2NPTA

Crystal structure of the complex of human mitogen activated protein kinase kinase 5 phox domain (map2k5-phox) with human mitogen activated protein kinase kinase kinase 2 phox domain (map3k2-phox)
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
106
structure length
102
Chain Sequence
b'SMALGPFPAMQVLVIRIKIPNSGAVDWTVHSQLLFRDVLDVIGQVLPEATTTAFEYEDEDGDRITVRSDEEMKAMLSYYYSTVMEQQVNGQLIEPLQIFPRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dual specificity mitogen-activated protein kinase kinase 5
molecule tags Transferase
source organism Homo sapiens
publication title Crystal Structure of the complex of human mitogen activated protein kinase kinase 5 phox domain (MAP2K5-phox) with human mitogen activated protein kinase kinase kinase 2 phox domain (MAP3K2-phox)
rcsb
total genus 21
structure length 102
sequence length 106
chains with identical sequence C
ec nomenclature ec 2.7.12.2: Mitogen-activated protein kinase kinase.
pdb deposition date 2006-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00564 PB1 PB1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2nptA01
4KZCA 3UINB 1V2YA 4EFOA 2KN5A 4IM0A 2Z0EB 3NZUA 4B95A 2FNJB 3QX1A 3RYTA 3HIZA 3QJZA 1WGHA 2N4FA 3WA0A 1J8CA 1SIFA 1WE6A 2FCNA 2BKFA 1CMXB 2REXA 4K7WA 1WJ6A 3CSTA 3M62B 3V62A 4NY0A 2WX1A 2BYEA 2G4DB 2EMTA 2XEWA 3H7PA 4DWFA 3B0AA 4NQKE 4YL8A 4E74A 4ANVA 2KDFB 3AI5A 1TTNA 3HM3A 4MGYE 5DPRA 1U4AA 2KMAA 2KDEB 1TBEA 4KV2A 2MP2B 4JGHB 2KWCA 1RFAA 4KDLB 2N7DA 4MGIE 3S2AA 2I1KA 3SHQA 3VFKA 2EMSA 2G45B 4LJPB 4MH0E 1IP9A 4GOCA 2D3GA 3L13A 2KKCA 2MWSB 2W9NA 4B6WA 2MP2A 5L95C 2GOWA 1P9DU 4HDOA 1E8ZA 4CYEA 5D6JB 1OQYA 1KOTA 4ANXA 1WFYA 4AOFA 3QA8A 1ZKHA 1GNUA 4PS3A 4ZRIA 4URKA 4DHZE 3N30A 3ZW3A 2C7NB 1S1QB 2JUOA 3H7SA 4GDKB 2NR2A 3PS6A 2D10A 4II2B 3JW0X 1A5RA 1L2NA 2RR9A 3OJ3A 3KUDB 2CHWA 4BKSD 4W9LA 2MBHA 3MHSD 2DZMA 2EKEC 1WMHA 2JPHA 2MBQA 2WDTB 5D2MB 3PTFC 2K8HA 1RAXA 4ZRJA 4IWPA 3WANA 3VTVA 2JWZA 2RPQA 3PPAA 3PRPB 1XD3B 3I3TB 1WX8A 2LGXA 3MTNB 4HWIB 4XZ4A 3OAWA 4BOZB 3ZDMC 4GDLA 5D7GA 1Q5WB 2GBRA 2IO3B 1ISNA 1I35A 2D11A 5C1ZA 1LQBA 4DDGD 2UYZB 2JVCA 3ZRCA 2K1FA 3SD5A 1PQSA 3OJ4B 2L3ZA 2NVUI 2DHZA 2KTRA 2LZ6A 3UIPB 4AP4C 1F9JA 5HKHA 3NY5A 4FJYA 2DAFA 4GU2A 3T8MA 3D32A 3QAQA 2LWPA 1J19A 3ONSA 4W9DA 4AWJA 2KOXA 4GMVA 4M8NA 3DOWA 3QCAA 5LXHA 3PV1A 3VTWA 4FHKA 2M8SA 4HVBA 2J7QB 2M17A 3N32A 3PT2B 2VRRB 2IY1B 3TCAA 4EZKA 3UQAA 1YX5B 2YVCA 4MGKE 1WF9A 1P1AA 1V49A 2MW5A 2CS4A 3RULA 3QK0A 1WY8A 1WMHB 2NBUA 4I6PA 3RT3B 2IO1B 4IM3A 1E7UA 2KWVB 2MQJA 5AZFA 1WJ4A 2CR5A 4GSWA 2C9WB 2IZVB 3IFWB 1IYFA 1EO6A 1WR1A 2L05A 3KH0A 4IUMB 4G11A 2KC2A 3ZNID 3A9JB 1P98A 1UGMA 1GJZA 3QHTA 1SE9A 1E90A 3ML8A 4GIVA 4TUUA 2DAJA 5CHWA 2CHZA 3VVWB 2DZIA 1E5WA 5CHFA 4DHJD 4DK5A 3GZNI 1NBFC 1YQBA 4BBNC 4FULA 4BKTA 2AL3A 3JVZX 4K1RB 4JL9A 1D3ZA 4G0NB 2GMIC 4HDQA 3ECIA 2GBMA 2KC1A 2JXXA 4W9JA 4IWOA 4IW0A 3W1SC 5LXIB 2O6VB 4RM9A 3M3JA 3PVLA 2C7HA 2K6DB 4BKSA 1LXDA 3DBRI 3LJ3A 3VQIA 5G2NA 1UD7A 1L7YA 4ICUA 5E6OA 5E6PA 1YD8U 2OOBB 4PYZA 4AJWA 5IA7A 2XK5B 3OLMD 4MSQB 1V9JA 4EKUA 2L0TA 4KIKA 4W9KA 2KK8A 2KWUB 1WR6E 1RRBA 4DDID 4WWPA 2C7MB 2NPTB 3QQ8B 2XK5A 3VUXA 1UBQA 1WZ3A 2N9EB 1UBIA 4ASWC 5JH5C 3A9KA 1EUVB 3ZUNA 2N7EA 3NHEB 2LVOA 3KYCD 4AUQC 1GUAB 2L0FA 1NI2A 3L08A 1WRDB 3RZFA 1YJ1A 2DX5B 3NS8A 1V5TA 4XX5A 4GDLB 2ZNVB 2DYMA 3V61A 3L10B 4ANUA 2FIFA 2DENB 3P2BA 3UIOB 1RLFA 3AU5A 3L17A 3U7DA 5AZGA 3MJWA 2L00B 1WJUA 2MA9B 4G50A 3ZNHB 2Z59B 2N1VA 4EZJA 1E7VA 2QHOA 3A4RA 2V4LA 2PJHA 3B1LX 2N9XA 3M95A 2JRIB 3HHMA 4OVUA 2K6QA 1G6JA 2J0KA 2BF8B 3V6EB 4BFRA 3Q3FA 4I6LB 1WGRA 4KVGB 1I42A 1WM3A 4KZ0A 3JSVB 4NQLB 4W9FA 1OEYA 3K9PB 4ZDVA 2MBEA 3ZIMA 1OGWA 2O6VD 4NJ6A 4FN2A 2GBNA 4A3OA 3C0RB 4CO7A 2V3SA 3RD2A 2A4ZA 3U30A 2A5UA 1WX9A 3DPDA 5AZHA 4MDKE 4EZLA 1H8CA 4GN1A 4HPMB 2LRWA 2KJRA 2KANA 4EOYA 4PS7A 5IAAC 3A9JA 3JSVA 4BBNF 4FADA 2C60A 4TV3A 3WIMA 1WGDA 3ALBA 1V86A 3IVFA 4XC2A 4F7ZA 1H4RA 1UZXB 2KFKB 4J6IA 5KHOA 2PE6B 2KO3A 2N9PC 3M63B 4GDKA 1Q1OA 4MM3A 1LFDA 1R4NI 3NOBA 3L0WB 3ZNZB 5CTRC 3DBHI 2G4SA 2HE7A 3HK0A 4PS8A 2ZCCA 4WQOB 2MBOA 4ZYNA 3VH3B 3UQBA 2JY6A 1EF5A 3QARA 2KDIA 2XBBC 3ZRFA 4HCNB 3RUIB 2LI5A 3IBEA 1Z2MA 1SGHA 1UH6A 2BYFA 3A33B 2LD9A 3KW5B 4DXAB 2LVPA 5DPTA 2N1WA 3KUCB 1WGYA 2LGYA 1UELA 3VAWA 3UF8A 3VDZA 4IWQA 2L7RA 2I1JA 4BKGA 1GG3A 3K9OB 2FCMA 3CSFA 4LCDE 4A20A 3H1UA 3SDLC 1E8XA 2JRHA 1WXVA 4I6NB 2NCNA 2DZKA 2HJ8A 2KVRA 3L16A 4IC7B 3ZKJC 2JZZA 3W1SA 5LLIA 4TQ0A 1P0RA 4HPLB 3TIXA 3WAOA 4M0WB 2MLBA 2OJRA 1WGGA 4JQWC 3APCA 3QIJA 1Z5SB 2KXJA 2M1MA 5GMVA 2FCQA 2KTFA 1XQQA 2IBIB 2CKHB 4M8MA 3TL5A 3BY4B 4LDTB 2KFJA 4X57B 2L8JA 4DHJB 2M0XA 1KJTA 4WAAA 2MSED 3Q3JA 2KQSA 3KYDD 1WIAA 3ML9A 4ANWA 3AXCA 4MJSA 3WALA 5AEKB 2KJ6A 3DBSA 2JZ3B 1T0YA 3PSEB 2O2VA 3EECA 5L83A 4KIKB 3R7QA 5JZEB 5JHAA 1M94A 3HM6X 3WAMA 3DBLI 3EFUA 4NJ7A 3DVNV 4P7IA 4WWOA 4K7SA 2ZCBA 2L76A 3T9LA 1YIWA 1LM8B 2R2OA 3B08A 2ZZPB 3DVGX 3AU4A 2ZVOA 5KHQA 3DCGA 2HTHA 2MX2A 4MJSB 1WE7A 1WXSA 2J0JA 1BT0A 2K39A 2KDBA 4FJZA 2KD0A 4HLEA 5JHBA 1E8WA 1V80A 1TGZB 1WXMA 5BO4B 2BYVE 2GBJA 2LUEA 2KQ7A 3VUWA 4E71A 2AEHA 4EUTA 4NAWA 4MGZE 2G3QB 2BGFA 5CX3A 1Q0WB 4F8CB 2RSUA 2NPTA 3H7PB 1P3QU 1OEYJ 4A3PA 2YLMA 2LVQA 5CHVC 3ZTCA 5TR5A 5DPWA 2ZNVC 3VXWA 4LJOB 2KFKA 3DVGY 4AJYB 4HK2A 1V6EA 4HXDA 3H6NA 2DZJA 4FBJB 4W9CA 2WYQA 2FCSA 4KSLC 2LGDA 1J0GA 2AYOB 2HD5B 2KZRA 4FHJA 1WI0A 1ZGUB 4ZRKA 4BVUC 3R66C 4MELA 3V6CB 2UWQA 1GC7A 2JF5A 3PHXB 1K8RB 3IHPC 5J17A 2IY0B 3VHTC 3L54A 2K8BA 2LXAA 3PLVA 4HJKA 2PEAA 4DBGA 4RMAA 1Y8RC 4K81A 1WM2A 2CHXA 1TZ1A 1VCBA 2LJ5A 2KHWB 3R3MA 2DYOA 3KUZA 1WJNA 3GOEA 2K25A 2AWTA 2B3AA 2Y5BB 4JLCA 1MG8A 4FJVB 3VH4B 4RM8A 2Z0DB 2ZPNA 4HCPB 3ZNGC 2FAZA 3UGBB 1WX7A 3WAPA 3R7RA 2ZEQA 5G55A 3TJPA 4CHKA 5J2RA 4II3B 3A4SC 1QZEA 2CU1A 2BPSA 3ZTDA 4MSMB 3H9DA 1KM7A 1EF1A 2IYDB 4IM2A 3CMMB 2BKRB 3ZO5B 3LDZE 3ZVVA 3QWZB 2KMCA 2R2QA 3BINA 2D2QA 3A1QA 4NAWB 4WJQA 2MCNB 3U8ZA 2LRUA 1XT9B 5J18A 1WH3A 1WYWB 3A9KB 2ZVNA 4BOSC 2ZPYA 2ASQA 3PHWB 2JT4B 3A1QB 1V81A 4NNJB 3PRMB 2RGFA 4OVVA 3SU8X 4DHZB 4FA6A 1WXAA 3O65B 4GB9A 4NPNA 2WX0A 2KLCA 4GGQA 3V60A 3ZLZA 3RZWC 3VUYA 1E8YA 3PRZA 2LXCA 4TKNA 3AULA 3DDCB 1VD2A 4ICVA 3NZSA 2KX0A 2KX3A 4IG7B 3N3KB 4EEWA 2K8CA 2KNBA 1V5OA 1NDDA 1FXTB 2FUHB 2D07B 3X0WA 3KVFB 4GXBA 4WJPA 1C3TA 2NBWB 2V1YA 5EDSA 4W9EA 2ZJDA 2J0MA 3CF6E 2O6VA 3APDA 2KJHB 4W9GA 3ENEA 2WWZA 1YX6B 4B9KA 2IO2B 4KDIC 3PGEA 4WJOA 1IPGA 3EHVA 5FR6A 2PPHA 3RCZA 1ZW7A 2BWFA 2NS5A 3TBLD 3PLUA 4KSKC 2NBVB 3QC8B 3PREA 5E6NA 3TMPB 3X23A 3DQVA 1KLVA 4PYUA 1X1MA 1JRUA 3EC8A 4K7UA 3JYUA 4W9IA 2PE9A 1AARA 2O2VB 1HE8A 4WWNA 2RD0A 2IO0B 3DVNU 4G3XB 4F1SA 5D94A 2KTRB 4MEMA 1OTRB 2FIDA 1R4MI 3IG3A 2AL6A 4JIOU 1C1YB 1WZ0A 2DYBA 2LASA 3ZDTA 4LDTD 2BWES 2C5LC 1S3SG 3PZDA 4W9HA 5DPSA 5C23A 3W1YA 2KLGA 4FLHA 1GC6A 2GBKA 4TQ1A 3VTUA 2MBBB 4WJNA 5DCNA 2MRPA 3APFA 2M4NA 4N9F4 4E3CA
chains in the Genus database with same CATH superfamily
