2NPTA

Crystal structure of the complex of human mitogen activated protein kinase kinase 5 phox domain (map2k5-phox) with human mitogen activated protein kinase kinase kinase 2 phox domain (map3k2-phox)
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
106
structure length
102
Chain Sequence
SMALGPFPAMQVLVIRIKIPNSGAVDWTVHSQLLFRDVLDVIGQVLPEATTTAFEYEDEDGDRITVRSDEEMKAMLSYYYSTVMEQQVNGQLIEPLQIFPRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the complex of human mitogen activated protein kinase kinase 5 phox domain (MAP2K5-phox) with human mitogen activated protein kinase kinase kinase 2 phox domain (MAP3K2-phox)
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Dual specificity mitogen-activated protein kinase kinase 5
total genus 21
structure length 102
sequence length 106
chains with identical sequence C
ec nomenclature ec 2.7.12.2: Mitogen-activated protein kinase kinase.
pdb deposition date 2006-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00564 PB1 PB1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2nptA01
2LASA 2IO0B 3AU4A 3ML8A 4OVVA 3ZKJC 5JHAA 2WX0A 3AULA 3OAWA 2FIDA 4BBNC 4HK2A 3ZVVA 3VVWB 3ALBA 2UWQA 3QARA 3VXWA 1IP9A 5CHFA 3PRPB 2FCMA 3B1LX 4KSKC 2KDEB 4HDOA 2DZMA 2RD0A 5LLIA 2MBEA 4DHZE 3NHEB 1UGMA 3O65B 3ECIA 5L83A 2KC2A 4G0NB 4MDKE 4AJWA 3MHSD 4MEMA 1BT0A 4LCDE 3ZRCA 2GBJA 1WE6A 3PS6A 3U8ZA 1A5RA 3AU5A 4ZDVA 2V3SA 2NR2A 2K6DB 2KWCA 3UIPB 4IUMB 3X0WA 4F7ZA 2MX2A 4FJVB 2DZJA 1M94A 1I42A 3QQ8B 1UD7A 1TGZB 5E6NA 4HXDA 2L3ZA 2L0TA 2J0KA 2ZVOA 4WJOA 1X1MA 2LRWA 3JSVB 3QAQA 1Q0WB 2IBIB 4MGIE 3UGBB 3A1QA 4TV3A 1UELA 1GUAB 2DX5B 2LWPA 4HWIB 1XT9B 3ZNZB 4GDLA 1J19A 4GSWA 1Z2MA 2LXAA 3M62B 4KDLB 5CHWA 1P9DU 2Y5BB 3KH0A 3UINB 1QZEA 4BKSD 5DPWA 3V6EB 1WGHA 4MGKE 2NPTB 4KSLC 4A20A 2KWUB 2JY6A 4KDIC 3A9KA 1WXMA 1WJ6A 3H7SA 4KVGB 4M8MA 2AL3A 2R2OA 2ZPYA 3ZUNA 3H7PB 2BF8B 1WRDB 4MM3A 2DAJA 2JT4B 2KJ6A 5C23A 1FXTB 4GDKA 2KFJA 2NBUA 3KW5B 5L95C 2C9WB 3WAOA 4WAAA 1PQSA 2Z0DB 3ZNID 2KO3A 2KWVB 4ZRJA 3VTWA 3H6NA 4NNJB 2VRRB 3ZTDA 1LXDA 2C7HA 2JVCA 3L16A 1RLFA 2O6VD 1ISNA 2ZVNA 3JYUA 3R7RA 4B95A 4DK5A 4IM0A 4GDKB 2MBQA 1R4NI 2MCNB 4B9KA 4DWFA 3SU8X 1WGRA 2D10A 2JRIB 3VTVA 3M3JA 3ZRFA 4BKTA 4K81A 4BBNF 2CHXA 1SGHA 4IM2A 1RFAA 2KDBA 3HM3A 2J7QB 4BKGA 3R3MA 3SD5A 4F8CB 1S1QB 1P98A 1WH3A 2ZJDA 1SE9A 2DYOA 3A9JB 3CF6E 1WF9A 4BFRA 3V6CB 1WGYA 1H4RA 4M0WB 2I1JA 2KDIA 1H8CA 4NJ7A 2JRHA 3DPDA 1UZXB 2CHZA 4DXAB 4JIOU 4GMVA 1WX8A 2N9EB 4FLHA 1SIFA 2WWZA 3PHXB 3CSTA 1EO6A 3AI5A 1LQBA 2CHWA 1UBIA 2ZEQA 3UQAA 4I6PA 1T0YA 2AWTA 5CHVC 1V6EA 3MTNB 3ZW3A 4DBGA 3PGEA 3RULA 1VD2A 2KMCA 1WYWB 2C7MB 4HCNB 2O2VB 4E71A 2BYFA 2K25A 2NCNA 2KLGA 2JPHA 5KHQA 2G4DB 4AP4C 3GOEA 4XC2A 3IFWB 2BGFA 1F9JA 2HD5B 2N9PC 2EMTA 4GB9A 1WX7A 3PPAA 3N32A 2BPSA 3HIZA 1JRUA 2NBWB 1UBQA 1WY8A 2UYZB 1OTRB 3B0AA 4G11A 3VH3B 2FCSA 1XD3B 3RCZA 1E7UA 1J8CA 3U30A 3NY5A 2BWES 2A4ZA 2DENB 3HK0A 4JL9A 5G2NA 3PHWB 3KYCD 1WR6E 2PJHA 2MQJA 3PVLA 4MGZE 1V81A 1YJ1A 1S3SG 3C0RB 2LUEA 3ZLZA 2ZPNA 1ZGUB 4AUQC 2JXXA 4EUTA 3N3KB 2BYVE 1WJ4A 3M63B 2BWFA 2KTFA 3PREA 4HCPB 4TQ1A 2KX0A 2NS5A 4HDQA 1NI2A 3DCGA 3EECA 4W9EA 3APDA 2KD0A 4WJQA 4J6IA 2FCNA 1Q1OA 2FAZA 1V2YA 2WYQA 3M95A 4W9GA 2J0MA 2JZ3B 4ICVA 1C3TA 3QIJA 3ENEA 1ZW7A 4EZJA 2LVPA 2RSUA 4WWNA 5DPSA 1XQQA 2K8CA 4FA6A 2J0JA 1WJUA 3NS8A 1E90A 1WZ0A 4PYZA 3ONSA 4B6WA 3PRZA 1HE8A 1NDDA 3DDCB 3K9OB 2N7EA 2LXCA 4G3XB 3PTFC 4WJPA 4ICUA 3WALA 4II2B 1E8YA 3RUIB 3GZNI 3VUWA 4MJSA 5D7GA 3L13A 2N4FA 4PS7A 1EF5A 2O6VB 3CSFA 4EEWA 1IYFA 3ZNHB 4AWJA 2ZNVC 2KFKA 2LGDA 5AZHA 2MSED 2IY0B 4HPLB 3DVGX 1Q5WB 1WZ3A 3VDZA 5GMVA 2IZVB 3EFUA 2KN5A 3LJ3A 4JGHB 2MA9B 3L0WB 3WIMA 4DDGD 4MGYE 2MRPA 2CKHB 4TKNA 4A3OA 3KYDD 2L05A 5E6OA 3UF8A 1E8XA 2NBVB 2D11A 2HJ8A 1WR1A 2KQSA 2ZCCA 2V4LA 3KVFB 3SDLC 3WA0A 3QWZB 3KUCB 2XK5B 2V1YA 2K39A 2QHOA 4I6LB 4CYEA 2GOWA 2KJRA 1P3QU 1WFYA 2WDTB 5DCNA 4DDID 2DYMA 4W9CA 4ZRKA 4E74A 1E8WA 1RAXA 4FULA 5D6JB 2KXJA 5CX3A 3RYTA 4NAWB 3UQBA 1D3ZA 3DQVA 2NVUI 3PLVA 3TIXA 2M0XA 4ANWA 3L10B 2GBMA 5JHBA 3TCAA 1KLVA 3NZSA 3PSEB 3QC8B 1OQYA 1YX6B 2K6QA 4GOCA 3NOBA 4EZLA 2LD9A 2PEAA 5FR6A 4GU2A 3JSVA 3A4SC 4HPMB 4W9LA 2MW5A 3U7DA 3ZDMC 2L0FA 2JZZA 2Z0EB 3HM6X 2BKRB 1G6JA 3W1SC 2L00B 1TBEA 3TJPA 1WMHB 2KTRA 4NQLB 2JF5A 4ASWC 3PRMB 4K7WA 1V5OA 4PS3A 2NPTA 4LDTD 1MG8A 2K8HA 4OVUA 5BO4B 3RD2A 2D07B 3BINA 3Q3JA 4HVBA 3RT3B 1E7VA 2OOBB 4KV2A 4N9F4 3R7QA 1YD8U 1GJZA 4DHZB 3DOWA 4PS8A 2L7RA 3JVZX 5DPTA 3L08A 4LJOB 4ANVA 4W9KA 5EDSA 3PLUA 2ZNVB 3CMMB 3EHVA 3EC8A 1L2NA 1L7YA 3A4RA 5TR5A 1TTNA 4E3CA 2C7NB 3I3TB 1LM8B 2ZCBA 3VHTC 2JUOA 2BYEA 3T8MA 5JZEB 3VTUA 2N1VA 4BVUC 3ZO5B 4MSQB 5DPRA 4XZ4A 1YQBA 4HLEA 2GBNA 2MP2B 2K1FA 3DBRI 3VUXA 1GNUA 5KHOA 4FBJB 2ASQA 4MH0E 2MWSB 4FN2A 4IC7B 2KLCA 2IO3B 3AXCA 5LXHA 4W9FA 3BY4B 3DBLI 4A3PA 2C60A 2N9XA 4GIVA 5D94A 4WWOA 3KUDB 4EOYA 5D2MB 3V61A 2Z59B 2KDFB 3ML9A 4IWPA 3WAPA 5JH5C 2YVCA 2M8SA 2LGXA 2O2VA 4II3B 2PE6B 5C1ZA 1E8ZA 1WI0A 1YIWA 4G50A 2D3GA 4YL8A 4DHJB 4BOZB 1VCBA 3QA8A 5IA7A 4PYUA 4RMAA 4XX5A 1WE7A 1E5WA 1UH6A 2B3AA 2KX3A 2N1WA 4MSMB 3OJ3A 4IWOA 3B08A 2GMIC 1I35A 3QX1A 4P7IA 3IG3A 2OJRA 4M8NA 3UIOB 4EKUA 4FHKA 1V5TA 2G45B 1WIAA 4KZ0A 3ZNGC 4RM9A 3VQIA 5CTRC 3H1UA 2PE9A 4RM8A 3TBLD 4GGQA 1RRBA 3HHMA 1KM7A 3RZFA 4FJYA 4ZRIA 2KFKB 3IBEA 4F1SA 4X57B 1K8RB 3DVGY 3VUYA 3MJWA 3QCAA 4K7SA 4NY0A 3VH4B 2KKCA 4ANXA 1WGDA 2HTHA 4CHKA 3L17A 4GN1A 4TQ0A 2AL6A 1WXVA 3QJZA 1LFDA 4IG7B 2A5UA 2JWZA 2LGYA 4FJZA 3T9LA 2IYDB 1YX5B 3A9JA 2KMAA 1V49A 4WJNA 3W1SA 3ZTCA 3WANA 3D32A 2YLMA 4CO7A 3DVNU 2C5LC 1P0RA 3P2BA 4JLCA 4W9DA 5E6PA 4KIKA 3V62A 2DHZA 5HKHA 2EMSA 2LRUA 1WXAA 3ZIMA 3DVNV 4JQWC 3H9DA 3OJ4B 3WAMA 5LXIB 2G4SA 2ZZPB 2KANA 2XBBC 2DYBA 3APCA 2RR9A 3A1QB 5AZGA 1AARA 3LDZE 2KQ7A 1TZ1A 1NBFC 1WX9A 2MBHA 1WJNA 1C1YB 1WM2A 2D2QA 2M1MA 2XEWA 3N30A 2MBBB 3PZDA 2O6VA 3W1YA 2IO2B 3SHQA 3A9KB 1GC7A 1Z5SB 2AEHA 2L8JA 2MP2A 2AYOB 2PPHA 3TMPB 4KIKB 3A33B 3TL5A 1WGGA 2L76A 2R2QA 4NPNA 2GBRA 1V9JA 1WM3A 2LZ6A 2M17A 2W9NA 2KZRA 2LVQA 3K9PB 4TUUA 3IVFA 1P1AA 4BOSC 2KK8A 1J0GA 2IO1B 2LI5A 2DAFA 2KNBA 3VAWA 2KOXA 4IWQA 4AJYB 3IHPC 4FHJA 2HE7A 4GDLB 2DZKA 2FCQA 2RGFA 4HJKA 1WMHA 3S2AA 3VFKA 3ZDTA 2REXA 5IAAC 3JW0X 2DZIA 4FADA 2LJ5A 4GXBA 2GBKA 4IW0A 2FUHB 3R66C 2KJHB 4WWPA 4URKA 2XK5A 4EFOA 2M4NA 5G55A 4NJ6A 5J18A 3OLMD 2KTRB 4ZYNA 1EUVB 2BKFA 3KUZA 4LJPB 3L54A 3X23A 2WX1A 4AOFA 4ANUA 1KOTA 2KHWB 2FIFA 3RZWC 4EZKA 1GG3A 3APFA 1R4MI 2N7DA 3NZUA 1OEYJ 4KZCA 1ZKHA 1EF1A 4I6NB 1OEYA 2KVRA 2I1KA 1WXSA 2CS4A 5AZFA 4NQKE 4W9JA 1V80A 2LVOA 5J2RA 4W9HA 4DHJD 1OGWA 1V86A 3H7PA 1Y8RC 4WQOB 3DBSA 1CMXB 2EKEC 1KJTA 1GC6A 4K1RB 4NAWA 3V60A 5AEKB 3PV1A 2IY1B 3Q3FA 2MLBA 4MJSB 2RPQA 3QK0A 4K7UA 1IPGA 2G3QB 2CR5A 3QHTA 3PT2B 4MELA 4W9IA 4BKSA 2K8BA 5J17A 2CU1A 2KC1A 2MBOA 2FNJB 4IM3A 4LDTB 3DBHI 1U4AA
chains in the Genus database with same CATH superfamily
