4P1CC

Crystal structure of the toluene 4-monooxygenase hydroxylase-ferredoxin c7s, c84a, c85a variant electron-transfer complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
82
structure length
82
Chain Sequence
SAFPVHAAFEKDFLVQLVVVDLNDSMDQVAEKVAYHCVNRRVAPREGVMRVRKHRSTELFPRDMTIAESGLNPTEVIDVVFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toluene-4-monooxygenase system protein A
publication title Structural basis for biomolecular recognition in overlapping binding sites in a diiron enzyme system.
pubmed doi rcsb
source organism Pseudomonas mendocina
molecule tags Oxidoreductase
total genus 25
structure length 82
sequence length 82
chains with identical sequence F
ec nomenclature ec 1.14.13.236: Toluene 4-monooxygenase.
pdb deposition date 2014-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 4p1cC00
3RNCC 3RNBC 3DHIC 4P1CC 3RN9C 3DHGC 3Q3NC 3DHHC 3GE8C 2RDBC 2INDC 3RMKC 3N1ZC 1T0SC 3Q14C 3GE3C 3RNEC 1T0RC 3N20C 1T0QC 3N1YC 3N1XC 3Q2AC 3Q3OC 3I63C 2INCC 3RI7C 3RNAC 3RNFC 3RNGC 3I5JC 4P1BC 3Q3MC
chains in the Genus database with same CATH superfamily
1UGJA 4PYUA 1HTOA 1J0GA 1KJTA 3P4PB 5HFYA 3MFGA 4ZHOA 2KOXA 2YEPB 2O6VA 2JU6X 1IBXA 5LXIB 1WSPA 3VUXA 4ICVA 4KZCA 2W82A 3V62A 4MGYE 3AB5A 4W9HA 3VRAB 1WI0A 3QARA 1FXTB 4G11A 4PK1A 4XX5A 1UUPA 3BVMA 4LJPB 1EU3A 1YN5A 2KWVB 3NRZA 2V4IB 4XE0A 2IDYA 1MG8A 4NY0A 1AN8A 4CHKA 4AQ7A 4KKJA 5FK9C 4MT5A 2RDHA 1DYQA 4WQOB 1VJKA 3FC4A 4Q2JA 4URKA 5KHQA 3ENEA 4FXCA 4K1RB 3DOWA 3NS1A 4EZJA 4B0EA 1NEKB 1P3QU 1B9RA 2V4LA 1A70A 3ZNGC 2K8BA 2J0KA 2LRUA 4TKNA 3W1YA 5EE1A 3RNFC 1UBIA 4DHJB 1FRRA 4IW0A 3W5VB 5LXHA 1WM2A 4GIVA 3BVGA 3P4RB 4W9JA 2V3PA 5H92C 3VFKA 2N9KA 2GBJA 3V05A 3PVLA 3SFDB 1HXYD 2DLBA 3IG3A 1XCTL 4WWPA 3RD2A 4OW0A 3FILA 4EZLA 1IUEA 3VH4B 1UELA 3KYCD 2C7NB 4S17A 1VZ7A 4NJ7A 2J0MA 5J18A 1E90A 2L00B 1QQRA 3PHXB 5D3DA 5D6JB 1NDDA 1XT9B 5CHWA 2L0FA 2D3BA 2D3GA 1T3QA 4MM3B 2C60A 3ZJUA 4YSZB 2PLPA 5EE0A 2LHEA 1TKYA 2LHDA 2MWSB 2L52A 1YIWA 2L7RA 2WXIA 2KJHB 3AEAB 1L6VA 3DWMA 4GDKB 1VCBA 3MP9A 1AYFA 5BMGA 4HROA 3ML8A 1ISNA 1ROEA 1L5PA 2WU5B 4EEWA 3PZ8A 2VH1A 2WYQA 4WJOA 4HJKA 5DPRA 4AP4C 2QMTA 2IGDA 1SE4A 2CHZA 3IAM1 1M94A 1L2NA 1ZXIA 1KFYB 2IGGA 5T8IA 2DZJA 4FN2A 4KSLC 3TEWA 3GOEA 2KC1A 4RGNA 3NS8A 2WDTB 4HPLB 2K1FA 3A9KA 2KC2A 2ZVNA 3DBRB 3B08A 2MP2B 2XNAC 1HEZE 4IM3A 1FEHA 3TJPA 1SE9A 1J7AA 3AE1B 5EDSA 1UZXB 3AEFB 4ZRJA 2KYWA 3A4RA 3ZDTA 1YMHE 4KDLB 3JW0X 2LFIA 4TMAB 1LM8B 4BKGA 4AWJA 1UBQA 2BWES 1C4PA 2AWTA 3KYDD 2WXRA 2CHWA 2REXA 3BINA 1WF9A 3N20C 1T0QC 3AV8A 3HVZA 3W1SC 1EM7A 5H8YE 3DBHB 3RZFA 2ZZPB 1RFKA 1SIFA 2DZIA 2ZCBA 1SJHD 1BT0A 3DHHC 4MH0E 1F0ZA 2MX2A 1P7EA 3CMMB 4ANUA 2DZMA 3MJWA 3AI5A 5BYRA 3GZNB 1YJIA 1L7YA 4ARCA 2HJ8A 2DZKA 4IDIA 3RFZB 4TUUA 3DVNV 4W9IA 4KX6B 3VDZA 1QOAA 2C7HA 2L32A 1E6EB 1N5XA 3AE8B 2KJRA 1V1PA 1JRUA 2WU2B 2NMQA 2OOBB 1KH0A 1ZDXA 4YWGG 2WLBA 3BWUD 3E56A 4HLEA 1P98A 2N1VA 3QHTA 2JZ3B 2MBOA 4ZDVA 2K0PA 5CTRC 1MFWA 1KF6B 2MW5A 3P4SB 2PE9A 1N5WA 3UGBB 1E8XA 3TBLD 2O6VB 2QC8A 1IBXB 4B6WA 1FMAD 1FD6A 2KTFA 4KVGB 2FAZA 1GAQB 4W9KA 2KMMA 1TJEA 3ONSA 3Q3MC 2KMAA 5AZHA 3DHIC 1WE6A 2N9LA 3NJTA 4PS8A 4FJVB 1FXAA 1TS5A 1RM6C 1V8CA 1MG4A 2MBQA 4C56C 2OEDA 1TKGA 2BS4B 4CQNA 1GJZA 5G55A 1D5MC 4MELA 3DQVA 2PMVA 1LFDA 2YLMA 3QX1A 3X0WA 1GB1A 3H8HA 3ZO5B 2DYBA 4WJNA 1TS2A 4JQWC 5G2NA 1WX9A 1UD7A 2JPHA 2MJ3A 2QSDA 1H8CA 3LJ3A 4AJYB 2IZVB 3Q8EA 2KFKA 4IC7B 5CHVC 3AMZA 2BBCA 2LI5A 4FJYA 5I4DA 2LEKA 4XDCA 2M8SA 4KZ0A 1WY8A 3LDZE 3N1ZC 2EELA 2MA9B 3K9PB 1QOBA 1YJJA 3PREA 4IG7B 2LWPA 3TUOA 4ACFA 3GB1A 1E7PB 5BYSA 2PW9A 2X8XX 3IT6B 2JX5A 2PJHA 3OJ4B 2WXMA 4B9KA 4DXFA 2EKIA 1T0YA 2N4FA 4ZRKA 2WXFA 4A20A 4BOSC 2FCMA 1WR1A 4MACA 1YOVB 5IO9A 