4W9LA

Pvhl:elob:eloc in complex with (2s,4r)-1-((s)-2-((s)-2-acetamido-3,3-dimethylbutanamido)-3,3-dimethylbutanoyl)-4-hydroxy-n-(4-(4-methylthiazol-5-yl)benzyl)pyrrolidine-2-carboxamide (ligand 15)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
103
structure length
101
Chain Sequence
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGEGFTSQTARPQAPATVGLAFRADDTFEALIEPFSSPPELPDVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Guided Design and Optimization of Small Molecules Targeting the Protein-Protein Interaction between the von Hippel-Lindau (VHL) E3 Ubiquitin Ligase and the Hypoxia Inducible Factor (HIF) Alpha Subunit with in Vitro Nanomolar Affinities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords Transcription elongation factor B polypeptide 2
total genus 22
structure length 101
sequence length 103
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4w9lA00
2D11A 1UZXB 2ZZPB 2RGFA 2DYBA 1P1AA 3SHQA 2JPHA 3KW5B 1TTNA 4IM0A 2FCMA 2Z0EB 1P9DU 4FJYA 4GOCA 5JH5C 3PLUA 4HDOA 5D6JB 4BBNC 4MSMB 4HCNB 3UGBB 3L0WB 3X0WA 4KDLB 2LRWA 1WFYA 2D2QA 4FBJB 1I42A 1UBQA 3JSVB 2QHOA 3B08A 3PHXB 3EFUA 2RSUA 3RD2A 1OGWA 2I1KA 4I6PA 5GMVA 3U8ZA 2Z0DB 1SE9A 4NAWB 4WWPA 3VTVA 2CHZA 2C9WB 3A9JA 3V62A 2AL6A 1YIWA 3QWZB 2MBBB 1I35A 5G55A 1LM8B 2DYMA 4JGHB 2LZ6A 4EZKA 3DQVA 3EHVA 3PTFC 2Z59B 4DDGD 3RUIB 2ZJDA 3H7PA 1Q5WB 2CHWA 1YX6B 3DPDA 2MQJA 2ZVNA 3ZTCA 4ANUA 2IO2B 5DPRA 4DHJB 3RT3B 2NBUA 3TMPB 1WRDB 2VRRB 5LXIB 2K25A 2KVRA 2LVQA 2L3ZA 4FULA 2LGDA 4F7ZA 4HXDA 4EUTA 2LVOA 2GBRA 2OOBB 2L0TA 1NDDA 2V1YA 4TKNA 2FIFA 4J6IA 3DVGY 4KDIC 2MBQA 3UQAA 1NBFC 3ONSA 4W9FA 3VUYA 1KLVA 2CR5A 1V9JA 2NVUI 3WAMA 1WE6A 4AUQC 2L8JA 4OVUA 2C7NB 4MGYE 2C60A 5IA7A 3HHMA 4AJYB 2KWVB 2GBJA 2ZNVB 2J0JA 3C0RB 3AULA 3OAWA 4N9F4 4LJPB 4M0WB 3ZRFA 3ZIMA 2NS5A 4BFRA 1E90A 5J17A 2IY1B 4K7WA 3R7RA 2D07B 2FCNA 1V5TA 4NY0A 3ZDTA 3K9OB 1WF9A 3IG3A 4E74A 3NY5A 1J0GA 2LGXA 3CF6E 4HPLB 3ZW3A 4HVBA 2IO0B 1RFAA 3PRZA 2LUEA 2KFJA 2N9PC 3UIPB 2ZPNA 1C3TA 3M3JA 3PGEA 3VH4B 1FXTB 3ZLZA 3QX1A 1R4MI 5LXHA 3EECA 3NS8A 3W1SC 4MEMA 3EC8A 3PVLA 4NQKE 2O6VD 4WQOB 2R2QA 4K7SA 3VUWA 5IAAC 1XQQA 3U7DA 4AP4C 2K6QA 4P7IA 1WH3A 3H6NA 3NHEB 4II2B 2MLBA 2KDIA 4K81A 2XEWA 4G3XB 4EKUA 2RD0A 2J0KA 5CHFA 4ICUA 3RCZA 4HJKA 2LVPA 4TQ1A 3L54A 1V49A 1WGGA 3HIZA 1E5WA 1WI0A 3WAPA 3QQ8B 3JSVA 1J19A 3QC8B 4MSQB 3VDZA 3OJ3A 1OQYA 2AWTA 3R3MA 4URKA 4OVVA 3UF8A 4LDTD 2L0FA 3JVZX 4DBGA 2L76A 2JZZA 4IM2A 2AYOB 2R2OA 5CHVC 2A5UA 2CU1A 1UD7A 3WANA 2FNJB 4PYUA 2DYOA 3WAOA 2C7HA 5JHBA 2GBMA 2A4ZA 4A20A 2LXCA 3KYCD 2NPTB 4IG7B 2PE9A 2N7EA 1WJNA 2DENB 2NR2A 3H7PB 3KH0A 5AZFA 5L95C 4BKSA 2PE6B 4AJWA 2C7MB 2BGFA 3PPAA 1UBIA 