4OHJA

Crystal structure of toxic shock syndrome toxin-1 (tsst-1) from staphylococcus aureus
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
194
structure length
194
Chain Sequence
TNDNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYGPKFDKKQLAISTLDFEIRHQLTQIHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEING
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords Toxic shock syndrome toxin-1
publication title Crystal structure of toxic shock syndrome toxin-1 (TSST-1) from Staphylococcus aureus
rcsb
source organism Staphylococcus aureus
total genus 58
structure length 194
sequence length 194
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4ohjA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4ohjA01
1CHQD 5ELEA 1LT6D 1SJHD 3BYYB 1B44D 1TS2A 1UUPA 3BYTB 5D3DA 1SJED 1JWMD 1YN5A 1TY2A 3DWAA 3W2DA 1LT4D 4C56C 1RF2D 1AW7A 1STEA 1D5MC 1TY0A 2RDHA 2J4XA 1LTBD 2XN9C 1F77A 3KLSX 1LTSD 1JQYD 1EWCA 4RGMA 3EA6A 3EFXD 1ENFA 1ET9A 1I4HA 4TSSA 4Z9CB 1PTOC 2QILA 2O2LD 5ELDA 2G9HD 2AQ1B 1V1PA 1LT5D 1XTCD 3BVZA 1T5XD 4RCOA 1SE4A 2AQ3B 1I4XA 1EU4A 1TS5A 1PRTD 1EU3A 1CT1D 1S5ED 1FNUA 1SE2A 1MD2D 2IJ0A 1L0XB 4RFBA 1B1ZA 1JCKB 1HXYD 1FNWA 1EEFD 1LTTD 1FGBD 5FK9C 1PZID 1GOZA 1YN3A 1PRTF 1KTKA 3O13A 1UNSA 5ELFA 5D3IB 1FD7D 1BCPD 1AN8A 3R8BA 1D5XC 1FNVA 2SEBD 1SBBB 1TS4A 1PRTB 3DWPA 2WV6D 1LT3D 2RDGA 1HA5A 1CHPD 1BCPF 4RGNA 4DXFA 4NZLB 1PRTC 1LTRD 3V05A 5FKAC 2CHBD 1PYWD 2R61A 5ELCA 2XNAC 4RGTA 3SEBA 3BVMA 4RH6A 1PZKD 2XRSD 3BZDB 4K6LA 4L6TB 3URYA 1BCPB 2AQ2B 5TSSA 4RHSA 3TSSA 3R2TA 3CHBD 4BWGB 2XRQD 1BCPC 1SE3A 2QEJC 3MFGA 1XXGA 1CK1A 4UDUC 1V1PB 1LO5D 1V1OA 2NTSA 1LTAD 3OWEB 1I4RA 1D6EC 1BXTA 1EEID 1PTOD 1JR0D 1KLGD 3R2IA 3GP7A 1TS3A 1ESFA 3DWQA 1RDPD 1CQVA 5I4DA 1QILA 1PTOF 1SXTA 1ET6A 1S5BD 4ZYSA 4O1NA 1RCVD 1HTLD 1LTID 1DJRD 1S5CD 2IPKD 1L0YB 2TSSA 4RGOS 1RD9D 1HQRD 1YN4A 1JWUD 1KLUD 1SEBD 4L63B 1EFID 3MC0B 4DXGA 1G8ZD 1DYQA 1PTOH 1PTOB 1D5ZC 1JWSD 4RHRA 1I4QA 1S5FD 2ICIA 1LTGD 3BVGA 4OHJA 1PZJD 5ELBA 1M4VA 1S5DD 1I4GA 1I4PA 2NTTA 1LLRD 2Z8LA
chains in the Genus database with same CATH superfamily
2MO1A 4H13C 3J80c 2VQEQ 4LF4Q 2ZPNA 3S15B 4K3BA 3QOJA 1VF7A 3GTGB 1JWMD 2BS4B 4JI5L 5BR8Q 4ITKA 1YX5B 2HDLA 1MJEA 3H15A 4IUQA 1GUWA 3A56A 1T0YA 3KLSX 4NAMA 2Y0SB 4ZRJA 4A20A 2YU9H 2WLBA 1K50A 1CZWA 5M5WH 4B3RL 5K5PA 3I73A 2O2LD 4PYUA 4BY1H 4NB3A 2GRIA 2ZXRA 1CUKA 1BBXC 3D4WA 2AQ1B 2LSSA 1OTRB 2JY6A 4HCPB 4NDXA 1VJKA 4HPMB 2MBOA 2PZWA 1EU4A 3KF8B 4JI7Q 1TZ1A 1VMPA 2BTEA 1F2YA 4L23A 1WYDA 2E76C 2JYOA 3S2DB 2BPSA 4MSMB 4HEDA 4KJOA 3PGZA 1Q86C 3K57A 3PREA 1F9RA 3A9KA 2C60A 3ZUNA 3NTHA 3GQBA 2A6EC 4JI1L 4WJ3M 2R92B 1Q1OA 1QF6A 3T1HL 2RDBC 3HOVB 1BKBA 4PYZA 1ZOYB 3TS0A 2LEKA 4GGQA 1BDOA 4KKJA 1SN8A 3H3VH 4BKSA 2E2IH 2OOBB 1FCCC 2JPHA 4KN4C 3J7ZC 1UF0A 3R3MA 1LT3D 4AYBB 3H09A 1JE4A 1LACA 1MSHA 1H95A 1FXIA 2Y5CA 3AE9B 4OWTB 1TKGA 1NR4A 3KH0A 1PYWD 3NTIA 1WXVA 2VRRB 5HFYA 4ZCKA 2LRWA 1VCIA 4FULA 3BVMA 1A15A 4RH6A 4U673 1K8GA 3P4QB 1EQTA 3KVFB 2VS1A 4DR1L 1KRHA 2EELA 4OONA 5HG2A 3MHBA 3ND8A 3Q3MC 2XBBC 3N9YC 4GLXA 2DGYA 4R9WA 2QA4A 3SDZA 1HEZE 5D14A 1O7LA 2Z6KA 3M4YA 5IP7G 4B3TL 4G3XB 3VUYA 4ANXA 4CJ1B 4JLCA 1C8CA 1V1OA 3KUDB 2NTSA 1D8LA 3RMHA 1E90A 4NNJB 3UGBB 3A55A 1J0GA 4DU9A 1MSGA 4XT1B 3L3OC 1VQEA 4K5VA 3FHWA 1P0RA 2N7JA 1PTOD 1QNUA 3KDFA 2R7ZH 2IO1B 2AL3A 3G71A 2L15A 1ZXTA 2M9VA 1NI3A 1TZOA 3DWQA 4E6IA 1IZ6A 4X3SA 2LHEA 1K8RB 4FHKA 1A70A 1QVGA 3HKSA 1SXTA 2N1WA 3D6WA 3T51B 2QDLA 2KZRA 2LMCA 1SYEA 4O1NA 3N1ZC 4HLEA 3OTOQ 3TZUA 4W9CA 1DOXA 4RGOS 2F0OA 2MRPA 1FRRA 2EYMA 4DV6L 3GS2A 3JVZX 4FXKC 1X9NA 3ZNZB 1C3TA 4DR7L 3Q6BA 3QC8B 2KEDA 4GOCA 3NHHA 1B9MA 1ZP0B 1EY8A 1OQRA 1VQHA 2A19A 2INNE 4A93H 2IO2B 3HUIA 5AZHA 4EOYA 2JA7H 3K80C 2NVXB 1SMYD 4OL7A 1EYGA 1TJEA 2R2OA 1E3PA 2AUKA 1YJWA 2NVUI 2HTME 4JQWC 2B2WC 2F0FA 2AHOB 1IBKQ 4XDXA 3H9DA 2K52A 3PS6A 1PDQA 1HH2P 1YNNC 2WHIA 2N9LA 5C3XA 1QOHA 4DV2L 2JA6H 2Y5PA 3RN9C 2NMQA 1WX7A 1U0LA 3DMUA 1YIJA 1CKMA 3L13A 2M0XA 1EY5A 3VYRA 5HURA 1SYBA 1TVXA 3GTMH 1D2BA 1EIGA 5A2QE 4GKJQ 4C1NK 5KIXA 1E0BA 5CX3A 4DV3L 4DUZL 1EWCA 1WXSA 3D0FA 4EGVA 4RGMA 4QCLA 1E10A 4E71A 3R3OA 3R7RA 4IURA 4PS7A 1B70B 4GLAC 3D3RA 4A3FB 2HD5B 4JOIC 3PZDA 4L1BA 4BOZB 2KACA 1IP9A 1A2TA 3DBRB 3ENEA 1VQDA 1Z9FA 1C7YA 4NAWB 3C2PA 1WE7A 2BH8A 5LNK1 5D65A 4CDFC 1FD6A 4OWXB 1FL0A 2K6QA 3Q3OC 4WJNA 4ZLTF 1IBML 4WRDA 3T1YL 3PO2G 2JSVX 2B2YA 5KHOA 2IJ0A 1I3QH 4W9LA 1VZ7A 2D07B 2CHXA 2I38A 2EYOA 4WAAA 1KDBA 2UXCL 4HWIB 1K83H 5DPRA 4ANVA 1WCMH 4RM9A 2Q2HA 4ANWA 1WJJA 2JEBI 3MEHA 2E6XA 4EQ5A 2BDOA 1K3RA 1VQBA 3MXUA 1PH5A 5HI1A 4K8IA 4ASWC 1L2NA 2K32A 1AFPA 1IYJB 1B7YB 1G6ZA 1FNVA 1ZE3D 4DHJD 2EE1A 1ILPA 1AE3A 4LNQA 5A2QL 1PGXA 4ID6A 5EAYA 1H9SB 4LFBQ 1OO9B 4OXPA 1C79A 4GXBA 3K9OB 3GTLB 3V6EB 2R61A 1NMGA 3TEWA 4XYOA 1PQSA 3H94A 3RYTA 4R4IA 4DR6Q 4K7SA 2WGSA 4N9F4 3HOUG 3CF6E 2IO3B 5CBAE 1L0WA 2F3WA 3WWVA 4OWWB 1JWAD 1NMFA 1TWGH 1KH0A 2FIFA 2LZ6A 3WAPA 4AQ7A 5DPWA 2VQFL 3PPAA 2JRIB 3BK2A 1IKMA 4GN5A 4UDUC 1V1PB 1X1MA 2G4DB 3L08A 2BGFA 4MTKA 2WXKA 4HKZE 5I9PA 3E56A 4A3IH 