4GDLA

Crystal structure of human atg12~atg5 conjugate in complex with an n-terminal fragment of atg16l1
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
88
structure length
88
Chain Sequence
KKIDILLKAVGDTPIMKTKKWAVERTRTIQGLIDFIKKFLKLVASEQLFIYVNQSFAPSPDQEVGTLYECFGSDGKLVLHYCKSQAWG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin-like protein ATG12
publication title Structure of the human ATG12~ATG5 conjugate required for LC3 lipidation in autophagy.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 18
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2012-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04110 APG12 Ubiquitin-like autophagy protein Apg12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4gdlA00
4II3B 3APDA 3MHSD 5J2RA 2HJ8A 4AWJA 2KFJA 4WJNA 3VFKA 2C7NB 2JVCA 2ZNVC 1WJ4A 2CR5A 3DBRI 4AJYB 3QCAA 3VXWA 3EECA 4LDTB 1UBQA 2K8CA 1XT9B 2MP2B 3KH0A 4NQLB 1MG8A 5JH5C 2QHOA 2IY0B 2KD0A 1BT0A 4M8MA 4RMAA 3R7QA 4HJKA 1WXMA 5JHAA 4GOCA 5IA7A 2L0TA 4GB9A 2KZRA 4N9F4 4ANVA 4CO7A 2KLGA 5LXIB 3PZDA 5AEKB 3VUYA 3OJ3A 1ISNA 3DQVA 1WM3A 2G4SA 4EOYA 3GZNI 1RRBA 4JLCA 2LXCA 4ZDVA 5IAAC 2JPHA 3V62A 2ZZPB 2KDEB 3QIJA 3EHVA 3WAMA 3ZDMC 2DYOA 2J0JA 4HPLB 3ZIMA 4AUQC 3PREA 3SD5A 2KDBA 4BKGA 2LVOA 1LM8B 3H7PA 3ZNID 3S2AA 3IHPC 3N32A 2MX2A 2L00B 2C60A 4W9IA 3WIMA 2LWPA 4BKSA 4W9HA 1GUAB 2DZKA 2K8HA 3DBLI 4YL8A 4ZRKA 3T9LA 3WANA 4IWQA 3PTFC 3C0RB 2GMIC 2EMTA 4GN1A 2RR9A 2NS5A 2IO2B 2KDIA 2ZEQA 1YD8U 5AZHA 5C1ZA 4PS7A 3K9PB 3IFWB 4FHJA 2L3ZA 3RT3B 2V1YA 4W9DA 1GC7A 3N3KB 2WX0A 1T0YA 3PRPB 2IO1B 2L76A 2HD5B 1YIWA 3KW5B 1Q5WB 1E8YA 4HDOA 1C3TA 4IWOA 1ZW7A 2KOXA 1UGMA 4NJ7A 2DX5B 4TV3A 4M8NA 2M17A 3M95A 3T8MA 4IG7B 5CHVC 4ICVA 5CHWA 2KMAA 2BPSA 3P2BA 4KDIC 3RUIB 3KYCD 4W9CA 4A3OA 1WF9A 2UYZB 3DVGY 1A5RA 2RSUA 3CSFA 4PYZA 3UINB 3W1SC 3L54A 3L0WB 3W1YA 3AXCA 1EF5A 2K25A 3A33B 4TKNA 2MBBB 4K7WA 4JGHB 2Z0EB 3L17A 5L95C 3ZW3A 4ANUA 3QK0A 2EKEC 3Q3JA 1E7UA 4FJZA 3NOBA 4EFOA 2ZJDA 4LDTD 3AU5A 4ANWA 4A3PA 1WXSA 2LVPA 3PRMB 1WM2A 3H7PB 3A9KA 3H7SA 3UIOB 3TJPA 1I35A 1PQSA 2FCSA 1OGWA 1TTNA 2LD9A 4IWPA 2JZ3B 1WX9A 3JYUA 1WRDB 2JXXA 2O6VD 5L83A 5LXHA 4TQ0A 2FCNA 4HK2A 1WGGA 2FIDA 2VRRB 4MEMA 5JHBA 5BO4B 1LXDA 4G50A 4TQ1A 4OVVA 2KVRA 2JZZA 2KNBA 4FLHA 2O6VA 1D3ZA 3GOEA 4IM2A 4LJOB 3VQIA 2M8SA 1WJUA 1WX7A 2AL6A 5AZFA 4HCNB 2N9XA 3QARA 5G55A 3BINA 1R4MI 2DZJA 4W9KA 2DHZA 3VH4B 1ZKHA 3TIXA 2G3QB 1WR6E 2N7EA 3A9JB 4FHKA 3ZTDA 5D6JB 3ZUNA 2N9EB 4II2B 5D7GA 2WDTB 2K8BA 2PJHA 2CHZA 3SHQA 4ZRJA 2KJHB 4HPMB 2Z59B 1G6JA 2KN5A 2K6DB 3PRZA 4I6LB 1SIFA 1X1MA 4K7SA 1Q0WB 1WE6A 2OOBB 1H8CA 1E8WA 4WQOB 3ENEA 2BYVE 2ZVOA 4G11A 2ZCCA 2I1KA 3A9KB 1GNUA 3VH3B 3QAQA 2C5LC 4W9GA 3M62B 3AU4A 2Y5BB 3R3MA 1F9JA 2K1FA 4B6WA 3ZLZA 4GDKA 4KZCA 1WH3A 5CTRC 3QHTA 5E6PA 3LJ3A 4NQKE 4FJYA 2KK8A 4K1RB 3NS8A 2JY6A 1V86A 2C7HA 5DPSA 4PS8A 1TBEA 4XC2A 4CYEA 2PPHA 2RD0A 5E6NA 5JZEB 1EUVB 1WI0A 4JIOU 4F1SA 3HK0A 2O6VB 3ZKJC 3M3JA 1WIAA 2DZMA 5DCNA 2MW5A 2D11A 2KQ7A 3QC8B 2FCMA 3JW0X 4KZ0A 4TUUA 3RZWC 1KJTA 2A5UA 3ZNGC 3O65B 4FULA 4F8CB 3UQAA 3UQBA 2LGDA 1XD3B 3L16A 4MGYE 3A1QA 2MCNB 1M94A 2Z0DB 4EZJA 2AWTA 2DZIA 1J8CA 3X0WA 1XQQA 4LJPB 1WMHA 2LJ5A 4AOFA 1P9DU 3DVNU 1V80A 3ALBA 3DOWA 2AYOB 3ONSA 4BKSD 3NHEB 3RZFA 3UF8A 2GBNA 3VTVA 2MBHA 2L8JA 4IM3A 2G45B 1TZ1A 4DK5A 1WYWB 1CMXB 1P0RA 3QA8A 2LXAA 1WXAA 4BFRA 2R2OA 3CF6E 4HLEA 2NBVB 4GDKB 4MM3A 3TCAA 2NBWB 1U4AA 4BOZB 3SDLC 3V60A 3VDZA 3VUXA 2PE9A 2BF8B 1OTRB 3L08A 2N9PC 3NZUA 1Q1OA 1NDDA 5TR5A 2KWUB 1WGRA 2WYQA 4JL9A 1KLVA 2D3GA 4B95A 3DCGA 2J0MA 3M63B 2FUHB 4WAAA 2CS4A 2KFKA 3TL5A 4FBJB 4NPNA 2MBOA 2ZVNA 2XK5A 2NBUA 3A9JA 2N4FA 3IG3A 2KXJA 4ZRIA 3A1QB 2BYFA 2KTRB 2CHXA 3APCA 1R4NI 1KOTA 2WWZA 2YVCA 2MSED 3AULA 4FA6A 3ZRCA 1WMHB 4W9EA 1L2NA 2G4DB 4HWIB 3VTUA 4KIKB 1V49A 4GGQA 3QQ8B 1WR1A 3BY4B 4GSWA 3TBLD 3SU8X 2LZ6A 4GU2A 3ZRFA 4RM9A 2FAZA 5EDSA 3A4RA 4EUTA 1E8ZA 2LASA 2KJRA 2O2VB 3K9OB 3PPAA 2RGFA 4WJQA 2IBIB 1YQBA 2M0XA 4ICUA 1WE7A 4NAWB 2NCNA 2LUEA 2XEWA 1IYFA 4PYUA 3PV1A 4IC7B 3RD2A 3V6CB 2N7DA 4J6IA 3PT2B 1JRUA 2J0KA 3AI5A 3PGEA 4AP4C 2I1JA 4IM0A 2KTFA 2BGFA 1YX5B 1OEYJ 2LVQA 2LRUA 2IYDB 3B1LX 3JSVA 2K6QA 2KFKB 3CSTA 2KDFB 3DVNV 1OQYA 2XK5B 4G3XB 4URKA 1IP9A 1V2YA 3PHWB 4DHZB 4KSKC 1P1AA 4DBGA 3EC8A 1SE9A 2KHWB 2IO3B 4PS3A 3KYDD 4WWPA 2JUOA 3QX1A 4HXDA 4MDKE 3B08A 1V6EA 5G2NA 4F7ZA 2K39A 4XX5A 2ZCBA 4KVGB 4DDID 2MRPA 4WJPA 4WWOA 2MBQA 3ZNZB 5J17A 2JWZA 1WY8A 4EKUA 3VVWB 3PLUA 4X57B 3UIPB 5KHOA 2BKRB 4DDGD 4XZ4A 2NVUI 2GBKA 3VUWA 4DXAB 1GG3A 2CKHB 2FIFA 2KANA 3RCZA 3DDCB 2AL3A 3L10B 1VD2A 2NR2A 3DBHI 1WJ6A 2ASQA 1VCBA 3OJ4B 4MJSA 1ZGUB 4BBNC 3VTWA 1IPGA 2NPTB 1LQBA 1RLFA 2DENB 1E8XA 4WWNA 3I3TB 1GC6A 1V5TA 1UD7A 2L7RA 3U8ZA 3JSVB 4CHKA 3PVLA 1UELA 1YX6B 4E3CA 2KTRA 5D2MB 2BYEA 3PHXB 3VAWA 3HM6X 3WAOA 5E6OA 2HE7A 5LLIA 2KLCA 2MWSB 3U7DA 5KHQA 1LFDA 1WFYA 4MGIE 4MSQB 4A20A 2LRWA 2GOWA 1C1YB 4ANXA 1I42A 3IBEA 4KIKA 2M4NA 1OEYA 4B9KA 2KWVB 3A4SC 2WX1A 3RYTA 4HCPB 4G0NB 2PEAA 2KX3A 3D32A 3IVFA 1SGHA 3RULA 2OJRA 2O2VA 1S1QB 3V61A 2CHWA 3QJZA 2DYBA 4GIVA 4NAWA 2BWES 3Q3FA 1KM7A 4KSLC 1EF1A 1V9JA 4W9JA 1H4RA 5GMVA 2L05A 1WGHA 4FN2A 1J19A 3KVFB 3VHTC 4E74A 3EFUA 2LI5A 1UBIA 4MJSB 4DHZE 4MSMB 1P98A 3H6NA 5FR6A 1RAXA 5AZGA 3ML8A 2C9WB 4GDLA 2GBJA 4DHJB 3HIZA 2RPQA 4BOSC 1AARA 1V5OA 2GBMA 2MBEA 4KV2A 2KKCA 2PE6B 3WALA 3U30A 1K8RB 2MLBA 1UH6A 2JRHA 1J0GA 2DAJA 1Y8RC 1FXTB 4K7UA 2IY1B 4AJWA 2IZVB 1S3SG 1WJNA 3L13A 4WJOA 1GJZA 3R7RA 2KMCA 2KQSA 1WZ3A 4K81A 3ML9A 5DPRA 4BVUC 2JF5A 4RM8A 1E7VA 3TMPB 4ZYNA 3NZSA 3DVGX 2V4LA 4GXBA 2KX0A 2MQJA 4LCDE 4NJ6A 2BKFA 3CMMB 4DWFA 1E90A 4GMVA 1WXVA 1Z2MA 2KO3A 3H1UA 2ZPYA 3B0AA 1NBFC 4JQWC 4W9LA 1HE8A 2HTHA 3ZVVA 5C23A 3ZDTA 2D2QA 2MA9B 2W9NA 2CU1A 4MELA 3KUZA 2LGXA 3PSEB 4MGZE 2JRIB 3DPDA 2N1VA 3KUDB 4MGKE 1WGDA 1V81A 2REXA 4MH0E 3ZNHB 1Z5SB 1L7YA 2A4ZA 1WZ0A 3MTNB 4KDLB 4NY0A 3KUCB 3WAPA 3ECIA 4IUMB 1UZXB 1YJ1A 2IO0B 3APFA 3R66C 5DPTA 2KC2A 2NPTA 3HM3A 4M0WB 2DYMA 5CHFA 1QZEA 2YLMA 4P7IA 2R2QA 2C7MB 2EMSA 2KJ6A 1NI2A 4OVUA 2B3AA 2ZNVB 4GDLB 3JVZX 4BKTA 2V3SA 2MP2A 3OAWA 5HKHA 4BBNF 3UGBB 3V6EB 4EZKA 2UWQA 3ZO5B 2LGYA 5J18A 3PLVA 2ZPNA 4ASWC 3DBSA 1TGZB 4I6PA 2KC1A 4I6NB 2XBBC 2BWFA 1P3QU 3X23A 3H9DA 4FJVB 3MJWA 2M1MA 4EEWA 2D10A 3HHMA 4HDQA 2FCQA 4W9FA 3QWZB 2KWCA 5DPWA 4HVBA 3NY5A 2DAFA 4IW0A 3OLMD 2D07B 1E5WA 2FNJB 3WA0A 1EO6A 2GBRA 1RFAA 5CX3A 3W1SA 2JT4B 2J7QB 1WX8A 3N30A 4EZLA 4FADA 2L0FA 4E71A 1WGYA 4DHJD 5D94A 2N1WA 3ZTCA 3LDZE 2AEHA 4NNJB 3PS6A
chains in the Genus database with same CATH superfamily
