4OHJA

Crystal structure of toxic shock syndrome toxin-1 (tsst-1) from staphylococcus aureus
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
194
structure length
194
Chain Sequence
b'TNDNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYGPKFDKKQLAISTLDFEIRHQLTQIHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEING'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toxic shock syndrome toxin-1
publication title Crystal structure of toxic shock syndrome toxin-1 (TSST-1) from Staphylococcus aureus
rcsb
source organism Staphylococcus aureus
molecule tags Toxin
total genus 58
structure length 194
sequence length 194
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4ohjA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4ohjA01
2XN9C 4ZYSA 1HA5A 1D5ZC 1JCKB 1S5FD 1PTOH 1SBBB 3DWQA 1RF2D 1XXGA 4OHJA 4L6TB 4BWGB 1CT1D 1LTRD 3W2DA 4RGMA 3KLSX 1TS5A 1FGBD 1JR0D 4RHSA 1CQVA 3V05A 1TS2A 3SEBA 1LTAD 5D3DA 4K6LA 2R61A 4RCOA 1FNVA 1PZJD 1SE3A 1CK1A 4C56C 1I4RA 2AQ1B 3O13A 5ELEA 1LT6D 1D5XC 1TS4A 1UUPA 1YN5A 1EFID 2G9HD 4RFBA 3EA6A 1PZKD 1SJED 3BYYB 1KTKA 1S5ED 1PTOD 1S5BD 2XNAC 1S5CD 1LT5D 3R2IA 2NTTA 1XTCD 1EU3A 1EEFD 1V1PB 4RHRA 1TY0A 2IPKD 3OWEB 1KLUD 1PTOF 1KLGD 1EU4A 1PZID 1I4GA 1GOZA 1HXYD 1JWMD 1QILA 1L0YB 5ELFA 1FD7D 2QEJC 4DXGA 4RGNA 1D5MC 1F77A 2IJ0A 3TSSA 3DWPA 2WV6D 3MC0B 1LTGD 1PRTD 1HTLD 2AQ2B 1YN4A 3CHBD 1V1PA 1V1OA 1PYWD 4RGOS 1ET6A 2J4XA 1UNSA 5FKAC 1AW7A 1RD9D 1PTOB 1LTBD 5ELDA 1YN3A 4L63B 1CHQD 1PRTF 1MD2D 1SXTA 1ENFA 1ESFA 3BYTB 3BVZA 4RGTA 1BXTA 1PTOC 5D3IB 1SE4A 1LT3D 4RH6A 2AQ3B 1SEBD 2NTSA 1LLRD 1LTID 1BCPD 5ELCA 1I4QA 3DWAA 1B1ZA 1SJHD 2ICIA 1STEA 1TY2A 4DXFA 3BVMA 3MFGA 1JWSD 5TSSA 1FNUA 1BCPF 5ELBA 1M4VA 4Z9CB 1PRTB 4TSSA 1RDPD 1SE2A 1AN8A 3URYA 1L0XB 2RDHA 2XRSD 1G8ZD 1PRTC 3BVGA 3R2TA 1D6EC 1JWUD 2XRQD 3R8BA 1I4XA 1DJRD 5FK9C 1JQYD 3BZDB 2CHBD 4NZLB 1LO5D 1BCPB 2SEBD 4O1NA 1S5DD 1DYQA 1T5XD 3GP7A 1I4HA 1I4PA 5I4DA 1B44D 2O2LD 1FNWA 1BCPC 1LTSD 1EWCA 1CHPD 1RCVD 1EEID 4UDUC 1HQRD 1LTTD 2TSSA 1ET9A 2QILA 1LT4D 2RDGA 2Z8LA 3EFXD 1TS3A
chains in the Genus database with same CATH superfamily
2D07B 4ZYSA 3CPFA 3LGJA 3QHTA 1HA5A 3RZOH 4ICVA 1ENAA 4RA8A 4BY7G 3FMCA 4DR6L 1GUAB 1CT1D 3KLSX 2B63G 4JPBW 3CCMA 2D3CA 2V4DA 2QIEB 3H3VH 4N6EB 4LFAQ 3NBHB 3HP3A 3P20A 1Q1EA 3K81C 5KIXA 2ZNVB 4QJFA 2XGTA 1WRIA 4B9XA 5KHOA 2WDVB 1AARA 1B70B 3E3XA 1I50H 1JE5A 4M0WB 1JROA 5BYSA 3I3CA 1YZ6A 2KA7A 4P71A 4XE0A 2JWUA 5F2DA 4K7UA 1QNUA 3D4RA 4OX9L 2V1YA 2W55A 2CJNA 4UPAA 1X3FA 4OXPA 3TDQA 1WF9A 1EEFD 4JI4L 5J2RA 2D9UA 1EOTA 3RNEC 1WI0A 4A3JG 1EM7A 3NELA 1IBLL 2FFKB 1BVSA 5CV8A 4BBRB 5CV5A 2WX1A 3RUIB 1FCLA 3K0XA 1WJUA 3VUWA 4IOIE 3PUZA 3L9AX 1L0YB 4M8AA 2XK5A 1ISNA 1X56A 3FKIH 5JXVA 3I91A 1WE7A 2IJ0A 1UELA 4IKGA 1WOCA 3DWPA 4CYEA 1J7BA 1B9NA 2BS3B 3CHBD 1GUTA 4YCWA 2PW9A 3Q2AC 5JH5C 2E5LQ 1BBXC 1NNXA 2A68D 2RCFA 5H8YE 3ZJTA 4EVOA 2FCQA 1U4RA 2K03A 4XT1B 3ONSA 1K3BC 1LTBD 1WGYA 1GUOA 2K75A 1WTRA 3D6CA 3A4RA 3RI7C 4RGTA 4JK1C 4F8MA 2EDGA 3VYSA 1GC6A 1HZ6A 1XEEA 3B2FA 2B8GA 4MT5A 2NTSA 3DBHI 2KQ4X 2NZOA 4O0AA 3UI2A 4FF2A 3IG3A 3UDXA 4EQ5A 3N20C 4JX1C 4TV3A 2N9KA 1STEA 2JA8H 2ZCBA 3KF6A 3AE1B 4WFN3 1VQOA 2F4VQ 3PPAA 5TSSA 1VMPA 3L17A 3KFUA 3DBHB 3F2BA 5EE1A 1K83B 3KUCB 2DGYA 1CUKA 1YJ9A 4AH6A 4ZRJA 5AZGA 3WIMA 1MHHE 3UE1A 5D14A 3KUPA 1PFNA 3M62B 2RKSA 3BVGA 1RLFA 1MIUA 1VQ8A 1QKZA 2QW7A 1I3QH 4DAYA 3W9CB 1TKWB 2WINB 1L0WA 2E2IB 2GBMA 1JQYD 1EY9A 1GUGA 2N88A 2L11A 4W9IA 1OQYA 2CHZA 4LJZC 3JSVA 2LGYA 2KBNA 4HEDA 4XYCA 1F9SA 1Q90A 1GG3A 1WFQA 1F2LA 3E56A 5E6OA 3U30A 4ZOHC 1F1HA 3MC8A 4ABNA 1WMHA 4PS8A 1VLBA 4B9WA 2TSSA 2UUBL 1VQHA 4LF6Q 2L7RA 3L16A 2MHVA 5IODA 4B0EA 4FJZA 3UE0A 1ML0D 3DEOA 4CDFC 3PREA 1A63A 1PTOH 1G291 1SBBB 2F0OA 2IHFA 1RF2D 3TMEA 3TZUA 4CKCA 2FCNA 4DR5Q 4JWUC 1V8CA 1UWXA 4DR2L 3B08A 2E2HH 5IKCM 1PXUA 1QVCA 4JI1Q 1C78A 3RNAC 1JQ4A 1Z47A 2C9OA 3STBC 4LF8Q 4NNJB 1TXYA 2LZ6A 2N3SA 2L15A 4RMAA 1CKMA 3AV8A 3OJ3A 2QSDA 5D65A 3F1ZA 4RAUC 4A3FB 4JI7L 4AS1A 1K8AC 1D5XC 3CW2C 1U0LA 4BXXH 2KYWA 2WNMA 2RPVA 2RHSB 3T56B 4C3IG 2HUGA 2MJDA 1VZ6A 1HNXL 3IAYA 5ELNA 3S2HH 1E90A 4JBWA 1WYWB 4BKSA 4L1BA 2JUOA 3HOUH 2UXBQ 2WXLA 5I2XA 2MBOA 1JJGA 3NZSA 5LNK1 3GOEA 1VQJA 3ZO5B 4KD3A 4DK3C 2WXRA 3DDCB 4HCNB 4JYAQ 2QDLA 2ACZB 2KVRA 5LL6S 1HXYD 2OQKA 4DXGA 3OW7A 5C0XG 1EF5A 3J7YW 3PMFA 1HNWL 2AUKA 1V81A 2EELA 3TSSA 2KMAA 2L83A 3V6EB 4B08A 3PSEB 1ZP0B 2NVXB 2F0IA 2GBJA 4ANVA 2VUMG 1YN4A 4DR4L 3N32A 2DZJA 1E7ZA 4TQ1A 4ME3A 1J6QA 2E2DC 3T13A 1SDFA 2MP2B 4OVZA 4L63B 5C6AA 1UAPA 3FHWA 4HAEA 5IP9H 1VQ5A 4WAFA 2KJ6A 5M5WB 3RUZA 2WXQA 2IL8A 2JSVX 4BBSH 1LT3D 4NPSA 1HJPA 3PO2H 3E9IA 3BDLA 1JOOA 1WTWA 4QMGA 2KJXA 1EY5A 3H3VC 3KK7A 4PMCA 3OMCA 3KLRA 4X62Q 2GLSA 2Q8IB 2K8BA 2BCOA 3OHXC 2KFJA 2M9VA 1MJCA 2BE5C 3BVMA 5FLXL 1MJDA 2Y0SG 5G3LF 1XLOA 2PMVA 4XYOA 5LLIA 3J81i 1FNUA 3A7LA 2IO2B 3GE8C 1TR5A 1C77A 3Q8BA 1WD1A 1PRTB 1IYFA 1V43A 2DAFA 4FNFA 2F0VA 5JJZA 1HZBA 3PIPA 1VQCA 2F0PA 4A3KH 2LJIA 1WZ3A 3MVVA 4HCEA 1XPUA 3BG3A 3B9JA 3I4MG 5D94A 3B0AA 1QCBD 2Q2IA 4DUZQ 3TP7A 3U7ZA 