3GE3C 3PCOB 3TEHB 1E7UA 3CSFA 1ZKOA 3A1QA 4IUPA 4X57B 3NQTA 3RD2A 1JR0D 3CRLC 3A8JE 1XPUA 3S17H 4KIKB 1ESFA 1GNUA 3APFA 3CCJA 2B8FA 5JEAH 1O78A 1LM8B 1PTOF 4BBSG 5L95C 3JAMi 2XTIA 3RLFA 5IYCG 4L5RC 3PV0A 1T6BX 3IT4B 1J9OA 1KLUD 2MQJA 1SGHA 2V3PA 4V0BA 5M5XB 1N8RC 1EUVB 3NPPA 5IP9H 1TTNA 4F87A 1R4NB 2LVOA 1Q12A 2DNEA 3LWEA 1YJ9A 4DWFA 3TEXA 3SK6A 1CHQD 3D6CA 5ELEA 3BIID 5E1FA 2ZJRA 1TU2B 5DM63 4GDKA 2JSOA 2RKSA 3SHLA 2F4VL 1RLFA 4MH0E 2KMMA 5EE0A 3DWAA 2KTFA 3IVFA 1SFOB 3FC4A 1D5MC 2K1BA 2IT1A 2D5DA 1EZ8A 4X65Q 4B3TQ 5C4HA 3RNAC 1MHWC 1YNJC 1JMCA 2Y5BB 2KLCA 4DGZA 1RYJA 1Y14B 3EA6A 1WIAA 2E2JB 2MCNB 4A3EG 4KTAA 3NSWA 2ZT9C 1KM7A 1U4RA 3JAME 2QEXA 1Y1VH 4L5QA 2GBJA 1HTOA 4CYEA 3H3VI 2KT7A 5ELDA 4ZRIA 4AIMA 5E4XA 5C0XH 4B3SQ 2K5PA 3SFDB 3X3MA 2DHZA 3LDZE 2N9PC 4DV5L 1Y56A 4LK1C 4YSXB 1Q81C 4GN1A 3PVLA 4FLHA 1JJ2A 2B2WA 2HQEA 1YHBA 4RFBA 2K3UA 3K9PB 3ZXRA 4M8AA 4QJFA 2K22A 4QAYA 1LTTD 4E74A 4DK5A 3M4OH 1K8AC 3GTKB 4K7WA 3TMEA 1WTVA 1RFKA 4IUTA 3DEPA 2ZCCA 5EBCA 3SDLC 4ARIA 4ME5A 1G51A 1MFWA 2UXBQ 1PV4A 1NJIC 2O5IC 3E9SA 1EWIA 1TWCB 3P1HA 2KN5A 4C2MB 2MHVA 2EMTA 4EZJA 3VUXA 5BYQA 2CH4W 4JI6Q 1PRTB 3W1SA 1YIWA 4USAA 2KQ3A 2F1MA 2KDBA 4PNYA 3B9JA 3E5SA 2E5LQ 4GZYC 2KANA 3GTPH 2HJ1A 3RFZB 4JI2L 3BDOA 5LMUL 4MDKE 2B2VC 5DLQE 3RR5A 3T3NA 3D4DA 3JAML 2HJ8A 3A9JA 2KQSA 4CJ0B 2E2DC 2M00A 3BZDB 2J42A 2L0TA 1GVPA 1Y8OB 1UE7A 2HCIA 3DBLB 2IX3A 2GBNA 2VH1A 3PO0A 3TZDA 4JWSC 2QEJC 4LNOA 4A3JG 1C77A 2WP8J 3L10B 1YVCA 3HOYH 4C80A 4JE3B 1HQMC 1W3SA 3NRZA 4PK1A 5E3FA 2K5QA 3NUHB 1WX8A 2C5CA 1D6EC 3RI7C 1BNZA 1STNA 3FDTA 4RMFA 4HIDA 2QCZA 3RNFC 2I2YA 3J81i 3AU7A 3NK9A 1TS3A 1BUIC 2PW5A 2RD0A 4QIWE 3AULA 2B2UA 3F2UA 4A3GG 1U5KA 4MM3B 4ZKBB 3A9KB 4GSWA 1MG8A 4JC0A 2DN8A 2K5HA 3TIXA 1HNZL 5IODA 3G6EA 1Q46A 2PCFB 1MG4A 3N20C 1JOKA 1C78A 3PLVA 2UXCQ 5F2DA 2DUDA 1RD9D 2K7VA 4TQUS 2WXNA 4US9A 2AWNA 5LL6S 3DM1A 2KAJA 3VH4B 3UI2A 4DKAC 2IW3A 3PO2B 1XLNA 1SLJA 4P2CB 1VQ5A 1I50H 3ZDTA 4OHJA 3Q3JA 1F2RC 1NENB 4XYCA 2BF8B 4WWOA 2JXXA 3S16H 2W82A 2LXJA 4FXDA 1K53A 4YSZB 4ZQ3A 4US8A 5CV6A 4JBJA 3RUZA 1AEXA 2K28A 2Z4IA 3U4VA 1FMAD 2X8XX 1A3TA 3K0YA 3DVNV 1RJTA 3W2DA 5LMNW 4KHVA 1NNXA 1QZHA 5JZEB 3GTOB 4YT0B 3PUYA 5GAEC 4TV3A 3J81E 2QKIC 3NE5B 3KWVA 2X69A 1V80A 1YJIA 4IWQA 2CKHB 4G4KA 1KC8C 1F2LA 4LUOA 3KDFB 1HUMA 4IO9A 3HOUB 3OLMD 1SMYC 5C4JB 2WDQB 2K05A 1AYFA 2BYVE 2PJHA 2WYQA 4Z9CB 2K33A 2QILA 5HKHA 1I94L 1WI0A 4XZ4A 1XJVA 5IP4D 3FKYA 3RT3B 2LMCB 2I46A 1AH9A 5EQ0A 2NWGA 2INCC 3WAOA 2LY7A 1YQ3B 3ERQA 1SE2A 4A3MH 2PYKA 4Y52H 1SR3A 1XMOL 1EO6A 4RCNA 4C3IH 1KTKA 4HEA1 4ANUA 4HSVA 5E6NA 4N8FA 1IYVA 3QO2A 4O0AA 3C0RB 4BBSB 2KXJA 2N7DA 3DWMA 3ZTCA 3MHSD 2MGSA 4G7HC 4GS3A 1WZ3A 2ALYB 3J81L 5CHVC 1PH4A 1CHPD 1V86A 2UUAL 2OQ0A 2Z1CA 1QOAA 3NVWA 4J6IA 1LTLA 2SDFA 1GUTA 4RAUC 3U7DA 1F0ZA 2F4VQ 1OQQA 4NKLA 3P4RB 3TSSA 4LUZA 5EGTA 3QCAA 1A62A 3B0AA 4BY1G 2D3CA 3N52A 3OJ4B 2NVYH 4JI0L 1Z6HA 3K59A 4J3OD 1TWFB 4UY8C 1PMRA 4DA2A 5E6JA 2IY1B 2D2QA 3QX1A 1EYDA 4ICUA 1H8CA 4KGTA 4HJ5A 4II2B 3OWEB 2CFMA 2WIIB 2QDBA 1WE6A 4L2YA 2B2TC 3J7AF 2F0UA 4ZAIA 3HG9A 3HOZH 4BA1I 3M7GA 2EPBA 2EZVA 4DV5Q 4A3KB 1EUJA 2E74C 2LUEA 5IGBA 4A3EB 3RZWC 1CQVA 2XIWA 1RL2A 3MAQA 3RZDB 4ZYSA 2Z4HA 5KNBA 1RCVD 1QZGA 1OFFA 2TSSA 1E2WA 1AWDA 1HQRD 2L05A 1JW9D 2NZ1D 5J1ZA 4LCDE 1G8ZD 5T1GA 1II3A 2K6AA 2EY6A 3LWUA 5IWAL 2B63H 2AEHA 2IY5B 2Q8TA 3AM9A 1QB5D 3PRMB 2F3VA 4AQYL 2KDMA 5H8YE 4ABNA 3KK7A 2NZOA 2NTTA 1XD3B 4HJKA 3G7LA 3MC8A 2EJGC 4DV7Q 4JI2Q 4CO7A 5LMUQ 2L11A 3DPDA 3ZNHB 3S2AA 4PQXA 1GC6A 3E3XA 5IT9E 2IGHA 3PIOA 3RZOB 2GVBA 5BN4A 5KYLA 3HOWH 4KHPL 5IYBH 3WAMA 4HKQA 4XWWA 1IYUA 1TY0A 4TKOB 2L52A 1ASYA 3CRKC 5JXVA 5A35A 1X32A 2R7ZG 3A1QB 4B9XA 3LGJA 2FCSA 3S9WA 1EYCA 4EQOA 1HR0Q 1UELA 1LYLA 4XX5A 3U2SC 3UQBA 5AJ3Q 3H6NA 2BS3B 3TP6A 1N5WA 2JVCA 3ZJTA 4A3JB 3K7AH 2GLSA 3VR9B 1I4XA 2PVGC 4KKSA 3AH7A 3SK4A 2EXZA 4JIOU 1WVLA 4GOPA 4JI4L 4NPSA 4YY3Q 1L0XB 1HNZQ 2CS4A 1FNWA 3VDYA 4FA6A 1TQOA 3JC66 5IGGA 2O4XA 3UE1A 4FBJB 1X54A 4URKA 4A93G 2PQEA 2JA7G 3VA5A 2REXA 4OZCA 4ILWA 1TWHB 3RLNA 5KEEA 1PYBA 4A3GB 1OEYJ 4CGYB 5D3IB 2K8BA 2A6HD 4V190 1XMQQ 5IT9L 1EY0A 1XCQL 1TKEA 4DN4M 3HRDD 4H0LC 3HFZB 1HPCA 2JA6G 1SBBB 1QCBD 1ZKHA 4GDKB 5G5HA 3KJOA 3AEFB 4DXFA 4DK1A 2CHWA 4M02A 1JB3A 4KN7C 4OVUA 1LTRD 4WWMA 1ESRA 2BKFA 1JORA 4NXNL 3SXHA 5JJZA 2XNAC 1VD2A 3U9SA 1PFMA 1KF6B 1GUGA 1OGWA 1HTQA 4WJQA 2RSUA 1PFDA 1E6EB 1QJOA 3SVMA 4HJ8A 4DR3L 2G45B 1CTMA 1PH8A 3C46A 1WGHA 1C4PA 4RG1A 5CV7A 2BWES 3HOXH 4HCSA 2KD0A 3IHPC 1FVIA 3MJWA 2WACA 4GNXC 3NVVA 4HN7A 4BS9A 3KLSA 3VR3A 4A4IA 1BXTA 3OMGA 4X64Q 4ALPA 1IL8A 1P3QU 1MPEA 1KHIA 4QIWB 4LK0M 1WCMG 1IHZA 1KLGD 3OWFA 1WXAA 3ML9A 4JI8L 4JG2A 1D3ZA 3Q24A 2R93H 5K36H 3I56A 2HTHA 5JHAA 1QOBA 1YD8U 1L1OA 2NVQB 3L9AX 1DJRD 1I5FA 3VXWA 4HSPA 4C3HH 2A4ZA 4RF1A 1E24A 1HNXQ 4H7BA 3E6ZX 1QVCA 1Y8PB 2CWPA 4LNNA 3M3YH 1NVID 2OF1A 5IOIA 4F7ZA 3I4MB 4RHRA 1I4QA 1S5FD 1YOVB 3A9JB 2V4DA 4LF9L 3PUZA 4K14A 1E7PB 1J6QA 2VUMH 4F1SA 1RTOA 2V0GA 4N6EB 3J81j 3GE8C 2FCNA 1ZEQX 2D2CC 2K8CA 4DV0L 2B3AA 1VQJA 3Q23A 1Q1EA 3S14H 1TS2A 4JVZA 