4P1CC

Crystal structure of the toluene 4-monooxygenase hydroxylase-ferredoxin c7s, c84a, c85a variant electron-transfer complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
82
structure length
82
Chain Sequence
SAFPVHAAFEKDFLVQLVVVDLNDSMDQVAEKVAYHCVNRRVAPREGVMRVRKHRSTELFPRDMTIAESGLNPTEVIDVVFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toluene-4-monooxygenase system protein A
publication title Structural basis for biomolecular recognition in overlapping binding sites in a diiron enzyme system.
pubmed doi rcsb
source organism Pseudomonas mendocina
molecule tags Oxidoreductase
total genus 25
structure length 82
sequence length 82
chains with identical sequence F
ec nomenclature ec 1.14.13.236: Toluene 4-monooxygenase.
pdb deposition date 2014-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 4p1cC00
2INDC 3Q2AC 3RMKC 3RNEC 3RNBC 1T0RC 3Q3NC 3GE3C 3N1YC 3DHHC 3DHGC 3I63C 3RNCC 2RDBC 3GE8C 3I5JC 3Q14C 3RI7C 4P1BC 3RNAC 3Q3MC 3DHIC 4P1CC 1T0QC 3N1ZC 3RNGC 3RN9C 2INCC 3RNFC 3N20C 3N1XC 3Q3OC 1T0SC
chains in the Genus database with same CATH superfamily
1FEHA 3L13A 1SF0A 1HEZE 4JL9A 4MELA 2KKCA 2C7MB 3MJ5A 1V6EA 3ZKJC 5JZEB 4ANVA 1P98A 3T3NA 1HQRD 4M0WB 4JQWC 1ZE3D 1XO3A 4WAFA 3NVZA 1L0VB 3K9PB 3FILA 3SHQA 4RF0A 2BGFA 3VTUA 1VJKA 4ZYSA 1TKGA 4WH4A 5H8YE 2JZZA 4A8XC 4FADA 1JWSD 1ZPSA 3DHGC 3TEXA 4OVVA 4TQ1A 2FE8A 4NPNA 1L4DB 2AWTA 2XK5A 2ZNVC 3CSFA 3A33B 4MGZE 1OEYA 1XLQA 3AU5A 4ZYNA 1Y56A 4KSKC 2KFJA 2V0GA 2WXKA 2WXNA 4NNJB 3TIXA 1WZ0A 2KO3A 1HZ6A 3SFDB 1YQBA 1IPGA 4IUMB 3NZSA 2KTRA 5AZHA 4B9KA 3OG5A 1E5WA 5BYRA 4XWWA 3ZW3A 2K25A 3U8ZA 4II3B 1KM7A 2EKIA 5L95C 2LGDA 1KH0A 3KVFB 2O6VD 2YLMA 1UF0A 3X0WA 3A9KB 2W54A 1TGZB 1L4ZB 2GBMA 3VRAB 3VH3B 1HA5A 4MM3A 4RNAA 1SJED 3AE6B 2FUHB 2LD9A 2N9EB 4EFOA 1VD2A 2M19A 4RM8A 1F2RI 2MQJA 3LJ3A 2FBWB 2ZW1A 3UI3A 3PO0A 4WJOA 3AB5A 1WR6E 3PTFC 2RR9A 1H4RA 1DOIA 4WAAA 2O2VB 1MVKA 2D2QA 2MBEA 1KF6B 3NS8A 4OZCA 4DHJD 3L54A 1XF5L 2NBUA 1N63A 3C0RB 4LNKA 2IGHA 3KH0A 3FILB 5FKAC 3RFZB 3PS6A 2V3NA 1QT9A 2N1WA 2MJEA 4W9HA 1NDDA 4M00A 4KGSA 4HDOA 2Z59B 3ALBA 3C8YA 3SR6A 3H8HA 2NBWB 3Q3NC 2M0AA 4P7IA 1UELA 3VUYA 4OZAA 2XK5B 4HCNB 2SEBD 3VRBB 1Z5SB 1XD3B 2C7HA 4A6QA 1OQRA 2LHEA 2ACZB 3RUIB 3DWMA 4LNOA 2KX3A 2L00B 3DBLB 4IKGA 4IC7B 3AXCA 1WE7A 2KQ4X 4BOZB 5H92C 1V49A 1OEYJ 3GZNB 2KMAA 5BMIA 1VZ8A 1VLBA 4P1BC 3EGRA 2N1VA 2J4XA 4C00A 4GU2A 1ESFA 2M8SA 2N9LA 5C23A 2L05A 2Z0EB 2RDGA 4JPSA 2HJ8A 4WJQA 3NOBA 2Y5CA 5G55A 1I35A 2ZPYA 2CJOA 4GDLB 4G0NB 3DHIC 3NG0A 4M02A 1E8ZA 2DWQA 1IP9A 3ZIMA 2BTEA 2JSVX 5T8IA 3ZGZA 4ITKA 2IBIB 1R4MB 3SFEB 3ZNHB 3PRPB 5HG2A 1UWXA 3T3OA 4TSSA 1KLUD 3RNEC 2N7DA 3ZDMC 5BYSA 3KUCB 2WXFA 4PT5A 2NPTA 4LLGM 4KDLB 2K39A 1MHXA 2HJ1A 1KLGD 2L7RA 4KSLC 4JGHB 2WDTB 4US8A 2BS4B 3B08A 1WYWB 2L0TA 1PQSA 1XLPA 3CWIA 1J7BA 1FFUA 3Q8EA 2KLCA 2JUOA 1KRHA 4BAXA 1NENB 5G2NA 4RMAA 4MGKE 5DPWA 4WQOB 2INNE 3JSVA 1WX9A 4WWNA 2WXRA 4XE0A 5EE1A 2W9NA 1Q10A 4K7UA 2GB1A 4EZLA 4IWPA 1SE2A 2FIDA 4XYCA 1DOYA 1ENFA 1QZEA 1SB3C 1F2RC 2WU5B 2NS5A 2FAZA 2EMTA 4FXCA 3Q8CA 3VHTC 3RT3B 1TS4A 2IO0B 2VH1A 1P7FA 3WIMA 1ZDXA 3KW5B 5IP4D 4LCDE 2KMCA 3PVLA 1YJ1A 4L23A 3CSTA 5D6JB 1V1OA 3OAWA 3KYCD 2G1EA 4II2B 5DPRA 1SJHD 3UGBB 4BKGA 2WXMA 3W5VB 2G4DB 2G9HD 1X1MA 2DAJA 1FCCC 1VZ7A 4PYUA 2KFKA 4E74A 2PE6B 1LQBA 1WR1A 3VTWA 3MJWA 2Y3AA 2L83A 5AUKA 3ZQ4A 1YIWA 3AEDB 1NYRA 3K9OB 1UBQA 3GB1A 2BBCA 2I1KA 3D32A 1RWSA 1EU4A 4MGIE 1WZ3A 1GC6A 4F8CB 4HROA 4RGNA 2BS2B 2REXA 4AJWA 2LI5A 3BK2A 4HJGE 1JQ4A 5IO9A 2IJ0A 2AQ1B 1PDXA 1K8RB 1TS3A 4RGTA 1OQYA 1N62A 3I9V1 1C3TA 1WI0A 2WXJA 1JRUA 4IDIA 3AEGB 5FR6A 3NUHB 4ZRQA 4RH6A 1GC7A 3WAMA 4HKZE 4CYEA 3N1XC 3AECB 1I4GA 4FJYA 4DXFA 3W9CB 3BVMA 4ANXA 