4P1CC

Crystal structure of the toluene 4-monooxygenase hydroxylase-ferredoxin c7s, c84a, c85a variant electron-transfer complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
82
structure length
82
Chain Sequence
SAFPVHAAFEKDFLVQLVVVDLNDSMDQVAEKVAYHCVNRRVAPREGVMRVRKHRSTELFPRDMTIAESGLNPTEVIDVVFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Toluene-4-monooxygenase system protein A
publication title Structural basis for biomolecular recognition in overlapping binding sites in a diiron enzyme system.
pubmed doi rcsb
source organism Pseudomonas mendocina
total genus 25
structure length 82
sequence length 82
chains with identical sequence F
ec nomenclature ec 1.14.13.236: Toluene 4-monooxygenase.
pdb deposition date 2014-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 4p1cC00
3RNBC 3RMKC 3RNGC 2INDC 3DHIC 3N20C 3Q3NC 3GE3C 2INCC 3RNCC 3N1XC 3I63C 3Q3OC 3Q3MC 3RI7C 4P1BC 3RNFC 3N1YC 3RNEC 4P1CC 3DHHC 1T0QC 3RNAC 3DHGC 3N1ZC 3Q2AC 3GE8C 3RN9C 3Q14C 1T0SC 1T0RC 2RDBC 3I5JC
chains in the Genus database with same CATH superfamily
2GBRA 2N9LA 2UWQA 2MBBB 3QAQA 3AN1A 2BB6A 1UELA 3DQVA 4TSSA 1JWAD 1YMHE 1TKYA 2MWSB 1NI3A 2K6QA 1V1OA 1U4AA 1ZKHA 5BYSA 1JRPA 3O13A 4AP4C 4ZYNA 2RSUA 3ENEA 2V4LA 3JVZX 2B3AA 2RDGA 5BYRA 3FAHA 1F2RC 4HROA 1SEBD 2L32A 3WALA 3A1QB 3H7PB 5BO4B 5JXVA 4OZBA 2CKHB 4KGRA 5G2NA 1EF5A 1ZW7A 2O2VA 2PIAA 4ZDVA 2W55A 2WGSA 1C3TA 1TZOA 1QOAA 3UIOB 2MA9B 4ZOHC 2BT6A 1OFFA 1YOVB 2REXA 3TEYA 1IBXA 3LJ3A 3QHTA 3AULA 1I7HA 1I4XA 4ANVA 3KH0A 3L16A 2LGDA 3UIPB 1FEHA 1SE2A 3ZRFA 2Z8LA 4TV3A 1OEYA 1J7BA 2BTEA 1KLVA 3DVGY 4PT5A 3TBLD 2JUOA 4JGHB 2V3PA 2NCNA 1WXAA 5D94A 5IAAC 3TEZA 4DXFA 2L52A 2DNFA 1L4ZB 3VQIA 1SJHD 4HCNB 1K51A 3GB1A 1Z2MA 2L7RA 1VRAB 3PZDA 5FR3A 3AE4B 4NZLB 3JYUA 1WJNA 2JXTA 2WXRA 1UNSA 4TUUA 3QARA 3SFEB 3QK0A 5LNK1 4IW0A 3N1YC 2KYWA 4AWJA 4YXDB 2ZNVB 4MSMB 3P4SB 2XBBC 5D3IB 5EDSA 4II2B 3PZ7A 2BS3B 1JCKB 1TY2A 3PRMB 5I4DA 1TTNA 2ZPNA 2IO2B 2LXAA 3RNGC 3GS2A 1FCLA 2WDQB 1HZ5A 3Q8AA 4UDUC 2BYEA 1XO3A 3T3OA 3N32A 1UZXB 4DXAB 3U7ZA 3V6CB 2KXJA 3Q6BA 1YJJA 2ZW1A 1I4RA 3KLSX 2VZKB 1IGCA 1Q1OA 1K52A 1T5XD 3DBLI 4XX5A 4ZYSA 1V9JA 2LXCA 1D5ZC 2RGFA 2GB1A 3O65B 2Q5WD 5IKCM 5GXGB 2LHEA 1KJTA 4YTNB 1V8CA 4HEA1 2H89B 3TSSA 1JWBD 2AEHA 2AQ1B 3M62B 3N3KB 1C78A 1F9JA 1I42A 3SFDB 3P42A 3NVYA 1VD2A 4W9JA 1TIFA 4OVVA 1PGAA 2HTHA 4HK2A 2MW5A 1WZ0A 4IM2A 2NTTA 3X0WA 2FNJB 2PKOA 2D3BA 1RFKA 3VVWB 4IWQA 1EWCA 4MGIE 3VXWA 3Q8CA 4MGYE 3HUIA 3L10B 2EELA 2L0FA 2RDHA 2JZZA 3RZWC 1HE8A 4X57B 5D2MB 4JL9A 5LLIA 4KGTA 3V61A 2IJ0A 1XCQL 4YTMB 1ISNA 2KJ6A 3KUZA 3IBEA 4RCOA 2D3AA 1WRIA 2LGSA 3EA6A 3MJ5A 4TKNA 3HK0A 4MH8A 2O2VB 4LLGM 2NBWB 3GOEA 4RMAA 4PYUA 3P4PB 5CHWA 3KYCD 2N4FA 1GG3A 3A9JA 4BVUC 2GBKA 3BYYB 1IBXB 1PYWD 3PO0A 2IY0B 1LGRA 4GXBA 3T3NA 3LDZE 2DYMA 1V49A 2BVCA 3HRDD 4B0EA 3W2DA 3AEDB 3PLVA 3GZNI 1BXTA 2HE7A 1GOZA 4K7WA 4WJQA 1XLOA 4HJKA 1UD7A 4WH4A 4ZRJA 2VRRB 4IC7B 2AYOB 3Q8BA 3U30A 3H8HA 3I9V1 3OLMD 2JY6A 2K0PA 1MG8A 2Y5BB 2PTLA 3I57A 1CQVA 4K7UA 3VR8B 2KLCA 1TT5B 4KGSA 2RD0A 5JZEB 1KOTA 2C7MB 1NEKB 3ZKJC 2W82A 5J18A 2NVUI 4ICUA 2WXMA 4P16A 4DHZB 2PVOD 2PE9A 1NVID 3VR9B 1E9MA 3W5VB 3Q14C 2V4IB 2LFIA 2WHIA 3VHTC 3B08A 3VTVA 3TMPB 2DENB 2I1JA 2IO0B 2WXIA 2R2OA 4IKGA 4IM0A 1JWUD 3R2TA 2E3TA 1FRRA 3RNAC 2LUEA 2JT4B 3AEGB 4W9IA 3NS1A 1VJKA 4BZAA 2WXJA 4MT5A 1L2NA 4K81A 1EF1A 3WAMA 4C7ZA 1AWDA 2LVPA 1WJUA 5HG2A 1SE9A 3ABVB 3OAWA 2D2QA 2J7QB 1IYFA 1NYRA 3PRZA 4RFBA 1N61A 2M8SA 4KX6B 1V6EA 5D6JB 1G6JA 2GOWA 4DDGD 3H6NA 4J3OD 3ZQ4A 2JYEA 1TS3A 1CJEA 1XCTL 5AZGA 1H8CA 1C1YB 3ZUNA 3AB5A 2KD0A 2MHJA 4N9F4 4G0NB 3RN9C 1VCBA 2L05A 2WXGA 3AH7A 1ACCA 2HDEA 3BY4B 4M0WA 3NS8A 2JRHA 4CYEA 2FIFA 4GMVA 