1NEKB

Complex ii (succinate dehydrogenase) from e. coli with ubiquinone bound
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
238
structure length
238
Chain Sequence
MRLEFSIYRYNPDVDDAPRMQDYTLEADEGRDMMLLDALIQLKEKDPSLSFRRSCREGVCGSDGLNMNGKNGLACITPISALNQPGKKIVIRPLPGLPVIRDLVVDMGQFYAQYEKIKPYLLNNGQNPPAREHLQMPEQREKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLAAYRFLIDSRDTETDSRLDGLSDAFSVFRCHSIMNCVSVCPKGLNPTRAIGHIKSMLLQRNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase flavoprotein subunit
publication title Architecture of succinate dehydrogenase and reactive oxygen species generation.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase/electron transport
total genus 56
structure length 238
sequence length 238
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2002-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 1nekB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1nekB01
2BS3B 2E3TA 3AM9A 3VRBB 1OFFA 3DWGC 1AYFA 1NYRA 3FC4A 1YJIA 1XLOA 3AE7B 2H88B 2EKIA 1GT8A 3AE9B 3AEFB 3NRZA 3W5UB 2BS4B 2WDVB 2H89B 3AE8B 1GAQB 4YTMB 2CU3A 1JALA 3VR8B 1WWTA 3FAHA 1A70A 1TKGA 5C3JB 2L52A 3ZYYX 4C7YA 1CJEA 2QIEB 1E6EB 1V8CA 2DBYA 3HUIA 3KWLA 1DOIA 2WLBA 1NYQA 3HRDD 3P4SB 1E7PB 1RWSA 3AB5A 3EUB2 1R7SA 2MJ3A 2W3RA 4US8A 1V97A 1WGKA 1JWBD 2W55A 4ZHOA 3NVYA 1YJJA 4HROA 3W9CB 1NVID 1DGJA 1N63A 1QOAA 1PDXA 1J7CA 4YTPB 3P4PB 2PIAA 2MH7A 3NVWA 5AUKA 3AEGB 1FM0D 2M56B 5MPOA 4HRSA 4YTNB 4C80A 1E9MA 1YQ3B 4YSXB 1UWMA 3AN1A 4ZOHC 1FO4A 1QOGA 5C2TB 1WYGA 3HVZA 1SB3C 2ACZB 1H7WA 1AWDA 2WP9B 1NEKB 1NENB 1JROA 1L6UA 1N5WA 2LEKA 3AE1B 2JX5A 2WS3B 1PFDA 3CIRB 3BIID 2WU5B 3AECB 3AE3B 4JWSC 1I7HA 2BT6A 4IDIA 1RFKA 3L4PA 1J7AA 3W5VB 5EE0A 1WXQA 1XLPA 2PVOD 2Y5CA 1QOBA 2WQYB 3ETRA 2QJLA 1GTEA 1JQ4A 2WU2B 1TKYA 2Q5WD 1QT9A 2BS2B 4YT0B 1TYGB 3P63A 2CJNA 1ZUD2 4ZHPA 4JX1C 1FXAA 1RM6C 1FFUA 5GXGB 1B9RA 2W54A 4JWUC 3AEDB 2MJEA 4P6VF 3PO0A 2CJOA 3LB8C 5G5GA 4FXCA 2L83A 4N58A 1L5PA 2AX5A 1JW9D 3B2FA 1JRPA 1FXIA 3B2GA 3B9JA 4N6EB 4USAA 1VLBA 5EE9A 5H92C 3SR6A 1PUTA 1XLNA 1GPXA 1VDVA 4KX6B 2FBWB 1FRDA 1QF6A 3AV8A 1N62A 1L0VB 3AE4B 1QLBB 3AE2B 1WRIA 3AMZA 1E10A 1E0ZA 2K22A 1FMAD 1XLQA 1TJEA 1GTHA 1T3QA 2K9XA 3DWMA 1OQRA 1KF6B 4ITKA 3WCQA 2DWQA 2HTME 3AEAB 1SIJA 1CZPA 5H8YE 4A9AA 2WDQB 1L6VA 4US9A 1ROEA 5EE1A 1FFVA 2KMMA 3NS1A 5AUIA 3RPFC 1EWYC 1ZXIA 5G5HA 2OHFA 3P1MA 3NVVA 1NI3A 1N61A 1SF0A 1N5XA 1JWAD 1RYJA 3SFDB 3ABVB 4LTUA 2PKOA 2WDRB 3AE6B 2M19A 1FIQA 1FRRA 2G1EA 3AH7A 1KFYB 1F0ZA 1OQQA 3CWIA 4YSZB 1KRHA 3VR9B 4N59A 3CF4A 1YQ4B 1XO3A 1QOFA 4WWMA 3VRAB 2JQRB 4YXDB 3AEBB 4YSYB 3SFEB 1IUEA 3AE5B 1DOYA 2N0SB 3P4QB 2K5PA 3P4RB 3AEEB 1VJKA 2MJDA 2B76B 1TKEA 1ZP0B 1ZOYB 2W3SA 1H7XA 3LXFA 1DOXA 4C7ZA 1J7BA 1N60A 2KAJA 2PVGC 5EE3A 3NVZA 4WQMA
chains in the Genus database with same CATH superfamily
1WE7A 2LHEA 1L7YA 4K1RB 3T9LA 3UI3A 1UH6A 1GT8A 2KO3A 1XXGA 2BS4B 5IN7A 2V1YA 3ZIMA 3O65B 1CJEA 3ZRCA 1F9JA 4REZA 3V3XA 2BKRB 3AB5A 3URYA 2N9PC 1V81A 2FIDA 4K7SA 1NVID 3PLUA 2LXAA 3NVWA 5AUKA 2MQJA 2LRUA 2KJHB 3PZDA 2BQQA 3JW0X 1JROA 4KZCA 3C8YA 4KGSA 4K7UA 1I4QA 1KLVA 1RFKA 2XK5B 5T8IA 4XGAB 4WJNA 2KQ4X 3EC8A 1TYGB 3PVLA 4GDKB 3ZQ4A 1B9RA 3VXWA 4P6VF 1EM7A 3LB8C 4IC7B 1R4MB 3DVNV 1JW9D 2V0GA 3S2AA 5EE9A 4PS8A 4NJCA 4ZRPA 4LDTB 2KHWB 1FMAD 1AN8A 1GG3A 3DHHC 4G50A 2MP2B 1Z2MA 2WDQB 2KN5A 1ROEA 4A55A 2KMMA 5AZFA 1EWCA 4BKTA 4A3OA 2C7NB 3Q8CA 2IO3B 1C79A 3SFDB 1ZPSA 2G9HD 4WWOA 3VVWB 4EZLA 2C5LC 4RGNA 2Z0DB 4JQWC 2JXTA 2KMAA 1XO3A 3V62A 1UWXA 2RGFA 3HIZA 4YXDB 3U2SC 1V5OA 3R66C 2FAZA 2X8XX 3IVFA 3RNCC 4HPLB 2KAJA 4NJ7A 2J0MA 4PT5A 1OFFA 2WXGA 1SIFA 1ZDVA 2WXLA 2IO1B 1F77A 2YEPB 4E74A 4OHJA 1CMXB 2CU3A 5DCNA 4O1NA 1GC7A 3C0RB 1WX7A 1SSNA 1KOTA 3QAQA 4GDKA 1C76A 3EFUA 5E6OA 1FEHA 1JWBD 3RYTA 4F7ZA 5JZEB 2I1KA 4P7IA 1TIFA 4HCPB 3L08A 1ENFA 3APFA 2WXHA 2HJ1A 2KTRB 2BPSA 2CU1A 1VZ8A 2VH2A 2BVCA 5C1ZA 4HKQA 2QC8A 2GLSA 4J6IA 4EFOA 2BT6A 1I4RA 4IDIA 1YX6B 2RPVA 4W9EA 5L83A 2DAJA 2LGDA 2K3UA 3DDCB 1RAXA 1ZUD2 2QHOA 3B2FA 3UIPB 3ZDTA 3AV8A 4KKIA 2LGYA 2ZCBA 1WRIA 1QQRA 2M8SA 1OQRA 4FJZA 4BZAA 2QMTA 2GMIC 2QCZA 3NS8A 4MH0E 2DLBA 2LUEA 1JWUD 4ANWA 3NVVA 1P98A 4W9FA 3J9CA 1FPYA 1ET6A 4FJYA 1WR6E 2GRIA 2GBMA 3N9YC 4F8CB 2EKEC 4G11A 3ZNZB 1SE9A 2JQRB 4NAMA 3JYUA 2QSDA 2ZZPB 4M02A 3ZJTA 2K5PA 5DPRA 2MJDA 2FCMA 1BT0A 1LM8B 4UDUC 2N7JA 1WY8A 4TUUA 1DYQA 3NVZA 5EE3A 4ASWC 3IHPC 2KTRA 3WAOA 1K50A 3A33B 4HDOA 1YJIA 2DX5B 2CKHB 5KHOA 4J3OD 3Q3FA 3L54A 4XWWA 4IWOA 2GB1A 1MI0A 3DVNU 1XCTL 1I4PA 3BYYB 1WWTA 4EEWA 2KDEB 1Q10A 3ZYYX 1J0GA 4EUTA 1V8CA 4MACA 1T0SC 2REXA 3P4SB 4BBNF 3EUB2 1XD3B 2KWVB 4HROA 1WM3A 3SHQA 1NBFC 1AW7A 3AEGB 2FUHB 2EMSA 1H4RA 1UWMA 4LCDE 2L0TA 2WXFA 1GNUA 5CX3A 2QDFA 2WXQA 2QJLA 2LFIA 2Q5WD 2C7MB 3VDZA 3VTWA 3TUOA 2Z0EB 2YEPF 4PYUA 1WFYA 2KK8A 4XDDA 1FCLA 2AQ1B 2HTHA 1PUTA 1GPXA 3W1YA 1L0VB 1MG4A 1LXDA 1WI0A 1XLQA 5D3DA 1YMHE 3L0WB 3I3TB 4A9AA 3QIJA 3NY5A 3RNBC 4FHKA 4W9DA 1WXVA 2ASQA 2I38A 3WIMA 3M95A 2OJRA 2LGIA 4BVUC 1EU3A 2IYDB 3OJ3A 3E9SA 3RD2A 4MSQB 4A6QA 2MX2A 2J4XA 1TTNA 1E7UA 2KNBA 1XF5L 1P3QU 2JT4B 1I4XA 3T3OA 1JMLA 3QK0A 4IM3A 1V1OA 2XN9C 3T3NA 3BVZA 4HK2A 4ARIA 1UBQA 4FULA 2KLCA 5DPTA 1PGXA 2NR2A 5BMIA 5AZHA 5AZGA 2WXIA 4WWPA 1TS3A 1WR1A 2LVOA 1KM7A 2E6XA 2WLBA 3TMPB 4IUMB 2KDIA 1N63A 3IAS1 2RPQA 2GBNA 3ZKJC 1QZEA 2PTLA 3DBRB 3H6NA 4GDLA 2JX5A 2HDEA 2K6DB 3NZ3A 3ZXRA 4K3BA 3DCGA 4BKSA 1P0RA 3K9PB 2QEJC 2N9KA 4AJYB 3ZJUA 5E6PA 4FA6A 3VH3B 5D7GA 2BGFA 4DHJD 4RFBA 4AOFA 2CR5A 1KTKA 3BVMA 1FXIA 3M3JA 3SR6A 5AEKB 2RD0A 3U30A 1H8CA 3VAWA 1V49A 2RMMA 3DWMA 2DZJA 2DYOA 1D6EC 1A5RA 3WALA 2VH1A 1SJHD 1E8WA 3U7ZA 3P1MA 3Q8AA 2MBEA 