3I5JC

Diferric resting state toluene 4-monooxygenase hd complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
82
structure length
82
Chain Sequence
SAFPVHAAFEKDFLVQLVVVDLNDSMDQVAEKVAYHCVNRRVAPREGVMRVRKHRSTELFPRDMTIAESGLNPTEVIDVVFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic and catalytic studies of the peroxide-shunt reaction in a diiron hydroxylase.
pubmed doi rcsb
source organism Pseudomonas mendocina
molecule tags Oxidoreductase
molecule keywords Toluene-4-monooxygenase system protein A
total genus 24
structure length 82
sequence length 82
ec nomenclature ec 1.14.13.236: Toluene 4-monooxygenase.
pdb deposition date 2009-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 3i5jC00
3GE3C 3Q3OC 3Q14C 3RNCC 3N1YC 3N1ZC 3I5JC 4P1BC 1T0SC 1T0QC 3RNFC 2RDBC 3DHHC 1T0RC 4P1CC 3DHGC 3RI7C 2INDC 3RNAC 3N20C 3RNEC 3I63C 3Q3MC 3Q2AC 3RN9C 3RNBC 3N1XC 3DHIC 3RMKC 3RNGC 3GE8C 2INCC 3Q3NC
chains in the Genus database with same CATH superfamily
4MH0E 4XDDA 1WI0A 3IG3A 1TBEA 2LVOA 2OJRA 1JRPA 3IT6B 1WGKA 2FNJB 1TY2A 3MHSD 4KIKB 1WR1A 2G45B 4LNNA 4RGMA 2WXIA 1C1YB 4OVUA 1JQ4A 1J7CA 3HUIA 4URKA 1IBXB 1VCBA 2I38A 3P4RB 1LGRA 2R61A 4NNJB 3PO0A 1Z2MA 3AN1A 4IKGA 3I57A 1WGHA 1D5XC 2PEAA 4PT5A 3ZUNA 2JU6X 4RGTA 2KLGA 5I4DA 1FRRA 4XE0A 1R4MB 2J0MA 4W9LA 2ZVOA 1HQRD 3ZNID 3EGRA 1RM6C 3W5UB 1V2YA 4S17A 3FILA 4RF1A 3UF8A 4M00A 5IAAC 5JHBA 3NG0A 3HVDA 4XGAB 5IOIA 2KWUB 4EKUA 2INNE 4B6WA 5J2RA 1NYQA 2YEPB 2LUEA 3NVYA 1Q1OA 2QEJC 3AE7B 4MEMA 3R7RA 4HPMB 3OG5A 2LVQA 1GAQB 1VZ6A 2K8HA 2JZPA 1Y8RC 3PV1A 1HE8A 4MGKE 1FNVA 3UIOB 1F0ZA 1QOBA 4W9CA 1PGXA 2IYDB 1IYFA 1B1ZA 2WWZA 2LMCA 4KKIA 1I7HA 2WXPA 4KDLB 1D5MC 1RWSA 4C00A 1GB4A 4ANXA 4Q2JA 3NY5A 3AEBB 3Q6BA 1E5WA 3A1QB 3MJ5A 4ARIA 3VUYA 3W5VB 2BWFA 2KJ6A 4D2KA 3V05A 3NZ3A 4JIOU 2GMIC 2VH1A 5HI1A 4H2AA 5DPRA 2UYZB 1HZ5A 2IGHA 2KMAA 3NRZA 1KM7A 2MQJA 4KV2A 3PRZA 1NVID 5LLIA 1FCLA 4M01A 2D3BA 1YNTE 2G3QB 5J18A 2MJEA 4LLGM 2KO3A 1P9DU 2KK8A 1WXQA 3U2SC 4C7ZA 4O1NA 4OVVA 2JRIB 2O2VB 4RF0A 3B2FA 2PTLA 1E8WA 1H4RA 2GOWA 2YVCA 1VJKA 2K1FA 4REZA 2BS2B 3GZNI 2C60A 3DVNV 4PS3A 2WYQA 1KLUD 1MG4A 1UUPA 4MACA 3CF6E 2M1MA 1PFDA 4MSQB 1F9JA 3RPFC 3BYYB 4C7YA 5G2NA 5CTRC 3ZVVA 4YSYB 2RR9A 3Q3OC 1FD6A 1YX5B 3IXSA 3I5JC 3WANA 1FIQA 4WWMA 4LNIA 1JWMD 3QWZB 2MP2A 5E6NA 1K8RB 3L16A 5FK9C 2N4FA 2NBUA 4M8NA 2PJHA 3KWVA 3C0RB 4GN1A 4AUQC 3UQBA 1I42A 1WXAA 2ZPNA 1L7YA 3ZYYX 4YSZB 1UZXB 2JQRB 4XYCA 2KQ7A 2MBEA 3H1UA 2WXFA 3OAWA 1WY8A 2IO1B 4WQMA 3H8HA 1Q0WB 3MC0B 3U52E 4W9FA 2MLBA 1YN5A 1N60A 2Z59B 3BVZA 2KACA 1JMLA 4DBGA 2KN5A 3V3XA 4GSWA 4LDTB 2M56B 1MPEA 3CSFA 1HZ6A 4DQOC 4P1CC 3LXFA 3GS2A 3DBRI 4A20A 3ALBA 2PKOA 1DOXA 2L3ZA 4FADA 4MT5A 4K1RB 4ZRQA 5L83A 1QLBB 4GMVA 1N5WA 2C9WB 2LZ6A 2DYMA 2LRUA 4GOCA 1V1PA 2GBNA 3MC9A 2LHEA 5CHWA 1E8XA 2MEKA 2H89B 2KMCA 1E9MA 1TS2A 4GU2A 4II2B 3L0WB 4LTUA 4WJOA 4RCOA 4M0WB 3PRMB 1WJUA 3PPAA 4RMAA 4IC7B 3MC8A 2WX0A 1RYJA 3LDZE 2M4NA 3DHGC 2AL3A 2ACZB 1IGCA 1RFAA 3KUDB 4EZLA 3C8YA 1OTRB 1FFVA 1SB3C 2JWZA 5FR6A 2E6XA 3KYCD 4ANVA 1UF0A 3MFGA 1XLPA 1C3TA 3HRDD 1KLVA 2I1JA 1FFUA 3NHEB 1HTQA 2KTRA 2SEBD 3AH7A 1WGDA 3DBLB 3PZ7A 2BS3B 3NS1A 3UI3A 3PZ8A 1TS4A 1C76A 3U30A 2VH2A 2MW5A 4KZCA 5KHOA 2N9EB 3EECA 3TEZA 4M0WA 3RNBC 2KC2A 5J17A 1WX8A 2FIFA 4EOYA 1XLOA 1CK1A 4HPPA 1GG3A 4PS7A 3AE3B 2K25A 3AEEB 4RM8A 3ZRCA 4NZLB 2WXGA 2X8XX 2G1EA 3TEWA 1PYWD 2EMSA 1YJIA 4ZDVA 4HEA1 5TSSA 3QA8A 3PS6A 1L0VB 1C77A 3WAOA 3A1QA 3TUOA 5AUIA 1SXTA 2X38A 3HHMA 4HK2A 4NQKE 3PVLA 1ZUD2 3LJ3A 4C80A 3QCAA 1SF0A 5D3DA 2KX0A 3UQAA 3RCZA 4KGSA 1JWUD 3T3OA 1P7EA 1QZEA 2JVCA 1E6EB 4ZRPA 3ZJTA 1EF5A 1SE3A 1V1OA 1FNWA 1XEEA 5HFYA 4DHJD 2MBBB 1ISNA 2KC1A 1ZKHA 4A90A 2ZJDA 