA 1QFUH 2CLVB 2OXHA 3G04B 2XZAL 1MOEA 3DUSA 4JREC 1S7XA 4GW1B 3GMNA 2YZ1A 4MHHI 2O61B 4QOKB 5MEQB 4GMSH 2D7FA 4PLJD 5ESQA 3WBDA 3DROB 4YW2A 4XVTL 4RFNC 3NIFE 5E5MB 2NZ9C 3JTSA 5FUZH 4X6DE 3ZHDA 4JRYA 1RUAH 1XCTA 4Q0XH 1MCQA 2J7LA 3T4AA 4Z7QE 1SJHA 1Z3GL 4HZAA 1F4AA 4ONFH 3BJLA 4MA3B 2G2RB 3F7VA 3IFPB 3PXHA 2NY3D 1FRGH 4K07A 4PLJC 1BQHG 1SBDA 4TYUA 4HXBL 2AXGA 3WFBL 3QA3A 3IJSB 1HEZA 5DVKA 2F54D 4NRZA 2BVQA 1KJLA 1G9ML 1VGKA 2BY0A 2EYTA 2JIXB 4PGEA 1DYKA 3DRTA 3CFBB 1GGUA 2J3SA 4XXPA 4O2EA 1T2JA 2C3GA 3L1OL 4M8QA 1A6TB 3N85L 2XXMB 2V2WB 43C9A 2DQTL 4O51B 3KLAB 2NW2A 5GS0L 3HN1A 3BP5A 4M5ZH 4UOW1 2CUHA 5FDWA 1AY1H 4HF5L 3TJEH 2BSED 3MUGB 4OD3L 3SKNA 4CJ1A 5K9KB 3QDHA 5FGCE 3TPUB 3MGOB 1WCBA 2DLEA 2XNAA 3B9EA 2VAAB 3LB6D 4H5SA 1MJUL 4AT6A 3JV6A 3OGCB 3I6LE 4OGYH 5KSUA 1LO5B 1K4CA 2M1KA 4JO4L 1XR8B 1NC4B 5DQJB 4XTPA 1U2CA 5CD3A 2DVFA 1D9KD 3S36L 1EV2E 1MIML 2ESVD 4L8CB 5FYKU 2A6JB 4KKLD 1YEGL 3UO1H 3C2AH 3NGBB 4LSPH 1RZGB 5ERWA 3LB6C 4N0CD 1XGQA 5IB2B 3MRBA 1T7VA 4RBPH 2E53A 1IGTB 3GSVA 5FREA 3WCRA 4LNRA 3K2MC 2MHAB 4WW1B 1CVSC 2W0KA 2A6YA 1EHLH 3L3HA 1D9KC 2DQGH 3UZQA 2MKLC 2Y7QA 4KKLC 1GNZA 2OI9C 2VISB 4ZUWB 4LSTL 2GEEA 4C83A 3WDWA 1QYGL 5DUPL 5JR1L 5IVXF 3GO1H 4Z0XB 4PCRA 3WUDA 3CNKA 3IRZA 3HS0A 4P3WA 4PFEA 4EVNB 2ZGMA 4OZIE 1DQTA 3HCVB 4LIQE 4PJIA 2NXZD 1AR1D 5FUOH 1YEHH 3AREC 4QHUA 4OZGB 4F2MB 1YECH 3BKCL 4JM2C 5BQ7B 4SLIA 2LQRA 4P3CL 3VGAC 1MFDL 2PTUA 3SGJA 2W92A 4PJAE 2IANB 4LPVA 4RISL 3QDJE 4G7VL 1GGTA 4FQ2L 3S96A 4LLYA 1UX6A 4HL0A 3ZYRA 3HI1A 5D7LE 4HT1L 1D5XA 1QUNA 4OM0L 1I1FA 4NNXB 1FV3A 1AFVH 5EU5A 4Y4KB 1ORSA 