1UF0A

Solution structure of the n-terminal dcx domain of human doublecortin-like kinase
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
116
structure length
116
Chain Sequence
GSSGSSGKKAKKVRFYRNGDRYFKGIVYAISPDRFRSFEALLADLTRTLSDNVNLPQGVRTIYTIDGLKKISSLDQLVEGESYVCGSIEPFKKLEYTKNVNPNWSVNVKTSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein kinase DCAMKL1
publication title Solution structure of the N-terminal DCX domain of human doublecortin-like kinase
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 13
structure length 116
sequence length 116
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2003-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03607 DCX Doublecortin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.230 Alpha Beta Roll Ubiquitin-like (UB roll) Doublecortin domain 1uf0A00
1MG4A 1MJDA 2BQQA 5IOIA 5IO9A 5IKCM 5IP4D 1MFWA 2DNFA 5IN7A 1UF0A
chains in the Genus database with same CATH superfamily
3ZXVA 1PDXA 3IT6B 5AUIA 4HPLB 3A9KA 3QJZA 1NYRA 2JQRB 4XDCA 5AZFA 1K51A 4P1BC 1DOXA 2L7RA 1NI3A 2AX5A 3TCAA 1L0YB 3JW0X 5J17A 4ANXA 4XWWA 2NBUA 3E9SA 3EHVA 3K9OB 1EF1A 3EFCA 4PYZA 2B3AA 2WP9B 5AEKB 1PUTA 2FCQA 3AEFB 2Y3AA 2K22A 1QKZA 4TKNA 4ICVA 3ZGZA 1ZXIA 3LXFA 2CKHB 1N5WA 3NVYA 3ZJUA 4JE3B 2DZKA 5BYQA 2Z0DB 3AN1A 5EE9A 4HWIB 1QOGA 3CIRB 1E7UA 4R3DA 4DXGA 1E8XA 4DHZE 3NUHB 4RGOS 1YX6B 1I7HA 3L13A 4YT0B 5E6NA 4W9DA 3VR8B 1MJDA 1SE2A 2KMAA 3EFUA 2ZW1A 2KLGA 4KSLC 3VRAB 4B0EA 1ET6A 2PTLA 3L17A 2G4DB 1E7PB 3AE3B 4ARIA 3H8HA 3NOBA 1GB1A 4A55A 1FEHA 2K39A 2KJHB 4FXCA 3NVVA 3HRDD 2I1JA 4W9IA 1VCBA 2X38A 2OOBB 1TYGB 3VUXA 1UELA 2D10A 1XLPA 4WJPA 3M95A 3ZNHB 1WGRA 2WXLA 5JHBA 3W1YA 3N3KB 1NDDA 2D3GA 1ET9A 4KGTA 2KDEB 1F2RI 4IDIA 4RGNA 4N58A 4G11A 1A5RA 4BAXA 4IWPA 1R4NI 3R8BA 4OZCA 3FILB 4H2AA 4LNNA 4RF0A 5JH5C 3P4PB 4I6LB 4N9F4 1LM8B 2O2VA 2KX3A 2WDTB 3NZUA 5C23A 5CHWA 3N1YC 2FCNA 4WWNA 4NPNA 1AARA 3KUDB 4PS8A 1Z2MA 5IAAC 1IGCA 1OQRA 3P4SB 2L0FA 2LHDA 1SIFA 3BK1A 3NVZA 3QQ8B 2RPQA 1J7BA 3W2DA 2MHJA 3SFDB 4GDLA 3B0AA 2LEKA 1YJ1A 2JPHA 1L2NA 1L0VB 2V4IB 3AXCA 2EELA 4W9KA 2G4SA 5I4DA 1K50A 2ZNVB 3ZKJC 2GLSA 1YQ3B 1C76A 4IWOA 4G0NB 4M00A 2WDQB 2WX1A 3R7QA 1AN8A 1P98A 1UH6A 3GP7A 4IWQA 4LNIA 3AE4B 1N63A 3DPDA 2WXRA 2BVCA 1WM3A 2GBRA 1XLQA 2ZCCA 2ZVOA 3W5UB 4GN1A 2RMMA 1BMLC 3HUIA 4IG7B 1I4QA 1R4MI 2KFKA 3QWZB 1MHHE 2L3ZA 3GE8C 2DBYA 3KUZA 4HJKA 4MH0E 4W9JA 5D3DA 3TEXA 3BVZA 3KH0A 4IM3A 4XZ4A 3RNGC 2GRIA 2NTTA 3RZFA 4LNOA 3RUIB 1FIQA 1WJNA 1WXMA 2KOXA 1V1PA 1YX5B 3HM6X 4MJSA 1T0QC 2RDGA 2K6QA 2HTME 3AMZA 4G50A 1VDVA 4DHJD 2AL6A 2MBBB 4KDIC 4FULA 1TT5B 3ZIMA 4KGRA 1FM0D 3FKYA 1WWTA 3AECB 3GZNB 3Q8CA 1TKYA 2PPHA 3T8MA 5EDSA 1UNSA 1MVKA 4OW0A 1C78A 2KO3A 3VQIA 1ZUD2 2OHFA 3NY5A 3HVDA 1YMHE 1D5MC 1FFVA 2BGFA 1V81A 3ONSA 4TQ1A 3TIXA 3WA0A 2LGXA 1UD7A 3AEDB 3APFA 3VXWA 1L4DB 2IGDA 1NI2A 3AE5B 2WX0A 3DHGC 3VRBB 1HZ6A 1WJ6A 4K7SA 5G2NA 4BBNC 2MP2B 2ZPNA 1Y8RC 1XCQL 4HDQA 1N60A 5BMHA 4LK0M 1YOVB 3KYDD 4X57B 3JSVB 3BYTB 2C7MB 1SBBB 2BPSA 4K1RB 4JLCA 3WIMA 1XT9B 4ZRIA 1TKGA 2O6VD 3IAM1 3ML8A 4JPSA 2IPKD 2CU3A 2V4LA 3TUOA 5IKCM 1DGJA 1WYWB 2KTRB 4HVBA 5AUKA 4LNKA 3LYYA 3D32A 3MC9A 4YTNB 2J42A 4II3B 2IYDB 1D6EC 3EUB2 3R2IA 2KDFB 3ZRFA 1GC7A 2FCSA 3V61A 1P7EA 2FAZA 4WWMA 1N62A 3OJ3A 2KK8A 1B1ZA 3VUWA 3C0RB 1ZPSA 1WI0A 4WWPA 1MFWA 3A4RA 1V86A 4MEMA 2LUEA 2LGIA 1L7YA 1ZDVA 3N1XC 1FRRA 1C1YB 3OG5A 4EEWA 3T3OA 1TZ1A 4MACA 3CSTA 4WQMA 3KQ4A 2XK5B 2LRUA 1K53A 3RMKC 4EFOA 1S3SG 2WXNA 3AEAB 1YN3A 1ZKHA 1C4AA 2PKOA 4GXBA 1GUAB 3CF6E 3TEYA 1WM2A 4DWFA 2NCNA 2KVRA 4YL8A 5JZEB 5T8IA 2KJ6A 2ZJDA 5CHVC 2WU2B 4BBNF 2WXIA 