2KO3A

Nedd8 solution structure
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
76
structure length
76
Chain Sequence
MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALRGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 60th residues of ubiquitin and Nedd8 are located out of E2-binding surfaces, but are important for K48 ubiquitin-linkage.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords NEDD8
total genus 13
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2009-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2ko3A00
4CO7A 2RD0A 2IZVB 2ZZPB 2G45B 2ZEQA 3LDZE 4JIOU 4JQWC 3UF8A 4BOSC 1WGHA 2L76A 4B6WA 2L0FA 3JW0X 4IWPA 4HPMB 2JT4B 3VTUA 2KLGA 1YJ1A 2RGFA 3L08A 4FJZA 4PYZA 2MP2A 1UBQA 4GDKA 4WWOA 1WXAA 2ZPNA 3JYUA 3VAWA 2R2QA 4WWNA 3MHSD 4EKUA 3R7RA 4WJQA 3KH0A 2RSUA 3ZDTA 2DZMA 2D07B 5D2MB 1H4RA 3VXWA 1WJ4A 4DHZE 2LUEA 2OOBB 3DBSA 1H8CA 3VTWA 1ZGUB 3UGBB 3VFKA 1I42A 2KDEB 5J2RA 2PEAA 1LFDA 3DBLI 3M3JA 4JL9A 2V1YA 2NPTB 2V4LA 4IWQA 1M94A 4KDLB 4EZJA 3AULA 3UIOB 4PYUA 2MBBB 3H6NA 1LQBA 1WJUA 4K7UA 3DQVA 3L13A 3VDZA 4B95A 1J8CA 2JWZA 1WE7A 2KXJA 3M62B 1GUAB 2A4ZA 3C0RB 3GZNI 1MG8A 1NI2A 2KWCA 2NBVB 3ALBA 3KYDD 5L83A 2PJHA 3IHPC 4LJOB 4EOYA 2AWTA 1X1MA 2KWUB 3DBHI 4FULA 4HK2A 3UINB 3BINA 2HE7A 4MGKE 3L17A 3O65B 4FJVB 2I1JA 2GMIC 4OVVA 3H9DA 1WF9A 2N9EB 4RM8A 3WAPA 2BWFA 3NHEB 1E8XA 3PLVA 4W9DA 1K8RB 2LASA 3U7DA 2K6QA 2LI5A 1TTNA 2KJHB 4MH0E 4MSMB 2Z0EB 2D2QA 1IPGA 5AZFA 2W9NA 3DBRI 3QA8A 3TIXA 2J0MA 4ZDVA 3ZNGC 2JRIB 5LXHA 2MRPA 2O2VB 1EF1A 4K1RB 1CMXB 2L7RA 3UIPB 3WALA 1U4AA 2KDFB 2C7HA 3ZVVA 2AEHA 2FCMA 3PRZA 1WXSA 1Z5SB 2Z0DB 1L7YA 4BKSA 4GSWA 1WJ6A 3W1YA 2KDIA 2ZJDA 2MSED 4XX5A 3OJ4B 1TGZB 3LJ3A 4BOZB 4E71A 3A1QB 3Q3FA 1WMHB 2WDTB 3HM3A 2IO0B 4GXBA 2KN5A 2KQ7A 2O6VD 4LDTB 1GJZA 3R3MA 2IY0B 3SU8X 2YLMA 3QIJA 3A4RA 3PHXB 3W1SC 3JSVB 1WR6E 2FCQA 5G55A 2MQJA 3WA0A 2J0KA 2D11A 3GOEA 2KANA 3HK0A 1NBFC 3V62A 2G4DB 4IM3A 1AARA 4FN2A 4II3B 2WYQA 1UBIA 4TUUA 1G6JA 3CSTA 2K6DB 2C7MB 2MBHA 2GBMA 1YD8U 3APCA 4X57B 5D94A 2LD9A 3KUDB 4IG7B 1WIAA 3PGEA 2KOXA 3NOBA 2N1VA 1F9JA 4IWOA 1V5OA 1V6EA 2BGFA 3OJ3A 2DYMA 3IVFA 2REXA 2GBNA 2KMCA 2KVRA 3ZLZA 3HIZA 2G4SA 4HPLB 3TCAA 1E5WA 4F1SA 3TMPB 4HDOA 4EEWA 4DHZB 2LVQA 4LJPB 3ZW3A 3DVGY 3ONSA 4M8MA 2GBRA 1RFAA 5D6JB 2ZCBA 2NS5A 2BYVE 3A4SC 3SD5A 1R4NI 1GNUA 4I6LB 4YL8A 3T9LA 3WAOA 2JUOA 1WI0A 1Q0WB 1XQQA 2KTRA 2G3QB 3AI5A 3ZKJC 2J0JA 1S3SG 2N7DA 4XC2A 1WRDB 2DAFA 3ZRFA 1GC7A 4IM0A 2JPHA 1Q1OA 4E74A 1E90A 2DENB 2ZVOA 3QJZA 4HDQA 3BY4B 5KHQA 4AUQC 3EHVA 2MX2A 1E7UA 3TBLD 3MJWA 2EKEC 2M4NA 1IP9A 2FIDA 2N1WA 4E3CA 3M95A 3ZNID 3QX1A 4EFOA 2DYBA 2ZNVC 3KW5B 1YIWA 2LZ6A 3L10B 3R7QA 3I3TB 2KO3A 3ZTCA 1EO6A 3APFA 4DDGD 2ZPYA 4EUTA 4RMAA 3RD2A 3PLUA 4IW0A 5C23A 2BYFA 5CX3A 3VTVA 4LCDE 1P9DU 3L54A 2KFKA 2JRHA 3CF6E 2GBKA 3QAQA 1WMHA 1J0GA 5E6PA 4GDLB 2JY6A 3IBEA 4P7IA 1A5RA 2NPTA 3DVNU 2CHWA 2IO3B 4HCPB 3TL5A 2KTFA 1WYWB 3RCZA 2DHZA 1UZXB 2VRRB 4DHJB 2O6VB 1J19A 3S2AA 4W9KA 4KDIC 1YQBA 5IA7A 3H7PB 3PRMB 1ISNA 2IY1B 4KV2A 1RLFA 5GMVA 4KSLC 4FJYA 1RRBA 2PPHA 2WWZA 2MLBA 1VD2A 5CHVC 3SDLC 3VUXA 2IBIB 2FNJB 5LLIA 4F7ZA 2ZCCA 1OQYA 4KIKB 2V3SA 4A3PA 5J18A 2DAJA 1WJNA 3MTNB 3ML8A 4LDTD 2HD5B 4MJSB 2BKFA 2ZNVB 4BBNC 2CS4A 2MBQA 4ICUA 3B1LX 4JGHB 5LXIB 1TBEA 3ZNZB 3R66C 4KZ0A 3IFWB 1I35A 1KJTA 2D3GA 2EMTA 2NR2A 4AJYB 1JRUA 4WAAA 5DPWA 2AL3A 2CHXA 4IM2A 1KM7A 1XT9B 2BF8B 2YVCA 3A9KB 1Y8RC 3ML9A 2M17A 4FLHA 3VH3B 3PTFC 2UWQA 1EF5A 2CU1A 2KJRA 2IYDB 3DVNV 3QCAA 4G0NB 2RR9A 4KZCA 3AXCA 1XD3B 3N30A 3UQBA 2JXXA 1UH6A 2K1FA 2JZZA 2C9WB 5L95C 1OEYA 2LVPA 2KLCA 3NY5A 1WM2A 1P1AA 2N4FA 1E7VA 1E8WA 2DYOA 2I1KA 3D32A 2KJ6A 4M8NA 2CKHB 1WZ3A 2MCNB 3ZTDA 1WX7A 3P2BA 3H1UA 2DZIA 3X0WA 3HM6X 1YX6B 3PREA 1P98A 1Z2MA 2MBEA 4HCNB 3V61A 1OTRB 4W9LA 2UYZB 4TV3A 1D3ZA 2WX1A 4NPNA 2HJ8A 3APDA 3NZSA 1EUVB 2KZRA 4GDKB 4OVUA 3B0AA 5DPRA 3H7PA 2LXCA 2LRWA 3V60A 3EC8A 3RULA 3ZUNA 3AU4A 3A33B 2PE9A 1WZ0A 3WANA 1V49A 3QARA 1ZKHA 4M0WB 1WH3A 2HTHA 4GDLA 3HHMA 4ZYNA 2L3ZA 3ENEA 3PPAA 3L0WB 2A5UA 3OAWA 4MEMA 1S1QB 4W9CA 2K25A 4HLEA 4BFRA 1ZW7A 3K9OB 2FAZA 2FIFA 4W9IA 2OJRA 5DCNA 4GOCA 4BVUC 4MGZE 1NDDA 5CTRC 3KUCB 1OGWA 4IUMB 3RZWC 4FADA 1LXDA 4G3XB 2GOWA 3N32A 4G11A 4ICVA 5J17A 1VCBA 3PZDA 3RZFA 3VH4B 2LGXA 2L05A 3KYCD 5JZEB 3V6EB 4WJNA 2PE6B 2LGYA 1WE6A 4FA6A 1QZEA 3A1QA 2JZ3B 2DZKA 3CMMB 4JLCA 3NS8A 2LVOA 2M8SA 2KC1A 1P0RA 4DXAB 3IG3A 3PT2B 3X23A 4FBJB 2BWES 4NNJB 2KFJA 2QHOA 4HXDA 4PS3A 1PQSA 4AP4C 1E8YA 2KWVB 2LRUA 4URKA 1UD7A 2Y5BB 4PS7A 2K39A 5CHFA 4FHKA 4WWPA 1YX5B 3U8ZA 4ANVA 3A9KA 1WGYA 5DPSA 1E8ZA 1WY8A 3AU5A 5JHBA 5EDSA 2MWSB 4NQLB 5IAAC 2XBBC 2WX0A 3QC8B 3PS6A 3EFUA 4ASWC 2O6VA 2N7EA 2M0XA 5KHOA 2MW5A 1WM3A 4CHKA 4MGYE 4K81A 1R4MI 2BYEA 2FUHB 4MELA 1WXVA 4BKGA 4DBGA 1Q5WB 1TZ1A 2RPQA 2NVUI 2DZJA 2KHWB 4N9F4 1SGHA 4WJOA 3KUZA 3QWZB 3WAMA 4MDKE 3H7SA 5FR6A 2FCSA 5JH5C 4HWIB 5DPTA 1L2NA 1P3QU 1WXMA 2LXAA 4MJSA 2KKCA 2C5LC 4G50A 2LJ5A 1KLVA 1WGGA 3KVFB 4GN1A 2BPSA 3DCGA 4GIVA 3CSFA 3PVLA 3ZNHB 3L16A 2EMSA 4ANUA 1WGDA 4CYEA 5E6NA 2MBOA 1V9JA 2KC2A 5C1ZA 1SE9A 4K7SA 2XEWA 3B08A 2BKRB 3U30A 4II2B 4IC7B 2C7NB 1T0YA 3V6CB 2ASQA 2KX0A 4ANWA 4DHJD 2LGDA 4TQ1A 4MSQB 2DX5B 5TR5A 3ZDMC 1BT0A 3QK0A 2GBJA 4DK5A 4W9FA 1WR1A 2KTRB 2M1MA 1SIFA 3QQ8B 3TJPA 4EZKA 3DOWA 2AYOB 4ZRKA 4AOFA 4EZLA 3PSEB 2CHZA 3VQIA 5AEKB 4FHJA 2IO1B 3M63B 1GC6A 5BO4B 4ZRIA 2JF5A 4W9HA 3PRPB 3RUIB 1RAXA 2FCNA 5E6OA 2KMAA 2LWPA 2MP2B 2MA9B 4GU2A 2K8HA 1WX9A 4NJ6A 4BKTA 4DWFA 5AZGA 4W9EA 1C1YB 3JSVA 2KFKB 1GG3A 1UGMA 2L8JA 2KX3A 2L0TA 3ECIA 3OLMD 3VVWB 3ZO5B 4XZ4A 2J7QB 4MGIE 4NY0A 3PHWB 5HKHA 2K8BA 3EECA 4AWJA 2KQSA 4I6PA 1V81A 1V5TA 4KSKC 4BBNF 2CR5A 3QHTA 2XK5A 2KK8A 2KD0A 3JVZX 4PS8A 4WJPA 1IYFA 2C60A 4KIKA 2L00B 2NBWB 2R2OA 2JVCA 4GGQA 5AZHA 3WIMA 4J6IA 3Q3JA 3DVGX 4WQOB 1KOTA 2N9XA 2D10A 2KNBA 5JHAA 1V2YA 4NAWB 1OEYJ 3VUWA 2KDBA 2Z59B 3RT3B 4TKNA 4RM9A 4GB9A 4NQKE 1LM8B 3VHTC 1UELA 1FXTB 4HVBA 2NCNA 1HE8A 1V80A 3DPDA 4HJKA 3W1SA 4TQ0A 4W9JA 4BKSD 2XK5B 4NJ7A 2B3AA 5D7GA 1WGRA 1V86A 3DDCB 3T8MA 1C3TA 4NAWA 1WFYA 4W9GA 2K8CA 4ZRJA 5CHWA 3UQAA 2O2VA 3ZIMA 3ZRCA 3PV1A 4DDID 1WX8A 2NBUA 4I6NB 4ANXA 3K9PB 4B9KA 3NZUA 2AL6A 4KVGB 2IO2B 5G2NA 4A20A 4A3OA 3SHQA 4GMVA 4AJWA 3A9JA 4K7WA 3N3KB 3RYTA 4MM3A 3A9JB 2N9PC 3VUYA 2ZVNA 4F8CB
chains in the Genus database with same CATH superfamily
