2KO3A

Nedd8 solution structure
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
76
structure length
76
Chain Sequence
MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALRGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords NEDD8
publication title 60th residues of ubiquitin and Nedd8 are located out of E2-binding surfaces, but are important for K48 ubiquitin-linkage.
pubmed doi rcsb
source organism Homo sapiens
total genus 13
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2009-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2ko3A00
2KLCA 2WYQA 4EZKA 4GDKB 1WX8A 2HJ8A 1WYWB 2NBUA 1ZGUB 2RPQA 1V5TA 5KHOA 3MTNB 5LXHA 3PT2B 4BBNF 1H8CA 2GOWA 4GGQA 1UELA 3IBEA 2KOXA 2BYVE 4DBGA 1GC6A 3P2BA 3R66C 4DXAB 4ZDVA 3PRMB 4MSMB 3UQBA 1UD7A 3B0AA 4GMVA 2DX5B 1XD3B 2KZRA 3PGEA 2KDBA 4FHKA 1WZ3A 2GBKA 2L76A 3VFKA 2MBEA 3WALA 5J18A 2BWFA 2L3ZA 3QAQA 2LUEA 1FXTB 4ASWC 3W1YA 1WGRA 4A20A 4GB9A 1WX9A 2BF8B 3H7PB 3QA8A 4KZCA 2IO3B 3CMMB 2R2OA 2DENB 2JXXA 3A9KB 3APDA 3U8ZA 3ZVVA 5E6PA 4GDLB 1GNUA 4FBJB 2CHXA 3SHQA 4HCPB 4E3CA 4IM0A 1V5OA 2KKCA 3QCAA 4MJSA 4ZRJA 1WJUA 5IA7A 1L7YA 2K25A 1LFDA 4B9KA 2FIFA 4IUMB 1D3ZA 3RT3B 4W9DA 4W9CA 4TV3A 2JY6A 5CX3A 3VTUA 1YD8U 1NDDA 1OGWA 2IY0B 5DPTA 4MSQB 1WFYA 2L00B 3RZFA 4M0WB 1WR1A 2DYMA 2NBWB 3QARA 2N9XA 1P3QU 4HJKA 3A1QB 4HK2A 4MGZE 1UZXB 1Q1OA 2N1VA 1TZ1A 4YL8A 4PS3A 2MRPA 2JRHA 3QJZA 2M8SA 3M3JA 4JL9A 3VTVA 3W1SA 3ZRFA 3PRPB 3VH4B 2O2VA 3VTWA 2KWUB 3QHTA 4K7SA 3UINB 2LRWA 4F8CB 3APFA 3KVFB 1GG3A 2K8BA 2KO3A 4W9JA 4GIVA 4MELA 4JIOU 5L83A 1WIAA 2A5UA 2N7EA 4LCDE 2KC1A 3M62B 4HPLB 4IM2A 3BY4B 1WXVA 3ZNID 3UQAA 3HIZA 4ICUA 4MH0E 3EECA 2CR5A 5CHVC 2AL6A 1WGYA 5AZGA 1P98A 2J0JA 2XBBC 2KFKA 3L0WB 4ICVA 4DWFA 3VUYA 5KHQA 1WXSA 3RULA 1WGGA 3TL5A 3L54A 4G0NB 3TIXA 2D3GA 1WJNA 3TJPA 4LDTD 1V6EA 4ANVA 1E7VA 2JZZA 2KNBA 3ZRCA 4HCNB 4EFOA 2GBNA 3LDZE 2MA9B 2NBVB 2NS5A 4I6LB 1WM2A 2L7RA 4BKGA 4HXDA 2N9EB 2DAFA 2MLBA 3SU8X 2K8CA 5G55A 3DVGY 2D2QA 4BKSD 1LM8B 2C5LC 2NVUI 2PEAA 5DPSA 2FAZA 2BGFA 4GDLA 4NJ7A 1EF5A 4CHKA 1NBFC 3Q3JA 3H9DA 4PYZA 3V6CB 3IHPC 1TGZB 2KTFA 4KDIC 2LGYA 3T8MA 2WX0A 3DVNU 4F7ZA 2J0KA 2LWPA 2UWQA 4DDGD 1P9DU 4GOCA 4HVBA 4RMAA 1WMHB 4B95A 1E8ZA 3QC8B 2DYBA 3V6EB 5E6NA 5TR5A 3ZNGC 3DBLI 4WAAA 4JGHB 2G45B 4ANUA 1YIWA 2DHZA 2KHWB 2REXA 1WRDB 2K1FA 4NPNA 2FCNA 3A4SC 5D7GA 3WA0A 3WANA 2I1KA 2MCNB 4WJNA 5CHFA 4NAWB 1GJZA 1OQYA 4NQKE 2EMTA 2PPHA 3K9OB 3L17A 5AZFA 3DVGX 2K6DB 3PHWB 4FHJA 2CHZA 4JLCA 3WAMA 4MM3A 1XT9B 2YLMA 3UIOB 2K39A 2KX3A 4KZ0A 2XEWA 3VHTC 4XC2A 3MJWA 2KDFB 4JQWC 5EDSA 5DCNA 1IYFA 2Z59B 1V80A 2N1WA 3SDLC 2DZIA 1R4NI 3TMPB 3H6NA 2IO1B 3L08A 4N9F4 1E90A 4K7WA 3B1LX 3DVNV 1WH3A 5JH5C 1RLFA 1VCBA 2KC2A 2XK5A 3ZO5B 3SD5A 3V60A 2LD9A 3AI5A 1SGHA 2KJRA 2D07B 5LXIB 3ML9A 2GMIC 4OVUA 1KM7A 2AEHA 3A9JA 4LJOB 1EO6A 3VDZA 1S1QB 3ZKJC 2NPTB 1UBQA 3HM3A 3KH0A 1H4RA 1C1YB 4LDTB 3ZW3A 3JSVA 4A3OA 4W9KA 4WQOB 4KIKB 2PE6B 2DAJA 2ASQA 1BT0A 4WJQA 3IVFA 4IG7B 3DCGA 3N32A 2KQ7A 2O6VA 2G4DB 4BKTA 5C23A 2BYEA 1E8XA 4HPMB 3R7RA 4HWIB 2C7MB 1IPGA 3VXWA 2JF5A 2JPHA 2ZVOA 2MP2B 2LXAA 2G4SA 3OJ4B 4K81A 2Z0EB 1ISNA 1V49A 1RAXA 2LVOA 4DHZE 1U4AA 2GBRA 3ALBA 4FN2A 1KLVA 4HDOA 3N3KB 2V3SA 1WE7A 4G50A 2J7QB 4EZJA 2MWSB 2DYOA 4KV2A 5CHWA 3K9PB 5D2MB 4GDKA 3R3MA 1LXDA 2HTHA 3NOBA 2KX0A 2IO2B 4PS8A 2M1MA 4TKNA 2C7NB 4DHJD 2V1YA 2MSED 3AU4A 3PPAA 3ZTDA 4AJWA 4EKUA 2ZEQA 3PLVA 1WXAA 3QX1A 1V9JA 2C9WB 2ZNVC 4EZLA 4W9EA 3JW0X 4M8MA 3A33B 2GBMA 2BPSA 3UF8A 2FCQA 2WX1A 3QK0A 4GN1A 2IBIB 4NY0A 4I6NB 4XX5A 3NY5A 5CTRC 3X0WA 1PQSA 4P7IA 2KWVB 4WWNA 1G6JA 3VQIA 3KYDD 3JYUA 3UGBB 3WAPA 1WE6A 2I1JA 4GSWA 1Q0WB 2BKRB 2RSUA 3VH3B 4CO7A 3I3TB 2NCNA 2FUHB 2ZZPB 1J0GA 2QHOA 3KW5B 1YQBA 3H7PA 3KUZA 1V86A 4IM3A 5HKHA 3NZSA 3A9KA 2K6QA 3PV1A 5L95C 3IG3A 3L16A 2V4LA 4PYUA 4X57B 2WWZA 4RM8A 4AUQC 1WM3A 1SIFA 1C3TA 3A4RA 3CSTA 5DPRA 1V81A 4ZRKA 3MHSD 2RD0A 2EMSA 1WX7A 2DZMA 4HLEA 3RD2A 2RGFA 1J8CA 4AP4C 4J6IA 4KSLC 2A4ZA 2D10A 2L8JA 3VUWA 4WWOA 4K7UA 4LJPB 1UGMA 4KIKA 3DOWA 5JHAA 3PVLA 3VAWA 2GBJA 4K1RB 3QIJA 1JRUA 2ZCCA 1E8YA 5J17A 1M94A 1Z5SB 2HE7A 5D94A 5JHBA 2K8HA 3A1QA 3VVWB 2IY1B 2Z0DB 4W9FA 4BKSA 2NR2A 2IYDB 2M0XA 2HD5B 3ENEA 1UBIA 2AL3A 3RCZA 4NNJB 3DDCB 1SE9A 4IWPA 4I6PA 2O2VB 4EEWA 2LJ5A 1L2NA 2C7HA 2ZPYA 2MX2A 2MBQA 3B08A 2MBOA 1S3SG 1WZ0A 2FCMA 2W9NA 1WGHA 5FR6A 2BYFA 2CHWA 2KN5A 3DQVA 3U7DA 4FJVB 4FLHA 2ZPNA 2M17A 4G3XB 4MEMA 1OTRB 4MGKE 5D6JB 2ZVNA 2KTRB 3H1UA 4IWQA 4ANWA 4DHJB 4II3B 2KFKB 2N4FA 1WJ6A 3OAWA 1K8RB 4TQ1A 2G3QB 4PS7A 1CMXB 2KMCA 1F9JA 2LVPA 2AYOB 3ECIA 3WIMA 3ZDMC 4A3PA 4ANXA 5DPWA 4OVVA 1TBEA 2KK8A 2VRRB 4DDID 1GUAB 5BO4B 3QWZB 4FJZA 3EHVA 1RFAA 3PRZA 1P0RA 2C60A 2KJHB 1YX5B 3QQ8B 3L13A 1WXMA 2CU1A 2JVCA 2O6VD 5E6OA 1V2YA 4E74A 4GU2A 1E7UA 2ZCBA 4FA6A 3ML8A 3PLUA 4XZ4A 1TTNA 2BWES 3ZNZB 1P1AA 2KJ6A 2LASA 3M95A 1LQBA 3S2AA 1EUVB 2ZNVB 2KMAA 3DPDA 3GOEA 3GZNI 1R4MI 2J0MA 3PSEB 3KUCB 4AJYB 4WWPA 1ZKHA 2L0TA 3R7QA 3M63B 3ZNHB 2OOBB 2IO0B 1Q5WB 2CS4A 2D11A 3H7SA 3PZDA 4NJ6A 4WJPA 5GMVA 5JZEB 1T0YA 3ZTCA 3AULA 3C0RB 1WMHA 2JRIB 3CSFA 3CF6E 4CYEA 3RZWC 3JVZX 2L0FA 5IAAC 1OEYJ 2KD0A 3PS6A 2N7DA 5AEKB 2MBBB 2YVCA 3DBHI 3HHMA 2RR9A 3OJ3A 2Y5BB 4NQLB 4DK5A 2FCSA 1I35A 4EOYA 5J2RA 3ONSA 3V61A 5LLIA 1WF9A 4NAWA 4DHZB 1NI2A 4RM9A 2LXCA 4M8NA 3ZIMA 2KLGA 2LVQA 1YJ1A 1YX6B 4FULA 3VUXA 2BKFA 1HE8A 1OEYA 3APCA 3EC8A 3X23A 5G2NA 3ZUNA 4BVUC 2UYZB 3OLMD 3PHXB 2KFJA 3ZDTA 3EFUA 4GXBA 4F1SA 4KDLB 2LRUA 4FADA 4MGIE 2PJHA 1MG8A 3Q3FA 4W9LA 4IW0A 2KDIA 1J19A 2KVRA 2OJRA 3D32A 3O65B 4BFRA 4E71A 1GC7A 3RUIB 2IZVB 3NZUA 1IP9A 3NHEB 1WY8A 3TBLD 2WDTB 4W9HA 2KDEB 2CKHB 3N30A 4HDQA 2EKEC 1XQQA 2KTRA 2LI5A 2KANA 4FJYA 4W9IA 1Z2MA 2LGXA 4W9GA 4AOFA 3WAOA 2XK5B 3AXCA 4BOZB 4WJOA 3TCAA 1RRBA 3PREA 4II2B 2KXJA 3HK0A 3A9JB 3L10B 4IWOA 3AU5A 2NPTA 2L05A 3DBSA 1E5WA 3KUDB 2PE9A 4MJSB 4ZYNA 3W1SC 1I42A 2M4NA 4B6WA 1ZW7A 4AWJA 1WJ4A 1VD2A 3JSVB 4EUTA 4IC7B 3U30A 2LGDA 3NS8A 3KYCD 4KSKC 4ZRIA 1X1MA 3HM6X 4KVGB 2JZ3B 2JWZA 1EF1A 2LZ6A 2R2QA 4MGYE 1KJTA 2B3AA 1A5RA 1E8WA 2O6VB 3BINA 3RYTA 4BOSC 2DZKA 3PTFC 4MDKE 1Y8RC 2FNJB 3UIPB 4BBNC 4TUUA 2KWCA 1UH6A 2JUOA 2MQJA 2MP2A 1WI0A 1WGDA 3LJ3A 1AARA 3T9LA 4URKA 3V62A 1KOTA 5AZHA 4TQ0A 2KQSA 2MBHA 2ZJDA 5C1ZA 4G11A 3IFWB 1WR6E 2AWTA 2N9PC 2DZJA 2FIDA 3ZLZA 2JT4B 1QZEA 2MW5A 3DBRI
chains in the Genus database with same CATH superfamily
