4GDLA

Crystal structure of human atg12~atg5 conjugate in complex with an n-terminal fragment of atg16l1
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
88
structure length
88
Chain Sequence
KKIDILLKAVGDTPIMKTKKWAVERTRTIQGLIDFIKKFLKLVASEQLFIYVNQSFAPSPDQEVGTLYECFGSDGKLVLHYCKSQAWG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin-like protein ATG12
publication title Structure of the human ATG12~ATG5 conjugate required for LC3 lipidation in autophagy.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 18
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2012-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04110 APG12 Ubiquitin-like autophagy protein Apg12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4gdlA00
1XQQA 2MCNB 4K81A 5L95C 2BKFA 2LUEA 2KOXA 1MG8A 1V86A 1T0YA 2ZPYA 3C0RB 4IC7B 4GDLA 3GOEA 3H6NA 2KO3A 2QHOA 4HCPB 2C9WB 1V6EA 5J17A 2XK5A 5AEKB 1HE8A 4KSLC 1GC7A 4FADA 3RCZA 2IO3B 4MJSB 1RLFA 5FR6A 4CO7A 2MP2B 2UYZB 2GBMA 2N1WA 4NY0A 1GC6A 1R4NI 3Q3FA 5IAAC 3U7DA 2KX3A 1YX6B 3WANA 3AU4A 2R2QA 3KYDD 1Q1OA 2FUHB 1GG3A 3R7RA 2LJ5A 4EFOA 2Z59B 3W1YA 3ZLZA 4MJSA 3ALBA 2MP2A 3HM3A 3H7SA 1EUVB 4MGZE 1WX7A 2KLGA 3VTWA 2KMCA 2C7HA 5AZGA 1ZW7A 2OOBB 1WM3A 4RM8A 3JYUA 1GNUA 4URKA 4IUMB 2EKEC 4WJPA 5AZFA 4OVVA 3ML8A 1PQSA 3A4SC 3VUYA 4HLEA 2KMAA 2MW5A 4HJKA 5J2RA 3H9DA 2JRHA 2J0MA 1XT9B 2KLCA 3L13A 4DDGD 1V81A 3APCA 1L2NA 2K8CA 1WGDA 1UBQA 3CSFA 2HJ8A 2DX5B 1V5OA 4AJWA 1Z5SB 2MBBB 3L10B 2MA9B 2UWQA 4P7IA 2C7MB 4KV2A 4LDTD 5CX3A 1H8CA 2WWZA 3RZFA 2MLBA 1S1QB 5KHOA 3VH3B 4MSMB 1WR1A 1WX8A 3DQVA 4AWJA 2G4SA 2RR9A 3HK0A 3PREA 3RUIB 1IPGA 1WH3A 1WY8A 1YQBA 3H1UA 5GMVA 3UIPB 3KUCB 1UGMA 3HIZA 4FHJA 4WWOA 5L83A 2NBWB 3S2AA 5DPRA 4E74A 3EECA 2N7EA 3WALA 4W9KA 2FAZA 5CHFA 4FLHA 2K25A 3B0AA 3VHTC 3PHXB 2CHXA 1XD3B 1E8ZA 1P0RA 3VAWA 3L16A 3MTNB 5DCNA 2FCMA 2LXCA 1IYFA 2AL6A 1P9DU 2B3AA 3ZRCA 4ZRIA 3RT3B 3MJWA 3NOBA 4FJZA 1JRUA 5KHQA 1YJ1A 4XX5A 1VCBA 3L0WB 4I6LB 4DHJD 1WMHB 3V60A 4B6WA 3QC8B 2NVUI 2NR2A 3ZTCA 4IM3A 2ZCCA 4F8CB 2MX2A 4W9LA 3PT2B 4K7WA 2D10A 3L54A 2GBJA 2KX0A 3SD5A 4HPLB 2R2OA 3V62A 4DDID 3UIOB 1LM8B 4JIOU 2KTRB 3K9PB 1Q0WB 4IWQA 4K7UA 1WMHA 2K6DB 4MGKE 3U30A 1KLVA 1CMXB 4MELA 2DYMA 1WZ0A 3X23A 1WGGA 4TUUA 4ANUA 3NZSA 4DHZB 3D32A 4EZLA 3DBRI 1TGZB 2G3QB 5CHWA 2CS4A 2M8SA 3QCAA 4HXDA 1C1YB 3VXWA 4JL9A 1V2YA 3A1QB 2KTRA 4FA6A 3PVLA 4BFRA 1BT0A 3IG3A 3R7QA 4BOZB 4F7ZA 1OEYJ 1OQYA 2GOWA 2VRRB 2JXXA 2LVOA 2DZJA 3A9KB 2CHZA 3DBLI 3OJ3A 3O65B 1M94A 1YX5B 3UF8A 2I1JA 3ONSA 2MBOA 3R3MA 4OVUA 3WAPA 2EMTA 1F9JA 2G45B 2O6VD 3A1QA 2PEAA 4YL8A 1WGRA 2IY0B 4RM9A 5E6NA 3PRMB 4HDOA 2ZVNA 4GSWA 3PPAA 4IWPA 2BGFA 3A9KA 3RULA 4DBGA 2L76A 1I42A 2LRWA 1FXTB 4ASWC 1U4AA 1KJTA 4W9FA 2FCSA 1ZGUB 4EKUA 2BF8B 4WJQA 3KW5B 4BBNC 2C7NB 3ZKJC 2XBBC 1UH6A 2BYVE 1WZ3A 3X0WA 2MSED 4N9F4 4JGHB 4ZRKA 5CTRC 1E7VA 3PZDA 4MDKE 1V49A 4EEWA 1D3ZA 1RAXA 3M3JA 2IO0B 2KC1A 4GOCA 3DCGA 2AYOB 3PRZA 3ZRFA 4AP4C 2KZRA 3BINA 4NPNA 4HDQA 2IO1B 4GN1A 3TIXA 4E71A 2KJHB 1UBIA 4WWPA 2KQ7A 2O2VB 2NPTB 2DZMA 2KXJA 5D7GA 1WR6E 1OTRB 3SDLC 4J6IA 3K9OB 2K8BA 3KVFB 1WJUA 1SE9A 2ZZPB 3P2BA 3QA8A 4W9CA 4BKSD 2AWTA 4NAWB 2HD5B 3SU8X 1GJZA 2M17A 3OJ4B 3PTFC 5C23A 3U8ZA 5JZEB 4TQ0A 2IYDB 2O2VA 2NPTA 2C5LC 2HE7A 2N4FA 1E5WA 2K39A 3LDZE 3CF6E 3IBEA 1V80A 2DYOA 3T8MA 4W9GA 5J18A 1Q5WB 4ZDVA 1E90A 4TQ1A 1GUAB 2JPHA 2LVQA 4NAWA 1H4RA 3N32A 2KDEB 2WX0A 2Z0DB 3L17A 4WJOA 2RSUA 2LGYA 1J8CA 3JVZX 3IHPC 4AUQC 3WA0A 4K7SA 2A5UA 2KJ6A 3Q3JA 1SGHA 3OAWA 4LDTB 4WJNA 4BOSC 3ENEA 4IM0A 2DZIA 4PS8A 2KWUB 3CSTA 3HHMA 2XEWA 3DVGX 2GMIC 2BWFA 2LVPA 2LGDA 2D07B 4MH0E 3BY4B 4F1SA 4JQWC 1EF1A 2FIFA 2PE9A 4NNJB 2HTHA 5TR5A 4IWOA 1C3TA 1SIFA 3ZDMC 3HM6X 4KDIC 2EMSA 3IFWB 1TZ1A 1WE7A 2C60A 3DPDA 3QHTA 1WRDB 4FBJB 3QK0A 2L00B 2BWES 3TBLD 3PGEA 3M62B 1WJ4A 1WYWB 3KYCD 4HWIB 4BKTA 3EHVA 1A5RA 3NZUA 3PRPB 4PS3A 3ZIMA 3B1LX 1KOTA 4FULA 2L0FA 3DDCB 3DOWA 2KHWB 2NBVB 2CR5A 2ZCBA 4M0WB 3RYTA 4DHJB 3PV1A 2KFJA 1WI0A 2I1KA 1WX9A 1EO6A 3TCAA 4CHKA 2N7DA 3GZNI 2NS5A 3UQBA 4ICUA 4A20A 2CHWA 4TV3A 2KFKB 4EUTA 2WX1A 2IZVB 3VH4B 1ISNA 4GB9A 4G3XB 4LJPB 1TTNA 2DHZA 2LI5A 4MSQB 2A4ZA 2KVRA 3VFKA 1NBFC 2PPHA 2PE6B 3RZWC 4KSKC 1VD2A 1Z2MA 2MBHA 3ZNID 3ZNHB 1J19A 2BYEA 1YIWA 3ML9A 1WFYA 4ANWA 4RMAA 2K6QA 3QAQA 1P3QU 3AI5A 4GXBA 4A3PA 2KFKA 1WF9A 3JW0X 1WE6A 2FCNA 2WDTB 4BKGA 1E8YA 2AL3A 3NHEB 4HPMB 4X57B 3WAMA 3ZW3A 4LCDE 3JSVB 3WIMA 1WXSA 2JVCA 5LXHA 5DPWA 2DYBA 4XC2A 2LZ6A 4G0NB 2JUOA 3ZVVA 3SHQA 2JRIB 3NY5A 3LJ3A 4AOFA 1WGYA 3PSEB 2J0JA 5HKHA 3T9LA 3KH0A 1P98A 3KUZA 2K1FA 2MBEA 1WM2A 4BVUC 2O6VB 4ANVA 3JSVA 4GDKB 4II2B 4ANXA 1OEYA 4DK5A 4E3CA 5DPTA 1RRBA 2V3SA 2V4LA 2D11A 2KQSA 3IVFA 4NQLB 2JZZA 1E8WA 4HVBA 2KK8A 4HK2A 1I35A 2J0KA 2GBRA 1LXDA 2NBUA 1E8XA 2JZ3B 2MRPA 3QJZA 3VTUA 2DZKA 5JH5C 4G11A 1S3SG 4MGYE 2D3GA 3R66C 2O6VA 4GDKA 2BPSA 1E7UA 2JY6A 2M4NA 2FCQA 1J0GA 4II3B 2LASA 4PYUA 1UELA 4FJYA 4IG7B 2N9PC 2G4DB 3A33B 2J7QB 4GIVA 2YLMA 4WAAA 2KNBA 2MQJA 1KM7A 5D94A 4EZKA 4XZ4A 4IW0A 1WXAA 2CU1A 3N3KB 4WWNA 5CHVC 1EF5A 4MGIE 3UQAA 4LJOB 4HCNB 2LGXA 4MM3A 3DVGY 4FJVB 1WJNA 5C1ZA 2N1VA 2KWVB 5E6PA 4KDLB 2JWZA 3AULA 4W9DA 5LXIB 1TBEA 2ZJDA 3TL5A 5JHAA 1ZKHA 3AXCA 2DAJA 3AU5A 3OLMD 4K1RB 3APDA 4DXAB 4KIKB 1WIAA 3VVWB 3VUWA 2L05A 3VTVA 4BBNF 1YD8U 4GGQA 1QZEA 3QWZB 2JT4B 3UGBB 1UD7A 2DENB 3B08A 1V5TA 2KC2A 3QX1A 2N9EB 4AJYB 2L7RA 3PS6A 2IO2B 4JLCA 4IM2A 2YVCA 2L3ZA 3CMMB 3APFA 3ZTDA 2KJRA 4BKSA 4M8MA 3V6EB 2M0XA 4KIKA 2ZNVC 3A4RA 4EZJA 2ZNVB 3H7PB 3A9JB 2WYQA 4I6PA 4W9IA 2GBNA 1WXMA 2BYFA 2IBIB 5D2MB 1X1MA 1WGHA 2NCNA 2IY1B 1UZXB 2ZVOA 3EFUA 5EDSA 4A3OA 2Y5BB 1L7YA 1V9JA 3V6CB 3DVNV 4ZRJA 3H7PA 1R4MI 2W9NA 2ZEQA 3A9JA 3W1SC 2M1MA 4PYZA 5G2NA 2KD0A 3ZNZB 3DVNU 4DHZE 4G50A 5JHBA 4FHKA 2OJRA 4NJ7A 2ASQA 4NJ6A 2LXAA 4W9JA 2N9XA 4KZ0A 4CYEA 4M8NA 4KZCA 2L8JA 2KN5A 4MEMA 5DPSA 3PLVA 3N30A 3RD2A 2K8HA 4WQOB 3NS8A 4PS7A 5AZHA 1OGWA 4GMVA 4KVGB 1WJ6A 3W1SA 2MBQA 5IA7A 1LQBA 2RPQA 4ICVA 2L0TA 2Z0EB 3QARA 5D6JB 3WAOA 4W9HA 2FIDA 2D2QA 2ZPNA 2LRUA 1IP9A 2KDFB 3ZDTA 1RFAA 3PLUA 2RGFA 2KKCA 3M63B 2CKHB 4W9EA 3QIJA 5E6OA 5G55A 3V61A 2RD0A 4TKNA 3TJPA 1LFDA 2BKRB 4DWFA 3TMPB 1NDDA 3EC8A 3PHWB 2MWSB 1Y8RC 2KWCA 3VDZA 1WXVA 1NI2A 2KTFA 2LWPA 2PJHA 4GU2A 5BO4B 3ZNGC 4B95A 3I3TB 1G6JA 3DBHI 2DAFA 1AARA 4NQKE 4I6NB 3ZO5B 2JF5A 3MHSD 2KANA 3L08A 2FNJB 2LD9A 3ECIA 1P1AA 2GBKA 2AEHA 4ZYNA 3VQIA 4EOYA 3VUXA 1K8RB 3UINB 4B9KA 4GDLB 3M95A 4FN2A 3QQ8B 3KUDB 3DBSA 2REXA 2V1YA 2XK5B 3ZUNA 2KDIA 2KDBA 5LLIA
chains in the Genus database with same CATH superfamily
