3I5JC

Diferric resting state toluene 4-monooxygenase hd complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
82
structure length
82
Chain Sequence
SAFPVHAAFEKDFLVQLVVVDLNDSMDQVAEKVAYHCVNRRVAPREGVMRVRKHRSTELFPRDMTIAESGLNPTEVIDVVFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Toluene-4-monooxygenase system protein A
publication title Crystallographic and catalytic studies of the peroxide-shunt reaction in a diiron hydroxylase.
pubmed doi rcsb
source organism Pseudomonas mendocina
total genus 24
structure length 82
sequence length 82
ec nomenclature ec 1.14.13.236: Toluene 4-monooxygenase.
pdb deposition date 2009-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 3i5jC00
3GE3C 3RMKC 3Q3MC 3N1XC 3RNEC 3RN9C 3I63C 3RI7C 3Q14C 3Q2AC 4P1BC 3RNFC 3RNGC 3I5JC 2INCC 3Q3OC 3RNCC 3RNBC 3DHHC 3GE8C 1T0RC 2INDC 3Q3NC 3RNAC 1T0QC 3N20C 3DHIC 4P1CC 3N1YC 1T0SC 2RDBC 3N1ZC 3DHGC
chains in the Genus database with same CATH superfamily
2WXFA 4LLGM 3VVWB 4S17A 4LNOA 2BB6A 3KUZA 4IWOA 3AE3B 1NDDA 4KGRA 3NUHB 1UBQA 1TKEA 4XGAB 1YN3A 2D3CA 3V62A 3UQAA 1WSPA 5JH5C 2JF5A 3N20C 4XDCA 4AUQC 1GUAB 1J0GA 1T0YA 3O13A 3ZXRA 5BMIA 2G45B 4GDLA 1WXVA 3AB5A 1B9RA 2M8SA 2KT7A 5TSSA 1WXSA 4JL9A 1NBFC 5DPSA 2KMCA 3IBEA 3ZTCA 4RGTA 3KUDB 1XLNA 2AQ3B 2M1MA 2WXIA 1YN4A 1XF5L 3SD5A 1J7BA 2BYTA 1R4NI 1K51A 4HLEA 2D5GA 1A5RA 3AXCA 4RCOA 3HVDA 3TL5A 3UINB 3SR6A 3I9V1 4KDLB 3KVFB 1E7VA 3ENEA 3GE8C 1LO5D 3Q3NC 2J0KA 3H8HA 2KDBA 3ONSA 4ICVA 3U2SC 2MA9B 1YNTE 3AE4B 2KC2A 1I7HA 3AEGB 3ZJTA 1R7SA 3Q8CA 3FAHA 2BWES 2DZIA 4E74A 1WE7A 2NPTA 2LVPA 3M62B 5DPTA 2QJLA 2Y5BB 3Q3JA 5CHFA 4F8CB 1AN8A 1C9FA 2G4DB 2I1KA 1VDVA 4GXBA 3B08A 2ZNVC 4P7IA 4JPSA 1P9DU 5IA7A 2PVOD 3WIMA 4CO7A 1SE3A 2PLPA 2W82A 2B76B 4YSYB 4NAWB 3N1ZC 3BVMA 4BZAA 1BXTA 4YTMB 4KKIA 1WGHA 2WXQA 4WAAA 2KFKB 2DLBA 2RDHA 1J19A 3IAM1 4DHZE 2QHOA 4N9F4 2AL3A 4HXDA 1OTRB 1SIFA 2AEHA 3ZIMA 4N59A 4LDTB 3RPFC 1IGDA 2WDVB 4JWUC 3PLUA 2D11A 3I63C 1UD7A 4LK0M 1YJIA 1UNSA 4EFOA 1TT5B 2V0GA 1XLQA 3TEYA 4JQWC 4G11A 3QWZB 4H2AA 4HPMB 1OQRA 2PJHA 2VRRB 3H7PB 4MJSB 2N1WA 1L2NA 2I2YA 1EU3A 3AEAB 1MVKA 4M0WA 1K50A 3TBLD 4EZJA 3N3KB 4WWOA 4A9AA 3CWIA 3MJWA 4W9JA 3DWMA 4M8NA 4II3B 2WWZA 1SIJA 4NPNA 1FRDA 2LEKA 4EUTA 2N9LA 5TR5A 2RDBC 2ZZPB 1SXTA 4RF0A 3ZNID 4C80A 3IFWB 2J4XA 2BYFA 2ICIA 4E3CA 2J53A 3QC8B 4N6EB 4P1BC 2ZW0A 3I5JC 2WXHA 1SB3C 3NJTA 4KKJA 3H7SA 3Q8AA 5IAAC 4GLSC 3QA8A 4MM3A 3DCGA 2WXOA 3VR9B 3ZLZA 2WXGA 4M02A 1ZP0B 5CTRC 1OGWA 2JZZA 3ZXVA 5LXHA 1VLBA 2G9HD 2JVCA 2W55A 1OFFA 2ZPNA 3V6EB 3FC4A 4K3CA 2XBBC 1DYQA 2FCQA 4AOFA 1KRHA 2R61A 2BF8B 1FRRA 4W9DA 2K39A 3PVLA 3EFUA 2DYBA 2KHWB 2FNJB 1L4DB 1TS4A 4O1NA 4PYUA 1DOYA 1DOXA 1WZ0A 2WU2B 4BKSD 4YTNB 4YL8A 4BKTA 2ZVOA 3RZFA 4TUUA 2BS3B 4DXAB 4ZDVA 1K53A 1FCCC 1FNUA 1FEHA 4FADA 2CR5A 4M01A 4ITKA 1Y56A 1YD8U 5IO9A 2IO1B 3RN9C 3P4QB 2KO3A 3RNFC 1T3QA 2MWSB 1L0XB 2KACA 2CHZA 3ZRCA 3U52E 1M94A 3DBRB 2IGDA 3UF8A 1XLPA 5FKAC 1V80A 1TGZB 3H1UA 1LM8B 4LNIA 4WJPA 2JX5A 3V61A 1FNWA 4K7SA 3U30A 3L17A 4ZHOA 4EZLA 3C19A 4PT5A 1XCTL 4ZRKA 4LTUA 1VZ7A 3TIXA 1MPEA 2XNAC 1JWBD 2NBUA 2M56B 1ZW7A 3DPDA 2KX3A 2LGXA 2X8XX 4KZ0A 2LHDA 1GC6A 1QKZA 3EA6A 1UZXB 2WP9B 3U4EG 3FILB 2WXPA 4C00A 2BQQA 3ZRFA 3PRZA 1RFAA 1ZUD2 4YXDB 1SGHA 1G6JA 2C7NB 2V4LA 2O2VB 4W9KA 4FHKA 4HWIB 4ANWA 1PDXA 3AECB 3APDA 4WIPA 5E6PA 3ETRA 1M4VA 4DWFA 2H88B 5AZFA 5FR3A 2DZJA 2NBWB 2Q5WD 2L1AA 2N9EB 2KMMA 2QILA 4XYCA 2V1YA 3PT2B 1TS5A 4GOCA 2GBNA 2CU1A 2DHZA 4LJOB 4XE0A 3A1QA 2KDEB 2WDTB 5HHDG 1RYJA 2KLGA 3ZGZA 4BOZB 2LXCA 2YVCA 1KFYB 2GBRA 1F52A 2PTLA 2CKHB 3KUCB 5I4DA 3IT4B 3ZJVA 3TUOA 4IM0A 2KNBA 1J8CA 3DOWA 3HK0A 1UH6A 1VJKA 4G0NB 3OAWA 3JW0X 4MGYE 3NRZA 4AS1A 