1UWMA 3I4LA 5I2XA 4OIJA 4LF6Q 4DQOC 4R8NA 1TKYA 4KK7A 3TN2A 4A3IG 1WTWA 4RF0A 2ZJDA 1VRAB 2BA1A 4KKIA 4N9PA 2WXLA 2HUGA 2KO3A 4LFCQ 3E9HA 2XK5A 3HP3A 4LNFA 2YU9B 4YHHL 1VZ8A 3JW0X 1E7ZA 1AZPA 5JEAG 5LLIA 4DBGA 1X55A 2C9WB 4HCNB 5M5WB 4IM2A 1STGA 3CCSA 4BY1B 1C0AA 5FLXE 1R4QB 1LT5D 4MGZE 3U9OA 4IQZA 5IOCA 2AYOB 2JK8A 2CWAA 3PSIA 2KYWA 2WXQA 4ZYNA 2DYMA 1YJNA 3PSEB 4C4VB 3NZ3A 2BWFA 4P71A 5E6OA 1E8WA 1KABA 2EYPA 5FR3A 5IP9G 1M94A 2ACZB 1SSNA 3SFEB 4IFDH 1G6JA 4NJCA 2JXTA 3DCGA 5JH5C 2NBFA 4HTHA 3SK5A 1EIHA 3Q3FA 2FXQA 1WJ4A 2N49A 3KUPA 4XDCA 1EYAA 3VQIA 3SGIA 2BYEA 1D7QA 2LXKA 2JQRB 5BMIA 4C1NI 2OCEA 2CJNA 3UI3A 2KCCA 4UPAA 4FF2A 2E2IB 1XCTL 2WXIA 4XWTA 1ZDVA 3VFKA 1HA5A 2INDC 3C1FA 2KCMA 4HMIA 2KVMA 3BZCA 4NXML 1K51A 3RD4A 1XLOA 2VB3X 2A5UA 4JBWA 2ZM6L 3D8GA 4WJWA 3CCEA 2WAQE 3SEBA 1WR6E 3U8ZA 2IBIB 3SD5A 2RCFA 2MQHA 5FLXL 1JJGA 2WNMA 1WWTA 2ZW0A 4IWPA 3R2TA 1V8QA 1Y1VG 3M85A 4GKKQ 3H0GH 4KHPQ 3VTVA 4KLKA 1EZ6A 3MFGA 2PQAB 5C0XG 4QUCA 4OX9L 1F9JA 1WF9A 1F9QA 1WGKA 3ETRA 4MM3A 3UIPB 5L83A 4A3LH 3LXFA 3Q8FA 2L0FA 4B95A 1V2YA 1UWXA 1HJPA 4BBRH 1UZXB 3RNGC 2JZPA 2D62A 2LVPA 1YQBA 1K52A 1STBA 3R2IA 4UP8A 3DHQA 2R7ZB 5NUCA 2R7DA 2FUG1 2KTRB 2O6VA 2ZEQA 3NHEB 2MH7A 4UP7A 5G3LD 4DF7A 2A5HA 1QOGA 1G91A 4BAXA 2RSOA 3STBC 4JI4Q 2WWZA 4QMGA 3S1MB 2G5DA 4AH6A 2BS2B 3S1NH 2WKCA 4MEMA 2WAQG 3ALBA 4C7ZA 1T0QC 3VR6A 3J80i 2DY7A 3T3OA 3OIQA 3JSVA 1JWSD 1KFYB 1OQYA 3M3JA 4MHEA 3WIMA 4KD3A 4DAYA 1M4VA 4N58A 4BXXH 1E1TA 4A93B 2JA7B 4J15A 2NB0A 4EEWA 2CH4A 2H1EA 2E3TA 4S17A 1VDZA 3P2BA 3GTQH 3WA0A 4HJ9A 3RCZA 3KUCB 1SROA 1N36Q 3HOYG 4N9TA 3M9BA 3AE3B 1SJED 1KRTA 4CDCC 2JA6B 3BG3A 1WMHA 1CMXB 1YN5A 3HM3A 4IOIE 1V9JA 1JB7A 1VQFA 1AW7A 2WKDA 2UUBL 1DGJA 1R7SA 1MKHA 2GB1A 4PV1C 4LFAL 3GTMB 4WWNA 1Y1WH 1VS0A 1LTSD 3ZJUA 1CZPA 3W9CB 3HEJA 1J19A 4W9IA 3UDIA 3MC9A 3PIPA 2JRHA 2JF5A 3ZIMA 1C1YB 1IXRA 5C4XH 4GLSC 3BVZA 1GUSA 3I8ZA 2WXJA 4B9KA 1UE6A 1XF5L 3IFTA 4DV1Q 4QB4A 4JI8Q 2BE5D 3J80E 1WD0A 1WGYA 1VQMA 1RM6C 1H9KA 2DNFA 2K14A 2PMZE 2OEOA 4LNIA 5J3BA 1EY4A 2PZTA 3A7LA 1HXYD 1I3QB 4OEMB 4ZRKA 2KJRA 1TR5A 3T13A 4HIKA 2JP1A 1K83B 2DYOA 2H89B 1WCMB 4CDDC 3N1YC 5JJLA 4DDGD 3O13A 4LDTB 2J0KA 4HDQA 4DDID 1FJGL 2LJIA 2N3SA 5ELNA 1WTXA 1QG7A 4G57A 3ZLZA 4KY6A 1EM7A 2MBHA 2PEAA 3B6YA 3KF6A 4DR4Q 4FJYA 3U4EG 1SIFA 2QSDA 2UUCQ 2VL6A 3DWPA 3RN2A 3PF4A 2C7NB 4DUYL 4KZCA 2V3SA 5AZGA 5FJ8H 2YEPB 2MBQA 4A75A 1FXTB 4XYQA 3FVQA 2MX2A 3OJ3A 3VYUA 2B39A 1BBWA 2N88A 2D0PA 5TSSA 2UU9Q 1STHA 1CFMA 1R4PB 3MVVA 2LI5A 1TWGB 5C5LA 2A6HC 3TQYA 4ZHOA 3CF5A 3J80L 4K0KL 4A3OA 1HZBA 4WH4A 1XXGA 2NBUA 4H02A 4MN3A 2UXDQ 1BMLC 3APDA 1NTGA 2WQYB 1GJZA 2HT1A 4IPGA 1XPOA 2FINB 3MEFA 2NUCA 4YHHQ 3VUWA 2ZXPA 5M5YH 4A3MG 4A3IB 4GOPB 4PMCA 2Z0DB 3DHGC 4YCUA 1GB4A 1JOOA 5EPJA 4PZ7A 3K5MA 1C4AA 2FBWB 2JN4A 2I0QA 5CORA 3TJPA 4C3IG 3S17B 1SMXA 4Y7NH 2KJXA 2KFKA 1GD7A 3PHXB 4YXDB 4FXGC 4X3UA 3UDFA 3I72A 1PH3A 1Z5SB 1SB3C 3WOFA 3PUWA 1QKZA 1TGZB 1YJJA 2MJ3A 2ON8A 4A90A 1TWAB 2JXMB 1VCBA 2K01A 2IPKD 4FXCA 3S1QH 4JI5Q 2KDFB 5G3LF 2L76A 4IM0A 3TL5A 4JV5L 4JYAL 2KBNA 3DBHI 3NTKA 2V9HA 2WDVB 1TXYA 1S3OA 3CQZH 3MC0B 1PTOH 4K8JA 5JEAJ 4A3DH 4IUMB 1MI2A 1PFNA 3ZVVA 3P7JA 2JEAI 1XO3A 1PZJD 1TKWB 4FP5D 5CR3A 5I6YA 1S4ZA 4B3RQ 4KSKC 3K58A 1X3FA 3VRAB 3NBHA 1B9RA 1LT6D 2V1CC 1EY7A 3AE5B 3I70A 2RGFA 2C9OA 1HCZA 1WI5A 3CCLA 2G4SA 4OO1H 2DJGC 1SE8A 3W1YA 4REZA 2ZTCA 4FNFA 3KLWA 2SNMA 4Q5VA 4IFDI 1OEYA 1WTHA 2WXMA 3P63A 1F77A 3HOZG 3N32A 2K1FA 3EECA 4JI1Q 2MO0A 2CCZA 3AV8A 3E9IA 3I7FA 5FO9B 4X3TA 3CWIA 5HHDG 1N60A 3T1HQ 2WXGA 3NUCA 1ET9A 4X62L 3C3LA 1UBIA 2QMTA 4MZ9A 4KGSA 1L7YA 1Y1VB 4IW0A 1UBQA 1EWYC 2K6DB 1L1OB 1SYFA 2ID0A 1NR2A 1T5XD 3H6MA 4I7AA 1DONA 1GHKA 1K0SA 2RPVA 1HZ6A 5T8IA 3DOWA 4AJWA 2RHSB 1PRTD 5EBDA 4U68A 3Q8AA 3U4ZA 2JWZA 4K5WA 3AE2B 2B63G 1WTRA 2CHZA 1HFGA 1B1ZA 4DR1Q 2NYZD 1RFAA 3PV1A 5FK9C 3W1BA 1PZID 3M4OB 2GN5A 5C0XJ 2AKWB 2WU5B 1Q10A 3K0XA 4B3ML 2KDEB 1B9NA 2HHHL 3OAWA 1ZYRC 1JRUA 1AN8A 4CJ2C 5LMNL 2GOWA 1HTPA 1CZGA 1R4MI 2D3BA 2G9DA 4YWLA 1GAQB 4RGNA 2M17A 1DCZA 2WXPA 3ZTDA 3HOWG 5IYBG 2WAQB 4X3KA 3GTPB 2HDEA 3L0WB 3RNEC 1K9MC 1OXSC 5BN5A 4I65A 4DNRB 1TIFA 1PZKD 1DOIA 4JW0A 2SOBA 2XK5B 3WDNA 4LF5L 1V43A 3BDCA 1NYRA 2K39A 4BZAA 5LL6X 2KWUB 3P75A 2WXOA 2F4IA 3CC2A 3HOYB 2RMMA 4KJNA 4LAAA 3CCRA 4YCVA 1LO5D 4DV6Q 2LXCA 4WQMA 2L00B 4BKSD 3ABVB 4II3B 4DR7Q 2CVRA 1VQ8A 1WGRA 4D2KA 3AU4A 2OJWA 4KSLC 1EEID 2QDFA 3M95A 1B4OA 2FFKB 4BA2I 4TQ1A 3GP7A 4IG7B 1BQQT 4JOIA 1XX8A 5I4DA 1ENCA 3KJPA 2N78A 4A3BH 2PKOA 3ND9A 4NY0A 1ET6A 1S5BD 3A5UA 4DV2Q 2KFJA 1S5CD 3ULPA 4NMZA 4GIVA 4HJGE 4M01A 2EJMA 3CP0A 2F0QA 4IPHA 2LJ5A 1FJGQ 1IGCA 4DR2L 3EFUA 2MNAA 4POFA 1WTQA 2BW2A 4DV3Q 4W9EA 1HFNA 1D5ZC 4DUZQ 2I5MX 3DWGC 3MTNB 2QJLA 3N1XC 1I50B 2VW9A 2FUHB 3QJYA 2PMVA 3BVGA 1A63A 4Q2JA 3QR8A 1KXLA 3T4AC 4Q0FA 3S16B 4W9FA 4IJLA 4QQBX 3BYYB 2KHIA 4L8JA 1B44D 3HOXG 4KZ0A 1S3SG 2EKIA 1Q8KA 1D1IA 3BYTB 1IBMQ 3RNCC 3NJTA 1JC7A 3T1YQ 1WGDA 2IYDB 2OQKA 2IX1A 3VR4A 3GO5A 4C56C 1WM2A 1EQQA 2KJ6A 2VB2X 3IFWB 5DAUA 3AI5A 1FFUA 2F0GA 1G6PA 4C00A 2F0IA 4HCEA 1P98A 3I3CA 