4OHJA

Crystal structure of toxic shock syndrome toxin-1 (tsst-1) from staphylococcus aureus
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
194
structure length
194
Chain Sequence
TNDNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYGPKFDKKQLAISTLDFEIRHQLTQIHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEING
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of toxic shock syndrome toxin-1 (TSST-1) from Staphylococcus aureus
rcsb
source organism Staphylococcus aureus
molecule tags Toxin
molecule keywords Toxic shock syndrome toxin-1
total genus 58
structure length 194
sequence length 194
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4ohjA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4ohjA01
1FNWA 1SE2A 1DJRD 1ET6A 1LT6D 4ZYSA 1PTOB 2O2LD 3URYA 1V1PB 1S5ED 1SEBD 5I4DA 1S5FD 3W2DA 3TSSA 1S5CD 4TSSA 4UDUC 1KLGD 3BZDB 1I4XA 4RH6A 3BVZA 4RHRA 1BCPD 1LT3D 1I4PA 4K6LA 1XTCD 1FNUA 1LLRD 1PRTD 2R61A 1TY2A 4O1NA 5ELCA 5FKAC 1STEA 4C56C 4RCOA 1CT1D 3MFGA 2QEJC 1LT5D 1LTGD 3EA6A 1CHQD 1ET9A 5ELFA 1BCPB 1YN3A 3BVGA 1M4VA 4RFBA 4RGNA 1JQYD 3GP7A 1FGBD 4DXFA 2NTSA 3OWEB 1S5BD 1RCVD 3MC0B 2Z8LA 1D6EC 1PZID 5TSSA 1YN5A 2ICIA 1ENFA 1LTBD 3DWQA 3SEBA 2RDGA 2WV6D 1TS2A 1T5XD 1LTTD 3BVMA 3V05A 1CQVA 1CHPD 1HXYD 2XNAC 1ESFA 2G9HD 1HTLD 1PRTB 1DYQA 5FK9C 1HA5A 1EFID 4OHJA 1L0XB 2SEBD 3R2TA 1AW7A 1AN8A 1PYWD 1I4HA 1PTOF 1JWMD 4DXGA 4NZLB 5ELBA 4BWGB 1RDPD 1TS5A 4L6TB 1D5MC 1PTOC 3BYYB 1KTKA 1LTSD 1D5XC 1EU4A 1GOZA 4RGMA 1KLUD 1LO5D 3KLSX 2NTTA 1PZJD 1JR0D 1TS3A 1LT4D 4RGTA 1F77A 1FNVA 1G8ZD 1MD2D 4L63B 1EU3A 1JWUD 3DWAA 1BCPF 1EWCA 1SE4A 1SE3A 2CHBD 4RHSA 1B1ZA 1PZKD 3O13A 1EEFD 1TY0A 2AQ3B 5ELDA 1S5DD 2IJ0A 3DWPA 1EEID 3R2IA 1BCPC 3BYTB 1L0YB 5D3IB 1UNSA 2AQ1B 1SJED 2XN9C 1SBBB 4RGOS 1RD9D 1LTID 3EFXD 5D3DA 1UUPA 1BXTA 1LTAD 1XXGA 1RF2D 1SJHD 1FD7D 1JCKB 1SXTA 1V1OA 3CHBD 2XRSD 5ELEA 3R8BA 1TS4A 1I4GA 1LTRD 2AQ2B 2J4XA 1PRTF 1QILA 1PTOH 1B44D 1PTOD 2TSSA 1V1PA 1CK1A 2RDHA 1PRTC 1HQRD 1JWSD 1D5ZC 2XRQD 1YN4A 1I4RA 2QILA 1I4QA 4Z9CB 2IPKD
chains in the Genus database with same CATH superfamily
4X64L 4KD3A 4IUPA 3AE4B 1XCTL 3KW5B 4BOZB 2F0DA 4LK0M 1LQBA 3PGEA 1Q0WB 3OAWA 1X6OA 3QOJA 5AUIA 2FAZA 1AE2A 1A2TA 1SROA 2P5ZX 5KNBA 4RH6A 3U9SA 1Q5WB 1WM2A 2CW0D 5C5LA 4BY7G 1TY2A 3A1QB 4L5TA 4A3FB 2IY5B 5C44G 1Q90A 1VF7A 4LF8Q 2HJ1A 3DBSA 3HOWH 4JI2L 1NUCA 3T1YL 4YHHL 4X66L 3G4SA 3K5NA 3S1RH 4KMUC 4FYDA 2KWCA 3A9JA 4TUUA 3A8JE 1L1OB 3S1NH 1K52A 4FF4A 4BKGA 3Q8FA 4DXFA 2GBMA 1PA6A 5IGCA 2BB5A 2R7DA 2F0EA 4G4KA 3JAMi 1GAQB 1CSQA 4XQQA 2LRWA 2WXGA 4JG2A 1MJEA 3VYRA 3DWQA 2VUMB 3Q3MC 5IGBA 3ZYYX 4XT3B 2JA5B 4HCNB 4WAFA 4J8QA 2QEXA 1LM8B 1J8CA 2WDVB 2RPVA 3CQZB 3A7AB 4JE3B 3HOZG 2N4FA 3A9KA 1QVFA 4MT5A 1HJPA 3SHQA 4A8XC 2KHJA 4WQOB 1EFID 4X57B 2LJ5A 3OHXC 4C3JG 1K50A 3VYTA 3PO3G 3M9BA 4ULLA 5IT9L 1JWMD 3X3MA 4P16A 4NZLB 2F0QA 3KLSA 2UXCL 2RBMA 4LF7Q 5IGFA 2KFKA 3S16H 1HZCA 2WACA 3DOWA 1U5KA 4DAPA 1YX5B 3K7UC 4KY7A 2J42A 5BN5A 4H13C 4GNXB 2CFMA 4MH0E 4OIKA 3EGRA 4NW2A 5EJWA 3PHXB 4O0AA 1TWHB 4RG1A 2PQAA 1MHWC 5IP9H 4K5XA 2VW9A 1FJGQ 1RL2A 2LXCA 1JWUD 5K36G 1TKEA 2IGHA 2IHFA 3VTWA 3C46A 3S1MH 3C1EA 4KY6A 1J8IA 3STBD 2K39A 3LGJA 5EDSA 4CDFC 4C2MB 1QF6A 3TBLD 2JA9A 5AFWA 2F3IA 4DV1Q 3DEPA 1H95A 3P4SB 4FA6A 2V1CC 4MIUA 4HIKA 5IGEA 2N9EB 2EKIA 2PI2E 1RF2D 1CJEA 1WTWA 4IWOA 1PH7A 3J80L 1SNPA 2KD0A 2FCSA 1ASZA 1T5EA 5M5WH 3WWVA 3CMAA 4H0LC 1P0RA 2B2YA 2XVSA 4WJ3M 5GMVA 4BVUC 2INNE 1PTOD 3M4OB 4KKJA 1WCMH 1WGRA 3GTGH 4I7ZC 1RJTA 3EC8A 2HE7A 2NZ1D 3FP9A 2GLSA 5JHBA 1QE6A 1E7UA 2N55A 2ZXOA 5IKCM 2LSSA 5C3EG 3L3OC 1SE2A 1GB1A 1QCBD 4O2DA 3A5ZB 4CDEC 4EVOA 4X65L 4R4TA 2R92H 3HOVG 3X0WA 1Q8IA 3DEOA 3PLUA 4B9KA 4LNIA 3PQIA 1MI2A 2B39A 1OO9B 1S5FD 1E2ZA 2ASBA 5M5XB 4OWTB 2E2IB 2UXDQ 3J9CA 3MP9A 4LDTB 4R4CA 3TDQA 4USAA 2I5MX 1TTNA 1I4PA 1DOLA 3RZFA 1HTOA 2RCNA 3KJOA 4DUZL 2I07B 3AU5A 4DV4Q 4DAYB 2FCNA 1LT5D 2LASA 1VCIA 2EDGA 1ONLA 4IPCA 5CV9A 4HVBA 4HK2A 5E6OA 1ET9A 4Q5VA 2UXCQ 4K7WA 3E3XA 3A5UA 1BCPB 2A6HD 1R4MB 2PKOA 1PDQA 1NBWA 2LMCB 3TS0A 3GTLB 4GZYC 2K8BA 4YTMB 2LVOA 1SYBA 2JWZA 1YN3A 3APFA 3SHLA 2KENA 4RGNA 2MRPA 1F2MA 2R93H 4LUOA 1H9JA 3GTKB 3RYTA 1YNNC 3KDFA 3I3CA 4JWUC 1B7YB 3MC0B 1R7SA 4LF6Q 3D4DA 2EY5A 2KANA 2FCMA 4QUCA 1WTXA 1E8ZA 1CKNA 3AE2B 3B9JA 3EBEA 1WJJA 2RVLA 2JYOA 4OIJA 3R3OA 4HCEA 5C4ZA 2J0KA 1CQVA 3H09A 5G3LD 1QNKA 3UI2A 1PRTB 3K81C 1CKOA 5K36H 2JA5G 4EZKA 3HUIA 2XBBC 1HH2P 3TEYA 1F1HA 2Q2IA 4OO1G 3KVFB 2E2JB 2HD3A 1OXSC 4DXGA 2D11A 2KMMA 2L12A 1NCVA 4DK3C 3T1YQ 3PUVA 4G0NB 4GOCA 2C5LC 2K01A 5L37A 1D1IA 3E0EA 1HNXQ 1PTOC 3TL5A 2JZPA 1EZ8A 3VH4B 4HXDA 3I4MH 1RLFA 5A35A 3A8IE 2OOBB 1Q82C 1SYFA 1EOTA 1TWAB 5NUCA 3SK6A 1WTRA 5BYRA 1V5TA 4IPDA 2A5HA 2PVOD 3SDZA 2CHZA 4C7ZA 1BO0A 5LMNQ 1K9MC 2D5DA 1FNVA 2K5QA 3DHIC 3VR8B 1EY5A 2CQOA 3CMEA 1HZ9A 4LW1A 1B2TA 4D2KA 2IGGA 2CHBD 1WX9A 4DFAA 3PUXA 4ANUA 4FXDA 4ASWC 1HRJA 3I72A 2NUCA 4IW0A 4L5SA 1NJIC 2LMCA 1MJCA 3V2TA 3U52E 4CJ2C 1XPOA 2QMTA 3RLOA 3CCQA 3PIOA 1QOBA 2EMTA 2E76C 1J7AA 5H1SE 3AE7B 5LMNL 4RMAA 1ZP0B 1XXGA 