1ZE3D 4EZKA 1T0QC 5KHOA 1OFFA 5LXHA 3PT2B 4BBNF 2M56B 2BYVE 2W55A 1GC6A 1TJEA 3B0AA 4GMVA 3PGEA 1WZ3A 2GBKA 3VFKA 2X8XX 4LNKA 5J18A 2D3CA 4A20A 3ZJUA 1F77A 4A55A 3BYYB 3H7PB 4KZCA 3R2IA 2R2OA 2DENB 3APDA 4HKZE 1TY0A 5E6PA 1L4ZB 3AV8A 2CHXA 3SHQA 4HCPB 4E3CA 4IM0A 4WQMA 4ZRJA 1L7YA 2V3NA 2FIFA 3RT3B 4TV3A 1YD8U 5DPTA 1SJED 2L00B 3H8HA 3NVZA 2BQQA 3RZFA 1FRRA 4RH6A 2N9XA 1TY2A 1P3QU 1XXGA 2PIAA 1Q1OA 2QJLA 2RDGA 3I9V1 1TZ1A 4RGOS 4US9A 4YL8A 2JRHA 3QJZA 3M3JA 4KGSA 2Y5CA 4XWTA 2KWUB 2LRWA 4W9JA 2PVOD 1XLOA 4GIVA 4JIOU 2QIEB 2A5UA 2N7EA 1MHHE 3NJTA 4FXCA 2KC1A 5AUKA 2SEBD 5BMGA 2WU2B 3L0WB 2YEPF 4ICVA 4DWFA 1WXSA 3TL5A 3TIXA 4ANVA 1E7VA 2KNBA 1VZ7A 1Q10A 3HUIA 1ZXIA 1WM2A 2QCZA 1NYRA 1B1ZA 2L7RA 5GXGB 4M00A 4JE3B 2BTEA 2D2QA 2WDQB 5DPSA 2PEAA 2BGFA 5IN7A 4US8A 1NBFC 3Q3JA 4N59A 3EA6A 4DDGD 3GS2A 1P9DU 1FXAA 4RMAA 1E8ZA 3V6EB 1YIWA 4NPNA 1AYFA 2WXRA 2I1KA 1EWCA 5CHFA 2PMVA 2KDMA 2EMTA 5G5GA 3W2DA 4JLCA 2W54A 2JSVX 2KX3A 3TEYA 3VHTC 3TSSA 3MJWA 3AEEB 1KRHA 3NVWA 1UGJA 1V80A 1WGKA 3SDLC 3TMPB 3H6NA 2IO1B 5JH5C 2XK5A 3ZO5B 1MI0A 3SD5A 3V60A 3ZJVA 2LD9A 3AI5A 1SGHA 3DWMA 1YJIA 1KLUD 4REZA 2NPTB 4HKQA 4C80A 2V3PA 4ZHOA 4WQOB 4KIKB 2BW2A 2ASQA 1BT0A 3URYA 2BYEA 1E8XA 4HPMB 4WAFA 1IPGA 4YT0B 3VXWA 1QLBB 2CU3A 2G4SA 4NZLB 4FN2A 3N3KB 4G50A 2J7QB 2WXFA 1SE4A 1LXDA 2IO2B 3ZTDA 4KKIA 3B2FA 1V9JA 1P7EA 3P63A 4W9EA 1VDVA 3A33B 3DBRB 2GBMA 3X0WA 4P7IA 5H92C 1G6JA 3NVYA 2DLBA 3HRDD 1WE6A 4GSWA 2RSUA 4C00A 3TUOA 3TEWA 3A9KA 2K6QA 2M19A 3BK2A 2JQRB 3L16A 2N9LA 4X57B 4RM8A 4AUQC 2MJDA 3A4RA 1SF0A 5DPRA 1V81A 1ZPSA 2DZMA 1CZPA 3RD2A 2QEJC 1UWXA 3EGRA 2Z8LA 3IT4B 2BT6A 4J6IA 4KSLC 4K7UA 2ONQA 1PUTA 3QIJA 4OHJA 3B9JA 4TMAB 1L5PA 4M0WA 5D94A 1C77A 2IY1B 4BKSA 4TSSA 5FKAC 3TEZA 2OHFA 1SE9A 4BAXA 3E56A 2C7HA 4C4VA 1I4QA 3B08A 2MBOA 2KMMA 1WGHA 5FR6A 3DQVA 2ZPNA 3RNFC 3AEDB 4MGKE 4AS1A 3OAWA 2GB1A 1EM7A 1K8RB 2OJWA 5BYQA 2YEPB 1XLNA 4A3PA 2KK8A 4DDID 5BO4B 3SFDB 3PRZA 2C60A 3QQ8B 5E6OA 2JVCA 2K22A 3ZJTA 5AUIA 4GU2A 4FA6A 3DWGC 1TTNA 2I2YA 3AECB 2LASA 1K50A 3S2AA 1EUVB 5BYRA 3GZNI 1R4MI 1D5MC 3MC8A 5E6JA 2L0TA 1DOYA 2IO0B 2D11A 2CJOA 3H7SA 2JRIB 1OEYJ 1HTQA 2FCSA 4USAA 2ACZB 1L0XB 3ONSA 5HFYA 1HXYD 4NAWA 4DHZB 2EKIA 1YN4A 1NEKB 2EELA 4OZAA 3PZ8A 1HE8A 1OEYA 1MJDA 3EC8A 4BVUC 3OLMD 1VJKA 3PHXB 2BB6A 3Q3FA 1QF6A 2NTSA 1N5XA 4RCOA 2KDIA 5IOIA 3LXFA 2OJRA 3AE9B 3D32A 5BYSA 2WDTB 4AQ7A 2WXQA 2LI5A 3W5VB 4AOFA 3WAOA 1C4PA 2XK5B 3AXCA 4WJOA 4II2B 1L6VA 1JRPA 3L10B 2IGDA 1E5WA 3KUDB 4MJSB 2JWUA 3W1SC 2M4NA 4O1NA 1WJ4A 4EUTA 3NS8A 3TBLD 1X1MA 1EF1A 4BOSC 3N1ZC 2J4XA 3PTFC 4MDKE 1IBXB 1WI0A 3Q8FA 4RF1A 3V62A 2KQSA 2MBHA 4K3CA 2J42A 1V8CA 1YNTE 2AWTA 3U7ZA 3ZLZA 5FK9C 4XDCA 2X38A 3RFZB 2HJ8A 2NBUA 2RPQA 1ZOYB 4XDDA 1IUEA 1V5TA 5EE0A 3IXSA 1H8CA 4LNNA 1UELA 2INCC 4NAMA 4DBGA 3P2BA 1E9MA 1MHXA 3UQBA 2KZRA 4FHKA 1GAQB 2L3ZA 1HZ5A 3QAQA 1KF6B 1QT9A 1FXTB 1NYQA 1WX9A 2BF8B 3QA8A 3A9KB 2QILA 3RNAC 1QOBA 5IA7A 2K25A 4JPSA 4B9KA 4IUMB 1L0YB 2JY6A 3VTUA 1NDDA 1OGWA 4MSQB 4M0WB 2NBWB 2DYMA 4JWUC 1E7PB 4HK2A 1UZXB 2E3TA 4ACFA 1V1PA 4PS3A 2MRPA 2HJ1A 3ZRFA 3N20C 1TZOA 3EFCA 2QSDA 1TYGB 5L83A 2WXPA 1BMLC 1WIAA 4C4VB 4LCDE 3LYYA 2GRIA 2TSSA 3M62B 4HPLB 4IM2A 3BY4B 3UQAA 4MH0E 1E6EB 2CR5A 5CHVC 4WURA 2J0JA 2KFKA 3VUYA 1DOXA 1WGGA 2PVGC 1Y56A 2D3GA 4LDTD 5G5HA 3ZRCA 1R4NB 1JWBD 2GBNA 1WYGA 3LDZE 4LNOA 2L1AA 2NS5A 2NBVB 2DAFA 2MLBA 3SU8X 2K8CA 3AE2B 4BKSD 2FAZA 3RI7C 2VH2A 4GDLA 1EF5A 1M4VA 3AN1A 4CQNA 3H9DA 4PYZA 3V6CB 3T8MA 4F7ZA 2WX0A 3R2TA 3W9CB 3BZDB 3ETRA 1YJJA 2RDHA 1FD6A 2DYBA 3GZNB 1R4MB 3DBLI 4XWWA 2KHWB 1FO4A 4JWSC 2MCNB 1NI3A 4WJNA 4DQOC 2DWQA 3ZYYX 4NAWB 1GJZA 2BS2B 4NQKE 2PPHA 3K9OB 2FE8A 4FHJA 1N61A 3WAMA 4MM3A 1XT9B 3UIOB 2K39A 1WRIA 3Q3NC 4PK1A 1HA5A 3AEBB 3L08A 2KT7A 3Q3MC 4N9F4 4K7WA 2LHDA 1L4DB 2LGSA 2KJRA 5LXIB 1BUIC 2JYTA 4IOIE 1S1QB 1F0ZA 3ZKJC 3KH0A 1C1YB 4A9AA 3ZXRA 3ZW3A 3JSVA 3AE1B 3NZ3A 3IVFA 3MC9A 3DCGA 3N32A 2V0GA 2KQ7A 2PW9A 3DHGC 4WH4A 2AX5A 4HWIB 4ITKA 1ET6A 2C7MB 2ZVOA 4K81A 4C7ZA 1ISNA 1RAXA 2LVOA 3GB1A 1UNSA 1YN5A 1WE7A 1D5ZC 5CHWA 3K9PB 5D2MB 4GDKA 2AQ2B 4RGNA 2B76B 2C7NB 3FKYA 2V1YA 2MSED 3AU4A 3PPAA 4AJWA 2L32A 2OEDA 2C9WB 3P4RB 2RDBC 2WX1A 3QK0A 4GN1A 4XX5A 2IBIB 5CTRC 4KKJA 4HRSA 4S17A 4WWNA 1SBBB 1K53A 3UGBB 2IGHA 1FPYA 2WHIA 3RNBC 3I3TB 2IJ0A 2ZW1A 1J0GA 2QHOA 3KW5B 3N1YC 5MPOA 3PV1A 5L95C 3IG3A 4PYUA 2V4LA 2WXGA 1WM3A 1SIFA 3CSTA 4ZRKA 2EMSA 4HLEA 2AQ3B 4AP4C 2D10A 1EU3A 5JHAA 1BXTA 2ZCCA 1E8YA 1JALA 5J17A 2HE7A 4EE2A 2K8HA 2QMTA 3VVWB 2Z0DB 2NR2A 2K3UA 1JCKB 2M0XA 2H89B 2BS4B 1V1PB 3DDCB 1ZXHA 3W5UB 3DBHB 4IWPA 1T0RC 3BWUD 2N7JA 4RF0A 1QILA 2ZPYA 3O13A 2W3SA 1YOVB 1S3SG 1WZ0A 1L6UA 4YSYB 2BYFA 3U7DA 2WXHA 4BZAA 1UWMA 3KQ4A 5D6JB 1NENB 4ANWA 1KFYB 3RPFC 2KFKB 4WWMA 3Q8CA 2KN4A 1PGBA 4LTUA 1FNVA 4PS7A 2KMCA 3ECIA 1F9JA 3PZ7A 3WIMA 5DPWA 1TBEA 2L83A 3VR9B 4FJZA 3Q14C 1RFAA 3BK1A 3Q6BA 2O6VD 2LJIA 3ML8A 3PLUA 3FILA 1XEEA 2KJ6A 1LQBA 3NRZA 3N1XC 3KUCB 1RM6C 1ZKHA 1FNWA 2OOBB 5JZEB 4NJ6A 5GMVA 1TT5B 1T0YA 3AEAB 3MHZA 1WMHA 1C78A 2NMQA 4UDUC 3RZWC 2L0FA 3C8YA 5I4DA 2N7DA 2MBBB 3HHMA 2RR9A 3OJ3A 1I35A 5LLIA 1WF9A 1ESFA 2LXCA 4M8NA 3ZIMA 2LVQA 1YJ1A 3N9YC 2R61A 2BKFA 3AEGB 3ZUNA 2KQ4X 3ZDTA 3EFUA 2BS3B 5TSSA 4F1SA 2LRUA 2PJHA 1MG8A 4W9LA 1I4XA 2KVRA 4BFRA 1IP9A 1D5XC 3NHEB 4W9HA 3N30A 1LGRA 2CKHB 1XQQA 2KTRA 4W9IA 2LGXA 4GLSC 3TCAA 2D5GA 1RRBA 3PREA 4YWGG 3EUB2 3BVMA 3AM9A 2JX5A 1RYJA 1VR9A 2JZPA 3AU5A 3DBSA 4OZCA 2PE9A 4ZYNA 2WNMA 3U2SC 4B6WA 1ZW7A 3JSVB 3U30A 3KYCD 3DHIC 4KVGB 1EWYC 1A5RA 1E8WA 3RYTA 1QOGA 3I5JC 2JUOA 2MQJA 5H8YE 1FEHA 2ZJDA 1T5XD 1WR6E 1ZDVA 2DZJA 2FIDA 1QZEA 2MW5A 3W1SA 2KLCA 2WYQA 4GDKB 4A6QA 1OQQA 2BYTA 1WYWB 1P7FA 3MTNB 2Q5WD 4GGQA 1GPXA 3HVZA 2WQYB 1D6EC 3R66C 4ZDVA 3PRMB 2E6XA 1XD3B 2L76A 1PFDA 3NUHB 2MBEA 3WALA 3ZQ4A 2RMMA 2J52A 1WGRA 4GB9A 3RMKC 2IO3B 3CMMB 3U8ZA 3ZVVA 4NJCA 4MH8A 2KKCA 3QCAA 3J9CA 1LFDA 3RNEC 1D3ZA 4W9DA 2RPVA 1JROA 1TIFA 1T6BX 2WXKA 3GP7A 3QARA 1TS4A 4HJKA 3LB8C 4YTPB 2I38A 2N1VA 1TKEA 1C79A 1ENFA 4ARCA 2M8SA 4JL9A 3VTVA 3PRPB 4HROA 3VH4B 2O2VA 2GI9A 2QDFA 3UINB 3APFA 1GG3A 2K8BA 3Q3OC 4XYCA 2VH1A 2W3RA 5T8IA 1F1HA 1WXVA 3ZNID 3HIZA 4ICUA 1YQ4B 3EECA 1WGYA 1DOIA 1P98A 2XBBC 4A90A 3UI3A 5KHQA 4P6VF 4RGTA 3TJPA 2D3BA 2JZZA 2ON8A 2XN9C 4HCNB 4EFOA 1N5WA 4BKGA 2N9EB 1AW7A 5G55A 2MJ3A 1LM8B 2C5LC 2NVUI 3FILB 4CHKA 5EE1A 3V3XA 5HHDG 3IHPC 2KTFA 4KDIC 2UWQA 3FC4A 2JU6X 4GOCA 4HVBA 3BIID 2WGSA 1WMHB 3QC8B 2BB5A 5EE3A 1XCTL 5E6NA 5TR5A 4WAAA 1SB3C 4XE0A 2REXA 1WRDB 3A4SC 3P4PB 3WCQA 2N0SB 3VRBB 3L17A 4OZBA 1UF0A 1MFWA 5C2TB 2CHZA 2YLMA 4B0EA 1RFKA 4XC2A 1T3QA 3PO0A 4HPPA 4L2YA 4JQWC 5EDSA 4K3BA 3Q69A 1IGDA 1WH3A 1FM0D 1RLFA 2D07B 4YTNB 2AEHA 4YSZB 4LJOB 3VDZA 2VZKD 1H4RA 4LDTB 4P16A 1SE3A 2PKOA 4W9KA 4RFBA 4YSXB 2PE6B 2DAJA 2O6VA 4ZRQA 1QKZA 5BMHA 4LNFA 5C3JB 2JF5A 2JPHA 3OJ4B 2LXAA 2Z0EB 1WSPA 1V49A 2GBRA 1KLVA 4HDOA 4IDIA 4EZJA 2MWSB 5EE9A 3R3MA 2WU5B 2KX0A 1E0ZA 4TKNA 4DHJD 2G1EA 4EKUA 2ZEQA 3PLVA 1WXAA 3QX1A 3Q2AC 2ZNVC 2BPSA 2FCQA 1SEBD 4I6NB 2WXMA 3MP9A 2KWVB 1DYQA 1LO5D 1OQRA 3WAPA 2DNFA 1Q0WB 2BKRB 3VH3B 2FUHB 4RGMA 3B2GA 5HKHA 1FRDA 2INPE 4M01A 1K51A 1RWSA 2RD0A 1GOZA 1FCCC 1J8CA 1SSNA 4WWOA 1UGMA 4KIKA 2GBJA 3IAM1 4K1RB 1JRUA 1M94A 1Z5SB 2IDYA 2ZW0A 3Q8AA 1D4BA 3A1QA 1KLGD 4W9FA 2IYDB 3KWVA 2HD5B 3ENEA 1NVID 3V05A 3RCZA 1T0SC 2KAJA 2MJEA 2O2VB 4EEWA 2AQ1B 2MX2A 2MBQA 4L23A 2W9NA 1I4HA 2KN5A 2WXIA 4MEMA 2M17A 4G3XB 1OTRB 2BVCA 2ZVNA 2LMCA 3H1UA 4II3B 3SEBA 2N4FA 1QOFA 2G3QB 2LVPA 4ANXA 4OVVA 2FBWB 3EHVA 1P0RA 3L13A 3IAS1 1V2YA 4E74A 4ARIA 1E7UA 3OG5A 2LGIA 4XZ4A 2BWES 3ZNZB 1P1AA 3M95A 2ZNVB 2KMAA 4AJYB 2J0MA 2K5PA 3AE8B 3KWLA 5FR3A 3R7QA 3ZNHB 5BMIA 1ET9A 4WJPA 1CJEA 1XLQA 1FXIA 3CSFA 3JVZX 5IAAC 5AEKB 2KD0A 3TEXA 2YVCA 4NQLB 4DK5A 2Y5BB 4EOYA 3V61A 1SIJA 3AE4B 3MC0B 4RM9A 2KLGA 4N58A 2V4IB 1YX6B 4FULA 1PYWD 3VUXA 5G2NA 3VRAB 2NTTA 1STEA 1VZ8A 4D2KA 4KDLB 4FADA 1J7AA 4KX6B 