5J2RA 2D3BA 1N6ZA 3N9YC 2KFJA 1WJ4A 3QCAA 2KACA 1UBQA 2K8CA 1OQQA 2MP2B 4NQLB 1L5PA 2LHDA 2QHOA 1J7AA 5TSSA 4ZHOA 4M8MA 3BK1A 2UU7A 4RMAA 2D5GA 3AEDB 2WXKA 4GOCA 4GB9A 4N9F4 4CO7A 2PW9A 3BIID 5LXIB 1UUPA 3PZDA 3VUYA 3OJ3A 4A6QA 1ISNA 1SB3C 2KWDA 3AEFB 1N5XA 1FXAA 4P16A 2OEDA 4AUQC 2JYTA 2LVOA 3H7PA 3ZNID 2EELA 4WURA 4GLSC 3N32A 2MX2A 2LWPA 4BKSA 4YL8A 3URYA 4IWQA 3C0RB 2EMTA 2NS5A 2KDIA 2ZEQA 1YD8U 3AE2B 3K9PB 5JXVA 3RT3B 2V1YA 1Q5WB 1SE2A 2KOXA 3Q6BA 4RFBA 2DX5B 2M17A 1XLNA 4ZYSA 3NZ3A 1WF9A 2UYZB 4JE3B 3W1SC 3DBLB 1Q10A 4KGRA 2K25A 5T8IA 1GB1A 1QQRA 4FJZA 3NOBA 1WXSA 1FNVA 1WM2A 3H7PB 3N1XC 2EKIA 2B76B 1WX9A 3RNCC 2O6VD 4TQ0A 4MEMA 1KFYB 4TQ1A 1JCKB 4LK0M 1DYQA 5EE0A 2KN4A 2M8SA 5AZFA 3V05A 1HXYD 2N9XA 3QARA 4HCNB 2PKOA 1R4MI 3W2DA 3A9JB 1FNUA 1TIFA 5BYSA 2N9EB 2WDTB 2PJHA 3GE3C 2KJHB 1N62A 2KN5A 4I6LB 2FUG1 2K5PA 4G11A 3TUOA 4YT0B 3VH3B 4P6VF 2C5LC 3M62B 2WXFA 1FRDA 4B6WA 1IGCA 5E6PA 4KGSA 1BUIC 5DPSA 4CYEA 1F2RC 3IT6B 5JZEB 2DZMA 1HZ5A 2AQ3B 2FCMA 3JW0X 1KJTA 3ZNGC 3L16A 4MGYE 1XXGA 1M94A 4R3DA 1XCQL 3HUIA 3GB1A 4RGTA 1WMHA 1VLBA 4OW0A 1V80A 1T3QA 4BKSD 4XWTA 2G1EA 2G45B 2WXOA 3SFEB 4DK5A 2WQYB 3AEAB 5G5GA 2BYTA 3QA8A 1D5MC 4BFRA 2R2OA 4XGAB 4US9A 3TCAA 1U4AA 2PE9A 4MACA 5IN7A 1QOGA 2WDVB 1NDDA 2KWUB 3ZQ4A 4JL9A 2D3GA 4B95A 4WAFA 1NYQA 2YEPF 2N4FA 1BMLC 4J3OD 2BYFA 1SJHD 2WWZA 2YVCA 3AULA 1I7HA 2INPE 3ZRCA 1WMHB 1V49A 3TSSA 3WCQA 3ZRFA 2LZ6A 4RM9A 1JALA 3N1YC 2QC8A 3TEXA 1V1PA 1XLQA 3A4RA 1E8ZA 4EUTA 3PZ7A 2LASA 3PPAA 4ICUA 2PTLA 2LUEA 2XEWA 4PYUA 4C00A 3PV1A 4IC7B 1B9RA 3AI5A 3PGEA 2LEKA 2LVQA 2BB6A 3JSVA 3CSTA 2KDFB 4KKIA 2V3NA 1ZOYB 5I4DA 4DHZB 5IO9A 1SE9A 4PS3A 1JMLA 4WWPA 3B08A 4KVGB 2MRPA 4WWOA 3ZNZB 2AQ2B 4EKUA 3UIPB 1V1PB 5KHOA 3BWUD 4XZ4A 2GBKA 1GG3A 2KANA 2AL3A 1PDXA 1C4PA 2INNE 4LTUA 4BBNC 1IPGA 1LQBA 2IGGA 2N0SB 1JW9D 3JSVB 5G5HA 1YX6B 3V3XA 2BYEA 3PHXB 3VAWA 5E6OA 2HE7A 5KHQA 4C4VB 1WFYA 5EE1A 1C1YB 1OEYA 3A4SC 3T3OA 2QMTA 2WX1A 4HKQA 1JWBD 1S1QB 3V61A 4GIVA 2BWES 1KM7A 1KLGD 3VR8B 1GB4A 1N60A 1V9JA 1H4RA 5GMVA 1AN8A 1EM7A 3MC9A 1WSPA 1WGHA 4FN2A 1WRIA 5BMGA 3KVFB 3VHTC 4E74A 3EFUA 3H6NA 5AZGA 2C9WB 4YTPB 3EA6A 2JSVX 1AARA 2MBEA 4KV2A 3WALA 2H89B 3U30A 3DWMA 1K8RB 4K7UA 4WH4A 2IZVB 1C77A 4C7YA 4WJOA 3ML9A 3NG0A 2JF5A 3TMPB 1E7VA 5EE3A 1C4AA 2V4LA 1HEZE 4LCDE 1SEBD 4GMVA 1YQ4B 1NBFC 2IGDA 4W9LA 1HE8A 3ZDTA 1EU3A 5C2TB 2LGXA 4MGZE 1PGXA 2JRIB 4ZRQA 3KUDB 4MGKE 2REXA 4MH0E 3ZNHB 2WS3B 2A4ZA 2WP9B 4KDLB 1L4DB 4NY0A 3ECIA 1ZPSA 2AX5A 3HM3A 2DYMA 2YLMA 2R2QA 2EMSA 2KJ6A 3R2TA 1VZ6A 2KMMA 4BBNF 3V6EB 2UWQA 1V8CA 3DHIC 2RDGA 2ZPNA 4UDUC 3DBSA 2KC1A 3R2IA 4D2KA 1NI3A 4QAYA 3X23A 3H9DA 4FJVB 4S0RA 4US8A 3T3NA 1YJIA 2MJDA 2KWCA 2RPVA 3GE8C 2DAFA 4IW0A 2D07B 1E5WA 3WA0A 1RFAA 2JT4B 2J7QB 3VRBB 3U52E 5D94A 3RNFC 3ZTCA 2L32A 2ZNVC 3PS6A 4JWUC 1T0RC 3MHSD 4AWJA 5BMHA 2K0PA 3O13A 3VFKA 3Q8FA 2JVCA 1ZXIA 3VXWA 2V0GA 3P63A 4LNFA 1P7EA 1SJED 4A9AA 1FCLA 2PVOD 1YN5A 3I5JC 1HTQA 5JHAA 5IA7A 2W3RA 2L0TA 2Z8LA 5AEKB 1SF0A 1ZDXA 2G4SA 4EOYA 1RRBA 1XLPA 4ZDVA 5IAAC 3CIRB 3L4PA 2WHIA 4AS1A 2GRIA 1AWDA 3EHVA 3WAMA 4HPLB 2CJOA 4WIPA 4RH6A 2WXHA 1L0YB 1UNSA 3S2AA 3IHPC 3W5VB 3Q3MC 2C60A 5LNK1 4W9IA 3WIMA 2DZKA 3WANA 3DBLI 3T9LA 3GZNB 1FFUA 4YSZB 3HVDA 4GN1A 2RR9A 3P4SB 5C1ZA 1NYRA 2L3ZA 1FNWA 4W9DA 1GC7A 3N3KB 4DQOC 1T0YA 3PRPB 3AEBB 1YIWA 3KW5B 1E8YA 2D3AA 4HDOA 4IWOA 1ZXHA 1LO5D 1UGMA 3T8MA 2OJWA 4M8NA 3M95A 5CHVC 5CHWA 3NJTA 2BPSA 3RUIB 4KDIC 1A5RA 4YTNB 4A3OA 5D3DA 2RSUA 3CSFA 2D3CA 1FXIA 3W1YA 3AXCA 1EF5A 4TKNA 4HKZE 3L17A 5L95C 3ZW3A 3QK0A 2EKEC 2ONQA 4EFOA 1MVKA 3AU5A 1E9MA 3TJPA 1PQSA 1OFFA 3DHGC 1TTNA 2LD9A 1FD6A 4IWPA 4RNAA 5LXHA 3FC4A 2FIDA 1NVID 4NZLB 5BO4B 1LXDA 2J4XA 5IKCM 4EE2A 2JZZA 3DHHC 3SFDB 2O6VA 2TSSA 3GOEA 3VQIA 3MHZA 5G55A 3BINA 4M00A 4W9KA 3VH4B 1ZKHA 4LLGM 1WGKA 2N7EA 1C9FA 3ZUNA 3BVGA 1PFDA 2K8BA 3SHQA 2WXRA 4ZRJA 1G6JA 3NVVA 1SIFA 1Q0WB 1WE6A 2ZVOA 4KGTA 1GNUA 5H92C 4W9GA 3R3MA 1TS5A 3BK2A 4KZCA 3QHTA 3LJ3A 2LFIA 3N20C 3PO0A 2N9LA 2C7HA 4XC2A 2RD0A 1EUVB 1WI0A 2WNMA 4F1SA 3HK0A 2O6VB 1JWSD 1WIAA 2KQ7A 3QC8B 4KZ0A 4L2YA 3NVZA 3AE1B 4ZRPA 4FULA 3UQAA 3UQBA 4ARCA 1TYGB 2QJLA 3EFCA 1C79A 4ZOHC 2RDHA 1J8CA 4P1CC 3RZFA 4IM3A 4Q2JA 1WYWB 3ZJTA 1CMXB 2BS4B 2LXAA 1WXAA 2NBVB 2MEKA 2JZPA 2NBWB 3VUXA 4RGMA 1OTRB 2KYWA 1I4GA 4L23A 3NVWA 1GAQB 3M63B 2KQ4X 3A9JA 2LJIA 3IG3A 2KXJA 2WDQB 1KOTA 1PGBA 4FA6A 5FR3A 4W9EA 3ZGZA 3MC0B 1AW7A 1F0ZA 3SU8X 2Y3AA 3HVZA 2KJRA 3B2GA 1MFWA 2CJNA 2IBIB 4NAWB 1WE7A 1ACCA 1R4NB 1IYFA 1SIJA 1C4CA 3V6CB 1QT9A 2N7DA 3TEWA 3PT2B 1JRUA 2RDBC 2INCC 2N9KA 4AP4C 2I1JA 2BGFA 1OEYJ 4G3XB 1OQYA 3FAHA 3W9CB 1K53A 1P1AA 5EE9A 1LGRA 2HDEA 3UI3A 4MDKE 5G2NA 4F7ZA 2K39A 1HA5A 5J17A 2JWZA 4CQNA 3PLUA 4X57B 2KDMA 3Q8EA 3VUWA 1QF6A 2CKHB 2QILA 3L10B 1PUTA 2NR2A 2ASQA 1VCBA 4YSXB 3VTWA 2NPTB 1E0ZA 2DENB 1M4VA 2WXMA 2W82A 2LHEA 5D2MB 4E3CA 1L4ZB 5LLIA 2MWSB 1LFDA 4ANXA 4A20A 1I42A 2LRWA 2GOWA 3DBHB 3IBEA 1UWMA 2K3UA 4N58A 2JX5A 1P7FA 2KWVB 3MFGA 3KQ4A 3P42A 1CJEA 4KSLC 3H8HA 1NENB 1KLUD 1F52A 3AB5A 2JU6X 1R7SA 4M0WA 2LI5A 1P98A 5FR6A 2ZW1A 4ZHPA 4KKJA 3HIZA 2RPQA 1TJEA 1V5OA 3N1ZC 2MLBA 2JRHA 2DAJA 1FXTB 2JXTA 2IY1B 1WJNA 1GJZA 2KQSA 2XNAC 5DPRA 1L6VA 5H8YE 4GXBA 2MQJA 4NJ6A 2KO3A 4JQWC 3ZVVA 5C23A 4MELA 1EU4A 2E3TA 1JROA 3DWGC 1L7YA 3MTNB 1I4PA 1UZXB 4IUMB 4TSSA 1YJ1A 5DPTA 3R66C 1CQVA 4M0WB 3AH7A 1QZEA 2C7MB 4B0MA 2B3AA 4BKTA 1SE4A 3OAWA 1STEA 4C4VA 3Q8AA 5E6JA 4ASWC 1TGZB 1SE3A 1FCCC 4M02A 3HHMA 2FCQA 3LB8C 3QWZB 5AUKA 1BXTA 5CX3A 3W1SA 1WX8A 4EZLA 4FADA 2L0FA 3FKYA 3I63C 1Y56A 3LDZE 4BAXA 3APDA 3BZDB 4PT5A 4WJNA 4USAA 1D6EC 3DBRI 4AJYB 2INDC 2Q5WD 3EECA 1I4HA 3KH0A 5JH5C 2H88B 2IY0B 2KD0A 1BT0A 2WDRB 3LXFA 3R7QA 3BVMA 4HJKA 1WXMA 4AQ7A 1QOBA 4ANVA 2KZRA 1KRHA 1IUEA 4OHJA 3DQVA 2IPKD 1WM3A 3GZNI 3I57A 1JWAD 2LXCA 1XLOA 3Q14C 2M19A 3V62A 3QIJA 2KDEB 4YTMB 2XN9C 3ZIMA 2DYOA 2J0JA 3PREA 5FK9C 2V4IB 2KDBA 3AE3B 1LM8B 2L00B 4W9HA 1OQRA 5FKAC 2IO2B 3ABVB 4FHJA 3IFWB 4PS7A 1XO3A 2WX0A 1C3TA 1ZW7A 4TV3A 1MJDA 2MH7A 4ICVA 3AE9B 3P2BA 4PK1A 3P1MA 4W9CA 3DVGY 1VZ7A 2YEPB 3L0WB 2MBBB 4ANUA 2AQ1B 1HQRD 4ANWA 4XDCA 2LVPA 5HHDG 3UIOB 3H7SA 1I35A 1OGWA 2WGSA 1UWXA 3GS2A 4N59A 3JYUA 2JXXA 5L83A 2VRRB 4MM3B 2MJEA 4OVVA 4IM2A 3ZXRA 1QILA 1WX7A 2AL6A 1AYFA 2DHZA 1NEKB 3TIXA 2IJ0A 2G3QB 3ZJVA 4II2B 4A90A 3Q8BA 5D7GA 1MHHE 2LGSA 1FMAD 1T5XD 2K6DB 4K7SA 1H8CA 3ENEA 2ZCCA 3QAQA 3AEEB 2WXGA 1WH3A 1TT5B 3U4EG 4NQKE 4K1RB 3NS8A 2WXPA 3U2SC 4PS8A 1TBEA 4JIOU 2VZKB 1L0VB 3CWIA 3ZKJC 3TEZA 1F77A 2A5UA 4O1NA 1E7PB 3O65B 4WWMA 3FILA 1XD3B 4LNNA 1JWMD 2DLBA 1L6UA 5AUIA 3X0WA 1XQQA 4LJPB 4AOFA 1QOFA 3IT4B 3ALBA 2AYOB 3UF8A 2GBNA 2NTTA 3I9V1 1ZDVA 2L8JA 2QDFA 1N63A 1P0RA 2IGHA 1ET6A 4OZBA 2BQQA 2Y5PA 3CF6E 3B2FA 2PLPA 3SDLC 3AN1A 3L08A 2N9PC 1DOXA 1L0XB 5TR5A 1RM6C 1WGRA 3NS1A 1KLVA 2I38A 1E10A 3DCGA 1GPXA 2CS4A 2KFKA 4FBJB 4XE0A 4ZRIA 2NBUA 3FILB 2V3PA 1K50A 2KTRB 2CHXA 1R4NI 2MSED 2J52A 5GXGB 1TZOA 1L2NA 2G4DB 1J7CA 2X8XX 3BYYB 1YQ3B 4KIKB 4GGQA 3QQ8B 2J42A 4GSWA 2FAZA 3OG5A 4L1BA 2VZKD 3C19A 2O2VB 2M0XA 2NCNA 3RD2A 4J6IA 1I4XA 2J0KA 2BVCA 2LRUA 2IYDB 1QOAA 2WXJA 2K6QA 2KFKB 2HJ1A 2PMVA 3DVNV 1IBXA 1UF0A 1B1ZA 2RMMA 1IP9A 1V2YA 1RWSA 4N6EB 4KSKC 3EC8A 2IO3B 1V1OA 2BT6A 3QX1A 4HXDA 5D3IB 2ZCBA 3ZYYX 2MBQA 3GP7A 4H2AA 2BKRB 2WXLA 4DXAB 4A8XC 1MG4A 3RCZA 1RFKA 1ESFA 3DBHI 2GLSA 4MJSA 1RLFA 4WWNA 5IOIA 1GC6A 1UD7A 2L7RA 1YN3A 4CHKA 3PVLA 1UELA 1K52A 3WAOA 1V97A 1IBXB 3RNEC 3U7DA 2KLCA 2DWQA 5BMIA 2BW2A 1YJJA 2M4NA 1FO4A 4RF0A 3RYTA 4G0NB 2KX3A 3IVFA 3RULA 2OJRA 1FM0D 2BBCA 3IAM1 1HZ6A 2CHWA 2DYBA 4NAWA 3Q3FA 2J53A 3AE6B 3Q8CA 2L05A 4C7ZA 2I2YA 3AE7B 2LMCA 1YN4A 1TS2A 1UBIA 4MJSB 1WWTA 3MC8A 1RAXA 3ML8A 1TY2A 3KLSX 3Q3OC 2HTME 4HROA 1QKZA 2ON8A 2GBMA 2KKCA 2PE6B 1XF5L 1JRPA 2L83A 1MPEA 1MHXA 