2UYZB 2KWUB 2Z59B 1Z5SB 4DK5A 2JZZA 3WAPA 3KLSX 3EFUA 1FXIA 3T9LA 2QEJC 4MGZE 4WAFA 3ZGZA 3U7DA 5IN7A 1WXVA 1ZDVA 3AE5B 2ZCCA 2INPE 2KJ6A 1N62A 2WGSA 1MPEA 2V1YA 2KHWB 2O2VA 3KH0A 2LASA 2OHFA 3DBLI 3DVGY 2FNJB 2JYTA 4BVUC 1CK1A 1C77A 2KDFB 2KVRA 4A3OA 4J3OD 1YJ1A 2INDC 1L0VB 5JXVA 2WHIA 3CIRB 5J2RA 1V97A 1J7CA 2ZW0A 1EO6A 3NVYA 1F9JA 3TEZA 2FIDA 2C5LC 1FNWA 1ZOYB 4ZOHC 1L0YB 2YVCA 3O65B 1OTRB 4DXGA 3QCAA 3Q8CA 2D5GA 3QIJA 3RNCC 5C1ZA 3L0WB 3ZTCA 2GMIC 2XK5A 1TS4A 3SFEB 1T0RC 2RDGA 4GN1A 4WH4A 3SDLC 3WCQA 1WJUA 4W9DA 2JSVX 4PS7A 1V5TA 1WJ6A 1M4VA 3AU5A 2I2YA 2MHJA 5TR5A 1ACCA 2BT6A 2LMCA 3AULA 1MHXA 3NY5A 3BVZA 1J8CA 3EC8A 1V81A 3K9OB 3L10B 2PTLA 3ZJTA 3Q69A 2BKFA 4BBNC 1WGGA 3TSSA 2RSUA 4M00A 2KLCA 5KHOA 3VTVA 1GC6A 2NCNA 4I6LB 2GOWA 2W9NA 4M02A 4R3DA 3KUZA 1P0RA 5C23A 4ZYNA 5DCNA 2KXJA 1V2YA 2L8JA 2KQSA 3Q3OC 3ALBA 2KZRA 2LGSA 3U2SC 3ZDMC 5AZGA 2W3SA 3L13A 4LDTD 1E8YA 1KLVA 1UWMA 3PRPB 2ZPYA 4E3CA 1V1PB 3HHMA 3NZ3A 2ZVOA 3MJ5A 4XGAB 5IP4D 3TCAA 1FCLA 1XLQA 3I9V1 1FRDA 2DYMA 2LD9A 4TSSA 1CZPA 2WNMA 4KIKA 2MH7A 4OVUA 4JWUC 3SHQA 1U4AA 4PS3A 4K3CA 4YXDB 1IGDA 1JRPA 1LO5D 1TBEA 5DPWA 2LVOA 1FNVA 3MC9A 2HTHA 4US9A 2AL6A 1TTNA 1EF5A 4A55A 3Q14C 4EZKA 4LNKA 2W3RA 2L1AA 1PGBA 1I4QA 4AUQC 1ZE3D 1I4HA 1EU4A 5D2MB 1E0ZA 1XF5L 1CJEA 2EMTA 5L83A 2M0XA 2UWQA 4NQLB 5JZEB 2NR2A 3W2DA 2KACA 2MJDA 5GMVA 4G50A 4XWTA 1FIQA 4N58A 1JALA 3MC0B 1L0XB 3T3NA 1QOFA 1N6ZA 2KDIA 3RUIB 2D10A 2N9PC 3BK1A 1WE7A 1RYJA 4W9EA 1T0SC 2HTME 4PT5A 3NZSA 4DHZE 3Q3JA 4LLGM 3PGEA 2LUMA 3Q2AC 1H4RA 1C3TA 3SEBA 1NYQA 4RGOS 2KFKB 3B0AA 2KK8A 3P42A 1JROA 2ZJDA 2D07B 1RAXA 4EFOA 1OQYA 4RM9A 4KKIA 1JMLA 2K6QA 1P7FA 5MPOA 3R2IA 1YQ3B 1FCCC 2BVCA 4A6QA 2IPKD 1Z2MA 3H6NA 3R7QA 2WDRB 2JQRB 1WFYA 2A5UA 2JZPA 4O1NA 3DBSA 3DPDA 2WXQA 4HRSA 1OEYA 2W55A 3AXCA 3NVWA 2RD0A 2KLGA 1N61A 1JWUD 1JWAD 2H89B 4NAMA 2Q5WD 2G4DB 1GC7A 3RNBC 2J52A 3RYTA 5EE9A 2WQYB 3AECB 5CHFA 1D4BA 3LB8C 2BQQA 1K51A 2N9XA 2ZNVB 1YX6B 3H7SA 3LXFA 4FJZA 3T3OA 4JGHB 4M8MA 1NBFC 1K8RB 1WRDB 2J7QB 4KV2A 3N1YC 3UIOB 3H1UA 4XZ4A 2O2VB 4JWSC 1PGXA 1HZ6A 4GMVA 1V86A 3HRDD 2G3QB 2X38A 3C8YA 1FNUA 3OLMD 1YN4A 3VR9B 2ICIA 5GXGB 1TYGB 2K39A 1C4CA 2KQ7A 1DOXA 1GUAB 3DDCB 2WDQB 1VLBA 1Q10A 3SR6A 3RNEC 1D6EC 2J4XA 4YTMB 1KM7A 3W5UB 3ZQ4A 2BB6A 1N63A 1VZ6A 3R8BA 2KX0A 5G5GA 1ET9A 5DPTA 2QCZA 4F7ZA 3EGRA 4DHZB 4XDDA 3MHSD 2KFJA 1C79A 2XK5B 1BXTA 3TEXA 3W1SA 1WJ4A 3R3MA 1E8ZA 4K7WA 2KAJA 4FHKA 1TT5B 3NZUA 1C9FA 3FAHA 2IBIB 5L95C 5AUKA 3A1QA 2FIFA 1SGHA 2JRIB 2WXGA 3T8MA 3CWIA 2PVOD 2QDFA 1F52A 1GG3A 1HTQA 1R4MB 2AQ2B 2WXNA 1C78A 5LNK1 3A4SC 5FR6A 4YSXB 2MBHA 4NZLB 3L4PA 1UNSA 4KDIC 2XBBC 3IHPC 3SU8X 4C7ZA 1ENFA 2N7DA 1NENB 2B3AA 2XEWA 1SBBB 4IKGA 5JHBA 4TQ0A 4M8NA 2KTRA 3Q3NC 2FUHB 3WAMA 1EF1A 3URYA 3ZUNA 3JYUA 2IGHA 3VQIA 5FR3A 1JQ4A 3GS2A 1OQQA 1S1QB 4IOIE 3C0RB 2Z8LA 2KDEB 1F77A 3U52E 1ZKHA 2KN4A 1F1HA 1TGZB 2CU1A 4N6EB 3AEGB 2IO3B 4JE3B 2EKEC 2M56B 4F1SA 2KN5A 3AEDB 1WXMA 1C4AA 4HDQA 2JWZA 4X57B 1R4NI 1E7UA 2B76B 1YQ4B 3B1LX 4NQKE 1JWMD 3CSTA 1WX8A 2BYEA 4RF1A 2HDEA 2QJLA 5CX3A 3DVNU 3L17A 1WH3A 4KIKB 3VVWB 2IJ0A 1SE3A 1WGYA 2DBYA 2LUEA 3I3TB 4HWIB 4WURA 3AE3B 2ZEQA 2ON8A 4W9FA 2IO1B 4MSMB 5DPSA 1D5XC 3QQ8B 1NI3A 3ML9A 3KQ4A 3A9JA 3PZDA 4OHJA 4RGTA 2I1JA 4BBNF 1TZ1A 4WWOA 5HG2A 1IGCA 1WZ0A 1I4GA 3ZJVA 4YTNB 1QOGA 2MSED 2C9WB 1RRBA 1I4RA 2KO3A 5LLIA 2V3NA 4ARIA 1E5WA 3OAWA 3VTWA 2Z0EB 1HE8A 4C80A 2GRIA 2TSSA 3Q8BA 3AE4B 2J0JA 2WXPA 1LQBA 2V3SA 4K7SA 1WYGA 4GDLA 3WA0A 1WR6E 2ONQA 3JSVA 4HEA1 1WMHA 1SJED 2JVCA 4RNAA 4JL9A 1RWSA 1V80A 1P9DU 3APFA 3DVGX 4ZHPA 1AARA 3BZDB 5EE3A 1PGAA 3ZXVA 3FILB 3TL5A 4N59A 5J17A 1AW7A 4TV3A 2KD0A 2I1KA 4D2KA 3ZXRA 1C1YB 3NUHB 4HCNB 4LCDE 2NBWB 3M62B 4YSYB 