2PPHA 1JCKB 1IBLL 3TP6A 1XEEA 2N9KA 1Q7YC 2QIEB 2AEHA 2JA6H 2LGXA 4C3IG 1SSNA 1EIGA 2OJRA 3NBHA 3SDLC 5FO8B 1C4CA 4AYBG 2KOLA 2JQRB 3T8MA 1OTRB 4GKKL 1Q8KA 3B08A 1KHIA 2MP2B 1JRPA 2C9OA 3L0WB 3P4RB 1HTPA 3U4VA 3M7NA 3HOUB 2SAKA 3NTIA 1ZE3D 2QW7A 4HDOA 1RM6C 4YXDB 2F0PA 1WZ0A 3SK4A 4GNXC 3A55A 5D7GA 1X32A 4KIKB 1S5CD 2AWTA 1I7HA 1X3QA 1WGKA 1YNJC 2UYZB 3AE8B 2WQYB 3ZXRA 1C4QA 5FKAC 3GZNI 4ZOHC 5C4JH 2INCC 2JA7B 2IBIB 2KVRA 1SR3A 2PW9A 4P73A 3MC9A 1STGA 4X3SA 4FXKC 2ZZPB 2K8HA 2B63B 4XYCA 3EA6A 1Y56A 3E9IA 2K28A 3I4NB 5JEAJ 4A93H 1IYVA 3DHQA 2NBWB 1HE8A 5AUKA 1DOYA 1A0IA 1SMYC 2F0MA 2Z59B 2F0KA 2DYMA 2XTIA 2QSDA 3KK7A 2FUHB 3MZ5A 4YWKA 1VQNA 1C78A 3GOEA 3HHMA 2E2HH 3ZO5B 4LLGM 4GS3A 1BQQT 3QX1A 2Z8LA 2BOSA 1WJUA 3TMEA 1IYJB 3TN2A 4KK7A 2I5LX 1ASYA 1MG4A 2B3AA 1TR5A 4K6DA 4IURA 2JE6I 2JZ3B 3VR4A 4K2KA 3CC4A 1AYFA 3CXCA 4MGIE 3KUDB 4M0WA 4X3UA 2R93G 4F7XA 1K3BC 3UDIA 4GDKB 4KSKC 3IBEA 3T9LA 3S15H 3WA0A 2FHTA 2LXJA 3RULA 1L0XB 4DR4Q 3HS0C 3MHBA 4MTKA 2NVYH 2R7ZG 1T3QA 1EYAA 1IBML 1WX7A 2K25A 1WZ3A 4XWWA 4A3MG 2B29A 3PZ7A 4K81A 5DPRA 4KX6B 1VQJA 5IY0A 2WGSA 2FIFA 3PRZA 1STBA 1IGDA 4GDLB 1EY7A 1C77A 2K0PA 4DKAC 1MKHA 3PV0A 1GKHA 2QDLA 1J7CA 4YL8A 5FJ8H 1KLUD 1YJIA 4DR7Q 5IYCG 4OX9L 4NP5A 3WCQA 1XJVA 2KJ6A 1JOKA 3K57A 1UWMA 1I3QH 1LT4D 3FMCA 4DV5Q 2NVTH 2VNUD 4NAWA 1F77A 1G8ZD 2GVBA 4A3JH 1GNUA 2JSVX 5G3LF 1XLQA 1PH4A 5BMHA 2A68C 2XK5A 1X1MA 2BVCA 3MTSA 3I4MG 4A3PA 2UUBL 4NXML 1PYSB 1S5DD 4YCWA 4CGYB 1L1OA 1EEID 1VF5C 4P71A 3K58A 1UWVA 2LS01 2PMZE 4KDLB 2ZNVB 3CKIB 2G4SA 5IWAL 3M63B 4I6PA 2XN9C 3LWEA 3W1BA 4A3JB 4PS8A 5EE3A 4HPPA 4NJ6A 4QCLA 3LXFA 1RD9D 4X6AH 5D3DA 4DV5L 3EFUA 3TP8A 5CORA 2RA4A 1VQKA 4TQ0A 3ULLA 3IKJA 2YTXA 5J39A 3OTOQ 3TREA 3VHTC 1SLJA 2D9UA 1WTOA 1E0ZA 1ZKOA 1F2RC 3KFUA 1KJTA 1Y8RC 1GXDC 5GAEC 4RF0A 1PFSA 5IYDH 2G45B 2RF4A 1WIAA 4FP5D 3AEFB 1JRUA 2AX5A 3AFQA 1VQ5A 2H88B 2CVRA 4ZUIA 4H44C 1FJGL 2O2VA 1O7ZA 1DGJA 2K5HA 1FMAD 2KYWA 2E74C 3I5JC 1WFQA 1DJRD 1LT6D 2KECA 3MHSD 4KGRA 1PTOB 3OTOL 1N9WA 1WF9A 3TS2A 1VDVA 2DZJA 4LFCQ 4LJOB 1S5ED 2MJ3A 2PTLA 4WWPA 3W5UB 2QCPX 2K8CA 1EYDA 3L9AX 1TIID 2ZTCA 2DY7A 1K3RA 3BVZA 3RD4A 1YNND 1BCPD 3H94A 4DR3Q 5CHFA 5J22A 2R61A 3V60A 3JAME 3QO2A 5AJ3Q 2F52A 3P63A 3DBHI 2BE5C 2AL3A 1M90C 4AJWA 1B3QA 1VJKA 2KQ7A 4A3EG 2Y3AA 4LUZA 5ELFA 1OXXK 4B3RQ 2RQXA 1KQSA 3E6ZX 1UGMA 3BDCA 1PQSA 2ZPNA 2KWUB 1X3PA 1WGGA 3J80c 1Y8PB 2EY1A 4JBWA 5IP7H 2ZM6Q 4II3B 1GJXA 4MJSA 1X65A 1YX6B 3M3JA 4F8CB 2ZW1A 4TVAB 4DV0L 2K9XA 4DK6C 3PO2H 1YNTE 4B0MA 4AJYB 1K0SA 2A1AA 4A90A 1D8LA 1QJOA 1JMLA 1WXVA 1WJ6A 3AE6B 3AN1A 2DUDA 2VRRB 3GTMH 1TWAH 3DBLI 1J9OA 2XWJB 4OHJA 1JROA 3Q23A 1C76A 1TVXA 5EPJA 2N9PC 4E71A 1S72A 3PUWA 3EJIA 4ITKA 1A3TA 1OGWA 2E2DC 2QDFA 1J19A 2VQFL 3QCAA 5KYIA 2WXRA 3NP8A 3GTQH 3G48A 4US8A 2LGIA 1FYCA 1GOZA 3AB9A 4HJ5A 4BBNF 2PPBC 1RKNA 3KLSX 3C8YA 2W54A 1FRRA 3AEDB 4ME5A 1GUTA 5C3EH 1FEHA 2O6VB 4JI5L 5IP7G 4LF6L 1Q3LA 2CKHB 1P16A 1EY6A 3BY4B 2B2YC 3S1NB 5CV8A 2KJHB 3K9PB 4GU2A 3QARA 1GM5A 3CPFA 1EY0A 1MI0A 2PZUA 1KRTA 4M8NA 3F2DA 3VA7A 1VQ9A 1UNSA 1N34L 4LF8L 3CC7A 2M00A 4HIDA 1QT9A 2KLCA 3PF4A 2N1WA 1JOOA 4OXPA 1X9NA 4GGQA 4MM3A 1OFFA 1R4QB 1WD1A 4CDDC 1F9RA 1DZ1A 3GTLH 3MXPA 3BU2A 3I8ZA 2REXA 2BWES 3K7AB 3R8BA 2I38A 1YQBA 4WWNA 1SAPA 3AI5A 2MJ8A 3K5OA 4NPSA 5C0XG 1FGUA 1JC7A 3AU7A 4WAAA 4KZCA 1A2UA 4JI7Q 2KDIA 4NQKE 5CHWA 4X65Q 1M8AA 3B2FA 1GPXA 2KC1A 4BOSC 5C4XH 4K1RB 4W9GA 4XDCA 1G2TA 4UHVA 1E8XA 1D1KA 1I4QA 2UXBQ 3SD5A 2Q8RE 3P2BA 3UIPB 5HI1A 4EUTA 3DWMA 4HEA1 1L6UA 2R2QA 2O2LD 1XYIA 3S14H 1AH9A 5IE8A 2QDBA 1LABA 1TBEA 1V97A 2L1BA 4KDIC 2AMCB 3CU7A 1S3OA 1V80A 1ZGUB 3QK0A 3T1HL 3CF6E 2RSNA 2V3NA 1XTCD 1XQQA 2A6EC 2IX3A 2MQHA 2UUCL 3VYUA 4N9TA 2LHEA 3HOXB 2ENBA 1EIYB 1E0BA 1SNMA 3MFGA 3OOCA 4HCSA 3JAML 3HOXH 3OWFA 3DDCB 4LCDE 4YWGG 1DOMA 1JJ2A 1KH0A 2CHXA 4IO9A 2BYVE 3N20C 3OJ3A 3I4NH 4DR1L 3PPAA 1FXAA 4TKNA 3L2PA 1KDCA 3M4PA 2JYTA 2N9XA 2GBKA 2CCZA 2ZXRA 1A62A 1OXVA 2F0OA 1I94L 2WXPA 2DNCA 2KAJA 2B2VA 4IFDH 5AZFA 3GTPH 4IPHA 1YNJD 4JIOU 2EJMA 2NTSA 2Y5PA 3ABVB 3AH7A 3KF6A 4CKEA 4DNIA 4IOCA 1YJJA 2WXIA 1G6JA 2IZVB 4XIGS 2QJLA 4JI3L 3NE5B 2L0TA 4UAIA 1R4NB 2F0VA 4JYAQ 2B8GA 2W82A 1L2NA 4RKLA 2QHOA 3H3VC 1PFMA 2Z6KA 1ZDXA 3W5OA 1QUQB 4WJQA 2RCFA 5KHQA 1U4RA 3A4RA 4A6QA 1QKZA 4LMQD 1TKWB 5ELOA 1CZPA 3OMCA 2SEBD 1XMQQ 3O65B 4QL5A 4LDTD 4BY7H 4V190 3HOZB 3FKYA 1GC7A 4FN2A 1JOQA 2PQEA 4TKOB 5C3WA 2NWGA 2ATWA 3NG0A 4BY1B 1K83H 2KVMA 1N5XA 1L2FA 3U50C 3BDLA 3VTUA 3MVVA 3ZIMA 1MJDA 3APDA 1Q46A 2IW3A 2NTTA 4TRDA 3DVGY 4JBMA 1FIQA 1MPEA 3I3TB 1WMHB 1FVIA 1WRDB 3PRMB 3Q69A 5DPSA 4W9HA 4RGTA 1MD2D 3HZXA 2A74C 3GO5A 4HSPA 4B3SL 4CO7A 1EQRA 2LRUA 1VQ8A 2FFKB 3A0JA 2LXKA 1GUAB 1PZKD 4XYOA 1K0RA 1XPUA 3EQLC 5D2MB 1BKBA 3PCOB 1W2BA 2DAJA 2IJ0A 4FVMA 2N8NA 5IYBG 1C79A 1L0YB 5GAHC 4B3TL 1TWGH 5I6YA 2OTLA 4A3FG 3DHHC 4LJZC 1GO3E 5C4JB 3MWYW 4IWQA 4OVUA 3EFXD 3RN2A 2DWQA 2JU6X 3AE3B 4EFOA 2KO3A 1SJHD 2KCCA 3CHBD 2KTRA 3PIPA 4UY8C 1MBYA 3E0JA 1XMOL 4JI0L 2CJNA 3CMMB 5G5HA 2L7RA 1YQ3B 1WD0A 1EWHA 1PTOH 5COYA 1E5WA 2ZJDA 5M5YH 4A20A 4C7YA 3PRPB 