2RDGA 3UINB 2KN5A 1GB4A 3NZUA 3EUB2 3QX1A 2WXFA 1J8CA 1WJ6A 2X38A 1SE3A 2EMTA 4US9A 3B0AA 5DPRA 1K52A 4S17A 3MC8A 2E3TA 2Z8LA 2KWCA 1HZ5A 2N7DA 4GOCA 2JQRB 2MWSB 2W9NA 1C4AA 4HDOA 4CYEA 5D6JB 2DLBA 4ANXA 1UWXA 1I4XA 3TUOA 4GDKB 2NR2A 2L32A 3PS6A 3B2GA 3JW0X 1A5RA 1L2NA 3C8YA 4W9LA 2MBHA 3MHSD 2DZMA 2EKEC 3ZXVA 2X8XX 2MJDA 3PTFC 1RAXA 4IWPA 1PYWD 3WANA 3VTVA 3I3TB 1QOGA 1LQBA 1FPYA 4DDGD 4RF1A 1BUIC 2UYZB 2JVCA 2K1FA 1PQSA 1FNWA 3B9JA 1F9JA 4FJYA 2IGDA 1J19A 4M8NA 3DOWA 3QCAA 3ZXRA 1JW9D 2J7QB 1YOVB 1PGBA 3HUIA 3UQAA 2YVCA 4MGKE 1V49A 2MW5A 3QK0A 3VR9B 1NEKB 2MQJA 2D3CA 3HVZA 4PT5A 1WJ4A 1VR9A 1E7PB 3MC0B 3L4PA 3R8BA 2L05A 1HXYD 1TS5A 1ZOYB 3KH0A 3AEFB 4YSXB 1UGMA 4TUUA 3ML8A 5BYQA 1XO3A 3AECB 2QDFA 1E5WA 4N58A 4DK5A 3GZNI 1CK1A 2PW9A 5LXIB 3PVLA 2K6DB 3IAM1 4RGMA 1LXDA 3LJ3A 5G2NA 5E6OA 2CJOA 5IA7A 2XK5B 3OLMD 4EKUA 4KIKA 1SBBB 2LHDA 3MJ5A 1RRBA 2ICIA 4WWPA 2C7MB 5E6JA 2XK5A 3Q2AC 1C77A 1UBQA 1JWSD 2N9EB 3ZJUA 2Q5WD 3PZ8A 4AUQC 1YJ1A 3NS8A 2WXHA 4XX5A 1QILA 4GDLB 3L10B 3CWIA 4ANUA 3P4QB 2FIFA 2DENB 3UIOB 1V1PA 3L17A 3I9V1 2L00B 1WJUA 2MA9B 1J7AA 2QHOA 2K5PA 3HHMA 4OVZA 1QKZA 2BF8B 5C3JB 1EU4A 3Q3FA 2R61A 1WM3A 4NQLB 4W9FA 4LNNA 2IDYA 1OGWA 2Y5PA 4A3OA 3RD2A 3U30A 5AZHA 1H8CA 2LRWA 4MACA 5IAAC 4H2AA 3A9JA 3JSVA 4FADA 2C60A 3WIMA 4JPSA 1V86A 1YJJA 2BBCA 4C4VA 1UZXB 1ZP0B 2PE6B 1T3QA 4MM3A 2WDRB 3L0WB 1SIJA 3AE1B 3UI3A 3DBHI 1YN4A 2HE7A 4WQOB 1T6BX 1EF5A 2XBBC 3AE9B 4HCNB 4BAXA 4ARIA 3SEBA 4OZBA 1Z2MA 1F77A 3KW5B 4BZAA 2LGSA 2LVPA 3GE3C 3E9SA 3UF8A 1FFUA 2L7RA 2ON8A 4LCDE 1E8XA 2EELA 2DZKA 1E0ZA 5EE1A 1T0SC 4HPLB 2OEDA 5BYRA 1WGGA 4JQWC 4ITKA 3QIJA 5GMVA 1OQRA 2WNMA 2FCQA 2KTFA 3Q6BA 1XQQA 4JWUC 3AE3B 4LDTB 1C9FA 2K3UA 1EWYC 2MSED 2AQ2B 2KQSA 2M56B 3ML9A 5AEKB 3WALA 3KWLA 5BMHA 2PKOA 3C19A 1WGKA 5JHAA 2PTLA 3HM6X 3DBLI 4P7IA 4K7SA 3R2IA 2L76A 2ZZPB 1WE7A 1N6ZA 2KDBA 2K39A 2OJWA 1V80A 4CQNA 3VUWA 2KQ7A 3P42A 4E71A 2H88B 4N59A 4DXFA 3H8HA 2K22A 1P3QU 2K0PA 2WU2B 1OEYJ 2YLMA 2LVQA 1V1PB 3B2FA 4C56C 2G1EA 2WYQA 3U7ZA 1L0VB 4P1BC 4XGAB 2HD5B 3W9CB 4ZRKA 3R66C 1GC7A 2JF5A 1K8RB 2IY0B 2WDQB 2PEAA 1VCBA 2LJ5A 2KHWB 2Y5BB 3VH4B 2ZPNA 2BB5A 2FAZA 1ROEA 1QOBA 3TJPA 2TSSA 5J2RA 1VZ7A 3WCQA 2BPSA 1J7CA 5FR3A 2BKRB 3ZO5B 4NAWB 2D2QA 3A1QA 3Q8FA 1XT9B 1TY0A 2ZVNA 4BOSC 3AM9A 1V81A 1R7SA 3T3NA 4NNJB 1UGJA 1FD6A 4OVVA 1ENFA 1VLBA 4GB9A 3V60A 2WX0A 3ZLZA 4M02A 2BT6A 4GLSC 4REZA 1KH0A 3P63A 2WGSA 4TKNA 1VD2A 4IG7B 3N3KB 2JX5A 4UDUC 3NVVA 1NDDA 3RNEC 2D07B 2EKIA 4W9EA 1C76A 2J0MA 1YX6B 1MI0A 3PGEA 3Q14C 1IPGA 3EHVA 2PPHA 2BWFA 3TBLD 4KSKC 3RPFC 4RH6A 4PYUA 1X1MA 2WXKA 1PGXA 3EC8A 1CZPA 4K7UA 4WWNA 2RD0A 3IT4B 3DVNU 3P1MA 3RNBC 3TEWA 4F1SA 4KGTA 2FIDA 3IG3A 3RN9C 4LNOA 2C5LC 3AH7A 2KLGA 4FLHA 1GB1A 4WJNA 2MRPA 4KZCA 2INNE 1D6EC 5D3DA 2Z0EB 3HIZA 3QJZA 3WA0A 1WE6A 2FCNA 2BKFA 1CMXB 4K7WA 1SE4A 4S0RA 3M62B 3V62A 1TS2A 3RNAC 2G4DB 5IO9A 2L83A 2QSDA 1JWMD 2FE8A 1C4CA 4P16A 2KDFB 4MGYE 1U4AA 2RPVA 1TBEA 4KV2A 2MP2B 4MGIE 4KKJA 3S2AA 1XXGA 2SEBD 1PFDA 2G45B 3L13A 2KKCA 1K53A 4B6WA 2GOWA 5EE0A 2D5GA 1WFYA 3QA8A 4PS3A 4ZRIA 4PK1A 4DHZE 2BS4B 1PGAA 1STEA 4A6QA 4OZAA 2D10A 5G5HA 4BKSD 2WS3B 3Q8CA 4ZRJA 1ACCA 2RPQA 1IBXA 3DBHB 1KFYB 1WX8A 2LGXA 4HWIB 4US8A 4BOZB 1KRHA 3EA6A 2GBRA 3E56A 2LFIA 1I35A 5C1ZA 4HKZE 3AB5A 1TKEA 3SD5A 2NVUI 2DHZA 1GPXA 3N1XC 3NY5A 2BYTA 3T8MA 2LWPA 3AEGB 4GMVA 2WXPA 3NRZA 3VTWA 2M8SA 4HVBA 3DBRB 2VRRB 2IY1B 3DWMA 1HQRD 2WXGA 1P1AA 2CS4A 1WY8A 1FMAD 5IP4D 1E7UA 2CR5A 4GSWA 3DHIC 2IZVB 4P1CC 5T8IA 1NENB 3A9JB 3ZYYX 2WLBA 3QHTA 2INPE 1QF6A 4HRSA 2DAJA 2QJLA 3VRBB 2XNAC 1XCTL 3OG5A 4FULA 4BKTA 3JVZX 1D3ZA 1C78A 4G0NB 2GMIC 4HDQA 2V4IB 4IWOA 1QQRA 1KLGD 4RM9A 3BVMA 4HPPA 3VQIA 2JSVX 1F52A 4RNAA 3PO0A 1FFVA 5E6PA 1YD8U 2OOBB 4PYZA 1QOAA 1IGCA 4W9KA 4DDID 1FXIA 4ASWC 3A9KA 3ZUNA 2N7EA 4YTMB 3KYCD 2FUG1 2DX5B 1V5TA 1JRPA 2DYMA 4L1BA 1L0XB 2MJEA 3U7DA 4G50A 3ZNHB 2Z59B 4C00A 2N1VA 1E7VA 2V4LA 2NTSA 2N9XA 4YTNB 2JRIB 2UU7A 1G6JA 1TIFA 4BFRA 2XN9C 1FCCC 4RGNA 3K9PB 3W5UB 3NJTA 3ZIMA 3Q69A 4FN2A 1V1OA 1MHHE 2AQ3B 1UUPA 2LGIA 2BVCA 2A4ZA 2A5UA 1ET6A 1WX9A 3DPDA 3FILB 4MDKE 1JWBD 4HPMB 2KJRA 3IXSA 5AUIA 4ARCA 1TS3A 2KT7A 1VRAB 4F7ZA 1ESFA 5KHOA 2KO3A 2BW2A 4GDKA 2H89B 2M19A 3AV8A 5D3IB 5CTRC 4ZYNA 3VH3B 3SR6A 2WXRA 3QARA 3RUIB 2GLSA 2LI5A 2GB1A 4NJCA 3KLSX 2G9HD 1SGHA 4DXAB 5DPTA 3RNCC 2LGYA 3CIRB 4IWQA 2I1JA 3CSFA 3H1UA 3GS2A 1YQ4B 1MG4A 4I6NB 3L16A 1VDVA 4IC7B 3ZKJC 2W82A 3AE6B 5LLIA 2JU6X 1K50A 2OJRA 1L4DB 3APCA 2KXJA 3BYTB 4M8MA 3BY4B 2L8JA 4DHJB 1KJTA 3TSSA 3ZJTA 3Q3JA 4Q2JA 1WIAA 4MJSA 3DBSA 1AWDA 3W5VB 3EECA 1UWMA 3N9YC 5JZEB 3AMZA 2E6XA 4NJ7A 1TYGB 1YIWA 4XE0A 3DVGX 2GI9A 2ZVOA 1PUTA 3DCGA 4MJSB 1WXSA 4HLEA 5HG2A 2J42A 5BO4B 1WXMA 1D5MC 1NI3A 4EUTA 3AEDB 5JXVA 4KGRA 5CX3A 2JYEA 2D3AA 5H8YE 4A3PA 5CHVC 5TR5A 3VXWA 1VZ8A 2WQYB 4LJOB 4RFBA 4HK2A 4HXDA 3H6NA 3N20C 1LGRA 4XWTA 2LGDA 3AE4B 1ZGUB 2HTME 4MELA 3V6CB 2UWQA 1ZDXA 5J17A 3U52E 3N1ZC 4NZLB 1TZ1A 1F2RC 1Y56A 3R3MA 3KUZA 1J7BA 1WJNA 2K25A 2AWTA 2B3AA 4JLCA 1MG8A 2IGGA 3UGBB 3R7RA 2ZEQA 5MPOA 1QZEA 1I4QA 4MSMB 3H9DA 1HTOA 1EF1A 3LDZE 3QWZB 4ZHPA 3BINA 3U8ZA 1IUEA 4A9AA 1WH3A 5IN7A 2ZPYA 1L4ZB 3A1QB 4EE2A 3MHZA 5GXGB 4D2KA 4NPNA 3O13A 3RZWC 3NVZA 3AULA 2CJNA 2KX3A 5LNK1 2KAJA 2ZW1A 4ZOHC 2K8CA 3U2SC 2FUHB 4WJPA 2PIAA 2NBWB 2V1YA 2Y5CA 5EDSA 2ZJDA 2AQ1B 2O6VA 3APDA 4W9GA 1MVKA 3ENEA 2OHFA 4WJOA 4N6EB 1CQVA 5FR6A 2NS5A 3EGRA 2NBVB 5E6NA 1TKYA 1KLVA 1XLNA 3RNGC 3VR8B 2LEKA 3AE5B 1NVID 1OTRB 1WZ0A 2LASA 2N9LA 4KKIA 4LDTD 3RI7C 2IGHA 5DPSA 1FIQA 4TQ1A 2GBKA 3VTUA 2MBBB 4XWWA 4N9F4 2HJ1A 4E3CA 2DBYA 1V2YA 4EFOA 4B95A 2FNJB 1YNTE 2N4FA 1SIFA 1I4PA 2REXA 3CSTA 4B0EA 2BYEA 1DOIA 4YT0B 2SAKA 1FNUA 1P7EA 4RGTA 4E74A 1TTNA 3HM3A 2PLPA 3P4RB 3HRDD 2KMAA 3BK2A 1P7FA 4JGHB 1RFAA 1R4NB 3SHQA 2I1KA 3VFKA 2W3SA 1DOXA 4MH0E 4P6VF 2MP2A 1E8ZA 4XDCA 1OQYA 2V3NA 3NVWA 4AOFA 2W55A 1ZKHA 4URKA 3ZW3A 1DYQA 2JUOA 1SXTA 3H7SA 4II2B 1FNVA 3OJ3A 4YWGG 3BVGA 2KN4A 2JPHA 1WMHA 2MBQA 4IOIE 2K8HA 2JWZA 3PPAA 1XD3B 3TEZA 2HDEA 3MTNB 4XZ4A 3OAWA 3ZDMC 4GDLA 1Q5WB 2D11A 1C79A 1FM0D 5G5GA 1UNSA 3Q3OC 2WHIA 3OJ4B 2L3ZA 1XEEA 2LZ6A 4AQ7A 4GU2A 3QAQA 3ONSA 4AWJA 2KOXA 1JWAD 1PDXA 4KGSA 3PV1A 1QLBB 3PT2B 1L6VA 3BK1A 2RMMA 1WF9A 1FXAA 1WMHB 4IM3A 1XLQA 2KWVB 5AZFA 1V8CA 3IFWB 2PVOD 1EO6A 4J3OD 3TEXA 2KC2A 3NZ3A 3ZNID 2PVGC 1E6EB 4JE3B 1P98A 2QCZA 1GJZA 4NAMA 1BMLC 1JMLA 1SE9A 4ZRQA 4GIVA 5CHWA 2CHZA 3AE8B 3J9CA 1I4GA 5CHFA 3NUHB 1NBFC 1ZXHA 2AL3A 3ECIA 2GBMA 2KC1A 2JXXA 4IW0A 2O6VB 2C7HA 4BKSA 3FKYA 1L7YA 1AW7A 1WRIA 1I7HA 2WXNA 4MSQB 2L0TA 2KWUB 1WR6E 3Q8AA 3V3XA 3QQ8B 1WZ3A 3R2TA 1YJIA 2LVOA 2L0FA 3L08A 1TS4A 3RMKC 1SJHD 1N62A 1KF6B 2WXJA 3MJWA 3A4RA 3M95A 5H92C 2K6QA 3V6EB 5EE3A 2JWUA 1WGRA 4KVGB 4KZ0A 1FEHA 4DXGA 3LB8C 1OEYA 4ZDVA 1I4HA 1D4BA 2MBEA 2DWQA 2VH1A 3I63C 4NJ6A 3EFCA 2GBNA 2W54A 3C0RB 2V9HA 1OQQA 2KANA 5EE9A 4BBNF 1V97A 3Q3MC 1WGDA 3VRAB 3IVFA 4XC2A 2MEKA 4J6IA 1T0QC 1Q1OA 1LFDA 3AE7B 4ZRPA 1TY2A 3ZNZB 2DNFA 2G4SA 3HK0A 2ZCCA 2MBOA 3ZRFA 3KQ4A 1HEZE 3IBEA 3NG0A 3A33B 1WGYA 2BS3B 2B76B 3VAWA 4BKGA 1F0ZA 3K9OB 2J4XA 1WXVA 2M0AA 4HKQA 2N0SB 3W1SA 5FKAC 5HHDG 1A70A 1P0RA 3TIXA 1XCQL 2NMQA 3WAOA 1RYJA 3PZ7A 2M1MA 3TL5A 2KFJA 4X57B 4WAAA 2QMTA 1N5WA 3IAS1 1M4VA 3KYDD 4WIPA 1AN8A 2VZKD 2JZ3B 1VJKA 4KIKB 2WDVB 3EFUA 3DVNV 4WWOA 3Q8EA 3T9LA 1LM8B 4C4VB 1RFKA 3AU4A 2LUMA 1Q10A 3DBLB 2WU5B 2HTHA 4FJZA 1E8WA 1TGZB 2BYVE 4K3BA 1R4MB 1TT5B 4MGZE 4IDIA 2BQQA 2G3QB 1Q0WB 4F8CB 2RSUA 2NPTA 1FRRA 3H7PB 3ZTCA 1XLPA 2ZNVC 