1UH6A 1ENFA 1Y8RC 3L13A 2VH2A 4K81A 1WZ3A 2DBYA 1YOVB 4BVUC 4RM8A 4ZYNA 3DVGX 2BKFA 4DWFA 1E90A 1KTKA 4A55A 2HTHA 4XWWA 2D2QA 2MA9B 2W9NA 3PSEB 3DPDA 2N1VA 1WGDA 3RNGC 4C80A 3AV8A 3WAPA 1WZ0A 1XEEA 2IO0B 3APFA 2KC2A 2NPTA 4RGNA 2QEJC 4XDDA 2W54A 5MPOA 2SEBD 3AE8B 2ZNVB 3JVZX 5HG2A 2BTEA 1FEHA 2V3SA 5HKHA 3KWVA 3RMKC 4EZKA 3ZO5B 2LGYA 3PLVA 4I6PA 3BYTB 1D5XC 4I6NB 2G9HD 1VR9A 3MJ5A 2BB5A 4EEWA 2D10A 4HDQA 1E6EB 1A70A 1TY0A 2GBRA 3N30A 2ICIA 2IDYA 2K22A 4E71A 1KH0A 3RNBC 2AEHA 4NNJB 4II3B 2L52A 2HJ8A 2C7NB 2CR5A 1C76A 5C3JB 4LDTB 1SBBB 1XT9B 1MG8A 2E6XA 3RI7C 3HRDD 4ITKA 4NJCA 3J9CA 2KLGA 2QCZA 4JLCA 4OZCA 1VDVA 3AM9A 2JPHA 2ZZPB 3ZDMC 3Q3NC 4HPPA 3SD5A 4BKGA 1CK1A 1QLBB 3C8YA 3NRZA 1JWUD 1GUAB 2K8HA 4ZRKA 3PTFC 2GMIC 1JQ4A 2WXQA 5AZHA 4MT5A 3Q2AC 2IO1B 2L76A 2HD5B 2DNFA 4NJ7A 4IG7B 2KMAA 3KYCD 4PYZA 3UINB 3L54A 2NTSA 3A33B 4K7WA 4YWGG 4JGHB 2Z0EB 1WXQA 1FFVA 2WU2B 1DOYA 3Q3JA 1E7UA 2ZJDA 4LDTD 4A3PA 2BS2B 3PRMB 4HJGE 1TS3A 3A9KA 3AMZA 1F2RI 2FCSA 2LGIA 2JZ3B 1DOIA 3EGRA 1WRDB 1TKGA 2FCNA 4HK2A 1WGGA 5JHBA 1PGAA 1SXTA 4G50A 4C56C 2KVRA 2KNBA 4FLHA 1TS4A 4RCOA 1D3ZA 3B9JA 2KVZA 4LJOB 1N61A 1WJUA 1MI0A 2PIAA 4JWSC 4HRSA 2L1AA 2DZJA 1N5WA 4HEA1 1WR6E 4OVZA 4FHKA 1SSNA 3ZTDA 5D6JB 1FRRA 4MH8A 2CHZA 3RN9C 4HPMB 2Z59B 3PRZA 1X1MA 2PVGC 2NMQA 2OOBB 1E8WA 1YNTE 4WQOB 2BYVE 4LNOA 2I1KA 3A9KB 1R4MB 3VRAB 3AU4A 2Y5BB 1F9JA 2K1FA 2JWUA 2FBWB 3KWLA 3ZLZA 2MHJA 4GDKA 4P1BC 5CTRC 4DXGA 4FJYA 2KK8A 5BYQA 3IXSA 2JY6A 1V86A 2PPHA 5E6NA 1EWCA 2LUMA 4OZAA 3M3JA 5DCNA 2MW5A 2D11A 2N7JA 3RZWC 4TUUA 2WXIA 4ACFA 4F8CB 2LGDA 2MCNB 3A1QA 2Z0DB 4EZJA 2AWTA 2VH1A 1EWYC 3TEYA 2DZIA 2LJ5A 1P9DU 3DVNU 4LNIA 1VZ8A 3DOWA 3ONSA 3NHEB 3EUB2 3VTVA 2MBHA 4LNKA 1D5ZC 3SR6A 1TZ1A 3U7ZA 3RPFC 4FXCA 1C78A 3LYYA 4HLEA 4GDKB 4MM3A 3P4RB 4BOZB 3V60A 3VDZA 2BF8B 2V9HA 4XYCA 3NZUA 1Q1OA 4B0EA 2WYQA 1IGDA 2J0MA 4K3BA 2FUHB 4WAAA 3TL5A 4NPNA 2MBOA 2ZVNA 2XK5A 2QIEB 2Y5CA 1FPYA 3A1QB 5BYRA 3PZ8A 3APCA 2M56B 2K9XA 3Q69A 2W3SA 2KT7A 4HWIB 3VTUA 1RYJA 4IKGA 3ETRA 1WR1A 3BY4B 3TBLD 1ET9A 4DXFA 4GU2A 5EDSA 4WQMA 2FE8A 3K9OB 1ZUD2 1CZPA 2RGFA 1J7BA 4WJQA 1YQBA 1TKYA 1FIQA 3AE5B 1D4BA 1VJKA 4NAMA 4IOIE 4IM0A 2KTFA 1YX5B 3B1LX 4YXDB 2XK5B 2KAJA 4URKA 2M0AA 3PHWB 4DBGA 3P4PB 2KHWB 1KF6B 3KYDD 1F1HA 1I4QA 1HTOA 3MP9A 2JUOA 4IDIA 1V6EA 4XX5A 2OHFA 3OWEB 3IAS1 4DDID 1YMHE 3VR9B 4WJPA 3BVZA 1WY8A 3VVWB 2QSDA 2JQRB 4DDGD 2NVUI 3R8BA 2FIFA 3DDCB 1VD2A 1WJ6A 4K3CA 1PYWD 3OJ4B 4RGOS 1ZGUB 5HFYA 1E8XA 1T6BX 3I3TB 1V5TA 3AE4B 2GI9A 3U8ZA 2KTRA 5HI1A 1ZE3D 3HM6X 3NVYA 4MGIE 4MSQB 4KIKA 3ZJUA 4B9KA 4HCPB 2PEAA 2SAKA 3D32A 1SGHA 2O2VA 3DBRB 4RF1A 4JPSA 3QJZA 2ACZB 1EF1A 4W9JA 4JX1C 3SEBA 4KX6B 1J19A 2WLBA 3W5UB 4MSMB 4DHZE 1XCTL 3E56A 4GDLA 2GBJA 4DHJB 2ZW0A 4BOSC 1DGJA 3AEGB 1ROEA 3NUHB 2BS3B 4BZAA 1J0GA 4AJWA 1S3SG 1VRAB 3R7RA 2JYEA 2KMCA 2WU5B 3NZSA 1ZP0B 2KX0A 3CMMB 1WXVA 1Z2MA 3H1UA 2ZPYA 3B0AA 2WXNA 2CU1A 3KUZA 1WYGA 2MJ3A 2X38A 1V81A 1Z5SB 3ZXVA 3KUCB 4ARIA 2CU3A 1TKEA 5CHFA 4P7IA 3RFZB 1I4RA 3RNAC 1T0QC 1NI2A 4OVUA 4M01A 4GDLB 1UGJA 2MP2A 1K51A 3UGBB 4S17A 5J18A 4YSYB 3E9SA 2XBBC 2BWFA 1P3QU 3MJWA 2M1MA 4REZA 2GB1A 1T0SC 4W9FA 5DPWA 4HVBA 3NY5A 3P4QB 3OLMD 2FNJB 1EO6A 5IP4D 2W55A 1WGYA 4DHJD 4TMAB 2R61A 2N1WA 1GOZA 3AECB
chains in the Genus database with same CATH topology
4II3B 3APDA 3MHSD 5J2RA 2HJ8A 4AWJA 2KFJA 4WJNA 3VFKA 2C7NB 2JVCA 2ZNVC 1WJ4A 2CR5A 3DBRI 4AJYB 3QCAA 3VXWA 3EECA 4LDTB 1UBQA 2K8CA 1XT9B 2MP2B 3KH0A 4NQLB 1MG8A 5JH5C 2QHOA 2IY0B 2KD0A 1BT0A 4M8MA 4RMAA 3R7QA 4HJKA 1WXMA 5JHAA 4GOCA 5IA7A 2L0TA 4GB9A 2KZRA 4N9F4 4ANVA 4CO7A 2KLGA 5LXIB 3PZDA 5AEKB 3VUYA 3OJ3A 1ISNA 3DQVA 1WM3A 2G4SA 4EOYA 3GZNI 1RRBA 4JLCA 2LXCA 4ZDVA 5IAAC 2JPHA 3V62A 2ZZPB 2KDEB 3QIJA 3EHVA 3WAMA 3ZDMC 2DYOA 2J0JA 4HPLB 3ZIMA 4AUQC 3PREA 3SD5A 2KDBA 4BKGA 2LVOA 1LM8B 3H7PA 3ZNID 3S2AA 3IHPC 3N32A 2MX2A 2L00B 2C60A 4W9IA 3WIMA 2LWPA 4BKSA 4W9HA 1GUAB 2DZKA 2K8HA 3DBLI 4YL8A 4ZRKA 3T9LA 3WANA 4IWQA 3PTFC 3C0RB 2GMIC 2EMTA 4GN1A 2RR9A 2NS5A 2IO2B 2KDIA 2ZEQA 1YD8U 5AZHA 5C1ZA 4PS7A 3K9PB 3IFWB 4FHJA 2L3ZA 3RT3B 2V1YA 4W9DA 1GC7A 3N3KB 2WX0A 1T0YA 3PRPB 2IO1B 2L76A 2HD5B 1YIWA 3KW5B 1Q5WB 1E8YA 4HDOA 1C3TA 4IWOA 1ZW7A 2KOXA 1UGMA 4NJ7A 2DX5B 4TV3A 4M8NA 2M17A 3M95A 3T8MA 4IG7B 5CHVC 4ICVA 5CHWA 2KMAA 2BPSA 3P2BA 4KDIC 3RUIB 3KYCD 4W9CA 4A3OA 1WF9A 2UYZB 3DVGY 1A5RA 2RSUA 3CSFA 4PYZA 3UINB 3W1SC 3L54A 3L0WB 3W1YA 3AXCA 1EF5A 2K25A 3A33B 4TKNA 2MBBB 4K7WA 4JGHB 2Z0EB 3L17A 5L95C 3ZW3A 4ANUA 3QK0A 2EKEC 3Q3JA 1E7UA 4FJZA 3NOBA 4EFOA 2ZJDA 4LDTD 3AU5A 4ANWA 4A3PA 1WXSA 2LVPA 3PRMB 1WM2A 3H7PB 3A9KA 3H7SA 3UIOB 3TJPA 1I35A 1PQSA 2FCSA 1OGWA 1TTNA 2LD9A 4IWPA 2JZ3B 1WX9A 3JYUA 1WRDB 2JXXA 2O6VD 5L83A 5LXHA 4TQ0A 2FCNA 4HK2A 1WGGA 2FIDA 2VRRB 4MEMA 5JHBA 5BO4B 1LXDA 4G50A 4TQ1A 4OVVA 2KVRA 2JZZA 2KNBA 4FLHA 2O6VA 1D3ZA 3GOEA 4IM2A 4LJOB 3VQIA 2M8SA 1WJUA 1WX7A 2AL6A 5AZFA 4HCNB 2N9XA 3QARA 5G55A 3BINA 1R4MI 2DZJA 4W9KA 2DHZA 3VH4B 1ZKHA 3TIXA 2G3QB 1WR6E 2N7EA 3A9JB 4FHKA 3ZTDA 5D6JB 3ZUNA 2N9EB 4II2B 5D7GA 2WDTB 2K8BA 2PJHA 2CHZA 3SHQA 4ZRJA 2KJHB 4HPMB 2Z59B 1G6JA 2KN5A 2K6DB 3PRZA 4I6LB 1SIFA 1X1MA 4K7SA 1Q0WB 1WE6A 2OOBB 1H8CA 1E8WA 4WQOB 3ENEA 2BYVE 2ZVOA 4G11A 2ZCCA 2I1KA 3A9KB 1GNUA 3VH3B 3QAQA 2C5LC 4W9GA 3M62B 3AU4A 2Y5BB 3R3MA 1F9JA 2K1FA 4B6WA 3ZLZA 4GDKA 4KZCA 1WH3A 5CTRC 3QHTA 5E6PA 3LJ3A 4NQKE 4FJYA 2KK8A 4K1RB 3NS8A 2JY6A 1V86A 2C7HA 5DPSA 4PS8A 1TBEA 4XC2A 4CYEA 2PPHA 2RD0A 5E6NA 5JZEB 1EUVB 1WI0A 4JIOU 4F1SA 3HK0A 2O6VB 3ZKJC 3M3JA 1WIAA 2DZMA 5DCNA 2MW5A 2D11A 2KQ7A 3QC8B 2FCMA 3JW0X 4KZ0A 4TUUA 3RZWC 1KJTA 2A5UA 3ZNGC 3O65B 4FULA 4F8CB 3UQAA 3UQBA 2LGDA 1XD3B 3L16A 4MGYE 3A1QA 2MCNB 1M94A 2Z0DB 4EZJA 2AWTA 2DZIA 1J8CA 3X0WA 1XQQA 4LJPB 1WMHA 2LJ5A 4AOFA 1P9DU 3DVNU 1V80A 3ALBA 3DOWA 2AYOB 3ONSA 4BKSD 3NHEB 3RZFA 3UF8A 2GBNA 3VTVA 2MBHA 2L8JA 4IM3A 2G45B 1TZ1A 4DK5A 1WYWB 1CMXB 1P0RA 3QA8A 2LXAA 1WXAA 4BFRA 2R2OA 3CF6E 4HLEA 2NBVB 4GDKB 4MM3A 3TCAA 2NBWB 1U4AA 4BOZB 3SDLC 3V60A 3VDZA 3VUXA 2PE9A 2BF8B 1OTRB 3L08A 2N9PC 3NZUA 1Q1OA 1NDDA 5TR5A 2KWUB 1WGRA 2WYQA 4JL9A 1KLVA 2D3GA 4B95A 3DCGA 2J0MA 3M63B 2FUHB 4WAAA 2CS4A 2KFKA 3TL5A 4FBJB 4NPNA 2MBOA 2ZVNA 2XK5A 2NBUA 3A9JA 2N4FA 3IG3A 2KXJA 4ZRIA 3A1QB 2BYFA 2KTRB 2CHXA 3APCA 1R4NI 1KOTA 2WWZA 2YVCA 2MSED 3AULA 4FA6A 3ZRCA 1WMHB 4W9EA 1L2NA 2G4DB 4HWIB 3VTUA 4KIKB 1V49A 4GGQA 3QQ8B 1WR1A 3BY4B 4GSWA 3TBLD 3SU8X 2LZ6A 4GU2A 3ZRFA 4RM9A 2FAZA 5EDSA 3A4RA 4EUTA 1E8ZA 2LASA 2KJRA 2O2VB 3K9OB 3PPAA 2RGFA 4WJQA 2IBIB 1YQBA 2M0XA 4ICUA 1WE7A 4NAWB 2NCNA 2LUEA 2XEWA 1IYFA 4PYUA 3PV1A 4IC7B 3RD2A 3V6CB 2N7DA 4J6IA 3PT2B 1JRUA 2J0KA 3AI5A 3PGEA 4AP4C 2I1JA 4IM0A 2KTFA 2BGFA 1YX5B 1OEYJ 2LVQA 2LRUA 2IYDB 3B1LX 3JSVA 2K6QA 2KFKB 3CSTA 2KDFB 3DVNV 1OQYA 2XK5B 4G3XB 4URKA 1IP9A 1V2YA 3PHWB 4DHZB 4KSKC 1P1AA 4DBGA 3EC8A 1SE9A 2KHWB 2IO3B 4PS3A 3KYDD 4WWPA 2JUOA 3QX1A 4HXDA 4MDKE 3B08A 1V6EA 5G2NA 4F7ZA 2K39A 4XX5A 2ZCBA 4KVGB 4DDID 2MRPA 4WJPA 4WWOA 2MBQA 3ZNZB 5J17A 2JWZA 1WY8A 4EKUA 3VVWB 3PLUA 4X57B 3UIPB 5KHOA 2BKRB 4DDGD 4XZ4A 2NVUI 2GBKA 3VUWA 4DXAB 1GG3A 2CKHB 2FIFA 2KANA 3RCZA 3DDCB 2AL3A 3L10B 1VD2A 2NR2A 3DBHI 1WJ6A 2ASQA 1VCBA 