3AEDB

Crystal structure of porcine heart mitochondrial complex ii bound with 2-iodo-n-phenyl-benzamide
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
239
structure length
239
Chain Sequence
PRIKKFAIYRWDPDKTGDKPHMQTYEIDLNNCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLDKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTGTCPKGLNPGKAIAEIKKMMATYKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Crystal structure of porcine heart mitochondrial complex II bound with 2-Iodo-N-phenyl-benzamide
rcsb
total genus 56
structure length 239
sequence length 239
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 3aedB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3aedB01
5AUKA 2B76B 1E6EB 4US8A 1GTEA 1N63A 2JQRB 1XLNA 3VR9B 3NVZA 2BS3B 3AEDB 1L6UA 3AE6B 3AE7B 4C80A 1ZP0B 5G5HA 3SFEB 3VR8B 1L5PA 2Q5WD 1AYFA 1GAQB 4YT0B 1DOIA 1N62A 1WXQA 2MJ3A 1TKEA 4IDIA 5H8YE 4ZHPA 1FFVA 1TJEA 1YJJA 1JWAD 1JROA 2AX5A 5EE0A 3AMZA 3HUIA 1VJKA 1JALA 2MJEA 2PVOD 2LEKA 1QOGA 2WDRB 3VRBB 1N5WA 1XO3A 4YSYB 2L52A 3W9CB 3P4SB 3DWMA 1FRRA 2N0SB 2EKIA 1OFFA 4JWSC 3CIRB 2CU3A 1KFYB 2PVGC 1TKGA 3EUB2 4N58A 4C7ZA 2DWQA 4YSXB 1FRDA 3NRZA 3P4RB 1ROEA 2CJNA 2PIAA 3WCQA 1JW9D 1PUTA 1SIJA 1NENB 2QIEB 3AE8B 3SFDB 1F0ZA 3LB8C 1R7SA 1JWBD 2OHFA 3AN1A 3P4PB 1J7AA 1RWSA 4N6EB 3AE2B 1RM6C 1N61A 3AEEB 1QOAA 2K22A 2Y5CA 1YQ4B 3AEGB 2W54A 1VDVA 2MH7A 2KAJA 1NVID 1CZPA 2WP9B 1CJEA 2WDVB 2M19A 3NVWA 4N59A 2BS4B 3AE5B 1PFDA 3AEAB 2WDQB 1QLBB 2WU5B 1DGJA 2WLBA 3ZYYX 3B2FA 4US9A 3SR6A 2W55A 3P4QB 1OQRA 2BT6A 1E9MA 1I7HA 3CWIA 3BIID 3HVZA 1FXIA 2FBWB 1FIQA 1YJIA 3ETRA 3PO0A 1T3QA 4YSZB 3W5UB 4USAA 2DBYA 1YQ3B 4YTMB 2H89B 3AE1B 1N60A 2G1EA 2K5PA 1FXAA 3DWGC 1J7BA 3NS1A 3NVVA 3P1MA 5AUIA 1RFKA 1E0ZA 1GT8A 2M56B 1L0VB 3AE3B 1XLOA 4KX6B 1TKYA 3FC4A 2E3TA 4YTNB 1FM0D 1WGKA 3B9JA 4ZOHC 3AV8A 1V8CA 1SB3C 1H7WA 1KF6B 2JX5A 1QOFA 1ZXIA 4ITKA 3NVYA 3AECB 4C7YA 3RPFC 4ZHOA 3AEFB 4YTPB 2MJDA 1E10A 1N5XA 1QT9A 2PKOA 3CF4A 1NI3A 1WWTA 1WYGA 1KRHA 1QOBA 1UWMA 4LTUA 3AB5A 3L4PA 1J7CA 3P63A 1RYJA 1OQQA 2W3SA 1AWDA 3AE4B 3VRAB 1XLPA 1XLQA 2W3RA 1TYGB 2ACZB 5GXGB 4JWUC 2WU2B 1DOXA 3B2GA 1EWYC 1GTHA 4YXDB 5G5GA 1VLBA 1FO4A 1A70A 1ZUD2 2KMMA 1NYQA 4A9AA 1PDXA 5EE9A 4HRSA 5C3JB 1SF0A 4JX1C 1NYRA 3AM9A 1QF6A 1E7PB 1IUEA 1WRIA 3HRDD 2K9XA 5C2TB 1V97A 2L83A 2WS3B 1NEKB 3W5VB 3AE9B 3FAHA 1L6VA 3AEBB 1B9RA 4HROA 1FMAD 2WQYB 2HTME 5MPOA 2CJOA 3ABVB 5H92C 1DOYA 1JQ4A 1FFUA 1ZOYB 4WQMA 2H88B 5EE3A 3AH7A 3KWLA 4P6VF 1H7XA 5EE1A 2QJLA 2BS2B 3LXFA 1JRPA 4FXCA 4WWMA 1GPXA
chains in the Genus database with same CATH superfamily
4MT5A 4WAFA 1V1OA 3VUYA 1D5XC 5IP4D 3L16A 1IP9A 4CHKA 1RFAA 2JWZA 2PVOD 5IN7A 1N5WA 3W9CB 2OJRA 3DVGX 2V0GA 4BOSC 4IWOA 3AU4A 2PIAA 1JW9D 2G4SA 2QIEB 3AE8B 3PSEB 3T3NA 3SFDB 1J7AA 1SE4A 3C0RB 2EELA 3AEGB 3ZNID 2MCNB 1IYFA 2KFJA 1NVID 3GZNI 1HTQA 1R4NI 1ZXHA 3RNEC 4KV2A 4PS8A 2K6QA 4HLEA 3H6NA 2NPTA 1L4ZB 1Q10A 2AQ1B 1ZW7A 1L0VB 4RCOA 4ZOHC 5L83A 2NS5A 4BKTA 1WGRA 4J3OD 1WMHB 4GGQA 1B1ZA 3GE3C 1YN4A 4NAWB 4II3B 2LZ6A 2WGSA 1XQQA 4MELA 4XX5A 4ZDVA 1WGGA 2O2VA 2BB5A 4RF0A 2Z0DB 5C3JB 3FILA 1V5OA 4HVBA 2QDFA 2WXKA 1WMHA 3UIOB 2JYTA 5D7GA 1QQRA 4NAWA 1HTOA 1JCKB 2D5GA 1FCCC 4BZAA 3RMKC 4WQMA 1M94A 3W2DA 2IJ0A 1NI2A 3VR8B 2BWES 5JXVA 1XEEA 1RRBA 4FLHA 3AMZA 3DBLB 2LEKA 4PK1A 4ARIA 1FEHA 1WF9A 4B9KA 3D32A 2FUG1 4URKA 4YSXB 1FRDA 2DZJA 1SJED 3WCQA 4EUTA 2MBQA 3R8BA 1WXVA 1IGCA 1F0ZA 3ALBA 3W1SA 1N61A 2PJHA 1HQRD 4TKNA 2KQ4X 3Q8AA 2EMSA 4ZRJA 2CKHB 3HVZA 3P2BA 2FBWB 1MG8A 4IKGA 4M0WB 3W5UB 3NOBA 1P98A 1N6ZA 2G4DB 4XGAB 2DLBA 1SXTA 4LNKA 4LJPB 2KN5A 2ZNVC 5BMGA 2DENB 1V49A 3S2AA 4M0WA 2HJ1A 3ZNHB 4GMVA 2OOBB 3HHMA 4HDQA 1TS3A 4HJGE 4W9FA 4II2B 2TSSA 3WIMA 2GBKA 5GMVA 1SF0A 5C2TB 3SHQA 4EOYA 3DHIC 2EMTA 1FMAD 2KDIA 1P0RA 4ARCA 4OVZA 5J2RA 4XE0A 2RPQA 3DVGY 2JY6A 2QJLA 4DXAB 1P9DU 2G9HD 5AUKA 1TY0A 4IC7B 1XLNA 1WX7A 4KZCA 1V9JA 3V6CB 2KHWB 2MJ3A 1FFVA 1YJJA 2NTTA 3VHTC 3RUIB 2MJEA 2D3GA 3R7QA 3I9V1 3PZ7A 3VVWB 3KUZA 1LFDA 3PLUA 1FNVA 4FADA 1E8ZA 4IM2A 3V62A 1VRAB 2KWVB 4P7IA 3LB8C 1M4VA 4N6EB 3ZTCA 4A3PA 1YQ4B 2VRRB 1L0XB 3WANA 3ZYYX 3RT3B 3NZUA 4W9LA 3DVNV 2W55A 3Q3FA 3NZSA 5IA7A 1CQVA 3ETRA 4TSSA 2LASA 2IO2B 2IGDA 2FCMA 2H89B 1N60A 3NVVA 2RR9A 4PT5A 3ZLZA 2INDC 3R66C 3GE8C 3LJ3A 2M1MA 1MJDA 5LNK1 3OWEB 3QQ8B 1TT5B 3UF8A 2N9PC 2IO0B 2B3AA 1D3ZA 2I1JA 4HCPB 3AE4B 1XLPA 1PQSA 4EFOA 3EHVA 4IOIE 4WJPA 1MHXA 4RH6A 3NJTA 2BKRB 1PDXA 4HRSA 4G50A 2KDMA 1C79A 2J0JA 4ANWA 2CJOA 3UIPB 1VZ6A 2KDBA 2WXLA 1J19A 3T3OA 1IGDA 3ZVVA 5IAAC 1T0QC 2L05A 4LJOB 1LO5D 1I4GA 3I3TB 1DOIA 3NZ3A 3ZJUA 1TBEA 2IGGA 3ONSA 2ZEQA 1JROA 2QEJC 1SSNA 4YSYB 1TS4A 1S3SG 1PGBA 2QMTA 4WIPA 2CHWA 4LNIA 2CU3A 3H8HA 4WJNA 1Y8RC 2CJNA 3JYUA 3PT2B 2LUEA 3L08A 4LNFA 1R7SA 2LRUA 1AN8A 2KDFB 1WXAA 2FCSA 4HDOA 2ZPYA 3Q3JA 4F8CB 4K3CA 2DZKA 1V81A 2I1KA 1E9MA 3CWIA 2LRWA 3IVFA 3MJ5A 3RI7C 3BVGA 3DQVA 3NG0A 2KOXA 3OAWA 1J7BA 1E0ZA 3ZRCA 3FC4A 2E3TA 2KC2A 2VH1A 4P1CC 1I4HA 3AULA 4LDTD 1QT9A 2L1AA 2V3PA 3UINB 2V1YA 4MACA 4OZBA 3PV1A 3V6EB 1H4RA 4P1BC 3ZNZB 4GU2A 4JWUC 1CMXB 3J9CA 2MLBA 2IY0B 4KKIA 1VD2A 4JX1C 3HVDA 1FXTB 1WE7A 4ICVA 1WXSA 4IWQA 2LHEA 2JPHA 1T0SC 2NCNA 2QC8A 4BBNF 1STEA 3N30A 4MSMB 5BMIA 2JF5A 1WYWB 5G55A 3V60A 1KOTA 5EE1A 2JU6X 5BYRA 2Y3AA 3BVZA 1IPGA 2BYFA 1N63A 4C80A 2KANA 3AE6B 2LWPA 1KH0A 3GOEA 4EEWA 5FKAC 3EC8A 3A9KB 4LLGM 2N7DA 1WE6A 2R2QA 3IAS1 2BPSA 5BO4B 3RNFC 1JALA 1QOGA 5DCNA 3UGBB 3RNCC 1FRRA 2INCC 1NENB 5FK9C 1WR6E 3V61A 3KW5B 3A9KA 1RWSA 2NBUA 3PZDA 4RGNA 1TS5A 2IO1B 4AWJA 4MDKE 1ZDXA 3A9JB 3IBEA 4OZCA 1OQRA 1FXIA 1YJIA 1V1PB 2D11A 3SD5A 5CX3A 5IKCM 