2KFKA 1ZPSA 4AJYB 1V6EA 4FBJB 4KSLC 2L1AA 1J0GA 2AYOB 2I2YA 2KZRA 5BYSA 4FHJA 2KDMA 3NVYA 1GOZA 1JCKB 3IHPC 1WYGA 3AEEB 2KACA 3L54A 1JROA 2LXAA 4LK0M 2FBWB 4RMAA 4K81A 1WM2A 2CHXA 2DYOA 1KLUD 3GOEA 2V3PA 4FJVB 3GB1A 2Z0DB 2L52A 3WAPA 1WX7A 1EWCA 5G55A 4CHKA 4II3B 2JXTA 3A4SC 4B0MA 2CU1A 3ZJVA 3NS1A 2IYDB 3CMMB 4YXDB 3ZVVA 2R2QA 2WXMA 4WH4A 2MCNB 4AS1A 1E9MA 1WYWB 3A9KB 1XF5L 4WWMA 3SU8X 4DHZB 1B1ZA 1WXAA 5I4DA 3O65B 2IJ0A 3BWUD 4WURA 3VUYA 1E8YA 2LXCA 3AEAB 4ICVA 2KX0A 4EEWA 4C80A 1C4PA 3I5JC 2KNBA 1V5OA 3X0WA 1FCLA 3KVFB 4ACFA 4GXBA 1C3TA 1KTKA 2MH7A 3CF6E 4TSSA 3ZGZA 4KDIC 3Q3NC 1CJEA 1FO4A 1ZW7A 1UF0A 2INDC 5IOIA 3QC8B 3TMPB 3X23A 3DQVA 2AX5A 2J52A 2JZPA 4A8XC 2N7JA 1T0RC 1R4MI 1C1YB 2DYBA 1TKGA 1S3SG 1NYRA 2KQ4X 2M4NA 4IM0A 2VZKB 3DHHC 3RYTA 1WGHA 4LNIA 4NY0A 2WX1A 1WXQA 2XEWA 3H7PA 4DWFA 4NQKE 4YL8A 4ANVA 1ZXIA 3AI5A 2KDEB 4WQMA 4KDLB 3SFEB 2EMSA 4LJPB 1IP9A 2D3GA 2WXLA 5L95C 1P9DU 3T3OA 4MM3B 1VZ6A 1KOTA 1L5PA 1GNUA 2ACZB 3N30A 1EM7A 1F1HA 2C7NB 1MHXA 1S1QB 4LNFA 1SSNA 1WSPA 2LJIA 2RR9A 3KUDB 4YSZB 2CHWA 3GZNB 3AEBB 5D2MB 2WDTB 5BMIA 4YSYB 3PRPB 1YMHE 2WXQA 3DHGC 5D7GA 1IGDA 3W2DA 2IO3B 2ONQA 1ISNA 3ZRCA 4L23A 2KTRA 3UIPB 4AP4C 4R3DA 5HKHA 4DQOC 2DAFA 3AE2B 3D32A 1N61A 4W9DA 5LXHA 1SF0A 4FHKA 5HI1A 3FC4A 2BB6A 1LO5D 2M17A 3N32A 3TCAA 1IBXB 4EZKA 4LLGM 1K51A 1YX5B 1MPEA 3RULA 3ETRA 2NBUA 4I6PA 3RT3B 2IO1B 3AN1A 1WWTA 2C9WB 4K3CA 1JWUD 1IYFA 1WR1A 2LHEA 2LMCA 4IUMB 1SB3C 4G11A 3LYYA 1N63A 3GE8C 1E90A 3VVWB 2DZIA 4DHJD 3ZQ4A 1YQBA 4BBNC 4A90A 4K1RB 4JL9A 3OWEB 3RFZB 4TMAB 4W9JA 4RCOA 3W1SC 3M3JA 1YQ3B 2MHJA 3DBRI 2I38A 2N9KA 1UD7A 4ICUA 1I4RA 4L2YA 4AJWA 4HROA 1V9JA 3V05A 2KK8A 1ZE3D 3BVZA 4ZYSA 2WP9B 3DWGC 2NPTB 4RF0A 3VUXA 1UBIA 5JH5C 1EUVB 3NHEB 1EU3A 5AUKA 1GUAB 2INCC 1NI2A 1WRDB 3RZFA 4C7YA 1ZUD2 5HFYA 2QEJC 2ZNVB 3V61A 4O1NA 4WAFA 1RWSA 3P2BA 1RLFA 3AU5A 5AZGA 1D5XC 4EZJA 2PJHA 3B1LX 4C7ZA 4OVUA 3MP9A 2J0KA 1JALA 4I6LB 1I42A 3JSVB 1HA5A 2NTTA 2JYTA 2KMMA 2O6VD 2GRIA 4CO7A 2V3SA 3URYA 4EZLA 4GN1A 4EOYA 4PS7A 1HZ6A 4MH8A 4TV3A 3ALBA 1H4RA 2KFKB 2N9PC 3M63B 1R4NI 1HTQA 3NOBA 2VH2A 1SJED 1ET9A 4PS8A 4ZHOA 1XLOA 2JY6A 3UQBA 2KDIA 4A55A 1NYQA 1DGJA 1L0YB 1UH6A 2BYFA 2LD9A 2N1WA 3KUCB 1UELA 3VDZA 2J53A 1GG3A 2FCMA 4A20A 3SDLC 3BIID 2JRHA 4OHJA 1L6UA 2NCNA 2HJ8A 2KVRA 2JZZA 4TQ0A 4M0WB 1MFWA 2MLBA 2ZW0A 2IPKD 1Z5SB 4MT5A 1TJEA 2MJ3A 1BXTA 2IBIB 2CKHB 1OFFA 4M00A 2M0XA 2BS2B 1N60A 3FAHA 4ANWA 3AXCA 2KJ6A 3PSEB 1T0YA 2O2VA 5L83A 3R7QA 1E10A 1ZDVA 1M94A 2KYWA 3GP7A 3WAMA 1RM6C 4LTUA 2ZCBA 2R2OA 3B08A 3KWVA 5KHQA 2YEPB 2MX2A 2J0JA 1BT0A 2KD0A 4IKGA 5JHBA 3U4EG 2GBJA 2LUEA 5IKCM 2AEHA 4NAWA 2BGFA 1AYFA 3P4PB 1SEBD 4JWSC 5DPWA 4USAA 2BTEA 3DVGY 1YN3A 2DZJA 4QAYA 3RNFC 4W9CA 2FCSA 3BYYB 3SFDB 4FXCA 2Y3AA 2QC8A 1QOFA 1WI0A 4BVUC 2WXOA 3PHXB 4YTPB 3VHTC 2K8BA 1GAQB 3PLVA 2PMVA 4HJKA 4DBGA 1F2RI 1Y8RC 4HJGE 1FRDA 5FK9C 5C2TB 1TZOA 2YEPF 4RM8A 4HCPB 2KWDA 3ZNGC 2RDBC 2QILA 3ZTDA 1KM7A 4IM2A 2W3RA 3IT6B 4HEA1 1JQ4A 2KMCA 4WJQA 1YN5A 2LRUA 3Q8BA 5J18A 4KX6B 2ASQA 3PHWB 2JT4B 3PRMB 4M0WA 1D5ZC 2RGFA 2WXIA 4FA6A 4GGQA 2KLCA 2V0GA 4OZCA 3MFGA 3PRZA 2KVZA 3DDCB 3N1YC 1MJDA 3NZSA 3HVDA 2CU3A 4OW0A 4M01A 1DOYA 1FXTB 3LXFA 5TSSA 3TEYA 4JX1C 4RGOS 3ABVB 1SE2A 1B9RA 2KJHB 1N5XA 2WWZA 3I57A 4B9KA 2IO2B 3RCZA 4XYCA 2K9XA 3PLUA 3PREA 5BMGA 2D3BA 1JRUA 3BZDB 3JYUA 4W9IA 2PE9A 1AARA 2O2VB 1HE8A 2IO0B 1QT9A 4G3XB 2RDHA 3MC9A 5D94A 2KTRB 4MEMA 2AL6A 4JIOU 3FILA 4XDDA 1T5XD 3ZDTA 2BWES 3PZDA 4W9HA 5C23A 3W1YA 2QIEB 4LNKA 1GC6A 3P4SB 5DCNA 3APFA
chains in the Genus database with same CATH topology
4KZCA 3UINB 1V2YA 4EFOA 2KN5A 4IM0A 2Z0EB 3NZUA 4B95A 2FNJB 3QX1A 3RYTA 3HIZA 3QJZA 1WGHA 2N4FA 3WA0A 1J8CA 1SIFA 1WE6A 2FCNA 2BKFA 1CMXB 2REXA 4K7WA 1WJ6A 3CSTA 3M62B 3V62A 4NY0A 2WX1A 2BYEA 2G4DB 2EMTA 2XEWA 3H7PA 4DWFA 3B0AA 4NQKE 4YL8A 4E74A 4ANVA 2KDFB 3AI5A 1TTNA 3HM3A 4MGYE 5DPRA 1U4AA 2KMAA 2KDEB 1TBEA 4KV2A 2MP2B 4JGHB 2KWCA 1RFAA 4KDLB 2N7DA 4MGIE 3S2AA 2I1KA 3SHQA 3VFKA 2EMSA 2G45B 4LJPB 4MH0E 1IP9A 4GOCA 2D3GA 3L13A 2KKCA 2MWSB 2W9NA 4B6WA 2MP2A 5L95C 2GOWA 1P9DU 4HDOA 1E8ZA 4CYEA 5D6JB 1OQYA 1KOTA 4ANXA 1WFYA 4AOFA 3QA8A 1ZKHA 1GNUA 4PS3A 4ZRIA 4URKA 4DHZE 3N30A 3ZW3A 2C7NB 1S1QB 2JUOA 3H7SA 4GDKB 2NR2A 3PS6A 2D10A 4II2B 3JW0X 1A5RA 1L2NA 2RR9A 3OJ3A 3KUDB 2CHWA 4BKSD 4W9LA 2MBHA 3MHSD 2DZMA 2EKEC 1WMHA 2JPHA 2MBQA 2WDTB 5D2MB 3PTFC 2K8HA 1RAXA 4ZRJA 4IWPA 3WANA 3VTVA 2JWZA 2RPQA 3PPAA 3PRPB 1XD3B 3I3TB 1WX8A 2LGXA 3MTNB 4HWIB 4XZ4A 3OAWA 4BOZB 3ZDMC 4GDLA 5D7GA 1Q5WB 2GBRA 2IO3B 1ISNA 1I35A 2D11A 5C1ZA 1LQBA 4DDGD 2UYZB 2JVCA 3ZRCA 2K1FA 3SD5A 1PQSA 3OJ4B 2L3ZA 2NVUI 2DHZA 2KTRA 2LZ6A 3UIPB 4AP4C 1F9JA 5HKHA 3NY5A 4FJYA 2DAFA 4GU2A 3T8MA 3D32A 3QAQA 2LWPA 1J19A 3ONSA 4W9DA 4AWJA 2KOXA 4GMVA 4M8NA 3DOWA 3QCAA 5LXHA 3PV1A 3VTWA 4FHKA 2M8SA 4HVBA 2J7QB 2M17A 3N32A 3PT2B 2VRRB 2IY1B 3TCAA 4EZKA 3UQAA 1YX5B 2YVCA 4MGKE 1WF9A 1P1AA 1V49A 2MW5A 2CS4A 3RULA 3QK0A 1WY8A 1WMHB 2NBUA 4I6PA 3RT3B 2IO1B 4IM3A 1E7UA 2KWVB 2MQJA 5AZFA 1WJ4A 2CR5A 4GSWA 2C9WB 2IZVB 3IFWB 1IYFA 1EO6A 1WR1A 2L05A 3KH0A 4IUMB 4G11A 2KC2A 3ZNID 3A9JB 1P98A 1UGMA 1GJZA 3QHTA 1SE9A 1E90A 3ML8A 4GIVA 4TUUA 2DAJA 5CHWA 2CHZA 3VVWB 2DZIA 1E5WA 5CHFA 4DHJD 4DK5A 3GZNI 1NBFC 1YQBA 4BBNC 4FULA 4BKTA 2AL3A 3JVZX 4K1RB 4JL9A 1D3ZA 4G0NB 2GMIC 4HDQA 3ECIA 2GBMA 2KC1A 2JXXA 4W9JA 4IWOA 4IW0A 3W1SC 5LXIB 2O6VB 4RM9A 3M3JA 3PVLA 2C7HA 2K6DB 4BKSA 1LXDA 3DBRI 3LJ3A 3VQIA 5G2NA 1UD7A 1L7YA 4ICUA 5E6OA 5E6PA 1YD8U 2OOBB 4PYZA 4AJWA 5IA7A 2XK5B 3OLMD 4MSQB 1V9JA 4EKUA 2L0TA 4KIKA 4W9KA 2KK8A 2KWUB 1WR6E 1RRBA 4DDID 4WWPA 2C7MB 2NPTB 3QQ8B 2XK5A 3VUXA 1UBQA 1WZ3A 2N9EB 1UBIA 4ASWC 5JH5C 3A9KA 1EUVB 3ZUNA 2N7EA 3NHEB 2LVOA 3KYCD 4AUQC 1GUAB 2L0FA 1NI2A 3L08A 1WRDB 3RZFA 1YJ1A 2DX5B 3NS8A 1V5TA 4XX5A 4GDLB 2ZNVB 2DYMA 3V61A 3L10B 4ANUA 2FIFA 2DENB 3P2BA 3UIOB 1RLFA 3AU5A 3L17A 3U7DA 5AZGA 3MJWA 2L00B 1WJUA 2MA9B 4G50A 3ZNHB 2Z59B 2N1VA 4EZJA 1E7VA 2QHOA 3A4RA 2V4LA 2PJHA 3B1LX 2N9XA 3M95A 2JRIB 3HHMA 4OVUA 2K6QA 1G6JA 2J0KA 2BF8B 3V6EB 4BFRA 3Q3FA 4I6LB 1WGRA 4KVGB 1I42A 1WM3A 4KZ0A 3JSVB 4NQLB 4W9FA 1OEYA 3K9PB 4ZDVA 2MBEA 3ZIMA 1OGWA 2O6VD 4NJ6A 4FN2A 2GBNA 4A3OA 3C0RB 4CO7A 2V3SA 3RD2A 2A4ZA 3U30A 2A5UA 1WX9A 3DPDA 5AZHA 4MDKE 4EZLA 1H8CA 4GN1A 4HPMB 2LRWA 2KJRA 2KANA 4EOYA 4PS7A 5IAAC 3A9JA 3JSVA 4BBNF 4FADA 2C60A 4TV3A 3WIMA 1WGDA 3ALBA 1V86A 3IVFA 4XC2A 4F7ZA 1H4RA 1UZXB 2KFKB 4J6IA 5KHOA 2PE6B 2KO3A 2N9PC 3M63B 4GDKA 1Q1OA 4MM3A 1LFDA 1R4NI 3NOBA 3L0WB 3ZNZB 5CTRC 3DBHI 2G4SA 2HE7A 3HK0A 4PS8A 2ZCCA 4WQOB 2MBOA 4ZYNA 3VH3B 3UQBA 2JY6A 1EF5A 3QARA 2KDIA 2XBBC 3ZRFA 4HCNB 3RUIB 2LI5A 3IBEA 1Z2MA 1SGHA 1UH6A 2BYFA 3A33B 2LD9A 3KW5B 4DXAB 2LVPA 5DPTA 2N1WA 3KUCB 1WGYA 2LGYA 1UELA 3VAWA 3UF8A 3VDZA 4IWQA 2L7RA 2I1JA 4BKGA 1GG3A 3K9OB 2FCMA 3CSFA 4LCDE 4A20A 3H1UA 3SDLC 1E8XA 2JRHA 1WXVA 4I6NB 2NCNA 2DZKA 2HJ8A 2KVRA 3L16A 4IC7B 3ZKJC 2JZZA 3W1SA 5LLIA 4TQ0A 1P0RA 4HPLB 3TIXA 3WAOA 4M0WB 2MLBA 2OJRA 1WGGA 4JQWC 3APCA 3QIJA 1Z5SB 2KXJA 2M1MA 5GMVA 2FCQA 2KTFA 1XQQA 2IBIB 2CKHB 4M8MA 3TL5A 3BY4B 4LDTB 2KFJA 4X57B 2L8JA 4DHJB 2M0XA 1KJTA 4WAAA 2MSED 3Q3JA 2KQSA 3KYDD 1WIAA 3ML9A 4ANWA 3AXCA 4MJSA 3WALA 5AEKB 2KJ6A 3DBSA 2JZ3B 