2NPTA

Crystal structure of the complex of human mitogen activated protein kinase kinase 5 phox domain (map2k5-phox) with human mitogen activated protein kinase kinase kinase 2 phox domain (map3k2-phox)
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
106
structure length
102
Chain Sequence
SMALGPFPAMQVLVIRIKIPNSGAVDWTVHSQLLFRDVLDVIGQVLPEATTTAFEYEDEDGDRITVRSDEEMKAMLSYYYSTVMEQQVNGQLIEPLQIFPRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Dual specificity mitogen-activated protein kinase kinase 5
publication title Crystal Structure of the complex of human mitogen activated protein kinase kinase 5 phox domain (MAP2K5-phox) with human mitogen activated protein kinase kinase kinase 2 phox domain (MAP3K2-phox)
rcsb
source organism Homo sapiens
total genus 21
structure length 102
sequence length 106
chains with identical sequence C
ec nomenclature ec 2.7.12.2: Mitogen-activated protein kinase kinase.
pdb deposition date 2006-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00564 PB1 PB1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2nptA01
4HLEA 2J7QB 1OQYA 4HWIB 3AULA 4CHKA 4NY0A 3DCGA 1WMHA 3UIOB 3WAOA 4KV2A 3S2AA 3ZLZA 4RM9A 3EHVA 4I6LB 4HPLB 2AL6A 1XT9B 2N1VA 4LJOB 1XD3B 1ISNA 3IVFA 1HE8A 5IAAC 3VAWA 4KZCA 3AXCA 4KZ0A 3W1YA 1QZEA 1WJ4A 2DYBA 3ML8A 4NJ6A 3V61A 1WJNA 5D94A 4BKGA 3B0AA 2NPTA 2NBVB 4GIVA 3RD2A 3QARA 1F9JA 2RSUA 4ANXA 4ZDVA 2GBRA 2LUEA 5G55A 5LXIB 4WJNA 5LXHA 2L00B 1KLVA 1E90A 2VRRB 2Z0DB 2YVCA 3IG3A 1X1MA 3A4SC 4GDKB 2YLMA 3JVZX 2BWFA 3JSVA 3PPAA 2IO3B 4BFRA 2XK5B 4WWNA 3L13A 5KHOA 1R4MI 4LDTB 3QJZA 1V6EA 1UH6A 2BKFA 2IY0B 2AEHA 2O6VA 1CMXB 4G11A 3NY5A 2JRIB 2PPHA 3SD5A 3RCZA 2A5UA 4MGYE 3N3KB 4ZRIA 2JF5A 1XQQA 4EKUA 4HCNB 3ALBA 4GGQA 1EF5A 2HD5B 1NDDA 1WXMA 3PREA 2K6DB 1V9JA 4GU2A 2C9WB 2JT4B 2D07B 3VVWB 3U8ZA 4DWFA 1H4RA 3L16A 2K39A 2DAJA 2DZMA 4WJQA 4RM8A 2V3SA 4KIKB 3QK0A 4MEMA 2N4FA 2WWZA 4M8NA 2Y5BB 1D3ZA 3ZDTA 4K81A 3K9OB 4CO7A 3A4RA 4JGHB 3OJ4B 2FNJB 2AYOB 1I35A 1IYFA 2AL3A 1V5TA 4FA6A 1LM8B 3CSFA 4PS3A 3H7PB 3ZO5B 3PVLA 2KK8A 2N7DA 4HPMB 4FLHA 4W9HA 2KTRB 3RUIB 5JH5C 4MM3A 3B08A 3V62A 3ZNGC 1P9DU 3L08A 1UZXB 2KOXA 2FCMA 4IM2A 2ZCCA 3VUXA 2LRWA 4ANUA 3PRMB 1NBFC 2KWUB 3SHQA 4GOCA 3TJPA 4JL9A 2N9EB 1UBIA 1WXVA 2MBHA 4IWPA 1WGDA 3WAMA 1WYWB 4BBNF 3Q3JA 4PYZA 3VHTC 2JVCA 3DVNU 4AJWA 1AARA 3ZDMC 3QWZB 5EDSA 3IFWB 3B1LX 3U7DA 3CSTA 1OTRB 4JIOU 5D2MB 5D7GA 3WIMA 4B6WA 2MBQA 1RFAA 4FADA 4MELA 4AOFA 3CF6E 2ZJDA 2CHZA 4RMAA 3ZVVA 1WRDB 4ASWC 1EO6A 1TBEA 1Z2MA 2C7NB 4MSQB 4EUTA 2KMCA 3UQBA 1R4NI 2GOWA 4FJYA 2BYFA 1LFDA 2BF8B 3OLMD 4AP4C 3L10B 1Q5WB 2KJRA 4P7IA 4W9DA 1BT0A 3VXWA 3VFKA 2EMSA 4J6IA 3N32A 5CHWA 2ASQA 2KQSA 2MBOA 2JWZA 1P3QU 2RD0A 1G6JA 2LASA 2XK5A 2NBWB 3M63B 1SE9A 3ZUNA 2KTFA 1WE7A 4YL8A 3AU5A 2MP2B 2K8HA 4DDID 4HDOA 4W9KA 2DYMA 4EZJA 2KANA 1OGWA 4DDGD 4GB9A 3N30A 3ZTDA 5GMVA 2L76A 3ECIA 4FULA 3R7QA 2KC2A 2LRUA 1Q0WB 1YX6B 4I6PA 4DBGA 3MJWA 2BGFA 1Y8RC 4W9LA 4EZKA 2O2VB 2L7RA 3NZUA 4PYUA 1WR1A 4HCPB 3ZKJC 2NBUA 1J0GA 1C1YB 2KFJA 2M8SA 4MDKE 1WGGA 2LVPA 3L0WB 2KZRA 3ENEA 3D32A 2ZVNA 3APFA 1Q1OA 3LJ3A 1KOTA 1ZW7A 2J0JA 2W9NA 4KIKA 2XEWA 1ZGUB 2K25A 2WDTB 4XC2A 4OVUA 4IWOA 1J8CA 3A9JB 1TGZB 3A9KB 2UWQA 3HHMA 4IM0A 2RGFA 2KC1A 1YJ1A 4DHJB 2MSED 1IP9A 2ZNVB 1WM3A 3QAQA 2ZEQA 2IO0B 4F1SA 2KTRA 3VTVA 1RLFA 2ZPNA 1M94A 3EC8A 4LDTD 2C5LC 1GUAB 1J19A 1GJZA 1WGHA 2D3GA 4XX5A 1WI0A 2FUHB 4NNJB 4W9EA 4F7ZA 2KX3A 2UYZB 4K7WA 1I42A 2BYEA 3M95A 4ZRJA 2PJHA 2OOBB 2A4ZA 2KQ7A 3DBRI 1PQSA 1EUVB 2LXCA 4G3XB 2M17A 4II3B 2K1FA 3PLUA 4ICUA 3ZTCA 2FCNA 2DZKA 2LWPA 4KSLC 2J0KA 4MGZE 4WJPA 3PRPB 2D2QA 3VTUA 1WX8A 3I3TB 1V81A 1OEYJ 1WH3A 3QA8A 3A1QB 4MJSB 1VD2A 4A20A 2FIFA 3VTWA 1LXDA 1WM2A 3DPDA 4FHJA 5TR5A 2L8JA 5AZHA 2PEAA 4DXAB 2MCNB 2K8BA 4HXDA 3L17A 3WAPA 3EECA 4BOSC 3QCAA 3GZNI 5E6PA 2GBNA 3R7RA 2HE7A 4A3OA 3QHTA 2KD0A 2CS4A 2ZPYA 3UIPB 1KM7A 2NVUI 3R3MA 2LVOA 1WX7A 3O65B 4NAWA 2BKRB 4W9CA 2CHWA 4F8CB 2MP2A 4ANVA 4GSWA 2PE9A 4A3PA 4G0NB 2MLBA 2KO3A 4GMVA 1S1QB 3ZNZB 2LGXA 4W9GA 4NQKE 4KVGB 1GC7A 2KFKB 1JRUA 2RPQA 2G4SA 3EFUA 3KUZA 3RYTA 3X23A 1WXSA 3LDZE 4OVVA 4W9FA 5CHFA 2BWES 3ZNID 4TQ0A 4FJZA 3VUYA 3X0WA 3Q3FA 3NZSA 2KVRA 3V6EB 4ICVA 3UQAA 2O2VA 3DVGX 2KHWB 1E8XA 4W9JA 2JUOA 3H1UA 3V6CB 4MGIE 1E7UA 3AU4A 4PS7A 3APDA 3L54A 1WFYA 1E8WA 1V5OA 2LVQA 1Z5SB 2GBMA 2JPHA 5JHAA 2KDIA 1KJTA 3BY4B 2KKCA 3TMPB 4IC7B 3K9PB 5DPWA 1TZ1A 2I1JA 2BYVE 2KJ6A 1ZKHA 4BBNC 1L2NA 1GC6A 4TQ1A 4ZRKA 3DDCB 3ZNHB 1WGRA 4GDKA 2AWTA 5DCNA 4CYEA 1UELA 3ZRFA 3A9JA 3A9KA 3ZW3A 1C3TA 2MA9B 4E3CA 2GBJA 3V60A 2JZZA 1WXAA 4IM3A 4GDLB 1WZ3A 2LXAA 1EF1A 4X57B 1H8CA 4EOYA 5LLIA 3TL5A 2LD9A 1P1AA 1V86A 2CU1A 2L3ZA 3M62B 3IHPC 4NPNA 5BO4B 1GNUA 3VH3B 2FAZA 4WQOB 2DZIA 4DK5A 2IYDB 1VCBA 2REXA 3JYUA 3ONSA 4EFOA 1YX5B 1V49A 1P98A 2KDEB 2N7EA 2GBKA 2GMIC 2V1YA 1S3SG 3RT3B 2KMAA 1V80A 3HK0A 2JRHA 2DX5B 2FCQA 4HJKA 2IY1B 4MGKE 5DPTA 5E6OA 3NOBA 1WIAA 3NS8A 3UGBB 3VQIA 3KYCD 2KJHB 5J17A 4K7SA 4EEWA 5JHBA 2KNBA 2G4DB 2FCSA 2R2QA 2LGYA 3W1SC 1E8YA 1E8ZA 3UINB 4IWQA 4FBJB 4MH0E 3KW5B 3CMMB 3A1QA 4FJVB 1WJ6A 2DENB 2LZ6A 1WY8A 2KWCA 3P2BA 2JXXA 2MBBB 1GG3A 1RAXA 3GOEA 3RULA 4KSKC 4I6NB 4K7UA 5C23A 5CX3A 2XBBC 3PV1A 3H7PA 3SU8X 2L05A 2Z59B 1YIWA 2IBIB 3PT2B 1NI2A 3PLVA 3HM6X 4HDQA 4FN2A 3U30A 4DHJD 3BINA 4MJSA 4GN1A 4IG7B 2Z0EB 4LJPB 5KHQA 2IZVB 3PHXB 2WX1A 2ZNVC 3SDLC 1IPGA 3PZDA 1MG8A 4TV3A 3ZIMA 3DBHI 1T0YA 2L0FA 4KDLB 1LQBA 2I1KA 3PRZA 2CKHB 1UD7A 4MSMB 1WX9A 2LI5A 2EKEC 1FXTB 4JQWC 4IW0A 2KFKA 2KWVB 5C1ZA 4FHKA 4M0WB 2LJ5A 3T8MA 4URKA 1WF9A 2KXJA 2N9PC 2NR2A 5FR6A 2D10A 2K6QA 3TBLD 3ZRCA 4AWJA 2K8CA 4E74A 5E6NA 1U4AA 1WGYA 3APCA 2ZZPB 4ANWA 2DZJA 2LGDA 4KDIC 1WMHB 4II2B 5L83A 3KYDD 5JZEB 2M0XA 2MRPA 4WWPA 3KUDB 2C7HA 3C0RB 2MQJA 5J18A 1YD8U 5J2RA 4PS8A 3QQ8B 4BKSA 4BOZB 2IO2B 3MHSD 3DBLI 2NPTB 2OJRA 2M4NA 3DVGY 2EMTA 2MX2A 3WANA 4AUQC 3H7SA 4GDLA 3HIZA 1WZ0A 3PTFC 3AI5A 1WR6E 4B95A 3NHEB 3OAWA 4WWOA 3TCAA 3DBSA 1E5WA 2G3QB 3QX1A 3JSVB 4K1RB 2DYOA 3MTNB 2N9XA 3QC8B 3PS6A 4TUUA 5IA7A 2KDBA 3PSEB 5CHVC 4GXBA 3DVNV 4DHZE 3A33B 2N1WA 2O6VB 1P0RA 2RR9A 2JY6A 2G45B 3HM3A 1SGHA 4DHZB 4BKTA 2QHOA 2O6VD 3W1SA 4E71A 2BPSA 1E7VA 3KVFB 4NQLB 2JZ3B 2B3AA 1L7YA 3DOWA 2KN5A 4B9KA 3PHWB 2MW5A 4WAAA 3WALA 1RRBA 2KLCA 2ZVOA 3R66C 3H9DA 5DPRA 2KLGA 4HK2A 3VDZA 1A5RA 4N9F4 4LCDE 5AEKB 2R2OA 5D6JB 5DPSA 3QIJA 3H6NA 4M8MA 4JLCA 2V4LA 3RZFA 2FIDA 4BKSD 1SIFA 1UGMA 2MWSB 4BVUC 2MBEA 2KDFB 2NS5A 4IUMB 4HVBA 3UF8A 5CTRC 2L0TA 3DQVA 5AZFA 3RZWC 3ML9A 3T9LA 1YQBA 4ZYNA 2CHXA 2C60A 4W9IA 1V2YA 1OEYA 2J0MA 2ZCBA 3TIXA 3KUCB 2KX0A 3OJ3A 2CR5A 1UBQA 2WX0A 2C7MB 3KH0A 1TTNA 4TKNA 3VH4B 1WJUA 3WA0A 1K8RB 3IBEA 2NCNA 2D11A 2DHZA 3JW0X 3PGEA 4AJYB 3M3JA 5AZGA 3VUWA 1WE6A 4XZ4A 4NAWB 5HKHA 4WJOA 2HTHA 4EZLA 2HJ8A 4G50A 5G2NA 5L95C 2PE6B 4NJ7A 2DAFA 2WYQA 2M1MA 2IO1B
chains in the Genus database with same CATH superfamily