5AUIA 3UQAA 2RDHA 3MHZA 1OEYA 2FE8A 2JX5A 1KLGD 2IYDB 4EKUA 4OVVA 4W9HA 1HZ6A 2K1FA 1GUAB 4FHKA 3A9JA 1E10A 2O6VA 3Q6BA 5BMHA 1V1PA 4I6NB 3IFWB 1K53A 4NY0A 1RYJA 3KYDD 1UF0A 2W3SA 5D3DA 3GS2A 4C56C 1XLQA 5HHDG 1GNUA 2GOWA 4KGSA 2ACZB 3Q8BA 3TMPB 2KKCA 3QAQA 1UD7A 1DOXA 5DPRA 1J0GA 3RD2A 4K7UA 2K9XA 5CHVC 3ZIMA 3CMMB 4CYEA 3IAM1 2LFIA 2GRIA 4C4VB 2ZW1A 4NAMA 4BKSD 2LVQA 3X0WA 1P7FA 4AJWA 3N1ZC 1ZOYB 3BK1A 3U7ZA 4WWMA 1Y56A 2BW2A 1WI0A 1L4DB 4MM3B 1KM7A 2M0XA 2ZPNA 2LUMA 4C4VA 3QWZB 1ISNA 2N1VA 3VQIA 2L00B 3IXSA 1RAXA 2M0AA 4JWSC 4KZ0A 4ACFA 2KTFA 2BB6A 2C9WB 2J0KA 2A5UA 2IY1B 3V05A 2M4NA 3LYYA 2RD0A 3RCZA 2Y5CA 3MP9A 4B0EA 1C76A 2M19A 1GB4A 4NJ7A 2DX5B 5KHOA 3H9DA 1SBBB 1WY8A 4ANXA 2G1EA 3TBLD 2L76A 4IM3A 2M56B 3KVFB 1WGKA 3U8ZA 1SB3C 3NVYA 2MJDA 2WX1A 1T6BX 2WX0A 3B1LX 3C8YA 4A6QA 2LVPA 3RFZB 2WXIA 1FPYA 1NYQA 5EE9A 3E9SA 2DYMA 2A4ZA 1MI0A 1V86A 1E90A 2KACA 2NBWB 4J6IA 1H8CA 2GBJA 2GLSA 3TIXA 1JRPA 4FXCA 2FNJB 5J18A 1V80A 4HJKA 2BYTA 4NNJB 1GAQB 1T0RC 1P1AA 2JXTA 3VXWA 4DQOC 2KDEB 1FCLA 4G3XB 2AX5A 3W1YA 1WM2A 1TS2A 4M8NA 1UBIA 2L8JA 4YWGG 2VZKB 3H7SA 4S0RA 2R2OA 4DXGA 3I5JC 3IHPC 3IT4B 2DWQA 4DK5A 5CHWA 4FULA 3OG5A 3VTUA 2Z59B 3KH0A 2RSUA 2KLCA 3K9PB 1QOAA 4PS3A 1VDVA 1C77A 2WDVB 1CJEA 1YJ1A 2ON8A 4N59A 1P3QU 3ECIA 1XCTL 5HI1A 1I7HA 2HE7A 1YX5B 4RF1A 4YSZB 1T5XD 1J8CA 3PPAA 4BBNC 2J4XA 2K25A 2N7EA 1QZEA 4KX6B 2J0MA 1VZ8A 3MFGA 3AV8A 3L0WB 2KJHB 2ZVOA 3RPFC 4ZHOA 2LGIA 2D3AA 2AQ2B 2WXPA 4MEMA 4A90A 4GDKB 2KZRA 2V9HA 5G5GA 1A70A 2J53A 1IBXB 1WRIA 4MGYE 3RNGC 4ICUA 3U30A 1TZ1A 2KTRB 1BUIC 3N32A 4GDKA 1K51A 2GBNA 3GZNB 1R4NB 2KXJA 5TR5A 1TGZB 2DHZA 1P7EA 3T9LA 1IBXA 2ZNVB 2KQ7A 4ZRPA 1WR1A 2KK8A 1L6UA 2L3ZA 4X57B 2WXJA 4NJCA 1VCBA 4YL8A 1WRDB 1FNUA 2KTRA 4IDIA 5H8YE 4GDLB 1JWAD 3M3JA 4NPNA 1C1YB 3DHHC 2CS4A 4ZRIA 2XN9C 2MW5A 4LNOA 5E6PA 1EUVB 4OHJA 1E7UA 1F77A 4O1NA 2LJIA 3A4SC 3BVMA 3TEYA 1T0YA 4RMAA 3P4PB 2V4IB 2KNBA 2RPVA 3UI3A 2ZCCA 3EA6A 3JW0X 1PFDA 3R2TA 3QARA 2IBIB 4A55A 3ENEA 4USAA 2D2QA 2L7RA 3A33B 1FXAA 1WZ0A 3C19A 1TKYA 2KWDA 1V8CA 1LQBA 3WAMA 4NZLB 3PREA 4MGIE 4GB9A 3U52E 1OQQA 2N9XA 3SEBA 4M02A 1EF5A 2BVCA 1GOZA 3HK0A 3OJ3A 1VLBA 2KWUB 4GSWA 5AEKB 2KFKB 1XXGA 1I4PA 2XBBC 1RLFA 4B95A 3ZGZA 2KVRA 3ML8A 1HZ5A 3KUCB 3Q3MC 1DOYA 5T8IA 3PRZA 1SE3A 3NY5A 3QC8B 2KYWA 4RM8A 3DBHI 3Q8FA 2JT4B 2KFKA 1YX6B 3BYYB 4UDUC 3VUXA 3KUDB 1MHHE 3SFEB 4S17A 3M95A 1WXMA 2Q5WD 1AYFA 1TKEA 2QHOA 5EE0A 3HUIA 1XCQL 4FJYA 4GXBA 2WXRA 4W9GA 5I4DA 1SGHA 2M17A 4LNNA 1WZ3A 2K8CA 3QK0A 4ANVA 1K52A 1AW7A 3NRZA 2PE9A 1L2NA 3AN1A 3UQBA 2L0FA 2JRHA 2K22A 2MH7A 1Q5WB 2WP9B 3NVWA 3ZRFA 1QLBB 1WX9A 3U2SC 3N1XC 1D4BA 1LGRA 2AEHA 2D10A 2X38A 5E6NA 4XYCA 2LMCA 4A9AA 3DWGC 2JXXA 2YVCA 4WQOB 4ASWC 1XLOA 5L95C 4L23A 1L0YB 1H7WA 2IGHA 1FD6A 2W9NA 4C7YA 2J7QB 1N5XA 3VFKA 2PKOA 3CF4A 1OGWA 3VDZA 1I4QA 1UWMA 1EF1A 4LDTB 3QX1A 2ZW0A 1SE9A 2HDEA 2KMCA 2FIFA 2NVUI 3B2GA 1YN5A 2Z8LA 1XF5L 4KDIC 3CF6E 2G3QB 4W9EA 3HRDD 1C78A 3APCA 4BOZB 3OJ4B 2WXQA 3H1UA 2D07B 3PVLA 3ZDMC 3AH7A 3NS8A 4P6VF 3VUWA 5JHAA 2ZZPB 1E6EB 1TTNA 3M63B 1WGYA 1UZXB 2BS3B 2FCQA 2JZZA 2PMVA 3WAPA 2ZJDA 3URYA 1WSPA 1BXTA 2JRIB 2SEBD 2NTSA 1FNWA 4W9JA 2KN4A 3T8MA 1WFYA 2XEWA 4XDDA 2AL6A 3EUB2 3Q14C 3P42A 1PUTA 1MPEA 3R3MA 2DYOA 3APDA 3AEEB 3WALA 4PS7A 1LXDA 4Q2JA 1I35A 3AE5B 3RN9C 3O13A 1ET9A 1Z5SB 2K8HA 3N20C 4KGTA 4RM9A 4KDLB 3W5VB 4W9DA 1UBQA 4WJQA 3ZTDA 4M8MA 3PHXB 4A20A 4FN2A 1ZXIA 1KTKA 4I6LB 4E74A 5HFYA 3DCGA 2AWTA 3GB1A 1Q0WB 2KVZA 4GLSC 2FIDA 3DDCB 1KRHA 1WX8A 1J7CA 1AWDA 3RZWC 3PHWB 2KX0A 2REXA 1TY2A 2MBEA 3ZDTA 4KKJA 1R4MI 3TEZA 2MP2B 4KSKC 5FR6A 2FCNA 4K7WA 4BKGA 4ZYNA 1L6VA 3AEBB 1YN3A 3VAWA 2WNMA 3K9OB 4GOCA 1C4PA 4JIOU 3DBRI 2B76B 2AL3A 4KGRA 5FR3A 2N9EB 2KO3A 3RULA 3TSSA 2KD0A 4ZHPA 3R2IA 2GMIC 2O6VD 3TEXA 3QHTA 4WJOA 1XO3A 1D6EC 4MJSB 4HPMB 2ZCBA 3EFUA 2N0SB 2PPHA 3TUOA 4D2KA 1ROEA 2IPKD 2MA9B 3MC9A 2OHFA 2JYEA 2R61A 1YIWA 1PGAA 3AE2B 2HD5B 3CSTA 3QCAA 1WJUA 1PYWD 4MJSA 3N1YC 3PS6A 4FA6A 3B08A 4LCDE 2WLBA 1JMLA 3B2FA 5HKHA 2J52A 2Y5BB 3TEWA 1ZGUB 4CQNA 2INNE 2DZIA 4MM3A 4YTMB 2K5PA 4OZAA 5H92C 2JUOA 3AE3B 4TQ1A 1NBFC 1BT0A 3BZDB 3M62B 3KYCD 4AS1A 3EECA 4IWPA 1BMLC 2MBBB 3VRAB 3BYTB 2GBRA 2IDYA 2JZPA 2LGSA 4GIVA 4YXDB 1F2RI 1ZUD2 2KMMA 2NBVB 3DHGC 4AP4C 2YEPF 1I4RA 3AM9A 4RNAA 4DHJD 3AE9B 1ZKHA 2X8XX 4HCNB 5MPOA 2WQYB 3VH3B 2BWFA 4FHJA 4F7ZA 1GC6A 5EE3A 4MSQB 4JPSA 1ENFA 2MWSB 2DAFA 3NVZA 2ZVNA 5TSSA 3BY4B 2BBCA 2NPTB 1A5RA 5G5HA 2C5LC 1L5PA 1N62A 4RFBA 2I38A 1C3TA 5AZHA 1R4MB 3QJZA 4AUQC 3DPDA 3ZW3A 3EFCA 2UWQA 1QKZA 4C7ZA 3MJWA 3MHSD 2PTLA 3WA0A 1SE2A 2KJ6A 2LXAA 3DBRB 4K1RB 2O2VB 3FILB 2I2YA 1E7VA 5BYQA 2WDQB 2WU5B 1DGJA 4QAYA 1YNTE 4W9IA 3SR6A 3PTFC 1HE8A 3P4QB 3MC0B 2HJ8A 2KX3A 3PLVA 1FIQA 1JWSD 1T3QA 1Z2MA 1K8RB 4W9CA 4AOFA 3HM3A 2KLGA 1GT8A 4KSLC 3ZXVA 3I63C 4YTNB 1D5ZC 3E56A 4WH4A 1QOFA 1VZ7A 2RGFA 3HIZA 4TV3A 2BKFA 1L7YA 5IO9A 1X1MA 2ASQA 1KJTA 2V3NA 2Z0EB 1JWUD 1WYGA 4DHZE 4ZRQA 2N1WA 3W1SC 3APFA 3FKYA 1V6EA 2WXNA 2UYZB 1WM3A 4JGHB 1GJZA 1ESFA 1GTHA 2L32A 2KJRA 2K8BA 1GC7A 4DHZB 2BF8B 3IT6B 2EKEC 2VZKD 2WHIA 2L83A 2WYQA 2WS3B 3ZKJC 1KLVA 1E5WA 4C00A 4G0NB 1UELA 5EDSA 1F2RC 3L10B 1FFUA 1YD8U 5HG2A 4NQLB 4HXDA 1EO6A 2JZ3B 1GPXA 5D6JB 2C7MB 4US8A 2PLPA 3L17A 1ZDVA 1ZE3D 1ZP0B 4E71A 2J42A 3BINA 3JSVB 1E8YA 2PEAA 3LDZE 3X23A 1SIFA 2JSVX 1V2YA 3VRBB 1UUPA 1U4AA 4K3BA 3DWMA 4RGOS 1WJ4A 2FAZA 2K3UA 2PVGC 1JRUA 1F1HA 4HEA1 4MGZE 4ZYSA 3H7PB 2D3CA 3JSVA 2RDGA 1OEYJ 3V3XA 1HXYD 4WWPA 2W54A 2RMMA 1CZPA 2LVOA 4HK2A 1ET6A 5DPTA 2BT6A 3SDLC 4HPPA 1EM7A 3BIID 2LHDA 4K7SA 3H7PA 2BGFA 4WURA 5C1ZA 3ML9A 2CHZA 1TZOA 3NS1A 3P1MA 4RGMA 1XD3B 