1NEKB

Complex ii (succinate dehydrogenase) from e. coli with ubiquinone bound
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
238
structure length
238
Chain Sequence
MRLEFSIYRYNPDVDDAPRMQDYTLEADEGRDMMLLDALIQLKEKDPSLSFRRSCREGVCGSDGLNMNGKNGLACITPISALNQPGKKIVIRPLPGLPVIRDLVVDMGQFYAQYEKIKPYLLNNGQNPPAREHLQMPEQREKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLAAYRFLIDSRDTETDSRLDGLSDAFSVFRCHSIMNCVSVCPKGLNPTRAIGHIKSMLLQRNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/electron transport
molecule keywords Succinate dehydrogenase flavoprotein subunit
publication title Architecture of succinate dehydrogenase and reactive oxygen species generation.
pubmed doi rcsb
source organism Escherichia coli
total genus 56
structure length 238
sequence length 238
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2002-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 1nekB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1nekB01
1DGJA 1VLBA 1GT8A 4IDIA 1N62A 1CJEA 3AN1A 1E7PB 4YSXB 2EKIA 1E6EB 3VRBB 1JWBD 1J7BA 2BS3B 1JQ4A 4YTNB 1QF6A 3SR6A 1QLBB 1N60A 2W3SA 3B2FA 3EUB2 1JWAD 4P6VF 5H92C 1NI3A 1XLOA 5EE9A 2K5PA 1TKGA 1YQ4B 4USAA 4ZHPA 1B9RA 1RWSA 3AH7A 1A70A 1N63A 2Y5CA 3DWMA 1QOBA 3PO0A 4JWUC 4C80A 3AMZA 2PIAA 3AEDB 5EE0A 4A9AA 3AE8B 2WQYB 1FIQA 1J7AA 3P63A 2H88B 1EWYC 2CJOA 2MH7A 3ABVB 1XLQA 2BS2B 2N0SB 2WU5B 1FM0D 3DWGC 1UWMA 3P4QB 1VDVA 3NRZA 2E3TA 3AE7B 1ROEA 1V97A 2W55A 3ETRA 3LXFA 4HRSA 4ZOHC 3KWLA 2MJ3A 1NENB 4FXCA 1JROA 1F0ZA 5C3JB 1PUTA 2WP9B 3B2GA 2FBWB 2BS4B 2CJNA 1WRIA 1OFFA 3VR8B 1RM6C 2CU3A 2L83A 4WWMA 4US8A 1TKEA 3AE9B 1FO4A 2H89B 1E9MA 3NVYA 4C7ZA 3CF4A 4YSZB 4LTUA 1FXAA 3B9JA 1QOAA 3AEAB 2DBYA 3FAHA 3NVWA 4JWSC 1L5PA 2PKOA 4YTMB 4JX1C 4YT0B 1YJJA 1XLPA 3AE1B 1KFYB 2DWQA 1NYRA 2G1EA 5G5HA 1QOFA 3AEGB 2K22A 1XO3A 1ZUD2 1ZXIA 3HUIA 1GPXA 2K9XA 3AECB 3CIRB 5GXGB 3WCQA 3P4RB 1AYFA 1SB3C 2AX5A 1CZPA 2M56B 3AB5A 3NS1A 2LEKA 1DOXA 3AEEB 1RYJA 3AE6B 1H7XA 1GTEA 2M19A 1DOYA 1NEKB 1FFVA 1L6VA 1NVID 1I7HA 1NYQA 1V8CA 5C2TB 3SFDB 2WDQB 1KF6B 1TYGB 1OQRA 1XLNA 1JRPA 3HVZA 2MJEA 4N6EB 1QOGA 5AUKA 1JALA 2B76B 3BIID 4HROA 1KRHA 3AE4B 4WQMA 1GTHA 1DOIA 3NVZA 3VR9B 2Q5WD 1WGKA 2KMMA 1IUEA 1YJIA 2L52A 3W9CB 3FC4A 2PVGC 2MJDA 3AE5B 3VRAB 2WS3B 3AM9A 3P1MA 4KX6B 2OHFA 1T3QA 5EE3A 3RPFC 3W5VB 1H7WA 1R7SA 5EE1A 1N5WA 2KAJA 3HRDD 1L0VB 1ZOYB 1AWDA 5G5GA 1TJEA 3P4PB 3AE2B 1N5XA 3LB8C 1GAQB 2ACZB 1FFUA 3NVVA 4ITKA 2W3RA 4ZHOA 4YSYB 1FXIA 2PVOD 2WLBA 1J7CA 4US9A 2WDVB 1OQQA 1WXQA 5MPOA 1E0ZA 1FRRA 2WDRB 1TKYA 1QT9A 4C7YA 4YXDB 4N59A 1N61A 1WWTA 2WU2B 1PDXA 3CWIA 1SF0A 1ZP0B 2HTME 1RFKA 5AUIA 3P4SB 1L6UA 2QJLA 5H8YE 3AEBB 2JX5A 2QIEB 1YQ3B 1WYGA 1FMAD 3AV8A 1FRDA 1VJKA 2W54A 1SIJA 3L4PA 4N58A 3SFEB 1PFDA 3ZYYX 3W5UB 3AEFB 1JW9D 4YTPB 1E10A 2BT6A 3AE3B 2JQRB
chains in the Genus database with same CATH superfamily
2KWUB 3HVDA 2KO3A 1S3SG 4E3CA 4ZRQA 2EKIA 2GBKA 4MDKE 4W9LA 1T0SC 4MH8A 3V60A 4ACFA 2L3ZA 4RM8A 4B95A 1P1AA 4C80A 2PIAA 4FHJA 3VAWA 3UQAA 2BS2B 2M1MA 4WQMA 3BVZA 3KWLA 1JMLA 4CYEA 3H6NA 1SE3A 1UNSA 3H7PA 1UH6A 4K3BA 4EUTA 2MRPA 2N1VA 4YSZB 2M8SA 2IBIB 2QHOA 4OZAA 4HPMB 2KTFA 4FN2A 5JHBA 4F7ZA 1WJUA 4REZA 1DOYA 1NEKB 3N1ZC 1WX8A 4LJPB 4KIKA 2LGDA 3WAPA 5IOIA 4AUQC 4RGTA 2GRIA 3VR9B 4PT5A 3U4EG 2QCZA 2MLBA 4YL8A 3VH3B 3VRAB 3DBRB 1ZW7A 2JXTA 2MW5A 2LJIA 5HHDG 1WGRA 2L76A 3ML9A 4DXAB 4KKIA 4WURA 2WWZA 1QZEA 2IY0B 1UBIA 1E0ZA 3OLMD 1R4NI 2WDRB 2VH2A 1WJ4A 4GDKA 1SF0A 1RRBA 1WYGA 3C8YA 3BINA 4YWGG 4FADA 1SIJA 3QA8A 2BT6A 3ZXVA 1N62A 1PGBA 5J18A 2N7EA 3I5JC 1V81A 3UGBB 2A5UA 3VTVA 2KJHB 1SIFA 1MPEA 1XLOA 2PE6B 2WXNA 4WJNA 4NPNA 1WSPA 1IBXA 3A9JA 2BTEA 3MC0B 2V9HA 3RMKC 3RFZB 5E6JA 2IZVB 3ONSA 1V6EA 3GZNB 2E3TA 1KOTA 1NI2A 2CHZA 4IWPA 5D94A 4A20A 2DAJA 2JVCA 2WX1A 4NAMA 3A9KB 2KLCA 1E9MA 1HZ6A 4JWSC 3ZDTA 2MP2A 4M01A 3KUCB 5FKAC 3T3OA 1PGXA 5BMGA 2K9XA 3Q8EA 1GC6A 4IM3A 1FFVA 2KOXA 2YEPB 3L10B 1V8CA 2GB1A 5C2TB 2AQ3B 1WRDB 1QILA 1SE4A 5C1ZA 5AZGA 4RF0A 1SGHA 1YN5A 3A4SC 2JZPA 2D07B 4M00A 1P98A 4KV2A 2RMMA 2NPTB 1BXTA 3RPFC 3W5VB 2LGXA 4OZBA 1X1MA 2J7QB 3AE2B 3H1UA 3QHTA 2LRUA 2UU7A 2I1KA 4ZHOA 4YSYB 3NZSA 1VRAB 2GLSA 1TKYA 2KANA 1Q10A 1WJ6A 3NZUA 3VHTC 5HFYA 4BKGA 2K25A 1TT5B 2ZPYA 4HCNB 3PT2B 4MT5A 4W9HA 1MFWA 2KNBA 4F1SA 1I4HA 3CSFA 5IA7A 3CF6E 4S0RA 1QLBB 2N4FA 1SE9A 3N32A 2RD0A 2ZVNA 3DHGC 1YQ4B 4OVZA 2HE7A 3BVGA 2KX0A 2MBHA 2WQYB 1M4VA 4HJKA 1FNVA 3TUOA 3ZTCA 1EWYC 3RT3B 1XLQA 2IO1B 4A55A 3QWZB 2L00B 2TSSA 4JQWC 2D10A 4OVVA 2MBBB 1PQSA 1BT0A 4TMAB 2KWVB 2BS4B 4KDIC 2RR9A 3ECIA 4OVUA 1LM8B 4EEWA 4MM3A 3W2DA 1L4DB 2DWQA 1GUAB 3HK0A 3WANA 1ZUD2 3HUIA 2DYBA 1L7YA 3ZO5B 4BZAA 3WCQA 2M56B 4KKJA 3DHHC 3ZDMC 3ZRFA 1Z5SB 2MCNB 3DHIC 1NYQA 4GGQA 2INPE 2WXQA 2Y5PA 4L1BA 4GDLB 3I9V1 1OQRA 1WGGA 1JRPA 4LK0M 2B76B 2Q5WD 2L52A 3DBLB 3NOBA 4NQKE 2HDEA 2OHFA 3DVGY 4MH0E 1EO6A 3PS6A 4IM0A 3HHMA 5IKCM 1IGCA 3PPAA 2VZKB 2JU6X 4PS7A 4JIOU 1V1PA 2ZW1A 4NJ6A 3ZLZA 3ALBA 5JXVA 1OQQA 5MPOA 1LXDA 1ZE3D 3WA0A 2HTHA 2WXPA 3RCZA 2DHZA 2JX5A 2ZNVC 2ZPNA 3SFEB 2CHWA 2GBJA 1S1QB 1NDDA 1FNWA 1MG8A 2GBMA 4LJOB 2O2VB 3VRBB 4YTNB 4DHJB 1WX7A 1NI3A 3A1QA 1N63A 3A9KA 3AEDB 4DDGD 2BBCA 5DPWA 2QDFA 4RCOA 4AS1A 4EKUA 2MJ3A 4WQOB 4FXCA 1D6EC 1TS4A 4ANUA 5LNK1 1I4GA 1WRIA 4GLSC 4HDOA 2AQ1B 4WWMA 3NVYA 3OJ4B 3MC9A 2J0MA 4OW0A 2Z8LA 1C79A 4LDTD 4HXDA 4YTMB 3FKYA 1F1HA 2IJ0A 3WALA 1XLPA 2EKEC 1YMHE 2LD9A 4IKGA 3LJ3A 3B08A 3UF8A 2V1YA 2NPTA 1VD2A 1DOXA 3MHSD 2INDC 2KD0A 1SXTA 2N7JA 2SAKA 2GBRA 1XLNA 2MJEA 3EFCA 3Q3OC 5LLIA 3VH4B 3AE4B 1GTHA 5JZEB 1DOIA 4I6LB 3BWUD 3FC4A 3PSEB 3AE5B 2XBBC 2FIFA 3L16A 1TS5A 1TS3A 3H7PB 5G5GA 3W1SA 1L0XB 1C77A 3Q3JA 