1HEZE 4HLEA 2J7QB 3N1ZC 4NY0A 3DCGA 2FUG1 1XLPA 3ZLZA 1AN8A 4RM9A 3EHVA 5IAAC 4KZCA 3AXCA 2L32A 5E6JA 4C4VB 1N61A 3NS1A 3B0AA 1CZPA 2G1EA 3QARA 1F9JA 3BYYB 3I5JC 5G55A 5LXIB 5LXHA 2VRRB 2YVCA 2B76B 2YLMA 2BWFA 2FE8A 4ZOHC 3IT4B 1UH6A 2AEHA 1L4DB 2PPHA 2CJNA 1T6BX 1PFDA 1V1OA 4ZRIA 1UWMA 2HTME 3W9CB 4GGQA 2RDGA 2WXLA 4KGTA 4GU2A 2D07B 2J53A 1RM6C 2Y5BB 4NJCA 1D3ZA 5FK9C 3ZDTA 3A4RA 3OJ4B 2WXGA 3AB5A 1LM8B 4PS3A 3Q3MC 1FPYA 2GB1A 3PVLA 4H2AA 2BB6A 2WNMA 3W5VB 1LGRA 1QQRA 3L08A 4NAMA 2YEPF 1F0ZA 3AH7A 3VUXA 4ANUA 3SFDB 2KWUB 2WXPA 4JL9A 1UBIA 3AMZA 1TKEA 4BBNF 3Q3JA 2JVCA 3DVNU 3QWZB 5EDSA 1XEEA 2K22A 2KMMA 3NZ3A 4FADA 4ASWC 1HZ5A 2J52A 2WU2B 4KKIA 2GOWA 4AP4C 4KGSA 4W9DA 2AX5A 2EMSA 4J6IA 1GB4A 2KQSA 2D3AA 1N62A 2JWZA 2WXJA 3M63B 4HKQA 1JWAD 4M0WA 2KTFA 4YL8A 3AU5A 1A70A 4HDOA 1OGWA 2L76A 4TMAB 4PK1A 1D5XC 2L7RA 1MPEA 3UI3A 3P4PB 2NBUA 3Q8CA 2M8SA 4MDKE 1WGGA 3ENEA 1UUPA 3APFA 4L2YA 2J0JA 4KIKA 1EU4A 1ZGUB 4QAYA 2K25A 4XC2A 1C4PA 4JPSA 3A9JB 1TGZB 3A9KB 4PT5A 4R3DA 2UWQA 2RGFA 4DHJB 1UGJA 3CIRB 4A8XC 4F1SA 2ZPNA 3VR8B 1GJZA 1GUAB 5MPOA 1WGHA 2D3GA 3RFZB 3GP7A 3R2TA 1YN5A 1MHHE 2WXQA 4ARCA 2BS4B 2WXMA 4L1BA 4MACA 1EUVB 2LXCA 4II3B 3PLUA 4WH4A 4ICUA 1K53A 3ZTCA 4MGZE 3C19A 2D2QA 2V3PA 4M02A 1QILA 1BXTA 3BVGA 3L4PA 1VD2A 4A20A 5AZHA 1F2RI 4OHJA 3GZNI 2GBNA 4ZYSA 4A3OA 2CS4A 2ZPYA 3UIPB 1KM7A 2E3TA 1WX7A 2MJDA 3O65B 4NAWA 4W9CA 1L5PA 4ANVA 4WQMA 2MLBA 1S1QB 2LGXA 2VZKD 1TKYA 4KVGB 2G4SA 3X23A 2KVZA 3RMKC 4TQ0A 2YEPB 4ICVA 2O2VA 4W9JA 3H1UA 3AU4A 2JQRB 3L54A 4PS7A 1L0XB 2DWQA 1Z5SB 5JHAA 3BY4B 4K3BA 1ZDXA 3AN1A 5D3DA 2AQ2B 2I1JA 2BT6A 3HUIA 1ZKHA 2LEKA 4USAA 3W2DA 4BBNC 1L2NA 1WGRA 1QOBA 1UELA 3BZDB 3HRDD 3ZW3A 2W3RA 4E3CA 4YSXB 1WXAA 4GDLB 1WZ3A 2LXAA 4X57B 1L0YB 2N9LA 2X38A 2CU1A 5BO4B 3VR9B 2IYDB 1VCBA 4KGRA 3JYUA 4EFOA 1YX5B 1FO4A 1P7FA 2AQ1B 1XXGA 2KMAA 2JX5A 5IO9A 4MGKE 1WIAA 3NS8A 1DOXA 4UDUC 1EM7A 4K7SA 2KACA 2KNBA 2G4DB 1ROEA 4FJVB 4MJSA 2LZ6A 3P2BA 1WY8A 1F1HA 3GOEA 1IGDA 4KSKC 4I6NB 3C8YA 4O1NA 4RGNA 5C23A 4US8A 2HDEA 1QLBB 1SE2A 2SEBD 3BINA 2IZVB 3PHXB 2ZNVC 3SDLC 1IPGA 2WDVB 3DBHI 4XYCA 1LQBA 3NG0A 2HJ1A 1UD7A 4MSMB 1WX9A 1FXTB 4JQWC 2KFKA 1ZPSA 1R4MB 1VDVA 2LJ5A 4AWJA 2K8CA 4E74A 1QF6A 1U4AA 3APCA 1SXTA 2JYEA 3ZJTA 4A55A 1ENFA 1SF0A 3R8BA 5L83A 5JZEB 5IKCM 4OZAA 4WWPA 2X8XX 3C0RB 1F2RC 1FRRA 3AE7B 2IO2B 4C7ZA 2K5PA 1KRHA 1TIFA 3PTFC 4WWOA 1E5WA 4K1RB 2RDBC 3PS6A 4TUUA 5IA7A 3DVNV 4Q2JA 2ZW0A 2G45B 3HM3A 1SGHA 4GLSC 2O6VD 3W1SA 3KVFB 1L7YA 1JWMD 1FM0D 2KLCA 1EU3A 1VZ7A 2WHIA 1K51A 5DPRA 2GRIA 4YTMB 5D6JB 5DPSA 3AE2B 1D5MC 1TT5B 2W3SA 1SIFA 4BVUC 2MBEA 3NVZA 2RPVA 2L0TA 3RZWC 3T9LA 1C78A 3TIXA 3KUCB 4RGOS 4HEA1 3WA0A 3JW0X 2WU5B 3VUWA 4EZLA 2HJ8A 5L95C 2WYQA 3AULA 4CHKA 1L4ZB 1WMHA 4KV2A 2CJOA 3B2FA 2GI9A 3BK1A 4XGAB 1XD3B 1ISNA 3VAWA 1HE8A 2QDFA 1JCKB 4KZ0A 1QZEA 2DYBA 3ML8A 1PGXA 2Y5PA 5GXGB 2NPTA 4ANXA 1FRDA 4WJNA 3IG3A 2IO3B 2XK5B 3QJZA 1V6EA 1MJDA 2BKFA 2O6VA 1FFVA 3NY5A 2JRIB 1TS5A 3SD5A 2A5UA 3Q14C 2UU7A 2ACZB 1TS2A 4EKUA 1I4HA 1L6UA 4HCNB 3PZ8A 1NDDA 3PREA 1XLOA 3DBRB 3P63A 5BYRA 2JT4B 3VVWB 1H4RA 2K39A 4WJQA 2V3SA 4MEMA 1VRAB 4K81A 3K9OB 1I35A 2AL3A 2WXKA 4CQNA 3ZXRA 3CSFA 3H7PB 3FC4A 2KK8A 3EFCA 3AEAB 2KTRB 1YNTE 4MM3A 3B08A 3KWVA 1F77A 3OG5A 1IBXB 1P9DU 3Q3OC 2KOXA 1FNWA 3ZJUA 3N9YC 2M19A 2BTEA 4HRSA 1M4VA 4WIPA 3HVZA 2Q5WD 1WGDA 3WAMA 3O13A 1WYWB 2I2YA 2BVCA 4KX6B 3ZGZA 1AARA 3ZDMC 3CSTA 4JIOU 5D2MB 3WIMA 3VRBB 1JRPA 1RFAA 4AOFA 2W82A 3SFEB 1CJEA 4RMAA 3ZVVA 4EUTA 3FKYA 2KMCA 4J3OD 2PTLA 1Q5WB 3IAM1 1QOFA 3VXWA 3N32A 4LNIA 4LTUA 5LNK1 2MJ3A 1SE9A 3ZUNA 1TZOA 3AE1B 4C7YA 2MP2B 2ON8A 4W9KA 3ZTDA 3ECIA 4FULA 4DBGA 4ZRQA 4I6PA 1V97A 1YJJA 2BGFA 4W9LA 3FILA 3NZUA 3CWIA 4HCPB 3SEBA 1KLUD 1WXQA 3L0WB 2KZRA 1V1PA 1F52A 3NVYA 1E10A 4EE2A 2Z8LA 1VZ8A 1OQQA 4IM0A 1T0SC 1IP9A 1WYGA 2IO0B 4IKGA 1K52A 3EC8A 4LDTD 4HPPA 4OZBA 2K0PA 1T0RC 1TJEA 4W9EA 1I42A 2DBYA 2A4ZA 3J9CA 1PQSA 4G3XB 1SB3C 2JSVX 2LWPA 1HZ6A 3IAS1 3PRPB 3I3TB 1OEYJ 1WH3A 3A1QB 1QOGA 5C3JB 4REZA 1NENB 2LGSA 1I4PA 1LXDA 1WM2A 3DPDA 5TR5A 2L8JA 4DXAB 1NYQA 4HXDA 3QCAA 1ET9A 2PW9A 2NVUI 1L6VA 1C76A 4MT5A 5EE3A 4A3PA 2KO3A 4W9GA 1GC7A 3EFUA 1WXSA 4OVVA 2BWES 3NVWA 3V6EB 3UQAA 2KHWB 2QJLA 1E8XA 3V6CB 1WSPA 1V5OA 1FIQA 4OVZA 1N5XA 1KJTA 4IC7B 3AE4B 2WXIA 3I63C 4M01A 4TQ1A 3ZNHB 4GDKA 4CYEA 3A9JA 3A9KA 1Y56A 2GBJA 2JZZA 1OFFA 4XE0A 4EOYA 1P1AA 3IHPC 3VH3B 4DK5A 2DZIA 4MH8A 3LYYA 1P7EA 4IDIA 1P98A 2N7EA 2GBKA 2Y3AA 1XLQA 1S3SG 3RT3B 3HK0A 2DX5B 3AM9A 4HJKA 2IY1B 5E6OA 3VQIA 2KJHB 4EEWA 5JHBA 4FBJB 4IWQA 3KW5B 3Q3NC 4NQLB 4FXCA 1RAXA 3RULA 3U2SC 1Q10A 2FBWB 4K7UA 4YSYB 1C4CA 3HVDA 5CX3A 3PV1A 1PGBA 1YIWA 1WRIA 3PT2B 3U30A 1MG4A 2DLBA 4IG7B 5KHQA 3PZDA 1MG8A 4TV3A 3ZIMA 2L0FA 1SIJA 2I1KA 2CKHB 1JALA 1QOAA 2KWDA 4M0WB 3T8MA 1MVKA 1WF9A 5FR6A 1PYWD 2K6QA 3GE8C 2L83A 3Q6BA 2DZJA 2PLPA 2LGDA 4II2B 1CK1A 3B9JA 1ZE3D 4LLGM 5J2RA 3QQ8B 4BKSA 2OJWA 2LMCA 4BOZB 2XN9C 1TS3A 4RGMA 1XCQL 3R2IA 3DVGY 2EMTA 1BUIC 4GDLA 3HIZA 1T5XD 1VZ6A 1WR6E 3NHEB 3OAWA 1HTQA 3DBSA 1MHXA 1J7CA 3SR6A 3JSVB 4M00A 3MTNB 5BMHA 2KDBA 4TSSA 5CHVC 4GXBA 5BMIA 5EE9A 3B2GA 1MFWA 2BPSA 3DOWA 4B9KA 4YXDB 2MW5A 4B0EA 3WALA 1T0QC 3V3XA 4YWGG 2KLGA 3VDZA 3TEWA 4LCDE 2R2OA 3H6NA 1YJIA 2V4LA 1SJHD 1JMLA 4IUMB 4BAXA 5AZFA 2AQ3B 4B0MA 1YQBA 2KAJA 2C60A 4W9IA 2ZCBA 2KX0A 4N59A 2WX0A 1TTNA 1K8RB 3VRAB 1C77A 2BYTA 1WE6A 4NAWB 5HKHA 4G50A 5G2NA 1ZXHA 3Q8FA 1DOYA 3I9V1 2MEKA 2LFIA 3UIOB 3WAOA 4LNNA 3S2AA 1E0ZA 2W55A 2AL6A 2N1VA 2WLBA 4P6VF 4NJ6A 4BKGA 5D94A 1I7HA 3RNGC 3DWMA 2LUEA 2L00B 5EE1A 3A4SC 2KYWA 3AE8B 3JVZX 2J42A 3MC8A 2V0GA 2IY0B 1CMXB 3MJ5A 1VR9A 2WXOA 4MGYE 3N3KB 2JF5A 2H88B 2MHJA 3I57A 2IGHA 5H92C 1WXMA 1AW7A 1SE3A 3N1XC 1ZOYB 4JE3B 4RM8A 4M8NA 2IDYA 4P16A 2K3UA 4CO7A 3MP9A 1UWXA 2AYOB 2WXHA 1ZP0B 3URYA 4YSZB 1YN4A 2D5GA 2N7DA 4HPMB 4FLHA 1J7BA 3RUIB 5JH5C 3V62A 3ZNGC 5HI1A 2BS2B 1JROA 2ZCCA 2VZKB 2LRWA 3RPFC 3PRMB 3TJPA 4GOCA 2N9EB 1FEHA 1WXVA 4IWPA 2G9HD 4PYZA 3VHTC 4L23A 3B1LX 3U7DA 1FMAD 4WWMA 4B6WA 4C00A 4MELA 3CF6E 2CHZA 1WRDB 1TBEA 1Z2MA 2I38A 4MSQB 5IOIA 1R4NI 4FJYA 4OZCA 2BYFA 1LFDA 1RFKA 2BF8B 3EUB2 2KJRA 1BT0A 1ZDVA 2MBOA 4XDCA 5IP4D 4IOIE 1N6ZA 1SEBD 1G6JA 3BVZA 2LASA 2XK5A 4ARIA 1R7SA 2RMMA 2DYMA 4EZJA 2KANA 4DDGD 3N30A 4WURA 1I4GA 2ICIA 5GMVA 1SJED 2KC2A 1B1ZA 1YX6B 3MJWA 1WR1A 3ZKJC 2KFJA 3D32A 3TEZA 2ZVNA 2OHFA 3LJ3A 1ZW7A 2W9NA 2XEWA 2BQQA 2WDTB 5H8YE 4OVUA 2NTSA 4IWOA 2KC1A 1YJ1A 2MSED 1I4XA 3QAQA 2KTRA 4JX1C 1AWDA 1M94A 2C5LC 2KDMA 1J19A 2BBCA 1IUEA 2EELA 5BYSA 2UYZB 4BZAA 4ZRJA 2N7JA 1RYJA 2PJHA 3TEXA 2OOBB 2KQ7A 2WXRA 1C9FA 2M17A 4ACFA 2K1FA 2FCNA 2WDQB 2DZKA 4WJPA 1TYGB 3VTUA 3RNCC 4ITKA 4S17A 1V81A 4XWWA 3H8HA 2MCNB 3DHHC 4BOSC 1FNUA 4KKJA 2HE7A 3QHTA 2LJIA 3R3MA 3WCQA 1VLBA 2CHWA 3ETRA 2MP2A 1NVID 3T3OA 2PE9A 4G0NB 4GMVA 4NQKE 3KUZA 2RPQA 2WP9B 1NYRA 4FJZA 3VUYA 3X0WA 3NZSA 4ZRPA 3DVGX 4RCOA 4MGIE 1E7UA 1WFYA 1E8WA 2VH2A 4C4VA 1UF0A 2JPHA 2WQYB 3TMPB 1TZ1A 5DCNA 2AWTA 3ZRFA 3PO0A 2MA9B 1GOZA 4DQOC 1EF1A 1H8CA 5LLIA 3E56A 1L0VB 3M62B 1V86A 4NPNA 2FAZA 4WQOB 2N0SB 1STEA 1CQVA 2SAKA 2KDEB 2GMIC 5IN7A 1V80A 2JRHA 2FCQA 2JZPA 5DPTA 3NOBA 3UGBB 3RNFC 3BIID 3AV8A 1E8YA 1E8ZA 3UINB 3A1QA 1WJ6A 2KWCA 2MBBB 1D6EC 4HKZE 2XBBC 2L05A 1NI2A 3PLVA 2J4XA 4FN2A 1ET6A 4DHJD 4GN1A 4LJPB 2Z0EB 4WAFA 2L52A 4LNOA 1KF6B 4KDLB 2N9KA 3RNEC 2LI5A 1FD6A 4IW0A 3TSSA 2KWVB 5C1ZA 4AS1A 4URKA 2KXJA 2JYTA 1XLNA 1JWSD 1WGYA 4ANWA 5TSSA 3BVMA 4KDIC 2E6XA 3U52E 3KYDD 1ZXIA 2M0XA 3P42A 2IJ0A 2RDHA 3FILB 2MRPA 3KUDB 2C7HA 