2NPTA

Crystal structure of the complex of human mitogen activated protein kinase kinase 5 phox domain (map2k5-phox) with human mitogen activated protein kinase kinase kinase 2 phox domain (map3k2-phox)
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
106
structure length
102
Chain Sequence
SMALGPFPAMQVLVIRIKIPNSGAVDWTVHSQLLFRDVLDVIGQVLPEATTTAFEYEDEDGDRITVRSDEEMKAMLSYYYSTVMEQQVNGQLIEPLQIFPRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the complex of human mitogen activated protein kinase kinase 5 phox domain (MAP2K5-phox) with human mitogen activated protein kinase kinase kinase 2 phox domain (MAP3K2-phox)
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Dual specificity mitogen-activated protein kinase kinase 5
total genus 21
structure length 102
sequence length 106
chains with identical sequence C
ec nomenclature ec 2.7.12.2: Mitogen-activated protein kinase kinase.
pdb deposition date 2006-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00564 PB1 PB1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2nptA01
3ZKJC 2KFJA 4W9GA 2K6QA 4DXAB 1AARA 1OGWA 1WRDB 2DZKA 4WWOA 4BKSA 2KWVB 2FCSA 3UINB 2KLCA 3GOEA 2YVCA 1NDDA 1J19A 2IYDB 5AZFA 4GDKA 2IY1B 3N32A 2KX3A 4G0NB 2A4ZA 2LGDA 2Z0EB 4W9LA 1Z2MA 4HWIB 3WALA 4EUTA 3UQAA 2HJ8A 3TL5A 1WJNA 3QA8A 4GXBA 1ZGUB 2DENB 4TQ0A 3SHQA 2KFKA 3APDA 4A20A 2JZ3B 2L05A 2K8HA 3L13A 1ZW7A 3KYDD 3APCA 2FIDA 2JPHA 3EC8A 1WMHA 3R66C 1H4RA 3B0AA 1WJ6A 4PYZA 2MWSB 4EEWA 3MTNB 5C1ZA 2C7HA 4HDQA 2MP2B 4X57B 2G4SA 2JT4B 4W9IA 5KHOA 3ZDMC 3L17A 3ML9A 3DVGY 4BKSD 3BY4B 4F1SA 4JGHB 4GMVA 4G3XB 3DVNV 3M63B 2J7QB 5HKHA 4CHKA 2OOBB 2DHZA 2K8BA 5D94A 3UQBA 1XT9B 3TMPB 2KJRA 3QJZA 5CX3A 4MEMA 4IWOA 2HE7A 2V3SA 3ZNID 2CKHB 1OTRB 3PV1A 2OJRA 2XBBC 3Q3JA 4OVUA 4BKGA 4ZRKA 4MJSA 3VXWA 3ZNHB 4ASWC 2VRRB 2GBNA 2Z59B 3A9KA 1S3SG 3A9JA 4BBNF 1V81A 3PTFC 1CMXB 4FJZA 1WX8A 2MA9B 4NJ6A 3KW5B 4FA6A 2K1FA 3VQIA 2G3QB 4AJWA 3TBLD 3R3MA 2KNBA 2DZMA 4MGIE 2L7RA 3NY5A 3M3JA 3ALBA 3VH4B 4G50A 1WM3A 4NQKE 3H6NA 4FJVB 4MGZE 4F8CB 1R4NI 2NBUA 2D11A 4II2B 2M1MA 1Q5WB 2DZIA 4KDIC 2D2QA 5CHFA 3VAWA 1KM7A 4ANVA 3ZW3A 3UGBB 3JYUA 4URKA 4LJOB 3DBSA 3DVNU 2LXAA 4II3B 1HE8A 1YX5B 4M8NA 1V49A 1LFDA 2MX2A 2KDBA 3U7DA 2CHWA 2ZZPB 2IO1B 2KANA 2NBVB 4IUMB 2RR9A 3NZSA 3KUZA 4EZKA 1YIWA 2G45B 2IO2B 2MLBA 2KK8A 1WIAA 2BF8B 2LVQA 2KDIA 2WX1A 5JHBA 2LVOA 2D07B 2Z0DB 1J8CA 2GOWA 4BOSC 1V80A 3IG3A 1Z5SB 1PQSA 4M8MA 1IYFA 2NS5A 3HHMA 1TTNA 3L16A 5D7GA 3VH3B 4WAAA 1VCBA 2HTHA 4WJNA 2N4FA 2MW5A 4A3PA 4MJSB 4AP4C 4DWFA 3HM6X 3N30A 5CHWA 1S1QB 3N3KB 1OEYA 1KOTA 2NPTB 3DBHI 4HVBA 1UH6A 1GG3A 3TJPA 4PS7A 2K39A 3PLUA 3T9LA 1Y8RC 4FADA 4XC2A 3RYTA 2XEWA 3ECIA 2JRIB 3SU8X 3A1QA 3W1SA 2DX5B 1JRUA 3V6CB 4E71A 1UBQA 3B1LX 3DVGX 4ZDVA 4K7WA 1V2YA 4B9KA 2JVCA 3VUYA 5L95C 4NAWA 2KC2A 2EMSA 4AUQC 4G11A 3QQ8B 3NOBA 3OJ4B 2D10A 1MG8A 2ASQA 2PE9A 4EOYA 2MSED 2I1JA 5AZHA 5KHQA 4DDGD 4IM3A 2CHZA 3V6EB 3PZDA 1V9JA 2AL3A 5AZGA 1LQBA 2BYEA 5CHVC 3SDLC 4DBGA 3ENEA 2KX0A 3GZNI 1RAXA 2WDTB 3WAPA 2MBEA 2DYMA 4IM2A 2DAFA 3X0WA 4FHJA 3OAWA 2MQJA 2W9NA 4NPNA 2BWES 4GOCA 3RZWC 3QC8B 5E6NA 4W9EA 2L8JA 4W9JA 5D2MB 3U30A 2J0JA 1WE6A 4TKNA 3X23A 2DYBA 2JWZA 4NQLB 1WJ4A 3BINA 1P0RA 3M62B 1BT0A 2N7EA 2RSUA 1D3ZA 2K25A 4I6LB 1WXSA 1WF9A 2LRWA 2KTRB 1E8ZA 3ONSA 4WWNA 1F9JA 5IAAC 4KSLC 4NJ7A 3IHPC 1ISNA 3RZFA 3QIJA 1VD2A 4MSQB 1P1AA 2HD5B 1TZ1A 1GNUA 3EHVA 3ZTDA 5DPWA 2BKFA 3DBLI 3AI5A 4HJKA 4KZCA 2LXCA 1V86A 4MGKE 3V60A 4ZRIA 4DK5A 4N9F4 2LASA 2FCNA 2NBWB 3PPAA 2GMIC 2MBBB 3ZLZA 2REXA 2KHWB 1R4MI 2KO3A 4TUUA 3UIPB 3VVWB 2KQSA 2LZ6A 2J0KA 3QWZB 3U8ZA 3L10B 2N9XA 2LUEA 2ZNVC 1KLVA 3ZNGC 2O2VA 3B08A 3A4SC 1GUAB 2KWCA 4MGYE 3PLVA 1WE7A 2KTRA 4MH0E 1WGDA 3WIMA 4LJPB 1P3QU 2LRUA 4I6PA 4OVVA 2WX0A 1YX6B 2FNJB 2KJ6A 4FLHA 2YLMA 1IPGA 3DOWA 4KVGB 2FCMA 1E7VA 4W9CA 4WQOB 3JW0X 3ZDTA 2N7DA 1WYWB 2R2OA 3KYCD 3QAQA 3WAOA 3KUCB 3QCAA 2ZCCA 4W9FA 4GU2A 3PHXB 1WI0A 4TQ1A 1WMHB 4GSWA 4EFOA 3MHSD 1SE9A 2RGFA 2IO3B 1UGMA 4DDID 2O6VD 3AULA 1L2NA 2MBQA 3DPDA 2KFKB 1NI2A 5DPSA 2MCNB 3AXCA 3VUWA 2KDEB 2R2QA 2DAJA 2EMTA 3H7PA 1GC7A 2B3AA 2N9EB 4MDKE 4W9KA 1P9DU 1T0YA 3PGEA 5DCNA 1EF5A 2KC1A 4PS3A 1WH3A 4ZYNA 2M0XA 2KVRA 3WA0A 2GBRA 1EO6A 2M4NA 3H7PB 2QHOA 2KMCA 2L3ZA 3CSTA 3Q3FA 3W1SC 4ANUA 1U4AA 1OEYJ 2XK5A 2UYZB 3ZTCA 1WGGA 2MBOA 2ZVNA 3NZUA 1WR1A 4GB9A 2KOXA 4ICVA 3V62A 2K6DB 2NVUI 1SIFA 2V4LA 3JSVA 2MP2A 3M95A 1E7UA 2GBMA 2XK5B 4KSKC 1Q1OA 2LI5A 5JZEB 3QK0A 1FXTB 5IA7A 1GC6A 3RUIB 2O6VB 3VHTC 4KDLB 4J6IA 5E6PA 2BKRB 3JVZX 1UD7A 1RLFA 2UWQA 4GGQA 3RULA 4AOFA 1UZXB 4FULA 1E5WA 4BOZB 3AU4A 4PYUA 3ZIMA 2L00B 3DCGA 3DQVA 5EDSA 3KH0A 2M17A 5J17A 4RM8A 3PT2B 1YJ1A 1EUVB 1J0GA 1K8RB 3OJ3A 3OLMD 3PRMB 2ZVOA 4HPLB 1QZEA 1Q0WB 5FR6A 1TGZB 2AYOB 3PSEB 3PREA 4PS8A 3ZVVA 3ML8A 1IP9A 4ANWA 1E8WA 4XX5A 1SGHA 3HK0A 4KV2A 1I42A 4K7SA 2A5UA 4HLEA 2BPSA 5BO4B 5J2RA 2L76A 4JLCA 3VDZA 4W9DA 1WXAA 4LCDE 3RCZA 4JL9A 5JHAA 2JF5A 2C9WB 1A5RA 4F7ZA 2KQ7A 3IVFA 4HCPB 2NPTA 3UF8A 1H8CA 2ZCBA 4FN2A 4MSMB 3L08A 2C60A 2BWFA 1NBFC 4IW0A 2IBIB 1XQQA 1RFAA 2KWUB 3L54A 4KZ0A 1ZKHA 2LJ5A 3P2BA 1RRBA 4BFRA 4P7IA 4MM3A 4CO7A 1WGHA 2WWZA 2CU1A 1WFYA 4W9HA 3UIOB 2FAZA 3NS8A 4DHJB 4E74A 3CF6E 3CSFA 4WJPA 2BGFA 3EECA 4DHZE 2ZPYA 2JRHA 3T8MA 4HCNB 2JUOA 2JXXA 3A9JB 3RD2A 2NR2A 2AEHA 1KJTA 4A3OA 3QARA 4GDKB 3WAMA 3ZNZB 3K9PB 3IBEA 4HPMB 4K1RB 3ZUNA 4EZJA 3H9DA 3JSVB 1X1MA 1WZ3A 2L0TA 4HDOA 4IWPA 2IZVB 4HXDA 2LD9A 3HM3A 4I6NB 1E8XA 2RPQA 3PRZA 4ICUA 4CYEA 1V6EA 3LDZE 5G55A 3O65B 4M0WB 2FCQA 2RD0A 3KVFB 4EZLA 3RT3B 2LGXA 3A1QB 3QHTA 2ZEQA 1WY8A 1EF1A 2C5LC 2FIFA 2IY0B 2J0MA 2LVPA 5J18A 1WGYA 4GDLB 3DBRI 4TV3A 4ZRJA 1GJZA 3D32A 4IWQA 2GBJA 3LJ3A 2D3GA 3H1UA 2KJHB 1WM2A 1WXMA 2O2VB 3IFWB 2CS4A 4B95A 3KUDB 4KIKA 3S2AA 3APFA 1WZ0A 4NY0A 3PS6A 3K9OB 4IG7B 2Y5BB 2JY6A 4RMAA 4EKUA 4GN1A 5AEKB 4FBJB 4LDTD 1WJUA 2ZNVB 3EFUA 1XD3B 4GIVA 4KIKB 2M8SA 2WYQA 1WXVA 4E3CA 3TCAA 5TR5A 4DHJD 2PPHA 4ANXA 2N1WA 2PEAA 2PJHA 4NAWB 2BYVE 1G6JA 2GBKA 5G2NA 4BBNC 4IC7B 3A9KB 2ZPNA 2KDFB 1I35A 4FJYA 1UELA 1WX9A 2N9PC 2JZZA 4B6WA 2KXJA 4HK2A 3CMMB 1WR6E 1OQYA 2I1KA 3I3TB 4JQWC 4RM9A 2L0FA 3VUXA 4BKTA 5L83A 1WGRA 2KD0A 2FUHB 2KMAA 3R7QA 2K8CA 3VFKA 1E90A 3SD5A 1V5TA 1C1YB 3W1YA 3MJWA 5E6OA 5C23A 1C3TA 5LLIA 4AJYB 5LXHA 5DPRA 4XZ4A 3V61A 1L7YA 4WJQA 2EKEC 4FHKA 3ZRCA 2MBHA 4IM0A 3VTWA 4LDTB 1WX7A 2CR5A 3HIZA 2N1VA 2IO0B 3PRPB 3PHWB 1TBEA 2KN5A 2KTFA 3A33B 3TIXA 3ZO5B 1LM8B 5DPTA 3AU5A 3ZRFA 5CTRC 1P98A 3R7RA 2O6VA 4YL8A 3A4RA 2DZJA 2LWPA 5JH5C 2AWTA 2NCNA 4JIOU 4K81A 4NNJB 4WJOA 3PVLA 2KLGA 1E8YA 1V5OA 2KKCA 2C7NB 2ZJDA 3QX1A 2MRPA 4WWPA 1YQBA 2C7MB 2V1YA 2CHXA 4AWJA 2G4DB 4GDLA 3VTVA 2LGYA 1YD8U 2DYOA 3C0RB 2KZRA 2AL6A 5GMVA 5D6JB 2PE6B 4BVUC 5LXIB 2BYFA 3DDCB 3WANA 3NHEB 4K7UA 3H7SA 4DHZB 1LXDA 3L0WB 4MELA 1UBIA 1M94A 3VTUA
chains in the Genus database with same CATH superfamily