2LASA 2W55A 2N9LA 3AU4A 4C7ZA 3RNAC 2FIDA 3AE9B 4BBNC 4HK2A 1HZ5A 2YEPB 1JWAD 2UWQA 3PRPB 2FCMA 4H2AA 2KDEB 5LLIA 3NHEB 1UGMA 3O65B 5L83A 3MC9A 5IKCM 1JW9D 1BT0A 2QILA 4IDIA 3U4EG 4XWTA 1WE6A 3U8ZA 3B2GA 3ZXRA 2NR2A 1WRIA 2K6DB 4HKQA 1M94A 5E6NA 4HXDA 2G1EA 2IBIB 3A1QA 1K50A 4O1NA 1M4VA 4DXFA 3CWIA 3ZNZB 2WXQA 1Z2MA 2LXAA 4MT5A 1P9DU 2Y5BB 3RN9C 3KH0A 4BKSD 1EWCA 2NPTB 2KWUB 3URYA 1SJED 1N63A 4KDIC 4J3OD 1WJ6A 1ZDVA 3H7SA 3UI3A 1C9FA 1D5XC 4M8MA 1ZOYB 2ZPYA 2BF8B 3EFCA 2JT4B 1FXTB 1YQ4B 3PZ8A 2NBUA 4RFBA 3DWMA 3KQ4A 2C9WB 1B1ZA 3NVYA 2R61A 3H6NA 1ESFA 2C7HA 2BTEA 2O6VD 2ZVNA 4N58A 1R4NI 4XE0A 1WGRA 1F52A 4KGTA 1D6EC 5EE1A 3DBLB 3Q3MC 1HTQA 4IM2A 1FXIA 4HRSA 2ZJDA 1SE9A 4BFRA 3Q69A 3V6CB 2KYWA 1H4RA 4M0WB 1V1PB 2M0AA 2JZPA 4A90A 1UZXB 2CHZA 4DXAB 4JIOU 4GMVA 1WX8A 2Y5CA 4BZAA 1EO6A 3AI5A 2ZEQA 1UBIA 3NS1A 3PGEA 2KMCA 1I7HA 2WGSA 3ZJUA 1HZ6A 3MP9A 2KLGA 3O13A 3AB5A 1UNSA 1F9JA 2BGFA 2NBWB 1WY8A 4A55A 4JL9A 1YN4A 1RM6C 1RFKA 3PHWB 2PJHA 1QQRA 2QIEB 3HVDA 3N1ZC 1YJ1A 1WXQA 2PIAA 2B76B 3N3KB 1V97A 2KWDA 3AN1A 4TQ1A 3I5JC 1NI2A 2INDC 4N59A 3APDA 3BVMA 4WJQA 2DNFA 2J0MA 4ICVA 3QIJA 3AE8B 1GPXA 4WWNA 1XQQA 4LK0M 1P7EA 3NS8A 4B6WA 3PRZA 3DBHB 2VZKD 1WGKA 1YN5A 4MJSA 3GP7A 4PS7A 3AM9A 1EF5A 1ZUD2 2O6VB 4EEWA 2ZNVC 3P4SB 2W82A 4ZYSA 1YN3A 4M02A 2UU7A 5GMVA 2IZVB 3AMZA 2K5PA 3LJ3A 4JGHB 2V9HA 3GZNB 1UWMA 3L0WB 2BVCA 4A3OA 1WR1A 2KQSA 2ZCCA 3IAM1 1GB4A 4B0EA 2V1YA 2QHOA 4LNOA 4I6LB 1SB3C 5DCNA 2L1AA 2WDTB 4W9CA 4E74A 1RAXA 4FULA 2KXJA 3RYTA 4NAWB 3L10B 5JHBA 3TCAA 1KLVA 3QC8B 4ARCA 1EU3A 2LD9A 5FR6A 3U7DA 2JZZA 2Z0EB 3SFEB 1G6JA 3W1SC 2L00B 1ZDXA 3T3OA 2NPTA 4HVBA 3BINA 3Q3JA 3RT3B 2OOBB 2EELA 1V1OA 4DHZB 4PS8A 2L7RA 3L08A 2GLSA 4LJOB 2AQ3B 1TTNA 4JX1C 1T6BX 2LUMA 1LM8B 4OZCA 3VTUA 2NTTA 4HLEA 2PVOD 5IOIA 2K1FA 3DBRI 1L4DB 5KHOA 4FBJB 2Y5PA 1TT5B 4FN2A 4IC7B 3TSSA 5I4DA 1ZXIA 2KLCA 2IO3B 4W9FA 3BY4B 1JALA 4EOYA 1DYQA 2Z59B 1SIJA 2KDFB 3WAPA 1KFYB 5C1ZA 2K22A 5D3DA 1J7BA 4M0WA 1C78A 1WE7A 2KVZA 4RF1A 1E5WA 4MSMB 3ZQ4A 3BK2A 4L23A 4IWOA 3W5UB 3ZXVA 1TY2A 3IG3A 2OJRA 3TUOA 3FAHA 1SF0A 3HVZA 2G45B 3ZJVA 4KZ0A 4RM8A 3HHMA 2OHFA 3RNGC 2TSSA 2KACA 4F1SA 4S0RA 4NY0A 3VH4B 1WGDA 3L17A 4WAFA 2CJOA 4R3DA 1N60A 4WH4A 2MJDA 1FNVA 3A9JA 1V49A 5LNK1 3WANA 1MVKA 3DVNU 1P0RA 3CIRB 3V62A 5HKHA 3Q8FA 3WAMA 1L6VA 1I4QA 2ZZPB 2KANA 1AARA 3LDZE 2KQ7A 1NBFC 3N30A 2MBBB 2O6VA 3W1YA 1F0ZA 3MJ5A 1CJEA 4WIPA 2AEHA 2PPHA 4NZLB 3TL5A 4GLSC 5BMHA 1C4CA 2IPKD 2LVQA 4TUUA 3IVFA 2KK8A 2IO1B 2LI5A 1XEEA 2D5GA 2DAFA 2KOXA 4AJYB 3IHPC 4YXDB 2HE7A 3S2AA 1WMHA 2WXGA 5IAAC 3JW0X 1PDXA 4WWPA 4URKA 4IOIE 5J18A 3OLMD 2KTRB 3Q8BA 1MJDA 4JWUC 4AOFA 4ANUA 1GG3A 3APFA 5G5HA 1OEYJ 4KZCA 1ZP0B 1F2RI 1QILA 2KVRA 2CS4A 5AZFA 4W9JA 1V80A 1OGWA 1TS2A 3Q8AA 4WQOB 3DBSA 1KJTA 5AEKB 4YTNB 3RNBC 1C4PA 2KAJA 5J17A 4K3BA 2IO0B 5FK9C 2IGGA 5JHAA 2KQ4X 3OAWA 4MACA 1IP9A 5CHFA 4KSKC 4DHZE 2MBEA 1ET9A 1IGCA 2KC2A 4MDKE 4DQOC 3FILA 1FCLA 2JXTA 3Q3NC 1OQQA 3ZRCA 2GBJA 3PS6A 1A5RA 4ZDVA 3VR8B 1Y56A 4IUMB 4F7ZA 2W3RA 3QQ8B 1UD7A 5EE9A 1YNTE 2L0TA 2I38A 3SR6A 1TY0A 3JSVB 4MGIE 4TV3A 1GUAB 2LWPA 1XT9B 5FR3A 1DGJA 1J19A 1VZ7A 4GSWA 3DHHC 5CHWA 4BAXA 4YT0B 1HEZE 1MI0A 1TS5A 4L2YA 2PW9A 1WXMA 3Q2AC 5EE3A 5H8YE 2WXFA 3ZUNA 3NVWA 2DAJA 1L0VB 3PO0A 4IKGA 2KFJA 5FKAC 2DBYA 3KW5B 1QOAA 5L95C 1PQSA 3ZNID 3VTWA 4NNJB 2VRRB 4QAYA 3ZGZA 1LXDA 1HTOA 1FNUA 1K52A 1RLFA 3B9JA 2JQRB 3R7RA 2LMCA 2IJ0A 2QMTA 2IDYA 3KLSX 2AQ1B 4K81A 4BBNF 2CHXA 1RFAA 2KDBA 3HM3A 4YTMB 4BKGA 3AEAB 3R3MA 4F8CB 5T8IA 3DWGC 1WH3A 3A9JB 3CF6E 2K9XA 2I1JA 1SE2A 1HXYD 5E6JA 2N9EB 3PHXB 1KLUD 2LGIA 3CSTA 1LQBA 2CHWA 3H8HA 2AWTA 5CHVC 1V6EA 3W2DA 4DBGA 2DWQA 1WYWB 2C7MB 1SEBD 4HCNB 4A9AA 2BYTA 2NCNA 4RCOA 4AP4C 2HD5B 1WSPA 4HPPA 2JX5A 3N32A 1PYWD 1UBQA 1OTRB 2FCSA 3RCZA 4B0MA 1J8CA 2K3UA 2WDVB 5G2NA 1WR6E 4P6VF 3PVLA 5D3IB 4KKJA 1OQRA 3EGRA 3C0RB 3ZLZA 2ZPNA 3EUB2 1WJ4A 2KTFA 3PREA 2NS5A 2WQYB 4XDDA 5JXVA 3AEDB 1Q1OA 2BT6A 1UF0A 2K8CA 4FA6A 2J0JA 1E90A 1WZ0A 3ONSA 2L52A 3K9OB 4G3XB 4WJPA 1Q10A 2WXJA 1E8YA 1DOIA 5D7GA 3ZJTA 4AWJA 1L0XB 2LGDA 2M19A 1JWUD 1C76A 1Q5WB 2AX5A 2J4XA 1WZ3A 2AQ2B 3VDZA 3AE3B 3MFGA 1VZ8A 1ENFA 3WIMA 4DDGD 2MRPA 2CKHB 4TKNA 3UF8A 2NBVB 2D11A 3KVFB 1TKEA 1FO4A 2WU2B 4CYEA 3OG5A 1ACCA 2DYMA 5CX3A 1DOYA 3DQVA 2NVUI 3PLVA 2PVGC 2GBMA 2WXHA 1AN8A 3NZSA 3PSEB 1YX6B 2K6QA 3FILB 4HPMB 4W9LA 2L0FA 4REZA 1WMHB 2D3AA 4NQLB 3BYYB 3LYYA 4LDTD 5BO4B 2D07B 1BUIC 2LFIA 2BQQA 3WCQA 5IO9A 3DOWA 4ANVA 4W9KA 5EDSA 4ITKA 3IXSA 3EC8A 1L7YA 2L32A 4E3CA 3GB1A 5AUKA 3VHTC 1P7FA 3GS2A 4BVUC 4XZ4A 3HUIA 2GBNA 1PGBA 4NJCA 4RNAA 2MWSB 2L83A 3N1YC 3AXCA 2WLBA 3DBLI 4A3PA 5D94A 4WWOA 5D2MB 3ML9A 4CQNA 5JH5C 1XO3A 2YVCA 2O2VA 1UUPA 3U7ZA 1E8ZA 1YIWA 2M56B 2D3GA 4YL8A 4BOZB 1FFVA 3BWUD 5IA7A 1ZPSA 1MHXA 2N1WA 4AS1A 2KMMA 3OJ3A 4A8XC 1TZOA 4RGOS 5BYRA 2J42A 4M8NA 1V5TA 2PTLA 3C8YA 3ZNGC 1UGJA 3VQIA 2PE9A 4EE2A 2BS4B 1AW7A 3ZYYX 4ZRIA 3DVGY 3MJWA 4XWWA 2IGHA 1A70A 1WXVA 4FJZA 3T9LA 5BMGA 4CO7A 2QJLA 4JLCA 4W9DA 2RDGA 5E6PA 1WXAA 4JQWC 3ABVB 2WXOA 2XBBC 2DYBA 5AZGA 3RFZB 3PZDA 2IO2B 3N1XC 1LO5D 2L8JA 1K53A 2AYOB 3TMPB 1WGGA 2L76A 2R2QA 1WM3A 2LZ6A 2M17A 4RF0A 3K9PB 4BOSC 1J0GA 3AEFB 3VAWA 2BS3B 1FCCC 2REXA 4TSSA 4KKIA 2FUHB 3AE1B 2HDEA 2E6XA 2XK5A 4EFOA 5G55A 4ZHPA 1EUVB 4A6QA 3L54A 1SXTA 3X23A 2KHWB 1R4MI 2N7DA 2FBWB 1ZKHA 4C56C 4I6NB 1OEYA 2ONQA 2HJ1A 4USAA 1GOZA 3H7PA 1PFDA 4MM3B 3V60A 1VZ6A 5G5GA 3PV1A 3Q3FA 4MJSB 4K7UA 2Q5WD 3B2FA 3DHIC 4BKSA 2K8BA 2WXLA 4K3CA 1YQ3B 4XGAB 1RYJA 3AEGB 2INCC 2Z8LA 3BVZA 2MHJA 3QARA 1IBXB 3B1LX 4HDOA 2RD0A 4G0NB 2WHIA 4LCDE 4YWGG 1XCTL 1MPEA 3J9CA 1TKGA 2CU3A 2KWCA 3UIPB 3X0WA 2MX2A 1QOFA 1I42A 2J0KA 2ZVOA 3AE6B 1Q0WB 3UGBB 1NEKB 3AE5B 4GDLA 3LXFA 3M62B 4KDLB 2ICIA 1QZEA 3NVVA 5DPWA 1FNWA 2WXRA 4MGKE 3NUHB 4KSLC 4S17A 4A20A 2JY6A 2WXPA 3VR9B 4KVGB 2AL3A 4NAMA 4RGNA 3WAOA 2Z0DB 2KO3A 4ZRJA 1E7PB 2ACZB 1BMLC 1K51A 3I63C 3L16A 4P1CC 4B95A 4DK5A 4IM0A 4UDUC 2MBQA 3SFDB 2MCNB 1IGDA 3RMKC 4B9KA 4DWFA 3SU8X 4ZRQA 1D5MC 4HROA 2JRIB 3VTVA 4BKTA 1WYGA 1SGHA 2WDQB 1FEHA 2J7QB 1I4XA 1XCQL 1S1QB 2WXNA 1P98A 2DYOA 1WF9A 1VDVA 2LHEA 2INNE 1SE4A 2JRHA 3BIID 2SAKA 4FLHA 2WWZA 1QOGA 2EKIA 4DXGA 2V0GA 4I6PA 2WU5B 4XDCA 1JWBD 3C19A 3ZW3A 1LGRA 3V05A 1F77A 2O2VB 2BYFA 5BYQA 1L6UA 2JPHA 1R4NB 4AQ7A 4JWSC 3IFWB 4C7YA 2N9PC 3BYTB 4GB9A 3PPAA 2BPSA 1JRUA 1NENB 2UYZB 3VH3B 1YJJA 3N9YC 3U30A 2A4ZA 3HK0A 2N9KA 1C79A 2MH7A 3P1MA 2MQJA 1L4ZB 2W54A 4AUQC 1VLBA 3U2SC 4EUTA 3M63B 4HCPB 2I2YA 2KX0A 4HDQA 3DCGA 3EECA 3IT6B 3P4PB 1L0YB 2KD0A 2WP9B 3GE8C 1V2YA 3M95A 3NVZA 4W9GA 1C3TA 4EZJA 2RSUA 1WJUA 2WXMA 4D2KA 3DDCB 1TYGB 2N7EA 3PTFC 4ICUA 3WALA 3VUWA 3GZNI 3L13A 1D5ZC 1TIFA 2N4FA 3CSFA 5HFYA 1IYFA 4LNNA 4M00A 2RDHA 2MSED 2IY0B 3DVGX 3EFUA 4P1BC 1FRRA 2KN5A 3V3XA 2MA9B 4WQMA 3KYDD 5E6OA 2HJ8A 2V4LA 3SDLC 1FXAA 3QWZB 1TJEA 2K39A 3FC4A 1WFYA 4DDID 1F2RC 2MJ3A 4ZRKA 1E8WA 1D3ZA 3UQBA 3Q8CA 3TIXA 2M0XA 4ANWA 3DHGC 2PKOA 4GOCA 1STEA 4M01A 2PEAA 2MW5A 1N6ZA 2G9HD 3ZDMC 1MG4A 1ZE3D 1SBBB 2BKRB 1FIQA 2X38A 2JF5A 4ASWC 4K7WA 1V5OA 4PS3A 4OVUA 1MG8A 2K8HA 3TEXA 2VZKB 3AE2B 3R7QA 2KN4A 4KV2A 1YD8U 3JVZX 4LTUA 5DPTA 1E10A 3PLUA 2ZNVB 3EHVA 1L2NA 5HI1A 3A4RA 3I3TB 2JUOA 5JZEB 1FMAD 2N1VA 3ZO5B 2QEJC 2MP2B 4MH0E 1QKZA 3AEBB 3NJTA 2FUG1 3ETRA 3P4RB 1QF6A 4GIVA 3KUDB 2X8XX 3V61A 1FPYA 3MC8A 2M8SA 2LGXA 3R2IA 1KLGD 4II3B 1YMHE 2PE6B 3GE3C 4G50A 4DHJB 3QA8A 4US8A 1UH6A 2B3AA 2KX3A 1XLNA 1SSNA 3BVGA 1NI3A 2GMIC 3TEWA 3QX1A 1XXGA 4EKUA 1NVID 1V8CA 5CTRC 3TBLD 2HTME 1RRBA 3Q6BA 1KM7A 1FD6A 2KFKB 2GI9A 