4M00A

Crystal structure of the ligand binding region of staphylococcal adhesion srap
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
501
structure length
501
Chain Sequence
TTAVTANTITVNKDNLKQYMTTSGNATYDQSTGIVTLTQDAYSQKGAITLGTRIDSNKSFHFSGKVNLGNKYEGHGNGGDGIGFAFSPGVLGETGLNGAAVGIGGLSNAFGFKLDTYHNTSKPNSAAKANADPSNVAGGGAFGAFVTTDSYGVATTYTSSSTADNAAKLNVQPTNNTFQDFDINYNGDTKVMTVKYAGQTWTRNISDWIAKSGTTNFSLSMTASTGGATNLQQVQFGTFEYTESAVTQVRYVDVTTGKDIIPPKTYSGNVDQVVTIDNQQSALTAKGYNYTSVDSSYASTYNDTNKTVKMTNAGQSVTYYFTDVKAPTVTVGNQTIEVGKTMNPIVLTTTDNGTGTVTNTVTGLPSGLSYDSATNSIIGTPTKIGQSTVTVVSTDQANNKSTTTFTINVVDTTAPTVTPIGDQSSEVYSPISPIKIATQDNSGNAVTNTVTGLPSGLTFDSTNNTISGTPTNIGTSTISIVSTDASGNKTTTTFKYEVTRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine-rich adhesin for platelets
publication title Structural Insights into SraP-Mediated Staphylococcus aureus Adhesion to Host Cells
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Cell adhesion
total genus 138
structure length 501
sequence length 501
ec nomenclature
pdb deposition date 2013-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18483 Bact_lectin Bacterial lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m00A03
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m00A04
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4m00A01
3.10.20.320 Alpha Beta Roll Ubiquitin-like (UB roll) Putative peptidoglycan bound protein (lpxtg motif) 4m00A02
2WINB 3QULA 4HX1A 5HHOB 1ZVHA 1MS9A 3PQYE 1JHNA 1WAAA 5I8EA 4IMKA 2OI9B 3SE3C 3L7EA 4RCAA 2X4PB 3BHBA 1N26A 2CQVA 3LDBC 5E5UB 4TPRL 2I60L 4K8RH 5CAYB 2CMRH 2XRAH 3U48A 4OZGA 2Z8SA 5BZDA 5FYLH 3T09A 5D7IE 4I0PC 2DTSA 1OAKL 3U9PH 3PWUB 1VFBA 4XMKH 4Y4HB 2JJ6A 5EU3B 4WWKC 1KPRB 5FYLE 3RDTB 1ZHNA 1NGWA 3H3KA 3DBXA 5HI5C 5B39G 1TVBA 1OT1A 3O2VH 4N0YH 3UPRA 4X9IA 5DEGB 1XAUA 5F71A 2YD1A 3FQRB 2EO1A 2OSLA 5TFSH 4HWZA 3MV9A 4RMVA 3VXSD 5KJRH 1I8MA 2UZIH 2XWTB 3MBXL 2X42A 4UINH 3BVNB 4QT5B 3IETA 2OK0L 5GRWA 3BP5B 1GZQA 1BQSA 3T65A 4K2UH 2R1DA 1I3GH 2NW3B 1UH3A 4OFIA 3GJEB 1CR9H 4C56A 2IPUG 5EC2A 1JTTA 3BOVA 2GNTA 1QEWA 1DUZA 3WL9B 1YEKL 1SYSB 5GZEA 2ZOLA 4HPOH 1KDMA 4O4YL 3HG1D 1A7OH 3QFDA 4G43B 3C6LC 3WDJA 1PG7H 4XAWL 3GIVB 2RFXB 4XPFH 4JM4L 4KRPC 2MCG1 3KPPA 2EKSB 4P2QB 3WXVH 3VKNA 1L7IH 2Z35B 1AO7D 1NAKH 4K9EH 3R1GL 1F8TL 3GMQB 4LSSL 4U4BA 3QNXB 1A3RH 4MB5A 4KRLB 1UYWL 2I9LA 5JHDA 4HUVA 4GRLD 3FLPA 1GBGA 5FGCE 5IR1A 5EU7E 1T20A 5H9RA 3GIZL 3MGAA 5JIIA 5D7SH 1JFQL 3GBNH 2YMXL 2HTLC 1RJYA 3U0PA 5EIIB 1LOCA 3NFPB 4LOUD 4HUNB 2XA8L 1XT5A 4R4BB 2EDQA 5CD5D 2ZA9A 5I9QB 2W9EH 2H8PA 4NZUL 3QBTB 1DANT 3KNBB 4ONHA 4FPFA 4Z76B 5E9DA 4CKVX 3G04B 2X4NA 4CDGC 1E27A 5GGVY 3MRQB 3BGAA 5E8AA 4AEHH 2X1OA 5INCB 5KXEA 3TGXA 4X8JA 4D9LL 1V6JA 2VDMH 4OAWA 3QISA 1G0DA 4UIKL 3TO2A 4PLNC 3Q1SH 2X70B 1CFQA 3CIQA 2CIKB 5IWLA 5BYNA 5F89B 4Y2DB 1OTTC 4M02A 5IG7A 4QRUB 5EFIB 3TWCL 1XF2A 2ATPA 4QRQB 5F9TA 3E1F1 5GGRY 4K21A 4F8TA 1U8QA 3VXMD 3LQAL 1C8PA 3UJQA 2KDGA 2P46B 3MV8E 1F4XL 1CU4L 3DGGA 4EQ2A 2I25N 3C6SB 3RNQB 1JWUA 5I16A 3UZVB 3T04D 3LSOB 2Q8BH 4M6NL 4CNIA 1I7UB 3SDAA 5T5NG 4A2MA 2I2SA 5BRZA 4GBXB 4BZ1L 1M71B 1KN4H 1QFWH 4W70A 2BY3A 3EIFA 4ITCA 3C8KB 4Z7UF 4HANA 1K5NA 1YJDL 3B2VH 4GW1B 5JDJA 1MCWW 1FNGA 5KSBE 2BNRD 4D94A 3OMZA 1G9MC 1DBKL 2XPGA 3CUPB 5KVDH 3VFOA 3F58L 2RCSH 4FQ4A 3PVOA 2LTQB 4TOYL 1P4LA 3EDKA 1JWSB 2FHFA 3H6JA 1OQXA 4RMRA 1MLCB 3NFNB 5EBGA 3WUDA 3LZFL 5CEYA 1RZKC 3WN5B 3AM8A 2NP0A 4OZFH 3QQNA 1CI5A 4Q9RL 4HKBA 1H3VA 3AP4A 3OKDA 4R0LC 1TJHH 4Z8FL 1QDCA 1VSCA 3C5ZB 3ULUL 1FL6A 2YUVA 5LQBH 5DVMA 4KAQH 2OVUA 3I3BA 1NMBL 3QG6A 1HCFX 4LEOB 1CK0L 1KNOA 1ENRA 1EVTC 2V9TA 2CY6A 5IB3A 2XA3A 3KPTA 2YPLD 4JFED 4LBNA 3MRRB 5D2LA 4Y4KD 2ZUQB 3VI3F 1H3XA 2ZZJA 3V0AA 1MCRA 1C57A 3OKLB 1QFWM 3N9GL 2VIRA 4Z7OF 2ZWLT 4LHUB 3DROB 1KJVA 2L7UA 4FFVD 1IQDB 3QDJA 5C07B 1WW5A 3DXAD 4ODVL 5IM7A 1JXNA 3HRPA 3MMEA 1UG9A 4WFEE 1UZYA 3O6FA 5C09A 4FTVB 1LMKA 4HIXL 3CMOL 4OGAD 1MI5A 3O2DA 3V0WL 1WBFA 4EN3B 3HZYB 1GOFA 4AZ8A 4XNUL 3KJ6L 5FGBA 4JM2B 3C2AL 1AXZA 3OB0K 1DLHA 1XF5B 1CICB 3UTQB 1DEEB 4HZAA 1HXYA 2IAMD 2MPAH 2YKLH 3SH3A 3QIUD 2C3WA 5DD1L 4MQTB 2GCYB 5H8DA 3O3DB 5T5LA 5T1DL 1W2KT 4UW6A 1OF2A 1CZ8L 1T5XB 2AKRA 1MCNA 3VXUB 4PJIE 3H9SA 3OR6B 3JZ7A 1G6RB 5E08H 1W6PB 3K1KC 4QF1B 1JYCA 4HUMB 3DX8A 3IKKA 4G6AD 1R3IH 2EXKA 2PYFB 3MNWA 4Z7QF 5TGBB 3SNMA 2R2BB 4WU7A 5ICXB 1UWEL 1YMMA 2B4CL 5IVXB 1KCKA 2IADA 4G42A 1GLHA 2BVPA 1MAML 1S7QA 3K8MA 1BJQA 3SISA 5I2IB 4FG6D 1ZMYA 5DD3L 32C2B 1YN6B 1YY8B 1T7ZA 3ARDA 1FVDB 1NCTA 4G9DB 3UYRH 2OX5A 4PJ5A 4Z5RB 5KVEH 5LGKA 4LLQB 1M05B 3QUYD 4OB5H 4OF3A 4AIZA 4DKAA 4KROC 5CGYD 1MEXH 4K8RL 4CVZB 4NBYB 1I85C 2QQLH 2XRAL 3BKCH 3OR7B 5FYLL 4AY0A 1JNNH 3OHXA 5F7MC 3QEQA 3QP3A 2DBLH 3U9PL 2G5BA 4XMKL 1UM6H 1D3CA 4R9HA 3D87B 1JZ7A 4Z78B 1GC1C 2B20A 1CDCA 5DK2A 3O2VL 5I71C 4N0YL 1PYWA 5F3HB 4HGWB 1CFNA 2YZ4A 2ZGNA 1CN1A 4KQ3H 2APBA 4R97B 3AFKA 1JZ6A 1KTRL 4PJ8C 3STZB 5TFSL 2D6MA 4EDWH 1LEDA 2HRLA 4M43H 5KJRL 5I75B 2UZIL 5FECA 4F37K 3U9UA 1JIBA 5I17B 5MI0B 4QYOB 3VXSB 3SKMB 4Y1AD 1JZ2A 4RQQB 3QAZC 4RX4D 4K2UL 3SDCD 5IW1B 1I3GL 3QUKA 4CJ1A 1SMAA 2EIDA 3BWAB 