4W9LA

Pvhl:elob:eloc in complex with (2s,4r)-1-((s)-2-((s)-2-acetamido-3,3-dimethylbutanamido)-3,3-dimethylbutanoyl)-4-hydroxy-n-(4-(4-methylthiazol-5-yl)benzyl)pyrrolidine-2-carboxamide (ligand 15)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
103
structure length
101
Chain Sequence
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGEGFTSQTARPQAPATVGLAFRADDTFEALIEPFSSPPELPDVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Guided Design and Optimization of Small Molecules Targeting the Protein-Protein Interaction between the von Hippel-Lindau (VHL) E3 Ubiquitin Ligase and the Hypoxia Inducible Factor (HIF) Alpha Subunit with in Vitro Nanomolar Affinities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords Transcription elongation factor B polypeptide 2
total genus 22
structure length 101
sequence length 103
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4w9lA00
4G11A 1WJNA 4TUUA 4DDGD 2JRHA 2LZ6A 2LUEA 3B1LX 3ZW3A 5CHVC 3RUIB 4XX5A 1KM7A 4I6LB 2C60A 1E5WA 2FCMA 5CTRC 4NAWB 2BYFA 2MP2B 2MBQA 1PQSA 1E90A 2D07B 3ZNGC 2ZEQA 4AJWA 4IM2A 4ZRKA 4ICVA 2BWES 4FHKA 2BGFA 4FHJA 1R4NI 1WJ6A 1WXAA 1WJ4A 1YD8U 2B3AA 4HDQA 4LJOB 4K1RB 2OOBB 2LJ5A 2FCSA 2HJ8A 3L16A 4BBNF 1QZEA 3H7SA 2K25A 2AEHA 1UELA 1WGDA 1WR6E 3M95A 4KZCA 4TV3A 3TBLD 2KVRA 3IG3A 4DHZB 5D2MB 1S3SG 1JRUA 1H8CA 3RCZA 4HCPB 2D2QA 2PE9A 3ZDMC 2LVPA 1Q5WB 3DBRI 2Z59B 4BFRA 5J17A 4ZDVA 3ENEA 3QHTA 2DAJA 2UYZB 3PLVA 4B6WA 3TL5A 3RD2A 1V6EA 4FJVB 2ZVOA 4BOSC 3ZNHB 3A9KB 4IC7B 1WF9A 2MLBA 2XK5A 2OJRA 3W1SC 1KOTA 3H9DA 1WZ0A 5DPRA 3KUDB 3O65B 3JYUA 4JGHB 3PRMB 2UWQA 4W9GA 2ZCCA 2KDBA 3H1UA 3VTWA 1Z2MA 3DVGY 3ZTCA 2J0KA 3CMMB 4JL9A 3JSVB 2MRPA 2DZIA 2XK5B 5L95C 2A4ZA 1EUVB 1OEYJ 2K1FA 2LRWA 3B08A 4ANVA 3W1SA 1WX9A 3QK0A 4CYEA 3A9JB 4KV2A 4WWOA 4W9EA 3ZDTA 4E74A 1E7UA 3AXCA 3V60A 4KSKC 3ZKJC 4PYZA 5CHWA 2J0MA 2NS5A 2ZCBA 5C23A 3T8MA 3KYDD 5D7GA 1WM3A 2DENB 3LDZE 2MBOA 3M62B 2RGFA 4RM9A 1J8CA 2XEWA 2DHZA 2GBKA 4LCDE 3A9JA 4RM8A 3PHXB 4M8MA 4BVUC 3K9OB 2K8HA 4GXBA 4X57B 1I42A 4G3XB 1EO6A 1YQBA 3TJPA 3DBLI 2GOWA 2O6VA 4IWOA 1WFYA 4IM0A 5FR6A 1WE6A 1UBIA 1E8XA 2BWFA 2JT4B 3B0AA 2L3ZA 2K6DB 4MH0E 5E6OA 1UD7A 2IZVB 4MGZE 2N4FA 4JIOU 2DZMA 4HPMB 3RZWC 3ML8A 1I35A 3OAWA 4PS3A 3EHVA 2I1KA 3SHQA 2MBBB 5DCNA 1TTNA 1E8YA 1YX5B 4URKA 3EC8A 4NQKE 3PSEB 2LI5A 2KJHB 1WYWB 4FA6A 2L8JA 4EZKA 4ASWC 3RULA 2GBRA 2LXCA 2EKEC 4XZ4A 5TR5A 3MJWA 3WALA 1WGYA 3IFWB 5DPSA 1GC6A 1Q0WB 2ZNVB 1WJUA 1E8ZA 3GOEA 3QAQA 4KZ0A 4W9FA 4FBJB 4W9KA 2LASA 2N9XA 2G3QB 2NVUI 2KANA 4CHKA 3X0WA 3A1QA 2NCNA 2R2QA 3IHPC 3NS8A 4ANUA 3PV1A 2RD0A 2KLGA 4E71A 4JLCA 3UIOB 2KMAA 2FUHB 4FLHA 4MSMB 2KC2A 2PPHA 2MP2A 4W9CA 4HLEA 2KTFA 3ML9A 1G6JA 2FIFA 2PJHA 2YVCA 2AL6A 3DVNU 1UZXB 3PGEA 3QC8B 2LD9A 4PYUA 3T9LA 1V49A 3A1QB 4HXDA 4F8CB 5AEKB 2KKCA 2ZNVC 3LJ3A 2D10A 4K81A 5JZEB 2M1MA 4FJZA 4FJYA 3RYTA 4MEMA 4HJKA 1A5RA 5EDSA 2KFJA 4WJQA 3PT2B 3UF8A 3QQ8B 2G4DB 1TGZB 2LVOA 3C0RB 2RPQA 4E3CA 3L0WB 2L0FA 5IAAC 4EOYA 2MCNB 3DVNV 4DK5A 3EECA 3ZIMA 2WX0A 1J0GA 1C3TA 2L0TA 2DYBA 5J2RA 2CHXA 2KLCA 1YIWA 2MW5A 1WGGA 2L7RA 3OJ4B 3VH3B 3ZLZA 5JHBA 3ZVVA 2DX5B 3QARA 4AJYB 5CHFA 4LDTB 4ICUA 1LM8B 4BKTA 3ZNZB 4AWJA 2JY6A 3R3MA 3DOWA 3R7QA 1X1MA 3AU4A 1Q1OA 2GBMA 2CKHB 2L76A 1Z5SB 2KJ6A 2VRRB 3DPDA 1BT0A 4N9F4 4W9HA 2MX2A 4GMVA 1WGHA 1E7VA 4CO7A 2KO3A 1RLFA 3DBHI 3DQVA 4BKSD 1LXDA 2CHWA 3R7RA 2LRUA 3V62A 3P2BA 3X23A 2FIDA 1GG3A 2N9EB 4EKUA 2KZRA 2NR2A 4MJSB 4WQOB 2JRIB 4HPLB 3HK0A 5AZGA 3KUCB 1D3ZA 4F7ZA 3DBSA 1T0YA 2IO3B 4K7WA 5AZHA 2JUOA 1Y8RC 3ZRFA 2PEAA 4G0NB 1EF5A 2CS4A 1OTRB 2KWUB 3UIPB 5J18A 2Z0EB 3NHEB 3VQIA 2C7NB 2PE6B 3R66C 2G45B 4NJ7A 3VUYA 1WZ3A 1SE9A 4DXAB 2KX3A 3L08A 3PS6A 3KH0A 2LGXA 2JPHA 1IPGA 1NBFC 1NDDA 2N1VA 3L13A 3PRZA 3ONSA 4I6PA 1TBEA 5D94A 1HE8A 3CSFA 4PS7A 5E6NA 4K7SA 2D11A 1IYFA 4NY0A 2KFKB 3CF6E 2KMCA 3N30A 4FADA 1GUAB 2O6VB 4GDLB 5G55A 3KVFB 1YJ1A 2MQJA 2MA9B 5JHAA 1E8WA 1NI2A 2V3SA 4ANXA 1FXTB 3KW5B 2QHOA 1MG8A 2G4SA 2JZZA 3NZSA 3TIXA 2EMTA 1VCBA 2KQ7A 3ALBA 3U7DA 3RZFA 1KJTA 2BKFA 2FCQA 2BPSA 5AZFA 2HTHA 5HKHA 2KC1A 3WAMA 1P98A 1WH3A 3CSTA 1VD2A 4M0WB 1S1QB 2AWTA 3ZTDA 2L00B 3VTVA 2KOXA 4XC2A 2ASQA 4M8NA 3A33B 3U8ZA 4OVUA 3Q3JA 5LLIA 3PZDA 1TZ1A 2RR9A 3S2AA 1WE7A 2KXJA 3KUZA 2JXXA 1ISNA 1J19A 2HD5B 2KK8A 1UBQA 3PHWB 4IM3A 5LXIB 3GZNI 4AUQC 4J6IA 3IBEA 3JW0X 2NBWB 2KWVB 1V2YA 2DYOA 2LGYA 1V81A 3WANA 4EZJA 3PRPB 2XBBC 3VUXA 2YLMA 2FAZA 2V1YA 2DYMA 2GMIC 4KVGB 1IP9A 1P9DU 5D6JB 3U30A 4AOFA 3VXWA 5G2NA 4ZRIA 4EUTA 3AU5A 2JVCA 3QA8A 4MDKE 2AL3A 1SIFA 2C7MB 4MELA 4MGKE 1UGMA 3PLUA 1P1AA 4ZRJA 4BKSA 1GJZA 2I1JA 2WDTB 3EFUA 4IWQA 4TQ1A 2N7EA 3PPAA 3MHSD 3MTNB 2IBIB 1V86A 3UGBB 1WX8A 4TQ0A 3TCAA 2IO1B 1V5TA 1U4AA 4ANWA 5KHQA 4TKNA 1LFDA 3AI5A 3HIZA 1KLVA 3APDA 1XD3B 2DZJA 4KDLB 2GBJA 2CU1A 2ZZPB 3KYCD 2O6VD 3M63B 4GU2A 3VTUA 1V9JA 2KDIA 3WIMA 3UQBA 3DDCB 5KHOA 1M94A 2K8BA 4WWPA 3VVWB 4MSQB 2FCNA 4YL8A 1AARA 3H7PA 3OJ3A 3PVLA 4A3OA 1WXVA 2N9PC 2N7DA 4GDKA 2GBNA 3DCGA 3AULA 2W9NA 3VUWA 1V5OA 3DVGX 4IW0A 3SD5A 1V80A 2IO0B 4W9LA 2KN5A 3ZUNA 3QIJA 1K8RB 4IUMB 3W1YA 2FNJB 2AYOB 3H6NA 4GIVA 3WAPA 2V4LA 2MWSB 4LDTD 3QWZB 4DWFA 3D32A 1F9JA 3V61A 2N1WA 5C1ZA 4WJNA 1EF1A 2KJRA 2REXA 3BINA 2EMSA 5DPWA 3RT3B 3V6CB 2M0XA 2M17A 3NOBA 1WX7A 1YX6B 2DAFA 2KWCA 1WMHA 4WAAA 2RSUA 3HHMA 2Z0DB 3PREA 4BKGA 2IY1B 1WI0A 3QJZA 5GMVA 4HK2A 4WJPA 2KX0A 2Y5BB 1OGWA 4NQLB 2K6QA 1WXSA 1WMHB 2M4NA 5IA7A 3QX1A 4FULA 4II3B 4MGIE 2MBHA 1ZW7A 4DBGA 4EZLA 2KHWB 4HDOA 4KDIC 4WJOA 3Q3FA 3N32A 2IY0B 1WM2A 1OEYA 1H4RA 4PS8A 3VDZA 3APFA 3TMPB 2J7QB 3I3TB 1L2NA 1LQBA 2JF5A 3UQAA 1XT9B 2WWZA 3UINB 5JH5C 4JQWC 2BYEA 4MGYE 2KQSA 2MSED 4EFOA 1WR1A 2IYDB 4I6NB 4B95A 4F1SA 2CR5A 1WRDB 4HCNB 4W9DA 3L17A 2ZJDA 5BO4B 3A4SC 4P7IA 3VFKA 3V6EB 2KD0A 2JWZA 3VAWA 4BBNC 4GSWA 1ZGUB 2NBUA 2WX1A 3NY5A 3NZUA 5DPTA 3JSVA 1UH6A 2MBEA 4NPNA 4GB9A 3ZNID 3ZO5B 4FN2A 4A3PA 4IG7B 2LXAA 1GNUA 2LWPA 3L10B 1WY8A 4DHJD 3ECIA 3IVFA 4MM3A 2JZ3B 1RAXA 5LXHA 1L7YA 5CX3A 3HM3A 4NJ6A 4W9JA 3M3JA 3VH4B 1OQYA 1CMXB 1XQQA 4GGQA 4KSLC 3L54A 3A9KA 5E6PA 4LJPB 3WA0A 4AP4C 4II2B 4HWIB 2M8SA 2L05A 2KDFB 4GOCA 2CHZA 3WAOA 3H7PB 2ZVNA 1ZKHA 4A20A 1P0RA 2IO2B 2NPTA 2C9WB 3SU8X 1SGHA 4B9KA 3OLMD 1R4MI 4GN1A 2BKRB 2KDEB 4ZYNA 4DHJB 4NNJB 2C7HA 2ZPNA 4IWPA 2K8CA 3N3KB 4HVBA 4KIKB 3K9PB 4DDID 2C5LC 2BF8B 5L83A 2NPTB 3QCAA 2KTRA 2O2VA 3A4RA 4MJSA 2KFKA 4G50A 2NBVB 2D3GA 4GDLA 2DZKA 3VHTC 1RRBA 1WGRA 3JVZX 1WXMA 4KIKA 2BYVE 3HM6X 4GDKB 2KTRB 2O2VB 4BOZB 4DHZE 3BY4B 3APCA 1C1YB 2WYQA 2J0JA 4RMAA 4WWNA 3ZRCA 2HE7A 4K7UA 2A5UA 1P3QU 3SDLC 2LGDA 2KNBA 2ZPYA 3PTFC 4OVVA 1GC7A 2LVQA 1RFAA 1WIAA 2R2OA 4NAWA 4W9IA 2K39A 4EEWA
chains in the Genus database with same CATH superfamily
