4OHJA

Crystal structure of toxic shock syndrome toxin-1 (tsst-1) from staphylococcus aureus
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
194
structure length
194
Chain Sequence
TNDNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYGPKFDKKQLAISTLDFEIRHQLTQIHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEING
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toxic shock syndrome toxin-1
publication title Crystal structure of toxic shock syndrome toxin-1 (TSST-1) from Staphylococcus aureus
rcsb
source organism Staphylococcus aureus
molecule tags Toxin
total genus 58
structure length 194
sequence length 194
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4ohjA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4ohjA01
2AQ2B 1CQVA 1ET6A 1LTBD 1HQRD 2XRQD 1HTLD 1JR0D 3BVMA 1T5XD 2R61A 3URYA 2Z8LA 3BZDB 1CHQD 1FNVA 1I4GA 3SEBA 1SJED 2WV6D 3BVZA 2RDHA 2QILA 1EEFD 1GOZA 3OWEB 1JQYD 4RH6A 1DJRD 1PTOD 1KLUD 5D3DA 1MD2D 5ELDA 1V1OA 1RF2D 1YN5A 1AW7A 1YN4A 2NTTA 1PTOC 1BCPB 2CHBD 1LTRD 3DWPA 1JWUD 1RD9D 4L6TB 4OHJA 3W2DA 2XN9C 4L63B 1LTGD 1LTID 1I4PA 1G8ZD 3EA6A 3MC0B 1PZKD 1SJHD 4NZLB 1UUPA 1DYQA 4RGMA 1ET9A 1D5ZC 1YN3A 1TS5A 2RDGA 1TS3A 2IJ0A 5ELCA 1XXGA 1L0YB 1TY2A 1XTCD 3MFGA 5FKAC 3CHBD 2ICIA 4Z9CB 1FGBD 1JWMD 1L0XB 4C56C 2IPKD 5ELFA 3R8BA 2AQ3B 5D3IB 1FNWA 1JWSD 1PRTF 1RDPD 1TS2A 1LT4D 1FD7D 1S5CD 1FNUA 1LLRD 1BCPD 5FK9C 1UNSA 2SEBD 1PRTB 2O2LD 4RCOA 5I4DA 1SE2A 1BXTA 4RFBA 1BCPC 1PTOF 1PZJD 4K6LA 1D5XC 1KTKA 4DXGA 1PZID 1EEID 1D5MC 1LTAD 1ENFA 1LT6D 4TSSA 1PTOB 1S5FD 1I4XA 4BWGB 1PTOH 2TSSA 4RGOS 1I4RA 5TSSA 1STEA 1SBBB 4O1NA 1EFID 1EU3A 1S5DD 3KLSX 1CHPD 1V1PB 3DWAA 3V05A 1EWCA 3EFXD 3DWQA 1KLGD 2QEJC 3BYYB 1LT5D 3TSSA 1HXYD 1B1ZA 4RHRA 1LO5D 1PYWD 1F77A 1HA5A 1CK1A 2NTSA 1D6EC 2AQ1B 1SE3A 1QILA 1I4HA 1TY0A 1PRTD 2XRSD 1LT3D 1JCKB 5ELBA 1SXTA 1EU4A 3O13A 2G9HD 2J4XA 3R2IA 4UDUC 4DXFA 1PRTC 3GP7A 4RHSA 2XNAC 1LTSD 3BVGA 3BYTB 1B44D 1BCPF 3R2TA 4RGNA 1S5ED 1S5BD 4ZYSA 4RGTA 1CT1D 1RCVD 5ELEA 1SE4A 1I4QA 1V1PA 1TS4A 1AN8A 1ESFA 1SEBD 1M4VA 1LTTD
chains in the Genus database with same CATH superfamily
1HQRD 1XMOQ 2JU6X 1GUGA 1ML0D 2VQEQ 2K25A 3URYA 4C3JH 5IWAQ 2MJEA 3L0WB 4W9EA 2ZXOA 4KV2A 2N7JA 3GE3C 4Q2JA 2N9EB 2FINB 4DBGA 2X69A 1U4PA 1TT5B 2KCNA 3G48A 4A93B 5DM63 1GOZA 1XLPA 1SNOA 3I4MB 3NPPA 2NMQA 4OZBA 1EM7A 3ENEA 4A55A 1M8AA 3KBGA 4QGUA 2IX0A 2DY7A 1WGGA 1CM9A 5AJ3L 1RYJA 5FR6A 1UH6A 1L2NA 5IY0A 2J52A 4HPMB 1F2RI 4DAVA 3H0GB 1LTRD 2A74C 2LRWA 3W2DA 2HIVA 3BWUD 1KC8C 2BS4B 4HEDA 1WJ4A 3PCOB 1KDCA 1G8ZD 2I1JA 2K5NA 5EBCA 4WJ4A 1GJXA 3R7RA 4JBKA 3K5MA 1PZKD 2F0DA 1VQ6A 3APCA 4FP5D 2D10A 4YWMA 2MX2A 2EQSA 4APVA 1XF5L 3T4AC 1QUQB 2PNHA 1SFOB 1JMCA 2K4KA 4A3LG 4KD4A 1TS3A 5HKHA 1STGA 3SDLC 1FRRA 3AYHB 3K7UC 4P1CC 2AWNA 5AJ3Q 3L2PA 2LXAA 4P2CB 5FLMH 1VMPA 4KY5A 3HOUH 1HZ6A 2K14A 1FM0D 1E6EB 2KEEA 4CJ1B 1B9NA 3NOBA 1A2UA 3X3MA 4IN3A 2O6VD 5GXGB 1ICFB 1SYGA 1UNSA 3KUPA 1YNJC 3OW2A 1RM6C 2MLBA 2YEPF 3LJ3A 4MIUA 4GZYC 4B3TL 5EE1A 4DR3L 3LWUA 2DAFA 3NWSA 3LGJA 3OIQA 1HR0W 3K81C 1XLQA 4HMJA 3Q6BA 3Q8FA 2W55A 4POGA 1EL0A 3OAWA 5KRUA 4WH4A 3IHPC 3W5UB 2JJQA 3T51B 3UE0A 1WRDB 3KF6B 5LHY1 1SYBA 1ZW7A 2BB5A 1QUQA 2V3PA 3KYHC 4HXDA 3S14B 3DWAA 1ENAA 5FLXL 1Y1WB 2B29A 1MSGA 3DVGY 2NYZD 4AJYB 2L7RA 1RAXA 2IY1B 1EYCA 2F0GA 2JA9A 1LT5D 5CR3A 2B8GA 4YSXB 3CCSA 1FJGL 4MNOA 2FCMA 4NJ7A 2L15A 3DPDA 4ABNA 1XNQQ 3A55A 2PE6B 1L1OC 1XLOA 4ZKCB 1K3RA 1VQAA 1MKHA 3IG3A 4A3MG 4IUUA 1AFPA 2J4XA 1ZYRC 4UDUC 4DXFA 2LUEA 2JA8G 2PQAB 2A6HC 1VDVA 2JXTA 3BYTB 3E0JA 3ECIA 4K7SA 1SYFA 3PSEB 1S5BD 1TWCB 1WM3A 2DNFA 1T9HA 2JY6A 2VB3X 2VZKD 1RCVD 2NZOA 3KF6A 2BBCA 4KIKB 1FJGQ 3RPFC 1PXUA 1NE3A 2F0TA 1WFQA 3N3KB 5E6PA 4OELB 4DR1L 1PFMA 2RCFA 3W3AA 2WDQB 5C6AA 1ZPSA 2PVGC 2WYQA 3HOYH 1PUTA 1FL0A 1J19A 1N36L 2OJRA 3X3NA 5DM73 1A62A 4JI6Q 2DWQA 2A68C 4WJPA 5IOIA 1TKYA 3D8GA 3I4LA 1CI3M 1EFWA 2L3ZA 4DK3C 5D14A 2HCCA 1LFDA 2K6DB 4UHVA 5JJKA 2Y0SE 3OWEB 1STYA 1TGZB 1VRAB 3QHTA 1K3BC 1TWFH 4HCEA 1E7VA 1PTOD 4HSVA 4LFCL 4NXNQ 5BYQA 2PQAA 2K75A 3R3OA 2P5ZX 1STHA 1WJJA 4KHZA 1FCLA 3OTOL 3A7LA 4MT5A 4C2MB 2KO3A 1HZ9A 3PIO3 4RKLA 3GTLB 4PYUA 4K5XA 3UINB 2E2JH 2HCIA 1TXYA 1IP9A 1N36Q 2J0JA 2NBWB 4KIKA 1EYDA 3UDFA 4OZCA 2YVCA 1K51A 1UWMA 1LV9A 2PQEA 4N8X1 2XIWA 1S3SG 3QQ8B 1IYUA 1HNXL 5EE0A 3ZJYC 1GVPA 3T1YL 2XTIA 4L5QA 3AEDB 3D6WA 3W9CB 1STNA 3KLWA 2B2UA 4MEMA 1IKLA 1STBA 1IKMA 2AHOB 1JJGA 3U30A 3CRLC 4DAMA 2GB1A 1XTDA 3KJOA 4F8CB 2NBFA 5LMNL 2E2IB 4A9AA 2R2OA 4A3IH 4X62L 1TTNA 3VYUA 2AL6A 2VRRB 4NB3A 4DAYA 4RWSC 1NAPA 2UUCL 4GKKL 5IT9L 4DV0L 1PH5A 4JW0A 4HKZE 3CCEA 2GBNA 1IUEA 3B0AA 2WP8J 1HNXQ 1WJUA 3X0WA 2IWHA 2WHIA 5K5PA 4P16A 2MRPA 1BOSA 4IQZA 4XWWA 5J39A 2OJWA 3UDXA 1EIHA 3Q14C 1I4XA 5J3BA 1CZPA 4RGOS 3CF5A 4FF2A 1J8CA 4TV3A 1ISNA 1YHAA 3SK8A 3KLSX 2Z4HA 2NUCA 2O5JC 4NY0A 3WDNA 4GKKQ 3BK2A 1EWCA 1MG8A 1UAPA 3BYYB 2F0MA 4GLVB 1KD1C 2Q2TA 3OIPA 4RHRA 4N8FA 4A3BG 4GMVA 5H92C 2CFMA 1CK1A 3PMFA 2PPBC 2F3VA 5IA7A 5K36H 1UEBA 1VQBA 1SE3A 1YIJA 4A3CH 4W9LA 3D4WA 4A3GH 2J7ZA 2ZJDA 4IALA 2HE7A 