3VRAB 1ZDVA 2M19A 3DCGA 1T0YA 2LEKA 2GLSA 3NS8A 1WGGA 2DHZA 2BYVE 3PREA 1LM8B 1CMXB 2MSED 1XF5L 5CX3A 1WXVA 1P1AA 3M95A 2WXLA 4IDIA 5HHDG 2FUG1 4L1BA 3VRBB 2Z0EB 5DPSA 3N30A 3U7ZA 2JZZA 2Y5PA 2KQSA 2L1AA 3VR8B 2XBBC 4DK5A 1DYQA 3APCA 1XD3B 2WXRA 2XNAC 2DZKA 3TIXA 3TMPB 1WGYA 1OEYA 3RNEC 3SD5A 4KZ0A 4II3B 1NI2A 1DGJA 3BK1A 3L13A 5LXHA 3ML8A 1OQRA 1EWCA 1FMAD 3A33B 2FCNA 3E56A 2K8BA 2G4SA 2O6VA 1DOYA 2PE9A 4MELA 1E7VA 2W55A 2NPTB 1P7FA 4B95A 3Q8FA 4QAYA 3BINA 2JY6A 1WE7A 2VZKB 2K22A 2J53A 4F8CB 2KWVB 3N1ZC 2JT4B 1PQSA 4K3BA 3QJZA 2D07B 1WYGA 1E8YA 1FPYA 1TJEA 2BT6A 3ZTDA 5DCNA 2D3CA 2IBIB 3DBHI 1C78A 1KF6B 4XDCA 2XK5B 2PE6B 4C4VB 2J4XA 1D5ZC 4W9KA 3U4EG 4EUTA 2KDIA 3I9V1 3BK2A 3PLVA 3ZIMA 1KH0A 1FRDA 3H7PB 2KLCA 5H92C 3T3NA 3VVWB 3KQ4A 1I4RA 2DZJA 3DWGC 3IVFA 4I6NB 1C4CA 5JZEB 1KOTA 1QF6A 4LNFA 4FXCA 2MA9B 1ZE3D 4LDTD 1FXTB 1ACCA 1EUVB 3L54A 3ZJUA 5BO4B 4XZ4A 3P1MA 2BKRB 4MSMB 2ZPYA 1TS5A 2LXCA 3JSVB 2IY0B 3JVZX 1WZ3A 1K53A 1RAXA 1P98A 1VD2A 4IW0A 2W3SA 3VUWA 2LXAA 1FCCC 1AW7A 2ZW0A 2N1VA 2DZIA 4HRSA 2IPKD 2N7JA 3OJ4B 4PK1A 3DBSA 4NAMA 4A3OA 4L2YA 4ZHPA 2RPQA 2ZNVB 3ZQ4A 4DDGD 4WWNA 3RD2A 2IO0B 2WU2B 3GOEA 2DLBA 2L76A 2DZMA 2KX3A 2MP2B 2JSVX 2N1WA 2EKEC 4HCNB 5AEKB 2WS3B 3A4RA 1E8ZA 3Q2AC 2KQ4X 4MM3A 4OZBA 1KJTA 4OHJA 4G0NB 3AE2B 2WXJA 2MHJA 3NZSA 2WDTB 3IHPC 1U4AA 3ML9A 4WQOB 1YQ4B 4BVUC 4E71A 1GOZA 2WHIA 4FN2A 3PZDA 4WIPA 2R2QA 2KDMA 5C1ZA 4AOFA 3PTFC 1FNUA 1Z5SB 3NUHB 5L95C 2LGIA 2D3AA 3JYUA 3QQ8B 5G5HA 2LVPA 1L0XB 4XX5A 1HTOA 5C23A 2AQ2B 2BTEA 3NVWA 4BBNC 3R2IA 3EFUA 3DWMA 2BYFA 1JCKB 3TBLD 1UGMA 1ZXHA 3ZNGC 2KFKA 2MBOA 4HROA 3U7DA 4WJQA 4RH6A 2WXHA 1JROA 3GZNB 3JW0X 1ZXIA 2GBMA 1V5OA 1I4XA 3ZRFA 2K6DB 2KD0A 2RDBC 3RFZB 1KTKA 1TYGB 4BKSA 4FJZA 3URYA 2AL6A 5DPWA 3KH0A 5JXVA 4KGRA 1E90A 3VH3B 1TTNA 2V4LA 2JXXA 1CQVA 4K7UA 5G55A 3K9PB 4TQ1A 2L0TA 2AWTA 4NAWB 1N6ZA 2L8JA 1TY0A 5CHFA 2BYTA 2L52A 2O6VB 1NYRA 4A3PA 3ZXRA 2HTHA 1LFDA 3VXWA 4JWSC 2IDYA 4KSLC 1J19A 1P3QU 2QIEB 3SDLC 2WDRB 4ZOHC 5GMVA 1OQYA 3ENEA 1J7AA 1N5XA 1JWSD 2BGFA 3ZXVA 1WE6A 2D10A 2W3RA 1WSPA 1ZP0B 3SHQA 1SSNA 1HXYD 4OW0A 3TL5A 4B9KA 4RNAA 2Y3AA 2QILA 2QC8A 2MJDA 3DBRB 3E9SA 1IGDA 3AM9A 1Q5WB 3RUIB 2CKHB 4L23A 4N6EB 4NJCA 1TKEA 2KDFB 1E0ZA 1XLNA 3TCAA 2SAKA 4G11A 3RNFC 3R3MA 1QT9A 2NMQA 2YLMA 4I6PA 2L7RA 1B9RA 1L4ZB 1GC6A 2WXKA 3R66C 1UGJA 1XCQL 3PRPB 3GB1A 4ZRKA 1I4GA 4ZYSA 2DBYA 2QDFA 2GBKA 2LD9A 4X57B 4YT0B 2MJ3A 4MJSA 4BOZB 1UWMA 2ZZPB 1PUTA 3JSVA 4EE2A 2RSUA 1EO6A 3V61A 2KAJA 2ASQA 1RFKA 3MTNB 4OZAA 1P0RA 5C2TB 4JL9A 4AJWA 2V9HA 1SJHD 4AP4C 3FAHA 1AYFA 4GGQA 3X23A 4RM9A 2WNMA 4BKGA 2JXTA 3N1YC 3AU4A 4JPSA 4W9HA 2RDHA 4NJ7A 2WDVB 1V1PB 1GB1A 3VQIA 4HKQA 3Q8EA 4HVBA 3IBEA 4FJYA 3RI7C 4DHZB 4NQLB 4HKZE 5EE9A 3VDZA 3IAM1 2FBWB 2W9NA 2MX2A 2HJ8A 3MHZA 4DWFA 4GDLA 2GI9A 2K6QA 5CHVC 1VZ7A 5E6OA 4FHKA 3ZNZB 5FR3A 4JQWC 3KUCB 2ONQA 2M0XA 2WXQA 1XO3A 4P7IA 2K3UA 1Y56A 1MG8A 1M94A 4IM0A 3RULA 2BWES 1V81A 2NPTA 2AYOB 3P4PB 4C4VA 1QILA 2QHOA 2Z0DB 4E3CA 2TSSA 5EE0A 3DVNU 3U8ZA 3AEFB 4KDIC 2EMTA 1WM3A 4USAA 1ZGUB 1NENB 1YQ3B 4KVGB 4DXFA 4CQNA 1EM7A 3I3TB 1FM0D 5MPOA 2Y5CA 4AWJA 3GP7A 1ZW7A 4KKJA 2CJNA 2LJIA 1I4HA 3PT2B 2G9HD 4JWUC 2CJOA 5BMIA 1R7SA 1NEKB 2DENB 3AEGB 3AV8A 4FJVB 2GBRA 1GPXA 3B1LX 2WQYB 4IM3A 1N62A 4HDQA 4HWIB 5JHAA 4IG7B 4LNOA 2KANA 1FXIA 4MGIE 3CMMB 1SE2A 4E74A 2KWDA 4G3XB 1VZ8A 4LNKA 4HDOA 4GLSC 1QKZA 3APFA 4FHJA 4TKNA 4UDUC 4EZJA 1IBXA 3BVGA 3RZFA 2CR5A 3MP9A 1H8CA 1QOGA 4MGYE 4R3DA 1R4MI 3V6CB 1JWAD 4TV3A 4KIKA 1LXDA 4IWOA 4B0MA 3A9KB 2NR2A 2LGSA 2B76B 3A9JB 3N32A 1QOFA 2A4ZA 3CSTA 4YTMB 4WH4A 1AARA 3ZJVA 1HA5A 1YN3A 3A9JA 3WCQA 5D6JB 3WAMA 1DOIA 2J0KA 4NPNA 3VTUA 4PYUA 4DXAB 1D4BA 1NBFC 4IOIE 3DBLI 