5J18A 1YD8U 3DBLB 4N58A 1V1PB 5FR3A 2OJRA 2M4NA 3WANA 4AUQC 1WZ0A 5D3IB 4B95A 4C80A 2WXFA 3Q8AA 2G3QB 2DYOA 3QC8B 1YQ4B 3PSEB 4DHZE 2N1WA 1P0RA 2JY6A 3EA6A 1TS4A 3MC0B 4BKTA 4E71A 1E7VA 2B3AA 2M56B 3KWLA 2MJEA 3PHWB 1LO5D 2WXNA 4WAAA 1WGKA 1RRBA 1SSNA 2ZVOA 2QC8A 3P4RB 5HG2A 3H9DA 2KN4A 2V9HA 4HK2A 1A5RA 4N9F4 5AEKB 3QIJA 4M8MA 4JLCA 2KQ4X 3RZFA 2FIDA 4BKSD 1E6EB 1JWUD 2MWSB 2KDFB 2LUMA 4HVBA 5CTRC 3DQVA 3AEGB 2VH1A 4ZYNA 2CHXA 1GB1A 1V2YA 3OJ3A 1FNVA 2CR5A 2C7MB 3U4EG 4JWSC 2WDRB 1AYFA 3VH4B 3IBEA 2D11A 3AEFB 5AZGA 4XZ4A 2ONQA 4WJOA 2HTHA 1PUTA 1DGJA 2PE6B 4NJ7A 2OEDA 1XF5L 1OQYA 4HWIB 2WS3B 3MC9A 2BW2A 2LGIA 1IGCA 2QSDA 4I6LB 4HPLB 4LJOB 1XT9B 1ESFA 3EGRA 2V3NA 3IVFA 1E7PB 3W1YA 1WJ4A 3V61A 1WJNA 1N5WA 1YN3A 4GIVA 3RD2A 2NBVB 2LHEA 4ZDVA 2BB5A 2RSUA 3NVVA 4OW0A 2GBRA 1KLVA 1E90A 2Z0DB 1X1MA 4GDKB 3BK2A 3JSVA 3PPAA 4RFBA 4BFRA 4WWNA 3L13A 5KHOA 1R4MI 4LDTB 4G11A 2INDC 3RCZA 3AE3B 5T8IA 2JWUA 3AEDB 1JQ4A 4DXFA 1XQQA 2PIAA 3ALBA 1EF5A 2HD5B 2V4IB 1FCCC 2K6DB 1V9JA 2C9WB 3U8ZA 4DWFA 3L16A 2PVGC 2DAJA 2DZMA 4KIKB 3QK0A 2N4FA 2WWZA 2TSSA 4JGHB 1B9RA 2FNJB 1IYFA 4HROA 1V5TA 1D5ZC 4FA6A 3ZO5B 5C2TB 4W9HA 1RWSA 4S0RA 1VJKA 1XCTL 1UZXB 2FCMA 4IM2A 1TY2A 1V8CA 4ZHOA 2CU3A 1I4RA 1NBFC 1FCLA 3SHQA 2MBHA 3AE9B 1SBBB 2PKOA 1FFUA 4AJWA 5JXVA 3IFWB 1OTRB 5D7GA 5EE0A 2MBQA 1KFYB 2ZJDA 4XDDA 1EO6A 2C7NB 2R61A 3MFGA 3UQBA 2QMTA 3OLMD 1HXYD 3L10B 4NZLB 1HA5A 1GPXA 4P7IA 3DHGC 3VFKA 5CHWA 2ASQA 1XO3A 1P3QU 3AEEB 2RD0A 4RF0A 2NBWB 2L1AA 2IGDA 1WE7A 3NUHB 5HFYA 2K8HA 4DDID 4GB9A 3RNAC 3R7QA 2LRUA 1Q0WB 1FXAA 1Y8RC 3W5UB 4EZKA 2O2VB 4PYUA 1J0GA 1C1YB 3OWEB 2LVPA 3LXFA 5BYQA 1Q1OA 1TKGA 1KOTA 1J8CA 2PMVA 3P1MA 3HHMA 3MHZA 3AECB 2ZNVB 1WM3A 1HQRD 2ZEQA 1GAQB 3VTVA 1RLFA 1QKZA 3E9SA 1ACCA 2WGSA 1YMHE 4XX5A 3FAHA 1WI0A 2FUHB 4NNJB 2QEJC 1NI3A 4F7ZA 2KX3A 4YT0B 4K7WA 4JWUC 1JW9D 2BYEA 3M95A 1KLGD 3N1YC 1HTOA 3KLSX 3DBRI 3ABVB 2IGGA 3BYTB 4KSLC 2J0KA 1ZUD2 3P4SB 1WX8A 3LB8C 3QA8A 4MJSB 1SE4A 4P1BC 2EKIA 2FIFA 1N60A 3VTWA 1KTKA 4FHJA 2PEAA 4YTNB 2K8BA 1C4AA 3GZNB 3L17A 3WAPA 3EECA 4DXGA 5E6PA 4RH6A 3R7RA 2KD0A 1C79A 5FKAC 2LVOA 2BKRB 1QT9A 4F8CB 4GSWA 1BMLC 3KQ4A 3ZNZB 5AUKA 2IPKD 5G5HA 2KFKB 1JRUA 5AUIA 3RYTA 3LDZE 5CHFA 3ZNID 4W9FA 3DHIC 3Q3FA 2KVRA 1MI0A 2INNE 2JUOA 1I4QA 3AE5B 3APDA 1N63A 1KH0A 1YOVB 2LVQA 2GBMA 2KDIA 4D2KA 4A90A 1NEKB 1YQ3B 2KKCA 3PZ7A 1DOIA 3K9PB 5DPWA 1D4BA 2BYVE 2KJ6A 1GC6A 4ZRKA 1EWYC 3DDCB 1EWCA 1J7AA 3NRZA 2K9XA 3AE6B 1C3TA 3GB1A 3DWGC 3V60A 2DNFA 4IM3A 2LHDA 3Q69A 3TL5A 2LD9A 3RN9C 2L3ZA 1GNUA 4US9A 2REXA 3ONSA 1V49A 2V1YA 4LNKA 4ZHPA 3ZJVA 3IXSA 2INCC 2Y5CA 3KYCD 5J17A 2FCSA 2R2QA 2LGYA 3W1SC 3U7ZA 4MH0E 3N20C 3CMMB 2DENB 3T3NA 2JXXA 1GG3A 2NTTA 3H7PA 3SU8X 2Z59B 2NMQA 4K3CA 4HDQA 2IBIB 3HM6X 2M0AA 1T3QA 4RNAA 2KT7A 2H89B 2WX1A 1IBXA 3DBHB 1T0YA 3NJTA 4XWTA 3PRZA 3P4QB 2QILA 2EKEC 3TUOA 2QIEB 1PDXA 4FHKA 2N9PC 2NR2A 2D10A 3TEYA 3TBLD 3ZRCA 1WWTA 3ZYYX 2INPE 5E6NA 2ZZPB 4LNFA 4RF1A 1OQRA 3ZQ4A 1WMHB 4YTPB 1K50A 2D3BA 2MQJA 5I4DA 4PS8A 2MH7A 3MHSD 4AQ7A 3DBLI 2ZW1A 2NPTB 4N6EB 3BWUD 2MX2A 3H7SA 1DYQA 3AI5A 3Q8EA 3TCAA 4HJGE 3QX1A 2N9XA 3RI7C 3V05A 4A9AA 3A33B 2O6VB 2RR9A 2PVOD 4DHZB 4LK0M 2QHOA 5HHDG 2JZ3B 2W54A 4C56C 3IT6B 5BMGA 2KN5A 2GLSA 3AEBB 3R66C 2BS3B 5G5GA 1PGAA 1JWBD 1TY0A 3GS2A 3Q2AC 2XNAC 1UGMA 2NS5A 2JXTA 3GE3C 3UF8A 1E9MA 1FXIA 1R4NB 3ML9A 1OEYA 2J0MA 3ZXVA 3Q8BA 2QCZA 4RGTA 1UBQA 3RNBC 3KH0A 4TKNA 1WJUA 4A6QA 1UNSA 2D3CA 4MM3B 2NCNA 2DHZA 3PGEA 4AJYB 4P1CC 3M3JA 2JU6X 2DAFA 2M1MA 2IO1B
chains in the Genus database with same CATH topology
4HLEA 2J7QB 1OQYA 4HWIB 3AULA 4CHKA 4NY0A 3DCGA 1WMHA 3UIOB 3WAOA 4KV2A 3S2AA 3ZLZA 4RM9A 3EHVA 4I6LB 4HPLB 2AL6A 1XT9B 2N1VA 4LJOB 1XD3B 1ISNA 3IVFA 1HE8A 5IAAC 3VAWA 4KZCA 3AXCA 4KZ0A 3W1YA 1QZEA 1WJ4A 2DYBA 3ML8A 4NJ6A 3V61A 1WJNA 5D94A 4BKGA 3B0AA 2NPTA 2NBVB 4GIVA 3RD2A 3QARA 1F9JA 2RSUA 4ANXA 4ZDVA 2GBRA 2LUEA 5G55A 5LXIB 4WJNA 5LXHA 2L00B 1KLVA 1E90A 2VRRB 2Z0DB 2YVCA 3IG3A 1X1MA 3A4SC 4GDKB 2YLMA 3JVZX 2BWFA 3JSVA 3PPAA 2IO3B 4BFRA 2XK5B 4WWNA 3L13A 5KHOA 1R4MI 4LDTB 3QJZA 1V6EA 1UH6A 2BKFA 2IY0B 2AEHA 2O6VA 1CMXB 4G11A 3NY5A 2JRIB 2PPHA 3SD5A 3RCZA 2A5UA 4MGYE 3N3KB 4ZRIA 2JF5A 1XQQA 4EKUA 4HCNB 3ALBA 4GGQA 1EF5A 2HD5B 1NDDA 1WXMA 3PREA 2K6DB 1V9JA 4GU2A 2C9WB 2JT4B 2D07B 3VVWB 3U8ZA 4DWFA 1H4RA 3L16A 2K39A 2DAJA 2DZMA 4WJQA 4RM8A 2V3SA 4KIKB 3QK0A 4MEMA 2N4FA 2WWZA 4M8NA 2Y5BB 1D3ZA 3ZDTA 4K81A 3K9OB 4CO7A 3A4RA 4JGHB 3OJ4B 2FNJB 2AYOB 1I35A 1IYFA 2AL3A 1V5TA 4FA6A 1LM8B 3CSFA 4PS3A 3H7PB 3ZO5B 3PVLA 2KK8A 2N7DA 4HPMB 4FLHA 4W9HA 2KTRB 3RUIB 5JH5C 4MM3A 3B08A 3V62A 3ZNGC 1P9DU 3L08A 1UZXB 2KOXA 2FCMA 4IM2A 2ZCCA 3VUXA 2LRWA 4ANUA 3PRMB 1NBFC 2KWUB 3SHQA 4GOCA 3TJPA 4JL9A 2N9EB 1UBIA 1WXVA 2MBHA 4IWPA 1WGDA 3WAMA 1WYWB 4BBNF 3Q3JA 4PYZA 3VHTC 2JVCA 3DVNU 4AJWA 1AARA 3ZDMC 3QWZB 5EDSA 3IFWB 3B1LX 3U7DA 3CSTA 1OTRB 4JIOU 5D2MB 5D7GA 3WIMA 4B6WA 2MBQA 1RFAA 4FADA 4MELA 4AOFA 3CF6E 2ZJDA 2CHZA 4RMAA 3ZVVA 1WRDB 4ASWC 1EO6A 1TBEA 1Z2MA 2C7NB 4MSQB 4EUTA 2KMCA 3UQBA 1R4NI 2GOWA 4FJYA 2BYFA 1LFDA 2BF8B 3OLMD 4AP4C 3L10B 1Q5WB 2KJRA 4P7IA 4W9DA 1BT0A 3VXWA 3VFKA 2EMSA 4J6IA 3N32A 5CHWA 2ASQA 2KQSA 2MBOA 2JWZA 1P3QU 2RD0A 1G6JA 2LASA 2XK5A 2NBWB 3M63B 1SE9A 3ZUNA 2KTFA 1WE7A 4YL8A 3AU5A 2MP2B 2K8HA 4DDID 4HDOA 4W9KA 2DYMA 4EZJA 2KANA 1OGWA 4DDGD 4GB9A 3N30A 3ZTDA 5GMVA 2L76A 3ECIA 4FULA 3R7QA 2KC2A 2LRUA 1Q0WB 1YX6B 4I6PA 4DBGA 3MJWA 2BGFA 1Y8RC 4W9LA 4EZKA 2O2VB 2L7RA 3NZUA 4PYUA 1WR1A 4HCPB 3ZKJC 2NBUA 1J0GA 1C1YB 2KFJA 2M8SA 4MDKE 1WGGA 2LVPA 3L0WB 2KZRA 3ENEA 3D32A 2ZVNA 3APFA 1Q1OA 3LJ3A 1KOTA 1ZW7A 2J0JA 2W9NA 4KIKA 2XEWA 1ZGUB 2K25A 2WDTB 4XC2A 4OVUA 4IWOA 1J8CA 3A9JB 1TGZB 3A9KB 2UWQA 3HHMA 4IM0A 2RGFA 2KC1A 1YJ1A 4DHJB 2MSED 1IP9A 2ZNVB 1WM3A 3QAQA 2ZEQA 2IO0B 4F1SA 2KTRA 3VTVA 1RLFA 2ZPNA 1M94A 3EC8A 4LDTD 2C5LC 1GUAB 1J19A 1GJZA 1WGHA 2D3GA 4XX5A 1WI0A 2FUHB 4NNJB 4W9EA 4F7ZA 2KX3A 2UYZB 4K7WA 1I42A 2BYEA 3M95A 4ZRJA 2PJHA 2OOBB 2A4ZA 2KQ7A 3DBRI 1PQSA 1EUVB 2LXCA 4G3XB 2M17A 4II3B 2K1FA 3PLUA 4ICUA 3ZTCA 2FCNA 2DZKA 2LWPA 4KSLC 2J0KA 4MGZE 4WJPA 3PRPB 2D2QA 3VTUA 1WX8A 3I3TB 1V81A 1OEYJ 1WH3A 3QA8A 3A1QB 4MJSB 1VD2A 4A20A 2FIFA 3VTWA 1LXDA 1WM2A 3DPDA 4FHJA 5TR5A 2L8JA 5AZHA 2PEAA 4DXAB 2MCNB 2K8BA 4HXDA 3L17A 3WAPA 3EECA 4BOSC 3QCAA 3GZNI 5E6PA 2GBNA 3R7RA 2HE7A 4A3OA 3QHTA 2KD0A 2CS4A 2ZPYA 3UIPB 1KM7A 2NVUI 3R3MA 2LVOA 1WX7A 3O65B 4NAWA 2BKRB 4W9CA 2CHWA 4F8CB 2MP2A 4ANVA 4GSWA 2PE9A 4A3PA 4G0NB 2MLBA 2KO3A 4GMVA 1S1QB 3ZNZB 2LGXA 4W9GA 4NQKE 4KVGB 1GC7A 2KFKB 1JRUA 2RPQA 2G4SA 3EFUA 3KUZA 3RYTA 3X23A 1WXSA 3LDZE 4OVVA 4W9FA 5CHFA 2BWES 3ZNID 4TQ0A 4FJZA 3VUYA 3X0WA 3Q3FA 3NZSA 2KVRA 3V6EB 4ICVA 3UQAA 2O2VA 3DVGX 2KHWB 1E8XA 4W9JA 2JUOA 3H1UA 3V6CB 4MGIE 1E7UA 3AU4A 4PS7A 3APDA 3L54A 1WFYA 1E8WA 1V5OA 2LVQA 1Z5SB 2GBMA 2JPHA 5JHAA 2KDIA 1KJTA 3BY4B 2KKCA 3TMPB 4IC7B 3K9PB 5DPWA 1TZ1A 2I1JA 2BYVE 2KJ6A 1ZKHA 4BBNC 1L2NA 1GC6A 4TQ1A 4ZRKA 3DDCB 3ZNHB 1WGRA 4GDKA 2AWTA 5DCNA 4CYEA 1UELA 3ZRFA 3A9JA 3A9KA 3ZW3A 1C3TA 2MA9B 4E3CA 2GBJA 3V60A 2JZZA 1WXAA 4IM3A 4GDLB 1WZ3A 2LXAA 1EF1A 4X57B 1H8CA 4EOYA 5LLIA 3TL5A 2LD9A 1P1AA 1V86A 2CU1A 2L3ZA 3M62B 3IHPC 4NPNA 5BO4B 1GNUA 3VH3B 2FAZA 4WQOB 