2MCNB 4K81A 2BKFA 2WLBA 1E6EB 2KDMA 4UDUC 1T0YA 4YSXB 2WXFA 4ZHPA 1FCCC 4RFBA 2KO3A 2XK5A 1HE8A 4JE3B 4USAA 4MJSB 5FR6A 4HJGE 2GBMA 2N1WA 3RNAC 4YSZB 1R4NI 4AQ7A 2BQQA 3OWEB 4H2AA 3WANA 3HVZA 3MC0B 4MJSA 3H7SA 1LO5D 4ZYSA 3NG0A 1ZW7A 1V97A 1WM3A 2DWQA 4LNOA 1N63A 5AZFA 4OVVA 3A4SC 2KMAA 4HJKA 4OZAA 1L2NA 2K8CA 3MP9A 4AJWA 1MHXA 2KVZA 2MA9B 2UWQA 4P7IA 4KV2A 4LDTD 2MLBA 2Y5PA 4YTNB 4MSMB 1WX8A 4K3CA 3PREA 1IPGA 3UIPB 3WCQA 4FHJA 4WWOA 3DWMA 5DPRA 4E74A 3WALA 1BXTA 3PHXB 4HKQA 4CQNA 1VZ8A 3MTNB 5DCNA 2LXCA 1P9DU 3RT3B 1JRUA 4MT5A 4I6LB 2IGGA 1MI0A 4N58A 4IM3A 2ZCCA 1D5ZC 2BS2B 1ZPSA 4K7WA 2KX0A 4HPLB 2R2OA 1LM8B 2J52A 1Q0WB 4MGKE 4MELA 1JMLA 4ANUA 4KX6B 4DHZB 3DBRI 2G3QB 3KQ4A 2JYTA 5CHWA 2M8SA 4HXDA 3MC8A 3ZJTA 4JL9A 1V2YA 3A1QB 1TY2A 2KT7A 2JXXA 2WP9B 2BBCA 1NYRA 4D2KA 2WXGA 3A1QA 1YQ3B 2Y3AA 4YL8A 1WGRA 4RM9A 1E0ZA 4HDOA 3GS2A 4GSWA 3PPAA 4IWPA 2L76A 1I42A 1KJTA 1JROA 3RNFC 2ONQA 4WJQA 1MFWA 2PLPA 2WXIA 4ZRKA 3N1ZC 1V49A 1D3ZA 1A70A 2L1AA 1RAXA 2K22A 2AYOB 4HDQA 3TIXA 1UBIA 2KQ7A 2ICIA 2KXJA 3C19A 4J6IA 3K9OB 3R8BA 3GP7A 4DXGA 2JX5A 4W9CA 2WXPA 3SU8X 2HD5B 1GJZA 5BMHA 2IYDB 1T5XD 2WU2B 1ROEA 3AN1A 3CF6E 2DYOA 5J18A 5C3JB 1E90A 4TQ1A 2X8XX 1H4RA 3N32A 4WJOA 3VRAB 3L17A 4N6EB 2LGYA 1T3QA 2KJ6A 2EKIA 1SGHA 3DHHC 4LDTB 2DZIA 1RFKA 2WXKA 2GMIC 2VH1A 2LVPA 2WS3B 2D07B 2LGDA 3P4RB 4DQOC 2RDBC 4NNJB 2HTHA 4IWOA 3ZDMC 3HM6X 4KDIC 4QAYA 1K53A 2PW9A 1TZ1A 3PGEA 5EE1A 3AEEB 1A5RA 3NZUA 3PRPB 4PS3A 2L0FA 4A6QA 3DDCB 3DOWA 1T0SC 2CR5A 4M0WB 4PK1A 3MC9A 1WI0A 1KFYB 3GZNI 3UQBA 4TV3A 1MG4A 1ISNA 4LJPB 4M0WA 1UF0A 4MSQB 2KVRA 1QQRA 2MBHA 3ZNID 1F77A 1J19A 2K6QA 1K51A 5HHDG 2BYTA 1WE6A 2PVGC 2DBYA 2PKOA 1ET6A 3JSVB 1TIFA 2JUOA 3SHQA 3CIRB 3PSEB 1ZE3D 4C4VB 2MBEA 3JSVA 1QILA 1GOZA 2V3SA 4NQLB 2KQSA 3AE8B 1E8WA 1I35A 1LXDA 2MRPA 1FCLA 3VTUA 2DZKA 5JH5C 4C4VA 1S3SG 2D3GA 4L1BA 2LASA 3W2DA 4PYUA 1I4RA 2N9PC 2J7QB 4WAAA 3B9JA 2MQJA 1TYGB 1C4AA 1YNTE 3AB5A 4XDDA 3J9CA 3UQAA 1JALA 3DVGY 4FJVB 2N1VA 2KWVB 4KDLB 4YWGG 5LXIB 3BVMA 4K1RB 2DAJA 3AU5A 3APDA 4KIKB 1FRRA 1EWYC 2JQRB 2L05A 5T8IA 1YD8U 1QZEA 2JT4B 2DENB 2QJLA 2N9EB 2L3ZA 1V8CA 2KJRA 3AEBB 4IOIE 3Q8EA 3RNEC 4KIKA 1C76A 3U52E 1E10A 4I6PA 2GBNA 1WXMA 2BYFA 2IBIB 4JWSC 2IY1B 4A3OA 4YT0B 5FK9C 4DXFA 2XN9C 1L7YA 1V9JA 4ZRJA 3I57A 3W1SC 2INNE 2RDHA 2WHIA 1L6VA 5JHBA 4FHKA 1XCQL 1OFFA 4JWUC 4M8NA 4KZCA 2KN5A 3ABVB 5DPSA 3PLVA 3RD2A 2K8HA 2M56B 4KKJA 3NS8A 5AZHA 1OGWA 2FUG1 4IKGA 2SAKA 5IA7A 1DOYA 2L0TA 3QARA 3PZ7A 4RGOS 1V1PB 1JWMD 1IP9A 3ZDTA 1RFAA 1YN5A 4W9EA 3QIJA 5E6OA 4TKNA 3TJPA 1TS3A 3TMPB 1NDDA 4YTPB 1Y8RC 4HRSA 3VDZA 3ZNGC 1V1PA 4B95A 3DHIC 2GB1A 2DAFA 1AARA 4Q2JA 2KANA 3L08A 2HTME 1DYQA 3P1MA 4ZYNA 1JRPA 4EOYA 3VUXA 3UINB 3M95A 3AE1B 2BT6A 1C3TA 1JWAD 5LLIA 2WXOA 4KGSA 2OEDA 3NVWA 3HRDD 2LUEA 2KOXA 2J42A 1VJKA 3H6NA 3TEXA 1BUIC 5G5HA 1XLQA 3Q3OC 4FADA 4BAXA 1LGRA 2MP2B 4NY0A 3NJTA 1YX6B 3AU4A 2R2QA 2E3TA 2MJEA 2Z59B 1YJIA 2VH2A 4TSSA 4R3DA 2MP2A 4ARCA 2QIEB 3N9YC 2C7HA 5AZGA 2OOBB 4RM8A 2K9XA 3JYUA 3VUYA 2QCZA 1UUPA 5J2RA 2JRHA 3R2TA 3L13A 1QOAA 3APCA 1GAQB 2HJ8A 1V5OA 2MBBB 3RZFA 1S1QB 2QMTA 1WR1A 4LNIA 1YQBA 1WY8A 3H1UA 5EE9A 1FXIA 1UGMA 2NBWB 5GXGB 3EECA 2N7EA 3V05A 5CHFA 2WDRB 3B0AA 3AEGB 1ZDVA 1E8ZA 1WXQA 2GRIA 4OW0A 1L4ZB 2LFIA 3IT6B 4XX5A 3ZJVA 4DHJD 1WMHB 3V60A 3TEYA 2MJDA 3Q3MC 1SEBD 3ZTCA 1I4GA 2OJWA 1SSNA 2D10A 4JIOU 1KLVA 1STEA 4IWQA 1WMHA 2V0GA 2IDYA 3VRBB 3NZSA 4RGNA 3BK1A 2WXHA 2CS4A 4RGMA 1HA5A 4RGTA 4NJCA 3VXWA 1XLOA 4LLGM 1BT0A 3IG3A 3R7QA 4F7ZA 5I4DA 2GOWA 3FC4A 4OVZA 3A9KB 2N9LA 3ONSA 2MBOA 2WXMA 3LYYA 3U7ZA 3Q2AC 2W82A 3DWGC 1TKEA 4MACA 3Q8FA 3RULA 2BGFA 3A9KA 1NYQA 4J3OD 4B0EA 4EKUA 2J4XA 4OHJA 3BK2A 4BBNC 3X0WA 4JGHB 1CZPA 4YTMB 1SB3C 3B2FA 5CTRC 1C77A 4MDKE 4EEWA 3NVYA 2KC1A 2LEKA 4AP4C 3PRZA 4N59A 3BINA 3BWUD 3RMKC 5D3IB 2NPTB 3SDLC 3KVFB 1JCKB 2FE8A 2YEPB 3QA8A 2M17A 3MHZA 3PTFC 5HFYA 3AE2B 3U8ZA 4TQ0A 4KKIA 2G9HD 2LHEA 2NPTA 2W55A 2N4FA 2MH7A 3TEZA 2K39A 3LDZE 2LHDA 3IBEA 4ZDVA 2H88B 1TT5B 2LVQA 1PYWD 2RSUA 1QKZA 2DLBA 2KACA 2R61A 3GB1A 2A5UA 4K7SA 4WJNA 3OAWA 4ARIA 3ENEA 3DBLB 3L4PA 4PS8A 2KWUB 4M02A 3BYTB 3HHMA 2LGIA 3Q8CA 2BB6A 5AUIA 4MH0E 3BY4B 2X38A 2EMSA 1WE7A 3QHTA 1WRDB 4XYCA 4FBJB 3QK0A 2INCC 3UI3A 3ZJUA 1KLUD 1WJ4A 1WYWB 4HWIB 4ZRQA 4JX1C 2KWDA 3ZIMA 5EE3A 2KQ4X 1Q10A 4DHJB 3RYTA 2N9KA 3Q14C 1EO6A 3TCAA 3LB8C 4EUTA 2IZVB 3VH4B 3NVVA 4C00A 2DHZA 2LI5A 1MVKA 5E6JA 2A4ZA 3VFKA 4KSKC 1VD2A 3ZNHB 2BYEA 4ANWA 4RMAA 4C56C 1EM7A 3C8YA 1E8YA 3NHEB 1D6EC 3WAMA 1WXSA 1PGAA 2LZ6A 3MFGA 4G0NB 3ZVVA 4AOFA 3NY5A 2QILA 3FAHA 1WM2A 4GDKB 4II2B 1OEYA 4REZA 2JZZA 4HVBA 2KK8A 1VZ7A 1DGJA 3ETRA 3QJZA 4MGYE 1V1OA 4GDKA 2JY6A 2PMVA 4IG7B 3AE3B 3N20C 4MH8A 1HEZE 1MJDA 1R4MB 2YLMA 4GIVA 4EZKA 4IW0A 1WXAA 1ENFA 2CU1A 3N3KB 5CHVC 3AMZA 1KRHA 5G5GA 3GE8C 4RF0A 1KH0A 1TBEA 1D5XC 1UWXA 5JHAA 1ZKHA 1WIAA 1P7EA 3E9SA 2KN4A 1V5TA 3AH7A 2LUMA 2L7RA 3PS6A 3B2GA 3AEDB 4IM2A 2AQ1B 3APFA 1J7BA 3BVGA 3RPFC 2M0XA 1GB4A 1RWSA 2ZNVC 3A4RA 3H7PB 1F1HA 4RCOA 4W9IA 1X1MA 2J53A 2RPVA 1WGHA 3AV8A 1UZXB 1JQ4A 3NVZA 1YQ4B 2YEPF 3RNGC 3DVNV 3H7PA 3TSSA 2HJ1A 2M1MA 4PYZA 4DHZE 1MPEA 2ASQA 2V3PA 3OG5A 4KZ0A 1SBBB 4CYEA 3BYYB 3N30A 5EE0A 4FXCA 3SEBA 2LGSA 4WQOB 4PS7A 4KVGB 1WJ6A 3W1SA 2I38A 2MBQA 4ICVA 5D6JB 1R4NB 3EC8A 3PHWB 2KWCA 1WRIA 4ZOHC 3DBHI 4GLSC 4NQKE 4I6NB 5HI1A 1E9MA 2JF5A 3ECIA 1NVID 1J7CA 2AEHA 1I4PA 2MHJA 3IAS1 2N7JA 1CK1A 1VRAB 4FN2A 1BMLC 3DBSA 2B76B 2REXA 2M0AA 1XCTL 1XQQA 2UU7A 4A8XC 1MG8A 1V86A 5BMGA 2K3UA 2ZPYA 4IC7B 2L83A 2C9WB 4XDCA 3I9V1 5J17A 4KSLC 3RCZA 3AE7B 4CO7A 3Q3NC 2UYZB 1UGJA 1GC6A 2AX5A 1QF6A 3U7DA 3I63C 3KYDD 1Q1OA 1GG3A 3R7RA 4ZHOA 3ALBA 3HM3A 2WXLA 1WX7A 3VTWA 2KMCA 3EFCA 1TKGA 4URKA 4IUMB 4WJPA 1UNSA 1PQSA 4HLEA 2WDQB 3MJ5A 3H9DA 4JPSA 4YXDB 2J0MA 1XT9B 2KLCA 1I7HA 1V81A 1F2RC 1UBQA 3RN9C 3SFDB 3KWLA 2C7MB 3AEFB 2WWZA 1JW9D 5KHOA 3VH3B 3R2IA 2W54A 3DQVA 2G4SA 2RR9A 3HK0A 3RUIB 5GMVA 3KUCB 1TS4A 1SXTA 3P42A 2BS3B 3HIZA 3W5VB 5L83A 2FAZA 2K25A 2Y5CA 2G1EA 2CHXA 1QOFA 1XD3B 4B0MA 1P0RA 3VAWA 3L16A 2LJIA 2B3AA 3P63A 4YSYB 1FFUA 4KGRA 3AE6B 5KHQA 3H8HA 1YJ1A 3L0WB 3QC8B 1EWCA 2NR2A 4LK0M 4F8CB 4W9LA 3PT2B 4US8A 3V62A 1OQQA 2KTRB 3K9PB 4K7UA 3TUOA 3KWVA 1YN4A 3U30A 1WZ0A 1VZ6A 1PGXA 2H89B 3X23A 1WGGA 3D32A 3QCAA 2NMQA 2KTRA 5H92C 3PVLA 4BOZB 1ZXIA 1OEYJ 1OQYA 2VRRB 3N1YC 2LVOA 2DZJA 1N60A 3DBLI 2KYWA 3O65B 1YX5B 2I1JA 3WAPA 2EMTA 2BTEA 1FPYA 1F9JA 3LXFA 2O6VD 1SJED 4IDIA 5HG2A 4AS1A 4WAFA 2WU5B 3PRMB 2ZVNA 4C7YA 5TSSA 1AYFA 2D5GA 1ZGUB 2BF8B 3KW5B 3ZKJC 2BYVE 1WZ3A 4O1NA 2L52A 1B1ZA 1HTQA 1XLNA 4GOCA 3DCGA 2KZRA 4NPNA 1KTKA 4GN1A 4E71A 2DZMA 5D7GA 1WR6E 2K8BA 2ZZPB 2AWTA 1VDVA 1CQVA 5C23A 5JZEB 1SE3A 1T0RC 1N5WA 3GZNB 1RM6C 1V80A 4W9GA 1Q5WB 1GUAB 2JPHA 3I5JC 1WWTA 2KDEB 2WX0A 3TEWA 3IHPC 4AUQC 1OQRA 4BOSC 2Z8LA 3CSTA 3P4PB 2XEWA 3DVGX 4S0RA 4LNFA 4JQWC 2NTSA 3URYA 1L0XB 1R7SA 1SIFA 3IFWB 2C60A 3TBLD 1IBXB 3M62B 2RDGA 1FIQA 4BKTA 1ZXHA 5H8YE 2W3SA 2V4IB 2KHWB 2NBVB 3FKYA 3PV1A 2KFJA 2I1KA 1WX9A 2ZW1A 2NS5A 1IBXA 4ICUA 1QT9A 4A20A 2CHWA 1GB1A 2WX1A 4GB9A 5IO9A 4G3XB 4M00A 3U2SC 1NBFC 1YIWA 2WXQA 2WXRA 3ML9A 4HEA1 3QAQA 3AI5A 4A3PA 1YJJA 1WF9A 2WDTB 2FCNA 3NUHB 2AL3A 1YMHE 4X57B 3ZW3A 1XF5L 4LCDE 3WIMA 2JVCA 5DPWA 2WGSA 2CJOA 3LJ3A 1WGYA 2J0JA 3T9LA 2K1FA 1KLGD 1NENB 4BVUC 2O6VB 2GI9A 4ANVA 4ANXA 4RF1A 3Q69A 2I2YA 2V4LA 1L5PA 2D11A 4HK2A 2J0KA 1I4QA 2NBUA 2PVOD 1RYJA 1FNUA 4G11A 3ZXVA 2FBWB 3R66C 2M19A 2NTTA 2O6VA 2BPSA 1E7UA 2M4NA 1J0GA 1TJEA 4II3B 1PGBA 2BVCA 2V3NA 5LNK1 1YN3A 4NZLB 2W3RA 1YOVB 2KNBA 1KM7A 4XZ4A 2WNMA 1TS2A 4LJOB 4XE0A 1HQRD 3IAM1 1PFDA 2AQ3B 2TSSA 2IPKD 4P1CC 4W9DA 3AM9A 4DXAB 3VVWB 1ACCA 1KF6B 3VUWA 5C2TB 3VTVA 4BBNF 1N6ZA 1UD7A 1I4HA 1QLBB 3B08A 1L0VB 4XWWA 4AJYB 4NAMA 2IO2B 4JLCA 2INPE 3AE4B 3CMMB 