3LDZE 2G45B 2LMCA 2LUMA 3JW0X 4IWPA 4HPMB 1SIJA 3FILA 3VTUA 2RGFA 2WP9B 3L08A 3U52E 1UBQA 4GDKA 4REZA 1WXAA 2ZPNA 3VAWA 4WWNA 4RF0A 4EKUA 4KKJA 4ACFA 1B1ZA 2DZMA 3DHGC 1WJ4A 4IOIE 1H8CA 3VTWA 1ZGUB 1I42A 3DBLI 3ZLZA 2KQ4X 3DHIC 3PZ8A 2NPTB 2X38A 2MBBB 3H6NA 4K7UA 3L13A 4B95A 1J8CA 2JWZA 5BYSA 5EE0A 1PGBA 2NBVB 1IBXA 1OQQA 1YMHE 2RMMA 3B2GA 2JYTA 3DBHI 4HK2A 3V3XA 1TS5A 2E6XA 3MP9A 3WAPA 2BWFA 2HJ1A 4W9DA 1VR9A 1MI0A 2LASA 2K6QA 2YEPF 2KJHB 2WGSA 3ZNGC 4M02A 4YXDB 3MJ5A 2L7RA 3UIPB 1V1PB 4NZLB 1MHXA 3PRZA 1WXSA 3RNEC 1I4PA 3BK2A 3NS1A 2KDIA 2OEDA 2MSED 4J3OD 4XX5A 3OJ4B 1TGZB 4BOZB 4A55A 1ZDXA 1ROEA 3A1QB 3R2IA 1QQRA 1HA5A 3RNFC 2NMQA 1IUEA 3IT6B 2FE8A 3BYYB 3SU8X 3A4RA 3Q3NC 1GB1A 2MQJA 3WA0A 3GOEA 2KANA 3AE1B 1NBFC 4FN2A 1D4BA 1PGXA 3P4QB 2C7MB 2X8XX 1C76A 2HDEA 1V5OA 3P63A 1M4VA 3AE5B 3HIZA 4F1SA 4HDOA 4DHZB 3DVGY 3TEWA 3ONSA 2BYVE 4B0EA 2PVOD 1GNUA 5LNK1 3FC4A 2H88B 2G3QB 1S3SG 1WRDB 3ZRFA 1V1PA 2JPHA 1Q1OA 1E90A 3IXSA 2W3SA 3QJZA 4HDQA 5KHQA 3EHVA 3Q8FA 2JX5A 3M95A 4A90A 4EFOA 2LHDA 2ZNVC 1TY0A 2I2YA 3ZJUA 3R7QA 2W3RA 1EO6A 4DDGD 2IGGA 4EUTA 4CQNA 4KGRA 2BYFA 3KQ4A 2KFKA 3CF6E 2GBKA 3FKYA 3QAQA 1V8CA 3NUHB 2JY6A 4XE0A 4P7IA 1A5RA 4N6EB 2IO3B 4HCPB 1L6VA 2KTFA 4Q2JA 3RCZA 3RI7C 3S2AA 1J19A 1YOVB 4KDIC 2VH1A 2IY1B 1RLFA 2QJLA 3SDLC 2IBIB 1NYRA 3AE3B 1XO3A 1E9MA 4HJGE 2V3SA 5J18A 1WJNA 3ZGZA 1SEBD 3ML8A 4BBNC 2AX5A 1YJJA 2V3PA 4YT0B 4JGHB 2CU3A 2RDHA 1VZ6A 2PTLA 4L2YA 2D3GA 3SR6A 4WAAA 1DGJA 2CHXA 1JALA 1KM7A 4IM2A 2YVCA 3A9KB 1Y8RC 3LXFA 2IYDB 3B9JA 1AWDA 2Y5PA 1GB4A 3AXCA 1XD3B 2JXXA 2K1FA 2JZZA 5L95C 2LVPA 2K5PA 3BK1A 5BYRA 2DNFA 2KVZA 3D32A 3P1MA 2PLPA 3HM6X 1NVID 1YX6B 2INDC 4HCNB 1P98A 1Z2MA 2IGDA 1E10A 1OTRB 2UYZB 1CK1A 2HJ8A 1ENFA 2LHEA 3H7PA 2NTSA 3RULA 3ZUNA 4N58A 2PE9A 1SB3C 4M0WB 1WH3A 3AM9A 3ENEA 2WXGA 2K25A 5BMHA 4BFRA 1ZW7A 2FAZA 1FO4A 4IUMB 1OGWA 3RZWC 4G11A 3NG0A 1N5WA 3VH4B 2GRIA 4P1CC 2WXQA 2I38A 2PE6B 2LGYA 4JLCA 2JZ3B 1QOGA 1NI3A 2M8SA 4ZOHC 2RPVA 2INNE 4DXAB 2WDVB 1NYQA 4AP4C 4HXDA 1PQSA 1C4AA 5CHFA 4LTUA 1UNSA 3N1XC 1E8ZA 1WY8A 5EDSA 2XBBC 1D5MC 3EFUA 2O6VA 1FMAD 2M0XA 4DQOC 5KHOA 2MW5A 1QOBA 1Q5WB 1YN3A 2NVUI 2RPQA 4N9F4 2KYWA 3KUZA 3QWZB 3H7SA 5FR6A 2BW2A 1P3QU 1WXMA 2LXAA 2LJ5A 3P4RB 3LYYA 3FAHA 3L16A 2V9HA 3NVVA 4CYEA 4ITKA 3B08A 1JRPA 2WXMA 2C7NB 3V6CB 4YSYB 1ESFA 2KX0A 5EE3A 2LGDA 3FILB 1JWSD 3QK0A 3MC8A 1FM0D 2WXHA 4W9FA 3NZ3A 2KTRB 3QQ8B 4NAMA 4ZRKA 2CHZA 1C9FA 1KRHA 2IO1B 3M63B 2BS3B 1VLBA 4C56C 3RN9C 1RAXA 2MA9B 1EM7A 3NVZA 1WSPA 4K3BA 4WAFA 4BKTA 4EE2A 2L8JA 1P7EA 2L0TA 4LK0M 3OLMD 1FNVA 5HKHA 3PHWB 3EECA 2KQSA 3WCQA 2CR5A 2YEPB 2KK8A 4PS8A 1GPXA 5AZHA 2L00B 2NBWB 2V0GA 5JHAA 1K52A 3U7ZA 3VUWA 2Z59B 3NVYA 3C19A 3N20C 1I4XA 4GB9A 1LM8B 3VHTC 2NCNA 3GZNB 1V80A 1FEHA 1FRDA 3T8MA 2J53A 2ONQA 4W9GA 1ZXIA 3SFDB 5FKAC 1JWMD 1RM6C 4JX1C 3PV1A 1E0ZA 1WX8A 4ANXA 3R8BA 2INPE 3NZUA 4B9KA 4XWWA 1K51A 5HI1A 4KVGB 2PVGC 2IO2B 3SHQA 3W9CB 4K7WA 2ZVNA 2RD0A 2ZZPB 4BOSC 1ET9A 3IAM1 4B6WA 4FJZA 1GAQB 3JYUA 4WURA 2INCC 4WJQA 2RSUA 5HG2A 1QF6A 1YN5A 1HZ6A 1ACCA 4DHZE 2FUG1 2Y3AA 1ZPSA 3UGBB 2KDEB 2PEAA 4IWQA 4EZJA 4KDLB 3AULA 4PYUA 4LLGM 1LQBA 1WJUA 4OHJA 3LB8C 1QKZA 1C79A 1GUAB 2A4ZA 3UI3A 3KYDD 3ALBA 5L83A 3IHPC 4LJOB 4EOYA 1X1MA 4FULA 2HTME 3UINB 1J7CA 2HE7A 2K22A 1L4ZB 4ZHPA 2PKOA 3O65B 4FJVB 2I1JA 2GMIC 3NVWA 4OVVA 3E56A 3H9DA 2WXOA 4XDDA 3PLVA 2LI5A 1TS4A 1TTNA 4MSMB 1YJIA 3DBRI 2J0MA 4ZDVA 1NENB 1I4RA 2O2VB 4K1RB 1CMXB 3SFEB 3WALA 3ZVVA 1MHHE 2Q5WD 2Z0DB 1VZ8A 1WJ6A 2ZJDA 3LJ3A 4H2AA 2JZPA 3HM3A 2IO0B 4GXBA 1YNTE 2KQ7A 2O6VD 1GJZA 2WXKA 3SEBA 3RNGC 4LNOA 3JSVB 1L0VB 2D11A 2J52A 3HK0A 3V62A 4IM3A 4II3B 4TUUA 1UBIA 1G6JA 3GP7A 1GOZA 5HFYA 4X57B 5D94A 4D2KA 5BYQA 1WIAA 3PGEA 3AEBB 1D6EC 3NOBA 1V6EA 2BGFA 4RF1A 2DYMA 1KFYB 2REXA 2GBNA 1V97A 2G4SA 4HPLB 3EUB2 5H92C 1MVKA 1XCTL 1RFAA 2ZCBA 3A4SC 3WAOA 2WXPA 1WI0A 3ZKJC 2QC8A 3AI5A 4RH6A 2N7DA 1K53A 4IM0A 2ZVOA 4M01A 3AE8B 1XLPA 3GE8C 4JWSC 2EKEC 2FIDA 2N1WA 3QX1A 3PO0A 1YIWA 1J7BA 3ZTCA 5G5GA 2ZPYA 4JPSA 2AQ3B 3OG5A 2JRHA 1L6UA 3IBEA 1N5XA 2NPTA 4HPPA 3DVNU 4K3CA 2O6VB 3AEDB 4W9KA 3PRMB 2L1AA 4KSLC 1RRBA 2WWZA 1SXTA 2W82A 2M0AA 4F7ZA 1WWTA 3ZYYX 1F2RC 4C4VA 1QLBB 2CS4A 2MJEA 3PZ7A 3ZNZB 4KZ0A 3Q14C 1KJTA 2AL3A 2G9HD 2MEKA 4MM3B 3ML9A 1EF5A 2KJRA 3DVNV 3W5UB 4G0NB 1KLGD 1PGAA 3EGRA 1LGRA 4MH8A 2KDMA 2C9WB 1WM2A 4MT5A 1P1AA 1TZOA 3T3NA 1VRAB 1E8WA 2I1KA 2IJ0A 3ZTDA 1WZ3A 3T3OA 1WX7A 3P2BA 3H1UA 2DZIA 3X0WA 3V61A 4JE3B 1D3ZA 1EUVB 2WU5B 5DPRA 4R3DA 3AU4A 3QARA 4ZYNA 1KLUD 2L3ZA 3PPAA 4DXGA 4MEMA 1S1QB 4HLEA 3AE2B 4BAXA 4W9IA 2BTEA 2OJRA 2WXIA 3DWMA 4HEA1 4MGZE 1NDDA 1LXDA 1UGJA 4G3XB 2GOWA 3N32A 3PZDA 2LGXA 4OZBA 1MG4A 1T3QA 2L05A 3KYCD 1RFKA 3V6EB 4FA6A 1WE6A 5AUKA 1QZEA 3A1QA 2DZKA 3ETRA 4M00A 2LVOA 2BWES 3H8HA 2OJWA 4PS3A 2KWVB 2LRUA 1UD7A 2Y5BB 3Q2AC 2LGIA 1I4QA 4FHKA 1EU3A 3V05A 1JROA 1WGYA 5DPSA 5JHBA 3PS6A 1F1HA 3BWUD 1VJKA 2N7EA 2BQQA 1FXAA 2JYEA 4MGYE 4CHKA 4K81A 2BYEA 2FUHB 1WXVA 4HRSA 4QAYA 2JQRB 1TZ1A 4RCOA 1TS3A 2MJ3A 2FCSA 5C2TB 3U4EG 4LNFA 2C5LC 4G50A 4C4VB 4US9A 3DCGA 4GIVA 3PVLA 4ZHOA 4ANUA 3GB1A 1N61A 5E6NA 1UWMA 1XF5L 1SE9A 2XEWA 1SSNA 2G1EA 3U30A 4II2B 3KLSX 2E3TA 2ASQA 4ANWA 3RNBC 4MSQB 1FCLA 2MJDA 4EZKA 3DOWA 2N9KA 2AYOB 3U2SC 3RNAC 3AE4B 2FCNA 4GU2A 2L83A 2Y5CA 4PK1A 3R2TA 1C1YB 1SE2A 1A70A 2GLSA 1L4DB 4A9AA 2ZW0A 4YTMB 4YTPB 3ECIA 3VVWB 3ZO5B 4MGIE 2K8BA 1WXQA 4WJPA 2KD0A 1Q10A 1IYFA 4GGQA 1KOTA 3Q3JA 2KNBA 1V2YA 1OEYJ 1PUTA 2KDBA 2BYTA 1UF0A 5BMIA 4NQKE 4ARIA 1UELA 1ZUD2 1JMLA 1HE8A 2B76B 3DPDA 1FPYA 4HJKA 1FRRA 4W9JA 4BKSD 4NJ7A 5D7GA 3VR8B 3BZDB 1C3TA 1QOFA 1V1OA 1WFYA 1QOAA 5CHWA 4KGTA 3ZRCA 2NBUA 4S0RA 2AL6A 5G2NA 4A3OA 1TKGA 4AJWA 3N3KB 4RNAA 3VUYA 4CO7A 2IZVB 4JQWC 5IOIA 2KLGA 4PYZA 4WWOA 2R2QA 3AE7B 2QILA 3R7RA 3Q8AA 3ZDTA 2LGSA 3VXWA 2LUEA 2OOBB 2ACZB 3AMZA 3VFKA 1LFDA 3M3JA 2V1YA 1M94A 3UIOB 1E6EB 3VDZA 1WE7A 2KXJA 3M62B 3C0RB 3GZNI 1NI2A 2PJHA 1KTKA 2AWTA 1FIQA 2WLBA 4MGKE 2K9XA 2WDQB 1HEZE 1WF9A 1XXGA 2IPKD 4GLSC 1K8RB 1XLNA 2D2QA 3AH7A 3EFCA 2K0PA 3AB5A 2W9NA 1U4AA 2C7HA 2RDGA 2FCMA 2JSVX 3DBHB 1Z5SB 2XNAC 3BIID 4GSWA 3ABVB 5TSSA 4C7ZA 4E71A 1WMHB 3R3MA 2IY0B 4IDIA 3DBLB 3QIJA 1I7HA 3PHXB 5H8YE 2FCQA 4TSSA 5G55A 1AW7A 1IGDA 1C77A 2J0KA 1SBBB 1AARA 2K3UA 5T8IA 1HQRD 1PDXA 2MBHA 1YD8U 5D3DA 4KX6B 2IGHA 2N1VA 1F9JA 2SAKA 3RPFC 3IVFA 3TCAA 3EA6A 1E5WA 1HZ5A 1D5XC 4EEWA 4LJPB 1QILA 3ZW3A 2D3AA 1TT5B 2NS5A 1R4NI 4I6LB 4YL8A 4WWMA 4MACA 3AEEB 1Q0WB 2J0JA 3DBRB 4XC2A 2DAFA 1GC7A 2DENB 1EWCA 4AUQC 1FFUA 2MX2A 2V3NA 3TBLD 3MJWA 2M4NA 1IP9A 4E3CA 3ZNID 3ZXRA 2DYBA 3KW5B 1JCKB 2R61A 3L10B 3NRZA 2PW9A 3I3TB 3MHZA 4RMAA 1VDVA 3RD2A 4IW0A 5C23A 5CX3A 4LCDE 1P9DU 3L54A 4JWUC 1J0GA 4GDLB 2CHWA 4C00A 2ZW1A 1WYWB 2DHZA 3Q3OC 5E6JA 1XCQL 4DHJB 5GXGB 2WXLA 3KWVA 1BXTA 1YQBA 3H7PB 1ISNA 2MLBA 2BVCA 5CHVC 4P6VF 3VUXA 5LLIA 2ZCCA 2FBWB 1OQYA 4KIKB 2WNMA 1TY2A 2IDYA 3MTNB 4LDTD 2HD5B 2DBYA 1DOIA 2BKFA 2ZNVB 1XEEA 4ICUA 3VRAB 1TBEA 3R66C 3IT4B 3N1ZC 2EMTA 1F77A 2BF8B 3GS2A 2UWQA 1NEKB 4KZCA 3N30A 1OEYA 3NY5A 2N4FA 2MCNB 4M8NA 2KJ6A 3Q6BA 4W9LA 2LJIA 2WX1A 3APDA 4UDUC 3NZSA 4OVUA 4GDKB 2LXCA 4YWGG 2EKIA 1TJEA 1FCCC 3V60A 2MH7A 3EC8A 1WZ0A 1C4CA 1ZP0B 5HHDG 2HTHA 3HHMA 2DLBA 2M56B 3L0WB 3RNCC 4W9CA 1BMLC 2JXTA 3DHHC 2TSSA 1R7SA 4FADA 4ICVA 4USAA 5J17A 1VCBA 3HVZA 3P4PB 1C4PA 1MJDA 3BVGA 4WJNA 5C3JB 3AE6B 4US8A 3CMMB 3HRDD 1P0RA 1MPEA 3X23A 4FBJB 2QSDA 1E8YA 1RYJA 3MFGA 2KN4A 4PS7A 3TEYA 2BS4B 2KAJA 4WWPA 1E7PB 1YX5B 5FR3A 1WM3A 4HROA 4BKGA 4DBGA 1TYGB 3ZJVA 1DOYA 2KHWB 4WJOA 1SE4A 1SF0A 1IBXB 4RGNA 5DPTA 1AN8A 4MJSA 5IO9A 1AYFA 3KVFB 4GN1A 1I4HA 2BPSA 3CSFA 4XGAB 1RWSA 3I5JC 2MBOA 5C1ZA 4K7SA 3P42A 2D3BA 3HUIA 1L0YB 4IC7B 1SJED 1T0YA 4TQ1A 1STEA 5TR5A 5JXVA 1WR1A 3AECB 3TSSA 1CJEA 1HXYD 1XLOA 3VQIA 3CIRB 4TMAB 1GC6A 5BO4B 3PRPB 3RUIB 2L52A 2NTTA 4XDCA 5E6OA 1UUPA 2MP2B 1WX9A 4NJ6A 5EE9A 5AZGA 2Z8LA 1JWBD 2N0SB 3JSVA 2KFKB 1GG3A 2KX3A 