2DZIA 4DK5A 2IYDB 1VCBA 2REXA 3JYUA 3ONSA 4EFOA 1YX5B 1V49A 1P98A 2KDEB 2N7EA 2GBKA 2GMIC 2V1YA 1S3SG 3RT3B 2KMAA 1V80A 3HK0A 2JRHA 2DX5B 2FCQA 4HJKA 2IY1B 4MGKE 5DPTA 5E6OA 3NOBA 1WIAA 3NS8A 3UGBB 3VQIA 3KYCD 2KJHB 5J17A 4K7SA 4EEWA 5JHBA 2KNBA 2G4DB 2FCSA 2R2QA 2LGYA 3W1SC 1E8YA 1E8ZA 3UINB 4IWQA 4FBJB 4MH0E 3KW5B 3CMMB 3A1QA 4FJVB 1WJ6A 2DENB 2LZ6A 1WY8A 2KWCA 3P2BA 2JXXA 2MBBB 1GG3A 1RAXA 3GOEA 3RULA 4KSKC 4I6NB 4K7UA 5C23A 5CX3A 2XBBC 3PV1A 3H7PA 3SU8X 2L05A 2Z59B 1YIWA 2IBIB 3PT2B 1NI2A 3PLVA 3HM6X 4HDQA 4FN2A 3U30A 4DHJD 3BINA 4MJSA 4GN1A 4IG7B 2Z0EB 4LJPB 5KHQA 2IZVB 3PHXB 2WX1A 2ZNVC 3SDLC 1IPGA 3PZDA 1MG8A 4TV3A 3ZIMA 3DBHI 1T0YA 2L0FA 4KDLB 1LQBA 2I1KA 3PRZA 2CKHB 1UD7A 4MSMB 1WX9A 2LI5A 2EKEC 1FXTB 4JQWC 4IW0A 2KFKA 2KWVB 5C1ZA 4FHKA 4M0WB 2LJ5A 3T8MA 4URKA 1WF9A 2KXJA 2N9PC 2NR2A 5FR6A 2D10A 2K6QA 3TBLD 3ZRCA 4AWJA 2K8CA 4E74A 5E6NA 1U4AA 1WGYA 3APCA 2ZZPB 4ANWA 2DZJA 2LGDA 4KDIC 1WMHB 4II2B 5L83A 3KYDD 5JZEB 2M0XA 2MRPA 4WWPA 3KUDB 2C7HA 3C0RB 2MQJA 5J18A 1YD8U 5J2RA 4PS8A 3QQ8B 4BKSA 4BOZB 2IO2B 3MHSD 3DBLI 2NPTB 2OJRA 2M4NA 3DVGY 2EMTA 2MX2A 3WANA 4AUQC 3H7SA 4GDLA 3HIZA 1WZ0A 3PTFC 3AI5A 1WR6E 4B95A 3NHEB 3OAWA 4WWOA 3TCAA 3DBSA 1E5WA 2G3QB 3QX1A 3JSVB 4K1RB 2DYOA 3MTNB 2N9XA 3QC8B 3PS6A 4TUUA 5IA7A 2KDBA 3PSEB 5CHVC 4GXBA 3DVNV 4DHZE 3A33B 2N1WA 2O6VB 1P0RA 2RR9A 2JY6A 2G45B 3HM3A 1SGHA 4DHZB 4BKTA 2QHOA 2O6VD 3W1SA 4E71A 2BPSA 1E7VA 3KVFB 4NQLB 2JZ3B 2B3AA 1L7YA 3DOWA 2KN5A 4B9KA 3PHWB 2MW5A 4WAAA 3WALA 1RRBA 2KLCA 2ZVOA 3R66C 3H9DA 5DPRA 2KLGA 4HK2A 3VDZA 1A5RA 4N9F4 4LCDE 5AEKB 2R2OA 5D6JB 5DPSA 3QIJA 3H6NA 4M8MA 4JLCA 2V4LA 3RZFA 2FIDA 4BKSD 1SIFA 1UGMA 2MWSB 4BVUC 2MBEA 2KDFB 2NS5A 4IUMB 4HVBA 3UF8A 5CTRC 2L0TA 3DQVA 5AZFA 3RZWC 3ML9A 3T9LA 1YQBA 4ZYNA 2CHXA 2C60A 4W9IA 1V2YA 1OEYA 2J0MA 2ZCBA 3TIXA 3KUCB 2KX0A 3OJ3A 2CR5A 1UBQA 2WX0A 2C7MB 3KH0A 1TTNA 4TKNA 3VH4B 1WJUA 3WA0A 1K8RB 3IBEA 2NCNA 2D11A 2DHZA 3JW0X 3PGEA 4AJYB 3M3JA 5AZGA 3VUWA 1WE6A 4XZ4A 4NAWB 5HKHA 4WJOA 2HTHA 4EZLA 2HJ8A 4G50A 5G2NA 5L95C 2PE6B 4NJ7A 2DAFA 2WYQA 2M1MA 2IO1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HLE A;  2J7Q B;  1OQY A;  4HWI B;  3AUL A;  4CHK A;  4NY0 A;  3DCG A;  1WMH A;  3UIO B;  3WAO A;  4KV2 A;  3S2A A;  3ZLZ A;  4RM9 A;  3EHV A;  4I6L B;  4HPL B;  2AL6 A;  1XT9 B;  2N1V A;  4LJO B;  1XD3 B;  1ISN A;  3IVF A;  1HE8 A;  5IAA C;  3VAW A;  4KZC A;  3AXC A;  4KZ0 A;  3W1Y A;  1QZE A;  1WJ4 A;  2DYB A;  3ML8 A;  4NJ6 A;  3V61 A;  1WJN A;  5D94 A;  4BKG A;  3B0A A;  2NPT A;  2NBV B;  4GIV A;  3RD2 A;  3QAR A;  1F9J A;  2RSU A;  4ANX A;  4ZDV A;  2GBR A;  2LUE A;  5G55 A;  5LXI B;  4WJN A;  5LXH A;  2L00 B;  1KLV A;  1E90 A;  2VRR B;  2Z0D B;  2YVC A;  3IG3 A;  1X1M A;  3A4S C;  4GDK B;  2YLM A;  3JVZ X;  2BWF A;  3JSV A;  3PPA A;  2IO3 B;  4BFR A;  2XK5 B;  4WWN A;  3L13 A;  5KHO A;  1R4M I;  4LDT B;  3QJZ A;  1V6E A;  1UH6 A;  2BKF A;  2IY0 B;  2AEH A;  2O6V A;  1CMX B;  4G11 A;  3NY5 A;  2JRI B;  2PPH A;  3SD5 A;  3RCZ A;  2A5U A;  4MGY E;  3N3K B;  4ZRI A;  2JF5 A;  1XQQ A;  4EKU A;  4HCN B;  3ALB A;  4GGQ A;  1EF5 A;  2HD5 B;  1NDD A;  1WXM A;  3PRE A;  2K6D B;  1V9J A;  4GU2 A;  2C9W B;  2JT4 B;  2D07 B;  3VVW B;  3U8Z A;  4DWF A;  1H4R A;  3L16 A;  2K39 A;  2DAJ A;  2DZM A;  4WJQ A;  4RM8 A;  2V3S A;  4KIK B;  3QK0 A;  4MEM A;  2N4F A;  2WWZ A;  4M8N A;  2Y5B B;  1D3Z A;  3ZDT A;  4K81 A;  3K9O B;  4CO7 A;  3A4R A;  4JGH B;  3OJ4 B;  2FNJ B;  2AYO B;  1I35 A;  1IYF A;  2AL3 A;  1V5T A;  4FA6 A;  1LM8 B;  3CSF A;  4PS3 A;  3H7P B;  3ZO5 B;  3PVL A;  2KK8 A;  2N7D A;  4HPM B;  4FLH A;  4W9H A;  2KTR B;  3RUI B;  5JH5 C;  4MM3 A;  3B08 A;  3V62 A;  3ZNG C;  1P9D U;  3L08 A;  1UZX B;  2KOX A;  2FCM A;  4IM2 A;  2ZCC A;  3VUX A;  2LRW A;  4ANU A;  3PRM B;  1NBF C;  2KWU B;  3SHQ A;  4GOC A;  3TJP A;  4JL9 A;  2N9E B;  1UBI A;  1WXV A;  2MBH A;  4IWP A;  1WGD A;  3WAM A;  1WYW B;  4BBN F;  3Q3J A;  4PYZ A;  3VHT C;  2JVC A;  3DVN U;  4AJW A;  1AAR A;  3ZDM C;  3QWZ B;  5EDS A;  3IFW B;  3B1L X;  3U7D A;  3CST A;  1OTR B;  4JIO U;  5D2M B;  5D7G A;  3WIM A;  4B6W A;  2MBQ A;  1RFA A;  4FAD A;  4MEL A;  4AOF A;  3CF6 E;  2ZJD A;  2CHZ A;  4RMA A;  3ZVV A;  1WRD B;  4ASW C;  1EO6 A;  1TBE A;  1Z2M A;  2C7N B;  4MSQ B;  4EUT A;  2KMC A;  3UQB A;  1R4N I;  2GOW A;  4FJY A;  2BYF A;  1LFD A;  2BF8 B;  3OLM D;  4AP4 C;  3L10 B;  1Q5W B;  2KJR A;  4P7I A;  4W9D A;  1BT0 A;  3VXW A;  3VFK A;  2EMS A;  4J6I A;  3N32 A;  5CHW A;  2ASQ A;  2KQS A;  2MBO A;  2JWZ A;  1P3Q U;  2RD0 A;  1G6J A;  2LAS A;  2XK5 A;  2NBW B;  3M63 B;  1SE9 A;  3ZUN A;  2KTF A;  1WE7 A;  4YL8 A;  3AU5 A;  2MP2 B;  2K8H A;  4DDI D;  4HDO A;  4W9K A;  2DYM A;  4EZJ A;  2KAN A;  1OGW A;  4DDG D;  4GB9 A;  3N30 A;  3ZTD A;  5GMV A;  2L76 A;  3ECI A;  4FUL A;  3R7Q A;  2KC2 A;  2LRU A;  1Q0W B;  1YX6 B;  4I6P A;  4DBG A;  3MJW A;  2BGF A;  1Y8R C;  4W9L A;  4EZK A;  2O2V B;  2L7R A;  3NZU A;  4PYU A;  1WR1 A;  4HCP B;  3ZKJ C;  2NBU A;  1J0G A;  1C1Y B;  2KFJ A;  2M8S A;  4MDK E;  1WGG A;  2LVP A;  3L0W B;  2KZR A;  3ENE A;  3D32 A;  2ZVN A;  3APF A;  1Q1O A;  3LJ3 A;  1KOT A;  1ZW7 A;  2J0J A;  2W9N A;  4KIK A;  2XEW A;  1ZGU B;  2K25 A;  2WDT B;  4XC2 A;  4OVU A;  4IWO A;  1J8C A;  3A9J B;  1TGZ B;  3A9K B;  2UWQ A;  3HHM A;  4IM0 A;  2RGF A;  2KC1 A;  1YJ1 A;  4DHJ B;  2MSE D;  1IP9 A;  2ZNV B;  1WM3 A;  3QAQ A;  2ZEQ A;  2IO0 B;  4F1S A;  2KTR A;  3VTV A;  1RLF A;  2ZPN A;  1M94 A;  3EC8 A;  4LDT D;  2C5L C;  1GUA B;  1J19 A;  1GJZ A;  1WGH A;  2D3G A;  4XX5 A;  1WI0 A;  2FUH B;  4NNJ B;  4W9E A;  4F7Z A;  2KX3 A;  2UYZ B;  4K7W A;  1I42 A;  2BYE A;  3M95 A;  4ZRJ A;  2PJH A;  2OOB B;  2A4Z A;  2KQ7 A;  3DBR I;  1PQS A;  1EUV B;  2LXC A;  4G3X B;  2M17 A;  4II3 B;  2K1F A;  3PLU A;  4ICU A;  3ZTC A;  2FCN A;  2DZK A;  2LWP A;  4KSL C;  2J0K A;  4MGZ E;  4WJP A;  3PRP B;  2D2Q A;  3VTU A;  1WX8 A;  3I3T B;  1V81 A;  1OEY J;  1WH3 A;  3QA8 A;  3A1Q B;  4MJS B;  1VD2 A;  4A20 A;  2FIF A;  3VTW A;  1LXD A;  1WM2 A;  3DPD A;  4FHJ A;  5TR5 A;  2L8J A;  5AZH A;  2PEA A;  4DXA B;  2MCN B;  2K8B A;  4HXD A;  3L17 A;  3WAP A;  3EEC A;  4BOS C;  3QCA A;  3GZN I;  5E6P A;  2GBN A;  3R7R A;  2HE7 A;  4A3O A;  3QHT A;  2KD0 A;  2CS4 A;  2ZPY A;  3UIP B;  1KM7 A;  2NVU I;  3R3M A;  2LVO A;  1WX7 A;  3O65 B;  4NAW A;  2BKR B;  4W9C A;  2CHW A;  4F8C B;  2MP2 A;  4ANV A;  4GSW A;  2PE9 A;  4A3P A;  4G0N B;  2MLB A;  2KO3 A;  4GMV A;  1S1Q B;  3ZNZ B;  2LGX A;  4W9G A;  4NQK E;  4KVG B;  1GC7 A;  2KFK B;  1JRU A;  2RPQ A;  2G4S A;  3EFU A;  3KUZ A;  3RYT A;  3X23 A;  1WXS A;  3LDZ E;  4OVV A;  4W9F A;  5CHF A;  2BWE S;  3ZNI D;  4TQ0 A;  4FJZ A;  3VUY A;  3X0W A;  3Q3F A;  3NZS A;  2KVR A;  3V6E B;  4ICV A;  3UQA A;  2O2V A;  3DVG X;  2KHW B;  1E8X A;  4W9J A;  2JUO A;  3H1U A;  3V6C B;  4MGI E;  1E7U A;  3AU4 A;  4PS7 A;  3APD A;  3L54 A;  1WFY A;  1E8W A;  1V5O A;  2LVQ A;  1Z5S B;  2GBM A;  2JPH A;  5JHA A;  2KDI A;  1KJT A;  3BY4 B;  2KKC A;  3TMP B;  4IC7 B;  3K9P B;  5DPW A;  1TZ1 A;  2I1J A;  2BYV E;  2KJ6 A;  1ZKH A;  4BBN C;  1L2N A;  1GC6 A;  4TQ1 A;  4ZRK A;  3DDC B;  3ZNH