4M00A

Crystal structure of the ligand binding region of staphylococcal adhesion srap
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
501
structure length
501
Chain Sequence
TTAVTANTITVNKDNLKQYMTTSGNATYDQSTGIVTLTQDAYSQKGAITLGTRIDSNKSFHFSGKVNLGNKYEGHGNGGDGIGFAFSPGVLGETGLNGAAVGIGGLSNAFGFKLDTYHNTSKPNSAAKANADPSNVAGGGAFGAFVTTDSYGVATTYTSSSTADNAAKLNVQPTNNTFQDFDINYNGDTKVMTVKYAGQTWTRNISDWIAKSGTTNFSLSMTASTGGATNLQQVQFGTFEYTESAVTQVRYVDVTTGKDIIPPKTYSGNVDQVVTIDNQQSALTAKGYNYTSVDSSYASTYNDTNKTVKMTNAGQSVTYYFTDVKAPTVTVGNQTIEVGKTMNPIVLTTTDNGTGTVTNTVTGLPSGLSYDSATNSIIGTPTKIGQSTVTVVSTDQANNKSTTTFTINVVDTTAPTVTPIGDQSSEVYSPISPIKIATQDNSGNAVTNTVTGLPSGLTFDSTNNTISGTPTNIGTSTISIVSTDASGNKTTTTFKYEVTRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into SraP-Mediated Staphylococcus aureus Adhesion to Host Cells
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Cell adhesion
molecule keywords Serine-rich adhesin for platelets
total genus 138
structure length 501
sequence length 501
ec nomenclature
pdb deposition date 2013-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18483 Bact_lectin Bacterial lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m00A03
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m00A04
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4m00A01
3.10.20.320 Alpha Beta Roll Ubiquitin-like (UB roll) Putative peptidoglycan bound protein (lpxtg motif) 4m00A02
2EIGA 1H9VA 3P30H 4LBOA 4CKVX 1P5VA 4QWWC 4NO4A 4X83A 1ZK9A 5IB5B 3W2DL 5J6GA 4G43B 1A6AB 3Q3GB 1N4XH 1BIIA 2DV9A 2FYYB 2DUPA 1IAII 3KPSE 4KMTH 3CSBA 1YPZF 25C8L 3P3YA 5DJ2A 5C0BE 2E7BA 3HZKB 4X6BB 3RDTC 5TQ0H 3L5HA 4XVJH 4KK9D 4J3OC 4OQ1A 2VC2H 3EGSB 4QRQB 2ZAAA 2UWBA 5CEYA 4MCYB 2X4TB 5I8EA 5FFLA 2P5EE 4X7CC 3MX0A 2VH9A 1DQ5A 1NC4B 5SWZE 1MI5D 3RA7H 1XGUB 5HHXH 3ME0A 3OHXA 3C2AL 4OZHE 3QXAB 4YHML 3UMTA 1KCSL 4R7DB 5INCA 1DQLL 2NXYD 4UQ3A 1RMFL 2CUMA 3GHBH 5FGCB 4NQED 3M8OH 3BPLB 4HAGA 1FL3A 1WWWX 3S36X 3RZWA 3KDMA 2Z0BA 2NY4C 4G43A 4OF6A 1TZHA 1WBYB 4UDTB 4R4FL 1VGKB 5DMYA 5HYFA 5GZND 2Z8VC 4Z8FH 3DBXA 1AGDA 2NY0C 3NIFF 1UWGH 1XGPB 4IIQB 3T2NL 2AQ1A 1HKLL 5FYLH 1P7QA 3JWNC 5CEYB 4Z7UF 1JI2A 3CFBA 3MLYL 3NA9L 4GBXB 4D0CB 4YDVB 3MOAH 1M05A 4DZ8B 5HY9B 4IRJD 3EO1B 3H7BA 4FQIH 1D2SA 1Q1JH 4U4BA 3OHXB 5LQBH 1K4DA 4XPGL 3O3EA 5CJQL 3WUDA 1DGLA 4M62H 4PY8I 2RHEA 5INCB 1RK1B 7CGTA 3C60B 3P11L 4OCSH 2FJHB 2KZWA 4BQ9A 1EFXD 2NPLX 2W0LA 1A7QH 1Q38A 3MRBA 3O8XB 3UDWC 1KTRL 4AL8H 5B8CC 2G75B 2GFBA 2YPVL 5E2UL 3RI5F 3PABA 3T1FA 1QSFB 5KS9B 4D0DB 1EVUA 1A3RL 4N0CD 1NFDA 2HFGL 4JANB 4GAGL 4WNQB 2EDDA 2AXFB 4YW1A 3GSVB 1W0WB 1F9KA 5EU6A 3FHAA 3S8WA 4AT6B 3EKCA 4LPUA 4HJJL 4Q2ZA 4I3SL 4WV1A 3MV8D 3T0XA 3WNMA 1DBBL 2DTMH 5FYKU 4AT6A 5T52A 3QDJE 3CVHH 3T65A 2D2OA 3VI4E 1GAFL 4YLQT 1Z9SA 4IRSD 1FIGL 2H32A 5ANMB 2A9NH 1T5WB 4YX2L 2X4UB 1MRCL 3GM8A 4WFFE 2D3RA 4URTB 2BNQD 4OJFL 1XGTB 2N7BA 3ULUF 2VZUA 2G75A 2H32B 5ANMA 3AREB 4KBBA 3ZYOA 3AVEA 4N5UA 3SKJL 3EYSL 4LRNH 5IM7A 3C2SA 1CFSA 4R90L 1N3NA 1MCBA 4UAOB 1Y18B 5FA4A 2WQ8A 5LJYH 1Z9LA 3WFDL 5T1KA 5KVMC 1CCZA 4KXZI 2ZNWA 1WWBX 4OV6F 2R1YB 5A3IC 3TGXA 1J18A 2ENYA 2JCCE 5I2IA 4LLQB 2AS5M 2ZG2A 3TIEA 1CTNA 1DLLA 1W0PA 3TA3B 4XBNA 4OBRA 4QY8A 5C0CB 2J6EA 5BVJA 5L7XH 2BHYA 1K2DB 2QKIB 4GWNA 1HXYB 3KPLB 3K2UH 4NNYB 1R5IA 3V4PL 2DF3A 5C0CA 3D9AH 3BIWE 5C07D 5IESL 3FCTB 3L5WB 1PZ7A 5T5NG 4YG3A 1IM3A 2P8LA 2C7UA 5EPMA 1CQYA 1N64H 2CMRH 2F19H 1YQVL 4M3JA 1MPAL 2C3XA 4M3CB 3O3DA 1EJOL 1BQLH 4NRZB 4JKPH 4APQC 2ARJA 1N8ZA 3LDBB 2E6VA 4PB0H 4RBPH 3JWDL 2XA8H 4MS8D 1PG7X 4TUOB 3GMNA 4LLUB 3VFRB 1AP2A 2Q20A 3UC0L 4WZFA 4Y1YA 3TIEB 4PRDA 4XC1H 2YD3A 3L2YA 3ARBA 5IJKA 1VFBA 1A7PL 1ZGLB 1MQKH 4K9EL 3MCKB 1S0CA 2BOCA 5I76B 3MEPA 2EDFA 1R5IB 1AD0B 3UBXA 4U6YB 5BRZD 2J5LB 4X4XA 1FL5B 4FQXD 4AMKH 3RL2B 3MLRH 2QQLH 1X5KA 4OZHF 4RMSA 4YFEA 1BVZA 3ZSSA 4OTXL 4ZUUB 3SITA 1NCWH 5F7EH 5AYUH 3V0VB 2DVBA 3S6CA 2Y5EA 4GAFB 1BYHA 1MRFH 3G6DL 3B9VA 4MD5A 1A7RH 1GNZA 4WFED 1KN2L 2JJWA 4ODVL 4JDVA 3FO9A 4YHMH 3V6FB 3IF1A 3S37L 5MENA 3SE4A 1F00I 1XR9A 3I6KB 4WU7A 4HIIA 5FDYA 4MYWB 3Q3GA 3C5ZC 3R05A 2H2SD 3LKQB 4G7VL 4P23A 4PP1C 3QEHA 4OM0H 1JV5B 4Y4HA 1FZOA 1KCSH 3UTZA 4JB9L 1NGZA 1LHVA 4DUVA 5C0BA 4BM7A 1IRAY 5A2KH 5SX4H 4CN1A 5C2BL 4P23B 1CICD 2PYFA 1P9MC 5D6DA 1RZFH 1LP9F 1DVFB 2HTKD 1DR9A 4Z76B 1HQ4B 1UB6A 2X40A 1UYWH 3VE0A 5DD5L 3NV4A 1DVFA 2P34A 1PD6A 1T83A 1NUFA 5SWSA 3ZLQC 3GSWB 1QSVA 4Y4KC 1IKFL 3KXFD 3N7JA 3IRZA 3TNNA 3WFZA 4HH8A 4OSUL 4YIQB 4OF7A 2H41A 4L3CB 4P2OB 5IBLC 5GLTA 2WW8A 1HINL 2DMKA 5GSVA 4M7LH 5IHUH 1BVKA 4RMQA 3F12A 2E6PA 4NO5A 4AK1A 4LIQE 3ARTA 5EU6D 3TWCL 3SKOA 4HV8B 4LLVB 3REVA 2NZIA 1E28A 1D0HA 2FLBT 2FX8L 1JGEA 3K4AA 3OXSB 1NCBH 1NDMA 4Z95H 1QHOA 5T5FL 3DJ9A 3REWB 1BX2B 5EORL 4ASMB 3OQ3B 3SISA 4J2XA 5H9SA 1LEGB 2MKLC 1ZHNB 3PHOA 4KJQD 3AAZA 3STLB 4E41E 3P9WB 5K9JH 3A0OA 1UADC 4DZ8A 5ADOH 1W8OA 3SH4A 4AJ0A 1KTLB 3QQ9D 3RIAK 2DS4A 3ARBC 3GI9H 3AYEA 1DZQA 3NV1A 2BDNL 3GSWA 3O3EB 4E9LA 4PR5B 1U8PA 3LVEA 4LSVL 1A7OH 4NQDE 2YZ4A 5E2WL 3OB0K 4NDMB 3MLXL 2VXQL 3HB3D 5A2FA 1YYNA 2QLVB 2WUBH 3RWJB 4ELME 4YHZL 2Q7NA 3WE6B 2Z35A 3V6OA 1KENH 4GT7A 