3IBEA 1K8RB 1R4MB 3VUYA 3QCAA 2LHDA 3E9SA 1N62A 5HG2A 1XLPA 2AL6A 3QJZA 1LFDA 2A5UA 2LGYA 3ZTCA 5HHDG 3D32A 2YLMA 1NYQA 2C5LC 3P2BA 1R7SA 4KIKA 2DHZA 2QDFA 1ZXHA 2LRUA 5LXIB 3H9DA 2RR9A 3A1QB 1ROEA 1WX9A 2M1MA 1WJNA 1C1YB 2D2QA 2XEWA 1IUEA 4C80A 1JWMD 3SHQA 1GC7A 1Z5SB 4XYCA 2N0SB 1UWXA 1C77A 3I9V1 4HJKA 4GDLB 2RGFA 4WURA 5AUIA 3AE4B 2KJHB 1TKYA 1KH0A 2M4NA 3N20C 1WWTA 3RI7C 4LJPB 2BKFA 3KUZA 2VH2A 1XLOA 3FKYA 1T5XD 2WX1A 2MJEA 1EU4A 3RZWC 2E3TA 4LNFA 2ZW1A 3NZUA 2RDBC 3PZ7A 1WXSA 4DHJD 4RGTA 1T0QC 4LNKA 1V86A 4RH6A 1GC6A 1F1HA 3KWVA 2RPQA 3QK0A 5IP4D 3TEYA 4FXCA 3QHTA 2W3SA 3PT2B 4MELA 3BZDB 4OHJA 3AEEB 2CU1A 1D4BA 2KC1A 4IM3A 3KWLA 4LDTB 3DBHI 4YSXB 2MEKA 3ML8A 4OVVA 3ZKJC 2WX0A 3AULA 2VH1A 2PMVA 3ZVVA 3Q3OC 3VVWB 3L4PA 1E9MA 3ALBA 3VXWA 3AE7B 1N5XA 2DZMA 2JWUA 3R2TA 3ECIA 4AJWA 3MHSD 4MEMA 3EA6A 2YEPF 1AWDA 1KF6B 3T3NA 2V3NA 3AU5A 2V3SA 1JCKB 4KX6B 4YSYB 4FJVB 2BS2B 2DZJA 2RPVA 2Y3AA 1TGZB 3RPFC 1GAQB 2L3ZA 4WJOA 1X1MA 2LRWA 3QAQA 1UELA 2SEBD 4OZBA 2DX5B 4HWIB 3RNEC 5TSSA 1XLQA 3UINB 3V6EB 3DBRB 1WGHA 4C00A 3A9KA 5IN7A 4P16A 2R2OA 3H7PB 4MM3A 1WRDB 4OW0A 1T0SC 2NMQA 2KJ6A 5C23A 4GDKA 2J53A 4US9A 3W5VB 1JROA 1CZPA 4WAAA 3I57A 2KWVB 1QT9A 3ZTDA 2JVCA 1YOVB 1ISNA 3JYUA 4GDKB 3VRAB 2D10A 1TS3A 3M3JA 3ZRFA 1L5PA 3LB8C 1HQRD 4KGRA 1DOXA 3SD5A 2BB5A 4MH8A 4L1BA 2NTSA 3IT4B 1WGYA 2KDIA 1H8CA 2WXIA 4NJ7A 4OVZA 3DPDA 1SIFA 1VRAB 3UQAA 2XNAC 4JE3B 3AV8A 1T0YA 2K0PA 2J52A 3MTNB 3MC0B 3RULA 1VD2A 4C4VA 1T0RC 1SE3A 5BYSA 4E71A 2K25A 1IBXA 5KHQA 5C2TB 2GRIA 2G4DB 3GOEA 4XC2A 2EMTA 3R8BA 1WX7A 2D3CA 1JRPA 3HIZA 4HJGE 4G11A 3B0AA 1XD3B 5MPOA 1E7UA 2ON8A 3NY5A 2BWES 2DENB 1XF5L 2JU6X 3KYCD 2V4IB 2CJNA 4MGZE 1V81A 4ZRPA 1S3SG 1MHHE 2LUEA 1ZGUB 2JXXA 5BMIA 1FRDA 2BYVE 2JSVX 2BWFA 4ARIA 4W9EA 1N5WA 4J6IA 2FCNA 1E0ZA 2FAZA 2WYQA 4ZHOA 1YJIA 2JZ3B 3ENEA 1ZW7A 2LVPA 5DPSA 4YSZB 4OZAA 4PYZA 1HE8A 1I4PA 1NDDA 2LXCA 4ACFA 4II2B 3RUIB 3ZNHB 1PGAA 2LGSA 3HRDD 2KFKA 5AZHA 1E6EB 4HPLB 4ZOHC 5EE0A 3P63A 1FFUA 4MGYE 2OEDA 1KTKA 2L05A 3AH7A 3Q8EA 3MHZA 4KGSA 1E8XA 1OFFA 5GXGB 3WA0A 1MFWA 3KUCB 2XK5B 3NRZA 2GOWA 3BK1A 2KJRA 1P3QU 5D6JB 1I4HA 2QCZA 1OQYA 3NOBA 4EZLA 2V3PA 3P4QB 4GU2A 3JSVA 3OWEB 3A4SC 1PUTA 4LLGM 1VR9A 3HM6X 2QSDA 1TBEA 2RMMA 3TJPA 2ZW0A 2KTRA 3PRMB 3RD2A 1PGXA 1AYFA 1CK1A 1E7VA 4N9F4 2JYEA 1GJZA 1B9RA 2H88B 3CMMB 2DLBA 5TR5A 2C7NB 2GB1A 2ZCBA 2BYEA 3T8MA 2QC8A 4MSQB 5DPRA 5H92C 1YQBA 3VUXA 1GNUA 3TEZA 2ASQA 1FM0D 2BW2A 5LXHA 2C60A 2N9XA 1SJHD 4IWPA 2INPE 2BB6A 4RGMA 1WI0A 2H89B 1VCBA 4PYUA 4RMAA 2LEKA 2WS3B 4XX5A 1QLBB 1NYRA 3B08A 1N61A 1VJKA 2PLPA 1I35A 4P7IA 3NZ3A 3UIOB 4FHKA 1WIAA 3P42A 3H1UA 4GGQA 3AECB 3RZFA 2JYTA 4FJYA 4X57B 1RWSA 4K7SA 2KKCA 4ANXA 2HTHA 4CHKA 4GN1A 3RNFC 4TQ0A 4IG7B 2JWZA 2IYDB 1YX5B 3W1SA 2KMAA 4WJNA 4YTPB 4PK1A 1KRHA 1JQ4A 2KT7A 2XN9C 1TS4A 2EMSA 3ZIMA 3DVNV 4PT5A 3VRBB 3OJ4B 2G4SA 3APCA 1BXTA 4WWMA 1CQVA 3NG0A 1TZ1A 5C3JB 2MBHA 1WM2A 1QOBA 3A9KB 2MP2A 1J7CA 4KIKB 2OJWA 3A33B 4NPNA 2GBRA 1V9JA 2W9NA 2KZRA 2LJIA 1P1AA 1T3QA 1JWSD 4N6EB 2KNBA 4IWQA 2FE8A 4FHJA 3ZDTA 2DZKA 2FCQA 4C4VB 1ET6A 3E56A 3VFKA 4Q2JA 3Q14C 2DZIA 3SEBA 4FADA 2LJ5A 4GXBA 2GBKA 4TMAB 4HKZE 4IW0A 1EM7A 1HA5A 3R66C 1J7AA 3RNCC 4LNIA 4NJ6A 4ZYNA 1I4RA 1JMLA 1KOTA 2FIFA 4EZKA 2N7JA 3W9CB 3IAS1 1EF1A 4JPSA 2I1KA 2KDMA 2IGDA 4NQKE 2WNMA 2LVOA 5J2RA 4W9HA 3U52E 1GB1A 1Y8RC 1I4GA 4NAWA 1CMXB 2EKEC 4HEA1 4K1RB 1V1PA 2IY1B 2BBCA 2MLBA 1IPGA 2D3BA 2WDRB 1EWYC 2G3QB 2CR5A 4W9IA 1C4AA 2WXKA 2MBOA 2FNJB 4RM9A 1U4AA
chains in the Genus database with same CATH topology
2LASA 2IO0B 3AU4A 3ML8A 4OVVA 3ZKJC 5JHAA 2WX0A 3AULA 3OAWA 2FIDA 4BBNC 4HK2A 3ZVVA 3VVWB 3ALBA 2UWQA 3QARA 3VXWA 1IP9A 5CHFA 3PRPB 2FCMA 3B1LX 4KSKC 2KDEB 4HDOA 2DZMA 2RD0A 5LLIA 2MBEA 4DHZE 3NHEB 1UGMA 3O65B 3ECIA 5L83A 2KC2A 4G0NB 4MDKE 4AJWA 3MHSD 4MEMA 1BT0A 4LCDE 3ZRCA 2GBJA 1WE6A 3PS6A 3U8ZA 1A5RA 3AU5A 4ZDVA 2V3SA 2NR2A 2K6DB 2KWCA 3UIPB 4IUMB 3X0WA 4F7ZA 2MX2A 4FJVB 2DZJA 1M94A 1I42A 3QQ8B 1UD7A 1TGZB 5E6NA 4HXDA 2L3ZA 2L0TA 2J0KA 2ZVOA 4WJOA 1X1MA 2LRWA 3JSVB 3QAQA 1Q0WB 2IBIB 4MGIE 3UGBB 3A1QA 4TV3A 1UELA 1GUAB 2DX5B 2LWPA 4HWIB 1XT9B 3ZNZB 4GDLA 1J19A 4GSWA 1Z2MA 2LXAA 3M62B 4KDLB 5CHWA 1P9DU 2Y5BB 3KH0A 3UINB 1QZEA 4BKSD 5DPWA 3V6EB 1WGHA 4MGKE 2NPTB 4KSLC 4A20A 2KWUB 2JY6A 4KDIC 3A9KA 1WXMA 1WJ6A 3H7SA 4KVGB 4M8MA 2AL3A 2R2OA 2ZPYA 3ZUNA 3H7PB 2BF8B 1WRDB 4MM3A 2DAJA 2JT4B 2KJ6A 5C23A 1FXTB 4GDKA 2KFJA 2NBUA 3KW5B 5L95C 2C9WB 3WAOA 4WAAA 1PQSA 2Z0DB 3ZNID 2KO3A 2KWVB 4ZRJA 3VTWA 3H6NA 4NNJB 2VRRB 3ZTDA 1LXDA 2C7HA 2JVCA 3L16A 1RLFA 2O6VD 1ISNA 2ZVNA 3JYUA 3R7RA 4B95A 4DK5A 4IM0A 4GDKB 2MBQA 1R4NI 2MCNB 4B9KA 4DWFA 3SU8X 1WGRA 2D10A 2JRIB 3VTVA 3M3JA 3ZRFA 4BKTA 4K81A 4BBNF 2CHXA 1SGHA 4IM2A 1RFAA 2KDBA 3HM3A 2J7QB 4BKGA 3R3MA 3SD5A 4F8CB 1S1QB 1P98A 1WH3A 2ZJDA 1SE9A 2DYOA 3A9JB 3CF6E 1WF9A 4BFRA 3V6CB 1WGYA 1H4RA 4M0WB 2I1JA 2KDIA 1H8CA 4NJ7A 2JRHA 3DPDA 1UZXB 2CHZA 4DXAB 4JIOU 4GMVA 1WX8A 2N9EB 4FLHA 1SIFA 2WWZA 3PHXB 3CSTA 1EO6A 3AI5A 1LQBA 2CHWA 1UBIA 2ZEQA 3UQAA 4I6PA 1T0YA 2AWTA 5CHVC 1V6EA 3MTNB 3ZW3A 4DBGA 3PGEA 3RULA 1VD2A 2KMCA 1WYWB 2C7MB 4HCNB 2O2VB 4E71A 2BYFA 2K25A 2NCNA 2KLGA 2JPHA 5KHQA 2G4DB 4AP4C 3GOEA 4XC2A 3IFWB 2BGFA 1F9JA 2HD5B 2N9PC 2EMTA 4GB9A 1WX7A 3PPAA 3N32A 2BPSA 3HIZA 1JRUA 2NBWB 1UBQA 1WY8A 2UYZB 1OTRB 3B0AA 4G11A 3VH3B 2FCSA 1XD3B 3RCZA 1E7UA 1J8CA 3U30A 3NY5A 2BWES 2A4ZA 2DENB 3HK0A 4JL9A 5G2NA 3PHWB 3KYCD 1WR6E 2PJHA 2MQJA 3PVLA 4MGZE 1V81A 1YJ1A 1S3SG 3C0RB 2LUEA 3ZLZA 2ZPNA 1ZGUB 4AUQC 2JXXA 4EUTA 3N3KB 2BYVE 1WJ4A 3M63B 2BWFA 2KTFA 3PREA 4HCPB 4TQ1A 2KX0A 2NS5A 4HDQA 1NI2A 3DCGA 3EECA 4W9EA 3APDA 2KD0A 4WJQA 4J6IA 2FCNA 1Q1OA 2FAZA 1V2YA 2WYQA 3M95A 4W9GA 2J0MA 2JZ3B 4ICVA 1C3TA 3QIJA 3ENEA 1ZW7A 4EZJA 2LVPA 2RSUA 4WWNA 5DPSA 1XQQA 2K8CA 4FA6A 2J0JA 1WJUA 3NS8A 1E90A 1WZ0A 4PYZA 3ONSA 4B6WA 3PRZA 1HE8A 1NDDA 3DDCB 3K9OB 2N7EA 2LXCA 4G3XB 3PTFC 4WJPA 4ICUA 3WALA 4II2B 1E8YA 3RUIB 3GZNI 3VUWA 4MJSA 5D7GA 3L13A 2N4FA 4PS7A 1EF5A 2O6VB 3CSFA 4EEWA 1IYFA 3ZNHB 4AWJA 2ZNVC 2KFKA 2LGDA 5AZHA 2MSED 2IY0B 4HPLB 3DVGX 1Q5WB 1WZ3A 3VDZA 5GMVA 2IZVB 3EFUA 2KN5A 3LJ3A 4JGHB 2MA9B 3L0WB 3WIMA 4DDGD 4MGYE 2MRPA 2CKHB 4TKNA 4A3OA 3KYDD 2L05A 5E6OA 3UF8A 1E8XA 2NBVB 2D11A 2HJ8A 1WR1A 2KQSA 2ZCCA 2V4LA 3KVFB 3SDLC 3WA0A 3QWZB 3KUCB 2XK5B 2V1YA 2K39A 2QHOA 4I6LB 4CYEA 2GOWA 2KJRA 1P3QU 1WFYA 2WDTB 5DCNA 4DDID 2DYMA 4W9CA 4ZRKA 4E74A 1E8WA 1RAXA 4FULA 5D6JB 2KXJA 5CX3A 3RYTA 4NAWB 3UQBA 1D3ZA 3DQVA 2NVUI 3PLVA 3TIXA 2M0XA 4ANWA 3L10B 2GBMA 5JHBA 3TCAA 1KLVA 3NZSA 3PSEB 3QC8B 1OQYA 1YX6B 2K6QA 4GOCA 3NOBA 4EZLA 2LD9A 2PEAA 5FR6A 4GU2A 3JSVA 3A4SC 4HPMB 4W9LA 2MW5A 3U7DA 3ZDMC 2L0FA 2JZZA 2Z0EB 3HM6X 2BKRB 1G6JA 3W1SC 2L00B 1TBEA 3TJPA 1WMHB 2KTRA 4NQLB 2JF5A 4ASWC 3PRMB 4K7WA 1V5OA 4PS3A 2NPTA 4LDTD 1MG8A 2K8HA 4OVUA 5BO4B 3RD2A 2D07B 3BINA 3Q3JA 4HVBA 3RT3B 1E7VA 2OOBB 4KV2A 4N9F4 3R7QA 1YD8U 1GJZA 4DHZB 3DOWA 4PS8A 2L7RA 3JVZX 5DPTA 3L08A 4LJOB 4ANVA 4W9KA 5EDSA 3PLUA 2ZNVB 3CMMB 3EHVA 3EC8A 1L2NA 1L7YA 3A4RA 5TR5A 1TTNA 4E3CA 2C7NB 3I3TB 1LM8B 2ZCBA 3VHTC 2JUOA 2BYEA 3T8MA 5JZEB 3VTUA 2N1VA 4BVUC 3ZO5B 4MSQB 5DPRA 4XZ4A 1YQBA 4HLEA 2GBNA 2MP2B 2K1FA 3DBRI 3VUXA 1GNUA 5KHOA 4FBJB 