4W9LA

Pvhl:elob:eloc in complex with (2s,4r)-1-((s)-2-((s)-2-acetamido-3,3-dimethylbutanamido)-3,3-dimethylbutanoyl)-4-hydroxy-n-(4-(4-methylthiazol-5-yl)benzyl)pyrrolidine-2-carboxamide (ligand 15)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
103
structure length
101
Chain Sequence
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGEGFTSQTARPQAPATVGLAFRADDTFEALIEPFSSPPELPDVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Transcription elongation factor B polypeptide 2
publication title Structure-Guided Design and Optimization of Small Molecules Targeting the Protein-Protein Interaction between the von Hippel-Lindau (VHL) E3 Ubiquitin Ligase and the Hypoxia Inducible Factor (HIF) Alpha Subunit with in Vitro Nanomolar Affinities.
pubmed doi rcsb
source organism Homo sapiens
total genus 22
structure length 101
sequence length 103
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4w9lA00
3SU8X 4AOFA 4BOZB 4IG7B 1WF9A 3UINB 2AL6A 4DDGD 1V6EA 3DVNU 1WFYA 4DHZE 1WX7A 2HTHA 5DPTA 2AL3A 3AXCA 1J8CA 4WAAA 4WJOA 3JW0X 2DZIA 2UYZB 2XK5B 4EZKA 3DBLI 1L2NA 1MG8A 2BWES 4P7IA 4DHZB 3SD5A 2MP2A 5LXIB 4GU2A 2JXXA 2LD9A 2EKEC 2LGXA 2HD5B 4JLCA 2C60A 3APFA 1UBQA 1P9DU 3HHMA 3MJWA 5IA7A 4ZRJA 1TTNA 5C23A 3RD2A 3ZRFA 5AEKB 3AU4A 2D10A 1WE6A 4GIVA 4HK2A 3PLVA 2C7MB 2LWPA 2ZVNA 2PE6B 1V49A 2OOBB 4BKSD 2IBIB 2DAFA 3B08A 4GN1A 4RM9A 1Y8RC 3VUYA 3EECA 4GDLA 1P98A 1WM2A 2KXJA 3W1SC 5CHWA 2C9WB 4RM8A 4KIKB 1S1QB 5FR6A 2DZJA 5J17A 3TCAA 3OLMD 4TQ1A 3NHEB 3PLUA 1E90A 4W9GA 2FUHB 4IW0A 1BT0A 2JRHA 5L83A 5D2MB 2M17A 3PHXB 4IUMB 1YQBA 3IBEA 3N30A 3VXWA 4F1SA 3ML9A 1XT9B 1CMXB 4PYZA 2KTFA 2LRUA 3H7PA 4W9CA 5DPWA 2JVCA 2ZVOA 2GBMA 4BVUC 1Z5SB 2ZEQA 4LDTB 4DHJB 1F9JA 1WGYA 1FXTB 1V5OA 3JSVB 1WRDB 3L16A 4KVGB 4W9HA 1WR6E 3H1UA 3V62A 3DOWA 2W9NA 1P1AA 3VTWA 2FIDA 2M4NA 3RYTA 2GOWA 2IO1B 5CX3A 1WJUA 4MSQB 4II3B 1WX9A 1WIAA 3QARA 2YLMA 4PS8A 2L76A 2N1WA 5E6NA 2J0MA 3I3TB 2M8SA 3EFUA 2N9EB 2MX2A 1NBFC 1E8ZA 2XBBC 4DDID 2J7QB 3PRZA 4KV2A 4EUTA 4FN2A 1E5WA 3RT3B 4MGZE 2EMTA 4NAWA 2CHZA 4TKNA 4F7ZA 4K1RB 1TBEA 2R2QA 3A9JB 5C1ZA 2OJRA 2KDEB 2WYQA 3EHVA 2MBQA 4MGKE 2RR9A 1WGGA 2KK8A 2L8JA 2VRRB 3ZKJC 2IYDB 1GUAB 3CF6E 4GXBA 3ZLZA 1K8RB 3QA8A 5E6PA 1H4RA 3VH4B 2MP2B 4FHKA 4KZ0A 4IM0A 4I6NB 4BBNF 5EDSA 4WWNA 2LI5A 2NCNA 3X23A 2KTRA 1EO6A 4PS3A 3ZNZB 5AZFA 1WJNA 2FNJB 4DHJD 1V80A 1GG3A 2MRPA 5DPSA 2K6DB 3L0WB 2IO3B 4MGYE 2KMAA 3TIXA 4DWFA 1WGDA 4IWPA 3QC8B 4B95A 1S3SG 1VCBA 3RULA 2L00B 2G4DB 3DBSA 4BBNC 3IG3A 3JVZX 3QX1A 4GDLB 4CHKA 3UF8A 4AJYB 2KMCA 2GBNA 4GSWA 3ZIMA 4W9LA 3DQVA 5LLIA 4A3OA 1VD2A 4URKA 2WX0A 4ANWA 1IPGA 3PVLA 3ZNGC 4W9IA 2KLCA 3NZUA 5JHBA 3OJ3A 4B9KA 2KANA 1WX8A 4W9DA 5CHFA 1P3QU 1UD7A 2CS4A 3NS8A 4E74A 2IY0B 5JH5C 1L7YA 1Q1OA 1JRUA 2XEWA 3WA0A 4GOCA 3KUCB 1C3TA 1OGWA 2KVRA 2FCSA 3IVFA 1RRBA 3Q3FA 4CYEA 2L7RA 3T9LA 4G3XB 4MGIE 1T0YA 2N9XA 3TBLD 4FADA 4ZRKA 4W9JA 4EOYA 1XQQA 1UELA 2LXCA 2L0FA 1GC7A 2NR2A 2I1JA 3IFWB 3S2AA 3VUWA 2NPTA 4G11A 5CHVC 2MQJA 2LVOA 2N7EA 3MHSD 2LRWA 5CTRC 3QCAA 3P2BA 1WH3A 4WQOB 2MCNB 1OQYA 1OEYA 4NAWB 3GZNI 3PZDA 4E3CA 2C5LC 2WDTB 3U30A 2KDIA 1Q5WB 4WJQA 3A4RA 1U4AA 5IAAC 1RAXA 4WJPA 2JY6A 4NQLB 3M95A 1C1YB 2BPSA 3DPDA 3M62B 2L0TA 2ZZPB 1ZGUB 3CMMB 3ENEA 2JPHA 5D94A 4IM3A 4FHJA 4GGQA 4WWPA 3RZWC 3GOEA 1WXVA 2NBVB 3KUZA 1I35A 3A4SC 2KTRB 3VAWA 4PYUA 1E8XA 2ZJDA 2KN5A 1WR1A 4NNJB 4TV3A 1KOTA 4HVBA 5D7GA 3ZTCA 1GNUA 3CSTA 3PT2B 3R7RA 1Z2MA 1YX5B 3PS6A 5G55A 4CO7A 2BWFA 4M8MA 1KM7A 1WGRA 3ZVVA 3UIOB 3QQ8B 2GBRA 4AWJA 4FBJB 2DYBA 4W9KA 3WAOA 2PE9A 2BKRB 3TMPB 3QK0A 3ZUNA 4ASWC 4XZ4A 3V60A 1RLFA 2GMIC 3A9KA 4JQWC 4TQ0A 3NZSA 2KX3A 2ASQA 1KJTA 2D07B 2LGYA 4XX5A 3VFKA 2J0KA 2MBEA 2DYMA 4HDQA 4MDKE 2NBUA 4MJSA 3ZNID 2MBBB 2K8HA 1EF1A 2BGFA 4FLHA 2GBJA 2V1YA 4FJZA 4EEWA 5AZHA 4BKTA 2A4ZA 2IO2B 3CSFA 1QZEA 1TZ1A 3PGEA 2NVUI 1WY8A 1E7VA 1Q0WB 2AYOB 2JZ3B 2WWZA 3NOBA 2ZCCA 2DHZA 4N9F4 3KW5B 3QHTA 3V61A 2ZCBA 3APCA 1WMHA 3QWZB 3RUIB 2Z59B 1M94A 2N7DA 1TGZB 4IM2A 2MBOA 2CHWA 3EC8A 1R4MI 4NQKE 1UH6A 4BFRA 1IYFA 2KQSA 2UWQA 3PTFC 4KSKC 3ZTDA 4A3PA 4HXDA 1LXDA 3WIMA 2AEHA 2K8CA 3L10B 1WZ0A 3L54A 4TUUA 3W1YA 2KJRA 3DVGY 3AU5A 3ALBA 1WM3A 2NPTB 4DXAB 3BINA 2KFKA 1UBIA 2C7NB 4J6IA 4ZRIA 2BF8B 2KLGA 3VTVA 1WJ4A 4JIOU 2K25A 2RPQA 3DCGA 4G50A 2Y5BB 1ISNA 1V5TA 2MW5A 3K9OB 4IC7B 4ANVA 3R66C 1OTRB 2JRIB 3VUXA 3HK0A 3RZFA 2M1MA 1EF5A 3APDA 3VQIA 5DCNA 2B3AA 5G2NA 1GC6A 1WGHA 4GB9A 2HJ8A 1AARA 2LVQA 2YVCA 1YD8U 2C7HA 4G0NB 4HCPB 3VH3B 5AZGA 5TR5A 4W9EA 3O65B 4JL9A 3R7QA 2PJHA 2KDBA 3BY4B 3ZDTA 2ZNVC 2CU1A 2O6VA 3H7PB 5KHQA 2LXAA 2KD0A 3A1QA 2KO3A 2REXA 4EZJA 2KKCA 2ZNVB 4MELA 1YIWA 3KH0A 4I6PA 3TJPA 2K8BA 3QJZA 4GDKA 2D11A 3ZNHB 3PRPB 4M0WB 4ANXA 1V86A 2KC1A 2FCNA 3PREA 2M0XA 4JGHB 4KZCA 4MEMA 3ONSA 3T8MA 1E7UA 4ICUA 2LASA 3JYUA 2FIFA 3Q3JA 3A9KB 2BYFA 2RD0A 3ZO5B 3H7SA 2NBWB 3DBHI 2L05A 4I6LB 4LJOB 3WAMA 4ZYNA 1LM8B 4AJWA 2IY1B 2JUOA 2L3ZA 4EFOA 2ZPYA 1NI2A 4EZLA 4MJSB 4NJ6A 3TL5A 3H6NA 4MM3A 3SHQA 1SE9A 1ZKHA 4M8NA 4ZDVA 2DZMA 3R3MA 2O2VA 3DVNV 4BKSA 1SGHA 4HWIB 2I1KA 2KOXA 3X0WA 3UQBA 2G3QB 3LDZE 3UIPB 5L95C 2BKFA 1SIFA 3ECIA 5J18A 3KYCD 1V9JA 1WZ3A 4RMAA 2MBHA 2KNBA 3V6CB 4X57B 1WMHB 4KDLB 4NPNA 3VVWB 4AUQC 4OVUA 1YJ1A 4ANUA 4EKUA 5J2RA 3KVFB 4IWOA 3DBRI 1D3ZA 2HE7A 2RSUA 1GJZA 4MSMB 1V2YA 2DAJA 2PPHA 3B0AA 3PPAA 3PV1A 4F8CB 5JHAA 2G45B 3K9PB 3HM6X 4LJPB 5JZEB 2DZKA 2N4FA 3MTNB 3VTUA 2KFKB 5BO4B 4BKGA 3ZW3A 4HLEA 2KWCA 2LGDA 3C0RB 2DX5B 3VHTC 4HCNB 1P0RA 1R4NI 2G4SA 4KSLC 2XK5A 2Z0EB 2ZPNA 2KHWB 4FA6A 2IO0B 5DPRA 3L17A 2QHOA 3A33B 2DENB 1KLVA 2MSED 4WWOA 4BOSC 2FAZA 2BYEA 3KUDB 4B6WA 1LFDA 4FJYA 3N3KB 1A5RA 2GBKA 3PHWB 4PS7A 1WYWB 1OEYJ 4HPLB 4K7SA 1RFAA 4A20A 1H8CA 1X1MA 4HPMB 4E71A 3UGBB 1J19A 1V81A 1XD3B 3B1LX 3RCZA 1WJ6A 2O6VB 2WX1A 4NJ7A 4W9FA 3IHPC 1E8WA 2KDFB 1J0GA 2D3GA 2KJHB 4IWQA 1UZXB 4WJNA 4GMVA 2LJ5A 3A1QB 3WAPA 1I42A 3LJ3A 1EUVB 3M3JA 1WI0A 3QIJA 4K7UA 3M63B 4KIKA 5GMVA 2A5UA 3VDZA 2K6QA 2KWUB 3D32A 4HDOA 4KDIC 4GDKB 4K81A 2PEAA 2CR5A 5LXHA 2J0JA 1PQSA 3DVGX 3W1SA 4OVVA 4MH0E 2N1VA 3L13A 1NDDA 5HKHA 2MLBA 3PSEB 2EMSA 3QAQA 1HE8A 2MA9B 3PRMB 4FULA 3OAWA 2LVPA 3KYDD 3ZRCA 3DDCB 4NY0A 1ZW7A 2KZRA 1IP9A 2KC2A 3UQAA 2KJ6A 2BYVE 1YX6B 2KWVB 2IZVB 2JT4B 2K1FA 3AI5A 3JSVA 4XC2A 5D6JB 4HJKA 2K39A 2V4LA 2DYOA 2D2QA 2FCMA 2JZZA 2KFJA 2KX0A 3NY5A 4LDTD 2JF5A 1WXMA 3V6EB 3ZDMC 2KQ7A 2O2VB 2AWTA 2JWZA 1LQBA 2RGFA 3OJ4B 2FCQA 1UGMA 2Z0DB 4II2B 4YL8A 3U7DA 3WANA 3SDLC 2NS5A 2O6VD 4AP4C 2LUEA 2V3SA 3U8ZA 3WALA 2MWSB 3HIZA 1E8YA 3HM3A 2CKHB 2LZ6A 1WXAA 5E6OA 1G6JA 2N9PC 3H9DA 4FJVB 3AULA 4ICVA 4DK5A 2R2OA 4LCDE 4DBGA 3L08A 1WXSA 1WE7A 3N32A 3A9JA 3ML8A 4K7WA 2CHXA 5KHOA
chains in the Genus database with same CATH superfamily