4W9GA 5D3IB 1QF6A 2WU2B 1WRDB 1KF6B 1TY0A 3GOEA 1J19A 5AZFA 2IY1B 3DHHC 2KX3A 2Z0EB 4EUTA 3Q8BA 1WJNA 4JWSC 3SR6A 2KFKA 2PIAA 2WXGA 1AW7A 4REZA 3FKYA 3PO0A 2R61A 2INDC 4PYZA 2MWSB 1VRAB 1QILA 4HDQA 4X57B 2G4SA 1L6VA 3DBHB 3MC8A 3TEXA 3ML9A 4OZCA 4F1SA 4JGHB 4G3XB 2KMMA 1T0QC 2CJOA 5D94A 3UQBA 5GXGB 2HJ1A 4BZAA 3EFCA 2HE7A 4IWOA 5AUIA 1OTRB 2OJRA 3Q3JA 4OVUA 1JWAD 1YN3A 3N1YC 3VXWA 2WXRA 2Z59B 3AB5A 3T3OA 1S3SG 3A9JA 1V81A 3PTFC 5BMGA 1A70A 2MA9B 4NJ6A 3KW5B 1ZP0B 2K1FA 3VQIA 2G3QB 3TBLD 3R3MA 3RNEC 2K5PA 4MGIE 1KTKA 2FE8A 1IUEA 2M1MA 2DZIA 1EU3A 4URKA 2J53A 1KM7A 3ZW3A 3UGBB 3DBSA 1F1HA 4LNIA 1C4PA 3CWIA 4A6QA 4II3B 1E9MA 4HRSA 1LFDA 3U7DA 2AQ2B 1L4ZB 2KANA 3DWGC 4OZAA 2RR9A 3TUOA 3HUIA 3KUZA 2WDVB 4EZKA 1BMLC 2MLBA 2KDIA 1ZUD2 1V80A 4HJGE 1VZ6A 1Z5SB 1IYFA 1SJED 1K51A 4GLSC 2MW5A 4MJSB 1K52A 5CHWA 2NPTB 3DBHI 1UH6A 1GG3A 2K39A 3PLUA 1QLBB 3HVDA 1PGBA 2JRIB 4E71A 1FO4A 3B1LX 5D3DA 2V9HA 3VUYA 4NAWA 2LHDA 2NTTA 5EE3A 2L32A 4P1CC 2QMTA 2PE9A 2IDYA 5CHVC 4KGTA 2VZKB 1N6ZA 3WAPA 3OWEB 3AE8B 3X0WA 4NPNA 4NZLB 2WP9B 2D5GA 4W9EA 2JYEA 4TKNA 4ARCA 1JW9D 2DYBA 1TKYA 4NQLB 3KLSX 3BINA 1V97A 1OQQA 2RSUA 1WXSA 3ONSA 1R4MB 1EU4A 1ISNA 3U4EG 4MSQB 1P1AA 3ZTDA 3DBLI 3AI5A 3SEBA 1KFYB 2LXCA 4MGKE 2WQYB 4N9F4 2KO3A 4TUUA 3VVWB 2N9XA 5BYRA 2WXHA 5G5HA 1WE7A 4XDCA 1P3QU 1YX6B 2KJ6A 2QCZA 3SFDB 2DWQA 3ZDTA 1WYWB 3Q3MC 3WAOA 4YTNB 1EM7A 2DBYA 5FK9C 2H89B 2VZKD 2K3UA 1PUTA 1SE9A 2LGIA 2BW2A 2RGFA 5BYQA 1NI2A 5DPSA 5C3JB 1XEEA 2DAJA 2B3AA 1LGRA 2J42A 2N9EB 4MDKE 1P9DU 1T0YA 2KC1A 4ZYNA 2INNE 2GBRA 1SE2A 3CSTA 1FNUA 1MJDA 2JYTA 4D2KA 3BK1A 5EE9A 2KOXA 4ICVA 2M56B 2V4LA 2KYWA 1SIJA 1MPEA 4KSKC 2LI5A 3NJTA 4J6IA 3Q3NC 1TKGA 4BOZB 2EKIA 3AU4A 3J9CA 5J17A 1MVKA 1XLQA 3AE6B 4USAA 4HPLB 1C4CA 1QZEA 2AYOB 4RFBA 3MHZA 1DGJA 2A5UA 1DYQA 2QILA 1BUIC 4US9A 3DBLB 2L76A 4M00A 3RNBC 3VDZA 1P7EA 3RCZA 1FM0D 1GPXA 1FFUA 1LO5D 2NPTA 2KVZA 2BWFA 3RNFC 4QAYA 4YXDB 3NG0A 1YQ3B 1XQQA 2JSVX 3MC9A 4C4VA 4LTUA 2CU1A 3UIOB 2PMVA 4E74A 1J7AA 2OEDA 4HCNB 2JXXA 3RD2A 1KJTA 3V3XA 3RMKC 3ZUNA 3JSVB 1NYQA 2WS3B 2LD9A 4HXDA 4OW0A 2KDMA 3HM3A 4I6NB 1C78A 1V1OA 3PRZA 4M0WB 3KVFB 3RT3B 2QEJC 2C5LC 2FIFA 3DBRI 4RNAA 4IWQA 2GBJA 3NVWA 2D3GA 3H1UA 4B95A 3APFA 2BTEA 3K9OB 2Y5BB 1SEBD 4GN1A 1VR9A 3EFUA 1XD3B 2M8SA 2WXFA 2VH1A 1ZDVA 4ANXA 2X38A 5G2NA 4BBNC 1PGAA 4IC7B 2ZPNA 3P4PB 3CMMB 3GE8C 1I4PA 1OQYA 2I1KA 2LHEA 1TS5A 2FUHB 1C76A 3TEWA 1FPYA 3SD5A 1FIQA 1XXGA 2QC8A 3W5VB 2WXOA 5LXHA 4IOIE 2J52A 1ZXHA 4WJQA 3VR9B 4IM0A 4LDTB 2CR5A 3IAM1 2N1VA 3T3NA 4S17A 1LM8B 3AU5A 5CTRC 5H8YE 1VJKA 1AYFA 4YL8A 4DHZE 2KLGA 4WWPA 2ZJDA 5EDSA 1RYJA 4GDLA 3VTVA 4P1BC 2KZRA 2AL6A 5GMVA 5D6JB 1KH0A 3GS2A 1I4QA 2TSSA 1LXDA 1M94A 1SSNA 1QOGA 2K6QA 1OGWA 4BKSA 4WWOA 2FCSA 2YEPB 4O1NA 2KLCA 1NDDA 2IYDB 2LGDA 3WALA 1AN8A 3P4RB 3U7ZA 4EE2A 2PVGC 3TL5A 1ZGUB 1JALA 3SHQA 3APDA 4A20A 3HVZA 3KYDD 3APCA 3EC8A 1H4RA 3MTNB 5KHOA 3L17A 3DVGY 2LUMA 3EA6A 3BY4B 3C8YA 2HTME 4GMVA 3DVNV 2PTLA 4HROA 2K8BA 3ZJUA 5CX3A 4MEMA 4C56C 3ZNID 1YQ4B 2XBBC 1L4DB 4BKGA 4MJSA 4BAXA 3ZNHB 1F77A 4ASWC 2VRRB 1CMXB 4FJZA 1WX8A 1QOAA 2AX5A 2L7RA 4XYCA 3ZJTA 4YSYB 4OVZA 4NQKE 3H6NA 4FJVB 2NBUA 2D11A 4Q2JA 1Q5WB 2N0SB 1YX5B 4M8NA 1V49A 3MFGA 1C77A 1HZ5A 3CIRB 1YNTE 5BMHA 2NBVB 2I38A 2IO2B 2KK8A 4XWTA 1WIAA 2LVQA 1L0XB 2LVOA 3IT4B 2D07B 2GOWA 2JXTA 1TYGB 3P4QB 3Q14C 1PQSA 4N6EB 4LNFA 4ZOHC 4WJNA 4C7YA 2WNMA 3E9SA 5HG2A 3TJPA 4PS7A 2MJDA 3T9LA 4HEA1 3P4SB 2QJLA 3SU8X 1JRUA 3FILA 3DVGX 4ZDVA 1B1ZA 4US8A 5L95C 4OZBA 2GLSA 1IGDA 2EMSA 1SBBB 2BB6A 3NOBA 3OJ4B 2D10A 4EOYA 4ZYSA 4L23A 4DDGD 2CHZA 3AEBB 5AZGA 3SDLC 1DOYA 4DBGA 1SE3A 2KX0A 1RAXA 2WDTB 1DOIA 2MBEA 1L5PA 1MI0A 2DAFA 4FHJA 2MQJA 4GOCA 4M02A 3RZWC 1YMHE 1I4XA 1YN4A 2AQ1B 5E6NA 4W9JA 3X23A 3M62B 1T3QA 2LRWA 1E8ZA 4WWNA 4KSLC 3RZFA 4A90A 1L6UA 3EHVA 5DPWA 2W3RA 2KQ4X 4HJKA 4KGSA 2IPKD 1TT5B 1V86A 3AE9B 4DK5A 2IGHA 4DXGA 1WWTA 2NBWB 3B2FA 3DBRB 3VR8B 3UIPB 2KQSA 2LZ6A 3QWZB 3U8ZA 2LUEA 1D6EC 1KLVA 2O2VA 3B08A 3Q8AA 3A4SC 3AEEB 3PLVA 1KRHA 2KTRA 4MH0E 4AQ7A 1WGDA 2K0PA 4KVGB 4W9CA 2FNJB 3KQ4A 2YLMA 3DOWA 4YT0B 1E7VA 3JW0X 4ITKA 3RN9C 3KYCD 1QT9A 2V3NA 3KUCB 1XCQL 2ZCCA 2V0GA 2ACZB 3RNAC 3PHXB 3N9YC 2BQQA 2K9XA 1FXIA 2ZW0A 4KKJA 2O6VD 1L2NA 3GB1A 3NVVA 2KDEB 1FRDA 3ETRA 2KVRA 1GAQB 2L1AA 1GB4A 3H7PB 3W1SC 1U4AA 2XK5A 2UYZB 3ZTCA 1NYRA 2MBOA 3Q6BA 1WR1A 2BYTA 3V62A 2NVUI 1SIFA 1C9FA 3PZ8A 2QSDA 3QK0A 1FXTB 5IA7A 2RDGA 2O6VB 3VHTC 2BVCA 5E6PA 2BKRB 3JVZX 1UD7A 1RLFA 4GGQA 4YSZB 5T8IA 2JZPA 4LNNA 3PT2B 5JXVA 1YJ1A 3KWVA 3PRMB 2ZVOA 1Q0WB 3IT6B 5FR6A 3RNCC 4AS1A 1L0VB 4N58A 3W5UB 4ANWA 2W3SA 1I42A 2LMCA 4HLEA 2BPSA 1ET9A 4A9AA 2YEPF 2INPE 1WXAA 5IKCM 1TKEA 2JF5A 2C9WB 1A5RA 1K50A 3AEGB 2H88B 1Q10A 2KQ7A 4HCPB 3UF8A 4FN2A 4MSMB 3L08A 2C60A 2IBIB 3L54A 4BFRA 4P7IA 2HDEA 4CO7A 2WWZA 4DHJB 3BVZA 3MC0B 2KT7A 3CSFA 4WJPA 1ACCA 3P1MA 3A9JB 4A3OA 3QARA 3ZNZB 1D5MC 3AE1B 4HPMB 3IBEA 4CQNA 4K1RB 1V1PA 1YN5A 2ON8A 2RPQA 3AEFB 3BYYB 4ICUA 5G55A 1QQRA 2RD0A 1RM6C 1QKZA 2QDFA 1WSPA 2ZEQA 1WY8A 1JWBD 2LVPA 4JE3B 3BVGA 4GDLB 4TV3A 3LJ3A 1WM2A 1WXMA 2O2VB 3IFWB 4KIKA 3S2AA 4RF0A 3Q8EA 1N61A 1N5XA 1WJUA 2ZNVB 2B76B 1WGKA 2VH2A 4GIVA 2I2YA 2WYQA 1WXVA 3TCAA 2PPHA 2PEAA 2PJHA 4NAWB 1G6JA 2GBKA 1YJIA 1UELA 1WX9A 1K53A 3I9V1 3VUXA 4RM9A 3NZ3A 5L83A 2OHFA 1WGRA 2KD0A 3W1YA 2NTSA 1C3TA 4P6VF 2WXNA 5LLIA 1UNSA 1N62A 3V61A 2EKEC 4FHKA 4XDDA 3ZRCA 2MBHA 3VTWA 3AE4B 1WX7A 3PRPB 3PHWB 5BMIA 3ZO5B 5IN7A 5DPTA 1TIFA 5IOIA 1P98A 2O6VA 2NMQA 2DZJA 1B9RA 3HRDD 4NNJB 2NCNA 2MRPA 2G4DB 2Q5WD 4BVUC 4YSXB 2BYFA 3WANA 2FBWB 4K7UA 1SB3C 3BVMA 3AEAB 3Q69A 4MELA 1UBIA 1T0SC 2Y3AA 3ZKJC 2KFJA 4DXAB 1AARA 3URYA 2KWVB 3UINB 3AECB 3ZGZA 2YVCA 1AWDA 3N32A 4G0NB 2A4ZA 1N63A 1TS4A 3VRBB 4GXBA 2N7JA 5E6JA 3L13A 1ZW7A 3C19A 3NVYA 1WJ6A 4EEWA 2BT6A 1OQRA 4BKSD 2WDQB 3ABVB 2EELA 4LK0M 2E3TA 2OOBB 2DHZA 1JWMD 3TMPB 2KJRA 3QJZA 2V3SA 4ZRKA 1JMLA 3I5JC 3A9KA 2GBNA 3N20C 4A8XC 3NVZA 4AJWA 2UU7A 1XLNA 2KNBA 2DZMA 3RFZB 3NY5A 3ALBA 1HXYD 2RMMA 1EWCA 4MGZE 4F8CB 3H8HA 1TS2A 3DWMA 4KDIC 2D2QA 3W2DA 4ANVA 3JYUA 2WLBA 1HE8A 4PK1A 1PDXA 3NZSA 1YIWA 2G45B 1GOZA 1ZXIA 4MACA 2PKOA 3I57A 5JHBA 4BOSC 1CJEA 4M8MA 2NS5A 3HHMA 1I7HA 2D3AA 4ZHPA 1TTNA 3L16A 3VH3B 2HTHA 2KAJA 2BS4B 2N4FA 4A3PA 4AP4C 4DWFA 3HM6X 3N30A 1OEYA 4S0RA 1SF0A 1Y8RC 3EGRA 3RYTA 3ECIA 3A1QA 1TS3A 3W1SA 2G1EA 1SXTA 3V6CB 1HA5A 2JVCA 5I4DA 2FUG1 1I4RA 4AUQC 3QQ8B 1MG8A 2ASQA 1ZE3D 3MP9A 2I1JA 5AZHA 5KHQA 3U52E 4IM3A 3AE2B 3V6EB 1V9JA 1LQBA 1JRPA 3MJ5A 1VDVA 1VZ7A 4IM2A 1JROA 3R2IA 1WRIA 2W9NA 2BWES 3QC8B 5D2MB 3U30A 3FC4A 1WE6A 1NVID 4HKQA 2JWZA 1WJ4A 1P0RA 1BXTA 2N7EA 4JWUC 4LNOA 3N1ZC 2K25A 1WF9A 1F9JA 5IAAC 4NJ7A 3IHPC 4ZRQA 1D5ZC 4IKGA 5HFYA 1E10A 4ACFA 3DHIC 2HD5B 1GNUA 2BKFA 3WCQA 4ZRIA 3AH7A 2FCNA 2BS2B 3PPAA 2GMIC 2MBBB 3ZLZA 2REXA 2KHWB 3SFEB 3AN1A 2KWCA 4MGYE 5FKAC 4P16A 2MEKA 1FNWA 3WIMA 2OJWA 4LJPB 4OVVA 4XGAB 1IPGA 4M0WA 2FCMA 2BBCA 1KLGD 2N7DA 4W9FA 3AMZA 4GU2A 4TQ1A 2LJIA 4GSWA 1NENB 2IO3B 5FR3A 3DPDA 2KFKB 4N59A 2MCNB 3ZJVA 3AXCA 4PT5A 3VUWA 2WXJA 4KGRA 2EMTA 1GC7A 4W9KA 2WHIA 3PGEA 2M0XA 3WA0A 2M4NA 1E7PB 5HHDG 2L3ZA 3Q3FA 1XF5L 1OEYJ 2D3BA 1WGGA 4GB9A 3Q8CA 1ENFA 1XCTL 2Z8LA 2K6DB 1MHHE 2SEBD 2JU6X 2V4IB 2MP2A 2JX5A 3M95A 2GBMA 1Q1OA 3Q8FA 4A55A 1T6BX 1GC6A 1CQVA 3Q2AC 4KDLB 3RULA 1HQRD 2UWQA 1V1PB 1UZXB 1E5WA 1RWSA 4PYUA 3ZIMA 3DQVA 4J3OD 3KH0A 4RM8A 3VRAB 2L83A 2WU5B 1IGCA 3P63A 4LNKA 1J0GA 3V05A 2INCC 3OJ3A 3OLMD 3ZVVA 1TGZB 4PS8A 1SGHA 3HK0A 4KV2A 1P7FA 4C80A 2WGSA 4K7SA 4JLCA 2WXMA 4W9DA 2M19A 4LCDE 