5HHNA 4DRVA 4DN3H 3P11H 4OCSL 3ZKMD 1FAIH 2COQA 1G1YA 2YMXL 3BKMH 1XT5A 5GIRB 1WLDA 2WLZA 2X41A 2C5DA 2XWTB 3H3KA 5FO8A 4L9LC 2KUTA 1H15A 1CXIA 3I6LE 4IJ3C 5DK2A 5GS2H 4PP2A 4U36A 1SY6A 2AV7B 1XF5A 5D7IA 3HUJB 1FLRH 1XGYL 2R0KL 1ENQA 2JTDA 4Q2ZB 4GMTL 5EZJA 4P4RB 3STLA 3U2SA 1CBVH 1I8LC 4R90H 3I6GA 1MHEA 2Q86A 1UEMA 2IH1A 1QSFE 3LEVL 4OD1L 2GDFA 5BZDB 3T2OA 1FH5L 1QEWB 3HLAB 1ONQB 5ESVA 4L8BA 1N6QL 2O93L 1L9MA 1SBFA 1PLGL 5F9WC 1FIGH 2ICES 4JFOA 4LBLA 1GGUA 2I5YH 4RGNB 3AREA 3BPNC 4OLZL 5GRXG 5I1GL 4QF1B 5HDQL 2DUOA 3V2AR 1OT2A 2V5RA 3N85H 4FQLL 5FO8B 2EH8H 3SE9H 2AEPL 1U8QA 3MLUL 5FHAH 4OI8A 1GNHA 3O6LL 2W68A 3LKNA 3ZSMA 1R3KB 1UXSA 3UPRB 2ZHLA 5C6WH 4NWTH 3BESR 4P9WA 5E2JA 3O11B 3OX8B 4UQ2B 3L3KB 4WI8A 3ZXJA 3TA3A 2UZYB 4XP1L 4JM4H 2BSRA 4ONFH 5IW3A 2YPKB 3QCUH 4HMDA 5IOPA 3KAAA 4Y16D 1IQWL 3WDYA 2IPUG 3L3KA 2CDEA 5GGVL 1QFHA 4HMEA 4NKMB 2D7TL 1FC2D 1MQKL 3DX6A 4Y1XA 1IM9A 3QCTL 1C1EH 4FQHA 1KN4L 3M1BA 4LL9A 1DUYB 2BNUA 4XC1L 4I18B 3AYAA 2JJTA 4XX1E 1PG7H 2HKHH 2VXUL 1TQCC 1HCVA 5IP4A 1LK2B 2X10A 1OF2B 4JC1A 1LO5A 2PXYB 3D18A 2Z8RA 4I77H 5E6ID 2PHXA 2O26U 5F7EL 1YQVH 3GJEB 3H9HA 4AMKL 1G9CA 4OCWL 2H2PC 5SWQA 4YGVB 3S4SA 3DUUB 5I71C 1LO4L 2GSIB 2QBWA 5MEOA 3OGCA 5DI8A 4HPYH 1DQMH 4TRPL 5DS8A 2DQUH 2GQHA 4YGVA 1J1PL 3IFPA 4LPWA 4Y2OA 3GMOA 5DJDB 1MIEL 2NXZB 1T0MB 3QDAA 5DI8B 4RWHA 1NCAH 2WBKA 4NC1E 4X4ZA 4M7LT 2WT0A 1FVCB 3BRDA 3IXAB 5H94B 4HG4K 1DYKA 1QYGL 3S98A 5DC0A 3DURA 4C83B 3RVTD 4EN3C 1EJ6A 1RV6X 4JPWH 4PJ7B 4W4OA 5KVFH 3G04B 1XR8B 1XF4B 4JRAA 3B5GA 4U49A 1HH9B 4X6DA 5ALBH 2KBGA 1H5BC 3OSKA 3FFCA 3H9HB 3NAAH 3SGDI 1MHCA 1MS5A 1LO0L 3JV0A 1K5NA 3CK0L 3ZKQD 1F4XH 4XNQB 5H9PA 2X89D 2JB6A 2ZSVA 4OI9A 4YDKH 4YM1A 4APQD 4HKXB 2V17H 3NTCL 3P73B 1AFVH 1CGTA 3O3AA 4XCYB 3AM8C 3AMKA 4EI5D 1DP0A 1EHAA 4G7YL 3DXAE 1CF8H 4IS6A 3EBAA 4ONGL 4C57C 1CONA 1CE1L 1RUQL 4FPLA 1L7IH 1F3DJ 5I16B 1A2YA 3B9AA 1U9KA 2Y4SA 3OJVC 5E03A 3RTQB 1YUHB 3IDJA 4GH7B 3V5DA 3SDDD 4IS6B 1UZ8A 1XF4A 5AWNL 1JNLH 1E4KA 3HAEA 1QVOB 3CJJA 1ACZA 2JD4A 2PTTA 5B4MD 3QEQD 3TVMC 4OM1L 5HYIA 3WLBB 1LILA 1P1ZB 1I9RH 2DM7A 3IJHA 2LTNA 4FQXC 4JAMA 1T4KA 2AYHA 1YYMH 5IF0B 5DURD 5JORB 1GL4B 5LKNA 3FRUA 1DBAH 1HYSC 4RL7A 4PJIB 3CMOH 3WXWL 5JNYA 2JLLA 4LF3B 4YAQB 5DMGC 4WI4A 1L7TH 5JMRA 3D3VE 4LSUL 2YD7A 3VXMA 5C0AA 5I8OH 1R0AH 5CJ8A 3ARFA 4DKFL 5JNYB 3LRGA 4AGRA 2VTFA 3FMGH 4XJAA 3WSQL 2NYYA 4PTTB 1DCLA 1G0XA 1KENL 3UEZA 3BMVA 5CGTA 4TSAL 5CEZL 5ILTH 1T0NB 5C0AD 1KIQA 1MNUH 1KJ2L 1FFOB 2FHCA 3UJIH 4FTVA 3VXOB 4FHBD 4L1HA 4FG6D 2D4DA 2AGJL 5C0ND 1INQA 4KI5D 2GJ6E 5E5RB 1DBMH 4P5MA 3D69A 3FZUC 2HTKC 2Q76B 3H42L 3VXOA 2BDNH 1IQDA 2Y06H 5BRZB 1TJIH 3ZYRA 5KW9L 1FP5A 1P6FA 3C6LB 4RFOH 4JY4A 1DQ6A 5GGSY 5DHYB 1EHNA 1HHHA 1JGVH 2A0LC 4QRRB 4M61A 1NEZB 3HE6A 2D43A 2OUJA 4G9FE 1ZT1B 4FXLA 4OLZH 4D3CH 1B6DA 4H20H 4LDLB 2R56L 3BSZL 5CSGA 3HUJA 3FQXA 2BOBB 4HUMB 4JFED 5J12B 4OZGA 1BD2E 3RZCA 2JJSA 3O6FA 4OFYA 4NWTL 2BZDA 2WNGA 3ULUE 4OLXH 4PRID 3PIQB 3MV11 3QCUL 4KRPD 4OGYH 4QHLA 3M3CA 3FO0H 1YY9C 1Z0NA 2VLJA 3K7UA 1JZ3A 3WLWC 3I50L 4GG6B 4S1RH 2JIXA 5L2KE 4XHJD 1JZ6A 1VSCA 2GEEA 4QHLB 3T77B 4HZAA 2QHRH 4P5KB 3L7EA 2WWMC 5IUSA 2J5LC 3RU8L 1PG7L 2GNDA 4RDQG 4GRWH 3O8XC 1GC1C 4LGRB 1V8HA 4MCZA 3ZTJH 2Y07L 1DN2A 3F7VA 4LDOB 4YGCA 1ZLSL 5DJYA 1JF1B 4YHOH 4UW4A 1GKBA 1CFTB 2AK4A 5DR5L 4EXKA 1A6WL 1FNHA 2VXVH 5IVXF 4YDLB 3RL1A 2YPKA 5DJYB 5H37H 5JQ6L 2I27N 4XWOD 4FFWC 4E5XB 5TH2A 3T3ME 1S5HB 2H2SC 1I1AA 5FXCH 4ZFGH 4JKMA 4YW5A 1IEAB 3OKEA 3L9RA 1YPZA 4QNPF 4LCWB 5CGMA 3HC4H 4KMTL 4U7KA 3KYAA 4ZAKB 3OR6A 3FJTA 3VKLA 1AF9A 4KV5F 4PJ5E 4X6EB 1CD1B 2FL5B 3QUMA 5I66B 1ZS8B 3LQAH 4NRXA 5FGSA 4YBQD 2YC1B 1KDMA 2DJ4A 2VXTH 3M17B 1ITCA 1U41A 4NHCH 4KKAC 3FB8A 1SY6L 1OARH 5HI3C 4N0YH 5F21B 5I66A 4ODUA 2VR4A 1A1MA 3AZXA 1YNLL 4BQ6A 2E9IA 4P4KA 3E1F1 5GRUL 1MACA 1LO0H 2B7DT 2VDRL 5T5NF 5EN2A 1YDPA 1FZJB 3H3PH 5TQ0L 1ULFA 2AV1A 2ICCA 5FUOL 4XVTL 3IRPX 2AEWA 5DA0B 3SJVA 1T2QL 4FFVC 2EDRA 4LBEB 3ARRA 2DL2A 1IZJA 2VDPL 4LBNA 4FVVA 1XF2B 3PWPE 3GSQA 1S5HA 3MNVB 5DK0B 4HUXB 5J9PA 2APTA 3FN9A 3NN8B 4Y20B 1J1TA 2OI9B 5JXAH 1TETL 1CD8A 4ISQA 4HKJA 3OR6B 2C3VA 4UIKL 4X6CF 2WWKT 2FL5A 3B00A 4BSWA 2CDGA 3OR7A 1A8DA 3QA3A 4GKNB 3FQUB 3WDWA 1HH9A 2VLJD 3I3DA 3WIIL 1RUAH 1JNLL 5JDSB 3ULUL 1E4XH 1T1WB 2YRZA 2Z93A 2VWEC 5CHNB 1R3JA 4U7MA 5DFTA 5HDBE 4PRIA 5DXWA 4CUCA 4R96B 1G9MH 3IGAB 1S9WA 5CILH 4KRPB 5HHPB 3TO4C 4KK5C 3OJDB 2XKNB 5JIIA 4PJFB 4PRIB 1CQ9A 3H9SB 4WUUE 4JM2B 5FCSH 4HXBH 5DMKA 4DRRA 4U0RC 1OT1A 4NQUA 3CMOL 2XZCL 1XF2A 2HFEB 1IM9D 2CRIA 1HLCA 4LLMB 3HFMH 5DK0A 5J9PB 3HI1B 3D0LB 3H9SA 4Y20A 1IKNA 3QJFA 4WO4D 2A6DA 4F15B 1KEGH 5I16A 3MRFA 3B5HA 4XVUD 1KOAA 3RFZC 2FWOA 3N35A 3BDYH 3PGCB 4MA1C 3PJQA 3QDGE 5T1KD 1G9DA 5GZGA 3IXTA 3ARGA 4LCCA 3U0PA 3C8KB 3VUOA 2FWOB 1T1YA 4LBMA 1QRNE 2OUHA 3ARPA 2ZGOA 1QBML 3QYCA 2DAVA 4HUNB 4PJEE 2EZ0D 1GZPA 3U0TB 3DXAB 5D72L 4A6YH 1DQQB 2X4PB 1VA9A 1B9ZA 4XNMA 1XCQB 1S0DA 5ESAA 3MRQB 1MH5A 1DBKL 2EDTA 5F96L 1QBAA 2E51A 5C0GA 4RFOL 5MEQA 1HK6A 5EUOA 3I75A 1K4CA 1UA6L 2PW2B 1RU9H 1B09A 4ENED 4Q6IB 2IANB 1NAMH 5DD6B 5HYJE 3X12A 4XBLA 1PYWB 1GAFH 1N0XL 4G3YL 3WS3A 4POYA 3BSZH 