3NUHB 4GDLA 3Q8CA 3B9JA 4MH0E 2GB1A 3ZXRA 1E8XA 5KHQA 3VH4B 3AEFB 3U4EG 3RZFA 1NI3A 2OJWA 1WWTA 1QOBA 2LGDA 3TJPA 3AB5A 4JL9A 1I4XA 2VH2A 1TYGB 4HPLB 2HTHA 2NMQA 1K50A 2UU7A 2XNAC 2QCZA 4DDGD 4ANUA 4EZKA 1LM8B 4HROA 5LXIB 1Q1OA 2H88B 2WDTB 3GP7A 1E8WA 2ONQA 3Q69A 4N9F4 1I42A 4WWOA 4NJ6A 1EWCA 1G6JA 2W82A 3AE7B 2DYBA 2LI5A 3DBSA 1WXQA 2M8SA 4HKZE 1ACCA 3RYTA 3ZJVA 3PGEA 1SJHD 4K81A 2K6DB 2CHXA 1OFFA 2PW9A 3P4RB 2KWCA 2LGXA 1SIJA 4KVGB 3RNBC 2BQQA 1JWBD 1XT9B 4HWIB 4TQ0A 1MFWA 4XC2A 4GN1A 3Q2AC 2SAKA 1KLUD 3AXCA 4BVUC 3AEAB 3EGRA 2V3SA 4US9A 2C7NB 1C4CA 3PO0A 2K39A 3ZJTA 1EU3A 2DBYA 1YQ3B 2JVCA 4WAAA 3BWUD 2AQ3B 3QIJA 2ICIA 3Q3NC 1NDDA 2YEPB 4PYZA 3VTVA 4YTPB 5E6JA 5JHBA 3L54A 2LXCA 3VTWA 3SU8X 3TL5A 2E6XA 5GXGB 1UWXA 2WU2B 2FUHB 3B0AA 1UH6A 1NYRA 1IUEA 5LXHA 1V97A 1WGHA 2WXFA 3O65B 1B9RA 3AI5A 4MH8A 1QILA 3ABVB 3NHEB 3MC8A 4OW0A 5AZFA 1TIFA 3IG3A 3KWLA 4F1SA 1WIAA 3PRPB 2KC1A 5D3IB 4G11A 5BYSA 1GTEA 5C23A 3KWVA 4IUMB 3VR9B 3WAOA 2C7HA 4JE3B 5D94A 1DYQA 4I6PA 4YT0B 3ZUNA 2QSDA 4P16A 3DOWA 5DPWA 1WJ6A 3QA8A 4EZJA 2WDRB 3I57A 3U7DA 2L52A 1F52A 3P4SB 1PGXA 5JZEB 5CHFA 2EKIA 2PE6B 1OTRB 3CIRB 1KFYB 2MRPA 1TKGA 2L0TA 4M01A 5CTRC 2QILA 2YLMA 2AYOB 2MBHA 4B6WA 3PRMB 4A3OA 1YOVB 1OQYA 2DAJA 2OEDA 4DBGA 3CSFA 4DDID 2BS4B 1AARA 2MHJA 2BTEA 4BFRA 4E3CA 2D3BA 1C4AA 4DWFA 5D2MB 2C60A 2XK5B 4BAXA 3AE1B 5DPSA 3HM6X 2KMAA 1JWMD 2N9LA 1FM0D 1C9FA 1VR9A 3DBHB 2WXMA 1YQBA 4ZRKA 2INPE 3AECB 3KLSX 5E6OA 3Q3OC 3MTNB 4XWTA 2DNFA 1YMHE 2XK5A 4KIKB 2BYEA 5JH5C 1WH3A 4XDCA 3Q8EA 1EWYC 3DVNU 1GG3A 3A1QB 1FO4A 4AJYB 5IOIA 2GI9A 2WXOA 1QF6A 2DZMA 2KQSA 4L2YA 1SEBD 4IG7B 1NEKB 1UGJA 2MX2A 3R7RA 4KIKA 1EU4A 4B0MA 2CU1A 3A1QA 2BS2B 3LXFA 4EE2A 2Y5PA 2JQRB 2MSED 4RGTA 4CO7A 3AEDB 4JQWC 2LGYA 2JWUA 4HKQA 3N3KB 1TJEA 3JVZX 4DXFA 1VJKA 3L13A 2K0PA 4FJVB 2NR2A 2O6VB 1UGMA 4N58A 2MEKA 4TMAB 1ZPSA 3TCAA 4NQKE 2MBOA 4IW0A 5AZGA 1WGDA 2MP2A 4R3DA 2WWZA 2KT7A 1RM6C 4XZ4A 2GBMA 2IZVB 4LK0M 1S1QB 4WWNA 2KAJA 4AQ7A 4M00A 4OVUA 4TUUA 5G2NA 4BKSA 4A8XC 4MGKE 2BYVE 2V4LA 1V5TA 3ZQ4A 2LJ5A 3A4RA 1HEZE 2MQJA 1RFKA 1CK1A 2N7JA 3AU5A 4FBJB 3ZNGC 1UNSA 1KF6B 2G45B 4ITKA 4EZLA 5J17A 1MVKA 1HA5A 3RNAC 4LTUA 3L4PA 3P63A 1MG4A 4L1BA 4JLCA 3BK2A 2W3RA 4H2AA 4W9KA 3OLMD 3ZO5B 2CR5A 1D5MC 5LLIA 2IO3B 1WJNA 2LD9A 3DBLI 3N9YC 1E7PB 2N9KA 4REZA 2WXHA 3FAHA 2WXGA 3PZ8A 4FJZA 4XWWA 2HTME 1F9JA 4DHJB 1JQ4A 4PYUA 1GB1A 3KQ4A 1H7XA 4IM0A 2RDBC 2N4FA
chains in the Genus database with same CATH topology
3Q8FA 4MT5A 4US8A 2PLPA 1N63A 4WAFA 1V1OA 4C80A 1ZDVA 1ZE3D 3AE6B 1D5XC 1KH0A 3BYYB 1ZP0B 4UDUC 1MHHE 3SFEB 5FKAC 2Q5WD 1AYFA 4LLGM 2J42A 1TKEA 3IAS1 5EE0A 3HUIA 1XCQL 1JALA 2PVOD 1QOGA 2JSVX 1N5WA 3VRBB 1UUPA 2WXRA 3W9CB 5I4DA 3DWMA 2V0GA 1FRRA 4RGOS 2K3UA 2PVGC 1K52A 1AW7A 3NRZA 2PIAA 4HEA1 1JW9D 2QIEB 1NENB 5FK9C 3AE8B 4ZYSA 3T3NA 3SFDB 3AN1A 1J7AA 1RWSA 1SE4A 2K22A 2RDGA 2EELA 3V3XA 3AEGB 1HXYD 2W54A 2MH7A 2RMMA 1NVID 1CZPA 2WP9B 3NVWA 4RGNA 1TS5A 1QLBB 1ET6A 1ZDXA 4OZCA 1ZXHA 3U2SC 2BT6A 1OQRA 1EM7A 3BIID 1D4BA 1FXIA 2LHDA 1YJIA 1V1PB 2X38A 4WURA 2LMCA 1TZOA 3DWGC 4A9AA 3NS1A 5AUIA 1L4ZB 1Q10A 3P1MA 4RGMA 2AQ1B 2RDHA 3MHZA 1L0VB 1XLOA 3NUHB 2FE8A 1L0YB 3Q8CA 3B9JA 4L23A 2GB1A 4RCOA 2JX5A 1H7WA 1KLGD 4ZOHC 2IGHA 1FD6A 1HZ6A 4C7YA 3AEFB 3U4EG 1E10A 1N5XA 2PKOA 4J3OD 3CF4A 1NI3A 1I4QA 1WWTA 1B1ZA 5BMHA 1V1PA 1QOBA 1UWMA 3AB5A 1K53A 1RYJA 2W3SA 5D3DA 1YN4A 3GS2A 4C56C 1I4XA 4NAWB 2ZW0A 1XLQA 2HDEA 1TYGB 5HHDG 4KGSA 2ACZB 3Q8BA 1DOXA 3B2GA 1YN5A 2Z8LA 1XF5L 2NMQA 1K50A 2BB5A 4RF0A 5C3JB 3FILA 2XNAC 3HRDD 1C78A 2K9XA 2WXKA 2JYTA 3IAM1 2WXQA 2LFIA 2GRIA 4HROA 2ZW1A 4NAMA 5D7GA 1QQRA 1P7FA 1JCKB 2D5GA 1ZOYB 1FCCC 2H88B 3GP7A 3AH7A 4P6VF 2ONQA 3BK1A 3U7ZA 4WQMA 4WWMA 3Q69A 1Y56A 3W2DA 1E6EB 2BW2A 2IJ0A 1EWCA 1L4DB 4MM3B 2BS3B 2W82A 3AE7B 2PMVA 3VR8B 2LUMA 1WXQA 3URYA 1WSPA 5JXVA 1XEEA 1BXTA 3AMZA 2SEBD 4HKZE 1ACCA 2NTSA 3ZJVA 2LEKA 1FNWA 4ARIA 1SJHD 2KN4A 1FEHA 3VQIA 4XDDA 3IXSA 2FUG1 2M0AA 1OFFA 4JWSC 3EUB2 4YSXB 1FRDA 2BB6A 3P4RB 1SJED 2PW9A 3WCQA 3P42A 1PUTA 1MPEA 1SIJA 3R8BA 2DYOA 3V05A 1IGCA 1F0ZA 1JWBD 3LYYA 3W1SA 1N61A 4TQ0A 3AEEB 2Y5CA 3MP9A 1HQRD 4B0EA 2KQ4X 4Q2JA 1C76A 2M19A 2SAKA 3Q8AA 1KLUD 3AE5B 1GB4A 3AEAB 3EGRA 4US9A 3O13A 1C4CA 1ET9A 3HVZA 2FBWB 1SBBB 3PO0A 4IKGA 3W5UB 3ZJTA 1EU3A 4KGTA 2DBYA 1YQ3B 3W5VB 2G1EA 3BWUD 2DLBA 2AQ3B 2M56B 1SXTA 2ICIA 1WGKA 1SB3C 1ZXIA 1KTKA 3NVYA 2YEPB 5BMGA 5HFYA 4YTPB 2MJDA 5E6JA 3GB1A 1T6BX 4GLSC 4M0WA 1KRHA 3C8YA 1J7CA 1AWDA 4A6QA 2E6XA 3RFZB 2WXIA 5GXGB 1UWXA 2WU2B 1TS3A 4HJGE 1TY2A 1NYQA 2TSSA 5EE9A 3E9SA 2DYMA 4KKJA 1SF0A 3TEZA 1NYRA 1MI0A 1IUEA 5C2TB 1V97A 2KACA 2WXFA 1L6VA 3AEBB 1YN3A 1B9RA 1FMAD 4MH8A 1QILA 3ABVB 2WNMA 4OW0A 4ARCA 4OVZA 4XE0A 1C4PA 3KWLA 2QJLA 1JRPA 4FXCA 2G9HD 5D3IB 5AUKA 2B76B 5BYSA 4KGRA 1GTEA 1TY0A 3KWVA 1XLNA 3VR9B 5FR3A 2BYTA 4JE3B 1DYQA 1GAQB 4YT0B 3TSSA 2JXTA 2MJ3A 3R2IA 4DQOC 4ZHPA 1FCLA 2QSDA 1FFVA 1YJJA 2AX5A 2NTTA 4P16A 3TEXA 2MJEA 1TS2A 2WDRB 3I57A 1XO3A 2L52A 4YWGG 1D6EC 2VZKB 3I9V1 3P4SB 1PGXA 3PZ7A 4DXGA 2N0SB 2EKIA 3CIRB 1FNVA 1KFYB 3TUOA 1TKGA 3IT4B 4D2KA 2DWQA 1ROEA 1VRAB 2IPKD 2QILA 3LB8C 1M4VA 2OHFA 2JYEA 2R61A 1PGAA 3AE2B 4N6EB 1QOAA 1YQ4B 1PYWD 1VDVA 2OEDA 1C77A 2WDVB 1CJEA 2ON8A 4N59A 2BS4B 1L0XB 3ZYYX 2BTEA 2WLBA 1JMLA 3B2FA 1XCTL 2J52A 2W55A 5HI1A 1I7HA 1CQVA 3ETRA 4RF1A 3TEWA 4TSSA 4YSZB 4CQNA 1T5XD 2INNE 1C4AA 2IGDA 4YTMB 2H89B 3AE1B 1N60A 2K5PA 4OZAA 5H92C 3NVVA 2J4XA 4PT5A 1JWMD 3AE3B 4TQ1A 4KX6B 2N9LA 1VZ8A 1FM0D 1C9FA 1VR9A 3AV8A 3MFGA 2WXMA 2INPE 3AECB 3KLSX 5LNK1 3BZDB 3OWEB 3RPFC 4ZHOA 2LGIA 4AS1A 4XWTA 1BMLC 2AQ2B 2WXPA 4A90A 1YMHE 4GDKB 