5AEKB 1DOYA 1HXYD 4JWSC 4ZHOA 4K7SA 1XF5L 3ZRCA 1YQ3B 4F8CB 3RT3B 2D11A 3EFCA 3N1ZC 3A9JB 2WNMA 3B2GA 1JMLA 4EKUA 2HJ1A 4EZJA 2N9KA 2G1EA 2DLBA 2RPVA 1TKEA 1QOGA 2K39A 1EM7A 2LHDA 5CHVC 2DWQA 4C56C 4CO7A 3I3TB 3TEWA 1T3QA 3DHGC 3ZDTA 1YQBA 1T0SC 2NBVB 1RM6C 2BB5A 4NNJB 3EUB2 2MSED 1MPEA 1LO5D 2LMCA 3N20C 3N9YC 5HHDG 3Q3JA 4WWOA 2JF5A 3I63C 2QSDA 3KYDD 3NHEB 4P6VF 1YJIA 2QIEB 3WCQA 1FD6A 2QEJC 1P7EA 2J0KA 2LASA 4MH0E 4P7IA 4W9GA 1OGWA 1MHHE 1Z5SB 4BBNC 4M00A 3SR6A 2KWCA 1WM2A 2JWUA 3Q8EA 4GDKA 4W9EA 3AU4A 2K8HA 4YL8A 3KUCB 1FXAA 1WGKA 3U4EG 2K8CA 5EE0A 3AEBB 4FA6A 2L83A 4ASWC 2FUHB 3AI5A 1GB1A 1WRDB 3SU8X 2W3RA 3DOWA 4LNNA 3HHMA 3ZO5B 2BKRB 4WJPA 3TUOA 1SIJA 3TEXA 3A33B 3FILA 4EZLA 3DPDA 5FK9C 3GZNB 2PMVA 2INPE 2JPHA 2LGXA 3ZNZB 3QWZB 1S1QB 2WXFA 2E6XA 3URYA 2PJHA 3R8BA 3DWGC 3IG3A 1B1ZA 1J19A 3ML9A 1FXTB 4FULA 1C9FA 2KC1A 3BIID 3P1MA 4NY0A 5AZFA 1BMLC 2NTSA 3PGEA 4NJ7A 4EFOA 2WU2B 4P1CC 3MTNB 2G9HD 1WSPA 1FFVA 3TJPA 1WWTA 3BZDB 2WX0A 4ITKA 3AECB 2CU1A 4PYZA 3ML8A 4W9LA 4GN1A 4ARIA 1R4MI 3HVDA 2BPSA 4C80A 3Q8FA 2NBUA 1YN4A 4BBNF 2JVCA 3NRZA 3NVZA 3CIRB 1R4NI 1VZ7A 2DAFA 2KANA 5J17A 3PPAA 1TZ1A 4WJOA 3K9PB 1QZEA 4IUMB 3PHXB 2UYZB 2RDBC 1UWXA 1E8XA 1WZ3A 4FHKA 3M95A 1HTQA 2WDVB 4DWFA 3RI7C 2J42A 3MC8A 2JYTA 2WXNA 3ZJUA 2C7HA 1T0QC 4OVUA 1SF0A 1MVKA 4YWGG 3QIJA 4R3DA 2K9XA 3L13A 4CQNA 2EKIA 1ZUD2 3DCGA 3RNBC 3MFGA 4GU2A 2Y5PA 3MHZA 4WWNA 3DVGX 2GBNA 3CMMB 3ZYYX 1UGJA 1HQRD 1UUPA 3PTFC 3OJ3A 2JXXA 4RF0A 3V6EB 1SE4A 1C4CA 2AWTA 3ONSA 2X8XX 3DHIC 1WJ4A 1WH3A 3B0AA 3SEBA 1E90A 3RNCC 2A5UA 4G11A 2OEDA 1YQ4B 1V5OA 2PEAA 3BK2A 2DYOA 3V62A 1F1HA 4GDKB 3ZLZA 2LVOA 2KQSA 1L6VA 3MC0B 4GDLA 2EKEC 3KW5B 4US8A 1L0XB 5H8YE 2Z0EB 1YX5B 2XEWA 4BKSD 4XE0A 3Q3NC 1WXVA 3NY5A 1PQSA 3Q3OC 2JZPA 5MPOA 1EUVB 2DZMA 5IO9A 2K5PA 2O6VD 2AL3A 2MEKA 5H92C 3FILB 3B1LX 3DBSA 2IZVB 2LGIA 4RM9A 1TS5A 4HJGE 1P3QU 2W3SA 4ICVA 4GIVA 1L5PA 2M1MA 3RNFC 2J53A 2KACA 1MFWA 3M63B 2CU3A 4Q2JA 4NAMA 2KX0A 2ZW0A 3NG0A 4S0RA 3SDLC 4KVGB 1WE6A 4HLEA 3VH4B 1VZ6A 2KO3A 3NUHB 2WLBA 1C77A 1QT9A 4W9FA 1SXTA 1XEEA 2BGFA 2FCSA 3VDZA 2NMQA 2WXKA 4W9HA 2G45B 1TY0A 2ASQA 1Q10A 1WJ6A 3JSVA 4OZAA 1KFYB 2LZ6A 2ZVNA 4LDTB 2RR9A 1WXMA 1YX6B 1SB3C 2KDMA 3HIZA 3OWEB 1OQRA 3BVGA 2C5LC 4FXCA 2KWUB 3VUXA 1WR6E 1FNUA 3NJTA 2I1KA 4HRSA 2J4XA 2WP9B 4AJYB 4REZA 4H2AA 2KDBA 5IOIA 1SSNA 1K50A 4XGAB 2IDYA 4MGZE 1ZXHA 3WAPA 5CX3A 1DYQA 2JZ3B 4NJ6A 1A70A 4HPPA 3BVZA 1STEA 2KT7A 1E7PB 3K9OB 1BUIC 1QOFA 4KSLC 1WGDA 3ZGZA 4A6QA 1JWSD 3IFWB 3IT6B 3HM6X 2KN5A 3WIMA 4PS8A 4YTPB 3B9JA 1NI2A 1I4PA 1OTRB 1T0RC 2INNE 5KHQA 2VZKD 4OHJA 1JQ4A 1K8RB 4NPNA 1RRBA 1R4MB 2C7NB 2LUMA 2KMCA 4A3OA 3UQBA 1OQYA 4WJNA 3R7QA 3FC4A 1R4NB 4RF1A 1E7UA 3T9LA 2MLBA 2KMAA 2W54A 3ECIA 3W1YA 1CMXB 3AE8B 1UWMA 2ZPYA 1FNWA 2MJEA 4GLSC 4A20A 2MBHA 5TR5A 2CR5A 4ARCA 1XLPA 1ZE3D 5C3JB 1DOIA 3OG5A 3HVZA 2BW2A 3DHHC 1IUEA 3H7SA 3PLUA 2WXLA 4DHZE 1VZ8A 4ZRPA 1P7FA 1L6UA 2AQ3B 1IP9A 4ANXA 4S17A 2J52A 3IAS1 1S3SG 4ANUA 5EE3A 1N5XA 1C79A 4XDDA 3PHWB 2QMTA 1NDDA 1HA5A 1B9RA 3EC8A 4XWTA 3ZTCA 1A5RA 4YT0B 4C00A 4HWIB 3U8ZA 4WQOB 4DXGA 3UINB 3SHQA 4W9CA 4LK0M 4LNIA 2KTRA 4ZHPA 3X23A 3ZJVA 1X1MA 3RMKC 1V81A 2XN9C 4RH6A 3R66C 2DYBA 1D3ZA 2WYQA 3APFA 2OOBB 2D10A 2DAJA 1PGXA 2N9EB 5EE9A 2HJ8A 2KFKA 1WX7A 2KZRA 3RFZB 3UI3A 2JWZA 3NZSA 3LB8C 1I35A 2YLMA 2DZKA 3WAOA 2ZVOA 2XK5A 1WM3A 3MC9A 4N59A 1KLGD 3IAM1 3VAWA 4FJYA 1GAQB 3NVVA 5D7GA 1WY8A 2PPHA 2MP2A 3JSVB 5C2TB 4B6WA 4N6EB 2WXHA 4L23A 2ONQA 2BYTA 3ZVVA 2D3GA 1HTOA 3IXSA 1TS2A 1E8WA 3T8MA 1FNVA 4YSXB 1GC6A 4W9KA 2N1WA 1UGMA 1WF9A 2INCC 4XYCA 2ZEQA 2R61A 2LEKA 1ROEA 1YNTE 2K3UA 3W5UB 3QQ8B 4KKJA 1RAXA 1WFYA 5L83A 1GJZA 2Y5CA 2B76B 3ZIMA 2DX5B 1V5TA 4JQWC 1FO4A 3VTWA 