2K5PA 2LWPA 3BZDB 4W9GA 3M62B 4FBJB 2PPHA 2REXA 4GIVA 4P1BC 2ON8A 4RGOS 4WWPA 4F1SA 1K52A 2PW9A 4XC2A 1XQQA 3R2TA 4US8A 1L6VA 3ZGZA 3QC8B 3AI5A 4BKSD 2KVZA 2G4DB 3A9KA 3P42A 1VRAB 3TEXA 3V6EB 1JALA 2MBHA 4US9A 2MRPA 3SEBA 4J3OD 1E7PB 2D11A 5IKCM 5D3IB 5EDSA 3PLUA 2FE8A 3EUB2 1MVKA 1SBBB 1Q10A 5BYRA 1A70A 2KNBA 1D3ZA 2INCC 1VR9A 3GE3C 4BKTA 3IT4B 1YJ1A 4NJ6A 3W1SA 1PGAA 1IP9A 1WX9A 5KHQA 1TZOA 2DWQA 3FKYA 1J7BA 4LJPB 3V60A 3VHTC 5GXGB 1LO5D 2BPSA 4AQ7A 3I63C 3IAS1 3RN9C 2FUHB 3C19A 2BS4B 4BZAA 4YXDB 1F2RI 2L32A 2XK5A 3GE8C 5HG2A 3ETRA 4PYZA 4YTNB 1WMHB 1AN8A 3M3JA 2ZCCA 2WDQB 4GDKA 2N9LA 2KXJA 2BW2A 2BKFA 2ZEQA 2IO3B 2HE7A 4WWOA 2I2YA 2KDEB 1K51A 2V1YA 1XCTL 1E7UA 2QSDA 3QARA 1KRHA 2WP9B 3HK0A 4FULA 3ZLZA 1E10A 1YQBA 2J7QB 1CJEA 3AULA 3ZTCA 2JRHA 1T3QA 2KFKB 5IN7A 4YTPB 3N9YC 4MH8A 3K9OB 2INDC 3Q8AA 3DQVA 2LUMA 4TSSA 1ESFA 4MGZE 1V8CA 2KJRA 1J0GA 2C5LC 4LCDE 4ZYNA 4DXGA 3RNCC 2JYEA 2AQ3B 3KYDD 1V80A 2CU3A 2PMVA 4JGHB 3Q8BA 4BFRA 4J6IA 3LB8C 1WRIA 1YN4A 2KJHB 1UNSA 2Z8LA 4TUUA 2JPHA 1V5TA 2LASA 2LGXA 2NCNA 5DPTA 4N59A 4P6VF 5HKHA 3X0WA 1WIAA 2IJ0A 1WR6E 1WFYA 1MFWA 3NZUA 4IM2A 1GNUA 4W9EA 2OJWA 1SIFA 1EF1A 2FAZA 1X1MA 3BYTB 1V6EA 1TT5B 2HDEA 3AE1B 1MI0A 1YD8U 4G50A 4S0RA 1WJ4A 3CWIA 2ZW1A 3P2BA 2Y5BB 1WJNA 1PGBA 5IO9A 4TQ0A 4MM3B 4P16A 3WA0A 1ENFA 4EFOA 1L2NA 2W54A 3AEAB 5FKAC 2AEHA 2VRRB 4F7ZA 1L4DB 1WH3A 3BIID 2RGFA 4IWQA 2IZVB 2DNFA 1FXAA 1F52A 4FA6A 1N61A 3ZNHB 5IA7A 3HVZA 2L0FA 4M02A 3B9JA 3EC8A 1VDVA 2DYOA 4W9IA 2CHWA 3VH4B 2BQQA 3L08A 3AB5A 2V3NA 3KLSX 2CS4A 5H8YE 2V3PA 5TR5A 3V62A 3FC4A 4NY0A 1OEYJ 2UWQA 2DX5B 4K7WA 4C56C 2D3GA 3J9CA 3VUXA 3M63B 1SGHA 1WF9A 1I35A 2NTSA 3AECB 3O13A 2KTFA 2LGYA 3ECIA 2ICIA 4ASWC 3APDA 3WAPA 1JRUA 1QQRA 5C3JB 3OJ3A 2WX1A 2RMMA 3MJWA 3TEYA 2EELA 2LHDA 3OLMD 3OWEB 3H6NA 4I6LB 2V3SA 4DHZE 3QX1A 3SFDB 2IGGA 4K81A 4GB9A 2K8CA 2IGDA 2L00B 3ZKJC 5T8IA 1NDDA 2XN9C 2DAJA 1T0QC 1AWDA 3NVVA 2MBQA 3QK0A 3RYTA 4A9AA 4GDLB 3SR6A 2KWCA 1ZOYB 4FLHA 3TSSA 3BWUD 3IFWB 1RRBA 4ICVA 2D5GA 3Q8CA 5AUKA 1MHHE 1WXMA 4ITKA 2FCQA 3KUZA 4CYEA 4LJOB 2L05A 4NAWA 3AE9B 2OHFA 2KVRA 4B0EA 3HM3A 1XXGA 2BF8B 3CIRB 2A5UA 1JWBD 4WAAA 3ZDMC 2BYEA 1WJ6A 2K9XA 1L5PA 1WWTA 2JF5A 2M0AA 2LI5A 1YJJA 3N3KB 1I4PA 1STEA 3D32A 2KYWA 1ZPSA 2NTTA 1PDXA 2WXMA 4KSKC 4MJSB 3EA6A 1J8CA 1YMHE 1V86A 3KWLA 4M8MA 4W9DA 4ANUA 3BVMA 1WM2A 3HM6X 4CHKA 3RZWC 3HIZA 3AU5A 2GBJA 1M4VA 2WGSA 2O6VD 3RMKC 2L83A 3ABVB 2NBVB 5JH5C 1YIWA 2HD5B 2MWSB 2OEDA 1VLBA 3Q3JA 3QIJA 3DVGX 4IUMB 2K39A 4GXBA 5BYQA 3VTWA 1L0YB 2J42A 2V4IB 2N9XA 4MDKE 4RGNA 3DDCB 3TJPA 1GUAB 1WRDB 3T9LA 5LNK1 5BMGA 1TIFA 2MCNB 2N9KA 3AE6B 1ET9A 2BVCA 1MHXA 2PVOD 3S2AA 1UWXA 4HLEA 2LFIA 2JYTA 2XEWA 2AQ1B 2PVGC 2WXNA 4DHJB 4AS1A 4AJYB 1IUEA 2ZCBA 4EZKA 2I1KA 1BMLC 1ROEA 5BYSA 2KKCA 3DPDA 2JZ3B 5BMHA 2OOBB 1JW9D 2IY1B 1KLGD 4A8XC 1T0SC 1V9JA 2FIDA 2ZNVC 1F1HA 3QAQA 2J52A 1KFYB 3N1XC 1TZ1A 4JLCA 2J0JA 1A5RA 4HPLB 5IP4D 1TKGA 3B2GA 2VZKD 3W1SC 1WX7A 3B08A 3L17A 4DDID 2KHWB 4JX1C 1CZPA 3NVZA 4HJGE 1T0RC 1C9FA 2QJLA 2CHXA 2FCSA 2Q5WD 1GC7A 4WURA 2RPVA 1G6JA 2JUOA 2JWUA 3ZW3A 1FEHA 3PGEA 2GRIA 2M8SA 3B0AA 2K0PA 1OFFA 3ZDTA 3ZO5B 2GB1A 1T6BX 2M17A 3R7QA 1UH6A 1UBIA 2HJ1A 3H9DA 4CO7A 2WXOA 1S3SG 1R4NI 2KN4A 1WYWB 1D6EC 2N7EA 3VTVA 4A6QA 1TGZB 2IO2B 1YOVB 1ZDXA 2R2OA 3W2DA 2V0GA 3DBHB 3AXCA 4ZRJA 5E6JA 4PS8A 2W82A 2ZVNA 4ZHOA 1OQQA 2RD0A 1TKYA 2FCMA 2KZRA 1SE9A 2INPE 4OVZA 2MH7A 3SFEB 1TS3A 4K7SA 2QMTA 3Q69A 3RNGC 2PIAA 4KGTA 4RFBA 1C4AA 2C7HA 1YX6B 2KOXA 3EHVA 3VFKA 3P63A 3UINB 4ICUA 2D2QA 5D94A 3SU8X 4YL8A 3Q3MC 3BY4B 3DOWA 2KMMA 2HTME 2UU7A 3WIMA 1F77A 4YWGG 4ANWA 4A55A 3AMZA 3EFCA 3Q14C 1BXTA 2CHZA 1V49A 1IPGA 1EU3A 3WALA 2C7NB 1GJZA 1RLFA 2QCZA 