4M00A

Crystal structure of the ligand binding region of staphylococcal adhesion srap
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
501
structure length
501
Chain Sequence
TTAVTANTITVNKDNLKQYMTTSGNATYDQSTGIVTLTQDAYSQKGAITLGTRIDSNKSFHFSGKVNLGNKYEGHGNGGDGIGFAFSPGVLGETGLNGAAVGIGGLSNAFGFKLDTYHNTSKPNSAAKANADPSNVAGGGAFGAFVTTDSYGVATTYTSSSTADNAAKLNVQPTNNTFQDFDINYNGDTKVMTVKYAGQTWTRNISDWIAKSGTTNFSLSMTASTGGATNLQQVQFGTFEYTESAVTQVRYVDVTTGKDIIPPKTYSGNVDQVVTIDNQQSALTAKGYNYTSVDSSYASTYNDTNKTVKMTNAGQSVTYYFTDVKAPTVTVGNQTIEVGKTMNPIVLTTTDNGTGTVTNTVTGLPSGLSYDSATNSIIGTPTKIGQSTVTVVSTDQANNKSTTTFTINVVDTTAPTVTPIGDQSSEVYSPISPIKIATQDNSGNAVTNTVTGLPSGLTFDSTNNTISGTPTNIGTSTISIVSTDASGNKTTTTFKYEVTRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Serine-rich adhesin for platelets
publication title Structural Insights into SraP-Mediated Staphylococcus aureus Adhesion to Host Cells
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 138
structure length 501
sequence length 501
ec nomenclature
pdb deposition date 2013-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18483 Bact_lectin Bacterial lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m00A03
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m00A04
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4m00A01
3.10.20.320 Alpha Beta Roll Ubiquitin-like (UB roll) Putative peptidoglycan bound protein (lpxtg motif) 4m00A02
5BYNA 2FEEI 3IDXH 3WJLA 5DGQA 4XMAA 3L9RA 4HJ0C 2J4WL 2VERN 3QCVH 3L7EB 4NJ9H 3MX0A 3MUGA 25C8H 4L9LB 1AP2A 1JVKA 1HYSC 1MF2L 3U30B 2ZCHH 5E6IC 1RD6A 3WUDA 4JRXB 3MV01 1IKFH 4KTYA 1M7IA 1NLDH 5JPNB 5DJZA 2DI7A 4U7MA 3I6GA 1ZLUK 3IKCA 2AKRB 4U1JA 4OCRL 4YHML 2OI9C 3MBEA 5F21B 1W72A 2WUBL 3ARDC 4JHZA 5INDB 3B9KD 1IGFH 4JFDD 4M6NH 2VTFA 2FL5B 1MVQA 1HINL 4UQ3A 4ZXKA 3QB7C 4U6XB 3EJJX 4KPHH 5CSBA 3SDAC 5I1DB 4PJFB 4R4FH 4TVPD 4NN7C 1QKZH 3MUHL 3MA9H 3V5DB 1DCLA 3DX9A 1SFYA 3QNZA 3FO1A 3SGEH 1CFSA 4XAWH 5H8DA 2RGSA 2JJSA 1DBAL 1XH3B 2EZ0C 4H88L 4EUPB 3KYMA 2HJFA 3VXME 3VXQB 1MRCH 5D2NC 4UUJB 4UU9B 2COQA 5DJ6A 1LP9E 1S7SA 4P3DB 2VLRE 4KRLB 1WWWX 3S4SG 4NC1C 2AJ3B 4FN0A 3MLTB 4HK3J 5E7BA 5F7DA 4YW1A 1TPXB 4Y4FC 1S9VA 1G0XA 4Q97A 1HNGA 3AAZA 2VMFA 3SDCA 5JORB 4QHKI 5L0QC 1XZ0B 1FNZA 4GKYA 2BNRE 3MV7A 4JAMB 5EXOA 3SOBL 5C9JB 1AD0B 5TGBA 1NAMA 5C0CE 3NIFE 1ZM1A 1CL7I 3KJ6H 2ZSWA 5JW5A 4QLRA 1K9TA 4KMLB 5GJSH 4KVNL 1BJQA 3INAA 1MFEH 2LTQC 2NY2B 2PYEE 1HHHA 3QEQB 4WI7A 4Y20B 3WBDA 4K7FB 4ODHL 2IAMB 4EDXA 2NY4C 5KS9F 4XNZC 1Q94B 3KGRA 4QRUA 1SBFA 2E6JA 5C09A 1PLGL 1TEIA 1A6VL 1SCRA 2VDOL 1CS6A 1U0AA 4U3CA 4MA8L 4AQ1B 3OJ2C 2C3VB 1BOYA 2HLAA 1OW0A 2ZKHH 1T7YA 1A3KA 3F5WB 1QKQA 4XPTH 2A9ML 2IQAA 3GSXB 4QXTA 4LBOA 3VU2A 2C5DA 1T20B 3GMLA 5T3XE 5IG7A 1O4YA 3N9GH 3MLXL 4OCXH 4OZFA 1JGVL 1PQZA 4PJ5A 3PGCB 2VDPL 4QHMA 3THML 4H20H 3BKMH 4NOBA 4G6KH 3D5OA 4TYSA 5IB3A 1LHZA 2CIKA 2MNUA 2W52A 4KJWD 2BNQE 3OV6A 1SCSA 2BSRB 1WD4A 1EFQA 4YHOH 4KRPD 3V7MA 4AVTA 3D48R 5HCFA 5H2BB 4KQ4H 1U3HD 2YA2A 3I50L 2NLJA 3TVMD 3JU9A 2G60H 1W72L 4PG9B 2YRLA 1HHIB 5DUPL 2AEQH 5GSVA 4MAYA 5DUXA 2BXYA 1U8MA 3VUOA 4ZOCA 3RZCC 3U46B 3UTSD 4J4PC 3MLYH 3FONB 5GRXG 2Q86A 2CL2A 1X5IA 5IK3B 5FO7B 3OB0H 4FQZA 3CNKA 3L7EA 3PP3H 1E4WH 1QP1A 2ZWLT 4L9LA 2V2WB 4BQ1A 2JCCB 1INEH 2FEDC 1BEYH 3IDNB 1CDUA 4BZ2L 4NZRL 1WBLA 4JRXA 5C0BD 1BVZA 3SDXF 5JPNA 1RAMA 2CK0L 2VDRL 4PTUB 2VR4A 3GM8A 4U49A 5E2VL 4ENEC 2AKRA 3QFJE 2X5PA 4GBXC 2MQ3A 4UT7H 4PJIA 4D69A 1VGEL 5F6HJ 4H1LH 2VZOA 4FOYA 3QI9B 2GIYA 2VAJA 1KN4H 1E0OB 4MGXA 4OFIA 1JF5A 1JPGB 4G6FB 5INDA 2ZHNA 5J1TC 5C2BL 3L5XL 1NAML 4FOWA 2FL5A 1T7ZA 3JZ7A 4G6JH 5TJWK 5DFVD 2AJYH 1UYWL 4HXAH 2F54D 4U05A 3LZFH 4OGXH 4U6XA 5C0JB 4PJBE 4PJFA 5FGBC 4K3HA 1X5GA 5SX4I 3V5DA 4WEMB 5HDLA 3RUGE 3EDKA 5JTWA 5IHBA 4LBKA 1KJMB 1XH3A 3M1BB 4JG1H 4EUPA 5H35B 1FLRH 3LKQB 2ARXA 4KZEH 3VXQA 5JHDB 3N7LA 5ITBH 2WW8A 2Q8BL 4UUJA 4UU9A 4BZ1L 3N7JA 1P2CB 4P9WA 4P3DA 4GRWB 1MPAH 2AJ3A 4K8RH 4X7SL 4KZDH 3MXVH 1F4XL 4C59B 3RWCB 4ZXBC 5JORA 1XZ0A 1CTNA 1EHAA 3DI3B 3MNZB 4JFDE 4JAMA 4NWUL 5C9JA 4S0SD 4YHIA 3IXAB 4MSWB 2F8OA 1AD0A 5D5ME 1ZLVK 4C54A 5CGYD 3SITA 1DQMH 4ZAKD 2E7CA 4YQXH 5E8NB 2PF6A 4TVPE 4LEXL 2V6HA 4BJLA 1NLSA 3TH4T 1UG9A 4G8FB 1A4KB 3QEQA 5CEYB 1A9EB 3MCLH 2R0ZL 2IAMA 4LHUG 2VIRB 1OWRM 3BPNC 2VLKE 5K9OB 1Q94A 1FZKB 3PGDB 1JYXA 4KUZL 1PG7X 2VDNH 3ZTNL 4Z6AT 1FLTX 2C3VA 5JIHA 4C56B 3KPNB 1ZVYA 4KKCD 3F5WA 4ISVB 3GSXA 2CKNA 5FKAA 2ZUQC 4R4NC 2ADIB 1T20A 1TQCC 3NCEB 1PGRB 4KFZC 4U1NB 4XJWA 3MBED 3PGCA 3BIKA 1FSKB 5AG9A 2WWMD 3MBXH 3WNOA 4PRPE 1K5NB 4N8CL 1F3RB 2W9DL 3BMVA 3G5VB 4Z5RB 1ZT1B 2R0LL 4OM1L 4LBLA 4GXUN 1EJ6A 5LKNA 1SHMA 1YN6A 2JJVA 2AW2A 2BSRA 4H26B 4BZYA 5B8CB 2VXQH 1QBBA 4UTAH 1UCBL 5H2BA 2F5AL 4IJ3B 2D6KA 1FFNB 1EO8L 3IM0A 3GSVB 1PD6A 3D5OF 3TBWB 4PG9A 1HHIA 5DHYA 5JOZA 5EU4B 4QOKA 5HXMA 5J11B 4P9ML 3VH8G 1TZIB 1IILE 5I1JL 3U46A 3MRCB 3P40A 4Q7DA 4P3CL 2ZP0T 1PZUB 1KEML 1BZ9B 3FJTA 5IK3A 1KJ2B 5T5PA 3TB0A 3MV7D 2YD4A 4HJJH 3U9PH 4N8PA 4K3EH 2V2WA 4N0YH 4NN5C 1GNZA 1A5FL 2JCCA 3IDNA 3EDFA 5EN2B 4NCC1 4YFZA 5H37G 1YMHB 4W4OC 3D6GA 5IT2L 4OM0L 5HI4C 1A21A 4HK3N 4PTUA 2PXYC 5F96L 1F02I 