2PTLA 1JWAD 2PVGC 5CHVC 2OEDA 4Q2JA 1J0GA 3Q8FA 3W2DA 1QOFA 4BBNF 3I5JC 4A3OA 2M56B 1WXSA 3DBHI 5EDSA 3BIID 2K5PA 1SEBD 4K7WA 1B9RA 4JX1C 4M8MA 4C80A 3UIPB 4LJPB 3ZRFA 4AWJA 1QOGA 3RNBC 2PVOD 2J0KA 1BT0A 2ZPNA 1LGRA 4MEMA 2MW5A 3ZNGC 4NZLB 2QHOA 4O1NA 1SIJA 3RNAC 4HRSA 1VRAB 3WAPA 2N9XA 2INCC 1C77A 3H1UA 2R61A 2CU3A 4KZ0A 3DPDA 2MLBA 2RPVA 3VQIA 1XT9B 2D3CA 3IBEA 2CS4A 1K53A 1C79A 2N7JA 2GBRA 1V5OA 2MP2B 2I2YA 3J9CA 3VR8B 2WXOA 1GPXA 3RD2A 2OJRA 2JRIB 1RFKA 2BW2A 2KVRA 4WIPA 1T5XD 2RD0A 3P42A 3HRDD 2V3PA 3NVWA 5L83A 2D11A 5G5HA 2PE9A 1CK1A 4WQMA 1QILA 2YEPF 1V5TA 4HXDA 2M0XA 2LWPA 3IAM1 1UGJA 2QEJC 3OJ4B 3HIZA 2WXHA 4BKTA 1A5RA 2KWVB 1TS2A 2NTTA 3CF6E 1ROEA 3ML9A 4HPMB 4HWIB 3L4PA 3W5UB 2O6VB 1WRDB 3HUIA 1D3ZA 2BVCA 4N9F4 1ISNA 3B9JA 4EUTA 1IGCA 2LMCA 3HVDA 3EECA 1E8WA 1L5PA 4REZA 2R2QA 2OJWA 1NI2A 3PRZA 2MH7A 4KIKB 1TBEA 3QX1A 4HPLB 4IG7B 2KJHB 3EHVA 1VZ6A 3W1SC 4OZBA 1G6JA 3AE7B 4G3XB 4J6IA 1V1PB 2WWZA 5GMVA 4JLCA 2WXGA 1T3QA 3RPFC 2NR2A 4S17A 3V60A 2K22A 2NBVB 2ZCCA 1YX5B 4DXGA 4A3PA 5IA7A 3ZXVA 1E8YA 2WS3B 3U52E 1WGYA 4DHJB 1C4AA 3ZJTA 4ZRKA 1AN8A 2PEAA 1AW7A 2DBYA 4HCPB 3H7PA 1GB4A 1Y8RC 3ENEA 1WX8A 4H2AA 3VFKA 1P7EA 2KN4A 2CHWA 4AUQC 3BWUD 3N20C 1XLNA 4CO7A 4L1BA 2BS3B 2DYOA 2K8BA 1OQQA 2C9WB 1WJUA 2ZZPB 3GE3C 1JW9D 3RNCC 1KOTA 3DBRB 4I6PA 4B0MA 5E6PA 4IM2A 2OOBB 3MP9A 3R2TA 1ZUD2 2WDRB 2C7NB 1Q5WB 3KYDD 2LFIA 3P4PB 4WWMA 1MFWA 4FHJA 3TEWA 3Q69A 4XDDA 4ICVA 4KVGB 1F77A 1E9MA 2RPQA 4ZDVA 2LHDA 4DHZE 3QAQA 3I63C 3VVWB 1FXTB 1EU3A 3R7QA 1VDVA 1EF5A 4JWUC 2MBBB 2JX5A 1JRPA 2D3BA 3V3XA 2BQQA 3AM9A 3WALA 4F7ZA 1DYQA 4FLHA 4AQ7A 3KUDB 2KC2A 3DVGY 1MPEA 3A9JB 5BO4B 2RMMA 2LASA 2B76B 1N5WA 1OFFA 2BB6A 5HHDG 2W82A 4YTNB 2AYOB 2QIEB 4GDKA 4FHKA 1J7AA 1ET6A 3QJZA 5I4DA 1D5MC 2FUG1 1WWTA 4GIVA 3EC8A 2XBBC 4RF1A 2PMVA 5KHOA 3HK0A 1I4RA 3ZYYX 5J17A 4RGOS 1E7UA 3CMMB 3NZ3A 1LFDA 4GOCA 1EF1A 1EWYC 1JWMD 3RMKC 2INPE 2WDVB 2KACA 3AV8A 2WQYB 2Q5WD 3NY5A 2KJ6A 2XEWA 4A20A 3BYTB 3OLMD 1UD7A 2BKFA 5TSSA 4AJYB 2IO3B 1WXAA 2MCNB 4WURA 1FXIA 3QC8B 4W9GA 1I4PA 5EE0A 4K1RB 3QARA 2KDEB 4ASWC 4HK2A 3URYA 2KVZA 1PFDA 1FCLA 3O65B 3NHEB 3ZJVA 2OHFA 4BFRA 2WXLA 2GMIC 3ML8A 3W1SA 2BPSA 2C5LC 2QILA 4OHJA 2AL3A 1ZGUB 1WF9A 4X57B 1WMHA 1ZKHA 1J7CA 4YTPB 3IT4B 1GUAB 2KNBA 4XC2A 2JXTA 2KDFB 1T0RC 5IOIA 2AEHA 4ARIA 3LYYA 2YEPB 4IOIE 2KDIA 3KUZA 3ZUNA 2KTRB 2ZEQA 2LJ5A 4GLSC 5AUIA 5LXHA 1WGGA 4HJKA 1SIFA 1C76A 1Q1OA 5HFYA 2IO2B 4ZRJA 1K50A 1XCTL 1WYGA 1OTRB 2D5GA 1V81A 1NVID 1UWMA 2LGXA 2W3SA 3EUB2 2KWUB 3VR9B 5LNK1 2IDYA 4GDKB 1EWCA 1ZOYB 3RYTA 1KLVA 3L08A 1WGDA 4ZHPA 3HVZA 4MM3B 1TZ1A 2IY1B 1V8CA 1S1QB 1D5XC 1WXMA 3M3JA 5D3IB 4TV3A 4A55A 2J42A 2UU7A 1XXGA 1E6EB 3NZUA 4DDGD 4YL8A 2KDMA 3R3MA 4KV2A 1QKZA 1OGWA 2LUEA 2A4ZA 2X38A 1UGMA 4LTUA 1M4VA 4QAYA 3PHXB 2DZMA 1ZXIA 1YMHE 4IW0A 1L2NA 1NEKB 2M17A 3V05A 1FIQA 2ZW0A 4MH8A 4RCOA 4W9CA 3P4QB 1NI3A 5KHQA 1SE4A 2FNJB 2RGFA 1D6EC 1BXTA 1L0XB 1L7YA 1TIFA 2K1FA 3N1ZC 4M8NA 4A9AA 1WY8A 2KWCA 2QDFA 3IVFA 2VH2A 3L17A 3AE2B 1JWBD 3H9DA 1C9FA 4PS8A 3PZ8A 2KHWB 1YOVB 2KK8A 2M1MA 3AE8B 3QQ8B 1TT5B 2K8CA 1T0QC 1R4NI 2K6QA 1C1YB 1XLOA 3MC0B 4FJVB 2WNMA 1P3QU 1RFAA 2FCNA 3APDA 3A1QA 3V62A 1IBXA 3SU8X 1CZPA 1FPYA 3MHZA 4MJSA 4N6EB 3N30A 3ZXRA 1C4PA 1WGHA 2RDHA 4LJOB 1RLFA 1ACCA 1KJTA 2ICIA 1NYQA 5CHWA 1WRIA 2J0MA 3DQVA 2MRPA 3NRZA 4FN2A 3U7DA 1R7SA 1VCBA 2LUMA 2WXQA 3P4RB 3KWVA 3DWGC 3PLUA 2J0JA 1TS5A 5JH5C 3TL5A 1BUIC 1JCKB 3DBHB 1TY2A 3RNFC 4G50A 1UUPA 4LDTD 2ZNVB 3N3KB 4W9LA 1S3SG 1E0ZA 3WA0A 3NVYA 1GB1A 4BBNC 2NPTB 3DOWA 3FKYA 1YN5A 5D94A 2IGGA 1RRBA 4NAWA 3DVGX 3VUXA 4DK5A 3Q3MC 2FCSA 2KZRA 2CHZA 4ANWA 1RYJA 3R66C 1P9DU 2SAKA 4EE2A 1RAXA 1HXYD 3ZNZB 2BB5A 2FCMA 1TTNA 4C56C 1I42A 4MSQB 