1UUPA 2G1EA 4C7YA 3SU8X 1L6VA 4NJ7A 3N9YC 2J53A 5FR3A 3OAWA 3RN9C 3IXSA 2MRPA 2M1MA 3DBHI 1ZXHA 5L95C 1HA5A 2PJHA 2WQYB 3SDLC 1TS4A 1YQ4B 4N59A 1TY0A 1NBFC 3NRZA 3VH3B 5EE0A 4RCOA 2ASQA 1CQVA 4ANUA 1E9MA 2BB5A 1J7AA 3UI3A 1TS5A 2J4XA 3RZWC 2YLMA 3M3JA 5LNK1 1I4PA 1E5WA 1WGGA 4C4VA 2NBWB 4LDTD 2LVOA 1I4RA 2UWQA 2C9WB 1BUIC 1E90A 3PZ7A 3CSFA 1VZ6A 2M0AA 2YVCA 2XEWA 5EE3A 1C3TA 2K1FA 3RNEC 1IBXA 5D94A 3TJPA 5HFYA 2LZ6A 2BYFA 2L76A 4TQ0A 4BOZB 4CHKA 4IKGA 3Q6BA 4AOFA 3NZSA 1UF0A 3Q3OC 4GIVA 2KMCA 4WJNA 1CK1A 1GG3A 2NTSA 4YWGG 1XXGA 4NQKE 4C00A 3P4QB 3U52E 1QILA 4RFBA 2DZJA 1VZ8A 3AI5A 2MBOA 2VZKD 3A4SC 4A20A 4M0WA 3TBLD 2CR5A 1JMLA 3SR6A 5D7GA 2IBIB 4FBJB 3ZYYX 4ITKA 5L83A 2K8CA 1XLOA 2PW9A 1D5ZC 2DWQA 4W9FA 2WXGA 4KKJA 3BZDB 2PIAA 2ZVNA 1CZPA 3NS1A 4IOIE 1JWSD 1C9FA 2N9PC 2M4NA 4M02A 3UF8A 3UGBB 4WIPA 1M94A 1WE6A 2JWZA 1SF0A 3RD2A 1IP9A 1T0SC 3PLVA 1OTRB 3ZQ4A 3VTUA 1L4ZB 1JWUD 5BMIA 1J8CA 2GBNA 1Q5WB 1L5PA 5AZGA 3H7PA 1J19A 1JWBD 1Y56A 2N7DA 5FKAC 2EKEC 2Z0EB 2QEJC 3T3NA 2KVZA 2G45B 2O6VA 1FNVA 4FJYA 2K5PA 1E6EB 4DK5A 2O2VB 4BKGA 2C5LC 3ZO5B 3Q3MC 1F2RC 4O1NA 1V9JA 5E6JA 4RM8A 4K81A 3ABVB 3BYYB 1WFYA 2ZCBA 2NPTA 4XYCA 2Y5CA 4JIOU 4EZLA 2KWUB 3ZJVA 3FAHA 1JW9D 4GLSC 3FC4A 2Z59B 3QAQA 2L8JA 4A9AA 4GDLB 1KFYB 2K9XA 3K9PB 3B2GA 1YJIA 1R4MB 2QSDA 1GB4A 4KIKB 1EM7A 2NBVB 1OQQA 5JXVA 2IZVB 5C1ZA 4URKA 5KHQA 2BBCA 1I35A 2BWFA 2KFJA 3WANA 4B9KA 3RYTA 3UQAA 1C4CA 3DOWA 1E8YA 4FN2A 5JHAA 4MELA 2KD0A 2KJRA 3IAS1 2SEBD 3AB5A 4ZHOA 3MC0B 2LXAA 2JX5A 3W5VB 1E10A 3H1UA 4MT5A 2CJNA 4RGTA 2A4ZA 2KFKB 1XF5L 1WGDA 1WRDB 4XC2A 3ZNID 4ZRQA 3PVLA 1V1OA 3LDZE 2PMVA 2FUHB 4A3OA 1ROEA 3DBSA 4K7UA 1V1PB 4M8NA 3AEEB 2MA9B 4MJSB 3U8ZA 3VDZA 1JALA 3DBLI 4MH8A 3KWVA 2QILA 5IN7A 2D11A 1EWYC 1FNUA 2WDVB 4HXDA 1PGBA 5C3JB 1KLGD 4J3OD 2OEDA 4MM3A 3DBRB 2BKRB 2VRRB 2AQ2B 2AYOB 2CU1A 2KWVB 4S17A 3VHTC 2RDHA 1MI0A 3GS2A 1MPEA 1R7SA 4DHZB 3BIID 2LMCA 1WY8A 3L54A 1RLFA 3ENEA 3EA6A 4PT5A 4A6QA 2INCC 3MP9A 2D2QA 2QHOA 3SD5A 1IPGA 2KWCA 1G6JA 1UWMA 4RH6A 1WGHA 2WHIA 1MG4A 2LXCA 1WZ3A 4HK2A 3TMPB 4GMVA 3QK0A 1TS3A 4F7ZA 1JWMD 2KTFA 1HQRD 4FA6A 4HEA1 3DQVA 3N1ZC 1WH3A 4KX6B 3QHTA 2X8XX 4J6IA 5FR6A 2HJ1A 2ICIA 4A90A 4ZRJA 2LJ5A 4NJ6A 3DWGC 1RFAA 1WX7A 1QLBB 1WR1A 3PRZA 4ZRPA 4MSQB 1WR6E 4MSMB 2JZ3B 5HG2A 4AP4C 4BFRA 4EZKA 1T0YA 1SE3A 2KACA 1WYGA 4L23A 1JCKB 2KHWB 3WAOA 1KJTA 3LJ3A 2WXMA 3C19A 3RNCC 4W9HA 1WXAA 3H7SA 4WQOB 5BMGA 1FNWA 2VH1A 3EC8A 1ESFA 2D3BA 2WXJA 4TMAB 1D4BA 2AEHA 1QOBA 4A3PA 1SGHA 1XEEA 2KYWA 2NR2A 1JROA 1UBIA 4ICUA 2LASA 1TJEA 3WAPA 4MGKE 4YTPB 1T6BX 2JXXA 2WU5B 4YSYB 2ZPYA 2KC1A 3PHWB 1HXYD 3MJ5A 3PRMB 4NY0A 4L1BA 1FXAA 3KVFB 1F9JA 1J7CA 2V3PA 2IGHA 4JWSC 3QA8A 2H89B 3KWLA 4F1SA 4K7WA 4RGMA 2UYZB 4RF1A 3ECIA 3PO0A 4FHJA 3PHXB 4BKSD 2N4FA 5IOIA 4ZYNA 4PYUA 1KOTA 3VFKA 3GOEA 2IGGA 1WE7A 2GBKA 4M01A 4DQOC 5AZHA 4E74A 2IDYA 3VAWA 2BYEA 3IHPC 3ZRCA 2M56B 2W54A 1SEBD 2CHXA 2GBJA 3UINB 1VJKA 2WLBA 4IM0A 2L0TA 4IC7B 1WXVA 2CS4A 3TSSA 5IA7A 3OWEB 3PPAA 2C7NB 1V80A 4KSKC 2JYTA 2DNFA 5CX3A 2LGYA 2L1AA 2KC2A 3IG3A 2N0SB 2JZZA 4C4VB 4YTMB 1WMHA 1MHXA 5BO4B 4II2B 1TTNA 1H8CA 3R3MA 2V1YA 4YSZB 4W9LA 3H9DA 1OQYA 2NMQA 4OZBA 1IBXB 3OJ4B 1UGJA 2KAJA 4D2KA 1QZEA 4HROA 4NQLB 1E8ZA 2MSED 2EMSA 1KLUD 1TZOA 2D5GA 3L0WB 4HKQA 2LVPA 2QCZA 2N9KA 2LRWA 2RD0A 1NYQA 3CWIA 4C7ZA 1T3QA 3JYUA 3R66C 2BS4B 4QAYA 1XO3A 1I4HA 1JWAD 4A8XC 2IJ0A 1T5XD 1I42A 2ONQA 4ASWC 4M0WB 3Q69A 1SE9A 2N9LA 3ZTDA 3I5JC 4DHJB 3AH7A 3L10B 1PQSA 4OVVA 4XWTA 2MBQA 4I6NB 1K8RB 2C60A 2REXA 1FXTB 1VR9A 3A9JA 1H4RA 1TS2A 3N30A 1PGAA 4RMAA 4MDKE 5D3IB 3RPFC 3O65B 4CYEA 4KZCA 2HE7A 5LXHA 3RFZB 4EUTA 