3OJ4B 4MJSA 1ZGUB 4BBNC 3VTWA 1IPGA 2NPTB 1LQBA 1RLFA 2DENB 1E8XA 4WWNA 3I3TB 1GC6A 1V5TA 1UD7A 2L7RA 3U8ZA 3JSVB 4CHKA 3PVLA 1UELA 1YX6B 4E3CA 2KTRA 5D2MB 2BYEA 3PHXB 3VAWA 3HM6X 3WAOA 5E6OA 2HE7A 5LLIA 2KLCA 2MWSB 3U7DA 5KHQA 1LFDA 1WFYA 4MGIE 4MSQB 4A20A 2LRWA 2GOWA 1C1YB 4ANXA 1I42A 3IBEA 4KIKA 2M4NA 1OEYA 4B9KA 2KWVB 3A4SC 2WX1A 3RYTA 4HCPB 4G0NB 2PEAA 2KX3A 3D32A 3IVFA 1SGHA 3RULA 2OJRA 2O2VA 1S1QB 3V61A 2CHWA 3QJZA 2DYBA 4GIVA 4NAWA 2BWES 3Q3FA 1KM7A 4KSLC 1EF1A 1V9JA 4W9JA 1H4RA 5GMVA 2L05A 1WGHA 4FN2A 1J19A 3KVFB 3VHTC 4E74A 3EFUA 2LI5A 1UBIA 4MJSB 4DHZE 4MSMB 1P98A 3H6NA 5FR6A 1RAXA 5AZGA 3ML8A 2C9WB 4GDLA 2GBJA 4DHJB 3HIZA 2RPQA 4BOSC 1AARA 1V5OA 2GBMA 2MBEA 4KV2A 2KKCA 2PE6B 3WALA 3U30A 1K8RB 2MLBA 1UH6A 2JRHA 1J0GA 2DAJA 1Y8RC 1FXTB 4K7UA 2IY1B 4AJWA 2IZVB 1S3SG 1WJNA 3L13A 4WJOA 1GJZA 3R7RA 2KMCA 2KQSA 1WZ3A 4K81A 3ML9A 5DPRA 4BVUC 2JF5A 4RM8A 1E7VA 3TMPB 4ZYNA 3NZSA 3DVGX 2V4LA 4GXBA 2KX0A 2MQJA 4LCDE 4NJ6A 2BKFA 3CMMB 4DWFA 1E90A 4GMVA 1WXVA 1Z2MA 2KO3A 3H1UA 2ZPYA 3B0AA 1NBFC 4JQWC 4W9LA 1HE8A 2HTHA 3ZVVA 5C23A 3ZDTA 2D2QA 2MA9B 2W9NA 2CU1A 4MELA 3KUZA 2LGXA 3PSEB 4MGZE 2JRIB 3DPDA 2N1VA 3KUDB 4MGKE 1WGDA 1V81A 2REXA 4MH0E 3ZNHB 1Z5SB 1L7YA 2A4ZA 1WZ0A 3MTNB 4KDLB 4NY0A 3KUCB 3WAPA 3ECIA 4IUMB 1UZXB 1YJ1A 2IO0B 3APFA 3R66C 5DPTA 2KC2A 2NPTA 3HM3A 4M0WB 2DYMA 5CHFA 1QZEA 2YLMA 4P7IA 2R2QA 2C7MB 2EMSA 2KJ6A 1NI2A 4OVUA 2B3AA 2ZNVB 4GDLB 3JVZX 4BKTA 2V3SA 2MP2A 3OAWA 5HKHA 4BBNF 3UGBB 3V6EB 4EZKA 2UWQA 3ZO5B 2LGYA 5J18A 3PLVA 2ZPNA 4ASWC 3DBSA 1TGZB 4I6PA 2KC1A 4I6NB 2XBBC 2BWFA 1P3QU 3X23A 3H9DA 4FJVB 3MJWA 2M1MA 4EEWA 2D10A 3HHMA 4HDQA 2FCQA 4W9FA 3QWZB 2KWCA 5DPWA 4HVBA 3NY5A 2DAFA 4IW0A 3OLMD 2D07B 1E5WA 2FNJB 3WA0A 1EO6A 2GBRA 1RFAA 5CX3A 3W1SA 2JT4B 2J7QB 1WX8A 3N30A 4EZLA 4FADA 2L0FA 4E71A 1WGYA 4DHJD 5D94A 2N1WA 3ZTCA 3LDZE 2AEHA 4NNJB 3PS6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4II3 B;  3APD A;  3MHS D;  5J2R A;  2HJ8 A;  4AWJ A;  2KFJ A;  4WJN A;  3VFK A;  2C7N B;  2JVC A;  2ZNV C;  1WJ4 A;  2CR5 A;  3DBR I;  4AJY B;  3QCA A;  3VXW A;  3EEC A;  4LDT B;  1UBQ A;  2K8C A;  1XT9 B;  2MP2 B;  3KH0 A;  4NQL B;  1MG8 A;  5JH5 C;  2QHO A;  2IY0 B;  2KD0 A;  1BT0 A;  4M8M A;  4RMA A;  3R7Q A;  4HJK A;  1WXM A;  5JHA A;  4GOC A;  5IA7 A;  2L0T A;  4GB9 A;  2KZR A;  4N9F 4;  4ANV A;  4CO7 A;  2KLG A;  5LXI B;  3PZD A;  5AEK B;  3VUY A;  3OJ3 A;  1ISN A;  3DQV A;  1WM3 A;  2G4S A;  4EOY A;  3GZN I;  1RRB A;  4JLC A;  2LXC A;  4ZDV A;  5IAA C;  2JPH A;  3V62 A;  2ZZP B;  2KDE B;  3QIJ A;  3EHV A;  3WAM A;  3ZDM C;  2DYO A;  2J0J A;  4HPL B;  3ZIM A;  4AUQ C;  3PRE A;  3SD5 A;  2KDB A;  4BKG A;  2LVO A;  1LM8 B;  3H7P A;  3ZNI D;  3S2A A;  3IHP C;  3N32 A;  2MX2 A;  2L00 B;  2C60 A;  4W9I A;  3WIM A;  2LWP A;  4BKS A;  4W9H A;  1GUA B;  2DZK A;  2K8H A;  3DBL I;  4YL8 A;  4ZRK A;  3T9L A;  3WAN A;  4IWQ A;  3PTF C;  3C0R B;  2GMI C;  2EMT A;  4GN1 A;  2RR9 A;  2NS5 A;  2IO2 B;  2KDI A;  2ZEQ A;  1YD8 U;  5AZH A;  5C1Z A;  4PS7 A;  3K9P B;  3IFW B;  4FHJ A;  2L3Z A;  3RT3 B;  2V1Y A;  4W9D A;  1GC7 A;  3N3K B;  2WX0 A;  1T0Y A;  3PRP B;  2IO1 B;  2L76 A;  2HD5 B;  1YIW A;  3KW5 B;  1Q5W B;  1E8Y A;  4HDO A;  1C3T A;  4IWO A;  1ZW7 A;  2KOX A;  1UGM A;  4NJ7 A;  2DX5 B;  4TV3 A;  4M8N A;  2M17 A;  3M95 A;  3T8M A;  4IG7 B;  5CHV C;  4ICV A;  5CHW A;  2KMA A;  2BPS A;  3P2B A;  4KDI C;  3RUI B;  3KYC D;  4W9C A;  4A3O A;  1WF9 A;  2UYZ B;  3DVG Y;  1A5R A;  2RSU A;  3CSF A;  4PYZ A;  3UIN B;  3W1S C;  3L54 A;  3L0W B;  3W1Y A;  3AXC A;  1EF5 A;  2K25 A;  3A33 B;  4TKN A;  2MBB B;  4K7W A;  4JGH B;  2Z0E B;  3L17 A;  5L95 C;  3ZW3 A;  4ANU A;  3QK0 A;  2EKE C;  3Q3J A;  1E7U A;  4FJZ A;  3NOB A;  4EFO A;  2ZJD A;  4LDT D;  3AU5 A;  4ANW A;  4A3P A;  1WXS A;  2LVP A;  3PRM B;  1WM2 A;  3H7P B;  3A9K A;  3H7S A;  3UIO B;  3TJP A;  1I35 A;  1PQS A;  2FCS A;  1OGW A;  1TTN A;  2LD9 A;  4IWP A;  2JZ3 B;  1WX9 A;  3JYU A;  1WRD B;  2JXX A;  2O6V D;  5L83 A;  5LXH A;  4TQ0 A;  2FCN A;  4HK2 A;  1WGG A;  2FID A;  2VRR B;  4MEM A;  5JHB A;  5BO4 B;  1LXD A;  4G50 A;  4TQ1 A;  4OVV A;  2KVR A;  2JZZ A;  2KNB A;  4FLH A;  2O6V A;  1D3Z A;  3GOE A;  4IM2 A;  4LJO B;  3VQI A;  2M8S A;  1WJU A;  1WX7 A;  2AL6 A;  5AZF A;  4HCN B;  2N9X A;  3QAR A;  5G55 A;  3BIN A;  1R4M I;  2DZJ A;  4W9K A;  2DHZ A;  3VH4 B;  1ZKH A;  3TIX A;  2G3Q B;  1WR6 E;  2N7E A;  3A9J B;  4FHK A;  3ZTD A;  5D6J B;  3ZUN A;  2N9E B;  4II2 B;  5D7G A;  2WDT B;  2K8B A;  2PJH A;  2CHZ A;  3SHQ A;  4ZRJ A;  2KJH B;  4HPM B;  2Z59 B;  1G6J A;  2KN5 A;  2K6D B;  3PRZ A;  4I6L B;  1SIF A;  1X1M A;  4K7S A;  1Q0W B;  1WE6 A;  2OOB B;  1H8C A;  1E8W A;  4WQO B;  3ENE A;  2BYV E;  2ZVO A;  4G11 A;  2ZCC A;  2I1K A;  3A9K B;  1GNU A;  3VH3 B;  3QAQ A;  2C5L C;  4W9G A;  3M62 B;  3AU4 A;  2Y5B B;  3R3M A;  1F9J A;  2K1F A;  4B6W A;  3ZLZ A;  4GDK A;  4KZC A;  1WH3 A;  5CTR C;  3QHT A;  5E6P A;  3LJ3 A;  4NQK E;  4FJY A;  2KK8 A;  4K1R B;  3NS8 A;  2JY6 A;  1V86 A;  2C7H A;  5DPS A;  4PS8 A;  1TBE A;  4XC2 A;  4CYE A;  2PPH A;  2RD0 A;  5E6N A;  5JZE B;  1EUV B;  1WI0 A;  4JIO U;  4F1S A;  3HK0 A;  2O6V B;  3ZKJ C;  3M3J A;  1WIA A;  2DZM A;  5DCN A;  2MW5 A;  2D11 A;  2KQ7 A;  3QC8 B;  2FCM A;  3JW0 X;  4KZ0 A;  4TUU A;  3RZW C;  1KJT A;  2A5U A;  3ZNG C;  3O65 B;  4FUL A;  4F8C B;  3UQA A;  3UQB A;  2LGD A;  1XD3 B;  3L16 A;  4MGY E;  3A1Q A;  2MCN B;  1M94 A;  2Z0D B;  4EZJ A;  2AWT A;  2DZI A;  1J8C A;  3X0W A;  1XQQ A;  4LJP B;  1WMH A;  2LJ5 A;  4AOF A;  1P9D U;  3DVN U;  1V80 A;  3ALB A;  3DOW A;  2AYO B;  3ONS A;  4BKS D;  3NHE B;  3RZF A;  3UF8 A;  2GBN A;  3VTV A;  2MBH A;  2L8J A;  4IM3 A;  2G45 B;  1TZ1 A;  4DK5 A;  1WYW B;  1CMX B;  1P0R A;  3QA8 A;  2LXA A;  1WXA A;  4BFR A;  2R2O A;  3CF6 E;  4HLE A;  2NBV B;  4GDK B;  4MM3 A;  3TCA A;  2NBW B;  1U4A A;  4BOZ B;  3SDL C;  3V60 A;  3VDZ A;  3VUX A;  2PE9 A;  2BF8 B;  1OTR B;  3L08 A;  2N9P C;  3NZU A;  1Q1O A;  1NDD A;  5TR5 A;  2KWU B;  1WGR A;  2WYQ A;  4JL9 A;  1KLV A;  2D3G A;  4B95 A;  3DCG A;  2J0M A;  3M63 B;  2FUH B;  4WAA A;  2CS4 A;  2KFK A;  3TL5 A;  4FBJ B;  4NPN A;  2MBO A;  2ZVN A;  2XK5 A;  2NBU A;  3A9J A;  2N4F A;  3IG3 A;  2KXJ A;  4ZRI A;  3A1Q B;  2BYF A;  2KTR B;  2CHX A;  3APC A;  1R4N I;  1KOT A;  2WWZ A;  2YVC A;  2MSE D;  3AUL A;  4FA6 A;  3ZRC A;  1WMH B;  4W9E A;  1L2N A;  2G4D B;  4HWI B;  3VTU A;  4KIK B;  1V49 A;  4GGQ A;  3QQ8 B;  1WR1 A;  3BY4 B;  4GSW A;  3TBL D;  3SU8 X;  2LZ6 A;  4GU2 A;  3ZRF A;  4RM9 A;  2FAZ A;  5EDS A;  3A4R A;  4EUT A;  1E8Z A;  2LAS A;  2KJR A;  2O2V B;  3K9O B;  3PPA A;  2RGF A;  4WJQ A;  2IBI B;  1YQB A;  2M0X A;  4ICU A;  1WE7 A;  4NAW B;  2NCN A;  2LUE A;  2XEW A;  1IYF A;  4PYU A;  3PV1 A;  4IC7 B;  3RD2 A;  3V6C B;  2N7D A;  4J6I A;  3PT2 B;  1JRU A;  2J0K A;  3AI5 A;  3PGE A;  4AP4 C;  2I1J A;  4IM0 A;  2KTF A;  2BGF A;  1YX5 B;  1OEY J;  2LVQ A;  2LRU A;  2IYD B;  3B1L X;  3JSV A;  2K6Q A;  2KFK B;  3CST A;  2KDF B;  3DVN V;  1OQY A;  2XK5 B;  4G3X B;  4URK A;  1IP9 A;  1V2Y A;  3PHW B;  4DHZ B;  4KSK C;  1P1A