4GRLA 1U6AL 3CK0L 1UC6A 1RUPL 4QY8B 2NZ9A 4CTEA 3WKNA 3B9VA 5GRUH 3RX5A 1RZIA 4XAKE 5F1SA 3Q3GB 2YV8A 3NZHL 1EDQA 3ILNA 3WXWH 1JPGA 3K4AA 5C3LD 1T83A 5TE7L 5C09D 4JJHA 4K23H 4NZJA 5CIPH 3RX7A 1CVRA 1IAIL 5BW7C 4Y16B 4WFFD 5EULV 3TZVC 5C0JA 1W6QB 3HCVB 4PJIF 5GRJL 3GNEA 3BMWA 2F19L 2BVQB 3F7YA 3U7YH 1XGUB 2UWEB 2R2EB 3V6OE 3AY4C 2IG2L 1KJMA 5KS9E 3M1BA 1YC7A 3OY8B 2F58H 3LKQA 4PJ5D 5EWIL 5JHDA 2AVGA 5DJ0B 4YBQD 5C0BE 5KG9B 2XPGB 3HUJB 2D6NA 1XR8A 5DS8B 5KZCB 1P2CA 2CTVA 3T2OA 4HUXB 1ZVHA 4KJPD 4TYUA 2FSEB 3PWUB 1F6AA 4PJFF 5I1CL 5A3IC 2D7NA 1Q9KB 1KB5H 2E9IA 1LWRA 2WT1A 1CXKA 3PL6A 4GRMB 5DEFB 2D3PA 3WNLA 1XR9B 1ZV5A 4QGTA 3OPZH 1URXA 2ZZUT 4HUKB 3IB4A 2NY7H 1AJ7L 1I3VA 1DZBA 4DFHA 1C4RA 1CU4L 1KCUL 3OXSB 4MAYD 1CICC 2MPAH 4G7YL 4BUGA 3KPMB 1R3LA 2I9LB 1HYRC 2X70B 4JO2L 1NBQA 4GWNA 3SDYH 3L3IB 2EXWD 2KM2A 1NGZB 5FO8B 4UW3A 4B7LA 4G8FA 3NGBB 1VAMA 1MFAH 1A9EA 1WZKA 5CEYA 4MXQD 5E70A 1VEOA 4XP9L 2P24B 2CRMA 2VIRA 5DEZA 3WLUA 4WI4A 1YY9D 4FQ4A 4HT1H 1P69B 5K9OA 2X4QB 1FZKA 2CGRL 4HKXB 1EJOL 2XTJC 4P99A 3V0WL 1BX2B 1OAZL 4HUWB 4L3EB 2ZMKA 2HJLB 1CDIA 4LIQL 5EWSA 4JRXD 4W65A 1P7QB 4C56A 3KPNA 2UUDH 2NY0B 3DGGB 1AQKL 3VXSB 4ISVA 4YXLL 1QOOA 4XTRC 1LO0L 3FB7A 1N64H 1BYHA 5EYXA 5SV8A 3VD9A 3H9SB 1G9NC 1T21B 3D39B 5I2IB 3QUXC 4U1NA 4JVPA 2GJZB 1FAIL 4WV8A 1A3RH 4XNXL 5D6DC 3UMTA 1ONAA 3ARWA 4L4VE 5JQ6L 1K5NA 3HZKB 4MJIE 4F2MB 4U7SA 2GSIB 3G5VA 4EEEA 2CXGA 3SDXE 2EXHA 1JYIA 3CZFB 4H26A 4JANB 4X9BA 4OKVB 5T55A 5B8CA 2PHTA 5HYSB 2O26U 3QRGL 1T1XB 1FFNA 2PW1A 1JI2A 5LWYH 1ZGLB 5ICYA 3TBWA 3MUJA 3BP6B 1NGPH 3M3CA 1HH9B 3S98A 5EU4A 1JK8B 4RGMC 3ZYJA 2HG5B 1S0DA 1YJDC 3BZEB 5EOQL 5I8OL 4POZC 2PW2A 1TZIA 4RWHA 4X7FC 4Z0XB 2QTEA 3MRCA 2UZIL 2D7MA 3CH8A 1T80A 4I3SH 1NL0L 4YDVB 1BZ9A 4JFPB 3OXRA 1LEGB 4ZTPL 3D0VB 5ILTL 4R97C 3F7VA 2XA8H 4JO1H 2HKHH 4U33A 4E42B 2HMIC 1M6OB 3B5GA 2R8SL 4F7CB 2P46B 5EN2A 2JLLA 1YMHA 2B0SL 1OARH 1LVEA 2ZJSL 1P84K 1A0QH 1FNSL 1TJGL 3UAJC 5HHQA 2NY2D 2HLFD 4YZ5A 4HF5H 1S7TB 3QEQD 3MPCA 3ESVF 2Z31B 1OAYH 1F4WL 1NSNL 1R5WB 2IAMD 2OZ4H 1NCUA 1RUMH 4ODTL 1WK0A 1WZLA 2JCCF 2BJMH 1DFQA 1V6OA 4YK4C 1J86A 2AGSA 4PRHE 1J10A 1ED3B 4X4YB 4Y16A 1DLFH 3RVWC 4NO3B 1W6QA 3LN4B 3HCVA 1IQWL 1XGRB 2BVQA 3RDTD 1XGUA 1S9KC 2PYFB 2UWEA 4S1QH 5EIIB 4DN3L 1U95B 2GJ6E 5DJ0A 1S5IL 5KG9A 1FG9C 2XPGA 3HUJA 5DD3L 5C0ND 4OLUL 5F9WC 4N8VG 4HDIB 4I4WB 3T0EE 4HUXA 1MH5A 5FGSA 5EIQA 5LGHH 2FSEA 3PWUA 1U8NB 3HAEB 1Q9KA 3D9AL 4GRMA 5DEFA 2OK0L 4GAJH 2NQCA 3JWOC 2H1PL 4I48B 5CEXB 1XR9A 4TULL 3FOLB 3UZVB 1ZLSL 4OCWL 5C09E 5I1KL 3V4VL 4QXUL 1UA6L 1KB9J 4WFFE 2AEPH 4OF8A 3KPMA 2I9LA 8CGTA 3JV6B 3L3IA 1OAQL 1NGZA 1X5JA 2JKBA 5FO8A 4LP4A 3BKYL 1T7VA 4OFYD 4J8RB 2FD6H 5T5NF 1MCLA 2AYHA 1MCHA 4PJ5E 2P24A 3SE4C 5HVGB 1AY1L 1DFBL 1J5OH 2KKQA 3ARDA 2X4QA 5ALCH 1N26A 2DQDL 2AEWA 4MQXD 1AGBA 1MFBH 4HKXA 3BEWB 1MJ7L 1BX2A 2W07A 4HUWA 4L3EA 5CUSH 4OF7A 3WG1A 1IM3B 4AL8H 2B4CH 1P7QA 3MJ9A 3DGGA 4NNPL 1BD2B 1PSKH 3VXSA 2Y6SD 1NCBL 3H9SA 1T21A 1JHLH 3D39A 3IDJB 5I2IA 2NZ9D 5EYYA 2IC2A 2GJZA 2FJFB 3QI9D 2ZGLA 2DL2A 1MJ8H 1T7XA 4G6FD 5HHXH 3RPIB 4F2MA 5TE4L 2GSIA 2EIDA 1GZ9A 3IPVB 3VE0B 3LB6C 5E8OB 2ERJC 4NWTH 4Y4FA 4P2QB 5B22A 4OKVA 5IWLA 4MX7B 5HGHB 3M8OH 5HYSA 2GQHA 3WG3A 1T1XA 3CFDB 3ZDXF 1ZGLA 5I1LB 3RTQC 5HY9B 3WIHA 1IGTB 3W2DL 3BP6A 4GQ9L 1TJHH 1HH9A 2APTA 1JK8A 4D0DB 4LU5L 4JRXE 1FRGL 1SBSH 4U7KA 3BZEA 4O4YL 2BHUA 3FL7A 4I5BB 3B2UD 4YHLL 4PJIE 3BODA 4YDVA 1CGWA 4JFPA 2H32B 1JUIA 1LEGA 4AEEA 3D0VA 3BRDA 3RWGA 1QVOB 4WUKL 5SV4A 4E42A 3V52H 1F13A 4F7CA 4FQJH 4G7VL 4XC3L 1VHPA 3F7RA 4UT9L 5SWZB 3LRGA 3I8TA 4YUEL 3F58H 4I3GA 4IEFB 4PJFE 3E3QC 5TE6H 2CK2A 4LFHD 2RAMA 1X6NA 5IBTL 1S7TA 2Z31A 2I24N 3DX8B 2DICA 1DANU 4KGLA 3ILQD 3WS3B 1LECA 1R5WA 3LKPB 4ESKA 4U6VL 5F71A 2CLVB 2VUOA 2WP3O 3VFOB 1NLBL 4L3AA 4Q1PA 4HXBL 2ICWJ 4KDVA 2GDFA 1UKQA 3FZUC 2D9QB 3D69B 4R90H 1S0GA 4JREB 1ED3A 2NYYD 4X4YA 3QAZC 2VXTH 1WIOA 2HFEB 4NSKB 4HMEA 4FZEL 4C56D 1IT9H 3GJFK 2C7UA 3LN4A 1BZ7B 2D4FA 1CL7H 3K7UA 1XGRA 4FQ1L 3ZO0A 3WCRA 2PHWA 1V7ML 4BH8A 1IM9B 2ED8A 1EIBA 1AX1A 1WFUA 2PYFA 1G9DA 3U4AA 1F90L 4C58B 3MA7B 1K4CA 3X14B 1A6TB 1U95A 2ZOLB 4UI2A 1A14H 3CJJA 1BAFH 4I4WA 3DVNB 2FGWH 3QSKB 3L5IA 4O58L 3MJ9L 2HP4A 3QEQE 4K7PL 5DHVB 1U8NA 3HAEA 5A1AA 3KPOB 2APBA 1SEBB 4DQAA 1EO7A 4YHKH 4P5TB 1C5CH 5CEXA 4ONGL 3IF1B 1SEQH 4R2GC 1A7RH 1JNHB 1OTSD 3FOLA 1CQ9A 2B5IB 2VABB 5K33A 1NCAL 3RHWF 4Y2DC 5E94A 5I71B 3PGFL 4U1MB 4F7PA 2VDML 4X9FA 4XHQA 5IB5B 1RZFH 2JK5B 3VJ6B 3SBWC 4LVHB 3JV6A 4WGVB 5JVVA 4P23B 3MNWB 1KXQE 4J8RA 4M7LL 1AQDB 5DJYB 3G5XB 3C08L 3CFIC 4NQDB 4PV9B 3WIHL 5IHLB 2BHZA 2YUXA 3TNMB 3NN8B 5GIRB 1S0JA 5EO1B 5DSCB 2E51A 2HJKB 5E2UH 5JOEA 1QU0A 3BEWA 4PJ7B 4HUVB 5GLUA 1RJCA 4RFEA 4KAQL 1MVFA 4HWNA 4P9HC 3LSOB 4RMRA 1IM3A 1U92B 1AF9A 4KVCL 2MWCA 3TO4B 1CN1A 1R24A 4UMGA 5CNAA 2DQHL 4OTXL 4M1GH 2FJFA 4QOKE 4WHYH 4P2OB 3HE6B 1UWEL 3B6SB 3ZVXA 4LIQE 2Q6WB 5JIIA 2F5BL 3RPIA 3V0AC 5F1KC 3IPVA 4Y5XB 5E8OA 4ISRA 3UBXB 4PUBL 3PV6A 4P2QA 2EIZB 4PB9H 4MX7A 5HGHA 4C1WA 1QNWA 4UOW1 4ZXBA 3ECBB 4TUKL 2M2DA 4ZNCD 3CFDA 5AYUH 3T4YB 4U1IB 1FORH 1JRHI 5HY9A 4OUOA 4F37K 3L5HA 2JCCE 2IFFL 3QG7L 5T50A 