1I4XA 3FRPB 3A9KA 2VRRB 2QKIC 3B6YA 3X23A 2A4ZA 4A3BH 5DM73 1X6OA 2PQAB 4H13C 2K6QA 1XPRA 4PYZA 2W9NA 4NXNL 1EEID 1VQDA 1VZ7A 2MHJA 3N30A 5EDSA 2K4KA 4P73A 3KBXA 1YIJA 1GUSA 1F2YA 1K8GA 2BYEA 3VVWB 2JXTA 4J6HA 4BBNC 5EKKA 1TS3A 4TKOB 3J81j 2IBIB 2K04A 1D5ZC 5KYIA 1WJNA 3HRDD 2MJ3A 5IYCH 3AN1A 4WWPA 4OWTB 3T53B 2QF7A 4BWGB 1FRDA 2B2VA 2M17A 1WJ4A 2N7EA 1VCIA 1QLBB 3K7AB 4IWQA 1CFMA 1N61A 1XLPA 2KN5A 1TIFA 3RZDB 2PNRC 2JA9A 2JSOA 3G4SA 3UDIA 3S1NB 2JRIB 5AJ3Q 4WJQA 3CCJA 3O13A 5JJKA 1YQ3B 5IAAC 5LMNQ 2WB1G 3JW0X 1Z2MA 4FBJB 1K8MA 1LV9A 3H9DA 3G71A 3K5MA 2F0HA 2L8JA 3M63B 1Q8IA 5DPSA 1JE4A 5IGEA 1FIQA 3AE6B 2LVQA 4Y7NB 3EROA 4JI5Q 5COYA 3CCSA 4MH0E 1OTRB 3U7DA 2CVRA 1VDVA 2IPKD 1DGJA 1XCTL 2JE6I 1VQAA 2V3SA 1KLGD 2F0WA 3CIRB 1EUJA 2NVTB 3BJUA 1OQQA 1H8CA 2Y5CA 2DWQA 2KDMA 5IGCA 5JAVA 2JQRB 4QF4A 3QOJA 1LTGD 1PRTD 4B3SQ 1FD6A 3HKZG 5C44H 3GV3A 3PO0A 4LJOB 2K52A 3PO3B 1JMCA 3PLVA 1ET6A 4KJOA 3SE0A 5L83A 3GTLB 1IZ6A 4IM3A 5AUIA 1VF7A 3M85A 5C4JH 3APCA 3HOXB 2FE8A 3E0EA 2WKDA 5LL6X 2YVCA 1MI0A 1OXSC 1SIJA 3T1YQ 1MJEA 2Y0SB 2ZVOA 3IAM1 1L7YA 3BYTB 3BVZA 1PTOC 4J8QA 1P16A 2F3WA 3JAML 4HKQA 3S1RB 4LF5Q 2B2YC 3HVDA 1TWHH 1SEBD 3CRKC 1N34L 1B8AA 3O65B 4W9GA 5FJ8G 2KNBA 3PGEA 1WR6E 2CH4A 4YL8A 4GKJL 2K6AA 1A2TA 2EIFA 1FM0D 2HDEA 4XX5A 4JG2A 5EPJA 5C23A 4N8FA 4IFDI 2IO0B 1SNDA 2LMCA 2ZTDA 4CHTB 4A93B 4G7ZC 1L0VB 3H91A 3HOYG 5J17A 5AFWA 4UY8C 3GDEA 1L1OA 1WI5A 4RG1A 3GQBA 4GS3A 2NBFA 1XNRQ 1XQQA 1PMRA 1IW7D 5M3FB 1UGMA 4N58A 1DOMA 1E3PA 5HI1A 1M8AA 2R7ZG 2D3GA 1XPOA 1UE7A 3I4OA 2W54A 5FR3A 3H0GG 3PQIA 2DBYA 5GMVA 2J42A 3A1QB 4XQQA 3GS2A 4EOYA 4RNAA 1KXLA 3M9BA 4HIMA 4GDLA 2LXAA 2ZJDA 3U4ZA 3AB5A 3CF5A 4KIKA 2B3GA 3HOWG 1FO4A 5KYLA 1I42A 4KKTA 4WAAA 1MPEA 2I1KA 3Q69A 1LTSD 4DAYB 4QUFA 4DA2A 2NBVB 5JJIA 5A2QE 3K8AA 2PW5A 5IYDG 2LRWA 3OIPA 3AYHB 3CCUA 3S2DH 1AH9A 1HQRD 2D5GA 3NVYA 1IXRA 1OXVA 2WAQE 4P2CB 5IP7G 1F2MA 1N63A 1ZPSA 1FVIA 3LB8C 4KY6A 1CM9A 4JW0A 2BVCA 3TL5A 2AMCB 2EYPA 1E0BA 4C00A 3S17B 5IT9L 4BKGA 2K39A 2YV5A 3KH0A 1A15A 4X66L 3C2PA 4LNQA 2KHWB 4N9TA 2OWOA 4FA6A 4EE2A 2LGXA 3A9JA 1TWFB 3ZXVA 3BZKA 2EJMA 1FJGL 3AU5A 2D0OA 2UUAL 2IGDA 5DCNA 4EQPA 4A3IG 3CC2A 4GN4B 5C3XA 3P2BA 3AM9A 2Z6KA 1VQMA 1EYCA 4PG3A 3L4PA 4K6DA 3A5UA 3FDTA 4HMJA 2RHQB 2M0XA 5IYBH 3VR3A 1R4QB 2A74C 4HXDA 4WQOB 3NBHA 1JRUA 1Q3LA 1Y8NB 3MTSA 2KWDA 2WP9B 3TEYA 1VQ6A 2XWJB 3CCEA 3ULJA 1HNZQ 1BNZA 5BYQA 3CMAA 4FP5D 1F9QA 2L55A 3I4NB 3EUB2 4KGSA 4RF1A 2V0GA 3X3NA 2JY6A 5C4ZA 4LAAA 1T0RC 5GQOA 1G6PA 1NBWA 4GXBA 2IO1B 2OCEA 2GVBA 1UE6A 4JCVE 2JA6B 1QILA 5EBCA 3PTFC 2MNAA 4BFRA 5C4XB 1F77A 2LI5A 3L54A 1F2ZA 1Q1OA 1YNJC 4P16A 1YNXA 5E4XA 4GN1A 2ZW1A 1I7HA 2AUJD 4QL5A 2OJRA 3GO5A 1YI2A 1CKOA 3Q8EA 3T9LA 1VCBA 1C4AA 3I3TB 1WGHA 3P75A 2MEKA 4I6PA 1A8VA 3OOCA 3UINB 5CTRC 3VQIA 2PZTA 4OEMB 3RLFA 1K73C 5EPLA 1BXTA 3A8JE 4H2AA 2IGHA 3KYHC 3DLLA 2C35B 4AQ7A 4S17A 1DD2A 4DK5A 5DPWA 4YIJA 4QIWB 5HY6A 2SDFA 1K8OA 4BY1G 1N5WA 2M4NA 1FPYA 5GADC 2CW0C 2MUYA 1WRDB 2BF8B 3HOVG 2JZPA 2BQQA 2Z0EB 1T5EA 2R2OA 2W3RA 3EIVA 3S16H 5GAHC 2HD3A 4MNOA 4NW2A 2UXDQ 3P4PB 1PA6A 2LRUA 3UGBB 4GZYC 2NB0A 4C3HH 1PVOA 1X65A 3H6NA 1Y1WG 3AECB 4X3SA 3ABVB 1SNOA 4MGIE 4X3TA 4KI0A 3PHWB 1WTHA 4B3RL 1XX8A 3AULA 1KF6B 3M3YB 3HOWB 3GTJB 4K3BA 4N9PA 3A33B 4IPGA 1XJVA 2KWCA 3R8BA 2UU9Q 2R93H 4HK2A 1GC7A 2JF5A 3BZDB 1QQRA 4G11A 2LEKA 4NZLB 2GA4B 1IBXA 4C2MB 3UIOB 5C4HA 3AE2B 4U68A 1T5XD 5FO8B 2XVSA 1E2ZA 1X9NA 4MM3B 1DM0B 1ZYRD 2A5HA 4P1BC 1CSPA 4G57A 2BKRB 2YLMA 3A9KB 5JPNC 1A70A 4CDEC 1WJ6A 4BAXA 1IL2A 1E1OA 2A6ED 1J9OA 2PVOD 2AX5A 4K8JA 1SYFA 2HIVA 2RDGA 4KHVA 1XNQQ 1V8QA 3CMEA 2XN9C 1N33Q 4A3MH 1KHIA 4DV0Q 5CBEE 1R9TB 1MHXA 1JCKB 4R4TA 2BS2B 2OEDA 3ZQ4A 3NOBA 3CSTA 4CDDC 1P9DU 1F9RA 4MGZE 1OXTA 3I73A 4LF4L 4MJSA 1TIID 4BKSD 1ZXTA 2IDYA 3DCGA 4ZCKA 2MO0A 2LGDA 3W1BA 5T8IA 3KWLA 3Q3NC 4NJ7A 4YWKA 3NBIA 4IALA 1WX7A 2K5DA 4C56C 2LXCA 1Z9FA 4L8JA 1UUPA 4AYBB 4ZLTF 1KQSA 4FF4A 4BY7H 1KL9A 1GNUA 4GNXC 1HQMC 4A3DG 1AWDA 1H9JA 4OWXB 5C5MA 3R93A 3TBIB 2B63H 4LMQD 1HR0L 4V190 3ZTDA 3OMGA 1KTKA 4HDQA 1S5CD 3QIAA 2FJ2A 5C5LA 1XO3A 1YQBA 1C4QA 1DGSA 2ZW0A 1EY7A 1QZEA 2VZKB 4LF9L 3VYUA 4LFCQ 4KGTA 1AFPA 4QIWE 3IKJA 1I4GA 1WYDA 1XMQL 1F0ZA 2E8GA 4WJNA 1RHPA 2JX5A 2M1MA 1NEKB 4DV6L 4HVBA 3U50C 5CMDA 3KLSA 1VZ8A 2WYQA 5H1SE 3W1SC 4OZBA 2IO3B 4A3JH 4MGYE 2JEBI 2JA7G 1N6ZA 4HWIB 4XWWA 5FR6A 4BY1B 4WJ3M 2B29A 2CWPA 3S1QH 3HOVB 1XF5L 4YXDB 3GZNI 2VS1A 1C7YA 1ZGUB 3N9YC 4NAWA 3T1HL 1C9FA 1SE4A 5G3LD 4G4KA 1HR0W 4P72A 2KCCA 2IYDB 3NVWA 4HCPB 3MHSD 2NR2A 2WXGA 3GZNB 3NRZA 4K3CA 3ZRFA 1SYGA 3AQQA 2OTLA 1PDXA 3Q8CA 5G2NA 2FCMA 3ZW3A 4FO2A 2DHZA 2RA4A 2EYHA 3UDGA 3MXNB 1HUNA 1A3TA 3U2SC 4OX9Q 3RT3B 1MSHA 4WRDA 4BBRG 2BB5A 1B3QA 1M1KC 2G4SA 3H6MA 4APVA 1N32L 4JI4Q 2LMCB 3PVLA 1MHWC 4QAYA 2F0NA 4HEA1 5HGQA 1D8LA 4B3ML 3FILA 1IBLQ 3RN9C 1LM0A 1L1OB 1NDDA 3SDLC 5I6WA 2WXPA 2N7DA 3ULLA 3OLMD 2Z6BA 3SK4A 4AP4C 1FMAD 1E10A 2O5IC 3A8IE 4KHPL 1DOIA 1TKGA 2MWSB 3GTOB 2O2VB 5C1ZA 1VS0A 5DLQE 3KWVA 2D2QA 1EQRA 3SK5A 4AYBE 2KDFB 1VDZA 1C0AA 4DKAC 2N7JA 4NXMQ 1SYEA 1JALA 3U4EG 1SYBA 