1UF0A

Solution structure of the n-terminal dcx domain of human doublecortin-like kinase
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
116
structure length
116
Chain Sequence
GSSGSSGKKAKKVRFYRNGDRYFKGIVYAISPDRFRSFEALLADLTRTLSDNVNLPQGVRTIYTIDGLKKISSLDQLVEGESYVCGSIEPFKKLEYTKNVNPNWSVNVKTSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Serine/threonine-protein kinase DCAMKL1
publication title Solution structure of the N-terminal DCX domain of human doublecortin-like kinase
rcsb
source organism Homo sapiens
total genus 13
structure length 116
sequence length 116
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2003-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03607 DCX Doublecortin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.230 Alpha Beta Roll Ubiquitin-like (UB roll) Doublecortin domain 1uf0A00
5IO9A 1MFWA 2BQQA 2DNFA 1MG4A 5IN7A 5IKCM 1MJDA 5IOIA 5IP4D 1UF0A
chains in the Genus database with same CATH superfamily
3NZSA 1V5TA 1A70A 1UBQA 4IWQA 3TEYA 1WSPA 2KHWB 2IJ0A 1WXAA 3NJTA 2LASA 3OAWA 2NPTB 3P4PB 1M4VA 2QHOA 3VH4B 3Q6BA 3TSSA 1F9JA 3HM6X 2CR5A 1VDVA 4EE2A 2HJ1A 2BYEA 4XYCA 2KNBA 3ZRFA 4US9A 2IYDB 1FNUA 3JVZX 3QC8B 5BMHA 2WNMA 1FXTB 5AZGA 4C4VB 4ZDVA 3NZ3A 3VHTC 2JZPA 4HJGE 3ZXRA 3KYCD 4BKSA 3BVZA 3SFEB 4I6NB 5EE9A 5J2RA 3EECA 3EFUA 2O2VB 2YVCA 3PRMB 2QC8A 4Q2JA 2NTTA 4ZHPA 4JLCA 2R61A 4GDKA 1JWMD 4B0MA 2REXA 3T8MA 3PRPB 4JQWC 3IHPC 4ACFA 2LJ5A 2W3RA 3Q69A 1B9RA 2NBWB 3S2AA 4IM0A 2HD5B 3I3TB 2FIFA 3GZNI 1V5OA 3WCQA 1SE2A 5DPRA 1NI3A 4IC7B 4RGNA 4P1CC 4CO7A 1TS2A 4FADA 2BS2B 4DXGA 4N59A 1YX6B 4HRSA 4FA6A 2N7EA 3WAOA 4HPMB 1GJZA 2D07B 4JE3B 1TTNA 3M63B 1PGXA 1FRDA 4A9AA 1EWCA 4HROA 3U30A 3I63C 4EZKA 1UH6A 1WM2A 2Z0EB 4WWOA 3QJZA 4OZAA 4TQ1A 3ZLZA 4IG7B 1UBIA 2J0JA 3TEXA 2IBIB 2IO1B 1WYGA 2MBEA 1WXMA 2GMIC 2WXQA 4MH0E 1SJHD 1KFYB 4FJVB 1I7HA 2EMTA 1VZ8A 4R3DA 4JGHB 2AL6A 4ZYSA 2JF5A 2K5PA 5JHBA 4B0EA 4WWPA 5HKHA 1YMHE 2INPE 3C19A 4HK2A 1RLFA 2Y5CA 2V3NA 3WA0A 3KQ4A 2ZJDA 4C56C 1I4QA 4BKTA 3NVVA 2WDVB 3H6NA 4P1BC 3P42A 4XGAB 3AB5A 4LNOA 2WXOA 3ZKJC 1R4NB 3ETRA 3FILA 3TCAA 1JALA 2H89B 3CIRB 4RH6A 3ZDMC 4EZJA 2D11A 5EE1A 1WXQA 1GNUA 1VZ6A 1I42A 1QOGA 4LDTB 1RRBA 4ARIA 5BYSA 3IAS1 3V6CB 2FCMA 3ML9A 2YEPB 5T8IA 1FRRA 1ZE3D 5G2NA 2BBCA 2KD0A 1OEYA 2MJEA 1H8CA 1SBBB 4MGKE 4XWTA 3J9CA 1C77A 1UD7A 2O6VD 5BO4B 4DXFA 2OJWA 1XO3A 1XT9B 1MVKA 3QQ8B 2L83A 2K3UA 5G55A 3B1LX 4NJ6A 3KH0A 4IDIA 1IP9A 2C7NB 3IXSA 3L4PA 2V3SA 2GBKA 3QCAA 5KHQA 5C23A 1DOXA 5D2MB 4OZCA 3LJ3A 5D7GA 2BYTA 2WXRA 3AE6B 5DPWA 1F2RC 1XCTL 1GB1A 2LVPA 4E71A 3TJPA 4PS7A 4P7IA 1PUTA 3BY4B 5DPSA 1JWBD 1TBEA 3VR9B 1HTQA 1Y56A 3NS1A 5BMIA 4YTMB 3WIMA 4WQMA 3A9KB 1N61A 3E56A 4OZBA 3U2SC 1KOTA 4J6IA 4BZAA 1SJED 1JMLA 2PLPA 2PE9A 1PGBA 3VQIA 3L13A 2LXAA 3VRBB 3ZNID 1TS3A 3BYTB 2ICIA 2FUG1 1YQBA 4HDOA 3DHGC 3ECIA 2MHJA 4KDIC 1TJEA 2UYZB 2DAJA 1WZ3A 3H1UA 3RI7C 2FE8A 3KUCB 4BFRA 3AV8A 2M0XA 2JYTA 1DYQA 1WXVA 1WGRA 2CU1A 1SEBD 1GAQB 1RAXA 4OVZA 4HKZE 1FNWA 2MBBB 1ZUD2 4N6EB 3R2TA 4G11A 1FFVA 4DHZB 1E90A 3E9SA 4GOCA 1OFFA 4REZA 1TYGB 1Q10A 3VDZA 4HPLB 1VCBA 1P7EA 1T6BX 2MLBA 4EOYA 3AEEB 2EMSA 2IO0B 1YNTE 2L32A 5HFYA 3KVFB 2K6DB 4W9GA 2M4NA 4RM8A 4S17A 3Q3OC 2Y3AA 2C7HA 2JUOA 3NZUA 4MT5A 1FEHA 4KDLB 2D3AA 1ZDVA 4KIKB 4C80A 4JL9A 3T3NA 1JWUD 1QQRA 4GSWA 5KHOA 1D3ZA 2DAFA 3PREA 4HXDA 3EA6A 4HJKA 3UIPB 1V49A 3DPDA 2AEHA 1OTRB 1HE8A 1X1MA 1Q1OA 5TR5A 1HZ5A 5L95C 4II3B 3U8ZA 3U4EG 2WP9B 3AE5B 3DBHI 2K39A 2WXLA 2JZ3B 2VZKB 4NNJB 2KLCA 3ZTDA 2NBVB 1SSNA 3VXWA 2QCZA 2A5UA 1WGGA 3KYDD 2G45B 4BBNC 3MHZA 3TIXA 4RF1A 2MSED 2BYFA 1I4GA 3QHTA 3VTUA 