1HE8A 3D4DA 2FCSA 1PFDA 4XDDA 2G9HD 4OX9L 1TR5A 2VH2A 4A3PA 3JW0X 1LTSD 4R4CA 2WXKA 3R2TA 1QOHA 3N52A 3RN2A 3MWYW 1XJVA 3M3YB 3DEPA 4HAEA 3CD6A 3OMGA 5HGQA 4MM3B 3CPWA 2L8JA 2Y5PA 3TCAA 3A8JE 4AYBB 5T8IA 4JOIA 3G4SA 3FPPA 2MUYA 1ZP0B 2WXHA 1M4VA 4JOIC 3AE6B 1HFGA 3DVNU 4ILWA 1YNNC 2M9VA 3UQAA 4I6LB 2Z6KA 1GKHA 2VQFQ 3VYTA 3PO3H 2KOXA 2PPHA 3KUZA 4OL7A 4KI0A 5JOBA 5KYIA 4OX9Q 4WJ3M 5HHDG 4PZ8A 2EELA 5BYSA 4ANVA 1FNVA 3JSVB 2EY5A 2IX1A 3HOXH 3A8KE 3MHBA 2UUBL 4CO7A 4EFOA 1VZ8A 3P4RB 2DZJA 4DA2A 4MACA 3CRKC 2LXKA 3KLRA 3CCMA 1GUSA 2ACZB 1IW7C 1DGSA 1VF7A 2WLBA 2WU5B 2PZTA 1CKOA 3OJ3A 2F0JA 1QT9A 4PK1A 5H1SE 5JAVA 1DONA 1XPRA 3R93A 2FHTA 2NVYB 4N9PA 5E4XA 1RFKA 1SGHA 4PMBA 1GM5A 4MM3A 3I4NB 2PW5A 1QE6A 3P4PB 1QKZA 5EKIA 1F1HA 1ENCA 4KJOA 1F9JA 1PDXA 2DX5B 2MP2B 1B9RA 4JYAL 3S2HB 3GZNB 3ZDMC 1Q1OA 1LTLA 5F2DA 1VJKA 4XE0A 2GVBA 2WXFA 4IJHA 3BZCA 4DUYL 2NN6H 2F0QA 4IPGA 3UDIA 3L9AX 3F1ZA 3FKIB 3MXUA 1VQLA 2KKCA 3Q0AA 1XTCD 2LGSA 3JSVA 2UXDL 5ELNA 2CCZA 1WCMB 4EE2A 1JB3A 1WM2A 1PH3A 2IYDB 4BY7B 2ZM6L 1Q90A 1JB7A 4Y7NB 1I5FA 4LF5L 1WR1A 3SXHA 2F1MA 4XQQA 1SLJA 4H44C 1SAPA 1LT4D 3BJUA 4AH6A 5C3EG 1N62A 5BMGA 3H3VC 3KK7A 5C44H 1Q82C 4JYAQ 4KSKC 3S1MB 4DNRB 3H7SA 4B0EA 4KV6A 5FO8B 4OEMB 4LF4L 3QAQA 4RA8A 3U4VA 1X54A 4K6LA 3K5LA 2KEDA 1WXAA 4DUYQ 3HHMA 1RLFA 3TN2A 4WJWA 2MP2A 4XWTA 3G71A 2K6QA 2UXDQ 4X66L 1LM8B 1YQBA 5TSSA 1U0LA 3A1QB 1E7ZA 1XT9B 2R93B 4W9JA 1CHPD 3K0YA 2ZTDA 3HGBA 5EAYA 1C0AA 4BBRB 4IUQA 4A3EG 1Q7YC 3TEZA 4B3SQ 2AUKA 3B9JA 3S1NB 2FMCA 3F2DA 1GNUA 4NAMA 1B1ZA 2UXBQ 4J6HA 4LF4Q 1JRUA 4KDIC 2OCEA 1VQNA 1A8VA 1R7SA 1SDFA 3BK1A 3WANA 3M4OB 5FR3A 1I4HA 1EWHA 2HD3A 3GD7A 3PIPA 4OONA 1TZ1A 3NELA 4KKSA 3RUZA 4X66Q 1XNRQ 2R7FA 3HOZG 1KXLA 1T3QA 2F0SA 5EPKA 3IVFA 1UWVA 4DV4L 1TWHH 4C3JG 1IBLL 3PLVA 1PFSA 1S5ED 4JLCA 4C00A 1TWGH 4OXPA 1L4DB 3A1QA 4JC0A 1G2SA 4FJVB 2R7ZH 1CTMA 2JN4A 1NVID 2BS2B 3HKZG 4WRDA 4IOIE 5EGTA 4FF1A 2RBMA 3RNBC 1Q10A 3GO5A 3IKJA 1V1QA 4JI7L 3V62A 1LTBD 4A3FH 5J22A 3R3MA 4RAUC 4II3B 2EOTA 1LABA 1GPXA 3SFDB 3NVWA 2E8GA 4G0NB 4DV4Q 1Q5WB 2ZCCA 2FIDA 2VZAA 2EE1A 1K8OA 4P72A 4IWQA 1DOIA 3D31A 4ZHPA 2C9OA 2F0FA 2G9DA 2M4NA 1CUKA 1QQRA 2JQOA 2HDLA 5FOBB 4CDFC 1SIFA 1C9FA 4JI7Q 3AB9A 1J5EL 3VRBB 2ZZPB 5FLMG 4LNFA 1OQRA 2XN9C 4L63B 5CBAE 3HOUG 1A6XA 2GBKA 4ARCA 4BY1H 2NVXH 4QCLA 2CVRA 5IGEA 1HEZE 4B6WA 3B2FA 1EY8A 4R4IA 4HJ5A 1LACA 1XO3A 2RMMA 3K5NA 1SJHD 4RNAA 1UUPA 2KHIA 4A3KH 3L17A 1IYFA 3TMPB 4K2KA 1KF6B 2CJNA 2XGTA 5ELCA 5M3FH 3HOVB 4IFDI 4OO1I 5LNK1 2CH4W 3D6CA 4L8JA 1CMXB 3Q3JA 3H6MA 3L54A 1K83H 1BR9A 2LMCB 2SNSA 3P4QB 1FGBD 2NVTB 2WAQE 4S0RA 4DDGD 4JV5L 1VDZA 3MVVA 5CHFA 3ZO5B 1OTCA 2CJOA 4J6IA 3B2GA 5M5YH 3QR8A 2Q8IB 3ZW3A 1GUAB 3GS2A 1V2YA 1S72A 1M94A 2CU1A 2KDEB 3PUYA 3NS1A 1W6JA 2RSUA 1BBUA 1K53A 4FJYA 1SMXA 2RA4A 1DD2A 2PE9A 2D3BA 5AEKB 5ELOA 3P63A 2D07B 4FXGC 1D2BA 1TVXA 1WXMA 1PH4A 2MQJA 3ONSA 2B2WC 2D5DA 4BWGB 1PTOH 2L55A 4DF7A 4OWWB 2JA6B 3GTMH 1FRDA 5IN7A 1GAQB 3VTVA 3H3VH 2D3CA 2NBVB 3S1QB 2CW0C 2O4XA 1H9JA 2RCNA 4HMIA 2V3SA 3BINA 2Z1CA 3L4PA 1WD0A 2V9HA 4HKQA 4M0WA 4ULLA 2Q8RE 4PNYA 2N4FA 3IAM1 2DZKA 2LMCA 3IFWB 1L6UA 3C46A 1VQGA 3H9DA 3KYDD 3T1HL 3A56A 3TJPA 1KQSA 1QWYA 4LTUA 2LI5A 1AARA 4ODGA 2A8VA 3AE9B 3MXNB 4XX5A 3CW2C 3HOWH 2D5GA 1NMGA 2EYJA 3HIZA 4OVUA 3HOYG 3NG0A 3K80C 2A6ED 1XPOA 3H6NA 1QZEA 2IDYA 4ME5A 1K8AC 1XQQA 4RGNA 1F0ZA 1BF4A 5LXIB 1EIFA 1GUOA 1X6OA 2MEKA 4HSPA 3RZDH 2QMTA 5IYCH 4WJQA 4ID6A 3P2BA 1QB5D 4OIJA 1I4QA 1E7UA 1T5EA 4FBJB 2JA5H 2KCMA 4RFBA 2BGFA 4WJNA 2Y0SB 4HR7B 4WORA 1CA6A 2K04A 3RZWC 1JR0D 2L12A 3HKSA 1ZDVA 4G3XB 3ZVVA 3HEJA 3L10B 1VCIA 4K2LA 1GUNA 1ZUD2 3RYTA 4YCUA 1PH2A 4A3DH 3N9YC 2MJ3A 3CMAA 2DN8A 1TIID 2D0PA 4FLHA 4H13C 4G50A 4W9IA 2QILA 5FLXE 3J81c 2UUAL 2HT1A 3GTGH 3NY5A 3MXNA 3H94A 4K7UA 1DJRD 1A3UA 4MH0E 4ANUA 2OF1A 4NAWB 3OWFA 4KHPQ 3DQVA 3S15H 1X3GA 3M85A 4F1SA 5L83A 4MTKA 2EYLA 4ASWC 1HZAA 3TEHB 3J7AV 3Q6SA 3ZYYX 2K03A 1RD9D 2Q2IA 5IGDA 1KDAA 2E2DC 3I8ZA 3RZOH 2BW2A 1EOTA 1LTGD 4GLAC 1LTID 3VH3B 4C3HH 5CV7A 1NR2A 3RNFC 2EKIA 2HD5B 2XSCA 4FHJA 2L05A 4JI1Q 3I91A 2IO3B 4BBSB 1DZ1A 5IODA 3NZ3A 1I6HB 3Q23A 4OVVA 2HTHA 2VS1A 1HNZL 2KWUB 2DY8A 4GKJL 3RZFA 3U9SA 1TKEA 5FO9B 3NZSA 3CMEA 1N6ZA 3GZNI 3EC8A 4YY3L 1WTVA 2RSOA 1YNJD 4JPSA 4NAWA 3TBLD 2YU9B 3MTNB 1FD7D 1OO9B 2QCPX 2V1YA 1C8CA 2WU2B 4CKEA 4M02A 5BMIA 2INCC 4V0BA 3PIOA 3AEEB 1P7FA 1NBFC 2KDBA 2KQSA 3GE8C 3SFEB 1XYIA 3O65B 3F2CA 4LUZA 3UI2A 1E2ZA 3TEXA 1CSPA 2IGGA 2BOSA 4C3IH 3L7ZC 3A54A 3S16B 1F2YA 4LAAA 4TSSA 3TS2A 1OFFA 2K01A 2WP9B 1HNZQ 5K36G 3GTPB 2D3GA 2EY1A 1X55A 4GKJQ 3DEOA 4A3GG 1SBBB 1MHWC 1IL2A 1KNEA 2MJDA 2H89B 2KCTA 4YY3Q 1DXMA 3WAPA 1OXVA 4DQOC 2JYEA 4G7OC 1DOYA 2KWVB 4NQKE 3Q3OC 5M5XH 2QEJC 3C2PA 4X3UA 5DNFA 3ZNID 2IHFA 2KACA 1LM0A 4EKUA 1NTGA 4OIKA 3PIP3 1Y56A 3JAML 3HP3A 2KBNA 2MO0A 5C5MA 1ASYA 1ZYRD 2N9XA 2WXNA 1VQIA 4DDID 1NNXA 3ERQA 1JE5A 4UAIA 2K1FA 2A6HD 2DZIA 5D2MB 1EU4A 5HY6A 5IP7H 3PRPB 1V43A 5I2YA 1U4AA 3MTSA 4WWPA 4HJ8A 1K73C 3K6OA 4A3JB 1J8IA 3CMMB 1KNAA 3RFZB 4EQPA 2MA9B 1X32A 2KVMA 4BA1I 5C3EH 2FE8A 4BXXH 3DBHB 4LDTD 