4QJFA 3HOUH 5M3FG 4HN7A 2EYHA 4L8JA 2E5LL 3AEGB 3S2AA 1KNEA 3J80E 2JA8B 5E7NA 3H7PA 3Q2AC 2V4LA 1SYDA 3BZDB 3ULJA 4EOYA 1FRDA 3F8TA 5C0XI 1FNWA 4FF3A 4OO1I 3EUB2 4ZYSA 1LYLA 2ZVOA 4A3IG 2V3SA 4GXBA 4M00A 4BKSD 1A5RA 2AWOA 2EYOA 3MAQA 1X3FA 3ULPA 1E1TA 1K73C 2A8VA 5FR6A 2R7ZB 2BA0A 1HA6A 1E7PB 3I55A 1X56A 2JA8H 3ITPA 4UDUC 4QB4A 4RKBA 1Z7TA 3JC66 3ZNZB 3AEAB 1SFOH 1IBXB 1LLRD 1XNRL 1S40A 1WH3A 3GTKH 5E3FA 3NHEB 4CYEA 4MGKE 3A33B 2L55A 4JGHB 1VD2A 4GLXA 4ACFA 2RSOA 4XXEA 2V9HA 2YEPB 1N34Q 3DCGA 2MWSB 2WXQA 3NZUA 2Q2HA 4PG3A 4C3JH 5KYLA 1G6ZA 3SU8X 4JI8Q 3BVGA 2NPTA 1M4VA 4DHZE 2RHQB 5M3MB 1HR0L 2BF8B 1V86A 1K53A 2V1YA 3H0GB 4CHTB 2F0GA 4HPMB 2LVPA 1B70B 2WHIA 4BFRA 4A3DB 3PO3B 3ND9A 2PW5A 2W9NA 4B08A 4U68A 3OW2A 4A3MH 4JI3Q 3ZNID 2UUAL 4F88A 2EPBA 1ZXHA 3D4WA 3U4ZA 2X69A 2I0QA 3RMKC 5KNDA 3AEBB 3L7ZC 2Z4HA 1DYQA 3PT2B 1C8CA 3PMFA 4KGTA 3VUWA 1JALA 3K5LA 1WE7A 2INPE 1AW7A 3U7DA 5MPOA 1I4HA 5I9PA 1EY8A 4B9WA 1VQBA 4GN4B 3M4OH 1VQDA 4LNNA 4NY0A 2ZTDA 1WJ4A 3W1YA 1HUNA 4L6TB 2M9VA 2GI9A 2FE8A 3UDGA 3WDNA 1PH6A 2NBFA 1VZ8A 3VA5A 2OEOA 4J3OD 4K3CA 1O7YA 3ICEA 1UD7A 2D2QA 2K75A 1TYGB 2MP2A 4P7IA 1WXMA 1XD3B 2BS4B 2ZJQA 2C9WB 1IKLA 4DV0Q 1N33Q 2JXMB 1T9HA 1N62A 2DHZA 5CR3A 1OQYA 3NBHB 1U4AA 4LNOA 5T8IA 1HTQA 1II3A 2KC2A 2PMVA 1T0QC 2J7QB 3SXHA 3DBRI 5IYBH 3GTOB 2B63H 1DM0B 4M01A 4AQ7A 3HOYB 2CW0C 3OMGA 4PMBA 2RMMA 2X38A 4A3KB 4QUFA 1B4OA 5I2XA 3S9WA 1KM7A 4FF2A 3C1FA 4DQOC 4Y7NH 4MN3A 2Z9HA 3U8ZA 5J18A 1UUPA 1ZYRD 2Y5CA 1KF6B 3SR1A 1K8OA 4WJPA 3RNFC 1PYBA 4QF4A 5EKIA 3L13A 4NKLA 1VRAB 2B2UA 2F4VQ 4WJOA 2GN5A 2D0OA 3VDZA 2AWNA 3HKZB 3T51B 2NVXH 3AU4A 3N32A 3ZKJC 2LGDA 1QZGA 2D0PA 1R4MI 2FINB 5GROA 4A3MB 2HT1A 4LNFA 3CCJA 1XNQQ 4XQNA 3S15B 4X66Q 2DAFA 3AE5B 1X3GA 2KQSA 1Y8OB 2D3AA 2JRIB 3IT6B 1C3TA 4DR3L 3QR8A 2BH2A 1GUGA 1S3SG 3H8HA 3OW7A 4ZRPA 1WVLA 2JA5H 5KHOA 2WIIB 1KXLA 2KHWB 2W55A 4A9AA 3RCZA 3GQBA 3A54A 2NBUA 3H7SA 4JV5Q 2J53A 4A3BB 2L32A 4RHRA 2LGSA 1WYWB 4JPSA 2D10A 4ID6A 1GB4A 1STEA 2E2HB 2KHIA 4LWCA 1DOKA 4BBSG 4CBVA 4QIWE 3AB5A 1ICWA 4KKTA 3UGBB 5IA7A 1WTPA 4A3LG 4MSMB 4QY7A 1NNXA 1EUJA 3CAMA 1R9TH 5JVH3 4HTHA 1WXQA 4JI5Q 4JK1C 2IO0B 3I7FA 4RWSC 3RLFA 2VL6A 3SK5A 4DV3Q 3VH3B 2WB1B 5LMUQ 4BBSH 1TIFA 3WALA 1R4NI 2A68D 3TUOA 1SIFA 4P2CB 2JJQA 3S17B 1J5EL 4A93B 4WH4A 3RZDH 4G11A 1KC8C 3I4MB 3GTMB 3J7ZC 2RDGA 5IWAQ 1EQQA 2DZKA 1AWDA 1JQ4A 1BUVT 4DV6L 2OJWA 1MSGA 1WGHA 2ONQA 2CH4W 4GB9A 4A3JG 5HGQA 1XWEA 3AQQA 2K04A 4AOFA 4MACA 4X62L 1JORA 1V8QA 1BUIC 1SSOA 1IXRA 3IVFA 3RZDB 3SGIA 2DZIA 3JW0X 4WJNA 3CCRA 3V6EB 4K5VA 2BQQA 3Q3NC 2A19A 2BS2B 1RODA 1FFVA 5ELBA 4GN3B 1H9KA 4I6LB 4W9IA 4B0EA 4YWLA 3DVGX 2EJFC 2EMSA 4B95A 1C4PA 1ILPA 1KNAA 3L08A 2H89B 1H9RA 2CS4A 1XNRQ 1YI2A 4ZQ3A 1EFWA 3C3LA 1DD2A 2D5GA 2GBNA 3KLRA 1WJNA 2LVQA 2M1MA 2X6GA 4DR2L 1E10A 4HJ8A 2R93B 2K50A 3DMUA 2PE6B 1J0GA 2HCIA 2WYQA 1WXAA 1EWCA 3D0FA 2IT1A 4A3GH 2NVUI 3Q3OC 2F4IA 3CWIA 5D94A 1VDZA 4DUZQ 2ES2A 1ISNA 1NAPA 2NVTB 1UE6A 3Q24A 2L52A 4G7OC 3FRPB 3FPUB 3CD6A 2LFIA 3R93A 4JBJA 5G2NA 5IT9E 4PZ7A 4EGVA 2NVQB 3T53B 3H15A 2NMQA 2JUOA 3I4NG 3H6MA 2JXXA 3TCAA 2IO3B 2EYPA 2K22A 1PV4A 1C1YB 1JW9D 3TP7A 2J4XA 2KCMA 3JSVB 3Q3FA 2Q2TA 2R92B 1RYJA 2BKFA 2V4IB 3BG3A 3DQVA 5EE9A 3TJPA 3KWVA 3HEJA 1KD1C 2DX5B 2WXNA 1V1PA 1ZKHA 3B1LX 3WAPA 3VR3A 3L17A 4DNTB 1YIJA 3F2CA 2FBWB 1EF1A 1XNQL 5DPTA 4DR6L 1K83B 3VFKA 3CCMA 4PYUA 3J81E 2PMZB 3I4OA 5FLXc 3GTPB 4J15A 1PHJA 5M5WB 1V5OA 2M19A 1NY4A 3ZW3A 1K51A 3NVVA 1CA5A 1VS0A 2K3UA 3IL8A 3S1QB 1I4XA 1TWFH 1U9RA 2EYLA 4LFAQ 4IN3A 4IG7B 3MA2B 3L4PA 3Q0AA 3CCVA 1BR9A 4AYBB 3V6CB 2OEDA 1VQOA 5ELCA 4NB3A 3HKZG 2MP1A 4IPGA 3M4QA 4RCOA 2UXBL 3HIZA 4A3KH 3PO0A 2MA9B 2X8XX 1QUQA 3H9DA 1CUKA 2F0LA 3HOUG 2BKRB 4H02A 1CHQD 1TT2A 1SE9A 1Q10A 3M95A 1TGZB 4RM8A 3H6NA 3I91A 3BK1A 1QB5D 1GJZA 2E5LQ 2PIAA 1JQYD 3GP7A 4RF1A 3WIMA 2YTYA 2ZTEA 2K32A 4ME3A 2Y5BB 1S5BD 3MTNB 5HG2A 3TRZA 4ANWA 3HG9A 3DWGC 5DPWA 3ML8A 2UU9Q 1L4DB 4M0WB 1KL9A 3VR5A 5C0XH 4F1SA 5K5PA 1YHQA 4WJ4A 3NUHB 2HD5B 2DBYA 4OVVA 3N3KB 2W3RA 4XX5A 4K8JA 1I94Q 1W6JA 4PZ8A 5EPLA 2PLPA 2R2OA 2M0AA 3A56A 2ZPYA 1HA5A 4YSZB 3TZDA 3IT4B 1KDBA 2ZJRA 3HVZA 4FJZA 3AE9B 3M3YB 2DNEA 1S1QB 1HZ5A 4NXMQ 2HIVA 3P7JA 1L6VA 3QWNA 4JI4L 4KN4C 5EKKA 2M17A 5T1IA 2Q5WD 3PSEB 4AYBE 3ERSX 3TP5A 5FOBB 4KHVA 4GIVA 1FCLA 3I4LA 3PUYA 5M9OA 1FR3A 2PZTA 2EJGC 1I6VC 5LMUL 1I42A 1IBLQ 4W9DA 1VQAA 4W9FA 1N61A 1GUSA 1CMXB 4DV7Q 2F0UA 2KDBA 4DN4M 4C2MH 4LNQA 3H1UA 3QIJA 1Y1WH 1QNUA 5CV4A 1F0ZA 3BIID 1SE4A 4C3JB 4LJPB 5HGTA 3GD7A 3O13A 2AQ3B 2WXKA 2RPQA 5AZHA 2F0NA 5C4XG 1E3PA 4FLHA 3IFTA 2MBHA 4HMIA 2XGTA 2N0SB 2NR2A 5M3MH 2A4ZA 4MDKE 4UP7A 5BYQA 3W1SC 3ZUNA 2BDNA 2V4DA 2YU9H 2K33A 1O78A 5D6JB 4UP8A 5T1GA 1L4ZB 5J3BA 2CU1A 2BE5D 1CTMA 1UEBA 3SK8A 2LUEA 1OXUA 1CZGA 4JYAL 2MX2A 3HP3A 3TEXA 1CA6A 3GE3C 1G2SA 4L1BA 5FLMG 2OWOA 4A3DG 1TWCH 2CHWA 2OTJA 3H0GG 4KZ0A 1VR9A 1EF5A 4II2B 1AZQA 2N88A 1HQMC 1OEYA 3WAOA 4UP9A 5CMDA 1XMQL 1ZDVA 1WYGA 5IYDG 4IJLA 3L54A 5HKHA 1B9RA 2KQ3A 4JX1C 2BGFA 2XRQD 3KF8A 1O7IA 3BJUA 1Y8NB 3GV6A 2Y0SE 3DPDA 4FADA 2NBVB 1SYGA 4PZ6A 2RD0A 