1T0YA 3PSEB 2O2VA 3EECA 5L83A 4KIKB 3R7QA 5JZEB 5JHAA 1M94A 3HM6X 3WAMA 3DBLI 3EFUA 4NJ7A 3DVNV 4P7IA 4WWOA 4K7SA 2ZCBA 2L76A 3T9LA 1YIWA 1LM8B 2R2OA 3B08A 2ZZPB 3DVGX 3AU4A 2ZVOA 5KHQA 3DCGA 2HTHA 2MX2A 4MJSB 1WE7A 1WXSA 2J0JA 1BT0A 2K39A 2KDBA 4FJZA 2KD0A 4HLEA 5JHBA 1E8WA 1V80A 1TGZB 1WXMA 5BO4B 2BYVE 2GBJA 2LUEA 2KQ7A 3VUWA 4E71A 2AEHA 4EUTA 4NAWA 4MGZE 2G3QB 2BGFA 5CX3A 1Q0WB 4F8CB 2RSUA 2NPTA 3H7PB 1P3QU 1OEYJ 4A3PA 2YLMA 2LVQA 5CHVC 3ZTCA 5TR5A 5DPWA 2ZNVC 3VXWA 4LJOB 2KFKA 3DVGY 4AJYB 4HK2A 1V6EA 4HXDA 3H6NA 2DZJA 4FBJB 4W9CA 2WYQA 2FCSA 4KSLC 2LGDA 1J0GA 2AYOB 2HD5B 2KZRA 4FHJA 1WI0A 1ZGUB 4ZRKA 4BVUC 3R66C 4MELA 3V6CB 2UWQA 1GC7A 2JF5A 3PHXB 1K8RB 3IHPC 5J17A 2IY0B 3VHTC 3L54A 2K8BA 2LXAA 3PLVA 4HJKA 2PEAA 4DBGA 4RMAA 1Y8RC 4K81A 1WM2A 2CHXA 1TZ1A 1VCBA 2LJ5A 2KHWB 3R3MA 2DYOA 3KUZA 1WJNA 3GOEA 2K25A 2AWTA 2B3AA 2Y5BB 4JLCA 1MG8A 4FJVB 3VH4B 4RM8A 2Z0DB 2ZPNA 4HCPB 3ZNGC 2FAZA 3UGBB 1WX7A 3WAPA 3R7RA 2ZEQA 5G55A 3TJPA 4CHKA 5J2RA 4II3B 3A4SC 1QZEA 2CU1A 2BPSA 3ZTDA 4MSMB 3H9DA 1KM7A 1EF1A 2IYDB 4IM2A 3CMMB 2BKRB 3ZO5B 3LDZE 3ZVVA 3QWZB 2KMCA 2R2QA 3BINA 2D2QA 3A1QA 4NAWB 4WJQA 2MCNB 3U8ZA 2LRUA 1XT9B 5J18A 1WH3A 1WYWB 3A9KB 2ZVNA 4BOSC 2ZPYA 2ASQA 3PHWB 2JT4B 3A1QB 1V81A 4NNJB 3PRMB 2RGFA 4OVVA 3SU8X 4DHZB 4FA6A 1WXAA 3O65B 4GB9A 4NPNA 2WX0A 2KLCA 4GGQA 3V60A 3ZLZA 3RZWC 3VUYA 1E8YA 3PRZA 2LXCA 4TKNA 3AULA 3DDCB 1VD2A 4ICVA 3NZSA 2KX0A 2KX3A 4IG7B 3N3KB 4EEWA 2K8CA 2KNBA 1V5OA 1NDDA 1FXTB 2FUHB 2D07B 3X0WA 3KVFB 4GXBA 4WJPA 1C3TA 2NBWB 2V1YA 5EDSA 4W9EA 2ZJDA 2J0MA 3CF6E 2O6VA 3APDA 2KJHB 4W9GA 3ENEA 2WWZA 1YX6B 4B9KA 2IO2B 4KDIC 3PGEA 4WJOA 1IPGA 3EHVA 5FR6A 2PPHA 3RCZA 1ZW7A 2BWFA 2NS5A 3TBLD 3PLUA 4KSKC 2NBVB 3QC8B 3PREA 5E6NA 3TMPB 3X23A 3DQVA 1KLVA 4PYUA 1X1MA 1JRUA 3EC8A 4K7UA 3JYUA 4W9IA 2PE9A 1AARA 2O2VB 1HE8A 4WWNA 2RD0A 2IO0B 3DVNU 4G3XB 4F1SA 5D94A 2KTRB 4MEMA 1OTRB 2FIDA 1R4MI 3IG3A 2AL6A 4JIOU 1C1YB 1WZ0A 2DYBA 2LASA 3ZDTA 4LDTD 2BWES 2C5LC 1S3SG 3PZDA 4W9HA 5DPSA 5C23A 3W1YA 2KLGA 4FLHA 1GC6A 2GBKA 4TQ1A 3VTUA 2MBBB 4WJNA 5DCNA 2MRPA 3APFA 2M4NA 4N9F4 4E3CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KZC A;  3UIN B;  1V2Y A;  4EFO A;  2KN5 A;  4IM0 A;  2Z0E B;  3NZU A;  4B95 A;  2FNJ B;  3QX1 A;  3RYT A;  3HIZ A;  3QJZ A;  1WGH A;  2N4F A;  3WA0 A;  1J8C A;  1SIF A;  1WE6 A;  2FCN A;  2BKF A;  1CMX B;  2REX A;  4K7W A;  1WJ6 A;  3CST A;  3M62 B;  3V62 A;  4NY0 A;  2WX1 A;  2BYE A;  2G4D B;  2EMT A;  2XEW A;  3H7P A;  4DWF A;  3B0A A;  4NQK E;  4YL8 A;  4E74 A;  4ANV A;  2KDF B;  3AI5 A;  1TTN A;  3HM3 A;  4MGY E;  5DPR A;  1U4A A;  2KMA A;  2KDE B;  1TBE A;  4KV2 A;  2MP2 B;  4JGH B;  2KWC A;  1RFA A;  4KDL B;  2N7D A;  4MGI E;  3S2A A;  2I1K A;  3SHQ A;  3VFK A;  2EMS A;  2G45 B;  4LJP B;  4MH0 E;  1IP9 A;  4GOC A;  2D3G A;  3L13 A;  2KKC A;  2MWS B;  2W9N A;  4B6W A;  2MP2 A;  5L95 C;  2GOW A;  1P9D U;  4HDO A;  1E8Z A;  4CYE A;  5D6J B;  1OQY A;  1KOT A;  4ANX A;  1WFY A;  4AOF A;  3QA8 A;  1ZKH A;  1GNU A;  4PS3 A;  4ZRI A;  4URK A;  4DHZ E;  3N30 A;  3ZW3 A;  2C7N B;  1S1Q B;  2JUO A;  3H7S A;  4GDK B;  2NR2 A;  3PS6 A;  2D10 A;  4II2 B;  3JW0 X;  1A5R A;  1L2N A;  2RR9 A;  3OJ3 A;  3KUD B;  2CHW A;  4BKS D;  4W9L A;  2MBH A;  3MHS D;  2DZM A;  2EKE C;  1WMH A;  2JPH A;  2MBQ A;  2WDT B;  5D2M B;  3PTF C;  2K8H A;  1RAX A;  4ZRJ A;  4IWP A;  3WAN A;  3VTV A;  2JWZ A;  2RPQ A;  3PPA A;  3PRP B;  1XD3 B;  3I3T B;  1WX8 A;  2LGX A;  3MTN B;  4HWI B;  4XZ4 A;  3OAW A;  4BOZ B;  3ZDM C;  4GDL A;  5D7G A;  1Q5W B;  2GBR A;  2IO3 B;  1ISN A;  1I35 A;  2D11 A;  5C1Z A;  1LQB A;  4DDG D;  2UYZ B;  2JVC A;  3ZRC A;  2K1F A;  3SD5 A;  1PQS A;  3OJ4 B;  2L3Z A;  2NVU I;  2DHZ A;  2KTR A;  2LZ6 A;  3UIP B;  4AP4 C;  1F9J A;  5HKH A;  3NY5 A;  4FJY A;  2DAF A;  4GU2 A;  3T8M A;  3D32 A;  3QAQ A;  2LWP A;  1J19 A;  3ONS A;  4W9D A;  4AWJ A;  2KOX A;  4GMV A;  4M8N A;  3DOW A;  3QCA A;  5LXH A;  3PV1 A;  3VTW A;  4FHK A;  2M8S A;  4HVB A;  2J7Q B;  2M17 A;  3N32 A;  3PT2 B;  2VRR B;  2IY1 B;  3TCA A;  4EZK A;  3UQA A;  1YX5 B;  2YVC A;  4MGK E;  1WF9 A;  1P1A A;  1V49 A;  2MW5 A;  2CS4 A;  3RUL A;  3QK0 A;  1WY8 A;  1WMH B;  2NBU A;  4I6P A;  3RT3 B;  2IO1 B;  4IM3 A;  1E7U A;  2KWV B;  2MQJ A;  5AZF A;  1WJ4 A;  2CR5 A;  4GSW A;  2C9W B;  2IZV B;  3IFW B;  1IYF A;  1EO6 A;  1WR1 A;  2L05 A;  3KH0 A;  4IUM B;  4G11 A;  2KC2 A;  3ZNI D;  3A9J B;  1P98 A;  1UGM A;  1GJZ A;  3QHT A;  1SE9 A;  1E90 A;  3ML8 A;  4GIV A;  4TUU A;  2DAJ A;  5CHW A;  2CHZ A;  3VVW B;  2DZI A;  1E5W A;  5CHF A;  4DHJ D;  4DK5 A;  3GZN I;  1NBF C;  1YQB A;  4BBN C;  4FUL A;  4BKT A;  2AL3 A;  3JVZ X;  4K1R B;  4JL9 A;  1D3Z A;  4G0N B;  2GMI C;  4HDQ A;  3ECI A;  2GBM A;  2KC1 A;  2JXX A;  4W9J A;  4IWO A;  4IW0 A;  3W1S C;  5LXI B;  2O6V B;  4RM9 A;  3M3J A;  3PVL A;  2C7H A;  2K6D B;  4BKS A;  1LXD A;  3DBR I;  3LJ3 A;  3VQI A;  5G2N A;  1UD7 A;  1L7Y A;  4ICU A;  5E6O A;  5E6P A;  1YD8 U;  2OOB B;  4PYZ A;  4AJW A;  5IA7 A;  2XK5 B;  3OLM D;  4MSQ B;  1V9J A;  4EKU A;  2L0T A;  4KIK A;  4W9K A;  2KK8 A;  2KWU B;  1WR6 E;  1RRB A;  4DDI D;  4WWP A;  2C7M B;  2NPT B;  3QQ8 B;  2XK5 A;  3VUX A;  1UBQ A;  1WZ3 A;  2N9E B;  1UBI A;  4ASW C;  5JH5 C;  3A9K A;  1EUV B;  3ZUN A;  2N7E A;  3NHE B;  2LVO A;  3KYC D;  4AUQ C;  1GUA B;  2L0F A;  1NI2 A;  3L08 A;  1WRD B;  3RZF A;  1YJ1 A;  2DX5 B;  3NS8 A;  1V5T A;  4XX5 A;  4GDL B;  2ZNV B;  2DYM A;  3V61 A;  3L10 B;  4ANU A;  2FIF A;  2DEN B;  3P2B A;  3UIO B;  1RLF A;  3AU5 A;  3L17 A;  3U7D A;  5AZG A;  3MJW A;  2L00 B;  1WJU A;  2MA9 B;  4G50 A;  3ZNH B;  2Z59 B;  2N1V A;  4EZJ A;  1E7V A;  2QHO A;  3A4R A;  2V4L A;  2PJH A;  3B1L X;  2N9X A;  3M95 A;  2JRI B;  3HHM A;  4OVU A;  2K6Q A;  1G6J A;  2J0K A;  2BF8 B;  3V6E B;  4BFR A;  3Q3F A;  4I6L B;  1WGR A;  4KVG B;  1I42 A;  1WM3 A;  4KZ0 A;  3JSV B;  4NQL B;  4W9F A;  1OEY A;  3K9P B;  4ZDV A;  2MBE A;  3ZIM A;  1OGW A;  2O6V D;  4NJ6 A;  4FN2 A;  2GBN A;  4A3O A;  3C0R B;  4CO7 A;  2V3S A;  3RD2 A;  2A4Z A;  3U30 A;  2A5U A;  1WX9 A;  3DPD A;  5AZH A;  4MDK E;  4EZL A;  1H8C A;  4GN1 A;  4HPM B;  2LRW A;  2KJR A;  2KAN A;  4EOY A;  4PS7 A;  5IAA C;  3A9J A;  3JSV A;  4BBN F;  4FAD A;  2C60 A;  4TV3 A;  3WIM A;  1WGD A;  3ALB A;  1V86 A;  3IVF A;  4XC2 A;  4F7Z A;  1H4R A;  1UZX B;  2KFK B;  4J6I A;  5KHO A;  2PE6 B;  2KO3 A;  2N9P C;  3M63 B;  4GDK A;  1Q1O A;  4MM3 A;  1LFD A;  1R4N I;  3NOB A;  3L0W B;  3ZNZ B;  5CTR C;  3DBH I;  2G4S A;  2HE7 A;  3HK0 A;  4PS8 A;  2ZCC A;  4WQO B;  2MBO A;  4ZYN A;  3VH3 B;  3UQB A;  2JY6 A;  1EF5 A;  3QAR A;  2KDI A;  2XBB C;  3ZRF A;  4HCN B;  3RUI B;  2LI5 A;  3IBE A;  1Z2M A;  1SGH A;  1UH6 A;  2BYF A;  3A33 B;  2LD9 A;  3KW5 B;  4DXA B;  2LVP A;  5DPT A;  2N1W A;  3KUC B;  1WGY A;  2LGY A;  1UEL A;  3VAW A;  3UF8 A;  3VDZ A;  4IWQ A;  2L7R A;  2I1J A;  4BKG A;  1GG3 A;  3K9O B;  2FCM A;  3CSF A;  4LCD E;  4A20 A;  3H1U A;  3SDL C;  1E8X A;  2JRH A;  1WXV A;  4I6N B;  2NCN A;  2DZK A;  2HJ8 A;  2KVR A;  3L16 A;  4IC7 B;  3ZKJ C;  2JZZ A;  3W1S A;  5LLI A;  4TQ0 A;  1P0R A;  4HPL B;  3TIX A;  3WAO A;  4M0W B;  2MLB A;  