4JL9A 5JHAA 4F7ZA 2ZCBA 4IW0A 2KWDA 2JWUA 2KWUB 4KZ0A 4XWWA 3P2BA 4RGMA 4MM3A 4HKZE 1WFYA 4W9HA 1JQ4A 2FAZA 2BGFA 3EECA 3DHGC 4MT5A 2JRHA 1YJJA 3LB8C 2AEHA 3GE3C 4JX1C 3K9PB 3AE5B 4EZJA 1UGJA 1X1MA 2WXKA 4ZRPA 1QOFA 2K22A 3O65B 3OG5A 2FCQA 2LGXA 3A1QB 1FMAD 5J18A 4R3DA 1EF1A 1FNVA 1WGYA 3ZXVA 1GJZA 3D32A 2DNFA 4ARIA 2CS4A 3KUDB 1WZ0A 4NY0A 3PS6A 5IO9A 4YTMB 2JY6A 4K3BA 4RCOA 2XN9C 1ZPSA 4LDTD 4FBJB 1FD6A 5TR5A 4DHJD 2N1WA 3IAS1 1PYWD 2PLPA 1R4NB 3A9KB 2KDFB 1XLPA 4FJYA 3TEZA 4B6WA 4M01A 4OHJA 4JQWC 1WR6E 4MH8A 1T5XD 2L0FA 1FEHA 3VFKA 2GRIA 1V5TA 5E6OA 3FAHA 2WDRB 1FCCC 4WH4A 2ZW1A 4FXCA 5AUKA 3HIZA 1TBEA 2KTFA 2RDBC 3TIXA 1NEKB 5BYSA 3R7RA 1TJEA 2KACA 3A4RA 5JH5C 3O13A 1TZOA 1E8YA 1V5OA 2LFIA 3KWLA 1YQBA 2CHXA 2IGGA 2DYOA 3C0RB 2PE6B 3NHEB 3H7SA 4JPSA 3L0WB 3R2TA 3I63C 2DZKA 4GDKA 4W9LA 3UQAA 1Z2MA 2E6XA 4HWIB 2HJ8A 3QA8A 2DENB 4TQ0A 5IP4D 2JZ3B 2L05A 2K8HA 1L0YB 2FIDA 2JPHA 1WMHA 3R66C 3B0AA 4RGOS 2MHJA 4YTPB 2C7HA 5C1ZA 2MP2B 1YOVB 2JT4B 4W9IA 3AEDB 1JWUD 2RPVA 4DQOC 3M63B 4WWMA 2J7QB 5HKHA 4CHKA 1XT9B 2N9KA 1IBXB 2CKHB 3TSSA 3PV1A 3B9JA 1E0ZA 3ZYYX 4BBNF 4NAMA 5H92C 4FA6A 4YWGG 2JQRB 2N9LA 3AM9A 3M3JA 3RI7C 3VH4B 4G50A 3UI3A 1WM3A 1R4NI 1SJHD 4II2B 3VAWA 5CHFA 4LJOB 3DVNU 1ROEA 2LXAA 2WXIA 2WXQA 3ZXRA 2ICIA 1I4HA 2MX2A 2W54A 2KDBA 2LGSA 2CHWA 2ZZPB 2IO1B 2WXPA 4IUMB 4B0MA 1ESFA 1MFWA 2BB5A 2BF8B 2WX1A 2GB1A 2Z0DB 1J8CA 1XO3A 3IG3A 1HTQA 5D7GA 1MHXA 4WAAA 1VCBA 1CK1A 1J7CA 1S1QB 1JWSD 3N3KB 1KOTA 3AE7B 4HVBA 3LXFA 4FADA 2AQ3B 4XC2A 3U2SC 2XEWA 2DX5B 2Y5PA 1UBQA 4K7WA 1V2YA 4B9KA 2KC2A 3ZQ4A 4G11A 2MSED 1UWXA 4H2AA 3PZDA 2AL3A 2BYEA 3ENEA 3GZNI 2DYMA 1J7BA 1NI3A 3OAWA 2PW9A 4IDIA 2L8JA 2J0JA 2GI9A 4C7ZA 3EUB2 1OFFA 1BT0A 1D3ZA 1D5XC 4I6LB 2KTRB 4B0EA 1Y56A 3AE3B 3N1XC 3P42A 3QIJA 3NS1A 1VD2A 1TZ1A 4KX6B 2X8XX 4KZCA 3V60A 1ZOYB 2LASA 4WQMA 1F2RI 3GZNB 1R4MI 2MJ3A 2J0KA 2QIEB 3L10B 2ZNVC 3ZNGC 4C4VB 3W9CB 1GUAB 1CZPA 1V8CA 3BWUD 3RPFC 1ZDXA 2LRUA 4I6PA 5C2TB 2WX0A 4FLHA 4WQOB 4CYEA 2XNAC 1HTOA 3QAQA 2R2OA 3AV8A 4WIPA 3QCAA 1WI0A 4C00A 1WMHB 4DXFA 4EFOA 3MHSD 1UGMA 4DDID 1FRRA 3AULA 4WURA 2MBQA 2BS3B 2CJNA 2CU3A 2R2QA 4K3CA 3H7PA 2LEKA 4RGTA 3RNGC 2WXLA 5DCNA 1EF5A 4PS3A 1WH3A 1HEZE 1EO6A 1TY2A 2IJ0A 2QHOA 2KMCA 4ZHOA 4ANUA 1FXAA 3FILB 2ZVNA 3NZUA 2W55A 1IBXA 4LLGM 4UDUC 1WXQA 2Y5CA 1R7SA 3JSVA 3BIID 1E7UA 2XK5B 3L4PA 5JZEB 2V3PA 1FFVA 3BK2A 3BYTB 3RUIB 4AOFA 4FULA 5EE0A 3E56A 2L00B 3DCGA 2M17A 1ET6A 1EUVB 1M4VA 1K8RB 1I4GA 2G9HD 3LYYA 3PSEB 3PREA 3ML8A 1IP9A 2KN4A 1E8WA 4XX5A 4TSSA 5G5GA 5BO4B 1F52A 5J2RA 1GB1A 4RH6A 3IVFA 1H8CA 1C79A 1NBFC 1RFAA 4RGNA 1ZKHA 2LJ5A 1RRBA 1WGHA 3NS8A 4NJCA 1FCLA 3CF6E 1UWMA 2ZPYA 3T8MA 2JUOA 4XE0A 2PVOD 2NR2A 3IXSA 4GDKB 3WAMA 3H9DA 1RFKA 2L0TA 1WZ3A 4IWPA 2SAKA 4HDOA 3R8BA 5MPOA 2IZVB 1E8XA 1PGXA 2ONQA 3TEYA 1F0ZA 1V6EA 3LDZE 4EZLA 3QHTA 2IY0B 2J0MA 1F2RC 4ZRJA 1JCKB 2KJHB 1UUPA 3B2GA 1EWYC 4IG7B 4L2YA 4RMAA 4EKUA 2D3CA 4RF1A 1WYGA 5AEKB 5LNK1 4HPPA 4TMAB 2RDHA 4KIKB 4E3CA 4KKIA 2L52A 1N60A 2BYVE 1XLOA 5EE1A 1T0RC 1I35A 2N9PC 2JZZA 2KXJA 4HK2A 3NUHB 3I3TB 1PFDA 3NRZA 1KLUD 1STEA 4BKTA 1VLBA 2KMAA 3R7QA 2K8CA 1VZ8A 1E90A 2M0AA 1C1YB 3MJWA 5C23A 3BZDB 1HZ6A 4AJYB 3GP7A 1N5WA 5DPRA 4XZ4A 1L7YA 2IGDA 1C4AA 1E6EB 2IO0B 4L1BA 2KN5A 1MG4A 1D4BA 1SE4A 3A33B 5HI1A 3ZRFA 2MJEA 2W82A 2LWPA 2AWTA 4WJOA 4JIOU 4K81A 4MM3B 3ZDMC 3PVLA 3Q3OC 3QX1A 5TSSA 2KKCA 2C7NB 4AWJA 2V1YA 2C7MB 4WAFA 2J4XA 2LGYA 1YD8U 1UF0A 5LXIB 1DOXA 3DDCB 2DLBA 4DHZB 3PZ7A 2MH7A 3VTUA 1QOBA
chains in the Genus database with same CATH topology
3ZKJC 2KFJA 4W9GA 2K6QA 4DXAB 1AARA 1OGWA 1WRDB 2DZKA 4WWOA 4BKSA 2KWVB 2FCSA 3UINB 2KLCA 3GOEA 2YVCA 1NDDA 1J19A 2IYDB 5AZFA 4GDKA 2IY1B 3N32A 2KX3A 4G0NB 2A4ZA 2LGDA 2Z0EB 4W9LA 1Z2MA 4HWIB 3WALA 4EUTA 3UQAA 2HJ8A 3TL5A 1WJNA 3QA8A 4GXBA 1ZGUB 2DENB 4TQ0A 3SHQA 2KFKA 3APDA 4A20A 2JZ3B 2L05A 2K8HA 3L13A 1ZW7A 3KYDD 3APCA 2FIDA 2JPHA 3EC8A 1WMHA 3R66C 1H4RA 3B0AA 1WJ6A 4PYZA 2MWSB 4EEWA 3MTNB 5C1ZA 2C7HA 4HDQA 2MP2B 4X57B 2G4SA 2JT4B 4W9IA 5KHOA 3ZDMC 3L17A 3ML9A 3DVGY 4BKSD 3BY4B 4F1SA 4JGHB 4GMVA 4G3XB 3DVNV 3M63B 2J7QB 5HKHA 4CHKA 2OOBB 2DHZA 2K8BA 5D94A 3UQBA 1XT9B 3TMPB 2KJRA 3QJZA 5CX3A 4MEMA 4IWOA 2HE7A 2V3SA 3ZNID 2CKHB 1OTRB 3PV1A 2OJRA 2XBBC 3Q3JA 4OVUA 4BKGA 4ZRKA 4MJSA 3VXWA 3ZNHB 4ASWC 2VRRB 2GBNA 2Z59B 3A9KA 1S3SG 3A9JA 4BBNF 1V81A 3PTFC 1CMXB 4FJZA 1WX8A 2MA9B 4NJ6A 3KW5B 4FA6A 2K1FA 3VQIA 2G3QB 4AJWA 3TBLD 3R3MA 2KNBA 2DZMA 4MGIE 2L7RA 3NY5A 3M3JA 3ALBA 3VH4B 4G50A 1WM3A 4NQKE 3H6NA 4FJVB 4MGZE 4F8CB 1R4NI 2NBUA 2D11A 4II2B 2M1MA 1Q5WB 2DZIA 4KDIC 2D2QA 5CHFA 3VAWA 1KM7A 4ANVA 3ZW3A 3UGBB 3JYUA 4URKA 4LJOB 3DBSA 3DVNU 2LXAA 4II3B 1HE8A 1YX5B 4M8NA 1V49A 1LFDA 2MX2A 2KDBA 3U7DA 2CHWA 2ZZPB 2IO1B 2KANA 2NBVB 4IUMB 2RR9A 3NZSA 3KUZA 4EZKA 1YIWA 2G45B 2IO2B 2MLBA 2KK8A 1WIAA 2BF8B 2LVQA 2KDIA 2WX1A 5JHBA 2LVOA 2D07B 2Z0DB 1J8CA 2GOWA 4BOSC 1V80A 3IG3A 1Z5SB 1PQSA 4M8MA 1IYFA 2NS5A 3HHMA 1TTNA 3L16A 5D7GA 3VH3B 4WAAA 1VCBA 2HTHA 4WJNA 2N4FA 2MW5A 4A3PA 4MJSB 4AP4C 4DWFA 3HM6X 3N30A 5CHWA 1S1QB 3N3KB 1OEYA 1KOTA 2NPTB 3DBHI 4HVBA 1UH6A 1GG3A 3TJPA 4PS7A 2K39A 3PLUA 3T9LA 1Y8RC 4FADA 4XC2A 3RYTA 2XEWA 3ECIA 2JRIB 3SU8X 3A1QA 3W1SA 2DX5B 1JRUA 3V6CB 4E71A 1UBQA 3B1LX 3DVGX 4ZDVA 4K7WA 1V2YA 4B9KA 2JVCA 3VUYA 5L95C 4NAWA 2KC2A 2EMSA 4AUQC 4G11A 3QQ8B 3NOBA 3OJ4B 2D10A 1MG8A 2ASQA 2PE9A 4EOYA 2MSED 2I1JA 5AZHA 5KHQA 4DDGD 4IM3A 2CHZA 3V6EB 3PZDA 1V9JA 2AL3A 5AZGA 1LQBA 2BYEA 5CHVC 3SDLC 4DBGA 3ENEA 2KX0A 3GZNI 1RAXA 2WDTB 3WAPA 2MBEA 2DYMA 4IM2A 2DAFA 3X0WA 4FHJA 3OAWA 2MQJA 2W9NA 4NPNA 2BWES 4GOCA 3RZWC 3QC8B 5E6NA 4W9EA 2L8JA 4W9JA 5D2MB 3U30A 2J0JA 1WE6A 4TKNA 3X23A 2DYBA 2JWZA 4NQLB 1WJ4A 3BINA 1P0RA 3M62B 1BT0A 2N7EA 2RSUA 1D3ZA 2K25A 4I6LB 1WXSA 1WF9A 2LRWA 2KTRB 1E8ZA 3ONSA 4WWNA 1F9JA 5IAAC 4KSLC 4NJ7A 3IHPC 1ISNA 3RZFA 3QIJA 1VD2A 4MSQB 1P1AA 2HD5B 1TZ1A 1GNUA 3EHVA 3ZTDA 5DPWA 2BKFA 3DBLI 3AI5A 4HJKA 4KZCA 2LXCA 1V86A 4MGKE 3V60A 4ZRIA 4DK5A 4N9F4 2LASA 2FCNA 2NBWB 3PPAA 2GMIC 2MBBB 3ZLZA 2REXA 2KHWB 1R4MI 2KO3A 4TUUA 3UIPB 3VVWB 2KQSA 2LZ6A 2J0KA 3QWZB 3U8ZA 3L10B 2N9XA 2LUEA 2ZNVC 1KLVA 3ZNGC 2O2VA 3B08A 3A4SC 1GUAB 2KWCA 4MGYE 3PLVA 1WE7A 2KTRA 4MH0E 1WGDA 3WIMA 4LJPB 1P3QU 2LRUA 4I6PA 4OVVA 2WX0A 1YX6B 2FNJB 2KJ6A 4FLHA 2YLMA 1IPGA 3DOWA 4KVGB 2FCMA 1E7VA 4W9CA 4WQOB 3JW0X 3ZDTA 2N7DA 1WYWB 2R2OA 3KYCD 3QAQA 3WAOA 3KUCB 3QCAA 2ZCCA 4W9FA 4GU2A 3PHXB 1WI0A 4TQ1A 1WMHB 4GSWA 4EFOA 3MHSD 1SE9A 2RGFA 2IO3B 1UGMA 4DDID 2O6VD 3AULA 1L2NA 2MBQA 3DPDA 2KFKB 1NI2A 5DPSA 2MCNB 3AXCA 3VUWA 2KDEB 2R2QA 2DAJA 2EMTA 3H7PA 1GC7A 2B3AA 2N9EB 4MDKE 4W9KA 1P9DU 1T0YA 3PGEA 5DCNA 1EF5A 2KC1A 4PS3A 1WH3A 4ZYNA 2M0XA 2KVRA 3WA0A 2GBRA 1EO6A 2M4NA 3H7PB 2QHOA 2KMCA 2L3ZA 3CSTA 3Q3FA 3W1SC 4ANUA 1U4AA 1OEYJ 2XK5A 2UYZB 3ZTCA 1WGGA 2MBOA 2ZVNA 3NZUA 1WR1A 4GB9A 2KOXA 4ICVA 3V62A 2K6DB 2NVUI 1SIFA 2V4LA 3JSVA 2MP2A 3M95A 1E7UA 2GBMA 2XK5B 4KSKC 1Q1OA 2LI5A 5JZEB 3QK0A 1FXTB 5IA7A 1GC6A 3RUIB 2O6VB 3VHTC 4KDLB 4J6IA 5E6PA 2BKRB 3JVZX 1UD7A 1RLFA 2UWQA 4GGQA 3RULA 4AOFA 1UZXB 4FULA 1E5WA 4BOZB 3AU4A 4PYUA 3ZIMA 2L00B 3DCGA 3DQVA 5EDSA 3KH0A 2M17A 5J17A 4RM8A 3PT2B 1YJ1A 1EUVB 1J0GA 1K8RB 3OJ3A 3OLMD 3PRMB 2ZVOA 4HPLB 