3JSVB 2WHIA 4C7ZA 4W9KA 5IN7A 3P2BA 4OW0A 2QMTA 1ZXHA 3H6NA 2TSSA 4RGMA 2V9HA 1FNVA 2PW9A 3AE1B 3OJ3A 2K6DB 4S0RA 3I57A 4C4VA 3VXWA 1STEA 3DCGA 3ECIA 3M95A 3U4EG 5D2MB 4NQLB 2R2OA 4LNIA 3P4SB 4LK0M 2ONQA 2L0FA 1WIAA 2KT7A 1EM7A 2Z8LA 5D7GA 3RN9C 3PV1A 1FNWA 4IM3A 1KFYB 1RM6C 4PS3A 1WJ6A 2HTHA 4CHKA 4NJ7A 2WLBA 3CIRB 5AEKB 1PUTA 2JWUA 3PZDA 2KFKB 2LRUA 1F52A 2AX5A 3QHTA 3APFA 3HHMA 2YVCA 5DPTA 2EKEC 3Q3OC 1HTQA 5MPOA 3N9YC 4B95A 3Q3JA 4C7YA 1LO5D 4P6VF 1WX7A 2IGDA 4BZAA 1J8CA 3RULA 4YT0B 3R8BA 2E3TA 2LGIA 2IY0B 2JQRB 4HKQA 4XX5A 4F1SA 3NVVA 3EA6A 3W1YA 3ONSA 1WSPA 5LXIB 4USAA 3AH7A 2XNAC 2MBHA 2KJRA 1QOBA 2CHXA 4OVZA 1K51A 2QJLA 3T9LA 4NAWB 1YD8U 3B2FA 3GOEA 3ZTDA 2KYWA 1GG3A 1WM2A 3NJTA 3AEBB 2VZKD 1ET9A 1Z2MA 4J3OD 1AYFA 2BWES 1UZXB 3QIJA 3VTVA 2PLPA 3IAS1 4PYZA 2H88B 3B2GA 3IXSA 4KX6B 2KANA 3PHWB 2HE7A 2BYVE 2FCQA 2KXJA 2KOXA 2J7QB 4GB9A 4FULA 2K3UA 4HLEA 4EOYA 2PPHA 2Y5BB 3OWEB 4I6LB 4ACFA 3UIOB 3Q8AA 1WXQA 4N58A 3VAWA 1MG8A 1HZ5A 3A9KA 3M63B 3AEAB 4HDQA 2PIAA 2H89B 2JZ3B 1QOAA 1N60A 1I4QA 1XCQL 4HPPA 2K8HA 3BZDB 4KZCA 1I4HA 4BKSA 2JWZA 4FBJB 2MJDA 1QF6A 2JPHA 3MHSD 3UF8A 4JIOU 2O2VA 2K0PA 3BYYB 3A4RA 4W9DA 3O13A 4ZRIA 2MHJA 2WDQB 4RFBA 5FR3A 1D5ZC 1SGHA 2ZJDA 2GBKA 3AEEB 5TR5A 1Q0WB 4MGYE 4AP4C 3V6EB 3VDZA 3L16A 1H8CA 3ZRCA 3PREA 3PLVA 3TEYA 3BY4B 3ABVB 4PK1A 1IUEA 2DHZA 4D2KA 5C2TB 1HE8A 5GXGB 1BMLC 1L6UA 3S2AA 3AE3B 2K9XA 2QSDA 3JYUA 4DXAB 2G4SA 3PT2B 2EMSA 2IO1B 5CX3A 3ZDTA 4ARCA 3L10B 3DDCB 4GN1A 1SE3A 3SD5A 2GBNA 3T8MA 2IPKD 1IYFA 3BVZA 2DLBA 2N9PC 1FRDA 3FAHA 5JHAA 3WANA 4NQKE 2DZJA 3ZJUA 4TUUA 1TZOA 2LJIA 4DHZB 3PRMB 5D3DA 2BT6A 5C1ZA 2BYFA 2DZIA 2Y5PA 4KDIC 3GS2A 3DHHC 3DBRI 2QCZA 2N4FA 1WFYA 1ZW7A 1AWDA 1N6ZA 4HVBA 2N7EA 1YN3A 4N59A 1WGRA 5DPSA 1AARA 4EZJA 1MJDA 2V3SA 1T0YA 4GDLA 3TJPA 2KAJA 1CMXB 3B0AA 3MTNB 4ZHOA 1YJIA 1GAQB 4DQOC 3UQBA 1CQVA 2IYDB 2N0SB 3N1YC 2L3ZA 3H7PB 4I6NB 3WCQA 3KQ4A 3HM3A 3PSEB 3Q14C 5G5GA 1FO4A 5AZGA 2JF5A 3PZ7A 1WXVA 4EZKA 4URKA 2KMMA 2JYEA 3ZO5B 3Q3FA 4E3CA 1B1ZA 4L2YA 1V80A 4W9EA 2XN9C 1KTKA 2KC1A 5HKHA 4MH0E 4UDUC 3I3TB 5FK9C 3GE8C 2WXPA 5HI1A 2MA9B 4DBGA 1PGXA 1YQ4B 3BVGA 2UWQA 5JHBA 1NBFC 4IM0A 1K52A 3L0WB 4AS1A 2NCNA 1YNTE 2M4NA 1GNUA 2I38A 2PKOA 2ON8A 3VH4B 2AQ3B 3P63A 1SXTA 2D07B 2V4IB 2KX0A 4ICUA 2D3AA 5EE9A 4R3DA 5E6OA 1FD6A 2JZPA 2DYBA 3Q6BA 1ZDVA 2AL6A 2EELA 3IFWB 2V1YA 1N5XA 1FNUA 2NMQA 2DX5B 3KWLA 2KQ7A 2KQSA 4ZOHC 3AE4B 3M62B 3AEFB 2I1JA 4MT5A 4GMVA 1ZP0B 2DYMA 2N9KA 4GGQA 4LDTB 3C19A 3BK1A 2INDC 2GRIA 2GBJA 1A70A 3AULA 2RDBC 1DGJA 1JWUD 2CU1A 2LXCA 4TQ0A 1WJNA 3TBLD 3DBLI 4AOFA 1R4NB 1LXDA 2A5UA 2J53A 1F9JA 3QCAA 3Q2AC 3VUWA 2VRRB 1EO6A 4WJNA 3GZNI 1J19A 1FRRA 1LM8B 1D4BA 1JMLA 2ZCBA 1PYWD 4BKSD 3RCZA 1V2YA 3E56A 2WXIA 3TMPB 1UNSA 3TCAA 1SE9A 2ZVOA 1YJJA 2WX1A 2AQ2B 2JY6A 3E9SA 1MG4A 4NAMA 1TYGB 4JE3B 1JROA 3QK0A 3APCA 2CR5A 4NY0A 3BINA 1V86A 4ANUA 2ZVNA 2LEKA 3A4SC 3TEZA 1E7PB 1WMHB 4EKUA 3R7RA 1UBIA 2DAFA 2L76A 5IKCM 1R4MI 4XDCA 1E90A 3SEBA 3P1MA 1TKYA 3DBSA 2ASQA 3DVNU 1WGKA 4PS7A 2FIFA 3ETRA 4HEA1 1L0YB 2LGYA 2JT4B 2L1AA 1JALA 4A90A 1V97A 2LRWA 1GJZA 4LNFA 2HD5B 1E10A 2X8XX 2Z0DB 2CKHB 3IG3A 3ZNID 1WE6A 2GLSA 3JW0X 4K7SA 4YSYB 4XZ4A 1FFVA 3ZTCA 3LXFA 1VR9A 2MBQA 3H7SA 1IGDA 2KLGA 3AE9B 4E71A 1L6VA 3X23A 1M94A 3RI7C 5J2RA 4ZRPA 2UYZB 3ZLZA 2MP2A 1DOXA 5BMHA 3JVZX 2G3QB 3HM6X 2JXXA 3MFGA 5IAAC 4W9FA 1SBBB 2NTSA 2WGSA 4US9A 2L52A 4YSZB 2L8JA 2W55A 2B3AA 2VZKB 3IHPC 4BOSC 2KN5A 2L32A 3AE5B 4KGTA 5EE3A 5DCNA 2MEKA 1QLBB 2E6XA 2KD0A 4GXBA 3QA8A 2MJ3A 1P0RA 1P1AA 5J18A 4G11A 4K3BA 4K81A 3N32A 1EUVB 4OVUA 1PGBA 3AMZA 3RZFA 2C60A 2WP9B 2HDEA 4YWGG 4GSWA 2BF8B 3RZWC 4B6WA 1C78A 1QQRA 2BWFA 1GOZA 3KLSX 1TKEA 3Q8BA 2O6VA 3V61A 1MHHE 2CJNA 1TY0A 