4P1CC

Crystal structure of the toluene 4-monooxygenase hydroxylase-ferredoxin c7s, c84a, c85a variant electron-transfer complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
82
structure length
82
Chain Sequence
b'SAFPVHAAFEKDFLVQLVVVDLNDSMDQVAEKVAYHCVNRRVAPREGVMRVRKHRSTELFPRDMTIAESGLNPTEVIDVVFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toluene-4-monooxygenase system protein A
publication title Structural basis for biomolecular recognition in overlapping binding sites in a diiron enzyme system.
pubmed doi rcsb
source organism Pseudomonas mendocina
molecule tags Oxidoreductase
total genus 25
structure length 82
sequence length 82
chains with identical sequence F
ec nomenclature ec 1.14.13.236: Toluene 4-monooxygenase.
pdb deposition date 2014-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 4p1cC00
2INCC 3I63C 4P1CC 3GE8C 3Q3MC 3DHGC 3N20C 3N1XC 3RNEC 2INDC 3GE3C 3RNCC 4P1BC 3RN9C 3N1ZC 1T0RC 3Q2AC 2RDBC 3DHHC 3RMKC 3RNFC 3RNBC 3RNAC 3DHIC 1T0SC 3N1YC 3Q3NC 3RI7C 1T0QC 3I5JC 3Q14C 3RNGC 3Q3OC
chains in the Genus database with same CATH superfamily
2O6VA 3O13A 4AOFA 2V4IB 1IPGA 1BMLC 3BINA 1KOTA 3ZIMA 3U2SC 2BWES 3AE7B 4GOCA 1XCTL 2K0PA 2KLGA 4ZRKA 1K50A 4KV2A 2Y5BB 5I4DA 5E6OA 2G1EA 3SU8X 3CSFA 1TBEA 5L83A 1VD2A 2BBCA 1ET9A 1WJ4A 1NENB 2GMIC 3TEWA 4BBNC 2VRRB 1DGJA 2WHIA 4FN2A 2VZKD 4ZDVA 2WXPA 3DHIC 3NS8A 2AX5A 4LJPB 1DYQA 5EE0A 3ZJTA 2QDFA 4BKGA 1TKGA 2M19A 5HI1A 2K9XA 4RNAA 1WZ3A 1NI3A 3MC0B 1L0XB 1CMXB 1FNWA 3GB1A 3QA8A 2ZPNA 3PLVA 1FXAA 3RZFA 4HJGE 2L0TA 2KWDA 1WXVA 2GOWA 5HHDG 2FUG1 2EMSA 4N59A 1EF1A 4DHJD 3R3MA 3KWVA 4US8A 2DZKA 2JX5A 3DBHI 2FAZA 2ZCCA 1WRDB 4JX1C 2H89B 3ZRFA 1JMLA 3PSEB 4A6QA 2FIFA 2WXHA 2WU2B 3Q6BA 2BKRB 3APFA 1TGZB 4HPPA 1NDDA 3KVFB 2FE8A 2PEAA 4ZRJA 1PQSA 1UBIA 1IUEA 4DQOC 4B6WA 1FXTB 4AJWA 4XE0A 2LMCA 5HG2A 2FIDA 1ENFA 2Z8LA 1N5WA 3T9LA 2PTLA 1V49A 3CF6E 3PRZA 2W54A 1CJEA 4PYZA 1K53A 5JXVA 4CHKA 5GXGB 4NJ7A 1I4GA 2AL3A 3UIOB 2IO2B 2N9PC 3TEYA 4J6IA 3W2DA 3PHWB 4S0RA 4BZAA 5G5HA 2INCC 2BGFA 3B2GA 3OJ3A 3ZNHB 4GU2A 4HK2A 2BPSA 2AQ1B 2ZJDA 1E5WA 4AWJA 1HE8A 1L7YA 3JYUA 2EKEC 4DBGA 1G6JA 4XDCA 2IGDA 1UF0A 3HRDD 4ACFA 1FFVA 3ZKJC 4W9FA 4FA6A 4M0WB 1E10A 4ICVA 3ZXVA 4K3CA 2LHDA 3CSTA 2ASQA 2IY1B 3MFGA 1E6EB 1F77A 2MHJA 2HTHA 2WXLA 4WWMA 1V1PA 2KTFA 2WX0A 5BMHA 4P16A 4KDIC 1YX5B 3W1SC 4K81A 4MT5A 3K9PB 4CO7A 2NPTA 1FM0D 3PRPB 4FBJB 4EFOA 1P7FA 2KZRA 1FNUA 2JYTA 4AS1A 3ZNZB 2IO0B 2MLBA 2INNE 3A9JB 3NZSA 2DZIA 4WQOB 4PS7A 2LGYA 2O2VA 4REZA 3A33B 1WX7A 1OQYA 1IBXB 1PGAA 2ZW1A 3EFCA 2KQ4X 1HXYD 2HJ1A 3A4RA 3L4PA 1XEEA 2DLBA 2IGHA 2M8SA 4KSKC 4B9KA 1ET6A 3SR6A 2EELA 1N62A 3LYYA 4IWOA 2BW2A 2PE6B 4MACA 4MGKE 4HVBA 1WXMA 2BF8B 3M3JA 4WIPA 3LJ3A 2L32A 3AEAB 3SFDB 2HDEA 3Q8CA 3QWZB 5KHQA 1YIWA 3NUHB 4XGAB 2REXA 5AEKB 5D6JB 3VR9B 4HRSA 3SD5A 4ZOHC 2GBNA 2JU6X 4RFBA 4RGOS 3EFUA 1J0GA 2D3AA 3QJZA 3ZRCA 5C2TB 4PS3A 5C1ZA 4ZYNA 2MH7A 2KQ7A 5J2RA 2AYOB 1KH0A 4WWPA 3C8YA 3BIID 3NVZA 2XK5A 2JWUA 2R2OA 3H6NA 3DBLB 1MPEA 2KJHB 3AE4B 4KDLB 1QZEA 2SEBD 2K1FA 4EOYA 3QIJA 3FILB 1EF5A 2W9NA 1WMHA 3ZJVA 2M56B 3FC4A 4LLGM 2K5PA 3SHQA 3ZDTA 3Q8AA 2L52A 2RDGA 3KWLA 3RFZB 5IOIA 5C3JB 4G0NB 4JE3B 2LGSA 4NQLB 2M1MA 1TS2A 2DX5B 2HJ8A 3B2FA 3VH4B 1F2RC 3I5JC 2J0JA 2WP9B 3IAM1 4I6LB 2XN9C 2Z0DB 2AEHA 2V3PA 5FKAC 4HLEA 3DHGC 4ANXA 5G2NA 3D32A 4FXCA 2RSUA 1XLNA 1GJZA 4RM9A 5BYQA 1UWXA 1NI2A 1ZE3D 1Z5SB 2K8BA 1FRRA 4Q2JA 2KMCA 4URKA 3BYTB 1N6ZA 3N1XC 1IGCA 2WXNA 3AEEB 2ZNVC 1WYWB 1EUVB 2BS3B 3IVFA 3H1UA 4LNFA 1HZ5A 3W5UB 3DHHC 5CX3A 1EU4A 1MI0A 3N9YC 2KFJA 2FCQA 5LNK1 1YJJA 4EUTA 4MDKE 5D2MB 2LJ5A 3WALA 2KX0A 2J52A 1L5PA 4ANUA 2KT7A 2Y5CA 1PDXA 1Q5WB 4E71A 1V5TA 1AN8A 2MBBB 4RF1A 1GAQB 