1NEKB

Complex ii (succinate dehydrogenase) from e. coli with ubiquinone bound
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
238
structure length
238
Chain Sequence
b'MRLEFSIYRYNPDVDDAPRMQDYTLEADEGRDMMLLDALIQLKEKDPSLSFRRSCREGVCGSDGLNMNGKNGLACITPISALNQPGKKIVIRPLPGLPVIRDLVVDMGQFYAQYEKIKPYLLNNGQNPPAREHLQMPEQREKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLAAYRFLIDSRDTETDSRLDGLSDAFSVFRCHSIMNCVSVCPKGLNPTRAIGHIKSMLLQRNA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase flavoprotein subunit
molecule tags Oxidoreductase/electron transport
source organism Escherichia coli
publication title Architecture of succinate dehydrogenase and reactive oxygen species generation.
pubmed doi rcsb
total genus 56
structure length 238
sequence length 238
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2002-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 1nekB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1nekB01
3ETRA 1KF6B 1N5XA 2MH7A 1N60A 3NVYA 3SR6A 3AE1B 3AM9A 1JRPA 3EUB2 3AE3B 4C7YA 4YSYB 4HRSA 3VRBB 3RPFC 2Y5CA 2PKOA 3AE8B 2H88B 1YJJA 2K9XA 1KFYB 1SB3C 1WGKA 1A70A 1KRHA 1PUTA 3CF4A 2PIAA 3NVVA 3HRDD 2EKIA 1T3QA 1ZOYB 1DOYA 1N61A 1FM0D 5EE9A 1FIQA 2KAJA 3HUIA 1TKEA 3AH7A 1E7PB 3AEFB 1QOFA 1ZP0B 3P4SB 1WXQA 3FC4A 3PO0A 4ITKA 5AUKA 3W9CB 1B9RA 1EWYC 1TYGB 3AEGB 1V97A 3CWIA 4WQMA 2BS4B 1FO4A 1E10A 2MJ3A 2Q5WD 1OQRA 1J7CA 1R7SA 2WU5B 4FXCA 3AE4B 2AX5A 1JALA 3LB8C 1FXIA 2K5PA 1GAQB 1GTHA 5H92C 3SFDB 1NVID 3AEAB 1L5PA 1WWTA 1PDXA 1ZXIA 3AE7B 2CJOA 3VRAB 4ZHOA 1ROEA 1RM6C 1NI3A 2PVOD 1VDVA 1IUEA 1J7AA 2G1EA 5EE0A 1OFFA 3P63A 1E6EB 2WDVB 1QT9A 3B9JA 4JX1C 3AECB 1GPXA 3BIID 1WRIA 1J7BA 2K22A 1FMAD 2CJNA 2W54A 4USAA 3P1MA 5EE1A 5EE3A 1YQ4B 2BS3B 1L6VA 3B2FA 3AN1A 3HVZA 1WYGA 1L6UA 4IDIA 2WDRB 1E0ZA 2CU3A 3AEEB 1FRRA 4YTMB 1XO3A 3KWLA 4KX6B 1FFUA 5GXGB 1E9MA 4LTUA 2L52A 1DOXA 3LXFA 1XLQA 2OHFA 5C3JB 2QJLA 3AV8A 1H7XA 3SFEB 1QOAA 4US9A 1RWSA 1AYFA 3NVWA 5G5GA 3W5UB 2W3SA 1YQ3B 4WWMA 3DWGC 1CJEA 2JQRB 4YT0B 2N0SB 2W3RA 2B76B 2MJEA 2HTME 1XLOA 4JWSC 3P4QB 1CZPA 3AE2B 2M56B 2WLBA 4N6EB 1RYJA 2E3TA 1QF6A 1QOGA 2WQYB 2ACZB 1FFVA 1GT8A 3DWMA 4ZHPA 3B2GA 1JQ4A 1FXAA 1JW9D 2WP9B 1JWBD 1AWDA 4N59A 1GTEA 1I7HA 1OQQA 1SIJA 2QIEB 1DOIA 1TJEA 1PFDA 4ZOHC 5AUIA 4US8A 1N62A 5MPOA 1L0VB 5H8YE 1XLPA 3P4RB 4YTPB 2FBWB 1NYQA 1YJIA 2DBYA 1NYRA 3ABVB 3W5VB 3VR8B 1NENB 2KMMA 3FAHA 3NRZA 3ZYYX 4N58A 2WS3B 3AE6B 1TKYA 3AE9B 2H89B 3AEBB 4YXDB 3AB5A 2WU2B 1F0ZA 4P6VF 1VJKA 1SF0A 2L83A 4YTNB 2W55A 1V8CA 1NEKB 3VR9B 1QOBA 1JWAD 1VLBA 1JROA 3AE5B 2BT6A 2DWQA 3AMZA 3CIRB 3L4PA 1ZUD2 4YSXB 1UWMA 1N5WA 4YSZB 2LEKA 2JX5A 5G5HA 1N63A 1TKGA 4C7ZA 4A9AA 3AEDB 2WDQB 4HROA 1H7WA 3NS1A 3NVZA 1RFKA 1XLNA 3P4PB 2MJDA 2BS2B 2M19A 1QLBB 2PVGC 4JWUC 1DGJA 3WCQA 5C2TB 4C80A 1FRDA
chains in the Genus database with same CATH superfamily
4JE3B 3QJZA 4C7YA 2WXHA 1HZ5A 3A9KB 2INCC 1I4GA 1SJHD 1VZ7A 4JGHB 1PGAA 3U52E 2X8XX 1FIQA 2RDGA 3QHTA 5AZGA 4OVZA 2DHZA 2LVQA 3QWZB 2BWFA 1JWMD 2YEPB 2K5PA 3O13A 5L95C 4W9GA 1E6EB 2WHIA 1L6VA 3HVZA 1CMXB 3N20C 3U2SC 3N30A 1XO3A 4ZYSA 2B3AA 2QHOA 2DZIA 2BPSA 1UUPA 2BYEA 4KIKB 3R7QA 2FUHB 1WM3A 1N6ZA 3RZFA 2CU1A 2V4LA 3ZQ4A 1VZ8A 1WYWB 3P42A 2PE6B 2VRRB 2D5GA 4BKSD 4PS3A 1LM8B 3RNCC 1E8ZA 3FKYA 4WJPA 1G6JA 2E6XA 2JU6X 5D3IB 1ET6A 1Q1OA 2WXLA 4C56C 1OEYA 1WR6E 3I9V1 3U4EG 2FCMA 3AE9B 2V3SA 5JH5C 4IM3A 2L83A 2D2QA 3VXWA 1ZKHA 2KFKA 2KMAA 2D11A 1N63A 3GS2A 4BKTA 1T0YA 4BBNF 1TBEA 2ZW0A 3A1QA 2BS2B 2N7JA 1ENFA 2BQQA 3NVYA 4B6WA 3BWUD 2KHWB 3I5JC 3Q8BA 1YOVB 2KDIA 1SB3C 1HE8A 1FD6A 4LDTD 3GZNI 2KAJA 4IUMB 2KANA 1ZW7A 3URYA 4ARCA 3NZUA 2MJ3A 1L0XB 1D4BA 2WYQA 4RGNA 3ZJUA 2KX0A 4JWSC 1L5PA 1WWTA 1UBIA 2G1EA 4XC2A 1L7YA 2LHDA 1QT9A 1T6BX 1GPXA 2KQ4X 1WMHB 4EUTA 4UDUC 2JF5A 3P1MA 3RCZA 3B2FA 1EF1A 4HEA1 4MELA 3ZKJC 5BYSA 3DDCB 1PYWD 1QOAA 3BK1A 5C23A 4EFOA 3ONSA 3B0AA 3IXSA 1WZ3A 2LRUA 4RM8A 1WI0A 2NTTA 4N6EB 5I4DA 4EZKA 3KW5B 4A6QA 2FIDA 4XYCA 4IWPA 3PRMB 2XBBC 1ZXHA 4FBJB 1NYRA 4I6PA 5D94A 1AARA 4N58A 4HPPA 3ZXVA 3JW0X 1EM7A 3JYUA 3BY4B 1JWAD 2WXOA 2FAZA 2WXPA 2NPTA 1ZDVA 1A5RA 2L76A 1UWXA 2LGIA 3V6CB 2PW9A 4O1NA 4L23A 1UELA 2LJIA 4M0WA 5DPTA 3ZGZA 2KOXA 1FNUA 3QA8A 2MLBA 4WJQA 2M0AA 2Y5CA 3AE8B 2W9NA 2G9HD 4XX5A 4E3CA 4KV2A 3NG0A 2FUG1 3W9CB 1V80A 3KWVA 2A5UA 3PHXB 2Z8LA 3DPDA 1I4HA 1GOZA 4KDLB 2N7DA 4KSLC 5IKCM 4M00A 1ZXIA 4AS1A 3AE7B 4DK5A 3SEBA 1HXYD 2N9LA 1S3SG 3SDLC 3AEEB 1P0RA 3GP7A 4H2AA 4FA6A 3PZ8A 1AYFA 4K3BA 2MRPA 1YQ3B 2W3RA 3QQ8B 3Q3OC 1JCKB 2IJ0A 2DENB 1QOGA 4FLHA 3PZDA 3OLMD 1GG3A 3ZNGC 4KKJA 4OHJA 1L0VB 2DBYA 2WWZA 3ZDMC 2YVCA 1I42A 1WX7A 4GDKA 1NENB 2KMMA 4BZAA 2JXTA 4FULA 3L0WB 1WE7A 2K1FA 2BT6A 1T0SC 2FCQA 1S1QB 3OWEB 2LEKA 2JX5A 2PE9A 2KWUB 3AULA 4MEMA 4C7ZA 4LJPB 2DYOA 2LXAA 5KHOA 2AQ1B 3BK2A 3Q8FA 1E5WA 4CO7A 2KJRA 1E7UA 4JLCA 1KF6B 2JYTA 3NZSA 5LXHA 3M95A 4GU2A 4DDGD 4KGSA 4G50A 3QIJA 2O2VB 1YD8U 1KH0A 2KC2A 3SU8X 2PEAA 2N1WA 2N9EB 3DOWA 3EGRA 3PV1A 2KACA 2QC8A 3P4SB 2RDBC 3PO0A 5CHFA 5G55A 2QILA 1K53A 1EWCA 2KDBA 2R61A 3SHQA 3NHEB 4K7UA 4EE2A 3QARA 1IUEA 3P63A 2WDVB 3B9JA 3AECB 3BIID 1YMHE 1FMAD 2W54A 3TEXA 1SIFA 2WXRA 5D2MB 4LLGM 2QSDA 5J2RA 1H7XA 3K9PB 2D10A 3DWGC 4WJOA 5AEKB 2W82A 2HTME 3A4RA 3M63B 2HD5B 4BOSC 3LYYA 4B0EA 4RM9A 1UH6A 2KWDA 1WGRA 1GT8A 2KDMA 2OEDA 4K7SA 3W1SA 4IWQA 2KD0A 3ZTCA 4US8A 1XCTL 2QDFA 5IAAC 1WRDB 4DHZE 1WIAA 3PGEA 1ZE3D 4P6VF 2L00B 3FILA 3KYDD 2IGDA 1E8YA 1LFDA 2PTLA 3QC8B 1LXDA 4P7IA 3L4PA 3ZVVA 1ZUD2 3ZLZA 5FR6A 2MA9B 5BMHA 2MBEA 1K8RB 4J6IA 2MP2B 1XLNA 3R8BA 4TUUA 4NQKE 4IG7B 2GLSA 1ET9A 3IAS1 4TQ0A 1FRDA 1N5XA 3Q3FA 4W9DA 1P9DU 1VZ6A 3DCGA 4LNFA 2RR9A 2I38A 