4JWSC 1U4AA 4W9IA 3V6CB 3MC9A 5E6JA 2IZVB 3U2SC 4K3CA 4MACA 1YX6B 2GI9A 4KIKA 3IT6B 3AI5A 4DDID 3DVNV 3AN1A 1YQ3B 1F0ZA 1MI0A 1XQQA 1T6BX 1V1PA 3UQAA 3WAOA 3TSSA 3QWZB 4WWOA 1YN4A 3A1QB 4KKIA 2LXAA 4RM9A 1IBXB 4WWPA 4MJSB 4IWOA 2BYTA 3UINB 2DNFA 3FC4A 2MSED 4MDKE 5BMGA 1PGAA 4EEWA 2D3GA 2GOWA 3EFCA 5C3JB 3EFUA 3U30A 4YSXB 3LB8C 4XGAB 4CQNA 2G45B 4TMAB 4M0WA 1CJEA 1FXAA 4M01A 2RSUA 2JYTA 2JU6X 1TJEA 4MSMB 1N61A 5CTRC 4BVUC 1V9JA 2DZKA 4IWQA 1E8XA 2BKRB 4NJCA 4P1CC 3LDZE 4FJZA 3ZVVA 1FMAD 4B0EA 2W3RA 4LNNA 2KDBA 3R2IA 1E7VA 1SSNA 1WH3A 1WJ4A 1C4CA 2LVQA 5AZFA 2DENB 1FM0D 3MC8A 2JRHA 5E6NA 1I4XA 2JVCA 3SDLC 4YTMB 2LVOA 1I7HA 4KGRA 4WJPA 3PGEA 2LVPA 3NS1A 1F1HA 4TKNA 3A9JA 2LZ6A 5CHFA 2QC8A 3U7ZA 2D10A 4P16A 2LGSA 2WU2B 2J52A 4YXDB 4NJ6A 2MBOA 2KTFA 4XWTA 2WYQA 2BYEA 5LLIA 3B1LX 4C4VB 3TUOA 2MWSB 3PPAA 2KWDA 1HTOA 3GP7A 5BYQA 2MX2A 5JXVA 1XEEA 4FA6A 2WX0A 2NVUI 4KKJA 2HTME 1WM3A 2PJHA 3RNGC 3AU4A 4W9JA 1T0SC 4DWFA 1UH6A 2V4LA
chains in the Genus database with same CATH topology
2INDC 3Q2AC 3RMKC 3RNEC 3RNBC 1T0RC 3Q3NC 3GE3C 3N1YC 3DHHC 3DHGC 3I63C 3RNCC 2RDBC 3GE8C 3I5JC 3Q14C 3RI7C 4P1BC 3RNAC 3Q3MC 3DHIC 4P1CC 1T0QC 3N1ZC 3RNGC 3RN9C 2INCC 3RNFC 3N20C 3N1XC 3Q3OC 1T0SC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IND C;  3Q2A C;  3RMK C;  3RNE C;  3RNB C;  1T0R C;  3Q3N C;  3GE3 C;  3N1Y C;  3DHH C;  3DHG C;  3I63 C;  3RNC C;  2RDB C;  3GE8 C;  3I5J C;  3Q14 C;  3RI7 C;  4P1B C;  3RNA C;  3Q3M C;  3DHI C;  4P1C C;  1T0Q C;  3N1Z C;  3RNG C;  3RN9 C;  2INC C;  3RNF C;  3N20 C;  3N1X C;  3Q3O C;  1T0S C; 
#chains in the Genus database with same CATH topology
 1FEH A;  3L13 A;  1SF0 A;  1HEZ E;  4JL9 A;  4MEL A;  2KKC A;  2C7M B;  3MJ5 A;  1V6E A;  3ZKJ C;  5JZE B;  4ANV A;  1P98 A;  3T3N A;  1HQR D;  4M0W B;  4JQW C;  1ZE3 D;  1XO3 A;  4WAF A;  3NVZ A;  1L0V B;  3K9P B;  3FIL A;  3SHQ A;  4RF0 A;  2BGF A;  3VTU A;  1VJK A;  4ZYS A;  1TKG A;  4WH4 A;  5H8Y E;  2JZZ A;  4A8X C;  4FAD A;  1JWS D;  1ZPS A;  3DHG C;  3TEX A;  4OVV A;  4TQ1 A;  2FE8 A;  4NPN A;  1L4D B;  2AWT A;  2XK5 A;  2ZNV C;  3CSF A;  3A33 B;  4MGZ E;  1OEY A;  1XLQ A;  3AU5 A;  4ZYN A;  1Y56 A;  4KSK C;  2KFJ A;  2V0G A;  2WXK A;  2WXN A;  4NNJ B;  3TIX A;  1WZ0 A;  2KO3 A;  1HZ6 A;  3SFD B;  1YQB A;  1IPG A;  4IUM B;  3NZS A;  2KTR A;  5AZH A;  4B9K A;  3OG5 A;  1E5W A;  5BYR A;  4XWW A;  3ZW3 A;  2K25 A;  3U8Z A;  4II3 B;  1KM7 A;  2EKI A;  5L95 C;  2LGD A;  1KH0 A;  3KVF B;  2O6V D;  2YLM A;  1UF0 A;  3X0W A;  3A9K B;  2W54 A;  1TGZ B;  1L4Z B;  2GBM A;  3VRA B;  3VH3 B;  1HA5 A;  4MM3 A;  4RNA A;  1SJE D;  3AE6 B;  2FUH B;  2LD9 A;  2N9E B;  4EFO A;  1VD2 A;  2M19 A;  4RM8 A;  1F2R I;  2MQJ A;  3LJ3 A;  2FBW B;  2ZW1 A;  3UI3 A;  3PO0 A;  4WJO A;  3AB5 A;  1WR6 E;  3PTF C;  2RR9 A;  1H4R A;  1DOI A;  4WAA A;  2O2V B;  1MVK A;  2D2Q A;  2MBE A;  1KF6 B;  3NS8 A;  4OZC A;  4DHJ D;  3L54 A;  1XF5 L;  2NBU A;  1N63 A;  3C0R B;  4LNK A;  2IGH A;  3KH0 A;  3FIL B;  5FKA C;  3RFZ B;  3PS6 A;  2V3N A;  1QT9 A;  2N1W A;  2MJE A;  4W9H A;  1NDD A;  4M00 A;  4KGS A;  4HDO A;  2Z59 B;  3ALB A;  3C8Y A;  3SR6 A;  3H8H A;  2NBW B;  3Q3N C;  2M0A A;  4P7I A;  1UEL A;  3VUY A;  4OZA A;  2XK5 B;  4HCN B;  2SEB D;  3VRB B;  1Z5S B;  1XD3 B;  2C7H A;  4A6Q A;  1OQR A;  2LHE A;  2ACZ B;  3RUI B;  3DWM A;  4LNO A;  2KX3 A;  2L00 B;  3DBL B;  4IKG A;  4IC7 B;  3AXC A;  1WE7 A;  2KQ4 X;  4BOZ B;  5H92 C;  1V49 A;  1OEY J;  3GZN B;  2KMA A;  5BMI A;  1VZ8 A;  1VLB A;  4P1B C;  3EGR A;  2N1V A;  2J4X A;  4C00 A;  4GU2 A;  1ESF A;  2M8S A;  2N9L A;  5C23 A;  2L05 A;  2Z0E B;  2RDG A;  4JPS A;  2HJ8 A;  4WJQ A;  3NOB A;  2Y5C A;  5G55 A;  1I35 