1Z2KA 4NT6B 4D0DA 4I13B 5INCA 3N0PB 4HQQL 1X5AA 2BC4B 3H3PH 1CICB 5KZCD 4EBQL 3WFHA 1FDLL 4HFWB 4I5BA 2R4SH 5K9JL 5JA8B 2YMXH 1OGTB 2C9AA 4HWBA 2IQ9H 4WVRA 1WCBA 2H32A 5F6HI 2YD2A 1UKSA 3DPBA 3SGJC 3R0NA 1WV7T 1G7QB 4KK8C 2V9TA 4XNQB 2WIMA 3CPLB 1LO4H 3FQXB 2ITCA 5LK5A 1IFHL 3DBXB 3VRJB 4JKWA 1X5LA 3MYZA 3BDYL 1N1YA 5HI5C 5SWZA 1MLCB 5T52A 3BEVB 4WW1A 5IM7A 3MCG1 2ZCKL 5E1HB 1MIMH 4JPWH 1E4XL 3A0KA 2LVCA 4OLYL 4HMCA 3WS3A 5HHVL 3LKPA 3V6ZB 5JHDE 3BH8A 4X98B 3EYSL 4WW2C 5AD0B 2CLVA 3WHXB 2VQTA 5JPMB 4D9LH 1G9FA 3P9LB 4YJZL 2A5ZA 3D69A 4L3ED 4LSQH 2HFEA 4NSKA 3QUYB 1P7QD 2F53B 3A0OA 3AJZA 2ZHMA 1BZ7A 2NY0D 4OD3L 3DJ9A 3VXSD 4FPGA 5I15L 4BSVA 2WMPA 1IM9A 3CLEH 1J1TA 2XKSA 3C09C 3H9SD 3SE8H 3PHSA 3D39D 3EHBD 5AZ2H 3MA7A 1RUAH 3X14A 2R1BA 1A6TA 3LY6A 1MS9A 1B4JL 2ZOLA 5IOPA 1LO2L 3ZSSA 5FFLA 2UY6A 2Z92B 1T04B 1IVLA 4Z76A 3VG9C 3LKOB 3DVNA 5CINH 3S97C 1IKPA 4JM4L 3ZKMD 3O9WB 4KXZH 5DHVA 3ZMRA 1P4LB 1IC5L 3KPOA 2IGFH 1HQLA 1SEBA 1FO0B 1LOAA 2VC2H 2YC1A 3BE1H 2XG4A 4P5TA 3WDYA 2E27H 2KZWA 2V17L 1DLLA 3IF1A 2P1YA 1JNHA 2VABA 3WIIL 5BVPH 3O4LE 4Y5VB 5D96C 1LULA 4N9GB 4WFGE 1GIGL 1H5BB 1ZOXA 5IB5A 4C56E 2H0BA 3MOBL 3A6CH 2JK5A 3VJ6A 2QKIB 4OLZL 4QWWC 1FZJB 4P59L 1BZWA 1D5XB 2DQEL 2PXYA 4MD4B 4WTZG 3QJHB 2O5XL 4P23A 3MNWA 3P0GB 4AT6B 1J1OH 4NQCE 1AQDA 2CWMA 1L7TH 4XJZA 5DK3A 5DJYA 3G5XA 3GB7B 1CIDA 4NQDA 1CD0A 4Y1AA 4TOYH 3TNMA 3NA9L 3NN8A 5GIRA 4XTPA 2AJXH 5EO1A 5DSCA 2HJKA 1FFQA 2WQRA 4AG4H 4HUVA 1DQQA 1GGCH 1DDHB 3LSOA 5I73B 1YEIL 3UPCA 4RGOL 1U92A 2YA0A 4K9EL 4XZUA 4XPGH 3OJBA 1MZ6A 4LKXB 4HWBL 2XZCL 3TO4A 3CFBB 3P73B 3GMRB 3WLBA 5DQJB 2Z31D 2ED7A 4JFYB 4XNMB 4X8JA 3MOAL 4P2OA 3K2MC 5EB9A 1TENA 3B6SA 5D8JL 2DM4A 4NO5B 2Q6WA 1EEQA 1OCWL 5JIPA 4GALA 1WT5C 4Y5XA 3UBXA 5DO2D 1D7FA 3D1MC 4M1CC 2EIZA 1YEGL 3NH7L 4CRQA 1S0EA 3ECBA 1AXTH 4UILL 2FH8A 1A1MB 3T4YA 4U1IA 3QH3B 4HLJA 5E8DL 1PG7L 5D70H 5L88H 3EJYD 3ESUF 4NT6A 5EOCJ 3DMMC 2BC4A 1CICA 5IVXF 1J0YA 1YNLL 4FQCH 2CLRB 1CQKA 5GGVY 1TLKA 5L9DL 1MZ5A 5FYKE 2ITDB 2XTLA 1CLZL 2IANB 2XZQH 4I8DA 1QOSA 5FGRA 1N47A 1OGTA 3TA3B 4GAYB 2C4XA 4Q2FA 1AO7A 4XP6L 3HC3L 1G7QA 3QUZC 4NM8L 4XNQA 3FQXA 3MTRA 5DRXB 3DBXA 3VRJA 4Z95H 1T6WA 1UXSB 2DQTL 4X8XA 3AMKA 3E8UH 4NZTH 1Y7BA 4MVBC 1MLCA 1WVZA 3BEVA 3IU4L 4WHYG 4NBZB 3WDVA 2X05A 3TWCH 1U8OB 3WDUA 1I1CA 2ZUWA 2UWCA 4FPOB 2UWEE 1CI5A 1S7VA 1D0HA 1QLFB 2PTUA 4X9IA 4KBBA 4X98A 1KGCD 3BPOC 4KV5F 5D6DA 5AD0A 2X6MA 2DVFA 3HUJE 3PWPB 5F1IB 3WHXA 3PWVB 2IH1B 5JPMA 4XP4L 7CGTA 3P9LA 4PLOB 1I8MB 2E6VA 1B9ZA 2CUHA 1KACB 3O6FB 5FUCC 3RBSA 4LRIA 2X10A 3QUYA 5DXWA 5AWNH 1QNZH 2F53A 4JFHE 2ADFL 1DN0B 4MDIB 2Y4SA 4BK5A 4S1SH 2HTLC 1BD2D 2WUCL 4L8SC 4NBXB 1CESA 4UW5A 1PYWB 1YEJH 3KVQA 3AZXA 3GMQB 3UYRH 4ZODA 1BQSA 2Z92A 1T04A 3D87B 3LKOA 2DM7A 4XP5L 4BM8A 4QHNB 1C7SA 3O9WA 4M03A 1P4LA 2PO6C 4P2QD 3V95A 2BY0A 1KULA 3RI5K 1FO0A 3X3FH 1JNJA 1MCDA 3W39B 5DG2A 2R1WB 2HFGH 3L3JB 4JPKH 1BLNB 1MCKA 3N7MA 5GS1C 2VXVL 4Y5VA 4DEPC 4N9GA 2P3JA 1BJMA 4MJ5B 3U6RB 1BOGB 1H5BA 4IRZH 4ZTOH 4HL0A 3S37X 1MJUL 3ZKQD 2QKIA 2MJWA 3P9WB 3VXSE 3A6BH 3HRPA 4LCCC 1D5XA 1T3FB 4MD4A 5CP3A 3QJHA 4HBCL 3H9SE 4AT6A 4Q6IC 1OTUC 3U83A 4RAVB 1ZHLB 3GB7A 4Q8LA 3WKML 5D2NE 3ZTJG 5E2JA 3LHPH 2J2ZA 2L0DA 4GG6B 1P9MA 1A7PH 1NGYB 4NC1E 5T33H 5E24E 1DDHA 5SWZD 3BD5A 4K94C 5TFSL 1DLHB 4PY7B 5J06A 1AGFB 4BPZA 1NANH 4FABH 2XWBB 4MLSA 3CFBA 2E3VA 3P73A 3GMRA 4ODVH 4JR9L 2GY5A 4OIAA 5DQJA 4F33B 5DD1L 4JFYA 1JGDB 1H3GA 4XNMA 1BF2A 1Q0XL 2MMXA 5JW4Q 2B2XL 4AVSA 2OTPA 4NO5A 3T65B 5IHZB 3WFBH 4PCRA 4FPEA 5B38B 3WCYA 3O11A 1ES0B 3LCPA 4RX4A 3EDEA 4DFIA 1YECL 4XMKH 3H7LA 4GAFB 2WAHA 2OW4A 3FN9A 3VG0H 3MREB 4ZD3H 2Z4QB 3QXTA 4B41A 5KVGH 1A1MA 4R2GB 1IM9D 1C12B 43CAA 3ISWA 4OCYH 5FCUH 4J6RH 1NC4D 1SLIA 1WWBX 1NQBA 1PW3A 3ALWA 3NACL 4OZFG 1H3PL 3BGFB 3OZ9L 2CLRA 4NP4H 2ITDA 2X9YA 1OOAA 1RU9H 1OVZA 2VL4A 2WKKA 1HILB 3FN0L 3SGKC 4HIIB 4KI5F 4GAYA 4PP1C 3SE4A 3TA3A 4S0TD 4Q27A 1MNUH 4DKDC 4EOWH 4P5TD 2NY5C 1ZHKB 3VGEA 4RIRA 3QIWC 4FQLL 3O6LH 2X4PB 2GUOB 5DRXA 1MAMH 4H0GA 4Y26A 3RL2B 4RBPH 1MHCB 5DMGC 1N1TA 5IFHH 1QPPA 1FVCB 4HX1B 3IDYC 5I74C 2B1HH 3UJIL 2AXFB 2A2QT 1FO0L 4GKNB 4P23D 5D9SB 2VWEC 3S35H 1K8IB 1NGQH 1QLFA 3DROB 4WCYH 2P8PB 4NQDD 3BN9C 3PWPA 5F1IA 3PWVA 2IH1A 3VMNA 1I8MA 3H42L 3TV3H 2R16A 2C1OB 3O6FA 4QRRD 2H6PB 3T2PA 4JRWA 4UTBL 1BJ1H 4XPHL 2XN9B 4ERSL 1YQ2A 1GGUA 4ELMF 2YOCA 1DN0A 4MDIA 4KROB 5EC1B 3DGTA 2LU7A 3IDGA 1AD9B 5DD5L 5CJQH 3IT8D 3B01A 3TO4D 1TFHA 3PP4L 4JCLA 3NBNA 1PYWA 3KPRB 3STBA 3LRHA 1GNHA 5I8KL 1A6UH 1H30A 4P2OD 3X11B 1J1XL 3HE6D 1MCJA 1QEWB 4X5LA 2CLZB 2BK8A 5IMLB 2P8LB 4HS8L 4QHNA 4JHAH 1SLBA 4JB9H 3KYNA 1BQHG 2UVEA 1A8DA 3FOMA 1KGCE 3W39A 2LFGA 2R1WA 1SBEA 1YYMH 5D7JB 1JFQL 1MUJB 3L3JA 3TT1H 4HZLB 4XJ8A 1BLNA 4KI5D 2QHRH 1SBDA 1M7XA 4WRLA 1I85A 3DO7A 3RNQA 4LBMA 4MJ5A 3U6RA 4OAWB 1BOGA 4EQ2A 3VWKB 1J1PL 1KLFA 3QPXH 4JQVA 3EZ8A 2VXRA 1CICD 1B2WH 4YG6A 2BCKB 3WFEL 3HNVL 1W6NB 1T3FA 4AH2B 3WHE0 1HLCA 2R56L 1KXVC 4MB4A 2J88L 4JDTH 4RAVA 5GS3A 2MOVA 4LKCB 3NCJH 2DKUA 4OLVL 4GG6A 3T1MA 4D3CH 1U42A 1VIWB 4JPIA 5IVXE 1G1CA 3GDBA 3S96B 2EECA 5HGBA 2WV3A 3WDIA 1DLHA 2P45B 4KTEH 5DRZB 4PY7A 1AGFA 