3MP9A 3U30A 4NAWA 2V4LA 4WAFA 1H8CA 1QT9A 4GN1A 1N61A 4P16A 2D3BA 3N20C 2DZJA 2ICIA 1EUVB 2J0JA 2RSUA 2KLGA 4C4VB 3DBRI 5IN7A 3AEFB 3TCAA 2FUG1 3Q3FA 1YN4A 1CJEA 2IPKD 2OOBB 2JT4B 4TSSA 1WXAA 2BS3B 3V62A 3B2FA 3BVMA 4W9FA 2ZNVB 4GB9A 1YX6B 2BB6A 4NQLB 2YEPF 3TEYA 4JE3B 2KDFB 1KTKA 2O6VB 4D2KA 2LRWA 4HKZE 4BOSC 2HJ8A 4XGAB 2KFKB 4HRSA 2D3AA 5DPTA 2NBWB 1V49A 1V1OA 2XN9C 2CJNA 1OFFA 4KZ0A 1V86A 2KDMA 4IG7B 1MG4A 1YN3A 2D11A 1QOAA 4GDLA 2QC8A 2EMTA 2YVCA 2PJHA 4BFRA 1WF9A 4M0WB 1TY0A 3GZNI 2M0XA 1WY8A 3B0AA 3AU4A 2PLPA 2LXAA 4MSQB 3I3TB 3SHQA 2WXLA 5AUKA 1L4ZB 1Q1OA 3P2BA 1EF5A 3PVLA 1D5MC 2KKCA 3NVZA 1KH0A 1AARA 1UD7A 3RI7C 4IWQA 2MEKA 2WS3B 1FEHA 1UGJA 4KSLC 3ZJUA 1IPGA 1WE7A 5BYQA 4IOIE 3LB8C 5GMVA 1HTOA 2D3GA 3JVZX 2O2VA 2WXOA 3X23A 1F2RI 1KLVA 2IO0B 2LUEA 4NNJB 1XD3B 1D5ZC 2DYMA 5D7GA 1VLBA 4NY0A 4IDIA 2ASQA 2JUOA 3VTUA 2BWES 1K53A 2HJ1A 2KFJA 5C23A 1MHXA 1EU3A 4USAA 5BMIA 1YD8U 3C0RB 3ZKJC 1JWMD 2LGYA 1XQQA 3QARA 3P63A 4WJOA 3R2TA 2N0SB 2M0AA 2W55A 3M63B 4ICUA 4W9DA 4KDLB 2L05A 2K8BA 4Q2JA 3DVGX 2RDBC 3TMPB 1V9JA 3PHXB 1T0RC 4FJVB 1V5TA 4LTUA 3NVWA 3RYTA 1STEA 3HM6X 3TEXA 4XYCA 2BF8B 3AE1B 5G55A 2NVUI 4B0EA 4EZLA 2WHIA 1F52A 3P4RB 1ESFA 3L13A 2LEKA 3LYYA 2M19A 1GTEA 4MGZE 2D3CA 1UWXA 2K3UA 3V05A 2PTLA 4K3CA 1V80A 3HVZA 2N9LA 1D3ZA 2WNMA 2B3AA 3RZFA 4URKA 2ZJDA 4JPSA 4X57B 5JHAA 5LXIB 4QAYA 1I4RA 2LASA 3P1MA 1T3QA 1H7WA 1K52A 4C4VA 1F2RC 2CHXA 4EOYA 3AI5A 1GAQB 4IW0A 3I63C 1WFYA 2CKHB 1P7FA 1TS2A 2W3RA 1ZXHA 2C7HA 3CMMB 4MM3B 1J7CA 2DZIA 3GE3C 1GNUA 3H9DA 1G6JA 4AJWA 4BBNC 2BYEA 3DBLI 5D2MB 1UUPA 3KLSX 3P42A 2O6VA 2ZZPB 1GT8A 2JPHA 1E5WA 3ENEA 4FLHA 1E6EB 2C7MB 2KFKA 3W1SC 2K5PA 3C19A 3E9SA 3QQ8B 4HWIB 2Y5CA 3PO0A 3R66C 3ZUNA 3NHEB 4IUMB 2KC2A 2MH7A 2BWFA 3URYA 1Y8RC 3AE7B 1V1PB 2GBNA 4M0WA 3V6CB 4GMVA 1F0ZA 3MFGA 1KLUD 1FO4A 1WX9A 2J4XA 2FE8A 4ZRIA 1E7VA 3TEWA 1YJJA 2V4IB 1OEYJ 1XO3A 2N9KA 1WM2A 2KQ7A 1WGDA 1SB3C 3RNCC 3ZNGC 4DHJD 2WXMA 1P0RA 3H7SA 3A1QB 2KQ4X 3LDZE 1WYWB 2WDQB 4HEA1 4N6EB 3O13A 2FCSA 2PVGC 3E56A 1B1ZA 2FCNA 1ZDVA 4M8NA 4L23A 1AWDA 2KMCA 1R4MI 4A3OA 3BK1A 3ZVVA 3TEZA 3TBLD 5J2RA 2K0PA 1WWTA 5J17A 2WU2B 1SSNA 1HZ5A 3AV8A 3FILA 1VJKA 4LCDE 4LNNA 2KT7A 4AP4C 3ZNID 1LQBA 2PW9A 1XT9B 1TIFA 4RGMA 3APDA 1N60A 4A3PA 5H92C 1B9RA 1J0GA 1TBEA 2LVPA 1WR1A 5CX3A 4A9AA 2K6DB 1LFDA 4AWJA 2MQJA 1VDVA 2I1JA 3IFWB 2WXKA 4NAWB 1YQBA 2I2YA 1ZDXA 3N3KB 2KQSA 3GS2A 4ZYNA 1EU4A 3PLVA 1UELA 1T5XD 2LVOA 3EECA 1OTRB 1WXVA 1NYRA 3M62B 2GMIC 4MSMB 1GG3A 3EC8A 3AE6B 1C4CA 4MEMA 4WJQA 4BKSA 1QOGA 2KHWB 2O6VD 1JRUA 3DBHB 4NJCA 2LVQA 1T0QC 1LO5D 1Y56A 4RM9A 2INNE 1JCKB 2DLBA 2FCMA 2ZCBA 1C9FA 5AZHA 1TJEA 2ACZB 1OQYA 2OJWA 3EHVA 2KDEB 2IGHA 4W9IA 3KW5B 1GB4A 5H8YE 3JW0X 4XC2A 1P9DU 2W54A 1WI0A 1ZPSA 4YTPB 2XNAC 1WZ0A 3AE3B 2NMQA 2R2OA 4J3OD 1GC7A 2BKFA 2IO2B 3TIXA 1EWCA 3SR6A 4R3DA 2JZZA 2N9XA 1A70A 1E8WA 1M94A 2JZ3B 3ABVB 1FM0D 3NRZA 2R2QA 4G11A 1NENB 2ONQA 4XZ4A 1OEYA 5L83A 2L0TA 1SE2A 4FULA 2H89B 1GB1A 3CF4A 1QQRA 1IYFA 5BMHA 1MHHE 1FXAA 2MBQA 3QK0A 1ACCA 1MI0A 5JH5C 3RNAC 2XK5B 3APCA 5GXGB 3CIRB 4DXFA 1L6VA 2NR2A 1QKZA 1WJNA 3NZ3A 4FA6A 3DDCB 4K81A 1V5OA 2JSVX 3NG0A 1KRHA 1GJZA 2J53A 2KMMA 3VQIA 3B1LX 4WWPA 4W9CA 1R7SA 3Q6BA 3J9CA 1VZ7A 2FAZA 3PRZA 1A5RA 1D4BA 3RNGC 3HM3A 3BY4B 3TSSA 4RGOS 3JSVB 3SDLC 5HG2A 3RULA 1FFUA 3PZDA 1SBBB 1R4MB 4GU2A 1Q5WB 3IT4B 3MJ5A 1WXQA 3QC8B 1ET9A 3RUIB 1RFKA 2QJLA 3U7DA 2V3PA 2LFIA 4GOCA 3HIZA 4WWNA 4FJYA 4G50A 3V3XA 2JRIB 1IGDA 4JLCA 4JGHB 2JQRB 2ZW0A 4A90A 2JWUA 3EGRA 4FHKA 1JQ4A 4IWOA 1RLFA 2KMAA 4PYUA 2X38A 4M02A 1XEEA 1BMLC 3L17A 1PGAA 2MBEA 2WXFA 5EE0A 4MELA 1XF5L 4KGSA 4EFOA 1FIQA 1WGYA 2CR5A 2HD5B 1TGZB 1XXGA 2JRHA 3R8BA 1FD6A 5IAAC 1CQVA 4ZOHC 2LZ6A 4LNKA 2WP9B 4OHJA 3TJPA 4CO7A 2J52A 1TKEA 3KUDB 3NS8A 3AEAB 1CK1A 2KN5A 2NS5A 2LHDA 4FJZA 4HLEA 2AX5A 2PMVA 1F77A 4WIPA 3A4RA 1OGWA 1H7XA 5EDSA 3OJ3A 4XX5A 4OZCA 4E71A 4BBNF 3U7ZA 3IAS1 2KACA 4DBGA 3IG3A 2N9EB 5DPRA 3SEBA 5EE1A 2MHJA 1I4QA 2BB5A 2C5LC 3P4PB 3H8HA 2LI5A 3EA6A 4ITKA 2JYEA 4E74A 2WLBA 3GE8C 2W9NA 2K39A 2PPHA 4L2YA 2JYTA 1WXSA 3N1YC 2Z0EB 2JF5A 2QIEB 4S17A 1YQ3B 2DZKA 2IDYA 2LGIA 3V61A 3W5UB 3SU8X 1AW7A 5KHQA 2QILA 2LJ5A 2Z59B 1CMXB 1QF6A 4H2AA 4P6VF 4UDUC 3IVFA 1RWSA 3DWMA 2GOWA 3V6EB 4JWUC 4LNOA 3AE8B 1UGMA 3DOWA 2L7RA 3DQVA 4DDID 2N9PC 4RNAA 2WU5B 3Q14C 1UBQA 1ROEA 3NY5A 1ZKHA 4HKQA 5C3JB 2XK5A 2UWQA 1UF0A 2AQ2B 5LXHA 1C4PA 1YNTE 2C9WB 2WXJA 2KZRA 3R2IA 2QSDA 3FILB 3UI3A 4JX1C 5D6JB 2G1EA 2GI9A 1VR9A 4RF1A 3AECB 2I38A 3AEEB 1ZGUB 2IY1B 1HQRD 2BYVE 4ZDVA 1E8ZA 4LNFA 2DNFA 4DQOC 1KF6B 3QCAA 3JSVA 1JALA 1Z2MA 4HROA 3UIOB 3Q3NC 3W9CB 1UZXB 4LDTB 1N5WA 1ZOYB 3ZW3A 5BYSA 3RN9C 3QX1A 2PVOD 2KWDA 2PE9A 3DBHI 1FRRA 2RPQA 4MGKE 1KLGD 4HJGE 3I57A 1EF1A 4XDDA 2IGDA 2V3NA 1PFDA 2WXRA 4W9KA 3MHZA 2RPVA 1T0YA 2QMTA 2DAFA 1WE6A 1C1YB 3GOEA 5E6OA 4YSXB 3AU5A 2ZVOA 5DCNA 3T8MA 4P7IA 1FCCC 2KDBA 2NTSA 1BUIC 3EUB2 1JWAD 2BGFA 4ZHPA 1YJ1A 1IP9A 3AH7A 5IO9A 4KGTA 3AMZA 1MVKA 4PS8A 5D3IB 4MACA 1XCQL 4HK2A 3ZNZB 3APFA 4HPLB 3DWGC 3N9YC 3U52E 3NJTA 4DK5A 3KQ4A 5KHOA 3IT6B 2ZCCA 5BO4B 3D32A 3ZNHB 2NCNA 4US8A 3VR8B 1NBFC 4TQ1A 4HDQA 4O1NA 4PS3A 4RGNA 3WAOA 1N6ZA 2FIDA 3VDZA 3AEGB 2OJRA 3DVNU 2VZKD 2WXGA 5D3DA 3NS1A 3PRPB 4ZRKA 3SFDB 4WWOA 1TYGB 4XDCA 5CHFA 3VUWA 2CU1A 2WX0A 2G45B 1IUEA 5AZFA 5DPSA 4ZRPA 4MJSB 4PYZA 2JY6A 5EE3A 4II2B 5CHVC 1WIAA 1H4RA 4ASWC 3VTWA 2KDIA 4B9KA 2NBUA 4I6NB 3KYDD 4K1RB 2UYZB 2WXIA 4XWWA 4ZYSA 1JWUD 3R3MA 4KSKC 4YXDB 2MX2A 1PDXA 2BYTA 2HTME 1ZP0B 1AN8A 2YLMA 1L6UA 3BYYB 1WM3A 1FRDA 2SEBD 3ZYYX 2L0FA 3IBEA 1DGJA 3A33B 4ARCA 3AN1A 2IGGA 3DVNV 4IC7B 2C7NB 1HA5A 3PTFC 5BYRA 5FR3A 3PRMB 3SD5A 2G4SA 1E8XA 1K50A 