2KO3A

Nedd8 solution structure
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
76
structure length
76
Chain Sequence
MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALRGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NEDD8
publication title 60th residues of ubiquitin and Nedd8 are located out of E2-binding surfaces, but are important for K48 ubiquitin-linkage.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 13
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2009-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2ko3A00
3V60A 2MRPA 4IW0A 3VAWA 3DCGA 3WA0A 4AJYB 3A1QB 1NDDA 3TBLD 3ZDMC 2NPTA 3ZLZA 2FIFA 3A4RA 4JQWC 4XZ4A 2REXA 3I3TB 3VTUA 1JRUA 2K6DB 2DZMA 4HLEA 2KDFB 3DPDA 2Z0DB 2DZKA 1WRDB 1UELA 3IFWB 1P3QU 3VQIA 1XD3B 2MLBA 4TUUA 2C7NB 2A5UA 2LGYA 2DX5B 2GBJA 3EC8A 4GDLA 4B9KA 4DHJD 2KN5A 2K8BA 1WMHA 2NR2A 4IM2A 4IC7B 1AARA 1WZ0A 2GBRA 4GDKB 3R7QA 1RRBA 4BBNC 4FJVB 2KFKB 4N9F4 4HCPB 2JT4B 3WAPA 4BKSD 2KC2A 4EOYA 3CSTA 1V6EA 2L7RA 3SHQA 1WR6E 2BF8B 2ZPYA 4G3XB 3ZRFA 4DXAB 5G2NA 2L00B 3APDA 4DK5A 4W9CA 2PPHA 3RZWC 4BOSC 5AZFA 2ZPNA 3VDZA 2IO3B 4M8NA 2G3QB 3M63B 3QX1A 2BYVE 1KM7A 5IAAC 3GZNI 3QARA 4AWJA 2KHWB 2HJ8A 4MEMA 3NHEB 2CHWA 2UYZB 4KSLC 2LXAA 2GBMA 1WJ4A 1MG8A 1GNUA 4BOZB 2IO2B 2KWCA 3N3KB 3RZFA 3X0WA 1OEYJ 5JHBA 3VFKA 1V86A 3HK0A 4RM8A 2C5LC 1RLFA 3KUDB 2JVCA 3PZDA 4TKNA 4IWOA 4WWNA 3ONSA 1VD2A 3V61A 2AEHA 3PRPB 5IA7A 3DOWA 2N4FA 2CKHB 3PT2B 3L54A 1IPGA 1V9JA 5D2MB 3VTWA 3PTFC 3DVNV 3VUXA 1V81A 3L13A 2N1VA 3W1YA 4W9JA 2LZ6A 5EDSA 2L3ZA 3PGEA 1NBFC 4KIKB 2BKRB 3P2BA 4II2B 2JRIB 5DCNA 2O2VA 3UIOB 3OJ3A 2DZIA 2DYBA 2IZVB 2O6VA 2J0JA 4WWPA 1WR1A 4CYEA 1UD7A 3KH0A 3BINA 4KDLB 1R4NI 2I1KA 4GXBA 3M95A 3UF8A 2PE6B 5CHWA 4PS8A 4G50A 5KHQA 3H6NA 3SU8X 2BPSA 4TV3A 1TGZB 3RT3B 3JSVA 2KVRA 4KDIC 1KJTA 3RULA 2B3AA 4ZRIA 2LRUA 1WGGA 4JGHB 3TJPA 4ANWA 2J0MA 2ZZPB 3ZUNA 4BKTA 1WGYA 2KTRA 3R3MA 3V6EB 1WXVA 4MH0E 4K7UA 2XK5B 1H4RA 2L76A 2KDIA 4ZYNA 3A9KB 4IM0A 2ZVNA 3QC8B 2MBOA 2XBBC 1E8YA 2I1JA 4LJOB 3LJ3A 4ZRKA 3V6CB 1EUVB 4F8CB 2KC1A 3S2AA 2EMTA 1LFDA 1WXAA 2C7HA 4HJKA 3Q3JA 2KWUB 3PHWB 3H1UA 4GOCA 2LGDA 4HDOA 1WF9A 1E90A 4XC2A 4F1SA 2D11A 1S3SG 3D32A 5GMVA 4A20A 3A1QA 3ZO5B 3VH4B 4DHZB 2BYEA 3C0RB 1WXSA 1WJNA 2KK8A 4GMVA 3L16A 1WI0A 5J17A 2LJ5A 4K7WA 1Q5WB 4B6WA 4PS7A 4WAAA 2JXXA 4FULA 2FCNA 4ANVA 4MDKE 3CMMB 1KLVA 4URKA 1SIFA 2KNBA 4OVUA 2O6VD 4FLHA 2IBIB 2VRRB 1KOTA 2KDBA 4K1RB 2A4ZA 2KMCA 2J7QB 3R66C 5BO4B 3ZDTA 4HXDA 3ZNHB 1WFYA 1I35A 1GUAB 2FCSA 4MJSB 4I6PA 3NZUA 4E3CA 2HE7A 4NJ6A 3ALBA 2MBHA 2K6QA 4GDKA 4FA6A 4BVUC 3DVGY 5LXHA 2D07B 3QIJA 3PREA 3DBSA 2MP2B 3B1LX 4E71A 2KD0A 2ZCCA 1I42A 1GC6A 2WWZA 4X57B 4ASWC 1V80A 3H7PA 3KYCD 5CHFA 2M0XA 4W9EA 2MW5A 2CU1A 1P1AA 2BWFA 4JLCA 5J2RA 3ZVVA 1UH6A 4W9GA 3OAWA 4LJPB 4TQ0A 4RM9A 3L0WB 4GN1A 2NPTB 2CS4A 1WYWB 2KLGA 2LASA 2LWPA 2W9NA 2KFJA 1WGHA 2JZZA 3JYUA 4IWPA 4WQOB 5C23A 3VHTC 3WIMA 2DAFA 2PE9A 1HE8A 1SE9A 2V3SA 2KQ7A 1V5TA 4KZ0A 4RMAA 3PRZA 2LVPA 2KJ6A 3A9JB 3ML9A 3SDLC 1EO6A 4GDLB 2NBVB 3W1SA 4HK2A 1E8ZA 1NI2A 1WMHB 2KDEB 4OVVA 2JY6A 1QZEA 2ZVOA 1L7YA 2R2QA 3QJZA 3KUCB 2MA9B 3UINB 1OEYA 3V62A 4HPLB 3QAQA 5TR5A 1P9DU 2FCMA 4MSMB 1YJ1A 2HD5B 3O65B 1ISNA 1YX6B 3QWZB 2MBEA 4WWOA 1L2NA 3GOEA 3N30A 4EEWA 1P0RA 4HCNB 5D94A 2DHZA 4GU2A 4M0WB 2KTFA 2KQSA 3AU5A 4MGKE 3U7DA 3KYDD 3HHMA 1LQBA 1WJ6A 4I6LB 1CMXB 4J6IA 1RFAA 3RYTA 5E6PA 2AL3A 5KHOA 4W9IA 3PLUA 4AOFA 4GSWA 2C7MB 2KKCA 3ZTDA 2JF5A 1D3ZA 2FNJB 1LXDA 2FCQA 2NVUI 1Z2MA 1BT0A 4FJYA 4DDID 3PHXB 1WE6A 2R2OA 4HPMB 2MBQA 2JRHA 2KJHB 1OGWA 2KZRA 4IUMB 4NY0A 4WJPA 4ICVA 5DPWA 1UZXB 1X1MA 1GJZA 3X23A 2KX3A 3M3JA 4NAWA 4EFOA 3EECA 3HM6X 2QHOA 2ZNVC 1SGHA 2L8JA 4A3PA 2N9XA 2FIDA 1Z5SB 1WX9A 3ML8A 3ZIMA 4II3B 2DAJA 3T8MA 1Y8RC 5AEKB 3TMPB 2Z59B 1E7VA 4IM3A 3WANA 4ICUA 2C60A 2RD0A 2RR9A 5D7GA 5LXIB 1IP9A 2Y5BB 4I6NB 3B08A 2O2VB 3HM3A 3JW0X 4PYUA 2BYFA 4EUTA 2OOBB 2O6VB 2N9PC 2DYMA 2EKEC 2K1FA 4DDGD 4MSQB 4GB9A 4LDTD 3ZTCA 3VUYA 3ZNGC 3A4SC 3QA8A 3NS8A 3Q3FA 1WJUA 4M8MA 2ZEQA 4W9HA 5E6NA 2AWTA 3U8ZA 2L0FA 2ASQA 3AU4A 3DBLI 4DHJB 1WM3A 3IHPC 3JSVB 3LDZE 3T9LA 3UQAA 1S1QB 4W9DA 1WIAA 2ZCBA 2KLCA 1F9JA 3AULA 4LCDE 4MGIE 1G6JA 2M4NA 2WDTB 3QCAA 4IG7B 2CR5A 4W9KA 2KJRA 1V49A 2KTRB 4JL9A 3U30A 3CSFA 3ZKJC 3ZNZB 2KOXA 2HTHA 2GBKA 2N1WA 5DPSA 1WM2A 5L95C 2N7EA 3OJ4B 2YLMA 2YVCA 4HDQA 5E6OA 5CX3A 2N9EB 2NS5A 2MP2A 2IY1B 5CTRC 2IY0B 1ZGUB 3OLMD 4KV2A 2J0KA 3RCZA 1EF1A 1U4AA 3EFUA 4WJNA 2KFKA 2M8SA 1UGMA 4G0NB 1J8CA 2MSED 2JUOA 4AP4C 4ANXA 4GIVA 4E74A 3H7SA 3K9PB 3ZW3A 2CHZA 2LRWA 1TTNA 5J18A 2G4DB 2WX0A 4WJQA 4F7ZA 2ZJDA 2LXCA 2JPHA 2DENB 2WYQA 1EF5A 3IG3A 4FHJA 1PQSA 1WGRA 1XT9B 2KWVB 2PEAA 1WXMA 3A9JA 3IVFA 4IWQA 4KVGB 4FJZA 2RPQA 2RSUA 5G55A 4A3OA 5D6JB 1WH3A 2LI5A 2G4SA 2L05A 2IO1B 2MBBB 4ANUA 4WJOA 1E8XA 3KUZA 4PYZA 2K39A 5DPTA 2PJHA 3CF6E 3VXWA 4EZLA 3TCAA 3PRMB 1WX7A 2GMIC 1J19A 3M62B 5L83A 3BY4B 1E5WA 1OQYA 3UQBA 2MCNB 1J0GA 1E8WA 2JZ3B 2KMAA 3PSEB 5CHVC 3UIPB 4CO7A 4EKUA 1GG3A 2Z0EB 3QHTA 2LVOA 3VVWB 3DBRI 3H7PB 2CHXA 1GC7A 3KW5B 4BFRA 3VTVA 2RGFA 4KSKC 2KANA 3L17A 2C9WB 2LVQA 4DWFA 3QK0A 4ZDVA 5AZGA 2EMSA 1ZW7A 4NQLB 2MQJA 4GGQA 4FN2A 4EZKA 1Q1OA 2WX1A 3EHVA 2XEWA 2D3GA 4EZJA 1XQQA 4KIKA 1T0YA 2K8CA 4MGYE 1R4MI 2ZNVB 1UBIA 4PS3A 2L0TA 3A33B 1ZKHA 3DBHI 3VUWA 3APFA 3IBEA 1TZ1A 3TIXA 3K9OB 3AI5A 2K25A 5JH5C 4FBJB 3SD5A 3L10B 3RUIB 3MHSD 4MGZE 4MM3A 2IYDB 2DZJA 4DBGA 1C3TA 1TBEA 4HVBA 5HKHA 2KXJA 1YX5B 2NBWB 5DPRA 1C1YB 1H8CA 2NCNA 2N7DA 2M1MA 3R7RA 3MTNB 2IO0B 3NOBA 4W9LA 3RD2A 3JVZX 3ZRCA 3ECIA 4LDTB 1V5OA 5LLIA 4DHZE 3UGBB 2V4LA 3ENEA 1WZ3A 1V2YA 2BGFA 3PLVA 4P7IA 5JHAA 3QQ8B 3DQVA 2KX0A 3MJWA 1M94A 2XK5A 3PS6A 3TL5A 2G45B 5AZHA 1RAXA 5C1ZA 3VH3B 3A9KA 4BKGA 5FR6A 3W1SC 2NBUA 4YL8A 1IYFA 2LD9A 4NPNA 1P98A 1Q0WB 4AUQC 1WX8A 2MWSB 3PPAA 4HWIB 4FADA 3WAMA 3NY5A 4W9FA 2LGXA 2AL6A 3WALA 2BKFA 1WY8A 1YD8U 3APCA 3ZNID 2V1YA 4K81A 2GBNA 2UWQA 3AXCA 2MX2A 4K7SA 1A5RA 4NAWB 2DYOA 2OJRA 4AJWA 2FUHB 2KO3A 3WAOA 2BWES 2AYOB 4JIOU 4CHKA 4BKSA 1LM8B 3H9DA 1YIWA 3DVGX 1WGDA 4KZCA 2K8HA 3PVLA 2D2QA 4XX5A 1OTRB 4MELA 3L08A 4BBNF 2LUEA 3HIZA 4TQ1A 5JZEB 1E7UA 3KVFB 1K8RB 1FXTB 3DVNU 2M17A 2GOWA 4MJSA 2D10A 4NQKE 4FHKA 1WE7A 1VCBA 3PV1A 3N32A 1UBQA 4NNJB 3DDCB 4B95A 3B0AA 2JWZA 4G11A 2FAZA 4NJ7A 4ZRJA 3NZSA 1YQBA
chains in the Genus database with same CATH superfamily
