2NPTA

Crystal structure of the complex of human mitogen activated protein kinase kinase 5 phox domain (map2k5-phox) with human mitogen activated protein kinase kinase kinase 2 phox domain (map3k2-phox)
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
106
structure length
102
Chain Sequence
SMALGPFPAMQVLVIRIKIPNSGAVDWTVHSQLLFRDVLDVIGQVLPEATTTAFEYEDEDGDRITVRSDEEMKAMLSYYYSTVMEQQVNGQLIEPLQIFPRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dual specificity mitogen-activated protein kinase kinase 5
publication title Crystal Structure of the complex of human mitogen activated protein kinase kinase 5 phox domain (MAP2K5-phox) with human mitogen activated protein kinase kinase kinase 2 phox domain (MAP3K2-phox)
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 21
structure length 102
sequence length 106
chains with identical sequence C
ec nomenclature ec 2.7.12.2: Mitogen-activated protein kinase kinase.
pdb deposition date 2006-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00564 PB1 PB1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2nptA01
3AU5A 3B08A 2WX0A 3Q3JA 5D7GA 1RRBA 2BWES 3APFA 3ML9A 3VH3B 1TTNA 2KC2A 3ZDMC 2CHXA 3A33B 3N3KB 1I42A 4GDKB 3LJ3A 4I6PA 2J7QB 2FAZA 3ECIA 2K8CA 2JF5A 4BKSD 3ML8A 1TZ1A 2FCNA 2G4SA 3DBHI 2UWQA 3AULA 2RR9A 2D2QA 4AJWA 2KXJA 1LM8B 2XK5A 3EFUA 5KHOA 4KDIC 4NPNA 3UIOB 5L95C 3JW0X 4DWFA 4GMVA 2RD0A 2N1WA 3JYUA 3S2AA 4TQ0A 1YJ1A 1E90A 3HK0A 1V5OA 2FCSA 3PLUA 1Y8RC 1U4AA 1L7YA 2KANA 2KKCA 1P0RA 3ALBA 2MSED 2ZCCA 4G0NB 4PYZA 4DDGD 4CO7A 3GOEA 1WYWB 4W9EA 2IY1B 2KQSA 2KMCA 2KVRA 4W9LA 3L54A 4FJZA 2MLBA 2FNJB 1R4NI 1P3QU 3DQVA 2BYEA 2C60A 3RUIB 3WAPA 1WMHB 2LGXA 2JZZA 3IVFA 3SHQA 4HPMB 2LI5A 2KHWB 3UGBB 1E8YA 1WXSA 4EKUA 2JUOA 3QJZA 3UQAA 3RZWC 1E8WA 1SE9A 2M4NA 2R2QA 2IO3B 2MBQA 2JXXA 2RPQA 2ZZPB 3W1SA 4A3OA 1ZKHA 4AP4C 5J18A 2DYMA 3A9KA 3X23A 4BFRA 4OVVA 4DK5A 2LRUA 4FADA 1GUAB 5DPSA 2MBOA 4EUTA 5JH5C 2KO3A 4MM3A 3VTVA 1NBFC 1YIWA 4GDKA 2MRPA 1RLFA 1YX5B 2IO0B 2KMAA 2YVCA 2JRHA 1E7VA 5E6PA 3OJ3A 2IYDB 3TCAA 2M0XA 5DPWA 5IAAC 2NPTB 3IBEA 3TJPA 5LXIB 2V4LA 2R2OA 3R66C 4JGHB 3HM3A 1BT0A 4ICVA 4RMAA 4FHKA 2HD5B 2BYFA 5C23A 3HHMA 1RAXA 1KJTA 2AL3A 1A5RA 3HM6X 5AZGA 4IW0A 2KOXA 3NHEB 2HE7A 2HTHA 4GOCA 2EKEC 4JIOU 2WWZA 4WJOA 3U30A 1WGYA 2I1KA 3VH4B 4AWJA 4EZKA 1ZW7A 4GXBA 2LXAA 4IUMB 3RCZA 1I35A 4KDLB 4KIKB 4EZLA 5LXHA 4DHZE 3RULA 1KLVA 1WR6E 4YL8A 1SIFA 1WMHA 4NQLB 3QA8A 2C7NB 2KX3A 3KUDB 3SDLC 2CHZA 4EEWA 2RSUA 2KK8A 2MX2A 3APCA 3NY5A 4G50A 3PREA 4HDQA 5E6NA 3VUXA 1H4RA 3R7RA 3N32A 2KC1A 1Z5SB 3X0WA 1G6JA 4TQ1A 1UBQA 4IM0A 5TR5A 2KDBA 3ZLZA 5BO4B 2LGYA 2RGFA 2AYOB 2GBKA 3ZKJC 2N7DA 1OEYA 1J8CA 2FIFA 2IY0B 2MWSB 3OJ4B 4XZ4A 2LVPA 5DPRA 1VD2A 1WJ6A 1KM7A 3AXCA 2L0TA 5D6JB 3UF8A 2KFKB 3VDZA 2B3AA 4FHJA 4MGKE 4RM9A 1C1YB 3PSEB 1NI2A 1SGHA 4K1RB 4ANVA 3ZW3A 3M63B 5J2RA 1WM2A 2J0KA 3RYTA 1WGGA 3PVLA 3CMMB 3EECA 4KSKC 3QARA 4BKSA 3TMPB 4GB9A 3M62B 2A4ZA 2PE9A 1QZEA 2DZMA 5C1ZA 2K39A 2KN5A 3WIMA 3T9LA 4F8CB 2EMTA 3VHTC 4ZRIA 4PS3A 2CU1A 3D32A 3NS8A 4HK2A 3KUCB 3RD2A 2LD9A 3NZUA 4FULA 4IWPA 4PYUA 1EUVB 3ONSA 1WR1A 3IG3A 4AJYB 4IM2A 1UH6A 1IPGA 3P2BA 4FN2A 2GOWA 4KIKA 2MQJA 5CX3A 4GSWA 1EO6A 5CHWA 1OGWA 4P7IA 1XT9B 2KWCA 4GGQA 5JZEB 2DAFA 3V61A 1WZ3A 2J0JA 3U8ZA 1OTRB 5D2MB 1WX7A 2LVOA 4KSLC 4F1SA 1IYFA 2JPHA 2GMIC 4W9DA 4DXAB 2MA9B 3ZDTA 1MG8A 4WWOA 3TL5A 1WX8A 2NVUI 3A4RA 1UGMA 2BPSA 4ZRKA 2XBBC 1J0GA 4HPLB 5AEKB 3VAWA 4KZCA 1WF9A 3CF6E 2NCNA 4W9FA 4WWPA 4WAAA 1JRUA 1L2NA 2MBEA 4EOYA 3B0AA 4KV2A 2DAJA 2KX0A 1WJNA 1WXVA 2KLGA 4BOSC 3RT3B 1HE8A 1XD3B 3H6NA 4IM3A 4E74A 4TV3A 1Q5WB 2KTRB 2JT4B 4LDTB 3VFKA 1Q1OA 1WH3A 2XEWA 1R4MI 1K8RB 1OQYA 4MGZE 4DHZB 4BKTA 2L0FA 4BBNC 4HDOA 1WY8A 1OEYJ 2K8BA 2JWZA 4LJOB 2KJHB 2DZIA 3PZDA 3DBSA 3EC8A 2VRRB 3V6EB 3V60A 3JVZX 3W1YA 4W9HA 4NJ6A 2K6DB 5AZHA 4MSMB 3PS6A 2KZRA 3H7SA 1UD7A 2GBJA 3WAOA 4FA6A 2EMSA 3DBLI 1WXMA 2PEAA 3MHSD 2BKRB 2MBHA 1YD8U 2WYQA 1V86A 1TBEA 2Z0DB 1X1MA 2MP2B 4PS7A 3ZRCA 3DVNU 4TUUA 3K9PB 4XX5A 3PHWB 3ZTDA 1T0YA 2OJRA 3PV1A 4GDLB 3U7DA 4X57B 4E71A 2DHZA 4MJSB 5G55A 2K8HA 2L05A 4JLCA 3KUZA 3QQ8B 2WDTB 3PGEA 2Y5BB 1S3SG 3BINA 4G11A 2FIDA 3M95A 1RFAA 3UQBA 2ZPNA 1WIAA 3DDCB 4I6NB 5FR6A 3PRPB 4HCNB 4NQKE 1S1QB 2LRWA 2N9XA 4URKA 5JHAA 4JL9A 4DHJD 4ANUA 2M8SA 5CTRC 4NAWB 3M3JA 2DZJA 2ZNVB 3L13A 2LXCA 4ASWC 4W9CA 5JHBA 2FCMA 1WGRA 2G3QB 1E8ZA 1WRDB 2WX1A 4DBGA 2A5UA 1V49A 2O6VD 2BYVE 2G4DB 3QIJA 3DVGX 2CS4A 3CSFA 3LDZE 2BF8B 3OAWA 4LDTD 1GG3A 2I1JA 3ZNZB 3ZNGC 3QC8B 2KTRA 3H1UA 3VQIA 2KQ7A 2N7EA 5KHQA 1WI0A 1LFDA 1AARA 2JZ3B 4WWNA 2GBRA 3PTFC 3NZSA 4MSQB 2N4FA 2KJRA 3BY4B 2ZVOA 3VVWB 1IP9A 3QK0A 4AOFA 2NS5A 2D11A 2Z59B 3V62A 4HLEA 2YLMA 1Q0WB 1J19A 1WFYA 2BWFA 4MGIE 3PPAA 3R3MA 2L3ZA 3O65B 4MELA 3VUWA 4F7ZA 1WZ0A 2NPTA 3QHTA 3H7PB 4J6IA 2LUEA 4W9GA 4B95A 3A1QB 1V2YA 2MP2A 3MTNB 3A9JB 4W9KA 3TBLD 3TIXA 1F9JA 1C3TA 2KDIA 3SU8X 4W9JA 4BKGA 3DBRI 3VTWA 1PQSA 1UELA 3QX1A 4FJVB 5E6OA 4II3B 2NBWB 4IC7B 1V80A 2ZVNA 5L83A 4RM8A 4EFOA 1Z2MA 3V6CB 2IBIB 1WE6A 2FUHB 1YX6B 4OVUA 1GC6A 2LVQA 4K7SA 3QCAA 4FJYA 4EZJA 5AZFA 4HCPB 4NAWA 4K7UA 2M1MA 2DENB 2N1VA 2GBMA 2KTFA 2LZ6A 4N9F4 4II2B 3IFWB 3JSVB 3B1LX 4JQWC 1FXTB 2AWTA 2ZJDA 3OLMD 4B6WA 1YQBA 1V5TA 4MGYE 4NNJB 4HVBA 2KD0A 5HKHA 2N9PC 2L76A 3L08A 3WANA 2IO1B 4CHKA 4DHJB 3WALA 3CSTA 3HIZA 3APDA 2BKFA 3ZTCA 5LLIA 2KLCA 4I6LB 2QHOA 3VUYA 3PLVA 4GIVA 2LASA 2L00B 3ZNHB 1WXAA 2O6VB 5DPTA 4GN1A 2KFKA 4M8MA 3I3TB 1P98A 1E7UA 2C5LC 2C7HA 2K1FA 4G3XB 2MW5A 2K25A 3GZNI 1ZGUB 3DPDA 2V3SA 4K81A 4M8NA 2DX5B 2DYOA 4HXDA 1WE7A 2O2VB 3H7PA 2AL6A 3PT2B 2Z0EB 3A1QA 2LGDA 4ANXA 4KVGB 3A9JA 3UIPB 3AU4A 4LJPB 3ZVVA 1KOTA 2L8JA 2CKHB 2GBNA 3KVFB 3C0RB 3NOBA 2KWUB 3KH0A 2M17A 4HWIB 3ENEA 4ICUA 4XC2A 3VTUA 4MDKE 1WJUA 3L17A 4PS8A 4MEMA 1E5WA 2V1YA 2W9NA 3PRMB 3PRZA 4IG7B 1UBIA 4GU2A 2MBBB 1WGDA 5J17A 2KDFB 4HJKA 3KYCD 4IWOA 1NDDA 5GMVA 3QAQA 2CR5A 2NBVB 2D10A 2D07B 3ZUNA 1LXDA 4WJPA 3K9OB 2FCQA 4K7WA 1H8CA 1V81A 2G45B 2KNBA 4A3PA 3R7QA 4A20A 1M94A 3L0WB 2LWPA 3SD5A 1VCBA 3JSVA 2KJ6A 4AUQC 3MJWA 2K6QA 1D3ZA 3ZNID 2JVCA 2C7MB 3AI5A 2ZPYA 1P9DU 4WQOB 2REXA 2DYBA 4M0WB 2ASQA 5DCNA 1P1AA 3RZFA 1ISNA 2ZNVC 2MCNB 2J0MA 3KW5B 1EF1A 1WJ4A 1V9JA 3DCGA 3Q3FA 5EDSA 5CHFA 1WM3A 5G2NA 2O6VA 2LJ5A 2PPHA 2HJ8A 1GNUA 1V6EA 2XK5B 2OOBB 3DOWA 4IWQA 3IHPC 2IZVB 1WX9A 3EHVA 4BVUC 4ZDVA 3L10B 4B9KA 2PE6B 1GC7A 4WJQA 2IO2B 4NJ7A 5IA7A 2O2VA 4MH0E 2KWVB 4ZYNA 3KYDD 2AEHA 3WAMA 4DDID 3VXWA 2JY6A 1GJZA 4TKNA 4WJNA 4ANWA 3UINB 3L16A 2NR2A 3DVGY 4NY0A 5CHVC 3DVNV 4W9IA 2N9EB 4LCDE 3H9DA 4BOZB 4KZ0A 2BGFA 5D94A 1TGZB 2C9WB 2PJHA 2KFJA 4E3CA 3N30A 3PHXB 2DZKA 1E8XA 1UZXB 3QWZB 4FBJB 3ZIMA 3A4SC 2CHWA 4BBNF 2NBUA 1CMXB 4GDLA 1XQQA 4MJSA 4FLHA 2L7RA 3WA0A 2ZEQA 3ZO5B 3ZRFA 2ZCBA 3T8MA 1WGHA 2KDEB 4ZRJA 1EF5A 4CYEA 1LQBA 3A9KB 2D3GA 2UYZB 2JRIB 3W1SC
chains in the Genus database with same CATH superfamily