2ASQA 4MH0E 2MWSB 4FN2A 4IC7B 2KLCA 2IO3B 3AXCA 5LXHA 4W9FA 3BY4B 3DBLI 4A3PA 2C60A 2N9XA 4GIVA 5D94A 4WWOA 3KUDB 4EOYA 5D2MB 3V61A 2Z59B 2KDFB 3ML9A 4IWPA 3WAPA 5JH5C 2YVCA 2M8SA 2LGXA 2O2VA 4II3B 2PE6B 5C1ZA 1E8ZA 1WI0A 1YIWA 4G50A 2D3GA 4YL8A 4DHJB 4BOZB 1VCBA 3QA8A 5IA7A 4PYUA 4RMAA 4XX5A 1WE7A 1E5WA 1UH6A 2B3AA 2KX3A 2N1WA 4MSMB 3OJ3A 4IWOA 3B08A 2GMIC 1I35A 3QX1A 4P7IA 3IG3A 2OJRA 4M8NA 3UIOB 4EKUA 4FHKA 1V5TA 2G45B 1WIAA 4KZ0A 3ZNGC 4RM9A 3VQIA 5CTRC 3H1UA 2PE9A 4RM8A 3TBLD 4GGQA 1RRBA 3HHMA 1KM7A 3RZFA 4FJYA 4ZRIA 2KFKB 3IBEA 4F1SA 4X57B 1K8RB 3DVGY 3VUYA 3MJWA 3QCAA 4K7SA 4NY0A 3VH4B 2KKCA 4ANXA 1WGDA 2HTHA 4CHKA 3L17A 4GN1A 4TQ0A 2AL6A 1WXVA 3QJZA 1LFDA 4IG7B 2A5UA 2JWZA 2LGYA 4FJZA 3T9LA 2IYDB 1YX5B 3A9JA 2KMAA 1V49A 4WJNA 3W1SA 3ZTCA 3WANA 3D32A 2YLMA 4CO7A 3DVNU 2C5LC 1P0RA 3P2BA 4JLCA 4W9DA 5E6PA 4KIKA 3V62A 2DHZA 5HKHA 2EMSA 2LRUA 1WXAA 3ZIMA 3DVNV 4JQWC 3H9DA 3OJ4B 3WAMA 5LXIB 2G4SA 2ZZPB 2KANA 2XBBC 2DYBA 3APCA 2RR9A 3A1QB 5AZGA 1AARA 3LDZE 2KQ7A 1TZ1A 1NBFC 1WX9A 2MBHA 1WJNA 1C1YB 1WM2A 2D2QA 2M1MA 2XEWA 3N30A 2MBBB 3PZDA 2O6VA 3W1YA 2IO2B 3SHQA 3A9KB 1GC7A 1Z5SB 2AEHA 2L8JA 2MP2A 2AYOB 2PPHA 3TMPB 4KIKB 3A33B 3TL5A 1WGGA 2L76A 2R2QA 4NPNA 2GBRA 1V9JA 1WM3A 2LZ6A 2M17A 2W9NA 2KZRA 2LVQA 3K9PB 4TUUA 3IVFA 1P1AA 4BOSC 2KK8A 1J0GA 2IO1B 2LI5A 2DAFA 2KNBA 3VAWA 2KOXA 4IWQA 4AJYB 3IHPC 4FHJA 2HE7A 4GDLB 2DZKA 2FCQA 2RGFA 4HJKA 1WMHA 3S2AA 3VFKA 3ZDTA 2REXA 5IAAC 3JW0X 2DZIA 4FADA 2LJ5A 4GXBA 2GBKA 4IW0A 2FUHB 3R66C 2KJHB 4WWPA 4URKA 2XK5A 4EFOA 2M4NA 5G55A 4NJ6A 5J18A 3OLMD 2KTRB 4ZYNA 1EUVB 2BKFA 3KUZA 4LJPB 3L54A 3X23A 2WX1A 4AOFA 4ANUA 1KOTA 2KHWB 2FIFA 3RZWC 4EZKA 1GG3A 3APFA 1R4MI 2N7DA 3NZUA 1OEYJ 4KZCA 1ZKHA 1EF1A 4I6NB 1OEYA 2KVRA 2I1KA 1WXSA 2CS4A 5AZFA 4NQKE 4W9JA 1V80A 2LVOA 5J2RA 4W9HA 4DHJD 1OGWA 1V86A 3H7PA 1Y8RC 4WQOB 3DBSA 1CMXB 2EKEC 1KJTA 1GC6A 4K1RB 4NAWA 3V60A 5AEKB 3PV1A 2IY1B 3Q3FA 2MLBA 4MJSB 2RPQA 3QK0A 4K7UA 1IPGA 2G3QB 2CR5A 3QHTA 3PT2B 4MELA 4W9IA 4BKSA 2K8BA 5J17A 2CU1A 2KC1A 2MBOA 2FNJB 4IM3A 4LDTB 3DBHI 1U4AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LAS A;  2IO0 B;  3AU4 A;  3ML8 A;  4OVV A;  3ZKJ C;  5JHA A;  2WX0 A;  3AUL A;  3OAW A;  2FID A;  4BBN C;  4HK2 A;  3ZVV A;  3VVW B;  3ALB A;  2UWQ A;  3QAR A;  3VXW A;  1IP9 A;  5CHF A;  3PRP B;  2FCM A;  3B1L X;  4KSK C;  2KDE B;  4HDO A;  2DZM A;  2RD0 A;  5LLI A;  2MBE A;  4DHZ E;  3NHE B;  1UGM A;  3O65 B;  3ECI A;  5L83 A;  2KC2 A;  4G0N B;  4MDK E;  4AJW A;  3MHS D;  4MEM A;  1BT0 A;  4LCD E;  3ZRC A;  2GBJ A;  1WE6 A;  3PS6 A;  3U8Z A;  1A5R A;  3AU5 A;  4ZDV A;  2V3S A;  2NR2 A;  2K6D B;  2KWC A;  3UIP B;  4IUM B;  3X0W A;  4F7Z A;  2MX2 A;  4FJV B;  2DZJ A;  1M94 A;  1I42 A;  3QQ8 B;  1UD7 A;  1TGZ B;  5E6N A;  4HXD A;  2L3Z A;  2L0T A;  2J0K A;  2ZVO A;  4WJO A;  1X1M A;  2LRW A;  3JSV B;  3QAQ A;  1Q0W B;  2IBI B;  4MGI E;  3UGB B;  3A1Q A;  4TV3 A;  1UEL A;  1GUA B;  2DX5 B;  2LWP A;  4HWI B;  1XT9 B;  3ZNZ B;  4GDL A;  1J19 A;  4GSW A;  1Z2M A;  2LXA A;  3M62 B;  4KDL B;  5CHW A;  1P9D U;  2Y5B B;  3KH0 A;  3UIN B;  1QZE A;  4BKS D;  5DPW A;  3V6E B;  1WGH A;  4MGK E;  2NPT B;  4KSL C;  4A20 A;  2KWU B;  2JY6 A;  4KDI C;  3A9K A;  1WXM A;  1WJ6 A;  3H7S A;  4KVG B;  4M8M A;  2AL3 A;  2R2O A;  2ZPY A;  3ZUN A;  3H7P B;  2BF8 B;  1WRD B;  4MM3 A;  2DAJ A;  2JT4 B;  2KJ6 A;  5C23 A;  1FXT B;  4GDK A;  2KFJ A;  2NBU A;  3KW5 B;  5L95 C;  2C9W B;  3WAO A;  4WAA A;  1PQS A;  2Z0D B;  3ZNI D;  2KO3 A;  2KWV B;  4ZRJ A;  3VTW A;  3H6N A;  4NNJ B;  2VRR B;  3ZTD A;  1LXD A;  2C7H A;  2JVC A;  3L16 A;  1RLF A;  2O6V D;  1ISN A;  2ZVN A;  3JYU A;  3R7R A;  4B95 A;  4DK5 A;  4IM0 A;  4GDK B;  2MBQ A;  1R4N I;  2MCN B;  4B9K A;  4DWF A;  3SU8 X;  1WGR A;  2D10 A;  2JRI B;  3VTV A;  3M3J A;  3ZRF A;  4BKT A;  4K81 A;  4BBN F;  2CHX A;  1SGH A;  4IM2 A;  1RFA A;  2KDB A;  3HM3 A;  2J7Q B;  4BKG A;  3R3M A;  3SD5 A;  4F8C B;  1S1Q B;  1P98 A;  1WH3 A;  2ZJD A;  1SE9 A;  2DYO A;  3A9J B;  3CF6 E;  1WF9 A;  4BFR A;  3V6C B;  1WGY A;  1H4R A;  4M0W B;  2I1J A;  2KDI A;  1H8C A;  4NJ7 A;  2JRH A;  3DPD A;  1UZX B;  2CHZ A;  4DXA B;  4JIO U;  4GMV A;  1WX8 A;  2N9E B;  4FLH A;  1SIF A;  2WWZ A;  3PHX B;  3CST A;  1EO6 A;  3AI5 A;  1LQB A;  2CHW A;  1UBI A;  2ZEQ A;  3UQA A;  4I6P A;  1T0Y A;  2AWT A;  5CHV C;  1V6E A;  3MTN B;  3ZW3 A;  4DBG A;  3PGE A;  3RUL A;  1VD2 A;  2KMC A;  1WYW B;  2C7M B;  4HCN B;  2O2V B;  4E71 A;  2BYF A;  2K25 A;  2NCN A;  2KLG A;  2JPH A;  5KHQ A;  2G4D B;  4AP4 C;  3GOE A;  4XC2 A;  3IFW B;  2BGF A;  1F9J A;  2HD5 B;  2N9P C;  2EMT A;  4GB9 A;  1WX7 A;  3PPA A;  3N32 A;  2BPS A;  3HIZ A;  1JRU A;  2NBW B;  1UBQ A;  1WY8 A;  2UYZ B;  1OTR B;  3B0A A;  4G11 A;  3VH3 B;  2FCS A;  1XD3 B;  3RCZ A;  1E7U A;  1J8C A;  3U30 A;  3NY5 A;  2BWE S;  2A4Z A;  2DEN B;  3HK0 A;  4JL9 A;  5G2N A;  3PHW B;  3KYC D;  1WR6 E;  2PJH A;  2MQJ A;  3PVL A;  4MGZ E;  1V81 A;  1YJ1 A;  1S3S G;  3C0R B;  2LUE A;  3ZLZ A;  2ZPN A;  1ZGU B;  4AUQ C;  2JXX A;  4EUT A;  3N3K B;  2BYV E;  1WJ4 A;  3M63 B;  2BWF A;  2KTF A;  3PRE A;  4HCP B;  4TQ1 A;  2KX0 A;  2NS5 A;  4HDQ A;  1NI2 A;  3DCG A;  3EEC A;  4W9E A;  3APD A;  2KD0 A;  4WJQ A;  4J6I A;  2FCN A;  1Q1O A;  2FAZ A;  1V2Y A;  2WYQ A;  3M95 A;  4W9G A;  2J0M A;  2JZ3 B;  4ICV A;  1C3T A;  3QIJ A;  3ENE A;  1ZW7 A;  4EZJ A;  2LVP A;  2RSU A;  4WWN A;  5DPS A;  1XQQ A;  2K8C A;  4FA6 A;  2J0J A;  1WJU A;  3NS8 A;  1E90 A;  1WZ0 A;  4PYZ A;  3ONS A;  4B6W A;  3PRZ A;  1HE8 A;  1NDD A;  3DDC B;  3K9O B;  2N7E A;  2LXC A;  4G3X B;  3PTF C;  4WJP A;  4ICU A;  3WAL A;  4II2 B;  1E8Y A;  3RUI B;  3GZN I;  3VUW A;  4MJS A;  5D7G A;  3L13 A;  2N4F A;  4PS7 A;  1EF5 A;  2O6V B;  3CSF A;  4EEW A;  1IYF A;  3ZNH B;  4AWJ A;  2ZNV C;  2KFK A;  2LGD A;  5AZH A;  2MSE D;  2IY0 B;  4HPL B;  3DVG X;  1Q5W B;  1WZ3 A;  3VDZ A;  5GMV A;  2IZV B;  3EFU A;  2KN5 A;  3LJ3 A;  4JGH B;  2MA9 B;  3L0W B;  3WIM A;  4DDG D;  4MGY E;  2MRP A;  2CKH B;  4TKN A;  4A3O A;  3KYD D;  2L05 A;  5E6O A;  3UF8 A;  1E8X A;  2NBV B;  2D11 A;  2HJ8 A;  1WR1 A;  2KQS A;  2ZCC A;  2V4L A;  3KVF B;  3SDL C;  3WA0 A;  3QWZ B;  3KUC B;  2XK5 B;  2V1Y A;  2K39 A;  2QHO A;  4I6L B;  4CYE A;  2GOW A;  2KJR A;  1P3Q U;  1WFY A;  2WDT B;  5DCN A;  4DDI D;  2DYM A;  4W9C A;  4ZRK A;  4E74 A;  1E8W A;  1RAX A;  4FUL A;  5D6J B;  2KXJ A;  5CX3 A;  3RYT A;  4NAW B;  3UQB A;  1D3Z A;  3DQV A;  2NVU I;  3PLV A;  3TIX A;  2M0X A;  4ANW A;  3L10 B;  2GBM A;  5JHB A;  3TCA A;  1KLV A;  3NZS A;  3PSE B;  3QC8 B;  1OQY A;  1YX6 B;  2K6Q A;  4GOC A;  3NOB A;  4EZL A;  2LD9 A;  2PEA A;  5FR6 A;  4GU2 A;  3JSV A;  3A4S C;  4HPM B;  4W9L A;  2MW5 A;  3U7D A;  3ZDM C;  2L0F A;  2JZZ A;  2Z0E B;  3HM6 X;  2BKR B;  1G6J A;  3W1S C;  2L00 B;  1TBE A;  3TJP A;  1WMH B;  2KTR A;  4NQL B;  2JF5 A;  4ASW C;  3PRM B;  4K7W A;  1V5O A;  4PS3 A;  2NPT A;  4LDT D;  1MG8 A;  2K8H A;  4OVU A;  5BO4 B;  3RD2 A;  2D07 B;  3BIN A;  3Q3J A;  4HVB A;  3RT3 B;  1E7V A;  2OOB B;  4KV2 A;  4N9F 4;  3R7Q A;  1YD8 U;  1GJZ A;  4DHZ B;  3DOW A;  4PS8 A;  2L7R A;  3JVZ X;  5DPT A;  3L08 