2K5PA 4MHEA 3HOXG 2PCFB 1N63A 1X1MA 2L0FA 1I50H 5DEHA 4ZHOA 2JRIB 1HRJA 5E3FA 4B9WA 2AQ2B 3BVMA 1P16A 4K8IA 2LVPA 1V8CA 3DLLA 3KH0A 2KQ3A 3LB8C 3T16A 4NPNA 1IGCA 1ILPA 2Z8LA 1VQFA 1N61A 1YMHE 1CHQD 2L83A 1P3QU 1EY4A 5M3MB 1RWSA 1JWAD 4PQXA 1VQCA 3AFPA 4LF8L 2INDC 3H91A 3KLSA 4I7AA 4GXBA 3VYRA 1A2TA 4LF6Q 4MGZE 5EPJA 2QDBA 2NBUA 4JWSC 1XX8A 5E1FA 5ELDA 2HIXA 4WIPA 4H2AA 2E75C 2KC2A 4LUVA 2NN6G 5BO4B 4R4QA 3V60A 3RI7C 3EFUA 3A7AB 4RMFA 3AEGB 4R4OA 1WTPA 4KMUC 4OZAA 1K8MA 3RNUA 2K5WA 3S1RH 3HOZH 1SN8A 2M17A 1KOTA 2K6AA 3BG3A 5G3LF 4PMWA 2C7MB 3J81i 3EGRA 2WKDA 2LGXA 5BYRA 1I94Q 2JA7H 4EGVA 5CBEE 5C44G 3L0OA 2E6XA 3Q8CA 5LMUL 1KAAA 2KFJA 1GD7A 3VRAB 1FXAA 2L1BA 2CHXA 2DNEA 2ZNVB 4LMQD 3ZJVA 1I3QB 4ZLTF 2G4DB 5DAUA 3PGZA 2K8BA 5FKAC 2SOBA 4A3IB 5GAHC 2INNE 3D32A 1PFNA 2K50A 4KVGB 1YHBA 1IGDA 1V86A 2RHSB 2I38A 3NHEB 1YJ9A 3PZDA 2W9NA 2KJHB 5CGKA 4KGRA 5JHAA 3MC8A 2SEBD 4RKBA 2JE6I 1CZGA 4ICUA 5LMUQ 3GDEA 5AZHA 2W3RA 4A3OA 5BR8L 3N1ZC 1HUNA 2N9PC 5C4JB 4B3RL 1GC6A 2J53A 2KTRB 2KX0A 4URKA 4K6DA 1WGHA 3H1UA 1KRSA 3ER0A 1E2WA 2K28A 3IAYA 4KN7C 3M7NA 4IWOA 3EFXD 2ZNVC 1VS0A 2MW5A 1KLGD 1QNUA 4X65L 1MPEA 2EJGC 4FXCA 2DBYA 3RNEC 4JI2L 3VA7A 4ANXA 1YEZA 3M4YA 2D9UA 2B63B 2MSED 2ONQA 2XK5B 2R7ZG 2PMZE 4DK6C 2R92H 2MQHA 3PUVA 5BR8Q 4DHJB 4NXML 4A4IA 4DKAC 2HTME 2UU7A 1BUVT 3NS8A 3NUHB 3ZGZA 4A3FG 4B3RQ 5JH5C 1YIWA 3WCQA 2FCQA 2RDFA 4TVAB 3CWIA 3MEFA 3S17B 1PH8A 2V1CC 1U5KA 2LXCA 3RD2A 2ZVOA 5CV5A 2M8SA 4X65Q 4PZ6A 2K5VA 2QCZA 1WZ3A 1V8QA 1GHJA 4JI2Q 1CT1D 2KTRA 4K3BA 3GTQH 1QCBD 1SYCA 4G57A 4KK7A 4OWTB 2WS3B 5KHQA 2X6LA 3CQZH 4LJPB 1JROA 4N58A 3CCRA 1II3A 4MSMB 1WYGA 3DXJC 4BKSA 3PO3B 2K5QA 4B3TQ 4DR3Q 2QDFA 4KSLC 4N59A 4JPBW 3K59A 2J0KA 3OLMD 4GDKB 5KIXA 3U4ZA 2XK5A 4XYQA 3CC2A 1F9SA 1UE6A 2JP1A 4JWUC 3ZNGC 4BY1G 4KTAA 2L0TA 4ZYNA 4XQJA 1IW7D 3GTJH 1GC7A 3S2DB 1PHJA 1K0SA 1PGAA 4AOFA 4K14A 2IO1B 3GTOB 3G6JB 4A3KG 3SDZA 1P1AA 1I42A 1JOQA 2RQXA 4FJZA 1RF2D 3SVMA 1EF1A 2BYVE 3K7AB 5M3FG 5I9PA 1DM0B 2LRUA 3IT4B 5DPRA 2OQKA 4HIDA 5EE3A 3TZDA 3Q69A 1EQRA 3LNNA 3TP8A 1ROEA 2F0KA 4TUUA 4ZRZA 3AE8B 3RMKC 1R9TB 5E6JA 1SNPA 2DAJA 2F0NA 2WAQB 1XPUA 4GOPA 1H8CA 2PJHA 3N1YC 5CX3A 1VZ7A 2RKSA 2PW7A 4HJAA 2RDGA 2IBIB 2CU3A 1B3QA 2MP1A 4GDKA 1YJJA 2AWTA 3QIJA 2EMTA 1VQPA 4F7XA 3CHBD 4KX6B 4G4KA 3NTIA 4XIGS 4DAYB 1L0XB 1PA6A 3QJZA 1Z7TA 2EIFA 1YJNA 2F0EA 1SRUA 3ZRFA 2WX0A 4M8MA 5IYBH 3VR3A 5J17A 2QKIC 4DR1Q 1VQ7A 3RNCC 4TQUS 1TKGA 2PVOD 1BDOA 1YBYA 2M00A 2EY2A 3N6RA 3V96A 2ZPYA 3HKZE 4MN3A 2L9HA 3WAMA 2CKHB 1VD2A 1IXRA 3OMCA 4DR6L 3PO2B 2KWDA 4BA2I 1SSOA 4WURA 3U8ZA 1WTHA 4PS7A 4JI4L 1LT6D 1TU2B 4IUVA 4O42A 3TREA 1P98A 1AE2A 1V49A 2B2UC 1Y1VH 5HGTA 4LFCQ 2JWUA 2QC8A 2UYZB 1V1PB 3HOWG 2LASA 4G11A 4GSWA 3OTOQ 3J7A5 3EFCA 1UE5A 2RHQB 3FKIG 3NENA 1NSNS 4FULA 3J81j 4IWPA 4KZ0A 5DPSA 2NWGA 4AJWA 1EZ8A 4KKTA 4ZRQA 4P74A 2O2VB 1A3TA 2SAKA 5IYCG 5M5WB 3B1LX 3T1YQ 1BMLC 2D2QA 4JI4Q 2JA5G 1TWAB 3NSWA 1WTRA 4MDKE 2Q5WD 3BU2A 3QARA 2EXDA 4CJ2C 5CHWA 5JEAJ 1X9NA 3TRZA 4USAA 2YTYA 5CV6A 4A93H 5LMNQ 3I4MH 4DR7L 5IKCM 2JZZA 1MJDA 4FXDA 2QHOA 4X62Q 4A3DG 1KJTA 2C60A 4L2YA 3ITPA 4WAAA 2IY5B 4QL5A 3AXCA 2UUCQ 1SR3A 2O6VB 5LL6S 4DV0Q 4AIMA 1LUZA 3H0GH 2F0PA 1SNQA 1V1PA 3MAQA 1EWIA 3HVZA 3ZKJC 1SEBD 2C7NB 4GB9A 2PTLA 2G5DA 2ZTCA 2JYOA 3WAOA 4BVUC 3PREA 2Z4IA 3DBHI 1PYSB 1WI5A 5IGBA 3HRZC 3OHXC 4IJLA 2O2VA 1HQMC 4GLXA 1SFOH 4IFDJ 3AMUA 3NP8A 4C3HG 2MWSB 4MGYE 1JQYD 2CHWA 2Y3AA 2CWAA 4EQOA 3Q2AC 1EWYC 2WDRB 4NPSA 3TEWA 3UQBA 2FXQA 2N8NA 2MHVA 1WX7A 5IP9G 4GNXB 2C5CA 1YN4A 2NTTA 2KAJA 5DLQE 3NEMA 3P4SB 1WVLA 2R6GA 1AH9A 1YITA 1WRIA 3T9LA 1F52A 2AYOB 1YX5B 4A3MB 2BA0A 2O6VA 3PV1A 5AUKA 4GN4B 3U58A 4BBNC 2E76C 1RFAA 4LLGM 2ZW0A 1T0SC 2BKFA 2JA8B 3N20C 2Z6KC 2K52A 2GBJA 2D0OA 4A90A 2JSOA 4ZDVA 2KHJA 1E8WA 2K5DA 1C79A 3C3LA 3PS6A 2VZKB 2BWFA 4LFAL 3MJ5A 5JPMC 4C3IG 2F03A 3S14H 2ICIA 4Z9CB 4CDDC 1QVGA 4IPHA 1JWMD 3ICEA 2R7DA 1Y1WH 2PI2E 4M00A 4D2KA 2ASBA 1IZ6A 2WX1A 2L11A 3ZRCA 3J7ZC 1HH2P 2L1AA 1L5PA 4ICVA 1JWSD 1F9RA 3DWGC 1TS2A 4P71A 4PMCA 3FVQA 3RLFA 1FNUA 2VXWA 4DFAA 4GNXA 1HNWL 3ZLZA 3EN2A 4KHVA 3M63B 3UF8A 2LWPA 1ICWA 4GNXC 2AUJD 1E0ZA 4UP7A 1HPCA 3ZQ4A 1SE2A 3A33B 2NCNA 3WWVA 3VUWA 3B6YA 3STBC 2D3AA 1IBXB 3K58A 4X3TA 2J42A 1Q8KA 3ETRA 4PG3A 3T8MA 1OQYA 4GU2A 3V6EB 3V2TA 2CW0D 1PTOB 1S5FD 1YVCA 3E3XA 2UUBQ 3NBHB 3GTMB 4EQ5A 1HZCA 1KFYB 3V61A 2IHEA 3FPUB 4O1NA 1PH1A 3GTKB 1SB3C 1VR9A 1R4NB 1S5DD 1TWCH 5I2XA 2B3AA 3HOVG 1PQSA 1N9WA 5IP7G 3CAMA 3IFDA 3NK9A 1GUTA 2WQYB 1HNWQ 5G5HA 4HVBA 1KIXA 4HROA 2CWPA 4QMGA 5JEAH 3B08A 4HN7A 2E5LL 4NMZA 3NWTA 3CCLA 4BXXG 1J7BA 1K52A 2FAZA 3NVVA 2WB1G 2M1MA 5NUCA 4PT5A 2BYFA 5GADC 3NVZA 5G55A 3WOFA 2INPE 5D94A 2B3GA 2BDOA 2GN5A 1NENB 3NQIA 4J15A 1LT3D 3J80c 3J9CA 3ML8A 5A2QL 1ZE3D 4GN5A 4DWFA 3AM9A 1H9RA 1UF0A 4ZUJA 1WFYA 1IBXA 4I6NB 1BCPF 1EZ6A 1SF0A 1ZDXA 2NVQB 1VLBA 3Q24A 2K32A 2ZM6Q 3NBHA 1SROA 3U7ZA 4LF5Q 5ELEA 4C2MH 3GTLH 3HM6X 2E5LQ 1SE4A 3TIXA 4I65A 4Y52H 4OO1H 5L95C 4JI8L 4JBMA 3TBIB 2AWOA 1CJEA 1RODA 1Z6HA 1VMCA 3CKIB 2EYFA 1DOLA 3W1BA 1TQOA 4DK0A 1K50A 2WDVB 4FA6A 3K57A 