A;  2ZPY A;  2CJO A;  4GDL B;  4G0N B;  3DHI C;  3NG0 A;  4M02 A;  1E8Z A;  2DWQ A;  1IP9 A;  3ZIM A;  2BTE A;  2JSV X;  5T8I A;  3ZGZ A;  4ITK A;  2IBI B;  1R4M B;  3SFE B;  3ZNH B;  3PRP B;  5HG2 A;  1UWX A;  3T3O A;  4TSS A;  1KLU D;  3RNE C;  2N7D A;  3ZDM C;  5BYS A;  3KUC B;  2WXF A;  4PT5 A;  2NPT A;  4LLG M;  4KDL B;  2K39 A;  1MHX A;  2HJ1 A;  1KLG D;  2L7R A;  4KSL C;  4JGH B;  2WDT B;  4US8 A;  2BS4 B;  3B08 A;  1WYW B;  2L0T A;  1PQS A;  1XLP A;  3CWI A;  1J7B A;  1FFU A;  3Q8E A;  2KLC A;  2JUO A;  1KRH A;  4BAX A;  1NEN B;  5G2N A;  4RMA A;  4MGK E;  5DPW A;  4WQO B;  2INN E;  3JSV A;  1WX9 A;  4WWN A;  2WXR A;  4XE0 A;  5EE1 A;  2W9N A;  1Q10 A;  4K7U A;  2GB1 A;  4EZL A;  4IWP A;  1SE2 A;  2FID A;  4XYC A;  1DOY A;  1ENF A;  1QZE A;  1SB3 C;  1F2R C;  2WU5 B;  2NS5 A;  2FAZ A;  2EMT A;  4FXC A;  3Q8C A;  3VHT C;  3RT3 B;  1TS4 A;  2IO0 B;  2VH1 A;  1P7F A;  3WIM A;  1ZDX A;  3KW5 B;  5IP4 D;  4LCD E;  2KMC A;  3PVL A;  1YJ1 A;  4L23 A;  3CST A;  5D6J B;  1V1O A;  3OAW A;  3KYC D;  2G1E A;  4II2 B;  5DPR A;  1SJH D;  3UGB B;  4BKG A;  2WXM A;  3W5V B;  2G4D B;  2G9H D;  1X1M A;  2DAJ A;  1FCC C;  1VZ7 A;  4PYU A;  2KFK A;  4E74 A;  2PE6 B;  1LQB A;  1WR1 A;  3VTW A;  3MJW A;  2Y3A A;  2L83 A;  5AUK A;  3ZQ4 A;  1YIW A;  3AED B;  1NYR A;  3K9O B;  1UBQ A;  3GB1 A;  2BBC A;  2I1K A;  3D32 A;  1RWS A;  1EU4 A;  4MGI E;  1WZ3 A;  1GC6 A;  4F8C B;  4HRO A;  4RGN A;  2BS2 B;  2REX A;  4AJW A;  2LI5 A;  3BK2 A;  4HJG E;  1JQ4 A;  5IO9 A;  2IJ0 A;  2AQ1 B;  1PDX A;  1K8R B;  1TS3 A;  4RGT A;  1OQY A;  1N62 A;  3I9V 1;  1C3T A;  1WI0 A;  2WXJ A;  1JRU A;  4IDI A;  3AEG B;  5FR6 A;  3NUH B;  4ZRQ A;  4RH6 A;  1GC7 A;  3WAM A;  4HKZ E;  4CYE A;  3N1X C;  3AEC B;  1I4G A;  4FJY A;  4DXF A;  3W9C B;  3BVM A;  4ANX A;  2PTL A;  1JWA D;  2PVG C;  5CHV C;  2OED A;  4Q2J A;  1J0G A;  3Q8F A;  3W2D A;  1QOF A;  4BBN F;  3I5J C;  4A3O A;  2M56 B;  1WXS A;  3DBH I;  5EDS A;  3BII D;  2K5P A;  1SEB D;  4K7W A;  1B9R A;  4JX1 C;  4M8M A;  4C80 A;  3UIP B;  4LJP B;  3ZRF A;  4AWJ A;  1QOG A;  3RNB C;  2PVO D;  2J0K A;  1BT0 A;  2ZPN A;  1LGR A;  4MEM A;  2MW5 A;  3ZNG C;  4NZL B;  2QHO A;  4O1N A;  1SIJ A;  3RNA C;  4HRS A;  1VRA B;  3WAP A;  2N9X A;  2INC C;  1C77 A;  3H1U A;  2R61 A;  2CU3 A;  4KZ0 A;  3DPD A;  2MLB A;  2RPV A;  3VQI A;  1XT9 B;  2D3C A;  3IBE A;  2CS4 A;  1K53 A;  1C79 A;  2N7J A;  2GBR A;  1V5O A;  2MP2 B;  2I2Y A;  3J9C A;  3VR8 B;  2WXO A;  1GPX A;  3RD2 A;  2OJR A;  2JRI B;  1RFK A;  2BW2 A;  2KVR A;  4WIP A;  1T5X D;  2RD0 A;  3P42 A;  3HRD D;  2V3P A;  3NVW A;  5L83 A;  2D11 A;  5G5H A;  2PE9 A;  1CK1 A;  4WQM A;  1QIL A;  2YEP F;  1V5T A;  4HXD A;  2M0X A;  2LWP A;  3IAM 1;  1UGJ A;  2QEJ C;  3OJ4 B;  3HIZ A;  2WXH A;  4BKT A;  1A5R A;  2KWV B;  1TS2 A;  2NTT A;  3CF6 E;  1ROE A;  3ML9 A;  4HPM B;  4HWI B;  3L4P A;  3W5U B;  2O6V B;  1WRD B;  3HUI A;  1D3Z A;  2BVC A;  4N9F 4;  1ISN A;  3B9J A;  4EUT A;  1IGC A;  2LMC A;  3HVD A;  3EEC A;  1E8W A;  1L5P A;  4REZ A;  2R2Q A;  2OJW A;  1NI2 A;  3PRZ A;  2MH7 A;  4KIK B;  1TBE A;  3QX1 A;  4HPL B;  4IG7 B;  2KJH B;  3EHV A;  1VZ6 A;  3W1S C;  4OZB A;  1G6J A;  3AE7 B;  4G3X B;  4J6I A;  1V1P B;  2WWZ A;  5GMV A;  4JLC A;  2WXG A;  1T3Q A;  3RPF C;  2NR2 A;  4S17 A;  3V60 A;  2K22 A;  2NBV B;  2ZCC A;  1YX5 B;  4DXG A;  4A3P A;  5IA7 A;  3ZXV A;  1E8Y A;  2WS3 B;  3U52 E;  1WGY A;  4DHJ B;  1C4A A;  3ZJT A;  4ZRK A;  1AN8 A;  2PEA A;  1AW7 A;  2DBY A;  4HCP B;  3H7P A;  1GB4 A;  1Y8R C;  3ENE A;  1WX8 A;  4H2A A;  3VFK A;  1P7E A;  2KN4 A;  2CHW A;  4AUQ C;  3BWU D;  3N20 C;  1XLN A;  4CO7 A;  4L1B A;  2BS3 B;  2DYO A;  2K8B