4Z7VF 5BO1H 4HS6B 2CKNA 4PJGF 5HVHC 4BLJA 2BNRE 1N1SA 3ELAT 5JOWA 2RGSA 4AQOA 3BZFA 4XPFL 5FYKE 3SDAA 4KJQC 2MHAA 3SCMD 3O4OB 4MD4A 3V6BR 5ILTL 4YHIB 1BZ7A 2EDOA 3MYJB 5EUOF 5IFJA 3S96A 5DURB 4HWEL 2NY3C 1KJ2H 4U3XA 4U2ZA 4BK4A 3QG7L 2R1XB 4XX1G 3SY0B 4P23C 1G9NC 3S9DB 2R0LL 3JWOH 1ORSB 3FB6B 3SGKC 3RY6C 1JNNL 1VKXB 3QXUA 1NCDH 4JY4B 2BQPA 3R06B 5TFSH 2VWEE 1BHGA 3N1GC 5HGBB 4WCYL 4ESKA 4MWFA 4JZJA 1BJ8A 2CKBH 4XP6L 3FOMB 5DF0A 2GN7A 4GRWE 2XZQH 3OPZH 1QRNA 3NFNB 2NZ9A 3BH8B 2DRUA 1S78D 3HZYA 3D25B 3I4IA 2GSGB 5L7XL 1RUKL 3AJZA 1DUZA 2A6JA 5ID1A 4PLKD 1JWSB 1M6OB 3QPQC 3T1MA 4JFQB 3O6KH 3TYGH 3GRWH 1N5YH 2VISA 3DLQR 3BOVA 1QRND 5DUXA 1SCRA 4NN5B 3HG1E 3LS5H 4KVNL 5DJ6A 3V6ZB 1SJEB 1VALA 5E8AA 4HKZA 1ZT4A 5IT2H 3S35H 3SE3A 3RKDD 1VEOA 1JE6A 4W4OC 5AZEL 2P5ED 4IBLT 3INUH 4QHUA 3LEYH 3FQNB 1OGAE 5GS2D 2CIIA 5SX4I 3LHPH 3VFTB 1WIUA 3TF7C 2OTWB 1YEEL 2AENA 1UH3A 4HJGA 1SEQH 2DQFB 5ICZB 4OUUA 4TVSa 5D7LA 3JUYA 3RY6A 2GSGA 1NANH 1T7ZA 1NC4A 3ZXLA 1HILA 1T03H 3TH2T 5JHLL 3BW9A 4F9LC 1KB5B 4WY7H 1WTLA 5GGVY 5JXEA 1JGUL 3AP4A 2WWKO 3X13A 3BWUC 4R7DA 2GCYA 3CFCL 1T2QH 1GZQB 4O2CB 3RWFA 5K93A 3PWPA 2DU1A 3HI6H 3VW3H 4RQQA 4JRYE 4M6NL 4P9ML 3QFJA 1B0GA 3P9LA 3GMRA 4MJIB 1NKRA 3EYVA 3QG6B 1LNUB 3VXMD 4O2CA 4W6XB 5E6IB 3RIAF 3VD5A 5T3ZH 3SNMA 1ZS8A 1NH6A 1A02N 1A7RL 1IGJA 1H3VA 2FSEB 3RPIA 4WI2A 4YDIL 3DUSA 5DLMH 1EO5A 1LNUA 2NQCA 1DIWA 4RWYH 2DQFA 1SM3L 2XYCA 4LCIL 3TN0C 1J11A 1XGUA 3JBG7 3SKNA 1UYWL 1CIUA 2QR0B 2ATKA 5LK5A 4RMRA 3SQOH 4F2MB 1IGCH 1SY6H 1GPOL 3U9PL 2VDML 2R1BA 5F72S 4L8CA 2I9TA 3RZCC 1Q9WA 3AB0C 3MO1A 4LCWE 2A1WL 1GGBL 4BLIA 2CPCA 1SYSA 3TT3L 5ITFA 3VXNB 4KTDL 2NY3B 4N9GA 4XVTH 3CFIC 2Z9TA 5J1SC 1UACL 3AREC 1R5VA 5F9OL 2DURA 1MHHB 1VENA 2DL9A 4Y26A 1PJ9A 5T55A 3VJ6B 3EOTL 3QUYD 3MRLB 1TETH 2EKJA 2WUCH 2NY6B 2P8MB 1TNMA 4CGTA 6FABH 4D9RD 1ADQA 4O9HL 3QP3A 4ZOEA 4FZ8H 1OM3H 4PJHF 5EUKA 1KJRA 1DN0A 4EUPG 3ZYIA 3TH4T 3GO1L 3KPOB 3IMNA 2O61A 4X99A 4C56D 1KFAH 5H9QA 4C58B 4FOVA 4LKCA 1CIWA 3MJ7A 3BGAA 5JHDA 5B21A 1TJHL 4BFEA 5C0EA 1T5XA 5K33A 2O61B 4UQ3B 4UIMB 4P3CL 1YNTB 2H8PB 3D0VB 4XPBL 3VG9C 1ZSDB 4HUUA 4A2MA 2A77L 4Q1RA 3SDCA 3GSVA 5KXDA 2W65B 1U8NB 4M8QA 4NN7C 4KQ4L 4R2GB 2V5SA 4NZJA 5FA4B 3HFML 2UWAA 1IL1A 2CLZB 1KIRA 1MFNA 4NUJA 1S7UB 3BQUC 2ZUWA 1BFOB 4M8QB 1RZ8B 1FJ1A 4HS8H 1T2JA 5T1LA 4JFFE 4YEEA 1ZGLM 4XVUC 1UAIA 2GALA 5FREA 1A5FH 1HCFX 4ZTPL 3SBWC 4R6UA 5B4MC 4ZO8A 1KGCE 1RZ8A 3RSJA 1ZEAH 4PGEB 2DVFA 2E6QA 4R9DA 5T1LB 3MJ7B 3DMMA 3MRQA 1WBZA 4QRTB 1BPVA 4PJDA 1QFWM 2ORBL 4WWKB 1MCCA 2L4OA 3IJYA 1RIHL 4M7ZB 3MRHA 1KTDB 4ETYA 4JG1H 1DBKH 1PQZA 1TVBA 4PJDB 2XY2A 2YK1H 5MI0B 5I1GH 3IFOB 1W0OA 3PQYB 3BT2H 4QYOA 1N2RA 4P57B 1PYWA 1EZVX 4K9EC 1TVBB 4L3EA 2OJEA 32C2A 1IEBA 4PB9L 2CK2A 3QUXD 4QYOB 5TDPA 1SBEA 1BF2A 1ZA3B 5CCKH 3HZMA 3RVWD 1YEFH 4MA7L 2P3KA 1S3KH 1NFDF 3O2DA 1WD4A 3RUGF 4Q9RL 4PUBL 3NVQA 1EVTC 2X6MA 3KXFB 5B39B 4FOMA 3CLEL 4X0KB 4OCRH 4FQ1L 1JPST 3EDEA 3F65A 4WEBH 3D39D 1WFNA 3G6JA 3CVIH 1Q72L 2B1HH 4BH8A 5ITBL 3Q6GH 1YECL 4DQOL 3ULUD 1V3MA 1U8HA 3VMOA 4LMQE 2UZXB 2VN4A 3IAPA 3BP5A 3KGRA 1JNNH 4MWFB 1UZ6F 2A74A 3MUZ1 3NCJL 1LGBA 3GSOB 3O4LB 2QJDA 2QTEA 3N9GL 4P23D 2IALB 5JO5B 3VGAC 3HS0B 4QOKD 1FNFA 4LLUA 3SE4C 1YEHH 5C09D 2XTLA 3N0PB 3O4LA 4E0RB 3EZJB 1RITA 2OZ4H 4TSCL 2H6PA 5IB1A 4V1DE 1F4YL 4APQA 3IKCB 1U8IB 1WBXA 3QCWA 4IDJL 3PL6A 1JPFB 1K8IB 2WIIA 4I4WA 4NWUH 1T20A 5IG7B 4YDJB 4WI7A 1T03L 3FT3B 1X5XA 4KK8D 4P2RE 2AJ3A 3UPCA 1NCAL 2XOTA 3U83A 4I0CC 5AZEH 5D7IF 4NPYA 3UZEA 1UQSB 2FHRA 3FT4A 1V00A 1CGXA 1I3HA 1EHLL 3PGDA 1SLBA 1UZYA 2ITDB 3WXVH 4NO2A 1KPUA 3MOQA 1MS4A 5C3LD 2P8LB 2VLKD 3TZVD 2EEDA 1J1PH 5C0IA 1G7MA 3FQRB 4R7NA 1NDGB 4WTXA 3W9DA 1ITBB 2NYYD 3OAZK 1K85A 1J05A 2KVZA 3GSUB 3QDJD 3VD9A 4NO3B 3QUYA 4J6RH 4JDZA 5CKGA 3N1QC 5HGDB 1FHGA 4LCIH 5CP3H 1U8IA 4P2CG 3V8CA 4ZPTB 1XAUA 2EYSA 1ZE3C 4LPVA 2P8PB 4TULL 4I13B 4J12A 3PWPB 1P53A 2ZCHL 1U8JA 1CIDA 1IKNC 1E27A 2FYYA 1YO8A 2D6MA 1A6VL 1HSBA 3CFJB 3QEQE 4EN3B 5CBEB 1G7IB 4LHUG 4PS4H 5CJQH 4M7ZC 3UBXB 3C2AH 3LCPA 2ITCA 3N7LA 1KJMA 3VMPA 1UN1A 1FL5A 5D70L 1V6MA 4PJXA 3OKMA 1N47A 4DVRH 1R3HA 1N6VA 4NQCE 4V2CB 3LQZA 4XMIA 3PP3H 1UEYA 1AFVL 5K59E 1OY3B 1K4DB 4R0LC 1A3RH 5FV1L 1X4XA 2IC2A 3Q1SH 2FJHA 2IPKB 4ODSH 4R8WL 1YMMA 4FQCH 3GSUA 1HKFA 1FFNA 1N59A 4S1DD 1G6RH 4MJ2A 5DVNA 5HGDA 1RUQH 4RBPK 1A4JB 1U8PB 1L7IL 2IFFH 1DBAL 4NDMA 1QFUL 3KPRB 4N9GB 3K4DA 1F4WH 4U1HA 1F2XK 2J8UF 4KUCD 3J7HA 3BODA 1JK8B 1OAQH 2VZVA 1NC2A 3VH8G 3VWJA 4LSTL 4POZD 5IIEB 2DWEA 4Z7UA 1ULCA 4PJFF 4GRWF 4M4PA 4OM1H 2ZKHH 4DOHE 4NQDB 1MAJA 4WHTB 2DBLL 3T04D 1OPGH 5I8OL 3WMSA 4FPEA 3ZDXF 4RGNE 1AGDB 2C3HA 3EOBB 2Z91A 3U82B 2AV7A 5T33L 4GW5B 3ARED 4L4VA 4YFDB 5E8NB 3VFMA 3ZSTA 3EHBD 5FOJA 3KYNA 3T0EE 3WHE1 5BOZG 3VE0B 3ARZA 5DZFA 1M05B 4NOBA 4CW1A 1RHHB 4L4VB 3IM0A 2IGFL 5DC9B 4LSUH 5BQ7B 1YIFA 1FLTX 4PJEB 2XZZA 2A7AA 1PEZA 3C5ZD 3U36A 4J4PA 4UNTA 1I4FA 4EI6B 5AD0A 4YQXH 2B0SH 3ULVF 3PP4L 1MCPH 2V7NB 3V0BA 1RIHH 3H3BC 1ZEAL 3BO8B 1QSFA 1HZHL 2FEEI 3AB0B 3VFGL 3DVFA 4CDGC 2AJXL 4KMLB 1U8NA 1OSZB 4JY6A 3V79C 3MBEB 3MA7B 4CBPA 1IL1B 2CLZA 4LBKA 4LSSH 4K3HA 3MLSH 1LODA 3KPSB 3D9AL 