2WLBA 2E3TA 3AEDB 5LXIB 3T8MA 1XT9B 3PHXB 3KVFB 2NBWB 3UGBB 1N63A 5E6PA 2KFJA 4JE3B 3AE8B 3O65B 2H88B 1C79A 2WU5B 4BAXA 4N9F4 4HJKA 1V97A 4WJNA 3P4SB 4ZRIA 3Q3FA 3VR9B 4BOSC 1SEBD 5AZHA 3W9CB 3QHTA 5D7GA 2JX5A 2B3AA 2LGDA 3PHWB 2O2VA 1EWYC 4ACFA 3A4SC 3W1YA 2RDGA 5EE3A 1OGWA 3RT3B 1K50A 3AE5B 1WGRA 3NJTA 1ET6A 3DVGY 2CU1A 5D2MB 1SIJA 1UD7A 3L4PA 1UBQA 3NOBA 4HXDA 1MJDA 2KDBA 5EE1A 2LJ5A 2N7DA 2KT7A 4YSXB 2BBCA 2C7MB 3H7PA 4XWTA 3DHHC 3ONSA 5G5GA 4BBNF 1UELA 4N58A 4GDKB 3H7SA 1SE4A 3N20C 1F2RC 1I4QA 1FO4A 4OZCA 4WAFA 1WXSA 4IWPA 2N0SB 3Q3NC 3FILB 2PLPA 1QOAA 1XLQA 3KW5B 1SJED 1T5XD 4KX6B 4LK0M 1BT0A 2NS5A 3LYYA 3P4QB 2N9PC 2DYBA 2NVUI 2BB5A 3RNAC 3UIPB 5AZGA 1C4PA 1HEZE 4EEWA 3DHIC 2AX5A 1S1QB 2BB6A 3R8BA 1LQBA 2LRWA 4TMAB 4K3CA 1NI3A 4W9JA 4HCPB 2DAFA 4WJPA 3VAWA 5AZFA 3AE4B 4XWWA 1BUIC 4ARCA 1WMHA 3L10B 1L6UA 1R4NB 1EU4A 2YEPF 1WZ0A 2EKIA 2KTRB 3PSEB
chains in the Genus database with same CATH topology
3GE3C 3Q3OC 3Q14C 3RNCC 3N1YC 3N1ZC 3I5JC 4P1BC 1T0SC 1T0QC 3RNFC 2RDBC 3DHHC 1T0RC 4P1CC 3DHGC 3RI7C 2INDC 3RNAC 3N20C 3RNEC 3I63C 3Q3MC 3Q2AC 3RN9C 3RNBC 3N1XC 3DHIC 3RMKC 3RNGC 3GE8C 2INCC 3Q3NC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GE3 C;  3Q3O C;  3Q14 C;  3RNC C;  3N1Y C;  3N1Z C;  3I5J C;  4P1B C;  1T0S C;  1T0Q C;  3RNF C;  2RDB C;  3DHH C;  1T0R C;  4P1C C;  3DHG C;  3RI7 C;  2IND C;  3RNA C;  3N20 C;  3RNE C;  3I63 C;  3Q3M C;  3Q2A C;  3RN9 C;  3RNB C;  3N1X C;  3DHI C;  3RMK C;  3RNG C;  3GE8 C;  2INC C;  3Q3N C; 
#chains in the Genus database with same CATH topology
 4MH0 E;  4XDD A;  1WI0 A;  3IG3 A;  1TBE A;  2LVO A;  2OJR A;  1JRP A;  3IT6 B;  1WGK A;  2FNJ B;  1TY2 A;  3MHS D;  4KIK B;  1WR1 A;  2G45 B;  4LNN A;  4RGM A;  2WXI A;  1C1Y B;  4OVU A;  1JQ4 A;  1J7C A;  3HUI A;  4URK A;  1IBX B;  1VCB A;  2I38 A;  3P4R B;  1LGR A;  2R61 A;  4NNJ B;  3PO0 A;  1Z2M A;  3AN1 A;  4IKG A;  3I57 A;  1WGH A;  1D5X C;  2PEA A;  4PT5 A;  3ZUN A;  2JU6 X;  4RGT A;  2KLG A;  5I4D A;  1FRR A;  4XE0 A;  1R4M B;  2J0M A;  4W9L A;  2ZVO A;  1HQR D;  3ZNI D;  3EGR A;  1RM6 C;  3W5U B;  1V2Y A;  4S17 A;  3FIL A;  4RF1 A;  3UF8 A;  4M00 A;  5IAA C;  5JHB A;  3NG0 A;  3HVD A;  4XGA B;  5IOI A;  2KWU B;  4EKU A;  2INN E;  4B6W A;  5J2R A;  1NYQ A;  2YEP B;  2LUE A;  3NVY A;  1Q1O A;  2QEJ C;  3AE7 B;  4MEM A;  3R7R A;  4HPM B;  3OG5 A;  2LVQ A;  1GAQ B;  1VZ6 A;  2K8H A;  2JZP A;  1Y8R C;  3PV1 A;  1HE8 A;  4MGK E;  1FNV A;  3UIO B;  1F0Z A;  1QOB A;  4W9C A;  1PGX A;  2IYD B;  1IYF A;  1B1Z A;  2WWZ A;  2LMC A;  4KKI A;  1I7H A;  2WXP A;  4KDL B;  1D5M C;  1RWS A;  4C00 A;  1GB4 A;  4ANX A;  4Q2J A;  3NY5 A;  3AEB B;  3Q6B A;  1E5W A;  3A1Q B;  3MJ5 A;  4ARI A;  3VUY A;  3W5V B;  2BWF A;  2KJ6 A;  4D2K A;  3V05 A;  3NZ3 A;  4JIO U;  2GMI C;  2VH1 A;  5HI1 A;  4H2A A;  5DPR A;  2UYZ B;  1HZ5 A;  2IGH A;  2KMA A;  3NRZ A;  1KM7 A;  2MQJ A;  4KV2 A;  3PRZ A;  1NVI D;  5LLI A;  1FCL A;  4M01 A;  2D3B A;  1YNT E;  2G3Q B;  5J18 A;  2MJE A;  4LLG M;  2KO3 A;  1P9D U;  2KK8 A;  1WXQ A;  3U2S C;  4C7Z A;  4O1N A;  4OVV A;  2JRI B;  2O2V B;  4RF0 A;  3B2F A;  2PTL A;  1E8W A;  1H4R A;  2GOW A;  2YVC A;  1VJK A;  2K1F A;  4REZ A;  2BS2 B;  3GZN I;  2C60 A;  3DVN V;  4PS3 A;  2WYQ A;  1KLU D;  1MG4 A;  1UUP A;  4MAC A;  3CF6 E;  2M1M A;  1PFD A;  4MSQ B;  1F9J A;  3RPF C;  3BYY B;  4C7Y A;  5G2N A;  5CTR C;  3ZVV A;  4YSY B;  2RR9 A;  3Q3O C;  1FD6 A;  1YX5 B;  3IXS A;  3I5J C;  3WAN A;  1FIQ A;  4WWM A;  4LNI A;  1JWM D;  3QWZ B;  2MP2 A;  5E6N A;  1K8R B;  3L16 A;  5FK9 C;  2N4F A;  2NBU A;  4M8N A;  2PJH A;  3KWV A;  3C0R B;  4GN1 A;  4AUQ C;  3UQB A;  1I42 A;  1WXA A;  2ZPN A;  