2OJR A;  1WGG A;  4JQW C;  3APC A;  3QIJ A;  1Z5S B;  2KXJ A;  2M1M A;  5GMV A;  2FCQ A;  2KTF A;  1XQQ A;  2IBI B;  2CKH B;  4M8M A;  3TL5 A;  3BY4 B;  4LDT B;  2KFJ A;  4X57 B;  2L8J A;  4DHJ B;  2M0X A;  1KJT A;  4WAA A;  2MSE D;  3Q3J A;  2KQS A;  3KYD D;  1WIA A;  3ML9 A;  4ANW A;  3AXC A;  4MJS A;  3WAL A;  5AEK B;  2KJ6 A;  3DBS A;  2JZ3 B;  1T0Y A;  3PSE B;  2O2V A;  3EEC A;  5L83 A;  4KIK B;  3R7Q A;  5JZE B;  5JHA A;  1M94 A;  3HM6 X;  3WAM A;  3DBL I;  3EFU A;  4NJ7 A;  3DVN V;  4P7I A;  4WWO A;  4K7S A;  2ZCB A;  2L76 A;  3T9L A;  1YIW A;  1LM8 B;  2R2O A;  3B08 A;  2ZZP B;  3DVG X;  3AU4 A;  2ZVO A;  5KHQ A;  3DCG A;  2HTH A;  2MX2 A;  4MJS B;  1WE7 A;  1WXS A;  2J0J A;  1BT0 A;  2K39 A;  2KDB A;  4FJZ A;  2KD0 A;  4HLE A;  5JHB A;  1E8W A;  1V80 A;  1TGZ B;  1WXM A;  5BO4 B;  2BYV E;  2GBJ A;  2LUE A;  2KQ7 A;  3VUW A;  4E71 A;  2AEH A;  4EUT A;  4NAW A;  4MGZ E;  2G3Q B;  2BGF A;  5CX3 A;  1Q0W B;  4F8C B;  2RSU A;  2NPT A;  3H7P B;  1P3Q U;  1OEY J;  4A3P A;  2YLM A;  2LVQ A;  5CHV C;  3ZTC A;  5TR5 A;  5DPW A;  2ZNV C;  3VXW A;  4LJO B;  2KFK A;  3DVG Y;  4AJY B;  4HK2 A;  1V6E A;  4HXD A;  3H6N A;  2DZJ A;  4FBJ B;  4W9C A;  2WYQ A;  2FCS A;  4KSL C;  2LGD A;  1J0G A;  2AYO B;  2HD5 B;  2KZR A;  4FHJ A;  1WI0 A;  1ZGU B;  4ZRK A;  4BVU C;  3R66 C;  4MEL A;  3V6C B;  2UWQ A;  1GC7 A;  2JF5 A;  3PHX B;  1K8R B;  3IHP C;  5J17 A;  2IY0 B;  3VHT C;  3L54 A;  2K8B A;  2LXA A;  3PLV A;  4HJK A;  2PEA A;  4DBG A;  4RMA A;  1Y8R C;  4K81 A;  1WM2 A;  2CHX A;  1TZ1 A;  1VCB A;  2LJ5 A;  2KHW B;  3R3M A;  2DYO A;  3KUZ A;  1WJN A;  3GOE A;  2K25 A;  2AWT A;  2B3A A;  2Y5B B;  4JLC A;  1MG8 A;  4FJV B;  3VH4 B;  4RM8 A;  2Z0D B;  2ZPN A;  4HCP B;  3ZNG C;  2FAZ A;  3UGB B;  1WX7 A;  3WAP A;  3R7R A;  2ZEQ A;  5G55 A;  3TJP A;  4CHK A;  5J2R A;  4II3 B;  3A4S C;  1QZE A;  2CU1 A;  2BPS A;  3ZTD A;  4MSM B;  3H9D A;  1KM7 A;  1EF1 A;  2IYD B;  4IM2 A;  3CMM B;  2BKR B;  3ZO5 B;  3LDZ E;  3ZVV A;  3QWZ B;  2KMC A;  2R2Q A;  3BIN A;  2D2Q A;  3A1Q A;  4NAW B;  4WJQ A;  2MCN B;  3U8Z A;  2LRU A;  1XT9 B;  5J18 A;  1WH3 A;  1WYW B;  3A9K B;  2ZVN A;  4BOS C;  2ZPY A;  2ASQ A;  3PHW B;  2JT4 B;  3A1Q B;  1V81 A;  4NNJ B;  3PRM B;  2RGF A;  4OVV A;  3SU8 X;  4DHZ B;  4FA6 A;  1WXA A;  3O65 B;  4GB9 A;  4NPN A;  2WX0 A;  2KLC A;  4GGQ A;  3V60 A;  3ZLZ A;  3RZW C;  3VUY A;  1E8Y A;  3PRZ A;  2LXC A;  4TKN A;  3AUL A;  3DDC B;  1VD2 A;  4ICV A;  3NZS A;  2KX0 A;  2KX3 A;  4IG7 B;  3N3K B;  4EEW A;  2K8C A;  2KNB A;  1V5O A;  1NDD A;  1FXT B;  2FUH B;  2D07 B;  3X0W A;  3KVF B;  4GXB A;  4WJP A;  1C3T A;  2NBW B;  2V1Y A;  5EDS A;  4W9E A;  2ZJD A;  2J0M A;  3CF6 E;  2O6V A;  3APD A;  2KJH B;  4W9G A;  3ENE A;  2WWZ A;  1YX6 B;  4B9K A;  2IO2 B;  4KDI C;  3PGE A;  4WJO A;  1IPG A;  3EHV A;  5FR6 A;  2PPH A;  3RCZ A;  1ZW7 A;  2BWF A;  2NS5 A;  3TBL D;  3PLU A;  4KSK C;  2NBV B;  3QC8 B;  3PRE A;  5E6N A;  3TMP B;  3X23 A;  3DQV A;  1KLV A;  4PYU A;  1X1M A;  1JRU A;  3EC8 A;  4K7U A;  3JYU A;  4W9I A;  2PE9 A;  1AAR A;  2O2V B;  1HE8 A;  4WWN A;  2RD0 A;  2IO0 B;  3DVN U;  4G3X B;  4F1S A;  5D94 A;  2KTR B;  4MEM A;  1OTR B;  2FID A;  1R4M I;  3IG3 A;  2AL6 A;  4JIO U;  1C1Y B;  1WZ0 A;  2DYB A;  2LAS A;  3ZDT A;  4LDT D;  2BWE S;  2C5L C;  1S3S G;  3PZD A;  4W9H A;  5DPS A;  5C23 A;  3W1Y A;  2KLG A;  4FLH A;  1GC6 A;  2GBK A;  4TQ1 A;  3VTU A;  2MBB B;  4WJN A;  5DCN A;  2MRP A;  3APF A;  2M4N A;  4N9F 4;  4E3C A; 
#chains in the Genus database with same CATH topology
 2RDG A;  3UIN B;  2KN5 A;  1GB4 A;  3NZU A;  3EUB 2;  3QX1 A;  2WXF A;  1J8C A;  1WJ6 A;  2X38 A;  1SE3 A;  2EMT A;  4US9 A;  3B0A A;  5DPR A;  1K52 A;  4S17 A;  3MC8 A;  2E3T A;  2Z8L A;  2KWC A;  1HZ5 A;  2N7D A;  4GOC A;  2JQR B;  2MWS B;  2W9N A;  1C4A A;  4HDO A;  4CYE A;  5D6J B;  2DLB A;  4ANX A;  1UWX A;  1I4X A;  3TUO A;  4GDK B;  2NR2 A;  2L32 A;  3PS6 A;  3B2G A;  3JW0 X;  1A5R A;  1L2N A;  3C8Y A;  4W9L A;  2MBH A;  3MHS D;  2DZM A;  2EKE C;  3ZXV A;  2X8X X;  2MJD A;  3PTF C;  1RAX A;  4IWP A;  1PYW D;  3WAN A;  3VTV A;  3I3T B;  1QOG A;  1LQB A;  1FPY A;  4DDG D;  4RF1 A;  1BUI C;  2UYZ B;  2JVC A;  2K1F A;  1PQS A;  1FNW A;  3B9J A;  1F9J A;  4FJY A;  2IGD A;  1J19 A;  4M8N A;  3DOW A;  3QCA A;  3ZXR A;  1JW9 D;  2J7Q B;  1YOV B;  1PGB A;  3HUI A;  3UQA A;  2YVC A;  4MGK E;  1V49 A;  2MW5 A;  3QK0 A;  3VR9 B;  1NEK B;  2MQJ A;  2D3C A;  3HVZ A;  4PT5 A;  1WJ4 A;  1VR9 A;  1E7P B;  3MC0 B;  3L4P A;  3R8B A;  2L05 A;  1HXY D;  1TS5 A;  1ZOY B;  3KH0 A;  3AEF B;  4YSX B;  1UGM A;  4TUU A;  3ML8 A;  5BYQ A;  1XO3 A;  3AEC B;  2QDF A;  1E5W A;  4N58 A;  4DK5 A;  3GZN I;  1CK1 A;  2PW9 A;  5LXI B;  3PVL A;  2K6D B;  3IAM 1;  4RGM A;  1LXD A;  3LJ3 A;  5G2N A;  5E6O A;  2CJO A;  5IA7 A;  2XK5 B;  3OLM D;  4EKU A;  4KIK A;  1SBB B;  2LHD A;  3MJ5 A;  1RRB A;  2ICI A;  4WWP A;  2C7M B;  5E6J A;  2XK5 A;  3Q2A C;  1C77 A;  1UBQ A;  1JWS D;  2N9E B;  3ZJU A;  2Q5W D;  3PZ8 A;  4AUQ C;  1YJ1 A;  3NS8 A;  2WXH A;  4XX5 A;  1QIL A;  4GDL B;  3L10 B;  3CWI A;  4ANU A;  3P4Q B;  2FIF A;  2DEN B;  3UIO B;  1V1P A;  3L17 A;  3I9V 1;  2L00 B;  1WJU A;  2MA9 B;  1J7A A;  2QHO A;  2K5P A;  3HHM A;  4OVZ A;  1QKZ A;  2BF8 B;  5C3J B;  1EU4 A;  3Q3F A;  2R61 A;  1WM3 A;  4NQL B;  4W9F A;  4LNN A;  2IDY A;  1OGW A;  2Y5P A;  4A3O A;  3RD2 A;  3U30 A;  5AZH A;  1H8C A;  2LRW A;  4MAC A;  5IAA C;  4H2A A;  3A9J A;  3JSV A;  4FAD A;  2C60 A;  3WIM A;  4JPS A;  1V86 A;  1YJJ A;  2BBC A;  4C4V A;  1UZX B;  1ZP0 B;  2PE6 B;  1T3Q A;  4MM3 A;  2WDR B;  3L0W B;  1SIJ A;  3AE1 B;  3UI3 A;  3DBH I;  1YN4 A;  2HE7 A;  4WQO B;  1T6B X;  1EF5 A;  2XBB C;  3AE9 B;  4HCN B;  4BAX A;  4ARI A;  3SEB A;  4OZB A;  1Z2M A;  1F77 A;  3KW5 B;  4BZA A;  2LGS A;  2LVP A;  3GE3 C;  3E9S A;  3UF8 A;  1FFU A;  2L7R A;  2ON8 A;  4LCD E;  1E8X A;  2EEL A;  2DZK A;  1E0Z A;  5EE1 A;  1T0S C;  4HPL B;  2OED A;  5BYR A;  1WGG A;  4JQW C;  4ITK A;  3QIJ A;  5GMV A;  1OQR A;  2WNM A;  2FCQ A;  2KTF A;  3Q6B A;  1XQQ A;  4JWU C;  3AE3 B;  4LDT B;  1C9F A;  2K3U A;  1EWY C;  2MSE D;  2AQ2 B;  2KQS A;  2M56 B;  3ML9 A;  5AEK B;  3WAL A;  3KWL A;  5BMH A;  2PKO A;  3C19 A;  1WGK A;  5JHA A;  2PTL A;  3HM6 X;  3DBL I;  4P7I A;  4K7S A;  3R2I A;  2L76 A;  2ZZP B;  1WE7 A;  1N6Z A;  2KDB A;  2K39 A;  2OJW A;  1V80 A;  4CQN A;  3VUW A;  2KQ7 A;  3P42 A;  4E71 A;  2H88 B;  4N59 A;  4DXF A;  3H8H A;  2K22 A;  1P3Q U;  2K0P A;  2WU2 B;  1OEY J;  2YLM A;  2LVQ A;  1V1P B;  3B2F A;  4C56 C;  2G1E A;  2WYQ A;  3U7Z A;  1L0V B;  4P1B C;  4XGA B;  2HD5 B;  3W9C B;  4ZRK A;  3R66 C;  1GC7 A;  2JF5 A;  1K8R B;  2IY0 B;  2WDQ B;  2PEA A;  1VCB A;  2LJ5 A;  2KHW B;  2Y5B B;  3VH4 B;  2ZPN A;  2BB5 A;  2FAZ A;  1ROE A;  1QOB A;  3TJP A;  2TSS A;  5J2R A;  1VZ7 A;  3WCQ A;  2BPS A;  1J7C A;  5FR3 A;  2BKR B;  3ZO5 B;  4NAW B;  2D2Q A;  3A1Q A;  3Q8F A;  1XT9 B;  1TY0 A;  2ZVN A;  4BOS C;  3AM9 A;  1V81 A;  1R7S A;  3T3N A;  4NNJ B;  1UGJ A;  1FD6 A;  4OVV A;  1ENF A;  1VLB A;  4GB9 A;  3V60 A;  2WX0 A;  3ZLZ A;  4M02 A;  2BT6 A;  4GLS C;  4REZ A;  