1FD6A 1GOZA 3SHQA 1YX6B 2MBOA 3RFZB 5C2TB 3DBLI 1QOGA 3UI3A 2SAKA 3M63B 1FFUA 2BTEA 5EE0A 2MP2B 2HE7A 3NOBA 3VDZA 1E9MA 2FCNA 4L23A 3B9JA 5IOIA 1YQ3B 3P63A 1JWUD 3BVGA 1S1QB 3P42A 3ZTDA 4C4VB 2INCC 3DHGC 3GS2A 1ESFA 1K8RB 1T6BX 1V86A 1ZDXA 2LWPA 5CHVC 1RRBA 1D3ZA 1KJTA 1IBXA 3L13A 3QQ8B 3TMPB 2PW9A 2LRUA 1NI3A 4MGIE 4RFBA 2RGFA 2UU7A 1MFWA 3UIOB 5IKCM 4JGHB 3AE6B 5BYSA 4ZYSA 5GXGB 1KLUD 4LNNA 4WAFA 2IO0B 4DHJD 4BBNC 5HKHA 2WNMA 4HDQA 5G5GA 1YQ4B 2X38A 1UF0A 3PTFC 1JRPA 2L0TA 3ZNGC 1PYWD 2R2QA 5E6NA 3KQ4A 1MJDA 3DDCB 2LI5A 3ALBA 2KJRA 2L76A 4IUMB 4JWSC 3M95A 3KWVA 1L7YA 2OEDA 1E8YA 3VUXA 4I6NB 2HTME 2M0XA 4YTPB 4G50A 2WXKA 3QIJA 2LGYA 3HM3A 1XO3A 1E0ZA 3GZNI 1LQBA 4RM8A 3TEWA 1ZOYB 3V05A 1JWAD 2PIAA 1LFDA 3RNGC 3VTWA 1WXAA 4BFRA 3ZYYX 3PZDA 1WRDB 2L0FA 1TY0A 1J7CA 4I6PA 3CMMB 2IO2B 4FLHA 2WX1A 2CS4A 4UDUC 1JRUA 3CIRB 2LGDA 3OG5A 3KYDD 1WE6A 1NVID 2N0SB 3AE5B 1I4HA 2IDYA 3GOEA 4DBGA 1UGJA 4KIKB 4J3OD 2MBBB 4NJCA 2OJWA 3MC9A 2GB1A 3ML8A 4DK5A 5J2RA 3AEFB 1EF5A 2RPQA 3WAOA 1XCQL 4BBNF 2FUG1 2R2OA 3A33B 4WWPA 1WZ3A 3N1XC 4USAA 2I38A 2LGIA 2VZKD 3Q3OC 1WR1A 2YEPF 3NZ3A 3HVZA 3PGEA 1KLGD 4HCNB 3WAPA 2GBMA 4AQ7A 2IPKD 3PHWB 4ZRIA 4B0EA 1WY8A 1HZ6A 1WXMA 2DAFA 2IJ0A 1L0YB 4RF1A 3BWUD 2LHEA 3V3XA 1SEBD 1AYFA 1V9JA 2JYEA 3H6NA 4ANXA 3AN1A 3DBLB 3AE7B 1JALA 1N5WA 1I4QA 3DBRI 3ABVB 2JYTA 1MHHE 1V49A 3VQIA 1V97A 3U7DA 2A5UA 4GSWA 3AEEB 2BW2A 1VCBA 1UGMA 4C7YA 3R2IA 3WALA 1HXYD 1RLFA 2Z8LA 2WLBA 3J9CA 4CYEA 4W9FA 4NAWA 1WXQA 4HKQA 3PSEB 2G4SA 2KLCA 1QF6A 2KVZA 2KFKA 2W3RA 3N32A 1OQQA 1ZPSA 3C0RB 4W9EA 1F0ZA 1YJJA 2JWZA 3MHZA 1JMLA 3APFA 3MTNB 3GP7A 2WXMA 1FXTB 2RPVA 3MFGA 4URKA 2KDMA 2RMMA 3NY5A 1JQ4A 1XXGA 2W3SA 2DWQA 3QARA 1FFVA 1C3TA 1PQSA 1I4GA 4X57B 4MACA 3W9CB 2K6QA 4RGOS 4F1SA 3ZDMC 1XQQA 3EFCA 3H7PA 4AP4C 3R8BA 2QMTA 4MJSA 3V60A 1WRIA 4NJ7A 1E6EB 2NBVB 1ZE3D 3LXFA 1C4PA 1YOVB 2TSSA 2L3ZA 3T9LA 2MJ3A 3MC8A 4EEWA 2FIFA 1ISNA 3QCAA 3EC8A 4OVUA 1GAQB 2GBJA 4CHKA 3NVWA 4K7WA 2JXTA 2WDRB 4W9IA 3ZO5B 3GZNB 3P4SB 2JXXA 4NNJB 1Z5SB 3AULA 3SFDB 1WM2A 1D5MC 2QCZA 1N5XA 4KVGB 4YWGG 3MP9A 2BKRB 4BAXA 2K1FA 4DQOC 1JCKB 3TEZA 3A9KB 3VUWA 4HPPA 3DHIC 1HA5A 2L52A 5E6OA 1CZPA 2J0JA 2RD0A 3DVNU 3W5VB 1VR9A 1WR6E 4WQOB 1GPXA 2Y5CA 3M3JA 1C77A 2BS2B 1Q0WB 1KOTA 3VFKA 2KXJA 2UWQA 4ICUA 4HPLB 4RM9A 2WXNA 3QX1A 5HG2A 2QC8A 3T3OA 1FXIA 3BYTB 3VHTC 1YJ1A 2IY0B 3L10B 4IDIA 4A20A 3PHXB 5BMHA 2QIEB 3JYUA 2CJOA 3DVGY 2GOWA 2PKOA 2KMAA 1P3QU 2OOBB 2G3QB 1V1PB 4JIOU 2SEBD 2PPHA 2KX0A 5AZHA 1C4AA 2JT4B 2B3AA 1S3SG 1QZEA 5DPWA 4A55A 1ZGUB 1CK1A 1E10A 1D6EC 3B0AA 3L54A 1VD2A 2IO3B 1PFDA 2LASA 3SU8X 4EOYA 1STEA 1GJZA 5AUKA 5FR6A 3BK2A 5AZGA 4ANUA 2MH7A 1X1MA 1I4XA 2KQ4X 2ONQA 3H9DA 3W2DA 2KFJA 1WGYA 2KKCA 3HRDD 5E6JA 1IPGA 1IUEA 2MHJA 2BT6A 3NVZA 2AQ2B 2RR9A 4RNAA 3DWGC 1PGXA 1WH3A 4WQMA 4XWTA 2D3AA 3BY4B 4A3OA 2AWTA 1V6EA 4NZLB 5AEKB 3ECIA 4OZBA 1UUPA 5D2MB 3FILA 1KLVA 4GDKB 4K81A 1WWTA 4TSSA 1MI0A 1QOAA 4WH4A 3AM9A 4WJQA 1EWCA 2AYOB 2INDC 2N9KA 2C7HA 2G1EA 2O2VA 1SJHD 4JLCA 2D2QA 2MQJA 3VRBB 3K9PB 2KK8A 2GLSA 2IY1B 2KTFA 1DGJA 4TQ0A 2DZMA 2KDIA 2WHIA 5JHAA 4CQNA 3N9YC 1HTOA 3RNAC 1GC7A 2MLBA 3IXSA 1UWMA 3AH7A 3JSVB 2K8CA 3JVZX 1XEEA 4MSMB 2KD0A 3MC0B 1FO4A 2KZRA 3RCZA 5EE1A 4W9HA 4WWMA 1KM7A 1F77A 1FPYA 2DYMA 1F2RI 4E71A 1VRAB 3NHEB 4NJ6A 5KHQA 3I3TB 2K22A 4HJKA 1I4RA 2J52A 3VR8B 3T3NA 1WYGA 1ACCA 3NVYA 4AWJA 1GB1A 2LXAA 2PMVA 3ZDTA 1WJUA 1D5ZC 3U8ZA 4OVVA 2DZKA 1L6UA 4ARCA 2GMIC 2KQ7A 2KAJA 2WXRA 1V1OA 3PPAA 3DHHC 2O6VD 2ACZB 4RMAA 2N7DA 4Q2JA 2OHFA 2HJ8A 3Q6BA 4ZRJA 4K3BA 2KVRA 1WF9A 1L6VA 2MP2A 4B95A 3RD2A 3PS6A 4N58A 1FNVA 2EMTA 2KC1A 2FAZA 3L4PA 3ZNZB 1TZ1A 4MH8A 2L83A 2K3UA 4TQ1A 1CJEA 4S0RA 3UGBB 4WJOA 4C4VA 