1I4XA 2FCMA 2BYVE 2BF8B 2AQ1B 2KT7A 1AW7A 3KLSX 2XBBC 4G3XB 4HCNB 5DPRA 3Q8BA 4NNJB 2M8SA 1U4AA 5MPOA 4LTUA 2LD9A 3U2SC 2HD5B 3BINA 2V9HA 1LXDA 2L52A 3NZ3A 3ML9A 4NAMA 2FBWB 4AQ7A 1RYJA 1NEKB 2KQ7A 3H7PB 1V2YA 3A9KB 3R7RA 4HKZE 4P16A 1B9RA 2DZIA 4REZA 2FIFA 1LQBA 2K8BA 5J18A 3P42A 2Y5PA 2O6VB 1TIFA 3AE9B 3BWUD 3O13A 3MC8A 3N32A 4ZRKA 4CQNA 3B9JA 1GOZA 3P2BA 3L16A 4GDKA 3QX1A 2AWTA 1C77A 1FO4A 4XX5A 3UIOB 2NPTB 2NVUI 3ZNZB 1JRPA 1XQQA 4RM9A 2V3SA 2WXKA 3PLUA 4NAWA 4C80A 1P1AA 3RNFC 2LHEA 3AE2B 3TEWA 1DOIA 5GXGB 3KYCD 3AU4A 3SFEB 4AWJA 5EE1A 2DX5B 3SEBA 4BZAA 2N1VA 4S0RA 2GI9A 3I63C 3AEBB 2WWZA 3PTFC 1N5XA 2N9XA 3Q3JA 1FRDA 2RSUA 3APDA 2KX0A 2YEPB 3I9V1 1C4PA 1VZ7A 4TUUA 2VH2A 3M63B 1KLVA 2RGFA 4WJOA 2OJWA 2WXHA 3HVZA 1LFDA 3V05A 2JRIB 3NJTA 3BVMA 1GPXA 2DLBA 2I2YA 3U30A 1FCCC 2J52A 1RRBA 1K52A 3AE1B 2KDMA 3P63A 4BKSA 1R4NB 3Q14C 4JWUC 2JY6A 2JZPA 3DDCB 2MQJA 4HJGE 1HZ5A 2HJ8A 3BK2A 1WX8A 1HEZE 1L6UA 1TGZB 2E6XA 1FXIA 3RNBC 2ON8A 4IW0A 1V6EA 2GOWA 4MM3B 2Q5WD 1IGDA 2KN4A 1OGWA 2KZRA 3L08A 4Q2JA 4PK1A 1YJJA 3Q3NC 3CMMB 3MHZA 2NS5A 3M62B 3IT4B 1KM7A 2KNBA 1JRUA 2K0PA 2I1KA 3PZ8A 2JU6X 4UDUC 2JSVX 4LDTB 4EKUA 3TL5A 2DHZA 1UWXA 1QT9A 2JXTA 4M8MA 2N7JA 2MLBA 4WWOA 2W82A 2A5UA 2PVGC 3AE7B 1LGRA 3WALA 2JRHA 2LI5A 4GB9A 1XLNA 4PS7A 2H88B 4W9CA 5J2RA 1IUEA 1WXSA 3EECA 4GGQA 4P1CC 2QDFA 5IP4D 4EE2A 3Q8AA 5DCNA 4B0MA 4GOCA 1BXTA 1M4VA 3PSEB 2N1WA 4FJVB 4IUMB 1YN5A 2JWUA 2JT4B 2J0MA 1ZDXA 4KDLB 1N6ZA 2VZKB 4WH4A 1QQRA 1JQ4A 2JVCA 5D2MB 3X0WA 1RAXA 3V62A 3ZXRA 3B08A 4FADA 1S1QB 1KRHA 1WF9A 4HCPB 2M0XA 3DHHC 4B95A 3W9CB 1WGKA 3RULA 1RWSA 3ZDTA 2WDRB 3DVNU 4B6WA 4LNFA 5BYSA 1SJHD 2G9HD 3Q2AC 1SB3C 5FK9C 2IO3B 2YEPF 3VR9B 4WURA 5LXIB 1Q10A 2MWSB 4NJCA 1ZE3D 4FJZA 2Y5BB 2AQ3B 1FD6A 1V5TA 2RR9A 5C2TB 1WZ0A 2R2OA 2BB6A 1V5OA 2KWDA 2DYMA 2SAKA 2BS2B 2MCNB 4XDDA 4LJPB 3VTVA 3KW5B 3A1QA 3IVFA 5CHFA 2L83A 1X1MA 1F0ZA 1VRAB 3S2AA 1D5XC 2WXOA 3QARA 1ENFA 5TSSA 1PYWD 2WXPA 2INPE 3PV1A 1Z5SB 1KTKA 2AL3A 4P7IA 4KGSA 3JVZX 3AE8B 3ZNGC 2GB1A 2WXFA 1SIJA 2M17A 1F52A 4ARCA 1F1HA 2V3NA 2LFIA 3NVWA 1NVID 4LCDE 1WJUA 2IO0B 3UIPB 1V97A 5G5GA 3A33B 4US8A 3DVGX 3DCGA 4DXFA 2MX2A 1P3QU 3ETRA 2K8HA 3IFWB 2G3QB 1P9DU 3AULA 1WMHB 1SSNA 2WNMA 4P6VF 5D6JB 4YSXB 1EF5A 1E0ZA 2MBEA 4AJWA 1SE4A 4EZJA 4BKTA 1F77A 1YIWA 1V49A 1EU3A 3C8YA 2R2QA 4BVUC 1OEYJ 3NHEB 4N6EB 4KIKA 2ZZPB 2W9NA 1DOYA 5HHDG 3ZLZA 3U7DA 2BKFA 5CTRC 2KDIA 4DBGA 1UBQA 3U7ZA 1NENB 2C7HA 5DPWA 1MG8A 3LB8C 4F8CB 4XE0A 3BY4B 2MJEA 4ZYSA 3DBHB 2KMMA 4WAFA 2MW5A 3NG0A 1D3ZA 2L00B 5DPTA 4E3CA 2ACZB 1V8CA 3Q8EA 4HPPA 2DAFA 3H6NA 2FNJB 1CJEA 4DXAB 2MEKA 2EMTA 4DDID 3A9JB 3EGRA 1FFUA 1GC6A 2BS3B 3WAMA 4EOYA 2LUMA 3AU5A 3IBEA 3DWMA 3RNAC 2J0JA 3HIZA 5TR5A 1ZW7A 4LJOB 4ANWA 2RDBC 2BT6A 4OZAA 2L32A 2ZNVC 3PRPB 3RCZA 2JUOA 3P4RB 1WSPA 2MJDA 3L4PA 3B2FA 3X23A 1J0GA 2N7EA 3QCAA 1HTOA 1VD2A 3AM9A 4MGYE 3WCQA 4GU2A 4FHKA 5G5HA 3FILA 4MGIE 2MJ3A 1Q1OA 4JL9A 1AWDA 3W1SC 3I3TB 1TKEA 2CHZA 1PGXA 2MBHA 1GJZA 4HPMB 4GSWA 2K25A 2IO1B 2FUG1 1EU4A 4GDKB 5LLIA 3DBRI 1WXQA 2EKIA 2KANA 3ZJTA 1QOAA 1HTQA 2QC8A 1C79A 3AV8A 3B1LX 4OVZA 1FCLA 3VTWA 4NAWB 3HK0A 3T9LA 3I57A 3QC8B 2PE6B 2W3SA 3Q3FA 3E56A 1LO5D 3PREA 4OHJA 3P1MA 1I4GA 2KN5A 1OFFA 2I38A 2HDEA 1E7VA 3ZW3A 1P7FA 1FMAD 3RI7C 2E3TA 4ZOHC 2D3CA 4XGAB 4K3CA 2IO2B 3OLMD 4KV2A 4OVUA 4USAA 5HI1A 1L0XB 3AEGB 2BWES 2IY0B 2XNAC 3W1SA 1IYFA 2D3AA 2LVQA 1ZOYB 1DYQA 3DVGY 3VH4B 3PGEA 1RFKA 2DZMA 4L2YA 3GB1A 3V6EB 3R2TA 2WYQA 3DHIC 2LGSA 4KVGB 3Q8FA 1ISNA 5GMVA 2OJRA 4JGHB 4DDGD 4TV3A 2W55A 4TSSA 1P0RA 3GE3C 3KUCB 4JQWC 1QOFA 3QIJA 3BVGA 3VUYA 2BYTA 5BYRA 4LLGM 1EUVB 2K3UA 3PZDA 