3AE4B 3VRAB 1XLPA 3BYTB 4XDCA 3Q8EA 2IDYA 2JZPA 1EWYC 4IOIE 4YXDB 1F2RI 5G5GA 1MHXA 1FO4A 4RH6A 1A70A 1ZUD2 2KMMA 1PDXA 2GI9A 2J53A 4HRSA 2YEPF 1I4RA 2WXOA 1IBXB 1QF6A 3AM9A 4RNAA 1WRIA 4L2YA 1SEBD 1NEKB 3AE9B 2KDMA 1C79A 1UGJA 5MPOA 2WQYB 2CJOA 1BUIC 1K51A 1EU4A 4B0MA 5EE3A 1VZ6A 4JPSA 1ENFA 2WXLA 3T3OA 2BS2B 3LXFA 4EE2A 1IGDA 1P7EA 2Y5PA 1IBXA 3NVZA 2JQRB 1LO5D 4RGTA 4ZRPA 5TSSA 3AEDB 1L6UA 2BBCA 5G5HA 2WXJA 4NJCA 1I4GA 2JWUA 1L5PA 4HKQA 1FNUA 3NZ3A 1DOIA 1N62A 4RFBA 2I38A 4IDIA 5H8YE 3ZJUA 2IGGA 1TJEA 4GDLB 1JWAD 1JROA 4DXFA 1VJKA 2QEJC 1SSNA 4YSYB 2K0PA 1TS4A 1PGBA 2QMTA 4WIPA 4N58A 2CU3A 1QKZA 3H8HA 2MEKA 4C7ZA 4TMAB 2XN9C 1ZPSA 2CJNA 2PTLA 4OHJA 1F77A 1SE2A 4O1NA 2LJIA 3BVMA 3TEYA 1R7SA 4R3DA 3P4PB 1RM6C 1AN8A 2V4IB 2RPVA 4LK0M 3UI3A 3FILB 2I2YA 2KAJA 3EA6A 4AQ7A 5BYQA 1PFDA 2WDQB 2WU5B 1DGJA 3R2TA 1YNTE 3SR6A 3P4QB 3MC0B 1E9MA 4A55A 3CWIA 4A8XC 1FIQA 1JWSD 1T3QA 3MJ5A 4USAA 3BVGA 3ZQ4A 1FXAA 1J7BA 1HEZE 1E0ZA 1RFKA 1GT8A 1CK1A 3FC4A 1TKYA 2KWDA 2N7JA 2E3TA 4YTNB 1D5ZC 3E56A 1V8CA 1UNSA 4WH4A 1KF6B 4ITKA 1QOFA 1VZ7A 4NZLB 1MVKA 1HA5A 1I4HA 3U52E 1QT9A 2L1AA 2V3NA 2V3PA 1JWUD 4MACA 4OZBA 1WYGA 4ZRQA 4LTUA 3L4PA 3P63A 1OQQA 4L1BA 3SEBA 3BK2A 2W3RA 2WXNA 4H2AA 4JWUC 1ESFA 1D5MC 3J9CA 1GOZA 1GTHA 1VLBA 2L32A 4KKIA 3N9YC 4JX1C 1XXGA 1I4PA 3HVDA 3IT6B 1E7PB 2VZKD 2L83A 2N9KA 2WS3B 4REZA 2WXHA 3FAHA 2LHEA 2WXGA 3PZ8A 4XWWA 2HTME 3ZGZA 1HZ5A 1STEA 1DOYA 5BMIA 1F2RC 1JQ4A 1FFUA 5HG2A 5T8IA 1GB1A 3KQ4A 1SE3A 1H7XA 5EE1A 2JU6X 5BYRA 2Y3AA 1GPXA 3BVZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AUK A;  2B76 B;  1E6E B;  4US8 A;  1GTE A;  1N63 A;  2JQR B;  1XLN A;  3VR9 B;  3NVZ A;  2BS3 B;  3AED B;  1L6U A;  3AE6 B;  3AE7 B;  4C80 A;  1ZP0 B;  5G5H A;  3SFE B;  3VR8 B;  1L5P A;  2Q5W D;  1AYF A;  1GAQ B;  4YT0 B;  1DOI A;  1N62 A;  1WXQ A;  2MJ3 A;  1TKE A;  4IDI A;  5H8Y E;  4ZHP A;  1FFV A;  1TJE A;  1YJJ A;  1JWA D;  1JRO A;  2AX5 A;  5EE0 A;  3AMZ A;  3HUI A;  1VJK A;  1JAL A;  2MJE A;  2PVO D;  2LEK A;  1QOG A;  2WDR B;  3VRB B;  1N5W A;  1XO3 A;  4YSY B;  2L52 A;  3W9C B;  3P4S B;  3DWM A;  1FRR A;  2N0S B;  2EKI A;  1OFF A;  4JWS C;  3CIR B;  2CU3 A;  1KFY B;  2PVG C;  1TKG A;  3EUB 2;  4N58 A;  4C7Z A;  2DWQ A;  4YSX B;  1FRD A;  3NRZ A;  3P4R B;  1ROE A;  2CJN A;  2PIA A;  3WCQ A;  1JW9 D;  1PUT A;  1SIJ A;  1NEN B;  2QIE B;  3AE8 B;  3SFD B;  1F0Z A;  3LB8 C;  1R7S A;  1JWB D;  2OHF A;  3AN1 A;  3P4P B;  1J7A A;  1RWS A;  4N6E B;  3AE2 B;  1RM6 C;  1N61 A;  3AEE B;  1QOA A;  2K22 A;  2Y5C A;  1YQ4 B;  3AEG B;  2W54 A;  1VDV A;  2MH7 A;  2KAJ A;  1NVI D;  1CZP A;  2WP9 B;  1CJE A;  2WDV B;  2M19 A;  3NVW A;  4N59 A;  2BS4 B;  3AE5 B;  1PFD A;  3AEA B;  2WDQ B;  1QLB B;  2WU5 B;  1DGJ A;  2WLB A;  3ZYY X;  3B2F A;  4US9 A;  3SR6 A;  2W55 A;  3P4Q B;  1OQR A;  2BT6 A;  1E9M A;  1I7H A;  3CWI A;  3BII D;  3HVZ A;  1FXI A;  2FBW B;  1FIQ A;  1YJI A;  3ETR A;  3PO0 A;  1T3Q A;  4YSZ B;  3W5U B;  4USA A;  2DBY A;  1YQ3 B;  4YTM B;  2H89 B;  3AE1 B;  1N60 A;  2G1E A;  2K5P A;  1FXA A;  3DWG C;  1J7B A;  3NS1 A;  3NVV A;  3P1M A;  5AUI A;  1RFK A;  1E0Z A;  1GT8 A;  2M56 B;  1L0V B;  3AE3 B;  1XLO A;  4KX6 B;  1TKY A;  3FC4 A;  2E3T A;  4YTN B;  1FM0 D;  1WGK A;  3B9J A;  4ZOH C;  3AV8 A;  1V8C A;  1SB3 C;  1H7W A;  1KF6 B;  2JX5 A;  1QOF A;  1ZXI A;  4ITK A;  3NVY A;  3AEC B;  4C7Y A;  3RPF C;  4ZHO A;  3AEF B;  4YTP B;  2MJD A;  1E10 A;  1N5X A;  1QT9 A;  2PKO A;  3CF4 A;  1NI3 A;  1WWT A;  1WYG A;  1KRH A;  1QOB A;  1UWM A;  4LTU A;  3AB5 A;  3L4P A;  1J7C A;  3P63 A;  1RYJ A;  1OQQ A;  2W3S A;  1AWD A;  3AE4 B;  3VRA B;  1XLP A;  1XLQ A;  2W3R A;  1TYG B;  2ACZ B;  5GXG B;  4JWU C;  2WU2 B;  1DOX A;  3B2G A;  1EWY C;  1GTH A;  4YXD B;  5G5G A;  1VLB A;  1FO4 A;  1A70 A;  1ZUD 2;  2KMM A;  1NYQ A;  4A9A A;  1PDX A;  5EE9 A;  4HRS A;  5C3J B;  1SF0 A;  4JX1 C;  1NYR A;  3AM9 A;  1QF6 A;  1E7P B;  1IUE A;  1WRI A;  3HRD D;  2K9X A;  5C2T B;  1V97 A;  2L83 A;  2WS3 B;  1NEK B;  3W5V B;  3AE9 B;  3FAH A;  1L6V A;  3AEB B;  1B9R A;  4HRO A;  1FMA D;  2WQY B;  2HTM E;  5MPO A;  2CJO A;  3ABV B;  5H92 C;  1DOY A;  1JQ4 A;  1FFU A;  1ZOY B;  4WQM A;  2H88 B;  5EE3 A;  3AH7 A;  3KWL A;  4P6V F;  1H7X A;  5EE1 A;  2QJL A;  2BS2 B;  3LXF A;  1JRP A;  4FXC A;  4WWM A;  1GPX A; 
#chains in the Genus database with same CATH topology
 4MT5 A;  4WAF A;  1V1O A;  3VUY A;  1D5X C;  5IP4 D;  3L16 A;  1IP9 A;  4CHK A;  1RFA A;  2JWZ A;  2PVO D;  5IN7 A;  1N5W A;  3W9C B;  2OJR A;  3DVG X;  2V0G A;  4BOS C;  4IWO A;  3AU4 A;  2PIA A;  1JW9 D;  2G4S A;  2QIE B;  3AE8 B;  3PSE B;  3T3N A;  3SFD B;  1J7A A;  1SE4 A;  3C0R B;  2EEL A;  3AEG B;  3ZNI D;  2MCN B;  1IYF A;  2KFJ A;  1NVI D;  3GZN I;  1HTQ A;  1R4N I;  1ZXH A;  3RNE C;  4KV2 A;  4PS8 A;  2K6Q A;  4HLE A;  3H6N A;  2NPT A;  1L4Z B;  1Q10 A;  2AQ1 B;  1ZW7 A;  1L0V B;  4RCO A;  4ZOH C;  5L83 A;  2NS5 A;  4BKT A;  1WGR A;  4J3O D;  1WMH B;  4GGQ A;  1B1Z A;  3GE3 C;  1YN4 A;  4NAW B;  4II3 B;  2LZ6 A;  2WGS A;  1XQQ A;  4MEL A;  4XX5 A;  4ZDV A;  1WGG A;  2O2V A;  2BB5 A;  4RF0 A;  2Z0D B;  5C3J B;  3FIL A;  1V5O A;  4HVB A;  2QDF A;  2WXK A;  1WMH A;  3UIO B;  2JYT A;  5D7G A;  1QQR A;  4NAW A;  1HTO A;  1JCK B;  2D5G A;  1FCC C;  4BZA A;  3RMK C;  4WQM A;  1M94 A;  3W2D A;  2IJ0 A;  1NI2 A;  3VR8 B;  2BWE S;  5JXV A;  1XEE A;  1RRB A;  4FLH A;  3AMZ A;  3DBL B;  2LEK A;  4PK1 A;  4ARI A;  1FEH A;  1WF9 A;  4B9K A;  3D32 A;  2FUG 1;  4URK A;  4YSX B;  1FRD A;  2DZJ A;  1SJE D;  3WCQ A;  4EUT A;  2MBQ A;  3R8B A;  1WXV A;  1IGC