A;  4LJO B;  4ANV A;  4W9K A;  5EDS A;  3PLU A;  2ZNV B;  3CMM B;  3EHV A;  3EC8 A;  1L2N A;  1L7Y A;  3A4R A;  5TR5 A;  1TTN A;  4E3C A;  2C7N B;  3I3T B;  1LM8 B;  2ZCB A;  3VHT C;  2JUO A;  2BYE A;  3T8M A;  5JZE B;  3VTU A;  2N1V A;  4BVU C;  3ZO5 B;  4MSQ B;  5DPR A;  4XZ4 A;  1YQB A;  4HLE A;  2GBN A;  2MP2 B;  2K1F A;  3DBR I;  3VUX A;  1GNU A;  5KHO A;  4FBJ B;  2ASQ A;  4MH0 E;  2MWS B;  4FN2 A;  4IC7 B;  2KLC A;  2IO3 B;  3AXC A;  5LXH A;  4W9F A;  3BY4 B;  3DBL I;  4A3P A;  2C60 A;  2N9X A;  4GIV A;  5D94 A;  4WWO A;  3KUD B;  4EOY A;  5D2M B;  3V61 A;  2Z59 B;  2KDF B;  3ML9 A;  4IWP A;  3WAP A;  5JH5 C;  2YVC A;  2M8S A;  2LGX A;  2O2V A;  4II3 B;  2PE6 B;  5C1Z A;  1E8Z A;  1WI0 A;  1YIW A;  4G50 A;  2D3G A;  4YL8 A;  4DHJ B;  4BOZ B;  1VCB A;  3QA8 A;  5IA7 A;  4PYU A;  4RMA A;  4XX5 A;  1WE7 A;  1E5W A;  1UH6 A;  2B3A A;  2KX3 A;  2N1W A;  4MSM B;  3OJ3 A;  4IWO A;  3B08 A;  2GMI C;  1I35 A;  3QX1 A;  4P7I A;  3IG3 A;  2OJR A;  4M8N A;  3UIO B;  4EKU A;  4FHK A;  1V5T A;  2G45 B;  1WIA A;  4KZ0 A;  3ZNG C;  4RM9 A;  3VQI A;  5CTR C;  3H1U A;  2PE9 A;  4RM8 A;  3TBL D;  4GGQ A;  1RRB A;  3HHM A;  1KM7 A;  3RZF A;  4FJY A;  4ZRI A;  2KFK B;  3IBE A;  4F1S A;  4X57 B;  1K8R B;  3DVG Y;  3VUY A;  3MJW A;  3QCA A;  4K7S A;  4NY0 A;  3VH4 B;  2KKC A;  4ANX A;  1WGD A;  2HTH A;  4CHK A;  3L17 A;  4GN1 A;  4TQ0 A;  2AL6 A;  1WXV A;  3QJZ A;  1LFD A;  4IG7 B;  2A5U A;  2JWZ A;  2LGY A;  4FJZ A;  3T9L A;  2IYD B;  1YX5 B;  3A9J A;  2KMA A;  1V49 A;  4WJN A;  3W1S A;  3ZTC A;  3WAN A;  3D32 A;  2YLM A;  4CO7 A;  3DVN U;  2C5L C;  1P0R A;  3P2B A;  4JLC A;  4W9D A;  5E6P A;  4KIK A;  3V62 A;  2DHZ A;  5HKH A;  2EMS A;  2LRU A;  1WXA A;  3ZIM A;  3DVN V;  4JQW C;  3H9D A;  3OJ4 B;  3WAM A;  5LXI B;  2G4S A;  2ZZP B;  2KAN A;  2XBB C;  2DYB A;  3APC A;  2RR9 A;  3A1Q B;  5AZG A;  1AAR A;  3LDZ E;  2KQ7 A;  1TZ1 A;  1NBF C;  1WX9 A;  2MBH A;  1WJN A;  1C1Y B;  1WM2 A;  2D2Q A;  2M1M A;  2XEW A;  3N30 A;  2MBB B;  3PZD A;  2O6V A;  3W1Y A;  2IO2 B;  3SHQ A;  3A9K B;  1GC7 A;  1Z5S B;  2AEH A;  2L8J A;  2MP2 A;  2AYO B;  2PPH A;  3TMP B;  4KIK B;  3A33 B;  3TL5 A;  1WGG A;  2L76 A;  2R2Q A;  4NPN A;  2GBR A;  1V9J A;  1WM3 A;  2LZ6 A;  2M17 A;  2W9N A;  2KZR A;  2LVQ A;  3K9P B;  4TUU A;  3IVF A;  1P1A A;  4BOS C;  2KK8 A;  1J0G A;  2IO1 B;  2LI5 A;  2DAF A;  2KNB A;  3VAW A;  2KOX A;  4IWQ A;  4AJY B;  3IHP C;  4FHJ A;  2HE7 A;  4GDL B;  2DZK A;  2FCQ A;  2RGF A;  4HJK A;  1WMH A;  3S2A A;  3VFK A;  3ZDT A;  2REX A;  5IAA C;  3JW0 X;  2DZI A;  4FAD A;  2LJ5 A;  4GXB A;  2GBK A;  4IW0 A;  2FUH B;  3R66 C;  2KJH B;  4WWP A;  4URK A;  2XK5 A;  4EFO A;  2M4N A;  5G55 A;  4NJ6 A;  5J18 A;  3OLM D;  2KTR B;  4ZYN A;  1EUV B;  2BKF A;  3KUZ A;  4LJP B;  3L54 A;  3X23 A;  2WX1 A;  4AOF A;  4ANU A;  1KOT A;  2KHW B;  2FIF A;  3RZW C;  4EZK A;  1GG3 A;  3APF A;  1R4M I;  2N7D A;  3NZU A;  1OEY J;  4KZC A;  1ZKH A;  1EF1 A;  4I6N B;  1OEY A;  2KVR A;  2I1K A;  1WXS A;  2CS4 A;  5AZF A;  4NQK E;  4W9J A;  1V80 A;  2LVO A;  5J2R A;  4W9H A;  4DHJ D;  1OGW A;  1V86 A;  3H7P A;  1Y8R C;  4WQO B;  3DBS A;  1CMX B;  2EKE C;  1KJT A;  1GC6 A;  4K1R B;  4NAW A;  3V60 A;  5AEK B;  3PV1 A;  2IY1 B;  3Q3F A;  2MLB A;  4MJS B;  2RPQ A;  3QK0 A;  4K7U A;  1IPG A;  2G3Q B;  2CR5 A;  3QHT A;  3PT2 B;  4MEL A;  4W9I A;  4BKS A;  2K8B A;  5J17 A;  2CU1 A;  2KC1 A;  2MBO A;  2FNJ B;  4IM3 A;  4LDT B;  3DBH I;  1U4A A; 
#chains in the Genus database with same CATH topology
 2LAS A;  2W55 A;  2N9L A;  3AU4 A;  4C7Z A;  3RNA C;  2FID A;  3AE9 B;  4BBN C;  4HK2 A;  1HZ5 A;  2YEP B;  1JWA D;  2UWQ A;  3PRP B;  2FCM A;  4H2A A;  2KDE B;  5LLI A;  3NHE B;  1UGM A;  3O65 B;  5L83 A;  3MC9 A;  5IKC M;  1JW9 D;  1BT0 A;  2QIL A;  4IDI A;  3U4E G;  4XWT A;  1WE6 A;  3U8Z A;  3B2G A;  3ZXR A;  2NR2 A;  1WRI A;  2K6D B;  4HKQ A;  1M94 A;  5E6N A;  4HXD A;  2G1E A;  2IBI B;  3A1Q A;  1K50 A;  4O1N A;  1M4V A;  4DXF A;  3CWI A;  3ZNZ B;  2WXQ A;  1Z2M A;  2LXA A;  4MT5 A;  1P9D U;  2Y5B B;  3RN9 C;  3KH0 A;  4BKS D;  1EWC A;  2NPT B;  2KWU B;  3URY A;  1SJE D;  1N63 A;  4KDI C;  4J3O D;  1WJ6 A;  1ZDV A;  3H7S A;  3UI3 A;  1C9F A;  1D5X C;  4M8M A;  1ZOY B;  2ZPY A;  2BF8 B;  3EFC A;  2JT4 B;  1FXT B;  1YQ4 B;  3PZ8 A;  2NBU A;  4RFB A;  3DWM A;  3KQ4 A;  2C9W B;  1B1Z A;  3NVY A;  2R61 A;  3H6N A;  1ESF A;  2C7H A;  2BTE A;  2O6V D;  2ZVN A;  4N58 A;  1R4N I;  4XE0 A;  1WGR A;  1F52 A;  4KGT A;  1D6E C;  5EE1 A;  3DBL B;  3Q3M C;  1HTQ A;  4IM2 A;  1FXI A;  4HRS A;  2ZJD A;  1SE9 A;  4BFR A;  3Q69 A;  3V6C B;  2KYW A;  1H4R A;  4M0W B;  1V1P B;  2M0A A;  2JZP A;  4A90 A;  1UZX B;  2CHZ A;  4DXA B;  4JIO U;  4GMV A;  1WX8 A;  2Y5C A;  4BZA A;  1EO6 A;  3AI5 A;  2ZEQ A;  1UBI A;  3NS1 A;  3PGE A;  2KMC A;  1I7H A;  2WGS A;  3ZJU A;  1HZ6 A;  3MP9 A;  2KLG A;  3O13 A;  3AB5 A;  1UNS A;  1F9J A;  2BGF A;  2NBW B;  1WY8 A;  4A55 A;  4JL9 A;  1YN4 A;  1RM6 C;  1RFK A;  3PHW B;  2PJH A;  1QQR A;  2QIE B;  3HVD A;  3N1Z C;  1YJ1 A;  1WXQ A;  2PIA A;  2B76 B;  3N3K B;  1V97 A;  2KWD A;  3AN1 A;  4TQ1 A;  3I5J C;  1NI2 A;  2IND C;  4N59 A;  3APD A;  3BVM A;  4WJQ A;  2DNF A;  2J0M A;  4ICV A;  3QIJ A;  3AE8 B;  1GPX A;  4WWN A;  1XQQ A;  4LK0 M;  1P7E A;  3NS8 A;  4B6W A;  3PRZ A;  3DBH B;  2VZK D;  1WGK A;  1YN5 A;  4MJS A;  3GP7 A;  4PS7 A;  3AM9 A;  1EF5 A;  1ZUD 2;  2O6V B;  4EEW A;  2ZNV C;  3P4S B;  2W82 A;  4ZYS A;  1YN3 A;  4M02 A;  2UU7 A;  5GMV A;  2IZV B;  3AMZ A;  2K5P A;  3LJ3 A;  4JGH B;  2V9H A;  3GZN B;  1UWM A;  3L0W B;  2BVC A;  4A3O A;  1WR1 A;  2KQS A;  2ZCC A;  3IAM 1;  1GB4 A;  4B0E A;  2V1Y A;  2QHO A;  4LNO A;  4I6L B;  1SB3 C;  5DCN A;  2L1A A;  2WDT B;  4W9C A;  4E74 A;  1RAX A;  4FUL A;  2KXJ A;  3RYT A;  4NAW B;  3L10 B;  5JHB A;  3TCA A;  1KLV A;  3QC8 B;  4ARC A;  1EU3 A;  2LD9 A;  5FR6 A;  3U7D A;  2JZZ A;  2Z0E B;  3SFE B;  1G6J A;  3W1S C;  2L00 B;  1ZDX A;  3T3O A;  2NPT A;  4HVB A;  3BIN A;  3Q3J A;  3RT3 B;  2OOB B;  2EEL A;  1V1O A;  4DHZ B;  4PS8 A;  2L7R A;  3L08 A;  2GLS A;  4LJO B;  2AQ3 B;  1TTN A;  4JX1 C;  1T6B X;  2LUM A;  1LM8 B;  4OZC A;  3VTU A;  2NTT A;  4HLE A;  2PVO D;  5IOI A;  2K1F A;  3DBR I;  1L4D B;  5KHO A;  4FBJ B;  2Y5P A;  1TT5 B;  4FN2 A;  4IC7 B;  3TSS A;  5I4D A;  1ZXI A;  2KLC A;  2IO3 B;  4W9F A;  3BY4 B;  1JAL A;  4EOY A;  1DYQ A;  2Z59 B;  1SIJ A;  2KDF B;  3WAP A;  1KFY B;  5C1Z A;  2K22 A;  5D3D A;  1J7B A;  4M0W A;  1C78 A;  1WE7 A;  2KVZ A;  4RF1 A;  1E5W A;  4MSM B;  3ZQ4 A;  3BK2 A;  4L23 A;  4IWO A;  3W5U B;  3ZXV A;  1TY2 A;  3IG3 A;  2OJR A;  3TUO A;  3FAH A;  1SF0 A;  3HVZ A;  2G45 B;  3ZJV A;  4KZ0 A;  4RM8 A;  3HHM A;  2OHF A;  3RNG C;  2TSS A;  2KAC A;  4F1S A;  4S0R A;  4NY0 A;  3VH4 B;  1WGD A;  3L17 A;  4WAF A;  2CJO A;  4R3D A;  1N60 A;  4WH4 A;  2MJD A;  1FNV A;  3A9J A;  1V49 A;  5LNK 1;  3WAN A;  1MVK A;  3DVN U;  1P0R A;  3CIR B;  3V62 A;  5HKH A;  3Q8F A;  3WAM A;  1L6V A;  1I4Q A;  2ZZP B;  2KAN A;  1AAR A;  3LDZ E;  2KQ7 A;  1NBF C;  3N30 A;  2MBB B;  2O6V A;  3W1Y A;  1F0Z A;  3MJ5 A;  1CJE A;  4WIP A;  