1L7Y A;  3ZYY X;  4YSZ B;  1UZX B;  2JQR B;  4XYC A;  2KQ7 A;  2MBE A;  3H1U A;  2WXF A;  3OAW A;  1WY8 A;  2IO1 B;  4WQM A;  3H8H A;  1Q0W B;  3MC0 B;  3U52 E;  4W9F A;  2MLB A;  1YN5 A;  1N60 A;  2Z59 B;  3BVZ A;  2KAC A;  1JML A;  4DBG A;  2KN5 A;  3V3X A;  4GSW A;  4LDT B;  2M56 B;  1MPE A;  3CSF A;  1HZ6 A;  4DQO C;  4P1C C;  3LXF A;  3GS2 A;  3DBR I;  4A20 A;  3ALB A;  2PKO A;  1DOX A;  2L3Z A;  4FAD A;  4MT5 A;  4K1R B;  4ZRQ A;  5L83 A;  1QLB B;  4GMV A;  1N5W A;  2C9W B;  2LZ6 A;  2DYM A;  2LRU A;  4GOC A;  1V1P A;  2GBN A;  3MC9 A;  2LHE A;  5CHW A;  1E8X A;  2MEK A;  2H89 B;  2KMC A;  1E9M A;  1TS2 A;  4GU2 A;  4II2 B;  3L0W B;  4LTU A;  4WJO A;  4RCO A;  4M0W B;  3PRM B;  1WJU A;  3PPA A;  4RMA A;  4IC7 B;  3MC8 A;  2WX0 A;  1RYJ A;  3LDZ E;  2M4N A;  3DHG C;  2AL3 A;  2ACZ B;  1IGC A;  1RFA A;  3KUD B;  4EZL A;  3C8Y A;  1OTR B;  1FFV A;  1SB3 C;  2JWZ A;  5FR6 A;  2E6X A;  3KYC D;  4ANV A;  1UF0 A;  3MFG A;  1XLP A;  1C3T A;  3HRD D;  1KLV A;  2I1J A;  1FFU A;  3NHE B;  1HTQ A;  2KTR A;  2SEB D;  3AH7 A;  1WGD A;  3DBL B;  3PZ7 A;  2BS3 B;  3NS1 A;  3UI3 A;  3PZ8 A;  1TS4 A;  1C76 A;  3U30 A;  2VH2 A;  2MW5 A;  4KZC A;  5KHO A;  2N9E B;  3EEC A;  3TEZ A;  4M0W A;  3RNB C;  2KC2 A;  5J17 A;  1WX8 A;  2FIF A;  4EOY A;  1XLO A;  1CK1 A;  4HPP A;  1GG3 A;  4PS7 A;  3AE3 B;  2K25 A;  3AEE B;  4RM8 A;  3ZRC A;  4NZL B;  2WXG A;  2X8X X;  2G1E A;  3TEW A;  1PYW D;  2EMS A;  1YJI A;  4ZDV A;  4HEA 1;  5TSS A;  3QA8 A;  3PS6 A;  1L0V B;  1C77 A;  3WAO A;  3A1Q A;  3TUO A;  5AUI A;  1SXT A;  2X38 A;  3HHM A;  4HK2 A;  4NQK E;  3PVL A;  1ZUD 2;  3LJ3 A;  4C80 A;  3QCA A;  1SF0 A;  5D3D A;  2KX0 A;  3UQA A;  3RCZ A;  4KGS A;  1JWU D;  3T3O A;  1P7E A;  1QZE A;  2JVC A;  1E6E B;  4ZRP A;  3ZJT A;  1EF5 A;  1SE3 A;  1V1O A;  1FNW A;  1XEE A;  5HFY A;  4DHJ D;  2MBB B;  1ISN A;  2KC1 A;  1ZKH A;  4A90 A;  2ZJD A;  3VRA B;  1ZDV A;  2M19 A;  3DCG A;  1T0Y A;  2LEK A;  2GLS A;  3NS8 A;  1WGG A;  2DHZ A;  2BYV E;  3PRE A;  1LM8 B;  1CMX B;  2MSE D;  1XF5 L;  5CX3 A;  1WXV A;  1P1A A;  3M95 A;  2WXL A;  4IDI A;  5HHD G;  2FUG 1;  4L1B A;  3VRB B;  2Z0E B;  5DPS A;  3N30 A;  3U7Z A;  2JZZ A;  2Y5P A;  2KQS A;  2L1A A;  3VR8 B;  2XBB C;  4DK5 A;  1DYQ A;  3APC A;  1XD3 B;  2WXR A;  2XNA C;  2DZK A;  3TIX A;  3TMP B;  1WGY A;  1OEY A;  3RNE C;  3SD5 A;  4KZ0 A;  4II3 B;  1NI2 A;  1DGJ A;  3BK1 A;  3L13 A;  5LXH A;  3ML8 A;  1OQR A;  1EWC A;  1FMA D;  3A33 B;  2FCN A;  3E56 A;  2K8B A;  2G4S A;  2O6V A;  1DOY A;  2PE9 A;  4MEL A;  1E7V A;  2W55 A;  2NPT B;  1P7F A;  4B95 A;  3Q8F A;  4QAY A;  3BIN A;  2JY6 A;  1WE7 A;  2VZK B;  2K22 A;  2J53 A;  4F8C B;  2KWV B;  3N1Z C;  2JT4 B;  1PQS A;  4K3B A;  3QJZ A;  2D07 B;  1WYG A;  1E8Y A;  1FPY A;  1TJE A;  2BT6 A;  3ZTD A;  5DCN A;  2D3C A;  2IBI B;  3DBH I;  1C78 A;  1KF6 B;  4XDC A;  2XK5 B;  2PE6 B;  4C4V B;  2J4X A;  1D5Z C;  4W9K A;  3U4E G;  4EUT A;  2KDI A;  3I9V 1;  3BK2 A;  3PLV A;  3ZIM A;  1KH0 A;  1FRD A;  3H7P B;  2KLC A;  5H92 C;  3T3N A;  3VVW B;  3KQ4 A;  1I4R A;  2DZJ A;  3DWG C;  3IVF A;  4I6N B;  1C4C A;  5JZE B;  1KOT A;  1QF6 A;  4LNF A;  4FXC A;  2MA9 B;  1ZE3 D;  4LDT D;  1FXT B;  1ACC A;  1EUV B;  3L54 A;  3ZJU A;  5BO4 B;  4XZ4 A;  3P1M A;  2BKR B;  4MSM B;  2ZPY A;  1TS5 A;  2LXC A;  3JSV B;  2IY0 B;  3JVZ X;  1WZ3 A;  1K53 A;  1RAX A;  1P98 A;  1VD2 A;  4IW0 A;  2W3S A;  3VUW A;  2LXA A;  1FCC C;  1AW7 A;  2ZW0 A;  2N1V A;  2DZI A;  4HRS A;  2IPK D;  2N7J A;  3OJ4 B;  4PK1 A;  3DBS A;  4NAM A;  4A3O A;  4L2Y A;  4ZHP A;  2RPQ A;  2ZNV B;  3ZQ4 A;  4DDG D;  4WWN A;  3RD2 A;  2IO0 B;  2WU2 B;  3GOE A;  2DLB A;  2L76 