5G55A 1WGDA 3GOEA 3RULA 2W9NA 3BZDB 1JWMD 2G1EA 1VD2A 4FBJB 2C7HA 3QCAA 2L1AA 2WHIA 1HA5A 2YLMA 3DBHB 4LK0M 4M8MA 3KWVA 3B9JA 3GZNB 3NHEB 2Y5BB 1AYFA 4YL8A 3A9KB 4LNFA 1NI2A 2WDVB 1D3ZA 5CHVC 1V80A 1YN4A 1T5XD 3RZFA 4FLHA 2DBYA 5D6JB 1BMLC 1C78A 2Z59B 1GC6A 1IGCA 4MGZE 5C23A 3HHMA 1FNVA 1OEYJ 2FNJB 3TL5A 3NVYA 2R2QA 5HFYA 4XYCA 4MEMA 2L7RA 2JPHA 5D2MB 3HM3A 3KUZA 5MPOA 5TSSA 2J7QB 3VQIA 2ONQA 1M4VA 2D3AA 1PQSA 5I4DA 1K8RB 3ONSA 2ZPYA 4WQOB 3V6EB 2JY6A 1RM6C 3DOWA 2AL6A 3LYYA 4DHJB 2LXCA 4NY0A 2KTFA 2DENB 1TT5B 1N62A 2FCSA 2IGGA 4KDIC 3AE4B 2L00B 3K9OB 3QARA 1T3QA 4FN2A 3W2DA 3Q3OC 4ANVA 1CZPA 3VUYA 1U4AA 1QILA 3P42A 4GB9A 2I1JA 3AU5A 3Q3MC 5G5HA 2L3ZA 2IY1B 3A9KA 3PHXB 3N20C 1FIQA 1SGHA 2GOWA 3DBSA 2IPKD 3CF4A 3V60A 5J17A 5IA7A 1N6ZA 1V86A 1VJKA 1ZP0B 3GB1A 3X0WA 1DOXA 3PREA 3ZO5B 2BS3B 1ZGUB 1YX5B 2BW2A 2K6QA 2ZNVC 4IOIE 2KZRA 4TV3A 2LUMA 1WXSA 4G3XB 3AEFB 4MM3A 1Y56A 3AE8B 2LHDA 4DXFA 4LNKA 3KLSX 4XZ4A 2I2YA 1A70A 2JZ3B 2QIEB 3W1SC 2WXMA 1R4NB 2JZZA 1VCBA 2J0KA 4RM8A 4WJPA 1FNUA 2KFKB 2HD5B 1V6EA 1E8XA 4XDCA 2INNE 4LNNA 2PLPA 2KQ7A 2PMVA 1K52A 3HVZA 1WRDB 1H7WA 2IGHA 3RUIB 4WH4A 3SDLC 1T0YA 1XLPA 2J42A 1YJ1A 3VFKA 1Y8RC 2WU2B 2ZCCA 2MA9B 2UYZB 2CJNA 4JIOU 3H7PB 3ECIA 2CJOA 1JRPA 4HJKA 4DK5A 5IP4D 1UZXB 1CQVA 1XLNA 1TY0A 2C9WB 2GI9A 1F1HA 1WGGA 3DHIC 1EWYC 2OHFA 1EUVB 1WX9A 4DDID 1FRRA 4B95A 4W9GA 3DHGC 1KRHA 3PGEA 3WAMA 1RRBA 3A9JA 4A90A 1QOFA 4K7WA 4RF1A 4YSYB 1C77A 2KFKA 3PZ7A 4QAYA 3CSFA 3OLMD 4MGYE 1MHHE 3KVFB 3PRPB 2MCNB 2XEWA 4EKUA 2KDFB 2E3TA 2EMTA 2N7DA 3GE3C 3VTVA 1TGZB 4S0RA 3QC8B 2H88B 1WYWB 4HJGE 3NRZA 4AP4C 1HE8A 4WAFA 4II2B 2G45B 4NJ6A 5DPSA 2KJRA 1TKGA 5D3IB 4C7YA 1E6EB 5GMVA 2KYWA 3QHTA 3H7PA 1F52A 2Z8LA 4EE2A 1V97A 4MH8A 1J7CA 4M01A 3VH4B 3Q3NC 1WZ3A 1J8CA 5TR5A 3BIID 3BVGA 1I42A 3AE3B 2AWTA 3L4PA 2WXOA 4IWQA 3KUDB 2WXJA 1NDDA 2JUOA 4M0WB 3HK0A 1PGBA 5GXGB 4CO7A 3MJWA 1VZ6A 5BMHA 4W9KA 2Y5PA 2FBWB 1P7EA 4ITKA 1HXYD 3PT2B 4TQ0A 5H8YE 2M17A 4HKZE 4F1SA 3RFZB 1J19A 4WJQA 1WMHB 3B0AA 2NCNA 1IPGA 4H2AA 2ZVOA 4LJOB 3U7DA 1KLGD 4MDKE 4W9LA 3AEBB 1WSPA 3P4QB 1LQBA 4ACFA 1E7VA 2B76B 1TKEA 2W3SA 3LXFA 2LD9A 2VRRB 4LNOA 1P7FA 4TQ1A 3OWEB 3DWGC 3FC4A 4NQKE 2KQSA 3AE7B 2VZKD 2PE6B 1C1YB 2H89B 2BYTA 4GGQA 2KWUB 3TJPA 3APCA 4TMAB 3SU8X 2IY0B 2GBKA 4M0WA 3EGRA 1R4MI 1YJJA 3RCZA 3W9CB 1FM0D 1OGWA 1WJNA 3HVDA 3AN1A 3HM6X 1FO4A 4BAXA 4P1BC 1SB3C 1AWDA 2WP9B 2L8JA 4DDGD 4DBGA 4EOYA 2IBIB 2YVCA 4W9CA 3N1YC 2Y5CA 1D5XC 1ZDXA 2PE9A 2QILA 1WMHA 1GTEA 3Q14C 4MGKE 4DHZE 2DHZA 1EO6A 3P63A 1FXAA 2BYEA 2NVUI 4ZRQA 3B2GA 3TEXA 4DHZB 1QLBB 3AULA 2K22A 2K9XA 2IDYA 1WGRA 2B3AA 3BYTB 2JU6X 4G0NB 1V1PA 1FFVA 3P2BA 2HE7A 2K8CA 1WM2A 2LJ5A 1G6JA 1WJ6A 4AJWA 3TBLD 4ICUA 1F0ZA 2NS5A 2DZKA 5L95C 4JL9A 3Q8FA 3VR9B 4N59A 4B6WA 4YWGG 2XNAC 2BKFA 4GDLB 3NZSA 3M62B 1N60A 1WX8A 1WXMA 1SBBB 4L1BA 2PPHA 5BYQA 3T8MA 1YIWA 2WXKA 1EF5A 2NPTB 4A8XC 1UUPA 3WAPA 1X1MA 4RCOA 3TSSA 2O6VD 4M00A 4XX5A 3BINA 1WGKA 1MPEA 5CHFA 1PGAA 4A3PA 1XCQL 3Q6BA 1QKZA 4C80A 1YQ3B 1C3TA 3MHZA 1QOGA 3NUHB 4DXAB 4AWJA 1NEKB 4C56C 3L16A 2LEKA 3PS6A 3AECB 2D10A 1I35A 4MSMB 1HZ6A 1L0YB 1QOBA 2MLBA 1JQ4A 2FUG1 1HEZE 5LLIA 1BUIC 1ZE3D 4ZHPA 1ZXHA 2HJ8A 1FFUA 4JWUC 2G3QB 5IKCM 1K51A 4HDQA 5KHQA 4FJVB 2JYEA 2OJWA 1VR9A 1QF6A 4BKGA 4ANUA 1TJEA 3FKYA 1WZ0A 2V3NA 4B0EA 2A4ZA 2RDHA 2OEDA 3IT6B 3Q2AC 3UGBB 1RYJA 2DYBA 2NPTA 4DWFA 3AE6B 5IOIA 3CWIA 4II3B 4YSZB 2WX1A 3C19A 1LGRA 4HVBA 3DBLB 3KH0A 1TS2A 1DOYA 2N0SB 4HPPA 5FR6A 3TCAA 2KVZA 4CYEA 1IBXB 1GB4A 3IAM1 2INDC 5JXVA 2JRHA 3UINB 1HTQA 1L4DB 2KDMA 2SAKA 3AXCA 3PZ8A 4KVGB 4GOCA 4ZRJA 4ZRIA 1F2RC 3KWLA 3PHWB 3ZNGC 2MRPA 1NYQA 3HRDD 3TEWA 4KKJA 1R7SA 2MJ3A 1WH3A 2KFJA 4RGMA 3N3KB 4OW0A 3UQBA 1GJZA 4OVUA 1NENB 3AE1B 3VUXA 2A5UA 3ZRFA 3ZVVA 1MHXA 4CHKA 2M4NA 4GU2A 3WA0A 2MWSB 1TKYA 2BS2B 2GBJA 3DPDA 2UU7A 2AYOB 2MSED 3AEDB 5G5GA 2WDTB 1D5MC 3ZNID 1F2RI 2LMCA 4PYZA 4A20A 3BY4B 2M1MA 3UQAA 1E10A 3PLVA 3ENEA 1IBXA 4MM3B 1SIJA 4TSSA 2WNMA 4US9A 1TZOA 3LDZE 3NS1A 2D3CA 1N61A 3TIXA 2WXPA 1YNTE 1ZKHA 4NAWB 2NTTA 5LXIB 3IT4B 2KC1A 3ALBA 4PK1A 4M8NA 3DVGY 1IUEA 3OAWA 4X57B 2LRWA 3CMMB 3H9DA 3V61A 3DBRI 1YOVB 3PTFC 3VRBB 1E8YA 3RNGC 1MVKA 2CHZA 3MC0B 5JH5C 2AL3A 3ZLZA 2L52A 1L2NA 3PSEB 4GLSC 3QWZB 2V3SA 3SEBA 2K8BA 3IBEA 1AARA 2CHXA 3KUCB 1ESFA 3IFWB 5E6JA 3BK2A 1SXTA 2LGSA 3L10B 4GXBA 4LDTD 2ACZB 1SE3A 4MJSB 2WS3B 4W9IA 2D2QA 4IM2A 2K1FA 2JRIB 3ML8A 3A9JB 2L76A 2PJHA 4KGTA 3A1QB 4YT0B 4NAWA 5EDSA 2ZPNA 3ZNHB 1WIAA 4L2YA 2NTSA 3MJ5A 3AU4A 2GBRA 3QA8A 2N9EB 3DBHI 1Q0WB 3MHSD 5IAAC 4GMVA 4OZBA 1GTHA 1IGDA 1PYWD 4NPNA 4ZRKA 4C00A 3GZNI 4JLCA 4D2KA 2LZ6A 3N1ZC 3I57A 3V6CB 5LNK1 4GN1A 3ZXVA 4RGTA 3M63B 4OZAA 4PS3A 4KSLC 1KFYB 1E8ZA 3TEZA 3RNFC 4MGIE 4E71A 1WGYA 3MP9A 2K25A 4ZYNA 3EECA 1GB1A 1WF9A 1ZOYB 3RI7C 3GE8C 2KANA 4MJSA 3ZTDA 3APDA 1NYRA 2CS4A 1WJ4A 2EKIA 3H7SA 1YQBA 3W5UB 1YN5A 1RLFA 2KMCA 4MELA 1JALA 1Q1OA 2K0PA 5JHBA 5CHWA 3A1QA 3HUIA 1UGJA 1TBEA 4GIVA 4HEA1 2N7EA 1XT9B 1I4HA 1L0XB 3P4PB 2PIAA 3QQ8B 3NJTA 2RSUA 4ZOHC 3R7RA 2MBQA 3MC8A 1XQQA 2WXNA 1L6UA 3FAHA 3R3MA 5HI1A 4K3CA 2BB5A 3PRZA 5EE0A 5DPWA 2FE8A 4ZDVA 3DVGX 2IGDA 3ETRA 2G4SA 1SEBD 3RNEC 4I6LB 5FK9C 4GSWA 2N4FA 2MJEA 2KLGA 4N58A 1L5PA 2DZIA 5BMGA 1TY2A 2CHWA 1VDVA 4RNAA 3BK1A 5D94A 1UD7A 4C4VB 2R2OA 1KF6B 4IWPA 1KJTA 3KYDD 2C60A 2K39A 4JE3B 1S1QB 1V5TA 4W9HA 5HG2A 2NMQA 1LFDA 2ZEQA 1P1AA 2PKOA 3BWUD 3UF8A 1MJDA 3FILB 3U8ZA 3AH7A 1OQQA 2XK5A 4RF0A 1YQ4B 2J53A 1R4NI 3CF6E 3EFCA 3Q8EA 2MBOA 3AE5B 5HKHA 2FCQA 2MBHA 2X38A 1GUAB 2J0JA 4RMAA 4KIKB 1Q5WB 1FNWA 4CQNA 2JXXA 1XLOA 4Q2JA 3RNAC 2J52A 2MP2A 1GAQB 1SE2A 2FCNA 5C3JB 1KH0A 2D3BA 3I9V1 1UF0A 4KZ0A 2Y3AA 4KDLB 