1IBXB 4RGOS 1NBFC 1KRHA 1C1YB 2EKIA 2KC1A 4BAXA 1ZOYB 1V2YA 4FJZA 2N9KA 1MG4A 3ZNID 4F8CB 5J18A 1EUVB 2RMMA 1QOFA 1ZP0B 2K6DB 1EWYC 1C4CA 3UIPB 3CWIA 4MSQB 3ZRCA 2BS4B 4GSWA 4FJVB 1R7SA 1WJUA 2LASA 3AE4B 1R4NI 2BKRB 4DWFA 2KQ7A 2LUMA 3MC8A 3AEAB 4II2B 4K3CA 2WXNA 1BUIC 3RNAC 2KXJA 3MC9A 1WRIA 2MBBB 2G3QB 4ANVA 4YTMB 1AN8A 1DOXA 4GOCA 2LUEA 4ANXA 4WURA 4DHJD 2WXQA 5LLIA 4L2YA 3R7RA 4K7WA 3AE2B 1TZOA 5G2NA 3VUYA 2WQYB 2AWTA 3L13A 3NJTA 4PYUA 1FXAA 2KLCA 1SIJA 3N32A 3Q3MC 1N62A 1SEBD 5JXVA 4IWOA 2INDC 4DQOC 1P1AA 4MH8A 3PZ7A 5BYRA 3RN9C 1UGMA 4XDDA 4REZA 1VJKA 5J17A 3S2AA 2GBNA 3KUDB 2J42A 1V8CA 2GBKA 1KLGD 3EA6A 5G5HA 3U7DA 3PRPB 3I63C 1V1PA 1I4QA 4IOIE 3L16A 4D2KA 3DBSA 4WWOA 2JZPA 2QEJC 2LGXA 3BYYB 4AJYB 4AJWA 2G4DB 4M02A 1WGKA 2MW5A 3NVVA 5CX3A 4IM2A 3AXCA 3Q2AC 4L1BA 1V81A 4WWNA 4BBNC 1FM0D 3R66C 4W9FA 3AH7A 3AEFB 5JZEB 5AUKA 2KO3A 3W1YA 1V97A 3RD2A 4DDID 3RYTA 4FXCA 2JRIB 3LB8C 1Y56A 1LGRA 4M01A 1PDXA 2K8BA 5JHAA 2BBCA 3Q8CA 3ALBA 2M8SA 2FE8A 1UNSA 1FPYA 1WGDA 5GMVA 2IZVB 5E6PA 1ZGUB 2GMIC 1OQYA 4KVGB 4HKQA 1F2RC 2VH2A 4X57B 4ZDVA 2N1VA 1TZ1A 2JQRB 2NPTB 3JVZX 2B76B 1Z2MA 2NBUA 3DQVA 3HM3A 1FCLA 1RYJA 1HEZE 3IG3A 1RRBA 4KSKC 1XF5L 1I4XA 1C3TA 1I7HA 3Q8AA 4ZOHC 2FCNA 2ZNVB 1TTNA 3VDZA 2DAFA 1LQBA 1R4MI 2NBWB 3BVGA 3ZYYX 1V9JA 2UU7A 1IBXA 3NY5A 1Q5WB 2KN5A 2J4XA 4ARIA 2O6VD 3IT6B 4ASWC 3RULA 1YQBA 4E71A 1JRUA 4MJSA 1GJZA 1V49A 1C4PA 4GMVA 2R2OA 4C80A 1OQQA 1MG8A 2KK8A 2IYDB 3PT2B 4WAAA 2MWSB 1GB4A 2IO2B 3B08A 3PLUA 4ICUA 1MVKA 1RLFA 1A70A 1SE9A 2HDEA 2N9PC 2LD9A 4KZCA 4W9CA 5T8IA 1E7VA 3PRZA 3V3XA 4NJ6A 4ITKA 2J0JA 4FHJA 4MSMB 1KJTA 4I6LB 2C7HA 4MGKE 5CHWA 3SFDB 4ZHOA 1ROEA 3DBRB 2JZ3B 2PVOD 3ZNZB 4LNKA 4NAWB 1NI2A 2HE7A 3RNGC 1V1PB 1GNUA 3E56A 4WWPA 3AV8A 4OZAA 2KJ6A 3P2BA 2RPQA 3ZDTA 3PTFC 1P7EA 3A9KA 1IGCA 3H7SA 2KWCA 3Q3JA 1PQSA 3GOEA 2JY6A 4ANWA 3PVLA 2NR2A 4XE0A 2RD0A 2QCZA 3EC8A 3ZXRA 1WX8A 3KLSX 3DHIC 2FBWB 2DNFA 1FNWA 2LMCA 2WS3B 3AE6B 2SAKA 1YN4A 1NDDA 1P7FA 1KM7A 3KVFB 1QILA 5D7GA 3MJ5A 4HCNB 3AE5B 4ACFA 2MSED 4KZ0A 4HROA 2ZJDA 2KDFB 1R4MB 3QCAA 4C4VB 2KJHB 4BOZB 4IM0A 2ZPYA 3AE1B 1JRPA 4NAWA 1VRAB 4YSYB 4NY0A 2SEBD 4ANUA 2XK5A 1MI0A 2WXIA 3PS6A 4GDKB 3VAWA 4EEWA 2YLMA 2PJHA 3QAQA 2KFJA 3KH0A 3UIOB 5D3DA 4NNJB 2V0GA 4CQNA 1WXSA 2MBQA 2HJ8A 4WH4A 3ZUNA 2NVUI 4AP4C 1WFYA 2KYWA 4HDQA 1ACCA 2AX5A 2JUOA 4DHZB 2KNBA 4GN1A 4EKUA 2JZZA 1NI3A 2JSVX 3BINA 1WH3A 2FCSA 4LNIA 1BXTA 4USAA 4HCPB 4LNNA 2PLPA 1PGBA 2LZ6A 3TEZA 2LI5A 4GIVA 1RWSA 1EO6A 3B1LX 3IVFA 4RGMA 4CYEA 2E3TA 2GB1A 2BVCA 2IY1B 1QQRA 4ZHPA 1FCCC 3ZO5B 3HIZA 1JW9D 1XCQL 2OOBB 1MHXA 4YWGG 3DBHB 1MJDA 2INNE 1WF9A 3ZTDA 5MPOA 2C7NB 3X23A 3IFWB 2XN9C 4LDTB 1KLVA 4JIOU 2KTRA 3GB1A 1V6EA 1P3QU 1SJED 3VR9B 1QOBA 2Z59B 3C8YA 3IBEA 1WXVA 3K9OB 3L54A 1V5OA 1IPGA 5C1ZA 4P16A 3N1ZC 2KT7A 2BB5A 4JWUC 2WNMA 3WAPA 2MH7A 3EHVA 2L8JA 1CK1A 3AU5A 3BYTB 3RFZB 2K9XA 4XZ4A 3EFUA 3AU4A 1PUTA 4II3B 2MQJA 4RNAA 2M0XA 4HPMB 3A9JA 2XEWA 2C60A 2KKCA 4FJYA 4PYZA 1B9RA 1V5TA 2D3CA 2EMTA 2MBOA 5BMGA 1M94A 3ML8A 1WGYA 5HI1A 4OVVA 5HKHA 2MEKA 2IY0B 2IO0B 2GI9A 2REXA 1WGGA 3R2TA 1QZEA 1H4RA 2CU3A 4Q2JA 3TEWA 5GXGB 3M62B 5L83A 2K6QA 2X38A 3M3JA 1T5XD 3VUXA 4AOFA 4G11A 4YT0B 2N0SB 2JT4B 2L32A 2Z0DB 1VD2A 2L0FA 3WANA 2FNJB 2RSUA 3DHHC 2V3NA 1WSPA 1JQ4A 1DYQA 4N59A 4LNOA 1RFAA 1H8CA 4XWTA 1GB1A 1YNTE 5AUIA 5BMIA 2YEPF 3W5VB 1YX5B 4JL9A 4NZLB 3APFA 4IKGA 3NRZA 3PPAA 2CHWA 1X1MA 1WJ4A 2W55A 1NEKB 2C9WB 1C78A 3H9DA 2L3ZA 4B0MA 1FNVA 1UWMA 4S0RA 4YSZB 2XNAC 3V05A 4DXGA 2MCNB 5IOIA 4BKGA 1SXTA 4HRSA 2UYZB 3RPFC 3TUOA 3J9CA 2H88B 3CSTA 4GDLB 4HLEA 3ZJVA 3U8ZA 1N61A 2D07B 2RGFA 3FILB 3HUIA 1Q0WB 3A4SC 2IO3B 5HHDG 2BYTA 1V86A 1TT5B 3UINB 1P98A 3KQ4A 3ZRFA 4RF1A 4A55A 4CHKA 4FADA 5HG2A 2HJ1A 2L1AA 1FXIA 1STEA 1SE4A 1GTHA 2BKFA 4M8NA 3SD5A 3L10B 3WAMA 1YIWA 4NAMA 1WJ6A 3PSEB 4TSSA 3UGBB 2TSSA 2KDEB 4JPSA 1FRRA 2UWQA 2ZNVC 3UI3A 2NS5A 3GZNB 1E8XA 3MHSD 1WE6A 2KN4A 2MJEA 3ECIA 2V3PA 4MH0E 3O65B 2KFKB 3U30A 2WLBA 2BYVE 2ZPNA 4KDIC 2WXKA 4J3OD 2NBVB 2LXCA 2N7EA 1AWDA 2QMTA 3TJPA 2K25A 4A90A 2KVZA 3NOBA 2DZKA 1YJIA 2ASQA 3ABVB 4OVUA 4MM3B 2AQ3B 2V9HA 4TKNA 1SF0A 2LGYA 3QX1A 5AZHA 2L7RA 3UQBA 3EECA 2OJWA 5KHQA 1RAXA 3QK0A 2AQ2B 1XT9B 4MDKE 3DBHI 3ZW3A 1TKGA 2WXMA 3TMPB 4W9HA 3MTNB 1I4RA 2JXXA 2AL3A 5E6NA 5HFYA 3WCQA 1YN3A 5BO4B 4M8MA 1N60A 5DPRA 3AM9A 3EUB2 3AE3B 5FK9C 2CS4A 3HRDD 5FKAC 4AQ7A 2GBRA 4OW0A 3DHGC 3U7ZA 3FC4A 2IDYA 2Y3AA 3X0WA 1E10A 2Q5WD 4KGRA 4ZYNA 1J7CA 3N1YC 4DXFA 4P1BC 1WM2A 1UGJA 3OJ3A 1GAQB 4HVBA 4PK1A 3MFGA 2K22A 1OTRB 1ISNA 1YQ4B 2R2QA 4W9EA 2K8HA 3DVGX 5JHBA 4WJNA 3LXFA 2J0MA 1JWSD 4PS8A 4US9A 3W5UB 5G5GA 2J52A 4B9KA 4ZRQA 3OAWA 2A4ZA 1CZPA 1FFVA 2DAJA 1UBQA 1C79A 1XD3B 2I1KA 3DBRI 3RNEC 1JWBD 2DZJA 1Y8RC 3UQAA 2L0TA 2WGSA 2LGSA 3FAHA 3VTWA 1D3ZA 2INPE 1V1OA 1WX9A 1I4PA 1TS5A 2DWQA 3H8HA 3PHWB 4YSXB 4RH6A 2KX3A 3E9SA 3NS1A 5LXIB 4HPLB 3BVMA 1C77A 2PVGC 2NMQA 4ZRIA 1SSNA 2KLGA 3Q3NC 2C7MB 3VRBB 2IGHA 3JSVB 1R4NB 4XGAB 1UZXB 1KFYB 1SBBB 3VHTC 1GUAB 3MHZA 1HTQA 2M17A 2KMCA 3LDZE 3TIXA 1F2RI 1PGXA 4OZCA 2WU5B 1K51A 4PS7A 2CHZA 2CR5A 1TIFA 2LHEA 4LK0M 4DXAB 2N9XA 2O6VA 3W2DA 2C5LC 4KX6B 3VH3B 4EZJA 1B1ZA 2OHFA 4IW0A 1IYFA 3IT4B 1C4AA 2WXFA 1FXTB 2K0PA 1XLOA 2BWES 3DBLB 1T0QC 2JPHA 3N1XC 2AEHA 1D5MC 2PMVA 2JRHA 1GTEA 1WY8A 2ZCBA 4NPNA 1K52A 3C0RB 3MP9A 1QKZA 2KWVB 4HDOA 1TGZB 1D6EC 2ZCCA 2WXJA 2ZW1A 2VZKB 2O2VA 3CSFA 3RZWC 2V1YA 4GDLA 2IGGA 1QF6A 1VLBA 2D3BA 3DBLI 3CIRB 5E6OA 4NJCA 4A9AA 2AL6A 1RFKA 3P4PB 2M19A 2K39A 5IA7A 1TS2A 5EDSA 4HK2A 1VR9A 3VH4B 2CJOA 5C2TB 5D6JB 3ETRA 4W9KA 1L4DB 1YJJA 3VUWA 3KUCB 3BZDB 5DPWA 3RI7C 2ZEQA 1DOYA 4BKSA 2KQSA 5CHVC 1TKEA 3MC0B 2CKHB 