1R7SA 4HCPB 4MM3A 2K3UA 1K50A 3EUB2 3L16A 2GBNA 4RFBA 2KNBA 1Q1OA 1OQRA 2KWDA 1XLNA 4EKUA 3PRMB 1VZ8A 4E74A 4USAA 1I7HA 2LGXA 4OZBA 1KLUD 4WJPA 3GE3C 1E8WA 5HHDG 2L83A 2Y3AA 2DYOA 4LJOB 4B0MA 4IM0A 3NVZA 2LJIA 3VUWA 2WX1A 2CR5A 3D32A 3LYYA 1XXGA 2RPQA 2MRPA 2CJNA 4ZYSA 1MJDA 2J53A 2AEHA 4HPMB 1L4ZB 3KVFB 1OGWA 4CYEA 1V49A 1B1ZA 3WIMA 1KRHA 4F8CB 4A3PA 1WRIA 2JUOA 4LNFA 1WM3A 4LNNA 3WAOA 5E6OA 2AX5A 4M0WA 2K9XA 3R66C 2WS3B 2DWQA 1OEYJ 2WXJA 3A9KB 2MP2A 2JT4B 4II3B 4DDID 2BF8B 5IAAC 4I6PA 2KDMA 3C19A 4L23A 1BMLC 4WQMA 1OFFA 2BYTA 1XEEA 2IY0B 5JHAA 3R7RA 1UWXA 4JIOU 5C2TB 4REZA 3CSFA 2KDBA 4BAXA 1PQSA 3DBRI 3AE2B 3KUDB 3FKYA 3J9CA 4C7YA 3AE9B 3HVDA 2Z0DB 1WWTA 3MHZA 4WWMA 3RCZA 4BKSD 4EUTA 3M3JA 2FBWB 4B95A 2PPHA 5AZFA 3A1QB 2BGFA 4XC2A 4WWNA 2M4NA 2SAKA 2G45B 2GBKA 3R2TA 1SSNA 4BZAA 3DBHI 5HI1A 3U4EG 3H9DA 2PVGC 2KANA 2IY1B 2HJ1A 3M95A 3DWGC 4P1BC 2Y5BB 4DWFA 1J7BA 3IBEA 4MH8A 3PV1A 4BOZB 1WYWB 4W9CA 2LJ5A 4RF0A 2VZKD 2BWFA 3GZNI 3KUCB 3SD5A 3VAWA 3N1XC 1I42A 1XQQA 3IAS1 2ACZB 1WX7A 2GI9A 2MCNB 4XYCA 4KGRA 3UQBA 1WXSA 2V9HA 4RM8A 1EUVB 4HJGE 1PDXA 3OG5A 4DBGA 2JWUA 4MJSA 4NAWA 2FCQA 2NBUA 2AYOB 2VH2A 2BTEA 2J42A 2UU7A 3QAQA 3TEYA 1GOZA 3WALA 2FCSA 4RH6A 3P63A 2FUG1 4CO7A 2LGDA 1Q5WB 2BPSA 1L4DB 4H2AA 3APCA 3VTUA 1ESFA 3KWLA 2K22A 4DXAB 3AE6B 2DENB 2DX5B 3ZNZB 3QC8B 1ZP0B 2HE7A 2MBBB 3A9JB 4II2B 3ZW3A 3B2FA 2RGFA 4BKSA 1PYWD 2GB1A 2PIAA 5BYQA 4FHJA 2ZW1A 4ANWA 4BKTA 4EOYA 4IM2A 1RFAA 2NPTA 4EE2A 4NJ6A 3W9CB 3VR8B 4JPSA 1XLOA 1ZPSA 3AEBB 1VR9A 5IOIA 3U8ZA 4ZRPA 2PKOA 3NVVA 2N7JA 4OVZA 3ABVB 3VUYA 3ZTDA 4GDLB 3TMPB 1ET6A 1T5XD 1E10A 1UH6A 4TQ1A 3P4QB 3JSVB 3EECA 3N3KB 1WMHB 4BFRA 3RULA 2N0SB 2LVPA 1YN3A 1KTKA 1STEA 4MDKE 3RZWC 2YEPF 2INCC 5D94A 2MJEA 2IO0B 1DOIA 4ITKA 2JRHA 1Y8RC 2G1EA 3ZNID 1HA5A 1JCKB 1EWCA 2R2QA 3RPFC 2NBVB 3Q6BA 3PS6A 3U30A 1WXAA 4JLCA 2N1WA 2K6DB 2Y5PA 5G5HA 3N32A 1YX5B 3DBLB 4AOFA 3A33B 1WZ3A 2WXLA 4RMAA 2LXAA 4HK2A 4LTUA 2PEAA 1V1OA 3MTNB 3H7PA 3L54A 4YT0B 2MLBA 4GU2A 4LK0M 2GBRA 3PTFC 4HXDA 2RR9A 3GP7A 4K7UA 3UI3A 1MHHE 4GGQA 3ZRCA 2KMCA 2D11A 3AU4A 3MC8A 4JX1C 3QA8A 3HM3A 3P2BA 5AUIA 1VRAB 4DQOC 3EHVA 5FKAC 2JY6A 5E6JA 3P1MA 5BMIA 1QKZA 4OZAA 1QLBB 4E71A 2I38A 2BKRB 3M63B 2V0GA 3ZYYX 4YL8A 2KKCA 1CMXB 3QWZB 4J6IA 4NNJB 2LVQA 1SB3C 1WGHA 2JF5A 1SE2A 4M0WB 1ZUD2 4GLSC 4G3XB 2CHXA 2K8CA 2M0AA 2BS3B 3L08A 5TSSA 3RMKC 2WXHA 1PFDA 2R2OA 2VRRB 1SIJA 3N9YC 3PZ7A 4WIPA 1NI2A 2QILA 2CJOA 3BK2A 1ZXHA 2WP9B 1S3SG 3I5JC 5AEKB 1GPXA 2KWCA 1XO3A 3CF6E 2M1MA 1D3ZA 2PE6B 2QIEB 3NG0A 2LXCA 2BW2A 4L1BA 2DAFA 4OZCA 5D3IB 3PHWB 4C00A 4C4VA 3ZVVA 2WDVB 4DHJD 4K3BA 4HPPA 1QT9A 3RN9C 1IP9A 1TY2A 2KQ4X 1AWDA 2GBMA 4W9LA 3HM6X 4ANVA 1I4XA 2GLSA 2FCNA 2WWZA 4I6NB 1V9JA 1FM0D 2KVZA 1WGDA 1FFUA 1IPGA 2C7MB 4GOCA 2ASQA 2RMMA 3NOBA 3I63C 3RNAC 4P7IA 2D3AA 4RCOA 2K8HA 3S2AA 1SF0A 2K25A 4ZRQA 3QK0A 4W9GA 2H88B 5BMHA 2NS5A 2NVUI 4L2YA 3IFWB 3V3XA 3AEEB 2N7EA 1TS3A 4MGKE 1NVID 4LNOA 1FO4A 2E3TA 3AE7B 2DHZA 4GSWA 4YTPB 4MSQB 4WJQA 4XWWA 1TIFA 4G0NB 1RLFA 4FADA 2LGYA 2G4SA 1VD2A 2M19A 1X1MA 3AM9A 3ECIA 2MQJA 4GXBA 1DOYA 3Q8FA 1E9MA 1WGKA 3Q3FA 4M01A 2AL3A 1EWYC 2L0TA 4WAAA 4MJSB 4NAWB 1GB4A 3DCGA 1SEBD 4IWPA 1IYFA 4A90A 1XCQL 1A5RA 1DGJA 4ASWC 1K53A 1JWBD 5JH5C 3PSEB 1N60A 1XD3B 4ZRIA 1Q0WB 4P6VF 2L3ZA 1Y56A 1GNUA 2RDBC 4NPNA 2IO2B 3TIXA 2A4ZA 2MEKA 1TZOA 4AS1A 1SXTA 4FULA 1V6EA 4KGSA 2K5PA 3V60A 3V6CB 3UINB 2E6XA 1I35A 3QJZA 4N9F4 4UDUC 3EFCA 3B2GA 2L05A 5HKHA 2RPVA 4S0RA 3GE8C 2NPTB 4US8A 4K81A 2JXTA 3ZLZA 2OJRA 4GB9A 3ZKJC 5IKCM 5E6NA 2AQ3B 2N9EB 1T6BX 2FE8A 2D2QA 3HK0A 3Q8AA 4ANXA 3PLUA 3VXWA 3PRZA 1KOTA 4LDTB 2SEBD 5C3JB 3KWVA 3UQAA 2BS2B 4HKZE 3JVZX 3BYTB 2CU3A 3OJ3A 4LNIA 3O13A 3IVFA 4KGTA 4HVBA 1QF6A 