1B1ZA 2LGXA 3GS2A 2W3RA 2KD0A 2D5GA 1E90A 3PPAA 2L0FA 1HZ5A 1V1PB 4OVZA 3MC9A 2N9LA 1MFWA 1E9MA 2LWPA 4C4VA 4BBNC 1WYGA 1GOZA 1N5WA 1I4GA 2D3GA 2UWQA 2BB6A 3L17A 2LASA 3A4RA 3W5VB 2RDBC 5FKAC 2WQYB 2FIFA 4BKSD 1QT9A 4AS1A 3FILA 3X23A 5BYRA 2KKCA 3H8HA 1VLBA 2BTEA 4FHJA 4DQOC 2RDGA 2V9HA 3VHTC 2DZMA 3WCQA 1C4CA 2DWQA 3RZWC 3IG3A 1VZ7A 4KIKA 3RPFC 1ZXIA 3SD5A 1JWAD 4URKA 4N9F4 2KN4A 3ABVB 2L32A 3TEYA 2MBBB 3WANA 4B0MA 4KSKC 4OVVA 3Q69A 4WWMA 4RGOS 3VRAB 4RM9A 4HXDA 3R2IA 1WXAA 4TKNA 2JWUA 1S3SG 3B1LX 1TZ1A 4NQLB 1ACCA 1EF1A 1BXTA 4I6NB 4BFRA 2N9XA 2R61A 3Q8BA 3AI5A 3OG5A 4YTMB 2V3PA 1HQRD 2DYMA 1TS5A 1STEA 1DOIA 1E5WA 2DNFA 3ZTCA 1RWSA 4AUQC 1HTOA 4US8A 2SEBD 4NZLB 2K8HA 1QOAA 4YTPB 3R7QA 2M56B 4YTNB 4YSXB 1JWSD 2AQ2B 2KC2A 4JPSA 4DXGA 5C2TB 2VZKB 1SE4A 2L05A 4P1CC 2JYTA 2WU5B 1I7HA 5FR3A 1WXQA 1CK1A 2PVOD 4HWIB 3U4EG 1JRUA 2WXRA 3GP7A 1K53A 4P16A 4WJOA 3PO0A 2KT7A 4FXCA 2AX5A 4N6EB 3ML9A 3AMZA 2KX3A 1E0ZA 1EU4A 5EE1A 2JF5A 1ZW7A 4E3CA 4IG7B 3RMKC 1C4PA 4MT5A 1SF0A 2M19A 4I6PA 3Q3JA 2KWDA 3CSTA 4WWNA 2D07B 1MG8A 3N30A 2ZW1A 2ICIA 1T0QC 3P4RB 3AEEB 2ZW0A 2KWCA 1H7XA 1VRAB 2KVRA 1FD6A 4EZJA 2PVGC 4WQMA 3AM9A 3PRMB 2D11A 2IO0B 1M94A 2AQ3B 3E56A 3QJZA 3VTUA 2EELA 3R2TA 4WIPA 2TSSA 4EZKA 4NNJB 5E6NA 3UIOB 2JVCA 2JWZA 1OQYA 3I63C 2O2VB 4ANXA 4RH6A 2BWES 4LNIA 3V05A 4ZHOA 2KDBA 1LO5D 1DGJA 4IM0A 2NBUA 2IO2B 3O13A 3PV1A 2V4LA 3QX1A 3CIRB 4JWSC 3ZW3A 1JCKB 5HHDG 5JHAA 2IZVB 2XBBC 2O6VB 2BBCA 4KGRA 5LXHA 2MW5A 2INPE 2MHJA 4HPMB 2KX0A 3EHVA 4JX1C 1T6BX 1YD8U 2IJ0A 2L83A 2KJ6A 5H92C 3MTNB 1C4AA 1FRDA 2DAFA 2NBWB 1YN3A 2N1WA 2HTME 2KOXA 3AEAB 3U52E 1ET9A 2KACA 1WE6A 3EA6A 3I5JC 1UBIA 1L6VA 1V2YA 3KYCD 3A4SC 5BO4B 1WJUA 4XC2A 2LVQA 1NI3A 2ZNVB 3ZDMC 5CTRC 1TS4A 4LTUA 4ARCA 2WDRB 3N32A 3NG0A 4R3DA 3RT3B 3R8BA 3JSVB 2O2VA 1L4ZB 3B08A 3L13A 4ICVA 4L23A 1C9FA 3RN9C 5IO9A 2PEAA 2WYQA 4FADA 4PS7A 1D5ZC 2MEKA 1D4BA 4WAAA 2WWZA 3AE9B 2WX0A 3JVZX 4K81A 1UNSA 4OZCA 1XEEA 2LI5A 3H1UA 3VR8B 1SJED 2WGSA 4KV2A 2O6VA 3NOBA 2JSVX 3ZUNA 2BYFA 2PW9A 3IXSA 5BYSA 1E7PB 4XE0A 4XWTA 2W55A 2RR9A 2BWFA 1PDXA 1RFAA 2MH7A 2KXJA 4HRSA 4LJPB 4WURA 4BOSC 3KW5B 1PFDA 2OOBB 4ZYSA 2M0AA 1J7AA 4HCNB 1FXTB 3KQ4A 3MFGA 3DQVA 1Z5SB 4B9KA 3OJ4B 2ZVNA 3LJ3A 2ZJDA 2W54A 3ZGZA 1WGHA 3JSVA 1T0RC 2BYVE 2BF8B 4USAA 5G2NA 3W1SA 3DBLI 4KX6B 4HLEA 1IYFA 3AE2B 2M0XA 2LVPA 1UELA 1OTRB 2W82A 3NZUA 2G4DB 2INCC 4W9JA 2AEHA 2NBVB 2N1VA 5AUIA 3D32A 1ISNA 1OEYA 1N5XA 4BOZB 2ON8A 5J18A 4IKGA 2JZPA 5J2RA 1V9JA 4IW0A 3N1XC 1FCCC 2LJIA 3SFEB 4LLGM 2V4IB 1UGMA 1IP9A 3ZJVA 4S17A 3VUWA 4JGHB 4C7ZA 1J7BA 4AQ7A 1KLUD 1P9DU
chains in the Genus database with same CATH topology
1SBBB 4L1BA 2LHEA 1FNWA 5BYQA 1AYFA 4CQNA 1XLOA 2WXKA 3UI3A 4Q2JA 1GT8A 1XXGA 2BS4B 2WDVB 2J52A 1GAQB 1SE2A 4A8XC 1YN4A 1T5XD 5C3JB 1KH0A 1UUPA 1CJEA 3I9V1 2DBYA 4RCOA 4REZA 3TSSA 2Y3AA 1BMLC 1B1ZA 1C78A 3V3XA 1IGCA 3GS2A 3AB5A 1FNVA 2W3RA 3URYA 1WGKA 1MPEA 2D5GA 3NVYA 1PGAA 5HFYA 1NVID 1HZ5A 1V1PB 1XCQL 4OVZA 3NVWA 5AUKA 2N9LA 1QKZA 5MPOA 5TSSA 4C80A 1E9MA 1YQ3B 3MHZA 1QOGA 3NUHB 1WYGA 1GOZA 3VQIA 1N5WA 1JROA 1I4GA 1NEKB 4C56C 2LEKA 2BB6A 3C8YA 4KGSA 3AECB 1I4QA 2ONQA 1M4VA 1RFKA 5T8IA 5I4DA 3W5VB 1HZ6A 1L0YB 5FKAC 1QOBA 2KQ4X 2WQYB 1JQ4A 2FUG1 1HEZE 1QT9A 4AS1A 1BUIC 1TYGB 1ZE3D 4GDKB 3ZQ4A 3FILA 4ZHPA 1ZXHA 1RM6C 1FFUA 1B9RA 4JWUC 3LYYA 4P6VF 1EM7A 3LB8C 1K51A 5BYRA 1JW9D 3H8HA 2V0GA 5EE9A 2JYEA 1VLBA 2BTEA 4NJCA 4ZRPA 1VR9A 4DQOC 1N62A 1QF6A 2IGGA 2RDGA 3AE4B 1FMAD 1AN8A 1TJEA 1T3QA 3WCQA 1C4CA 2DWQA 3W2DA 1CZPA 2WDQB 1VZ7A 1QILA 1ROEA 3P42A 4A55A 2V3NA 2KMMA 4B0EA 1EWCA 3RPFC 1ZXIA 5G5HA 3Q8CA 2RDHA 2OEDA 1C79A 1JWAD 3IT6B 1RYJA 2KN4A 3SFDB 3ABVB 1ZPSA 2L32A 3TEYA 2G9HD 3AE6B 1FIQA 3CWIA 4B0MA 4YSZB 4RGNA 2IPKD 3Q69A 2JXTA 3CF4A 1XO3A 4WWMA 4RGOS 3VRAB 1UWXA 4YXDB 3U2SC 1TS2A 3R2IA 1DOYA 2N0SB 1VJKA 1ZP0B 3GB1A 1IBXB 2KAJA 2JWUA 1GB4A 2BS3B 3IAM1 1ACCA 2BW2A 5JXVA 4IOIE 4PT5A 1BXTA 1OFFA 2LUMA 2WXGA 1ZDVA 3Q8BA 2R61A 2WXLA 1L4DB 2KDMA 1F77A 2SAKA 2YEPB 3AEFB 1Y56A 3AE8B 3PZ8A 2LHDA 4OHJA 4YTMB 4DXFA 2CU3A 2V3PA 3KLSX 1HQRD 4O1NA 1A70A 2I2YA 1F2RC 2DYMA 2QIEB 1TS5A 3KWLA 1STEA 2WXMA 1SSNA 1DOIA 1C76A 1NYQA 3HRDD 3TEWA 1RWSA 4KKJA 1R7SA 2MJ3A 1FEHA 1FNUA 4US8A 2SEBD 1JWBD 4NZLB 1QOAA 4YTPB 4XDCA 2INNE 2M56B 4YTNB 1ENFA 2WXHA 4RGMA 4YSXB 1JWSD 2AQ2B 2PLPA 2PMVA 1K52A 3HVZA 5C2TB 4JPSA 4OW0A 4DXGA 1VZ8A 2VZKB 1H7WA 2IGHA 1SE4A 1NENB 3AE1B 4HKQA 2JYTA 2WU5B 1I7HA 4WH4A 2BT6A 1I4RA 4IDIA 1MHXA 2RPVA 5FR3A 1WXQA 1CK1A 1XLPA 2J42A 2PVOD 3U4EG 2WXRA 2WU2B 1TKYA 2K3UA 2BS2B 3GP7A 1K53A 2CJNA 1ZUD2 4P16A 3AEDB 5G5GA 3PO0A 2CJOA 4FXCA 1D5MC 2AX5A 1F2RI 2LMCA 3B2FA 1JRPA 4N6EB 1CQVA 1XLNA 3AV8A 4KKIA 1WRIA 1QQRA 3AMZA 1E10A 1E0ZA 1TY0A 1OQRA 1EU4A 1IBXA 2GI9A 4MM3B 1SIJA 2QMTA 4TSSA 2WNMA 4US9A 1TZOA 5EE1A 3NS1A 2DLBA 1EWYC 1JWUD 2OHFA 1C4PA 3NVVA 4MT5A 1N61A 1SF0A 3J9CA 2WXPA 1YNTE 4NAWB 2M19A 1ET6A 1FRRA 2NTTA 3IT4B 2GRIA 2KWDA 1KRHA 3N9YC 4A90A 1QOFA 4RF1A 2JQRB 2ZW1A 4YSYB 1IUEA 4NAMA 1C77A 2ICIA 2QSDA 3PZ7A 3ZJTA 2K5PA 3P4RB 3AEEB 2ZW0A 2MJDA 1MHHE 1H7XA 1VRAB 1FD6A 4UDUC 2N7JA 2PVGC 1DYQA 3NVZA 4WQMA 5EE3A 2E3TA 3AM9A 3VRBB 2AQ3B 1K50A 1YJIA 3E56A 4J3OD 2H88B 4HJGE 4XWWA 2GB1A 3NRZA 1MI0A 1MVKA 2EELA 3MC0B 2TSSA 3R2TA 1XCTL 4WIPA 1I4PA 4WAFA 3BYYB 1WWTA 1Q10A 1TKGA 5D3IB 2L52A 3ZYYX 4C7YA 1E6EB 1V8CA 4GLSC 4MACA 4RH6A 3P4SB 3EUB2 2Z8LA 3SEBA 4EE2A 1V97A 3V05A 4ZHOA 4HROA 4MH8A 1LO5D 1ESFA 1DGJA 1J7CA 5E6JA 1AW7A 3AEGB 3BK2A 1SXTA 1UWMA 2WXFA 2ACZB 1SE3A 3O13A 3BIID 3BVGA 2WS3B 3CIRB 3AE3B 4JWSC 3L4PA 2WXOA 1JCKB 5HHDG 2WXJA 2WXQA 2QJLA 2BBCA 2LFIA 4KGRA 4KGTA 2Q5WD 2INPE 4YT0B 3TUOA 2YEPF 4JX1C 1PGBA 4L2YA 