A;  4DBG A;  3EC8 A;  1SE9 A;  2KHW B;  2IO3 B;  4PS3 A;  3KYD D;  4WWP A;  2JUO A;  3QX1 A;  4HXD A;  4MDK E;  3B08 A;  1V6E A;  5G2N A;  4F7Z A;  2K39 A;  4XX5 A;  2ZCB A;  4KVG B;  4DDI D;  2MRP A;  4WJP A;  4WWO A;  2MBQ A;  3ZNZ B;  5J17 A;  2JWZ A;  1WY8 A;  4EKU A;  3VVW B;  3PLU A;  4X57 B;  3UIP B;  5KHO A;  2BKR B;  4DDG D;  4XZ4 A;  2NVU I;  2GBK A;  3VUW A;  4DXA B;  1GG3 A;  2CKH B;  2FIF A;  2KAN A;  3RCZ A;  3DDC B;  2AL3 A;  3L10 B;  1VD2 A;  2NR2 A;  3DBH I;  1WJ6 A;  2ASQ A;  1VCB A;  3OJ4 B;  4MJS A;  1ZGU B;  4BBN C;  3VTW A;  1IPG A;  2NPT B;  1LQB A;  1RLF A;  2DEN B;  1E8X A;  4WWN A;  3I3T B;  1GC6 A;  1V5T A;  1UD7 A;  2L7R A;  3U8Z A;  3JSV B;  4CHK A;  3PVL A;  1UEL A;  1YX6 B;  4E3C A;  2KTR A;  5D2M B;  2BYE A;  3PHX B;  3VAW A;  3HM6 X;  3WAO A;  5E6O A;  2HE7 A;  5LLI A;  2KLC A;  2MWS B;  3U7D A;  5KHQ A;  1LFD A;  1WFY A;  4MGI E;  4MSQ B;  4A20 A;  2LRW A;  2GOW A;  1C1Y B;  4ANX A;  1I42 A;  3IBE A;  4KIK A;  2M4N A;  1OEY A;  4B9K A;  2KWV B;  3A4S C;  2WX1 A;  3RYT A;  4HCP B;  4G0N B;  2PEA A;  2KX3 A;  3D32 A;  3IVF A;  1SGH A;  3RUL A;  2OJR A;  2O2V A;  1S1Q B;  3V61 A;  2CHW A;  3QJZ A;  2DYB A;  4GIV A;  4NAW A;  2BWE S;  3Q3F A;  1KM7 A;  4KSL C;  1EF1 A;  1V9J A;  4W9J A;  1H4R A;  5GMV A;  2L05 A;  1WGH A;  4FN2 A;  1J19 A;  3KVF B;  3VHT C;  4E74 A;  3EFU A;  2LI5 A;  1UBI A;  4MJS B;  4DHZ E;  4MSM B;  1P98 A;  3H6N A;  5FR6 A;  1RAX A;  5AZG A;  3ML8 A;  2C9W B;  4GDL A;  2GBJ A;  4DHJ B;  3HIZ A;  2RPQ A;  4BOS C;  1AAR A;  1V5O A;  2GBM A;  2MBE A;  4KV2 A;  2KKC A;  2PE6 B;  3WAL A;  3U30 A;  1K8R B;  2MLB A;  1UH6 A;  2JRH A;  1J0G A;  2DAJ A;  1Y8R C;  1FXT B;  4K7U A;  2IY1 B;  4AJW A;  2IZV B;  1S3S G;  1WJN A;  3L13 A;  4WJO A;  1GJZ A;  3R7R A;  2KMC A;  2KQS A;  1WZ3 A;  4K81 A;  3ML9 A;  5DPR A;  4BVU C;  2JF5 A;  4RM8 A;  1E7V A;  3TMP B;  4ZYN A;  3NZS A;  3DVG X;  2V4L A;  4GXB A;  2KX0 A;  2MQJ A;  4LCD E;  4NJ6 A;  2BKF A;  3CMM B;  4DWF A;  1E90 A;  4GMV A;  1WXV A;  1Z2M A;  2KO3 A;  3H1U A;  2ZPY A;  3B0A A;  1NBF C;  4JQW C;  4W9L A;  1HE8 A;  2HTH A;  3ZVV A;  5C23 A;  3ZDT A;  2D2Q A;  2MA9 B;  2W9N A;  2CU1 A;  4MEL A;  3KUZ A;  2LGX A;  3PSE B;  4MGZ E;  2JRI B;  3DPD A;  2N1V A;  3KUD B;  4MGK E;  1WGD A;  1V81 A;  2REX A;  4MH0 E;  3ZNH B;  1Z5S B;  1L7Y A;  2A4Z A;  1WZ0 A;  3MTN B;  4KDL B;  4NY0 A;  3KUC B;  3WAP A;  3ECI A;  4IUM B;  1UZX B;  1YJ1 A;  2IO0 B;  3APF A;  3R66 C;  5DPT A;  2KC2 A;  2NPT A;  3HM3 A;  4M0W B;  2DYM A;  5CHF A;  1QZE A;  2YLM A;  4P7I A;  2R2Q A;  2C7M B;  2EMS A;  2KJ6 A;  1NI2 A;  4OVU A;  2B3A A;  2ZNV B;  4GDL B;  3JVZ X;  4BKT A;  2V3S A;  2MP2 A;  3OAW A;  5HKH A;  4BBN F;  3UGB B;  3V6E B;  4EZK A;  2UWQ A;  3ZO5 B;  2LGY A;  5J18 A;  3PLV A;  2ZPN A;  4ASW C;  3DBS A;  1TGZ B;  4I6P A;  2KC1 A;  4I6N B;  2XBB C;  2BWF A;  1P3Q U;  3X23 A;  3H9D A;  4FJV B;  3MJW A;  2M1M A;  4EEW A;  2D10 A;  3HHM A;  4HDQ A;  2FCQ A;  4W9F A;  3QWZ B;  2KWC A;  5DPW A;  4HVB A;  3NY5 A;  2DAF A;  4IW0 A;  3OLM D;  2D07 B;  1E5W A;  2FNJ B;  3WA0 A;  1EO6 A;  2GBR A;  1RFA A;  5CX3 A;  3W1S A;  2JT4 B;  2J7Q B;  1WX8 A;  3N30 A;  4EZL A;  4FAD A;  2L0F A;  4E71 A;  1WGY A;  4DHJ D;  5D94 A;  2N1W A;  3ZTC A;  3LDZ E;  2AEH A;  4NNJ B;  3PS6 A; 
#chains in the Genus database with same CATH topology
 5J2R A;  2D3B A;  1N6Z A;  3N9Y C;  2KFJ A;  1WJ4 A;  3QCA A;  2KAC A;  1UBQ A;  2K8C A;  1OQQ A;  2MP2 B;  4NQL B;  1L5P A;  2LHD A;  2QHO A;  1J7A A;  5TSS A;  4ZHO A;  4M8M A;  3BK1 A;  2UU7 A;  4RMA A;  2D5G A;  3AED B;  2WXK A;  4GOC A;  4GB9 A;  4N9F 4;  4CO7 A;  2PW9 A;  3BII D;  5LXI B;  1UUP A;  3PZD A;  3VUY A;  3OJ3 A;  4A6Q A;  1ISN A;  1SB3 C;  2KWD A;  3AEF B;  1N5X A;  1FXA A;  4P16 A;  2OED A;  4AUQ C;  2JYT A;  2LVO A;  3H7P A;  3ZNI D;  2EEL A;  4WUR A;  4GLS C;  3N32 A;  2MX2 A;  2LWP A;  4BKS A;  4YL8 A;  3URY A;  4IWQ A;  3C0R B;  2EMT A;  2NS5 A;  2KDI A;  2ZEQ A;  1YD8 U;  3AE2 B;  3K9P B;  5JXV A;  3RT3 B;  2V1Y A;  1Q5W B;  1SE2 A;  2KOX A;  3Q6B A;  4RFB A;  2DX5 B;  2M17 A;  1XLN A;  4ZYS A;  3NZ3 A;  1WF9 A;  2UYZ B;  4JE3 B;  3W1S C;  3DBL B;  1Q10 A;  4KGR A;  2K25 A;  5T8I A;  1GB1 A;  1QQR A;  4FJZ A;  3NOB A;  1WXS A;  1FNV A;  1WM2 A;  3H7P B;  3N1X C;  2EKI A;  2B76 B;  1WX9 A;  3RNC C;  2O6V D;  4TQ0 A;  4MEM A;  1KFY B;  4TQ1 A;  1JCK B;  4LK0 M;  1DYQ A;  5EE0 A;  2KN4 A;  2M8S A;  5AZF A;  3V05 A;  1HXY D;  2N9X A;  3QAR A;  4HCN B;  2PKO A;  1R4M I;  3W2D A;  3A9J B;  1FNU A;  1TIF A;  5BYS A;  2N9E B;  2WDT B;  2PJH A;  3GE3 C;  2KJH B;  1N62 A;  2KN5 A;  4I6L B;  2FUG 1;  2K5P A;  4G11 A;  3TUO A;  4YT0 B;  3VH3 B;  4P6V F;  2C5L C;  3M62 B;  2WXF A;  1FRD A;  4B6W A;  1IGC A;  5E6P A;  4KGS A;  1BUI C;  5DPS A;  4CYE A;  1F2R C;  3IT6 B;  5JZE B;  2DZM A;  1HZ5 A;  2AQ3 B;  2FCM A;  3JW0 X;  1KJT A;  3ZNG C;  3L16 A;  4MGY E;  1XXG A;  1M94 A;  4R3D A;  1XCQ L;  3HUI A;  3GB1 A;  4RGT A;  1WMH A;  1VLB A;  4OW0 A;  1V80 A;  1T3Q A;  4BKS D;  4XWT A;  2G1E A;  2G45 B;  2WXO A;  3SFE B;  4DK5 A;  2WQY B;  3AEA B;  5G5G A;  2BYT A;  3QA8 A;  1D5M C;  4BFR A;  2R2O A;  4XGA B;  4US9 A;  3TCA A;  1U4A A;  2PE9 A;  4MAC A;  5IN7 A;  1QOG A;  2WDV B;  1NDD A;  2KWU B;  3ZQ4 A;  4JL9 A;  2D3G A;  4B95 A;  4WAF A;  1NYQ A;  2YEP F;  2N4F A;  1BML C;  4J3O D;  2BYF A;  1SJH D;  2WWZ A;  2YVC A;  3AUL A;  1I7H A;  2INP E;  3ZRC A;  1WMH B;  1V49 A;  3TSS A;  3WCQ A;  3ZRF A;  2LZ6 A;  4RM9 A;  1JAL A;  3N1Y C;  2QC8 A;  3TEX A;  1V1P A;  1XLQ A;  3A4R A;  1E8Z A;  4EUT A;  3PZ7 A;  2LAS A;  3PPA A;  4ICU A;  2PTL A;  2LUE A;  2XEW A;  4PYU A;  4C00 A;  3PV1 A;  4IC7 B;  1B9R A;  3AI5 A;  3PGE A;  2LEK A;  2LVQ A;  2BB6 A;  3JSV A;  3CST A;  2KDF B;  4KKI A;  2V3N A;  1ZOY B;  5I4D A;  4DHZ B;  5IO9 A;  1SE9 A;  4PS3 A;  1JML A;  4WWP A;  3B08 A;  4KVG B;  2MRP A;  4WWO A;  3ZNZ B;  2AQ2 B;  4EKU A;  3UIP B;  1V1P B;  5KHO A;  3BWU D;  4XZ4 A;  2GBK A;  1GG3 A;  2KAN A;  2AL3 A;  1PDX A;  1C4P A;  2INN E;  4LTU A;  4BBN C;  1IPG A;  1LQB A;  2IGG A;  2N0S B;  1JW9 D;  3JSV B;  5G5H A;  1YX6 B;  3V3X A;  2BYE A;  3PHX B;  3VAW A;  5E6O A;  2HE7 A;  5KHQ A;  4C4V B;  1WFY A;  5EE1 A;  1C1Y B;  1OEY A;  3A4S C;  3T3O A;  2QMT A;  2WX1 A;  4HKQ A;  1JWB D;  1S1Q B;  3V61 A;  4GIV A;  2BWE S;  1KM7 A;  1KLG D;  3VR8 B;  1GB4 A;  1N60 A;  1V9J A;  1H4R A;  5GMV A;  1AN8 A;  1EM7 A;  3MC9 A;  1WSP A;  1WGH A;  4FN2 A;  1WRI A;  5BMG A;  3KVF B;  3VHT C;  4E74 A;  3EFU A;  3H6N A;  5AZG A;  2C9W B;  4YTP B;  3EA6 A;  2JSV X;  1AAR A;  2MBE A;  4KV2 A;  3WAL A;  2H89 B;  3U30 A;  3DWM A;  1K8R B;  4K7U A;  4WH4 A;  2IZV B;  1C77 A;  4C7Y A;  4WJO A;  3ML9 A;  3NG0 A;  2JF5 A;  3TMP B;  1E7V A;  5EE3 A;  1C4A A;  2V4L A;  1HEZ E;  4LCD E;  1SEB D;  4GMV A;  1YQ4 B;  1NBF C;  2IGD A;  4W9L A;  1HE8 A;  3ZDT A;  1EU3 A;  5C2T B;  2LGX A;  4MGZ E;  1PGX A;  2JRI B;  4ZRQ A;  3KUD B;  4MGK E;  2REX A;  4MH0 E;  3ZNH B;  2WS3 B;  2A4Z A;  2WP9 B;  4KDL B;  1L4D B;  4NY0 A;  3ECI A;  1ZPS A;  2AX5 