5G5GA 2LVQA 4GGQA 4HXDA 1NENB 4GSWA 1XT9B 1J7AA 2Y3AA 3VUYA 1WI0A 3UF8A 2V1YA 2ZCBA 4PK1A 2KK8A 2G4SA 3ZXVA 2FCMA 2MX2A 2I2YA 2KTFA 5TSSA 1FM0D 2L1AA 3RCZA 4HKZE 3UQAA 2SAKA 1C4AA 2FBWB 4OZCA 1SBBB 4BOSC 1PGBA 2O6VA 2KX3A 4DDID 1C76A 5AZHA 1FFUA 4EOYA 3ALBA 2CS4A 1WGGA 2D5GA 5BMIA 5IA7A 3R2IA 5D3DA 4A8XC 3AE5B 2MRPA 2JU6X 3L0WB 3Q3MC 3PS6A 1ZOYB 1J8CA 5J2RA 2N7JA 3R3MA 5AUKA 2BYFA 3L08A 2RPQA 5G55A 3W1SC 2QC8A 2CHZA 3Q2AC 2DZIA 3WANA 4A90A 3AEFB 1R7SA 2M56B 3ZJTA 1AN8A 4WURA 1NYQA 2KKCA 1C4PA 1RFAA 2QILA 2GRIA 2A4ZA 1LXDA 2LWPA 2UU7A 1GPXA 1EO6A 4BKTA 2KDIA 4DHJB 1PDXA 4HVBA 2KTRB 3LXFA 1XLQA 5LXIB 3VRAB 1YD8U 3U7DA 1QF6A 1AARA 2H88B 1ZXIA 3ZTDA 4RGOS 4IG7B 2V3NA 1WIAA 2MJ3A 1JROA 1V2YA 4YSZB 2KFKB 4TQ0A 3LYYA 2MCNB 4D2KA 4JWUC 3R7RA 4EZKA 1M94A 2K1FA 2L00B 2M19A 5E6JA 2XK5B 3A4SC 2I38A 5IN7A 2BBCA 3H9DA 3RD2A 2JX5A 4TQ1A 3WA0A 2WXPA 2MP2B 1QQRA 3C19A 3I5JC 2KQ4X 3A9KA 1WX9A 4I6NB 1I4HA 2KJRA 1F0ZA 3DBHI 2NS5A 1WR1A 4NQLB 1CK1A 5HFYA 1P1AA 4KIKA 2KDFB 3W9CB 1AW7A 2AL6A 4WWMA 3RULA 1BT0A 1FMAD 1EU3A 1CZPA 4XZ4A 2J0JA 4OVZA 5HKHA 3H1UA 3PREA 4LNKA 4MACA 1ENFA 4USAA 3D32A 3P4QB 2ACZB 2K25A 2GBJA 1DOXA 2WU5B 3E9SA 2TSSA 2MH7A 4BFRA 4M0WB 2WX1A 3AXCA 4FADA 4KKIA 1MG4A 4J6IA 3ZNHB 1HZ6A 3MHSD 4EEWA 2FIDA 1SGHA 2K6DB 3DVNU 3N30A 3JW0X 4WWPA 5IP4D 3AMZA 3AE9B 3QCAA 3TIXA 4XDCA 2C60A 4MJSA 4ANWA 4ZRQA 2NPTA 4GB9A 1KF6B 5C23A 1KTKA 2WXQA 2WS3B 1D5MC 4M02A 1P0RA 3ETRA 1L4DB 2L3ZA 2FCNA 3OJ4B 2KVZA 5DCNA 4MDKE 2O6VB 2BS4B 2BKFA 4HKQA 1FRDA 4G50A 1KM7A 1P9DU 2QJLA 1ESFA 1UBIA 1MI0A 2MBQA 3ZNGC 4M8MA 4PS3A 2PLPA 1E7VA 3L4PA 1TJEA 4JX1C 2KDEB 3BYTB 1E8YA 2GI9A 4DK5A 1OQQA 4XWWA 2BYVE 3KWLA 3E56A 2KC2A 3RPFC 4MEMA 1KLUD 1YN3A 2G3QB 2MBOA 4F7ZA 2LI5A 1YIWA 5DPTA 4B0MA 2INDC 2L0TA 1P98A 1WMHA 3CSTA 2IY1B 4DBGA 4AS1A 4JIOU 3ZW3A 3UGBB 1J0GA 2HD5B 2SEBD 1MHXA 1E0ZA 5DPSA 2EMTA 1XD3B 2X38A 1T6BX 1ET9A 2L76A 4LCDE 2BF8B 2YVCA 4W9DA 4E71A 3IVFA 4LTUA 3AEAB 3QA8A 2N9XA 4WAAA 4KDLB 2QCZA 3A9KB 4HDOA 2AQ2B 2KJHB 4US9A 2N9PC 1SE3A 2VH1A 3EFUA 4HDQA 3Q3FA 2RMMA 4N58A 3EECA 1Y8RC 4ZRKA 3S2AA 1JW9D 3FKYA 2ZNVC 4KIKB 1N60A 2OJWA 2OHFA 3DBRI 4FLHA 1ZDVA 2AX5A 1RLFA 2W9NA 1E10A 5L95C 3KUDB 4BOZB 4RGTA 3VH3B 2IO1B 2ZCCA 1ZPSA 3AEEB 2M17A 3APDA 4IOIE 2LRUA 2KN4A 4NAWA 3EGRA 2KQ7A 2V9HA 1L7YA 1WGHA 3AU5A 2IO3B 2DBYA 3GE3C 3P2BA 2KVRA 4MJSB 4KDIC 4P1BC 4BAXA 2NPTB 4WAFA 5DPRA 3VTUA 3DBHB 5JHAA 2DHZA 3RUIB 3V05A 3NZUA 3P4RB 1V80A 3AE3B 1E8ZA 5JH5C 2PE6B 1FIQA 2EMSA 2FCQA 1GUAB 1V86A 3AE7B 4YSYB 3AE2B 1UBQA 1WX8A 3M3JA 2KNBA 4MM3A 2FUG1 2Z0DB 1L0VB 2WXOA 1KRHA 4K3BA 4FJVB 1LM8B 4NQKE 2BS2B 1SJED 1E5WA 4LDTD 1V1PA 1YJ1A 2N7EA 3DWMA 3W1SA 1ZDXA 4IWPA 2NR2A 4XC2A 1EWYC 3TL5A 1D4BA 1JWMD 4GDLB 2CHWA 3C0RB 2ICIA 3VUWA 2LRWA 5GMVA 1WMHB 4IM3A 2V0GA 3B2FA 5LXHA 5FKAC 4LJPB 4DQOC 3MP9A 4JE3B 3A4RA 3KWVA 1IGDA 3CSFA 2WWZA 1GNUA 3N1XC 1Q5WB 1Q0WB 1VDVA 3KVFB 4KZ0A 1V97A 1LQBA 4NJCA 3C8YA 3U52E 4M8NA 1D6EC 2KWDA 3IHPC 5BMHA 3BINA 3APCA 4HCPB 2M4NA 4RM8A 2G4DB 4KV2A 3PVLA 4LJOB 2KMMA 1F77A 3ZXRA 1TGZB 2N1VA 4IDIA 1K53A 2WDRB 1I4GA 3RZFA 4KZCA 4EUTA 3PZ8A 4KSKC 2XNAC 4F1SA 2OJRA 3BWUD 2M0AA 4L1BA 3SD5A 3AV8A 1N63A 1QKZA 1UF0A 5BMGA 5DPWA 1FCCC 3PT2B 2LJ5A 1WXQA 4OW0A 5E6NA 4A55A 1F2RI 4MGKE 3PRPB 4WQMA 1NBFC 2IGDA 3DVNV 1RYJA 4E74A 1WXSA 2IYDB 1MJDA 2IPKD 4CHKA 2CJNA 4EE2A 3DDCB 2C9WB 3Q69A 4JPSA 4NAWB 4B95A 4L2YA 2KHWB 4TMAB 2M0XA 3CWIA 3QJZA 1EU4A 3V3XA 4MSQB 1WGYA 3RNEC 1JALA 2KWVB 1JRUA 2IGHA 2QHOA 2BQQA 2WQYB 4C4VA 2YEPB 5CTRC 3TCAA 1WYGA 2ZJDA 3L17A 4E3CA 1VR9A 4K3CA 5JHBA 2KOXA 4RGMA 3ZDMC 2FAZA 3PSEB 4FJZA 5CHFA 3PV1A 1DGJA 2WDTB 2Z59B 4FBJB 3AE6B 5E6OA 1D5XC 4M01A 2N7DA 4AOFA 1XXGA 3IT4B 2KFJA 4LNOA 3DBRB 3U2SC 1AYFA 1QLBB 4HPMB 