5GXGB 2NTSA 4XDDA 1T6BX 2IJ0A 3MJ5A 2L83A 2AQ1B 3B9JA 1FCLA 1VZ6A 5H92C 5BMHA 1C4AA 1PUTA 2Y5PA 1GPXA 1FRDA 2FBWB 1L0VB 1P7EA 4OZBA 1XLQA 5D3DA 1GTHA 4ITKA 1IGDA 1HXYD 1PYWD 1YN3A 1YMHE 2HTME 3U52E 3AEAB 1ET9A 2KACA 3EA6A 4TQ0A 5H8YE 4A9AA 4D2KA 1L6VA 4HKZE 3RFZB 3I57A 5LNK1 2I38A 1NI3A 1TS4A 4LTUA 4ARCA 4RGTA 2WDRB 4OZAA 1KFYB 4R3DA 2LGIA 3R8BA 4H2AA 1EU3A 3TEZA 3E9SA 1KLGD 3MP9A 4A6QA 1L4ZB 3AEBB 2J4XA 4L23A 1WSPA 1C9FA 3P4QB 1XF5L 1GB1A 2B76B 1TKEA 1ZOYB 2W3SA 3LXFA 1I4XA 3T3OA 1JMLA 1P7FA 1D5ZC 2MEKA 4TQ1A 3OWEB 1V1OA 2XN9C 3T3NA 3BVZA 3DWGC 1NYRA 3FC4A 4ARIA 3AE7B 1D4BA 2EKIA 2VZKD 3AE9B 3W5UB 1PGXA 1UNSA 1YN5A 4OZCA 2H89B 1XEEA 2BYTA 5BMIA 1JALA 3VR8B 1SJED 2K0PA 4TMAB 2WXIA 1TS3A 1UGJA 2JSVX 3HUIA 4M0WA 2PW9A 3EGRA 3IXSA 2WLBA 2E6XA 5BYSA 1E7PB 4XE0A 4XWTA 4HEA1 2W55A 1YJJA 1I4HA 3W9CB 1N63A 1L0XB 1PDXA 3IAS1 3P4PB 2PIAA 2MH7A 1FM0D 3HVDA 4HRSA 2PTLA 3AN1A 4WURA 4ZOHC 1FO4A 1SB3C 2WXNA 1AWDA 2WP9B 1L6UA 3FAHA 2JX5A 1PFDA 2HDEA 5HI1A 4ZYSA 3NZ3A 2M0AA 1J7AA 2BB5A 5EE0A 2FE8A 2Y5CA 3KQ4A 3MFGA 1D5XC 1ZDXA 2QEJC 2QILA 2IGDA 2N9KA 3ETRA 1SEBD 1GTEA 3ZJUA 3P63A 5FK9C 1FXAA 2W54A 2MJEA 5D7GA 3ZGZA 4ZRQA 4RFBA 4N58A 1L5PA 3B2GA 5BMGA 1KTKA 3BVMA 1FXIA 1TY2A 3SR6A 4USAA 3W1SA 1VDVA 4KX6B 3TEXA 4RNAA 3BK1A 1QLBB 3AE2B 2RMMA 2K22A 2K9XA 3DWMA 1KF6B 2W82A 2DYOA 1D6EC 2IDYA 3BYTB 2JU6X 1V1PA 1FFVA 5AUIA 4JE3B 1SJHD 3U7ZA 3P1MA 5HG2A 2NMQA 1N5XA 3Q8AA 2ON8A 2PKOA 3BZDB 3BWUD 1JWMD 2JZPA 4IKGA 2G1EA 3FILB 3AH7A 1F0ZA 1OQQA 3Q8FA 4RF0A 3VR9B 4N59A 1YQ4B 2L1AA 2J53A 4YWGG 1HA5A 1FCCC 2LJIA 2XNAC 3Q8EA 3SFEB 4LLGM 4LK0M 3AE5B 2V4IB 4GDLB 2X38A 3KWVA 3ZJVA 4C7ZA 1J7BA 4AQ7A 1N60A 1KLUD 1DOXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BS3 B;  2E3T A;  3AM9 A;  3VRB B;  1OFF A;  3DWG C;  1AYF A;  1NYR A;  3FC4 A;  1YJI A;  1XLO A;  3AE7 B;  2H88 B;  2EKI A;  1GT8 A;  3AE9 B;  3AEF B;  3NRZ A;  3W5U B;  2BS4 B;  2WDV B;  2H89 B;  3AE8 B;  1GAQ B;  4YTM B;  2CU3 A;  1JAL A;  3VR8 B;  1WWT A;  3FAH A;  1A70 A;  1TKG A;  5C3J B;  2L52 A;  3ZYY X;  4C7Y A;  1CJE A;  2QIE B;  1E6E B;  1V8C A;  2DBY A;  3HUI A;  3KWL A;  1DOI A;  2WLB A;  1NYQ A;  3HRD D;  3P4S B;  1E7P B;  1RWS A;  3AB5 A;  3EUB 2;  1R7S A;  2MJ3 A;  2W3R A;  4US8 A;  1V97 A;  1WGK A;  1JWB D;  2W55 A;  4ZHO A;  3NVY A;  1YJJ A;  4HRO A;  3W9C B;  1NVI D;  1DGJ A;  1N63 A;  1QOA A;  1PDX A;  1J7C A;  4YTP B;  3P4P B;  2PIA A;  2MH7 A;  3NVW A;  5AUK A;  3AEG B;  1FM0 D;  2M56 B;  5MPO A;  4HRS A;  4YTN B;  4C80 A;  1E9M A;  1YQ3 B;  4YSX B;  1UWM A;  3AN1 A;  4ZOH C;  1FO4 A;  1QOG A;  5C2T B;  1WYG A;  3HVZ A;  1SB3 C;  2ACZ B;  1H7W A;  1AWD A;  2WP9 B;  1NEK B;  1NEN B;  1JRO A;  1L6U A;  1N5W A;  2LEK A;  3AE1 B;  2JX5 A;  2WS3 B;  1PFD A;  3CIR B;  3BII D;  2WU5 B;  3AEC B;  3AE3 B;  4JWS C;  1I7H A;  2BT6 A;  4IDI A;  1RFK A;  3L4P A;  1J7A A;  3W5V B;  5EE0 A;  1WXQ A;  1XLP A;  2PVO D;  2Y5C A;  1QOB A;  2WQY B;  3ETR A;  2QJL A;  1GTE A;  1JQ4 A;  2WU2 B;  1TKY A;  2Q5W D;  1QT9 A;  2BS2 B;  4YT0 B;  1TYG B;  3P63 A;  2CJN A;  1ZUD 2;  4ZHP A;  4JX1 C;  1FXA A;  1RM6 C;  1FFU A;  5GXG B;  1B9R A;  2W54 A;  4JWU C;  3AED B;  2MJE A;  4P6V F;  3PO0 A;  2CJO A;  3LB8 C;  5G5G A;  4FXC A;  2L83 A;  4N58 A;  1L5P A;  2AX5 A;  1JW9 D;  3B2F A;  1JRP A;  1FXI A;  3B2G A;  3B9J A;  4N6E B;  4USA A;  1VLB A;  5EE9 A;  5H92 C;  3SR6 A;  1PUT A;  1XLN A;  1GPX A;  1VDV A;  4KX6 B;  2FBW B;  1FRD A;  1QF6 A;  3AV8 A;  1N62 A;  1L0V B;  3AE4 B;  1QLB B;  3AE2 B;  1WRI A;  3AMZ A;  1E10 A;  1E0Z A;  2K22 A;  1FMA D;  1XLQ A;  1TJE A;  1GTH A;  1T3Q A;  2K9X A;  3DWM A;  1OQR A;  1KF6 B;  4ITK A;  3WCQ A;  2DWQ A;  2HTM E;  3AEA B;  1SIJ A;  1CZP A;  5H8Y E;  4A9A A;  2WDQ B;  1L6V A;  4US9 A;  1ROE A;  5EE1 A;  1FFV A;  2KMM A;  3NS1 A;  5AUI A;  3RPF C;  1EWY C;  1ZXI A;  5G5H A;  2OHF A;  3P1M A;  3NVV A;  1NI3 A;  1N61 A;  1SF0 A;  1N5X A;  1JWA D;  1RYJ A;  3SFD B;  3ABV B;  4LTU A;  2PKO A;  2WDR B;  3AE6 B;  2M19 A;  1FIQ A;  1FRR A;  2G1E A;  3AH7 A;  1KFY B;  1F0Z A;  1OQQ A;  3CWI A;  4YSZ B;  1KRH A;  3VR9 B;  4N59 A;  3CF4 A;  1YQ4 B;  1XO3 A;  1QOF A;  4WWM A;  3VRA B;  2JQR B;  4YXD B;  3AEB B;  4YSY B;  3SFE B;  1IUE A;  3AE5 B;  1DOY A;  2N0S B;  3P4Q B;  2K5P A;  3P4R B;  3AEE B;  1VJK A;  2MJD A;  2B76 B;  1TKE A;  1ZP0 B;  1ZOY B;  2W3S A;  1H7X A;  3LXF A;  1DOX A;  4C7Z A;  1J7B A;  1N60 A;  2KAJ A;  2PVG C;  5EE3 A;  3NVZ A;  4WQM A; 
#chains in the Genus database with same CATH topology
 1WE7 A;  2LHE A;  1L7Y A;  4K1R B;  3T9L A;  3UI3 A;  1UH6 A;  1GT8 A;  2KO3 A;  1XXG A;  2BS4 B;  5IN7 A;  2V1Y A;  3ZIM A;  3O65 B;  1CJE A;  3ZRC A;  1F9J A;  4REZ A;  3V3X A;  2BKR B;  3AB5 A;  3URY A;  2N9P C;  1V81 A;  2FID A;  4K7S A;  1NVI D;  3PLU A;  2LXA A;  3NVW A;  5AUK A;  2MQJ A;  2LRU A;  2KJH B;  3PZD A;  2BQQ A;  3JW0 X;  1JRO A;  4KZC A;  3C8Y A;  4KGS A;  4K7U A;  1I4Q A;  1KLV A;  1RFK A;  2XK5 B;  5T8I A;  4XGA B;  4WJN A;  2KQ4 X;  3EC8 A;  1TYG B;  3PVL A;  4GDK B;  3ZQ4 A;  1B9R A;  3VXW A;  4P6V F;  1EM7 A;  3LB8 C;  4IC7 B;  1R4M B;  3DVN V;  1JW9 D;  2V0G A;  3S2A A;  5EE9 A;  4PS8 A;  4NJC A;  4ZRP A;  4LDT B;  2KHW B;  1FMA D;  1AN8 A;  1GG3 A;  3DHH C;  4G50 A;  2MP2 B;  1Z2M A;  2WDQ B;  2KN5 A;  1ROE A;  4A55 A;  2KMM A;  5AZF A;  1EWC A;  4BKT A;  4A3O A;  2C7N B;  3Q8C A;  2IO3 B;  1C79 A;  3SFD B;  1ZPS A;  2G9H D;  4WWO A;  3VVW B;  4EZL A;  2C5L C;  4RGN A;  2Z0D B;  4JQW C;  2JXT A;  2KMA A;  1XO3 A;  3V62 A;  1UWX A;  2RGF A;  3HIZ A;  4YXD B;  3U2S C;  1V5O A;  3R66 C;  2FAZ A;  2X8X X;  3IVF A;  