4GDLA

Crystal structure of human atg12~atg5 conjugate in complex with an n-terminal fragment of atg16l1
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
88
structure length
88
Chain Sequence
KKIDILLKAVGDTPIMKTKKWAVERTRTIQGLIDFIKKFLKLVASEQLFIYVNQSFAPSPDQEVGTLYECFGSDGKLVLHYCKSQAWG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Ubiquitin-like protein ATG12
publication title Structure of the human ATG12~ATG5 conjugate required for LC3 lipidation in autophagy.
pubmed doi rcsb
source organism Homo sapiens
total genus 18
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2012-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04110 APG12 Ubiquitin-like autophagy protein Apg12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4gdlA00
2C7HA 4AP4C 1UD7A 1R4MI 4FJVB 3NY5A 1YD8U 4HPMB 2L00B 2ZZPB 3VTWA 4DHZB 1NBFC 4W9LA 4ZRIA 2CHXA 3IHPC 4WWPA 5CHWA 1V86A 4GDLA 2BYVE 2WDTB 2LGDA 3WA0A 3CSFA 2EMTA 5IA7A 1TTNA 2BPSA 1V6EA 4KZ0A 2KQ7A 4MGIE 1OGWA 2CU1A 2JY6A 4GDKB 3OLMD 4E71A 2KX3A 2MP2A 4MSQB 2BF8B 4FBJB 2RSUA 1KJTA 4HDOA 2KMAA 2LD9A 2D3GA 4G0NB 3KVFB 4MJSB 3LDZE 5CHFA 1ZW7A 4J6IA 2KJRA 1R4NI 5DPRA 5L95C 2NBVB 2C7MB 5AZHA 3DBRI 2CHZA 2MA9B 4M8MA 3HK0A 3M63B 1VD2A 3U30A 4GOCA 4DDID 5G2NA 3JVZX 4IM3A 3ZUNA 3VAWA 3A33B 2XBBC 3KH0A 2G3QB 3H7PB 4BFRA 4WAAA 2FIFA 3DBLI 1SGHA 3PSEB 1EF1A 4CHKA 3NZSA 2PE6B 1ZKHA 1Q5WB 2K8HA 3CSTA 1IP9A 4DHJD 2DYOA 4ANXA 2C5LC 5KHOA 1E8ZA 3QARA 3LJ3A 3R3MA 1UH6A 1Q0WB 1WXAA 4WWNA 3APFA 3JSVB 2AWTA 1UZXB 2GBKA 4IUMB 4MJSA 3ZNHB 4NAWB 4IG7B 2IY1B 3RUIB 1WI0A 3ZW3A 5L83A 2JWZA 2HTHA 4NJ6A 1WYWB 3H6NA 1V9JA 1YX5B 2MBBB 3RT3B 4DXAB 2REXA 2V1YA 2DHZA 2AL6A 2LRWA 4GXBA 4JL9A 5E6OA 1WX9A 3EECA 1I35A 3VDZA 3WALA 4FLHA 4LDTD 1E8WA 2HE7A 3H7PA 3H1UA 3DOWA 2LWPA 1L2NA 2MRPA 3APCA 2ZJDA 4E74A 4MGZE 3DBHI 3A4RA 3OAWA 4EEWA 2KWCA 3VQIA 1RFAA 1WXVA 2FCSA 2V3SA 3ZRFA 5LLIA 4BOZB 3UIPB 2L0FA 3JYUA 4HWIB 3DPDA 2O6VB 1QZEA 3VH3B 2L7RA 3ZVVA 2MSED 1P0RA 3H7SA 3ENEA 2KC2A 3Q3FA 4ZYNA 5JH5C 3KUDB 3UF8A 3JSVA 4AWJA 2NPTB 4NAWA 3C0RB 3WIMA 3RD2A 3ZNZB 5KHQA 3L17A 3A4SC 3R7QA 4AUQC 3D32A 2LVPA 1OEYJ 3ZLZA 3PHXB 3PPAA 1LXDA 4W9GA 3DDCB 4JQWC 3RCZA 3M62B 1C3TA 2IY0B 3QHTA 3VH4B 2RR9A 2OOBB 3MHSD 1ZGUB 2MX2A 1WIAA 2DZIA 3VHTC 2MQJA 3L0WB 2CR5A 2KLCA 2J7QB 1WGHA 2JF5A 2KOXA 3KYDD 2MW5A 4IWPA 1NI2A 1P9DU 2O6VA 2Y5BB 4GSWA 4LJOB 3NHEB 3VXWA 1L7YA 1FXTB 4MDKE 3L54A 2B3AA 1J0GA 4EZLA 3QJZA 2G4DB 3JW0X 5FR6A 3TJPA 3TL5A 3L08A 4B6WA 3QAQA 3VTUA 1KM7A 2O2VA 3A9KB 4LJPB 4TQ1A 3VUYA 1WGYA 2J0JA 3EFUA 2RD0A 3N32A 3NS8A 1K8RB 2PE9A 3UGBB 4K7WA 3L13A 1H4RA 4KIKB 2KWVB 1WGDA 2KFJA 3SD5A 2UYZB 3PLUA 2HJ8A 2ZPNA 3BY4B 3PRPB 4I6LB 3TBLD 2WWZA 4DHJB 2NR2A 2KX0A 2M1MA 1WR1A 2GMIC 1CMXB 5IAAC 2JZ3B 2AL3A 1E8XA 3V6CB 4NQKE 1P3QU 2ZCCA 2JUOA 3HIZA 2KK8A 5LXIB 2MBHA 4WJQA 3ALBA 1UBIA 3DVGY 4G11A 3EC8A 4HK2A 3PTFC 2JXXA 2KNBA 4M8NA 3WAOA 2N4FA 4K7UA 3MTNB 4KDIC 3MJWA 4BBNC 1I42A 2D2QA 3DVGX 4FJZA 2M0XA 3DVNU 2IYDB 2MLBA 3A9KA 3VFKA 1Q1OA 4DBGA 5D2MB 4W9FA 1GJZA 2J0MA 5GMVA 2N9PC 4LDTB 1Z5SB 2W9NA 2ZCBA 2KANA 3PV1A 1UELA 2GBMA 2L3ZA 3HHMA 2KTFA 4KIKA 5G55A 3SU8X 2BKFA 4ICVA 5BO4B 4W9JA 1T0YA 1MG8A 2LRUA 3PREA 2N7EA 3VUXA 1E7VA 2L05A 1WM3A 2BYFA 1S3SG 3WANA 3RYTA 2NVUI 4KSKC 2I1JA 2JPHA 3ZTDA 3B1LX 5J17A 4NY0A 3EHVA 2FCMA 1F9JA 1P98A 1WH3A 1WJNA 1GG3A 2KO3A 2Z59B 1RAXA 4E3CA 4FN2A 2A4ZA 4JGHB 1WMHB 5JZEB 4BKTA 4DHZE 3N3KB 2NBUA 1JRUA 4HCNB 4XZ4A 4ANWA 1RRBA 2R2QA 1WY8A 3H9DA 1Y8RC 2WX0A 2LZ6A 4GMVA 3NOBA 2AEHA 4BKGA 1EO6A 2BYEA 2DAJA 2KLGA 2N1WA 4ANUA 1V5TA 3AULA 3OJ4B 2L76A 2LXCA 4PS7A 3HM6X 4RM8A 1GNUA 1UGMA 4EZKA 3PZDA 2K6DB 2KVRA 4LCDE 3RZWC 3ML8A 4TKNA 3AU5A 2KFKA 1WXSA 4YL8A 4MGYE 2DX5B 1YIWA 3DVNV 1U4AA 4BOSC 2LXAA 3PHWB 3DQVA 3M3JA 5JHBA 2CS4A 4IWOA 2C9WB 3UQBA 1HE8A 1EUVB 4ZRJA 3A1QB 2O2VB 1OQYA 1V49A 2KXJA 4EZJA 1Z2MA 1WMHA 3V6EB 2LASA 2A5UA 4CYEA 2K8CA 2RPQA 3TCAA 1YJ1A 2DYBA 5D94A 3W1SA 1E5WA 2LGYA 3V62A 1V5OA 1VCBA 2KN5A 3ONSA 5EDSA 4W9DA 3KW5B 4IC7B 4NPNA 3O65B 3IG3A 1NDDA 4F8CB 3ZIMA 2DYMA 2QHOA 2YLMA 2M17A 3IVFA 2N7DA 4F1SA 2L0TA 4HLEA 1V81A 4K81A 2DAFA 1KLVA 3WAPA 1WM2A 2GOWA 1WR6E 3KUZA 2KMCA 2C7NB 4ASWC 3U8ZA 3W1SC 4PS3A 3T8MA 3CMMB 3UQAA 4A20A 1WJ4A 1WE6A 2WX1A 2K8BA 4GB9A 3A1QA 4I6PA 4II3B 4BBNF 4EOYA 1WX8A 3HM3A 3KUCB 4PYUA 4GIVA 5DCNA 2ZEQA 2XEWA 4WQOB 3V60A 4A3OA 1RLFA 2KC1A 4RM9A 1WF9A 1WZ0A 2PJHA 2L8JA 2HD5B 4KDLB 1ISNA 1M94A 2FCNA 3GZNI 1G6JA 2K1FA 4W9IA 2EMSA 2JZZA 4G50A 2M8SA 4W9KA 2DZJA 4X57B 2KDIA 1AARA 2DZMA 4WWOA 4P7IA 4W9HA 4MH0E 3DBSA 4M0WB 2ZVOA 2D10A 2FNJB 4DDGD 4PYZA 1WZ3A 2N9EB 2IO3B 5E6NA 4EFOA 3SHQA 3ZRCA 4EUTA 3KYCD 3W1YA 1LFDA 2JRHA 3M95A 2KHWB 2N9XA 3AXCA 3K9OB 4NNJB 4W9EA 2DENB 3GOEA 4IWQA 4FJYA 2PEAA 2IO1B 3QQ8B 1BT0A 5HKHA 4WJPA 1V2YA 1GC6A 3VTVA 1A5RA 1UBQA 4KV2A 2KTRA 4HXDA 3L10B 1P1AA 4OVVA 4OVUA 3QK0A 2FUHB 3S2AA 1OEYA 4II2B 4IW0A 4B95A 2MCNB 2GBRA 3R66C 5CTRC 2KQSA 2ZNVB 2KWUB 1WXMA 2IBIB 4MM3A 4URKA 2WYQA 2K25A 1XD3B 3A9JB 2ASQA 5AEKB 3BINA 4PS8A 3APDA 4ZDVA 2KZRA 2KFKB 2K6QA 2VRRB 2XK5A 3TIXA 4K1RB 1XQQA 4FADA 1LQBA 3N30A 3CF6E 3PT2B 2FIDA 2YVCA 2KDEB 5AZFA 2LJ5A 1WGGA 5D6JB 1WGRA 4CO7A 2IO0B 4A3PA 1OTRB 4ICUA 4WJNA 4FULA 4N9F4 4NJ7A 4B9KA 2J0KA 2KKCA 3PLVA 3VVWB 4DK5A 1IYFA 2I1KA 2CHWA 4AJWA 1WJ6A 1J19A 2NS5A 4HJKA 3ZDTA 3AU4A 3AI5A 2GBJA 4HPLB 4WJOA 3ECIA 1S1QB 1SE9A 2ZVNA 4GDKA 1E8YA 3Q3JA 2PPHA 3RZFA 2MWSB 4TV3A 2LVQA 4IM0A 4TUUA 2EKEC 1WFYA 2V4LA 1X1MA 2KJ6A 3R7RA 3P2BA 1WX7A 4NQLB 2DZKA 4ANVA 5E6PA 3QCAA 4HVBA 2IO2B 3A9JA 2MBEA 3T9LA 1EF5A 3UIOB 4ZRKA 3IFWB 5DPWA 3DCGA 2K39A 5CHVC 1LM8B 3ZDMC 4TQ0A 2JT4B 1E90A 3PS6A 2RGFA 3QWZB 2Z0DB 5TR5A 3WAMA 1YX6B 2JVCA 2LGXA 3PGEA 2NCNA 4FHKA 4G3XB 2FAZA 2MBOA 3PRMB 2LUEA 4FA6A 4AJYB 1GC7A 4RMAA 4HDQA 4GN1A 1TZ1A 3ZO5B 2ZPYA 3RULA 2GBNA 4MELA 4KSLC 4JLCA 4KZCA 4IM2A 2ZNVC 3QA8A 2KDBA 4FHJA 5C1ZA 3ML9A 3QIJA 4XX5A 5CX3A 1TGZB 4EKUA 3TMPB 5JHAA 1GUAB 2LI5A 1E7UA 1WE7A 2BWES 3K9PB 3VUWA 3ZKJC 4BVUC 2C60A 4BKSD 1WJUA 2N1VA 2NBWB 4I6NB 4BKSA 2D07B 2AYOB 3V61A 1V80A 2MBQA 4JIOU 4KVGB 1J8CA 2BKRB 1XT9B 3X23A 1TBEA 2UWQA 5J18A 2KDFB 1D3ZA 2LVOA 4XC2A 3PVLA 2CKHB 4GDLB 2OJRA 2G4SA 5DPSA 5LXHA 3L16A 2G45B 1H8CA 4MGKE 5D7GA 2KJHB 1KOTA 5J2RA 4GGQA 4HCPB 3NZUA 3ZNGC 4AOFA 4W9CA 3PRZA 2KD0A 2KTRB 3QX1A 2IZVB 3I3TB 3U7DA 4DWFA 4MEMA 2BWFA 2MP2B 3B08A 5DPTA 3B0AA 3OJ3A 4MSMB 2BGFA 1C1YB 3UINB 3ZTCA 2O6VD 4GU2A 3X0WA 5AZGA 2XK5B 2JRIB 3ZNID 1SIFA 2Z0EB 3QC8B 4K7SA 1PQSA 1YQBA 2D11A 1IPGA 4F7ZA 1WRDB 3SDLC 2NPTA 5C23A 3IBEA 2R2OA 2M4NA 2FCQA
chains in the Genus database with same CATH superfamily