3HIZA 4IWOA 2VZKB 1L6UA 3U7ZA 1WXQA 3RI7C 1TKEA 3V6EB 3HUIA 3KW5B 3APDA 1LGRA 1D5ZC 1YD8U 2KT7A 3IXSA 4A8XC 2WX0A 2HD5B 4GDKA 5D7GA 2AQ1B 4HKQA 2LGIA 2XN9C 1WJNA 2CS4A 4MGIE 1WGRA 3ETRA 4P1CC 2BB5A 4OVVA 5IA7A 1J19A 3H7PB 2JXXA 2LRWA 4IUMB 3ZIMA 1KLGD 3WANA 3ZNHB 2ZNVC 2BYVE 2DAJA 3AH7A 2DNFA 1K52A 4NJCA 3VRBB 1MI0A 2INNE 3V61A 5BO4B 4A9AA 3OWEB 4PYZA 2WXKA 3BIID 3PT2B 3VHTC 1FFVA 3UIPB 1PUTA 1UGMA 3NHEB 2NTSA 3I57A 3AN1A 1UF0A 3UF8A 1MVKA 2O6VD 2G9HD 2EMSA 2JYEA 1FPYA 1QILA 1P1AA 1WIAA 3RNGC 2OJWA 3N30A 3X23A 3VH3B 1G6JA 2W54A 3BY4B 2KX3A 1HZ5A 3IT4B 1TY0A 2MBEA 1VDVA 4ICUA 1V5OA 2Y5CA 1CQVA 1LXDA 4FLHA 3B9JA 1QZEA 3BYYB 2LZ6A 1BUIC 3DHGC 1NYRA 4FBJB 2L76A 3PLVA 4AJWA 1C76A 5E6PA 1HQRD 1ZGUB 1E7VA 1JW9D 3PPAA 1YQBA 1JWSD 4C4VB 4HDOA 2CKHB 2D3CA 2R61A 3ZRFA 1F2RC 4DDGD 3RT3B 2BYFA 1ZW7A 3PO0A 2QHOA 1XLPA 1R4NB 2KTRB 4RGMA 4MEMA 1R4MI 4P16A 1I4PA 4QAYA 2ZPNA 1F2RI 2WXOA 4KSKC 4IWQA 1YNTE 3E9SA 2NTTA 4FA6A 2M17A 3EA6A 2IYDB
chains in the Genus database with same CATH topology
3RNCC 3RNBC 3DHIC 4P1CC 3RN9C 3DHGC 3Q3NC 3DHHC 3GE8C 2RDBC 2INDC 3RMKC 3N1ZC 1T0SC 3Q14C 3GE3C 3RNEC 1T0RC 3N20C 1T0QC 3N1YC 3N1XC 3Q2AC 3Q3OC 3I63C 2INCC 3RI7C 3RNAC 3RNFC 3RNGC 3I5JC 4P1BC 3Q3MC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RNC C;  3RNB C;  3DHI C;  4P1C C;  3RN9 C;  3DHG C;  3Q3N C;  3DHH C;  3GE8 C;  2RDB C;  2IND C;  3RMK C;  3N1Z C;  1T0S C;  3Q14 C;  3GE3 C;  3RNE C;  1T0R C;  3N20 C;  1T0Q C;  3N1Y C;  3N1X C;  3Q2A C;  3Q3O C;  3I63 C;  2INC C;  3RI7 C;  3RNA C;  3RNF C;  3RNG C;  3I5J C;  4P1B C;  3Q3M C; 
#chains in the Genus database with same CATH topology
 1UGJ A;  4PYU A;  1HTO A;  1J0G A;  1KJT A;  3P4P B;  5HFY A;  3MFG A;  4ZHO A;  2KOX A;  2YEP B;  2O6V A;  2JU6 X;  1IBX A;  5LXI B;  1WSP A;  3VUX A;  4ICV A;  4KZC A;  2W82 A;  3V62 A;  4MGY E;  3AB5 A;  4W9H A;  3VRA B;  1WI0 A;  3QAR A;  1FXT B;  4G11 A;  4PK1 A;  4XX5 A;  1UUP A;  3BVM A;  4LJP B;  1EU3 A;  1YN5 A;  2KWV B;  3NRZ A;  2V4I B;  4XE0 A;  2IDY A;  1MG8 A;  4NY0 A;  1AN8 A;  4CHK A;  4AQ7 A;  4KKJ A;  5FK9 C;  4MT5 A;  2RDH A;  1DYQ A;  4WQO B;  1VJK A;  3FC4 A;  4Q2J A;  4URK A;  5KHQ A;  3ENE A;  4FXC A;  4K1R B;  3DOW A;  3NS1 A;  4EZJ A;  4B0E A;  1NEK B;  1P3Q U;  1B9R A;  2V4L A;  1A70 A;  3ZNG C;  2K8B A;  2J0K A;  2LRU A;  4TKN A;  3W1Y A;  5EE1 A;  3RNF C;  1UBI A;  4DHJ B;  1FRR A;  4IW0 A;  3W5V B;  5LXH A;  1WM2 A;  4GIV A;  3BVG A;  3P4R B;  4W9J A;  2V3P A;  5H92 C;  3VFK A;  2N9K A;  2GBJ A;  3V05 A;  3PVL A;  3SFD B;  1HXY D;  2DLB A;  3IG3 A;  1XCT L;  4WWP A;  3RD2 A;  4OW0 A;  3FIL A;  4EZL A;  1IUE A;  3VH4 B;  1UEL A;  3KYC D;  2C7N B;  4S17 A;  1VZ7 A;  4NJ7 A;  2J0M A;  5J18 A;  1E90 A;  2L00 B;  1QQR A;  3PHX B;  5D3D A;  5D6J B;  1NDD A;  1XT9 B;  5CHW A;  2L0F A;  2D3B A;  2D3G A;  1T3Q A;  4MM3 B;  2C60 A;  3ZJU A;  4YSZ B;  2PLP A;  5EE0 A;  2LHE A;  1TKY A;  2LHD A;  2MWS B;  2L52 A;  1YIW A;  2L7R A;  2WXI A;  2KJH B;  3AEA B;  1L6V A;  3DWM A;  4GDK B;  1VCB A;  3MP9 A;  1AYF A;  5BMG A;  4HRO A;  3ML8 A;  1ISN A;  1ROE A;  1L5P A;  2WU5 B;  4EEW A;  3PZ8 A;  2VH1 A;  2WYQ A;  4WJO A;  4HJK A;  5DPR A;  4AP4 C;  2QMT A;  2IGD A;  1SE4 A;  2CHZ A;  3IAM 1;  1M94 A;  1L2N A;  1ZXI A;  1KFY B;  2IGG A;  5T8I A;  2DZJ A;  4FN2 A;  4KSL C;  3TEW A;  3GOE A;  2KC1 A;  4RGN A;  3NS8 A;  2WDT B;  4HPL B;  2K1F A;  3A9K A;  2KC2 A;  2ZVN A;  3DBR B;  3B08 A;  2MP2 B;  2XNA C;  1HEZ E;  4IM3 A;  1FEH A;  3TJP A;  1SE9 A;  1J7A A;  3AE1 B;  5EDS A;  1UZX B;  3AEF B;  4ZRJ A;  2KYW A;  3A4R A;  3ZDT A;  1YMH E;  4KDL B;  3JW0 X;  2LFI A;  4TMA B;  1LM8 B;  4BKG A;  4AWJ A;  1UBQ A;  2BWE S;  1C4P