5D96C 4OZFH 3MLVH 4X7DC 1QSFD 2BXYA 2NP0A 4HFUH 1A78A 1QACA 5T1MB 1NGXA 3X3FL 5BS0A 1MS3A 1JHNA 1AY1L 1JRHI 1CT8B 3P0YL 3T0EA 4IRJA 3CVHB 1J0YA 4F33A 3SDXB 1AKJA 4WW1A 3QDME 2UVFA 2VZ1A 4UINL 3L5WA 5DT1H 2AJUH 3G6JE 4M7KH 4DN4H 4DKEH 1IM3B 1FYTB 1FNYA 4FPHA 3E6FA 3QDMA 4PUBH 1QSED 2Z35B 3L1OH 1PQZB 2XN9B 4DAGH 4BKLA 4FS0A 5IVZA 1U8QB 1A7NL 2XQBL 3PF2A 5DC4B 3MBEA 1X5LA 1KLGB 2UU8A 3LEXB 5I17A 4TUKL 2WMPA 3UP1A 1IZKA 1SLCA 1D5ZA 3VD3A 3KYMA 1NC2D 4F3FB 5D9SA 3P4NA 3VFPA 5ISZD 3OF6D 1PKQE 1A6WH 1JTPA 5C0DA 1Q8VA 3CGTA 1AXKA 4YGEA 4NQCA 2ZMNA 4L8DB 2XPGB 5DJXB 1EJOH 4PJDE 5CZKA 3USUB 3U30B 3MXWL 3X11B 4YM3A 3PQYE 1GSMA 2DOCA 4ZFZA 1MI5B 2OSLB 4IOFC 2Q6WA 1IS4A 5DWUH 4ZUUA 2XPGA 2EXKA 3UO1L 5MP6L 1J1XH 4I1NB 3MLPA 3PMEA 5L8JB 4JFFA 2BY2A 1CWVA 3VDBA 2DI9A 4U1MA 2ARJB 5H35A 3UYRL 5MEOB 1N26A 4QHMA 4HX1A 3LDBC 5JDJA 4P9XA 2R0ZL 3D85D 4AG4L 3WOGA 4YZFE 4L3ED 4OGXH 1UXWA 1VFAA 3PL6D 1SBBA 1Q94B 4X8JA 3QISA 5C0DB 3QQNA 4Y4HB 1NMAL 5DD5H 4PJ7F 1VFBB 3CNKA 4L8DA 2UZIH 5JW4Q 1NCWL 3PVOA 2XQYG 4Y5VC 1UQSA 1S7QA 1FBIL 2WNEA 5GZNC 5BW7C 4FFYL 2RAMA 3OKKB 5E5UB 3MA9L 4H8WH 4NO2B 1C1FA 1CVNA 3WL9A 4P59L 2F8VA 4P2RA 4KY1L 4N1HB 2AJVL 2OI9C 5C0IB 4OIBA 5SWSB 1LEIA 1JPSH 4L4TB 4O58H 2PXYA 4X6FA 1LULA 4QHKI 4P2RB 4GMSH 3MRIB 1WD3A 3ALWA 4LRIA 5EIIB 5HBBA 5F7NC 5IFAL 1K3ZA 4NUGH 4N8VB 5CSZA 5HI4D 1NEUA 4XDQA 2EYSB 4ZDHB 5EYYA 5I15H 3HAEH 5LCVL 1P7QD 3DVNA 1E28B 3RTQC 3Q1SL 3T2TA 4H8WC 3L5XL 5I1LA 2EYTB 2WQRA 5E00B 3GI9L 3LKQA 4YGAB 2NZ9D 5BRZE 1G7IA 5EXOA 1NGWB 1L6XA 4AIZA 3V65A 1TJGL 3AAZB 1A0QH 2F74B 3VD7A 2GJ6D 2NY1C 5GRYA 5KZCD 4GOSA 3LKOB 1S7XB 5KSBA 4KK8C 1ADQH 1AGFA 4RIRB 5GISL 2OK0L 4XMKL 4XNXH 1MCOH 1T4KB 4K7PY 1PZ5B 3S97C 2B4CL 4HWBA 3DHMA 4PJCB 1C16B 5HVWA 2M1KA 3O9WD 1V6KA 2FX9H 1OP3K 4IHOA 4C56E 3NFPA 2EICA 4IRSC 2A3XA 5IHZB 5T3XH 1CGSH 2I25N 1S5IH 2UUDK 1D5XA 4U05A 4GMTH 4MNQD 2B0SL 3RGVD 5DUBA 3P0VL 2CIKB 5IIEA 3SKOB 5MEND 3RWHA 4WGVB 3K46A 4DUXA 5LWYH 3O2VH 3ILRA 4LFHD 4LSTH 3NCFB 4YQXL 1CGUA 4XMLH 1G9BA 1IC7H 3UYOD 1AJOA 1UWXK 4P4RA 2JCCA 5FK9A 1U3HD 5C0JA 3NPSC 5SWZB 5DO2C 5E99L 3HNVH 3ZSLA 4GW5A 4N8CL 2QQNL 2CYFA 3UL2A 1W72H 1EIBA 1HZHH 1OSPH 2WUBL 4MJ6B 1VPOH 2HVKA 1DANT 2R16A 3RVUC 5KSAC 5M7QA 1X6NA 3WFCL 4JFFD 4J3TA 1FPTL 1FSKC 3QFDA 2WAHA 1LO2H 2BVTA 3SDYL 4IM8A 4Q26A 1KCKA 3K2MC 1U6AH 4JQXC 5IQ9A 3UJJH 4UUJB 4YPGB 4M01A 2V2TA 2YA0A 1RJYA 4GG6A 3FN0H 4O4YH 4MJ4A 4XBEH 2VDKL 3P0YH 1NEZA 3BGFC 3HE6B 1J5OH 4ZXBB 5EOTA 4G9DA 4PBVC 5IW1B 3K1DA 5T5PA 2V2TB 3LQMA 5DD0H 1TNNA 2FIKB 4U1SA 3L1OL 2F53A 4LGSB 5E1HB 1GH7A 3HCVA 5F1KC 4Q0XH 3OZ9H 3RZCB 2OL3A 4CVZA 5JLZB 3GJFA 2BSRB 1IGYA 4JFEA 2F53B 5L6YL 4L3EE 3DGGA 1MS9A 3MRDB 3IAGC 2A6KB 4YUEL 3C5SB 3RJQB 2QQKL 3ISWA 3H2WA 4GLRH 2PNDA 1JRHL 3BZ4A 4EI5A 4FQQA 1MHEB 3N36A 3DGGB 4KROB 4M93B 2CUHA 3MRDA 3MRMB 2JJ6A 1FFOA 2NY2D 2Z4QB 3GSRB 4JO1H 5JPMB 2AGSA 2QSCL 5LGKA 2W08A 3G5VB 2VKXA 3BUYA 2FR4B 1CD0A 1BM3H 1IT9L 3WN5C 1Q9OB 5DYOB 1VESA 3O0RH 2OL3H 4R4ND 1KNOB 5KSAA 2NX5D 2XA3A 4LARH 4R9CA 1IQDB 3QULB 1U3JA 4G9DB 4MCZB 2IQ9H 3U1SL 5FDWA 1ERNA 4X5XA 1CZ8L 1CDIA 4LK4A 4WV8A 3DUHA 2GTZB 3BN3B 2IEPA 2R0WL 5D7JA 1ZT7A 3ULVD 3S4SG 3DVIA 1G9AA 3P4OB 3WCYA 1A1MB 1WUNT 3DI3B 3GJFB 4TTGA 3OL2A 4JFDB 2UY6A 4ZYKB 5E7BA 2VSDA 3GUTA 2EALA 4PYHA 3ZYPA 3EFDH 1GLHA 4TUKH 4Z7OE 4YZ5A 3BKJH 2DD8L 3V7MA 1I9EA 1ZLVK 2AV1B 2JJTC 4AG4H 3BISA 3ULVL 2MPAL 2CWSA 3O6MH 3HG1A 1Y0LB 2E9BA 2L7UA 3EJZD 4ZXKA 3A6BL 1F11A 3USUA 1WC7B 3G5VA 4HG4J 4U1LA 4I77L 3RGVA 1PVHA 4LSDA 4NRXB 1E6JH 5SX5K 2LU7A 1BBJA 1DLHA 2ESVE 2G60H 3DROA 2IAMD 1P9MA 2CR3A 4PFEA 5EBMA 5F7FA 4RMUA 5MERB 3O9WA 1DQML 4JVPA 1VEPA 3TT1L 5H37G 4WDIB 3TEUA 3IAQA 1PZUB 4OGAC 1S7SA 1LVEA 3HI6L 1PX4A 4CTEA 4YHLH 5IK3B 1JNHB 4XAKE 4QRRE 3I2CH 1JMXA 1C5CH 5K9QG 3Q48A 4LBEA 1N1YA 3R0NA 3DUUA 1DDHA 3I9GL 4MVBD 3Q5YA 4B7IA 4K71B 2GSIA 2NMSA 2K1MA 2ATPA 2X4RA 3QLQA 1G7QA 2ZNXA 3MNWA 4XBQA 1IGTB 1KB5L 1LP9E 2GIYA 1OP5K 4DS0A 5TH2B 2AEQH 2R2CA 1EBPA 5EULV 2BHUA 4Y4FA 4J23A 2ICWI 3NZHH 4GS7C 2OBGA 1J8HD 3ES6B 1BBJB 2WIMA 5TF0A 4H0HB 4LCWA 4YEFA 4JRXA 3F6LA 1LGVA 4PRIE 3DURB 3QJHA 4OB5L 4NN6C 1HE7A 1XGRB 3EOTH 3ZE0E 4JR9H 2P37A 1YNKL 2PHFA 4DGIL 4Y5XB 1QGLA 1P1ZA 3W81A 2R9HC 5DJCA 1G7JA 3TBYA 3QJHB 1MZ5A 1ADQL 1EBAA 4LCCB 1OQXA 4X6DB 4JZNA 3BIKA 5EU4A 5C92A 4U1IB 1RMFH 3GHBL 1JNHA 4OLVL 2W9EH 4M5ZH 1LK3H 1CF8L 4Q9CA 4P4KB 5C08B 4QXGH 4Z7NF 1CI5A 5EN2B 1UJTA 5T3XE 2X70A 3OKNA 4HT1H 2LV4A 3X14A 5K9KA 2GMPA 2HYMA 5K9OA 3HB3C 4LLMA 4JRYA 3RVVC 4YZ3A 2VH5H 4I48B 5CD3B 4WHCA 1MNUL 5FCUL 4ZUWA 2BJML 2VDLL 5FUZL 1SVCP 2WP3T 1SFYA 4PRHE 3RBGA 1S9VB 5JOFA 3ZKXB 3QDGA 2E27L 1S7WB 4RZCA 3LN5A 1CDBA 3AXLA 4PJAA 2X1QA 4GQ9L 3NA9H 5E8EA 2B2XL 2R4SL 3VRIB 4BZ1L 5EC1B 5AEAA 1MJ8H 4J1UB 4HMCA 4KDWA 5LWYL 3T0EC 3CXDH 2ZKNA 43C9B 1AJ7L 3HI5L 3SDAB 1V3LA 4FFVD 2FHFA 1D9KA 1C12A 3MV7D 5BV7H 5HHVH 4Y1AE 5DRNB 1FPTH 2DLGA 3QDHA 3HMYA 4Y88A 2A83A 4Y1UA 1CLZL 4AL8L 1RIRA 1JYVA 3CFDA 1NUDA 4S1DC 1C12B 2P48B 3VG9B 2IQAB 4NYLB 4BA8A 5IB4A 1VB9A 5CEZH 4FXGB 5T3XL 1A4KB 1CGSL 5E56A 4ZOAA 3O9WC 2C1OA 4KU1A 2VABA 4MAYA 3UJJL 3GBLA 4DEPC 2Z31D 3OKDA 4WTZA 1T1XB 2DQJH 4HS6A 4YPJA 3OF6A 4U1KB 1U36A 