4MH0E 2KTRA 3Q8EA 3NS8A 4OW0A 2RSUA 4RGNA 1T0SC 4K7UA 1D4BA 1WYWB 2KTRB 3BIID 3RNEC 3PZ7A 1SBBB 5JHBA 2LZ6A 5IP4D 2LMCA 4LNKA 1QT9A 2I1JA 4K1RB 1P7EA 2WGSA 1TTNA 1UELA 4YT0B 3EUB2 3S2AA 3PRMB 1E8XA 4DXFA 2EMSA 3Q69A 1K52A 1EUVB 3Q3MC 4KX6B 2W9NA 4TV3A 3RYTA 2PE9A 1WI0A 1GG3A 1VZ6A 3R3MA 1E8WA 2K5PA 4BVUC 3D32A 5MPOA 4D2KA 1V2YA 4II2B 1PGBA 3WAMA 5FK9C 4C56C 2ZCCA 3HIZA 1H8CA 1CMXB 1R4MI 3RT3B 2LVOA 2BVCA 4GMVA 3BINA 3Q2AC 1QOFA 3RNBC 3SDLC 5JZEB 3GB1A 4MELA 1WIAA 4REZA 2ZPYA 5G2NA 3AEDB 2JZPA 1TS3A 2IGGA 2M19A 5C3JB 2JZ3B 2E3TA 5D6JB 3KLSX 3BYYB 1I42A 1F1HA 2M0AA 1NYQA 3VH4B 3ZNHB 2GBKA 4PS8A 3RNCC 2GRIA 2NR2A 1TS2A 1JWSD 4DHZB 4IM2A 3IVFA 2MCNB 4KSKC 4LJPB 1L0VB 2LJ5A 1DOIA 5IN7A 1YN5A 4B0MA 4A8XC 5G55A 1XLOA 1C79A 4KIKA 2XK5B 1WMHA 2L00B 3NS1A 3X23A 3Q14C 3AE1B 4RGMA 1AW7A 1WMHB 1XD3B 3PZ8A 4ZRPA 2KJHB 2JRIB 2LVQA 2E6XA 4LDTD 3ZUNA 5EDSA 2NMQA 2KWCA 3U7ZA 2NVUI 3GE3C 2K9XA 1GNUA 3KW5B 2GI9A 3ZW3A 3FKYA 4IM3A 2N1VA 2YEPB 1TYGB 1WGKA 2JPHA 2VH2A 3P4RB 2FIDA 4M8MA 1NEKB 3WA0A 3DVGX 1OQYA 4P16A 4F7ZA 2V9HA 1P1AA 5T8IA 3VXWA 2N9PC 2MRPA 1QLBB 2EKIA 1WJNA 2DAJA 1MG8A 4GDLB 2A4ZA 5EE9A 4DHJB 3B1LX 3ZQ4A 2UYZB 3NZSA 3R7QA 1JROA 2BGFA 2Z0DB 3W1SA 4GU2A 2M17A 1I4PA 1FIQA 3DVNV 1PUTA 2N7EA 4BOSC 3OJ4B 1D5XC 1V5TA 3KYCD 2D10A 3HUIA 3X0WA 3VUYA 3RI7C 4RH6A 1E8ZA 5L95C 1TJEA 4ANVA 4OZAA 5LLIA 2BYEA 5HI1A 4MGZE 4FULA 2BKFA 4DDID 3CF6E 3LYYA 4TKNA 2DYOA 4WURA 3PV1A 2FE8A 1EU4A 4MDKE 4FJYA 5J17A 4GB9A 2K8BA 2RDGA 2JWUA 2FUHB 2MJDA 4ZHPA 1J7AA 1Q5WB 2WX0A 4B9KA 2NPTB 4ZOHC 4MT5A 2ZVNA 4KDIC 1HZ5A 1NYRA 1ROEA 2ON8A 5BYRA 1WM3A 4IKGA 3I57A 2N9XA 1ZXIA 2EELA 2WXLA 3A9JA 1EF1A 3SEBA 2NS5A 5D94A 1MG4A 1JW9D 3DBSA 3B2GA 3A9JB 3OWEB 5D3IB 5CHWA 2DENB 1TKGA 3C8YA 1BUIC 1N63A 3EHVA 3TJPA 1R4MB 1HQRD 2DBYA 3IG3A 5AUIA 2JQRB 2KQSA 1H4RA 3K9OB 3B2FA 3EECA 2VZKB 2BWFA 4A90A 2C7MB 2JUOA 1ENFA 2ZCBA 4AJYB 1C4CA 5D3DA 4IWQA 2HTHA 2J7QB 2LD9A 2L8JA 2HDEA 2ZNVB 2NTSA 3L16A 1NENB 3QAQA 2IGHA 1YQBA 2K6DB 3W5UB 3T8MA 4IW0A 4B6WA 4PS3A 4NQLB 1TBEA 4AJWA 1VZ8A 2KWDA 3A9KA 4IWPA 4M0WB 1N61A 5C1ZA 1RFKA 2LUEA 4GIVA 1HEZE 3ML9A 4NAMA 1IP9A 2NCNA 2J42A 1JWMD 4FJVB 3VTUA 2ZJDA 3NZUA 1E90A 2MJEA 2ZEQA 2CJNA 2YLMA 3LJ3A 5EE3A 3WANA 4R3DA 2MEKA 2L32A 4DDGD 4OZCA 3PLVA 3APCA 1RWSA 5H8YE 4EKUA 4WWNA 1AWDA 2C60A 4US9A 4FHJA 2PVGC 1TY2A 4J6IA 2BPSA 4L1BA 1L4ZB 3SFEB 1V1PA 1CQVA 4XZ4A 2V3NA 2Y3AA 1SJED 1B1ZA 4MM3B 1P98A 3VRAB 2KN4A 2KN5A 2HD5B 1WX9A 4NQKE 2KOXA 1A70A 1BMLC 2AQ1B 1SE4A 3AE9B 3URYA 2WDQB 3RULA 2L05A 5BMGA 3L0WB 1QILA 2HJ1A 3RUIB 3NVVA 4MSQB 3TCAA 3ZVVA 2Z59B 2PEAA 4FBJB 1KTKA 3PREA 1MHXA 2IBIB 2LFIA 4FN2A 4HK2A 4C7ZA 1R4NB 2IZVB 3VTVA 2MX2A 2AL6A 1N6ZA 1WGRA 2Z0EB 3TEXA 2KWVB 2FBWB 3DBHI 1L5PA 5GMVA 2BS4B 1I35A 4XC2A 3NG0A 3CSFA 1LGRA 1Q10A 1SE9A 3E9SA 1IGCA 3LDZE 1Y8RC 1AARA 1FMAD 4GDKA 4XX5A 1WGDA 1YMHE 3MHSD 2XN9C 4OVZA 3PRPB 1V8CA 3BZDB 1WX8A 1U4AA 4TMAB 2Y5PA 4HKZE 1V5OA 1LXDA 1F9JA 1RM6C 4LNFA 3P1MA 1C78A 5D7GA 1WJ6A 3VAWA 4KSLC 2IYDB 3BVZA 3MJ5A 3AE2B 2OJRA 3OJ3A 1SSNA 2VH1A 2H89B 5H92C 1YX5B 3KWLA 3V6CB 4A6QA 2AX5A 1E7PB 3JSVA 3UIPB 4OHJA 3Q8FA 1TKYA 1EM7A 5G5HA 3LB8C 2C5LC 2J0MA 1Q1OA 4G3XB 2WU5B 4HROA 4MGKE 4US8A 5BYQA 2JY6A 1HTQA 3AU5A 2MBQA 2JRHA 4HRSA 2K25A 5BO4B 3QHTA 2QSDA 4BKSA 3HM6X 1NI2A 2LGSA 1FXAA 2INPE 4FJZA 1WX7A 2ASQA 1V81A 4ARIA 2KJ6A 4ZYNA 1UWXA 3P4PB 3CSTA 2JU6X 2N7JA 5JXVA 2DNFA 1KH0A 2BB5A 1HE8A 2CHXA 4PYZA 3RMKC 2ZW1A 2LUMA 1WFYA 5DPRA 5HFYA 3ZJUA 4HEA1 5DCNA 4W9GA 3EGRA 2WQYB 4EZKA 4FA6A 4ACFA 2V3SA 1ET9A 1ZKHA 3A1QB 3DQVA 3WCQA 4HDOA 3AMZA 3N1YC 2LJIA 5CX3A 1ZDVA 4WJNA 4XWWA 2WYQA 4A3PA 4W9CA 4NY0A 2KDFB 1BT0A 3QJZA 1RAXA 1IYFA 2M4NA 2N4FA 4PS7A 4IOIE 2FCMA 1OEYA 4KZCA 1P7FA 5C23A 