3AP6A 2WJSA 3RGVA 1OAXH 5KVFH 4HPOL 2W68A 3D18B 2Y5TB 1NDGB 1A7OL 3FO9B 3LQZA 1PG7L 4UW4A 2UVEA 2NY2C 2GT9A 4XPFL 4GAGH 1YIFA 3HG1B 5MEQA 3WXVL 1L7IL 5BXFA 2O5XH 2R1XB 4PJEB 1NAKL 4K9EL 5SX5K 3MW4A 1NJ9B 1A3RL 1RUPH 2BFVH 1NGZA 1AX0A 1AO7B 1J1XH 4R4FH 3LAFA 4QHNB 5FV2A 2OBGA 5D7SL 4GRLB 4ODHH 3GBNL 3FUOA 1BX2B 3CDCA 1B09A 1U42A 2FX8H 4PJAF 2ZP0T 3K2MC 5F9OH 4JG0H 2I27N 5ICYA 5J6HA 1UAIA 5FYKU 2GY5A 1X5XA 4HT1H 1X5LA 3OF6D 3MLYH 2H32B 1AC6A 5I1LA 5TE4L 1JPFB 4TUKH 2W9EL 2A73A 3NIDE 2QSQA 2CKBH 5ERWB 3BH8A 3O8XD 4PJ9A 1TNMA 1N8ZB 3V5DB 3MV7D 3QIBA 2LALA 1XIWD 4ZFOA 5BS0D 2J4WH 4OIBA 3AP9A 4LCCC 3TH4T 4JRYA 4CAGA 2F5BH 3HUJE 1JUFA 3TBYB 2X1QA 3WOGA 2YBRA 2D0FA 4AEHL 4LLYB 2W39A 3FO2A 2ZHMA 1OKQA 1CTOA 5ETUA 5D2NE 3Q1SL 4RAVB 2CIIA 2ZJSH 4RGND 5TQ0H 1W0VB 2VDPH 5ALCH 1AVBA 1H9PA 4ZTOH 3DVFA 3QHFH 4X4XB 3DHJA 1BD2A 1JTPA 1MSPA 1SQ2N 1CD0A 5JOPD 4XWGH 4LBKA 1SBSH 1A6WH 1JE6A 1XCQB 4MJ5B 1KG0B 4OUUB 1UB5A 1H3PH 3GGWB 1KIRB 4DKEH 3RTQD 3OKMB 3VXMB 2B0SH 4OV5B 1RUQL 2BXZA 2MQ3A 3K1DA 4PRIE 4IHOB 5GLWA 4M48H 1UZ8A 3T2OA 4LVHC 4XNZC 1LESA 5AG9A 2BSRA 1DQ0A 4E0RA 4K3GA 3MFFA 1ZLWH 1PZ7A 1AXKA 1KACB 5ESAB 1QFWL 3V5HB 3B2VL 5DK3A 3RZCD 5H9SA 5HSFA 2EE3A 1ND0A 3SEPA 3KXFD 1CFSB 4Y4FD 2WUCH 4J6RH 2BNRB 4D8PA 5I1GH 5I1HH 2HT4C 5FDWB 4LKXB 2A83A 1BF2A 2IG2H 1W8NA 5CNAA 3ZKQD 1DDHA 1FAIH 4NQDA 3H8NA 4RZCB 1S8DB 1DQQA 1NFDB 2CNAA 3FFZA 4BZYA 2ZUUA 3WDXA 1UM5H 1F3JB 3AU1A 4Z0XB 1LP9E 3L3GB 3DMMA 3HE6A 4XJ8A 1TJHL 3OKEB 1SACA 1R3HB 3H9YA 1EZVY 1U3YA 1UKTA 3VGAC 3BXNB 3CZFB 1I3VA 5LQBL 4KAQL 3SN6N 4HHAA 3IGAB 1NXD1 4PJXB 5IK3A 1T04B 2HVKB 3CFCH 5BMFH 3SCMA 5EA0H 3VFPA 1MCWM 1NLDH 1C1LA 1IGYB 2IALA 1E4XL 3RX5A 1OAYH 1SLLA 5E89A 2WBJA 1CD1A 2FO4B 4JFEB 2YPLB 1QOKA 3FRPG 4Y4KB 4H5SA 2XWJA 3WDYA 1V7MH 1FL3A 4FQLH 2X4SB 1Z0NA 3UBXB 4P9HH 4YM3A 1F11A 3D0VB 4X6FA 1T83C 2JJTC 3DXAB 4AWDA 2ARJQ 5FM5O 1DL7H 2CO6B 4PG2C 1FNEA 4PJGA 3TT3H 5DVNA 2ZNWA 2VR4A 3SKJH 3U4EB 4K23H 3K4ZA 4YGVB 5C0BA 3BKJH 1K4CB 1WICA 1B0WA 5HGDA 4U2ZA 1VAMA 5DG1A 1AKJA 3BPOC 4ZSOE 2MPAL 2NYYC 3HTLX 3P9MA 4WFHD 3POYA 3GEWB 1JN6B 2IAMB 2X1WL 4DUXA 5EG6C 1BOGB 1PEZA 1EFQA 1P2CB 1BLNA 3J7HA 2UUDH 4DGIH 1ACYH 3FTGA 4XBNA 1MRCH 2VZ1A 3ZYOA 4P5KA 3QSKB 4KJPD 3ULVD 1R3IL 1G7MA 2NY7H 1DUYA 3W0WE 4WV8A 1FFRA 1K3ZA 5E2JA 1FYTD 4V1DA 5DJCB 1FV3A 4QOKA 4PRDA 3D85A 3UTZA 4G6FD 1C4RA 5BQ7B 4Y16D 4RRPG 5DQ9A 4UDTB 1J0YA 1JV5A 2EH8H 3GMLA 1FV1B 3UYRL 1R24A 3LEXB 4NFCA 4RDQG 2DUQA 4NKDB 5KVEL 5AWNH 1TZHA 4Y5VA 4OB5L 1FFPB 1L7TH 4EZMA 1GZWA 3QCVH 4P46D 3VFNB 2EC9U 1MEXL 2CDFA 3C5SA 4L3EE 3QUYB 2QQLL 4QY8B 4Y7MA 3BKCL 4WW1A 5D93C 1ENSA 5JXED 1JNLH 1JNNL 2WWMD 3PQYA 2DBLL 4FFWD 4PR5A 4GLRH 5HYQB 1UM6L 1UZ6E 4GMSH 3TZVB 4AM0B 4XXAA 2WP3T 3C2UA 3ZTNH 4KTEH 2H45A 3HPJB 5GGUB 2EE6A 5D7IA 2Y36H 5D7JC 4KV5E 4EUPB 1P69B 4KQ3L 4O2FA 3QDGD 4OI9A 2EZ0C 2XQBH 1LE9A 2QR0A 2GTZB 1ZA4A 4EDWL 4MS8D 1F2QA 5GRYA 1XR8A 3HR5B 2C3VB 2EDDA 3JTTB 5C86A 5KAQG 4YBLB 3ZHLA 5GZND 2A0LD 3O3BA 4Y1AB 2R4SH 4LLAA 4W4OA 2PO6C 3C9NA 5FO9B 3ARFA 3SDCB 2R9HD 3MA7B 3P9LB 4WTWA 4J4PA 1JGEA 1UADC 4R3SA 5SX4I 3VFMA 1OAXL 5KVFL 4NUGH 1UVQB 2ZGOA 3FB5B 4Q9CA 4L3AA 3KPSA 1SLTA 1KLGB 3S5LG 1JNJA 3GB7B 1Z9MA 2BCKA 4BSWA 4GAGL 4XXDB 4C83A 4E41D 3BQUD 3QEGH 1GZPB 1QYGH 2O5XL 1XZ0A 2JCCE 2O5ZH 2EIBA 1RZ8B 2VLKD 4GA9A 1JTOA 4BK5A 5FYJU 2BFVL 4PY8I 4G9FD 4F2MB 1J1XL 3AZXA 2J1KA 4R4FL 2A6ZA 5HDOA 5IMOB 3HPLA 4OZHF 4ODHL 4CN6A 2JKBA 5DJDB 2KYWA 4MJ4A 2FX8L 3L95B 5F9OL 5HDQH 4BM7A 4ZFGH 4JG0L 4FPKA 2BSSA 1HN1A 3IJSB 1T22B 2K9UA 4N5ED 3JBG7 3K7UA 3MLYL 5JW5A 3RAJH 2JF1A 4TUOB 3SJVD 1JGDA 4TUKL 1YEGH 3TEUA 2HT3D 4KK9D 3VFTA 2GMEA 2CKBL 3FOLA 1A6UH 4I13B 5J12C 1T3FA 2J4WL 3TFKD 1QLFB 1KIPA 3O8XB 3P73B 1S7VA 4IRSA 4WI4A 5JZ7D 2F5BL 3MV7B 1XIWB 1LK3H 5BS0B 1ULEA 5FKPB 4BFIA 4OLVH 3QZWA 3RJDA 1IAII 3F7VB 4KDVA 2J8UE 3IU3A 2HJFB 3BD5A 2Z4QA 5HDLA 2ZJSL 4HIIB 5TQ0L 2NTFB 2VDPL 5ALCL 3J8F7 1V8HA 2KKQA 4ZTOL 3S7GA 3QHFL 1CVNA 3WUZA 4RGNB 4YWGH 2GNDA 4XWGL 2MOVA 1SBSL 2BP3A 1B0RB 1L6ZA 1A6WL 4JFXA 3L3DA 3IVKA 43C9A 1W6MA 5HPMB 3WFBH 3REWB 1H3PL 3B5GA 3PV7A 4YHZH 4DKEL 1T1YA 4HPYH 2B0SL 1FZOB 3RWJB 1TITA 3H9HB 4M48L 3RTQB 3HN3A 5FA3A 2YUXA 4HKJB 1Y0LB 3IFNH 1D5BA 3VRIB 3SOBL 2FRGP 1CIUA 5HBBA 1WIPA 5TDNB 4MWFB 4TULH 5IFJB 1LGNA 1V6IA 2FJHB 4YDLC 5FCUH 3X14A 3BEWB 1L0YA 5CB7A 3MGOA 2P3KA 3ZDYF 5JA9A 1GGBH 5IHBA 3QCTH 2WUCL 4J6RL 1F3DJ 4V2BA 3RZCB 3TVMC 3FQUB 4PB0L 4FFYH 5I1GL 5I1HL 1AE6H 3AREC 3KXFB 3QWRD 4U2YA 5DDHA 5ENWB 1IGJB 2IG2L 3CSPA 3HKFA 4XAKD 4Y4FB 4GG6F 4JRXE 5FO7B 4WWKA 2A6DB 4JO3H 4BH8B 5KSBA 1FAIL 4OUOA 1F4HA 4DS0A 1PAMA 2E7BA 4LRIA 3AJZA 1LD9A 5HI3C 1U58B 1H3UA 4L8CA 1HYSC 3PHOA 5TE6H 2RR3A 5B8CC 4P57B 1AGEB 1HI6A 1U8JB 3CFDB 2Z8WC 1A22B 3QDME 2V7HB 4AT6B 4IMLB 3LQMA 4YNYB 3WHE0 5AYUH 1EBPA 1DBBH 3CFCL 5BMFL 4FFZH 1KB9J 5EA0L 1B90A 1NLDL 1IGMH 1IILE 2OI9C 1FZMA 2ZACA 1D9KA 1OAYL 1MR5A 3HCVB 3LRSA 4ZXBA 3F5WB 4JHBA 1NAMH 4UQ2B 2Q7YA 1A1OA 2E7TA 3N7JA 1HSAB 3BN3B 2ZMNA 3L5XH 1V7ML 1QA9B 4FQLL 2D0GA 2UWEE 4P9HL 4LCIH 5C9JB 4Y4HC 1T5WB 3IJHB 2FB4H 4UZGA 5DHVH 1GHFH 3UBXG 4P14A 5L73A 4XDQA 1PQZA 4OFPA 1DL7L 3TT3L 1G7IB 4MLIA 1I9IH 1G9CA 4K23L 3BAEH 5CSGA 