1QZEA 1Q0WB 5FR6A 1TGZB 2AYOB 3PSEB 3PREA 4PS8A 3ZVVA 3ML8A 1IP9A 4ANWA 1E8WA 4XX5A 1SGHA 3HK0A 4KV2A 1I42A 4K7SA 2A5UA 4HLEA 2BPSA 5BO4B 5J2RA 2L76A 4JLCA 3VDZA 4W9DA 1WXAA 4LCDE 3RCZA 4JL9A 5JHAA 2JF5A 2C9WB 1A5RA 4F7ZA 2KQ7A 3IVFA 4HCPB 2NPTA 3UF8A 1H8CA 2ZCBA 4FN2A 4MSMB 3L08A 2C60A 2BWFA 1NBFC 4IW0A 2IBIB 1XQQA 1RFAA 2KWUB 3L54A 4KZ0A 1ZKHA 2LJ5A 3P2BA 1RRBA 4BFRA 4P7IA 4MM3A 4CO7A 1WGHA 2WWZA 2CU1A 1WFYA 4W9HA 3UIOB 2FAZA 3NS8A 4DHJB 4E74A 3CF6E 3CSFA 4WJPA 2BGFA 3EECA 4DHZE 2ZPYA 2JRHA 3T8MA 4HCNB 2JUOA 2JXXA 3A9JB 3RD2A 2NR2A 2AEHA 1KJTA 4A3OA 3QARA 4GDKB 3WAMA 3ZNZB 3K9PB 3IBEA 4HPMB 4K1RB 3ZUNA 4EZJA 3H9DA 3JSVB 1X1MA 1WZ3A 2L0TA 4HDOA 4IWPA 2IZVB 4HXDA 2LD9A 3HM3A 4I6NB 1E8XA 2RPQA 3PRZA 4ICUA 4CYEA 1V6EA 3LDZE 5G55A 3O65B 4M0WB 2FCQA 2RD0A 3KVFB 4EZLA 3RT3B 2LGXA 3A1QB 3QHTA 2ZEQA 1WY8A 1EF1A 2C5LC 2FIFA 2IY0B 2J0MA 2LVPA 5J18A 1WGYA 4GDLB 3DBRI 4TV3A 4ZRJA 1GJZA 3D32A 4IWQA 2GBJA 3LJ3A 2D3GA 3H1UA 2KJHB 1WM2A 1WXMA 2O2VB 3IFWB 2CS4A 4B95A 3KUDB 4KIKA 3S2AA 3APFA 1WZ0A 4NY0A 3PS6A 3K9OB 4IG7B 2Y5BB 2JY6A 4RMAA 4EKUA 4GN1A 5AEKB 4FBJB 4LDTD 1WJUA 2ZNVB 3EFUA 1XD3B 4GIVA 4KIKB 2M8SA 2WYQA 1WXVA 4E3CA 3TCAA 5TR5A 4DHJD 2PPHA 4ANXA 2N1WA 2PEAA 2PJHA 4NAWB 2BYVE 1G6JA 2GBKA 5G2NA 4BBNC 4IC7B 3A9KB 2ZPNA 2KDFB 1I35A 4FJYA 1UELA 1WX9A 2N9PC 2JZZA 4B6WA 2KXJA 4HK2A 3CMMB 1WR6E 1OQYA 2I1KA 3I3TB 4JQWC 4RM9A 2L0FA 3VUXA 4BKTA 5L83A 1WGRA 2KD0A 2FUHB 2KMAA 3R7QA 2K8CA 3VFKA 1E90A 3SD5A 1V5TA 1C1YB 3W1YA 3MJWA 5E6OA 5C23A 1C3TA 5LLIA 4AJYB 5LXHA 5DPRA 4XZ4A 3V61A 1L7YA 4WJQA 2EKEC 4FHKA 3ZRCA 2MBHA 4IM0A 3VTWA 4LDTB 1WX7A 2CR5A 3HIZA 2N1VA 2IO0B 3PRPB 3PHWB 1TBEA 2KN5A 2KTFA 3A33B 3TIXA 3ZO5B 1LM8B 5DPTA 3AU5A 3ZRFA 5CTRC 1P98A 3R7RA 2O6VA 4YL8A 3A4RA 2DZJA 2LWPA 5JH5C 2AWTA 2NCNA 4JIOU 4K81A 4NNJB 4WJOA 3PVLA 2KLGA 1E8YA 1V5OA 2KKCA 2C7NB 2ZJDA 3QX1A 2MRPA 4WWPA 1YQBA 2C7MB 2V1YA 2CHXA 4AWJA 2G4DB 4GDLA 3VTVA 2LGYA 1YD8U 2DYOA 3C0RB 2KZRA 2AL6A 5GMVA 5D6JB 2PE6B 4BVUC 5LXIB 2BYFA 3DDCB 3WANA 3NHEB 4K7UA 3H7SA 4DHZB 1LXDA 3L0WB 4MELA 1UBIA 1M94A 3VTUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZKJ C;  2KFJ A;  4W9G A;  2K6Q A;  4DXA B;  1AAR A;  1OGW A;  1WRD B;  2DZK A;  4WWO A;  4BKS A;  2KWV B;  2FCS A;  3UIN B;  2KLC A;  3GOE A;  2YVC A;  1NDD A;  1J19 A;  2IYD B;  5AZF A;  4GDK A;  2IY1 B;  3N32 A;  2KX3 A;  4G0N B;  2A4Z A;  2LGD A;  2Z0E B;  4W9L A;  1Z2M A;  4HWI B;  3WAL A;  4EUT A;  3UQA A;  2HJ8 A;  3TL5 A;  1WJN A;  3QA8 A;  4GXB A;  1ZGU B;  2DEN B;  4TQ0 A;  3SHQ A;  2KFK A;  3APD A;  4A20 A;  2JZ3 B;  2L05 A;  2K8H A;  3L13 A;  1ZW7 A;  3KYD D;  3APC A;  2FID A;  2JPH A;  3EC8 A;  1WMH A;  3R66 C;  1H4R A;  3B0A A;  1WJ6 A;  4PYZ A;  2MWS B;  4EEW A;  3MTN B;  5C1Z A;  2C7H A;  4HDQ A;  2MP2 B;  4X57 B;  2G4S A;  2JT4 B;  4W9I A;  5KHO A;  3ZDM C;  3L17 A;  3ML9 A;  3DVG Y;  4BKS D;  3BY4 B;  4F1S A;  4JGH B;  4GMV A;  4G3X B;  3DVN V;  3M63 B;  2J7Q B;  5HKH A;  4CHK A;  2OOB B;  2DHZ A;  2K8B A;  5D94 A;  3UQB A;  1XT9 B;  3TMP B;  2KJR A;  3QJZ A;  5CX3 A;  4MEM A;  4IWO A;  2HE7 A;  2V3S A;  3ZNI D;  2CKH B;  1OTR B;  3PV1 A;  2OJR A;  2XBB C;  3Q3J A;  4OVU A;  4BKG A;  4ZRK A;  4MJS A;  3VXW A;  3ZNH B;  4ASW C;  2VRR B;  2GBN A;  2Z59 B;  3A9K A;  1S3S G;  3A9J A;  4BBN F;  1V81 A;  3PTF C;  1CMX B;  4FJZ A;  1WX8 A;  2MA9 B;  4NJ6 A;  3KW5 B;  4FA6 A;  2K1F A;  3VQI A;  2G3Q B;  4AJW A;  3TBL D;  3R3M A;  2KNB A;  2DZM A;  4MGI E;  2L7R A;  3NY5 A;  3M3J A;  3ALB A;  3VH4 B;  4G50 A;  1WM3 A;  4NQK E;  3H6N A;  4FJV B;  4MGZ E;  4F8C B;  1R4N I;  2NBU A;  2D11 A;  4II2 B;  2M1M A;  1Q5W B;  2DZI A;  4KDI C;  2D2Q A;  5CHF A;  3VAW A;  1KM7 A;  4ANV A;  3ZW3 A;  3UGB B;  3JYU A;  4URK A;  4LJO B;  3DBS A;  3DVN U;  2LXA A;  4II3 B;  1HE8 A;  1YX5 B;  4M8N A;  1V49 A;  1LFD A;  2MX2 A;  2KDB A;  3U7D A;  2CHW A;  2ZZP B;  2IO1 B;  2KAN A;  2NBV B;  4IUM B;  2RR9 A;  3NZS A;  3KUZ A;  4EZK A;  1YIW A;  2G45 B;  2IO2 B;  2MLB A;  2KK8 A;  1WIA A;  2BF8 B;  2LVQ A;  2KDI A;  2WX1 A;  5JHB A;  2LVO A;  2D07 B;  2Z0D B;  1J8C A;  2GOW A;  4BOS C;  1V80 A;  3IG3 A;  1Z5S B;  1PQS A;  4M8M A;  1IYF A;  2NS5 A;  3HHM A;  1TTN A;  3L16 A;  5D7G A;  3VH3 B;  4WAA A;  1VCB A;  2HTH A;  4WJN A;  2N4F A;  2MW5 A;  4A3P A;  4MJS B;  4AP4 C;  4DWF A;  3HM6 X;  3N30 A;  5CHW A;  1S1Q B;  3N3K B;  1OEY A;  1KOT A;  2NPT B;  3DBH I;  4HVB A;  1UH6 A;  1GG3 A;  3TJP A;  4PS7 A;  2K39 A;  3PLU A;  3T9L A;  1Y8R C;  4FAD A;  4XC2 A;  3RYT A;  2XEW A;  3ECI A;  2JRI B;  3SU8 X;  3A1Q A;  3W1S A;  2DX5 B;  1JRU A;  3V6C B;  4E71 A;  1UBQ A;  3B1L X;  3DVG X;  4ZDV A;  4K7W A;  1V2Y A;  4B9K A;  2JVC A;  3VUY A;  5L95 C;  4NAW A;  2KC2 A;  2EMS A;  4AUQ C;  4G11 A;  3QQ8 B;  3NOB A;  3OJ4 B;  2D10 A;  1MG8 A;  2ASQ A;  2PE9 A;  4EOY A;  2MSE D;  2I1J A;  5AZH A;  5KHQ A;  4DDG D;  4IM3 A;  2CHZ A;  3V6E B;  3PZD A;  1V9J A;  2AL3 A;  5AZG A;  1LQB A;  2BYE A;  5CHV C;  3SDL C;  4DBG A;  3ENE A;  2KX0 A;  3GZN I;  1RAX A;  2WDT B;  3WAP A;  2MBE A;  2DYM A;  4IM2 A;  2DAF A;  3X0W A;  4FHJ A;  3OAW A;  2MQJ A;  2W9N A;  4NPN A;  2BWE S;  4GOC A;  3RZW C;  3QC8 B;  5E6N A;  4W9E A;  2L8J A;  4W9J A;  5D2M B;  3U30 A;  2J0J A;  1WE6 A;  4TKN A;  3X23 A;  2DYB A;  2JWZ A;  4NQL B;  1WJ4 A;  3BIN A;  1P0R A;  3M62 B;  1BT0 A;  2N7E A;  2RSU A;  1D3Z A;  2K25 A;  4I6L B;  1WXS A;  1WF9 A;  2LRW A;  2KTR B;  1E8Z A;  3ONS A;  4WWN A;  1F9J A;  5IAA C;  4KSL C;  4NJ7 A;  3IHP C;  1ISN A;  3RZF A;  3QIJ A;  1VD2 A;  4MSQ B;  1P1A A;  2HD5 B;  1TZ1 A;  1GNU A;  3EHV A;  3ZTD A;  5DPW A;  2BKF A;  3DBL I;  3AI5 A;  4HJK A;  4KZC A;  2LXC A;  1V86 A;  4MGK E;  3V60 A;  4ZRI A;  4DK5 A;  4N9F 4;  2LAS A;  2FCN A;  2NBW B;  3PPA A;  2GMI C;  2MBB B;  3ZLZ A;  2REX A;  2KHW B;  1R4M I;  2KO3 A;  4TUU A;  3UIP B;  3VVW B;  2KQS A;  2LZ6 A;  2J0K A;  3QWZ B;  3U8Z A;  3L10 B;  2N9X A;  2LUE A;  2ZNV C;  1KLV A;  3ZNG C;  2O2V A;  3B08 A;  3A4S C;  1GUA B;  2KWC A;  4MGY E;  3PLV A;  1WE7 A;  2KTR A;  4MH0 E;  1WGD A;  3WIM A;  4LJP B;  1P3Q U;  2LRU A;  4I6P A;  4OVV A;  2WX0 A;  1YX6 B;  2FNJ B;  2KJ6 A;  4FLH A;  2YLM A;  1IPG A;  3DOW A;  4KVG B;  2FCM A;  1E7V A;  4W9C A;  4WQO B;  3JW0 X;  3ZDT A;  2N7D A;  1WYW B;  2R2O A;  3KYC D;  3QAQ A;  3WAO A;  3KUC B;  3QCA A;  2ZCC A;  4W9F A;  4GU2 A;  3PHX B;  1WI0 A;  4TQ1 A;  1WMH B;  4GSW A;  4EFO A;  3MHS D;  1SE9 A;  2RGF A;  2IO3 B;  1UGM A;  4DDI D;  2O6V D;  3AUL A;  1L2N A;  2MBQ A;  3DPD A;  2KFK B;  1NI2 A;  5DPS A;  2MCN B;  3AXC A;  3VUW A;  2KDE B;  2R2Q A;  2DAJ A;  2EMT A;  3H7P A;  1GC7 A;  2B3A A;  2N9E B;  4MDK E;  4W9K A;  1P9D U;  1T0Y A;  3PGE A;  5DCN A;  1EF5 A;  2KC1 A;  4PS3 A;  1WH3 A;  4ZYN A;  2M0X A;  2KVR A;  3WA0 A;  2GBR A;  1EO6 A;  2M4N A;  3H7P B;  2QHO A;  2KMC A;  2L3Z A;  3CST A;  3Q3F A;  3W1S C;  4ANU A;  1U4A A;  1OEY J;  2XK5 A;  2UYZ B;  3ZTC A;  1WGG A;  2MBO A;  2ZVN A;  3NZU A;  1WR1 A;  4GB9 A;  2KOX A;  4ICV A;  3V62 A;  2K6D B;  2NVU I;  1SIF A;  2V4L A;  3JSV A;  2MP2 A;  3M95 A;  1E7U A;  2GBM A;  2XK5 B;  4KSK C;  1Q1O A;  2LI5 A;  5JZE B;  3QK0 A;  1FXT