1UD7A 1R4MI 3NY5A 3ZXVA 2I2YA 3V3XA 1NBFC 3IHPC 2WDTB 1ZOYB 2QJLA 2AQ1B 3CSFA 2K3UA 3ZXRA 3FKYA 1TTNA 5IA7A 3N1XC 3Q2AC 3VRAB 1AWDA 2BF8B 4FBJB 2RSUA 4HDOA 3HVZA 1C77A 1XF5L 3LDZE 1ZW7A 3Q8EA 1K51A 5L95C 1FEHA 2RDGA 2BS4B 1F2RI 2MA9B 3M63B 3U30A 3RNAC 3RNEC 4IM3A 3AMZA 2KACA 4WAAA 2W54A 1ZE3D 2V4IB 4CHKA 1Q5WB 3CSTA 3B2GA 3JSVB 3ZNHB 1EWCA 4RNAA 2K9XA 4IG7B 3ZW3A 5L83A 3H6NA 3CWIA 2MBBB 2REXA 2LRWA 1FRRA 1MI0A 2HE7A 1L2NA 4E74A 1TYGB 3OAWA 2KWCA 1RFAA 2SEBD 4BOZB 3UIPB 2L7RA 2MSED 5JH5C 3Q3FA 3UF8A 1ZP0B 3JSVA 2W55A 2NPTB 1FFVA 4JPSA 1QT9A 3RD2A 4NAMA 1QOBA 3R7QA 1OEYJ 3RN9C 4JQWC 1V8CA 3RCZA 3GP7A 3M62B 1C3TA 2BS3B 2RR9A 1ZGUB 4IKGA 4RF1A 1FXIA 2KOXA 2MW5A 1NI2A 4MDKE 4EZLA 3N20C 2Q5WD 3N32A 3L13A 4KKIA 3MHZA 2OHFA 3SD5A 3MC9A 2WXPA 2RDHA 1F52A 5IAAC 1IBXB 1N61A 2AL3A 1FO4A 1E8XA 2JUOA 5LXIB 3ALBA 4HK2A 3PTFC 2JXXA 2KNBA 3Q6BA 1OQRA 3MJWA 3W5UB 3VFKA 1Q1OA 1PGBA 4W9FA 5GMVA 2ZCBA 2W9NA 2KANA 3PV1A 2L3ZA 2B76B 3SU8X 2L83A 4W9JA 3Q69A 3PREA 2DWQA 2BYFA 1S3SG 2I1JA 2JPHA 1CQVA 3GZNB 5G5HA 1TT5B 1IBXA 1F9JA 1P98A 1FM0D 2Z59B 1JRUA 1SE4A 3H8HA 3H9DA 1Y8RC 2WXFA 3IT6B 2LZ6A 1IUEA 5C3JB 3U4EG 1T0RC 2QDFA 2LXCA 4ACFA 1FFUA 4RM8A 1TS3A 4TKNA 1AYFA 2KFKA 3N9YC 2VH2A 2V0GA 4MGYE 3DVNV 3PHWB 2CS4A 1SXTA 1HE8A 1EUVB 2KAJA 4ZRJA 3U7ZA 2O2VB 1E10A 1CJEA 3V6EB 1MG4A 1SIJA 1L4DB 3AEAB 2XN9C 1ZUD2 3R2TA 3AECB 4W9DA 3WCQA 2RDBC 4DQOC 4F8CB 3ZIMA 3Q3OC 4HPPA 1I4PA 4YT0B 4F1SA 3ABVB 4HLEA 1V81A 4K81A 2DAFA 1PGAA 3W1SC 1L0VB 3CMMB 1VZ8A 1UF0A 1WJ4A 1T5XD 2BT6A 4WQOB 4A3OA 1MVKA 2V3PA 2HD5B 1ISNA 1CZPA 2EMSA 2JZZA 3DBHB 2KDIA 1VLBA 2DZMA 1YNTE 3U2SC 2IO3B 3VR8B 3T3NA 3M95A 2N9XA 4W9EA 2DENB 3GOEA 4IWQA 4FJYA 2IO1B 1BT0A 1J7BA 4XGAB 5HKHA 1V2YA 3MJ5A 4Q2JA 1P1AA 1SJED 4OVVA 4OVUA 2FUHB 2Z8LA 2MCNB 2GBRA 3KQ4A 2KQSA 2NTSA 2WYQA 4RGNA 3A9JB 1GB1A 2ASQA 4N58A 4PS8A 3RFZB 4K1RB 3AN1A 3TEXA 1NVID 1JWMD 3N30A 3CF6E 1YQ3B 3PT2B 1HTOA 1WGGA 3RI7C 4M01A 2M19A 4ICUA 4WJNA 4N9F4 3GE3C 4LLGM 1IYFA 2I1KA 2CHWA 4YSXB 1J19A 2NS5A 4MH8A 4HJKA 3ZDTA 3AU4A 4HPLB 2ZVNA 4GDKA 3TUOA 3AEGB 2MWSB 4TV3A 4IM0A 2EKEC 1X1MA 1OQQA 1P7FA 1CK1A 3QCAA 3A9JA 1E6EB 3UIOB 3IFWB 5I4DA 1YX6B 2LGXA 1LO5D 1YMHE 3OG5A 1IGCA 2MBOA 5AUIA 1GC7A 2K22A 2XNAC 1TZ1A 4K3CA 2GBNA 1YJJA 4IM2A 2RPVA 3IAM1 5HG2A 4XX5A 3TMPB 1QOGA 1JCKB 1GUAB 1WE7A 4KGSA 3ZKJC 4BKSD 1C4CA 1V80A 4JIOU 4KVGB 5H92C 1XLPA 2D3CA 1TY0A 2KDFB 1I7HA 2LJIA 2LVOA 3SFEB 2OJRA 5JXVA 5D7GA 2KJHB 1GOZA 3P42A 4GGQA 4W9CA 4A6QA 2KD0A 4WURA 3QX1A 3U7DA 1NYQA 2MEKA 2MP2B 3KWLA 4US9A 2BGFA 3UINB 5LNK1 1DOYA 2KWDA 5FK9C 1YQBA 4F7ZA 3P1MA 2R2OA 2FCQA 2OEDA 4JX1C 1XCQL 4R3DA 3RNBC 2L00B 4DHZB 2CHXA 5CHWA 2BYVE 4L2YA 5FR3A 3WA0A 2EMTA 2BPSA 4HKZE 4KZ0A 4WIPA 2KQ7A 2WXOA 4MGIE 1RYJA 2JY6A 3Q8AA 4E71A 2MP2A 5EE0A 2KMAA 1FRDA 2MHJA 4MJSB 5CHFA 4J6IA 2KJRA 1R4NI 1QKZA 3BZDB 1L6UA 4M00A 2CHZA 1PDXA 2WNMA 2J4XA 4M8MA 1Y56A 1SJHD 2QCZA 4GOCA 2MJDA 3FAHA 4BFRA 1E0ZA 2EKIA 2BBCA 1BMLC 3NZSA 1IP9A 4USAA 1DGJA 1HXYD 1V1PB 2DYOA 5KHOA 3AE8B 4YTMB 2IGDA 3R3MA 1FD6A 1WXAA 4MACA 4WWNA 3I5JC 4ZHPA 3Q8BA 2GBKA 2K0PA 4MJSA 2LHDA 4TMAB 1JRPA 2HTHA 2WXNA 5BYSA 1HZ5A 1WYWB 1L0YB 1RM6C 1YX5B 3RT3B 2V1YA 3R2IA 5E6OA 3EECA 1I35A 3TSSA 4HRSA 3H1UA 2FE8A 2MRPA 3APCA 3DBHI 2BB5A 2IGGA 4O1NA 1WXVA 1F0ZA 5LLIA 2L0FA 2M0AA 4HWIB 3RMKC 1P0RA 2KC2A 4NZLB 2IPKD 3ZNZB 5KHQA 3A4SC 2OJWA 2ACZB 3D32A 3DHIC 4W9GA 3DDCB 2WLBA 2HDEA 1K53A 1ZDVA 1E7PB 2WXJA 3QHTA 4UDUC 3VH4B 2MX2A 2H88B 1WIAA 2DZIA 3VHTC 3NS1A 2MQJA 2WDVB 1T0SC 1WXQA 1PUTA 2KLCA 2IDYA 4YSYB 1WGHA 1ZXHA 2LFIA 1N60A 3FILA 3Q14C 2Y5BB 4LJOB 3L54A 3CIRB 3QJZA 3TJPA 4B6WA 3L08A 3QAQA 4TQ1A 3VUYA 3UGBB 1H4RA 2KWVB 2K5PA 4RFBA 3BVZA 1YN3A 1KF6B 3SEBA 2ZPNA 3BY4B 4I6LB 3AB5A 2NR2A 2WXLA 2JZ3B 3V6CB 3MC0B 4DXFA 1C9FA 3ZJUA 1KLGD 2ZCCA 3W9CB 2N7JA 4G11A 1UBIA 3DHHC 3DVGY 3EC8A 4ARIA 3NUHB 3WAOA 4K7UA 4KDIC 4C4VB 1AN8A 1I42A 3KLSX 3DVGX 2PKOA 1TS4A 4DBGA 5D2MB 4LDTB 1FNWA 1UELA 5G55A 1RFKA 2WQYB 1T0YA 1MG8A 2LRUA 2N7EA 1FNUA 3RNFC 1E7VA 1IGDA 2NTTA 2WXIA 2MH7A 3B1LX 1EU3A 3EA6A 1L5PA 5BYQA 3P63A 2FUG1 1MJDA 4QAYA 2DLBA 4C4VA 4DHZE 3SFDB 4ANWA 1RRBA 2ICIA 2DBYA 1T0QC 2KLGA 3MFGA 1V5TA 4PS7A 4C00A 3HM6X 4MT5A 3LB8C 2K6DB 4ZRQA 1EWYC 1T3QA 3ML8A 2AQ2B 4YL8A 1HTQA 1TKYA 2DX5B 3GB1A 1QOFA 3M3JA 4K3BA 4HEA1 5JHBA 2R61A 1OQYA 1V49A 3P4PB 1Z2MA 2RPQA 1MFWA 1GAQB 2EELA 2LGYA 3V62A 1V5OA 4LTUA 2G1EA 2KN5A 2BS2B 5EDSA 4IC7B 1NDDA 2M17A 2L0TA 4C7YA 3KWVA 3BK1A 1WM2A 2GOWA 3KUZA 2LEKA 3ZJTA 3B2FA 3B9JA 3U8ZA 4ASWC 1PFDA 5E6JA 4A20A 2INNE 2WX1A 4GB9A 4KKJA 1JWSD 4I6PA 4II3B 4BBNF 1WX8A 3HM3A 3AE9B 4OZCA 4GIVA 2XEWA 3V60A 4YXDB 1JROA 2J42A 1RLFA 2KC1A 2QIEB 1WZ0A 2PJHA 4KDLB 2L8JA 4MM3B 2HJ1A 2K1FA 4W9IA 2JQRB 5IO9A 3NVVA 3AEBB 4W9HA 3DBSA 2ZVOA 2N9EB 4EFOA 1YN5A 3UI3A 1LFDA 1NENB 1QQRA 3E56A 3QQ8B 2MJ3A 4WJPA 3I63C 4KV2A 3U52E 5AUKA 3HVDA 3QK0A 3S2AA 4II2B 4J3OD 3R8BA 4MM3A 3VRBB 2KFKB 4FADA 2K6QA 2FIDA 2UU7A 5AZFA 4CO7A 3VR9B 2WU5B 1L4ZB 4FULA 1N6ZA 3AE1B 3GS2A 4AJWA 1SEBD 2H89B 3Q3MC 4WJOA 2PPHA 4OVZA 2V4LA 2KJ6A 3R7RA 3P2BA 2DZKA 2PW9A 1C78A 2IO2B 3PZ8A 2WXRA 4ZRKA 5IOIA 2BQQA 2PVOD 5CHVC 1LM8B 1E90A 3WAMA 3PGEA 4FHKA 4G3XB 1ZDXA 3PRMB 1R4NB 2JU6X 4C80A 3AE2B 4MELA 4KSLC 5EE3A 3NRZA 3BK2A 4YTPB 5C1ZA 3AEEB 4M02A 1E7UA 4BVUC 2VH1A 1V97A 5BYRA 2YEPB 2D07B 5BMHA 2AYOB 3X23A 1TS5A 5J18A 2JSVX 1KFYB 3W5VB 4XC2A 2CKHB 4RF0A 5LXHA 1H8CA 2G45B 2M56B 3DWGC 3RNCC 5J2RA 3NZUA 4AOFA 1FCLA 3I3TB 5T8IA 3B0AA 2AX5A 3ZTCA 2PIAA 4BZAA 1SIFA 3EGRA 2Z0EB 4K7SA 1JALA 1ET6A 4L1BA 2D11A 3AE6B 5GXGB 4S17A 1F2RC 4AP4C 4HPMB 2WU2B 4RH6A 4ZRIA 4WWPA 1HEZE 1WGKA 2AQ3B 1J7CA 2LGDA 3AV8A 1V6EA 1N5XA 1OGWA 2CU1A 4GDKB 3OLMD 2KX3A 1TKGA 3FC4A 4LNFA 2LD9A 4G0NB 3KVFB 4WAFA 1C4AA 2NBVB 1FCCC 2C7MB 2IGHA 3HK0A 1ZPSA 4DDID 5G2NA 1FIQA 3ZUNA 3A33B 2XBBC 2G3QB 1N63A 3W2DA 1XEEA 1SGHA 1SB3C 3ETRA 1ZKHA 2HTME 2K8HA 1ENFA 3J9CA 1E8ZA 1UH6A 1F1HA 3APFA 1UZXB 4IUMB 4NJCA 1JQ4A 3PZ7A 1DOXA 2KYWA 3RUIB 1WI0A 4OZBA 1FXAA 2JWZA 4BAXA 2AL6A 4GXBA 4JL9A 2BTEA 4FLHA 4LDTD 1E8WA 3T3OA 3DOWA 4EEWA 4P1BC 2ZJDA 3A4RA 3VQIA 4A55A 2FCSA 2V3SA 1XLOA 3ZRFA 3DPDA 4ZYNA 3KUDB 4AWJA 1RWSA 2WXHA 3L17A 1C4PA 4AUQC 2NMQA 3ZLZA 3PPAA 1LXDA 1BXTA 2FBWB 2IY0B 1QILA 2OOBB 1TIFA 2YEPF 2JF5A 1UUPA 3NVWA 3KYDD 4IWPA 4A90A 2DNFA 1D6EC 3NHEB 5HI1A 3VXWA 2PVGC 1FXTB 2B3AA 2LMCA 2G4DB 1J7AA 1LGRA 5FR6A 2V3NA 4LJPB 1WGYA 3BWUD 1D5XC 4KGRA 2KDMA 4K7WA 2WHIA 1WGDA 3P4SB 4AQ7A 2UYZB 3V05A 3PLUA 3TBLD 3AE3B 4WWMA 4DHJB 1QOAA 2KX0A 2M1MA 3AH7A 1HQRD 4IDIA 2MBHA 2E3TA 4WJQA 1TS2A 4M8NA 2N4FA 1PYWD 4BBNC 1QF6A 3N1YC 2D2QA 3TEWA 2M0XA 5FKAC 2JXTA 2IYDB 2MLBA 1GJZA 4A8XC 2J0MA 2GLSA 2N9PC 4B9KA 1Z5SB 2GBMA 1I4XA 2KTFA 2BKFA 5BO4B 2L05A 3RYTA 2JWUA 2WS3B 3LYYA 5J17A 4NY0A 1WH3A 1WJNA 2INCC 4TSSA 3L4PA 1GG3A 2KO3A 2KN4A 1WYGA 1WMHB 2LHEA 4L23A 1TY2A 2R2QA 2WX0A 5D3IB 2D3AA 4BKGA 2BYEA 2DAJA 2N1WA 4ANUA 3AULA 3OJ4B 4KX6B 1UGMA 4EZKA 4LCDE 3RZWC 1D5ZC 4XE0A 1WSPA 1XLNA 3FILB 1YIWA 1U4AA 2LXAA 2LUMA 4RGTA 1I4QA 2E6XA 2W3SA 4IWOA 1TJEA 1SE3A 1R7SA 1VR9A 4P1CC 2KXJA 1WMHA 2A5UA 2K8CA 1ET9A 3TCAA 1E5WA 2ON8A 1MPEA 1JW9D 3KW5B 4NPNA 3DBLB 3O65B 3IG3A 1WWTA 2QHOA 2YLMA 4LNNA 4REZA 2N7DA 3EFCA 1KLVA 3WAPA 1WR6E 1V1OA 4N6EB 5EE1A 4EE2A 3UQAA 3N1ZC 3BVGA 3KUCB 4PYUA 2V9HA 5DCNA 3Q3NC 1WF9A 1M94A 3PO0A 1ROEA 1G6JA 1ESFA 2M8SA 1XO3A 1AARA 2WDQB 5HFYA 4B0MA 3ZJVA 4M0WB 2D10A 2FNJB 4PYZA 1WZ3A 5E6NA 3SHQA 3ZRCA 1ZXIA 3KYCD 2KHWB 2JYTA 3AXCA 4NNJB 2PEAA 1GC6A 1JWUD 3VTVA 1UBQA 2KTRA 3L10B 2W3RA 1L6VA 4IW0A 4B95A 3BYTB 3R66C 5CTRC 2ZNVB 2KWUB 2IBIB 1XD3B 3APDA 2WGSA 2XK5A 2MJEA 4M0WA 2IO0B 3E9SA 1OTRB 4XDDA 1JWBD 2Y5CA 3Q8FA 2INPE 2ONQA 2QILA 2GBJA 1XCTL 1SE9A 2QC8A 1E8YA 5G5GA 3RZFA 5TSSA 2LVQA 2QSDA 4RGOS 4TUUA 1WX7A 4HKQA 4ANVA 1C76A 1KLUD 5E6PA 2CJOA 3RPFC 1GPXA 3T9LA 