3MC8A 4TKNA 1WZ3A 3N1XC 2K1FA 4DHZE 2CS4A 2QEJC 3KVFB 2MWSB 2L8JA 5E6PA 1VZ8A 1U4AA 4EE2A 5TR5A 2C60A 2KTRB 4MGYE 2E6XA 3Q2AC 4C00A 2CU3A 4CQNA 1RM6C 4K7WA 2KYWA 2KN4A 2RDGA 4WAAA 2DBYA 2K8HA 4AQ7A 2PEAA 3GB1A 5FK9C 3U2SC 1C76A 4N9F4 2KVRA 2VH1A 5CHWA 4GXBA 1P3QU 2LUMA 2RDHA 3M95A 4ANXA 2Z0DB 1HTQA 1WMHB 2BW2A 1RFAA 5HKHA 2G4DB 1YJIA 3M3JA 3X0WA 2MJDA 4ANWA 3O65B 3ZXRA 1TY2A 4KX6B 2JXXA 3VFKA 1L0VB 3VXWA 1TZOA 2KJRA 2AYOB 2M17A 2AEHA 2ZEQA 1I4XA 1HXYD 2D2QA 4II3B 1L0YB 3RNBC 4I6PA 2WGSA 1SJED 5E6NA 1J19A 3BZDB 3AEBB 2W82A 3ZIMA 4A8XC 4B0MA 2BPSA 3L4PA 2MSED 2LHEA 4BOZB 1E10A 1FCLA 2IYDB 2M4NA 3U8ZA 2D5GA 1DYQA 1I35A 4G0NB 3N30A 3R7RA 2AL6A 3Q8FA 5G2NA 2BVCA 4HPPA 3W1YA 1WR6E 2OEDA 1P7EA 2MBOA 3LXFA 2KVZA 1JROA 1HE8A 4RH6A 3AE9B 2DYOA 5T8IA 2Y5BB 4DHZB 3QAQA 1L5PA 1JWSD 4W9JA 2V3SA 2EELA 1XCTL 3OG5A 1GPXA 1WH3A 3PZ8A 4BVUC 4DWFA 4IM2A 1C78A 1HEZE 4K7UA 4MJSA 3L54A 3TL5A 3NUHB 2IO3B 3WIMA 1R4NB 1SJHD 3CSTA 3Q69A 3PGEA 1Q0WB 4KZCA 3OWEB 2NBVB 2KC1A 4TUUA 3IHPC 4ARIA 3JYUA 1FPYA 4AOFA 4NJ7A 2WXHA 1WXMA 4ICVA 2JWZA 5L95C 3Q8AA 2Y3AA 4EZJA 3AXCA 2FNJB 2XEWA 2WDTB 4C7YA 2X8XX 3R7QA 5CTRC 3CWIA 5AUIA 3VVWB 3P4SB 5I4DA 4HVBA 1I42A 1FMAD 2KWCA 4P1BC 4N58A 1E7UA 2V0GA 1MJDA 1LGRA 2WYQA 1YX5B 4BKTA 4PK1A 4A6QA 4B6WA 3T3NA 2J42A 1TTNA 1JWBD 1J7BA 3AULA 1ENFA 3DPDA 5FR6A 2KTRA 5EE9A 1TKGA 3RNFC 1J7AA 2BKRB 1WGHA 2R61A 3KWVA 3ETRA 3ZRCA 2AL3A 2FBWB 3KH0A 1YOVB 2BYFA 4WJPA 4C7ZA 1KM7A 2DENB 2DX5B 2MA9B 4YT0B 2AWTA 1WMHA 5G5HA 1KFYB 3L08A 1V2YA 3OAWA 2G3QB 2LGSA 4K7SA 3KUZA 4BKSD 1AYFA 4KVGB 3AB5A 1FNUA 4G3XB 1C3TA 2EMSA 4GSWA 1VCBA 3T9LA 3DBSA 3EFUA 1I7HA 2RGFA 5TSSA 1F9JA 4W9EA 1K51A 3BIID 1C4AA 3IAM1 1WGKA 2ON8A 1D5XC 2L1AA 4FBJB 5HI1A 4LNIA 3UIPB 4KIKB 3L0WB 3PV1A 1N5XA 1RAXA 5IP4D 4CHKA 3NVVA 2KXJA 3Q3MC 1I4PA 2A4ZA 2KK8A 2WDVB 1TZ1A 1KJTA 1T6BX 3ZJVA 4N59A 1K8RB 4F8CB 4GIVA 3S2AA 3DCGA 4W9GA 2K8CA 3ZQ4A 2N1WA 1JW9D 2REXA 4XWTA 1GOZA 4MGIE 3UINB 2VRRB 1ISNA 1E7PB 1VZ6A 2DZMA 3UQBA 2G9HD 3RNEC 3MTNB 4GDKB 2W3SA 3PHWB 2FCQA 3Q8BA 1QOBA 3K9PB 4TQ0A 3MJWA 2KJ6A 3KYCD 2H88B 2CJOA 1J8CA 1UWMA 3P4QB 1ET6A 4RFBA 1V97A 4M8MA 3ZTDA 3QJZA 4KGRA 1PUTA 3B2GA 2L83A 4P1CC 1IBXB 4J6IA 4C56C 1EM7A 3A9JB 1E90A 1E8YA 3QIJA 3FAHA 3B9JA 4EZKA 2PKOA 4HCPB 1QOFA 4ANVA 2K22A 1ZXIA 1PYWD 3PLUA 3ML8A 5AEKB 2LWPA 3BK2A 2KX3A 1CZPA 1RYJA 4NZLB 3K9OB 1NVID 2L32A 2FUHB 4WH4A 2LXCA 3BYTB 4ZRJA 2MP2B 2J0KA 1FXTB 1SEBD 3PZ7A 3RD2A 4DXGA 3AM9A 2NTTA 3Q8CA 3PREA 3VUYA 2KAJA 3VUXA 3HRDD 3WAMA 2LMCA 2K6QA 4LLGM 3ZGZA 1FXIA 3IXSA 4AJYB 4US9A 4TV3A 2N7DA 1L2NA 3GP7A 3ZJTA 4JL9A 4BAXA 1YIWA 4RMAA 3RZWC 2BQQA 2INCC 4XE0A
chains in the Genus database with same CATH topology
1DGJA 2NMQA 4ARCA 4J3OD 1CJEA 3AN1A 2IGGA 3HVDA 2IPKD 4ZRQA 2EKIA 1HA5A 4TSSA 2BS3B 1EWCA 3SR6A 5BYRA 3B2FA 3BVMA 4MH8A 5FR3A 4R3DA 2BB6A 2YEPF 1A70A 3TEYA 4C80A 1K50A 2PIAA 4JE3B 1KTKA 4D2KA 4HKZE 3ABVB 2QEJC 2BS2B 1FM0D 3NRZA 4WQMA 3BVZA 4HRSA 3KWLA 1VZ8A 1NENB 4EE2A 1JMLA 1SE3A 1UNSA 2ONQA 1V1OA 2XN9C 2CJNA 1SE2A 2E6XA 2CU3A 1OFFA 4CQNA 1RM6C 2KDMA 2H89B 1YN3A 1GB1A 3CF4A 1QQRA 5BMHA 2KN4A 4YSZB 1MHHE 2RDGA 1FXAA 1QOAA 2DBYA 1ACCA 4AQ7A 1MI0A 4OZAA 1TY0A 3GB1A 5FK9C 3U2SC 1C76A 5GXGB 3CIRB 4REZA 1DOYA 2PLPA 1NEKB 4DXFA 1L6VA 2LUMA 1QKZA 2RDHA 2WXLA 3NZ3A 5AUKA 1L4ZB 2JSVX 2BW2A 1KRHA 1D5MC 2J53A 4RGTA 2GRIA 3NVZA 3VR9B 1KH0A 4PT5A 2KMMA 1YJIA 3U4EG 3VQIA 2MEKA 2MJDA 3VRAB 2WS3B 1TY2A 4KX6B 1FEHA 1UGJA 3ZJUA 1R7SA 2JXTA 3J9CA 1VZ7A 2LJIA 5HHDG 5BYQA 1L0VB 1TZOA 1D4BA 4KKIA 4IOIE 3TSSA 3LB8C 4RGOS 4WURA 5HG2A 1FFUA 1SBBB 3IT4B 1I4XA 1HXYD 1WXQA 3MJ5A 1E0ZA 2WXOA 2WDRB 1ET9A 1L0YB 1SF0A 1RFKA 1SJED 1F2RI 3BZDB 2QJLA 3AEBB 1WYGA 2LFIA 2V3PA 2W82A 3C8YA 4YWGG 4A8XC 4B0MA 1SIJA 3L4PA 3V3XA 1IGDA 2LHEA 1E10A 2BT6A 1D5ZC 1N62A 2JQRB 1PGBA 2DYMA 2ZW0A 1VLBA 5D7GA 4IDIA 4A90A 2D5GA 2JWUA 3EGRA 1DYQA 1K53A 1JQ4A 2X38A 1MHXA 1EU3A 1XLOA 1MPEA 3Q8FA 4USAA 2WXNA 5BMIA 1XEEA 1BMLC 1PGAA 1WSPA 1IBXA 1JWMD 2WXFA 2BTEA 5EE0A 3MC0B 1XF5L 4KGSA 3RFZB 1FIQA 5E6JA 2OEDA 1P7EA 3P63A 3R2TA 1XXGA 2N0SB 2M0AA 3R8BA 1FD6A 2E3TA 1CQVA 2W55A 3LXFA 4ZOHC 1JROA 2WP9B 4OHJA 4Q2JA 4NAMA 4RH6A 2J52A 1TKEA 3AE9B 1E9MA 1HZ6A 2DYOA 5T8IA 4LTUA 1FCLA 3AEAB 4JWSC 3NVWA 1L5PA 1JWSD 1CK1A 1STEA 5FKAC 3TEXA 3T3OA 3AE1B 2EELA 2LHDA 1XCTL 4B0EA 1GPXA 1PGXA 5BMGA 2K9XA 3PZ8A 1C78A 3P4RB 2AX5A 1HEZE 2PMVA 1ESFA 1F77A 3Q8EA 2LEKA 3LYYA 4WIPA 2M19A 1H7XA 1GTEA 1FFVA 2YEPB 1V8CA 2GB1A 5C2TB 2AQ3B 3NUHB 1QILA 1SE4A 1UWXA 2K3UA 3V05A 2PTLA 4RF0A 4OZCA 3HVZA 1YN5A 2N9LA 2WNMA 2JZPA 1SJHD 4JPSA 3U7ZA 3Q69A 1I4RA 2RMMA 1BXTA 3IAS1 2KACA 3P1MA 1T3QA 3RPFC 3W5VB 1H7WA 3OWEB 3SEBA 5EE1A 1K52A 1I4QA 4OZBA 4ARIA 1F2RC 2BB5A 2WXHA 3P4PB 3AE2B 3H8HA 1GAQB 3EA6A 1P7FA 4ITKA 1TS2A 2W3RA 1ZXHA 2Y3AA 2JYEA 3Q8AA 4ZHOA 4YSYB 2WLBA 4MM3B 1J7CA 1VRAB 4L2YA 2JYTA 1TKYA 4C7YA 3CWIA 1Q10A 5AUIA 3P4SB 5I4DA 2QIEB 5HFYA 1YQ3B 1FMAD 1UUPA 2IDYA 4N58A 3KLSX 2LGIA 3P42A 3W5UB 2V0GA 4MT5A 4A6QA 1AW7A 1GT8A 2QILA 3T3NA 2J42A 1I4HA 1E6EB 1JWBD 1J7BA 1QF6A 4H2AA 1QLBB 1ENFA 4P6VF 4UDUC 5EE9A 2K5PA 1TKGA 1YQ4B 4OVZA 3E9SA 1RWSA 3DWMA 2Y5CA 3BVGA 3PO0A 4JWUC 3AE8B 2WQYB 1M4VA 1FNVA 1J7AA 3TUOA 1EWYC 2MH7A 1XLQA 4RNAA 3URYA 4A55A 2WU5B 2R61A 3AE3B 3KWVA 3AE7B 1ROEA 1V1PB 2TSSA 3ETRA 4M0WA 4HKQA 4TMAB 1F0ZA 5C3JB 3MFGA 1KLUD 2FBWB 2BS4B 2AQ2B 1FO4A 4C7ZA 2J4XA 1C4PA 1YNTE 2FE8A 2WXJA 3R2IA 2QSDA 3FILB 3UI3A 3W2DA 1L4DB 4JX1C 3TEWA 4YT0B 1YJJA 5G5HA 1KFYB 2DWQA 2G1EA 2V4IB 1XO3A 1ZUD2 2N9KA 2GI9A 3HUIA 1VR9A 4RF1A 3AECB 2I38A 3WCQA 1AYFA 1SB3C 3AB5A 2M56B 2WXMA 4KKJA 3AEEB 1FNUA 1HQRD 5TSSA 1I7HA 1NYQA 2INPE 2WXQA 2Y5PA 2KQ4X 2WDQB 4L1BA 4GDLB 4HEA1 4DQOC 3I9V1 