4G9FB 2XWBA 3MXWH 4L5FH 4NFCA 3C09B 4KQ3H 4F33A 2DDQH 1JGDA 3G6DH 4ODSL 2X4OB 4AQOA 1QBMH 2QQKH 4WV1B 4RGNB 3M3EA 3T65A 5IHZA 1RZJH 5FHBH 3A67H 5B38A 4M93C 1S0CA 4F58L 1FP5A 1ES0A 3QUYD 3TCLB 4F57H 1OP3K 4ONHA 1AX2A 1KC5H 3MREA 1KIPB 2YKLL 2Z4QA 3BJ91 5DRNB 2DQFB 1C12A 1CXIA 1P4IL 2DWDA 4J7RA 1VPOL 4PJCF 4RMQA 5D7LB 1F5FA 2FECI 5SWZE 1XT5A 4JKKA 4JO3L 1FV2A 3BT2L 3SBWA 4FOMA 4LLMB 1N0XL 2EXYD 1KTRL 1AFVH 2EH8L 5BV7C 3O9WD 4JRYB 1HILA 1INDH 4PR5B 1EXUB 2HWZH 3UTTB 2V5YA 2EDQA 1RIUL 2DM3A 1ZHKA 1VDGA 5IW1B 3HS0B 3HPLB 2X4PA 5IUQA 3X12B 2A74B 2ICWI 4M8VA 4OLXL 4M4RA 1CFVH 4ONFL 4JN1L 5C0RL 2DQJH 3RL2A 1FJ1A 3V4PH 1MHCA 5FXCH 3B3IB 1FVCA 4HX1A 5DLML 3BP5B 4H8WH 3QUMB 1MFDL 2AXFA 1MRDL 1GLHA 5JOPD 2YPVL 2YY1A 4GKNA 4O02L 5FUZL 4IRJC 1K8IA 5C0FA 1ND0B 3TBSB 3BUTA 2P8PA 15C8L 1PZ8A 2NY6B 2BNUB 4LMQI 1OGAB 5JLVA 1G7MB 3V0AA 1M05B 3LVEA 1YEHL 3ZKXC 3NFSH 2J7LA 2C1OA 4YHPB 1PZ7A 5I1EH 4XVTH 2H6PA 5TDOB 2YZ8A 3TIDB 2LE9A 4FFVC 3R0MA 3U0WH 1AHWB 2W9EH 1KELL 3QIBB 4MNGB 3HI5H 2PHFA 4PBXA 5EC1A 3W9DB 3RAJL 1AD9A 3MMEB 1W0VB 3KPRA 3C2SA 1LO3H 1BGXL 5I8CB 1UFUA 2RHPA 5KOMC 3GNML 2J12B 3KR3L 2CLZA 5IMLA 2D0GA 5MI0B 3MLWL 5FYJH 1UZYA 3VXOB 4UNUA 3REWB 4YZ1A 5BRZA 3DWTA 1I7UA 1TCMA 4NQDE 4Y1AE 3K81A 5D7JA 4PGEB 4WWID 3SGJA 4HZLA 1FVEB 5I66B 1JW6A 2IPUG 1EV2E 4OAWA 3VWKA 1NBVL 3GRWH 3SH5A 2HRPH 2BCKA 1RINA 4F9LC 4FS0A 4P49A 5KXCA 3RVTC 1W6NA 2YUZA 4AH2A 2IAND 3GBNH 2CO7B 4JQXC 1LJ7A 3TA3D 4FPHA 5F7NC 2SBAA 3WD5H 2A70A 2MQ0A 4Q9QL 4TSAL 2A9NH 3LRSB 1IGIH 5T5NG 3TLRA 2LVEA 4DN4H 2FO4B 4MWFB 3S96A 1JRHH 2AABL 3T3MF 1SJEB 2NXYB 4P46B 1A7QL 1C16B 1LE5A 5DRZA 1PBYA 4ZFGL 2A6XA 1RUQL 4LPCA 2HKFH 1ULFA 4KI5E 1ENRA 1IAII 3LS5H 1J9CT 1ZVSB 3TEUA 4GG6F 3MCKB 4YZ2A 3EYFB 2X4OA 1BQLH 4DRVA 3PWPD 4OCLC 1MFCH 1KCVH 4WV1A 5I19L 4P9HL 1YIFA 2DQGH 5AEAA 2F8VA 3G04B 2P4AB 2BOCA 2CD0A 3O6FD 5HSFA 5KSAC 4NO4A 4GQPH 1DR9A 4PPTA 3IAQA 1H8SA 4JY6B 1AO7E 4M1DH 3BD3A 4RFOH 5J13B 2P42B 1KIPA 3Q2CA 3BKJH 5DRNA 3UL2A 1I4FB 3VKOA 2DQFA 4MXWL 3QEUB 1MY7A 2WWKT 4XVSL 1EX0A 4O2EB 3UP1A 2B39A 2H2SC 3QT2A 4DKEH 1R1ZA 3C6LC 3T0XA 1YEEL 5D7LA 4HBQA 4PFEA 2QSCH 5IIEA 5IQ9B 5EH1A 1FNFA 5D4QA 5BZDB 2JB5H 3O8XC 4LLMA 4O9HL 4M6MH 4G6AC 3BPCB 4ELME 4OIIH 1U3ZA 1U58B 5DK2B 1I9EA 4PR5A 4XCFH 4M5YH 1F58L 1A3LL 3PP3K 5IW1A 3BIWE 1Q72H 3MACH 3X12A 2A74A 4LCYA 4YGCA 1AH1A 4A2LA 1W0PA 3POYA 3MC0A 1EHLL 4GG8B 2NXZB 2F53E 3B3IA 5EFIB 3BP5A 4WHDA 2TEPA 2WT0A 1IC7L 1V3LA 3M45A 4FFZL 4Y1ZA 1FFPA 5I8EB 4LVOC 3DUUB 4QT5B 1F97A 4JY5L 5IEKB 3TBSA 2NM1A 1T89A 1SBBA 4Z7VB 1IBGH 5GRVK 2V2TA 3OKMB 4N5EC 5ALBL 2R1XB 1OGAA 1QSEB 1G7MA 2X42A 4YHPA 4P3WA 1WF5A 5TDOA 4C4KT 3HI1B 4HWUA 3TIDA 1AC0A 1P84J 1AHWA 3QIBA 4MNGA 1GPOL 2FH6A 4Z7UF 4U6TA 3W9DA 1KJVA 5IHUL 1ZT7B 4PJGB 3JTSA 3MMEA 1W0VA 4WY7L 1MHPH 5TPWH 3TYFB 4CN1A 3I84A 4X80H 1CGVA 1D5IH 5CCKH 2ZABA 3Q1SL 3V4UH 5I8CA 4YDJB 2IMMA 1VFBB 3RIAF 5L6YL 4YC2B 2OP4L 5F3HB 4M7LT 2VXUL 1KT2B 1JUFA 3C87A 1NGXB 5EG6C 1FPTH 4EN3B 2E53A 1HZHL 4NO0A 4AMKL 3DHJA 4E0RA 1OTTC 4U1SA 3VXOA 3H9HA 3RNKB 4FQPA 3REWA 4KDTA 1GOGA 4ODWB 1U91A 3T1WA 3KYAA 2BZDA 3SO3B 4UIKL 4R2GD 1KPVB 2HYKA 1FVEA 1X4ZA 2EE2A 1JV5B 2H9GB 5I66A 3GMPB 4WI2A 5FV2A 4Z7WB 3T4AB 3ARUA 4HS6B 3VGHA 3UTOA 3GKWH 2RBLA 3R1GH 4JFFA 5EC2B 4JZJC 1OQXA 2NP0A 1FE8L 3SHSA 4FXLA 5D1ZC 4OQ1A 1PKOA 1CDJA 2XYCA 4PJCE 5GZNC 1VALA 3LRSA 4UDTA 3AMLA 5JOFB 4PJ9C 1BFVH 2OJEB 2FO4A 5E9DB 2Y07L 3MLUH 1ITBB 1SJEA 1T5WB 4P46A 3HKFA 3LKNB 1C16A 3Q48A 1G7YA 1NMCB 1JHKL 3UJTH 3AS3A 3QEGL 4WW2F 3OX8B 4EI5C 2EIBA 4NHCH 1ZVSA 1C1FA 4PJEF 3MCKA 5DVOA 3HNTH 3SCMC 3OG4B 1M7DB 1AVBA 5EZJB 1CJPA 1I9RH 2ATKA 1H3WM 1ZANL 2W0KA 3QIUC 1WITA 1C7TA 4EIZC 3AYEA 1MS8A 3G04A 5E5UB 4XILA 3QXWA 1CR9H 1DQLH 4WWKC 4NOFA 5JR1L 4HIXH 3QHZL 2CNAA 2IJ0C 2XN9D 3QQ9C 4XCCH 2N4IA 5E1AB 4KROD 4JY6A 2Y06H 1F3JB 3TP4A 1I4FA 4BQBA 5AAWA 3QEUA 4S10A 4O2EA 4A6YH 1HIMH 1KG0B 3KPRD 1JE6A 2YBRA 5EBMB 3QHFL 4EXPX 4QRTB 5IQ9A 3FCTB 5C0GB 1JGUH 1AR1C 5BZDA 1N8ZB 4YEFA 2E7LC 1DIWA 1N59B 4GSDH 4AGRA 1BKZA 3BPCA 4XHXA 3FLTA 5DK2A 1U58A 4K2UL 3TBVB 4LHUB 4MCYB 4YBLC 2ZUXA 4LASL 1AC6A 5D7JD 1P53A 1TJIL 2MKWA 3QCUH 5E5MB 3U4XA 5HYSG 3SKNB 1FL6B 1ZLWH 4XCNB 4LP5A 3VWKD 4GG8A 5EFIA 2CUMA 1QYGH 4YHZH 5GLVA 1FC2D 4E41B 4QEGA 5I8EA 1IRAY 3DUUA 4QT5A 1L7IL 5I16B 3IRPX 2VDQL 3BWAB 5IEKA 3ARFB 1BFTA 4Z7VA 4B50A 1EO5A 3MLZH 1KFAL 3OKMA 5FEBA 3JV5A 2R1XA 1QSEA 4PLJD 4N1CA 3FFDB 1I1AC 2N7BA 3HI1A 2DTML 3BPLC 1R6VA 3ZSTA 4JKPH 5T3ZE 2PR4H 4KHTH 1CZ8L 2Z35B 3EO9H 1ZT7A 3LCYA 4G9FD 4PJGA 4BFEA 5KN5B 3TYFA 4M6AA 1ENQA 4CRPA 5DUML 5EZOH 1OKQA 1MF2H 3N1GC 4YDJA 1FAKT 3AXDA 5F3HA 2QSTA 1KT2A 4JGUA 1NGXA 3VH8B 2RCSL 4RGND 3T3ME 4EN3A 5T54A 3W11D 3E3QE 1QF3A 2J6EH 4LLDA 1FNGB 4K55A 1AI1L 4ODWA 3AS0A 4UV7L 1KENL 3VFSB 3UEZA 3G9VA 2WUBH 3PHQB 3QIWA 4GG6E 2DVAA 2HAZA 3KJ4B 1LU2A 2N7AA 1JV5A 2H9GA 3UZQA 1BPVA 1WTLA 4O5LH 5ABDE 3H0OA 3GMPA 4M6OL 1VB9A 1Z5LA 4Z7WA 5D7LD 3G9AB 3T4AA 3NV2A 4LSTL 2R0HA 3POSA 3GIZL 2R39A 5DK0B 1UZ8B 4HS6A 4P57B 1PY4A 5EC2A 5F7HA 3T3PF 2VN4A 5HHPA 4JRYD 4JKLA 2WLQA 1CPNA 3UTTD 4H88H 1RVFL 5E4IA 4AEIL 3HAEG 3ZYOA 3S88H 3GSWB 5ACZB 1KTLB 5JOFA 5DD6A 1JMZA 3RVVD 3GSUB 1E6JH 