4C1NI 2KX3A 4JC0A 2J0TD 2LXJA 3ZTCA 1LTTD 3AEVA 5I2YA 4GDLB 5CV9A 1LT4D 1LM8B 2VB3X 1JOKA 2V1CC 3T4AC 1YHBA 5IOIA 5J3BA 4K5VA 2WACA 4UAIA 3S1MB 2IGGA 2WLBA 4KIKB 5C0XJ 3C3LA 1N36L 2EJGC 1XXGA 4TVAB 4DV2L 2MRPA 4LNNA 3NJTA 3R7RA 2BTEA 5M3MH 1NMGA 3E0JA 4QB4A 3TEHB 4DR1L 1GM5A 1VQKA 4HSPA 2QCZA 1AYFA 4WJ4A 2IY5B 4K0KQ 2JZ3B 1H9SB 1CI3M 4B0MA 3DQVA 2B3AA 3A74A 5IY0A 3W5VB 1P1AA 3AEEB 2BOSA 2R2QA 1WCMH 3D32A 3AB9A 3WDNA 1F2RI 2KTRB 2AQ1B 5J39A 1C3TA 3A54A 2OTJA 1SYDA 3ENEA 1WWTA 2EXZA 3DBRB 4ILWA 3LDZE 2F0SA 3EA6A 3C1EA 3A9JB 4FJVB 2JA5B 1EY0A 1MGSA 3GTMB 2KCTA 2DNFA 1S5ED 4A3EB 2Z0SA 4O2DA 3K59A 1VQEA 1NUCA 4EZKA 2BS4B 2NTTA 3WAOA 2KHSA 3TP6A 2Q2TA 2PZWA 5KGUA 1K53A 4YTMB 3W5UB 2ENBA 4KKUA 1TQOA 3I2ZA 3NP8A 4C3IH 4LNIA 1FR3A 1TBEA 1N8RC 3CCVA 2VH1A 4HCSA 2JA7B 2RD0A 2WDTB 5BYRA 1L6UA 4B3TQ 4IUNA 2EMSA 2O6VB 3NY5A 3M4QA 3PUVA 4M02A 3IL8A 2N49A 2PNHA 1CKNB 2WP8J 3I63C 1Y14B 2UUBQ 5DPRA 1PYSB 3TUOA 2BYVE 1YD8U 3VHTC 2O4XA 3I56A 1Q0WB 3DXJC 4YT0B 5BMHA 3EVQA 2BT6A 1AW7A 3TQYA 1LGRA 3AH7A 3ZXRA 2CU3A 4JI2L 3ML9A 4FADA 2A6HC 4OGQC 4A3FG 4IJLA 5C0XH 2VH2A 5IP4D 3CXCA 1NSNS 2CQOA 5D3IB 3PCOB 3RD2A 1WY8A 4WWNA 2QJLA 4HSVA 1J5EL 1BOSA 2VUMH 4DV3L 2Z59B 3N52A 4AJYB 5C3WA 5J22A 3MAQA 1T0QC 4MTKA 1K9MC 1NI2A 1XD3B 2HE7A 2WU2B 4JI7Q 1E24A 1O7IA 4W9HA 3NXWA 1CA5A 3CKIB 1SB3C 1J8IA 4MHEA 1JWSD 1W2BA 3HFZB 4A3LG 4KTAA 2GMIC 3FC4A 2QDFA 3SU8X 1HNXQ 3AMZA 3NZ3A 1VQBA 1QE6A 3CQZH 1FRRA 5AEKB 5JJLA 4IO9A 1QVFA 1HEZE 3LJ3A 3G7LA 2Q2UA 1L4ZB 1G8ZD 2G4DB 1EF1A 2NCNA 2SAKA 3CSFA 3L08A 4BBNF 1TWGB 3RMHA 4N9F4 5I9PA 3TBLD 3NVVA 1DOLA 4EZJA 4ZKCB 2BA0A 4XT3B 2H5XA 1HNWQ 1MG4A 4LDTB 3GTQB 3QOLA 1ZDVA 3NWSA 3VUYA 1A3UA 2E76C 1MVKA 1PUTA 3IFDA 2RSOA 4XXEA 1X3PA 2MFIA 4CKEA 1BCPC 3EN2A 2K5VA 3I4MH 1KRHA 3A1QA 2DLBA 2NN6H 3LX0A 1EWYC 4XIGS 2EKIA 1IBXB 2N55A 4L5QA 2QGQA 1QOAA 2JU6X 4BOSC 5L95C 4LF7L 1B9MA 3PZDA 3BS1A 4PK1A 2OF1A 1YHQA 4DXAB 2N8NA 3NTHA 1FGUA 2WXOA 4X65L 1HZ5A 1E22A 4AQYL 3HK0A 4LK0M 1TS2A 1LTAD 5D3DA 1PH4A 1PHJA 2BWFA 4YY3L 4ICUA 1GPXA 4TKNA 1I4RA 2K28A 3H8HA 1YNNC 1S4ZA 2UYZB 1JB7A 2DY7A 2NZHA 1YN5A 3P63A 3UQAA 4MJSB 4DGZA 5C2TB 4TQUS 3HZXA 1B9RA 1NVID 1YITA 1WTOA 2UXCL 1IKMA 3ZDMC 2BH2A 4W9DA 3DVNU 1SR3A 1WTQA 5EGTA 2XNAC 1BT0A 1A0IA 1JORA 2A1AA 3ZUNA 3OWFA 4IUTA 4RKLA 2N78A 2M8SA 3KVFB 4H02A 1HTPA 4J1MA 4GOPC 1R4NI 3FKYA 3QJZA 2MA9B 3I9V1 1PTOF 1M90C 2FNJB 2IY1B 1C48A 1VQLA 2SNSA 2G9DA 4NXNQ 2QEJC 2EXDA 1R4NB 2B2YA 4E6IA 1S40A 1OGWA 3F2CA 1E8WA 1NAPA 4X6AH 1OFFA 4OZAA 4MSMB 4X64Q 1CZGA 5M5XH 4LNFA 4WORA 2B2TC 2HCIA 3UIPB 2B2WC 1C8CA 1E8ZA 2Z4HA 4AJWA 2BYTA 5TR5A 3RLNA 4ARCA 1WXAA 1D4BA 1SXTA 5AZFA 3NHHA 3K57A 2CS4A 4DDID 2OOBB 1RODA 1VQ4A 4FHJA 5C3EB 3D4WA 3F8TA 1RWSA 3CAMA 2CQAA 1STNA 1P98A 4LDTD 4DR3L 2WX0A 3DM1A 2F0TA 2E75C 2A69D 4YWMA 5CC4A 4B9KA 4MZ9A 4JPSA 2HQLA 2VXWA 3CP0A 3KBGA 3HOZB 2YTVA 1S3OA 1WSPA 2N9EB 1EY4A 1PDQA 4NAWB 1M4VA 3AEGB 4HJAA 2JN4A 1IHZA 1PQSA 1RDPD 5FOBB 4PS3A 5GXGB 4DPGA 2XRSD 2N9LA 1OO9B 5FJ8H 2XBBC 3TS2A 2IX3A 3W3AA 2HJ1A 1W6KA 1TTNA 2ZPNA 1HTQA 2KZRA 3S9WA 3HOYH 3OSOA 2KANA 4D2KA 3PO3G 1WXVA 1PH8A 3A8KE 1K50A 4US8A 2E3TA 2WXMA 2F3VA 1AZQA 2SEBD 4ID6A 1XLQA 2PVGC 1S5DD 1Y8OB 4LFBQ 3HOXG 1YHAA 1KIXA 1FCCC 1B44D 2QC8A 2NZ1D 3RN5A 2XEWA 3N1YC 2R7ZH 4YSYB 4QQBX 1WE6A 4BVUC 4Q2JA 1CHPD 3H0GH 4TRDA 3FILB 1A3VA 4G7OC 1YJIA 2AYOB 1YBYA 4IUPA 3SGIA 2H89B 2B2UC 3GTKH 3CCRA 3VTUA 3GTPH 4DV5L 1WXSA 4MGKE 4B6WA 1SRUA 5HURA 2N1WA 2N1VA 2BDNA 3OAWA 4RWSC 5M5YH 4MM3A 1SLJA 4A93G 2FIDA 2IZVB 1KABA 3W2DA 3AMUA 2KVZA 3HKSA 1TS5A 5GAEC 2E74C 1SMYC 3F2DA 1U4MA 4RHSA 3VYTA 4GKJQ 5IYDH 4MELA 3V05A 4IFDG 5M3FG 2UUCQ 1O80A 1FNVA 1I6VC 1SE3A 2L32A 3GD7A 4UP8A 2MQJA 2E2JH 2N9XA 4IW0A 3RZWC 3SR6A 1G6ZA 1N62A 5ELEA 3CC4A 1WVLA 1WTVA 3SHLA 2AL3A 3HG9A 1TWAB 3HVZA 3KYDD 3V60A 1HUMA 4KJNA 2DJGC 2O5JC 3C8YA 3I55A 3FVQA 4NAMA 3MZ5A 2R92B 1TWCH 5M3MB 2LS01 1Q12A 3AEBB 3BDOA 4A3IH 4OONA 1QVGA 3APDA 3VUXA 4C7ZA 3Q14C 3VDZA 2PCFB 2JXXA 1H9KA 4JI1L 1OEYJ 2LHEA 2F0QA 3PF5A 5CHVC 3T16A 3M4OH 4OW0A 2NVYH 3TCAA 2YU9B 2PPBC 4PS7A 4FXKC 1UBQA 1Z7TA 2ZVNA 1GKHA 3ONAB 2CCZA 1LYLA 2QCPX 3OPOA 1AP0A 2I2YA 2LFIA 2YYZA 2WV6D 2KACA 5EE0A 4J15A 2Q8TA 5EKLA 1EQQA 1HTLD 1SFOH 1TKEA 1WYGA 3JYUA 3SFDB 4PZ7A 1NCVA 3H3VI 3KLWA 4DV1L 1JB3A 1UNSA 4R1JA 1PFBA 1DZ1A 2ZJRA 3QARA 3RZOB 4K7SA 1RD9D 3OYYA 3MEFA 4JI6L 2WAQB 4DNTB 3X3MA 5BR8Q 2NVQH 1WH3A 4OO1H 1OXXK 2YTYA 4X66Q 4OVVA 3ND9A 3C1FA 2MW5A 2DYMA 3Q3FA 3JAMi 2FMMA 3CF6E 3W1GA 1E8XA 4IURA 1FJGQ 4DWFA 3ER0A 4A3CH 3ALBA 2UUAQ 2VQEL 5LHY1 5ELCA 1ZE3D 4JYAL 4ITKA 4K14A 2LWPA 4QY7A 2K50A 1ZOYB 1I50B 4POGA 1YJJA 4M8MA 4DK1A 3U9SA 3I4NG 1KAWA 2ZT9C 3H7PA 1CZWA 1CA6A 4HN7A 1K3RA 1FFVA 1E2VA 2JA6G 4ZHPA 5C4XG 1F9PA 3STBD 1S1QB 2KOXA 4HROA 1QOFA 4K1RB 3WOFA 3VTWA 1JWUD 2C60A 2Y5PA 1QOGA 4YHHL 4LNOA 4FF1A 4LTUA 2KDIA 3T8MA 2J0JA 1A5RA 3HHMA 2JQOA 4A8XC 3T3NA 4R4CA 4BA2I 2QHOA 3MXNA 1PFSA 4IJHA 3DWGC 1LO5D 1TT2A 5T1IA 2ZM6L 1Y1WH 5K36H 2RVLA 1IBKL 3FKIB 4PNYA 5KRUA 3RMKC 4BKTA 3DHGC 4XDXA 2Y5BB 4LUOA 4TQ0A 2Q8RE 2PMZB 5E3FA 4N8X1 1PH9A 4HJGE 5AUKA 2MX2A 3CRLC 3KJPA 1WTXA 