1UEBA 4YWKA 1MVKA 2X6GA 1XNQL 2R93G 5K36G 1AARA 1ENFA 4X66L 1SF0A 2J53A 2O6VB 2QW7A 1LV9A 4KV6A 3VR2A 3MFYA 3S2HH 2LWPA 1PTOC 1WTOA 1L6UA 1KAAA 1E8YA 2X6LA 1HNWL 2DZMA 3FAHA 4K2KA 3ZNGC 3MXGA 4C3HG 3PO3H 2MLBA 2AQ3B 2PMZB 2RA4A 4YIJA 2CQOA 2CW0D 1QLBB 4GLVB 2FCMA 1JICA 2QC8A 3BY4B 3ZO5B 5DPSA 4A3MB 1XNRL 3K7UC 2YLMA 1EEFD 3D31A 1QZEA 3JSVB 4K7UA 1QT9A 5C44H 1UD7A 1GOZA 1PRTF 4DAYB 4YWMA 4C3IB 2KWVB 2Z0EB 1V81A 2ONQA 1PXUA 2OJRA 2VQFQ 2VUMG 2KOLA 3W1GA 4TRDA 4HMJA 1LFDA 4W9GA 5E7NA 4BVUC 2XGTA 4OGQC 4R3DA 1L6VA 2RR9A 3L7ZC 1WMHB 2PQAA 2LHDA 2WXHA 1O7ZA 4P7IA 1P8LA 2RVLA 4TQ0A 4QUFA 3AE1B 4MT5A 1CSQA 2F52A 2L1BA 3I90A 4AWJA 2KQ7A 4EE2A 1I6HH 4J6HA 1HE8A 4K6LA 3SR6A 2M0AA 4BKTA 2KMAA 1V97A 4JPBW 1BCPB 5IE8A 2J0MA 2KX0A 4XDDA 1MI0A 4FF4A 3LYYA 4S3SA 1JE5A 1VDVA 1KL9A 4P1CC 2KTRA 1EQRA 4HIOA 3U50C 2NVYB 3S1RH 1MIUA 2OTJA 3V3XA 3CCQA 2I1KA 3CCMA 3QK0A 4I7ZC 5GADC 3OIPA 4BBNF 3AEVA 2FJ2A 1FFVA 2N7EA 3IAYA 3HK0A 3NY5A 5EKIA 1OXTA 3A33B 4IFDG 4POGA 1F2RI 2LFIA 3DVGX 3P4PB 3HOZB 1N32L 1WGGA 4TKNA 1KRSA 4M8MA 5H1SE 1ZGUB 3Q6SA 2E8GA 3DLLA 3RN5A 1RDPD 3WANA 3QWZB 4LJOB 1QNKA 4KY7A 2Z59B 5H92C 2PIAA 3Q8BA 1TIID 3KF6B 1JRPA 4OO1I 3SHQA 3IAS1 3PHWB 4W9DA 5JPNC 1SNPA 5M3MH 3BINA 1SDFA 1L5PA 3DHHC 1EFID 3I57A 2N0SB 4WURA 5C4JH 4P75A 2A6ED 2B63B 4J1MA 1E8XA 1UEAB 3KW5B 3V96A 2JA8H 3U7ZA 1HZCA 1NUCA 3H0GG 3PGEA 2NBVB 1VQ7A 1MJDA 3IBEA 3RPFC 3NZUA 1GXDC 4A6QA 1NYQA 4FN2A 1ONLA 1WTPA 1J5EL 4YTNB 2BT6A 3DM3A 2G1EA 2TMPA 2L12A 4A3LG 5D3DA 1HR0W 1STAA 2IX0A 2ES2A 1X3PA 2EYFA 1Q82C 2ZCBA 3H1UA 1TY2A 2B2VA 5C2TB 4BBRG 1EOVA 4HIMA 2YV5A 1AZQA 4LF8L 1VQNA 5CV5A 4I6NB 2YTVA 3HRZC 1ZW7A 1GHJA 4L5TA 1WR1A 1L2FA 2BBCA 2BB6A 2JUOA 4NQKE 1J7AA 4RA8A 4KKUA 4HAEA 2W3SA 5DNFA 1ZDXA 4ZKCB 3OW2A 3EFCA 2AL6A 1BUVT 3K6OA 3F1ZA 4YCWA 2KFKB 2MP2A 3H8HA 3IL8A 3IAM1 3CCVA 2DZJA 2J0TD 3TREA 3I63C 2G9HD 3K7AB 4RCOA 1U4LA 1E7VA 1CKOA 4HVBA 1C9OA 4LF4L 1NDDA 2KC2A 3DQVA 1ISNA 2F0LA 5C0XI 3TP8A 2LGYA 1CI3M 2NZHA 3OG5A 5BR8L 3VHTC 2Q2TA 1V5OA 3F2DA 1KNEA 1E8ZA 2UYZB 2UU7A 1STYA 5C3EH 1B2TA 1YNTE 3EUB2 3PTFC 1RHPA 4BXXG 2IGGA 5IGDA 2K25A 3FKIH 2K04A 1E5WA 4JWUC 3NBHB 3AE4B 2L3ZA 1IBXB 2F0SA 2MBEA 2YTXA 2MJEA 3ERSX 1XPRA 2FMMA 4JI3L 1E2VA 4XC2A 2WV6D 3KFUA 1CA6A 1PRTC 3UQAA 2E75C 4IPCA 2CHBD 3UE0A 4A3KH 2ZJQA 4JI7L 1CQFA 4QL5A 4RGTA 1Y1WG 1LUZA 5EE1A 4G7ZC 1C4CA 3I9V1 2ZJPA 3ZNID 3AEAB 2IDYA 5JVG3 1FM0D 1R9TH 1U4PA 3IT6B 4QY7A 2LVQA 3DDCB 4KGRA 5C4XG 5I2YA 4AUQC 3HOXB 4KY5A 4MACA 4IUUA 5GMVA 2C35B 2VY3A 4IDIA 4TUUA 1P9DU 2IWHA 1G2TA 2VZKB 3KLRA 4HROA 3V62A 1V6EA 1VQ9A 2PVOD 1NEKB 3NENA 3OOCA 1GG3A 4DR5L 3I2ZA 2W3RA 2HQLA 1HNWQ 2XSCA 4P1BC 2KVRA 4ZRQA 1CM9A 3W5VB 2NN6H 1TBEA 1K28A 2R93B 3ZRCA 5CTRC 2NCNA 2XEWA 2RF4A 4AP4C 2XWBB 1BOSA 4BBNC 5IAAC 4TMAB 1T3QA 5KGUA 5FLMH 5BO4B 3KYCD 4C3HB 4H2AA 2WB1E 4ULLA 4LF7L 2F03A 1IGDA 1VF5C 4DK3C 2JYTA 5FJ8G 2K8HA 1T5EA 4CBVA 2JE6I 2N8NA 2Z0SA 1A3VA 4R4QA 3M3YB 3OW7A 1P1AA 2DWQA 3HVZA 1DOMA 1O7YA 2D10A 2B29A 2MEKA 2IZVB 4UP9A 2ZNVC 2BKRB 2EYLA 4ME3A 4JX1C 4MJSB 4LNKA 4BKGA 1I4GA 2B76B 3A4RA 1V9PA 1I94Q 1LLRD 1MJCA 4XGAB 2VUMB 3APCA 3HVDA 2HD3A 1RODA 1X3GA 1LGRA 3A8KE 3C19A 3S14B 3TMPB 3BZKA 2YYZA 5CV4A 1M90C 1WFYA 2V1YA 2LASA 5D94A 3OTOL 3AEBB 4NQLB 3DBHB 1RF2D 3I5JC 3D4RA 1XMOQ 4L5SA 2PE9A 3I3TB 3FPPA 4MGIE 3R93A 1Y8RC 1XEEA 1JQYD 3BDLA 5KNCA 2A73B 1F1HA 1F2ZA 4NJ6A 3GV6A 3FP9A 2NVTH 1Q1BA 2I5HA 5IYDH 1SE9A 3DHIC 5EKKA 3VAWA 2KHSA 3ER0A 2E2HH 1WYWB 2WB1G 2KHWB 1IBLL 1XYIA 2KK8A 4G11A 1YEZA 2YTYA 1HRJA 2BQQA 1S40A 1IBKL 1PDXA 5G2NA 5HGTA 2UUAQ 1B50A 4B6WA 1TS5A 2EIFA 2LS01 4MTNA 1XLQA 2B2TA 1C4QA 1WRDB 3T53B 4M0WB 1S5ED 2IY0B 4A3DG 2INPE 3AQQA 1KLVA 2DENB 1E22A 5M3FH 2KX3A 4DXAB 1KJTA 3P20A 4IUNA 4G0NB 3PRPB 3A5ZB 3TDQA 4P74A 1JQ4A 3CKIB 4GN3B 4JI0Q 4K1RB 1YQ4B 1KAWA 2LGDA 2LUMA 2GBKA 5ISRA 1EY6A 4P72A 3E0EA 4C3JH 2SEBD 4IFDJ 3CXCA 4OO1G 3OHXC 3I4NH 3KBXA 3IG3A 2WDTB 2YVCA 1GO3E 1NAPA 5IO9A 2F3IA 4ZUIA 5J17A 4WJPA 1MHHE 2O5JC 3TBLD 1YHAA 1S1QB 2MWSB 1XQQA 2EY5A 1J5EQ 4I6LB 3DXJC 4G7OC 1GUNA 4WORA 2PNRC 3URYA 2L83A 2W55A 1QQRA 2FNJB 3U52E 3KWLA 1FR3A 2A74C 5CV8A 2N1VA 3H0GB 3AMUA 1HZ5A 3CPFA 1SE3A 2C5LC 5C3JB 4IJHA 2A69D 1T0SC 4JCVE 3ZDMC 2KUMA 2H5XA 3GOEA 3FILB 1R4MB 1MHXA 3I4MH 1YNJD 2JA5H 1PFSA 2I5LX 3KYHC 3NELA 1ENAA 5EKLA 4BBRB 5CMDA 5IWAQ 4FF1A 1N63A 4LFBL 3GTJH 5JJKA 4AQYQ 1RRBA 2G3QB 2B2YC 3NQIA 2I07B 5BN3A 5IGFA 2KDIA 2K4KA 3GB1A 5DM73 1KQSA 1GM5A 4A3CH 1JROA 2KKCA 4GMVA 5LXHA 3CW2C 4DR6L 1V5TA 2JA9A 4WJOA 2M8SA 2GI9A 2WS3B 1O80A 4BFRA 1N34L 5AUKA 5HGQA 1HTLD 1DOLA 2VNUD 1L0YB 3S1NB 4BY7H 2LGIA 1SYDA 2F0NA 2J7ZA 2EY1A 5E4WC 1JWUD 1SEBD 3NVZA 2L0CA 1BT0A 3AE8B 3PZ8A 2DYBA 3TEYA 2IHEA 3CMAA 2MSED 4IN3A 4NPNA 4M00A 4JI3Q 1Y69U 3QARA 1WFQA 1PYSB 2MJ8A 1KIXA 1GPXA 3A4SC 2B3GA 2EQSA 1FO4A 1VQCA 3MWYW 2PO4A 2PW7A 4CKCA 3GTQB 1TT5B 2ZW1A 1D4BA 1SRUA 4OW0A 1WXMA 3S15H 2FIDA 3J7YW 1UUPA 2XVSA 3Q0AA 4K6DA 1T9HA 3GTGH 3VR5A 3CD6A 2F0HA 5L37A 2KHJA 3EGRA 5FO7B 1F9SA 1N5XA 4O42A 4J8QA 2ASBA 2DBYA 2QF7A 1K73C 2OHFA 1KNAA 2MFIA 2MPMA 1Q7YC 4EVOA 4W9HA 3CPWA 1Y1WB 5C23A 1E0ZA 2ATWA 