B;  1WGR A;  4GDK A;  2AWT A;  5DCN A;  4CYE A;  1UEL A;  3ZRF A;  3A9J A;  3A9K A;  3ZW3 A;  1C3T A;  2MA9 B;  4E3C A;  2GBJ A;  3V60 A;  2JZZ A;  1WXA A;  4IM3 A;  4GDL B;  1WZ3 A;  2LXA A;  1EF1 A;  4X57 B;  1H8C A;  4EOY A;  5LLI A;  3TL5 A;  2LD9 A;  1P1A A;  1V86 A;  2CU1 A;  2L3Z A;  3M62 B;  3IHP C;  4NPN A;  5BO4 B;  1GNU A;  3VH3 B;  2FAZ A;  4WQO B;  2DZI A;  4DK5 A;  2IYD B;  1VCB A;  2REX A;  3JYU A;  3ONS A;  4EFO A;  1YX5 B;  1V49 A;  1P98 A;  2KDE B;  2N7E A;  2GBK A;  2GMI C;  2V1Y A;  1S3S G;  3RT3 B;  2KMA A;  1V80 A;  3HK0 A;  2JRH A;  2DX5 B;  2FCQ A;  4HJK A;  2IY1 B;  4MGK E;  5DPT A;  5E6O A;  3NOB A;  1WIA A;  3NS8 A;  3UGB B;  3VQI A;  3KYC D;  2KJH B;  5J17 A;  4K7S A;  4EEW A;  5JHB A;  2KNB A;  2G4D B;  2FCS A;  2R2Q A;  2LGY A;  3W1S C;  1E8Y A;  1E8Z A;  3UIN B;  4IWQ A;  4FBJ B;  4MH0 E;  3KW5 B;  3CMM B;  3A1Q A;  4FJV B;  1WJ6 A;  2DEN B;  2LZ6 A;  1WY8 A;  2KWC A;  3P2B A;  2JXX A;  2MBB B;  1GG3 A;  1RAX A;  3GOE A;  3RUL A;  4KSK C;  4I6N B;  4K7U A;  5C23 A;  5CX3 A;  2XBB C;  3PV1 A;  3H7P A;  3SU8 X;  2L05 A;  2Z59 B;  1YIW A;  2IBI B;  3PT2 B;  1NI2 A;  3PLV A;  3HM6 X;  4HDQ A;  4FN2 A;  3U30 A;  4DHJ D;  3BIN A;  4MJS A;  4GN1 A;  4IG7 B;  2Z0E B;  4LJP B;  5KHQ A;  2IZV B;  3PHX B;  2WX1 A;  2ZNV C;  3SDL C;  1IPG A;  3PZD A;  1MG8 A;  4TV3 A;  3ZIM A;  3DBH I;  1T0Y A;  2L0F A;  4KDL B;  1LQB A;  2I1K A;  3PRZ A;  2CKH B;  1UD7 A;  4MSM B;  1WX9 A;  2LI5 A;  2EKE C;  1FXT B;  4JQW C;  4IW0 A;  2KFK A;  2KWV B;  5C1Z A;  4FHK A;  4M0W B;  2LJ5 A;  3T8M A;  4URK A;  1WF9 A;  2KXJ A;  2N9P C;  2NR2 A;  5FR6 A;  2D10 A;  2K6Q A;  3TBL D;  3ZRC A;  4AWJ A;  2K8C A;  4E74 A;  5E6N A;  1U4A A;  1WGY A;  3APC A;  2ZZP B;  4ANW A;  2DZJ A;  2LGD A;  4KDI C;  1WMH B;  4II2 B;  5L83 A;  3KYD D;  5JZE B;  2M0X A;  2MRP A;  4WWP A;  3KUD B;  2C7H A;  3C0R B;  2MQJ A;  5J18 A;  1YD8 U;  5J2R A;  4PS8 A;  3QQ8 B;  4BKS A;  4BOZ B;  2IO2 B;  3MHS D;  3DBL I;  2NPT B;  2OJR A;  2M4N A;  3DVG Y;  2EMT A;  2MX2 A;  3WAN A;  4AUQ C;  3H7S A;  4GDL A;  3HIZ A;  1WZ0 A;  3PTF C;  3AI5 A;  1WR6 E;  4B95 A;  3NHE B;  3OAW A;  4WWO A;  3TCA A;  3DBS A;  1E5W A;  2G3Q B;  3QX1 A;  3JSV B;  4K1R B;  2DYO A;  3MTN B;  2N9X A;  3QC8 B;  3PS6 A;  4TUU A;  5IA7 A;  2KDB A;  3PSE B;  5CHV C;  4GXB A;  3DVN V;  4DHZ E;  3A33 B;  2N1W A;  2O6V B;  1P0R A;  2RR9 A;  2JY6 A;  2G45 B;  3HM3 A;  1SGH A;  4DHZ B;  4BKT A;  2QHO A;  2O6V D;  3W1S A;  4E71 A;  2BPS A;  1E7V A;  3KVF B;  4NQL B;  2JZ3 B;  2B3A A;  1L7Y A;  3DOW A;  2KN5 A;  4B9K A;  3PHW B;  2MW5 A;  4WAA A;  3WAL A;  1RRB A;  2KLC A;  2ZVO A;  3R66 C;  3H9D A;  5DPR A;  2KLG A;  4HK2 A;  3VDZ A;  1A5R A;  4N9F 4;  4LCD E;  5AEK B;  2R2O A;  5D6J B;  5DPS A;  3QIJ A;  3H6N A;  4M8M A;  4JLC A;  2V4L A;  3RZF A;  2FID A;  4BKS D;  1SIF A;  1UGM A;  2MWS B;  4BVU C;  2MBE A;  2KDF B;  2NS5 A;  4IUM B;  4HVB A;  3UF8 A;  5CTR C;  2L0T A;  3DQV A;  5AZF A;  3RZW C;  3ML9 A;  3T9L A;  1YQB A;  4ZYN A;  2CHX A;  2C60 A;  4W9I A;  1V2Y A;  1OEY A;  2J0M A;  2ZCB A;  3TIX A;  3KUC B;  2KX0 A;  3OJ3 A;  2CR5 A;  1UBQ A;  2WX0 A;  2C7M B;  3KH0 A;  1TTN A;  4TKN A;  3VH4 B;  1WJU A;  3WA0 A;  1K8R B;  3IBE A;  2NCN A;  2D11 A;  2DHZ A;  3JW0 X;  3PGE A;  4AJY B;  3M3J A;  5AZG A;  3VUW A;  1WE6 A;  4XZ4 A;  4NAW B;  5HKH A;  4WJO A;  2HTH A;  4EZL A;  2HJ8 A;  4G50 A;  5G2N A;  5L95 C;  2PE6 B;  4NJ7 A;  2DAF A;  2WYQ A;  2M1M A;  2IO1 B; 
#chains in the Genus database with same CATH topology
 1HEZ E;  4HLE A;  2J7Q B;  3N1Z C;  4NY0 A;  3DCG A;  2FUG 1;  1XLP A;  3ZLZ A;  1AN8 A;  4RM9 A;  3EHV A;  5IAA C;  4KZC A;  3AXC A;  2L32 A;  5E6J A;  4C4V B;  1N61 A;  3NS1 A;  3B0A A;  1CZP A;  2G1E A;  3QAR A;  1F9J A;  3BYY B;  3I5J C;  5G55 A;  5LXI B;  5LXH A;  2VRR B;  2YVC A;  2B76 B;  2YLM A;  2BWF A;  2FE8 A;  4ZOH C;  3IT4 B;  1UH6 A;  2AEH A;  1L4D B;  2PPH A;  2CJN A;  1T6B X;  1PFD A;  1V1O A;  4ZRI A;  1UWM A;  2HTM E;  3W9C B;  4GGQ A;  2RDG A;  2WXL A;  4KGT A;  4GU2 A;  2D07 B;  2J53 A;  1RM6 C;  2Y5B B;  4NJC A;  1D3Z A;  5FK9 C;  3ZDT A;  3A4R A;  3OJ4 B;  2WXG A;  3AB5 A;  1LM8 B;  4PS3 A;  3Q3M C;  1FPY A;  2GB1 A;  3PVL A;  4H2A A;  2BB6 A;  2WNM A;  3W5V B;  1LGR A;  1QQR A;  3L08 A;  4NAM A;  2YEP F;  1F0Z A;  3AH7 A;  3VUX A;  4ANU A;  3SFD B;  2KWU B;  2WXP A;  4JL9 A;  1UBI A;  3AMZ A;  1TKE A;  4BBN F;  3Q3J A;  2JVC A;  3DVN U;  3QWZ B;  5EDS A;  1XEE A;  2K22 A;  2KMM A;  3NZ3 A;  4FAD A;  4ASW C;  1HZ5 A;  2J52 A;  2WU2 B;  4KKI A;  2GOW A;  4AP4 C;  4KGS A;  4W9D A;  2AX5 A;  2EMS A;  4J6I A;  1GB4 A;  2KQS A;  2D3A A;  1N62 A;  2JWZ A;  2WXJ A;  3M63 B;  4HKQ A;  1JWA D;  4M0W A;  2KTF A;  4YL8 A;  3AU5 A;  1A70 A;  4HDO A;  1OGW A;  2L76 A;  4TMA B;  4PK1 A;  1D5X C;  2L7R A;  1MPE A;  3UI3 A;  3P4P B;  2NBU A;  3Q8C A;  2M8S A;  4MDK E;  1WGG A;  3ENE A;  1UUP A;  3APF A;  4L2Y A;  2J0J A;  4KIK A;  1EU4 A;  1ZGU B;  4QAY A;  2K25 A;  4XC2 A;  1C4P A;  4JPS A;  3A9J B;  1TGZ B;  3A9K B;  4PT5 A;  4R3D A;  2UWQ A;  2RGF A;  4DHJ B;  1UGJ A;  3CIR B;  4A8X C;  4F1S A;  2ZPN A;  3VR8 B;  1GJZ A;  1GUA B;  5MPO A;  1WGH A;  2D3G A;  3RFZ B;  3GP7 A;  3R2T A;  1YN5 A;  1MHH E;  2WXQ A;  4ARC A;  2BS4 B;  2WXM A;  4L1B A;  4MAC A;  1EUV B;  2LXC A;  4II3 B;  3PLU A;  4WH4 A;  4ICU A;  1K53 A;  3ZTC A;  4MGZ E;  3C19 A;  2D2Q A;  2V3P A;  4M02 A;  1QIL A;  1BXT A;  3BVG A;  3L4P A;  1VD2 A;  4A20 A;  5AZH A;  1F2R I;  4OHJ A;  3GZN I;  2GBN A;  4ZYS A;  4A3O A;  2CS4 A;  2ZPY A;  3UIP B;  1KM7 A;  2E3T A;  1WX7 A;  2MJD A;  3O65 B;  4NAW A;  4W9C A;  1L5P A;  4ANV A;  4WQM A;  2MLB A;  1S1Q B;  2LGX A;  2VZK D;  1TKY A;  4KVG B;  2G4S A;  3X23 A;  2KVZ A;  3RMK C;  4TQ0 A;  2YEP B;  4ICV A;  2O2V A;  4W9J A;  3H1U A;  3AU4 A;  2JQR B;  3L54 A;  4PS7 A;  1L0X B;  2DWQ A;  1Z5S B;  5JHA A;  3BY4 B;  4K3B A;  1ZDX A;  3AN1 A;  5D3D A;  2AQ2 B;  2I1J A;  2BT6 A;  3HUI A;  1ZKH A;  2LEK A;  4USA A;  3W2D A;  4BBN C;  1L2N A;  1WGR A;  1QOB A;  1UEL A;  3BZD B;  3HRD D;  3ZW3 A;  2W3R A;  4E3C A;  4YSX B;  1WXA A;  4GDL B;  1WZ3 A;  2LXA A;  4X57 B;  1L0Y B;  2N9L A;  2X38 A;  2CU1 A;  5BO4 B;  3VR9 B;  2IYD B;  1VCB A;  4KGR A;  3JYU A;  4EFO A;  1YX5 B;  1FO4 A;  1P7F A;  2AQ1 B;  1XXG A;  2KMA A;  2JX5 A;  5IO9 A;  4MGK E;  1WIA A;  3NS8 A;  1DOX A;  4UDU C;  1EM7 A;  4K7S A;  2KAC A;  2KNB A;  2G4D B;  1ROE A;  4FJV B;  4MJS A;  2LZ6 A;  3P2B A;  1WY8 A;  1F1H A;  3GOE A;  1IGD A;  4KSK C;  4I6N B;  3C8Y A;  4O1N A;  4RGN A;  5C23 A;  4US8 A;  2HDE A;  1QLB B;  1SE2 A;  2SEB D;  3BIN A;  2IZV B;  3PHX B;  2ZNV C;  3SDL C;  1IPG A;  2WDV B;  3DBH I;  4XYC A;  1LQB A;  3NG0 A;  2HJ1 A;  1UD7 A;  4MSM B;  1WX9 A;  1FXT B;  4JQW C;  2KFK A;  1ZPS A;  1R4M B;  1VDV A;  2LJ5 A;  4AWJ A;  2K8C A;  4E74 A;  1QF6 A;  1U4A A;  3APC A;  1SXT A;  2JYE A;  3ZJT A;  4A55 A;  1ENF A;  1SF0 A;  3R8B A;  5L83 A;  5JZE B;  5IKC M;  4OZA A;  4WWP A;  2X8X X;  3C0R B;  1F2R C;  1FRR A;  3AE7 B;  2IO2 B;  4C7Z A;  2K5P A;  1KRH A;  1TIF A;  3PTF C;  4WWO A;  1E5W A;  4K1R B;  2RDB C;  