1QVGA 1WM3A 4IZ8A 4DR5Q 3PLVA 2DENB 2G4DB 3NSWA 5C2TB 4IWPA 5CX3A 1Z5SB 3DXJC 1X3EA 1KABA 4MH8A 4TSSA 5C3JB 1N32Q 3HRZC 1UELA 3VTVA 4FULA 2R6GA 5FR3A 3ZRFA 1RAXA 3X23A 1LTLA 5C44B 4P6VF 2MFIA 4WURA 1F2ZA 5C44H 2RGFA 3MHZA 4KHPL 1YNXA 5C0XJ 4IOAA 2VUMH 2AKWB 1E22A 5LL6S 1YIWA 4OGQC 1AFPA 1JJGA 3ZQ4A 5BO4B 4AS1A 4HJGE 3HVDA 1P1AA 2IGDA 4DHJD 1SDFA 3NUCA 4ICVA 2N7JA 1WCMG 4BY7B 2MBOA 2JSOA 4HRSA 1XCQL 2EELA 5IN7A 4AIMA 1ENFA 2HTME 2CR5A 4OX9Q 1F52A 1F9JA 2WB1E 4DA2A 5L83A 1N5WA 1LV9A 1NVID 2K5NA 1CKNB 1HXYD 3BZKA 4KD4A 3NS8A 2G9HD 2JY6A 2J0TD 1B9MA 1MG8A 2VY3A 4KJNA 1STNA 3H91A 3M4YA 4YY3L 4GLVB 3JAMc 4DWFA 1LM0A 3BINA 4A3EH 5AJ3L 3GTGB 2NPTB 3RZOB 1P98A 3N9YC 4C3HB 4GKJL 4YSYB 1N63A 4DAMA 2LZ6A 1D5MC 3J81L 1YJNA 4I7AA 3GV3A 2VUMG 4MTNA 1F2RI 5TR5A 2E2JH 2L9HA 4X3TA 1AEXA 1N8RC 2SDFA 2Y0SG 1BT0A 3JVZX 4NAMA 2H4OA 2JN4A 2SNSA 4G7ZC 2EE1A 2KLGA 2VB3X 1HR0Q 3IG3A 2ZM6L 1ZEQX 1J5EQ 1Z9FA 1SYCA 1E6EB 1TS3A 5JZEB 5GAGC 2ZCCA 4IFDG 3KYCD 4HJAA 1PVOA 4ZLTF 4EQ5A 2PVGC 3DWAA 3L0OA 3RMHA 4DHJB 3NTHA 1XX8A 1EUVB 4OZBA 2WXLA 1SE3A 4M1UB 1EYCA 4HSVA 5E6JA 2MO1A 4F8MA 1U0LA 3UE0A 1XPRA 1GHKA 3I57A 2IX1A 4DXAB 2BWFA 2AQ1B 3I56A 1SJED 2KKCA 3Q6SA 4IQZA 1LTID 3FKIG 3A4SC 2KEDA 2A73B 4H2AA 1W3SA 1LTAD 4F87A 1V81A 1YN4A 3A7LA 4A3LH 3RI7C 4KJOA 4BY1H 1D7QA 3KBXA 4BAXA 2WP8J 2BH8A 2FMMA 2KTRB 4HJ9A 1OTCA 2TSSA 4HKZE 4RA8A 2O6VD 3RNAC 4A3EB 2RDHA 4NAWB 3IFWB 3QB3A 4REZA 3NPPA 2KX3A 3NWSA 2XEWA 2ZVNA 4XDDA 1IPGA 1X55A 2PNHA 2VZKD 3PIP3 3U7ZA 3CCUA 3ZJVA 2LEKA 5J17A 1RTOA 1BOSA 2JT4B 4JI1Q 5BYSA 3H3VH 1YHBA 4DNRB 2RHSB 4GDLA 1WFYA 3W2DA 2D07B 2N78A 3IAS1 4GSWA 4POFA 2IDYA 1YOVB 1SNDA 1C9OA 2C35B 3ENEA 2JZZA 1H9SA 3S24A 1WMHA 3Q8EA 2KEEA 4BXXH 3AECB 2MPMA 1ZXIA 2K6DB 1ENCA 4GDKA 2QEJC 3RN5A 4HLEA 4JI6Q 4A3GB 4V0BA 3K7AH 3NQTA 4FBJB 3K0YA 4KHZA 2EY6A 2K5PA 2WXHA 3CRLC 3AEEB 2QKIC 3PS6A 2AYOB 1A8VA 3F1ZA 3CPWA 4HROA 2NCNA 3N30A 3D32A 1AP0A 1EWYC 2B2UC 4W9CA 4C4VA 2WXOA 3J80i 2JP1A 4K0KQ 4XE0A 1HZAA 3D3RA 5CYUA 5LLIA 4MSQB 2PW7A 1QLBB 3K59A 1LTBD 5C4HA 3ER0A 3SEBA 2I1KA 1YQ4B 5A2QE 2MJDA 1T5XD 5I9OA 4KKIA 2ZT9C 4CJ0B 3V05A 3A8KE 1PH2A 3PVLA 4NJ7A 2XNAC 3CC2A 4ANVA 4L23A 2BYEA 5FK9C 1EL0A 4L5QA 5FO9B 1UBIA 3K80C 2J52A 1PYWD 4KHPQ 1Q12A 5JVG3 2A6ED 1DCZA 1HNWQ 3ZNHB 2LY7A 2EXZA 4JPBW 2KJXA 3KYDD 3GTJH 2JVCA 5LHY1 3MXGA 3NENA 4ZRZA 4JI7L 1TWCB 2KZRA 3Q14C 2NN6I 5HURA 4JV5L 4N9F4 4JOIC 3D6WA 4LUVA 5IAAC 1AARA 3M85A 4K5WA 3Q8BA 2NVQH 2UU9L 1ZW7A 3UF8A 5BR8Q 3CQZH 3HM3A 4QIWB 4JBKA 1NI3A 4CKBA 3KH0A 1D2BA 4P74A 2IY1B 1C48A 2RR9A 2HUGA 4RHSA 5M3FH 1TY0A 4JL9A 4US9A 2JEBI 1WR1A 4KI0A 1BCPC 1IL2A 5JXVA 1VQ6A 3ZJUA 2B2TC 3VR6A 4YY3Q 3K5MA 4AQYQ 2FMCA 1SB3C 2MH7A 3MJ5A 2ZNVC 4YT0B 1SBBB 5KIXA 1C7YA 4Y52H 2EKEC 2XWBB 3FVQA 2O5IC 1L7YA 2OQKA 4LK1C 4OZAA 1FL0A 3R7RA 1TKGA 1H9SB 2MHJA 3K0XA 3CCEA 2DN8A 4YIJA 2N49A 4AP4C 2I1JA 1U4LA 2MGSA 3M7GA 1KDAA 3E9HA 1G51A 2RDBC 2EVBA 4KLKA 1PRTC 1HQRD 1N6ZA 3S2HH 5FO7B 1HNWL 4KV6A 4BS9A 1C4AA 2KTFA 1PGXA 1XLPA 2WNMA 1ET6A 5M5YB 3I70A 1UGJA 4M02A 1PLFA 2B2WC 4JQWC 1TXYA 2F1MA 2OQ0A 4I65A 1NENB 1A3UA 3KF6B 1STAA 2B8FA 2HDEA 4BBRG 2LXAA 1PGAA 3OJ4B 2WKDA 2NYZD 4NXNQ 1P7FA 2EY2A 2WX0A 4K6LA 1P8LA 3HRDD 2MBQA 4ZHOA 2JA7G 3Q6BA 4KSLC 4DR6Q 1SN8A 2L3ZA 3OIQA 1SE8A 1GC6A 3VQIA 3R3MA 3NTKA 4XQJA 4KN7C 1F9SA 4CKCA 5LNK1 1I5FA 3D8GA 4RNAA 2WAQE 5FLXL 1GUWA 4BBRB 1V49A 2WLBA 4MGZE 2O4XA 1F9PA 5JEAG 1SIJA 4KKUA 1QOGA 4IALA 2PJHA 3QWZB 3TEHB 4X3KA 1FO4A 2B2WA 4FHJA 1L0VB 3RNEC 2NB0A 4ANXA 4QAYA 1BVSA 4DK1A 1FGBD 4R9WA 2KDMA 5EE0A 3FHWA 1PMRA 1O7LA 3DM1A 5E1FA 3S1QH 1XF5L 3SR6A 1C9FA 4EZJA 1WI0A 2PE9A 2Z6KC 3SFDB 4N8X1 4W9LA 4R4QA 4XDXA 4EQNA 1Q1OA 4CDCC 2G1EA 1CHPD 3KF8B 3DBRB 5DAUA 1A15A 3HFZB 3VRBB 2Z4IA 2M8SA 4LF7L 1KRHA 3E9SA 5CHVC 1F2YA 2M4NA 1F2LA 1YMHE 2N7EA 2JQOA 1A70A 1QOAA 5E6PA 5BN3A 1STHA 3K9OB 2D2CC 4B3MQ 1VLBA 2BS3B 2NVXB 1VZ6A 1SYEA 2X6LA 4WRDA 1PDXA 4FJVB 3W1SA 1IYFA 1Y1VH 3QHTA 3P4PB 3BYYB 3AEVA 3D6CA 3MC8A 1D5XC 1U4MA 4DV6Q 4DV7L 5CBEE 3V96A 2F3WA 1CI3M 4IM3A 2N3SA 5H8YE 5EBCA 1NMFA 2IO1B 1NDDA 1BF4A 1CQFA 3UQAA 1SMXA 2WXMA 1ZYRC 5EKLA 1JWAD 1J7BA 1RFKA 2DYBA 2DZMA 4P72A 5JOBA 4CJ1B 1S4ZA 5DCNA 4N6EB 2AHOB 4DR4L 3QAQA 2I46A 1DONA 2QCZA 4ZKBB 2WXJA 4BKTA 3DLLA 1EIFA 3ZLZA 4EE2A 4EX5A 3J81j 1WSPA 3DBLB 4ZRJA 3KOJA 3RNGC 4ZAIA 2L83A 1TQOA 2MCNB 2KK8A 1BBWA 2DJGC 5JPNC 2BYFA 3OPOA 1Y1WG 4L2YA 3B2GA 4HCPB 1CZWA 3DUZA 4B6WA 1R4PB 5IODA 2L0FA 4WORA 1UE1A 3AMUA 1F9QA 1V1OA 2CU3A 5HFYA 2MW5A 2V3PA 2XRSD 4ZHPA 3ZNGC 1V8CA 1I4GA 1YHAA 5JJLA 2ZEQA 3ZGZA 4MELA 1ROEA 2HCCA 4JVZA 3UDFA 3UINB 1CKMA 4GN1A 4EKUA 3TEWA 2K1BA 3FEWX 3STBC 5G5GA 1TWHH 2NN6G 3T56B 2UUBQ 1QZHA 1GUNA 4FDBA 2BYTA 1RHPA 3UDXA 1IZ6A 1JWSD 1WTVA 1BNZA 4A3BG 1DGSA 1HFNA 3EROA 2PQAB 4O42A 1I4RA 2PNRC 4OWXB 4B3SQ 4LF4L 3VR9B 4OO1H 2FJ2A 3H0GH 1VZ7A 3NELA 2UUAQ 3I2ZA 3NEMA 4A3CG 4GNXA 2PYKA 3U2SC 3V62A 3RT3B 2C60A 2L1AA 2L8JA 3ECIA 5C3XA 5EAYA 3BWUD 2Z1CA 3MXUA 2AL6A 3GS2A 2N1VA 1V43A 2L4NA 1Y14B 4MJSB 1WE6A 1AE3A 2F3VA 4ZRKA 2V0GA 4LF5L 1UH6A 1YJWA 4K3BA 4C56C 3N6RA 2K5WA 2J0MA 2JA6G 3W5VB 4KV2A 5IGDA 