2YD6A 4QHLA 3BKJL 4YLQT 1LU1A 3VKLA 4U1MA 4GH7B 5DC0A 4PTUA 3OWEA 3KPLB 3QB7C 1SVZA 5T1KD 4XB8A 3H7LA 4LLDA 2XXCB 3U7WL 4RGMB 3MRKA 3ZE1F 4NQCE 5IMLA 4ZS7H 3HNTH 4KJWD 4D0CB 3BH9A 1ACYL 1LO3H 1VA9A 1D5MA 4WJ5A 1FZKB 3CFJB 5HGHB 5DJXA 2AK1H 1MRCL 1K3IA 4MD4B 4PRPD 5LVEA 1QOOA 1KCSH 2NY7L 4PLKC 3SPVB 2DQJL 4NNXB 3GJFK 2P5WD 3EO0B 4KK8D 3WE6B 4TTGA 4NCDA 4PJIA 4U1JB 5F6HJ 3NN8A 4P2RD 1FYTB 2EH8L 4JVUA 5GLUA 1CDHA 2AI0H 4G6FB 4YC2C 3S36H 1IRAY 5JA8B 1VCAA 2NPLX 4Y16B 5AWNL 1L7TL 2P7TA 3SDXF 3QCVL 1PZUB 3C60D 3A0NA 3CXDH 3WHTA 1CONA 1VEOA 4Z7WB 1JNLL 2AQ2A 1T1XB 4P46B 4WIQA 5ACZB 1PKQA 4DN3H 2PHXA 4HDIB 3VUOA 1DBAH 4PY7B 4GMSL 3TAYA 3VD7A 4X5WA 5F72S 1NCDH 3ZTNL 4KTEL 5IJKC 2GSIB 5I9QC 1UB6B 5HDBF 2O61B 4FOMA 2EDLA 5D7KE 1CR7A 1EO5A 4JHZA 2Y36L 2NMNA 2VO5A 1DQ5A 1R5IB 5C92A 5EZLB 4EUPG 4UQ3A 4GKZB 2WSKA 3QDGB 3HI5H 1LEGB 3OPZL 1Q8VA 1CXIA 2A6JA 2KVZA 1VESA 1T1ZA 2IEPA 2R23B 4ERSH 4H55A 4X4ZA 4XPTH 5JOXA 1FGNH 1G0YR 3LB6D 4LPTA 1Z3GH 5I74C 2VNCA 4F7MA 5C3TA 3HLAB 2HJKA 1ZHKB 4Y2DC 2R4SL 3OJDA 3AS3A 5GS0C 3VFWB 1CT8B 1ERNA 3FAXA 4PBXA 2AUYA 2AXFA 5SV3A 4MDIA 5D1QA 4UNTA 1ADQH 4QO1A 1AHWA 4NUGL 4TQEL 3SY0A 4MD0A 3POWA 2DWEB 4GXLA 4AH2B 3MV9D 4ZOEA 5K59E 3QEGL 3KPOA 2BY2A 2DMBA 5LAXB 1QYGL 1Q9LA 2O5ZL 1HWGB 4JREB 2G2RB 4JDVB 4WFFD 5FA4A 4E41B 3BQUB 5ABDE 5GS1A 1U36A 4D0BA 3QUML 4M1CD 4WHYH 4GBXC 2Z91B 1EEZB 2VLKB 3BN9D 2QQKH 4MMXC 4X0KA 4MB3A 4MSWA 3VGDA 5EUOE 3T77A 5CBAA 5LGHH 1MCIA 1T7WA 1IFHH 1RULH 2FWOA 3QQ4A 4Q9QL 1NL0H 4F7CA 1I7ZB 5E8NB 1D6EA 3WFHB 3EYQD 5ALBH 4MNGE 1KYOJ 2NZIA 4ZFGL 5HDQL 1S7WA 1ULFA 2VR5A 1U91A 4ZPTB 3GI9H 2JB5L 1INEH 1WTLA 4P5MB 3RAJL 1I9RH 5FOBB 1YEGL 3WHUA 5JMCA 1A6UL 3SJVB 4ELKA 5JHDD 1U8PB 2G5RA 2VABB 2A71A 3MRHA 1J1OH 4LVNC 1LOFC 1LK3L 4AEIH 3C5ZC 1SYVB 5F6IB 2ZSWA 3STLA 4OLVL 4Y19E 1XQNA 1K4DA 3WHE1 4YFEA 4H26B 3WG4A 4TUJA 1KB9K 3O3EB 2CKBA 5CJ5A 2NY4D 5IQ7H 4NIKB 1QZ1A 2VH9A 5T5PA 4JKKA 4YWGL 4K94C 4UT7H 4HXAH 3ZSMA 3FN0H 5I76A 4P2QE 4DZ8B 2LAAA 3K4DA 2BHUA 5D2NA 5E9DD 1BVKB 2YSSA 3MREB 3SO3C 3WFBL 2NY5C 3VRLF 4XNYH 4YHZL 5IEKA 3OYWA 4HPYL 3MJ6A 4YXHH 3WS3B 1HHKA 1MJJA 1UGNA 2KH2B 4JFDA 3MLZH 3FO1B 1NUDA 3IFNL 5GLTA 1WLDA 1HHJA 1C5CH 1E4KC 1S0CA 1I75A 2OQJB 4JM2C 9CGTA 4TULL 1CICC 4PRIA 1W0YT 2YK1L 1U0AA 5FCUL 1U9KA 1OTSC 1I8KA 1JJUA 1I85A 4KUCD 1A3QA 1UA6H 3ARBA 3C5JB 1GGBL 4ZUUA 1A6AA 3QCTL 4YFWA 2DLEA 2Q76B 4FFYL 1AE6L 3B8SA 1T0PB 4TTDD 1AD9A 15C8H 1GGIH 1P6AB 3PWPE 3WUCA 4JO3L 4HLZG 3L7FB 2D03H 5JOEA 1TTGA 2R2HA 3SDAD 3ARGD 3ARPA 1BBJB 1PBYA 5BRZD 1FH5H 4KI5D 4U49A 2R1WA 4NQEE 4NHUB 4PYGA 5TE6L 3I4IA 1MREL 2X4OB 5J1TC 4PJ8A 1RZGB 3AB0B 4JKWA 3F7QA 4JJHA 3H7BA 5GS2H 4JGUA 5AYUL 3EFFA 1DBBL 4UW5A 4FFZL 3RWGB 3EDJA 1LP9A 3E2HB 3SH5A 1IGML 4CADA 1K8DB 4RMTA 3A67H 2AJ3A 5IOPA 4Z9KB 5DR5H 4F7TB 4PJCA 5HYJA 1HQLA 1NAML 2KUTA 2AW2A 3CDGB 1EIBA 5ID1B 1ITBB 3D2UA 1U8IA 1EJOH 3KPQB 3L5XL 4Z95H 2J7LA 4ZAKA 1CGYA 4JFOA 4JN2A 4LCIL 4WY7H 1Q0YH 2Y1VA 3G08A 5J6GB 2FYYA 1G7JB 2FB4L 5F9WC 3M17B 3NIGE 1N4XL 4PV9B 4EI5C 1HH6A 2ZCHH 1LECA 3PVEA 1HXMB 3BAEL 2E6VA 3BIWE 5DRXB 2HAZA 5E24E 1C08B 2ITDB 2FX7H 2UVFA 4KRNA 3MPCA 4YGDA 3S35H 5CSZB 4M3KB 4GT7A 1X9QA 3JWDL 3KM5A 5M95B 3LKNB 2FSEA 5C0EA 3QDJD 5MI0C 5T1KB 4LP5A 4ZS7L 2D7MA 3ZYRA 3HNTL 1DBMH 3BT2H 5FCSH 4YBQC 4FXKB 2ADJA 1LO3L 4NN5C 3O6FD 1A9BA 1YECL 4R96A 4ZSOA 5C09D 5IKCB 1X4XA 2AJXH 2AEWA 1VFOA 1MI5D 1FAYA 4DTGL 1KCSL 1X6NA 2VITB 1CDUA 3B2UD 1KDKA 4PRPB 4MLSA 1CFTB 1UACH 5GS3A 2DUPA 1KUMA 3WJLA 1MJ8H 2IC2A 2P5WB 4ODSH 2DU0A 4X6CF 5DEZA 4LAQH 3KPNB 2AI0L 1S7RA 2VTFA 2GMPA 2YEZB 3S36L 3W0WA 5E8EB 4O5LH 4P2RB 4JFQA 3GMOA 1DN0A 2GITB 3CD4A 4Y5YA 1T0MA 3H9SD 4OTXH 3MYJA 4Q2FA 1ZKAA 2FJGB 1RINA 1B6UA 3P9WB 3CXDL 3X13A 1X7QB 5E6YA 3C60B 4DN3L 3LH2H 1FX5A 2YD2A 4U6HB 1YMMD 5F7NC 4U6YB 1DBAL 1Z0MA 3P0VH 1A7NH 4TRPH 1NCDL 4LOUC 3U46B 4L29A 2XFXA 3ARDD 5DF0A 1IGFH 1TVDA 3UCRA 1G7QA 2C1PB 4KQ4H 5CD5C 3D4KA 4PJ5D 2AJVH 2D4DA 3MLXH 4XHBA 3QULB 2D4FA 4HX1B 1LHUA 2GEEA 3QXWA 3VFUA 2PYEE 4BUHA 5I8EB 3CX5K 5F1NA 4OZIA 1N2RA 3HI5L 3L7EB 3PABA 3BHBB 3IDIA 2DM3A 3VXUE 2ORBH 3IKCA 4ERSL 3QEQD 4OZGB 4XPTL 1FGNL 4WW2F 1Z3GL 4YHYC 3GNEA 1GOGA 4OFDA 1NMAH 1VFBB 2XZAH 5HI4C 2EYTB 1LILA 5E8OA 1YY9D 3DX6A 2V5MA 5T5OA 1ZHNB 3HMXH 2X4TB 1XF4A 3DBXB 3NGBB 1G9NH 1Y6NR 1ADQL 4I48A 2I9TA 3UPRB 1TVBB 1TZIA 1KJMA 5FV1L 2W1NA 3LHPH 1VFMA 2PTUA 3HR6A 4LASH 2OSLB 5F3BB 3MUHL 1MAKA 3MV9B 3UAJD 1I8MB 1YEIH 5IVNA 4EDXB 3IETB 3MBEA 3T8XA 4YX2H 2QQKL 5BZWA 2DIJA 1GZQB 3T65B 2Q3ZA 1IFHL 1RULL 1SLCA 1NL0L 2BC4A 1TLKA 2JCCA 3RGVD 3AYCA 4DQOH 5ALBL 1HZHH 5EC2B 1I3UA 4IOFC 1DUZB 3SGKC 2ZOLB 5EOTA 4HKXA 3WLBA 3GI9L 2P8PA 4DGVH 3O5SA 1N59A 1INEL 2I26N 3QFDB 5EU6E 1I9RL 1LNUA 5FUZH 1YPZE 2JJTA 3UZQA 1TZGH 4QWWD 3KPPB 4PG2A 3WO4C 5CJ8A 2HKHH 1G84A 1BIIA 1LVEA 5F88A 1JI2A 3VXSE 3JV5A 1V6LA 2WNGA 3ULUF 1CCZA 1J1OL 1UJTA 4HUVB 1E28A 2I9LB 2F15A 3IYLW 5JHDB 2OUHA 4AEIL 3JWNC 5IR1B 1T20B 1RFDH 1OD9A 4JKMA 2NYYA 3HB3D 2YA2A 3MR9A 3QHZH 4YIQA 4EKXA 1N1SA 4NRZA 1RJYB 3U0PB 4X9BA 5F44A 3DIFA 3I6LD 4BLIA 5DHXB 4Q6IC 5IQ7L 5JOFA 4UT7L 4HXAL 1JRHH 4WHCA 1ULVA 3FN0L 2NY4B 4PJ9D 4RFEA 4XBPA 2J8UA 3QIBD 4KHTH 4Y4KC 5DUMH 2H8PB 