3I5JC

Diferric resting state toluene 4-monooxygenase hd complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
82
structure length
82
Chain Sequence
SAFPVHAAFEKDFLVQLVVVDLNDSMDQVAEKVAYHCVNRRVAPREGVMRVRKHRSTELFPRDMTIAESGLNPTEVIDVVFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic and catalytic studies of the peroxide-shunt reaction in a diiron hydroxylase.
pubmed doi rcsb
source organism Pseudomonas mendocina
molecule tags Oxidoreductase
molecule keywords Toluene-4-monooxygenase system protein A
total genus 24
structure length 82
sequence length 82
ec nomenclature ec 1.14.13.236: Toluene 4-monooxygenase.
pdb deposition date 2009-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 3i5jC00
3DHHC 1T0RC 2INCC 3GE8C 3N20C 3RNEC 3RMKC 3RNAC 3RI7C 4P1BC 3I63C 3Q3NC 3N1XC 3Q3MC 3RNCC 1T0QC 3GE3C 3RNFC 3Q14C 3RNGC 3RNBC 3N1ZC 3I5JC 1T0SC 3RN9C 2RDBC 4P1CC 3Q2AC 3DHIC 3N1YC 3Q3OC 3DHGC 2INDC
chains in the Genus database with same CATH superfamily
5LLIA 4WWMA 1JALA 2DZMA 2AWTA 2VZKD 3TEWA 4HKZE 4KSLC 1FPYA 4B95A 2KANA 3U30A 5C23A 2LUMA 3PLUA 1EUVB 1FRRA 2IO1B 4WWNA 4YXDB 2JX5A 5KHOA 2KK8A 2X38A 2ZW1A 1NVID 1WE6A 3AEFB 4BBNC 1FXIA 2W82A 3LJ3A 3N3KB 1Q10A 1E8XA 3PO0A 3WALA 4BZAA 1NYRA 4A3OA 4DXGA 3BK2A 1P7FA 2KJHB 2K39A 1FXTB 2WQYB 1WXSA 3P2BA 3P1MA 3PPAA 4FJZA 3TMPB 3ZNGC 4NJCA 2G4DB 2GOWA 2C7MB 2M0AA 1KTKA 4HDOA 1NDDA 3I63C 3PVLA 2UYZB 2MBBB 4OZCA 5CX3A 3V60A 1QOBA 3SEBA 2HD5B 1E10A 1FNWA 4PYUA 3ONSA 4NJ6A 2G1EA 4L23A 5L83A 1YJJA 2INCC 3Q8FA 4MGKE 5E6OA 2IGDA 2MH7A 4HJKA 1YIWA 4BOZB 2BYTA 3RNGC 3RT3B 3RN9C 3ZKJC 2O2VA 1YJ1A 3NRZA 4W9JA 3DBHB 1T6BX 2M8SA 2MA9B 2WXLA 3RULA 1K8RB 2LZ6A 1UH6A 2NCNA 3AMZA 2AL6A 3VUYA 3BYYB 4PT5A 1J19A 1UELA 2AYOB 3CIRB 2K0PA 3U4EG 3VFKA 4MM3B 1V5OA 3DHIC 2KD0A 3NVWA 1V6EA 2RDHA 1OFFA 2V4LA 1WXAA 2NPTA 3DHHC 3ZW3A 3ZYYX 3PZ8A 3KUDB 1YOVB 2AQ1B 4RMAA 1XXGA 4ICVA 3P42A 2KQ4X 3ZJVA 1ZKHA 1OQYA 2WXFA 1E90A 3ZNZB 4XX5A 3AU5A 1KJTA 4K7SA 4IG7B 2V4IB 1C77A 2KDMA 1UZXB 1KH0A 2L0TA 4RH6A 2N9XA 1FNVA 1Y8RC 4BKSA 1DOYA 3H8HA 4TSSA 3ZTCA 2SEBD 1NI3A 2WX0A 1CK1A 2I1JA 1SB3C 3QIJA 5BYRA 3FILA 5CHFA 3SDLC 1E5WA 4MH8A 3D32A 4C00A 2J0JA 1EF5A 4BOSC 2V3NA 2Y3AA 1ZGUB 1WX7A 1XD3B 2FBWB 3M3JA 3NVVA 1S3SG 4IWOA 2PLPA 2L76A 1PGAA 3PZDA 5FR6A 2JWZA 2MHJA 4F7ZA 3V61A 2D3GA 2AEHA 2ZVOA 1L0XB 1EU4A 3DBLB 2LRUA 2FAZA 2XK5A 4F8CB 1VJKA 1ZW7A 2K6QA 4MGIE 1YN3A 3V3XA 2BYVE 4F1SA 3BVMA 2CHWA 3EFUA 2LASA 1KLGD 4MDKE 4ZDVA 3MC0B 1AWDA 2KFKB 5D6JB 2WP9B 3ZVVA 2N1WA 2L52A 5IN7A 2IY1B 2DYMA 2M1MA 4PS3A 3MHZA 3JSVB 2LGSA 2G9HD 1TY2A 4M0WB 3K9PB 2KNBA 1B9RA 4EZKA 5GMVA 2KVRA 1X1MA 1Z2MA 2JZPA 1ESFA 3URYA 2ZVNA 2JUOA 4G3XB 4GGQA 3VRBB 1N5XA 3O13A 3QK0A 2KYWA 4Q2JA 2WXOA 1E9MA 3Q8EA 1I35A 2O2VB 3ABVB 3N20C 4XYCA 3BZDB 2N1VA 4KKIA 1WX8A 3X0WA 2H88B 3QAQA 1BXTA 3RUIB 2PJHA 1J8CA 3H1UA 2CU3A 2YEPF 4DWFA 2AX5A 1JWSD 2LVQA 1WJ4A 1D6EC 4ARCA 3PLVA 1STEA 1D3ZA 4ZYNA 2WXQA 1QLBB 2QEJC 2V0GA 1SGHA 1D4BA 3U2SC 3TCAA 4ANUA 3AEBB 4BKSD 2Z0DB 2WXRA 3FC4A 5DPSA 3R2TA 4XWWA 3NVYA 4OVVA 1VD2A 2GBNA 1PYWD 1QF6A 1V8CA 2LHEA 2JRHA 3X23A 1TS4A 4S0RA 1L0VB 3PSEB 3IFWB 1FD6A 4R3DA 2LHDA 4WQOB 1I4HA 1WM3A 1LFDA 4MH0E 2VH2A 2J0KA 2ZZPB 4YTMB 5DPRA 1LQBA 4O1NA 3U7ZA 2LXAA 2JRIB 1RFKA 1OGWA 5C2TB 1TS3A 3VTUA 4FN2A 5EE0A 1N63A 2FE8A 2FCSA 2KQSA 1I42A 1K51A 1TS2A 3M62B 3V62A 1SEBD 5E6NA 2EELA 3AECB 5LNK1 1QT9A 5D3DA 1S1QB 4OHJA 2IGGA 3JVZX 2NBVB 2M19A 4LK0M 4FLHA 3AE9B 3KYCD 1FO4A 4MEMA 1MHHE 4ICUA 4KV2A 3NHEB 3NZSA 4W9DA 4M8NA 2VZKB 4PS7A 2CKHB 2KACA 4C7ZA 4YT0B 2INNE 3UIPB 3DHGC 2WYQA 3PZ7A 1YN4A 2W54A 3S2AA 2KFKA 3PRMB 2OJWA 1I4GA 3IT6B 3R7QA 2YLMA 3JW0X 2MRPA 5IAAC 2ZPYA 1WZ0A 2BYFA 1KM7A 3R2IA 1ZP0B 3ZUNA 2BBCA 