1CK1A 3NS1A 1J19A 2H88B 3O65B 1N60A 4E71A 1GC7A 3RUIB 3NZUA 2IZVB 1L0VB 1ZUD2 2KDEB 4HDQA 1ACCA 4FJYA 2CJNA 4BOZB 2WDRB 1B9RA 2KXJA 3HK0A 2JYEA 2J53A 3NVVA 2FUG1 3P42A 1I42A 3DHHC 3IT6B 1VD2A 1YMHE 4IC7B 2LGDA 1E10A 3T3OA 1A70A 4ZRIA 2LZ6A 2JWZA 2R2QA 4MGYE 2B3AA 2O6VB 3BINA 2LHEA 2LFIA 2DZKA 2DBYA 1FMAD 2FNJB 4BBNC 2MP2A 5LNK1 3LJ3A 1AARA 4M02A 1SJHD 2MEKA 5C1ZA 2Y3AA 4G11A 2WP9B 1AWDA 1PGAA 1HQRD 2WXLA 2W82A 2JT4B 2V9HA 3T3NA 1XLPA 1WX8A 1ZGUB 2JXTA 1C4AA 2GOWA 2WXOA 1CQVA 3IBEA 2KOXA 4MT5A 1N62A 2BBCA 4DXAB 1JW9D 3ZXVA 4MSMB 1UD7A 2DX5B 2KDBA 1UUPA 3BVZA 4C56C 5HI1A 3AEFB 4LLGM 2BWFA 2LUEA 3I63C 4ASWC 3W1YA 3GE3C 1I4PA 5JXVA 1VRAB 2WXNA 2K9XA 1SXTA 1JWUD 2JXXA 4GDLB 1GNUA 4FBJB 1XO3A 1AN8A 1V5OA 3AE5B 4MJSA 1WJUA 4N6EB 2SAKA 3NG0A 4HJGE 2MHJA 4W9CA 5CX3A 4S0RA 1MVKA 2IY0B 1WFYA 1K52A 1WR1A 2ICIA 3A1QB 1IBXA 4MGZE 1QOAA 1KTKA 2XNAC 1PGXA 3DBLB 1HTOA 4MM3B 3VTWA 3QHTA 3AH7A 4K7SA 4F8CB 3KVFB 1IGCA 2KO3A 4MELA 1ZP0B 3RN9C 4IKGA 1EU4A 2AL6A 5AZGA 4LNIA 2LUMA 3RULA 3L54A 4G0NB 1WJNA 1V6EA 3AE6B 1I7HA 2MA9B 5HG2A 4I6LB 1C76A 4HXDA 3DVGY 4JX1C 4NJ7A 4WIPA 2L52A 5IP4D 4DXGA 4RNAA 1TGZB 2LGYA 1C4CA 3DVNU 2J0KA 2LWPA 1ROEA 1WWTA 4B95A 1I4RA 1YQ3B 5IKCM 4PT5A 3ZNGC 4JGHB 2G45B 4ANUA 2DHZA 3WA0A 1N6ZA 2K1FA 3WANA 2FCNA 2WS3B 5D7GA 2KWDA 2KYWA 1OQYA 4H2AA 5AZFA 3DVGX 2K6DB 3PHWB 3MJ5A 4YTMB 1F2RI 2XEWA 4KZ0A 3U52E 2KDFB 1WXQA 1IYFA 5DCNA 4B0MA 2LEKA 2Z59B 2Y5PA 3AMZA 1XCQL 2N1WA 3I57A 2DZIA 1TKYA 1R4NI 1E90A 2PLPA 3B1LX 3DVNV 1VCBA 2KC2A 3P4QB 1KH0A 3ML9A 2GMIC 1JWAD 4OVUA 1KM7A 1C9FA 3A9JA 1EO6A 3Q8EA 2WXJA 1UBQA 3HM3A 4A3OA 4YXDB 2WDVB 4WJQA 2IPKD 3E9SA 4IG7B 1SE2A 4MACA 2G4DB 4BKTA 5C23A 1XF5L 3R7RA 4J3OD 2MP2B 3R8BA 4DHZE 3P4SB 1U4AA 2M0AA 3ALBA 1J7BA 2V3SA 4KV2A 2DYOA 2KVZA 3FAHA 2HTHA 3NOBA 4PS8A 2HDEA 2M1MA 4HEA1 2QC8A 4QAYA 2MH7A 4EZLA 3JW0X 4M8MA 4OW0A 4XGAB 3UF8A 4NY0A 4R3DA 3NY5A 3P1MA 1PQSA 2D3AA 3VQIA 4KGTA 3KYDD 3JYUA 2I1JA 3ZGZA 3BVGA 4CO7A 2NCNA 2ZZPB 2INNE 1YQBA 1FNUA 3H7PA 1V86A 3KLSX 3KUZA 4IM3A 1TS5A 3NZSA 3BYTB 4ZOHC 2WWZA 1C3TA 3MHSD 1VLBA 1WX7A 2GLSA 2RGFA 3VUWA 2A4ZA 2L8JA 2VZKB 4LJPB 3DOWA 3PVLA 3VAWA 3AB5A 1F2RC 5JHBA 4Q2JA 1I4GA 3SFEB 4P1BC 1UBIA 3RNCC 2AL3A 4NNJB 1TS3A 1V97A 3SR6A 1GB1A 1GB4A 4I6PA 2LJ5A 1TKGA 1L2NA 2FCMA 2CHWA 3CWIA 4FJVB 4FLHA 2KTRB 4IWQA 4DHJB 1TS2A 1MPEA 2K0PA 3AE7B 1ZDXA 1JWMD 1WJ6A 1FIQA 1HZ6A 4TQ1A 3ZDMC 1CMXB 1F52A 2AYOB 3Q8BA 3C19A 2VRRB 2PTLA 1GUAB 3QWZB 2KJHB 1YX5B 1WXMA 2CU1A 2ZCBA 3GOEA 2G9HD 3DPDA 3PSEB 2INDC 4WWPA 3M63B 4ZHPA 1Q5WB 2CS4A 3PZDA 3ZTCA 3AULA 3C0RB 4L1BA 1FFUA 1J7CA 1HEZE 3CF6E 4CYEA 5IO9A 3RNGC 3PS6A 4A8XC 3DBHI 1MG4A 1YN3A 5J2RA 1QQRA 5D3DA 4OVZA 1JQ4A 1NI2A 4C7YA 2N9KA 4DXFA 3APCA 4ZYSA 3X23A 2UYZB 2KFJA 4GXBA 3MFGA 3AE3B 4LK0M 4MGIE 4IW0A 2HTME 1DGJA 3HVDA 3CIRB 1FFVA 1WY8A 2IGGA 3OWEB 2EKEC 2UU7A 2KANA 1Z2MA 4W9GA 1JWSD 5D3IB 2KACA 3VR8B 1R7SA 3A9JB 4IWOA 4KGRA 2NPTA 2L05A 4ZRPA 4AWJA 3L4PA 1VZ6A 4KSKC 1PDXA 3HM6X 2JZ3B 1KJTA 4P1CC 1N63A 1Y8RC 3GE8C 3UIPB 4TUUA 2KWCA 1UH6A 1FCLA 3U4EG 1WGDA 1JMLA 3T9LA 4URKA 1KOTA 5AZHA 4TQ0A 1V1OA 3IFWB 3ABVB 2N9PC 2WLBA 3DBRI
chains in the Genus database with same CATH topology
2KLCA 2WYQA 4EZKA 4GDKB 1WX8A 2HJ8A 1WYWB 2NBUA 1ZGUB 2RPQA 1V5TA 5KHOA 3MTNB 5LXHA 3PT2B 4BBNF 1H8CA 2GOWA 4GGQA 1UELA 3IBEA 2KOXA 2BYVE 4DBGA 1GC6A 3P2BA 3R66C 4DXAB 4ZDVA 3PRMB 4MSMB 3UQBA 1UD7A 3B0AA 4GMVA 2DX5B 1XD3B 2KZRA 3PGEA 2KDBA 4FHKA 1WZ3A 2GBKA 2L76A 3VFKA 2MBEA 3WALA 5J18A 2BWFA 2L3ZA 3QAQA 2LUEA 1FXTB 4ASWC 3W1YA 1WGRA 4A20A 4GB9A 1WX9A 2BF8B 3H7PB 3QA8A 4KZCA 2IO3B 3CMMB 2R2OA 2DENB 2JXXA 3A9KB 3APDA 3U8ZA 3ZVVA 5E6PA 4GDLB 1GNUA 4FBJB 2CHXA 3SHQA 4HCPB 4E3CA 4IM0A 1V5OA 2KKCA 3QCAA 4MJSA 4ZRJA 1WJUA 5IA7A 1L7YA 2K25A 1LFDA 4B9KA 2FIFA 4IUMB 1D3ZA 3RT3B 4W9DA 4W9CA 4TV3A 2JY6A 5CX3A 3VTUA 1YD8U 1NDDA 1OGWA 2IY0B 5DPTA 4MSQB 1WFYA 2L00B 3RZFA 4M0WB 1WR1A 2DYMA 2NBWB 3QARA 2N9XA 1P3QU 4HJKA 3A1QB 4HK2A 4MGZE 1UZXB 1Q1OA 2N1VA 1TZ1A 4YL8A 4PS3A 2MRPA 2JRHA 3QJZA 2M8SA 3M3JA 4JL9A 3VTVA 3W1SA 3ZRFA 3PRPB 3VH4B 2O2VA 3VTWA 2KWUB 3QHTA 4K7SA 3UINB 2LRWA 4F8CB 3APFA 3KVFB 1GG3A 2K8BA 2KO3A 4W9JA 4GIVA 4MELA 4JIOU 5L83A 1WIAA 2A5UA 2N7EA 4LCDE 2KC1A 3M62B 4HPLB 4IM2A 3BY4B 1WXVA 3ZNID 3UQAA 3HIZA 4ICUA 4MH0E 3EECA 2CR5A 5CHVC 2AL6A 1WGYA 5AZGA 1P98A 2J0JA 2XBBC 2KFKA 3L0WB 4ICVA 4DWFA 3VUYA 5KHQA 1WXSA 3RULA 1WGGA 3TL5A 3L54A 4G0NB 3TIXA 2D3GA 1WJNA 3TJPA 4LDTD 1V6EA 4ANVA 1E7VA 2JZZA 2KNBA 3ZRCA 4HCNB 4EFOA 2GBNA 3LDZE 2MA9B 2NBVB 2NS5A 4I6LB 1WM2A 2L7RA 4BKGA 4HXDA 2N9EB 2DAFA 2MLBA 3SU8X 2K8CA 5G55A 3DVGY 2D2QA 4BKSD 1LM8B 2C5LC 2NVUI 2PEAA 5DPSA 2FAZA 2BGFA 4GDLA 4NJ7A 1EF5A 4CHKA 1NBFC 3Q3JA 3H9DA 4PYZA 3V6CB 3IHPC 1TGZB 2KTFA 4KDIC 2LGYA 3T8MA 2WX0A 3DVNU 4F7ZA 2J0KA 2LWPA 2UWQA 4DDGD 1P9DU 4GOCA 4HVBA 4RMAA 1WMHB 4B95A 1E8ZA 3QC8B 2DYBA 3V6EB 5E6NA 5TR5A 3ZNGC 3DBLI 4WAAA 4JGHB 2G45B 4ANUA 1YIWA 2DHZA 2KHWB 2REXA 1WRDB 2K1FA 4NPNA 2FCNA 3A4SC 5D7GA 3WA0A 3WANA 2I1KA 2MCNB 4WJNA 5CHFA 4NAWB 1GJZA 1OQYA 4NQKE 2EMTA 2PPHA 3K9OB 3L17A 5AZFA 3DVGX 2K6DB 3PHWB 4FHJA 2CHZA 4JLCA 3WAMA 4MM3A 1XT9B 2YLMA 3UIOB 2K39A 2KX3A 4KZ0A 2XEWA 3VHTC 4XC2A 3MJWA 2KDFB 4JQWC 5EDSA 5DCNA 1IYFA 2Z59B 1V80A 2N1WA 3SDLC 2DZIA 1R4NI 3TMPB 3H6NA 2IO1B 3L08A 4N9F4 1E90A 4K7WA 3B1LX 3DVNV 1WH3A 5JH5C 1RLFA 1VCBA 2KC2A 2XK5A 3ZO5B 3SD5A 3V60A 2LD9A 3AI5A 1SGHA 2KJRA 2D07B 5LXIB 3ML9A 2GMIC 4OVUA 1KM7A 2AEHA 3A9JA 4LJOB 1EO6A 3VDZA 1S1QB 3ZKJC 2NPTB 1UBQA 3HM3A 3KH0A 1H4RA 1C1YB 4LDTB 3ZW3A 3JSVA 4A3OA 4W9KA 4WQOB 4KIKB 2PE6B 2DAJA 2ASQA 1BT0A 4WJQA 3IVFA 4IG7B 3DCGA 3N32A 2KQ7A 2O6VA 2G4DB 4BKTA 5C23A 2BYEA 1E8XA 4HPMB 3R7RA 4HWIB 2C7MB 1IPGA 3VXWA 2JF5A 2JPHA 2ZVOA 2MP2B 2LXAA 2G4SA 3OJ4B 4K81A 2Z0EB 1ISNA 1V49A 1RAXA 2LVOA 4DHZE 1U4AA 2GBRA 3ALBA 4FN2A 1KLVA 4HDOA 3N3KB 2V3SA 1WE7A 4G50A 2J7QB 4EZJA 2MWSB 2DYOA 4KV2A 5CHWA 3K9PB 5D2MB 4GDKA 3R3MA 1LXDA 2HTHA 3NOBA 2KX0A 2IO2B 4PS8A 2M1MA 4TKNA 2C7NB 4DHJD 2V1YA 2MSED 3AU4A 3PPAA 3ZTDA 4AJWA 4EKUA 2ZEQA 3PLVA 1WXAA 3QX1A 1V9JA 2C9WB 2ZNVC 4EZLA 4W9EA 3JW0X 4M8MA 3A33B 2GBMA 2BPSA 3UF8A 2FCQA 2WX1A 3QK0A 4GN1A 2IBIB 4NY0A 4I6NB 4XX5A 3NY5A 5CTRC 3X0WA 1PQSA 4P7IA 2KWVB 4WWNA 1G6JA 3VQIA 3KYDD 3JYUA 3UGBB 3WAPA 1WE6A 2I1JA 4GSWA 1Q0WB 2BKRB 2RSUA 3VH3B 4CO7A 3I3TB 2NCNA 2FUHB 2ZZPB 1J0GA 2QHOA 3KW5B 1YQBA 3H7PA 3KUZA 1V86A 4IM3A 5HKHA 3NZSA 3A9KA 2K6QA 3PV1A 5L95C 3IG3A 3L16A 2V4LA 4PYUA 4X57B 2WWZA 4RM8A 4AUQC 1WM3A 1SIFA 1C3TA 3A4RA 3CSTA 5DPRA 1V81A 4ZRKA 3MHSD 2RD0A 2EMSA 1WX7A 2DZMA 4HLEA 3RD2A 2RGFA 1J8CA 4AP4C 4J6IA 4KSLC 2A4ZA 2D10A 2L8JA 3VUWA 4WWOA 4K7UA 4LJPB 1UGMA 4KIKA 3DOWA 5JHAA 3PVLA 3VAWA 2GBJA 4K1RB 3QIJA 1JRUA 2ZCCA 1E8YA 5J17A 1M94A 1Z5SB 2HE7A 5D94A 5JHBA 2K8HA 3A1QA 3VVWB 2IY1B 2Z0DB 4W9FA 4BKSA 2NR2A 2IYDB 2M0XA 2HD5B 3ENEA 1UBIA 2AL3A 3RCZA 4NNJB 3DDCB 1SE9A 4IWPA 4I6PA 2O2VB 4EEWA 2LJ5A 1L2NA 2C7HA 2ZPYA 2MX2A 2MBQA 3B08A 2MBOA 1S3SG 1WZ0A 2FCMA 2W9NA 1WGHA 5FR6A 2BYFA 2CHWA 2KN5A 3DQVA 3U7DA 4FJVB 4FLHA 2ZPNA 2M17A 4G3XB 4MEMA 1OTRB 4MGKE 5D6JB 2ZVNA 2KTRB 3H1UA 4IWQA 4ANWA 4DHJB 4II3B 2KFKB 2N4FA 1WJ6A 3OAWA 1K8RB 4TQ1A 2G3QB 4PS7A 1CMXB 2KMCA 1F9JA 