3I5JC

Diferric resting state toluene 4-monooxygenase hd complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
82
structure length
82
Chain Sequence
SAFPVHAAFEKDFLVQLVVVDLNDSMDQVAEKVAYHCVNRRVAPREGVMRVRKHRSTELFPRDMTIAESGLNPTEVIDVVFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toluene-4-monooxygenase system protein A
publication title Crystallographic and catalytic studies of the peroxide-shunt reaction in a diiron hydroxylase.
pubmed doi rcsb
source organism Pseudomonas mendocina
molecule tags Oxidoreductase
total genus 24
structure length 82
sequence length 82
ec nomenclature ec 1.14.13.236: Toluene 4-monooxygenase.
pdb deposition date 2009-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 3i5jC00
4P1CC 3Q3NC 3RN9C 3N1XC 3RNAC 3RNFC 1T0SC 3Q2AC 3GE8C 3RNCC 3N1ZC 3Q3OC 3RI7C 2INDC 3Q3MC 3DHHC 3RNBC 3DHIC 2RDBC 3N20C 3N1YC 3RMKC 3RNEC 3DHGC 1T0QC 3I5JC 3Q14C 3GE3C 1T0RC 2INCC 3RNGC 4P1BC 3I63C
chains in the Genus database with same CATH superfamily
2KTFA 1HXYD 4MGYE 3V62A 3VUWA 3VH4B 5MPOA 1WGRA 3Q3OC 4JL9A 5EE3A 5H8YE 4MDKE 2GLSA 3AM9A 1BXTA 1CJEA 1AW7A 3W5UB 4I6NB 1IPGA 3N1YC 1V80A 5D94A 2IY1B 4KZ0A 1L0YB 1ZXIA 3SEBA 3P4PB 3Q2AC 2KTRA 4F8CB 2ZCBA 1P0RA 2KWUB 3RYTA 1YJJA 1XLQA 2KMCA 1P7FA 1UNSA 5IO9A 3KWLA 3KWVA 2LZ6A 1TJEA 2Q5WD 5BO4B 1UWMA 3FILA 4WAFA 3VR8B 4URKA 4MJSB 3HVZA 3ZXRA 2IPKD 2ZPYA 1AWDA 1D5ZC 2KACA 1IBXA 3PVLA 3ZNGC 4M01A 1L7YA 3VXWA 5GMVA 3KVFB 1XD3B 1KRHA 4KIKB 1NYQA 2GBKA 3UQBA 2KLCA 3RI7C 2WXFA 2QJLA 3DBRI 5IOIA 2J52A 4MGZE 4YXDB 2FCNA 2IGGA 3PREA 2IO3B 1C4PA 2N0SB 1GPXA 3KLSX 5AEKB 2I1KA 3ZW3A 4HCNB 3QIJA 3MP9A 1FCLA 2H89B 2GI9A 4HRSA 1CQVA 2HDEA 3NVYA 1LGRA 3EGRA 4HKZE 5LLIA 3DDCB 1KFYB 2RDBC 3AE3B 2ZCCA 3VVWB 3DBSA 3TEYA 2C7NB 2JSVX 1HTOA 1WX9A 2KHWB 1MG4A 3QA8A 1QOAA 2SAKA 3RNFC 3B0AA 3GZNI 4WIPA 1JWSD 2N4FA 2WXIA 1J7CA 2V3SA 1HEZE 1WE6A 3HM3A 4USAA 5L95C 4RM8A 5BMGA 4GIVA 2WYQA 5JXVA 3NVZA 3KW5B 2RDHA 1L4DB 3HRDD 3UIPB 1L6UA 3R2TA 2KDMA 4Q2JA 5E6NA 2I1JA 5IN7A 2J0MA 4K1RB 1TIFA 2RGFA 2DYMA 3VUYA 1FMAD 2FIFA 3V61A 4JQWC 3NZUA 3TJPA 4ASWC 4C4VB 1F52A 2DYOA 2BQQA 1D5XC 4GSWA 2MP2B 2IZVB 3RNBC 4DHJB 1TYGB 2JRIB 3C0RB 1TT5B 2JWUA 3HHMA 3QC8B 2KAJA 2QMTA 1K8RB 3PHWB 3Q3NC 4HKQA 3MC0B 3Q6BA 1I4QA 4E74A 3WAMA 1KTKA 4O1NA 5D7GA 2QHOA 2W54A 3KUCB 2ZW0A 3CIRB 3KYDD 4GDKB 3JSVA 1YJ1A 1E7PB 2D3CA 4IM0A 5I4DA 3VRAB 3LXFA 1GJZA 3AECB 3APDA 3CSFA 4GOCA 3NJTA 4BKSD 2KQ4X 1V9JA 2HJ1A 2BF8B 3EUB2 2JZZA 3WA0A 1Q0WB 4BKTA 1G6JA 3VQIA 3U30A 3DPDA 1QILA 1F2RC 2NBUA 2IBIB 1XLNA 4L2YA 1FFUA 3H9DA 1TZOA 3TCAA 2BBCA 2GBJA 3WCQA 3TEZA 2Y3AA 1Z5SB 1SF0A 4PS3A 2ZNVB 4IUMB 1YD8U 3B2FA 1TKGA 4LNIA 2DHZA 4NJ7A 3MHZA 3UI3A 3Q8EA 2JXXA 1I7HA 1YMHE 3ML9A 5AZHA 1J0GA 3OWEB 2D3AA 4KV2A 2AX5A 2QCZA 4KVGB 3PLVA 2FAZA 1UF0A 3LJ3A 1QOGA 1FD6A 5G5HA 3OAWA 3Q8CA 4B0MA 2ZW1A 2DZJA 5EE0A 2PTLA 4ZYSA 4P7IA 2BYEA 3FC4A 1LQBA 3AEDB 3BWUD 1WXVA 5LXHA 1EM7A 1YNTE 3IT4B 2E3TA 5BMIA 3QAQA 1QT9A 1OFFA 2IO2B 4XGAB 2M0AA 3N32A 4OVVA 1JWBD 2UYZB 4YSYB 3W1SA 2WP9B 1MVKA 2KFKA 2KX0A 1XCTL 1SE4A 4NPNA 4DXAB 5HFYA 3PRZA 1OQRA 2CJOA 3PZDA 2LHEA 4HPPA 1B1ZA 3PZ8A 2JX5A 2IY0B 1WY8A 3A9JB 3P1MA 3JVZX 2K6DB 2R2OA 2PW9A 4W9FA 2L0FA 2MBBB 3L16A 3MFGA 1L0VB 5CX3A 4MT5A 2NPTB 2L1AA 3APFA 2B3AA 2EKIA 2BT6A 5J17A 2Z0EB 4W9GA 2NS5A 4W9HA 2BYVE 2JY6A 2CHWA 2G45B 1S1QB 2D5GA 2K1FA 1JWMD 3VAWA 2W55A 1JWUD 3BK1A 4BOSC 1H4RA 3V6CB 2MBQA 2D11A 3EFCA 1YQ3B 1FRRA 4M02A 4JLCA 5CTRC 4DQOC 3H7PA 1TGZB 2JT4B 1R4MB 4BFRA 2RD0A 3BVMA 4ANVA 4ZRJA 2M1MA 2I2YA 3K9OB 3I3TB 4P6VF 3TMPB 5AUKA 1FRDA 3SD5A 2JYEA 2MWSB 4ZRPA 1ZP0B 1V97A 1MFWA 1WJ4A 1K53A 2XK5B 1IUEA 3AH7A 3NG0A 5J18A 4LJPB 1WGKA 2W82A 3T9LA 1GOZA 4W9KA 1N5XA 3AMZA 3RZWC 