2KJRA 1U9RA 2LVOA 5C0XI 2G3QB 1SJED 5J1ZA 4FF4A 2BPSA 2M56B 2JX5A 3U4EG 2RDHA 1RIPA 4R1JA 2N1WA 4XXEA 2VUMG 2E2IH 2JA7G 3IRBA 2LS01 1SNMA 4I6PA 1NBWA 2F3WA 3T56B 4A3BB 4K1RB 1AW7A 1JJCB 1TJEA 2L52A 2F0WA 2E2HB 4KKIA 3SK6A 1L0VB 3HM3A 3DWPA 3JAME 2L5TA 2MCNB 3QJYA 1E90A 5KEEA 4LF9L 2KYWA 4XGAB 3ULJA 3ML9A 4GIVA 1WTOA 3R7QA 4FDBA 1DYQA 2LKVA 1Q0WB 3SR1A 3ZXVA 4HDQA 2UU9L 5CORA 3I55A 2R3ZA 2RVLA 1ZOYB 1IBLQ 1L0YB 1G291 3QO2A 2M2LA 3KF8B 1V9PA 4MZ9A 1L2FA 1QOFA 3HG9A 2EY6A 1HZ5A 5JZEB 1NI3A 5EBDA 3E5SA 2MBEA 2O5IC 5G2NA 4ALPA 5IGCA 2UWQA 5D3IB 3PTFC 4LJOB 3RUIB 4M1UB 4HCSA 4L1BA 4CJ0B 2BB6A 1S5CD 2OEOA 2JZPA 2CH4A 1QJOA 5FK9C 2KLCA 5LL6X 1QVCA 3RLOA 4AWJA 4DN4M 3MA2B 2ATWA 1NDDA 1OQQA 1WYWB 2GBMA 5CV4A 4IOAA 4CHKA 5FJ8H 2DNCA 4X3SA 3T3OA 3TZUA 4IUMB 2KA7A 2CS4A 1YNTE 3EROA 1Y8OB 2R92G 4C7YA 2N49A 3TEYA 2LXJA 4AQ7A 4TQ0A 2KANA 2PMZB 2IW3A 2GOWA 5AZFA 4M0WB 3M3YH 1FIQA 1R4QB 2I1KA 2NR2A 2WGSA 3KF8A 1YZ6A 3DDCB 2ZPNA 5C4XG 3VTWA 1J5EQ 4AP4C 1NR4A 1EQVA 1MVKA 2WNMA 3JVZX 4HK2A 1HXYD 1XCTL 1GUWA 1RHPA 2DJGC 1FXIA 2KVRA 4IG7B 2PKOA 1ACCA 1RKNA 4FF3A 2KX3A 1N33L 1QILA 1SSNA 3K8AA 4MSQB 2Z59B 3NXWA 5ELBA 4IUTA 1GHKA 1PDQA 1SMYC 2ZTEA 2A69C 4BBNF 3Q3MC 2XNAC 3RULA 4JBJA 2JSVX 2KC1A 2X8XX 3RN9C 4DUZL 1WSPA 1BBWA 5C3EB 3UI3A 2EYOA 4B3ML 4JV5Q 2FJ2A 2ZEQA 5EQ0A 3ZJUA 2K0PA 4FNFA 2KXJA 4WAFA 3Q8BA 1WGDA 1WX8A 2F52A 3VR9B 4UP8A 1ESFA 2NVYH 5FO7B 3J80i 3KUCB 1LTTD 1BUIC 2ZCBA 4XT3B 3I4NH 5ISRA 1N33Q 3UIPB 2VY3A 4V190 4BFRA 3DCGA 1WH3A 3BDOA 5EJWA 3BDLA 3J7YW 4QJFA 1SIJA 4HRSA 4WJOA 1E5WA 1QOGA 3DWMA 4JI3L 1D3ZA 4P6VF 1K28A 4DUZQ 3I72A 3QIAA 3FKIH 3D0FA 4A3EB 2FIFA 2OTJA 1Y8RC 2DZMA 5FLXc 3MJWA 4YWLA 1WCMH 2DJFC 3M7GA 4BY7H 3LYYA 4OW0A 3A5ZB 3N1XC 3N30A 4Y7NH 4GGQA 3M3JA 1O7LA 4LNKA 4YHHL 1IBKL 1PGXA 1VQ8A 3MFYA 3HOZB 3T1HQ 2JUOA 2BH8A 3S1MH 2IX3A 5IYBG 4JI3Q 1NEKB 5C2TB 1MJCA 1JJ2A 4C3JB 4U68A 1P0RA 2FFKB 1N34L 2BH2A 2QSDA 1RJTA 1TS5A 3ALBA 3KWVA 1Z2MA 3QB3A 3ND8A 4X6AH 2NVUI 3ZIMA 4QIWE 1FXTB 3AE1B 2W54A 4DHZE 3E0EA 2HHHL 4YIJA 2D62A 2R93H 3HKZB 1MHHE 2LGYA 2L00B 2KZRA 3KW5B 3MFGA 2XWJB 5M3MG 2KCCA 3FHWA 1L4ZB 1VQEA 2E74C 2D2CC 4LW1A 2WXMA 2BE5C 2SDFA 4MGKE 4YHHQ 1IBKQ 3EVQA 2A73B 3S1NH 2F4VL 1FNWA 1Y1VG 2Q2HA 4K5WA 1UD7A 1RDPD 4XC2A 2LJ5A 1QLBB 3PUWA 1J7AA 2FCNA 1EIYB 1I7HA 1STAA 2Z0SA 4DPGA 1V6EA 1OXSC 2LVQA 2OEDA 2EXZA 4KD3A 2PNRC 3M4OH 1N32L 1EF5A 1PTOF 1KM7A 1L7YA 3AI5A 2KN4A 2HDMA 3T13A 1T6BX 1ENFA 2UUAQ 3PLUA 1KRHA 5IP9H 4CQNA 1HR0L 1JOOA 1IYVA 2JF5A 4RF0A 5JVG3 3KVFB 1STEA 4JVZA 4DV2L 4E3CA 3EHVA 1EO6A 3FRPB 4O2DA 4P75A 1Q81C 2F4VQ 1L0WA 4K0KL 3HOUB 4A93G 2F0LA 3KBXA 3RN5A 1EY7A 2NS5A 3I4MG 4YCWA 4ITKA 1C9OA 1M1KC 1E1OA 3APDA 4G7ZC 3T53B 4UPAA 4DV6L 1B70B 2HJ1A 4KZCA 1C78A 4S3SA 5C4HA 4DR4L 1R4NI 3VDZA 1C48A 2R2QA 3H0GG 2KQ7A 1Z5SB 3I57A 2EMSA 2LD9A 3AU7A 4F8MA 1NUCA 2WINB 3J81E 2ZT9C 1HR0Q 1FPYA 2LFNA 4HIKA 3MXGA 2N9LA 1G6ZA 3DHHC 3U2SC 5HI1A 2ZXPA 2FNJB 1G6JA 3AEFB 4EZLA 4S17A 4K0KQ 2XEWA 2LZ6A 3K0XA 2MBBB 3HUIA 2WXPA 4A8XC 2KK8A 4ME3A 2PLPA 4RG1A 4XTCS 1YJIA 2IO0B 5IT9c 3H7PB 1CZWA 2I46A 2F4IA 3EQLC 3L13A 3P1MA 3QA8A 3V6CB 3CCJA 1WWTA 3FKYA 1WXQA 4HCNB 3G6EA 1E9MA 3Q8EA 2BTEA 2B2TA 4P73A 1AN8A 1BVSA 4YTMB 1LGRA 1YOVB 1WE6A 2B2TC 2VL6A 2CKZB 2EZVA 4WWMA 1R4MB 1OEYA 2KFKB 4DV3L 1FD6A 3FC4A 4DK1A 1WXVA 1T0QC 1WF9A 2C35B 4DHJD 2QF7A 3H15A 3I90A 5GQOA 2JXXA 2A4ZA 1C77A 3HOVH 1WYDA 4BOZB 1JE4A 2VW9A 3APFA 5LXHA 5AUIA 3SHLA 1FFVA 5IIFA 3DVGX 1KLUD 1VQ9A 2NVTH 1HFNA 4ZQ3A 2K22A 1Z9FA 4LK0M 2K05A 1N8RC 1QNKA 4FVMA 3AB5A 4FN2A 2BDNA 3HK0A 4X3KA 4DV3Q 2EYHA 3H7PA 3AH7A 1Y1WG 3PUXA 2V3NA 3FAHA 5C23A 2A68D 4TKOB 1HTOA 4YSZB 3HOYB 2FUHB 1E0BA 3DHIC 4FADA 2B2VA 1EOVA 4LUOA 1DGJA 2IT1A 1N5WA 4DU9A 1YN3A 4ZAIA 2JZ3B 2KFKA 4XT1B 2YTXA 1GG3A 3OOCA 2AL3A 2JA6H 2SNMA 2JRHA 4DR5L 3NRZA 2N1VA 5TR5A 4NW2A 2UXCL 1TWFB 2JXMB 2F0VA 3PZ7A 2KLGA 3NUCA 4POFA 4KKJA 2KHWB 1WJ6A 4RMAA 2IPKD 2KOLA 5M9OA 1S40A 2C9WB 4HWIB 1MFWA 2H4OA 3CU7A 2NZHA 4M8NA 3E9SA 4B9XA 2E2JB 1PRTB 1FVIA 4RCOA 3CP0A 1V5TA 1V80A 1IBML 1C1YB 1EYAA 2ID0A 1PZJD 1XMOL 3PUZA 2VQEL 5JEAG 2VUMH 2KQ4X 5IWAL 4HJ9A 2C5LC 2WXGA 4B9KA 1D5MC 2KTFA 4DR5Q 1YQ3B 1KH0A 2PI2A 2BA1A 4LF8Q 2UXCQ 2BVCA 2MFIA 3AQQA 2ICEC 4DXAB 5I6WA 4H0LC 1WR6E 1E8ZA 4JCVE 5EKLA 2WKCA 1AE3A 3VR6A 1EU3A 3CC4A 2DYBA 2A6EC 5DPTA 1ONLA 1GO3E 4IOCA 1WMHB 3CF6E 4HDOA 1JICA 4W9FA 4OWXB 2OT2A 1ILQA 4II2B 2KMAA 5IYDH 1TIFA 3UIOB 1NMFA 1IBMQ 4BZAA 1R4PB 3IBEA 1QVFA 3W1SA 2L4NA 1VQHA 3NQTA 3NE5B 5JJIA 3W1SC 4FHKA 4IFDG 4OO1G 2MGSA 3VXWA 3IL8A 3PO2G 1B7YB 5CV9A 1PRTC 4EVOA 1C4AA 4ZOHC 1YJWA 1KAWA 1ZKOA 4CDCC 4HIOA 4XDCA 4HIMA 2EPBA 3NTHA 2C7HA 5HG2A 4ZYSA 2HJ8A 4RGTA 2XBBC 4MJSB 3TP6A 5AFWA 3C0RB 2LY7A 1BO0A 3U50C 1HZBA 1WMHA 5I9OA 3CXCA 2V4IB 4J1MA 5T1IA 1CQVA 2EKEC 5IAAC 2N3SA 2R61A 3A74A 1D4BA 2K8CA 2MHJA 4A3GB 2PZUA 1VQDA 3PV0A 5IOCA 4BBSH 3VH4B 2JEBI 3SEBA 4YTNB 1FEHA 1PV4A 1I6HH 2N7EA 2EDGA 3BVZA 4LCDE 5AZGA 3RNGC 4JIOU 3ZTCA 2GVAA 3D4RA 3J7AF 4W9GA 5C4XH 4C1NK 2V4DA 3K5OA 3VUXA 4DR2L 2EJMA 1NYQA 4B95A 2WXJA 4XQNA 2JT4B 1YN5A 1L1OB 3BS1A 5JJLA 2LHDA 1BCPB 3PZ8A 1IPGA 