4KI1A 5E9DA 4LSDA 1IGYB 1T5WA 5CAZA 5DVNA 5L2KB 5F8RC 3AZYA 1WBZB 1YYLL 4KMTH 3LKNA 4UINH 3KPLB 4OJFL 3RWJB 4RA0C 4BLJA 1P5UA 3KAAA 3TF7C 3T08A 2ZUUA 2FMDA 1KYOK 3B2VL 4QHLB 4LCWE 3RRDA 4BFIB 3V0BA 3WN5B 4HH8A 5EZJA 4YXHL 2NY6D 2XICA 3S37L 4CVWA 2X1XR 1RJYB 2YMZA 3CFCH 4NZUL 1CVSC 5T5JA 1E6OH 5KTEH 1ULGA 1VSCA 4G9DB 3MUY1 3WFDL 3O2WL 1MS1A 5F9DC 1DUZB 5HD8C 3QIBD 5E1AA 4OQTH 1M1SA 5I6XC 1ORSB 1F3JA 5T1DH 4IIQB 3NCYP 4I3RL 2AGJH 1KG0A 2UZYB 3P30L 5I1HH 5EBMA 4OCSL 1HE7A 2XY2A 4NUJB 4QRTA 2EE9A 3FCTA 4H1LB 5C0GA 3HN1A 1QFWI 1N8ZA 2XRAL 3LD8C 1N59A 3NAAL 3U7WL 4LK4A 3HFML 3OKOB 1G9NH 2B20A 5JW3H 4Z7UE 3TBVA 1EAPB 1A22B 4MCYA 5KVFH 1LNUB 4XMPH 2IEPA 2KDGA 4Z8BA 1L0YA 4RMVA 2K7QA 1QBLH 5B39G 1GGBH 2P7TB 1I1RA 5E5MA 1CLOL 1FYHB 3SKNA 1U0QA 4PRIB 3VDAA 1FL6A 2X9XA 3NV1A 1LK3L 7FABH 2CDFB 5I1GL 1LEDA 4HGWB 1TZHA 4YG0A 1KLGB 1J88A 3BP7B 3KHOA 1QFUL 2E8YA 5FCSH 2YRPA 4E41A 3BI9X 3E1F1 3KPRE 5I16A 2P44B 2KYWA 3BWAA 1YQVH 3ARFA 3WUCA 3X3GL 5M94B 3DRQA 3S3PA 4LSUL 1YJDH 1MCQA 4X7EC 2IF7A 4E5XB 1JP5A 4PB0L 2ADJB 1U8IB 5J6HB 2JD4A 4RMWA 2Q5TA 2FLRT 1GANA 2NXYD 4P46D 4KH2A 3QNYB 5BRZE 3MEPA 4Z8FL 3CDGB 3UX9B 3ZDYF 5J4MA 1U8QB 2A6YA 4KK5C 4BFBD 3OYWB 3D2UB 5H9RA 3ZYPA 2DTYA 4CVUA 2Z35A 4YDLC 5KN5A 4Z7VF 1CGUA 4GS7B 3P11L 2DKSA 1ZT4B 4FFWC 1J8HB 4NPYB 4XNUH 4Y5YB 2F8XC 2V7NA 5CZVH 5D7IA 4BZ2H 1BBDH 2V5TA 2AQ3A 4YGDA 3VW3H 4LSVH 2R0KH 5CLTA 3ZXFA 5D6CB 1FNGA 4EVNB 3WG2A 4PJGF 1UJ3B 3VFSA 4JO4H 1I3GL 4UB0H 1OQOA 3G6JA 3FMGH 3PHQA 4PJEE 3MR9A 3G08B 4MXVF 5KVEH 3L5XH 2QQLL 4FFYL 1A6WH 5F8QC 5IFAL 1MCOH 3DETC 4ZPTB 3IDXL 3MRBB 5IB1B 1QG3A 4N0RA 5DK0A 1UZ8A 1ULVA 3QCVL 4NJ9L 4P57A 4PY8J 25C8L 4UBDC 1SJVA 1RUKH 2HT3D 5CGMA 4XI5C 3RWFB 3DOSA 3RL1B 1IKFL 3IDUA 1NLDL 4XBLA 5DXDA 1IZKA 5CP7A 5EDXA 1TTUA 2Q8BH 4RGNE 2VUAA 5IBLD 5F3BB 2E7TA 4IRSC 3GSUA 1E4XI 3NPZB 1IGYA 5L2KA 2GYSA 3R8QA 2NXZD 3VXPB 3VGBA 1QHPA 1DQJB 3GSNH 4U0RC 1IGFL 3JWOH 3RWJA 4M6NL 1BMGA 1H3TA 4QHLA 1ZSDB 5D7SH 4BFIA 4HULB 1JZ4A 3TBYB 3GO1H 3WN5A 4FQHB 1UVQB 4R4FL 5JLZB 1QKZL 1FIGH 2YZ1A 2DMCA 1RJYA 3FO2B 1QSED 3FB8B 3FQUB 4XAWL 5GZGA 3PV7A 4YPJA 3O45B 4UW6A 1MRCL 3VV1A 4G9DA 1G8WA 4MHHI 5LAXB 1DUZA 2O5YH 4K71B 2IPKB 3OF6D 4CKVX 1FH5H 1ORSA 1JBCA 4IIQA 2PETA 2XT1B 3HB3C 1LD9B 1G7PB 2EC9U 3HTLX 4EQ3A 4V1DE 3R05A 1N3NA 3DUSA 4H1LA 1X9QA 4Y4KC 4EN3D 4LLUA 4ISQA 4XGZB 4GKSB 5F7FA 2P5EA 4ZUWB 3OKOA 3ZHKA 4GMSH 4GWMA 1EAPA 2DWRA 5CIPB 3W5NA 1LNUA 3MZTA 3UBXG 43C9A 2GFBB 3RX8A 3EOTH 2P7TA 1MFEL 1XIWB 5LVEA 1OGAE 2QHLA 3S6CA 3VXNB 4OT1L 4N8CH 4ZYKB 4POYA 3SDDC 2CDFA 1SVZA 3PVEA 4OM1H 4MJ4A 4P4KC 3VXMB 5D7KD 4HGWA 1U3JA 4NC0B 4MNGE 2EXIA 3O0XA 3BP7A 2X4TB 3FO9B 5GQBA 2OL3H 3HE7C 4PTTB 2VLRB 3P4LA 5BXFB 2QADB 2ZKHL 1KB5B 2Q8AL 2JJWA 1MJJB 4XXCC 4XPTL 1H9PA 1AXZA 2ADJA 1O5DT 1U8IA 3N9GL 5J6HA 1QOTA 4OCXL 4Z7OF 5CD5C 2AEIT 3BKML 4G6KL 3ENRA 4X4XB 3ARPA 3QNYA 4P3CH 3T3PE 4Z78B 5C0CB 3CDGA 5T3ZH 1OM3H 1U8QA 4UV4H 4X6DB 3OYWA 3D2UA 4M62H 3JWDC 4MA1C 3SQOH 2VKXA 5DI8B 2WLYA 3OR6A 5E08H 2PYEB 4YHOL 3F12B 2DIAA 1A5FH 1ZT4A 5IJKA 1J8HA 4NPYA 3UC0H 4Y5YA 3PXHA 5GS0C 5EORH 5DFTA 2GNDA 2G60L 4JFFE 4S1DC 1GYKA 3ILPB 1WAAF 5D6CA 2H2PD 3OJDB 4KWUA 1RUPH 4EVNA 4U6HB 5J89A 2VB5A 3WLWC 4PRDA 2NTSP 1LHOA 4YG3A 4DVRH 4GW5B 3FRPA 3SY0B 1AJKA 2NZIA 3E6HB 3G08A 3MNVA 2BY2A 5D7IF 3MLYL 4Y1UA 2EDJA 3TYGH 2CXKA 2BVOB 3O41B 1NFIB 4MS8C 3BZDA 4ACPA 1E4WL 5DHXB 4NN6B 3LEXB 5IK5A 1INEL 1MCCA 1M71A 2P2KA 3RL1A 3G6JF 2FX9H 3CH1B 1JN2P 4LHUD 1T22B 3UPRB 3GGWB 3C60B 2EYSB 1CIUA 3KPPB 3ZT7A 4K1YA 5F3BA 2G5RA 4UAOC 1GC1C 1HWGB 3ULUL 4WFED 5GPRA 4CMHB 3MO1B 5IKCB 2CIIB 3O0VA 1KN4L 3VXPA 2YN3A 1DQJA 4PD4J 2EDEA 2CKBH 5E2TH 2DBLH 1OY3B 4G6JL 1EBPA 2AJYL 4E41D 1GSLA 4HXAL 5ESVB 4TRPH 3UJOA 2DLIA 3LZFL 4DJMA 4OGXL 2YK1H 3TBYA 3ARFD 1DVFB 4FQHA 3I9GH 3P9MA 4XBGB 5JLZA 5IMKB 2XV6B 5J3HD 3BGMB 3FO2A 4HWZA 4TTDC 5D71H 2V5MA 3O45A 1FLRL 4KZEL 3VFVB 4FPFA 1GZPB 4P5MB 1GSMA 4N0FB 4XX1E 5ITBL 5LAXA 3BYTA 2KH2B 4XP9H 3EJZD 3ORJA 2IPKA 1MPAL 3MGTB 4K8RL 4L9DA 4KZDL 1IS5A 4QXGH 4JVUA 3MXVL 3KPTA 2CGRH 2JKXA 1LD9A 1G7JB 1G7PA 1IC4H 3TPUB 4OF5A 4I2XB 4X7DC 3RVXD 4M5ZH 1TTFA 1FX5A 3EOBB 4GKSA 4JZJA 2WBJB 1G9MC 5E6ZA 4ZUWA 4OD1L 5E4EC 1DQML 1UENA 3ZDYE 4MD0B 1EA9C 3EOYG 5CIPA 2VDLH 3HZMB 5HDQH 4YQXL 4B53A 5MENB 5CZXC 2VZSA 4Z7VE 2VITB 1WISA 1MREH 1RURL 2GKIA 3VXNA 1IAIM 3QRFM 1RIVH 3MCLL 4NYLA 4OIBA 1KN2H 3RUGB 2DQUH 5FYJU 3BZFB 4DK6A 3MRHA 5I76B 2NY3B 1DUYB 1KBGH 3U7AA 4ITCA 3A0NA 2A3YA 4KKAC 4OBSA 2X4TA 3FO9A 2XQYG 2OR7A 3EYOB 4PJGE 2VDNL 4PTTA 3VGFA 2NY1C 1NGWB 3NCYS 5BXFA 2H26B 1I7RA 4MXVE 1KB5A 1MJJA 1YXWA 4F9PC 4GUPA 1S8DB 2A6IB 3TPKA 4UW4A 1I8LC 3OPZA 5GHWH 4Q0XH 2VKWA 1LDPH 1CK0H 4FQXC 5L2KD 4D0CB 4X4XA 1NL0H 3MBXL 3TIEB 4X6DA 3JUZA 5ILTH 4WU5B 5FKPB 1OFSA 5DI8A 1HN1A 4K3DL 1V6KA 2PYEA 4OFDA 3F12A 3FQTB 2VXQL 5A2FA 4UTAL 4OZHB 5D7KE 4ZSOB 2VLKB 2R23B 5BO1H 3WDWA 2WNGA 1TJGH 3ILPA 2D43A 4U1KA 3JV0A 2JJUA 5L7XH 2VWEE 3RGVC 5JNYB 4U6HA 5JZ7D 1JN6B 1NSNH 2HN7B 2X44D 4GW5A 3MYJB 2LU3A 3SY0A 1JXNA 1Q9OB 3E6HA 2EICA 1QMJA 5IB4B 5GZOC 5GZFA 2EDKA 1Q8QA 2BVOA 3O41A 1NFIA 4PRBB 5E9DE 3U2SB 4KKBD 3ULUD 4JHBA 1NUGA 3PJQA 1JF1B 4W81A 2AQ1A 4HJJL 