3ZVVA 1TY2A 4C56C 1ACCA 4JX1C 4HDOA 1UGMA 5H92C 1N61A 2JYEA 2LGDA 1PFDA 5E6OA 1GAQB 3PT2B 4ZDVA 3AE6B 4RNAA 4AS1A 2MP2A 2Z8LA 2V0GA 1ZGUB 4KZ0A 4WJQA 3SHQA 1RM6C 4E71A 3GZNI 3V60A 1SXTA 3JSVA 3MJWA 4I6PA 4CO7A 1HE8A 1SJED 2KXJA 1WGYA 2PVOD 4WAAA 3RT3B 2DENB 3UQBA 3HHMA 2B76B 1EO6A 2J7QB 2R61A 2INDC 1A70A 1WX9A 2KTRA 3APCA 4US9A 2IY1B 5E6PA 1YD8U 4MGZE 4YXDB 1OEYA 3ALBA 2GMIC 2KKCA 3J9CA 3DVNV 4KKIA 4PS3A 4ZHPA 3TEZA 2DYBA 5G55A 2INNE 2CHWA 2KQSA 3HM3A 2D07B 2GBMA 1WJ4A 2DAJA 1CMXB 1BT0A 3ZTCA 2K6DB 2L05A 3V3XA 2M19A 2RPVA 1YN4A 5KHOA 1VLBA 3V6CB 4BOSC 1T0RC 5H8YE 2PLPA 3DBLB 2HTHA 1EWCA 4AJYB 4IM2A 4K3BA 2CJOA 4HRSA 4W9EA 3U4EG 1QF6A 1WIAA 4AUQC 2XK5A 2QIEB 1TBEA 2FIDA 2PE9A 1KF6B 2FE8A 2KLCA 2WXQA 2J0KA 3MHSD 2BW2A 2UU7A 2XN9C 4FLHA 1YNTE 2KDBA 2QJLA 3VVWB 2WGSA 2JF5A 2N9EB 2PEAA 1FPYA 2QMTA 1KH0A 2DYOA 2BTEA 2W3RA 4ANVA 3ZDMC 2ZW0A 4ACFA 1GNUA 5IO9A 1UZXB 1STEA 3MTNB 3N20C 3URYA 2MH7A 2LJIA 3MFGA 2LWPA 3A1QB 3ZUNA 1E8WA 1ZP0B 4NZLB 1XCTL 1WRIA 4W9GA 2ZEQA 1XD3B 2WS3B 1AYFA 3PS6A 5DPSA 2BQQA 2KQ4X 1Q0WB 1YQBA 2TSSA 4HLEA 3NS8A 5HKHA
chains in the Genus database with same CATH topology
1MG4A 1MJDA 2BQQA 5IOIA 5IO9A 5IKCM 5IP4D 1MFWA 2DNFA 5IN7A 1UF0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MG4 A;  1MJD A;  2BQQ A;  5IOI A;  5IO9 A;  5IKC M;  5IP4 D;  1MFW A;  2DNF A;  5IN7 A;  1UF0 A; 
#chains in the Genus database with same CATH topology
 3ZXV A;  1PDX A;  3IT6 B;  5AUI A;  4HPL B;  3A9K A;  3QJZ A;  1NYR A;  2JQR B;  4XDC A;  5AZF A;  1K51 A;  4P1B C;  1DOX A;  2L7R A;  1NI3 A;  2AX5 A;  3TCA A;  1L0Y B;  3JW0 X;  5J17 A;  4ANX A;  4XWW A;  2NBU A;  3E9S A;  3EHV A;  3K9O B;  1EF1 A;  3EFC A;  4PYZ A;  2B3A A;  2WP9 B;  5AEK B;  1PUT A;  2FCQ A;  3AEF B;  2Y3A A;  2K22 A;  1QKZ A;  4TKN A;  4ICV A;  3ZGZ A;  1ZXI A;  3LXF A;  2CKH B;  1N5W A;  3NVY A;  3ZJU A;  4JE3 B;  2DZK A;  5BYQ A;  2Z0D B;  3AN1 A;  5EE9 A;  4HWI B;  1QOG A;  3CIR B;  1E7U A;  4R3D A;  4DXG A;  1E8X A;  4DHZ E;  3NUH B;  4RGO S;  1YX6 B;  1I7H A;  3L13 A;  4YT0 B;  5E6N A;  4W9D A;  3VR8 B;  1MJD A;  1SE2 A;  2KMA A;  3EFU A;  2ZW1 A;  2KLG A;  4KSL C;  3VRA B;  4B0E A;  1ET6 A;  2PTL A;  3L17 A;  2G4D B;  1E7P B;  3AE3 B;  4ARI A;  3H8H A;  3NOB A;  1GB1 A;  4A55 A;  1FEH A;  2K39 A;  2KJH B;  4FXC A;  3NVV A;  3HRD D;  2I1J A;  4W9I A;  1VCB A;  2X38 A;  2OOB B;  1TYG B;  3VUX A;  1UEL A;  2D10 A;  1XLP A;  4WJP A;  3M95 A;  3ZNH B;  1WGR A;  2WXL A;  5JHB A;  3W1Y A;  3N3K B;  1NDD A;  2D3G A;  1ET9 A;  4KGT A;  2KDE B;  1F2R I;  4IDI A;  4RGN A;  4N58 A;  4G11 A;  1A5R A;  4BAX A;  4IWP A;  1R4N I;  3R8B A;  4OZC A;  3FIL B;  4H2A A;  4LNN A;  4RF0 A;  5JH5 C;  3P4P B;  4I6L B;  4N9F 4;  1LM8 B;  2O2V A;  2KX3 A;  2WDT B;  3NZU A;  5C23 A;  5CHW A;  3N1Y C;  2FCN A;  4WWN A;  4NPN A;  1AAR A;  3KUD B;  4PS8 A;  1Z2M A;  5IAA C;  1IGC A;  1OQR A;  3P4S B;  2L0F A;  2LHD A;  1SIF A;  3BK1 A;  3NVZ A;  3QQ8 B;  2RPQ A;  1J7B A;  3W2D A;  2MHJ A;  3SFD B;  4GDL A;  3B0A A;  2LEK A;  1YJ1 A;  2JPH A;  1L2N A;  1L0V B;  2V4I B;  3AXC A;  2EEL A;  4W9K A;  2G4S A;  5I4D A;  1K50 A;  2ZNV B;  3ZKJ C;  2GLS A;  1YQ3 B;  1C76 A;  4IWO A;  4G0N B;  4M00 A;  2WDQ B;  2WX1 A;  3R7Q A;  1AN8 A;  1P98 A;  1UH6 A;  3GP7 A;  4IWQ A;  4LNI A;  3AE4 B;  1N63 A;  3DPD A;  2WXR A;  2BVC A;  1WM3 A;  2GBR A;  1XLQ A;  2ZCC A;  2ZVO A;  3W5U B;  4GN1 A;  2RMM A;  1BML C;  3HUI A;  4IG7 B;  1I4Q A;  1R4M I;  2KFK A;  3QWZ B;  1MHH E;  2L3Z A;  3GE8 C;  2DBY A;  3KUZ A;  4HJK A;  4MH0 E;  4W9J A;  5D3D A;  3TEX A;  3BVZ A;  3KH0 A;  4IM3 A;  