4N9F4 2YU9H 3PPAA 4ZRJA 3ZNHB 1YNND 1C3TA 1JWUD 4MJSA 4GOPB 5A2QE 2WXLA 5IO9A 4WFN3 1SYDA 1LQBA 1JC7A 1LYLA 2WFWA 4NXMQ 2A19A 1OXXK 2JVCA 2H5XA 1XNQL 4NZLB 2V0GA 4C80A 2WWZA 4RGMA 2WB1E 2OQ0A 5JPNC 3S16H 1HTPA 4QB4A 2W82A 1FMAD 2QA4A 3GTPH 2Q8TA 1SE9A 3BIID 4QQBX 1W2BA 4DR2Q 3HOXB 3QX1A 4LDTB 3W1YA 4U673 2GLSA 2CQAA 1TY2A 2I07B 1B50A 3C8YA 4HPPA 5FJ8G 4FYDA 4YTPB 3E9HA 1XWEA 4ZRPA 2Y5CA 5KGUA 4KKUA 5C3JB 1PYBA 2H88B 3AFQA 2ZVNA 3VUYA 1WTQA 3RNAC 2ZJPA 2JQRB 2K1BA 5H8YE 4XDXA 1L1OA 4Q0FA 4R8NA 1E2VA 3RR5A 2WXQA 3STBD 3DHGC 1RTOA 1F9PA 3CC7A 3SU8X 4ZCKA 4AYBG 2B2YA 4C1NI 1QG7A 4DV1L 2K7VA 1BCPC 3F2BA 3EECA 1LXDA 3TL5A 2B2YC 2GRIA 1SNDA 4JI6L 4ANWA 1D5XC 1KTKA 4X57B 1D1IA 1PZID 2PYKA 4GOPC 1WD1A 2VNUD 1K8RB 5MPOA 2AKWB 2KT7A 5C1ZA 1I4RA 4A3JH 1E7PB 4W9KA 2CQOA 5GAGC 1AZQA 1EFID 3J81L 3W1GA 2F0IA 2LSSA 2IL8A 2DYMA 3EUB2 4NXNL 3DWQA 2M0XA 2N9KA 3MHSD 4ZRIA 2N78A 4P1BC 5D7GA 3PT2B 3HZXA 2F3IA 3HS0C 3DBRB 4ACFA 3KDFB 3S9WA 5J2RA 4H02A 5C44B 4DV1Q 3PRMB 3DM3A 1GXDC 1WIAA 3LDZE 4IPDA 4QY7A 4PS3A 1RL2A 5C0XJ 3CCVA 1JALA 1U4MA 2MBQA 4K5VA 5M3MH 3I4NG 1D1KA 5D65A 4MGIE 3TUOA 1JOKA 2ENBA 2WACA 3ZJTA 4NKLA 4RHSA 1MG4A 3BZKA 2TMPA 1TYGB 1VQJA 4R9WA 3KYCD 1Y69U 3LXFA 2I5LX 4RM8A 4LNOA 3PQIA 2QJLA 1UGJA 1CA5A 1C7YA 2N0SB 1UE1A 4HLEA 3GV6A 1B53A 1B9MA 3F2UA 2L76A 2YLMA 1F2MA 4HTHA 1TZOA 1WCMG 5I6YA 1V81A 4KGSA 3UGBB 4N6EB 1UE7A 2BWES 2PZWA 5BN3A 4BY7G 3PRZA 4DR6Q 3PVLA 2W3SA 1O80A 1CKNB 2B8FA 3QOJA 1BQQT 3KDFA 5CTRC 3DBSA 2KMMA 4W9CA 1AZPA 1AP0A 1Q3LA 2Z0EB 4A6QA 1YD8U 2KVZA 4GOCA 2X38A 4JBWA 3SGIA 1I3QH 1W6KA 1Z47A 1EEFD 1TWHB 2OTLA 1N5XA 1B4OA 3AU4A 4DV5L 1Q1EA 1PVOA 1R4MI 3C1EA 3VHTC 5D3DA 2NZ1D 4F7ZA 2JEAI 2BS3B 1TWGB 1T0RC 4LNQA 3M62B 2JK8A 2R7ZB 3KWLA 2DENB 4REZA 5KNBA 2R93G 1E22A 1A63A 3PHXB 4QIWB 2NB0A 4DHZB 5IGGA 4L6TB 4OHJA 3P42A 3QC8B 4BBRG 4A3FB 1I4PA 3MC0B 5KYLA 4YL8A 3QWNA 4LWCA 1AYFA 3GV3A 4YCVA 1MI0A 5BN5A 1VQKA 1D5ZC 1EQQA 2GMIC 1CKNA 3HFZB 1DCZA 3EBEA 1H9MA 3E9IA 4DV5Q 4DR7Q 5E6NA 1UELA 5C4JH 3ONAB 4KY7A 3TP5A 3RD4A 2KDIA 4HEA1 5CV8A 4CKCA 4L5RC 1HA6A 5IGFA 4PZ7A 1L6VA 3E56A 2LEKA 2WXIA 3ZUNA 3FMCA 3R8BA 4L5SA 1PRTF 1H4RA 4ARIA 2B63H 5JXVA 1LLRD 3QOLA 2ZJQA 2JWZA 5GROA 3QK0A 4BY1B 2NVXB 5DCNA 3DHQA 2J0MA 2RDBC 3NZUA 2KDFB 1J6QA 1RTNA 4CHTB 2JPHA 2VQFL 5JVH3 1FCCC 1S1QB 3TP7A 3PSIA 4A3KB 3Q3FA 4DXGA 2OXPA 2K8HA 1O7ZA 1S3OA 5M3FB 5L37A 1Y14B 2BKRB 1F9QA 1X3EA 3S17H 5D6JB 3WIMA 4KGTA 4CYEA 1H9KA 1NI2A 1DOKA 2MBHA 1BNZA 1EUJA 1K83B 4CDEC 2F0OA 1J0GA 4EZJA 2GA4B 5C0XH 1EUVB 2LUMA 3VR2A 5C5LA 3OYYA 3T3NA 5M5YB 4KLKA 2IO2B 2KHSA 2PW9A 1PYWD 1F77A 1YHQA 2MNAA 1EY6A 4DV7L 3AE3B 2NTSA 1A70A 1FYCA 3AMZA 1SMYD 2A69D 1TY0A 1F2ZA 3WOEA 5J18A 3X23A 3AN1A 1DOMA 2A5HA 4LFAQ 1KDBA 2BQQA 2QIEB 3SD5A 2ZW1A 2MPMA 3P1HA 1VQ4A 3S2DH 4HJ7A 5G3LD 1F2LA 4DNIA 3GTOH 3H09A 2A5UA 4NP5A 3K7AH 1HJPA 1BKBA 1FGUA 2ZJRA 4DV7Q 2RGFA 3CSTA 2LJIA 1ET6A 4RCNA 3UDGA 3DVNV 2JYTA 4RF1A 1A0IA 2BF8B 1R9TH 4C7ZA 2REXA 1HUMA 3BDCA 5G5GA 2OOBB 3ZDTA 1V9JA 2M19A 3TDQA 3AULA 2J0TD 4OGQC 3HOWB 2WV6D 4K8JA 3I9V1 3CCQA 4A75A 4X64L 2QDLA 1UZXB 4RH6A 1MHXA 1W3SA 4PYZA 4IUNA 2FBWB 2KMCA 4E71A 1V1OA 1D7QA 2A1AA 4QAYA 3RZDB 2JA6G 4JL9A 1H9SB 1PTOC 1JW9D 4A20A 1QOAA 4B3SL 3AV8A 4AQYL 2JA5B 1U4RA 3DBLB 4IFDH 4NJCA 1E24A 3VA5A 1WJNA 5DPWA 3JAMc 3S24A 1E10A 4PV1C 1B8AA 2BCOA 3F8TA 2UXBL 4KN4C 4JGHB 3PO2H 1IHZA 3QWZB 4JX1C 1Q1BA 2HQEA 4IM2A 3KJPA 4IM3A 4X64Q 2AX5A 4A3DB 4US8A 2OWOA 4BOSC 3GQBA 4DAPA 2KJXA 3ABVB 3DM1A 2MJ8A 2QGQA 1XNRL 4GN1A 1J7CA 2I5HA 4EZKA 2BE5D 3ZNZB 3GTGB 3ULPA 4K81A 1PH6A 1WGKA 3C1FA 1WZ0A 4H7BA 4R8IA 4CBVA 2OHFA 4YSYB 3S15B 4ZRKA 4AQYQ 2ES2A 4K3CA 3AEBB 1P8LA 2ZXRA 1M90C 4JI8Q 2Y5BB 3H8HA 5CHVC 4US9A 1X56A 4GLSC 3I4OA 3IAS1 4MELA 3RZOB 5GMVA 1H9SA 4A3LH 2IGHA 3TMEA 2O2LD 5I4DA 5M5WH 3J80E 2RF4A 4C3HB 1Q86C 5HFYA 1BXTA 1XMQL 3FDTA 1MJEA 2M0AA 2Y0SG 5IYDG 1TWAH 1EIGA 3FEWX 1IYJB 1O78A 1VQMA 1EEID 1VQOA 1I6VC 1B3AA 5LMNW 3OSOA 3SE0A 3MP9A 1SNCA 5CC4A 4E6IA 1JORA 2KDMA 2DUDA 3RT3B 4YWKA 1ESRA 3SHQA 1EY5A 4KY6A 4A76A 2CHZA 4QUFA 3V05A 4XYCA 4M01A 3I7FA 1C4QA 1E8YA 3U7DA 1E1TA 3AE7B 4K7WA 4BKGA 3A8IE 4LJZC 1VQ5A 4LF9Q 5KHOA 2NN6I 2BYEA 5KNDA 2AMCB 5JJZA 1TKWB 1XMQQ 2LFIA 3A9JB 3GB1A 4KDLB 2MH7A 3M4PA 5CYUA 2UU9Q 1XCQL 2G45B 3AE2B 4HJKA 1JCKB 1U4LA 1UWXA 1PFBA 4C3IB 1QOBA 3DUZA 3DBRI 3IXSA 2N7DA 1DOXA 1K9MC 2Q2UA 1Q46A 1NCVA 3BVGA 3NJTA 4L23A 1B44D 4DNTB 3V3XA 4OVZA 4DK5A 4BBSG 3CPFA 4KJNA 2CR5A 2K9XA 3A4RA 1N60A 3JYUA 5IE8A 2LGIA 2E3TA 5EE9A 5M5XB 3PF5A 2NPTB 4IW0A 4LK1C 1TS4A 1ZXTA 1Y8PB 4BKTA 1O7YA 3M95A 5C3XA 4A3MH 1HTLD 1H95A 1C4PA 1WGYA 2JA8H 2YYZA 3PGEA 4TRDA 3WALA 2K5HA 1OTRB 3S2AA 3A9JA 2K33A 1I4GA 3EJIA 2GBRA 3OJ4B 2EYPA 3ZTDA 1G2TA 1S4ZA 4BS9A 2KUMA 3A0JA 2G4SA 1FO4A 3FILB 3KOJA 3I5JC 4IM0A 2WB1B 1C76A 4J3OD 1HHVA 3SR6A 2X6GA 5T1GA 2CHBD 1I50B 4LF7L 3DMUA 3D3RA 1G51A 1KL9A 3OPOA 1T0YA 1E3PA 3K9OB 1PH9A 2RSNA 4IC7B 5LLIA 3NHHA 2NPTA 3EA6A 3CIRB 1PGBA 2HDEA 3PO0A 4GDLB 2KECA 2B2WA 1D8LA 3S2HH 1UGMA 1X3FA 4IZ8A 2RD0A 4EOYA 1ET9A 3VVWB 3A4SC 5JHBA 2I2YA 4IURA 2J7QB 3HRDD 4F88A 4R3DA 4YWGG 5E6OA 