A;  3HM3 A;  2DYM A;  2YLM A;  2R2Q A;  2EMS A;  2KJ6 A;  3R2T A;  1VZ6 A;  2KMM A;  4BBN F;  3V6E B;  2UWQ A;  1V8C A;  3DHI C;  2RDG A;  2ZPN A;  4UDU C;  3DBS A;  2KC1 A;  3R2I A;  4D2K A;  1NI3 A;  4QAY A;  3X23 A;  3H9D A;  4FJV B;  4S0R A;  4US8 A;  3T3N A;  1YJI A;  2MJD A;  2KWC A;  2RPV A;  3GE8 C;  2DAF A;  4IW0 A;  2D07 B;  1E5W A;  3WA0 A;  1RFA A;  2JT4 B;  2J7Q B;  3VRB B;  3U52 E;  5D94 A;  3RNF C;  3ZTC A;  2L32 A;  2ZNV C;  3PS6 A;  4JWU C;  1T0R C;  3MHS D;  4AWJ A;  5BMH A;  2K0P A;  3O13 A;  3VFK A;  3Q8F A;  2JVC A;  1ZXI A;  3VXW A;  2V0G A;  3P63 A;  4LNF A;  1P7E A;  1SJE D;  4A9A A;  1FCL A;  2PVO D;  1YN5 A;  3I5J C;  1HTQ A;  5JHA A;  5IA7 A;  2W3R A;  2L0T A;  2Z8L A;  5AEK B;  1SF0 A;  1ZDX A;  2G4S A;  4EOY A;  1RRB A;  1XLP A;  4ZDV A;  5IAA C;  3CIR B;  3L4P A;  2WHI A;  4AS1 A;  2GRI A;  1AWD A;  3EHV A;  3WAM A;  4HPL B;  2CJO A;  4WIP A;  4RH6 A;  2WXH A;  1L0Y B;  1UNS A;  3S2A A;  3IHP C;  3W5V B;  3Q3M C;  2C60 A;  5LNK 1;  4W9I A;  3WIM A;  2DZK A;  3WAN A;  3DBL I;  3T9L A;  3GZN B;  1FFU A;  4YSZ B;  3HVD A;  4GN1 A;  2RR9 A;  3P4S B;  5C1Z A;  1NYR A;  2L3Z A;  1FNW A;  4W9D A;  1GC7 A;  3N3K B;  4DQO C;  1T0Y A;  3PRP B;  3AEB B;  1YIW A;  3KW5 B;  1E8Y A;  2D3A A;  4HDO A;  4IWO A;  1ZXH A;  1LO5 D;  1UGM A;  3T8M A;  2OJW A;  4M8N A;  3M95 A;  5CHV C;  5CHW A;  3NJT A;  2BPS A;  3RUI B;  4KDI C;  1A5R A;  4YTN B;  4A3O A;  5D3D A;  2RSU A;  3CSF A;  2D3C A;  1FXI A;  3W1Y A;  3AXC A;  1EF5 A;  4TKN A;  4HKZ E;  3L17 A;  5L95 C;  3ZW3 A;  3QK0 A;  2EKE C;  2ONQ A;  4EFO A;  1MVK A;  3AU5 A;  1E9M A;  3TJP A;  1PQS A;  1OFF A;  3DHG C;  1TTN A;  2LD9 A;  1FD6 A;  4IWP A;  4RNA A;  5LXH A;  3FC4 A;  2FID A;  1NVI D;  4NZL B;  5BO4 B;  1LXD A;  2J4X A;  5IKC M;  4EE2 A;  2JZZ A;  3DHH C;  3SFD B;  2O6V A;  2TSS A;  3GOE A;  3VQI A;  3MHZ A;  5G55 A;  3BIN A;  4M00 A;  4W9K A;  3VH4 B;  1ZKH A;  4LLG M;  1WGK A;  2N7E A;  1C9F A;  3ZUN A;  3BVG A;  1PFD A;  2K8B A;  3SHQ A;  2WXR A;  4ZRJ A;  1G6J A;  3NVV A;  1SIF A;  1Q0W B;  1WE6 A;  2ZVO A;  4KGT A;  1GNU A;  5H92 C;  4W9G A;  3R3M A;  1TS5 A;  3BK2 A;  4KZC A;  3QHT A;  3LJ3 A;  2LFI A;  3N20 C;  3PO0 A;  2N9L A;  2C7H A;  4XC2 A;  2RD0 A;  1EUV B;  1WI0 A;  2WNM A;  4F1S A;  3HK0 A;  2O6V B;  1JWS D;  1WIA A;  2KQ7 A;  3QC8 B;  4KZ0 A;  4L2Y A;  3NVZ A;  3AE1 B;  4ZRP A;  4FUL A;  3UQA A;  3UQB A;  4ARC A;  1TYG B;  2QJL A;  3EFC A;  1C79 A;  4ZOH C;  2RDH A;  1J8C A;  4P1C C;  3RZF A;  4IM3 A;  4Q2J A;  1WYW B;  3ZJT A;  1CMX B;  2BS4 B;  2LXA A;  1WXA A;  2NBV B;  2MEK A;  2JZP A;  2NBW B;  3VUX A;  4RGM A;  1OTR B;  2KYW A;  1I4G A;  4L23 A;  3NVW A;  1GAQ B;  3M63 B;  2KQ4 X;  3A9J A;  2LJI A;  3IG3 A;  2KXJ A;  2WDQ B;  1KOT A;  1PGB A;  4FA6 A;  5FR3 A;  4W9E A;  3ZGZ A;  3MC0 B;  1AW7 A;  1F0Z A;  3SU8 X;  2Y3A A;  3HVZ A;  2KJR A;  3B2G A;  1MFW A;  2CJN A;  2IBI B;  4NAW B;  1WE7 A;  1ACC A;  1R4N B;  1IYF A;  1SIJ A;  1C4C A;  3V6C B;  1QT9 A;  2N7D A;  3TEW A;  3PT2 B;  1JRU A;  2RDB C;  2INC C;  2N9K A;  4AP4 C;  2I1J A;  2BGF A;  1OEY J;  4G3X B;  1OQY A;  3FAH A;  3W9C B;  1K53 A;  1P1A A;  5EE9 A;  1LGR A;  2HDE A;  3UI3 A;  4MDK E;  5G2N A;  4F7Z A;  2K39 A;  1HA5 A;  5J17 A;  2JWZ A;  4CQN A;  3PLU A;  4X57 B;  2KDM A;  3Q8E A;  3VUW A;  1QF6 A;  2CKH B;  2QIL A;  3L10 B;  1PUT A;  2NR2 A;  2ASQ A;  1VCB A;  4YSX B;  3VTW A;  2NPT B;  1E0Z A;  2DEN B;  1M4V A;  2WXM A;  2W82 A;  2LHE A;  5D2M B;  4E3C A;  1L4Z B;  5LLI A;  2MWS B;  1LFD A;  4ANX A;  4A20 A;  1I42 A;  2LRW A;  2GOW A;  3DBH B;  3IBE A;  1UWM A;  2K3U A;  4N58 A;  2JX5 A;  1P7F A;  2KWV B;  3MFG A;  3KQ4 A;  3P42 A;  1CJE A;  4KSL C;  3H8H A;  1NEN B;  1KLU D;  1F52 A;  3AB5 A;  2JU6 X;  1R7S A;  4M0W A;  2LI5 A;  1P98 A;  5FR6 A;  2ZW1 A;  4ZHP A;  4KKJ A;  3HIZ A;  2RPQ A;  1TJE A;  1V5O A;  3N1Z C;  2MLB A;  2JRH A;  2DAJ A;  1FXT B;  2JXT A;  2IY1 B;  1WJN A;  1GJZ A;  2KQS A;  2XNA C;  5DPR A;  1L6V A;  5H8Y E;  4GXB A;  2MQJ A;  4NJ6 A;  2KO3 A;  4JQW C;  3ZVV A;  5C23 A;  4MEL A;  1EU4 A;  2E3T A;  1JRO A;  3DWG C;  1L7Y A;  3MTN B;  1I4P A;  1UZX B;  4IUM B;  4TSS A;  1YJ1 A;  5DPT A;  3R66 C;  1CQV A;  4M0W B;  3AH7 A;  1QZE A;  2C7M B;  4B0M A;  2B3A A;  4BKT A;  1SE4 A;  3OAW A;  1STE A;  4C4V A;  3Q8A A;  5E6J A;  4ASW C;  1TGZ B;  1SE3 A;  1FCC C;  4M02 A;  3HHM A;  2FCQ A;  3LB8 C;  3QWZ B;  5AUK A;  1BXT A;  5CX3 A;  3W1S A;  1WX8 A;  4EZL A;  4FAD A;  2L0F A;  3FKY A;  3I63 C;  1Y56 A;  3LDZ E;  4BAX A;  3APD A;  3BZD B;  4PT5 A;  4WJN A;  4USA A;  1D6E C;  3DBR I;  4AJY B;  2IND C;  2Q5W D;  3EEC A;  1I4H A;  3KH0 A;  5JH5 C;  2H88 B;  2IY0 B;  2KD0 A;  1BT0 A;  2WDR B;  3LXF A;  3R7Q A;  3BVM A;  4HJK A;  1WXM A;  4AQ7 A;  1QOB A;  4ANV A;  2KZR A;  1KRH A;  1IUE A;  4OHJ A;  3DQV A;  2IPK D;  1WM3 A;  3GZN I;  3I57 A;  1JWA D;  2LXC A;  1XLO A;  3Q14 C;  2M19 A;  3V62 A;  3QIJ A;  2KDE B;  4YTM B;  2XN9 C;  3ZIM A;  2DYO A;  2J0J A;  3PRE A;  5FK9 C;  2V4I B;  2KDB A;  3AE3 B;  1LM8 B;  2L00 B;  4W9H A;  1OQR A;  5FKA C;  2IO2 B;  3ABV B;  4FHJ A;  3IFW B;  4PS7 A;  1XO3 A;  2WX0 A;  1C3T A;  1ZW7 A;  4TV3 A;  1MJD A;  2MH7 A;  4ICV A;  3AE9 B;  3P2B A;  4PK1 A;  3P1M A;  4W9C A;  3DVG Y;  1VZ7 A;  2YEP B;  3L0W B;  2MBB B;  4ANU A;  2AQ1 B;  1HQR D;  4ANW A;  4XDC A;  2LVP A;  5HHD G;  3UIO B;  3H7S A;  1I35 A;  1OGW A;  2WGS A;  1UWX A;  3GS2 A;  4N59 A;  3JYU A;  2JXX A;  5L83 A;  2VRR B;  4MM3 B;  2MJE A;  4OVV A;  4IM2 A;  3ZXR A;  1QIL A;  1WX7 A;  2AL6 A;  1AYF A;  2DHZ A;  1NEK B;  3TIX A;  2IJ0 A;  2G3Q B;  3ZJV A;  4II2 B;  4A90 A;  3Q8B A;  5D7G A;  1MHH E;  2LGS A;  1FMA D;  1T5X D;  2K6D B;  4K7S A;  1H8C A;  3ENE A;  2ZCC A;  3QAQ A;  3AEE B;  2WXG A;  1WH3 A;  1TT5 B;  3U4E G;  4NQK E;  4K1R B;  3NS8 A;  2WXP A;  3U2S C;  4PS8 A;  1TBE A;  4JIO U;  2VZK B;  1L0V B;  3CWI A;  3ZKJ C;  3TEZ A;  1F77 A;  2A5U A;  4O1N A;  1E7P B;  3O65 B;  4WWM A;  3FIL A;  1XD3 B;  4LNN A;  1JWM D;  2DLB A;  1L6U A;  5AUI A;  3X0W A;  1XQQ A;  4LJP B;  4AOF A;  1QOF A;  3IT4 B;  3ALB A;  2AYO B;  3UF8 A;  2GBN A;  2NTT A;  3I9V 1;  1ZDV A;  2L8J A;  2QDF A;  1N63 A;  1P0R A;  2IGH A;  1ET6 A;  4OZB A;  2BQQ A;  2Y5P A;  3CF6 E;  3B2F A;  2PLP A;  3SDL C;  3AN1 A;  3L08 A;  2N9P C;  1DOX A;  1L0X B;  5TR5 A;  1RM6 C;  1WGR A;  3NS1 A;  1KLV A;  2I38 A;  1E10 A;  3DCG A;  1GPX A;  2CS4 A;  2KFK A;  4FBJ B;  4XE0 A;  4ZRI A;  2NBU A;  3FIL B;  2V3P A;  1K50 A;  2KTR B;  2CHX A;  1R4N I;  2MSE D;  2J52 A;  5GXG B;  1TZO A;  1L2N A;  2G4D B;  1J7C A;  2X8X X;  3BYY B;  1YQ3 B;  4KIK B;  4GGQ A;  3QQ8 B;  2J42 A;  4GSW A;  2FAZ A;  3OG5 A;  4L1B A;  2VZK D;  3C19 A;  2O2V B;  2M0X A;  2NCN A;  3RD2 A;  4J6I A;  1I4X A;  2J0K A;  2BVC A;  2LRU A;  2IYD B;  1QOA A;  2WXJ A;  2K6Q A;  2KFK B;  2HJ1 A;  2PMV A;  3DVN V;  1IBX A;  1UF0 A;  1B1Z A;  2RMM A;  1IP9 A;  1V2Y A;  1RWS A;  4N6E B;  4KSK C;  3EC8 A;  2IO3 B;  1V1O A;  2BT6 A;  3QX1 A;  4HXD A;  5D3I B;  2ZCB A;  3ZYY X;  2MBQ A;  3GP7 A;  4H2A A;  2BKR B;  2WXL A;  