3SU8X 3TSSA 5DPTA 1NI3A 3JW0X 1MG8A 1KF6B 3SD5A 4GU2A 1D6EC 2JXXA 2LD9A 2EKEC 5BMHA 2L83A 2HD5B 1P9DU 1XXGA 3MJWA 3NVYA 4ZRJA 4HROA 1ZUD2 2IDYA 3AU4A 3AEEB 1D4BA 1L4ZB 1WE6A 4HK2A 3PLVA 2ZVNA 1V49A 2BB5A 2IBIB 2J4XA 4GDLA 5CHWA 2C9WB 4KIKB 1VZ7A 2DZJA 4TQ1A 1PGXA 5FR3A 4W9GA 4IW0A 1SE4A 1BT0A 1N5WA 4RGMA 5D2MB 2M17A 1A70A 3N30A 3VXWA 4YXDB 2LRUA 5IO9A 2GBMA 1I4XA 2ZEQA 4DHJB 1F9JA 1UGJA 2BTEA 3L16A 4KVGB 4W9HA 3V62A 2LEKA 3BK2A 2FIDA 2VH2A 2L52A 1XLNA 1ZDXA 2OJWA 3RFZB 1QKZA 4H2AA 2MX2A 3NVVA 4KV2A 4N58A 4R3DA 2CHZA 4TKNA 4AS1A 1TBEA 2R2QA 2WXGA 3A9JB 2Z8LA 2WYQA 1QILA 4A6QA 3EHVA 2Y3AA 2KK8A 1ZDVA 2IYDB 3P4QB 3VH4B 4WWNA 2FE8A 4K3CA 3X23A 2K5PA 1WGKA 3ZNZB 1KFYB 2PLPA 3EA6A 2MRPA 3AE2B 5DPSA 1EU4A 3L0WB 2IO3B 2KMAA 1WGDA 1XLPA 3QC8B 2WU2B 4BBNC 2M19A 4AJYB 3GZNB 3DQVA 2WP9B 4URKA 2WX0A 3PVLA 4HRSA 3OJ3A 4B9KA 1Q10A 1VZ8A 1WX8A 2CS4A 4E74A 3NS8A 5JH5C 1E7PB 1UF0A 1JRUA 1D5ZC 4YSXB 1OGWA 3Q3NC 2KVRA 2FCSA 1JRPA 1RRBA 4OZAA 2DLBA 2J53A 3T9LA 4MGIE 2N9XA 3TBLD 5EE9A 4RGTA 1C78A 2L0FA 3IT4B 2CJOA 3VUWA 2NPTA 1R4NB 4LK0M 2WXQA 1I4QA 4A8XC 2MQJA 2K22A 2LVOA 2N7EA 3P4SB 5CTRC 1WH3A 2QCZA 1P7FA 1D5MC 2MCNB 1OQYA 1C4PA 3PZDA 2WDTB 2W3RA 5IAAC 3M95A 4LNFA 3DPDA 3M62B 2ICIA 2MJEA 1V8CA 4LNKA 3GOEA 4C56C 1R4MB 1YJIA 1F0ZA 2KTRB 1E8XA 4NNJB 1KOTA 3ZTCA 1GNUA 3R7RA 4M0WA 1UWMA 3WCQA 2K9XA 1KM7A 4D2KA 4AWJA 1PUTA 4W9KA 1K52A 2WXNA 1UWXA 3ZUNA 4XZ4A 3LB8C 4TQ0A 2PTLA 2WDVB 1KJTA 3VFKA 2DYMA 3AE4B 1EWCA 2ZW0A 4REZA 2W54A 3ZQ4A 2V1YA 4FJZA 4BKTA 2A4ZA 1TS4A 3C8YA 3CSFA 3PGEA 4HPPA 2KAJA 1SSNA 2NVUI 1Q0WB 1FEHA 2WWZA 2ZCCA 3B9JA 3ETRA 4M01A 3RUIB 2Z59B 1M94A 2X8XX 2CHWA 4ZRQA 4BFRA 2KQSA 2UWQA 4PT5A 2AX5A 4A3PA 2KJRA 3DVGY 3OWEB 3ALBA 1UBIA 2C7NB 2BF8B 1T0QC 3HRDD 2Y5BB 2MW5A 4IC7B 2JRIB 3RI7C 3U4EG 3AECB 3VQIA 3NRZA 1MHXA 2MJDA 3Q3OC 4W9EA 3R7QA 3ZDTA 2ZNVC 2CU1A 2O6VA 3B2GA 1I4GA 1HZ6A 1ZXHA 2ZW1A 1JWSD 2LXAA 3W5VB 1B9RA 1ZP0B 2K8BA 1YN4A 3PRPB 2IGDA 1FCCC 4ANXA 4JGHB 1YN3A 2RD0A 3ZO5B 3H7SA 4I6LB 3DBHI 2L05A 1XLOA 4AJWA 2IY1B 2JUOA 3FILA 1YJJA 3AH7A 2PVGC 3H6NA 3SHQA 4ZDVA 2DZMA 3DVNV 4HWIB 2KOXA 3X0WA 1D5XC 3RNBC 1SIFA 1KRHA 3ECIA 4RMAA 2MBHA 4RCOA 2KNBA 1YJ1A 4ANUA 5J2RA 2RMMA 3U2SC 5MPOA 3PPAA 1BUIC 4F8CB 2TSSA 3K9PB 5JZEB 3Q8AA 3MTNB 4HLEA 4HCNB 1P0RA 2BYEA 3KUDB 4MACA 1VZ6A 1UNSA 1FPYA 3N3KB 2GBKA 3PHWB 4PS7A 1OFFA 4HPLB 1RFAA 1YOVB 2QILA 1H8CA 4E71A 1J19A 1V81A 3Q8FA 4KKJA 2WX1A 4ARCA 3IHPC 2D3CA 4GMVA 4HKQA 4OW0A 3LJ3A 1WI0A 3QIJA 4K7UA 4KIKA 4XE0A 2WDQB 4LLGM 2K6QA 3D32A 4GDKB 2QIEB 4K81A 2KT7A 5G5HA 2MLBA 3PSEB 2EMSA 2L32A 4FULA 5JHAA 2WDRB 2LVPA 2IJ0A 1MJDA 1ZE3D 1IP9A 2KJ6A 1YX6B 2JT4B 2K1FA 5D6JB 5G5GA 2G9HD 1R7SA 4MM3B 4LDTD 5H8YE 3CIRB 3V6EB 2KQ7A 1CJEA 2RGFA 4JX1C 4II2B 3U7DA 1PFDA 1C9FA 2NS5A 2LUEA 4HKZE 4Q2JA 3V05A 5E6OA 1G6JA 2N9PC 3H9DA 3URYA 4DK5A 1XF5L 3A9JA 3ML8A 3TIXA 2JX5A 1FNUA 1WF9A 2AL6A 1V97A 1WFYA 4DHZE 1J8CA 4WAAA 4WJOA 1ET6A 1JWMD 5AUIA 1L2NA 1J7AA 2LGXA 3NG0A 3APFA 3HHMA 3N1XC 4C7ZA 3U52E 5IA7A 4XWTA 2D10A 1FCLA 2LWPA 3AEDB 4BKSD 3B08A 5T8IA 4C4VB 2WQYB 1P98A 3W1SC 5FR6A 3ZXVA 5J17A 1S1QB 3TCAA 1TZOA 2KN4A 3OLMD 4LNNA 4OVZA 2FUHB 2UU7A 2JRHA 2L1AA 4ZRPA 1YQBA 3IBEA 1T5XD 4F1SA 2WS3B 1XO3A 3RNGC 1CMXB 4W9CA 2K3UA 2JVCA 1SE2A 2ZVOA 1ESFA 4ITKA 1V5OA 1TT5B 3H1UA 3J9CA 1C79A 4L23A 3AM9A 2M4NA 2NTSA 1WJUA 3AMZA 1WIAA 2YLMA 2J0MA 3I3TB 1JWBD 5BYQA 2CJNA 1FXIA 2M8SA 3EFUA 4P1CC 1E8ZA 2XBBC 4DDID 4YTMB 1C76A 2DWQA 1E5WA 1JMLA 4MGZE 3KWVA 3AE7B 4N59A 5C1ZA 2KDEB 4MGKE 3RNFC 1JQ4A 2VRRB 3NUHB 3VRAB 3ZLZA 1K8RB 3DWMA 4S0RA 4I6NB 2WXJA 2W55A 2KTRA 1DGJA 4PS3A 4WURA 2JQRB 3NJTA 2V4IB 2G4DB 3DBHB 1QOFA 3QX1A 1AWDA 3UF8A 2GBNA 4GSWA 3ZIMA 5LLIA 2WXFA 4WWMA 3ZNGC 2KMMA 5CHFA 1F77A 2IY0B 1L7YA 5LNK1 3KUCB 2BYTA 1FXAA 3IVFA 3ZJTA 4A55A 2L7RA 4G3XB 1UELA 1F2RI 3SR6A 3S2AA 2H89B 4GLSC 4NAMA 1L0VB 2LRWA 1J7CA 3TEZA 4NAWB 1SEBD 2C5LC 2Y5CA 3E56A 3U30A 3AEFB 1Q5WB 4WJPA 2FUG1 4XWWA 1RFKA 2BPSA 1I4HA 4IM3A 4WWPA 3BK1A 4GGQA 3RZWC 3EFCA 3HVDA 1EM7A 1EWYC 1SIJA 4LNOA 1FRDA 2J42A 2ZJDA 1MVKA 2JU6X 1WR1A 3CSTA 1ZOYB 1N6ZA 3PS6A 2KYWA 4CO7A 3ZVVA 2JWUA 2BKRB 4ASWC 2LHDA 1RLFA 2GMIC 3NZSA 2KX3A 3HUIA 4XX5A 1FNVA 4UDUC 2MBEA 2R61A 4M02A 4KGRA 2NBUA 3MP9A 2DBYA 4FLHA 4EEWA 2KVZA 5AZHA 4XYCA 3N1ZC 1FFUA 4YWGG 4LTUA 3N9YC 1TZ1A 3AE8B 5HHDG 3GE8C 2JZ3B 5EE3A 3EGRA 3KW5B 1WRIA 1TGZB 3KWLA 3I57A 3U7ZA 5H92C 2N9KA 4C80A 2AEHA 2WXLA 1WZ0A 4TUUA 3AU5A 4DXAB 3FAHA 4JIOU 3DCGA 4IKGA 4G50A 1ISNA 5FK9C 4B0MA 3K9OB 4ANVA 3R66C 1OTRB 3VUXA 3HK0A 3RZFA 1EF5A 1HQRD 2ACZB 5DCNA 2PW9A 2QEJC 2B3AA 1WGHA 1AARA 2LVQA 2YVCA 1YD8U 2C7HA 1K50A 4G0NB 5TR5A 1QOBA 4JL9A 1CZPA 1LGRA 2KD0A 1XCTL 2WXMA 2KO3A 2REXA 3GB1A 3NVWA 2XN9C 1YIWA 3KH0A 4YTNB 1AN8A 1N62A 1T3QA 4M00A 4GDKA 2Y5PA 2KC1A 3ABVB 2E3TA 4IDIA 2FBWB 4ICUA 2D5GA 3RNAC 2LASA 1TY2A 3N20C 2FIFA 3A9KB 2BYFA 4LJOB 4ZYNA 3RPFC 2ZPYA 3TL5A 1F52A 4MM3A 1TKEA 1ZPSA 1SE9A 1ZKHA 4AQ7A 3R3MA 1QF6A 1XLQA 5EE1A 3UQBA 2G3QB 5L95C 1V9JA 1WZ3A 3P1MA 4X57B 1WMHB 1FD6A 1N61A 4PK1A 4OZBA 2RSUA 2KWDA 3BVGA 2DAJA 2PPHA 3B0AA 3HM6X 4IOIE 2DZKA 3VTUA 1M4VA 2KFKB 2YEPB 2LGDA 2XNAC 3VHTC 1C77A 1VLBA 5DPRA 2QHOA 2FAZA 1HXYD 1A5RA 5BYRA 1TYGB 1WYWB 3BVZA 4K7SA 4S17A 4A20A 4BAXA 1QOGA 1E8WA 2KDFB 2D3GA 4WJNA 4YTPB 2LHEA 1HA5A 3A1QB 3WAPA 2WNMA 4C4VA 1TS2A 1I42A 4OHJA 1FFVA 4YT0B 5GMVA 5IN7A 3VDZA 4KDIC 5LXHA 2J0JA 3DVGX 1VR9A 4OVVA 4RF1A 2N1VA 3L13A 3ZXRA 3PRMB 3KYDD 3ZRCA 3DWGC 4NY0A 5IOIA 3W2DA 2KC2A 3UQAA 2BYVE 2KWVB 1VDVA 3AI5A 4N6EB 3NY5A 1L6UA 5D3DA 3ZDMC 1K51A 4MH8A 1MG4A 2AWTA 5BMGA 2JWZA 1LQBA 3BYTB 5FKAC 2FCQA 3Q3MC 4AP4C 3HIZA 1E8YA 3AEBB 1WXAA 3C19A 3SFDB 3CWIA 1WE7A 3DHIC 4AOFA 3AV8A 4BOZB 4IG7B 4YSZB 3DVNU 1WX7A 2QDFA 2AL3A 3AXCA 1PYWD 2DZIA 2UYZB 2XK5B 3DBLI 3VR8B 4P7IA 3LYYA 2C60A 1FNWA 2INPE 3ZRFA 2INDC 1SJED 2C7MB 2OOBB 3VUYA 4KGSA 1WM2A 2KXJA 4RM8A 3LXFA 1GAQB 2BB6A 1QLBB 3PLUA 5C3JB 2PVOD 3PHXB 4IUMB 4JWSC 1I4RA 1L4DB 3ML9A 3IAM1 3H7PA 5DPWA 2QJLA 1SB3C 5EE0A 3BZDB 3JSVB 1FRRA 1WR6E 3DOWA 2W9NA 1P1AA 3PZ7A 3SFEB 1QQRA 3VTWA 2WXPA 3RYTA 3ZJUA 2GOWA 5CX3A 4II3B 1WX9A 4PS8A 5E6NA 2N1WA 2AQ3B 1IBXB 1OQRA 2N9EB 1NBFC 2J7QB 4EUTA 3RT3B 2D3AA 2EMTA 4NAWA 4F7ZA 3ZJVA 2VZKD 1TKGA 2OJRA 4K3BA 1VJKA 2MBQA 2RR9A 2L8JA 1TY0A 4GXBA 3QA8A 2MP2B 1TS3A 5EDSA 2NCNA 2KDMA 2OEDA 2SEBD 1L5PA 5AZFA 1HTQA 2WXOA 3PO0A 2K6DB 4MGYE 2PKOA 2QSDA 2INCC 3B2FA 4DWFA 4IWPA 1S3SG 3Q69A 1QOAA 3RULA 2L00B 3GP7A 1T0RC 3DBSA 3IG3A 3JVZX 2D3BA 4USAA 2BVCA 4CHKA 1TJEA 1SJHD 1GB1A 1VD2A 1HEZE 5HG2A 2Q5WD 2M0AA 4W9IA 5JHBA 2RPVA 2KANA 1P3QU 3AEAB 3I9V1 1RYJA 1Q1OA 3WA0A 5C2TB 1IGDA 4ZHPA 3AE5B 3Q3FA 4CYEA 4FADA 4ZRKA 2AQ2B 1XQQA 4ZHOA 1GC7A 2NR2A 1ACCA 3L4PA 4HJGE 4ZOHC 3IFWB 4G11A 2V9HA 2RDHA 3H8HA 3QCAA 2N9LA 4LNIA 1OEYA 1WSPA 3GZNI 1EU3A 3Q8EA 4E3CA 3ZGZA 1L0XB 1Y56A 4WJQA 3A4RA 1RAXA 4NQLB 1AW7A 1YQ3B 3FC4A 2ZZPB 1NYRA 1FIQA 3CMMB 3ENEA 4FHJA 4KKIA 3T3NA 3AB5A 4XGAB 2PMVA 2W3SA 3KUZA 3A4SC 4PYUA 1C4CA 3I5JC 2KN5A 4TV3A 2WXKA 4HVBA 1Z2MA 1YX5B 5G55A 5HFYA 1WGRA 3UIOB 2GBRA 4FBJB 2DYBA 1KLGD 2LMCA 3WAOA 5IKCM 3QK0A 3V60A 3A9KA 5JXVA 2N7JA 2D07B 2LGYA 1ROEA 3IAS1 2J0KA 4MDKE 1J7BA 2MBBB 2K8HA 1EF1A 2BGFA 2GBJA 1SF0A 2IPKD 1FM0D 1L0YB 2JXTA 2IO2B 1QZEA 1WY8A 3NOBA 2W82A 3TEYA 1GB4A 2X38A 2KQ4X 3Q14C 3APCA 1WMHA 3QWZB 1IUEA 1SE3A 2EELA 4IM2A 2MBOA 3EC8A 1R4MI 1UH6A 1I4PA 1STEA 2QC8A 4KSKC 4HXDA 1LXDA 2K8CA 5AUKA 3W1YA 2INNE 4KX6B 2MHJA 3BINA 2KFKA 4J6IA 1CQVA 3VRBB 1XEEA 1WJ4A 4RFBA 1V5TA 1L6VA 3APDA 2BS2B 3SEBA 1NVID 5G2NA 4GB9A 3VH3B 5AZGA 2BW2A 2WLBA 2OHFA 3O65B 3ZYYX 3RNEC 2PJHA 3H7PB 1WXQA 1NYQA 3A1QA 3KLSX 1MI0A 2WGSA 1E6EB 1HTOA 4O1NA 1DOIA 4EZJA 2ZNVB 4I6PA 1DOXA 