1KH0 A;  3P63 A;  2WGS A;  4TKN A;  1VD2 A;  4IG7 B;  3N3K B;  2JX5 A;  4UDU C;  3NVV A;  1NDD A;  3RNE C;  2D07 B;  2EKI A;  4W9E A;  1C76 A;  2J0M A;  1YX6 B;  1MI0 A;  3PGE A;  3Q14 C;  1IPG A;  3EHV A;  2PPH A;  2BWF A;  3TBL D;  4KSK C;  3RPF C;  4RH6 A;  4PYU A;  1X1M A;  2WXK A;  1PGX A;  3EC8 A;  1CZP A;  4K7U A;  4WWN A;  2RD0 A;  3IT4 B;  3DVN U;  3P1M A;  3RNB C;  3TEW A;  4F1S A;  4KGT A;  2FID A;  3IG3 A;  3RN9 C;  4LNO A;  2C5L C;  3AH7 A;  2KLG A;  4FLH A;  1GB1 A;  4WJN A;  2MRP A;  4KZC A;  2INN E;  1D6E C;  5D3D A;  2Z0E B;  3HIZ A;  3QJZ A;  3WA0 A;  1WE6 A;  2FCN A;  2BKF A;  1CMX B;  4K7W A;  1SE4 A;  4S0R A;  3M62 B;  3V62 A;  1TS2 A;  3RNA C;  2G4D B;  5IO9 A;  2L83 A;  2QSD A;  1JWM D;  2FE8 A;  1C4C A;  4P16 A;  2KDF B;  4MGY E;  1U4A A;  2RPV A;  1TBE A;  4KV2 A;  2MP2 B;  4MGI E;  4KKJ A;  3S2A A;  1XXG A;  2SEB D;  1PFD A;  2G45 B;  3L13 A;  2KKC A;  1K53 A;  4B6W A;  2GOW A;  5EE0 A;  2D5G A;  1WFY A;  3QA8 A;  4PS3 A;  4ZRI A;  4PK1 A;  4DHZ E;  2BS4 B;  1PGA A;  1STE A;  4A6Q A;  4OZA A;  2D10 A;  5G5H A;  4BKS D;  2WS3 B;  3Q8C A;  4ZRJ A;  1ACC A;  2RPQ A;  1IBX A;  3DBH B;  1KFY B;  1WX8 A;  2LGX A;  4HWI B;  4US8 A;  4BOZ B;  1KRH A;  3EA6 A;  2GBR A;  3E56 A;  2LFI A;  1I35 A;  5C1Z A;  4HKZ E;  3AB5 A;  1TKE A;  3SD5 A;  2NVU I;  2DHZ A;  1GPX A;  3N1X C;  3NY5 A;  2BYT A;  3T8M A;  2LWP A;  3AEG B;  4GMV A;  2WXP A;  3NRZ A;  3VTW A;  2M8S A;  4HVB A;  3DBR B;  2VRR B;  2IY1 B;  3DWM A;  1HQR D;  2WXG A;  1P1A A;  2CS4 A;  1WY8 A;  1FMA D;  5IP4 D;  1E7U A;  2CR5 A;  4GSW A;  3DHI C;  2IZV B;  4P1C C;  5T8I A;  1NEN B;  3A9J B;  3ZYY X;  2WLB A;  3QHT A;  2INP E;  1QF6 A;  4HRS A;  2DAJ A;  2QJL A;  3VRB B;  2XNA C;  1XCT L;  3OG5 A;  4FUL A;  4BKT A;  3JVZ X;  1D3Z A;  1C78 A;  4G0N B;  2GMI C;  4HDQ A;  2V4I B;  4IWO A;  1QQR A;  1KLG D;  4RM9 A;  3BVM A;  4HPP A;  3VQI A;  2JSV X;  1F52 A;  4RNA A;  3PO0 A;  1FFV A;  5E6P A;  1YD8 U;  2OOB B;  4PYZ A;  1QOA A;  1IGC A;  4W9K A;  4DDI D;  1FXI A;  4ASW C;  3A9K A;  3ZUN A;  2N7E A;  4YTM B;  3KYC D;  2FUG 1;  2DX5 B;  1V5T A;  1JRP A;  2DYM A;  4L1B A;  1L0X B;  2MJE A;  3U7D A;  4G50 A;  3ZNH B;  2Z59 B;  4C00 A;  2N1V A;  1E7V A;  2V4L A;  2NTS A;  2N9X A;  4YTN B;  2JRI B;  2UU7 A;  1G6J A;  1TIF A;  4BFR A;  2XN9 C;  1FCC C;  4RGN A;  3K9P B;  3W5U B;  3NJT A;  3ZIM A;  3Q69 A;  4FN2 A;  1V1O A;  1MHH E;  2AQ3 B;  1UUP A;  2LGI A;  2BVC A;  2A4Z A;  2A5U A;  1ET6 A;  1WX9 A;  3DPD A;  3FIL B;  4MDK E;  1JWB D;  4HPM B;  2KJR A;  3IXS A;  5AUI A;  4ARC A;  1TS3 A;  2KT7 A;  1VRA B;  4F7Z A;  1ESF A;  5KHO A;  2KO3 A;  2BW2 A;  4GDK A;  2H89 B;  2M19 A;  3AV8 A;  5D3I B;  5CTR C;  4ZYN A;  3VH3 B;  3SR6 A;  2WXR A;  3QAR A;  3RUI B;  2GLS A;  2LI5 A;  2GB1 A;  4NJC A;  3KLS X;  2G9H D;  1SGH A;  4DXA B;  5DPT A;  3RNC C;  2LGY A;  3CIR B;  4IWQ A;  2I1J A;  3CSF A;  3H1U A;  3GS2 A;  1YQ4 B;  1MG4 A;  4I6N B;  3L16 A;  1VDV A;  4IC7 B;  3ZKJ C;  2W82 A;  3AE6 B;  5LLI A;  2JU6 X;  1K50 A;  2OJR A;  1L4D B;  3APC A;  2KXJ A;  3BYT B;  4M8M A;  3BY4 B;  2L8J A;  4DHJ B;  1KJT A;  3TSS A;  3ZJT A;  3Q3J A;  4Q2J A;  1WIA A;  4MJS A;  3DBS A;  1AWD A;  3W5V B;  3EEC A;  1UWM A;  3N9Y C;  5JZE B;  3AMZ A;  2E6X A;  4NJ7 A;  1TYG B;  1YIW A;  4XE0 A;  3DVG X;  2GI9 A;  2ZVO A;  1PUT A;  3DCG A;  4MJS B;  1WXS A;  4HLE A;  5HG2 A;  2J42 A;  5BO4 B;  1WXM A;  1D5M C;  1NI3 A;  4EUT A;  3AED B;  5JXV A;  4KGR A;  5CX3 A;  2JYE A;  2D3A A;  5H8Y E;  4A3P A;  5CHV C;  5TR5 A;  3VXW A;  1VZ8 A;  2WQY B;  4LJO B;  4RFB A;  4HK2 A;  4HXD A;  3H6N A;  3N20 C;  1LGR A;  4XWT A;  2LGD A;  3AE4 B;  1ZGU B;  2HTM E;  4MEL A;  3V6C B;  2UWQ A;  1ZDX A;  5J17 A;  3U52 E;  3N1Z C;  4NZL B;  1TZ1 A;  1F2R C;  1Y56 A;  3R3M A;  3KUZ A;  1J7B A;  1WJN A;  2K25 A;  2AWT A;  2B3A A;  4JLC A;  1MG8 A;  2IGG A;  3UGB B;  3R7R A;  2ZEQ A;  5MPO A;  1QZE A;  1I4Q A;  4MSM B;  3H9D A;  1HTO A;  1EF1 A;  3LDZ E;  3QWZ B;  4ZHP A;  3BIN A;  3U8Z A;  1IUE A;  4A9A A;  1WH3 A;  5IN7 A;  2ZPY A;  1L4Z B;  3A1Q B;  4EE2 A;  3MHZ A;  5GXG B;  4D2K A;  4NPN A;  3O13 A;  3RZW C;  3NVZ A;  3AUL A;  2CJN A;  2KX3 A;  5LNK 1;  2KAJ A;  2ZW1 A;  4ZOH C;  2K8C A;  3U2S C;  2FUH B;  4WJP A;  2PIA A;  2NBW B;  2V1Y A;  2Y5C A;  5EDS A;  2ZJD A;  2AQ1 B;  2O6V A;  3APD A;  4W9G A;  1MVK A;  3ENE A;  2OHF A;  4WJO A;  4N6E B;  1CQV A;  5FR6 A;  2NS5 A;  3EGR A;  2NBV B;  5E6N A;  1TKY A;  1KLV A;  1XLN A;  3RNG C;  3VR8 B;  2LEK A;  3AE5 B;  1NVI D;  1OTR B;  1WZ0 A;  2LAS A;  2N9L A;  4KKI A;  4LDT D;  3RI7 C;  2IGH A;  5DPS A;  1FIQ A;  4TQ1 A;  2GBK A;  3VTU A;  2MBB B;  4XWW A;  4N9F 4;  2HJ1 A;  4E3C A;  2DBY A;  1V2Y A;  4EFO A;  4B95 A;  2FNJ B;  1YNT E;  2N4F A;  1SIF A;  1I4P A;  2REX A;  3CST A;  4B0E A;  2BYE A;  1DOI A;  4YT0 B;  2SAK A;  1FNU A;  1P7E A;  4RGT A;  4E74 A;  1TTN A;  3HM3 A;  2PLP A;  3P4R B;  3HRD D;  2KMA A;  3BK2 A;  1P7F A;  4JGH B;  1RFA A;  1R4N B;  3SHQ A;  2I1K A;  3VFK A;  2W3S A;  1DOX A;  4MH0 E;  4P6V F;  2MP2 A;  1E8Z A;  4XDC A;  1OQY A;  2V3N A;  3NVW A;  4AOF A;  2W55 A;  1ZKH A;  4URK A;  3ZW3 A;  1DYQ A;  2JUO A;  1SXT A;  3H7S A;  4II2 B;  1FNV A;  3OJ3 A;  4YWG G;  3BVG A;  2KN4 A;  2JPH A;  1WMH A;  2MBQ A;  4IOI E;  2K8H A;  2JWZ A;  3PPA A;  1XD3 B;  3TEZ A;  2HDE A;  3MTN B;  4XZ4 A;  3OAW A;  3ZDM C;  4GDL A;  1Q5W B;  2D11 A;  1C79 A;  1FM0 D;  5G5G A;  1UNS A;  3Q3O C;  2WHI A;  3OJ4 B;  2L3Z A;  1XEE A;  2LZ6 A;  4AQ7 A;  4GU2 A;  3QAQ A;  3ONS A;  4AWJ A;  2KOX A;  1JWA D;  1PDX A;  4KGS A;  3PV1 A;  1QLB B;  3PT2 B;  1L6V A;  3BK1 A;  2RMM A;  1WF9 A;  1FXA A;  1WMH B;  4IM3 A;  1XLQ A;  2KWV B;  5AZF A;  1V8C A;  3IFW B;  2PVO D;  1EO6 A;  4J3O D;  3TEX A;  2KC2 A;  3NZ3 A;  3ZNI D;  2PVG C;  1E6E B;  4JE3 B;  1P98 A;  2QCZ A;  1GJZ A;  4NAM A;  1BML C;  1JML A;  1SE9 A;  4ZRQ A;  4GIV A;  5CHW A;  2CHZ A;  3AE8 B;  3J9C A;  1I4G A;  5CHF A;  3NUH B;  1NBF C;  1ZXH A;  2AL3 A;  3ECI A;  2GBM A;  2KC1 A;  2JXX A;  4IW0 A;  2O6V B;  2C7H A;  4BKS A;  3FKY A;  1L7Y A;  1AW7 A;  1WRI A;  1I7H A;  2WXN A;  4MSQ B;  2L0T A;  2KWU B;  1WR6 E;  3Q8A A;  3V3X A;  3QQ8 B;  1WZ3 A;  3R2T A;  1YJI A;  2LVO A;  2L0F A;  3L08 A;  1TS4 A;  3RMK C;  1SJH D;  1N62 A;  1KF6 B;  2WXJ A;  3MJW A;  3A4R A;  3M95 A;  5H92 C;  2K6Q A;  3V6E B;  5EE3 A;  2JWU A;  1WGR A;  4KVG B;  4KZ0 A;  1FEH A;  4DXG A;  3LB8 C;  1OEY A;  4ZDV A;  1I4H A;  1D4B A;  2MBE A;  2DWQ A;  2VH1 A;  3I63 C;  4NJ6 A;  3EFC A;  2GBN A;  2W54 A;  3C0R B;  2V9H A;  1OQQ A;  2KAN A;  5EE9 A;  4BBN F;  1V97 A;  3Q3M C;  1WGD A;  3VRA B;  3IVF A;  4XC2 A;  2MEK A;  4J6I A;  1T0Q C;  1Q1O A;  1LFD A;  3AE7 B;  4ZRP A;  1TY2 A;  3ZNZ B;  2DNF A;  2G4S A;  3HK0 A;  2ZCC A;  2MBO A;  3ZRF A;  3KQ4 A;  1HEZ E;  3IBE A;  3NG0 A;  3A33 B;  1WGY A;  2BS3 B;  2B76 B;  3VAW A;  4BKG A;  1F0Z A;  3K9O B;  2J4X A;  1WXV A;  2M0A A;  4HKQ A;  2N0S B;  3W1S A;  5FKA C;  5HHD G;  1A70 A;  1P0R A;  3TIX A;  1XCQ L;  2NMQ A;  3WAO A;  1RYJ A;  3PZ7 A;  2M1M A;  3TL5 A;  2KFJ A;  4X57 B;  4WAA A;  2QMT A;  1N5W A;  