2J0KA 3V61A 2JVCA 5TR5A 1E8WA 2OJRA 2N4FA 1YX6B 2WX1A 1UF0A 4G0NB 3VRAB 3Q14C 1K50A 5EE0A 1J19A 2PPHA 1BMLC 1J7BA 2IPKD 2BS3B 1WYGA 4HJKA 2WDRB 1E0ZA 2Z0EB 2VZKD 3KWLA 1FFUA 3DVNV 3Q69A 1ESFA 1L0YB 3BVZA 5IP4D 1F1HA 2W3SA 1CJEA 3I57A 3T3NA 4A8XC 2JYEA 2ACZB 2DYBA 1TS3A 3B2GA 2ON8A 4MM3A 3HM6X 4W9JA 2ZVNA 4K1RB 2LRWA 5H8YE 3P4RB 2LWPA 3T8MA 2NTSA 2IBIB 1SE3A 1T0RC 3HVDA 4YXDB 3AB5A 1F0ZA 1Z5SB 2D3AA 3RNFC 3WAOA 5DPSA 4MGYE 2LVOA 3NVZA 4M0WB 3H6NA 2LGDA 3D32A 1UD7A 1WJNA 5DCNA 4A3OA 3WIMA 1D5XC 3AI5A 1OGWA 1SE2A 4NJ7A 3KUZA 1CQVA 3EFCA 2K8CA 3CF4A 2PIAA 3TL5A 5EE9A 2EELA 1E7PB 1WXQA 2ZVOA 5IN7A 2DYMA 3AEGB 3R3MA 4MJSB 4NQLB 4HKZE 1JALA 1GC7A 1HA5A 1KLUD 1YN5A 2V4IB 1J0GA 2G4SA 4OZBA 4KIKA 2J53A 3CF6E 4IDIA 3W1SC 2HTHA 1L6UA 3WALA 4WAFA 2RDHA 1EF5A 2L52A 3PLVA 1WXAA 3APDA 1WGHA 2MBHA 3UF8A 1KOTA 4IC7B 1C9FA 1D5ZC 3P4QB 3WA0A 1E90A 2M56B 2LJ5A 2BB6A 3C19A 4GXBA 3DWMA 5IO9A 1I35A 1HQRD 4G3XB 2QIEB 4ZRPA 4K81A 1DOIA 2EMSA 4QAYA 1MHHE 5FR3A 2LVPA 4KGTA 3H7PB 1NYQA 1F77A 3RT3B 1MPEA 2AYOB 1LO5D 1TKYA 1JMLA 4E74A 2WXGA 1L4ZB 1XQQA 5TSSA 4RMAA 4YTNB 2JWUA 1XXGA 4AWJA 3ZNHB 3N9YC 4A20A 2EKEC 3AEDB 2L05A 4DHJB 1H7WA 3VVWB 4F1SA 4RCOA 2MJDA 4N9F4 4C00A 1QLBB 4F7ZA 3OJ4B 3SR6A 4LCDE 4AUQC 2PKOA 4I6NB 3HHMA 3ZJTA 2ZZPB 4W9LA 1IGDA 4WIPA 2BW2A 5LNK1 4GLSC 4BFRA 4XWWA 1Q10A 2Y5PA 3GE3C 5CTRC 4B95A 3Q8EA 4MGZE 4DBGA 3V62A 5AZFA 3H7PA 3HK0A 4WQMA 2JWZA 1OQRA 2WDTB 4RFBA 1EU3A 4WQOB 4JQWC 3CMMB 4TV3A 1NVID 3OG5A 4ZRJA 1RM6C 2ONQA 4RGTA 1VDVA 1YJ1A 4JX1C 4EOYA 3RUIB 1VCBA 5EE1A 5EE3A 2RPVA 1L2NA 4URKA 4LJOB 3TCAA 3A9JB 1E9MA 5BYQA 4LTUA 2GBMA 3L08A 2GRIA 1XLQA 5C3JB 1SGHA 3VTUA 4WWMA 3NUHB 3RMKC 4GB9A 4EZLA 4HXDA 2J7QB 5E6JA 2DZMA 3T9LA 2G45B 4MT5A 1EU4A 1AW7A 4HJGE 4W9IA 2VH1A 4HWIB 1JWUD 3I3TB 4KKIA 4R3DA 1PFDA 1FEHA 3V6EB 3VR8B 1TY0A 2KTFA 4XDCA 4GGQA 3DVGY 3IAM1 2WU2B 3LJ3A 2MP2A 2KTRB 4ZRKA 2MX2A 1JROA 3AMZA 4A3PA 4TQ1A 4S17A 3VQIA 2CHXA 2WX0A 2WDQB 2BTEA 1DGJA 4P1CC 3ENEA 4YL8A 2K3UA 3N3KB 3IHPC 3T3OA 3A33B 3L17A 1T3QA 2M1MA 4FHKA 3APCA 3NZ3A 3DVNU 1TS4A 1TYGB 2DLBA 4MACA 1XEEA 1C76A 1FO4A 1HZ6A 1GC6A 2O6VB 4TMAB 2Y5BB 1MFWA 4MGIE 2I2YA 2M4NA 3A1QB 3ML9A 5H92C 3NS8A 3VFKA 1J7AA 1OFFA 1BT0A 2CJNA 3JSVA 3AN1A 3GE8C 2DX5B 1IP9A 1WXMA 3MJWA 3ZIMA 2GBJA 1F9JA 4BVUC 1WMHA 2IO1B 2QJLA 2I1JA 3SFEB 3H1UA 1TY2A 1F52A 3NVWA 1U4AA 1M4VA 2KVRA 4RF0A 3KYCD 1HTOA 2XK5B 2LFIA 4FN2A 3TBLD 2FIFA 2D3GA 4PT5A 2WP9B 3TEYA 4C4VA 1TJEA 2GOWA 3TSSA 1XLPA 4YTPB 1WR1A 3PREA 3R2IA 2BF8B 2MHJA 4ICVA 3AEBB 2H89B 2BGFA 2KZRA 3Q6BA 2ICIA 1ZPSA 3RNBC 1N5WA 3VTVA 2BYFA 1ZDXA 1WZ0A 3V60A 1J8CA 1KTKA 2NCNA 1OEYJ
chains in the Genus database with same CATH topology
3ETRA 1N5XA 2MH7A 4JE3B 1VZ6A 4C7YA 2WXHA 1HZ5A 1L4DB 2I38A 1IBXB 1CK1A 3BYTB 4RGOS 3RFZB 1YJJA 2K9XA 1KRHA 1I4GA 1PUTA 1SJHD 1VZ7A 3BZDB 2EKIA 1PGAA 1ZOYB 3U52E 1DOYA 2N9KA 4RNAA 1FIQA 2RDGA 1TKEA 2RMMA 1QOFA 1ZP0B 3MC0B 4OVZA 1B9RA 1EWYC 1C4CA 3CWIA 1JWMD 2BS4B 5BMGA 1R7SA 2YEPB 3AE4B 2K5PA 3O13A 5HI1A 2LUMA 3AEAB 3VRAB 2WXNA 1K50A 2MEKA 5EE0A 1BUIC 2GI9A 1E6EB 1BMLC 1WRIA 1J7BA 1L6VA 2BS3B 2IPKD 3HVZA 3R2TA 1WYGA 3U2SC 2WDRB 1E0ZA 2CU3A 1XO3A 4Q2JA 4YTMB 2VZKD 3KWLA 4ZYSA 3TEWA 1FFUA 1AN8A 5GXGB 3Q69A 1ESFA 1UUPA 1DOXA 1L0YB 2X38A 3BVZA 1T5XD 2W3SA 4WURA 1CJEA 2WXQA 3ZQ4A 4YT0B 1VZ8A 2N0SB 4L2YA 2L32A 3I57A 3P42A 3T3NA 4A8XC 3AE2B 1TZOA 2D5GA 2WQYB 2ACZB 2JYEA 2V3NA 1WSPA 1TS3A 3B2GA 1DYQA 1JQ4A 1FXAA 2ON8A 4N59A 1SIJA 2E6XA 2JU6X 5D3IB 1ET6A 4XWTA 1GB1A 1YNTE 5AUIA 2WXLA 5BMIA 1N62A 1SEBD 5H8YE 2YEPF 4C56C 3P4RB 3W5VB 5JXVA 4DQOC 2NTSA 3I9V1 4NZLB 3U4EG 4IKGA 3NRZA 1SE3A 3PZ7A 4MH8A 5BYRA 3HVDA 4XDDA 3AE9B 4YXDB 4REZA 3AB5A 1F0ZA 1VJKA 2L83A 2W55A 2J42A 1V8CA 1NEKB 1C78A 1KLGD 4B0MA 1FNVA 1UWMA 4YSZB 3EA6A 5G5HA 1N63A 3GS2A 3NVZA 1V1PA 2XNAC 3V05A 2ZW0A 1I4QA 2BS2B 4IOIE 4D2KA 4DXGA 2N7JA 2JZPA 1ENFA 2QEJC 3NVYA 3BYYB 1D5XC 3BWUD 1SE2A 1SXTA 3Q8BA 4HRSA 3RPFC 3TUOA 1CQVA 3J9CA 2H88B 1SB3C 1WGKA 3CF4A 2PIAA 3NVVA 1FD6A 4GDLB 4L1BA 3ZJVA 1N61A 1FM0D 5EE9A 2EELA 2KAJA 3FILB 3HUIA 3AH7A 1E7PB 3AEFB 1WXQA 4ARCA 5AUKA 3URYA 2DYMA 3AEGB 1V97A 5HHDG 2BYTA 3KQ4A 2MJ3A 4HKZE 4RF1A 4A55A 5HG2A 1L0XB 1D4BA 4FXCA 2L1AA 4RGNA 3ZJUA 1JALA 1Y56A 1FXIA 1STEA 3LB8C 1SE4A 1GTHA 1HA5A 4JWSC 1L5PA 1WWTA 1PDXA 1KLUD 1YN5A 2BBCA 2V4IB 2G1EA 3Q8CA 2LHDA 4OZBA 1QT9A 1T6BX 4NAMA 2KQ4X 1GPXA 2J53A 4UDUC 2FE8A 3P1MA 4TSSA 3B2FA 2TSSA 4IDIA 1L6UA 1UNSA 4JPSA 1FRRA 4HEA1 3UI3A 4WAFA 5BYSA 2RDHA 2L52A 4HKQA 1PYWD 1QOAA 1F2RC 3BK1A 2JQRB 2KN4A 3IXSA 1C9FA 2B76B 2MJEA 1D5ZC 1FCLA 2V3PA 3P4QB 2NTTA 2M56B 2WLBA 2BB6A 4N6EB 5I4DA 2WXKA 1RYJA 1HEZE 4J3OD 3DWMA 1XF5L 1I4XA 4A6QA 1HQRD 1AWDA 2QMTA 1I7HA 2QIEB 4ZRPA 1DOIA 4A90A 5FR3A 1MHHE 4KGTA 3Q8AA 4ZOHC 1ZXHA 1NYQA 1YJIA 1F77A 1NYRA 3ABVB 1MPEA 1LO5D 3BVGA 3ZYYX 4N58A 1TKYA 1JMLA 4MM3B 2WXGA 1L4ZB 1IBXA 2AQ3B 5TSSA 1EM7A 1SF0A 4YTNB 2JWUA 1XXGA 1JWAD 2AQ2B 2J4XA 4ARIA 2WXOA 3N9YC 2WXPA 1TKGA 2WXMA 3AEDB 3IT6B 1H7WA 1ZDVA 1I4RA 1UWXA 2LGIA 2PW9A 4RCOA 2MJDA 4O1NA 4L23A 5HFYA 1QLBB 2LJIA 4M0WA 1C4PA 3WCQA 3ZGZA 1YN3A 4C80A 1OQQA 1N60A 3SR6A 1FNUA 3AM9A 3EUB2 3AE3B 1GB4A 2M0AA 2Y5CA 2PKOA 5FK9C 3AE8B 1MVKA 1A70A 3HRDD 2HDEA 5FKAC 3ZJTA 5T8IA 1IGDA 4AQ7A 4WIPA 2BW2A 5LNK1 4GLSC 2G9HD 3V3XA 4OW0A 4XWWA 1Q10A 3U7ZA 2Y5PA 3FC4A 2IDYA 4ITKA 2FUG1 3W9CB 3Q8EA 3KWVA 2Y3AA 4WQMA 1E10A 2Z8LA 1I4HA 1GOZA 2Q5WD 4KGRA 1OQRA 4RFBA 1J7CA 4DXFA 1EU3A 1UGJA 1GAQB 3SFDB 1NVID 1ZXIA 4AS1A 3AE7B 4ZHOA 1ROEA 1RM6C 2ONQA 2PVOD 1VDVA 3MFGA 4RGTA 3SEBA 4JX1C 4NAWB 1HXYD 2K22A 5EE1A 2N9LA 5EE3A 1YQ4B 2RPVA 1V1PB 3AEEB 3GP7A 3E56A 4H2AA 1E9MA 5BYQA 4LTUA 2GRIA 3LXFA 1XLQA 3AV8A 5C3JB 1JWSD 3PZ8A 