2YVCA 3ZTDA 1HZ6A 1FO4A 4M8MA 4XWTA 3V6EB 1ZP0B 2ZNVB 3A9JB 2WYQA 2WDVB 1WSPA 5D2MB 3EFUA 1XO3A 2ZVOA 4LTUA 1SIJA 3VR9B 4M01A 2QEJC 5BYSA 3A9JA 4G50A 4LNNA 2OJRA 4WWMA 1N5XA 1AN8A 3ZQ4A 2PTLA 2L8JA 4MEMA 3O13A 2CJNA 1WGKA 3DHGC 4GMVA 2RPQA 4W9HA 2FIDA 3RFZB 2D2QA 3PLUA 2RGFA 2CKHB 1T6BX 1QOBA 3V61A 2OHFA 4WH4A 2BKRB 4DWFA 2MWSB 3AE5B 2KTFA 2LWPA 3V3XA 3I3TB 4P6VF 4US9A 3ZO5B 3MHSD 2FNJB 1P1AA 3W9CB 3RNBC 3VQIA 3SR6A 1VLBA 4WURA 4B9KA 4GDLB 3KUDB 2V1YA 1J7AA 3ZUNA 2KDIA 2KDBA 5L95C 3AECB 1L4DB 3C0RB 4GDLA 3GOEA 2QHOA 4HCPB 2WQYB 1V6EA 1Y56A 5AEKB 1GC7A 2IO3B 1RLFA 1NEKB 4KGTA 1C79A 4RNAA 1VR9A 3Q3FA 5IAAC 2KX3A 2FUHB 2LJ5A 4EFOA 3W1YA 3ZLZA 3NRZA 2BB5A 1EUVB 4MGZE 2KLGA 3HUIA 2QC8A 1GNUA 2EKEC 4C7ZA 3ML8A 2MW5A 4DDGD 1WGDA 3CSFA 2DX5B 1Z5SB 5CX3A 3L10B 1H8CA 3PO0A 2IGHA 4RH6A 4AWJA 1WH3A 4ACFA 1T0QC 3S2AA 3SFEB 1ET9A 1HTOA 1ESFA 4W9KA 2D3AA 4FLHA 3EGRA 3VHTC 1N62A 3RI7C 3IT4B 2FCMA 1IYFA 2AL6A 3ZRCA 2QSDA 1SJHD 4ZRIA 3MJWA 3NOBA 4FJZA 1QOGA 1VCBA 5IN7A 4B6WA 2NVUI 2IGDA 2MX2A 1F52A 1TS5A 2LMCA 3L54A 4EE2A 2GBJA 4P1BC 3SD5A 2D3CA 4DDID 2ACZB 3UIOB 2D3BA 2K6DB 3AE9B 1CMXB 2DYMA 2AQ2B 1AWDA 4TUUA 4EZLA 1TGZB 3P4QB 4PT5A 3BZDB 1C1YB 1EU4A 3EUB2 3FILB 3BVZA 1C78A 4FA6A 4BFRA 4A9AA 2JYEA 2QDFA 2WXJA 5D3DA 2JWUA 2SEBD 2CHZA 3OJ3A 2MJ3A 2K5PA 4A55A 5FKAC 2Q5WD 1M94A 3UF8A 1L0YB 3R3MA 4OVUA 1SE4A 2N0SB 2G45B 3FILA 2PEAA 2VZKD 1L6UA 2IY0B 1GPXA 5E6NA 1C4PA 2JXTA 4DBGA 5BMIA 1FRDA 1FXTB 2JZPA 2LRWA 4LNKA 4ASWC 1U4AA 4W9FA 2FCSA 3PZ8A 2C7NB 2PIAA 3GE3C 2XBBC 1UH6A 5JXVA 3ZYYX 4BZAA 2MSED 4N9F4 4P16A 1IGDA 1C9FA 1E7VA 3E56A 1UWMA 3PZDA 4OZBA 3T3OA 4WQMA 3M3JA 2IO0B 3ZRFA 2IO1B 2ZW0A 2KJHB 4WWPA 2O2VB 3Q8BA 3NS1A 1OTRB 3W5UB 1WJUA 1SE9A 3P2BA 4BKSD 4XGAB 4NAWB 4HKZE 3OJ4B 2O2VA 2C5LC 2HE7A 5IP4D 1E5WA 1ZDXA 3DBRB 3T8MA 4K3BA 4NAWA 2V9HA 2Z0DB 1SE2A 4C80A 1J8CA 3JVZX 1JWSD 3WA0A 3Q3JA 1MHHE 4IM0A 1PDXA 2HDEA 1FM0D 3AEAB 3P4SB 2BWFA 4F1SA 1EF1A 2FIFA 2PE9A 3VR8B 5TR5A 3EA6A 1D5MC 5IOIA 3DPDA 1B9RA 2L00B 4L2YA 2BWES 2MEKA 3KYCD 3EHVA 3B1LX 1KOTA 4FULA 2BS4B 1I4XA 2ZCBA 4CHKA 2N7DA 3N1XC 1DOIA 5IKCM 2KFKB 1FXAA 2IJ0A 1TTNA 4WIPA 1IUEA 1XLPA 2PPHA 2PE6B 3RZWC 3ZXRA 1Z2MA 1K52A 1WFYA 4ITKA 1P3QU 1K50A 4GXBA 1XXGA 2KFKA 3JW0X 4BKGA 4HPMB 1D4BA 4TMAB 1IGCA 5LXHA 3T3NA 1F0ZA 2DYBA 4XC2A 2JRIB 5HKHA 1SF0A 3KH0A 1P98A 3KUZA 3ZGZA 2VZKB 4DK5A 4E3CA 2EELA 5DPTA 1RRBA 4A90A 3IVFA 2GBRA 1E8XA 2JZ3B 3RNCC 1HXYD 1WYGA 3CWIA 2E6XA 2XNAC 2FCQA 4L23A 2L32A 1FNWA 1UELA 4FJYA 2BW2A 4MM3B 1HZ5A 2G4DB 3A33B 1JWBD 5D94A 2KAJA 4WWNA 1EF5A 4MGIE 4HCNB 2LGXA 4MM3A 1M4VA 1P7FA 1WJNA 5C1ZA 2INDC 5E6PA 2JWZA 1E7PB 2JSVX 3AULA 3TL5A 2ZJDA 3AXCA 3OLMD 4HROA 1CJEA 4GGQA 4HPPA 2WXNA 3QWZB 3UGBB 2KC2A 3QX1A 1FEHA 2KMMA 1ZOYB 1FD6A 5MPOA 3U4EG 4BKSA 4EZJA 1AW7A 3DBHB 2GLSA 5BYQA 2NCNA 5EDSA 2Y5BB 2CU3A 3Q6BA 1EU3A 4S17A 3V6CB 1R4MI 2W9NA 2ZEQA 1JWUD 3BIID 5G2NA 2KD0A 3ZNZB 3DVNU 2K0PA 4NJ7A 4NJ6A 2LXAA 4ZRPA 4W9JA 2N9XA 5AUKA 3Q8AA 1TKYA 1NI3A 1LQBA 5FR3A 1FMAD 1TY0A 2Z0EB 2ON8A 3WAOA 1XEEA 2ZPNA 2LRUA 1FFVA 2KDFB 2KKCA 3M63B 5G55A 2RD0A 1LFDA 5BYRA 1TZOA 2JU6X 3NZ3A 1WXVA 1F2RI 1C4CA 1NI2A 2PJHA 5BO4B 4GU2A 1G6JA 1FNVA 1PUTA 2LD9A 2GBKA 3HVDA 3IXSA 1ZUD2 2RMMA 1DOXA 1K8RB 4OZCA 3QQ8B 2DNFA 2XK5B 3KLSX 1N61A
chains in the Genus database with same CATH topology
1XQQA 2MCNB 4K81A 5L95C 2BKFA 2LUEA 2KOXA 1MG8A 1V86A 1T0YA 2ZPYA 3C0RB 4IC7B 4GDLA 3GOEA 3H6NA 2KO3A 2QHOA 4HCPB 2C9WB 1V6EA 5J17A 2XK5A 5AEKB 1HE8A 4KSLC 1GC7A 4FADA 3RCZA 2IO3B 4MJSB 1RLFA 5FR6A 4CO7A 2MP2B 2UYZB 2GBMA 2N1WA 4NY0A 1GC6A 1R4NI 3Q3FA 5IAAC 3U7DA 2KX3A 1YX6B 3WANA 3AU4A 2R2QA 3KYDD 1Q1OA 2FUHB 1GG3A 3R7RA 2LJ5A 4EFOA 2Z59B 3W1YA 3ZLZA 4MJSA 3ALBA 2MP2A 3HM3A 3H7SA 1EUVB 4MGZE 1WX7A 2KLGA 3VTWA 2KMCA 2C7HA 5AZGA 1ZW7A 2OOBB 1WM3A 4RM8A 3JYUA 1GNUA 4URKA 4IUMB 2EKEC 4WJPA 5AZFA 4OVVA 3ML8A 1PQSA 3A4SC 3VUYA 4HLEA 2KMAA 2MW5A 4HJKA 5J2RA 3H9DA 2JRHA 2J0MA 1XT9B 2KLCA 3L13A 4DDGD 1V81A 3APCA 1L2NA 2K8CA 1WGDA 1UBQA 3CSFA 2HJ8A 2DX5B 1V5OA 4AJWA 1Z5SB 2MBBB 3L10B 2MA9B 2UWQA 4P7IA 2C7MB 4KV2A 4LDTD 5CX3A 1H8CA 2WWZA 3RZFA 2MLBA 1S1QB 5KHOA 3VH3B 4MSMB 1WR1A 1WX8A 3DQVA 4AWJA 2G4SA 2RR9A 3HK0A 3PREA 3RUIB 1IPGA 1WH3A 1WY8A 1YQBA 3H1UA 5GMVA 3UIPB 3KUCB 1UGMA 3HIZA 4FHJA 4WWOA 5L83A 2NBWB 3S2AA 5DPRA 4E74A 3EECA 2N7EA 3WALA 4W9KA 2FAZA 5CHFA 4FLHA 2K25A 3B0AA 3VHTC 3PHXB 2CHXA 1XD3B 1E8ZA 1P0RA 3VAWA 3L16A 3MTNB 5DCNA 2FCMA 2LXCA 1IYFA 2AL6A 1P9DU 2B3AA 3ZRCA 4ZRIA 3RT3B 3MJWA 3NOBA 4FJZA 1JRUA 5KHQA 1YJ1A 4XX5A 1VCBA 3L0WB 4I6LB 4DHJD 1WMHB 3V60A 4B6WA 3QC8B 2NVUI 2NR2A 3ZTCA 4IM3A 2ZCCA 4F8CB 2MX2A 4W9LA 3PT2B 4K7WA 2D10A 3L54A 2GBJA 2KX0A 3SD5A 4HPLB 2R2OA 3V62A 4DDID 3UIOB 1LM8B 4JIOU 2KTRB 3K9PB 1Q0WB 4IWQA 4K7UA 1WMHA 2K6DB 4MGKE 3U30A 1KLVA 1CMXB 4MELA 2DYMA 1WZ0A 3X23A 1WGGA 4TUUA 4ANUA 3NZSA 4DHZB 3D32A 4EZLA 3DBRI 1TGZB 2G3QB 5CHWA 2CS4A 2M8SA 3QCAA 4HXDA 1C1YB 3VXWA 4JL9A 1V2YA 3A1QB 2KTRA 4FA6A 3PVLA 4BFRA 1BT0A 3IG3A 3R7QA 4BOZB 4F7ZA 1OEYJ 1OQYA 2GOWA 2VRRB 2JXXA 2LVOA 2DZJA 3A9KB 2CHZA 3DBLI 3OJ3A 3O65B 1M94A 1YX5B 3UF8A 2I1JA 3ONSA 2MBOA 3R3MA 4OVUA 3WAPA 2EMTA 1F9JA 2G45B 2O6VD 3A1QA 2PEAA 4YL8A 1WGRA 2IY0B 4RM9A 5E6NA 3PRMB 4HDOA 2ZVNA 4GSWA 3PPAA 4IWPA 2BGFA 3A9KA 3RULA 4DBGA 2L76A 1I42A 2LRWA 1FXTB 4ASWC 1U4AA 1KJTA 4W9FA 2FCSA 1ZGUB 4EKUA 2BF8B 4WJQA 3KW5B 4BBNC 2C7NB 3ZKJC 2XBBC 1UH6A 2BYVE 1WZ3A 3X0WA 2MSED 4N9F4 4JGHB 4ZRKA 5CTRC 1E7VA 3PZDA 4MDKE 1V49A 4EEWA 1D3ZA 1RAXA 3M3JA 2IO0B 2KC1A 4GOCA 3DCGA 2AYOB 3PRZA 3ZRFA 4AP4C 2KZRA 3BINA 4NPNA 4HDQA 2IO1B 4GN1A 3TIXA 4E71A 2KJHB 1UBIA 4WWPA 2KQ7A 2O2VB 2NPTB 2DZMA 2KXJA 5D7GA 1WR6E 1OTRB 3SDLC 4J6IA 3K9OB 2K8BA 3KVFB 1WJUA 1SE9A 2ZZPB 3P2BA 3QA8A 4W9CA 4BKSD 2AWTA 4NAWB 2HD5B 3SU8X 1GJZA 2M17A 3OJ4B 3PTFC 5C23A 3U8ZA 5JZEB 4TQ0A 2IYDB 2O2VA 2NPTA 2C5LC 2HE7A 2N4FA 1E5WA 2K39A 3LDZE 3CF6E 3IBEA 1V80A 2DYOA 3T8MA 4W9GA 5J18A 1Q5WB 4ZDVA 1E90A 4TQ1A 1GUAB 2JPHA 2LVQA 4NAWA 1H4RA 3N32A 2KDEB 2WX0A 2Z0DB 3L17A 4WJOA 2RSUA 2LGYA 1J8CA 3JVZX 3IHPC 4AUQC 3WA0A 4K7SA 2A5UA 2KJ6A 3Q3JA 1SGHA 3OAWA 4LDTB 4WJNA 4BOSC 3ENEA 4IM0A 2DZIA 4PS8A 2KWUB 3CSTA 3HHMA 2XEWA 3DVGX 2GMIC 2BWFA 2LVPA 2LGDA 2D07B 4MH0E 3BY4B 4F1SA 4JQWC 1EF1A 2FIFA 2PE9A 4NNJB 2HTHA 5TR5A 4IWOA 1C3TA 1SIFA 3ZDMC 3HM6X 4KDIC 2EMSA 3IFWB 1TZ1A 1WE7A 2C60A 3DPDA 3QHTA 1WRDB 4FBJB 3QK0A 2L00B 2BWES 3TBLD 3PGEA 3M62B 1WJ4A 1WYWB 3KYCD 4HWIB 4BKTA 3EHVA 1A5RA 3NZUA 3PRPB 4PS3A 3ZIMA 3B1LX 1KOTA 4FULA 2L0FA 3DDCB 3DOWA 2KHWB 2NBVB 2CR5A 2ZCBA 4M0WB 3RYTA 4DHJB 3PV1A 2KFJA 1WI0A 2I1KA 1WX9A 1EO6A 3TCAA 4CHKA 2N7DA 3GZNI 2NS5A 3UQBA 4ICUA 4A20A 2CHWA 4TV3A 2KFKB 4EUTA 2WX1A 2IZVB 3VH4B 1ISNA 4GB9A 4G3XB 4LJPB 1TTNA 2DHZA 2LI5A 4MSQB 2A4ZA 2KVRA 3VFKA 1NBFC 2PPHA 2PE6B 3RZWC 4KSKC 1VD2A 1Z2MA 2MBHA 3ZNID 3ZNHB 1J19A 2BYEA 1YIWA 3ML9A 1WFYA 4ANWA 4RMAA 2K6QA 3QAQA 1P3QU 3AI5A 4GXBA 4A3PA 2KFKA 1WF9A 3JW0X 1WE6A 2FCNA 2WDTB 4BKGA 1E8YA 2AL3A 3NHEB 4HPMB 4X57B 3WAMA 3ZW3A 4LCDE 3JSVB 3WIMA 1WXSA 2JVCA 5LXHA 5DPWA 2DYBA 4XC2A 2LZ6A 4G0NB 2JUOA 3ZVVA 3SHQA 2JRIB 3NY5A 3LJ3A 4AOFA 1WGYA 3PSEB 2J0JA 5HKHA 3T9LA 3KH0A 1P98A 3KUZA 2K1FA 2MBEA 1WM2A 4BVUC 2O6VB 4ANVA 3JSVA 4GDKB 