1XF5L 2DX5B 1PGAA 3A9KA 2PVOD 4WWPA 2AEHA 2ZNVC 4KX6B 4C7ZA 1V86A 1YIWA 2KJRA 4FXCA 3DVNU 1D4BA 2L3ZA 1JRPA 1QOBA 1ZW7A 2FE8A 2K8HA 1ZDXA 2WU2B 2M4NA 2DAFA 3AE9B 2ICIA 2IGHA 3RZFA 4TQ0A 4I6PA 2YLMA 3N1XC 5AZFA 4FJZA 1QF6A 3A1QA 4P16A 1E10A 1D6EC 1C9FA 1C77A 3ONSA 4IW0A 1P3QU 1WGYA 2ZVOA 3FAHA 1WH3A 2Y5CA 3L0WB 2LD9A 4BAXA 4CO7A 1E8WA 2WX1A 2FUG1 3U52E 1YQBA 2WDVB 2ON8A 3ZXVA 3QHTA 4CYEA 2V4LA 4AJWA 2WWZA 3BK2A 2MBOA 2PJHA 2OJRA 2M56B 3AV8A 3U8ZA 4AS1A 4GN1A 4C00A 1V81A 3N30A 3BIID 2KO3A 1I4GA 3VR9B 3P4SB 4DDGD 2KN5A 4HK2A 3MHSD 4RGOS 2YEPB 2WQYB 4RGNA 2MW5A 1CZPA 5JHBA 2CU1A 5LNK1 5JZEB 1VDVA 3B08A 2CJNA 4WWOA 1EWYC 1DGJA 4EOYA 1AN8A 1L0XB 4WQMA 1V1OA 4YTPB 2HJ8A 1NVID 2IO0B 3P63A 2J53A 3SHQA 1WM2A 4LNFA 1NI3A 2N9LA 5IAAC 1SEBD 3R66C 1T3QA 4TQ1A 1MHHE 3DBLB 3ALBA 3O65B 2MJDA 1XQQA 3EC8A 1DOIA 1KJTA 2D07B 4IM3A 1NI2A 2BWES 3EA6A 1SE2A 4FN2A 2FCMA 2ACZB 5BYQA 1I42A 3M95A 1TKYA 1ISNA 1P1AA 3HM6X 4IWPA 4KKIA 2HE7A 2K5PA 4FJYA 4RFBA 2X38A 4A3PA 2O6VD 2B76B 1P9DU 3TEWA 4WWNA 1WGHA 1V49A 2MCNB 4BZAA 1DOXA 2MJ3A 4MH0E 3ETRA 1YN3A 1FO4A 1E7UA 4IOIE 4HXDA 1ET6A 2HTHA 1V8CA 4N59A 5KHOA 4LTUA 2GBRA 5EDSA 1WM3A 4H2AA 2K25A 3AEFB 2MHJA 4M0WA 2PIAA 2IYDB 2CHXA 3IAS1 4C7YA 4JIOU 3H8HA 4KKJA 2KKCA 3QQ8B 2LFIA 4KSLC 1LFDA 4CHKA 1R7SA 3S2AA 3SDLC 4ANWA 1VZ8A 3Q69A 1EF5A 5DPSA 1ESFA 4F7ZA 1KLGD 1KF6B 4N58A 3AEEB 2WDQB 1RWSA 1EU4A 1YX5B 4FJVB 3N3KB 5TR5A 2O2VA 2J7QB 4W9DA 5BMHA 1GUAB 4FHJA 1WXQA 2M8SA 4JE3B 3W5VB 4M8NA 1XLOA 3HK0A 2AL3A 2Y5BB 3FILB 1PDXA 4BKGA 4RM9A 2KWVB 1LXDA 1FNUA 3IFWB 3L17A 3B2GA 1ZXHA 2JPHA 3PTFC 3DOWA 2MLBA 2V3PA 5GXGB 2JZPA 2UWQA 4XDDA 4HVBA 1TS3A 3L54A 1WJUA 1PGXA 4HWIB 3PZ7A 2W9NA 3DHGC 4S0RA 4ARIA 1TY0A 1SIFA 4WJPA 2MP2A 2MEKA 2LXAA 1L2NA 2A5UA 3APCA 2K0PA 5TSSA 4IWOA 3OG5A 1YOVB 3RNCC 4WJOA 5D3DA 3DVGY 3TEXA 3DHHC 1Q5WB 3IBEA 1TS4A 4EZLA 3WALA 2K22A 2JYTA 1F2RI 3R2IA 2LXCA 4DDID 1BMLC 3Q14C 1E0ZA 4R3DA 2LRWA 1OTRB 3C19A 4GDKA 4L1BA 1EU3A 2KDFB 1RYJA 2L52A 5AZGA 2NBVB 3RD2A 1WYWB 1MHXA 3VUXA 2LGIA 4MEMA 4PK1A 3ZJUA 1V1PB 4IKGA 3TBLD 2QILA 4C80A 3H1UA 3RMKC 2JF5A 2LGXA 4TV3A 2K6QA 1KLUD 5KHQA 2CKHB 3BZDB 3SR6A 4JWUC 2QEJC 1MG8A 4EUTA 2PLPA 2YVCA 2WXLA 4GXBA 3I57A 2H88B 3DQVA 4A90A 3DVNV 4YT0B 1H8CA 4ICVA 3P42A 2M0XA 4DXGA 2G3QB 2G4DB 2KVZA 3O13A 3PLUA 3UINB 3NUHB 3X23A 1QKZA 2ZPNA 3B9JA 4MM3A 1A70A 1GB4A 1BUIC 1VZ7A 1ET9A 2KWCA 4K3BA 2KJHB 2C7HA 3UIOB 5E6PA 3H6NA 1QOFA 3JW0X 5G2NA 3M63B 4EEWA 1EF1A 5G55A 4US8A 1ROEA 4M00A 2MJEA 2KYWA 5D2MB 2XN9C 5FKAC 1UWXA 3ZLZA 2BW2A 4WAAA 2LASA 3DBHB 2RDGA 4A6QA 3ZUNA 3P4RB 1C78A 3NVWA 2WLBA 3SFEB 4RCOA 5LXIB 4GU2A 4TSSA 2K39A 1SXTA 4D2KA 2L76A 4TMAB 4MSMB 2W3RA 1IYFA 1VD2A 2XEWA 4ACFA 2MH7A 3KUDB 3IG3A 1E90A 2LEKA 4PYUA 1UGMA 3RT3B 1UD7A 1GC6A 3A9JA 5DPWA 2G1EA 4K7SA 2L00B 3PO0A 4REZA 4LNKA 1XXGA 5G5GA 2RMMA 3VTVA 1UH6A 2NPTA 2D2QA 1NENB 1M4VA 3CSTA 1V6EA 2L05A 2KANA 1R4NB 2J0JA 3EECA 1XLPA 3ZO5B 2Z8LA 1I4XA 3AE5B 3AE7B 4RGMA 1WGGA 2PMVA 1V5OA 4EZJA 4HDOA 2Z59B 1C4CA 2R61A 1RFAA 2MBEA 4ZOHC 4B9KA 4HJKA 2ZZPB 1C4AA 4RNAA 2IJ0A 4MH8A 1SB3C 1LO5D 2BS4B 1P7EA 4UDUC 3ECIA 4NAWA 3NZ3A 2J0KA 3IAM1 2WXPA 3P4QB 3TUOA 1QZEA 5J2RA 4AWJA 1LM8B 1GAQB 2E6XA 2IGDA 2MRPA 2WXMA 2D10A 2WXOA 2RPQA 3AB5A 1F77A 4WURA 3L08A 2KOXA 4XYCA 1F1HA 2KFKB 3NZSA 4TKNA 2C60A 4JPSA 5T8IA 3A4RA 2JQRB 4YSZB 3RN9C 2BVCA 5L83A 2QC8A 1VJKA 1WRIA 2CS4A 2AQ2B 1GNUA 4CQNA 4NQLB 2V3NA 2EMSA 3TIXA 3E9SA 2NBWB 4RH6A 3NS1A 1VCBA 1ZDVA 2OHFA 2WXKA 3H7SA 4AUQC 1J19A 4KGSA 2CHZA 2O6VB 3DWGC 4MELA 4GGQA 4K3CA 1T0SC 5EE9A 1E9MA 1YN5A 4OW0A 2VRRB 4AOFA 2DLBA 3ZIMA 1JCKB 2FNJB 4HROA 4KGRA 3P2BA 1MI0A 2J42A 5DPTA 3RULA 5C2TB 2L83A 3RUIB 4B0EA 2JWZA 3ENEA 3OJ3A 1WMHB 3VDZA 2JXTA 5HI1A 