1EF5A 5DPWA 2K39A 1B1ZA 2QMTA 4FA6A 4HDQA 4GN1A 2GI9A 2ZPYA 3RULA 1UWMA 1L0XB 4JLCA 1SBBB 1D5MC 2N9LA 3QA8A 1NEKB 2G9HD 3ML9A 4EKUA 1TGZB 5JHAA 2PLPA 2LI5A 3AE5B 3K9PB 3ZGZA 3LXFA 1WJUA 3C19A 2NBWB 4BKSA 4S0RA 1J8CA 2BKRB 2WP9B 1XT9B 1TBEA 1OFFA 3OWEB 1D3ZA 3TEZA 4ZHOA 1EU4A 3PVLA 4GDLB 2WXQA 4MGKE 1UWXA 1KOTA 3ZNGC 4MEMA 3B08A 3OJ3A 4RGMA 4JWSC 2SAKA 3ZNID 3URYA 3QC8B 1PQSA 4FXCA 5MPOA 3SDLC 2NPTA 4IOIE 3IBEA 2M4NA 2KQ4X 2C7HA 4FJVB 1YD8U 2ZZPB 3VTWA 4W9LA 1V86A 3NZ3A 4GDLA 3Q8CA 2JYEA 2BYTA 2GB1A 4MSQB 1KJTA 2D3GA 2Y5PA 5DPRA 5AZHA 3DBRI 1VD2A 1K50A 1XXGA 1JMLA 3JVZX 3P4RB 3VAWA 3KH0A 3HRDD 3H7PB 3BIID 2WXMA 4WH4A 2FIFA 1D4BA 3DBLI 3PSEB 1EF1A 1I4RA 2PE6B 3NJTA 4DHJD 4ANXA 2C5LC 2VZKB 3LJ3A 3AEDB 3QARA 2WXKA 1Q0WB 2N0SB 4C7ZA 4YTNB 2AWTA 1B9RA 4NAWB 2LGIA 1TKEA 2IY1B 2RMMA 4NJ6A 4XWTA 1VDVA 1V9JA 4DXAB 2DHZA 2X38A 1WX9A 4LNOA 5HHDG 3VDZA 1PGXA 3WALA 3BYYB 5C2TB 1YJIA 3H7PA 1ACCA 2LWPA 3NG0A 2WDRB 4MGZE 2Y3AA 5BMIA 2J53A 2LGSA 1KTKA 3JYUA 2O6VB 1QZEA 3VH3B 4N59A 3ZVVA 3H7SA 3ENEA 2L1AA 4JWUC 3TEYA 4NAWA 3C0RB 2KVZA 3AM9A 4OHJA 3WIMA 4ITKA 1SSNA 2LVPA 3GE8C 1UNSA 3PHXB 2D5GA 3MHSD 1UGJA 2ZW0A 3L0WB 2CR5A 2J7QB 1P9DU 2O6VA 3IXSA 4GSWA 1VRAB 1L7YA 4ARCA 1J0GA 3SR6A 1I4GA 2L52A 3JW0X 3TL5A 3VTUA 1KM7A 2O2VA 3A9KB 4HROA 2J0JA 3EFUA 2RD0A 3NVYA 3NS8A 1K8RB 1SE2A 2PE9A 2N9KA 4KIKB 2KFJA 2HJ8A 5IKCM 3PRPB 2WWZA 3P4QB 1HA5A 1JWAD 1WR1A 4AS1A 4D2KA 1MHXA 2GMIC 1CMXB 4PK1A 4NQKE 1P3QU 3HIZA 2KK8A 3RNGC 3AEFB 3MTNB 1A70A 2BW2A 1YQ4B 3NVZA 4FJZA 2D3BA 3DVNU 3A9KA 4HJGE 2JZPA 2KMMA 3AE4B 3ZQ4A 1FNVA 1KH0A 4ZYSA 2CU3A 4H2AA 4XWWA 3HHMA 4KIKA 3BVMA 1VZ7A 4A9AA 4ICVA 3EUB2 5EE9A 3VUXA 1WM3A 3WANA 2NVUI 4KSKC 3I57A 4GLSC 3ZTDA 3EHVA 2IJ0A 2FCMA 1GB4A 4CQNA 1RAXA 4E3CA 4FN2A 2A4ZA 4JGHB 1P7EA 5JZEB 4BKTA 3N3KB 2NBUA 1R4MB 4OZAA 4HCNB 4XZ4A 2JX5A 3AE7B 1WY8A 4GMVA 3NOBA 2AEHA 1EO6A 5BMGA 2L76A 1QLBB 1GNUA 2QEJC 4WQMA 3PZDA 2KVRA 4LNIA 3AU5A 1WXSA 4BOSC 1DOIA 3DQVA 4LK0M 2C9WB 3UQBA 3A1QB 4EZJA 4CYEA 2LASA 1YJ1A 2DYBA 5D94A 3W1SA 4US8A 1VCBA 3ONSA 4LNKA 2BVCA 2DYMA 2J52A 1Q10A 1VJKA 3IVFA 1STEA 3DWMA 2KMCA 2C7NB 2I38A 4XDCA 4PS3A 3T8MA 1WE6A 2K8BA 2PTLA 3A1QA 4EOYA 4RCOA 2ZEQA 1SF0A 1NYRA 1YN4A 4RM9A 4YSZB 2FCNA 1TZOA 3GZNI 1NI3A 2KT7A 4G50A 4W9KA 2DZJA 2PMVA 4X57B 4C56C 2GRIA 4XYCA 4WWOA 1AW7A 4P7IA 4MH0E 1F77A 4DDGD 1C79A 4EUTA 3W1YA 5H8YE 2W82A 2JRHA 4P6VF 2CJNA 2X8XX 1EM7A 3K9OB 3O13A 4ZRPA 1A5RA 1VZ6A 1HZ6A 1N62A 4HXDA 1OEYA 3IAS1 1WXMA 3DHGC 4URKA 2K25A 5AEKB 1YOVB 3BINA 4ZDVA 2KZRA 3TIXA 2VRRB 1XQQA 1LQBA 2YVCA 2KDEB 2BB6A 2LJ5A 5D6JB 3ZYYX 3IT4B 1WGRA 4P16A 5IN7A 4A3PA 4ZOHC 4NJ7A 2J0KA 1MHHE 2KKCA 3PLVA 3VVWB 4DK5A 1I4HA 3C8YA 1WJ6A 2L32A 2ZW1A 3AI5A 3ECIA 1S1QB 4PT5A 1M4VA 3Q3JA 1WFYA 4NQLB 3I9V1 3MP9A 4HVBA 2MBEA 3HUIA 3DCGA 3ZDMC 4TQ0A 2JT4B 3PS6A 2RGFA 3QWZB 2Z0DB 5TR5A 2JVCA 2NCNA 1K52A 2FAZA 2LUEA 4AJYB 4RMAA 5D3DA 3ZO5B 3DBRB 1WRIA 4KZCA 2TSSA 2ZNVC 4FHJA 1FMAD 2KDBA 4JE3B 3QIJA 5CX3A 1V1PA 2VZKD 2BWES 3VUWA 4OW0A 2C60A 2N1VA 2WXGA 4I6NB 3V61A 1XLQA 2MBQA 2UWQA 1T6BX 2G4SA 1KRHA 5DPSA 3L16A 4B0EA 1N5WA 4HCPB 2INDC 3PRZA 2KTRB 4DWFA 2IZVB 1FPYA 2BWFA 1BUIC 5DPTA 3MC8A 4DXGA 4MSMB 1C1YB 1DYQA 2O6VD 4GU2A 3X0WA 5AZGA 2XK5B 2JRIB 1E9MA 4KGTA 1IPGA 5IP4D 1WRDB 4YWGG 5C23A
chains in the Genus database with same CATH topology
2C7HA 4AP4C 1UD7A 1R4MI 4FJVB 3NY5A 1YD8U 4HPMB 2L00B 2ZZPB 3VTWA 4DHZB 1NBFC 4W9LA 4ZRIA 2CHXA 3IHPC 4WWPA 5CHWA 1V86A 4GDLA 2BYVE 2WDTB 2LGDA 3WA0A 3CSFA 2EMTA 5IA7A 1TTNA 2BPSA 1V6EA 4KZ0A 2KQ7A 4MGIE 1OGWA 2CU1A 2JY6A 4GDKB 3OLMD 4E71A 2KX3A 2MP2A 4MSQB 2BF8B 4FBJB 2RSUA 1KJTA 4HDOA 2KMAA 2LD9A 2D3GA 4G0NB 3KVFB 4MJSB 3LDZE 5CHFA 1ZW7A 4J6IA 2KJRA 1R4NI 5DPRA 5L95C 2NBVB 2C7MB 5AZHA 3DBRI 2CHZA 2MA9B 4M8MA 3HK0A 3M63B 1VD2A 3U30A 4GOCA 4DDID 5G2NA 3JVZX 4IM3A 3ZUNA 3VAWA 3A33B 2XBBC 3KH0A 2G3QB 3H7PB 4BFRA 4WAAA 2FIFA 3DBLI 1SGHA 3PSEB 1EF1A 4CHKA 3NZSA 2PE6B 1ZKHA 1Q5WB 2K8HA 3CSTA 1IP9A 4DHJD 2DYOA 4ANXA 2C5LC 5KHOA 1E8ZA 3QARA 3LJ3A 3R3MA 1UH6A 1Q0WB 1WXAA 4WWNA 3APFA 3JSVB 2AWTA 1UZXB 2GBKA 4IUMB 4MJSA 3ZNHB 4NAWB 4IG7B 2IY1B 3RUIB 1WI0A 3ZW3A 5L83A 2JWZA 2HTHA 4NJ6A 1WYWB 3H6NA 1V9JA 1YX5B 2MBBB 3RT3B 4DXAB 2REXA 2V1YA 2DHZA 2AL6A 2LRWA 4GXBA 4JL9A 5E6OA 1WX9A 3EECA 1I35A 3VDZA 3WALA 4FLHA 4LDTD 1E8WA 2HE7A 3H7PA 3H1UA 3DOWA 2LWPA 1L2NA 2MRPA 3APCA 2ZJDA 4E74A 4MGZE 3DBHI 3A4RA 3OAWA 4EEWA 2KWCA 3VQIA 1RFAA 1WXVA 2FCSA 2V3SA 3ZRFA 5LLIA 4BOZB 3UIPB 2L0FA 3JYUA 4HWIB 3DPDA 2O6VB 1QZEA 3VH3B 2L7RA 3ZVVA 2MSED 1P0RA 3H7SA 3ENEA 2KC2A 3Q3FA 4ZYNA 5JH5C 3KUDB 3UF8A 3JSVA 4AWJA 2NPTB 4NAWA 3C0RB 3WIMA 3RD2A 3ZNZB 5KHQA 3L17A 3A4SC 3R7QA 4AUQC 3D32A 2LVPA 1OEYJ 3ZLZA 3PHXB 3PPAA 1LXDA 4W9GA 3DDCB 4JQWC 3RCZA 3M62B 1C3TA 2IY0B 3QHTA 3VH4B 2RR9A 2OOBB 3MHSD 1ZGUB 2MX2A 1WIAA 2DZIA 3VHTC 2MQJA 3L0WB 2CR5A 2KLCA 2J7QB 1WGHA 2JF5A 2KOXA 3KYDD 2MW5A 4IWPA 1NI2A 1P9DU 2O6VA 2Y5BB 4GSWA 4LJOB 3NHEB 3VXWA 1L7YA 1FXTB 4MDKE 3L54A 2B3AA 1J0GA 4EZLA 3QJZA 2G4DB 3JW0X 5FR6A 3TJPA 3TL5A 3L08A 4B6WA 3QAQA 3VTUA 1KM7A 2O2VA 3A9KB 4LJPB 4TQ1A 3VUYA 1WGYA 2J0JA 3EFUA 2RD0A 3N32A 3NS8A 1K8RB 2PE9A 3UGBB 4K7WA 3L13A 1H4RA 4KIKB 2KWVB 1WGDA 2KFJA 3SD5A 2UYZB 3PLUA 2HJ8A 2ZPNA 3BY4B 3PRPB 4I6LB 3TBLD 2WWZA 4DHJB 2NR2A 2KX0A 2M1MA 1WR1A 2GMIC 1CMXB 5IAAC 2JZ3B 2AL3A 1E8XA 3V6CB 4NQKE 1P3QU 2ZCCA 2JUOA 3HIZA 2KK8A 5LXIB 2MBHA 4WJQA 3ALBA 1UBIA 3DVGY 4G11A 3EC8A 4HK2A 3PTFC 2JXXA 2KNBA 4M8NA 3WAOA 2N4FA 4K7UA 3MTNB 4KDIC 3MJWA 4BBNC 1I42A 2D2QA 3DVGX 4FJZA 2M0XA 3DVNU 2IYDB 2MLBA 3A9KA 3VFKA 1Q1OA 4DBGA 5D2MB 4W9FA 1GJZA 2J0MA 5GMVA 2N9PC 4LDTB 1Z5SB 2W9NA 2ZCBA 2KANA 3PV1A 1UELA 2GBMA 2L3ZA 3HHMA 2KTFA 4KIKA 5G55A 3SU8X 2BKFA 4ICVA 5BO4B 4W9JA 1T0YA 1MG8A 2LRUA 3PREA 2N7EA 3VUXA 1E7VA 2L05A 1WM3A 2BYFA 1S3SG 3WANA 3RYTA 2NVUI 4KSKC 2I1JA 2JPHA 3ZTDA 3B1LX 5J17A 4NY0A 3EHVA 2FCMA 1F9JA 1P98A 1WH3A 1WJNA 1GG3A 2KO3A 2Z59B 1RAXA 4E3CA 4FN2A 2A4ZA 4JGHB 1WMHB 5JZEB 4BKTA 4DHZE 3N3KB 2NBUA 1JRUA 4HCNB 4XZ4A 4ANWA 1RRBA 2R2QA 1WY8A 3H9DA 1Y8RC 2WX0A 2LZ6A 4GMVA 3NOBA 2AEHA 4BKGA 1EO6A 2BYEA 2DAJA 2KLGA 2N1WA 4ANUA 1V5TA 3AULA 3OJ4B 2L76A 2LXCA 4PS7A 3HM6X 4RM8A 1GNUA 1UGMA 4EZKA 3PZDA 2K6DB 2KVRA 4LCDE 3RZWC 3ML8A 4TKNA 3AU5A 2KFKA 1WXSA 4YL8A 4MGYE 2DX5B 1YIWA 3DVNV 1U4AA 4BOSC 2LXAA 3PHWB 3DQVA 3M3JA 5JHBA 2CS4A 4IWOA 2C9WB 3UQBA 1HE8A 1EUVB 4ZRJA 3A1QB 2O2VB 1OQYA 1V49A 2KXJA 4EZJA 1Z2MA 1WMHA 3V6EB 2LASA 2A5UA 4CYEA 2K8CA 2RPQA 3TCAA 1YJ1A 2DYBA 5D94A 3W1SA 1E5WA 2LGYA 3V62A 1V5OA 1VCBA 2KN5A 3ONSA 5EDSA 4W9DA 3KW5B 4IC7B 4NPNA 3O65B 3IG3A 1NDDA 4F8CB 3ZIMA 2DYMA 2QHOA 2YLMA 2M17A 3IVFA 2N7DA 4F1SA 2L0TA 4HLEA 1V81A 4K81A 2DAFA 1KLVA 3WAPA 1WM2A 2GOWA 1WR6E 3KUZA 2KMCA 2C7NB 4ASWC 3U8ZA 3W1SC 4PS3A 3T8MA 3CMMB 3UQAA 4A20A 1WJ4A 1WE6A 2WX1A 2K8BA 4GB9A 3A1QA 4I6PA 4II3B 4BBNF 4EOYA 1WX8A 3HM3A 3KUCB 4PYUA 4GIVA 5DCNA 2ZEQA 2XEWA 4WQOB 3V60A 4A3OA 1RLFA 2KC1A 4RM9A 1WF9A 1WZ0A 2PJHA 2L8JA 2HD5B 4KDLB 1ISNA 1M94A 2FCNA 3GZNI 1G6JA 2K1FA 4W9IA 2EMSA 2JZZA 4G50A 2M8SA 4W9KA 2DZJA 4X57B 2KDIA 1AARA 2DZMA 4WWOA 4P7IA 4W9HA 4MH0E 3DBSA 4M0WB 2ZVOA 2D10A 2FNJB 4DDGD 4PYZA 1WZ3A 2N9EB 2IO3B 5E6NA 4EFOA 3SHQA 3ZRCA 4EUTA 3KYCD 