4PP1C 1AR1C 4K3HA 4Z7VE 4Y20B 3R06B 5C0GB 4DEPC 2EH8H 1QACA 3ARRA 4QRUB 1S78C 3KYNA 1T5XA 1HHIB 1H15A 2Q8BH 1FO0H 1J0ZA 5T5FH 4P99A 3C5ZB 3SDXE 2ZHNA 3L2YA 3DXAE 3PQYA 3C5JA 2CRYA 2AV7B 2BJML 3HNSH 1T7ZA 4H0GA 2R4RL 5C0CB 2DURA 2KQMA 4WWKB 3P4NB 2KT7A 3D39E 5FA4B 4DKFH 5DVLA 4G6FB 1MRCH 1SBBA 4JQVA 1J18A 2PYEA 3NACH 1UENA 1BAFH 5AYUL 2EE6A 2YA0A 3ARGD 4FQQA 4XP5H 3ARPA 4YHYB 1VGEL 3Q1SL 1MUJA 5DG2A 5IVOA 3GK8L 2H3NA 5H8DA 1XGTA 3MFFA 2VQ1A 4OCLC 3WYRA 4NBZB 4JZJB 1J0JA 4MMZC 1A7NH 4PBVC 4QRPB 1J88A 4H1LA 3CFKA 4FFWD 3S3PA 5GRUL 5DRNB 1UG9A 3X17A 1Z78A 1OARH 2YRLA 3BPNB 1JHNA 5B4MD 2R29H 2VL4A 1RJYA 3IYLW 4OCXL 1A4KA 4DUWA 3ARGC 4NBYB 5K9QG 2C7UB 1EO8H 4BSWB 4XHJD 3NZHH 4L4JA 4YFWA 1C4RA 2B1AL 2ARJB 3LHPH 5BCAA 3USUB 3IU4L 3ZT6A 2ATPB 3H6JA 5B4MC 4YW5A 4M48H 3K74B 3D2UB 1MS9A 4HIJA 2XRAL 1Z5LA 4WTZG 2A6WA 5GRXG 3NA9H 1ED3B 1TTUA 2DQCH 1GGCH 5JW3L 4X9BA 4XHJC 4OCYH 5ITBL 3UC0L 5JW5A 2PR4H 2DIBA 2OX5A 4LCIL 3QDJD 5ENWB 1INEL 4YAQB 4GG6E 5D7LD 1AHWA 2BP3A 2IBGA 3BMVA 4JFPB 4LAJH 3WN5A 1X3DA 3STLA 3KPLB 3MUJA 4RIRB 3QEUB 4G3YL 1AO7A 3C6LA 2R0KL 1WIUA 4M6OH 4Q9QH 4JZOB 4L4VE 2R49A 4JFZL 4KDWA 5CJXC 1F3DH 2BOCB 2RJMA 5BYNA 3CDGB 5I1IL 2A9MH 2X4SA 2ID5A 3DURA 1Q9KA 1S7SA 3U4EA 2CNAA 4HQQL 5JA9A 4L9LB 4DPNA 5TF1H 2OJEB 3DXAD 1U91B 1CR9H 3PABB 2WIIB 1E4JA 2XWJA 4YE4H 4GW1A 4YWGL 1IQDB 1YPZB 3C8KB 4L1DA 3TH2T 3QCVL 1YI7A 3PWVA 3D39D 1LK3H 3RWGB 2PTTB 3BO8B 4HK3J 3PHQA 1OAQH 1RK1B 2Q86A 4TRPL 2AJXH 4FQCH 1G9DA 4AIXA 5I1DA 3ZHLA 5M7QA 4WGVB 1WIOA 3MJ6A 1NCTA 1LHVA 4FOYA 5IUQA 4MA3A 2G2RA 3LN5B 3IFPA 3APBA 5F7HA 1DBKL 1P7QB 