2WX0A 5D7GA 3IT4B 4ZHPA 1L4ZB 4ZRQA 1WRIA 3P63A 3RNGC 1TTNA 3ZDMC 2CHXA 4M0WA 4UDUC 3N3KB 1BMLC 4GDKB 1L0XB 2JF5A 2OEDA 1TZ1A 2UWQA 3Q8CA 2RR9A 1HZ6A 4AJWA 3EFUA 1LM8B 2N9KA 5KHOA 3UIOB 2N1WA 3EGRA 3S2AA 3PLUA 3UINB 1STEA 2KKCA 4G0NB 2ZCCA 4CO7A 3GOEA 2KMCA 3L54A 2MLBA 3RUIB 1M4VA 1WMHB 1FRDA 2JZZA 3SHQA 2WU5B 3Q8FA 3UGBB 1E8YA 4OVZA 3PZ8A 3QJZA 1YN5A 1E8WA 2WDVB 1WXQA 1SE9A 2RPQA 1FNWA 2ZZPB 2BW2A 4RNAA 4YTPB 4DK5A 3T3OA 4Q2JA 1NBFC 3PZ7A 2W55A 1YX5B 2JRHA 2JSVX 3RN9C 2IYDB 2HDEA 3TCAA 1UNSA 3N20C 5DPWA 3IBEA 4JGHB 3HM3A 1JWUD 4FXCA 4RMAA 4FHKA 1KJTA 2AL3A 3I57A 1A5RA 3U7ZA 4JE3B 4IW0A 1YJJA 2WWZA 1Y56A 4GXBA 2BYTA 4EZLA 3AEDB 4D2KA 1KLVA 5I4DA 3EUB2 2CHZA 3NY5A 2MX2A 5E6NA 4HDQA 3MC0B 3NUHB 5J18A 1G6JA 1P7FA 1TS3A 3DHHC 1FFVA 2KDBA 2L32A 3ZLZA 2LGYA 2RGFA 3ZKJC 1MI0A 2IGGA 3OJ4B 2MWSB 2LVPA 2BS2B 4WURA 1KM7A 3AXCA 2L0TA 2V4IB 2B3AA 4FHJA 2ACZB 3P4PB 4RFBA 1D4BA 3AECB 1SEBD 1WM2A 3RYTA 3EECA 1GPXA 3MC9A 1V97A 2A4ZA 2PE9A 4ZYSA 1I7HA 3WIMA 3T9LA 2V0GA 2EMTA 4ZRIA 3ZYYX 2INDC 2QIEB 4O1NA 1IPGA 2GOWA 4KIKA 1ZXHA 4GSWA 3URYA 1EO6A 4P6VF 1F2RI 1FIQA 1XT9B 2KWCA 4GGQA 3V61A 1CJEA 4C4VA 1OTRB 2XN9C 1WX7A 2KT7A 2LVOA 4ACFA 4DXAB 2MA9B 3ZDTA 3Q14C 4WWOA 3MP9A 1WX8A 2WXRA 2XBBC 1GAQB 1J0GA 1QLBB 1V8CA 3DHGC 2MBEA 3AE6B 2KX0A 3TUOA 1GOZA 4TV3A 1EU4A 4LDTB 2KDMA 1VZ8A 1K8RB 4MGZE 4DHZB 1L6UA 2M19A 4JWUC 4HDOA 3PZDA 4RF0A 1VLBA 2VRRB 3V60A 2ONQA 4HJGE 3JVZX 2JU6X 2KZRA 3H7SA 3DBLI 1E0ZA 1WXMA 1DOIA 2MBHA 2WHIA 3KQ4A 1E10A 1V86A 2Z0DB 1YN4A 4GDLB 3U7DA 4MJSB 3HRDD 4M00A 2L05A 4JLCA 4WAFA 2WXPA 2FIDA 1RFAA 2ZPNA 5C2TB 1YJIA 4NQKE 3GP7A 2LRWA 4LNNA 2AQ1B 4NAWB 1RWSA 3NG0A 3V05A 3L13A 4W9CA 2KVZA 2G3QB 4DBGA 1FRRA 2BYVE 3QIJA 3DVGX 2I1JA 2KTRA 5KHQA 2IGHA 3PTFC 3NZSA 1FCLA 2ZVOA 3VVWB 3FKYA 1XLPA 2RDGA 3R2TA 1SSNA 1SE4A 1WFYA 2GB1A 3PPAA 2L3ZA 4F7ZA 4HRSA 4B95A 2MP2A 3U4EG 2JZPA 4KGTA 3SU8X 1QF6A 1ZDXA 3VTWA 5E6OA 4II3B 4IC7B 4HPPA 4EFOA 1Z2MA 5FR3A 3U52E 4K7SA 3QCAA 4FJYA 2PW9A 2M1MA 4J3OD 2N1VA 2LZ6A 4N9F4 3JSVB 4JQWC 1FXTB 3Q69A 1LGRA 4NNJB 1CK1A 3L08A 1DOYA 2IO1B 4CHKA 4DHJB 3CSTA 3N1ZC 3APDA 2H89B 2QHOA 1KLUD 4XGAB 2LASA 3ZNHB 1WXAA 2O6VB 1IGDA 5DPTA 1JWSD 4M8MA 1TS5A 2K1FA 4G3XB 2MW5A 3HVZA 2K25A 3DPDA 4C7ZA 4M8NA 2O2VB 3PT2B 1XXGA 2FBWB 2WS3B 3FILB 3A9JA 3AU4A 4LJPB 1QOAA 2I38A 2NMQA 3E56A 3OG5A 5BYQA 2N0SB 4MEMA 1JW9D 1UBIA 4YSXB 1WGDA 5HI1A 2WXQA 4KGRA 2E3TA 4YXDB 1H8CA 1IBXA 4A3PA 3IXSA 2LWPA 3SD5A 4AUQC 3MJWA 1D3ZA 1XCTL 3ZNID 2J4XA 2CJOA 3UI3A 4WQOB 3IAM1 2LHDA 2KYWA 4XDDA 5IN7A 1JRPA 2MCNB 2R61A 3Q3FA 2JX5A 4KGSA 5CHFA 1J7CA 2XK5B 4IWQA 4NAMA 1WX9A 3L10B 2PE6B 4S0RA 2WXIA 4MH0E 2KWVB 3WAMA 2JY6A 3L16A 3VR9B 5CHVC 2N9EB 4LCDE 4MH8A 1TGZB 2C9WB 2PJHA 4S17A 2KFJA 3NVZA 3LYYA 3N30A 4E3CA 4FBJB 2DZKA 1E8XA 1E6EB 3A4SC 2CHWA 2MJ3A 2NBUA 1XQQA 2K22A 3W2DA 2M56B 1XLQA 3WA0A 4R3DA 2KDEB 2D3GA 2JRIB 3AU5A 3B08A 3Q3JA 2PIAA 4DQOC 2KC2A 2QEJC 4XWTA 4I6PA 2FAZA 1FEHA 3AULA 1VRAB 2D2QA 5L95C 4DWFA 1YJ1A 3HK0A 1I4PA 1U4AA 1L7YA 1KLGD 1P0RA 2ON8A 2K3UA 4DDGD 3MJ5A 1KF6B 4RH6A 1ET6A 5IO9A 4W9EA 2KQSA 2KVRA 3L4PA 4W9LA 4ZRPA 1FCCC 1F0ZA 2N9LA 5D3DA 2BYEA 4AS1A 3IVFA 1V1OA 4HPMB 1WXSA 2KAJA 1QOGA 3UQAA 4TMAB 1PUTA 2M4NA 3TEZA 2M0AA 3W1SA 1ZKHA 3A9KA 3ZJVA 1OFFA 1GUAB 5DPSA 2MBOA 4EUTA 4MM3A 4GDKA 1RLFA 2KMAA 2BB6A 2IO0B 2YVCA 1JWMD 3OJ3A 1SXTA 1NYRA 2VZKB 1T3QA 2LGSA 3H8HA 2NPTB 1PGXA 2RPVA 2R2OA 1ET9A 1BT0A 2J42A 2HD5B 2BYFA 5C23A 1RAXA 1NYQA 4A9AA 3BK1A 3Q3OC 3B2GA 4JIOU 1WGYA 3VH4B 2JQRB 4XWWA 2LXAA 3RCZA 2WGSA 1I35A 3ABVB 2LMCA 1SIFA 1WMHA 2C7NB 2KX3A 3MC8A 1GB4A 2KK8A 3VUXA 3PREA 3X0WA 1H4RA 3P4SB 3R7RA 3NVWA 4XE0A 4IM0A 5TR5A 2G9HD 3AE7B 2X8XX 5DPRA 1VD2A 1ZXIA 3TEYA 1L5PA 4WQMA 2IJ0A 3DWMA 4YSYB 4ARIA 3M63B 4KKJA 1WGGA 3PVLA 1XEEA 1T0RC 3TMPB 5C1ZA 1N5WA 4MACA 3VHTC 1MFWA 2CU1A 2IDYA 2KWDA 3NS8A 4HK2A 3RD2A 4PYUA 4L1BA 3ONSA 1WR1A 4IM2A 1UH6A 2XNAC 1FPYA 1IUEA 1B1ZA 4P7IA 2BT6A 2LEKA 3P42A 3U8ZA 1BXTA 4KSLC 2JPHA 3A4RA 5BYRA 3AEGB 2HJ1A 4HPLB 4KZCA 4W9FA 1JRUA 1L2NA 1WXVA 1HE8A 1I4RA 4IM3A 1C4AA 1WH3A 3Q3MC 1OQYA 2ICIA 4BKTA 4BBNC 2K8BA 1OEYJ 4H2AA 2JWZA 2KJHB 3RPFC 3V6EB 4FA6A 2OHFA 3SR6A 2WYQA 1EWCA 2I2YA 1X1MA 3TEWA 2LUMA 4TUUA 3PV1A 3I63C 4PT5A 4X57B 4E71A 2DHZA 2K8HA 2W82A 1OQQA 5FR6A 2EELA 2NTSA 4NZLB 1S1QB 2D3BA 1YNTE 1TKGA 2N9XA 5JHAA 4DHJD 4B0EA 2VH1A 2M8SA 4ANUA 2KMMA 3FAHA 2O6VD 3LDZE 3OAWA 2KQ7A 4L2YA 1LFDA 2JZ3B 1L6VA 3DBHB 2BS4B 4WWMA 1D5MC 1T5XD 3BY4B 3QK0A 4AOFA 2NS5A 2Z59B 4HLEA 1J19A 1VJKA 3LB8C 2OJWA 4MELA 3O65B 1C79A 1MPEA 3MTNB 3TIXA 2SAKA 1F9JA 2KDIA 4YTMB 1MJDA 4RM8A 1DGJA 3NJTA 3V6CB 1D6EC 3ZQ4A 1C78A 1YX6B 4OVUA 1GC6A 4EZJA 2Y5CA 4NAWA 4K7UA 1XF5L 4JX1C 4II2B 4MT5A 3AEBB 4B6WA 2KD0A 2N9PC 1QILA 3WANA 1JALA 4GIVA 4GN1A 2KFKA 3PO0A 1P98A 3VRBB 3P4RB 4K81A 2DX5B 2DYOA 2RDBC 4RGNA 1F1HA 3NRZA 2CKHB 2GBNA 3KVFB 2KWUB 4ICUA 3ENEA 3L17A 3PRMB 2L83A 4IG7B 2BS3B 2MBBB 2DNFA 4HJKA 3KYCD 1ZDVA 5GMVA 1R7SA 1UWXA 3QAQA 3GB1A 2D07B 1FD6A 1TY2A 3ZUNA 3Q8BA 2FCQA 2G45B 4A20A 3L0WB 3JSVA 2C7MB 5BMGA 1TKYA 2ZNVC 3SFEB 1WJ4A 3OWEB 2O6VA 1PGBA 4IOIE 1GNUA 1KTKA 3IHPC 4JPSA 3EHVA 4XYCA 4WJQA 2O2VA 4WH4A 3RNFC 2MH7A 3N1XC 2V3PA 4TKNA 4WJNA 3DVNV 4W9IA 5E6JA 3ZJTA 2BGFA 2FE8A 1T6BX 5AUIA 2WXNA 1C76A 1R4NB 1CMXB 1HTQA 2L7RA 1VZ7A 2ZEQA 2J52A 2ZCBA 2VZKD 4EOYA 3W1SC 3EA6A 5G5GA 1RRBA 2BWES 2B76B 1SE2A 1KH0A 1R4MB 3A33B 3P4QB 4LLGM 1EU3A 1TS4A 1SIJA 2J7QB 4BKSD 1N5XA 2FCNA 2G4SA 4CQNA 3ETRA 2XK5A 3AE8B 3AEEB 4DXGA 1PGAA 4KDIC 4NPNA 2QILA 4USAA 2QMTA 2RD0A 3JYUA 2PKOA 4TQ0A 4GLSC 2FCSA 1Y8RC 2KANA 3ALBA 2MSED 3ZXRA 1WYWB 5H8YE 4EE2A 3BIID 4HEA1 4FJZA 5EE1A 1R4NI 1P3QU 3BVZA 2LI5A 2KHWB 4EKUA 2YEPB 2WXLA 1AN8A 2R2QA 2IO3B 2MBQA 2JXXA 4A3OA 4AP4C 2D3AA 2DYMA 2PVOD 3X23A 4BFRA 2PMVA 2LRUA 4FADA 3ZXVA 2KO3A 1JCKB 3VTVA 2UU7A 4US9A 1K52A 2MRPA 1E9MA 5E6PA 5IAAC 5HHDG 3BYTB 3TJPA 1PFDA 1I4HA 2V4LA 3RI7C 3R66C 2X38A 1SE3A 3BYYB 2QJLA 3AE9B 3HHMA 4REZA 1SF0A 1J7BA 4N6EB 2E6XA 3HM6X 5AZGA 3NHEB 2HTHA 2ZW0A 4WJOA 2I1KA 3DBRB 4AWJA 1ZW7A 2PLPA 1TIFA 4KDLB 3BZDB 1HXYD 3QA8A 5IKCM 2GI9A 4EEWA 3APCA 4G50A 4LNOA 5IOIA 3HVDA 2KC1A 3WCQA 3P1MA 1N62A 4TQ1A 3RMKC 1F2RC 5BO4B 2AYOB 1AYFA 1T0SC 1NEKB 1J8CA 1PYWD 2FUG1 2FIFA 1YOVB 4XZ4A 3RNAC 1WJ6A 4HKQA 1HA5A 2BB5A 5D6JB 4WIPA 3VDZA 1PDXA 1D5XC 3AH7A 3PSEB 1NI2A 1SGHA 3ZW3A 2K0PA 2MHJA 5J2RA 2J0KA 3CMMB 4KSKC 3QARA 4GB9A 1N60A 1QZEA 2K39A 4F8CB 1J7AA 1V1PB 3D32A 5BMIA 4BKSA 3KUCB 3NZUA 4FULA 3Q8AA 1EUVB 2J53A 4C56C 2W3RA 3J9CA 4FN2A 1ESFA 3R2IA 4M02A 3NZ3A 1QQRA 2J0JA 1WGKA 5D2MB 3O13A 1ZE3D 2GMIC 4W9DA 1FO4A 3TL5A 4ZRKA 2NVUI 1UGMA 1VR9A 3W5UB 2LHEA 4PK1A 3CF6E 2NCNA 4WAAA 4XDCA 1MHHE 1QOFA 1QT9A 2BTEA 3B0AA 4KV2A 4US8A 1YQ3B 4BOSC 1N63A 3RT3B 2AQ2B 4E74A 3VFKA 1Q1OA 4YTNB 1WY8A 2MEKA 4LJOB 3DBSA 3ZJUA 2INNE 3VR8B 3W1YA 4W9HA 4NJ6A 2K6DB 5AZHA 4MSMB 1UD7A 3LXFA 2EMSA 1ROEA 5EE9A 1NVID 5HFYA 2PEAA 1YD8U 1JMLA 1TBEA 2WU2B 3AE3B 3ZRCA 3DVNU 4XX5A 2CU3A 3PHWB 1T0YA 4RGTA 2OJRA 1N61A 1HZ5A 3KUZA 2WDTB 3PGEA 2Y5BB 1S3SG 4G11A 1DOXA 1FNUA 1WIAA 3DDCB 4I6NB 4ZHOA 2HTME 2INPE 4URKA 4HKZE 1OQRA 2DZJA 2ZNVB 2LXCA 4K3CA 2WX1A 2G4DB 2CS4A 2BF8B 5BYSA 4LDTD 1GB1A 3ZNGC 3VQIA 3H1UA 2N7EA 1WI0A 1AARA 2GBRA 4MSQB 5LNK1 1KFYB 1IP9A 3KWVA 5HG2A 2LFIA 2D11A 2YLMA 1Q0WB 4MGIE 4P1BC 3R3MA 3VUWA 1WZ0A 3QHTA 3H7PB 4J6IA 2LUEA 4W9GA 3A1QB 1V2YA 4W9KA 3TBLD 1C3TA 4BKGA 5FKAC 3DHIC 1PQSA 3QX1A 4FJVB 1UWMA 2NBWB 2ZVNA 5L83A 1WE6A 2FUHB 5T8IA 2L52A 5AZFA 4MM3B 4HCPB 1UUPA 3GE8C 4YWGG 2SEBD 1L4DB 3B1LX 1F77A 2AWTA 2JYTA 3OLMD 4MGYE 2L76A 