4WJPA 5IP4D 5CHWA 1N5WA 4M8MA 3A1QB 2WXIA 3NS1A 2MQJA 2VRRB 1PFDA 2CJNA 1YX6B 3AXCA 4WAFA 1MI0A 3OLMD 1E0ZA 3FILB 3UI3A 2KJRA 3AULA 2KVZA 1KRHA 4AJWA 4FXCA 1IBXA 2JY6A 1WF9A 1VLBA 2ZCBA 1G6JA 2DENB 4P7IA 3RZFA 3VR8B 4B0MA 2NTTA 2KJ6A 3HHMA 2BS3B 4HROA 2KC1A 4W9IA 1JRUA 3NVZA 4K3CA 3P4RB 3L0WB 4L2YA 1BT0A 3QHTA 2NTSA 1FM0D 2KMAA 5IOIA 3I57A 2GMIC 4AOFA 3Q8BA 4WWPA 4ZOHC 2KLGA 2PVGC 3AE3B 2MP2A 3ZIMA 1EWCA 3E56A 4YTPB 5C1ZA 1L2NA 2RR9A 4I6LB 5IO9A 2J52A 4K7UA 2PMVA 4XE0A 2WU5B 2O6VB 4RF1A 4N59A 2BF8B 1RLFA 3AE7B 5G55A 5EE1A 3ZDTA 3ZRCA 1UGMA 3T8MA 2BS4B 2ZPNA 4JQWC 2J53A 2KTRB 3VR9B 3Q3OC 4NZLB 1E7VA 2GBMA 2QDFA 3AU4A 2R61A 2DNFA 2WHIA 1SXTA 1MG8A 2BW2A 3BVZA 3K9OB 2LMCA 4G50A 3IAM1 1XF5L 3DBLI 4KZ0A 3DVGY 4AS1A 1E8ZA 2K1FA 1XCQL 1YD8U 1ZOYB 2IO0B 2N7DA 1WYGA 2V3SA 3IT4B 2KWDA 2WX1A 1KOTA 5G5GA 2L3ZA 1EF1A 2NVUI 3Q3NC 3VH4B 3W5VB 4KGSA 2WXGA 3GOEA 2N9KA 2HJ8A 1UF0A 5DPWA 1XCTL 1F2RC 3LB8C 4NAWB 4US9A 1ET9A 4KSKC 2JYTA 4TV3A 1CMXB 4KKJA 2MBOA 3KUCB 4HCNB 4II3B 5DCNA 5D3IB 2K8HA 1TY0A 3I5JC 3E9SA 2L0FA 2ASQA 3SFEB 4IWQA 4ZRJA 3L54A 1LGRA 4CHKA 4ZHPA 5FK9C 2KN5A 1RYJA 1ISNA 4JE3B 1C4PA 2HTHA 3L13A 4HXDA 4K7WA 1L0YB 1SE2A 3V6CB 1V80A 2BKFA 4KZCA 1WYWB 2KFJA 4HRSA 4XDDA 3HM6X 4P6VF 3LDZE 1TKYA 1OQQA 4WJNA 2BVCA 4ACFA 5HFYA 1SSNA 1XLOA 2D10A 2KLCA 2QMTA 1VZ7A 1WZ3A 2J7QB 3NY5A 2DZJA 2N7JA 3ZO5B 2UU7A 3EC8A 1TBEA 3ECIA 4US8A 1GUAB 1QQRA 3J9CA 2KDBA 2Y5BB 4DHJB 4E74A 1GAQB 3AB5A 2FIDA 3DQVA 4GXBA 4IWPA 1C76A 2Z8LA 3TSSA 1UNSA 4LNIA 4P16A 2ZNVB 3P4QB 1WSPA 3P63A 1WRIA 4EFOA 4A8XC 1XQQA 1ZDXA 3TL5A 2K25A 2ZNVC 4K3BA 2KTRA 3BVGA 3NZ3A 3A1QA 3RZWC 1QKZA 1TJEA 2FCMA 3UF8A 2D11A 3L16A 3LXFA 1QILA 2TSSA 2J0MA 2JQRB 3I3TB 3APDA 2PKOA 3W5UB 2WNMA 5AZFA 2Z0EB 1J7AA 3DOWA 2WDQB 3ZXRA 3PRZA 1SJHD 4JL9A 1MHXA 1ZPSA 2KQ7A 2KT7A 3VHTC 2ACZB 2AL3A 3W9CB 1PDXA 2QILA 4NQLB 1GG3A 3W1SA 1SE4A 3AEAB 3V05A 1E8YA 2ZW0A 2LVPA 3UQBA 1CZPA 4ITKA 1L6UA 1GOZA 4DHZB 3RNAC 3ML8A 4BKGA 4NJ7A 5BMHA 2CHXA 5T8IA 4W9GA 2RDGA 3H6NA 3QJZA 3AI5A 1C78A 1WI0A 4LNOA 4FHKA 1VR9A 2QC8A 3MJWA 5EE9A 2WDTB 3IXSA 3B0AA 1C4AA 3OJ3A 1B1ZA 4TUUA 2KKCA 2V3PA 2Y5CA 4C7YA 1WXQA 3OWEB 3QARA 4C80A 2INDC 2XBBC 2LI5A 4BKTA 1C1YB 4BFRA 1JROA 2DLBA 2FCNA 3PS6A 3ZQ4A 3B08A 2L1AA 2W3SA 1I4XA 3NS8A 2ICIA 5HG2A 2ZCCA 1WGGA 2BB6A 1T0YA 2PIAA 3H7PB 3KYDD 5LXHA 1UWXA 3TIXA 3ZJTA 2BPSA 1WRDB 1TYGB 4AWJA 3DWMA 4RGOS 3HIZA 3L10B 5KHQA 1AYFA 2MBEA 4AP4C 1OEYA 2GI9A 5JHAA 2JU6X 2B3AA 2C7NB 4HPMB 1EWYC 4NAWA 2CU1A 3ZGZA 2NS5A 5IA7A 4DQOC 2DAJA 1V1PA 4ANVA 3VVWB 5H8YE 1IGCA 2MSED 1EM7A 3N30A 1V2YA 1E6EB 3B2FA 4RM8A 4YSZB 2Z59B 3KQ4A 2CS4A 5TSSA 2KTFA 2I38A 3U8ZA 3VDZA 4PK1A 2C7HA 1ACCA 3N1ZC 2R2QA 4KX6B 3AH7A 4W9FA 4C56C 3TEYA 1HEZE 4FULA 1SE9A 3Q3JA 2GLSA 1JWBD 2BB5A 4DK5A 1WWTA 2WLBA 4J6IA 1ENFA 3NOBA 2BWES 1I4PA 3RFZB 1GJZA 4KDLB 3PHWB 3TEZA 3T3OA 2ON8A 2V9HA 3AEEB 4HWIB 2BKRB 1YJIA 4FBJB 1ZXHA 1FFVA 3RPFC 2BGFA 1C4CA 1OEYJ 4KVGB 1NENB 2HJ1A 1UBIA 1ROEA 2LGXA 4X57B 2EMSA 1MG4A 2DX5B 3DDCB 2KMCA 2WXKA 2L8JA 4AJYB 4IUMB 4ZRKA 5AZHA 1ET6A 3L4PA 3BK1A 2E6XA 3QQ8B 4GDKA 3AN1A 4XWTA 4XZ4A 2D07B 3ZJUA 3JYUA 4XGAB 4MJSB 4P1BC 3QA8A 1RWSA 2NBUA 4IKGA 1PQSA 5BYSA 4NPNA 2IYDB 4LNFA 5HI1A 1N60A 1T0SC 1Q1OA 3OG5A 1RAXA 3PTFC 1FCCC 2NR2A 3N9YC 2CHZA 2K8CA 4LLGM 4A90A 1IP9A 3AE5B 5GXGB 3CMMB 2IO3B 4USAA 2Q5WD 1K50A 3APFA 3IAS1 2KWCA 3NUHB 3VTWA 2MP2B 3W1YA 1VZ6A 4WQMA 1P0RA 5G2NA 1VCBA 1I4RA 3C8YA 2FCQA 3QWZB 3SFDB 3ZNID 5CTRC 1XLNA 3PV1A 3BIID 1JW9D 1L6VA 4WURA 3H7SA 3C0RB 1OTRB 3H7PA 3NG0A 1A5RA 1IYFA 2LGYA 3U52E 1MFWA 3IBEA 3FKYA 4OZBA 4ZYSA 1R4NB 1PGBA 2D3BA 1I7HA 4OZAA 4IDIA 1F1HA 2D2QA 4W9HA 2D5GA 2V1YA 2GBKA 1IGDA 1FXAA 4CO7A 1N6ZA 1KLUD 1XT9B 2WS3B 3VRAB 1SIJA 