2C9WB 2D3BA 2K8HA 2MBEA 1QQRA 4IC7B 4W9LA 4ZRQA 2W54A 3PO0A 2BYVE 1KF6B 4BKGA 3O65B 1E5WA 1TZOA 1EO6A 2PE6B 4JE3B 2KANA 4P6VF 4P1CC 3ZKJC 2K0PA 3UQBA 1ET6A 1SF0A 1T5XD 3L08A 2D07B 2V4IB 1OEYJ 3AEBB 2REXA 5J18A 4HVBA 2V3PA 3AE8B 4LCDE 2KWUB 3IHPC 1IBXB 4XDDA 1T0QC 3OLMD 3A4RA 3DBHB 2D3GA 2MBHA 1YIWA 1UBIA 2JSVX 2WS3B 5KHOA 1P0RA 3VH3B 2CHWA 4PK1A 5LXIB 2WXJA 2QDFA 2EKEC 4HJGE 3Q8BA 3R66C 3AV8A 2XEWA 2KYWA 2MW5A 4M00A 1E7UA 4KGSA 4YSXB 4FXCA 2DX5B 3R2TA 5L83A 3HHMA 1N60A 3R7RA 1PGAA 3IT6B 1F2RC 3KH0A 1C1YB 1N62A 2O6VA 3RZWC 4ASWC 2FCSA 1XT9B 2MSED 1ZXHA 4L2YA 1Z2MA 3W1YA 1QOBA 1FM0D 2O6VB 1T0RC 1FCLA 1WGGA 4DXGA 2XK5A 4GN1A 4HCPB 2L7RA 4I6LB 3N30A 4IG7B 3QK0A 3TSSA 4KGTA 1GB4A 2LRWA 4EE2A 3P2BA 1SE2A 1WJ4A 2QEJC 4GGQA 3Q3FA 3IAS1 3E56A 1C76A 4QAYA 5LNK1 4JX1C 2NTTA 3A4SC 1TIFA 2BBCA 2CU3A 3BK1A 4KV2A 1EWYC 4MEMA 4YSZB 3AI5A 2INNE 3W1SC 3AU4A
chains in the Genus database with same CATH topology
3GE3C 3RMKC 3Q3MC 3N1XC 3RNEC 3RN9C 3I63C 3RI7C 3Q14C 3Q2AC 4P1BC 3RNFC 3RNGC 3I5JC 2INCC 3Q3OC 3RNCC 3RNBC 3DHHC 3GE8C 1T0RC 2INDC 3Q3NC 3RNAC 1T0QC 3N20C 3DHIC 4P1CC 3N1YC 1T0SC 2RDBC 3N1ZC 3DHGC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GE3 C;  3RMK C;  3Q3M C;  3N1X C;  3RNE C;  3RN9 C;  3I63 C;  3RI7 C;  3Q14 C;  3Q2A C;  4P1B C;  3RNF C;  3RNG C;  3I5J C;  2INC C;  3Q3O C;  3RNC C;  3RNB C;  3DHH C;  3GE8 C;  1T0R C;  2IND C;  3Q3N C;  3RNA C;  1T0Q C;  3N20 C;  3DHI C;  4P1C C;  3N1Y C;  1T0S C;  2RDB C;  3N1Z C;  3DHG C; 
#chains in the Genus database with same CATH topology
 2WXF A;  4LLG M;  3VVW B;  4S17 A;  4LNO A;  2BB6 A;  3KUZ A;  4IWO A;  3AE3 B;  1NDD A;  4KGR A;  3NUH B;  1UBQ A;  1TKE A;  4XGA B;  1YN3 A;  2D3C A;  3V62 A;  3UQA A;  1WSP A;  5JH5 C;  2JF5 A;  3N20 C;  4XDC A;  4AUQ C;  1GUA B;  1J0G A;  1T0Y A;  3O13 A;  3ZXR A;  5BMI A;  2G45 B;  4GDL A;  1WXV A;  3AB5 A;  1B9R A;  2M8S A;  2KT7 A;  5TSS A;  1WXS A;  4JL9 A;  1NBF C;  5DPS A;  2KMC A;  3IBE A;  3ZTC A;  4RGT A;  3KUD B;  1XLN A;  2AQ3 B;  2M1M A;  2WXI A;  1YN4 A;  1XF5 L;  3SD5 A;  1J7B A;  2BYT A;  1R4N I;  1K51 A;  4HLE A;  2D5G A;  1A5R A;  3AXC A;  4RCO A;  3HVD A;  3TL5 A;  3UIN B;  3SR6 A;  3I9V 1;  4KDL B;  3KVF B;  1E7V A;  3ENE A;  3GE8 C;  1LO5 D;  3Q3N C;  2J0K A;  3H8H A;  2KDB A;  3ONS A;  4ICV A;  3U2S C;  2MA9 B;  1YNT E;  3AE4 B;  2KC2 A;  1I7H A;  3AEG B;  3ZJT A;  1R7S A;  3Q8C A;  3FAH A;  2BWE S;  2DZI A;  4E74 A;  1WE7 A;  2NPT A;  2LVP A;  3M62 B;  5DPT A;  2QJL A;  2Y5B B;  3Q3J A;  5CHF A;  4F8C B;  1AN8 A;  1C9F A;  2G4D B;  2I1K A;  1VDV A;  4GXB A;  3B08 A;  2ZNV C;  4P7I A;  4JPS A;  1P9D U;  5IA7 A;  2PVO D;  3WIM A;  4CO7 A;  1SE3 A;  2PLP A;  2W82 A;  2B76 B;  4YSY B;  4NAW B;  3N1Z C;  3BVM A;  4BZA A;  1BXT A;  4YTM B;  4KKI A;  1WGH A;  2WXQ A;  4WAA A;  2KFK B;  2DLB A;  2RDH A;  1J19 A;  3IAM 1;  4DHZ E;  2QHO A;  4N9F 4;  2AL3 A;  4HXD A;  1OTR B;  1SIF A;  2AEH A;  3ZIM A;  4N59 A;  4LDT B;  3RPF C;  1IGD A;  2WDV B;  4JWU C;  3PLU A;  2D11 A;  3I63 C;  1UD7 A;  4LK0 M;  1YJI A;  1UNS A;  4EFO A;  1TT5 B;  2V0G A;  1XLQ A;  3TEY A;  4JQW C;  4G11 A;  3QWZ B;  4H2A A;  4HPM B;  1OQR A;  2PJH A;  2VRR B;  3H7P B;  4MJS B;  2N1W A;  1L2N A;  2I2Y A;  1EU3 A;  3AEA B;  1MVK A;  4M0W A;  1K50 A;  3TBL D;  4EZJ A;  3N3K B;  4WWO A;  4A9A A;  3CWI A;  3MJW A;  4W9J A;  3DWM A;  4M8N A;  4II3 B;  2WWZ A;  1SIJ A;  4NPN A;  1FRD A;  2LEK A;  4EUT A;  2N9L A;  5TR5 A;  2RDB C;  2ZZP B;  1SXT A;  4RF0 A;  3ZNI D;  4C80 A;  3IFW B;  2J4X A;  2BYF A;  2ICI A;  4E3C A;  2J53 A;  3QC8 B;  4N6E B;  4P1B C;  2ZW0 A;  3I5J C;  2WXH A;  1SB3 C;  3NJT A;  4KKJ A;  3H7S A;  