1TKGA 1RWSA 2MJDA 2D07B 1ET6A 4GOCA 3DBLB 4MM3B 3NOBA 5E6PA 4O1NA 4MELA 4BKSA 4I6LB 1HEZE 3GP7A 4FN2A 2BWFA 2CJOA 2MQJA 4FHJA 3BVMA 1WE7A 2QDFA 1PFDA 1UH6A 2JRIB 1V1PB 2JQRB 3J9CA 5FR6A 4ACFA 1VLBA 2J0MA 3A1QA 3H7PA 2PVGC 1PUTA 1SIFA 4AUQC 2L8JA 2FE8A 4A9AA 2V3SA 4RGNA 2BWES 1GC7A 3ZNID 5T8IA 1E6EB 4ZRIA 3V60A 2MBEA 1I4QA 2K8BA 5KHOA 4IWOA 4PS7A 2LGYA 2IGGA 4K1RB 1QOBA 1XQQA 1ZGUB 1T0YA 1WGRA 1KH0A 2D3CA 2GMIC 1M4VA 3CF6E 2HTME 1H4RA 4HPLB 3RYTA 4II3B 4AQ7A 3AM9A 2YEPF 4C7YA 2ON8A 1OEYJ 3NZ3A 2ZZPB 3AE1B 3QC8B 5BYQA 4JLCA 3KQ4A 3P63A 2GLSA 1YN5A 2CHXA 2N0SB 1FXIA 1TYGB 1FPYA 4LNFA 1N62A 4WIPA 4QAYA 1F52A 1LFDA 1TS4A 2IBIB 2LD9A 3VRBB 2DZJA 3HM3A 4BKGA 3VFKA 1QILA 5AUIA 1TBEA 2R2QA 4URKA 1WYWB 3L54A 2GBMA 2LJIA 1Y56A 4G3XB 1ZP0B 2VH2A 1GB4A 4AJWA 2JSVX 4C4VB 3MJWA 5G5HA 1L0YB 3NVWA 1IPGA 1J7CA 1N6ZA 1N5WA 2PW9A 3EHVA 2KLGA 5EE1A 4B9KA 1XLNA 2KAJA 2K22A 4DHJD 3GE8C 3QX1A 4A3PA 4I6PA 3BK1A 5C1ZA 5HI1A 4RNAA
chains in the Genus database with same CATH topology
3RNBC 3RMKC 3RNGC 2INDC 3DHIC 3N20C 3Q3NC 3GE3C 2INCC 3RNCC 3N1XC 3I63C 3Q3OC 3Q3MC 3RI7C 4P1BC 3RNFC 3N1YC 3RNEC 4P1CC 3DHHC 1T0QC 3RNAC 3DHGC 3N1ZC 3Q2AC 3GE8C 3RN9C 3Q14C 1T0SC 1T0RC 2RDBC 3I5JC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RNB C;  3RMK C;  3RNG C;  2IND C;  3DHI C;  3N20 C;  3Q3N C;  3GE3 C;  2INC C;  3RNC C;  3N1X C;  3I63 C;  3Q3O C;  3Q3M C;  3RI7 C;  4P1B C;  3RNF C;  3N1Y C;  3RNE C;  4P1C C;  3DHH C;  1T0Q C;  3RNA C;  3DHG C;  3N1Z C;  3Q2A C;  3GE8 C;  3RN9 C;  3Q14 C;  1T0S C;  1T0R C;  2RDB C;  3I5J C; 
#chains in the Genus database with same CATH topology
 2GBR A;  2N9L A;  2UWQ A;  2MBB B;  3QAQ A;  3AN1 A;  2BB6 A;  1UEL A;  3DQV A;  4TSS A;  1JWA D;  1YMH E;  1TKY A;  2MWS B;  1NI3 A;  2K6Q A;  1V1O A;  1U4A A;  1ZKH A;  5BYS A;  1JRP A;  3O13 A;  4AP4 C;  4ZYN A;  2RSU A;  3ENE A;  2V4L A;  3JVZ X;  2B3A A;  2RDG A;  5BYR A;  3FAH A;  1F2R C;  4HRO A;  1SEB D;  2L32 A;  3WAL A;  3A1Q B;  3H7P B;  5BO4 B;  5JXV A;  4OZB A;  2CKH B;  4KGR A;  5G2N A;  1EF5 A;  1ZW7 A;  2O2V A;  2PIA A;  4ZDV A;  2W55 A;  2WGS A;  1C3T A;  1TZO A;  1QOA A;  3UIO B;  2MA9 B;  4ZOH C;  2BT6 A;  1OFF A;  1YOV B;  2REX A;  3TEY A;  1IBX A;  3LJ3 A;  3QHT A;  3AUL A;  1I7H A;  1I4X A;  4ANV A;  3KH0 A;  3L16 A;  2LGD A;  3UIP B;  1FEH A;  1SE2 A;  3ZRF A;  2Z8L A;  4TV3 A;  1OEY A;  1J7B A;  2BTE A;  1KLV A;  3DVG Y;  4PT5 A;  3TBL D;  2JUO A;  4JGH B;  2V3P A;  2NCN A;  1WXA A;  5D94 A;  5IAA C;  3TEZ A;  4DXF A;  2L52 A;  2DNF A;  1L4Z B;  3VQI A;  1SJH D;  4HCN B;  1K51 A;  3GB1 A;  1Z2M A;  2L7R A;  1VRA B;  3PZD A;  5FR3 A;  3AE4 B;  4NZL B;  3JYU A;  1WJN A;  2JXT A;  2WXR A;  1UNS A;  4TUU A;  3QAR A;  3SFE B;  3QK0 A;  5LNK 1;  4IW0 A;  3N1Y C;  2KYW A;  4AWJ A;  4YXD B;  2ZNV B;  4MSM B;  3P4S B;  2XBB C;  5D3I B;  5EDS A;  4II2 B;  3PZ7 A;  2BS3 B;  1JCK B;  1TY2 A;  3PRM B;  5I4D A;  1TTN A;  2ZPN A;  2IO2 B;  2LXA A;  3RNG C;  3GS2 A;  1FCL A;  2WDQ B;  1HZ5 A;  3Q8A A;  4UDU C;  2BYE A;  1XO3 A;  3T3O A;  3N32 A;  1UZX B;  4DXA B;  3U7Z A;  3V6C B;  2KXJ A;  3Q6B A;  1YJJ A;  2ZW1 A;  1I4R A;  3KLS X;  2VZK B;  1IGC A;  1Q1O A;  1K52 A;  1T5X D;  3DBL I;  4XX5 A;  4ZYS A;  1V9J A;  2LXC A;  1D5Z C;  2RGF A;  2GB1 A;  3O65 B;  2Q5W D;  5IKC M;  5GXG B;  2LHE A;  1KJT A;  4YTN B;  1V8C A;  4HEA 1;  2H89 B;  3TSS A;  1JWB D;  2AEH A;  2AQ1 B;  3M62 B;  3N3K B;  1C78 A;  1F9J A;  1I42 A;  3SFD B;  3P42 A;  3NVY A;  1VD2 A;  4W9J A;  1TIF A;  4OVV A;  1PGA A;  2HTH A;  4HK2 A;  2MW5 A;  1WZ0 A;  4IM2 A;  2NTT A;  3X0W A;  2FNJ B;  2PKO A;  2D3B A;  1RFK A;  3VVW B;  4IWQ A;  1EWC A;  4MGI E;  3VXW A;  3Q8C A;  