3SD5A 1F0ZA 2G45B 3ZXVA 1U4AA 1GNUA 3MC8A 2JPHA 4ASWC 2I2YA 2LVOA 4WJQA 2KO3A 4YL8A 3AE4B 2K3UA 4E71A 3Q8CA 4RF0A 3Q6BA 3OAWA 4M02A 3ALBA 4JGHB 4MM3A 2IDYA 3L08A 3N1XC 1WMHB 3DBRI 1IUEA 5J2RA 2JF5A 2BYEA 1LO5D 5IKCM 5CHVC 2DYBA 3T3NA 3N32A 3PRPB 4HLEA 2M4NA 4G11A 1NEKB 2RPQA 3EECA 1TTNA 4XC2A 2KC2A 3BINA 4IOIE 4ZRQA 1TIFA 4EE2A 1WR1A 3BWUD 4W9CA 4GU2A 4EZJA 3VUXA 2IO2B 1TT5B 4NQKE 4AUQC 4IW0A 3AE1B 1JCKB 2PW9A 1SJED 4GOCA 2C5LC 1M94A 2OEDA 1FNUA 1WJNA 4L1BA 3WAPA 2X8XX 1V1OA 1FIQA 1PUTA 3U7DA 1V1PB 1V5TA 5AZGA 2OHFA 1MVKA 1V97A 4NAMA 1UD7A 2EKEC 2PEAA 2HTME 2KMMA 2W9NA 4HCPB 1K52A 1N62A 2BT6A 4JWUC 1WR6E 1DOIA 2LGIA 4FADA 2DBYA 2YVCA 2GRIA 2KWVB 2PE6B 4MT5A 3RD2A 1HXYD 1GC6A 3VH3B 4EOYA 1AARA 4YTNB 1JMLA 1L4ZB 2JXXA 2XEWA 4MSMB 1WJ6A 2H89B 1T5XD 4UDUC 4REZA 3A4SC 3GE8C 3TEXA 2JZ3B 3EHVA 3MC9A 3Q3MC 3MFGA 2WXJA 1ZUD2 3CWIA 3A9JA 2K9XA 3DBSA 3RYTA 2RDBC 4BAXA 2JYEA 2N7EA 5FKAC 4M0WA 2CR5A 3I9V1 2MX2A 3DVNV 4I6NB 1QZEA 1E7UA 2WDVB 4GN1A 1TKEA 2IZVB 1KF6B 2LFIA 4DHZE 4ZHOA 2MCNB 3PGEA 3DPDA 4A20A 1LXDA 1DGJA 3UGBB 1YQ3B 2AQ3B 4GLSC 1Y56A 3QCAA 2D3CA 2DHZA 1HA5A 2BTEA 4EZLA 1P7EA 2L32A 1J7BA 2MLBA 4URKA 3AEDB 5FR3A 2N0SB 3BY4B 3TUOA 3PREA 4LDTD 4CQNA 2GBRA 3VUWA 2LUEA 2WXHA 1R4NI 1WMHA 3WA0A 1F77A 2DWQA 1H8CA 2AQ2B 4TMAB 4RFBA 3DWGC 4OVUA 1F2RI 4RM9A 1RM6C 2KDEB 1DOXA 1L5PA 5BYQA 3KUZA 2BQQA 2KXJA 4DBGA 3CSTA 3HRDD 4II2B 4QAYA 5HKHA 5L95C 4ARIA 1N61A 3GS2A 2DAFA 2L00B 1YMHE 1GC7A 3L17A 3A33B 1TGZB 1E7PB 3M63B 3LYYA 4M01A 1TS5A 3DBHI 2LXCA 2JSVX 4N9F4 3AE2B 3KWVA 3DVGX 1HQRD 2WGSA 4C4VA 4DHJD 5D94A 4WAAA 1WGDA 3HVDA 4GB9A 1ZE3D 2MBHA 1UWMA 2RMMA 1YQ4B 2MJEA 3DCGA 3GZNI 4GMVA 2YEPB 2MW5A 2LWPA 5H92C 1P1AA 4JX1C 2OJRA 1P3QU 4FJYA 3DVNU 2KZRA 4RCOA 4N6EB 4CYEA 2JVCA 3ZRFA 4J3OD 1UUPA 3R7RA 4AQ7A 1H4RA 2PE9A 1WM2A 2RPVA 4WIPA 3KH0A 1BUIC 1TZ1A 1SBBB 2LEKA 1XEEA 1ZXIA 3A9KA 1MPEA 2J4XA 5E6PA 3R66C 1VZ8A 3ETRA 3AE8B 5G5HA 2GBJA 1IPGA 2O6VA 5JHBA 2OOBB 5D7GA 4TQ1A 1XLPA 3ZNHB 5DPTA 4FJVB 3GZNB 2KX3A 1T0RC 5BMIA 3RNEC 4LJPB 1YQBA 3HK0A 5JXVA 2G3QB 4KDIC 4IM2A 3Q69A 1WXVA 3RNFC 2I1KA 3HM3A 5D2MB 1RFAA 1SIFA 4FHJA 4GDLB 1ZDVA 1D5ZC 4HK2A 2KAJA 4HPPA 1IBXB 2DYOA 1T3QA 4YSYB 4LNNA 2PTLA 3VQIA 3PHXB 1PGXA 3KLSX 5BMGA 3W1SC 2CJOA 1D5XC 3SR6A 1KFYB 4MGYE 1TZOA 2HDEA 4KIKA 5AUIA 4ZRPA 4JWSC 4JLCA 3BYTB 2IY0B 3NJTA 3RI7C 1FEHA 4XDCA 2ONQA 4M00A 4MACA 3NZUA 5E6JA 4ANWA 3RNBC 1UBQA 1WGHA 4GDKB 4GSWA 2K22A 5MPOA 1JWMD 4EEWA 3B9JA 2EMTA 2FUG1 2K6DB 4MJSA 4YSXB 4DDGD 2J42A 2ZEQA 2L05A 4DXAB 1WGYA 1QOGA 1FRDA 4MELA 3RNCC 2O6VD 2K5PA 3H9DA 2QSDA 2JXTA 2W55A 1JRPA 2N9PC 3P4SB 1JQ4A 1C9FA 2M0XA 3W2DA 4C4VB 4EUTA 2KWUB 2NMQA 4JPSA 4W9EA 3Q8AA 3EA6A 4ANXA 2HE7A 4EKUA 1HTOA 4HDQA 2MJ3A 1GB1A 1AN8A 3UIOB 1YNTE 1GB4A 2QJLA 1D5MC 2INPE 4B9KA 4PS8A 3AM9A 1Z5SB 3QC8B 3TBLD 2IBIB 1R4MB 2WWZA 2WXNA 4G0NB 3WANA 3WCQA 1NBFC 4BVUC 4A3PA 3C19A 4W9LA 2XK5B 2PPHA 2FNJB 1HZ5A 3A9KB 3SHQA 5J17A 4GIVA 1SF0A 4S17A 3V6EB 3ML9A 3AV8A 3AEGB 4W9KA 2MJDA 2N4FA 2KN4A 4NY0A 4D2KA 3VXWA 5AUKA 4HKQA 1UGJA 2QIEB 1NYQA 4PYZA 3VAWA 1JWAD 2C60A 3GE3C 1TKGA 3JSVA 2DZIA 1SE3A 1HTQA 4I6PA 4A9AA 1BMLC 4A6QA 4KGTA 1YN5A 1AW7A 4TQ0A 1M4VA 2ZJDA 2XNAC 2UWQA 4OW0A 2SAKA 1WIAA 4BBNF 3O65B 3TJPA 5EDSA 2W3RA 4GDLA 4K81A 2LJ5A 2C9WB 2R2OA 3FAHA 3M95A 4ZRIA 2G4SA 2D3AA 3GP7A 1WH3A 3GB1A 2IGHA 4RNAA 3EUB2 3ZLZA 5TR5A 2GB1A 2FIFA 3WAMA 1WXMA 3HUIA 4NNJB 1WJUA 1OQRA 3KVFB 4KIKB 1F9JA 2BS2B 2A5UA 2LGDA 1R4MI 1CQVA 2BWFA 3WIMA 3KW5B 1V81A 1HE8A 3DBRB 1JWUD 1P98A 3N1YC 4WWOA 1FMAD 4OVZA 1CJEA 2KDIA 4JIOU 3UINB 4YWGG 2EKIA 1C3TA 2VH1A 3MJ5A 1E8WA 2N9LA 1EO6A 2LD9A 1WGKA 3KWLA 1WGRA 3OJ4B 4DXFA 3AE6B 4P1CC 4B6WA 3APCA 2K8BA 2IJ0A 2XN9C 3A4RA 2RGFA 3EFCA 2N9EB 