3W1YA 1LFDA 2JRHA 3M95A 2KHWB 2N9XA 3AXCA 3K9OB 4NNJB 4W9EA 2DENB 3GOEA 4IWQA 4FJYA 2PEAA 2IO1B 3QQ8B 1BT0A 5HKHA 4WJPA 1V2YA 1GC6A 3VTVA 1A5RA 1UBQA 4KV2A 2KTRA 4HXDA 3L10B 1P1AA 4OVVA 4OVUA 3QK0A 2FUHB 3S2AA 1OEYA 4II2B 4IW0A 4B95A 2MCNB 2GBRA 3R66C 5CTRC 2KQSA 2ZNVB 2KWUB 1WXMA 2IBIB 4MM3A 4URKA 2WYQA 2K25A 1XD3B 3A9JB 2ASQA 5AEKB 3BINA 4PS8A 3APDA 4ZDVA 2KZRA 2KFKB 2K6QA 2VRRB 2XK5A 3TIXA 4K1RB 1XQQA 4FADA 1LQBA 3N30A 3CF6E 3PT2B 2FIDA 2YVCA 2KDEB 5AZFA 2LJ5A 1WGGA 5D6JB 1WGRA 4CO7A 2IO0B 4A3PA 1OTRB 4ICUA 4WJNA 4FULA 4N9F4 4NJ7A 4B9KA 2J0KA 2KKCA 3PLVA 3VVWB 4DK5A 1IYFA 2I1KA 2CHWA 4AJWA 1WJ6A 1J19A 2NS5A 4HJKA 3ZDTA 3AU4A 3AI5A 2GBJA 4HPLB 4WJOA 3ECIA 1S1QB 1SE9A 2ZVNA 4GDKA 1E8YA 3Q3JA 2PPHA 3RZFA 2MWSB 4TV3A 2LVQA 4IM0A 4TUUA 2EKEC 1WFYA 2V4LA 1X1MA 2KJ6A 3R7RA 3P2BA 1WX7A 4NQLB 2DZKA 4ANVA 5E6PA 3QCAA 4HVBA 2IO2B 3A9JA 2MBEA 3T9LA 1EF5A 3UIOB 4ZRKA 3IFWB 5DPWA 3DCGA 2K39A 5CHVC 1LM8B 3ZDMC 4TQ0A 2JT4B 1E90A 3PS6A 2RGFA 3QWZB 2Z0DB 5TR5A 3WAMA 1YX6B 2JVCA 2LGXA 3PGEA 2NCNA 4FHKA 4G3XB 2FAZA 2MBOA 3PRMB 2LUEA 4FA6A 4AJYB 1GC7A 4RMAA 4HDQA 4GN1A 1TZ1A 3ZO5B 2ZPYA 3RULA 2GBNA 4MELA 4KSLC 4JLCA 4KZCA 4IM2A 2ZNVC 3QA8A 2KDBA 4FHJA 5C1ZA 3ML9A 3QIJA 4XX5A 5CX3A 1TGZB 4EKUA 3TMPB 5JHAA 1GUAB 2LI5A 1E7UA 1WE7A 2BWES 3K9PB 3VUWA 3ZKJC 4BVUC 2C60A 4BKSD 1WJUA 2N1VA 2NBWB 4I6NB 4BKSA 2D07B 2AYOB 3V61A 1V80A 2MBQA 4JIOU 4KVGB 1J8CA 2BKRB 1XT9B 3X23A 1TBEA 2UWQA 5J18A 2KDFB 1D3ZA 2LVOA 4XC2A 3PVLA 2CKHB 4GDLB 2OJRA 2G4SA 5DPSA 5LXHA 3L16A 2G45B 1H8CA 4MGKE 5D7GA 2KJHB 1KOTA 5J2RA 4GGQA 4HCPB 3NZUA 3ZNGC 4AOFA 4W9CA 3PRZA 2KD0A 2KTRB 3QX1A 2IZVB 3I3TB 3U7DA 4DWFA 4MEMA 2BWFA 2MP2B 3B08A 5DPTA 3B0AA 3OJ3A 4MSMB 2BGFA 1C1YB 3UINB 3ZTCA 2O6VD 4GU2A 3X0WA 5AZGA 2XK5B 2JRIB 3ZNID 1SIFA 2Z0EB 3QC8B 4K7SA 1PQSA 1YQBA 2D11A 1IPGA 4F7ZA 1WRDB 3SDLC 2NPTA 5C23A 3IBEA 2R2OA 2M4NA 2FCQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C7H A;  4AP4 C;  1UD7 A;  1R4M I;  4FJV B;  3NY5 A;  1YD8 U;  4HPM B;  2L00 B;  2ZZP B;  3VTW A;  4DHZ B;  1NBF C;  4W9L A;  4ZRI A;  2CHX A;  3IHP C;  4WWP A;  5CHW A;  1V86 A;  4GDL A;  2BYV E;  2WDT B;  2LGD A;  3WA0 A;  3CSF A;  2EMT A;  5IA7 A;  1TTN A;  2BPS A;  1V6E A;  4KZ0 A;  2KQ7 A;  4MGI E;  1OGW A;  2CU1 A;  2JY6 A;  4GDK B;  3OLM D;  4E71 A;  2KX3 A;  2MP2 A;  4MSQ B;  2BF8 B;  4FBJ B;  2RSU A;  1KJT A;  4HDO A;  2KMA A;  2LD9 A;  2D3G A;  4G0N B;  3KVF B;  4MJS B;  3LDZ E;  5CHF A;  1ZW7 A;  4J6I A;  2KJR A;  1R4N I;  5DPR A;  5L95 C;  2NBV B;  2C7M B;  5AZH A;  3DBR I;  2CHZ A;  2MA9 B;  4M8M A;  3HK0 A;  3M63 B;  1VD2 A;  3U30 A;  4GOC A;  4DDI D;  5G2N A;  3JVZ X;  4IM3 A;  3ZUN A;  3VAW A;  3A33 B;  2XBB C;  3KH0 A;  2G3Q B;  3H7P B;  4BFR A;  4WAA A;  2FIF A;  3DBL I;  1SGH A;  3PSE B;  1EF1 A;  4CHK A;  3NZS A;  2PE6 B;  1ZKH A;  1Q5W B;  2K8H A;  3CST A;  1IP9 A;  4DHJ D;  2DYO A;  4ANX A;  2C5L C;  5KHO A;  1E8Z A;  3QAR A;  3LJ3 A;  3R3M A;  1UH6 A;  1Q0W B;  1WXA A;  4WWN A;  3APF A;  3JSV B;  2AWT A;  1UZX B;  2GBK A;  4IUM B;  4MJS A;  3ZNH B;  4NAW B;  4IG7 B;  2IY1 B;  3RUI B;  1WI0 A;  3ZW3 A;  5L83 A;  2JWZ A;  2HTH A;  4NJ6 A;  1WYW B;  3H6N A;  1V9J A;  1YX5 B;  2MBB B;  3RT3 B;  4DXA B;  2REX A;  2V1Y A;  2DHZ A;  2AL6 A;  2LRW A;  4GXB A;  4JL9 A;  5E6O A;  1WX9 A;  3EEC A;  1I35 A;  3VDZ A;  3WAL A;  4FLH A;  4LDT D;  1E8W A;  2HE7 A;  3H7P A;  3H1U A;  3DOW A;  2LWP A;  1L2N A;  2MRP A;  3APC A;  2ZJD A;  4E74 A;  4MGZ E;  3DBH I;  3A4R A;  3OAW A;  4EEW A;  2KWC A;  3VQI A;  1RFA A;  1WXV A;  2FCS A;  2V3S A;  3ZRF A;  5LLI A;  4BOZ B;  3UIP B;  2L0F A;  3JYU A;  4HWI B;  3DPD A;  2O6V B;  1QZE A;  3VH3 B;  2L7R A;  3ZVV A;  2MSE D;  1P0R A;  3H7S A;  3ENE A;  2KC2 A;  3Q3F A;  4ZYN A;  5JH5 C;  3KUD B;  3UF8 A;  3JSV A;  4AWJ A;  2NPT B;  4NAW A;  3C0R B;  3WIM A;  3RD2 A;  3ZNZ B;  5KHQ A;  3L17 A;  3A4S C;  3R7Q A;  4AUQ C;  3D32 A;  2LVP A;  1OEY J;  3ZLZ A;  3PHX B;  3PPA A;  1LXD A;  4W9G A;  3DDC B;  4JQW C;  3RCZ A;  3M62 B;  1C3T A;  2IY0 B;  3QHT A;  3VH4 B;  2RR9 A;  2OOB B;  3MHS D;  1ZGU B;  2MX2 A;  1WIA A;  2DZI A;  3VHT C;  2MQJ A;  3L0W B;  2CR5 A;  2KLC A;  2J7Q B;  1WGH A;  2JF5 A;  2KOX A;  3KYD D;  2MW5 A;  4IWP A;  1NI2 A;  1P9D U;  2O6V A;  2Y5B B;  4GSW A;  4LJO B;  3NHE B;  3VXW A;  1L7Y A;  1FXT B;  4MDK E;  3L54 A;  2B3A A;  1J0G A;  4EZL A;  3QJZ A;  2G4D B;  3JW0 X;  5FR6 A;  3TJP A;  3TL5 A;  3L08 A;  4B6W A;  3QAQ A;  3VTU A;  1KM7 A;  2O2V A;  3A9K B;  4LJP B;  4TQ1 A;  3VUY A;  1WGY A;  2J0J A;  3EFU A;  2RD0 A;  3N32 A;  3NS8 A;  1K8R B;  2PE9 A;  3UGB B;  4K7W A;  3L13 A;  1H4R A;  4KIK B;  2KWV B;  1WGD A;  2KFJ A;  3SD5 A;  2UYZ B;  3PLU A;  2HJ8 A;  2ZPN A;  3BY4 B;  3PRP B;  4I6L B;  3TBL D;  2WWZ A;  4DHJ B;  2NR2 A;  2KX0 A;  2M1M A;  1WR1 A;  2GMI C;  1CMX B;  5IAA C;  2JZ3 B;  2AL3 A;  1E8X A;  3V6C B;  4NQK E;  1P3Q U;  2ZCC A;  2JUO A;  3HIZ A;  2KK8 A;  5LXI B;  2MBH A;  4WJQ A;  3ALB A;  1UBI A;  3DVG Y;  4G11 A;  3EC8 A;  4HK2 A;  3PTF C;  2JXX A;  2KNB A;  4M8N A;  3WAO A;  2N4F A;  4K7U A;  3MTN B;  4KDI C;  3MJW A;  4BBN C;  1I42 A;  2D2Q A;  3DVG X;  4FJZ A;  2M0X A;  3DVN U;  2IYD B;  2MLB A;  3A9K A;  3VFK A;  1Q1O A;  4DBG A;  5D2M B;  4W9F A;  1GJZ A;  2J0M A;  5GMV A;  2N9P C;  4LDT B;  1Z5S B;  2W9N A;  2ZCB A;  2KAN A;  3PV1 A;  1UEL A;  2GBM A;  2L3Z A;  3HHM A;  2KTF A;  4KIK A;  5G55 A;  3SU8 X;  2BKF A;  4ICV A;  5BO4 B;  4W9J A;  1T0Y A;  1MG8 A;  2LRU A;  3PRE A;  2N7E A;  3VUX A;  1E7V A;  2L05 A;  1WM3 A;  2BYF A;  1S3S G;  3WAN A;  3RYT A;  2NVU I;  4KSK C;  2I1J A;  2JPH A;  3ZTD A;  3B1L X;  5J17 A;  4NY0 A;  3EHV A;  2FCM A;  1F9J A;  1P98 A;  1WH3 A;  1WJN A;  1GG3 A;  2KO3 A;  2Z59 B;  1RAX A;  4E3C A;  4FN2 A;  2A4Z A;  4JGH B;  1WMH B;  5JZE B;  4BKT A;  4DHZ E;  3N3K B;  2NBU A;  1JRU A;  4HCN B;  4XZ4 A;  4ANW A;  1RRB A;  2R2Q A;  1WY8 A;  3H9D A;  1Y8R C;  2WX0 A;  2LZ6 A;  4GMV A;  3NOB A;  2AEH A;  4BKG A;  1EO6 A;  2BYE A;  2DAJ A;  2KLG A;  2N1W A;  4ANU A;  1V5T A;  3AUL A;  3OJ4 B;  2L76 A;  2LXC A;  4PS7 A;  3HM6 X;  4RM8 A;  1GNU A;  1UGM A;  4EZK A;  3PZD A;  2K6D B;  2KVR A;  4LCD E;  3RZW C;  3ML8 A;  4TKN A;  3AU5 A;  2KFK A;  1WXS A;  4YL8 A;  4MGY E;  2DX5 B;  1YIW A;  3DVN V;  1U4A A;  4BOS C;  2LXA A;  3PHW B;  3DQV A;  3M3J A;  5JHB A;  2CS4 A;  4IWO A;  2C9W B;  3UQB A;  1HE8 A;  1EUV B;  4ZRJ A;  3A1Q B;  2O2V B;  1OQY A;  1V49 A;  2KXJ A;  4EZJ A;  1Z2M A;  1WMH A;  3V6E B;  2LAS A;  2A5U A;  4CYE A;  2K8C A;  2RPQ A;  3TCA A;  1YJ1 A;  2DYB A;  5D94 A;  3W1S A;  1E5W A;  2LGY A;  3V62 A;  1V5O A;  1VCB A;  2KN5 A;  3ONS A;  5EDS A;  4W9D A;  3KW5 B;  4IC7 B;  4NPN A;  3O65 B;  3IG3 A;  1NDD A;  4F8C B;  3ZIM A;  2DYM A;  2QHO A;  2YLM A;  2M17 A;  3IVF A;  2N7D A;  4F1S A;  2L0T A;  4HLE A;  1V81 A;  4K81 A;  2DAF A;  1KLV A;  3WAP A;  1WM2 A;  2GOW A;  1WR6 E;  3KUZ A;  2KMC A;  2C7N B;  4ASW C;  3U8Z A;  3W1S C;  4PS3 A;  3T8M A;  3CMM B;  3UQA A;  4A20 A;  1WJ4 A;  1WE6 A;  2WX1 A;  2K8B A;  4GB9 A;  3A1Q A;  4I6P A;  4II3 B;  4BBN F;  4EOY A;  1WX8 A;  