1XXGA 3GTKH 4QF4A 2I5MX 3Q8DA 4B3MQ 3AE5B 1F2RC 1JWBD 3IFTA 5E4WC 1EY0A 1O7IA 3JAMi 3WA0A 5EDSA 2KD0A 4LF7Q 5BMHA 1Y8NB 5ELFA 2D11A 1MGSA 2AQ3B 4A3JG 1BT0A 3FILA 2ASQA 3NTKA 1UBIA 1FFUA 3Q8AA 4ZUIA 1ZGUB 3KUDB 1WOCA 1B2TA 1E8XA 3S1RB 2ALYB 3AEAB 3QCAA 1GB4A 4AS1A 2K39A 3HVDA 4CKBA 2VUMB 4W9HA 3TS0A 3P75A 4RM9A 4G7HC 3E6ZX 2JA7B 3U52E 1HTQA 1WI0A 2YEPB 3L08A 5EKKA 1QZHA 1XD3B 3MXPA 1V97A 4GDLA 2TSSA 1BBXC 4P7IA 4XZ4A 4QUCA 2NVQH 3A5UA 1P7EA 3U9OA 1VF5C 2L0CA 4JG2A 3EIVA 3KFUA 1PLFA 4FXKC 2I0QA 4KHPL 3CCUA 4LNNA 4BBRH 1SE8A 1WXSA 4YXDB 1NY4A 2KWCA 4O0AA 1HCZA 4B08A 4IUPA 3TSSA 1VCBA 3I73A 4BAXA 3OG5A 2HQLA 4UY8C 1WTXA 2F0UA 2YV5A 2Z6BA 5IP4D 3I3TB 1N34Q 1PRTD 2XRSD 1ZXHA 3L16A 2K3UA 1UEAB 1WE7A 1SXTA 2IGDA 3O13A 4JI1L 3I70A 2HHHQ 2WIIB 3R2IA 1WTWA 1YJ1A 4HPLB 4PS8A 4WQMA 3VQIA 3GP7A 1QF6A 2ON8A 1A15A 2XVSA 1G6PA 2QW7A 1XLNA 4IKGA 3TQYA 3JC66 3C19A 4A3BH 2DHZA 3ZXRA 3P20A 3LX0A 2E2HH 4IPCA 4TKNA 4NDXA 2B76B 3VTUA 3DOWA 4A3IG 4GS3A 2BT6A 4XYOA 1SYEA 1X65A 3I2ZA 4WWNA 3VR4A 4W9DA 4ZK9B 4NQLB 2XRQD 1EYGA 1N32Q 4E74A 3H3VI 1J9OA 1T5XD 2R92B 3VAWA 2MO1A 3L3OC 5CMDA 1KRTA 4J8QA 2DLBA 3M9BA 3BZDB 5E7NA 1I35A 1MSHA 1K8GA 1Q8IA 4AYBE 1P9DU 2LGDA 2Z0DB 4WWOA 4DV2Q 5KNCA 1JQ4A 3MZ5A 3BY4B 5C3WA 5C4XB 4HJGE 3AEVA 4EQNA 2VB2X 4EX5A 4LFBL 1YNXA 3W5VB 1KLVA 2KJ6A 3FP9A 1MD2D 3AECB 3LWEA 2PIAA 2PEAA 1ASZA 4M8AA 1YI2A 1C4CA 4B0MA 1CQFA 1X3QA 3GTQB 4YT0B 4Q5VA 4DV6Q 3CQZB 1KABA 4IO9A 1JRPA 3MC9A 2WXRA 3AU5A 1CSQA 4UP9A 4DR4Q 1JMLA 2VH1A 3VDYA 4BKSD 3GOEA 4EUTA 3KQ4A 4NJ6A 3R66C 1QZGA 1MI2A 1X3PA 4I7ZC 5HURA 3A9KB 3QG1A 2B63G 2L32A 3ULLA 1WX9A 3K9PB 3P7JA 4LFBQ 3RCZA 1KHIA 3J80L 2IJ0A 1G91A 4A3CG 4N9TA 1JT8A 1XEEA 3DBLI 3GTJB 3SK5A 1CFMA 3Q3NC 1TT2A 1ZEQX 4C56C 3OW7A 2WDTB 1PH7A 1GB1A 4GN3B 4ZKBB 4WQOB 2XWBB 1EQTA 1ZKHA 3MEHA 4JI0L 3VFKA 1YQ4B 2PO4A 1EY9A 2H1EA 2GI9A 4HCPB 1BCPD 1Q12A 2EJFC 2PMVA 2AEHA 2B39A 2EVBA 4L5TA 4LNIA 3MHZA 5C0XG 4R4TA 4FO2A 1AEXA 1MBYA 2IY0B 2MBOA 5C4ZA 1OEYJ 1WY8A 4TMAB 4C4VB 4JI5L 2KNBA 3AE4B 2QEXA 2B2VC 4MH8A 1LTAD 3ND9A 3PO3G 3NBIA 1CKMA 4CGYB 1ZXIA 5A35A 1TBEA 2DYOA 3A9KA 3N32A 4JQWC 2F0HA 2FUG1 5IT9E 1OGWA 2EYMA 1K0RA 3UE1A 3S1QH 2RR9A 3CSFA 2IZVB 4LF6L 1NYRA 3VYSA 3W5OA 4JI0Q 3Q22A 3RMHA 5COYA 4TQ1A 1WGRA 1OXUA 2KENA 1LO5D 4DGZA 1MIUA 3RLNA 1HA5A 2N88A 1NJIC 2KN5A 4AUQC 2G1EA 3ERSX 2V4LA 1D6EC 2DGYA 4JI5Q 2AQ1B 2BYTA 2Z9HA 3PHWB 3M4QA 3PF4A 4JK1C 1VZ6A 3I56A 1UBQA 2N55A 5GAEC 3I63C 1I94L 1A5RA 3SK4A 4IDIA 4A3EH 2WAQG 3G7LA 2FMMA 2RPQA 1AWDA 4C4VA 1OXTA 4NNJB 1RRBA 1PMRA 2RPVA 4JE3B 1Y1VB 2WXOA 4MTNA 2YTVA 3VR5A 1GJZA 3VR8B 1IL8A 3I3CA 3NVYA 4F87A 1FR3A 1V5OA 4EEWA 1A3VA 3IT6B 2LHEA 5EPLA 1YX6B 2HUGA 5BN4A
chains in the Genus database with same CATH topology
1HQRD 2JU6X 1GUGA 1ML0D 3URYA 2MJEA 2ZXOA 2N7JA 4Q2JA 2FINB 2X69A 1U4PA 2KCNA 4A93B 5DM63 1GOZA 1XLPA 1SNOA 3I4MB 3NPPA 2NMQA 4OZBA 1EM7A 4A55A 1M8AA 3KBGA 2IX0A 2DY7A 1CM9A 1RYJA 2J52A 1F2RI 4DAVA 3H0GB 1LTRD 2A74C 3W2DA 3BWUD 2BS4B 4HEDA 1KDCA 1G8ZD 5EBCA 1GJXA 3K5MA 1PZKD 2F0DA 4FP5D 1XF5L 3T4AC 1SFOB 4KD4A 1TS3A 1STGA 1FRRA 2AWNA 4P2CB 1VMPA 4KY5A 1HZ6A 1FM0D 1E6EB 2KEEA 4CJ1B 1B9NA 1A2UA 3X3MA 4IN3A 5GXGB 1SYGA 1RM6C 1UNSA 3KUPA 1YNJC 2YEPF 4MIUA 4GZYC 5EE1A 3LWUA 3NWSA 3OIQA 1XLQA 3Q8FA 4HMJA 2W55A 1EL0A 5KRUA 4WH4A 3W5UB 3T51B 2BB5A 2V3PA 5LHY1 1SYBA 3S14B 3DWAA 1ENAA 5FLXL 1Y1WB 1MSGA 2NYZD 1EYCA 2F0GA 1LT5D 5CR3A 2B8GA 4YSXB 4ABNA 3A55A 1XLOA 4ZKCB 4IUUA 1AFPA 2J4XA 1ZYRC 4UDUC 4DXFA 2A6HC 1VDVA 2JXTA 3BYTB 3E0JA 1SYFA 1S5BD 1TWCB 2VZKD 2VB3X 1RCVD 2BBCA 3RPFC 1PXUA 2F0TA 1PFMA 3W3AA 2WDQB 5C6AA 1ZPSA 2PVGC 1PUTA 3X3NA 5DM73 2DWQA 2A68C 1TKYA 3D8GA 3I4LA 1CI3M 5D14A 2HCCA 3OWEB 1STYA 1VRAB 4HCEA 1PTOD 4HSVA 5BYQA 3R3OA 1FCLA 1STHA 4KHZA 3A7LA 4MT5A 4C2MB 3GTLB 3PIO3 4RKLA 4K5XA 2HCIA 1EYDA 4OZCA 1K51A 1UWMA 1LV9A 2PQEA 2XIWA 1IYUA 5EE0A 3AEDB 3D6WA 3W9CB 1STNA 2B2UA 1IKLA 1STBA 1IKMA 3CRLC 2GB1A 2NBFA 2E2IB 4A9AA 3VYUA 4DAYA 4RWSC 1NAPA 5IT9L 4HKZE 1IUEA 2WP8J 2IWHA 5K5PA 4P16A 1BOSA 4IQZA 4XWWA 5J39A 1EIHA 1I4XA 1CZPA 4RGOS 4FF2A 3SK8A 3KLSX 2Z4HA 2NUCA 2O5JC 3WDNA 3BK2A 1EWCA 1UAPA 3BYYB 2F0MA 3OIPA 4RHRA 5H92C 1CK1A 3PMFA 2PPBC 2F3VA 5K36H 1SE3A 3D4WA 2J7ZA 4IALA 3D4DA 4XDDA 1PFDA 2G9HD 1TR5A 1LTSD 2WXKA 3R2TA 1QOHA 3N52A 3MWYW 3M3YB 3DEPA 4HAEA 3OMGA 4MM3B 2Y5PA 3A8JE 4AYBB 5T8IA 3FPPA 2MUYA 1ZP0B 2WXHA 1M4VA 3AE6B 1HFGA 4ILWA 1YNNC 2M9VA 3VYTA 4OL7A 4KI0A 5JOBA 5KYIA 5HHDG 2EELA 5BYSA 1FNVA 2EY5A 2IX1A 3A8KE 3MHBA 1VZ8A 3P4RB 4DA2A 4MACA 3CRKC 3KLRA 2WLBA 1GUSA 2ACZB 1IW7C 1VF7A 2WU5B 2PZTA 2F0JA 1QT9A 5JAVA 1DONA 3R93A 2FHTA 2NVYB 4N9PA 5E4XA 1RFKA 4PMBA 3I4NB 2PW5A 1QE6A 1QKZA 5EKIA 1PDXA 1ENCA 4KJOA 1B9RA 3S2HB 5F2DA 1VJKA 4XE0A 2WXFA 2NN6H 2F0QA 3L9AX 3FKIB 3MXUA 3Q0AA 1XTCD 1WCMB 4EE2A 1JB3A 4BY7B 1Q90A 4Y7NB 3SXHA 2F1MA 4XQQA 4H44C 1SAPA 1LT4D 1N62A 5BMGA 3H3VC 3KK7A 3S1MB 4DNRB 4B0EA 4KV6A 5FO8B 4RA8A 4K6LA 3K5LA 2KEDA 3TN2A 4WJWA 4XWTA 5TSSA 2R93B 1CHPD 3K0YA 3HGBA 4BBRB 4IUQA 3TEZA 2AUKA 3B9JA 3S1NB 2FMCA 4NAMA 1B1ZA 4J6HA 3BK1A 1R7SA 5FR3A 1SDFA 3M4OB 1I4HA 1EWHA 3GD7A 