2WXFA 4YSZB 1N62A 4AWJA 2UU7A 1EWYC 1V5TA 3QHTA 1I35A 3JVZX 2C60A 2R2OA 2CJNA 3WIMA 5I4DA 4J6IA 3DVGX 4C80A 4YSXB 4HKQA 3I57A 2D10A 2D3CA 3RT3B 4RM9A 3Q8EA 1FXTB 1EU4A 3W1SA 2GB1A 4B0MA 3AEFB 2JWUA 3Q3MC 3ZXVA 4ZRJA 4C7YA 1IGCA 4A8XC 3ZIMA 2EELA 3K9PB 4NJCA 1L0XB 3NJTA 4GMVA 4PT5A 1MFWA 4DXFA 3RYTA 3A9JB 4F8CB 3UF8A 3IAS1 2ZEQA 4JIOU 1WGHA 2L76A 2L0FA 2JT4B 1YJ1A 2MP2A 4AS1A 2WU2B 3MHSD 3KH0A 1UWXA 3MC9A 2D07B 1VZ7A 2GI9A 5D2MB 2ICIA 1H4RA 5MPOA 3DBSA 2DWQA 1XLQA 5J2RA 4JL9A 2V4LA 1YQ4B 4FXCA 3DQVA 4HKZE 1KLVA 1MG8A 2KWCA 1SE3A 2M19A 2KWUB 1TS2A 3BINA 3L17A 3O13A 1OQRA 1T0QC 2N9EB 4RM8A 3BYTB 5IP4D 3NHEB 1E8XA 1ET6A 3L4PA 2WXJA 3U7DA 1B9RA 4MH0E 4BZAA 2Z0EB 1IPGA 1FD6A 4RFBA 2WQYB 5AZFA 3QA8A 1JQ4A 2BBCA 4XYCA 3TIXA 4L1BA 1TIFA 2JRIB 5D3IB 5LXHA 2MRPA 1N63A 1EF1A 4P1BC 2KDFB 5G5HA 2AEHA 2QIEB 4BKSA 1L7YA 4XWTA 2W54A 3W1YA 3W2DA 1K50A 3Q3FA 2WDTB 1KH0A 4ARCA 2KN5A 4YTNB 4LDTB 3URYA 4AQ7A 1J7AA 4ZRPA 1CZPA 1LO5D 2YLMA 1FFVA 1QT9A 3W1SC 1WR6E 2PIAA 2KWDA 1JWUD 1HTQA 3VRBB 3AV8A 2G4DB 2SEBD 1HTOA 1F2RI 2WYQA 3AEGB 1FNUA 2J4XA 3CSTA 2K6DB 3DWGC 2GBMA 2L32A 3APCA 2KACA 2J42A 2BT6A 2LD9A 3KUDB 4IG7B 1ZE3D 2KOXA 4IWOA 3OJ3A 3VR9B 2KMCA 3BVMA 2KVRA 4A6QA 3TMPB 2AQ2B 4IKGA 2LVQA 1P7FA 4M8MA 2GBRA 5D6JB 3SD5A 1T0RC 3T9LA 3AEAB 2JUOA 4OW0A 1XQQA 4S17A 2KTRA 2MHJA 1T0SC 4RGTA 1YQ3B 4E74A 3C8YA 5IN7A 3BY4B 2KT7A 1R4MB 1E7UA 3I9V1 1PYWD 3OWEB 1JWAD 2LZ6A 3TUOA 2KO3A 3APFA 1N60A 2QDFA 3PLUA 3VTVA 4P16A 3RFZB 3I63C 1ZDVA 1WMHA 5E6PA 3TEZA 1OFFA 3TL5A 2OHFA 5BMGA 1UZXB 2VRRB 1YN4A 2AQ1B 5IA7A 4KV2A 5GMVA 4FJYA 2PPHA 1VD2A 1CQVA 2FNJB 4O1NA 3B2FA 4A3PA 2DAJA 1DYQA 4MJSB 4KGSA 2WXRA 2VZKB 2MBQA 3B1LX 5LXIB 1C78A 3IFWB 2WXNA 5EE1A 2NR2A 4AJYB 1JRUA 5DPWA 4OVZA 4KKIA 1XT9B 3AN1A 2M17A 4FLHA 3VH3B 3PTFC 2CU1A 3QCAA 2RDBC 2RR9A 5FK9C 3UQBA 1UH6A 2KLCA 1WGKA 4WH4A 1E7VA 2DYOA 3ZQ4A 2CKHB 2PMVA 3W5VB 3Q8CA 1Y56A 3PREA 4N59A 2MBEA 4TV3A 4RGMA 4NPNA 2KZRA 2VH2A 3B0AA 4WIPA 2LRWA 3A33B 3WANA 1V49A 1ZKHA 4GDLA 2D5GA 2A5UA 3OAWA 3K9OB 1BUIC 1F0ZA 2FIFA 1WRIA 5DCNA 4GOCA 4BVUC 1DOXA 5CTRC 3KUCB 3RZFA 2V4IB 4RGOS 1JW9D 5JZEB 3P4SB 4ZYSA 3TEXA 3N9YC 4WQMA 1N6ZA 3NS8A 2KMMA 2KC1A 3IG3A 3PT2B 2BS2B 4LNKA 3CWIA 2KFJA 2QHOA 4NNJB 4URKA 2K39A 3U8ZA 4ANVA 3A9KA 2QEJC 3AU5A 2MWSB 4NQLB 5IAAC 1T6BX 2WX0A 3QC8B 5AUIA 4ASWC 3N1YC 1R4MI 4MELA 1ZXHA 2LFIA 2DZJA 1SGHA 3WAMA 4MDKE 5JH5C 4HWIB 1L2NA 2N7JA 2KKCA 3Q69A 1WGGA 3J9CA 3ZNHB 2EMSA 1WGDA 1TKEA 4M0WA 2KC2A 1V9JA 2BKRB 1ZOYB 4DHJD 2DX5B 3ZDMC 1KF6B 1BT0A 1FNWA 2GBJA 4DK5A 2M1MA 1I4GA 1SIFA 3TJPA 1T5XD 4EZLA 5AEKB 4AOFA 3PSEB 2N9LA 2LEKA 2QCZA 3KWLA 4FHJA 2BB6A 4ZRIA 2JF5A 4W9HA 3ZJTA 2KMAA 2CJOA 2LWPA 1FXIA 4OZAA 1PFDA 2K8HA 4DWFA 4L23A 4W9EA 3MC0B 1UGMA 3HVDA 4XZ4A 2J7QB 4NY0A 4KSKC 4I6PA 1V81A 4BBNF 2VZKD 2XK5A 2WDRB 4KIKA 2JVCA 2W55A 4WQOB 2N9XA 5IKCM 4NAWB 1D5ZC 4OZCA 4TKNA 2XN9C 2JU6X 1TKYA 3GE3C 4HVBA 1WYGA 4TQ0A 2BB5A 2XK5B 2B3AA 1WGRA 1V86A 3DDCB 3BVZA 1F52A 3RMKC 1SJHD 4NAWA 1R4NB 3AE9B 2K8CA 2WHIA 2H89B 2ON8A 3Q8BA 4LNNA 2O2VA 3UQAA 4DDID 1L5PA 4I6NB 4ZRQA 2WS3B 4A20A 3A9JA 3E9SA 2QMTA 4MM3A 2N9PC 4LNIA
chains in the Genus database with same CATH topology
4CO7A 2RD0A 2IZVB 2ZZPB 2G45B 2ZEQA 3LDZE 4JIOU 4JQWC 3UF8A 4BOSC 1WGHA 2L76A 4B6WA 2L0FA 3JW0X 4IWPA 4HPMB 2JT4B 3VTUA 2KLGA 1YJ1A 2RGFA 3L08A 4FJZA 4PYZA 2MP2A 1UBQA 4GDKA 4WWOA 1WXAA 2ZPNA 3JYUA 3VAWA 2R2QA 4WWNA 3MHSD 4EKUA 3R7RA 4WJQA 3KH0A 2RSUA 3ZDTA 2DZMA 2D07B 5D2MB 1H4RA 3VXWA 1WJ4A 4DHZE 2LUEA 2OOBB 3DBSA 1H8CA 3VTWA 1ZGUB 3UGBB 3VFKA 1I42A 2KDEB 5J2RA 2PEAA 1LFDA 3DBLI 3M3JA 4JL9A 2V1YA 2NPTB 2V4LA 4IWQA 1M94A 4KDLB 4EZJA 3AULA 3UIOB 4PYUA 2MBBB 3H6NA 1LQBA 1WJUA 4K7UA 3DQVA 3L13A 3VDZA 4B95A 1J8CA 2JWZA 1WE7A 2KXJA 3M62B 1GUAB 2A4ZA 3C0RB 3GZNI 1MG8A 1NI2A 2KWCA 2NBVB 3ALBA 3KYDD 5L83A 2PJHA 3IHPC 4LJOB 4EOYA 2AWTA 1X1MA 2KWUB 3DBHI 4FULA 4HK2A 3UINB 3BINA 2HE7A 4MGKE 3L17A 3O65B 4FJVB 2I1JA 2GMIC 4OVVA 3H9DA 1WF9A 2N9EB 4RM8A 3WAPA 2BWFA 3NHEB 1E8XA 3PLVA 4W9DA 1K8RB 2LASA 3U7DA 2K6QA 2LI5A 1TTNA 2KJHB 4MH0E 4MSMB 2Z0EB 2D2QA 1IPGA 5AZFA 2W9NA 3DBRI 3QA8A 3TIXA 2J0MA 4ZDVA 3ZNGC 2JRIB 5LXHA 2MRPA 2O2VB 1EF1A 4K1RB 1CMXB 2L7RA 3UIPB 3WALA 1U4AA 2KDFB 2C7HA 3ZVVA 2AEHA 2FCMA 3PRZA 1WXSA 1Z5SB 2Z0DB 1L7YA 4BKSA 4GSWA 1WJ6A 3W1YA 2KDIA 2ZJDA 2MSED 4XX5A 3OJ4B 1TGZB 3LJ3A 4BOZB 4E71A 3A1QB 3Q3FA 1WMHB 2WDTB 3HM3A 2IO0B 4GXBA 2KN5A 2KQ7A 2O6VD 4LDTB 1GJZA 3R3MA 2IY0B 3SU8X 2YLMA 3QIJA 3A4RA 3PHXB 3W1SC 3JSVB 1WR6E 2FCQA 5G55A 2MQJA 3WA0A 2J0KA 2D11A 3GOEA 2KANA 3HK0A 1NBFC 3V62A 2G4DB 4IM3A 1AARA 4FN2A 4II3B 2WYQA 1UBIA 4TUUA 1G6JA 3CSTA 2K6DB 2C7MB 2MBHA 2GBMA 1YD8U 3APCA 4X57B 5D94A 2LD9A 3KUDB 4IG7B 1WIAA 3PGEA 2KOXA 3NOBA 2N1VA 1F9JA 4IWOA 1V5OA 1V6EA 2BGFA 3OJ3A 2DYMA 3IVFA 2REXA 2GBNA 2KMCA 2KVRA 3ZLZA 3HIZA 2G4SA 4HPLB 3TCAA 1E5WA 4F1SA 3TMPB 4HDOA 4EEWA 4DHZB 2LVQA 4LJPB 3ZW3A 3DVGY 3ONSA 4M8MA 2GBRA 1RFAA 5D6JB 2ZCBA 2NS5A 2BYVE 3A4SC 3SD5A 1R4NI 1GNUA 4I6LB 4YL8A 3T9LA 3WAOA 2JUOA 1WI0A 1Q0WB 1XQQA 2KTRA 2G3QB 3AI5A 3ZKJC 2J0JA 1S3SG 2N7DA 4XC2A 1WRDB 2DAFA 3ZRFA 1GC7A 4IM0A 2JPHA 1Q1OA 4E74A 1E90A 2DENB 2ZVOA 3QJZA 4HDQA 3BY4B 5KHQA 4AUQC 3EHVA 2MX2A 1E7UA 3TBLD 3MJWA 2EKEC 2M4NA 1IP9A 2FIDA 2N1WA 4E3CA 3M95A 3ZNID 3QX1A 4EFOA 2DYBA 2ZNVC 3KW5B 1YIWA 2LZ6A 3L10B 3R7QA 3I3TB 2KO3A 3ZTCA 1EO6A 3APFA 4DDGD 2ZPYA 4EUTA 4RMAA 3RD2A 3PLUA 4IW0A 5C23A 2BYFA 5CX3A 3VTVA 4LCDE 1P9DU 3L54A 2KFKA 2JRHA 3CF6E 2GBKA 3QAQA 1WMHA 1J0GA 5E6PA 4GDLB 2JY6A 3IBEA 4P7IA 1A5RA 2NPTA 3DVNU 2CHWA 2IO3B 4HCPB 3TL5A 2KTFA 1WYWB 3RCZA 2DHZA 1UZXB 2VRRB 4DHJB 2O6VB 1J19A 3S2AA 4W9KA 4KDIC 1YQBA 5IA7A 3H7PB 3PRMB 1ISNA 2IY1B 4KV2A 1RLFA 5GMVA 4KSLC 4FJYA 1RRBA 2PPHA 2WWZA 2MLBA 1VD2A 5CHVC 3SDLC 3VUXA 2IBIB 2FNJB 5LLIA 4F7ZA 2ZCCA 1OQYA 4KIKB 2V3SA 4A3PA 5J18A 2DAJA 1WJNA 3MTNB 3ML8A 4LDTD 2HD5B 4MJSB 2BKFA 2ZNVB 4BBNC 2CS4A 2MBQA 4ICUA 3B1LX 4JGHB 5LXIB 1TBEA 3ZNZB 3R66C 4KZ0A 3IFWB 1I35A 1KJTA 2D3GA 2EMTA 2NR2A 4AJYB 1JRUA 4WAAA 5DPWA 2AL3A 2CHXA 4IM2A 1KM7A 1XT9B 2BF8B 2YVCA 3A9KB 1Y8RC 3ML9A 2M17A 4FLHA 3VH3B 3PTFC 2UWQA 1EF5A 2CU1A 2KJRA 2IYDB 3DVNV 3QCAA 4G0NB 2RR9A 4KZCA 3AXCA 1XD3B 3N30A 3UQBA 2JXXA 1UH6A 2K1FA 2JZZA 2C9WB 5L95C 1OEYA 2LVPA 2KLCA 3NY5A 1WM2A 1P1AA 2N4FA 1E7VA 1E8WA 2DYOA 2I1KA 3D32A 2KJ6A 4M8NA 2CKHB 1WZ3A 2MCNB 3ZTDA 1WX7A 3P2BA 3H1UA 2DZIA 3X0WA 3HM6X 1YX6B 3PREA 1P98A 1Z2MA 2MBEA 4HCNB 3V61A 1OTRB 4W9LA 2UYZB 4TV3A 1D3ZA 2WX1A 4NPNA 2HJ8A 3APDA 3NZSA 1EUVB 2KZRA 4GDKB 4OVUA 3B0AA 5DPRA 3H7PA 2LXCA 2LRWA 3V60A 3EC8A 3RULA 3ZUNA 3AU4A 3A33B 2PE9A 1WZ0A 3WANA 1V49A 3QARA 1ZKHA 4M0WB 1WH3A 2HTHA 4GDLA 3HHMA 4ZYNA 2L3ZA 3ENEA 3PPAA 3L0WB 2A5UA 3OAWA 4MEMA 1S1QB 4W9CA 2K25A 4HLEA 4BFRA 1ZW7A 3K9OB 2FAZA 2FIFA 4W9IA 2OJRA 5DCNA 4GOCA 4BVUC 4MGZE 1NDDA 5CTRC 3KUCB 1OGWA 4IUMB 3RZWC 4FADA 1LXDA 4G3XB 2GOWA 3N32A 4G11A 4ICVA 5J17A 1VCBA 3PZDA 3RZFA 3VH4B 2LGXA 2L05A 3KYCD 5JZEB 3V6EB 4WJNA 2PE6B 2LGYA 1WE6A 4FA6A 1QZEA 3A1QA 2JZ3B 2DZKA 3CMMB 4JLCA 3NS8A 2LVOA 2M8SA 2KC1A 1P0RA 4DXAB 3IG3A 3PT2B 3X23A 4FBJB 2BWES 4NNJB 2KFJA 2QHOA 4HXDA 4PS3A 1PQSA 4AP4C 1E8YA 2KWVB 2LRUA 4URKA 1UD7A 2Y5BB 4PS7A 2K39A 5CHFA 