4DDGD 2LZ6A 4JX1C 3RUIB 2C60A 1E5WA 5CTRC 4NAWB 4RGOS 1C77A 2MBQA 2QC8A 5EE1A 1ZPSA 1EU4A 4ZRKA 4ICVA 2VZKD 1LO5D 3E9SA 4FHJA 2PW9A 1IGCA 1R4NB 3W5VB 4LJOB 2OOBB 2LJ5A 4BBNF 2HJ8A 4C4VB 4EE2A 4TV3A 1HQRD 3IG3A 4ZOHC 3BYTB 1H8CA 2DNFA 3PZ7A 4P1BC 2WXRA 1YQ4B 4BFRA 2Z59B 4ZDVA 3ENEA 5BYSA 1HEZE 2DAJA 1F2RC 2ZVOA 4C56C 4JWUC 2XK5A 1CJEA 2WU5B 3O65B 3PRMB 4LNFA 2MHJA 3SFEB 1Z2MA 3ZTCA 2J0KA 1OQQA 1NYRA 1N6ZA 2PTLA 3W1SA 4E74A 1WWTA 2MBOA 3M62B 4M8MA 4BVUC 4X57B 2INPE 1J7CA 1E8XA 2JT4B 4MH0E 5E6OA 2IZVB 2CJNA 3RZWC 3TUOA 3EHVA 1GB1A 3U4EG 3DWMA 1L4ZB 1D4BA 2V3PA 4FA6A 2L8JA 2GBRA 2LXCA 4XZ4A 1FCLA 1WJUA 1F52A 4KZ0A 1YJIA 4FBJB 4W9KA 2N9XA 1CZPA 3ZGZA 1E7PB 4JLCA 4YWGG 2KMAA 4MSMB 4FLHA 4C80A 2PPHA 1JW9D 2PJHA 3QC8B 1UZXB 3NVYA 1V49A 4HPPA 4HXDA 4F8CB 3DHIC 2KT7A 4D2KA 2QIEB 2BS4B 4HJKA 1A5RA 1DYQA 2SEBD 4LNNA 3UF8A 2QCZA 2RPQA 2WXLA 3L0WB 2L0FA 3EECA 1DOIA 1F1HA 2KLCA 1YIWA 2MW5A 1PGBA 2L7RA 3P4PB 3ZVVA 1C4CA 2INDC 4HKQA 2BQQA 1IBXB 4BKTA 5FKAC 3ZNZB 3R3MA 1X1MA 1FMAD 3AU4A 1Q1OA 2Y3AA 4NJCA 3DPDA 2KJ6A 2LHDA 4N9F4 1BT0A 4W9HA 4CO7A 1E7VA 2KO3A 1RLFA 2LRUA 3V62A 3U7ZA 3X23A 2FIDA 1GG3A 3Q3NC 4EKUA 2WNMA 1E0ZA 2NR2A 4MJSB 4WQOB 3HK0A 3KUCB 4F7ZA 2XN9C 4K7WA 2PEAA 2WXJA 2KWUB 4P1CC 3UIPB 3V3XA 4ZYSA 4US9A 2PE6B 4NJ7A 4DXAB 3PS6A 3GE3C 3URYA 4ZRPA 3L13A 4I6PA 1TBEA 3W9CB 1HE8A 2J53A 1TY0A 4PS7A 1UNSA 5E6NA 2D11A 2HDEA 1YJ1A 2MQJA 1NI2A 2V3SA 1FXTB 1TJEA 2QHOA 3TIXA 1UGJA 1T3QA 3U7DA 2FCQA 5HKHA 3VTVA 2ASQA 4M8NA 3U8ZA 2K3UA 3Q3JA 3PZDA 4C4VA 1KF6B 1T5XD 2JXXA 3AE1B 4A6QA 1C9FA 2KK8A 2J52A 3AE5B 3GE8C 5HHDG 4IM3A 3GZNI 4YSZB 5GXGB 3IBEA 4L2YA 2RPVA 2KWVB 2DYOA 2LGYA 1V81A 2XBBC 2INCC 3VUXA 2FAZA 3AEBB 2GMIC 1V1PB 5D6JB 3VXWA 4ZRIA 3AU5A 3QA8A 2GLSA 3OG5A 2JZPA 1P1AA 2L1AA 3W5UB 3PPAA 4UDUC 1V86A 4TQ0A 4RGMA 5KHQA 2ICIA 3HIZA 2IGGA 3APDA 4LNOA 3AM9A 4ITKA 3M63B 3UQBA 3NZ3A 4JE3B 4ARIA 3SFDB 3VR9B 3I9V1 5HG2A 2K8BA 1SE3A 2FCNA 3SR6A 4YL8A 2W82A 4GDKA 2HJ1A 3SD5A 3NS1A 4C00A 4W9LA 3ZUNA 4IUMB 3NUHB 4GIVA 2V4LA 1HTOA 2V0GA 5C1ZA 3LYYA 1TIFA 2KJRA 2REXA 5C3JB 3V6CB 2YEPF 2KWCA 4RF0A 2K22A 2Z0DB 3HHMA 2W3SA 1JRPA 4HK2A 2Y5BB 5IKCM 4NQLB 1WMHB 1GPXA 3QX1A 2WXNA 4MGIE 2MBHA 2KHWB 1KTKA 1Y56A 2Z8LA 3P4QB 1H4RA 3NVWA 3TMPB 2J7QB 1L2NA 1LQBA 5LNK1 2PMVA 4C7ZA 3UQAA 4DXFA 5JH5C 4JQWC 2JU6X 2BW2A 4I6NB 2MJDA 2M0AA 4RF1A 3L17A 5G5HA 1AYFA 3VFKA 3V6EB 3CWIA 3I5JC 5DPTA 3JSVA 3P63A 2LXAA 3L10B 1WY8A 4DHJD 2JZ3B 1L7YA 4LNIA 3Q3MC 2G9HD 1XQQA 4B0EA 1OFFA 3A9KA 1D5XC 3L54A 4LJPB 5E6PA 4USAA 4GOCA 1KRHA 1SGHA 2IDYA 4DHJB 1JROA 3DWGC 4IWPA 2K8CA 3N3KB 1NVID 2NPTB 2KTRA 2L32A 3U2SC 3VR8B 1WGRA 1RRBA 2BYVE 1TS4A 4WWNA 2J0JA 1ET6A 3ZRCA 4K7UA 3RN9C 2LGDA 3J9CA 1RM6C 2R2OA 3AE9B 3AB5A 4WJPA 2K39A 3IT4B 2L83A 2JRHA 4YTMB 1NEKB 1GOZA 5EE0A 1FM0D 4RGTA 1RFKA 2BYFA 2MP2B 2M19A 1FNVA 4N6EB 2QJLA 1AW7A 2BBCA 1E90A 2D07B 2ZEQA 1ZXHA 4IM2A 1FNUA 1WJ4A 3VRAB 4XGAB 1YMHE 4OW0A 2H88B 1P7FA 1UELA 3MC8A 4AQ7A 1S3SG 1JRUA 3ZDMC 2LVPA 2QILA 3QHTA 4B6WA 2BS2B 2N7JA 3RD2A 4FJVB 4JWSC 4IC7B 1WF9A 2MLBA 3H9DA 1WZ0A 3KUDB 3JYUA 4JGHB 2ZCCA 2KDBA 3ABVB 3VTWA 1JWAD 3DVGY 3CMMB 1ZOYB 2MRPA 2DZIA 1EUVB 4YTNB 2PKOA 4ANVA 2R61A 1STEA 3QK0A 4CYEA 3A9JB 4N59A 3AXCA 5G5GA 3T8MA 3KYDD 1B1ZA 2DENB 3LDZE 5BMHA 2BYTA 1I4HA 4RM8A 1ZUD2 3IT6B 1XLNA 2LGSA 3GP7A 1YQBA 2O6VA 1WE6A 2LHEA 3B0AA 3BYYB 2K6DB 2VH2A 4MGZE 3HVZA 3MFGA 3TEXA 1E8YA 3MHZA 3Q8CA 3EC8A 5JXVA 5TSSA 4ASWC 3WCQA 1I4PA 3IAM1 1P7EA 2IJ0A 1N60A 1HZ5A 1VRAB 2KANA 4CHKA 4NAMA 3X0WA 1TS3A 1YJJA 4ANUA 4E71A 2K0PA 3UIOB 1F77A 1DOXA 2Y5PA 4OVZA 4W9CA 1L0VB 3Q2AC 2KTFA 4XDCA 1N5WA 1QKZA 2JQRB 4PYUA 2YVCA 3DVNU 3PGEA 5AEKB 3A1QB 2KKCA 2ZNVC 3LJ3A 2D10A 4OZCA 4K3CA 4TSSA 2M1MA 4FJZA 3RNEC 5JZEB 1CK1A 4MEMA 2KFJA 1ZDXA 1TGZB 3C0RB 4HROA 4E3CA 2MCNB 3DVNV 3ZIMA 3BVZA 2L0TA 3AV8A 2DYBA 5J2RA 1WGGA 1C4AA 5D3DA 5JHBA 2DX5B 4J3OD 4AS1A 3AECB 3R8BA 1AWDA 2JY6A 1AN8A 2AX5A 2PLPA 1Z5SB 1WGHA 1LXDA 1ROEA 1FEHA 2I2YA 4HPLB 5AZGA 4TMAB 1K53A 5AZHA 2JUOA 3ZRFA 4G0NB 1BMLC 3DHHC 2EELA 3NHEB 2C7NB 2FUG1 3VUYA 1WZ3A 1SE9A 2K5PA 1IPGA 3PRZA 2N1VA 3R2IA 1F2RI 1F0ZA 2BS3B 3CSFA 1DOYA 3N30A 4FADA 2O6VB 4GDLB 2V4IB 3KVFB 2KVZA 4L23A 3NZSA 1VCBA 1KJTA 2BKFA 2BPSA 2HTHA 2KC1A 3WAMA 5IN7A 1WH3A 3CSTA 1VD2A 2WGSA 3AE7B 3L4PA 2L00B 4XC2A 1M4VA 2MJEA 4OVUA 1GB4A 2KN4A 3FILB 2KXJA 4A55A 3BZDB 3KUZA 1WYGA 1ISNA 3LXFA 2RDHA 3LB8C 5LXIB 3C8YA 4AUQC 4LTUA 2JX5A 3JW0X 1RYJA 2NBWB 1ZP0B 1V1OA 4EZJA 1YN3A 4LK0M 5BMIA 2TSSA 4K3BA 2V1YA 2LJIA 1I4RA 1IBXA 3U30A 2LMCA 1UGMA 2UU7A 4BKSA 1GJZA 2I1JA 2WDTB 4N58A 5BYQA 3MTNB 2IBIB 3UGBB 3TCAA 2IO1B 4RH6A 1QF6A 1C79A 3RNCC 3AEGB 2BB6A 4A8XC 2DZJA 3AEDB 2ZZPB 2O6VD 2KDIA 3WIMA 1TS5A 2WXOA 1M94A 4WWPA 1OQRA 4A3OA 2N7DA 2GBNA 3DCGA 3AULA 1V5OA 1V80A 2KN5A 1K8RB 3W1YA 3H6NA 1HTQA 4IKGA 5FK9C 1ESFA 4LDTD 4MH8A 1EF1A 2EKIA 3BVGA 2WS3B 3N9YC 2M17A 3NOBA 1WX7A 3AE3B 2D3AA 3OWEB 2IY1B 3MC0B 1WI0A 5GMVA 3RI7C 4FULA 3IXSA 4II3B 1ZW7A 4DBGA 4EZLA 5EE3A 2WP9B 2QSDA 1PDXA 4HDOA 2IY0B 4NZLB 1NI3A 1WM2A 1OEYA 3Q8EA 3AE4B 2SAKA 3MP9A 4RCOA 3UINB 1KFYB 1SE4A 4EFOA 1SEBD 3EGRA 2WXIA 4B95A 1FFUA 3A4SC 2KD0A 4BBNC 1ZGUB 1LGRA 1PGXA 4GB9A 4A3PA 3ZO5B 3ECIA 3N1XC 3HM3A 1I4XA 3KLSX 4GGQA 2KDFB 3H7PB 1XO3A 4A20A 1MPEA 2C9WB 3RFZB 4B9KA 4A90A 4GN1A 2BKRB 2KDEB 4YSYB 1R7SA 1C78A 4ZYNA 1HZ6A 1WRIA 2C7HA 4HVBA 3K9PB 4DDID 2BF8B 2FE8A 1J7AA 3AEFB 3QCAA 2KDMA 2O2VA 2KFKA 1TKGA 4G50A 4GDLA 3BWUD 3VHTC 1WXMA 3Q69A 4GDKB 3APCA 1C1YB 2NMQA 2WYQA 2HE7A 1XEEA 1P3QU 1D5ZC 1ET9A 2IPKD 3PTFC 1N63A 1GC7A 2LVQA 1WIAA 4NAWA 4W9IA 5IP4D 4G11A 4XE0A 2LUEA 3B1LX 4XX5A 2B76B 2FCMA 3ZXRA 1PQSA 4P16A 3ZNGC 4XWTA 4FHKA 3TEYA 2BGFA 4YTPB 1WJ6A 2WLBA 1YD8U 4HDQA 2B3AA 4WH4A 2FCSA 3L16A 1VLBA 1UF0A 3H7SA 3NG0A 1WR6E 4KZCA 3M95A 4HJGE 2KVRA 4S0RA 3RCZA 3AEEB 3HVDA 1Q5WB 3DBRI 5J17A 4FXCA 3TL5A 3GZNB 4ARCA 2PVGC 1D5MC 2OHFA 3A9KB 1KOTA 2BB5A 1D6EC 2WXMA 1VZ7A 5DPRA 2UWQA 4W9GA 3R2TA 1PFDA 2BVCA 4JL9A 3JSVB 2XK5B 3N20C 1OEYJ 3B08A 4WIPA 4W9EA 2KACA 1E7UA 3V60A 4KSKC 3ZXVA 2J0MA 2NS5A 2LGIA 3UI3A 5IO9A 3O13A 1EM7A 2RGFA 4RM9A 1J8CA 2XEWA 2DHZA 1DGJA 2GBKA 4LCDE 1T0SC 1VDVA 3PHXB 2K8HA 4GXBA 3RNBC 1I42A 4G3XB 3KQ4A 3TJPA 2GOWA 4IWOA 1WFYA 1UBIA 3FC4A 3RPFC 2XNAC 1UD7A 4KX6B 3NJTA 2N4FA 2KYWA 2DZMA 4JIOU 3ML8A 3SHQA 1TTNA 3W2DA 4URKA 3DBHB 2LI5A 1YQ3B 2X38A 3AE6B 3VRBB 3RULA 2EKEC 5TR5A 3MJWA 3WALA 1WGYA 1MFWA 2AQ3B 2ZNVB 2OEDA 1YN5A 2DBYA 2W3RA 4W9FA 1TS2A 2G3QB 2NVUI 1E10A 3IHPC 2RD0A 2KLGA 4WURA 3E56A 1JWMD 2WXFA 2MP2A 2FIFA 3W1SC 2LD9A 2ONQA 2D3BA 4H2AA 4K81A 4FJYA 3RYTA 4WJQA 3PT2B 1MI0A 2LVOA 4XWWA 1E9MA 4DK5A 1L0XB 2N9LA 1MJDA 1C3TA 4KKIA 1PGAA 4Q2JA 1T6BX 3VH3B 1FRDA 3QARA 4AJYB 1SB3C 3AEAB 2KAJA 1FNWA 3DOWA 2GBMA 2CKHB 2VRRB 1IUEA 2LFIA 4BKSD 2CHWA 1QILA 1BUIC 1RWSA 2JRIB 1D3ZA 3AE2B 3DBSA 2NTSA 3NVVA 2H89B 1OTRB 5J18A 3R66C 2G45B 5H92C 3KH0A 2LGXA 2JPHA 5D94A 1QOBA 2JWUA 1WXQA 4OZAA 4M01A 2KFKB 3CF6E 2KMCA 1GUAB 2MH7A 2G1EA 5G55A 1E8WA 4ANXA 5MPOA 4M00A 1MG8A 2G4SA 2LUMA 3ALBA 3N1ZC 1YOVB 3TSSA 2NTTA 5HFYA 4M0WB 1S1QB 1C76A 2AWTA 3ZTDA 1A70A 2KOXA 1R4MB 1FO4A 3A33B 3BIID 1FIQA 4PT5A 1NYQA 1ZE3D 3P4SB 1WE7A 3ETRA 4ZHPA 1NENB 3DBRB 3B9JA 1J19A 1GAQB 1TKEA 1UBQA 3ZJUA 2LEKA 1V8CA 3WANA 2YLMA 3SEBA 2DYMA 4BZAA 4KVGB 1IP9A 1P9DU 4EUTA 2AQ2B 2ZW1A 1ACCA 2AL3A 2C7MB 3GS2A 4MELA 4MGKE 1QOAA 1FPYA 3PLUA 1C4PA 4ZRJA 1EU3A 4GLSC 3EFUA 4TQ1A 3MHSD 2MEKA 1XXGA 1U4AA 4ANWA 1EWYC 1LFDA 2QEJC 4MM3B 1XD3B 1WSPA 1QOGA 4KDLB 1T0RC 2GBJA 2CU1A 2INNE 3KYCD 3VTUA 5KHOA 1BXTA 1AARA 3PVLA 1SJED 2N9PC 2D3CA 3VUWA 2W9NA 3DVGX 2ZW0A 2CU3A 2IO0B 2E3TA 2KMMA 1JWBD 2AYOB 2GB1A 3WAPA 2MWSB 2E6XA 1L4DB 4WJNA 3NVZA 2EMSA 2WXPA 2DAFA 5BYRA 