3Q8A A;  5IAA C;  4GLS C;  3QA8 A;  4MM3 A;  3DCG A;  2WXO A;  3VR9 B;  3ZLZ A;  2WXG A;  4M02 A;  1ZP0 B;  5CTR C;  1OGW A;  2JZZ A;  3ZXV A;  5LXH A;  1VLB A;  2G9H D;  2JVC A;  2W55 A;  1OFF A;  2ZPN A;  3V6E B;  3FC4 A;  4K3C A;  2XBB C;  1DYQ A;  2FCQ A;  4AOF A;  1KRH A;  2R61 A;  2BF8 B;  1FRR A;  4W9D A;  2K39 A;  3PVL A;  3EFU A;  2DYB A;  2KHW B;  2FNJ B;  1L4D B;  1TS4 A;  4O1N A;  4PYU A;  1DOY A;  1DOX A;  1WZ0 A;  2WU2 B;  4BKS D;  4YTN B;  4YL8 A;  4BKT A;  2ZVO A;  3RZF A;  4TUU A;  2BS3 B;  4DXA B;  4ZDV A;  1K53 A;  1FCC C;  1FNU A;  1FEH A;  4FAD A;  2CR5 A;  4M01 A;  4ITK A;  1Y56 A;  1YD8 U;  5IO9 A;  2IO1 B;  3RN9 C;  3P4Q B;  2KO3 A;  3RNF C;  1T3Q A;  2MWS B;  1L0X B;  2KAC A;  2CHZ A;  3ZRC A;  3U52 E;  1M94 A;  3DBR B;  2IGD A;  3UF8 A;  1XLP A;  5FKA C;  1V80 A;  1TGZ B;  3H1U A;  1LM8 B;  4LNI A;  4WJP A;  2JX5 A;  3V61 A;  1FNW A;  4K7S A;  3U30 A;  3L17 A;  4ZHO A;  4EZL A;  3C19 A;  4PT5 A;  1XCT L;  4ZRK A;  4LTU A;  1VZ7 A;  3TIX A;  1MPE A;  2XNA C;  1JWB D;  2NBU A;  2M56 B;  1ZW7 A;  3DPD A;  2KX3 A;  2LGX A;  2X8X X;  4KZ0 A;  2LHD A;  1GC6 A;  1QKZ A;  3EA6 A;  1UZX B;  2WP9 B;  3U4E G;  3FIL B;  2WXP A;  4C00 A;  2BQQ A;  3ZRF A;  3PRZ A;  1RFA A;  1ZUD 2;  4YXD B;  1SGH A;  1G6J A;  2C7N B;  2V4L A;  2O2V B;  4W9K A;  4FHK A;  4HWI B;  4ANW A;  1PDX A;  3AEC B;  3APD A;  4WIP A;  5E6P A;  3ETR A;  1M4V A;  4DWF A;  2H88 B;  5AZF A;  5FR3 A;  2DZJ A;  2NBW B;  2Q5W D;  2L1A A;  2N9E B;  2KMM A;  2QIL A;  4XYC A;  2V1Y A;  3PT2 B;  1TS5 A;  4GOC A;  2GBN A;  2CU1 A;  2DHZ A;  4LJO B;  4XE0 A;  3A1Q A;  2KDE B;  2WDT B;  5HHD G;  1RYJ A;  2KLG A;  3ZGZ A;  4BOZ B;  2LXC A;  2YVC A;  1KFY B;  2GBR A;  1F52 A;  2PTL A;  2CKH B;  3KUC B;  5I4D A;  3IT4 B;  3ZJV A;  3TUO A;  4IM0 A;  2KNB A;  1J8C A;  3DOW A;  3HK0 A;  1UH6 A;  1VJK A;  4G0N B;  3OAW A;  3JW0 X;  4MGY E;  3NRZ A;  4AS1 A;  1FD6 A;  1GOZ A;  3SHQ A;  1YX6 B;  2MBO A;  3RFZ B;  5C2T B;  3DBL I;  1QOG A;  3UI3 A;  2SAK A;  3M63 B;  1FFU A;  2BTE A;  5EE0 A;  2MP2 B;  2HE7 A;  3NOB A;  3VDZ A;  1E9M A;  2FCN A;  4L23 A;  3B9J A;  5IOI A;  1YQ3 B;  3P63 A;  1JWU D;  3BVG A;  1S1Q B;  3P42 A;  3ZTD A;  4C4V B;  2INC C;  3DHG C;  3GS2 A;  1ESF A;  1K8R B;  1T6B X;  1V86 A;  1ZDX A;  2LWP A;  5CHV C;  1RRB A;  1D3Z A;  1KJT A;  1IBX A;  3L13 A;  3QQ8 B;  3TMP B;  2PW9 A;  2LRU A;  1NI3 A;  4MGI E;  4RFB A;  2RGF A;  2UU7 A;  1MFW A;  3UIO B;  5IKC M;  4JGH B;  3AE6 B;  5BYS A;  4ZYS A;  5GXG B;  1KLU D;  4LNN A;  4WAF A;  2IO0 B;  4DHJ D;  4BBN C;  5HKH A;  2WNM A;  4HDQ A;  5G5G A;  1YQ4 B;  2X38 A;  1UF0 A;  3PTF C;  1JRP A;  2L0T A;  3ZNG C;  1PYW D;  2R2Q A;  5E6N A;  3KQ4 A;  1MJD A;  3DDC B;  2LI5 A;  3ALB A;  2KJR A;  2L76 A;  4IUM B;  4JWS C;  3M95 A;  3KWV A;  1L7Y A;  2OED A;  1E8Y A;  3VUX A;  4I6N B;  2HTM E;  2M0X A;  4YTP B;  4G50 A;  2WXK A;  3QIJ A;  2LGY A;  3HM3 A;  1XO3 A;  1E0Z A;  3GZN I;  1LQB A;  4RM8 A;  3TEW A;  1ZOY B;  3V05 A;  1JWA D;  2PIA A;  1LFD A;  3RNG C;  3VTW A;  1WXA A;  4BFR A;  3ZYY X;  3PZD A;  1WRD B;  2L0F A;  1TY0 A;  1J7C A;  4I6P A;  3CMM B;  2IO2 B;  4FLH A;  2WX1 A;  2CS4 A;  4UDU C;  1JRU A;  3CIR B;  2LGD A;  3OG5 A;  3KYD D;  1WE6 A;  1NVI D;  2N0S B;  3AE5 B;  1I4H A;  2IDY A;  3GOE A;  4DBG A;  1UGJ A;  4KIK B;  4J3O D;  2MBB B;  4NJC A;  2OJW A;  3MC9 A;  2GB1 A;  3ML8 A;  4DK5 A;  5J2R A;  3AEF B;  1EF5 A;  2RPQ A;  3WAO A;  1XCQ L;  4BBN F;  2FUG 1;  2R2O A;  3A33 B;  4WWP A;  1WZ3 A;  3N1X C;  4USA A;  2I38 A;  2LGI A;  2VZK D;  3Q3O C;  1WR1 A;  2YEP F;  3NZ3 A;  3HVZ A;  3PGE A;  1KLG D;  4HCN B;  3WAP A;  2GBM A;  4AQ7 A;  