3HM3 A;  3KUC B;  4PYU A;  4GIV A;  5DCN A;  2ZEQ A;  2XEW A;  4WQO B;  3V60 A;  4A3O A;  1RLF A;  2KC1 A;  4RM9 A;  1WF9 A;  1WZ0 A;  2PJH A;  2L8J A;  2HD5 B;  4KDL B;  1ISN A;  1M94 A;  2FCN A;  3GZN I;  1G6J A;  2K1F A;  4W9I A;  2EMS A;  2JZZ A;  4G50 A;  2M8S A;  4W9K A;  2DZJ A;  4X57 B;  2KDI A;  1AAR A;  2DZM A;  4WWO A;  4P7I A;  4W9H A;  4MH0 E;  3DBS A;  4M0W B;  2ZVO A;  2D10 A;  2FNJ B;  4DDG D;  4PYZ A;  1WZ3 A;  2N9E B;  2IO3 B;  5E6N A;  4EFO A;  3SHQ A;  3ZRC A;  4EUT A;  3KYC D;  3W1Y A;  1LFD A;  2JRH A;  3M95 A;  2KHW B;  2N9X A;  3AXC A;  3K9O B;  4NNJ B;  4W9E A;  2DEN B;  3GOE A;  4IWQ A;  4FJY A;  2PEA A;  2IO1 B;  3QQ8 B;  1BT0 A;  5HKH A;  4WJP A;  1V2Y A;  1GC6 A;  3VTV A;  1A5R A;  1UBQ A;  4KV2 A;  2KTR A;  4HXD A;  3L10 B;  1P1A A;  4OVV A;  4OVU A;  3QK0 A;  2FUH B;  3S2A A;  1OEY A;  4II2 B;  4IW0 A;  4B95 A;  2MCN B;  2GBR A;  3R66 C;  5CTR C;  2KQS A;  2ZNV B;  2KWU B;  1WXM A;  2IBI B;  4MM3 A;  4URK A;  2WYQ A;  2K25 A;  1XD3 B;  3A9J B;  2ASQ A;  5AEK B;  3BIN A;  4PS8 A;  3APD A;  4ZDV A;  2KZR A;  2KFK B;  2K6Q A;  2VRR B;  2XK5 A;  3TIX A;  4K1R B;  1XQQ A;  4FAD A;  1LQB A;  3N30 A;  3CF6 E;  3PT2 B;  2FID A;  2YVC A;  2KDE B;  5AZF A;  2LJ5 A;  1WGG A;  5D6J B;  1WGR A;  4CO7 A;  2IO0 B;  4A3P A;  1OTR B;  4ICU A;  4WJN A;  4FUL A;  4N9F 4;  4NJ7 A;  4B9K A;  2J0K A;  2KKC A;  3PLV A;  3VVW B;  4DK5 A;  1IYF A;  2I1K A;  2CHW A;  4AJW A;  1WJ6 A;  1J19 A;  2NS5 A;  4HJK A;  3ZDT A;  3AU4 A;  3AI5 A;  2GBJ A;  4HPL B;  4WJO A;  3ECI A;  1S1Q B;  1SE9 A;  2ZVN A;  4GDK A;  1E8Y A;  3Q3J A;  2PPH A;  3RZF A;  2MWS B;  4TV3 A;  2LVQ A;  4IM0 A;  4TUU A;  2EKE C;  1WFY A;  2V4L A;  1X1M A;  2KJ6 A;  3R7R A;  3P2B A;  1WX7 A;  4NQL B;  2DZK A;  4ANV A;  5E6P A;  3QCA A;  4HVB A;  2IO2 B;  3A9J A;  2MBE A;  3T9L A;  1EF5 A;  3UIO B;  4ZRK A;  3IFW B;  5DPW A;  3DCG A;  2K39 A;  5CHV C;  1LM8 B;  3ZDM C;  4TQ0 A;  2JT4 B;  1E90 A;  3PS6 A;  2RGF A;  3QWZ B;  2Z0D B;  5TR5 A;  3WAM A;  1YX6 B;  2JVC A;  2LGX A;  3PGE A;  2NCN A;  4FHK A;  4G3X B;  2FAZ A;  2MBO A;  3PRM B;  2LUE A;  4FA6 A;  4AJY B;  1GC7 A;  4RMA A;  4HDQ A;  4GN1 A;  1TZ1 A;  3ZO5 B;  2ZPY A;  3RUL A;  2GBN A;  4MEL A;  4KSL C;  4JLC A;  4KZC A;  4IM2 A;  2ZNV C;  3QA8 A;  2KDB A;  4FHJ A;  5C1Z A;  3ML9 A;  3QIJ A;  4XX5 A;  5CX3 A;  1TGZ B;  4EKU A;  3TMP B;  5JHA A;  1GUA B;  2LI5 A;  1E7U A;  1WE7 A;  2BWE S;  3K9P B;  3VUW A;  3ZKJ C;  4BVU C;  2C60 A;  4BKS D;  1WJU A;  2N1V A;  2NBW B;  4I6N B;  4BKS A;  2D07 B;  2AYO B;  3V61 A;  1V80 A;  2MBQ A;  4JIO U;  4KVG B;  1J8C A;  2BKR B;  1XT9 B;  3X23 A;  1TBE A;  2UWQ A;  5J18 A;  2KDF B;  1D3Z A;  2LVO A;  4XC2 A;  3PVL A;  2CKH B;  4GDL B;  2OJR A;  2G4S A;  5DPS A;  5LXH A;  3L16 A;  2G45 B;  1H8C A;  4MGK E;  5D7G A;  2KJH B;  1KOT A;  5J2R A;  4GGQ A;  4HCP B;  3NZU A;  3ZNG C;  4AOF A;  4W9C A;  3PRZ A;  2KD0 A;  2KTR B;  3QX1 A;  2IZV B;  3I3T B;  3U7D A;  4DWF A;  4MEM A;  2BWF A;  2MP2 B;  3B08 A;  5DPT A;  3B0A A;  3OJ3 A;  4MSM B;  2BGF A;  1C1Y B;  3UIN B;  3ZTC A;  2O6V D;  4GU2 A;  3X0W A;  5AZG A;  2XK5 B;  2JRI B;  3ZNI D;  1SIF A;  2Z0E B;  3QC8 B;  4K7S A;  1PQS A;  1YQB A;  2D11 A;  1IPG A;  4F7Z A;  1WRD B;  3SDL C;  2NPT A;  5C23 A;  3IBE A;  2R2O A;  2M4N A;  2FCQ A; 
#chains in the Genus database with same CATH topology
 1UD7 A;  1R4M I;  3NY5 A;  3ZXV A;  2I2Y A;  3V3X A;  1NBF C;  3IHP C;  2WDT B;  1ZOY B;  2QJL A;  2AQ1 B;  3CSF A;  2K3U A;  3ZXR A;  3FKY A;  1TTN A;  5IA7 A;  3N1X C;  3Q2A C;  3VRA B;  1AWD A;  2BF8 B;  4FBJ B;  2RSU A;  4HDO A;  3HVZ A;  1C77 A;  1XF5 L;  3LDZ E;  1ZW7 A;  3Q8E A;  1K51 A;  5L95 C;  1FEH A;  2RDG A;  2BS4 B;  1F2R I;  2MA9 B;  3M63 B;  3U30 A;  3RNA C;  3RNE C;  4IM3 A;  3AMZ A;  2KAC A;  4WAA A;  2W54 A;  1ZE3 D;  2V4I B;  4CHK A;  1Q5W B;  3CST A;  3B2G A;  3JSV B;  3ZNH B;  1EWC A;  4RNA A;  2K9X A;  4IG7 B;  3ZW3 A;  5L83 A;  3H6N A;  3CWI A;  2MBB B;  2REX A;  2LRW A;  1FRR A;  1MI0 A;  2HE7 A;  1L2N A;  4E74 A;  1TYG B;  3OAW A;  2KWC A;  1RFA A;  2SEB D;  4BOZ B;  3UIP B;  2L7R A;  2MSE D;  5JH5 C;  3Q3F A;  3UF8 A;  1ZP0 B;  3JSV A;  2W55 A;  2NPT B;  1FFV A;  4JPS A;  1QT9 A;  3RD2 A;  4NAM A;  1QOB A;  3R7Q A;  1OEY J;  3RN9 C;  4JQW C;  1V8C A;  3RCZ A;  3GP7 A;  3M62 B;  1C3T A;  2BS3 B;  2RR9 A;  1ZGU B;  4IKG A;  4RF1 A;  1FXI A;  2KOX A;  2MW5 A;  1NI2 A;  4MDK E;  4EZL A;  3N20 C;  2Q5W D;  3N32 A;  3L13 A;  4KKI A;  3MHZ A;  2OHF A;  3SD5 A;  3MC9 A;  2WXP A;  2RDH A;  1F52 A;  5IAA C;  1IBX B;  1N61 A;  2AL3 A;  1FO4 A;  1E8X A;  2JUO A;  5LXI B;  3ALB A;  4HK2 A;  3PTF C;  2JXX A;  2KNB A;  3Q6B A;  1OQR A;  3MJW A;  3W5U B;  3VFK A;  1Q1O A;  1PGB A;  4W9F A;  5GMV A;  2ZCB A;  2W9N A;  2KAN A;  3PV1 A;  2L3Z A;  2B76 B;  3SU8 X;  2L83 A;  4W9J A;  3Q69 A;  3PRE A;  2DWQ A;  2BYF A;  1S3S G;  2I1J A;  2JPH A;  1CQV A;  3GZN B;  5G5H A;  1TT5 B;  1IBX A;  1F9J A;  1P98 A;  1FM0 D;  2Z59 B;  1JRU A;  1SE4 A;  3H8H A;  3H9D A;  1Y8R C;  2WXF A;  3IT6 B;  2LZ6 A;  1IUE A;  5C3J B;  3U4E G;  1T0R C;  2QDF A;  2LXC A;  4ACF A;  1FFU A;  4RM8 A;  1TS3 A;  4TKN A;  1AYF A;  2KFK A;  3N9Y C;  2VH2 A;  2V0G A;  4MGY E;  3DVN V;  3PHW B;  2CS4 A;  1SXT A;  1HE8 A;  1EUV B;  2KAJ A;  4ZRJ A;  3U7Z A;  2O2V B;  1E10 A;  1CJE A;  3V6E B;  1MG4 A;  1SIJ A;  1L4D B;  3AEA B;  2XN9 C;  1ZUD 2;  3R2T A;  3AEC B;  4W9D A;  3WCQ A;  2RDB C;  4DQO C;  4F8C B;  3ZIM A;  3Q3O C;  4HPP A;  1I4P A;  4YT0 B;  4F1S A;  3ABV B;  4HLE A;  1V81 A;  4K81 A;  2DAF A;  1PGA A;  3W1S C;  1L0V B;  3CMM B;  1VZ8 A;  1UF0 A;  1WJ4 A;  1T5X D;  2BT6 A;  4WQO B;  4A3O A;  1MVK A;  2V3P A;  2HD5 B;  1ISN A;  1CZP A;  2EMS A;  2JZZ A;  3DBH B;  2KDI A;  1VLB A;  2DZM A;  1YNT E;  3U2S C;  2IO3 B;  3VR8 B;  3T3N A;  3M95 A;  2N9X A;  4W9E A;  2DEN B;  3GOE A;  4IWQ A;  4FJY A;  2IO1 B;  1BT0 A;  1J7B A;  4XGA B;  5HKH A;  1V2Y A;  3MJ5 A;  4Q2J A;  1P1A A;  1SJE D;  4OVV A;  4OVU A;  2FUH B;  2Z8L A;  2MCN B;  2GBR A;  3KQ4 A;  2KQS A;  2NTS A;  2WYQ A;  4RGN A;  3A9J B;  1GB1 A;  2ASQ A;  4N58 A;  4PS8 A;  3RFZ B;  4K1R B;  3AN1 A;  3TEX A;  1NVI D;  1JWM D;  3N30 A;  3CF6 E;  1YQ3 B;  3PT2 B;  1HTO A;  1WGG A;  3RI7 C;  4M01 A;  2M19 A;  4ICU A;  4WJN A;  4N9F 4;  3GE3 C;  4LLG M;  1IYF A;  2I1K A;  2CHW A;  4YSX B;  1J19 A;  2NS5 A;  4MH8 A;  4HJK A;  3ZDT A;  3AU4 A;  4HPL B;  2ZVN A;  4GDK A;  3TUO A;  3AEG B;  2MWS B;  4TV3 A;  4IM0 A;  2EKE C;  1X1M A;  1OQQ A;  1P7F A;  1CK1 A;  3QCA A;  3A9J A;  1E6E B;  3UIO B;  3IFW B;  5I4D A;  1YX6 B;  2LGX A;  1LO5 D;  1YMH E;  3OG5 A;  1IGC A;  2MBO A;  5AUI A;  1GC7 A;  2K22 A;  2XNA C;  1TZ1 A;  4K3C A;  2GBN A;  1YJJ A;  4IM2 A;  2RPV A;  3IAM 1;  5HG2 A;  4XX5 A;  3TMP B;  1QOG A;  1JCK B;  1GUA B;  1WE7 A;  4KGS A;  3ZKJ C;  4BKS D;  1C4C A;  1V80 A;  4JIO U;  4KVG B;  5H92 C;  1XLP A;  2D3C A;  1TY0 A;  2KDF B;  1I7H A;  2LJI A;  2LVO A;  3SFE B;  2OJR A;  5JXV A;  5D7G A;  2KJH B;  1GOZ A;  3P42 A;  4GGQ A;  4W9C A;  4A6Q A;  2KD0 A;  4WUR A;  3QX1 A;  3U7D