4WAAA 2QIEB 1RFKA 2QJLA 4MM3B 2KX3A 1PGBA 4ASWC 2CU1A 4OZAA 4L2YA 4JL9A 3PZ7A 1BXTA 2LXAA 2NS5A 3MTNB 2IY0B 3TEXA 2JUOA 4OVVA 4LCDE 3PLUA 1WRIA 1SEBD 4XWWA 1ZDVA 5AUIA 2DAFA 5E6PA 1M94A 3PPAA 2YEPF 5DPSA 3TIXA 1JWUD 3A4SC 3JSVA 2C7NB 1QF6A 3OJ4B 1N61A 2XK5B 1F52A 3RT3B 4RGTA 2D2QA 1KF6B 3R2IA 4TKNA 2ZNVB 1YD8U 1F2RI 1TY2A 1WXSA 2DYMA 3A1QB 4IM3A 3VQIA 2N1WA 4NPNA 2KD0A 1B9RA 2ICIA 2LI5A 4JWUC 4C4VA 2CKHB 2J4XA 1U4AA 4W9GA 3JW0X 4S17A 1WI0A 4GDKA 1J7BA 2RGFA 2GBKA 4LNNA 1C4AA 3HM3A 1NYQA 1WSPA 1QILA 1P98A 2D10A 4NAMA 1QOAA 2MJDA 1SB3C 2WYQA 2AWTA 3OWEB 5BMGA 1MJDA 4XX5A 1WX9A 2KO3A 5HFYA 1R4NI 3P2BA 3V3XA 4YSYB 3U7DA 3AXCA 1YQ3B 2WXQA 4A8XC 4TQ0A 1M4VA 2OJWA 1BT0A 1XO3A 1OQRA 3DWMA 2NMQA 3N30A 5CHVC 5EE9A 1IYFA 3VTVA 3Q14C 4TV3A 1WE6A 1P3QU 3AU5A 2C7HA 2EKIA 4MJSA 1SBBB 4RGNA 3W9CB 3DOWA 4FJYA 2J42A 2KDIA 4EZJA 4EZLA 4AUQC 2V0GA 3RNBC 3VHTC 4AJYB 2L7RA 1SJED 2FUHB 4C00A 1STEA 4XZ4A 3KYCD 1UH6A 2RD0A 2KDBA 1WXQA 4PT5A 3VFKA 1OQQA 2I1JA 4OZCA 4GB9A 3KW5B 3IBEA 3M63B 2KANA 1WR1A 4GDLA 5FR6A 1ESFA 1TS5A 1ZKHA 3AU4A 3RNAC 3QHTA 3U30A 3ZGZA 3BK2A 4ITKA 3DVGY 3DBSA 1WX8A 2KNBA 1QT9A 4WJNA 4HPLB 1CQVA 4K7UA 2CR5A 2L00B 3B0AA 2KVZA 3BYYB 2KWCA 1GC6A 2LVOA 3RULA 3ECIA 5JZEB 2JYEA 1J7CA 3U4EG 2B3AA 1TZOA 5GMVA 3IAS1 2NTTA 1I4PA 3ENEA 4HKQA 3JSVB 4ZRQA 1AARA 3L13A 2JF5A 1S1QB 1MG4A 1XXGA 1SF0A 4MH0E 1WGRA 5T8IA 1X1MA 3LXFA 2C5LC 4ZHOA 2GBRA 4FADA 2E3TA 1D5XC 3IFWB 4JWSC 2GBMA 1V8CA 3U52E 1UZXB 5IN7A 4C4VB 2AL6A 1KRHA 1SE2A 4GDKB 2G45B 1E90A 4F1SA 2ZZPB 4A90A 2D5GA 2WXIA 3AULA 2N9XA 4G50A 3MC8A 2MBHA 2XNAC 2YEPB 4FHJA 1VZ7A 3QX1A 1E9MA 1OEYA 3APDA 3Q3MC 4IKGA 4E3CA 4HCPB 3KUZA 3ETRA 4DHZB 1I7HA 1E8YA 2BYVE 4IWPA 4DWFA 1C78A 1MHXA 2JRHA 2PVOD 3RCZA 5J17A 3X23A 1WIAA 5DPTA 3OAWA 1WGKA 4MJSB 4BKTA 2MA9B 4IWQA 2X8XX 3AH7A 2N7DA 4FHKA 2JZZA 5H92C 2L05A 1T3QA 2CJOA 2IYDB 2LUEA 4KZ0A 1L6UA 1PYWD 3PZDA 1JWAD 2JQRB 1UELA 4EEWA 2MJ3A 1JWBD 3ZXRA 4GIVA 3PGEA 2HD5B 3DWGC 5JHAA 2IPKD 4WWNA 1N5XA 5JHBA 2INDC 4G11A 4WJQA 4RGMA 2KK8A 3DQVA 1WR6E 4W9EA 1HZ6A 2KJ6A 2WWZA 2WDVB 4TSSA 1I4RA 1XLQA 3TBLD 4TQ1A 2WQYB 4QAYA 3L0WB 4CQNA 2K6QA 4XWTA 3AB5A 1MFWA 2G9HD 2LASA 3K9OB 4ICUA 2BQQA 2GI9A 3MJWA 3AE3B 3H7PB 2PJHA 1K51A 2PVGC 2C7MB 1I4HA 4GXBA 2PMVA 2WGSA 2INPE 2KACA 1J8CA 2O6VB 4L23A 2C9WB 3ZNID 3ZO5B 1OEYJ 4RMAA 3KLSX 3UQAA 1T5XD 4RF0A 1T0YA 3Q8BA 2RR9A 2DYOA 4YL8A 2JXXA 2K3UA 2LXCA 1UNSA 1TTNA 4M01A 1P1AA 2J53A 2BYEA 1WGYA 3BWUD 3MC9A 4YT0B 2KDFB 5AUKA 3RI7C 4W9CA 1I42A 2L76A 3CIRB 3X0WA 4O1NA 4M02A 1C9FA 2FCMA 3URYA 3WAOA 4MELA 4WJPA 3Q3JA 4YTPB 3B08A 3ZTDA 2J0KA 2OJRA 2NR2A 1SIJA 2NBUA 2L0FA 2WXKA 3TSSA 1IP9A 1E7PB 4DXAB 2KC2A 2MBOA 4F7ZA 4LTUA 1YX6B 1YJ1A 3H8HA 2ACZB 2NBVB 2KMMA 2WXJA 3WAPA 1Y8RC 4W9KA 2KMAA 2Q5WD 2CU3A 2B76B 1XCQL 3P42A 1TT5B 2X38A 1K52A 3MHSD 4IM0A 3VTUA 1DOIA 2BS2B 1NVID 1UUPA 2G4SA 4NNJB 3KQ4A 4P1BC 4GMVA 2QSDA 3BY4B 2BVCA 5CTRC 2UYZB 5J18A 4DDGD 2JRIB 3L17A 3RMKC 2QC8A 2RDHA 3JVZX 1RWSA 1GB1A 3ZQ4A 4CYEA 5BO4B 3HK0A 1TZ1A 1QOFA 2VZKB 1FNVA 4BFRA 4YWGG 4GN1A 4W9DA 2MEKA 2WNMA 4ZHPA 4II2B 1WYGA 3AM9A 2M4NA 1D5ZC 2FBWB 1T6BX 1V6EA 2YVCA 3DBLI 3VR8B 3BZDB 4B0EA 3WCQA 4LJOB 2KTRA 4PK1A 4GSWA 2A4ZA 2BS4B 3IXSA 2LFIA 4A9AA 4AP4C 4JLCA 2MWSB 4DHJB 1ZDXA 3P4SB 4IW0A 4JPSA 1RLFA 1MVKA 2OOBB 4BOSC 1ZUD2 1IGDA 1V9JA 2RPQA 3KUCB 1XT9B 5IP4D 1V1PB 3AEBB 3VRBB 2JT4B 2NPTB 5DPWA 3GZNB 1V97A 4MSQB 3HM6X 1VRAB 1EU3A 2D11A 4HPMB 1SXTA 2O2VB 3UQBA 2NVUI 2J0MA 1FEHA 1JROA 3R66C 4H2AA 2NBWB 2WS3B 2Z59B 4JGHB 4YTNB 5FR3A 1EM7A 3P4PB 1UWMA 3A9KA 2L1AA 4DHZE 1HA5A 1EWYC 4HXDA 3P4QB 2MX2A 1E0ZA 1FFUA 4A55A 4LK0M 1GG3A 2LHEA 4RM8A 3C19A 3IG3A 3WIMA 4K7WA 2BB6A 4NJCA 2BB5A 2W82A 2OHFA 3IT6B 2BKFA 2WXMA 4W9HA 1BUIC 3VVWB 3ONSA 