4WAAA 2RSUA 1ZDVA 4C7YA 3QJZA 2PIAA 2RDBC 3ZQ4A 4QAYA 1WXSA 2M4NA 4KDIC 4WJOA 3N32A 1WGKA 1UWXA 3VDZA 1XLPA 1XT9B 2WWZA 4MGYE 2BYEA 2KQSA 2CJOA 1L5PA 4F1SA 1WRDB 4HCNB 4LLGM 5BO4B 2ZJDA 1KLGD 1K50A 2JWZA 3VAWA 2NBUA 3NY5A 2IGHA 3C19A 3ZNID 1K51A 4IG7B 1GNUA 1XLOA 1EWCA 1RAXA 1MVKA 4NJ6A 4W9JA 3M3JA 4HEA1 1YNTE 1OQYA 1CMXB 4KSLC 3WA0A 1FXAA 4AP4C 2RMMA 4II2B 4HWIB 5I4DA 2Y5CA 2L05A 2KWDA 3WAOA 2CHZA 1ZKHA 2IO2B 3SU8X 1R4MI 1SBBB 1L0YB 1UUPA 4KIKB 5L83A 2N0SB 1TYGB 1SF0A 3A4RA 1I4QA 1SIJA 2NBVB 3JVZX 4B0MA 3DHGC 2WHIA 2KTRB 4DHZE 3B2GA 1FXIA 1TT5B 2KNBA 2ZPYA 3H8HA 3AN1A 3FAHA 4HKZE 4ZRQA 4A9AA 1WJNA 3HRDD 4TUUA 4L1BA 1SE2A 3ZW3A 5CHVC 3EFCA 1KM7A 4I6LB 4KGTA 3Q3OC 3Q8AA 3CIRB 4AJWA 4KGRA 2BWES 3B2FA 4M0WA 1R4NI 1TY2A 1CQVA 1WXAA 4K1RB 1QZEA 2K25A 2AEHA 3TBLD 1TZOA 1WGDA 4DHZB 4KGSA 5D2MB 1FRRA 4BAXA 2ON8A 4HCPB 2D2QA 2PE9A 1VZ6A 4ZHOA 2UYZB 4YT0B 3PLVA 1V6EA 4BOSC 3ZNHB 2OJRA 4OHJA 3P4RB 4XDDA 3AE8B 1KLUD 3Q8FA 3Q14C 3H1UA 3TEWA 3AMZA 3PZ8A 2M56B 2A4ZA 2K1FA 2LRWA 1WX9A 4KV2A 4WWOA 3ZDTA 3ZKJC 4PYZA 5CHWA 2ZCBA 5C23A 5D7GA 1WM3A 3KWLA 1QOFA 5C2TB 1IGDA 3A9JA 2QDFA 2WU2B 1JWUD 3K9OB 1VZ8A 1EO6A 3DBLI 4IM0A 5FR6A 1ENFA 2BWFA 1JMLA 2L3ZA 2WDVB 3N1YC 1VR9A 3BK2A 4HPMB 1I35A 4R3DA 3OAWA 4PS3A 2I1KA 2MBBB 5DCNA 1YX5B 4NQKE 1XLQA 2V3NA 3PSEB 2KJHB 1WYWB 2K9XA 4EZKA 1QT9A 4RNAA 1I7HA 3IFWB 5DPSA 1GC6A 1Q0WB 1E8ZA 3QAQA 3GOEA 2LASA 2YEPB 2GI9A 3A1QA 4IOIE 2NCNA 2R2QA 3NS8A 3PV1A 2FUHB 2KC2A 4HLEA 3ML9A 1G6JA 3T9LA 2AL6A 5IA7A 5L95C 3NRZA 1QQRA 5EDSA 3QQ8B 2G4DB 1KH0A 3ZJVA 2VH1A 4EOYA 5IAAC 3ZYYX 5D3IB 2WX0A 1J0GA 2CHXA 1SXTA 3OJ4B 3ZLZA 3Q6BA 5CHFA 4LDTB 4ICUA 1V1PA 4S17A 1LM8B 1N61A 4AWJA 3R7QA 1N62A 1V97A 2L76A 4WWMA 4OZBA 2MX2A 4GMVA 3DBHI 3DQVA 4YSXB 2MJ3A 3R7RA 4HRSA 3P2BA 2N9EB 2KZRA 2WXHA 5IOIA 1T0YA 2IO3B 3U52E 1Y8RC 1EF5A 1HXYD 2CS4A 2JYEA 1XCTL 2DLBA 2Z0EB 3VQIA 1FD6A 2KX3A 3L08A 4MACA 1NBFC 1NDDA 3ONSA 1E6EB 4K7SA 3ZJTA 4NY0A 1VJKA 1IYFA 4ACFA 5EE9A 4REZA 2MA9B 5JHAA 3GB1A 2WXKA 3KW5B 1L6UA 2JZZA 2L52A 2EMTA 2KQ7A 3RZFA 5AZFA 2VZKB 2X8XX 1MHXA 2JSVX 1P98A 2ACZB 3AH7A 3P1MA 3KWVA 4XYCA 3T3NA 2J42A 5LLIA 1TZ1A 2RR9A 3S2AA 2Q5WD 4LNKA 2IGDA 4RFBA 2HD5B 3PHWB 3FILA 4J6IA 2OJWA 4IDIA 5AUIA 1V2YA 1JALA 1UWMA 3PRPB 2FBWB 2KQ4X 2JXTA 3TEZA 4AOFA 5G2NA 1ZXIA 2JVCA 1SJHD 4MDKE 1SIFA 4MT5A 1SSNA 4WQMA 4IWQA 3RMKC 2N7EA 1WX8A 5FR3A 5T8IA 5H8YE 2WDQB 1V5TA 1MG4A 2W54A 4TKNA 3AI5A 3RNAC 2V9HA 1JQ4A 1KLVA 4JPSA 4GU2A 1V9JA 3DDCB 4KKJA 3VVWB 4MSQB 1QLBB 3OJ3A 3H7PA 1WXVA 4IW0A 3QIJA 3I57A 2FNJB 2WDRB 4O1NA 3QWZB 4DWFA 4YXDB 3D32A 1XF5L 2D5GA 3I63C 1F9JA 3V61A 2N1WA 3BINA 3MJ5A 3V05A 1PUTA 5DPWA 3RT3B 2M0XA 5AUKA 3DBLB 1YX6B 1WMHA 1J7BA 3PREA 3HUIA 3IAS1 4BKGA 2N9KA 3BK1A 1JCKB 2KX0A 1HA5A 1OGWA 1JWSD 2K6QA 3EUB2 2WQYB 3Q3FA 3P42A 4PS8A 4WAFA 3APFA 4DQOC 1XCQL 3I3TB 1L6VA 2JF5A 3RNGC 4DXGA 2MSED 2PVOD 4PK1A 1WR1A 2IYDB 1FCCC 2CR5A 4W9DA 2WXQA 3RNFC 2BT6A 4P7IA 4CQNA 3BVMA 4P6VF 2JYTA 4GSWA 3NZUA 3T3OA 1MHHE 2WX1A 3PO0A 4US8A 1UH6A 2MBEA 1TKYA 4NPNA 4FN2A 2RDGA 2LWPA 4MM3A 3IVFA 2BTEA 1K52A 2HTME 2AQ1B 5LXHA 5CX3A 3MC9A 3FKYA 3VH4B 2GRIA 4RGNA 2W55A 1I4GA 2M8SA 5BMGA 2ZVNA 1P0RA 2NPTA 4M02A 1T0QC 3OLMD 1B9RA 5HI1A 1N5XA 2QMTA 4NNJB 2ZPNA 2C5LC 2WXGA 2DWQA 4MJSA 2D3GA 2DZKA 1Q10A 4KIKA 3EA6A 3HM6X 2O2VB 4BOZB 1FFVA 4RMAA 3BY4B 2A5UA 3SDLC 2I38A 4OVVA 1RFAA 5E6JA 1YN4A 1PYWD 3Q8BA 2J4XA 4EEWA
chains in the Genus database with same CATH topology
4G11A 1WJNA 4TUUA 4DDGD 2JRHA 2LZ6A 2LUEA 3B1LX 3ZW3A 5CHVC 3RUIB 4XX5A 1KM7A 4I6LB 2C60A 1E5WA 2FCMA 5CTRC 4NAWB 2BYFA 2MP2B 2MBQA 1PQSA 1E90A 2D07B 3ZNGC 2ZEQA 4AJWA 4IM2A 4ZRKA 4ICVA 2BWES 4FHKA 2BGFA 4FHJA 1R4NI 1WJ6A 1WXAA 1WJ4A 1YD8U 2B3AA 4HDQA 4LJOB 4K1RB 2OOBB 2LJ5A 2FCSA 2HJ8A 3L16A 4BBNF 1QZEA 3H7SA 2K25A 2AEHA 1UELA 1WGDA 1WR6E 3M95A 4KZCA 4TV3A 3TBLD 2KVRA 3IG3A 4DHZB 5D2MB 1S3SG 1JRUA 1H8CA 3RCZA 4HCPB 2D2QA 2PE9A 3ZDMC 2LVPA 1Q5WB 3DBRI 2Z59B 4BFRA 5J17A 4ZDVA 3ENEA 3QHTA 2DAJA 2UYZB 3PLVA 4B6WA 3TL5A 3RD2A 1V6EA 4FJVB 2ZVOA 4BOSC 3ZNHB 3A9KB 4IC7B 1WF9A 2MLBA 2XK5A 2OJRA 3W1SC 1KOTA 3H9DA 1WZ0A 5DPRA 3KUDB 3O65B 3JYUA 4JGHB 3PRMB 2UWQA 4W9GA 2ZCCA 2KDBA 3H1UA 3VTWA 1Z2MA 3DVGY 3ZTCA 2J0KA 3CMMB 4JL9A 3JSVB 2MRPA 2DZIA 2XK5B 5L95C 2A4ZA 1EUVB 1OEYJ 2K1FA 2LRWA 3B08A 4ANVA 3W1SA 1WX9A 3QK0A 4CYEA 3A9JB 4KV2A 4WWOA 4W9EA 3ZDTA 4E74A 1E7UA 3AXCA 3V60A 4KSKC 3ZKJC 4PYZA 5CHWA 2J0MA 2NS5A 2ZCBA 5C23A 3T8MA 3KYDD 5D7GA 1WM3A 2DENB 3LDZE 2MBOA 3M62B 2RGFA 4RM9A 1J8CA 2XEWA 2DHZA 2GBKA 4LCDE 3A9JA 4RM8A 3PHXB 4M8MA 4BVUC 3K9OB 2K8HA 4GXBA 4X57B 1I42A 4G3XB 1EO6A 1YQBA 3TJPA 3DBLI 2GOWA 2O6VA 4IWOA 1WFYA 4IM0A 5FR6A 1WE6A 1UBIA 1E8XA 2BWFA 2JT4B 3B0AA 2L3ZA 2K6DB 4MH0E 5E6OA 1UD7A 2IZVB 4MGZE 2N4FA 4JIOU 2DZMA 4HPMB 3RZWC 3ML8A 1I35A 3OAWA 4PS3A 3EHVA 2I1KA 3SHQA 2MBBB 5DCNA 1TTNA 1E8YA 1YX5B 4URKA 3EC8A 4NQKE 3PSEB 2LI5A 2KJHB 1WYWB 4FA6A 2L8JA 4EZKA 4ASWC 3RULA 2GBRA 2LXCA 2EKEC 4XZ4A 5TR5A 3MJWA 3WALA 1WGYA 3IFWB 5DPSA 1GC6A 1Q0WB 2ZNVB 1WJUA 1E8ZA 3GOEA 3QAQA 4KZ0A 4W9FA 4FBJB 4W9KA 2LASA 2N9XA 2G3QB 2NVUI 2KANA 4CHKA 3X0WA 3A1QA 2NCNA 2R2QA 3IHPC 3NS8A 4ANUA 3PV1A 2RD0A 2KLGA 4E71A 4JLCA 3UIOB 2KMAA 2FUHB 4FLHA 4MSMB 2KC2A 2PPHA 2MP2A 4W9CA 4HLEA 2KTFA 3ML9A 1G6JA 2FIFA 2PJHA 2YVCA 2AL6A 3DVNU 1UZXB 3PGEA 3QC8B 2LD9A 4PYUA 3T9LA 1V49A 3A1QB 4HXDA 4F8CB 5AEKB 2KKCA 2ZNVC 3LJ3A 2D10A 4K81A 5JZEB 2M1MA 4FJZA 4FJYA 3RYTA 4MEMA 4HJKA 1A5RA 5EDSA 2KFJA 4WJQA 3PT2B 3UF8A 3QQ8B 2G4DB 1TGZB 2LVOA 3C0RB 2RPQA 4E3CA 3L0WB 2L0FA 5IAAC 4EOYA 2MCNB 3DVNV 4DK5A 3EECA 3ZIMA 2WX0A 1J0GA 1C3TA 2L0TA 2DYBA 5J2RA 2CHXA 2KLCA 1YIWA 2MW5A 1WGGA 2L7RA 3OJ4B 3VH3B 3ZLZA 5JHBA 3ZVVA 2DX5B 3QARA 4AJYB 5CHFA 4LDTB 4ICUA 1LM8B 4BKTA 3ZNZB 4AWJA 2JY6A 3R3MA 3DOWA 3R7QA 1X1MA 3AU4A 1Q1OA 2GBMA 2CKHB 2L76A 1Z5SB 2KJ6A 2VRRB 3DPDA 1BT0A 4N9F4 4W9HA 2MX2A 4GMVA 1WGHA 1E7VA 4CO7A 2KO3A 1RLFA 3DBHI 3DQVA 4BKSD 1LXDA 2CHWA 3R7RA 2LRUA 3V62A 3P2BA 3X23A 2FIDA 1GG3A 2N9EB 4EKUA 2KZRA 2NR2A 4MJSB 4WQOB 2JRIB 4HPLB 3HK0A 5AZGA 3KUCB 1D3ZA 4F7ZA 3DBSA 1T0YA 2IO3B 4K7WA 5AZHA 2JUOA 1Y8RC 3ZRFA 2PEAA 4G0NB 1EF5A 2CS4A 1OTRB 2KWUB 3UIPB 5J18A 2Z0EB 3NHEB 3VQIA 2C7NB 2PE6B 3R66C 2G45B 4NJ7A 3VUYA 1WZ3A 1SE9A 4DXAB 2KX3A 3L08A 3PS6A 3KH0A 2LGXA 2JPHA 1IPGA 1NBFC 1NDDA 2N1VA 3L13A 3PRZA 3ONSA 4I6PA 1TBEA 5D94A 1HE8A 3CSFA 4PS7A 5E6NA 4K7SA 2D11A 1IYFA 4NY0A 2KFKB 3CF6E 2KMCA 3N30A 4FADA 1GUAB 2O6VB 4GDLB 5G55A 3KVFB 1YJ1A 2MQJA 2MA9B 5JHAA 1E8WA 1NI2A 2V3SA 4ANXA 1FXTB 3KW5B 2QHOA 1MG8A 2G4SA 2JZZA 3NZSA 3TIXA 2EMTA 1VCBA 2KQ7A 3ALBA 3U7DA 3RZFA 1KJTA 2BKFA 2FCQA 2BPSA 5AZFA 2HTHA 5HKHA 2KC1A 3WAMA 1P98A 1WH3A 3CSTA 1VD2A 4M0WB 1S1QB 2AWTA 3ZTDA 2L00B 3VTVA 2KOXA 4XC2A 2ASQA 4M8NA 3A33B 3U8ZA 4OVUA 3Q3JA 5LLIA 3PZDA 1TZ1A 2RR9A 3S2AA 1WE7A 2KXJA 3KUZA 2JXXA 1ISNA 1J19A 2HD5B 2KK8A 1UBQA 3PHWB 4IM3A 5LXIB 3GZNI 4AUQC 4J6IA 3IBEA 3JW0X 2NBWB 2KWVB 1V2YA 2DYOA 2LGYA 1V81A 3WANA 4EZJA 3PRPB 2XBBC 3VUXA 2YLMA 2FAZA 2V1YA 2DYMA 2GMIC 4KVGB 1IP9A 1P9DU 5D6JB 3U30A 4AOFA 3VXWA 5G2NA 4ZRIA 4EUTA 3AU5A 2JVCA 3QA8A 4MDKE 2AL3A 1SIFA 2C7MB 4MELA 4MGKE 1UGMA 3PLUA 1P1AA 4ZRJA 4BKSA 1GJZA 2I1JA 2WDTB 3EFUA 4IWQA 4TQ1A 2N7EA 3PPAA 3MHSD 3MTNB 2IBIB 1V86A 