1V86A 4JIOU 4ANXA 3QK0A 1WY8A 4LDTD 2QMTA 2G4SA 1NVID 1XQQA 1I4RA 4G50A 3NG0A 3BK2A 2L0FA 1YOVB 2KC2A 4MH8A 3FKYA 3PRZA 2KWCA 4OHJA 2Z8LA 4K7WA 1V1PA 2DYBA 2DZMA 1IBXB 1WYWB 4NY0A 4IM3A 4AUQC 3KLSX 2L1AA 2LGXA 4LJPB 2KX3A 2I38A 2WXGA 4LTUA 2BKRB 3AH7A 4DDGD 4NQKE 3A9JA 4IOIE 4AWJA 2JT4B 3AE2B 1V1OA 3M95A 1V97A 2ZNVC 3VUWA 2FCSA 3FILB 3GZNB 1WGYA 2BS3B 4ZRKA 4WAFA 2D2QA 1K53A 2LXCA 4ITKA 4A3OA 2G4DB 3BVMA 1E0ZA 4LK0M 1WGKA 3C0RB 1NYQA 3W5UB 2RD0A 2K8HA 5D94A 2KDFB 3PVLA 2XK5B 3IT6B 3MC9A 2WDQB 4NQLB 4KZCA 4IWPA 2D3CA 5J17A 4BOZB 1FNVA 1QLBB 3PT2B 3AE8B 2L0TA 2XN9C 4UDUC 4KGRA 5JH5C 4HVBA 1L6UA 2JU6X 4FJYA 1HQRD 4A3PA 3AMZA 4RCOA 2ZPNA 1QILA 2FIDA 1SF0A 4M0WA 2LD9A 1AARA 1BMLC 3AE4B 3TUOA 1RFKA 1FM0D 3VR8B 2WXMA 4WJOA 2ON8A 1Q5WB 2KFJA 4NAWA 3DVGY 5D6JB 3PHWB 1YN4A 2Q5WD 3AM9A 3MJ5A 3LDZE 2BB6A 1C76A 3BK1A 3ZW3A 2OOBB 3W1SC 4ZRIA 3SD5A 1KTKA 3ABVB 2KO3A 2MBOA 3APDA 4HEA1 1T3QA 2M0AA 4M02A 4BKSD 2K1FA 4XZ4A 1T0QC 3N1YC 2JWZA 3DBLI 2DHZA 1L4ZB 3ZNGC 1YJ1A 2M17A 1P3QU 1G6JA 2W82A 3QAQA 2KKCA 4EUTA 3Q8AA 3SU8X 3R2IA 3LXFA 2IPKD 2LZ6A 2KWUB 5MPOA 1WR1A 3W1YA 2LHEA 3QARA 2JPHA 2V4LA 2W3SA 5FR6A 1ZPSA 4ZOHC 4GU2A 1TKGA 1UUPA 2W9NA 2MBHA 3VUYA 3KUZA 2LGIA 1WJUA 2KQSA 1I4XA 3NY5A 3PHXB 3PSEB 3SR6A 4W9HA 3BVGA 2NTSA 4K7SA 2VZKD 2W55A 5BYRA 2JVCA 2E6XA 3A1QB 2RPQA 1WR6E 2DZIA 2MW5A 3N3KB 4MACA 3UGBB 1CK1A 1EU3A 2KFKB 5AZFA 1CMXB 1LXDA 3N1ZC 3VAWA 3RYTA 3UIOB 4TSSA 4ZRPA 1MI0A 3VRAB 3H8HA 1AWDA 1NENB 3NRZA 1L5PA 1F77A 1V8CA 4W9KA 2J0MA 2L3ZA 3OG5A 1E5WA 3Q3MC 5CTRC 2QJLA 2AL3A 4F7ZA 5H8YE 1WX7A 2KTFA 2PIAA 3GB1A 3O65B 3ZXVA 4K3BA 2BGFA 2MP2A 1DGJA 3M3JA 1E8XA 1ZDXA 2WXHA 4WAAA 3BWUD 1I4PA 2CU3A 4M00A 4A90A 3LB8C 4DHZE 4WJPA 1Y8RC 4JWSC 5IOIA 3JSVA 1IGDA 3NVWA 2V0GA 3A4RA 1QT9A 1J0GA 4MSMB 2NCNA 4GDLB 1D5XC 4M8NA 2JYEA 2NVUI 3DDCB 3CSFA 5LNK1 2HDEA 4I6PA 4G0NB 2LHDA 1J7AA 5CHFA 5JZEB 2SEBD 2LWPA 2L8JA 2DZKA 3DBSA 1BXTA 3EC8A 1LM8B 3Q8FA 1XLQA 4ICVA 2PPHA 4WURA 4FBJB 3AEFB 3DWGC 3Q3FA 2V4IB 1ZXIA 4KGTA 4N58A 1WFYA 1YJIA 2WDRB 3DWMA 5IKCM 5LXHA 1TKEA 3RMKC 1ACCA 1PFDA 1JQ4A 4IWOA 3W1SA 1WE7A 3CF6E 3H7PA 1CQVA 1E10A 2BS4B 3ZNZB 1YJJA 3A4SC 1E7PB 4TMAB 4PYZA 4K1RB 5C2TB 2K8CA 1I35A 1WJNA 1UWXA 3L16A 4RGMA 1ET9A 1JRPA 2AX5A 3V61A 1KRHA 1XLPA 1L0XB 3HM3A 3DVGX 1E8WA 1RWSA 3DVNU 4LCDE 1S3SG 1WI0A 2WGSA 2K0PA 3V6EB 3JYUA 3DBHB 2KT7A 4EKUA 1RFAA 2WDTB 2PEAA 5C3JB 1AW7A 2GRIA 3RNEC 1KLUD 1WX9A 4W9DA 1P7FA 3DBRI 3RZFA 2DENB 4KKJA 3UINB 1JRUA 2PVGC 4HCNB 4AP4C 4ASWC 1AYFA 3MC8A 1EO6A 2R2QA 1R4MI 3WAMA 2B3AA 3HVDA 4RGOS 3I57A 2BW2A 1F1HA 4YTPB 1WZ0A 2GB1A 1GC6A 4XC2A 4GIVA 3PZ8A 3L08A 4IKGA 2M1MA 2JXXA 3Q8CA 2QILA 2LI5A 2CHXA 1MHXA 4GMVA 4HWIB 2JWUA 4YSXB 2X8XX 5LLIA 3ZGZA 4PS8A 4WJQA 1PQSA 2KQ7A 5DCNA 1YN3A 4XDDA 2QSDA 4FLHA 2YEPF 2Y5PA 1JW9D 2JRHA 2PTLA 3MJWA 1FPYA 4AOFA 1IYFA 1FXIA 1OQRA 3VVWB 1EM7A 2KACA 3RNBC 3OJ3A 2DLBA 1T0RC 2L52A 3WALA 4A20A 4HKQA 3AULA 3OLMD 4FHJA 3ZO5B 1WJ6A 4LNKA 2K25A 2VH2A 2DNFA 4PK1A 1V80A 2JQRB 3BINA 4W9IA 4CHKA 3DOWA 2NPTA 2YLMA 3EGRA 2K8BA 3RNGC 1JROA 2CHZA 1KJTA 4RFBA 1LFDA 1XCQL 3QWZB 4XWWA 1E7VA 2J53A 1K52A 2WU5B 2H88B 3B9JA 3RFZB 4GXBA 1F2RI 2QEJC 4MM3A 5EDSA 2JRIB 3ZIMA 1WXSA 4IUMB 2D3BA 4C4VA 4RMAA 2C60A 4ZYNA 3O13A 2KOXA 3GP7A 2BQQA 1NYRA 1HA5A 3HVZA 2HE7A 4GDKB 1ZGUB 4MGZE 1DOIA 2O2VA 3U52E 1EWYC 1VD2A 1E8ZA 1XEEA 1V81A 5HHDG 2ZZPB 5IAAC 1D5MC 5E6PA 2CKHB 1EUVB 2RMMA 4RGTA 1FMAD 2NMQA 1HEZE 2PW9A 1XXGA 5HI1A 4BBNF 2NS5A 3N32A 2N9EB 2UU7A 4BKGA 1QKZA 5CHWA 1ISNA 5IN7A 3SDLC 1AN8A 3K9PB 1MJDA 4W9FA 1H4RA 2N9XA 1YD8U 3R7QA 5FK9C 2WX0A 4LNNA 3DBLB 4GGQA 1EU4A 5E6OA 1E9MA 3R66C 2DX5B 2RDBC 2WU2B 3QX1A 