1EO6A 4YXDB 1TS4A 1L0YB 4M8NA 1HEZE 3GE8C 2KVRA 4N58A 1LQBA 1F0ZA 3T8MA 3NVYA 3DVNU 1E7UA 4KVGB 3V61A 4USAA 1ZPSA 2LEKA 4FJVB 5EE3A 2V9HA 1NEKB 2LGXA 4BVUC 2V4LA 1WMHB 2LD9A 3N32A 3ALBA 5E6JA 1TIFA 2MW5A 5D3DA 3V6EB 2CJNA 3EA6A 4HDOA 4PYUA 2TSSA 4BAXA 1YN3A 1C1YB 3PO0A 1C4CA 1KLGD 2L83A 3HVZA 3PS6A 1V86A 2J7QB 4LNIA 3DBRB 5KHOA 4KGRA 3RD2A 4L1BA 3UIPB 3P63A 3ZNGC 1RFAA 3RNGC 2QILA 2MP2A 1KM7A 3APCA 1FCCC 3ZUNA 2Y5PA 2KTRB 4A20A 3N20C 3I57A 3PREA 2D3CA 3AECB 1SE4A 3M62B 1SE9A 2I1KA 3S2AA 2KQSA 1Z2MA 2UWQA 1WM3A 4DXFA 3PV1A 2GLSA 3DBRI 4TUUA 1ZGUB 2FCSA 1K8RB 3AE5B 3RN9C 3ZDMC 3RYTA 2H88B 1MG8A 3LDZE 1VR9A 1QKZA 1AYFA 4IOIE 4HJKA 2JZ3B 1Q10A 5AZFA 2O6VD 1ZW7A 1C77A 3NRZA 2K22A 4W9JA 4BKSD 4RH6A 1NBFC 4EKUA 2KC1A 3U8ZA 2WXGA 4C7ZA 2ZCBA 4KIKA 2IO3B 3N1YC 2N7JA 4ZYSA 2N9LA 1HTOA 4P1CC 1YMHE 3H9DA 4M8MA 1L4ZB 1WM2A 2GBJA 4K7SA 3HIZA 3Q8FA 3Q2AC 4XC2A 5C23A 1YQ4B 2ZW0A 5E6NA 1AW7A 4OVUA 2DAJA 1V1OA 1WY8A 3MHZA 5H8YE 3EUB2 3TMPB 4HEA1 2DENB 2CS4A 4E74A 4WQMA 4FJZA 4KKJA 1D3ZA 4C56C 1MHHE 2WDQB 2VH2A 1CZPA 2LZ6A 3NVWA 2IO1B 4KZCA 2WX1A 4I6NB 3ML9A 4W9LA 2DZJA 1VJKA 1KFYB 3RUIB 3TEZA 5D94A 3WANA 2PE9A 3V6CB 3V62A 1ZXHA 5IA7A 4MGIE 1UBQA 3AV8A 4K1RB 4M0WA 3L54A 1DOXA 4BKSA 2KJRA 2ON8A 2MQJA 3N1ZC 3PT2B 2K8HA 2HTME 4A3PA 2M0XA 2ZPYA 1SE3A 1R4MB 3GS2A 2MP2B 1FO4A 3U7ZA 1Y56A 3QQ8B 3TUOA 4G3XB 2LVQA 4LNKA 4FULA 1XLPA 4HCNB 3L10B 4LNOA 1Q1OA 1D4BA 1H4RA 4LDTB 3EGRA 4ANWA 4W9IA 2JY6A 1ACCA 5EE1A 1R7SA 2W3RA 3A9JA 4PS8A 3DDCB 5LLIA 4OHJA 4YSZB 3DBHB 4MGYE 1IBXA 3CWIA 1A70A 2V1YA 3T3OA 4XDDA 2KHWB 1S3SG 5CHWA 4AQ7A 2FNJB 3DCGA 1R4MI 3LB8C 2WXFA 3VUYA 4M00A 2K8CA 2K25A 3ZVVA 2WXRA 4JIOU 2RPVA 3PTFC 1NYRA 1H8CA 4K3BA 2JPHA 3QAQA 4N6EB 4UDUC 5G55A 5FK9C 1YJIA 2SAKA 4OZBA 3H7SA 3N3KB 4GDLB 3EHVA 3B9JA 2M17A 4KIKB 1L0VB 3P1MA 1QQRA 3IHPC 3AEFB 4WJOA 1E8ZA 2MBEA 2KDEB 2KWVB 3ABVB 4J3OD 2GB1A 3AE1B 4EE2A 3DPDA 2BYTA 2N9KA 2N4FA 4KSLC 4F8CB 3UI3A 3W1SA 3J9CA 2ZVOA 3FILA 1SJHD 4NY0A 1T0RC 1AWDA 3CMMB 2LWPA 4KGSA 1T0SC 3R7QA 1WF9A 2R2QA 3MP9A 1FMAD 5HKHA 1V80A 3HVDA 1XQQA 2NTSA 2L8JA 2MCNB 3PHXB 4OVZA 3NG0A 1GOZA 2XEWA 4OW0A 1Q0WB 2AQ3B 1RM6C 1KJTA 2BWFA 3Q69A 4IG7B 2KAJA 1I35A 1LM8B 3AE8B 1YN4A 1B1ZA 3QK0A 1WE7A 2CHXA 2KLCA 3AEDB 2N0SB 1FRDA 4EZKA 4IUMB 1C3TA 2BT6A 2N9EB 2M0AA 3QCAA 3NY5A 1TJEA 1WJ6A 2KDMA 3RPFC 2VH1A 3KUDB 1VZ8A 2HE7A 2KFKA 1JALA 4DK5A 3RNFC 2YLMA 1JCKB 2IJ0A 1TKYA 2LJIA 3VUXA 1HTQA 2A5UA 4B0MA 3BVMA 2PIAA 1YNTE 1P0RA 5D7GA 3GP7A 1KLVA 2ONQA 3GOEA 4A3OA 2WU5B 5LXHA 3R7RA 3T3NA 3C0RB 1N60A 5AZGA 1XF5L 2AQ2B 4MM3A 3RZWC 4WURA 3B1LX 1WWTA 3UINB 3DVGX 3PZ8A 2D3BA 2E6XA 1FXIA 3AE2B 2PLPA 1VCBA 1SIFA 1LFDA 1E7VA 1I4XA 3VH3B 1F1HA 1KTKA 1F9JA 2DBYA 1N63A 4XYCA 4YTMB 4NQKE 2RMMA 4GGQA 4NAWA 4II3B 2CHWA 2FCNA 2BTEA 1VZ6A 1QOGA 2BYFA 3BK1A 3EC8A 1L6VA 2GRIA 3E9SA 5TSSA 3Q3OC 2MSED 4WWOA 3ZW3A 2LGIA 3W5VB 1OGWA 2ZVNA 1WXAA 4TMAB 2V3SA 3PRMB 3UGBB 3PVLA 1V81A 1LXDA 1FPYA 1TS3A 3A1QA 2N7EA 3Q3FA 1C4PA 2QCZA 1UGMA 1J19A 1CK1A 2I38A 3AE6B 2Z0EB 4IDIA 3Q3NC 4BOZB 1GC7A 3WA0A 1RAXA 3I9V1 4I6PA 3TL5A 1JWSD 2QEJC 1L4DB 3VDZA 3NS1A 5BYRA 4GLSC 4ARIA 1GPXA 3R2TA 4MEMA 2OEDA 3HUIA 4DDID 5IKCM 3O65B 1TY0A 2KN4A 1C79A 1WGDA 1V5OA 2MJEA 4KKIA 2K6DB 3AMZA 2N1VA 2W3SA 1UGJA 2LUMA 3NZ3A 1WJUA 3OG5A 1FCLA 3L08A 1C76A 2C60A 3RNEC 1I4QA 5DPRA 3VTWA 5EDSA 2MRPA 2KFKB 2MBQA 3ML8A 2G4DB 3SDLC 3SFEB 1FD6A 2LRUA 2L3ZA 3DVNV 3SEBA 2V3NA 2XBBC 3V60A 3GZNI 1DOYA 1GUAB 2ZEQA 2WDRB 4MGZE 4N9F4 1ROEA 2KWUB 1E8XA 1J7AA 3GE3C 2DZMA 1GNUA 1ZOYB 1P9DU 3BVZA 4FLHA 2I2YA 3W1YA 1YOVB 1ZXIA 5AZHA 1E8WA 3VUWA 4NZLB 5CHFA 1GB4A 4HROA 2DNFA 4HKZE 1RRBA 4C80A 4ARCA 1JQ4A 4NAWB 2WDTB 4LDTD 4D2KA 1TYGB 1TKEA 5JH5C 2KN5A 1WZ0A 3L16A 4C7YA 3HHMA 3OLMD 2IGGA 