4MGY E;  3HUI A;  3L10 B;  2EEL A;  2L0F A;  2RDH A;  2JZZ A;  3RZW C;  1HE8 A;  4X57 B;  5D2M B;  4JL9 A;  5LLI A;  4KGT A;  3V61 A;  2IJ0 A;  1XCQ L;  4YTM B;  1ISN A;  2KJ6 A;  3KUZ A;  3IBE A;  4RCO A;  2D3A A;  1WRI A;  2LGS A;  3EA6 A;  3MJ5 A;  4TKN A;  3HK0 A;  4MH8 A;  2O2V B;  4LLG M;  2NBW B;  3GOE A;  4RMA A;  4PYU A;  3P4P B;  5CHW A;  3KYC D;  2N4F A;  1GG3 A;  3A9J A;  4BVU C;  2GBK A;  3BYY B;  1IBX B;  1PYW D;  3PO0 A;  2IY0 B;  1LGR A;  4GXB A;  3T3N A;  3LDZ E;  2DYM A;  1V49 A;  2BVC A;  3HRD D;  4B0E A;  3W2D A;  3AED B;  3PLV A;  3GZN I;  1BXT A;  2HE7 A;  1GOZ A;  4K7W A;  4WJQ A;  1XLO A;  4HJK A;  1UD7 A;  4WH4 A;  4ZRJ A;  2VRR B;  4IC7 B;  2AYO B;  3Q8B A;  3U30 A;  3H8H A;  3I9V 1;  3OLM D;  2JY6 A;  2K0P A;  1MG8 A;  2Y5B B;  2PTL A;  3I57 A;  1CQV A;  4K7U A;  3VR8 B;  2KLC A;  1TT5 B;  4KGS A;  2RD0 A;  5JZE B;  1KOT A;  2C7M B;  1NEK B;  3ZKJ C;  2W82 A;  5J18 A;  2NVU I;  4ICU A;  2WXM A;  4P16 A;  4DHZ B;  2PVO D;  2PE9 A;  1NVI D;  3VR9 B;  1E9M A;  3W5V B;  3Q14 C;  2V4I B;  2LFI A;  2WHI A;  3VHT C;  3B08 A;  3VTV A;  3TMP B;  2DEN B;  2I1J A;  2IO0 B;  2WXI A;  2R2O A;  4IKG A;  4IM0 A;  1JWU D;  3R2T A;  2E3T A;  1FRR A;  3RNA C;  2LUE A;  2JT4 B;  3AEG B;  4W9I A;  3NS1 A;  1VJK A;  4BZA A;  2WXJ A;  4MT5 A;  1L2N A;  4K81 A;  1EF1 A;  3WAM A;  4C7Z A;  1AWD A;  2LVP A;  1WJU A;  5HG2 A;  1SE9 A;  3ABV B;  3OAW A;  2D2Q A;  2J7Q B;  1IYF A;  1NYR A;  3PRZ A;  4RFB A;  1N61 A;  2M8S A;  4KX6 B;  1V6E A;  5D6J B;  1G6J A;  2GOW A;  4DDG D;  3H6N A;  4J3O D;  3ZQ4 A;  2JYE A;  1TS3 A;  1CJE A;  1XCT L;  5AZG A;  1H8C A;  1C1Y B;  3ZUN A;  3AB5 A;  2KD0 A;  2MHJ A;  4N9F 4;  4G0N B;  3RN9 C;  1VCB A;  2L05 A;  2WXG A;  3AH7 A;  1ACC A;  2HDE A;  3BY4 B;  4M0W A;  3NS8 A;  2JRH A;  4CYE A;  2FIF A;  4GMV A;  5AEK B;  1DOY A;  1HXY D;  4JWS C;  4ZHO A;  4K7S A;  1XF5 L;  3ZRC A;  1YQ3 B;  4F8C B;  3RT3 B;  2D11 A;  3EFC A;  3N1Z C;  3A9J B;  2WNM A;  3B2G A;  1JML A;  4EKU A;  2HJ1 A;  4EZJ A;  2N9K A;  2G1E A;  2DLB A;  2RPV A;  1TKE A;  1QOG A;  2K39 A;  1EM7 A;  2LHD A;  5CHV C;  2DWQ A;  4C56 C;  4CO7 A;  3I3T B;  3TEW A;  1T3Q A;  3DHG C;  3ZDT A;  1YQB A;  1T0S C;  2NBV B;  1RM6 C;  2BB5 A;  4NNJ B;  3EUB 2;  2MSE D;  1MPE A;  1LO5 D;  2LMC A;  3N20 C;  3N9Y C;  5HHD G;  3Q3J A;  4WWO A;  2JF5 A;  3I63 C;  2QSD A;  3KYD D;  3NHE B;  4P6V F;  1YJI A;  2QIE B;  3WCQ A;  1FD6 A;  2QEJ C;  1P7E A;  2J0K A;  2LAS A;  4MH0 E;  4P7I A;  4W9G A;  1OGW A;  1MHH E;  1Z5S B;  4BBN C;  4M00 A;  3SR6 A;  2KWC A;  1WM2 A;  2JWU A;  3Q8E A;  4GDK A;  4W9E A;  3AU4 A;  2K8H A;  4YL8 A;  3KUC B;  1FXA A;  1WGK A;  3U4E G;  2K8C A;  5EE0 A;  3AEB B;  4FA6 A;  2L83 A;  4ASW C;  2FUH B;  3AI5 A;  1GB1 A;  1WRD B;  3SU8 X;  2W3R A;  3DOW A;  4LNN A;  3HHM A;  3ZO5 B;  2BKR B;  4WJP A;  3TUO A;  1SIJ A;  3TEX A;  3A33 B;  3FIL A;  4EZL A;  3DPD A;  5FK9 C;  3GZN B;  2PMV A;  2INP E;  2JPH A;  2LGX A;  3ZNZ B;  3QWZ B;  1S1Q B;  2WXF A;  2E6X A;  3URY A;  2PJH A;  3R8B A;  3DWG C;  3IG3 A;  1B1Z A;  1J19 A;  3ML9 A;  1FXT B;  4FUL A;  1C9F A;  2KC1 A;  3BII D;  3P1M A;  4NY0 A;  5AZF A;  1BML C;  2NTS A;  3PGE A;  4NJ7 A;  4EFO A;  2WU2 B;  4P1C C;  3MTN B;  2G9H D;  1WSP A;  1FFV A;  3TJP A;  1WWT A;  3BZD B;  2WX0 A;  4ITK A;  3AEC B;  2CU1 A;  4PYZ A;  3ML8 A;  4W9L A;  4GN1 A;  4ARI A;  1R4M I;  3HVD A;  2BPS A;  4C80 A;  3Q8F A;  2NBU A;  1YN4 A;  4BBN F;  2JVC A;  3NRZ A;  3NVZ A;  3CIR B;  1R4N I;  1VZ7 A;  2DAF A;  2KAN A;  5J17 A;  3PPA A;  1TZ1 A;  4WJO A;  3K9P B;  1QZE A;  4IUM B;  3PHX B;  2UYZ B;  2RDB C;  1UWX A;  1E8X A;  1WZ3 A;  4FHK A;  3M95 A;  1HTQ A;  