2D11A 3ZNHB 5I4DA 1V86A 3AE1B 3PREA 2CU3A 2M0XA 4KZCA 4MEMA 1KH0A 3ONSA 3T8MA 3I63C 3FKYA 4DXFA 3JYUA 2LJIA 2SAKA 1HZ5A 3WAMA 2L3ZA 4EZLA 4MJSB 2KACA 4M8NA 2WU5B 3DHGC 4BKSA 3UI3A 2YEPF 4A9AA 2I1KA 3LDZE 1RM6C 3KYCD 1NEKB 1E0ZA 4NPNA 3VVWB 4OVUA 1V1PB 4IWOA 3DBRI 1D3ZA 2HE7A 3KQ4A 4MSMB 5TSSA 3PV1A 4LJPB 2I2YA 2MH7A 4BKGA 2KWCA 3C0RB 4BZAA 2DX5B 2IGGA 2XK5A 2Z0EB 2ZPNA 1JCKB 4L1BA 2IO0B 3L17A 2DENB 2RDBC 3BVMA 4FXCA 4P1BC 1X1MA 4HPMB 3UGBB 3RCZA 4W9FA 4IWQA 1UZXB 4KGTA 2VH1A 3M63B 2KWUB 4HDOA 4A90A 1YMHE 2CR5A 1YQ4B 4MH0E 1JWUD 4US8A 3MC9A 2MA9B 1MPEA 3OAWA 1ZW7A 2LGIA 2GRIA 2IZVB 3JSVA 1J0GA 3Q8CA 2JZZA 1WXMA 2LGSA 4DXGA 4C00A 3P63A 2O2VB 5HI1A 1K53A 3BIID 4YL8A 1F1HA 2N0SB 1IBXA 2O6VD 2BS4B 2V3SA 1N5XA 2CKHB 2LZ6A 1BXTA 4FJVB 4ICVA 1AYFA 4LCDE 3MC8A 3N32A 4K7WA 5KHOA 3UINB 4DDGD 1V6EA 2JYTA 2HTHA 2V0GA 4EZKA 2BWES 4DHZB 2MP2A 5LXIB 1DOYA 4JLCA 1UBQA 1LO5D 1MHHE 1OQQA 1TTNA 4OZCA 5C23A 3RD2A 5AEKB 4NJCA 1N63A 2V3NA 4GIVA 2PE6B 4RM9A 2DAFA 4GN1A 1Y8RC 3EECA 2LFIA 4NZLB 1IGCA 4C7YA 5D3IB 3NHEB 2VZKB 1E90A 3TEXA 5L83A 2ONQA 1XT9B 4PYZA 2KTFA 3BWUD 4BVUC 1ENFA 1Z5SB 4LDTB 1WGYA 1FXTB 1WRDB 3HVZA 2HTME 5BMIA 2IO1B 4MSQB 3QARA 3IT6B 3NZ3A 2L76A 4CQNA 1JROA 3PRZA 3RNCC 4FN2A 4QAYA 3TEWA 4K1RB 1PDXA 1WGGA 2AQ1B 3ZKJC 1GUAB 3CF6E 2E6XA 3Q8BA 2QMTA 3AE3B 5E6PA 4HEA1 1H4RA 4FHKA 4KZ0A 4IM0A 4BBNF 3DHHC 2LI5A 2GI9A 1T0SC 1EO6A 1WJNA 2FNJB 4DHJD 1V80A 1GG3A 2WXRA 3GS2A 1E10A 1JWAD 4B95A 1VCBA 2JYEA 4RGOS 2GB1A 1KLUD 2WHIA 4GDLB 2KMCA 4W9LA 4A3OA 4ANWA 3R8BA 3Q6BA 1IPGA 2V3PA 2KLCA 1T6BX 3NZUA 4RGNA 4W9DA 1UD7A 2JSVX 1B1ZA 2XEWA 4GOCA 1C3TA 3DBRB 4EE2A 1UUPA 2WXHA 2LUMA 4XDCA 1T0YA 4W9JA 4EOYA 2LXCA 4XDDA 3IXSA 1NENB 2RDGA 2I1JA 2I38A 3E9SA 1ET9A 4WAFA 5CHVC 3R2TA 3MHSD 1YN5A 3P2BA 3BYYB 4WQOB 4JPSA 3V3XA 1VRAB 1WYGA 3Q2AC 2KDIA 1U4AA 3EUB2 2JY6A 1C1YB 4MT5A 2L0TA 1ZGUB 5D94A 2JPHA 3MHZA 1PGBA 3PZ8A 1WXVA 2NBVB 1I35A 3VAWA 4US9A 1C4AA 5D7GA 3PT2B 2BWFA 4M8MA 3QQ8B 2M56B 3W5UB 2PE9A 3TMPB 4JQWC 5IP4D 1FO4A 3P4PB 2ASQA 4YSYB 4HDQA 4MJSA 3NVZA 3AE9B 3ZNID 2NMQA 1TKYA 3O13A 3R2IA 3RN9C 1E7VA 2AYOB 4N9F4 2DHZA 3MC0B 3QHTA 2IGHA 3V61A 4JE3B 2ZCBA 2N7DA 1V1PA 4NQKE 1N60A 1IYFA 1BMLC 3PTFC 3ZTDA 1TIFA 3WIMA 3L10B 3L54A 3P42A 1SXTA 3AN1A 4TMAB 1WM3A 2NPTB 1FMAD 3NS1A 4ZRIA 2KLGA 4RH6A 3VTVA 3MFGA 1I7HA 2K25A 2RPQA 2BS3B 1WWTA 3GE3C 2M1MA 1JALA 4P6VF 4L2YA 1GC6A 2HJ8A 4HCPB 5GXGB 2PIAA 3BY4B 2KDBA 5KHQA 2J52A 5E6JA 1V1OA 2K0PA 2HDEA 1KTKA 2BBCA 2KKCA 4MELA 1TS5A 3TJPA 4WIPA 3QJZA 4P16A 2MJ3A 4M0WB 1ZXIA 2FCNA 1YNTE 1E7UA 4ARIA 3N1YC 3Q3JA 2NBWB 3AEGB 4TSSA 1LM8B 3TUOA 2ON8A 5BYSA 4EFOA 1NI2A 3T3OA 4NJ6A 4RNAA 2B76B 2O2VA 1SGHA 3UIPB 2BKFA 5J18A 1DYQA 3AE6B 2MEKA 3V6CB 4AUQC 4KDLB 4JWUC 4EKUA 3KVFB 3RMKC 1GJZA 1V2YA 4ZYSA 4B0EA 2G45B 2N4FA 5BO4B 3ZW3A 4DQOC 1MFWA 1R4NI 2EKIA 2G4SA 4KSLC 4FA6A 2KHWB 3A33B 4J3OD 1XCQL 1KLVA 2MSED 4WWOA 4BOSC 4B6WA 1LFDA 4FJYA 1OEYJ 2GLSA 2H88B 1XD3B 3B1LX 1WJ6A 2O6VB 4NJ7A 2BT6A 2KJHB 4RF0A 1E9MA 2LJ5A 1EUVB 1RWSA 3M3JA 2A5UA 2G1EA 2PEAA 3P4RB 1PQSA 3W1SA 4ACFA 2WXIA 1NDDA 5HKHA 3QAQA 1GOZA 1HE8A 3DBLB 3DDCB 2BQQA 2KZRA 2JZPA 2DNFA 1F2RC 3FILB 4XC2A 4HJKA 2K39A 2V4LA 2DYOA 2D2QA 2FCMA 2KFJA 2KX0A 2JF5A 3OG5A 4WH4A 1QT9A 3VR9B 3W9CB 1JW9D 3OJ4B 1P7EA 1CK1A 1UGMA 2Z0DB 3WANA 3SDLC 2HJ1A 3U8ZA 3WALA 2MWSB 2NTTA 3HM3A 1SBBB 4WQMA 1GPXA 1PGAA 3AULA 3MJ5A 2R2OA 4DBGA 3L08A 1WXSA 2CHXA
chains in the Genus database with same CATH topology
3SU8X 4AOFA 4BOZB 4IG7B 1WF9A 3UINB 2AL6A 4DDGD 1V6EA 3DVNU 1WFYA 4DHZE 1WX7A 2HTHA 5DPTA 2AL3A 3AXCA 1J8CA 4WAAA 4WJOA 3JW0X 2DZIA 2UYZB 2XK5B 4EZKA 3DBLI 1L2NA 1MG8A 2BWES 4P7IA 4DHZB 3SD5A 2MP2A 5LXIB 4GU2A 2JXXA 2LD9A 2EKEC 2LGXA 2HD5B 4JLCA 2C60A 3APFA 1UBQA 1P9DU 3HHMA 3MJWA 5IA7A 4ZRJA 1TTNA 5C23A 3RD2A 3ZRFA 5AEKB 3AU4A 2D10A 1WE6A 4GIVA 4HK2A 3PLVA 2C7MB 2LWPA 2ZVNA 2PE6B 1V49A 2OOBB 4BKSD 2IBIB 2DAFA 3B08A 4GN1A 4RM9A 1Y8RC 3VUYA 3EECA 4GDLA 1P98A 1WM2A 2KXJA 3W1SC 5CHWA 2C9WB 4RM8A 4KIKB 1S1QB 5FR6A 2DZJA 5J17A 3TCAA 3OLMD 4TQ1A 3NHEB 3PLUA 1E90A 4W9GA 2FUHB 4IW0A 1BT0A 2JRHA 5L83A 5D2MB 2M17A 3PHXB 4IUMB 1YQBA 3IBEA 3N30A 3VXWA 4F1SA 3ML9A 1XT9B 1CMXB 4PYZA 2KTFA 2LRUA 3H7PA 4W9CA 5DPWA 2JVCA 2ZVOA 2GBMA 4BVUC 1Z5SB 2ZEQA 4LDTB 4DHJB 1F9JA 1WGYA 1FXTB 1V5OA 3JSVB 1WRDB 3L16A 4KVGB 4W9HA 1WR6E 3H1UA 3V62A 3DOWA 2W9NA 1P1AA 3VTWA 2FIDA 2M4NA 3RYTA 2GOWA 2IO1B 5CX3A 1WJUA 4MSQB 4II3B 1WX9A 1WIAA 3QARA 2YLMA 4PS8A 2L76A 2N1WA 5E6NA 2J0MA 3I3TB 2M8SA 3EFUA 2N9EB 2MX2A 1NBFC 1E8ZA 2XBBC 4DDID 2J7QB 3PRZA 4KV2A 4EUTA 4FN2A 1E5WA 3RT3B 4MGZE 2EMTA 4NAWA 2CHZA 4TKNA 4F7ZA 4K1RB 1TBEA 2R2QA 3A9JB 5C1ZA 2OJRA 2KDEB 2WYQA 3EHVA 2MBQA 4MGKE 2RR9A 1WGGA 2KK8A 2L8JA 2VRRB 3ZKJC 2IYDB 1GUAB 3CF6E 4GXBA 3ZLZA 1K8RB 3QA8A 5E6PA 1H4RA 3VH4B 2MP2B 4FHKA 4KZ0A 4IM0A 4I6NB 4BBNF 5EDSA 4WWNA 2LI5A 2NCNA 3X23A 2KTRA 1EO6A 4PS3A 3ZNZB 5AZFA 1WJNA 2FNJB 4DHJD 1V80A 1GG3A 2MRPA 5DPSA 2K6DB 3L0WB 2IO3B 4MGYE 2KMAA 3TIXA 4DWFA 1WGDA 4IWPA 3QC8B 4B95A 1S3SG 1VCBA 3RULA 2L00B 2G4DB 3DBSA 4BBNC 3IG3A 3JVZX 3QX1A 4GDLB 4CHKA 3UF8A 4AJYB 2KMCA 2GBNA 4GSWA 3ZIMA 4W9LA 3DQVA 5LLIA 4A3OA 1VD2A 4URKA 2WX0A 4ANWA 1IPGA 3PVLA 3ZNGC 4W9IA 2KLCA 3NZUA 5JHBA 3OJ3A 4B9KA 2KANA 1WX8A 4W9DA 5CHFA 1P3QU 1UD7A 2CS4A 3NS8A 4E74A 2IY0B 5JH5C 1L7YA 1Q1OA 1JRUA 2XEWA 3WA0A 4GOCA 3KUCB 1C3TA 1OGWA 2KVRA 2FCSA 3IVFA 1RRBA 3Q3FA 4CYEA 2L7RA 3T9LA 4G3XB 4MGIE 1T0YA 2N9XA 3TBLD 4FADA 4ZRKA 4W9JA 4EOYA 1XQQA 1UELA 2LXCA 2L0FA 1GC7A 2NR2A 2I1JA 3IFWB 3S2AA 3VUWA 2NPTA 4G11A 5CHVC 2MQJA 2LVOA 2N7EA 3MHSD 2LRWA 5CTRC 3QCAA 3P2BA 1WH3A 4WQOB 2MCNB 1OQYA 1OEYA 4NAWB 3GZNI 3PZDA 4E3CA 2C5LC 2WDTB 3U30A 2KDIA 1Q5WB 4WJQA 3A4RA 1U4AA 5IAAC 1RAXA 4WJPA 2JY6A 4NQLB 3M95A 1C1YB 2BPSA 3DPDA 3M62B 2L0TA 2ZZPB 1ZGUB 3CMMB 3ENEA 2JPHA 5D94A 4IM3A 4FHJA 4GGQA 4WWPA 3RZWC 3GOEA 1WXVA 2NBVB 3KUZA 1I35A 3A4SC 2KTRB 3VAWA 4PYUA 1E8XA 2ZJDA 2KN5A 1WR1A 4NNJB 4TV3A 1KOTA 4HVBA 5D7GA 3ZTCA 1GNUA 3CSTA 3PT2B 3R7RA 1Z2MA 1YX5B 3PS6A 5G55A 4CO7A 2BWFA 4M8MA 1KM7A 1WGRA 3ZVVA 3UIOB 3QQ8B 2GBRA 4AWJA 4FBJB 2DYBA 4W9KA 3WAOA 2PE9A 2BKRB 3TMPB 3QK0A 3ZUNA 4ASWC 4XZ4A 3V60A 1RLFA 2GMIC 3A9KA 4JQWC 4TQ0A 3NZSA 2KX3A 2ASQA 1KJTA 2D07B 2LGYA 4XX5A 3VFKA 2J0KA 2MBEA 2DYMA 4HDQA 4MDKE 2NBUA 4MJSA 3ZNID 2MBBB 2K8HA 1EF1A 2BGFA 4FLHA 2GBJA 2V1YA 4FJZA 4EEWA 5AZHA 4BKTA 2A4ZA 2IO2B 3CSFA 1QZEA 1TZ1A 3PGEA 2NVUI 1WY8A 1E7VA 1Q0WB 2AYOB 2JZ3B 2WWZA 3NOBA 2ZCCA 2DHZA 4N9F4 3KW5B 3QHTA 3V61A 2ZCBA 3APCA 1WMHA 3QWZB 3RUIB 2Z59B 1M94A 2N7DA 1TGZB 4IM2A 2MBOA 2CHWA 3EC8A 1R4MI 4NQKE 1UH6A 4BFRA 1IYFA 2KQSA 2UWQA 3PTFC 4KSKC 3ZTDA 4A3PA 4HXDA 1LXDA 3WIMA 2AEHA 2K8CA 3L10B 1WZ0A 3L54A 4TUUA 3W1YA 2KJRA 3DVGY 3AU5A 3ALBA 1WM3A 2NPTB 4DXAB 3BINA 2KFKA 1UBIA 2C7NB 4J6IA 4ZRIA 2BF8B 2KLGA 3VTVA 1WJ4A 4JIOU 2K25A 2RPQA 3DCGA 4G50A 2Y5BB 1ISNA 1V5TA 2MW5A 3K9OB 4IC7B 4ANVA 3R66C 1OTRB 2JRIB 3VUXA 3HK0A 3RZFA 2M1MA 1EF5A 3APDA 3VQIA 5DCNA 2B3AA 5G2NA 1GC6A 1WGHA 4GB9A 2HJ8A 1AARA 2LVQA 2YVCA 1YD8U 2C7HA 4G0NB 4HCPB 3VH3B 5AZGA 5TR5A 4W9EA 3O65B 4JL9A 3R7QA 2PJHA 2KDBA 3BY4B 3ZDTA 2ZNVC 2CU1A 2O6VA 3H7PB 5KHQA 2LXAA 2KD0A 3A1QA 2KO3A 2REXA 4EZJA 2KKCA 2ZNVB 4MELA 1YIWA 3KH0A 4I6PA 3TJPA 2K8BA 