2KO3A

Nedd8 solution structure
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
76
structure length
76
Chain Sequence
MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALRGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NEDD8
publication title 60th residues of ubiquitin and Nedd8 are located out of E2-binding surfaces, but are important for K48 ubiquitin-linkage.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 13
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2009-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2ko3A00
2JPHA 3APCA 4W9KA 2K25A 3KYDD 3M62B 1E7VA 2J0KA 3WALA 4DXAB 2HD5B 1UELA 2JF5A 2KN5A 3NHEB 3JSVA 4WWOA 2FAZA 4MSMB 2AL3A 4MJSA 1LQBA 2GBKA 3NY5A 2MSED 4GOCA 2AYOB 3QK0A 3PREA 1I35A 3ECIA 4FJYA 3H7PA 4ZYNA 3IG3A 2Y5BB 2KFKB 4HCPB 4DHJB 4HXDA 3BINA 4KIKA 3PS6A 4BVUC 4LDTD 2JZZA 3UF8A 4A20A 2M0XA 2CKHB 1NDDA 1F9JA 2LUEA 3U7DA 2KC2A 1V49A 4KZCA 3L54A 2IY0B 1Q0WB 3DVNV 3PHXB 1KOTA 3H9DA 1RLFA 2N9XA 1RFAA 3ZNID 2JWZA 2M4NA 2G4DB 1E8ZA 3L16A 3CMMB 2DYMA 2PPHA 3WIMA 2GBRA 2HJ8A 4KSKC 4ANXA 4GXBA 1V2YA 3ONSA 2C60A 3ENEA 3UIPB 5J18A 3SHQA 4ZRIA 4IM2A 2KTRB 4DK5A 2KTFA 4G3XB 2KKCA 3N32A 2L0FA 4NQKE 2ZPYA 3NZUA 3L10B 1GJZA 2WX1A 1C1YB 4FJZA 3A33B 4PYUA 2MLBA 2BWFA 3Q3JA 1U4AA 2LRWA 4FADA 1Z5SB 2OJRA 2KQSA 2CHXA 2MA9B 2V4LA 1WYWB 2ZVOA 3VTWA 4EZJA 5DPWA 2BWES 2C5LC 3MTNB 3W1SA 4MGIE 3TCAA 1L2NA 2MRPA 3RUIB 3L13A 5JHBA 2C7HA 4W9IA 2CHZA 2IYDB 2L00B 3A9JB 1IP9A 5L95C 3ML8A 3WAOA 3U30A 5CHFA 4DHZB 4KZ0A 4II2B 2MX2A 4MGYE 2ZCBA 3VUWA 2JVCA 2KMCA 2Z0DB 1ZGUB 3O65B 3PLUA 4B95A 3DCGA 1PQSA 2KO3A 3IFWB 3H7PB 1V86A 2DZIA 2ZEQA 3UINB 1QZEA 4ANUA 4P7IA 3VVWB 4GGQA 1ISNA 1NI2A 3M3JA 4NAWB 1YD8U 3PRMB 1EF5A 3CF6E 1RAXA 5D2MB 2WX0A 2BKRB 3AULA 2RR9A 4IC7B 2C7NB 3CSTA 2W9NA 1WJ6A 4B9KA 3B0AA 2DYOA 1E8YA 3A9JA 1P98A 4EOYA 2CR5A 2FCMA 2LXAA 4EEWA 2CHWA 2K6DB 4LDTB 3UGBB 4AOFA 4G50A 2I1KA 4GSWA 3P2BA 4ICUA 2IZVB 3R7QA 2IBIB 4WJPA 5CHVC 2JY6A 1P9DU 2KLGA 4GDLB 2LI5A 4W9JA 4W9DA 4BKGA 3DVGY 4EKUA 2K8CA 4NNJB 1V5TA 3WAPA 1OQYA 2KK8A 3EFUA 3W1SC 5KHOA 2MQJA 2KWUB 3M95A 4IWOA 2KVRA 2FNJB 5GMVA 3ZDTA 4NY0A 2N1VA 3QARA 1JRUA 2KLCA 1XQQA 2L0TA 2AEHA 4KVGB 4JL9A 3EECA 4J6IA 3A9KA 4CO7A 3T8MA 1WMHA 2C7MB 2RGFA 4GU2A 1WJUA 4JLCA 2JT4B 2ZVNA 4F1SA 2V1YA 4GDKA 1D3ZA 3OJ3A 2MP2B 4KDLB 3RZFA 3LDZE 5BO4B 3PZDA 4BOSC 2QHOA 4HDOA 4KDIC 4X57B 2GMIC 2UYZB 2MBQA 1OEYA 5L83A 4JIOU 2BPSA 2J0MA 1XT9B 4BKSD 3B08A 4TUUA 3TMPB 1VD2A 2ZJDA 5LXIB 1NBFC 3K9OB 3QHTA 2KDEB 2PJHA 1V80A 1G6JA 2IO0B 2KDIA 4XC2A 2WDTB 3VTUA 1WX9A 2FUHB 2JRHA 5DPRA 3QX1A 4MEMA 2LVOA 4W9GA 5J2RA 4BKSA 3L0WB 1YJ1A 1ZW7A 3DBHI 4FBJB 4KV2A 1UH6A 3L08A 1UZXB 4GMVA 1AARA 4RM8A 1Z2MA 1TBEA 4N9F4 2NBVB 1WR1A 5EDSA 3VTVA 2NPTA 1UBIA 4II3B 1C3TA 3ZUNA 2G45B 2LGYA 3HK0A 4WWPA 3ZTDA 3VQIA 1OTRB 2N9PC 4IG7B 3QWZB 2DZKA 2ZNVC 2D11A 1Y8RC 3SD5A 3V6EB 4YL8A 1WRDB 3QA8A 2C9WB 1UBQA 2D3GA 4EZLA 3V6CB 4M0WB 3PT2B 3ZVVA 3H1UA 2ASQA 4AUQC 4M8MA 1WX8A 2PEAA 2ZNVB 3APDA 2O6VD 2BYFA 3BY4B 1OGWA 1R4NI 2I1JA 2KJ6A 2ZZPB 4ZRJA 4WAAA 4XX5A 3PRZA 4DDID 4EZKA 2NR2A 1WFYA 2O6VA 3VH3B 4MELA 3DPDA 3KUDB 2WWZA 3EC8A 1GC7A 1YIWA 2YVCA 4W9FA 2AL6A 4HVBA 1Q1OA 4GDKB 1I42A 3ML9A 2J7QB 4MDKE 2KWVB 2KZRA 3ALBA 1OEYJ 1WF9A 3GZNI 4FHKA 2AWTA 4GB9A 3AXCA 1R4MI 4XZ4A 5G2NA 2KJHB 3DOWA 2JUOA 2RSUA 3M63B 1WIAA 4GN1A 4FLHA 3DVNU 4I6PA 1KM7A 3NOBA 1V5OA 2K39A 2KWCA 3S2AA 3WA0A 4JGHB 2CS4A 2L76A 3VH4B 1LFDA 2LVPA 2KD0A 2D2QA 4WJQA 3JSVB 5AEKB 4MJSB 4WQOB 4HDQA 2XBBC 2J0JA 2A4ZA 3DVGX 3H6NA 3OLMD 5IA7A 2LD9A 3PLVA 2MWSB 2RD0A 3R3MA 2GOWA 1WM3A 1YQBA 4WJNA 2N7DA 4NQLB 3MJWA 3UQBA 3R66C 4KIKB 2DAJA 3A1QA 3QC8B 2FIFA 2L05A 4W9HA 1E8XA 3QJZA 5FR6A 4K7SA 3U8ZA 5C23A 2MBOA 2O2VA 2A5UA 2R2QA 3NS8A 2M8SA 4E3CA 2V3SA 4A3OA 4RMAA 3KVFB 4ZDVA 4DBGA 2HTHA 1SE9A 4HK2A 4IM3A 3RCZA 1WX7A 1A5RA 3ZIMA 4W9EA 2NS5A 3DBLI 3DQVA 4B6WA 2GBJA 5TR5A 2KMAA 5E6OA 3TJPA 3VXWA 2LRUA 3KYCD 2XK5A 3A4SC 3TL5A 2DZJA 5LXHA 1WGHA 2K6QA 2MBBB 3PTFC 4TQ1A 4TV3A 3V61A 2KX0A 2L8JA 5D6JB 4AJWA 2O6VB 4MGZE 4PYZA 1E90A 2KHWB 5HKHA 2BYEA 4DHZE 1M94A 4FULA 1UD7A 2MCNB 4IUMB 2L3ZA 2EMSA 5CTRC 4WWNA 1KLVA 2WYQA 3GOEA 3N3KB 1WR6E 2KDFB 3ZNHB 4I6LB 2KJRA 2LWPA 3VDZA 1WE7A 2RPQA 2NVUI 2PE6B 1WJNA 3PPAA 1WM2A 2KX3A 2D10A 2JZ3B 2IO2B 2EMTA 4ICVA 5D7GA 2LGXA 3PRPB 5J17A 2NCNA 4BBNC 4IM0A 3I3TB 2KNBA 3RZWC 3IVFA 3Q3FA 4MSQB 2HE7A 2FCNA 2CU1A 4AP4C 3T9LA 1S1QB 3IBEA 2JRIB 4A3PA 3QQ8B 4G0NB 2M17A 5LLIA 3ZO5B 1GG3A 3ZLZA 4ASWC 2O2VB 5IAAC 4DWFA 1K8RB 3QIJA 2KDBA 4W9LA 3JVZX 4ANWA 4ZRKA 4FHJA 4E74A 2IY1B 2KXJA 2XEWA 3JW0X 4LJPB 3MHSD 2LJ5A 4G11A 2ZPNA 1WGRA 2VRRB 3EHVA 1J8CA 5DCNA 4HWIB 4JQWC 2MBEA 3KH0A 4HPLB 5KHQA 4I6NB 3VFKA 3KW5B 1WH3A 2K8BA 2FCSA 2XK5B 3PGEA 4MGKE 1HE8A 5AZFA 3ZKJC 4NAWA 3PVLA 2N7EA 3V60A 4F7ZA 3ZRCA 1GUAB 3ZNZB 3DDCB 3IHPC 3ZDMC 5CHWA 3VHTC 2DZMA 4BFRA 4FJVB 4HJKA 4IW0A 1H8CA 3A9KB 4GIVA 4K7UA 3APFA 1WMHB 2DAFA 5AZGA 1WI0A 5CX3A 3ZTCA 4LJOB 3X0WA 4EFOA 1EF1A 3RYTA 5D94A 3UIOB 2N4FA 3UQAA 1J0GA 3KUCB 3HM6X 4WJOA 5E6PA 1WZ3A 1KJTA 1E7UA 3AU5A 4GDLA 1EUVB 3PSEB 1GC6A 3L17A 3PV1A 3SU8X 2BF8B 2DYBA 1V81A 3ZNGC 1WXAA 1EO6A 1TTNA 2N9EB 4NJ7A 2Z59B 4F8CB 1Q5WB 3R7RA 2B3AA 1TGZB 2KC1A 4TKNA 3TIXA 2BKFA 4K7WA 3OAWA 4E71A 1WE6A 4BBNF 2KFJA 1IYFA 1TZ1A 2KQ7A 3AI5A 3DBRI 4W9CA 2IO3B 3HIZA 4KSLC 4DDGD 2N1WA 1LM8B 2EKEC 1CMXB 3A4RA 4OVUA 1VCBA 3C0RB 2NPTB 2MP2A 1V9JA 2LGDA 2MW5A 2DX5B 1MG8A 1P1AA 2LASA 2FCQA 3LJ3A 4IWQA 3ZW3A 4ANVA 2D07B 4FN2A 4BKTA 3H7SA 3D32A 1E8WA 2NBUA 4CYEA 4K81A 2DENB 4K1RB 2BGFA 4DHJD 1J19A 2K1FA 3RD2A 2IO1B 3RT3B 4HPMB 2BYVE 5JH5C 3PHWB 2DHZA 3HM3A 1SIFA 1L7YA 2K8HA 3KUZA 1SGHA 3B1LX 3TBLD 3WAMA 5JHAA 1S3SG 1WY8A 2G3QB 3X23A 2KFKA 3DBSA 4MM3A 5E6NA 4PS8A 4M8NA 1E5WA 3NZSA 5DPTA 5AZHA 2LXCA 2M1MA 4CHKA 1P0RA 1WXMA 4TQ0A 4LCDE 3QAQA 2OOBB 3N30A 1V6EA 4MH0E 1WZ0A 2R2OA 4RM9A 5DPSA 1H4RA 2GBNA 1GNUA 1WGDA 3VAWA 3QCAA 2Z0EB 4AJYB 3JYUA 3AU4A 4FA6A 2YLMA 4PS7A 4NJ6A 1ZKHA 1LXDA 2MBHA 3OJ4B 4HLEA 4NPNA 1FXTB 3HHMA 1WXSA 1P3QU 1YX6B 2REXA 2GBMA 2UWQA 5JZEB 1WXVA 3RULA 2NBWB 4URKA 1RRBA 2KOXA 2KTRA 2ZCCA 1BT0A 3SDLC 3WANA 1IPGA 4EUTA 3V62A 1T0YA 1XD3B 4IWPA 1WJ4A 5G55A 2JXXA 5C1ZA 3ZRFA 2PE9A 2LVQA 1X1MA 2FIDA 3A1QB 4AWJA 4HCNB 2KANA 4OVVA 4PS3A 2L7RA 2LZ6A 3VUXA 1YX5B 4BOZB 1WGGA 2G4SA 3CSFA 3K9PB 3W1YA 1UGMA 3VUYA 1WGYA
chains in the Genus database with same CATH superfamily