A;  1OQQ A;  2C9W B;  1WJU A;  2ZZP B;  3GE3 C;  1JW9 D;  3RNC C;  1KOT A;  3DBR B;  4I6P A;  4B0M A;  5E6P A;  4IM2 A;  2OOB B;  3MP9 A;  3R2T A;  1ZUD 2;  2WDR B;  2C7N B;  1Q5W B;  3KYD D;  2LFI A;  3P4P B;  4WWM A;  1MFW A;  4FHJ A;  3TEW A;  3Q69 A;  4XDD A;  4ICV A;  4KVG B;  1F77 A;  1E9M A;  2RPQ A;  4ZDV A;  2LHD A;  4DHZ E;  3QAQ A;  3I63 C;  3VVW B;  1FXT B;  1EU3 A;  3R7Q A;  1VDV A;  1EF5 A;  4JWU C;  2MBB B;  2JX5 A;  1JRP A;  2D3B A;  3V3X A;  2BQQ A;  3AM9 A;  3WAL A;  4F7Z A;  1DYQ A;  4FLH A;  4AQ7 A;  3KUD B;  2KC2 A;  3DVG Y;  1MPE A;  3A9J B;  5BO4 B;  2RMM A;  2LAS A;  2B76 B;  1N5W A;  1OFF A;  2BB6 A;  5HHD G;  2W82 A;  4YTN B;  2AYO B;  2QIE B;  4GDK A;  4FHK A;  1J7A A;  1ET6 A;  3QJZ A;  5I4D A;  1D5M C;  2FUG 1;  1WWT A;  4GIV A;  3EC8 A;  2XBB C;  4RF1 A;  2PMV A;  5KHO A;  3HK0 A;  1I4R A;  3ZYY X;  5J17 A;  4RGO S;  1E7U A;  3CMM B;  3NZ3 A;  1LFD A;  4GOC A;  1EF1 A;  1EWY C;  1JWM D;  3RMK C;  2INP E;  2WDV B;  2KAC A;  3AV8 A;  2WQY B;  2Q5W D;  3NY5 A;  2KJ6 A;  2XEW A;  4A20 A;  3BYT B;  3OLM D;  1UD7 A;  2BKF A;  5TSS A;  4AJY B;  2IO3 B;  1WXA A;  2MCN B;  4WUR A;  1FXI A;  3QC8 B;  4W9G A;  1I4P A;  5EE0 A;  4K1R B;  3QAR A;  2KDE B;  4ASW C;  4HK2 A;  3URY A;  2KVZ A;  1PFD A;  1FCL A;  3O65 B;  3NHE B;  3ZJV A;  2OHF A;  4BFR A;  2WXL A;  2GMI C;  3ML8 A;  3W1S A;  2BPS A;  2C5L C;  2QIL A;  4OHJ A;  2AL3 A;  1ZGU B;  1WF9 A;  4X57 B;  1WMH A;  1ZKH A;  1J7C A;  4YTP B;  3IT4 B;  1GUA B;  2KNB A;  4XC2 A;  2JXT A;  2KDF B;  1T0R C;  5IOI A;  2AEH A;  4ARI A;  3LYY A;  2YEP B;  4IOI E;  2KDI A;  3KUZ A;  3ZUN A;  2KTR B;  2ZEQ A;  2LJ5 A;  4GLS C;  5AUI A;  5LXH A;  1WGG A;  4HJK A;  1SIF A;  1C76 A;  1Q1O A;  5HFY A;  2IO2 B;  4ZRJ A;  1K50 A;  1XCT L;  1WYG A;  1OTR B;  2D5G A;  1V81 A;  1NVI D;  1UWM A;  2LGX A;  2W3S A;  3EUB 2;  2KWU B;  3VR9 B;  5LNK 1;  2IDY A;  4GDK B;  1EWC A;  1ZOY B;  3RYT A;  1KLV A;  3L08 A;  1WGD A;  4ZHP A;  3HVZ A;  4MM3 B;  1TZ1 A;  2IY1 B;  1V8C A;  1S1Q B;  1D5X C;  1WXM A;  3M3J A;  5D3I B;  4TV3 A;  4A55 A;  2J42 A;  2UU7 A;  1XXG A;  1E6E B;  3NZU A;  4DDG D;  4YL8 A;  2KDM A;  3R3M A;  4KV2 A;  1QKZ A;  1OGW A;  2LUE A;  2A4Z A;  2X38 A;  1UGM A;  4LTU A;  1M4V A;  4QAY A;  3PHX B;  2DZM A;  1ZXI A;  1YMH E;  4IW0 A;  1L2N A;  1NEK B;  2M17 A;  3V05 A;  1FIQ A;  2ZW0 A;  4MH8 A;  4RCO A;  4W9C A;  3P4Q B;  1NI3 A;  5KHQ A;  1SE4 A;  2FNJ B;  2RGF A;  1D6E C;  1BXT A;  1L0X B;  1L7Y A;  1TIF A;  2K1F A;  3N1Z C;  4M8N A;  4A9A A;  1WY8 A;  2KWC A;  2QDF A;  3IVF A;  2VH2 A;  3L17 A;  3AE2 B;  1JWB D;  3H9D A;  1C9F A;  4PS8 A;  3PZ8 A;  2KHW B;  1YOV B;  2KK8 A;  2M1M A;  3AE8 B;  3QQ8 B;  1TT5 B;  2K8C A;  1T0Q C;  1R4N I;  2K6Q A;  1C1Y B;  1XLO A;  3MC0 B;  4FJV B;  2WNM A;  1P3Q U;  1RFA A;  2FCN A;  3APD A;  3A1Q A;  3V62 A;  1IBX A;  3SU8 X;  1CZP A;  1FPY A;  3MHZ A;  4MJS A;  4N6E B;  3N30 A;  3ZXR A;  1C4P A;  1WGH A;  2RDH A;  4LJO B;  1RLF A;  1ACC A;  1KJT A;  2ICI A;  1NYQ A;  5CHW A;  1WRI A;  2J0M A;  3DQV A;  2MRP A;  3NRZ A;  4FN2 A;  3U7D A;  1R7S A;  1VCB A;  2LUM A;  2WXQ A;  3P4R B;  3KWV A;  3DWG C;  3PLU A;  2J0J A;  1TS5 A;  5JH5 C;  3TL5 A;  1BUI C;  1JCK B;  3DBH B;  1TY2 A;  3RNF C;  4G50 A;  1UUP A;  4LDT D;  2ZNV B;  3N3K B;  4W9L A;  1S3S G;  1E0Z A;  3WA0 A;  3NVY A;  1GB1 A;  4BBN C;  2NPT B;  3DOW A;  3FKY A;  1YN5 A;  5D94 A;  2IGG A;  1RRB A;  4NAW A;  3DVG X;  3VUX A;  4DK5 A;  3Q3M C;  2FCS A;  2KZR A;  2CHZ A;  4ANW A;  1RYJ A;  3R66 C;  1P9D U;  2SAK A;  4EE2 A;  1RAX A;  1HXY D;  3ZNZ B;  2BB5 A;  2FCM A;  1TTN A;  4C56 C;  1I42 A;  4MSQ B;  3JSV B;  2WHI A;  4C7Z A;  4W9K