2LVPA 2AYOB 3ECIA 3WIMA 3ZDMC 4A3PA 4ANXA 5DPWA 4OVVA 1TBEA 2KK8A 2VRRB 4DDID 1GUAB 5BO4B 3QWZB 4FJZA 3EHVA 1RFAA 3PRZA 1P0RA 2C60A 2KJHB 1YX5B 3QQ8B 3L13A 1WXMA 2CU1A 2JVCA 2O6VD 5E6OA 1V2YA 4E74A 4GU2A 1E7UA 2ZCBA 4FA6A 3ML8A 3PLUA 4XZ4A 1TTNA 2BWES 3ZNZB 1P1AA 2KJ6A 2LASA 3M95A 1LQBA 3S2AA 1EUVB 2ZNVB 2KMAA 3DPDA 3GOEA 3GZNI 1R4MI 2J0MA 3PSEB 3KUCB 4AJYB 4WWPA 1ZKHA 2L0TA 3R7QA 3M63B 3ZNHB 2OOBB 2IO0B 1Q5WB 2CS4A 2D11A 3H7SA 3PZDA 4NJ6A 4WJPA 5GMVA 5JZEB 1T0YA 3ZTCA 3AULA 3C0RB 1WMHA 2JRIB 3CSFA 3CF6E 4CYEA 3RZWC 3JVZX 2L0FA 5IAAC 1OEYJ 2KD0A 3PS6A 2N7DA 5AEKB 2MBBB 2YVCA 3DBHI 3HHMA 2RR9A 3OJ3A 2Y5BB 4NQLB 4DK5A 2FCSA 1I35A 4EOYA 5J2RA 3ONSA 3V61A 5LLIA 1WF9A 4NAWA 4DHZB 1NI2A 4RM9A 2LXCA 4M8NA 3ZIMA 2KLGA 2LVQA 1YJ1A 1YX6B 4FULA 3VUXA 2BKFA 1HE8A 1OEYA 3APCA 3EC8A 3X23A 5G2NA 3ZUNA 4BVUC 2UYZB 3OLMD 3PHXB 2KFJA 3ZDTA 3EFUA 4GXBA 4F1SA 4KDLB 2LRUA 4FADA 4MGIE 2PJHA 1MG8A 3Q3FA 4W9LA 4IW0A 2KDIA 1J19A 2KVRA 2OJRA 3D32A 3O65B 4BFRA 4E71A 1GC7A 3RUIB 2IZVB 3NZUA 1IP9A 3NHEB 1WY8A 3TBLD 2WDTB 4W9HA 2KDEB 2CKHB 3N30A 4HDQA 2EKEC 1XQQA 2KTRA 2LI5A 2KANA 4FJYA 4W9IA 1Z2MA 2LGXA 4W9GA 4AOFA 3WAOA 2XK5B 3AXCA 4BOZB 4WJOA 3TCAA 1RRBA 3PREA 4II2B 2KXJA 3HK0A 3A9JB 3L10B 4IWOA 3AU5A 2NPTA 2L05A 3DBSA 1E5WA 3KUDB 2PE9A 4MJSB 4ZYNA 3W1SC 1I42A 2M4NA 4B6WA 1ZW7A 4AWJA 1WJ4A 1VD2A 3JSVB 4EUTA 4IC7B 3U30A 2LGDA 3NS8A 3KYCD 4KSKC 4ZRIA 1X1MA 3HM6X 4KVGB 2JZ3B 2JWZA 1EF1A 2LZ6A 2R2QA 4MGYE 1KJTA 2B3AA 1A5RA 1E8WA 2O6VB 3BINA 3RYTA 4BOSC 2DZKA 3PTFC 4MDKE 1Y8RC 2FNJB 3UIPB 4BBNC 4TUUA 2KWCA 1UH6A 2JUOA 2MQJA 2MP2A 1WI0A 1WGDA 3LJ3A 1AARA 3T9LA 4URKA 3V62A 1KOTA 5AZHA 4TQ0A 2KQSA 2MBHA 2ZJDA 5C1ZA 4G11A 3IFWB 1WR6E 2AWTA 2N9PC 2DZJA 2FIDA 3ZLZA 2JT4B 1QZEA 2MW5A 3DBRI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KLC A;  2WYQ A;  4EZK A;  4GDK B;  1WX8 A;  2HJ8 A;  1WYW B;  2NBU A;  1ZGU B;  2RPQ A;  1V5T A;  5KHO A;  3MTN B;  5LXH A;  3PT2 B;  4BBN F;  1H8C A;  2GOW A;  4GGQ A;  1UEL A;  3IBE A;  2KOX A;  2BYV E;  4DBG A;  1GC6 A;  3P2B A;  3R66 C;  4DXA B;  4ZDV A;  3PRM B;  4MSM B;  3UQB A;  1UD7 A;  3B0A A;  4GMV A;  2DX5 B;  1XD3 B;  2KZR A;  3PGE A;  2KDB A;  4FHK A;  1WZ3 A;  2GBK A;  2L76 A;  3VFK A;  2MBE A;  3WAL A;  5J18 A;  2BWF A;  2L3Z A;  3QAQ A;  2LUE A;  1FXT B;  4ASW C;  3W1Y A;  1WGR A;  4A20 A;  4GB9 A;  1WX9 A;  2BF8 B;  3H7P B;  3QA8 A;  4KZC A;  2IO3 B;  3CMM B;  2R2O A;  2DEN B;  2JXX A;  3A9K B;  3APD A;  3U8Z A;  3ZVV A;  5E6P A;  4GDL B;  1GNU A;  4FBJ B;  2CHX A;  3SHQ A;  4HCP B;  4E3C A;  4IM0 A;  1V5O A;  2KKC A;  3QCA A;  4MJS A;  4ZRJ A;  1WJU A;  5IA7 A;  1L7Y A;  2K25 A;  1LFD A;  4B9K A;  2FIF A;  4IUM B;  1D3Z A;  3RT3 B;  4W9D A;  4W9C A;  4TV3 A;  2JY6 A;  5CX3 A;  3VTU A;  1YD8 U;  1NDD A;  1OGW A;  2IY0 B;  5DPT A;  4MSQ B;  1WFY A;  2L00 B;  3RZF A;  4M0W B;  1WR1 A;  2DYM A;  2NBW B;  3QAR A;  2N9X A;  1P3Q U;  4HJK A;  3A1Q B;  4HK2 A;  4MGZ E;  1UZX B;  1Q1O A;  2N1V A;  1TZ1 A;  4YL8 A;  4PS3 A;  2MRP A;  2JRH A;  3QJZ A;  2M8S A;  3M3J A;  4JL9 A;  3VTV A;  3W1S A;  3ZRF A;  3PRP B;  3VH4 B;  2O2V A;  3VTW A;  2KWU B;  3QHT A;  4K7S A;  3UIN B;  2LRW A;  4F8C B;  3APF A;  3KVF B;  1GG3 A;  2K8B A;  2KO3 A;  4W9J A;  4GIV A;  4MEL A;  4JIO U;  5L83 A;  1WIA A;  2A5U A;  2N7E A;  4LCD E;  2KC1 A;  3M62 B;  4HPL B;  4IM2 A;  3BY4 B;  1WXV A;  3ZNI D;  3UQA A;  3HIZ A;  4ICU A;  4MH0 E;  3EEC A;  2CR5 A;  5CHV C;  2AL6 A;  1WGY A;  5AZG A;  1P98 A;  2J0J A;  2XBB C;  2KFK A;  3L0W B;  4ICV A;  4DWF A;  3VUY A;  5KHQ A;  1WXS A;  3RUL A;  1WGG A;  3TL5 A;  3L54 A;  4G0N B;  3TIX A;  2D3G A;  1WJN A;  3TJP A;  4LDT D;  1V6E A;  4ANV A;  1E7V A;  2JZZ A;  2KNB A;  3ZRC A;  4HCN B;  4EFO A;  2GBN A;  3LDZ E;  2MA9 B;  2NBV B;  2NS5 A;  4I6L B;  1WM2 A;  2L7R A;  4BKG A;  4HXD A;  2N9E B;  2DAF A;  2MLB A;  3SU8 X;  2K8C A;  5G55 A;  3DVG Y;  2D2Q A;  4BKS D;  1LM8 B;  2C5L C;  2NVU I;  2PEA A;  5DPS A;  2FAZ A;  2BGF A;  4GDL A;  4NJ7 A;  1EF5 A;  4CHK A;  1NBF C;  3Q3J A;  3H9D A;  4PYZ A;  3V6C B;  3IHP C;  1TGZ B;  2KTF A;  4KDI C;  2LGY A;  3T8M A;  2WX0 A;  3DVN U;  4F7Z A;  2J0K A;  2LWP A;  2UWQ A;  4DDG D;  1P9D U;  4GOC A;  4HVB A;  4RMA A;  1WMH B;  4B95 A;  1E8Z A;  3QC8 B;  2DYB A;  3V6E B;  5E6N A;  5TR5 A;  3ZNG C;  3DBL I;  4WAA A;  4JGH B;  2G45 B;  4ANU A;  1YIW A;  2DHZ A;  2KHW B;  2REX A;  1WRD B;  2K1F A;  4NPN A;  2FCN A;  3A4S C;  5D7G A;  3WA0 A;  3WAN A;  2I1K A;  2MCN B;  4WJN A;  5CHF A;  4NAW B;  1GJZ A;  1OQY A;  4NQK E;  2EMT A;  2PPH A;  3K9O B;  3L17 A;  5AZF A;  3DVG X;  2K6D B;  3PHW B;  4FHJ A;  2CHZ A;  4JLC A;  3WAM A;  4MM3 A;  1XT9 B;  2YLM A;  3UIO B;  2K39 A;  2KX3 A;  4KZ0 A;  2XEW A;  3VHT C;  4XC2 A;  3MJW A;  2KDF B;  4JQW C;  5EDS A;  5DCN A;  1IYF A;  2Z59 B;  1V80 A;  2N1W A;  3SDL C;  2DZI A;  1R4N I;  3TMP B;  3H6N A;  2IO1 B;  3L08 A;  4N9F 4;  1E90 A;  4K7W A;  3B1L X;  3DVN V;  1WH3 A;  5JH5 C;  1RLF A;  1VCB A;  2KC2 A;  2XK5 A;  3ZO5 B;  3SD5 A;  3V60 A;  2LD9 A;  3AI5 A;  1SGH A;  2KJR A;  2D07 B;  5LXI B;  3ML9 A;  2GMI C;  4OVU A;  1KM7 A;  2AEH A;  3A9J A;  4LJO B;  1EO6 A;  3VDZ A;  1S1Q B;  3ZKJ C;  2NPT B;  1UBQ A;  3HM3 A;  3KH0 A;  1H4R A;  1C1Y B;  4LDT B;  3ZW3 A;  3JSV A;  4A3O A;  4W9K A;  4WQO B;  4KIK B;  2PE6 B;  2DAJ A;  2ASQ A;  1BT0 A;  4WJQ A;  3IVF A;  4IG7 B;  3DCG A;  3N32 A;  2KQ7 A;  2O6V A;  2G4D B;  4BKT A;  5C23 A;  2BYE A;  1E8X A;  4HPM B;  3R7R A;  4HWI B;  2C7M B;  1IPG A;  3VXW A;  2JF5 A;  2JPH A;  2ZVO A;  2MP2 B;  2LXA A;  2G4S A;  3OJ4 B;  4K81 A;  2Z0E B;  1ISN A;  1V49 A;  1RAX A;  2LVO A;  4DHZ E;  1U4A A;  2GBR A;  3ALB A;  4FN2 A;  1KLV A;  4HDO A;  3N3K B;  2V3S A;  1WE7 A;  4G50 A;  2J7Q B;  4EZJ A;  2MWS B;  2DYO A;  4KV2 A;  5CHW A;  3K9P B;  5D2M B;  4GDK A;  3R3M A;  1LXD A;  2HTH A;  3NOB A;  2KX0 A;  2IO2 B;  4PS8 A;  2M1M A;  4TKN A;  2C7N B;  4DHJ D;  2V1Y A;  2MSE D;  3AU4 A;  3PPA A;  3ZTD A;  4AJW A;  4EKU A;  2ZEQ A;  3PLV A;  1WXA A;  3QX1 A;  1V9J A;  2C9W B;  2ZNV C;  4EZL A;  4W9E A;  3JW0 X;  4M8M A;  3A33 B;  2GBM A;  2BPS A;  3UF8 A;  2FCQ A;  2WX1 A;  3QK0 A;  4GN1 A;  2IBI B;  4NY0 A;  4I6N B;  4XX5 A;  3NY5 A;  5CTR C;  3X0W A;  1PQS A;  4P7I A;  2KWV B;  4WWN A;  1G6J A;  3VQI A;  3KYD D;  3JYU A;  3UGB B;  3WAP A;  1WE6 A;  2I1J A;  4GSW A;  1Q0W B;  2BKR B;  2RSU A;  3VH3 B;  4CO7 A;  3I3T B;  2NCN A;  2FUH B;  2ZZP B;  1J0G A;  2QHO A;  3KW5 B;  1YQB A;  3H7P A;  3KUZ A;  1V86 A;  4IM3 A;  5HKH A;  3NZS A;  3A9K A;  2K6Q A;  3PV1 A;  5L95 C;  3IG3 A;  3L16 A;  2V4L A;  4PYU A;  4X57 B;  2WWZ A;  4RM8 A;  4AUQ C;  1WM3 A;  1SIF A;  1C3T A;  3A4R A;  3CST A;  5DPR A;  1V81 A;  4ZRK A;  3MHS D;  2RD0 A;  2EMS A;  1WX7 A;  2DZM A;  4HLE A;  3RD2 A;  2RGF A;  1J8C A;  4AP4 C;  4J6I A;  4KSL C;  2A4Z A;  2D10 A;  2L8J A;  3VUW A;  4WWO A;  4K7U A;  4LJP B;  1UGM A;  4KIK A;  3DOW A;  5JHA A;  3PVL A;  3VAW A;  2GBJ A;  4K1R B;  3QIJ A;  1JRU A;  2ZCC A;  1E8Y A;  5J17 A;  1M94 A;  1Z5S B;  2HE7 A;  5D94 A;  5JHB A;  2K8H A;  3A1Q A;  3VVW