4XZ4 A;  3RNG C;  2GRI A;  2NTT A;  3RZF A;  4LNO A;  3RUI B;  1FIQ A;  1WJN A;  1WXM A;  2KOX A;  1V1P A;  1YX5 B;  3HM6 X;  4MJS A;  1T0Q C;  2RDG A;  2K6Q A;  2HTM E;  3AMZ A;  4G50 A;  1VDV A;  4DHJ D;  2AL6 A;  2MBB B;  4KDI C;  4FUL A;  1TT5 B;  3ZIM A;  4KGR A;  1FM0 D;  3FKY A;  1WWT A;  3AEC B;  3GZN B;  3Q8C A;  1TKY A;  2PPH A;  3T8M A;  5EDS A;  1UNS A;  1MVK A;  4OW0 A;  1C78 A;  2KO3 A;  3VQI A;  1ZUD 2;  2OHF A;  3NY5 A;  3HVD A;  1YMH E;  1D5M C;  1FFV A;  2BGF A;  1V81 A;  3ONS A;  4TQ1 A;  3TIX A;  3WA0 A;  2LGX A;  1UD7 A;  3AED B;  3APF A;  3VXW A;  1L4D B;  2IGD A;  1NI2 A;  3AE5 B;  2WX0 A;  3DHG C;  3VRB B;  1HZ6 A;  1WJ6 A;  4K7S A;  5G2N A;  4BBN C;  2MP2 B;  2ZPN A;  1Y8R C;  1XCQ L;  4HDQ A;  1N60 A;  5BMH A;  4LK0 M;  1YOV B;  3KYD D;  4X57 B;  3JSV B;  3BYT B;  2C7M B;  1SBB B;  2BPS A;  4K1R B;  4JLC A;  3WIM A;  1XT9 B;  4ZRI A;  1TKG A;  2O6V D;  3IAM 1;  3ML8 A;  4JPS A;  2IPK D;  2CU3 A;  2V4L A;  3TUO A;  5IKC M;  1DGJ A;  1WYW B;  2KTR B;  4HVB A;  5AUK A;  4LNK A;  3LYY A;  3D32 A;  3MC9 A;  4YTN B;  2J42 A;  4II3 B;  2IYD B;  1D6E C;  3EUB 2;  3R2I A;  2KDF B;  3ZRF A;  1GC7 A;  2FCS A;  3V61 A;  1P7E A;  2FAZ A;  4WWM A;  1N62 A;  3OJ3 A;  2KK8 A;  1B1Z A;  3VUW A;  3C0R B;  1ZPS A;  1WI0 A;  4WWP A;  1MFW A;  3A4R A;  1V86 A;  4MEM A;  2LUE A;  2LGI A;  1L7Y A;  1ZDV A;  3N1X C;  1FRR A;  1C1Y B;  3OG5 A;  4EEW A;  3T3O A;  1TZ1 A;  4MAC A;  3CST A;  4WQM A;  3KQ4 A;  2XK5 B;  2LRU A;  1K53 A;  3RMK C;  4EFO A;  1S3S G;  2WXN A;  3AEA B;  1YN3 A;  1ZKH A;  1C4A A;  2PKO A;  4GXB A;  1GUA B;  3CF6 E;  3TEY A;  1WM2 A;  4DWF A;  2NCN A;  2KVR A;  4YL8 A;  5JZE B;  5T8I A;  2KJ6 A;  2ZJD A;  5CHV C;  2WU2 B;  4BBN F;  2WXI A;  1UUP A;  2G1E A;  4C7Y A;  3SU8 X;  1L6V A;  4NJ7 A;  3N9Y C;  2J53 A;  5FR3 A;  3OAW A;  3RN9 C;  3IXS A;  2MRP A;  2M1M A;  3DBH I;  1ZXH A;  5L95 C;  1HA5 A;  2PJH A;  2WQY B;  3SDL C;  1TS4 A;  1YQ4 B;  4N59 A;  1TY0 A;  1NBF C;  3NRZ A;  3VH3 B;  5EE0 A;  4RCO A;  2ASQ A;  1CQV A;  4ANU A;  1E9M A;  2BB5 A;  1J7A A;  3UI3 A;  1TS5 A;  2J4X A;  3RZW C;  2YLM A;  3M3J A;  5LNK 1;  1I4P A;  1E5W A;  1WGG A;  4C4V A;  2NBW B;  4LDT D;  2LVO A;  1I4R A;  2UWQ A;  2C9W B;  1BUI C;  1E90 A;  3PZ7 A;  3CSF A;  1VZ6 A;  2M0A A;  2YVC A;  2XEW A;  5EE3 A;  1C3T A;  2K1F A;  3RNE C;  1IBX A;  5D94 A;  3TJP A;  5HFY A;  2LZ6 A;  2BYF A;  2L76 A;  4TQ0 A;  4BOZ B;  4CHK A;  4IKG A;  3Q6B A;  4AOF A;  3NZS A;  1UF0 A;  3Q3O C;  4GIV A;  2KMC A;  4WJN A;  1CK1 A;  1GG3 A;  2NTS A;  4YWG G;  1XXG A;  4NQK E;  4C00 A;  3P4Q B;  3U52 E;  1QIL A;  4RFB A;  2DZJ A;  1VZ8 A;  3AI5 A;  2MBO A;  2VZK D;  3A4S C;  4A20 A;  4M0W A;  3TBL D;  2CR5 A;  1JML A;  3SR6 A;  5D7G A;  2IBI B;  4FBJ B;  3ZYY X;  4ITK A;  5L83 A;  2K8C A;  1XLO A;  2PW9 A;  1D5Z C;  2DWQ A;  4W9F A;  2WXG A;  4KKJ A;  3BZD B;  2PIA A;  2ZVN A;  1CZP A;  3NS1 A;  4IOI E;  1JWS D;  1C9F A;  2N9P C;  2M4N A;  4M02 A;  3UF8 A;  3UGB B;  4WIP A;  1M94 A;  1WE6 A;  2JWZ A;  1SF0 A;  3RD2 A;  1IP9 A;  1T0S C;  3PLV A;  1OTR B;  3ZQ4 A;  3VTU A;  1L4Z B;  1JWU D;  5BMI A;  1J8C A;  2GBN A;  1Q5W B;  1L5P A;  5AZG A;  3H7P A;  1J19 A;  1JWB D;  1Y56 A;  2N7D A;  5FKA C;  2EKE C;  2Z0E B;  2QEJ C;  3T3N A;  2KVZ A;  2G45 B;  2O6V A;  1FNV A;  4FJY A;  2K5P A;  1E6E B;  4DK5 A;  2O2V B;  4BKG A;  2C5L C;  3ZO5 B;  3Q3M C;  1F2R C;  4O1N A;  1V9J A;  5E6J A;  4RM8 A;  4K81 A;  3ABV B;  3BYY B;  1WFY A;  2ZCB A;  2NPT A;  4XYC A;  2Y5C A;  4JIO U;  4EZL A;  2KWU B;  3ZJV A;  3FAH A;  1JW9 D;  4GLS C;  3FC4 A;  