A;  2DZM A;  2KX3 A;  2MP2 B;  2JSV X;  2N1W A;  2EKE C;  4HCN B;  5AEK B;  2WS3 B;  3A4R A;  1E8Z A;  3Q2A C;  2KQ4 X;  4MM3 A;  4OZB A;  1KJT A;  4OHJ A;  4G0N B;  3AE2 B;  2WXJ A;  2MHJ A;  3NZS A;  2WDT B;  3IHP C;  1U4A A;  3ML9 A;  4WQO B;  1YQ4 B;  4BVU C;  4E71 A;  1GOZ A;  2WHI A;  4FN2 A;  3PZD A;  4WIP A;  2R2Q A;  2KDM A;  5C1Z A;  4AOF A;  3PTF C;  1FNU A;  1Z5S B;  3NUH B;  5L95 C;  2LGI A;  2D3A A;  3JYU A;  3QQ8 B;  5G5H A;  2LVP A;  1L0X B;  4XX5 A;  1HTO A;  5C23 A;  2AQ2 B;  2BTE A;  3NVW A;  4BBN C;  3R2I A;  3EFU A;  3DWM A;  2BYF A;  1JCK B;  3TBL D;  1UGM A;  1ZXH A;  3ZNG C;  2KFK A;  2MBO A;  4HRO A;  3U7D A;  4WJQ A;  4RH6 A;  2WXH A;  1JRO A;  3GZN B;  3JW0 X;  1ZXI A;  2GBM A;  1V5O A;  1I4X A;  3ZRF A;  2K6D B;  2KD0 A;  2RDB C;  3RFZ B;  1KTK A;  1TYG B;  4BKS A;  4FJZ A;  3URY A;  2AL6 A;  5DPW A;  3KH0 A;  5JXV A;  4KGR A;  1E90 A;  3VH3 B;  1TTN A;  2V4L A;  2JXX A;  1CQV A;  4K7U A;  5G55 A;  3K9P B;  4TQ1 A;  2L0T A;  2AWT A;  4NAW B;  1N6Z A;  2L8J A;  1TY0 A;  5CHF A;  2BYT A;  2L52 A;  2O6V B;  1NYR A;  4A3P A;  3ZXR A;  2HTH A;  1LFD A;  3VXW A;  4JWS C;  2IDY A;  4KSL C;  1J19 A;  1P3Q U;  2QIE B;  3SDL C;  2WDR B;  4ZOH C;  5GMV A;  1OQY A;  3ENE A;  1J7A A;  1N5X A;  1JWS D;  2BGF A;  3ZXV A;  1WE6 A;  2D10 A;  2W3R A;  1WSP A;  1ZP0 B;  3SHQ A;  1SSN A;  1HXY D;  4OW0 A;  3TL5 A;  4B9K A;  4RNA A;  2Y3A A;  2QIL A;  2QC8 A;  2MJD A;  3DBR B;  3E9S A;  1IGD A;  3AM9 A;  1Q5W B;  3RUI B;  2CKH B;  4L23 A;  4N6E B;  4NJC A;  1TKE A;  2KDF B;  1E0Z A;  1XLN A;  3TCA A;  2SAK A;  4G11 A;  3RNF C;  3R3M A;  1QT9 A;  2NMQ A;  2YLM A;  4I6P A;  2L7R A;  1B9R A;  1L4Z B;  1GC6 A;  2WXK A;  3R66 C;  1UGJ A;  1XCQ L;  3PRP B;  3GB1 A;  4ZRK A;  1I4G A;  4ZYS A;  2DBY A;  2QDF A;  2GBK A;  2LD9 A;  4X57 B;  4YT0 B;  2MJ3 A;  4MJS A;  4BOZ B;  1UWM A;  2ZZP B;  1PUT A;  3JSV A;  4EE2 A;  2RSU A;  1EO6 A;  3V61 A;  2KAJ A;  2ASQ A;  1RFK A;  3MTN B;  4OZA A;  1P0R A;  5C2T B;  4JL9 A;  4AJW A;  2V9H A;  1SJH D;  4AP4 C;  3FAH A;  1AYF A;  4GGQ A;  3X23 A;  4RM9 A;  2WNM A;  4BKG A;  2JXT A;  3N1Y C;  3AU4 A;  4JPS A;  4W9H A;  2RDH A;  4NJ7 A;  2WDV B;  1V1P B;  1GB1 A;  3VQI A;  4HKQ A;  3Q8E A;  4HVB A;  3IBE A;  4FJY A;  3RI7 C;  4DHZ B;  4NQL B;  4HKZ E;  5EE9 A;  3VDZ A;  3IAM 1;  2FBW B;  2W9N A;  2MX2 A;  2HJ8 A;  3MHZ A;  4DWF A;  4GDL A;  2GI9 A;  2K6Q A;  5CHV C;  1VZ7 A;  5E6O A;  4FHK A;  3ZNZ B;  5FR3 A;  4JQW C;  3KUC B;  2ONQ A;  2M0X A;  2WXQ A;  1XO3 A;  4P7I A;  2K3U A;  1Y56 A;  1MG8 A;  1M94 A;  4IM0 A;  3RUL A;  2BWE S;  1V81 A;  2NPT A;  2AYO B;  3P4P B;  4C4V A;  1QIL A;  2QHO A;  2Z0D B;  4E3C A;  2TSS A;  5EE0 A;  3DVN U;  3U8Z A;  3AEF B;  4KDI C;  2EMT A;  1WM3 A;  4USA A;  1ZGU B;  1NEN B;  1YQ3 B;  4KVG B;  4DXF A;  4CQN A;  1EM7 A;  3I3T B;  1FM0 D;  5MPO A;  2Y5C A;  4AWJ A;  3GP7 A;  1ZW7 A;  4KKJ A;  2CJN A;  2LJI A;  1I4H A;  3PT2 B;  2G9H D;  4JWU C;  2CJO A;  5BMI A;  1R7S A;  1NEK B;  2DEN B;  3AEG B;  3AV8 A;  4FJV B;  2GBR A;  1GPX A;  3B1L X;  2WQY B;  4IM3 A;  1N62 A;  4HDQ A;  4HWI B;  5JHA A;  4IG7 B;  4LNO A;  2KAN A;  1FXI A;  4MGI E;  3CMM B;  1SE2 A;  4E74 A;  2KWD A;  4G3X B;  1VZ8 A;  4LNK A;  4HDO A;  4GLS C;  1QKZ A;  3APF A;  4FHJ A;  4TKN A;  4UDU C;  4EZJ A;  1IBX A;  3BVG A;  3RZF A;  2CR5 A;  3MP9 A;  1H8C A;  1QOG A;  4MGY E;  4R3D A;  1R4M I;  3V6C B;  1JWA D;  4TV3 A;  4KIK A;  1LXD A;  4IWO A;  4B0M A;  3A9K B;  2NR2 A;  2LGS A;  2B76 B;  3A9J B;  3N32 A;  1QOF A;  2A4Z A;  3CST A;  4YTM B;  4WH4 A;  1AAR A;  3ZJV A;  1HA5 A;  1YN3 A;  3A9J A;  3WCQ A;  5D6J B;  3WAM A;  1DOI A;  2J0K A;  