A;  1NYQ A;  2MEK A;  2MP2 B;  3KWL A;  4US9 A;  2BGF A;  3UIN B;  5LNK 1;  1DOY A;  2KWD A;  5FK9 C;  1YQB A;  4F7Z A;  3P1M A;  2R2O A;  2FCQ A;  2OED A;  4JX1 C;  1XCQ L;  4R3D A;  3RNB C;  2L00 B;  4DHZ B;  2CHX A;  5CHW A;  2BYV E;  4L2Y A;  5FR3 A;  3WA0 A;  2EMT A;  2BPS A;  4HKZ E;  4KZ0 A;  4WIP A;  2KQ7 A;  2WXO A;  4MGI E;  1RYJ A;  2JY6 A;  3Q8A A;  4E71 A;  2MP2 A;  5EE0 A;  2KMA A;  1FRD A;  2MHJ A;  4MJS B;  5CHF A;  4J6I A;  2KJR A;  1R4N I;  1QKZ A;  3BZD B;  1L6U A;  4M00 A;  2CHZ A;  1PDX A;  2WNM A;  2J4X A;  4M8M A;  1Y56 A;  1SJH D;  2QCZ A;  4GOC A;  2MJD A;  3FAH A;  4BFR A;  1E0Z A;  2EKI A;  2BBC A;  1BML C;  3NZS A;  1IP9 A;  4USA A;  1DGJ A;  1HXY D;  1V1P B;  2DYO A;  5KHO A;  3AE8 B;  4YTM B;  2IGD A;  3R3M A;  1FD6 A;  1WXA A;  4MAC A;  4WWN A;  3I5J C;  4ZHP A;  3Q8B A;  2GBK A;  2K0P A;  4MJS A;  2LHD A;  4TMA B;  1JRP A;  2HTH A;  2WXN A;  5BYS A;  1HZ5 A;  1WYW B;  1L0Y B;  1RM6 C;  1YX5 B;  3RT3 B;  2V1Y A;  3R2I A;  5E6O A;  3EEC A;  1I35 A;  3TSS A;  4HRS A;  3H1U A;  2FE8 A;  2MRP A;  3APC A;  3DBH I;  2BB5 A;  2IGG A;  4O1N A;  1WXV A;  1F0Z A;  5LLI A;  2L0F A;  2M0A A;  4HWI B;  3RMK C;  1P0R A;  2KC2 A;  4NZL B;  2IPK D;  3ZNZ B;  5KHQ A;  3A4S C;  2OJW A;  2ACZ B;  3D32 A;  3DHI C;  4W9G A;  3DDC B;  2WLB A;  2HDE A;  1K53 A;  1ZDV A;  1E7P B;  2WXJ A;  3QHT A;  4UDU C;  3VH4 B;  2MX2 A;  2H88 B;  1WIA A;  2DZI A;  3VHT C;  3NS1 A;  2MQJ A;  2WDV B;  1T0S C;  1WXQ A;  1PUT A;  2KLC A;  2IDY A;  4YSY B;  1WGH A;  1ZXH A;  2LFI A;  1N60 A;  3FIL A;  3Q14 C;  2Y5B B;  4LJO B;  3L54 A;  3CIR B;  3QJZ A;  3TJP A;  4B6W A;  3L08 A;  3QAQ A;  4TQ1 A;  3VUY A;  3UGB B;  1H4R A;  2KWV B;  2K5P A;  4RFB A;  3BVZ A;  1YN3 A;  1KF6 B;  3SEB A;  2ZPN A;  3BY4 B;  4I6L B;  3AB5 A;  2NR2 A;  2WXL A;  2JZ3 B;  3V6C B;  3MC0 B;  4DXF A;  1C9F A;  3ZJU A;  1KLG D;  2ZCC A;  3W9C B;  2N7J A;  4G11 A;  1UBI A;  3DHH C;  3DVG Y;  3EC8 A;  4ARI A;  3NUH B;  3WAO A;  4K7U A;  4KDI C;  4C4V B;  1AN8 A;  1I42 A;  3KLS X;  3DVG X;  2PKO A;  1TS4 A;  4DBG A;  5D2M B;  4LDT B;  1FNW A;  1UEL A;  5G55 A;  1RFK A;  2WQY B;  1T0Y A;  1MG8 A;  2LRU A;  2N7E A;  1FNU A;  3RNF C;  1E7V A;  1IGD A;  2NTT A;  2WXI A;  2MH7 A;  3B1L X;  1EU3 A;  3EA6 A;  1L5P A;  5BYQ A;  3P63 A;  2FUG 1;  1MJD A;  4QAY A;  2DLB A;  4C4V A;  4DHZ E;  3SFD B;  4ANW A;  1RRB A;  2ICI A;  2DBY A;  1T0Q C;  2KLG A;  3MFG A;  1V5T A;  4PS7 A;  4C00 A;  3HM6 X;  4MT5 A;  3LB8 C;  2K6D B;  4ZRQ A;  1EWY C;  1T3Q A;  3ML8 A;  2AQ2 B;  4YL8 A;  1HTQ A;  1TKY A;  2DX5 B;  3GB1 A;  1QOF A;  3M3J A;  4K3B A;  4HEA 1;  5JHB A;  2R61 A;  1OQY A;  1V49 A;  3P4P B;  1Z2M A;  2RPQ A;  1MFW A;  1GAQ B;  2EEL A;  2LGY A;  3V62 A;  1V5O A;  4LTU A;  2G1E A;  2KN5 A;  2BS2 B;  5EDS A;  4IC7 B;  1NDD A;  2M17 A;  2L0T A;  4C7Y A;  3KWV A;  3BK1 A;  1WM2 A;  2GOW A;  3KUZ A;  2LEK A;  3ZJT A;  3B2F A;  3B9J A;  3U8Z A;  4ASW C;  1PFD A;  5E6J A;  4A20 A;  2INN E;  2WX1 A;  4GB9 A;  4KKJ A;  1JWS D;  4I6P A;  4II3 B;  4BBN F;  1WX8 A;  3HM3 A;  3AE9 B;  4OZC A;  4GIV A;  2XEW A;  3V60 A;  4YXD B;  1JRO A;  2J42 A;  1RLF A;  2KC1 A;  2QIE B;  1WZ0 A;  2PJH A;  4KDL B;  2L8J A;  4MM3 B;  2HJ1 A;  2K1F A;  4W9I A;  2JQR B;  5IO9 A;  3NVV A;  3AEB B;  4W9H A;  3DBS A;  2ZVO A;  2N9E B;  4EFO A;  1YN5 A;  3UI3 A;  1LFD A;  1NEN B;  1QQR A;  3E56 A;  3QQ8 B;  2MJ3 A;  4WJP A;  3I63 C;  4KV2 A;  3U52 E;  5AUK A;  3HVD A;  3QK0 A;  3S2A A;  4II2 B;  4J3O D;  3R8B A;  4MM3 A;  3VRB B;  2KFK B;  4FAD A;  2K6Q A;  2FID A;  2UU7 A;  5AZF A;  4CO7 A;  3VR9 B;  2WU5 B;  1L4Z B;  4FUL A;  1N6Z A;  3AE1 B;  3GS2 A;  4AJW A;  1SEB D;  2H89 B;  3Q3M C;  4WJO A;  2PPH A;  4OVZ A;  2V4L A;  2KJ6 A;  3R7R A;  3P2B A;  2DZK A;  2PW9 A;  1C78 A;  2IO2 B;  3PZ8 A;  2WXR A;  4ZRK A;  5IOI A;  2BQQ A;  2PVO D;  5CHV C;  1LM8 B;  1E90 A;  3WAM A;  3PGE A;  4FHK A;  4G3X B;  1ZDX A;  3PRM B;  1R4N B;  2JU6 X;  4C80 A;  3AE2 B;  4MEL A;  4KSL C;  5EE3 A;  3NRZ A;  3BK2 A;  4YTP B;  5C1Z A;  3AEE B;  4M02 A;  1E7U A;  4BVU C;  2VH1 A;  1V97 A;  5BYR A;  2YEP B;  2D07 B;  5BMH A;  2AYO B;  3X23 A;  1TS5 A;  5J18 A;  2JSV X;  1KFY B;  3W5V B;  4XC2 A;  2CKH B;  4RF0 A;  5LXH A;  1H8C A;  2G45 B;  2M56 B;  3DWG C;  3RNC C;  5J2R A;  3NZU A;  4AOF A;  1FCL A;  3I3T B;  5T8I A;  3B0A A;  2AX5 A;  3ZTC A;  2PIA A;  4BZA A;  1SIF A;  3EGR A;  2Z0E B;  4K7S A;  1JAL A;  1ET6 A;  4L1B A;  2D11 A;  3AE6 B;  5GXG B;  4S17 A;  1F2R C;  4AP4 C;  4HPM B;  2WU2 B;  4RH6 A;  4ZRI A;  4WWP A;  1HEZ E;  1WGK A;  2AQ3 B;  1J7C A;  2LGD A;  3AV8 A;  1V6E A;  1N5X A;  1OGW A;  2CU1 A;  4GDK B;  3OLM D;  2KX3 A;  1TKG A;  3FC4 A;  4LNF A;  2LD9 A;  4G0N B;  3KVF B;  4WAF A;  1C4A A;  2NBV B;  1FCC C;  2C7M B;  2IGH A;  3HK0 A;  1ZPS A;  4DDI D;  5G2N A;  1FIQ A;  3ZUN A;  3A33 B;  2XBB C;  2G3Q B;  1N63 A;  3W2D A;  1XEE A;  1SGH A;  1SB3 C;  3ETR A;  1ZKH A;  2HTM E;  2K8H A;  1ENF A;  3J9C A;  1E8Z A;  1UH6 A;  1F1H A;  3APF A;  1UZX B;  4IUM B;  4NJC A;  1JQ4 A;  3PZ7 A;  1DOX A;  2KYW A;  3RUI B;  1WI0 A;  4OZB A;  1FXA A;  2JWZ A;  4BAX A;  2AL6 A;  4GXB A;  4JL9 A;  2BTE A;  4FLH A;  4LDT D;  1E8W A;  3T3O A;  3DOW A;  4EEW A;  4P1B C;  2ZJD A;  3A4R A;  3VQI A;  4A55 A;  2FCS A;  2V3S A;  1XLO A;  3ZRF A;  3DPD A;  4ZYN A;  3KUD B;  4AWJ A;  1RWS A;  2WXH A;  3L17 A;  1C4P A;  4AUQ C;  2NMQ A;  3ZLZ A;  3PPA A;  1LXD A;  1BXT A;  2FBW B;  2IY0 B;  1QIL A;  2OOB B;  1TIF A;  2YEP F;  2JF5 A;  1UUP A;  3NVW A;  3KYD D;  4IWP A;  4A90 A;  2DNF A;  1D6E C;  3NHE B;  5HI1 A;  3VXW A;  2PVG C;  1FXT B;  2B3A A;  2LMC A;  2G4D B;  1J7A A;  1LGR A;  5FR6 A;  2V3N A;  4LJP B;  1WGY A;  3BWU D;  1D5X C;  4KGR A;  2KDM A;  4K7W A;  2WHI A;  1WGD A;  3P4S B;  4AQ7 A;  2UYZ B;  3V05 A;  3PLU A;  3TBL D;  3AE3 B;  4WWM A;  4DHJ B;  1QOA A;  2KX0 A;  2M1M A;  3AH7 A;  1HQR D;  4IDI A;  2MBH A;  2E3T A;  4WJQ A;  1TS2 A;  4M8N A;  2N4F A;  1PYW D;  4BBN C;  1QF6 A;  3N1Y C;  2D2Q A;  3TEW A;  2M0X A;  5FKA C;  2JXT A;  2IYD B;  2MLB A;  1GJZ A;  4A8X C;  2J0M A;  2GLS A;  2N9P C;  4B9K A;  1Z5S B;  2GBM A;  1I4X A;  2KTF A;  2BKF A;  5BO4 B;  2L05 A;  3RYT A;  2JWU A;  2WS3 B;  3LYY A;  5J17 A;  4NY0 A;  1WH3 A;  1WJN A;  2INC C;  4TSS A;  3L4P A;  1GG3 A;  2KO3 A;  2KN4 A;  1WYG A;  1WMH B;  2LHE A;  4L23 A;  1TY2 A;  2R2Q A;  2WX0 A;  5D3I B;  2D3A A;  4BKG A;  2BYE A;  2DAJ A;  2N1W A;  4ANU A;  3AUL A;  3OJ4 B;  4KX6 B;  1UGM A;  4EZK A;  4LCD E;  3RZW C;  1D5Z C;  4XE0 A;  1WSP A;  1XLN A;  3FIL B;  1YIW A;  1U4A A;  2LXA A;  2LUM A;  4RGT A;  1I4Q A;  2E6X A;  2W3S A;  4IWO A;  1TJE A;  1SE3 A;  1R7S A;  1VR9 A;  4P1C C;  2KXJ A;  1WMH A;  2A5U A;  2K8C A;  1ET9 A;  3TCA A;  1E5W A;  2ON8 A;  1MPE A;  1JW9 D;  3KW5 B;  4NPN A;  3DBL B;  3O65 B;  3IG3 A;  1WWT A;  2QHO A;  2YLM A;  4LNN A;  4REZ A;  2N7D A;  3EFC A;  1KLV A;  3WAP A;  1WR6 E;  1V1O A;  4N6E B;  5EE1 A;  4EE2 A;  3UQA A;  3N1Z C;  3BVG A;  3KUC B;  4PYU A;  2V9H A;  5DCN A;  3Q3N C;  1WF9 A;  1M94 A;  3PO0 A;  1ROE A;  1G6J A;  