A;  1F0Z A;  3ALB A;  3W1S A;  1N61 A;  2PJH A;  1HQR D;  4TKN A;  2KQ4 X;  3Q8A A;  2EMS A;  4ZRJ A;  2CKH B;  3HVZ A;  3P2B A;  2FBW B;  1MG8 A;  4IKG A;  4M0W B;  3W5U B;  3NOB A;  1P98 A;  1N6Z A;  2G4D B;  4XGA B;  2DLB A;  1SXT A;  4LNK A;  4LJP B;  2KN5 A;  2ZNV C;  5BMG A;  2DEN B;  1V49 A;  3S2A A;  4M0W A;  2HJ1 A;  3ZNH B;  4GMV A;  2OOB B;  3HHM A;  4HDQ A;  1TS3 A;  4HJG E;  4W9F A;  4II2 B;  2TSS A;  3WIM A;  2GBK A;  5GMV A;  1SF0 A;  5C2T B;  3SHQ A;  4EOY A;  3DHI C;  2EMT A;  1FMA D;  2KDI A;  1P0R A;  4ARC A;  4OVZ A;  5J2R A;  4XE0 A;  2RPQ A;  3DVG Y;  2JY6 A;  2QJL A;  4DXA B;  1P9D U;  2G9H D;  5AUK A;  1TY0 A;  4IC7 B;  1XLN A;  1WX7 A;  4KZC A;  1V9J A;  3V6C B;  2KHW B;  2MJ3 A;  1FFV A;  1YJJ A;  2NTT A;  3VHT C;  3RUI B;  2MJE A;  2D3G A;  3R7Q A;  3I9V 1;  3PZ7 A;  3VVW B;  3KUZ A;  1LFD A;  3PLU A;  1FNV A;  4FAD A;  1E8Z A;  4IM2 A;  3V62 A;  1VRA B;  2KWV B;  4P7I A;  3LB8 C;  1M4V A;  4N6E B;  3ZTC A;  4A3P A;  1YQ4 B;  2VRR B;  1L0X B;  3WAN A;  3ZYY X;  3RT3 B;  3NZU A;  4W9L A;  3DVN V;  2W55 A;  3Q3F A;  3NZS A;  5IA7 A;  1CQV A;  3ETR A;  4TSS A;  2LAS A;  2IO2 B;  2IGD A;  2FCM A;  2H89 B;  1N60 A;  3NVV A;  2RR9 A;  4PT5 A;  3ZLZ A;  2IND C;  3R66 C;  3GE8 C;  3LJ3 A;  2M1M A;  1MJD A;  5LNK 1;  3OWE B;  3QQ8 B;  1TT5 B;  3UF8 A;  2N9P C;  2IO0 B;  2B3A A;  1D3Z A;  2I1J A;  4HCP B;  3AE4 B;  1XLP A;  1PQS A;  4EFO A;  3EHV A;  4IOI E;  4WJP A;  1MHX A;  4RH6 A;  3NJT A;  2BKR B;  1PDX A;  4HRS A;  4G50 A;  2KDM A;  1C79 A;  2J0J A;  4ANW A;  2CJO A;  3UIP B;  1VZ6 A;  2KDB A;  2WXL A;  1J19 A;  3T3O A;  1IGD A;  3ZVV A;  5IAA C;  1T0Q C;  2L05 A;  4LJO B;  1LO5 D;  1I4G A;  3I3T B;  1DOI A;  3NZ3 A;  3ZJU A;  1TBE A;  2IGG A;  3ONS A;  2ZEQ A;  1JRO A;  2QEJ C;  1SSN A;  4YSY B;  1TS4 A;  1S3S G;  1PGB A;  2QMT A;  4WIP A;  2CHW A;  4LNI A;  2CU3 A;  3H8H A;  4WJN A;  1Y8R C;  2CJN A;  3JYU A;  3PT2 B;  2LUE A;  3L08 A;  4LNF A;  1R7S A;  2LRU A;  1AN8 A;  2KDF B;  1WXA A;  2FCS A;  4HDO A;  2ZPY A;  3Q3J A;  4F8C B;  4K3C A;  2DZK A;  1V81 A;  2I1K A;  1E9M A;  3CWI A;  2LRW A;  3IVF A;  3MJ5 A;  3RI7 C;  3BVG A;  3DQV A;  3NG0 A;  2KOX A;  3OAW A;  1J7B A;  1E0Z A;  3ZRC A;  3FC4 A;  2E3T A;  2KC2 A;  2VH1 A;  4P1C C;  1I4H A;  3AUL A;  4LDT D;  1QT9 A;  2L1A A;  2V3P A;  3UIN B;  2V1Y A;  4MAC A;  4OZB A;  3PV1 A;  3V6E B;  1H4R A;  4P1B C;  3ZNZ B;  4GU2 A;  4JWU C;  1CMX B;  3J9C A;  2MLB A;  2IY0 B;  4KKI A;  1VD2 A;  4JX1 C;  3HVD A;  1FXT B;  1WE7 A;  4ICV A;  1WXS A;  4IWQ A;  2LHE A;  2JPH A;  1T0S C;  2NCN A;  2QC8 A;  4BBN F;  1STE A;  3N30 A;  4MSM B;  5BMI A;  2JF5 A;  1WYW B;  5G55 A;  3V60 A;  1KOT A;  5EE1 A;  2JU6 X;  5BYR A;  2Y3A A;  3BVZ A;  1IPG A;  2BYF A;  1N63 A;  4C80 A;  2KAN A;  3AE6 B;  2LWP A;  1KH0 A;  3GOE A;  4EEW A;  5FKA C;  3EC8 A;  3A9K B;  4LLG M;  2N7D A;  1WE6 A;  2R2Q A;  3IAS 1;  2BPS A;  5BO4 B;  3RNF C;  1JAL A;  1QOG A;  5DCN A;  3UGB B;  3RNC C;  1FRR A;  2INC C;  1NEN B;  5FK9 C;  1WR6 E;  3V61 A;  3KW5 B;  3A9K A;  1RWS A;  2NBU A;  3PZD A;  4RGN A;  1TS5 A;  2IO1 B;  4AWJ A;  4MDK E;  1ZDX A;  3A9J B;  3IBE A;  4OZC A;  1OQR A;  1FXI A;  1YJI A;  1V1P B;  2D11 A;  3SD5 A;  5CX3 A;  5IKC M;  5AUI A;  3UQA A;  2RDH A;  3MHZ A;  1OEY A;  2FE8 A;  2JX5 A;  1KLG D;  2IYD B;  4EKU A;  4OVV A;  4W9H A;  1HZ6 A;  2K1F A;  1GUA B;  4FHK A;  3A9J A;  1E10 A;  2O6V A;  3Q6B A;  5BMH A;  1V1P A;  4I6N B;  3IFW B;  1K53 A;  4NY0 A;  1RYJ A;  3KYD D;  1UF0 A;  2W3S A;  5D3D A;  3GS2 A;  4C56 C;  1XLQ A;  5HHD G;  1GNU A;  2GOW A;  4KGS A;  2ACZ B;  3Q8B A;  3TMP B;  2KKC A;  3QAQ A;  1UD7 A;  1DOX A;  5DPR A;  1J0G A;  3RD2 A;  4K7U A;  2K9X A;  5CHV C;  3ZIM A;  3CMM B;  4CYE A;  3IAM 1;  2LFI A;  2GRI A;  4C4V B;  2ZW1 A;  4NAM A;  4BKS D;  2LVQ A;  3X0W A;  1P7F A;  4AJW A;  3N1Z C;  1ZOY B;  3BK1 A;  3U7Z A;  4WWM A;  1Y56 A;  2BW2 A;  1WI0 A;  1L4D B;  4MM3 B;  1KM7 A;  2M0X A;  2ZPN A;  2LUM A;  4C4V A;  3QWZ B;  1ISN A;  2N1V A;  3VQI A;  2L00 B;  3IXS A;  1RAX A;  2M0A A;  4JWS C;  4KZ0 A;  4ACF A;  2KTF A;  2BB6 A;  2C9W B;  2J0K A;  2A5U A;  2IY1 B;  3V05 A;  2M4N A;  3LYY A;  2RD0 A;  3RCZ A;  2Y5C A;  3MP9 A;  4B0E A;  1C76 A;  2M19 A;  1GB4 A;  4NJ7 A;  2DX5 B;  5KHO A;  3H9D A;  1SBB B;  1WY8 A;  4ANX A;  2G1E A;  3TBL D;  2L76 A;  4IM3 A;  2M56 B;  3KVF B;  1WGK A;  3U8Z A;  1SB3 C;  3NVY A;  2MJD A;  2WX1 A;  1T6B X;  2WX0 A;  3B1L X;  3C8Y A;  4A6Q A;  2LVP A;  3RFZ B;  2WXI A;  1FPY A;  1NYQ A;  5EE9 A;  3E9S A;  2DYM A;  2A4Z A;  1MI0 A;  1V86 A;  1E90 A;  2KAC A;  2NBW B;  4J6I A;  1H8C A;  2GBJ A;  2GLS A;  3TIX A;  1JRP A;  4FXC A;  2FNJ B;  5J18 A;  1V80 A;  4HJK A;  2BYT A;  4NNJ B;  1GAQ B;  1T0R C;  1P1A A;  2JXT A;  3VXW A;  4DQO C;  2KDE B;  1FCL A;  4G3X B;  2AX5 A;  3W1Y A;  1WM2 A;  1TS2 A;  4M8N A;  1UBI A;  2L8J A;  4YWG G;  2VZK B;  3H7S A;  4S0R A;  2R2O A;  4DXG A;  3I5J C;  3IHP C;  3IT4 B;  2DWQ A;  4DK5 A;  5CHW A;  4FUL A;  3OG5 A;  3VTU A;  2Z59 B;  3KH0 A;  2RSU A;  2KLC A;  3K9P B;  1QOA A;  4PS3 A;  1VDV A;  1C77 A;  2WDV B;  1CJE A;  1YJ1 A;  2ON8 A;  4N59 A;  1P3Q U;  3ECI A;  1XCT L;  5HI1 A;  1I7H A;  2HE7 A;  1YX5 B;  4RF1 A;  4YSZ B;  1T5X D;  1J8C A;  3PPA A;  4BBN C;  2J4X A;  2K25 A;  2N7E A;  1QZE A;  4KX6 B;  2J0M A;  1VZ8 A;  3MFG A;  3AV8 A;  3L0W B;  2KJH B;  2ZVO A;  3RPF C;  4ZHO A;  2LGI A;  2D3A A;  2AQ2 B;  2WXP A;  4MEM A;  4A90 A;  4GDK B;  2KZR A;  2V9H A;  5G5G A;  1A70 A;  2J53 A;  1IBX B;  1WRI A;  4MGY E;  3RNG C;  4ICU A;  