2IPK D;  3PHW B;  4ZRI A;  4B0E A;  1WY8 A;  1HZ6 A;  1WXM A;  2DAF A;  2IJ0 A;  1L0Y B;  4RF1 A;  3BWU D;  2LHE A;  3V3X A;  1SEB D;  1AYF A;  1V9J A;  2JYE A;  3H6N A;  4ANX A;  3AN1 A;  3DBL B;  3AE7 B;  1JAL A;  1N5W A;  1I4Q A;  3DBR I;  3ABV B;  2JYT A;  1MHH E;  1V49 A;  3VQI A;  1V97 A;  3U7D A;  2A5U A;  4GSW A;  3AEE B;  2BW2 A;  1VCB A;  1UGM A;  4C7Y A;  3R2I A;  3WAL A;  1HXY D;  1RLF A;  2Z8L A;  2WLB A;  3J9C A;  4CYE A;  4W9F A;  4NAW A;  1WXQ A;  4HKQ A;  3PSE B;  2G4S A;  2KLC A;  1QF6 A;  2KVZ A;  2KFK A;  2W3R A;  3N32 A;  1OQQ A;  1ZPS A;  3C0R B;  4W9E A;  1F0Z A;  1YJJ A;  2JWZ A;  3MHZ A;  1JML A;  3APF A;  3MTN B;  3GP7 A;  2WXM A;  1FXT B;  2RPV A;  3MFG A;  4URK A;  2KDM A;  2RMM A;  3NY5 A;  1JQ4 A;  1XXG A;  2W3S A;  2DWQ A;  3QAR A;  1FFV A;  1C3T A;  1PQS A;  1I4G A;  4X57 B;  4MAC A;  3W9C B;  2K6Q A;  4RGO S;  4F1S A;  3ZDM C;  1XQQ A;  3EFC A;  3H7P A;  4AP4 C;  3R8B A;  2QMT A;  4MJS A;  3V60 A;  1WRI A;  4NJ7 A;  1E6E B;  2NBV B;  1ZE3 D;  3LXF A;  1C4P A;  1YOV B;  2TSS A;  2L3Z A;  3T9L A;  2MJ3 A;  3MC8 A;  4EEW A;  2FIF A;  1ISN A;  3QCA A;  3EC8 A;  4OVU A;  1GAQ B;  2GBJ A;  4CHK A;  3NVW A;  4K7W A;  2JXT A;  2WDR B;  4W9I A;  3ZO5 B;  3GZN B;  3P4S B;  2JXX A;  4NNJ B;  1Z5S B;  3AUL A;  3SFD B;  1WM2 A;  1D5M C;  2QCZ A;  1N5X A;  4KVG B;  4YWG G;  3MP9 A;  2BKR B;  4BAX A;  2K1F A;  4DQO C;  1JCK B;  3TEZ A;  3A9K B;  3VUW A;  4HPP A;  3DHI C;  1HA5 A;  2L52 A;  5E6O A;  1CZP A;  2J0J A;  2RD0 A;  3DVN U;  3W5V B;  1VR9 A;  1WR6 E;  4WQO B;  1GPX A;  2Y5C A;  3M3J A;  1C77 A;  2BS2 B;  1Q0W B;  1KOT A;  3VFK A;  2KXJ A;  2UWQ A;  4ICU A;  4HPL B;  4RM9 A;  2WXN A;  3QX1 A;  5HG2 A;  2QC8 A;  3T3O A;  1FXI A;  3BYT B;  3VHT C;  1YJ1 A;  2IY0 B;  3L10 B;  4IDI A;  4A20 A;  3PHX B;  5BMH A;  2QIE B;  3JYU A;  2CJO A;  3DVG Y;  2GOW A;  2PKO A;  2KMA A;  1P3Q U;  2OOB B;  2G3Q B;  1V1P B;  4JIO U;  2SEB D;  2PPH A;  2KX0 A;  5AZH A;  1C4A A;  2JT4 B;  2B3A A;  1S3S G;  1QZE A;  5DPW A;  4A55 A;  1ZGU B;  1CK1 A;  1E10 A;  1D6E C;  3B0A A;  3L54 A;  1VD2 A;  2IO3 B;  1PFD A;  2LAS A;  3SU8 X;  4EOY A;  1STE A;  1GJZ A;  5AUK A;  5FR6 A;  3BK2 A;  5AZG A;  4ANU A;  2MH7 A;  1X1M A;  1I4X A;  2KQ4 X;  2ONQ A;  3H9D A;  3W2D A;  2KFJ A;  1WGY A;  2KKC A;  3HRD D;  5E6J A;  1IPG A;  1IUE A;  2MHJ A;  2BT6 A;  3NVZ A;  2AQ2 B;  2RR9 A;  4RNA A;  3DWG C;  1PGX A;  1WH3 A;  4WQM A;  4XWT A;  2D3A A;  3BY4 B;  4A3O A;  2AWT A;  1V6E A;  4NZL B;  5AEK B;  3ECI A;  4OZB A;  1UUP A;  5D2M B;  3FIL A;  1KLV A;  4GDK B;  4K81 A;  1WWT A;  4TSS A;  1MI0 A;  1QOA A;  4WH4 A;  3AM9 A;  4WJQ A;  1EWC A;  2AYO B;  2IND C;  2N9K A;  2C7H A;  2G1E A;  2O2V A;  1SJH D;  4JLC A;  2D2Q A;  2MQJ A;  3VRB B;  3K9P B;  2KK8 A;  2GLS A;  2IY1 B;  2KTF A;  1DGJ A;  4TQ0 A;  2DZM A;  2KDI A;  2WHI A;  5JHA A;  4CQN A;  3N9Y C;  1HTO A;  3RNA C;  1GC7 A;  2MLB A;  3IXS A;  1UWM A;  3AH7 A;  3JSV B;  2K8C A;  3JVZ X;  1XEE A;  4MSM B;  2KD0 A;  3MC0 B;  1FO4 A;  2KZR A;  3RCZ A;  5EE1 A;  4W9H A;  4WWM A;  1KM7 A;  1F77 A;  1FPY A;  2DYM A;  1F2R I;  4E71 A;  1VRA B;  3NHE B;  4NJ6 A;  5KHQ A;  3I3T B;  2K22 A;  4HJK A;  1I4R A;  2J52 A;  3VR8 B;  3T3N A;  1WYG A;  1ACC A;  3NVY A;  4AWJ A;  1GB1 A;  2LXA A;  2PMV A;  3ZDT A;  1WJU A;  1D5Z C;  3U8Z A;  4OVV A;  2DZK A;  1L6U A;  4ARC A;  2GMI C;  2KQ7 A;  2KAJ A;  2WXR A;  1V1O A;  3PPA A;  3DHH C;  2O6V D;  2ACZ B;  4RMA A;  2N7D A;  4Q2J A;  2OHF A;  2HJ8 A;  3Q6B A;  4ZRJ A;  4K3B A;  2KVR A;  1WF9 A;  1L6V A;  2MP2 A;  4B95 A;  3RD2 A;  3PS6 A;  4N58 A;  1FNV A;  2EMT A;  2KC1 A;  2FAZ A;  3L4P A;  3ZNZ B;  1TZ1 