1UM4L 1AE6L 2F19L 5DJCB 3IJSA 1S0FA 1NL0H 3KDMB 4OFIA 4HUUB 3SGJC 3T77B 4HEME 4K23H 2JIXA 5JOXA 1D6VH 2DYPB 5TFSH 3HPLB 3OSKA 1DTUA 3DVNA 5F96H 3TBVB 1HKFA 4YDIH 2WUCL 1A6TA 1P4LA 4IRZL 1ZGLM 4NBXB 2IBZY 4TPRL 2V2WA 5KW9H 3B9KB 5IK8A 5B22A 5HHQA 4O51A 3SDAC 1AXYA 2C4XA 4DTGL 1BX2B 4NNYB 4O5LH 3PMEA 2X4QA 4HLZG 2NY7H 5ADPL 4NC1E 2W08A 4PGCB 2M8XA 5GRWA 1NLDH 3QRGH 2EZ0D 3MUGA 5F1IB 1CF8L 1PKQB 2IWGA 3P4OA 1BJMA 4PJEF 3L6FB 1RULH 2VSCA 3TPUA 3ZSKA 3MGOA 3TA3D 2EALA 3ZXLA 4N5EC 2BNQB 2HN7B 2FYYB 3JZ7A 3OAYK 1WZLA 4NQEB 5BVJA 1C08B 4OCRL 4IHOB 5K9JH 3EJZD 3TGXA 1LO5A 3VV1A 4R97B 4Y0GA 1JPGA 3TFKD 1XR8A 5DQJA 2EZ0C 1BJ1H 5EOQL 5D2LF 3DO7B 3ARBB 4L4VD 4UINH 5DHXB 3TYGL 4ELKA 3UTTE 3TA3C 5AYQA 5JMOC 1RZGA 5IJKA 5KVFH 5IB2A 3KYMB 2ZCLL 3ZKMC 1V6LA 4WI9A 2GFBA 3EJZC 3QAZB 3TFKC 1U93B 3IKKA 1RJLB 3QJFB 3WS3B 2CO7B 1A14H 3O45B 5FXCH 3B2VH 1TPXB 1K3ZA 5HHXH 3U7YH 1NGXB 4MJ2A 4OTXH 4PRHB 3ZPYA 4DKEH 3UCRA 2HLFC 2ICEB 1TEIA 4UDUB 3DV4B 1LHZA 3VCLB 2CUIA 4Z95L 3EYOA 4Q9RL 1UB5B 1Q9LA 5IMLA 5E08H 3WHUA 2XWBB 1G6RA 4QHNB 1N4XH 4KROD 5MENB 5J1SC 1EXUA 3VD5A 1HKLH 4PGBB 1A6WH 4LRIA 1AJ7L 3ASIA 3HCVA 4P46B 1RSFA 4UTAL 5I1LB 3GM8A 4Y2DB 3RL1B 5BQ7A 1O4YA 3WIHH 1MNUH 3LQZB 2IANA 4P2RB 1GZQB 1IARB 2W9EL 3OAZK 4AYFA 2YXSA 4KMTL 3WFCH 1U8HA 3VFWA 5T52A 3TP4A 2P8LB 4NNXA 4Y4KA 2P46B 2NTFB 3RU8H 3WDXA 4Y20A 2P8MA 1AKJB 2AK4E 5J11B 4LLAA 4RA0C 5C08E 5C0GA 2KZWA 1QBBA 3EBAA 3DIFB 5L88H 4GAGH 1RUQH 5GS1A 4QRUA 5ACLA 2ARXA 2JTDA 2TEPA 2Z92A 4NQDB 1HHIA 4ODHL 3WHTA 3QUMB 1OAUL 2OQJB 4M3CA 3C5ZA 1Z0NA 4BH7B 3CXHK 4GJTB 2BY3A 3AU1A 4FXKB 5ABDE 1OW0C 