3U30 A;  1TZ1 A;  2KTR B;  1BUI C;  3N32 A;  4GDK A;  1K51 A;  2GBN A;  3GZN B;  1R4N B;  2KXJ A;  5TR5 A;  1TGZ B;  2DHZ A;  1P7E A;  3T9L A;  1IBX A;  2ZNV B;  2KQ7 A;  4ZRP A;  1WR1 A;  2KK8 A;  1L6U A;  2L3Z A;  4X57 B;  2WXJ A;  4NJC A;  1VCB A;  4YL8 A;  1WRD B;  1FNU A;  2KTR A;  4IDI A;  5H8Y E;  4GDL B;  1JWA D;  3M3J A;  4NPN A;  1C1Y B;  3DHH C;  2CS4 A;  4ZRI A;  2XN9 C;  2MW5 A;  4LNO A;  5E6P A;  1EUV B;  4OHJ A;  1E7U A;  1F77 A;  4O1N A;  2LJI A;  3A4S C;  3BVM A;  3TEY A;  1T0Y A;  4RMA A;  3P4P B;  2V4I B;  2KNB A;  2RPV A;  3UI3 A;  2ZCC A;  3EA6 A;  3JW0 X;  1PFD A;  3R2T A;  3QAR A;  2IBI B;  4A55 A;  3ENE A;  4USA A;  2D2Q A;  2L7R A;  3A33 B;  1FXA A;  1WZ0 A;  3C19 A;  1TKY A;  2KWD A;  1V8C A;  1LQB A;  3WAM A;  4NZL B;  3PRE A;  4MGI E;  4GB9 A;  3U52 E;  1OQQ A;  2N9X A;  3SEB A;  4M02 A;  1EF5 A;  2BVC A;  1GOZ A;  3HK0 A;  3OJ3 A;  1VLB A;  2KWU B;  4GSW A;  5AEK B;  2KFK B;  1XXG A;  1I4P A;  2XBB C;  1RLF A;  4B95 A;  3ZGZ A;  2KVR A;  3ML8 A;  1HZ5 A;  3KUC B;  3Q3M C;  1DOY A;  5T8I A;  3PRZ A;  1SE3 A;  3NY5 A;  3QC8 B;  2KYW A;  4RM8 A;  3DBH I;  3Q8F A;  2JT4 B;  2KFK A;  1YX6 B;  3BYY B;  4UDU C;  3VUX A;  3KUD B;  1MHH E;  3SFE B;  4S17 A;  3M95 A;  1WXM A;  2Q5W D;  1AYF A;  1TKE A;  2QHO A;  5EE0 A;  3HUI A;  1XCQ L;  4FJY A;  4GXB A;  2WXR A;  4W9G A;  5I4D A;  1SGH A;  2M17 A;  4LNN A;  1WZ3 A;  2K8C A;  3QK0 A;  4ANV A;  1K52 A;  1AW7 A;  3NRZ A;  2PE9 A;  1L2N A;  3AN1 A;  3UQB A;  2L0F A;  2JRH A;  2K22 A;  2MH7 A;  1Q5W B;  2WP9 B;  3NVW A;  3ZRF A;  1QLB B;  1WX9 A;  3U2S C;  3N1X C;  1D4B A;  1LGR A;  2AEH A;  2D10 A;  2X38 A;  5E6N A;  4XYC A;  2LMC A;  4A9A A;  3DWG C;  2JXX A;  2YVC A;  4WQO B;  4ASW C;  1XLO A;  5L95 C;  4L23 A;  1L0Y B;  1H7W A;  2IGH A;  1FD6 A;  2W9N A;  4C7Y A;  2J7Q B;  1N5X A;  3VFK A;  2PKO A;  3CF4 A;  1OGW A;  3VDZ A;  1I4Q A;  1UWM A;  1EF1 A;  4LDT B;  3QX1 A;  2ZW0 A;  1SE9 A;  2HDE A;  2KMC A;  2FIF A;  2NVU I;  3B2G A;  1YN5 A;  2Z8L A;  1XF5 L;  4KDI C;  3CF6 E;  2G3Q B;  4W9E A;  3HRD D;  1C78 A;  3APC A;  4BOZ B;  3OJ4 B;  2WXQ A;  3H1U A;  2D07 B;  3PVL A;  3ZDM C;  3AH7 A;  3NS8 A;  4P6V F;  3VUW A;  5JHA A;  2ZZP B;  1E6E B;  1TTN A;  3M63 B;  1WGY A;  1UZX B;  2BS3 B;  2FCQ A;  2JZZ A;  2PMV A;  3WAP A;  2ZJD A;  3URY A;  1WSP A;  1BXT A;  2JRI B;  2SEB D;  2NTS A;  1FNW A;  4W9J A;  2KN4 A;  3T8M A;  1WFY A;  2XEW A;  4XDD A;  2AL6 A;  3EUB 2;  3Q14 C;  3P42 A;  1PUT A;  1MPE A;  3R3M A;  2DYO A;  3APD A;  3AEE B;  3WAL A;  4PS7 A;  1LXD A;  4Q2J A;  1I35 A;  3AE5 B;  3RN9 C;  3O13 A;  1ET9 A;  1Z5S B;  2K8H A;  3N20 C;  4KGT A;  4RM9 A;  4KDL B;  3W5V B;  4W9D A;  1UBQ A;  4WJQ A;  3ZTD A;  4M8M A;  3PHX B;  4A20 A;  4FN2 A;  1ZXI A;  1KTK A;  4I6L B;  4E74 A;  5HFY A;  3DCG A;  2AWT A;  3GB1 A;  1Q0W B;  2KVZ A;  4GLS C;  2FID A;  3DDC B;  1KRH A;  1WX8 A;  1J7C A;  1AWD A;  3RZW C;  3PHW B;  2KX0 A;  2REX A;  1TY2 A;  2MBE A;  3ZDT A;  4KKJ A;  1R4M I;  3TEZ A;  2MP2 B;  4KSK C;  5FR6 A;  2FCN A;  4K7W A;  4BKG A;  4ZYN A;  1L6V A;  3AEB B;  1YN3 A;  3VAW A;  2WNM A;  3K9O B;  4GOC A;  1C4P A;  4JIO U;  3DBR I;  2B76 B;  2AL3 A;  4KGR A;  5FR3 A;  2N9E B;  2KO3 A;  3RUL A;  3TSS A;  2KD0 A;  4ZHP A;  3R2I A;  2GMI C;  2O6V D;  3TEX A;  3QHT A;  4WJO A;  1XO3 A;  1D6E C;  4MJS B;  4HPM B;  2ZCB A;  3EFU A;  2N0S B;  2PPH A;  3TUO A;  4D2K A;  1ROE A;  2IPK D;  2MA9 B;  3MC9 A;  2OHF A;  2JYE A;  2R61 A;  1YIW A;  1PGA A;  3AE2 B;  2HD5 B;  3CST A;  3QCA A;  1WJU A;  1PYW D;  4MJS A;  3N1Y C;  3PS6 A;  4FA6 A;  3B08 A;  4LCD E;  2WLB A;  1JML A;  3B2F A;  5HKH A;  2J52 A;  2Y5B B;  3TEW A;  1ZGU B;  4CQN A;  2INN E;  2DZI A;  4MM3 A;  4YTM B;  2K5P A;  4OZA A;  5H92 C;  2JUO A;  3AE3 B;  4TQ1 A;  1NBF C;  1BT0 A;  3BZD B;  3M62 B;  3KYC D;  4AS1 A;  3EEC A;  4IWP A;  1BML C;  2MBB B;  3VRA B;  3BYT B;  2GBR A;  2IDY A;  2JZP A;  2LGS A;  4GIV A;  4YXD B;  1F2R I;  1ZUD 2;  2KMM A;  2NBV B;  3DHG C;  4AP4 C;  2YEP F;  1I4R A;  3AM9 A;  4RNA A;  4DHJ D;  3AE9 B;  1ZKH A;  2X8X X;  4HCN B;  5MPO A;  2WQY B;  3VH3 B;  2BWF A;  4FHJ A;  4F7Z A;  1GC6 A;  5EE3 A;  4MSQ B;  4JPS A;  1ENF A;  2MWS B;  2DAF A;  3NVZ A;  2ZVN A;  5TSS A;  3BY4 B;  2BBC A;  2NPT B;  1A5R A;  5G5H A;  2C5L C;  1L5P A;  1N62 A;  4RFB A;  2I38 A;  1C3T A;  5AZH A;  1R4M B;  3QJZ A;  4AUQ C;  3DPD A;  3ZW3 A;  3EFC A;  2UWQ A;  1QKZ A;  4C7Z A;  3MJW A;  3MHS D;  2PTL A;  3WA0 A;  1SE2 A;  2KJ6 A;  2LXA A;  3DBR B;  4K1R B;  2O2V B;  3FIL B;  2I2Y A;  1E7V A;  5BYQ A;  2WDQ B;  2WU5 B;  1DGJ A;  4QAY A;  1YNT E;  4W9I A;  3SR6 A;  3PTF C;  1HE8 A;  3P4Q B;  3MC0 B;  2HJ8 A;  2KX3 A;  3PLV A;  1FIQ A;  1JWS D;  1T3Q A;  1Z2M A;  1K8R B;  4W9C A;  4AOF A;  3HM3 A;  2KLG A;  1GT8 A;  4KSL C;  3ZXV A;  3I63 C;  4YTN B;  1D5Z C;  3E56 A;  4WH4 A;  1QOF A;  1VZ7 A;  2RGF A;  3HIZ A;  4TV3 A;  2BKF A;  1L7Y A;  5IO9 A;  1X1M A;  2ASQ A;  1KJT A;  2V3N A;  2Z0E B;  1JWU D;  1WYG A;  4DHZ E;  4ZRQ A;  2N1W A;  3W1S C;  3APF A;  3FKY A;  1V6E A;  2WXN A;  2UYZ B;  1WM3 A;  4JGH B;  1GJZ A;  1ESF A;  1GTH A;  2L32 A;  2KJR A;  2K8B A;  1GC7 A;  4DHZ B;  2BF8 B;  3IT6 B;  2EKE C;  2VZK D;  2WHI A;  2L83 A;  2WYQ A;  2WS3 B;  3ZKJ C;  1KLV A;  1E5W A;  4C00 A;  4G0N B;  1UEL A;  5EDS A;  1F2R C;  3L10 B;  1FFU A;  1YD8 U;  5HG2 A;  4NQL B;  4HXD A;  1EO6 A;  2JZ3 B;  1GPX A;  5D6J B;  2C7M B;  4US8 A;  2PLP A;  3L17 A;  1ZDV A;  1ZE3 D;  1ZP0 B;  4E71 A;  2J42 A;  3BIN A;  3JSV B;  1E8Y A;  2PEA A;  3LDZ E;  3X23 A;  1SIF