3IAS 1;  1M4V A;  3KYD D;  4WIP A;  1AN8 A;  2VZK D;  2JZ3 B;  1VJK A;  4KIK B;  2WDV B;  3EFU A;  3DVN V;  4WWO A;  3Q8E A;  3T9L A;  1LM8 B;  4C4V B;  1RFK A;  3AU4 A;  2LUM A;  1Q10 A;  3DBL B;  2WU5 B;  2HTH A;  4FJZ A;  1E8W A;  1TGZ B;  2BYV E;  4K3B A;  1R4M B;  1TT5 B;  4MGZ E;  4IDI A;  2BQQ A;  2G3Q B;  1Q0W B;  4F8C B;  2RSU A;  2NPT A;  1FRR A;  3H7P B;  3ZTC A;  1XLP A;  2ZNV C;  2KFK A;  1ZPS A;  4AJY B;  1V6E A;  4FBJ B;  4KSL C;  2L1A A;  1J0G A;  2AYO B;  2I2Y A;  2KZR A;  5BYS A;  4FHJ A;  2KDM A;  3NVY A;  1GOZ A;  1JCK B;  3IHP C;  1WYG A;  3AEE B;  2KAC A;  3L54 A;  1JRO A;  2LXA A;  4LK0 M;  2FBW B;  4RMA A;  4K81 A;  1WM2 A;  2CHX A;  2DYO A;  1KLU D;  3GOE A;  2V3P A;  4FJV B;  3GB1 A;  2Z0D B;  2L52 A;  3WAP A;  1WX7 A;  1EWC A;  5G55 A;  4CHK A;  4II3 B;  2JXT A;  3A4S C;  4B0M A;  2CU1 A;  3ZJV A;  3NS1 A;  2IYD B;  3CMM B;  4YXD B;  3ZVV A;  2R2Q A;  2WXM A;  4WH4 A;  2MCN B;  4AS1 A;  1E9M A;  1WYW B;  3A9K B;  1XF5 L;  4WWM A;  3SU8 X;  4DHZ B;  1B1Z A;  1WXA A;  5I4D A;  3O65 B;  2IJ0 A;  3BWU D;  4WUR A;  3VUY A;  1E8Y A;  2LXC A;  3AEA B;  4ICV A;  2KX0 A;  4EEW A;  4C80 A;  1C4P A;  3I5J C;  2KNB A;  1V5O A;  3X0W A;  1FCL A;  3KVF B;  4ACF A;  4GXB A;  1C3T A;  1KTK A;  2MH7 A;  3CF6 E;  4TSS A;  3ZGZ A;  4KDI C;  3Q3N C;  1CJE A;  1FO4 A;  1ZW7 A;  1UF0 A;  2IND C;  5IOI A;  3QC8 B;  3TMP B;  3X23 A;  3DQV A;  2AX5 A;  2J52 A;  2JZP A;  4A8X C;  2N7J A;  1T0R C;  1R4M I;  1C1Y B;  2DYB A;  1TKG A;  1S3S G;  1NYR A;  2KQ4 X;  2M4N A;  4IM0 A;  2VZK B;  3DHH C;  3RYT A;  1WGH A;  4LNI A;  4NY0 A;  2WX1 A;  1WXQ A;  2XEW A;  3H7P A;  4DWF A;  4NQK E;  4YL8 A;  4ANV A;  1ZXI A;  3AI5 A;  2KDE B;  4WQM A;  4KDL B;  3SFE B;  2EMS A;  4LJP B;  1IP9 A;  2D3G A;  2WXL A;  5L95 C;  1P9D U;  3T3O A;  4MM3 B;  1VZ6 A;  1KOT A;  1L5P A;  1GNU A;  2ACZ B;  3N30 A;  1EM7 A;  1F1H A;  2C7N B;  1MHX A;  1S1Q B;  4LNF A;  1SSN A;  1WSP A;  2LJI A;  2RR9 A;  3KUD B;  4YSZ B;  2CHW A;  3GZN B;  3AEB B;  5D2M B;  2WDT B;  5BMI A;  4YSY B;  3PRP B;  1YMH E;  2WXQ A;  3DHG C;  5D7G A;  1IGD A;  3W2D A;  2IO3 B;  2ONQ A;  1ISN A;  3ZRC A;  4L23 A;  2KTR A;  3UIP B;  4AP4 C;  4R3D A;  5HKH A;  4DQO C;  2DAF A;  3AE2 B;  3D32 A;  1N61 A;  4W9D A;  5LXH A;  1SF0 A;  4FHK A;  5HI1 A;  3FC4 A;  2BB6 A;  1LO5 D;  2M17 A;  3N32 A;  3TCA A;  1IBX B;  4EZK A;  4LLG M;  1K51 A;  1YX5 B;  1MPE A;  3RUL A;  3ETR A;  2NBU A;  4I6P A;  3RT3 B;  2IO1 B;  3AN1 A;  1WWT A;  2C9W B;  4K3C A;  1JWU D;  1IYF A;  1WR1 A;  2LHE A;  2LMC A;  4IUM B;  1SB3 C;  4G11 A;  3LYY A;  1N63 A;  3GE8 C;  1E90 A;  3VVW B;  2DZI A;  4DHJ D;  3ZQ4 A;  1YQB A;  4BBN C;  4A90 A;  4K1R B;  4JL9 A;  3OWE B;  3RFZ B;  4TMA B;  4W9J A;  4RCO A;  3W1S C;  3M3J A;  1YQ3 B;  2MHJ A;  3DBR I;  2I38 A;  2N9K A;  1UD7 A;  4ICU A;  1I4R A;  4L2Y A;  4AJW A;  4HRO A;  1V9J A;  3V05 A;  2KK8 A;  1ZE3 D;  3BVZ A;  4ZYS A;  2WP9 B;  3DWG C;  2NPT B;  4RF0 A;  3VUX A;  1UBI A;  5JH5 C;  1EUV B;  3NHE B;  1EU3 A;  5AUK A;  1GUA B;  2INC C;  1NI2 A;  1WRD B;  3RZF A;  4C7Y A;  1ZUD 2;  5HFY A;  2QEJ C;  2ZNV B;  3V61 A;  4O1N A;  4WAF A;  1RWS A;  3P2B A;  1RLF A;  3AU5 A;  5AZG A;  1D5X C;  4EZJ A;  2PJH A;  3B1L X;  4C7Z A;  4OVU A;  3MP9 A;  2J0K A;  1JAL A;  4I6L B;  1I42 A;  3JSV B;  1HA5 A;  2NTT A;  2JYT A;  2KMM A;  2O6V D;  2GRI A;  4CO7 A;  2V3S A;  3URY A;  4EZL A;  4GN1 A;  4EOY A;  4PS7 A;  1HZ6 A;  4MH8 A;  4TV3 A;  3ALB A;  1H4R A;  2KFK B;  2N9P C;  3M63 B;  1R4N I;  1HTQ A;  3NOB A;  2VH2 A;  1SJE D;  1ET9 A;  4PS8 A;  4ZHO A;  1XLO A;  2JY6 A;  3UQB A;  2KDI A;  4A55 A;  1NYQ A;  1DGJ A;  1L0Y B;  1UH6 A;  2BYF A;  2LD9 A;  2N1W A;  3KUC B;  1UEL A;  3VDZ A;  2J53 A;  1GG3 A;  2FCM A;  4A20 A;  3SDL C;  3BII D;  2JRH A;  4OHJ A;  1L6U A;  2NCN A;  2HJ8 A;  2KVR A;  2JZZ A;  4TQ0 A;  4M0W B;  1MFW A;  2MLB A;  2ZW0 A;  2IPK D;  1Z5S B;  4MT5 A;  1TJE A;  2MJ3 A;  1BXT A;  2IBI B;  2CKH B;  1OFF A;  4M00 A;  2M0X A;  2BS2 B;  1N60 A;  3FAH A;  4ANW A;  3AXC A;  2KJ6 A;  3PSE B;  1T0Y A;  2O2V A;  5L83 A;  3R7Q A;  1E10 A;  1ZDV A;  1M94 A;  2KYW A;  3GP7 A;  3WAM A;  1RM6 C;  4LTU A;  2ZCB A;  2R2O A;  3B08 A;  3KWV A;  5KHQ A;  2YEP B;  2MX2 A;  2J0J A;  1BT0 A;  2KD0 A;  4IKG A;  5JHB A;  3U4E G;  2GBJ A;  2LUE A;  5IKC M;  2AEH A;  4NAW A;  2BGF A;  1AYF A;  3P4P B;  1SEB D;  4JWS C;  5DPW A;  4USA A;  2BTE A;  3DVG Y;  1YN3 A;  2DZJ A;  4QAY A;  3RNF C;  4W9C A;  2FCS A;  3BYY B;  3SFD B;  4FXC A;  2Y3A A;  2QC8 A;  1QOF A;  1WI0 A;  4BVU C;  2WXO A;  3PHX B;  4YTP B;  3VHT C;  2K8B A;  1GAQ B;  3PLV A;  2PMV A;  4HJK A;  4DBG A;  1F2R I;  1Y8R C;  4HJG E;  1FRD A;  5FK9 C;  5C2T B;  1TZO A;  2YEP F;  4RM8 A;  4HCP B;  2KWD A;  3ZNG C;  2RDB C;  2QIL A;  3ZTD A;  1KM7 A;  4IM2 A;  2W3R A;  3IT6 B;  4HEA 1;  1JQ4 A;  2KMC A;  4WJQ A;  1YN5 A;  2LRU A;  3Q8B A;  5J18 A;  4KX6 B;  2ASQ A;  3PHW B;  2JT4 B;  3PRM B;  4M0W A;  1D5Z C;  2RGF A;  2WXI A;  4FA6 A;  4GGQ A;  2KLC A;  2V0G A;  4OZC A;  3MFG A;  3PRZ A;  2KVZ A;  3DDC B;  3N1Y C;  1MJD A;  3NZS A;  3HVD A;  2CU3 A;  4OW0 A;  4M01 A;  1DOY A;  1FXT B;  3LXF A;  5TSS A;  3TEY A;  4JX1 C;  4RGO S;  3ABV B;  1SE2 A;  1B9R A;  2KJH B;  1N5X A;  2WWZ A;  3I57 A;  4B9K A;  2IO2 B;  3RCZ A;  4XYC A;  2K9X A;  3PLU A;  3PRE A;  5BMG A;  2D3B A;  1JRU A;  3BZD B;  3JYU A;  4W9I A;  2PE9 A;  1AAR A;  2O2V B;  1HE8 A;  2IO0 B;  1QT9 A;  4G3X B;  2RDH A;  3MC9 A;  5D94 A;  2KTR B;  4MEM A;  2AL6 A;  4JIO U;  3FIL A;  4XDD A;  1T5X D;  3ZDT A;  2BWE S;  3PZD A;  4W9H A;  5C23 A;  3W1Y A;  2QIE B;  4LNK A;  1GC6 A;  3P4S B;  5DCN A;  3APF A; 
#chains in the Genus database with same CATH homology
 4KZC A;  3UIN B;  1V2Y A;  4EFO A;  2KN5 A;  4IM0 A;  2Z0E B;  3NZU A;  4B95 A;  2FNJ B;  3QX1 A;  3RYT A;  3HIZ A;  3QJZ A;  1WGH A;  2N4F A;  3WA0 A;  1J8C A;  1SIF A;  1WE6 A;  2FCN A;  2BKF A;  1CMX B;  2REX A;  4K7W A;  1WJ6 A;  3CST A;  3M62 B;  3V62 A;  4NY0 A;  2WX1 A;  2BYE A;  2G4D B;  2EMT A;  2XEW A;  3H7P A;  4DWF A;  3B0A A;  4NQK E;  4YL8 A;  4E74 A;  4ANV A;  2KDF B;  3AI5 A;  1TTN A;  3HM3 A;  4MGY E;  5DPR A;  1U4A A;  2KMA A;  2KDE B;  1TBE A;  4KV2 A;  2MP2 B;  4JGH B;  2KWC A;  1RFA A;  4KDL B;  2N7D A;  4MGI E;  3S2A A;  2I1K A;  3SHQ A;  3VFK A;  2EMS A;  2G45 B;  4LJP B;  4MH0 E;  1IP9 A;  4GOC A;  2D3G A;  3L13 A;  2KKC A;  2MWS B;  2W9N A;  4B6W A;  2MP2 A;  5L95 C;  2GOW A;  1P9D U;  4HDO A;  1E8Z A;  4CYE A;  5D6J B;  1OQY A;  1KOT A;  4ANX A;  1WFY A;  4AOF A;  3QA8 A;  1ZKH A;  1GNU A;  4PS3 A;  4ZRI A;  4URK A;  4DHZ E;  3N30 A;  3ZW3 A;  2C7N B;  1S1Q B;  2JUO A;  3H7S A;  4GDK B;  2NR2 A;  3PS6 A;  2D10 A;  4II2 B;  3JW0 X;  1A5R A;  1L2N A;  2RR9 A;  3OJ3 A;  3KUD B;  2CHW A;  4BKS D;  4W9L A;  2MBH A;  3MHS D;  2DZM A;  2EKE C;  1WMH A;  2JPH A;  2MBQ A;  2WDT B;  5D2M B;  3PTF C;  2K8H A;  1RAX A;  4ZRJ A;  4IWP A;  3WAN A;  3VTV A;  2JWZ A;  2RPQ A;  3PPA A;  3PRP B;  1XD3 B;  3I3T B;  1WX8 A;  2LGX A;  3MTN B;  4HWI B;  4XZ4 A;  3OAW A;  4BOZ B;  3ZDM C;  4GDL A;  5D7G A;  1Q5W B;  2GBR A;  2IO3 B;  1ISN