4FHKA 4WWPA 1YX5B 3U8ZA 4ANVA 3A9KA 1WGYA 5DPSA 1E8ZA 1WY8A 3AU5A 5JHBA 5EDSA 2MWSB 4NQLB 5IAAC 2XBBC 2WX0A 3QC8B 3PS6A 3EFUA 4ASWC 2O6VA 2N7EA 2M0XA 5KHOA 2MW5A 1WM3A 4CHKA 4MGYE 4K81A 1R4MI 2BYEA 2FUHB 4MELA 1WXVA 4BKGA 4DBGA 1Q5WB 1TZ1A 2RPQA 2NVUI 2DZJA 2KHWB 4N9F4 1SGHA 4WJOA 3KUZA 3QWZB 3WAMA 4MDKE 3H7SA 5FR6A 2FCSA 5JH5C 4HWIB 5DPTA 1L2NA 1P3QU 1WXMA 2LXAA 4MJSA 2KKCA 2C5LC 4G50A 2LJ5A 1KLVA 1WGGA 3KVFB 4GN1A 2BPSA 3DCGA 4GIVA 3CSFA 3PVLA 3ZNHB 3L16A 2EMSA 4ANUA 1WGDA 4CYEA 5E6NA 2MBOA 1V9JA 2KC2A 5C1ZA 1SE9A 4K7SA 2XEWA 3B08A 2BKRB 3U30A 4II2B 4IC7B 2C7NB 1T0YA 3V6CB 2ASQA 2KX0A 4ANWA 4DHJD 2LGDA 4TQ1A 4MSQB 2DX5B 5TR5A 3ZDMC 1BT0A 3QK0A 2GBJA 4DK5A 4W9FA 1WR1A 2KTRB 2M1MA 1SIFA 3QQ8B 3TJPA 4EZKA 3DOWA 2AYOB 4ZRKA 4AOFA 4EZLA 3PSEB 2CHZA 3VQIA 5AEKB 4FHJA 2IO1B 3M63B 1GC6A 5BO4B 4ZRIA 2JF5A 4W9HA 3PRPB 3RUIB 1RAXA 2FCNA 5E6OA 2KMAA 2LWPA 2MP2B 2MA9B 4GU2A 2K8HA 1WX9A 4NJ6A 4BKTA 4DWFA 5AZGA 4W9EA 1C1YB 3JSVA 2KFKB 1GG3A 1UGMA 2L8JA 2KX3A 2L0TA 3ECIA 3OLMD 3VVWB 3ZO5B 4XZ4A 2J7QB 4MGIE 4NY0A 3PHWB 5HKHA 2K8BA 3EECA 4AWJA 2KQSA 4I6PA 1V81A 1V5TA 4KSKC 4BBNF 2CR5A 3QHTA 2XK5A 2KK8A 2KD0A 3JVZX 4PS8A 4WJPA 1IYFA 2C60A 4KIKA 2L00B 2NBWB 2R2OA 2JVCA 4GGQA 5AZHA 3WIMA 4J6IA 3Q3JA 3DVGX 4WQOB 1KOTA 2N9XA 2D10A 2KNBA 5JHAA 1V2YA 4NAWB 1OEYJ 3VUWA 2KDBA 2Z59B 3RT3B 4TKNA 4RM9A 4GB9A 4NQKE 1LM8B 3VHTC 1UELA 1FXTB 4HVBA 2NCNA 1HE8A 1V80A 3DPDA 4HJKA 3W1SA 4TQ0A 4W9JA 4BKSD 2XK5B 4NJ7A 2B3AA 5D7GA 1WGRA 1V86A 3DDCB 3T8MA 1C3TA 4NAWA 1WFYA 4W9GA 2K8CA 4ZRJA 5CHWA 3UQAA 2O2VA 3ZIMA 3ZRCA 3PV1A 4DDID 1WX8A 2NBUA 4I6NB 4ANXA 3K9PB 4B9KA 3NZUA 2AL6A 4KVGB 2IO2B 5G2NA 4A20A 4A3OA 3SHQA 4GMVA 4AJWA 3A9JA 4K7WA 3N3KB 3RYTA 4MM3A 3A9JB 2N9PC 3VUYA 2ZVNA 4F8CB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CO7 A;  2RD0 A;  2IZV B;  2ZZP B;  2G45 B;  2ZEQ A;  3LDZ E;  4JIO U;  4JQW C;  3UF8 A;  4BOS C;  1WGH A;  2L76 A;  4B6W A;  2L0F A;  3JW0 X;  4IWP A;  4HPM B;  2JT4 B;  3VTU A;  2KLG A;  1YJ1 A;  2RGF A;  3L08 A;  4FJZ A;  4PYZ A;  2MP2 A;  1UBQ A;  4GDK A;  4WWO A;  1WXA A;  2ZPN A;  3JYU A;  3VAW A;  2R2Q A;  4WWN A;  3MHS D;  4EKU A;  3R7R A;  4WJQ A;  3KH0 A;  2RSU A;  3ZDT A;  2DZM A;  2D07 B;  5D2M B;  1H4R A;  3VXW A;  1WJ4 A;  4DHZ E;  2LUE A;  2OOB B;  3DBS A;  1H8C A;  3VTW A;  1ZGU B;  3UGB B;  3VFK A;  1I42 A;  2KDE B;  5J2R A;  2PEA A;  1LFD A;  3DBL I;  3M3J A;  4JL9 A;  2V1Y A;  2NPT B;  2V4L A;  4IWQ A;  1M94 A;  4KDL B;  4EZJ A;  3AUL A;  3UIO B;  4PYU A;  2MBB B;  3H6N A;  1LQB A;  1WJU A;  4K7U A;  3DQV A;  3L13 A;  3VDZ A;  4B95 A;  1J8C A;  2JWZ A;  1WE7 A;  2KXJ A;  3M62 B;  1GUA B;  2A4Z A;  3C0R B;  3GZN I;  1MG8 A;  1NI2 A;  2KWC A;  2NBV B;  3ALB A;  3KYD D;  5L83 A;  2PJH A;  3IHP C;  4LJO B;  4EOY A;  2AWT A;  1X1M A;  2KWU B;  3DBH I;  4FUL A;  4HK2 A;  3UIN B;  3BIN A;  2HE7 A;  4MGK E;  3L17 A;  3O65 B;  4FJV B;  2I1J A;  2GMI C;  4OVV A;  3H9D A;  1WF9 A;  2N9E B;  4RM8 A;  3WAP A;  2BWF A;  3NHE B;  1E8X A;  3PLV A;  4W9D A;  1K8R B;  2LAS A;  3U7D A;  2K6Q A;  2LI5 A;  1TTN A;  2KJH B;  4MH0 E;  4MSM B;  2Z0E B;  2D2Q A;  1IPG A;  5AZF A;  2W9N A;  3DBR I;  3QA8 A;  3TIX A;  2J0M A;  4ZDV A;  3ZNG C;  2JRI B;  5LXH A;  2MRP A;  2O2V B;  1EF1 A;  4K1R B;  1CMX B;  2L7R A;  3UIP B;  3WAL A;  1U4A A;  2KDF B;  2C7H A;  3ZVV A;  2AEH A;  2FCM A;  3PRZ A;  1WXS A;  1Z5S B;  2Z0D B;  1L7Y A;  4BKS A;  4GSW A;  1WJ6 A;  3W1Y A;  2KDI A;  2ZJD A;  2MSE D;  4XX5 A;  3OJ4 B;  1TGZ B;  3LJ3 A;  4BOZ B;  4E71 A;  3A1Q B;  3Q3F A;  1WMH B;  2WDT B;  3HM3 A;  2IO0 B;  4GXB A;  2KN5 A;  2KQ7 A;  2O6V D;  4LDT B;  1GJZ A;  3R3M A;  2IY0 B;  3SU8 X;  2YLM A;  3QIJ A;  3A4R A;  3PHX B;  3W1S C;  3JSV B;  1WR6 E;  2FCQ A;  5G55 A;  2MQJ A;  3WA0 A;  2J0K A;  2D11 A;  3GOE A;  2KAN A;  3HK0 A;  1NBF C;  3V62 A;  2G4D B;  4IM3 A;  1AAR A;  4FN2 A;  4II3 B;  2WYQ A;  1UBI A;  4TUU A;  1G6J A;  3CST A;  2K6D B;  2C7M B;  2MBH A;  2GBM A;  1YD8 U;  3APC A;  4X57 B;  5D94 A;  2LD9 A;  3KUD B;  4IG7 B;  1WIA A;  3PGE A;  2KOX A;  3NOB A;  2N1V A;  1F9J A;  4IWO A;  1V5O A;  1V6E A;  2BGF A;  3OJ3 A;  2DYM A;  3IVF A;  2REX A;  2GBN A;  2KMC A;  2KVR A;  3ZLZ A;  3HIZ A;  2G4S A;  4HPL B;  3TCA A;  1E5W A;  4F1S A;  3TMP B;  4HDO A;  4EEW A;  4DHZ B;  2LVQ A;  4LJP B;  3ZW3 A;  3DVG Y;  3ONS A;  4M8M A;  2GBR A;  1RFA A;  5D6J B;  2ZCB A;  2NS5 A;  2BYV E;  3A4S C;  3SD5 A;  1R4N I;  1GNU A;  4I6L B;  4YL8 A;  3T9L A;  3WAO A;  2JUO A;  1WI0 A;  1Q0W B;  1XQQ A;  2KTR A;  2G3Q B;  3AI5 A;  3ZKJ C;  2J0J A;  1S3S G;  2N7D A;  4XC2 A;  1WRD B;  2DAF A;  3ZRF A;  1GC7 A;  4IM0 A;  2JPH A;  1Q1O A;  4E74 A;  1E90 A;  2DEN B;  2ZVO A;  3QJZ A;  4HDQ A;  3BY4 B;  5KHQ A;  4AUQ C;  3EHV A;  2MX2 A;  1E7U A;  3TBL D;  3MJW A;  2EKE C;  2M4N A;  1IP9 A;  2FID A;  2N1W A;  4E3C A;  3M95 A;  3ZNI D;  3QX1 A;  4EFO A;  2DYB A;  2ZNV C;  3KW5 B;  1YIW A;  2LZ6 A;  3L10 B;  3R7Q A;  3I3T B;  2KO3 A;  3ZTC A;  1EO6 A;  3APF A;  4DDG D;  2ZPY A;  4EUT A;  4RMA A;  3RD2 A;  3PLU A;  4IW0 A;  5C23 A;  2BYF A;  5CX3 A;  3VTV A;  4LCD E;  1P9D U;  3L54 A;  2KFK A;  2JRH A;  3CF6 E;  2GBK A;  3QAQ A;  1WMH A;  1J0G A;  5E6P A;  4GDL B;  2JY6 A;  3IBE A;  4P7I A;  1A5R A;  2NPT A;  3DVN U;  2CHW A;  2IO3 B;  4HCP B;  3TL5 A;  2KTF A;  1WYW B;  3RCZ A;  2DHZ A;  1UZX B;  2VRR B;  4DHJ B;  2O6V B;  1J19 A;  3S2A A;  4W9K A;  4KDI C;  1YQB A;  5IA7 A;  3H7P B;  3PRM B;  1ISN A;  2IY1 B;  4KV2 A;  1RLF A;  5GMV A;  4KSL C;  4FJY A;  1RRB A;  2PPH A;  2WWZ A;  2MLB A;  1VD2 A;  5CHV C;  3SDL C;  3VUX A;  2IBI B;  2FNJ B;  5LLI A;  4F7Z A;  2ZCC A;  1OQY A;  4KIK B;  2V3S A;  4A3P A;  5J18 A;  2DAJ A;  1WJN A;  3MTN B;  3ML8 A;  4LDT D;  2HD5 B;  4MJS B;  2BKF A;  2ZNV B;  4BBN C;  2CS4 A;  2MBQ A;  4ICU A;  3B1L X;  4JGH B;  5LXI B;  1TBE A;  3ZNZ B;  3R66 C;  4KZ0 A;  3IFW B;  1I35 A;  1KJT A;  2D3G A;  2EMT A;  2NR2 A;  4AJY B;  1JRU A;  4WAA A;  5DPW A;  2AL3 A;  2CHX A;  4IM2 A;  1KM7 A;  1XT9 B;  2BF8 B;  2YVC A;  3A9K B;  1Y8R C;  3ML9 A;  2M17 A;  4FLH A;  3VH3 B;  3PTF C;  2UWQ A;  1EF5 A;  2CU1 A;  2KJR A;  2IYD B;  3DVN V;  3QCA A;  4G0N B;  2RR9 A;  4KZC A;  3AXC A;  1XD3 B;  3N30 A;  3UQB A;  2JXX A;  1UH6 A;  2K1F A;  2JZZ A;  2C9W B;  5L95 C;  1OEY A;  2LVP A;  2KLC A;  3NY5 A;  1WM2 A;  1P1A A;  2N4F A;  1E7V A;  1E8W A;  2DYO A;  2I1K A;  3D32 A;  2KJ6 A;  4M8N A;  2CKH B;  1WZ3 A;  2MCN B;  3ZTD A;  1WX7 A;  3P2B A;  3H1U A;  2DZI A;  3X0W A;  3HM6 X;  1YX6 B;  3PRE A;  1P98 A;  1Z2M A;  2MBE A;  4HCN B;  3V61 A;  1OTR B;  4W9L A;  2UYZ B;  4TV3 A;  1D3Z A;  2WX1 A;  4NPN A;  2HJ8 A;  3APD A;  3NZS A;  1EUV B;  2KZR A;  4GDK B;  4OVU A;  3B0A A;  5DPR A;  3H7P A;  2LXC A;  2LRW A;  3V60 A;  3EC8 A;  3RUL A;  3ZUN A;  3AU4 A;  3A33 B;  2PE9 A;  1WZ0 A;  3WAN A;  1V49 A;  3QAR A;  1ZKH A;  4M0W B;  1WH3 A;  2HTH A;  4GDL A;  3HHM A;  4ZYN A;  2L3Z A;  3ENE A;  3PPA A;  3L0W B;  2A5U A;  3OAW A;  4MEM A;  1S1Q B;  4W9C A;  2K25 A;  4HLE A;  4BFR A;  1ZW7 A;  3K9O B;  2FAZ A;  2FIF A;  4W9I A;  