1Q7YC 1X32A 3DUZA 3A4SC 3ZNHB 4P75A 2W3SA 4A3PA 2F4IA 1HZ9A 4II3B 3SHQA 2O2VA 4GLXA 1EZ8A 1E8YA 1UGJA 1S5FD 1SNCA 3DWQA 2PO4A 1AE2A 2MH7A 1IL8A 3OG5A 4EEWA 3ZLZA 1GHJA 4HKZE 2MQHA 2L3ZA 4UP7A 2NN6I 2BDOA 1WM3A 3TMPB 2FXQA 4K6LA 4DAPA 2R61A 4IUUA 2JA8B 1VJKA 4DUYQ 2K0PA 1CK1A 2K7VA 5CX3A 4V0BA 3FAHA 3SVMA 3DMUA 5HHDG 2EJFC 2PLPA 4LCDE 1FXIA 3TP5A 3Q24A 2LUEA 3CCLA 4JL9A 4EUTA 3AE9B 2RCNA 4B3RQ 4ZYNA 1SNQA 3A56A 3MWYW 4PQXA 4OWWB 3TEZA 1H9SA 1HH2P 2ICEC 2MP1A 1XYIA 4MN3A 5JEAG 1I3QB 1TVXA 3J80L 2I1JA 4FN2A 3W1SA 2PZUA 2KTRA 3G6JB 3K9OB 3P4RB 3J7AV 2NWGA 2PW7A 5BMGA 3U52E 1KLUD 3NENA 4K2KA 4A3DH 2L52A 5HGTA 4JBKA 2KQ7A 1GOZA 2R3ZA 4NMZA 1VD2A 2PE9A 1STHA 5ELFA 4C3JH 4F8CB 3J81c 3RFZB 2J53A 1Q81C 4G0NB 1YQ4B 2I5HA 2LSSA 1W6JA 3D3RA 3NQTA 3APFA 3BU2A 1IYUA 3E5SA 2FMCA 3F2UA 4RGOS 1YEZA 2VQFL 2ZJPA 5LMNL 4FVMA 1X54A 1GJXA 1EYGA 2OJWA 3J9CA 4KZCA 4A9AA 5FLXE 2D3AA 2EY5A 1PTOB 5ELDA 2WXIA 5MPOA 3QB3A 4LF4Q 1Y56A 3MHZA 2RPQA 2E2HB 2O6VA 1DOYA 4AYBG 3PGZA 2J0KA 5D6JB 4JI5L 1T0SC 1CKNA 2V4IB 3VRAB 3WAMA 4URKA 4GOCA 1XTDA 4W9JA 1D3ZA 1UBIA 1JRPA 2PYKA 1EWHA 1Y1VH 4FXGC 4C7YA 1DCZA 2G45B 5IYCG 4FXCA 2D10A 4FHKA 2PMZE 2I38A 4BZAA 1KDBA 1C4PA 2RR9A 4NQLB 3VFKA 2MO1A 1HR0Q 5KNCA 1MG8A 2LHDA 3S2HB 1G2TA 1P7FA 4HPLB 4KSLC 4JV5L 1I94L 4A3GH 2WXKA 3DOWA 1SE2A 4ASWC 1WGGA 3HOUB 4HIDA 1EYAA 3L13A 1HCZA 5G5GA 4PV1C 3GTGH 4DAMA 2PKOA 3OJ4B 3J81E 1D6EC 5LMUL 3C46A 4IM2A 3RLOA 1QT9A 3Q8AA 2OXPA 2VY3A 1RRBA 1XMQQ 4FYDA 2ZJQA 3AE8B 4NPNA 1YOVB 2UU7A 1WXMA 2ATWA 4JBMA 4FLHA 1V80A 4DHZB 1GD7A 1HZAA 4JLCA 4DV6Q 4BBRH 5GAGC 1R4PB 4DR7L 4K81A 3ZJVA 2HD5B 1KFYB 2KWUB 4G3XB 1LTLA 2L76A 3ZJYC 2KLCA 1SE9A 4KGRA 5GROA 2F0GA 1UEBA 1HPCA 1PH5A 3TEWA 4UDUC 2V9HA 3R7QA 2B2VC 1ILPA 2I5MX 1GO3E 3PSIA 3MJ5A 3W1YA 5J1ZA 5FLMG 4EKUA 4JOIC 3LWUA 3JAMc 3MXPA 3U9OA 1KM7A 1B3AA 1EYDA 3LNNA 4R4IA 4BBSB 4EQOA 3PO2B 4OHJA 4L6TB 3VA5A 3QR8A 2KOLA 1NR4A 1SAPA 4DFAA 3QIJA 5HKHA 4UP9A 5CORA 1GAQB 1BBWA 4KKIA 3KYCD 1A2UA 1QJOA 4NJCA 2F03A 4JGHB 2ZTEA 4IUMB 4A3OA 1VQPA 5EJWA 2KD0A 3MP9A 3TIXA 1Q10A 3KUZA 1LT6D 3S24A 1KOTA 1PFDA 3IXSA 3FP9A 4ACFA 1EZ6A 1EIGA 4H0LC 5EPKA 1K83H 3NVZA 1PZKD 2DUDA 1UZXB 1VQNA 1N32Q 2WIIB 4A3KB 1PTOD 4HJ9A 1S3SG 4P7IA 4MEMA 1RTNA 1KC8C 3VYRA 4B3MQ 4JWSC 1JC7A 2PI2E 1XTCD 4L5TA 2JZZA 2KECA 2WB1E 1VQ9A 1VQ7A 1PV4A 3AE4B 4A3BB 4KHPQ 5LXIB 2ZXRA 2KTFA 2E2IH 1VQFA 1EU4A 1Y8PB 4OL7A 4HJ7A 3TRZA 1WGKA 2EE1A 3KW5B 3SD5A 1KDCA 3AXCA 4ZUJA 4RGNA 2IHEA 3JAME 1ZDXA 1J8CA 4AUQC 1QOBA 2PTLA 4HPPA 4JQWC 4ANUA 4JI8L 2NS5A 4K2LA 3K9PB 3Q8DA 1KRTA 2X38A 3M7GA 1TGZB 1EFWA 4YTNB 5FO9B 3PS6A 5IT9c 3EHVA 3ML8A 3S14H 4ZDVA 4ZQ3A 3VR6A 2KEDA 3D8GA 3V2TA 5KHQA 5IWAL 3M4PA 3MTNB 4DR1Q 1ENFA 3HKZE 1LFDA 4DBGA 2MBBB 3G48A 4XGAB 3VTVA 2M19A 1SSOA 4KK7A 2M2LA 1WD0A 3IHPC 1YJNA 5T1GA 2JA5G 4DHZE 5HFYA 1B1ZA 4R4QA 4A3EG 4F7ZA 4DV7Q 1I35A 1STGA 2EY2A 4OO1I 4CBVA 2HHHL 1B7YB 3VDYA 4A3FH 4W9CA 1BCPF 2HTHA 3CPWA 3I7FA 1SSNA 1TYGB 3RYTA 3DPDA 1Q82C 1K0RA 1JJCB 2EPBA 2K9XA 4AWJA 3RZFA 2CH4W 1L2NA 2JWZA 2MJ8A 3Q23A 2DNCA 2K5NA 2UWQA 3RNUA 3CC7A 4DR6Q 2L4NA 3CCQA 1YX6B 1STBA 2A68C 4A3LH 3W5OA 2RMMA 1Z6HA 4IG7B 3CMMB 1JJ2A 1IGDA 2F0LA 3H7PB 5JHAA 1V1QA 3PUWA 1N5XA 5G5HA 1JICA 4XQNA 3QK0A 4JI3L 2JYOA 1NENB 5I4DA 1DYQA 5IOCA 5IT9E 3U8ZA 1D1IA 3EBEA 2KMMA 2F0EA 3DHQA 2KC1A 1E9MA 2FINB 1RCVD 5C44B 1PGAA 3HS0C 1ASZA 1K8RB 2NVXH 1X1MA 4GKKL 5C4JB 3VH3B 3K6OA 2OQ0A 3MHBA 4DV4L 2ONQA 2F0UA 3A5ZB 5IO9A 1E7UA 2GBRA 4PYUA 4IQZA 1BBUA 4DV3Q 1RTOA 1TWHB 5M5WH 2K25A 5DM63 4RGMA 1BUVT 3M7NA 2B39A 2KCMA 4IOCA 1UH6A 3D31A 3H7SA 3I8ZA 5IGFA 4MTNA 2G3QB 4WJOA 2WFWA 5FO7B 3Q3MC 5KNBA 2GN5A 2J7ZA 4GNXB 4GN5A 4ARIA 3NWTA 2L5TA 2DYBA 4O42A 1TS4A 2ZNVC 4BA1I 1I5FA 5IGBA 3AEDB 1EFID 1U4PA 3BWUD 1GUNA 3GB1A 4II2B 3BK2A 1Q8KA 3VA7A 1VQIA 1S5BD 4RM8A 3DBLI 5DPTA 1LT5D 2WXFA 3QWZB 2RDFA 1EU3A 4DV0L 2VZKD 4HJKA 1AE3A 1V1PB 2REXA 2WXHA 2VW9A 2B2WA 1XWEA 1HZCA 1NR2A 2CW0D 2ZTCA 1YX5B 1A62A 3DBLB 3MXGA 4LUVA 3SR1A 3P1MA 4HR7B 3ERSX 3IT6B 3PUYA 1GUWA 2LVPA 2L0TA 3V6CB 5DEHA 1RKNA 4C4VB 4ZUIA 2CHXA 1EQTA 3S15H 3S2DB 4XDDA 3L0OA 4HMIA 2BB6A 1CSQA 3B2GA 2KHIA 1E7PB 4E74A 4LF7Q 2KT7A 2ID0A 2QEXA 4TUUA 2SNMA 1YN3A 2M0AA 4IC7B 2HT1A 1STYA 2BPSA 1MD2D 4NY0A 4X65Q 1YVCA 3N1ZC 4AQYQ 4EX5A 4YY3Q 3ZRCA 3H15A 1T0YA 1D2BA 4WJWA 1X3QA 4A3MG 3K7AH 2C9WB 2K5PA 2W82A 3VR4A 2Z1CA 3RZDH 4Y52H 1BDOA 4WH4A 2EMTA 1FXAA 3S1NH 4FJYA 3RNBC 3WALA 2CJOA 1KNAA 2L12A 5ELBA 2UXCQ 4A4IA 4USAA 3Q22A 3K5LA 4ZRQA 3OIQA 1KH0A 1L0XB 2AHOB 2RDHA 4IFDJ 1IKLA 3UI3A 3JC66 3X0WA 3R2TA 4OELB 4QGUA 3I5JC 4DR2Q 3NTIA 3OTOL 2B2UA 3DM3A 1HE8A 4XC2A 4Y7NH 1Y1VB 2WHIA 1EQVA 2WXJA 3AE7B 3TJPA 1FXTB 1ZW7A 2OEOA 1NYRA 2DZKA 1QG7A 3L7ZC 3AE5B 2KXJA 1I4PA 2NVTH 2BH8A 3C0RB 1XCQL 2INNE 2KJRA 2MCNB 1D1KA 2EYOA 1SMXA 5M9OA 1FNWA 2X6LA 4A3GB 4KKSA 1PH6A 4JI0L 1Z5SB 3EJIA 2I5LX 1OXUA 5C3EG 2K5QA 2EQSA 4MH8A 3N6RA 2C7HA 3GTGB 2QILA 5EQ0A 2FUG1 3VH4B 3PO3H 1QOHA 4GIVA 2NBUA 1ILQA 3AI5A 3DVGX 1SN8A 2Z8LA 3IRBA 2KCNA 3GTLH 3ICEA 1C76A 4NJ6A 2K5WA 3HOXH 1T3QA 1ZKOA 3ETRA 3IBEA 3HOZG 1PH7A 1ICFB 4KV2A 1I6HH 1UD7A 4DR3Q 2EY1A 