A;  1I35 A;  2D11 A;  5C1Z A;  1LQB A;  4DDG D;  2UYZ B;  2JVC A;  3ZRC A;  2K1F A;  3SD5 A;  1PQS A;  3OJ4 B;  2L3Z A;  2NVU I;  2DHZ A;  2KTR A;  2LZ6 A;  3UIP B;  4AP4 C;  1F9J A;  5HKH A;  3NY5 A;  4FJY A;  2DAF A;  4GU2 A;  3T8M A;  3D32 A;  3QAQ A;  2LWP A;  1J19 A;  3ONS A;  4W9D A;  4AWJ A;  2KOX A;  4GMV A;  4M8N A;  3DOW A;  3QCA A;  5LXH A;  3PV1 A;  3VTW A;  4FHK A;  2M8S A;  4HVB A;  2J7Q B;  2M17 A;  3N32 A;  3PT2 B;  2VRR B;  2IY1 B;  3TCA A;  4EZK A;  3UQA A;  1YX5 B;  2YVC A;  4MGK E;  1WF9 A;  1P1A A;  1V49 A;  2MW5 A;  2CS4 A;  3RUL A;  3QK0 A;  1WY8 A;  1WMH B;  2NBU A;  4I6P A;  3RT3 B;  2IO1 B;  4IM3 A;  1E7U A;  2KWV B;  2MQJ A;  5AZF A;  1WJ4 A;  2CR5 A;  4GSW A;  2C9W B;  2IZV B;  3IFW B;  1IYF A;  1EO6 A;  1WR1 A;  2L05 A;  3KH0 A;  4IUM B;  4G11 A;  2KC2 A;  3ZNI D;  3A9J B;  1P98 A;  1UGM A;  1GJZ A;  3QHT A;  1SE9 A;  1E90 A;  3ML8 A;  4GIV A;  4TUU A;  2DAJ A;  5CHW A;  2CHZ A;  3VVW B;  2DZI A;  1E5W A;  5CHF A;  4DHJ D;  4DK5 A;  3GZN I;  1NBF C;  1YQB A;  4BBN C;  4FUL A;  4BKT A;  2AL3 A;  3JVZ X;  4K1R B;  4JL9 A;  1D3Z A;  4G0N B;  2GMI C;  4HDQ A;  3ECI A;  2GBM A;  2KC1 A;  2JXX A;  4W9J A;  4IWO A;  4IW0 A;  3W1S C;  5LXI B;  2O6V B;  4RM9 A;  3M3J A;  3PVL A;  2C7H A;  2K6D B;  4BKS A;  1LXD A;  3DBR I;  3LJ3 A;  3VQI A;  5G2N A;  1UD7 A;  1L7Y A;  4ICU A;  5E6O A;  5E6P A;  1YD8 U;  2OOB B;  4PYZ A;  4AJW A;  5IA7 A;  2XK5 B;  3OLM D;  4MSQ B;  1V9J A;  4EKU A;  2L0T A;  4KIK A;  4W9K A;  2KK8 A;  2KWU B;  1WR6 E;  1RRB A;  4DDI D;  4WWP A;  2C7M B;  2NPT B;  3QQ8 B;  2XK5 A;  3VUX A;  1UBQ A;  1WZ3 A;  2N9E B;  1UBI A;  4ASW C;  5JH5 C;  3A9K A;  1EUV B;  3ZUN A;  2N7E A;  3NHE B;  2LVO A;  3KYC D;  4AUQ C;  1GUA B;  2L0F A;  1NI2 A;  3L08 A;  1WRD B;  3RZF A;  1YJ1 A;  2DX5 B;  3NS8 A;  1V5T A;  4XX5 A;  4GDL B;  2ZNV B;  2DYM A;  3V61 A;  3L10 B;  4ANU A;  2FIF A;  2DEN B;  3P2B A;  3UIO B;  1RLF A;  3AU5 A;  3L17 A;  3U7D A;  5AZG A;  3MJW A;  2L00 B;  1WJU A;  2MA9 B;  4G50 A;  3ZNH B;  2Z59 B;  2N1V A;  4EZJ A;  1E7V A;  2QHO A;  3A4R A;  2V4L A;  2PJH A;  3B1L X;  2N9X A;  3M95 A;  2JRI B;  3HHM A;  4OVU A;  2K6Q A;  1G6J A;  2J0K A;  2BF8 B;  3V6E B;  4BFR A;  3Q3F A;  4I6L B;  1WGR A;  4KVG B;  1I42 A;  1WM3 A;  4KZ0 A;  3JSV B;  4NQL B;  4W9F A;  1OEY A;  3K9P B;  4ZDV A;  2MBE A;  3ZIM A;  1OGW A;  2O6V D;  4NJ6 A;  4FN2 A;  2GBN A;  4A3O A;  3C0R B;  4CO7 A;  2V3S A;  3RD2 A;  2A4Z A;  3U30 A;  2A5U A;  1WX9 A;  3DPD A;  5AZH A;  4MDK E;  4EZL A;  1H8C A;  4GN1 A;  4HPM B;  2LRW A;  2KJR A;  2KAN A;  4EOY A;  4PS7 A;  5IAA C;  3A9J A;  3JSV A;  4BBN F;  4FAD A;  2C60 A;  4TV3 A;  3WIM A;  1WGD A;  3ALB A;  1V86 A;  3IVF A;  4XC2 A;  4F7Z A;  1H4R A;  1UZX B;  2KFK B;  4J6I A;  5KHO A;  2PE6 B;  2KO3 A;  2N9P C;  3M63 B;  4GDK A;  1Q1O A;  4MM3 A;  1LFD A;  1R4N I;  3NOB A;  3L0W B;  3ZNZ B;  5CTR C;  3DBH I;  2G4S A;  2HE7 A;  3HK0 A;  4PS8 A;  2ZCC A;  4WQO B;  2MBO A;  4ZYN A;  3VH3 B;  3UQB A;  2JY6 A;  1EF5 A;  3QAR A;  2KDI A;  2XBB C;  3ZRF A;  4HCN B;  3RUI B;  2LI5 A;  3IBE A;  1Z2M A;  1SGH A;  1UH6 A;  2BYF A;  3A33 B;  2LD9 A;  3KW5 B;  4DXA B;  2LVP A;  5DPT A;  2N1W A;  3KUC B;  1WGY A;  2LGY A;  1UEL A;  3VAW A;  3UF8 A;  3VDZ A;  4IWQ A;  2L7R A;  2I1J A;  4BKG A;  1GG3 A;  3K9O B;  2FCM A;  3CSF A;  4LCD E;  4A20 A;  3H1U A;  3SDL C;  1E8X A;  2JRH A;  1WXV A;  4I6N B;  2NCN A;  2DZK A;  2HJ8 A;  2KVR A;  3L16 A;  4IC7 B;  3ZKJ C;  2JZZ A;  3W1S A;  5LLI A;  4TQ0 A;  1P0R A;  4HPL B;  3TIX A;  3WAO A;  4M0W B;  2MLB A;  2OJR A;  1WGG A;  4JQW C;  3APC A;  3QIJ A;  1Z5S B;  2KXJ A;  2M1M A;  5GMV A;  2FCQ A;  2KTF A;  1XQQ A;  2IBI B;  2CKH B;  4M8M A;  3TL5 A;  3BY4 B;  4LDT B;  2KFJ A;  4X57 B;  2L8J A;  4DHJ B;  2M0X A;  1KJT A;  4WAA A;  2MSE D;  3Q3J A;  2KQS A;  3KYD D;  1WIA A;  3ML9 A;  4ANW A;  3AXC A;  4MJS A;  3WAL A;  5AEK B;  2KJ6 A;  3DBS A;  2JZ3 B;  1T0Y A;  3PSE B;  2O2V A;  3EEC A;  5L83 A;  4KIK B;  3R7Q A;  5JZE B;  5JHA A;  1M94 A;  3HM6 X;  3WAM A;  3DBL I;  3EFU A;  4NJ7 A;  3DVN V;  4P7I A;  4WWO A;  4K7S A;  2ZCB A;  2L76 A;  3T9L A;  1YIW A;  1LM8 B;  2R2O A;  3B08 A;  2ZZP B;  3DVG X;  3AU4 A;  2ZVO A;  5KHQ A;  3DCG A;  2HTH A;  2MX2 A;  4MJS B;  1WE7 A;  1WXS A;  2J0J A;  1BT0 A;  2K39 A;  2KDB A;  4FJZ A;  2KD0 A;  4HLE A;  5JHB A;  1E8W A;  1V80 A;  1TGZ B;  1WXM A;  5BO4 B;  2BYV E;  2GBJ A;  2LUE A;  2KQ7 A;  3VUW A;  4E71 A;  2AEH A;  4EUT A;  4NAW A;  4MGZ E;  2G3Q B;  2BGF A;  5CX3 A;  1Q0W B;  4F8C B;  2RSU A;  2NPT A;  3H7P B;  1P3Q U;  1OEY J;  4A3P A;  2YLM A;  2LVQ A;  5CHV C;  3ZTC A;  5TR5 A;  5DPW A;  2ZNV C;  3VXW A;  4LJO B;  2KFK A;  3DVG Y;  4AJY B;  4HK2 A;  1V6E A;  4HXD A;  3H6N A;  2DZJ A;  4FBJ B;  4W9C A;  2WYQ A;  2FCS A;  4KSL C;  2LGD A;  1J0G A;  2AYO B;  2HD5 B;  2KZR A;  4FHJ A;  1WI0 A;  1ZGU B;  4ZRK A;  4BVU C;  3R66 C;  4MEL A;  3V6C B;  2UWQ A;  1GC7 A;  2JF5 A;  3PHX B;  1K8R B;  3IHP C;  5J17 A;  2IY0 B;  3VHT C;  3L54 A;  2K8B A;  2LXA A;  3PLV A;  4HJK A;  2PEA A;  4DBG A;  4RMA A;  1Y8R C;  4K81 A;  1WM2 A;  2CHX A;  1TZ1 A;  1VCB A;  2LJ5 A;  2KHW B;  3R3M A;  2DYO A;  3KUZ A;  1WJN A;  3GOE A;  2K25 A;  2AWT A;  2B3A A;  2Y5B B;  4JLC A;  1MG8 A;  4FJV B;  3VH4 B;  4RM8 A;  2Z0D B;  2ZPN A;  4HCP B;  3ZNG C;  2FAZ A;  3UGB B;  1WX7 A;  3WAP A;  3R7R A;  2ZEQ A;  5G55 A;  3TJP A;  4CHK A;  5J2R A;  4II3 B;  3A4S C;  1QZE A;  2CU1 A;  2BPS A;  3ZTD A;  4MSM B;  3H9D A;  1KM7 A;  1EF1 A;  2IYD B;  4IM2 A;  3CMM B;  2BKR B;  3ZO5 B;  3LDZ E;  3ZVV A;  3QWZ B;  2KMC A;  2R2Q A;  3BIN A;  2D2Q A;  3A1Q A;  4NAW B;  4WJQ A;  2MCN B;  3U8Z A;  2LRU A;  1XT9 B;  5J18 A;  1WH3 A;  1WYW B;  3A9K B;  2ZVN A;  4BOS C;  2ZPY A;  2ASQ A;  3PHW B;  2JT4 B;  3A1Q B;  1V81 A;  4NNJ B;  3PRM B;  2RGF A;  4OVV A;  3SU8 X;  4DHZ B;  4FA6 A;  1WXA A;  3O65 B;  4GB9 A;  4NPN A;  2WX0 A;  2KLC A;  4GGQ A;  3V60 A;  3ZLZ A;  3RZW C;  3VUY A;  1E8Y A;  3PRZ A;  2LXC A;  4TKN A;  3AUL A;  3DDC B;  1VD2 A;  4ICV A;  3NZS A;  2KX0 A;  2KX3 A;  4IG7 B;  3N3K B;  4EEW A;  2K8C A;  2KNB A;  1V5O A;  1NDD A;  1FXT B;  2FUH B;  2D07 B;  3X0W A;  3KVF B;  4GXB A;  4WJP A;  1C3T A;  2NBW B;  2V1Y A;  5EDS A;  4W9E A;  2ZJD A;  2J0M A;  3CF6 E;  2O6V A;  3APD A;  2KJH B;  4W9G A;  3ENE A;  2WWZ A;  1YX6 B;  4B9K A;  2IO2 B;  4KDI C;  3PGE A;  4WJO A;  1IPG A;  3EHV A;  5FR6 A;  2PPH A;  3RCZ A;  1ZW7 A;  2BWF A;  2NS5 A;  3TBL D;  3PLU A;  4KSK C;  2NBV B;  3QC8 B;  3PRE A;  5E6N A;  3TMP B;  3X23 A;  3DQV A;  1KLV A;  4PYU A;  1X1M A;  1JRU A;  3EC8 A;  4K7U A;  3JYU A;  4W9I A;  2PE9 A;  1AAR A;  2O2V B;  1HE8 A;  4WWN A;  2RD0 A;  2IO0 B;  3DVN U;  4G3X B;  4F1S A;  5D94 A;  2KTR B;  4MEM A;  1OTR B;  2FID A;  1R4M I;  3IG3 A;  2AL6 A;  4JIO U;  1C1Y B;  1WZ0 A;  2DYB A;  2LAS A;  3ZDT A;  4LDT D;  2BWE S;  2C5L C;  1S3S G;  3PZD A;  4W9H A;  5DPS A;  5C23 A;  3W1Y A;  2KLG A;  4FLH A;  1GC6 A;  2GBK A;  4TQ1 A;  3VTU A;  2MBB B;  4WJN A;  5DCN A;  2MRP A;  3APF A;  2M4N A;  4N9F 4;  4E3C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...