2IGGA 3AEBB 2ZW1A 2MWSB 1SXTA 3RN9C 4BAXA 4XDCA 2PMVA 3AI5A 4GB9A 4L23A 1L6VA 3AE7B 4DXAB 4B6WA 2FCNA 4TQ0A 2HJ8A 1ZW7A 3FAHA 2MCNB 3N20C 1WF9A 2MJ3A 3BYYB 4II2B 4J3OD 1SIFA 5AUKA 1UGJA 2KQ4X 2LFIA 2G9HD 2ZVOA 2KC1A 2KVZA 1D5ZC 1C4AA 1F52A 5AUIA 2XEWA 4MEMA 4ARCA 1WH3A 1HXYD 1UELA 2BT6A 4EEWA 3ZNHB 2MQJA 2LUEA 1B1ZA 4HPPA 1D6EC 2D10A 3NVYA 5D3DA 3PV1A 1FIQA 3RPFC 4X57B 3VH3B 5JXVA 1N5XA 2KLGA 4URKA 2DYMA 2IDYA 1UGMA 2J7QB 2INDC 3IG3A 4YTNB 2LVOA 1KM7A 2N7JA 2L7RA 3P4RB 2LGDA 3ZUNA 2AQ2B 1EF1A 3V60A 3DHIC 3T3OA 1TS5A 3UF8A 1L2NA 4A55A 4DHJD 1S1QB 1SB3C 5JHAA 2X38A 1TZOA 4NPNA 2RR9A 2PKOA 4FXCA 1N6ZA 4KVGB 1M94A 2EELA 2K6QA 2SAKA 2R2OA 3ZJUA 3W9CB 5E6JA 1TKYA 3N9YC 2BKFA 3U7DA 2C5LC 1VR9A 2J42A 3UQBA 1QOAA 2JZZA 1XF5L 3D32A 3C8YA 1JWSD 5EE0A 4PS3A 2JX5A 1N5WA 1XLNA 1TS4A 2KAJA 4KKIA 2MBQA 1K50A 1E7UA 3Q8EA 1ZP0B 4DQOC 1C78A 2KMMA 4L1BA 3M62B 3W5VB 1WMHA 2CJOA 1WJ4A 1GB4A 3UQAA 1SE3A 1OQYA 4M8MA 3Q14C 2PVOD 1KF6B 3HIZA 3I9V1 2I1KA 3RT3B 1Z2MA 4C7YA 2KJHB 4QAYA 3ZDTA 4HCPB 4BOSC 4BVUC 4YXDB 3P1MA 1PGAA 1CJEA 3SFDB 3VFKA 4W9EA 1KH0A 4B95A 4NZLB 1LO5D 2IO3B 2WXIA 4B9KA 3A9KA 4OVVA 2OHFA 1MG4A 2M19A 3X0WA 5IA7A 2ACZB 1BT0A 2WWZA 4CQNA 4P6VF 4MSQB 1C9FA 5IO9A 4WJNA 3HUIA 2N0SB 4AJWA 3K9OB 5E6NA 4LJOB 2KJRA 3B2FA 3ZVVA 2ASQA 2FNJB 1J8CA 5BMGA 3B08A 4ANUA 1IUEA 3CMMB 3P4SB 2JY6A 2WXJA 5D3IB 3DBRB 2M8SA 2J0KA 4MGYE 5GXGB 4AJYB 3IT4B 1NI2A 3TBLD 2V9HA 1OEYJ 1F0ZA 1L7YA 4MM3B 5H92C 3W2DA 1A5RA 3JW0X 1J7CA 1QF6A 1R4MB 2QIEB 2FBWB 3AE9B 2BYVE 1T5XD 3AN1A 3OJ4B 2N9PC 2D3GA 2M56B 4K81A 2IGDA 5DPTA 2KZRA 3TEZA 1DOYA 3VUXA 2BVCA 2LVQA 3RNAC 4P16A 4E74A 3GE3C 1I4HA 3H9DA 4FHKA 1SE9A 2WX1A 4RM9A 4A8XC 4OVUA 3EFCA 2WQYB 1QZEA 2ZCCA 3AEAB 1P1AA 2MH7A 2WLBA 1XLOA 1SIJA 4KIKA 1Z5SB 4JX1C 2J4XA 1RYJA 5G5GA 2RDGA 2AQ1B 1IPGA 3ZTCA 1C4PA 3ALBA 5EE3A 2E3TA 4HDQA 1QOFA 3QA8A 1L0YB 3Q8BA 2GBNA 2KMCA 1PDXA 3ZYYX 2C9WB 4TV3A 2EKIA 2BB5A 4ANVA 1UWMA 2Z0DB 1RM6C 1MFWA 2WXNA 3PGEA 4RF0A 2KTRA 4K7UA 2C7MB 3ZJVA 2DWQA 3Q3NC 5TSSA 1V6EA 1T0YA 3PTFC 2LEKA 4DWFA 4WQOB 1VRAB 2GI9A 2L05A 3PPAA 2ZCBA 1OGWA 4MJSA 3SHQA 1V1PB 2INNE 3NS8A 1YQ3B 2MEKA 3L54A 3I5JC 5G5HA 1YQ4B 5CX3A 1FO4A 2QDFA 2BWES 3Q2AC 2KDBA 2N1VA 2UWQA 3R7RA 2AQ3B 3TL5A 4FULA 1IBXA 4ZRJA 5AZHA 3PS6A 3U7ZA 2RPVA 3A9JB 2BPSA 2KVRA 2A4ZA 4JWUC 1T0SC 2KDEB 3RZWC 1V2YA 2EKEC 1VLBA 3ONSA 1K51A 1OQQA 2K9XA 1Q0WB 1WRIA 1ET6A 2V1YA 2ONQA 2KN4A 4NJCA 1SE4A 2GBRA 3AE3B 2G3QB 1L0VB 3ZQ4A 2OJRA 5IP4D 3HK0A 2FAZA 1J7BA 2HTHA 2DZJA 1WWTA 2LGSA 2TSSA 3BZDB 1LQBA 1V9JA 2I2YA 2KXJA 4USAA 2WYQA 1C3TA 1VZ7A 2XK5A 1N63A 1C79A 2IY0B 2XBBC 1FXAA 1J19A 1TIFA 4YWGG 2LRWA 1K8RB 4MDKE 1L4DB 4WIPA 2WXFA 4M0WB 3URYA 3T9LA 3DHHC 5AEKB 3GS2A 5LXIB 2HTME 1D4BA 1JCKB 3DVNV 2FCQA 2K22A 2V3PA 3V3XA 4D2KA 1WMHB 4DHJB 2KWVB 4N9F4 4XX5A 3QIJA 3DCGA 4NAWB 1PYWD 4O1NA 1C4CA 2WS3B 4KSLC 1NDDA 2WHIA 3PZDA 4MELA 4W9LA 3MC0B 4ANWA 3PLVA 4PT5A 2N1WA 4LNIA 2LJIA 2N9KA 2B76B 3LYYA 2O6VA 1STEA 3N30A 3VTWA 3NOBA 5BYQA 1UNSA 2ZPYA 2KMAA 2IZVB 3L0WB 2IY1B 2ZW0A 3APCA 3PZ7A 1EF5A 5L83A 2I1JA 3WAPA 3MFGA 2LGYA 1R7SA 4K3CA 3UI3A 4W9JA 4HLEA 2DYOA 3AECB 4IM2A 4LNFA 2RDHA 2NBUA 4JPSA 4KGSA 3IBEA 2NR2A 2GLSA 2N7DA 4WH4A 4LLGM 2MA9B 2BF8B 2MJDA 4WWNA 5CHVC 1U4AA 4EZLA 5FKAC 1TZ1A 1FFUA 2GBMA 3HRDD 4TUUA 2OEDA 1WE6A 1C1YB 1MG8A 3L17A 4TKNA 2ZNVB 4ICUA 1FD6A 1MPEA 4GN1A 3RUIB 3H7SA 2LRUA 3R8BA 3MP9A 3A1QA 3AXCA 3FC4A 2W54A 3AU4A 2KFKA 2LMCA 3ENEA 1VJKA 3GE8C 1R4NI 5I4DA 4YSYB 4F1SA 2BWFA 2CS4A 3X23A 3P2BA 2MP2B 2KDMA 3P4QB 1GUAB 2GOWA 2ZEQA 5FR3A 2N9LA 5GMVA 2IGHA 3KW5B 1GG3A 1YX5B 3SEBA 1LGRA 1WIAA 2ZVNA 2MRPA 2WXPA 3IAM1 2KX0A 3JSVB 1NBFC 3L10B 