3RNC C;  4HPL B;  2KAJ A;  4NJ7 A;  2J0M A;  4PT5 A;  1OFF A;  2WXG A;  1SIF A;  1ZDV A;  2WXL A;  2IO1 B;  1F77 A;  2YEP B;  4E74 A;  4OHJ A;  1CMX B;  2CU3 A;  5DCN A;  4O1N A;  1GC7 A;  3C0R B;  1WX7 A;  1SSN A;  1KOT A;  3QAQ A;  4GDK A;  1C76 A;  3EFU A;  5E6O A;  1FEH A;  1JWB D;  3RYT A;  4F7Z A;  5JZE B;  2I1K A;  4P7I A;  1TIF A;  4HCP B;  3L08 A;  1ENF A;  3APF A;  2WXH A;  2HJ1 A;  2KTR B;  2BPS A;  2CU1 A;  1VZ8 A;  2VH2 A;  2BVC A;  5C1Z A;  4HKQ A;  2QC8 A;  2GLS A;  4J6I A;  4EFO A;  2BT6 A;  1I4R A;  4IDI A;  1YX6 B;  2RPV A;  4W9E A;  5L83 A;  2DAJ A;  2LGD A;  2K3U A;  3DDC B;  1RAX A;  1ZUD 2;  2QHO A;  3B2F A;  3UIP B;  3ZDT A;  3AV8 A;  4KKI A;  2LGY A;  2ZCB A;  1WRI A;  1QQR A;  2M8S A;  1OQR A;  4FJZ A;  4BZA A;  2QMT A;  2GMI C;  2QCZ A;  3NS8 A;  4MH0 E;  2DLB A;  2LUE A;  1JWU D;  4ANW A;  3NVV A;  1P98 A;  4W9F A;  3J9C A;  1FPY A;  1ET6 A;  4FJY A;  1WR6 E;  2GRI A;  2GBM A;  3N9Y C;  4F8C B;  2EKE C;  4G11 A;  3ZNZ B;  1SE9 A;  2JQR B;  4NAM A;  3JYU A;  2QSD A;  2ZZP B;  4M02 A;  3ZJT A;  2K5P A;  5DPR A;  2MJD A;  2FCM A;  1BT0 A;  1LM8 B;  4UDU C;  2N7J A;  1WY8 A;  4TUU A;  1DYQ A;  3NVZ A;  5EE3 A;  4ASW C;  3IHP C;  2KTR A;  3WAO A;  1K50 A;  3A33 B;  4HDO A;  1YJI A;  2DX5 B;  2CKH B;  5KHO A;  4J3O D;  3Q3F A;  3L54 A;  4XWW A;  4IWO A;  2GB1 A;  1MI0 A;  3DVN U;  1XCT L;  1I4P A;  3BYY B;  1WWT A;  4EEW A;  2KDE B;  1Q10 A;  3ZYY X;  1J0G A;  4EUT A;  1V8C A;  4MAC A;  1T0S C;  2REX A;  3P4S B;  4BBN F;  3EUB 2;  1XD3 B;  2KWV B;  4HRO A;  1WM3 A;  3SHQ A;  1NBF C;  1AW7 A;  3AEG B;  2FUH B;  2EMS A;  1H4R A;  1UWM A;  4LCD E;  2L0T A;  2WXF A;  1GNU A;  5CX3 A;  2QDF A;  2WXQ A;  2QJL A;  2LFI A;  2Q5W D;  2C7M B;  3VDZ A;  3VTW A;  3TUO A;  2Z0E B;  2YEP F;  4PYU A;  1WFY A;  2KK8 A;  4XDD A;  1FCL A;  2AQ1 B;  2HTH A;  1PUT A;  1GPX A;  3W1Y A;  1L0V B;  1MG4 A;  1LXD A;  1WI0 A;  1XLQ A;  5D3D A;  1YMH E;  3L0W B;  3I3T B;  4A9A A;  3QIJ A;  3NY5 A;  3RNB C;  4FHK A;  4W9D A;  1WXV A;  2ASQ A;  2I38 A;  3WIM A;  3M95 A;  2OJR A;  2LGI A;  4BVU C;  1EU3 A;  2IYD B;  3OJ3 A;  3E9S A;  3RD2 A;  4MSQ B;  4A6Q A;  2MX2 A;  2J4X A;  1TTN A;  1E7U A;  2KNB A;  1XF5 L;  1P3Q U;  2JT4 B;  1I4X A;  3T3O A;  1JML A;  3QK0 A;  4IM3 A;  1V1O A;  2XN9 C;  3T3N A;  3BVZ A;  4HK2 A;  4ARI A;  1UBQ A;  4FUL A;  2KLC A;  5DPT A;  1PGX A;  2NR2 A;  5BMI A;  5AZH A;  5AZG A;  2WXI A;  4WWP A;  1TS3 A;  1WR1 A;  2LVO A;  1KM7 A;  2E6X A;  2WLB A;  3TMP B;  4IUM B;  2KDI A;  1N63 A;  3IAS 1;  2RPQ A;  2GBN A;  3ZKJ C;  1QZE A;  2PTL A;  3DBR B;  3H6N A;  4GDL A;  2JX5 A;  2HDE A;  2K6D B;  3NZ3 A;  3ZXR A;  4K3B A;  3DCG A;  4BKS A;  1P0R A;  3K9P B;  2QEJ C;  2N9K A;  4AJY B;  3ZJU A;  5E6P A;  4FA6 A;  3VH3 B;  5D7G A;  2BGF A;  4DHJ D;  4RFB A;  4AOF A;  2CR5 A;  1KTK A;  3BVM A;  1FXI A;  3M3J A;  3SR6 A;  5AEK B;  2RD0 A;  3U30 A;  1H8C A;  3VAW A;  1V49 A;  2RMM A;  3DWM A;  2DZJ A;  2DYO A;  1D6E C;  1A5R A;  3WAL A;  2VH1 A;  1SJH D;  1E8W A;  3U7Z A;  3P1M A;  3Q8A A;  2MBE A;  5G55 A;  1WGD A;  3GOE A;  3RUL A;  2W9N A;  3BZD B;  1JWM D;  2G1E A;  1VD2 A;  4FBJ B;  2C7H A;  3QCA A;  2L1A A;  2WHI A;  1HA5 A;  2YLM A;  3DBH B;  4LK0 M;  4M8M A;  3KWV A;  3B9J A;  3GZN B;  3NHE B;  2Y5B B;  1AYF A;  4YL8 A;  3A9K B;  4LNF A;  1NI2 A;  2WDV B;  1D3Z A;  5CHV C;  1V80 A;  1YN4 A;  1T5X D;  3RZF A;  4FLH A;  2DBY A;  5D6J B;  1BML C;  1C78 A;  2Z59 B;  1GC6 A;  1IGC A;  4MGZ E;  5C23 A;  3HHM A;  1FNV A;  1OEY J;  2FNJ B;  3TL5 A;  3NVY A;  2R2Q A;  5HFY A;  4XYC A;  4MEM A;  2L7R A;  2JPH A;  5D2M B;  3HM3 A;  3KUZ A;  5MPO A;  5TSS A;  2J7Q B;  3VQI A;  2ONQ A;  1M4V A;  2D3A A;  1PQS A;  5I4D A;  1K8R B;  3ONS A;  2ZPY A;  4WQO B;  3V6E B;  2JY6 A;  1RM6 C;  3DOW A;  2AL6 A;  3LYY A;  4DHJ B;  2LXC A;  4NY0 A;  2KTF A;  2DEN B;  1TT5 B;  1N62 A;  2FCS A;  2IGG A;  4KDI C;  3AE4 B;  2L00 B;  3K9O B;  3QAR A;  1T3Q A;  4FN2 A;  3W2D A;  3Q3O C;  4ANV A;  1CZP A;  3VUY A;  1U4A A;  1QIL A;  3P42 A;  4GB9 A;  2I1J A;  3AU5 A;  3Q3M C;  5G5H A;  2L3Z A;  2IY1 B;  3A9K A;  3PHX B;  3N20 C;  1FIQ A;  1SGH A;  2GOW A;  3DBS A;  2IPK D;  3CF4 A;  3V60 A;  5J17 A;  5IA7 A;  1N6Z A;  1V86 A;  1VJK A;  1ZP0 B;  3GB1 A;  3X0W A;  1DOX A;  3PRE A;  3ZO5 B;  2BS3 B;  1ZGU B;  1YX5 B;  2BW2 A;  2K6Q A;  2ZNV C;  4IOI E;  2KZR A;  4TV3 A;  2LUM A;  1WXS A;  4G3X B;  3AEF B;  4MM3 A;  1Y56 A;  3AE8 B;  2LHD A;  4DXF A;  4LNK A;  3KLS X;  4XZ4 A;  2I2Y A;  1A70 A;  2JZ3 B;  2QIE B;  3W1S C;  2WXM A;  1R4N B;  2JZZ A;  1VCB A;  2J0K A;  4RM8 A;  4WJP A;  1FNU A;  2KFK B;  2HD5 B;  1V6E A;  1E8X A;  4XDC A;  2INN E;  4LNN A;  2PLP A;  2KQ7 A;  2PMV A;  1K52 A;  3HVZ A;  1WRD B;  1H7W A;  2IGH A;  3RUI B;  4WH4 A;  3SDL C;  1T0Y A;  1XLP A;  2J42 A;  1YJ1 A;  3VFK A;  1Y8R C;  2WU2 B;  2ZCC A;  2MA9 B;  2UYZ B;  2CJN A;  4JIO U;  3H7P B;  3ECI A;  2CJO A;  1JRP A;  4HJK A;  4DK5 A;  5IP4 D;  1UZX B;  1CQV A;  1XLN A;  1TY0 A;  2C9W B;  2GI9 A;  1F1H A;  1WGG A;  3DHI C;  1EWY C;  2OHF A;  1EUV B;  1WX9 A;  4DDI D;  1FRR A;  4B95 A;  4W9G A;  3DHG C;  1KRH A;  3PGE A;  3WAM A;  1RRB A;  3A9J A;  4A90 A;  1QOF A;  4K7W A;  4RF1 A;  4YSY B;  1C77 A;  2KFK A;  3PZ7 A;  4QAY A;  3CSF A;  3OLM D;  4MGY E;  1MHH E;  3KVF B;  3PRP B;  2MCN B;  2XEW A;  4EKU A;  2KDF B;  2E3T A;  2EMT A;  2N7D A;  3GE3 C;  3VTV A;  1TGZ B;  4S0R A;  3QC8 B;  2H88 B;  1WYW B;  4HJG E;  3NRZ A;  4AP4 C;  1HE8 A;  4WAF A;  4II2 B;  2G45 B;  4NJ6 A;  5DPS A;  2KJR A;  1TKG A;  5D3I B;  4C7Y A;  1E6E B;  5GMV A;  2KYW A;  