3QJZA 4GDKA 2D11A 3ZNHB 3PRPB 4M0WB 4ANXA 1V86A 2KC1A 2FCNA 3PREA 2M0XA 4JGHB 4KZCA 4MEMA 3ONSA 3T8MA 1E7UA 4ICUA 2LASA 3JYUA 2FIFA 3Q3JA 3A9KB 2BYFA 2RD0A 3ZO5B 3H7SA 2NBWB 3DBHI 2L05A 4I6LB 4LJOB 3WAMA 4ZYNA 1LM8B 4AJWA 2IY1B 2JUOA 2L3ZA 4EFOA 2ZPYA 1NI2A 4EZLA 4MJSB 4NJ6A 3TL5A 3H6NA 4MM3A 3SHQA 1SE9A 1ZKHA 4M8NA 4ZDVA 2DZMA 3R3MA 2O2VA 3DVNV 4BKSA 1SGHA 4HWIB 2I1KA 2KOXA 3X0WA 3UQBA 2G3QB 3LDZE 3UIPB 5L95C 2BKFA 1SIFA 3ECIA 5J18A 3KYCD 1V9JA 1WZ3A 4RMAA 2MBHA 2KNBA 3V6CB 4X57B 1WMHB 4KDLB 4NPNA 3VVWB 4AUQC 4OVUA 1YJ1A 4ANUA 4EKUA 5J2RA 3KVFB 4IWOA 3DBRI 1D3ZA 2HE7A 2RSUA 1GJZA 4MSMB 1V2YA 2DAJA 2PPHA 3B0AA 3PPAA 3PV1A 4F8CB 5JHAA 2G45B 3K9PB 3HM6X 4LJPB 5JZEB 2DZKA 2N4FA 3MTNB 3VTUA 2KFKB 5BO4B 4BKGA 3ZW3A 4HLEA 2KWCA 2LGDA 3C0RB 2DX5B 3VHTC 4HCNB 1P0RA 1R4NI 2G4SA 4KSLC 2XK5A 2Z0EB 2ZPNA 2KHWB 4FA6A 2IO0B 5DPRA 3L17A 2QHOA 3A33B 2DENB 1KLVA 2MSED 4WWOA 4BOSC 2FAZA 2BYEA 3KUDB 4B6WA 1LFDA 4FJYA 3N3KB 1A5RA 2GBKA 3PHWB 4PS7A 1WYWB 1OEYJ 4HPLB 4K7SA 1RFAA 4A20A 1H8CA 1X1MA 4HPMB 4E71A 3UGBB 1J19A 1V81A 1XD3B 3B1LX 3RCZA 1WJ6A 2O6VB 2WX1A 4NJ7A 4W9FA 3IHPC 1E8WA 2KDFB 1J0GA 2D3GA 2KJHB 4IWQA 1UZXB 4WJNA 4GMVA 2LJ5A 3A1QB 3WAPA 1I42A 3LJ3A 1EUVB 3M3JA 1WI0A 3QIJA 4K7UA 3M63B 4KIKA 5GMVA 2A5UA 3VDZA 2K6QA 2KWUB 3D32A 4HDOA 4KDIC 4GDKB 4K81A 2PEAA 2CR5A 5LXHA 2J0JA 1PQSA 3DVGX 3W1SA 4OVVA 4MH0E 2N1VA 3L13A 1NDDA 5HKHA 2MLBA 3PSEB 2EMSA 3QAQA 1HE8A 2MA9B 3PRMB 4FULA 3OAWA 2LVPA 3KYDD 3ZRCA 3DDCB 4NY0A 1ZW7A 2KZRA 1IP9A 2KC2A 3UQAA 2KJ6A 2BYVE 1YX6B 2KWVB 2IZVB 2JT4B 2K1FA 3AI5A 3JSVA 4XC2A 5D6JB 4HJKA 2K39A 2V4LA 2DYOA 2D2QA 2FCMA 2JZZA 2KFJA 2KX0A 3NY5A 4LDTD 2JF5A 1WXMA 3V6EB 3ZDMC 2KQ7A 2O2VB 2AWTA 2JWZA 1LQBA 2RGFA 3OJ4B 2FCQA 1UGMA 2Z0DB 4II2B 4YL8A 3U7DA 3WANA 3SDLC 2NS5A 2O6VD 4AP4C 2LUEA 2V3SA 3U8ZA 3WALA 2MWSB 3HIZA 1E8YA 3HM3A 2CKHB 2LZ6A 1WXAA 5E6OA 1G6JA 2N9PC 3H9DA 4FJVB 3AULA 4ICVA 4DK5A 2R2OA 4LCDE 4DBGA 3L08A 1WXSA 1WE7A 3N32A 3A9JA 3ML8A 4K7WA 2CHXA 5KHOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SU8 X;  4AOF A;  4BOZ B;  4IG7 B;  1WF9 A;  3UIN B;  2AL6 A;  4DDG D;  1V6E A;  3DVN U;  1WFY A;  4DHZ E;  1WX7 A;  2HTH A;  5DPT A;  2AL3 A;  3AXC A;  1J8C A;  4WAA A;  4WJO A;  3JW0 X;  2DZI A;  2UYZ B;  2XK5 B;  4EZK A;  3DBL I;  1L2N A;  1MG8 A;  2BWE S;  4P7I A;  4DHZ B;  3SD5 A;  2MP2 A;  5LXI B;  4GU2 A;  2JXX A;  2LD9 A;  2EKE C;  2LGX A;  2HD5 B;  4JLC A;  2C60 A;  3APF A;  1UBQ A;  1P9D U;  3HHM A;  3MJW A;  5IA7 A;  4ZRJ A;  1TTN A;  5C23 A;  3RD2 A;  3ZRF A;  5AEK B;  3AU4 A;  2D10 A;  1WE6 A;  4GIV A;  4HK2 A;  3PLV A;  2C7M B;  2LWP A;  2ZVN A;  2PE6 B;  1V49 A;  2OOB B;  4BKS D;  2IBI B;  2DAF A;  3B08 A;  4GN1 A;  4RM9 A;  1Y8R C;  3VUY A;  3EEC A;  4GDL A;  1P98 A;  1WM2 A;  2KXJ A;  3W1S C;  5CHW A;  2C9W B;  4RM8 A;  4KIK B;  1S1Q B;  5FR6 A;  2DZJ A;  5J17 A;  3TCA A;  3OLM D;  4TQ1 A;  3NHE B;  3PLU A;  1E90 A;  4W9G A;  2FUH B;  4IW0 A;  1BT0 A;  2JRH A;  5L83 A;  5D2M B;  2M17 A;  3PHX B;  4IUM B;  1YQB A;  3IBE A;  3N30 A;  3VXW A;  4F1S A;  3ML9 A;  1XT9 B;  1CMX B;  4PYZ A;  2KTF A;  2LRU A;  3H7P A;  4W9C A;  5DPW A;  2JVC A;  2ZVO A;  2GBM A;  4BVU C;  1Z5S B;  2ZEQ A;  4LDT B;  4DHJ B;  1F9J A;  1WGY A;  1FXT B;  1V5O A;  3JSV B;  1WRD B;  3L16 A;  4KVG B;  4W9H A;  1WR6 E;  3H1U A;  3V62 A;  3DOW A;  2W9N A;  1P1A A;  3VTW A;  2FID A;  2M4N A;  3RYT A;  2GOW A;  2IO1 B;  5CX3 A;  1WJU A;  4MSQ B;  4II3 B;  1WX9 A;  1WIA A;  3QAR A;  2YLM A;  4PS8 A;  2L76 A;  2N1W A;  5E6N A;  2J0M A;  3I3T B;  2M8S A;  3EFU A;  2N9E B;  2MX2 A;  1NBF C;  1E8Z A;  2XBB C;  4DDI D;  2J7Q B;  3PRZ A;  4KV2 A;  4EUT A;  4FN2 A;  1E5W A;  3RT3 B;  4MGZ E;  2EMT A;  4NAW A;  2CHZ A;  4TKN A;  4F7Z A;  4K1R B;  1TBE A;  2R2Q A;  3A9J B;  5C1Z A;  2OJR A;  2KDE B;  2WYQ A;  3EHV A;  2MBQ A;  4MGK E;  2RR9 A;  1WGG A;  2KK8 A;  2L8J A;  2VRR B;  3ZKJ C;  2IYD B;  1GUA B;  3CF6 E;  4GXB A;  3ZLZ A;  1K8R B;  3QA8 A;  5E6P A;  1H4R A;  3VH4 B;  2MP2 B;  4FHK A;  4KZ0 A;  4IM0 A;  4I6N B;  4BBN F;  5EDS A;  4WWN A;  2LI5 A;  2NCN A;  3X23 A;  2KTR A;  1EO6 A;  4PS3 A;  3ZNZ B;  5AZF A;  1WJN A;  2FNJ B;  4DHJ D;  1V80 A;  1GG3 A;  2MRP A;  5DPS A;  2K6D B;  3L0W B;  2IO3 B;  4MGY E;  2KMA A;  3TIX A;  4DWF A;  1WGD A;  4IWP A;  3QC8 B;  4B95 A;  1S3S G;  1VCB A;  3RUL A;  2L00 B;  2G4D B;  3DBS A;  4BBN C;  3IG3 A;  3JVZ X;  3QX1 A;  4GDL B;  4CHK A;  3UF8 A;  4AJY B;  2KMC A;  2GBN A;  4GSW A;  3ZIM A;  4W9L A;  3DQV A;  5LLI A;  4A3O A;  1VD2 A;  4URK A;  2WX0 A;  4ANW A;  1IPG A;  3PVL A;  3ZNG C;  4W9I A;  2KLC A;  3NZU A;  5JHB A;  3OJ3 A;  4B9K A;  2KAN A;  1WX8 A;  4W9D A;  5CHF A;  1P3Q U;  1UD7 A;  2CS4 A;  3NS8 A;  4E74 A;  2IY0 B;  5JH5 C;  1L7Y A;  1Q1O A;  1JRU A;  2XEW A;  3WA0 A;  4GOC A;  3KUC B;  1C3T A;  1OGW A;  2KVR A;  2FCS A;  3IVF A;  1RRB A;  3Q3F A;  4CYE A;  2L7R A;  3T9L A;  4G3X B;  4MGI E;  1T0Y A;  2N9X A;  3TBL D;  4FAD A;  4ZRK A;  4W9J A;  4EOY A;  1XQQ A;  1UEL A;  2LXC A;  2L0F A;  1GC7 A;  2NR2 A;  2I1J A;  3IFW B;  3S2A A;  3VUW A;  2NPT A;  4G11 A;  5CHV C;  2MQJ A;  2LVO A;  2N7E A;  3MHS D;  2LRW A;  5CTR C;  3QCA A;  3P2B A;  1WH3 A;  4WQO B;  2MCN B;  1OQY A;  1OEY A;  4NAW B;  3GZN I;  3PZD A;  4E3C A;  2C5L C;  2WDT B;  3U30 A;  2KDI A;  1Q5W B;  4WJQ A;  3A4R A;  1U4A A;  5IAA C;  1RAX A;  4WJP A;  2JY6 A;  4NQL B;  3M95 A;  1C1Y B;  2BPS A;  3DPD A;  3M62 B;  2L0T A;  2ZZP B;  1ZGU B;  3CMM B;  3ENE A;  2JPH A;  5D94 A;  4IM3 A;  4FHJ A;  4GGQ A;  4WWP A;  3RZW C;  3GOE A;  1WXV A;  2NBV B;  3KUZ A;  1I35 A;  3A4S C;  2KTR B;  3VAW A;  4PYU A;  1E8X A;  2ZJD A;  2KN5 A;  1WR1 A;  4NNJ B;  4TV3 A;  1KOT A;  4HVB A;  5D7G A;  3ZTC A;  1GNU A;  3CST A;  3PT2 B;  3R7R A;  1Z2M A;  1YX5 B;  3PS6 A;  5G55 A;  4CO7 A;  2BWF A;  4M8M A;  1KM7 A;  1WGR A;  3ZVV A;  3UIO B;  3QQ8 B;  2GBR A;  4AWJ A;  4FBJ B;  2DYB A;  4W9K A;  3WAO A;  2PE9 A;  2BKR B;  3TMP B;  3QK0 A;  3ZUN A;  4ASW C;  4XZ4 A;  3V60 A;  1RLF A;  2GMI C;  3A9K A;  4JQW C;  4TQ0 A;  3NZS A;  2KX3 A;  2ASQ A;  1KJT A;  2D07 B;  2LGY A;  4XX5 A;  3VFK A;  2J0K A;  2MBE A;  2DYM A;  4HDQ A;  4MDK E;  2NBU A;  4MJS A;  3ZNI D;  2MBB B;  2K8H A;  1EF1 A;  2BGF A;  4FLH A;  2GBJ A;  2V1Y A;  4FJZ A;  4EEW A;  5AZH A;  4BKT A;  2A4Z A;  2IO2 B;  3CSF A;  1QZE A;  1TZ1 A;  3PGE A;  2NVU I;  1WY8 A;  1E7V A;  1Q0W B;  2AYO B;  2JZ3 B;  2WWZ A;  3NOB A;  2ZCC A;  2DHZ A;  4N9F 4;  3KW5 B;  3QHT A;  3V61 A;  2ZCB A;  3APC A;  1WMH A;  3QWZ B;  3RUI B;  2Z59 B;  1M94 A;  2N7D A;  1TGZ B;  4IM2 A;  2MBO A;  2CHW A;  3EC8 A;  1R4M I;  4NQK E;  1UH6 A;  4BFR A;  1IYF A;  2KQS A;  2UWQ A;  3PTF C;  4KSK C;  3ZTD A;  4A3P A;  4HXD A;  1LXD A;  3WIM A;  2AEH A;  2K8C A;  3L10 B;  1WZ0 A;  3L54 A;  4TUU A;  3W1Y A;  2KJR A;  3DVG Y;  3AU5 A;  3ALB A;  1WM3 A;  2NPT B;  4DXA B;  3BIN A;  2KFK A;  1UBI A;  2C7N B;  4J6I A;  4ZRI A;  2BF8 B;  2KLG A;  3VTV A;  1WJ4 A;  4JIO U;  2K25 A;  2RPQ A;  3DCG A;  4G50 A;  2Y5B B;  1ISN A;  1V5T A;  2MW5 A;  3K9O B;  4IC7 B;  4ANV A;  3R66 C;  1OTR B;  2JRI B;  3VUX A;  3HK0 A;  3RZF A;  