3UGBB 1WX8A 4TQ0A 3TCAA 2IO1B 1V5TA 1U4AA 4ANWA 5KHQA 4TKNA 1LFDA 3AI5A 3HIZA 1KLVA 3APDA 1XD3B 2DZJA 4KDLB 2GBJA 2CU1A 2ZZPB 3KYCD 2O6VD 3M63B 4GU2A 3VTUA 1V9JA 2KDIA 3WIMA 3UQBA 3DDCB 5KHOA 1M94A 2K8BA 4WWPA 3VVWB 4MSQB 2FCNA 4YL8A 1AARA 3H7PA 3OJ3A 3PVLA 4A3OA 1WXVA 2N9PC 2N7DA 4GDKA 2GBNA 3DCGA 3AULA 2W9NA 3VUWA 1V5OA 3DVGX 4IW0A 3SD5A 1V80A 2IO0B 4W9LA 2KN5A 3ZUNA 3QIJA 1K8RB 4IUMB 3W1YA 2FNJB 2AYOB 3H6NA 4GIVA 3WAPA 2V4LA 2MWSB 4LDTD 3QWZB 4DWFA 3D32A 1F9JA 3V61A 2N1WA 5C1ZA 4WJNA 1EF1A 2KJRA 2REXA 3BINA 2EMSA 5DPWA 3RT3B 3V6CB 2M0XA 2M17A 3NOBA 1WX7A 1YX6B 2DAFA 2KWCA 1WMHA 4WAAA 2RSUA 3HHMA 2Z0DB 3PREA 4BKGA 2IY1B 1WI0A 3QJZA 5GMVA 4HK2A 4WJPA 2KX0A 2Y5BB 1OGWA 4NQLB 2K6QA 1WXSA 1WMHB 2M4NA 5IA7A 3QX1A 4FULA 4II3B 4MGIE 2MBHA 1ZW7A 4DBGA 4EZLA 2KHWB 4HDOA 4KDIC 4WJOA 3Q3FA 3N32A 2IY0B 1WM2A 1OEYA 1H4RA 4PS8A 3VDZA 3APFA 3TMPB 2J7QB 3I3TB 1L2NA 1LQBA 2JF5A 3UQAA 1XT9B 2WWZA 3UINB 5JH5C 4JQWC 2BYEA 4MGYE 2KQSA 2MSED 4EFOA 1WR1A 2IYDB 4I6NB 4B95A 4F1SA 2CR5A 1WRDB 4HCNB 4W9DA 3L17A 2ZJDA 5BO4B 3A4SC 4P7IA 3VFKA 3V6EB 2KD0A 2JWZA 3VAWA 4BBNC 4GSWA 1ZGUB 2NBUA 2WX1A 3NY5A 3NZUA 5DPTA 3JSVA 1UH6A 2MBEA 4NPNA 4GB9A 3ZNID 3ZO5B 4FN2A 4A3PA 4IG7B 2LXAA 1GNUA 2LWPA 3L10B 1WY8A 4DHJD 3ECIA 3IVFA 4MM3A 2JZ3B 1RAXA 5LXHA 1L7YA 5CX3A 3HM3A 4NJ6A 4W9JA 3M3JA 3VH4B 1OQYA 1CMXB 1XQQA 4GGQA 4KSLC 3L54A 3A9KA 5E6PA 4LJPB 3WA0A 4AP4C 4II2B 4HWIB 2M8SA 2L05A 2KDFB 4GOCA 2CHZA 3WAOA 3H7PB 2ZVNA 1ZKHA 4A20A 1P0RA 2IO2B 2NPTA 2C9WB 3SU8X 1SGHA 4B9KA 3OLMD 1R4MI 4GN1A 2BKRB 2KDEB 4ZYNA 4DHJB 4NNJB 2C7HA 2ZPNA 4IWPA 2K8CA 3N3KB 4HVBA 4KIKB 3K9PB 4DDID 2C5LC 2BF8B 5L83A 2NPTB 3QCAA 2KTRA 2O2VA 3A4RA 4MJSA 2KFKA 4G50A 2NBVB 2D3GA 4GDLA 2DZKA 3VHTC 1RRBA 1WGRA 3JVZX 1WXMA 4KIKA 2BYVE 3HM6X 4GDKB 2KTRB 2O2VB 4BOZB 4DHZE 3BY4B 3APCA 1C1YB 2WYQA 2J0JA 4RMAA 4WWNA 3ZRCA 2HE7A 4K7UA 2A5UA 1P3QU 3SDLC 2LGDA 2KNBA 2ZPYA 3PTFC 4OVVA 1GC7A 2LVQA 1RFAA 1WIAA 2R2OA 4NAWA 4W9IA 2K39A 4EEWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G11 A;  1WJN A;  4TUU A;  4DDG D;  2JRH A;  2LZ6 A;  2LUE A;  3B1L X;  3ZW3 A;  5CHV C;  3RUI B;  4XX5 A;  1KM7 A;  4I6L B;  2C60 A;  1E5W A;  2FCM A;  5CTR C;  4NAW B;  2BYF A;  2MP2 B;  2MBQ A;  1PQS A;  1E90 A;  2D07 B;  3ZNG C;  2ZEQ A;  4AJW A;  4IM2 A;  4ZRK A;  4ICV A;  2BWE S;  4FHK A;  2BGF A;  4FHJ A;  1R4N I;  1WJ6 A;  1WXA A;  1WJ4 A;  1YD8 U;  2B3A A;  4HDQ A;  4LJO B;  4K1R B;  2OOB B;  2LJ5 A;  2FCS A;  2HJ8 A;  3L16 A;  4BBN F;  1QZE A;  3H7S A;  2K25 A;  2AEH A;  1UEL A;  1WGD A;  1WR6 E;  3M95 A;  4KZC A;  4TV3 A;  3TBL D;  2KVR A;  3IG3 A;  4DHZ B;  5D2M B;  1S3S G;  1JRU A;  1H8C A;  3RCZ A;  4HCP B;  2D2Q A;  2PE9 A;  3ZDM C;  2LVP A;  1Q5W B;  3DBR I;  2Z59 B;  4BFR A;  5J17 A;  4ZDV A;  3ENE A;  3QHT A;  2DAJ A;  2UYZ B;  3PLV A;  4B6W A;  3TL5 A;  3RD2 A;  1V6E A;  4FJV B;  2ZVO A;  4BOS C;  3ZNH B;  3A9K B;  4IC7 B;  1WF9 A;  2MLB A;  2XK5 A;  2OJR A;  3W1S C;  1KOT A;  3H9D A;  1WZ0 A;  5DPR A;  3KUD B;  3O65 B;  3JYU A;  4JGH B;  3PRM B;  2UWQ A;  4W9G A;  2ZCC A;  2KDB A;  3H1U A;  3VTW A;  1Z2M A;  3DVG Y;  3ZTC A;  2J0K A;  3CMM B;  4JL9 A;  3JSV B;  2MRP A;  2DZI A;  2XK5 B;  5L95 C;  2A4Z A;  1EUV B;  1OEY J;  2K1F A;  2LRW A;  3B08 A;  4ANV A;  3W1S A;  1WX9 A;  3QK0 A;  4CYE A;  3A9J B;  4KV2 A;  4WWO A;  4W9E A;  3ZDT A;  4E74 A;  1E7U A;  3AXC A;  3V60 A;  4KSK C;  3ZKJ C;  4PYZ A;  5CHW A;  2J0M A;  2NS5 A;  2ZCB A;  5C23 A;  3T8M A;  3KYD D;  5D7G A;  1WM3 A;  2DEN B;  3LDZ E;  2MBO A;  3M62 B;  2RGF A;  4RM9 A;  1J8C A;  2XEW A;  2DHZ A;  2GBK A;  4LCD E;  3A9J A;  4RM8 A;  3PHX B;  4M8M A;  4BVU C;  3K9O B;  2K8H A;  4GXB A;  4X57 B;  1I42 A;  4G3X B;  1EO6 A;  1YQB A;  3TJP A;  3DBL I;  2GOW A;  2O6V A;  4IWO A;  1WFY A;  4IM0 A;  5FR6 A;  1WE6 A;  1UBI A;  1E8X A;  2BWF A;  2JT4 B;  3B0A A;  2L3Z A;  2K6D B;  4MH0 E;  5E6O A;  1UD7 A;  2IZV B;  4MGZ E;  2N4F A;  4JIO U;  2DZM A;  4HPM B;  3RZW C;  3ML8 A;  1I35 A;  3OAW A;  4PS3 A;  3EHV A;  2I1K A;  3SHQ A;  2MBB B;  5DCN A;  1TTN A;  1E8Y A;  1YX5 B;  4URK A;  3EC8 A;  4NQK E;  3PSE B;  2LI5 A;  2KJH B;  1WYW B;  4FA6 A;  2L8J A;  4EZK A;  4ASW C;  3RUL A;  2GBR A;  2LXC A;  2EKE C;  4XZ4 A;  5TR5 A;  3MJW A;  3WAL A;  1WGY A;  3IFW B;  5DPS A;  1GC6 A;  1Q0W B;  2ZNV B;  1WJU A;  1E8Z A;  3GOE A;  3QAQ A;  4KZ0 A;  4W9F A;  4FBJ B;  4W9K A;  2LAS A;  2N9X A;  2G3Q B;  2NVU I;  2KAN A;  4CHK A;  3X0W A;  3A1Q A;  2NCN A;  2R2Q A;  3IHP C;  3NS8 A;  4ANU A;  3PV1 A;  2RD0 A;  2KLG A;  4E71 A;  4JLC A;  3UIO B;  2KMA A;  2FUH B;  4FLH A;  4MSM B;  2KC2 A;  2PPH A;  2MP2 A;  4W9C A;  4HLE A;  2KTF A;  3ML9 A;  1G6J A;  2FIF A;  2PJH A;  2YVC A;  2AL6 A;  3DVN U;  1UZX B;  3PGE A;  3QC8 B;  2LD9 A;  4PYU A;  3T9L A;  1V49 A;  3A1Q B;  4HXD A;  4F8C B;  5AEK B;  2KKC A;  2ZNV C;  3LJ3 A;  2D10 A;  4K81 A;  5JZE B;  2M1M A;  4FJZ A;  4FJY A;  3RYT A;  4MEM A;  4HJK A;  1A5R A;  5EDS A;  2KFJ A;  4WJQ A;  3PT2 B;  3UF8 A;  3QQ8 B;  2G4D B;  1TGZ B;  2LVO A;  3C0R B;  2RPQ A;  4E3C A;  3L0W B;  2L0F A;  5IAA C;  4EOY A;  2MCN B;  3DVN V;  4DK5 A;  3EEC A;  3ZIM A;  2WX0 A;  1J0G A;  1C3T A;  2L0T A;  2DYB A;  5J2R A;  2CHX A;  2KLC A;  1YIW A;  2MW5 A;  1WGG A;  2L7R A;  3OJ4 B;  3VH3 B;  3ZLZ A;  5JHB A;  3ZVV A;  2DX5 B;  3QAR A;  4AJY B;  5CHF A;  4LDT B;  4ICU A;  1LM8 B;  4BKT A;  3ZNZ B;  4AWJ A;  2JY6 A;  3R3M A;  3DOW A;  3R7Q A;  1X1M A;  3AU4 A;  1Q1O A;  2GBM A;  2CKH B;  2L76 A;  1Z5S B;  2KJ6 A;  2VRR B;  3DPD A;  1BT0 A;  4N9F 4;  4W9H A;  2MX2 A;  4GMV A;  1WGH A;  1E7V A;  4CO7 A;  2KO3 A;  1RLF A;  3DBH I;  3DQV A;  4BKS D;  1LXD A;  2CHW A;  3R7R A;  2LRU A;  3V62 A;  3P2B A;  3X23 A;  2FID A;  1GG3 A;  2N9E B;  4EKU A;  2KZR A;  2NR2 A;  4MJS B;  4WQO B;  2JRI B;  4HPL B;  3HK0 A;  5AZG A;  3KUC B;  1D3Z A;  4F7Z A;  3DBS A;  1T0Y A;  2IO3 B;  4K7W A;  5AZH A;  2JUO A;  1Y8R C;  3ZRF A;  2PEA A;  4G0N B;  1EF5 A;  2CS4 A;  1OTR B;  2KWU B;  3UIP B;  5J18 A;  2Z0E B;  3NHE B;  3VQI A;  2C7N B;  2PE6 B;  3R66 C;  2G45 B;  4NJ7 A;  3VUY A;  1WZ3 A;  1SE9 A;  4DXA B;  2KX3 A;  3L08 A;  3PS6 A;  3KH0 A;  2LGX A;  2JPH A;  1IPG A;  1NBF C;  1NDD A;  2N1V A;  3L13 A;  3PRZ A;  3ONS A;  4I6P A;  1TBE A;  5D94 A;  1HE8 A;  3CSF A;  4PS7 A;  5E6N A;  4K7S A;  2D11 A;  1IYF A;  4NY0 A;  2KFK B;  3CF6 E;  2KMC A;  3N30 A;  4FAD A;  1GUA B;  2O6V B;  4GDL B;  5G55 A;  3KVF B;  1YJ1 A;  2MQJ A;  2MA9 B;  5JHA A;  1E8W A;  1NI2 A;  2V3S A;  4ANX A;  1FXT B;  3KW5 B;  2QHO A;  1MG8 A;  2G4S A;  2JZZ A;  3NZS A;  3TIX A;  2EMT A;  1VCB A;  2KQ7 A;  3ALB A;  3U7D A;  3RZF A;  1KJT A;  2BKF A;  2FCQ A;  2BPS A;  5AZF A;  2HTH A;  5HKH A;  2KC1 A;  3WAM A;  1P98 A;  1WH3 A;  3CST A;  1VD2 A;  4M0W B;  1S1Q B;  2AWT A;  3ZTD A;  2L00 B;  3VTV A;  2KOX A;  4XC2 A;  2ASQ A;  4M8N A;  3A33 B;  3U8Z A;  4OVU A;  3Q3J A;  5LLI A;  3PZD A;  1TZ1 A;  2RR9 A;  3S2A A;  1WE7 A;  2KXJ A;  3KUZ A;  2JXX A;  1ISN A;  1J19 A;  2HD5 B;  2KK8 A;  1UBQ A;  3PHW B;  4IM3 A;  5LXI B;  3GZN I;  4AUQ C;  4J6I A;  3IBE A;  3JW0 X;  2NBW B;  2KWV B;  1V2Y