1Y8RC 3NHEB 3U2SC 4IDIA 2LRUA 3H7PB 1PFDA 2LVQA 3WAOA 2LGSA 4MSQB 4BVUC 2NR2A 2DBYA 5C1ZA 2N9PC 2VH2A 2L8JA 3OJ4B 2HTME 4F1SA 1R4MI 1OGWA 4ZRIA 4BOZB 2N7EA 4HEA1 1PYWD 1UZXB 4MGKE 3L10B 4JWSC 2KD0A 4XZ4A 2LWPA 4NJCA 1VR9A 1RFKA 4W9LA 2INPE 2WXNA 4ZHOA 3NS8A 1WYGA 3T3NA 1CMXB 3C8YA 3MC8A 3ZKJC 1DYQA 1WXMA 3ZRFA 4IG7B 1WFYA 2DZKA 1WJ6A 3LDZE 1FPYA 4YSXB 1FFVA 4A9AA 3HUIA 4S17A 1RM6C 2N9KA 1OEYJ 2WGSA 4A55A 3AU5A 3UQAA 4GDLB 2LJ5A 3ZJTA 3U7DA 1YQ4B 3NVVA 4HJGE 1IGCA 4AP4C 2SEBD 2KDIA 3PGEA 5FR6A 4N6EB 2EELA 1D5MC 4OZCA 3QCAA 2BYTA 2AWTA 3MC9A 1WIAA 3W1SC 1VZ6A 1UBIA 1J7AA 1J8CA 1DOYA 2WX0A 3QWZB 2KQ7A 2KFJA 1T0YA 2IO1B 2BKRB 2WDTB 4I6LB 1C3TA 5HG2A 3M62B 1L4ZB 3Q3JA 4MJSA 4OZAA 2XBBC 1N61A 3IXSA 1KH0A 2QSDA 2Z0DB 4IM2A 2PPHA 4PS7A 1JALA 3B1LX 1AYFA 4BKSA 3KQ4A 3DBRB 1OQYA 2LGYA 3U4EG 4KIKA 3DHIC 1TY2A 3AI5A 5IKCM 4N9F4 3RNEC 3KYCD 5E6JA 4AQ7A 3DWMA 2BB6A 2K9XA 4XDCA 2LGDA 4RGTA 5CHVC 4A20A 4RF0A 4YL8A 2WXHA 1FXAA 1WZ3A 2D3BA 4W9JA 1AARA 2OEDA 3AE8B 3ZGZA 3HVDA 2D3GA 2AQ3B 2JVCA 4ZHPA 2K8CA 2EMTA 2HD5B 4DK5A 4NNJB 4NQKE 3DBLI 1RRBA 2LMCA 1YN4A 3UF8A 1STEA 3GZNB 1RLFA 2KNBA 1WR6E 2KDEB 5AUIA 2L32A 3LYYA 1E8ZA 1SJHD 1TKEA 3AU4A 4ANXA 2AL6A 1M94A 3PHXB 1FIQA 3W2DA 2BS3B 2VH1A 3Q8AA 3D32A 2W3SA 4G0NB 2KC1A 3DVGX 1L5PA 1S3SG 2KTRB 1IP9A 4K7WA 1E7VA 1FNVA 5DPRA 1NBFC 2KVRA 4NJ6A 2VZKD 4QAYA 3RNAC 1TBEA 1Q10A 3IHPC 2MX2A 4AJYB 3ZNZB 3TL5A 3GB1A 4M8MA 1UGJA 4LDTD 3L13A 5BYSA 3VTUA 2DZIA 1WE7A 4ICUA 3Q8BA 2LUMA 1WI0A 2PE6B 4M0WB 4P1CC 3AULA 1PUTA 1IBXB 1C76A 3BVGA 3R7RA 3N1ZC 4L23A 1L6VA 1JW9D 4HCPB 2FUHB 4DHZB 4LK0M 1T5XD 4II3B 4PT5A 4C4VA 2N7JA 3N20C 4LJOB 2KLGA 4OHJA 1V1PA 2KWDA 5BYRA 3OLMD 2ONQA 4W9IA 4KDLB 2ZJDA 4WH4A 3ZVVA 1E8XA 1ZE3D 1FEHA 1HZ6A 5JH5C 2NMQA 3QX1A 1CK1A 1K51A 3ZTCA 2BB5A 2FCQA 1WF9A 5H92C 4WJNA 5JHAA 1P98A 4K81A 4A8XC 3LB8C 2KXJA 2CU3A 2G9HD 3NY5A 5FR3A 2O2VB 2DYBA 1SIJA 1GB1A 2NTTA 5DCNA 5E6OA 1FNWA 1JWAD 2WXGA 4WWMA 2WNMA 2DAJA 1C79A 4KGTA 5IP4D 1TZ1A 4XWTA 1OEYA 1HTQA 3U7ZA 1I4RA 2NTSA 2KX3A 3QJZA 2LUEA 4K7UA 1BT0A 3V6EB 2RR9A 2BWFA 2FCSA 2K8BA 2LVOA 3Q8FA 2Y5PA 2I38A 2BTEA 3URYA 2LVPA 4ANUA 3BY4B 2BGFA 4XC2A 1WX7A 1SBBB 2DWQA 4PYZA 1N6ZA 1WRDB 1SJED 3QK0A 2M17A 1V5TA 1N5WA 1XT9B 4ZRQA 4KSKC 3CF6E 3KH0A 1JROA 1FXIA 2ZVNA 2V0GA 1I35A 3QARA 3AE1B 4WQOB 1FM0D 3NOBA 4P1BC 4KDIC 3E56A 4XWWA 3PRPB 3K9PB 3ZDMC 4FBJB 3RPFC 5EE1A 1PGBA 1XEEA 2GBMA 3Q3FA 1F9JA 4FULA 4XE0A 1WZ0A 3BYTB 1UBQA 3EFUA 3MJ5A 4ITKA 4EE2A 4GMVA 3AE4B 1IGDA 3PRMB 1TS5A 2MBHA 2ZEQA 4II2B 1WXSA 1K50A 2RSUA 2JZ3B 3BVZA 3WAPA 2GRIA 2LHDA 2MQJA 3T8MA 4JX1C 3AE2B 3PV1A 2KQSA 1WJNA 1HA5A 3GE3C 4W9EA 4ARCA 3J9CA 3FKYA 1ENFA 1WSPA 3ZQ4A 3SFDB 1KOTA 2ASQA 3JSVB 4XX5A 2PKOA 2WXQA 1VLBA 2C9WB 3ZNHB 5C23A 1N62A 3PS6A 4MM3B 3ML8A 1NEKB 2WXJA 4EFOA 3SU8X 3GOEA 1I4HA 2KC2A 2RPVA 2BS2B 5HKHA 1T6BX 3HIZA 2J4XA 4HPLB 2L7RA 4WJQA 3NRZA 5HHDG 1SE3A 1KM7A 2BKFA 2GBNA 2TSSA 2WU5B 2QDFA 1ZPSA 3RFZB 3DCGA 2G4SA 2MA9B 2KZRA 3ZYYX 1B9RA 1T0QC 3VRBB 4TUUA 1FCCC 3RNGC 1NYRA 2X8XX 3PSEB 4HPMB 1XCQL 3UGBB 2N7DA 2KK8A 4OVZA 2CR5A 3W9CB 2OJWA 3AEBB 3Q3MC 5D3IB 2PE9A 3ZTDA 3DBHI 4G3XB 2N9XA 1Z2MA 4DWFA 1SE9A 4RF1A 1HZ5A 1N63A 4KZCA 5IA7A 3EHVA 3CWIA 2N1WA 2DENB 1EUVB 1WGDA 2XK5A 3PPAA 4X57B 3I9V1 2DZMA 2AYOB 3V3XA 1K52A 3R3MA 2PVGC 1YX6B 2JUOA 2GB1A 2O6VA 3ZRCA 5FK9C 3R8BA 2NCNA 4NAMA 4DHJD 1F0ZA 3JYUA 1T0RC 5CHFA 2INCC 1EO6A 1FXTB 1GG3A 4J3OD 4J6IA 4LNOA 1X1MA 2DNFA 1PQSA 1ACCA 1GC7A 3GE8C 1J7BA 1NDDA 2BPSA 2WS3B 4LCDE 2PEAA 4FA6A 1WMHA 1D3ZA 3WIMA 3VH3B 4A3OA 1VRAB 3AEAB 1JQ4A 2FIDA 1R4NI 3MTNB 4OZBA 2MSED 1A5RA 4IWQA 3GS2A 1ZKHA 4DXFA 3R7QA 2K3UA 2KDBA 1C1YB 1SGHA 1ZUD2 4B95A 2KMAA 4BBNF 4LLGM 4DHZE 4NAWB 5D6JB 1WR1A 4FADA 2L0TA 2LI5A 