2M1M A;  1EF5 A;  3APD A;  3VQI A;  5DCN A;  2B3A A;  5G2N A;  1GC6 A;  1WGH A;  4GB9 A;  2HJ8 A;  1AAR A;  2LVQ A;  2YVC A;  1YD8 U;  2C7H A;  4G0N B;  4HCP B;  3VH3 B;  5AZG A;  5TR5 A;  4W9E A;  3O65 B;  4JL9 A;  3R7Q A;  2PJH A;  2KDB A;  3BY4 B;  3ZDT A;  2ZNV C;  2CU1 A;  2O6V A;  3H7P B;  5KHQ A;  2LXA A;  2KD0 A;  3A1Q A;  2KO3 A;  2REX A;  4EZJ A;  2KKC A;  2ZNV B;  4MEL A;  1YIW A;  3KH0 A;  4I6P A;  3TJP A;  2K8B A;  3QJZ A;  4GDK A;  2D11 A;  3ZNH B;  3PRP B;  4M0W B;  4ANX A;  1V86 A;  2KC1 A;  2FCN A;  3PRE A;  2M0X A;  4JGH B;  4KZC A;  4MEM A;  3ONS A;  3T8M A;  1E7U A;  4ICU A;  2LAS A;  3JYU A;  2FIF A;  3Q3J A;  3A9K B;  2BYF A;  2RD0 A;  3ZO5 B;  3H7S A;  2NBW B;  3DBH I;  2L05 A;  4I6L B;  4LJO B;  3WAM A;  4ZYN A;  1LM8 B;  4AJW A;  2IY1 B;  2JUO A;  2L3Z A;  4EFO A;  2ZPY A;  1NI2 A;  4EZL A;  4MJS B;  4NJ6 A;  3TL5 A;  3H6N A;  4MM3 A;  3SHQ A;  1SE9 A;  1ZKH A;  4M8N A;  4ZDV A;  2DZM A;  3R3M A;  2O2V A;  3DVN V;  4BKS A;  1SGH A;  4HWI B;  2I1K A;  2KOX A;  3X0W A;  3UQB A;  2G3Q B;  3LDZ E;  3UIP B;  5L95 C;  2BKF A;  1SIF A;  3ECI A;  5J18 A;  3KYC D;  1V9J A;  1WZ3 A;  4RMA A;  2MBH A;  2KNB A;  3V6C B;  4X57 B;  1WMH B;  4KDL B;  4NPN A;  3VVW B;  4AUQ C;  4OVU A;  1YJ1 A;  4ANU A;  4EKU A;  5J2R A;  3KVF B;  4IWO A;  3DBR I;  1D3Z A;  2HE7 A;  2RSU A;  1GJZ A;  4MSM B;  1V2Y A;  2DAJ A;  2PPH A;  3B0A A;  3PPA A;  3PV1 A;  4F8C B;  5JHA A;  2G45 B;  3K9P B;  3HM6 X;  4LJP B;  5JZE B;  2DZK A;  2N4F A;  3MTN B;  3VTU A;  2KFK B;  5BO4 B;  4BKG A;  3ZW3 A;  4HLE A;  2KWC A;  2LGD A;  3C0R B;  2DX5 B;  3VHT C;  4HCN B;  1P0R A;  1R4N I;  2G4S A;  4KSL C;  2XK5 A;  2Z0E B;  2ZPN A;  2KHW B;  4FA6 A;  2IO0 B;  5DPR A;  3L17 A;  2QHO A;  3A33 B;  2DEN B;  1KLV A;  2MSE D;  4WWO A;  4BOS C;  2FAZ A;  2BYE A;  3KUD B;  4B6W A;  1LFD A;  4FJY A;  3N3K B;  1A5R A;  2GBK A;  3PHW B;  4PS7 A;  1WYW B;  1OEY J;  4HPL B;  4K7S A;  1RFA A;  4A20 A;  1H8C A;  1X1M A;  4HPM B;  4E71 A;  3UGB B;  1J19 A;  1V81 A;  1XD3 B;  3B1L X;  3RCZ A;  1WJ6 A;  2O6V B;  2WX1 A;  4NJ7 A;  4W9F A;  3IHP C;  1E8W A;  2KDF B;  1J0G A;  2D3G A;  2KJH B;  4IWQ A;  1UZX B;  4WJN A;  4GMV A;  2LJ5 A;  3A1Q B;  3WAP A;  1I42 A;  3LJ3 A;  1EUV B;  3M3J A;  1WI0 A;  3QIJ A;  4K7U A;  3M63 B;  4KIK A;  5GMV A;  2A5U A;  3VDZ A;  2K6Q A;  2KWU B;  3D32 A;  4HDO A;  4KDI C;  4GDK B;  4K81 A;  2PEA A;  2CR5 A;  5LXH A;  2J0J A;  1PQS A;  3DVG X;  3W1S A;  4OVV A;  4MH0 E;  2N1V A;  3L13 A;  1NDD A;  5HKH A;  2MLB A;  3PSE B;  2EMS A;  3QAQ A;  1HE8 A;  2MA9 B;  3PRM B;  4FUL A;  3OAW A;  2LVP A;  3KYD D;  3ZRC A;  3DDC B;  4NY0 A;  1ZW7 A;  2KZR A;  1IP9 A;  2KC2 A;  3UQA A;  2KJ6 A;  2BYV E;  1YX6 B;  2KWV B;  2IZV B;  2JT4 B;  2K1F A;  3AI5 A;  3JSV A;  4XC2 A;  5D6J B;  4HJK A;  2K39 A;  2V4L A;  2DYO A;  2D2Q A;  2FCM A;  2JZZ A;  2KFJ A;  2KX0 A;  3NY5 A;  4LDT D;  2JF5 A;  1WXM A;  3V6E B;  3ZDM C;  2KQ7 A;  2O2V B;  2AWT A;  2JWZ A;  1LQB A;  2RGF A;  3OJ4 B;  2FCQ A;  1UGM A;  2Z0D B;  4II2 B;  4YL8 A;  3U7D A;  3WAN A;  3SDL C;  2NS5 A;  2O6V D;  4AP4 C;  2LUE A;  2V3S A;  3U8Z A;  3WAL A;  2MWS B;  3HIZ A;  1E8Y A;  3HM3 A;  2CKH B;  2LZ6 A;  1WXA A;  5E6O A;  1G6J A;  2N9P C;  3H9D A;  4FJV B;  3AUL A;  4ICV A;  4DK5 A;  2R2O A;  4LCD E;  4DBG A;  3L08 A;  1WXS A;  1WE7 A;  3N32 A;  3A9J A;  3ML8 A;  4K7W A;  2CHX A;  5KHO A; 
#chains in the Genus database with same CATH topology
 3SU8 X;  3TSS A;  5DPT A;  1NI3 A;  3JW0 X;  1MG8 A;  1KF6 B;  3SD5 A;  4GU2 A;  1D6E C;  2JXX A;  2LD9 A;  2EKE C;  5BMH A;  2L83 A;  2HD5 B;  1P9D U;  1XXG A;  3MJW A;  3NVY A;  4ZRJ A;  4HRO A;  1ZUD 2;  2IDY A;  3AU4 A;  3AEE B;  1D4B A;  1L4Z B;  1WE6 A;  4HK2 A;  3PLV A;  2ZVN A;  1V49 A;  2BB5 A;  2IBI B;  2J4X A;  4GDL A;  5CHW A;  2C9W B;  4KIK B;  1VZ7 A;  2DZJ A;  4TQ1 A;  1PGX A;  5FR3 A;  4W9G A;  4IW0 A;  1SE4 A;  1BT0 A;  1N5W A;  4RGM A;  5D2M B;  2M17 A;  1A70 A;  3N30 A;  3VXW A;  4YXD B;  2LRU A;  5IO9 A;  2GBM A;  1I4X A;  2ZEQ A;  4DHJ B;  1F9J A;  1UGJ A;  2BTE A;  3L16 A;  4KVG B;  4W9H A;  3V62 A;  2LEK A;  3BK2 A;  2FID A;  2VH2 A;  2L52 A;  1XLN A;  1ZDX A;  2OJW A;  3RFZ B;  1QKZ A;  4H2A A;  2MX2 A;  3NVV A;  4KV2 A;  4N58 A;  4R3D A;  2CHZ A;  4TKN A;  4AS1 A;  1TBE A;  2R2Q A;  2WXG A;  3A9J B;  2Z8L A;  2WYQ A;  1QIL A;  4A6Q A;  3EHV A;  2Y3A A;  2KK8 A;  1ZDV A;  2IYD B;  3P4Q B;  3VH4 B;  4WWN A;  2FE8 A;  4K3C A;  3X23 A;  2K5P A;  1WGK A;  3ZNZ B;  1KFY B;  2PLP A;  3EA6 A;  2MRP A;  3AE2 B;  5DPS A;  1EU4 A;  3L0W B;  2IO3 B;  2KMA A;  1WGD A;  1XLP A;  3QC8 B;  2WU2 B;  4BBN C;  2M19 A;  4AJY B;  3GZN B;  3DQV A;  2WP9 B;  4URK A;  2WX0 A;  3PVL A;  4HRS A;  3OJ3 A;  4B9K A;  1Q10 A;  1VZ8 A;  1WX8 A;  2CS4 A;  4E74 A;  3NS8 A;  5JH5 C;  1E7P B;  1UF0 A;  1JRU A;  1D5Z C;  4YSX B;  1OGW A;  3Q3N C;  2KVR A;  2FCS A;  1JRP A;  1RRB A;  4OZA A;  2DLB A;  2J53 A;  3T9L A;  4MGI E;  2N9X A;  3TBL D;  5EE9 A;  4RGT A;  1C78 A;  2L0F A;  3IT4 B;  2CJO A;  3VUW A;  2NPT A;  1R4N B;  4LK0 M;  2WXQ A;  1I4Q A;  4A8X C;  2MQJ A;  2K22 A;  2LVO A;  2N7E A;  3P4S B;  5CTR C;  1WH3 A;  2QCZ A;  1P7F A;  1D5M C;  2MCN B;  1OQY A;  1C4P A;  3PZD A;  2WDT B;  2W3R A;  5IAA C;  3M95 A;  4LNF A;  3DPD A;  3M62 B;  2ICI A;  2MJE A;  1V8C A;  4LNK A;  3GOE A;  4C56 C;  1R4M B;  1YJI A;  1F0Z A;  2KTR B;  1E8X A;  4NNJ B;  1KOT A;  3ZTC A;  1GNU A;  3R7R A;  4M0W A;  1UWM A;  3WCQ A;  2K9X A;  1KM7 A;  4D2K A;  4AWJ A;  1PUT A;  4W9K A;  1K52 A;  2WXN A;  1UWX A;  3ZUN A;  4XZ4 A;  3LB8 C;  4TQ0 A;  2PTL A;  2WDV B;  1KJT A;  3VFK A;  2DYM A;  3AE4 B;  1EWC A;  2ZW0 A;  4REZ A;  2W54 A;  3ZQ4 A;  2V1Y A;  4FJZ A;  4BKT A;  2A4Z A;  1TS4 A;  3C8Y A;  3CSF A;  3PGE A;  4HPP A;  2KAJ A;  1SSN A;  2NVU I;  1Q0W B;  1FEH A;  2WWZ A;  2ZCC A;  3B9J A;  3ETR A;  4M01 A;  3RUI B;  2Z59 B;  1M94 A;  2X8X X;  2CHW A;  4ZRQ A;  4BFR A;  2KQS A;  2UWQ A;  4PT5 A;  2AX5 A;  4A3P A;  2KJR A;  3DVG Y;  3OWE B;  3ALB A;  1UBI A;  2C7N B;  2BF8 B;  1T0Q C;  3HRD D;  2Y5B B;  2MW5 A;  4IC7 B;  2JRI B;  3RI7 C;  3U4E G;  3AEC B;  3VQI A;  3NRZ A;  1MHX A;  2MJD A;  3Q3O C;  4W9E A;  3R7Q A;  3ZDT A;  2ZNV C;  2CU1 A;  2O6V A;  3B2G A;  1I4G A;  1HZ6 A;  1ZXH A;  2ZW1 A;  1JWS D;  2LXA A;  3W5V B;  1B9R A;  1ZP0 B;  2K8B A;  1YN4 A;  3PRP B;  2IGD A;  1FCC C;  4ANX A;  4JGH B;  1YN3 A;  2RD0 A;  3ZO5 B;  3H7S A;  4I6L B;  3DBH I;  2L05 A;  1XLO A;  4AJW A;  2IY1 B;  2JUO A;  3FIL A;  1YJJ A;  3AH7 A;  2PVG C;  3H6N A;  3SHQ A;  4ZDV A;  2DZM A;  3DVN V;  4HWI B;  2KOX A;  3X0W A;  1D5X C;  3RNB C;  1SIF A;  1KRH A;  3ECI A;  4RMA A;  2MBH A;  4RCO A;  2KNB A;  1YJ1 A;  4ANU A;  5J2R A;  2RMM A;  3U2S C;  5MPO A;  3PPA A;  1BUI C;  4F8C B;  2TSS A;  3K9P B;  5JZE B;  3Q8A A;  3MTN B;  4HLE A;  4HCN B;  1P0R A;  2BYE A;  3KUD B;  4MAC A;  1VZ6 A;  1UNS A;  1FPY A;  3N3K B;  2GBK A;  3PHW B;  4PS7 A;  1OFF A;  4HPL B;  1RFA A;  1YOV B;  2QIL A;  1H8C A;  4E71 A;  1J19 A;  1V81 A;  3Q8F A;  4KKJ A;  2WX1 A;  4ARC A;  3IHP C;  2D3C A;  4GMV A;  4HKQ A;  4OW0 