A;  4MH8 A;  2L83 A;  2K3U A;  4TQ1 A;  1CJE A;  4S0R A;  3UGB B;  4WJO A;  4C4V A;  4MH0 E;  2KTR A;  3Q8E A;  3NS8 A;  4OW0 A;  2RSU A;  4RGN A;  1T0S C;  4K7U A;  1D4B A;  1WYW B;  2KTR B;  3BII D;  3RNE C;  3PZ7 A;  1SBB B;  5JHB A;  2LZ6 A;  5IP4 D;  2LMC A;  4LNK A;  1QT9 A;  2I1J A;  4K1R B;  1P7E A;  2WGS A;  1TTN A;  1UEL A;  4YT0 B;  3EUB 2;  3S2A A;  3PRM B;  1E8X A;  4DXF A;  2EMS A;  3Q69 A;  1K52 A;  1EUV B;  3Q3M C;  4KX6 B;  2W9N A;  4TV3 A;  3RYT A;  2PE9 A;  1WI0 A;  1GG3 A;  1VZ6 A;  3R3M A;  1E8W A;  2K5P A;  4BVU C;  3D32 A;  5MPO A;  4D2K A;  1V2Y A;  4II2 B;  1PGB A;  3WAM A;  5FK9 C;  4C56 C;  2ZCC A;  3HIZ A;  1H8C A;  1CMX B;  1R4M I;  3RT3 B;  2LVO A;  2BVC A;  4GMV A;  3BIN A;  3Q2A C;  1QOF A;  3RNB C;  3SDL C;  5JZE B;  3GB1 A;  4MEL A;  1WIA A;  4REZ A;  2ZPY A;  5G2N A;  3AED B;  2JZP A;  1TS3 A;  2IGG A;  2M19 A;  5C3J B;  2JZ3 B;  2E3T A;  5D6J B;  3KLS X;  3BYY B;  1I42 A;  1F1H A;  2M0A A;  1NYQ A;  3VH4 B;  3ZNH B;  2GBK A;  4PS8 A;  3RNC C;  2GRI A;  2NR2 A;  1TS2 A;  1JWS D;  4DHZ B;  4IM2 A;  3IVF A;  2MCN B;  4KSK C;  4LJP B;  1L0V B;  2LJ5 A;  1DOI A;  5IN7 A;  1YN5 A;  4B0M A;  4A8X C;  5G55 A;  1XLO A;  1C79 A;  4KIK A;  2XK5 B;  1WMH A;  2L00 B;  3NS1 A;  3X23 A;  3Q14 C;  3AE1 B;  4RGM A;  1AW7 A;  1WMH B;  1XD3 B;  3PZ8 A;  4ZRP A;  2KJH B;  2JRI B;  2LVQ A;  2E6X A;  4LDT D;  3ZUN A;  5EDS A;  2NMQ A;  2KWC A;  3U7Z A;  2NVU I;  3GE3 C;  2K9X A;  1GNU A;  3KW5 B;  2GI9 A;  3ZW3 A;  3FKY A;  4IM3 A;  2N1V A;  2YEP B;  1TYG B;  1WGK A;  2JPH A;  2VH2 A;  3P4R B;  2FID A;  4M8M A;  1NEK B;  3WA0 A;  3DVG X;  1OQY A;  4P16 A;  4F7Z A;  2V9H A;  1P1A A;  5T8I A;  3VXW A;  2N9P C;  2MRP A;  1QLB B;  2EKI A;  1WJN A;  2DAJ A;  1MG8 A;  4GDL B;  2A4Z A;  5EE9 A;  4DHJ B;  3B1L X;  3ZQ4 A;  2UYZ B;  3NZS A;  3R7Q A;  1JRO A;  2BGF A;  2Z0D B;  3W1S A;  4GU2 A;  2M17 A;  1I4P A;  1FIQ A;  3DVN V;  1PUT A;  2N7E A;  4BOS C;  3OJ4 B;  1D5X C;  1V5T A;  3KYC D;  2D10 A;  3HUI A;  3X0W A;  3VUY A;  3RI7 C;  4RH6 A;  1E8Z A;  5L95 C;  1TJE A;  4ANV A;  4OZA A;  5LLI A;  2BYE A;  5HI1 A;  4MGZ E;  4FUL A;  2BKF A;  4DDI D;  3CF6 E;  3LYY A;  4TKN A;  2DYO A;  4WUR A;  3PV1 A;  2FE8 A;  1EU4 A;  4MDK E;  4FJY A;  5J17 A;  4GB9 A;  2K8B A;  2RDG A;  2JWU A;  2FUH B;  2MJD A;  4ZHP A;  1J7A A;  1Q5W B;  2WX0 A;  4B9K A;  2NPT B;  4ZOH C;  4MT5 A;  2ZVN A;  4KDI C;  1HZ5 A;  1NYR A;  1ROE A;  2ON8 A;  5BYR A;  1WM3 A;  4IKG A;  3I57 A;  2N9X A;  1ZXI A;  2EEL A;  2WXL A;  3A9J A;  1EF1 A;  3SEB A;  2NS5 A;  5D94 A;  1MG4 A;  1JW9 D;  3DBS A;  3B2G A;  3A9J B;  3OWE B;  5D3I B;  5CHW A;  2DEN B;  1TKG A;  3C8Y A;  1BUI C;  1N63 A;  3EHV A;  3TJP A;  1R4M B;  1HQR D;  2DBY A;  3IG3 A;  5AUI A;  2JQR B;  2KQS A;  1H4R A;  3K9O B;  3B2F A;  3EEC A;  2VZK B;  2BWF A;  4A90 A;  2C7M B;  2JUO A;  1ENF A;  2ZCB A;  4AJY B;  1C4C A;  5D3D A;  4IWQ A;  2HTH A;  2J7Q B;  2LD9 A;  2L8J A;  2HDE A;  2ZNV B;  2NTS A;  3L16 A;  1NEN B;  3QAQ A;  2IGH A;  1YQB A;  2K6D B;  3W5U B;  3T8M A;  4IW0 A;  4B6W A;  4PS3 A;  4NQL B;  1TBE A;  4AJW A;  1VZ8 A;  2KWD A;  3A9K A;  4IWP A;  4M0W B;  1N61 A;  5C1Z A;  1RFK A;  2LUE A;  4GIV A;  1HEZ E;  3ML9 A;  4NAM A;  1IP9 A;  2NCN A;  2J42 A;  1JWM D;  4FJV B;  3VTU A;  2ZJD A;  3NZU A;  1E90 A;  2MJE A;  2ZEQ A;  2CJN A;  2YLM A;  3LJ3 A;  5EE3 A;  3WAN A;  4R3D A;  2MEK A;  2L32 A;  4DDG D;  4OZC A;  3PLV A;  3APC A;  1RWS A;  5H8Y E;  4EKU A;  4WWN A;  1AWD A;  2C60 A;  4US9 A;  4FHJ A;  2PVG C;  1TY2 A;  4J6I A;  2BPS A;  4L1B A;  1L4Z B;  3SFE B;  1V1P A;  1CQV A;  4XZ4 A;  2V3N A;  2Y3A A;  1SJE D;  1B1Z A;  4MM3 