3PS6 A;  4TUU A;  5IA7 A;  3DVN V;  4Q2J A;  2ZW0 A;  2G45 B;  3HM3 A;  1SGH A;  4GLS C;  2O6V D;  3W1S A;  3KVF B;  1L7Y A;  1JWM D;  1FM0 D;  2KLC A;  1EU3 A;  1VZ7 A;  2WHI A;  1K51 A;  5DPR A;  2GRI A;  4YTM B;  5D6J B;  5DPS A;  3AE2 B;  1D5M C;  1TT5 B;  2W3S A;  1SIF A;  4BVU C;  2MBE A;  3NVZ A;  2RPV A;  2L0T A;  3RZW C;  3T9L A;  1C78 A;  3TIX A;  3KUC B;  4RGO S;  4HEA 1;  3WA0 A;  3JW0 X;  2WU5 B;  3VUW A;  4EZL A;  2HJ8 A;  5L95 C;  2WYQ A;  3AUL A;  4CHK A;  1L4Z B;  1WMH A;  4KV2 A;  2CJO A;  3B2F A;  2GI9 A;  3BK1 A;  4XGA B;  1XD3 B;  1ISN A;  3VAW A;  1HE8 A;  2QDF A;  1JCK B;  4KZ0 A;  1QZE A;  2DYB A;  3ML8 A;  1PGX A;  2Y5P A;  5GXG B;  2NPT A;  4ANX A;  1FRD A;  4WJN A;  3IG3 A;  2IO3 B;  2XK5 B;  3QJZ A;  1V6E A;  1MJD A;  2BKF A;  2O6V A;  1FFV A;  3NY5 A;  2JRI B;  1TS5 A;  3SD5 A;  2A5U A;  3Q14 C;  2UU7 A;  2ACZ B;  1TS2 A;  4EKU A;  1I4H A;  1L6U A;  4HCN B;  3PZ8 A;  1NDD A;  3PRE A;  1XLO A;  3DBR B;  3P63 A;  5BYR A;  2JT4 B;  3VVW B;  1H4R A;  2K39 A;  4WJQ A;  2V3S A;  4MEM A;  1VRA B;  4K81 A;  3K9O B;  1I35 A;  2AL3 A;  2WXK A;  4CQN A;  3ZXR A;  3CSF A;  3H7P B;  3FC4 A;  2KK8 A;  3EFC A;  3AEA B;  2KTR B;  1YNT E;  4MM3 A;  3B08 A;  3KWV A;  1F77 A;  3OG5 A;  1IBX B;  1P9D U;  3Q3O C;  2KOX A;  1FNW A;  3ZJU A;  3N9Y C;  2M19 A;  2BTE A;  4HRS A;  1M4V A;  4WIP A;  3HVZ A;  2Q5W D;  1WGD A;  3WAM A;  3O13 A;  1WYW B;  2I2Y A;  2BVC A;  4KX6 B;  3ZGZ A;  1AAR A;  3ZDM C;  3CST A;  4JIO U;  5D2M B;  3WIM A;  3VRB B;  1JRP A;  1RFA A;  4AOF A;  2W82 A;  3SFE B;  1CJE A;  4RMA A;  3ZVV A;  4EUT A;  3FKY A;  2KMC A;  4J3O D;  2PTL A;  1Q5W B;  3IAM 1;  1QOF A;  3VXW A;  3N32 A;  4LNI A;  4LTU A;  5LNK 1;  2MJ3 A;  1SE9 A;  3ZUN A;  1TZO A;  3AE1 B;  4C7Y A;  2MP2 B;  2ON8 A;  4W9K A;  3ZTD A;  3ECI A;  4FUL A;  4DBG A;  4ZRQ A;  4I6P A;  1V97 A;  1YJJ A;  2BGF A;  4W9L A;  3FIL A;  3NZU A;  3CWI A;  4HCP B;  3SEB A;  1KLU D;  1WXQ A;  3L0W B;  2KZR A;  1V1P A;  1F52 A;  3NVY A;  1E10 A;  4EE2 A;  2Z8L A;  1VZ8 A;  1OQQ A;  4IM0 A;  1T0S C;  1IP9 A;  1WYG A;  2IO0 B;  4IKG A;  1K52 A;  3EC8 A;  4LDT D;  4HPP A;  4OZB A;  2K0P A;  1T0R C;  1TJE A;  4W9E A;  1I42 A;  2DBY A;  2A4Z A;  3J9C A;  1PQS A;  4G3X B;  1SB3 C;  2JSV X;  2LWP A;  1HZ6 A;  3IAS 1;  3PRP B;  3I3T B;  1OEY J;  1WH3 A;  3A1Q B;  1QOG A;  5C3J B;  4REZ A;  1NEN B;  2LGS A;  1I4P A;  1LXD A;  1WM2 A;  3DPD A;  5TR5 A;  2L8J A;  4DXA B;  1NYQ A;  4HXD A;  3QCA A;  1ET9 A;  2PW9 A;  2NVU I;  1L6V A;  1C76 A;  4MT5 A;  5EE3 A;  4A3P A;  2KO3 A;  4W9G A;  1GC7 A;  3EFU A;  1WXS A;  4OVV A;  2BWE S;  3NVW A;  3V6E B;  3UQA A;  2KHW B;  2QJL A;  1E8X A;  3V6C B;  1WSP A;  1V5O A;  1FIQ A;  4OVZ A;  1N5X A;  1KJT A;  4IC7 B;  3AE4 B;  2WXI A;  3I63 C;  4M01 A;  4TQ1 A;  3ZNH B;  4GDK A;  4CYE A;  3A9J A;  3A9K A;  1Y56 A;  2GBJ A;  2JZZ A;  1OFF A;  4XE0 A;  4EOY A;  1P1A A;  3IHP C;  3VH3 B;  4DK5 A;  2DZI A;  4MH8 A;  3LYY A;  1P7E A;  4IDI A;  1P98 A;  2N7E A;  2GBK A;  2Y3A A;  1XLQ A;  1S3S G;  3RT3 B;  3HK0 A;  2DX5 B;  3AM9 A;  4HJK A;  2IY1 B;  5E6O A;  3VQI A;  2KJH B;  4EEW A;  5JHB A;  4FBJ B;  4IWQ A;  3KW5 B;  3Q3N C;  4NQL B;  4FXC A;  1RAX A;  3RUL A;  3U2S C;  1Q10 A;  2FBW B;  4K7U A;  4YSY B;  1C4C A;  3HVD A;  5CX3 A;  3PV1 A;  1PGB A;  1YIW A;  1WRI A;  3PT2 B;  3U30 A;  1MG4 A;  2DLB A;  4IG7 B;  5KHQ A;  3PZD A;  1MG8 A;  4TV3 A;  3ZIM A;  2L0F A;  1SIJ A;  2I1K A;  2CKH B;  1JAL A;  1QOA A;  2KWD A;  4M0W B;  3T8M A;  1MVK A;  1WF9 A;  5FR6 A;  1PYW D;  2K6Q A;  3GE8 C;  2L83 A;  3Q6B A;  2DZJ A;  2PLP A;  2LGD A;  4II2 B;  1CK1 A;  3B9J A;  1ZE3 D;  4LLG M;  5J2R A;  3QQ8 B;  4BKS A;  2OJW A;  2LMC A;  4BOZ B;  2XN9 C;  1TS3 A;  4RGM A;  1XCQ L;  3R2I A;  3DVG Y;  2EMT A;  1BUI C;  4GDL A;  3HIZ A;  1T5X D;  1VZ6 A;  1WR6 E;  3NHE B;  3OAW A;  1HTQ A;  3DBS A;  1MHX A;  1J7C A;  3SR6 A;  3JSV B;  4M00 A;  3MTN B;  5BMH A;  2KDB A;  4TSS A;  5CHV C;  4GXB A;  5BMI A;  5EE9 A;  3B2G A;  1MFW A;  2BPS A;  3DOW A;  4B9K A;  4YXD B;  2MW5 A;  4B0E A;  3WAL A;  1T0Q C;  3V3X A;  4YWG G;  2KLG A;  3VDZ A;  3TEW A;  4LCD E;  2R2O A;  3H6N A;  1YJI A;  2V4L A;  1SJH D;  1JML A;  4IUM B;  4BAX A;  5AZF A;  2AQ3 B;  4B0M A;  1YQB A;  2KAJ A;  2C60 A;  4W9I A;  2ZCB A;  2KX0 A;  4N59 A;  2WX0 A;  1TTN A;  1K8R B;  3VRA B;  1C77 A;  2BYT A;  1WE6 A;  4NAW B;  5HKH A;  4G50 A;  5G2N A;  1ZXH A;  3Q8F A;  1DOY A;  3I9V 1;  2MEK A;  2LFI A;  3UIO B;  3WAO A;  4LNN A;  3S2A A;  1E0Z A;  2W55 A;  2AL6 A;  2N1V A;  2WLB A;  4P6V F;  4NJ6 A;  4BKG A;  5D94 A;  1I7H A;  3RNG C;  3DWM A;  2LUE A;  2L00 B;  5EE1 A;  3A4S C;  2KYW A;  3AE8 B;  3JVZ X;  2J42 A;  3MC8 A;  2V0G A;  2IY0 B;  1CMX B;  3MJ5 A;  1VR9 A;  2WXO A;  4MGY E;  3N3K B;  2JF5 A;  2H88 B;  2MHJ A;  3I57 A;  2IGH A;  5H92 C;  1WXM A;  1AW7 A;  1SE3 A;  3N1X C;  1ZOY B;  4JE3 B;  4RM8 A;  4M8N A;  2IDY A;  4P16 A;  2K3U A;  4CO7 A;  3MP9 A;  1UWX A;  2AYO B;  2WXH A;  1ZP0 B;  3URY A;  4YSZ B;  1YN4 A;  2D5G A;  2N7D A;  4HPM B;  4FLH A;  1J7B A;  3RUI B;  5JH5 C;  3V62 A;  3ZNG C;  5HI1 A;  2BS2 B;  1JRO A;  2ZCC A;  2VZK B;  2LRW A;  3RPF C;  3PRM B;  3TJP A;  4GOC A;  2N9E B;  1FEH A;  1WXV A;  4IWP A;  2G9H D;  4PYZ A;  3VHT C;  4L23 A;  3B1L X;  3U7D A;  1FMA D;  4WWM A;  4B6W A;  4C00 A;  4MEL A;  3CF6 E;  2CHZ A;  1WRD B;  1TBE A;  1Z2M A;  2I38 A;  4MSQ B;  5IOI A;  1R4N I;  4FJY A;  4OZC A;  2BYF A;  1LFD A;  1RFK A;  2BF8 B;  3EUB 2;  2KJR A;  1BT0 A;  1ZDV A;  2MBO A;  4XDC A;  5IP4 D;  4IOI E;  1N6Z A;  1SEB D;  1G6J A;  3BVZ A;  2LAS A;  2XK5 A;  4ARI A;  1R7S A;  2RMM A;  2DYM A;  4EZJ A;  2KAN A;  4DDG D;  3N30 A;  4WUR A;  1I4G A;  2ICI A;  5GMV A;  1SJE D;  2KC2 A;  1B1Z A;  1YX6 B;  3MJW A;  1WR1 A;  3ZKJ C;  2KFJ A;  3D32 A;  3TEZ A;  2ZVN A;  2OHF A;  3LJ3 A;  1ZW7 A;  2W9N A;  2XEW A;  2BQQ A;  2WDT B;  5H8Y E;  4OVU A;  2NTS A;  4IWO A;  2KC1 A;  1YJ1 A;  2MSE D;  1I4X A;  3QAQ A;  2KTR A;  4JX1 C;  1AWD A;  1M94 A;  2C5L C;  2KDM A;  1J19 A;  2BBC A;  1IUE A;  2EEL A;  5BYS A;  2UYZ B;  4BZA A;  4ZRJ A;  2N7J A;  1RYJ A;  2PJH A;  3TEX A;  2OOB B;  2KQ7 A;  2WXR A;  1C9F A;  2M17 A;  4ACF A;  2K1F A;  2FCN A;  2WDQ B;  2DZK A;  4WJP A;  1TYG B;  3VTU A;  3RNC C;  4ITK A;  4S17 A;  1V81 A;  4XWW A;  3H8H A;  2MCN B;  3DHH C;  4BOS C;  1FNU A;  4KKJ A;  2HE7 A;  3QHT A;  2LJI A;  3R3M A;  3WCQ A;  1VLB A;  2CHW A;  3ETR A;  2MP2 A;  1NVI D;  3T3O A;  2PE9 A;  4G0N B;  4GMV A;  4NQK E;  3KUZ A;  2RPQ A;  2WP9 B;  1NYR A;  4FJZ A;  3VUY A;  3X0W A;  3NZS A;  4ZRP A;  3DVG X;  4RCO A;  4MGI E;  1E7U A;  1WFY A;  1E8W A;  2VH2 A;  4C4V A;  1UF0 A;  2JPH A;  2WQY B;  3TMP B;  1TZ1 A;  5DCN A;  2AWT A;  3ZRF A;  3PO0 A;  2MA9 B;  1GOZ A;  4DQO C;  1EF1 A;  1H8C A;  5LLI A;  3E56 A;  1L0V B;  3M62 B;  1V86 A;  4NPN A;  2FAZ A;  4WQO B;  2N0S B;  1STE A;  1CQV A;  2SAK A;  2KDE B;  2GMI C;  5IN7 A;  1V80 A;  2JRH A;  2FCQ A;  2JZP A;  5DPT A;  3NOB A;  3UGB B;  3RNF C;  3BII D;  3AV8 A;  1E8Y A;  1E8Z A;  3UIN B;  3A1Q A;  1WJ6 A;  2KWC A;  2MBB B;  1D6E C;  4HKZ E;  2XBB C;  