2DBYA 3WALA 3BK2A 2BKFA 1TJEA 3AV8A 5AUKA 4I6LB 2KACA 3VUYA 2L00B 3C19A 3I3TB 2C5LC 3DWGC 2KQ4X 2H88B 1YMHE 4HXDA 1WE7A 2AL6A 4KVGB 3UIPB 3I9V1 2Z8LA 1KOTA 4LNIA 1Q10A 3KH0A 2M17A 1TS2A 4HWIB 4N58A 4MDKE 4PS8A 1E5WA 2V1YA 3PRZA 4GU2A 1SJHD 1ACCA 2KDFB 2AQ3B 4IWOA 2CR5A 2D10A 3IAS1 4WJPA 1V81A 2KNBA 1VCBA 2CJNA 2JVCA 1VZ6A 3AI5A 2ZPYA 4KX6B 4M0WB 5DCNA 1P1AA 1KRHA 2NTTA 3DCGA 5EDSA 5G2NA 2LJ5A 2JXTA 2PVGC 3MHZA 3GS2A 3DOWA 1I4GA 2IZVB 4HROA 4B9KA 4N59A 1GC7A 2IO2B 4NJ7A 2LJIA 4ZYNA 3KYDD 1VDVA 3VXWA 4ANWA 2EKIA 2NR2A 5MPOA 3DVGY 1AWDA 4M01A 2JWUA 3H9DA 4BOZB 4KZ0A 3PHXB 1UZXB 5G5HA 2WP9B 4YT0B 4GDLA 4MJSA 2WXKA 2WDQB 3ZO5B 1LO5D 1WGHA 4ZRJA 1ENFA 4CYEA 2D3CA 2UYZB 5IP4D 1FFUA 3APFA 3ML9A 5TSSA 3R8BA 3VH3B 2IPKD 1FXAA 1I42A 3AE5B 1K51A 3LJ3A 3ECIA 2K8CA 3ML8A 3DBHI 1MG4A 2KXJA 3DBLB 3JW0X 4GMVA 1RFKA 1E90A 1V5OA 3E9SA 3I5JC 4KKIA 4ARCA 4PYZA 2IY1B 1HEZE 2FNJB 1YQ4B 1ZPSA 3DQVA 2C60A 1B9RA 3IT6B 3WAPA 2LGXA 4NJCA 1RYJA 4C7YA 1JQ4A 3NVYA 2JUOA 3RZWC 1MVKA 2ZW1A 1XLOA 2WXOA 4OVVA 1CQVA 2WQYB 2WXJA 5JH5C 1YIWA 1EM7A 3W5VB 2QC8A 1E7VA 2M0XA 4A6QA 1BUIC 2V3NA 1HQRD 5LXIB 3Q6BA 4ICVA 4P1CC 3KWLA 3FC4A 2KOXA 2HE7A 2N7JA 4GOCA 2EKEC 3U30A 4EZKA 1WSPA 1IGCA 4IUMB 3AEFB 4KIKB 2DWQA 4DHZE 3RULA 3AEAB 1WR6E 4YL8A 4RGMA 4NQLB 2IGDA 3FILA 3KUDB 3SDLC 4C4VB 2WXHA 2RSUA 5LXHA 3N32A 1TKEA 1Z5SB 1UBQA 4A8XC 2GBKA 2N7DA 1OEYA 2KN4A 2IY0B 3BWUD 2D5GA 1C4CA 3UF8A 2KFKB 3V3XA 4MGKE 4RM9A 1C1YB 3CIRB 4RCOA 4ANVA 4K1RB 4JWSC 4ITKA 2QDFA 3M62B 1CZPA 2DZMA 2GLSA 2KN5A 1P7EA 2K5PA 3SEBA 4PS3A 3VRAB 3T3NA 2L1AA 3AB5A 2LD9A 4IWPA 3IG3A 1I4QA 4AJYB 3P2BA 2JYEA 4OZAA 3TSSA 1TYGB 2MQJA 5CX3A 1TT5B 5CHWA 1QKZA 1OGWA 5JZEB 2DAFA 1JROA 1FXIA 1WZ3A 1DYQA 4A55A 2K9XA 4DXFA 4F1SA 1IYFA 1MG8A 5EE3A 3AN1A 2BPSA 1WWTA 4LTUA 1C9FA 5AEKB 3VAWA 1WF9A 4WWPA 3AE2B 2DAJA 1SBBB 1WJNA 2KLGA 1XD3B 3H6NA 1Q5WB 2KTRB 2JT4B 1NENB 2XEWA 1R4MI 2L0FA 4LK0M 2DZIA 3EC8A 2LGIA 1F52A 3PS6A 1V1PA 3WAOA 2GBJA 4OZBA 5GXGB 3AE4B 4TSSA 3MHSD 1EWYC 2BKRB 3N9YC 2MP2B 4PS7A 2DLBA 3K9PB 5EE0A 3ZTDA 1K50A 4LNFA 5FK9C 5G55A 2PTLA 3HUIA 4RF1A 3QQ8B 3MFGA 3BINA 3M95A 3UQBA 3BVMA 4B0MA 3N1YC 4L23A 3PRPB 4HCNB 3Q8EA 4JL9A 3ZGZA 5CTRC 2WLBA 3M3JA 2WXMA 4ASWC 4OHJA 3NS1A 5JHBA 2FCMA 1WGRA 1E8ZA 1WRDB 2A5UA 1V49A 2QCZA 3CSFA 3GE3C 1GG3A 3ZNZB 2V9HA 3QC8B 4C00A 2VH2A 4WWNA 4A90A 3B2FA 1FMAD 2N4FA 2KJRA 1ZP0B 2W54A 3V62A 2INCC 1RM6C 2BWFA 2RMMA 4K3BA 1ZOYB 2NPTA 4YSZB 3SFDB 5C3JB 3A9JB 3GZNB 5H92C 4W9JA 1XCQL 3DBRI 1UELA 1UF0A 1WYGA 4BZAA 1V80A 2BQQA 2IBIB 1NI3A 1HTOA 1TY0A 1XO3A 3U2SC 1YN3A 2LVQA 3B9JA 1C77A 2DENB 3CWIA 2GBMA 2KTFA 1IBXB 3BVGA 3RNEC 3IFWB 2ZJDA 5HKHA 1YQBA 1V5TA 4P16A 3Q2AC 3W9CB 4QAYA 1UGJA 3HIZA 3ZTCA 5LLIA 2G1EA 1JWAD 2KLCA 1D5ZC 1C4PA 3PLVA 1L0YB 2WXGA 2BBCA 1FM0D 3EFCA 2WNMA 1E7UA 2C7HA 1I4XA 1N6ZA 3GZNI 1ZGUB 2V3SA 1A70A 1FNVA 3H7PA 2MJEA 2Z0EB 3A1QA 2LGDA 4ANXA 4BAXA 3ZVVA 2L8JA 3RFZB 3C0RB 2W3SA 3NOBA 4C80A 2RDHA 4XC2A 3VTUA 2GRIA 4RGOS 1WJUA 2W9NA 5BMHA 3RNBC 3AMZA 2QSDA 4IKGA 5J17A 1T0QC 2Y3AA 1JWBD 5D3IB 3AM9A 1NDDA 2NBVB 1LXDA 1L0VB 3K9OB 1E7PB 3RNCC 4K7WA 4LNKA 3R7QA 1M94A 3NVVA 2KJ6A 2K6QA 5JXVA 2MJDA 1P9DU 2REXA 2DYBA 2ASQA 1SB3C 4AQ7A 3TEXA 4ZOHC 3RZFA 2WDRB 1ISNA 3KLSX 2J0MA 3KW5B 1EF1A 1V9JA 1WM3A 2PPHA 2HJ8A 1V6EA 2TSSA 2OOBB 4BVUC 4ZDVA 2Q5WD 5IA7A 3C8YA 2AX5A 2AEHA 4OW0A 4DDID 3AE1B 3Q3NC 1GJZA 2Y5PA 4NY0A 2BVCA 1XLNA 5D94A 4IDIA 2YEPF 1TZOA 3QWZB 3ZIMA 1ZUD2 4BBNF 1QOBA 1K53A 1SJED 4FLHA 4OZCA 3ZRFA 1MHXA 3T8MA 1AW7A 2WXFA 4HVBA 1EF5A 1LQBA 3A9KB
chains in the Genus database with same CATH topology
3AU5A 3B08A 2WX0A 3Q3JA 5D7GA 1RRBA 2BWES 3APFA 3ML9A 3VH3B 1TTNA 2KC2A 3ZDMC 2CHXA 3A33B 3N3KB 1I42A 4GDKB 3LJ3A 4I6PA 2J7QB 2FAZA 3ECIA 2K8CA 2JF5A 4BKSD 3ML8A 1TZ1A 2FCNA 2G4SA 3DBHI 2UWQA 3AULA 2RR9A 2D2QA 4AJWA 2KXJA 1LM8B 2XK5A 3EFUA 5KHOA 4KDIC 4NPNA 3UIOB 5L95C 3JW0X 4DWFA 4GMVA 2RD0A 2N1WA 3JYUA 3S2AA 4TQ0A 1YJ1A 1E90A 3HK0A 1V5OA 2FCSA 3PLUA 1Y8RC 1U4AA 1L7YA 2KANA 2KKCA 1P0RA 3ALBA 2MSED 2ZCCA 4G0NB 4PYZA 4DDGD 4CO7A 3GOEA 1WYWB 4W9EA 2IY1B 2KQSA 2KMCA 2KVRA 4W9LA 3L54A 4FJZA 2MLBA 2FNJB 1R4NI 1P3QU 3DQVA 2BYEA 2C60A 3RUIB 3WAPA 1WMHB 2LGXA 2JZZA 3IVFA 3SHQA 4HPMB 2LI5A 2KHWB 3UGBB 1E8YA 1WXSA 4EKUA 2JUOA 3QJZA 3UQAA 3RZWC 1E8WA 1SE9A 2M4NA 2R2QA 2IO3B 2MBQA 2JXXA 2RPQA 2ZZPB 3W1SA 4A3OA 1ZKHA 4AP4C 5J18A 2DYMA 3A9KA 3X23A 4BFRA 4OVVA 4DK5A 2LRUA 4FADA 1GUAB 5DPSA 2MBOA 4EUTA 5JH5C 2KO3A 4MM3A 3VTVA 1NBFC 1YIWA 4GDKA 2MRPA 1RLFA 1YX5B 2IO0B 2KMAA 2YVCA 2JRHA 1E7VA 5E6PA 3OJ3A 2IYDB 3TCAA 2M0XA 5DPWA 5IAAC 2NPTB 3IBEA 3TJPA 5LXIB 2V4LA 2R2OA 3R66C 4JGHB 3HM3A 1BT0A 4ICVA 4RMAA 4FHKA 2HD5B 2BYFA 5C23A 3HHMA 1RAXA 1KJTA 2AL3A 1A5RA 3HM6X 5AZGA 4IW0A 2KOXA 3NHEB 2HE7A 2HTHA 4GOCA 2EKEC 4JIOU 2WWZA 4WJOA 3U30A 1WGYA 2I1KA 3VH4B 4AWJA 4EZKA 1ZW7A 4GXBA 2LXAA 4IUMB 3RCZA 1I35A 4KDLB 4KIKB 4EZLA 5LXHA 4DHZE 3RULA 1KLVA 1WR6E 4YL8A 1SIFA 1WMHA 4NQLB 3QA8A 2C7NB 2KX3A 3KUDB 3SDLC 2CHZA 4EEWA 2RSUA 2KK8A 2MX2A 3APCA 3NY5A 4G50A 3PREA 4HDQA 5E6NA 3VUXA 1H4RA 3R7RA 3N32A 2KC1A 1Z5SB 3X0WA 1G6JA 4TQ1A 1UBQA 4IM0A 5TR5A 2KDBA 3ZLZA 5BO4B 2LGYA 2RGFA 2AYOB 2GBKA 3ZKJC 2N7DA 1OEYA 1J8CA 2FIFA 2IY0B 2MWSB 3OJ4B 4XZ4A 2LVPA 5DPRA 1VD2A 1WJ6A 1KM7A 3AXCA 2L0TA 5D6JB 3UF8A 2KFKB 3VDZA 2B3AA 4FHJA 4MGKE 4RM9A 1C1YB 3PSEB 1NI2A 1SGHA 4K1RB 4ANVA 3ZW3A 3M63B 5J2RA 1WM2A 2J0KA 3RYTA 1WGGA 3PVLA 3CMMB 3EECA 4KSKC 3QARA 4BKSA 3TMPB 4GB9A 3M62B 2A4ZA 2PE9A 1QZEA 2DZMA 5C1ZA 2K39A 2KN5A 3WIMA 3T9LA 4F8CB 2EMTA 3VHTC 4ZRIA 4PS3A 2CU1A 3D32A 3NS8A 4HK2A 3KUCB 3RD2A 2LD9A 3NZUA 4FULA 4IWPA 4PYUA 1EUVB 3ONSA 1WR1A 3IG3A 4AJYB 4IM2A 1UH6A 1IPGA 3P2BA 4FN2A 2GOWA 4KIKA 2MQJA 5CX3A 4GSWA 1EO6A 5CHWA 1OGWA 4P7IA 1XT9B 2KWCA 4GGQA 5JZEB 2DAFA 3V61A 1WZ3A 2J0JA 3U8ZA 1OTRB 5D2MB 1WX7A 2LVOA 4KSLC 4F1SA 1IYFA 2JPHA 2GMIC 4W9DA 4DXAB 2MA9B 3ZDTA 1MG8A 4WWOA 3TL5A 1WX8A 2NVUI 3A4RA 1UGMA 2BPSA 4ZRKA 2XBBC 1J0GA 4HPLB 5AEKB 3VAWA 4KZCA 1WF9A 3CF6E 2NCNA 4W9FA 4WWPA 4WAAA 1JRUA 1L2NA 2MBEA 4EOYA 3B0AA 4KV2A 2DAJA 2KX0A 1WJNA 1WXVA 2KLGA 4BOSC 3RT3B 1HE8A 1XD3B 3H6NA 4IM3A 4E74A 4TV3A 1Q5WB 2KTRB 2JT4B 4LDTB 3VFKA 1Q1OA 1WH3A 2XEWA 1R4MI 1K8RB 1OQYA 4MGZE 4DHZB 4BKTA 2L0FA 4BBNC 4HDOA 1WY8A 1OEYJ 2K8BA 2JWZA 4LJOB 2KJHB 2DZIA 3PZDA 3DBSA 3EC8A 2VRRB 3V6EB 3V60A 3JVZX 3W1YA 4W9HA 4NJ6A 2K6DB 5AZHA 4MSMB 3PS6A 2KZRA 3H7SA 1UD7A 2GBJA 3WAOA 4FA6A 2EMSA 3DBLI 1WXMA 2PEAA 3MHSD 2BKRB 2MBHA 1YD8U 2WYQA 1V86A 1TBEA 2Z0DB 1X1MA 2MP2B 4PS7A 3ZRCA 3DVNU 4TUUA 3K9PB 4XX5A 3PHWB 3ZTDA 1T0YA 2OJRA 3PV1A 4GDLB 3U7DA 4X57B 4E71A 2DHZA 4MJSB 5G55A 2K8HA 2L05A 4JLCA 3KUZA 3QQ8B 2WDTB 3PGEA 2Y5BB 1S3SG 3BINA 4G11A 2FIDA 3M95A 1RFAA 3UQBA 2ZPNA 1WIAA 3DDCB 4I6NB 5FR6A 3PRPB 4HCNB 4NQKE 1S1QB 2LRWA 2N9XA 4URKA 5JHAA 4JL9A 4DHJD 4ANUA 2M8SA 5CTRC 4NAWB 3M3JA 2DZJA 2ZNVB 3L13A 2LXCA 4ASWC 4W9CA 5JHBA 2FCMA 1WGRA 2G3QB 1E8ZA 1WRDB 2WX1A 4DBGA 2A5UA 1V49A 2O6VD 2BYVE 2G4DB 3QIJA 3DVGX 2CS4A 3CSFA 3LDZE 2BF8B 3OAWA 4LDTD 1GG3A 2I1JA 3ZNZB 3ZNGC 3QC8B 2KTRA 3H1UA 3VQIA 2KQ7A 2N7EA 5KHQA 1WI0A 1LFDA 1AARA 2JZ3B 4WWNA 2GBRA 3PTFC 3NZSA 4MSQB 2N4FA 2KJRA 3BY4B 2ZVOA 3VVWB 1IP9A 3QK0A 4AOFA 2NS5A 2D11A 2Z59B 3V62A 4HLEA 2YLMA 1Q0WB 1J19A 1WFYA 2BWFA 4MGIE 