A;  5IN7 A;  3P2B A;  4OW0 A;  2QMT A;  1ZXH A;  3H6N A;  2TSS A;  4RGM A;  2V9H A;  1FNV A;  2PW9 A;  3AE1 B;  3OJ3 A;  2K6D B;  4S0R A;  3I57 A;  4C4V A;  3VXW A;  1STE A;  3DCG A;  3ECI A;  3M95 A;  3U4E G;  5D2M B;  4NQL B;  2R2O A;  4LNI A;  3P4S B;  4LK0 M;  2ONQ A;  2L0F A;  1WIA A;  2KT7 A;  1EM7 A;  2Z8L A;  5D7G A;  3RN9 C;  3PV1 A;  1FNW A;  4IM3 A;  1KFY B;  1RM6 C;  4PS3 A;  1WJ6 A;  2HTH A;  4CHK A;  4NJ7 A;  2WLB A;  3CIR B;  5AEK B;  1PUT A;  2JWU A;  3PZD A;  2KFK B;  2LRU A;  1F52 A;  2AX5 A;  3QHT A;  3APF A;  3HHM A;  2YVC A;  5DPT A;  2EKE C;  3Q3O C;  1HTQ A;  5MPO A;  3N9Y C;  4B95 A;  3Q3J A;  4C7Y A;  1LO5 D;  4P6V F;  1WX7 A;  2IGD A;  4BZA A;  1J8C A;  3RUL A;  4YT0 B;  3R8B A;  2E3T A;  2LGI A;  2IY0 B;  2JQR B;  4HKQ A;  4XX5 A;  4F1S A;  3NVV A;  3EA6 A;  3W1Y A;  3ONS A;  1WSP A;  5LXI B;  4USA A;  3AH7 A;  2XNA C;  2MBH A;  2KJR A;  1QOB A;  2CHX A;  4OVZ A;  1K51 A;  2QJL A;  3T9L A;  4NAW B;  1YD8 U;  3B2F A;  3GOE A;  3ZTD A;  2KYW A;  1GG3 A;  1WM2 A;  3NJT A;  3AEB B;  2VZK D;  1ET9 A;  1Z2M A;  4J3O D;  1AYF A;  2BWE S;  1UZX B;  3QIJ A;  3VTV A;  2PLP A;  3IAS 1;  4PYZ A;  2H88 B;  3B2G A;  3IXS A;  4KX6 B;  2KAN A;  3PHW B;  2HE7 A;  2BYV E;  2FCQ A;  2KXJ A;  2KOX A;  2J7Q B;  4GB9 A;  4FUL A;  2K3U A;  4HLE A;  4EOY A;  2PPH A;  2Y5B B;  3OWE B;  4I6L B;  4ACF A;  3UIO B;  3Q8A A;  1WXQ A;  4N58 A;  3VAW A;  1MG8 A;  1HZ5 A;  3A9K A;  3M63 B;  3AEA B;  4HDQ A;  2PIA A;  2H89 B;  2JZ3 B;  1QOA A;  1N60 A;  1I4Q A;  1XCQ L;  4HPP A;  2K8H A;  3BZD B;  4KZC A;  1I4H A;  4BKS A;  2JWZ A;  4FBJ B;  2MJD A;  1QF6 A;  2JPH A;  3MHS D;  3UF8 A;  4JIO U;  2O2V A;  2K0P A;  3BYY B;  3A4R A;  4W9D A;  3O13 A;  4ZRI A;  2MHJ A;  2WDQ B;  4RFB A;  5FR3 A;  1D5Z C;  1SGH A;  2ZJD A;  2GBK A;  3AEE B;  5TR5 A;  1Q0W B;  4MGY E;  4AP4 C;  3V6E B;  3VDZ A;  3L16 A;  1H8C A;  3ZRC A;  3PRE A;  3PLV A;  3TEY A;  3BY4 B;  3ABV B;  4PK1 A;  1IUE A;  2DHZ A;  4D2K A;  5C2T B;  1HE8 A;  5GXG B;  1BML C;  1L6U A;  3S2A A;  3AE3 B;  2K9X A;  2QSD A;  3JYU A;  4DXA B;  2G4S A;  3PT2 B;  2EMS A;  2IO1 B;  5CX3 A;  3ZDT A;  4ARC A;  3L10 B;  3DDC B;  4GN1 A;  1SE3 A;  3SD5 A;  2GBN A;  3T8M A;  2IPK D;  1IYF A;  3BVZ A;  2DLB A;  2N9P C;  1FRD A;  3FAH A;  5JHA A;  3WAN A;  4NQK E;  2DZJ A;  3ZJU A;  4TUU A;  1TZO A;  2LJI A;  4DHZ B;  3PRM B;  5D3D A;  2BT6 A;  5C1Z A;  2BYF A;  2DZI A;  2Y5P A;  4KDI C;  3GS2 A;  3DHH C;  3DBR I;  2QCZ A;  2N4F A;  1WFY A;  1ZW7 A;  1AWD A;  1N6Z A;  4HVB A;  2N7E A;  1YN3 A;  4N59 A;  1WGR A;  5DPS A;  1AAR A;  4EZJ A;  1MJD A;  2V3S A;  1T0Y A;  4GDL A;  3TJP A;  2KAJ A;  1CMX B;  3B0A A;  3MTN B;  4ZHO A;  1YJI A;  1GAQ B;  4DQO C;  3UQB A;  1CQV A;  2IYD B;  2N0S B;  3N1Y C;  2L3Z A;  3H7P B;  4I6N B;  3WCQ A;  3KQ4 A;  3HM3 A;  3PSE B;  3Q14 C;  5G5G A;  1FO4 A;  5AZG A;  2JF5 A;  3PZ7 A;  1WXV A;  4EZK A;  4URK A;  2KMM A;  2JYE A;  3ZO5 B;  3Q3F A;  4E3C A;  1B1Z A;  4L2Y A;  1V80 A;  4W9E A;  2XN9 C;  1KTK A;  2KC1 A;  5HKH A;  4MH0 E;  4UDU C;  3I3T B;  5FK9 C;  3GE8 C;  2WXP A;  5HI1 A;  2MA9 B;  4DBG A;  1PGX A;  1YQ4 B;  3BVG A;  2UWQ A;  5JHB A;  1NBF C;  4IM0 A;  1K52 A;  3L0W B;  4AS1 A;  2NCN A;  1YNT E;  2M4N A;  1GNU A;  2I38 A;  2PKO A;  2ON8 A;  3VH4 B;  2AQ3 B;  3P63 A;  1SXT A;  2D07 B;  2V4I B;  2KX0 A;  4ICU A;  2D3A A;  5EE9 A;  4R3D A;  5E6O A;  1FD6 A;  2JZP A;  2DYB A;  3Q6B A;  1ZDV A;  2AL6 A;  2EEL A;  3IFW B;  2V1Y A;  1N5X A;  1FNU A;  2NMQ A;  2DX5 B;  3KWL A;  2KQ7 A;  2KQS A;  4ZOH C;  3AE4 B;  3M62 B;  3AEF B;  2I1J A;  4MT5 A;  4GMV A;  1ZP0 B;  2DYM A;  2N9K A;  4GGQ A;  4LDT B;  3C19 A;  3BK1 A;  2IND C;  