4JPKH 2FATH 5A3ID 5C0CA 2XIDA 3MV7A 4WWKA 2DQUL 3TJHC 5FA4A 1OM3H 2R9HD 1YNLL 5GRVK 2Q7YB 4ORGB 4OT1L 2WW8A 1S9XA 1CT8B 4PJBB 1IGIL 3QT2A 3U4AA 3W0WA 1N3NB 2UURA 3BSZH 1DDHB 1C1FA 4XP1L 2X1XR 1UYWL 3UTTD 5A3IC 4KUCD 2X6MA 5D71H 5F7KC 5KTEL 3LDBC 4NUGL 1BECA 4I77H 4JM2F 4XB7A 4KVCL 5E24E 1MI5B 4NO0B 4PJ7E 5SWSE 1DQJB 2PXYB 1L7IH 1A9EA 2J12B 4GLRI 1BQSA 4RGMB 5K9OA 4OCNC 3RWFA 2ADIB 2Y1VA 2H26B 2XZAH 2C7UA 4BSWA 3O0XA 3RMYA 4L5FL 4U0RB 2FJFA 4HW6A 5T1LD 1CXEA 3QPXL 3A67L 3USUA 1BJQA 5CKAA 2ATPA 4AVSA 1IMHC 3D2UA 3QQ3B 2CJUH 1SJVA 1Z3GH 1ED3A 3WXWL 3WNNA 5CEZL 4FMFA 1MF2L 1G9NL 1Q0YL 4YHKH 4LHUD 2KDGA 4TNVF 2UWBA 2Y36L 3DUUA 5F89B 1X5KA 5ENWA 5JHDA 4HXBH 2NY4D 4XTRD 3OKDA 1JGDB 3EDFA 4PJGE 3WFBH 4YAQA 2DU0A 1P1ZA 5D7JB 5C9JA 1EFQA 3KPLA 4RIRA 4S1RL 3SEPA 3RQ3A 1RMFL 3HB3D 3QEUA 3SH5A 5F7FA 2AK4D 4XRCA 5C2UB 3G6JA 4X99A 5C08D 5LGKA 1HWHB 4Q2ZB 2BOCA 3CDGA 4U1MB 3GMLB 1CQKA 4M7LL 3C08L 3NGBC 4XH2B 3MLSL 1MFAH 4XTRC 3NCMA 4MD4B 1O5DT 5IJKC 4L9LA 2DQTH 2Q5TA 2E8ZA 5DJDB 1GIGL 3PABA 5FGBA 2WIIA 4OKDA 5CILL 1YPZA 3AZVA 4ZUVA 5SWQB 2ARBA 3FB6A 4OD3H 1ITBB 3LOWA 1PZUB 2A6ZA 4XYXA 1H9WA 1XZ0B 1M6OB 4U7SA 3VMOA 3G5VA 4NT6B 4ETYA 5DD0L 3CX2A 4GQ9L 3KWWB 4Z76B 1M1SA 5DZGA 4XBEL 3MLTB 5IOPB 1E28B 2DJ4A 4GKYA 2CXKA 2OW4A 1HQ4A 4KZDH 1VADA 4KC3B 2PCPA 5FV2A 3ZKSD 3LN5A 4M00A 5DUBA 4ZFGL 2IEPA 4JO4H 2Y23A 3HI6L 1XF5B 3BEWA 3S36H 1YNKL 1NQBA 4UUJB 4KDTC 4X5WA 5DJCA 2VZUA 1EEYB 1FVEB 2PW1B 3OXSA 1U8OB 2SLIA 3EOAB 4A6YL 3T04D 5SWSD 1DYPA 1S0EA 4L3EB 4MSWA 4AENB 4M9PA 3SE3A 3MACL 4ZQKB 4BH8B 1AP2A 4LAQL 4LQ1A 3QIBA 4WHYH 3SITA 4MA1B 1CGVA 