3QHT A;  3H7P A;  1F52 A;  2Z8L A;  4EE2 A;  1V97 A;  4MH8 A;  1J7C A;  4M01 A;  3VH4 B;  3Q3N C;  1WZ3 A;  1J8C A;  5TR5 A;  3BII D;  3BVG A;  1I42 A;  3AE3 B;  2AWT A;  3L4P A;  2WXO A;  4IWQ A;  3KUD B;  2WXJ A;  1NDD A;  2JUO A;  4M0W B;  3HK0 A;  1PGB A;  5GXG B;  4CO7 A;  3MJW A;  1VZ6 A;  5BMH A;  4W9K A;  2Y5P A;  2FBW B;  1P7E A;  4ITK A;  1HXY D;  3PT2 B;  4TQ0 A;  5H8Y E;  2M17 A;  4HKZ E;  4F1S A;  3RFZ B;  1J19 A;  4WJQ A;  1WMH B;  3B0A A;  2NCN A;  1IPG A;  4H2A A;  2ZVO A;  4LJO B;  3U7D A;  1KLG D;  4MDK E;  4W9L A;  3AEB B;  1WSP A;  3P4Q B;  1LQB A;  4ACF A;  1E7V A;  2B76 B;  1TKE A;  2W3S A;  3LXF A;  2LD9 A;  2VRR B;  4LNO A;  1P7F A;  4TQ1 A;  3OWE B;  3DWG C;  3FC4 A;  4NQK E;  2KQS A;  3AE7 B;  2VZK D;  2PE6 B;  1C1Y B;  2H89 B;  2BYT A;  4GGQ A;  2KWU B;  3TJP A;  3APC A;  4TMA B;  3SU8 X;  2IY0 B;  2GBK A;  4M0W A;  3EGR A;  1R4M I;  1YJJ A;  3RCZ A;  3W9C B;  1FM0 D;  1OGW A;  1WJN A;  3HVD A;  3AN1 A;  3HM6 X;  1FO4 A;  4BAX A;  4P1B C;  1SB3 C;  1AWD A;  2WP9 B;  2L8J A;  4DDG D;  4DBG A;  4EOY A;  2IBI B;  2YVC A;  4W9C A;  3N1Y C;  2Y5C A;  1D5X C;  1ZDX A;  2PE9 A;  2QIL A;  1WMH A;  1GTE A;  3Q14 C;  4MGK E;  4DHZ E;  2DHZ A;  1EO6 A;  3P63 A;  1FXA A;  2BYE A;  2NVU I;  4ZRQ A;  3B2G A;  3TEX A;  4DHZ B;  1QLB B;  3AUL A;  2K22 A;  2K9X A;  2IDY A;  1WGR A;  2B3A A;  3BYT B;  2JU6 X;  4G0N B;  1V1P A;  1FFV A;  3P2B A;  2HE7 A;  2K8C A;  1WM2 A;  2LJ5 A;  1G6J A;  1WJ6 A;  4AJW A;  3TBL D;  4ICU A;  1F0Z A;  2NS5 A;  2DZK A;  5L95 C;  4JL9 A;  3Q8F A;  3VR9 B;  4N59 A;  4B6W A;  4YWG G;  2XNA C;  2BKF A;  4GDL B;  3NZS A;  3M62 B;  1N60 A;  1WX8 A;  1WXM A;  1SBB B;  4L1B A;  2PPH A;  5BYQ A;  3T8M A;  1YIW A;  2WXK A;  1EF5 A;  2NPT B;  4A8X C;  1UUP A;  3WAP A;  1X1M A;  4RCO A;  3TSS A;  2O6V D;  4M00 A;  4XX5 A;  3BIN A;  1WGK A;  1MPE A;  5CHF A;  1PGA A;  4A3P A;  1XCQ L;  3Q6B A;  1QKZ A;  4C80 A;  1YQ3 B;  1C3T A;  3MHZ A;  1QOG A;  3NUH B;  4DXA B;  4AWJ A;  1NEK B;  4C56 C;  3L16 A;  2LEK A;  3PS6 A;  3AEC B;  2D10 A;  1I35 A;  4MSM B;  1HZ6 A;  1L0Y B;  1QOB A;  2MLB A;  1JQ4 A;  2FUG 1;  1HEZ E;  5LLI A;  1BUI C;  1ZE3 D;  4ZHP A;  1ZXH A;  2HJ8 A;  1FFU A;  4JWU C;  2G3Q B;  5IKC M;  1K51 A;  4HDQ A;  5KHQ A;  4FJV B;  2JYE A;  2OJW A;  1VR9 A;  1QF6 A;  4BKG A;  4ANU A;  1TJE A;  3FKY A;  1WZ0 A;  2V3N A;  4B0E A;  2A4Z A;  2RDH A;  2OED A;  3IT6 B;  3Q2A C;  3UGB B;  1RYJ A;  2DYB A;  2NPT A;  4DWF A;  3AE6 B;  5IOI A;  3CWI A;  4II3 B;  4YSZ B;  2WX1 A;  3C19 A;  1LGR A;  4HVB A;  3DBL B;  3KH0 A;  1TS2 A;  1DOY A;  2N0S B;  4HPP A;  5FR6 A;  3TCA A;  2KVZ A;  4CYE A;  1IBX B;  1GB4 A;  3IAM 1;  2IND C;  5JXV A;  2JRH A;  3UIN B;  1HTQ A;  1L4D B;  2KDM A;  2SAK A;  3AXC A;  3PZ8 A;  4KVG B;  4GOC A;  4ZRJ A;  4ZRI A;  1F2R C;  3KWL A;  3PHW B;  3ZNG C;  2MRP A;  1NYQ A;  3HRD D;  3TEW A;  4KKJ A;  1R7S A;  2MJ3 A;  1WH3 A;  2KFJ A;  4RGM A;  3N3K B;  4OW0 A;  3UQB A;  1GJZ A;  4OVU A;  1NEN B;  3AE1 B;  3VUX A;  2A5U A;  3ZRF A;  3ZVV A;  1MHX A;  4CHK A;  2M4N A;  4GU2 A;  3WA0 A;  2MWS B;  1TKY A;  2BS2 B;  2GBJ A;  3DPD A;  2UU7 A;  2AYO B;  2MSE D;  3AED B;  5G5G A;  2WDT B;  1D5M C;  3ZNI D;  1F2R I;  2LMC A;  4PYZ A;  4A20 A;  3BY4 B;  2M1M A;  3UQA A;  1E10 A;  3PLV A;  3ENE A;  1IBX A;  4MM3 B;  1SIJ A;  4TSS A;  2WNM A;  4US9 A;  1TZO A;  3LDZ E;  3NS1 A;  2D3C A;  1N61 A;  3TIX A;  2WXP A;  1YNT E;  1ZKH A;  4NAW B;  2NTT A;  5LXI B;  3IT4 B;  2KC1 A;  3ALB A;  4PK1 A;  4M8N A;  3DVG Y;  1IUE A;  3OAW A;  4X57 B;  2LRW A;  3CMM B;  3H9D A;  3V61 A;  3DBR I;  1YOV B;  3PTF C;  3VRB B;  1E8Y A;  3RNG C;  1MVK A;  2CHZ A;  3MC0 B;  5JH5 C;  2AL3 A;  3ZLZ A;  2L52 A;  1L2N A;  3PSE B;  4GLS C;  3QWZ B;  2V3S A;  3SEB A;  2K8B A;  3IBE A;  1AAR A;  2CHX A;  3KUC B;  1ESF A;  3IFW B;  5E6J A;  3BK2 A;  1SXT A;  2LGS A;  3L10 B;  4GXB A;  4LDT D;  2ACZ B;  1SE3 A;  4MJS B;  2WS3 B;  4W9I A;  2D2Q A;  4IM2 A;  2K1F A;  2JRI B;  3ML8 A;  3A9J B;  2L76 A;  2PJH A;  4KGT A;  3A1Q B;  4YT0 B;  4NAW A;  5EDS A;  2ZPN A;  3ZNH B;  1WIA A;  4L2Y A;  2NTS A;  3MJ5 A;  3AU4 A;  2GBR A;  3QA8 A;  2N9E B;  3DBH I;  1Q0W B;  3MHS D;  5IAA C;  4GMV A;  4OZB A;  1GTH A;  1IGD A;  1PYW D;  4NPN A;  4ZRK A;  4C00 A;  3GZN I;  4JLC A;  4D2K A;  2LZ6 A;  3N1Z C;  3I57 A;  3V6C B;  5LNK 1;  4GN1 A;  3ZXV A;  4RGT A;  3M63 B;  4OZA A;  4PS3 A;  4KSL C;  1KFY B;  1E8Z A;  3TEZ A;  3RNF C;  4MGI E;  4E71 A;  1WGY A;  3MP9 A;  2K25 A;  4ZYN A;  3EEC A;  1GB1 A;  1WF9 A;  1ZOY B;  3RI7 C;  3GE8 C;  2KAN A;  4MJS A;  3ZTD A;  3APD A;  1NYR A;  2CS4 A;  1WJ4 A;  2EKI A;  3H7S A;  1YQB A;  3W5U B;  1YN5 A;  1RLF A;  2KMC A;  4MEL A;  1JAL A;  1Q1O A;  2K0P A;  5JHB A;  5CHW A;  3A1Q A;  3HUI A;  1UGJ A;  1TBE A;  4GIV A;  4HEA 1;  2N7E A;  1XT9 B;  1I4H A;  1L0X B;  3P4P B;  2PIA A;  3QQ8 B;  3NJT A;  2RSU A;  4ZOH C;  3R7R A;  2MBQ A;  3MC8 A;  1XQQ A;  2WXN A;  1L6U A;  3FAH A;  3R3M A;  5HI1 A;  4K3C A;  2BB5 A;  3PRZ A;  5EE0 A;  5DPW A;  2FE8 A;  4ZDV A;  3DVG X;  2IGD A;  3ETR A;  2G4S A;  1SEB D;  3RNE C;  4I6L B;  5FK9 C;  4GSW A;  2N4F A;  2MJE A;  2KLG A;  4N58 A;  1L5P A;  2DZI A;  5BMG A;  1TY2 A;  2CHW A;  1VDV A;  4RNA A;  3BK1 A;  5D94 A;  1UD7 A;  4C4V B;  2R2O A;  1KF6 B;  4IWP A;  1KJT A;  3KYD D;  2C60 A;  2K39 A;  4JE3 B;  1S1Q B;  1V5T A;  4W9H A;  5HG2 A;  2NMQ A;  1LFD A;  2ZEQ A;  1P1A A;  2PKO A;  3BWU D;  3UF8 A;  1MJD A;  3FIL B;  3U8Z A;  3AH7 A;  1OQQ A;  2XK5 A;  4RF0 A;  1YQ4 B;  2J53 A;  1R4N I;  3CF6 E;  3EFC A;  3Q8E A;  2MBO A;  3AE5 