4KKSA 3RUZA 1T3QA 2F0SA 5EPKA 4C3JG 1S5ED 1L4DB 1G2SA 1CTMA 1NVID 2BS2B 4WRDA 4IOIE 5EGTA 4FF1A 2RBMA 1Q10A 3GO5A 3IKJA 1LTBD 5J22A 4RAUC 2EOTA 1LABA 1GPXA 3SFDB 3NVWA 2EE1A 1K8OA 1DOIA 3D31A 4ZHPA 2C9OA 2F0FA 2G9DA 1QQRA 2HDLA 5FOBB 1C9FA 3AB9A 3VRBB 1OQRA 2XN9C 4L63B 5CBAE 1A6XA 4ARCA 1HEZE 4QCLA 2CVRA 5IGEA 3B2FA 1EY8A 1XO3A 1LACA 2RMMA 3K5NA 1SJHD 4RNAA 1UUPA 4K2KA 1KF6B 2CJNA 5ELCA 3HOVB 4IFDI 4OO1I 5LNK1 4L8JA 3D6CA 3H6MA 2SNSA 1BR9A 2LMCB 3P4QB 1FGBD 2NVTB 1VDZA 3MVVA 2CJOA 3B2GA 2Q8IB 3GS2A 3PUYA 3NS1A 1W6JA 1K53A 1DD2A 2RA4A 3P63A 4FXGC 1D2BA 1TVXA 2B2WC 2D5DA 4BWGB 1PTOH 2L55A 4DF7A 2JA6B 1FRDA 1GAQB 3S1QB 2CW0C 2O4XA 1H9JA 4HMIA 2Z1CA 3L4PA 1WD0A 4HKQA 4M0WA 4ULLA 2Q8RE 4PNYA 3IAM1 2LMCA 1L6UA 3C46A 3A56A 1QWYA 4LTUA 4ODGA 3AE9B 2D5GA 2EYJA 2A6ED 2IDYA 4ME5A 4RGNA 1F0ZA 1BF4A 1GUOA 2MEKA 4HSPA 2QMTA 4ID6A 1QB5D 4OIJA 1I4QA 1T5EA 4RFBA 4HR7B 2Y0SB 4WORA 1CA6A 2K04A 1JR0D 2L12A 1ZDVA 3HEJA 1VCIA 4K2LA 1GUNA 1ZUD2 3N9YC 2MJ3A 2DN8A 1TIID 4H13C 2QILA 5FLXE 3MXNA 3H94A 1DJRD 1A3UA 2OF1A 4NAWB 3OWFA 3M85A 2EYLA 3J7AV 3Q6SA 3ZYYX 2K03A 1RD9D 5IGDA 1KDAA 2E2DC 3I8ZA 2BW2A 1EOTA 1LTGD 1LTID 5CV7A 1NR2A 2EKIA 2XSCA 3I91A 4BBSB 1DZ1A 5IODA 3NZ3A 1I6HB 3Q23A 2DY8A 3U9SA 1TKEA 5FO9B 1WTVA 2RSOA 1YNJD 4JPSA 2YU9B 1FD7D 1OO9B 2QCPX 1C8CA 2WU2B 4CKEA 5BMIA 4V0BA 3AEEB 1P7FA 3SFEB 1XYIA 3UI2A 1E2ZA 3TEXA 2IGGA 2BOSA 3L7ZC 3A54A 3S16B 1F2YA 4LAAA 4TSSA 1OFFA 2WP9B 2K01A 3TEYA 5K36G 3GTPB 2EY1A 3DEOA 1SBBB 1KNEA 2MJDA 2H89B 1DXMA 4DQOC 1OXVA 1DOYA 2JYEA 4G7OC 2QEJC 3C2PA 4X3UA 5DNFA 2KACA 4OIKA 3PIP3 1Y56A 3JAML 3HP3A 2WXNA 5C5MA 1ZYRD 3ERQA 4UAIA 2A6HD 1EU4A 1V43A 5I2YA 3MTSA 3K6OA 4A3JB 1J8IA 1KNAA 3RFZB 4EQPA 1X32A 2KVMA 4BA1I 2FE8A 2K5PA 4MHEA 2PCFB 1N63A 5DEHA 4ZHOA 1HRJA 5E3FA 4B9WA 2AQ2B 3BVMA 4K8IA 1V8CA 3LB8C 2KQ3A 3T16A 1IGCA 1ILPA 2Z8LA 1N61A 1YMHE 1CHQD 2L83A 1EY4A 5M3MB 1RWSA 1JWAD 4PQXA 3H91A 3KLSA 3VQIA 3VYRA 1A2TA 5EPJA 2QDBA 4JWSC 1XX8A 5E1FA 5ELDA 4WIPA 4H2AA 2E75C 2NN6G 3A7AB 3AEGB 1WTPA 4KMUC 4OZAA 1K8MA 2K5WA 2K6AA 3BG3A 5G3LF 4PMWA 3EGRA 2WKDA 5BYRA 4EGVA 5CBEE 2E6XA 3Q8CA 1KAAA 3VRAB 3ZJVA 1FXAA 2L1BA 2DNEA 4LMQD 1I3QB 4ZLTF 5DAUA 5FKAC 2SOBA 4A3IB 2INNE 1PFNA 1IGDA 2I38A 5CGKA 4KGRA 2SEBD 4RKBA 2JE6I 1CZGA 2W3RA 1HUNA 5C4JB 2J53A 4K6DA 1E2WA 2K28A 3IAYA 4KN7C 3M7NA 3EFXD 4FXCA 1KLGD 1QNUA 1MPEA 2EJGC 2DBYA 3VA7A 3M4YA 2D9UA 2B63B 2ONQA 3PUVA 2HTME 3NUHB 1BUVT 3ZGZA 3WCQA 2RDFA 3CWIA 3S17B 5CV5A 1V8QA 1GHJA 1CT1D 1QCBD 1SYCA 4G57A 4KK7A 2WS3B 2X6LA 1JROA 4N58A 1II3A 1WYGA 3DXJC 3PO3B 2K5QA 4N59A 3K59A 4GDKB 5KIXA 4XYQA 1F9SA 2JP1A 4JWUC 4KTAA 4XQJA 1IW7D 3S2DB 1PGAA 4K14A 3GTOB 3G6JB 3SDZA 1JOQA 2RQXA 1RF2D 3SVMA 3K7AB 5I9PA 1DM0B 3IT4B 5EE3A 3TZDA 3Q69A 3LNNA 3TP8A 1ROEA 2F0KA 4ZRZA 3AE8B 1R9TB 5E6JA 1SNPA 2F0NA 2WAQB 1VZ7A 2RKSA 2PW7A 2RDGA 2CU3A 2MP1A 1YJJA 4F7XA 3CHBD 4KX6B 4G4KA 3NTIA 4XIGS 1L0XB 1Z7TA 2F0EA 3VR3A 2QKIC 4TQUS 1TKGA 2PVOD 1BDOA 2M00A 2EY2A 3N6RA 3V96A 4MN3A 2L9HA 3OMCA 3PO2B 2KWDA 4BA2I 1SSOA 4WURA 1LT6D 1TU2B 4IUVA 4O42A 2B2UC 5HGTA 2JWUA 1V1PB 1NSNS 2NWGA 1EZ8A 4KKTA 4ZRQA 1A3TA 2SAKA 5M5WB 1BMLC 1TWAB 3NSWA 1WTRA 2Q5WD 4CJ2C 5JEAJ 4USAA 5CV6A 4FXDA 4L2YA 3ITPA 5LL6S 2F0PA 1SNQA 1V1PA 3MAQA 3HVZA 1SEBD 2PTLA 2JYOA 2Z4IA 5IGBA 3HRZC 3OHXC 1HQMC 4IFDJ 3AMUA 3NP8A 4C3HG 1JQYD 2Y3AA 4EQOA 1EWYC 2WDRB 3TEWA 2MHVA 2C5CA 1YN4A 2NTTA 2KAJA 3P4SB 1WVLA 2R6GA 1WRIA 4A3MB 2BA0A 5AUKA 2E76C 4LLGM 2ZW0A 2JA8B 4A90A 2JSOA 2K5DA 1C79A 3C3LA 2VZKB 3MJ5A 5JPMC 4C3IG 2F03A 2ICIA 4Z9CB 1JWMD 4D2KA 2L11A 2L1AA 1L5PA 1JWSD 1F9RA 3DWGC 1TS2A 4PMCA 4DFAA 3RLFA 3FVQA 1FNUA 2VXWA 4KHVA 1ICWA 2AUJD 1E0ZA 1HPCA 3ZQ4A 1SE2A 1IBXB 3K58A 4X3TA 2J42A 3ETRA 3V2TA 2CW0D 1PTOB 1S5FD 3GTMB 3P4PB 1KFYB 3GTKB 3FPUB 4O1NA 1SB3C 1VR9A 1S5DD 5I2XA 3IFDA 3NK9A 1GUTA 2WQYB 5G5HA 4HROA 4QMGA 5JEAH 4HN7A 4NMZA 3NWTA 1J7BA 1K52A 3NVVA 4PT5A 5NUCA 3NVZA 3WOFA 2INPE 2BDOA 1NENB 3NQIA 1LT3D 3J9CA 5A2QL 1ZE3D 3AM9A 1H9RA 4ZUJA 1IBXA 1BCPF 1EZ6A 1SF0A 1ZDXA 2NVQB 1VLBA 3Q24A 2K32A 3NBHA 3U7ZA 5ELEA 1SE4A 4I65A 4OO1H 3TBIB 2AWOA 1CJEA 1RODA 1Z6HA 1VMCA 3CKIB 4DK0A 1DOLA 2EYFA 1TQOA 1K50A 2WDVB 3K57A 1U9RA 5C0XI 1SJED 5J1ZA 4FF4A 2M56B 2JX5A 3U4EG 2RDHA 4XXEA 2LS01 1SNMA 2F3WA 3T56B 4A3BB 1AW7A 1TJEA 2L52A 2F0WA 2E2HB 4KKIA 3SK6A 1L0VB 3DWPA 3JAME 2L5TA 3QJYA 5KEEA 1WTOA 1DYQA 2LKVA 3SR1A 5CORA 2R3ZA 2RVLA 1ZOYB 1L0YB 1G291 3QO2A 2M2LA 1QOFA 3HG9A 2EY6A 1HZ5A 1NI3A 5EBDA 3E5SA 2O5IC 5IGCA 5D3IB 4M1UB 4HCSA 4L1BA 4CJ0B 2BB6A 1S5CD 2OEOA 2JZPA 1QJOA 5FK9C 5LL6X 4DN4M 3MA2B 1OQQA 5CV4A 2DNCA 4X3SA 3T3OA 3TZUA 2KA7A 1YNTE 3EROA 1Y8OB 4C7YA 4AQ7A 4TQ0A 2PMZB 2IW3A 1FIQA 1R4QB 3KF8A 1NR4A 1EQVA 1MVKA 2WNMA 1HXYD 1XCTL 1GUWA 1RHPA 1FXIA 2PKOA 1ACCA 1RKNA 4FF3A 1QILA 1SSNA 3NXWA 5ELBA 4IUTA 1GHKA 1PDQA 1SMYC 2A69C 2XNAC 2JSVX 3UI3A 1WSPA 5C3EB 2EYOA 2FJ2A 5EQ0A 3ZJUA 2K0PA 4FNFA 4WAFA 3Q8BA 3VR9B 1ESFA 5FO7B 1LTTD 1BUIC 4XT3B 5ISRA 4V190 3BDOA 5EJWA 3BDLA 3J7YW 1SIJA 4HRSA 1QOGA 3DWMA 4P6VF 3I72A 3QIAA 4A3EB 3M7GA 3LYYA 4OW0A 1O7LA 1PGXA 3MFYA 3HOZB 2IX3A 5C2TB 1NEKB 4C3JB 4U68A 2FFKB 