1EL0A 3NXWA 4EFOA 1LM0A 5EJWA 4LDTD 2OEDA 4A3BG 2BA0A 4UAIA 2ENBA 1PUTA 4DR5Q 1KD1C 3TP5A 3VTWA 5GROA 5C4XB 1PH9A 2K5DA 4GNXA 1UGMA 4YL8A 4O2DA 1SE4A 3EJIA 1ILQA 2PZUA 2EDGA 1CJEA 4NXNQ 1V8CA 1B53A 3QG1A 4N59A 3M63B 3S2DH 4NJ7A 5E6PA 4GN4B 4MH8A 5FOBB 4IOAA 3F2CA 1EIYB 3GZNB 1A3UA 2D0OA 3Q69A 3NG0A 4X65L 2F0WA 4AOFA 4LF7Q 1GKHA 4DR3Q 4HPPA 2W9NA 2V4LA 5ELFA 4APVA 3NOBA 2R92H 1HA6A 1WZ0A 3L4PA 4A55A 3I91A 3HOVH 1JALA 1ZXIA 4GDLA 3MXNA 1M8AA 4GB9A 4B0MA 3M7NA 4MSQB 2L32A 4B3SL 2JYEA 2IL8A 2ASQA 2VH2A 3O65B 4KV2A 4NZLB 1WD1A 4RKBA 1D1KA 1Q5WB 4W9JA 3ZW3A 4HXDA 2J0JA 1YBYA 2PI2A 2DAJA 2ZTEA 4WJ4A 5JAVA 3S1MH 4EZLA 2NN6I 4B08A 4AS1A 4DAVA 3EHVA 4CHKA 2L7RA 3ECIA 3TCAA 1WYGA 3RULA 1LQBA 2MP2B 4NP5A 2RPQA 3B2GA 2NPTA 3Q14C 3Q22A 2CQAA 1P7EA 1NBFC 2UXBL 3ONSA 3OPOA 3PO3G 3ZJVA 2DAFA 4JI6L 1YZ6A 3M4PA 1BF4A 3DUZA 2SAKA 5M5YB 2JJQA 3KYDD 5KNDA 2E5LL 3LJ3A 3RMKC 2MHJA 1IBLQ 2HIVA 3VYTA 1I6VC 1YNXA 5C44G 4LF9Q 2GMIC 4Y7NB 3B08A 2L8JA 4FDBA 5C6AA 3JYUA 3RNBC 2PLPA 3BK1A 1Q0WB 2BDNA 1TYGB 1DD2A 4DV0Q 1L4DB 2FCQA 3AEGB 2BB5A 4CKEA 2WB1B 3PF5A 3AE7B 1AP0A 3S1QB 5I6WA 2ZPYA 4HR7B 2K5NA 4ZDVA 2CJOA 3HGBA 3VRBB 2F0PA 2RCNA 1E2ZA 3CQZB 1FYCA 4DXGA 3W1SC 4AJYB 1PTOB 4A3DB 3CMEA 2PNHA 2ICIA 3JAMc 2LFNA 2MW5A 2V4IB 1WOCA 1A5RA 2OXPA 4E3CA 2NVXH 1YI2A 1WSPA 2PI2E 2JZZA 1A2UA 1UE5A 4ZK9B 2D9UA 2F0JA 3ULLA 4HJ7A 4A8XC 1HUNA 3HZXA 5IGCA 3PIP3 4ZRPA 3K81C 1OXVA 3SE0A 1IUEA 4EQPA 1N9WA 1RAXA 1QWYA 4W9KA 5AUIA 3A74A 3DBSA 5JOBA 3P4SB 3PQIA 3T56B 4FJZA 2N4FA 1LABA 1RIPA 2RDFA 3ZRFA 2A1AA 1A6XA 4YWGG 4PT5A 1CKNA 4F7XA 4WQOB 1VQGA 2LGXA 4XQNA 2R7FA 4A3FH 3EC8A 3ZKJC 4FYDA 2B2UC 2EYHA 1W2BA 4KDLB 2EYJA 4IKGA 3SK8A 1T0RC 2L1AA 3TEZA 4XQQA 1E1OA 1EQVA 5M3MG 2LRUA 3M4QA 1FGUA 4NXMQ 1DZ1A 1ZPSA 3W5UB 1IBXA 2ZM6Q 3CCUA 3LX0A 5EDSA 4F8CB 3VYSA 1JCKB 4NW2A 4B9WA 4DFAA 2QHOA 3IXSA 1N34Q 3ULJA 3EQLC 3W3AA 2KJHB 3LB8C 1P16A 3FPUB 2IHFA 2JA8G 2D3GA 3R66C 1M1KC 4JK1C 4RNAA 3AN1A 1IW7D 2WINB 2YEPF 4R4TA 4OX9Q 1PA6A 2KECA 4XT3B 1GUOA 1EY9A 3FEWX 4IWOA 2BCOA 3U58A 2PPHA 3ICEA 1YITA 2F0VA 2QGQA 5KRUA 3H3VC 2ZVOA 4PMWA 5BYSA 3QOLA 3E0JA 2IGDA 3R7QA 1VQIA 2DJFC 4DNTB 1P7FA 2PPBC 3LNNA 3GTLH 1GC7A 5CYUA 3N3KB 2NS5A 1DXMA 1C48A 1ICFB 4L6TB 1TWAH 2A68D 3A54A 3ITPA 1W6KA 2AQ2B 2JZ3B 1B8AA 3FMCA 5BMGA 2XRQD 1Z2MA 1ACCA 4C7YA 4XIGS 3CC4A 1ZUD2 4DHJB 5JVH3 3UF8A 4WAFA 2KQ4X 5J39A 3NP8A 1ZXHA 1OTCA 2PW9A 1FEHA 4HDOA 4KMUC 2LKVA 4BOSC 2WFWA 1VLBA 4RM8A 2XWJB 5ELOA 4XXEA 2M1MA 3H7PA 2P5ZX 3Q8CA 2KWCA 2WU2B 5FR6A 1DOYA 5C3EG 3TBIB 2FE8A 1IYFA 4EZKA 1IL2A 3UIOB 1B3AA 4CHTB 1SNDA 5G5GA 3X0WA 1H9MA 1QUQA 4ODGA 1I35A 4LW1A 3FKIG 1WX9A 5IY0A 2Q2UA 4A3BB 4MJSA 2KVZA 3P42A 2A69C 1XT9B 1VQKA 3F2BA 2O2VB 2UWQA 3DEOA 1YN4A 3J81c 5LHY1 2UUBQ 3NS8A 1WXQA 3RZFA 5CHWA 4LFAQ 5M5XH 4A3KG 2N9XA 3K5NA 3AB5A 3IKJA 3PZ7A 4EUTA 1MGSA 3RNUA 1WRIA 4KX6B 1S5DD 1VMCA 5D7GA 3BJUA 3OYYA 2K75A 2JQOA 3TUOA 2O6VD 5AEKB 3EVQA 4R8IA 1PH1A 3J9CA 1F2MA 4YTPB 5EE3A 3CIRB 1EIFA 2KCNA 1YHQA 3EIVA 1IKLA 2F0KA 3VH3B 3NZSA 1LT4D 2DY8A 4FO2A 1SFOH 1IPGA 3QQ8B 3C1EA 1GB1A 3T16A 4XTCS 4EQNA 2JWUA 3C8YA 5MPOA 2VZAA 4WFN3 4MIUA 5D2MB 2RQXA 2R6GA 4M0WA 3EROA 4DV4L 2D11A 4WWPA 4DHZE 1BO0A 2A8VA 2NN6G 2E2JH 1YX6B 3EFXD 2DLBA 1MBYA 4JGHB 3S2HB 1FXAA 2EXDA 1J7BA 2VXWA 2C7HA 5IP7H 1V1QA 5IGEA 3N30A 4DV7L 3WOEA 5FLMG 4DUYQ 3PMFA 3PO3B 1PGBA 2SNSA 3B1LX 3IRBA 3Q2AC 5JPMC 3NVYA 1ASZA 3GDEA 3SU8X 1CT1D 3MZ5A 2BYTA 2GBMA 5C1ZA 1Z7TA 1HZAA 5C44B 3Q3NC 5EE9A 3GTKH 5IA7A 4DAPA 4K2LA 3QWNA 1RKNA 1OXXK 1SNQA 5J18A 2KC1A 4K0KQ 3GZNI 5TR5A 3AECB 2K5WA 3ONAB 1BCPD 1HR0L 1RTNA 1TWCH 3EBEA 1D5XC 1NCVA 4C2MH 5AJ3L 2Z6BA 3AYHB 3H7SA 1SNOA 3CSTA 4DNIA 2RDGA 3GV3A 3HKZE 5EPKA 4LJPB 3MJ5A 5BMHA 2L5TA 1K3BC 3UDGA 3FILA 4FVMA 1AE2A 3AE6B 1BR9A 4PS3A 3MA2B 5J2RA 2FMCA 1RWSA 2JU6X 1NY4A 5CGKA 1SNCA 4YY3L 1SYCA 1VQ4A 4H44C 2AMCB 1I6HB 2MA9B 4FADA 1XWEA 3V60A 2GA4B 5IYDG 2KN4A 2EJFC 4OVZA 3CHBD 2QCPX 1DM0B 3AMZA 4FHJA 4JBKA 3U30A 4KD4A 3T9LA 1JT8A 3L0OA 3S1RB 2HDMA 4JV5Q 1XMQL 4JYAQ 1L0VB 1FCLA 1UWVA 5IKCM 3NS1A 4GNXB 2ZNVB 3G4SA 2C7MB 5GQOA 2QIEB 1CSPA 4GU2A 3A0JA 1I4RA 2LD9A 5M3FG 1VQLA 3AEDB 2K0PA 1NBWA 4GOPC 2BE5C 1U4AA 1EWHA 4IPDA 3BU2A 3HHMA 2DX5B 1QILA 5IT9c 4LLGM 3L17A 4RKLA 4KHZA 4GDLB 3HKZG 3MXNB 1LTID 1CA5A 4C3JG 3FRPB 4ZRZA 1PFBA 1TT2A 2KEEA 3I4NG 2DZIA 1GUAB 3KF8A 4K3CA 5CBEE 5M3MB 1J8CA 3AU5A 1H4RA 1N61A 3PO2H 1JWBD 3CMMB 3K5OA 1VQOA 5DCNA 2AX5A 3VDZA 1JJCB 3DVGY 4X64L 4X62Q 1EF5A 5C3WA 1JMLA 2JA8B 1QOFA 2AUJD 4FJVB 2CR5A 1QVFA 3AFPA 3G48A 3QIAA 4IUVA 4N8X1 1FIQA 3VR8B 5FO8B 3DBRI 2NPTB 3CAMA 3UINB 1J7CA 2MJDA 1H9JA 3I4MG 4DK0A 2JA5G 1KDCA 2K03A 4ICVA 2J52A 3GTOH 1UAPA 3ZYYX 1HNXL 2OWOA 2RDHA 2HCCA 2J4XA 1LTBD 1G2SA 2RHQB 2XN9C 3SR1A 4CKBA 3MP9A 3Q8DA 1A0IA 1U4MA 4B3MQ 1S72A 3W5OA 2Q8RE 2HHHQ 4A3CG 4PZ8A 3HOUH 1FPYA 2H4OA 4ZOHC 3VTUA 2KWDA 4EKUA 3H91A 2KCTA 2Y0SE 4TSSA 4TVAB 2N9KA 1X56A 1PLFA 5LMNQ 4B0EA 1EOTA 2PE6B 3OMCA 1LXDA 4YSYB 2ZVNA 2BH2A 4BY7G 2MBBB 1K8MA 1L1OC 3T8MA 5T1IA 5BYRA 2ICEC 3AEEB 2JX5A 1PH7A 3M62B 2GVAA 1EU3A 4QF4A 2RSNA 3UDXA 1PGAA 4LJZC 4LF6L 1FNUA 1XTDA 2Q5WD 