3NVVA 3AE9B 2WXOA 1OTRB 1XD3B 1QLBB 3QARA 5LXIB 1SGHA 2G3QB 1SSNA 2W55A 3M95A 2RDBC 3Q8EA 4WH4A 1R4NB 4US9A 1WGHA 4ZRIA 3UF8A 5BYSA 3FKYA 3ZYYX 1LO5D 3NZUA 2UU7A 2D07B 2PW9A 2K39A 1OFFA 3TJPA 3VRAB 3AN1A 4R3DA 3AEGB 1LGRA 2R61A 3TCAA 4IM2A 5IO9A 2KKCA 3BVGA 4HWIB 1PGXA 2LRWA 3ZTCA 4IC7B 2PPHA 1YQBA 1XLOA 2IBIB 3WAMA 2KOXA 1WFYA 2LGDA 3I63C 4DXGA 3KH0A 4JQWC 5D3IB 2DYBA 5TR5A 1JRPA 1D6EC 1WH3A 1PFDA 3VAWA 2Y3AA 2JSVX 4RCOA 3ZLZA 4P7IA 2DHZA 1T0QC 1QOBA 1KLUD 2QMTA 4P6VF 2CHZA 4BBNF 2DWQA 1V2YA 2WLBA 3EECA 4B95A 3A9KB 4MSMB 5IAAC 2KXJA 4KX6B 2IZVB 1RYJA 2IDYA 1D5MC 1JRUA 1EWCA 1WGGA 4YSXB 1UD7A 3I3TB 4NJ6A 1A5RA 4WAFA 3FAHA 1P7EA 1VLBA 3IT4B 1JW9D 2NCNA 3AI5A 4KGTA 4X57B 3V05A 5G5GA 3NJTA 5L95C 4ANVA 4HDQA 3MJ5A 5BMIA 3VXWA 1FIQA 3ZJUA 3R8BA 5MPOA 2JVCA 3P4RB 3KYDD 1PUTA 2KYWA 2PKOA 3QC8B 1JWMD 3NOBA 1VDVA 3RNCC 1YN5A 2JXTA 1HQRD 2JWZA 1WJNA 5DCNA 3NHEB 3H7PA 2D3GA 2QHOA 4MH8A 2LVPA 2EMTA 3E56A 1L2NA 4ZRPA 2JZPA 1ISNA 1ZP0B
chains in the Genus database with same CATH topology
2INCC 3I63C 4P1CC 3GE8C 3Q3MC 3DHGC 3N20C 3N1XC 3RNEC 2INDC 3GE3C 3RNCC 4P1BC 3RN9C 3N1ZC 1T0RC 3Q2AC 2RDBC 3DHHC 3RMKC 3RNFC 3RNBC 3RNAC 3DHIC 1T0SC 3N1YC 3Q3NC 3RI7C 1T0QC 3I5JC 3Q14C 3RNGC 3Q3OC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2INC C;  3I63 C;  4P1C C;  3GE8 C;  3Q3M C;  3DHG C;  3N20 C;  3N1X C;  3RNE C;  2IND C;  3GE3 C;  3RNC C;  4P1B C;  3RN9 C;  3N1Z C;  1T0R C;  3Q2A C;  2RDB C;  3DHH C;  3RMK C;  3RNF C;  3RNB C;  3RNA C;  3DHI C;  1T0S C;  3N1Y C;  3Q3N C;  3RI7 C;  1T0Q C;  3I5J C;  3Q14 C;  3RNG C;  3Q3O C; 
#chains in the Genus database with same CATH topology
 2O6V A;  3O13 A;  4AOF A;  2V4I B;  1IPG A;  1BML C;  3BIN A;  1KOT A;  3ZIM A;  3U2S C;  2BWE S;  3AE7 B;  4GOC A;  1XCT L;  2K0P A;  2KLG A;  4ZRK A;  1K50 A;  4KV2 A;  2Y5B B;  5I4D A;  5E6O A;  2G1E A;  3SU8 X;  3CSF A;  1TBE A;  5L83 A;  1VD2 A;  2BBC A;  1ET9 A;  1WJ4 A;  1NEN B;  2GMI C;  3TEW A;  4BBN C;  2VRR B;  1DGJ A;  2WHI A;  4FN2 A;  2VZK D;  4ZDV A;  2WXP A;  3DHI C;  3NS8 A;  2AX5 A;  4LJP B;  1DYQ A;  5EE0 A;  3ZJT A;  2QDF A;  4BKG A;  1TKG A;  2M19 A;  5HI1 A;  2K9X A;  4RNA A;  1WZ3 A;  1NI3 A;  3MC0 B;  1L0X B;  1CMX B;  1FNW A;  3GB1 A;  3QA8 A;  2ZPN A;  3PLV A;  1FXA A;  3RZF A;  4HJG E;  2L0T A;  2KWD A;  1WXV A;  2GOW A;  5HHD G;  2FUG 1;  2EMS A;  4N59 A;  1EF1 A;  4DHJ D;  3R3M A;  3KWV A;  4US8 A;  2DZK A;  2JX5 A;  3DBH I;  2FAZ A;  2ZCC A;  1WRD B;  4JX1 C;  2H89 B;  3ZRF A;  1JML A;  3PSE B;  4A6Q A;  2FIF A;  2WXH A;  2WU2 B;  3Q6B A;  2BKR B;  3APF A;  1TGZ B;  4HPP A;  1NDD A;  3KVF B;  2FE8 A;  2PEA A;  4ZRJ A;  1PQS A;  1UBI A;  1IUE A;  4DQO C;  4B6W A;  1FXT B;  4AJW A;  4XE0 A;  2LMC A;  5HG2 A;  2FID A;  1ENF A;  2Z8L A;  1N5W A;  3T9L A;  2PTL A;  1V49 A;  3CF6 E;  3PRZ A;  2W54 A;  1CJE A;  4PYZ A;  1K53 A;  5JXV A;  4CHK A;  5GXG B;  4NJ7 A;  1I4G A;  2AL3 A;  3UIO B;  2IO2 B;  2N9P C;  3TEY A;  4J6I A;  3W2D A;  3PHW B;  4S0R A;  4BZA A;  5G5H A;  2INC C;  2BGF A;  3B2G A;  3OJ3 A;  3ZNH B;  4GU2 A;  4HK2 A;  2BPS A;  2AQ1 B;  2ZJD A;  1E5W A;  4AWJ A;  1HE8 A;  1L7Y A;  3JYU A;  2EKE C;  4DBG A;  1G6J A;  4XDC A;  2IGD A;  1UF0 A;  3HRD D;  4ACF A;  1FFV A;  3ZKJ C;  4W9F A;  4FA6 A;  4M0W B;  1E10 A;  4ICV A;  3ZXV A;  4K3C A;  2LHD A;  3CST A;  2ASQ A;  2IY1 B;  3MFG A;  1E6E B;  1F77 A;  2MHJ A;  2HTH A;  2WXL A;  4WWM A;  1V1P A;  2KTF A;  2WX0 A;  5BMH A;  4P16 A;  4KDI C;  1YX5 B;  3W1S C;  4K81 A;  4MT5 A;  3K9P B;  4CO7 A;  2NPT A;  1FM0 D;  3PRP B;  4FBJ B;  4EFO A;  1P7F A;  2KZR A;  1FNU A;  2JYT A;  4AS1 A;  3ZNZ B;  2IO0 B;  2MLB A;  2INN E;  3A9J B;  3NZS A;  2DZI A;  