1JR0D 1IBML 2LGIA 2NVUI 3NS8A 4IWOA 2F1MA 1PLFA 3BIID 2LD9A 3S1RH 1IUEA 1IGCA 2H1EA 2F0KA 1B2TA 3Q8FA 1L2FA 4Q5VA 3NEMA 3J7AF 3S16B 1U5KA 3H94A 4YCVA 2WS3B 5CHWA 1V97A 3Q3OC 2A19A 3DWMA 2RSUA 4C3HB 4DR4Q 4U673 2RGFA 3RNCC 3PF4A 1QF6A 4A93H 4XDCA 4KD4A 3KOJA 3MFYA 3U58A 2IWHA 5E4WC 4CDCC 4NXML 2BGFA 3EFCA 2I07B 2EKEC 3CU7A 4IFDH 2FCSA 5M3FH 5BN4A 3Q6BA 1BQQT 1U9RA 1A6XA 2JYEA 3D4DA 1BR9A 2KFKB 3S2AA 1P8LA 2R93B 1RM6C 1HHVA 1VR9A 5EKIA 2A5UA 1JOQA 1FFUA 4IWPA 3VR9B 1KRSA 5L37A 2PEAA 1PZID 4K0KL 1J7CA 1ROEA 3ZVVA 3BDCA 1XMOL 4IOAA 4YSZB 2O6VD 2DNEA 4CQNA 1UWMA 1HFGA 2AWNA 4ALPA 2VNUD 4RM9A 1E0ZA 2CKZB 1V86A 2BA1A 2IW3A 5A35A 4DV5Q 4A75A 4M00A 2J4XA 2BWES 4A3MB 1BKBA 2CU1A 2MLBA 1MSGA 1LACA 4JE3B 5CGKA 3NUCA 3S17H 1N9WA 1ONLA 3P7JA 1LXDA 4KHZA 4RH6A 2AQ3B 3MA2B 1II3A 4CJ2C 4LUZA 1TWFH 4OIJA 1X55A 4LFAL 2R92G 2FIFA 1CTMA 3MFGA 3SDZA 5M3MG 4BY7B 1V5TA 2GBNA 4J3OD 4B3TL 2PI2A 2OHFA 3V96A 2B63B 2EYFA 4Z9CB 3KF8B 1ZUD2 4TSSA 3PUXA 1NTGA 3VR8B 3S14B 4JVZA 3QX1A 1LABA 5ELOA 5BN3A 1WCMG 4ZRKA 2RF4A 1LQBA 2JVCA 1PRTC 1K0SA 3PIO3 2OT2A 1SNMA 1EIYB 1PH1A 2AWOA 1E5WA 1IYJB 3I4NH 4A90A 3EQLC 2L0CA 3RPFC 3K7UC 4ODGA 1EY8A 2PPHA 3PHXB 2L1AA 1QB5D 1BCPB 3NHEB 4O1NA 2JK8A 2QMTA 2JA6H 2WAQG 4CJ0B 4GDKA 1H9MA 3L2PA 5JEAJ 3SK6A 5C4XH 1C1YB 5EAYA 2K1FA 1YMHE 3T51B 2NUCA 5K5PA 4DV1Q 4A3JB 2L1BA 3NK9A 1BMLC 2DZIA 4JI6Q 1QWYA 4LK1C 3MEHA 4RKBA 2GB1A 1SROA 1G91A 5DNFA 3S1QB 2E5LL 3QWNA 3RULA 1IYVA 5JVH3 2F52A 1K28A 3KJOA 3IFWB 1IW7C 2VQEQ 2RSNA 2LGSA 1CQVA 5A2QL 2K01A 4HIKA 3SEBA 1B50A 4K7WA 4F87A 2VL6A 2PE6B 1PZJD 2F0MA 1UE5A 4I7ZC 1NE3A 2JT4B 4A76A 4ZRPA 1QZHA 4HDOA 1V9PA 4IZ8A 1B4OA 2F4VL 4KDLB 4WQMA 1E6EB 5IGGA 2A6HD 2WKCA 3HEJA 4H44C 2KX0A 1ZKHA 2M56B 2YEPF 3ZDTA 3TN2A 1EUVB 4HRSA 3HRZC 2LXKA 2WQYB 2KVMA 3FKIG 4K8IA 5JVG3 4GOPB 4YHHQ 3JVZX 2ES2A 4ZKBB 4KLKA 4CO7A 1TT5B 4ZAIA 3M3YH 3HOWH 1SE8A 3GTJH 2NBWB 2ZEQA 4EGVA 2ZM6Q 1N34Q 1IBKQ 2MSED 1DXMA 4M01A 2FBWB 2N4FA 3QA8A 3UF8A 4DHJB 4IUVA 4IM0A 4C2MH 1D7QA 5G55A 2Z9HA 3PV0A 1RL2A 3M4YA 2F3IA 5IP7H 5JEAH 5H92C 1STAA 2EY6A 3UQBA 1KLVA 2EYMA 3H1UA 1H95A 1R7SA 1PYWD 3R66C 1EOVA 2JA8G 1C9OA 2PIAA 4LF6L 1UF0A 4ZHOA 1CHQD 4A6QA 3K0YA 4LWCA 3HGBA 3KQ4A 2P5ZX 1R9TH 1HFNA 2NN6G 2ZZPB 2X6GA 4OZCA 4DR5L 1LTID 1BCPD 1QUQA 3A7AB 4DK0A 3E6ZX 4P1CC 4LF8L 1WCMB 2ASBA 3PZ7A 3MXUA 4LNKA 3S15B 1TY2A 4NDXA 3HIZA 5J18A 1O7ZA 3ZIMA 2G5DA 3J81L 3QCAA 1GB1A 2A73B 2K05A 1VMCA 4NB3A 2JEAI 2KENA 2EVBA 4X64L 1UE1A 3URYA 1B53A 4FDBA 3OW2A 4US9A 4I65A 4KX6B 1WX9A 1RIPA 2XSCA 2NMQA 2FAZA 2UXBL 2GRIA 3BY4B 2KWVB 3K5OA 3R3MA 4GMVA 5IE8A 5CYUA 4DK6C 1PFMA 4C3IB 3DEPA 1MFWA 2KQ3A 4RMFA 1JWAD 1YNND 2CHBD 4JOIA 1W3SA 5IN7A 1CZPA 5I9OA 5NUCA 4AIMA 2K8CA 3QJYA 4HPMB 1ZXIA 1EWIA 2KAJA 3EC8A 5C0XI 2VQFQ 2D5DA 3TZDA 4AOFA 4L2YA 1SYCA 4DNIA 3I57A 2FUHB 2R7DA 2DZMA 2KQSA 4HJ8A 1KAAA 1WIAA 3PV1A 2XTIA 2LUMA 3GV6A 3QO2A 1JMLA 3I72A 4BY1H 3AU7A 4BXXG 3KUDB 4K5WA 3HOVH 3HM6X 1KDAA 2VUMB 5KNDA 4XQJA 2WWZA 3IVFA 3AFPA 2C5LC 4L23A 2BKFA 3RR5A 5CV4A 4IDIA 4DHJD 3HOUG 3QAQA 4MACA 2IT1A 2JXMB 1V49A 2LASA 4LFBL 5FLMH 4X62L 3CQZB 4JV5Q 4B95A 1F52A 1I94Q 4A20A 4YCUA 5CV6A 2K3UA 2GVAA 1OEYA 1V6EA 1V5OA 1NMFA 1ZYRC 3AEAB 3DVNV 3NSWA 3M3JA 3NQIA 5LMUQ 2XK5B 2B8FA 2FHTA 1U4AA 4CKBA 4XZ4A 3K80C 3J80i 4POFA 4GNXA 1I6HB 2A6EC 2TMPA 1NY4A 4FXDA 2N0SB 3LYYA 2ZPYA 4RHRA 1Q86C 3ECIA 3ZNID 3FPPA 2EZVA 4DF7A 4IN3A 4QUCA 1J7AA 4DUZL 1WTPA 4DR7Q 1BO0A 4KY7A 1SGHA 2C7NB 3QQ8B 5AZHA 3B1LX 3M95A 5IP9G 5FLXc 1FD7D 5EE9A 3IFTA 2UUCL 3GTOH 4BOZB 4IUQA 5HG2A 1HTOA 4BBSG 3I4MB 1L4DB 3VRBB 3WOEA 4ZK9B 3PO2G 3MC0B 3DHHC 4WWOA 4S0RA 3ZKJC 1V1PA 1QZGA 2HDMA 2MBHA 3SXHA 3RN2A 2NPTA 1WJJA 3VR5A 1T9HA 1MKHA 5IIFA 3Q0AA 2Q5WD 2CR5A 3KDFA 3KF6B 4G7HC 2ZXOA 4GSWA 3NS1A 3SFEB 1IPGA 2D62A 3LWEA 4FF3A 3S1MH 4C4VA 2K22A 2EYLA 1MI2A 1PH3A 3C19A 2IX0A 1AZPA 4CJ1B 1YIWA 2G1EA 4IPHA 2Y3AA 2BE5D 2H88B 3P4QB 3I70A 2D3BA 5BN5A 2KJHB 4A3KG 1G6JA 3RD4A 2Z0DB 2ICIA 4IPCA 1X3EA 2K6DB 4W9FA 4RCNA 4ANWA 2CHWA 4DXFA 4KV6A 3DVGY 2L9HA 1EIHA 2L05A 5E6JA 4W9LA 5AJ3L 2EOTA 3WWVA 1P3QU 2IY0B 1IP9A 4A3BG 1LUZA 1CQFA 1EIFA 2CFMA 3JSVB 3HM3A 4E71A 4QCLA 3ZJUA 2JA5H 3GTMH 1ZEQX 2INCC 1KJTA 5CHFA 3VXWA 1SMYD 3SK8A 4A3EH 4I6LB 2V3PA 5BR8L 1EO6A 1JWBD 2DN8A 1F9JA 1TU2B 4ZRZA 2WB1B 1T6BX 1WMHB 1DJRD 5FK9C 4YWLA 2C7MB 2KO3A 4H7BA 3VR2A 3TREA 3PLUA 3PRZA 2HQEA 1ASYA 2L0FA 2VB2X 5E1FA 3L10B 1PGBA 2GI9A 4JIOU 3WA0A 2JA7H 1KD1C 4JI8Q 2QDBA 4CGYB 1EWCA 3CWIA 4KMUC 1Y8RC 4YSXB 5M5XB 1E2WA 2PQEA 2MBEA 1QNKA 1GXDC 5CR3A 1ET9A 4B3SL 5E6NA 2F0JA 2H4OA 2HIXA 5E6PA 5IWAQ 2J7QB 3ULPA 2WDQB 4GDKB 3ND8A 2Y0SE 4OVUA 3P42A 4LF9Q 1OQRA 3PIOA 1GHKA 1CJEA 1WFYA 4M0WA 3VAWA 1NI3A 2HDLA 4I6NB 4XWTA 3RNFC 3HKZB 3T1YL 3A55A 4LJPB 5LMNW 2NYZD 1SF0A 4LF5L 1NBFC 4OO1G 2LVOA 2HHHQ 3EFUA 2R7FA 3WCQA 2A8VA 2K32A 4A3CG 1DOKA 3BINA 3V61A 4X3UA 3V62A 4EZLA 1NYQA 2G9HD 4RFBA 4DNRB 3H09A 3BYYB 3QC8B 3P1HA 3ZNZB 1RJTA 3J7ZC 1XNRL 4KDIC 1EL0A 2KMCA 4GB9A 2INDC 3PRMB 1WGRA 3L3OC 1O7YA 1P0RA 2SOBA 3NZUA 1RFKA 1TWGH 3T1HQ 1UWVA 3FEWX 3K5NA 3HOYB 5C44G 4C1NK 3TP8A 4JI3Q 1HRJA 1XT9B 2LJ5A 3OWEB 