4AS1A 3NHEB 1FCLA 4E3CA 4NJ7A 1JWAD 2CJNA 4CYEA 3B0AA 1P9DU 3Q3JA 1GC7A 2LUMA 2XNAC 2DBYA 2L00B 2VRRB 3DQVA 3ZJTA 2CHWA 3RULA 2KTRB 2AYOB 3PO0A 4IW0A 3TEWA 1UZXB 3IVFA 4GDLA 2PE6B 2BTEA 2KANA 2FUHB 4GLSC 4YSZB 5J18A 3BIID 4US8A 1WGDA 2JXTA 3B2GA 3PLUA 1UF0A 4MJSB 4W9CA 4FJZA 2GBJA 1YIWA 4OW0A 4M01A 1ZOYB 4KSKC 1NEKB 3NVZA 1KLVA 3RNCC 1SGHA 2RGFA 3AE1B 3H7PB 3CSTA 1FCCC 1E6EB 1P98A 3MTNB 3ML8A 2Z59B 3WANA 4DK5A 1WGHA 4S0RA 4I6LB 3KUDB 3R3MA 4RNAA 2KYWA 3V05A 1TT5B 4KZ0A 4WWMA 4DBGA 2KDIA 4C00A 3AEDB 3P63A 2Y5BB 3APFA 1WRDB 4MGIE 4G3XB 2KK8A 1KLGD 4KX6B 2G1EA 2JSVX 1QOBA 2KN5A 1P0RA 2J52A 1BUIC 1WM3A 2VH1A 5C1ZA 1ZXHA 4ZHOA 2WXKA 3KWVA 1TY2A 4YT0B 1E8YA 1WX8A 3IFWB 4FN2A 1N62A 1ROEA 4NAMA 3RD2A 2MX2A 3GOEA 4KV2A 3RCZA 4L2YA 2IO2B 3NUHB 3ZRCA 4YL8A 4C7ZA 3EHVA 4AQ7A 1GOZA 1MHHE 3VTVA 1N60A 4ZRQA 3OWEB 1CZPA 2D5GA 4A6QA 2PJHA 4PYUA 1YN5A 2RSUA 1IGCA 3AEGB 3HHMA 5HG2A 1XD3B 2KJ6A 1HZ6A 1ZKHA 2INCC 1HTOA 4H2AA 4F8CB 3AU5A 2AWTA 2L76A 1ENFA 1TY0A 3RNFC 3KWLA 2O6VB 2KWDA 2N4FA 3MHSD 1GPXA 4DDID 3V62A 3TMPB 3N1XC 3A33B 1ESFA 1TGZB 3EUB2 3CWIA 4XE0A 4EFOA
chains in the Genus database with same CATH topology
5IO9A 1MFWA 2BQQA 2DNFA 1MG4A 5IN7A 5IKCM 1MJDA 5IOIA 5IP4D 1UF0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IO9 A;  1MFW A;  2BQQ A;  2DNF A;  1MG4 A;  5IN7 A;  5IKC M;  1MJD A;  5IOI A;  5IP4 D;  1UF0 A; 
#chains in the Genus database with same CATH topology
 3NZS A;  1V5T A;  1A70 A;  1UBQ A;  4IWQ A;  3TEY A;  1WSP A;  2KHW B;  2IJ0 A;  1WXA A;  3NJT A;  2LAS A;  3OAW A;  2NPT B;  3P4P B;  1M4V A;  2QHO A;  3VH4 B;  3Q6B A;  3TSS A;  1F9J A;  3HM6 X;  2CR5 A;  1VDV A;  4EE2 A;  2HJ1 A;  2BYE A;  4XYC A;  2KNB A;  3ZRF A;  4US9 A;  2IYD B;  1FNU A;  3JVZ X;  3QC8 B;  5BMH A;  2WNM A;  1FXT B;  5AZG A;  4C4V B;  4ZDV A;  3NZ3 A;  3VHT C;  2JZP A;  4HJG E;  3ZXR A;  3KYC D;  4BKS A;  3BVZ A;  3SFE B;  4I6N B;  5EE9 A;  5J2R A;  3EEC A;  3EFU A;  2O2V B;  2YVC A;  3PRM B;  2QC8 A;  4Q2J A;  2NTT A;  4ZHP A;  4JLC A;  2R61 A;  4GDK A;  1JWM D;  4B0M A;  2REX A;  3T8M A;  3PRP B;  4JQW C;  3IHP C;  4ACF A;  2LJ5 A;  2W3R A;  3Q69 A;  1B9R A;  2NBW B;  3S2A A;  4IM0 A;  2HD5 B;  3I3T B;  2FIF A;  3GZN I;  1V5O A;  3WCQ A;  1SE2 A;  5DPR A;  1NI3 A;  4IC7 B;  4RGN A;  4P1C C;  4CO7 A;  1TS2 A;  4FAD A;  2BS2 B;  4DXG A;  4N59 A;  1YX6 B;  4HRS A;  4FA6 A;  2N7E A;  3WAO A;  4HPM B;  1GJZ A;  2D07 B;  4JE3 B;  1TTN A;  3M63 B;  1PGX A;  1FRD A;  4A9A A;  1EWC A;  4HRO A;  3U30 A;  3I63 C;  4EZK A;  1UH6 A;  1WM2 A;  2Z0E B;  4WWO A;  3QJZ A;  4OZA A;  4TQ1 A;  3ZLZ A;  4IG7 B;  1UBI A;  2J0J A;  3TEX A;  2IBI B;  2IO1 B;  1WYG A;  2MBE A;  1WXM A;  2GMI C;  2WXQ A;  4MH0 E;  1SJH D;  1KFY B;  4FJV B;  1I7H A;  2EMT A;  1VZ8 A;  4R3D A;  4JGH B;  2AL6 A;  4ZYS A;  2JF5 A;  2K5P A;  5JHB A;  4B0E A;  4WWP A;  5HKH A;  1YMH E;  2INP E;  3C19 A;  4HK2 A;  1RLF A;  2Y5C A;  2V3N A;  3WA0 A;  3KQ4 A;  2ZJD A;  4C56 C;  1I4Q A;  4BKT A;  3NVV A;  2WDV B;  3H6N A;  4P1B C;  3P42 A;  4XGA B;  3AB5 A;  4LNO A;  2WXO A;  3ZKJ C;  1R4N B;  3ETR A;  3FIL A;  3TCA A;  1JAL A;  2H89 B;  3CIR B;  4RH6 A;  3ZDM C;  4EZJ A;  2D11 A;  5EE1 A;  1WXQ A;  1GNU A;  1VZ6 A;  1I42 A;  1QOG A;  4LDT B;  1RRB A;  4ARI A;  5BYS A;  3IAS 1;  3V6C B;  2FCM A;  3ML9 A;  2YEP B;  5T8I A;  1FRR A;  1ZE3 D;  5G2N A;  2BBC A;  2KD0 A;  1OEY A;  2MJE A;  1H8C A;  1SBB B;  4MGK E;  4XWT A;  3J9C A;  1C77 A;  1UD7 A;  2O6V D;  5BO4 B;  4DXF A;  2OJW A;  1XO3 A;  1XT9 B;  1MVK A;  3QQ8 B;  2L83 A;  2K3U A;  5G55 A;  3B1L X;  4NJ6 A;  3KH0 A;  4IDI A;  1IP9 