2GRI A;  2GBJ A;  1A70 A;  3AUL A;  2RDB C;  1DGJ A;  1JWU D;  2CU1 A;  2LXC A;  4TQ0 A;  1WJN A;  3TBL D;  3DBL I;  4AOF A;  1R4N B;  1LXD A;  2A5U A;  2J53 A;  1F9J A;  3QCA A;  3Q2A C;  3VUW A;  2VRR B;  1EO6 A;  4WJN A;  3GZN I;  1J19 A;  1FRR A;  1LM8 B;  1D4B A;  1JML A;  2ZCB A;  1PYW D;  4BKS D;  3RCZ A;  1V2Y A;  3E56 A;  2WXI A;  3TMP B;  1UNS A;  3TCA A;  1SE9 A;  2ZVO A;  1YJJ A;  2WX1 A;  2AQ2 B;  2JY6 A;  3E9S A;  1MG4 A;  4NAM A;  1TYG B;  4JE3 B;  1JRO A;  3QK0 A;  3APC A;  2CR5 A;  4NY0 A;  3BIN A;  1V86 A;  4ANU A;  2ZVN A;  2LEK A;  3A4S C;  3TEZ A;  1E7P B;  1WMH B;  4EKU A;  3R7R A;  1UBI A;  2DAF A;  2L76 A;  5IKC M;  1R4M I;  4XDC A;  1E90 A;  3SEB A;  3P1M A;  1TKY A;  3DBS A;  2ASQ A;  3DVN U;  1WGK A;  4PS7 A;  2FIF A;  3ETR A;  4HEA 1;  1L0Y B;  2LGY A;  2JT4 B;  2L1A A;  1JAL A;  4A90 A;  1V97 A;  2LRW A;  1GJZ A;  4LNF A;  2HD5 B;  1E10 A;  2X8X X;  2Z0D B;  2CKH B;  3IG3 A;  3ZNI D;  1WE6 A;  2GLS A;  3JW0 X;  4K7S A;  4YSY B;  4XZ4 A;  1FFV A;  3ZTC A;  3LXF A;  1VR9 A;  2MBQ A;  3H7S A;  1IGD A;  2KLG A;  3AE9 B;  4E71 A;  1L6V A;  3X23 A;  1M94 A;  3RI7 C;  5J2R A;  4ZRP A;  2UYZ B;  3ZLZ A;  2MP2 A;  1DOX A;  5BMH A;  3JVZ X;  2G3Q B;  3HM6 X;  2JXX A;  3MFG A;  5IAA C;  4W9F A;  1SBB B;  2NTS A;  2WGS A;  4US9 A;  2L52 A;  4YSZ B;  2L8J A;  2W55 A;  2B3A A;  2VZK B;  3IHP C;  4BOS C;  2KN5 A;  2L32 A;  3AE5 B;  4KGT A;  5EE3 A;  5DCN A;  2MEK A;  1QLB B;  2E6X A;  2KD0 A;  4GXB A;  3QA8 A;  2MJ3 A;  1P0R A;  1P1A A;  5J18 A;  4G11 A;  4K3B A;  4K81 A;  3N32 A;  1EUV B;  4OVU A;  1PGB A;  3AMZ A;  3RZF A;  2C60 A;  2WP9 B;  2HDE A;  4YWG G;  4GSW A;  2BF8 B;  3RZW C;  4B6W A;  1C78 A;  1QQR A;  2BWF A;  1GOZ A;  3KLS X;  1TKE A;  3Q8B A;  2O6V A;  3V61 A;  1MHH E;  2CJN A;  1TY0 A;  4JWS C;  1U4A A;  4W9I A;  3V6C B;  3MC9 A;  5E6J A;  2IZV B;  3U2S C;  4K3C A;  4MAC A;  1YX6 B;  2GI9 A;  4KIK A;  3IT6 B;  3AI5 A;  4DDI D;  3DVN V;  3AN1 A;  1YQ3 B;  1F0Z A;  1MI0 A;  1XQQ A;  1T6B X;  1V1P A;  3UQA A;  3WAO A;  3TSS A;  3QWZ B;  4WWO A;  1YN4 A;  3A1Q B;  4KKI A;  2LXA A;  4RM9 A;  1IBX B;  4WWP A;  4MJS B;  4IWO A;  2BYT A;  3UIN B;  2DNF A;  3FC4 A;  2MSE D;  4MDK E;  5BMG A;  1PGA A;  4EEW A;  2D3G A;  2GOW A;  3EFC A;  5C3J B;  3EFU A;  3U30 A;  4YSX B;  3LB8 C;  4XGA B;  4CQN A;  2G45 B;  4TMA B;  4M0W A;  1CJE A;  1FXA A;  4M01 A;  2RSU A;  2JYT A;  2JU6 X;  1TJE A;  4MSM B;  1N61 A;  5CTR C;  4BVU C;  1V9J A;  2DZK A;  4IWQ A;  1E8X A;  2BKR B;  4NJC A;  4P1C C;  3LDZ E;  4FJZ A;  3ZVV A;  1FMA D;  4B0E A;  2W3R A;  4LNN A;  2KDB A;  3R2I A;  1E7V A;  1SSN A;  1WH3 A;  1WJ4 A;  1C4C A;  2LVQ A;  5AZF A;  2DEN B;  1FM0 D;  3MC8 A;  2JRH A;  5E6N A;  1I4X A;  2JVC A;  3SDL C;  4YTM B;  2LVO A;  1I7H A;  4KGR A;  4WJP A;  3PGE A;  2LVP A;  3NS1 A;  1F1H A;  4TKN A;  3A9J A;  2LZ6 A;  5CHF A;  2QC8 A;  3U7Z A;  2D10 A;  4P16 A;  2LGS A;  2WU2 B;  2J52 A;  4YXD B;  4NJ6 A;  2MBO A;  2KTF A;  4XWT A;  2WYQ A;  2BYE A;  5LLI A;  3B1L X;  4C4V B;  3TUO A;  2MWS B;  3PPA A;  2KWD A;  1HTO A;  3GP7 A;  5BYQ A;  2MX2 A;  5JXV A;  1XEE A;  4FA6 A;  2WX0 A;  2NVU I;  4KKJ A;  2HTM E;  1WM3 A;  2PJH A;  3RNG C;  3AU4 A;  4W9J A;  1T0S C;  4DWF A;  1UH6 A;  2V4L A; 
#chains in the Genus database with same CATH homology
 2IND C;  3Q2A C;  3RMK C;  3RNE C;  3RNB C;  1T0R C;  3Q3N C;  3GE3 C;  3N1Y C;  3DHH C;  3DHG C;  3I63 C;  3RNC C;  2RDB C;  3GE8 C;  3I5J C;  3Q14 C;  3RI7 C;  4P1B C;  3RNA C;  3Q3M C;  3DHI C;  4P1C C;  1T0Q C;  3N1Z C;  3RNG C;  3RN9 C;  2INC C;  3RNF C;  3N20 C;  3N1X C;  3Q3O C;  1T0S C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...