2Z59 B;  3QAQ A;  2L8J A;  4A9A A;  4GDL B;  1KFY B;  2K9X A;  3K9P B;  3B2G A;  1YJI A;  1R4M B;  2QSD A;  1GB4 A;  4KIK B;  1EM7 A;  2NBV B;  1OQQ A;  5JXV A;  2IZV B;  5C1Z A;  4URK A;  5KHQ A;  2BBC A;  1I35 A;  2BWF A;  2KFJ A;  3WAN A;  4B9K A;  3RYT A;  3UQA A;  1C4C A;  3DOW A;  1E8Y A;  4FN2 A;  5JHA A;  4MEL A;  2KD0 A;  2KJR A;  3IAS 1;  2SEB D;  3AB5 A;  4ZHO A;  3MC0 B;  2LXA A;  2JX5 A;  3W5V B;  1E10 A;  3H1U A;  4MT5 A;  2CJN A;  4RGT A;  2A4Z A;  2KFK B;  1XF5 L;  1WGD A;  1WRD B;  4XC2 A;  3ZNI D;  4ZRQ A;  3PVL A;  1V1O A;  3LDZ E;  2PMV A;  2FUH B;  4A3O A;  1ROE A;  3DBS A;  4K7U A;  1V1P B;  4M8N A;  3AEE B;  2MA9 B;  4MJS B;  3U8Z A;  3VDZ A;  1JAL A;  3DBL I;  4MH8 A;  3KWV A;  2QIL A;  5IN7 A;  2D11 A;  1EWY C;  1FNU A;  2WDV B;  4HXD A;  1PGB A;  5C3J B;  1KLG D;  4J3O D;  2OED A;  4MM3 A;  3DBR B;  2BKR B;  2VRR B;  2AQ2 B;  2AYO B;  2CU1 A;  2KWV B;  4S17 A;  3VHT C;  2RDH A;  1MI0 A;  3GS2 A;  1MPE A;  1R7S A;  4DHZ B;  3BII D;  2LMC A;  1WY8 A;  3L54 A;  1RLF A;  3ENE A;  3EA6 A;  4PT5 A;  4A6Q A;  2INC C;  3MP9 A;  2D2Q A;  2QHO A;  3SD5 A;  1IPG A;  2KWC A;  1G6J A;  1UWM A;  4RH6 A;  1WGH A;  2WHI A;  1MG4 A;  2LXC A;  1WZ3 A;  4HK2 A;  3TMP B;  4GMV A;  3QK0 A;  1TS3 A;  4F7Z A;  1JWM D;  2KTF A;  1HQR D;  4FA6 A;  4HEA 1;  3DQV A;  3N1Z C;  1WH3 A;  4KX6 B;  3QHT A;  2X8X X;  4J6I A;  5FR6 A;  2HJ1 A;  2ICI A;  4A90 A;  4ZRJ A;  2LJ5 A;  4NJ6 A;  3DWG C;  1RFA A;  1WX7 A;  1QLB B;  1WR1 A;  3PRZ A;  4ZRP A;  4MSQ B;  1WR6 E;  4MSM B;  2JZ3 B;  5HG2 A;  4AP4 C;  4BFR A;  4EZK A;  1T0Y A;  1SE3 A;  2KAC A;  1WYG A;  4L23 A;  1JCK B;  2KHW B;  3WAO A;  1KJT A;  3LJ3 A;  2WXM A;  3C19 A;  3RNC C;  4W9H A;  1WXA A;  3H7S A;  4WQO B;  5BMG A;  1FNW A;  2VH1 A;  3EC8 A;  1ESF A;  2D3B A;  2WXJ A;  4TMA B;  1D4B A;  2AEH A;  1QOB A;  4A3P A;  1SGH A;  1XEE A;  2KYW A;  2NR2 A;  1JRO A;  1UBI A;  4ICU A;  2LAS A;  1TJE A;  3WAP A;  4MGK E;  4YTP B;  1T6B X;  2JXX A;  2WU5 B;  4YSY B;  2ZPY A;  2KC1 A;  3PHW B;  1HXY D;  3MJ5 A;  3PRM B;  4NY0 A;  4L1B A;  1FXA A;  3KVF B;  1F9J A;  1J7C A;  2V3P A;  2IGH A;  4JWS C;  3QA8 A;  2H89 B;  3KWL A;  4F1S A;  4K7W A;  4RGM A;  2UYZ B;  4RF1 A;  3ECI A;  3PO0 A;  4FHJ A;  3PHX B;  4BKS D;  2N4F A;  5IOI A;  4ZYN A;  4PYU A;  1KOT A;  3VFK A;  3GOE A;  2IGG A;  1WE7 A;  2GBK A;  4M01 A;  4DQO C;  5AZH A;  4E74 A;  2IDY A;  3VAW A;  2BYE A;  3IHP C;  3ZRC A;  2M56 B;  2W54 A;  1SEB D;  2CHX A;  2GBJ A;  3UIN B;  1VJK A;  2WLB A;  4IM0 A;  2L0T A;  4IC7 B;  1WXV A;  2CS4 A;  3TSS A;  5IA7 A;  3OWE B;  3PPA A;  2C7N B;  1V80 A;  4KSK C;  2JYT A;  2DNF A;  5CX3 A;  2LGY A;  2L1A A;  2KC2 A;  3IG3 A;  2N0S B;  2JZZ A;  4C4V B;  4YTM B;  1WMH A;  1MHX A;  5BO4 B;  4II2 B;  1TTN A;  1H8C A;  3R3M A;  2V1Y A;  4YSZ B;  4W9L A;  3H9D A;  1OQY A;  2NMQ A;  4OZB A;  1IBX B;  3OJ4 B;  1UGJ A;  2KAJ A;  4D2K A;  1QZE A;  4HRO A;  4NQL B;  1E8Z A;  2MSE D;  2EMS A;  1KLU D;  1TZO A;  2D5G A;  3L0W B;  4HKQ A;  2LVP A;  2QCZ A;  2N9K A;  2LRW A;  2RD0 A;  1NYQ A;  3CWI A;  4C7Z A;  1T3Q A;  3JYU A;  3R66 C;  2BS4 B;  4QAY A;  1XO3 A;  1I4H A;  1JWA D;  4A8X C;  2IJ0 A;  1T5X D;  1I42 A;  2ONQ A;  4ASW C;  4M0W B;  3Q69 A;  1SE9 A;  2N9L A;  3ZTD A;  3I5J C;  4DHJ B;  3AH7 A;  3L10 B;  1PQS A;  4OVV A;  4XWT A;  2MBQ A;  4I6N B;  1K8R B;  2C60 A;  2REX A;  1FXT B;  1VR9 A;  3A9J A;  1H4R A;  1TS2 A;  3N30 A;  1PGA A;  4RMA A;  4MDK E;  5D3I B;  3RPF C;  3O65 B;  4CYE A;  4KZC A;  2HE7 A;  5LXH A;  3RFZ B;  4EUT A;  1I4X A;  2FCM A;  2BYV E;  2BF8 B;  2AQ1 B;  