2OJR A;  5DCN A;  4GOC A;  4BVU C;  4MGZ E;  1NDD A;  5CTR C;  3KUC B;  1OGW A;  4IUM B;  3RZW C;  4FAD A;  1LXD A;  4G3X B;  2GOW A;  3N32 A;  4G11 A;  4ICV A;  5J17 A;  1VCB A;  3PZD A;  3RZF A;  3VH4 B;  2LGX A;  2L05 A;  3KYC D;  5JZE B;  3V6E B;  4WJN A;  2PE6 B;  2LGY A;  1WE6 A;  4FA6 A;  1QZE A;  3A1Q A;  2JZ3 B;  2DZK A;  3CMM B;  4JLC A;  3NS8 A;  2LVO A;  2M8S A;  2KC1 A;  1P0R A;  4DXA B;  3IG3 A;  3PT2 B;  3X23 A;  4FBJ B;  2BWE S;  4NNJ B;  2KFJ A;  2QHO A;  4HXD A;  4PS3 A;  1PQS A;  4AP4 C;  1E8Y A;  2KWV B;  2LRU A;  4URK A;  1UD7 A;  2Y5B B;  4PS7 A;  2K39 A;  5CHF A;  4FHK A;  4WWP A;  1YX5 B;  3U8Z A;  4ANV A;  3A9K A;  1WGY A;  5DPS A;  1E8Z A;  1WY8 A;  3AU5 A;  5JHB A;  5EDS A;  2MWS B;  4NQL B;  5IAA C;  2XBB C;  2WX0 A;  3QC8 B;  3PS6 A;  3EFU A;  4ASW C;  2O6V A;  2N7E A;  2M0X A;  5KHO A;  2MW5 A;  1WM3 A;  4CHK A;  4MGY E;  4K81 A;  1R4M I;  2BYE A;  2FUH B;  4MEL A;  1WXV A;  4BKG A;  4DBG A;  1Q5W B;  1TZ1 A;  2RPQ A;  2NVU I;  2DZJ A;  2KHW B;  4N9F 4;  1SGH A;  4WJO A;  3KUZ A;  3QWZ B;  3WAM A;  4MDK E;  3H7S A;  5FR6 A;  2FCS A;  5JH5 C;  4HWI B;  5DPT A;  1L2N A;  1P3Q U;  1WXM A;  2LXA A;  4MJS A;  2KKC A;  2C5L C;  4G50 A;  2LJ5 A;  1KLV A;  1WGG A;  3KVF B;  4GN1 A;  2BPS A;  3DCG A;  4GIV A;  3CSF A;  3PVL A;  3ZNH B;  3L16 A;  2EMS A;  4ANU A;  1WGD A;  4CYE A;  5E6N A;  2MBO A;  1V9J A;  2KC2 A;  5C1Z A;  1SE9 A;  4K7S A;  2XEW A;  3B08 A;  2BKR B;  3U30 A;  4II2 B;  4IC7 B;  2C7N B;  1T0Y A;  3V6C B;  2ASQ A;  2KX0 A;  4ANW A;  4DHJ D;  2LGD A;  4TQ1 A;  4MSQ B;  2DX5 B;  5TR5 A;  3ZDM C;  1BT0 A;  3QK0 A;  2GBJ A;  4DK5 A;  4W9F A;  1WR1 A;  2KTR B;  2M1M A;  1SIF A;  3QQ8 B;  3TJP A;  4EZK A;  3DOW A;  2AYO B;  4ZRK A;  4AOF A;  4EZL A;  3PSE B;  2CHZ A;  3VQI A;  5AEK B;  4FHJ A;  2IO1 B;  3M63 B;  1GC6 A;  5BO4 B;  4ZRI A;  2JF5 A;  4W9H A;  3PRP B;  3RUI B;  1RAX A;  2FCN A;  5E6O A;  2KMA A;  2LWP A;  2MP2 B;  2MA9 B;  4GU2 A;  2K8H A;  1WX9 A;  4NJ6 A;  4BKT A;  4DWF A;  5AZG A;  4W9E A;  1C1Y B;  3JSV A;  2KFK B;  1GG3 A;  1UGM A;  2L8J A;  2KX3 A;  2L0T A;  3ECI A;  3OLM D;  3VVW B;  3ZO5 B;  4XZ4 A;  2J7Q B;  4MGI E;  4NY0 A;  3PHW B;  5HKH A;  2K8B A;  3EEC A;  4AWJ A;  2KQS A;  4I6P A;  1V81 A;  1V5T A;  4KSK C;  4BBN F;  2CR5 A;  3QHT A;  2XK5 A;  2KK8 A;  2KD0 A;  3JVZ X;  4PS8 A;  4WJP A;  1IYF A;  2C60 A;  4KIK A;  2L00 B;  2NBW B;  2R2O A;  2JVC A;  4GGQ A;  5AZH A;  3WIM A;  4J6I A;  3Q3J A;  3DVG X;  4WQO B;  1KOT A;  2N9X A;  2D10 A;  2KNB A;  5JHA A;  1V2Y A;  4NAW B;  1OEY J;  3VUW A;  2KDB A;  2Z59 B;  3RT3 B;  4TKN A;  4RM9 A;  4GB9 A;  4NQK E;  1LM8 B;  3VHT C;  1UEL A;  1FXT B;  4HVB A;  2NCN A;  1HE8 A;  1V80 A;  3DPD A;  4HJK A;  3W1S A;  4TQ0 A;  4W9J A;  4BKS D;  2XK5 B;  4NJ7 A;  2B3A A;  5D7G A;  1WGR A;  1V86 A;  3DDC B;  3T8M A;  1C3T A;  4NAW A;  1WFY A;  4W9G A;  2K8C A;  4ZRJ A;  5CHW A;  3UQA A;  2O2V A;  3ZIM A;  3ZRC A;  3PV1 A;  4DDI D;  1WX8 A;  2NBU A;  4I6N B;  4ANX A;  3K9P B;  4B9K A;  3NZU A;  2AL6 A;  4KVG B;  2IO2 B;  5G2N A;  4A20 A;  4A3O A;  3SHQ A;  4GMV A;  4AJW A;  3A9J A;  4K7W A;  3N3K B;  3RYT A;  4MM3 A;  3A9J B;  2N9P C;  3VUY A;  2ZVN A;  4F8C B; 
#chains in the Genus database with same CATH topology
 3LDZ E;  2G45 B;  2LMC A;  2LUM A;  3JW0 X;  4IWP A;  4HPM B;  1SIJ A;  3FIL A;  3VTU A;  2RGF A;  2WP9 B;  3L08 A;  3U52 E;  1UBQ A;  4GDK A;  4REZ A;  1WXA A;  2ZPN A;  3VAW A;  4WWN A;  4RF0 A;  4EKU A;  4KKJ A;  4ACF A;  1B1Z A;  2DZM A;  3DHG C;  1WJ4 A;  4IOI E;  1H8C A;  3VTW A;  1ZGU B;  1I42 A;  3DBL I;  3ZLZ A;  2KQ4 X;  3DHI C;  3PZ8 A;  2NPT B;  2X38 A;  2MBB B;  3H6N A;  4K7U A;  3L13 A;  4B95 A;  1J8C A;  2JWZ A;  5BYS A;  5EE0 A;  1PGB A;  2NBV B;  1IBX A;  1OQQ A;  1YMH E;  2RMM A;  3B2G A;  2JYT A;  3DBH I;  4HK2 A;  3V3X A;  1TS5 A;  2E6X A;  3MP9 A;  3WAP A;  2BWF A;  2HJ1 A;  4W9D A;  1VR9 A;  1MI0 A;  2LAS A;  2K6Q A;  2YEP F;  2KJH B;  2WGS A;  3ZNG C;  4M02 A;  4YXD B;  3MJ5 A;  2L7R A;  3UIP B;  1V1P B;  4NZL B;  1MHX A;  3PRZ A;  1WXS A;  3RNE C;  1I4P A;  3BK2 A;  3NS1 A;  2KDI A;  2OED A;  2MSE D;  4J3O D;  4XX5 A;  3OJ4 B;  1TGZ B;  4BOZ B;  4A55 A;  1ZDX A;  1ROE A;  3A1Q B;  3R2I A;  1QQR A;  1HA5 A;  3RNF C;  2NMQ A;  1IUE A;  3IT6 B;  2FE8 A;  3BYY B;  3SU8 X;  3A4R A;  3Q3N C;  1GB1 A;  2MQJ A;  3WA0 A;  3GOE A;  2KAN A;  3AE1 B;  1NBF C;  4FN2 A;  1D4B A;  1PGX A;  3P4Q B;  2C7M B;  2X8X X;  1C76 A;  2HDE A;  1V5O A;  3P63 A;  1M4V A;  3AE5 B;  3HIZ A;  4F1S A;  4HDO A;  4DHZ B;  3DVG Y;  3TEW A;  3ONS A;  2BYV E;  4B0E A;  2PVO D;  1GNU A;  5LNK 1;  3FC4 A;  2H88 B;  2G3Q B;  1S3S G;  1WRD B;  3ZRF A;  1V1P A;  2JPH A;  1Q1O A;  1E90 A;  3IXS A;  2W3S A;  3QJZ A;  4HDQ A;  5KHQ A;  3EHV A;  3Q8F A;  2JX5 A;  3M95 A;  4A90 A;  4EFO A;  2LHD A;  2ZNV C;  1TY0 A;  2I2Y A;  3ZJU A;  3R7Q A;  2W3R A;  1EO6 A;  4DDG D;  2IGG A;  4EUT A;  4CQN A;  4KGR A;  2BYF A;  3KQ4 A;  2KFK A;  3CF6 E;  2GBK A;  3FKY A;  3QAQ A;  1V8C A;  3NUH B;  2JY6 A;  4XE0 A;  4P7I A;  1A5R A;  4N6E B;  2IO3 B;  4HCP B;  1L6V A;  2KTF A;  4Q2J A;  3RCZ A;  3RI7 C;  3S2A A;  1J19 A;  1YOV B;  4KDI C;  2VH1 A;  2IY1 B;  1RLF A;  2QJL A;  3SDL C;  2IBI B;  1NYR A;  3AE3 B;  1XO3 A;  1E9M A;  4HJG E;  2V3S A;  5J18 A;  1WJN A;  3ZGZ A;  1SEB D;  3ML8 A;  4BBN C;  2AX5 A;  1YJJ A;  2V3P A;  4YT0 B;  4JGH B;  2CU3 A;  2RDH A;  1VZ6 A;  2PTL A;  4L2Y A;  2D3G A;  3SR6 A;  4WAA A;  1DGJ A;  2CHX A;  1JAL A;  1KM7 A;  4IM2 A;  2YVC A;  3A9K B;  1Y8R C;  3LXF A;  2IYD B;  3B9J A;  1AWD A;  2Y5P A;  1GB4 A;  3AXC A;  1XD3 B;  2JXX A;  2K1F A;  2JZZ A;  5L95 C;  2LVP A;  2K5P A;  3BK1 A;  5BYR A;  2DNF A;  2KVZ A;  3D32 A;  3P1M A;  2PLP A;  3HM6 X;  1NVI D;  1YX6 B;  2IND C;  4HCN B;  1P98 A;  1Z2M A;  2IGD A;  1E10 A;  1OTR B;  2UYZ B;  1CK1 A;  2HJ8 A;  1ENF A;  2LHE A;  3H7P A;  2NTS A;  3RUL A;  3ZUN A;  4N58 A;  2PE9 A;  1SB3 C;  4M0W B;  1WH3 A;  3AM9 A;  3ENE A;  2WXG A;  2K25 A;  5BMH A;  4BFR A;  1ZW7 A;  2FAZ A;  1FO4 A;  4IUM B;  1OGW A;  3RZW C;  4G11 A;  3NG0 A;  1N5W A;  3VH4 B;  2GRI A;  4P1C C;  2WXQ A;  2I38 A;  2PE6 B;  2LGY A;  4JLC A;  2JZ3 B;  1QOG A;  1NI3 A;  2M8S A;  4ZOH C;  2RPV A;  2INN E;  4DXA B;  2WDV B;  1NYQ A;  4AP4 C;  4HXD A;  1PQS A;  1C4A A;  5CHF A;  4LTU A;  1UNS A;  3N1X C;  1E8Z A;  1WY8 A;  5EDS A;  2XBB C;  1D5M C;  3EFU A;  2O6V A;  1FMA D;  2M0X A;  4DQO C;  5KHO A;  2MW5 A;  1QOB A;  1Q5W B;  1YN3 A;  2NVU I;  2RPQ A;  4N9F 4;  2KYW A;  3KUZ A;  3QWZ B;  3H7S A;  5FR6 A;  2BW2 A;  1P3Q U;  1WXM A;  2LXA A;  2LJ5 A;  3P4R B;  3LYY A;  3FAH A;  3L16 A;  2V9H A;  3NVV A;  4CYE A;  4ITK A;  3B08 A;  1JRP A;  2WXM A;  2C7N B;  3V6C B;  4YSY B;  1ESF A;  2KX0 A;  5EE3 A;  2LGD A;  3FIL B;  1JWS D;  3QK0 A;  3MC8 A;  1FM0 D;  2WXH A;  4W9F A;  3NZ3 A;  2KTR B;  3QQ8 B;  4NAM A;  4ZRK A;  2CHZ A;  1C9F A;  1KRH A;  2IO1 B;  3M63 B;  2BS3 B;  1VLB A;  4C56 C;  3RN9 C;  1RAX A;  2MA9 B;  1EM7 A;  3NVZ A;  1WSP A;  4K3B A;  4WAF A;  4BKT A;  4EE2 A;  2L8J