A;  2JSV X;  1V2Y A;  3VRB B;  1UUP A;  1U4A A;  4K3B A;  3DWM A;  4RGO S;  1WJ4 A;  2FAZ A;  2K3U A;  2PVG C;  1JRU A;  1F1H A;  4HEA 1;  4MGZ E;  4ZYS A;  3H7P B;  2D3C A;  3JSV A;  2RDG A;  1OEY J;  3V3X A;  1HXY D;  4WWP A;  2W54 A;  2RMM A;  1CZP A;  2LVO A;  4HK2 A;  1ET6 A;  5DPT A;  2BT6 A;  3SDL C;  4HPP A;  1EM7 A;  3BII D;  2LHD A;  4K7S A;  3H7P A;  2BGF A;  4WUR A;  5C1Z A;  3ML9 A;  2CHZ A;  1TZO A;  3NS1 A;  3P1M A;  4RGM A;  1XD3 B;  3NUH B;  4GDL A;  3Q8C A;  3B9J A;  4MH0 E;  2GB1 A;  3ZXR A;  1E8X A;  5KHQ A;  3VH4 B;  3AEF B;  3U4E G;  3RZF A;  1NI3 A;  2OJW A;  1WWT A;  1QOB A;  2LGD A;  3TJP A;  3AB5 A;  4JL9 A;  1I4X A;  2VH2 A;  1TYG B;  4HPL B;  2HTH A;  2NMQ A;  1K50 A;  2UU7 A;  2XNA C;  2QCZ A;  4DDG D;  4ANU A;  4EZK A;  1LM8 B;  4HRO A;  5LXI B;  1Q1O A;  2H88 B;  2WDT B;  3GP7 A;  1E8W A;  2ONQ A;  3Q69 A;  4N9F 4;  1I42 A;  4WWO A;  4NJ6 A;  1EWC A;  1G6J A;  2W82 A;  3AE7 B;  2DYB A;  2LI5 A;  3DBS A;  1WXQ A;  2M8S A;  4HKZ E;  1ACC A;  3RYT A;  3ZJV A;  3PGE A;  1SJH D;  4K81 A;  2K6D B;  2CHX A;  1OFF A;  2PW9 A;  3P4R B;  2KWC A;  2LGX A;  1SIJ A;  4KVG B;  3RNB C;  2BQQ A;  1JWB D;  1XT9 B;  4HWI B;  4TQ0 A;  1MFW A;  4XC2 A;  4GN1 A;  3Q2A C;  2SAK A;  1KLU D;  3AXC A;  4BVU C;  3AEA B;  3EGR A;  2V3S A;  4US9 A;  2C7N B;  1C4C A;  3PO0 A;  2K39 A;  3ZJT A;  1EU3 A;  2DBY A;  1YQ3 B;  2JVC A;  4WAA A;  3BWU D;  2AQ3 B;  3QIJ A;  2ICI A;  3Q3N C;  1NDD A;  2YEP B;  4PYZ A;  3VTV A;  4YTP B;  5E6J A;  5JHB A;  3L54 A;  2LXC A;  3VTW A;  3SU8 X;  3TL5 A;  2E6X A;  5GXG B;  1UWX A;  2WU2 B;  2FUH B;  3B0A A;  1UH6 A;  1NYR A;  1IUE A;  5LXH A;  1V97 A;  1WGH A;  2WXF A;  3O65 B;  1B9R A;  3AI5 A;  4MH8 A;  1QIL A;  3ABV B;  3NHE B;  3MC8 A;  4OW0 A;  5AZF A;  1TIF A;  3IG3 A;  3KWL A;  4F1S A;  1WIA A;  3PRP B;  2KC1 A;  5D3I B;  4G11 A;  5BYS A;  1GTE A;  5C23 A;  3KWV A;  4IUM B;  3VR9 B;  3WAO A;  2C7H A;  4JE3 B;  5D94 A;  1DYQ A;  4I6P A;  4YT0 B;  3ZUN A;  2QSD A;  4P16 A;  3DOW A;  5DPW A;  1WJ6 A;  3QA8 A;  4EZJ A;  2WDR B;  3I57 A;  3U7D A;  2L52 A;  1F52 A;  3P4S B;  1PGX A;  5JZE B;  5CHF A;  2EKI A;  2PE6 B;  1OTR B;  3CIR B;  1KFY B;  2MRP A;  1TKG A;  2L0T A;  4M01 A;  5CTR C;  2QIL A;  2YLM A;  2AYO B;  2MBH A;  4B6W A;  3PRM B;  4A3O A;  1YOV B;  1OQY A;  2DAJ A;  2OED A;  4DBG A;  3CSF A;  4DDI D;  2BS4 B;  1AAR A;  2MHJ A;  2BTE A;  4BFR A;  4E3C A;  2D3B A;  1C4A A;  4DWF A;  5D2M B;  2C60 A;  2XK5 B;  4BAX A;  3AE1 B;  5DPS A;  3HM6 X;  2KMA A;  1JWM D;  2N9L A;  1FM0 D;  1C9F A;  1VR9 A;  3DBH B;  2WXM A;  1YQB A;  4ZRK A;  2INP E;  3AEC B;  3KLS X;  5E6O A;  3Q3O C;  3MTN B;  4XWT A;  2DNF A;  1YMH E;  2XK5 A;  4KIK B;  2BYE A;  5JH5 C;  1WH3 A;  4XDC A;  3Q8E A;  1EWY C;  3DVN U;  1GG3 A;  3A1Q B;  1FO4 A;  4AJY B;  5IOI A;  2GI9 A;  2WXO A;  1QF6 A;  2DZM A;  2KQS A;  4L2Y A;  1SEB D;  4IG7 B;  1NEK B;  1UGJ A;  2MX2 A;  3R7R A;  4KIK A;  1EU4 A;  4B0M A;  2CU1 A;  3A1Q A;  2BS2 B;  3LXF A;  4EE2 A;  2Y5P A;  2JQR B;  2MSE D;  4RGT A;  4CO7 A;  3AED B;  4JQW C;  2LGY A;  2JWU A;  4HKQ A;  3N3K B;  1TJE A;  3JVZ X;  4DXF A;  1VJK A;  3L13 A;  2K0P A;  4FJV B;  2NR2 A;  2O6V B;  1UGM A;  4N58 A;  2MEK A;  4TMA B;  1ZPS A;  3TCA A;  4NQK E;  2MBO A;  4IW0 A;  5AZG A;  1WGD A;  2MP2 A;  4R3D A;  2WWZ A;  2KT7 A;  1RM6 C;  4XZ4 A;  2GBM A;  2IZV B;  4LK0 M;  1S1Q B;  4WWN A;  2KAJ A;  4AQ7 A;  4M00 A;  4OVU A;  4TUU A;  5G2N A;  4BKS A;  4A8X C;  4MGK E;  2BYV E;  2V4L A;  1V5T A;  3ZQ4 A;  2LJ5 A;  3A4R A;  1HEZ E;  2MQJ A;  1RFK A;  1CK1 A;  2N7J A;  3AU5 A;  4FBJ B;  3ZNG C;  1UNS A;  1KF6 B;  2G45 B;  4ITK A;  4EZL A;  5J17 A;  1MVK A;  1HA5 A;  3RNA C;  4LTU A;  3L4P A;  3P63 A;  1MG4 A;  4L1B A;  4JLC A;  3BK2 A;  2W3R A;  4H2A A;  4W9K A;  3OLM D;  3ZO5 B;  2CR5 A;  1D5M C;  5LLI A;  2IO3 B;  1WJN A;  2LD9 A;  3DBL I;  3N9Y C;  1E7P B;  2N9K A;  4REZ A;  2WXH A;  3FAH A;  2WXG A;  3PZ8 A;  4FJZ A;  4XWW A;  2HTM E;  1F9J A;  4DHJ B;  1JQ4 A;  4PYU A;  1GB1 A;  3KQ4 A;  1H7X A;  4IM0 A;  2RDB C;  2N4F A; 
#chains in the Genus database with same CATH homology
 3Q8F A;  4MT5 A;  4US8 A;  2PLP A;  1N63 A;  4WAF A;  1V1O A;  4C80 A;  1ZDV A;  1ZE3 D;  3AE6 B;  1D5X C;  1KH0 A;  3BYY B;  1ZP0 B;  4UDU C;  1MHH E;  3SFE B;  5FKA C;  2Q5W D;  1AYF A;  4LLG M;  2J42 A;  1TKE A;  3IAS 1;  5EE0 A;  3HUI A;  1XCQ L;  1JAL A;  2PVO D;  1QOG A;  2JSV X;  1N5W A;  3VRB B;  1UUP A;  2WXR A;  3W9C B;  5I4D A;  3DWM A;  2V0G A;  1FRR A;  4RGO S;  2K3U A;  2PVG C;  1K52 A;  1AW7 A;  3NRZ A;  2PIA A;  4HEA 1;  1JW9 D;  2QIE B;  1NEN B;  5FK9 C;  3AE8 B;  4ZYS A;  3T3N A;  3SFD B;  3AN1 A;  1J7A A;  1RWS A;  1SE4 A;  2K22 A;  2RDG A;  2EEL A;  3V3X A;  3AEG B;  1HXY D;  2W54 A;  2MH7 A;  2RMM A;  1NVI D;  1CZP A;  2WP9 B;  3NVW A;  4RGN A;  1TS5 A;  1QLB B;  1ET6 A;  1ZDX A;  4OZC A;  1ZXH A;  3U2S C;  2BT6 A;  1OQR A;  1EM7 A;  3BII D;  1D4B A;  1FXI A;  2LHD A;  1YJI A;  1V1P B;  2X38 A;  4WUR A;  2LMC A;  1TZO A;  3DWG C;  4A9A A;  3NS1 A;  5AUI A;  1L4Z B;  1Q10 A;  3P1M A;  4RGM A;  2AQ1 B;  2RDH A;  3MHZ A;  1L0V B;  1XLO A;  3NUH B;  2FE8 A;  1L0Y B;  3Q8C A;  3B9J A;  4L23 A;  2GB1 A;  4RCO A;  2JX5 A;  1H7W A;  1KLG D;  4ZOH C;  2IGH A;  1FD6 A;  1HZ6 A;  4C7Y A;  3AEF B;  3U4E G;  1E10 A;  1N5X A;  2PKO A;  4J3O D;  3CF4 A;  1NI3 A;  1I4Q A;  1WWT A;  1B1Z A;  5BMH A;  1V1P A;  1QOB A;  1UWM A;  3AB5 A;  1K53 A;  1RYJ A;  2W3S A;  5D3D A;  1YN4 A;  3GS2 A;  4C56 C;  1I4X A;  4NAW B;  2ZW0 A;  1XLQ A;  2HDE A;  1TYG B;  