B;  2IY1 B;  2Z0D B;  4W9F A;  4BKS A;  2NR2 A;  2IYD B;  2M0X A;  2HD5 B;  3ENE A;  1UBI A;  2AL3 A;  3RCZ A;  4NNJ B;  3DDC B;  1SE9 A;  4IWP A;  4I6P A;  2O2V B;  4EEW A;  2LJ5 A;  1L2N A;  2C7H A;  2ZPY A;  2MX2 A;  2MBQ A;  3B08 A;  2MBO A;  1S3S G;  1WZ0 A;  2FCM A;  2W9N A;  1WGH A;  5FR6 A;  2BYF A;  2CHW A;  2KN5 A;  3DQV A;  3U7D A;  4FJV B;  4FLH A;  2ZPN A;  2M17 A;  4G3X B;  4MEM A;  1OTR B;  4MGK E;  5D6J B;  2ZVN A;  2KTR B;  3H1U A;  4IWQ A;  4ANW A;  4DHJ B;  4II3 B;  2KFK B;  2N4F A;  1WJ6 A;  3OAW A;  1K8R B;  4TQ1 A;  2G3Q B;  4PS7 A;  1CMX B;  2KMC A;  1F9J A;  2LVP A;  2AYO B;  3ECI A;  3WIM A;  3ZDM C;  4A3P A;  4ANX A;  5DPW A;  4OVV A;  1TBE A;  2KK8 A;  2VRR B;  4DDI D;  1GUA B;  5BO4 B;  3QWZ B;  4FJZ A;  3EHV A;  1RFA A;  3PRZ A;  1P0R A;  2C60 A;  2KJH B;  1YX5 B;  3QQ8 B;  3L13 A;  1WXM A;  2CU1 A;  2JVC A;  2O6V D;  5E6O A;  1V2Y A;  4E74 A;  4GU2 A;  1E7U A;  2ZCB A;  4FA6 A;  3ML8 A;  3PLU A;  4XZ4 A;  1TTN A;  2BWE S;  3ZNZ B;  1P1A A;  2KJ6 A;  2LAS A;  3M95 A;  1LQB A;  3S2A A;  1EUV B;  2ZNV B;  2KMA A;  3DPD A;  3GOE A;  3GZN I;  1R4M I;  2J0M A;  3PSE B;  3KUC B;  4AJY B;  4WWP A;  1ZKH A;  2L0T A;  3R7Q A;  3M63 B;  3ZNH B;  2OOB B;  2IO0 B;  1Q5W B;  2CS4 A;  2D11 A;  3H7S A;  3PZD A;  4NJ6 A;  4WJP A;  5GMV A;  5JZE B;  1T0Y A;  3ZTC A;  3AUL A;  3C0R B;  1WMH A;  2JRI B;  3CSF A;  3CF6 E;  4CYE A;  3RZW C;  3JVZ X;  2L0F A;  5IAA C;  1OEY J;  2KD0 A;  3PS6 A;  2N7D A;  5AEK B;  2MBB B;  2YVC A;  3DBH I;  3HHM A;  2RR9 A;  3OJ3 A;  2Y5B B;  4NQL B;  4DK5 A;  2FCS A;  1I35 A;  4EOY A;  5J2R A;  3ONS A;  3V61 A;  5LLI A;  1WF9 A;  4NAW A;  4DHZ B;  1NI2 A;  4RM9 A;  2LXC A;  4M8N A;  3ZIM A;  2KLG A;  2LVQ A;  1YJ1 A;  1YX6 B;  4FUL A;  3VUX A;  2BKF A;  1HE8 A;  1OEY A;  3APC A;  3EC8 A;  3X23 A;  5G2N A;  3ZUN A;  4BVU C;  2UYZ B;  3OLM D;  3PHX B;  2KFJ A;  3ZDT A;  3EFU A;  4GXB A;  4F1S A;  4KDL B;  2LRU A;  4FAD A;  4MGI E;  2PJH A;  1MG8 A;  3Q3F A;  4W9L A;  4IW0 A;  2KDI A;  1J19 A;  2KVR A;  2OJR A;  3D32 A;  3O65 B;  4BFR A;  4E71 A;  1GC7 A;  3RUI B;  2IZV B;  3NZU A;  1IP9 A;  3NHE B;  1WY8 A;  3TBL D;  2WDT B;  4W9H A;  2KDE B;  2CKH B;  3N30 A;  4HDQ A;  2EKE C;  1XQQ A;  2KTR A;  2LI5 A;  2KAN A;  4FJY A;  4W9I A;  1Z2M A;  2LGX A;  4W9G A;  4AOF A;  3WAO A;  2XK5 B;  3AXC A;  4BOZ B;  4WJO A;  3TCA A;  1RRB A;  3PRE A;  4II2 B;  2KXJ A;  3HK0 A;  3A9J B;  3L10 B;  4IWO A;  3AU5 A;  2NPT A;  2L05 A;  3DBS A;  1E5W A;  3KUD B;  2PE9 A;  4MJS B;  4ZYN A;  3W1S C;  1I42 A;  2M4N A;  4B6W A;  1ZW7 A;  4AWJ A;  1WJ4 A;  1VD2 A;  3JSV B;  4EUT A;  4IC7 B;  3U30 A;  2LGD A;  3NS8 A;  3KYC D;  4KSK C;  4ZRI A;  1X1M A;  3HM6 X;  4KVG B;  2JZ3 B;  2JWZ A;  1EF1 A;  2LZ6 A;  2R2Q A;  4MGY E;  1KJT A;  2B3A A;  1A5R A;  1E8W A;  2O6V B;  3BIN A;  3RYT A;  4BOS C;  2DZK A;  3PTF C;  4MDK E;  1Y8R C;  2FNJ B;  3UIP B;  4BBN C;  4TUU A;  2KWC A;  1UH6 A;  2JUO A;  2MQJ A;  2MP2 A;  1WI0 A;  1WGD A;  3LJ3 A;  1AAR A;  3T9L A;  4URK A;  3V62 A;  1KOT A;  5AZH A;  4TQ0 A;  2KQS A;  2MBH A;  2ZJD A;  5C1Z A;  4G11 A;  3IFW B;  1WR6 E;  2AWT A;  2N9P C;  2DZJ A;  2FID A;  3ZLZ A;  2JT4 B;  1QZE A;  2MW5 A;  3DBR I; 
#chains in the Genus database with same CATH topology
 1ZE3 D;  4EZK A;  1T0Q C;  5KHO A;  1OFF A;  5LXH A;  3PT2 B;  4BBN F;  2M56 B;  2BYV E;  2W55 A;  1GC6 A;  1TJE A;  3B0A A;  4GMV A;  3PGE A;  1WZ3 A;  2GBK A;  3VFK A;  2X8X X;  4LNK A;  5J18 A;  2D3C A;  4A20 A;  3ZJU A;  1F77 A;  4A55 A;  3BYY B;  3H7P B;  4KZC A;  3R2I A;  2R2O A;  2DEN B;  3APD A;  4HKZ E;  1TY0 A;  5E6P A;  1L4Z B;  3AV8 A;  2CHX A;  3SHQ A;  4HCP B;  4E3C A;  4IM0 A;  4WQM A;  4ZRJ A;  1L7Y A;  2V3N A;  2FIF A;  3RT3 B;  4TV3 A;  1YD8 U;  5DPT A;  1SJE D;  2L00 B;  3H8H A;  3NVZ A;  2BQQ A;  3RZF A;  1FRR A;  4RH6 A;  2N9X A;  1TY2 A;  1P3Q U;  1XXG A;  2PIA A;  1Q1O A;  2QJL A;  2RDG A;  3I9V 1;  1TZ1 A;  4RGO S;  4US9 A;  4YL8 A;  2JRH A;  3QJZ A;  3M3J A;  4KGS A;  2Y5C A;  4XWT A;  2KWU B;  2LRW A;  4W9J A;  2PVO D;  1XLO A;  4GIV A;  4JIO U;  2QIE B;  2A5U A;  2N7E A;  1MHH E;  3NJT A;  4FXC A;  2KC1 A;  5AUK A;  2SEB D;  5BMG A;  2WU2 B;  3L0W B;  2YEP F;  4ICV A;  4DWF A;  1WXS A;  3TL5 A;  3TIX A;  4ANV A;  1E7V A;  2KNB A;  1VZ7 A;  1Q10 A;  3HUI A;  1ZXI A;  1WM2 A;  2QCZ A;  1NYR A;  1B1Z A;  2L7R A;  5GXG B;  4M00 A;  4JE3 B;  2BTE A;  2D2Q A;  2WDQ B;  5DPS A;  2PEA A;  2BGF A;  5IN7 A;  4US8 A;  1NBF C;  3Q3J A;  4N59 A;  3EA6 A;  4DDG D;  3GS2 A;  1P9D U;  1FXA A;  4RMA A;  1E8Z A;  3V6E B;  1YIW A;  4NPN A;  1AYF A;  2WXR A;  2I1K A;  1EWC A;  5CHF A;  2PMV A;  2KDM A;  2EMT A;  5G5G A;  3W2D A;  4JLC A;  2W54 A;  2JSV X;  2KX3 A;  3TEY A;  3VHT C;  3TSS A;  3MJW A;  3AEE B;  1KRH A;  3NVW A;  1UGJ A;  1V80 A;  1WGK A;  3SDL C;  3TMP B;  3H6N A;  2IO1 B;  5JH5 C;  2XK5 A;  3ZO5 B;  1MI0 A;  3SD5 A;  3V60 A;  3ZJV A;  2LD9 A;  3AI5 A;  1SGH A;  3DWM A;  1YJI A;  1KLU D;  4REZ A;  2NPT B;  4HKQ A;  4C80 A;  2V3P A;  4ZHO A;  4WQO B;  4KIK B;  2BW2 A;  2ASQ A;  1BT0 A;  3URY A;  2BYE A;  1E8X A;  4HPM B;  4WAF A;  1IPG A;  4YT0 B;  3VXW A;  1QLB B;  2CU3 A;  2G4S A;  4NZL B;  4FN2 A;  3N3K B;  4G50 A;  2J7Q B;  2WXF A;  1SE4 A;  1LXD A;  2IO2 B;  3ZTD A;  4KKI A;  3B2F A;  1V9J A;  1P7E A;  3P63 A;  4W9E A;  1VDV A;  3A33 B;  3DBR B;  2GBM A;  3X0W A;  4P7I A;  5H92 C;  1G6J A;  3NVY A;  2DLB A;  3HRD D;  1WE6 A;  4GSW A;  2RSU A;  4C00 A;  3TUO A;  3TEW A;  3A9K A;  2K6Q A;  2M19 A;  3BK2 A;  2JQR B;  3L16 A;  2N9L A;  4X57 B;  4RM8 A;  4AUQ C;  2MJD A;  3A4R A;  1SF0 A;  5DPR A;  1V81 A;  1ZPS A;  2DZM A;  1CZP A;  3RD2 A;  2QEJ C;  1UWX A;  3EGR A;  2Z8L A;  3IT4 B;  2BT6 A;  4J6I A;  4KSL C;  4K7U A;  2ONQ A;  1PUT A;  3QIJ A;  4OHJ A;  3B9J A;  4TMA B;  1L5P A;  4M0W A;  5D94 A;  1C77 A;  2IY1 B;  4BKS A;  4TSS A;  5FKA C;  3TEZ A;  2OHF A;  1SE9 A;  4BAX A;  3E56 A;  2C7H A;  4C4V A;  1I4Q A;  3B08 A;  2MBO A;  2KMM A;  1WGH A;  5FR6 A;  3DQV A;  2ZPN A;  3RNF C;  3AED B;  4MGK E;  4AS1 A;  3OAW A;  2GB1 A;  1EM7 A;  1K8R B;  2OJW A;  5BYQ A;  2YEP B;  1XLN A;  4A3P A;  2KK8 A;  4DDI D;  5BO4 B;  3SFD B;  3PRZ A;  2C60 A;  3QQ8 B;  5E6O A;  2JVC A;  2K22 A;  3ZJT A;  5AUI A;  4GU2 A;  4FA6 A;  3DWG C;  1TTN A;  2I2Y A;  3AEC B;  2LAS A;  1K50 A;  3S2A A;  1EUV B;  5BYR A;  3GZN I;  1R4M I;  1D5M C;  3MC8 A;  5E6J A;  2L0T A;  1DOY A;  2IO0 B;  2D11 A;  2CJO A;  3H7S A;  2JRI B;  1OEY J;  1HTQ A;  2FCS A;  4USA A;  2ACZ B;  1L0X B;  3ONS A;  5HFY A;  1HXY D;  4NAW A;  4DHZ B;  2EKI A;  1YN4 A;  1NEK B;  2EEL A;  4OZA A;  3PZ8 A;  1HE8 A;  1OEY A;  1MJD A;  3EC8 A;  4BVU C;  3OLM D;  1VJK A;  3PHX B;  2BB6 A;  3Q3F A;  1QF6 A;  2NTS A;  1N5X A;  4RCO A;  2KDI A;  5IOI A;  3LXF A;  2OJR A;  3AE9 B;  3D32 A;  5BYS A;  2WDT B;  4AQ7 A;  2WXQ A;  2LI5 A;  3W5V B;  4AOF A;  3WAO A;  1C4P A;  2XK5 B;  3AXC A;  4WJO A;  4II2 B;  1L6V A;  1JRP A;  3L10 B;  2IGD A;  1E5W A;  3KUD B;  4MJS B;  2JWU A;  3W1S C;  2M4N A;  4O1N A;  1WJ4 A;  4EUT A;  