A;  1P7E A;  2L0T A;  4LK0 M;  3OLM D;  1FNV A;  5HKH A;  3PHW B;  3EEC A;  2KQS A;  3WCQ A;  2CR5 A;  2YEP B;  2KK8 A;  4PS8 A;  1GPX A;  5AZH A;  2L00 B;  2NBW B;  2V0G A;  5JHA A;  1K52 A;  3U7Z A;  3VUW A;  2Z59 B;  3NVY A;  3C19 A;  3N20 C;  1I4X A;  4GB9 A;  1LM8 B;  3VHT C;  2NCN A;  3GZN B;  1V80 A;  1FEH A;  1FRD A;  3T8M A;  2J53 A;  2ONQ A;  4W9G A;  1ZXI A;  3SFD B;  5FKA C;  1JWM D;  1RM6 C;  4JX1 C;  3PV1 A;  1E0Z A;  1WX8 A;  4ANX A;  3R8B A;  2INP E;  3NZU A;  4B9K A;  4XWW A;  1K51 A;  5HI1 A;  4KVG B;  2PVG C;  2IO2 B;  3SHQ A;  3W9C B;  4K7W A;  2ZVN A;  2RD0 A;  2ZZP B;  4BOS C;  1ET9 A;  3IAM 1;  4B6W A;  4FJZ A;  1GAQ B;  3JYU A;  4WUR A;  2INC C;  4WJQ A;  2RSU A;  5HG2 A;  1QF6 A;  1YN5 A;  1HZ6 A;  1ACC A;  4DHZ E;  2FUG 1;  2Y3A A;  1ZPS A;  3UGB B;  2KDE B;  2PEA A;  4IWQ A;  4EZJ A;  4KDL B;  3AUL A;  4PYU A;  4LLG M;  1LQB A;  1WJU A;  4OHJ A;  3LB8 C;  1QKZ A;  1C79 A;  1GUA B;  2A4Z A;  3UI3 A;  3KYD D;  3ALB A;  5L83 A;  3IHP C;  4LJO B;  4EOY A;  1X1M A;  4FUL A;  2HTM E;  3UIN B;  1J7C A;  2HE7 A;  2K22 A;  1L4Z B;  4ZHP A;  2PKO A;  3O65 B;  4FJV B;  2I1J A;  2GMI C;  3NVW A;  4OVV A;  3E56 A;  3H9D A;  2WXO A;  4XDD A;  3PLV A;  2LI5 A;  1TS4 A;  1TTN A;  4MSM B;  1YJI A;  3DBR I;  2J0M A;  4ZDV A;  1NEN B;  1I4R A;  2O2V B;  4K1R B;  1CMX B;  3SFE B;  3WAL A;  3ZVV A;  1MHH E;  2Q5W D;  2Z0D B;  1VZ8 A;  1WJ6 A;  2ZJD A;  3LJ3 A;  4H2A A;  2JZP A;  3HM3 A;  2IO0 B;  4GXB A;  1YNT E;  2KQ7 A;  2O6V D;  1GJZ A;  2WXK A;  3SEB A;  3RNG C;  4LNO A;  3JSV B;  1L0V B;  2D11 A;  2J52 A;  3HK0 A;  3V62 A;  4IM3 A;  4II3 B;  4TUU A;  1UBI A;  1G6J A;  3GP7 A;  1GOZ A;  5HFY A;  4X57 B;  5D94 A;  4D2K A;  5BYQ A;  1WIA A;  3PGE A;  3AEB B;  1D6E C;  3NOB A;  1V6E A;  2BGF A;  4RF1 A;  2DYM A;  1KFY B;  2REX A;  2GBN A;  1V97 A;  2G4S A;  4HPL B;  3EUB 2;  5H92 C;  1MVK A;  1XCT L;  1RFA A;  2ZCB A;  3A4S C;  3WAO A;  2WXP A;  1WI0 A;  3ZKJ C;  2QC8 A;  3AI5 A;  4RH6 A;  2N7D A;  1K53 A;  4IM0 A;  2ZVO A;  4M01 A;  3AE8 B;  1XLP A;  3GE8 C;  4JWS C;  2EKE C;  2FID A;  2N1W A;  3QX1 A;  3PO0 A;  1YIW A;  1J7B A;  3ZTC A;  5G5G A;  2ZPY A;  4JPS A;  2AQ3 B;  3OG5 A;  2JRH A;  1L6U A;  3IBE A;  1N5X A;  2NPT A;  4HPP A;  3DVN U;  4K3C A;  2O6V B;  3AED B;  4W9K A;  3PRM B;  2L1A A;  4KSL C;  1RRB A;  2WWZ A;  1SXT A;  2W82 A;  2M0A A;  4F7Z A;  1WWT A;  3ZYY X;  1F2R C;  4C4V A;  1QLB B;  2CS4 A;  2MJE A;  3PZ7 A;  3ZNZ B;  4KZ0 A;  3Q14 C;  1KJT A;  2AL3 A;  2G9H D;  2MEK A;  4MM3 B;  3ML9 A;  1EF5 A;  2KJR A;  3DVN V;  3W5U B;  4G0N B;  1KLG D;  1PGA A;  3EGR A;  1LGR A;  4MH8 A;  2KDM A;  2C9W B;  1WM2 A;  4MT5 A;  1P1A A;  1TZO A;  3T3N A;  1VRA B;  1E8W A;  2I1K A;  2IJ0 A;  3ZTD A;  1WZ3 A;  3T3O A;  1WX7 A;  3P2B A;  3H1U A;  2DZI A;  3X0W A;  3V61 A;  4JE3 B;  1D3Z A;  1EUV B;  2WU5 B;  5DPR A;  4R3D A;  3AU4 A;  3QAR A;  4ZYN A;  1KLU D;  2L3Z A;  3PPA A;  4DXG A;  4MEM A;  1S1Q B;  4HLE A;  3AE2 B;  4BAX A;  4W9I A;  2BTE A;  2OJR A;  2WXI A;  3DWM A;  4HEA 1;  4MGZ E;  1NDD A;  1LXD A;  1UGJ A;  4G3X B;  2GOW A;  3N32 A;  3PZD A;  2LGX A;  4OZB A;  1MG4 A;  1T3Q A;  2L05 A;  3KYC D;  1RFK A;  3V6E B;  4FA6 A;  1WE6 A;  5AUK A;  1QZE A;  3A1Q A;  2DZK A;  3ETR A;  4M00 A;  2LVO A;  2BWE S;  3H8H A;  2OJW A;  4PS3 A;  2KWV B;  2LRU A;  1UD7 A;  2Y5B B;  3Q2A C;  2LGI A;  1I4Q A;  4FHK A;  1EU3 A;  3V05 A;  1JRO A;  1WGY A;  5DPS A;  5JHB A;  3PS6 A;  1F1H A;  3BWU D;  1VJK A;  2N7E A;  2BQQ A;  1FXA A;  2JYE A;  4MGY E;  4CHK A;  4K81 A;  2BYE A;  2FUH B;  1WXV A;  4HRS A;  4QAY A;  2JQR B;  1TZ1 A;  4RCO A;  1TS3 A;  2MJ3 A;  2FCS A;  5C2T B;  3U4E G;  4LNF A;  2C5L C;  4G50 A;  4C4V B;  4US9 A;  3DCG A;  4GIV A;  3PVL A;  4ZHO A;  4ANU A;  3GB1 A;  1N61 A;  5E6N A;  1UWM A;  1XF5 L;  1SE9 A;  2XEW A;  1SSN A;  2G1E A;  3U30 A;  4II2 B;  3KLS X;  2E3T A;  2ASQ A;  4ANW A;  3RNB C;  4MSQ B;  1FCL A;  2MJD A;  4EZK A;  3DOW A;  2N9K A;  2AYO B;  3U2S C;  3RNA C;  3AE4 B;  2FCN A;  4GU2 A;  2L83 A;  2Y5C A;  4PK1 A;  3R2T A;  1C1Y B;  1SE2 A;  1A70 A;  2GLS A;  1L4D B;  4A9A A;  2ZW0 A;  4YTM B;  4YTP B;  3ECI A;  3VVW B;  3ZO5 B;  4MGI E;  2K8B A;  1WXQ A;  4WJP A;  2KD0 A;  1Q10 A;  1IYF A;  4GGQ A;  1KOT A;  3Q3J A;  2KNB A;  1V2Y A;  1OEY J;  1PUT A;  2KDB A;  2BYT A;  1UF0 A;  5BMI A;  4NQK E;  4ARI A;  1UEL A;  1ZUD 2;  1JML A;  1HE8 A;  2B76 B;  3DPD A;  1FPY A;  4HJK A;  1FRR A;  4W9J A;  4BKS D;  4NJ7 A;  5D7G A;  3VR8 B;  3BZD B;  1C3T A;  1QOF A;  1V1O A;  1WFY A;  1QOA A;  5CHW A;  4KGT A;  3ZRC A;  2NBU A;  4S0R A;  2AL6 A;  5G2N A;  4A3O A;  1TKG A;  4AJW A;  3N3K B;  4RNA A;  3VUY A;  4CO7 A;  2IZV B;  4JQW C;  5IOI A;  2KLG A;  4PYZ A;  4WWO A;  2R2Q A;  3AE7 B;  2QIL A;  3R7R A;  3Q8A A;  3ZDT A;  2LGS A;  3VXW A;  2LUE A;  2OOB B;  2ACZ B;  3AMZ A;  3VFK A;  1LFD A;  3M3J A;  2V1Y A;  1M94 A;  3UIO B;  1E6E B;  3VDZ A;  1WE7 A;  2KXJ A;  3M62 B;  3C0R B;  3GZN I;  1NI2 A;  2PJH A;  1KTK A;  2AWT A;  1FIQ A;  2WLB A;  4MGK E;  2K9X A;  2WDQ B;  1HEZ E;  1WF9 A;  1XXG A;  2IPK D;  4GLS C;  1K8R B;  1XLN A;  2D2Q A;  3AH7 A;  3EFC A;  2K0P A;  3AB5 A;  2W9N A;  1U4A A;  2C7H A;  2RDG A;  2FCM A;  2JSV X;  3DBH B;  1Z5S B;  2XNA C;  3BII D;  4GSW A;  3ABV B;  5TSS A;  4C7Z A;  4E71 A;  1WMH B;  3R3M A;  2IY0 B;  4IDI A;  3DBL B;  3QIJ A;  1I7H A;  3PHX B;  5H8Y E;  2FCQ A;  4TSS A;  5G55 A;  1AW7 A;  1IGD A;  1C77 A;  2J0K A;  1SBB B;  1AAR A;  2K3U A;  5T8I A;  1HQR D;  1PDX A;  2MBH A;  1YD8 U;  5D3D A;  4KX6 B;  2IGH A;  2N1V A;  1F9J A;  2SAK A;  3RPF C;  3IVF A;  3TCA A;  3EA6 A;  1E5W A;  1HZ5 A;  1D5X C;  4EEW A;  4LJP B;  1QIL A;  3ZW3 A;  2D3A A;  1TT5 B;  2NS5 A;  1R4N I;  4I6L B;  4YL8 A;  4WWM A;  4MAC A;  3AEE B;  1Q0W B;  2J0J A;  3DBR B;  4XC2 A;  2DAF A;  1GC7 A;  2DEN B;  1EWC A;  4AUQ C;  1FFU A;  2MX2 A;  2V3N A;  3TBL D;  3MJW A;  2M4N A;  1IP9 A;  4E3C A;  3ZNI D;  3ZXR A;  2DYB A;  3KW5 B;  1JCK B;  2R61 A;  3L10 B;  3NRZ A;  2PW9 A;  3I3T B;  3MHZ A;  4RMA A;  1VDV A;  3RD2 A;  4IW0 A;  5C23 A;  5CX3 A;  4LCD E;  1P9D U;  3L54 A;  4JWU C;  1J0G A;  4GDL B;  2CHW A;  4C00 A;  2ZW1 A;  1WYW B;  2DHZ A;  3Q3O C;  5E6J A;  1XCQ L;  4DHJ B;  5GXG B;  2WXL A;  3KWV A;  1BXT A;  1YQB A;  3H7P B;  1ISN A;  2MLB A;  2BVC A;  5CHV C;  4P6V F;  3VUX A;  5LLI A;  2ZCC A;  2FBW B;  1OQY A;  4KIK B;  2WNM A;  1TY2 A;  2IDY A;  3MTN B;  4LDT D;  2HD5 B;  2DBY A;  1DOI A;  2BKF A;  2ZNV B;  1XEE A;  4ICU A;  3VRA B;  1TBE A;  3R66 C;  3IT4 B;  3N1Z C;  2EMT A;  1F77 A;  2BF8 B;  3GS2 A;  2UWQ A;  1NEK B;  4KZC A;  3N30 A;  1OEY A;  3NY5 A;  2N4F A;  2MCN B;  4M8N A;  2KJ6 A;  3Q6B A;  4W9L A;  2LJI A;  2WX1 A;  3APD A;  4UDU C;  3NZS A;  4OVU A;  4GDK B;  2LXC A;  4YWG G;  2EKI A;  1TJE A;  1FCC C;  3V60 A;  2MH7 A;  3EC8 A;  1WZ0 A;  1C4C A;  1ZP0 B;  5HHD G;  2HTH A;  3HHM A;  2DLB A;  2M56 B;  3L0W B;  3RNC C;  4W9C A;  1BML C;  2JXT A;  3DHH C;  2TSS A;  1R7S A;  4FAD A;  4ICV A;  4USA A;  5J17 A;  1VCB A;  3HVZ A;  3P4P B;  1C4P