1MD2D 4ARCA 2GBRA 2WDRB 3F8TA 4ACFA 3DVNU 2M4NA 3STBD 1FGBD 5C3EB 4LF5Q 1W6JA 4KDIC 1K8OA 1WM3A 3AXCA 5M9OA 3HOWB 2WP9B 4LFCL 4PG3A 4RMAA 2Q2IA 3K5LA 2M56B 4S0RA 4F88A 2M19A 3QAQA 1YMHE 3FKIB 1I42A 2JT4B 4OELB 4R4OA 3R8BA 3L2PA 4BBSH 1PHJA 5IYCH 1ICWA 1NI2A 2I1JA 5COYA 1TS4A 1N33L 1GJXA 1XLPA 1UE1A 2EVBA 1BCPF 2F0TA 1BBUA 3NWSA 4KI0A 3TS2A 1HZ9A 2KLGA 1B3QA 5AZFA 2BVCA 2VZKD 4AYBE 1PH6A 2VQEL 5ELCA 1YJ1A 2HE7A 3ZJYC 5GAGC 2WX1A 4MGYE 2Y0SG 4A76A 2EMSA 2XRSD 2Y3AA 3GD7A 2IO0B 1A8VA 3HIZA 4IOCA 1IW7C 1R9TB 1CKNB 1KOTA 4HPLB 1C76A 3A7AB 1G291 2OTLA 5CHFA 1X6OA 1CK1A 1E9MA 1TWFH 5HY6A 1SNMA 2EKEC 4DV4Q 2KNBA 1WH3A 3QHTA 4DR2Q 2OT2A 3CU7A 3X23A 1I7HA 3PRZA 5CV9A 5CC4A 5IIFA 4K81A 4IM3A 3QA8A 2KA7A 3RUIB 2DZKA 4A3PA 3J7A5 1R4NI 4JPSA 5IN7A 2A68C 2K5VA 4UHVA 3VVWB 4A3EH 2R92G 3G6JB 1NSNS 5I9OA 3HOVG 5GXGB 4YTMB 4QGUA 2B8GA 3RZDH 4NAWA 4GKKL 2FHTA 1V49A 3TRZA 4FF3A 3PLUA 1YNND 2K9XA 3N6RA 4PS8A 3OSOA 4AYBG 1H9RA 1VQPA 4L63B 1SYGA 5GAHC 1PVOA 4XQJA 1UGJA 2CKZB 1SSOA 1DYQA 3I55A 5KHQA 3ZGZA 4A9AA 2D3AA 3MXPA 4LUVA 3ZXVA 2V3NA 1XNQQ 4C4VA 4MELA 1ROEA 4X66Q 5ELBA 3KOJA 2FAZA 3KUZA 4IC7B 1JOQA 1I4PA 5FLXc 2DNCA 3ZQ4A 1WJNA 2F0MA 5JHBA 2Z9HA 1SJHD 1UH6A 1Y8NB 2H88B 3L16A 3L54A 4X6AH 2L4NA 5G55A 1Q90A 2F0DA 5EPLA 5LXIB 4LWCA 2HIXA 1VZ6A 3X3NA 1Q8IA 1H9SA 4R4CA 4EX5A 3RZOH 4ZHPA 1WJ6A 4M8NA 1XNRQ 1STEA 4CQNA 4DHZB 4HRSA 1VQAA 3H7PB 1F9PA 2F0EA 2K50A 2R3ZA 5DEHA 3V2TA 2L55A 1N62A 4IZ8A 1DGSA 1BVSA 1F52A 4P16A 3WCQA 3NBIA 1QUQB 1I4HA 2NVTB 2LXAA 3PIO3 2E2HB 2D5GA 3S24A 1ML0D 3K8AA 4OZBA 4A3JH 1V1PA 1XTCD 1KDAA 1VR9A 4I6PA 1N36L 2ZZPB 2Q8IB 1SIJA 1U9RA 2W54A 2KOXA 4P73A 1NE3A 4WIPA 2CU3A 2Z6KC 1Z47A 1WY8A 2CU1A 1PH2A 5M3FB 3QIJA 4K5XA 3D32A 1X3EA 1YN3A 2MUYA 4OZAA 4KIKA 1UNSA 2AWTA 3DBLI 1TWHH 4A3GH 5DPTA 4ZUJA 4PMBA 3CC7A 1FD7D 3TP7A 3WALA 1WJUA 3KQ4A 4DPGA 3MHZA 3HKZB 1OXUA 4OIKA 4C3JB 1J8IA 2M2LA 3I4NB 1N6ZA 3AB9A 2NR2A 3BWUD 1X3QA 3QB3A 5KYIA 4DV1L 3V05A 2BOSA 2X38A 5FKAC 2R2QA 1N32Q 2EOTA 2KENA 3MTSA 4RWSC 4MNOA 3AFQA 1HHVA 2NBWB 2KMCA 5D6JB 4KVGB 3V61A 3J7AV 2WXFA 4HJAA 1VQ6A 4JL9A 4BWGB 4RHSA 4F8MA 5C5MA 2L9HA 3HM6X 2RBMA 4A3FG 1BCPC 3PUXA 1C9FA 3NEMA 1DOKA 4GKJL 4R1JA 3HS0C 3NWTA 2J7QB 1EFWA 3VA7A 4DR4L 4M1UB 3IFDA 2JA5B 1LTAD 1QE6A 2ZTDA 5J22A 2UUCL 4CDEC 3V6CB 2O2VA 3ML8A 4LMQD 3GTJB 1O7IA 2LGSA 2N55A 3EN2A 2CW0C 3PT2B 2PTLA 4HK2A 2WX0A 2AWOA 3PUVA 3RLOA 2EY2A 2NVQH 5C4ZA 2UU9L 1Q3LA 1X65A 4JBMA 1EF1A 4G50A 3QJZA 3A8IE 2WXRA 3P1MA 4BY7B 4LF8Q 4MGKE 4KKTA 1SAPA 3B2FA 2UXDL 3Q8EA 3KBGA 4XE0A 4P6VF 4PZ6A 2BYFA 4LTUA 4IALA 4OVVA 1ZYRD 4DAMA 2N9EB 1LTGD 1FRDA 1K0RA 3I4OA 1N33Q 3BS1A 4DK6C 1L4ZB 2ZXOA 5JJIA 2MP1A 2Z8LA 5AFWA
chains in the Genus database with same CATH topology
4H13C 3S15B 3QOJA 1VF7A 3GTGB 1JWMD 2BS4B 4ITKA 2HDLA 4IUQA 1GUWA 3A56A 3KLSX 4NAMA 2Y0SB 2WLBA 1K50A 1CZWA 5K5PA 3I73A 2O2LD 2GRIA 2ZXRA 1BBXC 3D4WA 2AQ1B 4NDXA 1VJKA 2PZWA 1EU4A 1VMPA 2BTEA 1F2YA 4L23A 2E76C 2JYOA 3S2DB 4HEDA 4KJOA 3K57A 1F9RA 3NTHA 3GQBA 2A6EC 2R92B 1QF6A 3HOVB 1ZOYB 2LEKA 1BDOA 4KKJA 1FCCC 4KN4C 1LT3D 4AYBB 3H09A 1JE4A 1LACA 1MSHA 1FXIA 2Y5CA 3AE9B 1TKGA 1NR4A 1PYWD 3NTIA 5HFYA 1VCIA 3BVMA 1A15A 4RH6A 4U673 3P4QB 1EQTA 1KRHA 2EELA 5HG2A 3MHBA 3ND8A 3N9YC 4R9WA 1HEZE 3SDZA 5D14A 1O7LA 3M4YA 4CJ1B 1C8CA 1V1OA 2NTSA 3RMHA 3A55A 4DU9A 1MSGA 4XT1B 3L3OC 4K5VA 2N7JA 1PTOD 1QNUA 1ZXTA 2M9VA 1NI3A 1TZOA 3DWQA 4E6IA 4X3SA 2LHEA 1A70A 1SXTA 3D6WA 3T51B 2LMCA 1SYEA 4O1NA 3TZUA 1DOXA 4RGOS 2F0OA 1FRRA 2EYMA 3GS2A 4FXKC 2KEDA 3NHHA 1B9MA 1ZP0B 1EY8A 1OQRA 5FR3A 2INNE 3HUIA 2NVXB 1SMYD 4OL7A 1TJEA 2AUKA 2HTME 2B2WC 2F0FA 4XDXA 1PDQA 1YNNC 2N9LA 5C3XA 1QOHA 2Y5PA 2NMQA 3DMUA 1EY5A 3VYRA 5HURA 1SYBA 1TVXA 1D2BA 1EIGA 5A2QE 4C1NK 5KIXA 1E0BA 1EWCA 1E10A 4EGVA 4RGMA 4QCLA 3R3OA 4IURA 3D3RA 4A3FB 4L1BA 2KACA 1A2TA 4NAWB 5LNK1 3C2PA 5D65A 1FD6A 4ZLTF 4WRDA 2JSVX 2B2YA 2IJ0A 1VZ7A 2I38A 2EYOA 1KDBA 3MEHA 2JEBI 2E6XA 2BDOA 3MXUA 5HI1A 4K8IA 2K32A 1AFPA 1ZE3D 1G6ZA 1FNVA 2EE1A 1ILPA 5A2QL 1PGXA 4ID6A 1H9SB 1OO9B 1C79A 3GTLB 3TEWA 2R61A 4XYOA 3H94A 5CBAE 1JWAD 2F3WA 4AQ7A 1KH0A 3BK2A 1IKMA 4UDUC 1V1PB 2WXKA 4HKZE 5I9PA 3E56A 1ZKOA 4IUPA 3NQTA 1JR0D 3CRLC 3A8JE 1ESFA 2B8FA 5JEAH 1O78A 1PTOF 3RLFA 3PV0A 1T6BX 3IT4B 1J9OA 1KLUD 2V3PA 4V0BA 5M5XB 3NPPA 4F87A 1Q12A 2DNEA 3LWEA 3TEXA 3SK6A 1CHQD 3D6CA 5ELEA 3BIID 5E1FA 1TU2B 5DM63 2JSOA 2RKSA 3SHLA 2KMMA 5EE0A 3DWAA 1SFOB 3FC4A 1D5MC 2K1BA 2IT1A 2D5DA 1EZ8A 5C4HA 1YNJC 4DGZA 1RYJA 3EA6A 2E2JB 4KTAA 2ZT9C 3NSWA 1U4RA 3JAME 5ELDA 5E4XA 5C0XH 2K5PA 3SFDB 3X3MA 1Y56A 4LK1C 4YSXB 2B2WA 2HQEA 4RFBA 2K3UA 4M8AA 2K22A 1LTTD 3GTKB 3TMEA 1WTVA 1RFKA 4IUTA 3DEPA 5EBCA 4ARIA 4ME5A 2O5IC 3E9SA 1TWCB 3P1HA 4C2MB 2MHVA 5BYQA 1PRTB 3W1SA 4USAA 2KQ3A 2F1MA 3B9JA 4PNYA 3E5SA 4GZYC 3RFZB 3BDOA 2B2VC 3T3NA 3D4DA 3JAML 4CJ0B 2E2DC 2M00A 3BZDB 2J42A 1Y8OB 2HCIA 2IX3A 3PO0A 4JWSC 3TZDA 2QEJC 1C77A 2WP8J 4C80A 4JE3B 1HQMC 3NRZA 5E3FA 2K5QA 3NUHB 2C5CA 1D6EC 1BNZA 1STNA 3FDTA 2I2YA 3AU7A 3NK9A 1TS3A 1BUIC 2PW5A 2B2UA 3F2UA 4MM3B 4ZKBB 2DN8A 5IODA 2PCFB 1JOKA 1C78A 5F2DA 1RD9D 4TQUS 