2BPSA 5FR6A 5HKHA 2KC2A 2O2VA 2UWQA 4AWJA 2J7QB 2D10A 3TIXA 1YJ1A 2CKHB 3V6CB 2N7DA 1RLFA 2XK5A 3T8MA 4B6WA 3M63B 4TQ0A 1KOTA 2G45B 2I1JA 2PJHA 4EZLA 5C23A 5D94A 4CO7A 5D2MB 4DDID 3HM3A 1R4NI 1WXMA 4EOYA 2BYEA 1RRBA 4HK2A 1E8WA 1ZW7A 4KVGB 1TBEA 3I3TB 1ISNA 2JUOA 4ZRKA 3TL5A 3R66C 2DZKA 4JL9A 1SIFA 5KHQA 3SDLC 4MH0E 4ASWC 3ZNZB 5C1ZA 5CHWA 2BYVE 2PPHA 2GBNA 3ZTDA 1GC7A 2XK5B 3QIJA 5CX3A 2WWZA 2RPQA 4FLHA 3OJ4B 4KSKC 2L00B 4BKTA 1H8CA 3B0AA 3U30A 1WJ6A 1WX9A 2REXA 5E6PA 2ZPYA 5KHOA 1GJZA 3VAWA 3B1LX 4W9EA 3RZWC 2KTRA 4RM8A 4FJZA 3CMMB 2KX0A 2MP2A 2KJHB 3N32A 4ZYNA 4W9LA 1GNUA 4BKGA 1YX5B 4W9HA 2LI5A 2AEHA 2NBWB 4KSLC 1QZEA 4GMVA 1OEYJ 3VTWA 1EF1A 2HJ8A 1WM2A 2DHZA 4HLEA 5EDSA 1WR1A 3APDA 1Y8RC 2KTFA 3DBLI 3IBEA 2M17A 3DVNU 4GSWA 4MM3A 4IC7B 2ZCBA 4FHJA 4PS8A 2KQ7A 3PLVA 4WAAA 2EMTA 5CTRC 3PZDA 1V81A 1WR6E 3AU5A 4XX5A 2JRIB 2PEAA 5JZEB 2MP2B 2G3QB 4WJQA 3V60A 4GDLB 4FA6A 2DZJA 3PT2B 4FADA 3IHPC 1GUAB 3ZNGC 4IWPA 1L2NA 1LXDA 2BWFA 2FUHB 3A4SC 3PV1A 1WX7A 4IW0A 3RYTA 3ZVVA 1P0RA 2HE7A 1X1MA 2NPTA 3ML8A 2KLCA 2JWZA 3VVWB 5BO4B 3TJPA 1YQBA 3KUZA 3T9LA 4WWNA 1WXSA 4GGQA 5L83A 5AEKB 4ICVA 4A3PA 3HM6X 2KWCA 1WGYA 3DVGX 1UGMA 1JRUA 4G11A 1IPGA 2KC1A 3RULA 2KJ6A 3ZO5B 2N4FA 4W9KA 1HE8A 4ZRJA 1Z2MA 4HWIB 4W9CA 2IY0B 5J2RA 1SGHA 2FAZA 3PRMB 1H4RA 1P3QU 1ZGUB 3BINA 3LJ3A 3PREA 5LLIA 2UYZB 2DZIA 2JF5A 2WYQA 4MGZE 3WALA 2KDEB 1V2YA 2YVCA 3A4RA 4KIKB 2LWPA 2MSED 3SD5A 4HCPB 2FCSA 1Z5SB 1A5RA 3OLMD 2ZEQA 3PHWB 3KUCB 4RM9A 2MX2A 3A33B 4GDKB 5AZGA 3UINB 4DHZE 4HPMB 1IYFA 4XC2A 2KK8A 5DCNA 1EO6A 1KJTA 4NJ6A 3VHTC 2KJRA 4E71A 4NJ7A 2BKFA 3IVFA 2WX1A 1RAXA 2KANA 1CMXB 4LDTB 1Q0WB 5AZHA 2K6DB 2N1VA 2AL3A 4NPNA 4MDKE 3ECIA 4JLCA 1J8CA 1G6JA 2LXAA 2IBIB 3TBLD 4ZRIA 1TGZB 4JIOU 2KMAA 3D32A 4NAWA 3PSEB 1YD8U 4LJOB 1WGDA 1U4AA 2HTHA 1GG3A 1Q1OA 2KD0A 4ANWA 3DDCB 5E6NA 4G0NB 4IUMB 2IO3B 1E7VA 2ZNVC 1UELA 2GBKA 2LASA 1F9JA 2MCNB 4EFOA 3L10B 3L13A 3P2BA 2MW5A 3L17A 3TCAA 2DAFA 2N9XA 5E6OA 1ZKHA 4BBNF 3QJZA 3WIMA 2FIDA 3WA0A 1V86A 4FJVB 4YL8A 3VXWA 3DVNV 4K7UA 1WMHB 2KKCA 3BY4B 3KVFB 3VTUA 2K39A 2K1FA 1LFDA 2GMIC 2MRPA 4GDKA 1S1QB 3NZUA 4HDQA 3GZNI 3DBSA 3A9KA 3QCAA 4LCDE 5DPWA 4F8CB 3ZDMC 3QAQA 4DHZB 2DZMA 4ZDVA 4W9IA 1E7UA 2KZRA 2K8BA 3A1QA 3ML9A 4BOSC 2Y5BB 2HD5B 3UQBA 2L7RA 1WGRA 2DX5B 5DPTA 1T0YA 2M1MA 5G2NA 3VH3B 2EKEC 4NQLB 4WJNA 4ANXA 2KQSA 1KM7A 1LQBA 2BF8B 3IFWB 2WDTB 5J18A 1WZ3A 1XD3B 2G4SA 2M4NA 1IP9A 4DK5A 2JT4B 3DBRI 3APCA 4IWQA 3S2AA 2MBHA 4K1RB 1GC6A 4RMAA 4KV2A 3R7QA 4BVUC 2BKRB 3APFA 2KNBA 2IO1B 4X57B 5TR5A 3NOBA 3HK0A 3NZSA 2KWUB 2LJ5A 4CHKA 2N1WA 4GDLA 3ZKJC 3MHSD 3W1YA 1NI2A 3AI5A 2RR9A 3JYUA 2JRHA 2D3GA 3H9DA 4MJSA 4AOFA 1P98A 3Q3FA 4II3B 4B9KA 1E8XA 3L16A 1WGHA 