B;  5IA7 A;  1GC6 A;  3RUI B;  2O6V B;  3VHT C;  4KDL B;  4J6I A;  5E6P A;  2BKR B;  3JVZ X;  1UD7 A;  1RLF A;  2UWQ A;  4GGQ A;  3RUL A;  4AOF A;  1UZX B;  4FUL A;  1E5W A;  4BOZ B;  3AU4 A;  4PYU A;  3ZIM A;  2L00 B;  3DCG A;  3DQV A;  5EDS A;  3KH0 A;  2M17 A;  5J17 A;  4RM8 A;  3PT2 B;  1YJ1 A;  1EUV B;  1J0G A;  1K8R B;  3OJ3 A;  3OLM D;  3PRM B;  2ZVO A;  4HPL B;  1QZE A;  1Q0W B;  5FR6 A;  1TGZ B;  2AYO B;  3PSE B;  3PRE A;  4PS8 A;  3ZVV A;  3ML8 A;  1IP9 A;  4ANW A;  1E8W A;  4XX5 A;  1SGH A;  3HK0 A;  4KV2 A;  1I42 A;  4K7S A;  2A5U A;  4HLE A;  2BPS A;  5BO4 B;  5J2R A;  2L76 A;  4JLC A;  3VDZ A;  4W9D A;  1WXA A;  4LCD E;  3RCZ A;  4JL9 A;  5JHA A;  2JF5 A;  2C9W B;  1A5R A;  4F7Z A;  2KQ7 A;  3IVF A;  4HCP B;  2NPT A;  3UF8 A;  1H8C A;  2ZCB A;  4FN2 A;  4MSM B;  3L08 A;  2C60 A;  2BWF A;  1NBF C;  4IW0 A;  2IBI B;  1XQQ A;  1RFA A;  2KWU B;  3L54 A;  4KZ0 A;  1ZKH A;  2LJ5 A;  3P2B A;  1RRB A;  4BFR A;  4P7I A;  4MM3 A;  4CO7 A;  1WGH A;  2WWZ A;  2CU1 A;  1WFY A;  4W9H A;  3UIO B;  2FAZ A;  3NS8 A;  4DHJ B;  4E74 A;  3CF6 E;  3CSF A;  4WJP A;  2BGF A;  3EEC A;  4DHZ E;  2ZPY A;  2JRH A;  3T8M A;  4HCN B;  2JUO A;  2JXX A;  3A9J B;  3RD2 A;  2NR2 A;  2AEH A;  1KJT A;  4A3O A;  3QAR A;  4GDK B;  3WAM A;  3ZNZ B;  3K9P B;  3IBE A;  4HPM B;  4K1R B;  3ZUN A;  4EZJ A;  3H9D A;  3JSV B;  1X1M A;  1WZ3 A;  2L0T A;  4HDO A;  4IWP A;  2IZV B;  4HXD A;  2LD9 A;  3HM3 A;  4I6N B;  1E8X A;  2RPQ A;  3PRZ A;  4ICU A;  4CYE A;  1V6E A;  3LDZ E;  5G55 A;  3O65 B;  4M0W B;  2FCQ A;  2RD0 A;  3KVF B;  4EZL A;  3RT3 B;  2LGX A;  3A1Q B;  3QHT A;  2ZEQ A;  1WY8 A;  1EF1 A;  2C5L C;  2FIF A;  2IY0 B;  2J0M A;  2LVP A;  5J18 A;  1WGY A;  4GDL B;  3DBR I;  4TV3 A;  4ZRJ A;  1GJZ A;  3D32 A;  4IWQ A;  2GBJ A;  3LJ3 A;  2D3G A;  3H1U A;  2KJH B;  1WM2 A;  1WXM A;  2O2V B;  3IFW B;  2CS4 A;  4B95 A;  3KUD B;  4KIK A;  3S2A A;  3APF A;  1WZ0 A;  4NY0 A;  3PS6 A;  3K9O B;  4IG7 B;  2Y5B B;  2JY6 A;  4RMA A;  4EKU A;  4GN1 A;  5AEK B;  4FBJ B;  4LDT D;  1WJU A;  2ZNV B;  3EFU A;  1XD3 B;  4GIV A;  4KIK B;  2M8S A;  2WYQ A;  1WXV A;  4E3C A;  3TCA A;  5TR5 A;  4DHJ D;  2PPH A;  4ANX A;  2N1W A;  2PEA A;  2PJH A;  4NAW B;  2BYV E;  1G6J A;  2GBK A;  5G2N A;  4BBN C;  4IC7 B;  3A9K B;  2ZPN A;  2KDF B;  1I35 A;  4FJY A;  1UEL A;  1WX9 A;  2N9P C;  2JZZ A;  4B6W A;  2KXJ A;  4HK2 A;  3CMM B;  1WR6 E;  1OQY A;  2I1K A;  3I3T B;  4JQW C;  4RM9 A;  2L0F A;  3VUX A;  4BKT A;  5L83 A;  1WGR A;  2KD0 A;  2FUH B;  2KMA A;  3R7Q A;  2K8C A;  3VFK A;  1E90 A;  3SD5 A;  1V5T A;  1C1Y B;  3W1Y A;  3MJW A;  5E6O A;  5C23 A;  1C3T A;  5LLI A;  4AJY B;  5LXH A;  5DPR A;  4XZ4 A;  3V61 A;  1L7Y A;  4WJQ A;  2EKE C;  4FHK A;  3ZRC A;  2MBH A;  4IM0 A;  3VTW A;  4LDT B;  1WX7 A;  2CR5 A;  3HIZ A;  2N1V A;  2IO0 B;  3PRP B;  3PHW B;  1TBE A;  2KN5 A;  2KTF A;  3A33 B;  3TIX A;  3ZO5 B;  1LM8 B;  5DPT A;  3AU5 A;  3ZRF A;  5CTR C;  1P98 A;  3R7R A;  2O6V A;  4YL8 A;  3A4R A;  2DZJ A;  2LWP A;  5JH5 C;  2AWT A;  2NCN A;  4JIO U;  4K81 A;  4NNJ B;  4WJO A;  3PVL A;  2KLG A;  1E8Y A;  1V5O A;  2KKC A;  2C7N B;  2ZJD A;  3QX1 A;  2MRP A;  4WWP A;  1YQB A;  2C7M B;  2V1Y A;  2CHX A;  4AWJ A;  2G4D B;  4GDL A;  3VTV A;  2LGY A;  1YD8 U;  2DYO A;  3C0R B;  2KZR A;  2AL6 A;  5GMV A;  5D6J B;  2PE6 B;  4BVU C;  5LXI B;  2BYF A;  3DDC B;  3WAN A;  3NHE B;  4K7U A;  3H7S A;  4DHZ B;  1LXD A;  3L0W B;  4MEL A;  1UBI A;  1M94 A;  3VTU A; 
#chains in the Genus database with same CATH topology
 4W9G A;  5D3I B;  1QF6 A;  2WU2 B;  1WRD B;  1KF6 B;  1TY0 A;  3GOE A;  1J19 A;  5AZF A;  2IY1 B;  3DHH C;  2KX3 A;  2Z0E B;  4EUT A;  3Q8B A;  1WJN A;  4JWS C;  3SR6 A;  2KFK A;  2PIA A;  2WXG A;  1AW7 A;  4REZ A;  3FKY A;  3PO0 A;  2R61 A;  2IND C;  4PYZ A;  2MWS B;  1VRA B;  1QIL A;  4HDQ A;  4X57 B;  2G4S A;  1L6V A;  3DBH B;  3MC8 A;  3TEX A;  3ML9 A;  4OZC A;  4F1S A;  4JGH B;  4G3X B;  2KMM A;  1T0Q C;  2CJO A;  5D94 A;  3UQB A;  5GXG B;  2HJ1 A;  4BZA A;  3EFC A;  2HE7 A;  4IWO A;  5AUI A;  1OTR B;  2OJR A;  3Q3J A;  4OVU A;  1JWA D;  1YN3 A;  3N1Y C;  3VXW A;  2WXR A;  2Z59 B;  3AB5 A;  3T3O A;  1S3S G;  3A9J A;  1V81 A;  3PTF C;  5BMG A;  1A70 A;  2MA9 B;  4NJ6 A;  3KW5 B;  1ZP0 B;  2K1F A;  3VQI A;  2G3Q B;  3TBL D;  3R3M A;  3RNE C;  2K5P A;  4MGI E;  1KTK A;  2FE8 A;  1IUE A;  2M1M A;  2DZI A;  1EU3 A;  4URK A;  2J53 A;  1KM7 A;  3ZW3 A;  3UGB B;  3DBS A;  1F1H A;  4LNI A;  1C4P A;  3CWI A;  4A6Q A;  4II3 B;  1E9M A;  4HRS A;  1LFD A;  3U7D A;  2AQ2 B;  1L4Z B;  2KAN A;  3DWG C;  4OZA A;  2RR9 A;  3TUO A;  3HUI A;  3KUZ A;  2WDV B;  4EZK A;  1BML C;  2MLB A;  2KDI A;  1ZUD 2;  1V80 A;  4HJG E;  1VZ6 A;  1Z5S B;  1IYF A;  1SJE D;  1K51 A;  4GLS C;  2MW5 A;  4MJS B;  1K52 A;  5CHW A;  2NPT B;  3DBH I;  1UH6 A;  1GG3 A;  2K39 A;  3PLU A;  1QLB B;  3HVD A;  1PGB A;  2JRI B;  4E71 A;  1FO4 A;  3B1L X;  5D3D A;  2V9H A;  3VUY A;  4NAW A;  2LHD A;  2NTT A;  5EE3 A;  2L32 A;  4P1C C;  2QMT A;  2PE9 A;  2IDY A;  5CHV C;  4KGT A;  2VZK B;  1N6Z A;  3WAP A;  3OWE B;  3AE8 B;  3X0W A;  4NPN A;  4NZL B;  2WP9 B;  2D5G A;  4W9E A;  2JYE A;  4TKN A;  4ARC A;  1JW9 D;  2DYB A;  1TKY A;  4NQL B;  3KLS X;  3BIN A;  1V97 A;  1OQQ A;  2RSU A;  1WXS A;  3ONS A;  1R4M B;  1EU4 A;  1ISN A;  3U4E G;  4MSQ B;  1P1A A;  3ZTD A;  3DBL I;  3AI5 A;  3SEB A;  1KFY B;  2LXC A;  4MGK E;  2WQY B;  4N9F 4;  2KO3 A;  4TUU A;  3VVW B;  2N9X A;  5BYR A;  2WXH A;  5G5H A;  1WE7 A;  4XDC A;  1P3Q U;  1YX6 B;  2KJ6 A;  2QCZ A;  3SFD B;  2DWQ A;  3ZDT A;  1WYW B;  3Q3M C;  3WAO A;  4YTN B;  1EM7 A;  2DBY A;  5FK9 C;  2H89 B;  2VZK D;  2K3U A;  1PUT A;  1SE9 A;  2LGI A;  2BW2 A;  2RGF A;  5BYQ A;  1NI2 A;  5DPS A;  5C3J B;  1XEE A;  2DAJ A;  2B3A A;  1LGR A;  2J42 A;  2N9E B;  4MDK E;  1P9D U;  1T0Y A;  2KC1 A;  4ZYN A;  2INN E;  2GBR A;  1SE2 A;  3CST A;  1FNU A;  1MJD A;  2JYT A;  4D2K A;  3BK1 A;  5EE9 A;  2KOX A;  4ICV A;  2M56 B;  2V4L A;  2KYW A;  1SIJ A;  1MPE A;  4KSK C;  2LI5 A;  3NJT A;  4J6I A;  3Q3N C;  1TKG A;  4BOZ B;  2EKI A;  3AU4 A;  3J9C A;  5J17 A;  1MVK A;  1XLQ A;  3AE6 B;  4USA A;  4HPL B;  1C4C A;  1QZE A;  2AYO B;  4RFB A;  3MHZ A;  1DGJ A;  2A5U A;  1DYQ A;  2QIL A;  1BUI C;  4US9 A;  3DBL B;  2L76 A;  4M00 A;  3RNB C;  3VDZ A;  1P7E A;  3RCZ A;  1FM0 D;  1GPX A;  1FFU A;  1LO5 D;  2NPT A;  2KVZ A;  2BWF A;  3RNF C;  4QAY A;  4YXD B;  3NG0 A;  1YQ3 B;  1XQQ A;  2JSV X;  3MC9 A;  4C4V A;  4LTU A;  2CU1 A;  3UIO B;  2PMV A;  4E74 A;  1J7A A;  2OED A;  4HCN B;  2JXX A;  3RD2 A;  1KJT A;  3V3X A;  3RMK C;  3ZUN A;  3JSV B;  1NYQ A;  2WS3 B;  2LD9 A;  4HXD A;  4OW0 A;  2KDM A;  3HM3 A;  4I6N B;  1C78 A;  1V1O A;  3PRZ A;  4M0W B;  3KVF B;  3RT3 B;  2QEJ C;  2C5L C;  2FIF A;  3DBR I;  4RNA A;  4IWQ A;  2GBJ A;  3NVW A;  2D3G A;  3H1U A;  4B95 A;  3APF A;  2BTE A;  3K9O B;  2Y5B B;  1SEB D;  4GN1 A;  1VR9 A;  3EFU A;  1XD3 B;  2M8S A;  2WXF A;  2VH1 A;  1ZDV A;  4ANX A;  2X38 A;  5G2N A;  4BBN C;  1PGA A;  4IC7 B;  2ZPN A;  3P4P B;  3CMM B;  3GE8 C;  1I4P A;  1OQY A;  2I1K A;  2LHE A;  1TS5 A;  2FUH B;  1C76 A;  