A;  3LJ3 A;  1WI0 A;  3QIJ A;  4K7U A;  4KIK A;  4XE0 A;  2WDQ B;  4LLG M;  2K6Q A;  3D32 A;  4GDK B;  2QIE B;  4K81 A;  2KT7 A;  5G5H A;  2MLB A;  3PSE B;  2EMS A;  2L32 A;  4FUL A;  5JHA A;  2WDR B;  2LVP A;  2IJ0 A;  1MJD A;  1ZE3 D;  1IP9 A;  2KJ6 A;  1YX6 B;  2JT4 B;  2K1F A;  5D6J B;  5G5G A;  2G9H D;  1R7S A;  4MM3 B;  4LDT D;  5H8Y E;  3CIR B;  3V6E B;  2KQ7 A;  1CJE A;  2RGF A;  4JX1 C;  4II2 B;  3U7D A;  1PFD A;  1C9F A;  2NS5 A;  2LUE A;  4HKZ E;  4Q2J A;  3V05 A;  5E6O A;  1G6J A;  2N9P C;  3H9D A;  3URY A;  4DK5 A;  1XF5 L;  3A9J A;  3ML8 A;  3TIX A;  2JX5 A;  1FNU A;  1WF9 A;  2AL6 A;  1V97 A;  1WFY A;  4DHZ E;  1J8C A;  4WAA A;  4WJO A;  1ET6 A;  1JWM D;  5AUI A;  1L2N A;  1J7A A;  2LGX A;  3NG0 A;  3APF A;  3HHM A;  3N1X C;  4C7Z A;  3U52 E;  5IA7 A;  4XWT A;  2D10 A;  1FCL A;  2LWP A;  3AED B;  4BKS D;  3B08 A;  5T8I A;  4C4V B;  2WQY B;  1P98 A;  3W1S C;  5FR6 A;  3ZXV A;  5J17 A;  1S1Q B;  3TCA A;  1TZO A;  2KN4 A;  3OLM D;  4LNN A;  4OVZ A;  2FUH B;  2UU7 A;  2JRH A;  2L1A A;  4ZRP A;  1YQB A;  3IBE A;  1T5X D;  4F1S A;  2WS3 B;  1XO3 A;  3RNG C;  1CMX B;  4W9C A;  2K3U A;  2JVC A;  1SE2 A;  2ZVO A;  1ESF A;  4ITK A;  1V5O A;  1TT5 B;  3H1U A;  3J9C A;  1C79 A;  4L23 A;  3AM9 A;  2M4N A;  2NTS A;  1WJU A;  3AMZ A;  1WIA A;  2YLM A;  2J0M A;  3I3T B;  1JWB D;  5BYQ A;  2CJN A;  1FXI A;  2M8S A;  3EFU A;  4P1C C;  1E8Z A;  2XBB C;  4DDI D;  4YTM B;  1C76 A;  2DWQ A;  1E5W A;  1JML A;  4MGZ E;  3KWV A;  3AE7 B;  4N59 A;  5C1Z A;  2KDE B;  4MGK E;  3RNF C;  1JQ4 A;  2VRR B;  3NUH B;  3VRA B;  3ZLZ A;  1K8R B;  3DWM A;  4S0R A;  4I6N B;  2WXJ A;  2W55 A;  2KTR A;  1DGJ A;  4PS3 A;  4WUR A;  2JQR B;  3NJT A;  2V4I B;  2G4D B;  3DBH B;  1QOF A;  3QX1 A;  1AWD A;  3UF8 A;  2GBN A;  4GSW A;  3ZIM A;  5LLI A;  2WXF A;  4WWM A;  3ZNG C;  2KMM A;  5CHF A;  1F77 A;  2IY0 B;  1L7Y A;  5LNK 1;  3KUC B;  2BYT A;  1FXA A;  3IVF A;  3ZJT A;  4A55 A;  2L7R A;  4G3X B;  1UEL A;  1F2R I;  3SR6 A;  3S2A A;  2H89 B;  4GLS C;  4NAM A;  1L0V B;  2LRW A;  1J7C A;  3TEZ A;  4NAW B;  1SEB D;  2C5L C;  2Y5C A;  3E56 A;  3U30 A;  3AEF B;  1Q5W B;  4WJP A;  2FUG 1;  4XWW A;  1RFK A;  2BPS A;  1I4H A;  4IM3 A;  4WWP A;  3BK1 A;  4GGQ A;  3RZW C;  3EFC A;  3HVD A;  1EM7 A;  1EWY C;  1SIJ A;  4LNO A;  1FRD A;  2J42 A;  2ZJD A;  1MVK A;  2JU6 X;  1WR1 A;  3CST A;  1ZOY B;  1N6Z A;  3PS6 A;  2KYW A;  4CO7 A;  3ZVV A;  2JWU A;  2BKR B;  4ASW C;  2LHD A;  1RLF A;  2GMI C;  3NZS A;  2KX3 A;  3HUI A;  4XX5 A;  1FNV A;  4UDU C;  2MBE A;  2R61 A;  4M02 A;  4KGR A;  2NBU A;  3MP9 A;  2DBY A;  4FLH A;  4EEW A;  2KVZ A;  5AZH A;  4XYC A;  3N1Z C;  1FFU A;  4YWG G;  4LTU A;  3N9Y C;  1TZ1 A;  3AE8 B;  5HHD G;  3GE8 C;  2JZ3 B;  5EE3 A;  3EGR A;  3KW5 B;  1WRI A;  1TGZ B;  3KWL A;  3I57 A;  3U7Z A;  5H92 C;  2N9K A;  4C80 A;  2AEH A;  2WXL A;  1WZ0 A;  4TUU A;  3AU5 A;  4DXA B;  3FAH A;  4JIO U;  3DCG A;  4IKG A;  4G50 A;  1ISN A;  5FK9 C;  4B0M A;  3K9O B;  4ANV A;  3R66 C;  1OTR B;  3VUX A;  3HK0 A;  3RZF A;  1EF5 A;  1HQR D;  2ACZ B;  5DCN A;  2PW9 A;  2QEJ C;  2B3A A;  1WGH A;  1AAR A;  2LVQ A;  2YVC A;  1YD8 U;  2C7H A;  1K50 A;  4G0N B;  5TR5 A;  1QOB A;  4JL9 A;  1CZP A;  1LGR A;  2KD0 A;  1XCT L;  2WXM A;  2KO3 A;  2REX A;  3GB1 A;  3NVW A;  2XN9 C;  1YIW A;  3KH0 A;  4YTN B;  1AN8 A;  1N62 A;  1T3Q A;  4M00 A;  4GDK A;  2Y5P A;  2KC1 A;  3ABV B;  2E3T A;  4IDI A;  2FBW B;  4ICU A;  2D5G A;  3RNA C;  2LAS A;  1TY2 A;  3N20 C;  2FIF A;  3A9K B;  2BYF A;  4LJO B;  4ZYN A;  3RPF C;  2ZPY A;  3TL5 A;  1F52 A;  4MM3 A;  1TKE A;  1ZPS A;  1SE9 A;  1ZKH A;  4AQ7 A;  3R3M A;  1QF6 A;  1XLQ A;  5EE1 A;  3UQB A;  2G3Q B;  5L95 C;  1V9J A;  1WZ3 A;  3P1M A;  4X57 B;  1WMH B;  1FD6 A;  1N61 A;  4PK1 A;  4OZB A;  2RSU A;  2KWD A;  3BVG A;  2DAJ A;  2PPH A;  3B0A A;  3HM6 X;  4IOI E;  2DZK A;  3VTU A;  1M4V A;  2KFK B;  2YEP B;  2LGD A;  2XNA C;  3VHT C;  1C77 A;  1VLB A;  5DPR A;  2QHO A;  2FAZ A;  1HXY D;  1A5R A;  5BYR A;  1TYG B;  1WYW B;  3BVZ A;  4K7S A;  4S17 A;  4A20 A;  4BAX A;  1QOG A;  1E8W A;  2KDF B;  2D3G A;  4WJN A;  4YTP B;  2LHE A;  1HA5 A;  3A1Q B;  3WAP A;  2WNM A;  4C4V A;  1TS2 A;  1I42 A;  4OHJ A;  1FFV A;  4YT0 B;  5GMV A;  5IN7 A;  3VDZ A;  4KDI C;  5LXH A;  2J0J A;  3DVG X;  1VR9 A;  4OVV A;  4RF1 A;  2N1V A;  3L13 A;  3ZXR A;  3PRM B;  3KYD D;  3ZRC A;  3DWG C;  4NY0 A;  5IOI A;  3W2D A;  2KC2 A;  3UQA A;  2BYV E;  2KWV B;  1VDV A;  3AI5 A;  4N6E B;  3NY5 A;  1L6U A;  5D3D A;  3ZDM C;  1K51 A;  4MH8 A;  1MG4 A;  2AWT A;  5BMG A;  2JWZ A;  1LQB A;  3BYT B;  5FKA C;  2FCQ A;  3Q3M C;  4AP4 C;  3HIZ A;  1E8Y A;  3AEB B;  1WXA A;  3C19 A;  3SFD B;  3CWI A;  1WE7 A;  3DHI C;  4AOF A;  3AV8 A;  4BOZ B;  4IG7 B;  4YSZ B;  3DVN U;  1WX7 A;  2QDF A;  2AL3 A;  3AXC A;  1PYW D;  2DZI A;  2UYZ B;  2XK5 B;  3DBL I;  3VR8 B;  4P7I A;  3LYY A;  2C60 A;  1FNW A;  2INP E;  3ZRF A;  2IND C;  1SJE D;  2C7M B;  2OOB B;  3VUY A;  4KGS A;  1WM2 A;  2KXJ A;  4RM8 A;  3LXF A;  1GAQ B;  2BB6 A;  1QLB B;  3PLU A;  5C3J B;  2PVO D;  3PHX B;  4IUM B;  4JWS C;  1I4R A;  1L4D B;  3ML9 A;  3IAM 1;  3H7P A;  5DPW A;  2QJL A;  1SB3 C;  5EE0 A;  3BZD B;  3JSV B;  1FRR A;  1WR6 E;  3DOW A;  2W9N A;  1P1A A;  3PZ7 A;  3SFE B;  1QQR A;  3VTW A;  2WXP A;  3RYT A;  3ZJU A;  2GOW A;  5CX3 A;  4II3 B;  1WX9 A;  4PS8 A;  5E6N A;  2N1W A;  2AQ3 B;  1IBX B;  1OQR A;  2N9E B;  1NBF C;  2J7Q B;  4EUT A;  3RT3 B;  2D3A A;  2EMT A;  4NAW A;  4F7Z A;  3ZJV A;  2VZK D;  1TKG A;  2OJR A;  4K3B A;  1VJK A;  2MBQ A;  2RR9 A;  2L8J A;  1TY0 A;  4GXB A;  3QA8 A;  2MP2 B;  1TS3 A;  5EDS A;  2NCN A;  2KDM A;  2OED A;  2SEB D;  1L5P A;  5AZF A;  1HTQ A;  2WXO A;  3PO0 A;  2K6D B;  4MGY E;  2PKO A;  2QSD A;  2INC C;  3B2F A;  4DWF A;  4IWP A;  1S3S G;  3Q69 A;  1QOA A;  3RUL A;  2L00 B;  3GP7 A;  1T0R C;  3DBS A;  3IG3 A;  3JVZ X;  2D3B A;  4USA A;  2BVC A;  4CHK A;  1TJE A;  1SJH D;  1GB1 A;  1VD2 A;  1HEZ E;  5HG2 A;  2Q5W D;  2M0A A;  4W9I A;  5JHB A;  2RPV A;  2KAN A;  1P3Q U;  3AEA B;  3I9V 1;  1RYJ A;  1Q1O A;  3WA0 A;  5C2T B;  1IGD A;  4ZHP A;  3AE5 B;  3Q3F A;  4CYE A;  4FAD A;  4ZRK A;  2AQ2 B;  1XQQ A;  4ZHO A;  1GC7 A;  2NR2 A;  1ACC A;  3L4P A;  4HJG E;  4ZOH C;  3IFW B;  4G11 A;  2V9H A;  2RDH A;  3H8H A;  3QCA A;  2N9L A;  4LNI A;  1OEY A;  1WSP A;  3GZN I;  1EU3 A;  3Q8E A;  4E3C A;  3ZGZ A;  1L0X B;  1Y56 A;  4WJQ A;  3A4R A;  1RAX A;  4NQL B;  1AW7 A;  1YQ3 B;  3FC4 A;  2ZZP B;  1NYR A;  1FIQ A;  3CMM B;  3ENE A;  4FHJ A;  4KKI A;  3T3N A;  3AB5 A;  4XGA B;  2PMV A;  2W3S A;  3KUZ A;  3A4S C;  4PYU A;  1C4C A;  3I5J C;  2KN5 A;  4TV3 A;  2WXK A;  4HVB A;  1Z2M A;  1YX5 B;  5G55 A;  5HFY A;  1WGR A;  3UIO B;  2GBR A;  4FBJ B;  2DYB A;  1KLG D;  2LMC A;  3WAO A;  5IKC M;  3QK0 A;  3V60 A;  3A9K A;  5JXV A;  2N7J A;  2D07 B;  2LGY A;  1ROE A;  3IAS 1;  2J0K A;  4MDK E;  1J7B A;  2MBB B;  2K8H A;  1EF1 A;  2BGF A;  2GBJ A;  1SF0 A;  2IPK D;  1FM0 D;  1L0Y B;  2JXT A;  2IO2 B;  1QZE A;  1WY8 A;  3NOB A;  2W82 A;  3TEY A;  1GB4 A;  2X38 A;  2KQ4 X;  3Q14 C;  3APC A;  1WMH A;  