3U9PL 1BZQK 4K3EL 5GGRB 4N0YL 1IQWH 2E7MA 1CFQB 3K4ZA 4LVNC 4PRPB 3A6OA 5EOCH 3MROB 5DA0B 2NNAB 2NTFB 1WLCA 3CH1A 2PKDA 3BQUB 4TNVF 3GGWA 3C60A 4ODUB 3M3OA 1R5VB 2EYSA 3KLHC 2A6KB 4YDIH 5FECA 3U4BH 1U3YA 5DC0A 4PRID 1J8KA 4P5KB 3MO1A 5GRUL 3WNPA 2CIIA 4JM2C 3SE9H 4Q9CA 4LQFH 1JPTL 1NCTA 3NIDF 4U3HA 1YYNA 2OYPA 3WXWL 3ME0A 2FO1A 2VO5A 4L8BB 1VACB 2VDKH 3V65A 2QEJA 3WNKA 4OGAC 4K23L 3VWJC 5ESVA 4J3XA 3Q0HA 5I1KH 4K8RD 5DMJB 2IMNA 5DTFB 3GEWB 4XBGA 4XDQA 4PLKC 4OLEA 5IMKA 3L3GB 12E8H 4FQ2H 3FT4B 2GTWA 5J8OA 4RMTA 3BGMA 2GK2A 3U7YL 4PG2C 4ZG1A 3QXAB 5I1IH 4APQC 2F58L 3GSOA 4IS6B 3IAGC 1GZPA 4N0FA 3OBAA 1OD9A 4WO4C 2D3RA 3MODL 1UACH 4FTVB 3KS0J 3D2UD 4HANA 2EH7H 3MGTA 4W68A 4CUCA 1S3KH 4TPRH 4WFEE 5IB2B 1D6EB 1CDGA 1KB5L 1QZ1A 1G7JA 3TPUA 4M01A 1J8HD 4I2XA 5L8KB 3I6KA 3OPZL 4M7ZC 4B7IA 2OZ4A 1S78D 4Z7OE 2J8UF 2NY7L 3EOBA 2WBJA 1LHVA 4E41E 4MD0A 2MPAL 3HZMA 4YO0B 5B38G 5MENA 1N6QH 1HWHB 1KJ2H 1V5JA 4M02A 3BHBB 3EYQC 3SDYL 5H94B 4BM7A 1F4YL 1MFAL 1CVNA 3RUGA 2BSTB 4IHOB 3BZFA 5KS9B 4G5ZH 5DJCA 5I76A 1DUYA 4HKJB 4P4RA 3MRPB 1D5MB 3IFOB 4RA3A 1YEKH 3EYOA 1UGNA 3O4OC 3QR2A 4CADB 3B83A 3LAFA 1CXEA 3NFNB 4LPUA 2H26A 4HZAA 5D7IE 1RK0B 4XCYB 4Q1RA 2J5LC 1S8DA 3E2HC 2A6IA 1TVHB 1XF3A 1JI1A 4NCC2 4YHLH 1IAOB 4D0CA 5F97E 5GGRY 4OFKA 5IVZB 5JOXA 3Q5TA 5T5FH 3U0PB 2I9TB 3H6JA 3G6JE 4WU5A 5FKPA 4YHYC 2Y23A 2Q87A 5HI3C 2EDNA 2ICES 3RPKA 1HI6B 1HKLH 3FQTA 4L3CA 3S36H 4OZHA 4JLRA 5JW4R 4QGYA 4ZSOA 5LWYL 2VLKA 2R23A 1JGLH 2CH8A 4AGVA 1NGPL 3ET9F 4ZOAA 4X6DF 5I75B 5JNYA 3EYVB 4WENB 1LK2B 1GRWA 3OAUH 4HEPG 1JN6A 3SO5A 1QD0A 5FDWB 2HN7A 5CZKA 5GJ6A 4UIMB 3MYJA 1Q9OA 4KK6C 3ULVC 3RG0A 4I3SL 3WS6C 1YA5A 2CJUH 4PRBA 2HA1A 3U2SA 5IMOB 4FNLH 3CSYB 4WI8A 5L2KE 2XA8L 4JO1L 1Y6MR 2ILLA 4G8EB 2HKHL 1JF1A 4CVXA 1D9KC 1WZMA 5J0BA 1U9KA 1OSZB 1W6MB 4L4VB 1CFQA 4PRPA 4CGTA 1B3JA 4MJIB 3MROA 2ZG1A 2NNAA 2NTFA 3CVIH 1ADQH 1OARL 4HW6A 5FDYA 3SDXB 5F5QA 3BQUA 1WLWA 4R7NA 4I0PC 1J0IA 1A0QL 4ODUA 1Y18B 1R5VA 4GW4B 1JZ2A 3KNBB 1XIWD 2A6KA 4HF5L 1FNEB 2GNTA 1BQPA 1OAYL 4P5KA 2OZ4L 1RUML 2BJML 3VXMD 3NCCB 2UYLB 4L8BA 1X7QB 3UO1H 1E4KC 4IOFD 1QFWH 3DSFH 2VLRD 1DLFL 2XWJB 2A83B 1YRZA 2QADD 4N5UA 4YLQT 2VUYA 3L3GA 4HLZG 1QR1B 4BSWB 5GLZA 3QXAA 4S1QL 2P5EE 2AV7A 5JW4N 4IS6A 1W8NA 5GGSY 2X7LB 2X89A 1V3MA 4UQ3B 5E00B 5K9QG 3MPPG 4NQTA 4M3JA 1NMAH 1FBIH 1P7KA 5C0CD 4LOUC 4FTVA 4Z0BH 3SKJH 1WTGT 4XHJD 3C5ZB 2CUIA 5IB2A 1D6EA 1T66C 3DX9B 2PYED 1K2DB 4LPWA 1KTKE 4GAJL 3S3JA 4K94H 2D6OX 3KYMB 3KLSA 5HYFA 1F3DJ 4CJ1A 1LODA 1R3IH 4CDHA 3WXVH 4FQIL 1S9YB 4RL7A 4XWGH 1D3CA 4PRHB 1VFAB 1KITA 4HK0B 2BVYA 4YO0A 5F7DB 3TN0C 1S9VB 4L1DA 3BHBA 3WUZA 4JY4B 3V0VB 2APFA 2GK0A 5H94A 4AY0A 4OI8A 5JOYA 3SDCB 4UAOB 1NBZB 1X5ZA 2FD6L 2MCPH 4I18C 4XPAH 5CBAA 5C1MB 3I75B 2BSTA 2EYRB 2WLZA 5D72H 4IHOA 1J5OL 2VW0A 4PUBH 3SJVE 3WHE1 5KS9A 4FPCA 4HKJA 1CG9A 4BQ9A 2IPUK 2GJ6B 3MRPA 2A0LD 3IFOA 1MFBL 1EK3A 2APXA 4FOVA 1NJ9B 5JW5B 4DRRA 3T0EB 5CUSL 4CADA 4AL8L 2B4CL 1I7ZB 5A40E 2K7PA 3NFNA 3JWNC 1J8HE 2FJGB 4JJ5B 1PSKL 1RK0A 3C60D 2I5YH 4XCYA 5E2WH 5HYJA 3HMYA 3OMZA 1JHLL 4GLRI 4YFLI 4XHBA 2W9LA 1TVHA 4KKLC 1MCSA 3IJSB 2CRYA 5AZEH 2YXSA 4PGDB 3Q5YA 4MJ6B 1MJ8L 2GMMA 3GK8H 1IAOA 5CSZB 1ZLVH 5HHXL 3S8WA 3R4SA 5IVZA 3U0PA 2NY5H 3LQAC 2I9TA 2HLAB 2VR5A 3D6EA 4NWTL 3TJHC 2EF6A 4G3YH 3AREC 1HKDA 5D1XB 1HI6A 3M8OL 1DVFD 1AR2A 4WIQA 2RR3A 4OZFB 3IMNA 3SKUD 3LKSB 3EAKA 2X1QA 5IB3B 2D7QA 4PY8I 3NIDE 1MY5A 2QJDA 1ZGLM 4YGEA 1SBSL 3EYVA 1LK2A 1E4XH 5ID0B 5DT1L 5FDWA 3CNAA 4UIMA 3F6IA 1N4XL 2EALA 3P77B 1N6UA 3MLRH 3RQ3A 1PAMA 3O3AB 3GMMB 4JE4B 2FJHB 3CSYA 1K85A 2R2HB 3T77B 5GS2H 3DNKA 4G8EA 2XKUA 1LHWA 1OSZA 5I9QC 3V52L 1W6MA 4L4VA 2FNBA 1GOHA 2WBJD 4MJIA 4YIQB 1XGPB 3RIFF 5D2LF 2DVDA 3F58L 4QXWA 3SDXA 5MEND 1PEWA 2E5EA 1Y18A 3UDWC 3H2WA 5GGUB 5TE6L 1E28B 3KNBA 1REIA 4OKDA 5ACMA 1JYVA 1FNEA 1KCSH 3MLPA 4Y4HB 5SWSE 3U79A 4PBPA 4J3UA 3E6FB 2J8UE 5MHSD 2NY3D 1YPZB 1KSRA 2UYLA 1X7QA 5EBLB 2EDOA 4R90L 2NPLX 4ORZC 2A38A 3MJ6A 5F6IB 5ID1A 2XWJA 1DANT 2A83A 1TQBC 3G5ZB 1HSBB 1IT9L 4K7PX 2F74A 5DZLA 4PJIB 4GXLA 1CL7L 1QR1A 4BSWA 3AXLB 1Z3GH 2X9WA 3N1PC 5KXBA 4BELD 3I85A 2O5XH 2X7LA 3WNXA 1BQHB 3PMEA 4J3VA 1BREA 5E00A 1A14L 5HCBA 3O6MH 1BAFL 4RFNC 3HNSH 5DWUH 4UQ2B 2FGWL 2KPNA 5FHAH 3C5ZA 5GGQH 2ZZJA 4HKBB 1K2DA 3UTPE 2E7HA 1C5CL 3WO3B 4KK9D 1GGTA 3CZJA 1SEQL 1A7RL 1WBXA 5DC4B 2VLKD 1HHJB 3ULSB 4J2XA 1S9YA 1NCCL 3MFGB 3SLIA 1I7TB 2AV1B 4PRHA 1VFAA 4HK0A 1CGXA 3GI9H 1DJSA 3OTTA 3MOAH 1VFUA 4JY4A 3V0VA 3GUTB 3VXUB 5JXAH 1NBZA 1NKRA 3I75A 3V9FA 1FNLA 2EYRA 2BERA 1NEZB 4YHIB 1WFTA 4SLIA 5DMKB 4LARH 4M9OA 2GJ6A 2EEBA 1YEGH 2BXZA 4X6DE 4YAQB 5E2UL 1NJ9A 1MRFH 4GT7A 5DUVA 4PRPD 1A6ZB 5DQDH 3T0EA 2OSLB 2PELA 3D25A 2CSPA 4Y1VA 1I7ZA 2C4FT 3RKDC 3RHWK 3BQUD 4X0KB 4F15B 2FJGA 4JJ5A 1TZGH 4S11A 4XX1G 5MEQB 2XZAL 4WI6A 3FTGA 3GJEB 3AVEA 1XF5B 3IJSA 4M1GL 2CQVA 3WEXB 1CLZH 1NAKH 1T1ZB 2EO9A 4MJ6A 4PGDA 5BV7H 5CSZA 1KJLA 5ADOH 4ZFZB 4XWOC 2I07B 1YN7B 3QCWA 4XE9A 4NM8H 2DUOA 5FKAB 3HZVA 5D1XA 1F5WA 4HV8B 4PB9L 3QCTH 5I0ZA 5K59F 3V5HB 2BDNL 3WL9A 2KBGA 4F8TA 2AH2A 3LKSA 1FORL 3BIKB 3BN3B 3PDOB 4PS4H 1BFOB 4XNYH 3RMXA 2Q76A 3OKLB 3CD4A 2DLHA 