3NS8 A;  3TBL D;  1X1M A;  1EF1 A;  4BOS C;  3N1Z C;  2J4X A;  3PTF C;  4MDK E;  1IBX B;  1WI0 A;  3Q8F A;  4RF1 A;  3V62 A;  2KQS A;  2MBH A;  4K3C A;  2J42 A;  1V8C A;  1YNT E;  2AWT A;  3U7Z A;  3ZLZ A;  5FK9 C;  4XDC A;  2X38 A;  3RFZ B;  2HJ8 A;  2NBU A;  2RPQ A;  1ZOY B;  4XDD A;  1IUE A;  1V5T A;  5EE0 A;  3IXS A;  1H8C A;  4LNN A;  1UEL A;  2INC C;  4NAM A;  4DBG A;  3P2B A;  1E9M A;  1MHX A;  3UQB A;  2KZR A;  4FHK A;  1GAQ B;  2L3Z A;  1HZ5 A;  3QAQ A;  1KF6 B;  1QT9 A;  1FXT B;  1NYQ A;  1WX9 A;  2BF8 B;  3QA8 A;  3A9K B;  2QIL A;  3RNA C;  1QOB A;  5IA7 A;  2K25 A;  4JPS A;  4B9K A;  4IUM B;  1L0Y B;  2JY6 A;  3VTU A;  1NDD A;  1OGW A;  4MSQ B;  4M0W B;  2NBW B;  2DYM A;  4JWU C;  1E7P B;  4HK2 A;  1UZX B;  2E3T A;  4ACF A;  1V1P A;  4PS3 A;  2MRP A;  2HJ1 A;  3ZRF A;  3N20 C;  1TZO A;  3EFC A;  2QSD A;  1TYG B;  5L83 A;  2WXP A;  1BML C;  1WIA A;  4C4V B;  4LCD E;  3LYY A;  2GRI A;  2TSS A;  3M62 B;  4HPL B;  4IM2 A;  3BY4 B;  3UQA A;  4MH0 E;  1E6E B;  2CR5 A;  5CHV C;  4WUR A;  2J0J A;  2KFK A;  3VUY A;  1DOX A;  1WGG A;  2PVG C;  1Y56 A;  2D3G A;  4LDT D;  5G5H A;  3ZRC A;  1R4N B;  1JWB D;  2GBN A;  1WYG A;  3LDZ E;  4LNO A;  2L1A A;  2NS5 A;  2NBV B;  2DAF A;  2MLB A;  3SU8 X;  2K8C A;  3AE2 B;  4BKS D;  2FAZ A;  3RI7 C;  2VH2 A;  4GDL A;  1EF5 A;  1M4V A;  3AN1 A;  4CQN A;  3H9D A;  4PYZ A;  3V6C B;  3T8M A;  4F7Z A;  2WX0 A;  3R2T A;  3W9C B;  3BZD B;  3ETR A;  1YJJ A;  2RDH A;  1FD6 A;  2DYB A;  3GZN B;  1R4M B;  3DBL I;  4XWW A;  2KHW B;  1FO4 A;  4JWS C;  2MCN B;  1NI3 A;  4WJN A;  4DQO C;  2DWQ A;  3ZYY X;  4NAW B;  1GJZ A;  2BS2 B;  4NQK E;  2PPH A;  3K9O B;  2FE8 A;  4FHJ A;  1N61 A;  3WAM A;  4MM3 A;  1XT9 B;  3UIO B;  2K39 A;  1WRI A;  3Q3N C;  4PK1 A;  1HA5 A;  3AEB B;  3L08 A;  2KT7 A;  3Q3M C;  4N9F 4;  4K7W A;  2LHD A;  1L4D B;  2LGS A;  2KJR A;  5LXI B;  1BUI C;  2JYT A;  4IOI E;  1S1Q B;  1F0Z A;  3ZKJ C;  3KH0 A;  1C1Y B;  4A9A A;  3ZXR A;  3ZW3 A;  3JSV A;  3AE1 B;  3NZ3 A;  3IVF A;  3MC9 A;  3DCG A;  3N32 A;  2V0G A;  2KQ7 A;  2PW9 A;  3DHG C;  4WH4 A;  2AX5 A;  4HWI B;  4ITK A;  1ET6 A;  2C7M B;  2ZVO A;  4K81 A;  4C7Z A;  1ISN A;  1RAX A;  2LVO A;  3GB1 A;  1UNS A;  1YN5 A;  1WE7 A;  1D5Z C;  5CHW A;  3K9P B;  5D2M B;  4GDK A;  2AQ2 B;  4RGN A;  2B76 B;  2C7N B;  3FKY A;  2V1Y A;  2MSE D;  3AU4 A;  3PPA A;  4AJW A;  2L32 A;  2OED A;  2C9W B;  3P4R B;  2RDB C;  2WX1 A;  3QK0 A;  4GN1 A;  4XX5 A;  2IBI B;  5CTR C;  4KKJ A;  4HRS A;  4S17 A;  4WWN A;  1SBB B;  1K53 A;  3UGB B;  2IGH A;  1FPY A;  2WHI A;  3RNB C;  3I3T B;  2IJ0 A;  2ZW1 A;  1J0G A;  2QHO A;  3KW5 B;  3N1Y C;  5MPO A;  3PV1 A;  5L95 C;  3IG3 A;  4PYU A;  2V4L A;  2WXG A;  1WM3 A;  1SIF A;  3CST A;  4ZRK A;  2EMS A;  4HLE A;  2AQ3 B;  4AP4 C;  2D10 A;  1EU3 A;  5JHA A;  1BXT A;  2ZCC A;  1E8Y A;  1JAL A;  5J17 A;  2HE7 A;  4EE2 A;  2K8H A;  2QMT A;  3VVW B;  2Z0D B;  2NR2 A;  2K3U A;  1JCK B;  2M0X A;  2H89 B;  2BS4 B;  1V1P B;  3DDC B;  1ZXH A;  3W5U B;  3DBH B;  4IWP A;  1T0R C;  3BWU D;  2N7J A;  4RF0 A;  1QIL A;  2ZPY A;  3O13 A;  2W3S A;  1YOV B;  1S3S G;  1WZ0 A;  1L6U A;  4YSY B;  2BYF A;  3U7D A;  2WXH A;  4BZA A;  1UWM A;  3KQ4 A;  5D6J B;  1NEN B;  4ANW A;  1KFY B;  3RPF C;  2KFK B;  4WWM A;  3Q8C A;  2KN4 A;  1PGB A;  4LTU A;  1FNV A;  4PS7 A;  2KMC A;  3ECI A;  1F9J A;  3PZ7 A;  3WIM A;  5DPW A;  1TBE A;  2L83 A;  3VR9 B;  4FJZ A;  3Q14 C;  1RFA A;  3BK1 A;  3Q6B A;  2O6V D;  2LJI A;  3ML8 A;  3PLU A;  3FIL A;  1XEE A;  2KJ6 A;  1LQB A;  3NRZ A;  3N1X C;  3KUC B;  1RM6 C;  1ZKH A;  1FNW A;  2OOB B;  5JZE B;  4NJ6 A;  5GMV A;  1TT5 B;  1T0Y A;  3AEA B;  3MHZ A;  1WMH A;  1C78 A;  2NMQ A;  4UDU C;  3RZW C;  2L0F A;  3C8Y A;  5I4D A;  2N7D A;  2MBB B;  3HHM A;  2RR9 A;  3OJ3 A;  1I35 A;  5LLI A;  1WF9 A;  1ESF A;  2LXC A;  4M8N A;  3ZIM A;  2LVQ A;  1YJ1 A;  3N9Y C;  2R61 A;  2BKF A;  3AEG B;  3ZUN A;  2KQ4 X;  3ZDT A;  3EFU A;  2BS3 B;  5TSS A;  4F1S A;  2LRU A;  2PJH A;  1MG8 A;  4W9L A;  1I4X A;  2KVR A;  4BFR A;  1IP9 A;  1D5X C;  3NHE B;  4W9H A;  3N30 A;  1LGR A;  2CKH B;  1XQQ A;  2KTR A;  4W9I A;  2LGX A;  4GLS C;  3TCA A;  2D5G A;  1RRB A;  3PRE A;  4YWG G;  3EUB 2;  3BVM A;  3AM9 A;  2JX5 A;  1RYJ A;  1VR9 A;  2JZP A;  3AU5 A;  3DBS A;  4OZC A;  2PE9 A;  4ZYN A;  2WNM A;  3U2S C;  4B6W A;  1ZW7 A;  3JSV B;  3U30 A;  3KYC D;  3DHI C;  4KVG B;  1EWY C;  1A5R A;  1E8W A;  3RYT A;  1QOG A;  3I5J C;  2JUO A;  2MQJ A;  5H8Y E;  1FEH A;  2ZJD A;  1T5X D;  1WR6 E;  1ZDV A;  2DZJ A;  2FID A;  1QZE A;  2MW5 A;  3W1S A;  2KLC A;  2WYQ A;  4GDK B;  4A6Q A;  1OQQ A;  2BYT A;  1WYW B;  1P7F A;  3MTN B;  2Q5W D;  4GGQ A;  1GPX A;  3HVZ A;  2WQY B;  1D6E C;  3R66 C;  4ZDV A;  3PRM B;  2E6X A;  1XD3 B;  2L76 A;  1PFD A;  3NUH B;  2MBE A;  3WAL A;  3ZQ4 A;  2RMM A;  2J52 A;  1WGR A;  4GB9 A;  3RMK C;  2IO3 B;  3CMM B;  3U8Z A;  3ZVV A;  4NJC A;  4MH8 A;  2KKC A;  3QCA A;  3J9C A;  1LFD A;  3RNE C;  1D3Z A;  4W9D A;  2RPV A;  1JRO A;  1TIF A;  1T6B X;  2WXK A;  3GP7 A;  3QAR A;  1TS4 A;  4HJK A;  3LB8 C;  4YTP B;  2I38 A;  2N1V A;  1TKE A;  1C79 A;  1ENF A;  4ARC A;  2M8S A;  4JL9 A;  3VTV A;  3PRP B;  4HRO A;  3VH4 B;  2O2V A;  2GI9 A;  2QDF A;  3UIN B;  3APF A;  1GG3 A;  2K8B A;  3Q3O C;  4XYC A;  2VH1 A;  2W3R A;  5T8I A;  1F1H A;  1WXV A;  3ZNI D;  3HIZ A;  4ICU A;  1YQ4 B;  3EEC A;  1WGY A;  1DOI A;  1P98 A;  2XBB C;  4A90 A;  3UI3 A;  5KHQ A;  4P6V F;  4RGT A;  3TJP A;  2D3B A;  2JZZ A;  2ON8 A;  2XN9 C;  4HCN B;  4EFO A;  1N5W A;  4BKG A;  2N9E B;  1AW7 A;  5G55 A;  2MJ3 A;  1LM8 B;  2C5L C;  2NVU I;  3FIL B;  4CHK A;  5EE1 A;  3V3X A;  5HHD G;  3IHP C;  2KTF A;  4KDI C;  2UWQ A;  3FC4 A;  2JU6 X;  4GOC A;  4HVB A;  3BII D;  2WGS A;  1WMH B;  3QC8 B;  2BB5 A;  5EE3 A;  1XCT L;  5E6N A;  5TR5 A;  4WAA A;  1SB3 C;  4XE0 A;  2REX A;  1WRD B;  3A4S C;  3P4P B;  3WCQ A;  2N0S B;  3VRB B;  3L17 A;  4OZB A;  1UF0 A;  1MFW A;  5C2T B;  2CHZ A;  2YLM A;  4B0E A;  1RFK A;  4XC2 A;  1T3Q A;  3PO0 A;  4HPP A;  4L2Y A;  4JQW C;  5EDS A;  4K3B A;  3Q69 A;  1IGD A;  1WH3 A;  1FM0 D;  1RLF A;  2D07 B;  4YTN B;  2AEH A;  4YSZ B;  4LJO B;  3VDZ A;  2VZK D;  1H4R A;  4LDT B;  4P16 A;  1SE3 A;  2PKO A;  4W9K A;  4RFB A;  4YSX B;  2PE6 B;  2DAJ A;  2O6V A;  4ZRQ A;  1QKZ A;  5BMH A;  4LNF A;  5C3J B;  2JF5 A;  2JPH A;  3OJ4 B;  2LXA A;  2Z0E B;  1WSP A;  1V49 A;  2GBR A;  1KLV A;  4HDO A;  4IDI A;  4EZJ A;  2MWS B;  5EE9 A;  3R3M A;  2WU5 B;  2KX0 A;  1E0Z A;  4TKN A;  4DHJ D;  2G1E A;  4EKU A;  2ZEQ A;  3PLV A;  1WXA A;  3QX1 A;  3Q2A C;  2ZNV C;  2BPS A;  2FCQ A;  1SEB D;  4I6N B;  2WXM A;  3MP9 A;  2KWV B;  1DYQ A;  1LO5 D;  1OQR A;  3WAP A;  2DNF A;  1Q0W B;  2BKR B;  3VH3 B;  2FUH B;  4RGM A;  3B2G A;  5HKH A;  1FRD A;  2INP E;  4M01 A;  1K51 A;  1RWS A;  2RD0 A;  1GOZ A;  1FCC C;  1J8C A;  1SSN A;  4WWO A;  1UGM A;  4KIK A;  2GBJ A;  3IAM 1;  4K1R B;  1JRU A;  1M94 A;  1Z5S B;  2IDY A;  2ZW0 A;  3Q8A A;  1D4B A;  3A1Q A;  1KLG D;  4W9F A;  2IYD B;  3KWV A;  2HD5 B;  3ENE A;  1NVI D;  3V05 A;  