4MACA 1Q10A 4DXFA 3A1QB 1ZDXA 1SEBD 3FAHA 2FIFA 2LEKA 4JQWC 1TYGB 1C4CA 3NG0A 3DPDA 2Z0DB 3VR9B 3NUHB 3VQIA 1XD3B 2MLBA 1XLPA 4DHJD 3U52E 4XDCA 3CSTA 3SHQA 2JXTA 2ZPYA 5BMHA 3MFGA 4ITKA 3AEBB 4K3CA 1TY2A 2QIEB 3FILA 3RZWC 2PTLA 1RYJA 1PDXA 3DBLB 4M8NA 5BYQA 2IDYA 1V97A 2G3QB 3BK1A 4J3OD 3QX1A 1WRIA 2H88B 3AE8B 3NHEB 2VH2A 3SEBA 2GBMA 3N3KB 3X0WA 4Q2JA 3VFKA 3AN1A 3HK0A 5C2TB 1PGBA 3MC0B 3LXFA 2H89B 4YSXB 4IWOA 1DOYA 4M01A 4P1BC 2AEHA 4QAYA 2CKHB 3PT2B 3L54A 3VTWA 2JYEA 4MT5A 3VUXA 2CU3A 1EU4A 3PGEA 1NBFC 3VR8B 2BKRB 2JRIB 5DCNA 3UIOB 3OJ3A 2J0JA 1WR1A 4KDLB 3U2SC 3M95A 5CHWA 5KHQA 3P4RB 1TGZB 3JSVA 5BYRA 4KDIC 2J4XA 4ZRIA 3TJPA 1CJEA 2INDC 2ICIA 1VZ6A 2MHJA 3Q8CA 3V6EB 4MH0E 4WWMA 4P1CC 2KDIA 4IM0A 1J7BA 2ZVNA 3N1ZC 1HXYD 3AMZA 3I5JC 2I1JA 1FD6A 5E6JA 1EUVB 3S2AA 2C7HA 4USAA 4KGRA 2KWUB 3PHWB 4GOCA 1PGXA 2LGDA 1YJJA 1WF9A 3GZNB 1E90A 4XC2A 1D5XC 4F1SA 1S3SG 1K52A 3AEGB 2WXGA 3C0RB 4GMVA 5J17A 2LJ5A 1FEHA 3Q6BA 4WAAA 4MDKE 2LMCA 4K1RB 3R66C 2WXQA 1I35A 1GUAB 4I6PA 2HE7A 4NJ6A 3ALBA 2MBHA 1E9MA 2GLSA 3DVGY 2D07B 3PREA 2MP2B 1YQ3B 4E71A 5HFYA 2PVOD 2WP9B 2LHDA 3KYCD 5CHFA 2EELA 2CU1A 1P1AA 4JLCA 1UH6A 4LJPB 2WDRB 2JZPA 2CS4A 1WYWB 3MP9A 2KLGA 2LASA 3JYUA 2KFJA 3VHTC 2DAFA 2V3SA 1DGJA 1K51A 2LVPA 3EGRA 3B2GA 1EO6A 1AYFA 1QZEA 3EA6A 2ZVOA 2R2QA 1FCCC 2BBCA 3QJZA 2RDBC 1SJED 3UINB 1AW7A 1DYQA 2FCMA 3IT6B 3O65B 1L2NA 1IGCA 1UWXA 3GOEA 2GI9A 1P0RA 2QEJC 4GU2A 1XCQL 3FILB 3IT4B 1UNSA 3AEDB 2N0SB 1BUIC 5E6PA 4AOFA 3VRAB 4GSWA 1OQQA 2JF5A 1CQVA 1D3ZA 2FCQA 3IXSA 1BT0A 2R2OA 1N61A 2JRHA 3BVMA 1JWSD 2ON8A 1QF6A 3NZ3A 2G1EA 1Z5SB 5IO9A 4WIPA 1JWMD 5AEKB 1BMLC 1I7HA 1L5PA 4ICUA 2RD0A 1T5XD 5D7GA 4I6NB 3B08A 1L0YB 4EUTA 4MSQB 2MJ3A 3NS8A 2J42A 4W9HA 1YJIA 3AU4A 1JW9D 3JSVB 3LDZE 3RN9C 3UQAA 1S1QB 4W9DA 4IG7B 4W9KA 1E10A 1V49A 4JL9A 4IDIA 3CSFA 3NVVA 3P4PB 2GBKA 2G9HD 2YVCA 4HDQA 3NVZA 1F2RI 4HKQA 2PKOA 2J0KA 1FFUA 2YEPB 1ZOYB 1SBBB 3CWIA 2M8SA 1TS4A 2MSED 1GB4A 3H7SA 2CHZA 2LRWA 1TKGA 3HVZA 5J18A 3GS2A 1R4NB 4CQNA 4HKZE 1QOBA 4FJZA 5G55A 4H2AA 1WH3A 2LI5A 2MBBB 3KUZA 4PYZA 3VXWA 4EZLA 3TCAA 2GMIC 1C79A 4P6VF 2WU5B 4EKUA 1KF6B 1GG3A 2Z0EB 3VVWB 1GC7A 2RGFA 3AE6B 1WXQA 2C9WB 5EE0A 4NQLB 1XQQA 2L0TA 1ZKHA 3DBHI 4LLGM 4RFBA 3AI5A 4FBJB 1TS5A 3L10B 4MGZE 1P7EA 1H8CA 1YX5B 2NBWB 1C76A 2M1MA 3LB8C 3R7RA 4W9LA 3JVZX 1DOXA 4LDTB 1NI3A 2BGFA 4P7IA 2INPE 3DQVA 4L23A 4LK0M 3TL5A 3PS6A 3AE9B 4WAFA 2L83A 5FR6A 2Y5PA 2LD9A 1D4BA 3PPAA 4A55A 4NJCA 2LGXA 2AL6A 1PFDA 1UGJA 3KQ4A 3ZNID 1JWAD 4K81A 2UWQA 1A5RA 1D6EC 2FUHB 4HROA 1HZ6A 2M19A 2VZKB 4JIOU 4BKSA 4N59A 2D3BA 2INCC 3Q8AA 3AECB 4C7ZA 2JSVX 3PVLA 4MELA 4RNAA 3HIZA 3AE1B 2RDGA 4L2YA 2QJLA 4IOIE 4NQKE 1VCBA 2N9LA 1QT9A 3N32A 4G11A 4ZRJA 3NZSA 4HEA1 3TSSA 3V60A 2W3RA 3DCGA 2KACA 5G5GA 2IGHA 3TBLD 3A4RA 2PIAA 3VTUA 1JRUA 2DZKA 3Q8BA 1HZ5A 3SR6A 3IFWB 1P3QU 1PYWD 4GLSC 4B0MA 1L0XB 2DX5B 2SAKA 4XWWA 1T6BX 1WZ0A 3AH7A 4GDKB 1RRBA 4FJVB 3RNCC 2L7RA 2BF8B 2V0GA 1QLBB 4DXAB 2XNAC 2BVCA 3APDA 4W9CA 5AZFA 4BAXA 4ARCA 2BYVE 3QARA 4AWJA 2KHWB 2WXHA 2HJ8A 1C77A 3Q8FA 4KSLC 2LXAA 3SFDB 3ZJVA 3KWVA 3RZFA 1I4XA 1V86A 2WS3B 1JRPA 1RLFA 2JVCA 3LYYA 3V61A 1N62A 3DOWA 4L1BA 2WXRA 3RI7C 1V9JA 3DVNV 2L3ZA 1MHXA 3AB5A 1JCKB 1UD7A 2I1KA 3UF8A 4OW0A 4OZAA 1EWCA 3N1XC 2KVRA 5H8YE 3RULA 1WGGA 3I63C 3NVWA 2KTRA 2AX5A 4DXGA 3W5VB 1PUTA 2L76A 4ZYNA 3B2FA 2ZW1A 4B0EA 2MBOA 1E8YA 4LNKA 2KC1A 4F8CB 2MJDA 2EMTA 1LFDA 4JWSC 1R4MB 3D32A 2ACZB 4DHZB 1WXSA 1WJNA 3L16A 4K7WA 3U4EG 1N5WA 4FULA 4ANVA 5AUIA 1SIFA 3RNEC 2O6VD 1ZXIA 2KDBA 2WXMA 2WGSA 2J7QB 1VLBA 3ZNHB 1WFYA 2QILA 5TSSA 1AN8A 4BVUC 3QIJA 2X38A 3DBSA 3B1LX 2VZKD 4K3BA 3N9YC 3TEXA 1I42A 1GC6A 1V80A 2W82A 2M0XA 4W9EA 5JXVA 2LGSA 2W9NA 4WQOB 3WIMA 1WGHA 4IWPA 2PE9A 1SE9A 2J53A 3PRZA 2KJ6A 4YXDB 3Q3MC 4RF1A 2NBVB 3W1SA 4OVVA 2KDEB 2RPVA 5HHDG 1B9RA 4OHJA 5IN7A 3V62A 5TR5A 1P9DU 4C4VA 1YJ1A 2HD5B 3Q69A 1ISNA 1YX6B 3QWZB 2MBEA 4ZYSA 4AQ7A 2PMVA 4EEWA 2QSDA 3BK2A 5D94A 2DHZA 3DHHC 2KWDA 3DHIC 2KTFA 2B76B 3U7DA 3OG5A 1LQBA 1SE4A 1CMXB 2QMTA 1RFAA 3RYTA 4YTMB 1QOGA 3DWMA 2KKCA 2FNJB 4FJYA 4DDID 3TEWA 3PHXB 1M4VA 1WE6A 4MM3B 4NY0A 4ICVA 1UZXB 1X1MA 3X23A 4NAWA 1WYGA 3EECA 3HM6X 4A3PA 2N9XA 2FIDA 4PK1A 1WX9A 1QQRA 3ML8A 1LO5D 3T8MA 1Y8RC 1IP9A 1F0ZA 2OOBB 3E56A 1STEA 3VUYA 1WSPA 1MG4A 1TZOA 2ZEQA 1FNWA 3DBLI 1TS2A 1WM3A 2ZCBA 2YEPF 1F9JA 3AULA 1G6JA 2M4NA 1FMAD 2JYTA 2KTRB 3U30A 3ZNZB 2HTHA 5DPSA 1WM2A 2N7EA 1UWMA 3I9V1 2IY1B 2IY0B 1ZGUB 3TUOA 2WXKA 4OZCA 2KFKA 2J52A 4G0NB 2JUOA 3K9PB 1V1OA 1RFKA 2G4DB 4WJQA 2ZJDA 2JPHA 1EF5A 1KLGD 1NYRA 3PZ7A 2KVZA 1WGRA 1XT9B 2KWVB 2M56B 4OZBA 1WXMA 1E7PB 3A9JA 4IWQA 2RPQA 2RSUA 4A3OA 5D6JB 5DPTA 1SIJA 5EE3A 3M62B 2AQ3B 2MCNB 3PSEB 3UIPB 4CO7A 1YN4A 1QILA 2LVOA 1V8CA 3DBRI 3FC4A 4HJGE 4BFRA 3VTVA 2KANA 2LVQA 4DWFA 1CK1A 4GGQA 4FN2A 2PLPA 2XEWA 2D3GA 1T0YA 2K8CA 4MGYE 4PS3A 3MHZA 2W54A 3VRBB 1HTOA 1J7AA 3E9SA 1QOFA 3MHSD 2DZJA 1C3TA 1K50A 2IPKD 4HVBA 5HKHA 5DPRA 2K5PA 2NCNA 2N7DA 1FFVA 2NMQA 1JALA 2KQ4X 4C4VB 4EZJA 3ECIA 1V5OA 3W5UB 3ENEA 1V2YA 1AWDA 1M94A 2G45B 5AZHA 3VH3B 4BKGA 4JWUC 4TMAB 2V3NA 4AUQC 1Q0WB 1WX8A 3AE2B 4HWIB 3WAMA 1T3QA 2BS2B 3RMKC 3NY5A 4W9FA 3WALA 4A6QA 1WY8A 1VZ7A 2GBNA 3AXCA 2MX2A 4ZRPA 4NAWB 2CJNA 1FIQA 2BWES 4EE2A 4YWGG 2MEKA 3H9DA 3T3NA 1XLQA 5JZEB 2WU2B 1K8RB 4MJSA 2GOWA 3U7ZA 1UUPA 1WE7A 3PV1A 1UBQA 2JWZA 2FAZA 4YSYB 1YQBA 2MRPA 4IW0A 3VAWA 2KYWA 3WA0A 3ZLZA 4XZ4A 3I3TB 1MPEA 2K6DB 4HLEA 1ENFA 4TUUA 4B9KA 3EC8A 2KN5A 1WMHA 2XN9C 4IC7B 2GBRA 3R7QA 1P7FA 2KFKB 4N9F4 2JT4B 1IBXA 3WAPA 2KC2A 1DOIA 1V6EA 1MJDA 4G3XB 4A9AA 3ZRFA 2L00B 2PPHA 4BOSC 2ZPNA 1K53A 3VDZA 4HRSA 2IO3B 5I4DA 3HUIA 1HQRD 3N20C 2CHWA 2UYZB 1WJ4A 1FM0D 1D5ZC 2IO2B 2KWCA 4BZAA 1MHHE 4RM8A 2C5LC 4WWNA 3ONSA 2WHIA 1VD2A 1C4AA 4C80A 5IA7A 1C4PA 5D2MB 4FXCA 1SSNA 2N1VA 4W9JA 1Y56A 4II2B 1TKYA 2O2VA 2DYBA 1SE3A 4CYEA 2K0PA 4KKIA 1R4NI 4GXBA 3GB1A 2PE6B 4XDDA 1GAQB 4PS8A 4G50A 3H6NA 3TEYA 4N58A 4RCOA 2IJ0A 2BPSA 4TV3A 1F52A 4JX1C 4RGNA 1JWUD 2B3AA 4ANWA 4N6EB 2J0MA 3ZUNA 1WGYA 1FXAA 3R3MA 1YOVB 4K7UA 1TT5B 3O13A 1YN5A 1ZPSA 3LJ3A 5FK9C 2PVGC 4HJKA 4HDOA 2BB5A 4UDUC 4ZRQA 3A1QA 3ZO5B 3VH4B 2BYEA 1XCTL 2KK8A 1KH0A 2RMMA 1I4PA 2WDQB 4PS7A 2FCNA 3CMMB 1KLVA 2K3UA 4OVUA 2VRRB 1KOTA 2A4ZA 2Y5CA 3ZDTA 2BQQA 2WXJA 2FCSA 4MJSB 3NZUA 4ACFA 4FA6A 2K6QA 3P1MA 3R8BA 1FRDA 4S17A 2ZCCA 2CJOA 2WWZA 4X57B 3EFCA 3H7PA 1TJEA 4OVZA 2MW5A 2BWFA 5J2RA 1B1ZA 4RM9A 2JX5A 1FXIA 4RGMA 2LFIA 5C23A 1XLNA 5HG2A 2BS4B 1RWSA 1HE8A 2DBYA 4REZA 1V5TA 4KZ0A 1E0ZA 1E6EB 3ML9A 5LNK1 3SDLC 1WGKA 3AE4B 4HK2A 4KKJA 1E8ZA 1NI2A 1WMHB 1ZP0B 3BWUD 1EU3A 1L7YA 4IKGA 4XWTA 3KUCB 2MA9B 2D3CA 4HCNB 5IOIA 2FUG1 4MGKE 3KYDD 1WJ6A 4I6LB 2AL3A 5KHOA 4W9IA 3PLUA 3ZTDA 2KAJA 3C19A 1LXDA 2NVUI 1Z2MA 3PO0A 4HPMB 1JWBD 1OGWA 2KZRA 4IUMB 1GJZA 2KX3A 2ZNVC 2FE8A 1VZ8A 5IKCM 2NTTA 3ZIMA 1I4RA 3NJTA 3MC9A 2DAJA 1LGRA 3I57A 4YT0B 3TMPB 4IM3A 3WANA 2C60A 1YQ4B 5LXIB 4WURA 2Y5BB 2O2VB 3W9CB 3JW0X 2BYFA 1N60A 3RNFC 1N63A 2N9PC 2DYMA 2EKEC 4GB9A 4LDTD 3ZNGC 4R3DA 3A4SC 3QA8A 3Q3FA 1WJUA 3NVYA 4M8MA 2AWTA 2RDHA 4KGSA 4RGOS 2L0FA 3U8ZA 5D3DA 3IHPC 3T9LA 1WIAA 2KLCA 4RH6A 3BVGA 4LCDE 3QCAA 3ZXVA 2N9KA 2KJRA 2MJEA 3ZKJC 2KOXA 2N1WA 2N7JA 2JU6X 3OJ4B 3Q3NC 2YLMA 4PT5A 4LNNA 4LNOA 5E6OA 2MP2A 5CTRC 3RCZA 1U4AA 4WJNA 4US8A 1XXGA 2I38A 1N6ZA 2V4IB 1QKZA 1L4ZB 1J8CA 4GIVA 3Q14C 4E74A 3ZW3A 1GB1A 2IGDA 1L0VB 4F7ZA 2KT7A 1ZXHA 2LXCA 2WYQA 4NAMA 4FHJA 3P4QB 1A70A 2HTME 2PEAA 3IVFA 3AEAB 1MI0A 2IO1B 4US9A 4WJOA 3CF6E 3PRMB 1WX7A 1ET6A 3BY4B 1E5WA 3AEFB 2IGGA 1J0GA 2JZ3B 3KLSX 3H7PB 4S0RA 3L17A 2BS3B 2EMSA 2MQJA 2E3TA 1Q1OA 2WX1A 3EHVA 4EZKA 2AQ2B 3BYTB 4KIKA 1R4MI 2ZNVB 1UBIA 2BYTA 3APFA 2DLBA 1NYQA 5JH5C 4JE3B 2K22A 3SD5A 1R7SA 3RUIB 4KGTA 2IYDB 3AV8A 1L6VA 2QCZA 3RD2A 3NOBA 2AQ1B 3ZRCA 5LLIA 4AS1A 3PLVA 3QQ8B 2XK5A 1IGDA 4XE0A 1C9FA 3A9KA 3MJ5A 2JWUA 3W1SC 4FADA 4LNIA 2DWQA 2ZW0A 1OFFA 4NZLB 1F2RC 1WWTA 3RPFC 2WQYB 4DQOC 2V1YA 