1SSNA 4MGIE 4GLSC 2GMIC 3V05A 2WXRA 2C5LC 4G50A 4C56C 4RMAA 1JRUA 3A33B 4LNNA 3AN1A 3IVFA 3WANA 5CHWA 4E3CA 1N60A 4W9CA 3MJWA 4US9A 2QIEB 2JRHA 2BYFA 2V1YA 2UU7A 2XNAC 4EKUA 2NVUI 3A4SC 4ZDVA 4NY0A 4ZRKA 4ZYNA 3AE6B 1Q1OA 2KJ6A 3N9YC 2REXA 4E71A 2N9EB 1MJDA 1E5WA 3I63C 4IC7B 1WXAA 2KT7A 3AXCA 3BYYB 1XO3A 3KUZA 1U4AA 4GDLA 1UELA 2WDRB 4HDQA 4MACA 1HQRD 1Y56A 1ZOYB 3A9KB 1E6EB 4YTNB 3ABVB 4PS8A 2FBWB 3TSSA 2VZKB 1RAXA 1TS2A 4EZKA 3VTWA 2V9HA 1I4PA 2N1VA 2C7MB 1ZGUB 4LDTB 3AEGB 4FLHA 3CMMB 3X0WA 1WX8A 1UUPA 2GOWA 4G11A 2KN4A 3A1QB 3BINA 3T3OA 1V2YA 2JU6X 1QQRA 1E8YA 4YTMB 3RCZA 3VFKA 1MPEA 4NZLB 1JMLA 2INDC 4OVUA 3L4PA 4YWGG 3ZNID 2IDYA 4GB9A 2YEPF 4JGHB 2AQ1B 4DBGA 5C3JB 1QLBB 2V4IB 4FHKA 1EWCA 1WWTA 1TTNA 2KMMA 2INNE 2WHIA 1YJIA 2A4ZA 3W1YA 2OOBB 3GP7A 3VHTC 2R2QA 2M19A 3V60A 3ZJVA 4HLEA 3IT6B 3PT2B 3M3JA 3I5JC 1HE8A 4BBNC 4B6WA 1OQQA 2EKEC 2LJIA 1KLVA 3ZDTA
chains in the Genus database with same CATH topology
4P1CC 3Q3NC 3RN9C 3N1XC 3RNAC 3RNFC 1T0SC 3Q2AC 3GE8C 3RNCC 3N1ZC 3Q3OC 3RI7C 2INDC 3Q3MC 3DHHC 3RNBC 3DHIC 2RDBC 3N20C 3N1YC 3RMKC 3RNEC 3DHGC 1T0QC 3I5JC 3Q14C 3GE3C 1T0RC 2INCC 3RNGC 4P1BC 3I63C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P1C C;  3Q3N C;  3RN9 C;  3N1X C;  3RNA C;  3RNF C;  1T0S C;  3Q2A C;  3GE8 C;  3RNC C;  3N1Z C;  3Q3O C;  3RI7 C;  2IND C;  3Q3M C;  3DHH C;  3RNB C;  3DHI C;  2RDB C;  3N20 C;  3N1Y C;  3RMK C;  3RNE C;  3DHG C;  1T0Q C;  3I5J C;  3Q14 C;  3GE3 C;  1T0R C;  2INC C;  3RNG C;  4P1B C;  3I63 C; 
#chains in the Genus database with same CATH topology
 2KTF A;  1HXY D;  4MGY E;  3V62 A;  3VUW A;  3VH4 B;  5MPO A;  1WGR A;  3Q3O C;  4JL9 A;  5EE3 A;  5H8Y E;  4MDK E;  2GLS A;  3AM9 A;  1BXT A;  1CJE A;  1AW7 A;  3W5U B;  4I6N B;  1IPG A;  3N1Y C;  1V80 A;  5D94 A;  2IY1 B;  4KZ0 A;  1L0Y B;  1ZXI A;  3SEB A;  3P4P B;  3Q2A C;  2KTR A;  4F8C B;  2ZCB A;  1P0R A;  2KWU B;  3RYT A;  1YJJ A;  1XLQ A;  2KMC A;  1P7F A;  1UNS A;  5IO9 A;  3KWL A;  3KWV A;  2LZ6 A;  1TJE A;  2Q5W D;  5BO4 B;  1UWM A;  3FIL A;  4WAF A;  3VR8 B;  4URK A;  4MJS B;  3HVZ A;  3ZXR A;  2IPK D;  2ZPY A;  1AWD A;  1D5Z C;  2KAC A;  1IBX A;  3PVL A;  3ZNG C;  4M01 A;  1L7Y A;  3VXW A;  5GMV A;  3KVF B;  1XD3 B;  1KRH A;  4KIK B;  1NYQ A;  2GBK A;  3UQB A;  2KLC A;  3RI7 C;  2WXF A;  2QJL A;  3DBR I;  5IOI A;  2J52 A;  4MGZ E;  4YXD B;  2FCN A;  2IGG A;  3PRE A;  2IO3 B;  1C4P A;  2N0S B;  1GPX A;  3KLS X;  5AEK B;  2I1K A;  3ZW3 A;  4HCN B;  3QIJ A;  3MP9 A;  1FCL A;  2H89 B;  2GI9 A;  4HRS A;  1CQV A;  2HDE A;  3NVY A;  1LGR A;  3EGR A;  4HKZ E;  5LLI A;  3DDC B;  1KFY B;  2RDB C;  3AE3 B;  2ZCC A;  3VVW B;  3DBS A;  3TEY A;  2C7N B;  2JSV X;  1HTO A;  1WX9 A;  2KHW B;  1MG4 A;  3QA8 A;  1QOA A;  2SAK A;  3RNF C;  3B0A A;  3GZN I;  4WIP A;  1JWS D;  2N4F A;  2WXI A;  1J7C A;  2V3S A;  1HEZ E;  1WE6 A;  3HM3 A;  4USA A;  5L95 C;  4RM8 A;  5BMG A;  4GIV A;  2WYQ A;  5JXV A;  3NVZ A;  3KW5 B;  2RDH A;  1L4D B;  3HRD D;  3UIP B;  1L6U A;  3R2T A;  2KDM A;  4Q2J A;  5E6N A;  2I1J A;  5IN7 A;  2J0M A;  4K1R B;  1TIF A;  2RGF A;  2DYM A;  3VUY A;  1FMA D;  2FIF A;  3V61 A;  4JQW C;  3NZU A;  3TJP A;  4ASW C;  4C4V B;  1F52 A;  2DYO A;  2BQQ A;  1D5X C;  4GSW A;  2MP2 B;  2IZV B;  3RNB C;  4DHJ B;  1TYG B;  2JRI B;  3C0R B;  1TT5 B;  2JWU A;  3HHM A;  3QC8 B;  2KAJ A;  2QMT A;  1K8R B;  3PHW B;  3Q3N C;  4HKQ A;  3MC0 B;  3Q6B A;  1I4Q A;  4E74 A;  3WAM A;  1KTK A;  4O1N A;  5D7G A;  2QHO A;  2W54 A;  3KUC B;  2ZW0 A;  3CIR B;  3KYD D;  4GDK B;  3JSV A;  1YJ1 A;  1E7P B;  2D3C A;  4IM0 A;  5I4D A;  3VRA B;  3LXF A;  1GJZ A;  3AEC B;  3APD A;  3CSF A;  4GOC A;  3NJT A;  