3RCZ A;  1T0S C;  2KAJ A;  2MJE A;  2O2V B;  4EEW A;  2AQ1 B;  2MX2 A;  2MBQ A;  4L23 A;  2W9N A;  1I4H A;  2KN5 A;  2WXI A;  4MEM A;  2M17 A;  4G3X B;  1OTR B;  2BVC A;  2ZVN A;  2LMC A;  3H1U A;  4II3 B;  3SEB A;  2N4F A;  1QOF A;  2G3Q B;  2LVP A;  4ANX A;  4OVV A;  2FBW B;  3EHV A;  1P0R A;  3L13 A;  3IAS 1;  1V2Y A;  4E74 A;  4ARI A;  1E7U A;  3OG5 A;  2LGI A;  4XZ4 A;  2BWE S;  3ZNZ B;  1P1A A;  3M95 A;  2ZNV B;  2KMA A;  4AJY B;  2J0M A;  2K5P A;  3AE8 B;  3KWL A;  5FR3 A;  3R7Q A;  3ZNH B;  5BMI A;  1ET9 A;  4WJP A;  1CJE A;  1XLQ A;  1FXI A;  3CSF A;  3JVZ X;  5IAA C;  5AEK B;  2KD0 A;  3TEX A;  2YVC A;  4NQL B;  4DK5 A;  2Y5B B;  4EOY A;  3V61 A;  1SIJ A;  3AE4 B;  3MC0 B;  4RM9 A;  2KLG A;  4N58 A;  2V4I B;  1YX6 B;  4FUL A;  1PYW D;  3VUX A;  5G2N A;  3VRA B;  2NTT A;  1STE A;  1VZ8 A;  4D2K A;  4KDL B;  4FAD A;  1J7A A;  4KX6 B;  1CK1 A;  3NS1 A;  1J19 A;  2H88 B;  3O65 B;  1N60 A;  4E71 A;  1GC7 A;  3RUI B;  3NZU A;  2IZV B;  1L0V B;  1ZUD 2;  2KDE B;  4HDQ A;  1ACC A;  4FJY A;  2CJN A;  4BOZ B;  2WDR B;  1B9R A;  2KXJ A;  3HK0 A;  2JYE A;  2J53 A;  3NVV A;  2FUG 1;  3P42 A;  1I42 A;  3DHH C;  3IT6 B;  1VD2 A;  1YMH E;  4IC7 B;  2LGD A;  1E10 A;  3T3O A;  1A70 A;  4ZRI A;  2LZ6 A;  2JWZ A;  2R2Q A;  4MGY E;  2B3A A;  2O6V B;  3BIN A;  2LHE A;  2LFI A;  2DZK A;  2DBY A;  1FMA D;  2FNJ B;  4BBN C;  2MP2 A;  5LNK 1;  3LJ3 A;  1AAR A;  4M02 A;  1SJH D;  2MEK A;  5C1Z A;  2Y3A A;  4G11 A;  2WP9 B;  1AWD A;  1PGA A;  1HQR D;  2WXL A;  2W82 A;  2JT4 B;  2V9H A;  3T3N A;  1XLP A;  1WX8 A;  1ZGU B;  2JXT A;  1C4A A;  2GOW A;  2WXO A;  1CQV A;  3IBE A;  2KOX A;  4MT5 A;  1N62 A;  2BBC A;  4DXA B;  1JW9 D;  3ZXV A;  4MSM B;  1UD7 A;  2DX5 B;  2KDB A;  1UUP A;  3BVZ A;  4C56 C;  5HI1 A;  3AEF B;  4LLG M;  2BWF A;  2LUE A;  3I63 C;  4ASW C;  3W1Y A;  3GE3 C;  1I4P A;  5JXV A;  1VRA B;  2WXN A;  2K9X A;  1SXT A;  1JWU D;  2JXX A;  4GDL B;  1GNU A;  4FBJ B;  1XO3 A;  1AN8 A;  1V5O A;  3AE5 B;  4MJS A;  1WJU A;  4N6E B;  2SAK A;  3NG0 A;  4HJG E;  2MHJ A;  4W9C A;  5CX3 A;  4S0R A;  1MVK A;  2IY0 B;  1WFY A;  1K52 A;  1WR1 A;  2ICI A;  3A1Q B;  1IBX A;  4MGZ E;  1QOA A;  1KTK A;  2XNA C;  1PGX A;  3DBL B;  1HTO A;  4MM3 B;  3VTW A;  3QHT A;  3AH7 A;  4K7S A;  4F8C B;  3KVF B;  1IGC A;  2KO3 A;  4MEL A;  1ZP0 B;  3RN9 C;  4IKG A;  1EU4 A;  2AL6 A;  5AZG A;  4LNI A;  2LUM A;  3RUL A;  3L54 A;  4G0N B;  1WJN A;  1V6E A;  3AE6 B;  1I7H A;  2MA9 B;  5HG2 A;  4I6L B;  1C76 A;  4HXD A;  3DVG Y;  4JX1 C;  4NJ7 A;  4WIP A;  2L52 A;  5IP4 D;  4DXG A;  4RNA A;  1TGZ B;  2LGY A;  1C4C A;  3DVN U;  2J0K A;  2LWP A;  1ROE A;  1WWT A;  4B95 A;  1I4R A;  1YQ3 B;  5IKC M;  4PT5 A;  3ZNG C;  4JGH B;  2G45 B;  4ANU A;  2DHZ A;  3WA0 A;  1N6Z A;  2K1F A;  3WAN A;  2FCN A;  2WS3 B;  5D7G A;  2KWD A;  2KYW A;  1OQY A;  4H2A A;  5AZF A;  3DVG X;  2K6D B;  3PHW B;  3MJ5 A;  4YTM B;  1F2R I;  2XEW A;  4KZ0 A;  3U52 E;  2KDF B;  1WXQ A;  1IYF A;  5DCN A;  4B0M A;  2LEK A;  2Z59 B;  2Y5P A;  3AMZ A;  1XCQ L;  2N1W A;  3I57 A;  2DZI A;  1TKY A;  1R4N I;  1E90 A;  2PLP A;  3B1L X;  3DVN V;  1VCB A;  2KC2 A;  3P4Q B;  1KH0 A;  3ML9 A;  2GMI C;  1JWA D;  4OVU A;  1KM7 A;  1C9F A;  3A9J A;  1EO6 A;  3Q8E A;  2WXJ A;  1UBQ A;  3HM3 A;  4A3O A;  4YXD B;  2WDV B;  4WJQ A;  2IPK D;  3E9S A;  4IG7 B;  1SE2 A;  4MAC A;  2G4D B;  4BKT A;  5C23 A;  1XF5 L;  3R7R A;  4J3O D;  2MP2 B;  3R8B A;  4DHZ E;  3P4S B;  1U4A A;  2M0A A;  3ALB A;  1J7B A;  2V3S A;  4KV2 A;  2DYO A;  2KVZ A;  3FAH A;  2HTH A;  3NOB A;  4PS8 A;  2HDE A;  2M1M A;  4HEA 1;  2QC8 A;  4QAY A;  2MH7 A;  4EZL A;  3JW0 X;  4M8M A;  4OW0 A;  4XGA B;  3UF8 A;  4NY0 A;  4R3D A;  3NY5 A;  3P1M A;  1PQS A;  2D3A A;  3VQI A;  4KGT A;  3KYD D;  3JYU A;  2I1J A;  3ZGZ A;  3BVG A;  4CO7 A;  2NCN A;  2ZZP B;  2INN E;  1YQB A;  1FNU A;  3H7P A;  1V86 A;  3KLS X;  3KUZ A;  4IM3 A;  1TS5 A;  3NZS A;  3BYT B;  4ZOH C;  2WWZ A;  1C3T A;  3MHS D;  1VLB A;  1WX7 A;  2GLS A;  2RGF A;  3VUW A;  2A4Z A;  2L8J A;  2VZK B;  4LJP B;  3DOW A;  3PVL A;  3VAW A;  3AB5 A;  1F2R C;  5JHB A;  4Q2J A;  1I4G A;  3SFE B;  4P1B C;  1UBI A;  3RNC C;  2AL3 A;  4NNJ B;  1TS3 A;  1V97 A;  3SR6 A;  1GB1 A;  1GB4 A;  4I6P A;  2LJ5 A;  1TKG A;  1L2N A;  2FCM A;  2CHW A;  3CWI A;  4FJV B;  4FLH A;  2KTR B;  4IWQ A;  4DHJ B;  1TS2 A;  1MPE A;  2K0P A;  3AE7 B;  1ZDX A;  1JWM D;  1WJ6 A;  1FIQ A;  1HZ6 A;  4TQ1 A;  3ZDM C;  1CMX B;  1F52 A;  2AYO B;  3Q8B A;  3C19 A;  2VRR B;  2PTL A;  1GUA B;  3QWZ B;  2KJH B;  1YX5 B;  1WXM A;  2CU1 A;  2ZCB A;  3GOE A;  2G9H D;  3DPD A;  3PSE B;  2IND C;  4WWP A;  3M63 B;  4ZHP A;  1Q5W B;  2CS4 A;  3PZD A;  3ZTC A;  3AUL A;  3C0R B;  4L1B A;  1FFU A;  1J7C A;  1HEZ E;  3CF6 E;  4CYE A;  5IO9 A;  3RNG C;  3PS6 A;  4A8X C;  3DBH I;  1MG4 A;  1YN3 A;  5J2R A;  1QQR A;  5D3D A;  4OVZ A;  1JQ4 A;  1NI2 A;  4C7Y A;  2N9K A;  4DXF A;  3APC A;  4ZYS A;  3X23 A;  2UYZ B;  2KFJ A;  4GXB A;  3MFG A;  3AE3 B;  4LK0 M;  4MGI E;  4IW0 A;  2HTM E;  1DGJ A;  3HVD A;  3CIR B;  1FFV A;  1WY8 A;  2IGG A;  3OWE B;  2EKE C;  2UU7 A;  2KAN A;  1Z2M A;  4W9G A;  1JWS D;  5D3I B;  2KAC A;  3VR8 B;  1R7S A;  3A9J B;  4IWO A;  4KGR A;  2NPT A;  2L05 A;  4ZRP A;  4AWJ A;  3L4P A;  1VZ6 A;  4KSK C;  1PDX A;  3HM6 X;  2JZ3 B;  1KJT A;  4P1C C;  1N63 A;  1Y8R C;  3GE8 C;  3UIP B;  4TUU A;  2KWC A;  1UH6 A;  1FCL A;  3U4E G;  1WGD A;  1JML A;  3T9L A;  4URK A;  1KOT A;  5AZH A;  4TQ0 A;  1V1O A;  3IFW B;  3ABV B;  2N9P C;  2WLB A;  3DBR I; 
#chains in the Genus database with same CATH homology
 2KLC A;  2WYQ A;  4EZK A;  4GDK B;  1WX8 A;  2HJ8 A;  1WYW B;  2NBU A;  1ZGU B;  2RPQ A;  1V5T A;  5KHO A;  3MTN B;  5LXH A;  3PT2 B;  4BBN F;  1H8C A;  2GOW A;  4GGQ A;  1UEL A;  3IBE A;  2KOX A;  2BYV E;  4DBG A;  1GC6 A;  3P2B A;  3R66 C;  4DXA B;  4ZDV A;  3PRM B;  4MSM B;  3UQB A;  1UD7 A;  3B0A A;  4GMV A;  2DX5 B;  1XD3 B;  2KZR A;  3PGE A;  2KDB A;  4FHK A;  1WZ3 A;  2GBK A;  2L76 A;  3VFK A;  2MBE A;  3WAL A;  5J18 A;  2BWF A;  2L3Z A;  3QAQ A;  2LUE A;  1FXT B;  4ASW C;  3W1Y A;  1WGR A;  4A20 A;  4GB9 A;  1WX9 A;  2BF8 B;  3H7P B;  3QA8 A;  4KZC A;  2IO3 B;  3CMM B;  2R2O A;  2DEN B;  2JXX A;  3A9K B;  3APD A;  3U8Z A;  3ZVV A;  5E6P A;  4GDL B;  1GNU A;  4FBJ B;  2CHX A;  3SHQ A;  4HCP B;  4E3C A;  4IM0 A;  1V5O A;  2KKC A;  3QCA A;  4MJS A;  4ZRJ A;  1WJU A;  5IA7 A;  1L7Y A;  2K25 A;  1LFD A;  4B9K A;  2FIF A;  4IUM B;  1D3Z A;  3RT3 B;  4W9D A;  4W9C A;  4TV3 A;  2JY6 A;  5CX3 A;  3VTU A;  1YD8 U;  1NDD A;  1OGW A;  2IY0 B;  5DPT A;  4MSQ B;  1WFY A;  2L00 B;  3RZF A;  4M0W B;  1WR1 A;  2DYM A;  2NBW B;  3QAR A;  2N9X A;  1P3Q U;  4HJK A;  3A1Q B;  4HK2 A;  4MGZ E;  1UZX B;  1Q1O A;  2N1V A;  1TZ1 A;  4YL8 A;  4PS3 A;  2MRP A;  2JRH A;  3QJZ A;  2M8S A;  3M3J A;  4JL9 A;  3VTV A;  3W1S A;  3ZRF A;  3PRP B;  3VH4 B;  2O2V A;  3VTW A;  2KWU B;  3QHT A;  4K7S A;  3UIN B;  2LRW A;  4F8C B;  3APF A;  3KVF B;  1GG3 A;  2K8B A;  2KO3 A;  4W9J A;  4GIV A;  4MEL A;  4JIO U;  5L83 A;  1WIA A;  2A5U A;  