5HHD G;  4KGS A;  2ACZ B;  3Q8B A;  1DOX A;  3B2G A;  1YN5 A;  2Z8L A;  1XF5 L;  2NMQ A;  1K50 A;  2BB5 A;  4RF0 A;  5C3J B;  3FIL A;  2XNA C;  3HRD D;  1C78 A;  2K9X A;  2WXK A;  2JYT A;  3IAM 1;  2WXQ A;  2LFI A;  2GRI A;  4HRO A;  2ZW1 A;  4NAM A;  5D7G A;  1QQR A;  1P7F A;  1JCK B;  2D5G A;  1ZOY B;  1FCC C;  2H88 B;  3GP7 A;  3AH7 A;  4P6V F;  2ONQ A;  3BK1 A;  3U7Z A;  4WQM A;  4WWM A;  3Q69 A;  1Y56 A;  3W2D A;  1E6E B;  2BW2 A;  2IJ0 A;  1EWC A;  1L4D B;  4MM3 B;  2BS3 B;  2W82 A;  3AE7 B;  2PMV A;  3VR8 B;  2LUM A;  1WXQ A;  3URY A;  1WSP A;  5JXV A;  1XEE A;  1BXT A;  3AMZ A;  2SEB D;  4HKZ E;  1ACC A;  2NTS A;  3ZJV A;  2LEK A;  1FNW A;  4ARI A;  1SJH D;  2KN4 A;  1FEH A;  3VQI A;  4XDD A;  3IXS A;  2FUG 1;  2M0A A;  1OFF A;  4JWS C;  3EUB 2;  4YSX B;  1FRD A;  2BB6 A;  3P4R B;  1SJE D;  2PW9 A;  3WCQ A;  3P42 A;  1PUT A;  1MPE A;  1SIJ A;  3R8B A;  2DYO A;  3V05 A;  1IGC A;  1F0Z A;  1JWB D;  3LYY A;  3W1S A;  1N61 A;  4TQ0 A;  3AEE B;  2Y5C A;  3MP9 A;  1HQR D;  4B0E A;  2KQ4 X;  4Q2J A;  1C76 A;  2M19 A;  2SAK A;  3Q8A A;  1KLU D;  3AE5 B;  1GB4 A;  3AEA B;  3EGR A;  4US9 A;  3O13 A;  1C4C A;  1ET9 A;  3HVZ A;  2FBW B;  1SBB B;  3PO0 A;  4IKG A;  3W5U B;  3ZJT A;  1EU3 A;  4KGT A;  2DBY A;  1YQ3 B;  3W5V B;  2G1E A;  3BWU D;  2DLB A;  2AQ3 B;  2M56 B;  1SXT A;  2ICI A;  1WGK A;  1SB3 C;  1ZXI A;  1KTK A;  3NVY A;  2YEP B;  5BMG A;  5HFY A;  4YTP B;  2MJD A;  5E6J A;  3GB1 A;  1T6B X;  4GLS C;  4M0W A;  1KRH A;  3C8Y A;  1J7C A;  1AWD A;  4A6Q A;  2E6X A;  3RFZ B;  2WXI A;  5GXG B;  1UWX A;  2WU2 B;  1TS3 A;  4HJG E;  1TY2 A;  1NYQ A;  2TSS A;  5EE9 A;  3E9S A;  2DYM A;  4KKJ A;  1SF0 A;  3TEZ A;  1NYR A;  1MI0 A;  1IUE A;  5C2T B;  1V97 A;  2KAC A;  2WXF A;  1L6V A;  3AEB B;  1YN3 A;  1B9R A;  1FMA D;  4MH8 A;  1QIL A;  3ABV B;  2WNM A;  4OW0 A;  4ARC A;  4OVZ A;  4XE0 A;  1C4P A;  3KWL A;  2QJL A;  1JRP A;  4FXC A;  2G9H D;  5D3I B;  5AUK A;  2B76 B;  5BYS A;  4KGR A;  1GTE A;  1TY0 A;  3KWV A;  1XLN A;  3VR9 B;  5FR3 A;  2BYT A;  4JE3 B;  1DYQ A;  1GAQ B;  4YT0 B;  3TSS A;  2JXT A;  2MJ3 A;  3R2I A;  4DQO C;  4ZHP A;  1FCL A;  2QSD A;  1FFV A;  1YJJ A;  2AX5 A;  2NTT A;  4P16 A;  3TEX A;  2MJE A;  1TS2 A;  2WDR B;  3I57 A;  1XO3 A;  2L52 A;  4YWG G;  1D6E C;  2VZK B;  3I9V 1;  3P4S B;  1PGX A;  3PZ7 A;  4DXG A;  2N0S B;  2EKI A;  3CIR B;  1FNV A;  1KFY B;  3TUO A;  1TKG A;  3IT4 B;  4D2K A;  2DWQ A;  1ROE A;  1VRA B;  2IPK D;  2QIL A;  3LB8 C;  1M4V A;  2OHF A;  2JYE A;  2R61 A;  1PGA A;  3AE2 B;  4N6E B;  1QOA A;  1YQ4 B;  1PYW D;  1VDV A;  2OED A;  1C77 A;  2WDV B;  1CJE A;  2ON8 A;  4N59 A;  2BS4 B;  1L0X B;  3ZYY X;  2BTE A;  2WLB A;  1JML A;  3B2F A;  1XCT L;  2J52 A;  2W55 A;  5HI1 A;  1I7H A;  1CQV A;  3ETR A;  4RF1 A;  3TEW A;  4TSS A;  4YSZ B;  4CQN A;  1T5X D;  2INN E;  1C4A A;  2IGD A;  4YTM B;  2H89 B;  3AE1 B;  1N60 A;  2K5P A;  4OZA A;  5H92 C;  3NVV A;  2J4X A;  4PT5 A;  1JWM D;  3AE3 B;  4TQ1 A;  4KX6 B;  2N9L A;  1VZ8 A;  1FM0 D;  1C9F A;  1VR9 A;  3AV8 A;  3MFG A;  2WXM A;  2INP E;  3AEC B;  3KLS X;  5LNK 1;  3BZD B;  3OWE B;  3RPF C;  4ZHO A;  2LGI A;  4AS1 A;  4XWT A;  1BML C;  2AQ2 B;  2WXP A;  4A90 A;  1YMH E;  4GDK B;  3AE4 B;  3VRA B;  1XLP A;  3BYT B;  4XDC A;  3Q8E A;  2IDY A;  2JZP A;  1EWY C;  4IOI E;  4YXD B;  1F2R I;  5G5G A;  1MHX A;  1FO4 A;  4RH6 A;  1A70 A;  1ZUD 2;  2KMM A;  1PDX A;  2GI9 A;  2J53 A;  4HRS A;  2YEP F;  1I4R A;  2WXO A;  1IBX B;  1QF6 A;  3AM9 A;  4RNA A;  1WRI A;  4L2Y A;  1SEB D;  1NEK B;  3AE9 B;  2KDM A;  1C79 A;  1UGJ A;  5MPO A;  2WQY B;  2CJO A;  1BUI C;  1K51 A;  1EU4 A;  4B0M A;  5EE3 A;  1VZ6 A;  4JPS A;  1ENF A;  2WXL A;  3T3O A;  2BS2 B;  3LXF A;  4EE2 A;  1IGD A;  1P7E A;  2Y5P A;  1IBX A;  3NVZ A;  2JQR B;  1LO5 D;  4RGT A;  4ZRP A;  5TSS A;  3AED B;  1L6U A;  2BBC A;  5G5H A;  2WXJ A;  4NJC A;  1I4G A;  2JWU A;  1L5P A;  4HKQ A;  1FNU A;  3NZ3 A;  1DOI A;  1N62 A;  4RFB A;  2I38 A;  4IDI A;  5H8Y E;  3ZJU A;  2IGG A;  1TJE A;  4GDL B;  1JWA D;  1JRO A;  4DXF A;  1VJK A;  2QEJ C;  1SSN A;  4YSY B;  2K0P A;  1TS4 A;  1PGB A;  2QMT A;  4WIP A;  4N58 A;  2CU3 A;  1QKZ A;  3H8H A;  2MEK A;  4C7Z A;  4TMA B;  2XN9 C;  1ZPS A;  2CJN A;  2PTL A;  4OHJ A;  1F77 A;  1SE2 A;  4O1N A;  2LJI A;  3BVM A;  3TEY A;  1R7S A;  4R3D A;  3P4P B;  1RM6 C;  1AN8 A;  2V4I B;  2RPV A;  4LK0 M;  3UI3 A;  3FIL B;  2I2Y A;  2KAJ A;  3EA6 A;  4AQ7 A;  5BYQ A;  1PFD A;  2WDQ B;  2WU5 B;  1DGJ A;  3R2T A;  1YNT E;  3SR6 A;  3P4Q B;  3MC0 B;  1E9M A;  4A55 A;  3CWI A;  4A8X C;  1FIQ A;  1JWS D;  1T3Q A;  3MJ5 A;  4USA A;  3BVG A;  3ZQ4 A;  1FXA A;  1J7B A;  1HEZ E;  1E0Z A;  1RFK A;  1GT8 A;  1CK1 A;  3FC4 A;  1TKY A;  2KWD A;  2N7J A;  2E3T A;  4YTN B;  1D5Z C;  3E56 A;  1V8C A;  1UNS A;  4WH4 A;  1KF6 B;  4ITK A;  1QOF A;  1VZ7 A;  4NZL B;  1MVK A;  1HA5 A;  1I4H A;  3U52 E;  1QT9 A;  2L1A A;  2V3N A;  2V3P A;  1JWU D;  4MAC A;  4OZB A;  1WYG A;  4ZRQ A;  4LTU A;  3L4P A;  3P63 A;  1OQQ A;  4L1B A;  3SEB A;  3BK2 A;  2W3R A;  2WXN A;  4H2A A;  4JWU C;  1ESF A;  1D5M C;  3J9C A;  1GOZ A;  1GTH A;  1VLB A;  2L32 A;  4KKI A;  3N9Y C;  4JX1 C;  1XXG A;  1I4P A;  3HVD A;  3IT6 B;  1E7P B;  2VZK D;  2L83 A;  2N9K A;  2WS3 B;  4REZ A;  2WXH A;  3FAH A;  2LHE A;  2WXG A;  3PZ8 A;  4XWW A;  2HTM E;  3ZGZ A;  1HZ5 A;  1STE A;  1DOY A;  5BMI A;  1F2R C;  1JQ4 A;  1FFU A;  5HG2 A;  5T8I A;  1GB1 A;  3KQ4 A;  1SE3 A;  1H7X A;  5EE1 A;  2JU6 X;  5BYR A;  2Y3A A;  1GPX A;  3BVZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...