2JPHA 1D5XC 3WALA 2J0KA 5HG2A 2KN5A 4NZLB 3NHEB 4WWOA 4MJSA 1R4NB 2MSED 1N62A 4ZYNA 3BINA 1XCTL 3ZYYX 4BVUC 4LDTD 4WIPA 2JZZA 2M0XA 2INCC 1F9JA 1Q10A 1HTQA 3U7DA 2KC2A 4KZCA 2G1EA 1T5XD 4RFBA 2WDVB 2IY0B 1F2RC 3P4QB 2N9XA 3VR8B 3ZNID 2M4NA 2G4DB 1JWAD 3U4EG 1TY0A 3HVZA 4RF1A 2KAJA 4GXBA 4XWWA 1YN3A 3ABVB 4DK5A 2PKOA 4G3XB 4ITKA 1JROA 2ZPYA 1VLBA 2WX1A 4PYUA 1SEBD 2MLBA 1SF0A 2BWFA 1PGXA 1E0ZA 3FKYA 3C8YA 2K22A 2MA9B 1DYQA 3MTNB 3W1SA 3TCAA 2MRPA 3EFCA 1V1PA 1FO4A 4YXDB 2C7HA 1JALA 2OEDA 5CHFA 1B1ZA 2WXKA 2MX2A 4YSYB 2TSSA 2KMCA 1PQSA 3IFWB 2QDFA 3TEYA 1V86A 2DZIA 3UINB 4P7IA 2LJIA 1HXYD 1EF5A 2BKRB 3AULA 3AV8A 5BYRA 1P98A 3KLSX 4REZA 4LNIA 4EEWA 3UGBB 3ZJUA 1A70A 4ICUA 3R7QA 5T8IA 2WP9B 1P9DU 4LK0M 1EU4A 2LI5A 4W9JA 4N58A 4OZCA 2MQJA 2KWUB 4P1BC 3Q14C 2FNJB 3ZDTA 1JRUA 1XQQA 4IKGA 1UGJA 3FILB 4HRSA 3T8MA 4A8XC 4GU2A 2JT4B 1D3ZA 3VRAB 3OJ3A 2LFIA 1V97A 1SE3A 4HDOA 2MBQA 1OEYA 5L83A 4JIOU 3B08A 4TUUA 3TMPB 5MPOA 2D3AA 1DOYA 2KDEB 1N60A 2BVCA 2WDTB 3VTUA 3QX1A 4MEMA 2LVOA 4W9GA 2K0PA 3DBHI 4KV2A 1UH6A 1AARA 4RM8A 3ZGZA 1Z2MA 2KACA 1CJEA 2NBVB 1IBXB 3ZUNA 2G45B 3HK0A 2DZKA 2ZNVC 2D11A 1Y8RC 3QA8A 1UBQA 4M02A 3V6CB 2M56B 3H1UA 3DWMA 4CQNA 1WWTA 1WX8A 2PEAA 2ZNVB 2NTSA 3DHHC 2WGSA 4A90A 2N0SB 1N5XA 3W5VB 1OQRA 1PGBA 3DPDA 3KUDB 2WWZA 3NZ3A 1GC7A 4HVBA 2AL6A 2WXRA 1JWSD 2WXGA 3ALBA 2AWTA 3AE9B 4FLHA 3DVNU 3UI3A 2KWCA 4JGHB 3CWIA 1QT9A 2CS4A 2D2QA 3BVMA 5JXVA 3OLMD 5C3JB 3H6NA 5IA7A 2L52A 1E9MA 1YN4A 3MJWA 1HQRD 4YTMB 1ZXHA 2FIFA 4W9HA 4XDDA 5FR6A 2R2QA 4E3CA 4A3OA 1QQRA 3HRDD 2HTHA 1SE9A 4IM3A 1PUTA 1IGCA 1A5RA 1XO3A 3DQVA 2IGGA 1MI0A 2KMAA 3TSSA 3TJPA 3KYCD 3A4SC 1WGHA 2O6VB 4PYZA 2KHWB 1EU3A 4IUMB 2EMSA 1JWUD 2PMVA 3BVZA 3GOEA 2KDMA 3N3KB 2LWPA 3AE7B 1WM2A 1Y56A 3RNAC 2IO2B 4ICVA 2LGXA 1BMLC 3Q3NC 3PRPB 2E3TA 1AN8A 4BBNC 1MHXA 2FCNA 1JW9D 3AE3B 3T9LA 3IBEA 4J3OD 4G0NB 1TS5A 2M17A 3ZO5B 4ASWC 3AEAB 1K8RB 3QIJA 4ANWA 4ZRKA 2IY1B 3JW0X 5BYQA 5IP4D 4LNKA 3Q6BA 1KFYB 1K50A 1WYGA 4I6NB 5BMHA 1WH3A 4C7ZA 2FCSA 3ZKJC 5IOIA 3PVLA 4F7ZA 1GUAB 1YNTE 3DDCB 3LB8C 3ZDMC 3MP9A 2BS4B 2DZMA 2ONQA 3ZJTA 4AS1A 4IW0A 1H8CA 2E6XA 3APFA 5CX3A 4LJOB 1EF1A 3RYTA 3UIOB 3HM6X 5HHDG 3EUB2 1E7UA 1SJED 1EUVB 3ZXVA 3SU8X 1EO6A 1Q5WB 2B3AA 1F2RI 3I5JC 2BKFA 4K7WA 1GAQB 1TZ1A 2MHJA 2IO3B 3FILA 1MJDA 1VCBA 3C0RB 2NPTB 3OG5A 1D5ZC 1P1AA 2LASA 2FCQA 4IWQA 1E8WA 4CYEA 3R2IA 4AQ7A 4K1RB 3I63C 2BGFA 4DHJD 2K1FA 1FCLA 1D6EC 1SGHA 3TBLD 3WAMA 3X23A 4HEA1 1P0RA 1WXMA 3Q69A 2YEPF 1V6EA 2DWQA 4OVZA 1PYWD 3VAWA 2Z0EB 1FCCC 4OZBA 1FXAA 3OJ4B 1TS2A 2JYEA 2SEBD 2NBWB 4URKA 2KOXA 3SDLC 2ZCCA 1BT0A 2WXPA 3DBHB 1XD3B 4IWPA 1KLGD 3ZRFA 1JWMD 1X1MA 1RM6C 4AWJA 4PS3A 3VUXA 1YX5B 3K9PB 4ZHOA 3W1YA 1WGYA 3APCA 2K25A 3KYDD 1E7VA 1YN5A 4DXAB 1FD6A 4RGTA 2RDHA 2MJEA 2AL3A 1T0QC 2GBKA 5C2TB 2AYOB 3QK0A 1L6VA 2JYTA 4FJYA 3NVVA 2KFKB 1FIQA 4MM3B 2JZPA 3AECB 3PS6A 3RNGC 1ZDXA 1JCKB 2CKHB 1NDDA 1ZUD2 3Q3MC 1V49A 1D4BA 4MACA 3DVNV 3PHXB 3IXSA 3L16A 2HJ8A 4ANXA 3ONSA 2C60A 4RGOS 3UIPB 3AE5B 4HROA 3N32A 2L0FA 4NQKE 1HA5A 1ZP0B 3Q3JA 2LRWA 2OJRA 2KQSA 1WYWB 1L4DB 5DPWA 2C5LC 4MGIE 3AB5A 1C9FA 4USAA 2Z8LA 2CHZA 3V05A 4H2AA 2QSDA 3A9JB 3WAOA 4DHZB 4L23A 4II2B 2ZCBA 3V3XA 3VUWA 2Z0DB 5AUKA 3PLUA 2V4IB 3H7PB 2ZEQA 4A6QA 1L0XB 1ISNA 3M3JA 1YD8U 2AQ3B 1J7BA 1E10A 4HJGE 5D2MB 2RR9A 2C7NB 3CSTA 2W9NA 1L0VB 5FKAC 1NYRA 2FCMA 3NRZA 3N1ZC 2CHWA 2K6DB 4LDTB 4AOFA 3GB1A 2I1KA 2WXLA 3LXFA 1NI3A 5CHVC 1TT5B 2KLGA 2RDGA 2B76B 2W82A 1I4QA 2R61A 3EFUA 2DNFA 1GB1A 3QARA 2L0TA 2AEHA 1VR9A 4KVGB 4JL9A 3EECA 2JU6X 1L6UA 2V3NA 2V1YA 4GDKA 1KF6B 4ZYSA 4X57B 2GMIC 2SAKA 4LLGM 3PO0A 2J0MA 1L5PA 3I9V1 2ZJDA 5LXIB 1M4VA 3QHTA 4XE0A 2WXOA 2PJHA 1V80A 2M0AA 2IO0B 2KDIA 2WNMA 2FUHB 2JRHA 5DPRA 5J2RA 1FMAD 4BKSA 1JRPA 3L08A 1UZXB 1QF6A 2WU2B 2EELA 2NPTA 1UBIA 1C3TA 2LGYA 3VQIA 2N9PC 4IG7B 4LNFA 3V6EB 5H92C 4YL8A 1V8CA 2ASQA 3NS1A 4M8MA 3URYA 4N59A 4ARCA 3BY4B 1PDXA 4JWUC 4ZRJA 4MH8A 4DXGA 2BS2B 4DDID 5BMGA 4EZKA 2JX5A 4MELA 1F1HA 1D5MC 1QOGA 3EC8A 2YVCA 5G5GA 1Q1OA 4WQMA 4C00A 2KWVB 3RZFA 1WF9A 4FHKA 4XZ4A 1R4MI 3DOWA 4GN1A 4I6PA 2K39A 3VH4B 2Y5CA 2LVPA 2KD0A 3P4RB 3JSVB 5AEKB 3DBLB 2XBBC 2J0JA 2A4ZA 1YQBA 5E6JA 3T3NA 2N7DA 1CQVA 4HPPA 2JSVX 1E8XA 3QJZA 3U8ZA 3VR9B 2KT7A 2BT6A 2A5UA 1FFUA 2KWDA 4RMAA 4K3BA 2W54A 2J4XA 3E56A 3KVFB 1PGAA 4DBGA 4HK2A 4KKIA 4B6WA 1F52A 5TR5A 3VXWA 2LRUA 4MT5A 2K6QA 4TV3A 3PTFC 3BIID 4AJWA 2INDC 4MGZE 3FAHA 5HKHA 2BYEA 3LYYA 1M94A 4FULA 1UD7A 4WWNA 3ZNHB 3VDZA 1WE7A 2RPQA 3W2DA 2PE6B 2AQ1B 2BYTA 5D7GA 2MEKA 2RMMA 4P6VF 2KNBA 3R8BA 1V1OA 3RZWC 3Q3FA 1CZPA 2VH1A 3P42A 2HE7A 1N61A 2J42A 4AP4C 5H8YE 2JRIB 1DOIA 2D3CA 3ZLZA 2O2VB 3W9CB 3FC4A 2QJLA 3NVWA 3I57A 4FHJA 1SJHD 4E74A 3J9CA 4G11A 2ZPNA 1TKEA 2L83A 3GE3C 3BK2A 5DCNA 4HWIB 3KH0A 5KHQA 1FNVA 2XK5B 4MGKE 1EWYC 1MG4A 3V60A 3IHPC 5CHWA 3VHTC 4FJVB 4HJKA 3A9KB 1JWBD 4K7UA 1MPEA 4M01A 1WI0A 3AE6B 3PZ8A 3ZTCA 3WCQA 2N4FA 1YJIA 3UQAA 2YEPB 1GC6A 3ZNGC 1WXAA 3HVDA 4F8CB 4E71A 1WE6A 3DBRI 3HIZA 4KSLC 4DDGD 2N1WA 1LM8B 2EKEC 1SE4A 3RNFC 5HI1A 4XWTA 1XLOA 3LJ3A 3ZW3A 4ANVA 2D07B 3BZDB 4FN2A 5HFYA 2IO1B 4HPMB 2DHZA 1ENFA 1SIFA 2KVZA 3C19A 1EM7A 1WY8A 2GRIA 2IGHA 3MHZA 1WGKA 4M8NA 1E5WA 2VZKD 5DPTA 2M1MA 1C4AA 2BS3B 1AYFA 2FE8A 1TS3A 1JQ4A 3QAQA 1HZ6A 3N30A 2KYWA 1WZ0A 4P16A 1WGDA 3QCAA 1C76A 3Q8AA 1B9RA 3OWEB 1I4HA 1VRAB 2MBHA 1C4CA 4NPNA 3RPFC 4NJCA 1HEZE 1WXSA 1P3QU 1YX6B 3EA6A 1WXVA 1GB4A 1RRBA 2OHFA 3WANA 1IPGA 4EUTA 1T0YA 2OJWA 1BUIC 1YOVB 4OHJA 3N9YC 3A1QB 1HZ5A 2WXMA 4ZOHC 4QAYA 4OVVA 1SE2A 4BOZB 4XGAB 2IGDA 3M62B 2JF5A 1FM0D 3JSVA 2FAZA 4MSMB 1LQBA 3NY5A 3PREA 4HKQA 3ECIA 1I35A 3BK1A 2BQQA 4HCPB 4DHJB 4HXDA 3B2GA 4S0RA 1FEHA 4YT0B 2LUEA 3NG0A 3KWLA 2WS3B 4WWMA 2QIEB 1R4MB 4RNAA 4ACFA 1KOTA 4YSXB 1RLFA 1RFAA 1ZXIA 2WXHA 2JWZA 2DYMA 2PPHA 3U2SC 4DXFA 2GBRA 4KSKC 3RN9C 2J52A 1V2YA 4ZRIA 3AEGB 2KTRB 3U52E 3Q2AC 3RMKC 4FJZA 3A33B 3SEBA 1TS4A 4WAFA 4FADA 1U4AA 4M00A 4NAMA 3R2TA 2V4LA 2ZVOA 1L2NA 2BWES 3RUIB 1K52A 1GOZA 3L13A 5JHBA 4W9IA 2IYDB 1E7PB 2PLPA 5L95C 3U30A 2NTTA 1K53A 2JVCA 1T6BX 2I38A 2WQYB 4L1BA 1NI2A 3KWVA 4KGRA 3CF6E 1F77A 1QLBB 4IC7B 4B9KA 2DYOA 4EOYA 1IBXA 2CR5A 1TIFA 2LXAA 4G50A 3BYYB 3P2BA 2IZVB 2L32A 1J7AA 1TY2A 2LGSA 2K5PA 3DWGC 4W9DA 4BKGA 3DVGY 2D5GA 1MHHE 1NYQA 2K8CA 4NNJB 1V5TA 3W1SC 4TMAB 5KHOA 4IWOA 3DHGC 3CIRB 4NY0A 4ZHPA 3MFGA 1P7FA 2JWUA 4J6IA 3A9KA 2RGFA 2Y3AA 1F0ZA 1WJUA 4JLCA 4F1SA 2ZVNA 3AM9A 4KDLB 3LDZE 4BAXA 2QHOA 2W3RA 2UYZB 2BPSA 4BKSD 3MC8A 5FK9C 1NBFC 3K9OB 2QILA 1G6JA 3ETRA 3MJ5A 3L0WB 1YJ1A 1IYFA 1TBEA 4N9F4 3O13A 4LNNA 3ZTDA 3QWZB 2PW9A 2LEKA 4EZLA 3PT2B 3ZVVA 3AH7A 2BYFA 1XLNA 4KX6B 3Q8CA 3DBRB 4WAAA 3AE2B 4XX5A 2CJNA 3PRZA 1RYJA 2NR2A 1WFYA 2O6VA 3VH3B 2MJDA 3IT6B 5EE1A 2BW2A 1L4ZB 1N6ZA 4W9FA 1I42A 3ML9A 4JX1C 1I4PA 1FNWA 2KZRA 1OEYJ 1AWDA 3GZNI 4GB9A 5G2NA 3AXCA 2KJHB 3M63B 2RSUA 3AE8B 1WIAA 3NOBA 1V5OA 1QOFA 1YQ4B 3WA0A 1P7EA 2N9KA 2L76A 1LFDA 2UU7A 2I2YA 4WJQA 4WQOB 4HDQA 3AE1B 1SSNA 2N9LA 2LD9A 3R3MA 2RD0A 4WJNA 2GOWA 1WM3A 1LO5D 4NQLB 3UQBA 3R66C 4KIKB 1L0YB 3A1QA 3AN1A 2ON8A 2L05A 3PZ7A 3RI7C 4K7SA 4ZRQA 3NS8A 2D3BA 2V3SA 4Q2JA 3SFDB 3GE8C 4ZDVA 3RCZA 4US9A 3BWUD 3ZIMA 4W9EA 2NS5A 4PT5A 1LGRA 2GBJA 3H8HA 5E6OA 4YTPB 4YSZB 3TL5A 2DZJA 5LXHA 2MBBB 2WXQA 3V61A 2L8JA 3EGRA 5D6JB 4C80A 1DGJA 5CTRC 2L3ZA 4ZRPA 4RCOA 4I6LB 1UWXA 3P63A 1TJEA 1WJNA 2XNAC 3PPAA 2D10A 2KX3A 2JZ3B 1YQ3B 2HDEA 4DQOC 5J17A 1XLQA 2M19A 1S1QB 3QQ8B 1GG3A 3U7ZA 1RFKA 2WDRB 4W9LA 2KDBA 1XEEA 3JVZX 2KXJA 4C4VB 3W5UB 2V9HA 1XF5L 4LJPB 2LJ5A 2WXIA 1ZE3D 5BMIA 2VRRB 2MBEA 1PFDA 1I4XA 3PGEA 1HE8A 4JPSA 2QEJC 2N7EA 3ZRCA 3ZNZB 4BFRA 1NEKB 4B0MA 2NMQA 1WMHB 2PVGC 1DOXA 3KQ4A 1QKZA 3KUCB 2MH7A 1UF0A 3AU5A 3L17A 2DYBA 1V81A 2IPKD 2N9EB 2Z59B 2V0GA 2KC1A 4TKNA 3OAWA 3AEFB 2DBYA 2KQ7A 5GXGB 4C7YA 1CMXB 3A4RA 5AUIA 4XYCA 1V9JA 2LGDA 2BBCA 1MG8A 4BKTA 3H7SA 3D32A 2NBUA 3RFZB 2L1AA 2JXTA 1J19A 3RD2A 5FR3A 3PHWB 4US8A 3IT4B 3KUZA 1L7YA 