1ESF A;  2M8S A;  1XO3 A;  1AAR A;  2WDQ B;  5HFY A;  4B0M A;  3ZJV A;  4M0W B;  2D10 A;  2FNJ B;  4PYZ A;  1WZ3 A;  5E6N A;  3SHQ A;  3ZRC A;  1ZXI A;  3KYC D;  2KHW B;  2JYT A;  3AXC A;  4NNJ B;  2PEA A;  1GC6 A;  1JWU D;  3VTV A;  1UBQ A;  2KTR A;  3L10 B;  2W3R A;  1L6V A;  4IW0 A;  4B95 A;  3BYT B;  3R66 C;  5CTR C;  2ZNV B;  2KWU B;  2IBI B;  1XD3 B;  3APD A;  2WGS A;  2XK5 A;  2MJE A;  4M0W A;  2IO0 B;  3E9S A;  1OTR B;  4XDD A;  1JWB D;  2Y5C A;  3Q8F A;  2INP E;  2ONQ A;  2QIL A;  2GBJ A;  1XCT L;  1SE9 A;  2QC8 A;  1E8Y A;  5G5G A;  3RZF A;  5TSS A;  2LVQ A;  2QSD A;  4RGO S;  4TUU A;  1WX7 A;  4HKQ A;  4ANV A;  1C76 A;  1KLU D;  5E6P A;  2CJO A;  3RPF C;  1GPX A;  3T9L A;  1EF5 A;  5DPW A;  2K39 A;  1B1Z A;  2QMT A;  4FA6 A;  4HDQ A;  4GN1 A;  2GI9 A;  2ZPY A;  3RUL A;  1UWM A;  1L0X B;  4JLC A;  1SBB B;  1D5M C;  2N9L A;  3QA8 A;  1NEK B;  2G9H D;  3ML9 A;  4EKU A;  1TGZ B;  5JHA A;  2PLP A;  2LI5 A;  3AE5 B;  3K9P B;  3ZGZ A;  3LXF A;  1WJU A;  3C19 A;  2NBW B;  4BKS A;  4S0R A;  1J8C A;  2BKR B;  2WP9 B;  1XT9 B;  1TBE A;  1OFF A;  3OWE B;  1D3Z A;  3TEZ A;  4ZHO A;  1EU4 A;  3PVL A;  4GDL B;  2WXQ A;  4MGK E;  1UWX A;  1KOT A;  3ZNG C;  4MEM A;  3B08 A;  3OJ3 A;  4RGM A;  4JWS C;  2SAK A;  3ZNI D;  3URY A;  3QC8 B;  1PQS A;  4FXC A;  5MPO A;  3SDL C;  2NPT A;  4IOI E;  3IBE A;  2M4N A;  2KQ4 X;  2C7H A;  4FJV B;  1YD8 U;  2ZZP B;  3VTW A;  4W9L A;  1V86 A;  3NZ3 A;  4GDL A;  3Q8C A;  2JYE A;  2BYT A;  2GB1 A;  4MSQ B;  1KJT A;  2D3G A;  2Y5P A;  5DPR A;  5AZH A;  3DBR I;  1VD2 A;  1K50 A;  1XXG A;  1JML A;  3JVZ X;  3P4R B;  3VAW A;  3KH0 A;  3HRD D;  3H7P B;  3BII D;  2WXM A;  4WH4 A;  2FIF A;  1D4B A;  3DBL I;  3PSE B;  1EF1 A;  1I4R A;  2PE6 B;  3NJT A;  4DHJ D;  4ANX A;  2C5L C;  2VZK B;  3LJ3 A;  3AED B;  3QAR A;  2WXK A;  1Q0W B;  2N0S B;  4C7Z A;  4YTN B;  2AWT A;  1B9R A;  4NAW B;  2LGI A;  1TKE A;  2IY1 B;  2RMM A;  4NJ6 A;  4XWT A;  1VDV A;  1V9J A;  4DXA B;  2DHZ A;  2X38 A;  1WX9 A;  4LNO A;  5HHD G;  3VDZ A;  1PGX A;  3WAL A;  3BYY B;  5C2T B;  1YJI A;  3H7P A;  1ACC A;  2LWP A;  3NG0 A;  2WDR B;  4MGZ E;  2Y3A A;  5BMI A;  2J53 A;  2LGS A;  1KTK A;  3JYU A;  2O6V B;  1QZE A;  3VH3 B;  4N59 A;  3ZVV A;  3H7S A;  3ENE A;  2L1A A;  4JWU C;  3TEY A;  4NAW A;  3C0R B;  2KVZ A;  3AM9 A;  4OHJ A;  3WIM A;  4ITK A;  1SSN A;  2LVP A;  3GE8 C;  1UNS A;  3PHX B;  2D5G A;  3MHS D;  1UGJ A;  2ZW0 A;  3L0W B;  2CR5 A;  2J7Q B;  1P9D U;  2O6V A;  3IXS A;  4GSW A;  1VRA B;  1L7Y A;  4ARC A;  1J0G A;  3SR6 A;  1I4G A;  2L52 A;  3JW0 X;  3TL5 A;  3VTU A;  1KM7 A;  2O2V A;  3A9K B;  4HRO A;  2J0J A;  3EFU A;  2RD0 A;  3NVY A;  3NS8 A;  1K8R B;  1SE2 A;  2PE9 A;  2N9K A;  4KIK B;  2KFJ A;  2HJ8 A;  5IKC M;  3PRP B;  2WWZ A;  3P4Q B;  1HA5 A;  1JWA D;  1WR1 A;  4AS1 A;  4D2K A;  1MHX A;  2GMI C;  1CMX B;  4PK1 A;  4NQK E;  1P3Q U;  3HIZ A;  2KK8 A;  3RNG C;  3AEF B;  3MTN B;  1A70 A;  2BW2 A;  1YQ4 B;  3NVZ A;  4FJZ A;  2D3B A;  3DVN U;  3A9K A;  4HJG E;  2JZP A;  2KMM A;  3AE4 B;  3ZQ4 A;  1FNV A;  1KH0 A;  4ZYS A;  2CU3 A;  4H2A A;  4XWW A;  3HHM A;  4KIK A;  3BVM A;  1VZ7 A;  4A9A A;  4ICV A;  3EUB 2;  5EE9 A;  3VUX A;  1WM3 A;  3WAN A;  2NVU I;  4KSK C;  3I57 A;  4GLS C;  3ZTD A;  3EHV A;  2IJ0 A;  2FCM A;  1GB4 A;  4CQN A;  1RAX A;  4E3C A;  4FN2 A;  2A4Z A;  4JGH B;  1P7E A;  5JZE B;  4BKT A;  3N3K B;  2NBU A;  1R4M B;  4OZA A;  4HCN B;  4XZ4 A;  2JX5 A;  3AE7 B;  1WY8 A;  4GMV A;  3NOB A;  2AEH A;  1EO6 A;  5BMG A;  2L76 A;  1QLB B;  1GNU A;  2QEJ C;  4WQM A;  3PZD A;  2KVR A;  4LNI A;  3AU5 A;  1WXS A;  4BOS C;  1DOI A;  3DQV A;  4LK0 M;  2C9W B;  3UQB A;  3A1Q B;  4EZJ A;  4CYE A;  2LAS A;  1YJ1 A;  2DYB A;  5D94 A;  3W1S A;  4US8 A;  1VCB A;  3ONS A;  4LNK A;  2BVC A;  2DYM A;  2J52 A;  1Q10 A;  1VJK A;  3IVF A;  1STE A;  3DWM A;  2KMC A;  2C7N B;  2I38 A;  4XDC A;  4PS3 A;  3T8M A;  1WE6 A;  2K8B A;  2PTL A;  3A1Q A;  4EOY A;  4RCO A;  2ZEQ A;  1SF0 A;  1NYR A;  1YN4 A;  4RM9 A;  4YSZ B;  2FCN A;  1TZO A;  3GZN I;  1NI3 A;  2KT7 A;  4G50 A;  4W9K A;  2DZJ A;  2PMV A;  4X57 B;  4C56 C;  2GRI A;  4XYC A;  4WWO A;  1AW7 A;  4P7I A;  4MH0 E;  1F77 A;  4DDG D;  1C79 A;  4EUT A;  3W1Y A;  5H8Y E;  2W82 A;  2JRH A;  4P6V F;  2CJN A;  2X8X X;  1EM7 A;  3K9O B;  3O13 A;  4ZRP A;  1A5R A;  1VZ6 A;  1HZ6 A;  1N62 A;  4HXD A;  1OEY A;  3IAS 1;  1WXM A;  3DHG C;  4URK A;  2K25 A;  5AEK B;  1YOV B;  3BIN A;  4ZDV A;  2KZR A;  3TIX A;  2VRR B;  1XQQ A;  1LQB A;  2YVC A;  2KDE B;  2BB6 A;  2LJ5 A;  5D6J B;  3ZYY X;  3IT4 B;  1WGR A;  4P16 A;  5IN7 A;  4A3P A;  4ZOH C;  4NJ7 A;  2J0K A;  1MHH E;  2KKC A;  3PLV A;  3VVW B;  4DK5 A;  1I4H A;  3C8Y A;  1WJ6 A;  2L32 A;  2ZW1 A;  3AI5 A;  3ECI A;  1S1Q B;  4PT5 A;  1M4V A;  3Q3J A;  1WFY A;  4NQL B;  3I9V 1;  3MP9 A;  4HVB A;  2MBE A;  3HUI A;  3DCG A;  3ZDM C;  4TQ0 A;  2JT4 B;  3PS6 A;  2RGF A;  3QWZ B;  2Z0D B;  5TR5 A;  2JVC A;  2NCN A;  1K52 A;  2FAZ A;  2LUE A;  4AJY B;  4RMA A;  5D3D A;  3ZO5 B;  3DBR B;  1WRI A;  4KZC A;  2TSS A;  2ZNV C;  4FHJ A;  1FMA D;  2KDB A;  4JE3 B;  3QIJ A;  5CX3 A;  1V1P A;  2VZK D;  2BWE S;  3VUW A;  4OW0 A;  2C60 A;  2N1V A;  2WXG A;  4I6N B;  3V61 A;  1XLQ A;  2MBQ A;  2UWQ A;  1T6B X;  2G4S A;  1KRH A;  5DPS A;  3L16 A;  4B0E A;  1N5W A;  4HCP B;  2IND C;  3PRZ A;  2KTR B;  4DWF A;  2IZV B;  1FPY A;  2BWF A;  1BUI C;  5DPT A;  3MC8 A;  4DXG A;  4MSM B;  1C1Y B;  1DYQ A;  2O6V D;  4GU2 A;  3X0W A;  5AZG A;  2XK5 B;  2JRI B;  1E9M A;  4KGT A;  1IPG A;  5IP4 D;  1WRD B;  4YWG G;  5C23 A; 
#chains in the Genus database with same CATH homology
 2C7H A;  4AP4 C;  1UD7 A;  1R4M I;  4FJV B;  3NY5 A;  1YD8 U;  4HPM B;  2L00 B;  2ZZP B;  3VTW A;  4DHZ B;  1NBF C;  4W9L A;  4ZRI A;  2CHX A;  3IHP C;  4WWP A;  5CHW A;  1V86 A;  4GDL A;  2BYV E;  2WDT B;  2LGD A;  3WA0 A;  3CSF A;  2EMT A;  5IA7 A;  1TTN A;  2BPS A;  1V6E A;  4KZ0 A;  2KQ7 A;  4MGI E;  1OGW A;  2CU1 A;  2JY6 A;  4GDK B;  3OLM D;  4E71 A;  2KX3 A;  2MP2 A;  4MSQ B;  2BF8 B;  4FBJ B;  2RSU A;  1KJT A;  4HDO A;  2KMA A;  2LD9 A;  2D3G A;  4G0N B;  3KVF B;  4MJS B;  3LDZ E;  5CHF A;  1ZW7 A;  4J6I A;  2KJR A;  1R4N I;  5DPR A;  5L95 C;  2NBV B;  2C7M B;  5AZH A;  3DBR I;  2CHZ A;  2MA9 B;  4M8M A;  3HK0 A;  3M63 B;  1VD2 A;  3U30 A;  4GOC A;  4DDI D;  5G2N A;  3JVZ X;  4IM3 A;  3ZUN A;  3VAW A;  3A33 B;  2XBB C;  3KH0 A;  2G3Q B;  3H7P B;  4BFR A;  4WAA A;  2FIF A;  3DBL I;  1SGH A;  3PSE B;  1EF1 A;  4CHK A;  3NZS A;  2PE6 B;  1ZKH A;  1Q5W B;  2K8H A;  3CST A;  1IP9 A;  4DHJ D;  2DYO A;  4ANX A;  2C5L C;  5KHO A;  1E8Z A;  3QAR A;  3LJ3 A;  3R3M A;  1UH6 A;  1Q0W B;  1WXA A;  4WWN A;  3APF A;  3JSV B;  2AWT A;  1UZX B;  2GBK A;  4IUM B;  4MJS A;  3ZNH B;  4NAW B;  4IG7 B;  2IY1 B;  3RUI B;  1WI0 A;  3ZW3 A;  5L83 A;  2JWZ A;  2HTH A;  4NJ6 A;  1WYW B;  3H6N A;  1V9J A;  1YX5 B;  2MBB B;  3RT3 B;  4DXA B;  2REX A;  2V1Y A;  2DHZ A;  2AL6 A;  2LRW A;  4GXB A;  4JL9 A;  5E6O A;  1WX9 A;  3EEC A;  1I35 A;  3VDZ A;  3WAL A;  4FLH A;  4LDT D;  1E8W A;  2HE7 A;  3H7P A;  