4MGZE 4LDTB 4HVBA 1K53A 4MSQB 3UQAA 1Q0WB 4DDID 1J0GA 2LJIA 4RGMA 2Y5PA 3B1LX 4RGTA 2WXMA 2IPKD 2WU2B 1EU3A 1QOAA 1VRAB 3R8BA 2B76B 2LRWA 2QCZA 2DZKA 1J7CA 4LNKA 1XLQA 1FFUA 1L4DB 3WAOA 1RRBA 3A9JB 4HPLB 4IM0A 3ZTDA 5JH5C 3RMKC 1A70A 3R3MA 2KX0A 3QX1A 1F52A 4LTUA 2E3TA 2MEKA 2MWSB 3Q14C 5HHDG 1C79A 3Q2AC 4K1RB 2RD0A 1WY8A 4RGNA 1YX5B 2JWUA 1QOFA 2L7RA 3ZDMC 2WXPA 3B2GA 1V49A 5BO4B 2KOXA 2JZZA 4KGRA 2RSUA 5I4DA 3VTVA 1NI2A 1VDVA 4HEA1 5LXIB 2FUHB 4A55A 1WE7A 3PT2B 4IC7B 4E3CA 1HZ6A 1WFYA 1XO3A 1V9JA 1I4QA 3P4PB 3MP9A 4B0EA 4IM3A 4H2AA 2PVOD 3EGRA 5AEKB 2NBWB 1T0QC 5EE3A 3IHPC 3Q3FA 2NPTB 1Q5WB 5JZEB 2M17A 4TKNA 1V86A 2KHWB 2JT4B 2L83A 3ENEA 5J18A 4FA6A 5C3JB 1WX9A 3SU8X 4WH4A 3T9LA 1DYQA 2M56B 2KDFB 2QHOA 3MHSD 3MTNB 1GPXA 2WDRB 3CSFA 3IVFA 4N58A 4LCDE 2A4ZA 1FCLA 1L7YA 1P9DU 1KLVA 3IG3A 4WJOA 1LM8B 3CF6E 4LJOB 1MJDA 4HJGE 2REXA 3HVZA 1R7SA 3RCZA 2MBQA
chains in the Genus database with same CATH topology
3DHHC 1T0RC 2INCC 3GE8C 3N20C 3RNEC 3RMKC 3RNAC 3RI7C 4P1BC 3I63C 3Q3NC 3N1XC 3Q3MC 3RNCC 1T0QC 3GE3C 3RNFC 3Q14C 3RNGC 3RNBC 3N1ZC 3I5JC 1T0SC 3RN9C 2RDBC 4P1CC 3Q2AC 3DHIC 3N1YC 3Q3OC 3DHGC 2INDC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DHH C;  1T0R C;  2INC C;  3GE8 C;  3N20 C;  3RNE C;  3RMK C;  3RNA C;  3RI7 C;  4P1B C;  3I63 C;  3Q3N C;  3N1X C;  3Q3M C;  3RNC C;  1T0Q C;  3GE3 C;  3RNF C;  3Q14 C;  3RNG C;  3RNB C;  3N1Z C;  3I5J C;  1T0S C;  3RN9 C;  2RDB C;  4P1C C;  3Q2A C;  3DHI C;  3N1Y C;  3Q3O C;  3DHG C;  2IND C; 
#chains in the Genus database with same CATH topology
 5LLI A;  4WWM A;  1JAL A;  2DZM A;  2AWT A;  2VZK D;  3TEW A;  4HKZ E;  4KSL C;  1FPY A;  4B95 A;  2KAN A;  3U30 A;  5C23 A;  2LUM A;  3PLU A;  1EUV B;  1FRR A;  2IO1 B;  4WWN A;  4YXD B;  2JX5 A;  5KHO A;  2KK8 A;  2X38 A;  2ZW1 A;  1NVI D;  1WE6 A;  3AEF B;  4BBN C;  1FXI A;  2W82 A;  3LJ3 A;  3N3K B;  1Q10 A;  1E8X A;  3PO0 A;  3WAL A;  4BZA A;  1NYR A;  4A3O A;  4DXG A;  3BK2 A;  1P7F A;  2KJH B;  2K39 A;  1FXT B;  2WQY B;  1WXS A;  3P2B A;  3P1M A;  3PPA A;  4FJZ A;  3TMP B;  3ZNG C;  4NJC A;  2G4D B;  2GOW A;  2C7M B;  2M0A A;  1KTK A;  4HDO A;  1NDD A;  3I63 C;  3PVL A;  2UYZ B;  2MBB B;  4OZC A;  5CX3 A;  3V60 A;  1QOB A;  3SEB A;  2HD5 B;  1E10 A;  1FNW A;  4PYU A;  3ONS A;  4NJ6 A;  2G1E A;  4L23 A;  5L83 A;  1YJJ A;  2INC C;  3Q8F A;  4MGK E;  5E6O A;  2IGD A;  2MH7 A;  4HJK A;  1YIW A;  4BOZ B;  2BYT A;  3RNG C;  3RT3 B;  3RN9 C;  3ZKJ C;  2O2V A;  1YJ1 A;  3NRZ A;  4W9J A;  3DBH B;  1T6B X;  2M8S A;  2MA9 B;  2WXL A;  3RUL A;  1K8R B;  2LZ6 A;  1UH6 A;  2NCN A;  3AMZ A;  2AL6 A;  3VUY A;  3BYY B;  4PT5 A;  1J19 A;  1UEL A;  2AYO B;  3CIR B;  2K0P A;  3U4E G;  3VFK A;  4MM3 B;  1V5O A;  3DHI C;  2KD0 A;  3NVW A;  1V6E A;  2RDH A;  1OFF A;  2V4L A;  1WXA A;  2NPT A;  3DHH C;  3ZW3 A;  3ZYY X;  3PZ8 A;  3KUD B;  1YOV B;  2AQ1 B;  4RMA A;  1XXG A;  4ICV A;  3P42 A;  2KQ4 X;  3ZJV A;  1ZKH A;  1OQY A;  2WXF A;  1E90 A;  3ZNZ B;  4XX5 A;  3AU5 A;  1KJT A;  4K7S A;  4IG7 B;  2V4I B;  1C77 A;  2KDM A;  1UZX B;  1KH0 A;  2L0T A;  4RH6 A;  2N9X A;  1FNV A;  1Y8R C;  4BKS A;  1DOY A;  3H8H A;  4TSS A;  3ZTC A;  2SEB D;  1NI3 A;  2WX0 A;  1CK1 A;  2I1J A;  1SB3 C;  3QIJ A;  5BYR A;  3FIL A;  5CHF A;  3SDL C;  1E5W A;  4MH8 A;  3D32 A;  4C00 A;  2J0J A;  1EF5 A;  4BOS C;  2V3N A;  2Y3A A;  1ZGU B;  1WX7 A;  1XD3 B;  2FBW B;  3M3J A;  3NVV A;  1S3S G;  4IWO A;  2PLP A;  2L76 A;  1PGA A;  3PZD A;  5FR6 A;  2JWZ A;  2MHJ A;  4F7Z A;  3V61 A;  2D3G A;  2AEH A;  2ZVO A;  1L0X B;  1EU4 A;  3DBL B;  2LRU A;  2FAZ A;  2XK5 A;  4F8C B;  1VJK A;  1ZW7 A;  2K6Q A;  4MGI E;  1YN3 A;  3V3X A;  2BYV E;  