2KHWB 3H1UA 1V80A 2KMCA 4GU2A 4WJPA 3RZFA 4M8MA 4CYEA 4DXAB 3VFKA 2NCNA 3ALBA 3VQIA 3GOEA 2NBVB 2C5LC 2L05A 4FN2A 3ZNHB 3N3KB 5D7GA 1WXVA 2EMSA 3DCGA 3SU8X 4F1SA 1PQSA 3QA8A 1WJUA 3PS6A 4BOZB 2MWSB 4B95A 1V5OA 2KOXA 4GIVA 3DBHI 4MGIE 2O2VB 3N30A 2KFKA 4GN1A 2M8SA 4KZ0A 2ASQA 2JY6A 1AARA 2FCQA 2KTRB 4DHJD 1WMHA 3Q3JA 1M94A 4W9GA 4A3OA 2O6VA 3W1SA 1WIAA 4DWFA 1S3SG 1OEYA 2OJRA 1E8YA 3KYDD 1WM3A 2W9NA 4BKSD 2BWES 1VCBA 1E8ZA 2GOWA 3QK0A 4W9JA 4WJOA 2MA9B 1WX8A 3K9PB 4MELA 4PS7A 3ZUNA 4E3CA 2G4DB 2JZ3B 3M62B 2XBBC 5DPSA 3QARA 1D3ZA 3A1QB 5JHAA 3UIOB 3JW0X 2IYDB 3PRPB 4IM3A 4NNJB 4XZ4A 4MJSB 2LD9A 2O6VB 3MTNB 4JQWC 2KDBA 4G50A 2KXJA 3M95A 3ENEA 3V6EB 3CSTA 2MBOA 2N9EB 2LRUA 3DOWA 3AXCA 2JXXA 3V61A 1WXAA 2CS4A 1WE7A 4TUUA 2J0MA 2ZCCA 2BYFA 2JVCA 2M0XA 1EF5A 1EUVB 1VD2A 1XT9B 3O65B 4EEWA 4EZJA 1K8RB 2KLGA 1WYWB 4PYZA 2ZVOA 2KFKB 2IZVB 1WZ0A 4FHKA 1OTRB 4M8NA 3KUDB 3H7SA 2MBEA 3L08A 4KZCA 2DAJA 4GXBA 1WJ4A 1WY8A 4TV3A 1BT0A 2WX0A 3AU4A 4GB9A 4I6NB 3X23A 4W9DA 1UH6A 4PS3A 4I6LB 2LGYA 2K8HA 4IWOA 4ANVA 2B3AA 4WWOA 1MG8A 1C1YB 3MJWA 4KIKA 4MGKE 3ZRCA 3ZNID 3LDZE 3A9KB 3QHTA 2V4LA 1L7YA 2KN5A 2YLMA 2KX3A 2KDFB 2K8CA 1TZ1A 2KO3A 3A9JB 2V3SA 3CSFA 1V6EA 2CHXA 3VUXA
chains in the Genus database with same CATH superfamily
1UZXB 2QC8A 2RGFA 3B9JA 3SHQA 1VRAB 2JPHA 1OQQA 2FCMA 2Z0EB 4Q2JA 4GOCA 1OFFA 1JW9D 4BBNC 2QSDA 5GXGB 3UGBB 1WFYA 2D2QA 4FBJB 1DOIA 3C19A 1I42A 2QHOA 3B2FA 3RD2A 2RSUA 2PVOD 1CJEA 1QOGA 2WXOA 4NAWB 3Q14C 3VTVA 3A9JA 3NUHB 2JWUA 4JGHB 3V05A 1DYQA 2VH1A 2JYTA 3SFDB 2W55A 3H7PA 4HRSA 1Q5WB 3DPDA 3Q8EA 4ANUA 4DHJB 3SR6A 1WRDB 3VRAB 2L3ZA 3OWEB 4R3DA 3MJ5A 4EUTA 5LNK1 3IT6B 4TKNA 2FIFA 3E9SA 1MHHE 2MBQA 3ONSA 1KLVA 4OVZA 1HA5A 1JWAD 2NVUI 1YMHE 1WE6A 3WAMA 2L8JA 3HHMA 2GBJA 2ZNVB 1ZOYB 4N9F4 3OAWA 1HTOA 3TEZA 2LHEA 3R7RA 2D07B 2M0AA 1XLNA 3NS1A 1WF9A 3IG3A 1MHXA 5FKAC 1KF6B 1E9MA 2K3UA 2N9PC 1EWYC 3AE9B 1RWSA 3M3JA 3FKYA 3ZLZA 5LXHA 4NAMA 3NS8A 4MEMA 3PVLA 4NQKE 2O6VD 3MC0B 1CQVA 2R2QA 4K7SA 4KKIA 3U7DA 2N7JA 4II2B 3RNBC 4G3XB 5CHFA 4HJKA 2LVPA 4TQ1A 3R8BA 2PMVA 3HIZA 1E5WA 1WI0A 4JX1C 2WXKA 4MSQB 5HG2A 5IOIA 3UF8A 1BUIC 1F1HA 2L76A 2JZZA 2A5UA 2DYOA 3WAOA 1N5XA 4A20A 3KYCD 4IG7B 2PE9A 2N7EA 1WJNA 2DENB 2NR2A 3PPAA 2BGFA 1UBIA 4LTUA 5H8YE 4AWJA 2J7QB 3V6CB 1RLFA 1GAQB 2G45B 4EZLA 4CO7A 5D2MB 4DDID 4KVGB 4HK2A 1TBEA 1WGKA 4GLSC 3TL5A 2V4IB 5HFYA 5CHWA 4M0WA 2WXPA 3ZTDA 4JPSA 5CX3A 5IP4D 2RPQA 3AEDB 2X38A 2L00B 2BYTA 3U30A 1F2RI 1ZXIA 3RZWC 4RM8A 1DOYA 3AE5B 4BKGA 2LI5A 2IGGA 4XWTA 1L6UA 1EF1A 2NTTA 2KTFA 4XDCA 2ZCBA 1WWTA 3AE8B 2JRIB 2MP2B 2G3QB 4GDLB 4DQOC 2DZJA 5MPOA 1L2NA 2BWFA 1M4VA 3A4SC 4MACA 4IW0A 1Y56A 3RYTA 1P0RA 1TT5B 1D4BA 1D5ZC 3KUZA 4WWNA 