3W5NA 4POZD 1H3GA 5D5MF 4XNYL 4JRYD 4ONHB 3JV6A 4WI3A 4YXHL 5E9DB 2X4NB 1E27B 1ZE3C 4FQHA 4PRHE 3HZMA 4XPHL 3FQNB 1YYLH 3MRFA 3GSOA 1C5CL 4X8JB 4BA8A 4OAWB 3PGFH 3TO2B 1T03L 1IKNC 3K46A 4OGAC 2G75B 4BQ6A 1BD2D 5JW4M 4NQXA 4R6UA 4Z7VF 1MFNA 5GGRB 1I9JH 1FCGA 4NZTL 5IG7B 1UA6L 2IAMC 1XF2B 4RFNB 4UV7H 4YHIA 2ATPB 2Y6SC 4QRRA 3I2CH 1U8QB 4PD4J 1MCFA 1GGIL 1FNZA 3DGGB 2D03L 1YYMH 3S9DB 1MELA 3FB7A 4HC1H 1JWUB 5I16B 1SLBA 4GKNA 3CFBA 4HIEA 3BESR 1FH5L 4CNIB 3SDAB 5KS9E 4DGYH 1TCMA 3CFEA 1F3DH 4G6AC 5BRZB 5I8OH 3QQ9D 4JRXA 3TNMA 2AYHA 4HQQL 4ZPVB 2VC2H 1EAJA 2A6KB 1K5NB 3RWCA 2FEEL 5GXBB 1YMHA 1H30A 2YA1A 4XJZA 2XPGB 3L6FA 3VFOB 4PJ7F 3N0PB 1Q72H 1J9CT 2DJUA 3A67L 4NNPH 1P4LB 3QDMA 4C4KT 3SDYH 1MAJA 1NSNH 2NXYD 4FQ2H 3E3QE 4NQDD 2F8XC 2IPUK 5CMAA 3QPQC 4PJBF 3LCPA 1EJOL 4LSQL 1Q8MA 4P59H 1N3NA 4QHUA 4WWID 5CGYC 4Z95L 3EJYD 5CEYB 3FLRA 3OL2A 3DMMD 3HE6D 4WY7L 5E5MA 1YC7A 1Q0YL 3TZVC 1BZWA 1ZLVK 4XP1H 4HKBB 4JFZH 1CD9B 3OKDB 1MHCA 8FABA 5AVAA 4MJ6A 4YBHA 3UBXI 1A64A 1FL6B 3QUXA 2D6OX 2ZCHL 4DUVA 4ZS6C 4JGMA 3QG6B 4K7PX 1NAMA 2DVDA 5DGRA 5J3HC 3T08A 1KNOB 2VDRH 5IB3B 2VW1A 2WBJD 2FX7L 3S35L 3G6JF 5D2LB 4POYA 1L6XA 5DHVA 2Z8RA 3V0AB 2YWYA 4YBLC 5C2BH 1NFDE 4B5EA 2ARWA 4J3OC 1R6VA 1KJVB 1EMTH 1DBML 3BT2L 3QDJB 1MIEH 1RPQA 2AJXL 4M8VA 3ZXJA 3ZKND 3O6FB 5C09B 4JCKA 5C0BD 3VA6A 4PJXE 4NQCA 2FBOJ 4YH6A 1MI5B 1UACL 1AKJD 4OCRH 4FQ1L 3CFIC 1MJ8L 1DLHB 1YEDB 4ODSL 5HJ3A 4OQ1A 1HXYB 4O5LL 3UYPA 3VXOB 4P3WA 4ZNEE 4G6KH 1S3KH 4OTXL 4XIKA 1OF2B 2AKRB 5CIPH 4RAUA 2OR7A 3H9SB 1KN2H 3TN0C 2CXGA 3LH2L 1FNFA 3AK0A 1DVFC 3UTPD 1WW7A 3S96A 3MNWB 3P0VL 4V1DD 3BZFA 1A7NL 4WU7B 4QOKD 3D85D 4TRPL 1YMMB 1KXVC 2E6PA 3GRWH 4F15C 1MS0A 2IADB 4G42B 2BVPB 1IGFL 2XN9D 1H0DA 1Q9OA 4NP4H 5FHAH 4KDTC 2YV8A 5E2TH 3ZPYA 4NN6C 2AJVL 3S4SA 3ARDB 3MLXL 4ZO7A 4OKVA 3GSXA 1IGCH 5CS7A 4XZUA 4PJ5B 1DP0A 1F2XK 1XIWC 4UU9A 5D70H 4AIZB 2ORBL 3PQYD 4BMEA 2PW1A 4WVRA 2NY0D 4KU1A 3OHXB 3QEQB 1NMAL 2XZAL 2G5BB 4KI1A 1GNHA 1EEQA 4P2OD 4RGNC 3HMXL 3AUVA 4HMCA 2QQQA 1G9NL 4K8RD 5DK2B 1PYWB 2IMNA 2VZVA 2GAZA 1CFNB 2X10A 5FYLD 4AIOA 3HC4H 4NN7C 3EJZC 4AVVA 1DQ6A 3EZJB 4WCYH 5DJ0A 5CEZH 2WAHA 1X5ZA 4LASL 3ZZ1A 6FABH 1LODA 5CHNA 2DD8H 5CEZE 3I84A 5DT1H 1YEIL 5FECB 4BQBA 3U9UB 2GNMA 1EEYA 4XTMA 3JUUA 3HZVA 1WC7A 4YX2L 2XG5A 5FUCC 5GRUH 1KV3A 3ARFD 5H2BA 4GRWH 4Z7UE 3STBA 1GKBA 4U1IA 1N1TA 3QUKB 4J4PD 4DQOL 2GALA 1B4JL 5K9OA 3CAFA 1D6VH 1HZHL 1IGTB 4LGRB 2C9AA 2A6IA 3KPSD 3RGVB 2H3NB 3V7MA 1VLNA 1PDKA 4DGVL 4Y4FC 3OAYH 1PGRB 1UXWA 2R0HA 3LQZB 1X3DA 1DQ1A 1P84K 3D9AL 2GT9B 1TZGL 2F53E 4NGHH 1S7XA 4KJQC 3V4VL 5JW3H 5MEQB 1YO8A 1MWAH 2HKHL 5F1KC 3RJQB 2RJMA 4LDEB 1D0HA 3MZGB 1NGZB 5DTFA 3B5TA 2DLFH 1NC4A 4MXVF 3AZVA 1KLUA 3MGTA 1JUIA 1RK0A 3WS6C 5JORA 2CYFA 1RFDL 3IDGB 3QHZL 3KS0J 2V5TA 3DUUB 2AK4E 3JTSA 4XJ9A 2YRLA 2OTPA 1YQVH 5FKAA 5F7FA 5ICYB 5J6HB 3EYVA 4ZOBA 4RMUA 1JRHL 4Y19A 1NLSA 3VI3E 4N0CD 3WDUA 4ENEC 5I1LB 4KHTL 5DUML 2A73B 4Z7OE 2EECA 3BH8B 4PJ9B 2VLLA 3VXNA 1ETZA 4IRSD 1IKQA 3QIBB 5C0AE 2A7AA 4ZFOB 5JVVA 4FZ8H 4JRYB 4X6DF 1M7XA 1KFAH 1UKQA 1JUFB 2ICCA 1YYLL 2N4IA 1T89C 3JVGA 4NOBA 3FO2B 4S10A 3LN5A 3PGFL 1UN1A 1J11A 5ETUB 4OD3H 5DA0B 1DQDH 2C5DA 2M2DA 1I9JL 5HHPA 1BD2B 4DVRH 2NCMA 4UV7L 3I2CL 3WXWH 1Z0HA 1UB5B 4LL9A 4LBEB 1GH7A 1QTYT 1YYML 2HLAA 5KOVC 1C1EH 3QO1A 1FATA 3BIKB 4HC1L 3W39A 1UZ8B 5CINH 1OFSA 3MV8D 5JPNA 4LVOC 3P40A 2V9QA 1GGUA 3F8UB 4Z7QE 2BSRB 5FB8A 4KJPC 4E0RB 3ULVC 3MFFB 5I8OL 3PWPA 1JYVA 5JW4N 4XBGB 2HFTA 1Q8OA 2D6NA 2VC2L 4CN1A 1K9TA 1AJ7H 2P3JA 5H37H 1ND0B 1OCWH 4Y16C 2VQ1A 3PWVA 4NQEA 1EFXA 4D8PB 4WWKD 1Q72L 4AYUA 4NNPL 3SDYL 2A83B 4FQ2L 3V6OC 3QA3A 3LPGA 5HI5D 4S1SH 1DDHB 4P46C 4P59L 2NXYB 4NQDB 2D7QA 4YZFF 5A2LH 4BUGA 1G7PA 1QBMH 2WWMC 4XP1L 4JFZL 3AU1B 4FFWC 1LOAA 3DMMB 3HE6B 3AYEA 2C7UA 2DN7A 4U05A 3BIBX 1T1WA 4QHKI 2DICA 5IMMA 1WUNT 4HHAB 3MLSH 5IK3B 4NOFA 1D9KD 3VD3A 4JQIH 3VFPB 3KXFE 4YHOH 4MA3A 4ZXBD 2IALB 3BMVA 3GUTA 1M4KA 5FIEA 1S7SA 2VL5A 2WBJB 1CD1B 5HGBB 2X44D 2HVJA 1CLYH 4MS8C 5C2BL 4XBQA 3IFLH 4H5SB 2FLBT 2XWJB 4OIAA 1V6OA 1FL3B 1B9ZA 1EMTL 1MIEL 4XMIA 4KRPD 2E9WA 3LKQB 1A3KA 1P4BH 4X6FB 3FONA 3N35A 2VDOH 4FXGA 1FNEB 3FN3A 4PJGB 2VZTA 4YXLH 3U4XA 2MFNA 4OCRL 5C0BB 4WFED 3C8DA 2K7PA 1S7TA 3H9ZA 1ZWIB 1JHLL 1LO2H 5D6DC 2BJMH 5HGDB 3MJ9H 1AKJB 4HCRA 1CLZH 2VW2A 1SJXA 5D1ZA 3P9MB 5KSAA 1P9MC 1U8KA 3BQUC 1A7BA 1JYNA 4KC3B 4I9WE 5DZLA 4G6KL 3E8UH 1S3KL 5J11C 1BLNB 5BW7C 2AXGA 5EN2A 4AIXA 1ZV5A 5FOJA 1WWAX 3FTGB 4J7RA 3BRDA 4P5KB 3ORJA 4PJAE 2ZGLA 1MHPH 1G7MB 5DJ2A 1DUYB 3ZE2F 5CBLA 3GRWL 3M3CA 1GCFA 2O26U 4V1DB 4OF7A 1C5DB 2ADGA 2EDTA 3D85B 4N5EC 4PRDB 4QOKB 4NP4L 5FHAL 5SX4H 4N68A 2ADFH 5E2TL 5DQ9B 5JDSA 5KSVA 3DSNA 1JV5B 1E4KA 2HT3C 2XN9B 3GMLB 1IGCL 1R24B 4ZUVA 2ZCLH 4O2CA 1T21A 1WT5A 4AK1A 1TZHB 4Y5VB 5D70L 2CR6A 3TFKC 5EORH 5F6IC 5BV7C 4IDJH 3WD5H 2CDFB 3C5SB 3IAQA 4WW1B 1UCBH 1NBVH 4MA8H 1UWXH 1CFBA 4N8CH 1AH1A 5I1DA 3IPVA 3PQYB 2OCFD 4PR5B 3WV0A 3VFGH 4HUUA 5ESQA 2NY0B 1S0BA 4MHHI 3ULVE 4HS6A 3HI1A 4PUBH 4I3SH 4H0GA 3UEZA 2ZUXA 5D7IB 3ZKMC 5HHVH 3HC4L 4O2FB 1I1FA 4M00A 4XP4H 4OFVA 5CEZL 3OXRA 1KCLA 4HJ0D 1HNGA 1LE9B 2QR0B 6FABL 5HHXH 4Z7NF 2DD8L 