B;  5HKH A;  2FCQ A;  2MBH A;  2X38 A;  1GUA B;  2J0J A;  4RMA A;  4KIK B;  1Q5W B;  1FNW A;  4CQN A;  2JXX A;  1XLO A;  4Q2J A;  3RNA C;  2J52 A;  2MP2 A;  1GAQ B;  1SE2 A;  2FCN A;  5C3J B;  1KH0 A;  2D3B A;  3I9V 1;  1UF0 A;  4KZ0 A;  2Y3A A;  4KDL B;  1B1Z A;  2LGX A;  3GS2 A;  2W3R A;  2KD0 A;  2D5G A;  1E90 A;  3PPA A;  2L0F A;  1HZ5 A;  1V1P B;  4OVZ A;  3MC9 A;  2N9L A;  1MFW A;  1E9M A;  2LWP A;  4C4V A;  4BBN C;  1WYG A;  1GOZ A;  1N5W A;  1I4G A;  2D3G A;  2UWQ A;  2BB6 A;  3L17 A;  2LAS A;  3A4R A;  3W5V B;  2RDB C;  5FKA C;  2WQY B;  2FIF A;  4BKS D;  1QT9 A;  4AS1 A;  3FIL A;  3X23 A;  5BYR A;  2KKC A;  3H8H A;  1VLB A;  2BTE A;  4FHJ A;  4DQO C;  2RDG A;  2V9H A;  3VHT C;  2DZM A;  3WCQ A;  1C4C A;  2DWQ A;  3RZW C;  3IG3 A;  1VZ7 A;  4KIK A;  3RPF C;  1ZXI A;  3SD5 A;  1JWA D;  4URK A;  4N9F 4;  2KN4 A;  3ABV B;  2L32 A;  3TEY A;  2MBB B;  3WAN A;  4B0M A;  4KSK C;  4OVV A;  3Q69 A;  4WWM A;  4RGO S;  3VRA B;  4RM9 A;  4HXD A;  3R2I A;  1WXA A;  4TKN A;  2JWU A;  1S3S G;  3B1L X;  1TZ1 A;  4NQL B;  1ACC A;  1EF1 A;  1BXT A;  4I6N B;  4BFR A;  2N9X A;  2R61 A;  3Q8B A;  3AI5 A;  3OG5 A;  4YTM B;  2V3P A;  1HQR D;  2DYM A;  1TS5 A;  1STE A;  1DOI A;  1E5W A;  2DNF A;  3ZTC A;  1RWS A;  4AUQ C;  1HTO A;  4US8 A;  2SEB D;  4NZL B;  2K8H A;  1QOA A;  4YTP B;  3R7Q A;  2M56 B;  4YTN B;  4YSX B;  1JWS D;  2AQ2 B;  2KC2 A;  4JPS A;  4DXG A;  5C2T B;  2VZK B;  1SE4 A;  2L05 A;  4P1C C;  2JYT A;  2WU5 B;  1I7H A;  5FR3 A;  1WXQ A;  1CK1 A;  2PVO D;  4HWI B;  3U4E G;  1JRU A;  2WXR A;  3GP7 A;  1K53 A;  4P16 A;  4WJO A;  3PO0 A;  2KT7 A;  4FXC A;  2AX5 A;  4N6E B;  3ML9 A;  3AMZ A;  2KX3 A;  1E0Z A;  1EU4 A;  5EE1 A;  2JF5 A;  1ZW7 A;  4E3C A;  4IG7 B;  3RMK C;  1C4P A;  4MT5 A;  1SF0 A;  2M19 A;  4I6P A;  3Q3J A;  2KWD A;  3CST A;  4WWN A;  2D07 B;  1MG8 A;  3N30 A;  2ZW1 A;  2ICI A;  1T0Q C;  3P4R B;  3AEE B;  2ZW0 A;  2KWC A;  1H7X A;  1VRA B;  2KVR A;  1FD6 A;  4EZJ A;  2PVG C;  4WQM A;  3AM9 A;  3PRM B;  2D11 A;  2IO0 B;  1M94 A;  2AQ3 B;  3E56 A;  3QJZ A;  3VTU A;  2EEL A;  3R2T A;  4WIP A;  2TSS A;  4EZK A;  4NNJ B;  5E6N A;  3UIO B;  2JVC A;  2JWZ A;  1OQY A;  3I63 C;  2O2V B;  4ANX A;  4RH6 A;  2BWE S;  4LNI A;  3V05 A;  4ZHO A;  2KDB A;  1LO5 D;  1DGJ A;  4IM0 A;  2NBU A;  2IO2 B;  3O13 A;  3PV1 A;  2V4L A;  3QX1 A;  3CIR B;  4JWS C;  3ZW3 A;  1JCK B;  5HHD G;  5JHA A;  2IZV B;  2XBB C;  2O6V B;  2BBC A;  4KGR A;  5LXH A;  2MW5 A;  2INP E;  2MHJ A;  4HPM B;  2KX0 A;  3EHV A;  4JX1 C;  1T6B X;  1YD8 U;  2IJ0 A;  2L83 A;  2KJ6 A;  5H92 C;  3MTN B;  1C4A A;  1FRD A;  2DAF A;  2NBW B;  1YN3 A;  2N1W A;  2HTM E;  2KOX A;  3AEA B;  3U52 E;  1ET9 A;  2KAC A;  1WE6 A;  3EA6 A;  3I5J C;  1UBI A;  1L6V A;  1V2Y A;  3KYC D;  3A4S C;  5BO4 B;  1WJU A;  4XC2 A;  2LVQ A;  1NI3 A;  2ZNV B;  3ZDM C;  5CTR C;  1TS4 A;  4LTU A;  4ARC A;  2WDR B;  3N32 A;  3NG0 A;  4R3D A;  3RT3 B;  3R8B A;  3JSV B;  2O2V A;  1L4Z B;  3B08 A;  3L13 A;  4ICV A;  4L23 A;  1C9F A;  3RN9 C;  5IO9 A;  2PEA A;  2WYQ A;  4FAD A;  4PS7 A;  1D5Z C;  2MEK A;  1D4B A;  4WAA A;  2WWZ A;  3AE9 B;  2WX0 A;  3JVZ X;  4K81 A;  1UNS A;  4OZC A;  1XEE A;  2LI5 A;  3H1U A;  3VR8 B;  1SJE D;  2WGS A;  4KV2 A;  2O6V A;  3NOB A;  2JSV X;  3ZUN A;  2BYF A;  2PW9 A;  3IXS A;  5BYS A;  1E7P B;  4XE0 A;  4XWT A;  2W55 A;  2RR9 A;  2BWF A;  1PDX A;  1RFA A;  2MH7 A;  2KXJ A;  4HRS A;  4LJP B;  4WUR A;  4BOS C;  3KW5 B;  1PFD A;  2OOB B;  4ZYS A;  2M0A A;  1J7A A;  4HCN B;  1FXT B;  3KQ4 A;  3MFG A;  3DQV A;  1Z5S B;  4B9K A;  3OJ4 B;  2ZVN A;  3LJ3 A;  2ZJD A;  2W54 A;  3ZGZ A;  1WGH A;  3JSV A;  1T0R C;  2BYV E;  2BF8 B;  4USA A;  5G2N A;  3W1S A;  3DBL I;  4KX6 B;  4HLE A;  1IYF A;  3AE2 B;  2M0X A;  2LVP A;  1UEL A;  1OTR B;  2W82 A;  3NZU A;  2G4D B;  2INC C;  4W9J A;  2AEH A;  2NBV B;  2N1V A;  5AUI A;  3D32 A;  1ISN A;  1OEY A;  1N5X A;  4BOZ B;  2ON8 A;  5J18 A;  4IKG A;  2JZP A;  5J2R A;  1V9J A;  4IW0 A;  3N1X C;  1FCC C;  2LJI A;  3SFE B;  4LLG M;  2V4I B;  1UGM A;  1IP9 A;  3ZJV A;  4S17 A;  3VUW A;  4JGH B;  4C7Z A;  1J7B A;  4AQ7 A;  1KLU D;  1P9D U; 
#chains in the Genus database with same CATH homology
 1SBB B;  4L1B A;  2LHE A;  1FNW A;  5BYQ A;  1AYF A;  4CQN A;  1XLO A;  2WXK A;  3UI3 A;  4Q2J A;  1GT8 A;  1XXG A;  2BS4 B;  2WDV B;  2J52 A;  1GAQ B;  1SE2 A;  4A8X C;  1YN4 A;  1T5X D;  5C3J B;  1KH0 A;  1UUP A;  1CJE A;  3I9V 1;  2DBY A;  4RCO A;  4REZ A;  3TSS A;  2Y3A A;  1BML C;  1B1Z A;  1C78 A;  3V3X A;  1IGC A;  3GS2 A;  3AB5 A;  1FNV A;  2W3R A;  3URY A;  1WGK A;  1MPE A;  2D5G A;  3NVY A;  1PGA A;  5HFY A;  1NVI D;  1HZ5 A;  1V1P B;  1XCQ L;  4OVZ A;  3NVW A;  5AUK A;  2N9L A;  1QKZ A;  5MPO A;  5TSS A;  4C80 A;  1E9M A;  1YQ3 B;  3MHZ A;  1QOG A;  3NUH B;  1WYG A;  1GOZ A;  3VQI A;  1N5W A;  1JRO A;  1I4G A;  1NEK B;  4C56 C;  2LEK A;  2BB6 A;  3C8Y A;  4KGS A;  3AEC B;  1I4Q A;  2ONQ A;  1M4V A;  1RFK A;  5T8I A;  5I4D A;  3W5V B;  1HZ6 A;  1L0Y B;  5FKA C;  1QOB A;  2KQ4 X;  2WQY B;  1JQ4 A;  2FUG 1;  1HEZ E;  1QT9 A;  4AS1 A;  1BUI C;  1TYG B;  1ZE3 D;  4GDK B;  3ZQ4 A;  3FIL A;  4ZHP A;  1ZXH A;  1RM6 C;  1FFU A;  1B9R A;  4JWU C;  3LYY A;  4P6V F;  1EM7 A;  3LB8 C;  1K51 A;  5BYR A;  1JW9 D;  3H8H A;  2V0G A;  5EE9 A;  2JYE A;  1VLB A;  2BTE A;  4NJC A;  4ZRP A;  1VR9 A;  4DQO C;  1N62 A;  1QF6 A;  2IGG A;  2RDG A;  3AE4 B;  1FMA D;  1AN8 A;  1TJE A;  1T3Q A;  3WCQ A;  1C4C A;  2DWQ A;  3W2D A;  1CZP A;  2WDQ B;  1VZ7 A;  1QIL A;  1ROE A;  3P42 A;  4A55 A;  2V3N A;  2KMM A;  4B0E A;  1EWC A;  3RPF C;  1ZXI A;  