1WXSA 4LNNA 1WGYA 3DVGX 3DWGC 1IPGA 2MJEA 2KJ6A 2N4FA 1HE8A 2LMCA 1H4RA 1P3QU 3Q2AC 4WWMA 2DZIA 1QOBA 4KIKB 2LWPA 4OZAA 2MHJA 2I2YA 1A5RA 4GDKB 5AZGA 3UINB 4H2AA 4HPMB 3BYYB 2KK8A 1EO6A 1KJTA 2KJRA 4M01A 1K53A 3NRZA 1JCKB 1I4QA 4L2YA 3AE7B 1Q0WB 2K6DB 4MDKE 3TEWA 2EKIA 4OZBA 1QOAA 1TGZB 2MH7A 4B0EA 4WIPA 2BT6A 1N60A 4NAWA 2WGSA 1YD8U 1PGAA 1T0RC 1GG3A 1N61A 2JSVX 3DDCB 5E6NA 4G0NB 2RDBC 3L13A 3P2BA 1L6VA 2Y5CA 4BBNF 1ZE3D 3L4PA 3Q8FA 4K7UA 3DBLB 2K1FA 3GZNI 4US8A 3DBSA 4QAYA 3QCAA 4LCDE 1GB4A 2KT7A 2DBYA 4DXFA 2K8BA 3ML9A 2HD5B 5D3DA 2L7RA 3AB5A 4RGNA 1KLUD 1JWUD 1TIFA 3VH3B 4WJNA 4ANXA 1C9FA 4L23A 1WZ3A 1XD3B 2G4SA 3APCA 2K9XA 2L32A 3BVMA 5BMIA 2I38A 2ZW1A 3GS2A 2KNBA 4X57B 3NOBA 2KWUB 2LJ5A 4YSZB 1N6ZA 3MHSD 3AI5A 3JYUA 3H9DA 4AOFA 3Q3FA 4II3B 3L16A 4DXAB 1FMAD 2NCNA 3Q8AA 2AQ2B 5C3JB 3GOEA 2C5LC 2K0PA 4FN2A 3ZNHB 3J9CA 2EMSA 2W54A 3SU8X 2R61A 3EGRA 3PS6A 4N59A 1IGCA 2AX5A 1SIJA 4MGIE 2O2VB 4XDDA 1V1PB 2D5GA 2BBCA 1AARA 3IXSA 1FNVA 1WMHA 3Q3JA 1XEEA 4DWFA 3RFZB 2OJRA 3KYDD 1XO3A 1WM3A 3ZQ4A 2KN4A 3FAHA 4BKSD 2BWES 2MA9B 4HROA 4WQMA 2CJNA 5JHAA 1FRRA 2IYDB 3JW0X 1V97A 3CSTA 4TUUA 2ZCCA 2JVCA 4HKQA 2M0XA 1EF5A 1EUVB 1VD2A 1XT9B 4EEWA 2WU2B 2KLGA 1WYWB 4LNIA 3AMZA 2KFKB 3MP9A 1P7FA 2MBEA 3L08A 1WJ4A 1I4GA 3AU4A 3X23A 1UH6A 4US9A 4ANVA 1XF5L 3ZRCA 3A9KB 3LYYA 2KN5A 4NZLB 3A9JB 3GB1A 3UI3A 1V6EA 2D11A 2INDC 2K22A 3BK1A 4RFBA 2CJOA 1TTNA 1WYGA 1JQ4A 4C80A 5D6JB 2BS2B 2W3RA 4RF1A 4HCNB 5G5HA 3L0WB 3X0WA 4KDLB 2IDYA 4KGSA 3EFUA 2OEDA 1ACCA 2Z0DB 1SE9A 2ON8A 2C9WB 3V62A 3QWZB 1I35A 4EZKA 2WXQA 3NVWA 2CHWA 2ZVNA 3BVGA 3ZTCA 2IO2B 5DPRA 3RT3B 1MVKA 2K25A 2LVQA 4XE0A 2LGIA 3AN1A 2LVOA 2V1YA 4LLGM 3DVGY 1NBFC 1FEHA 1HZ6A 3AEEB 1V9JA 3MHZA 2C60A 3DHGC 3LB8C 3C0RB 4N58A 3ZRFA 3ZIMA 4BFRA 4BAXA 5J17A 2BS3B 4LK0M 3ZDTA 4NY0A 1KLGD 1VLBA 1E10A 3I57A 2NMQA 3NY5A 1J0GA 2L1AA 2KDMA 1C3TA 2ZPNA 3TSSA 3PGEA 1FXTB 1N63A 3QX1A 3W1SC 3EC8A 2PVGC 4WQOB 1XQQA 5BMGA 2Y3AA 1QF6A 3RPFC 4P7IA 1NVID 1WH3A 4K81A 4EKUA 4ICUA 3RCZA 3L54A 2KWDA 3JSVA 3OJ3A 1OQYA 4OVVA 1JWSD 1D5MC 3B2GA 2L0FA 1R4NB 3N1ZC 4S17A 4IM2A 2AYOB 2R2OA 5CHVC 4PYUA 4YWGG 2K5PA 2NPTB 4L1BA 4AJWA 2ACZB 5FR6A 2KC2A 1PDXA 5H92C 1YJ1A 2CKHB 2XK5A 1XLPA 3M63B 5D3IB 2PJHA 4KGTA 3AE1B 1NYQA 3AEGB 2WS3B 2LEKA 2W3SA 4IKGA 1ZW7A 3I3TB 2JUOA 4ZRKA 2E6XA 2DZKA 3PZ8A 2QDFA 5C1ZA 1PFDA 2GBNA 5C2TB 1C4PA 4FLHA 4BKTA 3VR8B 2PIAA 1WX9A 2ZPYA 5KHOA 3VAWA 3MFGA 2KX0A 2MP2A 2BB5A 4W9LA 1GNUA 1YX5B 1ET6A 4KSLC 1QZEA 1FCCC 4GMVA 3VTWA 1WM2A 2DHZA 3IBEA 1Y8RC 3DBLI 3DVNU 4GSWA 1NYRA 4FHJA 1LO5D 2KQ7A 2WXRA 4WAAA 2V3NA 1WR6E 2WXIA 5JZEB 4WJQA 3V60A 1HTQA 4FA6A 3PT2B 4M00A 3IHPC 1FNWA 1LXDA 3PV1A 2WXLA 2H89B 3VVWB 3TJPA 3Q8BA 1TY0A 