2WDV B;  4DWF A;  3RI7 C;  2J42 A;  3MC8 A;  2JYT A;  2WXN A;  3ZJU A;  2C7H A;  1T0Q C;  4OVU A;  1SF0 A;  1MVK A;  4YWG G;  3QIJ A;  4R3D A;  2K9X A;  3L13 A;  4CQN A;  2EKI A;  1ZUD 2;  3DCG A;  3RNB C;  3MFG A;  4GU2 A;  2Y5P A;  3MHZ A;  4WWN A;  3DVG X;  2GBN A;  3CMM B;  3ZYY X;  1UGJ A;  1HQR D;  1UUP A;  3PTF C;  3OJ3 A;  2JXX A;  4RF0 A;  3V6E B;  1SE4 A;  1C4C A;  2AWT A;  3ONS A;  2X8X X;  3DHI C;  1WJ4 A;  1WH3 A;  3B0A A;  3SEB A;  1E90 A;  3RNC C;  2A5U A;  4G11 A;  2OED A;  1YQ4 B;  1V5O A;  2PEA A;  3BK2 A;  2DYO A;  3V62 A;  1F1H A;  4GDK B;  3ZLZ A;  2LVO A;  2KQS A;  1L6V A;  3MC0 B;  4GDL A;  2EKE C;  3KW5 B;  4US8 A;  1L0X B;  5H8Y E;  2Z0E B;  1YX5 B;  2XEW A;  4BKS D;  4XE0 A;  3Q3N C;  1WXV A;  3NY5 A;  1PQS A;  3Q3O C;  2JZP A;  5MPO A;  1EUV B;  2DZM A;  5IO9 A;  2K5P A;  2O6V D;  2AL3 A;  2MEK A;  5H92 C;  3FIL B;  3B1L X;  3DBS A;  2IZV B;  2LGI A;  4RM9 A;  1TS5 A;  4HJG E;  1P3Q U;  2W3S A;  4ICV A;  4GIV A;  1L5P A;  2M1M A;  3RNF C;  2J53 A;  2KAC A;  1MFW A;  3M63 B;  2CU3 A;  4Q2J A;  4NAM A;  2KX0 A;  2ZW0 A;  3NG0 A;  4S0R A;  3SDL C;  4KVG B;  1WE6 A;  4HLE A;  3VH4 B;  1VZ6 A;  2KO3 A;  3NUH B;  2WLB A;  1C77 A;  1QT9 A;  4W9F A;  1SXT A;  1XEE A;  2BGF A;  2FCS A;  3VDZ A;  2NMQ A;  2WXK A;  4W9H A;  2G45 B;  1TY0 A;  2ASQ A;  1Q10 A;  1WJ6 A;  3JSV A;  4OZA A;  1KFY B;  2LZ6 A;  2ZVN A;  4LDT B;  2RR9 A;  1WXM A;  1YX6 B;  1SB3 C;  2KDM A;  3HIZ A;  3OWE B;  1OQR A;  3BVG A;  2C5L C;  4FXC A;  2KWU B;  3VUX A;  1WR6 E;  1FNU A;  3NJT A;  2I1K A;  4HRS A;  2J4X A;  2WP9 B;  4AJY B;  4REZ A;  4H2A A;  2KDB A;  5IOI A;  1SSN A;  1K50 A;  4XGA B;  2IDY A;  4MGZ E;  1ZXH A;  3WAP A;  5CX3 A;  1DYQ A;  2JZ3 B;  4NJ6 A;  1A70 A;  4HPP A;  3BVZ A;  1STE A;  2KT7 A;  1E7P B;  3K9O B;  1BUI C;  1QOF A;  4KSL C;  1WGD A;  3ZGZ A;  4A6Q A;  1JWS D;  3IFW B;  3IT6 B;  3HM6 X;  2KN5 A;  3WIM A;  4PS8 A;  4YTP B;  3B9J A;  1NI2 A;  1I4P A;  1OTR B;  1T0R C;  2INN E;  5KHQ A;  2VZK D;  4OHJ A;  1JQ4 A;  1K8R B;  4NPN A;  1RRB A;  1R4M B;  2C7N B;  2LUM A;  2KMC A;  4A3O A;  3UQB A;  1OQY A;  4WJN A;  3R7Q A;  3FC4 A;  1R4N B;  4RF1 A;  1E7U A;  3T9L A;  2MLB A;  2KMA A;  2W54 A;  3ECI A;  3W1Y A;  1CMX B;  3AE8 B;  1UWM A;  2ZPY A;  1FNW A;  2MJE A;  4GLS C;  4A20 A;  2MBH A;  5TR5 A;  2CR5 A;  4ARC A;  1XLP A;  1ZE3 D;  5C3J B;  1DOI A;  3OG5 A;  3HVZ A;  2BW2 A;  3DHH C;  1IUE A;  3H7S A;  3PLU A;  2WXL A;  4DHZ E;  1VZ8 A;  4ZRP A;  1P7F A;  1L6U A;  2AQ3 B;  1IP9 A;  4ANX A;  4S17 A;  2J52 A;  3IAS 1;  1S3S G;  4ANU A;  5EE3 A;  1N5X A;  1C79 A;  4XDD A;  3PHW B;  2QMT A;  1NDD A;  1HA5 A;  1B9R A;  3EC8 A;  4XWT A;  3ZTC A;  1A5R A;  4YT0 B;  4C00 A;  4HWI B;  3U8Z A;  4WQO B;  4DXG A;  3UIN B;  3SHQ A;  4W9C A;  4LK0 M;  4LNI A;  2KTR A;  4ZHP A;  3X23 A;  3ZJV A;  1X1M A;  3RMK C;  1V81 A;  2XN9 C;  4RH6 A;  3R66 C;  2DYB A;  1D3Z A;  2WYQ A;  3APF A;  2OOB B;  2D10 A;  2DAJ A;  1PGX A;  2N9E B;  5EE9 A;  2HJ8 A;  2KFK A;  1WX7 A;  2KZR A;  3RFZ B;  3UI3 A;  2JWZ A;  3NZS A;  3LB8 C;  1I35 A;  2YLM A;  2DZK A;  3WAO A;  2ZVO A;  2XK5 A;  1WM3 A;  3MC9 A;  4N59 A;  1KLG D;  3IAM 1;  3VAW A;  4FJY A;  1GAQ B;  3NVV A;  5D7G A;  1WY8 A;  2PPH A;  2MP2 A;  3JSV B;  5C2T B;  4B6W A;  4N6E B;  2WXH A;  4L23 A;  2ONQ A;  2BYT A;  3ZVV A;  2D3G A;  1HTO A;  3IXS A;  1TS2 A;  1E8W A;  3T8M A;  1FNV A;  4YSX B;  1GC6 A;  4W9K A;  2N1W A;  1UGM A;  1WF9 A;  2INC C;  4XYC A;  2ZEQ A;  2R61 A;  2LEK A;  1ROE A;  1YNT E;  2K3U A;  3W5U B;  3QQ8 B;  4KKJ A;  1RAX A;  1WFY A;  5L83 A;  1GJZ A;  2Y5C A;  2B76 B;  3ZIM A;  2DX5 B;  1V5T A;  4JQW C;  1FO4 A;  3VTW A;  5G5G