2K8HA 4L2YA 5JHAA 3RNCC 2G3QB 2KFKA 1ZDVA 3DBSA 4MM3A 5AZHA 4CHKA 4TQ0A 1WSPA 4LCDE 5G5HA 4OW0A 4MH0E 4RM9A 2R2OA 1BXTA 2H88B 1H4RA 4O1NA 5BYSA 4AJYB 3JYUA 2YLMA 3Q8FA 4PS7A 1FPYA 4NJ6A 4HLEA 3HHMA 5EE3A 2GBMA 3RULA 1ACCA 4WH4A 3RNEC 2XN9C 1VJKA 1E6EB 2V3PA 2IJ0A 2JXXA 4IOIE 5C1ZA 2PE9A 1C78A 1VZ6A 2LUMA 2BB6A 1VZ8A 1WGGA 2G4SA 3CSFA 3A9JA 1K51A 4W9KA 2KMMA 2HD5B 3AE4B 1UELA 1I4RA 2JQRB 3GP7A 4GOCA 4BZAA 3H7PA 3IG3A 2Y5BB 4XDCA 4KIKA 4EE2A 2K3UA 3UF8A 4A20A 1I4GA 2MJ3A 3GZNB 4RF0A 2QMTA 3L54A 1Q0WB 3H9DA 1T3QA 2VZKB 1E8ZA 3CMMB 3WIMA 1IUEA 3ZQ4A 2PVOD 2LMCA 3ENEA 5J18A 2INNE 2QCZA 3SHQA 4IM2A 1YJJA 4A9AA 2KTFA 3BYTB 2KKCA 3NZUA 3L10B 2WHIA 2K9XA 1GJZA 1C1YB 4D2KA 1C77A 3AEBB 2W55A 2KN4A 2INPE 1Z5SB 4EZJA 3VTWA 2CHXA 2ZW0A 1TZOA 2RDBC 2L00B 1IP9A 4IDIA 3ML8A 4KZ0A 4YTNB 4MGYE 3HUIA 1ZGUB 3TEWA 3O65B 4B95A 3DCGA 1VDVA 2KO3A 3AEEB 4JE3B 4ANUA 2DLBA 1QZEA 4K3CA 3VVWB 4GGQA 1SXTA 4NAWB 3PRMB 4LTUA 4B0EA 1RAXA 2WX0A 2WLBA 1WJ6A 3B0AA 1E8YA 2QC8A 3TEZA 1QILA 3E9SA 2ICIA 4C4VA 1T0SC 1ROEA 4GSWA 3T3OA 1UUPA 2IBIB 1QOAA 2JY6A 4GDLB 2J53A 4PK1A 4EKUA 3WAPA 1FRRA 1OQYA 2KK8A 3M95A 1CK1A 2KVRA 5GMVA 2N1VA 2KLCA 4CO7A 1EWCA 1WMHA 2C7MB 1ET6A 5IKCM 2MP2B 4BOSC 5BO4B 3PZDA 4KDIC 1JMLA 2RPVA 3ZXRA 1XT9B 1VD2A 1WRIA 4WURA 4HKZE 4XC2A 1ZOYB 1WX9A 1ZW7A 4FBJB 3P4PB 4GMVA 3Q8EA 2W3SA 1WR1A 3TEXA 3VTVA 5EDSA 4II3B 4WWPA 1OTRB 1FRDA 3SD5A 2LHDA 1WRDB 2C9WB 5EE0A 2D3GA 1C4PA 4M0WB 4JWSC 4AUQC 4KKJA 1N5WA 1UNSA 3RNBC 3IAM1 2WXFA 2O6VD 3APDA 4OZAA 1OGWA 1FXIA 2KQ4X 1R4NI 2I1JA 2KJ6A 2ZZPB 3NVYA 4LNOA 3NJTA 5I4DA 2ACZB 1YMHE 1FFVA 1YIWA 4GDKB 2J7QB 1KTKA 4MDKE 4WJPA 5JH5C 4RGNA 2GB1A 2JUOA 1KM7A 5EE9A 3S2AA 1SBBB 3VRBB 1N63A 2LHEA 3L4PA 4MJSB 4TSSA 3SFEB 1AW7A 2CJOA 3DVGX 3PLVA 2MWSB 3NVZA 1C79A 2DAJA 4RGMA 3QC8B 4ARIA 5C23A 2MBOA 2O2VA 2M8SA 1UWMA 3MC9A 1WX7A 3DBLI 2XK5A 2IDYA 3P4SB 4TQ1A 2KX0A 1E90A 4R3DA 4KGSA 4DHZE 2MCNB 2N7JA 1KLVA 2WYQA 4P1CC 1MFWA 1WR6E 1V1PB 2KDFB 2GI9A 4N6EB 1I7HA 2KJRA 3IAS1 2NVUI 3AMZA 1GPXA 1ZPSA 1OQQA 2LGIA 3SR6A 2EMTA 5LNK1 2PIAA 1TKYA 2NCNA 4IM0A 3I3TB 5D3IB 3IVFA 4RH6A 4MSQB 1NENB 2CU1A 2Q5WD 1STEA 4A3PA 5IO9A 5LLIA 3N20C 3MC0B 4KGTA 5IAAC 4DWFA 2AX5A 3TUOA 2XEWA 1KLUD 3B9JA 1XXGA 1R7SA 3MHSD 1TYGB 1WGRA 3EHVA 2GLSA 1J8CA 1J7CA 4JQWC 4HPLB 2H89B 3VFKA 3KW5B 2K8BA 5AZFA 3GS2A 4NAWA 2WU5B 1IGDA 1XLPA 3B2FA 3N1XC 4GIVA 5AZGA 2DAFA 4UDUC 4EFOA 3X0WA 5D94A 1J0GA 2BB5A 4WJOA 5E6PA 1WZ3A 1KJTA 2AQ2B 4GDLA 3PSEB 4GLSC 1SIJA 3BVGA 3PV1A 2HJ1A 2BF8B 3NUHB 1TTNA 4NJ7A 3Q8BA 3R7RA 1NVID 1TGZB 3TIXA 4BBNF 2KFJA 3AI5A 4W9CA 1VZ7A 1T0RC 2X8XX 2HTME 1WXQA 2PTLA 1FNUA 3Q3OC 4OVUA 1KRHA 5D3DA 2MP2A 2MW5A 2DX5B 1RWSA 4FXCA 1TKGA 2CU3A 4K81A 1KH0A 1ESFA 2DENB 1MVKA 3RT3B 2BYVE 2BTEA 3HM3A 3B1LX 4A55A 1S3SG 5E6NA 4PS8A 4C56C 3AEDB 1ET9A 3NZSA 2LXCA 5TSSA 3DHIC 2OOBB 2G9HD 1SB3C 1OFFA 5DPSA 2FUG1 2WDQB 2GBNA 1GNUA 2ZW1A 3ZJVA 4M0WA 1XCQL 3AU4A 4FA6A 1HTOA 1ZKHA 1LXDA 1QOBA 1FXTB 3N1YC 2EKIA 2X38A 2REXA 4YWGG 2UWQA 5JZEB 2KTRA 2Y5PA 2VH2A 3V62A 3P1MA 1WJ4A 5G55A 2FBWB 2LVQA 4S17A 2FIDA 5IN7A 2WXJA 2WXNA 4HCNB 2KANA 2L7RA 2LZ6A 1UGMA 3VUYA
chains in the Genus database with same CATH topology
2JPHA 3APCA 4W9KA 2K25A 3KYDD 3M62B 1E7VA 2J0KA 3WALA 4DXAB 2HD5B 1UELA 2JF5A 2KN5A 3NHEB 3JSVA 4WWOA 2FAZA 4MSMB 2AL3A 4MJSA 1LQBA 2GBKA 3NY5A 2MSED 4GOCA 2AYOB 3QK0A 3PREA 1I35A 3ECIA 4FJYA 3H7PA 4ZYNA 3IG3A 2Y5BB 2KFKB 4HCPB 4DHJB 4HXDA 3BINA 4KIKA 3PS6A 4BVUC 4LDTD 2JZZA 3UF8A 4A20A 2M0XA 2CKHB 1NDDA 1F9JA 2LUEA 3U7DA 2KC2A 1V49A 4KZCA 3L54A 2IY0B 1Q0WB 3DVNV 3PHXB 1KOTA 3H9DA 1RLFA 2N9XA 1RFAA 3ZNID 2JWZA 2M4NA 2G4DB 1E8ZA 3L16A 3CMMB 2DYMA 2PPHA 3WIMA 2GBRA 2HJ8A 4KSKC 4ANXA 4GXBA 1V2YA 3ONSA 2C60A 3ENEA 3UIPB 5J18A 3SHQA 4ZRIA 4IM2A 2KTRB 4DK5A 2KTFA 4G3XB 2KKCA 3N32A 2L0FA 4NQKE 2ZPYA 3NZUA 3L10B 1GJZA 2WX1A 1C1YB 4FJZA 3A33B 4PYUA 2MLBA 2BWFA 3Q3JA 1U4AA 2LRWA 4FADA 1Z5SB 2OJRA 2KQSA 2CHXA 2MA9B 2V4LA 1WYWB 2ZVOA 3VTWA 4EZJA 5DPWA 2BWES 2C5LC 3MTNB 3W1SA 4MGIE 3TCAA 1L2NA 2MRPA 3RUIB 3L13A 5JHBA 2C7HA 4W9IA 2CHZA 2IYDB 2L00B 3A9JB 1IP9A 5L95C 3ML8A 3WAOA 3U30A 5CHFA 4DHZB 4KZ0A 4II2B 2MX2A 4MGYE 2ZCBA 3VUWA 2JVCA 2KMCA 2Z0DB 1ZGUB 3O65B 3PLUA 4B95A 3DCGA 1PQSA 2KO3A 3IFWB 3H7PB 1V86A 2DZIA 2ZEQA 3UINB 1QZEA 4ANUA 4P7IA 3VVWB 4GGQA 1ISNA 1NI2A 3M3JA 4NAWB 1YD8U 3PRMB 1EF5A 3CF6E 1RAXA 5D2MB 2WX0A 2BKRB 3AULA 2RR9A 4IC7B 2C7NB 3CSTA 2W9NA 1WJ6A 4B9KA 3B0AA 2DYOA 1E8YA 3A9JA 1P98A 4EOYA 2CR5A 2FCMA 2LXAA 4EEWA 2CHWA 2K6DB 4LDTB 3UGBB 4AOFA 4G50A 2I1KA 4GSWA 3P2BA 4ICUA 2IZVB 3R7QA 2IBIB 4WJPA 5CHVC 2JY6A 1P9DU 2KLGA 4GDLB 2LI5A 4W9JA 4W9DA 4BKGA 3DVGY 4EKUA 2K8CA 4NNJB 1V5TA 3WAPA 1OQYA 2KK8A 3EFUA 3W1SC 5KHOA 2MQJA 2KWUB 3M95A 4IWOA 2KVRA 2FNJB 5GMVA 3ZDTA 4NY0A 2N1VA 3QARA 1JRUA 2KLCA 1XQQA 2L0TA 2AEHA 4KVGB 4JL9A 3EECA 4J6IA 3A9KA 4CO7A 3T8MA 1WMHA 2C7MB 2RGFA 4GU2A 1WJUA 4JLCA 2JT4B 2ZVNA 4F1SA 2V1YA 4GDKA 1D3ZA 3OJ3A 2MP2B 4KDLB 3RZFA 3LDZE 5BO4B 3PZDA 4BOSC 2QHOA 4HDOA 4KDIC 4X57B 2GMIC 2UYZB 2MBQA 1OEYA 5L83A 4JIOU 2BPSA 2J0MA 1XT9B 4BKSD 3B08A 4TUUA 3TMPB 1VD2A 2ZJDA 5LXIB 1NBFC 3K9OB 3QHTA 2KDEB 2PJHA 1V80A 1G6JA 2IO0B 2KDIA 4XC2A 2WDTB 3VTUA 1WX9A 2FUHB 2JRHA 5DPRA 3QX1A 4MEMA 2LVOA 4W9GA 5J2RA 4BKSA 3L0WB 1YJ1A 1ZW7A 3DBHI 4FBJB 4KV2A 1UH6A 3L08A 1UZXB 4GMVA 1AARA 4RM8A 1Z2MA 1TBEA 4N9F4 2NBVB 1WR1A 5EDSA 3VTVA 2NPTA 1UBIA 4II3B 1C3TA 3ZUNA 2G45B 2LGYA 3HK0A 4WWPA 3ZTDA 3VQIA 1OTRB 2N9PC 4IG7B 3QWZB 2DZKA 2ZNVC 2D11A 1Y8RC 3SD5A 3V6EB 4YL8A 1WRDB 3QA8A 2C9WB 1UBQA 2D3GA 4EZLA 3V6CB 4M0WB 3PT2B 3ZVVA 3H1UA 2ASQA 4AUQC 4M8MA 1WX8A 2PEAA 2ZNVB 3APDA 2O6VD 2BYFA 3BY4B 1OGWA 1R4NI 2I1JA 2KJ6A 2ZZPB 4ZRJA 4WAAA 4XX5A 3PRZA 4DDID 4EZKA 2NR2A 1WFYA 2O6VA 3VH3B 4MELA 3DPDA 3KUDB 2WWZA 3EC8A 1GC7A 1YIWA 2YVCA 4W9FA 2AL6A 4HVBA 1Q1OA 4GDKB 1I42A 3ML9A 2J7QB 4MDKE 2KWVB 2KZRA 3ALBA 1OEYJ 1WF9A 3GZNI 4FHKA 2AWTA 4GB9A 3AXCA 1R4MI 4XZ4A 5G2NA 2KJHB 3DOWA 2JUOA 2RSUA 3M63B 1WIAA 4GN1A 4FLHA 3DVNU 4I6PA 1KM7A 3NOBA 1V5OA 2K39A 2KWCA 3S2AA 3WA0A 4JGHB 2CS4A 2L76A 3VH4B 1LFDA 2LVPA 2KD0A 2D2QA 4WJQA 3JSVB 5AEKB 4MJSB 4WQOB 4HDQA 2XBBC 2J0JA 2A4ZA 3DVGX 3H6NA 3OLMD 5IA7A 2LD9A 3PLVA 2MWSB 2RD0A 3R3MA 2GOWA 1WM3A 1YQBA 4WJNA 2N7DA 4NQLB 3MJWA 3UQBA 3R66C 4KIKB 2DAJA 3A1QA 3QC8B 2FIFA 2L05A 4W9HA 1E8XA 3QJZA 5FR6A 4K7SA 3U8ZA 5C23A 2MBOA 2O2VA 2A5UA 2R2QA 3NS8A 2M8SA 4E3CA 2V3SA 4A3OA 4RMAA 3KVFB 4ZDVA 4DBGA 2HTHA 1SE9A 4HK2A 4IM3A 3RCZA 1WX7A 1A5RA 3ZIMA 4W9EA 2NS5A 3DBLI 3DQVA 4B6WA 2GBJA 5TR5A 2KMAA 5E6OA 3TJPA 3VXWA 2LRUA 3KYCD 2XK5A 3A4SC 3TL5A 2DZJA 5LXHA 1WGHA 2K6QA 2MBBB 3PTFC 4TQ1A 4TV3A 3V61A 2KX0A 2L8JA 5D6JB 4AJWA 2O6VB 4MGZE 4PYZA 1E90A 2KHWB 5HKHA 2BYEA 4DHZE 1M94A 4FULA 1UD7A 2MCNB 4IUMB 2L3ZA 2EMSA 5CTRC 4WWNA 1KLVA 2WYQA 3GOEA 3N3KB 1WR6E 2KDFB 3ZNHB 4I6LB 2KJRA 2LWPA 3VDZA 1WE7A 2RPQA 2NVUI 2PE6B 1WJNA 3PPAA 1WM2A 2KX3A 2D10A 2JZ3B 2IO2B 2EMTA 4ICVA 5D7GA 2LGXA 3PRPB 5J17A 2NCNA 4BBNC 4IM0A 3I3TB 2KNBA 3RZWC 3IVFA 3Q3FA 4MSQB 2HE7A 2FCNA 2CU1A 4AP4C 3T9LA 1S1QB 3IBEA 2JRIB 4A3PA 3QQ8B 4G0NB 2M17A 5LLIA 3ZO5B 1GG3A 3ZLZA 4ASWC 2O2VB 5IAAC 4DWFA 1K8RB 3QIJA 2KDBA 4W9LA 3JVZX 4ANWA 4ZRKA 4FHJA 4E74A 2IY1B 