3A9KB 5GADC 4ALPA 4FJYA 4AQYL 3DHGC 3PO3H 3V3XA 2IWHA 2TMPA 2K14A 2MHVA 5IP4D 2Q8IB 2BW2A 4LF5Q 4A3IH 1P9DU 5GQOA 2OF1A 5C3EB 4A3KG 1PH5A 2IYDB 5DEHA 2GBJA 3S1RB 4A3BH 3T3OA 2RDFA 1IUEA 1OQQA 1FFUA 3RNBC 4PS3A 3FKIB 4BA1I 2JF5A 3HK0A 4GOPC 4DV3L 1Q1BA 3BZCA 2LKVA 2R7ZH 1GVPA 2KHSA 3J7AF 2HJ8A 1NMGA 4J1MA 3HOWB 2PEAA 3L16A 3VAWA 3MJWA 3I73A 3FPPA 1PH9A 3MEHA 3MEFA 1SFOB 3PUZA 4DR1Q 1I35A 1HUMA 4ZYNA 4DDGD 5HY6A 3ALBA 4CHKA 4A93G 3JSVA 4HKQA 3APCA 4LNKA 2KDFB 1MHHE 5IOCA 4P1BC 2E3TA 5IO9A 2K03A 2VZAA 3KUPA 1GD7A 3TZUA 1VQPA 3GTJB 4FF1A 2UWQA 3UI3A 4A55A 4FNFA 2KX0A 3EHVA 1TWGB 1KTKA 3PSIA 4NXNL 4JC0A 3W1GA 1VQLA 1E90A 1EU4A 2G5DA 1ZOYB 1WTHA 3PO2G 2WU5B 3KUCB 1LO5D 2C7MB 3JYUA 4HPLB 3LB8C 1H9MA 2KFJA 2K5DA 1EM7A 5G55A 5DM63 3NRZA 5C5MA 3CP0A 1M1KC 1EY9A 1PUTA 3N1XC 1E7ZA 1PFBA 3NQIA 4BZAA 1ML0D 3RZWC 4J6HA 3TQYA 3UIOB 1GG3A 2VQEL 5I2YA 2R3ZA 2Y0SB 2CWAA 2E2IH 4WQMA 3DWPA 1VQGA 3IRBA 4BY1G 1DXMA 4DUYL 1ENAA 4FXGC 3NVYA 3QC8B 1LXDA 1KRSA 2ZJPA 5CGKA 4W9KA 4WFN3 4MGYE 4C3IH 4K14A 2XIWA 4RGOS 1NEKB 2Q2UA 3J7AV 4RMFA 4IFDI 1BXTA 4XGAB 2GMIC 2C5CA 2DYOA 1CFMA 3NOBA 1PH3A 1SMYD 2YYZA 3D31A 4PNYA 1PRTF 4TQUS 1Y1VG 2DLBA 5AZGA 3ETRA 1A63A 5IIFA 2HDLA 3FAHA 4JW0A 1XLNA 2ON8A 2WAQB 1XTDA 1J6QA 1QQRA 2KWDA 3EECA 3U58A 4HR7B 1YITA 4LF4Q 3OSOA 2YV5A 3N52A 1FCCC 4Z9CB 5ELEA 1LGRA 4J6IA 3RFZB 2D62A 3T4AC 1SNQA 3GE8C 3QJZA 1V1PB 3ONSA 4IOIE 3HOZH 5E4XA 1SEBD 1YBYA 5I4DA 1SNOA 1NR2A 1PH1A 1EQTA 2F0JA 1KLGD 1SF0A 3RUZA 4FXCA 3ND8A 3S1MB 4LAAA 3QIAA 4C1NK 1PRTD 4ILWA 5IT9c 4OL7A 4ZCKA 4DGZA 3HOXG 3NHHA 2F0IA 4PS7A 4K7UA 3UQBA 4JI8L 3ONAB 5ELNA 1UWXA 4B9XA 3NJTA 3VDYA 4A3OA 3MXNA 1XO3A 3F2UA 1QOFA 2E6XA 1N33L 3NXWA 1L5PA 5BR8L 2JXTA 1CSPA 4RFBA 5LXIB 1D4BA 1QOHA 3K6OA 5IP9G 1T0RC 3OWEB 1GHJA 1WRIA 4KIKA 1YD8U 2WDTB 2KMCA 4YCVA 1L1OC 5IYCH 4MNOA 2PZWA 3C2PA 2WAQG 1BBXC 2KWVB 2EZVA 4DV2Q 3FILB 4PT5A 1TS2A 1YVCA 4N59A 1LTTD 1Y1VB 4X64Q 1KOTA 2A6HC 1E2WA 3HM6X 4YCUA 2KACA 1JICA 1Q1EA 2IY0B 2WINB 2YTVA 2LWPA 3S2DH 2HDMA 4DUYQ 2OCEA 2GB1A 3AMZA 3KDFB 3WOFA 2L11A 4HJ7A 4G3XB 2WWZA 1FXIA 3G6JB 1JT8A 1RRBA 4OVZA 4X62Q 2QF7A 1DOXA 3T16A 5M3MG 4E74A 1K28A 4R4OA 2IHEA 1NYQA 4PYZA 1IHZA 4C3HG 5EPKA 1HZ6A 4PMWA 3NZSA 3Q22A 2D3GA 3PO2B 3AYHB 1VQ4A 3LX0A 2WDQB 2QGQA 1HR0W 4R1JA 2LUMA 1VQCA 2F0WA 2HHHQ 1G91A 2GRIA 3W9CB 2EXDA 4KTAA 5KRUA 1WX8A 3B0AA 4WIPA 2DJFC 1IW7D 4IC7B 1T6BX 2VQEQ 2WS3B 1EEFD 2EIFA 3DM3A 5ELDA 1YJ1A 2LD9A 4OEMB 2KUMA 3AULA 3R2IA 1E9MA 2MEKA 4YHHQ 4KY5A 1FXTB 1TZOA 1NYRA 5KEEA 5DLQE 2MBEA 4PV1C 3AV8A 1JB3A 1XMOQ 4JI0Q 3HOVB 2WFWA 1EO6A 3R66C 3FDTA 3J7YW 4AH6A 4S3SA 2JX5A 3ZVVA 4IDIA 2K5VA 2MO0A 4IUMB 4LF9Q 4GOPB 1WTQA 1FD7D 1IW7C 5HHDG 4ZKCB 1N32L 2BB6A 5E6NA 3E5SA 1FM0D 3PGZA 1QILA 2W3SA 5JJZA 3RD2A 1UBQA 4DAVA 1PGBA 1B53A 2D3CA 3RZOH 3I63C 1K8RB 1YJ9A 1P7EA 1KAWA 2SNMA 1JJCB 2MBBB 3KWLA 3P42A 3ZTDA 2IPKD 1N36L 1EZ6A 5GXGB 1LFDA 4XC2A 4DHZB 1C0AA 3KBGA 5D65A 2ASQA 4E3CA 3PTFC 1KAAA 4N8FA 3BDOA 1HZBA 2WXFA 5AEKB 3RUIB 1QVCA 3P1MA 2UU7A 1VQ7A 1V2YA 2RSUA 1MSHA 1DOIA 5CC4A 1NTGA 1FNUA 3B6YA 1B8AA 2YU9B 5J1ZA 1X54A 2MUYA 2B2TA 1IBMQ 4JCVE 1NI2A 4B3RL 4NMZA 2FCQA 4C80A 3RNUA 4GKKQ 1LTGD 1WGYA 2C7HA 4LTUA 1IYUA 4DAYA 4EQPA 1P3QU 2YEPF 5JJIA 4LFBQ 2L76A 4IUVA 2ALYB 2KFKB 3T13A 2H1EA 1O80A 2R92G 3HOVH 4IFDJ 2O5JC 4A3CH 1SGHA 3LDZE 3IAYA 3Q8CA 1H4RA 1TKYA 4C00A 4PK1A 4R8IA 2F0SA 3GDEA 4XYQA 1R9TB 1VCBA 1IBKQ 4QQBX 3Q3JA 4EEWA 1MIUA 5TSSA 4DPGA 2DNFA 4YSXB 1JMCA 4URKA 4TQ1A 4H7BA 3S2DB 3BK2A 2KMAA 4NPNA 3AE1B 3KQ4A 2HIXA 2K4KA 1Y1WB 2RKSA 4G50A 3TIXA 4G57A 1RTNA 4Q0FA 4EQOA 3NY5A 1ESFA 4MEMA 3IXSA 1HTLD 3WOEA 1PFNA 3QOLA 3PHWB 3QQ8B 3IFDA 2NZHA 3WAMA 5E4WC 2K6AA 1V9PA 2JRHA 3CIRB 1PTOF 1VQFA 4BXXG 3PZ8A 1WCMB 2BA1A 3ML9A 4UPAA 2M56B 1RDPD 2I5HA 4PQXA 4ZUJA 1FD6A 1EIHA 4DV2L 3HOWG 1TS5A 3MXNB 1XLOA 2LFNA 2KVZA 2XSCA 1LTSD 2KN5A 1V1QA 3HOYH 2F0HA 4DR2Q 3GTOH 1B9NA 3C19A 1NE3A 1HFGA 4GLAC 3PREA 1PZJD 2WKCA 4HWIB 1SNCA 2N9LA 3BS1A 4ZDVA 4S0RA 4IKGA 5EBDA 5BMIA 3VXWA 3DVNV 2WU2B 1PFDA 2NZOA 1Z47A 1RFAA 2D3BA 2L5TA 2KCNA 2K52A 3PIO3 3G6EA 2N7DA 2E8GA 3NBIA 5KNCA 2BBCA 4MZ9A 1K8GA 2Z0SA 2CJOA 3PZDA 5D14A 3EFCA 2K1FA 1ILQA 2F0TA 3K8AA 3QA8A 2KCTA 3CRKC 2WP9B 4A75A 2INDC 1ESRA 2F4VL 1M94A 4YTPB 3LWUA 5KGUA 3M62B 2M2LA 1E1OA 4GMVA 2VS1A 4M8MA 4OONA 1K8AC 4HAEA 1E8WA 4QMGA 1TS4A 2B2VC 2L0CA 2JEAI 3GTQB 1IBXA 3S16B 3J81i 2YVCA 1EY4A 1XT9B 4C3HH 2GOWA 2LGYA 5CV6A 1HNXL 4IUTA 4LFBL 2I2YA 1ZXTA 2FXQA 3F2BA 2MJEA 5LXHA 3M3YH 2VB2X 1D5ZC 2B63G 1V9JA 3ZJTA 2BCOA 5FLMH 4A3DH 1UF0A 1MGSA 4DV4L 2KOXA 4APVA 1MHXA 3L10B 3G7LA 1AZPA 2MSED 3X3NA 3H7PB 2OHFA 1MVKA 4XWTA 2B3GA 3URYA 3FC4A 4LFAL 3H3VI 3RPFC 2CQAA 2CKZB 2UUCQ 1RIPA 5BMGA 5C4XB 5FLXE 1E8YA 4C1NI 4ZK9B 4JI1L 1LT3D 3WANA 1Y69U 4JI4Q 4LF9L 3A9JB 4O1NA 1ZUD2 3AXCA 1N36Q 2WB1G 3CSTA 3G71A 3CW2C 2JK8A 4ODGA 3QJYA 4DDID 2VH1A 5EGTA 2GVAA 5JEAH 1TT5B 4BBRH 3KUZA 3A1QA 4BKSA 3P1HA 1VQMA 3V61A 4C3IB 3LJ3A 4JI6L 4ZRQA 1KLVA 1TU2B 2ID0A 2Z6BA 3UE1A 4A3FH 4XT1B 2JA7H 3J7A5 2IO2B 3SFEB 3T3NA 4C4VB 1ZPSA 1RCVD 1ACCA 4WJWA 3C0RB 4RM9A 3LYYA 1IBKL 1PZID 1YEZA 1TWFB 