4W9EA 1GB4A 1YJWA 1L6VA 1JW9D 1C4CA 5KEEA 2LKVA 2R6GA 3L0WB 1PH2A 2JJQA 2K33A 1O78A 1NJIC 1PYBA 4ZRIA 2R7ZB 2YEPB 5LXHA 3ERQA 4DDGD 1D5MC 3GTQH 3H0GB 2JYTA 4IPDA 4R9WA 4DUYL 2K8HA 4EFOA 2KFKA 1TZ1A 3Q6SA 4KVGB 4GKKQ 2CKHB 2ASQA 4ANXA 2AQ2B 1ICWA 5K36G 4KN4C 4DV4Q 4BS9A 3GTKB 2DENB 3GTPB 4NKLA 2KKCA 3NPPA 3I4LA 5FKAC 4DN4M 1H9RA 1G2SA 5M5YB 2F0DA 4S3SA 1J19A 2DJFC 1S72A 2AKWB 3A0JA 1ESFA 4YWGG 2V3NA 3NE5B 2B76B 1H4RA 1U4LA 2AEHA 1PGXA 2DAJA 1LLRD 1SNPA 1P7EA 1Q46A 4KSKC 4RF0A 5D7GA 1E1TA 4DAVA 2E2JB 3WANA 1EY6A 1C79A 2MBQA 3PRPB 3AU4A 4GLSC 3NTKA 3P4SB 4WIPA 1J0GA 2WGSA 1R4MI 4R8NA 2ZXPA 3IAS1 1K51A 4HIOA 1TJEA 1TZOA 5I6YA 2KEEA 1AN8A 1QUQB 2GBKA 2D2CC 1AEXA 4GU2A 1TWCB 3J80c 2AWTA 2HJ8A 2JRHA 1VQGA 1R4MB 4P6VF 1N36Q 4A3IB 4M8NA 2D11A 4DV2Q 2ALYB 1YNTE 2ZCCA 5D2MB 2XRQD 2I0QA 1HNZL 3N3KB 2HCCA 3BZCA 3M4OB 2NVYB 3KF8A 1VRAB 2KK8A 5EE3A 3I90A 1L1OC 3GP7A 1I4HA 4HLEA 2F0FA 3N1XC 1O7LA 2O2LD 3DHIC 4KKJA 3ZNGC 1SFOB 2XWBB 2QA4A 3GE3C 1UEAB 2LFNA 3U4VA 3UDFA 3EECA 4C80A 1CMXB 2K14A 1DONA 4UHVA 2BYFA 4C3JG 2NVQB 5CBAE 1WM2A 4ME5A 3J7A5 4TMAB 2J0MA 2K5HA 4JBJA 4PZ8A 4LLGM 3D6WA 2D0PA 4X3KA 3AE3B 1LTRD 5IYBG 3AEFB 4KN7C 3MC9A 1FGBD 1L5PA 4WWMA 1V2YA 1GVPA 3T3OA 3NUHB 2VZAA 1WZ0A 5C3EH 4F1SA 4PMWA 4G50A 3J80E 4E3CA 2KLGA 4HTHA 4RCOA 2KDBA 3IT4B 4DU9A 2DX5B 4R8IA 2RBMA 3EGRA 4NQKE 3HOZH 1FEHA 2YTXA 1ENCA 1Y1VG 4XYQA 2UXDL 1G51A 3RNGC 1RYJA 1SJED 2MPMA 2N9PC 4JI2Q 3OTOQ 1WR1A 3R2IA 4GGQA 4MIUA 3WAPA 5C3JB 1F2RC 4A3GG 1WXQA 5E7NA 1J5EQ 2V4LA 4R3DA 4W9KA 1TY0A 3FPUB 3R3OA 2L00B 3PZ8A 4WJPA 1FYCA 3K58A 2Z6KC 2Q2HA 4GN3B 4KY5A 2EYJA 1Y1WB 1V9JA 2WDRB 3BK1A 2UU9L 2I46A 3QG1A 1YNJD 1JWMD 2KDEB 2INPE 2MP2A 4JI0Q 4L5SA 4GOPA 1Q5WB 4XTCS 2LY7A 3PT2B 3Q3JA 4KZ0A 4GLAC 4GLVB 4P74A 1HA6A 4FULA 1V1OA 1X3GA 4K5XA 4X57B 3PIP3 5BO4B 4A55A 1K52A 5DAUA 1SIFA 4J6IA 2IX1A 2MJEA 5IGDA 5JOBA 4F7XA 4ULLA 3NG0A 4EQNA 1PRTF 1Q1BA 4NP5A 4HJ5A 1XNQL 3CD6A 1IBMQ 1N33L 2E6XA 4C3HG 4F88A 4I7AA 3AFQA 2B2TA 4YTPB 3D0FA 2NPTB 3HUIA 4MSQB 4PMBA 4PT5A 1I4QA 4N59A 4DQOC 3DWAA 1SJHD 1BF4A 4CHKA 3KDFB 2KN4A 1FL0A 1Y69U 4Q0FA 1ESRA 2XIWA 4R4OA 3RCZA 1YJ1A 2R93G 2X8XX 1XLNA 2KC2A 5ISRA 1ZXHA 2KHJA 2Z4IA 4LW1A 2GOWA 2CWAA 4WURA 1TWAH 2RQXA 3G6EA 2J52A 3DBSA 1JT8A 2AL6A 2PQAA 3E9HA 4PZ6A 2C5CA 1ACCA 2RDBC 3TS0A 1RFAA 4REZA 3V3XA 1DOXA 5JHBA 2KUMA 4M1UB 2R92H 1VF5C 5EBDA 2PJHA 3E9SA 2ON8A 2DYOA 4A3DB 3ZGZA 1WX8A 1MBYA 5JZEB 3MJWA 3DBRI 3ITPA 4LFCL 3LXFA 1XMOQ 2HTME 4C3JB 1KNEA 2JP1A 1N60A 1TKYA 2K1BA 2YU9H 1BUIC 2X69A 4DV7L 1E7VA 5BMIA 1GJZA 2MGSA 1WGDA 5JPMC 3ZYYX 2WXNA 2DY8A 3TEXA 2A69C 1OTCA 2M00A 2BW2A 2WU5B 2BBCA 1RAXA 5CV7A 5IA7A 4MDKE 4L5RC 2JPHA 1M94A 4OIKA 3EFXD
chains in the Genus database with same CATH topology
4ZYSA 1HA5A 1ENAA 4RA8A 3FMCA 1CT1D 3KLSX 2V4DA 2QIEB 4N6EB 3HP3A 3P20A 1Q1EA 5KIXA 1WRIA 4B9XA 2WDVB 1JROA 5BYSA 3I3CA 2KA7A 4XE0A 2JWUA 5F2DA 1QNUA 3D4RA 2W55A 2CJNA 3TDQA 1EEFD 2D9UA 1EOTA 1EM7A 2FFKB 5CV8A 4BBRB 5CV5A 1FCLA 4IOIE 3PUZA 3L9AX 1L0YB 4M8AA 5JXVA 3I91A 2IJ0A 4IKGA 3DWPA 1J7BA 1B9NA 2BS3B 3CHBD 1GUTA 2PW9A 1BBXC 2A68D 5H8YE 3ZJTA 4EVOA 1U4RA 2K03A 4XT1B 1LTBD 1GUOA 1WTRA 3D6CA 4RGTA 4JK1C 4F8MA 2EDGA 3VYSA 1HZ6A 1XEEA 3B2FA 2B8GA 4MT5A 2NTSA 2KQ4X 3UI2A 4FF2A 4JX1C 2N9KA 1STEA 3AE1B 4WFN3 5TSSA 1VMPA 5EE1A 1K83B 1MHHE 5D14A 3KUPA 1PFNA 2RKSA 3BVGA 1QKZA 4DAYA 3W9CB 1TKWB 2WINB 2E2IB 1JQYD 1EY9A 1GUGA 2N88A 2L11A 4LJZC 4HEDA 1F9SA 1Q90A 1F2LA 3E56A 4ZOHC 4ABNA 1VLBA 4B9WA 2TSSA 2MHVA 5IODA 4B0EA 1ML0D 3DEOA 1PTOH 1G291 1SBBB 2F0OA 3AM9A 3TMEA 1RF2D 3TZUA 4CKCA 4JWUC 1V8CA 1UWXA 1JQ4A 1PXUA 1C78A 1Z47A 2C9OA 3AV8A 2QSDA 5D65A 4RAUC 4A3FB 1D5XC 2WNMA 2RPVA 3T56B 4C3IG 2HUGA 2MJDA 1VZ6A 3IAYA 4JBWA 4L1BA 2WXLA 5I2XA 5LNK1 4KD3A 2WXRA 2ACZB 5LL6S 1HXYD 4DXGA 3OW7A 5C0XG 3J7YW 3PMFA 2EELA 2AUKA 2L83A 3TSSA 4B08A 1ZP0B 2NVXB 2F0IA 1YN4A 4TQ1A 2E2DC 3T13A 1SDFA 4OVZA 4L63B 5C6AA 1UAPA 4HAEA 4WAFA 5M5WB 3RUZA 2WXQA 2IL8A 2JSVX 1LT3D 3BDLA 1JOOA 1WTWA 4QMGA 2KJXA 1EY5A 3H3VC 3KK7A 4PMCA 3OMCA 3KLRA 2Q8IB 2BCOA 3OHXC 2M9VA 2BE5C 3BVMA 5FLXL 2PMVA 5G3LF 1XLOA 4XYOA 1FNUA 3A7LA 1TR5A 1C77A 3Q8BA 1WD1A 1PRTB 1V43A 4FNFA 2F0VA 5JJZA 2F0PA 2LJIA 3MVVA 4HCEA 3B9JA 3BG3A 1QCBD 3U7ZA 3TP7A 1I4XA 3FRPB 2QKIC 5DM73 4H13C 1EEID 1VZ7A 3KBXA 1GUSA 1F2YA 2JXTA 4J6HA 5EKKA 1TS3A 4TKOB 2K04A 1D5ZC 5KYIA 3HRDD 2MJ3A 3AN1A 3T53B 2QF7A 4BWGB 1FRDA 2B2VA 1VCIA 1QLBB 3K7AB 1CFMA 1N61A 1XLPA 3RZDB 2PNRC 2JSOA 3S1NB 3O13A 1YQ3B 1K8MA 1LV9A 3K5MA 2F0HA 1Q8IA 1JE4A 5IGEA 1FIQA 3AE6B 4Y7NB 3EROA 5COYA 2CVRA 1VDVA 2IPKD 1DGJA 1XCTL 2JE6I 1KLGD 2F0WA 3CIRB 2NVTB 1OQQA 2Y5CA 2DWQA 2KDMA 5IGCA 5JAVA 2JQRB 4QF4A 3QOJA 1LTGD 1PRTD 1FD6A 3PO0A 3GV3A 3PO3B 1ET6A 4KJOA 3SE0A 3GTLB 5AUIA 1VF7A 3M85A 3HOXB 2FE8A 2WKDA 5LL6X 1MI0A 1OXSC 1SIJA 3IAM1 2Y0SB 3BYTB 3BVZA 1PTOC 4J8QA 3JAML 2F3WA 4HKQA 3S1RB 3HVDA 2B2YC 1SEBD 3CRKC 2K6AA 1A2TA 1FM0D 2HDEA 5EPJA 4IFDI 2LMCA 1SNDA 4CHTB 4A93B 4G7ZC 1L0VB 3H91A 5AFWA 3GQBA 2NBFA 1PMRA 1IW7D 5M3FB 4N58A 1DOMA 5HI1A 1M8AA 2W54A 5FR3A 2DBYA 2J42A 4XQQA 3GS2A 4RNAA 3AB5A 1FO4A 5KYLA 4KKTA 