4K7SA 1XLOA 3EUB2 2Q5WD 2OJRA 4AJWA 2KO3A 2M0AA 2LUMA 1FPYA 4CHKA 4O1NA 1LM8B 1CZPA 1YIWA 1WGDA 3DBRB 1FNVA 1JMLA 2D2QA 2EKIA 3L08A 4BBNF 4TQ1A 3HVDA 2OJWA 3ZQ4A 1FXTB 5EE9A 2M17A 4FHKA 1VJKA 3NRZA 4HPPA 4B95A 2FBWB 3B0AA 1KFYB 4NJ7A 1NEKB 4ZHPA 3BVZA 3P63A 3Q3OC 4AJYB 1NDDA 3ZDMC 2NPTA 1L6UA 2V9HA 1F1HA 2REXA 1XO3A 2DZMA 2KDFB 1WRDB 1UELA 1FRRA 4C7YA 5GXGB 2MH7A 4D2KA 4RGTA 2C7NB 2A5UA 2LGYA 2GBJA 3GE8C 4GDLA 2K8BA 1TKEA 2NR2A 4M00A 3RNGC 3AE3B 4IM2A 1AARA 4TSSA 3URYA 4JPSA 4BBNC 3BZDB 4HCPB 4BKSD 4EOYA 5IP4D 1WR6E 1FNUA 2VH1A 5G2NA 5FKAC 2LJIA 4M0WA 4DK5A 5T8IA 3P4SB 5H92C 1T0QC 1L4DB 3M63B 1KM7A 5IAAC 3GZNI 4YTNB 3R2IA 4MEMA 1MG8A 1GNUA 2NTSA 4BOZB 3C8YA 5BMGA 1I4GA 1OEYJ 3ABVB 5JHBA 1XF5L 2GB1A 3J9CA 1GOZA 3KUDB 3DWGC 3PZDA 4TKNA 2R61A 3PRPB 2N4FA 1FO4A 2D5GA 1IPGA 3PTFC 1V81A 3L13A 4MH8A 3W1YA 5EDSA 2LZ6A 1FCLA 4KIKB 3OWEB 3P2BA 1MVKA 1ZDVA 2QC8A 2DZIA 2IZVB 4WWPA 2HJ1A 2O6VA 3KH0A 3BINA 2L1AA 3MC8A 3SU8X 1KLUD 2I2YA 3RT3B 1KJTA 2LRUA 4JGHB 1F77A 1BXTA 2L32A 2ZZPB 4BKTA 1EM7A 1WXVA 1KTKA 1ET9A 1ZE3D 2XK5B 1H4RA 1ESFA 1HA5A 3RNBC 3A9KB 3QC8B 3RFZB 1TIFA 4KX6B 2XBBC 3B9JA 4LJOB 3V6CB 4ZRKA 1IUEA 1WXAA 4M02A 3TEZA 3Q3JA 4XYCA 3H1UA 2LGIA 2W3SA 2D3AA 3DBHB 2D11A 3ZJUA 5FR3A 5GMVA 4A20A 1NENB 1ZUD2 4LNFA 1WI0A 1Q5WB 2K9XA 4B6WA 2JXXA 4URKA 2KNBA 4FLHA 2IBIB 4ZHOA 2GRIA 2KMCA 5BO4B 4HXDA 5G5HA 3AEEB 1XEEA 4E3CA 4ARIA 4GDKA 4RF0A 5LXHA 2KD0A 4ASWC 2X8XX 2QDFA 3AM9A 3ZVVA 4W9GA 1SXTA 3OAWA 2LHEA 4TQ0A 3L0WB 4GN1A 2NPTB 3BIID 1VDVA 2LWPA 2JZZA 1J7CA 2KQ7A 4RMAA 1EWYC 3A9JB 3KWLA 4GDLB 1HTQA 1C78A 2E6XA 3IAS1 2JY6A 1OEYA 3GE3C 2SEBD 4HPLB 3QAQA 4C00A 4MSMB 2TSSA 4WWOA 3AE5B 3H8HA 3N30A 2WXFA 1N5XA 5BYSA 3DHGC 4M0WB 2WLBA 2JQRB 2KQSA 3AU5A 3HHMA 4WH4A 4A8XC 3V05A 2WXPA 4J6IA 3W2DA 3P42A 2C7MB 2KMMA 2OEDA 1PGAA 3GP7A 2Z8LA 1UF0A 2MBQA 2KJHB 4WJPA 3CIRB 5DPWA 2BTEA 3M3JA 4EFOA 2QHOA 3V3XA 1SGHA 2L8JA 3NS1A 4A90A 4II3B 1NVID 3WCQA 2Z59B 1E7VA 2L52A 1V1PA 1TY0A 2RR9A 1JROA 3HM3A 3T3OA 4PYUA 2O6VB 3R2TA 2K1FA 2V3PA 4DDGD 3ZTCA 3BYYB 5E6NA 3ZXRA 2ASQA 4DHJB 2KDMA 2DNFA 2KN4A 4P16A 1ACCA 4MGIE 1VR9A 2WDTB 5MPOA 2CR5A 2WXIA 4WQMA 5L95C 1YMHE 2W55A 1T0RC 2WXOA 5CX3A 2N9EB 2NS5A 5D3IB 3OLMD 4KV2A 1EF1A 2OHFA 3EFUA 5AUKA 5BMIA 1UGMA 4AP4C 4ANXA 1TTNA 1D5MC 2WX0A 3SFEB 3ZJTA 2DENB 3IG3A 1KRHA 1PQSA 4KVGB 3L4PA 1JQ4A 2Y3AA 2G4SA 1QOAA 2L05A 1YNTE 4ANUA 1E8XA 1ROEA 2K39A 2PJHA 1J19A 5L83A 1OQYA 3UQBA 3HRDD 1E8WA 5CHVC 2KMAA 2WXNA 3QHTA 1SJHD 3ZYYX 1HEZE 2CHXA 3KW5B 1IBXB 4KSKC 3QK0A 4ZDVA 5AZGA 1ZW7A 3RNAC 2UU7A 3IAM1 1GPXA 1VRAB 2WNMA 3A33B 3VUWA 3TIXA 3IBEA 1TZ1A 3K9OB 2INNE 2K25A 4XGAB 4C56C 4MM3A 4DBGA 1TBEA 2KXJA 3AE7B 3N1YC 1C1YB 1I4HA 3MTNB 2IO0B 4DHZE 3UGBB 2V4LA 2WXLA 1WZ3A 3UI3A 5JHAA 2KX0A 3MJWA 5C1ZA 1RAXA 2BT6A 3ZGZA 2NBUA 4YL8A 1IYFA 4NPNA 1P98A 1SE2A 2MWSB 3FKYA 3ETRA 1YN3A 1MFWA 5EE1A 2BKFA 3APCA 1YD8U 2DYOA 2BW2A 2BB6A 3Q8EA 3WAOA 2AYOB 4YTPB 1T0SC 4LTUA 1TS3A 2ONQA 1OQRA 1SB3C 2HDEA 3DVGX 4KZCA 5HI1A 2K8HA 4XX5A 1OTRB 3PZ8A 1SF0A 2LUEA 4YSZB 2PW9A 1E7UA 2WDVB 3KVFB 1V1PB 3DVNU 3Q2AC 2D10A 1I4QA 5C3JB 4NNJB 3DDCB 1RM6C 4ZOHC
chains in the Genus database with same CATH topology
3V60A 2MRPA 4IW0A 3VAWA 3DCGA 3WA0A 4AJYB 3A1QB 1NDDA 3TBLD 3ZDMC 2NPTA 3ZLZA 2FIFA 3A4RA 4JQWC 4XZ4A 2REXA 3I3TB 3VTUA 1JRUA 2K6DB 2DZMA 4HLEA 2KDFB 3DPDA 2Z0DB 2DZKA 1WRDB 1UELA 3IFWB 1P3QU 3VQIA 1XD3B 2MLBA 4TUUA 2C7NB 2A5UA 2LGYA 2DX5B 2GBJA 3EC8A 4GDLA 4B9KA 4DHJD 2KN5A 2K8BA 1WMHA 2NR2A 4IM2A 4IC7B 1AARA 1WZ0A 2GBRA 4GDKB 3R7QA 1RRBA 4BBNC 4FJVB 2KFKB 4N9F4 4HCPB 2JT4B 3WAPA 4BKSD 2KC2A 4EOYA 3CSTA 1V6EA 2L7RA 3SHQA 1WR6E 2BF8B 2ZPYA 4G3XB 3ZRFA 4DXAB 5G2NA 2L00B 3APDA 4DK5A 4W9CA 2PPHA 3RZWC 4BOSC 5AZFA 2ZPNA 3VDZA 2IO3B 4M8NA 2G3QB 3M63B 3QX1A 2BYVE 1KM7A 5IAAC 3GZNI 3QARA 4AWJA 2KHWB 2HJ8A 4MEMA 3NHEB 2CHWA 2UYZB 4KSLC 2LXAA 2GBMA 1WJ4A 1MG8A 1GNUA 4BOZB 2IO2B 2KWCA 3N3KB 3RZFA 3X0WA 1OEYJ 5JHBA 3VFKA 1V86A 3HK0A 4RM8A 2C5LC 1RLFA 3KUDB 2JVCA 3PZDA 4TKNA 4IWOA 4WWNA 3ONSA 1VD2A 3V61A 2AEHA 3PRPB 5IA7A 3DOWA 2N4FA 2CKHB 3PT2B 3L54A 1IPGA 1V9JA 5D2MB 3VTWA 3PTFC 3DVNV 3VUXA 1V81A 3L13A 2N1VA 3W1YA 4W9JA 2LZ6A 5EDSA 2L3ZA 3PGEA 1NBFC 4KIKB 2BKRB 3P2BA 4II2B 2JRIB 5DCNA 2O2VA 3UIOB 3OJ3A 2DZIA 2DYBA 2IZVB 2O6VA 2J0JA 4WWPA 1WR1A 4CYEA 1UD7A 3KH0A 3BINA 4KDLB 1R4NI 2I1KA 4GXBA 3M95A 3UF8A 2PE6B 5CHWA 4PS8A 4G50A 5KHQA 3H6NA 3SU8X 2BPSA 4TV3A 1TGZB 3RT3B 3JSVA 2KVRA 4KDIC 1KJTA 3RULA 2B3AA 4ZRIA 2LRUA 1WGGA 4JGHB 3TJPA 4ANWA 2J0MA 2ZZPB 3ZUNA 4BKTA 1WGYA 2KTRA 3R3MA 3V6EB 1WXVA 4MH0E 4K7UA 2XK5B 1H4RA 2L76A 2KDIA 4ZYNA 3A9KB 4IM0A 2ZVNA 3QC8B 2MBOA 2XBBC 1E8YA 2I1JA 4LJOB 3LJ3A 4ZRKA 3V6CB 1EUVB 4F8CB 2KC1A 3S2AA 2EMTA 1LFDA 1WXAA 2C7HA 4HJKA 3Q3JA 2KWUB 3PHWB 3H1UA 4GOCA 2LGDA 4HDOA 1WF9A 1E90A 4XC2A 4F1SA 2D11A 1S3SG 3D32A 5GMVA 4A20A 3A1QA 3ZO5B 3VH4B 4DHZB 2BYEA 3C0RB 1WXSA 1WJNA 2KK8A 4GMVA 3L16A 1WI0A 5J17A 2LJ5A 4K7WA 1Q5WB 4B6WA 4PS7A 4WAAA 2JXXA 4FULA 2FCNA 4ANVA 4MDKE 3CMMB 1KLVA 4URKA 1SIFA 2KNBA 4OVUA 2O6VD 4FLHA 2IBIB 2VRRB 1KOTA 2KDBA 4K1RB 2A4ZA 2KMCA 2J7QB 3R66C 5BO4B 3ZDTA 4HXDA 3ZNHB 1WFYA 1I35A 1GUAB 2FCSA 4MJSB 4I6PA 3NZUA 4E3CA 2HE7A 4NJ6A 3ALBA 2MBHA 2K6QA 4GDKA 4FA6A 4BVUC 3DVGY 5LXHA 2D07B 3QIJA 3PREA 3DBSA 2MP2B 3B1LX 4E71A 2KD0A 2ZCCA 1I42A 1GC6A 2WWZA 4X57B 4ASWC 1V80A 3H7PA 3KYCD 5CHFA 2M0XA 4W9EA 2MW5A 2CU1A 1P1AA 2BWFA 4JLCA 5J2RA 3ZVVA 1UH6A 4W9GA 3OAWA 4LJPB 4TQ0A 4RM9A 3L0WB 4GN1A 2NPTB 2CS4A 1WYWB 2KLGA 2LASA 2LWPA 2W9NA 2KFJA 1WGHA 2JZZA 3JYUA 4IWPA 4WQOB 5C23A 3VHTC 3WIMA 2DAFA 2PE9A 1HE8A 1SE9A 2V3SA 2KQ7A 1V5TA 4KZ0A 4RMAA 3PRZA 2LVPA 2KJ6A 3A9JB 3ML9A 3SDLC 1EO6A 4GDLB 2NBVB 3W1SA 4HK2A 1E8ZA 1NI2A 1WMHB 2KDEB 4OVVA 2JY6A 1QZEA 2ZVOA 1L7YA 2R2QA 3QJZA 3KUCB 2MA9B 3UINB 1OEYA 3V62A 4HPLB 3QAQA 5TR5A 1P9DU 2FCMA 4MSMB 1YJ1A 2HD5B 3O65B 1ISNA 1YX6B 3QWZB 2MBEA 4WWOA 1L2NA 3GOEA 3N30A 4EEWA 1P0RA 4HCNB 5D94A 2DHZA 4GU2A 4M0WB 2KTFA 2KQSA 3AU5A 4MGKE 3U7DA 3KYDD 3HHMA 1LQBA 1WJ6A 4I6LB 1CMXB 4J6IA 1RFAA 3RYTA 5E6PA 2AL3A 5KHOA 4W9IA 3PLUA 4AOFA 4GSWA 2C7MB 2KKCA 3ZTDA 2JF5A 1D3ZA 2FNJB 1LXDA 2FCQA 2NVUI 1Z2MA 1BT0A 4FJYA 4DDID 3PHXB 1WE6A 2R2OA 4HPMB 2MBQA 2JRHA 2KJHB 1OGWA 2KZRA 4IUMB 4NY0A 4WJPA 4ICVA 5DPWA 1UZXB 1X1MA 1GJZA 3X23A 2KX3A 3M3JA 4NAWA 4EFOA 3EECA 3HM6X 2QHOA 2ZNVC 1SGHA 2L8JA 4A3PA 2N9XA 2FIDA 1Z5SB 1WX9A 3ML8A 3ZIMA 4II3B 2DAJA 3T8MA 1Y8RC 5AEKB 3TMPB 2Z59B 1E7VA 4IM3A 3WANA 4ICUA 2C60A 2RD0A 2RR9A 5D7GA 5LXIB 1IP9A 2Y5BB 4I6NB 3B08A 2O2VB 3HM3A 3JW0X 4PYUA 2BYFA 4EUTA 2OOBB 2O6VB 2N9PC 2DYMA 2EKEC 2K1FA 4DDGD 4MSQB 4GB9A 4LDTD 3ZTCA 3VUYA 3ZNGC 3A4SC 3QA8A 3NS8A 3Q3FA 1WJUA 4M8MA 2ZEQA 4W9HA 5E6NA 2AWTA 3U8ZA 2L0FA 2ASQA 3AU4A 3DBLI 4DHJB 1WM3A 3IHPC 3JSVB 3LDZE 3T9LA 3UQAA 1S1QB 4W9DA 1WIAA 2ZCBA 2KLCA 1F9JA 3AULA 4LCDE 4MGIE 1G6JA 2M4NA 2WDTB 3QCAA 4IG7B 2CR5A 4W9KA 2KJRA 1V49A 2KTRB 4JL9A 3U30A 3CSFA 3ZKJC 3ZNZB 2KOXA 2HTHA 2GBKA 2N1WA 5DPSA 1WM2A 5L95C 2N7EA 3OJ4B 2YLMA 2YVCA 4HDQA 5E6OA 5CX3A 2N9EB 2NS5A 2MP2A 2IY1B 5CTRC 2IY0B 1ZGUB 3OLMD 4KV2A 2J0KA 3RCZA 1EF1A 1U4AA 3EFUA 4WJNA 2KFKA 2M8SA 1UGMA 4G0NB 1J8CA 2MSED 2JUOA 4AP4C 4ANXA 4GIVA 4E74A 3H7SA 3K9PB 