3PPAA 3R3MA 2L3ZA 3O65B 4MELA 3VUWA 4F7ZA 1WZ0A 2NPTA 3QHTA 3H7PB 4J6IA 2LUEA 4W9GA 4B95A 3A1QB 1V2YA 2MP2A 3MTNB 3A9JB 4W9KA 3TBLD 3TIXA 1F9JA 1C3TA 2KDIA 3SU8X 4W9JA 4BKGA 3DBRI 3VTWA 1PQSA 1UELA 3QX1A 4FJVB 5E6OA 4II3B 2NBWB 4IC7B 1V80A 2ZVNA 5L83A 4RM8A 4EFOA 1Z2MA 3V6CB 2IBIB 1WE6A 2FUHB 1YX6B 4OVUA 1GC6A 2LVQA 4K7SA 3QCAA 4FJYA 4EZJA 5AZFA 4HCPB 4NAWA 4K7UA 2M1MA 2DENB 2N1VA 2GBMA 2KTFA 2LZ6A 4N9F4 4II2B 3IFWB 3JSVB 3B1LX 4JQWC 1FXTB 2AWTA 2ZJDA 3OLMD 4B6WA 1YQBA 1V5TA 4MGYE 4NNJB 4HVBA 2KD0A 5HKHA 2N9PC 2L76A 3L08A 3WANA 2IO1B 4CHKA 4DHJB 3WALA 3CSTA 3HIZA 3APDA 2BKFA 3ZTCA 5LLIA 2KLCA 4I6LB 2QHOA 3VUYA 3PLVA 4GIVA 2LASA 2L00B 3ZNHB 1WXAA 2O6VB 5DPTA 4GN1A 2KFKA 4M8MA 3I3TB 1P98A 1E7UA 2C5LC 2C7HA 2K1FA 4G3XB 2MW5A 2K25A 3GZNI 1ZGUB 3DPDA 2V3SA 4K81A 4M8NA 2DX5B 2DYOA 4HXDA 1WE7A 2O2VB 3H7PA 2AL6A 3PT2B 2Z0EB 3A1QA 2LGDA 4ANXA 4KVGB 3A9JA 3UIPB 3AU4A 4LJPB 3ZVVA 1KOTA 2L8JA 2CKHB 2GBNA 3KVFB 3C0RB 3NOBA 2KWUB 3KH0A 2M17A 4HWIB 3ENEA 4ICUA 4XC2A 3VTUA 4MDKE 1WJUA 3L17A 4PS8A 4MEMA 1E5WA 2V1YA 2W9NA 3PRMB 3PRZA 4IG7B 1UBIA 4GU2A 2MBBB 1WGDA 5J17A 2KDFB 4HJKA 3KYCD 4IWOA 1NDDA 5GMVA 3QAQA 2CR5A 2NBVB 2D10A 2D07B 3ZUNA 1LXDA 4WJPA 3K9OB 2FCQA 4K7WA 1H8CA 1V81A 2G45B 2KNBA 4A3PA 3R7QA 4A20A 1M94A 3L0WB 2LWPA 3SD5A 1VCBA 3JSVA 2KJ6A 4AUQC 3MJWA 2K6QA 1D3ZA 3ZNID 2JVCA 2C7MB 3AI5A 2ZPYA 1P9DU 4WQOB 2REXA 2DYBA 4M0WB 2ASQA 5DCNA 1P1AA 3RZFA 1ISNA 2ZNVC 2MCNB 2J0MA 3KW5B 1EF1A 1WJ4A 1V9JA 3DCGA 3Q3FA 5EDSA 5CHFA 1WM3A 5G2NA 2O6VA 2LJ5A 2PPHA 2HJ8A 1GNUA 1V6EA 2XK5B 2OOBB 3DOWA 4IWQA 3IHPC 2IZVB 1WX9A 3EHVA 4BVUC 4ZDVA 3L10B 4B9KA 2PE6B 1GC7A 4WJQA 2IO2B 4NJ7A 5IA7A 2O2VA 4MH0E 2KWVB 4ZYNA 3KYDD 2AEHA 3WAMA 4DDID 3VXWA 2JY6A 1GJZA 4TKNA 4WJNA 4ANWA 3UINB 3L16A 2NR2A 3DVGY 4NY0A 5CHVC 3DVNV 4W9IA 2N9EB 4LCDE 3H9DA 4BOZB 4KZ0A 2BGFA 5D94A 1TGZB 2C9WB 2PJHA 2KFJA 4E3CA 3N30A 3PHXB 2DZKA 1E8XA 1UZXB 3QWZB 4FBJB 3ZIMA 3A4SC 2CHWA 4BBNF 2NBUA 1CMXB 4GDLA 1XQQA 4MJSA 4FLHA 2L7RA 3WA0A 2ZEQA 3ZO5B 3ZRFA 2ZCBA 3T8MA 1WGHA 2KDEB 4ZRJA 1EF5A 4CYEA 1LQBA 3A9KB 2D3GA 2UYZB 2JRIB 3W1SC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AU5 A;  3B08 A;  2WX0 A;  3Q3J A;  5D7G A;  1RRB A;  2BWE S;  3APF A;  3ML9 A;  3VH3 B;  1TTN A;  2KC2 A;  3ZDM C;  2CHX A;  3A33 B;  3N3K B;  1I42 A;  4GDK B;  3LJ3 A;  4I6P A;  2J7Q B;  2FAZ A;  3ECI A;  2K8C A;  2JF5 A;  4BKS D;  3ML8 A;  1TZ1 A;  2FCN A;  2G4S A;  3DBH I;  2UWQ A;  3AUL A;  2RR9 A;  2D2Q A;  4AJW A;  2KXJ A;  1LM8 B;  2XK5 A;  3EFU A;  5KHO A;  4KDI C;  4NPN A;  3UIO B;  5L95 C;  3JW0 X;  4DWF A;  4GMV A;  2RD0 A;  2N1W A;  3JYU A;  3S2A A;  4TQ0 A;  1YJ1 A;  1E90 A;  3HK0 A;  1V5O A;  2FCS A;  3PLU A;  1Y8R C;  1U4A A;  1L7Y A;  2KAN A;  2KKC A;  1P0R A;  3ALB A;  2MSE D;  2ZCC A;  4G0N B;  4PYZ A;  4DDG D;  4CO7 A;  3GOE A;  1WYW B;  4W9E A;  2IY1 B;  2KQS A;  2KMC A;  2KVR A;  4W9L A;  3L54 A;  4FJZ A;  2MLB A;  2FNJ B;  1R4N I;  1P3Q U;  3DQV A;  2BYE A;  2C60 A;  3RUI B;  3WAP A;  1WMH B;  2LGX A;  2JZZ A;  3IVF A;  3SHQ A;  4HPM B;  2LI5 A;  2KHW B;  3UGB B;  1E8Y A;  1WXS A;  4EKU A;  2JUO A;  3QJZ A;  3UQA A;  3RZW C;  1E8W A;  1SE9 A;  2M4N A;  2R2Q A;  2IO3 B;  2MBQ A;  2JXX A;  2RPQ A;  2ZZP B;  3W1S A;  4A3O A;  1ZKH A;  4AP4 C;  5J18 A;  2DYM A;  3A9K A;  3X23 A;  4BFR A;  4OVV A;  4DK5 A;  2LRU A;  4FAD A;  1GUA B;  5DPS A;  2MBO A;  4EUT A;  5JH5 C;  2KO3 A;  4MM3 A;  3VTV A;  1NBF C;  1YIW A;  4GDK A;  2MRP A;  1RLF A;  1YX5 B;  2IO0 B;  2KMA A;  2YVC A;  2JRH A;  1E7V A;  5E6P A;  3OJ3 A;  2IYD B;  3TCA A;  2M0X A;  5DPW A;  5IAA C;  2NPT B;  3IBE A;  3TJP A;  5LXI B;  2V4L A;  2R2O A;  3R66 C;  4JGH B;  3HM3 A;  1BT0 A;  4ICV A;  4RMA A;  4FHK A;  2HD5 B;  2BYF A;  5C23 A;  3HHM A;  1RAX A;  1KJT A;  2AL3 A;  1A5R A;  3HM6 X;  5AZG A;  4IW0 A;  2KOX A;  3NHE B;  2HE7 A;  2HTH A;  4GOC A;  2EKE C;  4JIO U;  2WWZ A;  4WJO A;  3U30 A;  1WGY A;  2I1K A;  3VH4 B;  4AWJ A;  4EZK A;  1ZW7 A;  4GXB A;  2LXA A;  4IUM B;  3RCZ A;  1I35 A;  4KDL B;  4KIK B;  4EZL A;  5LXH A;  4DHZ E;  3RUL A;  1KLV A;  1WR6 E;  4YL8 A;  1SIF A;  1WMH A;  4NQL B;  3QA8 A;  2C7N B;  2KX3 A;  3KUD B;  3SDL C;  2CHZ A;  4EEW A;  2RSU A;  2KK8 A;  2MX2 A;  3APC A;  3NY5 A;  4G50 A;  3PRE A;  4HDQ A;  5E6N A;  3VUX A;  1H4R A;  3R7R A;  3N32 A;  2KC1 A;  1Z5S B;  3X0W A;  1G6J A;  4TQ1 A;  1UBQ A;  4IM0 A;  5TR5 A;  2KDB A;  3ZLZ A;  5BO4 B;  2LGY A;  2RGF A;  2AYO B;  2GBK A;  3ZKJ C;  2N7D A;  1OEY A;  1J8C A;  2FIF A;  2IY0 B;  2MWS B;  3OJ4 B;  4XZ4 A;  2LVP A;  5DPR A;  1VD2 A;  1WJ6 A;  1KM7 A;  3AXC A;  2L0T A;  5D6J B;  3UF8 A;  2KFK B;  3VDZ A;  2B3A A;  4FHJ A;  4MGK E;  4RM9 A;  1C1Y B;  3PSE B;  1NI2 A;  1SGH A;  4K1R B;  4ANV A;  3ZW3 A;  3M63 B;  5J2R A;  1WM2 A;  2J0K A;  3RYT A;  1WGG A;  3PVL A;  3CMM B;  3EEC A;  4KSK C;  3QAR A;  4BKS A;  3TMP B;  4GB9 A;  3M62 B;  2A4Z A;  2PE9 A;  1QZE A;  2DZM A;  5C1Z A;  2K39 A;  2KN5 A;  3WIM A;  3T9L A;  4F8C B;  2EMT A;  3VHT C;  4ZRI A;  4PS3 A;  2CU1 A;  3D32 A;  3NS8 A;  4HK2 A;  3KUC B;  3RD2 A;  2LD9 A;  3NZU A;  4FUL A;  4IWP A;  4PYU A;  1EUV B;  3ONS A;  1WR1 A;  3IG3 A;  4AJY B;  4IM2 A;  1UH6 A;  1IPG A;  3P2B A;  4FN2 A;  2GOW A;  4KIK A;  2MQJ A;  5CX3 A;  4GSW A;  1EO6 A;  5CHW A;  1OGW A;  4P7I A;  1XT9 B;  2KWC A;  4GGQ A;  5JZE B;  2DAF A;  3V61 A;  1WZ3 A;  2J0J A;  3U8Z A;  1OTR B;  5D2M B;  1WX7 A;  2LVO A;  4KSL C;  4F1S A;  1IYF A;  2JPH A;  2GMI C;  4W9D A;  4DXA B;  2MA9 B;  3ZDT A;  1MG8 A;  4WWO A;  3TL5 A;  1WX8 A;  2NVU I;  3A4R A;  1UGM A;  2BPS A;  4ZRK A;  2XBB C;  1J0G A;  4HPL B;  5AEK B;  3VAW A;  4KZC A;  1WF9 A;  3CF6 E;  2NCN A;  4W9F A;  4WWP A;  4WAA A;  1JRU A;  1L2N A;  2MBE A;  4EOY A;  3B0A A;  4KV2 A;  2DAJ A;  2KX0 A;  1WJN A;  1WXV A;  2KLG A;  4BOS C;  3RT3 B;  1HE8 A;  1XD3 B;  3H6N A;  4IM3 A;  4E74 A;  4TV3 A;  1Q5W B;  2KTR B;  2JT4 B;  4LDT B;  3VFK A;  1Q1O A;  1WH3 A;  2XEW A;  1R4M I;  1K8R B;  1OQY A;  4MGZ E;  4DHZ B;  4BKT A;  2L0F A;  4BBN C;  4HDO A;  1WY8 A;  1OEY J;  2K8B A;  2JWZ A;  4LJO B;  2KJH B;  2DZI A;  3PZD A;  3DBS A;  3EC8 A;  2VRR B;  3V6E B;  3V60 A;  3JVZ X;  3W1Y A;  4W9H A;  4NJ6 A;  2K6D B;  5AZH A;  4MSM B;  3PS6 A;  2KZR A;  3H7S A;  1UD7 A;  2GBJ A;  3WAO A;  4FA6 A;  2EMS A;  3DBL I;  1WXM A;  2PEA A;  3MHS D;  2BKR B;  2MBH A;  1YD8 U;  2WYQ A;  1V86 A;  1TBE A;  2Z0D B;  1X1M A;  2MP2 B;  4PS7 A;  3ZRC A;  3DVN U;  4TUU A;  3K9P B;  4XX5 A;  3PHW B;  3ZTD A;  1T0Y A;  2OJR A;  3PV1 A;  4GDL B;  3U7D A;  4X57 B;  4E71 A;  2DHZ A;  4MJS B;  5G55 A;  2K8H A;  2L05 A;  4JLC A;  3KUZ A;  3QQ8 B;  2WDT B;  3PGE A;  2Y5B B;  1S3S G;  3BIN A;  4G11 A;  2FID A;  3M95 A;  1RFA A;  3UQB A;  2ZPN A;  1WIA A;  3DDC B;  4I6N B;  5FR6 A;  3PRP B;  4HCN B;  4NQK E;  1S1Q B;  2LRW A;  2N9X A;  4URK A;  5JHA A;  4JL9 A;  4DHJ D;  4ANU A;  2M8S A;  5CTR C;  4NAW B;  3M3J A;  2DZJ A;  2ZNV B;  3L13 A;  2LXC A;  4ASW C;  4W9C A;  5JHB A;  2FCM A;  1WGR A;  2G3Q B;  1E8Z A;  1WRD B;  2WX1 A;  4DBG A;  2A5U A;  1V49 A;  2O6V D;  2BYV E;  2G4D B;  3QIJ A;  3DVG X;  2CS4 A;  3CSF A;  3LDZ E;  2BF8 B;  3OAW A;  