2AEH A;  2PPH A;  4NZL B;  3TL5 A;  4GLS C;  5BMH A;  1C4C A;  2IPK D;  2LVQ A;  4TUU A;  3IVF A;  2KK8 A;  2IO1 B;  2LI5 A;  1XEE A;  2D5G A;  2DAF A;  2KOX A;  4AJY B;  3IHP C;  4YXD B;  2HE7 A;  3S2A A;  1WMH A;  2WXG A;  5IAA C;  3JW0 X;  1PDX A;  4WWP A;  4URK A;  4IOI E;  5J18 A;  3OLM D;  2KTR B;  3Q8B A;  1MJD A;  4JWU C;  4AOF A;  4ANU A;  1GG3 A;  3APF A;  5G5H A;  1OEY J;  4KZC A;  1ZP0 B;  1F2R I;  1QIL A;  2KVR A;  2CS4 A;  5AZF A;  4W9J A;  1V80 A;  1OGW A;  1TS2 A;  3Q8A A;  4WQO B;  3DBS A;  1KJT A;  5AEK B;  4YTN B;  3RNB C;  1C4P A;  2KAJ A;  5J17 A;  4K3B A;  2IO0 B;  5FK9 C;  2IGG A;  5JHA A;  2KQ4 X;  3OAW A;  4MAC A;  1IP9 A;  5CHF A;  4KSK C;  4DHZ E;  2MBE A;  1ET9 A;  1IGC A;  2KC2 A;  4MDK E;  4DQO C;  3FIL A;  1FCL A;  2JXT A;  3Q3N C;  1OQQ A;  3ZRC A;  2GBJ A;  3PS6 A;  1A5R A;  4ZDV A;  3VR8 B;  1Y56 A;  4IUM B;  4F7Z A;  2W3R A;  3QQ8 B;  1UD7 A;  5EE9 A;  1YNT E;  2L0T A;  2I38 A;  3SR6 A;  1TY0 A;  3JSV B;  4MGI E;  4TV3 A;  1GUA B;  2LWP A;  1XT9 B;  5FR3 A;  1DGJ A;  1J19 A;  1VZ7 A;  4GSW A;  3DHH C;  5CHW A;  4BAX A;  4YT0 B;  1HEZ E;  1MI0 A;  1TS5 A;  4L2Y A;  2PW9 A;  1WXM A;  3Q2A C;  5EE3 A;  5H8Y E;  2WXF A;  3ZUN A;  3NVW A;  2DAJ A;  1L0V B;  3PO0 A;  4IKG A;  2KFJ A;  5FKA C;  2DBY A;  3KW5 B;  1QOA A;  5L95 C;  1PQS A;  3ZNI D;  3VTW A;  4NNJ B;  2VRR B;  4QAY A;  3ZGZ A;  1LXD A;  1HTO A;  1FNU A;  1K52 A;  1RLF A;  3B9J A;  2JQR B;  3R7R A;  2LMC A;  2IJ0 A;  2QMT A;  2IDY A;  3KLS X;  2AQ1 B;  4K81 A;  4BBN F;  2CHX A;  1RFA A;  2KDB A;  3HM3 A;  4YTM B;  4BKG A;  3AEA B;  3R3M A;  4F8C B;  5T8I A;  3DWG C;  1WH3 A;  3A9J B;  3CF6 E;  2K9X A;  2I1J A;  1SE2 A;  1HXY D;  5E6J A;  2N9E B;  3PHX B;  1KLU D;  2LGI A;  3CST A;  1LQB A;  2CHW A;  3H8H A;  2AWT A;  5CHV C;  1V6E A;  3W2D A;  4DBG A;  2DWQ A;  1WYW B;  2C7M B;  1SEB D;  4HCN B;  4A9A A;  2BYT A;  2NCN A;  4RCO A;  4AP4 C;  2HD5 B;  1WSP A;  4HPP A;  2JX5 A;  3N32 A;  1PYW D;  1UBQ A;  1OTR B;  2FCS A;  3RCZ A;  4B0M A;  1J8C A;  2K3U A;  2WDV B;  5G2N A;  1WR6 E;  4P6V F;  3PVL A;  5D3I B;  4KKJ A;  1OQR A;  3EGR A;  3C0R B;  3ZLZ A;  2ZPN A;  3EUB 2;  1WJ4 A;  2KTF A;  3PRE A;  2NS5 A;  2WQY B;  4XDD A;  5JXV A;  3AED B;  1Q1O A;  2BT6 A;  1UF0 A;  2K8C A;  4FA6 A;  2J0J A;  1E90 A;  1WZ0 A;  3ONS A;  2L52 A;  3K9O B;  4G3X B;  4WJP A;  1Q10 A;  2WXJ A;  1E8Y A;  1DOI A;  5D7G A;  3ZJT A;  4AWJ A;  1L0X B;  2LGD A;  2M19 A;  1JWU D;  1C76 A;  1Q5W B;  2AX5 A;  2J4X A;  1WZ3 A;  2AQ2 B;  3VDZ A;  3AE3 B;  3MFG A;  1VZ8 A;  1ENF A;  3WIM A;  4DDG D;  2MRP A;  2CKH B;  4TKN A;  3UF8 A;  2NBV B;  2D11 A;  3KVF B;  1TKE A;  1FO4 A;  2WU2 B;  4CYE A;  3OG5 A;  1ACC A;  2DYM A;  5CX3 A;  1DOY A;  3DQV A;  2NVU I;  3PLV A;  2PVG C;  2GBM A;  2WXH A;  1AN8 A;  3NZS A;  3PSE B;  1YX6 B;  2K6Q A;  3FIL B;  4HPM B;  4W9L A;  2L0F A;  4REZ A;  1WMH B;  2D3A A;  4NQL B;  3BYY B;  3LYY A;  4LDT D;  5BO4 B;  2D07 B;  1BUI C;  2LFI A;  2BQQ A;  3WCQ A;  5IO9 A;  3DOW A;  4ANV A;  4W9K A;  5EDS A;  4ITK A;  3IXS A;  3EC8 A;  1L7Y A;  2L32 A;  4E3C A;  3GB1 A;  5AUK A;  3VHT C;  1P7F A;  3GS2 A;  4BVU C;  4XZ4 A;  3HUI A;  2GBN A;  1PGB A;  4NJC A;  4RNA A;  2MWS B;  2L83 A;  3N1Y C;  3AXC A;  2WLB A;  3DBL I;  4A3P A;  5D94 A;  4WWO A;  5D2M B;  3ML9 A;  4CQN A;  5JH5 C;  1XO3 A;  2YVC A;  2O2V A;  1UUP A;  3U7Z A;  1E8Z A;  1YIW A;  2M56 B;  2D3G A;  4YL8 A;  4BOZ B;  1FFV A;  3BWU D;  5IA7 A;  1ZPS A;  1MHX A;  2N1W A;  4AS1 A;  2KMM A;  3OJ3 A;  4A8X C;  1TZO A;  4RGO S;  5BYR A;  2J42 A;  4M8N A;  1V5T A;  2PTL A;  3C8Y A;  3ZNG C;  1UGJ A;  3VQI A;  2PE9 A;  4EE2 A;  2BS4 B;  1AW7 A;  3ZYY X;  4ZRI A;  3DVG Y;  3MJW A;  4XWW A;  2IGH A;  1A70 A;  1WXV A;  4FJZ A;  3T9L A;  5BMG A;  4CO7 A;  2QJL A;  4JLC A;  4W9D A;  2RDG A;  5E6P A;  1WXA A;  4JQW C;  3ABV B;  2WXO A;  2XBB C;  2DYB A;  5AZG A;  3RFZ B;  3PZD A;  2IO2 B;  3N1X C;  1LO5 D;  2L8J A;  1K53 A;  2AYO B;  3TMP B;  1WGG A;  2L76 A;  2R2Q A;  1WM3 A;  2LZ6 A;  2M17 A;  4RF0 A;  3K9P B;  4BOS C;  1J0G A;  3AEF B;  3VAW A;  2BS3 B;  1FCC C;  2REX A;  4TSS A;  4KKI A;  2FUH B;  3AE1 B;  2HDE A;  2E6X A;  2XK5 A;  4EFO A;  5G55 A;  4ZHP A;  1EUV B;  4A6Q A;  3L54 A;  1SXT A;  3X23 A;  2KHW B;  1R4M I;  2N7D A;  2FBW B;  1ZKH A;  4C56 C;  4I6N B;  1OEY A;  2ONQ A;  2HJ1 A;  4USA A;  1GOZ A;  3H7P A;  1PFD A;  4MM3 B;  3V60 A;  1VZ6 A;  5G5G A;  3PV1 A;  3Q3F A;  4MJS B;  4K7U A;  2Q5W D;  3B2F A;  3DHI C;  4BKS A;  2K8B A;  2WXL A;  4K3C A;  1YQ3 B;  4XGA B;  1RYJ A;  3AEG B;  2INC C;  2Z8L A;  3BVZ A;  2MHJ A;  3QAR A;  1IBX B;  3B1L X;  4HDO A;  2RD0 A;  4G0N B;  2WHI A;  4LCD E;  4YWG G;  1XCT L;  1MPE A;  3J9C A;  1TKG A;  2CU3 A;  2KWC A;  3UIP B;  3X0W A;  2MX2 A;  1QOF A;  1I42 A;  2J0K A;  2ZVO A;  3AE6 B;  1Q0W B;  3UGB B;  1NEK B;  3AE5 B;  4GDL A;  3LXF A;  3M62 B;  4KDL B;  2ICI A;  1QZE A;  3NVV A;  5DPW A;  1FNW A;  2WXR A;  4MGK E;  3NUH B;  4KSL C;  4S17 A;  4A20 A;  2JY6 A;  2WXP A;  3VR9 B;  4KVG B;  2AL3 A;  4NAM A;  4RGN A;  3WAO A;  2Z0D B;  2KO3 A;  4ZRJ A;  1E7P B;  2ACZ B;  1BML C;  1K51 A;  3I63 C;  3L16 A;  4P1C C;  4B95 A;  4DK5 A;  4IM0 A;  4UDU C;  2MBQ A;  3SFD B;  2MCN B;  1IGD A;  3RMK C;  4B9K A;  4DWF A;  3SU8 X;  4ZRQ A;  1D5M C;  4HRO A;  2JRI B;  3VTV A;  4BKT A;  1WYG A;  1SGH A;  2WDQ B;  1FEH A;  2J7Q B;  1I4X A;  1XCQ L;  1S1Q B;  2WXN A;  1P98 A;  2DYO A;  1WF9 A;  1VDV A;  2LHE A;  2INN E;  1SE4 A;  2JRH A;  3BII D;  2SAK A;  4FLH A;  2WWZ A;  1QOG A;  2EKI A;  4DXG A;  2V0G A;  4I6P A;  2WU5 B;  4XDC A;  1JWB D;  3C19 A;  3ZW3 A;  1LGR A;  3V05 A;  1F77 A;  2O2V B;  2BYF A;  5BYQ A;  1L6U A;  2JPH A;  1R4N B;  4AQ7 A;  4JWS C;  3IFW B;  4C7Y A;  2N9P C;  3BYT B;  4GB9 A;  3PPA A;  2BPS A;  1JRU A;  1NEN B;  2UYZ B;  3VH3 B;  1YJJ A;  3N9Y C;  3U30 A;  2A4Z A;  3HK0 A;  2N9K A;  1C79 A;  2MH7 A;  3P1M A;  2MQJ A;  1L4Z B;  2W54 A;  4AUQ C;  1VLB A;  3U2S C;  4EUT A;  3M63 B;  4HCP B;  2I2Y A;  2KX0 A;  4HDQ A;  3DCG A;  3EEC A;  3IT6 B;  3P4P B;  1L0Y B;  2KD0 A;  2WP9 B;  3GE8 C;  1V2Y A;  3M95 A;  3NVZ A;  4W9G A;  1C3T A;  4EZJ A;  2RSU A;  1WJU A;  2WXM A;  4D2K A;  3DDC B;  1TYG B;  2N7E A;  3PTF C;  4ICU A;  3WAL A;  3VUW A;  3GZN I;  3L13 A;  1D5Z C;  1TIF A;  2N4F A;  3CSF A;  5HFY A;  1IYF A;  4LNN A;  4M00 A;  2RDH A;  2MSE D;  2IY0 B;  3DVG X;  3EFU A;  4P1B C;  1FRR A;  2KN5 A;  3V3X A;  2MA9 B;  4WQM A;  3KYD D;  5E6O A;  2HJ8 A;  2V4L A;  3SDL C;  1FXA A;  3QWZ B;  1TJE A;  2K39 A;  3FC4 A;  1WFY A;  4DDI D;  1F2R C;  2MJ3 A;  4ZRK A;  1E8W A;  1D3Z A;  3UQB A;  3Q8C A;  3TIX A;  2M0X A;  4ANW A;  3DHG C;  2PKO A;  4GOC A;  1STE A;  4M01 A;  2PEA A;  2MW5 A;  1N6Z A;  2G9H D;  3ZDM C;  1MG4 A;  1ZE3 D;  1SBB B;  2BKR B;  1FIQ A;  2X38 A;  2JF5 A;  4ASW C;  4K7W A;  1V5O A;  4PS3 A;  4OVU A;  1MG8 A;  2K8H A;  3TEX A;  2VZK B;  3AE2 B;  3R7Q A;  2KN4 A;  4KV2 A;  1YD8 U;  3JVZ X;  4LTU A;  5DPT A;  1E10 A;  3PLU A;  2ZNV B;  3EHV A;  1L2N A;  5HI1 A;  3A4R A;  3I3T B;  2JUO A;  5JZE B;  1FMA D;  2N1V A;  3ZO5 B;  2QEJ C;  2MP2 B;  4MH0 