3ZW3A 2CHZA 2LRWA 1TTNA 5J18A 2G4DB 2WX0A 4WJQA 4F7ZA 2ZJDA 2LXCA 2JPHA 2DENB 2WYQA 1EF5A 3IG3A 4FHJA 1PQSA 1WGRA 1XT9B 2KWVB 2PEAA 1WXMA 3A9JA 3IVFA 4IWQA 4KVGB 4FJZA 2RPQA 2RSUA 5G55A 4A3OA 5D6JB 1WH3A 2LI5A 2G4SA 2L05A 2IO1B 2MBBB 4ANUA 4WJOA 1E8XA 3KUZA 4PYZA 2K39A 5DPTA 2PJHA 3CF6E 3VXWA 4EZLA 3TCAA 3PRMB 1WX7A 2GMIC 1J19A 3M62B 5L83A 3BY4B 1E5WA 1OQYA 3UQBA 2MCNB 1J0GA 1E8WA 2JZ3B 2KMAA 3PSEB 5CHVC 3UIPB 4CO7A 4EKUA 1GG3A 2Z0EB 3QHTA 2LVOA 3VVWB 3DBRI 3H7PB 2CHXA 1GC7A 3KW5B 4BFRA 3VTVA 2RGFA 4KSKC 2KANA 3L17A 2C9WB 2LVQA 4DWFA 3QK0A 4ZDVA 5AZGA 2EMSA 1ZW7A 4NQLB 2MQJA 4GGQA 4FN2A 4EZKA 1Q1OA 2WX1A 3EHVA 2XEWA 2D3GA 4EZJA 1XQQA 4KIKA 1T0YA 2K8CA 4MGYE 1R4MI 2ZNVB 1UBIA 4PS3A 2L0TA 3A33B 1ZKHA 3DBHI 3VUWA 3APFA 3IBEA 1TZ1A 3TIXA 3K9OB 3AI5A 2K25A 5JH5C 4FBJB 3SD5A 3L10B 3RUIB 3MHSD 4MGZE 4MM3A 2IYDB 2DZJA 4DBGA 1C3TA 1TBEA 4HVBA 5HKHA 2KXJA 1YX5B 2NBWB 5DPRA 1C1YB 1H8CA 2NCNA 2N7DA 2M1MA 3R7RA 3MTNB 2IO0B 3NOBA 4W9LA 3RD2A 3JVZX 3ZRCA 3ECIA 4LDTB 1V5OA 5LLIA 4DHZE 3UGBB 2V4LA 3ENEA 1WZ3A 1V2YA 2BGFA 3PLVA 4P7IA 5JHAA 3QQ8B 3DQVA 2KX0A 3MJWA 1M94A 2XK5A 3PS6A 3TL5A 2G45B 5AZHA 1RAXA 5C1ZA 3VH3B 3A9KA 4BKGA 5FR6A 3W1SC 2NBUA 4YL8A 1IYFA 2LD9A 4NPNA 1P98A 1Q0WB 4AUQC 1WX8A 2MWSB 3PPAA 4HWIB 4FADA 3WAMA 3NY5A 4W9FA 2LGXA 2AL6A 3WALA 2BKFA 1WY8A 1YD8U 3APCA 3ZNID 2V1YA 4K81A 2GBNA 2UWQA 3AXCA 2MX2A 4K7SA 1A5RA 4NAWB 2DYOA 2OJRA 4AJWA 2FUHB 2KO3A 3WAOA 2BWES 2AYOB 4JIOU 4CHKA 4BKSA 1LM8B 3H9DA 1YIWA 3DVGX 1WGDA 4KZCA 2K8HA 3PVLA 2D2QA 4XX5A 1OTRB 4MELA 3L08A 4BBNF 2LUEA 3HIZA 4TQ1A 5JZEB 1E7UA 3KVFB 1K8RB 1FXTB 3DVNU 2M17A 2GOWA 4MJSA 2D10A 4NQKE 4FHKA 1WE7A 1VCBA 3PV1A 3N32A 1UBQA 4NNJB 3DDCB 4B95A 3B0AA 2JWZA 4G11A 2FAZA 4NJ7A 4ZRJA 3NZSA 1YQBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V60 A;  2MRP A;  4IW0 A;  3VAW A;  3DCG A;  3WA0 A;  4AJY B;  3A1Q B;  1NDD A;  3TBL D;  3ZDM C;  2NPT A;  3ZLZ A;  2FIF A;  3A4R A;  4JQW C;  4XZ4 A;  2REX A;  3I3T B;  3VTU A;  1JRU A;  2K6D B;  2DZM A;  4HLE A;  2KDF B;  3DPD A;  2Z0D B;  2DZK A;  1WRD B;  1UEL A;  3IFW B;  1P3Q U;  3VQI A;  1XD3 B;  2MLB A;  4TUU A;  2C7N B;  2A5U A;  2LGY A;  2DX5 B;  2GBJ A;  3EC8 A;  4GDL A;  4B9K A;  4DHJ D;  2KN5 A;  2K8B A;  1WMH A;  2NR2 A;  4IM2 A;  4IC7 B;  1AAR A;  1WZ0 A;  2GBR A;  4GDK B;  3R7Q A;  1RRB A;  4BBN C;  4FJV B;  2KFK B;  4N9F 4;  4HCP B;  2JT4 B;  3WAP A;  4BKS D;  2KC2 A;  4EOY A;  3CST A;  1V6E A;  2L7R A;  3SHQ A;  1WR6 E;  2BF8 B;  2ZPY A;  4G3X B;  3ZRF A;  4DXA B;  5G2N A;  2L00 B;  3APD A;  4DK5 A;  4W9C A;  2PPH A;  3RZW C;  4BOS C;  5AZF A;  2ZPN A;  3VDZ A;  2IO3 B;  4M8N A;  2G3Q B;  3M63 B;  3QX1 A;  2BYV E;  1KM7 A;  5IAA C;  3GZN I;  3QAR A;  4AWJ A;  2KHW B;  2HJ8 A;  4MEM A;  3NHE B;  2CHW A;  2UYZ B;  4KSL C;  2LXA A;  2GBM A;  1WJ4 A;  1MG8 A;  1GNU A;  4BOZ B;  2IO2 B;  2KWC A;  3N3K B;  3RZF A;  3X0W A;  1OEY J;  5JHB A;  3VFK A;  1V86 A;  3HK0 A;  4RM8 A;  2C5L C;  1RLF A;  3KUD B;  2JVC A;  3PZD A;  4TKN A;  4IWO A;  4WWN A;  3ONS A;  1VD2 A;  3V61 A;  2AEH A;  3PRP B;  5IA7 A;  3DOW A;  2N4F A;  2CKH B;  3PT2 B;  3L54 A;  1IPG A;  1V9J A;  5D2M B;  3VTW A;  3PTF C;  3DVN V;  3VUX A;  1V81 A;  3L13 A;  2N1V A;  3W1Y A;  4W9J A;  2LZ6 A;  5EDS A;  2L3Z A;  3PGE A;  1NBF C;  4KIK B;  2BKR B;  3P2B A;  4II2 B;  2JRI B;  5DCN A;  2O2V A;  3UIO B;  3OJ3 A;  2DZI A;  2DYB A;  2IZV B;  2O6V A;  2J0J A;  4WWP A;  1WR1 A;  4CYE A;  1UD7 A;  3KH0 A;  3BIN A;  4KDL B;  1R4N I;  2I1K A;  4GXB A;  3M95 A;  3UF8 A;  2PE6 B;  5CHW A;  4PS8 A;  4G50 A;  5KHQ A;  3H6N A;  3SU8 X;  2BPS A;  4TV3 A;  1TGZ B;  3RT3 B;  3JSV A;  2KVR A;  4KDI C;  1KJT A;  3RUL A;  2B3A A;  4ZRI A;  2LRU A;  1WGG A;  4JGH B;  3TJP A;  4ANW A;  2J0M A;  2ZZP B;  3ZUN A;  4BKT A;  1WGY A;  2KTR A;  3R3M A;  3V6E B;  1WXV A;  4MH0 E;  4K7U A;  2XK5 B;  1H4R A;  2L76 A;  2KDI A;  4ZYN A;  3A9K B;  4IM0 A;  2ZVN A;  3QC8 B;  2MBO A;  2XBB C;  1E8Y A;  2I1J A;  4LJO B;  3LJ3 A;  4ZRK A;  3V6C B;  1EUV B;  4F8C B;  2KC1 A;  3S2A A;  2EMT A;  1LFD A;  1WXA A;  2C7H A;  4HJK A;  3Q3J A;  2KWU B;  3PHW B;  3H1U A;  4GOC A;  2LGD A;  4HDO A;  1WF9 A;  1E90 A;  4XC2 A;  4F1S A;  2D11 A;  1S3S G;  3D32 A;  5GMV A;  4A20 A;  3A1Q A;  3ZO5 B;  3VH4 B;  4DHZ B;  2BYE A;  3C0R B;  1WXS A;  1WJN A;  2KK8 A;  4GMV A;  3L16 A;  1WI0 A;  5J17 A;  2LJ5 A;  4K7W A;  1Q5W B;  4B6W A;  4PS7 A;  4WAA A;  2JXX A;  4FUL A;  2FCN A;  4ANV A;  4MDK E;  3CMM B;  1KLV A;  4URK A;  1SIF A;  2KNB A;  4OVU A;  2O6V D;  4FLH A;  2IBI B;  2VRR B;  1KOT A;  2KDB A;  4K1R B;  2A4Z A;  2KMC A;  2J7Q B;  3R66 C;  5BO4 B;  3ZDT A;  4HXD A;  3ZNH B;  1WFY A;  1I35 A;  1GUA B;  2FCS A;  4MJS B;  4I6P A;  3NZU A;  4E3C A;  2HE7 A;  4NJ6 A;  3ALB A;  2MBH A;  2K6Q A;  4GDK A;  4FA6 A;  4BVU C;  3DVG Y;  5LXH A;  2D07 B;  3QIJ A;  3PRE A;  3DBS A;  2MP2 B;  3B1L X;  4E71 A;  2KD0 A;  2ZCC A;  1I42 A;  1GC6 A;  2WWZ A;  4X57 B;  4ASW C;  1V80 A;  3H7P A;  3KYC D;  5CHF A;  2M0X A;  4W9E A;  2MW5 A;  2CU1 A;  1P1A A;  2BWF A;  4JLC A;  5J2R A;  3ZVV A;  1UH6 A;  4W9G A;  3OAW A;  4LJP B;  4TQ0 A;  4RM9 A;  3L0W B;  4GN1 A;  2NPT B;  2CS4 A;  1WYW B;  2KLG A;  2LAS A;  2LWP A;  2W9N A;  2KFJ A;  1WGH A;  2JZZ A;  3JYU A;  4IWP A;  4WQO B;  5C23 A;  3VHT C;  3WIM A;  2DAF A;  2PE9 A;  1HE8 A;  1SE9 A;  2V3S A;  2KQ7 A;  1V5T A;  4KZ0 A;  4RMA A;  3PRZ A;  2LVP A;  2KJ6 A;  3A9J B;  3ML9 A;  3SDL C;  1EO6 A;  4GDL B;  2NBV B;  3W1S A;  4HK2 A;  1E8Z A;  1NI2 A;  1WMH B;  2KDE B;  4OVV A;  2JY6 A;  1QZE A;  2ZVO A;  1L7Y A;  2R2Q A;  3QJZ A;  3KUC B;  2MA9 B;  3UIN B;  1OEY A;  3V62 A;  4HPL B;  3QAQ A;  5TR5 A;  1P9D U;  2FCM A;  4MSM B;  1YJ1 A;  2HD5 B;  3O65 B;  1ISN A;  1YX6 B;  3QWZ B;  2MBE A;  4WWO A;  1L2N A;  3GOE A;  3N30 A;  4EEW A;  1P0R A;  4HCN B;  5D94 A;  2DHZ A;  4GU2 A;  4M0W B;  2KTF A;  2KQS A;  3AU5 A;  4MGK E;  3U7D A;  3KYD D;  3HHM A;  1LQB A;  1WJ6 A;  4I6L B;  1CMX B;  4J6I A;  1RFA A;  3RYT A;  5E6P A;  2AL3 A;  5KHO A;  4W9I A;  3PLU A;  4AOF A;  4GSW A;  2C7M B;  2KKC A;  3ZTD A;  2JF5 A;  1D3Z A;  2FNJ B;  1LXD A;  2FCQ A;  2NVU I;  1Z2M A;  1BT0 A;  4FJY A;  4DDI D;  3PHX B;  1WE6 A;  2R2O A;  4HPM B;  2MBQ A;  2JRH A;  2KJH B;  1OGW A;  2KZR A;  4IUM B;  4NY0 A;  4WJP A;  4ICV A;  5DPW A;  1UZX B;  1X1M A;  1GJZ A;  3X23 A;  2KX3 A;  3M3J A;  4NAW A;  4EFO A;  3EEC A;  3HM6 X;  2QHO A;  2ZNV C;  1SGH A;  2L8J A;  4A3P A;  2N9X A;  2FID A;  1Z5S B;  1WX9 A;  3ML8 A;  3ZIM A;  4II3 B;  2DAJ A;  3T8M A;  1Y8R C;  5AEK B;  3TMP B;  2Z59 B;  1E7V A;  4IM3 A;  3WAN A;  4ICU A;  2C60 A;  2RD0 A;  2RR9 A;  5D7G A;  5LXI B;  1IP9 A;  2Y5B B;  4I6N B;  3B08 A;  2O2V B;  3HM3 A;  3JW0 X;  4PYU A;  2BYF A;  4EUT A;  2OOB B;  2O6V B;  2N9P C;  2DYM A;  2EKE C;  2K1F A;  4DDG D;  4MSQ B;  4GB9 A;  4LDT D;  3ZTC A;  3VUY A;  3ZNG C;  3A4S C;  3QA8 A;  3NS8 A;  3Q3F A;  1WJU A;  4M8M A;  2ZEQ A;  4W9H A;  5E6N A;  2AWT A;  3U8Z A;  2L0F A;  2ASQ A;  3AU4 A;  3DBL I;  4DHJ B;  1WM3 A;  3IHP C;  3JSV B;  3LDZ E;  3T9L A;  3UQA A;  