A;  2DYO A;  2LGY A;  1V81 A;  3WAN A;  4EZJ A;  3PRP B;  2XBB C;  3VUX A;  2YLM A;  2FAZ A;  2V1Y A;  2DYM A;  2GMI C;  4KVG B;  1IP9 A;  1P9D U;  5D6J B;  3U30 A;  4AOF A;  3VXW A;  5G2N A;  4ZRI A;  4EUT A;  3AU5 A;  2JVC A;  3QA8 A;  4MDK E;  2AL3 A;  1SIF A;  2C7M B;  4MEL A;  4MGK E;  1UGM A;  3PLU A;  1P1A A;  4ZRJ A;  4BKS A;  1GJZ A;  2I1J A;  2WDT B;  3EFU A;  4IWQ A;  4TQ1 A;  2N7E A;  3PPA A;  3MHS D;  3MTN B;  2IBI B;  1V86 A;  3UGB B;  1WX8 A;  4TQ0 A;  3TCA A;  2IO1 B;  1V5T A;  1U4A A;  4ANW A;  5KHQ A;  4TKN A;  1LFD A;  3AI5 A;  3HIZ A;  1KLV A;  3APD A;  1XD3 B;  2DZJ A;  4KDL B;  2GBJ A;  2CU1 A;  2ZZP B;  3KYC D;  2O6V D;  3M63 B;  4GU2 A;  3VTU A;  1V9J A;  2KDI A;  3WIM A;  3UQB A;  3DDC B;  5KHO A;  1M94 A;  2K8B A;  4WWP A;  3VVW B;  4MSQ B;  2FCN A;  4YL8 A;  1AAR A;  3H7P A;  3OJ3 A;  3PVL A;  4A3O A;  1WXV A;  2N9P C;  2N7D A;  4GDK A;  2GBN A;  3DCG A;  3AUL A;  2W9N A;  3VUW A;  1V5O A;  3DVG X;  4IW0 A;  3SD5 A;  1V80 A;  2IO0 B;  4W9L A;  2KN5 A;  3ZUN A;  3QIJ A;  1K8R B;  4IUM B;  3W1Y A;  2FNJ B;  2AYO B;  3H6N A;  4GIV A;  3WAP A;  2V4L A;  2MWS B;  4LDT D;  3QWZ B;  4DWF A;  3D32 A;  1F9J A;  3V61 A;  2N1W A;  5C1Z A;  4WJN A;  1EF1 A;  2KJR A;  2REX A;  3BIN A;  2EMS A;  5DPW A;  3RT3 B;  3V6C B;  2M0X A;  2M17 A;  3NOB A;  1WX7 A;  1YX6 B;  2DAF A;  2KWC A;  1WMH A;  4WAA A;  2RSU A;  3HHM A;  2Z0D B;  3PRE A;  4BKG A;  2IY1 B;  1WI0 A;  3QJZ A;  5GMV A;  4HK2 A;  4WJP A;  2KX0 A;  2Y5B B;  1OGW A;  4NQL B;  2K6Q A;  1WXS A;  1WMH B;  2M4N A;  5IA7 A;  3QX1 A;  4FUL A;  4II3 B;  4MGI E;  2MBH A;  1ZW7 A;  4DBG A;  4EZL A;  2KHW B;  4HDO A;  4KDI C;  4WJO A;  3Q3F A;  3N32 A;  2IY0 B;  1WM2 A;  1OEY A;  1H4R A;  4PS8 A;  3VDZ A;  3APF A;  3TMP B;  2J7Q B;  3I3T B;  1L2N A;  1LQB A;  2JF5 A;  3UQA A;  1XT9 B;  2WWZ A;  3UIN B;  5JH5 C;  4JQW C;  2BYE A;  4MGY E;  2KQS A;  2MSE D;  4EFO A;  1WR1 A;  2IYD B;  4I6N B;  4B95 A;  4F1S A;  2CR5 A;  1WRD B;  4HCN B;  4W9D A;  3L17 A;  2ZJD A;  5BO4 B;  3A4S C;  4P7I A;  3VFK A;  3V6E B;  2KD0 A;  2JWZ A;  3VAW A;  4BBN C;  4GSW A;  1ZGU B;  2NBU A;  2WX1 A;  3NY5 A;  3NZU A;  5DPT A;  3JSV A;  1UH6 A;  2MBE A;  4NPN A;  4GB9 A;  3ZNI D;  3ZO5 B;  4FN2 A;  4A3P A;  4IG7 B;  2LXA A;  1GNU A;  2LWP A;  3L10 B;  1WY8 A;  4DHJ D;  3ECI A;  3IVF A;  4MM3 A;  2JZ3 B;  1RAX A;  5LXH A;  1L7Y A;  5CX3 A;  3HM3 A;  4NJ6 A;  4W9J A;  3M3J A;  3VH4 B;  1OQY A;  1CMX B;  1XQQ A;  4GGQ A;  4KSL C;  3L54 A;  3A9K A;  5E6P A;  4LJP B;  3WA0 A;  4AP4 C;  4II2 B;  4HWI B;  2M8S A;  2L05 A;  2KDF B;  4GOC A;  2CHZ A;  3WAO A;  3H7P B;  2ZVN A;  1ZKH A;  4A20 A;  1P0R A;  2IO2 B;  2NPT A;  2C9W B;  3SU8 X;  1SGH A;  4B9K A;  3OLM D;  1R4M I;  4GN1 A;  2BKR B;  2KDE B;  4ZYN A;  4DHJ B;  4NNJ B;  2C7H A;  2ZPN A;  4IWP A;  2K8C A;  3N3K B;  4HVB A;  4KIK B;  3K9P B;  4DDI D;  2C5L C;  2BF8 B;  5L83 A;  2NPT B;  3QCA A;  2KTR A;  2O2V A;  3A4R A;  4MJS A;  2KFK A;  4G50 A;  2NBV B;  2D3G A;  4GDL A;  2DZK A;  3VHT C;  1RRB A;  1WGR A;  3JVZ X;  1WXM A;  4KIK A;  2BYV E;  3HM6 X;  4GDK B;  2KTR B;  2O2V B;  4BOZ B;  4DHZ E;  3BY4 B;  3APC A;  1C1Y B;  2WYQ A;  2J0J A;  4RMA A;  4WWN A;  3ZRC A;  2HE7 A;  4K7U A;  2A5U A;  1P3Q U;  3SDL C;  2LGD A;  2KNB A;  2ZPY A;  3PTF C;  4OVV A;  1GC7 A;  2LVQ A;  1RFA A;  1WIA A;  2R2O A;  4NAW A;  4W9I A;  2K39 A;  4EEW A; 
#chains in the Genus database with same CATH topology
 4DDG D;  2LZ6 A;  4JX1 C;  3RUI B;  2C60 A;  1E5W A;  5CTR C;  4NAW B;  4RGO S;  1C77 A;  2MBQ A;  2QC8 A;  5EE1 A;  1ZPS A;  1EU4 A;  4ZRK A;  4ICV A;  2VZK D;  1LO5 D;  3E9S A;  4FHJ A;  2PW9 A;  1IGC A;  1R4N B;  3W5V B;  4LJO B;  2OOB B;  2LJ5 A;  4BBN F;  2HJ8 A;  4C4V B;  4EE2 A;  4TV3 A;  1HQR D;  3IG3 A;  4ZOH C;  3BYT B;  1H8C A;  2DNF A;  3PZ7 A;  4P1B C;  2WXR A;  1YQ4 B;  4BFR A;  2Z59 B;  4ZDV A;  3ENE A;  5BYS A;  1HEZ E;  2DAJ A;  1F2R C;  2ZVO A;  4C56 C;  4JWU C;  2XK5 A;  1CJE A;  2WU5 B;  3O65 B;  3PRM B;  4LNF A;  2MHJ A;  3SFE B;  1Z2M A;  3ZTC A;  2J0K A;  1OQQ A;  1NYR A;  1N6Z A;  2PTL A;  3W1S A;  4E74 A;  1WWT A;  2MBO A;  3M62 B;  4M8M A;  4BVU C;  4X57 B;  2INP E;  1J7C A;  1E8X A;  2JT4 B;  4MH0 E;  5E6O A;  2IZV B;  2CJN A;  3RZW C;  3TUO A;  3EHV A;  1GB1 A;  3U4E G;  3DWM A;  1L4Z B;  1D4B A;  2V3P A;  4FA6 A;  2L8J A;  2GBR A;  2LXC A;  4XZ4 A;  1FCL A;  1WJU A;  1F52 A;  4KZ0 A;  1YJI A;  4FBJ B;  4W9K A;  2N9X A;  1CZP A;  3ZGZ A;  1E7P B;  4JLC A;  4YWG G;  2KMA A;  4MSM B;  4FLH A;  4C80 A;  2PPH A;  1JW9 D;  2PJH A;  3QC8 B;  1UZX B;  3NVY A;  1V49 A;  4HPP A;  4HXD A;  4F8C B;  3DHI C;  2KT7 A;  4D2K A;  2QIE B;  2BS4 B;  4HJK A;  1A5R A;  1DYQ A;  2SEB D;  4LNN A;  3UF8 A;  2QCZ A;  2RPQ A;  2WXL A;  3L0W B;  2L0F A;  3EEC A;  1DOI A;  1F1H A;  2KLC A;  1YIW A;  2MW5 A;  1PGB A;  2L7R A;  3P4P B;  3ZVV A;  1C4C A;  2IND C;  4HKQ A;  2BQQ A;  1IBX B;  4BKT A;  5FKA C;  3ZNZ B;  3R3M A;  1X1M A;  1FMA D;  3AU4 A;  1Q1O A;  2Y3A A;  4NJC A;  3DPD A;  2KJ6 A;  2LHD A;  4N9F 4;  1BT0 A;  4W9H A;  4CO7 A;  1E7V A;  2KO3 A;  1RLF A;  2LRU A;  3V62 A;  3U7Z A;  3X23 A;  2FID A;  1GG3 A;  3Q3N C;  4EKU A;  2WNM A;  1E0Z A;  2NR2 A;  4MJS B;  4WQO B;  3HK0 A;  3KUC B;  4F7Z A;  2XN9 C;  4K7W A;  2PEA A;  2WXJ A;  2KWU B;  4P1C C;  3UIP B;  3V3X A;  4ZYS A;  4US9 A;  2PE6 B;  4NJ7 A;  4DXA B;  3PS6 A;  3GE3 C;  3URY A;  4ZRP A;  3L13 A;  4I6P A;  1TBE A;  3W9C B;  1HE8 A;  2J53 A;  1TY0 A;  4PS7 A;  1UNS A;  5E6N A;  2D11 A;  2HDE A;  1YJ1 A;  2MQJ A;  1NI2 A;  2V3S A;  1FXT B;  1TJE A;  2QHO A;  3TIX A;  1UGJ A;  1T3Q A;  3U7D A;  2FCQ A;  5HKH A;  3VTV A;  2ASQ A;  4M8N A;  3U8Z A;  2K3U A;  3Q3J A;  3PZD A;  4C4V A;  1KF6 B;  1T5X D;  2JXX A;  3AE1 B;  4A6Q A;  1C9F A;  2KK8 A;  2J52 A;  3AE5 B;  3GE8 C;  5HHD G;  4IM3 A;  3GZN I;  4YSZ B;  5GXG B;  3IBE A;  4L2Y A;  2RPV A;  2KWV B;  2DYO A;  2LGY A;  1V81 A;  2XBB C;  2INC C;  3VUX A;  2FAZ A;  3AEB B;  2GMI C;  1V1P B;  5D6J B;  3VXW A;  4ZRI A;  3AU5 A;  3QA8 A;  2GLS A;  3OG5 A;  2JZP A;  1P1A A;  2L1A A;  3W5U B;  3PPA A;  4UDU C;  1V86 A;  4TQ0 A;  4RGM A;  5KHQ A;  2ICI A;  3HIZ A;  2IGG A;  3APD A;  4LNO A;  3AM9 A;  4ITK A;  3M63 B;  3UQB A;  3NZ3 A;  4JE3 B;  4ARI A;  3SFD B;  3VR9 B;  3I9V 1;  5HG2 A;  2K8B A;  1SE3 A;  2FCN A;  3SR6 A;  4YL8 A;  2W82 A;  4GDK A;  2HJ1 A;  3SD5 A;  3NS1 A;  4C00 A;  4W9L A;  3ZUN A;  4IUM B;  3NUH B;  4GIV A;  2V4L A;  1HTO A;  2V0G A;  5C1Z A;  3LYY A;  1TIF A;  2KJR A;  2REX A;  5C3J B;  3V6C B;  2YEP F;  2KWC A;  4RF0 A;  2K22 A;  2Z0D B;  3HHM A;  2W3S A;  1JRP A;  4HK2 A;  2Y5B B;  5IKC M;  4NQL B;  1WMH B;  1GPX A;  3QX1 A;  2WXN A;  4MGI E;  2MBH A;  2KHW B;  1KTK A;  1Y56 A;  2Z8L A;  3P4Q B;  1H4R A;  3NVW A;  3TMP B;  2J7Q B;  1L2N A;  1LQB A;  5LNK 1;  2PMV A;  4C7Z A;  3UQA A;  4DXF A;  5JH5 C;  4JQW C;  2JU6 X;  2BW2 A;  4I6N B;  2MJD A;  2M0A A;  4RF1 A;  3L17 A;  5G5H A;  1AYF A;  3VFK A;  3V6E B;  3CWI A;  3I5J C;  5DPT A;  3JSV A;  3P63 A;  2LXA A;  3L10 B;  1WY8 A;  4DHJ D;  2JZ3 B;  1L7Y A;  4LNI A;  3Q3M C;  