5DT1L 1XR8B 4ZUWA 5GZGA 1IBGH 5DK0A 4PFEA 4WV1C 2SBAA 1WEJH 3BX7C 4BQ1A 3HFMH 3HMYA 1FL5A 3ZYZA 4XBEH 5GRUL 3UP1A 3EAKA 2ZNXA 5D1QD 3QH3A 1KQRA 2DLGA 4OM0H 3C9NB 5J13C 4GAYB 3ARFB 1D6VL 3H3BC 3SGEI 5DG2A 1JGEB 4R3SB 3VFMB 5E4IA 1OM3H 2PXYC 3O81A 2AQ1A 5DC4B 3KPSB 1GPOH 2PKDA 3A6OA 2BCKB 4BSWB 4X4YA 4C83B 2R49A 4NGHL 1PLGH 3L5WA 4PJCF 5JW3L 1MWAL 4GW4A 4KMQA 3SO5A 3LSEA 1U93A 3EO1A 4X5LA 3BZEA 4G8GE 5EWIH 1T4KA 4HAGA 5EU6A 4YGCA 2DLFL 3ME0A 3ROOA 3AB0C 4OQTL 3BISA 1YPZA 3HPLB 5F7UA 3U4AA 1I3HA 4LSVH 3FT3A 5EB9A 3EUUA 3QXTA 2W9DH 1DQLH 1YQVL 3VH8A 4O00A 2BSSB 5FGCB 4WVWA 4G8EA 1ORSA 2R16A 4ZOAA 1EGJH 3MLWH 2MJWA 1JGDB 1ZA6A 5AZEH 2MQ0A 3VFTB 5IJVA 3S5LA 3FOLB 4HH9A 4H20H 5IGXH 1T3FB 4XH2A 3CDFA 4OLYH 3MLVL 3RGHA 3A0KA 4FZ8L 4BQCA 1DANU 1TJGH 1S7VB 4IRSB 2R0ZH 1KFAL 1HHIB 2YD9A 2OYPA 2APVA 4U3XA 4YFLF 4BFIB 2VUOA 2PF6A 3QZWB 2Q8AH 4FPLA 3IU3B 5E6IA 4OD3L 5D96B 4FABH 2RBLA 1YQ2A 2J5LC 2ZKNA 4PRHA 5F7YC 5DJZA 3U30C 4DVRL 5GZFA 4JFXB 3H42H 2XZZA 3KYOA 1LOEA 3L3DB 2DKMA 5T50A 3SJVE 3IVKB 3DYPA 43C9B 3WXWL 2W0LA 4BK4A 4JFDD 1W6MB 4FQZA 5E1AA 3DVGA 1T1YB 1P53A 1C1EL 3DUSA 4KJWC 1OWRM 2AP2A 3RUGF 4DK3A 3EOAA 1CGXA 5CINL 2HFGL 5FA3B 5GISH 1BHGA 4FQCH 1D5BB 3VGEA 1S0FA 4AL8H 5T3XH 3LRHA 4PRID 3MV8B 3KLSA 1XGPA 4LPXA 5E94B 3K3QA 5MENE 1XEDA 4KK8C 1LO5A 1AJ7L 5TPWH 3X14B 1FN4A 1NCNA 4FXLA 3G5YA 3MGOB 2QL1A 1OCWL 5KS9A 1ES0A 4HC1A 3U7YH 2SEBA 3CZJA 3F6LA 4CTEA 3CSYB 5DDHB 3E0GA 1PY4A 4WWKB 3DLQR 4HFWA 5C2UB 3A0OA 4OZIF 4S1SL 5KSBB 5I30H 3C60C 4XPBH 1SVCP 5IHLB 1FBIH 1KTDA 2NZ9C 1I8LC 2OR9H 1MIML 1LD9B 1CLOH 1QBML 4L8CB 4XCEA 3PHOB 4PJ8D 3X3GH 4FPOB 2P8MA 5CJOH 2IBZY 1HI6B 2BMKA 3VG9C 5I1EH 4IOIA 3TESA 3W11C 3JWOL 4ODUA 2YD4A 3MLSL 1BZ9A 1EV2E 1WFUA 3MROA 3T1MA 4JQIL 1F6AA 4IMKC 4YHOL 1FZMB 4WDIA 1D9KB 4MA7H 2GJJA 3LRSB 2XKSA 4ZXBB 3AX4A 1CLYL 4HXBH 4ZAKD 2Q7YB 1A1OB 3OGCA 5ITBH 3IFLL 4X7EC 3U0WL 2C3HA 4IIQA 3SGKA 4U1SA 5I1AB 2NY2D 2J8HA 3U79A 1QF3A 1KELH 1P4BL 5SV8A 1U95A 3ARVA 1PQZB 5IROC 4POUB 2VDOL 4KRPB 5JOWA 1LDSA 3V79C 4BZ2H 4YXLL 3HZKA 3DARA 1RIUH 4HG4K 4OF0A 1ED3A 5JXAH 3PVNA 2CRYA 4QHLB 3GHEH 3QQ3A 5EUKB 1LO2L 3B43A 3BP4A 4U1MB 2BJML 4RGOH 1ZVSA 1NCBL 3M3QA 3MJ9L 3MODH 4PTUB 3RL1A 1CLZL 1U0QA 5JW4R 4NQSA 1N47A 2EXIA 3RPIA 1NKOA 4ESKA 3ZYJA 2AGSA 3MC0A 4LLDB 3MRKB 3WFCL 3E8UL 4L4VE 5IMLB 1IZKA 2WIMA 4Q6IA 4OZHE 3BEVA 4WJ5B 1D5MB 3UX9B 2EEDA 3PL6A 1NBYA 4OCMC 4GKSB 2A38A 5DJXB 4D0DA 5C6WH 1MHPL 2FO1A 4ZNEA 4NO4A 5DMKA 1MFCH 3BDBA 3BPCA 2B7DT 4WRLA 4AEFA 4R9AA 4PJIB 4X9HA 4C1WA 3MRNA 2ADFL 3NN8B 3W0WD 2LE9A 4JPKH 4KHXH 1YXWA 4LF3B 1NUNB 3ALXA 2ZCLL 4MAUH 3HAEH 4IBLT 1DZQA 2P7TB 2DWRA 5F21B 4IDJL 3KDMB 4A6YA 4X9FA 4M7LL 1WCBA 3GRWA 5CP7B 1NBVL 3MRPA 2CJUH 4JQVA 1FO0H 4N8CL 3ZE0F 1CGWA 3WDTA 2AV7A 2ESVE 3VFGL 1MVQA 3FQXA 3TPUA 4U1NB 1E4WH 3ULSA 3ARWA 2VB5A 1UKGA 3IDJA 3OXSA 4X5WB 4Y24A 4RBPH 4PUBL 4LMQI 4I3SL 4H88H 1XR9A 1I1YA 3GNMH 4I77H 3QLQA 5HHVL 4FNLH 1NEUA 3DRQA 3EKCA 4XP4L 4ZXKA 2FBJH 1CJPA 5FREA 1MNUH 4JDZA 2KQNA 4UQ3B 5HHXL 2XQYG 3ROLB 5T5FH 1U2HA 2A6JB 3DX9A 4NKIH 4JZNA 1T1ZB 1BWMA 3V4PH 1IBGL 4Y22A 2HT4D 3Q5TA 4MDJA 3NVQA 3WIIH 1WEJL 3V6FA 2ICWA 4F7MB 4U1GB 2XTLA 3HFML 4YG3A 4K71C 2FCBA 1RHFA 4XBEL 2FIKA 2HJKB 1OTUC 3OJDB 5DVLA 4OM0L 5L88H 4RFNC 2AXFB 3ZDYE 4MDIB 5D1QB 3RKDC 4WO4C 2XY2A 3SDDC 1AHWB 2Q86A 1OM3L 1WTGT 3SY0B 4MD0B 3CH1A 4S0SD 1EUUA 4GG6E 1GPOL 4Z7UA 5EZJA 4TTDC 3BKYH 4NKMA 4OCWH 1PLGL 3N85H 3KPOB 1SBEA 5ACLA 1Q9LB 1EO8H 1RVFH 3P4NA 3SDAC 1H15A 5FA4B 1YDPA 5GS1B 5EWIL 4YGEA 4D0BB 2ZPKH 4XX1G 4X0KB 1PFCA 3WNMA 4MSWB 3T77B 2FGWH 2F53A 5CBAB 4BH7A 4LSVL 5CP3H 2FWOB 3QQ4B 1WIUA 2OL3H 2ID5A 1D6EB 2W9DL 1DQLL 5MEPA 5T3ZE 3GMNA 5C08E 3TCLA 3ZT6A 5M94B 1MWAA 5IW6A 1U91B 2KL6A 1TVHA 2CO7B 3NIFF 1EGJL 2YRZA 3MLWL 4KKLC 3N1GC 1RU9H 2AK4A 4XMLL 3AM8C 3KS0H 3MYZA 4H20L 4ELKB 5IGXL 1FNSH 2B8OT 4OLYL 1ZHLA 3MRHB 1TJGL 2NYYD 2R0ZL 1HQWA 1FSKB 4LBLA 1HYRC 4NO0A 2ZSWB 3STLB 1K4DB 2Q8AL 4B50A 4C56E 4CZSA 3NMEA 1ZAGA 2B2XH 1MRDH 4TUJB 4FABL 2W0FA 4M5ZH 3WNLA 2A2QT 4GAFB 2VYRE 2CKBB 1R5VB 2OR8A 5DZOA 2PW2B 3V0AC 5BO1H 3H42L 3TN0A 4AMKL 5I76B 3DO7A 1NFKA 1MFDH 3ZE1E 3BI9X 1IL1B 1DVFA 5D2NB 5KVGH 2ENYA 4NJ9H 4AENA 2YSSB 1CPNA 4XI5C 1IT9H 1F3RB 5JR1H 4QHKJ 5A3ID 5IEKB 3OYWB 1F5WA 5HHNA 1HHKB 1MJJB 2ZMKA 4JFDB 2B7YA 5C6PB 5DRNA 3O6FC 1BYHA 4DN4L 5GISL 2AJUH 4FQCL 4KDTA 5CUSH 1CXKA 4AL8L 4XMAA 3P3YA 1HHJB 4WENB 5T3XL 4HD9A 1H5BA 3GALA 5FGBC 3B2UC 1YEHH 5IHUL 3ZL4L 4PRIB 1PG7X 3O9WA 5I0DA 5DQJA 5TPWL 1EEUA 4QRRD 1I8KB 5JIKA 2SLIA 5E95B 2YD8A 4ZUUB 1A6AB 3U7YL 2WT1A 3BRFA 3X11A 4U1KA 3JXAA 3O2WH 4NDMA 4NJAH 3OKKA 3RVWC 5FYKH 4ZUTA 3SDXE 3VD4A 1AD9B 1NCUA 5HGAA 3TH2T 3AVEA 3FMGH 5I30L 3MW3A 5FYKE 2R2HB 4XPBL 4JFPA 5IK4A 3CNKA 1FBIL 4HUWA 2EZ0D 2OR9L 4HGMA 2JE9A 1P7HL 1CLOL 4JRXD 2FH6A 2R1WB 1CQKA 1FVCA 2A9NH 3X3GL 5CJOL 4IRJC 2X9YA 4I2XE 1HHGA 5HDBE 5I1EL 4PJ8B 1XCTA 1G6RH 1F58H 3ARDC 3CGTA 3EFFB 3N1QC 3NCFB 3QDMD 3WKMH 1LP9B 1A4JA 4CADB 4MA7L 3VFRB 2AJ3B 3QAZB 5C6TH 5IOPB 5CEXA 1SJEB 4HXBL 4Q1RA 4HBCH 4OZFG 3D48R 5ITBL 1U8IB 3USUA 3S8WA 3O11A 5I6XB 4ZAKB 4JFOB 1RIVL 2QJDA 4JN2B 1S78D 1Q0XH 3G08B 3UTSE 5JNYA 4N90E 2FYYB 1KELL 1F45A 3QUXD 