1S1Q B;  4W9D A;  1WIA A;  2ZCB A;  2KLC A;  1F9J A;  3AUL A;  4LCD E;  4MGI E;  1G6J A;  2M4N A;  2WDT B;  3QCA A;  4IG7 B;  2CR5 A;  4W9K A;  2KJR A;  1V49 A;  2KTR B;  4JL9 A;  3U30 A;  3CSF A;  3ZKJ C;  3ZNZ B;  2KOX A;  2HTH A;  2GBK A;  2N1W A;  5DPS A;  1WM2 A;  5L95 C;  2N7E A;  3OJ4 B;  2YLM A;  2YVC A;  4HDQ A;  5E6O A;  5CX3 A;  2N9E B;  2NS5 A;  2MP2 A;  2IY1 B;  5CTR C;  2IY0 B;  1ZGU B;  3OLM D;  4KV2 A;  2J0K A;  3RCZ A;  1EF1 A;  1U4A A;  3EFU A;  4WJN A;  2KFK A;  2M8S A;  1UGM A;  4G0N B;  1J8C A;  2MSE D;  2JUO A;  4AP4 C;  4ANX A;  4GIV A;  4E74 A;  3H7S A;  3K9P B;  3ZW3 A;  2CHZ A;  2LRW A;  1TTN A;  5J18 A;  2G4D B;  2WX0 A;  4WJQ A;  4F7Z A;  2ZJD A;  2LXC A;  2JPH A;  2DEN B;  2WYQ A;  1EF5 A;  3IG3 A;  4FHJ A;  1PQS A;  1WGR A;  1XT9 B;  2KWV B;  2PEA A;  1WXM A;  3A9J A;  3IVF A;  4IWQ A;  4KVG B;  4FJZ A;  2RPQ A;  2RSU A;  5G55 A;  4A3O A;  5D6J B;  1WH3 A;  2LI5 A;  2G4S A;  2L05 A;  2IO1 B;  2MBB B;  4ANU A;  4WJO A;  1E8X A;  3KUZ A;  4PYZ A;  2K39 A;  5DPT A;  2PJH A;  3CF6 E;  3VXW A;  4EZL A;  3TCA A;  3PRM B;  1WX7 A;  2GMI C;  1J19 A;  3M62 B;  5L83 A;  3BY4 B;  1E5W A;  1OQY A;  3UQB A;  2MCN B;  1J0G A;  1E8W A;  2JZ3 B;  2KMA A;  3PSE B;  5CHV C;  3UIP B;  4CO7 A;  4EKU A;  1GG3 A;  2Z0E B;  3QHT A;  2LVO A;  3VVW B;  3DBR I;  3H7P B;  2CHX A;  1GC7 A;  3KW5 B;  4BFR A;  3VTV A;  2RGF A;  4KSK C;  2KAN A;  3L17 A;  2C9W B;  2LVQ A;  4DWF A;  3QK0 A;  4ZDV A;  5AZG A;  2EMS A;  1ZW7 A;  4NQL B;  2MQJ A;  4GGQ A;  4FN2 A;  4EZK A;  1Q1O A;  2WX1 A;  3EHV A;  2XEW A;  2D3G A;  4EZJ A;  1XQQ A;  4KIK A;  1T0Y A;  2K8C A;  4MGY E;  1R4M I;  2ZNV B;  1UBI A;  4PS3 A;  2L0T A;  3A33 B;  1ZKH A;  3DBH I;  3VUW A;  3APF A;  3IBE A;  1TZ1 A;  3TIX A;  3K9O B;  3AI5 A;  2K25 A;  5JH5 C;  4FBJ B;  3SD5 A;  3L10 B;  3RUI B;  3MHS D;  4MGZ E;  4MM3 A;  2IYD B;  2DZJ A;  4DBG A;  1C3T A;  1TBE A;  4HVB A;  5HKH A;  2KXJ A;  1YX5 B;  2NBW B;  5DPR A;  1C1Y B;  1H8C A;  2NCN A;  2N7D A;  2M1M A;  3R7R A;  3MTN B;  2IO0 B;  3NOB A;  4W9L A;  3RD2 A;  3JVZ X;  3ZRC A;  3ECI A;  4LDT B;  1V5O A;  5LLI A;  4DHZ E;  3UGB B;  2V4L A;  3ENE A;  1WZ3 A;  1V2Y A;  2BGF A;  3PLV A;  4P7I A;  5JHA A;  3QQ8 B;  3DQV A;  2KX0 A;  3MJW A;  1M94 A;  2XK5 A;  3PS6 A;  3TL5 A;  2G45 B;  5AZH A;  1RAX A;  5C1Z A;  3VH3 B;  3A9K A;  4BKG A;  5FR6 A;  3W1S C;  2NBU A;  4YL8 A;  1IYF A;  2LD9 A;  4NPN A;  1P98 A;  1Q0W B;  4AUQ C;  1WX8 A;  2MWS B;  3PPA A;  4HWI B;  4FAD A;  3WAM A;  3NY5 A;  4W9F A;  2LGX A;  2AL6 A;  3WAL A;  2BKF A;  1WY8 A;  1YD8 U;  3APC A;  3ZNI D;  2V1Y A;  4K81 A;  2GBN A;  2UWQ A;  3AXC A;  2MX2 A;  4K7S A;  1A5R A;  4NAW B;  2DYO A;  2OJR A;  4AJW A;  2FUH B;  2KO3 A;  3WAO A;  2BWE S;  2AYO B;  4JIO U;  4CHK A;  4BKS A;  1LM8 B;  3H9D A;  1YIW A;  3DVG X;  1WGD A;  4KZC A;  2K8H A;  3PVL A;  2D2Q A;  4XX5 A;  1OTR B;  4MEL A;  3L08 A;  4BBN F;  2LUE A;  3HIZ A;  4TQ1 A;  5JZE B;  1E7U A;  3KVF B;  1K8R B;  1FXT B;  3DVN U;  2M17 A;  2GOW A;  4MJS A;  2D10 A;  4NQK E;  4FHK A;  1WE7 A;  1VCB A;  3PV1 A;  3N32 A;  1UBQ A;  4NNJ B;  3DDC B;  4B95 A;  3B0A A;  2JWZ A;  4G11 A;  2FAZ A;  4NJ7 A;  4ZRJ A;  3NZS A;  1YQB A; 
#chains in the Genus database with same CATH topology
 4MAC A;  1Q10 A;  4DXF A;  3A1Q B;  1ZDX A;  1SEB D;  3FAH A;  2FIF A;  2LEK A;  4JQW C;  1TYG B;  1C4C A;  3NG0 A;  3DPD A;  2Z0D B;  3VR9 B;  3NUH B;  3VQI A;  1XD3 B;  2MLB A;  1XLP A;  4DHJ D;  3U52 E;  4XDC A;  3CST A;  3SHQ A;  2JXT A;  2ZPY A;  5BMH A;  3MFG A;  4ITK A;  3AEB B;  4K3C A;  1TY2 A;  2QIE B;  3FIL A;  3RZW C;  2PTL A;  1RYJ A;  1PDX A;  3DBL B;  4M8N A;  5BYQ A;  2IDY A;  1V97 A;  2G3Q B;  3BK1 A;  4J3O D;  3QX1 A;  1WRI A;  2H88 B;  3AE8 B;  3NHE B;  2VH2 A;  3SEB A;  2GBM A;  3N3K B;  3X0W A;  4Q2J A;  3VFK A;  3AN1 A;  3HK0 A;  5C2T B;  1PGB A;  3MC0 B;  3LXF A;  2H89 B;  4YSX B;  4IWO A;  1DOY A;  4M01 A;  4P1B C;  2AEH A;  4QAY A;  2CKH B;  3PT2 B;  3L54 A;  3VTW A;  2JYE A;  4MT5 A;  3VUX A;  2CU3 A;  1EU4 A;  3PGE A;  1NBF C;  3VR8 B;  2BKR B;  2JRI B;  5DCN A;  3UIO B;  3OJ3 A;  2J0J A;  1WR1 A;  4KDL B;  3U2S C;  3M95 A;  5CHW A;  5KHQ A;  3P4R B;  1TGZ B;  3JSV A;  5BYR A;  4KDI C;  2J4X A;  4ZRI A;  3TJP A;  1CJE A;  2IND C;  2ICI A;  1VZ6 A;  2MHJ A;  3Q8C A;  3V6E B;  4MH0 E;  4WWM A;  4P1C C;  2KDI A;  4IM0 A;  1J7B A;  2ZVN A;  3N1Z C;  1HXY D;  3AMZ A;  3I5J C;  2I1J A;  1FD6 A;  5E6J A;  1EUV B;  3S2A A;  2C7H A;  4USA A;  4KGR A;  2KWU B;  3PHW B;  4GOC A;  1PGX A;  2LGD A;  1YJJ A;  1WF9 A;  3GZN B;  1E90 A;  4XC2 A;  1D5X C;  4F1S A;  1S3S G;  1K52 A;  3AEG B;  2WXG A;  3C0R B;  4GMV A;  5J17 A;  2LJ5 A;  1FEH A;  3Q6B A;  4WAA A;  4MDK E;  2LMC A;  4K1R B;  3R66 C;  2WXQ A;  1I35 A;  1GUA B;  4I6P A;  2HE7 A;  4NJ6 A;  3ALB A;  2MBH A;  1E9M A;  2GLS A;  3DVG Y;  2D07 B;  3PRE A;  2MP2 B;  1YQ3 B;  4E71 A;  5HFY A;  2PVO D;  2WP9 B;  2LHD A;  3KYC D;  5CHF A;  2EEL A;  2CU1 A;  1P1A A;  4JLC A;  1UH6 A;  4LJP B;  2WDR B;  2JZP A;  2CS4 A;  1WYW B;  3MP9 A;  2KLG A;  2LAS A;  3JYU A;  2KFJ A;  3VHT C;  2DAF A;  2V3S A;  1DGJ A;  1K51 A;  2LVP A;  3EGR A;  3B2G A;  1EO6 A;  1AYF A;  1QZE A;  3EA6 A;  2ZVO A;  2R2Q A;  1FCC C;  2BBC A;  3QJZ A;  2RDB C;  1SJE D;  3UIN B;  1AW7 A;  1DYQ A;  2FCM A;  3IT6 B;  3O65 B;  1L2N A;  1IGC A;  1UWX A;  3GOE A;  2GI9 A;  1P0R A;  2QEJ C;  4GU2 A;  1XCQ L;  3FIL B;  3IT4 B;  1UNS A;  3AED B;  2N0S B;  1BUI C;  5E6P A;  4AOF A;  3VRA B;  4GSW A;  1OQQ A;  2JF5 A;  1CQV A;  1D3Z A;  2FCQ A;  3IXS A;  1BT0 A;  2R2O A;  1N61 A;  2JRH A;  3BVM A;  1JWS D;  2ON8 A;  1QF6 A;  3NZ3 A;  2G1E A;  1Z5S B;  5IO9 A;  4WIP A;  1JWM D;  5AEK B;  1BML C;  1I7H A;  1L5P A;  4ICU A;  2RD0 A;  1T5X D;  5D7G A;  4I6N B;  3B08 A;  1L0Y B;  4EUT A;  4MSQ B;  2MJ3 A;  3NS8 A;  2J42 A;  4W9H A;  1YJI A;  3AU4 A;  1JW9 D;  3JSV B;  3LDZ E;  3RN9 C;  3UQA A;  1S1Q B;  4W9D A;  4IG7 B;  4W9K A;  1E10 A;  1V49 A;  4JL9 A;  4IDI A;  3CSF A;  3NVV A;  3P4P B;  2GBK A;  2G9H D;  2YVC A;  4HDQ A;  3NVZ A;  1F2R I;  4HKQ A;  2PKO A;  2J0K A;  1FFU A;  2YEP B;  1ZOY B;  1SBB B;  3CWI A;  2M8S A;  1TS4 A;  2MSE D;  1GB4 A;  3H7S A;  2CHZ A;  2LRW A;  1TKG A;  3HVZ A;  5J18 A;  3GS2 A;  1R4N B;  4CQN A;  4HKZ E;  1QOB A;  4FJZ A;  5G55 A;  4H2A A;  1WH3 A;  2LI5 A;  2MBB B;  3KUZ A;  4PYZ A;  3VXW A;  4EZL A;  3TCA A;  2GMI C;  1C79 A;  4P6V F;  2WU5 B;  4EKU A;  1KF6 B;  1GG3 A;  2Z0E B;  3VVW B;  1GC7 A;  2RGF A;  3AE6 B;  1WXQ A;  2C9W B;  5EE0 A;  4NQL B;  1XQQ A;  2L0T A;  1ZKH A;  3DBH I;  4LLG M;  4RFB A;  3AI5 A;  4FBJ B;  1TS5 A;  3L10 B;  4MGZ E;  1P7E A;  1H8C A;  1YX5 B;  2NBW B;  1C76 A;  2M1M A;  3LB8 C;  3R7R A;  4W9L A;  3JVZ X;  1DOX A;  4LDT B;  1NI3 A;  2BGF A;  4P7I A;  2INP E;  3DQV A;  4L23 A;  4LK0 M;  3TL5 A;  3PS6 A;  3AE9 B;  4WAF A;  2L83 A;  5FR6 A;  2Y5P A;  2LD9 A;  1D4B A;  3PPA A;  4A55 A;  4NJC A;  2LGX A;  2AL6 A;  1PFD A;  1UGJ A;  3KQ4 A;  3ZNI D;  1JWA D;  4K81 A;  2UWQ A;  1A5R A;  1D6E C;  2FUH B;  4HRO