4II2B 4ANXA 1OEYA 4DK5A 4E3CA 5DPTA 1RRBA 2V3SA 2V4LA 2D11A 2KQSA 3IVFA 4NQLB 2JZZA 1E8WA 4HVBA 2KK8A 4HK2A 1I35A 2J0KA 2GBRA 1LXDA 2NBUA 1E8XA 2JZ3B 2MRPA 3QJZA 3VTUA 2DZKA 5JH5C 4G11A 1S3SG 4MGYE 2D3GA 3R66C 2O6VA 4GDKA 2BPSA 1E7UA 2JY6A 2M4NA 2FCQA 1J0GA 4II3B 2LASA 4PYUA 1UELA 4FJYA 4IG7B 2N9PC 2G4DB 3A33B 2J7QB 4GIVA 2YLMA 4WAAA 2KNBA 2MQJA 1KM7A 5D94A 4EZKA 4XZ4A 4IW0A 1WXAA 2CU1A 3N3KB 4WWNA 5CHVC 1EF5A 4MGIE 3UQAA 4LJOB 4HCNB 2LGXA 4MM3A 3DVGY 4FJVB 1WJNA 5C1ZA 2N1VA 2KWVB 5E6PA 4KDLB 2JWZA 3AULA 4W9DA 5LXIB 1TBEA 2ZJDA 3TL5A 5JHAA 1ZKHA 3AXCA 2DAJA 3AU5A 3OLMD 4K1RB 3APDA 4DXAB 4KIKB 1WIAA 3VVWB 3VUWA 2L05A 3VTVA 4BBNF 1YD8U 4GGQA 1QZEA 3QWZB 2JT4B 3UGBB 1UD7A 2DENB 3B08A 1V5TA 2KC2A 3QX1A 2N9EB 4AJYB 2L7RA 3PS6A 2IO2B 4JLCA 4IM2A 2YVCA 2L3ZA 3CMMB 3APFA 3ZTDA 2KJRA 4BKSA 4M8MA 3V6EB 2M0XA 4KIKA 2ZNVC 3A4RA 4EZJA 2ZNVB 3H7PB 3A9JB 2WYQA 4I6PA 4W9IA 2GBNA 1WXMA 2BYFA 2IBIB 5D2MB 1X1MA 1WGHA 2NCNA 2IY1B 1UZXB 2ZVOA 3EFUA 5EDSA 4A3OA 2Y5BB 1L7YA 1V9JA 3V6CB 3DVNV 4ZRJA 3H7PA 1R4MI 2W9NA 2ZEQA 3A9JA 3W1SC 2M1MA 4PYZA 5G2NA 2KD0A 3ZNZB 3DVNU 4DHZE 4G50A 5JHBA 4FHKA 2OJRA 4NJ7A 2ASQA 4NJ6A 2LXAA 4W9JA 2N9XA 4KZ0A 4CYEA 4M8NA 4KZCA 2L8JA 2KN5A 4MEMA 5DPSA 3PLVA 3N30A 3RD2A 2K8HA 4WQOB 3NS8A 4PS7A 5AZHA 1OGWA 4GMVA 4KVGB 1WJ6A 3W1SA 2MBQA 5IA7A 1LQBA 2RPQA 4ICVA 2L0TA 2Z0EB 3QARA 5D6JB 3WAOA 4W9HA 2FIDA 2D2QA 2ZPNA 2LRUA 1IP9A 2KDFB 3ZDTA 1RFAA 3PLUA 2RGFA 2KKCA 3M63B 2CKHB 4W9EA 3QIJA 5E6OA 5G55A 3V61A 2RD0A 4TKNA 3TJPA 1LFDA 2BKRB 4DWFA 3TMPB 1NDDA 3EC8A 3PHWB 2MWSB 1Y8RC 2KWCA 3VDZA 1WXVA 1NI2A 2KTFA 2LWPA 2PJHA 4GU2A 5BO4B 3ZNGC 4B95A 3I3TB 1G6JA 3DBHI 2DAFA 1AARA 4NQKE 4I6NB 3ZO5B 2JF5A 3MHSD 2KANA 3L08A 2FNJB 2LD9A 3ECIA 1P1AA 2GBKA 2AEHA 4ZYNA 3VQIA 4EOYA 3VUXA 1K8RB 3UINB 4B9KA 4GDLB 3M95A 4FN2A 3QQ8B 3KUDB 3DBSA 2REXA 2V1YA 2XK5B 3ZUNA 2KDIA 2KDBA 5LLIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XQQ A;  2MCN B;  4K81 A;  5L95 C;  2BKF A;  2LUE A;  2KOX A;  1MG8 A;  1V86 A;  1T0Y A;  2ZPY A;  3C0R B;  4IC7 B;  4GDL A;  3GOE A;  3H6N A;  2KO3 A;  2QHO A;  4HCP B;  2C9W B;  1V6E A;  5J17 A;  2XK5 A;  5AEK B;  1HE8 A;  4KSL C;  1GC7 A;  4FAD A;  3RCZ A;  2IO3 B;  4MJS B;  1RLF A;  5FR6 A;  4CO7 A;  2MP2 B;  2UYZ B;  2GBM A;  2N1W A;  4NY0 A;  1GC6 A;  1R4N I;  3Q3F A;  5IAA C;  3U7D A;  2KX3 A;  1YX6 B;  3WAN A;  3AU4 A;  2R2Q A;  3KYD D;  1Q1O A;  2FUH B;  1GG3 A;  3R7R A;  2LJ5 A;  4EFO A;  2Z59 B;  3W1Y A;  3ZLZ A;  4MJS A;  3ALB A;  2MP2 A;  3HM3 A;  3H7S A;  1EUV B;  4MGZ E;  1WX7 A;  2KLG A;  3VTW A;  2KMC A;  2C7H A;  5AZG A;  1ZW7 A;  2OOB B;  1WM3 A;  4RM8 A;  3JYU A;  1GNU A;  4URK A;  4IUM B;  2EKE C;  4WJP A;  5AZF A;  4OVV A;  3ML8 A;  1PQS A;  3A4S C;  3VUY A;  4HLE A;  2KMA A;  2MW5 A;  4HJK A;  5J2R A;  3H9D A;  2JRH A;  2J0M A;  1XT9 B;  2KLC A;  3L13 A;  4DDG D;  1V81 A;  3APC A;  1L2N A;  2K8C A;  1WGD A;  1UBQ A;  3CSF A;  2HJ8 A;  2DX5 B;  1V5O A;  4AJW A;  1Z5S B;  2MBB B;  3L10 B;  2MA9 B;  2UWQ A;  4P7I A;  2C7M B;  4KV2 A;  4LDT D;  5CX3 A;  1H8C A;  2WWZ A;  3RZF A;  2MLB A;  1S1Q B;  5KHO A;  3VH3 B;  4MSM B;  1WR1 A;  1WX8 A;  3DQV A;  4AWJ A;  2G4S A;  2RR9 A;  3HK0 A;  3PRE A;  3RUI B;  1IPG A;  1WH3 A;  1WY8 A;  1YQB A;  3H1U A;  5GMV A;  3UIP B;  3KUC B;  1UGM A;  3HIZ A;  4FHJ A;  4WWO A;  5L83 A;  2NBW B;  3S2A A;  5DPR A;  4E74 A;  3EEC A;  2N7E A;  3WAL A;  4W9K A;  2FAZ A;  5CHF A;  4FLH A;  2K25 A;  3B0A A;  3VHT C;  3PHX B;  2CHX A;  1XD3 B;  1E8Z A;  1P0R A;  3VAW A;  3L16 A;  3MTN B;  5DCN A;  2FCM A;  2LXC A;  1IYF A;  2AL6 A;  1P9D U;  2B3A A;  3ZRC A;  4ZRI A;  3RT3 B;  3MJW A;  3NOB A;  4FJZ A;  1JRU A;  5KHQ A;  1YJ1 A;  4XX5 A;  1VCB A;  3L0W B;  4I6L B;  4DHJ D;  1WMH B;  3V60 A;  4B6W A;  3QC8 B;  2NVU I;  2NR2 A;  3ZTC A;  4IM3 A;  2ZCC A;  4F8C B;  2MX2 A;  4W9L A;  3PT2 B;  4K7W A;  2D10 A;  3L54 A;  2GBJ A;  2KX0 A;  3SD5 A;  4HPL B;  2R2O A;  3V62 A;  4DDI D;  3UIO B;  1LM8 B;  4JIO U;  2KTR B;  3K9P B;  1Q0W B;  4IWQ A;  4K7U A;  1WMH A;  2K6D B;  4MGK E;  3U30 A;  1KLV A;  1CMX B;  4MEL A;  2DYM A;  1WZ0 A;  3X23 A;  1WGG A;  4TUU A;  4ANU A;  3NZS A;  4DHZ B;  3D32 A;  4EZL A;  3DBR I;  1TGZ B;  2G3Q B;  5CHW A;  2CS4 A;  2M8S A;  3QCA A;  4HXD A;  1C1Y B;  3VXW A;  4JL9 A;  1V2Y A;  3A1Q B;  2KTR A;  4FA6 A;  3PVL A;  4BFR A;  1BT0 A;  3IG3 A;  3R7Q A;  4BOZ B;  4F7Z A;  1OEY J;  1OQY A;  2GOW A;  2VRR B;  2JXX A;  2LVO A;  2DZJ A;  3A9K B;  2CHZ A;  3DBL I;  3OJ3 A;  3O65 B;  1M94 A;  1YX5 B;  3UF8 A;  2I1J A;  3ONS A;  2MBO A;  3R3M A;  4OVU A;  3WAP A;  2EMT A;  1F9J A;  2G45 B;  2O6V D;  3A1Q A;  2PEA A;  4YL8 A;  1WGR A;  2IY0 B;  4RM9 A;  5E6N A;  3PRM B;  4HDO A;  2ZVN A;  4GSW A;  3PPA A;  4IWP A;  2BGF A;  3A9K A;  3RUL A;  4DBG A;  2L76 A;  1I42 A;  2LRW A;  1FXT B;  4ASW C;  1U4A A;  1KJT A;  4W9F A;  2FCS A;  1ZGU B;  4EKU A;  2BF8 B;  4WJQ A;  3KW5 B;  4BBN C;  2C7N B;  3ZKJ C;  2XBB C;  1UH6 A;  2BYV E;  1WZ3 A;  3X0W A;  2MSE D;  4N9F 4;  4JGH B;  4ZRK A;  5CTR C;  1E7V A;  3PZD A;  4MDK E;  1V49 A;  4EEW A;  1D3Z A;  1RAX A;  3M3J A;  2IO0 B;  2KC1 A;  4GOC A;  3DCG A;  2AYO B;  3PRZ A;  3ZRF A;  4AP4 C;  2KZR A;  3BIN A;  4NPN A;  4HDQ A;  2IO1 B;  4GN1 A;  3TIX A;  4E71 A;  2KJH B;  1UBI A;  4WWP A;  2KQ7 A;  2O2V B;  2NPT B;  2DZM A;  2KXJ A;  5D7G A;  1WR6 E;  1OTR B;  3SDL C;  4J6I A;  3K9O B;  2K8B A;  3KVF B;  1WJU A;  1SE9 A;  2ZZP B;  3P2B A;  3QA8 A;  4W9C A;  4BKS D;  2AWT A;  4NAW B;  2HD5 B;  3SU8 X;  1GJZ A;  2M17 A;  3OJ4 B;  3PTF C;  5C23 A;  3U8Z A;  5JZE B;  4TQ0 A;  2IYD B;  2O2V A;  2NPT A;  2C5L C;  2HE7 A;  2N4F A;  1E5W A;  2K39 A;  3LDZ E;  3CF6 E;  3IBE A;  1V80 A;  2DYO A;  3T8M A;  4W9G A;  5J18 A;  1Q5W B;  4ZDV A;  1E90 A;  4TQ1 A;  1GUA B;  2JPH A;  2LVQ A;  4NAW A;  1H4R A;  3N32 A;  2KDE B;  2WX0 A;  2Z0D B;  3L17 A;  4WJO A;  2RSU A;  2LGY A;  1J8C A;  3JVZ X;  3IHP C;  4AUQ C;  3WA0 A;  4K7S A;  2A5U A;  2KJ6 A;  3Q3J A;  1SGH A;  3OAW A;  4LDT B;  4WJN A;  4BOS C;  3ENE A;  4IM0 A;  2DZI A;  4PS8 A;  2KWU B;  3CST A;  3HHM A;  2XEW A;  3DVG X;  2GMI C;  2BWF A;  2LVP A;  2LGD A;  2D07 B;  4MH0 E;  3BY4 B;  4F1S A;  4JQW C;  1EF1 A;  2FIF A;  2PE9 A;  4NNJ B;  2HTH A;  5TR5 A;  4IWO A;  1C3T A;  1SIF A;  3ZDM C;  3HM6 X;  4KDI C;  2EMS A;  3IFW B;  1TZ1 A;  1WE7 A;  2C60 A;  3DPD A;  3QHT A;  1WRD B;  4FBJ B;  3QK0 A;  2L00 B;  2BWE S;  3TBL D;  3PGE A;  3M62 B;  1WJ4 A;  1WYW B;  3KYC D;  4HWI B;  4BKT A;  3EHV A;  1A5R A;  3NZU A;  3PRP B;  4PS3 A;  3ZIM A;  3B1L X;  1KOT A;  4FUL A;  2L0F A;  3DDC B;  3DOW A;  2KHW B;  2NBV B;  2CR5 A;  2ZCB A;  4M0W B;  3RYT A;  4DHJ B;  3PV1 A;  2KFJ A;  1WI0 A;  2I1K A;  1WX9 A;  1EO6 A;  3TCA A;  4CHK A;  2N7D A;  3GZN I;  2NS5 A;  3UQB A;  4ICU A;  4A20 A;  2CHW A;  4TV3 A;  2KFK B;  4EUT A;  2WX1 A;  2IZV B;  3VH4 B;  1ISN A;  4GB9 A;  4G3X B;  4LJP B;  1TTN A;  2DHZ A;  2LI5 A;  4MSQ B;  2A4Z A;  2KVR A;  3VFK A;  1NBF C;  2PPH A;  2PE6 B;  3RZW C;  4KSK C;  1VD2 A;  1Z2M A;  2MBH A;  3ZNI D;  3ZNH B;  1J19 A;  2BYE A;  1YIW A;  3ML9 A;  1WFY