5DZGA 1KIQA 5L8LB 5JMOC 2OW4A 5A40E 1HH6B 1S5IH 1QBBA 4BZ2L 1LEIA 4Y8AA 4XYXA 3MRJA 2QSCH 5JXAL 1JZ5A 3GHEL 1JK8A 4RGOL 2YXSA 3WLWC 3MODL 1AF9A 4HK3J 2Z92A 3CU7A 3FO0H 1MH5A 3P4LA 5B4MC 2FSEB 5TDOA 5C0EB 2XI9A 4KBBA 2A9MH 2ADJB 4R96B 1A9BB 2Z31A 4ZSOB 1Z2KA 2LVCA 1X5KA 2OM5A 4NQCD 4CJ0A 5B38B 2CTVA 1M7IB 3MJ9A 2GHWB 2V5YA 2DKSA 4ELMF 2P34A 2W38A 1T7XA 1S0IA 2P3IA 1A1NA 1B6DA 1RHHA 3KGRA 2GSGA 4GW5A 4JPKL 4PJAA 3MRGA 1S7RB 1KENH 4XVTH 4QWWC 4Q8KA 2EDEA 3W0WB 4JFQB 3GMOB 4MAUL 1DN0B 4OD2A 3WV6A 1QBAA 1T0MB 2Z93A 2V2TB 3S88H 3X13B 1PY9A 4UNUA 4DEPC 2AJYH 2CJUL 1NANI 1FO0L 4D9QE 3HB3C 4Q0XH 3BJLA 3ARYA 3WG2A 1E4WL 3PXJA 4KZEH 4DWHA 3RFZC 5CKAA 4HSQA 4L29B 4WGWB 4R2GC 2XFXB 4H88L 4R8WH 1W0WA 3GNML 1G7QB 4ZQKA 3HA0A 1RY7B 5E4EB 5F9JA 4XNZB 4I77L 3OQ3B 4PJ9C 4FNLL 4NBZB 3VRLE 4ORZC 4JY6A 5CD3B 1O7VA 3VFUB 5TDPA 1MNUL 1QLRA 2IQAA 5F1NB 1NUGA 5I1KH 1N2RB 4HJJH 3PABB 2YRPA 5T5FL 3IDIB 4QRSA 5D1XC 1HK6A 5MERA 2H32H 1LO4H 1RZJH 3H9SE 1MF2H 4RWHA 4FP8H 3IKCB 3V4PL 4L3CA 3WIIL 5EBLA 4GRMA 1UT9A 4G7YH 4AG4H 1MLBA 1N5YH 5E8OB 1KJ2H 3DX6B 5F7KC 2DKUA 5HI3D 1XF4B 4CRQA 3LKRA 2FEDD 4I48B 2I9TB 1F02I 2ITCA 1TZIB 1KJMB 4DCQB 3CVHH 4BELD 1FVEA 3OSKA 3GSUA 5C0RH 3BKYL 1OP5K 4OCWL 3VGAB 3N85L 4D3CH 4XJAA 3FQTA 3PP3H 4WW2C 3R0MA 1RVFL 2DTWA 1GJIA 3C09B 3H2WA 1QO3B 2GNBA 1IZJA 2ZPKL 3T8XB 2IH1A 3NV2A 5BZWB 2EDOA 2DI7A 2FGWL 2DTYA 3L3KA 3V8CA 3LQAC 5FEBA 2BC4B 5ADOH 2OL3L 2JCCB 4G8GA 4Y5XC 2AXHA 5EOTB 4HKXB 3WLBB 1HDKA 2P8PB 4BFEA 1UFUA 2XB6C 4EEEA 1N59B 3ZSLA 3RG0A 1LNUB 5KW9H 4I18C 1RU9L 1HEZA 5GLVA 1CTNA 2ZUYA 5D4QA 4LBMA 1A5FH 1YJDC 4CRPA 1FNSL 1BIIB 3IDNA 3O0RH 1DSFH 1MCKA 4B7IA 1WBXB 3HE6C 2UYLA 4L4TA 3VD9A 3ES6A 1E28B 5E6ZA 3S37H 4CDHA 3WIHA 1J0JA 2ED7A 1N5AA 2HTKC 3BPOB 2W08A 3S3SA 2P47B 3MR9B 4YIQB 3BP6B 1P9MA 5BVJA 2B2XL 1EGJA 4LSPH 1MRDL 4NRZB 2KPNA 3SCMC 1JBCA 5LK5A 5F97E 4M5ZL 5F93C 4ZD3H 4Y19D 3BDYH 5BW7A 2YN3A 1KTKE 5JOFB 2WBJC 1AJKA 5BO1L 3GK8H 1MFDL 4RFEB 4XBPB 2DQHL 2J8UB 4HULB 5KVGL 3ULUC 5A16A 1IT9L 4JY4A 4M93B 5JR1L 3JV6B 4QXGH 2WWKT 4YHNA 1YNTA 2R2EA 2AJUL 4FQHB 3HZMB 4YFZA 5CUSL 5CZKA 3VI4F 3MRFB 2VE6A 3GSOB 4GO6B 1ZS8A 5FYJH 1I7TB 4LSSH 3MA9H 5GPRA 1YEHL 2ICEA 1Z6JT 4GWNA 1KPUA 5CGMA 1T7VA 1U8OA 2ARJA 1CDGA 4WI5A 3AS1A 4X6CE 5FYJE 2ZG1A 1AJOA 2B39A 4JFHD 5D93B 2JJUA 2X7LA 4YHIB 2F58H 2BNQA 4NQVA 4QRRB 5IB4A 4M8QA 3O2WL 4R7NA 5FYKL 5GSVA 5MENA 3NV3A 4Z77A 5ISZE 1EPWA 3FMGL 1G8WA 3FB7B 3ILQD 3AZZA 5J89A 1L9MA 3DGCR 4P9MH 5FF6A 4GKNB 3CFBB 4HIEB 3PWPD 4BQ8A 1UENA 3LIZH 2A9NL 3UL2A 4PGDA 3T0VA 1K85A 4JRXB 5IK5A 3TNMB 4NUJA 1G6RL 1F58L 4NQED 5HY9B 5DSCA 3RWCB 1EFXD 1YMHB 3FL7A 4WV1A 3WKML 3R4SA 3L6FB 4LPCA 1INDH 1WBYA 4Y2DD 4LCYB 2GY7B 3UJIH 5GS0D 1Z9LA 2A6YA 3QDMB 5CMAB 2B4CC 4HBCL 5GS2D 4QHUB 1N3NB 4PV8A 2BVOA 5I1JH 1Q0XL 4G5ZL 2GI7A 4ALAL 1MHCB 8FABB 1ZANL 4ISQA 2P43B 3UXFA 1S5IL 2IGFH 3QUXB 1MPAH 5BCAA 4K8RC 2QSCL 1WSST 1NAMB 4N8VA 1S9VA 3V5KA 5I8KH 1JYIA 5DZNA 3V95A 4JFYA 1Q56A 1OVZA 3CVIH 4EQ3A 2E6QA 4BSJA 2JB6A 2VN4A 3FO0L 1DFQA 3QJFB 2HRPH 1ZOXA 5CWSA 1LE5A 5DHVB 4KFZC 1DBKH 1D5XA 4DUWA 3LVEA 1C7SA 3D69A 1S9XA 4JPVH 3RRDA 3RWHA 4Y1YA 1KCRH 1WLWA 3WFEH 4H1LH 3BPNB 3QIWC 4YHMH 1NMCC 5HVHB 1SEQH 1F90H 4J4PC 4P23C 2YPKA 4NQCB 4L4VA 1MJUH 5J7CC 4YR6A 5J12B 1GANA 1RJCA 3C5ZD 4OZHA 1CXEA 1SBFA 3ARXA 5E99H 4DFSA 5FM4A 5B22A 3NH7H 4KK6C 1KENL 1NMBH 3MRCA 4XVTL 1LK2A 3B9KC 3UPCA 3FQRA 3NCEB 2APTA 3ULUE 4D9RE 4LLUA 4J8RA 3LPWA 4QT5A 3S88L 1ZLSH 4RAUB 4J1UA 2AJYL 3V6ZA 2JECA 5DUWA 3I3EA 4Q0XL 2P8LA 2ZUSA 3MV11 4U0RC 1VADA 3B3IA 4MZ3A 3S96B 3BZFB 3AXDA 4KZEL 4K9EC 5EU7C 3HAEA 1H0DB 5KANG 2R29L 2ESVA 3S4SB 5D5ME 3CMOH 2JJSA 1KJ3L 3BRGC 2DBJA 4OKVB 2D0HA 3GSXB 3SH4A 1FO0A 4XZUB 5FHBH 4HJJL 5I1KL 4UU9B 4PJDA 2EXJA 3TJHC 1LO4L 1RZJL 4YDLB 5I15H 1MF2L 3VKOA 5JOYA 4ZO9A 1IC5H 2YPVL 2PYED 2PW1B 2N1KA 4Q7DA 2MHAB 2FL5B 5FM5M 4EI6B 3K8LA 3V8OA 5L6YH 1JPSH 1FFQA 1HSBA 3GM8A 4G7YL 5T1DH 1YZZA 3UTPE 5DRZA 4Z7VE 1VEMA 2CGRH 2D2OA 1U8LA 4V1DE 3MRMA 1SLIA 5C0CE 1UL9A 1A14H 5AZ2H 1J0ZA 3RL2A 1H9WA 3D1MC 2AH2A 2NZ9A 2GAZB 2DWDA 3CVHL 2D7NA 3LN9A 2ED8A 2CXKA 5B8CB 5C0RL 5DJ0B 2BSTA 4UAOB 5CHNB 3RIFK 3U2SA 3SGDI 1HQ4A 1KT2A 1EEYB 1T0NA 3HZVB 1WC7B 2OXHA 4I0KA 4GG6A 1FP5A 2A3XA 5J9PA 5H2BB 4U1IB 5ADOL 3DV6A 2RIKA 4YG6A 5K9OB 1AXIB 1KRIA 4JCMA 1CE1H 2A6IB 1TXKA 3K74B 4PJ7E 4QRUA 4PRNA 1KGCE 4L4JA 3WUWG 3FZUC 2YOCA 2BOCA 2QKIA 3CLFH 4YQXH 1UXWB 3I75A 5EUOB 1TTUA 2BY1A 4EI5D 3QDHA 5KW9L 3ZLQC 5K9QG 3NBNA 4NKQB 4PJBE 4XP6H 5IROA 4LRIC 1OW0A 1S7XB 4MNGB 1A5FL 5C08A 5EU6D 3O0RL 1DSFL 4PPTA 1OGTA 2IMMA 2OL3A 3LOWA 5DTFB 4XVUC 4LVEA 3S37L 4M7JH 4PJFF 3IM0A 1G7HA 3VWJC 1KLUB 1H3TA 3MGTB 2AS5M 4FOWA 1RK0B 5JORB 1WWBX 2QSTA 2HN7B 4LSPL 3JTSB 4WHTB 3C8KA 3O4LE 4YBQD 5FKAB 3Q6FA 4ZD3L 4HV8A 1D9KC 3UJJL 3BDYL 4ORGB 3W9EA 5IIEA 3KPSE 3G6JE 4ZXBC 4Y19B 3GK8L 3MOAH 3EDDA 2E7MA 4NHCH 1JGLL 4XX1E 2VLLB 2GUOA 3VXNB 1GZCA 5J1AA 3F12A 5IBUB 1N3OA 1PX3A 1B2WH 2ARBA 4QXGL 1QR4A 2VQTA 3B9DA 5ACMA 3IS1X 1N3PA 2K1MA 5E6ID 3KYMB 5FYJL 3LN5B 4MNQE 4YC2B 5FFLA 1EHLH 1D2SA 3MA9L 4HLJA 4PRHD 5BJTA 3RS6A 3PDOA 3ISWA 3KYKH 4RWYH 5HHPB 1VGEH 1D5IL 5D7LA 3Q5OA 3RRQA 1KXTB 1NPUA 4AYFA 