4LDT D;  1GG3 A;  2I1J A;  3ZNZ B;  3ZNG C;  3QC8 B;  2KTR A;  3H1U A;  3VQI A;  2KQ7 A;  2N7E A;  5KHQ A;  1WI0 A;  1LFD A;  1AAR A;  2JZ3 B;  4WWN A;  2GBR A;  3PTF C;  3NZS A;  4MSQ B;  2N4F A;  2KJR A;  3BY4 B;  2ZVO A;  3VVW B;  1IP9 A;  3QK0 A;  4AOF A;  2NS5 A;  2D11 A;  2Z59 B;  3V62 A;  4HLE A;  2YLM A;  1Q0W B;  1J19 A;  1WFY A;  2BWF A;  4MGI E;  3PPA A;  3R3M A;  2L3Z A;  3O65 B;  4MEL A;  3VUW A;  4F7Z A;  1WZ0 A;  2NPT A;  3QHT A;  3H7P B;  4J6I A;  2LUE A;  4W9G A;  4B95 A;  3A1Q B;  1V2Y A;  2MP2 A;  3MTN B;  3A9J B;  4W9K A;  3TBL D;  3TIX A;  1F9J A;  1C3T A;  2KDI A;  3SU8 X;  4W9J A;  4BKG A;  3DBR I;  3VTW A;  1PQS A;  1UEL A;  3QX1 A;  4FJV B;  5E6O A;  4II3 B;  2NBW B;  4IC7 B;  1V80 A;  2ZVN A;  5L83 A;  4RM8 A;  4EFO A;  1Z2M A;  3V6C B;  2IBI B;  1WE6 A;  2FUH B;  1YX6 B;  4OVU A;  1GC6 A;  2LVQ A;  4K7S A;  3QCA A;  4FJY A;  4EZJ A;  5AZF A;  4HCP B;  4NAW A;  4K7U A;  2M1M A;  2DEN B;  2N1V A;  2GBM A;  2KTF A;  2LZ6 A;  4N9F 4;  4II2 B;  3IFW B;  3JSV B;  3B1L X;  4JQW C;  1FXT B;  2AWT A;  2ZJD A;  3OLM D;  4B6W A;  1YQB A;  1V5T A;  4MGY E;  4NNJ B;  4HVB A;  2KD0 A;  5HKH A;  2N9P C;  2L76 A;  3L08 A;  3WAN A;  2IO1 B;  4CHK A;  4DHJ B;  3WAL A;  3CST A;  3HIZ A;  3APD A;  2BKF A;  3ZTC A;  5LLI A;  2KLC A;  4I6L B;  2QHO A;  3VUY A;  3PLV A;  4GIV A;  2LAS A;  2L00 B;  3ZNH B;  1WXA A;  2O6V B;  5DPT A;  4GN1 A;  2KFK A;  4M8M A;  3I3T B;  1P98 A;  1E7U A;  2C5L C;  2C7H A;  2K1F A;  4G3X B;  2MW5 A;  2K25 A;  3GZN I;  1ZGU B;  3DPD A;  2V3S A;  4K81 A;  4M8N A;  2DX5 B;  2DYO A;  4HXD A;  1WE7 A;  2O2V B;  3H7P A;  2AL6 A;  3PT2 B;  2Z0E B;  3A1Q A;  2LGD A;  4ANX A;  4KVG B;  3A9J A;  3UIP B;  3AU4 A;  4LJP B;  3ZVV A;  1KOT A;  2L8J A;  2CKH B;  2GBN A;  3KVF B;  3C0R B;  3NOB A;  2KWU B;  3KH0 A;  2M17 A;  4HWI B;  3ENE A;  4ICU A;  4XC2 A;  3VTU A;  4MDK E;  1WJU A;  3L17 A;  4PS8 A;  4MEM A;  1E5W A;  2V1Y A;  2W9N A;  3PRM B;  3PRZ A;  4IG7 B;  1UBI A;  4GU2 A;  2MBB B;  1WGD A;  5J17 A;  2KDF B;  4HJK A;  3KYC D;  4IWO A;  1NDD A;  5GMV A;  3QAQ A;  2CR5 A;  2NBV B;  2D10 A;  2D07 B;  3ZUN A;  1LXD A;  4WJP A;  3K9O B;  2FCQ A;  4K7W A;  1H8C A;  1V81 A;  2G45 B;  2KNB A;  4A3P A;  3R7Q A;  4A20 A;  1M94 A;  3L0W B;  2LWP A;  3SD5 A;  1VCB A;  3JSV A;  2KJ6 A;  4AUQ C;  3MJW A;  2K6Q A;  1D3Z A;  3ZNI D;  2JVC A;  2C7M B;  3AI5 A;  2ZPY A;  1P9D U;  4WQO B;  2REX A;  2DYB A;  4M0W B;  2ASQ A;  5DCN A;  1P1A A;  3RZF A;  1ISN A;  2ZNV C;  2MCN B;  2J0M A;  3KW5 B;  1EF1 A;  1WJ4 A;  1V9J A;  3DCG A;  3Q3F A;  5EDS A;  5CHF A;  1WM3 A;  5G2N A;  2O6V A;  2LJ5 A;  2PPH A;  2HJ8 A;  1GNU A;  1V6E A;  2XK5 B;  2OOB B;  3DOW A;  4IWQ A;  3IHP C;  2IZV B;  1WX9 A;  3EHV A;  4BVU C;  4ZDV A;  3L10 B;  4B9K A;  2PE6 B;  1GC7 A;  4WJQ A;  2IO2 B;  4NJ7 A;  5IA7 A;  2O2V A;  4MH0 E;  2KWV B;  4ZYN A;  3KYD D;  2AEH A;  3WAM A;  4DDI D;  3VXW A;  2JY6 A;  1GJZ A;  4TKN A;  4WJN A;  4ANW A;  3UIN B;  3L16 A;  2NR2 A;  3DVG Y;  4NY0 A;  5CHV C;  3DVN V;  4W9I A;  2N9E B;  4LCD E;  3H9D A;  4BOZ B;  4KZ0 A;  2BGF A;  5D94 A;  1TGZ B;  2C9W B;  2PJH A;  2KFJ A;  4E3C A;  3N30 A;  3PHX B;  2DZK A;  1E8X A;  1UZX B;  3QWZ B;  4FBJ B;  3ZIM A;  3A4S C;  2CHW A;  4BBN F;  2NBU A;  1CMX B;  4GDL A;  1XQQ A;  4MJS A;  4FLH A;  2L7R A;  3WA0 A;  2ZEQ A;  3ZO5 B;  3ZRF A;  2ZCB A;  3T8M A;  1WGH A;  2KDE B;  4ZRJ A;  1EF5 A;  4CYE A;  1LQB A;  3A9K B;  2D3G A;  2UYZ B;  2JRI B;  3W1S C; 
#chains in the Genus database with same CATH topology
 2WX0 A;  5D7G A;  3IT4 B;  4ZHP A;  1L4Z B;  4ZRQ A;  1WRI A;  3P63 A;  3RNG C;  1TTN A;  3ZDM C;  2CHX A;  4M0W A;  4UDU C;  3N3K B;  1BML C;  4GDK B;  1L0X B;  2JF5 A;  2OED A;  1TZ1 A;  2UWQ A;  3Q8C A;  2RR9 A;  1HZ6 A;  4AJW A;  3EFU A;  1LM8 B;  2N9K A;  5KHO A;  3UIO B;  2N1W A;  3EGR A;  3S2A A;  3PLU A;  3UIN B;  1STE A;  2KKC A;  4G0N B;  2ZCC A;  4CO7 A;  3GOE A;  2KMC A;  3L54 A;  2MLB A;  3RUI B;  1M4V A;  1WMH B;  1FRD A;  2JZZ A;  3SHQ A;  2WU5 B;  3Q8F A;  3UGB B;  1E8Y A;  4OVZ A;  3PZ8 A;  3QJZ A;  1YN5 A;  1E8W A;  2WDV B;  1WXQ A;  1SE9 A;  2RPQ A;  1FNW A;  2ZZP B;  2BW2 A;  4RNA A;  4YTP B;  4DK5 A;  3T3O A;  4Q2J A;  1NBF C;  3PZ7 A;  2W55 A;  1YX5 B;  2JRH A;  2JSV X;  3RN9 C;  2IYD B;  2HDE A;  3TCA A;  1UNS A;  3N20 C;  5DPW A;  3IBE A;  4JGH B;  3HM3 A;  1JWU D;  4FXC A;  4RMA A;  4FHK A;  1KJT A;  2AL3 A;  3I57 A;  1A5R A;  3U7Z A;  4JE3 B;  4IW0 A;  1YJJ A;  2WWZ A;  1Y56 A;  4GXB A;  2BYT A;  4EZL A;  3AED B;  4D2K A;  1KLV A;  5I4D A;  3EUB 2;  2CHZ A;  3NY5 A;  2MX2 A;  5E6N A;  4HDQ A;  3MC0 B;  3NUH B;  5J18 A;  1G6J A;  1P7F A;  1TS3 A;  3DHH C;  1FFV A;  2KDB A;  2L32 A;  3ZLZ A;  2LGY A;  2RGF A;  3ZKJ C;  1MI0 A;  2IGG A;  3OJ4 B;  2MWS B;  2LVP A;  2BS2 B;  4WUR A;  1KM7 A;  3AXC A;  2L0T A;  2V4I B;  2B3A A;  4FHJ A;  2ACZ B;  3P4P B;  4RFB A;  1D4B A;  3AEC B;  1SEB D;  1WM2 A;  3RYT A;  3EEC A;  1GPX A;  3MC9 A;  1V97 A;  2A4Z A;  2PE9 A;  4ZYS A;  1I7H A;  3WIM A;  3T9L A;  2V0G A;  2EMT A;  4ZRI A;  3ZYY X;  2IND C;  2QIE B;  4O1N A;  1IPG A;  2GOW A;  4KIK A;  1ZXH A;  4GSW A;  3URY A;  1EO6 A;  4P6V F;  1F2R I;  1FIQ A;  1XT9 B;  2KWC A;  4GGQ A;  3V61 A;  1CJE A;  4C4V A;  1OTR B;  2XN9 C;  1WX7 A;  2KT7 A;  2LVO A;  4ACF A;  4DXA B;  2MA9 B;  3ZDT A;  3Q14 C;  4WWO A;  3MP9 A;  1WX8 A;  2WXR A;  2XBB C;  1GAQ B;  1J0G A;  1QLB B;  1V8C A;  3DHG C;  2MBE A;  3AE6 B;  2KX0 A;  3TUO A;  1GOZ A;  4TV3 A;  1EU4 A;  4LDT B;  2KDM A;  1VZ8 A;  1K8R B;  4MGZ E;  4DHZ B;  1L6U A;  2M19 A;  4JWU C;  4HDO A;  3PZD A;  4RF0 A;  1VLB A;  2VRR B;  3V60 A;  2ONQ A;  4HJG E;  3JVZ X;  2JU6 X;  2KZR A;  3H7S A;  3DBL I;  1E0Z A;  1WXM A;  1DOI A;  2MBH A;  2WHI A;  3KQ4 A;  1E10 A;  1V86 A;  2Z0D B;  1YN4 A;  4GDL B;  3U7D A;  4MJS B;  3HRD D;  4M00 A;  2L05 A;  4JLC A;  4WAF A;  2WXP A;  2FID A;  1RFA A;  2ZPN A;  5C2T B;  1YJI A;  4NQK E;  3GP7 A;  2LRW A;  4LNN A;  2AQ1 B;  4NAW B;  1RWS A;  3NG0 A;  3V05 A;  3L13 A;  4W9C A;  2KVZ A;  2G3Q B;  4DBG A;  1FRR A;  2BYV E;  3QIJ A;  3DVG X;  2I1J A;  2KTR A;  5KHQ A;  2IGH A;  3PTF C;  3NZS A;  1FCL A;  2ZVO A;  3VVW B;  3FKY A;  1XLP A;  2RDG A;  3R2T A;  1SSN A;  1SE4 A;  1WFY A;  2GB1 A;  3PPA A;  2L3Z A;  4F7Z A;  4HRS A;  4B95 A;  2MP2 A;  3U4E G;  2JZP A;  4KGT A;  3SU8 X;  1QF6 A;  1ZDX A;  3VTW A;  5E6O A;  4II3 B;  4IC7 B;  4HPP A;  4EFO A;  1Z2M A;  5FR3 A;  3U52 E;  4K7S A;  3QCA A;  4FJY A;  2PW9 A;  2M1M A;  4J3O D;  2N1V A;  2LZ6 A;  4N9F 4;  3JSV B;  4JQW C;  1FXT B;  3Q69 A;  1LGR A;  4NNJ B;  1CK1 A;  3L08 A;  1DOY A;  2IO1 B;  4CHK A;  4DHJ B;  3CST A;  3N1Z C;  3APD A;  2H89 B;  2QHO A;  1KLU D;  4XGA B;  2LAS A;  3ZNH B;  1WXA A;  2O6V B;  1IGD A;  5DPT A;  1JWS D;  4M8M A;  1TS5 A;  2K1F A;  4G3X B;  2MW5 A;  3HVZ A;  2K25 A;  3DPD A;  4C7Z A;  4M8N A;  2O2V B;  3PT2 B;  1XXG A;  2FBW B;  2WS3 B;  3FIL B;  3A9J A;  3AU4 A;  4LJP B;  1QOA A;  2I38 A;  2NMQ A;  3E56 A;  3OG5 A;  5BYQ A;  2N0S B;  4MEM A;  1JW9 D;  1UBI A;  4YSX B;  1WGD A;  5HI1 A;  2WXQ A;  4KGR A;  2E3T A;  4YXD B;  1H8C A;  