1MPEA 3Q69A 1LTSD 4QUFA 4DA2A 5A2QE 2PW5A 3OIPA 1HQRD 2D5GA 3NVYA 1OXVA 4P2CB 1N63A 1ZPSA 1F2MA 3LB8C 4KY6A 1CM9A 2EYPA 1E0BA 3S17B 5IT9L 1A15A 3C2PA 4N9TA 4EE2A 1TWFB 2EJMA 2IGDA 4EQPA 5C3XA 1EYCA 3L4PA 4K6DA 3FDTA 4HMJA 3VR3A 1R4QB 2A74C 3NBHA 1Q3LA 1Y8NB 3MTSA 2KWDA 2WP9B 3TEYA 2XWJB 1BNZA 5BYQA 4FP5D 1F9QA 2L55A 3I4NB 3EUB2 4KGSA 4RF1A 2V0GA 3X3NA 5C4ZA 4LAAA 2JA6B 1QILA 5EBCA 5C4XB 1F77A 1F2ZA 1YNJC 4P16A 5E4XA 2ZW1A 1I7HA 2AUJD 3GO5A 3Q8EA 1C4AA 3P75A 2MEKA 3OOCA 3VQIA 2PZTA 3RLFA 5EPLA 1BXTA 3A8JE 4H2AA 2IGHA 4AQ7A 1DD2A 4YIJA 4QIWB 2SDFA 1K8OA 1N5WA 2CW0C 2MUYA 2JZPA 1T5EA 2W3RA 3P4PB 4NW2A 4GZYC 2NB0A 3AECB 4X3SA 3ABVB 1SNOA 4X3TA 4KI0A 1XX8A 1KF6B 3M3YB 3HOWB 3GTJB 4N9PA 3R8BA 3BZDB 1QQRA 2LEKA 4NZLB 2GA4B 1IBXA 4C2MB 5C4HA 3AE2B 4U68A 1T5XD 5FO8B 2XVSA 1E2ZA 4MM3B 1DM0B 1ZYRD 2A5HA 4G57A 5JPNC 1A70A 2A6ED 1J9OA 2PVOD 2AX5A 4K8JA 1SYFA 2RDGA 4KHVA 1V8QA 2XN9C 2BS2B 5CBEE 1R9TB 1MHXA 1JCKB 3ZQ4A 2OEDA 1F9RA 1OXTA 3I73A 1TIID 1ZXTA 2IDYA 5T8IA 3KWLA 3NBIA 4IALA 2K5DA 4C56C 4L8JA 1UUPA 4AYBB 4ZLTF 4FF4A 1HQMC 1AWDA 1H9JA 5C5MA 3R93A 3TBIB 4LMQD 4V190 3OMGA 1KTKA 1S5CD 3QIAA 2FJ2A 5C5LA 1XO3A 2ZW0A 1C4QA 1EY7A 2VZKB 3VYUA 4KGTA 1AFPA 3IKJA 1I4GA 1F0ZA 1RHPA 2JX5A 1NEKB 5CMDA 3KLSA 1VZ8A 4OZBA 2JEBI 4XWWA 4BY1B 3HOVB 1XF5L 4YXDB 3N9YC 1C9FA 1SE4A 5G3LD 4G4KA 2KCCA 3NVWA 2WXGA 3NRZA 1SYGA 1PDXA 3Q8CA 4FO2A 2RA4A 2EYHA 1HUNA 1A3TA 3U2SC 1MSHA 4WRDA 2BB5A 3H6MA 2LMCB 2F0NA 4HEA1 3FILA 5I6WA 2WXPA 3SK4A 1FMAD 1E10A 2O5IC 3A8IE 1DOIA 1TKGA 3GTOB 3KWVA 3SK5A 1VDZA 2N7JA 1JALA 1SYEA 3U4EG 1SYBA 4C1NI 2J0TD 1LTTD 5I2YA 4GDLB 5CV9A 1LT4D 2VB3X 1JOKA 3T4AC 4K5VA 2WACA 4UAIA 3S1MB 2IGGA 2WLBA 5C0XJ 3C3LA 2EJGC 1XXGA 2BTEA 3E0JA 4QB4A 4HSPA 1AYFA 1H9SB 1CI3M 4B0MA 3W5VB 3AEEB 2BOSA 3AB9A 3WDNA 1F2RI 2AQ1B 5J39A 3A54A 1SYDA 1WWTA 2EXZA 4ILWA 2F0SA 3EA6A 3C1EA 2JA5B 1EY0A 1MGSA 3GTMB 1S5ED 4A3EB 3K59A 1NUCA 2BS4B 2NTTA 2KHSA 3TP6A 2PZWA 5KGUA 1K53A 4YTMB 3W5UB 2ENBA 4KKUA 1TQOA 3NP8A 1FR3A 5BYRA 4HCSA 2JA7B 1L6UA 4IUNA 3PUVA 3IL8A 2WP8J 3TUOA 2O4XA 3DXJC 4YT0B 5BMHA 3EVQA 2BT6A 1AW7A 3AH7A 2CU3A 2A6HC 4OGQC 5C0XH 1NSNS 5D3IB 2QJLA 4HSVA 1BOSA 3N52A 5C3WA 5J22A 3MAQA 2WU2B 3NXWA 1CA5A 3CKIB 1SB3C 1J8IA 4MHEA 1JWSD 4KTAA 3FC4A 3AMZA 3NZ3A 1QE6A 1FRRA 1HEZE 3G7LA 1L4ZB 1G8ZD 2SAKA 1TWGB 3RMHA 5I9PA 3NVVA 1DOLA 4ZKCB 2BA0A 4XT3B 3GTQB 3QOLA 1ZDVA 3NWSA 1A3UA 2E76C 1MVKA 1PUTA 3IFDA 2RSOA 4XXEA 1X3PA 4CKEA 1BCPC 1KRHA 2DLBA 2NN6H 3LX0A 1EWYC 4XIGS 2EKIA 1IBXB 2N55A 1QOAA 2JU6X 1B9MA 3BS1A 2OF1A 3NTHA 2WXOA 1HZ5A 4LK0M 1TS2A 1LTAD 5D3DA 1GPXA 1I4RA 2K28A 3H8HA 1YNNC 1S4ZA 2DY7A 1YN5A 3P63A 4DGZA 5C2TB 4TQUS 3HZXA 1B9RA 1NVID 1IKMA 1WTOA 1WTQA 5EGTA 2XNAC 1JORA 3OWFA 4IUTA 4RKLA 1HTPA 4J1MA 3I9V1 1PTOF 1C48A 2SNSA 2G9DA 2QEJC 2B2YA 4E6IA 1NAPA 1OFFA 4OZAA 1CZGA 4WORA 2B2TC 2HCIA 2B2WC 1C8CA 2BYTA 2Z4HA 4ARCA 1D4BA 1SXTA 3NHHA 3K57A 1RODA 5C3EB 3D4WA 1RWSA 2CQAA 1STNA 3DM1A 2F0TA 2E75C 2A69D 5CC4A 4JPSA 2VXWA 3KBGA 3HOZB 1WSPA 1EY4A 1PDQA 4NAWB 1M4VA 3AEGB 1IHZA 1RDPD 5FOBB 5GXGB 2XRSD 2N9LA 1OO9B 2IX3A 3W3AA 1W6KA 3S9WA 3OSOA 4D2KA 3A8KE 1K50A 4US8A 2E3TA 2WXMA 2F3VA 1AZQA 2SEBD 4ID6A 1XLQA 2PVGC 1S5DD 1Y8OB 1FCCC 1B44D 4YSYB 2NZ1D 4Q2JA 1CHPD 4TRDA 3FILB 1A3VA 4G7OC 1YJIA 4IUPA 2H89B 2B2UC 5HURA 2BDNA 4RWSC 1KABA 3W2DA 3AMUA 1TS5A 2E74C 1SMYC 1U4MA 4RHSA 3VYTA 3V05A 4IFDG 1O80A 1FNVA 1I6VC 1SE3A 2L32A 3GD7A 3SR6A 1G6ZA 1N62A 5ELEA 1WVLA 1WTVA 3SHLA 3HVZA 3HG9A 1TWAB 1HUMA 4KJNA 2O5JC 3C8YA 3FVQA 4NAMA 3MZ5A 2R92B 5M3MB 2LS01 1Q12A 3AEBB 3BDOA 4C7ZA 2PCFB 1H9KA 2LHEA 2F0QA 3T16A 4OW0A 2YU9B 2PPBC 4FXKC 1Z7TA 3ONAB 2QCPX 3OPOA 1AP0A 2I2YA 2LFIA 2YYZA 2WV6D 2KACA 5EE0A 2Q8TA 5EKLA 1HTLD 1TKEA 1WYGA 3SFDB 1NCVA 1JB3A 1UNSA 1DZ1A 1PFBA 3RZOB 1RD9D 2WAQB 4DNTB 3X3MA 4OO1H 1OXXK 3ND9A 3C1FA 2DYMA 2FMMA 4IURA 5LHY1 5ELCA 1ZE3D 4ITKA 4K14A 1ZOYB 1I50B 1YJJA 4DK1A 3U9SA 2ZT9C 1CZWA 1CA6A 4HN7A 1FFVA 1E2VA 4ZHPA 1F9PA 4HROA 1QOFA 3WOFA 1JWUD 2Y5PA 1QOGA 4FF1A 4LTUA 3T3NA 4A8XC 4BA2I 3MXNA 3DWGC 1LO5D 1TT2A 5T1IA 5K36H 2RVLA 3FKIB 4PNYA 5KRUA 4XDXA 4TQ0A 2Q8RE 2PMZB 5E3FA 4HJGE 5AUKA 3CRLC 1WTXA 1X32A 3DUZA 2W3SA 2F4IA 1EZ8A 1UGJA 1S5FD 1SNCA 3DWQA 2PO4A 2MH7A 1IL8A 1GHJA 4HKZE 2NN6I 2BDOA 4K6LA 4DAPA 2R61A 4IUUA 2JA8B 1VJKA 2K0PA 1CK1A 2K7VA 4V0BA 3FAHA 3SVMA 3DMUA 5HHDG 2EJFC 2PLPA 1FXIA 3TP5A 3Q24A 3AE9B 1SNQA 3A56A 3MWYW 4PQXA 3TEZA 1H9SA 2ICEC 2MP1A 1XYIA 4MN3A 5JEAG 1I3QB 1TVXA 3J80L 3W1SA 2PZUA 3G6JB 3P4RB 3J7AV 2NWGA 2PW7A 5BMGA 3U52E 1KLUD 4K2KA 2L52A 5HGTA 1GOZA 2R3ZA 4NMZA 1STHA 5ELFA 3RFZB 2J53A 1YQ4B 3D3RA 1W6JA 3NQTA 1IYUA 3E5SA 2FMCA 3F2UA 4RGOS 1GJXA 4A9AA 4FVMA 3J9CA 5FLXE 2EY5A 1PTOB 5ELDA 2WXIA 5MPOA 3QB3A 1Y56A 3MHZA 2E2HB 1DOYA 2V4IB 3VRAB 1JRPA 2PYKA 1EWHA 4FXGC 4C7YA 1DCZA 4FXCA 2I38A 1KDBA 1C4PA 2LHDA 5KNCA 3S2HB 1G2TA 1P7FA 2WXKA 1SE2A 3HOUB 1EYAA 1HCZA 5G5GA 4PV1C 2PKOA 3J81E 1D6EC 3C46A 1QT9A 3Q8AA 2OXPA 4FYDA 3AE8B 1R4PB 3ZJVA 1KFYB 4KGRA 2F0GA 3TEWA 1HPCA 4UDUC 2B2VC 1ILPA 3MJ5A 5J1ZA 3LWUA 3MXPA 3U9OA 1B3AA 1EYDA 3LNNA 4BBSB 4EQOA 3PO2B 4OHJA 4L6TB 3VA5A 2KOLA 