5DD6A 2F58L 4JAMA 4PJHF 1MZ6A 4B53A 1JHTA 4WU5A 2VY0A 4GXVH 4QRTA 3KYNA 1W6QB 3KJ4C 2HLAB 2ZAAA 2FNBA 3DROA 1XGQA 5C1MB 5DFTA 2CL2A 5TE4H 3W39B 4P9ML 3UZEA 4OLZH 1QFOA 5DVKA 5JPNB 1C16A 5EIVA 5DD0H 3AS0A 3LIZL 3WG3A 3HUJF 5FB8B 3SDXA 1QFWI 4FTVA 2DL9A 3PWPB 4MJIE 5DA4A 2V17L 4PP2A 2F54E 1CIDA 7FABH 3H0OA 1INDL 2VQ1B 3PWVB 4NQEB 2WT2A 5HI4D 5I74B 1EFXB 3UJIL 2BSED 4CMHC 1F4WH 4I2XA 1SJVA 1G9FA 2ZG2A 2FIRT 1Q94A 3QA3B 3U7AA 1BEYH 1URLA 5E2UH 2EDXA 1VB9A 4M3CF 4XCFH 1DCLA 4WGVB 4WO4A 3SDDA 1G7PB 4JG1H 2NQCA 1F4YH 1RUKH 5I1JL 5GZDA 3ZXFA 4QF1A 4QTHB 2EDKA 1IOAA 2C7UB 1RUQH 3GMMA 3ARTA 2EYSA 2IGFL 1MPAL 3N7KA 1T1WB 3TM6A 5IMMB 4JHAH 5I8KL 1AI1L 2R1YA 3GSWA 5I2IA 3UTSA 4MA3B 4OCXH 4PYHA 3CVIL 3IU4H 3KLHC 3GUTB 1IM3A 4HJ0C 3VA2C 1S7SB 1BPVA 2VL5B 2HRPL 2V5RA 4Z5RA 2HVJB 4IOFD 1T66C 3FB6A 5LCVH 4GRWF 4U1GC 1YA5A 4IJ3C 4JPVL 5GZOD 5HYSA 1WF5A 4C54A 5EYXA 3F6IA 5D71L 1KCRL 2OZ4A 3WFEL 1FYUA 1ACZA 4NFBA 3OY8A 3FONB 3VFSA 4YHML 1SEQL 5D1QC 1F90L 2J6EA 4FXGB 1AHWC 4BLJA 4AJ0A 4Z78A 1MJUL 4OSUH 4R9BA 2Y23A 3L3OA 1S7TB 1UKSA 5EU4A 1ZA3A 4LVNB 5E99L 4NSKA 4K3DH 5DJ8A 4Z6AT 2CH8A 2CLVB 3NH7L 3T0AA 3RVVD 1V7NH 5KSAB 1U8KB 5IBLD 5GS1C 2Q3AA 3WFDH 1WV7T 5GGSA 4FQIL 1AQDA 4MXVE 1E4XH 4FPHA 3PL6D 2AXGB 1ZLSL 1V5JA 2HMIC 4CVUA 3SKMA 3O3UN 3IMNA 1W0OA 4QNPF 3P2TA 3LCYA 3TYGH 4S11A 4FRWA 4LPYA 3SO3B 5DJ2B 2NM1A 3PGDA 2HWZH 2WWKO 1NDGA 2ADGB 3CC5B 1XF1A 2XTJC 3MOBH 5JDSB 2JK5B 5KSVB 1R3LA 1ZT1A 3RWFA 1QNWA 5C0NC 4ATEA 3AZYA 4FPYA 4O2CB 4OBRA 1T21B 1FSKC 5FHBL 3S4SG 2R1XA 5M7QA 5CA6A 4X6DE 3X12A 3FJTA 1I7RA 5I15L 4YW5A 2Y6SD 4OV6F 1IC5L 2RQ8A 2DDQH 4U0QB 1J18A 3IPVB 5I1DB 2VN7A 5L6YL 2AAVA 1JPSL 2PYEB 4ZYKA 1H9VA 5GQBA 4HUUB 5ESQB 3QRFM 3I50H 2CGRL 4LSTH 3HNVH 1K6QH 3RNKA 4HS6B 3HI1B 3WJJA 2OLDA 3LKPA 1A14L 5AZ2L 4H25A 2X05A 5D2NC 4HWBA 4NNYA 4NWTH 1KSRA 1I1FB 1UEYA 4PGEA 3OXRB 4XWOC 4IRJA 4LDLB 2CLZA 2IPKA 2XY1A 1CGTA 2A1WH 3HRZA 3FOMA 3SHSA 1TCRB 1KJ2A 4ZUWB 1PKQE 3QXAA 4K3EH 5L7XH 1A3LL 3T3PE 1FL5B 3QPQD 3CVHA 5CEZD 3QH3B 1W0VA 3RIAF 5SWQA 3ARBC 1BZQK 4MA1B 3TZVD 1CE1L 3S36X 5IUQA 3NABH 4G3YL 3C2SA 2VUAA 4G8FA 2FLRT 2C3GA 4YQXL 3CLFL 5TF0A 2CUMA 1CGUA 2FHBA 1TMCB 5F9WB 4X4YB 1FGVH 2X41A 4ZS6D 4XP6L 1CG9A 3QFJE 3L5WB 1ZEAH 4KK5C 4YZFE 4EI5B 3N36A 5J3HD 4GW4B 1A7RH 1U93B 3CLEH 4WHYG 3EO1B 3BZEB 1KCVH 1PJ9A 4F80A 2F53D 2NTSP 2VH5H 1T4KB 5EU6B 3TYFA 4M7JL 3ROOB 2B1HH 1CD8A 1YPZB 1XF3A 5A43C 5L2KE 3FT3B 1I3RA 2W65A 1QKZH 1Y18A 3ZSSA 2D3VA 5EZOH 4XNMA 4JO1H 3VH8B 4F7EA 3BW9A 4O02H 3MACH 4XB7A 4NN5B 4X80H 2AK4D 4G8EB 1GSLA 1ORSB 3LS5H 1TJIH 3MOAL 4JPWH 4LAJH 1ZA6B 4NHCL 1AQKH 5KTEH 5IJVB 5I6XC 3S5LB 4S0TD 4ZAKC 4HH9B 3IS0X 3FFDB 4RISH 2EICA 4XH2B 3R0NA 4RZCA 1S8DA 5GRJH 5HCFA 4NO0D 1B2WL 4NC2B 4XIOA 5IBUG 4XT1C 5E8DH 1MVFA 1N6UA 5C0AD 3VXRE 3BXNA 1EHLL 5E6IB 2APXA 4LEXH 5DEFA 4WI9A 3ZDXF 1IM9A 2YR3A 3KYKL 4P9HC 3TN0D 4PRHB 4RWYL 3K0WA 1VGEL 1YEJL 1DVFD 2D43A 1KIUA 3KYOB 2XTJE 2OJZH 1K2DA 3LN4A 4GXVL 2QADB 5E1AB 1YI7A 3DVGB 4X6CA 3DUSB 1EX0A 4WI6A 3EOAB 4OLZL 3EO9H 3VG0H 4XE9A 2DVGA 5DD0L 35C8H 3MOQA 5KOMC 1RIRA 1X6LA 3ZE2E 1XGPB 3O9WD 5FDYA 3WJLC 2YC1A 5ISZA 4RL7A 1LO5B 2DU1A 5D1XA 4XZPA 1FN4B 3G5YB 4GJTB 7FABL 5KS9B 1VIWB 3WNNA 1ES0B 4PREB 4ETQA 1AD0A 4X98A 4YHYB 4Y5YC 2DQUH 5DD5H 1F4WL 1WUVA 2BNUA 2AVGA 2VL4A 4JFDE 4HFWB 1BEYL 3QIUA 5E2UL 1P2CA 1CIWA 4XCFL 3T4YB 1LU2A 1AXTH 3IRZA 1J8KA 3EJZD 1WZKA 1KTDB 4JG1L 1F4YL 1RUKL 4GQPH 4XCEB 1CF8H 2DTMH 3IDXH 2P8MB 3O45A 4HMEA 4ONOA 4YHPA 2BMKB 4ZG1A 4JZOA 3O6MH 5MHSE 1CFVH 4W4NA 4WW2A 5E4EC 4IOIB 4JHAL 4ODUB 3SOBH 1BZ9B 3MROB 4S1RH 4S1DC 4XCCH 1F6AB 5BQ7A 4OCXL 3IU4L 4WDIB 1FV1A 4TVSa 3RQ3A 4Z7NE 2DVFA 5FUOH 4F7PA 3OGCB 5LCVL 2COQA 3VFNA 4IIQB 2IH3A 4PB0H 4Y5XA 1SCRA 3A6BH 4U1SB 1R5WA 5B21A 1N1YA 4QGTA 3SE4C 4KJQD 1P1ZA 4I18A 1U95B 2NR6C 1GGCH 4F33A 3UDWC 3WO4B 4OSUL 5AYQA 3HZKB 1J0IA 4KTDH 1ED3B 3N3HA 1R3JA 3NCMA 1N3QA 1XGUA 3QQ3B 1QSEE 1GGTA 3BP4B 1OB1B 4K3DL 5JQ6H 2CPCA 1ZVSB 1IEBA 4PJCE 1KEMH 4YXKH 5HYJE 4LLWA 4NQSB 2EO9A 3RPIB 4P9YA 1V7NL 3C09C 2LU7A 4H1LA 3AYDA 4DQAA 3WFDL 3MBEC 3GFUA 1KLFA 5T5NF 4Q6IB 4ENED 1SY6H 4P0DA 3BEVB 4I9WD 3PHSA 2UWEF 2X40A 5JQHC 3BP7A 3PL6B 1NBYB 3TYGL 4CMMA 1I1EA 1DJSA 2CK0H 1W8OA 4Y1AA 4D0DB 3OKYA 3I85A 3OAZK 3SDCA 5DMKB 4XVJH 3FN9A 3PUCA 2YHGA 3BPCB 2HWZL 1GGYA 3MRNB 2VR9A 3RVUD 1DIWA 5JPMB 2V5SA 3MOBL 2P44B 4YGBA 5LJYH 3L5JA 1FAKT 1BQHA 2DLHA 5F7WC 1DYKA 3G5ZA 1A8DA 4NZDA 3MEPA 1RITA 2VSCA 4A6YB 2DDQL 1WCBB 5D5MA 3IKWA 4GLRI 3MRPB 1OP3K 3U7WH 4UDUA 4YW4A 2XACC 2AV7B 3W58A 4JHWH 2YD3A 3FQXB 3MJ8A 3TPUB 3I50L 3RQ0A 3ULSB 4LSTL 5SWZE 3HNVL 3IDJB 1K6QL 3OXSB 3VGFA 3N1PC 3S35X 5L8KB 1GIGH 1HIMH 1E4JA 1XR9B 2QHRH 1I1YB 3L2YA 1CL7I 3WCRA 1MCCA 3GM0A 4M93C 4NWTL 1J87A 3DRQB 2DQJH 2CK2A 4Z7VA 1NEZG 4HK3N 2X4UA 4JDZB 1S1AA 5A3IC 3ZKXB 2A1WL 1C5BH 2NLJA 3AXLB 5C0CA 1CGSH 3DX9B 2R1BA 3O8XA 4JZNB 2ZOKA 1I4FA 1ODAA 4UMGA 4Y22B 4K3EL 4XMPL 5GGVH 3V6FB 5L7XL 2ICWB 5D8JH 2WW8A 3GO1H 2FIKB 3LD8B 2HJFA 3IRPX 5F96H 1QACA 4HIIA 4KXZI 2WSUA 2EXYC 2XT1B 3NABL 2Q86B 1LTEA 1B0RA 2DQFB 3CH1B 4Z7UB 4OZIE 4EXKA 2QEJA 5EZJB 3VJ6A 1FGVL 4NKMB 5K9QI 3MLRL 1ZEAL 1XGYH 1CDBA 3B5HA 1A7RL 3CLEL 3ZXLA 5HHME 