1KF6B 4N6EB 1OQRA 3O13A 1JRPA 1K51A 4LK0M 1JALA 2B76B 3BIID 4HROA 1C4AA 3IAM1 2Q5WD 1WGKA 2ON8A 1D5XC 2L52A 3W9CB 2PVGC 3E56A 2HDEA 2OHFA 1B1ZA 1ZDVA 1N5WA 2L1AA 5HI1A 1ZOYB 1AWDA 4L23A 1IGCA 2VZKB 1N5XA 2JU6X 5BYSA 1V1PA 2ZW1A 3BK1A 3NVVA 1I4PA 5JXVA 3TEZA 2PVOD 2KWDA 2WDVB 1OQQA 5MPOA 1ZE3D 1T6BX 1FRRA 2K0PA 3ZJVA 4N59A 2WXPA 1WWTA 1KLGD 2WU2B 4HJGE 1SSNA 2JX5A 1HZ5A 3I57A 3AV8A 4XDDA 3ZQ4A 3FILA 1VJKA 2IGDA 2V3NA 3SFEB 1PFDA 2WXRA 1JW9D 2RPVA 3MHZA 2QMTA 4XWTA 1GOZA 2PW9A 1FNWA 1E7PB 1VZ6A 4RGMA 2G9HD 4YSXB 3VRBB 4YTNB 1FCCC 4GDKB 1N60A 2NTSA 1BUIC 2W3SA 3EUB2 1JWAD 5H92C 1NI3A 4ZHPA 1B9RA 3AH7A 1N63A 3Q8BA 4KGTA 1QOBA 4TQ0A 3AMZA 3AEDB 1MVKA 5D3IB 4A9AA 4MACA 1XCQL 2H88B 2CJOA 2BBCA 3DWGC 1UWMA 3P4QB 1ET6A 1VDVA 3N9YC 4RCOA 4RFBA 1V97A 3U52E 4AS1A 2MJ3A 4FXCA 1D6EC 1TS4A 3KQ4A 4KGRA 1PUTA 2WXKA 3B2GA 3IT6B 4NAWB 5LNK1 2I2YA 1I4GA 1WRIA 4GLSC 3VR8B 1ZDXA 2L83A 2AQ1B 4WWMA 4US8A 1IBXB 4C56C 1EM7A 3NVYA 3GS2A 4TQ1A 4O1NA 1EU4A 4OW0A 3FAHA 3B9JA 2Z8LA 1C79A 2PKOA 4YTMB 4RGNA 1T5XD 2IJ0A 1XLPA 1NYRA 1YMHE 1QOFA 4IKGA 3AEGB 2K22A 1ZXIA 1PYWD 2VZKD 3BK2A 2WXGA 1DOXA 1CZPA 5D3DA 3NS1A 1RYJA 3AE6B 4NZLB 1NVID 2L32A 3SFDB 1SXTA 4WH4A 1C4CA 2N7JA 3BYTB 2SAKA 1TYGB 1XLNA 2MJEA 1QOGA 1SEBD 3AE4B 4NJCA 1GTHA 3PZ7A 1DOIA 4XDCA 1IUEA 1LO5D 3BWUD 3FC4A 4DXGA 1Y56A 3AE5B 2NTTA 3AM9A 4ZRPA 2INNE 1JCKB 2DLBA 3Q8CA 5EE3A 1TS5A 1TS3A 2KAJA 3HRDD 2LMCA 1C9FA 5G5GA 1TJEA 3W1SA 1L0XB 2ACZB 4LLGM 3ZGZA 1C77A 2WXIA 1FXIA 3IXSA 4XWWA 4US9A 3MP9A 4ZYSA 1JWUD 4WAFA 2IGHA 1QT9A 4YXDB 1N61A 1PDXA 4P16A 3GP7A 2HTME 1ZP0B 2BYTA 3ZJTA 1AN8A 2ICIA 1L6UA 1GB4A 3BYYB 5H8YE 1FRDA 2W54A 2SEBD 3ZYYX 3AEFB 1ZPSA 4YTPB 2XNAC 2FUG1 1YN4A 4XE0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DGJ A;  1VLB A;  1GT8 A;  4IDI A;  1N62 A;  1CJE A;  3AN1 A;  1E7P B;  4YSX B;  2EKI A;  1E6E B;  3VRB B;  1JWB D;  1J7B A;  2BS3 B;  1JQ4 A;  4YTN B;  1QF6 A;  3SR6 A;  1QLB B;  1N60 A;  2W3S A;  3B2F A;  3EUB 2;  1JWA D;  4P6V F;  5H92 C;  1NI3 A;  1XLO A;  5EE9 A;  2K5P A;  1TKG A;  1YQ4 B;  4USA A;  4ZHP A;  1B9R A;  1RWS A;  3AH7 A;  1A70 A;  1N63 A;  2Y5C A;  3DWM A;  1QOB A;  3PO0 A;  4JWU C;  4C80 A;  3AMZ A;  2PIA A;  3AED B;  5EE0 A;  4A9A A;  3AE8 B;  2WQY B;  1FIQ A;  1J7A A;  3P63 A;  2H88 B;  1EWY C;  2CJO A;  2MH7 A;  3ABV B;  1XLQ A;  2BS2 B;  2N0S B;  2WU5 B;  1FM0 D;  3DWG C;  1UWM A;  3P4Q B;  1VDV A;  3NRZ A;  2E3T A;  3AE7 B;  1ROE A;  1V97 A;  2W55 A;  3ETR A;  3LXF A;  4HRS A;  4ZOH C;  3KWL A;  2MJ3 A;  1NEN B;  4FXC A;  1JRO A;  1F0Z A;  5C3J B;  1PUT A;  2WP9 B;  3B2G A;  2FBW B;  2BS4 B;  2CJN A;  1WRI A;  1OFF A;  3VR8 B;  1RM6 C;  2CU3 A;  2L83 A;  4WWM A;  4US8 A;  1TKE A;  3AE9 B;  1FO4 A;  2H89 B;  1E9M A;  3NVY A;  4C7Z A;  3CF4 A;  4YSZ B;  4LTU A;  1FXA A;  3B9J A;  1QOA A;  3AEA B;  2DBY A;  3FAH A;  3NVW A;  4JWS C;  1L5P A;  2PKO A;  4YTM B;  4JX1 C;  4YT0 B;  1YJJ A;  1XLP A;  3AE1 B;  1KFY B;  2DWQ A;  1NYR A;  2G1E A;  5G5H A;  1QOF A;  3AEG B;  2K22 A;  1XO3 A;  1ZUD 2;  1ZXI A;  3HUI A;  1GPX A;  2K9X A;  3AEC B;  3CIR B;  5GXG B;  3WCQ A;  3P4R B;  1AYF A;  1SB3 C;  2AX5 A;  1CZP A;  2M56 B;  3AB5 A;  3NS1 A;  2LEK A;  1DOX A;  3AEE B;  1RYJ A;  3AE6 B;  1H7X A;  1GTE A;  2M19 A;  1DOY A;  1NEK B;  1FFV A;  1L6V A;  1NVI D;  1I7H A;  1NYQ A;  1V8C A;  5C2T B;  3SFD B;  2WDQ B;  1KF6 B;  1TYG B;  1OQR A;  1XLN A;  1JRP A;  3HVZ A;  2MJE A;  4N6E B;  1QOG A;  5AUK A;  1JAL A;  2B76 B;  3BII D;  4HRO A;  1KRH A;  3AE4 B;  4WQM A;  1GTH A;  1DOI A;  3NVZ A;  3VR9 B;  2Q5W D;  1WGK A;  2KMM A;  1IUE A;  1YJI A;  2L52 A;  3W9C B;  3FC4 A;  2PVG C;  2MJD A;  3AE5 B;  3VRA B;  2WS3 B;  3AM9 A;  3P1M A;  4KX6 B;  2OHF A;  1T3Q A;  5EE3 A;  3RPF C;  3W5V B;  1H7W A;  1R7S A;  5EE1 A;  1N5W A;  2KAJ A;  3HRD D;  1L0V B;  1ZOY B;  1AWD A;  5G5G A;  1TJE A;  3P4P B;  3AE2 B;  1N5X A;  3LB8 C;  1GAQ B;  2ACZ B;  1FFU A;  3NVV A;  4ITK A;  2W3R A;  4ZHO A;  4YSY B;  1FXI A;  2PVO D;  2WLB A;  1J7C A;  4US9 A;  2WDV B;  1OQQ A;  1WXQ A;  5MPO A;  1E0Z A;  1FRR A;  2WDR B;  1TKY A;  1QT9 A;  4C7Y A;  4YXD B;  4N59 A;  1N61 A;  1WWT A;  2WU2 B;  1PDX A;  3CWI A;  1SF0 A;  1ZP0 B;  2HTM E;  1RFK A;  5AUI A;  3P4S B;  1L6U A;  2QJL A;  5H8Y E;  3AEB B;  2JX5 A;  2QIE B;  1YQ3 B;  1WYG A;  1FMA D;  3AV8 A;  1FRD A;  1VJK A;  2W54 A;  1SIJ A;  3L4P A;  4N58 A;  3SFE B;  1PFD A;  3ZYY X;  3W5U B;  3AEF B;  1JW9 D;  4YTP B;  1E10 A;  2BT6 A;  3AE3 B;  2JQR B; 
#chains in the Genus database with same CATH topology
 2KWU B;  3HVD A;  2KO3 A;  1S3S G;  4E3C A;  4ZRQ A;  2EKI A;  2GBK A;  4MDK E;  4W9L A;  1T0S C;  4MH8 A;  3V60 A;  4ACF A;  2L3Z A;  4RM8 A;  4B95 A;  1P1A A;  4C80 A;  2PIA A;  4FHJ A;  3VAW A;  3UQA A;  2BS2 B;  2M1M A;  4WQM A;  3BVZ A;  3KWL A;  1JML A;  4CYE A;  3H6N A;  1SE3 A;  1UNS A;  3H7P A;  1UH6 A;  4K3B A;  4EUT A;  2MRP A;  2N1V A;  4YSZ B;  2M8S A;  2IBI B;  2QHO A;  4OZA A;  4HPM B;  2KTF A;  4FN2 A;  5JHB A;  4F7Z A;  1WJU A;  4REZ A;  1DOY A;  1NEK B;  3N1Z C;  1WX8 A;  4LJP B;  4KIK A;  2LGD A;  3WAP A;  5IOI A;  4AUQ C;  4RGT A;  2GRI A;  3VR9 B;  4PT5 A;  3U4E G;  2QCZ A;  2MLB A;  4YL8 A;  3VH3 B;  3VRA B;  3DBR B;  1ZW7 A;  2JXT A;  2MW5 A;  2LJI A;  5HHD G;  1WGR A;  2L76 A;  3ML9 A;  4DXA B;  4KKI A;  4WUR A;  2WWZ A;  1QZE A;  2IY0 B;  1UBI A;  1E0Z A;  3OLM D;  1R4N I;  2WDR B;  2VH2 A;  1WJ4 A;  4GDK A;  1SF0 A;  1RRB A;  1WYG A;  3C8Y A;  3BIN A;  4YWG G;  4FAD A;  1SIJ A;  3QA8 A;  2BT6 A;  3ZXV A;  1N62 A;  1PGB A;  5J18 A;  2N7E A;  3I5J C;  1V81 A;  3UGB B;  2A5U A;  3VTV A;  2KJH B;  1SIF