2KXJA 2XEWA 3JW0X 4LJPB 3MHSD 2LJ5A 4G11A 2ZPNA 1WGRA 2VRRB 3EHVA 1J8CA 5DCNA 4HWIB 4JQWC 2MBEA 3KH0A 4HPLB 5KHQA 4I6NB 3VFKA 3KW5B 1WH3A 2K8BA 2FCSA 2XK5B 3PGEA 4MGKE 1HE8A 5AZFA 3ZKJC 4NAWA 3PVLA 2N7EA 3V60A 4F7ZA 3ZRCA 1GUAB 3ZNZB 3DDCB 3IHPC 3ZDMC 5CHWA 3VHTC 2DZMA 4BFRA 4FJVB 4HJKA 4IW0A 1H8CA 3A9KB 4GIVA 4K7UA 3APFA 1WMHB 2DAFA 5AZGA 1WI0A 5CX3A 3ZTCA 4LJOB 3X0WA 4EFOA 1EF1A 3RYTA 5D94A 3UIOB 2N4FA 3UQAA 1J0GA 3KUCB 3HM6X 4WJOA 5E6PA 1WZ3A 1KJTA 1E7UA 3AU5A 4GDLA 1EUVB 3PSEB 1GC6A 3L17A 3PV1A 3SU8X 2BF8B 2DYBA 1V81A 3ZNGC 1WXAA 1EO6A 1TTNA 2N9EB 4NJ7A 2Z59B 4F8CB 1Q5WB 3R7RA 2B3AA 1TGZB 2KC1A 4TKNA 3TIXA 2BKFA 4K7WA 3OAWA 4E71A 1WE6A 4BBNF 2KFJA 1IYFA 1TZ1A 2KQ7A 3AI5A 3DBRI 4W9CA 2IO3B 3HIZA 4KSLC 4DDGD 2N1WA 1LM8B 2EKEC 1CMXB 3A4RA 4OVUA 1VCBA 3C0RB 2NPTB 2MP2A 1V9JA 2LGDA 2MW5A 2DX5B 1MG8A 1P1AA 2LASA 2FCQA 3LJ3A 4IWQA 3ZW3A 4ANVA 2D07B 4FN2A 4BKTA 3H7SA 3D32A 1E8WA 2NBUA 4CYEA 4K81A 2DENB 4K1RB 2BGFA 4DHJD 1J19A 2K1FA 3RD2A 2IO1B 3RT3B 4HPMB 2BYVE 5JH5C 3PHWB 2DHZA 3HM3A 1SIFA 1L7YA 2K8HA 3KUZA 1SGHA 3B1LX 3TBLD 3WAMA 5JHAA 1S3SG 1WY8A 2G3QB 3X23A 2KFKA 3DBSA 4MM3A 5E6NA 4PS8A 4M8NA 1E5WA 3NZSA 5DPTA 5AZHA 2LXCA 2M1MA 4CHKA 1P0RA 1WXMA 4TQ0A 4LCDE 3QAQA 2OOBB 3N30A 1V6EA 4MH0E 1WZ0A 2R2OA 4RM9A 5DPSA 1H4RA 2GBNA 1GNUA 1WGDA 3VAWA 3QCAA 2Z0EB 4AJYB 3JYUA 3AU4A 4FA6A 2YLMA 4PS7A 4NJ6A 1ZKHA 1LXDA 2MBHA 3OJ4B 4HLEA 4NPNA 1FXTB 3HHMA 1WXSA 1P3QU 1YX6B 2REXA 2GBMA 2UWQA 5JZEB 1WXVA 3RULA 2NBWB 4URKA 1RRBA 2KOXA 2KTRA 2ZCCA 1BT0A 3SDLC 3WANA 1IPGA 4EUTA 3V62A 1T0YA 1XD3B 4IWPA 1WJ4A 5G55A 2JXXA 5C1ZA 3ZRFA 2PE9A 2LVQA 1X1MA 2FIDA 3A1QB 4AWJA 4HCNB 2KANA 4OVVA 4PS3A 2L7RA 2LZ6A 3VUXA 1YX5B 4BOZB 1WGGA 2G4SA 3CSFA 3K9PB 3W1YA 1UGMA 3VUYA 1WGYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JPH A;  3APC A;  4W9K A;  2K25 A;  3KYD D;  3M62 B;  1E7V A;  2J0K A;  3WAL A;  4DXA B;  2HD5 B;  1UEL A;  2JF5 A;  2KN5 A;  3NHE B;  3JSV A;  4WWO A;  2FAZ A;  4MSM B;  2AL3 A;  4MJS A;  1LQB A;  2GBK A;  3NY5 A;  2MSE D;  4GOC A;  2AYO B;  3QK0 A;  3PRE A;  1I35 A;  3ECI A;  4FJY A;  3H7P A;  4ZYN A;  3IG3 A;  2Y5B B;  2KFK B;  4HCP B;  4DHJ B;  4HXD A;  3BIN A;  4KIK A;  3PS6 A;  4BVU C;  4LDT D;  2JZZ A;  3UF8 A;  4A20 A;  2M0X A;  2CKH B;  1NDD A;  1F9J A;  2LUE A;  3U7D A;  2KC2 A;  1V49 A;  4KZC A;  3L54 A;  2IY0 B;  1Q0W B;  3DVN V;  3PHX B;  1KOT A;  3H9D A;  1RLF A;  2N9X A;  1RFA A;  3ZNI D;  2JWZ A;  2M4N A;  2G4D B;  1E8Z A;  3L16 A;  3CMM B;  2DYM A;  2PPH A;  3WIM A;  2GBR A;  2HJ8 A;  4KSK C;  4ANX A;  4GXB A;  1V2Y A;  3ONS A;  2C60 A;  3ENE A;  3UIP B;  5J18 A;  3SHQ A;  4ZRI A;  4IM2 A;  2KTR B;  4DK5 A;  2KTF A;  4G3X B;  2KKC A;  3N32 A;  2L0F A;  4NQK E;  2ZPY A;  3NZU A;  3L10 B;  1GJZ A;  2WX1 A;  1C1Y B;  4FJZ A;  3A33 B;  4PYU A;  2MLB A;  2BWF A;  3Q3J A;  1U4A A;  2LRW A;  4FAD A;  1Z5S B;  2OJR A;  2KQS A;  2CHX A;  2MA9 B;  2V4L A;  1WYW B;  2ZVO A;  3VTW A;  4EZJ A;  5DPW A;  2BWE S;  2C5L C;  3MTN B;  3W1S A;  4MGI E;  3TCA A;  1L2N A;  2MRP A;  3RUI B;  3L13 A;  5JHB A;  2C7H A;  4W9I A;  2CHZ A;  2IYD B;  2L00 B;  3A9J B;  1IP9 A;  5L95 C;  3ML8 A;  3WAO A;  3U30 A;  5CHF A;  4DHZ B;  4KZ0 A;  4II2 B;  2MX2 A;  4MGY E;  2ZCB A;  3VUW A;  2JVC A;  2KMC A;  2Z0D B;  1ZGU B;  3O65 B;  3PLU A;  4B95 A;  3DCG A;  1PQS A;  2KO3 A;  3IFW B;  3H7P B;  1V86 A;  2DZI A;  2ZEQ A;  3UIN B;  1QZE A;  4ANU A;  4P7I A;  3VVW B;  4GGQ A;  1ISN A;  1NI2 A;  3M3J A;  4NAW B;  1YD8 U;  3PRM B;  1EF5 A;  3CF6 E;  1RAX A;  5D2M B;  2WX0 A;  2BKR B;  3AUL A;  2RR9 A;  4IC7 B;  2C7N B;  3CST A;  2W9N A;  1WJ6 A;  4B9K A;  3B0A A;  2DYO A;  1E8Y A;  3A9J A;  1P98 A;  4EOY A;  2CR5 A;  2FCM A;  2LXA A;  4EEW A;  2CHW A;  2K6D B;  4LDT B;  3UGB B;  4AOF A;  4G50 A;  2I1K A;  4GSW A;  3P2B A;  4ICU A;  2IZV B;  3R7Q A;  2IBI B;  4WJP A;  5CHV C;  2JY6 A;  1P9D U;  2KLG A;  4GDL B;  2LI5 A;  4W9J A;  4W9D A;  4BKG A;  3DVG Y;  4EKU A;  2K8C A;  4NNJ B;  1V5T A;  3WAP A;  1OQY A;  2KK8 A;  3EFU A;  3W1S C;  5KHO A;  2MQJ A;  2KWU B;  3M95 A;  4IWO A;  2KVR A;  2FNJ B;  5GMV A;  3ZDT A;  4NY0 A;  2N1V A;  3QAR A;  1JRU A;  2KLC A;  1XQQ A;  2L0T A;  2AEH A;  4KVG B;  4JL9 A;  3EEC A;  4J6I A;  3A9K A;  4CO7 A;  3T8M A;  1WMH A;  2C7M B;  2RGF A;  4GU2 A;  1WJU A;  4JLC A;  2JT4 B;  2ZVN A;  4F1S A;  2V1Y A;  4GDK A;  1D3Z A;  3OJ3 A;  2MP2 B;  4KDL B;  3RZF A;  3LDZ E;  5BO4 B;  3PZD A;  4BOS C;  2QHO A;  4HDO A;  4KDI C;  4X57 B;  2GMI C;  2UYZ B;  2MBQ A;  1OEY A;  5L83 A;  4JIO U;  2BPS A;  2J0M A;  1XT9 B;  4BKS D;  3B08 A;  4TUU A;  3TMP B;  1VD2 A;  2ZJD A;  5LXI B;  1NBF C;  3K9O B;  3QHT A;  2KDE B;  2PJH A;  1V80 A;  1G6J A;  2IO0 B;  2KDI A;  4XC2 A;  2WDT B;  3VTU A;  1WX9 A;  2FUH B;  2JRH A;  5DPR A;  3QX1 A;  4MEM A;  2LVO A;  4W9G A;  5J2R A;  4BKS A;  3L0W B;  1YJ1 A;  1ZW7 A;  3DBH I;  4FBJ B;  4KV2 A;  1UH6 A;  3L08 A;  1UZX B;  4GMV A;  1AAR A;  4RM8 A;  1Z2M A;  1TBE A;  4N9F 4;  2NBV B;  1WR1 A;  5EDS A;  3VTV A;  2NPT A;  1UBI A;  4II3 B;  1C3T A;  3ZUN A;  2G45 B;  2LGY A;  3HK0 A;  4WWP A;  3ZTD A;  3VQI A;  1OTR B;  2N9P C;  4IG7 B;  3QWZ B;  2DZK A;  2ZNV C;  2D11 A;  1Y8R C;  3SD5 A;  3V6E B;  4YL8 A;  1WRD B;  3QA8 A;  2C9W B;  1UBQ A;  2D3G A;  4EZL A;  3V6C B;  4M0W B;  3PT2 B;  3ZVV A;  3H1U A;  2ASQ A;  4AUQ C;  4M8M A;  1WX8 A;  2PEA A;  2ZNV B;  3APD A;  2O6V D;  2BYF A;  3BY4 B;  1OGW A;  1R4N I;  2I1J A;  2KJ6 A;  2ZZP B;  4ZRJ A;  4WAA A;  4XX5 A;  3PRZ A;  4DDI D;  4EZK A;  2NR2 A;  1WFY A;  2O6V A;  3VH3 B;  4MEL A;  3DPD A;  3KUD B;  2WWZ A;  3EC8 A;  1GC7 A;  1YIW A;  2YVC A;  4W9F A;  2AL6 A;  4HVB A;  1Q1O A;  4GDK B;  1I42 A;  3ML9 A;  2J7Q B;  4MDK E;  2KWV B;  2KZR A;  3ALB A;  1OEY J;  1WF9 A;  3GZN I;  4FHK A;  2AWT A;  4GB9 A;  3AXC A;  1R4M I;  4XZ4 A;  5G2N A;  2KJH B;  3DOW A;  2JUO A;  2RSU A;  3M63 B;  1WIA A;  4GN1 A;  4FLH A;  3DVN U;  4I6P A;  1KM7 A;  3NOB A;  1V5O A;  2K39 A;  2KWC A;  3S2A A;  3WA0 A;  4JGH B;  2CS4 A;  2L76 A;  3VH4 B;  1LFD A;  2LVP A;  2KD0 A;  2D2Q A;  4WJQ A;  3JSV B;  5AEK B;  4MJS B;  4WQO B;  4HDQ A;  2XBB C;  2J0J A;  2A4Z A;  3DVG X;  3H6N A;  3OLM D;  5IA7 A;  2LD9 A;  3PLV A;  2MWS B;  2RD0 A;  3R3M A;  2GOW A;  1WM3 A;  1YQB A;  4WJN A;  2N7D A;  4NQL B;  3MJW A;  3UQB A;  3R66 C;  4KIK B;  2DAJ A;  3A1Q A;  3QC8 B;  2FIF A;  2L05 A;  4W9H A;  1E8X A;  3QJZ A;  5FR6 A;  4K7S A;  3U8Z A;  5C23 A;  2MBO A;  2O2V A;  2A5U A;  2R2Q A;  3NS8 A;  2M8S A;  4E3C A;  2V3S A;  4A3O A;  4RMA A;  3KVF B;  4ZDV A;  4DBG A;  2HTH A;  1SE9 A;  4HK2 A;  4IM3 A;  3RCZ A;  1WX7 A;  1A5R A;  3ZIM A;  4W9E A;  2NS5 A;  3DBL I;  3DQV A;  4B6W A;  2GBJ A;  5TR5 A;  2KMA A;  5E6O A;  3TJP A;  3VXW A;  2LRU A;  3KYC D;  2XK5 A;  3A4S C;  3TL5 A;  2DZJ A;  5LXH A;  1WGH A;  2K6Q A;  2MBB B;  3PTF C;  4TQ1 A;  4TV3 A;  3V61 A;  2KX0 A;  2L8J A;  5D6J B;  4AJW A;  2O6V B;  4MGZ E;  4PYZ A;  1E90 A;  2KHW B;  5HKH A;  2BYE A;  4DHZ E;  1M94 A;  4FUL A;  1UD7 A;  2MCN B;  4IUM B;  2L3Z A;  2EMS A;  5CTR C;  4WWN A;  1KLV A;  