A;  4ANW A;  4RMA A;  2K6Q A;  3QAQ A;  1P3Q U;  3AI5 A;  4GXB A;  4A3P A;  2KFK A;  1WF9 A;  3JW0 X;  1WE6 A;  2FCN A;  2WDT B;  4BKG A;  1E8Y A;  2AL3 A;  3NHE B;  4HPM B;  4X57 B;  3WAM A;  3ZW3 A;  4LCD E;  3JSV B;  3WIM A;  1WXS A;  2JVC A;  5LXH A;  5DPW A;  2DYB A;  4XC2 A;  2LZ6 A;  4G0N B;  2JUO A;  3ZVV A;  3SHQ A;  2JRI B;  3NY5 A;  3LJ3 A;  4AOF A;  1WGY A;  3PSE B;  2J0J A;  5HKH A;  3T9L A;  3KH0 A;  1P98 A;  3KUZ A;  2K1F A;  2MBE A;  1WM2 A;  4BVU C;  2O6V B;  4ANV A;  3JSV A;  4GDK B;  4II2 B;  4ANX A;  1OEY A;  4DK5 A;  4E3C A;  5DPT A;  1RRB A;  2V3S A;  2V4L A;  2D11 A;  2KQS A;  3IVF A;  4NQL B;  2JZZ A;  1E8W A;  4HVB A;  2KK8 A;  4HK2 A;  1I35 A;  2J0K A;  2GBR A;  1LXD A;  2NBU A;  1E8X A;  2JZ3 B;  2MRP A;  3QJZ A;  3VTU A;  2DZK A;  5JH5 C;  4G11 A;  1S3S G;  4MGY E;  2D3G A;  3R66 C;  2O6V A;  4GDK A;  2BPS A;  1E7U A;  2JY6 A;  2M4N A;  2FCQ A;  1J0G A;  4II3 B;  2LAS A;  4PYU A;  1UEL A;  4FJY A;  4IG7 B;  2N9P C;  2G4D B;  3A33 B;  2J7Q B;  4GIV A;  2YLM A;  4WAA A;  2KNB A;  2MQJ A;  1KM7 A;  5D94 A;  4EZK A;  4XZ4 A;  4IW0 A;  1WXA A;  2CU1 A;  3N3K B;  4WWN A;  5CHV C;  1EF5 A;  4MGI E;  3UQA A;  4LJO B;  4HCN B;  2LGX A;  4MM3 A;  3DVG Y;  4FJV B;  1WJN A;  5C1Z A;  2N1V A;  2KWV B;  5E6P A;  4KDL B;  2JWZ A;  3AUL A;  4W9D A;  5LXI B;  1TBE A;  2ZJD A;  3TL5 A;  5JHA A;  1ZKH A;  3AXC A;  2DAJ A;  3AU5 A;  3OLM D;  4K1R B;  3APD A;  4DXA B;  4KIK B;  1WIA A;  3VVW B;  3VUW A;  2L05 A;  3VTV A;  4BBN F;  1YD8 U;  4GGQ A;  1QZE A;  3QWZ B;  2JT4 B;  3UGB B;  1UD7 A;  2DEN B;  3B08 A;  1V5T A;  2KC2 A;  3QX1 A;  2N9E B;  4AJY B;  2L7R A;  3PS6 A;  2IO2 B;  4JLC A;  4IM2 A;  2YVC A;  2L3Z A;  3CMM B;  3APF A;  3ZTD A;  2KJR A;  4BKS A;  4M8M A;  3V6E B;  2M0X A;  4KIK A;  2ZNV C;  3A4R A;  4EZJ A;  2ZNV B;  3H7P B;  3A9J B;  2WYQ A;  4I6P A;  4W9I A;  2GBN A;  1WXM A;  2BYF A;  2IBI B;  5D2M B;  1X1M A;  1WGH A;  2NCN A;  2IY1 B;  1UZX B;  2ZVO A;  3EFU A;  5EDS A;  4A3O A;  2Y5B B;  1L7Y A;  1V9J A;  3V6C B;  3DVN V;  4ZRJ A;  3H7P A;  1R4M I;  2W9N A;  2ZEQ A;  3A9J A;  3W1S C;  2M1M A;  4PYZ A;  5G2N A;  2KD0 A;  3ZNZ B;  3DVN U;  4DHZ E;  4G50 A;  5JHB A;  4FHK A;  2OJR A;  4NJ7 A;  2ASQ A;  4NJ6 A;  2LXA A;  4W9J A;  2N9X A;  4KZ0 A;  4CYE A;  4M8N A;  4KZC A;  2L8J A;  2KN5 A;  4MEM A;  5DPS A;  3PLV A;  3N30 A;  3RD2 A;  2K8H A;  4WQO B;  3NS8 A;  4PS7 A;  5AZH A;  1OGW A;  4GMV A;  4KVG B;  1WJ6 A;  3W1S A;  2MBQ A;  5IA7 A;  1LQB A;  2RPQ A;  4ICV A;  2L0T A;  2Z0E B;  3QAR A;  5D6J B;  3WAO A;  4W9H A;  2FID A;  2D2Q A;  2ZPN A;  2LRU A;  1IP9 A;  2KDF B;  3ZDT A;  1RFA A;  3PLU A;  2RGF A;  2KKC A;  3M63 B;  2CKH B;  4W9E A;  3QIJ A;  5E6O A;  5G55 A;  3V61 A;  2RD0 A;  4TKN A;  3TJP A;  1LFD A;  2BKR B;  4DWF A;  3TMP B;  1NDD A;  3EC8 A;  3PHW B;  2MWS B;  1Y8R C;  2KWC A;  3VDZ A;  1WXV A;  1NI2 A;  2KTF A;  2LWP A;  2PJH A;  4GU2 A;  5BO4 B;  3ZNG C;  4B95 A;  3I3T B;  1G6J A;  3DBH I;  2DAF A;  1AAR A;  4NQK E;  4I6N B;  3ZO5 B;  2JF5 A;  3MHS D;  2KAN A;  3L08 A;  2FNJ B;  2LD9 A;  3ECI A;  1P1A A;  2GBK A;  2AEH A;  4ZYN A;  3VQI A;  4EOY A;  3VUX A;  1K8R B;  3UIN B;  4B9K A;  4GDL B;  3M95 A;  4FN2 A;  3QQ8 B;  3KUD B;  3DBS A;  2REX A;  2V1Y A;  2XK5 B;  3ZUN A;  2KDI A;  2KDB A;  5LLI A; 
#chains in the Genus database with same CATH topology
 2MCN B;  4K81 A;  2BKF A;  2WLB A;  1E6E B;  2KDM A;  4UDU C;  1T0Y A;  4YSX B;  2WXF A;  4ZHP A;  1FCC C;  4RFB A;  2KO3 A;  2XK5 A;  1HE8 A;  4JE3 B;  4USA A;  4MJS B;  5FR6 A;  4HJG E;  2GBM A;  2N1W A;  3RNA C;  4YSZ B;  1R4N I;  4AQ7 A;  2BQQ A;  3OWE B;  4H2A A;  3WAN A;  3HVZ A;  3MC0 B;  4MJS A;  3H7S A;  1LO5 D;  4ZYS A;  3NG0 A;  1ZW7 A;  1V97 A;  1WM3 A;  2DWQ A;  4LNO A;  1N63 A;  5AZF A;  4OVV A;  3A4S C;  2KMA A;  4HJK A;  4OZA A;  1L2N A;  2K8C A;  3MP9 A;  4AJW A;  1MHX A;  2KVZ A;  2MA9 B;  2UWQ A;  4P7I A;  4KV2 A;  4LDT D;  2MLB A;  2Y5P A;  4YTN B;  4MSM B;  1WX8 A;  4K3C A;  3PRE A;  1IPG A;  3UIP B;  3WCQ A;  4FHJ A;  4WWO A;  3DWM A;  5DPR A;  4E74 A;  3WAL A;  1BXT A;  3PHX B;  4HKQ A;  4CQN A;  1VZ8 A;  3MTN B;  5DCN A;  2LXC A;  1P9D U;  3RT3 B;  1JRU A;  4MT5 A;  4I6L B;  2IGG A;  1MI0 A;  4N58 A;  4IM3 A;  2ZCC A;  1D5Z C;  2BS2 B;  1ZPS A;  4K7W A;  2KX0 A;  4HPL B;  2R2O A;  1LM8 B;  2J52 A;  1Q0W B;  4MGK E;  4MEL A;  1JML A;  4ANU A;  4KX6 B;  4DHZ B;  3DBR I;  2G3Q B;  3KQ4 A;  2JYT A;  5CHW A;  2M8S A;  4HXD A;  3MC8 A;  3ZJT A;  4JL9 A;  1V2Y A;  3A1Q B;  1TY2 A;  2KT7 A;  2JXX A;  2WP9 B;  2BBC A;  1NYR A;  4D2K A;  2WXG A;  3A1Q A;  1YQ3 B;  2Y3A A;  4YL8 A;  1WGR A;  4RM9 A;  1E0Z A;  4HDO A;  3GS2 A;  4GSW A;  3PPA A;  4IWP A;  2L76 A;  1I42 A;  1KJT A;  1JRO A;  3RNF C;  2ONQ A;  4WJQ A;  1MFW A;  2PLP A;  2WXI A;  4ZRK A;  3N1Z C;  1V49 A;  1D3Z A;  1A70 A;  2L1A A;  1RAX A;  2K22 A;  2AYO B;  4HDQ A;  3TIX A;  1UBI A;  2KQ7 A;  2ICI A;  2KXJ A;  3C19 A;  4J6I A;  3K9O B;  3R8B A;  3GP7 A;  4DXG A;  2JX5 A;  4W9C A;  2WXP A;  3SU8 X;  2HD5 B;  1GJZ A;  5BMH A;  2IYD B;  1T5X D;  2WU2 B;  1ROE A;  3AN1 A;  3CF6 E;  2DYO A;  5J18 A;  5C3J B;  1E90 A;  4TQ1 A;  2X8X X;  1H4R A;  3N32 A;  4WJO A;  3VRA B;  3L17 A;  4N6E B;  2LGY A;  1T3Q A;  2KJ6 A;  2EKI A;  1SGH A;  3DHH C;  4LDT B;  2DZI A;  1RFK A;  2WXK A;  2GMI C;  2VH1 A;  2LVP A;  2WS3 B;  2D07 B;  2LGD A;  3P4R B;  4DQO C;  2RDB C;  4NNJ B;  2HTH A;  4IWO A;  3ZDM C;  3HM6 X;  4KDI C;  4QAY A;  1K53 A;  2PW9 A;  1TZ1 A;  3PGE A;  5EE1 A;  3AEE B;  1A5R A;  3NZU A;  3PRP B;  4PS3 A;  2L0F A;  4A6Q A;  3DDC B;  3DOW A;  1T0S C;  2CR5 A;  4M0W B;  4PK1 A;  3MC9 A;  1WI0 A;  1KFY B;  3GZN I;  3UQB A;  4TV3 A;  1MG4 A;  1ISN A;  4LJP B;  4M0W A;  1UF0 A;  4MSQ B;  2KVR A;  1QQR A;  2MBH A;  3ZNI D;  1F77 A;  1J19 A;  2K6Q A;  1K51 A;  5HHD G;  2BYT A;  1WE6 A;  2PVG C;  2DBY A;  2PKO A;  1ET6 A;  3JSV B;  1TIF A;  2JUO A;  3SHQ A;  3CIR B;  3PSE B;  1ZE3 D;  4C4V B;  2MBE A;  3JSV A;  1QIL A;  1GOZ A;  2V3S A;  4NQL B;  2KQS A;  3AE8 B;  1E8W A;  1I35 A;  1LXD A;  2MRP A;  1FCL A;  3VTU A;  2DZK A;  5JH5 C;  4C4V A;  1S3S G;  2D3G A;  4L1B A;  2LAS A;  3W2D A;  4PYU A;  1I4R A;  2N9P C;  2J7Q B;  4WAA A;  3B9J A;  2MQJ A;  1TYG B;  1C4A A;  1YNT E;  3AB5 A;  4XDD A;  3J9C A;  3UQA A;  1JAL A;  3DVG Y;  4FJV B;  2N1V A;  2KWV B;  4KDL B;  4YWG G;  5LXI B;  3BVM A;  4K1R B;  2DAJ A;  3AU5 A;  3APD A;  4KIK B;  1FRR A;  1EWY C;  2JQR B;  2L05 A;  5T8I A;  1YD8 U;  1QZE A;  2JT4 B;  2DEN B;  2QJL A;  2N9E B;  2L3Z A;  1V8C A;  2KJR A;  3AEB B;  4IOI E;  3Q8E A;  3RNE C;  4KIK A;  1C76 A;  3U52 E;  1E10 A;  4I6P A;  2GBN A;  1WXM A;  2BYF A;  2IBI B;  4JWS C;  2IY1 B;  4A3O A;  4YT0 B;  5FK9 C;  4DXF A;  2XN9 C;  1L7Y A;  1V9J A;  4ZRJ A;  3I57 A;  3W1S C;  2INN E;  2RDH A;  2WHI A;  1L6V A;  5JHB A;  4FHK A;  1XCQ L;  1OFF A;  4JWU C;  4M8N A;  4KZC A;  2KN5 A;  3ABV B;  5DPS A;  3PLV A;  3RD2 A;  2K8H A;  2M56 B;  4KKJ A;  3NS8 A;  5AZH A;  1OGW A;  2FUG 1;  4IKG A;  2SAK A;  5IA7 A;  1DOY A;  2L0T A;  3QAR A;  3PZ7 A;  4RGO