3TEW A;  1FPY A;  3SD5 A;  1FIQ A;  1XXG A;  2QC8 A;  3W5V B;  2WXO A;  5LXH A;  4IOI E;  2J52 A;  1ZXH A;  4WJQ A;  3VR9 B;  4IM0 A;  4LDT B;  2CR5 A;  3IAM 1;  2N1V A;  3T3N A;  4S17 A;  1LM8 B;  3AU5 A;  5CTR C;  5H8Y E;  1VJK A;  1AYF A;  4YL8 A;  4DHZ E;  2KLG A;  4WWP A;  2ZJD A;  5EDS A;  1RYJ A;  4GDL A;  3VTV A;  4P1B C;  2KZR A;  2AL6 A;  5GMV A;  5D6J B;  1KH0 A;  3GS2 A;  1I4Q A;  2TSS A;  1LXD A;  1M94 A;  1SSN A;  1QOG A;  2K6Q A;  1OGW A;  4BKS A;  4WWO A;  2FCS A;  2YEP B;  4O1N A;  2KLC A;  1NDD A;  2IYD B;  2LGD A;  3WAL A;  1AN8 A;  3P4R B;  3U7Z A;  4EE2 A;  2PVG C;  3TL5 A;  1ZGU B;  1JAL A;  3SHQ A;  3APD A;  4A20 A;  3HVZ A;  3KYD D;  3APC A;  3EC8 A;  1H4R A;  3MTN B;  5KHO A;  3L17 A;  3DVG Y;  2LUM A;  3EA6 A;  3BY4 B;  3C8Y A;  2HTM E;  4GMV A;  3DVN V;  2PTL A;  4HRO A;  2K8B A;  3ZJU A;  5CX3 A;  4MEM A;  4C56 C;  3ZNI D;  1YQ4 B;  2XBB C;  1L4D B;  4BKG A;  4MJS A;  4BAX A;  3ZNH B;  1F77 A;  4ASW C;  2VRR B;  1CMX B;  4FJZ A;  1WX8 A;  1QOA A;  2AX5 A;  2L7R A;  4XYC A;  3ZJT A;  4YSY B;  4OVZ A;  4NQK E;  3H6N A;  4FJV B;  2NBU A;  2D11 A;  4Q2J A;  1Q5W B;  2N0S B;  1YX5 B;  4M8N A;  1V49 A;  3MFG A;  1C77 A;  1HZ5 A;  3CIR B;  1YNT E;  5BMH A;  2NBV B;  2I38 A;  2IO2 B;  2KK8 A;  4XWT A;  1WIA A;  2LVQ A;  1L0X B;  2LVO A;  3IT4 B;  2D07 B;  2GOW A;  2JXT A;  1TYG B;  3P4Q B;  3Q14 C;  1PQS A;  4N6E B;  4LNF A;  4ZOH C;  4WJN A;  4C7Y A;  2WNM A;  3E9S A;  5HG2 A;  3TJP A;  4PS7 A;  2MJD A;  3T9L A;  4HEA 1;  3P4S B;  2QJL A;  3SU8 X;  1JRU A;  3FIL A;  3DVG X;  4ZDV A;  1B1Z A;  4US8 A;  5L95 C;  4OZB A;  2GLS A;  1IGD A;  2EMS A;  1SBB B;  2BB6 A;  3NOB A;  3OJ4 B;  2D10 A;  4EOY A;  4ZYS A;  4L23 A;  4DDG D;  2CHZ A;  3AEB B;  5AZG A;  3SDL C;  1DOY A;  4DBG A;  1SE3 A;  2KX0 A;  1RAX A;  2WDT B;  1DOI A;  2MBE A;  1L5P A;  1MI0 A;  2DAF A;  4FHJ A;  2MQJ A;  4GOC A;  4M02 A;  3RZW C;  1YMH E;  1I4X A;  1YN4 A;  2AQ1 B;  5E6N A;  4W9J A;  3X23 A;  3M62 B;  1T3Q A;  2LRW A;  1E8Z A;  4WWN A;  4KSL C;  3RZF A;  4A90 A;  1L6U A;  3EHV A;  5DPW A;  2W3R A;  2KQ4 X;  4HJK A;  4KGS A;  2IPK D;  1TT5 B;  1V86 A;  3AE9 B;  4DK5 A;  2IGH A;  4DXG A;  1WWT A;  2NBW B;  3B2F A;  3DBR B;  3VR8 B;  3UIP B;  2KQS A;  2LZ6 A;  3QWZ B;  3U8Z A;  2LUE A;  1D6E C;  1KLV A;  2O2V A;  3B08 A;  3Q8A A;  3A4S C;  3AEE B;  3PLV A;  1KRH A;  2KTR A;  4MH0 E;  4AQ7 A;  1WGD A;  2K0P A;  4KVG B;  4W9C A;  2FNJ B;  3KQ4 A;  2YLM A;  3DOW A;  4YT0 B;  1E7V A;  3JW0 X;  4ITK A;  3RN9 C;  3KYC D;  1QT9 A;  2V3N A;  3KUC B;  1XCQ L;  2ZCC A;  2V0G A;  2ACZ B;  3RNA C;  3PHX B;  3N9Y C;  2BQQ A;  2K9X A;  1FXI A;  2ZW0 A;  4KKJ A;  2O6V D;  1L2N A;  3GB1 A;  3NVV A;  2KDE B;  1FRD A;  3ETR A;  2KVR A;  1GAQ B;  2L1A A;  1GB4 A;  3H7P B;  3W1S C;  1U4A A;  2XK5 A;  2UYZ B;  3ZTC A;  1NYR A;  2MBO A;  3Q6B A;  1WR1 A;  2BYT A;  3V62 A;  2NVU I;  1SIF A;  1C9F A;  3PZ8 A;  2QSD A;  3QK0 A;  1FXT B;  5IA7 A;  2RDG A;  2O6V B;  3VHT C;  2BVC A;  5E6P A;  2BKR B;  3JVZ X;  1UD7 A;  1RLF A;  4GGQ A;  4YSZ B;  5T8I A;  2JZP A;  4LNN A;  3PT2 B;  5JXV A;  1YJ1 A;  3KWV A;  3PRM B;  2ZVO A;  1Q0W B;  3IT6 B;  5FR6 A;  3RNC C;  4AS1 A;  1L0V B;  4N58 A;  3W5U B;  4ANW A;  2W3S A;  1I42 A;  2LMC A;  4HLE A;  2BPS A;  1ET9 A;  4A9A A;  2YEP F;  2INP E;  1WXA A;  5IKC M;  1TKE A;  2JF5 A;  2C9W B;  1A5R A;  1K50 A;  3AEG B;  2H88 B;  1Q10 A;  2KQ7 A;  4HCP B;  3UF8 A;  4FN2 A;  4MSM B;  3L08 A;  2C60 A;  2IBI B;  3L54 A;  4BFR A;  4P7I A;  2HDE A;  4CO7 A;  2WWZ A;  4DHJ B;  3BVZ A;  3MC0 B;  2KT7 A;  3CSF A;  4WJP A;  1ACC A;  3P1M A;  3A9J B;  4A3O A;  3QAR A;  3ZNZ B;  1D5M C;  3AE1 B;  4HPM B;  3IBE A;  4CQN A;  4K1R B;  1V1P A;  1YN5 A;  2ON8 A;  2RPQ A;  3AEF B;  3BYY B;  4ICU A;  5G55 A;  1QQR A;  2RD0 A;  1RM6 C;  1QKZ A;  2QDF A;  1WSP A;  2ZEQ A;  1WY8 A;  1JWB D;  2LVP A;  4JE3 B;  3BVG A;  4GDL B;  4TV3 A;  3LJ3 A;  1WM2 A;  1WXM A;  2O2V B;  3IFW B;  4KIK A;  3S2A A;  4RF0 A;  3Q8E A;  1N61 A;  1N5X A;  1WJU A;  2ZNV B;  2B76 B;  1WGK A;  2VH2 A;  4GIV A;  2I2Y A;  2WYQ A;  1WXV A;  3TCA A;  2PPH A;  2PEA A;  2PJH A;  4NAW B;  1G6J A;  2GBK A;  1YJI A;  1UEL A;  1WX9 A;  1K53 A;  3I9V 1;  3VUX A;  4RM9 A;  3NZ3 A;  5L83 A;  2OHF A;  1WGR A;  2KD0 A;  3W1Y A;  2NTS A;  1C3T A;  4P6V F;  2WXN A;  5LLI A;  1UNS A;  1N62 A;  3V61 A;  2EKE C;  4FHK A;  4XDD A;  3ZRC A;  2MBH A;  3VTW A;  3AE4 B;  1WX7 A;  3PRP B;  3PHW B;  5BMI A;  3ZO5 B;  5IN7 A;  5DPT A;  1TIF A;  5IOI A;  1P98 A;  2O6V A;  2NMQ A;  2DZJ A;  1B9R A;  3HRD D;  4NNJ B;  2NCN A;  2MRP A;  2G4D B;  2Q5W D;  4BVU C;  4YSX B;  2BYF A;  3WAN A;  2FBW B;  4K7U A;  1SB3 C;  3BVM A;  3AEA B;  3Q69 A;  4MEL A;  1UBI A;  1T0S C;  2Y3A A;  3ZKJ C;  2KFJ A;  4DXA B;  1AAR A;  3URY A;  2KWV B;  3UIN B;  3AEC B;  3ZGZ A;  2YVC A;  1AWD A;  3N32 A;  4G0N B;  2A4Z A;  1N63 A;  1TS4 A;  3VRB B;  4GXB A;  2N7J A;  5E6J A;  3L13 A;  1ZW7 A;  3C19 A;  3NVY A;  1WJ6 A;  4EEW A;  2BT6 A;  1OQR A;  4BKS D;  2WDQ B;  3ABV B;  2EEL A;  4LK0 M;  2E3T A;  2OOB B;  2DHZ A;  1JWM D;  3TMP B;  2KJR A;  3QJZ A;  2V3S A;  4ZRK A;  1JML A;  3I5J C;  3A9K A;  2GBN A;  3N20 C;  4A8X C;  3NVZ A;  4AJW A;  2UU7 A;  1XLN A;  2KNB A;  2DZM A;  3RFZ B;  3NY5 A;  3ALB A;  1HXY D;  2RMM A;  1EWC A;  4MGZ E;  4F8C B;  3H8H A;  1TS2 A;  3DWM A;  4KDI C;  2D2Q A;  3W2D A;  4ANV A;  3JYU A;  2WLB A;  1HE8 A;  4PK1 A;  1PDX A;  3NZS A;  1YIW A;  2G45 B;  1GOZ A;  1ZXI A;  4MAC A;  2PKO A;  3I57 A;  5JHB A;  4BOS C;  1CJE A;  4M8M A;  2NS5 A;  3HHM A;  1I7H A;  2D3A A;  4ZHP A;  1TTN A;  3L16 A;  3VH3 B;  2HTH A;  2KAJ A;  2BS4 B;  2N4F A;  4A3P A;  4AP4 C;  4DWF A;  3HM6 X;  3N30 A;  1OEY A;  4S0R A;  1SF0 A;  1Y8R C;  3EGR A;  3RYT A;  3ECI A;  3A1Q A;  1TS3 A;  3W1S A;  2G1E A;  1SXT A;  3V6C B;  1HA5 A;  2JVC A;  5I4D A;  2FUG 1;  1I4R A;  4AUQ C;  3QQ8 B;  1MG8 A;  2ASQ A;  1ZE3 D;  3MP9 A;  2I1J A;  5AZH A;  5KHQ A;  3U52 E;  4IM3 A;  3AE2 B;  3V6E B;  1V9J A;  1LQB A;  1JRP A;  3MJ5 A;  1VDV A;  1VZ7 A;  4IM2 A;  1JRO A;  3R2I A;  1WRI A;  2W9N A;  2BWE S;  3QC8 B;  5D2M B;  3U30 A;  3FC4 A;  1WE6 A;  1NVI D;  4HKQ A;  2JWZ A;  1WJ4 A;  1P0R A;  1BXT A;  2N7E A;  4JWU C;  4LNO A;  3N1Z C;  2K25 A;  1WF9 A;  1F9J A;  5IAA C;  4NJ7 A;  3IHP C;  4ZRQ A;  1D5Z C;  4IKG A;  5HFY A;  1E10 A;  4ACF A;  3DHI C;  2HD5 B;  1GNU A;  2BKF A;  3WCQ A;  4ZRI A;  3AH7 A;  2FCN A;  2BS2 B;  3PPA A;  2GMI C;  2MBB B;  3ZLZ A;  2REX A;  2KHW B;  3SFE B;  3AN1 A;  2KWC A;  4MGY E;  5FKA C;  4P16 A;  2MEK A;  1FNW A;  3WIM A;  2OJW A;  4LJP B;  4OVV A;  4XGA B;  1IPG A;  4M0W A;  2FCM A;  2BBC A;  1KLG D;  2N7D A;  4W9F A;  3AMZ A;  4GU2 A;  4TQ1 A;  2LJI A;  4GSW A;  1NEN B;  2IO3 B;  5FR3 A;  3DPD A;  2KFK B;  4N59 A;  2MCN B;  3ZJV A;  3AXC A;  4PT5 A;  3VUW A;  2WXJ A;  4KGR A;  2EMT A;  1GC7 A;  4W9K A;  2WHI A;  3PGE A;  2M0X A;  3WA0 A;  2M4N A;  1E7P B;  5HHD G;  2L3Z A;  3Q3F A;  1XF5 L;  1OEY J;  2D3B A;  1WGG A;  4GB9 A;  3Q8C A;  1ENF A;  1XCT L;  2Z8L A;  2K6D B;  1MHH E;  2SEB D;  2JU6 X;  2V4I B;  2MP2 A;  2JX5 A;  3M95 