5G5H A;  3Q8C A;  2RDH A;  2OED A;  1C79 A;  1JWA D;  3IT6 B;  1RYJ A;  2KN4 A;  3SFD B;  3ABV B;  1ZPS A;  2L32 A;  3TEY A;  2G9H D;  3AE6 B;  1FIQ A;  3CWI A;  4B0M A;  4YSZ B;  4RGN A;  2IPK D;  3Q69 A;  2JXT A;  3CF4 A;  1XO3 A;  4WWM A;  4RGO S;  3VRA B;  1UWX A;  4YXD B;  3U2S C;  1TS2 A;  3R2I A;  1DOY A;  2N0S B;  1VJK A;  1ZP0 B;  3GB1 A;  1IBX B;  2KAJ A;  2JWU A;  1GB4 A;  2BS3 B;  3IAM 1;  1ACC A;  2BW2 A;  5JXV A;  4IOI E;  4PT5 A;  1BXT A;  1OFF A;  2LUM A;  2WXG A;  1ZDV A;  3Q8B A;  2R61 A;  2WXL A;  1L4D B;  2KDM A;  1F77 A;  2SAK A;  2YEP B;  3AEF B;  1Y56 A;  3AE8 B;  3PZ8 A;  2LHD A;  4OHJ A;  4YTM B;  4DXF A;  2CU3 A;  2V3P A;  3KLS X;  1HQR D;  4O1N A;  1A70 A;  2I2Y A;  1F2R C;  2DYM A;  2QIE B;  1TS5 A;  3KWL A;  1STE A;  2WXM A;  1SSN A;  1DOI A;  1C76 A;  1NYQ A;  3HRD D;  3TEW A;  1RWS A;  4KKJ A;  1R7S A;  2MJ3 A;  1FEH A;  1FNU A;  4US8 A;  2SEB D;  1JWB D;  4NZL B;  1QOA A;  4YTP B;  4XDC A;  2INN E;  2M56 B;  4YTN B;  1ENF A;  2WXH A;  4RGM A;  4YSX B;  1JWS D;  2AQ2 B;  2PLP A;  2PMV A;  1K52 A;  3HVZ A;  5C2T B;  4JPS A;  4OW0 A;  4DXG A;  1VZ8 A;  2VZK B;  1H7W A;  2IGH A;  1SE4 A;  1NEN B;  3AE1 B;  4HKQ A;  2JYT A;  2WU5 B;  1I7H A;  4WH4 A;  2BT6 A;  1I4R A;  4IDI A;  1MHX A;  2RPV A;  5FR3 A;  1WXQ A;  1CK1 A;  1XLP A;  2J42 A;  2PVO D;  3U4E G;  2WXR A;  2WU2 B;  1TKY A;  2K3U A;  2BS2 B;  3GP7 A;  1K53 A;  2CJN A;  1ZUD 2;  4P16 A;  3AED B;  5G5G A;  3PO0 A;  2CJO A;  4FXC A;  1D5M C;  2AX5 A;  1F2R I;  2LMC A;  3B2F A;  1JRP A;  4N6E B;  1CQV A;  1XLN A;  3AV8 A;  4KKI A;  1WRI A;  1QQR A;  3AMZ A;  1E10 A;  1E0Z A;  1TY0 A;  1OQR A;  1EU4 A;  1IBX A;  2GI9 A;  4MM3 B;  1SIJ A;  2QMT A;  4TSS A;  2WNM A;  4US9 A;  1TZO A;  5EE1 A;  3NS1 A;  2DLB A;  1EWY C;  1JWU D;  2OHF A;  1C4P A;  3NVV A;  4MT5 A;  1N61 A;  1SF0 A;  3J9C A;  2WXP A;  1YNT E;  4NAW B;  2M19 A;  1ET6 A;  1FRR A;  2NTT A;  3IT4 B;  2GRI A;  2KWD A;  1KRH A;  3N9Y C;  4A90 A;  1QOF A;  4RF1 A;  2JQR B;  2ZW1 A;  4YSY B;  1IUE A;  4NAM A;  1C77 A;  2ICI A;  2QSD A;  3PZ7 A;  3ZJT A;  2K5P A;  3P4R B;  3AEE B;  2ZW0 A;  2MJD A;  1MHH E;  1H7X A;  1VRA B;  1FD6 A;  4UDU C;  2N7J A;  2PVG C;  1DYQ A;  3NVZ A;  4WQM A;  5EE3 A;  2E3T A;  3AM9 A;  3VRB B;  2AQ3 B;  1K50 A;  1YJI A;  3E56 A;  4J3O D;  2H88 B;  4HJG E;  4XWW A;  2GB1 A;  3NRZ A;  1MI0 A;  1MVK A;  2EEL A;  3MC0 B;  2TSS A;  3R2T A;  1XCT L;  4WIP A;  1I4P A;  4WAF A;  3BYY B;  1WWT A;  1Q10 A;  1TKG A;  5D3I B;  2L52 A;  3ZYY X;  4C7Y A;  1E6E B;  1V8C A;  4GLS C;  4MAC A;  4RH6 A;  3P4S B;  3EUB 2;  2Z8L A;  3SEB A;  4EE2 A;  1V97 A;  3V05 A;  4ZHO A;  4HRO A;  4MH8 A;  1LO5 D;  1ESF A;  1DGJ A;  1J7C A;  5E6J A;  1AW7 A;  3AEG B;  3BK2 A;  1SXT A;  1UWM A;  2WXF A;  2ACZ B;  1SE3 A;  3O13 A;  3BII D;  3BVG A;  2WS3 B;  3CIR B;  3AE3 B;  4JWS C;  3L4P A;  2WXO A;  1JCK B;  5HHD G;  2WXJ A;  2WXQ A;  2QJL A;  2BBC A;  2LFI A;  4KGR A;  4KGT A;  2Q5W D;  2INP E;  4YT0 B;  3TUO A;  2YEP F;  4JX1 C;  1PGB A;  4L2Y A;  5GXG B;  2NTS A;  4XDD A;  1T6B X;  2IJ0 A;  3MJ5 A;  2L83 A;  2AQ1 B;  3B9J A;  1FCL A;  1VZ6 A;  5H92 C;  5BMH A;  1C4A A;  1PUT A;  2Y5P A;  1GPX A;  1FRD A;  2FBW B;  1L0V B;  1P7E A;  4OZB A;  1XLQ A;  5D3D A;  1GTH A;  4ITK A;  1IGD A;  1HXY D;  1PYW D;  1YN3 A;  1YMH E;  2HTM E;  3U52 E;  3AEA B;  1ET9 A;  2KAC A;  3EA6 A;  4TQ0 A;  5H8Y E;  4A9A A;  4D2K A;  1L6V A;  4HKZ E;  3RFZ B;  3I57 A;  5LNK 1;  2I38 A;  1NI3 A;  1TS4 A;  4LTU A;  4ARC A;  4RGT A;  2WDR B;  4OZA A;  1KFY B;  4R3D A;  2LGI A;  3R8B A;  4H2A A;  1EU3 A;  3TEZ A;  3E9S A;  1KLG D;  3MP9 A;  4A6Q A;  1L4Z B;  3AEB B;  2J4X A;  4L23 A;  1WSP A;  1C9F A;  3P4Q B;  1XF5 L;  1GB1 A;  2B76 B;  1TKE A;  1ZOY B;  2W3S A;  3LXF A;  1I4X A;  3T3O A;  1JML A;  1P7F A;  1D5Z C;  2MEK A;  4TQ1 A;  3OWE B;  1V1O A;  2XN9 C;  3T3N A;  3BVZ A;  3DWG C;  1NYR A;  3FC4 A;  4ARI A;  3AE7 B;  1D4B A;  2EKI A;  2VZK D;  3AE9 B;  3W5U B;  1PGX A;  1UNS A;  1YN5 A;  4OZC A;  2H89 B;  1XEE A;  2BYT A;  5BMI A;  1JAL A;  3VR8 B;  1SJE D;  2K0P A;  4TMA B;  2WXI A;  1TS3 A;  1UGJ A;  2JSV X;  3HUI A;  4M0W A;  2PW9 A;  3EGR A;  3IXS A;  2WLB A;  2E6X A;  5BYS A;  1E7P B;  4XE0 A;  4XWT A;  4HEA 1;  2W55 A;  1YJJ A;  1I4H A;  3W9C B;  1N63 A;  1L0X B;  1PDX A;  3IAS 1;  3P4P B;  2PIA A;  2MH7 A;  1FM0 D;  3HVD A;  4HRS A;  2PTL A;  3AN1 A;  4WUR A;  4ZOH C;  1FO4 A;  1SB3 C;  2WXN A;  1AWD A;  2WP9 B;  1L6U A;  3FAH A;  2JX5 A;  1PFD A;  2HDE A;  5HI1 A;  4ZYS A;  3NZ3 A;  2M0A A;  1J7A A;  2BB5 A;  5EE0 A;  2FE8 A;  2Y5C A;  3KQ4 A;  3MFG A;  1D5X C;  1ZDX A;  2QEJ C;  2QIL A;  2IGD A;  2N9K A;  3ETR A;  1SEB D;  1GTE A;  3ZJU A;  3P63 A;  5FK9 C;  1FXA A;  2W54 A;  2MJE A;  5D7G A;  3ZGZ A;  4ZRQ A;  4RFB A;  4N58 A;  1L5P A;  3B2G A;  5BMG A;  1KTK A;  3BVM A;  1FXI A;  1TY2 A;  3SR6 A;  4USA A;  3W1S A;  1VDV A;  4KX6 B;  3TEX A;  4RNA A;  3BK1 A;  1QLB B;  3AE2 B;  2RMM A;  2K22 A;  2K9X A;  3DWM A;  1KF6 B;  2W82 A;  2DYO A;  1D6E C;  2IDY A;  3BYT B;  2JU6 X;  1V1P A;  1FFV A;  5AUI A;  4JE3 B;  1SJH D;  3U7Z A;  3P1M A;  5HG2 A;  2NMQ A;  1N5X A;  3Q8A A;  2ON8 A;  2PKO A;  3BZD B;  3BWU D;  1JWM D;  2JZP A;  4IKG A;  2G1E A;  3FIL B;  3AH7 A;  1F0Z A;  1OQQ A;  3Q8F A;  4RF0 A;  3VR9 B;  4N59 A;  1YQ4 B;  2L1A A;  2J53 A;  4YWG G;  1HA5 A;  1FCC C;  2LJI A;  2XNA C;  3Q8E A;  3SFE B;  4LLG M;  4LK0 M;  3AE5 B;  2V4I B;  4GDL B;  2X38 A;  3KWV A;  3ZJV A;  4C7Z A;  1J7B A;  4AQ7 A;  1N60 A;  1KLU D;  1DOX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...