E;  1QKZ A;  3AEB B;  3NJT A;  2FUG 1;  3ETR A;  3P4R B;  1QF6 A;  4GIV A;  3KUD B;  2X8X X;  3V61 A;  1FPY A;  3MC8 A;  2M8S A;  2LGX A;  3R2I A;  1KLG D;  4II3 B;  1YMH E;  2PE6 B;  3GE3 C;  4G50 A;  4DHJ B;  3QA8 A;  4US8 A;  1UH6 A;  2B3A A;  2KX3 A;  1XLN A;  1SSN A;  3BVG A;  1NI3 A;  2GMI C;  3TEW A;  3QX1 A;  1XXG A;  4EKU A;  1NVI D;  1V8C A;  5CTR C;  3TBL D;  2HTM E;  1RRB A;  3Q6B A;  1KM7 A;  1FD6 A;  2KFK B;  2GI9 A;  3IBE A;  1K8R B;  1R4M B;  3VUY A;  3QCA A;  2LHD A;  3E9S A;  1N62 A;  5HG2 A;  1XLP A;  2AL6 A;  3QJZ A;  1LFD A;  2A5U A;  2LGY A;  3ZTC A;  5HHD G;  3D32 A;  2YLM A;  1NYQ A;  2C5L C;  3P2B A;  1R7S A;  4KIK A;  2DHZ A;  2QDF A;  1ZXH A;  2LRU A;  5LXI B;  3H9D A;  2RR9 A;  3A1Q B;  1ROE A;  1WX9 A;  2M1M A;  1WJN A;  1C1Y B;  2D2Q A;  2XEW A;  1IUE A;  4C80 A;  1JWM D;  3SHQ A;  1GC7 A;  1Z5S B;  4XYC A;  2N0S B;  1UWX A;  1C77 A;  3I9V 1;  4HJK A;  4GDL B;  2RGF A;  4WUR A;  5AUI A;  3AE4 B;  2KJH B;  1TKY A;  1KH0 A;  2M4N A;  3N20 C;  1WWT A;  3RI7 C;  4LJP B;  2BKF A;  3KUZ A;  2VH2 A;  1XLO A;  3FKY A;  1T5X D;  2WX1 A;  2MJE A;  1EU4 A;  3RZW C;  2E3T A;  4LNF A;  2ZW1 A;  3NZU A;  2RDB C;  3PZ7 A;  1WXS A;  4DHJ D;  4RGT A;  1T0Q C;  4LNK A;  1V86 A;  4RH6 A;  1GC6 A;  1F1H A;  3KWV A;  2RPQ A;  3QK0 A;  5IP4 D;  3TEY A;  4FXC A;  3QHT A;  2W3S A;  3PT2 B;  4MEL A;  3BZD B;  4OHJ A;  3AEE B;  2CU1 A;  1D4B A;  2KC1 A;  4IM3 A;  3KWL A;  4LDT B;  3DBH I;  4YSX B;  2MEK A;  3ML8 A;  4OVV A;  3ZKJ C;  2WX0 A;  3AUL A;  2VH1 A;  2PMV A;  3ZVV A;  3Q3O C;  3VVW B;  3L4P A;  1E9M A;  3ALB A;  3VXW A;  3AE7 B;  1N5X A;  2DZM A;  2JWU A;  3R2T A;  3ECI A;  4AJW A;  3MHS D;  4MEM A;  3EA6 A;  2YEP F;  1AWD A;  1KF6 B;  3T3N A;  2V3N A;  3AU5 A;  2V3S A;  1JCK B;  4KX6 B;  4YSY B;  4FJV B;  2BS2 B;  2DZJ A;  2RPV A;  2Y3A A;  1TGZ B;  3RPF C;  1GAQ B;  2L3Z A;  4WJO A;  1X1M A;  2LRW A;  3QAQ A;  1UEL A;  2SEB D;  4OZB A;  2DX5 B;  4HWI B;  3RNE C;  5TSS A;  1XLQ A;  3UIN B;  3V6E B;  3DBR B;  1WGH A;  4C00 A;  3A9K A;  5IN7 A;  4P16 A;  2R2O A;  3H7P B;  4MM3 A;  1WRD B;  4OW0 A;  1T0S C;  2NMQ A;  2KJ6 A;  5C23 A;  4GDK A;  2J53 A;  4US9 A;  3W5V B;  1JRO A;  1CZP A;  4WAA A;  3I57 A;  2KWV B;  1QT9 A;  3ZTD A;  2JVC A;  1YOV B;  1ISN A;  3JYU A;  4GDK B;  3VRA B;  2D10 A;  1TS3 A;  3M3J A;  3ZRF A;  1L5P A;  3LB8 C;  1HQR D;  4KGR A;  1DOX A;  3SD5 A;  2BB5 A;  4MH8 A;  4L1B A;  2NTS A;  3IT4 B;  1WGY A;  2KDI A;  1H8C A;  2WXI A;  4NJ7 A;  4OVZ A;  3DPD A;  1SIF A;  1VRA B;  3UQA A;  2XNA C;  4JE3 B;  3AV8 A;  1T0Y A;  2K0P A;  2J52 A;  3MTN B;  3MC0 B;  3RUL A;  1VD2 A;  4C4V A;  1T0R C;  1SE3 A;  5BYS A;  4E71 A;  2K25 A;  1IBX A;  5KHQ A;  5C2T B;  2GRI A;  2G4D B;  3GOE A;  4XC2 A;  2EMT A;  3R8B A;  1WX7 A;  2D3C A;  1JRP A;  3HIZ A;  4HJG E;  4G11 A;  3B0A A;  1XD3 B;  5MPO A;  1E7U A;  2ON8 A;  3NY5 A;  2BWE S;  2DEN B;  1XF5 L;  2JU6 X;  3KYC D;  2V4I B;  2CJN A;  4MGZ E;  1V81 A;  4ZRP A;  1S3S G;  1MHH E;  2LUE A;  1ZGU B;  2JXX A;  5BMI A;  1FRD A;  2BYV E;  2JSV X;  2BWF A;  4ARI A;  4W9E A;  1N5W A;  4J6I A;  2FCN A;  1E0Z A;  2FAZ A;  2WYQ A;  4ZHO A;  1YJI A;  2JZ3 B;  3ENE A;  1ZW7 A;  2LVP A;  5DPS A;  4YSZ B;  4OZA A;  4PYZ A;  1HE8 A;  1I4P A;  1NDD A;  2LXC A;  4ACF A;  4II2 B;  3RUI B;  3ZNH B;  1PGA A;  2LGS A;  3HRD D;  2KFK A;  5AZH A;  1E6E B;  4HPL B;  4ZOH C;  5EE0 A;  3P63 A;  1FFU A;  4MGY E;  2OED A;  1KTK A;  2L05 A;  3AH7 A;  3Q8E A;  3MHZ A;  4KGS A;  1E8X A;  1OFF A;  5GXG B;  3WA0 A;  1MFW A;  3KUC B;  2XK5 B;  3NRZ A;  2GOW A;  3BK1 A;  2KJR A;  1P3Q U;  5D6J B;  1I4H A;  2QCZ A;  1OQY A;  3NOB A;  4EZL A;  2V3P A;  3P4Q B;  4GU2 A;  3JSV A;  3OWE B;  3A4S C;  1PUT A;  4LLG M;  1VR9 A;  3HM6 X;  2QSD A;  1TBE A;  2RMM A;  3TJP A;  2ZW0 A;  2KTR A;  3PRM B;  3RD2 A;  1PGX A;  1AYF A;  1CK1 A;  1E7V A;  4N9F 4;  2JYE A;  1GJZ A;  1B9R A;  2H88 B;  3CMM B;  2DLB A;  5TR5 A;  2C7N B;  2GB1 A;  2ZCB A;  2BYE A;  3T8M A;  2QC8 A;  4MSQ B;  5DPR A;  5H92 C;  1YQB A;  3VUX A;  1GNU A;  3TEZ A;  2ASQ A;  1FM0 D;  2BW2 A;  5LXH A;  2C60 A;  2N9X A;  1SJH D;  4IWP A;  2INP E;  2BB6 A;  4RGM A;  1WI0 A;  2H89 B;  1VCB A;  4PYU A;  4RMA A;  2LEK A;  2WS3 B;  4XX5 A;  1QLB B;  1NYR A;  3B08 A;  1N61 A;  1VJK A;  2PLP A;  1I35 A;  4P7I A;  3NZ3 A;  3UIO B;  4FHK A;  1WIA A;  3P42 A;  3H1U A;  4GGQ A;  3AEC B;  3RZF A;  2JYT A;  4FJY A;  4X57 B;  1RWS A;  4K7S A;  2KKC A;  4ANX A;  2HTH A;  4CHK A;  4GN1 A;  3RNF C;  4TQ0 A;  4IG7 B;  2JWZ A;  2IYD B;  1YX5 B;  3W1S A;  2KMA A;  4WJN A;  4YTP B;  4PK1 A;  1KRH A;  1JQ4 A;  2KT7 A;  2XN9 C;  1TS4 A;  2EMS A;  3ZIM A;  3DVN V;  4PT5 A;  3VRB B;  3OJ4 B;  2G4S A;  3APC A;  1BXT A;  4WWM A;  1CQV A;  3NG0 A;  1TZ1 A;  5C3J B;  2MBH A;  1WM2 A;  1QOB A;  3A9K B;  2MP2 A;  1J7C A;  4KIK B;  2OJW A;  3A33 B;  4NPN A;  2GBR A;  1V9J A;  2W9N A;  2KZR A;  2LJI A;  1P1A A;  1T3Q A;  1JWS D;  4N6E B;  2KNB A;  4IWQ A;  2FE8 A;  4FHJ A;  3ZDT A;  2DZK A;  2FCQ A;  4C4V B;  1ET6 A;  3E56 A;  3VFK A;  4Q2J A;  3Q14 C;  2DZI A;  3SEB A;  4FAD A;  2LJ5 A;  4GXB A;  2GBK A;  4TMA B;  4HKZ E;  4IW0 A;  1EM7 A;  1HA5 A;  3R66 C;  1J7A A;  3RNC C;  4LNI A;  4NJ6 A;  4ZYN A;  1I4R A;  1JML A;  1KOT A;  2FIF A;  4EZK A;  2N7J A;  3W9C B;  3IAS 1;  1EF1 A;  4JPS A;  2I1K A;  2KDM A;  2IGD A;  4NQK E;  2WNM A;  2LVO A;  5J2R A;  4W9H A;  3U52 E;  1GB1 A;  1Y8R C;  1I4G A;  4NAW A;  1CMX B;  2EKE C;  4HEA 1;  4K1R B;  1V1P A;  2IY1 B;  2BBC A;  2MLB A;  1IPG A;  2D3B A;  2WDR B;  1EWY C;  2G3Q B;  2CR5 A;  4W9I A;  1C4A A;  2WXK A;  2MBO A;  2FNJ B;  4RM9 A;  1U4A A; 
#chains in the Genus database with same CATH homology
 2LAS A;  2IO0 B;  3AU4 A;  3ML8 A;  4OVV A;  3ZKJ C;  5JHA A;  2WX0 A;  3AUL A;  3OAW A;  2FID A;  4BBN C;  4HK2 A;  3ZVV A;  3VVW B;  3ALB A;  2UWQ A;  3QAR A;  3VXW A;  1IP9 A;  5CHF A;  3PRP B;  2FCM A;  3B1L X;  4KSK C;  2KDE B;  4HDO A;  2DZM A;  2RD0 A;  5LLI A;  2MBE A;  4DHZ E;  3NHE B;  1UGM A;  3O65 B;  3ECI A;  5L83 A;  2KC2 A;  4G0N B;  4MDK E;  4AJW A;  3MHS D;  4MEM A;  1BT0 A;  4LCD E;  3ZRC A;  2GBJ A;  1WE6 A;  3PS6 A;  3U8Z A;  1A5R A;  3AU5 A;  4ZDV A;  2V3S A;  2NR2 A;  2K6D B;  2KWC A;  3UIP B;  4IUM B;  3X0W A;  4F7Z A;  2MX2 A;  4FJV B;  2DZJ A;  1M94 A;  1I42 A;  3QQ8 B;  1UD7 A;  1TGZ B;  5E6N A;  4HXD A;  2L3Z A;  2L0T A;  2J0K A;  2ZVO A;  4WJO A;  1X1M A;  2LRW A;  3JSV B;  3QAQ A;  1Q0W B;  2IBI B;  4MGI E;  3UGB B;  3A1Q A;  4TV3 A;  1UEL A;  1GUA B;  2DX5 B;  2LWP A;  4HWI B;  1XT9 B;  3ZNZ B;  4GDL A;  1J19 A;  4GSW A;  1Z2M A;  2LXA A;  3M62 B;  4KDL B;  5CHW A;  1P9D U;  2Y5B B;  3KH0 A;  3UIN B;  1QZE A;  4BKS D;  5DPW A;  3V6E B;  1WGH A;  4MGK E;  2NPT B;  4KSL C;  4A20 A;  2KWU B;  2JY6 A;  4KDI C;  3A9K A;  1WXM A;  1WJ6 A;  3H7S A;  4KVG B;  4M8M A;  2AL3 A;  2R2O A;  2ZPY A;  3ZUN A;  3H7P B;  2BF8 B;  1WRD B;  4MM3 A;  2DAJ A;  2JT4 B;  2KJ6 A;  5C23 A;  1FXT B;  4GDK A;  2KFJ A;  2NBU A;  3KW5 B;  5L95 C;  2C9W B;  3WAO A;  4WAA A;  1PQS A;  2Z0D B;  3ZNI D;  2KO3 A;  2KWV B;  4ZRJ A;  3VTW A;  3H6N A;  