A;  2LVQ A;  4GGQ A;  4HXD A;  1NEN B;  4GSW A;  1XT9 B;  1J7A A;  2Y3A A;  3VUY A;  1WI0 A;  3UF8 A;  2V1Y A;  2ZCB A;  4PK1 A;  2KK8 A;  2G4S A;  3ZXV A;  2FCM A;  2MX2 A;  2I2Y A;  2KTF A;  5TSS A;  1FM0 D;  2L1A A;  3RCZ A;  4HKZ E;  3UQA A;  2SAK A;  1C4A A;  2FBW B;  4OZC A;  1SBB B;  4BOS C;  1PGB A;  2O6V A;  2KX3 A;  4DDI D;  1C76 A;  5AZH A;  1FFU A;  4EOY A;  3ALB A;  2CS4 A;  1WGG A;  2D5G A;  5BMI A;  5IA7 A;  3R2I A;  5D3D A;  4A8X C;  3AE5 B;  2MRP A;  2JU6 X;  3L0W B;  3Q3M C;  3PS6 A;  1ZOY B;  1J8C A;  5J2R A;  2N7J A;  3R3M A;  5AUK A;  2BYF A;  3L08 A;  2RPQ A;  5G55 A;  3W1S C;  2QC8 A;  2CHZ A;  3Q2A C;  2DZI A;  3WAN A;  4A90 A;  3AEF B;  1R7S A;  2M56 B;  3ZJT A;  1AN8 A;  4WUR A;  1NYQ A;  2KKC A;  1C4P A;  1RFA A;  2QIL A;  2GRI A;  2A4Z A;  1LXD A;  2LWP A;  2UU7 A;  1GPX A;  1EO6 A;  4BKT A;  2KDI A;  4DHJ B;  1PDX A;  4HVB A;  2KTR B;  3LXF A;  1XLQ A;  5LXI B;  3VRA B;  1YD8 U;  3U7D A;  1QF6 A;  1AAR A;  2H88 B;  1ZXI A;  3ZTD A;  4RGO S;  4IG7 B;  2V3N A;  1WIA A;  2MJ3 A;  1JRO A;  1V2Y A;  4YSZ B;  2KFK B;  4TQ0 A;  3LYY A;  2MCN B;  4D2K A;  4JWU C;  3R7R A;  4EZK A;  1M94 A;  2K1F A;  2L00 B;  2M19 A;  5E6J A;  2XK5 B;  3A4S C;  2I38 A;  5IN7 A;  2BBC A;  3H9D A;  3RD2 A;  2JX5 A;  4TQ1 A;  3WA0 A;  2WXP A;  2MP2 B;  1QQR A;  3C19 A;  3I5J C;  2KQ4 X;  3A9K A;  1WX9 A;  4I6N B;  1I4H A;  2KJR A;  1F0Z A;  3DBH I;  2NS5 A;  1WR1 A;  4NQL B;  1CK1 A;  5HFY A;  1P1A A;  4KIK A;  2KDF B;  3W9C B;  1AW7 A;  2AL6 A;  4WWM A;  3RUL A;  1BT0 A;  1FMA D;  1EU3 A;  1CZP A;  4XZ4 A;  2J0J A;  4OVZ A;  5HKH A;  3H1U A;  3PRE A;  4LNK A;  4MAC A;  1ENF A;  4USA A;  3D32 A;  3P4Q B;  2ACZ B;  2K25 A;  2GBJ A;  1DOX A;  2WU5 B;  3E9S A;  2TSS A;  2MH7 A;  4BFR A;  4M0W B;  2WX1 A;  3AXC A;  4FAD A;  4KKI A;  1MG4 A;  4J6I A;  3ZNH B;  1HZ6 A;  3MHS D;  4EEW A;  2FID A;  1SGH A;  2K6D B;  3DVN U;  3N30 A;  3JW0 X;  4WWP A;  5IP4 D;  3AMZ A;  3AE9 B;  3QCA A;  3TIX A;  4XDC A;  2C60 A;  4MJS A;  4ANW A;  4ZRQ A;  2NPT A;  4GB9 A;  1KF6 B;  5C23 A;  1KTK A;  2WXQ A;  2WS3 B;  1D5M C;  4M02 A;  1P0R A;  3ETR A;  1L4D B;  2L3Z A;  2FCN A;  3OJ4 B;  2KVZ A;  5DCN A;  4MDK E;  2O6V B;  2BS4 B;  2BKF A;  4HKQ A;  1FRD A;  4G50 A;  1KM7 A;  1P9D U;  2QJL A;  1ESF A;  1UBI A;  1MI0 A;  2MBQ A;  3ZNG C;  4M8M A;  4PS3 A;  2PLP A;  1E7V A;  3L4P A;  1TJE A;  4JX1 C;  2KDE B;  3BYT B;  1E8Y A;  2GI9 A;  4DK5 A;  1OQQ A;  4XWW A;  2BYV E;  3KWL A;  3E56 A;  2KC2 A;  3RPF C;  4MEM A;  1KLU D;  1YN3 A;  2G3Q B;  2MBO A;  4F7Z A;  2LI5 A;  1YIW A;  5DPT A;  4B0M A;  2IND C;  2L0T A;  1P98 A;  1WMH A;  3CST A;  2IY1 B;  4DBG A;  4AS1 A;  4JIO U;  3ZW3 A;  3UGB B;  1J0G A;  2HD5 B;  2SEB D;  1MHX A;  1E0Z A;  5DPS A;  2EMT A;  1XD3 B;  2X38 A;  1T6B X;  1ET9 A;  2L76 A;  4LCD E;  2BF8 B;  2YVC A;  4W9D A;  4E71 A;  3IVF A;  4LTU A;  3AEA B;  3QA8 A;  2N9X A;  4WAA A;  4KDL B;  2QCZ A;  3A9K B;  4HDO A;  2AQ2 B;  2KJH B;  4US9 A;  2N9P C;  1SE3 A;  2VH1 A;  3EFU A;  4HDQ A;  3Q3F A;  2RMM A;  4N58 A;  3EEC A;  1Y8R C;  4ZRK A;  3S2A A;  1JW9 D;  3FKY A;  2ZNV C;  4KIK B;  1N60 A;  2OJW A;  2OHF A;  3DBR I;  4FLH A;  1ZDV A;  2AX5 A;  1RLF A;  2W9N A;  1E10 A;  5L95 C;  3KUD B;  4BOZ B;  4RGT A;  3VH3 B;  2IO1 B;  2ZCC A;  1ZPS A;  3AEE B;  2M17 A;  3APD A;  4IOI E;  2LRU A;  2KN4 A;  4NAW A;  3EGR A;  2KQ7 A;  2V9H A;  1L7Y A;  1WGH A;  3AU5 A;  2IO3 B;  2DBY A;  3GE3 C;  3P2B A;  2KVR A;  4MJS B;  4KDI C;  4P1B C;  4BAX A;  2NPT B;  4WAF A;  5DPR A;  3VTU A;  3DBH B;  5JHA A;  2DHZ A;  3RUI B;  3V05 A;  3NZU A;  3P4R B;  1V80 A;  3AE3 B;  1E8Z A;  5JH5 C;  2PE6 B;  1FIQ A;  2EMS A;  