4XB7A 2E53A 3CLFL 4LLAA 5DMGD 2Y36L 2YUWA 4YFLI 5GSRA 5IMOB 3I84A 3MUY1 3HNSH 4I8DA 2CNAA 2QQNH 4H88H 3C8HA 2HJLB 2D0FA 1CFNB 3GSNL 3KR3H 1ACYL 4X4ME 3PWLB 3V6ZA 4Z7VA 3KQRA 2NY1B 4XXPA 2GUOB 4ISRA 5IBTL 2V6HA 5TE7L 2VDQH 2RFXB 1MS1A 1V7NL 4JM2C 1CDGA 3HC0B 3QQ9C 4UUJA 6CGTA 4RAVB 1VDGA 1X5IA 4YHOL 1DQJB 4XTMA 3IU3A 3MFFB 4Z7VB 3HKFA 4EUPB 4PJGB 2IQAA 4NYLA 3V7AG 5BMFH 1FZMA 4X8XA 3FO2B 5F9JB 5KG9B 4P5TD 3HZYB 2EIEA 3B2VH 1T1ZB 4PJHA 4MA8L 4G42B 3RJDA 2VSCA 4RGOH 1S3KL 3HPJA 4S0TD 3T0ED 2VRAA 1JUFA 1M71B 1BD2A 5KG9A 1ZHBB 2DQDH 3QEGL 1NMBL 3G6JF 3TPUA 1QG3A 4DGVH 3RDTD 4Q0XL 4YR6A 1KF9B 5D2LE 4R9AA 3IDYB 4TSCH 4LVEA 1IBGH 5HYJA 4K2UH 5F89B 4K3EH 3S88L 5HHME 4MJ5A 5J11C 4KDTC 1FC1A 1FSKB 1CFNA 1QNZL 1YPZB 4IRZL 4XJ8A 4HDIB 3N9GH 5GGRA 1U3HC 1L4IA 2RFXA 4XJWA 4X6EA 2F8XC 1BKZA 1D5BB 3OBTA 4AVVA 3PWUA 3GRWA 2Y9RT 2R1XA 3SY0A 4CRPA 1JXNA 4GXUM 4FMKA 2JIXB 4L29A 1N64L 4WHYG 3ULVH 3IDNA 1WSST 2V2XB 1BOGA 1VKXA 3NCCB 3K8MA 2K7QA 3ALXA 2OL3L 5FDWB 3PWUB 4M6OL 3UTSE 4F80A 5CFHA 1MELA 2HJKA 1OQ1A 4FG6C 2HH0H 2MFNA 3ILPA 4I5BA 1YN7A 1CD9B 1EDQA 2IQ9L 3U1SH 3VXRD 5IMMA 3MW4A 3BW9B 2JKBA 4EDXB 4PJIE 4H1LG 2LE9A 2CLVA 1AXIB 3VI3E 4JPKL 1I1AD 4NKQB 4LLDA 2YZ8A 4EVNB 2P2KA 3LN4B 3IT8D 4U6VH 1N7MH 2D6OX 5HYJB 4FZEH 1MVFA 4HFWB 2XTJE 2F5AL 5ITFB 1KT2B 1ORQA 2CO7B 4XAWH 5F1IB 1GYKA 2O5XL 5CMAB 1A21A 1YJDL 3WS6C 1F90L 3AS1A 1Q8QA 4O2EB 5E5MB 2FH6A 5SV4A 5GRUH 5F1IA 4QRQA 4EKXA 1WUVA 3QEUA 5B3NA 5FYKH 2D03L 2YC1A 3R8BB 5D1ZA 3TN0B 4G9FA 4J8RB 1F3DH 3LKPA 5IEHB 1CDCA 3C87A 4DKDC 3FB8B 3AZZA 5IB3A 5FKPB 4KI1A 2HWZH 4RMWA 3MBXH 1RSFA 4IIQC 5I75B 4G9FB 4J8RA 5IEHA 1D5IH 4OGZA 2HT3C 4U6HB 3VCLB 4BFBD 4FP3A 2P49B 3JTSB 3M07A 4X99B 5C07A 4BOWA 3WIFB 3OB0H 2YEZB 4LKCB 5JHDB 1G7QB 1LD9B 2J12B 2W91A 1P7HL 1UB5B 3LZFL 4OF3A 5F3HB 4LCYB 2VH5L 3WIIH 2Z31B 3E8UL 1LD9A 3QBTB 4HT1L 1S7TA 4LNVA 2B8OT 2GHWB 2XA8L 2E27H 2P8MA 3UTSD 4OD3L 4DFHA 3HHRB 3U6RA 3N7MA 3L3OB 5D1QA 1VGEH 1C7TA 1PY9A 2VDLH 1IC4L 2FX7L 2R4SH 1NGPH 5BVPH 1V6IA 1S7TB 3PVNA 3MOBL 5D2NE 3FQUA 3BEVB 5HJ3B 4ZUVA 1CR9H 3O2WL 2R8SL 2DQGH 2D4FA 4MCYA 3CXDL 1OAQL 4KJPD 1I3UA 4P9YA 1XCQA 2A3WA 1ZXQA 4XP5L 3QXVA 2CO6B 3BEVA 5HJ3A 1RZGA 3T3PE 4LSVH 3SDDA 4OZFB 2IFGA 4S2SB 3S36L 1KCUH 3DHJA 5F88B 4KKBC 4R2GC 3FLRA 4EDWL 3BDYL 3MCLL 1A14H 3SDCB 2VW2A 5DFVD 3AP9A 5HI3D 1MJUL 3RVXD 1PDKA 1RZKC 4JZOB 3W39A 1SBDA 2E9JA 2BY3A 1GC1H 1WBLA 2AXFA 3MRPB 1QBMH 3FUOA 3WDJA 2X2YA 1KACB 4P3DB 4EI5C 1YEGL 4ELKB 1OLLA 4Y2DD 5ESQA 4HQQL 4HAFA 2XWJB 1GOHA 2OCFD 1BQHG 1HHGB 2EYRA 1OAUL 4JHWH 3FKUS 3MRKA 2F8OA 4NQSA 1JJUA 5IV2A 5KVDH 2OW4A 3BQUA 3OBRA 3ZT7A 4Q9QH 3HNTH 1EHXA 4DN3L 5E9DB 4OZIB 2AJUL 3VGDA 3ZTNL 1X7QB 1EERB 2DLHA 1WT5C 4XE9A 4NZTH 4MLIA 3RQ3A 5FYLD 2GITA 3VXME 4POZC 2YN5A 2ZCLH 5EU5B 4TQEH 1MLBB 3UZVB 3B9CA 2ZG1A 3ZL4L 4D0DA 4RGOL 2W92A 5IMLA 1NFDB 4P0DA 4K94H 5BMFL 5CBLA 5EU5A 2ADJB 4LGPB 4TVPH 4XNUH 1OTSD 4RGNC 2VZTA 4OD1H 5GZOC 1U8LB 4QHNB 4XTRD 4TNVF 2ADJA 1UCBH 3HE7A 4M43H 1GGCL 2WINA 2DQHH 3DOSA 5F1NB 5D1ZD 4NHUB 4WVVA 3HNSL 1ZA6B 2I9LA 3VXSA 4QHNA 5MEPB 4BH8B 4GKZA 2YBRA 4FQZA 4NQEA 3U7YH 1CU4L 3VA6A 5F1NA 3ZXEA 1I8IA 4NPYB 3SGEH 2IAMB 4HK3J 2AXGA 1CVRA 5D6CA 1JGUH 1N5YL 5E7FA 1TCMA 3IFLL 3KNBA 1QO3B 5D1QC 3BD5A 3BP4A 5E0QA 5FHAL 4EBQH 2ERFA 1SEBB 1I8IB 3RWEA 3R1GH 3BPCB 4E41D 2D7OA 1BVLA 4D9RE 4ODWB 4M6NH 1BD2D 1JHTA 5D7IE 1X5GA 1C08B 3P77B 1BQSA 4TSBH 5DRWB 2YUVA 3NWKA 1BVLB 5IHBA 4GW4B 5BJTB 3QIBB 1MWAA 4DGVL 5KAQF 2DQEH 1QLFA 4OGXL 3MV9B 4U0RB 1MIML 4G6ML 4Y4FC 2BOCB 1KQRA 3NACH 3QPQD 3LRSA 3GKWH 3OAUL 3L3DA 3SDCC 3KPRE 3EZ8A 5A43C 3OKLA 1KRIA 4JN1L 2APFA 2C1PB 1G9EA 3FBYA 4NIKB 2VLRB 4ZD3L 1NEZG 4Q58C 3RWEB 1W0YT 3KS0J 2ADIB 3ILQC 1J05B 1WAAF 4Y5XC 3M2MA 5EZIH 1KCLA 3VW3L 1HHJA 5FM8A 3AGVA 4P9MH 1B4JH 4GRLC 3SBWA 3G6AB 1F4XL 4LASL 3BZEB 4H55A 4ZKTB 2X5PA 2YROA 1PLGH 1TCRA 3V4UL 5JA8B 1CS6A 3QO0B 5DJ8A 2WLYA 3GBNL 3D3VD 3SE8L 5C8JA 1QQDB 3AP6A 5DLML 3CU1A 4FP8L 3RNQB 1BQPA 4UU9B 2XWBB 3LRSB 5B39G 5IB5A 5E8PB 3VU2A 3N85L 3G5XB 4FQLH 4X4YB 3SQOL 1Z9MA 1RIUH 2ZGUA 4HIXH 2YHGA 5I18H 5HPMA 4ZMAT 1KEML 1BXHA 2DMCA 3EOBA 4YDVA 4XOGA 2R2HB 4WVWA 3EO9H 1AJKA 5H8DA 1HDMA 1SHMA 1WITA 3TT3H 2Z42A 3X17A 5C2UB 4X6DE 4JO4L 2SEBA 2XRAH 5FYLL 3V6OE 2FLRT 1T04A 3VXUB 4LHUD 1IQWH 3MUGA 5CJ5A 3ZDXE 2YKLL 1W6PA 2AKRA 3WIFA 4FPGA 3D0VA 2D0GA 4GRWB 1T0PB 3BAEH 1D5IL 3JV6B 4Z7UE 4CU6A 5SV8A 3BKYL 3S36H 1KG0A 4CJ1A 2DQGL 3WXWH 1OAKH 4HJ0D 1JHKL 4JLRB 4PJ5B 1DQ0A 5EC2B 2GY7B 4V1DB 2XWBA 5HYQB 1MCOL 4FZ8L 1OM3L 3BKCH 1CLYL 3QIWD 1X5JA 4MXVF 2N7AA 1F6FB 4EDWH 1YMME 3REWA 3IN9A 2R2BA 5T3XD 1FJ1B 2DTML 3MA7A 5FYJU 2NMNA 4OCWH 5GRWA 4BH7A 1Q56A 3WV6A 1YEDA 2ORBH 4E41B 4XCNB 1WVZA 3F62A 4XIKA 1OQOA 3MGTB 3BYTA 3ETBF 1R3HB 4L9LB 3T65B 4KZDL 1WW4A 1NGXB 4HLJA 4BZYA 5E4EC 3LB6C 1G7PB 1CGVA 1Q0YH 2V5TA 1SMOA 3WDHA 2HN7A 1WBZB 12E8H 3H9YA 2F15A 3UXFA 2DQTH 3D48R 4BZ2L 3ZMRA 2VXSL 3BFOA 3QEQA 1PKOA 2EE9A 5J6HB 4PJ9B 2MJWA 3V0BB 5KAQG 3LCYA 1NCNA 3SGJA 2FCBA 3BO8A 4JFXB 1WEJL 4KKLC 1OP5H 3VI4F 4C54A 3QDMB 4NO5B 1Y18A 5GRJH 3DYPA 3IVKB 1A47A 1I9IL 2R29L 2DKSA 4PP2B 4EUPH 5I19L 3FFDA 2EDXA 2W65A 3CLEH 5EU7C 3FLPA 3ZL4H 4YXHH 4NQDA 