2L05 A;  1NI2 A;  3PLV A;  2J4X A;  4FN2 A;  1ET6 A;  4DHJ D;  4GN1 A;  4LJP B;  2Z0E B;  4WAF A;  2L52 A;  4LNO A;  1KF6 B;  4KDL B;  2N9K A;  3RNE C;  2LI5 A;  1FD6 A;  4IW0 A;  3TSS A;  2KWV B;  5C1Z A;  4AS1 A;  4URK A;  2KXJ A;  2JYT A;  1XLN A;  1JWS D;  1WGY A;  4ANW A;  5TSS A;  3BVM A;  4KDI C;  2E6X A;  3U52 E;  3KYD D;  1ZXI A;  2M0X A;  3P42 A;  2IJ0 A;  2RDH A;  3FIL B;  2MRP A;  3KUD B;  2C7H A;  5J18 A;  1YD8 U;  3DBL B;  4N58 A;  1V1P B;  5FR3 A;  2OJR A;  2M4N A;  3WAN A;  4AUQ C;  1WZ0 A;  5D3I B;  4B95 A;  4C80 A;  2WXF A;  3Q8A A;  2G3Q B;  2DYO A;  3QC8 B;  1YQ4 B;  3PSE B;  4DHZ E;  2N1W A;  1P0R A;  2JY6 A;  3EA6 A;  1TS4 A;  3MC0 B;  4BKT A;  4E71 A;  1E7V A;  2B3A A;  2M56 B;  3KWL A;  2MJE A;  3PHW B;  1LO5 D;  2WXN A;  4WAA A;  1WGK A;  1RRB A;  1SSN A;  2ZVO A;  2QC8 A;  3P4R B;  5HG2 A;  3H9D A;  2KN4 A;  2V9H A;  4HK2 A;  1A5R A;  4N9F 4;  5AEK B;  3QIJ A;  4M8M A;  4JLC A;  2KQ4 X;  3RZF A;  2FID A;  4BKS D;  1E6E B;  1JWU D;  2MWS B;  2KDF B;  2LUM A;  4HVB A;  5CTR C;  3DQV A;  3AEG B;  2VH1 A;  4ZYN A;  2CHX A;  1GB1 A;  1V2Y A;  3OJ3 A;  1FNV A;  2CR5 A;  2C7M B;  3U4E G;  4JWS C;  2WDR B;  1AYF A;  3VH4 B;  3IBE A;  2D11 A;  3AEF B;  5AZG A;  4XZ4 A;  2ONQ A;  4WJO A;  2HTH A;  1PUT A;  1DGJ A;  2PE6 B;  4NJ7 A;  2OED A;  1XF5 L;  1OQY A;  4HWI B;  2WS3 B;  3MC9 A;  2BW2 A;  2LGI A;  1IGC A;  2QSD A;  4I6L B;  4HPL B;  4LJO B;  1XT9 B;  1ESF A;  3EGR A;  2V3N A;  3IVF A;  1E7P B;  3W1Y A;  1WJ4 A;  3V61 A;  1WJN A;  1N5W A;  1YN3 A;  4GIV A;  3RD2 A;  2NBV B;  2LHE A;  4ZDV A;  2BB5 A;  2RSU A;  3NVV A;  4OW0 A;  2GBR A;  1KLV A;  1E90 A;  2Z0D B;  1X1M A;  4GDK B;  3BK2 A;  3JSV A;  3PPA A;  4RFB A;  4BFR A;  4WWN A;  3L13 A;  5KHO A;  1R4M I;  4LDT B;  4G11 A;  2IND C;  3RCZ A;  3AE3 B;  5T8I A;  2JWU A;  3AED B;  1JQ4 A;  4DXF A;  1XQQ A;  2PIA A;  3ALB A;  1EF5 A;  2HD5 B;  2V4I B;  1FCC C;  2K6D B;  1V9J A;  2C9W B;  3U8Z A;  4DWF A;  3L16 A;  2PVG C;  2DAJ A;  2DZM A;  4KIK B;  3QK0 A;  2N4F A;  2WWZ A;  2TSS A;  4JGH B;  1B9R A;  2FNJ B;  1IYF A;  4HRO A;  1V5T A;  1D5Z C;  4FA6 A;  3ZO5 B;  5C2T B;  4W9H A;  1RWS A;  4S0R A;  1VJK A;  1XCT L;  1UZX B;  2FCM A;  4IM2 A;  1TY2 A;  1V8C A;  4ZHO A;  2CU3 A;  1I4R A;  1NBF C;  1FCL A;  3SHQ A;  2MBH A;  3AE9 B;  1SBB B;  2PKO A;  1FFU A;  4AJW A;  5JXV A;  3IFW B;  1OTR B;  5D7G A;  5EE0 A;  2MBQ A;  1KFY B;  2ZJD A;  4XDD A;  1EO6 A;  2C7N B;  2R61 A;  3MFG A;  3UQB A;  2QMT A;  3OLM D;  1HXY D;  3L10 B;  4NZL B;  1HA5 A;  1GPX A;  4P7I A;  3DHG C;  3VFK A;  5CHW A;  2ASQ A;  1XO3 A;  1P3Q U;  3AEE B;  2RD0 A;  4RF0 A;  2NBW B;  2L1A A;  2IGD A;  1WE7 A;  3NUH B;  5HFY A;  2K8H A;  4DDI D;  4GB9 A;  3RNA C;  3R7Q A;  2LRU A;  1Q0W B;  1FXA A;  1Y8R C;  3W5U B;  4EZK A;  2O2V B;  4PYU A;  1J0G A;  1C1Y B;  3OWE B;  2LVP A;  3LXF A;  5BYQ A;  1Q1O A;  1TKG A;  1KOT A;  1J8C A;  2PMV A;  3P1M A;  3HHM A;  3MHZ A;  3AEC B;  2ZNV B;  1WM3 A;  1HQR D;  2ZEQ A;  1GAQ B;  3VTV A;  1RLF A;  1QKZ A;  3E9S A;  1ACC A;  2WGS A;  1YMH E;  4XX5 A;  3FAH A;  1WI0 A;  2FUH B;  4NNJ B;  2QEJ C;  1NI3 A;  4F7Z A;  2KX3 A;  4YT0 B;  4K7W A;  4JWU C;  1JW9 D;  2BYE A;  3M95 A;  1KLG D;  3N1Y C;  1HTO A;  3KLS X;  3DBR I;  3ABV B;  2IGG A;  3BYT B;  4KSL C;  2J0K A;  1ZUD 2;  3P4S B;  1WX8 A;  3LB8 C;  3QA8 A;  4MJS B;  1SE4 A;  4P1B C;  2EKI A;  2FIF A;  1N60 A;  3VTW A;  1KTK A;  4FHJ A;  2PEA A;  4YTN B;  2K8B A;  1C4A A;  3GZN B;  3L17 A;  3WAP A;  3EEC A;  4DXG A;  5E6P A;  4RH6 A;  3R7R A;  2KD0 A;  1C79 A;  5FKA C;  2LVO A;  2BKR B;  1QT9 A;  4F8C B;  4GSW A;  1BML C;  3KQ4 A;  3ZNZ B;  5AUK A;  2IPK D;  5G5H A;  2KFK B;  1JRU A;  5AUI A;  3RYT A;  3LDZ E;  5CHF A;  3ZNI D;  4W9F A;  3DHI C;  3Q3F A;  2KVR A;  1MI0 A;  2INN E;  2JUO A;  1I4Q A;  3AE5 B;  3APD A;  1N63 A;  1KH0 A;  1YOV B;  2LVQ A;  2GBM A;  2KDI A;  4D2K A;  4A90 A;  1NEK B;  1YQ3 B;  2KKC A;  3PZ7 A;  1DOI A;  3K9P B;  5DPW A;  1D4B A;  2BYV E;  2KJ6 A;  1GC6 A;  4ZRK A;  1EWY C;  3DDC B;  1EWC A;  1J7A A;  3NRZ A;  2K9X A;  3AE6 B;  1C3T A;  3GB1 A;  3DWG C;  3V60 A;  2DNF A;  4IM3 A;  2LHD A;  3Q69 A;  3TL5 A;  2LD9 A;  3RN9 C;  2L3Z A;  1GNU A;  4US9 A;  2REX A;  3ONS A;  1V49 A;  2V1Y A;  4LNK A;  4ZHP A;  3ZJV A;  3IXS A;  2INC C;  2Y5C A;  3KYC D;  5J17 A;  2FCS A;  2R2Q A;  2LGY A;  3W1S C;  3U7Z A;  4MH0 E;  3N20 C;  3CMM B;  2DEN B;  3T3N A;  2JXX A;  1GG3 A;  2NTT A;  3H7P A;  3SU8 X;  2Z59 B;  2NMQ A;  4K3C A;  4HDQ A;  2IBI B;  3HM6 X;  2M0A A;  1T3Q A;  4RNA A;  2KT7 A;  2H89 B;  2WX1 A;  1IBX A;  3DBH B;  1T0Y A;  3NJT A;  4XWT A;  3PRZ A;  3P4Q B;  2QIL A;  2EKE C;  3TUO A;  2QIE B;  1PDX A;  4FHK A;  2N9P C;  2NR2 A;  2D10 A;  3TEY A;  3TBL D;  3ZRC A;  1WWT A;  3ZYY X;  2INP E;  5E6N A;  2ZZP B;  4LNF A;  4RF1 A;  1OQR A;  3ZQ4 A;  1WMH B;  4YTP B;  1K50 A;  2D3B A;  2MQJ A;  5I4D A;  4PS8 A;  2MH7 A;  3MHS D;  4AQ7 A;  3DBL I;  2ZW1 A;  2NPT B;  4N6E B;  3BWU D;  2MX2 A;  3H7S A;  1DYQ A;  3AI5 A;  3Q8E A;  3TCA A;  4HJG E;  3QX1 A;  2N9X A;  3RI7 C;  3V05 A;  4A9A A;  3A33 B;  2O6V B;  2RR9 A;  2PVO D;  4DHZ B;  4LK0 M;  2QHO A;  5HHD G;  2JZ3 B;  2W54 A;  4C56 C;  3IT6 B;  5BMG A;  2KN5 A;  2GLS A;  3AEB B;  3R66 C;  2BS3 B;  5G5G A;  1PGA A;  1JWB D;  1TY0 A;  3GS2 A;  3Q2A C;  2XNA C;  1UGM A;  2NS5 A;  2JXT A;  3GE3 C;  3UF8 A;  1E9M A;  1FXI A;  1R4N B;  3ML9 A;  1OEY A;  2J0M A;  3ZXV A;  3Q8B A;  2QCZ A;  4RGT A;  1UBQ A;  3RNB C;  3KH0 A;  4TKN A;  1WJU A;  4A6Q A;  1UNS A;  2D3C A;  4MM3 B;  2NCN A;  2DHZ A;  3PGE A;  4AJY B;  4P1C C;  3M3J A;  2JU6 X;  2DAF A;  2M1M A;  2IO1 B; 
#chains in the Genus database with same CATH homology
 4HLE A;  2J7Q B;  1OQY A;  4HWI B;  3AUL A;  4CHK A;  4NY0 A;  3DCG A;  1WMH A;  3UIO B;  3WAO A;  4KV2 A;  3S2A A;  3ZLZ A;  4RM9 A;  3EHV A;  4I6L B;  4HPL B;  2AL6 A;  1XT9 B;  2N1V A;  4LJO B;  1XD3 B;  1ISN A;  3IVF A;  1HE8 A;  5IAA C;  3VAW A;  4KZC A;  3AXC A;  4KZ0 A;  3W1Y A;  1QZE A;  1WJ4 A;  2DYB A;  3ML8 A;  4NJ6 A;  3V61 A;  1WJN A;  5D94 A;  4BKG A;  3B0A A;  2NPT A;  2NBV B;  4GIV A;  3RD2 A;  3QAR A;  1F9J A;  2RSU A;  4ANX A;  4ZDV A;  2GBR A;  2LUE A;  5G55 A;  5LXI B;  4WJN A;  5LXH A;  2L00 B;  1KLV A;  1E90 A;  2VRR B;  2Z0D B;  2YVC A;  3IG3 A;  1X1M A;  3A4S C;  4GDK B;  2YLM A;  3JVZ X;  2BWF A;  3JSV A;  3PPA A;  2IO3 B;  4BFR A;  2XK5 B;  4WWN A;  3L13 A;  5KHO A;  1R4M I;  4LDT B;  3QJZ A;  1V6E A;  1UH6 A;  2BKF A;  2IY0 B;  2AEH A;  2O6V A;  1CMX B;  4G11 A;  3NY5 A;  2JRI B;  2PPH A;  3SD5 A;  3RCZ A;  2A5U A;  4MGY E;  3N3K B;  4ZRI A;  2JF5 A;  1XQQ A;  4EKU A;  4HCN B;  3ALB A;  4GGQ A;  1EF5 A;  2HD5 B;  1NDD A;  1WXM A;  3PRE A;  2K6D B;  1V9J A;  4GU2 A;  2C9W B;  2JT4 B;  2D07 B;  3VVW B;  3U8Z A;  4DWF A;  1H4R A;  3L16 A;  2K39 A;  2DAJ A;  2DZM A;  4WJQ A;  4RM8 A;  2V3S A;  4KIK B;  3QK0 A;  4MEM A;  2N4F A;  2WWZ A;  4M8N A;  2Y5B B;  1D3Z A;  3ZDT A;  4K81 A;  3K9O B;  4CO7 A;  3A4R A;  4JGH B;  3OJ4 B;  2FNJ B;  2AYO B;  1I35 A;  1IYF A;  2AL3 A;  1V5T A;  4FA6 A;  1LM8 B;  3CSF A;  4PS3 A;  3H7P B;  