S;  1V1P B;  1JWM D;  1IP9 A;  3ZDT A;  1RFA A;  1YN5 A;  4W9E A;  3QIJ A;  5E6O A;  4TKN A;  3TJP A;  1TS3 A;  3TMP B;  1NDD A;  4YTP B;  1Y8R C;  4HRS A;  3VDZ A;  3ZNG C;  1V1P A;  4B95 A;  3DHI C;  2GB1 A;  2DAF A;  1AAR A;  4Q2J A;  2KAN A;  3L08 A;  2HTM E;  1DYQ A;  3P1M A;  4ZYN A;  1JRP A;  4EOY A;  3VUX A;  3UIN B;  3M95 A;  3AE1 B;  2BT6 A;  1C3T A;  1JWA D;  5LLI A;  2WXO A;  4KGS A;  2OED A;  3NVW A;  3HRD D;  2LUE A;  2KOX A;  2J42 A;  1VJK A;  3H6N A;  3TEX A;  1BUI C;  5G5H A;  1XLQ A;  3Q3O C;  4FAD A;  4BAX A;  1LGR A;  2MP2 B;  4NY0 A;  3NJT A;  1YX6 B;  3AU4 A;  2R2Q A;  2E3T A;  2MJE A;  2Z59 B;  1YJI A;  2VH2 A;  4TSS A;  4R3D A;  2MP2 A;  4ARC A;  2QIE B;  3N9Y C;  2C7H A;  5AZG A;  2OOB B;  4RM8 A;  2K9X A;  3JYU A;  3VUY A;  2QCZ A;  1UUP A;  5J2R A;  2JRH A;  3R2T A;  3L13 A;  1QOA A;  3APC A;  1GAQ B;  2HJ8 A;  1V5O A;  2MBB B;  3RZF A;  1S1Q B;  2QMT A;  1WR1 A;  4LNI A;  1YQB A;  1WY8 A;  3H1U A;  5EE9 A;  1FXI A;  1UGM A;  2NBW B;  5GXG B;  3EEC A;  2N7E A;  3V05 A;  5CHF A;  2WDR B;  3B0A A;  3AEG B;  1ZDV A;  1E8Z A;  1WXQ A;  2GRI A;  4OW0 A;  1L4Z B;  2LFI A;  3IT6 B;  4XX5 A;  3ZJV A;  4DHJ D;  1WMH B;  3V60 A;  3TEY A;  2MJD A;  3Q3M C;  1SEB D;  3ZTC A;  1I4G A;  2OJW A;  1SSN A;  2D10 A;  4JIO U;  1KLV A;  1STE A;  4IWQ A;  1WMH A;  2V0G A;  2IDY A;  3VRB B;  3NZS A;  4RGN A;  3BK1 A;  2WXH A;  2CS4 A;  4RGM A;  1HA5 A;  4RGT A;  4NJC A;  3VXW A;  1XLO A;  4LLG M;  1BT0 A;  3IG3 A;  3R7Q A;  4F7Z A;  5I4D A;  2GOW A;  3FC4 A;  4OVZ A;  3A9K B;  2N9L A;  3ONS A;  2MBO A;  2WXM A;  3LYY A;  3U7Z A;  3Q2A C;  2W82 A;  3DWG C;  1TKE A;  4MAC A;  3Q8F A;  3RUL A;  2BGF A;  3A9K A;  1NYQ A;  4J3O D;  4B0E A;  4EKU A;  2J4X A;  4OHJ A;  3BK2 A;  4BBN C;  3X0W A;  4JGH B;  1CZP A;  4YTM B;  1SB3 C;  3B2F A;  5CTR C;  1C77 A;  4MDK E;  4EEW A;  3NVY A;  2KC1 A;  2LEK A;  4AP4 C;  3PRZ A;  4N59 A;  3BIN A;  3BWU D;  3RMK C;  5D3I B;  2NPT B;  3SDL C;  3KVF B;  1JCK B;  2FE8 A;  2YEP B;  3QA8 A;  2M17 A;  3MHZ A;  3PTF C;  5HFY A;  3AE2 B;  3U8Z A;  4TQ0 A;  4KKI A;  2G9H D;  2LHE A;  2NPT A;  2W55 A;  2N4F A;  2MH7 A;  3TEZ A;  2K39 A;  3LDZ E;  2LHD A;  3IBE A;  4ZDV A;  2H88 B;  1TT5 B;  2LVQ A;  1PYW D;  2RSU A;  1QKZ A;  2DLB A;  2KAC A;  2R61 A;  3GB1 A;  2A5U A;  4K7S A;  4WJN A;  3OAW A;  4ARI A;  3ENE A;  3DBL B;  3L4P A;  4PS8 A;  2KWU B;  4M02 A;  3BYT B;  3HHM A;  2LGI A;  3Q8C A;  2BB6 A;  5AUI A;  4MH0 E;  3BY4 B;  2X38 A;  2EMS A;  1WE7 A;  3QHT A;  1WRD B;  4XYC A;  4FBJ B;  3QK0 A;  2INC C;  3UI3 A;  3ZJU A;  1KLU D;  1WJ4 A;  1WYW B;  4HWI B;  4ZRQ A;  4JX1 C;  2KWD A;  3ZIM A;  5EE3 A;  2KQ4 X;  1Q10 A;  4DHJ B;  3RYT A;  2N9K A;  3Q14 C;  1EO6 A;  3TCA A;  3LB8 C;  4EUT A;  2IZV B;  3VH4 B;  3NVV A;  4C00 A;  2DHZ A;  2LI5 A;  1MVK A;  5E6J A;  2A4Z A;  3VFK A;  4KSK C;  1VD2 A;  3ZNH B;  2BYE A;  4ANW A;  4RMA A;  4C56 C;  1EM7 A;  3C8Y A;  1E8Y A;  3NHE B;  1D6E C;  3WAM A;  1WXS A;  1PGA A;  2LZ6 A;  3MFG A;  4G0N B;  3ZVV A;  4AOF A;  3NY5 A;  2QIL A;  3FAH A;  1WM2 A;  4GDK B;  4II2 B;  1OEY A;  4REZ A;  2JZZ A;  4HVB A;  2KK8 A;  1VZ7 A;  1DGJ A;  3ETR A;  3QJZ A;  4MGY E;  1V1O A;  4GDK A;  2JY6 A;  2PMV A;  4IG7 B;  3AE3 B;  3N20 C;  4MH8 A;  1HEZ E;  1MJD A;  1R4M B;  2YLM A;  4GIV A;  4EZK A;  4IW0 A;  1WXA A;  1ENF A;  2CU1 A;  3N3K B;  5CHV C;  3AMZ A;  1KRH A;  5G5G A;  3GE8 C;  4RF0 A;  1KH0 A;  1TBE A;  1D5X C;  1UWX A;  5JHA A;  1ZKH A;  1WIA A;  1P7E A;  3E9S A;  2KN4 A;  1V5T A;  3AH7 A;  2LUM A;  2L7R A;  3PS6 A;  3B2G A;  3AED B;  4IM2 A;  2AQ1 B;  3APF A;  1J7B A;  3BVG A;  3RPF C;  2M0X A;  1GB4 A;  1RWS A;  2ZNV C;  3A4R A;  3H7P B;  1F1H A;  4RCO A;  4W9I A;  1X1M A;  2J53 A;  2RPV A;  1WGH A;  3AV8 A;  1UZX B;  1JQ4 A;  3NVZ A;  1YQ4 B;  2YEP F;  3RNG C;  3DVN V;  3H7P A;  3TSS A;  2HJ1 A;  2M1M A;  4PYZ A;  4DHZ E;  1MPE A;  2ASQ A;  2V3P A;  3OG5 A;  4KZ0 A;  1SBB B;  4CYE A;  3BYY B;  3N30 A;  5EE0 A;  4FXC A;  3SEB A;  2LGS A;  4WQO B;  4PS7 A;  4KVG B;  1WJ6 A;  3W1S A;  2I38 A;  2MBQ A;  4ICV A;  5D6J B;  1R4N B;  3EC8 A;  3PHW B;  2KWC A;  1WRI A;  4ZOH C;  3DBH I;  4GLS C;  4NQK E;  4I6N B;  5HI1 A;  1E9M A;  2JF5 A;  3ECI A;  1NVI D;  1J7C A;  2AEH A;  1I4P A;  2MHJ A;  3IAS 1;  2N7J A;  1CK1 A;  1VRA B;  4FN2 A;  1BML C;  3DBS A;  2B76 B;  2REX A;  2M0A A;  1XCT L;  1XQQ A;  2UU7 A;  4A8X C;  1MG8 A;  1V86 A;  5BMG A;  2K3U A;  2ZPY A;  4IC7 B;  2L83 A;  2C9W B;  4XDC A;  3I9V 1;  5J17 A;  4KSL C;  3RCZ A;  3AE7 B;  4CO7 A;  3Q3N C;  2UYZ B;  1UGJ A;  1GC6 A;  2AX5 A;  1QF6 A;  3U7D A;  3I63 C;  3KYD D;  1Q1O A;  1GG3 A;  3R7R A;  4ZHO A;  3ALB A;  3HM3 A;  2WXL A;  1WX7 A;  3VTW A;  2KMC A;  3EFC A;  1TKG A;  4URK A;  4IUM B;  4WJP A;  1UNS A;  1PQS A;  4HLE A;  2WDQ B;  3MJ5 A;  3H9D A;  4JPS A;  4YXD B;  2J0M A;  1XT9 B;  2KLC A;  1I7H A;  1V81 A;  1F2R C;  1UBQ A;  3RN9 C;  3SFD B;  3KWL A;  2C7M B;  3AEF B;  2WWZ A;  1JW9 D;  5KHO A;  3VH3 B;  3R2I A;  2W54 A;  3DQV A;  2G4S A;  2RR9 A;  3HK0 A;  3RUI B;  5GMV A;  3KUC B;  1TS4 A;  1SXT A;  3P42 A;  2BS3 B;  3HIZ A;  3W5V B;  5L83 A;  2FAZ A;  2K25 A;  2Y5C A;  2G1E A;  2CHX A;  1QOF A;  1XD3 B;  4B0M A;  1P0R A;  3VAW A;  3L16 A;  2LJI A;  2B3A A;  3P63 A;  4YSY B;  1FFU A;  4KGR A;  3AE6 B;  5KHQ A;  3H8H A;  1YJ1 A;  3L0W B;  3QC8 B;  1EWC A;  2NR2 A;  4LK0 M;  4F8C B;  4W9L A;  3PT2 B;  4US8 A;  3V62 A;  1OQQ A;  2KTR B;  3K9P B;  4K7U A;  3TUO A;  3KWV A;  1YN4 A;  3U30 A;  1WZ0 A;  1VZ6 A;  1PGX A;  2H89 B;  3X23 A;  1WGG A;  3D32 A;  3QCA A;  2NMQ A;  2KTR A;  5H92 C;  3PVL A;  4BOZ B;  1ZXI A;  1OEY J;  1OQY A;  2VRR B;  3N1Y C;  2LVO A;  2DZJ A;  1N60 A;  3DBL I;  2KYW A;  3O65 B;  1YX5 B;  2I1J A;  3WAP A;  2EMT A;  2BTE A;  1FPY A;  1F9J A;  3LXF A;  2O6V D;  1SJE D;  4IDI A;  5HG2 A;  4AS1 A;  4WAF A;  2WU5 B;  3PRM B;  2ZVN A;  4C7Y A;  5TSS A;  1AYF A;  2D5G A;  1ZGU B;  2BF8 B;  3KW5 B;  3ZKJ C;  2BYV E;  1WZ3 A;  4O1N A;  2L52 A;  1B1Z A;  1HTQ A;  1XLN A;  4GOC A;  3DCG A;  2KZR A;  4NPN A;  1KTK A;  4GN1 A;  4E71 A;  2DZM A;  5D7G A;  1WR6 E;  2K8B A;  2ZZP B;  2AWT A;  1VDV A;  1CQV A;  5C23 A;  5JZE B;  1SE3 A;  1T0R C;  1N5W A;  3GZN B;  1RM6 C;  1V80 A;  4W9G A;  1Q5W B;  1GUA B;  2JPH A;  3I5J C;  1WWT A;  2KDE B;  2WX0 A;  3TEW A;  3IHP C;  4AUQ C;  1OQR A;  4BOS C;  2Z8L A;  3CST A;  3P4P B;  2XEW A;  3DVG X;  4S0R A;  4LNF A;  4JQW C;  2NTS A;  3URY A;  1L0X B;  1R7S A;  1SIF A;  3IFW B;  2C60 A;  3TBL D;  1IBX B;  3M62 B;  2RDG A;  1FIQ A;  4BKT A;  1ZXH A;  5H8Y E;  2W3S A;  2V4I B;  2KHW B;  2NBV B;  3FKY A;  3PV1 A;  2KFJ A;  2I1K A;  1WX9 A;  2ZW1 A;  2NS5 A;  1IBX A;  4ICU A;  1QT9 A;  4A20 A;  2CHW A;  1GB1 A;  2WX1 A;  4GB9 A;  5IO9 A;  4G3X B;  4M00 A;  3U2S C;  1NBF C;  1YIW A;  2WXQ A;  2WXR A;  3ML9 A;  4HEA 1;  3QAQ A;  3AI5 A;  4A3P A;  1YJJ A;  1WF9 A;  2WDT B;  2FCN A;  3NUH B;  2AL3 A;  1YMH E;  4X57 B;  3ZW3 A;  1XF5 L;  4LCD E;  3WIM A;  2JVC A;  5DPW A;  2WGS A;  2CJO A;  3LJ3 A;  1WGY A;  2J0J A;  3T9L A;  2K1F A;  1KLG D;  