A;  2C7N B;  3IXS A;  3L4P A;  2V3S A;  2GBK A;  3QCA A;  5KHQ A;  5C23 A;  1DOX A;  5D2M B;  4OZC A;  3LJ3 A;  5D7G A;  2BYT A;  2WXR A;  3AE6 B;  5DPW A;  1F2R C;  1XCT L;  1GB1 A;  2LVP A;  4E71 A;  3TJP A;  4PS7 A;  4P7I A;  1PUT A;  3BY4 B;  5DPS A;  1JWB D;  1TBE A;  3VR9 B;  1HTQ A;  1Y56 A;  3NS1 A;  5BMI A;  4YTM B;  3WIM A;  4WQM A;  3A9K B;  1N61 A;  3E56 A;  4OZB A;  3U2S C;  1KOT A;  4J6I A;  4BZA A;  1SJE D;  1JML A;  2PLP A;  2PE9 A;  1PGB A;  3VQI A;  3L13 A;  2LXA A;  3VRB B;  3ZNI D;  1TS3 A;  3BYT B;  2ICI A;  2FUG 1;  1YQB A;  4HDO A;  3DHG C;  3ECI A;  2MHJ A;  4KDI C;  1TJE A;  2UYZ B;  2DAJ A;  1WZ3 A;  3H1U A;  3RI7 C;  2FE8 A;  3KUC B;  4BFR A;  3AV8 A;  2M0X A;  2JYT A;  1DYQ A;  1WXV A;  1WGR A;  2CU1 A;  1SEB D;  1GAQ B;  1RAX A;  4OVZ A;  4HKZ E;  1FNW A;  2MBB B;  1ZUD 2;  4N6E B;  3R2T A;  4G11 A;  1FFV A;  4DHZ B;  1E90 A;  3E9S A;  4GOC A;  1OFF A;  4REZ A;  1TYG B;  1Q10 A;  3VDZ A;  4HPL B;  1VCB A;  1P7E A;  1T6B X;  2MLB A;  4EOY A;  3AEE B;  2EMS A;  2IO0 B;  1YNT E;  2L32 A;  5HFY A;  3KVF B;  2K6D B;  4W9G A;  2M4N A;  4RM8 A;  4S17 A;  3Q3O C;  2Y3A A;  2C7H A;  2JUO A;  3NZU A;  4MT5 A;  1FEH A;  4KDL B;  2D3A A;  1ZDV A;  4KIK B;  4C80 A;  4JL9 A;  3T3N A;  1JWU D;  1QQR A;  4GSW A;  5KHO A;  1D3Z A;  2DAF A;  3PRE A;  4HXD A;  3EA6 A;  4HJK A;  3UIP B;  1V49 A;  3DPD A;  2AEH A;  1OTR B;  1HE8 A;  1X1M A;  1Q1O A;  5TR5 A;  1HZ5 A;  5L95 C;  4II3 B;  3U8Z A;  3U4E G;  2WP9 B;  3AE5 B;  3DBH I;  2K39 A;  2WXL A;  2JZ3 B;  2VZK B;  4NNJ B;  2KLC A;  3ZTD A;  2NBV B;  1SSN A;  3VXW A;  2QCZ A;  2A5U A;  1WGG A;  3KYD D;  2G45 B;  4BBN C;  3MHZ A;  3TIX A;  4RF1 A;  2MSE D;  2BYF A;  1I4G A;  3QHT A;  3VTU A;  1V86 A;  4JIO U;  4ANX A;  3QK0 A;  1WY8 A;  4LDT D;  2QMT A;  2G4S A;  1NVI D;  1XQQ A;  1I4R A;  4G50 A;  3NG0 A;  3BK2 A;  2L0F A;  1YOV B;  2KC2 A;  4MH8 A;  3FKY A;  3PRZ A;  2KWC A;  4OHJ A;  2Z8L A;  4K7W A;  1V1P A;  2DYB A;  2DZM A;  1IBX B;  1WYW B;  4NY0 A;  4IM3 A;  4AUQ C;  3KLS X;  2L1A A;  2LGX A;  4LJP B;  2KX3 A;  2I38 A;  2WXG A;  4LTU A;  2BKR B;  3AH7 A;  4DDG D;  4NQK E;  3A9J A;  4IOI E;  4AWJ A;  2JT4 B;  3AE2 B;  1V1O A;  3M95 A;  1V97 A;  2ZNV C;  3VUW A;  2FCS A;  3FIL B;  3GZN B;  1WGY A;  2BS3 B;  4ZRK A;  4WAF A;  2D2Q A;  1K53 A;  2LXC A;  4ITK A;  4A3O A;  2G4D B;  3BVM A;  1E0Z A;  4LK0 M;  1WGK A;  3C0R B;  1NYQ A;  3W5U B;  2RD0 A;  2K8H A;  5D94 A;  2KDF B;  3PVL A;  2XK5 B;  3IT6 B;  3MC9 A;  2WDQ B;  4NQL B;  4KZC A;  4IWP A;  2D3C A;  5J17 A;  4BOZ B;  1FNV A;  1QLB B;  3PT2 B;  3AE8 B;  2L0T A;  2XN9 C;  4UDU C;  4KGR A;  5JH5 C;  4HVB A;  1L6U A;  2JU6 X;  4FJY A;  1HQR D;  4A3P A;  3AMZ A;  4RCO A;  2ZPN A;  1QIL A;  2FID A;  1SF0 A;  4M0W A;  2LD9 A;  1AAR A;  1BML C;  3AE4 B;  3TUO A;  1RFK A;  1FM0 D;  3VR8 B;  2WXM A;  4WJO A;  2ON8 A;  1Q5W B;  2KFJ A;  4NAW A;  3DVG Y;  5D6J B;  3PHW B;  1YN4 A;  2Q5W D;  3AM9 A;  3MJ5 A;  3LDZ E;  2BB6 A;  1C76 A;  3BK1 A;  3ZW3 A;  2OOB B;  3W1S C;  4ZRI A;  3SD5 A;  1KTK A;  3ABV B;  2KO3 A;  2MBO A;  3APD A;  4HEA 1;  1T3Q A;  2M0A A;  4M02 A;  4BKS D;  2K1F A;  4XZ4 A;  1T0Q C;  3N1Y C;  2JWZ A;  3DBL I;  2DHZ A;  1L4Z B;  3ZNG C;  1YJ1 A;  2M17 A;  1P3Q U;  1G6J A;  2W82 A;  3QAQ A;  2KKC A;  4EUT A;  3Q8A A;  3SU8 X;  3R2I A;  3LXF A;  2IPK D;  2LZ6 A;  2KWU B;  5MPO A;  1WR1 A;  3W1Y A;  2LHE A;  3QAR A;  2JPH A;  2V4L A;  2W3S A;  5FR6 A;  1ZPS A;  4ZOH C;  4GU2 A;  1TKG A;  1UUP A;  2W9N A;  2MBH A;  3VUY A;  3KUZ A;  2LGI A;  1WJU A;  2KQS A;  1I4X A;  3NY5 A;  3PHX B;  3PSE