2K7VA 2WXNA 4US9A 2AWNA 5LL6S 3DM1A 2KAJA 3UI2A 2IW3A 3PO2B 1XLNA 4P2CB 4OHJA 1F2RC 1NENB 2W82A 4FXDA 1K53A 4YSZB 4ZQ3A 4US8A 5CV6A 3RUZA 1AEXA 2K28A 2Z4IA 1FMAD 1A3TA 3K0YA 1RJTA 3W2DA 4KHVA 3GTOB 4YT0B 3PUYA 3J81E 2QKIC 3NE5B 3KWVA 2X69A 1YJIA 4G4KA 1F2LA 1HUMA 3HOUB 1SMYC 5C4JB 2WDQB 2K05A 1AYFA 4Z9CB 2K33A 2QILA 2LMCB 2I46A 5EQ0A 2NWGA 2LY7A 1YQ3B 3ERQA 1SE2A 2PYKA 4RCNA 4HEA1 1KTKA 4HSVA 1IYVA 3QO2A 4BBSB 3DWMA 2MGSA 4G7HC 3J81L 1CHPD 2Z1CA 1QOAA 3NVWA 2SDFA 1F0ZA 1GUTA 4RAUC 1OQQA 4NKLA 3P4RB 3TSSA 5EGTA 3N52A 1Z6HA 3K59A 4J3OD 1TWFB 1PMRA 4DA2A 5E6JA 1EYDA 4KGTA 3OWEB 2WIIB 2QDBA 4L2YA 2B2TC 3J7AF 2F0UA 4ZAIA 3HG9A 4BA1I 3M7GA 2EPBA 2EZVA 4A3KB 2E74C 5IGBA 4A3EB 1CQVA 2XIWA 3MAQA 3RZDB 4ZYSA 2Z4HA 5KNBA 1RCVD 1OFFA 2TSSA 1E2WA 1AWDA 1HQRD 1JW9D 2NZ1D 5J1ZA 1G8ZD 5T1GA 1II3A 2K6AA 2EY6A 3LWUA 2Q8TA 3AM9A 1QB5D 2F3VA 2KDMA 5H8YE 4ABNA 3KK7A 2NTTA 3G7LA 2EJGC 2L11A 4PQXA 5IT9E 2IGHA 3RZOB 5BN4A 5KYLA 4HKQA 4XWWA 1IYUA 1TY0A 4TKOB 2L52A 3CRKC 5JXVA 5A35A 1X32A 4B9XA 3S9WA 1EYCA 4EQOA 3U2SC 2BS3B 3TP6A 1N5WA 3ZJTA 4A3JB 3VR9B 1I4XA 2PVGC 4KKSA 3AH7A 3SK4A 2EXZA 1WVLA 1L0XB 1FNWA 1TQOA 5IGGA 2O4XA 2PQEA 3VA5A 4OZCA 4ILWA 1TWHB 5KEEA 4A3GB 4CGYB 5D3IB 2A6HD 4V190 5IT9L 1EY0A 1XCQL 1TKEA 4DN4M 3HRDD 4H0LC 1HPCA 1SBBB 1QCBD 4GDKB 5G5HA 3AEFB 4DXFA 4DK1A 1JB3A 4KN7C 4WWMA 1LTRD 1ESRA 1JORA 3SXHA 5JJZA 2XNAC 3U9SA 1PFMA 1KF6B 1GUGA 1PFDA 1E6EB 1QJOA 3SVMA 1CTMA 3C46A 1C4PA 5CV7A 4HCSA 2WACA 3NVVA 4HN7A 4BS9A 3KLSA 3VR3A 1BXTA 3OMGA 1IL8A 1MPEA 4QIWB 4LK0M 1IHZA 1KLGD 3OWFA 3Q24A 5K36H 1QOBA 2NVQB 3L9AX 1DJRD 4HSPA 4RF1A 4H7BA 3E6ZX 1Y8PB 1NVID 2OF1A 3I4MB 4RHRA 1I4QA 1S5FD 2V4DA 3PUZA 4K14A 1E7PB 2V0GA 1RTOA 4N6EB 1ZEQX 2D2CC 3Q23A 1Q1EA 1TS2A 1UWMA 3I4LA 5I2XA 4OIJA 4DQOC 4R8NA 1TKYA 4KK7A 3TN2A 1WTWA 4RF0A 1VRAB 2BA1A 4KKIA 4N9PA 2WXLA 2HUGA 3HP3A 2YU9B 1VZ8A 1AZPA 5JEAG 5M5WB 1STGA 4BY1B 5FLXE 1R4QB 1LT5D 3U9OA 4IQZA 5IOCA 2WXQA 2DYMA 3NZ3A 1KABA 2EYPA 2ACZB 1SSNA 3SFEB 4IFDH 4NJCA 2JXTA 2NBFA 4HTHA 3SK5A 1EIHA 3KUPA 1EYAA 3VQIA 5BMIA 2JQRB 4C1NI 2CJNA 3UI3A 2KCCA 4FF2A 2E2IB 1XCTL 2WXIA 4XWTA 1ZDVA 1HA5A 3C1FA 4HMIA 2KVMA 1K51A 3RD4A 1XLOA 2VB3X 4JBWA 3D8GA 4WJWA 3SEBA 5FLXL 2WNMA 1WWTA 2ZW0A 3R2TA 1V8QA 3M85A 1EZ6A 3MFGA 5C0XG 5EE9A 4QUCA 3ETRA 1WGKA 1F9QA 3LXFA 3Q8FA 1UWXA 2JZPA 2D62A 1K52A 1STBA 3R2IA 2R7ZB 3DHQA 5NUCA 2FUG1 2MH7A 4DF7A 5G3LD 1QOGA 2A5HA 1G91A 2RSOA 4QMGA 3S1MB 2BS2B 2WKCA 4C7ZA 3VR6A 2DY7A 3T3OA 3OIQA 1JWSD 1KFYB 4MHEA 4KD3A 4DAYA 1M4VA 4N58A 4A93B 2JA7B 2NB0A 2H1EA 2E3TA 1VDZA 4N9TA 3AE3B 1SJED 2JA6B 3BG3A 1YN5A 4IOIE 1AW7A 2WKDA 1DGJA 1R7SA 2GB1A 4PV1C 3GTMB 1LTSD 3ZJUA 1CZPA 3W9CB 3HEJA 4GLSC 3BVZA 1GUSA 3I8ZA 2WXJA 1XF5L 3IFTA 4QB4A 3J80E 2BE5D 1WD0A 1RM6C 1H9KA 2OEOA 1EY4A 2PZTA 3A7LA 1HXYD 1I3QB 1TR5A 3T13A 2DYOA 2JP1A 1K83B 2H89B 4WURA 1WCMB 3O13A 2LJIA 1WTXA 1QG7A 4G57A 4KY6A 1EM7A 3U4EG 2QSDA 3DWPA 2YEPB 4XYQA 3FVQA 3VYUA 2B39A 2N88A 5TSSA 1STHA 1CFMA 1R4PB 3MVVA 1TWGB 5C5LA 2A6HC 4ZHOA 3J80L 4WH4A 1XXGA 4MN3A 1BMLC 2WQYB 2FINB 2NUCA 2ZXPA 4A3IB 4PMCA 1GB4A 1JOOA 5EPJA 1C4AA 3K5MA 2FBWB 5CORA 4C3IG 3S17B 2KJXA 4YXDB 4FXGC 4X3UA 3I72A 1SB3C 3WOFA 3PUWA 1QKZA 1YJJA 2MJ3A 2ON8A 4A90A 1TWAB 2JXMB 4FXCA 2K01A 2IPKD 5G3LF 3NTKA 2WDVB 3MC0B 1PTOH 4K8JA 5JEAJ 1MI2A 1PFNA 3P7JA 2JEAI 1XO3A 1PZJD 1TKWB 4FP5D 5CR3A 5I6YA 1S4ZA 3K58A 3VRAB 3NBHA 1B9RA 1LT6D 1EY7A 3AE5B 3I70A 2C9OA 1HCZA 4OO1H 4REZA 4FNFA 2SNMA 2WXMA 4Q5VA 4IFDI 3P63A 1F77A 3AV8A 5FO9B 4X3TA 3CWIA 5HHDG 1N60A 2WXGA 3NUCA 1ET9A 3C3LA 2QMTA 4KGSA 1Y1VB 1EWYC 1SYFA 2ID0A 1NR2A 1T5XD 3H6MA 1DONA 1GHKA 2RPVA 1HZ6A 5T8IA 1PRTD 5EBDA 4U68A 3Q8AA 3AE2B 4K5WA 1WTRA 1HFGA 1B1ZA 2NYZD 5FK9C 1PZID 3M4OB 5C0XJ 2WU5B 1Q10A 1B9NA 1ZYRC 1AN8A 4CJ2C 1HTPA 1CZGA 2G9DA 1GAQB 4RGNA 2WXPA 1DCZA 2WAQB 4X3KA 3GTPB 2HDEA 1OXSC 5BN5A 4I65A 4DNRB 1PZKD 1DOIA 2SOBA 3WDNA 1V43A 3BDCA 1NYRA 5LL6X 2WXOA 3P75A 2F4IA 3HOYB 2RMMA 4KJNA 4LAAA 4WQMA 1LO5D 3ABVB 2CVRA 4D2KA 1EEID 1B4OA 2FFKB 4BA2I 4TQ1A 3GP7A 1BQQT 1XX8A 5I4DA 1ENCA 2PKOA 3ND9A 1ET6A 1S5BD 1S5CD 4NMZA 4HJGE 2EJMA 2F0QA 1IGCA 1WTQA 2BW2A 1HFNA 1D5ZC 3DWGC 2QJLA 1I50B 4Q2JA 3QJYA 2PMVA 3BVGA 3T4AC 4Q0FA 3S16B 3BYYB 4L8JA 1B44D 2EKIA 1D1IA 3BYTB 1JC7A 2IX1A 3VR4A 3GO5A 4C56C 2VB2X 5DAUA 1FFUA 2F0GA 2F0IA 4HCEA 3I3CA 1MVKA 2X6GA 5K36G 2J53A 1ENFA 1SF0A 4KV6A 1LV9A 3VR2A 3MFYA 1PTOC 1WTOA 1L6UA 1KAAA 2X6LA 3FAHA 4K2KA 3MXGA 4C3HG 2AQ3B 2PMZB 2RA4A 4YIJA 2CW0D 1QLBB 1JICA 4A3MB 1EEFD 3D31A 1QT9A 1GOZA 1PRTF 4C3IB 2ONQA 1PXUA 2KOLA 4TRDA 4HMJA 4OGQC 4R3DA 1L6VA 3L7ZC 2LHDA 2WXHA 1O7ZA 4TQ0A 2RVLA 4QUFA 3AE1B 4MT5A 2L1BA 3I90A 4EE2A 4J6HA 4K6LA 3SR6A 2M0AA 1V97A 1BCPB 4XDDA 1MI0A 4FF4A 3LYYA 4S3SA 1VDVA 2NVYB 3V3XA 4I7ZC 3OIPA 2FJ2A 1FFVA 3IAYA 5EKIA 1OXTA 4IFDG 1F2RI 2LFIA 3P4PB 3HOZB 3Q6SA 1RDPD 1QNKA 4KY7A 5H92C 2PIAA 3Q8BA 1TIID 1JRPA 4OO1I 3IAS1 5JPNC 1SNPA 1SDFA 1L5PA 1EFID 3I57A 2N0SB 2B63B 2A6ED 4J1MA 1UEAB 3V96A 3U7ZA 1NUCA 3RPFC 1GXDC 4A6QA 1NYQA 1ONLA 1WTPA 4YTNB 2BT6A 2G1EA 2TMPA 2L12A 5D3DA 1STAA 2IX0A 1X3PA 2EYFA 5C2TB 1TY2A 2B2VA 1AZQA 