4DXA B;  4A8X C;  1MG4 A;  3RCZ A;  1RFK A;  1ESF A;  3DBH I;  2GLS A;  4MJS A;  1RLF A;  4WWN A;  5IOI A;  1GC6 A;  1UD7 A;  2L7R A;  1YN3 A;  4CHK A;  3PVL A;  1UEL A;  1K52 A;  3WAO A;  1V97 A;  1IBX B;  3RNE C;  3U7D A;  2KLC A;  2DWQ A;  5BMI A;  2BW2 A;  1YJJ A;  2M4N A;  1FO4 A;  4RF0 A;  3RYT A;  4G0N B;  2KX3 A;  3IVF A;  3RUL A;  2OJR A;  1FM0 D;  2BBC A;  3IAM 1;  1HZ6 A;  2CHW A;  2DYB A;  4NAW A;  3Q3F A;  2J53 A;  3AE6 B;  3Q8C A;  2L05 A;  4C7Z A;  2I2Y A;  3AE7 B;  2LMC A;  1YN4 A;  1TS2 A;  1UBI A;  4MJS B;  1WWT A;  3MC8 A;  1RAX A;  3ML8 A;  1TY2 A;  3KLS X;  3Q3O C;  2HTM E;  4HRO A;  1QKZ A;  2ON8 A;  2GBM A;  2KKC A;  2PE6 B;  1XF5 L;  1JRP A;  2L83 A;  1MPE A;  1MHX A;  1UH6 A;  1ENF A;  1Y8R C;  3L13 A;  2VH2 A;  4K81 A;  1WZ3 A;  2DBY A;  1YOV B;  4BVU C;  4RM8 A;  4ZYN A;  3DVG X;  2BKF A;  4DWF A;  1E90 A;  1KTK A;  4A55 A;  2HTH A;  4XWW A;  2D2Q A;  2MA9 B;  2W9N A;  3PSE B;  3DPD A;  2N1V A;  1WGD A;  3RNG C;  4C80 A;  3AV8 A;  3WAP A;  1WZ0 A;  1XEE A;  2IO0 B;  3APF A;  2KC2 A;  2NPT A;  4RGN A;  2QEJ C;  4XDD A;  2W54 A;  5MPO A;  2SEB D;  3AE8 B;  2ZNV B;  3JVZ X;  5HG2 A;  2BTE A;  1FEH A;  2V3S A;  5HKH A;  3KWV A;  3RMK C;  4EZK A;  3ZO5 B;  2LGY A;  3PLV A;  4I6P A;  3BYT B;  1D5X C;  4I6N B;  2G9H D;  1VR9 A;  3MJ5 A;  2BB5 A;  4EEW A;  2D10 A;  4HDQ A;  1E6E B;  1A70 A;  1TY0 A;  2GBR A;  3N30 A;  2ICI A;  2IDY A;  2K22 A;  4E71 A;  1KH0 A;  3RNB C;  2AEH A;  4NNJ B;  4II3 B;  2L52 A;  2HJ8 A;  2C7N B;  2CR5 A;  1C76 A;  5C3J B;  4LDT B;  1SBB B;  1XT9 B;  1MG8 A;  2E6X A;  3RI7 C;  3HRD D;  4ITK A;  4NJC A;  3J9C A;  2KLG A;  2QCZ A;  4JLC A;  4OZC A;  1VDV A;  3AM9 A;  2JPH A;  2ZZP B;  3ZDM C;  3Q3N C;  4HPP A;  3SD5 A;  4BKG A;  1CK1 A;  1QLB B;  3C8Y A;  3NRZ A;  1JWU D;  1GUA B;  2K8H A;  4ZRK A;  3PTF C;  2GMI C;  1JQ4 A;  2WXQ A;  5AZH A;  4MT5 A;  3Q2A C;  2IO1 B;  2L76 A;  2HD5 B;  2DNF A;  4NJ7 A;  4IG7 B;  2KMA A;  3KYC D;  4PYZ A;  3UIN B;  3L54 A;  2NTS A;  3A33 B;  4K7W A;  4YWG G;  4JGH B;  2Z0E B;  1WXQ A;  1FFV A;  2WU2 B;  1DOY A;  3Q3J A;  1E7U A;  2ZJD A;  4LDT D;  4A3P A;  2BS2 B;  3PRM B;  4HJG E;  1TS3 A;  3A9K A;  3AMZ A;  1F2R I;  2FCS A;  2LGI A;  2JZ3 B;  1DOI A;  3EGR A;  1WRD B;  1TKG A;  2FCN A;  4HK2 A;  1WGG A;  5JHB A;  1PGA A;  1SXT A;  4G50 A;  4C56 C;  2KVR A;  2KNB A;  4FLH A;  1TS4 A;  4RCO A;  1D3Z A;  3B9J A;  2KVZ A;  4LJO B;  1N61 A;  1WJU A;  1MI0 A;  2PIA A;  4JWS C;  4HRS A;  2L1A A;  2DZJ A;  1N5W A;  4HEA 1;  1WR6 E;  4OVZ A;  4FHK A;  1SSN A;  3ZTD A;  5D6J B;  1FRR A;  4MH8 A;  2CHZ A;  3RN9 C;  4HPM B;  2Z59 B;  3PRZ A;  1X1M A;  2PVG C;  2NMQ A;  2OOB B;  1E8W A;  1YNT E;  4WQO B;  2BYV E;  4LNO A;  2I1K A;  3A9K B;  1R4M B;  3VRA B;  3AU4 A;  2Y5B B;  1F9J A;  2K1F A;  2JWU A;  2FBW B;  3KWL A;  3ZLZ A;  2MHJ A;  4GDK A;  4P1B C;  5CTR C;  4DXG A;  4FJY A;  2KK8 A;  5BYQ A;  3IXS A;  2JY6 A;  1V86 A;  2PPH A;  5E6N A;  1EWC A;  2LUM A;  4OZA A;  3M3J A;  5DCN A;  2MW5 A;  2D11 A;  2N7J A;  3RZW C;  4TUU A;  2WXI A;  4ACF A;  4F8C B;  2LGD A;  2MCN B;  3A1Q A;  2Z0D B;  4EZJ A;  2AWT A;  2VH1 A;  1EWY C;  3TEY A;  2DZI A;  2LJ5 A;  1P9D U;  3DVN U;  4LNI A;  1VZ8 A;  3DOW A;  3ONS A;  3NHE B;  3EUB 2;  3VTV A;  2MBH A;  4LNK A;  1D5Z C;  3SR6 A;  1TZ1 A;  3U7Z A;  3RPF C;  4FXC A;  1C78 A;  3LYY A;  4HLE A;  4GDK B;  4MM3 A;  3P4R B;  4BOZ B;  3V60 A;  3VDZ A;  2BF8 B;  2V9H A;  4XYC A;  3NZU A;  1Q1O A;  4B0E A;  2WYQ A;  1IGD A;  2J0M A;  4K3B A;  2FUH B;  4WAA A;  3TL5 A;  4NPN A;  2MBO A;  2ZVN A;  2XK5 A;  2QIE B;  2Y5C A;  1FPY A;  3A1Q B;  5BYR A;  3PZ8 A;  3APC A;  2M56 B;  2K9X A;  3Q69 A;  2W3S A;  2KT7 A;  4HWI B;  3VTU A;  1RYJ A;  4IKG A;  3ETR A;  1WR1 A;  3BY4 B;  3TBL D;  1ET9 A;  4DXF A;  4GU2 A;  5EDS A;  4WQM A;  2FE8 A;  3K9O B;  1ZUD 2;  1CZP A;  2RGF A;  1J7B A;  4WJQ A;  1YQB A;  1TKY A;  1FIQ A;  3AE5 B;  1D4B A;  1VJK A;  4NAM A;  4IOI E;  4IM0 A;  2KTF A;  1YX5 B;  3B1L X;  4YXD B;  2XK5 B;  2KAJ A;  4URK A;  2M0A A;  3PHW B;  4DBG A;  3P4P B;  2KHW B;  1KF6 B;  3KYD D;  1F1H A;  1I4Q A;  1HTO A;  3MP9 A;  2JUO A;  4IDI A;  1V6E A;  4XX5 A;  2OHF A;  3OWE B;  3IAS 1;  4DDI D;  1YMH E;  3VR9 B;  4WJP A;  3BVZ A;  1WY8 A;  3VVW B;  2QSD A;  2JQR B;  4DDG D;  2NVU I;  3R8B A;  2FIF A;  3DDC B;  1VD2 A;  1WJ6 A;  4K3C A;  1PYW D;  3OJ4 B;  4RGO S;  1ZGU B;  5HFY A;  1E8X A;  1T6B X;  3I3T B;  1V5T A;  3AE4 B;  2GI9 A;  3U8Z A;  2KTR A;  5HI1 A;  1ZE3 D;  3HM6 X;  3NVY A;  4MGI E;  4MSQ B;  4KIK A;  3ZJU A;  4B9K A;  4HCP B;  2PEA A;  2SAK A;  3D32 A;  1SGH A;  2O2V A;  3DBR B;  4RF1 A;  4JPS A;  3QJZ A;  2ACZ B;  1EF1 A;  4W9J A;  4JX1 C;  3SEB A;  4KX6 B;  1J19 A;  2WLB A;  3W5U B;  4MSM B;  4DHZ E;  1XCT L;  3E56 A;  4GDL A;  2GBJ A;  4DHJ B;  2ZW0 A;  4BOS C;  1DGJ A;  3AEG B;  1ROE A;  3NUH B;  2BS3 B;  4BZA A;  1J0G A;  4AJW A;  1S3S G;  1VRA B;  3R7R A;  2JYE A;  2KMC A;  2WU5 B;  3NZS A;  1ZP0 B;  2KX0 A;  3CMM B;  1WXV A;  1Z2M A;  3H1U A;  2ZPY A;  3B0A A;  2WXN A;  2CU1 A;  3KUZ A;  1WYG A;  2MJ3 A;  2X38 A;  1V81 A;  1Z5S B;  3ZXV A;  3KUC B;  4ARI A;  2CU3 A;  1TKE A;  5CHF A;  4P7I A;  3RFZ B;  1I4R A;  3RNA C;  1T0Q C;  1NI2 A;  4OVU A;  4M01 A;  4GDL B;  1UGJ A;  2MP2 A;  1K51 A;  3UGB B;  4S17 A;  5J18 A;  4YSY B;  3E9S A;  2XBB C;  2BWF A;  1P3Q U;  3MJW A;  2M1M A;  4REZ A;  2GB1 A;  1T0S C;  4W9F A;  5DPW A;  4HVB A;  3NY5 A;  3P4Q B;  3OLM D;  2FNJ B;  1EO6 A;  5IP4 D;  2W55 A;  1WGY A;  4DHJ D;  4TMA B;  2R61 A;  2N1W A;  1GOZ A;  3AEC B; 
#chains in the Genus database with same CATH homology
 4II3 B;  3APD A;  3MHS D;  5J2R A;  2HJ8 A;  4AWJ A;  2KFJ A;  4WJN A;  3VFK A;  2C7N B;  2JVC A;  2ZNV C;  1WJ4 A;  2CR5 A;  3DBR I;  4AJY B;  3QCA A;  3VXW A;  3EEC A;  4LDT B;  1UBQ A;  2K8C A;  1XT9 B;  2MP2 B;  3KH0 A;  4NQL B;  1MG8 A;  5JH5 C;  2QHO A;  2IY0 B;  2KD0 A;  1BT0 A;  4M8M A;  4RMA A;  3R7Q A;  4HJK A;  1WXM A;  5JHA A;  4GOC A;  5IA7 A;  2L0T A;  4GB9 A;  2KZR A;  4N9F 4;  4ANV A;  4CO7 A;  2KLG A;  5LXI B;  3PZD A;  5AEK B;  3VUY A;  3OJ3 A;  1ISN A;  3DQV A;  1WM3 A;  2G4S A;  4EOY A;  3GZN I;  1RRB A;  4JLC A;  2LXC A;  4ZDV A;  5IAA C;  2JPH A;  3V62 A;  2ZZP B;  2KDE B;  3QIJ A;  3EHV A;  3WAM A;  3ZDM C;  2DYO A;  2J0J A;  4HPL B;  3ZIM A;  4AUQ C;  3PRE A;  3SD5 A;  2KDB A;  4BKG A;  2LVO A;  1LM8 B;  3H7P A;  3ZNI D;  3S2A A;  3IHP C;  3N32 A;  2MX2 A;  2L00 B;  2C60 A;  4W9I A;  3WIM A;  2LWP A;  4BKS A;  4W9H A;  1GUA B;  2DZK A;  2K8H A;  3DBL I;  4YL8 A;  4ZRK A;  3T9L A;  3WAN A;  4IWQ A;  3PTF C;  3C0R B;  2GMI C;  2EMT A;  4GN1 A;  2RR9 A;  2NS5 A;  2IO2 B;  2KDI A;  2ZEQ A;  1YD8 U;  5AZH A;  5C1Z A;  4PS7 A;  3K9P B;  3IFW B;  4FHJ A;  2L3Z A;  3RT3 B;  2V1Y A;  4W9D A;  1GC7 A;  3N3K B;  2WX0 A;  1T0Y A;  3PRP B;  2IO1 B;  2L76 A;  2HD5 B;  1YIW A;  3KW5 B;  1Q5W B;  1E8Y A;  4HDO A;  1C3T A;  4IWO A;  1ZW7 A;  2KOX A;  1UGM A;  4NJ7 A;  2DX5 B;  4TV3 A;  4M8N A;  2M17 A;  3M95 A;  3T8M A;  4IG7 B;  5CHV C;  4ICV A;  5CHW A;  2KMA A;  2BPS A;  3P2B