A;  2AWT A;  3KYD D;  2WXR A;  2CHW A;  2REX A;  3BIN A;  1WF9 A;  3N20 C;  1T0Q C;  3AV8 A;  3HVZ A;  3W1S C;  1EM7 A;  5H8Y E;  3DBH B;  3RZF A;  2ZZP B;  1RFK A;  1SIF A;  2DZI A;  2ZCB A;  1SJH D;  1BT0 A;  3DHH C;  4MH0 E;  1F0Z A;  2MX2 A;  1P7E A;  3CMM B;  4ANU A;  2DZM A;  3MJW A;  3AI5 A;  5BYR A;  3GZN B;  1YJI A;  1L7Y A;  4ARC A;  2HJ8 A;  2DZK A;  4IDI A;  3RFZ B;  4TUU A;  3DVN V;  4W9I A;  4KX6 B;  3VDZ A;  1QOA A;  2C7H A;  2L32 A;  1E6E B;  1N5X A;  3AE8 B;  2KJR A;  1V1P A;  1JRU A;  2WU2 B;  2NMQ A;  2OOB B;  1KH0 A;  1ZDX A;  4YWG G;  2WLB A;  3BWU D;  3E56 A;  4HLE A;  1P98 A;  2N1V A;  3QHT A;  2JZ3 B;  2MBO A;  4ZDV A;  2K0P A;  5CTR C;  1MFW A;  1KF6 B;  2MW5 A;  3P4S B;  2PE9 A;  1N5W A;  3UGB B;  1E8X A;  3TBL D;  2O6V B;  2QC8 A;  1IBX B;  4B6W A;  1FMA D;  1FD6 A;  2KTF A;  4KVG B;  2FAZ A;  1GAQ B;  4W9K A;  2KMM A;  1TJE A;  3ONS A;  3Q3M C;  2KMA A;  5AZH A;  3DHI C;  1WE6 A;  2N9L A;  3NJT A;  4PS8 A;  4FJV B;  1FXA A;  1TS5 A;  1RM6 C;  1V8C A;  1MG4 A;  2MBQ A;  4C56 C;  2OED A;  1TKG A;  2BS4 B;  4CQN A;  1GJZ A;  5G55 A;  1D5M C;  4MEL A;  3DQV A;  2PMV A;  1LFD A;  2YLM A;  3QX1 A;  3X0W A;  1GB1 A;  3H8H A;  3ZO5 B;  2DYB A;  4WJN A;  1TS2 A;  4JQW C;  5G2N A;  1WX9 A;  1UD7 A;  2JPH A;  2MJ3 A;  2QSD A;  1H8C A;  3LJ3 A;  4AJY B;  2IZV B;  3Q8E A;  2KFK A;  4IC7 B;  5CHV C;  3AMZ A;  2BBC A;  2LI5 A;  4FJY A;  5I4D A;  2LEK A;  4XDC A;  2M8S A;  4KZ0 A;  1WY8 A;  3LDZ E;  3N1Z C;  2EEL A;  2MA9 B;  3K9P B;  1QOB A;  1YJJ A;  3PRE A;  4IG7 B;  2LWP A;  3TUO A;  4ACF A;  3GB1 A;  1E7P B;  5BYS A;  2PW9 A;  2X8X X;  3IT6 B;  2JX5 A;  2PJH A;  3OJ4 B;  2WXM A;  4B9K A;  4DXF A;  2EKI A;  1T0Y A;  2N4F A;  4ZRK A;  2WXF A;  4A20 A;  4BOS C;  2FCM A;  1WR1 A;  4MAC A;  1YOV B;  5IO9 A;  2UYZ B;  2KWU B;  2Z59 B;  1Z5S B;  4DK5 A;  2JZZ A;  3WAP A;  3KLS X;  3EFU A;  1FXI A;  3T9L A;  2QEJ C;  4MGZ E;  4WAF A;  3ZGZ A;  3U7D A;  5IN7 A;  1WXV A;  1ZDV A;  3AE5 B;  2ZCC A;  2INP E;  2KJ6 A;  1N62 A;  2WGS A;  1MPE A;  2V1Y A;  2KHW B;  2O2V A;  3KH0 A;  2LAS A;  2OHF A;  3DBL I;  3DVG Y;  2FNJ B;  2JYT A;  4BVU C;  1CK1 A;  1C77 A;  2KDF B;  2KVR A;  4A3O A;  4J3O D;  1YJ1 A;  2IND C;  1L0V B;  5JXV A;  2WHI A;  3CIR B;  5J2R A;  1V97 A;  1J7C A;  2ZW0 A;  1EO6 A;  3NVY A;  1F9J A;  3TEZ A;  2FID A;  2C5L C;  1FNW A;  1ZOY B;  4ZOH C;  1L0Y B;  2YVC A;  3O65 B;  1OTR B;  4DXG A;  3QCA A;  3Q8C A;  2D5G A;  3QIJ A;  3RNC C;  5C1Z A;  3L0W B;  3ZTC A;  2GMI C;  2XK5 A;  1TS4 A;  3SFE B;  1T0R C;  2RDG A;  4GN1 A;  4WH4 A;  3SDL C;  3WCQ A;  1WJU A;  4W9D A;  2JSV X;  4PS7 A;  1V5T A;  1WJ6 A;  1M4V A;  3AU5 A;  2I2Y A;  2MHJ A;  5TR5 A;  1ACC A;  2BT6 A;  2LMC A;  3AUL A;  1MHX A;  3NY5 A;  3BVZ A;  1J8C A;  3EC8 A;  1V81 A;  3K9O B;  3L10 B;  2PTL A;  3ZJT A;  3Q69 A;  2BKF A;  4BBN C;  1WGG A;  3TSS A;  2RSU A;  4M00 A;  2KLC A;  5KHO A;  3VTV A;  1GC6 A;  2NCN A;  4I6L B;  2GOW A;  2W9N A;  4M02 A;  4R3D A;  3KUZ A;  1P0R A;  5C23 A;  4ZYN A;  5DCN A;  2KXJ A;  1V2Y A;  2L8J A;  2KQS A;  3Q3O C;  3ALB A;  2KZR A;  2LGS A;  3U2S C;  3ZDM C;  5AZG A;  2W3S A;  3L13 A;  4LDT D;  1E8Y A;  1KLV A;  1UWM A;  3PRP B;  2ZPY A;  4E3C A;  1V1P B;  3HHM A;  3NZ3 A;  2ZVO A;  3MJ5 A;  4XGA B;  5IP4 D;  3TCA A;  1FCL A;  1XLQ A;  3I9V 1;  1FRD A;  2DYM A;  2LD9 A;  4TSS A;  1CZP A;  2WNM A;  4KIK A;  2MH7 A;  4OVU A;  4JWU C;  3SHQ A;  1U4A A;  4PS3 A;  4K3C A;  4YXD B;  1IGD A;  1JRP A;  1LO5 D;  1TBE A;  5DPW A;  2LVO A;  1FNV A;  3MC9 A;  2HTH A;  4US9 A;  2AL6 A;  1TTN A;  1EF5 A;  4A55 A;  3Q14 C;  4EZK A;  4LNK A;  2W3R A;  2L1A A;  1PGB A;  1I4Q A;  4AUQ C;  1ZE3 