4F1S A;  3BVM A;  2CHW A;  3EFU A;  2LAS A;  1KLG D;  4MDK E;  4ZDV A;  3MC0 B;  1AWD A;  2KFK B;  5D6J B;  2WP9 B;  3ZVV A;  2N1W A;  2L52 A;  5IN7 A;  2IY1 B;  2DYM A;  2M1M A;  4PS3 A;  3MHZ A;  3JSV B;  2LGS A;  2G9H D;  1TY2 A;  4M0W B;  3K9P B;  2KNB A;  1B9R A;  4EZK A;  5GMV A;  2KVR A;  1X1M A;  1Z2M A;  2JZP A;  1ESF A;  3URY A;  2ZVN A;  2JUO A;  4G3X B;  4GGQ A;  3VRB B;  1N5X A;  3O13 A;  3QK0 A;  2KYW A;  4Q2J A;  2WXO A;  1E9M A;  3Q8E A;  1I35 A;  2O2V B;  3ABV B;  3N20 C;  4XYC A;  3BZD B;  2N1V A;  4KKI A;  1WX8 A;  3X0W A;  2H88 B;  3QAQ A;  1BXT A;  3RUI B;  2PJH A;  1J8C A;  3H1U A;  2CU3 A;  2YEP F;  4DWF A;  2AX5 A;  1JWS D;  2LVQ A;  1WJ4 A;  1D6E C;  4ARC A;  3PLV A;  1STE A;  1D3Z A;  4ZYN A;  2WXQ A;  1QLB B;  2QEJ C;  2V0G A;  1SGH A;  1D4B A;  3U2S C;  3TCA A;  4ANU A;  3AEB B;  4BKS D;  2Z0D B;  2WXR A;  3FC4 A;  5DPS A;  3R2T A;  4XWW A;  3NVY A;  4OVV A;  1VD2 A;  2GBN A;  1PYW D;  1QF6 A;  1V8C A;  2LHE A;  2JRH A;  3X23 A;  1TS4 A;  4S0R A;  1L0V B;  3PSE B;  3IFW B;  1FD6 A;  4R3D A;  2LHD A;  4WQO B;  1I4H A;  1WM3 A;  1LFD A;  4MH0 E;  2VH2 A;  2J0K A;  2ZZP B;  4YTM B;  5DPR A;  1LQB A;  4O1N A;  3U7Z A;  2LXA A;  2JRI B;  1RFK A;  1OGW A;  5C2T B;  1TS3 A;  3VTU A;  4FN2 A;  5EE0 A;  1N63 A;  2FE8 A;  2FCS A;  2KQS A;  1I42 A;  1K51 A;  1TS2 A;  3M62 B;  3V62 A;  1SEB D;  5E6N A;  2EEL A;  3AEC B;  5LNK 1;  1QT9 A;  5D3D A;  1S1Q B;  4OHJ A;  2IGG A;  3JVZ X;  2NBV B;  2M19 A;  4LK0 M;  4FLH A;  3AE9 B;  3KYC D;  1FO4 A;  4MEM A;  1MHH E;  4ICU A;  4KV2 A;  3NHE B;  3NZS A;  4W9D A;  4M8N A;  2VZK B;  4PS7 A;  2CKH B;  2KAC A;  4C7Z A;  4YT0 B;  2INN E;  3UIP B;  3DHG C;  2WYQ A;  3PZ7 A;  1YN4 A;  2W54 A;  3S2A A;  2KFK A;  3PRM B;  2OJW A;  1I4G A;  3IT6 B;  3R7Q A;  2YLM A;  3JW0 X;  2MRP A;  5IAA C;  2ZPY A;  1WZ0 A;  2BYF A;  1KM7 A;  3R2I A;  1ZP0 B;  3ZUN A;  2BBC A;  4WJP A;  5IP4 D;  5CHW A;  1N5W A;  4M8M A;  3A1Q B;  2WXI A;  3NS1 A;  2MQJ A;  2VRR B;  1PFD A;  2CJN A;  1YX6 B;  3AXC A;  4WAF A;  1MI0 A;  3OLM D;  1E0Z A;  3FIL B;  3UI3 A;  2KJR A;  3AUL A;  2KVZ A;  1KRH A;  4AJW A;  4FXC A;  1IBX A;  2JY6 A;  1WF9 A;  1VLB A;  2ZCB A;  1G6J A;  2DEN B;  4P7I A;  3RZF A;  3VR8 B;  4B0M A;  2NTT A;  2KJ6 A;  3HHM A;  2BS3 B;  4HRO A;  2KC1 A;  4W9I A;  1JRU A;  3NVZ A;  4K3C A;  3P4R B;  3L0W B;  4L2Y A;  1BT0 A;  3QHT A;  2NTS A;  1FM0 D;  2KMA A;  5IOI A;  3I57 A;  2GMI C;  4AOF A;  3Q8B A;  4WWP A;  4ZOH C;  2KLG A;  2PVG C;  3AE3 B;  2MP2 A;  3ZIM A;  1EWC A;  3E56 A;  4YTP B;  5C1Z A;  1L2N A;  2RR9 A;  4I6L B;  5IO9 A;  2J52 A;  4K7U A;  2PMV A;  4XE0 A;  2WU5 B;  2O6V B;  4RF1 A;  4N59 A;  2BF8 B;  1RLF A;  3AE7 B;  5G55 A;  5EE1 A;  3ZDT A;  3ZRC A;  1UGM A;  3T8M A;  2BS4 B;  2ZPN A;  4JQW C;  2J53 A;  2KTR B;  3VR9 B;  3Q3O C;  4NZL B;  1E7V A;  2GBM A;  2QDF A;  3AU4 A;  2R61 A;  2DNF A;  2WHI A;  1SXT A;  1MG8 A;  2BW2 A;  3BVZ A;  3K9O B;  2LMC A;  4G50 A;  3IAM 1;  1XF5 L;  3DBL I;  4KZ0 A;  3DVG Y;  4AS1 A;  1E8Z A;  2K1F A;  1XCQ L;  1YD8 U;  1ZOY B;  2IO0 B;  2N7D A;  1WYG A;  2V3S A;  3IT4 B;  2KWD A;  2WX1 A;  1KOT A;  5G5G A;  2L3Z A;  1EF1 A;  2NVU I;  3Q3N C;  3VH4 B;  3W5V B;  4KGS A;  2WXG A;  3GOE A;  2N9K A;  2HJ8 A;  1UF0 A;  5DPW A;  1XCT L;  1F2R C;  3LB8 C;  4NAW B;  4US9 A;  1ET9 A;  4KSK C;  2JYT A;  4TV3 A;  1CMX B;  4KKJ A;  2MBO A;  3KUC B;  4HCN B;  4II3 B;  5DCN A;  5D3I B;  2K8H A;  1TY0 A;  3I5J C;  3E9S A;  2L0F A;  2ASQ A;  3SFE B;  4IWQ A;  4ZRJ A;  3L54 A;  1LGR A;  4CHK A;  4ZHP A;  5FK9 C;  2KN5 A;  1RYJ A;  1ISN A;  4JE3 B;  1C4P A;  2HTH A;  3L13 A;  4HXD A;  4K7W A;  1L0Y B;  1SE2 