4BKS D;  2KQ4 X;  1V9J A;  2HJ1 A;  2BF8 B;  3EUB 2;  2JZZ A;  3WA0 A;  1Q0W B;  4BKT A;  1G6J A;  3VQI A;  3U30 A;  3DPD A;  1QIL A;  1F2R C;  2NBU A;  2IBI B;  1XLN A;  4L2Y A;  1FFU A;  3H9D A;  1TZO A;  3TCA A;  2BBC A;  2GBJ A;  3WCQ A;  3TEZ A;  2Y3A A;  1Z5S B;  1SF0 A;  4PS3 A;  2ZNV B;  4IUM B;  1YD8 U;  3B2F A;  1TKG A;  4LNI A;  2DHZ A;  4NJ7 A;  3MHZ A;  3UI3 A;  3Q8E A;  2JXX A;  1I7H A;  1YMH E;  3ML9 A;  5AZH A;  1J0G A;  3OWE B;  2D3A A;  4KV2 A;  2AX5 A;  2QCZ A;  4KVG B;  3PLV A;  2FAZ A;  1UF0 A;  3LJ3 A;  1QOG A;  1FD6 A;  5G5H A;  3OAW A;  3Q8C A;  4B0M A;  2ZW1 A;  2DZJ A;  5EE0 A;  2PTL A;  4ZYS A;  4P7I A;  2BYE A;  3FC4 A;  1LQB A;  3AED B;  3BWU D;  1WXV A;  5LXH A;  1EM7 A;  1YNT E;  3IT4 B;  2E3T A;  5BMI A;  3QAQ A;  1QT9 A;  1OFF A;  2IO2 B;  4XGA B;  2M0A A;  3N32 A;  4OVV A;  1JWB D;  2UYZ B;  4YSY B;  3W1S A;  2WP9 B;  1MVK A;  2KFK A;  2KX0 A;  1XCT L;  1SE4 A;  4NPN A;  4DXA B;  5HFY A;  3PRZ A;  1OQR A;  2CJO A;  3PZD A;  2LHE A;  4HPP A;  1B1Z A;  3PZ8 A;  2JX5 A;  2IY0 B;  1WY8 A;  3A9J B;  3P1M A;  3JVZ X;  2K6D B;  2R2O A;  2PW9 A;  4W9F A;  2L0F A;  2MBB B;  3L16 A;  3MFG A;  1L0V B;  5CX3 A;  4MT5 A;  2NPT B;  2L1A A;  3APF A;  2B3A A;  2EKI A;  2BT6 A;  5J17 A;  2Z0E B;  4W9G A;  2NS5 A;  4W9H A;  2BYV E;  2JY6 A;  2CHW A;  2G45 B;  1S1Q B;  2D5G A;  2K1F A;  1JWM D;  3VAW A;  2W55 A;  1JWU D;  3BK1 A;  4BOS C;  1H4R A;  3V6C B;  2MBQ A;  2D11 A;  3EFC A;  1YQ3 B;  1FRR A;  4M02 A;  4JLC A;  5CTR C;  4DQO C;  3H7P A;  1TGZ B;  2JT4 B;  1R4M B;  4BFR A;  2RD0 A;  3BVM A;  4ANV A;  4ZRJ A;  2M1M A;  2I2Y A;  3K9O B;  3I3T B;  4P6V F;  3TMP B;  5AUK A;  1FRD A;  3SD5 A;  2JYE A;  2MWS B;  4ZRP A;  1ZP0 B;  1V97 A;  1MFW A;  1WJ4 A;  1K53 A;  2XK5 B;  1IUE A;  3AH7 A;  3NG0 A;  5J18 A;  4LJP B;  1WGK A;  2W82 A;  3T9L A;  1GOZ A;  4W9K A;  1N5X A;  3AMZ A;  3RZW C;  1XF5 L;  2DX5 B;  1PGA A;  3A9K A;  2PVO D;  4WWP A;  2AEH A;  2ZNV C;  4KX6 B;  4C7Z A;  1V86 A;  1YIW A;  2KJR A;  4FXC A;  3DVN U;  1D4B A;  2L3Z A;  1JRP A;  1QOB A;  1ZW7 A;  2FE8 A;  2K8H A;  1ZDX A;  2WU2 B;  2M4N A;  2DAF A;  3AE9 B;  2ICI A;  2IGH A;  3RZF A;  4TQ0 A;  4I6P A;  2YLM A;  3N1X C;  5AZF A;  4FJZ A;  1QF6 A;  3A1Q A;  4P16 A;  1E10 A;  1D6E C;  1C9F A;  1C77 A;  3ONS A;  4IW0 A;  1P3Q U;  1WGY A;  2ZVO A;  3FAH A;  1WH3 A;  2Y5C A;  3L0W B;  2LD9 A;  4BAX A;  4CO7 A;  1E8W A;  2WX1 A;  2FUG 1;  3U52 E;  1YQB A;  2WDV B;  2ON8 A;  3ZXV A;  3QHT A;  4CYE A;  2V4L A;  4AJW A;  2WWZ A;  3BK2 A;  2MBO A;  2PJH A;  2OJR A;  2M56 B;  3AV8 A;  3U8Z A;  4AS1 A;  4GN1 A;  4C00 A;  1V81 A;  3N30 A;  3BII D;  2KO3 A;  1I4G A;  3VR9 B;  3P4S B;  4DDG D;  2KN5 A;  4HK2 A;  3MHS D;  4RGO S;  2YEP B;  2WQY B;  4RGN A;  2MW5 A;  1CZP A;  5JHB A;  2CU1 A;  5LNK 1;  5JZE B;  1VDV A;  3B08 A;  2CJN A;  4WWO A;  1EWY C;  1DGJ A;  4EOY A;  1AN8 A;  1L0X B;  4WQM A;  1V1O A;  4YTP B;  2HJ8 A;  1NVI D;  2IO0 B;  3P63 A;  2J53 A;  3SHQ A;  1WM2 A;  4LNF A;  1NI3 A;  2N9L A;  5IAA C;  1SEB D;  3R66 C;  1T3Q A;  4TQ1 A;  1MHH E;  3DBL B;  3ALB A;  3O65 B;  2MJD A;  1XQQ A;  3EC8 A;  1DOI A;  1KJT A;  2D07 B;  4IM3 A;  1NI2 A;  2BWE S;  3EA6 A;  1SE2 A;  4FN2 A;  2FCM A;  2ACZ B;  5BYQ A;  1I42 A;  3M95 A;  1TKY A;  1ISN A;  1P1A A;  3HM6 X;  4IWP A;  4KKI A;  2HE7 A;  2K5P A;  4FJY A;  4RFB A;  2X38 A;  4A3P A;  2O6V D;  2B76 B;  1P9D U;  3TEW A;  4WWN A;  1WGH A;  1V49 A;  2MCN B;  4BZA A;  1DOX A;  2MJ3 A;  4MH0 E;  3ETR A;  1YN3 A;  1FO4 A;  1E7U A;  4IOI E;  4HXD A;  1ET6 A;  2HTH A;  1V8C A;  4N59 A;  5KHO A;  4LTU A;  2GBR A;  5EDS A;  1WM3 A;  4H2A A;  2K25 A;  3AEF B;  2MHJ A;  