2WYQ A;  3GOE A;  3N3K B;  1WR6 E;  2KDF B;  3ZNH B;  4I6L B;  2KJR A;  2LWP A;  3VDZ A;  1WE7 A;  2RPQ A;  2NVU I;  2PE6 B;  1WJN A;  3PPA A;  1WM2 A;  2KX3 A;  2D10 A;  2JZ3 B;  2IO2 B;  2EMT A;  4ICV A;  5D7G A;  2LGX A;  3PRP B;  5J17 A;  2NCN A;  4BBN C;  4IM0 A;  3I3T B;  2KNB A;  3RZW C;  3IVF A;  3Q3F A;  4MSQ B;  2HE7 A;  2FCN A;  2CU1 A;  4AP4 C;  3T9L A;  1S1Q B;  3IBE A;  2JRI B;  4A3P A;  3QQ8 B;  4G0N B;  2M17 A;  5LLI A;  3ZO5 B;  1GG3 A;  3ZLZ A;  4ASW C;  2O2V B;  5IAA C;  4DWF A;  1K8R B;  3QIJ A;  2KDB A;  4W9L A;  3JVZ X;  4ANW A;  4ZRK A;  4FHJ A;  4E74 A;  2IY1 B;  2KXJ A;  2XEW A;  3JW0 X;  4LJP B;  3MHS D;  2LJ5 A;  4G11 A;  2ZPN A;  1WGR A;  2VRR B;  3EHV A;  1J8C A;  5DCN A;  4HWI B;  4JQW C;  2MBE A;  3KH0 A;  4HPL B;  5KHQ A;  4I6N B;  3VFK A;  3KW5 B;  1WH3 A;  2K8B A;  2FCS A;  2XK5 B;  3PGE A;  4MGK E;  1HE8 A;  5AZF A;  3ZKJ C;  4NAW A;  3PVL A;  2N7E A;  3V60 A;  4F7Z A;  3ZRC A;  1GUA B;  3ZNZ B;  3DDC B;  3IHP C;  3ZDM C;  5CHW A;  3VHT C;  2DZM A;  4BFR A;  4FJV B;  4HJK A;  4IW0 A;  1H8C A;  3A9K B;  4GIV A;  4K7U A;  3APF A;  1WMH B;  2DAF A;  5AZG A;  1WI0 A;  5CX3 A;  3ZTC A;  4LJO B;  3X0W A;  4EFO A;  1EF1 A;  3RYT A;  5D94 A;  3UIO B;  2N4F A;  3UQA A;  1J0G A;  3KUC B;  3HM6 X;  4WJO A;  5E6P A;  1WZ3 A;  1KJT A;  1E7U A;  3AU5 A;  4GDL A;  1EUV B;  3PSE B;  1GC6 A;  3L17 A;  3PV1 A;  3SU8 X;  2BF8 B;  2DYB A;  1V81 A;  3ZNG C;  1WXA A;  1EO6 A;  1TTN A;  2N9E B;  4NJ7 A;  2Z59 B;  4F8C B;  1Q5W B;  3R7R A;  2B3A A;  1TGZ B;  2KC1 A;  4TKN A;  3TIX A;  2BKF A;  4K7W A;  3OAW A;  4E71 A;  1WE6 A;  4BBN F;  2KFJ A;  1IYF A;  1TZ1 A;  2KQ7 A;  3AI5 A;  3DBR I;  4W9C A;  2IO3 B;  3HIZ A;  4KSL C;  4DDG D;  2N1W A;  1LM8 B;  2EKE C;  1CMX B;  3A4R A;  4OVU A;  1VCB A;  3C0R B;  2NPT B;  2MP2 A;  1V9J A;  2LGD A;  2MW5 A;  2DX5 B;  1MG8 A;  1P1A A;  2LAS A;  2FCQ A;  3LJ3 A;  4IWQ A;  3ZW3 A;  4ANV A;  2D07 B;  4FN2 A;  4BKT A;  3H7S A;  3D32 A;  1E8W A;  2NBU A;  4CYE A;  4K81 A;  2DEN B;  4K1R B;  2BGF A;  4DHJ D;  1J19 A;  2K1F A;  3RD2 A;  2IO1 B;  3RT3 B;  4HPM B;  2BYV E;  5JH5 C;  3PHW B;  2DHZ A;  3HM3 A;  1SIF A;  1L7Y A;  2K8H A;  3KUZ A;  1SGH A;  3B1L X;  3TBL D;  3WAM A;  5JHA A;  1S3S G;  1WY8 A;  2G3Q B;  3X23 A;  2KFK A;  3DBS A;  4MM3 A;  5E6N A;  4PS8 A;  4M8N A;  1E5W A;  3NZS A;  5DPT A;  5AZH A;  2LXC A;  2M1M A;  4CHK A;  1P0R A;  1WXM A;  4TQ0 A;  4LCD E;  3QAQ A;  2OOB B;  3N30 A;  1V6E A;  4MH0 E;  1WZ0 A;  2R2O A;  4RM9 A;  5DPS A;  1H4R A;  2GBN A;  1GNU A;  1WGD A;  3VAW A;  3QCA A;  2Z0E B;  4AJY B;  3JYU A;  3AU4 A;  4FA6 A;  2YLM A;  4PS7 A;  4NJ6 A;  1ZKH A;  1LXD A;  2MBH A;  3OJ4 B;  4HLE A;  4NPN A;  1FXT B;  3HHM A;  1WXS A;  1P3Q U;  1YX6 B;  2REX A;  2GBM A;  2UWQ A;  5JZE B;  1WXV A;  3RUL A;  2NBW B;  4URK A;  1RRB A;  2KOX A;  2KTR A;  2ZCC A;  1BT0 A;  3SDL C;  3WAN A;  1IPG A;  4EUT A;  3V62 A;  1T0Y A;  1XD3 B;  4IWP A;  1WJ4 A;  5G55 A;  2JXX A;  5C1Z A;  3ZRF A;  2PE9 A;  2LVQ A;  1X1M A;  2FID A;  3A1Q B;  4AWJ A;  4HCN B;  2KAN A;  4OVV A;  4PS3 A;  2L7R A;  2LZ6 A;  3VUX A;  1YX5 B;  4BOZ B;  1WGG A;  2G4S A;  3CSF A;  3K9P B;  3W1Y A;  1UGM A;  3VUY A;  1WGY A; 
#chains in the Genus database with same CATH topology
 2JPH A;  1D5X C;  3WAL A;  2J0K A;  5HG2 A;  2KN5 A;  4NZL B;  3NHE B;  4WWO A;  4MJS A;  1R4N B;  2MSE D;  1N62 A;  4ZYN A;  3BIN A;  1XCT L;  3ZYY X;  4BVU C;  4LDT D;  4WIP A;  2JZZ A;  2M0X A;  2INC C;  1F9J A;  1Q10 A;  1HTQ A;  3U7D A;  2KC2 A;  4KZC A;  2G1E A;  1T5X D;  4RFB A;  2WDV B;  2IY0 B;  1F2R C;  3P4Q B;  2N9X A;  3VR8 B;  3ZNI D;  2M4N A;  2G4D B;  1JWA D;  3U4E G;  1TY0 A;  3HVZ A;  4RF1 A;  2KAJ A;  4GXB A;  4XWW A;  1YN3 A;  3ABV B;  4DK5 A;  2PKO A;  4G3X B;  4ITK A;  1JRO A;  2ZPY A;  1VLB A;  2WX1 A;  4PYU A;  1SEB D;  2MLB A;  1SF0 A;  2BWF A;  1PGX A;  1E0Z A;  3FKY A;  3C8Y A;  2K22 A;  2MA9 B;  1DYQ A;  3MTN B;  3W1S A;  3TCA A;  2MRP A;  3EFC A;  1V1P A;  1FO4 A;  4YXD B;  2C7H A;  1JAL A;  2OED A;  5CHF A;  1B1Z A;  2WXK A;  2MX2 A;  4YSY B;  2TSS A;  2KMC A;  1PQS A;  3IFW B;  2QDF A;  3TEY A;  1V86 A;  2DZI A;  3UIN B;  4P7I A;  2LJI A;  1HXY D;  1EF5 A;  2BKR B;  3AUL A;  3AV8 A;  5BYR A;  1P98 A;  3KLS X;  4REZ A;  4LNI A;  4EEW A;  3UGB B;  3ZJU A;  1A70 A;  4ICU A;  3R7Q A;  5T8I A;  2WP9 B;  1P9D U;  4LK0 M;  1EU4 A;  2LI5 A;  4W9J A;  4N58 A;  4OZC A;  2MQJ A;  2KWU B;  4P1B C;  3Q14 C;  2FNJ B;  3ZDT A;  1JRU A;  1XQQ A;  4IKG A;  1UGJ A;  3FIL B;  4HRS A;  3T8M A;  4A8X C;  4GU2 A;  2JT4 B;  1D3Z A;  3VRA B;  3OJ3 A;  2LFI A;  1V97 A;  1SE3 A;  4HDO A;  2MBQ A;  1OEY A;  5L83 A;  4JIO U;  3B08 A;  4TUU A;  3TMP B;  5MPO A;  2D3A A;  1DOY A;  2KDE B;  1N60 A;  2BVC A;  2WDT B;  3VTU A;  3QX1 A;  4MEM A;  2LVO A;  4W9G A;  2K0P A;  3DBH I;  4KV2 A;  1UH6 A;  1AAR A;  4RM8 A;  3ZGZ A;  1Z2M A;  2KAC A;  1CJE A;  2NBV B;  1IBX B;  3ZUN A;  2G45 B;  3HK0 A;  2DZK A;  2ZNV C;  2D11 A;  1Y8R C;  3QA8 A;  1UBQ A;  4M02 A;  3V6C B;  2M56 B;  3H1U A;  3DWM A;  4CQN A;  1WWT A;  1WX8 A;  2PEA A;  2ZNV B;  2NTS A;  3DHH C;  2WGS A;  4A90 A;  2N0S B;  1N5X A;  3W5V B;  1OQR A;  1PGB A;  3DPD A;  3KUD B;  2WWZ A;  3NZ3 A;  1GC7 A;  4HVB A;  2AL6 A;  2WXR A;  1JWS D;  2WXG A;  3ALB A;  2AWT A;  3AE9 B;  4FLH A;  3DVN U;  3UI3 A;  2KWC A;  4JGH B;  3CWI A;  1QT9 A;  2CS4 A;  2D2Q A;  3BVM A;  5JXV A;  3OLM D;  5C3J B;  3H6N A;  5IA7 A;  2L52 A;  1E9M A;  1YN4 A;  3MJW A;  1HQR D;  4YTM B;  1ZXH A;  2FIF A;  4W9H A;  4XDD A;  5FR6 A;  2R2Q A;  4E3C A;  4A3O A;  1QQR A;  3HRD D;  2HTH A;  1SE9 A;  4IM3 A;  1PUT A;  1IGC A;  1A5R A;  1XO3 A;  3DQV A;  2IGG A;  1MI0 A;  2KMA A;  3TSS A;  3TJP A;  3KYC D;  3A4S C;  1WGH A;  2O6V B;  4PYZ A;  2KHW B;  1EU3 A;  4IUM B;  2EMS A;  1JWU D;  2PMV A;  3BVZ A;  3GOE A;  2KDM A;  3N3K B;  2LWP A;  3AE7 B;  1WM2 A;  1Y56 A;  3RNA C;  2IO2 B;  4ICV A;  2LGX A;  1BML C;  3Q3N C;  3PRP B;  2E3T A;  1AN8 A;  4BBN C;  1MHX A;  2FCN A;  1JW9 D;  3AE3 B;  3T9L A;  3IBE A;  4J3O D;  4G0N B;  1TS5 A;  2M17 A;  3ZO5 B;  4ASW C;  3AEA B;  1K8R B;  3QIJ A;  4ANW A;  4ZRK A;  2IY1 B;  3JW0 X;  5BYQ A;  5IP4 D;  4LNK A;  3Q6B A;  1KFY B;  1K50 A;  1WYG A;  4I6N B;  5BMH A;  1WH3 A;  4C7Z A;  2FCS A;  3ZKJ C;  5IOI A;  3PVL A;  4F7Z A;  1GUA B;  1YNT E;  3DDC B;  3LB8 C;  3ZDM C;  3MP9 A;  2BS4 B;  2DZM A;  2ONQ A;  3ZJT A;  4AS1 A;  4IW0 A;  1H8C A;  2E6X A;  3APF A;  5CX3 A;  4LJO B;  1EF1 A;  3RYT A;  3UIO B;  3HM6 X;  5HHD G;  3EUB 2;  1E7U A;  1SJE D;  1EUV B;  3ZXV A;  3SU8 X;  1EO6 A;  1Q5W B;  2B3A A;  1F2R I;  3I5J C;  2BKF A;  4K7W A;  1GAQ B;  1TZ1 A;  2MHJ A;  2IO3 B;  3FIL A;  1MJD A;  1VCB A;  3C0R B;  2NPT B;  3OG5 A;  1D5Z C;  1P1A A;  2LAS A;  2FCQ A;  4IWQ A;  1E8W A;  4CYE A;  3R2I A;  4AQ7 A;  4K1R B;  3I63 C;  2BGF A;  4DHJ D;  2K1F A;  1FCL A;  1D6E C;  1SGH A;  3TBL D;  3WAM A;  3X23 A;  4HEA 1;  1P0R A;  1WXM A;  3Q69 A;  2YEP F;  1V6E A;  2DWQ A;  4OVZ A;  1PYW D;  3VAW A;  2Z0E B;  1FCC C;  4OZB A;  1FXA A;  3OJ4 B;  1TS2 A;  2JYE A;  2SEB D;  2NBW B;  4URK A;  2KOX A;  3SDL C;  2ZCC A;  1BT0 A;  2WXP A;  3DBH B;  1XD3 B;  4IWP A;  1KLG D;  3ZRF A;  1JWM D;  1X1M A;  1RM6 C;  4AWJ A;  4PS3 A;  3VUX A;  1YX5 B;  3K9P B;  4ZHO A;  3W1Y A;  1WGY A;  3APC A;  2K25 A;  3KYD D;  1E7V A;  1YN5 A;  4DXA B;  1FD6 A;  4RGT A;  2RDH A;  2MJE A;  2AL3 A;  1T0Q C;  2GBK A;  5C2T B;  2AYO B;  3QK0 A;  1L6V A;  2JYT A;  4FJY A;  3NVV A;  2KFK B;  1FIQ A;  4MM3 B;  2JZP A;  3AEC B;  3PS6 A;  3RNG C;  1ZDX A;  1JCK B;  2CKH B;  1NDD A;  1ZUD 2;  3Q3M C;  1V49 A;  1D4B A;  4MAC A;  3DVN V;  3PHX B;  3IXS A;  3L16 A;  2HJ8 A;  4ANX A;  3ONS A;  2C60 A;  4RGO S;  3UIP B;  3AE5 B;  4HRO A;  3N32 A;  2L0F A;  4NQK E;  1HA5 A;  1ZP0 B;  3Q3J A;  2LRW A;  2OJR A;  2KQS A;  1WYW B;  1L4D B;  5DPW A;  2C5L C;  4MGI E;  3AB5 A;  1C9F A;  4USA A;  2Z8L A;  2CHZ A;  3V05 A;  4H2A A;  2QSD A;  3A9J B;  3WAO A;  4DHZ B;  4L23 A;  4II2 B;  2ZCB A;  3V3X A;  3VUW A;  2Z0D B;  5AUK A;  3PLU A;  2V4I B;  3H7P B;  2ZEQ A;  4A6Q A;  1L0X B;  1ISN A;  3M3J A;  1YD8 U;  2AQ3 B;  1J7B A;  1E10 A;  4HJG E;  5D2M B;  2RR9 A;  2C7N B;  3CST A;  2W9N A;  1L0V B;  5FKA C;  1NYR A;  2FCM A;  3NRZ A;  3N1Z C;  2CHW A;  2K6D B;  4LDT B;  4AOF A;  3GB1 A;  2I1K A;  2WXL A;  3LXF A;  1NI3 A;  5CHV C;  1TT5 B;  2KLG A;  2RDG A;  2B76 B;  2W82 A;  1I4Q A;  2R61 A;  3EFU A;  2DNF A;  1GB1 A;  3QAR A;  2L0T A;  2AEH A;  1VR9 A;  4KVG B;  4JL9 A;  3EEC A;  2JU6 X;  1L6U A;  2V3N A;  2V1Y A;  4GDK A;  1KF6 B;  4ZYS A;  4X57 B;  2GMI C;  2SAK A;  4LLG M;  3PO0 A;  2J0M A;  1L5P A;  3I9V 1;  2ZJD A;  5LXI B;  1M4V A;  3QHT A;  4XE0 A;  2WXO A;  2PJH A;  1V80 A;  2M0A A;  2IO0 B;  2KDI A;  2WNM A;  2FUH B;  2JRH A;  5DPR A;  5J2R A;  1FMA D;  4BKS A;  1JRP A;  3L08 A;  1UZX B;  1QF6 A;  2WU2 B;  2EEL A;  2NPT A;  1UBI A;  1C3T A;  2LGY A;  3VQI A;  2N9P C;  4IG7 B;  4LNF A;  3V6E B;  5H92 C;  4YL8 A;  1V8C A;  2ASQ A;  3NS1 A;  4M8M A;  3URY A;  4N59 A;  4ARC A;  3BY4 B;  1PDX A;  4JWU C;  4ZRJ A;  4MH8 A;  4DXG A;  2BS2 B;  4DDI D;  5BMG A;  4EZK A;  2JX5 A;  4MEL A;  1F1H A;  1D5M C;  1QOG A;  3EC8 A;  2YVC A;  5G5G A;  1Q1O A;  4WQM A;  4C00 A;  2KWV B;  3RZF A;  1WF9 A;  4FHK A;  4XZ4 A;  1R4M I;  3DOW A;  4GN1 A;  4I6P A;  2K39 A;  3VH4 B;  2Y5C A;  2LVP A;  2KD0 A;  3P4R B;  3JSV B;  5AEK B;  3DBL B;  2XBB C;  2J0J A;  2A4Z A;  1YQB A;  5E6J A;  3T3N A;  2N7D A;  1CQV A;  4HPP A;  2JSV X;  1E8X A;  3QJZ A;  3U8Z A;  3VR9 B;  2KT7 A;  2BT6 A;  2A5U A;  1FFU A;  2KWD A;  4RMA A;  4K3B A;  2W54 A;  2J4X A;  3E56 A;  3KVF B;  1PGA A;  4DBG A;  4HK2 A;  4KKI A;  4B6W A;  1F52 A;  5TR5 A;  3VXW A;  2LRU A;  4MT5 A;  2K6Q A;  4TV3 A;  3PTF C;  3BII D;  4AJW A;  2IND C;  4MGZ E;  3FAH A;  5HKH A;  2BYE A;  3LYY A;  1M94 A;  4FUL A;  1UD7 A;  4WWN A;  3ZNH B;  3VDZ A;  1WE7 A;  2RPQ A;  3W2D A;  2PE6 B;  2AQ1 B;  2BYT A;  5D7G A;  2MEK A;  2RMM A;  4P6V F;  2KNB A;  3R8B A;  1V1O A;  3RZW C;  3Q3F A;  1CZP A;  2VH1 A;  3P42 A;  2HE7 A;  1N61 A;  2J42 A;  4AP4 C;  5H8Y E;  2JRI B;  1DOI A;  2D3C A;  3ZLZ A;  2O2V B;  3W9C B;  3FC4 A;  2QJL A;  3NVW A;  3I57 A;  4FHJ A;  1SJH D;  4E74 A;  3J9C A;  4G11 A;  2ZPN A;  1TKE A;  2L83 A;  3GE3 C;  3BK2 A;  5DCN A;  4HWI B;  3KH0 A;  5KHQ A;  1FNV A;  2XK5 B;  4MGK E;  1EWY C;  1MG4 A;  3V60 A;  3IHP C;  5CHW A;  3VHT C;  4FJV B;  4HJK A;  3A9K B;  1JWB D;  4K7U A;  1MPE A;  4M01 A;  1WI0 A;  3AE6 B;  3PZ8 A;  3ZTC A;  3WCQ A;  2N4F A;  1YJI A;  3UQA A;  2YEP B;  1GC6 A;  3ZNG C;  1WXA A;  3HVD A;  4F8C B;  4E71 A;  1WE6 A;  3DBR I;  3HIZ A;  4KSL C;  4DDG D;  2N1W A;  1LM8 B;  2EKE C;  1SE4 A;  3RNF C;  5HI1 A;  4XWT A;  1XLO A;  3LJ3 A;  3ZW3 A;  4ANV A;  2D07 B;  3BZD B;  4FN2 A;  5HFY A;  2IO1 B;  4HPM B;  2DHZ A;  1ENF A;  1SIF A;  2KVZ A;  3C19 A;  1EM7 A;  1WY8 A;  2GRI A;  2IGH A;  3MHZ A;  1WGK A;  4M8N A;  1E5W A;  2VZK D;  5DPT A;  2M1M A;  1C4A A;  2BS3 B;  1AYF A;  2FE8 A;  1TS3 A;  1JQ4 A;  3QAQ A;  1HZ6 A;  3N30 A;  2KYW A;  1WZ0 A;  4P16 A;  1WGD A;  3QCA A;  1C76 A;  3Q8A A;  1B9R A;  3OWE B;  1I4H A;  1VRA B;  2MBH A;  1C4C A;  4NPN A;  3RPF C;  4NJC A;  1HEZ E;  1WXS A;  1P3Q U;  1YX6 B;  3EA6 A;  1WXV A;  1GB4 A;  1RRB A;  2OHF A;  3WAN A;  1IPG A;  4EUT A;  1T0Y A;  2OJW A;  1BUI C;  1YOV B;  4OHJ A;  3N9Y C;  3A1Q B;  1HZ5 A;  2WXM A;  4ZOH C;  4QAY A;  4OVV A;  1SE2 A;  4BOZ B;  4XGA B;  2IGD A;  3M62 B;  2JF5 A;  1FM0 D;  3JSV A;  2FAZ A;  4MSM B;  1LQB A;  3NY5 A;  3PRE A;  4HKQ A;  3ECI A;  1I35 A;  3BK1 A;  2BQQ A;  4HCP B;  4DHJ B;  4HXD A;  3B2G A;  4S0R A;  1FEH A;  4YT0 B;  2LUE A;  3NG0 A;  3KWL A;  2WS3 B;  4WWM A;  2QIE B;  1R4M B;  4RNA A;  4ACF A;  1KOT A;  4YSX B;  1RLF A;  1RFA A;  1ZXI A;  2WXH A;  2JWZ A;  2DYM A;  2PPH A;  3U2S C;  4DXF A;  2GBR A;  4KSK C;  3RN9 C;  2J52 A;  1V2Y A;  4ZRI A;  3AEG B;  2KTR B;  3U52 E;  3Q2A C;  3RMK C;  4FJZ A;  3A33 B;  3SEB A;  1TS4 A;  4WAF A;  4FAD A;  1U4A A;  4M00 A;  4NAM A;  3R2T A;  2V4L A;  2ZVO A;  1L2N A;  2BWE S;  3RUI B;  1K52 A;  1GOZ A;  3L13 A;  5JHB A;  4W9I A;  2IYD B;  1E7P B;  2PLP A;  5L95 C;  3U30 A;  2NTT A;  1K53 A;  2JVC A;  1T6B X;  2I38 A;  2WQY B;  4L1B A;  1NI2 A;  3KWV A;  4KGR A;  3CF6 E;  1F77 A;  1QLB B;  4IC7 B;  4B9K A;  2DYO A;  4EOY A;  1IBX A;  2CR5 A;  1TIF A;  2LXA A;  4G50 A;  3BYY B;  3P2B A;  2IZV B;  2L32 A;  1J7A A;  1TY2 A;  2LGS A;  2K5P A;  3DWG C;  4W9D A;  4BKG A;  3DVG Y;  2D5G A;  1MHH E;  1NYQ A;  2K8C A;  4NNJ B;  1V5T A;  3W1S C;  4TMA B;  5KHO A;  4IWO A;  3DHG C;  3CIR B;  4NY0 A;  4ZHP A;  3MFG A;  1P7F A;  2JWU A;  4J6I A;  3A9K A;  2RGF A;  2Y3A A;  1F0Z A;  1WJU A;  4JLC A;  4F1S A;  2ZVN A;  3AM9 A;  4KDL B;  3LDZ E;  4BAX A;  2QHO A;  2W3R A;  2UYZ B;  2BPS A;  4BKS D;  3MC8 A;  5FK9 C;  1NBF C;  3K9O B;  2QIL A;  1G6J A;  3ETR A;  3MJ5 A;  3L0W B;  1YJ1 A;  1IYF A;  1TBE A;  4N9F 4;  3O13 A;  4LNN A;  3ZTD A;  3QWZ B;  2PW9 A;  2LEK A;  4EZL A;  3PT2 B;  3ZVV A;  3AH7 A;  2BYF A;  1XLN A;  4KX6 B;  3Q8C A;  3DBR B;  4WAA A;  3AE2 B;  4XX5 A;  2CJN A;  3PRZ A;  1RYJ A;  2NR2 A;  1WFY A;  2O6V A;  3VH3 B;  2MJD A;  3IT6 B;  5EE1 A;  2BW2 A;  1L4Z B;  1N6Z A;  4W9F A;  1I42 A;  3ML9 A;  4JX1 C;  1I4P A;  1FNW A;  2KZR A;  1OEY J;  1AWD A;  3GZN I;  4GB9 A;  5G2N A;  3AXC A;  2KJH B;  3M63 B;  2RSU A;  3AE8 B;  1WIA A;  3NOB A;  1V5O A;  1QOF A;  1YQ4 B;  3WA0 A;  1P7E A;  2N9K A;  2L76 A;  1LFD A;  2UU7 A;  2I2Y A;  4WJQ A;  4WQO B;  4HDQ A;  3AE1 B;  1SSN A;  2N9L A;  2LD9 A;  3R3M A;  2RD0 A;  4WJN A;  2GOW A;  1WM3 A;  1LO5 D;  4NQL B;  3UQB A;  3R66 C;  4KIK B;  1L0Y B;  3A1Q A;  3AN1 A;  2ON8 A;  2L05 A;  3PZ7 A;  3RI7 C;  4K7S A;  4ZRQ A;  3NS8 A;  2D3B A;  2V3S A;  4Q2J A;  3SFD B;  3GE8 C;  4ZDV A;  3RCZ A;  4US9 A;  3BWU D;  3ZIM A;  4W9E A;  2NS5 A;  4PT5 A;  1LGR A;  2GBJ A;  3H8H A;  5E6O A;  4YTP B;  4YSZ B;  3TL5 A;  2DZJ A;  5LXH A;  2MBB B;  2WXQ A;  3V61 A;  2L8J A;  3EGR A;  5D6J B;  4C80 A;  1DGJ A;  5CTR C;  2L3Z A;  4ZRP A;  4RCO A;  4I6L B;  1UWX A;  