3HGBA 1YN5A 5CTRC 5BN4A 1W6KA 1UE5A 2ICIA 3SVMA 4OELB 4KKSA 1UAPA 1A6XA 2F03A 2WV6D 1STYA 4QGUA 1QZEA 1IKMA 4GLSC 4K0KL 2QC8A 1EYGA 3BVMA 3W3AA 1NBFC 1PXUA 4HIMA 2IL8A 3VUXA 1LACA 4GKJQ 3RR5A 1WYDA 2SOBA 4IJHA 1I6HH 4NNJB 4ABNA 3R2TA 1I6HB 2M0XA 4XZ4A 4U673 3S17H 4KGSA 1QWYA 3CSFA 2FUG1 1CM9A 2EQSA 1KFYB 2PI2A 4HMJA 1G6PA 3ZDMC 1EQVA 4A3IB 1WY8A 3RNCC 3CF5A 4IUUA 5J2RA 4XTCS 3HOYG 1WI5A 3VRAB 4RGMA 1GUOA 3S2HB 3OLMD 2G9DA 1E24A 4IUNA 4LFCL 4M8AA 3KJPA 5M3FB 5JH5C 3TEZA 4PMCA 5EQ0A 5H92C 2IX0A 1JR0D 1KIXA 2J7ZA 1HPCA 2Z0DB 4DK0A 3PV1A 3VYSA 2JA6B 4L63B 2BDOA 3NWTA 4HEDA 1EU3A 1JWBD 4K2LA 4N9PA 4MHEA 3RN9C 3FKIH 1A3VA 3J81c 1B50A 4NQLB 1FPYA 4L5RC 1WR6E 3A74A 1VQHA 2H5XA 3VVWB 4BBSB 3DBHB 2MNAA 5D3IB 1HNZL 5JAVA 3DVNU 2OXPA 2WDRB 3GB1A 4GOPA 3AM9A 2EYMA 3I90A 1ICFB 2A5UA 1EOVA 2NS5A 2VZKB 4N58A 2UXDL 4OWWB 1MFWA 3TBIB 2VXWA 2K6QA 2QA4A 5F2DA 1HEZE 1SXTA 4ARIA 2Q8TA 5C6AA 1QG7A 2DY8A 5LMNW 2BT6A 1V6EA 2AQ2B 3KLWA 3P4QB 5DNFA 1B44D 2PCFB 3LNNA 5A2QL 1PH8A 2BPSA 2J0JA 1VMPA 2NVYB 4JWSC 4DR5L 1RWSA 3EIVA 4B3ML 2KJRA 3NVWA 5C1ZA 4A3GG 1D3ZA 1SRUA 1Z6HA 5I6WA 4OW0A 4ZRIA 3PF5A 2L15A 1WGDA 4RAUC 3IHPC 2OT2A 4BBNC 1E2VA 3NK9A 1VMCA 2EYJA 5DM73 3T1HQ 1VQEA 4Q2JA 4E6IA 3R7QA 1I50H 1E7VA 4RCNA 2DGYA 4HDQA 3TSSA 4WWMA 2KXJA 5FJ8G 2KBNA 4TMAB 4DV1L 1L0WA 4DR7L 3N1YC 2JPHA 2CH4A 4W9JA 3CCSA 1H8CA 4B3TQ 3ZDTA 2BTEA 4AUQC 3VR2A 1CT1D 5CV5A 4HIOA 3P75A 2VH2A 4MM3B 2JA8G 3I9V1 2CWPA 3U9OA 1T0SC 3SE0A 4A76A 1OEYJ 5M5XH 2WX1A 4FHKA 3FILA 4HJKA 3U30A 1Q86C 1OXTA 4S17A 4EZLA 4OZCA 3S14B 2YLMA 2ACZB 3MFYA 1HHVA 5LL6X 3CCLA 1BMLC 2PO4A 4K8IA 1LUZA 4W9EA 4I6NB 2HQEA 5ISRA 2A69C 1IP9A 1D6EC 2G3QB 1EWIA 2ZCBA 4CQNA 1WWTA 1N60A 2JYEA 2O6VA 4NDXA 1Z2MA 3NVZA 3Q8AA 3NS1A 1I50B 4ICUA 4IM2A 4DK5A 5CV7A 3D4RA 5EE1A 3EN2A 3HKZE 2O2VB 1NSNS 4R8NA 2ZW0A 2KDEB 3P20A 1I3QB 4DBGA 4P75A 3Q8DA 4ARCA 1Q81C 1B3AA 4WWOA 3VUYA 5CBAE 4TV3A 3ERQA 3OYYA 4A4IA 1HNZQ 4JI2Q 4GN5A 5JJKA 1AN8A 5JHAA 4KVGB 4IUQA 4IM0A 4POGA 2L00B 2MLBA 4R4IA 2GA4B 4BWGB 1WXSA 2LI5A 2B76B 3IAM1 1JB7A 2NN6H 1HCZA 3AFPA 1IL8A 4G7HC 3ZTCA 3ZRCA 4AWJA 1UEAB 2K05A 1VQIA 3ZJYC 1TZ1A 4FO2A 1T0YA 3ZXVA 4Y7NB 3NZ3A 2KA7A 2K7VA 1UZXB 2LJIA 1U4PA 2AUJD 3HKSA 2C7NB 2KN4A 4NJCA 2JWUA 5JPMC 2KNBA 2XK5B 1BCPF 2FIDA 3OG5A 2KQ4X 5IOIA 1B1ZA 2LHDA 2MQJA 4P1CC 4BA2I 3RLNA 1WOCA 3BYTB 2Z0EB 3TMPB 5L95C 3OIPA 4DF7A 1G291 2HHHL 3GZNB 2E75C 3U4EG 2EOTA 2HQLA 4YTNB 3KYHC 2ZXPA 4DU9A 2ICEC 1LTRD 1TJEA 1YZ6A 2L05A 2GBRA 4K7SA 2KT7A 2R7FA 1BBUA 1K8MA 2EYFA 4F7ZA 1NR4A 2VQFQ 1BDOA 5C23A 3QG1A 1UE7A 1JE4A 1CK1A 2AUKA 1OQRA 2HTHA 2A69D 2F0FA 2FNJB 4JLCA 1JE5A 4JOIA 1IGCA 5IGGA 2QILA 4YWMA 3E56A 3N1ZC 3EVQA 4R3DA
chains in the Genus database with same CATH topology
4KD3A 4IUPA 3AE4B 1XCTL 2F0DA 4LK0M 3QOJA 5AUIA 1A2TA 5KNBA 4RH6A 3U9SA 2CW0D 5C5LA 1TY2A 4A3FB 1Q90A 1VF7A 1NUCA 3K5NA 4KMUC 4FYDA 3A8JE 1K52A 4FF4A 3Q8FA 4DXFA 5IGCA 2BB5A 2F0EA 4G4KA 1GAQB 4XQQA 2WXGA 3VYRA 3DWQA 2VUMB 4WAFA 5IGBA 3ZYYX 4XT3B 2JA5B 4J8QA 2WDVB 2RPVA 3CQZB 3A7AB 4JE3B 4MT5A 4A8XC 1EFID 3OHXC 4C3JG 1K50A 3VYTA 4ULLA 5IT9L 1JWMD 3X3MA 4P16A 4NZLB 2F0QA 3KLSA 2RBMA 5IGFA 2WACA 4DAPA 2J42A 4KY7A 5BN5A 4H13C 4OIKA 3EGRA 4NW2A 5EJWA 1TWHB 4K5XA 1JWUD 5K36G 1TKEA 2IGHA 3C46A 3C1EA 4KY6A 1J8IA 4C2MB 1QF6A 5AFWA 3P4SB 3DEPA 4MIUA 5IGEA 2EKIA 1CJEA 1RF2D 1WTWA 3J80L 1SNPA 1T5EA 4H0LC 2B2YA 2XVSA 2INNE 1PTOD 3M4OB 4KKJA 4I7ZC 1RJTA 2NZ1D 1QE6A 2N55A 2ZXOA 3L3OC 1SE2A 1GB1A 1QCBD 4EVOA 1Q8IA 3DEOA 1MI2A 2B39A 1OO9B 1S5FD 1E2ZA 5M5XB 2E2IB 3J9CA 3MP9A 3TDQA 4USAA 1I4PA 1DOLA 2I07B 1LT5D 1VCIA 2EDGA 1ONLA 5CV9A 1ET9A 4Q5VA 1BCPB 2A6HD 2PKOA 1PDQA 2LMCB 4GZYC 3GTLB 4YTMB 1SYBA 1YN3A 3SHLA 4RGNA 1F2MA 1H9JA 3GTKB 1YNNC 3I3CA 4JWUC 1R7SA 3MC0B 3D4DA 2EY5A 4QUCA 1WTXA 3AE2B 3B9JA 2RVLA 2JYOA 4OIJA 3R3OA 4HCEA 5C4ZA 1CQVA 3H09A 5G3LD 1QNKA 3UI2A 1PRTB 5K36H 3HUIA 3TEYA 4OO1G 2E2JB 4DXGA 1OXSC 2KMMA 2L12A 1NCVA 3PUVA 2K01A 1D1IA 1PTOC 2JZPA 1EZ8A 5A35A 3A8IE 1SYFA 1EOTA 1TWAB 5NUCA 3SK6A 1WTRA 5BYRA 2A5HA 2PVOD 3SDZA 4C7ZA 1BO0A 2D5DA 1FNVA 2K5QA 3VR8B 1EY5A 1B2TA 4D2KA 2IGGA 2CHBD 4DFAA 3PUXA 4FXDA 1HRJA 3I72A 2NUCA 2LMCA 3V2TA 3U52E 4CJ2C 2QMTA 1QOBA 2E76C 1J7AA 3AE7B 1ZP0B 1XXGA 1JCKB 3TP6A 1XEEA 2N9KA 2QIEB 4C3IG 1SSNA 1EIGA 3NBHA 5FO8B 1C4CA 2KOLA 2JQRB 1JRPA 2C9OA 3P4RB 1HTPA 3M7NA 3HOUB 2SAKA 3NTIA 1ZE3D 1RM6C 4YXDB 2F0PA 3SK4A 3A55A 5D7GA 1X32A 1S5CD 1I7HA 1X3QA 1WGKA 1YNJC 3AE8B 2WQYB 1C4QA 5FKAC 4ZOHC 2JA7B 2PW9A 1STGA 4X3SA 4FXKC 2B63B 3EA6A 1Y56A 2K28A 3I4NB 5JEAJ 1IYVA 5AUKA 3DHQA 1DOYA 2F0MA 1SMYC 2F0KA 2DYMA 2QSDA 3KK7A 3MZ5A 1C78A 4LLGM 1BQQT 2Z8LA 2BOSA 3TMEA 3TN2A 4KK7A 1TR5A 4K6DA 4IURA 2JE6I 3VR4A 4K2KA 1AYFA 4M0WA 4X3UA 4F7XA 4GDKB 2FHTA 1L0XB 3HS0C 3MHBA 1T3QA 1EYAA 4XWWA 3PZ7A 4KX6B 1STBA 1IGDA 4GDLB 1EY7A 1C77A 2K0PA 3PV0A 1J7CA 1KLUD 1YJIA 4NP5A 3WCQA 1JOKA 3K57A 1UWMA 1LT4D 3FMCA 2VNUD 1F77A 1G8ZD 2JSVX 5G3LF 1XLQA 5BMHA 2A68C 3MTSA 1S5DD 4CGYB 1EEID 1VF5C 3K58A 2LS01 3CKIB 2XN9C 3LWEA 4A3JB 5EE3A 4QCLA 3LXFA 1RD9D 5D3DA 3TP8A 5CORA 2RA4A 4TQ0A 3IKJA 5J39A 2D9UA 1WTOA 1E0ZA 