4WQO B;  4PS7 A;  2LGY A;  2O2V A;  4REZ A;  3A33 B;  1WX7 A;  1OQY A;  1IBX B;  1PGA A;  2ZW1 A;  3EFC A;  2KQ4 X;  1HXY D;  2HJ1 A;  3A4R A;  3L4P A;  1XEE A;  2DLB A;  2IGH A;  2M8S A;  4KSK C;  4B9K A;  1ET6 A;  3SR6 A;  2EEL A;  1N62 A;  3LYY A;  4IWO A;  2BW2 A;  2PE6 B;  4MAC A;  4MGK E;  4HVB A;  1WXM A;  2BF8 B;  3M3J A;  4WIP A;  3LJ3 A;  2L32 A;  3AEA B;  3SFD B;  2HDE A;  3Q8C A;  3QWZ B;  5KHQ A;  1YIW A;  3NUH B;  4XGA B;  2REX A;  5AEK B;  5D6J B;  3VR9 B;  4HRS A;  3SD5 A;  4ZOH C;  2GBN A;  2JU6 X;  4RFB A;  4RGO S;  3EFU A;  1J0G A;  2D3A A;  3QJZ A;  3ZRC A;  5C2T B;  4PS3 A;  5C1Z A;  4ZYN A;  2MH7 A;  2KQ7 A;  5J2R A;  2AYO B;  1KH0 A;  4WWP A;  3C8Y A;  3BII D;  3NVZ A;  2XK5 A;  2JWU A;  2R2O A;  3H6N A;  3DBL B;  1MPE A;  2KJH B;  3AE4 B;  4KDL B;  1QZE A;  2SEB D;  2K1F A;  4EOY A;  3QIJ A;  3FIL B;  1EF5 A;  2W9N A;  1WMH A;  3ZJV A;  2M56 B;  3FC4 A;  4LLG M;  2K5P A;  3SHQ A;  3ZDT A;  3Q8A A;  2L52 A;  2RDG A;  3KWL A;  3RFZ B;  5IOI A;  5C3J B;  4G0N B;  4JE3 B;  2LGS A;  4NQL B;  2M1M A;  1TS2 A;  2DX5 B;  2HJ8 A;  3B2F A;  3VH4 B;  1F2R C;  3I5J C;  2J0J A;  2WP9 B;  3IAM 1;  4I6L B;  2XN9 C;  2Z0D B;  2AEH A;  2V3P A;  5FKA C;  4HLE A;  3DHG C;  4ANX A;  5G2N A;  3D32 A;  4FXC A;  2RSU A;  1XLN A;  1GJZ A;  4RM9 A;  5BYQ A;  1UWX A;  1NI2 A;  1ZE3 D;  1Z5S B;  2K8B A;  1FRR A;  4Q2J A;  2KMC A;  4URK A;  3BYT B;  1N6Z A;  3N1X C;  1IGC A;  2WXN A;  3AEE B;  2ZNV C;  1WYW B;  1EUV B;  2BS3 B;  3IVF A;  3H1U A;  4LNF A;  1HZ5 A;  3W5U B;  3DHH C;  5CX3 A;  1EU4 A;  1MI0 A;  3N9Y C;  2KFJ A;  2FCQ A;  5LNK 1;  1YJJ A;  4EUT A;  4MDK E;  5D2M B;  2LJ5 A;  3WAL A;  2KX0 A;  2J52 A;  1L5P A;  4ANU A;  2KT7 A;  2Y5C A;  1PDX A;  1Q5W B;  4E71 A;  1V5T A;  1AN8 A;  2MBB B;  4RF1 A;  1GAQ B;  4WAA A;  2QIE B;  1RFK A;  2QJL A;  4MM3 B;  2KX3 A;  1PGB A;  4ASW C;  2CU1 A;  4OZA A;  4L2Y A;  4JL9 A;  3PZ7 A;  1BXT A;  2LXA A;  2NS5 A;  3MTN B;  2IY0 B;  3TEX A;  2JUO A;  4OVV A;  4LCD E;  3PLU A;  1WRI A;  1SEB D;  4XWW A;  1ZDV A;  5AUI A;  2DAF A;  5E6P A;  1M94 A;  3PPA A;  2YEP F;  5DPS A;  3TIX A;  1JWU D;  3A4S C;  3JSV A;  2C7N B;  1QF6 A;  3OJ4 B;  1N61 A;  2XK5 B;  1F52 A;  3RT3 B;  4RGT A;  2D2Q A;  1KF6 B;  3R2I A;  4TKN A;  2ZNV B;  1YD8 U;  1F2R I;  1TY2 A;  1WXS A;  2DYM A;  3A1Q B;  4IM3 A;  3VQI A;  2N1W A;  4NPN A;  2KD0 A;  1B9R A;  2ICI A;  2LI5 A;  4JWU C;  4C4V A;  2CKH B;  2J4X A;  1U4A A;  4W9G A;  3JW0 X;  4S17 A;  1WI0 A;  4GDK A;  1J7B A;  2RGF A;  2GBK A;  4LNN A;  1C4A A;  3HM3 A;  1NYQ A;  1WSP A;  1QIL A;  1P98 A;  2D10 A;  4NAM A;  1QOA A;  2MJD A;  1SB3 C;  2WYQ A;  2AWT A;  3OWE B;  5BMG A;  1MJD A;  4XX5 A;  1WX9 A;  2KO3 A;  5HFY A;  1R4N I;  3P2B A;  3V3X A;  4YSY B;  3U7D A;  3AXC A;  1YQ3 B;  2WXQ A;  4A8X C;  4TQ0 A;  1M4V A;  2OJW A;  1BT0 A;  1XO3 A;  1OQR A;  3DWM A;  2NMQ A;  3N30 A;  5CHV C;  5EE9 A;  1IYF A;  3VTV A;  3Q14 C;  4TV3 A;  1WE6 A;  1P3Q U;  3AU5 A;  2C7H A;  2EKI A;  4MJS A;  1SBB B;  4RGN A;  3W9C B;  3DOW A;  4FJY A;  2J42 A;  2KDI A;  4EZJ A;  4EZL A;  4AUQ C;  2V0G A;  3RNB C;  3VHT C;  4AJY B;  2L7R A;  1SJE D;  2FUH B;  4C00 A;  1STE A;  4XZ4 A;  3KYC D;  1UH6 A;  2RD0 A;  2KDB A;  1WXQ A;  4PT5 A;  3VFK A;  1OQQ A;  2I1J A;  4OZC A;  4GB9 A;  3KW5 B;  3IBE A;  3M63 B;  2KAN A;  1WR1 A;  4GDL A;  5FR6 A;  1ESF A;  1TS5 A;  1ZKH A;  3AU4 A;  3RNA C;  3QHT A;  3U30 A;  3ZGZ A;  3BK2 A;  4ITK A;  3DVG Y;  3DBS A;  1WX8 A;  2KNB A;  1QT9 A;  4WJN A;  4HPL B;  1CQV A;  4K7U A;  2CR5 A;  2L00 B;  3B0A A;  2KVZ A;  3BYY B;  2KWC A;  1GC6 A;  2LVO A;  3RUL A;  3ECI A;  5JZE B;  2JYE A;  1J7C A;  3U4E G;  2B3A A;  1TZO