3QWZ B;  1IUE A;  1SE3 A;  2EEL A;  4IM2 A;  2MBO A;  3EC8 A;  1R4M I;  1UH6 A;  1I4P A;  1STE A;  2QC8 A;  4KSK C;  4HXD A;  1LXD A;  2K8C A;  5AUK A;  3W1Y A;  2INN E;  4KX6 B;  2MHJ A;  3BIN A;  2KFK A;  4J6I A;  1CQV A;  3VRB B;  1XEE A;  1WJ4 A;  4RFB A;  1V5T A;  1L6V A;  3APD A;  2BS2 B;  3SEB A;  1NVI D;  5G2N A;  4GB9 A;  3VH3 B;  5AZG A;  2BW2 A;  2WLB A;  2OHF A;  3O65 B;  3ZYY X;  3RNE C;  2PJH A;  3H7P B;  1WXQ A;  1NYQ A;  3A1Q A;  3KLS X;  1MI0 A;  2WGS A;  1E6E B;  1HTO A;  4O1N A;  1DOI A;  4EZJ A;  2ZNV B;  4I6P A;  1DOX A;  2D11 A;  3ZNH B;  5I4D A;  1V86 A;  3AE1 B;  3PRE A;  2CU3 A;  2M0X A;  4KZC A;  4MEM A;  1KH0 A;  3ONS A;  3T8M A;  3I63 C;  3FKY A;  4DXF A;  3JYU A;  2LJI A;  2SAK A;  1HZ5 A;  3WAM A;  2L3Z A;  4EZL A;  4MJS B;  2KAC A;  4M8N A;  2WU5 B;  3DHG C;  4BKS A;  3UI3 A;  2YEP F;  4A9A A;  2I1K A;  3LDZ E;  1RM6 C;  3KYC D;  1NEK B;  1E0Z A;  4NPN A;  3VVW B;  4OVU A;  1V1P B;  4IWO A;  3DBR I;  1D3Z A;  2HE7 A;  3KQ4 A;  4MSM B;  5TSS A;  3PV1 A;  4LJP B;  2I2Y A;  2MH7 A;  4BKG A;  2KWC A;  3C0R B;  4BZA A;  2DX5 B;  2IGG A;  2XK5 A;  2Z0E B;  2ZPN A;  1JCK B;  4L1B A;  2IO0 B;  3L17 A;  2DEN B;  2RDB C;  3BVM A;  4FXC A;  4P1B C;  1X1M A;  4HPM B;  3UGB B;  3RCZ A;  4W9F A;  4IWQ A;  1UZX B;  4KGT A;  2VH1 A;  3M63 B;  2KWU B;  4HDO A;  4A90 A;  1YMH E;  2CR5 A;  1YQ4 B;  4MH0 E;  1JWU D;  4US8 A;  3MC9 A;  2MA9 B;  1MPE A;  3OAW A;  1ZW7 A;  2LGI A;  2GRI A;  2IZV B;  3JSV A;  1J0G A;  3Q8C A;  2JZZ A;  1WXM A;  2LGS A;  4DXG A;  4C00 A;  3P63 A;  2O2V B;  5HI1 A;  1K53 A;  3BII D;  4YL8 A;  1F1H A;  2N0S B;  1IBX A;  2O6V D;  2BS4 B;  2V3S A;  1N5X A;  2CKH B;  2LZ6 A;  1BXT A;  4FJV B;  4ICV A;  1AYF A;  4LCD E;  3MC8 A;  3N32 A;  4K7W A;  5KHO A;  3UIN B;  4DDG D;  1V6E A;  2JYT A;  2HTH A;  2V0G A;  4EZK A;  2BWE S;  4DHZ B;  2MP2 A;  5LXI B;  1DOY A;  4JLC A;  1UBQ A;  1LO5 D;  1MHH E;  1OQQ A;  1TTN A;  4OZC A;  5C23 A;  3RD2 A;  5AEK B;  4NJC A;  1N63 A;  2V3N A;  4GIV A;  2PE6 B;  4RM9 A;  2DAF A;  4GN1 A;  1Y8R C;  3EEC A;  2LFI A;  4NZL B;  1IGC A;  4C7Y A;  5D3I B;  3NHE B;  2VZK B;  1E90 A;  3TEX A;  5L83 A;  2ONQ A;  1XT9 B;  4PYZ A;  2KTF A;  3BWU D;  4BVU C;  1ENF A;  1Z5S B;  4LDT B;  1WGY A;  1FXT B;  1WRD B;  3HVZ A;  2HTM E;  5BMI A;  2IO1 B;  4MSQ B;  3QAR A;  3IT6 B;  3NZ3 A;  2L76 A;  4CQN A;  1JRO A;  3PRZ A;  3RNC C;  4FN2 A;  4QAY A;  3TEW A;  4K1R B;  1PDX A;  1WGG A;  2AQ1 B;  3ZKJ C;  1GUA B;  3CF6 E;  2E6X A;  3Q8B A;  2QMT A;  3AE3 B;  5E6P A;  4HEA 1;  1H4R A;  4FHK A;  4KZ0 A;  4IM0 A;  4BBN F;  3DHH C;  2LI5 A;  2GI9 A;  1T0S C;  1EO6 A;  1WJN A;  2FNJ B;  4DHJ D;  1V80 A;  1GG3 A;  2WXR A;  3GS2 A;  1E10 A;  1JWA D;  4B95 A;  1VCB A;  2JYE A;  4RGO S;  2GB1 A;  1KLU D;  2WHI A;  4GDL B;  2KMC A;  4W9L A;  4A3O A;  4ANW A;  3R8B A;  3Q6B A;  1IPG A;  2V3P A;  2KLC A;  1T6B X;  3NZU A;  4RGN A;  4W9D A;  1UD7 A;  2JSV X;  1B1Z A;  2XEW A;  4GOC A;  1C3T A;  3DBR B;  4EE2 A;  1UUP A;  2WXH A;  2LUM A;  4XDC A;  1T0Y A;  4W9J A;  4EOY A;  2LXC A;  4XDD A;  3IXS A;  1NEN B;  2RDG A;  2I1J A;  2I38 A;  3E9S A;  1ET9 A;  4WAF A;  5CHV C;  3R2T A;  3MHS D;  1YN5 A;  3P2B A;  3BYY B;  4WQO B;  4JPS A;  3V3X A;  1VRA B;  1WYG A;  3Q2A C;  2KDI A;  1U4A A;  3EUB 2;  2JY6 A;  1C1Y B;  4MT5 A;  2L0T A;  1ZGU B;  5D94 A;  2JPH A;  3MHZ A;  1PGB A;  3PZ8 A;  1WXV A;  2NBV B;  1I35 A;  3VAW A;  4US9 A;  1C4A A;  5D7G A;  3PT2 B;  2BWF A;  4M8M A;  3QQ8 B;  2M56 B;  3W5U B;  2PE9 A;  3TMP B;  4JQW C;  5IP4 D;  1FO4 A;  3P4P B;  2ASQ A;  4YSY B;  4HDQ A;  4MJS A;  3NVZ A;  3AE9 B;  3ZNI D;  2NMQ A;  1TKY A;  3O13 A;  3R2I A;  3RN9 C;  1E7V A;  2AYO B;  4N9F 4;  2DHZ A;  3MC0 B;  3QHT A;  2IGH A;  3V61 A;  4JE3 B;  2ZCB A;  2N7D A;  1V1P A;  4NQK E;  1N60 A;  1IYF A;  1BML C;  3PTF C;  3ZTD A;  1TIF A;  3WIM A;  3L10 B;  3L54 A;  3P42 A;  1SXT A;  3AN1 A;  4TMA B;  1WM3 A;  2NPT B;  1FMA D;  3NS1 A;  4ZRI A;  2KLG A;  4RH6 A;  3VTV A;  3MFG A;  1I7H A;  2K25 A;  2RPQ A;  2BS3 B;  1WWT A;  3GE3 C;  2M1M A;  1JAL A;  4P6V F;  4L2Y A;  1GC6 A;  2HJ8 A;  4HCP B;  5GXG B;  2PIA A;  3BY4 B;  2KDB A;  5KHQ A;  2J52 A;  5E6J A;  1V1O A;  2K0P A;  2HDE A;  1KTK A;  2BBC A;  2KKC A;  4MEL A;  1TS5 A;  3TJP A;  4WIP A;  3QJZ A;  4P16 A;  2MJ3 A;  4M0W B;  1ZXI A;  2FCN A;  1YNT E;  1E7U A;  4ARI A;  3N1Y C;  3Q3J A;  2NBW B;  3AEG B;  4TSS A;  1LM8 B;  3TUO A;  2ON8 A;  5BYS A;  4EFO A;  1NI2 A;  3T3O A;  4NJ6 A;  4RNA A;  2B76 B;  2O2V A;  1SGH A;  3UIP B;  2BKF A;  5J18 A;  1DYQ A;  3AE6 B;  2MEK A;  3V6C B;  4AUQ C;  4KDL B;  4JWU C;  4EKU A;  3KVF B;  3RMK C;  1GJZ A;  1V2Y A;  4ZYS A;  4B0E A;  2G45 B;  2N4F A;  5BO4 B;  3ZW3 A;  4DQO C;  1MFW A;  1R4N I;  2EKI A;  2G4S A;  4KSL C;  4FA6 A;  2KHW B;  3A33 B;  4J3O D;  1XCQ L;  1KLV A;  2MSE D;  4WWO A;  4BOS C;  4B6W A;  1LFD A;  4FJY A;  1OEY J;  2GLS A;  2H88 B;  1XD3 B;  3B1L X;  1WJ6 A;  2O6V B;  4NJ7 A;  2BT6 A;  2KJH B;  4RF0 A;  1E9M A;  2LJ5 A;  1EUV B;  1RWS A;  3M3J A;  2A5U A;  2G1E A;  2PEA A;  3P4R B;  1PQS A;  3W1S A;  4ACF A;  2WXI A;  1NDD A;  5HKH A;  3QAQ A;  1GOZ A;  1HE8 A;  3DBL B;  3DDC B;  2BQQ A;  2KZR A;  2JZP A;  2DNF A;  1F2R C;  3FIL B;  4XC2 A;  4HJK A;  2K39 A;  2V4L A;  2DYO A;  2D2Q A;  2FCM A;  2KFJ A;  2KX0 A;  2JF5 A;  3OG5 A;  4WH4 A;  1QT9 A;  3VR9 B;  3W9C B;  1JW9 D;  3OJ4 B;  1P7E A;  1CK1 A;  1UGM A;  2Z0D B;  3WAN A;  3SDL C;  2HJ1 A;  3U8Z A;  3WAL A;  2MWS B;  2NTT A;  3HM3 A;  1SBB B;  4WQM A;  1GPX A;  1PGA A;  3AUL A;  3MJ5 A;  2R2O A;  4DBG A;  3L08 A;  1WXS A;  2CHX A; 
#chains in the Genus database with same CATH homology
 3SU8 X;  4AOF A;  4BOZ B;  4IG7 B;  1WF9 A;  3UIN B;  2AL6 A;  4DDG D;  1V6E A;  3DVN U;  1WFY A;  4DHZ E;  1WX7 A;  2HTH A;  5DPT A;  2AL3 A;  3AXC A;  1J8C A;  4WAA A;  4WJO A;  3JW0 X;  2DZI A;  2UYZ B;  2XK5 B;  4EZK A;  3DBL I;  1L2N A;  1MG8 A;  2BWE S;  4P7I A;  4DHZ B;  3SD5 A;  2MP2 A;  5LXI B;  4GU2 A;  2JXX A;  2LD9 A;  2EKE C;  2LGX A;  2HD5 B;  4JLC A;  2C60 A;  3APF A;  1UBQ A;  1P9D U;  3HHM A;  3MJW A;  5IA7 A;  4ZRJ A;  1TTN A;  5C23 A;  3RD2 A;  3ZRF A;  5AEK B;  3AU4 A;  2D10 A;  1WE6 A;  4GIV A;  4HK2 A;  3PLV A;  2C7M B;  2LWP A;  2ZVN A;  2PE6 B;  1V49 A;  2OOB B;  4BKS D;  2IBI B;  2DAF A;  3B08 A;  4GN1 A;  4RM9 A;  1Y8R C;  3VUY A;  3EEC A;  4GDL A;  1P98 A;  1WM2 A;  2KXJ A;  3W1S C;  5CHW A;  2C9W B;  4RM8 A;  4KIK B;  1S1Q B;  5FR6 A;  2DZJ A;  5J17 A;  3TCA A;  3OLM D;  4TQ1 A;  3NHE B;  3PLU A;  1E90 A;  4W9G A;  2FUH B;  4IW0 A;  1BT0 A;  2JRH A;  5L83 A;  5D2M B;  2M17 A;  3PHX B;  4IUM B;  1YQB A;  3IBE A;  3N30 A;  3VXW A;  4F1S A;  3ML9 A;  1XT9 B;  1CMX B;  4PYZ A;  2KTF A;  2LRU A;  3H7P A;  4W9C A;  5DPW A;  2JVC A;  2ZVO A;  2GBM A;  4BVU C;  1Z5S B;  2ZEQ A;  4LDT B;  4DHJ B;  1F9J A;  1WGY A;  1FXT B;  1V5O A;  3JSV B;  1WRD B;  3L16 A;  4KVG B;  4W9H A;  1WR6 E;  3H1U A;  3V62 A;  3DOW A;  2W9N A;  1P1A A;  3VTW A;  2FID A;  2M4N A;  3RYT A;  2GOW A;  2IO1 B;  5CX3 A;  1WJU A;  4MSQ B;  4II3 B;  1WX9 A;  1WIA A;  3QAR A;  