A;  3V6C B;  1V80 A;  2BKF A;  4KZC A;  1WYW B;  2KFJ A;  4HRS A;  4XDD A;  3HM6 X;  4P6V F;  3LDZ E;  1TKY A;  1OQQ A;  4WJN A;  2BVC A;  4ACF A;  5HFY A;  1SSN A;  1XLO A;  2D10 A;  2KLC A;  2QMT A;  1VZ7 A;  1WZ3 A;  2J7Q B;  3NY5 A;  2DZJ A;  2N7J A;  3ZO5 B;  2UU7 A;  3EC8 A;  1TBE A;  3ECI A;  4US8 A;  1GUA B;  1QQR A;  3J9C A;  2KDB A;  2Y5B B;  4DHJ B;  4E74 A;  1GAQ B;  3AB5 A;  2FID A;  3DQV A;  4GXB A;  4IWP A;  1C76 A;  2Z8L A;  3TSS A;  1UNS A;  4LNI A;  4P16 A;  2ZNV B;  3P4Q B;  1WSP A;  3P63 A;  1WRI A;  4EFO A;  4A8X C;  1XQQ A;  1ZDX A;  3TL5 A;  2K25 A;  2ZNV C;  4K3B A;  2KTR A;  3BVG A;  3NZ3 A;  3A1Q A;  3RZW C;  1QKZ A;  1TJE A;  2FCM A;  3UF8 A;  2D11 A;  3L16 A;  3LXF A;  1QIL A;  2TSS A;  2J0M A;  2JQR B;  3I3T B;  3APD A;  2PKO A;  3W5U B;  2WNM A;  5AZF A;  2Z0E B;  1J7A A;  3DOW A;  2WDQ B;  3ZXR A;  3PRZ A;  1SJH D;  4JL9 A;  1MHX A;  1ZPS A;  2KQ7 A;  2KT7 A;  3VHT C;  2ACZ B;  2AL3 A;  3W9C B;  1PDX A;  2QIL A;  4NQL B;  1GG3 A;  3W1S A;  1SE4 A;  3AEA B;  3V05 A;  1E8Y A;  2ZW0 A;  2LVP A;  3UQB A;  1CZP A;  4ITK A;  1L6U A;  1GOZ A;  4DHZ B;  3RNA C;  3ML8 A;  4BKG A;  4NJ7 A;  5BMH A;  2CHX A;  5T8I A;  4W9G A;  2RDG A;  3H6N A;  3QJZ A;  3AI5 A;  1C78 A;  1WI0 A;  4LNO A;  4FHK A;  1VR9 A;  2QC8 A;  3MJW A;  5EE9 A;  2WDT B;  3IXS A;  3B0A A;  1C4A A;  3OJ3 A;  1B1Z A;  4TUU A;  2KKC A;  2V3P A;  2Y5C A;  4C7Y A;  1WXQ A;  3OWE B;  3QAR A;  4C80 A;  2IND C;  2XBB C;  2LI5 A;  4BKT A;  1C1Y B;  4BFR A;  1JRO A;  2DLB A;  2FCN A;  3PS6 A;  3ZQ4 A;  3B08 A;  2L1A A;  2W3S A;  1I4X A;  3NS8 A;  2ICI A;  5HG2 A;  2ZCC A;  1WGG A;  2BB6 A;  1T0Y A;  2PIA A;  3H7P B;  3KYD D;  5LXH A;  1UWX A;  3TIX A;  3ZJT A;  2BPS A;  1WRD B;  1TYG B;  4AWJ A;  3DWM A;  4RGO S;  3HIZ A;  3L10 B;  5KHQ A;  1AYF A;  2MBE A;  4AP4 C;  1OEY A;  2GI9 A;  5JHA A;  2JU6 X;  2B3A A;  2C7N B;  4HPM B;  1EWY C;  4NAW A;  2CU1 A;  3ZGZ A;  2NS5 A;  5IA7 A;  4DQO C;  2DAJ A;  1V1P A;  4ANV A;  3VVW B;  5H8Y E;  1IGC A;  2MSE D;  1EM7 A;  3N30 A;  1V2Y A;  1E6E B;  3B2F A;  4RM8 A;  4YSZ B;  2Z59 B;  3KQ4 A;  2CS4 A;  5TSS A;  2KTF A;  2I38 A;  3U8Z A;  3VDZ A;  4PK1 A;  2C7H A;  1ACC A;  3N1Z C;  2R2Q A;  4KX6 B;  3AH7 A;  4W9F A;  4C56 C;  3TEY A;  1HEZ E;  4FUL A;  1SE9 A;  3Q3J A;  2GLS A;  1JWB D;  2BB5 A;  4DK5 A;  1WWT A;  2WLB A;  4J6I A;  1ENF A;  3NOB A;  2BWE S;  1I4P A;  3RFZ B;  1GJZ A;  4KDL B;  3PHW B;  3TEZ A;  3T3O A;  2ON8 A;  2V9H A;  3AEE B;  4HWI B;  2BKR B;  1YJI A;  4FBJ B;  1ZXH A;  1FFV A;  3RPF C;  2BGF A;  1C4C A;  1OEY J;  4KVG B;  1NEN B;  2HJ1 A;  1UBI A;  1ROE A;  2LGX A;  4X57 B;  2EMS A;  1MG4 A;  2DX5 B;  3DDC B;  2KMC A;  2WXK A;  2L8J A;  4AJY B;  4IUM B;  4ZRK A;  5AZH A;  1ET6 A;  3L4P A;  3BK1 A;  2E6X A;  3QQ8 B;  4GDK A;  3AN1 A;  4XWT A;  4XZ4 A;  2D07 B;  3ZJU A;  3JYU A;  4XGA B;  4MJS B;  4P1B C;  3QA8 A;  1RWS A;  2NBU A;  4IKG A;  1PQS A;  5BYS A;  4NPN A;  2IYD B;  4LNF A;  5HI1 A;  1N60 A;  1T0S C;  1Q1O A;  3OG5 A;  1RAX A;  3PTF C;  1FCC C;  2NR2 A;  3N9Y C;  2CHZ A;  2K8C A;  4LLG M;  4A90 A;  1IP9 A;  3AE5 B;  5GXG B;  3CMM B;  2IO3 B;  4USA A;  2Q5W D;  1K50 A;  3APF A;  3IAS 1;  2KWC A;  3NUH B;  3VTW A;  2MP2 B;  3W1Y A;  1VZ6 A;  4WQM A;  1P0R A;  5G2N A;  1VCB A;  1I4R A;  3C8Y A;  2FCQ A;  3QWZ B;  3SFD B;  3ZNI D;  5CTR C;  1XLN A;  3PV1 A;  3BII D;  1JW9 D;  1L6V A;  4WUR A;  3H7S A;  3C0R B;  1OTR B;  3H7P A;  3NG0 A;  1A5R A;  1IYF A;  2LGY A;  3U52 E;  1MFW A;  3IBE A;  3FKY A;  4OZB A;  4ZYS A;  1R4N B;  1PGB A;  2D3B A;  1I7H A;  4OZA A;  4IDI A;  1F1H A;  2D2Q A;  4W9H A;  2D5G A;  2V1Y A;  2GBK A;  1IGD A;  