D;  1I4H A;  1EU4 A;  5D2M B;  1E0Z A;  1XF5 L;  1CJE A;  2EMT A;  5L83 A;  2M0X A;  2UWQ A;  4NQL B;  5JZE B;  2NR2 A;  3W2D A;  2KAC A;  2MJD A;  5GMV A;  4G50 A;  4XWT A;  1FIQ A;  4N58 A;  1JAL A;  3MC0 B;  1L0X B;  3T3N A;  1QOF A;  1N6Z A;  2KDI A;  3RUI B;  2D10 A;  2N9P C;  3BK1 A;  1WE7 A;  1RYJ A;  4W9E A;  1T0S C;  2HTM E;  4PT5 A;  3NZS A;  4DHZ E;  3Q3J A;  4LLG M;  3PGE A;  2LUM A;  3Q2A C;  1H4R A;  1C3T A;  3SEB A;  1NYQ A;  4RGO S;  2KFK B;  3B0A A;  2KK8 A;  3P42 A;  1JRO A;  2ZJD A;  2D07 B;  1RAX A;  4EFO A;  1OQY A;  4RM9 A;  4KKI A;  1JML A;  2K6Q A;  1P7F A;  5MPO A;  3R2I A;  1YQ3 B;  1FCC C;  2BVC A;  4A6Q A;  2IPK D;  1Z2M A;  3H6N A;  3R7Q A;  2WDR B;  2JQR B;  1WFY A;  2A5U A;  2JZP A;  4O1N A;  3DBS A;  3DPD A;  2WXQ A;  4HRS A;  1OEY A;  2W55 A;  3AXC A;  3NVW A;  2RD0 A;  2KLG A;  1N61 A;  1JWU D;  1JWA D;  2H89 B;  4NAM A;  2Q5W D;  2G4D B;  1GC7 A;  3RNB C;  2J52 A;  3RYT A;  5EE9 A;  2WQY B;  3AEC B;  5CHF A;  1D4B A;  3LB8 C;  2BQQ A;  1K51 A;  2N9X A;  2ZNV B;  1YX6 B;  3H7S A;  3LXF A;  4FJZ A;  3T3O A;  4JGH B;  4M8M A;  1NBF C;  1K8R B;  1WRD B;  2J7Q B;  4KV2 A;  3N1Y C;  3UIO B;  3H1U A;  4XZ4 A;  2O2V B;  4JWS C;  1PGX A;  1HZ6 A;  4GMV A;  1V86 A;  3HRD D;  2G3Q B;  2X38 A;  3C8Y A;  1FNU A;  3OLM D;  1YN4 A;  3VR9 B;  2ICI A;  5GXG B;  1TYG B;  2K39 A;  1C4C A;  2KQ7 A;  1DOX A;  1GUA B;  3DDC B;  2WDQ B;  1VLB A;  1Q10 A;  3SR6 A;  3RNE C;  1D6E C;  2J4X A;  4YTM B;  1KM7 A;  3W5U B;  3ZQ4 A;  2BB6 A;  1N63 A;  1VZ6 A;  3R8B A;  2KX0 A;  5G5G A;  1ET9 A;  5DPT A;  2QCZ A;  4F7Z A;  3EGR A;  4DHZ B;  4XDD A;  3MHS D;  2KFJ A;  1C79 A;  2XK5 B;  1BXT A;  3TEX A;  3W1S A;  1WJ4 A;  3R3M A;  1E8Z A;  4K7W A;  2KAJ A;  4FHK A;  1TT5 B;  3NZU A;  1C9F A;  3FAH A;  2IBI B;  5L95 C;  5AUK A;  3A1Q A;  2FIF A;  1SGH A;  2JRI B;  2WXG A;  3T8M A;  3CWI A;  2PVO D;  2QDF A;  1F52 A;  1GG3 A;  1HTQ A;  1R4M B;  2AQ2 B;  2WXN A;  1C78 A;  5LNK 1;  3A4S C;  5FR6 A;  4YSX B;  2MBH A;  4NZL B;  3L4P A;  1UNS A;  4KDI C;  2XBB C;  3IHP C;  3SU8 X;  4C7Z A;  1ENF A;  2N7D A;  1NEN B;  2B3A A;  2XEW A;  1SBB B;  4IKG A;  5JHB A;  4TQ0 A;  4M8N A;  2KTR A;  3Q3N C;  2FUH B;  3WAM A;  1EF1 A;  3URY A;  3ZUN A;  3JYU A;  2IGH A;  3VQI A;  5FR3 A;  1JQ4 A;  3GS2 A;  1OQQ A;  1S1Q B;  4IOI E;  3C0R B;  2Z8L A;  2KDE B;  1F77 A;  3U52 E;  1ZKH A;  2KN4 A;  1F1H A;  1TGZ B;  2CU1 A;  4N6E B;  3AEG B;  2IO3 B;  4JE3 B;  2EKE C;  2M56 B;  4F1S A;  2KN5 A;  3AED B;  1WXM A;  1C4A A;  4HDQ A;  2JWZ A;  4X57 B;  1R4N I;  1E7U A;  2B76 B;  1YQ4 B;  3B1L X;  4NQK E;  1JWM D;  3CST A;  1WX8 A;  2BYE A;  4RF1 A;  2HDE A;  2QJL A;  5CX3 A;  3DVN U;  3L17 A;  1WH3 A;  4KIK B;  3VVW B;  2IJ0 A;  1SE3 A;  1WGY A;  2DBY A;  2LUE A;  3I3T B;  4HWI B;  4WUR A;  3AE3 B;  2ZEQ A;  2ON8 A;  4W9F A;  2IO1 B;  4MSM B;  5DPS A;  1D5X C;  3QQ8 B;  1NI3 A;  3ML9 A;  3KQ4 A;  3A9J A;  3PZD A;  4OHJ A;  4RGT A;  2I1J A;  4BBN F;  1TZ1 A;  4WWO A;  5HG2 A;  1IGC A;  1WZ0 A;  1I4G A;  3ZJV A;  4YTN B;  1QOG A;  2MSE D;  2C9W B;  1RRB A;  1I4R A;  2KO3 A;  5LLI A;  2V3N A;  4ARI A;  1E5W A;  3OAW A;  3VTW A;  2Z0E B;  1HE8 A;  4C80 A;  2GRI A;  2TSS A;  3Q8B A;  3AE4 B;  2J0J A;  2WXP A;  1LQB A;  2V3S A;  4K7S A;  1WYG A;  4GDL A;  3WA0 A;  1WR6 E;  2ONQ A;  3JSV A;  4HEA 1;  1WMH A;  1SJE D;  2JVC A;  4RNA A;  4JL9 A;  1RWS A;  1V80 A;  1P9D U;  3APF A;  3DVG X;  4ZHP A;  1AAR A;  3BZD B;  5EE3 A;  1PGA A;  3ZXV A;  3FIL B;  3TL5 A;  4N59 A;  5J17 A;  1AW7 A;  4TV3 A;  2KD0 A;  2I1K A;  4D2K A;  3ZXR A;  1C1Y B;  3NUH B;  4HCN B;  4LCD E;  2NBW B;  3M62 B;  4YSY B;  1R7S A;  4HCP B;  4MM3 A;  2K3U