2G9H D;  1XQQ A;  4B0E A;  1OFF A;  3A9K A;  1D5X C;  3L54 A;  4LJP B;  5E6P A;  4USA A;  4GOC A;  1KRH A;  1SGH A;  2IDY A;  4DHJ B;  1JRO A;  3DWG C;  4IWP A;  2K8C A;  3N3K B;  1NVI D;  2NPT B;  2KTR A;  2L32 A;  3U2S C;  3VR8 B;  1WGR A;  1RRB A;  2BYV E;  1TS4 A;  4WWN A;  2J0J A;  1ET6 A;  3ZRC A;  4K7U A;  3RN9 C;  2LGD A;  3J9C A;  1RM6 C;  2R2O A;  3AE9 B;  3AB5 A;  4WJP A;  2K39 A;  3IT4 B;  2L83 A;  2JRH A;  4YTM B;  1NEK B;  1GOZ A;  5EE0 A;  1FM0 D;  4RGT A;  1RFK A;  2BYF A;  2MP2 B;  2M19 A;  1FNV A;  4N6E B;  2QJL A;  1AW7 A;  2BBC A;  1E90 A;  2D07 B;  2ZEQ A;  1ZXH A;  4IM2 A;  1FNU A;  1WJ4 A;  3VRA B;  4XGA B;  1YMH E;  4OW0 A;  2H88 B;  1P7F A;  1UEL A;  3MC8 A;  4AQ7 A;  1S3S G;  1JRU A;  3ZDM C;  2LVP A;  2QIL A;  3QHT A;  4B6W A;  2BS2 B;  2N7J A;  3RD2 A;  4FJV B;  4JWS C;  4IC7 B;  1WF9 A;  2MLB A;  3H9D A;  1WZ0 A;  3KUD B;  3JYU A;  4JGH B;  2ZCC A;  2KDB A;  3ABV B;  3VTW A;  1JWA D;  3DVG Y;  3CMM B;  1ZOY B;  2MRP A;  2DZI A;  1EUV B;  4YTN B;  2PKO A;  4ANV A;  2R61 A;  1STE A;  3QK0 A;  4CYE A;  3A9J B;  4N59 A;  3AXC A;  5G5G A;  3T8M A;  3KYD D;  1B1Z A;  2DEN B;  3LDZ E;  5BMH A;  2BYT A;  1I4H A;  4RM8 A;  1ZUD 2;  3IT6 B;  1XLN A;  2LGS A;  3GP7 A;  1YQB A;  2O6V A;  1WE6 A;  2LHE A;  3B0A A;  3BYY B;  2K6D B;  2VH2 A;  4MGZ E;  3HVZ A;  3MFG A;  3TEX A;  1E8Y A;  3MHZ A;  3Q8C A;  3EC8 A;  5JXV A;  5TSS A;  4ASW C;  3WCQ A;  1I4P A;  3IAM 1;  1P7E A;  2IJ0 A;  1N60 A;  1HZ5 A;  1VRA B;  2KAN A;  4CHK A;  4NAM A;  3X0W A;  1TS3 A;  1YJJ A;  4ANU A;  4E71 A;  2K0P A;  3UIO B;  1F77 A;  1DOX A;  2Y5P A;  4OVZ A;  4W9C A;  1L0V B;  3Q2A C;  2KTF A;  4XDC A;  1N5W A;  1QKZ A;  2JQR B;  4PYU A;  2YVC A;  3DVN U;  3PGE A;  5AEK B;  3A1Q B;  2KKC A;  2ZNV C;  3LJ3 A;  2D10 A;  4OZC A;  4K3C A;  4TSS A;  2M1M A;  4FJZ A;  3RNE C;  5JZE B;  1CK1 A;  4MEM A;  2KFJ A;  1ZDX A;  1TGZ B;  3C0R B;  4HRO A;  4E3C A;  2MCN B;  3DVN V;  3ZIM A;  3BVZ A;  2L0T A;  3AV8 A;  2DYB A;  5J2R A;  1WGG A;  1C4A A;  5D3D A;  5JHB A;  2DX5 B;  4J3O D;  4AS1 A;  3AEC B;  3R8B A;  1AWD A;  2JY6 A;  1AN8 A;  2AX5 A;  2PLP A;  1Z5S B;  1WGH A;  1LXD A;  1ROE A;  1FEH A;  2I2Y A;  4HPL B;  5AZG A;  4TMA B;  1K53 A;  5AZH A;  2JUO A;  3ZRF A;  4G0N B;  1BML C;  3DHH C;  2EEL A;  3NHE B;  2C7N B;  2FUG 1;  3VUY A;  1WZ3 A;  1SE9 A;  2K5P A;  1IPG A;  3PRZ A;  2N1V A;  3R2I A;  1F2R I;  1F0Z A;  2BS3 B;  3CSF A;  1DOY A;  3N30 A;  4FAD A;  2O6V B;  4GDL B;  2V4I B;  3KVF B;  2KVZ A;  4L23 A;  3NZS A;  1VCB A;  1KJT A;  2BKF A;  2BPS A;  2HTH A;  2KC1 A;  3WAM A;  5IN7 A;  1WH3 A;  3CST A;  1VD2 A;  2WGS A;  3AE7 B;  3L4P A;  2L00 B;  4XC2 A;  1M4V A;  2MJE A;  4OVU A;  1GB4 A;  2KN4 A;  3FIL B;  2KXJ A;  4A55 A;  3BZD B;  3KUZ A;  1WYG A;  1ISN A;  3LXF A;  2RDH A;  3LB8 C;  5LXI B;  3C8Y A;  4AUQ C;  4LTU A;  2JX5 A;  3JW0 X;  1RYJ A;  2NBW B;  1ZP0 B;  1V1O A;  4EZJ A;  1YN3 A;  4LK0 M;  5BMI A;  2TSS A;  4K3B A;  2V1Y A;  2LJI A;  1I4R A;  1IBX A;  3U30 A;  2LMC A;  1UGM A;  2UU7 A;  4BKS A;  1GJZ A;  2I1J A;  2WDT B;  4N58 A;  5BYQ A;  3MTN B;  2IBI B;  3UGB B;  3TCA A;  2IO1 B;  4RH6 A;  1QF6 A;  1C79 A;  3RNC C;  3AEG B;  2BB6 A;  4A8X C;  2DZJ A;  3AED B;  2ZZP B;  2O6V D;  2KDI A;  3WIM A;  1TS5 A;  2WXO A;  1M94 A;  4WWP A;  1OQR A;  4A3O A;  2N7D A;  2GBN A;  3DCG A;  3AUL A;  1V5O A;  1V80 A;  2KN5 A;  1K8R B;  3W1Y A;  3H6N A;  1HTQ A;  4IKG A;  5FK9 C;  1ESF A;  4LDT D;  4MH8 A;  1EF1 A;  2EKI A;  3BVG A;  2WS3 B;  3N9Y C;  2M17 A;  3NOB A;  1WX7 A;  3AE3 B;  2D3A A;  3OWE B;  2IY1 B;  3MC0 B;  1WI0 A;  5GMV A;  3RI7 C;  4FUL A;  3IXS A;  4II3 B;  1ZW7 A;  4DBG A;  4EZL A;  5EE3 A;  2WP9 B;  2QSD A;  1PDX A;  4HDO A;  2IY0 B;  4NZL B;  1NI3 A;  1WM2 A;  1OEY A;  3Q8E A;  3AE4 B;  2SAK A;  3MP9 A;  4RCO A;  3UIN B;  1KFY B;  1SE4 A;  4EFO A;  1SEB D;  3EGR A;  2WXI A;  4B95 A;  1FFU A;  3A4S C;  2KD0 A;  4BBN C;  1ZGU B;  1LGR A;  1PGX A;  4GB9 A;  4A3P A;  3ZO5 B;  3ECI A;  3N1X C;  3HM3 A;  1I4X A;  3KLS X;  4GGQ A;  2KDF B;  3H7P B;  1XO3 A;  4A20 A;  1MPE A;  2C9W B;  3RFZ B;  4B9K A;  4A90 A;  4GN1 A;  2BKR B;  2KDE B;  4YSY B;  1R7S A;  1C78 A;  4ZYN A;  1HZ6 A;  1WRI A;  2C7H A;  4HVB A;  3K9P B;  4DDI D;  2BF8 B;  2FE8 A;  1J7A A;  3AEF B;  3QCA A;  2KDM A;  2O2V A;  2KFK A;  1TKG A;  4G50 A;  4GDL A;  3BWU D;  3VHT C;  1WXM A;  3Q69 A;  4GDK B;  3APC A;  1C1Y B;  2NMQ A;  2WYQ A;  2HE7 A;  1XEE A;  1P3Q U;  1D5Z C;  1ET9 A;  2IPK D;  3PTF C;  1N63 A;  1GC7 A;  2LVQ A;  1WIA A;  4NAW A;  4W9I A;  5IP4 D;  4G11 A;  4XE0 A;  2LUE A;  3B1L X;  4XX5 A;  2B76 B;  2FCM A;  3ZXR A;  1PQS A;  4P16 A;  3ZNG C;  4XWT A;  4FHK A;  3TEY A;  2BGF A;  4YTP B;  1WJ6 A;  2WLB A;  1YD8 U;  4HDQ A;  2B3A A;  4WH4 A;  2FCS A;  3L16 A;  1VLB A;  1UF0 A;  3H7S A;  3NG0 A;  1WR6 E;  4KZC A;  3M95 A;  4HJG E;  2KVR A;  4S0R A;  3RCZ A;  3AEE B;  3HVD A;  1Q5W B;  3DBR I;  5J17 A;  4FXC A;  3TL5 A;  3GZN B;  4ARC A;  2PVG C;  1D5M C;  2OHF A;  3A9K B;  1KOT A;  2BB5 A;  1D6E C;  2WXM A;  1VZ7 A;  5DPR A;  2UWQ A;  4W9G A;  3R2T A;  1PFD A;  2BVC A;  4JL9 A;  3JSV B;  2XK5 B;  3N20 C;  1OEY J;  3B08 A;  4WIP A;  4W9E A;  2KAC A;  1E7U A;  3V60 A;  4KSK C;  3ZXV A;  2J0M A;  2NS5 A;  2LGI A;  3UI3 A;  5IO9 A;  3O13 A;  1EM7 A;  2RGF A;  4RM9 A;  1J8C A;  2XEW A;  2DHZ A;  1DGJ A;  2GBK A;  4LCD E;  1T0S C;  1VDV A;  3PHX B;  2K8H A;  4GXB A;  3RNB C;  1I42 A;  4G3X B;  3KQ4 A;  3TJP A;  2GOW A;  4IWO A;  1WFY A;  1UBI A;  3FC4 A;  3RPF C;  2XNA C;  1UD7 A;  4KX6 B;  3NJT A;  2N4F A;  2KYW A;  2DZM A;  4JIO U;  3ML8 A;  3SHQ A;  1TTN A;  3W2D A;  4URK A;  3DBH B;  2LI5 A;  1YQ3 B;  2X38 A;  3AE6 B;  3VRB B;  3RUL A;  2EKE C;  5TR5 A;  3MJW A;  3WAL A;  1WGY A;  1MFW A;  2AQ3 B;  2ZNV B;  2OED A;  1YN5 A;  2DBY A;  2W3R A;  4W9F A;  1TS2 A;  2G3Q B;  2NVU I;  1E10 A;  3IHP C;  2RD0 A;  2KLG A;  4WUR A;  3E56 A;  1JWM D;  2WXF A;  2MP2 A;  2FIF A;  3W1S C;  2LD9 A;  2ONQ A;  2D3B A;  4H2A A;  4K81 A;  4FJY A;  3RYT A;  4WJQ A;  3PT2 B;  1MI0 A;  2LVO A;  4XWW A;  1E9M A;  4DK5 A;  1L0X B;  2N9L A;  1MJD A;  1C3T A;  4KKI A;  1PGA A;  4Q2J A;  1T6B X;  3VH3 B;  1FRD A;  3QAR A;  4AJY B;  1SB3 C;  3AEA B;  2KAJ A;  1FNW A;  3DOW A;  2GBM A;  2CKH B;  2VRR B;  1IUE A;  2LFI A;  4BKS D;  2CHW A;  1QIL A;  1BUI C;  1RWS A;  2JRI B;  1D3Z A;  3AE2 B;  3DBS A;  2NTS A;  3NVV A;  2H89 B;  1OTR B;  5J18 A;  3R66 C;  2G45 B;  5H92 C;  3KH0 A;  2LGX A;  2JPH A;  5D94 A;  1QOB A;  2JWU A;  1WXQ A;  4OZA A;  4M01 A;  2KFK B;  3CF6 E;  2KMC A;  1GUA B;  2MH7 A;  2G1E A;  5G55 A;  1E8W A;  4ANX A;  5MPO A;  4M00 A;  1MG8 A;  2G4S A;  2LUM A;  3ALB A;  3N1Z C;  1YOV B;  3TSS A;  2NTT A;  5HFY A;  4M0W B;  1S1Q B;  1C76 A;  2AWT A;  3ZTD A;  1A70 A;  2KOX A;  1R4M B;  1FO4 A;  3A33 B;  3BII D;  1FIQ A;  4PT5 A;  1NYQ A;  1ZE3 D;  3P4S B;  1WE7 A;  3ETR A;  4ZHP A;  1NEN B;  3DBR B;  3B9J A;  1J19 A;  1GAQ B;  1TKE A;  1UBQ A;  3ZJU A;  2LEK A;  1V8C A;  3WAN A;  2YLM A;  3SEB A;  2DYM A;  4BZA A;  4KVG B;  1IP9 A;  1P9D U;  4EUT A;  2AQ2 B;  2ZW1 