2KT7 A;  1AW7 A;  3KLS X;  2XBB C;  4G3X B;  4HCN B;  5DPR A;  3Q8B A;  4NNJ B;  2M8S A;  1U4A A;  5MPO A;  4LTU A;  2LD9 A;  3U2S C;  2HD5 B;  3BIN A;  2V9H A;  1LXD A;  2L52 A;  3NZ3 A;  3ML9 A;  4NAM A;  2FBW B;  4AQ7 A;  1RYJ A;  1NEK B;  2KQ7 A;  3H7P B;  1V2Y A;  3A9K B;  3R7R A;  4HKZ E;  4P16 A;  1B9R A;  2DZI A;  4REZ A;  2FIF A;  1LQB A;  2K8B A;  5J18 A;  3P42 A;  2Y5P A;  2O6V B;  1TIF A;  3AE9 B;  3BWU D;  3O13 A;  3MC8 A;  3N32 A;  4ZRK A;  4CQN A;  3B9J A;  1GOZ A;  3P2B A;  3L16 A;  4GDK A;  3QX1 A;  2AWT A;  1C77 A;  1FO4 A;  4XX5 A;  3UIO B;  2NPT B;  2NVU I;  3ZNZ B;  1JRP A;  1XQQ A;  4RM9 A;  2V3S A;  2WXK A;  3PLU A;  4NAW A;  4C80 A;  1P1A A;  3RNF C;  2LHE A;  3AE2 B;  3TEW A;  1DOI A;  5GXG B;  3KYC D;  3AU4 A;  3SFE B;  4AWJ A;  5EE1 A;  2DX5 B;  3SEB A;  4BZA A;  2N1V A;  4S0R A;  2GI9 A;  3I63 C;  3AEB B;  2WWZ A;  3PTF C;  1N5X A;  2N9X A;  3Q3J A;  1FRD A;  2RSU A;  3APD A;  2KX0 A;  2YEP B;  3I9V 1;  1C4P A;  1VZ7 A;  4TUU A;  2VH2 A;  3M63 B;  1KLV A;  2RGF A;  4WJO A;  2OJW A;  2WXH A;  3HVZ A;  1LFD A;  3V05 A;  2JRI B;  3NJT A;  3BVM A;  1GPX A;  2DLB A;  2I2Y A;  3U30 A;  1FCC C;  2J52 A;  1RRB A;  1K52 A;  3AE1 B;  2KDM A;  3P63 A;  4BKS A;  1R4N B;  3Q14 C;  4JWU C;  2JY6 A;  2JZP A;  3DDC B;  2MQJ A;  4HJG E;  1HZ5 A;  2HJ8 A;  3BK2 A;  1WX8 A;  1HEZ E;  1L6U A;  1TGZ B;  2E6X A;  1FXI A;  3RNB C;  2ON8 A;  4IW0 A;  1V6E A;  2GOW A;  4MM3 B;  2Q5W D;  1IGD A;  2KN4 A;  1OGW A;  2KZR A;  3L08 A;  4Q2J A;  4PK1 A;  1YJJ A;  3Q3N C;  3CMM B;  3MHZ A;  2NS5 A;  3M62 B;  3IT4 B;  1KM7 A;  2KNB A;  1JRU A;  2K0P A;  2I1K A;  3PZ8 A;  2JU6 X;  4UDU C;  2JSV X;  4LDT B;  4EKU A;  3TL5 A;  2DHZ A;  1UWX A;  1QT9 A;  2JXT A;  4M8M A;  2N7J A;  2MLB A;  4WWO A;  2W82 A;  2A5U A;  2PVG C;  3AE7 B;  1LGR A;  3WAL A;  2JRH A;  2LI5 A;  4GB9 A;  1XLN A;  4PS7 A;  2H88 B;  4W9C A;  5J2R A;  1IUE A;  1WXS A;  3EEC A;  4GGQ A;  4P1C C;  2QDF A;  5IP4 D;  4EE2 A;  3Q8A A;  5DCN A;  4B0M A;  4GOC A;  1BXT A;  1M4V A;  3PSE B;  2N1W A;  4FJV B;  4IUM B;  1YN5 A;  2JWU A;  2JT4 B;  2J0M A;  1ZDX A;  4KDL B;  1N6Z A;  2VZK B;  4WH4 A;  1QQR A;  1JQ4 A;  2JVC A;  5D2M B;  3X0W A;  1RAX A;  3V62 A;  3ZXR A;  3B08 A;  4FAD A;  1S1Q B;  1KRH A;  1WF9 A;  4HCP B;  2M0X A;  3DHH C;  4B95 A;  3W9C B;  1WGK A;  3RUL A;  1RWS A;  3ZDT A;  2WDR B;  3DVN U;  4B6W A;  4LNF A;  5BYS A;  1SJH D;  2G9H D;  3Q2A C;  1SB3 C;  5FK9 C;  2IO3 B;  2YEP F;  3VR9 B;  4WUR A;  5LXI B;  1Q10 A;  2MWS B;  4NJC A;  1ZE3 D;  4FJZ A;  2Y5B B;  2AQ3 B;  1FD6 A;  1V5T A;  2RR9 A;  5C2T B;  1WZ0 A;  2R2O A;  2BB6 A;  1V5O A;  2KWD A;  2DYM A;  2SAK A;  2BS2 B;  2MCN B;  4XDD A;  4LJP B;  3VTV A;  3KW5 B;  3A1Q A;  3IVF A;  5CHF A;  2L83 A;  1X1M A;  1F0Z A;  1VRA B;  3S2A A;  1D5X C;  2WXO A;  3QAR A;  1ENF A;  5TSS A;  1PYW D;  2WXP A;  2INP E;  3PV1 A;  1Z5S B;  1KTK A;  2AL3 A;  4P7I A;  4KGS A;  3JVZ X;  3AE8 B;  3ZNG C;  2GB1 A;  2WXF A;  1SIJ A;  2M17 A;  1F52 A;  4ARC A;  1F1H A;  2V3N A;  2LFI A;  3NVW A;  1NVI D;  4LCD E;  1WJU A;  2IO0 B;  3UIP B;  1V97 A;  5G5G A;  3A33 B;  4US8 A;  3DVG X;  3DCG A;  4DXF A;  2MX2 A;  1P3Q U;  3ETR A;  2K8H A;  3IFW B;  2G3Q B;  1P9D U;  3AUL A;  1WMH B;  1SSN A;  2WNM A;  4P6V F;  5D6J B;  4YSX B;  1EF5 A;  1E0Z A;  2MBE A;  4AJW A;  1SE4 A;  4EZJ A;  4BKT A;  1F77 A;  1YIW A;  1V49 A;  1EU3 A;  3C8Y A;  2R2Q A;  4BVU C;  1OEY J;  3NHE B;  4N6E B;  4KIK A;  2ZZP B;  2W9N A;  1DOY A;  5HHD G;  3ZLZ A;  3U7D A;  2BKF A;  5CTR C;  2KDI A;  4DBG A;  1UBQ A;  3U7Z A;  1NEN B;  2C7H A;  