A;  1MJD A;  3BVG A;  4WJN A;  5C3J B;  3AE6 B;  4US8 A;  3CMM B;  3HRD D;  1P0R A;  1MPE A;  3X23 A;  4FBJ B;  2QSD A;  1E8Y A;  1RYJ A;  3MFG A;  2KN4 A;  4PS7 A;  3TEY A;  2BS4 B;  2KAJ A;  4WWP A;  1E7P B;  1YX5 B;  5FR3 A;  1WM3 A;  4HRO A;  4BKG A;  4DBG A;  1TYG B;  3ZJV A;  1DOY A;  2KHW B;  4WJO A;  1SE4 A;  1SF0 A;  1IBX B;  4RGN A;  5DPT A;  1AN8 A;  4MJS A;  5IO9 A;  1AYF A;  3KVF B;  4GN1 A;  1I4H A;  2BPS A;  3CSF A;  4XGA B;  1RWS A;  3I5J C;  2MBO A;  5C1Z A;  4K7S A;  3P42 A;  2D3B A;  3HUI A;  1L0Y B;  4IC7 B;  1SJE D;  1T0Y A;  4TQ1 A;  1STE A;  5TR5 A;  5JXV A;  1WR1 A;  3AEC B;  3TSS A;  1CJE A;  1HXY D;  1XLO A;  3VQI A;  3CIR B;  4TMA B;  1GC6 A;  5BO4 B;  3PRP B;  3RUI B;  2L52 A;  2NTT A;  4XDC A;  5E6O A;  1UUP A;  2MP2 B;  1WX9 A;  4NJ6 A;  5EE9 A;  5AZG A;  2Z8L A;  1JWB D;  2N0S B;  3JSV A;  2KFK B;  1GG3 A;  2KX3 A;  2WXF A;  4YSZ B;  1N62 A;  4AWJ A;  2UU7 A;  1EWY C;  1V5T A;  3QHT A;  1I35 A;  3JVZ X;  2C60 A;  2R2O A;  2CJN A;  3WIM A;  5I4D A;  4J6I A;  3DVG X;  4C80 A;  4YSX B;  4HKQ A;  3I57 A;  2D10 A;  2D3C A;  3RT3 B;  4RM9 A;  3Q8E A;  1FXT B;  1EU4 A;  3W1S A;  2GB1 A;  4B0M A;  3AEF B;  2JWU A;  3Q3M C;  3ZXV A;  4ZRJ A;  4C7Y A;  1IGC A;  4A8X C;  3ZIM A;  2EEL A;  3K9P B;  4NJC A;  1L0X B;  3NJT A;  4GMV A;  4PT5 A;  1MFW A;  4DXF A;  3RYT A;  3A9J B;  4F8C B;  3UF8 A;  3IAS 1;  2ZEQ A;  4JIO U;  1WGH A;  2L76 A;  2L0F A;  2JT4 B;  1YJ1 A;  2MP2 A;  4AS1 A;  2WU2 B;  3MHS D;  3KH0 A;  1UWX A;  3MC9 A;  2D07 B;  1VZ7 A;  2GI9 A;  5D2M B;  2ICI A;  1H4R A;  5MPO A;  3DBS A;  2DWQ A;  1XLQ A;  5J2R A;  4JL9 A;  2V4L A;  1YQ4 B;  4FXC A;  3DQV A;  4HKZ E;  1KLV A;  1MG8 A;  2KWC A;  1SE3 A;  2M19 A;  2KWU B;  1TS2 A;  3BIN A;  3L17 A;  3O13 A;  1OQR A;  1T0Q C;  2N9E B;  4RM8 A;  3BYT B;  5IP4 D;  3NHE B;  1E8X A;  1ET6 A;  3L4P A;  2WXJ A;  3U7D A;  1B9R A;  4MH0 E;  4BZA A;  2Z0E B;  1IPG A;  1FD6 A;  4RFB A;  2WQY B;  5AZF A;  3QA8 A;  1JQ4 A;  2BBC A;  4XYC A;  3TIX A;  4L1B A;  1TIF A;  2JRI B;  5D3I B;  5LXH A;  2MRP A;  1N63 A;  1EF1 A;  4P1B C;  2KDF B;  5G5H A;  2AEH A;  2QIE B;  4BKS A;  1L7Y A;  4XWT A;  2W54 A;  3W1Y A;  3W2D A;  1K50 A;  3Q3F A;  2WDT B;  1KH0 A;  4ARC A;  2KN5 A;  4YTN B;  4LDT B;  3URY A;  4AQ7 A;  1J7A A;  4ZRP A;  1CZP A;  1LO5 D;  2YLM A;  1FFV A;  1QT9 A;  3W1S C;  1WR6 E;  2PIA A;  2KWD A;  1JWU D;  1HTQ A;  3VRB B;  3AV8 A;  2G4D B;  2SEB D;  1HTO A;  1F2R I;  2WYQ A;  3AEG B;  1FNU A;  2J4X A;  3CST A;  2K6D B;  3DWG C;  2GBM A;  2L32 A;  3APC A;  2KAC A;  2J42 A;  2BT6 A;  2LD9 A;  3KUD B;  4IG7 B;  1ZE3 D;  2KOX A;  4IWO A;  3OJ3 A;  3VR9 B;  2KMC A;  3BVM A;  2KVR A;  4A6Q A;  3TMP B;  2AQ2 B;  4IKG A;  2LVQ A;  1P7F A;  4M8M A;  2GBR A;  5D6J B;  3SD5 A;  1T0R C;  3T9L A;  3AEA B;  2JUO A;  4OW0 A;  1XQQ A;  4S17 A;  2KTR A;  2MHJ A;  1T0S C;  4RGT A;  1YQ3 B;  4E74 A;  3C8Y A;  5IN7 A;  3BY4 B;  2KT7 A;  1R4M B;  1E7U A;  3I9V 1;  1PYW D;  3OWE B;  1JWA D;  2LZ6 A;  3TUO A;  2KO3 A;  3APF A;  1N60 A;  2QDF A;  3PLU A;  3VTV A;  4P16 A;  3RFZ B;  3I63 C;  1ZDV A;  1WMH A;  5E6P A;  3TEZ A;  1OFF A;  3TL5 A;  2OHF A;  5BMG A;  1UZX B;  2VRR B;  1YN4 A;  2AQ1 B;  5IA7 A;  4KV2 A;  5GMV A;  4FJY A;  2PPH A;  1VD2 A;  1CQV A;  2FNJ B;  4O1N A;  3B2F A;  4A3P A;  2DAJ A;  1DYQ A;  4MJS B;  4KGS A;  2WXR A;  2VZK B;  2MBQ A;  3B1L X;  5LXI B;  1C78 A;  3IFW B;  2WXN A;  5EE1 A;  2NR2 A;  4AJY B;  1JRU A;  5DPW A;  4OVZ A;  4KKI A;  1XT9 B;  3AN1 A;  2M17 A;  4FLH A;  3VH3 B;  3PTF C;  2CU1 A;  3QCA A;  2RDB C;  2RR9 A;  5FK9 C;  3UQB A;  1UH6 A;  2KLC A;  1WGK A;  4WH4 A;  1E7V A;  2DYO A;  3ZQ4 A;  2CKH B;  2PMV A;  3W5V B;  3Q8C A;  1Y56 A;  3PRE A;  4N59 A;  2MBE A;  4TV3 A;  4RGM A;  4NPN A;  2KZR A;  2VH2 A;  3B0A A;  4WIP A;  2LRW A;  3A33 B;  3WAN A;  1V49 A;  1ZKH A;  4GDL A;  2D5G A;  2A5U A;  3OAW A;  3K9O B;  1BUI C;  1F0Z A;  2FIF A;  1WRI A;  5DCN A;  4GOC A;  4BVU C;  1DOX A;  5CTR C;  3KUC B;  3RZF A;  2V4I B;  4RGO S;  1JW9 D;  5JZE B;  3P4S B;  4ZYS A;  3TEX A;  3N9Y C;  4WQM A;  1N6Z A;  3NS8 A;  2KMM A;  2KC1 A;  3IG3 A;  3PT2 B;  2BS2 B;  4LNK A;  3CWI A;  2KFJ A;  2QHO A;  4NNJ B;  4URK A;  2K39 A;  3U8Z A;  4ANV A;  3A9K A;  2QEJ C;  3AU5 A;  2MWS B;  4NQL B;  5IAA C;  1T6B X;  2WX0 A;  3QC8 B;  5AUI A;  4ASW C;  3N1Y C;  1R4M I;  4MEL A;  1ZXH A;  2LFI A;  2DZJ A;  1SGH A;  3WAM A;  4MDK E;  5JH5 C;  4HWI B;  1L2N A;  2N7J A;  2KKC A;  3Q69 A;  1WGG A;  3J9C A;  3ZNH B;  2EMS A;  1WGD A;  1TKE A;  4M0W A;  2KC2 A;  1V9J A;  2BKR B;  1ZOY B;  4DHJ D;  2DX5 B;  3ZDM C;  1KF6 B;  1BT0 A;  1FNW A;  2GBJ A;  4DK5 A;  2M1M A;  1I4G A;  1SIF A;  3TJP A;  1T5X D;  4EZL A;  5AEK B;  4AOF A;  3PSE B;  2N9L A;  2LEK A;  2QCZ A;  3KWL A;  4FHJ A;  2BB6 A;  4ZRI A;  2JF5 A;  4W9H A;  3ZJT A;  2KMA A;  2CJO A;  2LWP A;  1FXI A;  4OZA A;  1PFD A;  2K8H A;  4DWF A;  4L23 A;  4W9E A;  3MC0 B;  1UGM A;  3HVD A;  4XZ4 A;  2J7Q B;  4NY0 A;  4KSK C;  4I6P A;  1V81 A;  4BBN F;  2VZK D;  2XK5 A;  2WDR B;  4KIK A;  2JVC A;  2W55 A;  4WQO B;  2N9X A;  5IKC M;  4NAW B;  1D5Z C;  4OZC A;  4TKN A;  2XN9 C;  2JU6 X;  1TKY A;  3GE3 C;  4HVB A;  1WYG A;  4TQ0 A;  2BB5 A;  2XK5 B;  2B3A A;  1WGR A;  1V86 A;  3DDC B;  3BVZ A;  1F52 A;  3RMK C;  1SJH D;  4NAW A;  1R4N B;  3AE9 B;  2K8C A;  2WHI A;  2H89 B;  2ON8 A;  3Q8B A;  4LNN A;  2O2V A;  3UQA A;  4DDI D;  1L5P A;  4I6N B;  4ZRQ A;  2WS3 B;  4A20 A;  3A9J A;  3E9S A;  2QMT A;  4MM3 A;  2N9P C;  4LNI A; 
#chains in the Genus database with same CATH homology
 4CO7 A;  2RD0 A;  2IZV B;  2ZZP B;  2G45 B;  2ZEQ A;  3LDZ E;  4JIO U;  4JQW C;  3UF8 A;  4BOS C;  1WGH A;  2L76 A;  4B6W A;  2L0F A;  3JW0 X;  4IWP A;  4HPM B;  2JT4 B;  3VTU A;  2KLG A;  1YJ1 A;  2RGF A;  3L08 A;  4FJZ A;  4PYZ A;  2MP2 A;  1UBQ A;  4GDK A;  4WWO A;  1WXA A;  2ZPN A;  3JYU A;  3VAW A;  2R2Q A;  4WWN A;  3MHS D;  4EKU A;  3R7R A;  4WJQ A;  3KH0 A;  2RSU A;  3ZDT A;  2DZM A;  2D07 B;  5D2M B;  1H4R A;  3VXW A;  1WJ4 A;  4DHZ E;  2LUE A;  2OOB B;  3DBS A;  1H8C A;  3VTW A;  1ZGU B;  3UGB B;  3VFK A;  1I42 A;  2KDE B;  5J2R A;  2PEA A;  1LFD A;  3DBL I;  3M3J A;  4JL9 A;  2V1Y A;  2NPT B;  2V4L A;  4IWQ A;  1M94 A;  4KDL B;  4EZJ A;  3AUL A;  3UIO B;  4PYU A;  2MBB B;  3H6N A;  1LQB A;  1WJU A;  4K7U A;  3DQV A;  3L13 A;  3VDZ A;  4B95 A;  1J8C A;  2JWZ A;  1WE7 A;  2KXJ A;  3M62 B;  1GUA B;  2A4Z A;  3C0R B;  3GZN I;  1MG8 A;  1NI2 A;  2KWC A;  2NBV B;  3ALB A;  3KYD D;  5L83 A;  2PJH A;  3IHP C;  4LJO B;  4EOY A;  2AWT A;  1X1M A;  2KWU B;  3DBH I;  4FUL A;  4HK2 A;  3UIN B;  3BIN A;  2HE7 A;  4MGK E;  3L17 A;  3O65 B;  4FJV B;  2I1J A;  2GMI C;  4OVV A;  3H9D A;  1WF9 A;  2N9E B;  4RM8 A;  3WAP A;  2BWF A;  3NHE B;  1E8X A;  3PLV A;  4W9D A;  1K8R B;  2LAS A;  3U7D A;  2K6Q A;  2LI5 A;  1TTN A;  2KJH B;  4MH0 E;  4MSM B;  2Z0E B;  2D2Q A;  1IPG A;  5AZF A;  2W9N A;  3DBR I;  3QA8 A;  3TIX A;  2J0M A;  4ZDV A;  3ZNG C;  2JRI B;  5LXH A;  2MRP A;  2O2V B;  1EF1 A;  4K1R B;  1CMX B;  2L7R A;  