3ZO5 B;  3PVL A;  2KK8 A;  2N7D A;  4HPM B;  4FLH A;  4W9H A;  2KTR B;  3RUI B;  5JH5 C;  4MM3 A;  3B08 A;  3V62 A;  3ZNG C;  1P9D U;  3L08 A;  1UZX B;  2KOX A;  2FCM A;  4IM2 A;  2ZCC A;  3VUX A;  2LRW A;  4ANU A;  3PRM B;  1NBF C;  2KWU B;  3SHQ A;  4GOC A;  3TJP A;  4JL9 A;  2N9E B;  1UBI A;  1WXV A;  2MBH A;  4IWP A;  1WGD A;  3WAM A;  1WYW B;  4BBN F;  3Q3J A;  4PYZ A;  3VHT C;  2JVC A;  3DVN U;  4AJW A;  1AAR A;  3ZDM C;  3QWZ B;  5EDS A;  3IFW B;  3B1L X;  3U7D A;  3CST A;  1OTR B;  4JIO U;  5D2M B;  5D7G A;  3WIM A;  4B6W A;  2MBQ A;  1RFA A;  4FAD A;  4MEL A;  4AOF A;  3CF6 E;  2ZJD A;  2CHZ A;  4RMA A;  3ZVV A;  1WRD B;  4ASW C;  1EO6 A;  1TBE A;  1Z2M A;  2C7N B;  4MSQ B;  4EUT A;  2KMC A;  3UQB A;  1R4N I;  2GOW A;  4FJY A;  2BYF A;  1LFD A;  2BF8 B;  3OLM D;  4AP4 C;  3L10 B;  1Q5W B;  2KJR A;  4P7I A;  4W9D A;  1BT0 A;  3VXW A;  3VFK A;  2EMS A;  4J6I A;  3N32 A;  5CHW A;  2ASQ A;  2KQS A;  2MBO A;  2JWZ A;  1P3Q U;  2RD0 A;  1G6J A;  2LAS A;  2XK5 A;  2NBW B;  3M63 B;  1SE9 A;  3ZUN A;  2KTF A;  1WE7 A;  4YL8 A;  3AU5 A;  2MP2 B;  2K8H A;  4DDI D;  4HDO A;  4W9K A;  2DYM A;  4EZJ A;  2KAN A;  1OGW A;  4DDG D;  4GB9 A;  3N30 A;  3ZTD A;  5GMV A;  2L76 A;  3ECI A;  4FUL A;  3R7Q A;  2KC2 A;  2LRU A;  1Q0W B;  1YX6 B;  4I6P A;  4DBG A;  3MJW A;  2BGF A;  1Y8R C;  4W9L A;  4EZK A;  2O2V B;  2L7R A;  3NZU A;  4PYU A;  1WR1 A;  4HCP B;  3ZKJ C;  2NBU A;  1J0G A;  1C1Y B;  2KFJ A;  2M8S A;  4MDK E;  1WGG A;  2LVP A;  3L0W B;  2KZR A;  3ENE A;  3D32 A;  2ZVN A;  3APF A;  1Q1O A;  3LJ3 A;  1KOT A;  1ZW7 A;  2J0J A;  2W9N A;  4KIK A;  2XEW A;  1ZGU B;  2K25 A;  2WDT B;  4XC2 A;  4OVU A;  4IWO A;  1J8C A;  3A9J B;  1TGZ B;  3A9K B;  2UWQ A;  3HHM A;  4IM0 A;  2RGF A;  2KC1 A;  1YJ1 A;  4DHJ B;  2MSE D;  1IP9 A;  2ZNV B;  1WM3 A;  3QAQ A;  2ZEQ A;  2IO0 B;  4F1S A;  2KTR A;  3VTV A;  1RLF A;  2ZPN A;  1M94 A;  3EC8 A;  4LDT D;  2C5L C;  1GUA B;  1J19 A;  1GJZ A;  1WGH A;  2D3G A;  4XX5 A;  1WI0 A;  2FUH B;  4NNJ B;  4W9E A;  4F7Z A;  2KX3 A;  2UYZ B;  4K7W A;  1I42 A;  2BYE A;  3M95 A;  4ZRJ A;  2PJH A;  2OOB B;  2A4Z A;  2KQ7 A;  3DBR I;  1PQS A;  1EUV B;  2LXC A;  4G3X B;  2M17 A;  4II3 B;  2K1F A;  3PLU A;  4ICU A;  3ZTC A;  2FCN A;  2DZK A;  2LWP A;  4KSL C;  2J0K A;  4MGZ E;  4WJP A;  3PRP B;  2D2Q A;  3VTU A;  1WX8 A;  3I3T B;  1V81 A;  1OEY J;  1WH3 A;  3QA8 A;  3A1Q B;  4MJS B;  1VD2 A;  4A20 A;  2FIF A;  3VTW A;  1LXD A;  1WM2 A;  3DPD A;  4FHJ A;  5TR5 A;  2L8J A;  5AZH A;  2PEA A;  4DXA B;  2MCN B;  2K8B A;  4HXD A;  3L17 A;  3WAP A;  3EEC A;  4BOS C;  3QCA A;  3GZN I;  5E6P A;  2GBN A;  3R7R A;  2HE7 A;  4A3O A;  3QHT A;  2KD0 A;  2CS4 A;  2ZPY A;  3UIP B;  1KM7 A;  2NVU I;  3R3M A;  2LVO A;  1WX7 A;  3O65 B;  4NAW A;  2BKR B;  4W9C A;  2CHW A;  4F8C B;  2MP2 A;  4ANV A;  4GSW A;  2PE9 A;  4A3P A;  4G0N B;  2MLB A;  2KO3 A;  4GMV A;  1S1Q B;  3ZNZ B;  2LGX A;  4W9G A;  4NQK E;  4KVG B;  1GC7 A;  2KFK B;  1JRU A;  2RPQ A;  2G4S A;  3EFU A;  3KUZ A;  3RYT A;  3X23 A;  1WXS A;  3LDZ E;  4OVV A;  4W9F A;  5CHF A;  2BWE S;  3ZNI D;  4TQ0 A;  4FJZ A;  3VUY A;  3X0W A;  3Q3F A;  3NZS A;  2KVR A;  3V6E B;  4ICV A;  3UQA A;  2O2V A;  3DVG X;  2KHW B;  1E8X A;  4W9J A;  2JUO A;  3H1U A;  3V6C B;  4MGI E;  1E7U A;  3AU4 A;  4PS7 A;  3APD A;  3L54 A;  1WFY A;  1E8W A;  1V5O A;  2LVQ A;  1Z5S B;  2GBM A;  2JPH A;  5JHA A;  2KDI A;  1KJT A;  3BY4 B;  2KKC A;  3TMP B;  4IC7 B;  3K9P B;  5DPW A;  1TZ1 A;  2I1J A;  2BYV E;  2KJ6 A;  1ZKH A;  4BBN C;  1L2N A;  1GC6 A;  4TQ1 A;  4ZRK A;  3DDC B;  3ZNH B;  1WGR A;  4GDK A;  2AWT A;  5DCN A;  4CYE A;  1UEL A;  3ZRF A;  3A9J A;  3A9K A;  3ZW3 A;  1C3T A;  2MA9 B;  4E3C A;  2GBJ A;  3V60 A;  2JZZ A;  1WXA A;  4IM3 A;  4GDL B;  1WZ3 A;  2LXA A;  1EF1 A;  4X57 B;  1H8C A;  4EOY A;  5LLI A;  3TL5 A;  2LD9 A;  1P1A A;  1V86 A;  2CU1 A;  2L3Z A;  3M62 B;  3IHP C;  4NPN A;  5BO4 B;  1GNU A;  3VH3 B;  2FAZ A;  4WQO B;  2DZI A;  4DK5 A;  2IYD B;  1VCB A;  2REX A;  3JYU A;  3ONS A;  4EFO A;  1YX5 B;  1V49 A;  1P98 A;  2KDE B;  2N7E A;  2GBK A;  2GMI C;  2V1Y A;  1S3S G;  3RT3 B;  2KMA A;  1V80 A;  3HK0 A;  2JRH A;  2DX5 B;  2FCQ A;  4HJK A;  2IY1 B;  4MGK E;  5DPT A;  5E6O A;  3NOB A;  1WIA A;  3NS8 A;  3UGB B;  3VQI A;  3KYC D;  2KJH B;  5J17 A;  4K7S A;  4EEW A;  5JHB A;  2KNB A;  2G4D B;  2FCS A;  2R2Q A;  2LGY A;  3W1S C;  1E8Y A;  1E8Z A;  3UIN B;  4IWQ A;  4FBJ B;  4MH0 E;  3KW5 B;  3CMM B;  3A1Q A;  4FJV B;  1WJ6 A;  2DEN B;  2LZ6 A;  1WY8 A;  2KWC A;  3P2B A;  2JXX A;  2MBB B;  1GG3 A;  1RAX A;  3GOE A;  3RUL A;  4KSK C;  4I6N B;  4K7U A;  5C23 A;  5CX3 A;  2XBB C;  3PV1 A;  3H7P A;  3SU8 X;  2L05 A;  2Z59 B;  1YIW A;  2IBI B;  3PT2 B;  1NI2 A;  3PLV A;  3HM6 X;  4HDQ A;  4FN2 A;  3U30 A;  4DHJ D;  3BIN A;  4MJS A;  4GN1 A;  4IG7 B;  2Z0E B;  4LJP B;  5KHQ A;  2IZV B;  3PHX B;  2WX1 A;  2ZNV C;  3SDL C;  1IPG A;  3PZD A;  1MG8 A;  4TV3 A;  3ZIM A;  3DBH I;  1T0Y A;  2L0F A;  4KDL B;  1LQB A;  2I1K A;  3PRZ A;  2CKH B;  1UD7 A;  4MSM B;  1WX9 A;  2LI5 A;  2EKE C;  1FXT B;  4JQW C;  4IW0 A;  2KFK A;  2KWV B;  5C1Z A;  4FHK A;  4M0W B;  2LJ5 A;  3T8M A;  4URK A;  1WF9 A;  2KXJ A;  2N9P C;  2NR2 A;  5FR6 A;  2D10 A;  2K6Q A;  3TBL D;  3ZRC A;  4AWJ A;  2K8C A;  4E74 A;  5E6N A;  1U4A A;  1WGY A;  3APC A;  2ZZP B;  4ANW A;  2DZJ A;  2LGD A;  4KDI C;  1WMH B;  4II2 B;  5L83 A;  3KYD D;  5JZE B;  2M0X A;  2MRP A;  4WWP A;  3KUD B;  2C7H A;  3C0R B;  2MQJ A;  5J18 A;  1YD8 U;  5J2R A;  4PS8 A;  3QQ8 B;  4BKS A;  4BOZ B;  2IO2 B;  3MHS D;  3DBL I;  2NPT B;  2OJR A;  2M4N A;  3DVG Y;  2EMT A;  2MX2 A;  3WAN A;  4AUQ C;  3H7S A;  4GDL A;  3HIZ A;  1WZ0 A;  3PTF C;  3AI5 A;  1WR6 E;  4B95 A;  3NHE B;  3OAW A;  4WWO A;  3TCA A;  3DBS A;  1E5W A;  2G3Q B;  3QX1 A;  3JSV B;  4K1R B;  2DYO A;  3MTN B;  2N9X A;  3QC8 B;  3PS6 A;  4TUU A;  5IA7 A;  2KDB A;  3PSE B;  5CHV C;  4GXB A;  3DVN V;  4DHZ E;  3A33 B;  2N1W A;  2O6V B;  1P0R A;  2RR9 A;  2JY6 A;  2G45 B;  3HM3 A;  1SGH A;  4DHZ B;  4BKT A;  2QHO A;  2O6V D;  3W1S A;  4E71 A;  2BPS A;  1E7V A;  3KVF B;  4NQL B;  2JZ3 B;  2B3A A;  1L7Y A;  3DOW A;  2KN5 A;  4B9K A;  3PHW B;  2MW5 A;  4WAA A;  3WAL A;  1RRB A;  2KLC A;  2ZVO A;  3R66 C;  3H9D A;  5DPR A;  2KLG A;  4HK2 A;  3VDZ A;  1A5R A;  4N9F 4;  4LCD E;  5AEK B;  2R2O A;  5D6J B;  5DPS A;  3QIJ A;  3H6N A;  4M8M A;  4JLC A;  2V4L A;  3RZF A;  2FID A;  4BKS D;  1SIF A;  1UGM A;  2MWS B;  4BVU C;  2MBE A;  2KDF B;  2NS5 A;  4IUM B;  4HVB A;  3UF8 A;  5CTR C;  2L0T A;  3DQV A;  5AZF A;  3RZW C;  3ML9 A;  3T9L A;  1YQB A;  4ZYN A;  2CHX A;  2C60 A;  4W9I A;  1V2Y A;  1OEY A;  2J0M A;  2ZCB A;  3TIX A;  3KUC B;  2KX0 A;  3OJ3 A;  2CR5 A;  1UBQ A;  2WX0 A;  2C7M B;  3KH0 A;  1TTN A;  4TKN A;  3VH4 B;  1WJU A;  3WA0 A;  1K8R B;  3IBE A;  2NCN A;  2D11 A;  2DHZ A;  3JW0 X;  3PGE A;  4AJY B;  3M3J A;  5AZG A;  3VUW A;  1WE6 A;  4XZ4 A;  4NAW B;  5HKH A;  4WJO A;  2HTH A;  4EZL A;  2HJ8 A;  4G50 A;  5G2N A;  5L95 C;  2PE6 B;  4NJ7 A;  2DAF A;  2WYQ A;  2M1M A;  2IO1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...