A;  1ACC A;  2AL3 A;  2C7M B;  3GS2 A;  4MEL A;  4MGK E;  1QOA A;  1FPY A;  3PLU A;  1C4P A;  4ZRJ A;  1EU3 A;  4GLS C;  3EFU A;  4TQ1 A;  3MHS D;  2MEK A;  1XXG A;  1U4A A;  4ANW A;  1EWY C;  1LFD A;  2QEJ C;  4MM3 B;  1XD3 B;  1WSP A;  1QOG A;  4KDL B;  1T0R C;  2GBJ A;  2CU1 A;  2INN E;  3KYC D;  3VTU A;  5KHO A;  1BXT A;  1AAR A;  3PVL A;  1SJE D;  2N9P C;  2D3C A;  3VUW A;  2W9N A;  3DVG X;  2ZW0 A;  2CU3 A;  2IO0 B;  2E3T A;  2KMM A;  1JWB D;  2AYO B;  2GB1 A;  3WAP A;  2MWS B;  2E6X A;  1L4D B;  4WJN A;  3NVZ A;  2EMS A;  2WXP A;  2DAF A;  5BYR A;  4WAA A;  2RSU A;  1ZDV A;  4C7Y A;  3QJZ A;  2PIA A;  2RDB C;  3ZQ4 A;  4QAY A;  1WXS A;  2M4N A;  4KDI C;  4WJO A;  3N32 A;  1WGK A;  1UWX A;  3VDZ A;  1XLP A;  1XT9 B;  2WWZ A;  4MGY E;  2BYE A;  2KQS A;  2CJO A;  1L5P A;  4F1S A;  1WRD B;  4HCN B;  4LLG M;  5BO4 B;  2ZJD A;  1KLG D;  1K50 A;  2JWZ A;  3VAW A;  2NBU A;  3NY5 A;  2IGH A;  3C19 A;  3ZNI D;  1K51 A;  4IG7 B;  1GNU A;  1XLO A;  1EWC A;  1RAX A;  1MVK A;  4NJ6 A;  4W9J A;  3M3J A;  4HEA 1;  1YNT E;  1OQY A;  1CMX B;  4KSL C;  3WA0 A;  1FXA A;  4AP4 C;  2RMM A;  4II2 B;  4HWI B;  5I4D A;  2Y5C A;  2L05 A;  2KWD A;  3WAO A;  2CHZ A;  1ZKH A;  2IO2 B;  3SU8 X;  1R4M I;  1SBB B;  1L0Y B;  1UUP A;  4KIK B;  5L83 A;  2N0S B;  1TYG B;  1SF0 A;  3A4R A;  1I4Q A;  1SIJ A;  2NBV B;  3JVZ X;  4B0M A;  3DHG C;  2WHI A;  2KTR B;  4DHZ E;  3B2G A;  1FXI A;  1TT5 B;  2KNB A;  2ZPY A;  3H8H A;  3AN1 A;  3FAH A;  4HKZ E;  4ZRQ A;  4A9A A;  1WJN A;  3HRD D;  4TUU A;  4L1B A;  1SE2 A;  3ZW3 A;  5CHV C;  3EFC A;  1KM7 A;  4I6L B;  4KGT A;  3Q3O C;  3Q8A A;  3CIR B;  4AJW A;  4KGR A;  2BWE S;  3B2F A;  4M0W A;  1R4N I;  1TY2 A;  1CQV A;  1WXA A;  4K1R B;  1QZE A;  2K25 A;  2AEH A;  3TBL D;  1TZO A;  1WGD A;  4DHZ B;  4KGS A;  5D2M B;  1FRR A;  4BAX A;  2ON8 A;  4HCP B;  2D2Q A;  2PE9 A;  1VZ6 A;  4ZHO A;  2UYZ B;  4YT0 B;  3PLV A;  1V6E A;  4BOS C;  3ZNH B;  2OJR A;  4OHJ A;  3P4R B;  4XDD A;  3AE8 B;  1KLU D;  3Q8F A;  3Q14 C;  3H1U A;  3TEW A;  3AMZ A;  3PZ8 A;  2M56 B;  2A4Z A;  2K1F A;  2LRW A;  1WX9 A;  4KV2 A;  4WWO A;  3ZDT A;  3ZKJ C;  4PYZ A;  5CHW A;  2ZCB A;  5C23 A;  5D7G A;  1WM3 A;  3KWL A;  1QOF A;  5C2T B;  1IGD A;  3A9J A;  2QDF A;  2WU2 B;  1JWU D;  3K9O B;  1VZ8 A;  1EO6 A;  3DBL I;  4IM0 A;  5FR6 A;  1ENF A;  2BWF A;  1JML A;  2L3Z A;  2WDV B;  3N1Y C;  1VR9 A;  3BK2 A;  4HPM B;  1I35 A;  4R3D A;  3OAW A;  4PS3 A;  2I1K A;  2MBB B;  5DCN A;  1YX5 B;  4NQK E;  1XLQ A;  2V3N A;  3PSE B;  2KJH B;  1WYW B;  2K9X A;  4EZK A;  1QT9 A;  4RNA A;  1I7H A;  3IFW B;  5DPS A;  1GC6 A;  1Q0W B;  1E8Z A;  3QAQ A;  3GOE A;  2LAS A;  2YEP B;  2GI9 A;  3A1Q A;  4IOI E;  2NCN A;  2R2Q A;  3NS8 A;  3PV1 A;  2FUH B;  2KC2 A;  4HLE A;  3ML9 A;  1G6J A;  3T9L A;  2AL6 A;  5IA7 A;  5L95 C;  3NRZ A;  1QQR A;  5EDS A;  3QQ8 B;  2G4D B;  1KH0 A;  3ZJV A;  2VH1 A;  4EOY A;  5IAA C;  3ZYY X;  5D3I B;  2WX0 A;  1J0G A;  2CHX A;  1SXT A;  3OJ4 B;  3ZLZ A;  3Q6B A;  5CHF A;  4LDT B;  4ICU A;  1V1P A;  4S17 A;  1LM8 B;  1N61 A;  4AWJ A;  3R7Q A;  1N62 A;  1V97 A;  2L76 A;  4WWM A;  4OZB A;  2MX2 A;  4GMV A;  3DBH I;  3DQV A;  4YSX B;  2MJ3 A;  3R7R A;  4HRS A;  3P2B A;  2N9E B;  2KZR A;  2WXH A;  5IOI A;  1T0Y A;  2IO3 B;  3U52 E;  1Y8R C;  1EF5 A;  1HXY D;  2CS4 A;  2JYE A;  1XCT L;  2DLB A;  2Z0E B;  3VQI A;  1FD6 A;  2KX3 A;  3L08 A;  4MAC A;  1NBF C;  1NDD A;  3ONS A;  1E6E B;  4K7S A;  3ZJT A;  4NY0 A;  1VJK A;  1IYF A;  4ACF A;  5EE9 A;  4REZ A;  2MA9 B;  5JHA A;  3GB1 A;  2WXK A;  3KW5 B;  1L6U A;  2JZZ A;  2L52 A;  2EMT A;  2KQ7 A;  3RZF A;  5AZF A;  2VZK B;  2X8X X;  1MHX A;  2JSV X;  1P98 A;  2ACZ B;  3AH7 A;  3P1M A;  3KWV A;  4XYC A;  3T3N A;  2J42 A;  5LLI A;  1TZ1 A;  2RR9 A;  3S2A A;  2Q5W D;  4LNK A;  2IGD A;  4RFB A;  2HD5 B;  3PHW B;  3FIL A;  4J6I A;  2OJW A;  4IDI A;  5AUI A;  1V2Y A;  1JAL A;  1UWM A;  3PRP B;  2FBW B;  2KQ4 X;  2JXT A;  3TEZ A;  4AOF A;  5G2N A;  1ZXI A;  2JVC A;  1SJH D;  4MDK E;  1SIF A;  4MT5 A;  1SSN A;  4WQM A;  4IWQ A;  3RMK C;  2N7E A;  1WX8 A;  5FR3 A;  5T8I A;  5H8Y E;  2WDQ B;  1V5T A;  1MG4 A;  2W54 A;  4TKN A;  3AI5 A;  3RNA C;  2V9H A;  1JQ4 A;  1KLV A;  4JPS A;  4GU2 A;  1V9J A;  3DDC B;  4KKJ A;  3VVW B;  4MSQ B;  1QLB B;  3OJ3 A;  3H7P A;  1WXV A;  4IW0 A;  3QIJ A;  3I57 A;  2FNJ B;  2WDR B;  4O1N A;  3QWZ B;  4DWF A;  4YXD B;  3D32 A;  1XF5 L;  2D5G A;  3I63 C;  1F9J A;  3V61 A;  2N1W A;  3BIN A;  3MJ5 A;  3V05 A;  1PUT A;  5DPW A;  3RT3 B;  2M0X A;  5AUK A;  3DBL B;  1YX6 B;  1WMH A;  1J7B A;  3PRE A;  3HUI A;  3IAS 1;  4BKG A;  2N9K A;  3BK1 A;  1JCK B;  2KX0 A;  1HA5 A;  1OGW A;  1JWS D;  2K6Q A;  3EUB 2;  2WQY B;  3Q3F A;  3P42 A;  4PS8 A;  4WAF A;  3APF A;  4DQO C;  1XCQ L;  3I3T B;  1L6V A;  2JF5 A;  3RNG C;  4DXG A;  2MSE D;  2PVO D;  4PK1 A;  1WR1 A;  2IYD B;  1FCC C;  2CR5 A;  4W9D A;  2WXQ A;  3RNF C;  2BT6 A;  4P7I A;  4CQN A;  3BVM A;  4P6V F;  2JYT A;  4GSW A;  3NZU A;  3T3O A;  1MHH E;  2WX1 A;  3PO0 A;  4US8 A;  1UH6 A;  2MBE A;  1TKY A;  4NPN A;  4FN2 A;  2RDG A;  2LWP A;  4MM3 A;  3IVF A;  2BTE A;  1K52 A;  2HTM E;  2AQ1 B;  5LXH A;  5CX3 A;  3MC9 A;  3FKY A;  3VH4 B;  2GRI A;  4RGN A;  2W55 A;  1I4G A;  2M8S A;  5BMG A;  2ZVN A;  1P0R A;  2NPT A;  4M02 A;  1T0Q C;  3OLM D;  1B9R A;  5HI1 A;  1N5X A;  2QMT A;  4NNJ B;  2ZPN A;  2C5L C;  2WXG A;  2DWQ A;  4MJS A;  2D3G A;  2DZK A;  1Q10 A;  4KIK A;  3EA6 A;  3HM6 X;  2O2V B;  4BOZ B;  1FFV A;  4RMA A;  3BY4 B;  2A5U A;  3SDL C;  2I38 A;  4OVV A;  1RFA A;  5E6J A;  1YN4 A;  1PYW D;  3Q8B A;  2J4X A;  4EEW A; 
#chains in the Genus database with same CATH homology
 4G11 A;  1WJN A;  4TUU A;  4DDG D;  2JRH A;  2LZ6 A;  2LUE A;  3B1L X;  3ZW3 A;  5CHV C;  3RUI B;  4XX5 A;  1KM7 A;  4I6L B;  2C60 A;  1E5W A;  2FCM A;  5CTR C;  4NAW B;  2BYF A;  2MP2 B;  2MBQ A;  1PQS A;  1E90 A;  2D07 B;  3ZNG C;  2ZEQ A;  4AJW A;  4IM2 A;  4ZRK A;  4ICV A;  2BWE S;  4FHK A;  2BGF A;  4FHJ A;  1R4N I;  1WJ6 A;  1WXA A;  1WJ4 A;  1YD8 U;  2B3A A;  4HDQ A;  4LJO B;  4K1R B;  2OOB B;  2LJ5 A;  2FCS A;  2HJ8 A;  3L16 A;  4BBN F;  1QZE A;  3H7S A;  2K25 A;  2AEH A;  1UEL A;  1WGD A;  1WR6 E;  3M95 A;  4KZC A;  4TV3 A;  3TBL D;  2KVR A;  3IG3 A;  4DHZ B;  5D2M B;  1S3S G;  1JRU A;  1H8C A;  3RCZ A;  4HCP B;  2D2Q A;  2PE9 A;  3ZDM C;  2LVP A;  1Q5W B;  3DBR I;  2Z59 B;  4BFR A;  5J17 A;  4ZDV A;  3ENE A;  3QHT A;  2DAJ A;  2UYZ B;  3PLV A;  4B6W A;  3TL5 A;  3RD2 A;  1V6E A;  4FJV B;  2ZVO A;  4BOS C;  3ZNH B;  3A9K B;  4IC7 B;  1WF9 A;  2MLB A;  2XK5 A;  2OJR A;  3W1S C;  1KOT A;  3H9D A;  1WZ0 A;  5DPR A;  3KUD B;  3O65 B;  3JYU A;  4JGH B;  3PRM B;  2UWQ A;  4W9G A;  2ZCC A;  2KDB A;  3H1U A;  3VTW A;  1Z2M A;  3DVG Y;  3ZTC A;  2J0K A;  3CMM B;  4JL9 A;  3JSV B;  2MRP A;  2DZI A;  2XK5 B;  5L95 C;  2A4Z A;  1EUV B;  1OEY J;  2K1F A;  2LRW A;  3B08 A;  4ANV A;  3W1S A;  1WX9 A;  3QK0 A;  4CYE A;  3A9J B;  4KV2 A;  4WWO A;  4W9E A;  3ZDT A;  4E74 A;  1E7U A;  3AXC A;  3V60 A;  4KSK C;  3ZKJ C;  4PYZ A;  5CHW A;  2J0M A;  2NS5 A;  2ZCB A;  5C23 A;  