B;  1P98 A;  3VRA B;  2KN4 A;  2KN5 A;  2HD5 B;  1WX9 A;  4NQK E;  2KOX A;  1A70 A;  1BML C;  2AQ1 B;  1SE4 A;  3AE9 B;  3URY A;  2WDQ B;  3RUL A;  2L05 A;  5BMG A;  3L0W B;  1QIL A;  2HJ1 A;  3RUI B;  3NVV A;  4MSQ B;  3TCA A;  3ZVV A;  2Z59 B;  2PEA A;  4FBJ B;  1KTK A;  3PRE A;  1MHX A;  2IBI B;  2LFI A;  4FN2 A;  4HK2 A;  4C7Z A;  1R4N B;  2IZV B;  3VTV A;  2MX2 A;  2AL6 A;  1N6Z A;  1WGR A;  2Z0E B;  3TEX A;  2KWV B;  2FBW B;  3DBH I;  1L5P A;  5GMV A;  2BS4 B;  1I35 A;  4XC2 A;  3NG0 A;  3CSF A;  1LGR A;  1Q10 A;  1SE9 A;  3E9S A;  1IGC A;  3LDZ E;  1Y8R C;  1AAR A;  1FMA D;  4GDK A;  4XX5 A;  1WGD A;  1YMH E;  3MHS D;  2XN9 C;  4OVZ A;  3PRP B;  1V8C A;  3BZD B;  1WX8 A;  1U4A A;  4TMA B;  2Y5P A;  4HKZ E;  1V5O A;  1LXD A;  1F9J A;  1RM6 C;  4LNF A;  3P1M A;  1C78 A;  5D7G A;  1WJ6 A;  3VAW A;  4KSL C;  2IYD B;  3BVZ A;  3MJ5 A;  3AE2 B;  2OJR A;  3OJ3 A;  1SSN A;  2VH1 A;  2H89 B;  5H92 C;  1YX5 B;  3KWL A;  3V6C B;  4A6Q A;  2AX5 A;  1E7P B;  3JSV A;  3UIP B;  4OHJ A;  3Q8F A;  1TKY A;  1EM7 A;  5G5H A;  3LB8 C;  2C5L C;  2J0M A;  1Q1O A;  4G3X B;  2WU5 B;  4HRO A;  4MGK E;  4US8 A;  5BYQ A;  2JY6 A;  1HTQ A;  3AU5 A;  2MBQ A;  2JRH A;  4HRS A;  2K25 A;  5BO4 B;  3QHT A;  2QSD A;  4BKS A;  3HM6 X;  1NI2 A;  2LGS A;  1FXA A;  2INP E;  4FJZ A;  1WX7 A;  2ASQ A;  1V81 A;  4ARI A;  2KJ6 A;  4ZYN A;  1UWX A;  3P4P B;  3CST A;  2JU6 X;  2N7J A;  5JXV A;  2DNF A;  1KH0 A;  2BB5 A;  1HE8 A;  2CHX A;  4PYZ A;  3RMK C;  2ZW1 A;  2LUM A;  1WFY A;  5DPR A;  5HFY A;  3ZJU A;  4HEA 1;  5DCN A;  4W9G A;  3EGR A;  2WQY B;  4EZK A;  4FA6 A;  4ACF A;  2V3S A;  1ET9 A;  1ZKH A;  3A1Q B;  3DQV A;  3WCQ A;  4HDO A;  3AMZ A;  3N1Y C;  2LJI A;  5CX3 A;  1ZDV A;  4WJN A;  4XWW A;  2WYQ A;  4A3P A;  4W9C A;  4NY0 A;  2KDF B;  1BT0 A;  3QJZ A;  1RAX A;  1IYF A;  2M4N A;  2N4F A;  4PS7 A;  4IOI E;  2FCM A;  1OEY A;  4KZC A;  1P7F A;  5C23 A;  2C9W B;  2D3B A;  2K8H A;  2MBE A;  1QQR A;  4IC7 B;  4W9L A;  4ZRQ A;  2W54 A;  3PO0 A;  2BYV E;  1KF6 B;  4BKG A;  3O65 B;  1E5W A;  1TZO A;  1EO6 A;  2PE6 B;  4JE3 B;  2KAN A;  4P6V F;  4P1C C;  3ZKJ C;  2K0P A;  3UQB A;  1ET6 A;  1SF0 A;  1T5X D;  3L08 A;  2D07 B;  2V4I B;  1OEY J;  3AEB B;  2REX A;  5J18 A;  4HVB A;  2V3P A;  3AE8 B;  4LCD E;  2KWU B;  3IHP C;  1IBX B;  4XDD A;  1T0Q C;  3OLM D;  3A4R A;  3DBH B;  2D3G A;  2MBH A;  1YIW A;  1UBI A;  2JSV X;  2WS3 B;  5KHO A;  1P0R A;  3VH3 B;  2CHW A;  4PK1 A;  5LXI B;  2WXJ A;  2QDF A;  2EKE C;  4HJG E;  3Q8B A;  3R66 C;  3AV8 A;  2XEW A;  2KYW A;  2MW5 A;  4M00 A;  1E7U A;  4KGS A;  4YSX B;  4FXC A;  2DX5 B;  3R2T A;  5L83 A;  3HHM A;  1N60 A;  3R7R A;  1PGA A;  3IT6 B;  1F2R C;  3KH0 A;  1C1Y B;  1N62 A;  2O6V A;  3RZW C;  4ASW C;  2FCS A;  1XT9 B;  2MSE D;  1ZXH A;  4L2Y A;  1Z2M A;  3W1Y A;  1QOB A;  1FM0 D;  2O6V B;  1T0R C;  1FCL A;  1WGG A;  4DXG A;  2XK5 A;  4GN1 A;  4HCP B;  2L7R A;  4I6L B;  3N30 A;  4IG7 B;  3QK0 A;  3TSS A;  4KGT A;  1GB4 A;  2LRW A;  4EE2 A;  3P2B A;  1SE2 A;  1WJ4 A;  2QEJ C;  4GGQ A;  3Q3F A;  3IAS 1;  3E56 A;  1C76 A;  4QAY A;  5LNK 1;  4JX1 C;  2NTT A;  3A4S C;  1TIF A;  2BBC A;  2CU3 A;  3BK1 A;  4KV2 A;  1EWY C;  4MEM A;  4YSZ B;  3AI5 A;  2INN E;  3W1S C;  3AU4 A; 
#chains in the Genus database with same CATH homology
 3GE3 C;  3RMK C;  3Q3M C;  3N1X C;  3RNE C;  3RN9 C;  3I63 C;  3RI7 C;  3Q14 C;  3Q2A C;  4P1B C;  3RNF C;  3RNG C;  3I5J C;  2INC C;  3Q3O C;  3RNC C;  3RNB C;  3DHH C;  3GE8 C;  1T0R C;  2IND C;  3Q3N C;  3RNA C;  1T0Q C;  3N20 C;  3DHI C;  4P1C C;  3N1Y C;  1T0S C;  2RDB C;  3N1Z C;  3DHG C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...