2N7E A;  4LCD E;  2KC1 A;  3M62 B;  4HPL B;  4IM2 A;  3BY4 B;  1WXV A;  3ZNI D;  3UQA A;  3HIZ A;  4ICU A;  4MH0 E;  3EEC A;  2CR5 A;  5CHV C;  2AL6 A;  1WGY A;  5AZG A;  1P98 A;  2J0J A;  2XBB C;  2KFK A;  3L0W B;  4ICV A;  4DWF A;  3VUY A;  5KHQ A;  1WXS A;  3RUL A;  1WGG A;  3TL5 A;  3L54 A;  4G0N B;  3TIX A;  2D3G A;  1WJN A;  3TJP A;  4LDT D;  1V6E A;  4ANV A;  1E7V A;  2JZZ A;  2KNB A;  3ZRC A;  4HCN B;  4EFO A;  2GBN A;  3LDZ E;  2MA9 B;  2NBV B;  2NS5 A;  4I6L B;  1WM2 A;  2L7R A;  4BKG A;  4HXD A;  2N9E B;  2DAF A;  2MLB A;  3SU8 X;  2K8C A;  5G55 A;  3DVG Y;  2D2Q A;  4BKS D;  1LM8 B;  2C5L C;  2NVU I;  2PEA A;  5DPS A;  2FAZ A;  2BGF A;  4GDL A;  4NJ7 A;  1EF5 A;  4CHK A;  1NBF C;  3Q3J A;  3H9D A;  4PYZ A;  3V6C B;  3IHP C;  1TGZ B;  2KTF A;  4KDI C;  2LGY A;  3T8M A;  2WX0 A;  3DVN U;  4F7Z A;  2J0K A;  2LWP A;  2UWQ A;  4DDG D;  1P9D U;  4GOC A;  4HVB A;  4RMA A;  1WMH B;  4B95 A;  1E8Z A;  3QC8 B;  2DYB A;  3V6E B;  5E6N A;  5TR5 A;  3ZNG C;  3DBL I;  4WAA A;  4JGH B;  2G45 B;  4ANU A;  1YIW A;  2DHZ A;  2KHW B;  2REX A;  1WRD B;  2K1F A;  4NPN A;  2FCN A;  3A4S C;  5D7G A;  3WA0 A;  3WAN A;  2I1K A;  2MCN B;  4WJN A;  5CHF A;  4NAW B;  1GJZ A;  1OQY A;  4NQK E;  2EMT A;  2PPH A;  3K9O B;  3L17 A;  5AZF A;  3DVG X;  2K6D B;  3PHW B;  4FHJ A;  2CHZ A;  4JLC A;  3WAM A;  4MM3 A;  1XT9 B;  2YLM A;  3UIO B;  2K39 A;  2KX3 A;  4KZ0 A;  2XEW A;  3VHT C;  4XC2 A;  3MJW A;  2KDF B;  4JQW C;  5EDS A;  5DCN A;  1IYF A;  2Z59 B;  1V80 A;  2N1W A;  3SDL C;  2DZI A;  1R4N I;  3TMP B;  3H6N A;  2IO1 B;  3L08 A;  4N9F 4;  1E90 A;  4K7W A;  3B1L X;  3DVN V;  1WH3 A;  5JH5 C;  1RLF A;  1VCB A;  2KC2 A;  2XK5 A;  3ZO5 B;  3SD5 A;  3V60 A;  2LD9 A;  3AI5 A;  1SGH A;  2KJR A;  2D07 B;  5LXI B;  3ML9 A;  2GMI C;  4OVU A;  1KM7 A;  2AEH A;  3A9J A;  4LJO B;  1EO6 A;  3VDZ A;  1S1Q B;  3ZKJ C;  2NPT B;  1UBQ A;  3HM3 A;  3KH0 A;  1H4R A;  1C1Y B;  4LDT B;  3ZW3 A;  3JSV A;  4A3O A;  4W9K A;  4WQO B;  4KIK B;  2PE6 B;  2DAJ A;  2ASQ A;  1BT0 A;  4WJQ A;  3IVF A;  4IG7 B;  3DCG A;  3N32 A;  2KQ7 A;  2O6V A;  2G4D B;  4BKT A;  5C23 A;  2BYE A;  1E8X A;  4HPM B;  3R7R A;  4HWI B;  2C7M B;  1IPG A;  3VXW A;  2JF5 A;  2JPH A;  2ZVO A;  2MP2 B;  2LXA A;  2G4S A;  3OJ4 B;  4K81 A;  2Z0E B;  1ISN A;  1V49 A;  1RAX A;  2LVO A;  4DHZ E;  1U4A A;  2GBR A;  3ALB A;  4FN2 A;  1KLV A;  4HDO A;  3N3K B;  2V3S A;  1WE7 A;  4G50 A;  2J7Q B;  4EZJ A;  2MWS B;  2DYO A;  4KV2 A;  5CHW A;  3K9P B;  5D2M B;  4GDK A;  3R3M A;  1LXD A;  2HTH A;  3NOB A;  2KX0 A;  2IO2 B;  4PS8 A;  2M1M A;  4TKN A;  2C7N B;  4DHJ D;  2V1Y A;  2MSE D;  3AU4 A;  3PPA A;  3ZTD A;  4AJW A;  4EKU A;  2ZEQ A;  3PLV A;  1WXA A;  3QX1 A;  1V9J A;  2C9W B;  2ZNV C;  4EZL A;  4W9E A;  3JW0 X;  4M8M A;  3A33 B;  2GBM A;  2BPS A;  3UF8 A;  2FCQ A;  2WX1 A;  3QK0 A;  4GN1 A;  2IBI B;  4NY0 A;  4I6N B;  4XX5 A;  3NY5 A;  5CTR C;  3X0W A;  1PQS A;  4P7I A;  2KWV B;  4WWN A;  1G6J A;  3VQI A;  3KYD D;  3JYU A;  3UGB B;  3WAP A;  1WE6 A;  2I1J A;  4GSW A;  1Q0W B;  2BKR B;  2RSU A;  3VH3 B;  4CO7 A;  3I3T B;  2NCN A;  2FUH B;  2ZZP B;  1J0G A;  2QHO A;  3KW5 B;  1YQB A;  3H7P A;  3KUZ A;  1V86 A;  4IM3 A;  5HKH A;  3NZS A;  3A9K A;  2K6Q A;  3PV1 A;  5L95 C;  3IG3 A;  3L16 A;  2V4L A;  4PYU A;  4X57 B;  2WWZ A;  4RM8 A;  4AUQ C;  1WM3 A;  1SIF A;  1C3T A;  3A4R A;  3CST A;  5DPR A;  1V81 A;  4ZRK A;  3MHS D;  2RD0 A;  2EMS A;  1WX7 A;  2DZM A;  4HLE A;  3RD2 A;  2RGF A;  1J8C A;  4AP4 C;  4J6I A;  4KSL C;  2A4Z A;  2D10 A;  2L8J A;  3VUW A;  4WWO A;  4K7U A;  4LJP B;  1UGM A;  4KIK A;  3DOW A;  5JHA A;  3PVL A;  3VAW A;  2GBJ A;  4K1R B;  3QIJ A;  1JRU A;  2ZCC A;  1E8Y A;  5J17 A;  1M94 A;  1Z5S B;  2HE7 A;  5D94 A;  5JHB A;  2K8H A;  3A1Q A;  3VVW B;  2IY1 B;  2Z0D B;  4W9F A;  4BKS A;  2NR2 A;  2IYD B;  2M0X A;  2HD5 B;  3ENE A;  1UBI A;  2AL3 A;  3RCZ A;  4NNJ B;  3DDC B;  1SE9 A;  4IWP A;  4I6P A;  2O2V B;  4EEW A;  2LJ5 A;  1L2N A;  2C7H A;  2ZPY A;  2MX2 A;  2MBQ A;  3B08 A;  2MBO A;  1S3S G;  1WZ0 A;  2FCM A;  2W9N A;  1WGH A;  5FR6 A;  2BYF A;  2CHW A;  2KN5 A;  3DQV A;  3U7D A;  4FJV B;  4FLH A;  2ZPN A;  2M17 A;  4G3X B;  4MEM A;  1OTR B;  4MGK E;  5D6J B;  2ZVN A;  2KTR B;  3H1U A;  4IWQ A;  4ANW A;  4DHJ B;  4II3 B;  2KFK B;  2N4F A;  1WJ6 A;  3OAW A;  1K8R B;  4TQ1 A;  2G3Q B;  4PS7 A;  1CMX B;  2KMC A;  1F9J A;  2LVP A;  2AYO B;  3ECI A;  3WIM A;  3ZDM C;  4A3P A;  4ANX A;  5DPW A;  4OVV A;  1TBE A;  2KK8 A;  2VRR B;  4DDI D;  1GUA B;  5BO4 B;  3QWZ B;  4FJZ A;  3EHV A;  1RFA A;  3PRZ A;  1P0R A;  2C60 A;  2KJH B;  1YX5 B;  3QQ8 B;  3L13 A;  1WXM A;  2CU1 A;  2JVC A;  2O6V D;  5E6O A;  1V2Y A;  4E74 A;  4GU2 A;  1E7U A;  2ZCB A;  4FA6 A;  3ML8 A;  3PLU A;  4XZ4 A;  1TTN A;  2BWE S;  3ZNZ B;  1P1A A;  2KJ6 A;  2LAS A;  3M95 A;  1LQB A;  3S2A A;  1EUV B;  2ZNV B;  2KMA A;  3DPD A;  3GOE A;  3GZN I;  1R4M I;  2J0M A;  3PSE B;  3KUC B;  4AJY B;  4WWP A;  1ZKH A;  2L0T A;  3R7Q A;  3M63 B;  3ZNH B;  2OOB B;  2IO0 B;  1Q5W B;  2CS4 A;  2D11 A;  3H7S A;  3PZD A;  4NJ6 A;  4WJP A;  5GMV A;  5JZE B;  1T0Y A;  3ZTC A;  3AUL A;  3C0R B;  1WMH A;  2JRI B;  3CSF A;  3CF6 E;  4CYE A;  3RZW C;  3JVZ X;  2L0F A;  5IAA C;  1OEY J;  2KD0 A;  3PS6 A;  2N7D A;  5AEK B;  2MBB B;  2YVC A;  3DBH I;  3HHM A;  2RR9 A;  3OJ3 A;  2Y5B B;  4NQL B;  4DK5 A;  2FCS A;  1I35 A;  4EOY A;  5J2R A;  3ONS A;  3V61 A;  5LLI A;  1WF9 A;  4NAW A;  4DHZ B;  1NI2 A;  4RM9 A;  2LXC A;  4M8N A;  3ZIM A;  2KLG A;  2LVQ A;  1YJ1 A;  1YX6 B;  4FUL A;  3VUX A;  2BKF A;  1HE8 A;  1OEY A;  3APC A;  3EC8 A;  3X23 A;  5G2N A;  3ZUN A;  4BVU C;  2UYZ B;  3OLM D;  3PHX B;  2KFJ A;  3ZDT A;  3EFU A;  4GXB A;  4F1S A;  4KDL B;  2LRU A;  4FAD A;  4MGI E;  2PJH A;  1MG8 A;  3Q3F A;  4W9L A;  4IW0 A;  2KDI A;  1J19 A;  2KVR A;  2OJR A;  3D32 A;  3O65 B;  4BFR A;  4E71 A;  1GC7 A;  3RUI B;  2IZV B;  3NZU A;  1IP9 A;  3NHE B;  1WY8 A;  3TBL D;  2WDT B;  4W9H A;  2KDE B;  2CKH B;  3N30 A;  4HDQ A;  2EKE C;  1XQQ A;  2KTR A;  2LI5 A;  2KAN A;  4FJY A;  4W9I A;  1Z2M A;  2LGX A;  4W9G A;  4AOF A;  3WAO A;  2XK5 B;  3AXC A;  4BOZ B;  4WJO A;  3TCA A;  1RRB A;  3PRE A;  4II2 B;  2KXJ A;  3HK0 A;  3A9J B;  3L10 B;  4IWO A;  3AU5 A;  2NPT A;  2L05 A;  3DBS A;  1E5W A;  3KUD B;  2PE9 A;  4MJS B;  4ZYN A;  3W1S C;  1I42 A;  2M4N A;  4B6W A;  1ZW7 A;  4AWJ A;  1WJ4 A;  1VD2 A;  3JSV B;  4EUT A;  4IC7 B;  3U30 A;  2LGD A;  3NS8 A;  3KYC D;  4KSK C;  4ZRI A;  1X1M A;  3HM6 X;  4KVG B;  2JZ3 B;  2JWZ A;  1EF1 A;  2LZ6 A;  2R2Q A;  4MGY E;  1KJT A;  2B3A A;  1A5R A;  1E8W A;  2O6V B;  3BIN A;  3RYT A;  4BOS C;  2DZK A;  3PTF C;  4MDK E;  1Y8R C;  2FNJ B;  3UIP B;  4BBN C;  4TUU A;  2KWC A;  1UH6 A;  2JUO A;  2MQJ A;  2MP2 A;  1WI0 A;  1WGD A;  3LJ3 A;  1AAR A;  3T9L A;  4URK A;  3V62 A;  1KOT A;  5AZH A;  4TQ0 A;  2KQS A;  2MBH A;  2ZJD A;  5C1Z A;  4G11 A;  3IFW B;  1WR6 E;  2AWT A;  2N9P C;  2DZJ A;  2FID A;  3ZLZ A;  2JT4 B;  1QZE A;  2MW5 A;  3DBR I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...