1NEN B;  4BVU C;  2O6V B;  2GI9 A;  4ANV A;  4ANX A;  4RF1 A;  3Q69 A;  2I2Y A;  2V4L A;  1L5P A;  2D11 A;  4HK2 A;  2J0K A;  1I4Q A;  2NBU A;  2PVO D;  1RYJ A;  1FNU A;  4G11 A;  3ZXV A;  2FBW B;  3R66 C;  2M19 A;  2NTT A;  2O6V A;  2BPS A;  1E7U A;  2M4N A;  1J0G A;  1TJE A;  4II3 B;  1PGB A;  2BVC A;  2V3N A;  5LNK 1;  1YN3 A;  4NZL B;  2W3R A;  1YOV B;  2KNB A;  1KM7 A;  4XZ4 A;  2WNM A;  1TS2 A;  4LJO B;  4XE0 A;  1HQR D;  3IAM 1;  1PFD A;  2AQ3 B;  2TSS A;  2IPK D;  4P1C C;  4W9D A;  3AM9 A;  4DXA B;  3VVW B;  1ACC A;  1KF6 B;  3VUW A;  5C2T B;  3VTV A;  4BBN F;  1N6Z A;  1UD7 A;  1I4H A;  1QLB B;  3B08 A;  1L0V B;  4XWW A;  4AJY B;  4NAM A;  2IO2 B;  4JLC A;  2INP E;  3AE4 B;  3CMM B;  2YVC A;  3ZTD A;  1HZ6 A;  1FO4 A;  4M8M A;  4XWT A;  3V6E B;  1ZP0 B;  2ZNV B;  3A9J B;  2WYQ A;  2WDV B;  1WSP A;  5D2M B;  3EFU A;  1XO3 A;  2ZVO A;  4LTU A;  1SIJ A;  3VR9 B;  4M01 A;  2QEJ C;  5BYS A;  3A9J A;  4G50 A;  4LNN A;  2OJR A;  4WWM A;  1N5X A;  1AN8 A;  3ZQ4 A;  2PTL A;  2L8J A;  4MEM A;  3O13 A;  2CJN A;  1WGK A;  3DHG C;  4GMV A;  2RPQ A;  4W9H A;  2FID A;  3RFZ B;  2D2Q A;  3PLU A;  2RGF A;  2CKH B;  1T6B X;  1QOB A;  3V61 A;  2OHF A;  4WH4 A;  2BKR B;  4DWF A;  2MWS B;  3AE5 B;  2KTF A;  2LWP A;  3V3X A;  3I3T B;  4P6V F;  4US9 A;  3ZO5 B;  3MHS D;  2FNJ B;  1P1A A;  3W9C B;  3RNB C;  3VQI A;  3SR6 A;  1VLB A;  4WUR A;  4B9K A;  4GDL B;  3KUD B;  2V1Y A;  1J7A A;  3ZUN A;  2KDI A;  2KDB A;  5L95 C;  3AEC B;  1L4D B;  3C0R B;  4GDL A;  3GOE A;  2QHO A;  4HCP B;  2WQY B;  1V6E A;  1Y56 A;  5AEK B;  1GC7 A;  2IO3 B;  1RLF A;  1NEK B;  4KGT A;  1C79 A;  4RNA A;  1VR9 A;  3Q3F A;  5IAA C;  2KX3 A;  2FUH B;  2LJ5 A;  4EFO A;  3W1Y A;  3ZLZ A;  3NRZ A;  2BB5 A;  1EUV B;  4MGZ E;  2KLG A;  3HUI A;  2QC8 A;  1GNU A;  2EKE C;  4C7Z A;  3ML8 A;  2MW5 A;  4DDG D;  1WGD A;  3CSF A;  2DX5 B;  1Z5S B;  5CX3 A;  3L10 B;  1H8C A;  3PO0 A;  2IGH A;  4RH6 A;  4AWJ A;  1WH3 A;  4ACF A;  1T0Q C;  3S2A A;  3SFE B;  1ET9 A;  1HTO A;  1ESF A;  4W9K A;  2D3A A;  4FLH A;  3EGR A;  3VHT C;  1N62 A;  3RI7 C;  3IT4 B;  2FCM A;  1IYF A;  2AL6 A;  3ZRC A;  2QSD A;  1SJH D;  4ZRI A;  3MJW A;  3NOB A;  4FJZ A;  1QOG A;  1VCB A;  5IN7 A;  4B6W A;  2NVU I;  2IGD A;  2MX2 A;  1F52 A;  1TS5 A;  2LMC A;  3L54 A;  4EE2 A;  2GBJ A;  4P1B C;  3SD5 A;  2D3C A;  4DDI D;  2ACZ B;  3UIO B;  2D3B A;  2K6D B;  3AE9 B;  1CMX B;  2DYM A;  2AQ2 B;  1AWD A;  4TUU A;  4EZL A;  1TGZ B;  3P4Q B;  4PT5 A;  3BZD B;  1C1Y B;  1EU4 A;  3EUB 2;  3FIL B;  3BVZ A;  1C78 A;  4FA6 A;  4BFR A;  4A9A A;  2JYE A;  2QDF A;  2WXJ A;  5D3D A;  2JWU A;  2SEB D;  2CHZ A;  3OJ3 A;  2MJ3 A;  2K5P A;  4A55 A;  5FKA C;  2Q5W D;  1M94 A;  3UF8 A;  1L0Y B;  3R3M A;  4OVU A;  1SE4 A;  2N0S B;  2G45 B;  3FIL A;  2PEA A;  2VZK D;  1L6U A;  2IY0 B;  1GPX A;  5E6N A;  1C4P A;  2JXT A;  4DBG A;  5BMI A;  1FRD A;  1FXT B;  2JZP A;  2LRW A;  4LNK A;  4ASW C;  1U4A A;  4W9F A;  2FCS A;  3PZ8 A;  2C7N B;  2PIA A;  3GE3 C;  2XBB C;  1UH6 A;  5JXV A;  3ZYY X;  4BZA A;  2MSE D;  4N9F 4;  4P16 A;  1IGD A;  1C9F A;  1E7V A;  3E56 A;  1UWM A;  3PZD A;  4OZB A;  3T3O A;  4WQM A;  3M3J A;  2IO0 B;  3ZRF A;  2IO1 B;  2ZW0 A;  2KJH B;  4WWP A;  2O2V B;  3Q8B A;  3NS1 A;  1OTR B;  3W5U B;  1WJU A;  1SE9 A;  3P2B A;  4BKS D;  4XGA B;  4NAW B;  4HKZ E;  3OJ4 B;  2O2V A;  2C5L C;  2HE7 A;  5IP4 D;  1E5W A;  1ZDX A;  3DBR B;  3T8M A;  4K3B A;  4NAW A;  2V9H A;  2Z0D B;  1SE2 A;  4C80 A;  1J8C A;  3JVZ X;  1JWS D;  3WA0 A;  3Q3J A;  1MHH E;  4IM0 A;  1PDX A;  2HDE A;  1FM0 D;  3AEA B;  3P4S B;  2BWF A;  4F1S A;  1EF1 A;  2FIF A;  2PE9 A;  3VR8 B;  5TR5 A;  3EA6 A;  1D5M C;  5IOI A;  3DPD A;  1B9R A;  2L00 B;  4L2Y A;  2BWE S;  2MEK A;  3KYC D;  3EHV A;  3B1L X;  1KOT A;  4FUL A;  2BS4 B;  1I4X A;  2ZCB A;  4CHK A;  2N7D A;  3N1X C;  1DOI A;  5IKC M;  2KFK B;  1FXA A;  2IJ0 A;  1TTN A;  4WIP A;  1IUE A;  1XLP A;  2PPH A;  2PE6 B;  3RZW C;  3ZXR A;  1Z2M A;  1K52 A;  1WFY A;  4ITK A;  1P3Q U;  1K50 A;  4GXB A;  1XXG A;  2KFK A;  3JW0 X;  4BKG A;  4HPM B;  1D4B A;  4TMA B;  1IGC A;  5LXH A;  3T3N A;  1F0Z A;  2DYB A;  4XC2 A;  2JRI B;  5HKH A;  1SF0 A;  3KH0 A;  1P98 A;  3KUZ A;  3ZGZ A;  2VZK B;  4DK5 A;  4E3C A;  2EEL A;  5DPT A;  1RRB A;  4A90 A;  3IVF A;  2GBR A;  1E8X A;  2JZ3 B;  3RNC C;  1HXY D;  1WYG A;  3CWI A;  2E6X A;  2XNA C;  2FCQ A;  4L23 A;  2L32 A;  1FNW A;  1UEL A;  4FJY A;  2BW2 A;  4MM3 B;  1HZ5 A;  2G4D B;  3A33 B;  1JWB D;  5D94 A;  2KAJ A;  4WWN A;  1EF5 A;  4MGI E;  4HCN B;  2LGX A;  4MM3 A;  1M4V A;  1P7F A;  1WJN A;  5C1Z A;  2IND C;  5E6P A;  2JWZ A;  1E7P B;  2JSV X;  3AUL A;  3TL5 A;  2ZJD A;  3AXC A;  3OLM D;  4HRO A;  1CJE A;  4GGQ A;  4HPP A;  2WXN A;  3QWZ B;  3UGB B;  2KC2 A;  3QX1 A;  1FEH A;  2KMM A;  1ZOY B;  1FD6 A;  5MPO A;  3U4E G;  4BKS A;  4EZJ A;  1AW7 A;  3DBH B;  2GLS A;  5BYQ A;  2NCN A;  5EDS A;  2Y5B B;  2CU3 A;  3Q6B A;  1EU3 A;  4S17 A;  3V6C B;  1R4M I;  2W9N A;  2ZEQ A;  1JWU D;  3BII D;  5G2N A;  2KD0 A;  3ZNZ B;  3DVN U;  2K0P A;  4NJ7 A;  4NJ6 A;  2LXA A;  4ZRP A;  4W9J A;  2N9X A;  5AUK A;  3Q8A A;  1TKY A;  1NI3 A;  1LQB A;  5FR3 A;  1FMA D;  1TY0 A;  2Z0E B;  2ON8 A;  3WAO A;  1XEE A;  2ZPN A;  2LRU A;  1FFV A;  2KDF B;  2KKC A;  3M63 B;  5G55 A;  2RD0 A;  1LFD A;  5BYR A;  1TZO A;  2JU6 X;  3NZ3 A;  1WXV A;  1F2R I;  1C4C A;  1NI2 A;  2PJH A;  5BO4 B;  4GU2 A;  1G6J A;  1FNV A;  1PUT A;  2LD9 A;  2GBK A;  3HVD A;  3IXS A;  1ZUD 2;  2RMM A;  1DOX A;  1K8R B;  4OZC A;  3QQ8 B;  2DNF A;  2XK5 B;  3KLS X;  1N61 A; 
#chains in the Genus database with same CATH homology
 1XQQ A;  2MCN B;  4K81 A;  5L95 C;  2BKF A;  2LUE A;  2KOX A;  1MG8 A;  1V86 A;  1T0Y A;  2ZPY A;  3C0R B;  4IC7 B;  4GDL A;  3GOE A;  3H6N A;  2KO3 A;  2QHO A;  4HCP B;  2C9W B;  1V6E A;  5J17 A;  2XK5 A;  5AEK B;  1HE8 A;  4KSL C;  1GC7 A;  4FAD A;  3RCZ A;  2IO3 B;  4MJS B;  1RLF A;  5FR6 A;  4CO7 A;  2MP2 B;  2UYZ B;  2GBM A;  2N1W A;  4NY0 A;  1GC6 A;  1R4N I;  3Q3F A;  5IAA C;  3U7D A;  2KX3 A;  1YX6 B;  3WAN A;  3AU4 A;  2R2Q A;  3KYD D;  1Q1O A;  2FUH B;  1GG3 A;  3R7R A;  2LJ5 A;  4EFO A;  2Z59 B;  3W1Y A;  3ZLZ A;  4MJS A;  3ALB A;  2MP2 A;  3HM3 A;  3H7S A;  1EUV B;  4MGZ E;  1WX7 A;  2KLG A;  3VTW A;  2KMC A;  2C7H A;  5AZG A;  1ZW7 A;  2OOB B;  1WM3 A;  4RM8 A;  3JYU A;  1GNU A;  4URK A;  4IUM B;  2EKE C;  4WJP A;  5AZF A;  4OVV A;  3ML8 A;  1PQS A;  3A4S C;  3VUY A;  4HLE A;  2KMA A;  2MW5 A;  4HJK A;  5J2R A;  3H9D A;  2JRH A;  2J0M A;  1XT9 B;  2KLC A;  3L13 A;  4DDG D;  1V81 A;  3APC A;  1L2N A;  2K8C A;  1WGD A;  1UBQ A;  3CSF A;  2HJ8 A;  2DX5 B;  1V5O A;  4AJW A;  1Z5S B;  2MBB B;  3L10 B;  2MA9 B;  2UWQ A;  4P7I A;  2C7M B;  4KV2 A;  4LDT D;  5CX3 A;  1H8C A;  2WWZ A;  3RZF A;  2MLB A;  1S1Q B;  5KHO A;  3VH3 B;  4MSM B;  1WR1 A;  1WX8 A;  3DQV A;  4AWJ A;  2G4S A;  2RR9 A;  3HK0 A;  3PRE A;  3RUI B;  1IPG A;  1WH3 A;  1WY8 A;  1YQB A;  3H1U A;  5GMV A;  3UIP B;  3KUC B;  1UGM A;  3HIZ A;  4FHJ A;  4WWO A;  5L83 A;  2NBW B;  3S2A A;  5DPR A;  4E74 A;  3EEC A;  2N7E