4NPN A;  3VTU A;  4PYU A;  4DXA B;  1D4B A;  1NBF C;  4IOI E;  3DBL I;  2K5P A;  2LWP A;  3BZD B;  4W9G A;  3M62 B;  4FBJ B;  2PPH A;  2REX A;  4GIV A;  4P1B C;  2ON8 A;  4RGO S;  4WWP A;  4F1S A;  1K52 A;  2PW9 A;  4XC2 A;  1XQQ A;  3R2T A;  4US8 A;  1L6V A;  3ZGZ A;  3QC8 B;  3AI5 A;  4BKS D;  2KVZ A;  2G4D B;  3A9K A;  3P42 A;  1VRA B;  3TEX A;  3V6E B;  1JAL A;  2MBH A;  4US9 A;  2MRP A;  3SEB A;  4J3O D;  1E7P B;  2D11 A;  5IKC M;  5D3I B;  5EDS A;  3PLU A;  2FE8 A;  3EUB 2;  1MVK A;  1SBB B;  1Q10 A;  5BYR A;  1A70 A;  2KNB A;  1D3Z A;  2INC C;  1VR9 A;  3GE3 C;  4BKT A;  3IT4 B;  1YJ1 A;  4NJ6 A;  3W1S A;  1PGA A;  1IP9 A;  1WX9 A;  5KHQ A;  1TZO A;  2DWQ A;  3FKY A;  1J7B A;  4LJP B;  3V60 A;  3VHT C;  5GXG B;  1LO5 D;  2BPS A;  4AQ7 A;  3I63 C;  3IAS 1;  3RN9 C;  2FUH B;  3C19 A;  2BS4 B;  4BZA A;  4YXD B;  1F2R I;  2L32 A;  2XK5 A;  3GE8 C;  5HG2 A;  3ETR A;  4PYZ A;  4YTN B;  1WMH B;  1AN8 A;  3M3J A;  2ZCC A;  2WDQ B;  4GDK A;  2N9L A;  2KXJ A;  2BW2 A;  2BKF A;  2ZEQ A;  2IO3 B;  2HE7 A;  4WWO A;  2I2Y A;  2KDE B;  1K51 A;  2V1Y A;  1XCT L;  1E7U A;  2QSD A;  3QAR A;  1KRH A;  2WP9 B;  3HK0 A;  4FUL A;  3ZLZ A;  1E10 A;  1YQB A;  2J7Q B;  1CJE A;  3AUL A;  3ZTC A;  2JRH A;  1T3Q A;  2KFK B;  5IN7 A;  4YTP B;  3N9Y C;  4MH8 A;  3K9O B;  2IND C;  3Q8A A;  3DQV A;  2LUM A;  4TSS A;  1ESF A;  4MGZ E;  1V8C A;  2KJR A;  1J0G A;  2C5L C;  4LCD E;  4ZYN A;  4DXG A;  3RNC C;  2JYE A;  2AQ3 B;  3KYD D;  1V80 A;  2CU3 A;  2PMV A;  4JGH B;  3Q8B A;  4BFR A;  4J6I A;  3LB8 C;  1WRI A;  1YN4 A;  2KJH B;  1UNS A;  2Z8L A;  4TUU A;  2JPH A;  1V5T A;  2LAS A;  2LGX A;  2NCN A;  5DPT A;  4N59 A;  4P6V F;  5HKH A;  3X0W A;  1WIA A;  2IJ0 A;  1WR6 E;  1WFY A;  1MFW A;  3NZU A;  4IM2 A;  1GNU A;  4W9E A;  2OJW A;  1SIF A;  1EF1 A;  2FAZ A;  1X1M A;  3BYT B;  1V6E A;  1TT5 B;  2HDE A;  3AE1 B;  1MI0 A;  1YD8 U;  4G50 A;  4S0R A;  1WJ4 A;  3CWI A;  2ZW1 A;  3P2B A;  2Y5B B;  1WJN A;  1PGB A;  5IO9 A;  4TQ0 A;  4MM3 B;  4P16 A;  3WA0 A;  1ENF A;  4EFO A;  1L2N A;  2W54 A;  3AEA B;  5FKA C;  2AEH A;  2VRR B;  4F7Z A;  1L4D B;  1WH3 A;  3BII D;  2RGF A;  4IWQ A;  2IZV B;  2DNF A;  1FXA A;  1F52 A;  4FA6 A;  1N61 A;  3ZNH B;  5IA7 A;  3HVZ A;  2L0F A;  4M02 A;  3B9J A;  3EC8 A;  1VDV A;  2DYO A;  4W9I A;  2CHW A;  3VH4 B;  2BQQ A;  3L08 A;  3AB5 A;  2V3N A;  3KLS X;  2CS4 A;  5H8Y E;  2V3P A;  5TR5 A;  3V62 A;  3FC4 A;  4NY0 A;  1OEY J;  2UWQ A;  2DX5 B;  4K7W A;  4C56 C;  2D3G A;  3J9C A;  3VUX A;  3M63 B;  1SGH A;  1WF9 A;  1I35 A;  2NTS A;  3AEC B;  3O13 A;  2KTF A;  2LGY A;  3ECI A;  2ICI A;  4ASW C;  3APD A;  3WAP A;  1JRU A;  1QQR A;  5C3J B;  3OJ3 A;  2WX1 A;  2RMM A;  3MJW A;  3TEY A;  2EEL A;  2LHD A;  3OLM D;  3OWE B;  3H6N A;  4I6L B;  2V3S A;  4DHZ E;  3QX1 A;  3SFD B;  2IGG A;  4K81 A;  4GB9 A;  2K8C A;  2IGD A;  2L00 B;  3ZKJ C;  5T8I A;  1NDD A;  2XN9 C;  2DAJ A;  1T0Q C;  1AWD A;  3NVV A;  2MBQ A;  3QK0 A;  3RYT A;  4A9A A;  4GDL B;  3SR6 A;  2KWC A;  1ZOY B;  4FLH A;  3TSS A;  3BWU D;  3IFW B;  1RRB A;  4ICV A;  2D5G A;  3Q8C A;  5AUK A;  1MHH E;  1WXM A;  4ITK A;  2FCQ A;  3KUZ A;  4CYE A;  4LJO B;  2L05 A;  4NAW A;  3AE9 B;  2OHF A;  2KVR A;  4B0E A;  3HM3 A;  1XXG A;  2BF8 B;  3CIR B;  2A5U A;  1JWB D;  4WAA A;  3ZDM C;  2BYE A;  1WJ6 A;  2K9X A;  1L5P A;  1WWT A;  2JF5 A;  2M0A A;  2LI5 A;  1YJJ A;  3N3K B;  1I4P A;  1STE A;  3D32 A;  2KYW A;  1ZPS A;  2NTT A;  1PDX A;  2WXM A;  4KSK C;  4MJS B;  3EA6 A;  1J8C A;  1YMH E;  1V86 A;  3KWL A;  4M8M A;  4W9D A;  4ANU A;  3BVM A;  1WM2 A;  3HM6 X;  4CHK A;  3RZW C;  3HIZ A;  3AU5 A;  2GBJ A;  1M4V A;  2WGS A;  2O6V D;  3RMK