A;  1MPE A;  1XLO A;  2PE6 B;  2WXN A;  4WJN A;  4NPN A;  1WSP A;  1IBX A;  3A9J A;  2BTE A;  3MC0 B;  2V9H A;  3RMK C;  3RFZ B;  5E6J A;  2IZV B;  3ONS A;  1V6E A;  3GZN B;  2E3T A;  1KOT A;  1NI2 A;  2CHZ A;  4IWP A;  5D94 A;  4A20 A;  2DAJ A;  2JVC A;  2WX1 A;  4NAM A;  3A9K B;  2KLC A;  1E9M A;  1HZ6 A;  4JWS C;  3ZDT A;  2MP2 A;  4M01 A;  3KUC B;  5FKA C;  3T3O A;  1PGX A;  5BMG A;  2K9X A;  3Q8E A;  1GC6 A;  4IM3 A;  1FFV A;  2KOX A;  2YEP B;  3L10 B;  1V8C A;  2GB1 A;  5C2T B;  2AQ3 B;  1WRD B;  1QIL A;  1SE4 A;  5C1Z A;  5AZG A;  4RF0 A;  1SGH A;  1YN5 A;  3A4S C;  2JZP A;  2D07 B;  4M00 A;  1P98 A;  4KV2 A;  2RMM A;  2NPT B;  1BXT A;  3RPF C;  3W5V B;  2LGX A;  4OZB A;  1X1M A;  2J7Q B;  3AE2 B;  3H1U A;  3QHT A;  2LRU A;  2UU7 A;  2I1K A;  4ZHO A;  4YSY B;  3NZS A;  1VRA B;  2GLS A;  1TKY A;  2KAN A;  1Q10 A;  1WJ6 A;  3NZU A;  3VHT C;  5HFY A;  4BKG A;  2K25 A;  1TT5 B;  2ZPY A;  4HCN B;  3PT2 B;  4MT5 A;  4W9H A;  1MFW A;  2KNB A;  4F1S A;  1I4H A;  3CSF A;  5IA7 A;  3CF6 E;  4S0R A;  1QLB B;  2N4F A;  1SE9 A;  3N32 A;  2RD0 A;  2ZVN A;  3DHG C;  1YQ4 B;  4OVZ A;  2HE7 A;  3BVG A;  2KX0 A;  2MBH A;  2WQY B;  1M4V A;  4HJK A;  1FNV A;  3TUO A;  3ZTC A;  1EWY C;  3RT3 B;  1XLQ A;  2IO1 B;  4A55 A;  3QWZ B;  2L00 B;  2TSS A;  4JQW C;  2D10 A;  4OVV A;  2MBB B;  1PQS A;  1BT0 A;  4TMA B;  2KWV B;  2BS4 B;  4KDI C;  2RR9 A;  3ECI A;  4OVU A;  1LM8 B;  4EEW A;  4MM3 A;  3W2D A;  1L4D B;  2DWQ A;  1GUA B;  3HK0 A;  3WAN A;  1ZUD 2;  3HUI A;  2DYB A;  1L7Y A;  3ZO5 B;  4BZA A;  3WCQ A;  2M56 B;  4KKJ A;  3DHH C;  3ZDM C;  3ZRF A;  1Z5S B;  2MCN B;  3DHI C;  1NYQ A;  4GGQ A;  2INP E;  2WXQ A;  2Y5P A;  4L1B A;  4GDL B;  3I9V 1;  1OQR A;  1WGG A;  1JRP A;  4LK0 M;  2B76 B;  2Q5W D;  2L52 A;  3DBL B;  3NOB A;  4NQK E;  2HDE A;  2OHF A;  3DVG Y;  4MH0 E;  1EO6 A;  3PS6 A;  4IM0 A;  3HHM A;  5IKC M;  1IGC A;  3PPA A;  2VZK B;  2JU6 X;  4PS7 A;  4JIO U;  1V1P A;  2ZW1 A;  4NJ6 A;  3ZLZ A;  3ALB A;  5JXV A;  1OQQ A;  5MPO A;  1LXD A;  1ZE3 D;  3WA0 A;  2HTH A;  2WXP A;  3RCZ A;  2DHZ A;  2JX5 A;  2ZNV C;  2ZPN A;  3SFE B;  2CHW A;  2GBJ A;  1S1Q B;  1NDD A;  1FNW A;  1MG8 A;  2GBM A;  4LJO B;  2O2V B;  3VRB B;  4YTN B;  4DHJ B;  1WX7 A;  1NI3 A;  3A1Q A;  1N63 A;  3A9K A;  3AED B;  4DDG D;  2BBC A;  5DPW A;  2QDF A;  4RCO A;  4AS1 A;  4EKU A;  2MJ3 A;  4WQO B;  4FXC A;  1D6E C;  1TS4 A;  4ANU A;  5LNK 1;  1I4G A;  1WRI A;  4GLS C;  4HDO A;  2AQ1 B;  4WWM A;  3NVY A;  3OJ4 B;  3MC9 A;  2J0M A;  4OW0 A;  2Z8L A;  1C79 A;  4LDT D;  4HXD A;  4YTM B;  3FKY A;  1F1H A;  2IJ0 A;  3WAL A;  1XLP A;  2EKE C;  1YMH E;  2LD9 A;  4IKG A;  3LJ3 A;  3B08 A;  3UF8 A;  2V1Y A;  2NPT A;  1VD2 A;  1DOX A;  3MHS D;  2IND C;  2KD0 A;  1SXT A;  2N7J A;  2SAK A;  2GBR A;  1XLN A;  2MJE A;  3EFC A;  3Q3O C;  5LLI A;  3VH4 B;  3AE4 B;  1GTH A;  5JZE B;  1DOI A;  4I6L B;  3BWU D;  3FC4 A;  3PSE B;  3AE5 B;  2XBB C;  2FIF A;  3L16 A;  1TS5 A;  1TS3 A;  3H7P B;  5G5G A;  3W1S A;  1L0X B;  1C77 A;  3Q3J A;  3MP9 A;  3U30 A;  4NAW A;  2V4L A;  4WAF A;  1H8C A;  1QT9 A;  4GN1 A;  1N61 A;  4P16 A;  2D3B A;  3N20 C;  2DZJ A;  2ICI A;  1EUV B;  2J0J A;  2RSU A;  2KLG A;  4C4V B;  3DBR I;  5IN7 A;  3AEF B;  3TCA A;  2FUG 1;  3Q3F A;  1YN4 A;  1CJE A;  2IPK D;  2OOB B;  2JT4 B;  4TSS A;  1WXA A;  2BS3 B;  3V62 A;  3B2F A;  3BVM A;  4W9F A;  2ZNV B;  4GB9 A;  1YX6 B;  2BB6 A;  4NQL B;  2YEP F;  3TEY A;  4JE3 B;  2KDF B;  1KTK A;  2O6V B;  4D2K A;  2LRW A;  4HKZ E;  4BOS C;  2HJ8 A;  4XGA B;  2KFK B;  4HRS A;  2D3A A;  5DPT A;  2NBW B;  1V49 A;  1V1O A;  2XN9 C;  2CJN A;  1OFF A;  4KZ0 A;  1V86 A;  2KDM A;  4IG7 B;  1MG4 A;  1YN3 A;  2D11 A;  1QOA A;  4GDL A;  2QC8 A;  2EMT A;  2YVC A;  2PJH A;  4BFR A;  1WF9 A;  4M0W B;  1TY0 A;  3GZN I;  2M0X A;  1WY8 A;  3B0A A;  3AU4 A;  2PLP A;  2LXA A;  4MSQ B;  3I3T B;  3SHQ A;  2WXL A;  5AUK A;  1L4Z B;  1Q1O A;  3P2B A;  1EF5 A;  3PVL A;  1D5M C;  2KKC A;  3NVZ A;  1KH0 A;  1AAR A;  1UD7 A;  3RI7 C;  4IWQ A;  2MEK A;  2WS3 B;  1FEH A;  1UGJ A;  4KSL C;  3ZJU A;  1IPG A;  1WE7 A;  5BYQ A;  4IOI E;  3LB8 C;  5GMV A;  1HTO A;  2D3G A;  3JVZ X;  2O2V A;  2WXO A;  3X23 A;  1F2R I;  1KLV A;  2IO0 B;  2LUE A;  4NNJ B;  1XD3 B;  1D5Z C;  2DYM A;  5D7G A;  1VLB A;  4NY0 A;  4IDI A;  2ASQ A;  2JUO A;  3VTU A;  2BWE S;  1K53 A;  2HJ1 A;  2KFJ A;  5C23 A;  1MHX A;  1EU3 A;  4USA A;  5BMI A;  1YD8 U;  3C0R B;  3ZKJ C;  1JWM D;  2LGY A;  1XQQ A;  3QAR A;  3P63 A;  4WJO A;  3R2T A;  2N0S B;  2M0A A;  2W55 A;  3M63 B;  4ICU A;  4W9D A;  4KDL B;  2L05 A;  2K8B A;  4Q2J A;  3DVG X;  2RDB C;  3TMP B;  1V9J A;  3PHX B;  1T0R C;  4FJV B;  1V5T A;  4LTU A;  3NVW A;  3RYT A;  1STE A;  3HM6 X;  3TEX A;  4XYC A;  2BF8 B;  3AE1 B;  5G55 A;  2NVU I;  4B0E A;  4EZL A;  2WHI A;  1F52 A;  3P4R B;  1ESF A;  3L13 A;  2LEK A;  3LYY A;  2M19 A;  1GTE A;  4MGZ E;  2D3C A;  1UWX A;  2K3U A;  3V05 A;  2PTL A;  4K3C A;  1V80 A;  3HVZ A;  2N9L A;  1D3Z A;  2WNM A;  2B3A A;  3RZF A;  4URK A;  2ZJD A;  4JPS A;  4X57 B;  5JHA A;  5LXI B;  4QAY A;  1I4R A;  2LAS A;  3P1M A;  1T3Q A;  1H7W A;  1K52 A;  4C4V A;  1F2R C;  2CHX A;  4EOY A;  3AI5 A;  1GAQ B;  4IW0 A;  3I63 C;  1WFY A;  2CKH B;  1P7F A;  1TS2 A;  2W3R A;  1ZXH A;  2C7H A;  3CMM B;  4MM3 B;  1J7C A;  2DZI A;  3GE3 C;  1GNU A;  3H9D A;  1G6J A;  4AJW A;  4BBN C;  2BYE A;  3DBL I;  5D2M B;  1UUP A;  3KLS X;  3P42 A;  2O6V A;  2ZZP B;  1GT8 A;  2JPH A;  1E5W A;  3ENE A;  4FLH A;  1E6E B;  2C7M B;  2KFK A;  3W1S C;  2K5P A;  3C19 A;  3E9S A;  3QQ8 B;  4HWI B;  2Y5C A;  3PO0 A;  3R66 