5DPW A;  1MG8 A;  3LB8 C;  4F8C B;  4XE0 A;  3BY4 B;  2MJE A;  4ZYS A;  3DBH B;  2KMM A;  4WAF A;  2MW5 A;  3NG0 A;  1D3Z A;  2L00 B;  5DPT A;  4E3C A;  2ACZ B;  1V8C A;  3Q8E A;  4HPP A;  2DAF A;  3H6N A;  2FNJ B;  1CJE A;  4DXA B;  2MEK A;  2EMT A;  4DDI D;  3A9J B;  3EGR A;  1FFU A;  1GC6 A;  2BS3 B;  3WAM A;  4EOY A;  2LUM A;  3AU5 A;  3IBE A;  3DWM A;  3RNA C;  2J0J A;  3HIZ A;  5TR5 A;  1ZW7 A;  4LJO B;  4ANW A;  2RDB C;  2BT6 A;  4OZA A;  2L32 A;  2ZNV C;  3PRP B;  3RCZ A;  2JUO A;  3P4R B;  1WSP A;  2MJD A;  3L4P A;  3B2F A;  3X23 A;  1J0G A;  2N7E A;  3QCA A;  1HTO A;  1VD2 A;  3AM9 A;  4MGY E;  3WCQ A;  4GU2 A;  4FHK A;  5G5H A;  3FIL A;  4MGI E;  2MJ3 A;  1Q1O A;  4JL9 A;  1AWD A;  3W1S C;  3I3T B;  1TKE A;  2CHZ A;  1PGX A;  2MBH A;  1GJZ A;  4HPM B;  4GSW A;  2K25 A;  2IO1 B;  2FUG 1;  1EU4 A;  4GDK B;  5LLI A;  3DBR I;  1WXQ A;  2EKI A;  2KAN A;  3ZJT A;  1QOA A;  1HTQ A;  2QC8 A;  1C79 A;  3AV8 A;  3B1L X;  4OVZ A;  1FCL A;  3VTW A;  4NAW B;  3HK0 A;  3T9L A;  3I57 A;  3QC8 B;  2PE6 B;  2W3S A;  3Q3F A;  3E56 A;  1LO5 D;  3PRE A;  4OHJ A;  3P1M A;  1I4G A;  2KN5 A;  1OFF A;  2I38 A;  2HDE A;  1E7V A;  3ZW3 A;  1P7F A;  1FMA D;  3RI7 C;  2E3T A;  4ZOH C;  2D3C A;  4XGA B;  4K3C A;  2IO2 B;  3OLM D;  4KV2 A;  4OVU A;  4USA A;  5HI1 A;  1L0X B;  3AEG B;  2BWE S;  2IY0 B;  2XNA C;  3W1S A;  1IYF A;  2D3A A;  2LVQ A;  1ZOY B;  1DYQ A;  3DVG Y;  3VH4 B;  3PGE A;  1RFK A;  2DZM A;  4L2Y A;  3GB1 A;  3V6E B;  3R2T A;  2WYQ A;  3DHI C;  2LGS A;  4KVG B;  3Q8F A;  1ISN A;  5GMV A;  2OJR A;  4JGH B;  4DDG D;  4TV3 A;  2W55 A;  4TSS A;  1P0R A;  3GE3 C;  3KUC B;  4JQW C;  1QOF A;  3QIJ A;  3BVG A;  3VUY A;  2BYT A;  5BYR A;  4LLG M;  1EUV B;  2K3U A;  3PZD A;  3ZVV A;  1TY2 A;  4C56 C;  1ACC A;  4JX1 C;  4HDO A;  1UGM A;  5H92 C;  1N61 A;  2JYE A;  2LGD A;  1PFD A;  5E6O A;  1GAQ B;  3PT2 B;  4ZDV A;  3AE6 B;  4RNA A;  4AS1 A;  2MP2 A;  2Z8L A;  2V0G A;  1ZGU B;  4KZ0 A;  4WJQ A;  3SHQ A;  1RM6 C;  4E71 A;  3GZN I;  3V60 A;  1SXT A;  3JSV A;  3MJW A;  4I6P A;  4CO7 A;  1HE8 A;  1SJE D;  2KXJ A;  1WGY A;  2PVO D;  4WAA A;  3RT3 B;  2DEN B;  3UQB A;  3HHM A;  2B76 B;  1EO6 A;  2J7Q B;  2R61 A;  2IND C;  1A70 A;  1WX9 A;  2KTR A;  3APC A;  4US9 A;  2IY1 B;  5E6P A;  1YD8 U;  4MGZ E;  4YXD B;  1OEY A;  3ALB A;  2GMI C;  2KKC A;  3J9C A;  3DVN V;  4KKI A;  4PS3 A;  4ZHP A;  3TEZ A;  2DYB A;  5G55 A;  2INN E;  2CHW A;  2KQS A;  3HM3 A;  2D07 B;  2GBM A;  1WJ4 A;  2DAJ A;  1CMX B;  1BT0 A;  3ZTC A;  2K6D B;  2L05 A;  3V3X A;  2M19 A;  2RPV A;  1YN4 A;  5KHO A;  1VLB A;  3V6C B;  4BOS C;  1T0R C;  5H8Y E;  2PLP A;  3DBL B;  2HTH A;  1EWC A;  4AJY B;  4IM2 A;  4K3B A;  2CJO A;  4HRS A;  4W9E A;  3U4E G;  1QF6 A;  1WIA A;  4AUQ C;  2XK5 A;  2QIE B;  1TBE A;  2FID A;  2PE9 A;  1KF6 B;  2FE8 A;  2KLC A;  2WXQ A;  2J0K A;  3MHS D;  2BW2 A;  2UU7 A;  2XN9 C;  4FLH A;  1YNT E;  2KDB A;  2QJL A;  3VVW B;  2WGS A;  2JF5 A;  2N9E B;  2PEA A;  1FPY A;  2QMT A;  1KH0 A;  2DYO A;  2BTE A;  2W3R A;  4ANV A;  3ZDM C;  2ZW0 A;  4ACF A;  1GNU A;  5IO9 A;  1UZX B;  1STE A;  3MTN B;  3N20 C;  3URY A;  2MH7 A;  2LJI A;  3MFG A;  2LWP A;  3A1Q B;  3ZUN A;  1E8W A;  1ZP0 B;  4NZL B;  1XCT L;  1WRI A;  4W9G A;  2ZEQ A;  1XD3 B;  2WS3 B;  1AYF A;  3PS6 A;  5DPS A;  2BQQ A;  2KQ4 X;  1Q0W B;  1YQB A;  2TSS A;  4HLE A;  3NS8 A;  5HKH A; 
#chains in the Genus database with same CATH homology
 1MG4 A;  1MJD A;  2BQQ A;  5IOI A;  5IO9 A;  5IKC M;  5IP4 D;  1MFW A;  2DNF A;  5IN7 A;  1UF0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...