A;  2GBM A;  1Q1O A;  3Q8F A;  4A55 A;  1T6B X;  1GC6 A;  1CQV A;  3Q2A C;  4KDL B;  3RUL A;  1HQR D;  2UWQ A;  1V1P B;  1UZX B;  1E5W A;  1RWS A;  4PYU A;  3ZIM A;  3DQV A;  4J3O D;  3KH0 A;  4RM8 A;  3VRA B;  2L83 A;  2WU5 B;  1IGC A;  3P63 A;  4LNK A;  1J0G A;  3V05 A;  2INC C;  3OJ3 A;  3OLM D;  3ZVV A;  1TGZ B;  4PS8 A;  1SGH A;  3HK0 A;  4KV2 A;  1P7F A;  4C80 A;  2WGS A;  4K7S A;  4JLC A;  2WXM A;  4W9D A;  2M19 A;  4LCD E;  4JL9 A;  5JHA A;  4F7Z A;  2ZCB A;  4IW0 A;  2KWD A;  2JWU A;  2KWU B;  4KZ0 A;  4XWW A;  3P2B A;  4RGM A;  4MM3 A;  4HKZ E;  1WFY A;  4W9H A;  1JQ4 A;  2FAZ A;  2BGF A;  3EEC A;  3DHG C;  4MT5 A;  2JRH A;  1YJJ A;  3LB8 C;  2AEH A;  3GE3 C;  4JX1 C;  3K9P B;  3AE5 B;  4EZJ A;  1UGJ A;  1X1M A;  2WXK A;  4ZRP A;  1QOF A;  2K22 A;  3O65 B;  3OG5 A;  2FCQ A;  2LGX A;  3A1Q B;  1FMA D;  5J18 A;  4R3D A;  1EF1 A;  1FNV A;  1WGY A;  3ZXV A;  1GJZ A;  3D32 A;  2DNF A;  4ARI A;  2CS4 A;  3KUD B;  1WZ0 A;  4NY0 A;  3PS6 A;  5IO9 A;  4YTM B;  2JY6 A;  4K3B A;  4RCO A;  2XN9 C;  1ZPS A;  4LDT D;  4FBJ B;  1FD6 A;  5TR5 A;  4DHJ D;  2N1W A;  3IAS 1;  1PYW D;  2PLP A;  1R4N B;  3A9K B;  2KDF B;  1XLP A;  4FJY A;  3TEZ A;  4B6W A;  4M01 A;  4OHJ A;  4JQW C;  1WR6 E;  4MH8 A;  1T5X D;  2L0F A;  1FEH A;  3VFK A;  2GRI A;  1V5T A;  5E6O A;  3FAH A;  2WDR B;  1FCC C;  4WH4 A;  2ZW1 A;  4FXC A;  5AUK A;  3HIZ A;  1TBE A;  2KTF A;  2RDB C;  3TIX A;  1NEK B;  5BYS A;  3R7R A;  1TJE A;  2KAC A;  3A4R A;  5JH5 C;  3O13 A;  1TZO A;  1E8Y A;  1V5O A;  2LFI A;  3KWL A;  1YQB A;  2CHX A;  2IGG A;  2DYO A;  3C0R B;  2PE6 B;  3NHE B;  3H7S A;  4JPS A;  3L0W B;  3R2T A;  3I63 C;  2DZK A;  4GDK A;  4W9L A;  3UQA A;  1Z2M A;  2E6X A;  4HWI B;  2HJ8 A;  3QA8 A;  2DEN B;  4TQ0 A;  5IP4 D;  2JZ3 B;  2L05 A;  2K8H A;  1L0Y B;  2FID A;  2JPH A;  1WMH A;  3R66 C;  3B0A A;  4RGO S;  2MHJ A;  4YTP B;  2C7H A;  5C1Z A;  2MP2 B;  1YOV B;  2JT4 B;  4W9I A;  3AED B;  1JWU D;  2RPV A;  4DQO C;  3M63 B;  4WWM A;  2J7Q B;  5HKH A;  4CHK A;  1XT9 B;  2N9K A;  1IBX B;  2CKH B;  3TSS A;  3PV1 A;  3B9J A;  1E0Z A;  3ZYY X;  4BBN F;  4NAM A;  5H92 C;  4FA6 A;  4YWG G;  2JQR B;  2N9L A;  3AM9 A;  3M3J A;  3RI7 C;  3VH4 B;  4G50 A;  3UI3 A;  1WM3 A;  1R4N I;  1SJH D;  4II2 B;  3VAW A;  5CHF A;  4LJO B;  3DVN U;  1ROE A;  2LXA A;  2WXI A;  2WXQ A;  3ZXR A;  2ICI A;  1I4H A;  2MX2 A;  2W54 A;  2KDB A;  2LGS A;  2CHW A;  2ZZP B;  2IO1 B;  2WXP A;  4IUM B;  4B0M A;  1ESF A;  1MFW A;  2BB5 A;  2BF8 B;  2WX1 A;  2GB1 A;  2Z0D B;  1J8C A;  1XO3 A;  3IG3 A;  1HTQ A;  5D7G A;  1MHX A;  4WAA A;  1VCB A;  1CK1 A;  1J7C A;  1S1Q B;  1JWS D;  3N3K B;  1KOT A;  3AE7 B;  4HVB A;  3LXF A;  4FAD A;  2AQ3 B;  4XC2 A;  3U2S C;  2XEW A;  2DX5 B;  2Y5P A;  1UBQ A;  4K7W A;  1V2Y A;  4B9K A;  2KC2 A;  3ZQ4 A;  4G11 A;  2MSE D;  1UWX A;  4H2A A;  3PZD A;  2AL3 A;  2BYE A;  3ENE A;  3GZN I;  2DYM A;  1J7B A;  1NI3 A;  3OAW A;  2PW9 A;  4IDI A;  2L8J A;  2J0J A;  2GI9 A;  4C7Z A;  3EUB 2;  1OFF A;  1BT0 A;  1D3Z A;  1D5X C;  4I6L B;  2KTR B;  4B0E A;  1Y56 A;  3AE3 B;  3N1X C;  3P42 A;  3QIJ A;  3NS1 A;  1VD2 A;  1TZ1 A;  4KX6 B;  2X8X X;  4KZC A;  3V60 A;  1ZOY B;  2LAS A;  4WQM A;  1F2R I;  3GZN B;  1R4M I;  2MJ3 A;  2J0K A;  2QIE B;  3L10 B;  2ZNV C;  3ZNG C;  4C4V B;  3W9C B;  1GUA B;  1CZP A;  1V8C A;  3BWU D;  3RPF C;  1ZDX A;  2LRU A;  4I6P A;  5C2T B;  2WX0 A;  4FLH A;  4WQO B;  4CYE A;  2XNA C;  1HTO A;  3QAQ A;  2R2O A;  3AV8 A;  4WIP A;  3QCA A;  1WI0 A;  4C00 A;  1WMH B;  4DXF A;  4EFO A;  3MHS D;  1UGM A;  4DDI D;  1FRR A;  3AUL A;  4WUR A;  2MBQ A;  2BS3 B;  2CJN A;  2CU3 A;  2R2Q A;  4K3C A;  3H7P A;  2LEK A;  4RGT A;  3RNG C;  2WXL A;  5DCN A;  1EF5 A;  4PS3 A;  1WH3 A;  1HEZ E;  1EO6 A;  1TY2 A;  2IJ0 A;  2QHO A;  2KMC A;  4ZHO A;  4ANU A;  1FXA A;  3FIL B;  2ZVN A;  3NZU A;  2W55 A;  1IBX A;  4LLG M;  4UDU C;  1WXQ A;  2Y5C A;  1R7S A;  3JSV A;  3BII D;  1E7U A;  2XK5 B;  3L4P A;  5JZE B;  2V3P A;  1FFV A;  3BK2 A;  3BYT B;  3RUI B;  4AOF A;  4FUL A;  5EE0 A;  3E56 A;  2L00 B;  3DCG A;  2M17 A;  1ET6 A;  1EUV B;  1M4V A;  1K8R B;  1I4G A;  2G9H D;  3LYY A;  3PSE B;  3PRE A;  3ML8 A;  1IP9 A;  2KN4 A;  1E8W A;  4XX5 A;  4TSS A;  5G5G A;  5BO4 B;  1F52 A;  5J2R A;  1GB1 A;  4RH6 A;  3IVF A;  1H8C A;  1C79 A;  1NBF C;  1RFA A;  4RGN A;  1ZKH A;  2LJ5 A;  1RRB A;  1WGH A;  3NS8 A;  4NJC A;  1FCL A;  3CF6 E;  1UWM A;  2ZPY A;  3T8M A;  2JUO A;  4XE0 A;  2PVO D;  2NR2 A;  3IXS A;  4GDK B;  3WAM A;  3H9D A;  1RFK A;  2L0T A;  1WZ3 A;  4IWP A;  2SAK A;  4HDO A;  3R8B A;  5MPO A;  2IZV B;  1E8X A;  1PGX A;  2ONQ A;  3TEY A;  1F0Z A;  1V6E A;  3LDZ E;  4EZL A;  3QHT A;  2IY0 B;  2J0M A;  1F2R C;  4ZRJ A;  1JCK B;  2KJH B;  1UUP A;  3B2G A;  1EWY C;  4IG7 B;  4L2Y A;  4RMA A;  4EKU A;  2D3C A;  4RF1 A;  1WYG A;  5AEK B;  5LNK 1;  4HPP A;  4TMA B;  2RDH A;  4KIK B;  4E3C A;  4KKI A;  2L52 A;  1N60 A;  2BYV E;  1XLO A;  5EE1 A;  1T0R C;  1I35 A;  2N9P C;  2JZZ A;  2KXJ A;  4HK2 A;  3NUH B;  3I3T B;  1PFD A;  3NRZ A;  1KLU D;  1STE A;  4BKT A;  1VLB A;  2KMA A;  3R7Q A;  2K8C A;  1VZ8 A;  1E90 A;  2M0A A;  1C1Y B;  3MJW A;  5C23 A;  3BZD B;  1HZ6 A;  4AJY B;  3GP7 A;  1N5W A;  5DPR A;  4XZ4 A;  1L7Y A;  2IGD A;  1C4A A;  1E6E B;  2IO0 B;  4L1B A;  2KN5 A;  1MG4 A;  1D4B A;  1SE4 A;  3A33 B;  5HI1 A;  3ZRF A;  2MJE A;  2W82 A;  2LWP A;  2AWT A;  4WJO A;  4JIO U;  4K81 A;  4MM3 B;  3ZDM C;  3PVL A;  3Q3O C;  3QX1 A;  5TSS A;  2KKC A;  2C7N B;  4AWJ A;  2V1Y A;  2C7M B;  4WAF A;  2J4X A;  2LGY A;  1YD8 U;  1UF0 A;  5LXI B;  1DOX A;  3DDC B;  2DLB A;  4DHZ B;  3PZ7 A;  2MH7 A;  3VTU A;  1QOB A; 
#chains in the Genus database with same CATH homology
 3ZKJ C;  2KFJ A;  4W9G A;  2K6Q A;  4DXA B;  1AAR A;  1OGW A;  1WRD B;  2DZK A;  4WWO A;  4BKS A;  2KWV B;  2FCS A;  3UIN B;  2KLC A;  3GOE A;  2YVC A;  1NDD A;  1J19 A;  2IYD B;  5AZF A;  4GDK A;  2IY1 B;  3N32 A;  2KX3 A;  4G0N B;  2A4Z A;  2LGD A;  2Z0E B;  4W9L A;  1Z2M A;  4HWI B;  3WAL A;  4EUT A;  3UQA A;  2HJ8 A;  3TL5 A;  1WJN A;  3QA8 A;  4GXB A;  1ZGU B;  2DEN B;  4TQ0 A;  3SHQ A;  2KFK A;  3APD A;  4A20 A;  2JZ3 B;  2L05 A;  2K8H A;  3L13 A;  1ZW7 A;  3KYD D;  3APC A;  2FID A;  2JPH A;  3EC8 A;  1WMH A;  3R66 C;  1H4R A;  3B0A A;  1WJ6 A;  4PYZ A;  2MWS B;  4EEW A;  3MTN B;  5C1Z A;  2C7H A;  4HDQ A;  2MP2 B;  4X57 B;  2G4S A;  2JT4 B;  4W9I A;  5KHO A;  3ZDM C;  3L17 A;  3ML9 A;  3DVG Y;  4BKS D;  3BY4 B;  4F1S A;  4JGH B;  4GMV A;  4G3X B;  3DVN V;  3M63 B;  2J7Q B;  5HKH A;  4CHK A;  2OOB B;  2DHZ A;  2K8B A;  5D94 A;  3UQB A;  1XT9 B;  3TMP B;  2KJR A;  3QJZ A;  5CX3 A;  4MEM A;  4IWO A;  2HE7 A;  2V3S A;  3ZNI D;  2CKH B;  1OTR B;  3PV1 A;  2OJR A;  2XBB C;  3Q3J A;  4OVU A;  4BKG A;  4ZRK A;  4MJS A;  3VXW A;  3ZNH B;  4ASW C;  2VRR B;  2GBN A;  2Z59 B;  3A9K A;  1S3S G;  3A9J A;  4BBN F;  1V81 A;  3PTF C;  1CMX B;  4FJZ A;  1WX8 A;  2MA9 B;  4NJ6 A;  3KW5 B;  4FA6 A;  2K1F A;  3VQI A;  2G3Q B;  4AJW A;  3TBL D;  3R3M A;  2KNB A;  2DZM A;  4MGI E;  2L7R A;  3NY5 A;  3M3J A;  3ALB A;  3VH4 B;  4G50 A;  1WM3 A;  4NQK E;  3H6N A;  