5CV5A 3HRZC 1GHJA 2BBCA 2BB6A 1J7AA 4RA8A 4KKUA 4HAEA 2W3SA 5DNFA 1ZDXA 4ZKCB 1BUVT 3K6OA 3H8HA 3IL8A 3IAM1 2J0TD 2G9HD 3K7AB 4RCOA 1U4LA 2F0LA 5C0XI 3TP8A 1CI3M 1KNEA 1STYA 1YNTE 1B2TA 3EUB2 1RHPA 2IGGA 5IGDA 2K04A 4JWUC 3AE4B 1IBXB 2F0SA 2MJEA 2FMMA 1E2VA 2WV6D 1CA6A 1PRTC 2E75C 2CHBD 1CQFA 4RGTA 5EE1A 4G7ZC 1C4CA 3I9V1 3AEAB 2IDYA 5JVG3 1FM0D 1U4PA 3IT6B 4KGRA 5I2YA 3HOXB 4KY5A 4MACA 4IUUA 4IDIA 2VZKB 2IWHA 1G2TA 4HROA 3KLRA 2PVOD 1NEKB 2W3RA 3OOCA 2XSCA 4ZRQA 1CM9A 3W5VB 2NN6H 2R93B 2XWBB 1BOSA 4TMAB 1T3QA 5KGUA 4H2AA 4C3HB 4ULLA 2F03A 1IGDA 1VF5C 2JYTA 1T5EA 4CBVA 2JE6I 3M3YB 3HVZA 1A3VA 2DWQA 4XDCA 3OW7A 1DOMA 1O7YA 2MEKA 4JX1C 2EYLA 1I4GA 2B76B 1LLRD 2VUMB 3HVDA 1RODA 3A8KE 3S14B 2YYZA 5CV4A 3AEBB 1RF2D 3D4RA 3FPPA 3R93A 1XEEA 1JQYD 3BDLA 5KNCA 2A73B 1F2ZA 3GV6A 1Q1BA 5EKKA 2KHSA 1XYIA 1HRJA 1PDXA 5HGTA 1B50A 1TS5A 2LS01 1XLQA 2B2TA 1C4QA 3T53B 1S5ED 2INPE 3P20A 4IUNA 3TDQA 1JQ4A 3CKIB 1YQ4B 2LUMA 5ISRA 1EY6A 2SEBD 4IFDJ 4OO1G 3OHXC 3KBXA 1NAPA 4ZUIA 1MHHE 2O5JC 2EY5A 3DXJC 4G7OC 1GUNA 4WORA 2PNRC 3URYA 2L83A 2W55A 1QQRA 3U52E 3KWLA 1FR3A 2A74C 5CV8A 3H0GB 3AMUA 1HZ5A 1SE3A 5C3JB 2A69D 2KUMA 3FILB 1MHXA 1YNJD 5EKLA 5CMDA 1ENAA 4BBRB 4FF1A 1N63A 2B2YC 3NQIA 2I07B 5BN3A 5IGFA 3GB1A 5DM73 1JROA 2GI9A 2WS3B 1O80A 5AUKA 1HTLD 1DOLA 2VNUD 1L0YB 3S1NB 2LGIA 1SYDA 2F0NA 5E4WC 2EY1A 2J7ZA 1JWUD 1SEBD 3NVZA 2L0CA 3AE8B 3PZ8A 3TEYA 4IN3A 1Y69U 1GPXA 2MJ8A 1FO4A 3MWYW 2PO4A 4CKCA 2PW7A 3GTQB 2ZW1A 1D4BA 4OW0A 3J7YW 1UUPA 2XVSA 3Q0AA 4K6DA 3VR5A 2F0HA 3EGRA 5FO7B 1F9SA 1N5XA 4O42A 4J8QA 2DBYA 2OHFA 2QF7A 1KNAA 2MPMA 4EVOA 1Y1WB 1E0ZA 1EL0A 3NXWA 5EJWA 2OEDA 2BA0A 4UAIA 2ENBA 1PUTA 3TP5A 5C4XB 2K5DA 1SE4A 3EJIA 1ILQA 2PZUA 2EDGA 1CJEA 1V8CA 1B53A 3QG1A 4N59A 4MH8A 5FOBB 1A3UA 3Q69A 2F0WA 5ELFA 1HA6A 4A55A 3L4PA 3I91A 1ZXIA 1JALA 3MXNA 1M8AA 4B0MA 3M7NA 2L32A 2JYEA 2IL8A 4NZLB 1WD1A 4RKBA 1D1KA 5JAVA 2NN6I 4B08A 4AS1A 4DAVA 1WYGA 4NP5A 3B2GA 3Q22A 2CQAA 1P7EA 3OPOA 3ZJVA 1BF4A 3DUZA 2SAKA 5M5YB 5KNDA 3VYTA 1I6VC 4Y7NB 5C6AA 2PLPA 3BK1A 1TYGB 2BDNA 3AEGB 1DD2A 1L4DB 2BB5A 4CKEA 2WB1B 3AE7B 1AP0A 3S1QB 5I6WA 4HR7B 2CJOA 3HGBA 3VRBB 2F0PA 1E2ZA 3CQZB 1FYCA 4DXGA 1PTOB 4A3DB 2ICIA 2LFNA 2V4IB 2OXPA 1WSPA 1A2UA 4ZK9B 2D9UA 2F0JA 4A8XC 1HUNA 3HZXA 5IGCA 3PIP3 4ZRPA 1OXVA 3SE0A 1IUEA 4EQPA 1QWYA 5AUIA 5JOBA 3P4SB 3T56B 1LABA 2RDFA 4YWGG 1A6XA 4PT5A 4F7XA 4XQNA 4FYDA 2B2UC 2EYHA 2EYJA 4IKGA 3SK8A 2L1AA 3TEZA 4XQQA 1EQVA 1DZ1A 1ZPSA 3W5UB 1IBXA 3LX0A 3VYSA 1JCKB 4NW2A 4B9WA 4DFAA 3IXSA 3EQLC 3W3AA 3LB8C 3FPUB 4JK1C 4RNAA 3AN1A 1IW7D 2WINB 2YEPF 2KECA 4XT3B 1GUOA 1EY9A 3FEWX 2BCOA 2F0VA 5KRUA 3H3VC 4PMWA 5BYSA 3QOLA 3E0JA 2IGDA 1P7FA 4DNTB 2PPBC 3LNNA 5CYUA 1DXMA 1C48A 4L6TB 2A68D 3A54A 3ITPA 1W6KA 2AQ2B 3FMCA 5BMGA 2XRQD 1ACCA 4C7YA 4XIGS 1ZUD2 5JVH3 4WAFA 2KQ4X 5J39A 3NP8A 1ZXHA 2PW9A 1FEHA 4KMUC 2LKVA 1VLBA 2XWJB 3Q8CA 4XXEA 1DOYA 2WU2B 3TBIB 2FE8A 1B3AA 4CHTB 1SNDA 5G5GA 1H9MA 4ODGA 4A3BB 3P42A 2A69C 3DEOA 1YN4A 5LHY1 1WXQA 3AB5A 3K5NA 3IKJA 3PZ7A 1MGSA 4KX6B 1WRIA 1S5DD 1VMCA 5D7GA 3TUOA 3EVQA 4R8IA 3J9CA 1F2MA 4YTPB 5EE3A 3CIRB 2KCNA 1IKLA 2F0KA 1LT4D 2DY8A 4FO2A 1GB1A 3C1EA 3T16A 4XTCS 4EQNA 2JWUA 3C8YA 5MPOA 4WFN3 4MIUA 2RQXA 2R6GA 4M0WA 3EROA 1BO0A 2NN6G 3EFXD 2DLBA 1MBYA 3S2HB 1FXAA 1J7BA 2VXWA 5IGEA 3WOEA 3PMFA 3PO3B 1PGBA 2SNSA 5JPMC 3NVYA 1CT1D 3MZ5A 2BYTA 1Z7TA 5C44B 4DAPA 4K2LA 3QWNA 1RKNA 1OXXK 1SNQA 3AECB 2K5WA 3ONAB 1BCPD 1RTNA 1D5XC 1NCVA 1SNOA 2RDGA 3GV3A 5EPKA 3MJ5A 5BMHA 2L5TA 3FILA 4FVMA 3AE6B 1BR9A 3MA2B 2FMCA 1RWSA 2JU6X 5CGKA 1SNCA 1SYCA 1I6HB 4H44C 1XWEA 2GA4B 2KN4A 2EJFC 4OVZA 3CHBD 2QCPX 1DM0B 3AMZA 4KD4A 3S1RB 2HDMA 1FCLA 1L0VB 3NS1A 2QIEB 1I4RA 3AEDB 2K0PA 2BE5C 1EWHA 1QILA 4LLGM 4RKLA 4KHZA 4GDLB 1LTID 1CA5A 4C3JG 3FRPB 4ZRZA 1PFBA 1TT2A 2KEEA 3KF8A 5CBEE 5M3MB 1N61A 1JWBD 3K5OA 2AX5A 5C3WA 1JMLA 2JA8B 1QOFA 2AUJD 3VR8B 3QIAA 4IUVA 1FIQA 5FO8B 1J7CA 2MJDA 1H9JA 4DK0A 1KDCA 2K03A 2J52A 1UAPA 3ZYYX 2RDHA 2HCCA 2J4XA 1LTBD 1G2SA 2XN9C 3SR1A 4CKBA 3MP9A 1U4MA 2Q8RE 2H4OA 4ZOHC 2KWDA 3H91A 4TSSA 2N9KA 1PLFA 4B0EA 1EOTA 3OMCA 4YSYB 1K8MA 5T1IA 5BYRA 2ICEC 3AEEB 2JX5A 1EU3A 4QF4A 2RSNA 1PGAA 3MHZA 4LJZC 1FNUA 2Q5WD 1MD2D 4ARCA 2WDRB 1FGBD 5C3EB 1W6JA 1K8OA 5M9OA 3HOWB 2WP9B 3K5LA 2M56B 4F88A 2M19A 1YMHE 3FKIB 3R8BA 1ICWA 5COYA 1TS4A 1XLPA 1GJXA 2EVBA 1BCPF 2F0TA 3NWSA 4KI0A 2VZKD 5ELCA 2XRSD 2Y3AA 3GD7A 1IW7C 1R9TB 1C76A 3A7AB 1G291 1E9MA 1CK1A 1SNMA 2OT2A 3CU7A 1I7HA 5CV9A 5CC4A 5IIFA 2KA7A 4JPSA 2A68C 3G6JB 1NSNS 5I9OA 5GXGB 4YTMB 2B8GA 2FHTA 4FF3A 1YNND 2K9XA 3N6RA 3OSOA 1H9RA 4L63B 1SYGA 1UGJA 4XQJA 1SSOA 1DYQA 3ZGZA 4A9AA 3MXPA 2V3NA 1ROEA 5ELBA 1JOQA 1I4PA 2DNCA 3ZQ4A 2F0MA 1SJHD 2H88B 1Y8NB 2L4NA 1Q90A 2F0DA 5EPLA 1VZ6A 3X3NA 1Q8IA 1H9SA 4ZHPA 1STEA 4CQNA 4HRSA 1F9PA 2F0EA 2R3ZA 5DEHA 3V2TA 2L55A 1N62A 4IZ8A 4P16A 3WCQA 3NBIA 1I4HA 2NVTB 3PIO3 2E2HB 2D5GA 4OZBA 1ML0D 1V1PA 1XTCD 1KDAA 1VR9A 2Q8IB 1SIJA 1U9RA 2W54A 4WIPA 2CU3A 1Z47A 5M3FB 4K5XA 1YN3A 2MUYA 4OZAA 1UNSA 4ZUJA 4PMBA 1FD7D 3TP7A 3KQ4A 3HKZB 1OXUA 4OIKA 4C3JB 1J8IA 2M2LA 3I4NB 3BWUD<