2FCQ A;  1GUA B;  1V86 A;  3AE7 B;  4YSY B;  3AE2 B;  1UBQ A;  1WX8 A;  3M3J A;  2KNB A;  4MM3 A;  2FUG 1;  2Z0D B;  1L0V B;  2WXO A;  1KRH A;  4K3B A;  4FJV B;  1LM8 B;  4NQK E;  2BS2 B;  1SJE D;  1E5W A;  4LDT D;  1V1P A;  1YJ1 A;  2N7E A;  3DWM A;  3W1S A;  1ZDX A;  4IWP A;  2NR2 A;  4XC2 A;  1EWY C;  3TL5 A;  1D4B A;  1JWM D;  4GDL B;  2CHW A;  3C0R B;  2ICI A;  3VUW A;  2LRW A;  5GMV A;  1WMH B;  4IM3 A;  2V0G A;  3B2F A;  5LXH A;  5FKA C;  4LJP B;  4DQO C;  3MP9 A;  4JE3 B;  3A4R A;  3KWV A;  1IGD A;  3CSF A;  2WWZ A;  1GNU A;  3N1X C;  1Q5W B;  1Q0W B;  1VDV A;  3KVF B;  4KZ0 A;  1V97 A;  1LQB A;  4NJC A;  3C8Y A;  3U52 E;  4M8N A;  1D6E C;  2KWD A;  3IHP C;  5BMH A;  3BIN A;  3APC A;  4HCP B;  2M4N A;  4RM8 A;  2G4D B;  4KV2 A;  3PVL A;  4LJO B;  2KMM A;  1F77 A;  3ZXR A;  1TGZ B;  2N1V A;  4IDI A;  1K53 A;  2WDR B;  1I4G A;  3RZF A;  4KZC A;  4EUT A;  3PZ8 A;  4KSK C;  2XNA C;  4F1S A;  2OJR A;  3BWU D;  2M0A A;  4L1B A;  3SD5 A;  3AV8 A;  1N63 A;  1QKZ A;  1UF0 A;  5BMG A;  5DPW A;  1FCC C;  3PT2 B;  2LJ5 A;  1WXQ A;  4OW0 A;  5E6N A;  4A55 A;  1F2R I;  4MGK E;  3PRP B;  4WQM A;  1NBF C;  2IGD A;  3DVN V;  1RYJ A;  4E74 A;  1WXS A;  2IYD B;  1MJD A;  2IPK D;  4CHK A;  2CJN A;  4EE2 A;  3DDC B;  2C9W B;  3Q69 A;  4JPS A;  4NAW B;  4B95 A;  4L2Y A;  2KHW B;  4TMA B;  2M0X A;  3CWI A;  3QJZ A;  1EU4 A;  3V3X A;  4MSQ B;  1WGY A;  3RNE C;  1JAL A;  2KWV B;  1JRU A;  2IGH A;  2QHO A;  2BQQ A;  2WQY B;  4C4V A;  2YEP B;  5CTR C;  3TCA A;  1WYG A;  2ZJD A;  3L17 A;  4E3C A;  1VR9 A;  4K3C A;  5JHB A;  2KOX A;  4RGM A;  3ZDM C;  2FAZ A;  3PSE B;  4FJZ A;  5CHF A;  3PV1 A;  1DGJ A;  2WDT B;  2Z59 B;  4FBJ B;  3AE6 B;  5E6O A;  1D5X C;  4M01 A;  2N7D A;  4AOF A;  1XXG A;  3IT4 B;  2KFJ A;  4LNO A;  3DBR B;  3U2S C;  1AYF A;  1QLB B;  4HPM B;  1TKG A;  1RWS A;  2MJD A;  2D07 B;  1ET6 A;  4GOC A;  3DBL B;  4MM3 B;  3NOB A;  5E6P A;  4O1N A;  4MEL A;  4BKS A;  4I6L B;  1HEZ E;  3GP7 A;  4FN2 A;  2BWF A;  2CJO A;  2MQJ A;  4FHJ A;  3BVM A;  1WE7 A;  2QDF A;  1PFD A;  1UH6 A;  2JRI B;  1V1P B;  2JQR B;  3J9C A;  5FR6 A;  4ACF A;  1VLB A;  2J0M A;  3A1Q A;  3H7P A;  2PVG C;  1PUT A;  1SIF A;  4AUQ C;  2L8J A;  2FE8 A;  4A9A A;  2V3S A;  4RGN A;  2BWE S;  1GC7 A;  3ZNI D;  5T8I A;  1E6E B;  4ZRI A;  3V60 A;  2MBE A;  1I4Q A;  2K8B A;  5KHO A;  4IWO A;  4PS7 A;  2LGY A;  2IGG A;  4K1R B;  1QOB A;  1XQQ A;  1ZGU B;  1T0Y A;  1WGR A;  1KH0 A;  2D3C A;  2GMI C;  1M4V A;  3CF6 E;  2HTM E;  1H4R A;  4HPL B;  3RYT A;  4II3 B;  4AQ7 A;  3AM9 A;  2YEP F;  4C7Y A;  2ON8 A;  1OEY J;  3NZ3 A;  2ZZP B;  3AE1 B;  3QC8 B;  5BYQ A;  4JLC A;  3KQ4 A;  3P63 A;  2GLS A;  1YN5 A;  2CHX A;  2N0S B;  1FXI A;  1TYG B;  1FPY A;  4LNF A;  1N62 A;  4WIP A;  4QAY A;  1F52 A;  1LFD A;  1TS4 A;  2IBI B;  2LD9 A;  3VRB B;  2DZJ A;  3HM3 A;  4BKG A;  3VFK A;  1QIL A;  5AUI A;  1TBE A;  2R2Q A;  4URK A;  1WYW B;  3L54 A;  2GBM A;  2LJI A;  1Y56 A;  4G3X B;  1ZP0 B;  2VH2 A;  1GB4 A;  4AJW A;  2JSV X;  4C4V B;  3MJW A;  5G5H A;  1L0Y B;  3NVW A;  1IPG A;  1J7C A;  1N6Z A;  1N5W A;  2PW9 A;  3EHV A;  2KLG A;  5EE1 A;  4B9K A;  1XLN A;  2KAJ A;  2K22 A;  4DHJ D;  3GE8 C;  3QX1 A;  4A3P A;  4I6P A;  3BK1 A;  5C1Z A;  5HI1 A;  4RNA A; 
#chains in the Genus database with same CATH homology
 3RNB C;  3RMK C;  3RNG C;  2IND C;  3DHI C;  3N20 C;  3Q3N C;  3GE3 C;  2INC C;  3RNC C;  3N1X C;  3I63 C;  3Q3O C;  3Q3M C;  3RI7 C;  4P1B C;  3RNF C;  3N1Y C;  3RNE C;  4P1C C;  3DHH C;  1T0Q C;  3RNA C;  3DHG C;  3N1Z C;  3Q2A C;  3GE8 C;  3RN9 C;  3Q14 C;  1T0S C;  1T0R C;  2RDB C;  3I5J C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...