2X89D 3H3PL 4R0LC 5IR1B 1MCPH 4KJQC 3LN5B 2FIKB 4CW1B 1YN6B 5ID0A 4F8QA 4FTVD 4Q2ZB 3ZKNC 2R4SL 3P77A 2YMXL 5B4MD 3O3AA 2IQ9L 3GMMA 3VGAB 2FJHA 4QHUA 2DD8H 2R2HA 3T77A 5DHYB 4QOKB 4XAKD 5FA4A 1LO4L 2ADFH 3ARBB 4UBDD 4NUGH 1X6LA 1MCBA 2LABA 4YIQA 2BY1A 1XGPA 2L7UA 1T4KB 2R9HD 1DQ5A 4L4JA 3ARGB 5GGUA 1E28A 1MIML 4F9PA 5HHNB 4JPWL 2JELL 1KJ3H 4Y4HA 5LGKA 1WEJH 4EIGB 4YPGA 3E6FA 2EDTA 1YPZA 4D9LL 4Z7NF 4Q8KA 3QPQD 3DV4B 3VD3A 2I26N 5EBLA 4WHCA 4LSQL 4F83A 3LMJH 4XRCB 2HVJB 2VXVH 3QWRD 4GRLB 4F80A 3G5ZA 3P4NB 4PJ8B 1HSBA 1C57A 4I2XE 3EKCA 1RZIB 2VJXA 3FUOA 1MJUH 3AXLA 1HHKB 3SE8L 3O3EB 4Q9RH 1MIEL 5AZ2L 3RRQA 1RUAL 1FGNH 1CWVA 4LBNA 4HBCH 1BQHA 3RGVA 1LOFC 5MENE 1CN4A 3WFZA 3RY6A 4WTWA 4UQ2A 4U0QB 3DRTA 5CINL 2Y5EA 4XVUD 3WKMH 2FCBA 4RSVA 1MVUA 3NPSC 2FYYB 2IGFL 4NC2B 3F7YB 4HS3B 3RVUD 2M1KA 4HKBA 3VKFC 5KSBF 2QSQA 2E27L 4Y1YA 1UWXK 5MHSE 3CVHH 2ZPKH 4ZS6D 5TFSH 3DUHA 5BVPL 3B9KC 1HHJA 2ARBA 1XR8B 3ULSA 5CBLA 2JB6B 4R26H 1I7TA 2AV1A 1A7NH 1F6AB 3A6CL 1DBKH 1G6RH 1PX3A 1NFKA 3PL6B 4ZO9A 3GUTA 3VXUA 1MS4A 2BVUA 4YEEA 4JPVH 4RISL 5GSRB 2DMKA 4TOYL 1NEZA 4QTIH 5DMKA 2AJXL 1UB6B 4YAQA 1B6DA 4AG4L 4L4VD 1R3LB 1A6ZA 1GGCL 4MJID 1D5ZB 1II4E 2OSLA 1OL0A 4NKMB 3WSQH 3GALA 2GEEA 3J8F7 2W91A 5DD0H 1K6QH 1JF6A 4X0KA 2J1KA 5FO9A 5JMRA 4U1GC 4OZHE 2JIXA 3ZPYA 2DB8A 5MEQA 4ZOBA 4ZSOE 4RAUB 3MRLB 5CBEB 1Q56A 5GGVH 3ILRA 3GJEA 1IKNC 4LNRB 4APQA 4XBEH 1XF5A 3WEXA 1T1ZA 3O4LB 2D7TH 2LALA 3DVFA 5J12B 4FZ8H 3DIFB 2ZG3A 4M43H 4DGYL 4ZFZA 5DG1A 2I07A 4HEME 1YN7A 5D2LE 1FHGA 3O81A 2OR9H 1CXLA 3FB7B 4HV8A 3K1KC 5LQBH 3ZL4H 4NQCB 1AXTL 3V5HA 4N0CD 3AX4A 4WDIB 4HG4J 4HUUB 2QV2A 3PDOA 1F6LL 5I17B 4X83A 1BFOA 3CSPA 5D70L 3OKLA 5L88L 5IR1A 1LHUA 1QDCA 3LN5A 2FIKA 1M4KA 4QYOB 4FQCL 4CW1A 4Q2ZA 4BQCA 4HPOH 3TC9A 1NMBH 2XZQL 3C5ZD 5IV2B 2PW1B 3AFLA 1FG2B 3HA0A 1U8LB 1YC8A 5A2LH 5ICYB 4YW5A 5L8LB 4KRMB 3V6FA 3GHEH 4ZO6A 3ARBA 4KJWC 3NTCH 4GMTH 2PW2B 5DJ2B 3E8UL 3GMOB 4NZTL 1T4KA 4YZ4A 4PRHD 1U8KB 4LVEA 4KRPC 3O12A 1DEEB 3AYDA 3ARGA 1OPGH 1QSVA 4P14A 3TWCL 3OXRB 1U3HC 3SDCD 4XMIA 5HHNA 3F7VB 3TVMC 5KXDA 1UEYA 2BVPB 2WIIA 2GJ6D 3DV4A 3CFEB 4FTVE 2V73A 3M2MA 4BYHA 2CR3A 1KIRB 3T0ED 4XRCA 2HVJA 3N50A 5AWNL 3V79C 4OZGB 5HHQB 1QNZL 3P4NA 4PJ8A 4M3CF 3BOPA 1CD1B 4S1SL 2WINB 1U8HA 3ZXJA 1HHKA 3O3EA 5JXEA 1YEJL 3TFKD 1YPZF 3V6OC 1NXD1 3FT3B 3UYRL 4FP3A 1UKGA 2R56H 3ZLQC 4DAGH 3BAEH 3G5YB 3C8KB 4WI9A 1Y0LB 2EAKA 1C5BH 4AIXA 2FYYA 4HS3A 3X3FL 1YUHB 5D1XD 3QO0A 5J1AB 2HFGL 3CMGA 4JPKL 1WSST 4HC1H 4WVVA 4MB5A 5ADPH 2LAAA 4TSBH 5I9QB 3UXFA 5BZWB 4OGYH 5DFVC 4MLIA 3FKUS 2JB6A 1MH5B 4KUCF 4Y8DC 3STLB 4PBOA 4F3FB 1QLEH 1BXHA 2V2XB 2EXJA 3V64A 3BRFA 3A6BL 5HYJE 3GJFH 5GJTH 4JZNB 5K59E 3S7GA 5GSRA 2OJZH 4HJGB 1X50A 3LHPL 1IAKB 3MLSL 5E6IB 3WDXA 1F00I 3WJJC 1UB6A 1RJLB 1EVUA 1CE1H 1E4KA 4H1LG 4JFQA 5F7YC 1D5ZA 2YROA 1Q9LB 4LSSH 4N1EA 1LGVA 4NKMA 5HVHC 3OGGA 4ETQB 5C08B 3L1OH 2OI9B 1W0YT 4HUMB 4FABL 3O6KH 4RAUA 4ODVL 3QNXB 3MRLA 3EFFB 1NFDB 5CBEA 2YWZA 4DW2H 1E4JA 3ARDB 3H9ZA 4LNRA 5F70A 4HKZA 4Y4HD 1AGBB 3O4LA 5CGYC 1DQDH 4LBQB 4WNQA 3DIFA 5HDOA 1B0WA 4ZAKC 3HI6H 3SGEI 5LXGH 3JVGC 3SDAB 3PWJA 3WFBL 2XQBL 3F7PC 5FAAA 4NN7B 4Y2OA 2KVZA 4OLXH 4XMKL 2NR6D 4JN1H 3QULB 1YEFH 3WJLC 3VG0L 4NQCA 4O2CB 5C0RH 3M1HA 4ZD3L 1SLTA 5KVGL 5HGDB 4WDIA 5D2NB 4CU7A 2YPLB 4HUUA 2BVEA 4OCYL 3ES6B 1DBBH 4J6RL 5I17A 2YPVH 4Z7NE 4O02H 5FUZH 1VENA 1S7WB 3ZYZA 4I9WE 4QYOA 4Y4FB 3RS6A 4KKCC 3LDBC 4NP4L 3GBMH 2ICEB 3UROR 4BMEA 1CBVH 5C92A 1H3VA 1RU9L 5IV2A 5L0QB 3P4OA 3MUZ1 3WDJA 1FG2A 1U8LA 4K3JH 1Q1JH 1DYKA 1MNUL 4EOWL 3MBEC 2FATH 1F45A 5F7EH 4QO1A 1QACA 2CPCA 2WWMC 3MQIA 2ZMLA 3O6LL 5E8AA 3DTXB 1A6AB 2EDDA 1MAML 4JFZH 3VFGH 5KJRH 3TNNB 5DJ2A 5I18H 3GMOA 1ERNA 2XKNB 1HXMB 1U8KA 2LTQB 5IFHL 3WO4C 1DEEA 2B1HL 1OF2B 1CGSH 3S5LA 2NY4B 3WCSA 3VXUD 5IROA 1JPSH 5KSBE 3KR3H 1EUTA 4JQIH 3RWGB 1N5YH 4R9HA 4XNZB 3S35L 1WJ3A 1OAKH 2JJSC 1NGQL 3FRPG 2BVPA 4BLIA 4QRPB 3IN9A 2IALB 1KPUB 4WCYL 3T04D 5LJYH 3OBTA 3MZGB 3CFEA 4FQQB 4JFEA 3VCLB 4PQ9A 3UJJH 3K2UH 3TV3L 1CCZA 1KIRA 1UQSB 3VFUB 1AE6H 4OZGA 1RZ8B 1CD1A 2WNEA 2WINA 4PLKD 1UB5A 5CJQL 2D0FA 5GALA 3T1LA 3FT3A 1A6UL 1MAKA 1I9JH 4JZOB 2AK4B 3G5YA 3C8KA 5H9QA 1Y0LA 2C7UB 4JHAL 4XMLH 1Z0NA 4JB9L 3RWHA 5GISH 4BH8B 1SM3H 1YUHA 4TUOB 5J1AA 1YYML 1K4CB 5E99H 3TT1L 4HAGA 3WOGA 2RB8A 4HGKC 2QHRL 5DMIH 2I27N 5BZWA 1DBMH 4UDUB 3B8SA 4FP8H 3QPXL 4GLRH 3STLA 3RZCB 4ALAL 1B2WL 4F3FA 3ULVF 2V2XA 5EOTB 4K7PY 5ESAB 1NCDH 3K0WA 2YWYA 3BKCH 3UDWA 4JZNA 1JTTA 4WTXA 1HNFA 2WQ8A 5EO0A 4JDTL 4UOW0 3PABB 4HJGA 2D31B 5E94B 4YBQC 3NCJL 1PDKA 1IAKA 4OBRA 5E6IA 4LAQH 4QOKD 5FUOL 4F7PB 3ARBD 4D3CL 5DJDB 1RJLA 5CA6A 4KJPC 1B88A 3IFPA 5HHME 3BDXA 3EYUH 1Q9LA 3CMOH 4HSQA 4ETQA 5CJ5A 4GBXB 4KTEL 5C08A 4LAJH 3BIAX 3ARGD 3N06B 2DN7A 4RZCB 4M48H 2DUPA 3C5JB 3MXWL 4L5FL 2HT2D 3QNXA 3EFFA 1NFDA 4XH2B 4KQ3L 3TH3T 3KLAB 2DDQL 4BK4A 3T2QA 2W39A 3G6DL 2XI9A 2HT4D 2MSPA 4LBQA 2D03H 3LIZL 1QBML 4MAYC 2QQKL 4OGZA 4RFEB 5C0DB 5I0DA 1JPST 1RZJL 3GRWA 5FHBL 3A67L 3SDAA 1L6ZA 2EXWC 3PQYE 4IDJH 3ROOA 3MFFB 4MMZC 2RJMA 4UZGA 2ZAAA 4MXQC 4F57L 4GRLD 1WZ1H 1R24B 3ATGA 4PJ8D 1KC5L 4YDKH 3QULA 5H9PA 4QF1B 4O2CA 1YY9C 3CXDH 