5TSSA 2Y5PA 1JROA 1TJEA 4GGQA 3Q3NC 4A3PA 1JRUA 2KC1A 1E7PB 3HVDA 1Z2MA 3RN9C 4XGAB 1FXAA 1NENB 1UWXA 2JF5A 4NJCA 4OW0A 1TKGA 2FCSA 4C7YA 1XCTL 1VJKA 3PHWB 3KUCB 4DHZE 4TSSA 4XC2A 4USAA 3IVFA 1SJED 4XYCA 4YT0B 2AQ1B 4LDTB 4N6EB 3RNEC 2WNMA 1JMLA 1ZDXA 2LXAA 3MC8A 1YJJA 2B76B 3D32A 1QOFA 1WGDA 3WCQA 3P42A 2BB6A 4C00A 1K51A 3W9CB 1FPYA 2LASA 1F9JA 1XXGA 2MW5A 2BTEA 2N9XA 3QJZA 2FIDA 1I7HA 1V86A 3ETRA 3BY4B 2MRPA 4GDKA 1HZ5A 1S1QB 1WSPA 4UDUC 2KYWA 1SXTA 4F8CB 3QAQA 1MI0A 4ZDVA 3U4EG 2J4XA 2KZRA 2IJ0A 4AQ7A 5FK9C 3ZJUA 4BOSC 2INPE 1WGRA 5DPTA 2M1MA 1RYJA 4NQLB 1LQBA 2BF8B 2XNAC 2M4NA 1IP9A 3DBRI 2V9HA 4IDIA 1GC6A 2RMMA 4KV2A 3AE2B 2BKRB 2IO1B 5TR5A 3NZSA 3HK0A 5E6JA 4GDLA 3ZKJC 1ET9A 2JRHA 4MJSA 4B9KA 2WDRB 1WGHA 5EE1A 3VQIA 1ZUD2 2NBVB 2L05A 5D7GA 3P4PB 3DCGA 1PQSA 3NZ3A 5AUKA 4BOZB 2MWSB 4C4VA 3HRDD 3DBHI 4GN1A 2M8SA 3OG5A 1YJIA 1M94A 1S3SG 1HXYD 2ICIA 1VCBA 2GOWA 4PS7A 1WX8A 3ZUNA 4E3CA 1GB1A 1D6EC 1D3ZA 3A1QB 1UWMA 3AH7A 3UIOB 4NNJB 4IM3A 2J52A 3MTNB 3ENEA 2MBOA 1IGDA 2J42A 3AXCA 1WXAA 3AECB 1WE7A 1E0ZA 3Q3OC 3AE4B 1BMLC 2IGHA 3O65B 4PYZA 1RM6C 2ZVOA 1C78A 1OTRB 2PKOA 1CK1A 4S0RA 4ACFA 4GB9A 2WX0A 4HPPA 1D5XC 2WXMA 2LGYA 4IOIE 4IWOA 2B3AA 1PUTA 4WWOA 4XWWA 1MPEA 4KX6B 3E56A 1AN8A 2YLMA 2KX3A 4RGTA 2KO3A 2CHXA 3VUXA 2ZZPB 1IUEA 2WLBA 1YQ4B 3KW5B 4IM0A 1AYFA 1P9DU 5JH5C 1L0XB 1STEA 1B9RA 4MSMB 2DWQA 2LRWA 1F52A 1UBQA 3PHXB 1OGWA 2I1KA 4I6PA 4P6VF 5GMVA 2G9HD 2AL6A 3P4SB 3GE8C 1LM8B 1JRPA 1XLOA 2LZ6A 3DQVA 3EHVA 2Z59B 2GI9A 3RUIB 2ZJDA 4ITKA 2VRRB 5LXIB 3TEXA 2G1EA 1C77A 5IO9A 4CQNA 4F7ZA 1SE4A 4HXDA 3T3OA 3TEYA 4M02A 2L0TA 4J6IA 3BZDB 1KRHA 4AUQC 2QEJC 4OVUA 4MGYE 5IA7A 2MEKA 2J53A 4LJPB 2NS5A 3BYTB 2IY1B 4K7WA 2FCNA 4MM3B 2ONQA 4E74A 4YTNB 3CF6E 3ZW3A 3IAM1 1RFAA 3PRZA 3UIPB 3VH4B 2PW9A 1ZDVA 1EU4A 1QLBB 4J3OD 5IAAC 2K6QA 3H6NA 2WXFA 3KWVA 2RD0A 2J0KA 2WXHA 2YEPF 4MT5A 5IN7A 1V49A 1QT9A 3WAPA 1WXQA 3QQ8B 1J19A 3VDZA 1I4PA 2AWTA 2HJ1A 3R3MA 3FC4A 1GOZA 1AWDA 4DBGA 3WANA 1UD7A 2FNJB 5BYSA 2C7HA 5JHBA 2GBMA 2A4ZA 2LXCA 3ZXRA 4DXGA 3KH0A 5L95C 2KACA 2PE6B 1JWMD 2BPSA 5HKHA 2O2VA 2UWQA 1I4HA 2D10A 3TIXA 2WP9B 3T8MA 1KOTA 4ZRQA 2I1JA 5D94A 3EFCA 1R4NI 1E8WA 1JALA 1ISNA 1VZ6A 1SIFA 3HUIA 5KHQA 4P1CC 4ASWC 1FFUA 3U52E 3N1XC 1C4AA 2BYVE 2PPHA 2VZKB 4JE3B 2KQ4X 1GC7A 3GZNB 2LGSA 3OJ4B 4KSKC 4PT5A 4HJGE 1HQRD 2HDEA 1A70A 3N1YC 4W9EA 2Q5WD 2KTRA 2LFIA 4C56C 2QILA 3N32A 1V1OA 2AEHA 2NBWB 2BW2A 2HJ8A 3RNCC 4HLEA 3APDA 4IC7B 4PS8A 3NVVA 3PLVA 2EMTA 2N9LA 3Q6BA 1F2RC 3AU5A 4XX5A 3ZJVA 4FADA 3ZNGC 1FFVA 2FUHB 3AM9A 4K3BA 3ZJTA 1X1MA 2NPTA 3CWIA 2JQRB 3ML8A 2KLCA 2JWZA 1F77A 1QILA 4YSYB 1YQBA 3NG0A 2QJLA 1SJHD 1ZXHA 5AEKB 2MJDA 2RPVA 4ICVA 1FCLA 2VZKD 3C8YA 1R4MB 3IAS1 