1ZKOA 1F2RC 1GXDC 4RF0A 4FP5D 3AEFB 2AX5A 2H88B 2CVRA 4ZUIA 4H44C 1O7ZA 1DGJA 1FMAD 2E74C 1DJRD 1LT6D 2KECA 4KGRA 1PTOB 1VDVA 3W5UB 1S5ED 2MJ3A 2PTLA 2QCPX 1EYDA 3L9AX 1TIID 2DY7A 3BVZA 3RD4A 1YNND 1BCPD 3H94A 5J22A 2R61A 3JAME 3QO2A 3P63A 2BE5C 1VJKA 2Y3AA 5ELFA 1OXXK 2RQXA 3E6ZX 3BDCA 1X3PA 1Y8PB 2EY1A 4JBWA 1GJXA 2ZW1A 2K9XA 1YNTE 4B0MA 4A90A 1QJOA 1JMLA 3AE6B 3AN1A 1J9OA 2XWJB 4OHJA 1JROA 3Q23A 1C76A 1TVXA 5EPJA 3PUWA 3EJIA 4ITKA 1A3TA 2E2DC 5KYIA 2WXRA 3NP8A 4US8A 2LGIA 1FYCA 1GOZA 3AB9A 2PPBC 1RKNA 3KLSX 3C8YA 2W54A 1FRRA 3AEDB 4ME5A 1GUTA 1FEHA 1Q3LA 1EY6A 2B2YC 3S1NB 5CV8A 1EY0A 1MI0A 2PZUA 3VA7A 1UNSA 1QT9A 2M00A 1JOOA 1OFFA 1R4QB 1WD1A 1F9RA 1DZ1A 3MXPA 3I8ZA 3K7AB 3R8BA 2I38A 1SAPA 2MJ8A 3K5OA 5C0XG 1JC7A 3AU7A 1A2UA 1M8AA 3B2FA 1GPXA 4XDCA 1G2TA 1D1KA 1I4QA 2Q8RE 5HI1A 3DWMA 4HEA1 1L6UA 2O2LD 1XYIA 2QDBA 1LABA 1V97A 2L1BA 3CU7A 2RSNA 2V3NA 1XTCD 2A6EC 2IX3A 3VYUA 4N9TA 2LHEA 3HOXB 2ENBA 1E0BA 1SNMA 3MFGA 3OOCA 4HCSA 3JAML 3OWFA 4YWGG 1DOMA 1KH0A 1FXAA 1KDCA 2JYTA 2ZXRA 2F0OA 1OXVA 2WXPA 2DNCA 2KAJA 2B2VA 4IFDH 1YNJD 2EJMA 2NTSA 2Y5PA 3ABVB 3AH7A 4CKEA 1YJJA 2WXIA 4XIGS 2QJLA 3NE5B 4UAIA 2F0VA 2W82A 2B8GA 4RKLA 3H3VC 1PFMA 1ZDXA 1U4RA 4A6QA 1QKZA 4LMQD 1TKWB 1CZPA 3OMCA 2SEBD 4V190 3HOZB 1JOQA 2PQEA 4TKOB 5C3WA 2NWGA 4BY1B 1N5XA 2KVMA 3BDLA 3MVVA 2IW3A 2NTTA 4TRDA 1FIQA 1MPEA 3Q69A 4RGTA 1MD2D 3HZXA 2A74C 3GO5A 4HSPA 2FFKB 1PZKD 4XYOA 3EQLC 2IJ0A 4FVMA 1C79A 1L0YB 5I6YA 4LJZC 5C4JB 3MWYW 3EFXD 2DWQA 2JU6X 3AE3B 1SJHD 2KCCA 3CHBD 1MBYA 3E0JA 2CJNA 5G5HA 1YQ3B 1WD0A 1EWHA 1PTOH 5COYA 4C7YA 4HN7A 2EYHA 4L8JA 3AEGB 1KNEA 3J80E 2JA8B 1SYDA 3BZDB 1FRDA 5C0XI 1FNWA 4FF3A 4OO1I 3EUB2 4ZYSA 2AWOA 2EYOA 3MAQA 2R7ZB 2BA0A 1HA6A 1E7PB 3ITPA 4UDUC 4QB4A 4RKBA 1Z7TA 3AEAB 1IBXB 1LLRD 5E3FA 2L55A 2RSOA 4XXEA 2YEPB 2WXQA 5KYLA 1G6ZA 3BVGA 1M4VA 5M3MB 1K53A 3H0GB 4CHTB 2F0GA 4A3DB 3PO3B 3ND9A 2PW5A 4B08A 4U68A 4F88A 2EPBA 1ZXHA 3D4WA 2X69A 5KNDA 3AEBB 3L7ZC 2Z4HA 1DYQA 1C8CA 3PMFA 4KGTA 1JALA 3K5LA 2INPE 1AW7A 5MPOA 1I4HA 5I9PA 1EY8A 4B9WA 1HUNA 4L6TB 2M9VA 2GI9A 2FE8A 3WDNA 1VZ8A 2NBFA 3VA5A 2OEOA 4J3OD 1O7YA 1TYGB 2BS4B 1IKLA 2JXMB 1N62A 5CR3A 5T8IA 1II3A 2PMVA 3SXHA 3GTOB 4AQ7A 1DM0B 3HOYB 2CW0C 3OMGA 4PMBA 2RMMA 2X38A 4A3KB 4QUFA 1B4OA 5I2XA 3S9WA 4FF2A 3C1FA 4DQOC 4MN3A 1UUPA 1ZYRD 2Y5CA 1KF6B 3SR1A 1K8OA 4QF4A 5EKIA 4NKLA 1VRAB 2B2UA 2AWNA 3HKZB 3T51B 2FINB 4A3MB 4XQNA 3S15B 3AE5B 1Y8OB 3IT6B 4ZRPA 1GUGA 3H8HA 3OW7A 1WVLA 2WIIB 2W55A 4A9AA 3GQBA 3A54A 2J53A 4A3BB 2L32A 4RHRA 4JPSA 4ID6A 1GB4A 1STEA 2E2HB 1DOKA 4CBVA 3AB5A 1ICWA 4KKTA 1WTPA 5JVH3 4HTHA 1WXQA 4JK1C 4RWSC 3RLFA 3SK5A 2WB1B 2A68D 3TUOA 4P2CB 3S17B 4A93B 4WH4A 3I4MB 3GTMB 2RDGA 1AWDA 1JQ4A 1BUVT 1MSGA 2ONQA 1XWEA 2K04A 4MACA 1JORA 1V8QA 1BUIC 1SSOA 3RZDB 4K5VA 2BS2B 1RODA 1FFVA 5ELBA 1H9KA 4B0EA 2EJFC 1C4PA 1ILPA 1KNAA 2H89B 1H9RA 4ZQ3A 1DD2A 3C3LA 2D5GA 3KLRA 2X6GA 1E10A 2R93B 3DMUA 2HCIA 1EWCA 2IT1A 2F4IA 3CWIA 1VDZA 1NAPA 2NVTB 3Q24A 2L52A 4G7OC 3FRPB 3FPUB 2LFIA 3R93A 5IT9E 4EGVA 2NVQB 3T53B 2NMQA 3H6MA 2EYPA 2K22A 1JW9D 3TP7A 2J4XA 2R92B 1RYJA 2V4IB 5EE9A 3BG3A 3KWVA 3HEJA 2WXNA 1V1PA 3VR3A 4DNTB 2FBWB 1K83B 3J81E 2PMZB 3GTPB 5M5WB 2M19A 1K51A 3NVVA 1CA5A 2K3UA 3IL8A 3S1QB 1I4XA 1U9RA 2EYLA 4IN3A 3MA2B 3L4PA 3Q0AA 1BR9A 4AYBB 2OEDA 5ELCA 2MP1A 4RCOA 3PO0A 2F0LA 1CHQD 1TT2A 1Q10A 3I91A 3BK1A 1QB5D 2PIAA 1JQYD 3GP7A 4RF1A 2K32A 1S5BD 5HG2A 3HG9A 3DWGC 1L4DB 3VR5A 5C0XH 5K5PA 3NUHB 2DBYA 2W3RA 4K8JA 1W6JA 5EPLA 2PLPA 2M0AA 3A56A 1HA5A 4YSZB 3TZDA 3IT4B 1KDBA 3HVZA 3AE9B 3M3YB 2DNEA 1HZ5A 3P7JA 1L6VA 3QWNA 4KN4C 5EKKA 5T1IA 2Q5WD 3TP5A 5FOBB 4KHVA 1FCLA 3I4LA 3PUYA 5M9OA 1FR3A 2PZTA 2EJGC 1I6VC 1N61A 1GUSA 2F0UA 4DN4M 1QNUA 5CV4A 1F0ZA 3BIID 1SE4A 4C3JB 5HGTA 3GD7A 3O13A 2AQ3B 2WXKA 2F0NA 3IFTA 4HMIA 2N0SB 5BYQA 2BDNA 2V4DA 2K33A 1O78A 5T1GA 1L4ZB 2BE5D 1CTMA 3SK8A 1OXUA 1CZGA 3HP3A 3TEXA 1CA6A 1G2SA 4L1BA 1VR9A 1AZQA 2N88A 1HQMC 5CMDA 1ZDVA 1WYGA 1B9RA 2KQ3A 4JX1C 2XRQD 3KF8A 1Y8NB 3GV6A 1SYGA 4IZ8A 3NSWA 3DXJC 1KABA 4MH8A 4TSSA 5C3JB 3HRZC 2R6GA 5FR3A 5C44B 4P6VF 4WURA 1F2ZA 3MHZA 5C0XJ 5LL6S 4OGQC 1AFPA 3ZQ4A 4AS1A 4HJGE 3HVDA 2IGDA 1SDFA 3NUCA 2N7JA 4BY7B 2JSOA 4HRSA 1XCQL 2EELA 1ENFA 2HTME 4DA2A 1N5WA 1LV9A 1NVID 1HXYD 4KD4A 2G9HD 2J0TD 1B9MA 4KJNA 1STNA 3H91A 3M4YA 3GTGB 3RZOB 3N9YC 4C3HB 4YSYB 1N63A 1D5MC 3J81L 1F2RI 3GV3A 2L9HA 4X3TA 1AEXA 2SDFA 4NAMA 2H4OA 2SNSA 4G7ZC 2EE1A 2VB3X 1ZEQX 1SYCA 1E6EB 1TS3A 4IFDG 4ZLTF 2PVGC 3DWAA 3RMHA 3NTHA 1XX8A 4OZBA 2WXLA 1SE3A 4M1UB 1EYCA 4HSVA 5E6JA 4F8MA 3I57A 1GHKA 2IX1A 2AQ1B 1SJED 3Q6SA 4IQZA 1LTID 2KEDA 2A73B 4H2AA 4F87A 1LTAD 1YN4A 3A7LA 4KJOA 3KBXA 2WP8J 2FMMA 2TSSA 4HKZE 4RA8A 4A3EB 2RDHA 4NAWB 3QB3A 4REZA 3NPPA 3NWSA 4XDDA 2VZKD 3PIP3 3U7ZA 3ZJVA 2LEKA 1RTOA 1BOSA 5BYSA 4DNRB 3W2DA 3IAS1 2IDYA 1SNDA 1H9SA 3Q8EA 2KEEA 3AECB 2MPMA 1ZXIA 1ENCA 2QEJC 4A3GB 4V0BA 3NQTA 3K0YA 4KHZA 2EY6A 2K5PA 2WXHA 3CRLC 3AEEB 2QKIC 4HROA 1AP0A 1EWYC 2B2UC 2WXOA 2JP1A 4XE0A 3D3RA 5CYUA 2PW7A 1QLBB 3K59A 1LTBD 5C4HA 3SEBA 1YQ4B 5A2QE 2MJDA 1T5XD 5I9OA 4KKIA 2ZT9C 