4US9A 4OZAA 3W5UB 1AYFA 5G5GA 1YQ3B 2J52A 4WWMA 3NUHB 2W3RA 4ZRQA 4TQ0A 1CZPA 1P7EA 5E6JA 1IGCA 1JCKB 2IJ0A 1QOGA 1EU4A 4MT5A 1FFVA 1AW7A 1C79A 4HJGE 4XE0A 1JWBD 1JWUD 4KKIA 4R3DA 2WNMA 4KKJA 1PFDA 3KLSX 4OHJA 1L0VB 2DBYA 2FBWB 1FEHA 3VR8B 1FNWA 1NENB 2LMCA 2KMMA 1TY0A 3FAHA 2WS3B 3AE6B 2SAKA 1YN4A 2JXTA 1P7FA 4XDCA 2INPE 1QILA 1V1OA 2WU2B 3IAM1 5C2TB 1I4PA 1TS5A 5D7GA 3MJ5A 2BT6A 1JROA 3AE5B 2DWQA 3AMZA 4TQ1A 3H8HA 3OWEB 4RH6A 4YSXB 2LEKA 2JX5A 4C7ZA 3VQIA 2WDQB 3E9SA 4HROA 2DYOA 3NS1A 2BTEA 2AQ1B 3BK2A 3Q8FA 3BVMA 1C77A 2PVGC 2NMQA 1DGJA 1KF6B 1SSNA 2JYTA 3AE1B 1JRPA 1VRAB 2K3UA 4YSYB 3VRBB 2IGHA 2SEBD 4KGSA 3T3OA 1KFYB 1SBBB 1MI0A 2WXIA 4GDKB 3MHZA 1KH0A 1T3QA 5D3DA 3EGRA 3NZ3A 2V0GA 4CQNA 2KACA 1TS4A 3P4SB 4WH4A 3PO0A 2QILA 1F2RI 1TYGB 2DLBA 4MACA 1K53A 1XEEA 1C76A 1FO4A 1HZ6A 1PGXA 4OZCA 1EWCA 2WU5B 4TMAB 1ACCA 2AX5A 2I2YA 5H92C 2R61A 4EE2A 1K51A 1NI3A 2JSVX 1IUEA 1J7AA 1OFFA 3P63A 2WDVB 3B9JA 3AECB 2LHEA 4LK0M 3BIID 1YMHE 1FMAD 1BXTA 2CJNA 2W54A 4USAA 3TEXA 3W2DA 3AN1A 2PLPA 1PGBA 2WXRA 4KX6B 3TEZA 4LLGM 1B1ZA 2QSDA 2OHFA 2QJLA 1H7XA 3SFEB 1RWSA 1TY2A 3NVWA 3IT4B 3DWGC 1C4AA 2WXFA 1M4VA 2W82A 2HTME 2K0PA 4RF0A 1XLOA 4RGMA 3LYYA 4B0EA 2LFIA 2KWDA 2E3TA 2GB1A 1D5MC 2PMVA 1QQRA 1GT8A 4PT5A 4ZHPA 1FCCC 2KDMA 2OEDA 1JW9D 2WP9B 3W1SA 3TEYA 1XCQL 1GTEA 1MHXA 1K52A 1TJEA 4YWGG 3MP9A 3TSSA 1QKZA 2INNE 4US8A 5MPOA 1XCTL 1XLPA 4YTPB 1D6EC 2XN9C 3R2IA 3GB1A 2WXJA 3AEBB 2H89B 2ICIA 2VZKB 1ZE3D 2ZW1A 4P6VF 1ZPSA 2IGGA 3FILA 2IGDA 2PTLA 1SJED 3VR9B 1QOBA 3C8YA 1VLBA 1QF6A 3L4PA 3CIRB 1ZUD2 1N5WA 1ZDXA 5BMHA 4NJCA 4A9AA 1KTKA 1RFKA 4P16A 1XLNA 3P4PB 2M19A 3R8BA 1TS2A 2BB5A 4JWUC 1VR9A 2CJOA 1ET9A 3IAS1 1FRDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ETR A;  1KF6 B;  1N5X A;  2MH7 A;  1N60 A;  3NVY A;  3SR6 A;  3AE1 B;  3AM9 A;  1JRP A;  3EUB 2;  3AE3 B;  4C7Y A;  4YSY B;  4HRS A;  3VRB B;  3RPF C;  2Y5C A;  2PKO A;  3AE8 B;  2H88 B;  1YJJ A;  2K9X A;  1KFY B;  1SB3 C;  1WGK A;  1A70 A;  1KRH A;  1PUT A;  3CF4 A;  2PIA A;  3NVV A;  3HRD D;  2EKI A;  1T3Q A;  1ZOY B;  1DOY A;  1N61 A;  1FM0 D;  5EE9 A;  1FIQ A;  2KAJ A;  3HUI A;  1TKE A;  3AH7 A;  1E7P B;  3AEF B;  1QOF A;  1ZP0 B;  3P4S B;  1WXQ A;  3FC4 A;  3PO0 A;  4ITK A;  5AUK A;  3W9C B;  1B9R A;  1EWY C;  1TYG B;  3AEG B;  1V97 A;  3CWI A;  4WQM A;  2BS4 B;  1FO4 A;  1E10 A;  2MJ3 A;  2Q5W D;  1OQR A;  1J7C A;  1R7S A;  2WU5 B;  4FXC A;  3AE4 B;  2AX5 A;  1JAL A;  3LB8 C;  1FXI A;  2K5P A;  1GAQ B;  1GTH A;  5H92 C;  3SFD B;  1NVI D;  3AEA B;  1L5P A;  1WWT A;  1PDX A;  1ZXI A;  3AE7 B;  2CJO A;  3VRA B;  4ZHO A;  1ROE A;  1RM6 C;  1NI3 A;  2PVO D;  1VDV A;  1IUE A;  1J7A A;  2G1E A;  5EE0 A;  1OFF A;  3P63 A;  1E6E B;  2WDV B;  1QT9 A;  3B9J A;  4JX1 C;  3AEC B;  1GPX A;  3BII D;  1WRI A;  1J7B A;  2K22 A;  1FMA D;  2CJN A;  2W54 A;  4USA A;  3P1M A;  5EE1 A;  5EE3 A;  1YQ4 B;  2BS3 B;  1L6V A;  3B2F A;  3AN1 A;  3HVZ A;  1WYG A;  1L6U A;  4IDI A;  2WDR B;  1E0Z A;  2CU3 A;  3AEE B;  1FRR A;  4YTM B;  1XO3 A;  3KWL A;  4KX6 B;  1FFU A;  5GXG B;  1E9M A;  4LTU A;  2L52 A;  1DOX A;  3LXF A;  1XLQ A;  2OHF A;  5C3J B;  2QJL A;  3AV8 A;  1H7X A;  3SFE B;  1QOA A;  4US9 A;  1RWS A;  1AYF A;  3NVW A;  5G5G A;  3W5U B;  2W3S A;  1YQ3 B;  4WWM A;  3DWG C;  1CJE A;  2JQR B;  4YT0 B;  2N0S B;  2W3R A;  2B76 B;  2MJE A;  2HTM E;  1XLO A;  4JWS C;  3P4Q B;  1CZP A;  3AE2 B;  2M56 B;  2WLB A;  4N6E B;  1RYJ A;  2E3T A;  1QF6 A;  1QOG A;  2WQY B;  2ACZ B;  1FFV A;  1GT8 A;  3DWM A;  4ZHP A;  3B2G A;  1JQ4 A;  1FXA A;  1JW9 D;  2WP9 B;  1JWB D;  1AWD A;  4N59 A;  1GTE A;  1I7H A;  1OQQ A;  1SIJ A;  2QIE B;  1DOI A;  1TJE A;  1PFD A;  4ZOH C;  5AUI A;  4US8 A;  1N62 A;  5MPO A;  1L0V B;  5H8Y E;  1XLP A;  3P4R B;  4YTP B;  2FBW B;  1NYQ A;  1YJI A;  2DBY A;  1NYR A;  3ABV B;  3W5V B;  3VR8 B;  1NEN B;  2KMM A;  3FAH A;  3NRZ A;  3ZYY X;  4N58 A;  2WS3 B;  3AE6 B;  1TKY A;  3AE9 B;  2H89 B;  3AEB B;  4YXD B;  3AB5 A;  2WU2 B;  1F0Z A;  4P6V F;  1VJK A;  1SF0 A;  2L83 A;  4YTN B;  2W55 A;  1V8C A;  1NEK B;  3VR9 B;  1QOB A;  1JWA D;  1VLB A;  1JRO A;  3AE5 B;  2BT6 A;  2DWQ A;  3AMZ A;  3CIR B;  3L4P A;  1ZUD 2;  4YSX B;  1UWM A;  1N5W A;  4YSZ B;  2LEK A;  2JX5 A;  5G5H A;  1N63 A;  1TKG A;  4C7Z A;  4A9A A;  3AED B;  2WDQ B;  4HRO A;  1H7W A;  3NS1 A;  3NVZ A;  1RFK A;  1XLN A;  3P4P B;  2MJD A;  2BS2 B;  2M19 A;  1QLB B;  2PVG C;  4JWU C;  1DGJ A;  3WCQ A;  5C2T B;  4C80 A;  1FRD A; 
#chains in the Genus database with same CATH topology
 4JE3 B;  3QJZ A;  4C7Y A;  2WXH A;  1HZ5 A;  3A9K B;  2INC C;  1I4G A;  1SJH D;  1VZ7 A;  4JGH B;  1PGA A;  3U52 E;  2X8X X;  1FIQ A;  2RDG A;  3QHT A;  5AZG A;  4OVZ A;  2DHZ A;  2LVQ A;  3QWZ B;  2BWF A;  1JWM D;  2YEP B;  2K5P A;  3O13 A;  5L95 C;  4W9G A;  1E6E B;  2WHI A;  1L6V A;  3HVZ A;  1CMX B;  3N20 C;  3U2S C;  3N30 A;  1XO3 A;  4ZYS A;  2B3A A;  2QHO A;  2DZI A;  2BPS A;  1UUP A;  2BYE A;  4KIK B;  3R7Q A;  2FUH B;  1WM3 A;  1N6Z A;  3RZF A;  2CU1 A;  2V4L A;  3ZQ4 A;  1VZ8 A;  1WYW B;  3P42 A;  2PE6 B;  2VRR B;  2D5G A;  4BKS D;  4PS3 A;  1LM8 B;  3RNC C;  1E8Z A;  3FKY A;  4WJP A;  1G6J A;  2E6X A;  2JU6 X;  5D3I B;  1ET6 A;  1Q1O A;  2WXL A;  4C56 C;  1OEY A;  1WR6 E;  3I9V 1;  3U4E G;  2FCM A;  3AE9 B;  2V3S A;  5JH5 C;  4IM3 A;  2L83 A;  2D2Q A;  3VXW A;  1ZKH A;  2KFK A;  2KMA A;  2D11 A;  1N63 A;  3GS2 A;  4BKT A;  1T0Y A;  4BBN F;  1TBE A;  2ZW0 A;  3A1Q A;  2BS2 B;  2N7J A;  1ENF A;  2BQQ A;  3NVY A;  4B6W A;  3BWU D;  2KHW B;  3I5J C;  3Q8B A;  1YOV B;  2KDI A;  1SB3 C;  1HE8 A;  1FD6 A;  4LDT D;  3GZN