4NNJ B;  2VRR B;  3ZTD A;  1LXD A;  2C7H A;  2JVC A;  3L16 A;  1RLF A;  2O6V D;  1ISN A;  2ZVN A;  3JYU A;  3R7R A;  4B95 A;  4DK5 A;  4IM0 A;  4GDK B;  2MBQ A;  1R4N I;  2MCN B;  4B9K A;  4DWF A;  3SU8 X;  1WGR A;  2D10 A;  2JRI B;  3VTV A;  3M3J A;  3ZRF A;  4BKT A;  4K81 A;  4BBN F;  2CHX A;  1SGH A;  4IM2 A;  1RFA A;  2KDB A;  3HM3 A;  2J7Q B;  4BKG A;  3R3M A;  3SD5 A;  4F8C B;  1S1Q B;  1P98 A;  1WH3 A;  2ZJD A;  1SE9 A;  2DYO A;  3A9J B;  3CF6 E;  1WF9 A;  4BFR A;  3V6C B;  1WGY A;  1H4R A;  4M0W B;  2I1J A;  2KDI A;  1H8C A;  4NJ7 A;  2JRH A;  3DPD A;  1UZX B;  2CHZ A;  4DXA B;  4JIO U;  4GMV A;  1WX8 A;  2N9E B;  4FLH A;  1SIF A;  2WWZ A;  3PHX B;  3CST A;  1EO6 A;  3AI5 A;  1LQB A;  2CHW A;  1UBI A;  2ZEQ A;  3UQA A;  4I6P A;  1T0Y A;  2AWT A;  5CHV C;  1V6E A;  3MTN B;  3ZW3 A;  4DBG A;  3PGE A;  3RUL A;  1VD2 A;  2KMC A;  1WYW B;  2C7M B;  4HCN B;  2O2V B;  4E71 A;  2BYF A;  2K25 A;  2NCN A;  2KLG A;  2JPH A;  5KHQ A;  2G4D B;  4AP4 C;  3GOE A;  4XC2 A;  3IFW B;  2BGF A;  1F9J A;  2HD5 B;  2N9P C;  2EMT A;  4GB9 A;  1WX7 A;  3PPA A;  3N32 A;  2BPS A;  3HIZ A;  1JRU A;  2NBW B;  1UBQ A;  1WY8 A;  2UYZ B;  1OTR B;  3B0A A;  4G11 A;  3VH3 B;  2FCS A;  1XD3 B;  3RCZ A;  1E7U A;  1J8C A;  3U30 A;  3NY5 A;  2BWE S;  2A4Z A;  2DEN B;  3HK0 A;  4JL9 A;  5G2N A;  3PHW B;  3KYC D;  1WR6 E;  2PJH A;  2MQJ A;  3PVL A;  4MGZ E;  1V81 A;  1YJ1 A;  1S3S G;  3C0R B;  2LUE A;  3ZLZ A;  2ZPN A;  1ZGU B;  4AUQ C;  2JXX A;  4EUT A;  3N3K B;  2BYV E;  1WJ4 A;  3M63 B;  2BWF A;  2KTF A;  3PRE A;  4HCP B;  4TQ1 A;  2KX0 A;  2NS5 A;  4HDQ A;  1NI2 A;  3DCG A;  3EEC A;  4W9E A;  3APD A;  2KD0 A;  4WJQ A;  4J6I A;  2FCN A;  1Q1O A;  2FAZ A;  1V2Y A;  2WYQ A;  3M95 A;  4W9G A;  2J0M A;  2JZ3 B;  4ICV A;  1C3T A;  3QIJ A;  3ENE A;  1ZW7 A;  4EZJ A;  2LVP A;  2RSU A;  4WWN A;  5DPS A;  1XQQ A;  2K8C A;  4FA6 A;  2J0J A;  1WJU A;  3NS8 A;  1E90 A;  1WZ0 A;  4PYZ A;  3ONS A;  4B6W A;  3PRZ A;  1HE8 A;  1NDD A;  3DDC B;  3K9O B;  2N7E A;  2LXC A;  4G3X B;  3PTF C;  4WJP A;  4ICU A;  3WAL A;  4II2 B;  1E8Y A;  3RUI B;  3GZN I;  3VUW A;  4MJS A;  5D7G A;  3L13 A;  2N4F A;  4PS7 A;  1EF5 A;  2O6V B;  3CSF A;  4EEW A;  1IYF A;  3ZNH B;  4AWJ A;  2ZNV C;  2KFK A;  2LGD A;  5AZH A;  2MSE D;  2IY0 B;  4HPL B;  3DVG X;  1Q5W B;  1WZ3 A;  3VDZ A;  5GMV A;  2IZV B;  3EFU A;  2KN5 A;  3LJ3 A;  4JGH B;  2MA9 B;  3L0W B;  3WIM A;  4DDG D;  4MGY E;  2MRP A;  2CKH B;  4TKN A;  4A3O A;  3KYD D;  2L05 A;  5E6O A;  3UF8 A;  1E8X A;  2NBV B;  2D11 A;  2HJ8 A;  1WR1 A;  2KQS A;  2ZCC A;  2V4L A;  3KVF B;  3SDL C;  3WA0 A;  3QWZ B;  3KUC B;  2XK5 B;  2V1Y A;  2K39 A;  2QHO A;  4I6L B;  4CYE A;  2GOW A;  2KJR A;  1P3Q U;  1WFY A;  2WDT B;  5DCN A;  4DDI D;  2DYM A;  4W9C A;  4ZRK A;  4E74 A;  1E8W A;  1RAX A;  4FUL A;  5D6J B;  2KXJ A;  5CX3 A;  3RYT A;  4NAW B;  3UQB A;  1D3Z A;  3DQV A;  2NVU I;  3PLV A;  3TIX A;  2M0X A;  4ANW A;  3L10 B;  2GBM A;  5JHB A;  3TCA A;  1KLV A;  3NZS A;  3PSE B;  3QC8 B;  1OQY A;  1YX6 B;  2K6Q A;  4GOC A;  3NOB A;  4EZL A;  2LD9 A;  2PEA A;  5FR6 A;  4GU2 A;  3JSV A;  3A4S C;  4HPM B;  4W9L A;  2MW5 A;  3U7D A;  3ZDM C;  2L0F A;  2JZZ A;  2Z0E B;  3HM6 X;  2BKR B;  1G6J A;  3W1S C;  2L00 B;  1TBE A;  3TJP A;  1WMH B;  2KTR A;  4NQL B;  2JF5 A;  4ASW C;  3PRM B;  4K7W A;  1V5O A;  4PS3 A;  2NPT A;  4LDT D;  1MG8 A;  2K8H A;  4OVU A;  5BO4 B;  3RD2 A;  2D07 B;  3BIN A;  3Q3J A;  4HVB A;  3RT3 B;  1E7V A;  2OOB B;  4KV2 A;  4N9F 4;  3R7Q A;  1YD8 U;  1GJZ A;  4DHZ B;  3DOW A;  4PS8 A;  2L7R A;  3JVZ X;  5DPT A;  3L08 A;  4LJO B;  4ANV A;  4W9K A;  5EDS A;  3PLU A;  2ZNV B;  3CMM B;  3EHV A;  3EC8 A;  1L2N A;  1L7Y A;  3A4R A;  5TR5 A;  1TTN A;  4E3C A;  2C7N B;  3I3T B;  1LM8 B;  2ZCB A;  3VHT C;  2JUO A;  2BYE A;  3T8M A;  5JZE B;  3VTU A;  2N1V A;  4BVU C;  3ZO5 B;  4MSQ B;  5DPR A;  4XZ4 A;  1YQB A;  4HLE A;  2GBN A;  2MP2 B;  2K1F A;  3DBR I;  3VUX A;  1GNU A;  5KHO A;  4FBJ B;  2ASQ A;  4MH0 E;  2MWS B;  4FN2 A;  4IC7 B;  2KLC A;  2IO3 B;  3AXC A;  5LXH A;  4W9F A;  3BY4 B;  3DBL I;  4A3P A;  2C60 A;  2N9X A;  4GIV A;  5D94 A;  4WWO A;  3KUD B;  4EOY A;  5D2M B;  3V61 A;  2Z59 B;  2KDF B;  3ML9 A;  4IWP A;  3WAP A;  5JH5 C;  2YVC A;  2M8S A;  2LGX A;  2O2V A;  4II3 B;  2PE6 B;  5C1Z A;  1E8Z A;  1WI0 A;  1YIW A;  4G50 A;  2D3G A;  4YL8 A;  4DHJ B;  4BOZ B;  1VCB A;  3QA8 A;  5IA7 A;  4PYU A;  4RMA A;  4XX5 A;  1WE7 A;  1E5W A;  1UH6 A;  2B3A A;  2KX3 A;  2N1W A;  4MSM B;  3OJ3 A;  4IWO A;  3B08 A;  2GMI C;  1I35 A;  3QX1 A;  4P7I A;  3IG3 A;  2OJR A;  4M8N A;  3UIO B;  4EKU A;  4FHK A;  1V5T A;  2G45 B;  1WIA A;  4KZ0 A;  3ZNG C;  4RM9 A;  3VQI A;  5CTR C;  3H1U A;  2PE9 A;  4RM8 A;  3TBL D;  4GGQ A;  1RRB A;  3HHM A;  1KM7 A;  3RZF A;  4FJY A;  4ZRI A;  2KFK B;  3IBE A;  4F1S A;  4X57 B;  1K8R B;  3DVG Y;  3VUY A;  3MJW A;  3QCA A;  4K7S A;  4NY0 A;  3VH4 B;  2KKC A;  4ANX A;  1WGD A;  2HTH A;  4CHK A;  3L17 A;  4GN1 A;  4TQ0 A;  2AL6 A;  1WXV A;  3QJZ A;  1LFD A;  4IG7 B;  2A5U A;  2JWZ A;  2LGY A;  4FJZ A;  3T9L A;  2IYD B;  1YX5 B;  3A9J A;  2KMA A;  1V49 A;  4WJN A;  3W1S A;  3ZTC A;  3WAN A;  3D32 A;  2YLM A;  4CO7 A;  3DVN U;  2C5L C;  1P0R A;  3P2B A;  4JLC A;  4W9D A;  5E6P A;  4KIK A;  3V62 A;  2DHZ A;  5HKH A;  2EMS A;  2LRU A;  1WXA A;  3ZIM A;  3DVN V;  4JQW C;  3H9D A;  3OJ4 B;  3WAM A;  5LXI B;  2G4S A;  2ZZP B;  2KAN A;  2XBB C;  2DYB A;  3APC A;  2RR9 A;  3A1Q B;  5AZG A;  1AAR A;  3LDZ E;  2KQ7 A;  1TZ1 A;  1NBF C;  1WX9 A;  2MBH A;  1WJN A;  1C1Y B;  1WM2 A;  2D2Q A;  2M1M A;  2XEW A;  3N30 A;  2MBB B;  3PZD A;  2O6V A;  3W1Y A;  2IO2 B;  3SHQ A;  3A9K B;  1GC7 A;  1Z5S B;  2AEH A;  2L8J A;  2MP2 A;  2AYO B;  2PPH A;  3TMP B;  4KIK B;  3A33 B;  3TL5 A;  1WGG A;  2L76 A;  2R2Q A;  4NPN A;  2GBR A;  1V9J A;  1WM3 A;  2LZ6 A;  2M17 A;  2W9N A;  2KZR A;  2LVQ A;  3K9P B;  4TUU A;  3IVF A;  1P1A A;  4BOS C;  2KK8 A;  1J0G A;  2IO1 B;  2LI5 A;  2DAF A;  2KNB A;  3VAW A;  2KOX A;  4IWQ A;  4AJY B;  3IHP C;  4FHJ A;  2HE7 A;  4GDL B;  2DZK A;  2FCQ A;  2RGF A;  4HJK A;  1WMH A;  3S2A A;  3VFK A;  3ZDT A;  2REX A;  5IAA C;  3JW0 X;  2DZI A;  4FAD A;  2LJ5 A;  4GXB A;  2GBK A;  4IW0 A;  2FUH B;  3R66 C;  2KJH B;  4WWP A;  4URK A;  2XK5 A;  4EFO A;  2M4N A;  5G55 A;  4NJ6 A;  5J18 A;  3OLM D;  2KTR B;  4ZYN A;  1EUV B;  2BKF A;  3KUZ A;  4LJP B;  3L54 A;  3X23 A;  2WX1 A;  4AOF A;  4ANU A;  1KOT A;  2KHW B;  2FIF A;  3RZW C;  4EZK A;  1GG3 A;  3APF A;  1R4M I;  2N7D A;  3NZU A;  1OEY J;  4KZC A;  1ZKH A;  1EF1 A;  4I6N B;  1OEY A;  2KVR A;  2I1K A;  1WXS A;  2CS4 A;  5AZF A;  4NQK E;  4W9J A;  1V80 A;  2LVO A;  5J2R A;  4W9H A;  4DHJ D;  1OGW A;  1V86 A;  3H7P A;  1Y8R C;  4WQO B;  3DBS A;  1CMX B;  2EKE C;  1KJT A;  1GC6 A;  4K1R B;  4NAW A;  3V60 A;  5AEK B;  3PV1 A;  2IY1 B;  3Q3F A;  2MLB A;  4MJS B;  2RPQ A;  3QK0 A;  4K7U A;  1IPG A;  2G3Q B;  2CR5 A;  3QHT A;  3PT2 B;  4MEL A;  4W9I A;  4BKS A;  2K8B A;  5J17 A;  2CU1 A;  2KC1 A;  2MBO A;  2FNJ B;  4IM3 A;  4LDT B;  3DBH I;  1U4A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...