A;  5GMV A;  3IAS 1;  2NTT A;  1I4P A;  3ENE A;  4HKQ A;  3JSV B;  4ZRQ A;  1AAR A;  3L13 A;  2JF5 A;  1S1Q B;  1MG4 A;  1XXG A;  1SF0 A;  4MH0 E;  1WGR A;  5T8I A;  1X1M A;  3LXF A;  2C5L C;  4ZHO A;  2GBR A;  4FAD A;  2E3T A;  1D5X C;  3IFW B;  4JWS C;  2GBM A;  1V8C A;  3U52 E;  1UZX B;  5IN7 A;  4C4V B;  2AL6 A;  1KRH A;  1SE2 A;  4GDK B;  2G45 B;  1E90 A;  4F1S A;  2ZZP B;  4A90 A;  2D5G A;  2WXI A;  3AUL A;  2N9X A;  4G50 A;  3MC8 A;  2MBH A;  2XNA C;  2YEP B;  4FHJ A;  1VZ7 A;  3QX1 A;  1E9M A;  1OEY A;  3APD A;  3Q3M C;  4IKG A;  4E3C A;  4HCP B;  3KUZ A;  3ETR A;  4DHZ B;  1I7H A;  1E8Y A;  2BYV E;  4IWP A;  4DWF A;  1C78 A;  1MHX A;  2JRH A;  2PVO D;  3RCZ A;  5J17 A;  3X23 A;  1WIA A;  5DPT A;  3OAW A;  1WGK A;  4MJS B;  4BKT A;  2MA9 B;  4IWQ A;  2X8X X;  3AH7 A;  2N7D A;  4FHK A;  2JZZ A;  5H92 C;  2L05 A;  1T3Q A;  2CJO A;  2IYD B;  2LUE A;  4KZ0 A;  1L6U A;  1PYW D;  3PZD A;  1JWA D;  2JQR B;  1UEL A;  4EEW A;  2MJ3 A;  1JWB D;  3ZXR A;  4GIV A;  3PGE A;  2HD5 B;  3DWG C;  5JHA A;  2IPK D;  4WWN A;  1N5X A;  5JHB A;  2IND C;  4G11 A;  4WJQ A;  4RGM A;  2KK8 A;  3DQV A;  1WR6 E;  4W9E A;  1HZ6 A;  2KJ6 A;  2WWZ A;  2WDV B;  4TSS A;  1I4R A;  1XLQ A;  3TBL D;  4TQ1 A;  2WQY B;  4QAY A;  3L0W B;  4CQN A;  2K6Q A;  4XWT A;  3AB5 A;  1MFW A;  2G9H D;  2LAS A;  3K9O B;  4ICU A;  2BQQ A;  2GI9 A;  3MJW A;  3AE3 B;  3H7P B;  2PJH A;  1K51 A;  2PVG C;  2C7M B;  1I4H A;  4GXB A;  2PMV A;  2WGS A;  2INP E;  2KAC A;  1J8C A;  2O6V B;  4L23 A;  2C9W B;  3ZNI D;  3ZO5 B;  1OEY J;  4RMA A;  3KLS X;  3UQA A;  1T5X D;  4RF0 A;  1T0Y A;  3Q8B A;  2RR9 A;  2DYO A;  4YL8 A;  2JXX A;  2K3U A;  2LXC A;  1UNS A;  1TTN A;  4M01 A;  1P1A A;  2J53 A;  2BYE A;  1WGY A;  3BWU D;  3MC9 A;  4YT0 B;  2KDF B;  5AUK A;  3RI7 C;  4W9C A;  1I42 A;  2L76 A;  3CIR B;  3X0W A;  4O1N A;  4M02 A;  1C9F A;  2FCM A;  3URY A;  3WAO A;  4MEL A;  4WJP A;  3Q3J A;  4YTP B;  3B08 A;  3ZTD A;  2J0K A;  2OJR A;  2NR2 A;  1SIJ A;  2NBU A;  2L0F A;  2WXK A;  3TSS A;  1IP9 A;  1E7P B;  4DXA B;  2KC2 A;  2MBO A;  4F7Z A;  4LTU A;  1YX6 B;  1YJ1 A;  3H8H A;  2ACZ B;  2NBV B;  2KMM A;  2WXJ A;  3WAP A;  1Y8R C;  4W9K A;  2KMA A;  2Q5W D;  2CU3 A;  2B76 B;  1XCQ L;  3P42 A;  1TT5 B;  2X38 A;  1K52 A;  3MHS D;  4IM0 A;  3VTU A;  1DOI A;  2BS2 B;  1NVI D;  1UUP A;  2G4S A;  4NNJ B;  3KQ4 A;  4P1B C;  4GMV A;  2QSD A;  3BY4 B;  2BVC A;  5CTR C;  2UYZ B;  5J18 A;  4DDG D;  2JRI B;  3L17 A;  3RMK C;  2QC8 A;  2RDH A;  3JVZ X;  1RWS A;  1GB1 A;  3ZQ4 A;  4CYE A;  5BO4 B;  3HK0 A;  1TZ1 A;  1QOF A;  2VZK B;  1FNV A;  4BFR A;  4YWG G;  4GN1 A;  4W9D A;  2MEK A;  2WNM A;  4ZHP A;  4II2 B;  1WYG A;  3AM9 A;  2M4N A;  1D5Z C;  2FBW B;  1T6B X;  1V6E A;  2YVC A;  3DBL I;  3VR8 B;  3BZD B;  4B0E A;  3WCQ A;  4LJO B;  2KTR A;  4PK1 A;  4GSW A;  2A4Z A;  2BS4 B;  3IXS A;  2LFI A;  4A9A A;  4AP4 C;  4JLC A;  2MWS B;  4DHJ B;  1ZDX A;  3P4S B;  4IW0 A;  4JPS A;  1RLF A;  1MVK A;  2OOB B;  4BOS C;  1ZUD 2;  1IGD A;  1V9J A;  2RPQ A;  3KUC B;  1XT9 B;  5IP4 D;  1V1P B;  3AEB B;  3VRB B;  2JT4 B;  2NPT B;  5DPW A;  3GZN B;  1V97 A;  4MSQ B;  3HM6 X;  1VRA B;  1EU3 A;  2D11 A;  4HPM B;  1SXT A;  2O2V B;  3UQB A;  2NVU I;  2J0M A;  1FEH A;  1JRO A;  3R66 C;  4H2A A;  2NBW B;  2WS3 B;  2Z59 B;  4JGH B;  4YTN B;  5FR3 A;  1EM7 A;  3P4P B;  1UWM A;  3A9K A;  2L1A A;  4DHZ E;  1HA5 A;  1EWY C;  4HXD A;  3P4Q B;  2MX2 A;  1E0Z A;  1FFU A;  4A55 A;  4LK0 M;  1GG3 A;  2LHE A;  4RM8 A;  3C19 A;  3IG3 A;  3WIM A;  4K7W A;  2BB6 A;  4NJC A;  2BB5 A;  2W82 A;  2OHF A;  3IT6 B;  2BKF A;  2WXM A;  4W9H A;  1BUI C;  3VVW B;  3ONS A;  1EO6 A;  4YXD B;  1TS4 A;  1L0Y