4M0W A;  2PIA A;  2IYD B;  2CHX A;  3IAS 1;  4C7Y A;  4JIO U;  3H8H A;  4KKJ A;  2KKC A;  3QQ8 B;  2LFI A;  4KSL C;  1LFD A;  4CHK A;  1R7S A;  3S2A A;  3SDL C;  4ANW A;  1VZ8 A;  3Q69 A;  1EF5 A;  5DPS A;  1ESF A;  4F7Z A;  1KLG D;  1KF6 B;  4N58 A;  3AEE B;  2WDQ B;  1RWS A;  1EU4 A;  1YX5 B;  4FJV B;  3N3K B;  5TR5 A;  2O2V A;  2J7Q B;  4W9D A;  5BMH A;  1GUA B;  4FHJ A;  1WXQ A;  2M8S A;  4JE3 B;  3W5V B;  4M8N A;  1XLO A;  3HK0 A;  2AL3 A;  2Y5B B;  3FIL B;  1PDX A;  4BKG A;  4RM9 A;  2KWV B;  1LXD A;  1FNU A;  3IFW B;  3L17 A;  3B2G A;  1ZXH A;  2JPH A;  3PTF C;  3DOW A;  2MLB A;  2V3P A;  5GXG B;  2JZP A;  2UWQ A;  4XDD A;  4HVB A;  1TS3 A;  3L54 A;  1WJU A;  1PGX A;  4HWI B;  3PZ7 A;  2W9N A;  3DHG C;  4S0R A;  4ARI A;  1TY0 A;  1SIF A;  4WJP A;  2MP2 A;  2MEK A;  2LXA A;  1L2N A;  2A5U A;  3APC A;  2K0P A;  5TSS A;  4IWO A;  3OG5 A;  1YOV B;  3RNC C;  4WJO A;  5D3D A;  3DVG Y;  3TEX A;  3DHH C;  1Q5W B;  3IBE A;  1TS4 A;  4EZL A;  3WAL A;  2K22 A;  2JYT A;  1F2R I;  3R2I A;  2LXC A;  4DDI D;  1BML C;  3Q14 C;  1E0Z A;  4R3D A;  2LRW A;  1OTR B;  3C19 A;  4GDK A;  4L1B A;  1EU3 A;  2KDF B;  1RYJ A;  2L52 A;  5AZG A;  2NBV B;  3RD2 A;  1WYW B;  1MHX A;  3VUX A;  2LGI A;  4MEM A;  4PK1 A;  3ZJU A;  1V1P B;  4IKG A;  3TBL D;  2QIL A;  4C80 A;  3H1U A;  3RMK C;  2JF5 A;  2LGX A;  4TV3 A;  2K6Q A;  1KLU D;  5KHQ A;  2CKH B;  3BZD B;  3SR6 A;  4JWU C;  2QEJ C;  1MG8 A;  4EUT A;  2PLP A;  2YVC A;  2WXL A;  4GXB A;  3I57 A;  2H88 B;  3DQV A;  4A90 A;  3DVN V;  4YT0 B;  1H8C A;  4ICV A;  3P42 A;  2M0X A;  4DXG A;  2G3Q B;  2G4D B;  2KVZ A;  3O13 A;  3PLU A;  3UIN B;  3NUH B;  3X23 A;  1QKZ A;  2ZPN A;  3B9J A;  4MM3 A;  1A70 A;  1GB4 A;  1BUI C;  1VZ7 A;  1ET9 A;  2KWC A;  4K3B A;  2KJH B;  2C7H A;  3UIO B;  5E6P A;  3H6N A;  1QOF A;  3JW0 X;  5G2N A;  3M63 B;  4EEW A;  1EF1 A;  5G55 A;  4US8 A;  1ROE A;  4M00 A;  2MJE A;  2KYW A;  5D2M B;  2XN9 C;  5FKA C;  1UWX A;  3ZLZ A;  2BW2 A;  4WAA A;  2LAS A;  3DBH B;  2RDG A;  4A6Q A;  3ZUN A;  3P4R B;  1C78 A;  3NVW A;  2WLB A;  3SFE B;  4RCO A;  5LXI B;  4GU2 A;  4TSS A;  2K39 A;  1SXT A;  4D2K A;  2L76 A;  4TMA B;  4MSM B;  2W3R A;  1IYF A;  1VD2 A;  2XEW A;  4ACF A;  2MH7 A;  3KUD B;  3IG3 A;  1E90 A;  2LEK A;  4PYU A;  1UGM A;  3RT3 B;  1UD7 A;  1GC6 A;  3A9J A;  5DPW A;  2G1E A;  4K7S A;  2L00 B;  3PO0 A;  4REZ A;  4LNK A;  1XXG A;  5G5G A;  2RMM A;  3VTV A;  1UH6 A;  2NPT A;  2D2Q A;  1NEN B;  1M4V A;  3CST A;  1V6E A;  2L05 A;  2KAN A;  1R4N B;  2J0J A;  3EEC A;  1XLP A;  3ZO5 B;  2Z8L A;  1I4X A;  3AE5 B;  3AE7 B;  4RGM A;  1WGG A;  2PMV A;  1V5O A;  4EZJ A;  4HDO A;  2Z59 B;  1C4C A;  2R61 A;  1RFA A;  2MBE A;  4ZOH C;  4B9K A;  4HJK A;  2ZZP B;  1C4A A;  4RNA A;  2IJ0 A;  4MH8 A;  1SB3 C;  1LO5 D;  2BS4 B;  1P7E A;  4UDU C;  3ECI A;  4NAW A;  3NZ3 A;  2J0K A;  3IAM 1;  2WXP A;  3P4Q B;  3TUO A;  1QZE A;  5J2R A;  4AWJ A;  1LM8 B;  1GAQ B;  2E6X A;  2IGD A;  2MRP A;  2WXM A;  2D10 A;  2WXO A;  2RPQ A;  3AB5 A;  1F77 A;  4WUR A;  3L08 A;  2KOX A;  4XYC A;  1F1H A;  2KFK B;  3NZS A;  4TKN A;  2C60 A;  4JPS A;  5T8I A;  3A4R A;  2JQR B;  4YSZ B;  3RN9 C;  2BVC A;  5L83 A;  2QC8 A;  1VJK A;  1WRI A;  2CS4 A;  2AQ2 B;  1GNU A;  4CQN A;  4NQL B;  2V3N A;  2EMS A;  3TIX A;  3E9S A;  2NBW B;  4RH6 A;  3NS1 A;  1VCB A;  1ZDV A;  2OHF A;  2WXK A;  3H7S A;  4AUQ C;  1J19 A;  4KGS A;  2CHZ A;  2O6V B;  3DWG C;  4MEL A;  4GGQ A;  4K3C A;  1T0S C;  5EE9 A;  1E9M A;  1YN5 A;  4OW0 A;  2VRR B;  4AOF A;  2DLB A;  3ZIM A;  1JCK B;  2FNJ B;  4HRO A;  4KGR A;  3P2B A;  1MI0 A;  2J42 A;  5DPT A;  3RUL A;  5C2T B;  2L83 A;  3RUI B;  4B0E A;  2JWZ A;  3ENE A;  3OJ3 A;  1WMH B;  3VDZ A;  2JXT A;  5HI1 A;  1Y8R C;  3NHE B;  3U2S C;  4IDI A;  2LRU A;  3H7P B;  1PFD A;  2LVQ A;  3WAO A;  2LGS A;  4MSQ B;  4BVU C;  2NR2 A;  2DBY A;  5C1Z A;  2N9P C;  2VH2 A;  2L8J A;  3OJ4 B;  2HTM E;  4F1S A;  1R4M I;  1OGW A;  4ZRI A;  4BOZ B;  2N7E A;  4HEA 1;  1PYW D;  1UZX B;  4MGK E;  3L10 B;  4JWS C;  2KD0 A;  4XZ4 A;  2LWP A;  4NJC A;  1VR9 A;  1RFK A;  4W9L A;  2INP E;  2WXN A;  4ZHO A;  3NS8 A;  1WYG A;  3T3N A;  1CMX B;  3C8Y A;  3MC8 A;  3ZKJ C;  1DYQ A;  1WXM A;  3ZRF A;  4IG7 B;  1WFY A;  2DZK A;  1WJ6 A;  3LDZ E;  1FPY A;  4YSX B;  1FFV A;  4A9A A;  3HUI A;  4S17 A;  1RM6 C;  2N9K A;  1OEY J;  2WGS A;  4A55 A;  3AU5 A;  3UQA A;  4GDL B;  2LJ5 A;  3ZJT A;  3U7D A;  1YQ4 B;  3NVV A;  4HJG E;  1IGC A;  4AP4 C;  2SEB D;  2KDI A;  3PGE A;  5FR6 A;  4N6E B;  2EEL A;  1D5M C;  4OZC A;  3QCA A;  2BYT A;  2AWT A;  3MC9 A;  1WIA A;  3W1S C;  1VZ6 A;  1UBI A;  1J7A A;  1J8C A;  1DOY A;  2WX0 A;  3QWZ B;  2KQ7 A;  2KFJ A;  1T0Y A;  2IO1 B;  2BKR B;  2WDT B;  4I6L B;  1C3T A;  5HG2 A;  3M62 B;  1L4Z B;  3Q3J A;  4MJS A;  4OZA A;  2XBB C;  1N61 A;  3IXS A;  1KH0 A;  2QSD A;  2Z0D B;  4IM2 A;  2PPH A;  4PS7 A;  1JAL A;  3B1L X;  1AYF A;  4BKS A;  3KQ4 A;  3DBR B;  1OQY A;  2LGY A;  3U4E G;  4KIK A;  3DHI C;  1TY2 A;  3AI5 A;  5IKC M;  4N9F 4;  3RNE C;  3KYC D;  5E6J A;  4AQ7 A;  3DWM A;  2BB6 A;  2K9X A;  4XDC A;  2LGD A;  4RGT A;  5CHV C;  4A20 A;  4RF0 A;  4YL8 A;  2WXH A;  1FXA A;  1WZ3 A;  2D3B A;  4W9J A;  1AAR A;  2OED A;  3AE8 B;  3ZGZ A;  3HVD A;  2D3G A;  2AQ3 B;  2JVC A;  4ZHP A;  2K8C A;  2EMT A;  2HD5 B;  4DK5 A;  4NNJ B;  4NQK E;  3DBL I;  1RRB A;  2LMC A;  1YN4 A;  3UF8 A;  1STE A;  3GZN B;  1RLF A;  2KNB A;  1WR6 E;  2KDE B;  5AUI A;  2L32 A;  3LYY A;  1E8Z A;  1SJH D;  1TKE A;  3AU4 A;  4ANX A;  2AL6 A;  1M94 A;  3PHX B;  1FIQ A;  3W2D A;  2BS3 B;  2VH1 A;  3Q8A A;  3D32 A;  2W3S A;  4G0N B;  2KC1 A;  3DVG X;  1L5P A;  1S3S G;  2KTR B;  1IP9 A;  4K7W A;  1E7V A;  1FNV A;  5DPR A;  1NBF C;  2KVR A;  4NJ6 A;  2VZK D;  4QAY A;  3RNA C;  1TBE A;  1Q10 A;  3IHP C;  2MX2 A;  4AJY B;  3ZNZ B;  3TL5 A;  3GB1 A;  4M8M A;  1UGJ A;  4LDT D;  3L13 A;  5BYS A;  3VTU A;  2DZI A;  1WE7 A;  4ICU A;  3Q8B A;  2LUM A;  1WI0 A;  2PE6 B;  4M0W B;  4P1C C;  3AUL A;  1PUT A;  1IBX B;  1C76 A;  3BVG A;  3R7R A;  3N1Z C;  4L23 A;  1L6V A;  1JW9 D;  4HCP B;  2FUH B;  4DHZ B;  4LK0 M;  1T5X D;  4II3 B;  4PT5 A;  4C4V A;  2N7J A;  3N20 C;  4LJO B;  2KLG A;  4OHJ A;  1V1P A;  2KWD A;  5BYR A;  3OLM D;  2ONQ A;  4W9I A;  4KDL B;  2ZJD A;  4WH4 A;  3ZVV A;  1E8X A;  1ZE3 D;  1FEH A;  1HZ6 A;  5JH5 C;  2NMQ A;  3QX1 A;  1CK1 A;  1K51 A;  3ZTC A;  2BB5 A;  2FCQ A;  1WF9 A;  5H92 C;  4WJN A;  5JHA A;  1P98 A;  4K81 A;  4A8X C;  3LB8 C;  2KXJ A;  2CU3 A;  2G9H D;  3NY5 A;  5FR3 A;  2O2V B;  2DYB A;  1SIJ A;  1GB1 A;  2NTT A;  5DCN A;  5E6O A;  1FNW A;  1JWA D;  2WXG A;  4WWM A;  2WNM A;  2DAJ A;  1C79 A;  4KGT A;  5IP4 D;  1TZ1 A;  4XWT A;  1OEY A;  1HTQ A;  3U7Z A;  1I4R A;  2NTS A;  2KX3 A;  3QJZ A;  2LUE A;  4K7U A;  1BT0 A;  3V6E B;  2RR9 A;  2BWF A;  2FCS A;  2K8B A;  2LVO A;  3Q8F A;  2Y5P A;  2I38 A;  2BTE A;  3URY A;  2LVP A;  4ANU A;  3BY4 B;  2BGF A;  4XC2 A;  1WX7 A;  1SBB B;  2DWQ A;  4PYZ A;  1N6Z A;  1WRD B;  1SJE D;  3QK0 A;  2M17 A;  1V5T A;  1N5W A;  1XT9 B;  4ZRQ A;  4KSK C;  3CF6 E;  3KH0 A;  1JRO A;  1FXI A;  2ZVN A;  2V0G A;  1I35 A;  3QAR A;  3AE1 B;  4WQO B;  1FM0 D;  3NOB A;  4P1B C;  4KDI C;  3E56 A;  4XWW A;  3PRP B;  3K9P B;  3ZDM C;  4FBJ B;  3RPF C;  5EE1 A;  1PGB A;  1XEE A;  2GBM A;  3Q3F A;  1F9J A;  4FUL A;  4XE0 A;  1WZ0 A;  