3T8M A;  3KYD D;  5D7G A;  1WM3 A;  2DEN B;  3LDZ E;  2MBO A;  3M62 B;  2RGF A;  4RM9 A;  1J8C A;  2XEW A;  2DHZ A;  2GBK A;  4LCD E;  3A9J A;  4RM8 A;  3PHX B;  4M8M A;  4BVU C;  3K9O B;  2K8H A;  4GXB A;  4X57 B;  1I42 A;  4G3X B;  1EO6 A;  1YQB A;  3TJP A;  3DBL I;  2GOW A;  2O6V A;  4IWO A;  1WFY A;  4IM0 A;  5FR6 A;  1WE6 A;  1UBI A;  1E8X A;  2BWF A;  2JT4 B;  3B0A A;  2L3Z A;  2K6D B;  4MH0 E;  5E6O A;  1UD7 A;  2IZV B;  4MGZ E;  2N4F A;  4JIO U;  2DZM A;  4HPM B;  3RZW C;  3ML8 A;  1I35 A;  3OAW A;  4PS3 A;  3EHV A;  2I1K A;  3SHQ A;  2MBB B;  5DCN A;  1TTN A;  1E8Y A;  1YX5 B;  4URK A;  3EC8 A;  4NQK E;  3PSE B;  2LI5 A;  2KJH B;  1WYW B;  4FA6 A;  2L8J A;  4EZK A;  4ASW C;  3RUL A;  2GBR A;  2LXC A;  2EKE C;  4XZ4 A;  5TR5 A;  3MJW A;  3WAL A;  1WGY A;  3IFW B;  5DPS A;  1GC6 A;  1Q0W B;  2ZNV B;  1WJU A;  1E8Z A;  3GOE A;  3QAQ A;  4KZ0 A;  4W9F A;  4FBJ B;  4W9K A;  2LAS A;  2N9X A;  2G3Q B;  2NVU I;  2KAN A;  4CHK A;  3X0W A;  3A1Q A;  2NCN A;  2R2Q A;  3IHP C;  3NS8 A;  4ANU A;  3PV1 A;  2RD0 A;  2KLG A;  4E71 A;  4JLC A;  3UIO B;  2KMA A;  2FUH B;  4FLH A;  4MSM B;  2KC2 A;  2PPH A;  2MP2 A;  4W9C A;  4HLE A;  2KTF A;  3ML9 A;  1G6J A;  2FIF A;  2PJH A;  2YVC A;  2AL6 A;  3DVN U;  1UZX B;  3PGE A;  3QC8 B;  2LD9 A;  4PYU A;  3T9L A;  1V49 A;  3A1Q B;  4HXD A;  4F8C B;  5AEK B;  2KKC A;  2ZNV C;  3LJ3 A;  2D10 A;  4K81 A;  5JZE B;  2M1M A;  4FJZ A;  4FJY A;  3RYT A;  4MEM A;  4HJK A;  1A5R A;  5EDS A;  2KFJ A;  4WJQ A;  3PT2 B;  3UF8 A;  3QQ8 B;  2G4D B;  1TGZ B;  2LVO A;  3C0R B;  2RPQ A;  4E3C A;  3L0W B;  2L0F A;  5IAA C;  4EOY A;  2MCN B;  3DVN V;  4DK5 A;  3EEC A;  3ZIM A;  2WX0 A;  1J0G A;  1C3T A;  2L0T A;  2DYB A;  5J2R A;  2CHX A;  2KLC A;  1YIW A;  2MW5 A;  1WGG A;  2L7R A;  3OJ4 B;  3VH3 B;  3ZLZ A;  5JHB A;  3ZVV A;  2DX5 B;  3QAR A;  4AJY B;  5CHF A;  4LDT B;  4ICU A;  1LM8 B;  4BKT A;  3ZNZ B;  4AWJ A;  2JY6 A;  3R3M A;  3DOW A;  3R7Q A;  1X1M A;  3AU4 A;  1Q1O A;  2GBM A;  2CKH B;  2L76 A;  1Z5S B;  2KJ6 A;  2VRR B;  3DPD A;  1BT0 A;  4N9F 4;  4W9H A;  2MX2 A;  4GMV A;  1WGH A;  1E7V A;  4CO7 A;  2KO3 A;  1RLF A;  3DBH I;  3DQV A;  4BKS D;  1LXD A;  2CHW A;  3R7R A;  2LRU A;  3V62 A;  3P2B A;  3X23 A;  2FID A;  1GG3 A;  2N9E B;  4EKU A;  2KZR A;  2NR2 A;  4MJS B;  4WQO B;  2JRI B;  4HPL B;  3HK0 A;  5AZG A;  3KUC B;  1D3Z A;  4F7Z A;  3DBS A;  1T0Y A;  2IO3 B;  4K7W A;  5AZH A;  2JUO A;  1Y8R C;  3ZRF A;  2PEA A;  4G0N B;  1EF5 A;  2CS4 A;  1OTR B;  2KWU B;  3UIP B;  5J18 A;  2Z0E B;  3NHE B;  3VQI A;  2C7N B;  2PE6 B;  3R66 C;  2G45 B;  4NJ7 A;  3VUY A;  1WZ3 A;  1SE9 A;  4DXA B;  2KX3 A;  3L08 A;  3PS6 A;  3KH0 A;  2LGX A;  2JPH A;  1IPG A;  1NBF C;  1NDD A;  2N1V A;  3L13 A;  3PRZ A;  3ONS A;  4I6P A;  1TBE A;  5D94 A;  1HE8 A;  3CSF A;  4PS7 A;  5E6N A;  4K7S A;  2D11 A;  1IYF A;  4NY0 A;  2KFK B;  3CF6 E;  2KMC A;  3N30 A;  4FAD A;  1GUA B;  2O6V B;  4GDL B;  5G55 A;  3KVF B;  1YJ1 A;  2MQJ A;  2MA9 B;  5JHA A;  1E8W A;  1NI2 A;  2V3S A;  4ANX A;  1FXT B;  3KW5 B;  2QHO A;  1MG8 A;  2G4S A;  2JZZ A;  3NZS A;  3TIX A;  2EMT A;  1VCB A;  2KQ7 A;  3ALB A;  3U7D A;  3RZF A;  1KJT A;  2BKF A;  2FCQ A;  2BPS A;  5AZF A;  2HTH A;  5HKH A;  2KC1 A;  3WAM A;  1P98 A;  1WH3 A;  3CST A;  1VD2 A;  4M0W B;  1S1Q B;  2AWT A;  3ZTD A;  2L00 B;  3VTV A;  2KOX A;  4XC2 A;  2ASQ A;  4M8N A;  3A33 B;  3U8Z A;  4OVU A;  3Q3J A;  5LLI A;  3PZD A;  1TZ1 A;  2RR9 A;  3S2A A;  1WE7 A;  2KXJ A;  3KUZ A;  2JXX A;  1ISN A;  1J19 A;  2HD5 B;  2KK8 A;  1UBQ A;  3PHW B;  4IM3 A;  5LXI B;  3GZN I;  4AUQ C;  4J6I A;  3IBE A;  3JW0 X;  2NBW B;  2KWV B;  1V2Y A;  2DYO A;  2LGY A;  1V81 A;  3WAN A;  4EZJ A;  3PRP B;  2XBB C;  3VUX A;  2YLM A;  2FAZ A;  2V1Y A;  2DYM A;  2GMI C;  4KVG B;  1IP9 A;  1P9D U;  5D6J B;  3U30 A;  4AOF A;  3VXW A;  5G2N A;  4ZRI A;  4EUT A;  3AU5 A;  2JVC A;  3QA8 A;  4MDK E;  2AL3 A;  1SIF A;  2C7M B;  4MEL A;  4MGK E;  1UGM A;  3PLU A;  1P1A A;  4ZRJ A;  4BKS A;  1GJZ A;  2I1J A;  2WDT B;  3EFU A;  4IWQ A;  4TQ1 A;  2N7E A;  3PPA A;  3MHS D;  3MTN B;  2IBI B;  1V86 A;  3UGB B;  1WX8 A;  4TQ0 A;  3TCA A;  2IO1 B;  1V5T A;  1U4A A;  4ANW A;  5KHQ A;  4TKN A;  1LFD A;  3AI5 A;  3HIZ A;  1KLV A;  3APD A;  1XD3 B;  2DZJ A;  4KDL B;  2GBJ A;  2CU1 A;  2ZZP B;  3KYC D;  2O6V D;  3M63 B;  4GU2 A;  3VTU A;  1V9J A;  2KDI A;  3WIM A;  3UQB A;  3DDC B;  5KHO A;  1M94 A;  2K8B A;  4WWP A;  3VVW B;  4MSQ B;  2FCN A;  4YL8 A;  1AAR A;  3H7P A;  3OJ3 A;  3PVL A;  4A3O A;  1WXV A;  2N9P C;  2N7D A;  4GDK A;  2GBN A;  3DCG A;  3AUL A;  2W9N A;  3VUW A;  1V5O A;  3DVG X;  4IW0 A;  3SD5 A;  1V80 A;  2IO0 B;  4W9L A;  2KN5 A;  3ZUN A;  3QIJ A;  1K8R B;  4IUM B;  3W1Y A;  2FNJ B;  2AYO B;  3H6N A;  4GIV A;  3WAP A;  2V4L A;  2MWS B;  4LDT D;  3QWZ B;  4DWF A;  3D32 A;  1F9J A;  3V61 A;  2N1W A;  5C1Z A;  4WJN A;  1EF1 A;  2KJR A;  2REX A;  3BIN A;  2EMS A;  5DPW A;  3RT3 B;  3V6C B;  2M0X A;  2M17 A;  3NOB A;  1WX7 A;  1YX6 B;  2DAF A;  2KWC A;  1WMH A;  4WAA A;  2RSU A;  3HHM A;  2Z0D B;  3PRE A;  4BKG A;  2IY1 B;  1WI0 A;  3QJZ A;  5GMV A;  4HK2 A;  4WJP A;  2KX0 A;  2Y5B B;  1OGW A;  4NQL B;  2K6Q A;  1WXS A;  1WMH B;  2M4N A;  5IA7 A;  3QX1 A;  4FUL A;  4II3 B;  4MGI E;  2MBH A;  1ZW7 A;  4DBG A;  4EZL A;  2KHW B;  4HDO A;  4KDI C;  4WJO A;  3Q3F A;  3N32 A;  2IY0 B;  1WM2 A;  1OEY A;  1H4R A;  4PS8 A;  3VDZ A;  3APF A;  3TMP B;  2J7Q B;  3I3T B;  1L2N A;  1LQB A;  2JF5 A;  3UQA A;  1XT9 B;  2WWZ A;  3UIN B;  5JH5 C;  4JQW C;  2BYE A;  4MGY E;  2KQS A;  2MSE D;  4EFO A;  1WR1 A;  2IYD B;  4I6N B;  4B95 A;  4F1S A;  2CR5 A;  1WRD B;  4HCN B;  4W9D A;  3L17 A;  2ZJD A;  5BO4 B;  3A4S C;  4P7I A;  3VFK A;  3V6E B;  2KD0 A;  2JWZ A;  3VAW A;  4BBN C;  4GSW A;  1ZGU B;  2NBU A;  2WX1 A;  3NY5 A;  3NZU A;  5DPT A;  3JSV A;  1UH6 A;  2MBE A;  4NPN A;  4GB9 A;  3ZNI D;  3ZO5 B;  4FN2 A;  4A3P A;  4IG7 B;  2LXA A;  1GNU A;  2LWP A;  3L10 B;  1WY8 A;  4DHJ D;  3ECI A;  3IVF A;  4MM3 A;  2JZ3 B;  1RAX A;  5LXH A;  1L7Y A;  5CX3 A;  3HM3 A;  4NJ6 A;  4W9J A;  3M3J A;  3VH4 B;  1OQY A;  1CMX B;  1XQQ A;  4GGQ A;  4KSL C;  3L54 A;  3A9K A;  5E6P A;  4LJP B;  3WA0 A;  4AP4 C;  4II2 B;  4HWI B;  2M8S A;  2L05 A;  2KDF B;  4GOC A;  2CHZ A;  3WAO A;  3H7P B;  2ZVN A;  1ZKH A;  4A20 A;  1P0R A;  2IO2 B;  2NPT A;  2C9W B;  3SU8 X;  1SGH A;  4B9K A;  3OLM D;  1R4M I;  4GN1 A;  2BKR B;  2KDE B;  4ZYN A;  4DHJ B;  4NNJ B;  2C7H A;  2ZPN A;  4IWP A;  2K8C A;  3N3K B;  4HVB A;  4KIK B;  3K9P B;  4DDI D;  2C5L C;  2BF8 B;  5L83 A;  2NPT B;  3QCA A;  2KTR A;  2O2V A;  3A4R A;  4MJS A;  2KFK A;  4G50 A;  2NBV B;  2D3G A;  4GDL A;  2DZK A;  3VHT C;  1RRB A;  1WGR A;  3JVZ X;  1WXM A;  4KIK A;  2BYV E;  3HM6 X;  4GDK B;  2KTR B;  2O2V B;  4BOZ B;  4DHZ E;  3BY4 B;  3APC A;  1C1Y B;  2WYQ A;  2J0J A;  4RMA A;  4WWN A;  3ZRC A;  2HE7 A;  4K7U A;  2A5U A;  1P3Q U;  3SDL C;  2LGD A;  2KNB A;  2ZPY A;  3PTF C;  4OVV A;  1GC7 A;  2LVQ A;  1RFA A;  1WIA A;  2R2O A;  4NAW A;  4W9I A;  2K39 A;  4EEW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...