A;  1K50 A;  3EUB 2;  3L16 A;  2GBN A;  4RFB A;  2KNB A;  1Q1O A;  1OQR A;  2KWD A;  1XLN A;  4EKU A;  3PRM B;  1VZ8 A;  4E74 A;  4USA A;  1I7H A;  2LGX A;  4OZB A;  1KLU D;  4WJP A;  3GE3 C;  1E8W A;  5HHD G;  2L83 A;  2Y3A A;  2DYO A;  4LJO B;  4B0M A;  4IM0 A;  3NVZ A;  2LJI A;  3VUW A;  2WX1 A;  2CR5 A;  3D32 A;  3LYY A;  1XXG A;  2RPQ A;  2MRP A;  2CJN A;  4ZYS A;  1MJD A;  2J53 A;  2AEH A;  4HPM B;  1L4Z B;  3KVF B;  1OGW A;  4CYE A;  1V49 A;  1B1Z A;  3WIM A;  1KRH A;  4F8C B;  4A3P A;  1WRI A;  2JUO A;  4LNF A;  1WM3 A;  4LNN A;  3WAO A;  5E6O A;  2AX5 A;  4M0W A;  2K9X A;  3R66 C;  2WS3 B;  2DWQ A;  1OEY J;  2WXJ A;  3A9K B;  2MP2 A;  2JT4 B;  4II3 B;  4DDI D;  2BF8 B;  5IAA C;  4I6P A;  2KDM A;  3C19 A;  4L23 A;  1BML C;  4WQM A;  1OFF A;  2BYT A;  1XEE A;  2IY0 B;  5JHA A;  3R7R A;  1UWX A;  4JIO U;  5C2T B;  4REZ A;  3CSF A;  2KDB A;  4BAX A;  1PQS A;  3DBR I;  3AE2 B;  3KUD B;  3FKY A;  3J9C A;  4C7Y A;  3AE9 B;  3HVD A;  2Z0D B;  1WWT A;  3MHZ A;  4WWM A;  3RCZ A;  4BKS D;  4EUT A;  3M3J A;  2FBW B;  4B95 A;  2PPH A;  5AZF A;  3A1Q B;  2BGF A;  4XC2 A;  4WWN A;  2M4N A;  2SAK A;  2G45 B;  2GBK A;  3R2T A;  1SSN A;  4BZA A;  3DBH I;  5HI1 A;  3U4E G;  3H9D A;  2PVG C;  2KAN A;  2IY1 B;  2HJ1 A;  3M95 A;  3DWG C;  4P1B C;  2Y5B B;  4DWF A;  1J7B A;  3IBE A;  4MH8 A;  3PV1 A;  4BOZ B;  1WYW B;  4W9C A;  2LJ5 A;  4RF0 A;  2VZK D;  2BWF A;  3GZN I;  3KUC B;  3SD5 A;  3VAW A;  3N1X C;  1I42 A;  1XQQ A;  3IAS 1;  2ACZ B;  1WX7 A;  2GI9 A;  2MCN B;  4XYC A;  4KGR A;  3UQB A;  1WXS A;  2V9H A;  4RM8 A;  1EUV B;  4HJG E;  1PDX A;  3OG5 A;  4DBG A;  2JWU A;  4MJS A;  4NAW A;  2FCQ A;  2NBU A;  2AYO B;  2VH2 A;  2BTE A;  2J42 A;  2UU7 A;  3QAQ A;  3TEY A;  1GOZ A;  3WAL A;  2FCS A;  4RH6 A;  3P63 A;  2FUG 1;  4CO7 A;  2LGD A;  1Q5W B;  2BPS A;  1L4D B;  4H2A A;  3APC A;  3VTU A;  1ESF A;  3KWL A;  2K22 A;  4DXA B;  3AE6 B;  2DEN B;  2DX5 B;  3ZNZ B;  3QC8 B;  1ZP0 B;  2HE7 A;  2MBB B;  3A9J B;  4II2 B;  3ZW3 A;  3B2F A;  2RGF A;  4BKS A;  1PYW D;  2GB1 A;  2PIA A;  5BYQ A;  4FHJ A;  2ZW1 A;  4ANW A;  4BKT A;  4EOY A;  4IM2 A;  1RFA A;  2NPT A;  4EE2 A;  4NJ6 A;  3W9C B;  3VR8 B;  4JPS A;  1XLO A;  1ZPS A;  3AEB B;  1VR9 A;  5IOI A;  3U8Z A;  4ZRP A;  2PKO A;  3NVV A;  2N7J A;  4OVZ A;  3ABV B;  3VUY A;  3ZTD A;  4GDL B;  3TMP B;  1ET6 A;  1T5X D;  1E10 A;  1UH6 A;  4TQ1 A;  3P4Q B;  3JSV B;  3EEC A;  3N3K B;  1WMH B;  4BFR A;  3RUL A;  2N0S B;  2LVP A;  1YN3 A;  1KTK A;  1STE A;  4MDK E;  3RZW C;  2YEP F;  2INC C;  5D94 A;  2MJE A;  2IO0 B;  1DOI A;  4ITK A;  2JRH A;  1Y8R C;  2G1E A;  3ZNI D;  1HA5 A;  1JCK B;  1EWC A;  2R2Q A;  3RPF C;  2NBV B;  3Q6B A;  3PS6 A;  3U30 A;  1WXA A;  4JLC A;  2N1W A;  2K6D B;  2Y5P A;  5G5H A;  3N32 A;  1YX5 B;  3DBL B;  4AOF A;  3A33 B;  1WZ3 A;  2WXL A;  4RMA A;  2LXA A;  4HK2 A;  4LTU A;  2PEA A;  1V1O A;  3MTN B;  3H7P A;  3L54 A;  4YT0 B;  2MLB A;  4GU2 A;  4LK0 M;  2GBR A;  3PTF C;  4HXD A;  2RR9 A;  3GP7 A;  4K7U A;  3UI3 A;  1MHH E;  4GGQ A;  3ZRC A;  2KMC A;  2D11 A;  3AU4 A;  3MC8 A;  4JX1 C;  3QA8 A;  3HM3 A;  3P2B A;  5AUI A;  1VRA B;  4DQO C;  3EHV A;  5FKA C;  2JY6 A;  5E6J A;  3P1M A;  5BMI A;  1QKZ A;  4OZA A;  1QLB B;  4E71 A;  2I38 A;  2BKR B;  3M63 B;  2V0G A;  3ZYY X;  4YL8 A;  2KKC A;  1CMX B;  3QWZ B;  4J6I A;  4NNJ B;  2LVQ A;  1SB3 C;  1WGH A;  2JF5 A;  1SE2 A;  4M0W B;  1ZUD 2;  4GLS C;  4G3X B;  2CHX A;  2K8C A;  2M0A A;  2BS3 B;  3L08 A;  5TSS A;  3RMK C;  2WXH A;  1PFD A;  2R2O A;  2VRR B;  1SIJ A;  3N9Y C;  3PZ7 A;  4WIP A;  1NI2 A;  2QIL A;  2CJO A;  3BK2 A;  1ZXH A;  2WP9 B;  1S3S G;  3I5J C;  5AEK B;  1GPX A;  2KWC A;  1XO3 A;  