1IBX A;  4A3P A;  3IXS A;  2LWP A;  3SD5 A;  4AUQ C;  3MJW A;  1D3Z A;  1XCT L;  3ZNI D;  2J4X A;  2CJO A;  3UI3 A;  4WQO B;  3IAM 1;  2LHD A;  2KYW A;  4XDD A;  5IN7 A;  1JRP A;  2MCN B;  2R61 A;  3Q3F A;  2JX5 A;  4KGS A;  5CHF A;  1J7C A;  2XK5 B;  4IWQ A;  4NAM A;  1WX9 A;  3L10 B;  2PE6 B;  4S0R A;  2WXI A;  4MH0 E;  2KWV B;  3WAM A;  2JY6 A;  3L16 A;  3VR9 B;  5CHV C;  2N9E B;  4LCD E;  4MH8 A;  1TGZ B;  2C9W B;  2PJH A;  4S17 A;  2KFJ A;  3NVZ A;  3LYY A;  3N30 A;  4E3C A;  4FBJ B;  2DZK A;  1E8X A;  1E6E B;  3A4S C;  2CHW A;  2MJ3 A;  2NBU A;  1XQQ A;  2K22 A;  3W2D A;  2M56 B;  1XLQ A;  3WA0 A;  4R3D A;  2KDE B;  2D3G A;  2JRI B;  3AU5 A;  3B08 A;  3Q3J A;  2PIA A;  4DQO C;  2KC2 A;  2QEJ C;  4XWT A;  4I6P A;  2FAZ A;  1FEH A;  3AUL A;  1VRA B;  2D2Q A;  5L95 C;  4DWF A;  1YJ1 A;  3HK0 A;  1I4P A;  1U4A A;  1L7Y A;  1KLG D;  1P0R A;  2ON8 A;  2K3U A;  4DDG D;  3MJ5 A;  1KF6 B;  4RH6 A;  1ET6 A;  5IO9 A;  4W9E A;  2KQS A;  2KVR A;  3L4P A;  4W9L A;  4ZRP A;  1FCC C;  1F0Z A;  2N9L A;  5D3D A;  2BYE A;  4AS1 A;  3IVF A;  1V1O A;  4HPM B;  1WXS A;  2KAJ A;  1QOG A;  3UQA A;  4TMA B;  1PUT A;  2M4N A;  3TEZ A;  2M0A A;  3W1S A;  1ZKH A;  3A9K A;  3ZJV A;  1OFF A;  1GUA B;  5DPS A;  2MBO A;  4EUT A;  4MM3 A;  4GDK A;  1RLF A;  2KMA A;  2BB6 A;  2IO0 B;  2YVC A;  1JWM D;  3OJ3 A;  1SXT A;  1NYR A;  2VZK B;  1T3Q A;  2LGS A;  3H8H A;  2NPT B;  1PGX A;  2RPV A;  2R2O A;  1ET9 A;  1BT0 A;  2J42 A;  2HD5 B;  2BYF A;  5C23 A;  1RAX A;  1NYQ A;  4A9A A;  3BK1 A;  3Q3O C;  3B2G A;  4JIO U;  1WGY A;  3VH4 B;  2JQR B;  4XWW A;  2LXA A;  3RCZ A;  2WGS A;  1I35 A;  3ABV B;  2LMC A;  1SIF A;  1WMH A;  2C7N B;  2KX3 A;  3MC8 A;  1GB4 A;  2KK8 A;  3VUX A;  3PRE A;  3X0W A;  1H4R A;  3P4S B;  3R7R A;  3NVW A;  4XE0 A;  4IM0 A;  5TR5 A;  2G9H D;  3AE7 B;  2X8X X;  5DPR A;  1VD2 A;  1ZXI A;  3TEY A;  1L5P A;  4WQM A;  2IJ0 A;  3DWM A;  4YSY B;  4ARI A;  3M63 B;  4KKJ A;  1WGG A;  3PVL A;  1XEE A;  1T0R C;  3TMP B;  5C1Z A;  1N5W A;  4MAC A;  3VHT C;  1MFW A;  2CU1 A;  2IDY A;  2KWD A;  3NS8 A;  4HK2 A;  3RD2 A;  4PYU A;  4L1B A;  3ONS A;  1WR1 A;  4IM2 A;  1UH6 A;  2XNA C;  1FPY A;  1IUE A;  1B1Z A;  4P7I A;  2BT6 A;  2LEK A;  3P42 A;  3U8Z A;  1BXT A;  4KSL C;  2JPH A;  3A4R A;  5BYR A;  3AEG B;  2HJ1 A;  4HPL B;  4KZC A;  4W9F A;  1JRU A;  1L2N A;  1WXV A;  1HE8 A;  1I4R A;  4IM3 A;  1C4A A;  1WH3 A;  3Q3M C;  1OQY A;  2ICI A;  4BKT A;  4BBN C;  2K8B A;  1OEY J;  4H2A A;  2JWZ A;  2KJH B;  3RPF C;  3V6E B;  4FA6 A;  2OHF A;  3SR6 A;  2WYQ A;  1EWC A;  2I2Y A;  1X1M A;  3TEW A;  2LUM A;  4TUU A;  3PV1 A;  3I63 C;  4PT5 A;  4X57 B;  4E71 A;  2DHZ A;  2K8H A;  2W82 A;  1OQQ A;  5FR6 A;  2EEL A;  2NTS A;  4NZL B;  1S1Q B;  2D3B A;  1YNT E;  1TKG A;  2N9X A;  5JHA A;  4DHJ D;  4B0E A;  2VH1 A;  2M8S A;  4ANU A;  2KMM A;  3FAH A;  2O6V D;  3LDZ E;  3OAW A;  2KQ7 A;  4L2Y A;  1LFD A;  2JZ3 B;  1L6V A;  3DBH B;  2BS4 B;  4WWM A;  1D5M C;  1T5X D;  3BY4 B;  3QK0 A;  4AOF A;  2NS5 A;  2Z59 B;  4HLE A;  1J19 A;  1VJK A;  3LB8 C;  2OJW A;  4MEL A;  3O65 B;  1C79 A;  1MPE A;  3MTN B;  3TIX A;  2SAK A;  1F9J A;  2KDI A;  4YTM B;  1MJD A;  4RM8 A;  1DGJ A;  3NJT A;  3V6C B;  1D6E C;  3ZQ4 A;  1C78 A;  1YX6 B;  4OVU A;  1GC6 A;  4EZJ A;  2Y5C A;  4NAW A;  4K7U A;  1XF5 L;  4JX1 C;  4II2 B;  4MT5 A;  3AEB B;  4B6W A;  2KD0 A;  2N9P C;  1QIL A;  3WAN A;  1JAL A;  4GIV A;  4GN1 A;  2KFK A;  3PO0 A;  1P98 A;  3VRB B;  3P4R B;  4K81 A;  2DX5 B;  2DYO A;  2RDB C;  4RGN A;  1F1H A;  3NRZ A;  2CKH B;  2GBN A;  3KVF B;  2KWU B;  4ICU A;  3ENE A;  3L17 A;  3PRM B;  2L83 A;  4IG7 B;  2BS3 B;  2MBB B;  2DNF A;  4HJK A;  3KYC D;  1ZDV A;  5GMV A;  1R7S A;  1UWX A;  3QAQ A;  3GB1 A;  2D07 B;  1FD6 A;  1TY2 A;  3ZUN A;  3Q8B A;  2FCQ A;  2G45 B;  4A20 A;  3L0W B;  3JSV A;  2C7M B;  5BMG A;  1TKY A;  2ZNV C;  3SFE B;  1WJ4 A;  3OWE B;  2O6V A;  1PGB A;  4IOI E;  1GNU A;  1KTK A;  3IHP C;  4JPS A;  3EHV A;  4XYC A;  4WJQ A;  2O2V A;  4WH4 A;  3RNF C;  2MH7 A;  3N1X C;  2V3P A;  4TKN A;  4WJN A;  3DVN V;  4W9I A;  5E6J A;  3ZJT A;  2BGF A;  2FE8 A;  1T6B X;  5AUI A;  2WXN A;  1C76 A;  1R4N B;  1CMX B;  1HTQ A;  2L7R A;  1VZ7 A;  2ZEQ A;  2J52 A;  2ZCB A;  2VZK D;  4EOY A;  3W1S C;  3EA6 A;  5G5G A;  1RRB A;  2BWE S;  2B76 B;  1SE2 A;  1KH0 A;  1R4M B;  3A33 B;  3P4Q B;  4LLG M;  1EU3 A;  1TS4 A;  1SIJ A;  2J7Q B;  4BKS D;  1N5X A;  2FCN A;  2G4S A;  4CQN A;  3ETR A;  2XK5 A;  3AE8 B;  3AEE B;  4DXG A;  1PGA A;  4KDI C;  4NPN A;  2QIL A;  4USA A;  2QMT A;  2RD0 A;  3JYU A;  2PKO A;  4TQ0 A;  4GLS C;  2FCS A;  1Y8R C;  2KAN A;  3ALB A;  2MSE D;  3ZXR A;  1WYW B;  5H8Y E;  4EE2 A;  3BII D;  4HEA 1;  4FJZ A;  5EE1 A;  1R4N I;  1P3Q U;  3BVZ A;  2LI5 A;  2KHW B;  4EKU A;  2YEP B;  2WXL A;  1AN8 A;  2R2Q A;  2IO3 B;  2MBQ A;  2JXX A;  4A3O A;  4AP4 C;  2D3A A;  2DYM A;  2PVO D;  3X23 A;  4BFR A;  2PMV A;  2LRU A;  4FAD A;  3ZXV A;  2KO3 A;  1JCK B;  3VTV A;  2UU7 A;  4US9 A;  1K52 A;  2MRP A;  1E9M A;  5E6P A;  5IAA C;  5HHD G;  3BYT B;  3TJP A;  1PFD A;  1I4H A;  2V4L A;  3RI7 C;  3R66 C;  2X38 A;  1SE3 A;  3BYY B;  2QJL A;  3AE9 B;  3HHM A;  4REZ A;  1SF0 A;  1J7B A;  4N6E B;  2E6X A;  3HM6 X;  5AZG A;  3NHE B;  2HTH A;  2ZW0 A;  4WJO A;  2I1K A;  3DBR B;  4AWJ A;  1ZW7 A;  2PLP A;  1TIF A;  4KDL B;  3BZD B;  1HXY D;  3QA8 A;  5IKC M;  2GI9 A;  4EEW A;  3APC A;  4G50 A;  4LNO A;  5IOI A;  3HVD A;  2KC1 A;  3WCQ A;  3P1M A;  1N62 A;  4TQ1 A;  3RMK C;  1F2R C;  5BO4 B;  2AYO B;  1AYF A;  1T0S C;  1NEK B;  1J8C A;  1PYW D;  2FUG 1;  2FIF A;  1YOV B;  4XZ4 A;  3RNA C;  1WJ6 A;  4HKQ A;  1HA5 A;  2BB5 A;  5D6J B;  4WIP A;  3VDZ A;  1PDX A;  1D5X C;  3AH7 A;  3PSE B;  1NI2 A;  1SGH A;  3ZW3 A;  2K0P A;  2MHJ A;  5J2R A;  2J0K A;  3CMM B;  4KSK C;  3QAR A;  4GB9 A;  1N60 A;  1QZE A;  2K39 A;  4F8C B;  1J7A A;  1V1P B;  3D32 A;  5BMI A;  4BKS A;  3KUC B;  3NZU A;  4FUL A;  3Q8A A;  1EUV B;  2J53 A;  4C56 C;  2W3R A;  3J9C A;  4FN2 A;  1ESF A;  3R2I A;  4M02 A;  3NZ3 A;  1QQR A;  2J0J A;  1WGK A;  5D2M B;  3O13 A;  1ZE3 D;  2GMI C;  4W9D A;  1FO4 A;  3TL5 A;  4ZRK A;  2NVU I;  1UGM A;  1VR9 A;  3W5U B;  2LHE A;  4PK1 A;  3CF6 E;  2NCN A;  4WAA A;  4XDC A;  1MHH E;  1QOF A;  1QT9 A;  2BTE A;  3B0A A;  4KV2 A;  4US8 A;  1YQ3 B;  4BOS C;  1N63 A;  3RT3 B;  2AQ2 B;  4E74 A;  3VFK A;  1Q1O A;  4YTN B;  1WY8 A;  2MEK A;  4LJO B;  3DBS A;  3ZJU A;  2INN E;  3VR8 B;  3W1Y A;  4W9H A;  4NJ6 A;  2K6D B;  5AZH A;  4MSM B;  1UD7 A;  3LXF A;  2EMS A;  1ROE A;  5EE9 A;  1NVI D;  5HFY A;  2PEA A;  1YD8 U;  1JML A;  1TBE A;  2WU2 B;  3AE3 B;  3ZRC A;  3DVN U;  4XX5 A;  2CU3 A;  3PHW B;  1T0Y A;  4RGT A;  2OJR A;  1N61 A;  1HZ5 A;  3KUZ A;  2WDT B;  3PGE A;  2Y5B B;  1S3S G;  4G11 A;  1DOX A;  1FNU A;  1WIA A;  3DDC B;  4I6N B;  4ZHO A;  2HTM E;  2INP E;  4URK A;  4HKZ E;  1OQR A;  2DZJ A;  2ZNV B;  2LXC A;  4K3C A;  2WX1 A;  2G4D B;  2CS4 A;  2BF8 B;  5BYS A;  4LDT D;  1GB1 A;  3ZNG C;  3VQI A;  3H1U A;  2N7E A;  1WI0 A;  1AAR A;  2GBR A;  4MSQ B;  5LNK 1;  1KFY B;  1IP9 A;  3KWV A;  5HG2 A;  2LFI A;  2D11 A;  2YLM A;  