3P63 A;  1TJE A;  1WJN A;  2XNA C;  3PPA A;  2D10 A;  2KX3 A;  2JZ3 B;  1YQ3 B;  2HDE A;  4DQO C;  5J17 A;  1XLQ A;  2M19 A;  1S1Q B;  3QQ8 B;  1GG3 A;  3U7Z A;  1RFK A;  2WDR B;  4W9L A;  2KDB A;  1XEE A;  3JVZ X;  2KXJ A;  4C4V B;  3W5U B;  2V9H A;  1XF5 L;  4LJP B;  2LJ5 A;  2WXI A;  1ZE3 D;  5BMI A;  2VRR B;  2MBE A;  1PFD A;  1I4X A;  3PGE A;  1HE8 A;  4JPS A;  2QEJ C;  2N7E A;  3ZRC A;  3ZNZ B;  4BFR A;  1NEK B;  4B0M A;  2NMQ A;  1WMH B;  2PVG C;  1DOX A;  3KQ4 A;  1QKZ A;  3KUC B;  2MH7 A;  1UF0 A;  3AU5 A;  3L17 A;  2DYB A;  1V81 A;  2IPK D;  2N9E B;  2Z59 B;  2V0G A;  2KC1 A;  4TKN A;  3OAW A;  3AEF B;  2DBY A;  2KQ7 A;  5GXG B;  4C7Y A;  1CMX B;  3A4R A;  5AUI A;  4XYC A;  1V9J A;  2LGD A;  2BBC A;  1MG8 A;  4BKT A;  3H7S A;  3D32 A;  2NBU A;  3RFZ B;  2L1A A;  2JXT A;  1J19 A;  3RD2 A;  5FR3 A;  3PHW B;  4US8 A;  3IT4 B;  3KUZ A;  1L7Y A;  2K8H A;  4L2Y A;  5JHA A;  3RNC C;  2G3Q B;  2KFK A;  1ZDV A;  3DBS A;  4MM3 A;  5AZH A;  4CHK A;  4TQ0 A;  1WSP A;  4LCD E;  5G5H A;  4OW0 A;  4MH0 E;  4RM9 A;  2R2O A;  1BXT A;  2H88 B;  1H4R A;  4O1N A;  5BYS A;  4AJY B;  3JYU A;  2YLM A;  3Q8F A;  4PS7 A;  1FPY A;  4NJ6 A;  4HLE A;  3HHM A;  5EE3 A;  2GBM A;  3RUL A;  1ACC A;  4WH4 A;  3RNE C;  2XN9 C;  1VJK A;  1E6E B;  2V3P A;  2IJ0 A;  2JXX A;  4IOI E;  5C1Z A;  2PE9 A;  1C78 A;  1VZ6 A;  2LUM A;  2BB6 A;  1VZ8 A;  1WGG A;  2G4S A;  3CSF A;  3A9J A;  1K51 A;  4W9K A;  2KMM A;  2HD5 B;  3AE4 B;  1UEL A;  1I4R A;  2JQR B;  3GP7 A;  4GOC A;  4BZA A;  3H7P A;  3IG3 A;  2Y5B B;  4XDC A;  4KIK A;  4EE2 A;  2K3U A;  3UF8 A;  4A20 A;  1I4G A;  2MJ3 A;  3GZN B;  4RF0 A;  2QMT A;  3L54 A;  1Q0W B;  3H9D A;  1T3Q A;  2VZK B;  1E8Z A;  3CMM B;  3WIM A;  1IUE A;  3ZQ4 A;  2PVO D;  2LMC A;  3ENE A;  5J18 A;  2INN E;  2QCZ A;  3SHQ A;  4IM2 A;  1YJJ A;  4A9A A;  2KTF A;  3BYT B;  2KKC A;  3NZU A;  3L10 B;  2WHI A;  2K9X A;  1GJZ A;  1C1Y B;  4D2K A;  1C77 A;  3AEB B;  2W55 A;  2KN4 A;  2INP E;  1Z5S B;  4EZJ A;  3VTW A;  2CHX A;  2ZW0 A;  1TZO A;  2RDB C;  2L00 B;  1IP9 A;  4IDI A;  3ML8 A;  4KZ0 A;  4YTN B;  4MGY E;  3HUI A;  1ZGU B;  3TEW A;  3O65 B;  4B95 A;  3DCG A;  1VDV A;  2KO3 A;  3AEE B;  4JE3 B;  4ANU A;  2DLB A;  1QZE A;  4K3C A;  3VVW B;  4GGQ A;  1SXT A;  4NAW B;  3PRM B;  4LTU A;  4B0E A;  1RAX A;  2WX0 A;  2WLB A;  1WJ6 A;  3B0A A;  1E8Y A;  2QC8 A;  3TEZ A;  1QIL A;  3E9S A;  2ICI A;  4C4V A;  1T0S C;  1ROE A;  4GSW A;  3T3O A;  1UUP A;  2IBI B;  1QOA A;  2JY6 A;  4GDL B;  2J53 A;  4PK1 A;  4EKU A;  3WAP A;  1FRR A;  1OQY A;  2KK8 A;  3M95 A;  1CK1 A;  2KVR A;  5GMV A;  2N1V A;  2KLC A;  4CO7 A;  1EWC A;  1WMH A;  2C7M B;  1ET6 A;  5IKC M;  2MP2 B;  4BOS C;  5BO4 B;  3PZD A;  4KDI C;  1JML A;  2RPV A;  3ZXR A;  1XT9 B;  1VD2 A;  1WRI A;  4WUR A;  4HKZ E;  4XC2 A;  1ZOY B;  1WX9 A;  1ZW7 A;  4FBJ B;  3P4P B;  4GMV A;  3Q8E A;  2W3S A;  1WR1 A;  3TEX A;  3VTV A;  5EDS A;  4II3 B;  4WWP A;  1OTR B;  1FRD A;  3SD5 A;  2LHD A;  1WRD B;  2C9W B;  5EE0 A;  2D3G A;  1C4P A;  4M0W B;  4JWS C;  4AUQ C;  4KKJ A;  1N5W A;  1UNS A;  3RNB C;  3IAM 1;  2WXF A;  2O6V D;  3APD A;  4OZA A;  1OGW A;  1FXI A;  2KQ4 X;  1R4N I;  2I1J A;  2KJ6 A;  2ZZP B;  3NVY A;  4LNO A;  3NJT A;  5I4D A;  2ACZ B;  1YMH E;  1FFV A;  1YIW A;  4GDK B;  2J7Q B;  1KTK A;  4MDK E;  4WJP A;  5JH5 C;  4RGN A;  2GB1 A;  2JUO A;  1KM7 A;  5EE9 A;  3S2A A;  1SBB B;  3VRB B;  1N63 A;  2LHE A;  3L4P A;  4MJS B;  4TSS A;  3SFE B;  1AW7 A;  2CJO A;  3DVG X;  3PLV A;  2MWS B;  3NVZ A;  1C79 A;  2DAJ A;  4RGM A;  3QC8 B;  4ARI A;  5C23 A;  2MBO A;  2O2V A;  2M8S A;  1UWM A;  3MC9 A;  1WX7 A;  3DBL I;  2XK5 A;  2IDY A;  3P4S B;  4TQ1 A;  2KX0 A;  1E90 A;  4R3D A;  4KGS A;  4DHZ E;  2MCN B;  2N7J A;  1KLV A;  2WYQ A;  4P1C C;  1MFW A;  1WR6 E;  1V1P B;  2KDF B;  2GI9 A;  4N6E B;  1I7H A;  2KJR A;  3IAS 1;  2NVU I;  3AMZ A;  1GPX A;  1ZPS A;  1OQQ A;  2LGI A;  3SR6 A;  2EMT A;  5LNK 1;  2PIA A;  1TKY A;  2NCN A;  4IM0 A;  3I3T B;  5D3I B;  3IVF A;  4RH6 A;  4MSQ B;  1NEN B;  2CU1 A;  2Q5W D;  1STE A;  4A3P A;  5IO9 A;  5LLI A;  3N20 C;  3MC0 B;  4KGT A;  5IAA C;  4DWF A;  2AX5 A;  3TUO A;  2XEW A;  1KLU D;  3B9J A;  1XXG A;  1R7S A;  3MHS D;  1TYG B;  1WGR A;  3EHV A;  2GLS A;  1J8C A;  1J7C A;  4JQW C;  4HPL B;  2H89 B;  3VFK A;  3KW5 B;  2K8B A;  5AZF A;  3GS2 A;  4NAW A;  2WU5 B;  1IGD A;  1XLP A;  3B2F A;  3N1X C;  4GIV A;  5AZG A;  2DAF A;  4UDU C;  4EFO A;  3X0W A;  5D94 A;  1J0G A;  2BB5 A;  4WJO A;  5E6P A;  1WZ3 A;  1KJT A;  2AQ2 B;  4GDL A;  3PSE B;  4GLS C;  1SIJ A;  3BVG A;  3PV1 A;  2HJ1 A;  2BF8 B;  3NUH B;  1TTN A;  4NJ7 A;  3Q8B A;  3R7R A;  1NVI D;  1TGZ B;  3TIX A;  4BBN F;  2KFJ A;  3AI5 A;  4W9C A;  1VZ7 A;  1T0R C;  2X8X X;  2HTM E;  1WXQ A;  2PTL A;  1FNU A;  3Q3O C;  4OVU A;  1KRH A;  5D3D A;  2MP2 A;  2MW5 A;  2DX5 B;  1RWS A;  4FXC A;  1TKG A;  2CU3 A;  4K81 A;  1KH0 A;  1ESF A;  2DEN B;  1MVK A;  3RT3 B;  2BYV E;  2BTE A;  3HM3 A;  3B1L X;  4A55 A;  1S3S G;  5E6N A;  4PS8 A;  4C56 C;  3AED B;  1ET9 A;  3NZS A;  2LXC A;  5TSS A;  3DHI C;  2OOB B;  2G9H D;  1SB3 C;  1OFF A;  5DPS A;  2FUG 1;  2WDQ B;  2GBN A;  1GNU A;  2ZW1 A;  3ZJV A;  4M0W A;  1XCQ L;  3AU4 A;  4FA6 A;  1HTO A;  1ZKH A;  1LXD A;  1QOB A;  1FXT B;  3N1Y C;  2EKI A;  2X38 A;  2REX A;  4YWG G;  2UWQ A;  5JZE B;  2KTR A;  2Y5P A;  2VH2 A;  3V62 A;  3P1M A;  1WJ4 A;  5G55 A;  2FBW B;  2LVQ A;  4S17 A;  2FID A;  5IN7 A;  2WXJ A;  2WXN A;  4HCN B;  2KAN A;  2L7R A;  2LZ6 A;  1UGM A;  3VUY A; 
#chains in the Genus database with same CATH homology
 2JPH A;  3APC A;  4W9K A;  2K25 A;  3KYD D;  3M62 B;  1E7V A;  2J0K A;  3WAL A;  4DXA B;  2HD5 B;  1UEL A;  2JF5 A;  2KN5 A;  3NHE B;  3JSV A;  4WWO A;  2FAZ A;  4MSM B;  2AL3 A;  4MJS A;  1LQB A;  2GBK A;  3NY5 A;  2MSE D;  4GOC A;  2AYO B;  3QK0 A;  3PRE A;  1I35 A;  3ECI A;  4FJY A;  3H7P A;  4ZYN A;  3IG3 A;  2Y5B B;  2KFK B;  4HCP B;  4DHJ B;  4HXD A;  3BIN A;  4KIK A;  3PS6 A;  4BVU C;  4LDT D;  2JZZ A;  3UF8 A;  4A20 A;  2M0X A;  2CKH B;  1NDD A;  1F9J A;  2LUE A;  3U7D A;  2KC2 A;  1V49 A;  4KZC A;  3L54 A;  2IY0 B;  1Q0W B;  3DVN V;  3PHX B;  1KOT A;  3H9D A;  1RLF A;  2N9X A;  1RFA A;  3ZNI D;  2JWZ A;  2M4N A;  2G4D B;  1E8Z A;  3L16 A;  3CMM B;  2DYM A;  2PPH A;  3WIM A;  2GBR A;  2HJ8 A;  4KSK C;  4ANX A;  4GXB A;  1V2Y A;  3ONS A;  2C60 A;  3ENE A;  3UIP B;  5J18 A;  3SHQ A;  4ZRI A;  4IM2 A;  2KTR B;  4DK5 A;  2KTF A;  4G3X B;  2KKC A;  3N32 A;  2L0F A;  4NQK E;  2ZPY A;  3NZU A;  3L10 B;  1GJZ A;  2WX1 A;  1C1Y B;  4FJZ A;  3A33 B;  4PYU A;  2MLB A;  2BWF A;  3Q3J A;  1U4A A;  2LRW A;  4FAD A;  1Z5S B;  2OJR A;  2KQS A;  2CHX A;  2MA9 B;  2V4L A;  1WYW B;  2ZVO A;  3VTW A;  4EZJ A;  5DPW A;  2BWE S;  2C5L C;  3MTN B;  3W1S A;  4MGI E;  3TCA A;  1L2N A;  2MRP A;  3RUI B;  3L13 A;  5JHB A;  2C7H A;  4W9I A;  2CHZ A;  2IYD B;  2L00 B;  3A9J B;  1IP9 A;  5L95 C;  3ML8 A;  3WAO A;  3U30 A;  5CHF A;  4DHZ B;  4KZ0 A;  4II2 B;  2MX2 A;  4MGY E;  2ZCB A;  3VUW A;  2JVC A;  2KMC A;  2Z0D B;  1ZGU B;  