5KSUA 5HGDA 2YD1A 1ZEAH 5D2NA 5DJAB 2YPLA 4L9LC 5JHLH 5JXED 3ES6A 1JZ3A 3U30C 4AEHH 2AJSH 1S7WA 1IEBB 5IVXB 5I30H 3AROA 3PV6B 5B39B 5TH2B 2ZBJA 1I75A 2DLFL 5FYKL 2ICEA 1GL4B 3CXHJ 1EH9A 4PV8B 1ORQB 4ZXBB 1AFVL 4M3CE 1CFNB 1INDL 1WFOA 2GALA 2HWZL 3Q6GH 1S9XB 2W0PA 1AXYA 1J0KA 3RA7H 1YPZE 2YXFA 5JHDD 5IK7A 5DJXB 3W9EB 2Q7YB 3DTXA 5INCB 1A6AA 2GMEA 4K1ZA 2UZXB 3PE9A 4PP2B 4RWYH 1SACA 1CFVL 1H8NA 3WFHB 3TNNA 1CLYL 2DQJL 1QA9B 2XKNA 3V4PL 1HXMA 1PJ9A 2FB4H 4KY1L 2H3NB 3Q1SH 5JDJA 4H8WL 3EIFA 1OF2A 3N35A 3PL6D 1WCBB 5KANG 3BPNB 5J6GB 3O3UN 1J0HA 1MQKH 4L8QA 1P4BH 4XPFH 1FATA 3O3BA 4QRPA 2VW1A 2IALA 2JE7A 1KPUA 2ITCB 2DLGA 4A6YB 4AMKH 5TQ2H 4EI6B 4N9OB 4TNWF 3MRJB 4FQQA 3VCLA 3VD5A 1UM4H 1FYUA 3NFSL 5IVNA 4U36A 3WV0A 4WW1B 2DYCA 5IM7B 4XVTL 1UQSA 3VFUA 1TPXC 5TDNA 4FOQA 2L4OA 3U0WL 2XQYK 2W9EL 1NCWH 1RZ8A 1WLHA 2ZUQB 4CNIB 3HI5L 3D4KA 1TQCB 4NJAH 1FNHA 1A8JH 3BH8B 5JA9A 2YD3A 2GITB 2UWBA 4YNYB 4PIRF 1LO3L 1CYGA 4XBNA 4JG0H 3ABZA 1JHTB 3O4LD 2X09A 4NDMB 4WFGD 2Q1EA 4HHAB 4KJYA 4JZOA 2XZZA 1LILA 5GZCA 2ZUVA 1PX4A 2AK4A 4J3SA 3WUWB 4OZGF 1SY6H 3GI8L 3VXUE 5ICZB 1EGJH 2NY2C 3L3HB 2HLFC 5FYJL 1HK6A 4BSVB 5M7QA 1T66D 3LPWA 5MP6H 4TUOA 3W0WB 2IAMC 5SX5H 1OAUH 4NQCD 1C1EH 1T6VN 2A6VA 4R3SB 5IOPB 4GXVH 1AGCB 5FF6B 3LOWA 4UDUA 5CJOH 4Z76B 3IKWA 3HMXH 3RZCA 1LGBA 3GRWL 4GA9A 1BJ8A 2HRPL 4M7KH 5EOTA 2JF1A 3PHOB 5ESAA 3KXFA 4J4PA 3QDHA 4HCRH 1SQ2N 2YC1B 8FABB 1U3HB 3RDTC 2MTPA 3L3DB 1F2XK 1TDQA 3GBNL 4DK3A 3RU8H 4LF3B 1UZZA 3PABA 3AZZA 2D31A 4I77L 3C9NB 3WD5L 5JR1H 3QUMH 4NN5B 2K9UA 5C0NC 4O51B 4FG6D 2A9NL 1JMXA 5DJDA 1IGIL 3EDDA 2EYTA 1GHFH 2FX8H 4YHNB 2D3SA 1JRHL 2QLVB 3QDGA 2PXYB 2VU9A 3RY5A 4GBXA 1K8DB 4JVWA 4Q6YA 4ATFA 2C4FU 4RZCA 1AXKA 2HKFL 1AGDA 5KW9H 2K1MA 3C5JA 4Y1AB 4XH2A 3LS5L 3KLAA 4X4ZA 2R0WH 1BQLL 1DQQB 3NIGF 5C0DA 1MFCL 1KCVL 2HTKD 5ESQB 2DQGL 2AP2A 3TZVB 4LASH 4XZUB 3MW4A 5FGBA 3P0VH 3MFFA 3ZT6A 1F8TH 5GM0A 1ZXQA 1LOGA 3EW3B 5FYKD 4D0BB 3LH2H 3K46A 3WLBB 5IQ7H 1NFDF 1LO5B 4QF1A 3U1SH 4M1DL 2FGZA 4X8JB 3VFPB 1XCQB 1DBNA 3GKZA 5DJAA 1G0DA 4MQXC 3BXNB 1DE4B 2ZHLA 3TJEH 1RULH 1IEBA 4ODXB 1L7IH 5IVXA 3T09A 1LOEA 2VDQH 1ZAGA 2PHXA 4M7JL 5B39A 2JB5L 4Y16D 5TH2A 4M6ML 3KDMA 1OAXH 2Y6SC 4PV8A 1ORQA 1U8JA 4XC1H 5DZOA 1IOAA 1CFNA 4OIIL 5F1NB 1UH2A 2NZ9C 4XCFL 1A4JB 4M5YL 3UK9A 1T03H 1S9XA 3QI9C 3JTTA 1A78A 4WHTA 5IBUB 2AJVH 1QGLA 5DJXA 3W9EA 3ZSLA 2Q7YA 1T83C 2W65A 3AS1A 3MACL 4LSRH 1IC1A 1KRIA 4PP2A 1CZ8H 3KYKH 3JWDH 4NZDA 2R29H 1QA9A 3MRIB 1I1EA 5EA0H 1ACYL 5HVHB 2H3NA 3RGHA 1TNMA 2FDBP 3FQRB 4LPTA 1MR5A 2R69H 5GS0H 4JFHD 5J6GA 1AO7B 3FFCB 4HJ0D 1JWSA 1D5BB 4A6YA 3NFPA 1HYSD 1IBGL 2XTJB 5SX4H 4EI6A 1F2QA 5FK9B 5E6ID 1UN1A 4WGWB 3MRJA 3LS4H 3N85H 5FM5M 2DKMA 3B2UC 1VAVA 5E8PB 1ITCA 1AXSB 4CNIA 1H15B 4ELMB 5FYJD 5C08D 3QUXB 1S7VB 3EDJA 3IRZA 5TPWL 1MHPL 5DVKA 2GITA 4X80L 1D5IL 3ARDD 5CCKL 2X41A 4YNYA 3V4UL 1JHTA 4LBQD 4NDMA 4HHAA 5JUEH 2X1PA 4CDGC 1FPTL 1I3UA 3WUWA 3LDBB 3SDAD 3T0WA 5ICZA 1UWGH 2IPTH 3AU1B 3L3HA 1ZHNB 1GC1H 2NN8A 3ILQC 1NDGB 2BMKB 3W0WA 3WHUA 2AJUH 1DSFH 1WW5A 4J23A 4DGVH 4KHXH 2EZ0D 2W92A 1UM6H 4OZIA 3DVGB 4R3SA 3WDTA 4RGMB 1J12A 1AGCA 4YE4H 2VLMD 5FF6A 2VH5H 3GHBH 1FFRA 4PBWD 4LDOB 2NYYC 4EZMA 1BM3H 4CVZB 4DGIL 1OP5H 1UM5H 1RQ5A 3PHOA 4Y4FD 3GKWL 4NRYB 3R1GL 2V7HB 3RIAK 8FABA 2FHCA 1U3HA 4DKFH 3L3DA 3SEPA 4R97B 1IL1B 4NZUH 4YLZA 4LF3A 1MQ8A 5CEZE 3IXTB 3U82B 3C9NA 4JCMA 1GH7A 1XF1A 4PYHA 4O51A 3O2WH 5C6TH 4W4OA 1BFVL 4PJDB 2WQZC 3UTSA 4YHNA 2QQNH 3MLUL 2MHAB 1HQRB 1JTPA 4ETYA 1K8DA 5B8CC 4H5SB 5LCVH 1EHXA 2J6EA 4BSJA 5IEHB 3UJTL 4N1HB 1KCRH 3BSZH 3JUYA 3QYCA 4IJ3C 2NY4D 1HHGB 5GRYA 3ZDXE 3OJMB 4I1NB 1DYPA 2E7QA 3IJHB 3VA2C 1LEIB 4NHCL 1G7LB 1G9MH 3HNTL 2CRZA 4YK4B 4QRPD 3U7WH 1GICA 2A6ZA 3FHQA 3OBRA 1I9RL 4Y22B 5JW4M 5J11C 5BW7A 5ESQA 4IBLT 3TZVA 4JGJA 1CR9L 1CLOH 2AQ2A 4HIXL 4D0BA 1TETH 1KQRA 1LO5A 3AY4A 2Y06L 4HD9A 4H55A 3VFPA 2ZUTA 1XCQA 1KCLA 4A6YL 1HIML 3BXNA 2DIBA 1DE4A 4PJCB 2FBJH 5F9WB 4NM4H 2F54A 4ODXA 1BBJB 3MJGX 2DRUA 3L3OB 1JGUL 1IZJA 3O11B 1MEXH 2AK4D 1IEHA 4GSDL 3GSNB 3RZWA 4QRSB 5F1NA 3O2DH 3OSKA 1A4JA 2BSED 2Y36H 3KS0H 5TQ0H 1G9CA 5E56A 43CAB 1N7MH 2Y1VA 3HRZA 3EFDH 5ELIA 3QCUL 4DQOH 4JFEE 5D93C 3MRIA 2JJTC 3S36X 1RK1A 3RZCD 3BWUC 1VGKB 2OMBA 3ALPA 4OZGE 1QYGL 3SKOB 4YHZL 2ICWB 3B43A 3FQRA 4J4PD 2NMSA 3K8LA 2MQCA 4OQTA 3FFCA 4RIRB 5HVWA 4PJAF 1EFXB 2B1AH 3OJVC 1D5BA 3VFRB 3MLZL 2GCYB 1R5IA 5FK9A 2EE6A 2FEDD 5DDHB 4ZAKA 1F6FB 3K3QA 1I3GH 2XNAB 3WMSA 2YD5A 5E8PA 4ENED 4S2SA 3T1FB 3UZEA 1AXSA 1H15A 4FFYH 4GBXD 1FGVH 4JKPL 4ELMA 4Y89A 4LDLB 3QUXA 2PR4L 4KHTL 1IS3A 3EO9L 3MRNA 5EZOL 1I3HA 2ZCLH 5T5LA 4JHWH 2DJ4A 1UXWA 5DZNA 1BWWA 5A16B 1MCWM 2ERJB 4U2YA 5F9TA 3PG2A 3AU1A 1ZHNA 4OB5H 3IDGB 3NGBC 2ZKNA 2J6EL 4YX2L 2OL3B 3RTQB 1NDGA 1CT8B 2BMKA 3WFCL 1UCTA 3DVGA 3DYMA 4O5LL 1LENA 3NIGE 3P2TA 1J0JA 4FXGB 4XB8A 5C07B 4CVZA 2C3XA 5FGCE 3VA6A 1U93B 5FYJE 5C08E 2JTDA 5DFWH 4NRYA 2NY0C 3KYNB 1W0WB 2V7HA 3RSJA 3INUH 1WW7A 3V8CA 3FOMB 3QO1B 4ZXBD 5KVDL 1IL1A 1NFDE 5JIKA 2DV9A 4WEUD 1HKFA 4OZIF 3EHBC 3IXTA 3DO7B 4HFUH 1IGCH 3RNQB 2ICCA 3I2CH 3S88L 4ZNEA 1T0MB 5BOPA 2ARJQ 4LGPB 4PJDA 1S0FA 2VLJE 1E6JL 3ZKMC 3PDGA