1Q0W B;  4MGI E;  4P1B C;  3R3M A;  3VUW A;  1WZ0 A;  3QHT A;  3H7P B;  4J6I A;  2LUE A;  4W9G A;  3A1Q B;  1V2Y A;  4W9K A;  3TBL D;  1C3T A;  4BKG A;  5FKA C;  3DHI C;  1PQS A;  3QX1 A;  4FJV B;  1UWM A;  2NBW B;  2ZVN A;  5L83 A;  1WE6 A;  2FUH B;  5T8I A;  2L52 A;  5AZF A;  4MM3 B;  4HCP B;  1UUP A;  3GE8 C;  4YWG G;  2SEB D;  1L4D B;  3B1L X;  1F77 A;  2AWT A;  2JYT A;  3OLM D;  4MGY E;  2L76 A;  2DBY A;  3WAL A;  3BK2 A;  2BKF A;  1TJE A;  3AV8 A;  5AUK A;  4I6L B;  2KAC A;  3VUY A;  2L00 B;  3C19 A;  3I3T B;  2C5L C;  3DWG C;  2KQ4 X;  2H88 B;  1YMH E;  4HXD A;  1WE7 A;  2AL6 A;  4KVG B;  3UIP B;  3I9V 1;  2Z8L A;  1KOT A;  4LNI A;  1Q10 A;  3KH0 A;  2M17 A;  1TS2 A;  4HWI B;  4N58 A;  4MDK E;  4PS8 A;  1E5W A;  2V1Y A;  3PRZ A;  4GU2 A;  1SJH D;  1ACC A;  2KDF B;  2AQ3 B;  4IWO A;  2CR5 A;  2D10 A;  3IAS 1;  4WJP A;  1V81 A;  2KNB A;  1VCB A;  2CJN A;  2JVC A;  1VZ6 A;  3AI5 A;  2ZPY A;  4KX6 B;  4M0W B;  5DCN A;  1P1A A;  1KRH A;  2NTT A;  3DCG A;  5EDS A;  5G2N A;  2LJ5 A;  2JXT A;  2PVG C;  3MHZ A;  3GS2 A;  3DOW A;  1I4G A;  2IZV B;  4HRO A;  4B9K A;  4N59 A;  1GC7 A;  2IO2 B;  4NJ7 A;  2LJI A;  4ZYN A;  3KYD D;  1VDV A;  3VXW A;  4ANW A;  2EKI A;  2NR2 A;  5MPO A;  3DVG Y;  1AWD A;  4M01 A;  2JWU A;  3H9D A;  4BOZ B;  4KZ0 A;  3PHX B;  1UZX B;  5G5H A;  2WP9 B;  4YT0 B;  4GDL A;  4MJS A;  2WXK A;  2WDQ B;  3ZO5 B;  1LO5 D;  1WGH A;  4ZRJ A;  1ENF A;  4CYE A;  2D3C A;  2UYZ B;  5IP4 D;  1FFU A;  3APF A;  3ML9 A;  5TSS A;  3R8B A;  3VH3 B;  2IPK D;  1FXA A;  1I42 A;  3AE5 B;  1K51 A;  3LJ3 A;  3ECI A;  2K8C A;  3ML8 A;  3DBH I;  1MG4 A;  2KXJ A;  3DBL B;  3JW0 X;  4GMV A;  1RFK A;  1E90 A;  1V5O A;  3E9S A;  3I5J C;  4KKI A;  4ARC A;  4PYZ A;  2IY1 B;  1HEZ E;  2FNJ B;  1YQ4 B;  1ZPS A;  3DQV A;  2C60 A;  1B9R A;  3IT6 B;  3WAP A;  2LGX A;  4NJC A;  1RYJ A;  4C7Y A;  1JQ4 A;  3NVY A;  2JUO A;  3RZW C;  1MVK A;  2ZW1 A;  1XLO A;  2WXO A;  4OVV A;  1CQV A;  2WQY B;  2WXJ A;  5JH5 C;  1YIW A;  1EM7 A;  3W5V B;  2QC8 A;  1E7V A;  2M0X A;  4A6Q A;  1BUI C;  2V3N A;  1HQR D;  5LXI B;  3Q6B A;  4ICV A;  4P1C C;  3KWL A;  3FC4 A;  2KOX A;  2HE7 A;  2N7J A;  4GOC A;  2EKE C;  3U30 A;  4EZK A;  1WSP A;  1IGC A;  4IUM B;  3AEF B;  4KIK B;  2DWQ A;  4DHZ E;  3RUL A;  3AEA B;  1WR6 E;  4YL8 A;  4RGM A;  4NQL B;  2IGD A;  3FIL A;  3KUD B;  3SDL C;  4C4V B;  2WXH A;  2RSU A;  5LXH A;  3N32 A;  1TKE A;  1Z5S B;  1UBQ A;  4A8X C;  2GBK A;  2N7D A;  1OEY A;  2KN4 A;  2IY0 B;  3BWU D;  2D5G A;  1C4C A;  3UF8 A;  2KFK B;  3V3X A;  4MGK E;  4RM9 A;  1C1Y B;  3CIR B;  4RCO A;  4ANV A;  4K1R B;  4JWS C;  4ITK A;  2QDF A;  3M62 B;  1CZP A;  2DZM A;  2GLS A;  2KN5 A;  1P7E A;  2K5P A;  3SEB A;  4PS3 A;  3VRA B;  3T3N A;  2L1A A;  3AB5 A;  2LD9 A;  4IWP A;  3IG3 A;  1I4Q A;  4AJY B;  3P2B A;  2JYE A;  4OZA A;  3TSS A;  1TYG B;  2MQJ A;  5CX3 A;  1TT5 B;  5CHW A;  1QKZ A;  1OGW A;  5JZE B;  2DAF A;  1JRO A;  1FXI A;  1WZ3 A;  1DYQ A;  4A55 A;  2K9X A;  4DXF A;  4F1S A;  1IYF A;  1MG8 A;  5EE3 A;  3AN1 A;  2BPS A;  1WWT A;  4LTU A;  1C9F A;  5AEK B;  3VAW A;  1WF9 A;  4WWP A;  3AE2 B;  2DAJ A;  1SBB B;  1WJN A;  2KLG A;  1XD3 B;  3H6N A;  1Q5W B;  2KTR B;  2JT4 B;  1NEN B;  2XEW A;  1R4M I;  2L0F A;  4LK0 M;  2DZI A;  3EC8 A;  2LGI A;  1F52 A;  3PS6 A;  1V1P A;  3WAO A;  2GBJ A;  4OZB A;  5GXG B;  3AE4 B;  4TSS A;  3MHS D;  1EWY C;  2BKR B;  3N9Y C;  2MP2 B;  4PS7 A;  2DLB A;  3K9P B;  5EE0 A;  3ZTD A;  1K50 A;  4LNF A;  5FK9 C;  5G55 A;  2PTL A;  3HUI A;  4RF1 A;  3QQ8 B;  3MFG A;  3BIN A;  3M95 A;  3UQB A;  3BVM A;  4B0M A;  3N1Y C;  4L23 A;  3PRP B;  4HCN B;  3Q8E A;  4JL9 A;  3ZGZ A;  5CTR C;  2WLB A;  3M3J A;  2WXM A;  4ASW C;  4OHJ A;  3NS1 A;  5JHB A;  2FCM A;  1WGR A;  1E8Z A;  1WRD B;  2A5U A;  1V49 A;  2QCZ A;  3CSF A;  3GE3 C;  1GG3 A;  3ZNZ B;  2V9H A;  3QC8 B;  4C00 A;  2VH2 A;  4WWN A;  4A90 A;  3B2F A;  1FMA D;  2N4F A;  2KJR A;  1ZP0 B;  2W54 A;  3V62 A;  2INC C;  1RM6 C;  2BWF A;  2RMM A;  4K3B A;  1ZOY B;  2NPT A;  4YSZ B;  3SFD B;  5C3J B;  3A9J B;  3GZN B;  5H92 C;  4W9J A;  1XCQ L;  3DBR I;  1UEL A;  1UF0 A;  1WYG A;  4BZA A;  1V80 A;  2BQQ A;  2IBI B;  1NI3 A;  1HTO A;  1TY0 A;  1XO3 A;  3U2S C;  1YN3 A;  2LVQ A;  3B9J A;  1C77 A;  2DEN B;  3CWI A;  2GBM A;  2KTF A;  1IBX B;  3BVG A;  3RNE C;  3IFW B;  2ZJD A;  5HKH A;  1YQB A;  1V5T A;  4P16 A;  3Q2A C;  3W9C B;  4QAY A;  1UGJ A;  3HIZ A;  3ZTC A;  5LLI A;  2G1E A;  1JWA D;  2KLC A;  1D5Z C;  1C4P A;  3PLV A;  1L0Y B;  2WXG A;  2BBC A;  1FM0 D;  3EFC A;  2WNM A;  1E7U A;  2C7H A;  1I4X A;  1N6Z A;  3GZN I;  1ZGU B;  2V3S A;  1A70 A;  1FNV A;  3H7P A;  2MJE A;  2Z0E B;  3A1Q A;  2LGD A;  4ANX A;  4BAX A;  3ZVV A;  2L8J A;  3RFZ B;  3C0R B;  2W3S A;  3NOB A;  4C80 A;  2RDH A;  4XC2 A;  3VTU A;  2GRI A;  4RGO S;  1WJU A;  2W9N A;  5BMH A;  3RNB C;  3AMZ A;  2QSD A;  4IKG A;  5J17 A;  1T0Q C;  2Y3A A;  1JWB D;  5D3I B;  3AM9 A;  1NDD A;  2NBV B;  1LXD A;  1L0V B;  3K9O B;  1E7P B;  3RNC C;  4K7W A;  4LNK A;  3R7Q A;  1M94 A;  3NVV A;  2KJ6 A;  2K6Q A;  5JXV A;  2MJD A;  1P9D U;  2REX A;  2DYB A;  2ASQ A;  1SB3 C;  4AQ7 A;  3TEX A;  4ZOH C;  3RZF A;  2WDR B;  1ISN A;  3KLS X;  2J0M A;  3KW5 B;  1EF1 A;  1V9J A;  1WM3 A;  2PPH A;  2HJ8 A;  1V6E A;  2TSS A;  2OOB B;  4BVU C;  4ZDV A;  2Q5W D;  5IA7 A;  3C8Y A;  2AX5 A;  2AEH A;  4OW0 A;  4DDI D;  3AE1 B;  3Q3N C;  1GJZ A;  2Y5P A;  4NY0 A;  2BVC A;  1XLN A;  5D94 A;  4IDI A;  2YEP F;  1TZO A;  3QWZ B;  3ZIM A;  1ZUD 2;  4BBN F;  1QOB A;  1K53 A;  1SJE D;  4FLH A;  4OZC A;  3ZRF A;  1MHX A;  3T8M A;  1AW7 A;  2WXF A;  4HVB A;  1EF5 A;  1LQB A;  3A9K B; 
#chains in the Genus database with same CATH homology
 3AU5 A;  3B08 A;  2WX0 A;  3Q3J A;  5D7G A;  1RRB A;  2BWE S;  3APF A;  3ML9 A;  3VH3 B;  1TTN A;  2KC2 A;  3ZDM C;  2CHX A;  3A33 B;  3N3K B;  1I42 A;  4GDK B;  3LJ3 A;  4I6P A;  2J7Q B;  2FAZ A;  3ECI A;  2K8C A;  2JF5 A;  4BKS D;  3ML8 A;  1TZ1 A;  2FCN A;  2G4S A;  3DBH I;  2UWQ A;  3AUL A;  2RR9 A;  2D2Q A;  4AJW A;  2KXJ A;  1LM8 B;  2XK5 A;  3EFU A;  5KHO A;  4KDI C;  4NPN A;  3UIO B;  5L95 C;  3JW0 X;  4DWF A;  4GMV A;  2RD0 A;  2N1W A;  3JYU A;  3S2A A;  4TQ0 A;  1YJ1 A;  1E90 A;  3HK0 A;  1V5O A;  2FCS A;  3PLU A;  1Y8R C;  1U4A A;  1L7Y A;  2KAN A;  2KKC A;  1P0R A;  3ALB A;  2MSE D;  2ZCC A;  4G0N B;  4PYZ A;  4DDG D;  4CO7 A;  3GOE A;  1WYW B;  4W9E A;  2IY1 B;  2KQS A;  2KMC A;  2KVR A;  4W9L A;  3L54 A;  4FJZ A;  2MLB A;  2FNJ B;  1R4N I;  1P3Q U;  3DQV A;  2BYE A;  2C60 A;  3RUI B;  3WAP A;  1WMH B;  2LGX A;  2JZZ A;  3IVF A;  3SHQ A;  4HPM B;  2LI5 A;  2KHW B;  3UGB B;  1E8Y A;  1WXS A;  4EKU A;  2JUO A;  3QJZ A;  3UQA A;  3RZW C;  1E8W A;  1SE9 A;  2M4N A;  2R2Q A;  2IO3 B;  2MBQ A;  2JXX A;  2RPQ A;  2ZZP B;  3W1S A;  4A3O A;  1ZKH A;  4AP4 C;  5J18 A;  2DYM A;  3A9K A;  3X23 A;  4BFR A;  4OVV A;  4DK5 A;  2LRU A;  4FAD A;  1GUA B;  5DPS A;  2MBO A;  4EUT A;  5JH5 C;  2KO3 A;  4MM3 A;  3VTV A;  1NBF C;  1YIW A;  4GDK A;  2MRP A;  1RLF A;  1YX5 B;  2IO0 B;  2KMA A;  2YVC A;  2JRH A;  1E7V A;  5E6P A;  3OJ3 A;  2IYD B;  3TCA A;  