2IY0B 4B0MA 2FAZA 1VZ7A 1T6BX 1ZGUB 1MJDA 3BINA 3LJ3A 4MGZE 1T3QA 1YN3A 2KDEB 3A4RA 1FRDA 1K50A 4HCPB 1Z5SB 4RM9A 2MX2A 1K52A 3A33B 1IYFA 3VHTC 2H88B 2BKFA 2KANA 1J7AA 5AZHA 2N1VA 2AL3A 4NPNA 4BZAA 3TBLD 3PSEB 2GLSA 4ZHOA 2HTHA 4ZHPA 4RF0A 1FD6A 4IUMB 2GBKA 3ZYYX 4EFOA 1J7CA 1C76A 1UGJA 4YXDB 5E6OA 1ZKHA 1KFYB 3WA0A 3VXWA 1YQ3B 1WMHB 2KKCA 3VTUA 3RMKC 2K39A 3R2TA 2GMIC 3NZUA 4HDQA 3IT4B 4KGRA 1TS4A 4ARIA 4HEA1 1ZP0B 4ZOHC 2DZMA 2E3TA 3TUOA 1E7UA 2DX5B 5G2NA 3H8HA 1KM7A 1YOVB 3IFWB 2WDTB 2WQYB 2JT4B 1V8CA 1L4ZB 4O1NA 4IWQA 3S2AA 2MBHA 4K1RB 4RMAA 4BVUC 4WAFA 3APFA 2BQQA 1TY2A 4P1BC 3RNGC 3W1YA 1NI2A 2OJWA 4LNOA 5EE9A 3H1UA 3RZFA 2N0SB 1T0QC 3EA6A 3ALBA 1TS2A 4ZRPA 3BVZA 2SEBD 3CIRB 3PZ7A 1WXVA 3GP7A 1SF0A 3QA8A 1WJUA 3P1MA 4B95A 2WU5B 1V5OA 1SSNA 2KOXA 2TSSA 2KFKA 4KZ0A 2KAJA 2ASQA 2MJ3A 2JY6A 2FCQA 2O6VA 3W1SA 1WIAA 1OEYA 1L0VB 1I4XA 4A9AA 4C7ZA 4C4VB 3URYA 3T3NA 4W9JA 1E8ZA 3QK0A 3N20C 3K9PB 3P63A 1FNUA 2G4DB 2JZ3B 5DPSA 4A90A 3QARA 2WDVB 3PRPB 1N5WA 2OHFA 4XZ4A 4MJSB 2LD9A 4A55A 4AS1A 4JQWC 2KDBA 2KXJA 3ZGZA 3V6EB 4YSXB 1TKYA 1SB3C 2LRUA 3ABVB 3V61A 2JXXA 5FR3A 2FE8A 3AEFB 2NTSA 1SE2A 4EZJA 1MFWA 4FHKA 2KVZA 2WHIA 2IGDA 3H7SA 4RH6A 4KZCA 3AE3B 1WY8A 2WXNA 4I6NB 4W9DA 1VR9A 3R2IA 1XCQL 3AEAB 4I6LB 3I9V1 1EM7A 3MJWA 4KIKA 3AE6B 4MGKE 3ZNID 2LUMA 2SAKA 3QHTA 2V4LA 2IPKD 1PGBA 5G5GA 1FM0D 2KDFB 2W82A 2DYBA 1P1AA 3N9YC 3MC9A 4FJYA 3PLUA 4HDOA 1ESFA 2M56B 1T0SC 2JZPA 3JSVB 3B08A 2BVCA 1QQRA 1CZPA 2INNE 1L0YB 4OZCA 3U8ZA 4WWPA 2CHZA 2N9KA 5BYQA 1FO4A 1YIWA 2MBBB 2L52A 5G55A 3W5UB 2DYMA 1L5PA 5EE3A 2FUG1 1OQRA 3PTFC 2DLBA 4DDGD 2X8XX 2WDQB 1YX6B 1J7BA 2MQJA 3PO0A 2NBUA 3TMPB 2KVRA 5JXVA 4FULA 2LGDA 2GBRA 2OOBB 1NDDA 2INCC 3DHHC 1P7EA 4KDIC 3UQAA 3AV8A 4W9FA 3VUYA 2CR5A 2QCZA 2C7NB 2EELA 4AJYB 2KWVB 2J0JA 3AULA 1YN4A 4M0WB 1VZ8A 1E90A 1Q10A 1TS3A 1V5TA 1LGRA 3K9OB 2LGXA 4HPLB 4HVBA 2IO0B 2LUEA 2KFJA 1R4MI 3EECA 2VH2A 1N62A 3ZXVA 3NJTA 3VUWA 4AP4C 3NHEB 3Q3MC 2CU3A 2ZW0A 2MLBA 2KDIA 2WXGA 2XEWA 1BXTA 3W2DA 3FILA 1WGGA 4JWUC 3DWMA 1AW7A 1MG4A 3QC8B 4WH4A 1TS5A 4URKA 4RGOS 4LDTD 4KKJA 3JVZX 3DHIC 2CU1A 4PK1A 3H7PB 2JU6X 5AZFA 1KTKA 4BKSA 2QIEB 2JX5A 2C7MB 4EE2A 4B6WA 2N7DA 2GB1A 2LJIA 4TQ0A 1YN5A 5C23A 1UF0A 3HM3A 1WXMA 4EOYA 2BYEA 1RRBA 1L4DB 3P4QB 2YEPB 3R66C 1E6EB 3VRBB 4REZA 4JL9A 3SDLC 4MH0E 2D3CA 3ZNZB 2V0GA 1UUPA 3BK2A 2XK5B 3QIJA 2WWZA 1H8CA 3B0AA 1WRIA 2BS4B 1WJ6A 2REXA 5E6PA 1XLQA 1GJZA 3B1LX 3W5VB 5IKCM 4FJZA 3CMMB 2KJHB 3HVZA 4ZYNA 3AEBB 4W9HA 2KMMA 1ZPSA 5BMHA 1OEYJ 3I63C 2LHDA 4WURA 5EDSA 1WR1A 1DOXA 2M17A 4MM3A 1EU3A 5CTRC 3PZDA 1V81A 3VR9B 1SE3A 2PEAA 2QMTA 5EE0A 4HKZE 1GUAB 2UU7A 4IWPA 1V1PA 1WX7A 3ZVVA 1HEZE 1R7SA 1ENFA 2HE7A 1KH0A 2D3BA 