I;  2KAJ A;  4IUM B;  2KAN A;  1ZW7 A;  3URY A;  4ARC A;  3NZU A;  2MJ3 A;  1L0X B;  1D4B A;  2WYQ A;  4RGN A;  3ZJU A;  2KX0 A;  4JWS C;  1L5P A;  1WWT A;  1UBI A;  2G1E A;  4XC2 A;  1L7Y A;  2LHD A;  1QT9 A;  1T6B X;  1GPX A;  2KQ4 X;  1WMH B;  4EUT A;  4UDU C;  2JF5 A;  3P1M A;  3RCZ A;  3B2F A;  1EF1 A;  4HEA 1;  4MEL A;  3ZKJ C;  5BYS A;  3DDC B;  1PYW D;  1QOA A;  3BK1 A;  5C23 A;  4EFO A;  3ONS A;  3B0A A;  3IXS A;  1WZ3 A;  2LRU A;  4RM8 A;  1WI0 A;  2NTT A;  4N6E B;  5I4D A;  4EZK A;  3KW5 B;  4A6Q A;  2FID A;  4XYC A;  4IWP A;  3PRM B;  2XBB C;  1ZXH A;  4FBJ B;  1NYR A;  4I6P A;  5D94 A;  1AAR A;  4N58 A;  4HPP A;  3ZXV A;  3JW0 X;  1EM7 A;  3JYU A;  3BY4 B;  1JWA D;  2WXO A;  2FAZ A;  2WXP A;  2NPT A;  1ZDV A;  1A5R A;  2L76 A;  1UWX A;  2LGI A;  3V6C B;  2PW9 A;  4O1N A;  4L23 A;  1UEL A;  2LJI A;  4M0W A;  5DPT A;  3ZGZ A;  2KOX A;  1FNU A;  3QA8 A;  2MLB A;  4WJQ A;  2M0A A;  2Y5C A;  3AE8 B;  2W9N A;  2G9H D;  4XX5 A;  4E3C A;  4KV2 A;  3NG0 A;  2FUG 1;  3W9C B;  1V80 A;  3KWV A;  2A5U A;  3PHX B;  2Z8L A;  3DPD A;  1I4H A;  1GOZ A;  4KDL B;  2N7D A;  4KSL C;  5IKC M;  4M00 A;  1ZXI A;  4AS1 A;  3AE7 B;  4DK5 A;  3SEB A;  1HXY D;  2N9L A;  1S3S G;  3SDL C;  3AEE B;  1P0R A;  3GP7 A;  4H2A A;  4FA6 A;  3PZ8 A;  1AYF A;  4K3B A;  2MRP A;  1YQ3 B;  2W3R A;  3QQ8 B;  3Q3O C;  1JCK B;  2IJ0 A;  2DEN B;  1QOG A;  4FLH A;  3PZD A;  3OLM D;  1GG3 A;  3ZNG C;  4KKJ A;  4OHJ A;  1L0V B;  2DBY A;  2WWZ A;  3ZDM C;  2YVC A;  1I42 A;  1WX7 A;  4GDK A;  1NEN B;  2KMM A;  4BZA A;  2JXT A;  4FUL A;  3L0W B;  1WE7 A;  2K1F A;  2BT6 A;  1T0S C;  2FCQ A;  1S1Q B;  3OWE B;  2LEK A;  2JX5 A;  2PE9 A;  2KWU B;  3AUL A;  4MEM A;  4C7Z A;  4LJP B;  2DYO A;  2LXA A;  5KHO A;  2AQ1 B;  3BK2 A;  3Q8F A;  1E5W A;  4CO7 A;  2KJR A;  1E7U A;  4JLC A;  1KF6 B;  2JYT A;  3NZS A;  5LXH A;  3M95 A;  4GU2 A;  4DDG D;  4KGS A;  4G50 A;  3QIJ A;  2O2V B;  1YD8 U;  1KH0 A;  2KC2 A;  3SU8 X;  2PEA A;  2N1W A;  2N9E B;  3DOW A;  3EGR A;  3PV1 A;  2KAC A;  2QC8 A;  3P4S B;  2RDB C;  3PO0 A;  5CHF A;  5G55 A;  2QIL A;  1K53 A;  1EWC A;  2KDB A;  2R61 A;  3SHQ A;  3NHE B;  4K7U A;  4EE2 A;  3QAR A;  1IUE A;  3P63 A;  2WDV B;  3B9J A;  3AEC B;  3BII D;  1YMH E;  1FMA D;  2W54 A;  3TEX A;  1SIF A;  2WXR A;  5D2M B;  4LLG M;  2QSD A;  5J2R A;  1H7X A;  3K9P B;  2D10 A;  3DWG C;  4WJO A;  5AEK B;  2W82 A;  2HTM E;  3A4R A;  3M63 B;  2HD5 B;  4BOS C;  3LYY A;  4B0E A;  4RM9 A;  1UH6 A;  2KWD A;  1WGR A;  1GT8 A;  2KDM A;  2OED A;  4K7S A;  3W1S A;  4IWQ A;  2KD0 A;  3ZTC A;  4US8 A;  1XCT L;  2QDF A;  5IAA C;  1WRD B;  4DHZ E;  1WIA A;  3PGE A;  1ZE3 D;  4P6V F;  2L00 B;  3FIL A;  3KYD D;  2IGD A;  1E8Y A;  1LFD A;  2PTL A;  3QC8 B;  1LXD A;  4P7I A;  3L4P A;  3ZVV A;  1ZUD 2;  3ZLZ A;  5FR6 A;  2MA9 B;  5BMH A;  2MBE A;  1K8R B;  4J6I A;  2MP2 B;  1XLN A;  3R8B A;  4TUU A;  4NQK E;  4IG7 B;  2GLS A;  1ET9 A;  3IAS 1;  4TQ0 A;  1FRD A;  1N5X A;  3Q3F A;  4W9D A;  1P9D U;  1VZ6 A;  3DCG A;  4LNF A;  2RR9 A;  2I38 A;  1IBX B;  4RGO S;  1NBF C;  1KRH A;  1C1Y B;  2EKI A;  2KC1 A;  4BAX A;  1ZOY B;  1V2Y A;  4FJZ A;  2N9K A;  1MG4 A;  3ZNI D;  4F8C B;  5J18 A;  1EUV B;  2RMM A;  1QOF A;  1ZP0 B;  2K6D B;  1EWY C;  1C4C A;  3UIP B;  3CWI A;  4MSQ B;  3ZRC A;  2BS4 B;  4GSW A;  4FJV B;  1R7S A;  1WJU A;  2LAS A;  3AE4 B;  1R4N I;  2BKR B;  4DWF A;  2KQ7 A;  2LUM A;  3MC8 A;  3AEA B;  4II2 B;  4K3C A;  2WXN A;  1BUI C;  3RNA C;  2KXJ A;  3MC9 A;  1WRI A;  2MBB B;  2G3Q B;  4ANV A;  4YTM B;  1AN8 A;  1DOX A;  4GOC A;  2LUE A;  4ANX A;  4WUR A;  4DHJ D;  2WXQ A;  5LLI A;  4L2Y A;  3R7R A;  4K7W A;  3AE2 B;  1TZO A;  5G2N A;  3VUY A;  2WQY B;  2AWT A;  3L13 A;  3NJT A;  4PYU A;  1FXA A;  2KLC A;  1SIJ A;  3N32 A;  3Q3M C;  1N62 A;  1SEB D;  5JXV A;  4IWO A;  2IND C;  4DQO C;  1P1A A;  4MH8 A;  3PZ7 A;  5BYR A;  3RN9 C;  1UGM A;  4XDD A;  4REZ A;  1VJK A;  5J17 A;  3S2A A;  2GBN A;  3KUD B;  2J42 A;  1V8C A;  2GBK A;  1KLG D;  3EA6 A;  5G5H A;  3U7D A;  3PRP B;  3I63 C;  1V1P A;  1I4Q A;  4IOI E;  3L16 A;  4D2K A;  3DBS A;  4WWO A;  2JZP A;  2QEJ C;  2LGX A;  3BYY B;  4AJY B;  4AJW A;  2G4D B;  4M02 A;  1WGK A;  2MW5 A;  3NVV A;  5CX3 A;  4IM2 A;  3AXC A;  3Q2A C;  4L1B A;  1V81 A;  4WWN A;  4BBN C;  1FM0 D;  3R66 C;  4W9F A;  3AH7 A;  3AEF B;  5JZE B;  5AUK A;  2KO3 A;  3W1Y A;  1V97 A;  3RD2 A;  4DDI D;  3RYT A;  4FXC A;  2JRI B;  3LB8 C;  1Y56 A;  1LGR A;  4M01 A;  1PDX A;  2K8B A;  5JHA A;  2BBC A;  3Q8C A;  3ALB A;  2M8S A;  2FE8 A;  1UNS A;  1FPY A;  1WGD A;  5GMV A;  2IZV B;  5E6P A;  1ZGU B;  2GMI C;  1OQY A;  4KVG B;  4HKQ A;  1F2R C;  2VH2 A;  4X57 B;  4ZDV A;  2N1V A;  1TZ1 A;  2JQR B;  2NPT B;  3JVZ X;  2B76 B;  1Z2M A;  2NBU A;  3DQV A;  3HM3 A;  1FCL A;  1RYJ A;  1HEZ E;  3IG3 A;  1RRB A;  4KSK C;  1XF5 L;  1I4X A;  1C3T A;  1I7H A;  3Q8A A;  4ZOH C;  2FCN A;  2ZNV B;  1TTN A;  3VDZ A;  2DAF A;  1LQB A;  1R4M I;  2NBW B;  3BVG A;  3ZYY X;  1V9J A;  2UU7 A;  1IBX A;  3NY5 A;  1Q5W B;  2KN5 A;  2J4X A;  4ARI A;  2O6V D;  3IT6 B;  4ASW C;  3RUL A;  1YQB A;  4E71 A;  1JRU A;  4MJS A;  1GJZ A;  1V49 A;  1C4P A;  4GMV A;  2R2O A;  4C80 A;  1OQQ A;  1MG8 A;  2KK8 A;  2IYD B;  3PT2 B;  4WAA A;  2MWS B;  1GB4 A;  2IO2 B;  3B08 A;  3PLU A;  4ICU A;  1MVK A;  1RLF A;  1A70 A;  1SE9 A;  2HDE A;  2N9P C;  2LD9 A;  4KZC A;  4W9C A;  5T8I A;  1E7V A;  3PRZ A;  3V3X A;  4NJ6 A;  4ITK A;  2J0J A;  4FHJ A;  4MSM B;  1KJT A;  4I6L B;  2C7H A;  4MGK E;  5CHW A;  3SFD B;  4ZHO A;  1ROE A;  3DBR B;  2JZ3 B;  2PVO D;  3ZNZ B;  4LNK A;  4NAW B;  1NI2 