4WHTA 3WHUA 3OKYA 5DJAB 5ETUA 2H32H 2P47B 3BPLC 3BJLA 1DLFH 3V4VL 1NFIB 4XCFH 3TA3C 2NX5E 1A9BA 2QQKH 4L9LA 1UH4A 1KJ2A 4X0KA 4TZDA 2DIAA 4S0SD 4FQJL 3BI9X 1AKJD 5E4EB 3T3MF 5C70A 4TVPL 1Q1JL 5SWSD 4NQCB 4JFZL 2IPUK 2ED8A 4PGEA 1EUTA 1CL7I 3I02A 4NN6B 4YGBA 4H0GA 2P24A 4K94C 1IT9H 1EPFA 1T5WA 4G8GD 4LVNB 3K2UL 4GKOA 2PTVA 2B7YA 4Z7WF 3ARGD 4HIHA 2YN3A 3STZA 2J4WL 2YA1A 4NZTL 4FN0A 3CU7A 5IESH 3NH7H 3QZWA 4Y2DB 1QF3A 4UW5A 1S9XB 3LKNB 1N2RB 4GAGH 4P57A 3I8TA 4JKWA 1LDPH 1U0AA 4K21A 1F6AB 4KPHH 3NIDF 5DR5H 4L3EB 4N8PA 1CE6A 5SWSE 3TBTB 4M00A 3FQTB 2NYYC 3JWDH 3Q9OA 3L6FA 1RIVL 4ODBD 5JQ6H 1KJ2B 4I3SH 4PGJA 2AR6A 5B3JF 1AXSA 1Q94A 4X8JB 4G6JH 2C4XA 4PY8J 1AC0A 2XFXB 4JHAH 5HGHB 2QQLL 4M43L 1ULGA 4F33B 2CTVA 5JZ7D 1OB1B 3VFOB 1SLTA 1NAKL 1YEHL 4PD4K 1S0EA 1Z5LB 4LVOB 5BZDA 2RQ8A 3BIBX 3KG5A 3AS3A 1MIMH 1RI8A 1QP1A 4G6MH 2VN7A 5D1ZC 1G7MB 3FQRA 4ACPA 1NL0L 2ZUQB 1F31A 1TENA 4PJAE 5F6HI 5FV2A 1D5MA 3VWKC 5J13C 2SLIA 4K1ZA 1H5BA 1PX3A 4EEEA 4OFPA 4JDZB 5SWQB 2AK4D 4NRZA 1MCFA 1Q9LB 1AQDA 2E7CA 5EO0B 2PO6B 3DX9A 3WDUA 4F7EB 3DO3A 4OM0L 4BELD 4U3CA 4LASH 2ESVA 1IVLA 1PFCA 5L2JA 1K2DA 1S0GA 1RZIB 3C5JB 2ZBJA 3HZVB 4XGZB 3DX7B 1S7RA 2YD8A 4HJ0C 2HA1A 3ARBB 4N90E 3T8XB 5IBLD 2BRQA 1IARB 1LE5A 4LHUA 3VV1A 1T7YA 2DWDB 5E00A 1CXHA 3VI3F 2WWMD 3DV4A 3THML 4S1SH 1R6VA 3DRQA 2DWDA 5DJZA 3QWRD 4EQ3A 3EDJA 1F4WL 1FNSH 4XPAL 4ISVA 5EIIA 3AS0A 1JWMB 1I7RB 1YA5A 4FNLH 4WGWB 1BIHA 5KVGL 2X1PA 5DEGA 4OQTA 3ULUC 4YLZA 2HRLA 4MXVE 4F7EA 1MWAL 4MD5B 3P73A 3IPVB 1FRGL 2Y1VA 3EDFA 1YY8B 5LBSH 1UG9A 4NM8H 3C5JA 3RVXC 2GYSA 2P8PA 1OAKL 3FO1B 5FM4A 3DUIA 5HYJD 5E8PA 1I7UA 5E1AA 5FCUH 5FUZH 1NDMB 1U8KB 1ZOXA 4ELMB 2HVJA 1U8MB 1YJDC 3LOWA 5CINH 3F58L 3GHEL 1UFUA 1S7XA 2NM1A 1G6RL 5FK9B 3WNLA 4ZXBC 5C0JB 1O4ZA 5SWZA 4JVUA 2B2XH 4MQ7B 1CGWA 2DTSA 2OP4H 3WL9B 1YZZA 1DQDL 3VGGA 2ZGLA 3DNKA 1C16A 1XR8A 3MLWH 1HWGB 4ISVB 5FHBH 4ZFFB 2EDYA 3WEXB 3IJHB 4MVBC 4U1NA 4UILH 4QRUA 2F53E 5IF0A 5F44A 3QFDB 4ZFGL 3IF1B 3CH1A 1CVSC 2FB4L 5HYEA 1U3HA 1L0YA 4GSDL 2PKDA 2IADB 3K80A 4XCEB 2V7NA 4KAQL 4PV9B 2ICWB 3DSNA 4BZ2H 4O5LL 3B2UD 3FN3A 3WFEL 1W2KT 2BVPA 4CVUA 2R2EB 5T33H 4HPOL 4RNRB 4U6XB 5CGYC 2DLEA 3GJFK 4NQDD 1A7OL 4QTHA 3FO1A 4OLUL 5D5ME 2DQTL 3PGFL 5ANME 2CJUL 3RRQA 3WHTA 2IMMA 1FO0L 2FHBA 4AYFA 2CDFA 3L3HA 1EMTL 1FORL 4LQ1A 1SJHA 1YYLH 2ZG3A 2DYPD 2GAZB 3UTTB 3KPRD 1JGEB 3OXSA 4MJ6A 1I85C 1LEKA 5ACMA 3PV6B 2AABH 5JIHA 3CLFH 4NO0D 3KLAB 3HE7C 5F7LB 5IKCB 2IH1B 3QDJA 5CEZE 5B38G 4K3JL 5M94B 3A6CH 1M7DB 3HMWL 4XCFL 2EDNA 3VGFA 1PSKL 2VW1A 1AVBA 1INQB 4YIQA 3QNXB 1YMMD 2OM5A 4LVOC 2X9XA 3PDDA 2P45B 3TJEH 5GHWH 3LEVH 1QFWH 3V8OA 4EI6A 5AD0B 5C0CE 4NNXB 5E89A 1WZ1H 1U2CA 4LPTA 4XWGH 2Y36H 3REVB 1U3ZA 4OKDA 2HMID 4JGUA 5DUWA 2YD6A 4YK4B 2CRZA 1EO8L 1VIWB 1CLCA 4JY6B 1R3KA 1P4BH 3UPRA 2BY0A 4F3FA 5D7JB 4Y19D 2PN5A 4PJBF 5ETUB 1V7NH 4KHXH 4XI5D 5KSBE 1G7YA 2DQDL 3QEGH 3P4OA 1QSEE 5E2VL 5EOQL 2I24N 4P2QD 4DKEL 3KPSA 1JFQH 5JXED 5D7LE 4HWEH 1A6PA 4HIEB 3DMMD 2VZ3A 2WBJD 3NH7L 4GKSB 5JOXA 3X11A 4PRPB 4NKMA 4N0FA 5TGBA 5EOCH 2Z92A 1YXWA 5A1AA 2Q6WB 1NCDL 3W58A 2XQBH 1HOCA 4RAUB 2VXUH 2PW1B 1JYIA 4FQJH 4BK5A 4ZO6A 4DTGH 1RIVH 4MB3A 2VAJA 1NAKH 2A6IB 1J12A 4MQTB 4P5KA 2X1OA 4CADA 4JFPB 4YHZH 4N68A 4XB8A 1MFCH 3DO7B 5D1XD 1LO5B 4JHAL 2DLIA 3OKOB 3ARDA 4ZTOL 3N7KA 4XNYH 4K3EL 2DICA 3EW3B 1OL0A 5AG8A 1AXTL 4QF1A 2DQUL 5D7IB 1K6QL 1BMGA 4HWBL 4F7PA 2AQ2A 5KN5A 1TQBC 1GZWB 2EXHA 3PWNA 4HS3A 3FQXB 3INUL 5L9DH 1KYOJ 2YPLE 2BSED 5HHMB 2WSVA 1QYGH 4JFYA 1TPXB 2DTYA 1WWAX 1RURL 5HDOA 5D71L 3QXDB 4JPWL 5ICYB 4U1GB 1HOCB 4RAUA 3PXHA 1ZVSA 3VDAA 2VO5A 2O5XH 2SBAA 4R4FH 1U58B 5ALBL 4MQXD 5FAAA 1Q8PA 2ZZJA 5KSAB 2VOTA 5DRZA 4FOYA 4WDIA 4NCDA 1N7ML 5D1QD 4FZEL 4UV7H 2G5BB 2BNRA 3GM0A 1OAXL 2AXHA 4H1LH 3M45A 1GZ9A 1CR7A 5DG1A 2GTZA 4OKVA 4X80L 1JGLH 4M48H 5EH1A 2ATPB 3MBXL 4MGXA 2LVEA 1J8HB 3R4DA 3DVNB 5A16B 1NLBH 4KUZH 3VWJC 1FNSL 4W65A 5HCBA 1AQKH 4FABH 4KKNA 4XPGH 3K8LA 4XP1H 1URLA 3OGCB 2D03H 4PGBB 2OK0H 1T3FA 4CN4A 1YEJL 1FFPB 3T8XA 1CG9B 2BVUA 1J7VR 1UM6L 3ES6A 4Y4FD 1Y0LA 3M8OL 4Z7WE 5JOFB 1U95B 5HXMA 1RUKH 3WCSA 3MV7E 5DG2A 4GG8A 4XBGA 4RDQF 3TBWB 3F8UB 3L9RB 4OZHA 4JDTL 1G7JB 3C6LC 2HKHL 1IKPA 3ZKNC 1H3TA 4LCCC 3S5LB 2OP4L 4P46B 4ATFA 3ARDD 2KT7A 4UNUA 3UTTD 4CMHB 2R8SH 3I3BA 2X4OB 2A1WH 4LNRB 2DVAA 1J86A 2NX5A 3F7QA 2BP3A 3WG1A 5GLUA 3FFCB 3MRNA 2H1PL 4FFWD 1KXTB 3EJZC 3KJ6L 4Y8DC 4PJFA 4AENB 3H9SE 5DGQA 2FB4H 1KSRA 1UWEL 4N90D 4JE4B 4TRPH 4N0UE 1S9VA 4C4KT 4RISL 2A77H 2P5WD 4XTPA 3R0MA 3AMLA 2WBJA 4XHQA 3QRGL 5CJXA 4R26L 2XXMB 3QAZC 4MHHG 2DLFL 4OZHB 4JRXB 4NM4H 2A75A 1HN1A 3NIDE 2OR9L 2YR3A 4Z0XA 4MZ3A 5C1MB 4YG0A 3ENRA 5ELIA 1AGFB 1R5WA 3GBMH 4RIRA 1UZ8B 2WT2A 5DRNA 2W38A 5GSRB 3CC5B 2IPTH 1C57A 1PG7W 4Z0BH 5KW9H 1Y6KR 1RY7B 2JE7A 4LNRA 4Z0XB 4PJCA 3GFUA 1QBLL 5F7MC 5TF1H 4P3CH 5CHNA 5F6HJ 3MMEB 3NFPB 4GKXA 1X9QA 2BVPB 5AZ2H 1N5AA 5E4IA 3O3AB 4XCYA 1PSKH 1YY9D 2E7TA 1RZJC 4QGYA 4XMAA 3HCVB 4O5LH 5K9OB 1OSPL 3QNYA 3P2TA 3B9KB 3VH8A 4CAGA 1CDJA 5IR1B 1FAYA 5JLZA 2M26A 1ND0B 3MLTA 2VU9A 5C6PB 3H6JA 5IGXL 4XXCA 2HFFB 2NY3D 5IEKA 2WSKA 4ZAKC 3UCRA 4Q2FA 2J88L 3V6OC 1TDQA 3O0VA 3SJVD 3WNPA 