2QSDA 1RJTA 1TS5A 3KWVA 3QB3A 3ND8A 3AE1B 2W54A 4YIJA 2D62A 3HKZB 1MHHE 3MFGA 2XWJB 2KCCA 1L4ZB 2E74C 2D2CC 2WXMA 2BE5C 2SDFA 3EVQA 2A73B 1FNWA 4K5WA 1RDPD 1QLBB 3PUWA 1J7AA 1I7HA 1STAA 2OEDA 1OXSC 2EXZA 4KD3A 2PNRC 1PTOF 2KN4A 2HDMA 3T13A 1T6BX 1ENFA 1KRHA 4CQNA 1IYVA 1JOOA 4RF0A 5JVG3 1STEA 3FRPB 3HOUB 2F0LA 3KBXA 1EY7A 4ITKA 4G7ZC 3T53B 1C78A 4S3SA 5C4HA 1C48A 3I57A 3AU7A 4F8MA 1NUCA 2WINB 3J81E 2ZT9C 2LFNA 3MXGA 2N9LA 1G6ZA 3U2SC 5HI1A 2ZXPA 3AEFB 3HUIA 4A8XC 2WXPA 2PLPA 4XTCS 1YJIA 1CZWA 2I46A 2F4IA 3EQLC 3P1MA 1WWTA 1WXQA 1E9MA 3Q8EA 2BTEA 2B2TA 1AN8A 4YTMB 2B2TC 2EZVA 4WWMA 1FD6A 3FC4A 4DK1A 2QF7A 3I90A 1C77A 1JE4A 5AUIA 3SHLA 1FFVA 5IIFA 1KLUD 1HFNA 4ZQ3A 2K22A 4LK0M 2K05A 1QNKA 4FVMA 3AB5A 2BDNA 4X3KA 2EYHA 3AH7A 3PUXA 2V3NA 3FAHA 2A68D 4TKOB 4YSZB 3HOYB 1E0BA 2B2VA 1DGJA 2IT1A 1N5WA 4DU9A 1YN3A 4ZAIA 4XT1B 3OOCA 2SNMA 3NRZA 4NW2A 1TWFB 2JXMB 2F0VA 3PZ7A 3NUCA 4KKJA 2IPKD 2KOLA 5M9OA 2H4OA 3CU7A 3E9SA 4B9XA 2E2JB 1PRTB 4RCOA 1EYAA 2ID0A 1PZJD 3PUZA 5JEAG 2KQ4X 2WXGA 1D5MC 1YQ3B 1KH0A 2BA1A 2ICEC 5I6WA 4H0LC 3VR6A 5EKLA 2WKCA 1EU3A 2A6EC 1ONLA 1JICA 2OT2A 1ILQA 1R4PB 3W1SA 2L4NA 3NQTA 3NE5B 4IFDG 4OO1G 2MGSA 3IL8A 5CV9A 1PRTC 4EVOA 1C4AA 4ZOHC 1ZKOA 4XDCA 2EPBA 3NTHA 5HG2A 4ZYSA 4RGTA 3TP6A 5AFWA 2LY7A 1BO0A 5I9OA 2V4IB 4J1MA 5T1IA 1CQVA 2R61A 1D4BA 4A3GB 2PZUA 3PV0A 5IOCA 2JEBI 3SEBA 4YTNB 1FEHA 2EDGA 3BVZA 3D4RA 3J7AF 4C1NK 2V4DA 3K5OA 2EJMA 1NYQA 2WXJA 4XQNA 1YN5A 3BS1A 2LHDA 1BCPB 3PZ8A 1YNND 1JWUD 5A2QE 2WXLA 4WFN3 1SYDA 1JC7A 1OXXK 4NZLB 2V0GA 4C80A 4RGMA 5JPNC 1HTPA 4QB4A 2W82A 1FMAD 2Q8TA 3BIID 3HOXB 4U673 2CQAA 1TY2A 2I07B 1B50A 3C8YA 4YTPB 4FYDA 1XWEA 4ZRPA 2Y5CA 5KGUA 4KKUA 5C3JB 2H88B 1WTQA 2JQRB 2K1BA 5H8YE 4XDXA 4Q0FA 4R8NA 1E2VA 2WXQA 1RTOA 1F9PA 2B2YA 4C1NI 1QG7A 2K7VA 1BCPC 2B2YC 2GRIA 1SNDA 1D5XC 1KTKA 5MPOA 1D1IA 1PZID 2PYKA 1WD1A 2VNUD 1I4RA 1E7PB 1AZQA 1EFID 3J81L 2F0IA 2IL8A 2DYMA 3EUB2 3DWQA 2N9KA 5D7GA 3HZXA 3HS0C 3S9WA 5C44B 1GXDC 5C0XJ 1JALA 1U4MA 4K5VA 1D1KA 5D65A 3TUOA 1JOKA 2ENBA 2WACA 3ZJTA 4NKLA 4RHSA 2TMPA 1TYGB 3LXFA 4R9WA 1Y69U 2QJLA 1UGJA 1CA5A 2N0SB 3GV6A 1B53A 1B9MA 3F2UA 1F2MA 4HTHA 1TZOA 5I6YA 4KGSA 4N6EB 2PZWA 5BN3A 2W3SA 1O80A 2B8FA 3QOJA 1BQQT 2KMMA 1AZPA 1AP0A 1Q3LA 4A6QA 2X38A 4JBWA 1W6KA 1Z47A 1EEFD 1TWHB 1N5XA 1B4OA 1Q1EA 3C1EA 5D3DA 2NZ1D 2JEAI 2BS3B 1TWGB 2R7ZB 3KWLA 4REZA 5KNBA 4QIWB 2NB0A 5IGGA 4L6TB 4OHJA 3P42A 4A3FB 1I4PA 3MC0B 5KYLA 3QWNA 1AYFA 3GV3A 1MI0A 5BN5A 1D5ZC 1DCZA 1H9MA 3ONAB 4KY7A 3TP5A 3RD4A 4HEA1 5CV8A 4CKCA 1HA6A 5IGFA 1L6VA 3E56A 2LEKA 2WXIA 3FMCA 3R8BA 1PRTF 4ARIA 5JXVA 1LLRD 3QOLA 4BY1B 2NVXB 3DHQA 1RTNA 4CHTB 5JVH3 1FCCC 3TP7A 4A3KB 4DXGA 2OXPA 1O7ZA 5M3FB 1F9QA 4KGTA 1H9KA 1DOKA 1BNZA 1K83B 2F0OA 2GA4B 5C0XH 2LUMA 3VR2A 5C5LA 3T3NA 5M5YB 2KHSA 2PW9A 1PYWD 1F77A 1EY6A 3AE3B 2NTSA 1A70A 1FYCA 3AMZA 1SMYD 2A69D 1TY0A 1F2ZA 3WOEA 3AN1A 1DOMA 2A5HA 1KDBA 2QIEB 2ZW1A 2MPMA 3P1HA 5G3LD 1F2LA 3H09A 4NP5A 2LJIA 1ET6A 4RCNA 2JYTA 4RF1A 4C7ZA 1HUMA 3BDCA 5G5GA 2M19A 3TDQA 2J0TD 4OGQC 3HOWB 2WV6D 4K8JA 3I9V1 4RH6A 1MHXA 4IUNA 2FBWB 1V1OA 3RZDB 1H9SB 1PTOC 1JW9D 1QOAA 3AV8A 2JA5B 1U4RA 4IFDH 4NJCA 1E10A 3VA5A 4PV1C 2BCOA 4KN4C 1IHZA 4JX1C 1Q1BA 2HQEA 4US8A 2AX5A 4A3DB 3GQBA 4DAPA 2KJXA 3ABVB 2MJ8A 3DM1A 1J7CA 2BE5D 3GTGB 1WGKA 3C1FA 4H7BA 4R8IA 4CBVA 2OHFA 4YSYB 3S15B 3AEBB 2ZXRA 3H8HA 4US9A 4GLSC 3IAS1 3RZOB 1H9SA 2IGHA 3TMEA 2O2LD 5I4DA 5HFYA 3J80E 4C3HB 1BXTA 3FDTA 2M0AA 1EIGA 3FEWX 1O78A 1EEID 1I6VC 1B3AA 3MP9A 3OSOA 3SE0A 1SNCA 5CC4A 4E6IA 1JORA 2KDMA 1ESRA 1EY5A 4KY6A 4QUFA 3V05A 1C4QA 3AE7B 3A8IE 4LJZC 2NN6I 5KNDA 5JJZA 2LFIA 1TKWB 3GB1A 2MH7A 5CYUA 1XCQL 3AE2B 1JCKB 1U4LA 1UWXA 1PFBA 4C3IB 1QOBA 3DUZA 3IXSA 1DOXA 1NCVA 3BVGA 4L23A 1B44D 4DNTB 3V3XA 4OVZA 4KJNA 2K9XA 1N60A 2LGIA 2E3TA 5EE9A 5M5XB 4LK1C 1TS4A 1ZXTA 1Y8PB 1O7YA 5C3XA 1HTLD 1C4PA 2YYZA 4TRDA 2K33A 1I4GA 3EJIA 2EYPA 1G2TA 1S4ZA 4BS9A 2KUMA 1FO4A 3FILB 2WB1B 1C76A 4J3OD 1HHVA 3SR6A 2X6GA 5T1GA 2CHBD 1I50B 3DMUA 3D3RA 3OPOA 2RSNA 3NHHA 3EA6A 3CIRB 1PGBA 2HDEA 3PO0A 4GDLB 2KECA 2B2WA 4IZ8A 2I2YA 1ET9A 4IURA 3HRDD 4F88A 4R3DA 4YWGG 1XXGA 4QF4A 3AE5B 1F2RC 1JWBD 3IFTA 5E4WC 1EY0A 5BMHA 1Y8NB 5ELFA 3FILA 1MGSA 2AQ3B 3NTKA 1FFUA 3Q8AA 4ZUIA 1B2TA 3S1RB 3AEAB 1GB4A 4AS1A 3HVDA 4CKBA 2VUMB 3P75A 4G7HC 3E6ZX 2JA7B 3U52E 2YEPB 5EKKA 3MXPA 1V97A 2TSSA 1BBXC 4QUCA 1P7EA 3U9OA 1VF5C 2L0CA 1PLFA 4FXKC 4YXDB 4B08A 1HCZA 4IUPA 3TSSA 3I73A 1WTXA 2F0UA 1PRTD 2XRSD 1ZXHA 2K3UA 1UEAB 1SXTA 2IGDA 3O13A 3I70A 2WIIB 3R2IA 1WTWA 4WQMA 3GP7A 1QF6A 2ON8A 1A15A 2XVSA 1XLNA 4IKGA 3P20A 3LX0A 4NDXA 2B76B 2BT6A 4XYOA 1SYEA 3VR4A 4ZK9B 2XRQD 1J9OA 1T5XD 2R92B 3L3OC 5CMDA 4J8QA 2DLBA 3BZDB 1MSHA 1Q8IA 5KNCA 1JQ4A 3MZ5A 5C3WA 5C4XB 4HJGE 4EQNA 2VB2X 3W5VB 1MD2D 3AECB 3LWEA 2PIAA 4M8AA 1C4CA 4B0MA 1CQFA 1X3QA 3GTQB 4YT0B 4Q5VA 3CQZB 1KABA 1JRPA 2WXRA 1JMLA 3KQ4A 1MI2A 1X3PA 4I7ZC 5HURA 3QG1A 2L32A 3P7JA 3J80L 2IJ0A 1G91A 4N9TA 1XEEA 3GTJB 3SK5A 1CFMA 1TT2A 1ZEQX 4C56C 3OW7A 1GB1A 4ZKBB 2XWBB 1EQTA 3MEHA 1YQ4B 2PO4A 1EY9A 2H1EA 2GI9A 1BCPD 1Q12A 2EJFC 2PMVA