3BYT B;  1UBQ A;  3EFU A;  3MJ5 A;  4ITK A;  4EE2 A;  4GMV A;  3AE4 B;  1IGD A;  3PRM B;  1TS5 A;  2MBH A;  2ZEQ A;  4II2 B;  1WXS A;  1K50 A;  2RSU A;  2JZ3 B;  3BVZ A;  3WAP A;  2GRI A;  2LHD A;  2MQJ A;  3T8M A;  4JX1 C;  3AE2 B;  3PV1 A;  2KQS A;  1WJN A;  1HA5 A;  3GE3 C;  4W9E A;  4ARC A;  3J9C A;  3FKY A;  1ENF A;  1WSP A;  3ZQ4 A;  3SFD B;  1KOT A;  2ASQ A;  3JSV B;  4XX5 A;  2PKO A;  2WXQ A;  1VLB A;  2C9W B;  3ZNH B;  5C23 A;  1N62 A;  3PS6 A;  4MM3 B;  3ML8 A;  1NEK B;  2WXJ A;  4EFO A;  3SU8 X;  3GOE A;  1I4H A;  2KC2 A;  2RPV A;  2BS2 B;  5HKH A;  1T6B X;  3HIZ A;  2J4X A;  4HPL B;  2L7R A;  4WJQ A;  3NRZ A;  5HHD G;  1SE3 A;  1KM7 A;  2BKF A;  2GBN A;  2TSS A;  2WU5 B;  2QDF A;  1ZPS A;  3RFZ B;  3DCG A;  2G4S A;  2MA9 B;  2KZR A;  3ZYY X;  1B9R A;  1T0Q C;  3VRB B;  4TUU A;  1FCC C;  3RNG C;  1NYR A;  2X8X X;  3PSE B;  4HPM B;  1XCQ L;  3UGB B;  2N7D A;  2KK8 A;  4OVZ A;  2CR5 A;  3W9C B;  2OJW A;  3AEB B;  3Q3M C;  5D3I B;  2PE9 A;  3ZTD A;  3DBH I;  4G3X B;  2N9X A;  1Z2M A;  4DWF A;  1SE9 A;  4RF1 A;  1HZ5 A;  1N63 A;  4KZC A;  5IA7 A;  3EHV A;  3CWI A;  2N1W A;  2DEN B;  1EUV B;  1WGD A;  2XK5 A;  3PPA A;  4X57 B;  3I9V 1;  2DZM A;  2AYO B;  3V3X A;  1K52 A;  3R3M A;  2PVG C;  1YX6 B;  2JUO A;  2GB1 A;  2O6V A;  3ZRC A;  5FK9 C;  3R8B A;  2NCN A;  4NAM A;  4DHJ D;  1F0Z A;  3JYU A;  1T0R C;  5CHF A;  2INC C;  1EO6 A;  1FXT B;  1GG3 A;  4J3O D;  4J6I A;  4LNO A;  1X1M A;  2DNF A;  1PQS A;  1ACC A;  1GC7 A;  3GE8 C;  1J7B A;  1NDD A;  2BPS A;  2WS3 B;  4LCD E;  2PEA A;  4FA6 A;  1WMH A;  1D3Z A;  3WIM A;  3VH3 B;  4A3O A;  1VRA B;  3AEA B;  1JQ4 A;  2FID A;  1R4N I;  3MTN B;  4OZB A;  2MSE D;  1A5R A;  4IWQ A;  3GS2 A;  1ZKH A;  4DXF A;  3R7Q A;  2K3U A;  2KDB A;  1C1Y B;  1SGH A;  1ZUD 2;  4B95 A;  2KMA A;  4BBN F;  4LLG M;  4DHZ E;  4NAW B;  5D6J B;  1WR1 A;  4FAD A;  2L0T A;  2LI5 A;  1SSN A;  4MGI E;  4GLS C;  2GMI C;  3V05 A;  2WXR A;  2C5L C;  4G50 A;  4C56 C;  4RMA A;  1JRU A;  3A33 B;  4LNN A;  3AN1 A;  3IVF A;  3WAN A;  5CHW A;  4E3C A;  1N60 A;  4W9C A;  3MJW A;  4US9 A;  2QIE B;  2JRH A;  2BYF A;  2V1Y A;  2UU7 A;  2XNA C;  4EKU A;  2NVU I;  3A4S C;  4ZDV A;  4NY0 A;  4ZRK A;  4ZYN A;  3AE6 B;  1Q1O A;  2KJ6 A;  3N9Y C;  2REX A;  4E71 A;  2N9E B;  1MJD A;  1E5W A;  3I63 C;  4IC7 B;  1WXA A;  2KT7 A;  3AXC A;  3BYY B;  1XO3 A;  3KUZ A;  1U4A A;  4GDL A;  1UEL A;  2WDR B;  4HDQ A;  4MAC A;  1HQR D;  1Y56 A;  1ZOY B;  3A9K B;  1E6E B;  4YTN B;  3ABV B;  4PS8 A;  2FBW B;  3TSS A;  2VZK B;  1RAX A;  1TS2 A;  4EZK A;  3VTW A;  2V9H A;  1I4P A;  2N1V A;  2C7M B;  1ZGU B;  4LDT B;  3AEG B;  4FLH A;  3CMM B;  3X0W A;  1WX8 A;  1UUP A;  2GOW A;  4G11 A;  2KN4 A;  3A1Q B;  3BIN A;  3T3O A;  1V2Y A;  2JU6 X;  1QQR A;  1E8Y A;  4YTM B;  3RCZ A;  3VFK A;  1MPE A;  4NZL B;  1JML A;  2IND C;  4OVU A;  3L4P A;  4YWG G;  3ZNI D;  2IDY A;  4GB9 A;  2YEP F;  4JGH B;  2AQ1 B;  4DBG A;  5C3J B;  1QLB B;  2V4I B;  4FHK A;  1EWC A;  1WWT A;  1TTN A;  2KMM A;  2INN E;  2WHI A;  1YJI A;  2A4Z A;  3W1Y A;  2OOB B;  3GP7 A;  3VHT C;  2R2Q A;  2M19 A;  3V60 A;  3ZJV A;  4HLE A;  3IT6 B;  3PT2 B;  3M3J A;  3I5J C;  1HE8 A;  4BBN C;  4B6W A;  1OQQ A;  2EKE C;  2LJI A;  1KLV A;  3ZDT A; 
#chains in the Genus database with same CATH homology
 4P1C C;  3Q3N C;  3RN9 C;  3N1X C;  3RNA C;  3RNF C;  1T0S C;  3Q2A C;  3GE8 C;  3RNC C;  3N1Z C;  3Q3O C;  3RI7 C;  2IND C;  3Q3M C;  3DHH C;  3RNB C;  3DHI C;  2RDB C;  3N20 C;  3N1Y C;  3RMK C;  3RNE C;  3DHG C;  1T0Q C;  3I5J C;  3Q14 C;  3GE3 C;  1T0R C;  2INC C;  3RNG C;  4P1B C;  3I63 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...