4CJ0B 3V05A 3A8KE 4OZCA 2XNAC 4L23A 5FK9C 1EL0A 5FO9B 2J52A 1PYWD 1Q12A 5JVG3 2A6ED 1DCZA 2LY7A 2EXZA 2KJXA 5LHY1 3MXGA 4ZRZA 1TWCB 2NN6I 5HURA 3D6WA 3M85A 4K5WA 3Q8BA 4QIWB 1NI3A 4CKBA 1D2BA 1C48A 2HUGA 4RHSA 1TY0A 4US9A 2JEBI 4KI0A 1BCPC 5JXVA 3ZJUA 2B2TC 3VR6A 3K5MA 2FMCA 1SB3C 2MH7A 3MJ5A 4YT0B 1SBBB 5KIXA 2XWBB 3FVQA 2O5IC 4LK1C 4OZAA 1TKGA 1H9SB 2DN8A 4YIJA 1U4LA 2MGSA 3M7GA 1KDAA 2EVBA 1PRTC 1HQRD 5FO7B 4KV6A 4BS9A 1C4AA 1PGXA 1XLPA 2WNMA 1ET6A 5M5YB 3I70A 1UGJA 1PLFA 2B2WC 2F1MA 4I65A 1NENB 1A3UA 2HDEA 1STAA 2B8FA 1PGAA 2WKDA 2NYZD 1P7FA 2EY2A 4K6LA 3HRDD 4ZHOA 3OIQA 3VQIA 3NTKA 4XQJA 4KN7C 1F9SA 4CKCA 5LNK1 3D8GA 4RNAA 5FLXL 1GUWA 4BBRB 2WLBA 2O4XA 1F9PA 5JEAG 1SIJA 4KKUA 1QOGA 4IALA 1FO4A 4X3KA 2B2WA 1L0VB 2NB0A 4DK1A 1FGBD 4R9WA 2KDMA 5EE0A 1PMRA 1O7LA 3DM1A 5E1FA 1XF5L 3SR6A 1C9FA 3SFDB 4XDXA 4EQNA 2G1EA 1CHPD 5DAUA 1A15A 3VRBB 2Z4IA 3E9SA 1KRHA 1F2YA 1F2LA 1YMHE 1A70A 1QOAA 5BN3A 1STHA 2D2CC 1VLBA 2BS3B 2NVXB 1VZ6A 1SYEA 2X6LA 4WRDA 1PDXA 3W1SA 3P4PB 3BYYB 3D6CA 1D5XC 1U4MA 5CBEE 3V96A 2F3WA 1CI3M 5H8YE 5EBCA 1BF4A 1CQFA 2WXMA 1ZYRC 5EKLA 1JWAD 1J7BA 1RFKA 5JOBA 4CJ1B 1S4ZA 4N6EB 2I46A 1DONA 2WXJA 4ZKBB 4EE2A 1WSPA 4ZAIA 2L83A 1TQOA 5JPNC 3OPOA 4L2YA 3B2GA 1CZWA 3DUZA 1R4PB 5IODA 4WORA 3AMUA 1F9QA 1V1OA 2CU3A 5HFYA 2V3PA 2XRSD 4ZHPA 1V8CA 1I4GA 3ZGZA 1ROEA 2HCCA 3TEWA 2K1BA 3FEWX 5G5GA 2NN6G 3T56B 1GUNA 2BYTA 1RHPA 1JWSD 1WTVA 1BNZA 1HFNA 3EROA 4O42A 3VR9B 1I4RA 2PNRC 4OO1H 2FJ2A 1VZ7A 3U2SC 2PYKA 2L1AA 3GS2A 4XWTA 5C3XA 5C2TB 3BWUD 2Z1CA 3MXUA 1V43A 2L4NA 2F3VA 2V0GA 4C56C 3N6RA 2K5WA 3W5VB 5IGDA 3V3XA 2IWHA 2TMPA 2MHVA 2Q8IB 2BW2A 2OF1A 5C3EB 5DEHA 3S1RB 3T3OA 2RDFA 1IUEA 1OQQA 1FFUA 3FKIB 4BA1I 1Q1BA 2LKVA 2KHSA 3J7AF 3HOWB 4J1MA 3I73A 3FPPA 3MEHA 1SFOB 3PUZA 1HUMA 4HKQA 1MHHE 5IOCA 2E3TA 2K03A 3KUPA 3UI3A 3GTJB 3TZUA 4FF1A 4A55A 4FNFA 1TWGB 1KTKA 1EU4A 1ZOYB 2WU5B 1LO5D 3LB8C 1H9MA 2K5DA 1EM7A 5DM63 3NRZA 5C5MA 1EY9A 1PUTA 1PFBA 3NQIA 1ML0D 4J6HA 5I2YA 2R3ZA 2Y0SB 4WQMA 3DWPA 1DXMA 3NVYA 1ENAA 4FXGC 5CGKA 4WFN3 4K14A 2XIWA 4RGOS 1NEKB 3J7AV 4IFDI 1BXTA 2C5CA 2DYOA 1CFMA 1SMYD 2YYZA 3D31A 4PNYA 1PRTF 4TQUS 2DLBA 3ETRA 5IIFA 2HDLA 3FAHA 1XLNA 2ON8A 2WAQB 1QQRA 2KWDA 4HR7B 1FCCC 3OSOA 3N52A 3RFZB 5ELEA 4Z9CB 2D62A 3T4AC 1SNQA 1V1PB 4IOIE 5E4XA 1SEBD 5I4DA 1SNOA 1NR2A 1EQTA 2F0JA 1KLGD 1SF0A 3RUZA 4FXCA 3ND8A 3S1MB 4LAAA 3QIAA 4C1NK 1PRTD 4ILWA 4OL7A 4DGZA 3NHHA 2F0IA 3ONAB 1UWXA 4B9XA 3MXNA 1XO3A 3F2UA 1QOFA 2E6XA 3NXWA 1L5PA 2JXTA 4RFBA 1D4BA 1QOHA 3K6OA 3OWEB 1GHJA 1WRIA 2PZWA 3C2PA 1BBXC 3FILB 2EZVA 4PT5A 1TS2A 4N59A 1LTTD 1Y1VB 2A6HC 1E2WA 2KACA 1JICA 1Q1EA 2WINB 2HDMA 3AMZA 2GB1A 3WOFA 2L11A 1FXIA 3G6JB 4OVZA 2QF7A 1DOXA 3T16A 1NYQA 1IHZA 4C3HG 5EPKA 1HZ6A 4PMWA 3Q22A 3PO2B 3LX0A 2WDQB 2LUMA 2F0WA 1G91A 2GRIA 3W9CB 4KTAA 5KRUA 4WIPA 1IW7D 1T6BX 2WS3B 1EEFD 5ELDA 2KUMA 3R2IA 1E9MA 2MEKA 4KY5A 1TZOA 1NYRA 5KEEA 4PV1C 3AV8A 1JB3A 3HOVB 3FDTA 3J7YW 2JX5A 4S3SA 4IDIA 1WTQA 1FD7D 1IW7C 5HHDG 4ZKCB 2BB6A 3E5SA 1FM0D 1QILA 2W3SA 5JJZA 4DAVA 1PGBA 1B53A 1P7EA 2SNMA 3KWLA 3P42A 2IPKD 5GXGB 1EZ6A 3KBGA 5D65A 1KAAA 3BDOA 2WXFA 3P1MA 1MSHA 1DOIA 5CC4A 1FNUA 2YU9B 5J1ZA 2MUYA 2B2TA 4C80A 4NMZA 1LTGD 4LTUA 1IYUA 4DAYA 4EQPA 2YEPF 4IUVA 3T13A 2H1EA 1O80A 4IFDJ 2O5JC 3Q8CA 3IAYA 1TKYA 4R8IA 2F0SA 4XYQA 1R9TB 5TSSA 4YSXB 4TQ1A 4H7BA 3S2DB 3BK2A 3AE1B 3KQ4A 1Y1WB 2RKSA 4G57A 1RTNA 4Q0FA 4EQOA 1ESFA 3IXSA 1HTLD 3WOEA 1PFNA 3QOLA 3IFDA 5E4WC 2K6AA 3CIRB 1PTOF 3PZ8A 1WCMB 2BA1A 2M56B 1RDPD 4PQXA 4ZUJA 1FD6A 1EIHA 1TS5A 1XLOA 2LFNA 2XSCA 1LTSD 2F0HA 1B9NA 1HFGA 1PZJD 2WKCA 1SNCA 2N9LA 3BS1A 4IKGA 5EBDA 5BMIA 2WU2B 1PFDA 1Z47A 2L5TA 2KCNA 3PIO3 3NBIA 5KNCA 2BBCA 2CJOA 5D14A 1ILQA 2F0TA 3CRKC 2WP9B 1ESRA 4YTPB 3LWUA 5KGUA 2M2LA 4HAEA 4QMGA 1TS4A 2B2VC 2L0CA 2JEAI 3GTQB 1IBXA 3S16B 1EY4A 5CV6A 4IUTA 2I2YA 1ZXTA 2MJEA 2VB2X 1D5ZC 3ZJTA 2BCOA 1MGSA 1MHXA 3G7LA 1AZPA 3X3NA 2OHFA 1MVKA 3URYA 3FC4A 3RPFC 2CQAA 5BMGA 5C4XB 5FLXE 4C1NI 4ZK9B 1LT3D 1Y69U 4O1NA 1ZUD2 4ODGA 3QJYA 5EGTA 5JEAH 3P1HA 4C3IB 4ZRQA 1TU2B 2ID0A 4XT1B 3SFEB 3T3NA 1ZPSA 1RCVD 1ACCA 4WJWA 3LYYA 1PZID 1TWFB 3HGBA 1YN5A 5BN4A 1W6KA 2ICIA 3SVMA 4KKSA 1UAPA 1A6XA 2F03A 2WV6D 1STYA 1IKMA 4GLSC 3BVMA 3W3AA 1PXUA 2IL8A 1LACA 2SOBA 4ABNA 3R2TA 1I6HB 4U673 4KGSA 1QWYA 2FUG1 1CM9A 1KFYB 4HMJA 1EQVA 4A3IB 4IUUA 4XTCS 3VRAB 4RGMA 1GUOA 3S2HB 2G9DA 4IUNA 4M8AA 5M3FB 3TEZA 4PMCA 5EQ0A 5H92C 2IX0A 1JR0D 2J7ZA 1HPCA 4DK0A 3VYSA 2JA6B 4L63B 2BDOA 3NWTA 4HEDA 1EU3A 1JWBD 4K2LA 4N9PA 4MHEA 1A3VA 1B50A 4BBSB 5D3IB 5JAVA 3GB1A 2OXPA 2WDRB 3AM9A 2EYMA 3I90A 2VZKB 4N58A 3TBIB 2VXWA 5F2DA 1HEZE 1SXTA 4ARIA 2Q8TA 5C6AA 1QG7A 2DY8A 2BT6A 3P4QB 2AQ2B 5DNFA 1B44D 2PCFB 3LNNA 5A2QL 1VMPA 2NVYB 4JWSC 1RWSA 3NVWA 1Z6HA 5I6WA 4OW0A 4RAUC 2OT2A 1E2VA 3NK9A 1VMCA 2EYJA 5DM73 4Q2JA 4E6IA 4RCNA 3TSSA 4WWMA 4TMAB 2BTEA 3VR2A 1CT1D 5CV5A 3P75A 4MM3B 3I9V1 3U9OA 3SE0A 3FILA 1OXTA 3S14B 2ACZB 3MFYA 1HHVA 5LL6X 1BMLC 2PO4A 4K8IA 2HQEA 5ISRA 2A69C 1D6EC 4CQNA 1WWTA 1N60A 2JYEA 3Q8AA 4NDXA 3NVZA 3NS1A 1I50B 5CV7A 3D4RA 5EE1A 1NSNS 4R8NA 2ZW0A