B;  3SR6 A;  4W9H A;  3BVG A;  2NTS A;  4K7S A;  2VZK D;  2W55 A;  5BYR A;  2JVC A;  2E6X A;  3A1Q B;  2RPQ A;  1WR6 E;  2DZI A;  2MW5 A;  3N3K B;  4MAC A;  3UGB B;  1CK1 A;  1EU3 A;  2KFK B;  5AZF A;  1CMX B;  1LXD A;  3N1Z C;  3VAW A;  3RYT A;  3UIO B;  4TSS A;  4ZRP A;  1MI0 A;  3VRA B;  3H8H A;  1AWD A;  1NEN B;  3NRZ A;  1L5P A;  1F77 A;  1V8C A;  4W9K A;  2J0M A;  2L3Z A;  3OG5 A;  1E5W A;  3Q3M C;  5CTR C;  2QJL A;  2AL3 A;  4F7Z A;  5H8Y E;  1WX7 A;  2KTF A;  2PIA A;  3GB1 A;  3O65 B;  3ZXV A;  4K3B A;  2BGF A;  2MP2 A;  1DGJ A;  3M3J A;  1E8X A;  1ZDX A;  2WXH A;  4WAA A;  3BWU D;  1I4P A;  2CU3 A;  4M00 A;  4A90 A;  3LB8 C;  4DHZ E;  4WJP A;  1Y8R C;  4JWS C;  5IOI A;  3JSV A;  1IGD A;  3NVW A;  2V0G A;  3A4R A;  1QT9 A;  1J0G A;  4MSM B;  2NCN A;  4GDL B;  1D5X C;  4M8N A;  2JYE A;  2NVU I;  3DDC B;  3CSF A;  5LNK 1;  2HDE A;  4I6P A;  4G0N B;  2LHD A;  1J7A A;  5CHF A;  5JZE B;  2SEB D;  2LWP A;  2L8J A;  2DZK A;  3DBS A;  1BXT A;  3EC8 A;  1LM8 B;  3Q8F A;  1XLQ A;  4ICV A;  2PPH A;  4WUR A;  4FBJ B;  3AEF B;  3DWG C;  3Q3F A;  2V4I B;  1ZXI A;  4KGT A;  4N58 A;  1WFY A;  1YJI A;  2WDR B;  3DWM A;  5IKC M;  5LXH A;  1TKE A;  3RMK C;  1ACC A;  1PFD A;  1JQ4 A;  4IWO A;  3W1S A;  1WE7 A;  3CF6 E;  3H7P A;  1CQV A;  1E10 A;  2BS4 B;  3ZNZ B;  1YJJ A;  3A4S C;  1E7P B;  4TMA B;  4PYZ A;  4K1R B;  5C2T B;  2K8C A;  1I35 A;  1WJN A;  1UWX A;  3L16 A;  4RGM A;  1ET9 A;  1JRP A;  2AX5 A;  3V61 A;  1KRH A;  1XLP A;  1L0X B;  3HM3 A;  3DVG X;  1E8W A;  1RWS A;  3DVN U;  4LCD E;  1S3S G;  1WI0 A;  2WGS A;  2K0P A;  3V6E B;  3JYU A;  3DBH B;  2KT7 A;  4EKU A;  1RFA A;  2WDT B;  2PEA A;  5C3J B;  1AW7 A;  2GRI A;  3RNE C;  1KLU D;  1WX9 A;  4W9D A;  1P7F A;  3DBR I;  3RZF A;  2DEN B;  4KKJ A;  3UIN B;  1JRU A;  2PVG C;  4HCN B;  4AP4 C;  4ASW C;  1AYF A;  3MC8 A;  1EO6 A;  2R2Q A;  1R4M I;  3WAM A;  2B3A A;  3HVD A;  4RGO S;  3I57 A;  2BW2 A;  1F1H A;  4YTP B;  1WZ0 A;  2GB1 A;  1GC6 A;  4XC2 A;  4GIV A;  3PZ8 A;  3L08 A;  4IKG A;  2M1M A;  2JXX A;  3Q8C A;  2QIL A;  2LI5 A;  2CHX A;  1MHX A;  4GMV A;  4HWI B;  2JWU A;  4YSX B;  2X8X X;  5LLI A;  3ZGZ A;  4PS8 A;  4WJQ A;  1PQS A;  2KQ7 A;  5DCN A;  1YN3 A;  4XDD A;  2QSD A;  4FLH A;  2YEP F;  2Y5P A;  1JW9 D;  2JRH A;  2PTL A;  3MJW A;  1FPY A;  4AOF A;  1IYF A;  1FXI A;  1OQR A;  3VVW B;  1EM7 A;  2KAC A;  3RNB C;  3OJ3 A;  2DLB A;  1T0R C;  2L52 A;  3WAL A;  4A20 A;  4HKQ A;  3AUL A;  3OLM D;  4FHJ A;  3ZO5 B;  1WJ6 A;  4LNK A;  2K25 A;  2VH2 A;  2DNF A;  4PK1 A;  1V80 A;  2JQR B;  3BIN A;  4W9I A;  4CHK A;  3DOW A;  2NPT A;  2YLM A;  3EGR A;  2K8B A;  3RNG C;  1JRO A;  2CHZ A;  1KJT A;  4RFB A;  1LFD A;  1XCQ L;  3QWZ B;  4XWW A;  1E7V A;  2J53 A;  1K52 A;  2WU5 B;  2H88 B;  3B9J A;  3RFZ B;  4GXB A;  1F2R I;  2QEJ C;  4MM3 A;  5EDS A;  2JRI B;  3ZIM A;  1WXS A;  4IUM B;  2D3B A;  4C4V A;  4RMA A;  2C60 A;  4ZYN A;  3O13 A;  2KOX A;  3GP7 A;  2BQQ A;  1NYR A;  1HA5 A;  3HVZ A;  2HE7 A;  4GDK B;  1ZGU B;  4MGZ E;  1DOI A;  2O2V A;  3U52 E;  1EWY C;  1VD2 A;  1E8Z A;  1XEE A;  1V81 A;  5HHD G;  2ZZP B;  5IAA C;  1D5M C;  5E6P A;  2CKH B;  1EUV B;  2RMM A;  4RGT A;  1FMA D;  2NMQ A;  1HEZ E;  2PW9 A;  1XXG A;  5HI1 A;  4BBN F;  2NS5 A;  3N32 A;  2N9E B;  2UU7 A;  4BKG A;  1QKZ A;  5CHW A;  1ISN A;  5IN7 A;  3SDL C;  1AN8 A;  3K9P B;  1MJD A;  4W9F A;  1H4R A;  2N9X A;  1YD8 U;  3R7Q A;  5FK9 C;  2WX0 A;  4LNN A;  3DBL B;  4GGQ A;  1EU4 A;  5E6O A;  1E9M A;  3R66 C;  2DX5 B;  2RDB C;  2WU2 B;  3QX1 A;  2IGG A;  3AEB B;  2ZW1 A;  2MWS B;  1SXT A;  3RN9 C;  4BAX