C;  3ZUN A;  3NHE B;  4IUM B;  2KC2 A;  2MH7 A;  2BWF A;  3URY A;  1Y8R C;  3AE7 B;  1V1P B;  2GBN A;  4M0W A;  3V6C B;  4GMV A;  1F0Z A;  3MFG A;  1KLU D;  1FO4 A;  1WX9 A;  2J4X A;  2FE8 A;  4ZRI A;  1E7V A;  3TEW A;  1YJJ A;  2V4I B;  1OEY J;  1XO3 A;  2N9K A;  1WM2 A;  2KQ7 A;  1WGD A;  1SB3 C;  3RNC C;  3ZNG C;  4DHJ D;  2WXM A;  1P0R A;  3H7S A;  3A1Q B;  2KQ4 X;  3LDZ E;  1WYW B;  2WDQ B;  4HEA 1;  4N6E B;  3O13 A;  2FCS A;  2PVG C;  3E56 A;  1B1Z A;  2FCN A;  1ZDV A;  4M8N A;  4L23 A;  1AWD A;  2KMC A;  1R4M I;  4A3O A;  3BK1 A;  3ZVV A;  3TEZ A;  3TBL D;  5J2R A;  2K0P A;  1WWT A;  5J17 A;  2WU2 B;  1SSN A;  1HZ5 A;  3AV8 A;  3FIL A;  1VJK A;  4LCD E;  4LNN A;  2KT7 A;  4AP4 C;  3ZNI D;  1LQB A;  2PW9 A;  1XT9 B;  1TIF A;  4RGM A;  3APD A;  1N60 A;  4A3P A;  5H92 C;  1B9R A;  1J0G A;  1TBE A;  2LVP A;  1WR1 A;  5CX3 A;  4A9A A;  2K6D B;  1LFD A;  4AWJ A;  2MQJ A;  1VDV A;  2I1J A;  3IFW B;  2WXK A;  4NAW B;  1YQB A;  2I2Y A;  1ZDX A;  3N3K B;  2KQS A;  3GS2 A;  4ZYN A;  1EU4 A;  3PLV A;  1UEL A;  1T5X D;  2LVO A;  3EEC A;  1OTR B;  1WXV A;  1NYR A;  3M62 B;  2GMI C;  4MSM B;  1GG3 A;  3EC8 A;  3AE6 B;  1C4C A;  4MEM A;  4WJQ A;  4BKS A;  1QOG A;  2KHW B;  2O6V D;  1JRU A;  3DBH B;  4NJC A;  2LVQ A;  1T0Q C;  1LO5 D;  1Y56 A;  4RM9 A;  2INN E;  1JCK B;  2DLB A;  2FCM A;  2ZCB A;  1C9F A;  5AZH A;  1TJE A;  2ACZ B;  1OQY A;  2OJW A;  3EHV A;  2KDE B;  2IGH A;  4W9I A;  3KW5 B;  1GB4 A;  5H8Y E;  3JW0 X;  4XC2 A;  1P9D U;  2W54 A;  1WI0 A;  1ZPS A;  4YTP B;  2XNA C;  1WZ0 A;  3AE3 B;  2NMQ A;  2R2O A;  4J3O D;  1GC7 A;  2BKF A;  2IO2 B;  3TIX A;  1EWC A;  3SR6 A;  4R3D A;  2JZZ A;  2N9X A;  1A70 A;  1E8W A;  1M94 A;  2JZ3 B;  3ABV B;  1FM0 D;  3NRZ A;  2R2Q A;  4G11 A;  1NEN B;  2ONQ A;  4XZ4 A;  1OEY A;  5L83 A;  2L0T A;  1SE2 A;  4FUL A;  2H89 B;  1GB1 A;  3CF4 A;  1QQR A;  1IYF A;  5BMH A;  1MHH E;  1FXA A;  2MBQ A;  3QK0 A;  1ACC A;  1MI0 A;  5JH5 C;  3RNA C;  2XK5 B;  3APC A;  5GXG B;  3CIR B;  4DXF A;  1L6V A;  2NR2 A;  1QKZ A;  1WJN A;  3NZ3 A;  4FA6 A;  3DDC B;  4K81 A;  1V5O A;  2JSV X;  3NG0 A;  1KRH A;  1GJZ A;  2J53 A;  2KMM A;  3VQI A;  3B1L X;  4WWP A;  4W9C A;  1R7S A;  3Q6B A;  3J9C A;  1VZ7 A;  2FAZ A;  3PRZ A;  1A5R A;  1D4B A;  3RNG C;  3HM3 A;  3BY4 B;  3TSS A;  4RGO S;  3JSV B;  3SDL C;  5HG2 A;  3RUL A;  1FFU A;  3PZD A;  1SBB B;  1R4M B;  4GU2 A;  1Q5W B;  3IT4 B;  3MJ5 A;  1WXQ A;  3QC8 B;  1ET9 A;  3RUI B;  1RFK A;  2QJL A;  3U7D A;  2V3P A;  2LFI A;  4GOC A;  3HIZ A;  4WWN A;  4FJY A;  4G50 A;  3V3X A;  2JRI B;  1IGD A;  4JLC A;  4JGH B;  2JQR B;  2ZW0 A;  4A90 A;  2JWU A;  3EGR A;  4FHK A;  1JQ4 A;  4IWO A;  1RLF A;  2KMA A;  4PYU A;  2X38 A;  4M02 A;  1XEE A;  1BML C;  3L17 A;  1PGA A;  2MBE A;  2WXF A;  5EE0 A;  4MEL A;  1XF5 L;  4KGS A;  4EFO A;  1FIQ A;  1WGY A;  2CR5 A;  2HD5 B;  1TGZ B;  1XXG A;  2JRH A;  3R8B A;  1FD6 A;  5IAA C;  1CQV A;  4ZOH C;  2LZ6 A;  4LNK A;  2WP9 B;  4OHJ A;  3TJP A;  4CO7 A;  2J52 A;  1TKE A;  3KUD B;  3NS8 A;  3AEA B;  1CK1 A;  2KN5 A;  2NS5 A;  2LHD A;  4FJZ A;  4HLE A;  2AX5 A;  2PMV A;  1F77 A;  4WIP A;  3A4R A;  1OGW A;  1H7X A;  5EDS A;  3OJ3 A;  4XX5 A;  4OZC A;  4E71 A;  4BBN F;  3U7Z A;  3IAS 1;  2KAC A;  4DBG A;  3IG3 A;  2N9E B;  5DPR A;  3SEB A;  5EE1 A;  2MHJ A;  1I4Q A;  2BB5 A;  2C5L C;  3P4P B;  3H8H A;  2LI5 A;  3EA6 A;  4ITK A;  2JYE A;  4E74 A;  2WLB A;  3GE8 C;  2W9N A;  2K39 A;  2PPH A;  4L2Y A;  2JYT A;  1WXS A;  3N1Y C;  2Z0E B;  2JF5 A;  2QIE B;  4S17 A;  1YQ3 B;  2DZK A;  2IDY A;  2LGI A;  3V61 A;  3W5U B;  3SU8 X;  1AW7 A;  5KHQ A;  2QIL A;  2LJ5 A;  2Z59 B;  1CMX B;  1QF6 A;  4H2A A;  4P6V F;  4UDU C;  3IVF A;  1RWS A;  3DWM A;  2GOW A;  3V6E B;  4JWU C;  4LNO A;  3AE8 B;  1UGM A;  3DOW A;  2L7R A;  3DQV A;  4DDI D;  2N9P C;  4RNA A;  2WU5 B;  3Q14 C;  1UBQ A;  1ROE A;  3NY5 A;  1ZKH A;  4HKQ A;  5C3J B;  2XK5 A;  2UWQ A;  1UF0 A;  2AQ2 B;  5LXH A;  1C4P A;  1YNT E;  2C9W B;  2WXJ A;  2KZR A;  3R2I A;  2QSD A;  3FIL B;  3UI3 A;  4JX1 C;  5D6J B;  2G1E A;  2GI9 A;  1VR9 A;  4RF1 A;  3AEC B;  2I38 A;  3AEE B;  1ZGU B;  2IY1 B;  1HQR D;  2BYV E;  4ZDV A;  1E8Z A;  4LNF A;  2DNF A;  4DQO C;  1KF6 B;  3QCA A;  3JSV A;  1JAL A;  1Z2M A;  4HRO A;  3UIO B;  3Q3N C;  3W9C B;  1UZX B;  4LDT B;  1N5W A;  1ZOY B;  3ZW3 A;  5BYS A;  3RN9 C;  3QX1 A;  2PVO D;  2KWD A;  2PE9 A;  3DBH I;  1FRR A;  2RPQ A;  4MGK E;  1KLG D;  4HJG E;  3I57 A;  1EF1 A;  4XDD A;  2IGD A;  2V3N A;  1PFD A;  2WXR A;  4W9K A;  3MHZ A;  2RPV A;  1T0Y A;  2QMT A;  2DAF A;  1WE6 A;  1C1Y B;  3GOE A;  5E6O A;  4YSX B;  3AU5 A;  2ZVO A;  5DCN A;  3T8M A;  4P7I A;  1FCC C;  2KDB A;  2NTS A;  1BUI C;  3EUB 2;  1JWA D;  2BGF A;  4ZHP A;  1YJ1 A;  1IP9 A;  3AH7 A;  5IO9 A;  4KGT A;  3AMZ A;  1MVK A;  4PS8 A;  5D3I B;  4MAC A;  1XCQ L;  4HK2 A;  3ZNZ B;  3APF A;  4HPL B;  3DWG C;  3N9Y C;  3U52 E;  3NJT A;  4DK5 A;  3KQ4 A;  5KHO A;  3IT6 B;  2ZCC A;  5BO4 B;  3D32 A;  3ZNH B;  2NCN A;  4US8 A;  3VR8 B;  1NBF C;  4TQ1 A;  4HDQ A;  4O1N A;  4PS3 A;  4RGN A;  3WAO A;  1N6Z A;  2FID A;  3VDZ A;  3AEG B;  2OJR A;  3DVN U;  2VZK D;  2WXG A;  5D3D A;  3NS1 A;  3PRP B;  4ZRK A;  3SFD B;  4WWO A;  1TYG B;  4XDC A;  5CHF A;  3VUW A;  2CU1 A;  2WX0 A;  2G45 B;  1IUE A;  5AZF A;  5DPS A;  4ZRP A;  4MJS B;  4PYZ A;  2JY6 A;  5EE3 A;  4II2 B;  5CHV C;  1WIA A;  1H4R A;  4ASW C;  3VTW A;  2KDI A;  4B9K A;  2NBU A;  4I6N B;  3KYD D;  4K1R B;  2UYZ B;  2WXI A;  4XWW A;  4ZYS A;  1JWU D;  3R3M A;  4KSK C;  4YXD B;  2MX2 A;  1PDX A;  2BYT A;  2HTM E;  1ZP0 B;  1AN8 A;  2YLM