3CF6 E;  2M1M A;  1D3Z A;  2PE6 B;  2QIE B;  3NG0 A;  2LXC A;  2BW2 A;  4L1B A;  2DAF A;  4OZC A;  5D3I B;  3PHW B;  4C00 A;  4C4V A;  3ZVV A;  2WDV B;  4DHJ D;  4K3B A;  4HPP A;  1QT9 A;  3RN9 C;  1IP9 A;  1TY2 A;  2KQ4 X;  1AWD A;  2GBM A;  4W9L A;  3HM6 X;  4ANV A;  1I4X A;  2GLS A;  2FCN A;  2WWZ A;  4I6N B;  1V9J A;  1FM0 D;  2KVZ A;  1WGD A;  1FFU A;  1IPG A;  2C7M B;  4GOC A;  2ASQ A;  2RMM A;  3NOB A;  3I63 C;  3RNA C;  4P7I A;  2D3A A;  4RCO A;  2K8H A;  3S2A A;  1SF0 A;  2K25 A;  4ZRQ A;  3QK0 A;  4W9G A;  2H88 B;  5BMH A;  2NS5 A;  2NVU I;  4L2Y A;  3IFW B;  3V3X A;  3AEE B;  2N7E A;  1TS3 A;  4MGK E;  1NVI D;  4LNO A;  1FO4 A;  2E3T A;  3AE7 B;  2DHZ A;  4GSW A;  4YTP B;  4MSQ B;  4WJQ A;  4XWW A;  1TIF A;  4G0N B;  1RLF A;  4FAD A;  2LGY A;  2G4S A;  1VD2 A;  2M19 A;  1X1M A;  3AM9 A;  3ECI A;  2MQJ A;  4GXB A;  1DOY A;  3Q8F A;  1E9M A;  1WGK A;  3Q3F A;  4M01 A;  2AL3 A;  1EWY C;  2L0T A;  4WAA A;  4MJS B;  4NAW B;  1GB4 A;  3DCG A;  1SEB D;  4IWP A;  1IYF A;  4A90 A;  1XCQ L;  1A5R A;  1DGJ A;  4ASW C;  1K53 A;  1JWB D;  5JH5 C;  3PSE B;  1N60 A;  1XD3 B;  4ZRI A;  1Q0W B;  4P6V F;  2L3Z A;  1Y56 A;  1GNU A;  2RDB C;  4NPN A;  2IO2 B;  3TIX A;  2A4Z A;  2MEK A;  1TZO A;  4AS1 A;  1SXT A;  4FUL A;  1V6E A;  4KGS A;  2K5P A;  3V60 A;  3V6C B;  3UIN B;  2E6X A;  1I35 A;  3QJZ A;  4N9F 4;  4UDU C;  3EFC A;  3B2G A;  2L05 A;  5HKH A;  2RPV A;  4S0R A;  3GE8 C;  2NPT B;  4US8 A;  4K81 A;  2JXT A;  3ZLZ A;  2OJR A;  4GB9 A;  3ZKJ C;  5IKC M;  5E6N A;  2AQ3 B;  2N9E B;  1T6B X;  2FE8 A;  2D2Q A;  3HK0 A;  3Q8A A;  4ANX A;  3PLU A;  3VXW A;  3PRZ A;  1KOT A;  4LDT B;  2SEB D;  5C3J B;  3KWV A;  3UQA A;  2BS2 B;  4HKZ E;  3JVZ X;  3BYT B;  2CU3 A;  3OJ3 A;  4LNI A;  3O13 A;  3IVF A;  4KGT A;  4HVB A;  1QF6 A;  3HIZ A;  4IWO A;  2VZK B;  1L6U A;  3U7Z A;  1WXQ A;  3RI7 C;  1TKE A;  3V6E B;  3HUI A;  3KW5 B;  3APD A;  1LGR A;  1D5Z C;  1YD8 U;  2KT7 A;  3IXS A;  4A8X C;  2WX0 A;  2HD5 B;  4GDK A;  5D7G A;  2AQ1 B;  4HKQ A;  2LGI A;  2XN9 C;  1WJN A;  2CS4 A;  4MGI E;  1WGR A;  3ETR A;  4P1C C;  2BB5 A;  4OVV A;  5IA7 A;  1J19 A;  3H7P B;  2JXX A;  2LRW A;  4IUM B;  3ZIM A;  1KLG D;  3WAN A;  3ZNH B;  2ZNV C;  2BYV E;  2DAJ A;  3AH7 A;  2DNF A;  1K52 A;  4NJC A;  3VRB B;  1MI0 A;  2INN E;  3V61 A;  5BO4 B;  4A9A A;  3OWE B;  4PYZ A;  2WXK A;  3BII D;  3PT2 B;  3VHT C;  1FFV A;  3UIP B;  1PUT A;  1UGM A;  3NHE B;  2NTS A;  3I57 A;  3AN1 A;  1UF0 A;  3UF8 A;  1MVK A;  2O6V D;  2G9H D;  2EMS A;  2JYE A;  1FPY A;  1QIL A;  1P1A A;  1WIA A;  3RNG C;  2OJW A;  3N30 A;  3X23 A;  3VH3 B;  1G6J A;  2W54 A;  3BY4 B;  2KX3 A;  1HZ5 A;  3IT4 B;  1TY0 A;  2MBE A;  1VDV A;  4ICU A;  1V5O A;  2Y5C A;  1CQV A;  1LXD A;  4FLH A;  3B9J A;  1QZE A;  3BYY B;  2LZ6 A;  1BUI C;  3DHG C;  1NYR A;  4FBJ B;  2L76 A;  3PLV A;  4AJW A;  1C76 A;  5E6P A;  1HQR D;  1ZGU B;  1E7V A;  1JW9 D;  3PPA A;  1YQB A;  1JWS D;  4C4V B;  4HDO A;  2CKH B;  2D3C A;  2R61 A;  3ZRF A;  1F2R C;  4DDG D;  3RT3 B;  2BYF A;  1ZW7 A;  3PO0 A;  2QHO A;  1XLP A;  1R4N B;  2KTR B;  4RGM A;  4MEM A;  1R4M I;  4P16 A;  1I4P A;  4QAY A;  2ZPN A;  1F2R I;  2WXO A;  4KSK C;  4IWQ A;  1YNT E;  3E9S A;  2NTT A;  4FA6 A;  2M17 A;  3EA6 A;  2IYD B; 
#chains in the Genus database with same CATH homology
 3RNC C;  3RNB C;  3DHI C;  4P1C C;  3RN9 C;  3DHG C;  3Q3N C;  3DHH C;  3GE8 C;  2RDB C;  2IND C;  3RMK C;  3N1Z C;  1T0S C;  3Q14 C;  3GE3 C;  3RNE C;  1T0R C;  3N20 C;  1T0Q C;  3N1Y C;  3N1X C;  3Q2A C;  3Q3O C;  3I63 C;  2INC C;  3RI7 C;  3RNA C;  3RNF C;  3RNG C;  3I5J C;  4P1B C;  3Q3M C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...