2M0X A;  5DPW A;  5IAA C;  2NPT B;  3IBE A;  3TJP A;  5LXI B;  2V4L A;  2R2O A;  3R66 C;  4JGH B;  3HM3 A;  1BT0 A;  4ICV A;  4RMA A;  4FHK A;  2HD5 B;  2BYF A;  5C23 A;  3HHM A;  1RAX A;  1KJT A;  2AL3 A;  1A5R A;  3HM6 X;  5AZG A;  4IW0 A;  2KOX A;  3NHE B;  2HE7 A;  2HTH A;  4GOC A;  2EKE C;  4JIO U;  2WWZ A;  4WJO A;  3U30 A;  1WGY A;  2I1K A;  3VH4 B;  4AWJ A;  4EZK A;  1ZW7 A;  4GXB A;  2LXA A;  4IUM B;  3RCZ A;  1I35 A;  4KDL B;  4KIK B;  4EZL A;  5LXH A;  4DHZ E;  3RUL A;  1KLV A;  1WR6 E;  4YL8 A;  1SIF A;  1WMH A;  4NQL B;  3QA8 A;  2C7N B;  2KX3 A;  3KUD B;  3SDL C;  2CHZ A;  4EEW A;  2RSU A;  2KK8 A;  2MX2 A;  3APC A;  3NY5 A;  4G50 A;  3PRE A;  4HDQ A;  5E6N A;  3VUX A;  1H4R A;  3R7R A;  3N32 A;  2KC1 A;  1Z5S B;  3X0W A;  1G6J A;  4TQ1 A;  1UBQ A;  4IM0 A;  5TR5 A;  2KDB A;  3ZLZ A;  5BO4 B;  2LGY A;  2RGF A;  2AYO B;  2GBK A;  3ZKJ C;  2N7D A;  1OEY A;  1J8C A;  2FIF A;  2IY0 B;  2MWS B;  3OJ4 B;  4XZ4 A;  2LVP A;  5DPR A;  1VD2 A;  1WJ6 A;  1KM7 A;  3AXC A;  2L0T A;  5D6J B;  3UF8 A;  2KFK B;  3VDZ A;  2B3A A;  4FHJ A;  4MGK E;  4RM9 A;  1C1Y B;  3PSE B;  1NI2 A;  1SGH A;  4K1R B;  4ANV A;  3ZW3 A;  3M63 B;  5J2R A;  1WM2 A;  2J0K A;  3RYT A;  1WGG A;  3PVL A;  3CMM B;  3EEC A;  4KSK C;  3QAR A;  4BKS A;  3TMP B;  4GB9 A;  3M62 B;  2A4Z A;  2PE9 A;  1QZE A;  2DZM A;  5C1Z A;  2K39 A;  2KN5 A;  3WIM A;  3T9L A;  4F8C B;  2EMT A;  3VHT C;  4ZRI A;  4PS3 A;  2CU1 A;  3D32 A;  3NS8 A;  4HK2 A;  3KUC B;  3RD2 A;  2LD9 A;  3NZU A;  4FUL A;  4IWP A;  4PYU A;  1EUV B;  3ONS A;  1WR1 A;  3IG3 A;  4AJY B;  4IM2 A;  1UH6 A;  1IPG A;  3P2B A;  4FN2 A;  2GOW A;  4KIK A;  2MQJ A;  5CX3 A;  4GSW A;  1EO6 A;  5CHW A;  1OGW A;  4P7I A;  1XT9 B;  2KWC A;  4GGQ A;  5JZE B;  2DAF A;  3V61 A;  1WZ3 A;  2J0J A;  3U8Z A;  1OTR B;  5D2M B;  1WX7 A;  2LVO A;  4KSL C;  4F1S A;  1IYF A;  2JPH A;  2GMI C;  4W9D A;  4DXA B;  2MA9 B;  3ZDT A;  1MG8 A;  4WWO A;  3TL5 A;  1WX8 A;  2NVU I;  3A4R A;  1UGM A;  2BPS A;  4ZRK A;  2XBB C;  1J0G A;  4HPL B;  5AEK B;  3VAW A;  4KZC A;  1WF9 A;  3CF6 E;  2NCN A;  4W9F A;  4WWP A;  4WAA A;  1JRU A;  1L2N A;  2MBE A;  4EOY A;  3B0A A;  4KV2 A;  2DAJ A;  2KX0 A;  1WJN A;  1WXV A;  2KLG A;  4BOS C;  3RT3 B;  1HE8 A;  1XD3 B;  3H6N A;  4IM3 A;  4E74 A;  4TV3 A;  1Q5W B;  2KTR B;  2JT4 B;  4LDT B;  3VFK A;  1Q1O A;  1WH3 A;  2XEW A;  1R4M I;  1K8R B;  1OQY A;  4MGZ E;  4DHZ B;  4BKT A;  2L0F A;  4BBN C;  4HDO A;  1WY8 A;  1OEY J;  2K8B A;  2JWZ A;  4LJO B;  2KJH B;  2DZI A;  3PZD A;  3DBS A;  3EC8 A;  2VRR B;  3V6E B;  3V60 A;  3JVZ X;  3W1Y A;  4W9H A;  4NJ6 A;  2K6D B;  5AZH A;  4MSM B;  3PS6 A;  2KZR A;  3H7S A;  1UD7 A;  2GBJ A;  3WAO A;  4FA6 A;  2EMS A;  3DBL I;  1WXM A;  2PEA A;  3MHS D;  2BKR B;  2MBH A;  1YD8 U;  2WYQ A;  1V86 A;  1TBE A;  2Z0D B;  1X1M A;  2MP2 B;  4PS7 A;  3ZRC A;  3DVN U;  4TUU A;  3K9P B;  4XX5 A;  3PHW B;  3ZTD A;  1T0Y A;  2OJR A;  3PV1 A;  4GDL B;  3U7D A;  4X57 B;  4E71 A;  2DHZ A;  4MJS B;  5G55 A;  2K8H A;  2L05 A;  4JLC A;  3KUZ A;  3QQ8 B;  2WDT B;  3PGE A;  2Y5B B;  1S3S G;  3BIN A;  4G11 A;  2FID A;  3M95 A;  1RFA A;  3UQB A;  2ZPN A;  1WIA A;  3DDC B;  4I6N B;  5FR6 A;  3PRP B;  4HCN B;  4NQK E;  1S1Q B;  2LRW A;  2N9X A;  4URK A;  5JHA A;  4JL9 A;  4DHJ D;  4ANU A;  2M8S A;  5CTR C;  4NAW B;  3M3J A;  2DZJ A;  2ZNV B;  3L13 A;  2LXC A;  4ASW C;  4W9C A;  5JHB A;  2FCM A;  1WGR A;  2G3Q B;  1E8Z A;  1WRD B;  2WX1 A;  4DBG A;  2A5U A;  1V49 A;  2O6V D;  2BYV E;  2G4D B;  3QIJ A;  3DVG X;  2CS4 A;  3CSF A;  3LDZ E;  2BF8 B;  3OAW A;  4LDT D;  1GG3 A;  2I1J A;  3ZNZ B;  3ZNG C;  3QC8 B;  2KTR A;  3H1U A;  3VQI A;  2KQ7 A;  2N7E A;  5KHQ A;  1WI0 A;  1LFD A;  1AAR A;  2JZ3 B;  4WWN A;  2GBR A;  3PTF C;  3NZS A;  4MSQ B;  2N4F A;  2KJR A;  3BY4 B;  2ZVO A;  3VVW B;  1IP9 A;  3QK0 A;  4AOF A;  2NS5 A;  2D11 A;  2Z59 B;  3V62 A;  4HLE A;  2YLM A;  1Q0W B;  1J19 A;  1WFY A;  2BWF A;  4MGI E;  3PPA A;  3R3M A;  2L3Z A;  3O65 B;  4MEL A;  3VUW A;  4F7Z A;  1WZ0 A;  2NPT A;  3QHT A;  3H7P B;  4J6I A;  2LUE A;  4W9G A;  4B95 A;  3A1Q B;  1V2Y A;  2MP2 A;  3MTN B;  3A9J B;  4W9K A;  3TBL D;  3TIX A;  1F9J A;  1C3T A;  2KDI A;  3SU8 X;  4W9J A;  4BKG A;  3DBR I;  3VTW A;  1PQS A;  1UEL A;  3QX1 A;  4FJV B;  5E6O A;  4II3 B;  2NBW B;  4IC7 B;  1V80 A;  2ZVN A;  5L83 A;  4RM8 A;  4EFO A;  1Z2M A;  3V6C B;  2IBI B;  1WE6 A;  2FUH B;  1YX6 B;  4OVU A;  1GC6 A;  2LVQ A;  4K7S A;  3QCA A;  4FJY A;  4EZJ A;  5AZF A;  4HCP B;  4NAW A;  4K7U A;  2M1M A;  2DEN B;  2N1V A;  2GBM A;  2KTF A;  2LZ6 A;  4N9F 4;  4II2 B;  3IFW B;  3JSV B;  3B1L X;  4JQW C;  1FXT B;  2AWT A;  2ZJD A;  3OLM D;  4B6W A;  1YQB A;  1V5T A;  4MGY E;  4NNJ B;  4HVB A;  2KD0 A;  5HKH A;  2N9P C;  2L76 A;  3L08 A;  3WAN A;  2IO1 B;  4CHK A;  4DHJ B;  3WAL A;  3CST A;  3HIZ A;  3APD A;  2BKF A;  3ZTC A;  5LLI A;  2KLC A;  4I6L B;  2QHO A;  3VUY A;  3PLV A;  4GIV A;  2LAS A;  2L00 B;  3ZNH B;  1WXA A;  2O6V B;  5DPT A;  4GN1 A;  2KFK A;  4M8M A;  3I3T B;  1P98 A;  1E7U A;  2C5L C;  2C7H A;  2K1F A;  4G3X B;  2MW5 A;  2K25 A;  3GZN I;  1ZGU B;  3DPD A;  2V3S A;  4K81 A;  4M8N A;  2DX5 B;  2DYO A;  4HXD A;  1WE7 A;  2O2V B;  3H7P A;  2AL6 A;  3PT2 B;  2Z0E B;  3A1Q A;  2LGD A;  4ANX A;  4KVG B;  3A9J A;  3UIP B;  3AU4 A;  4LJP B;  3ZVV A;  1KOT A;  2L8J A;  2CKH B;  2GBN A;  3KVF B;  3C0R B;  3NOB A;  2KWU B;  3KH0 A;  2M17 A;  4HWI B;  3ENE A;  4ICU A;  4XC2 A;  3VTU A;  4MDK E;  1WJU A;  3L17 A;  4PS8 A;  4MEM A;  1E5W A;  2V1Y A;  2W9N A;  3PRM B;  3PRZ A;  4IG7 B;  1UBI A;  4GU2 A;  2MBB B;  1WGD A;  5J17 A;  2KDF B;  4HJK A;  3KYC D;  4IWO A;  1NDD A;  5GMV A;  3QAQ A;  2CR5 A;  2NBV B;  2D10 A;  2D07 B;  3ZUN A;  1LXD A;  4WJP A;  3K9O B;  2FCQ A;  4K7W A;  1H8C A;  1V81 A;  2G45 B;  2KNB A;  4A3P A;  3R7Q A;  4A20 A;  1M94 A;  3L0W B;  2LWP A;  3SD5 A;  1VCB A;  3JSV A;  2KJ6 A;  4AUQ C;  3MJW A;  2K6Q A;  1D3Z A;  3ZNI D;  2JVC A;  2C7M B;  3AI5 A;  2ZPY A;  1P9D U;  4WQO B;  2REX A;  2DYB A;  4M0W B;  2ASQ A;  5DCN A;  1P1A A;  3RZF A;  1ISN A;  2ZNV C;  2MCN B;  2J0M A;  3KW5 B;  1EF1 A;  1WJ4 A;  1V9J A;  3DCG A;  3Q3F A;  5EDS A;  5CHF A;  1WM3 A;  5G2N A;  2O6V A;  2LJ5 A;  2PPH A;  2HJ8 A;  1GNU A;  1V6E A;  2XK5 B;  2OOB B;  3DOW A;  4IWQ A;  3IHP C;  2IZV B;  1WX9 A;  3EHV A;  4BVU C;  4ZDV A;  3L10 B;  4B9K A;  2PE6 B;  1GC7 A;  4WJQ A;  2IO2 B;  4NJ7 A;  5IA7 A;  2O2V A;  4MH0 E;  2KWV B;  4ZYN A;  3KYD D;  2AEH A;  3WAM A;  4DDI D;  3VXW A;  2JY6 A;  1GJZ A;  4TKN A;  4WJN A;  4ANW A;  3UIN B;  3L16 A;  2NR2 A;  3DVG Y;  4NY0 A;  5CHV C;  3DVN V;  4W9I A;  2N9E B;  4LCD E;  3H9D A;  4BOZ B;  4KZ0 A;  2BGF A;  5D94 A;  1TGZ B;  2C9W B;  2PJH A;  2KFJ A;  4E3C A;  3N30 A;  3PHX B;  2DZK A;  1E8X A;  1UZX B;  3QWZ B;  4FBJ B;  3ZIM A;  3A4S C;  2CHW A;  4BBN F;  2NBU A;  1CMX B;  4GDL A;  1XQQ A;  4MJS A;  4FLH A;  2L7R A;  3WA0 A;  2ZEQ A;  3ZO5 B;  3ZRF A;  2ZCB A;  3T8M A;  1WGH A;  2KDE B;  4ZRJ A;  1EF5 A;  4CYE A;  1LQB A;  3A9K B;  2D3G A;  2UYZ B;  2JRI B;  3W1S C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...