A;  4XDC A;  2PMV A;  3AI5 A;  4GB9 A;  4L23 A;  1L6V A;  3AE7 B;  4DXA B;  4B6W A;  2FCN A;  4TQ0 A;  2HJ8 A;  1ZW7 A;  3FAH A;  2MCN B;  3N20 C;  1WF9 A;  2MJ3 A;  3BYY B;  4II2 B;  4J3O D;  1SIF A;  5AUK A;  1UGJ A;  2KQ4 X;  2LFI A;  2G9H D;  2ZVO A;  2KC1 A;  2KVZ A;  1D5Z C;  1C4A A;  1F52 A;  5AUI A;  2XEW A;  4MEM A;  4ARC A;  1WH3 A;  1HXY D;  1UEL A;  2BT6 A;  4EEW A;  3ZNH B;  2MQJ A;  2LUE A;  1B1Z A;  4HPP A;  1D6E C;  2D10 A;  3NVY A;  5D3D A;  3PV1 A;  1FIQ A;  3RPF C;  4X57 B;  3VH3 B;  5JXV A;  1N5X A;  2KLG A;  4URK A;  2DYM A;  2IDY A;  1UGM A;  2J7Q B;  2IND C;  3IG3 A;  4YTN B;  2LVO A;  1KM7 A;  2N7J A;  2L7R A;  3P4R B;  2LGD A;  3ZUN A;  2AQ2 B;  1EF1 A;  3V60 A;  3DHI C;  3T3O A;  1TS5 A;  3UF8 A;  1L2N A;  4A55 A;  4DHJ D;  1S1Q B;  1SB3 C;  5JHA A;  2X38 A;  1TZO A;  4NPN A;  2RR9 A;  2PKO A;  4FXC A;  1N6Z A;  4KVG B;  1M94 A;  2EEL A;  2K6Q A;  2SAK A;  2R2O A;  3ZJU A;  3W9C B;  5E6J A;  1TKY A;  3N9Y C;  2BKF A;  3U7D A;  2C5L C;  1VR9 A;  2J42 A;  3UQB A;  1QOA A;  2JZZ A;  1XF5 L;  3D32 A;  3C8Y A;  1JWS D;  5EE0 A;  4PS3 A;  2JX5 A;  1N5W A;  1XLN A;  1TS4 A;  2KAJ A;  4KKI A;  2MBQ A;  1K50 A;  1E7U A;  3Q8E A;  1ZP0 B;  4DQO C;  1C78 A;  2KMM A;  4L1B A;  3M62 B;  3W5V B;  1WMH A;  2CJO A;  1WJ4 A;  1GB4 A;  3UQA A;  1SE3 A;  1OQY A;  4M8M A;  3Q14 C;  2PVO D;  1KF6 B;  3HIZ A;  3I9V 1;  2I1K A;  3RT3 B;  1Z2M A;  4C7Y A;  2KJH B;  4QAY A;  3ZDT A;  4HCP B;  4BOS C;  4BVU C;  4YXD B;  3P1M A;  1PGA A;  1CJE A;  3SFD B;  3VFK A;  4W9E A;  1KH0 A;  4B95 A;  4NZL B;  1LO5 D;  2IO3 B;  2WXI A;  4B9K A;  3A9K A;  4OVV A;  2OHF A;  1MG4 A;  2M19 A;  3X0W A;  5IA7 A;  2ACZ B;  1BT0 A;  2WWZ A;  4CQN A;  4P6V F;  4MSQ B;  1C9F A;  5IO9 A;  4WJN A;  3HUI A;  2N0S B;  4AJW A;  3K9O B;  5E6N A;  4LJO B;  2KJR A;  3B2F A;  3ZVV A;  2ASQ A;  2FNJ B;  1J8C A;  5BMG A;  3B08 A;  4ANU A;  1IUE A;  3CMM B;  3P4S B;  2JY6 A;  2WXJ A;  5D3I B;  3DBR B;  2M8S A;  2J0K A;  4MGY E;  5GXG B;  4AJY B;  3IT4 B;  1NI2 A;  3TBL D;  2V9H A;  1OEY J;  1F0Z A;  1L7Y A;  4MM3 B;  5H92 C;  3W2D A;  1A5R A;  3JW0 X;  1J7C A;  1QF6 A;  1R4M B;  2QIE B;  2FBW B;  3AE9 B;  2BYV E;  1T5X D;  3AN1 A;  3OJ4 B;  2N9P C;  2D3G A;  2M56 B;  4K81 A;  2IGD A;  5DPT A;  2KZR A;  3TEZ A;  1DOY A;  3VUX A;  2BVC A;  2LVQ A;  3RNA C;  4P16 A;  4E74 A;  3GE3 C;  1I4H A;  3H9D A;  4FHK A;  1SE9 A;  2WX1 A;  4RM9 A;  4A8X C;  4OVU A;  3EFC A;  2WQY B;  1QZE A;  2ZCC A;  3AEA B;  1P1A A;  2MH7 A;  2WLB A;  1XLO A;  1SIJ A;  4KIK A;  1Z5S B;  4JX1 C;  2J4X A;  1RYJ A;  5G5G A;  2RDG A;  2AQ1 B;  1IPG A;  3ZTC A;  1C4P A;  3ALB A;  5EE3 A;  2E3T A;  4HDQ A;  1QOF A;  3QA8 A;  1L0Y B;  3Q8B A;  2GBN A;  2KMC A;  1PDX A;  3ZYY X;  2C9W B;  4TV3 A;  2EKI A;  2BB5 A;  4ANV A;  1UWM A;  2Z0D B;  1RM6 C;  1MFW A;  2WXN A;  3PGE A;  4RF0 A;  2KTR A;  4K7U A;  2C7M B;  3ZJV A;  2DWQ A;  3Q3N C;  5TSS A;  1V6E A;  1T0Y A;  3PTF C;  2LEK A;  4DWF A;  4WQO B;  1VRA B;  2GI9 A;  2L05 A;  3PPA A;  2ZCB A;  1OGW A;  4MJS A;  3SHQ A;  1V1P B;  2INN E;  3NS8 A;  1YQ3 B;  2MEK A;  3L54 A;  3I5J C;  5G5H A;  1YQ4 B;  5CX3 A;  1FO4 A;  2QDF A;  2BWE S;  3Q2A C;  2KDB A;  2N1V A;  2UWQ A;  3R7R A;  2AQ3 B;  3TL5 A;  4FUL A;  1IBX A;  4ZRJ A;  5AZH A;  3PS6 A;  3U7Z A;  2RPV A;  3A9J B;  2BPS A;  2KVR A;  2A4Z A;  4JWU C;  1T0S C;  2KDE B;  3RZW C;  1V2Y A;  2EKE C;  1VLB A;  3ONS A;  1K51 A;  1OQQ A;  2K9X A;  1Q0W B;  1WRI A;  1ET6 A;  2V1Y A;  2ONQ A;  2KN4 A;  4NJC A;  1SE4 A;  2GBR A;  3AE3 B;  2G3Q B;  1L0V B;  3ZQ4 A;  2OJR A;  5IP4 D;  3HK0 