3UIP B;  3WAL A;  1U4A A;  2KDF B;  2C7H A;  3ZVV A;  2AEH A;  2FCM A;  3PRZ A;  1WXS A;  1Z5S B;  2Z0D B;  1L7Y A;  4BKS A;  4GSW A;  1WJ6 A;  3W1Y A;  2KDI A;  2ZJD A;  2MSE D;  4XX5 A;  3OJ4 B;  1TGZ B;  3LJ3 A;  4BOZ B;  4E71 A;  3A1Q B;  3Q3F A;  1WMH B;  2WDT B;  3HM3 A;  2IO0 B;  4GXB A;  2KN5 A;  2KQ7 A;  2O6V D;  4LDT B;  1GJZ A;  3R3M A;  2IY0 B;  3SU8 X;  2YLM A;  3QIJ A;  3A4R A;  3PHX B;  3W1S C;  3JSV B;  1WR6 E;  2FCQ A;  5G55 A;  2MQJ A;  3WA0 A;  2J0K A;  2D11 A;  3GOE A;  2KAN A;  3HK0 A;  1NBF C;  3V62 A;  2G4D B;  4IM3 A;  1AAR A;  4FN2 A;  4II3 B;  2WYQ A;  1UBI A;  4TUU A;  1G6J A;  3CST A;  2K6D B;  2C7M B;  2MBH A;  2GBM A;  1YD8 U;  3APC A;  4X57 B;  5D94 A;  2LD9 A;  3KUD B;  4IG7 B;  1WIA A;  3PGE A;  2KOX A;  3NOB A;  2N1V A;  1F9J A;  4IWO A;  1V5O A;  1V6E A;  2BGF A;  3OJ3 A;  2DYM A;  3IVF A;  2REX A;  2GBN A;  2KMC A;  2KVR A;  3ZLZ A;  3HIZ A;  2G4S A;  4HPL B;  3TCA A;  1E5W A;  4F1S A;  3TMP B;  4HDO A;  4EEW A;  4DHZ B;  2LVQ A;  4LJP B;  3ZW3 A;  3DVG Y;  3ONS A;  4M8M A;  2GBR A;  1RFA A;  5D6J B;  2ZCB A;  2NS5 A;  2BYV E;  3A4S C;  3SD5 A;  1R4N I;  1GNU A;  4I6L B;  4YL8 A;  3T9L A;  3WAO A;  2JUO A;  1WI0 A;  1Q0W B;  1XQQ A;  2KTR A;  2G3Q B;  3AI5 A;  3ZKJ C;  2J0J A;  1S3S G;  2N7D A;  4XC2 A;  1WRD B;  2DAF A;  3ZRF A;  1GC7 A;  4IM0 A;  2JPH A;  1Q1O A;  4E74 A;  1E90 A;  2DEN B;  2ZVO A;  3QJZ A;  4HDQ A;  3BY4 B;  5KHQ A;  4AUQ C;  3EHV A;  2MX2 A;  1E7U A;  3TBL D;  3MJW A;  2EKE C;  2M4N A;  1IP9 A;  2FID A;  2N1W A;  4E3C A;  3M95 A;  3ZNI D;  3QX1 A;  4EFO A;  2DYB A;  2ZNV C;  3KW5 B;  1YIW A;  2LZ6 A;  3L10 B;  3R7Q A;  3I3T B;  2KO3 A;  3ZTC A;  1EO6 A;  3APF A;  4DDG D;  2ZPY A;  4EUT A;  4RMA A;  3RD2 A;  3PLU A;  4IW0 A;  5C23 A;  2BYF A;  5CX3 A;  3VTV A;  4LCD E;  1P9D U;  3L54 A;  2KFK A;  2JRH A;  3CF6 E;  2GBK A;  3QAQ A;  1WMH A;  1J0G A;  5E6P A;  4GDL B;  2JY6 A;  3IBE A;  4P7I A;  1A5R A;  2NPT A;  3DVN U;  2CHW A;  2IO3 B;  4HCP B;  3TL5 A;  2KTF A;  1WYW B;  3RCZ A;  2DHZ A;  1UZX B;  2VRR B;  4DHJ B;  2O6V B;  1J19 A;  3S2A A;  4W9K A;  4KDI C;  1YQB A;  5IA7 A;  3H7P B;  3PRM B;  1ISN A;  2IY1 B;  4KV2 A;  1RLF A;  5GMV A;  4KSL C;  4FJY A;  1RRB A;  2PPH A;  2WWZ A;  2MLB A;  1VD2 A;  5CHV C;  3SDL C;  3VUX A;  2IBI B;  2FNJ B;  5LLI A;  4F7Z A;  2ZCC A;  1OQY A;  4KIK B;  2V3S A;  4A3P A;  5J18 A;  2DAJ A;  1WJN A;  3MTN B;  3ML8 A;  4LDT D;  2HD5 B;  4MJS B;  2BKF A;  2ZNV B;  4BBN C;  2CS4 A;  2MBQ A;  4ICU A;  3B1L X;  4JGH B;  5LXI B;  1TBE A;  3ZNZ B;  3R66 C;  4KZ0 A;  3IFW B;  1I35 A;  1KJT A;  2D3G A;  2EMT A;  2NR2 A;  4AJY B;  1JRU A;  4WAA A;  5DPW A;  2AL3 A;  2CHX A;  4IM2 A;  1KM7 A;  1XT9 B;  2BF8 B;  2YVC A;  3A9K B;  1Y8R C;  3ML9 A;  2M17 A;  4FLH A;  3VH3 B;  3PTF C;  2UWQ A;  1EF5 A;  2CU1 A;  2KJR A;  2IYD B;  3DVN V;  3QCA A;  4G0N B;  2RR9 A;  4KZC A;  3AXC A;  1XD3 B;  3N30 A;  3UQB A;  2JXX A;  1UH6 A;  2K1F A;  2JZZ A;  2C9W B;  5L95 C;  1OEY A;  2LVP A;  2KLC A;  3NY5 A;  1WM2 A;  1P1A A;  2N4F A;  1E7V A;  1E8W A;  2DYO A;  2I1K A;  3D32 A;  2KJ6 A;  4M8N A;  2CKH B;  1WZ3 A;  2MCN B;  3ZTD A;  1WX7 A;  3P2B A;  3H1U A;  2DZI A;  3X0W A;  3HM6 X;  1YX6 B;  3PRE A;  1P98 A;  1Z2M A;  2MBE A;  4HCN B;  3V61 A;  1OTR B;  4W9L A;  2UYZ B;  4TV3 A;  1D3Z A;  2WX1 A;  4NPN A;  2HJ8 A;  3APD A;  3NZS A;  1EUV B;  2KZR A;  4GDK B;  4OVU A;  3B0A A;  5DPR A;  3H7P A;  2LXC A;  2LRW A;  3V60 A;  3EC8 A;  3RUL A;  3ZUN A;  3AU4 A;  3A33 B;  2PE9 A;  1WZ0 A;  3WAN A;  1V49 A;  3QAR A;  1ZKH A;  4M0W B;  1WH3 A;  2HTH A;  4GDL A;  3HHM A;  4ZYN A;  2L3Z A;  3ENE A;  3PPA A;  3L0W B;  2A5U A;  3OAW A;  4MEM A;  1S1Q B;  4W9C A;  2K25 A;  4HLE A;  4BFR A;  1ZW7 A;  3K9O B;  2FAZ A;  2FIF A;  4W9I A;  2OJR A;  5DCN A;  4GOC A;  4BVU C;  4MGZ E;  1NDD A;  5CTR C;  3KUC B;  1OGW A;  4IUM B;  3RZW C;  4FAD A;  1LXD A;  4G3X B;  2GOW A;  3N32 A;  4G11 A;  4ICV A;  5J17 A;  1VCB A;  3PZD A;  3RZF A;  3VH4 B;  2LGX A;  2L05 A;  3KYC D;  5JZE B;  3V6E B;  4WJN A;  2PE6 B;  2LGY A;  1WE6 A;  4FA6 A;  1QZE A;  3A1Q A;  2JZ3 B;  2DZK A;  3CMM B;  4JLC A;  3NS8 A;  2LVO A;  2M8S A;  2KC1 A;  1P0R A;  4DXA B;  3IG3 A;  3PT2 B;  3X23 A;  4FBJ B;  2BWE S;  4NNJ B;  2KFJ A;  2QHO A;  4HXD A;  4PS3 A;  1PQS A;  4AP4 C;  1E8Y A;  2KWV B;  2LRU A;  4URK A;  1UD7 A;  2Y5B B;  4PS7 A;  2K39 A;  5CHF A;  4FHK A;  4WWP A;  1YX5 B;  3U8Z A;  4ANV A;  3A9K A;  1WGY A;  5DPS A;  1E8Z A;  1WY8 A;  3AU5 A;  5JHB A;  5EDS A;  2MWS B;  4NQL B;  5IAA C;  2XBB C;  2WX0 A;  3QC8 B;  3PS6 A;  3EFU A;  4ASW C;  2O6V A;  2N7E A;  2M0X A;  5KHO A;  2MW5 A;  1WM3 A;  4CHK A;  4MGY E;  4K81 A;  1R4M I;  2BYE A;  2FUH B;  4MEL A;  1WXV A;  4BKG A;  4DBG A;  1Q5W B;  1TZ1 A;  2RPQ A;  2NVU I;  2DZJ A;  2KHW B;  4N9F 4;  1SGH A;  4WJO A;  3KUZ A;  3QWZ B;  3WAM A;  4MDK E;  3H7S A;  5FR6 A;  2FCS A;  5JH5 C;  4HWI B;  5DPT A;  1L2N A;  1P3Q U;  1WXM A;  2LXA A;  4MJS A;  2KKC A;  2C5L C;  4G50 A;  2LJ5 A;  1KLV A;  1WGG A;  3KVF B;  4GN1 A;  2BPS A;  3DCG A;  4GIV A;  3CSF A;  3PVL A;  3ZNH B;  3L16 A;  2EMS A;  4ANU A;  1WGD A;  4CYE A;  5E6N A;  2MBO A;  1V9J A;  2KC2 A;  5C1Z A;  1SE9 A;  4K7S A;  2XEW A;  3B08 A;  2BKR B;  3U30 A;  4II2 B;  4IC7 B;  2C7N B;  1T0Y A;  3V6C B;  2ASQ A;  2KX0 A;  4ANW A;  4DHJ D;  2LGD A;  4TQ1 A;  4MSQ B;  2DX5 B;  5TR5 A;  3ZDM C;  1BT0 A;  3QK0 A;  2GBJ A;  4DK5 A;  4W9F A;  1WR1 A;  2KTR B;  2M1M A;  1SIF A;  3QQ8 B;  3TJP A;  4EZK A;  3DOW A;  2AYO B;  4ZRK A;  4AOF A;  4EZL A;  3PSE B;  2CHZ A;  3VQI A;  5AEK B;  4FHJ A;  2IO1 B;  3M63 B;  1GC6 A;  5BO4 B;  4ZRI A;  2JF5 A;  4W9H A;  3PRP B;  3RUI B;  1RAX A;  2FCN A;  5E6O A;  2KMA A;  2LWP A;  2MP2 B;  2MA9 B;  4GU2 A;  2K8H A;  1WX9 A;  4NJ6 A;  4BKT A;  4DWF A;  5AZG A;  4W9E A;  1C1Y B;  3JSV A;  2KFK B;  1GG3 A;  1UGM A;  2L8J A;  2KX3 A;  2L0T A;  3ECI A;  3OLM D;  3VVW B;  3ZO5 B;  4XZ4 A;  2J7Q B;  4MGI E;  4NY0 A;  3PHW B;  5HKH A;  2K8B A;  3EEC A;  4AWJ A;  2KQS A;  4I6P A;  1V81 A;  1V5T A;  4KSK C;  4BBN F;  2CR5 A;  3QHT A;  2XK5 A;  2KK8 A;  2KD0 A;  3JVZ X;  4PS8 A;  4WJP A;  1IYF A;  2C60 A;  4KIK A;  2L00 B;  2NBW B;  2R2O A;  2JVC A;  4GGQ A;  5AZH A;  3WIM A;  4J6I A;  3Q3J A;  3DVG X;  4WQO B;  1KOT A;  2N9X A;  2D10 A;  2KNB A;  5JHA A;  1V2Y A;  4NAW B;  1OEY J;  3VUW A;  2KDB A;  2Z59 B;  3RT3 B;  4TKN A;  4RM9 A;  4GB9 A;  4NQK E;  1LM8 B;  3VHT C;  1UEL A;  1FXT B;  4HVB A;  2NCN A;  1HE8 A;  1V80 A;  3DPD A;  4HJK A;  3W1S A;  4TQ0 A;  4W9J A;  4BKS D;  2XK5 B;  4NJ7 A;  2B3A A;  5D7G A;  1WGR A;  1V86 A;  3DDC B;  3T8M A;  1C3T A;  4NAW A;  1WFY A;  4W9G A;  2K8C A;  4ZRJ A;  5CHW A;  3UQA A;  2O2V A;  3ZIM A;  3ZRC A;  3PV1 A;  4DDI D;  1WX8 A;  2NBU A;  4I6N B;  4ANX A;  3K9P B;  4B9K A;  3NZU A;  2AL6 A;  4KVG B;  2IO2 B;  5G2N A;  4A20 A;  4A3O A;  3SHQ A;  4GMV A;  4AJW A;  3A9J A;  4K7W A;  3N3K B;  3RYT A;  4MM3 A;  3A9J B;  2N9P C;  3VUY A;  2ZVN A;  4F8C B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...