2DUQA 4RRPA 1RJZA 4UB0L 3RX8A 3VKFC 5CCKL 5DZEA 5JTWA 4KDTA 3C60C 2R0FA 2X05A 1HQRA 4P2QE 1KNOA 1TMCB 2JJUA 2VZOA 2LFGA 4I0PB 1FO0A 3RNKB 4OI7A 3CVIL 4U33A 1DSFH 1WFUA 3FO2A 1SYVB 3T0WA 1MVQA 3OYWB 2VQ1A 2G9HB 4DOHB 3RX5A 4OF5A 4G42A 4PCRA 4BM8A 3BT2L 5DVKA 4FPOB 3QNYB 3VXMB 4S1RL 3C6LA 3SEPA 4F37F 3BH8A 1U92A 3NIGF 4N0CC 1UCBL 1Y6NR 4XWGL 5TDNB 2X9YA 3K81A 4ORGB 3R1GL 5F1SA 3V52H 1YN7B 2QSCH 1J10A 4OTXH 1C7SA 4TPRH 1EO8H 4Q6IA 4HWZA 4PRHB 2G60L 1I1FB 1RJZB 3HG1B 4Z18A 1JN2P 4E5XA 2DU0A 1K3IA 2DM4A 5GGRB 4FPYA 5DRXA 1L0QA 5TGBB 4Y4KA 1CPMA 4EBQL 1MF2H 2MHAB 3BPOB 3F7RA 4I3RH 3IFNL 2PW1A 3NACL 1GXEA 2LU3A 3UJOA 4O51A 4I0PA 5EG6C 3O4OC 1HIMH 2NY4B 1DBML 3O9WB 2Q7YB 4QXUL 1F6LL 1QMJA 3O5SA 3PNWB 3DYOA 2LVCA 3O3BA 3VFSB 1TJIL 4TSBL 5D7LD 2LABA 4P49A 3RUGA 3DO7A 1ZT1A 1ORSA 3QEUB 3CIQA 5D7LB 2G4IA 4KVCH 1SQ2N 5CD5D 5JW4N 4MNGA 2NY4D 1CICA 3E6HB 2BOBA 3DV6B 3VRJB 3GKWL 1T89C 3AK0A 2Q3ZA 2QSTA 3HUJF 3QPXL 4HZLA 1DEEB 5I73B 4AGVA 2ZOKB 5KXEA 5F7DA 2NTFB 5D2NB 4G80A 4YR6B 2FIRT 4JFQA 2V5YA 1TVDA 2R69H 5GGTH 3K1KC 1UZ6E 8CGTA 3WFHA 4Y8AA 1AQKL 4FABL 4WEMB 2FEEL 2GTWA 4Y4KB 1I3RB 3DX8A 2DB8A 4RQQB 4XAKD 2JK5A 5FO9A 1YEJH 3BXNB 4U31A 3ZDZF 5MHSD 4HKZB 1RURH 3EDDA 1NBVH 5JZ7C 3HRZA 2IMNA 3L3IB 3PDGA 1T80A 4QHUB 1RUAL 3NIGE 4WFEE 4X7FC 1A3QA 4YNYB 3DUSB 4QHKJ 1RZJL 4UT7H 1SACA 3Q5OA 3BIKB 9CGTA 2KZ1B 5T5FH 2AP2A 4JDTH 2X4TA 2ARWA 1ULDA 3WNKA 5F93C 2YV8A 3T2QA 3BN9C 3EUUA 3EO9L 3SDDC 4QNPE 1D3CA 1KB5H 4MHHI 1PKQB 5FUCE 4Y4KD 4H25B 4I5BB 1NLDL 1JPTL 5EO1B 3EYQC 4WIQA 4FQCL 2XKNA 1C5DA 4CU7A 4FQ2L 5CD3A 5TJWK 4JM2A 4B5EA 4OFYD 5F9WB 3Q6GL 1DE4B 5EO9B 3TYFA 5KJRH 3SJVB 4Y4HD 1E4WL 5GGQL 2XG5A 4KRNA 4WO4A 1AJ7H 4PQ9A 4RA0C 3OKEB 5J3HC 1BZ9B 4PJCF 3LSEA 1ROWA 5EWIH 1GZQA 2C4FU 4YHKH 3ZDYF 5JIKA 1DE4A 5EO9A 3T2PA 1ES0A 2DKMA 2NW3A 3DBXB 5HCFA 5IW6A 3B9KD 3B9DA 3MACH 1CLOH 5E08L 5CZVL 2EDEA 2PCPA 3M3OA 2VXTL 4F7CB 1NCBL 3WG4A 4RFNB 3S5LA 4GBXA 5FB8B 4D0BB 1IGIL 1UJ3B 4MA3B 2V5MA 4BQ8A 1TTUA 1HHGA 3U0TA 2R1WA 2MOVA 5EO1A 2ZACA 3ILFA 4F7CA 3EJJX 3MRNB 4Z0BL 1JW6A 4NM4L 1O5DT 3FB7A 4XNMB 3BQUB 1R3JB 3HG1D 5ADOL 4MYEA 5L8KB 2DDQL 4PRHD 2VXSH 3OTTA 3JVGA 1MFBH 2VL5A 5E8OA 1MFEL 1HXMA 4KZDH 4U1JB 1CK0L 5D96B 4KK9C 5IHLB 3MRCB 4JANA 4NZDA 3ZXKA 1MLBA 5GRJL 4XPFH 2XTJB 3HI1A 4XH2B 1W72A 4Y1ZA 5T1DL 3H9SD 5ISZE 3RY4A 3VJ6A 5FECA 3LS4H 1LHOA 2PCPB 1DLFL 1I1YA 3V4VH 1Y6MR 4KDVA 5E2TL 1FLRL 5EOCJ 4ZOCA 1LOBA 4KRPC 3ZZ1A 4ONFL 2WINB 4OZIA 1MZ6A 4POUB 1V6JA 3QFJD 3M3EA 4PJGA 2R29H 2ENSA 5HHPA 2HLAB 1IFHL 5CUSL 2FDBP 3PP4H 1VADB 2XZQL 3OPZL 1TTGA 5CILL 2EDHA 4OZFA 5I74B 3MRHB 2ICEB 4KQ3L 2R9HD 3WHXA 3ARDC 3HPJB 3ZDYE 5GLWA 4YM0A 4LLWA 4CNIA 3L95B 2EDLA 2C1OB 3FQWB 1O0VA 1QHPA 2W0PA 1OAZH 3L3JA 4JREC 1O4YA 4HLZG 1MAMH 2P46B 2XNAA 2YSSB 4NKDA 2CKBL 4PREA 4KKCD 4XP6H 3ULVC 1AR1D 4PG2C 3WUWB 3HC3H 1AGEB 5DQJB 5BOPA 1WK0A 5DRWA 1AC6A 3UJQA 1AHWB 2Z31C 4JN2A 3EOYG 4PRPE 1HQRB 3ZSKA 1I1EA 4AVSA 4HPYL 3B2VL 1GZPB 3AY4A 5BZWA 5TDOA 3IU4H 2W0FA 3SQBA 1AI1H 2HRPH 4QRPD 1BOGB 1G6VK 1YEEH 1GZCA 1FVEB 4A6YL 3L3DB 1LDPL 5C0GB 2JKXA 4QXUH 3BUTA 3V9FA 4OLYL 3DWTA 3ARSA 2PHRA 1C1EL 3HPLA 3WJJC 4XC3L 2JELH 3SPVA 5HHQA 35C8H 3MRRB 2FO4A 4H1LA 4NFBA 4ORGA 1LOFC 1MCDA 4JGJA 3ARVA 2ADIA 1A1NA 5DDHB 3LKSB 1JZ4A 1N4XL 3IFOA 2A6JB 1N0XH 3MRRA 2XACC 4KVCL 5GGTA 1CL7H 5HDBF 3AJYA 3WUWG 2EC9U 4JN2B 5CMAA 3IS1X 3SDAC 3U4XA 2VITA 3JV4B 1XIWC 3RIFK 1AX0A 1MCPL 1QQDA 3HE7B 2AJ3B 4GAJL 2E7LC 5AUMA 1ZANH 3NCYP 2HWZL 3SO3C 5E6ZA 3RWCB 2E6JA 5CJOL 3G5XA 4X4YA 5D1ZB 1NBVL 2FSEA 1NSNL 1NBZB 2XZAH 3KPMB 5DGRA 4E42B 2VLRA 4LP4A 2VE6B 5HI5C 1LE9A 3MLSL 5C07E 3VDCA 3RWCA 1DFQA 3N3HA 2D3SA 2NR6D 4JZJC 4X7SL 5EBLA 1WLWA 4N8VG 2R2HA 1HHJB 1SEBA 5CWSA 1MFAH 2A74B 5J56B 5AWNH 3P4LA 1H0DA 2BCKB 3GKZA 4DFSA 1ULVA 1GYAA 3H7LA 2D7NA 4L1DA 4KHTL 3MBEC 1UACH 1I9RL 2J8UB 4ZFOB 3LN4A 3MQIA 3NAAL 3G9VA 2R4RL 4QTIL 1EEUA 5L88H 4Y1AA 2GTWB 3NGBC 4YE4H 1TZHB 1LO3L 1RFDL 3QIUB 2ZUXA 1JPFA 1G7LB 1CR9L 3O2WH 1J88A 1Z3GH 3QIUD 5KTEH 4NFDA 5D7JD 3U6RB 1ZWIB 2GY5A 1G9MC 2Q3AA 5AAMA 4QRRD 4ZG1A 1BAFH 4HBCH 3A6OA 1XGPA 4IIQA 1BZQK 4MJIA 1R0AL 2PYFB 4Z77B 4O58L 4G7YH 3QAZB 3NCYS 3LQZB 5I1KH 4GQPH 4IMKA 1P5UA 3TZVB 4E41A 1QLEL 5EBLB 5LBSL 3EYOB 3KS0H 4X4MA 4Z7VE 4YBQC 3AZYA 1W6PB 1YMMB 3HR5B 4UOW1 1ZTXH 6FABL 2VLKE 4R7NB 3W11C 3JV6A 2Q8BH 1G1CA 3QDGD 4H5SA 2XG3A 3MXWH 1WLCA 4UTAH 3KPPB 3QUKB 4DQAA 2E8ZA 3HR5A 2OZ4A 4B53A 1PEWA 3SDCD 5CLWA 3PHSA 1F42A 1KFAL 1YYML 4MNQE 1J1XL 5L8LB 1B0GB 3EHBC 3P9LB 5GS0H 2WQZC 1MFEH 5KSVA 5D2LB 3QUXA 2B5IC 5DJ2B 3J8F7 3HZKA 4X6BA 3AXEA 3IDUA 2ZUVA 5ESQB 1MHHA 1IGJB 1E27B 4Q9BA 1L7TL 1VGKA 4G6AD 4GW1A 4JRXE 5D2LA 2IBGA 4H20L 2AJSH 5DJAA 3EDKA 1KCUL 1W72L 1BQHA 3DSFL 3B3QE 1S9YA 4K7PL 2ZGKA 5I1CL 1MAKA 5L2KB 3PG2A 3VXTB 3UTSB 4OLUH 3C6SA 4AVTA 4L8CB 2LU4A 1JZ2A 4HCRL 5INDA 1X7QA 3DMMB 1B4RA 4CRQA 4TVPD 3SDDB 4QO1A 1REIA 3TAYA 2YK1L 3CD4A 1IS5A 1G6RB 3RTQD 1FL3B 3RWJA 3MGAA 2EE6A 3KDMB 2PHTA 3K74B 3HN1A 4DCQB 5ACLA 1FV1A 1JYCA 1I8MA 5DD1L 5F7KC 5JPNA 2AJVH 1D6EB 1R3IL 4LU5L 4FQ4A 1CFSB 3QUXB 5DMIL 2ZCKH 2MCPL 1RJLA 2VDOH 2X4QB 4QT5B 1EXUB 2N4IA 1R24B 5B8CB 1T7XA 3B3IA 3JSSA 3U7YL 1XF5B 1ZVYA 