A;  3WAL A;  4W9K A;  2FAZ A;  5CHF A;  4FLH A;  2K25 A;  3B0A A;  3VHT C;  3PHX B;  2CHX A;  1XD3 B;  1E8Z A;  1P0R A;  3VAW A;  3L16 A;  3MTN B;  5DCN A;  2FCM A;  2LXC A;  1IYF A;  2AL6 A;  1P9D U;  2B3A A;  3ZRC A;  4ZRI A;  3RT3 B;  3MJW A;  3NOB A;  4FJZ A;  1JRU A;  5KHQ A;  1YJ1 A;  4XX5 A;  1VCB A;  3L0W B;  4I6L B;  4DHJ D;  1WMH B;  3V60 A;  4B6W A;  3QC8 B;  2NVU I;  2NR2 A;  3ZTC A;  4IM3 A;  2ZCC A;  4F8C B;  2MX2 A;  4W9L A;  3PT2 B;  4K7W A;  2D10 A;  3L54 A;  2GBJ A;  2KX0 A;  3SD5 A;  4HPL B;  2R2O A;  3V62 A;  4DDI D;  3UIO B;  1LM8 B;  4JIO U;  2KTR B;  3K9P B;  1Q0W B;  4IWQ A;  4K7U A;  1WMH A;  2K6D B;  4MGK E;  3U30 A;  1KLV A;  1CMX B;  4MEL A;  2DYM A;  1WZ0 A;  3X23 A;  1WGG A;  4TUU A;  4ANU A;  3NZS A;  4DHZ B;  3D32 A;  4EZL A;  3DBR I;  1TGZ B;  2G3Q B;  5CHW A;  2CS4 A;  2M8S A;  3QCA A;  4HXD A;  1C1Y B;  3VXW A;  4JL9 A;  1V2Y A;  3A1Q B;  2KTR A;  4FA6 A;  3PVL A;  4BFR A;  1BT0 A;  3IG3 A;  3R7Q A;  4BOZ B;  4F7Z A;  1OEY J;  1OQY A;  2GOW A;  2VRR B;  2JXX A;  2LVO A;  2DZJ A;  3A9K B;  2CHZ A;  3DBL I;  3OJ3 A;  3O65 B;  1M94 A;  1YX5 B;  3UF8 A;  2I1J A;  3ONS A;  2MBO A;  3R3M A;  4OVU A;  3WAP A;  2EMT A;  1F9J A;  2G45 B;  2O6V D;  3A1Q A;  2PEA A;  4YL8 A;  1WGR A;  2IY0 B;  4RM9 A;  5E6N A;  3PRM B;  4HDO A;  2ZVN A;  4GSW A;  3PPA A;  4IWP A;  2BGF A;  3A9K A;  3RUL A;  4DBG A;  2L76 A;  1I42 A;  2LRW A;  1FXT B;  4ASW C;  1U4A A;  1KJT A;  4W9F A;  2FCS A;  1ZGU B;  4EKU A;  2BF8 B;  4WJQ A;  3KW5 B;  4BBN C;  2C7N B;  3ZKJ C;  2XBB C;  1UH6 A;  2BYV E;  1WZ3 A;  3X0W A;  2MSE D;  4N9F 4;  4JGH B;  4ZRK A;  5CTR C;  1E7V A;  3PZD A;  4MDK E;  1V49 A;  4EEW A;  1D3Z A;  1RAX A;  3M3J A;  2IO0 B;  2KC1 A;  4GOC A;  3DCG A;  2AYO B;  3PRZ A;  3ZRF A;  4AP4 C;  2KZR A;  3BIN A;  4NPN A;  4HDQ A;  2IO1 B;  4GN1 A;  3TIX A;  4E71 A;  2KJH B;  1UBI A;  4WWP A;  2KQ7 A;  2O2V B;  2NPT B;  2DZM A;  2KXJ A;  5D7G A;  1WR6 E;  1OTR B;  3SDL C;  4J6I A;  3K9O B;  2K8B A;  3KVF B;  1WJU A;  1SE9 A;  2ZZP B;  3P2B A;  3QA8 A;  4W9C A;  4BKS D;  2AWT A;  4NAW B;  2HD5 B;  3SU8 X;  1GJZ A;  2M17 A;  3OJ4 B;  3PTF C;  5C23 A;  3U8Z A;  5JZE B;  4TQ0 A;  2IYD B;  2O2V A;  2NPT A;  2C5L C;  2HE7 A;  2N4F A;  1E5W A;  2K39 A;  3LDZ E;  3CF6 E;  3IBE A;  1V80 A;  2DYO A;  3T8M A;  4W9G A;  5J18 A;  1Q5W B;  4ZDV A;  1E90 A;  4TQ1 A;  1GUA B;  2JPH A;  2LVQ A;  4NAW A;  1H4R A;  3N32 A;  2KDE B;  2WX0 A;  2Z0D B;  3L17 A;  4WJO A;  2RSU A;  2LGY A;  1J8C A;  3JVZ X;  3IHP C;  4AUQ C;  3WA0 A;  4K7S A;  2A5U A;  2KJ6 A;  3Q3J A;  1SGH A;  3OAW A;  4LDT B;  4WJN A;  4BOS C;  3ENE A;  4IM0 A;  2DZI A;  4PS8 A;  2KWU B;  3CST A;  3HHM A;  2XEW A;  3DVG X;  2GMI C;  2BWF A;  2LVP A;  2LGD A;  2D07 B;  4MH0 E;  3BY4 B;  4F1S A;  4JQW C;  1EF1 A;  2FIF A;  2PE9 A;  4NNJ B;  2HTH A;  5TR5 A;  4IWO A;  1C3T A;  1SIF A;  3ZDM C;  3HM6 X;  4KDI C;  2EMS A;  3IFW B;  1TZ1 A;  1WE7 A;  2C60 A;  3DPD A;  3QHT A;  1WRD B;  4FBJ B;  3QK0 A;  2L00 B;  2BWE S;  3TBL D;  3PGE A;  3M62 B;  1WJ4 A;  1WYW B;  3KYC D;  4HWI B;  4BKT A;  3EHV A;  1A5R A;  3NZU A;  3PRP B;  4PS3 A;  3ZIM A;  3B1L X;  1KOT A;  4FUL A;  2L0F A;  3DDC B;  3DOW A;  2KHW B;  2NBV B;  2CR5 A;  2ZCB A;  4M0W B;  3RYT A;  4DHJ B;  3PV1 A;  2KFJ A;  1WI0 A;  2I1K A;  1WX9 A;  1EO6 A;  3TCA A;  4CHK A;  2N7D A;  3GZN I;  2NS5 A;  3UQB A;  4ICU A;  4A20 A;  2CHW A;  4TV3 A;  2KFK B;  4EUT A;  2WX1 A;  2IZV B;  3VH4 B;  1ISN A;  4GB9 A;  4G3X B;  4LJP B;  1TTN A;  2DHZ A;  2LI5 A;  4MSQ B;  2A4Z A;  2KVR A;  3VFK A;  1NBF C;  2PPH A;  2PE6 B;  3RZW C;  4KSK C;  1VD2 A;  1Z2M A;  2MBH A;  3ZNI D;  3ZNH B;  1J19 A;  2BYE A;  1YIW A;  3ML9 A;  1WFY A;  4ANW A;  4RMA A;  2K6Q A;  3QAQ A;  1P3Q U;  3AI5 A;  4GXB A;  4A3P A;  2KFK A;  1WF9 A;  3JW0 X;  1WE6 A;  2FCN A;  2WDT B;  4BKG A;  1E8Y A;  2AL3 A;  3NHE B;  4HPM B;  4X57 B;  3WAM A;  3ZW3 A;  4LCD E;  3JSV B;  3WIM A;  1WXS A;  2JVC A;  5LXH A;  5DPW A;  2DYB A;  4XC2 A;  2LZ6 A;  4G0N B;  2JUO A;  3ZVV A;  3SHQ A;  2JRI B;  3NY5 A;  3LJ3 A;  4AOF A;  1WGY A;  3PSE B;  2J0J A;  5HKH A;  3T9L A;  3KH0 A;  1P98 A;  3KUZ A;  2K1F A;  2MBE A;  1WM2 A;  4BVU C;  2O6V B;  4ANV A;  3JSV A;  4GDK B;  4II2 B;  4ANX A;  1OEY A;  4DK5 A;  4E3C A;  5DPT A;  1RRB A;  2V3S A;  2V4L A;  2D11 A;  2KQS A;  3IVF A;  4NQL B;  2JZZ A;  1E8W A;  4HVB A;  2KK8 A;  4HK2 A;  1I35 A;  2J0K A;  2GBR A;  1LXD A;  2NBU A;  1E8X A;  2JZ3 B;  2MRP A;  3QJZ A;  3VTU A;  2DZK A;  5JH5 C;  4G11 A;  1S3S G;  4MGY E;  2D3G A;  3R66 C;  2O6V A;  4GDK A;  2BPS A;  1E7U A;  2JY6 A;  2M4N A;  2FCQ A;  1J0G A;  4II3 B;  2LAS A;  4PYU A;  1UEL A;  4FJY A;  4IG7 B;  2N9P C;  2G4D B;  3A33 B;  2J7Q B;  4GIV A;  2YLM A;  4WAA A;  2KNB A;  2MQJ A;  1KM7 A;  5D94 A;  4EZK A;  4XZ4 A;  4IW0 A;  1WXA A;  2CU1 A;  3N3K B;  4WWN A;  5CHV C;  1EF5 A;  4MGI E;  3UQA A;  4LJO B;  4HCN B;  2LGX A;  4MM3 A;  3DVG Y;  4FJV B;  1WJN A;  5C1Z A;  2N1V A;  2KWV B;  5E6P A;  4KDL B;  2JWZ A;  3AUL A;  4W9D A;  5LXI B;  1TBE A;  2ZJD A;  3TL5 A;  5JHA A;  1ZKH A;  3AXC A;  2DAJ A;  3AU5 A;  3OLM D;  4K1R B;  3APD A;  4DXA B;  4KIK B;  1WIA A;  3VVW B;  3VUW A;  2L05 A;  3VTV A;  4BBN F;  1YD8 U;  4GGQ A;  1QZE A;  3QWZ B;  2JT4 B;  3UGB B;  1UD7 A;  2DEN B;  3B08 A;  1V5T A;  2KC2 A;  3QX1 A;  2N9E B;  4AJY B;  2L7R A;  3PS6 A;  2IO2 B;  4JLC A;  4IM2 A;  2YVC A;  2L3Z A;  3CMM B;  3APF A;  3ZTD A;  2KJR A;  4BKS A;  4M8M A;  3V6E B;  2M0X A;  4KIK A;  2ZNV C;  3A4R A;  4EZJ A;  2ZNV B;  3H7P B;  3A9J B;  2WYQ A;  4I6P A;  4W9I A;  2GBN A;  1WXM A;  2BYF A;  2IBI B;  5D2M B;  1X1M A;  1WGH A;  2NCN A;  2IY1 B;  1UZX B;  2ZVO A;  3EFU A;  5EDS A;  4A3O A;  2Y5B B;  1L7Y A;  1V9J A;  3V6C B;  3DVN V;  4ZRJ A;  3H7P A;  1R4M I;  2W9N A;  2ZEQ A;  3A9J A;  3W1S C;  2M1M A;  4PYZ A;  5G2N A;  2KD0 A;  3ZNZ B;  3DVN U;  4DHZ E;  4G50 A;  5JHB A;  4FHK A;  2OJR A;  4NJ7 A;  2ASQ A;  4NJ6 A;  2LXA A;  4W9J A;  2N9X A;  4KZ0 A;  4CYE A;  4M8N A;  4KZC A;  2L8J A;  2KN5 A;  4MEM A;  5DPS A;  3PLV A;  3N30 A;  3RD2 A;  2K8H A;  4WQO B;  3NS8 A;  4PS7 A;  5AZH A;  1OGW A;  4GMV A;  4KVG B;  1WJ6 A;  3W1S A;  2MBQ A;  5IA7 A;  1LQB A;  2RPQ A;  4ICV A;  2L0T A;  2Z0E B;  3QAR A;  5D6J B;  3WAO A;  4W9H A;  2FID A;  2D2Q A;  2ZPN A;  2LRU A;  1IP9 A;  2KDF B;  3ZDT A;  1RFA A;  3PLU A;  2RGF A;  2KKC A;  3M63 B;  2CKH B;  4W9E A;  3QIJ A;  5E6O A;  5G55 A;  3V61 A;  2RD0 A;  4TKN A;  3TJP A;  1LFD A;  2BKR B;  4DWF A;  3TMP B;  1NDD A;  3EC8 A;  3PHW B;  2MWS B;  1Y8R C;  2KWC A;  3VDZ A;  1WXV A;  1NI2 A;  2KTF A;  2LWP A;  2PJH A;  4GU2 A;  5BO4 B;  3ZNG C;  4B95 A;  3I3T B;  1G6J A;  3DBH I;  2DAF A;  1AAR A;  4NQK E;  4I6N B;  3ZO5 B;  2JF5 A;  3MHS D;  2KAN A;  3L08 A;  2FNJ B;  2LD9 A;  3ECI A;  1P1A A;  2GBK A;  2AEH A;  4ZYN A;  3VQI A;  4EOY A;  3VUX A;  1K8R B;  3UIN B;  4B9K A;  4GDL B;  3M95 A;  4FN2 A;  3QQ8 B;  3KUD B;  3DBS A;  2REX A;  2V1Y A;  2XK5 B;  3ZUN A;  2KDI A;  2KDB A;  5LLI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...