B;  4M8N A;  1HEZ E;  3GE8 C;  2KVR A;  4N58 A;  1LQB A;  1F0Z A;  3T8M A;  3NVY A;  3DVN U;  1E7U A;  4KVG B;  3V61 A;  4USA A;  1ZPS A;  2LEK A;  4FJV B;  5EE3 A;  2V9H A;  1NEK B;  2LGX A;  4BVU C;  2V4L A;  1WMH B;  2LD9 A;  3N32 A;  3ALB A;  5E6J A;  1TIF A;  2MW5 A;  5D3D A;  3V6E B;  2CJN A;  3EA6 A;  4HDO A;  4PYU A;  2TSS A;  4BAX A;  1YN3 A;  1C1Y B;  3PO0 A;  1C4C A;  1KLG D;  2L83 A;  3HVZ A;  3PS6 A;  1V86 A;  2J7Q B;  4LNI A;  3DBR B;  5KHO A;  4KGR A;  3RD2 A;  4L1B A;  3UIP B;  3P63 A;  3ZNG C;  1RFA A;  3RNG C;  2QIL A;  2MP2 A;  1KM7 A;  3APC A;  1FCC C;  3ZUN A;  2Y5P A;  2KTR B;  4A20 A;  3N20 C;  3I57 A;  3PRE A;  2D3C A;  3AEC B;  1SE4 A;  3M62 B;  1SE9 A;  2I1K A;  3S2A A;  2KQS A;  1Z2M A;  2UWQ A;  1WM3 A;  4DXF A;  3PV1 A;  2GLS A;  3DBR I;  4TUU A;  1ZGU B;  2FCS A;  1K8R B;  3AE5 B;  3RN9 C;  3ZDM C;  3RYT A;  2H88 B;  1MG8 A;  3LDZ E;  1VR9 A;  1QKZ A;  1AYF A;  4IOI E;  4HJK A;  2JZ3 B;  1Q10 A;  5AZF A;  2O6V D;  1ZW7 A;  1C77 A;  3NRZ A;  2K22 A;  4W9J A;  4BKS D;  4RH6 A;  1NBF C;  4EKU A;  2KC1 A;  3U8Z A;  2WXG A;  4C7Z A;  2ZCB A;  4KIK A;  2IO3 B;  3N1Y C;  2N7J A;  4ZYS A;  2N9L A;  1HTO A;  4P1C C;  1YMH E;  3H9D A;  4M8M A;  1L4Z B;  1WM2 A;  2GBJ A;  4K7S A;  3HIZ A;  3Q8F A;  3Q2A C;  4XC2 A;  5C23 A;  1YQ4 B;  2ZW0 A;  5E6N A;  1AW7 A;  4OVU A;  2DAJ A;  1V1O A;  1WY8 A;  3MHZ A;  5H8Y E;  3EUB 2;  3TMP B;  4HEA 1;  2DEN B;  2CS4 A;  4E74 A;  4WQM A;  4FJZ A;  4KKJ A;  1D3Z A;  4C56 C;  1MHH E;  2WDQ B;  2VH2 A;  1CZP A;  2LZ6 A;  3NVW A;  2IO1 B;  4KZC A;  2WX1 A;  4I6N B;  3ML9 A;  4W9L A;  2DZJ A;  1VJK A;  1KFY B;  3RUI B;  3TEZ A;  5D94 A;  3WAN A;  2PE9 A;  3V6C B;  3V62 A;  1ZXH A;  5IA7 A;  4MGI E;  1UBQ A;  3AV8 A;  4K1R B;  4M0W A;  3L54 A;  1DOX A;  4BKS A;  2KJR A;  2ON8 A;  2MQJ A;  3N1Z C;  3PT2 B;  2K8H A;  2HTM E;  4A3P A;  2M0X A;  2ZPY A;  1SE3 A;  1R4M B;  3GS2 A;  2MP2 B;  1FO4 A;  3U7Z A;  1Y56 A;  3QQ8 B;  3TUO A;  4G3X B;  2LVQ A;  4LNK A;  4FUL A;  1XLP A;  4HCN B;  3L10 B;  4LNO A;  1Q1O A;  1D4B A;  1H4R A;  4LDT B;  3EGR A;  4ANW A;  4W9I A;  2JY6 A;  1ACC A;  5EE1 A;  1R7S A;  2W3R A;  3A9J A;  4PS8 A;  3DDC B;  5LLI A;  4OHJ A;  4YSZ B;  3DBH B;  4MGY E;  1IBX A;  3CWI A;  1A70 A;  2V1Y A;  3T3O A;  4XDD A;  2KHW B;  1S3S G;  5CHW A;  4AQ7 A;  2FNJ B;  3DCG A;  1R4M I;  3LB8 C;  2WXF A;  3VUY A;  4M00 A;  2K8C A;  2K25 A;  3ZVV A;  2WXR A;  4JIO U;  2RPV A;  3PTF C;  1NYR A;  1H8C A;  4K3B A;  2JPH A;  3QAQ A;  4N6E B;  4UDU C;  5G55 A;  5FK9 C;  1YJI A;  2SAK A;  4OZB A;  3H7S A;  3N3K B;  4GDL B;  3EHV A;  3B9J A;  2M17 A;  4KIK B;  1L0V B;  3P1M A;  1QQR A;  3IHP C;  3AEF B;  4WJO A;  1E8Z A;  2MBE A;  2KDE B;  2KWV B;  3ABV B;  4J3O D;  2GB1 A;  3AE1 B;  4EE2 A;  3DPD A;  2BYT A;  2N9K A;  2N4F A;  4KSL C;  4F8C B;  3UI3 A;  3W1S A;  3J9C A;  2ZVO A;  3FIL A;  1SJH D;  4NY0 A;  1T0R C;  1AWD A;  3CMM B;  2LWP A;  4KGS A;  1T0S C;  3R7Q A;  1WF9 A;  2R2Q A;  3MP9 A;  1FMA D;  5HKH A;  1V80 A;  3HVD A;  1XQQ A;  2NTS A;  2L8J A;  2MCN B;  3PHX B;  4OVZ A;  3NG0 A;  1GOZ A;  2XEW A;  4OW0 A;  1Q0W B;  2AQ3 B;  1RM6 C;  1KJT A;  2BWF A;  3Q69 A;  4IG7 B;  2KAJ A;  1I35 A;  1LM8 B;  3AE8 B;  1YN4 A;  1B1Z A;  3QK0 A;  1WE7 A;  2CHX A;  2KLC A;  3AED B;  2N0S B;  1FRD A;  4EZK A;  4IUM B;  1C3T A;  2BT6 A;  2N9E B;  2M0A A;  3QCA A;  3NY5 A;  1TJE A;  1WJ6 A;  2KDM A;  3RPF C;  2VH1 A;  3KUD B;  1VZ8 A;  2HE7 A;  2KFK A;  1JAL A;  4DK5 A;  3RNF C;  2YLM A;  1JCK B;  2IJ0 A;  1TKY A;  2LJI A;  3VUX A;  1HTQ A;  2A5U A;  4B0M A;  3BVM A;  2PIA A;  1YNT E;  1P0R A;  5D7G A;  3GP7 A;  1KLV A;  2ONQ A;  3GOE A;  4A3O A;  2WU5 B;  