A;  2FAZ A;  1J7B A;  2HTH A;  2DZJ A;  1WWT A;  2LGS A;  2TSS A;  3BZD B;  1LQB A;  1V9J A;  2I2Y A;  2KXJ A;  4USA A;  2WYQ A;  1C3T A;  1VZ7 A;  2XK5 A;  1N63 A;  1C79 A;  2IY0 B;  2XBB C;  1FXA A;  1J19 A;  1TIF A;  4YWG G;  2LRW A;  1K8R B;  4MDK E;  1L4D B;  4WIP A;  2WXF A;  4M0W B;  3URY A;  3T9L A;  3DHH C;  5AEK B;  3GS2 A;  5LXI B;  2HTM E;  1D4B A;  1JCK B;  3DVN V;  2FCQ A;  2K22 A;  2V3P A;  3V3X A;  4D2K A;  1WMH B;  4DHJ B;  2KWV B;  4N9F 4;  4XX5 A;  3QIJ A;  3DCG A;  4NAW B;  1PYW D;  4O1N A;  1C4C A;  2WS3 B;  4KSL C;  1NDD A;  2WHI A;  3PZD A;  4MEL A;  4W9L A;  3MC0 B;  4ANW A;  3PLV A;  4PT5 A;  2N1W A;  4LNI A;  2LJI A;  2N9K A;  2B76 B;  3LYY A;  2O6V A;  1STE A;  3N30 A;  3VTW A;  3NOB A;  5BYQ A;  1UNS A;  2ZPY A;  2KMA A;  2IZV B;  3L0W B;  2IY1 B;  2ZW0 A;  3APC A;  3PZ7 A;  1EF5 A;  5L83 A;  2I1J A;  3WAP A;  3MFG A;  2LGY A;  1R7S A;  4K3C A;  3UI3 A;  4W9J A;  4HLE A;  2DYO A;  3AEC B;  4IM2 A;  4LNF A;  2RDH A;  2NBU A;  4JPS A;  4KGS A;  3IBE A;  2NR2 A;  2GLS A;  2N7D A;  4WH4 A;  4LLG M;  2MA9 B;  2BF8 B;  2MJD A;  4WWN A;  5CHV C;  1U4A A;  4EZL A;  5FKA C;  1TZ1 A;  1FFU A;  2GBM A;  3HRD D;  4TUU A;  2OED A;  1WE6 A;  1C1Y B;  1MG8 A;  3L17 A;  4TKN A;  2ZNV B;  4ICU A;  1FD6 A;  1MPE A;  4GN1 A;  3RUI B;  3H7S A;  2LRU A;  3R8B A;  3MP9 A;  3A1Q A;  3AXC A;  3FC4 A;  2W54 A;  3AU4 A;  2KFK A;  2LMC A;  3ENE A;  1VJK A;  3GE8 C;  1R4N I;  5I4D A;  4YSY B;  4F1S A;  2BWF A;  2CS4 A;  3X23 A;  3P2B A;  2MP2 B;  2KDM A;  3P4Q B;  1GUA B;  2GOW A;  2ZEQ A;  5FR3 A;  2N9L A;  5GMV A;  2IGH A;  3KW5 B;  1GG3 A;  1YX5 B;  3SEB A;  1LGR A;  1WIA A;  2ZVN A;  2MRP A;  2WXP A;  3IAM 1;  2KX0 A;  3JSV B;  1NBF C;  3L10 B;  4AS1 A;  3NHE B;  1FCL A;  4E3C A;  4NJ7 A;  1JWA D;  2CJN A;  4CYE A;  3B0A A;  1P9D U;  3Q3J A;  1GC7 A;  2LUM A;  2XNA C;  2DBY A;  2L00 B;  2VRR B;  3DQV A;  3ZJT A;  2CHW A;  3RUL A;  2KTR B;  2AYO B;  3PO0 A;  4IW0 A;  3TEW A;  1UZX B;  3IVF A;  4GDL A;  2PE6 B;  2BTE A;  2KAN A;  2FUH B;  4GLS C;  4YSZ B;  5J18 A;  3BII D;  4US8 A;  1WGD A;  2JXT A;  3B2G A;  3PLU A;  1UF0 A;  4MJS B;  4W9C A;  4FJZ A;  2GBJ A;  1YIW A;  4OW0 A;  4M01 A;  1ZOY B;  4KSK C;  1NEK B;  3NVZ A;  1KLV A;  3RNC C;  1SGH A;  2RGF A;  3AE1 B;  3H7P B;  3CST A;  1FCC C;  1E6E B;  1P98 A;  3MTN B;  3ML8 A;  2Z59 B;  3WAN A;  4DK5 A;  1WGH A;  4S0R A;  4I6L B;  3KUD B;  3R3M A;  4RNA A;  2KYW A;  3V05 A;  1TT5 B;  4KZ0 A;  4WWM A;  4DBG A;  2KDI A;  4C00 A;  3AED B;  3P63 A;  2Y5B B;  3APF A;  1WRD B;  4MGI E;  4G3X B;  2KK8 A;  1KLG D;  4KX6 B;  2G1E A;  2JSV X;  1QOB A;  2KN5 A;  1P0R A;  2J52 A;  1BUI C;  1WM3 A;  2VH1 A;  5C1Z A;  1ZXH A;  4ZHO A;  2WXK A;  3KWV A;  1TY2 A;  4YT0 B;  1E8Y A;  1WX8 A;  3IFW B;  4FN2 A;  1N62 A;  1ROE A;  4NAM A;  3RD2 A;  2MX2 A;  3GOE A;  4KV2 A;  3RCZ A;  4L2Y A;  2IO2 B;  3NUH B;  3ZRC A;  4YL8 A;  4C7Z A;  3EHV A;  4AQ7 A;  1GOZ A;  1MHH E;  3VTV A;  1N60 A;  4ZRQ A;  3OWE B;  1CZP A;  2D5G A;  4A6Q A;  2PJH A;  4PYU A;  1YN5 A;  2RSU A;  1IGC A;  3AEG B;  3HHM A;  5HG2 A;  1XD3 B;  2KJ6 A;  1HZ6 A;  1ZKH A;  2INC C;  1HTO A;  4H2A A;  4F8C B;  3AU5 A;  2AWT A;  2L76 A;  1ENF A;  1TY0 A;  3RNF C;  3KWL A;  2O6V B;  2KWD A;  2N4F A;  3MHS D;  1GPX A;  4DDI D;  3V62 A;  3TMP B;  3N1X C;  3A33 B;  1ESF A;  1TGZ B;  3EUB 2;  3CWI A;  4XE0 A;  4EFO A; 
#chains in the Genus database with same CATH homology
 5IO9 A;  1MFW A;  2BQQ A;  2DNF A;  1MG4 A;  5IN7 A;  5IKC M;  1MJD A;  5IOI A;  5IP4 D;  1UF0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...