A;  1L6U A;  3BYY B;  1WM3 A;  1FRD A;  2SEB D;  3ZYY X;  2L0F A;  3IBE A;  1DGJ A;  3A33 B;  4ARC A;  3AN1 A;  2IGG A;  3DVN V;  4IC7 B;  2C7N B;  1HA5 A;  3PTF C;  5BYR A;  5FR3 A;  3PRM B;  3SD5 A;  2G4S A;  1E8X A;  1K50 A;  3MC8 A;  4TKN A;  1WZ3 A;  3N1X C;  2K1F A;  4DHZ E;  2CS4 A;  2QEJ C;  3KVF B;  2MWS B;  2L8J A;  5E6P A;  1VZ8 A;  1U4A A;  4EE2 A;  5TR5 A;  2C60 A;  2KTR B;  4MGY E;  2E6X A;  3Q2A C;  4C00 A;  2CU3 A;  4CQN A;  1RM6 C;  4K7W A;  2KYW A;  2KN4 A;  2RDG A;  4WAA A;  2DBY A;  2K8H A;  4AQ7 A;  2PEA A;  3GB1 A;  5FK9 C;  3U2S C;  1C76 A;  4N9F 4;  2KVR A;  2VH1 A;  5CHW A;  4GXB A;  1P3Q U;  2LUM A;  2RDH A;  3M95 A;  4ANX A;  2Z0D B;  1HTQ A;  1WMH B;  2BW2 A;  1RFA A;  5HKH A;  2G4D B;  1YJI A;  3M3J A;  3X0W A;  2MJD A;  4ANW A;  3O65 B;  3ZXR A;  1TY2 A;  4KX6 B;  2JXX A;  3VFK A;  1L0V B;  3VXW A;  1TZO A;  2KJR A;  2AYO B;  2M17 A;  2AEH A;  2ZEQ A;  1I4X A;  1HXY D;  2D2Q A;  4II3 B;  1L0Y B;  3RNB C;  4I6P A;  2WGS A;  1SJE D;  5E6N A;  1J19 A;  3BZD B;  3AEB B;  2W82 A;  3ZIM A;  4A8X C;  4B0M A;  2BPS A;  3L4P A;  2MSE D;  2LHE A;  4BOZ B;  1E10 A;  1FCL A;  2IYD B;  2M4N A;  3U8Z A;  2D5G A;  1DYQ A;  1I35 A;  4G0N B;  3N30 A;  3R7R A;  2AL6 A;  3Q8F A;  5G2N A;  2BVC A;  4HPP A;  3W1Y A;  1WR6 E;  2OED A;  1P7E A;  2MBO A;  3LXF A;  2KVZ A;  1JRO A;  1HE8 A;  4RH6 A;  3AE9 B;  2DYO A;  5T8I A;  2Y5B B;  4DHZ B;  3QAQ A;  1L5P A;  1JWS D;  4W9J A;  2V3S A;  2EEL A;  1XCT L;  3OG5 A;  1GPX A;  1WH3 A;  3PZ8 A;  4BVU C;  4DWF A;  4IM2 A;  1C78 A;  1HEZ E;  4K7U A;  4MJS A;  3L54 A;  3TL5 A;  3NUH B;  2IO3 B;  3WIM A;  1R4N B;  1SJH D;  3CST A;  3Q69 A;  3PGE A;  1Q0W B;  4KZC A;  3OWE B;  2NBV B;  2KC1 A;  4TUU A;  3IHP C;  4ARI A;  3JYU A;  1FPY A;  4AOF A;  4NJ7 A;  2WXH A;  1WXM A;  4ICV A;  2JWZ A;  5L95 C;  3Q8A A;  2Y3A A;  4EZJ A;  3AXC A;  2FNJ B;  2XEW A;  2WDT B;  4C7Y A;  2X8X X;  3R7Q A;  5CTR C;  3CWI A;  5AUI A;  3VVW B;  3P4S B;  5I4D A;  4HVB A;  1I42 A;  1FMA D;  2KWC A;  4P1B C;  4N58 A;  1E7U A;  2V0G A;  1MJD A;  1LGR A;  2WYQ A;  1YX5 B;  4BKT A;  4PK1 A;  4A6Q A;  4B6W A;  3T3N A;  2J42 A;  1TTN A;  1JWB D;  1J7B A;  3AUL A;  1ENF A;  3DPD A;  5FR6 A;  2KTR A;  5EE9 A;  1TKG A;  3RNF C;  1J7A A;  2BKR B;  1WGH A;  2R61 A;  3KWV A;  3ETR A;  3ZRC A;  2AL3 A;  2FBW B;  3KH0 A;  1YOV B;  2BYF A;  4WJP A;  4C7Z A;  1KM7 A;  2DEN B;  2DX5 B;  2MA9 B;  4YT0 B;  2AWT A;  1WMH A;  5G5H A;  1KFY B;  3L08 A;  1V2Y A;  3OAW A;  2G3Q B;  2LGS A;  4K7S A;  3KUZ A;  4BKS D;  1AYF A;  4KVG B;  3AB5 A;  1FNU A;  4G3X B;  1C3T A;  2EMS A;  4GSW A;  1VCB A;  3T9L A;  3DBS A;  3EFU A;  1I7H A;  2RGF A;  5TSS A;  1F9J A;  4W9E A;  1K51 A;  3BII D;  1C4A A;  3IAM 1;  1WGK A;  2ON8 A;  1D5X C;  2L1A A;  4FBJ B;  5HI1 A;  4LNI A;  3UIP B;  4KIK B;  3L0W B;  3PV1 A;  1N5X A;  1RAX A;  5IP4 D;  4CHK A;  3NVV A;  2KXJ A;  3Q3M C;  1I4P A;  2A4Z A;  2KK8 A;  2WDV B;  1TZ1 A;  1KJT A;  1T6B X;  3ZJV A;  4N59 A;  1K8R B;  4F8C B;  4GIV A;  3S2A A;  3DCG A;  4W9G A;  2K8C A;  3ZQ4 A;  2N1W A;  1JW9 D;  2REX A;  4XWT A;  1GOZ A;  4MGI E;  3UIN B;  2VRR B;  1ISN A;  1E7P B;  1VZ6 A;  2DZM A;  3UQB A;  2G9H D;  3RNE C;  3MTN B;  4GDK B;  2W3S A;  3PHW B;  2FCQ A;  3Q8B A;  1QOB A;  3K9P B;  4TQ0 A;  3MJW A;  2KJ6 A;  3KYC D;  2H88 B;  2CJO A;  1J8C A;  1UWM A;  3P4Q B;  1ET6 A;  4RFB A;  1V97 A;  4M8M A;  3ZTD A;  3QJZ A;  4KGR A;  1PUT A;  3B2G A;  2L83 A;  4P1C C;  1IBX B;  4J6I A;  4C56 C;  1EM7 A;  3A9J B;  1E90 A;  1E8Y A;  3QIJ A;  3FAH A;  3B9J A;  4EZK A;  2PKO A;  4HCP B;  1QOF A;  4ANV A;  2K22 A;  1ZXI A;  1PYW D;  3PLU A;  3ML8 A;  5AEK B;  2LWP A;  3BK2 A;  2KX3 A;  1CZP A;  1RYJ A;  4NZL B;  3K9O B;  1NVI D;  2L32 A;  2FUH B;  4WH4 A;  2LXC A;  3BYT B;  4ZRJ A;  2MP2 B;  2J0K A;  1FXT B;  1SEB D;  3PZ7 A;  3RD2 A;  4DXG A;  3AM9 A;  2NTT A;  3Q8C A;  3PRE A;  3VUY A;  2KAJ A;  3VUX A;  3HRD D;  3WAM A;  2LMC A;  2K6Q A;  4LLG M;  3ZGZ A;  1FXI A;  3IXS A;  4AJY B;  4US9 A;  4TV3 A;  2N7D A;  1L2N A;  3GP7 A;  3ZJT A;  4JL9 A;  4BAX A;  1YIW A;  4RMA A;  3RZW C;  2BQQ A;  2INC C;  4XE0 A; 
#chains in the Genus database with same CATH homology
 1DGJ A;  2NMQ A;  4ARC A;  4J3O D;  1CJE A;  3AN1 A;  2IGG A;  3HVD A;  2IPK D;  4ZRQ A;  2EKI A;  1HA5 A;  4TSS A;  2BS3 B;  1EWC A;  3SR6 A;  5BYR A;  3B2F A;  3BVM A;  4MH8 A;  5FR3 A;  4R3D A;  2BB6 A;  2YEP F;  1A70 A;  3TEY A;  4C80 A;  1K50 A;  2PIA A;  4JE3 B;  1KTK A;  4D2K A;  4HKZ E;  3ABV B;  2QEJ C;  2BS2 B;  1FM0 D;  3NRZ A;  4WQM A;  3BVZ A;  4HRS A;  3KWL A;  1VZ8 A;  1NEN B;  4EE2 A;  1JML A;  1SE3 A;  1UNS A;  2ONQ A;  1V1O A;  2XN9 C;  2CJN A;  1SE2 A;  2E6X A;  2CU3 A;  1OFF A;  4CQN A;  1RM6 C;  2KDM A;  2H89 B;  1YN3 A;  1GB1 A;  3CF4 A;  1QQR A;  5BMH A;  2KN4 A;  4YSZ B;  1MHH E;  2RDG A;  1FXA A;  1QOA A;  2DBY A;  1ACC A;  4AQ7 A;  1MI0 A;  4OZA A;  1TY0 A;  3GB1 A;  5FK9 C;  3U2S C;  1C76 A;  5GXG B;  3CIR B;  4REZ A;  1DOY A;  2PLP A;  1NEK B;  4DXF A;  1L6V A;  2LUM A;  1QKZ A;  2RDH A;  2WXL A;  3NZ3 A;  5AUK A;  1L4Z B;  2JSV X;  2BW2 A;  1KRH A;  1D5M C;  2J53 A;  4RGT A;  2GRI A;  3NVZ A;  3VR9 B;  1KH0 A;  4PT5 A;  2KMM A;  1YJI A;  3U4E G;  3VQI A;  2MEK A;  2MJD A;  3VRA B;  2WS3 B;  1TY2 A;  4KX6 B;  1FEH A;  1UGJ A;  3ZJU A;  1R7S A;  2JXT A;  3J9C A;  1VZ7 A;  2LJI A;  5HHD G;  5BYQ A;  1L0V B;  1TZO A;  1D4B A;  4KKI A;  4IOI E;  3TSS A;  3LB8 C;  4RGO S;  4WUR A;  5HG2 A;  1FFU A;  1SBB B;  3IT4 B;  1I4X A;  1HXY D;  1WXQ A;  3MJ5 A;  1E0Z A;  2WXO A;  2WDR B;  1ET9 A;  1L0Y B;  1SF0 