5LXH A;  3R7R A;  3T3N A;  3C0R B;  1N60 A;  5AZG A;  1XF5 L;  2AQ2 B;  4MM3 A;  3RZW C;  4WUR A;  3B1L X;  1WWT A;  3UIN B;  3DVG X;  3PZ8 A;  2D3B A;  2E6X A;  1FXI A;  3AE2 B;  2PLP A;  1VCB A;  1SIF A;  1LFD A;  1E7V A;  1I4X A;  3VH3 B;  1F1H A;  1KTK A;  1F9J A;  2DBY A;  1N63 A;  4XYC A;  4YTM B;  4NQK E;  2RMM A;  4GGQ A;  4NAW A;  4II3 B;  2CHW A;  2FCN A;  2BTE A;  1VZ6 A;  1QOG A;  2BYF A;  3BK1 A;  3EC8 A;  1L6V A;  2GRI A;  3E9S A;  5TSS A;  3Q3O C;  2MSE D;  4WWO A;  3ZW3 A;  2LGI A;  3W5V B;  1OGW A;  2ZVN A;  1WXA A;  4TMA B;  2V3S A;  3PRM B;  3UGB B;  3PVL A;  1V81 A;  1LXD A;  1FPY A;  1TS3 A;  3A1Q A;  2N7E A;  3Q3F A;  1C4P A;  2QCZ A;  1UGM A;  1J19 A;  1CK1 A;  2I38 A;  3AE6 B;  2Z0E B;  4IDI A;  3Q3N C;  4BOZ B;  1GC7 A;  3WA0 A;  1RAX A;  3I9V 1;  4I6P A;  3TL5 A;  1JWS D;  2QEJ C;  1L4D B;  3VDZ A;  3NS1 A;  5BYR A;  4GLS C;  4ARI A;  1GPX A;  3R2T A;  4MEM A;  2OED A;  3HUI A;  4DDI D;  5IKC M;  3O65 B;  1TY0 A;  2KN4 A;  1C79 A;  1WGD A;  1V5O A;  2MJE A;  4KKI A;  2K6D B;  3AMZ A;  2N1V A;  2W3S A;  1UGJ A;  2LUM A;  3NZ3 A;  1WJU A;  3OG5 A;  1FCL A;  3L08 A;  1C76 A;  2C60 A;  3RNE C;  1I4Q A;  5DPR A;  3VTW A;  5EDS A;  2MRP A;  2KFK B;  2MBQ A;  3ML8 A;  2G4D B;  3SDL C;  3SFE B;  1FD6 A;  2LRU A;  2L3Z A;  3DVN V;  3SEB A;  2V3N A;  2XBB C;  3V60 A;  3GZN I;  1DOY A;  1GUA B;  2ZEQ A;  2WDR B;  4MGZ E;  4N9F 4;  1ROE A;  2KWU B;  1E8X A;  1J7A A;  3GE3 C;  2DZM A;  1GNU A;  1ZOY B;  1P9D U;  3BVZ A;  4FLH A;  2I2Y A;  3W1Y A;  1YOV B;  1ZXI A;  5AZH A;  1E8W A;  3VUW A;  4NZL B;  5CHF A;  1GB4 A;  4HRO A;  2DNF A;  4HKZ E;  1RRB A;  4C80 A;  4ARC A;  1JQ4 A;  4NAW B;  2WDT B;  4LDT D;  4D2K A;  1TYG B;  1TKE A;  5JH5 C;  2KN5 A;  1WZ0 A;  3L16 A;  4C7Y A;  3HHM A;  3OLM D;  2IGG A;  3NVV A;  3AE9 B;  2WXO A;  1OTR B;  1XD3 B;  1QLB B;  3QAR A;  5LXI B;  1SGH A;  2G3Q B;  1SSN A;  2W55 A;  3M95 A;  2RDB C;  3Q8E A;  4WH4 A;  1R4N B;  4US9 A;  1WGH A;  4ZRI A;  3UF8 A;  5BYS A;  3FKY A;  3ZYY X;  1LO5 D;  3NZU A;  2UU7 A;  2D07 B;  2PW9 A;  2K39 A;  1OFF A;  3TJP A;  3VRA B;  3AN1 A;  4R3D A;  3AEG B;  1LGR A;  2R61 A;  3TCA A;  4IM2 A;  5IO9 A;  2KKC A;  3BVG A;  4HWI B;  1PGX A;  2LRW A;  3ZTC A;  4IC7 B;  2PPH A;  1YQB A;  1XLO A;  2IBI B;  3WAM A;  2KOX A;  1WFY A;  2LGD A;  3I63 C;  4DXG A;  3KH0 A;  4JQW C;  5D3I B;  2DYB A;  5TR5 A;  1JRP A;  1D6E C;  1WH3 A;  1PFD A;  3VAW A;  2Y3A A;  2JSV X;  4RCO A;  3ZLZ A;  4P7I A;  2DHZ A;  1T0Q C;  1QOB A;  1KLU D;  2QMT A;  4P6V F;  2CHZ A;  4BBN F;  2DWQ A;  1V2Y A;  2WLB A;  3EEC A;  4B95 A;  3A9K B;  4MSM B;  5IAA C;  2KXJ A;  4KX6 B;  2IZV B;  1RYJ A;  2IDY A;  1D5M C;  1JRU A;  1EWC A;  1WGG A;  4YSX B;  1UD7 A;  3I3T B;  4NJ6 A;  1A5R A;  4WAF A;  3FAH A;  1P7E A;  1VLB A;  3IT4 B;  1JW9 D;  2NCN A;  3AI5 A;  4KGT A;  4X57 B;  3V05 A;  5G5G A;  3NJT A;  5L95 C;  4ANV A;  4HDQ A;  3MJ5 A;  5BMI A;  3VXW A;  1FIQ A;  3ZJU A;  3R8B A;  5MPO A;  2JVC A;  3P4R B;  3KYD D;  1PUT A;  2KYW A;  2PKO A;  3QC8 B;  1JWM D;  3NOB A;  1VDV A;  3RNC C;  1YN5 A;  2JXT A;  1HQR D;  2JWZ A;  1WJN A;  5DCN A;  3NHE B;  3H7P A;  2D3G A;  2QHO A;  4MH8 A;  2LVP A;  2EMT A;  3E56 A;  1L2N A;  4ZRP A;  2JZP A;  1ISN A;  1ZP0 B; 
#chains in the Genus database with same CATH homology
 2INC C;  3I63 C;  4P1C C;  3GE8 C;  3Q3M C;  3DHG C;  3N20 C;  3N1X C;  3RNE C;  2IND C;  3GE3 C;  3RNC C;  4P1B C;  3RN9 C;  3N1Z C;  1T0R C;  3Q2A C;  2RDB C;  3DHH C;  3RMK C;  3RNF C;  3RNB C;  3RNA C;  3DHI C;  1T0S C;  3N1Y C;  3Q3N C;  3RI7 C;  1T0Q C;  3I5J C;  3Q14 C;  3RNG C;  3Q3O C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...