4FJV B;  4MGZ E;  4F8C B;  1R4N I;  2NBU A;  2D11 A;  4II2 B;  2M1M A;  1Q5W B;  2DZI A;  4KDI C;  2D2Q A;  5CHF A;  3VAW A;  1KM7 A;  4ANV A;  3ZW3 A;  3UGB B;  3JYU A;  4URK A;  4LJO B;  3DBS A;  3DVN U;  2LXA A;  4II3 B;  1HE8 A;  1YX5 B;  4M8N A;  1V49 A;  1LFD A;  2MX2 A;  2KDB A;  3U7D A;  2CHW A;  2ZZP B;  2IO1 B;  2KAN A;  2NBV B;  4IUM B;  2RR9 A;  3NZS A;  3KUZ A;  4EZK A;  1YIW A;  2G45 B;  2IO2 B;  2MLB A;  2KK8 A;  1WIA A;  2BF8 B;  2LVQ A;  2KDI A;  2WX1 A;  5JHB A;  2LVO A;  2D07 B;  2Z0D B;  1J8C A;  2GOW A;  4BOS C;  1V80 A;  3IG3 A;  1Z5S B;  1PQS A;  4M8M A;  1IYF A;  2NS5 A;  3HHM A;  1TTN A;  3L16 A;  5D7G A;  3VH3 B;  4WAA A;  1VCB A;  2HTH A;  4WJN A;  2N4F A;  2MW5 A;  4A3P A;  4MJS B;  4AP4 C;  4DWF A;  3HM6 X;  3N30 A;  5CHW A;  1S1Q B;  3N3K B;  1OEY A;  1KOT A;  2NPT B;  3DBH I;  4HVB A;  1UH6 A;  1GG3 A;  3TJP A;  4PS7 A;  2K39 A;  3PLU A;  3T9L A;  1Y8R C;  4FAD A;  4XC2 A;  3RYT A;  2XEW A;  3ECI A;  2JRI B;  3SU8 X;  3A1Q A;  3W1S A;  2DX5 B;  1JRU A;  3V6C B;  4E71 A;  1UBQ A;  3B1L X;  3DVG X;  4ZDV A;  4K7W A;  1V2Y A;  4B9K A;  2JVC A;  3VUY A;  5L95 C;  4NAW A;  2KC2 A;  2EMS A;  4AUQ C;  4G11 A;  3QQ8 B;  3NOB A;  3OJ4 B;  2D10 A;  1MG8 A;  2ASQ A;  2PE9 A;  4EOY A;  2MSE D;  2I1J A;  5AZH A;  5KHQ A;  4DDG D;  4IM3 A;  2CHZ A;  3V6E B;  3PZD A;  1V9J A;  2AL3 A;  5AZG A;  1LQB A;  2BYE A;  5CHV C;  3SDL C;  4DBG A;  3ENE A;  2KX0 A;  3GZN I;  1RAX A;  2WDT B;  3WAP A;  2MBE A;  2DYM A;  4IM2 A;  2DAF A;  3X0W A;  4FHJ A;  3OAW A;  2MQJ A;  2W9N A;  4NPN A;  2BWE S;  4GOC A;  3RZW C;  3QC8 B;  5E6N A;  4W9E A;  2L8J A;  4W9J A;  5D2M B;  3U30 A;  2J0J A;  1WE6 A;  4TKN A;  3X23 A;  2DYB A;  2JWZ A;  4NQL B;  1WJ4 A;  3BIN A;  1P0R A;  3M62 B;  1BT0 A;  2N7E A;  2RSU A;  1D3Z A;  2K25 A;  4I6L B;  1WXS A;  1WF9 A;  2LRW A;  2KTR B;  1E8Z A;  3ONS A;  4WWN A;  1F9J A;  5IAA C;  4KSL C;  4NJ7 A;  3IHP C;  1ISN A;  3RZF A;  3QIJ A;  1VD2 A;  4MSQ B;  1P1A A;  2HD5 B;  1TZ1 A;  1GNU A;  3EHV A;  3ZTD A;  5DPW A;  2BKF A;  3DBL I;  3AI5 A;  4HJK A;  4KZC A;  2LXC A;  1V86 A;  4MGK E;  3V60 A;  4ZRI A;  4DK5 A;  4N9F 4;  2LAS A;  2FCN A;  2NBW B;  3PPA A;  2GMI C;  2MBB B;  3ZLZ A;  2REX A;  2KHW B;  1R4M I;  2KO3 A;  4TUU A;  3UIP B;  3VVW B;  2KQS A;  2LZ6 A;  2J0K A;  3QWZ B;  3U8Z A;  3L10 B;  2N9X A;  2LUE A;  2ZNV C;  1KLV A;  3ZNG C;  2O2V A;  3B08 A;  3A4S C;  1GUA B;  2KWC A;  4MGY E;  3PLV A;  1WE7 A;  2KTR A;  4MH0 E;  1WGD A;  3WIM A;  4LJP B;  1P3Q U;  2LRU A;  4I6P A;  4OVV A;  2WX0 A;  1YX6 B;  2FNJ B;  2KJ6 A;  4FLH A;  2YLM A;  1IPG A;  3DOW A;  4KVG B;  2FCM A;  1E7V A;  4W9C A;  4WQO B;  3JW0 X;  3ZDT A;  2N7D A;  1WYW B;  2R2O A;  3KYC D;  3QAQ A;  3WAO A;  3KUC B;  3QCA A;  2ZCC A;  4W9F A;  4GU2 A;  3PHX B;  1WI0 A;  4TQ1 A;  1WMH B;  4GSW A;  4EFO A;  3MHS D;  1SE9 A;  2RGF A;  2IO3 B;  1UGM A;  4DDI D;  2O6V D;  3AUL A;  1L2N A;  2MBQ A;  3DPD A;  2KFK B;  1NI2 A;  5DPS A;  2MCN B;  3AXC A;  3VUW A;  2KDE B;  2R2Q A;  2DAJ A;  2EMT A;  3H7P A;  1GC7 A;  2B3A A;  2N9E B;  4MDK E;  4W9K A;  1P9D U;  1T0Y A;  3PGE A;  5DCN A;  1EF5 A;  2KC1 A;  4PS3 A;  1WH3 A;  4ZYN A;  2M0X A;  2KVR A;  3WA0 A;  2GBR A;  1EO6 A;  2M4N A;  3H7P B;  2QHO A;  2KMC A;  2L3Z A;  3CST A;  3Q3F A;  3W1S C;  4ANU A;  1U4A A;  1OEY J;  2XK5 A;  2UYZ B;  3ZTC A;  1WGG A;  2MBO A;  2ZVN A;  3NZU A;  1WR1 A;  4GB9 A;  2KOX A;  4ICV A;  3V62 A;  2K6D B;  2NVU I;  1SIF A;  2V4L A;  3JSV A;  2MP2 A;  3M95 A;  1E7U A;  2GBM A;  2XK5 B;  4KSK C;  1Q1O A;  2LI5 A;  5JZE B;  3QK0 A;  1FXT B;  5IA7 A;  1GC6 A;  3RUI B;  2O6V B;  3VHT C;  4KDL B;  4J6I A;  5E6P A;  2BKR B;  3JVZ X;  1UD7 A;  1RLF A;  2UWQ A;  4GGQ A;  3RUL A;  4AOF A;  1UZX B;  4FUL A;  1E5W A;  4BOZ B;  3AU4 A;  4PYU A;  3ZIM A;  2L00 B;  3DCG A;  3DQV A;  5EDS A;  3KH0 A;  2M17 A;  5J17 A;  4RM8 A;  3PT2 B;  1YJ1 A;  1EUV B;  1J0G A;  1K8R B;  3OJ3 A;  3OLM D;  3PRM B;  2ZVO A;  4HPL B;  1QZE A;  1Q0W B;  5FR6 A;  1TGZ B;  2AYO B;  3PSE B;  3PRE A;  4PS8 A;  3ZVV A;  3ML8 A;  1IP9 A;  4ANW A;  1E8W A;  4XX5 A;  1SGH A;  3HK0 A;  4KV2 A;  1I42 A;  4K7S A;  2A5U A;  4HLE A;  2BPS A;  5BO4 B;  5J2R A;  2L76 A;  4JLC A;  3VDZ A;  4W9D A;  1WXA A;  4LCD E;  3RCZ A;  4JL9 A;  5JHA A;  2JF5 A;  2C9W B;  1A5R A;  4F7Z A;  2KQ7 A;  3IVF A;  4HCP B;  2NPT A;  3UF8 A;  1H8C A;  2ZCB A;  4FN2 A;  4MSM B;  3L08 A;  2C60 A;  2BWF A;  1NBF C;  4IW0 A;  2IBI B;  1XQQ A;  1RFA A;  2KWU B;  3L54 A;  4KZ0 A;  1ZKH A;  2LJ5 A;  3P2B A;  1RRB A;  4BFR A;  4P7I A;  4MM3 A;  4CO7 A;  1WGH A;  2WWZ A;  2CU1 A;  1WFY A;  4W9H A;  3UIO B;  2FAZ A;  3NS8 A;  4DHJ B;  4E74 A;  3CF6 E;  3CSF A;  4WJP A;  2BGF A;  3EEC A;  4DHZ E;  2ZPY A;  2JRH A;  3T8M A;  4HCN B;  2JUO A;  2JXX A;  3A9J B;  3RD2 A;  2NR2 A;  2AEH A;  1KJT A;  4A3O A;  3QAR A;  4GDK B;  3WAM A;  3ZNZ B;  3K9P B;  3IBE A;  4HPM B;  4K1R B;  3ZUN A;  4EZJ A;  3H9D A;  3JSV B;  1X1M A;  1WZ3 A;  2L0T A;  4HDO A;  4IWP A;  2IZV B;  4HXD A;  2LD9 A;  3HM3 A;  4I6N B;  1E8X A;  2RPQ A;  3PRZ A;  4ICU A;  4CYE A;  1V6E A;  3LDZ E;  5G55 A;  3O65 B;  4M0W B;  2FCQ A;  2RD0 A;  3KVF B;  4EZL A;  3RT3 B;  2LGX A;  3A1Q B;  3QHT A;  2ZEQ A;  1WY8 A;  1EF1 A;  2C5L C;  2FIF A;  2IY0 B;  2J0M A;  2LVP A;  5J18 A;  1WGY A;  4GDL B;  3DBR I;  4TV3 A;  4ZRJ A;  1GJZ A;  3D32 A;  4IWQ A;  2GBJ A;  3LJ3 A;  2D3G A;  3H1U A;  2KJH B;  1WM2 A;  1WXM A;  2O2V B;  3IFW B;  2CS4 A;  4B95 A;  3KUD B;  4KIK A;  3S2A A;  3APF A;  1WZ0 A;  4NY0 A;  3PS6 A;  3K9O B;  4IG7 B;  2Y5B B;  2JY6 A;  4RMA A;  4EKU A;  4GN1 A;  5AEK B;  4FBJ B;  4LDT D;  1WJU A;  2ZNV B;  3EFU A;  1XD3 B;  4GIV A;  4KIK B;  2M8S A;  2WYQ A;  1WXV A;  4E3C A;  3TCA A;  5TR5 A;  4DHJ D;  2PPH A;  4ANX A;  2N1W A;  2PEA A;  2PJH A;  4NAW B;  2BYV E;  1G6J A;  2GBK A;  5G2N A;  4BBN C;  4IC7 B;  3A9K B;  2ZPN A;  2KDF B;  1I35 A;  4FJY A;  1UEL A;  1WX9 A;  2N9P C;  2JZZ A;  4B6W A;  2KXJ A;  4HK2 A;  3CMM B;  1WR6 E;  1OQY A;  2I1K A;  3I3T B;  4JQW C;  4RM9 A;  2L0F A;  3VUX A;  4BKT A;  5L83 A;  1WGR A;  2KD0 A;  2FUH B;  2KMA A;  3R7Q A;  2K8C A;  3VFK A;  1E90 A;  3SD5 A;  1V5T A;  1C1Y B;  3W1Y A;  3MJW A;  5E6O A;  5C23 A;  1C3T A;  5LLI A;  4AJY B;  5LXH A;  5DPR A;  4XZ4 A;  3V61 A;  1L7Y A;  4WJQ A;  2EKE C;  4FHK A;  3ZRC A;  2MBH A;  4IM0 A;  3VTW A;  4LDT B;  1WX7 A;  2CR5 A;  3HIZ A;  2N1V A;  2IO0 B;  3PRP B;  3PHW B;  1TBE A;  2KN5 A;  2KTF A;  3A33 B;  3TIX A;  3ZO5 B;  1LM8 B;  5DPT A;  3AU5 A;  3ZRF A;  5CTR C;  1P98 A;  3R7R A;  2O6V A;  4YL8 A;  3A4R A;  2DZJ A;  2LWP A;  5JH5 C;  2AWT A;  2NCN A;  4JIO U;  4K81 A;  4NNJ B;  4WJO A;  3PVL A;  2KLG A;  1E8Y A;  1V5O A;  2KKC A;  2C7N B;  2ZJD A;  3QX1 A;  2MRP A;  4WWP A;  1YQB A;  2C7M B;  2V1Y A;  2CHX A;  4AWJ A;  2G4D B;  4GDL A;  3VTV A;  2LGY A;  1YD8 U;  2DYO A;  3C0R B;  2KZR A;  2AL6 A;  5GMV A;  5D6J B;  2PE6 B;  4BVU C;  5LXI B;  2BYF A;  3DDC B;  3WAN A;  3NHE B;  4K7U A;  3H7S A;  4DHZ B;  1LXD A;  3L0W B;  4MEL A;  1UBI A;  1M94 A;  3VTU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...