2YLM A;  4PS8 A;  2L76 A;  2N1W A;  5E6N A;  2J0M A;  3I3T B;  2M8S A;  3EFU A;  2N9E B;  2MX2 A;  1NBF C;  1E8Z A;  2XBB C;  4DDI D;  2J7Q B;  3PRZ A;  4KV2 A;  4EUT A;  4FN2 A;  1E5W A;  3RT3 B;  4MGZ E;  2EMT A;  4NAW A;  2CHZ A;  4TKN A;  4F7Z A;  4K1R B;  1TBE A;  2R2Q A;  3A9J B;  5C1Z A;  2OJR A;  2KDE B;  2WYQ A;  3EHV A;  2MBQ A;  4MGK E;  2RR9 A;  1WGG A;  2KK8 A;  2L8J A;  2VRR B;  3ZKJ C;  2IYD B;  1GUA B;  3CF6 E;  4GXB A;  3ZLZ A;  1K8R B;  3QA8 A;  5E6P A;  1H4R A;  3VH4 B;  2MP2 B;  4FHK A;  4KZ0 A;  4IM0 A;  4I6N B;  4BBN F;  5EDS A;  4WWN A;  2LI5 A;  2NCN A;  3X23 A;  2KTR A;  1EO6 A;  4PS3 A;  3ZNZ B;  5AZF A;  1WJN A;  2FNJ B;  4DHJ D;  1V80 A;  1GG3 A;  2MRP A;  5DPS A;  2K6D B;  3L0W B;  2IO3 B;  4MGY E;  2KMA A;  3TIX A;  4DWF A;  1WGD A;  4IWP A;  3QC8 B;  4B95 A;  1S3S G;  1VCB A;  3RUL A;  2L00 B;  2G4D B;  3DBS A;  4BBN C;  3IG3 A;  3JVZ X;  3QX1 A;  4GDL B;  4CHK A;  3UF8 A;  4AJY B;  2KMC A;  2GBN A;  4GSW A;  3ZIM A;  4W9L A;  3DQV A;  5LLI A;  4A3O A;  1VD2 A;  4URK A;  2WX0 A;  4ANW A;  1IPG A;  3PVL A;  3ZNG C;  4W9I A;  2KLC A;  3NZU A;  5JHB A;  3OJ3 A;  4B9K A;  2KAN A;  1WX8 A;  4W9D A;  5CHF A;  1P3Q U;  1UD7 A;  2CS4 A;  3NS8 A;  4E74 A;  2IY0 B;  5JH5 C;  1L7Y A;  1Q1O A;  1JRU A;  2XEW A;  3WA0 A;  4GOC A;  3KUC B;  1C3T A;  1OGW A;  2KVR A;  2FCS A;  3IVF A;  1RRB A;  3Q3F A;  4CYE A;  2L7R A;  3T9L A;  4G3X B;  4MGI E;  1T0Y A;  2N9X A;  3TBL D;  4FAD A;  4ZRK A;  4W9J A;  4EOY A;  1XQQ A;  1UEL A;  2LXC A;  2L0F A;  1GC7 A;  2NR2 A;  2I1J A;  3IFW B;  3S2A A;  3VUW A;  2NPT A;  4G11 A;  5CHV C;  2MQJ A;  2LVO A;  2N7E A;  3MHS D;  2LRW A;  5CTR C;  3QCA A;  3P2B A;  1WH3 A;  4WQO B;  2MCN B;  1OQY A;  1OEY A;  4NAW B;  3GZN I;  3PZD A;  4E3C A;  2C5L C;  2WDT B;  3U30 A;  2KDI A;  1Q5W B;  4WJQ A;  3A4R A;  1U4A A;  5IAA C;  1RAX A;  4WJP A;  2JY6 A;  4NQL B;  3M95 A;  1C1Y B;  2BPS A;  3DPD A;  3M62 B;  2L0T A;  2ZZP B;  1ZGU B;  3CMM B;  3ENE A;  2JPH A;  5D94 A;  4IM3 A;  4FHJ A;  4GGQ A;  4WWP A;  3RZW C;  3GOE A;  1WXV A;  2NBV B;  3KUZ A;  1I35 A;  3A4S C;  2KTR B;  3VAW A;  4PYU A;  1E8X A;  2ZJD A;  2KN5 A;  1WR1 A;  4NNJ B;  4TV3 A;  1KOT A;  4HVB A;  5D7G A;  3ZTC A;  1GNU A;  3CST A;  3PT2 B;  3R7R A;  1Z2M A;  1YX5 B;  3PS6 A;  5G55 A;  4CO7 A;  2BWF A;  4M8M A;  1KM7 A;  1WGR A;  3ZVV A;  3UIO B;  3QQ8 B;  2GBR A;  4AWJ A;  4FBJ B;  2DYB A;  4W9K A;  3WAO A;  2PE9 A;  2BKR B;  3TMP B;  3QK0 A;  3ZUN A;  4ASW C;  4XZ4 A;  3V60 A;  1RLF A;  2GMI C;  3A9K A;  4JQW C;  4TQ0 A;  3NZS A;  2KX3 A;  2ASQ A;  1KJT A;  2D07 B;  2LGY A;  4XX5 A;  3VFK A;  2J0K A;  2MBE A;  2DYM A;  4HDQ A;  4MDK E;  2NBU A;  4MJS A;  3ZNI D;  2MBB B;  2K8H A;  1EF1 A;  2BGF A;  4FLH A;  2GBJ A;  2V1Y A;  4FJZ A;  4EEW A;  5AZH A;  4BKT A;  2A4Z A;  2IO2 B;  3CSF A;  1QZE A;  1TZ1 A;  3PGE A;  2NVU I;  1WY8 A;  1E7V A;  1Q0W B;  2AYO B;  2JZ3 B;  2WWZ A;  3NOB A;  2ZCC A;  2DHZ A;  4N9F 4;  3KW5 B;  3QHT A;  3V61 A;  2ZCB A;  3APC A;  1WMH A;  3QWZ B;  3RUI B;  2Z59 B;  1M94 A;  2N7D A;  1TGZ B;  4IM2 A;  2MBO A;  2CHW A;  3EC8 A;  1R4M I;  4NQK E;  1UH6 A;  4BFR A;  1IYF A;  2KQS A;  2UWQ A;  3PTF C;  4KSK C;  3ZTD A;  4A3P A;  4HXD A;  1LXD A;  3WIM A;  2AEH A;  2K8C A;  3L10 B;  1WZ0 A;  3L54 A;  4TUU A;  3W1Y A;  2KJR A;  3DVG Y;  3AU5 A;  3ALB A;  1WM3 A;  2NPT B;  4DXA B;  3BIN A;  2KFK A;  1UBI A;  2C7N B;  4J6I A;  4ZRI A;  2BF8 B;  2KLG A;  3VTV A;  1WJ4 A;  4JIO U;  2K25 A;  2RPQ A;  3DCG A;  4G50 A;  2Y5B B;  1ISN A;  1V5T A;  2MW5 A;  3K9O B;  4IC7 B;  4ANV A;  3R66 C;  1OTR B;  2JRI B;  3VUX A;  3HK0 A;  3RZF A;  2M1M A;  1EF5 A;  3APD A;  3VQI A;  5DCN A;  2B3A A;  5G2N A;  1GC6 A;  1WGH A;  4GB9 A;  2HJ8 A;  1AAR A;  2LVQ A;  2YVC A;  1YD8 U;  2C7H A;  4G0N B;  4HCP B;  3VH3 B;  5AZG A;  5TR5 A;  4W9E A;  3O65 B;  4JL9 A;  3R7Q A;  2PJH A;  2KDB A;  3BY4 B;  3ZDT A;  2ZNV C;  2CU1 A;  2O6V A;  3H7P B;  5KHQ A;  2LXA A;  2KD0 A;  3A1Q A;  2KO3 A;  2REX A;  4EZJ A;  2KKC A;  2ZNV B;  4MEL A;  1YIW A;  3KH0 A;  4I6P A;  3TJP A;  2K8B A;  3QJZ A;  4GDK A;  2D11 A;  3ZNH B;  3PRP B;  4M0W B;  4ANX A;  1V86 A;  2KC1 A;  2FCN A;  3PRE A;  2M0X A;  4JGH B;  4KZC A;  4MEM A;  3ONS A;  3T8M A;  1E7U A;  4ICU A;  2LAS A;  3JYU A;  2FIF A;  3Q3J A;  3A9K B;  2BYF A;  2RD0 A;  3ZO5 B;  3H7S A;  2NBW B;  3DBH I;  2L05 A;  4I6L B;  4LJO B;  3WAM A;  4ZYN A;  1LM8 B;  4AJW A;  2IY1 B;  2JUO A;  2L3Z A;  4EFO A;  2ZPY A;  1NI2 A;  4EZL A;  4MJS B;  4NJ6 A;  3TL5 A;  3H6N A;  4MM3 A;  3SHQ A;  1SE9 A;  1ZKH A;  4M8N A;  4ZDV A;  2DZM A;  3R3M A;  2O2V A;  3DVN V;  4BKS A;  1SGH A;  4HWI B;  2I1K A;  2KOX A;  3X0W A;  3UQB A;  2G3Q B;  3LDZ E;  3UIP B;  5L95 C;  2BKF A;  1SIF A;  3ECI A;  5J18 A;  3KYC D;  1V9J A;  1WZ3 A;  4RMA A;  2MBH A;  2KNB A;  3V6C B;  4X57 B;  1WMH B;  4KDL B;  4NPN A;  3VVW B;  4AUQ C;  4OVU A;  1YJ1 A;  4ANU A;  4EKU A;  5J2R A;  3KVF B;  4IWO A;  3DBR I;  1D3Z A;  2HE7 A;  2RSU A;  1GJZ A;  4MSM B;  1V2Y A;  2DAJ A;  2PPH A;  3B0A A;  3PPA A;  3PV1 A;  4F8C B;  5JHA A;  2G45 B;  3K9P B;  3HM6 X;  4LJP B;  5JZE B;  2DZK A;  2N4F A;  3MTN B;  3VTU A;  2KFK B;  5BO4 B;  4BKG A;  3ZW3 A;  4HLE A;  2KWC A;  2LGD A;  3C0R B;  2DX5 B;  3VHT C;  4HCN B;  1P0R A;  1R4N I;  2G4S A;  4KSL C;  2XK5 A;  2Z0E B;  2ZPN A;  2KHW B;  4FA6 A;  2IO0 B;  5DPR A;  3L17 A;  2QHO A;  3A33 B;  2DEN B;  1KLV A;  2MSE D;  4WWO A;  4BOS C;  2FAZ A;  2BYE A;  3KUD B;  4B6W A;  1LFD A;  4FJY A;  3N3K B;  1A5R A;  2GBK A;  3PHW B;  4PS7 A;  1WYW B;  1OEY J;  4HPL B;  4K7S A;  1RFA A;  4A20 A;  1H8C A;  1X1M A;  4HPM B;  4E71 A;  3UGB B;  1J19 A;  1V81 A;  1XD3 B;  3B1L X;  3RCZ A;  1WJ6 A;  2O6V B;  2WX1 A;  4NJ7 A;  4W9F A;  3IHP C;  1E8W A;  2KDF B;  1J0G A;  2D3G A;  2KJH B;  4IWQ A;  1UZX B;  4WJN A;  4GMV A;  2LJ5 A;  3A1Q B;  3WAP A;  1I42 A;  3LJ3 A;  1EUV B;  3M3J A;  1WI0 A;  3QIJ A;  4K7U A;  3M63 B;  4KIK A;  5GMV A;  2A5U A;  3VDZ A;  2K6Q A;  2KWU B;  3D32 A;  4HDO A;  4KDI C;  4GDK B;  4K81 A;  2PEA A;  2CR5 A;  5LXH A;  2J0J A;  1PQS A;  3DVG X;  3W1S A;  4OVV A;  4MH0 E;  2N1V A;  3L13 A;  1NDD A;  5HKH A;  2MLB A;  3PSE B;  2EMS A;  3QAQ A;  1HE8 A;  2MA9 B;  3PRM B;  4FUL A;  3OAW A;  2LVP A;  3KYD D;  3ZRC A;  3DDC B;  4NY0 A;  1ZW7 A;  2KZR A;  1IP9 A;  2KC2 A;  3UQA A;  2KJ6 A;  2BYV E;  1YX6 B;  2KWV B;  2IZV B;  2JT4 B;  2K1F A;  3AI5 A;  3JSV A;  4XC2 A;  5D6J B;  4HJK A;  2K39 A;  2V4L A;  2DYO A;  2D2Q A;  2FCM A;  2JZZ A;  2KFJ A;  2KX0 A;  3NY5 A;  4LDT D;  2JF5 A;  1WXM A;  3V6E B;  3ZDM C;  2KQ7 A;  2O2V B;  2AWT A;  2JWZ A;  1LQB A;  2RGF A;  3OJ4 B;  2FCQ A;  1UGM A;  2Z0D B;  4II2 B;  4YL8 A;  3U7D A;  3WAN A;  3SDL C;  2NS5 A;  2O6V D;  4AP4 C;  2LUE A;  2V3S A;  3U8Z A;  3WAL A;  2MWS B;  3HIZ A;  1E8Y A;  3HM3 A;  2CKH B;  2LZ6 A;  1WXA A;  5E6O A;  1G6J A;  2N9P C;  3H9D A;  4FJV B;  3AUL A;  4ICV A;  4DK5 A;  2R2O A;  4LCD E;  4DBG A;  3L08 A;  1WXS A;  1WE7 A;  3N32 A;  3A9J A;  3ML8 A;  4K7W A;  2CHX A;  5KHO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...