3VFUB 1T1XB 3L5IA 4FRWA 3L9RA 2VC2L 2Q7NA 4XMPL 4EJ1C 3I50L 4LSTH 1SQ2N 1BX2A 3SY0B 4LVOB 5A16B 1QYGH 5DUPH 5JR1H 3MSPA 4U1KB 3B9CA 2OTPA 1YEDB 4MZ2A 5CP3H 1LD9B 3QDMB 3HN3A 5IK3A 2HH0L 2JB6B 5C0NC 5FYJL 3INAA 4YC2B 3A6CH 2BNQA 5IIEB 3ULVE 5I8EB 2YKLL 3LEVH 4NQEA 1F02I 4ATEA 4P3CH 5E5UB 1RUKL 1T2XA 5DT1L 5GGRY 1MFDH 1MCDA 4G7VH 1HXYB 1CBVL 4FQ2H 5IW6B 3GSXA 4YHYC 4HT1H 1ZT7B 2X7LA 4OM0H 4H25A 3ZMRA 4JZJC 3KPSE 2EIBA 3ZTJG 2UZYB 4MAYA 4PJIF 1B6DA 1OGAB 3N35A 5DDHB 5EBMA 3B00A 1ZWIA 2VSDA 5I1GL 3JBG7 3VWKB 5C0EB 3SISA 3IKWA 5GLVA 3BPNC 4XX1E 1EFXA 5IB5B 3QJFA 5AZ2L 2HTLD 4ZFOA 5DVMA 5F1KC 3NAAH 5I75B 1TJGL 2CK2A 4JFEE 3MW4A 1PKQE 2BJMH 2QHLA 1IKFL 2YEZB 5D1ZB 2R4RH 3MJ9A 4GRLB 3Q6FB 4UT6L 3TCLB 1CPNA 3DV4A 4OZ4A 4XC3H 1FDLL 3HE7B 2WIMA 3N1PC 3PDDA 4G9FA 5HVFB 3GI9H 5HYJA 2Y07H 5I17B 3OKMA 4U1JB 2XWBA 4E0RA 3Q5TA 3P4MB 4QHNA 3VKMA 4OZFG 4KK6C 4XAKE 3C6SB 1TNMA 3VXQA 4LK4A 4QYOB 3IDYB 4P46A 1FC1A 4Y5VB 1QRNB 3TYFB 1VGEH 3Q1SH 4C1WA 1RK0B 32C2A 1CDHA 3GK8H 3RL1A 2VDMH 5IWLA 4W6WB 1LOEA 1YIFA 1A1OB 3NFSL 5DQ9A 4IM8A 3LQZA 3AMLA 4PD4K 1KJMB 4Z7UE 4YFZA 4XP9L 4DZBA 1CD1B 4JY6B 5GRUH 3UJIL 4G43A 4LU5H 4OFVA 4P2CG 3ZSJA 3NN8B 4KJQD 5JZ7D 1BPVA 2J8UB 4RQQB 1RITA 4PRPB 3FT2B 2VUYA 5JW4Q 5EU7E 3WNLA 5B3JF 2C3WA 3FN3A 1KG0A 3BZ4A 1YEJL 1NCDL 3WDHA 1R3HA 1I3VA 1WV7T 4JKLA 4PRHE 5B38G 2A75A 1MJJB 1H8NA 1SLAA 5CKGA 4FPFA 2B1AH 3QUMA 1UVQB 4P2QB 3EYSL 1UWGL 3IU4H 4KJQC 4ZPVB 5FGBC 1MLCB 4HKZA 2JECA 2UV3A 1OTSD 2XRAH 5CD5D 1DE4B 5I19L 4K3EL 4UT7L 3O6KL 4F7TB 5EZJB 2XWTA 5ITBH 4MB5A 3E8UL 1A7OL 3L7EA 3UC0H 5C0RH 2W60B 4ORGA 1JZ8A 1CT8A 