1FXA A;  4CO7 A;  1N6Z A;  1KLU D;  1XT9 B;  2WS3 B;  3VRA B;  1SIJ A;  3SD5 A;  1F0Z A;  2G45 B;  3ZXV A;  1U4A A;  1GNU A;  3MC8 A;  2JPH A;  4ASW C;  2I2Y A;  2LVO A;  4WJQ A;  2KO3 A;  4YL8 A;  3AE4 B;  2K3U A;  4E71 A;  3Q8C A;  4RF0 A;  3Q6B A;  3OAW A;  4M02 A;  3ALB A;  4JGH B;  4MM3 A;  2IDY A;  3L08 A;  3N1X C;  1WMH B;  3DBR I;  1IUE A;  5J2R A;  2JF5 A;  2BYE A;  1LO5 D;  5IKC M;  5CHV C;  2DYB A;  3T3N A;  3N32 A;  3PRP B;  4HLE A;  2M4N A;  4G11 A;  1NEK B;  2RPQ A;  3EEC A;  1TTN A;  4XC2 A;  2KC2 A;  3BIN A;  4IOI E;  4ZRQ A;  1TIF A;  4EE2 A;  1WR1 A;  3BWU D;  4W9C A;  4GU2 A;  4EZJ A;  3VUX A;  2IO2 B;  1TT5 B;  4NQK E;  4AUQ C;  4IW0 A;  3AE1 B;  1JCK B;  2PW9 A;  1SJE D;  4GOC A;  2C5L C;  1M94 A;  2OED A;  1FNU A;  1WJN A;  4L1B A;  3WAP A;  2X8X X;  1V1O A;  1FIQ A;  1PUT A;  3U7D A;  1V1P B;  1V5T A;  5AZG A;  2OHF A;  1MVK A;  1V97 A;  4NAM A;  1UD7 A;  2EKE C;  2PEA A;  2HTM E;  2KMM A;  2W9N A;  4HCP B;  1K52 A;  1N62 A;  2BT6 A;  4JWU C;  1WR6 E;  1DOI A;  2LGI A;  4FAD A;  2DBY A;  2YVC A;  2GRI A;  2KWV B;  2PE6 B;  4MT5 A;  3RD2 A;  1HXY D;  1GC6 A;  3VH3 B;  4EOY A;  1AAR A;  4YTN B;  1JML A;  1L4Z B;  2JXX A;  2XEW A;  4MSM B;  1WJ6 A;  2H89 B;  1T5X D;  4UDU C;  4REZ A;  3A4S C;  3GE8 C;  3TEX A;  2JZ3 B;  3EHV A;  3MC9 A;  3Q3M C;  3MFG A;  2WXJ A;  1ZUD 2;  3CWI A;  3A9J A;  2K9X A;  3DBS A;  3RYT A;  2RDB C;  4BAX A;  2JYE A;  2N7E A;  5FKA C;  4M0W A;  2CR5 A;  3I9V 1;  2MX2 A;  3DVN V;  4I6N B;  1QZE A;  1E7U A;  2WDV B;  4GN1 A;  1TKE A;  2IZV B;  1KF6 B;  2LFI A;  4DHZ E;  4ZHO A;  2MCN B;  3PGE A;  3DPD A;  4A20 A;  1LXD A;  1DGJ A;  3UGB B;  1YQ3 B;  2AQ3 B;  4GLS C;  1Y56 A;  3QCA A;  2D3C A;  2DHZ A;  1HA5 A;  2BTE A;  4EZL A;  1P7E A;  2L32 A;  1J7B A;  2MLB A;  4URK A;  3AED B;  5FR3 A;  2N0S B;  3BY4 B;  3TUO A;  3PRE A;  4LDT D;  4CQN A;  2GBR A;  3VUW A;  2LUE A;  2WXH A;  1R4N I;  1WMH A;  3WA0 A;  1F77 A;  2DWQ A;  1H8C A;  2AQ2 B;  4TMA B;  4RFB A;  3DWG C;  4OVU A;  1F2R I;  4RM9 A;  1RM6 C;  2KDE B;  1DOX A;  1L5P A;  5BYQ A;  3KUZ A;  2BQQ A;  2KXJ A;  4DBG A;  3CST A;  3HRD D;  4II2 B;  4QAY A;  5HKH A;  5L95 C;  4ARI A;  1N61 A;  3GS2 A;  2DAF A;  2L00 B;  1YMH E;  1GC7 A;  3L17 A;  3A33 B;  1TGZ B;  1E7P B;  3M63 B;  3LYY A;  4M01 A;  1TS5 A;  3DBH I;  2LXC A;  2JSV X;  4N9F 4;  3AE2 B;  3KWV A;  3DVG X;  1HQR D;  2WGS A;  4C4V A;  4DHJ D;  5D94 A;  4WAA A;  1WGD A;  3HVD A;  4GB9 A;  1ZE3 D;  2MBH A;  1UWM A;  2RMM A;  1YQ4 B;  2MJE A;  3DCG A;  3GZN I;  4GMV A;  2YEP B;  2MW5 A;  2LWP A;  5H92 C;  1P1A A;  4JX1 C;  2OJR A;  1P3Q U;  4FJY A;  3DVN U;  2KZR A;  4RCO A;  4N6E B;  4CYE A;  2JVC A;  3ZRF A;  4J3O D;  1UUP A;  3R7R A;  4AQ7 A;  1H4R A;  2PE9 A;  1WM2 A;  2RPV A;  4WIP A;  3KH0 A;  1BUI C;  1TZ1 A;  1SBB B;  2LEK A;  1XEE A;  1ZXI A;  3A9K A;  1MPE A;  2J4X A;  5E6P A;  3R66 C;  1VZ8 A;  3ETR A;  3AE8 B;  5G5H A;  2GBJ A;  1IPG A;  2O6V A;  5JHB A;  2OOB B;  5D7G A;  4TQ1 A;  1XLP A;  3ZNH B;  5DPT A;  4FJV B;  3GZN B;  2KX3 A;  1T0R C;  5BMI A;  3RNE C;  4LJP B;  1YQB A;  3HK0 A;  5JXV A;  2G3Q B;  4KDI C;  4IM2 A;  3Q69 A;  1WXV A;  3RNF C;  2I1K A;  3HM3 A;  5D2M B;  1RFA A;  1SIF A;  4FHJ A;  4GDL B;  1ZDV A;  1D5Z C;  4HK2 A;  2KAJ A;  4HPP A;  1IBX B;  2DYO A;  1T3Q A;  4YSY B;  4LNN A;  2PTL A;  3VQI A;  3PHX B;  1PGX A;  3KLS X;  5BMG A;  3W1S C;  2CJO A;  1D5X C;  3SR6 A;  1KFY B;  4MGY E;  1TZO A;  2HDE A;  4KIK A;  5AUI A;  4ZRP A;  4JWS C;  4JLC A;  3BYT B;  2IY0 B;  3NJT A;  3RI7 C;  1FEH A;  4XDC A;  2ONQ A;  4M00 A;  4MAC A;  3NZU A;  5E6J A;  4ANW A;  3RNB C;  1UBQ A;  1WGH A;  4GDK B;  4GSW