3DBHB 5BO4B 3I5JC 3T9LA 4P16A 5L83A 3HM6X 2KWCA 1B1ZA 1UGMA 4G11A 3RULA 1T5XD 3ZO5B 4W9KA 3FILB 4ZRJA 4HWIB 4W9CA 5J2RA 1SGHA 4YTMB 3BIID 3PRMB 1FXIA 1UNSA 3V3XA 1QKZA 3PREA 4TMAB 5LLIA 2UYZB 1PGXA 2WYQA 3WALA 1V2YA 2YVCA 2PTLA 2MSED 1F0ZA 3SD5A 3P4RB 3OLMD 2ZEQA 1GPXA 5DCNA 4NJ6A 4E71A 4NJ7A 2WX1A 1RAXA 5BYRA 1CMXB 3NVZA 3RNFC 3ECIA 4JLCA 1J8CA 1G6JA 2RDHA 2IBIB 1TYGB 4ZRIA 4JIOU 4MH8A 2KMAA 4LJOB 3DBRB 1U4AA 2GRIA 1Q1OA 2XN9C 2KD0A 3KWLA 1NEKB 4ANWA 2IO3B 1NI3A 1E7VA 2ZNVC 1UELA 3U7ZA 2MCNB 3L10B 3L17A 3TCAA 2DAFA 3WIMA 1DGJA 4FJVB 4YL8A 1RFKA 3DVNV 3KVFB 4RCOA 1LFDA 2WXJA 4RNAA 3A9KA 5I4DA 3Q8CA 5DPWA 3ZDMC 4ARCA 1C79A 4A6QA 4DHZB 4W9IA 4ZYSA 3A1QA 4OHJA 2AQ3B 2Y5BB 3UQBA 5HI1A 1T0YA 3LXFA 2EKEC 2KQSA 2L83A 1PYWD 5J18A 4DK5A 3R7QA 2M19A 4CHKA 2JXTA 2N1WA 2RR9A 1TKEA 2D3GA 3SFEB 1P98A 3RNAC 1E8XA 2KHWB 1V80A 2KMCA 4GU2A 4WJPA 5T8IA 4M8MA 4CYEA 2DNFA 3VFKA 2Z8LA 3N3KB 4FXCA 3NVYA 3RI7C 2RDGA 1ROEA 4F1SA 4GIVA 3N30A 2FBWB 4LNFA 5AUIA 2KTRB 1VDVA 4DHJD 4A3OA 4W9GA 2V3PA 1YNTE 4LNKA 3KLSX 1E8YA 3BWUD 1I4RA 2W9NA 5HHDG 2HTME 4RGMA 4WJOA 1IBXB 4MELA 4K3CA 3M62B 2XBBC 3GE3C 1IBXA 4JWSC 1C4CA 2O6VB 2JYEA 4G50A 3M95A 1EWCA 2N9EB 3DOWA 2CS4A 2J0MA 4D2KA 3U2SC 2BYFA 3KQ4A 1K8RB 2IZVB 1WZ0A 4M8NA 3KUDB 2DAJA 4GXBA 2PLPA 1BT0A 4TV3A 2D3AA 4PS3A 4A8XC 1FIQA 2K8HA 4YTPB 3SEBA 1JWBD 1MG8A 1C1YB 3LDZE 1SEBD 3Q69A 1L7YA 1TZOA 1SBBB 2K8CA 1TZ1A 3CSFA 2V3SA 3O13A 3EUB2
chains in the Genus database with same CATH topology
2D11A 1UZXB 2ZZPB 2RGFA 2DYBA 1P1AA 3SHQA 2JPHA 3KW5B 1TTNA 4IM0A 2FCMA 2Z0EB 1P9DU 4FJYA 4GOCA 5JH5C 3PLUA 4HDOA 5D6JB 4BBNC 4MSMB 4HCNB 3UGBB 3L0WB 3X0WA 4KDLB 2LRWA 1WFYA 2D2QA 4FBJB 1I42A 1UBQA 3JSVB 2QHOA 3B08A 3PHXB 3EFUA 2RSUA 3RD2A 1OGWA 2I1KA 4I6PA 5GMVA 3U8ZA 2Z0DB 1SE9A 4NAWB 4WWPA 3VTVA 2CHZA 2C9WB 3A9JA 3V62A 2AL6A 1YIWA 3QWZB 2MBBB 1I35A 5G55A 1LM8B 2DYMA 4JGHB 2LZ6A 4EZKA 3DQVA 3EHVA 3PTFC 2Z59B 4DDGD 3RUIB 2ZJDA 3H7PA 1Q5WB 2CHWA 1YX6B 3DPDA 2MQJA 2ZVNA 3ZTCA 4ANUA 2IO2B 5DPRA 4DHJB 3RT3B 2NBUA 3TMPB 1WRDB 2VRRB 5LXIB 2K25A 2KVRA 2LVQA 2L3ZA 4FULA 2LGDA 4F7ZA 4HXDA 4EUTA 2LVOA 2GBRA 2OOBB 2L0TA 1NDDA 2V1YA 4TKNA 2FIFA 4J6IA 3DVGY 4KDIC 2MBQA 3UQAA 1NBFC 3ONSA 4W9FA 3VUYA 1KLVA 2CR5A 1V9JA 2NVUI 3WAMA 1WE6A 4AUQC 2L8JA 4OVUA 2C7NB 4MGYE 2C60A 5IA7A 3HHMA 4AJYB 2KWVB 2GBJA 2ZNVB 2J0JA 3C0RB 3AULA 3OAWA 4N9F4 4LJPB 4M0WB 3ZRFA 3ZIMA 2NS5A 4BFRA 1E90A 5J17A 2IY1B 4K7WA 3R7RA 2D07B 2FCNA 1V5TA 4NY0A 3ZDTA 3K9OB 1WF9A 3IG3A 4E74A 3NY5A 1J0GA 2LGXA 3CF6E 4HPLB 3ZW3A 4HVBA 2IO0B 1RFAA 3PRZA 2LUEA 2KFJA 2N9PC 3UIPB 2ZPNA 1C3TA 3M3JA 3PGEA 3VH4B 1FXTB 3ZLZA 3QX1A 1R4MI 5LXHA 3EECA 3NS8A 3W1SC 4MEMA 3EC8A 3PVLA 4NQKE 2O6VD 4WQOB 2R2QA 4K7SA 3VUWA 