3O65 B;  3PLU A;  4B95 A;  3DCG A;  1PQS A;  2KO3 A;  3IFW B;  3H7P B;  1V86 A;  2DZI A;  2ZEQ A;  3UIN B;  1QZE A;  4ANU A;  4P7I A;  3VVW B;  4GGQ A;  1ISN A;  1NI2 A;  3M3J A;  4NAW B;  1YD8 U;  3PRM B;  1EF5 A;  3CF6 E;  1RAX A;  5D2M B;  2WX0 A;  2BKR B;  3AUL A;  2RR9 A;  4IC7 B;  2C7N B;  3CST A;  2W9N A;  1WJ6 A;  4B9K A;  3B0A A;  2DYO A;  1E8Y A;  3A9J A;  1P98 A;  4EOY A;  2CR5 A;  2FCM A;  2LXA A;  4EEW A;  2CHW A;  2K6D B;  4LDT B;  3UGB B;  4AOF A;  4G50 A;  2I1K A;  4GSW A;  3P2B A;  4ICU A;  2IZV B;  3R7Q A;  2IBI B;  4WJP A;  5CHV C;  2JY6 A;  1P9D U;  2KLG A;  4GDL B;  2LI5 A;  4W9J A;  4W9D A;  4BKG A;  3DVG Y;  4EKU A;  2K8C A;  4NNJ B;  1V5T A;  3WAP A;  1OQY A;  2KK8 A;  3EFU A;  3W1S C;  5KHO A;  2MQJ A;  2KWU B;  3M95 A;  4IWO A;  2KVR A;  2FNJ B;  5GMV A;  3ZDT A;  4NY0 A;  2N1V A;  3QAR A;  1JRU A;  2KLC A;  1XQQ A;  2L0T A;  2AEH A;  4KVG B;  4JL9 A;  3EEC A;  4J6I A;  3A9K A;  4CO7 A;  3T8M A;  1WMH A;  2C7M B;  2RGF A;  4GU2 A;  1WJU A;  4JLC A;  2JT4 B;  2ZVN A;  4F1S A;  2V1Y A;  4GDK A;  1D3Z A;  3OJ3 A;  2MP2 B;  4KDL B;  3RZF A;  3LDZ E;  5BO4 B;  3PZD A;  4BOS C;  2QHO A;  4HDO A;  4KDI C;  4X57 B;  2GMI C;  2UYZ B;  2MBQ A;  1OEY A;  5L83 A;  4JIO U;  2BPS A;  2J0M A;  1XT9 B;  4BKS D;  3B08 A;  4TUU A;  3TMP B;  1VD2 A;  2ZJD A;  5LXI B;  1NBF C;  3K9O B;  3QHT A;  2KDE B;  2PJH A;  1V80 A;  1G6J A;  2IO0 B;  2KDI A;  4XC2 A;  2WDT B;  3VTU A;  1WX9 A;  2FUH B;  2JRH A;  5DPR A;  3QX1 A;  4MEM A;  2LVO A;  4W9G A;  5J2R A;  4BKS A;  3L0W B;  1YJ1 A;  1ZW7 A;  3DBH I;  4FBJ B;  4KV2 A;  1UH6 A;  3L08 A;  1UZX B;  4GMV A;  1AAR A;  4RM8 A;  1Z2M A;  1TBE A;  4N9F 4;  2NBV B;  1WR1 A;  5EDS A;  3VTV A;  2NPT A;  1UBI A;  4II3 B;  1C3T A;  3ZUN A;  2G45 B;  2LGY A;  3HK0 A;  4WWP A;  3ZTD A;  3VQI A;  1OTR B;  2N9P C;  4IG7 B;  3QWZ B;  2DZK A;  2ZNV C;  2D11 A;  1Y8R C;  3SD5 A;  3V6E B;  4YL8 A;  1WRD B;  3QA8 A;  2C9W B;  1UBQ A;  2D3G A;  4EZL A;  3V6C B;  4M0W B;  3PT2 B;  3ZVV A;  3H1U A;  2ASQ A;  4AUQ C;  4M8M A;  1WX8 A;  2PEA A;  2ZNV B;  3APD A;  2O6V D;  2BYF A;  3BY4 B;  1OGW A;  1R4N I;  2I1J A;  2KJ6 A;  2ZZP B;  4ZRJ A;  4WAA A;  4XX5 A;  3PRZ A;  4DDI D;  4EZK A;  2NR2 A;  1WFY A;  2O6V A;  3VH3 B;  4MEL A;  3DPD A;  3KUD B;  2WWZ A;  3EC8 A;  1GC7 A;  1YIW A;  2YVC A;  4W9F A;  2AL6 A;  4HVB A;  1Q1O A;  4GDK B;  1I42 A;  3ML9 A;  2J7Q B;  4MDK E;  2KWV B;  2KZR A;  3ALB A;  1OEY J;  1WF9 A;  3GZN I;  4FHK A;  2AWT A;  4GB9 A;  3AXC A;  1R4M I;  4XZ4 A;  5G2N A;  2KJH B;  3DOW A;  2JUO A;  2RSU A;  3M63 B;  1WIA A;  4GN1 A;  4FLH A;  3DVN U;  4I6P A;  1KM7 A;  3NOB A;  1V5O A;  2K39 A;  2KWC A;  3S2A A;  3WA0 A;  4JGH B;  2CS4 A;  2L76 A;  3VH4 B;  1LFD A;  2LVP A;  2KD0 A;  2D2Q A;  4WJQ A;  3JSV B;  5AEK B;  4MJS B;  4WQO B;  4HDQ A;  2XBB C;  2J0J A;  2A4Z A;  3DVG X;  3H6N A;  3OLM D;  5IA7 A;  2LD9 A;  3PLV A;  2MWS B;  2RD0 A;  3R3M A;  2GOW A;  1WM3 A;  1YQB A;  4WJN A;  2N7D A;  4NQL B;  3MJW A;  3UQB A;  3R66 C;  4KIK B;  2DAJ A;  3A1Q A;  3QC8 B;  2FIF A;  2L05 A;  4W9H A;  1E8X A;  3QJZ A;  5FR6 A;  4K7S A;  3U8Z A;  5C23 A;  2MBO A;  2O2V A;  2A5U A;  2R2Q A;  3NS8 A;  2M8S A;  4E3C A;  2V3S A;  4A3O A;  4RMA A;  3KVF B;  4ZDV A;  4DBG A;  2HTH A;  1SE9 A;  4HK2 A;  4IM3 A;  3RCZ A;  1WX7 A;  1A5R A;  3ZIM A;  4W9E A;  2NS5 A;  3DBL I;  3DQV A;  4B6W A;  2GBJ A;  5TR5 A;  2KMA A;  5E6O A;  3TJP A;  3VXW A;  2LRU A;  3KYC D;  2XK5 A;  3A4S C;  3TL5 A;  2DZJ A;  5LXH A;  1WGH A;  2K6Q A;  2MBB B;  3PTF C;  4TQ1 A;  4TV3 A;  3V61 A;  2KX0 A;  2L8J A;  5D6J B;  4AJW A;  2O6V B;  4MGZ E;  4PYZ A;  1E90 A;  2KHW B;  5HKH A;  2BYE A;  4DHZ E;  1M94 A;  4FUL A;  1UD7 A;  2MCN B;  4IUM B;  2L3Z A;  2EMS A;  5CTR C;  4WWN A;  1KLV A;  2WYQ A;  3GOE A;  3N3K B;  1WR6 E;  2KDF B;  3ZNH B;  4I6L B;  2KJR A;  2LWP A;  3VDZ A;  1WE7 A;  2RPQ A;  2NVU I;  2PE6 B;  1WJN A;  3PPA A;  1WM2 A;  2KX3 A;  2D10 A;  2JZ3 B;  2IO2 B;  2EMT A;  4ICV A;  5D7G A;  2LGX A;  3PRP B;  5J17 A;  2NCN A;  4BBN C;  4IM0 A;  3I3T B;  2KNB A;  3RZW C;  3IVF A;  3Q3F A;  4MSQ B;  2HE7 A;  2FCN A;  2CU1 A;  4AP4 C;  3T9L A;  1S1Q B;  3IBE A;  2JRI B;  4A3P A;  3QQ8 B;  4G0N B;  2M17 A;  5LLI A;  3ZO5 B;  1GG3 A;  3ZLZ A;  4ASW C;  2O2V B;  5IAA C;  4DWF A;  1K8R B;  3QIJ A;  2KDB A;  4W9L A;  3JVZ X;  4ANW A;  4ZRK A;  4FHJ A;  4E74 A;  2IY1 B;  2KXJ A;  2XEW A;  3JW0 X;  4LJP B;  3MHS D;  2LJ5 A;  4G11 A;  2ZPN A;  1WGR A;  2VRR B;  3EHV A;  1J8C A;  5DCN A;  4HWI B;  4JQW C;  2MBE A;  3KH0 A;  4HPL B;  5KHQ A;  4I6N B;  3VFK A;  3KW5 B;  1WH3 A;  2K8B A;  2FCS A;  2XK5 B;  3PGE A;  4MGK E;  1HE8 A;  5AZF A;  3ZKJ C;  4NAW A;  3PVL A;  2N7E A;  3V60 A;  4F7Z A;  3ZRC A;  1GUA B;  3ZNZ B;  3DDC B;  3IHP C;  3ZDM C;  5CHW A;  3VHT C;  2DZM A;  4BFR A;  4FJV B;  4HJK A;  4IW0 A;  1H8C A;  3A9K B;  4GIV A;  4K7U A;  3APF A;  1WMH B;  2DAF A;  5AZG A;  1WI0 A;  5CX3 A;  3ZTC A;  4LJO B;  3X0W A;  4EFO A;  1EF1 A;  3RYT A;  5D94 A;  3UIO B;  2N4F A;  3UQA A;  1J0G A;  3KUC B;  3HM6 X;  4WJO A;  5E6P A;  1WZ3 A;  1KJT A;  1E7U A;  3AU5 A;  4GDL A;  1EUV B;  3PSE B;  1GC6 A;  3L17 A;  3PV1 A;  3SU8 X;  2BF8 B;  2DYB A;  1V81 A;  3ZNG C;  1WXA A;  1EO6 A;  1TTN A;  2N9E B;  4NJ7 A;  2Z59 B;  4F8C B;  1Q5W B;  3R7R A;  2B3A A;  1TGZ B;  2KC1 A;  4TKN A;  3TIX A;  2BKF A;  4K7W A;  3OAW A;  4E71 A;  1WE6 A;  4BBN F;  2KFJ A;  1IYF A;  1TZ1 A;  2KQ7 A;  3AI5 A;  3DBR I;  4W9C A;  2IO3 B;  3HIZ A;  4KSL C;  4DDG D;  2N1W A;  1LM8 B;  2EKE C;  1CMX B;  3A4R A;  4OVU A;  1VCB A;  3C0R B;  2NPT B;  2MP2 A;  1V9J A;  2LGD A;  2MW5 A;  2DX5 B;  1MG8 A;  1P1A A;  2LAS A;  2FCQ A;  3LJ3 A;  4IWQ A;  3ZW3 A;  4ANV A;  2D07 B;  4FN2 A;  4BKT A;  3H7S A;  3D32 A;  1E8W A;  2NBU A;  4CYE A;  4K81 A;  2DEN B;  4K1R B;  2BGF A;  4DHJ D;  1J19 A;  2K1F A;  3RD2 A;  2IO1 B;  3RT3 B;  4HPM B;  2BYV E;  5JH5 C;  3PHW B;  2DHZ A;  3HM3 A;  1SIF A;  1L7Y A;  2K8H A;  3KUZ A;  1SGH A;  3B1L X;  3TBL D;  3WAM A;  5JHA A;  1S3S G;  1WY8 A;  2G3Q B;  3X23 A;  2KFK A;  3DBS A;  4MM3 A;  5E6N A;  4PS8 A;  4M8N A;  1E5W A;  3NZS A;  5DPT A;  5AZH A;  2LXC A;  2M1M A;  4CHK A;  1P0R A;  1WXM A;  4TQ0 A;  4LCD E;  3QAQ A;  2OOB B;  3N30 A;  1V6E A;  4MH0 E;  1WZ0 A;  2R2O A;  4RM9 A;  5DPS A;  1H4R A;  2GBN A;  1GNU A;  1WGD A;  3VAW A;  3QCA A;  2Z0E B;  4AJY B;  3JYU A;  3AU4 A;  4FA6 A;  2YLM A;  4PS7 A;  4NJ6 A;  1ZKH A;  1LXD A;  2MBH A;  3OJ4 B;  4HLE A;  4NPN A;  1FXT B;  3HHM A;  1WXS A;  1P3Q U;  1YX6 B;  2REX A;  2GBM A;  2UWQ A;  5JZE B;  1WXV A;  3RUL A;  2NBW B;  4URK A;  1RRB A;  2KOX A;  2KTR A;  2ZCC A;  1BT0 A;  3SDL C;  3WAN A;  1IPG A;  4EUT A;  3V62 A;  1T0Y A;  1XD3 B;  4IWP A;  1WJ4 A;  5G55 A;  2JXX A;  5C1Z A;  3ZRF A;  2PE9 A;  2LVQ A;  1X1M A;  2FID A;  3A1Q B;  4AWJ A;  4HCN B;  2KAN A;  4OVV A;  4PS3 A;  2L7R A;  2LZ6 A;  3VUX A;  1YX5 B;  4BOZ B;  1WGG A;  2G4S A;  3CSF A;  3K9P B;  3W1Y A;  1UGM A;  3VUY A;  1WGY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...