A;  1HZ6 A;  2M19 A;  2VZK B;  4JIO U;  4BKS A;  4N59 A;  2D3B A;  2INC C;  3Q8A A;  3AEC B;  4C7Z A;  2JSV X;  3PVL A;  4MEL A;  4RNA A;  3HIZ A;  3AE1 B;  2RDG A;  4L2Y A;  2QJL A;  4IOI E;  4NQK E;  1VCB A;  2N9L A;  1QT9 A;  3N32 A;  4G11 A;  4ZRJ A;  3NZS A;  4HEA 1;  3TSS A;  3V60 A;  2W3R A;  3DCG A;  2KAC A;  5G5G A;  2IGH A;  3TBL D;  3A4R A;  2PIA A;  3VTU A;  1JRU A;  2DZK A;  3Q8B A;  1HZ5 A;  3SR6 A;  3IFW B;  1P3Q U;  1PYW D;  4GLS C;  4B0M A;  1L0X B;  2DX5 B;  2SAK A;  4XWW A;  1T6B X;  1WZ0 A;  3AH7 A;  4GDK B;  1RRB A;  4FJV B;  3RNC C;  2L7R A;  2BF8 B;  2V0G A;  1QLB B;  4DXA B;  2XNA C;  2BVC A;  3APD A;  4W9C A;  5AZF A;  4BAX A;  4ARC A;  2BYV E;  3QAR A;  4AWJ A;  2KHW B;  2WXH A;  2HJ8 A;  1C77 A;  3Q8F A;  4KSL C;  2LXA A;  3SFD B;  3ZJV A;  3KWV A;  3RZF A;  1I4X A;  1V86 A;  2WS3 B;  1JRP A;  1RLF A;  2JVC A;  3LYY A;  3V61 A;  1N62 A;  3DOW A;  4L1B A;  2WXR A;  3RI7 C;  1V9J A;  3DVN V;  2L3Z A;  1MHX A;  3AB5 A;  1JCK B;  1UD7 A;  2I1K A;  3UF8 A;  4OW0 A;  4OZA A;  1EWC A;  3N1X C;  2KVR A;  5H8Y E;  3RUL A;  1WGG A;  3I63 C;  3NVW A;  2KTR A;  2AX5 A;  4DXG A;  3W5V B;  1PUT A;  2L76 A;  4ZYN A;  3B2F A;  2ZW1 A;  4B0E A;  2MBO A;  1E8Y A;  4LNK A;  2KC1 A;  4F8C B;  2MJD A;  2EMT A;  1LFD A;  4JWS C;  1R4M B;  3D32 A;  2ACZ B;  4DHZ B;  1WXS A;  1WJN A;  3L16 A;  4K7W A;  3U4E G;  1N5W A;  4FUL A;  4ANV A;  5AUI A;  1SIF A;  3RNE C;  2O6V D;  1ZXI A;  2KDB A;  2WXM A;  2WGS A;  2J7Q B;  1VLB A;  3ZNH B;  1WFY A;  2QIL A;  5TSS A;  1AN8 A;  4BVU C;  3QIJ A;  2X38 A;  3DBS A;  3B1L X;  2VZK D;  4K3B A;  3N9Y C;  3TEX A;  1I42 A;  1GC6 A;  1V80 A;  2W82 A;  2M0X A;  4W9E A;  5JXV A;  2LGS A;  2W9N A;  4WQO B;  3WIM A;  1WGH A;  4IWP A;  2PE9 A;  1SE9 A;  2J53 A;  3PRZ A;  2KJ6 A;  4YXD B;  3Q3M C;  4RF1 A;  2NBV B;  3W1S A;  4OVV A;  2KDE B;  2RPV A;  5HHD G;  1B9R A;  4OHJ A;  5IN7 A;  3V62 A;  5TR5 A;  1P9D U;  4C4V A;  1YJ1 A;  2HD5 B;  3Q69 A;  1ISN A;  1YX6 B;  3QWZ B;  2MBE A;  4ZYS A;  4AQ7 A;  2PMV A;  4EEW A;  2QSD A;  3BK2 A;  5D94 A;  2DHZ A;  3DHH C;  2KWD A;  3DHI C;  2KTF A;  2B76 B;  3U7D A;  3OG5 A;  1LQB A;  1SE4 A;  1CMX B;  2QMT A;  1RFA A;  3RYT A;  4YTM B;  1QOG A;  3DWM A;  2KKC A;  2FNJ B;  4FJY A;  4DDI D;  3TEW A;  3PHX B;  1M4V A;  1WE6 A;  4MM3 B;  4NY0 A;  4ICV A;  1UZX B;  1X1M A;  3X23 A;  4NAW A;  1WYG A;  3EEC A;  3HM6 X;  4A3P A;  2N9X A;  2FID A;  4PK1 A;  1WX9 A;  1QQR A;  3ML8 A;  1LO5 D;  3T8M A;  1Y8R C;  1IP9 A;  1F0Z A;  2OOB B;  3E56 A;  1STE A;  3VUY A;  1WSP A;  1MG4 A;  1TZO A;  2ZEQ A;  1FNW A;  3DBL I;  1TS2 A;  1WM3 A;  2ZCB A;  2YEP F;  1F9J A;  3AUL A;  1G6J A;  2M4N A;  1FMA D;  2JYT A;  2KTR B;  3U30 A;  3ZNZ B;  2HTH A;  5DPS A;  1WM2 A;  2N7E A;  1UWM A;  3I9V 1;  2IY1 B;  2IY0 B;  1ZGU B;  3TUO A;  2WXK A;  4OZC A;  2KFK A;  2J52 A;  4G0N B;  2JUO A;  3K9P B;  1V1O A;  1RFK A;  2G4D B;  4WJQ A;  2ZJD A;  2JPH A;  1EF5 A;  1KLG D;  1NYR A;  3PZ7 A;  2KVZ A;  1WGR A;  1XT9 B;  2KWV B;  2M56 B;  4OZB A;  1WXM A;  1E7P B;  3A9J A;  4IWQ A;  2RPQ A;  2RSU A;  4A3O A;  5D6J B;  5DPT A;  1SIJ A;  5EE3 A;  3M62 B;  2AQ3 B;  2MCN B;  3PSE B;  3UIP B;  4CO7 A;  1YN4 A;  1QIL A;  2LVO A;  1V8C A;  3DBR I;  3FC4 A;  4HJG E;  4BFR A;  3VTV A;  2KAN A;  2LVQ A;  4DWF A;  1CK1 A;  4GGQ A;  4FN2 A;  2PLP A;  2XEW A;  2D3G A;  1T0Y A;  2K8C A;  4MGY E;  4PS3 A;  3MHZ A;  2W54 A;  3VRB B;  1HTO A;  1J7A A;  3E9S A;  1QOF A;  3MHS D;  2DZJ A;  1C3T A;  1K50 A;  2IPK D;  4HVB A;  5HKH A;  5DPR A;  2K5P A;  2NCN A;  2N7D A;  1FFV A;  2NMQ A;  1JAL A;  2KQ4 X;  4C4V B;  4EZJ A;  3ECI A;  1V5O A;  3W5U B;  3ENE A;  1V2Y A;  1AWD A;  1M94 A;  2G45 B;  5AZH A;  3VH3 B;  4BKG A;  4JWU C;  4TMA B;  2V3N A;  4AUQ C;  1Q0W B;  1WX8 A;  3AE2 B;  4HWI B;  3WAM A;  1T3Q A;  2BS2 B;  3RMK C;  3NY5 A;  4W9F A;  3WAL A;  4A6Q A;  1WY8 A;  1VZ7 A;  2GBN A;  3AXC A;  2MX2 A;  4ZRP A;  4NAW B;  2CJN A;  1FIQ A;  2BWE S;  4EE2 A;  4YWG G;  2MEK A;  3H9D A;  3T3N A;  1XLQ A;  5JZE B;  2WU2 B;  1K8R B;  4MJS A;  2GOW A;  3U7Z A;  1UUP A;  1WE7 A;  3PV1 A;  1UBQ A;  2JWZ A;  2FAZ A;  4YSY B;  1YQB A;  2MRP A;  4IW0 A;  3VAW A;  2KYW A;  3WA0 A;  3ZLZ A;  4XZ4 A;  3I3T B;  1MPE A;  2K6D B;  4HLE A;  1ENF A;  4TUU A;  4B9K A;  3EC8 A;  2KN5 A;  1WMH A;  2XN9 C;  4IC7 B;  2GBR A;  3R7Q A;  1P7F A;  2KFK B;  4N9F 4;  2JT4 B;  1IBX A;  3WAP A;  2KC2 A;  1DOI A;  1V6E A;  1MJD A;  4G3X B;  4A9A A;  3ZRF A;  2L00 B;  2PPH A;  4BOS C;  2ZPN A;  1K53 A;  3VDZ A;  4HRS A;  2IO3 B;  5I4D A;  3HUI A;  1HQR D;  3N20 C;  2CHW A;  2UYZ B;  1WJ4 A;  1FM0 D;  1D5Z C;  2IO2 B;  2KWC A;  4BZA A;  1MHH E;  4RM8 A;  2C5L C;  4WWN A;  3ONS A;  2WHI A;  1VD2 A;  1C4A A;  4C80 A;  5IA7 A;  1C4P A;  5D2M B;  4FXC A;  1SSN A;  2N1V A;  4W9J A;  1Y56 A;  4II2 B;  1TKY A;  2O2V A;  2DYB A;  1SE3 A;  4CYE A;  2K0P A;  4KKI A;  1R4N I;  4GXB A;  3GB1 A;  2PE6 B;  4XDD A;  1GAQ B;  4PS8 A;  4G50 A;  3H6N A;  3TEY A;  4N58 A;  4RCO A;  2IJ0 A;  2BPS A;  4TV3 A;  1F52 A;  4JX1 C;  4RGN A;  1JWU D;  2B3A A;  4ANW A;  4N6E B;  2J0M A;  3ZUN A;  1WGY A;  1FXA A;  3R3M A;  1YOV B;  4K7U A;  1TT5 B;  3O13 A;  1YN5 A;  1ZPS A;  3LJ3 A;  5FK9 C;  2PVG C;  4HJK A;  4HDO A;  2BB5 A;  4UDU C;  4ZRQ A;  3A1Q A;  3ZO5 B;  3VH4 B;  2BYE A;  1XCT L;  2KK8 A;  1KH0 A;  2RMM A;  1I4P A;  2WDQ B;  4PS7 A;  2FCN A;  3CMM B;  1KLV A;  2K3U A;  4OVU A;  2VRR B;  1KOT A;  2A4Z A;  2Y5C A;  3ZDT A;  2BQQ A;  2WXJ A;  2FCS A;  4MJS B;  3NZU A;  4ACF A;  4FA6 A;  2K6Q A;  3P1M A;  3R8B A;  1FRD A;  4S17 A;  2ZCC A;  2CJO A;  2WWZ A;  4X57 B;  3EFC A;  3H7P A;  1TJE A;  4OVZ A;  2MW5 A;  2BWF A;  5J2R A;  1B1Z A;  4RM9 A;  2JX5 A;  1FXI A;  4RGM A;  2LFI A;  5C23 A;  1XLN A;  5HG2 A;  2BS4 B;  1RWS A;  1HE8 A;  2DBY A;  4REZ A;  1V5T A;  4KZ0 A;  1E0Z A;  1E6E B;  3ML9 A;  5LNK 1;  3SDL C;  1WGK A;  3AE4 B;  4HK2 A;  4KKJ A;  1E8Z A;  1NI2 A;  1WMH B;  1ZP0 B;  3BWU D;  1EU3 A;  1L7Y A;  4IKG A;  4XWT A;  3KUC B;  2MA9 B;  2D3C A;  4HCN B;  5IOI A;  2FUG 1;  4MGK E;  3KYD D;  1WJ6 A;  4I6L B;  2AL3 A;  5KHO A;  4W9I A;  3PLU A;  3ZTD A;  2KAJ A;  3C19 A;  1LXD A;  2NVU I;  1Z2M A;  3PO0 A;  4HPM B;  1JWB D;  1OGW A;  2KZR A;  4IUM B;  1GJZ A;  2KX3 A;  2ZNV C;  2FE8 A;  1VZ8 A;  5IKC M;  2NTT A;  3ZIM A;  1I4R A;  3NJT A;  3MC9 A;  2DAJ A;  1LGR A;  3I57 A;  4YT0 B;  3TMP B;  4IM3 A;  3WAN A;  2C60 A;  1YQ4 B;  5LXI B;  4WUR A;  2Y5B B;  2O2V B;  3W9C B;  3JW0 X;  2BYF A;  1N60 A;  3RNF C;  1N63 A;  2N9P C;  2DYM A;  2EKE C;  4GB9 A;  4LDT D;  3ZNG C;  4R3D A;  3A4S C;  3QA8 A;  3Q3F A;  1WJU A;  3NVY A;  4M8M A;  2AWT A;  2RDH A;  4KGS A;  4RGO S;  2L0F A;  3U8Z A;  5D3D A;  3IHP C;  3T9L A;  1WIA A;  2KLC A;  4RH6 A;  3BVG A;  4LCD E;  3QCA A;  3ZXV A;  2N9K A;  2KJR A;  2MJE A;  3ZKJ C;  2KOX A;  2N1W A;  2N7J A;  2JU6 X;  3OJ4 B;  3Q3N C;  2YLM A;  4PT5 A;  4LNN A;  4LNO A;  5E6O A;  2MP2 A;  5CTR C;  3RCZ A;  1U4A A;  4WJN A;  4US8 A;  1XXG A;  2I38 A;  1N6Z A;  2V4I B;  1QKZ A;  1L4Z B;  