A;  4KDI C;  3RUI B;  3KYC D;  4W9C A;  4A3O A;  1WF9 A;  2UYZ B;  3DVG Y;  1A5R A;  2RSU A;  3CSF A;  4PYZ A;  3UIN B;  3W1S C;  3L54 A;  3L0W B;  3W1Y A;  3AXC A;  1EF5 A;  2K25 A;  3A33 B;  4TKN A;  2MBB B;  4K7W A;  4JGH B;  2Z0E B;  3L17 A;  5L95 C;  3ZW3 A;  4ANU A;  3QK0 A;  2EKE C;  3Q3J A;  1E7U A;  4FJZ A;  3NOB A;  4EFO A;  2ZJD A;  4LDT D;  3AU5 A;  4ANW A;  4A3P A;  1WXS A;  2LVP A;  3PRM B;  1WM2 A;  3H7P B;  3A9K A;  3H7S A;  3UIO B;  3TJP A;  1I35 A;  1PQS A;  2FCS A;  1OGW A;  1TTN A;  2LD9 A;  4IWP A;  2JZ3 B;  1WX9 A;  3JYU A;  1WRD B;  2JXX A;  2O6V D;  5L83 A;  5LXH A;  4TQ0 A;  2FCN A;  4HK2 A;  1WGG A;  2FID A;  2VRR B;  4MEM A;  5JHB A;  5BO4 B;  1LXD A;  4G50 A;  4TQ1 A;  4OVV A;  2KVR A;  2JZZ A;  2KNB A;  4FLH A;  2O6V A;  1D3Z A;  3GOE A;  4IM2 A;  4LJO B;  3VQI A;  2M8S A;  1WJU A;  1WX7 A;  2AL6 A;  5AZF A;  4HCN B;  2N9X A;  3QAR A;  5G55 A;  3BIN A;  1R4M I;  2DZJ A;  4W9K A;  2DHZ A;  3VH4 B;  1ZKH A;  3TIX A;  2G3Q B;  1WR6 E;  2N7E A;  3A9J B;  4FHK A;  3ZTD A;  5D6J B;  3ZUN A;  2N9E B;  4II2 B;  5D7G A;  2WDT B;  2K8B A;  2PJH A;  2CHZ A;  3SHQ A;  4ZRJ A;  2KJH B;  4HPM B;  2Z59 B;  1G6J A;  2KN5 A;  2K6D B;  3PRZ A;  4I6L B;  1SIF A;  1X1M A;  4K7S A;  1Q0W B;  1WE6 A;  2OOB B;  1H8C A;  1E8W A;  4WQO B;  3ENE A;  2BYV E;  2ZVO A;  4G11 A;  2ZCC A;  2I1K A;  3A9K B;  1GNU A;  3VH3 B;  3QAQ A;  2C5L C;  4W9G A;  3M62 B;  3AU4 A;  2Y5B B;  3R3M A;  1F9J A;  2K1F A;  4B6W A;  3ZLZ A;  4GDK A;  4KZC A;  1WH3 A;  5CTR C;  3QHT A;  5E6P A;  3LJ3 A;  4NQK E;  4FJY A;  2KK8 A;  4K1R B;  3NS8 A;  2JY6 A;  1V86 A;  2C7H A;  5DPS A;  4PS8 A;  1TBE A;  4XC2 A;  4CYE A;  2PPH A;  2RD0 A;  5E6N A;  5JZE B;  1EUV B;  1WI0 A;  4JIO U;  4F1S A;  3HK0 A;  2O6V B;  3ZKJ C;  3M3J A;  1WIA A;  2DZM A;  5DCN A;  2MW5 A;  2D11 A;  2KQ7 A;  3QC8 B;  2FCM A;  3JW0 X;  4KZ0 A;  4TUU A;  3RZW C;  1KJT A;  2A5U A;  3ZNG C;  3O65 B;  4FUL A;  4F8C B;  3UQA A;  3UQB A;  2LGD A;  1XD3 B;  3L16 A;  4MGY E;  3A1Q A;  2MCN B;  1M94 A;  2Z0D B;  4EZJ A;  2AWT A;  2DZI A;  1J8C A;  3X0W A;  1XQQ A;  4LJP B;  1WMH A;  2LJ5 A;  4AOF A;  1P9D U;  3DVN U;  1V80 A;  3ALB A;  3DOW A;  2AYO B;  3ONS A;  4BKS D;  3NHE B;  3RZF A;  3UF8 A;  2GBN A;  3VTV A;  2MBH A;  2L8J A;  4IM3 A;  2G45 B;  1TZ1 A;  4DK5 A;  1WYW B;  1CMX B;  1P0R A;  3QA8 A;  2LXA A;  1WXA A;  4BFR A;  2R2O A;  3CF6 E;  4HLE A;  2NBV B;  4GDK B;  4MM3 A;  3TCA A;  2NBW B;  1U4A A;  4BOZ B;  3SDL C;  3V60 A;  3VDZ A;  3VUX A;  2PE9 A;  2BF8 B;  1OTR B;  3L08 A;  2N9P C;  3NZU A;  1Q1O A;  1NDD A;  5TR5 A;  2KWU B;  1WGR A;  2WYQ A;  4JL9 A;  1KLV A;  2D3G A;  4B95 A;  3DCG A;  2J0M A;  3M63 B;  2FUH B;  4WAA A;  2CS4 A;  2KFK A;  3TL5 A;  4FBJ B;  4NPN A;  2MBO A;  2ZVN A;  2XK5 A;  2NBU A;  3A9J A;  2N4F A;  3IG3 A;  2KXJ A;  4ZRI A;  3A1Q B;  2BYF A;  2KTR B;  2CHX A;  3APC A;  1R4N I;  1KOT A;  2WWZ A;  2YVC A;  2MSE D;  3AUL A;  4FA6 A;  3ZRC A;  1WMH B;  4W9E A;  1L2N A;  2G4D B;  4HWI B;  3VTU A;  4KIK B;  1V49 A;  4GGQ A;  3QQ8 B;  1WR1 A;  3BY4 B;  4GSW A;  3TBL D;  3SU8 X;  2LZ6 A;  4GU2 A;  3ZRF A;  4RM9 A;  2FAZ A;  5EDS A;  3A4R A;  4EUT A;  1E8Z A;  2LAS A;  2KJR A;  2O2V B;  3K9O B;  3PPA A;  2RGF A;  4WJQ A;  2IBI B;  1YQB A;  2M0X A;  4ICU A;  1WE7 A;  4NAW B;  2NCN A;  2LUE A;  2XEW A;  1IYF A;  4PYU A;  3PV1 A;  4IC7 B;  3RD2 A;  3V6C B;  2N7D A;  4J6I A;  3PT2 B;  1JRU A;  2J0K A;  3AI5 A;  3PGE A;  4AP4 C;  2I1J A;  4IM0 A;  2KTF A;  2BGF A;  1YX5 B;  1OEY J;  2LVQ A;  2LRU A;  2IYD B;  3B1L X;  3JSV A;  2K6Q A;  2KFK B;  3CST A;  2KDF B;  3DVN V;  1OQY A;  2XK5 B;  4G3X B;  4URK A;  1IP9 A;  1V2Y A;  3PHW B;  4DHZ B;  4KSK C;  1P1A A;  4DBG A;  3EC8 A;  1SE9 A;  2KHW B;  2IO3 B;  4PS3 A;  3KYD D;  4WWP A;  2JUO A;  3QX1 A;  4HXD A;  4MDK E;  3B08 A;  1V6E A;  5G2N A;  4F7Z A;  2K39 A;  4XX5 A;  2ZCB A;  4KVG B;  4DDI D;  2MRP A;  4WJP A;  4WWO A;  2MBQ A;  3ZNZ B;  5J17 A;  2JWZ A;  1WY8 A;  4EKU A;  3VVW B;  3PLU A;  4X57 B;  3UIP B;  5KHO A;  2BKR B;  4DDG D;  4XZ4 A;  2NVU I;  2GBK A;  3VUW A;  4DXA B;  1GG3 A;  2CKH B;  2FIF A;  2KAN A;  3RCZ A;  3DDC B;  2AL3 A;  3L10 B;  1VD2 A;  2NR2 A;  3DBH I;  1WJ6 A;  2ASQ A;  1VCB A;  3OJ4 B;  4MJS A;  1ZGU B;  4BBN C;  3VTW A;  1IPG A;  2NPT B;  1LQB A;  1RLF A;  2DEN B;  1E8X A;  4WWN A;  3I3T B;  1GC6 A;  1V5T A;  1UD7 A;  2L7R A;  3U8Z A;  3JSV B;  4CHK A;  3PVL A;  1UEL A;  1YX6 B;  4E3C A;  2KTR A;  5D2M B;  2BYE A;  3PHX B;  3VAW A;  3HM6 X;  3WAO A;  5E6O A;  2HE7 A;  5LLI A;  2KLC A;  2MWS B;  3U7D A;  5KHQ A;  1LFD A;  1WFY A;  4MGI E;  4MSQ B;  4A20 A;  2LRW A;  2GOW A;  1C1Y B;  4ANX A;  1I42 A;  3IBE A;  4KIK A;  2M4N A;  1OEY A;  4B9K A;  2KWV B;  3A4S C;  2WX1 A;  3RYT A;  4HCP B;  4G0N B;  2PEA A;  2KX3 A;  3D32 A;  3IVF A;  1SGH A;  3RUL A;  2OJR A;  2O2V A;  1S1Q B;  3V61 A;  2CHW A;  3QJZ A;  2DYB A;  4GIV A;  4NAW A;  2BWE S;  3Q3F A;  1KM7 A;  4KSL C;  1EF1 A;  1V9J A;  4W9J A;  1H4R A;  5GMV A;  2L05 A;  1WGH A;  4FN2 A;  1J19 A;  3KVF B;  3VHT C;  4E74 A;  3EFU A;  2LI5 A;  1UBI A;  4MJS B;  4DHZ E;  4MSM B;  1P98 A;  3H6N A;  5FR6 A;  1RAX A;  5AZG A;  3ML8 A;  2C9W B;  4GDL A;  2GBJ A;  4DHJ B;  3HIZ A;  2RPQ A;  4BOS C;  1AAR A;  1V5O A;  2GBM A;  2MBE A;  4KV2 A;  2KKC A;  2PE6 B;  3WAL A;  3U30 A;  1K8R B;  2MLB A;  1UH6 A;  2JRH A;  1J0G A;  2DAJ A;  1Y8R C;  1FXT B;  4K7U A;  2IY1 B;  4AJW A;  2IZV B;  1S3S G;  1WJN A;  3L13 A;  4WJO A;  1GJZ A;  3R7R A;  2KMC A;  2KQS A;  1WZ3 A;  4K81 A;  3ML9 A;  5DPR A;  4BVU C;  2JF5 A;  4RM8 A;  1E7V A;  3TMP B;  4ZYN A;  3NZS A;  3DVG X;  2V4L A;  4GXB A;  2KX0 A;  2MQJ A;  4LCD E;  4NJ6 A;  2BKF A;  3CMM B;  4DWF A;  1E90 A;  4GMV A;  1WXV A;  1Z2M A;  2KO3 A;  3H1U A;  2ZPY A;  3B0A A;  1NBF C;  4JQW C;  4W9L A;  1HE8 A;  2HTH A;  3ZVV A;  5C23 A;  3ZDT A;  2D2Q A;  2MA9 B;  2W9N A;  2CU1 A;  4MEL A;  3KUZ A;  2LGX A;  3PSE B;  4MGZ E;  2JRI B;  3DPD A;  2N1V A;  3KUD B;  4MGK E;  1WGD A;  1V81 A;  2REX A;  4MH0 E;  3ZNH B;  1Z5S B;  1L7Y A;  2A4Z A;  1WZ0 A;  3MTN B;  4KDL B;  4NY0 A;  3KUC B;  3WAP A;  3ECI A;  4IUM B;  1UZX B;  1YJ1 A;  2IO0 B;  3APF A;  3R66 C;  5DPT A;  2KC2 A;  2NPT A;  3HM3 A;  4M0W B;  2DYM A;  5CHF A;  1QZE A;  2YLM A;  4P7I A;  2R2Q A;  2C7M B;  2EMS A;  2KJ6 A;  1NI2 A;  4OVU A;  2B3A A;  2ZNV B;  4GDL B;  3JVZ X;  4BKT A;  2V3S A;  2MP2 A;  3OAW A;  5HKH A;  4BBN F;  3UGB B;  3V6E B;  4EZK A;  2UWQ A;  3ZO5 B;  2LGY A;  5J18 A;  3PLV A;  2ZPN A;  4ASW C;  3DBS A;  1TGZ B;  4I6P A;  2KC1 A;  4I6N B;  2XBB C;  2BWF A;  1P3Q U;  3X23 A;  3H9D A;  4FJV B;  3MJW A;  2M1M A;  4EEW A;  2D10 A;  3HHM A;  4HDQ A;  2FCQ A;  4W9F A;  3QWZ B;  2KWC A;  5DPW A;  4HVB A;  3NY5 A;  2DAF A;  4IW0 A;  3OLM D;  2D07 B;  1E5W A;  2FNJ B;  3WA0 A;  1EO6 A;  2GBR A;  1RFA A;  5CX3 A;  3W1S A;  2JT4 B;  2J7Q B;  1WX8 A;  3N30 A;  4EZL A;  4FAD A;  2L0F A;  4E71 A;  1WGY A;  4DHJ D;  5D94 A;  2N1W A;  3ZTC A;  3LDZ E;  2AEH A;  4NNJ B;  3PS6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...