4PJBA 1INEH 4MXVF 5AEAA 1V7NH 3ULSB 3C5SB 5GGTL 2CXGA 5CD5C 3KPSD 4XB8A 9CGTA 2ED9A 4CTEA 4G3YH 1T21B 2R0KH 1V5JA 2P5WA 3ILFA 3U7WL 4Q6YA 1I3RB 4JFZH 1ZKAA 4LLMB 2HLAA 1N5AB 3AP5A 3VFTA 5I1IH 5CLWA 4MJ5A 5DSCB 1TZIB 2EIGA 4HQQH 1SBEA 3ZXKA 1VKXA 1DQ0A 3GJEA 2AERT 3QXDB 5JQHC 3V64A 2VLME 5F7MC 2VDNL 4YWGH 3IPVA 3T09A 3O3DA 1VFAA 4Y22B 2C1OB 4I1NB 3B9KC 4U31A 4YGBA 4FHBD 1PG7L 4PIRF 3AAZB 3E1F1 1WBZB 4XAKD 2VW2A 4TRPH 5DHYA 3B83A 1WD3A 1LECA 4KK9D 3FONB 3EAKA 2ZGNA 1X5GA 4LKXA 4PJXB 4TSCH 1UM4H 1AE6H 2F19H 4GSDL 3SE8L 1ENSA 3NZ8B 5E9DA 1A78A 1LOFA 5GS0D 1AD9B 3MV9E 4R97C 5AAMA 4ZNEE 2WBJD 1O4ZA 1D5IL 2R2BA 2AJ3A 3ARBC 4KK9C 3BN9D 5FDYA 2GQHA 1FSKB 4TNWF 43CAB 4PRHD 4JGJA 3RX5A 2HKHL 1B2WL 3IU3B 4JJ5A 4U1MA 3GMLA 1QNZL 2P3JA 1F4YL 1KRIA 4BSVB 3K7UA 1YMME 2ED7A 5JOWA 4BQCA 4DTGH 5C71A 2EDKA 5DJDA 1JUIA 3QAZC 5MEND 5AZEL 4QRQA 5ADPH 1BMGA 3QDGE 1CXIA 2CIKB 4B0MM 4QF1B 4ZUSA 4ODSL 2IH3B 2GAZB 5D1XD 1ULDA 1TPXC 5FYKL 3BN9C 3JVGC 1WWBX 1V6MA 1CF8H 5JIKA 2KQNA 1IGJB 2A73A 4HCRL 4Y2DD 3OKOB 4JAMA 2VDRL 4MNGE 5IV2A 4KUCF 4CVXB 4ASMB 2CDGA 4NT6A 3S5LA 2FECL 4P5KB 5GLWA 1SBSL 2KVZA 3KPQB 3MLTA 5IOPA 1E28A 4OCRH 4UDTB 4YHZL 3GRWL 2R2EB 4KKAD 3L3DA 4HG4K 3D0VA 4MVBD 4P46C 4PRBA 3MA7B 5D1XC 4H88L 3VXUA 3HAEA 5EOQH 1CYGA 1Q9WA 4K9EL 2P48B 1AKJD 5JDSA 4Y2DC 3O0VA 3TYGH 2R1WB 1FVEA 5MERB 4BK5A 3OAYH 4AGGA 2D43A 3VXPA 3QO0A 4NQDD 1VA9A 2VXTL 4IMKC 2H9GA 4PP2B 4AENA 2VLRE 4LVHB 5KSBB 4HGWB 3CUPA 4ZQKA 2ZCLH 4BH8A 2P3IA 4KKAC 2VLMD 2EDQA 4ZO8A 4BFIB 4JPVL 3QEHA 4R4NC 4YHLH 2ED8A 3DYMA 2X4TA 1VIWB 4OFKA 5J11C 2EEBA 3MNWB 1G1CA 5J57B 5FM5O