A;  1RFK A;  1SJE D;  1F2R I;  3BZD B;  2QJL A;  3AEB B;  1WYG A;  2LFI A;  2V3P A;  2W82 A;  3C8Y A;  4YWG G;  4A8X C;  4B0M A;  1SIJ A;  3L4P A;  3V3X A;  1IGD A;  2LHE A;  1E10 A;  2BT6 A;  1D5Z C;  1N62 A;  2JQR B;  1PGB A;  2DYM A;  2ZW0 A;  1VLB A;  5D7G A;  4IDI A;  4A90 A;  2D5G A;  2JWU A;  3EGR A;  1DYQ A;  1K53 A;  1JQ4 A;  2X38 A;  1MHX A;  1EU3 A;  1XLO A;  1MPE A;  3Q8F A;  4USA A;  2WXN A;  5BMI A;  1XEE A;  1BML C;  1PGA A;  1WSP A;  1IBX A;  1JWM D;  2WXF A;  2BTE A;  5EE0 A;  3MC0 B;  1XF5 L;  4KGS A;  3RFZ B;  1FIQ A;  5E6J A;  2OED A;  1P7E A;  3P63 A;  3R2T A;  1XXG A;  2N0S B;  2M0A A;  3R8B A;  1FD6 A;  2E3T A;  1CQV A;  2W55 A;  3LXF A;  4ZOH C;  1JRO A;  2WP9 B;  4OHJ A;  4Q2J A;  4NAM A;  4RH6 A;  2J52 A;  1TKE A;  3AE9 B;  1E9M A;  1HZ6 A;  2DYO A;  5T8I A;  4LTU A;  1FCL A;  3AEA B;  4JWS C;  3NVW A;  1L5P A;  1JWS D;  1CK1 A;  1STE A;  5FKA C;  3TEX A;  3T3O A;  3AE1 B;  2EEL A;  2LHD A;  1XCT L;  4B0E A;  1GPX A;  1PGX A;  5BMG A;  2K9X A;  3PZ8 A;  1C78 A;  3P4R B;  2AX5 A;  1HEZ E;  2PMV A;  1ESF A;  1F77 A;  3Q8E A;  2LEK A;  3LYY A;  4WIP A;  2M19 A;  1H7X A;  1GTE A;  1FFV A;  2YEP B;  1V8C A;  2GB1 A;  5C2T B;  2AQ3 B;  3NUH B;  1QIL A;  1SE4 A;  1UWX A;  2K3U A;  3V05 A;  2PTL A;  4RF0 A;  4OZC A;  3HVZ A;  1YN5 A;  2N9L A;  2WNM A;  2JZP A;  1SJH D;  4JPS A;  3U7Z A;  3Q69 A;  1I4R A;  2RMM A;  1BXT A;  3IAS 1;  2KAC A;  3P1M A;  1T3Q A;  3RPF C;  3W5V B;  1H7W A;  3OWE B;  3SEB A;  5EE1 A;  1K52 A;  1I4Q A;  4OZB A;  4ARI A;  1F2R C;  2BB5 A;  2WXH A;  3P4P B;  3AE2 B;  3H8H A;  1GAQ B;  3EA6 A;  1P7F A;  4ITK A;  1TS2 A;  2W3R A;  1ZXH A;  2Y3A A;  2JYE A;  3Q8A A;  4ZHO A;  4YSY B;  2WLB A;  4MM3 B;  1J7C A;  1VRA B;  4L2Y A;  2JYT A;  1TKY A;  4C7Y A;  3CWI A;  1Q10 A;  5AUI A;  3P4S B;  5I4D A;  2QIE B;  5HFY A;  1YQ3 B;  1FMA D;  1UUP A;  2IDY A;  4N58 A;  3KLS X;  2LGI A;  3P42 A;  3W5U B;  2V0G A;  4MT5 A;  4A6Q A;  1AW7 A;  1GT8 A;  2QIL A;  3T3N A;  2J42 A;  1I4H A;  1E6E B;  1JWB D;  1J7B A;  1QF6 A;  4H2A A;  1QLB B;  1ENF A;  4P6V F;  4UDU C;  5EE9 A;  2K5P A;  1TKG A;  1YQ4 B;  4OVZ A;  3E9S A;  1RWS A;  3DWM A;  2Y5C A;  3BVG A;  3PO0 A;  4JWU C;  3AE8 B;  2WQY B;  1M4V A;  1FNV A;  1J7A A;  3TUO A;  1EWY C;  2MH7 A;  1XLQ A;  4RNA A;  3URY A;  4A55 A;  2WU5 B;  2R61 A;  3AE3 B;  3KWV A;  3AE7 B;  1ROE A;  1V1P B;  2TSS A;  3ETR A;  4M0W A;  4HKQ A;  4TMA B;  1F0Z A;  5C3J B;  3MFG A;  1KLU D;  2FBW B;  2BS4 B;  2AQ2 B;  1FO4 A;  4C7Z A;  2J4X A;  1C4P A;  1YNT E;  2FE8 A;  2WXJ A;  3R2I A;  2QSD A;  3FIL B;  3UI3 A;  3W2D A;  1L4D B;  4JX1 C;  3TEW A;  4YT0 B;  1YJJ A;  5G5H A;  1KFY B;  2DWQ A;  2G1E A;  2V4I B;  1XO3 A;  1ZUD 2;  2N9K A;  2GI9 A;  3HUI A;  1VR9 A;  4RF1 A;  3AEC B;  2I38 A;  3WCQ A;  1AYF A;  1SB3 C;  3AB5 A;  2M56 B;  2WXM A;  4KKJ A;  3AEE B;  1FNU A;  1HQR D;  5TSS A;  1I7H A;  1NYQ A;  2INP E;  2WXQ A;  2Y5P A;  2KQ4 X;  2WDQ B;  4L1B A;  4GDL B;  4HEA 1;  4DQO C;  3I9V 1;  1KF6 B;  4N6E B;  1OQR A;  3O13 A;  1JRP A;  1K51 A;  4LK0 M;  1JAL A;  2B76 B;  3BII D;  4HRO A;  1C4A A;  3IAM 1;  2Q5W D;  1WGK A;  2ON8 A;  1D5X C;  2L52 A;  3W9C B;  2PVG C;  3E56 A;  2HDE A;  2OHF A;  1B1Z A;  1ZDV A;  1N5W A;  2L1A A;  5HI1 A;  1ZOY B;  1AWD A;  4L23 A;  1IGC A;  2VZK B;  1N5X A;  2JU6 X;  5BYS A;  1V1P A;  2ZW1 A;  3BK1 A;  3NVV A;  1I4P A;  5JXV A;  3TEZ A;  2PVO D;  2KWD A;  2WDV B;  1OQQ A;  5MPO A;  1ZE3 D;  1T6B X;  1FRR A;  2K0P A;  3ZJV A;  4N59 A;  2WXP A;  1WWT A;  1KLG D;  2WU2 B;  4HJG E;  1SSN A;  2JX5 A;  1HZ5 A;  3I57 A;  3AV8 A;  4XDD A;  3ZQ4 A;  3FIL A;  1VJK A;  2IGD A;  2V3N A;  3SFE B;  1PFD A;  2WXR A;  1JW9 D;  2RPV A;  3MHZ A;  2QMT A;  4XWT A;  1GOZ A;  2PW9 A;  1FNW A;  1E7P B;  1VZ6 A;  4RGM A;  2G9H D;  4YSX B;  3VRB B;  4YTN B;  1FCC C;  4GDK B;  1N60 A;  2NTS A;  1BUI C;  2W3S A;  3EUB 2;  1JWA D;  5H92 C;  1NI3 A;  4ZHP A;  1B9R A;  3AH7 A;  1N63 A;  3Q8B A;  4KGT A;  1QOB A;  4TQ0 A;  3AMZ A;  3AED B;  1MVK A;  5D3I B;  4A9A A;  4MAC A;  1XCQ L;  2H88 B;  2CJO A;  2BBC A;  3DWG C;  1UWM A;  3P4Q B;  1ET6 A;  1VDV A;  3N9Y C;  4RCO A;  4RFB A;  1V97 A;  3U52 E;  4AS1 A;  2MJ3 A;  4FXC A;  1D6E C;  1TS4 A;  3KQ4 A;  4KGR A;  1PUT A;  2WXK A;  3B2G A;  3IT6 B;  4NAW B;  5LNK 1;  2I2Y A;  1I4G A;  1WRI A;  4GLS C;  3VR8 B;  1ZDX A;  2L83 A;  2AQ1 B;  4WWM A;  4US8 A;  1IBX B;  4C56 C;  1EM7 A;  3NVY A;  3GS2 A;  4TQ1 A;  4O1N A;  1EU4 A;  4OW0 A;  3FAH A;  3B9J A;  2Z8L A;  1C79 A;  2PKO A;  4YTM B;  4RGN A;  1T5X D;  2IJ0 A;  1XLP A;  1NYR A;  1YMH E;  1QOF A;  4IKG A;  3AEG B;  2K22 A;  1ZXI A;  1PYW D;  2VZK D;  3BK2 A;  2WXG A;  1DOX A;  1CZP A;  5D3D A;  3NS1 A;  1RYJ A;  3AE6 B;  4NZL B;  1NVI D;  2L32 A;  3SFD B;  1SXT A;  4WH4 A;  1C4C A;  2N7J A;  3BYT B;  2SAK A;  1TYG B;  1XLN A;  2MJE A;  1QOG A;  1SEB D;  3AE4 B;  4NJC A;  1GTH A;  3PZ7 A;  1DOI A;  4XDC A;  1IUE A;  1LO5 D;  3BWU D;  3FC4 A;  4DXG A;  1Y56 A;  3AE5 B;  2NTT A;  3AM9 A;  4ZRP A;  2INN E;  1JCK B;  2DLB A;  3Q8C A;  5EE3 A;  1TS5 A;  1TS3 A;  2KAJ A;  3HRD D;  2LMC A;  1C9F A;  5G5G A;  1TJE A;  3W1S A;  1L0X B;  2ACZ B;  4LLG M;  3ZGZ A;  1C77 A;  2WXI A;  1FXI A;  3IXS A;  4XWW A;  4US9 A;  3MP9 A;  4ZYS A;  1JWU D;  4WAF A;  2IGH A;  1QT9 A;  4YXD B;  1N61 A;  1PDX A;  4P16 A;  3GP7 A;  2HTM E;  1ZP0 B;  2BYT A;  3ZJT A;  1AN8 A;  2ICI A;  1L6U A;  1GB4 A;  3BYY B;  5H8Y E;  1FRD A;  2W54 A;  2SEB D;  3ZYY X;  3AEF B;  1ZPS A;  4YTP B;  2XNA C;  2FUG 1;  1YN4 A;  4XE0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...