A;  2HE7 A;  3RNG C;  1V1P B;  1GNU A;  3E56 A;  4WWP A;  3AV8 A;  4OZA A;  2KJ6 A;  3P2B A;  2RPQ A;  3ZDT A;  3PTF C;  1P7E A;  3A9K A;  1IGC A;  3H7S A;  2KWC A;  3Q3J A;  1PQS A;  3GOE A;  2JY6 A;  4ANW A;  3PVL A;  2NR2 A;  4XE0 A;  2RD0 A;  2QCZ A;  3EC8 A;  3ZXR A;  1WX8 A;  3KLS X;  3DHI C;  2FBW B;  2DNF A;  1FNW A;  2LMC A;  2WS3 B;  3AE6 B;  2SAK A;  1YN4 A;  1NDD A;  1P7F A;  1KM7 A;  3KVF B;  1QIL A;  5D7G A;  3MJ5 A;  4HCN B;  3AE5 B;  4ACF A;  2MSE D;  4KZ0 A;  4HRO A;  2ZJD A;  2KDF B;  1R4M B;  3QCA A;  4C4V B;  2KJH B;  4BOZ B;  4IM0 A;  2ZPY A;  3AE1 B;  1JRP A;  4NAW A;  1VRA B;  4YSY B;  4NY0 A;  2SEB D;  4ANU A;  2XK5 A;  1MI0 A;  2WXI A;  3PS6 A;  4GDK B;  3VAW A;  4EEW A;  2YLM A;  2PJH A;  3QAQ A;  2KFJ A;  3KH0 A;  3UIO B;  5D3D A;  4NNJ B;  2V0G A;  4CQN A;  1WXS A;  2MBQ A;  2HJ8 A;  4WH4 A;  3ZUN A;  2NVU I;  4AP4 C;  1WFY A;  2KYW A;  4HDQ A;  1ACC A;  2AX5 A;  2JUO A;  4DHZ B;  2KNB A;  4GN1 A;  4EKU A;  2JZZ A;  1NI3 A;  2JSV X;  3BIN A;  1WH3 A;  2FCS A;  4LNI A;  1BXT A;  4USA A;  4HCP B;  4LNN A;  2PLP A;  1PGB A;  2LZ6 A;  3TEZ A;  2LI5 A;  4GIV A;  1RWS A;  1EO6 A;  3B1L X;  3IVF A;  4RGM A;  4CYE A;  2E3T A;  2GB1 A;  2BVC A;  2IY1 B;  1QQR A;  4ZHP A;  1FCC C;  3ZO5 B;  3HIZ A;  1JW9 D;  1XCQ L;  2OOB B;  1MHX A;  4YWG G;  3DBH B;  1MJD A;  2INN E;  1WF9 A;  3ZTD A;  5MPO A;  2C7N B;  3X23 A;  3IFW B;  2XN9 C;  4LDT B;  1KLV A;  4JIO U;  2KTR A;  3GB1 A;  1V6E A;  1P3Q U;  1SJE D;  3VR9 B;  1QOB A;  2Z59 B;  3C8Y A;  3IBE A;  1WXV A;  3K9O B;  3L54 A;  1V5O A;  1IPG A;  5C1Z A;  4P16 A;  3N1Z C;  2KT7 A;  2BB5 A;  4JWU C;  2WNM A;  3WAP A;  2MH7 A;  3EHV A;  2L8J A;  1CK1 A;  3AU5 A;  3BYT B;  3RFZ B;  2K9X A;  4XZ4 A;  3EFU A;  3AU4 A;  1PUT A;  4II3 B;  2MQJ A;  4RNA A;  2M0X A;  4HPM B;  3A9J A;  2XEW A;  2C60 A;  2KKC A;  4FJY A;  4PYZ A;  1B9R A;  1V5T A;  2D3C A;  2EMT A;  2MBO A;  5BMG A;  1M94 A;  3ML8 A;  1WGY A;  5HI1 A;  4OVV A;  5HKH A;  2MEK A;  2IY0 B;  2IO0 B;  2GI9 A;  2REX A;  1WGG A;  3R2T A;  1QZE A;  1H4R A;  2CU3 A;  4Q2J A;  3TEW A;  5GXG B;  3M62 B;  5L83 A;  2K6Q A;  2X38 A;  3M3J A;  1T5X D;  3VUX A;  4AOF A;  4G11 A;  4YT0 B;  2N0S B;  2JT4 B;  2L32 A;  2Z0D B;  1VD2 A;  2L0F A;  3WAN A;  2FNJ B;  2RSU A;  3DHH C;  2V3N A;  1WSP A;  1JQ4 A;  1DYQ A;  4N59 A;  4LNO A;  1RFA A;  1H8C A;  4XWT A;  1GB1 A;  1YNT E;  5AUI A;  5BMI A;  2YEP F;  3W5V B;  1YX5 B;  4JL9 A;  4NZL B;  3APF A;  4IKG A;  3NRZ A;  3PPA A;  2CHW A;  1X1M A;  1WJ4 A;  2W55 A;  1NEK B;  2C9W B;  1C78 A;  3H9D A;  2L3Z A;  4B0M A;  1FNV A;  1UWM A;  4S0R A;  4YSZ B;  2XNA C;  3V05 A;  4DXG A;  2MCN B;  5IOI A;  4BKG A;  1SXT A;  4HRS A;  2UYZ B;  3RPF C;  3TUO A;  3J9C A;  2H88 B;  3CST A;  4GDL B;  4HLE A;  3ZJV A;  3U8Z A;  1N61 A;  2D07 B;  2RGF A;  3FIL B;  3HUI A;  1Q0W B;  3A4S C;  2IO3 B;  5HHD G;  2BYT A;  1V86 A;  1TT5 B;  3UIN B;  1P98 A;  3KQ4 A;  3ZRF A;  4RF1 A;  4A55 A;  4CHK A;  4FAD A;  5HG2 A;  2HJ1 A;  2L1A A;  1FXI A;  1STE A;  1SE4 A;  1GTH A;  2BKF A;  4M8N A;  3SD5 A;  3L10 B;  3WAM A;  1YIW A;  4NAM A;  1WJ6 A;  3PSE B;  4TSS A;  3UGB B;  2TSS A;  2KDE B;  4JPS A;  1FRR A;  2UWQ A;  2ZNV C;  3UI3 A;  2NS5 A;  3GZN B;  1E8X A;  3MHS D;  1WE6 A;  2KN4 A;  2MJE A;  3ECI A;  2V3P A;  4MH0 E;  3O65 B;  2KFK B;  3U30 A;  2WLB A;  2BYV E;  2ZPN A;  4KDI C;  2WXK A;  4J3O D;  2NBV B;  2LXC A;  2N7E A;  1AWD A;  2QMT A;  3TJP A;  2K25 A;  4A90 A;  2KVZ A;  3NOB A;  2DZK A;  1YJI A;  2ASQ A;  3ABV B;  4OVU A;  4MM3 B;  2AQ3 B;  2V9H A;  4TKN A;  1SF0 A;  2LGY A;  3QX1 A;  5AZH A;  2L7R A;  3UQB A;  3EEC A;  2OJW A;  5KHQ A;  1RAX A;  3QK0 A;  2AQ2 B;  1XT9 B;  4MDK E;  3DBH I;  3ZW3 A;  1TKG A;  2WXM A;  3TMP B;  4W9H A;  3MTN B;  1I4R A;  2JXX A;  2AL3 A;  5E6N A;  5HFY A;  3WCQ A;  1YN3 A;  5BO4 B;  4M8M A;  1N60 A;  5DPR A;  3AM9 A;  3EUB 2;  3AE3 B;  5FK9 C;  2CS4 A;  3HRD D;  5FKA C;  4AQ7 A;  2GBR A;  4OW0 A;  3DHG C;  3U7Z A;  3FC4 A;  2IDY A;  2Y3A A;  3X0W A;  1E10 A;  2Q5W D;  4KGR A;  4ZYN A;  1J7C A;  3N1Y C;  4DXF A;  4P1B C;  1WM2 A;  1UGJ A;  3OJ3 A;  1GAQ B;  4HVB A;  4PK1 A;  3MFG A;  2K22 A;  1OTR B;  1ISN A;  1YQ4 B;  2R2Q A;  4W9E A;  2K8H A;  3DVG X;  5JHB A;  4WJN A;  3LXF A;  2J0M A;  1JWS D;  4PS8 A;  4US9 A;  3W5U B;  5G5G A;  2J52 A;  4B9K A;  4ZRQ A;  3OAW A;  2A4Z A;  1CZP A;  1FFV A;  2DAJ A;  1UBQ A;  1C79 A;  1XD3 B;  2I1K A;  3DBR I;  3RNE C;  1JWB D;  2DZJ A;  1Y8R C;  3UQA A;  2L0T A;  2WGS A;  2LGS A;  3FAH A;  3VTW A;  1D3Z A;  2INP E;  1V1O A;  1WX9 A;  1I4P A;  1TS5 A;  2DWQ A;  3H8H A;  3PHW B;  4YSX B;  4RH6 A;  2KX3 A;  3E9S A;  3NS1 A;  5LXI B;  4HPL B;  3BVM A;  1C77 A;  2PVG C;  2NMQ A;  4ZRI A;  1SSN A;  2KLG A;  3Q3N C;  2C7M B;  3VRB B;  2IGH A;  3JSV B;  1R4N B;  4XGA B;  1UZX B;  1KFY B;  1SBB B;  3VHT C;  1GUA B;  3MHZ A;  1HTQ A;  2M17 A;  2KMC A;  3LDZ E;  3TIX A;  1F2R I;  1PGX A;  4OZC A;  2WU5 B;  1K51 A;  4PS7 A;  2CHZ A;  2CR5 A;  1TIF A;  2LHE A;  4LK0 M;  4DXA B;  2N9X A;  2O6V A;  3W2D A;  2C5L C;  4KX6 B;  3VH3 B;  4EZJ A;  1B1Z A;  2OHF A;  4IW0 A;  1IYF A;  3IT4 B;  1C4A A;  2WXF A;  1FXT B;  2K0P A;  1XLO A;  2BWE S;  3DBL B;  1T0Q C;  2JPH A;  3N1X C;  2AEH A;  1D5M C;  2PMV A;  2JRH A;  1GTE A;  1WY8 A;  2ZCB A;  4NPN A;  1K52 A;  3C0R B;  3MP9 A;  1QKZ A;  2KWV B;  4HDO A;  1TGZ B;  1D6E C;  2ZCC A;  2WXJ A;  2ZW1 A;  2VZK B;  2O2V A;  3CSF A;  3RZW C;  2V1Y A;  4GDL A;  2IGG A;  1QF6 A;  1VLB A;  2D3B A;  3DBL I;  3CIR B;  5E6O A;  4NJC A;  4A9A A;  2AL6 A;  1RFK A;  3P4P B;  2M19 A;  2K39 