C;  2L83 A;  3ABV B;  2NBV B;  5JH5 C;  1YIW A;  2HD5 B;  2MWS B;  2OED A;  1VLB A;  3Q3J A;  3QIJ A;  3DVG X;  4IUM B;  2K39 A;  4GXB A;  5BYQ A;  3VTW A;  1L0Y B;  2J42 A;  2V4I B;  2N9X A;  4MDK E;  4RGN A;  3DDC B;  3TJP A;  1GUA B;  1WRD B;  3T9L A;  5LNK 1;  5BMG A;  1TIF A;  2MCN B;  2N9K A;  3AE6 B;  1ET9 A;  2BVC A;  1MHX A;  2PVO D;  3S2A A;  1UWX A;  4HLE A;  2LFI A;  2JYT A;  2XEW A;  2AQ1 B;  2PVG C;  2WXN A;  4DHJ B;  4AS1 A;  4AJY B;  1IUE A;  2ZCB A;  4EZK A;  2I1K A;  1BML C;  1ROE A;  5BYS A;  2KKC A;  3DPD A;  2JZ3 B;  5BMH A;  2OOB B;  1JW9 D;  2IY1 B;  1KLG D;  4A8X C;  1T0S C;  1V9J A;  2FID A;  2ZNV C;  1F1H A;  3QAQ A;  2J52 A;  1KFY B;  3N1X C;  1TZ1 A;  4JLC A;  2J0J A;  1A5R A;  4HPL B;  5IP4 D;  1TKG A;  3B2G A;  2VZK D;  3W1S C;  1WX7 A;  3B08 A;  3L17 A;  4DDI D;  2KHW B;  4JX1 C;  1CZP A;  3NVZ A;  4HJG E;  1T0R C;  1C9F A;  2QJL A;  2CHX A;  2FCS A;  2Q5W D;  1GC7 A;  4WUR A;  2RPV A;  1G6J A;  2JUO A;  2JWU A;  3ZW3 A;  1FEH A;  3PGE A;  2GRI A;  2M8S A;  3B0A A;  2K0P A;  1OFF A;  3ZDT A;  3ZO5 B;  2GB1 A;  1T6B X;  2M17 A;  3R7Q A;  1UH6 A;  1UBI A;  2HJ1 A;  3H9D A;  4CO7 A;  2WXO A;  1S3S G;  1R4N I;  2KN4 A;  1WYW B;  1D6E C;  2N7E A;  3VTV A;  4A6Q A;  1TGZ B;  2IO2 B;  1YOV B;  1ZDX A;  2R2O A;  3W2D A;  2V0G A;  3DBH B;  3AXC A;  4ZRJ A;  5E6J A;  4PS8 A;  2W82 A;  2ZVN A;  4ZHO A;  1OQQ A;  2RD0 A;  1TKY A;  2FCM A;  2KZR A;  1SE9 A;  2INP E;  4OVZ A;  2MH7 A;  3SFE B;  1TS3 A;  4K7S A;  2QMT A;  3Q69 A;  3RNG C;  2PIA A;  4KGT A;  4RFB A;  1C4A A;  2C7H A;  1YX6 B;  2KOX A;  3EHV A;  3VFK A;  3P63 A;  3UIN B;  4ICU A;  2D2Q A;  5D94 A;  3SU8 X;  4YL8 A;  3Q3M C;  3BY4 B;  3DOW A;  2KMM A;  2HTM E;  2UU7 A;  3WIM A;  1F77 A;  4YWG G;  4ANW A;  4A55 A;  3AMZ A;  3EFC A;  3Q14 C;  1BXT A;  2CHZ A;  1V49 A;  1IPG A;  1EU3 A;  3WAL A;  2C7N B;  1GJZ A;  1RLF A;  2QCZ A;  2WLB A;  2E3T A;  3AED B;  5LXI B;  3T8M A;  1XT9 B;  3PHX B;  3KVF B;  2NBW B;  3UGB B;  1N63 A;  5E6P A;  2KFJ A;  4JE3 B;  3AE8 B;  3O65 B;  2H88 B;  1C79 A;  2WU5 B;  4BAX A;  4N9F 4;  4HJK A;  1V97 A;  4WJN A;  3P4S B;  4ZRI A;  3Q3F A;  3VR9 B;  4BOS C;  1SEB D;  5AZH A;  3W9C B;  3QHT A;  5D7G A;  2JX5 A;  2B3A A;  2LGD A;  3PHW B;  2O2V A;  1EWY C;  4ACF A;  3A4S C;  3W1Y A;  2RDG A;  5EE3 A;  1OGW A;  3RT3 B;  1K50 A;  3AE5 B;  1WGR A;  3NJT A;  1ET6 A;  3DVG Y;  2CU1 A;  5D2M B;  1SIJ A;  1UD7 A;  3L4P A;  1UBQ A;  3NOB A;  4HXD A;  1MJD A;  2KDB A;  5EE1 A;  2LJ5 A;  2N7D A;  2KT7 A;  4YSX B;  2BBC A;  2C7M B;  3H7P A;  4XWT A;  3DHH C;  3ONS A;  5G5G A;  4BBN F;  1UEL A;  4N58 A;  4GDK B;  3H7S A;  1SE4 A;  3N20 C;  1F2R C;  1I4Q A;  1FO4 A;  4OZC A;  4WAF A;  1WXS A;  4IWP A;  2N0S B;  3Q3N C;  3FIL B;  2PLP A;  1QOA A;  1XLQ A;  3KW5 B;  1SJE D;  1T5X D;  4KX6 B;  4LK0 M;  1BT0 A;  2NS5 A;  3LYY A;  3P4Q B;  2N9P C;  2DYB A;  2NVU I;  2BB5 A;  3RNA C;  3UIP B;  5AZG A;  1C4P A;  1HEZ E;  4EEW A;  3DHI C;  2AX5 A;  1S1Q B;  2BB6 A;  3R8B A;  1LQB A;  2LRW A;  4TMA B;  4K3C A;  1NI3 A;  4W9J A;  4HCP B;  2DAF A;  4WJP A;  3VAW A;  5AZF A;  3AE4 B;  4XWW A;  1BUI C;  4ARC A;  1WMH A;  3L10 B;  1L6U A;  1R4N B;  1EU4 A;  2YEP F;  1WZ0 A;  2EKI A;  2KTR B;  3PSE B; 
#chains in the Genus database with same CATH homology
 3GE3 C;  3Q3O C;  3Q14 C;  3RNC C;  3N1Y C;  3N1Z C;  3I5J C;  4P1B C;  1T0S C;  1T0Q C;  3RNF C;  2RDB C;  3DHH C;  1T0R C;  4P1C C;  3DHG C;  3RI7 C;  2IND C;  3RNA C;  3N20 C;  3RNE C;  3I63 C;  3Q3M C;  3Q2A C;  3RN9 C;  3RNB C;  3N1X C;  3DHI C;  3RMK C;  3RNG C;  3GE8 C;  2INC C;  3Q3N C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...