1NR4A 1SAPA 4DFAA 5CORA 1GAQB 4KKIA 1A2UA 1QJOA 4NJCA 2F03A 5EJWA 3MP9A 1Q10A 1LT6D 1PFDA 3IXSA 1EZ6A 1EIGA 4H0LC 5EPKA 3NVZA 1PZKD 2WIIB 4A3KB 1PTOD 1RTNA 3VYRA 4JWSC 1JC7A 1XTCD 2KECA 3AE4B 4A3BB 2ZXRA 1EU4A 1Y8PB 4OL7A 1WGKA 2EE1A 1KDCA 4ZUJA 4RGNA 3JAME 1ZDXA 1QOBA 2PTLA 4K2LA 2X38A 3M7GA 4YTNB 5FO9B 4ZQ3A 3VR6A 2KEDA 3D8GA 3V2TA 1ENFA 2M19A 1SSOA 4KK7A 2M2LA 1WD0A 5HFYA 5T1GA 1B1ZA 1STGA 2EY2A 4OO1I 4CBVA 1BCPF 1SSNA 1TYGB 2EPBA 2K9XA 2MJ8A 3Q23A 2DNCA 2L4NA 1STBA 2A68C 2RMMA 1Z6HA 1IGDA 2F0LA 3PUWA 1N5XA 5G5HA 1JICA 4XQNA 2JYOA 1NENB 5I4DA 1DYQA 5IOCA 5IT9E 1D1IA 2KMMA 2F0EA 3DHQA 1E9MA 2FINB 1RCVD 5C44B 1PGAA 3HS0C 5C4JB 3K6OA 3MHBA 2ONQA 2F0UA 4IQZA 1RTOA 1TWHB 5DM63 4RGMA 1BUVT 3M7NA 2B39A 3D31A 3I8ZA 5IGFA 5FO7B 5KNBA 2J7ZA 4ARIA 3NWTA 2L5TA 4O42A 1TS4A 4BA1I 5IGBA 3AEDB 1EFID 1U4PA 3BWUD 1GUNA 3GB1A 3BK2A 3VA7A 1S5BD 1LT5D 2WXFA 2RDFA 1EU3A 2VZKD 1V1PB 2WXHA 2B2WA 1XWEA 2CW0D 1NR2A 3MXGA 3SR1A 3P1MA 4HR7B 3IT6B 3PUYA 1GUWA 5DEHA 1RKNA 4ZUIA 1EQTA 3S2DB 4XDDA 4HMIA 2BB6A 3B2GA 1E7PB 2ID0A 2SNMA 1YN3A 2M0AA 1STYA 1MD2D 2W82A 1D2BA 4WJWA 1X3QA 2K5PA 3VR4A 2Z1CA 1BDOA 4WH4A 1FXAA 2CJOA 1KNAA 2L12A 5ELBA 4USAA 3Q22A 3K5LA 4ZRQA 3OIQA 1KH0A 1L0XB 2RDHA 4IFDJ 1IKLA 3UI3A 3R2TA 3NTIA 2B2UA 1Y1VB 1EQVA 2WXJA 3AE7B 2OEOA 1NYRA 3AE5B 1QG7A 3L7ZC 1I4PA 1XCQL 2INNE 1D1KA 2EYOA 5M9OA 1FNWA 2X6LA 4A3GB 4KKSA 3EJIA 1OXUA 2K5QA 4MH8A 3N6RA 3GTGB 2QILA 5EQ0A 2FUG1 1QOHA 1ILQA 2Z8LA 2KCNA 1C76A 2K5WA 1T3QA 1ZKOA 3ETRA 4WIPA 4AS1A 2EY1A 1JR0D 2LGIA 2F1MA 1PLFA 3BIID 1IUEA 1IGCA 2H1EA 2F0KA 1B2TA 3Q8FA 4Q5VA 3J7AF 3S16B 3H94A 2WS3B 1V97A 3DWMA 4C3HB 4U673 1QF6A 4XDCA 4KD4A 3MFYA 2IWHA 5E4WC 2I07B 3CU7A 4IFDH 5BN4A 1BQQT 1U9RA 1A6XA 2JYEA 3D4DA 1BR9A 2R93B 1RM6C 1HHVA 1VR9A 5EKIA 3VR9B 1JOQA 1FFUA 1PZID 1J7CA 1ROEA 3BDCA 4YSZB 2DNEA 4CQNA 1UWMA 1HFGA 2AWNA 2VNUD 1E0ZA 2BA1A 2IW3A 5A35A 2J4XA 4A3MB 1MSGA 1LACA 4JE3B 5CGKA 3NUCA 3P7JA 1ONLA 4KHZA 4RH6A 2AQ3B 3MA2B 1II3A 4CJ2C 4OIJA 1CTMA 3MFGA 3SDZA 4BY7B 4J3OD 2OHFA 3V96A 2B63B 2EYFA 4Z9CB 1ZUD2 4TSSA 3PUXA 3VR8B 3S14B 1LABA 5BN3A 1PRTC 3PIO3 2OT2A 1SNMA 2AWOA 4A90A 3EQLC 2L0CA 3RPFC 4ODGA 1EY8A 2L1AA 1QB5D 1BCPB 4O1NA 2QMTA 4CJ0B 1H9MA 5JEAJ 3SK6A 1YMHE 3T51B 2NUCA 5K5PA 4A3JB 2L1BA 3NK9A 1BMLC 1QWYA 4LK1C 3MEHA 4RKBA 2GB1A 1G91A 5DNFA 3S1QB 3QWNA 1IYVA 5JVH3 1IW7C 2RSNA 1CQVA 5A2QL 2K01A 3SEBA 1B50A 4F87A 1PZJD 2F0MA 4I7ZC 4ZRPA 4IZ8A 1B4OA 4WQMA 1E6EB 5IGGA 2A6HD 2WKCA 3HEJA 4H44C 2YEPF 2M56B 3TN2A 4HRSA 3HRZC 2WQYB 2KVMA 4K8IA 5JVG3 4ZKBB 4ZAIA 4EGVA 1DXMA 2FBWB 4IUVA 3PV0A 3M4YA 5JEAH 5H92C 1STAA 2EY6A 2EYMA 1R7SA 1PYWD 2PIAA 4ZHOA 1CHQD 4A6QA 3K0YA 3HGBA 3KQ4A 1HFNA 2NN6G 2X6GA 4OZCA 1LTID 1BCPD 3A7AB 4DK0A 3E6ZX 1WCMB 3PZ7A 3MXUA 3S15B 1TY2A 4NDXA 1O7ZA 3J81L 1GB1A 2A73B 2K05A 1VMCA 2JEAI 2EVBA 3URYA 1B53A 4US9A 4I65A 4KX6B 2XSCA 2NMQA 2GRIA 3K5OA 5CYUA 1PFMA 4C3IB 3DEPA 2KQ3A 1JWAD 1YNND 2CHBD 1CZPA 5I9OA 5NUCA 3QJYA 1ZXIA 2KAJA 5C0XI 2D5DA 3TZDA 4L2YA 1SYCA 3I57A 1KAAA 2LUMA 3GV6A 3QO2A 1JMLA 3I72A 3AU7A 4K5WA 1KDAA 2VUMB 5KNDA 4XQJA 4L23A 5CV4A 4IDIA 4MACA 2IT1A 2JXMB 3CQZB 2K3UA 5CV6A 1ZYRC 3AEAB 3NSWA 3NQIA 2B8FA 2FHTA 4CKBA 1I6HB 2A6EC 2TMPA 4FXDA 2N0SB 3LYYA 4RHRA 3FPPA 2EZVA 4DF7A 4IN3A 4QUCA 1J7AA 1WTPA 1BO0A 4KY7A 1FD7D 5EE9A 3IFTA 4IUQA 5HG2A 1L4DB 3VRBB 3I4MB 3WOEA 4ZK9B 3MC0B 1V1PA 2HDMA 3SXHA 3VR5A 5IIFA 3Q0AA 2Q5WD 4G7HC 2ZXOA 3NS1A 3SFEB 2D62A 3LWEA 4FF3A 2K22A 2EYLA 1MI2A 2IX0A 1AZPA 4CJ1B 2G1EA 2Y3AA 2BE5D 2H88B 3P4QB 3I70A 5BN5A 3RD4A 2ICIA 4RCNA 4DXFA 4KV6A 2L9HA 1EIHA 5E6JA 2EOTA 1CQFA 4QCLA 3ZJUA 1ZEQX 1SMYD 3SK8A 2V3PA 1JWBD 2DN8A 1TU2B 4ZRZA 2WB1B 1T6BX 1DJRD 5FK9C 4H7BA 3VR2A 2HQEA 2VB2X 5E1FA 1PGBA 2GI9A 2QDBA 4CGYB 1EWCA 3CWIA 4KMUC 4YSXB 5M5XB 1E2WA 2PQEA 1QNKA 1GXDC 5CR3A 1ET9A 2F0JA 2H4OA 2WDQB 4GDKB 3ND8A 3P42A 1OQRA 1GHKA 1CJEA 4M0WA 1NI3A 2HDLA 4XWTA 3HKZB 3A55A 2NYZD 1SF0A 4OO1G 3WCQA 2K32A 1DOKA 4X3UA 1NYQA 2G9HD 4RFBA 4DNRB 3H09A 3BYYB 3P1HA 1RJTA 1EL0A 3L3OC 1O7YA 2SOBA 1RFKA 3FEWX 3K5NA 3HOYB 4C1NK 3TP8A 1HRJA 1GB4A 3OWEB 1L6VA 1JW9D 1C4CA 5KEEA 2LKVA 2R6GA 2K33A 1O78A 2R7ZB 2YEPB 3ERQA 1D5MC 3H0GB 2JYTA 4R9WA 3Q6SA 2AQ2B 1ICWA 5K36G 4KN4C 4BS9A 3GTKB 3GTPB 4NKLA 3NPPA 3I4LA 5FKAC 4DN4M 1H9RA 1G2SA 5M5YB 2F0DA 4S3SA 4YWGG 1ESFA 2V3NA 3NE5B 2B76B 1U4LA 1PGXA 1LLRD 1SNPA 1P7EA 4RF0A 5D7GA 4DAVA 2E2JB 1EY6A 1C79A 4GLSC 3NTKA 3P4SB 4R8NA 2ZXPA 3IAS1 1K51A 1TZOA 1TJEA 5I6YA 2KEEA 1AN8A 2D2CC 1AEXA 1TWCB 4P6VF 4A3IB 1YNTE 2XRQD 2HCCA 3M4OB 2NVYB 3KF8A 1VRAB 5EE3A 3I90A 3GP7A 1I4HA 2F0FA 1O7LA 2O2LD 4KKJA 1SFOB 2XWBB 1UEAB 2LFNA 4C80A 1DONA 4C3JG 2NVQB 5CBAE 4ME5A 4TMAB 4LLGM 3D6WA 4X3KA 3AE3B 1LTRD 3AEFB 4KN7C 1FGBD 1L5PA 4WWMA 3T3OA 3NUHB 4PMWA 3J80E 4HTHA 4RCOA 3IT4B 4DU9A 4R8IA 2RBMA 3EGRA 1FEHA 1ENCA 4XYQA 1RYJA 1SJED 2MPMA 3R2IA 4MIUA 5C3JB 1F2RC 1WXQA 4R3DA 1TY0A 3FPUB 3R3OA 3PZ8A 1FYCA 3K58A 1Y1WB 2WDRB 4KY5A 3BK1A 2EYJA 2I46A 3QG1A 1YNJD 1JWMD 2INPE 4XTCS 2LY7A 1HA6A 1V1OA 4K5XA 3PIP3 4A55A 1K52A 5DAUA 2IX1A 2MJEA 5IGDA 5JOBA 4F7XA 4ULLA 4EQNA 1PRTF 1Q1BA 4NP5A 2E6XA 4C3HG