5T5JA 3P4NB 4PJ7A 1N0LA 4J3UA 1LJ7A 1KCVL 3TJEL 2VH5L 4ONFH 2X5PA 2B1HL 2ZGTA 3OPZH 4PJBA 2F53B 4QRPE 2YD7A 4BH7B 4G8GD 1QKZL 3QYCA 4PGCA 4XHJC 1WLCA 3AMLA 5EZOL 5MEPB 4JO1L 1DN2A 3BEWA 3GMNB 1L9NA 1MWAB 2GDFA 5EC1A 5IW6B 5JMRA 3OB0H 4O02L 2A6XA 3MACL 4Y20A 1TVHB 4X80L 1F5FA 3G6AA 3VH8G 2XZCH 1CESA 3LS5L 1TJIL 2W59A 4JPWL 2ERFA 3QIWA 1IGJA 2APFA 1AQKL 2GIYA 5KTEL 1BJMA 2AK4B 4BM8A 4P23A 1ZLUK 3O4LA 4KGJA 1T2QH 4TQEH 4RISL 1FC2D 2AREA 5K59F 5DMYA 5GRJL 1X5JA 3G6JA 3KWWA 1S78C 5IK8A 5E8DL 3QUXC 1M7DA 2X09A 3QO0A 4KY1H 4NO0B 3I8TA 2LU3A 3B9KA 4HS8L 4TVPH 4AT6A 4LEXL 5C0AB 3QUMH 4TVPE 5C70A 1VDGA 3EOBB 5DC9B 4Q9QH 2Q7NA 3DO7B 3TN0B 4RA0A 4K1ZA 5C0FA 4MNQA 2OJZL 2DI9A 1DVFB 4AENB 3FT4A 4OZ4A 5HHNB 5JIHA 2JB5H 3BPNC 4XCYB 3O4OC 4F15B 1ZGLP 1AXSA 5DRNB 5HVHC 3EO9L 3VG0L 4X7TA 35C8L 4NN6B 1JHKH 3JWDC 1UJ3A 2YXFA 5ESVA 2XQYK 5TE7L 5I73B 1F6FB 2GW5A 1G7IA 4U7MA 1C7TA 2VXUH 3O9WB 5DQJB 4YE4H 3SKOA 2BNQD 1AXYA 2PETA 1A6PA 4F8QA 5MEND 3LPFA 4K20A 3PE9A 4U1KB 2DQUL 4NDMB 5DD5L 3OKKB 1U2CA 4N8PA 2E7QA 3O0XA 4ZUTB 3HR9A 4MJIA 3IDYB 2F5AH 3WLUA 4M6MH 5HGAB 1UXSA 2B5IB 4PJDF 2AJSH 3ZKMD 2F54A 1AXTL 2R69H 4JFPB 3ZE0E 1G7YA 4HUWB 3CFJA 3A4UA 1CF8L 1Q38A 2DTML 3IDXL 5GGTH 1FVCB 4NN7B 4OM1H 2VLRE 4MD4A 3UPAA 3O6ML 2HH0L 4YAQA 1CFVL 4UTBL 3U0TA 1XCTB 2WM0A 4P2YA 4S1RL 4XCCL 4QRRE 1ZM1A 3DOSA 2UURA 2OXGA 3GSQA 1A4JB 2VXSH 3BMWA 1FNAA 2E7HA 2X4QA 2YK1H 3BZDA 3IXTA 5CEXB 4EIZC 4KJYA 5FUOL 1QRNE 2PXYD 4XGZA 3PGCA 2DYPA 3USUB 4EOWH 4JO4H 4XTRC 3O11B 2R0WH 3A6BL 5SX5H 3NCCB 5JNYB 3P4MA 4UOJA 4JANA 1KIQB 1NANH 4MQXC 2H1PH 1GGCL 5AD0B 4YPGA 5E00A 1JMXA 2FZ3A 1LEIB 3E6HA 4ONGH 3MRJB 1DQ2A 2FEDC 4KTDL 2ED9A 1JK8B 1MREH 3MNVA 4JKLA 5JQ6L 4UAOC 1KEML 3VWJA 4YXKL 1NKRA 2Z92B 3P4OA 1MH5B 3ZXKA 1I1CA 1REIA 1P4IH 1DZBA 3MJGX 1AZDA 3TNNA 5C0DA 2DURA 4Q8LA 4OZFA 2J88H 5EU5A 5DI8A 1SY6L 1IC7H 2Z31B 4Q2ZA 3T3MF 4IEFB 4KKAC 3D3VE 3QXVA 4L4VD 2CK0L 1ZHKA 4QCIA 1HCVA 5J57B 4LK4A 4MCZA 3RMYA 4XVJL 2W9LA 3NIFE 1SJHA 2YWZA 1A1NB 1N4XH 3V0BA 3QI9A 1RHHB 2GSGB 2XICA 4GW5B 4AH2A 4PJAB 2EDRA 4LHJB 2IANE 3SGJC 1MVUA 4KKNA 4JDVA 4JDTH 4W6XB 1O7SA 5J56B 4NYLA 2Z93B 1QQDA 1MS3A 4IS6A 4FOYA 4GG8A 3JWDH 2EIEA 4NO5A 1NH6A 3CCHA 1GVIA 4G9FA 4JHWL 1QSFE 1DR9A 4GQ9H 4X6DA 3RWIA 3DTXA 1YECH 2C26A 1KB5B 1GIGL 4PLJD 1W6OA 1HIML 2ESVD 4PG9A 4ZPTA 2QHRL 4ZQKB 5F9JB 2X1PA 4DTGH 3H0TA 4LVOB 2HFEA 4O58H 4JY6B 3DX7A 5TDPB 1QLRB 2IQAB 2V2WA 4U6XA 2VABA 1C5BL 1SLAA 3FUQA 4QRSB 1S0JA 1CGSL 3EYSH 5MERB 4RIRA 3JVGC 4L3CB 4K3JH 1AGCA 5EBLB 5GGVL 3NPZB 2CRMA 3BOPA 5D8JL 2C5DC 2VXTH 5EO9A 3GO1L 5F7DA 1A6TA 1WZMA 2N7AA 1GYAA 3TIDA 1MLBB 5F96L 1PZ5A 4KGLA 2NZ9D 3MLTA 1M1SA 1MFEH 3DETC 3LKRB 3BPLB 1RAMA 2MCPH 4JM2F 5I66A 5C8JA 2ITCB 3UC0H 3KLAA 1FVEB 1HLCA 3GSUB 1BVKA 1EPFA 3W11D 1EHAA 3WSQH 3BUYA 2EAKA 4APQA 3ZT5A 3FQTB 1XGYL 3MJ7A 3ILQC 3N1FC 2QQNH 3RY6A 5LWYH 3MLPA 1FIEA 1HDMB 2IH1B 3NFSH 4ONFL 4X5XA 5DUVA 2BQPA 3L3KB 3REVA 3PIQA 3QFJA 3U36A 1CWVA 1IAKA 2H6PB 3O3AA 4G8GB 5IVXF 4V2CB 5DJ6B 2NY1C 4RDQF 5L2KA 2XZCL 5T3ZD 3HC0A 5C08D 1HEZB 4YW1A 2G9HA 2GYSA 1YUHA 1T2QL 1E6JH 4H0HB 3IDNB 3MUGA 4YDJA 4H8WH 2UYLB 3ES6B 3M07A 1I9EA 2V9RA 4KY1L 1N5AB 5JW4Q 1D7FA 3AYAA 4TVPL 4WI8A 1WLHA 3AS2A 5BVJB 4J3VA 4U1LA 3L5IA 5GSRA 4LPVA 4YEEA 4UTAH 1F6LL 5J11B 4C56D 2K7QA 3OTTA 4J3SA 3VXRA 1WK0A 1WVZA 3CDGA 2PNDA 1DQJA 5A16B 4NO3A 4JY4B 3U4BL 3ILRA 4XNQA 3F7YA 1OT2A 4YHNB 1MCHA 3Q6GH 3Q5YA 3D39E 4U36A 1YNTB 2R2EB 2UZXB 2JE7A 1LDPH 5SWSE 3LEVH 2VE6B 5DGQA 2A77L 1BJ1J 1JHKL 2VDQL 1ZS8B 4ELME 4FPCA 3CX5J 1A7QL 4YK4C 3WCYA 2ICEB 2BRQA 1KPUB 2VXUL 4W81A 5D7LD 1U8OB 3L3HA 2ARJB 4ZUSA 4X4ME 5BV7B 4WFGE 4YE4L 5D1ZC 1I1AA 3R8QA 5KSAC 4S2SA 3DSFH 2X7LB 5IB4B 2BNQB 2PHRA 4M8QB 5T1MA 3O2DL 1LEKA 5GSVB 5DWUH 4DAGH 5MENB 5J1SC 3THMH 4SLIA 2F5AL 3WNXA 3WNOA 4Z77B 4M6ML 4PJEF 1FIGH 2AJSL 3SBWA 3B9EA 4L8SA 2R69L 4M03A 5IKCA 1CQYA 5FF6B 4TNWK 2V2XA 1IAOA 1GYKA 2NXZC 5GGTL 4JLRA 4OM1L 4GFTB 4PGDB 3ZT7A 5FYKD 3MRLA 2ZUVA 2CSPA 4F58H 2DQTH 1VALA 2CR3A 3WYRA 4PRPA 2DMCA 5H37G 3O6LH 1CFTA 4XPHH 1OD7A 5DSCB 3GZKA 4U6VH 2KBGA 4NKOA 1AR1C 4WV1B 2RHEA 4JFHE 3Q3GA 1WBYB 4MXQC 1T03H 1PVHA 2VXSL 1WT5C 1OTUD 3INAA 3AMKA 3O12A 1OGAE 1BQPA 1KOAA 2WQZC 3MCLH 1QFPA 3AAZB 4OCLC 3RKDD 3AP5A 2GITA 4NZTH 4WO4D 1SCSA 3SDDD 5J13B 4FQXA 5T52A 3GSRA 2FDBP 4EOWL 4JO4L 3O6KH 4PV8B 2R0WL 4FQJH 2BVOB 4J3XA 2PXYB 3ESVF 3INUH 3KR3H 3RSJA 2H1PL 2IPTH 3G9VA 2W07A 1U8HA 3SQOH 5ID0A 3UTSD 4ONGL 4N90D 4U1HA 4N8VB 1S9VB 3V5KB 5CCKH 1FCCA 4QHMA 2X1XR 1TEIA 2YROA 1SEBA 4HQQH 4JFYB 5GLZA 2JB6B 4HKZA 2VWEC 1FHGA 5CWSB 1LE5B 4XBLA 1P4IL 2UZYB 3WDIA 3WDHA 1D5XB 1J0HA 1G9NC 1FE8H 3D69B 3MQIA 1S9XB 1QSEA 5ADPH 4KKLD 3MCKA 3RWHB 3RZWA 2J88L 4PIRF 4P4KA 1FZJA 1IC7L 1LWRA 3PNWA 4MA1C 5INDA 1RUAH 1T6VN 1U6AH 4LSQH 2EYTA 2E8YA 4F9PA 2YPKB 5DO2C 4L4VB 2X4TA 4YR6B 4M5YH 1TETH 4OZHB 2CWMA 4NC0B 3OBTA 5FO8A 4CU7A 2K3TA 3M45A 2DVAA 1SY6A 1AP2B 3MRCB 1LK2B 5IEHA 1JYWA 4JFFE 4PB9H 2EE2A 3FT2A 5F3BA 3SKNB 4JDTL 1UX6A 4LLUB 4J8RB 1LENA 4OI8A 2OS7A 2J5LB 1NFDF 3SGDH 4EDXA 4AEEA 4OCYH 3W59A 4J1UB 3U30B 3V6ZB 5FAAA 4XI5D 2P8LB 4I4WA 1JGUH 3QUZC 1VADB 4GQ9L 3B3IB 3NCYP 4Y89A 1MCPH 1QU0A 3EYFA 4D9QD