1BF8A 1SBSH 1FVDB 1IOAA 3PQYD 2Z8SA 5ALCL 3TJEL 3EYFB 1S9YB 4TTDC 7FABH 4QY8B 5DFWH 4Z78B 1Q72H 4OUOA 1LEMA 2D6KA 5IK8A 4PB9H 2X89A 4EJ1C 2PR4H 4WW2A 1AIFB 5DUUA 5T5JA 1D6VL 5E94B 3G6JB 1JYXA 2G2RA 4WHDA 3QWRA 4G8FB 3NV3A 1FYTE 1ONQA 5ESVB 1AGCB 4EIGB 5BQ7A 4OCYH 2A73A 1TJHH 3ZTJG 3OJMB 2HTLD 4FQXA 3BPCA 3HC4L 1DHKB 5B3JE 3NBNA 2B1HL 5IB2A 4UT9L 1N8ZB 4JG0L 4XNYL 1D5MB 3EJYD 1F6AA 4F8TA 5IWLC 4WTZG 2VR5A 1H3UA 1JF6A 4IEFB 2ZGPA 4NKDB 4U0QB 1CXLA 5B8CA 3QIBA 3FFDB 3A67H 3TCLB 1K6QH 5I8KL 1IAIM 4KKBD 4R2GD 3TZVC 1Q8SA 2A6ZA 3MV9A 2Y07H 3CFKA 2HFGH 2D6NA 4MNQA 1IGML 2EC8A 4JO1L 4YBHA 2XTJD 1LWRA 1CL7L 3IFLH 2ZPKH 5HGHA 1MFCL 3BEWB 1CN1A 3UTQB 1CPNA 1AX2A 3UPAA 1IAIH 1I9JH 5I1EH 2JIXD 1KPVB 1A9EB 1CT8A 1BWMA 4YK4C 2PXYD 3G08B 1NGYA 2G2RB 2OTUA 3OKLB 2IAMC 3SN6N 3ZHKA 5MEPA 2CLRB 1RUPH 1EFXA 1TIUA 4WWKA 4XMPL 5D7JC 5FA3B 2FECL 1EAPA 1OWRM 3VKOA 3CVHL 1A9EA 1LENA 2CRYA 4EXPX 3BQUD 2AXGB 2XZAL 5D6CB 4ALAH 1CFBA 1OD7A 1G9NL 1KN2H 4ODVH 2RCSH 4WVRA 5JDBA 4Q7DA 1LK2A 2X7LA 4MJIE 1EX0A 3B43A 3STZB 4UMGA 4ZSOA 1UM5H 1IE5A 4OJFH 1TZIA 5KOVC 4XJZA 3QUYB 2QV2A 2YWYA 4HUWB 2X7LB 4G7VH 3P77A 5F7WC 4M48L 4GG6E 4LLQA 4BQBA 3TVMB 2PETA 1TZIB 3W5MA 3NA4A 3ATGA 4UU9A 3RHWK 2VQUA 2DMBA 4U6YA 1ZLUH 4RRPG 5E6YA 1UVQA 1JV5A 2OJZH 3DV4B 4ZUSB 43CAA 1ZGLA 1U8KA 4GAJH 3B9EA 3QHZL 2F58H 1NBZA 4KRMB 4PIRF 4FTVD 3U4EB 5I76A 2ZCHH 5JUEL 3DIFB 3G04A 5JXAL 1G7HA 4JR9L 1A6VH 5FEBA 3CPLB 4LSQL 3QUYC 4L4TA 5DTFB 1PZ9A 3GBNH 5GS1B 3CUPA 1W6QA 1UMZA 4U1GC 4UOJA 4U1NB 3NPZB 1MFDL 3S34L 3TWCH 2CMRL 2VLME 4G6FB 4W6YB 4A6YB 4L3CA 4OAWA 4P2OA 2VAAB 4HIXL 4QXGL 2A6WA 2V9QA 1NFDE 4U1HB 3CX5K 1MUJA 4YDJA 4QLRA 5J6GB 5C09A 5D72H 1QLRA 3PHQA 4AYUA 3ILQD 4HKXA 5L2JB 3V6FA 2EYTA 4Q8LA 5GALA 1KLUB 4UTAL 1X5YA 2FJGB 1ZA4A 1AD9A 4L8SC 2YKLH 3QDMD 1UZZA 1V7ML 2DIJA 3RTQA 3KJ6H 1NLSA 5I8EB 1NGZB 4UT6H 2V2WB 4TYUA 1NDGA 1KEGL 3PV6A 5E2WH 2W9EL 1HDMB 1WZKA 5IVXE 2NY6C 1OTUC 1DFBH 1JBJA 3UROR 1KULA 3DVGB 1FAIL 4H5SB 1IS6A 3FO9B 3FRUB 4LLVA 4HW6A 4YBLC 1C1LA 1MUJB 2NXZC 4L5FH 1SLIA 4JJ5B 4KJYB 1YMHB 4LAJH 1IC5H 4NC1C 2JECA 3RWHB 3ZO0A 4XNZC 3MLVL 3ARFB 4LQFL 2BNQE 1KC5L 4FTVE 4XVSL 2ZCKL 5CP7A 1AY1H 3KJ4B 2EE2A 3B01A 4GW1B 2R2BB 1QBLH 1RU9L 5T1MA 1T89A 4YHYB 4K1YA 4DFIA 1QKZL 4HF5H 4P2OD 2C26A 5CZXD 4WI3A 5AZ2L 2WT1A 3RVWC 2D9QB 4LSSL 5L2KA 1FX5A 4WUUB 5F9AC 1ACYH 5T50A 1XZ0B 1FFNB 4LIQL 3AP7A 4YPGA 3IDMA 4CW1B 3HRPA 3VRLF 1GIGH 3MV01 1YN6B 1G0DA 1DVFD 4NP4H 1QSZA 1BP3B 3MRBB 3RWDB 1VFOA 3LEYL 4XJUA 4I0PD 5FM5O 5EZOH 1H15B 3QG7H 5AG9A 3NZ8B 5I1AB 4OZGE 5CAYB 3LV3A 2DQJL 1MY5A 1H3GA 4KXZH 1NAMA 3U7WH 3W9EB 4LSPH 5HHNB 1F5FA 1RJLB 3NZ8A 3SKMA 1CE6B 2Z91B 3MJ6A 3L3HB 3GGWB 4HHAB 1SJHB 5LAXB 5C6TL 5HVFB 1LOAA 2ES3A 4PRPA 2MCG1 4JG0H 2ZZUT 1B88A 1OB1A 3VFOA 2E7LA 4ODHH 1UT9A 2HVKB 3C5ZA 5CNAA 2BERA 3QQ4A 1MI5A 5MP6H 3UO1H 1BOYA 1LOGA 1QR4A 1I4FB 3LS5L 4FQHB 4KVNH 4L9DA 3UZQA 3DGTA 3V52L 3GIZH 4SLIA 4ZO7A 1KLFA 4AH2A 3SOBH 3I02B 4JJHA 1XMWA 3VGHA 1DQ4A 1TXKA 2P24B 4KPHL 4OIIH 2EKSA 2VLRD 5I1DA 2UWEF 4GQ9H 5ECJE 1QEWA 2VR9A 3HLAA 5DSCA 4JPIA 1V6NA 1H5BB 2MQ0A 5IB2B 5JOEA 1NMBH 3D2UD 3TBVA 1W6OB 4AGGA 4ZXBA 3D39A 1JHLH 4V1DD 4JFDD 5T1KB 1FGVH 3ABZA 3F7VB 1RHFA 4HX1B 4QGTA 4B41A 3D3VA 3E0GA 4ZYKA 3S37X 4KFZC 1HSAB 2EH7H 3RVUD 4Y22B 4Y1AD 1WLHA 1TTFA 2ZWLT 4GRLD 1H3PL 2OL3B 4FFZH 3MV9D 4CVZB 4S1QL 4OFVA 5J1AB 4S1SL 3DGCR 1IM9B 4NJ9L 4LHUB 4HIEA 3D2UB 4ODXB 1IGMH 2WZPD 1GGBH 1NXD1 5GJ6A 3BZ4B 2OS7A 2ZPKL 2RJMA 1N1TA 5D93B 5D8JH 2Q8AL 3VG0H 5JPMA 2ZA9A 1GANA 5DRZB 4M7KL 4DN4L 3FCTA 3D18B 2FR4A 3SGKA 4ZS7L 2EECA 5I1DB 3OG4B 3F6IA 3EIFA 3WG2A 1QR1A 3GMMB 4MQSB 4ZOBA 1DUYA 1I7RA 2ZJSL 5KVEH 4M3CA 4PJDF 1LOCA 5HGAB 3ARDB 1S7SB 4NCC2 1QNWA 3UTOA 2RCSL 4DJMA 5I73C 2I5YL 3RZCD 1M7XA 5LCVH 4LPCA 5C0CD 1OF2A 1P4IH 1WZMA 4MSWB 1N3QA 1K5NB 4Y22A 4OFDA 3WCRA 1YDPB 2YD4A 5TPWL 5IROC 1FYHB 1EEZA 3THMH 4XIOA 1M7IA 1BJQA 1O7VA 5IOPB 2K3TA 1LP9B 4U7SA 3WD5H 5DJXA 4NUGL 4Y4FB 1A0QL 2XT1B 2CXGA 5JOPD 1M7IB 3FFCE 2UWEE 4ZUSA 2ADFH 2FBJH 2KKQA 1I7ZA 3LPGA 5GS0C 4MQ7A 1T0MA 3U4EA 5C0RL 2C3VB 1A2YB 3NABL 4GSDH 4JFFB 1RZKL 4MDIB 1FVCA 3KLSA 4BSWB 4KQ4H 4Y19E 1UGNA 5FYJL 4CVXA 2AAVA 2GK0A 5DTFA 4TNWF 4UTBH 1LGCA 3UBXI 4C83A 3UAJC 1PZ5A 2FX9L 3BP6A 5H35B 5HHOA 5CAZA 3OBAA 3U30C 2OXHA 4R4BB 4PV9A 2HKFH 3LB6D 4HS8L 4TOYL 2JJSC 3UYRH 4ENEC 1ZLWH 4WI9A 4ZAKD 4XMKH 3S4SB 2QADC 4OKVB 4WTWA 4LCWD 5KSAD 4R4BA 3OKNB 3FRPA 4O2FB 1SVZA 5CINL 1MFDH 1G9FA 3ARFD 1EEZB 3WSQH 2R49A 1DDHB 2Y5TA 1N5AB 4LPYA 2GJZA 2ZUSA 2FJFB 1LO4H 3P0GB 4PRAB 3BJ91 4RZCB 2NN8A 3MLWL 4Y2DC 1I3VA 5BVPL 5IJVB 1BEYL 4NZUH 4TYSA 3PGCA 1NGWA 1HEZB 1UKTA 1FFRA 1HQ4A 3WDVA 2P1YA 1ONAA 4JQVC 4JAMB 3HMXH 1DQTA 4JKKA 2XI9A 1XGRA 2NNAB 3W0WD 4HCRA 2X1XR 1OAYH 5GJTH 4XBEL 3SE3C 3U46B 4HK3N 5IQ9B 4OIAA 1YEFL 4MA7H 3TNNB 2HYKA 5D1XB 3IETB 4JZNB 2DQCH 4HF5L 4Q9QL 5GSVB 2CL2A 1BVKB 3DETD 4ZTPH 5ESAB 4IHOB 5M95B 1JFQL 3B9KA 3E3QE 2GK2A 1I85A 2IG2H 3MJGX 2EE3A 5MEQB 2Y7QB 3B8SA 1BJ1H 4RX4A 4PRPD 1TVHA 3EJYC 1F5WA 2WBJB 5I74C 4JFEB 4G6FD 1SCSA 1EGJL 3C5SA 1BECA 1TJGH 3MJ8B 4JM2F 4L4TD 1LEGA 1JTOA 1ZHKB 3PDOB 1EA9C 1QFWL 5FF6B 1CE1H 3MJ8A 1D9KD 3MV7A 3BUYB 3QQ3A 3S96B 5FF6A