3H1U A;  3DOW A;  2LWP A;  1L2N A;  2MRP A;  3APC A;  2ZJD A;  4E74 A;  4MGZ E;  3DBH I;  3A4R A;  3OAW A;  4EEW A;  2KWC A;  3VQI A;  1RFA A;  1WXV A;  2FCS A;  2V3S A;  3ZRF A;  5LLI A;  4BOZ B;  3UIP B;  2L0F A;  3JYU A;  4HWI B;  3DPD A;  2O6V B;  1QZE A;  3VH3 B;  2L7R A;  3ZVV A;  2MSE D;  1P0R A;  3H7S A;  3ENE A;  2KC2 A;  3Q3F A;  4ZYN A;  5JH5 C;  3KUD B;  3UF8 A;  3JSV A;  4AWJ A;  2NPT B;  4NAW A;  3C0R B;  3WIM A;  3RD2 A;  3ZNZ B;  5KHQ A;  3L17 A;  3A4S C;  3R7Q A;  4AUQ C;  3D32 A;  2LVP A;  1OEY J;  3ZLZ A;  3PHX B;  3PPA A;  1LXD A;  4W9G A;  3DDC B;  4JQW C;  3RCZ A;  3M62 B;  1C3T A;  2IY0 B;  3QHT A;  3VH4 B;  2RR9 A;  2OOB B;  3MHS D;  1ZGU B;  2MX2 A;  1WIA A;  2DZI A;  3VHT C;  2MQJ A;  3L0W B;  2CR5 A;  2KLC A;  2J7Q B;  1WGH A;  2JF5 A;  2KOX A;  3KYD D;  2MW5 A;  4IWP A;  1NI2 A;  1P9D U;  2O6V A;  2Y5B B;  4GSW A;  4LJO B;  3NHE B;  3VXW A;  1L7Y A;  1FXT B;  4MDK E;  3L54 A;  2B3A A;  1J0G A;  4EZL A;  3QJZ A;  2G4D B;  3JW0 X;  5FR6 A;  3TJP A;  3TL5 A;  3L08 A;  4B6W A;  3QAQ A;  3VTU A;  1KM7 A;  2O2V A;  3A9K B;  4LJP B;  4TQ1 A;  3VUY A;  1WGY A;  2J0J A;  3EFU A;  2RD0 A;  3N32 A;  3NS8 A;  1K8R B;  2PE9 A;  3UGB B;  4K7W A;  3L13 A;  1H4R A;  4KIK B;  2KWV B;  1WGD A;  2KFJ A;  3SD5 A;  2UYZ B;  3PLU A;  2HJ8 A;  2ZPN A;  3BY4 B;  3PRP B;  4I6L B;  3TBL D;  2WWZ A;  4DHJ B;  2NR2 A;  2KX0 A;  2M1M A;  1WR1 A;  2GMI C;  1CMX B;  5IAA C;  2JZ3 B;  2AL3 A;  1E8X A;  3V6C B;  4NQK E;  1P3Q U;  2ZCC A;  2JUO A;  3HIZ A;  2KK8 A;  5LXI B;  2MBH A;  4WJQ A;  3ALB A;  1UBI A;  3DVG Y;  4G11 A;  3EC8 A;  4HK2 A;  3PTF C;  2JXX A;  2KNB A;  4M8N A;  3WAO A;  2N4F A;  4K7U A;  3MTN B;  4KDI C;  3MJW A;  4BBN C;  1I42 A;  2D2Q A;  3DVG X;  4FJZ A;  2M0X A;  3DVN U;  2IYD B;  2MLB A;  3A9K A;  3VFK A;  1Q1O A;  4DBG A;  5D2M B;  4W9F A;  1GJZ A;  2J0M A;  5GMV A;  2N9P C;  4LDT B;  1Z5S B;  2W9N A;  2ZCB A;  2KAN A;  3PV1 A;  1UEL A;  2GBM A;  2L3Z A;  3HHM A;  2KTF A;  4KIK A;  5G55 A;  3SU8 X;  2BKF A;  4ICV A;  5BO4 B;  4W9J A;  1T0Y A;  1MG8 A;  2LRU A;  3PRE A;  2N7E A;  3VUX A;  1E7V A;  2L05 A;  1WM3 A;  2BYF A;  1S3S G;  3WAN A;  3RYT A;  2NVU I;  4KSK C;  2I1J A;  2JPH A;  3ZTD A;  3B1L X;  5J17 A;  4NY0 A;  3EHV A;  2FCM A;  1F9J A;  1P98 A;  1WH3 A;  1WJN A;  1GG3 A;  2KO3 A;  2Z59 B;  1RAX A;  4E3C A;  4FN2 A;  2A4Z A;  4JGH B;  1WMH B;  5JZE B;  4BKT A;  4DHZ E;  3N3K B;  2NBU A;  1JRU A;  4HCN B;  4XZ4 A;  4ANW A;  1RRB A;  2R2Q A;  1WY8 A;  3H9D A;  1Y8R C;  2WX0 A;  2LZ6 A;  4GMV A;  3NOB A;  2AEH A;  4BKG A;  1EO6 A;  2BYE A;  2DAJ A;  2KLG A;  2N1W A;  4ANU A;  1V5T A;  3AUL A;  3OJ4 B;  2L76 A;  2LXC A;  4PS7 A;  3HM6 X;  4RM8 A;  1GNU A;  1UGM A;  4EZK A;  3PZD A;  2K6D B;  2KVR A;  4LCD E;  3RZW C;  3ML8 A;  4TKN A;  3AU5 A;  2KFK A;  1WXS A;  4YL8 A;  4MGY E;  2DX5 B;  1YIW A;  3DVN V;  1U4A A;  4BOS C;  2LXA A;  3PHW B;  3DQV A;  3M3J A;  5JHB A;  2CS4 A;  4IWO A;  2C9W B;  3UQB A;  1HE8 A;  1EUV B;  4ZRJ A;  3A1Q B;  2O2V B;  1OQY A;  1V49 A;  2KXJ A;  4EZJ A;  1Z2M A;  1WMH A;  3V6E B;  2LAS A;  2A5U A;  4CYE A;  2K8C A;  2RPQ A;  3TCA A;  1YJ1 A;  2DYB A;  5D94 A;  3W1S A;  1E5W A;  2LGY A;  3V62 A;  1V5O A;  1VCB A;  2KN5 A;  3ONS A;  5EDS A;  4W9D A;  3KW5 B;  4IC7 B;  4NPN A;  3O65 B;  3IG3 A;  1NDD A;  4F8C B;  3ZIM A;  2DYM A;  2QHO A;  2YLM A;  2M17 A;  3IVF A;  2N7D A;  4F1S A;  2L0T A;  4HLE A;  1V81 A;  4K81 A;  2DAF A;  1KLV A;  3WAP A;  1WM2 A;  2GOW A;  1WR6 E;  3KUZ A;  2KMC A;  2C7N B;  4ASW C;  3U8Z A;  3W1S C;  4PS3 A;  3T8M A;  3CMM B;  3UQA A;  4A20 A;  1WJ4 A;  1WE6 A;  2WX1 A;  2K8B A;  4GB9 A;  3A1Q A;  4I6P A;  4II3 B;  4BBN F;  4EOY A;  1WX8 A;  3HM3 A;  3KUC B;  4PYU A;  4GIV A;  5DCN A;  2ZEQ A;  2XEW A;  4WQO B;  3V60 A;  4A3O A;  1RLF A;  2KC1 A;  4RM9 A;  1WF9 A;  1WZ0 A;  2PJH A;  2L8J A;  2HD5 B;  4KDL B;  1ISN A;  1M94 A;  2FCN A;  3GZN I;  1G6J A;  2K1F A;  4W9I A;  2EMS A;  2JZZ A;  4G50 A;  2M8S A;  4W9K A;  2DZJ A;  4X57 B;  2KDI A;  1AAR A;  2DZM A;  4WWO A;  4P7I A;  4W9H A;  4MH0 E;  3DBS A;  4M0W B;  2ZVO A;  2D10 A;  2FNJ B;  4DDG D;  4PYZ A;  1WZ3 A;  2N9E B;  2IO3 B;  5E6N A;  4EFO A;  3SHQ A;  3ZRC A;  4EUT A;  3KYC D;  3W1Y A;  1LFD A;  2JRH A;  3M95 A;  2KHW B;  2N9X A;  3AXC A;  3K9O B;  4NNJ B;  4W9E A;  2DEN B;  3GOE A;  4IWQ A;  4FJY A;  2PEA A;  2IO1 B;  3QQ8 B;  1BT0 A;  5HKH A;  4WJP A;  1V2Y A;  1GC6 A;  3VTV A;  1A5R A;  1UBQ A;  4KV2 A;  2KTR A;  4HXD A;  3L10 B;  1P1A A;  4OVV A;  4OVU A;  3QK0 A;  2FUH B;  3S2A A;  1OEY A;  4II2 B;  4IW0 A;  4B95 A;  2MCN B;  2GBR A;  3R66 C;  5CTR C;  2KQS A;  2ZNV B;  2KWU B;  1WXM A;  2IBI B;  4MM3 A;  4URK A;  2WYQ A;  2K25 A;  1XD3 B;  3A9J B;  2ASQ A;  5AEK B;  3BIN A;  4PS8 A;  3APD A;  4ZDV A;  2KZR A;  2KFK B;  2K6Q A;  2VRR B;  2XK5 A;  3TIX A;  4K1R B;  1XQQ A;  4FAD A;  1LQB A;  3N30 A;  3CF6 E;  3PT2 B;  2FID A;  2YVC A;  2KDE B;  5AZF A;  2LJ5 A;  1WGG A;  5D6J B;  1WGR A;  4CO7 A;  2IO0 B;  4A3P A;  1OTR B;  4ICU A;  4WJN A;  4FUL A;  4N9F 4;  4NJ7 A;  4B9K A;  2J0K A;  2KKC A;  3PLV A;  3VVW B;  4DK5 A;  1IYF A;  2I1K A;  2CHW A;  4AJW A;  1WJ6 A;  1J19 A;  2NS5 A;  4HJK A;  3ZDT A;  3AU4 A;  3AI5 A;  2GBJ A;  4HPL B;  4WJO A;  3ECI A;  1S1Q B;  1SE9 A;  2ZVN A;  4GDK A;  1E8Y A;  3Q3J A;  2PPH A;  3RZF A;  2MWS B;  4TV3 A;  2LVQ A;  4IM0 A;  4TUU A;  2EKE C;  1WFY A;  2V4L A;  1X1M A;  2KJ6 A;  3R7R A;  3P2B A;  1WX7 A;  4NQL B;  2DZK A;  4ANV A;  5E6P A;  3QCA A;  4HVB A;  2IO2 B;  3A9J A;  2MBE A;  3T9L A;  1EF5 A;  3UIO B;  4ZRK A;  3IFW B;  5DPW A;  3DCG A;  2K39 A;  5CHV C;  1LM8 B;  3ZDM C;  4TQ0 A;  2JT4 B;  1E90 A;  3PS6 A;  2RGF A;  3QWZ B;  2Z0D B;  5TR5 A;  3WAM A;  1YX6 B;  2JVC A;  2LGX A;  3PGE A;  2NCN A;  4FHK A;  4G3X B;  2FAZ A;  2MBO A;  3PRM B;  2LUE A;  4FA6 A;  4AJY B;  1GC7 A;  4RMA A;  4HDQ A;  4GN1 A;  1TZ1 A;  3ZO5 B;  2ZPY A;  3RUL A;  2GBN A;  4MEL A;  4KSL C;  4JLC A;  4KZC A;  4IM2 A;  2ZNV C;  3QA8 A;  2KDB A;  4FHJ A;  5C1Z A;  3ML9 A;  3QIJ A;  4XX5 A;  5CX3 A;  1TGZ B;  4EKU A;  3TMP B;  5JHA A;  1GUA B;  2LI5 A;  1E7U A;  1WE7 A;  2BWE S;  3K9P B;  3VUW A;  3ZKJ C;  4BVU C;  2C60 A;  4BKS D;  1WJU A;  2N1V A;  2NBW B;  4I6N B;  4BKS A;  2D07 B;  2AYO B;  3V61 A;  1V80 A;  2MBQ A;  4JIO U;  4KVG B;  1J8C A;  2BKR B;  1XT9 B;  3X23 A;  1TBE A;  2UWQ A;  5J18 A;  2KDF B;  1D3Z A;  2LVO A;  4XC2 A;  3PVL A;  2CKH B;  4GDL B;  2OJR A;  2G4S A;  5DPS A;  5LXH A;  3L16 A;  2G45 B;  1H8C A;  4MGK E;  5D7G A;  2KJH B;  1KOT A;  5J2R A;  4GGQ A;  4HCP B;  3NZU A;  3ZNG C;  4AOF A;  4W9C A;  3PRZ A;  2KD0 A;  2KTR B;  3QX1 A;  2IZV B;  3I3T B;  3U7D A;  4DWF A;  4MEM A;  2BWF A;  2MP2 B;  3B08 A;  5DPT A;  3B0A A;  3OJ3 A;  4MSM B;  2BGF A;  1C1Y B;  3UIN B;  3ZTC A;  2O6V D;  4GU2 A;  3X0W A;  5AZG A;  2XK5 B;  2JRI B;  3ZNI D;  1SIF A;  2Z0E B;  3QC8 B;  4K7S A;  1PQS A;  1YQB A;  2D11 A;  1IPG A;  4F7Z A;  1WRD B;  3SDL C;  2NPT A;  5C23 A;  3IBE A;  2R2O A;  2M4N A;  2FCQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...