1J8C A;  4GIV A;  3Q14 C;  4E74 A;  3ZW3 A;  1GB1 A;  2IGD A;  1L0V B;  4F7Z A;  2KT7 A;  1ZXH A;  2LXC A;  2WYQ A;  4NAM A;  4FHJ A;  3P4Q B;  1A70 A;  2HTM E;  2PEA A;  3IVF A;  3AEA B;  1MI0 A;  2IO1 B;  4US9 A;  4WJO A;  3CF6 E;  3PRM B;  1WX7 A;  1ET6 A;  3BY4 B;  1E5W A;  3AEF B;  2IGG A;  1J0G A;  2JZ3 B;  3KLS X;  3H7P B;  4S0R A;  3L17 A;  2BS3 B;  2EMS A;  2MQJ A;  2E3T A;  1Q1O A;  2WX1 A;  3EHV A;  4EZK A;  2AQ2 B;  3BYT B;  4KIK A;  1R4M I;  2ZNV B;  1UBI A;  2BYT A;  3APF A;  2DLB A;  1NYQ A;  5JH5 C;  4JE3 B;  2K22 A;  3SD5 A;  1R7S A;  3RUI B;  4KGT A;  2IYD B;  3AV8 A;  1L6V A;  2QCZ A;  3RD2 A;  3NOB A;  2AQ1 B;  3ZRC A;  5LLI A;  4AS1 A;  3PLV A;  3QQ8 B;  2XK5 A;  1IGD A;  4XE0 A;  1C9F A;  3A9K A;  3MJ5 A;  2JWU A;  3W1S C;  4FAD A;  4LNI A;  2DWQ A;  2ZW0 A;  1OFF A;  4NZL B;  1F2R C;  1WWT A;  3RPF C;  2WQY B;  4DQO C;  2V1Y A;  4K7S A;  1XLO A;  3EUB 2;  2Q5W D;  2OJR A;  4AJW A;  2KO3 A;  2M0A A;  2LUM A;  1FPY A;  4CHK A;  4O1N A;  1LM8 B;  1CZP A;  1YIW A;  1WGD A;  3DBR B;  1FNV A;  1JML A;  2D2Q A;  2EKI A;  3L08 A;  4BBN F;  4TQ1 A;  3HVD A;  2OJW A;  3ZQ4 A;  1FXT B;  5EE9 A;  2M17 A;  4FHK A;  1VJK A;  3NRZ A;  4HPP A;  4B95 A;  2FBW B;  3B0A A;  1KFY B;  4NJ7 A;  1NEK B;  4ZHP A;  3BVZ A;  3P63 A;  3Q3O C;  4AJY B;  1NDD A;  3ZDM C;  2NPT A;  1L6U A;  2V9H A;  1F1H A;  2REX A;  1XO3 A;  2DZM A;  2KDF B;  1WRD B;  1UEL A;  1FRR A;  4C7Y A;  5GXG B;  2MH7 A;  4D2K A;  4RGT A;  2C7N B;  2A5U A;  2LGY A;  2GBJ A;  3GE8 C;  4GDL A;  2K8B A;  1TKE A;  2NR2 A;  4M00 A;  3RNG C;  3AE3 B;  4IM2 A;  1AAR A;  4TSS A;  3URY A;  4JPS A;  4BBN C;  3BZD B;  4HCP B;  4BKS D;  4EOY A;  5IP4 D;  1WR6 E;  1FNU A;  2VH1 A;  5G2N A;  5FKA C;  2LJI A;  4M0W A;  4DK5 A;  5T8I A;  3P4S B;  5H92 C;  1T0Q C;  1L4D B;  3M63 B;  1KM7 A;  5IAA C;  3GZN I;  4YTN B;  3R2I A;  4MEM A;  1MG8 A;  1GNU A;  2NTS A;  4BOZ B;  3C8Y A;  5BMG A;  1I4G A;  1OEY J;  3ABV B;  5JHB A;  1XF5 L;  2GB1 A;  3J9C A;  1GOZ A;  3KUD B;  3DWG C;  3PZD A;  4TKN A;  2R61 A;  3PRP B;  2N4F A;  1FO4 A;  2D5G A;  1IPG A;  3PTF C;  1V81 A;  3L13 A;  4MH8 A;  3W1Y A;  5EDS A;  2LZ6 A;  1FCL A;  4KIK B;  3OWE B;  3P2B A;  1MVK A;  1ZDV A;  2QC8 A;  2DZI A;  2IZV B;  4WWP A;  2HJ1 A;  2O6V A;  3KH0 A;  3BIN A;  2L1A A;  3MC8 A;  3SU8 X;  1KLU D;  2I2Y A;  3RT3 B;  1KJT A;  2LRU A;  4JGH B;  1F77 A;  1BXT A;  2L32 A;  2ZZP B;  4BKT A;  1EM7 A;  1WXV A;  1KTK A;  1ET9 A;  1ZE3 D;  2XK5 B;  1H4R A;  1ESF A;  1HA5 A;  3RNB C;  3A9K B;  3QC8 B;  3RFZ B;  1TIF A;  4KX6 B;  2XBB C;  3B9J A;  4LJO B;  3V6C B;  4ZRK A;  1IUE A;  1WXA A;  4M02 A;  3TEZ A;  3Q3J A;  4XYC A;  3H1U A;  2LGI A;  2W3S A;  2D3A A;  3DBH B;  2D11 A;  3ZJU A;  5FR3 A;  5GMV A;  4A20 A;  1NEN B;  1ZUD 2;  4LNF A;  1WI0 A;  1Q5W B;  2K9X A;  4B6W A;  2JXX A;  4URK A;  2KNB A;  4FLH A;  2IBI B;  4ZHO A;  2GRI A;  2KMC A;  5BO4 B;  4HXD A;  5G5H A;  3AEE B;  1XEE A;  4E3C A;  4ARI A;  4GDK A;  4RF0 A;  5LXH A;  2KD0 A;  4ASW C;  2X8X X;  2QDF A;  3AM9 A;  3ZVV A;  4W9G A;  1SXT A;  3OAW A;  2LHE A;  4TQ0 A;  3L0W B;  4GN1 A;  2NPT B;  3BII D;  1VDV A;  2LWP A;  2JZZ A;  1J7C A;  2KQ7 A;  4RMA A;  1EWY C;  3A9J B;  3KWL A;  4GDL B;  1HTQ A;  1C78 A;  2E6X A;  3IAS 1;  2JY6 A;  1OEY A;  3GE3 C;  2SEB D;  4HPL B;  3QAQ A;  4C00 A;  4MSM B;  2TSS A;  4WWO A;  3AE5 B;  3H8H A;  3N30 A;  2WXF A;  1N5X A;  5BYS A;  3DHG C;  4M0W B;  2WLB A;  2JQR B;  2KQS A;  3AU5 A;  3HHM A;  4WH4 A;  4A8X C;  3V05 A;  2WXP A;  4J6I A;  3W2D A;  3P42 A;  2C7M B;  2KMM A;  2OED A;  1PGA A;  3GP7 A;  2Z8L A;  1UF0 A;  2MBQ A;  2KJH B;  4WJP A;  3CIR B;  5DPW A;  2BTE A;  3M3J A;  4EFO A;  2QHO A;  3V3X A;  1SGH A;  2L8J A;  3NS1 A;  4A90 A;  4II3 B;  1NVI D;  3WCQ A;  2Z59 B;  1E7V A;  2L52 A;  1V1P A;  1TY0 A;  2RR9 A;  1JRO A;  3HM3 A;  3T3O A;  4PYU A;  2O6V B;  3R2T A;  2K1F A;  2V3P A;  4DDG D;  3ZTC A;  3BYY B;  5E6N A;  3ZXR A;  2ASQ A;  4DHJ B;  2KDM A;  2DNF A;  2KN4 A;  4P16 A;  1ACC A;  4MGI E;  1VR9 A;  2WDT B;  5MPO A;  2CR5 A;  2WXI A;  4WQM A;  5L95 C;  1YMH E;  2W55 A;  1T0R C;  2WXO A;  5CX3 A;  2N9E B;  2NS5 A;  5D3I B;  3OLM D;  4KV2 A;  1EF1 A;  2OHF A;  3EFU A;  5AUK A;  5BMI A;  1UGM A;  4AP4 C;  4ANX A;  1TTN A;  1D5M C;  2WX0 A;  3SFE B;  3ZJT A;  2DEN B;  3IG3 A;  1KRH A;  1PQS A;  4KVG B;  3L4P A;  1JQ4 A;  2Y3A A;  2G4S A;  1QOA A;  2L05 A;  1YNT E;  4ANU A;  1E8X A;  1ROE A;  2K39 A;  2PJH A;  1J19 A;  5L83 A;  1OQY A;  3UQB A;  3HRD D;  1E8W A;  5CHV C;  2KMA A;  2WXN A;  3QHT A;  1SJH D;  3ZYY X;  1HEZ E;  2CHX A;  3KW5 B;  1IBX B;  4KSK C;  3QK0 A;  4ZDV A;  5AZG A;  1ZW7 A;  3RNA C;  2UU7 A;  3IAM 1;  1GPX A;  1VRA B;  2WNM A;  3A33 B;  3VUW A;  3TIX A;  3IBE A;  1TZ1 A;  3K9O B;  2INN E;  2K25 A;  4XGA B;  4C56 C;  4MM3 A;  4DBG A;  1TBE A;  2KXJ A;  3AE7 B;  3N1Y C;  1C1Y B;  1I4H A;  3MTN B;  2IO0 B;  4DHZ E;  3UGB B;  2V4L A;  2WXL A;  1WZ3 A;  3UI3 A;  5JHA A;  2KX0 A;  3MJW A;  5C1Z A;  1RAX A;  2BT6 A;  3ZGZ A;  2NBU A;  4YL8 A;  1IYF A;  4NPN A;  1P98 A;  1SE2 A;  2MWS B;  3FKY A;  3ETR A;  1YN3 A;  1MFW A;  5EE1 A;  2BKF A;  3APC A;  1YD8 U;  2DYO A;  2BW2 A;  2BB6 A;  3Q8E A;  3WAO A;  2AYO B;  4YTP B;  1T0S C;  4LTU A;  1TS3 A;  2ONQ A;  1OQR A;  1SB3 C;  2HDE A;  3DVG X;  4KZC A;  5HI1 A;  2K8H A;  4XX5 A;  1OTR B;  3PZ8 A;  1SF0 A;  2LUE A;  4YSZ B;  2PW9 A;  1E7U A;  2WDV B;  3KVF B;  1V1P B;  3DVN U;  3Q2A C;  2D10 A;  1I4Q A;  5C3J B;  4NNJ B;  3DDC B;  1RM6 C;  4ZOH C; 
#chains in the Genus database with same CATH homology
 3V60 A;  2MRP A;  4IW0 A;  3VAW A;  3DCG A;  3WA0 A;  4AJY B;  3A1Q B;  1NDD A;  3TBL D;  3ZDM C;  2NPT A;  3ZLZ A;  2FIF A;  3A4R A;  4JQW C;  4XZ4 A;  2REX A;  3I3T B;  3VTU A;  1JRU A;  2K6D B;  2DZM A;  4HLE A;  2KDF B;  3DPD A;  2Z0D B;  2DZK A;  1WRD B;  1UEL A;  3IFW B;  1P3Q U;  3VQI A;  1XD3 B;  2MLB A;  4TUU A;  2C7N B;  2A5U A;  2LGY A;  2DX5 B;  2GBJ A;  3EC8 A;  4GDL A;  4B9K A;  4DHJ D;  2KN5 A;  2K8B A;  1WMH A;  2NR2 A;  4IM2 A;  4IC7 B;  1AAR A;  1WZ0 A;  2GBR A;  4GDK B;  3R7Q A;  1RRB A;  4BBN C;  4FJV B;  2KFK B;  4N9F 4;  4HCP B;  2JT4 B;  3WAP A;  4BKS D;  2KC2 A;  4EOY A;  3CST A;  1V6E A;  2L7R A;  3SHQ A;  1WR6 E;  2BF8 B;  2ZPY A;  4G3X B;  3ZRF A;  4DXA B;  5G2N A;  2L00 B;  3APD A;  4DK5 A;  4W9C A;  2PPH A;  3RZW C;  4BOS C;  5AZF A;  2ZPN A;  3VDZ A;  2IO3 B;  4M8N A;  2G3Q B;  3M63 B;  3QX1 A;  2BYV E;  1KM7 A;  5IAA C;  3GZN I;  3QAR A;  4AWJ A;  2KHW B;  2HJ8 A;  4MEM A;  3NHE B;  2CHW A;  2UYZ B;  4KSL C;  2LXA A;  2GBM A;  1WJ4 A;  1MG8 A;  1GNU A;  4BOZ B;  2IO2 B;  2KWC A;  3N3K B;  3RZF A;  3X0W A;  1OEY J;  5JHB A;  3VFK A;  1V86 A;  3HK0 A;  4RM8 A;  2C5L C;  1RLF A;  3KUD B;  2JVC A;  3PZD A;  4TKN A;  4IWO A;  4WWN A;  3ONS A;  1VD2 A;  3V61 A;  2AEH A;  3PRP B;  5IA7 A;  3DOW A;  2N4F A;  2CKH B;  3PT2 B;  3L54 A;  1IPG A;  1V9J A;  5D2M B;  3VTW A;  3PTF C;  3DVN V;  3VUX A;  1V81 A;  3L13 A;  2N1V A;  3W1Y A;  4W9J A;  2LZ6 A;  5EDS A;  2L3Z A;  3PGE A;  1NBF C;  