A;  2K22 A;  5MPO A;  1JWM D;  4EEW A;  3B9J A;  2EMT A;  2FUG 1;  2K6D B;  4MJS A;  4YSX B;  4DDG D;  2J42 A;  2ZEQ A;  2L05 A;  4DXA B;  1WGY A;  1QOG A;  1FRD A;  4MEL A;  3RNC C;  2O6V D;  2K5P A;  3H9D A;  2QSD A;  2JXT A;  2W55 A;  1JRP A;  2N9P C;  3P4S B;  1JQ4 A;  1C9F A;  2M0X A;  3W2D A;  4C4V B;  4EUT A;  2KWU B;  2NMQ A;  4JPS A;  4W9E A;  3Q8A A;  3EA6 A;  4ANX A;  2HE7 A;  4EKU A;  1HTO A;  4HDQ A;  2MJ3 A;  1GB1 A;  1AN8 A;  3UIO B;  1YNT E;  1GB4 A;  2QJL A;  1D5M C;  2INP E;  4B9K A;  4PS8 A;  3AM9 A;  1Z5S B;  3QC8 B;  3TBL D;  2IBI B;  1R4M B;  2WWZ A;  2WXN A;  4G0N B;  3WAN A;  3WCQ A;  1NBF C;  4BVU C;  4A3P A;  3C19 A;  4W9L A;  2XK5 B;  2PPH A;  2FNJ B;  1HZ5 A;  3A9K B;  3SHQ A;  5J17 A;  4GIV A;  1SF0 A;  4S17 A;  3V6E B;  3ML9 A;  3AV8 A;  3AEG B;  4W9K A;  2MJD A;  2N4F A;  2KN4 A;  4NY0 A;  4D2K A;  3VXW A;  5AUK A;  4HKQ A;  1UGJ A;  2QIE B;  1NYQ A;  4PYZ A;  3VAW A;  1JWA D;  2C60 A;  3GE3 C;  1TKG A;  3JSV A;  2DZI A;  1SE3 A;  1HTQ A;  4I6P A;  4A9A A;  1BML C;  4A6Q A;  4KGT A;  1YN5 A;  1AW7 A;  4TQ0 A;  1M4V A;  2ZJD A;  2XNA C;  2UWQ A;  4OW0 A;  2SAK A;  1WIA A;  4BBN F;  3O65 B;  3TJP A;  5EDS A;  2W3R A;  4GDL A;  4K81 A;  2LJ5 A;  2C9W B;  2R2O A;  3FAH A;  3M95 A;  4ZRI A;  2G4S A;  2D3A A;  3GP7 A;  1WH3 A;  3GB1 A;  2IGH A;  4RNA A;  3EUB 2;  3ZLZ A;  5TR5 A;  2GB1 A;  2FIF A;  3WAM A;  1WXM A;  3HUI A;  4NNJ B;  1WJU A;  1OQR A;  3KVF B;  4KIK B;  1F9J A;  2BS2 B;  2A5U A;  2LGD A;  1R4M I;  1CQV A;  2BWF A;  3WIM A;  3KW5 B;  1V81 A;  1HE8 A;  3DBR B;  1JWU D;  1P98 A;  3N1Y C;  4WWO A;  1FMA D;  4OVZ A;  1CJE A;  2KDI A;  4JIO U;  3UIN B;  4YWG G;  2EKI A;  1C3T A;  2VH1 A;  3MJ5 A;  1E8W A;  2N9L A;  1EO6 A;  2LD9 A;  1WGK A;  3KWL A;  1WGR A;  3OJ4 B;  4DXF A;  3AE6 B;  4P1C C;  4B6W A;  3APC A;  2K8B A;  2IJ0 A;  2XN9 C;  3A4R A;  2RGF A;  3EFC A;  2N9E B;  4MGZ E;  4LDT B;  4HVB A;  1K53 A;  4MSQ B;  3UQA A;  1Q0W B;  4DDI D;  1J0G A;  2LJI A;  4RGM A;  2Y5P A;  3B1L X;  4RGT A;  2WXM A;  2IPK D;  2WU2 B;  1EU3 A;  1QOA A;  1VRA B;  3R8B A;  2B76 B;  2LRW A;  2QCZ A;  2DZK A;  1J7C A;  4LNK A;  1XLQ A;  1FFU A;  1L4D B;  3WAO A;  1RRB A;  3A9J B;  4HPL B;  4IM0 A;  3ZTD A;  5JH5 C;  3RMK C;  1A70 A;  3R3M A;  2KX0 A;  3QX1 A;  1F52 A;  4LTU A;  2E3T A;  2MEK A;  2MWS B;  3Q14 C;  5HHD G;  1C79 A;  3Q2A C;  4K1R B;  2RD0 A;  1WY8 A;  4RGN A;  1YX5 B;  2JWU A;  1QOF A;  2L7R A;  3ZDM C;  2WXP A;  3B2G A;  1V49 A;  5BO4 B;  2KOX A;  2JZZ A;  4KGR A;  2RSU A;  5I4D A;  3VTV A;  1NI2 A;  1VDV A;  4HEA 1;  5LXI B;  2FUH B;  4A55 A;  1WE7 A;  3PT2 B;  4IC7 B;  4E3C A;  1HZ6 A;  1WFY A;  1XO3 A;  1V9J A;  1I4Q A;  3P4P B;  3MP9 A;  4B0E A;  4IM3 A;  4H2A A;  2PVO D;  3EGR A;  5AEK B;  2NBW B;  1T0Q C;  5EE3 A;  3IHP C;  3Q3F A;  2NPT B;  1Q5W B;  5JZE B;  2M17 A;  4TKN A;  1V86 A;  2KHW B;  2JT4 B;  2L83 A;  3ENE A;  5J18 A;  4FA6 A;  5C3J B;  1WX9 A;  3SU8 X;  4WH4 A;  3T9L A;  1DYQ A;  2M56 B;  2KDF B;  2QHO A;  3MHS D;  3MTN B;  1GPX A;  2WDR B;  3CSF A;  3IVF A;  4N58 A;  4LCD E;  2A4Z A;  1FCL A;  1L7Y A;  1P9D U;  1KLV A;  3IG3 A;  4WJO A;  1LM8 B;  3CF6 E;  4LJO B;  1MJD A;  4HJG E;  2REX A;  3HVZ A;  1R7S A;  3RCZ A;  2MBQ A; 
#chains in the Genus database with same CATH homology
 3DHH C;  1T0R C;  2INC C;  3GE8 C;  3N20 C;  3RNE C;  3RMK C;  3RNA C;  3RI7 C;  4P1B C;  3I63 C;  3Q3N C;  3N1X C;  3Q3M C;  3RNC C;  1T0Q C;  3GE3 C;  3RNF C;  3Q14 C;  3RNG C;  3RNB C;  3N1Z C;  3I5J C;  1T0S C;  3RN9 C;  2RDB C;  4P1C C;  3Q2A C;  3DHI C;  3N1Y C;  3Q3O C;  3DHG C;  2IND C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...