A;  5IA7 A;  1TS2 A;  5EDS A;  4HK2 A;  1VR9 A;  3VH4 B;  2CJO A;  5C2T B;  5D6J B;  3ETR A;  4W9K A;  1L4D B;  1YJJ A;  3VUW A;  3KUC B;  3BZD B;  5DPW A;  3RI7 C;  2ZEQ A;  1DOY A;  4BKS A;  2KQS A;  5CHV C;  1TKE A;  3MC0 B;  2CKH B;  2J0K A;  3V61 A;  2JVC A;  5TR5 A;  1E8W A;  2OJR A;  2N4F A;  1YX6 B;  2WX1 A;  1UF0 A;  4G0N B;  3VRA B;  3Q14 C;  1K50 A;  5EE0 A;  1J19 A;  2PPH A;  1BML C;  1J7B A;  2IPK D;  2BS3 B;  1WYG A;  4HJK A;  2WDR B;  1E0Z A;  2Z0E B;  2VZK D;  3KWL A;  1FFU A;  3DVN V;  3Q69 A;  1ESF A;  1L0Y B;  3BVZ A;  5IP4 D;  1F1H A;  2W3S A;  1CJE A;  3I57 A;  3T3N A;  4A8X C;  2JYE A;  2ACZ B;  2DYB A;  1TS3 A;  3B2G A;  2ON8 A;  4MM3 A;  3HM6 X;  4W9J A;  2ZVN A;  4K1R B;  2LRW A;  5H8Y E;  3P4R B;  2LWP A;  3T8M A;  2NTS A;  2IBI B;  1SE3 A;  1T0R C;  3HVD A;  4YXD B;  3AB5 A;  1F0Z A;  1Z5S B;  2D3A A;  3RNF C;  3WAO A;  5DPS A;  4MGY E;  2LVO A;  3NVZ A;  4M0W B;  3H6N A;  2LGD A;  3D32 A;  1UD7 A;  1WJN A;  5DCN A;  4A3O A;  3WIM A;  1D5X C;  3AI5 A;  1OGW A;  1SE2 A;  4NJ7 A;  3KUZ A;  1CQV A;  3EFC A;  2K8C A;  3CF4 A;  2PIA A;  3TL5 A;  5EE9 A;  2EEL A;  1E7P B;  1WXQ A;  2ZVO A;  5IN7 A;  2DYM A;  3AEG B;  3R3M A;  4MJS B;  4NQL B;  4HKZ E;  1JAL A;  1GC7 A;  1HA5 A;  1KLU D;  1YN5 A;  2V4I B;  1J0G A;  2G4S A;  4OZB A;  4KIK A;  2J53 A;  3CF6 E;  4IDI A;  3W1S C;  2HTH A;  1L6U A;  3WAL A;  4WAF A;  2RDH A;  1EF5 A;  2L52 A;  3PLV A;  1WXA A;  3APD A;  1WGH A;  2MBH A;  3UF8 A;  1KOT A;  4IC7 B;  1C9F A;  1D5Z C;  3P4Q B;  3WA0 A;  1E90 A;  2M56 B;  2LJ5 A;  2BB6 A;  3C19 A;  4GXB A;  3DWM A;  5IO9 A;  1I35 A;  1HQR D;  4G3X B;  2QIE B;  4ZRP A;  4K81 A;  1DOI A;  2EMS A;  4QAY A;  1MHH E;  5FR3 A;  2LVP A;  4KGT A;  3H7P B;  1NYQ A;  1F77 A;  3RT3 B;  1MPE A;  2AYO B;  1LO5 D;  1TKY A;  1JML A;  4E74 A;  2WXG A;  1L4Z B;  1XQQ A;  5TSS A;  4RMA A;  4YTN B;  2JWU A;  1XXG A;  4AWJ A;  3ZNH B;  3N9Y C;  4A20 A;  2EKE C;  3AED B;  2L05 A;  4DHJ B;  1H7W A;  3VVW B;  4F1S A;  4RCO A;  2MJD A;  4N9F 4;  4C00 A;  1QLB B;  4F7Z A;  3OJ4 B;  3SR6 A;  4LCD E;  4AUQ C;  2PKO A;  4I6N B;  3HHM A;  3ZJT A;  2ZZP B;  4W9L A;  1IGD A;  4WIP A;  2BW2 A;  5LNK 1;  4GLS C;  4BFR A;  4XWW A;  1Q10 A;  2Y5P A;  3GE3 C;  5CTR C;  4B95 A;  3Q8E A;  4MGZ E;  4DBG A;  3V62 A;  5AZF A;  3H7P A;  3HK0 A;  4WQM A;  2JWZ A;  1OQR A;  2WDT B;  4RFB A;  1EU3 A;  4WQO B;  4JQW C;  3CMM B;  4TV3 A;  1NVI D;  3OG5 A;  4ZRJ A;  1RM6 C;  2ONQ A;  4RGT A;  1VDV A;  1YJ1 A;  4JX1 C;  4EOY A;  3RUI B;  1VCB A;  5EE1 A;  5EE3 A;  2RPV A;  1L2N A;  4URK A;  4LJO B;  3TCA A;  3A9J B;  1E9M A;  5BYQ A;  4LTU A;  2GBM A;  3L08 A;  2GRI A;  1XLQ A;  5C3J B;  1SGH A;  3VTU A;  4WWM A;  3NUH B;  3RMK C;  4GB9 A;  4EZL A;  4HXD A;  2J7Q B;  5E6J A;  2DZM A;  3T9L A;  2G45 B;  4MT5 A;  1EU4 A;  1AW7 A;  4HJG E;  4W9I A;  2VH1 A;  4HWI B;  1JWU D;  3I3T B;  4KKI A;  4R3D A;  1PFD A;  1FEH A;  3V6E B;  3VR8 B;  1TY0 A;  2KTF A;  4XDC A;  4GGQ A;  3DVG Y;  3IAM 1;  2WU2 B;  3LJ3 A;  2MP2 A;  2KTR B;  4ZRK A;  2MX2 A;  1JRO A;  3AMZ A;  4A3P A;  4TQ1 A;  4S17 A;  3VQI A;  2CHX A;  2WX0 A;  2WDQ B;  2BTE A;  1DGJ A;  4P1C C;  3ENE A;  4YL8 A;  2K3U A;  3N3K B;  3IHP C;  3T3O A;  3A33 B;  3L17 A;  1T3Q A;  2M1M A;  4FHK A;  3APC A;  3NZ3 A;  3DVN U;  1TS4 A;  1TYG B;  2DLB A;  4MAC A;  1XEE A;  1C76 A;  1FO4 A;  1HZ6 A;  1GC6 A;  2O6V B;  4TMA B;  2Y5B B;  1MFW A;  4MGI E;  2I2Y A;  2M4N A;  3A1Q B;  3ML9 A;  5H92 C;  3NS8 A;  3VFK A;  1J7A A;  1OFF A;  1BT0 A;  2CJN A;  3JSV A;  3AN1 A;  3GE8 C;  2DX5 B;  1IP9 A;  1WXM A;  3MJW A;  3ZIM A;  2GBJ A;  1F9J A;  4BVU C;  1WMH A;  2IO1 B;  2QJL A;  2I1J A;  3SFE B;  3H1U A;  1TY2 A;  1F52 A;  3NVW A;  1U4A A;  1M4V A;  2KVR A;  4RF0 A;  3KYC D;  1HTO A;  2XK5 B;  2LFI A;  4FN2 A;  3TBL D;  2FIF A;  2D3G A;  4PT5 A;  2WP9 B;  3TEY A;  4C4V A;  1TJE A;  2GOW A;  3TSS A;  1XLP A;  4YTP B;  1WR1 A;  3PRE A;  3R2I A;  2BF8 B;  2MHJ A;  4ICV A;  3AEB B;  2H89 B;  2BGF A;  2KZR A;  3Q6B A;  2ICI A;  1ZPS A;  3RNB C;  1N5W A;  3VTV A;  2BYF A;  1ZDX A;  1WZ0 A;  3V60 A;  1J8C A;  1KTK A;  2NCN A;  1OEY J; 
#chains in the Genus database with same CATH homology
 3ETR A;  1N5X A;  2MH7 A;  4JE3 B;  1VZ6 A;  4C7Y A;  2WXH A;  1HZ5 A;  1L4D B;  2I38 A;  1IBX B;  1CK1 A;  3BYT B;  4RGO S;  3RFZ B;  1YJJ A;  2K9X A;  1KRH A;  1I4G A;  1PUT A;  1SJH D;  1VZ7 A;  3BZD B;  2EKI A;  1PGA A;  1ZOY B;  3U52 E;  1DOY A;  2N9K A;  4RNA A;  1FIQ A;  2RDG A;  1TKE A;  2RMM A;  1QOF A;  1ZP0 B;  3MC0 B;  4OVZ A;  1B9R A;  1EWY C;  1C4C A;  3CWI A;  1JWM D;  2BS4 B;  5BMG A;  1R7S A;  2YEP B;  3AE4 B;  2K5P A;  3O13 A;  5HI1 A;  2LUM A;  3AEA B;  3VRA B;  2WXN A;  1K50 A;  2MEK A;  5EE0 A;  1BUI C;  2GI9 A;  1E6E B;  1BML C;  1WRI A;  1J7B A;  1L6V A;  2BS3 B;  2IPK D;  3HVZ A;  3R2T A;  1WYG A;  3U2S C;  2WDR B;  1E0Z A;  2CU3 A;  1XO3 A;  4Q2J A;  4YTM B;  2VZK D;  3KWL A;  4ZYS A;  3TEW A;  1FFU A;  1AN8 A;  5GXG B;  3Q69 A;  1ESF A;  1UUP A;  1DOX A;  1L0Y B;  2X38 A;  3BVZ A;  1T5X D;  2W3S A;  4WUR A;  1CJE A;  2WXQ A;  3ZQ4 A;  4YT0 B;  1VZ8 A;  2N0S B;  4L2Y A;  2L32 A;  3I57 A;  3P42 A;  3T3N A;  4A8X C;  3AE2 B;  1TZO A;  2D5G A;  2WQY B;  2ACZ B;  2JYE A;  2V3N A;  1WSP A;  1TS3 A;  3B2G A;  1DYQ A;  1JQ4 A;  1FXA A;  2ON8 A;  4N59 A;  1SIJ A;  2E6X A;  2JU6 X;  5D3I B;  1ET6 A;  4XWT A;  1GB1 A;  1YNT E;  5AUI A;  2WXL A;  5BMI A;  1N62 A;  1SEB D;  5H8Y E;  2YEP F;  4C56 C;  3P4R B;  3W5V B;  5JXV A;  4DQO C;  2NTS A;  3I9V 1;  4NZL B;  3U4E G;  4IKG A;  3NRZ A;  1SE3 A;  3PZ7 A;  4MH8 