4KIK B;  2BKR B;  3P2B A;  4II2 B;  2JRI B;  5DCN A;  2O2V A;  3UIO B;  3OJ3 A;  2DZI A;  2DYB A;  2IZV B;  2O6V A;  2J0J A;  4WWP A;  1WR1 A;  4CYE A;  1UD7 A;  3KH0 A;  3BIN A;  4KDL B;  1R4N I;  2I1K A;  4GXB A;  3M95 A;  3UF8 A;  2PE6 B;  5CHW A;  4PS8 A;  4G50 A;  5KHQ A;  3H6N A;  3SU8 X;  2BPS A;  4TV3 A;  1TGZ B;  3RT3 B;  3JSV A;  2KVR A;  4KDI C;  1KJT A;  3RUL A;  2B3A A;  4ZRI A;  2LRU A;  1WGG A;  4JGH B;  3TJP A;  4ANW A;  2J0M A;  2ZZP B;  3ZUN A;  4BKT A;  1WGY A;  2KTR A;  3R3M A;  3V6E B;  1WXV A;  4MH0 E;  4K7U A;  2XK5 B;  1H4R A;  2L76 A;  2KDI A;  4ZYN A;  3A9K B;  4IM0 A;  2ZVN A;  3QC8 B;  2MBO A;  2XBB C;  1E8Y A;  2I1J A;  4LJO B;  3LJ3 A;  4ZRK A;  3V6C B;  1EUV B;  4F8C B;  2KC1 A;  3S2A A;  2EMT A;  1LFD A;  1WXA A;  2C7H A;  4HJK A;  3Q3J A;  2KWU B;  3PHW B;  3H1U A;  4GOC A;  2LGD A;  4HDO A;  1WF9 A;  1E90 A;  4XC2 A;  4F1S A;  2D11 A;  1S3S G;  3D32 A;  5GMV A;  4A20 A;  3A1Q A;  3ZO5 B;  3VH4 B;  4DHZ B;  2BYE A;  3C0R B;  1WXS A;  1WJN A;  2KK8 A;  4GMV A;  3L16 A;  1WI0 A;  5J17 A;  2LJ5 A;  4K7W A;  1Q5W B;  4B6W A;  4PS7 A;  4WAA A;  2JXX A;  4FUL A;  2FCN A;  4ANV A;  4MDK E;  3CMM B;  1KLV A;  4URK A;  1SIF A;  2KNB A;  4OVU A;  2O6V D;  4FLH A;  2IBI B;  2VRR B;  1KOT A;  2KDB A;  4K1R B;  2A4Z A;  2KMC A;  2J7Q B;  3R66 C;  5BO4 B;  3ZDT A;  4HXD A;  3ZNH B;  1WFY A;  1I35 A;  1GUA B;  2FCS A;  4MJS B;  4I6P A;  3NZU A;  4E3C A;  2HE7 A;  4NJ6 A;  3ALB A;  2MBH A;  2K6Q A;  4GDK A;  4FA6 A;  4BVU C;  3DVG Y;  5LXH A;  2D07 B;  3QIJ A;  3PRE A;  3DBS A;  2MP2 B;  3B1L X;  4E71 A;  2KD0 A;  2ZCC A;  1I42 A;  1GC6 A;  2WWZ A;  4X57 B;  4ASW C;  1V80 A;  3H7P A;  3KYC D;  5CHF A;  2M0X A;  4W9E A;  2MW5 A;  2CU1 A;  1P1A A;  2BWF A;  4JLC A;  5J2R A;  3ZVV A;  1UH6 A;  4W9G A;  3OAW A;  4LJP B;  4TQ0 A;  4RM9 A;  3L0W B;  4GN1 A;  2NPT B;  2CS4 A;  1WYW B;  2KLG A;  2LAS A;  2LWP A;  2W9N A;  2KFJ A;  1WGH A;  2JZZ A;  3JYU A;  4IWP A;  4WQO B;  5C23 A;  3VHT C;  3WIM A;  2DAF A;  2PE9 A;  1HE8 A;  1SE9 A;  2V3S A;  2KQ7 A;  1V5T A;  4KZ0 A;  4RMA A;  3PRZ A;  2LVP A;  2KJ6 A;  3A9J B;  3ML9 A;  3SDL C;  1EO6 A;  4GDL B;  2NBV B;  3W1S A;  4HK2 A;  1E8Z A;  1NI2 A;  1WMH B;  2KDE B;  4OVV A;  2JY6 A;  1QZE A;  2ZVO A;  1L7Y A;  2R2Q A;  3QJZ A;  3KUC B;  2MA9 B;  3UIN B;  1OEY A;  3V62 A;  4HPL B;  3QAQ A;  5TR5 A;  1P9D U;  2FCM A;  4MSM B;  1YJ1 A;  2HD5 B;  3O65 B;  1ISN A;  1YX6 B;  3QWZ B;  2MBE A;  4WWO A;  1L2N A;  3GOE A;  3N30 A;  4EEW A;  1P0R A;  4HCN B;  5D94 A;  2DHZ A;  4GU2 A;  4M0W B;  2KTF A;  2KQS A;  3AU5 A;  4MGK E;  3U7D A;  3KYD D;  3HHM A;  1LQB A;  1WJ6 A;  4I6L B;  1CMX B;  4J6I A;  1RFA A;  3RYT A;  5E6P A;  2AL3 A;  5KHO A;  4W9I A;  3PLU A;  4AOF A;  4GSW A;  2C7M B;  2KKC A;  3ZTD A;  2JF5 A;  1D3Z A;  2FNJ B;  1LXD A;  2FCQ A;  2NVU I;  1Z2M A;  1BT0 A;  4FJY A;  4DDI D;  3PHX B;  1WE6 A;  2R2O A;  4HPM B;  2MBQ A;  2JRH A;  2KJH B;  1OGW A;  2KZR A;  4IUM B;  4NY0 A;  4WJP A;  4ICV A;  5DPW A;  1UZX B;  1X1M A;  1GJZ A;  3X23 A;  2KX3 A;  3M3J A;  4NAW A;  4EFO A;  3EEC A;  3HM6 X;  2QHO A;  2ZNV C;  1SGH A;  2L8J A;  4A3P A;  2N9X A;  2FID A;  1Z5S B;  1WX9 A;  3ML8 A;  3ZIM A;  4II3 B;  2DAJ A;  3T8M A;  1Y8R C;  5AEK B;  3TMP B;  2Z59 B;  1E7V A;  4IM3 A;  3WAN A;  4ICU A;  2C60 A;  2RD0 A;  2RR9 A;  5D7G A;  5LXI B;  1IP9 A;  2Y5B B;  4I6N B;  3B08 A;  2O2V B;  3HM3 A;  3JW0 X;  4PYU A;  2BYF A;  4EUT A;  2OOB B;  2O6V B;  2N9P C;  2DYM A;  2EKE C;  2K1F A;  4DDG D;  4MSQ B;  4GB9 A;  4LDT D;  3ZTC A;  3VUY A;  3ZNG C;  3A4S C;  3QA8 A;  3NS8 A;  3Q3F A;  1WJU A;  4M8M A;  2ZEQ A;  4W9H A;  5E6N A;  2AWT A;  3U8Z A;  2L0F A;  2ASQ A;  3AU4 A;  3DBL I;  4DHJ B;  1WM3 A;  3IHP C;  3JSV B;  3LDZ E;  3T9L A;  3UQA A;  1S1Q B;  4W9D A;  1WIA A;  2ZCB A;  2KLC A;  1F9J A;  3AUL A;  4LCD E;  4MGI E;  1G6J A;  2M4N A;  2WDT B;  3QCA A;  4IG7 B;  2CR5 A;  4W9K A;  2KJR A;  1V49 A;  2KTR B;  4JL9 A;  3U30 A;  3CSF A;  3ZKJ C;  3ZNZ B;  2KOX A;  2HTH A;  2GBK A;  2N1W A;  5DPS A;  1WM2 A;  5L95 C;  2N7E A;  3OJ4 B;  2YLM A;  2YVC A;  4HDQ A;  5E6O A;  5CX3 A;  2N9E B;  2NS5 A;  2MP2 A;  2IY1 B;  5CTR C;  2IY0 B;  1ZGU B;  3OLM D;  4KV2 A;  2J0K A;  3RCZ A;  1EF1 A;  1U4A A;  3EFU A;  4WJN A;  2KFK A;  2M8S A;  1UGM A;  4G0N B;  1J8C A;  2MSE D;  2JUO A;  4AP4 C;  4ANX A;  4GIV A;  4E74 A;  3H7S A;  3K9P B;  3ZW3 A;  2CHZ A;  2LRW A;  1TTN A;  5J18 A;  2G4D B;  2WX0 A;  4WJQ A;  4F7Z A;  2ZJD A;  2LXC A;  2JPH A;  2DEN B;  2WYQ A;  1EF5 A;  3IG3 A;  4FHJ A;  1PQS A;  1WGR A;  1XT9 B;  2KWV B;  2PEA A;  1WXM A;  3A9J A;  3IVF A;  4IWQ A;  4KVG B;  4FJZ A;  2RPQ A;  2RSU A;  5G55 A;  4A3O A;  5D6J B;  1WH3 A;  2LI5 A;  2G4S A;  2L05 A;  2IO1 B;  2MBB B;  4ANU A;  4WJO A;  1E8X A;  3KUZ A;  4PYZ A;  2K39 A;  5DPT A;  2PJH A;  3CF6 E;  3VXW A;  4EZL A;  3TCA A;  3PRM B;  1WX7 A;  2GMI C;  1J19 A;  3M62 B;  5L83 A;  3BY4 B;  1E5W A;  1OQY A;  3UQB A;  2MCN B;  1J0G A;  1E8W A;  2JZ3 B;  2KMA A;  3PSE B;  5CHV C;  3UIP B;  4CO7 A;  4EKU A;  1GG3 A;  2Z0E B;  3QHT A;  2LVO A;  3VVW B;  3DBR I;  3H7P B;  2CHX A;  1GC7 A;  3KW5 B;  4BFR A;  3VTV A;  2RGF A;  4KSK C;  2KAN A;  3L17 A;  2C9W B;  2LVQ A;  4DWF A;  3QK0 A;  4ZDV A;  5AZG A;  2EMS A;  1ZW7 A;  4NQL B;  2MQJ A;  4GGQ A;  4FN2 A;  4EZK A;  1Q1O A;  2WX1 A;  3EHV A;  2XEW A;  2D3G A;  4EZJ A;  1XQQ A;  4KIK A;  1T0Y A;  2K8C A;  4MGY E;  1R4M I;  2ZNV B;  1UBI A;  4PS3 A;  2L0T A;  3A33 B;  1ZKH A;  3DBH I;  3VUW A;  3APF A;  3IBE A;  1TZ1 A;  3TIX A;  3K9O B;  3AI5 A;  2K25 A;  5JH5 C;  4FBJ B;  3SD5 A;  3L10 B;  3RUI B;  3MHS D;  4MGZ E;  4MM3 A;  2IYD B;  2DZJ A;  4DBG A;  1C3T A;  1TBE A;  4HVB A;  5HKH A;  2KXJ A;  1YX5 B;  2NBW B;  5DPR A;  1C1Y B;  1H8C A;  2NCN A;  2N7D A;  2M1M A;  3R7R A;  3MTN B;  2IO0 B;  3NOB A;  4W9L A;  3RD2 A;  3JVZ X;  3ZRC A;  3ECI A;  4LDT B;  1V5O A;  5LLI A;  4DHZ E;  3UGB B;  2V4L A;  3ENE A;  1WZ3 A;  1V2Y A;  2BGF A;  3PLV A;  4P7I A;  5JHA A;  3QQ8 B;  3DQV A;  2KX0 A;  3MJW A;  1M94 A;  2XK5 A;  3PS6 A;  3TL5 A;  2G45 B;  5AZH A;  1RAX A;  5C1Z A;  3VH3 B;  3A9K A;  4BKG A;  5FR6 A;  3W1S C;  2NBU A;  4YL8 A;  1IYF A;  2LD9 A;  4NPN A;  1P98 A;  1Q0W B;  4AUQ C;  1WX8 A;  2MWS B;  3PPA A;  4HWI B;  4FAD A;  3WAM A;  3NY5 A;  4W9F A;  2LGX A;  2AL6 A;  3WAL A;  2BKF A;  1WY8 A;  1YD8 U;  3APC A;  3ZNI D;  2V1Y A;  4K81 A;  2GBN A;  2UWQ A;  3AXC A;  2MX2 A;  4K7S A;  1A5R A;  4NAW B;  2DYO A;  2OJR A;  4AJW A;  2FUH B;  2KO3 A;  3WAO A;  2BWE S;  2AYO B;  4JIO U;  4CHK A;  4BKS A;  1LM8 B;  3H9D A;  1YIW A;  3DVG X;  1WGD A;  4KZC A;  2K8H A;  3PVL A;  2D2Q A;  4XX5 A;  1OTR B;  4MEL A;  3L08 A;  4BBN F;  2LUE A;  3HIZ A;  4TQ1 A;  5JZE B;  1E7U A;  3KVF B;  1K8R B;  1FXT B;  3DVN U;  2M17 A;  2GOW A;  4MJS A;  2D10 A;  4NQK E;  4FHK A;  1WE7 A;  1VCB A;  3PV1 A;  3N32 A;  1UBQ A;  4NNJ B;  3DDC B;  4B95 A;  3B0A A;  2JWZ A;  4G11 A;  2FAZ A;  4NJ7 A;  4ZRJ A;  3NZS A;  1YQB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...