A;  5BYR A;  3HVD A;  4XDD A;  3AE9 B;  4YXD B;  4REZ A;  3AB5 A;  1F0Z A;  1VJK A;  2L83 A;  2W55 A;  2J42 A;  1V8C A;  1NEK B;  1C78 A;  1KLG D;  4B0M A;  1FNV A;  1UWM A;  4YSZ B;  3EA6 A;  5G5H A;  1N63 A;  3GS2 A;  3NVZ A;  1V1P A;  2XNA C;  3V05 A;  2ZW0 A;  1I4Q A;  2BS2 B;  4IOI E;  4D2K A;  4DXG A;  2N7J A;  2JZP A;  1ENF A;  2QEJ C;  3NVY A;  3BYY B;  1D5X C;  3BWU D;  1SE2 A;  1SXT A;  3Q8B A;  4HRS A;  3RPF C;  3TUO A;  1CQV A;  3J9C A;  2H88 B;  1SB3 C;  1WGK A;  3CF4 A;  2PIA A;  3NVV A;  1FD6 A;  4GDL B;  4L1B A;  3ZJV A;  1N61 A;  1FM0 D;  5EE9 A;  2EEL A;  2KAJ A;  3FIL B;  3HUI A;  3AH7 A;  1E7P B;  3AEF B;  1WXQ A;  4ARC A;  5AUK A;  3URY A;  2DYM A;  3AEG B;  1V97 A;  5HHD G;  2BYT A;  3KQ4 A;  2MJ3 A;  4HKZ E;  4RF1 A;  4A55 A;  5HG2 A;  1L0X B;  1D4B A;  4FXC A;  2L1A A;  4RGN A;  3ZJU A;  1JAL A;  1Y56 A;  1FXI A;  1STE A;  3LB8 C;  1SE4 A;  1GTH A;  1HA5 A;  4JWS C;  1L5P A;  1WWT A;  1PDX A;  1KLU D;  1YN5 A;  2BBC A;  2V4I B;  2G1E A;  3Q8C A;  2LHD A;  4OZB A;  1QT9 A;  1T6B X;  4NAM A;  2KQ4 X;  1GPX A;  2J53 A;  4UDU C;  2FE8 A;  3P1M A;  4TSS A;  3B2F A;  2TSS A;  4IDI A;  1L6U A;  1UNS A;  4JPS A;  1FRR A;  4HEA 1;  3UI3 A;  4WAF A;  5BYS A;  2RDH A;  2L52 A;  4HKQ A;  1PYW D;  1QOA A;  1F2R C;  3BK1 A;  2JQR B;  2KN4 A;  3IXS A;  1C9F A;  2B76 B;  2MJE A;  1D5Z C;  1FCL A;  2V3P A;  3P4Q B;  2NTT A;  2M56 B;  2WLB A;  2BB6 A;  4N6E B;  5I4D A;  2WXK A;  1RYJ A;  1HEZ E;  4J3O D;  3DWM A;  1XF5 L;  1I4X A;  4A6Q A;  1HQR D;  1AWD A;  2QMT A;  1I7H A;  2QIE B;  4ZRP A;  1DOI A;  4A90 A;  5FR3 A;  1MHH E;  4KGT A;  3Q8A A;  4ZOH C;  1ZXH A;  1NYQ A;  1YJI A;  1F77 A;  1NYR A;  3ABV B;  1MPE A;  1LO5 D;  3BVG A;  3ZYY X;  4N58 A;  1TKY A;  1JML A;  4MM3 B;  2WXG A;  1L4Z B;  1IBX A;  2AQ3 B;  5TSS A;  1EM7 A;  1SF0 A;  4YTN B;  2JWU A;  1XXG A;  1JWA D;  2AQ2 B;  2J4X A;  4ARI A;  2WXO A;  3N9Y C;  2WXP A;  1TKG A;  2WXM A;  3AED B;  3IT6 B;  1H7W A;  1ZDV A;  1I4R A;  1UWX A;  2LGI A;  2PW9 A;  4RCO A;  2MJD A;  4O1N A;  4L23 A;  5HFY A;  1QLB B;  2LJI A;  4M0W A;  1C4P A;  3WCQ A;  3ZGZ A;  1YN3 A;  4C80 A;  1OQQ A;  1N60 A;  3SR6 A;  1FNU A;  3AM9 A;  3EUB 2;  3AE3 B;  1GB4 A;  2M0A A;  2Y5C A;  2PKO A;  5FK9 C;  3AE8 B;  1MVK A;  1A70 A;  3HRD D;  2HDE A;  5FKA C;  3ZJT A;  5T8I A;  1IGD A;  4AQ7 A;  4WIP A;  2BW2 A;  5LNK 1;  4GLS C;  2G9H D;  3V3X A;  4OW0 A;  4XWW A;  1Q10 A;  3U7Z A;  2Y5P A;  3FC4 A;  2IDY A;  4ITK A;  2FUG 1;  3W9C B;  3Q8E A;  3KWV A;  2Y3A A;  4WQM A;  1E10 A;  2Z8L A;  1I4H A;  1GOZ A;  2Q5W D;  4KGR A;  1OQR A;  4RFB A;  1J7C A;  4DXF A;  1EU3 A;  1UGJ A;  1GAQ B;  3SFD B;  1NVI D;  1ZXI A;  4AS1 A;  3AE7 B;  4ZHO A;  1ROE A;  1RM6 C;  2ONQ A;  2PVO D;  1VDV A;  3MFG A;  4RGT A;  3SEB A;  4JX1 C;  4NAW B;  1HXY D;  2K22 A;  5EE1 A;  2N9L A;  5EE3 A;  1YQ4 B;  2RPV A;  1V1P B;  3AEE B;  3GP7 A;  3E56 A;  4H2A A;  1E9M A;  5BYQ A;  4LTU A;  2GRI A;  3LXF A;  1XLQ A;  3AV8 A;  5C3J B;  1JWS D;  3PZ8 A;  4US9 A;  4OZA A;  3W5U B;  1AYF A;  5G5G A;  1YQ3 B;  2J52 A;  4WWM A;  3NUH B;  2W3R A;  4ZRQ A;  4TQ0 A;  1CZP A;  1P7E A;  5E6J A;  1IGC A;  1JCK B;  2IJ0 A;  1QOG A;  1EU4 A;  4MT5 A;  1FFV A;  1AW7 A;  1C79 A;  4HJG E;  4XE0 A;  1JWB D;  1JWU D;  4KKI A;  4R3D A;  2WNM A;  4KKJ A;  1PFD A;  3KLS X;  4OHJ A;  1L0V B;  2DBY A;  2FBW B;  1FEH A;  3VR8 B;  1FNW A;  1NEN B;  2LMC A;  2KMM A;  1TY0 A;  3FAH A;  2WS3 B;  3AE6 B;  2SAK A;  1YN4 A;  2JXT A;  1P7F A;  4XDC A;  2INP E;  1QIL A;  1V1O A;  2WU2 B;  3IAM 1;  5C2T B;  1I4P A;  1TS5 A;  5D7G A;  3MJ5 A;  2BT6 A;  1JRO A;  3AE5 B;  2DWQ A;  3AMZ A;  4TQ1 A;  3H8H A;  3OWE B;  4RH6 A;  4YSX B;  2LEK A;  2JX5 A;  4C7Z A;  3VQI A;  2WDQ B;  3E9S A;  4HRO A;  2DYO A;  3NS1 A;  2BTE A;  2AQ1 B;  3BK2 A;  3Q8F A;  3BVM A;  1C77 A;  2PVG C;  2NMQ A;  1DGJ A;  1KF6 B;  1SSN A;  2JYT A;  3AE1 B;  1JRP A;  1VRA B;  2K3U A;  4YSY B;  3VRB B;  2IGH A;  2SEB D;  4KGS A;  3T3O A;  1KFY B;  1SBB B;  1MI0 A;  2WXI A;  4GDK B;  3MHZ A;  1KH0 A;  1T3Q A;  5D3D A;  3EGR A;  3NZ3 A;  2V0G A;  4CQN A;  2KAC A;  1TS4 A;  3P4S B;  4WH4 A;  3PO0 A;  2QIL A;  1F2R I;  1TYG B;  2DLB A;  4MAC A;  1K53 A;  1XEE A;  1C76 A;  1FO4 A;  1HZ6 A;  1PGX A;  4OZC A;  1EWC A;  2WU5 B;  4TMA B;  1ACC A;  2AX5 A;  2I2Y A;  5H92 C;  2R61 A;  4EE2 A;  1K51 A;  1NI3 A;  2JSV X;  1IUE A;  1J7A A;  1OFF A;  3P63 A;  2WDV B;  3B9J A;  3AEC B;  2LHE A;  4LK0 M;  3BII D;  1YMH E;  1FMA D;  1BXT A;  2CJN A;  2W54 A;  4USA A;  3TEX A;  3W2D A;  3AN1 A;  2PLP A;  1PGB A;  2WXR A;  4KX6 B;  3TEZ A;  4LLG M;  1B1Z A;  2QSD A;  2OHF A;  2QJL A;  1H7X A;  3SFE B;  1RWS A;  1TY2 A;  3NVW A;  3IT4 B;  3DWG C;  1C4A A;  2WXF A;  1M4V A;  2W82 A;  2HTM E;  2K0P A;  4RF0 A;  1XLO A;  4RGM A;  3LYY A;  4B0E A;  2LFI A;  2KWD A;  2E3T A;  2GB1 A;  1D5M C;  2PMV A;  1QQR A;  1GT8 A;  4PT5 A;  4ZHP A;  1FCC C;  2KDM A;  2OED A;  1JW9 D;  2WP9 B;  3W1S A;  3TEY A;  1XCQ L;  1GTE A;  1MHX A;  1K52 A;  1TJE A;  4YWG G;  3MP9 A;  3TSS A;  1QKZ A;  2INN E;  4US8 A;  5MPO A;  1XCT L;  1XLP A;  4YTP B;  1D6E C;  2XN9 C;  3R2I A;  3GB1 A;  2WXJ A;  3AEB B;  2H89 B;  2ICI A;  2VZK B;  1ZE3 D;  2ZW1 A;  4P6V F;  1ZPS A;  2IGG A;  3FIL A;  2IGD A;  2PTL A;  1SJE D;  3VR9 B;  1QOB A;  3C8Y A;  1VLB A;  1QF6 A;  3L4P A;  3CIR B;  1ZUD 2;  1N5W A;  1ZDX A;  5BMH A;  4NJC A;  4A9A A;  1KTK A;  1RFK A;  4P16 A;  1XLN A;  3P4P B;  2M19 A;  3R8B A;  1TS2 A;  2BB5 A;  4JWU C;  1VR9 A;  2CJO A;  1ET9 A;  3IAS 1;  1FRD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...