5IAAC 1XQQA 3U7DA 4AP4C 2K6QA 4P7IA 1WH3A 3H6NA 3NHEB 4II2B 2MLBA 2KDIA 4K81A 2XEWA 4G3XB 4EKUA 2RD0A 2J0KA 5CHFA 4ICUA 3RCZA 4HJKA 2LVPA 4TQ1A 3L54A 1V49A 1WGGA 3HIZA 1E5WA 1WI0A 3WAPA 3QQ8B 3JSVA 1J19A 3QC8B 4MSQB 3VDZA 3OJ3A 1OQYA 2AWTA 3R3MA 4URKA 4OVVA 3UF8A 4LDTD 2L0FA 3JVZX 4DBGA 2L76A 2JZZA 4IM2A 2AYOB 2R2OA 5CHVC 2A5UA 2CU1A 1UD7A 3WANA 2FNJB 4PYUA 2DYOA 3WAOA 2C7HA 5JHBA 2GBMA 2A4ZA 4A20A 2LXCA 3KYCD 2NPTB 4IG7B 2PE9A 2N7EA 1WJNA 2DENB 2NR2A 3H7PB 3KH0A 5AZFA 5L95C 4BKSA 2PE6B 4AJWA 2C7MB 2BGFA 3PPAA 1UBIA 2BPSA 5FR6A 5HKHA 2KC2A 2O2VA 2UWQA 4AWJA 2J7QB 2D10A 3TIXA 1YJ1A 2CKHB 3V6CB 2N7DA 1RLFA 2XK5A 3T8MA 4B6WA 3M63B 4TQ0A 1KOTA 2G45B 2I1JA 2PJHA 4EZLA 5C23A 5D94A 4CO7A 5D2MB 4DDID 3HM3A 1R4NI 1WXMA 4EOYA 2BYEA 1RRBA 4HK2A 1E8WA 1ZW7A 4KVGB 1TBEA 3I3TB 1ISNA 2JUOA 4ZRKA 3TL5A 3R66C 2DZKA 4JL9A 1SIFA 5KHQA 3SDLC 4MH0E 4ASWC 3ZNZB 5C1ZA 5CHWA 2BYVE 2PPHA 2GBNA 3ZTDA 1GC7A 2XK5B 3QIJA 5CX3A 2WWZA 2RPQA 4FLHA 3OJ4B 4KSKC 2L00B 4BKTA 1H8CA 3B0AA 3U30A 1WJ6A 1WX9A 2REXA 5E6PA 2ZPYA 5KHOA 1GJZA 3VAWA 3B1LX 4W9EA 3RZWC 2KTRA 4RM8A 4FJZA 3CMMB 2KX0A 2MP2A 2KJHB 3N32A 4ZYNA 4W9LA 1GNUA 4BKGA 1YX5B 4W9HA 2LI5A 2AEHA 2NBWB 4KSLC 1QZEA 4GMVA 1OEYJ 3VTWA 1EF1A 2HJ8A 1WM2A 2DHZA 4HLEA 5EDSA 1WR1A 3APDA 1Y8RC 2KTFA 3DBLI 3IBEA 2M17A 3DVNU 4GSWA 4MM3A 4IC7B 2ZCBA 4FHJA 4PS8A 2KQ7A 3PLVA 4WAAA 2EMTA 5CTRC 3PZDA 1V81A 1WR6E 3AU5A 4XX5A 2JRIB 2PEAA 5JZEB 2MP2B 2G3QB 4WJQA 3V60A 4GDLB 4FA6A 2DZJA 3PT2B 4FADA 3IHPC 1GUAB 3ZNGC 4IWPA 1L2NA 1LXDA 2BWFA 2FUHB 3A4SC 3PV1A 1WX7A 4IW0A 3RYTA 3ZVVA 1P0RA 2HE7A 1X1MA 2NPTA 3ML8A 2KLCA 2JWZA 3VVWB 5BO4B 3TJPA 1YQBA 3KUZA 3T9LA 4WWNA 1WXSA 4GGQA 5L83A 5AEKB 4ICVA 4A3PA 3HM6X 2KWCA 1WGYA 3DVGX 1UGMA 1JRUA 4G11A 1IPGA 2KC1A 3RULA 2KJ6A 3ZO5B 2N4FA 4W9KA 1HE8A 4ZRJA 1Z2MA 4HWIB 4W9CA 2IY0B 5J2RA 1SGHA 2FAZA 3PRMB 1H4RA 1P3QU 1ZGUB 3BINA 3LJ3A 3PREA 5LLIA 2UYZB 2DZIA 2JF5A 2WYQA 4MGZE 3WALA 2KDEB 1V2YA 2YVCA 3A4RA 4KIKB 2LWPA 2MSED 3SD5A 4HCPB 2FCSA 1Z5SB 1A5RA 3OLMD 2ZEQA 3PHWB 3KUCB 4RM9A 2MX2A 3A33B 4GDKB 5AZGA 3UINB 4DHZE 4HPMB 1IYFA 4XC2A 2KK8A 5DCNA 1EO6A 1KJTA 4NJ6A 3VHTC 2KJRA 4E71A 4NJ7A 2BKFA 3IVFA 2WX1A 1RAXA 2KANA 1CMXB 4LDTB 1Q0WB 5AZHA 2K6DB 2N1VA 2AL3A 4NPNA 4MDKE 3ECIA 4JLCA 1J8CA 1G6JA 2LXAA 2IBIB 3TBLD 4ZRIA 1TGZB 4JIOU 2KMAA 3D32A 4NAWA 3PSEB 1YD8U 4LJOB 1WGDA 1U4AA 2HTHA 1GG3A 1Q1OA 2KD0A 4ANWA 3DDCB 5E6NA 4G0NB 4IUMB 2IO3B 1E7VA 2ZNVC 1UELA 2GBKA 2LASA 1F9JA 2MCNB 4EFOA 3L10B 3L13A 3P2BA 2MW5A 3L17A 3TCAA 2DAFA 2N9XA 5E6OA 1ZKHA 4BBNF 3QJZA 3WIMA 2FIDA 3WA0A 1V86A 4FJVB 4YL8A 3VXWA 3DVNV 4K7UA 1WMHB 2KKCA 3BY4B 3KVFB 3VTUA 2K39A 2K1FA 1LFDA 2GMIC 2MRPA 4GDKA 1S1QB 3NZUA 4HDQA 3GZNI 3DBSA 3A9KA 3QCAA 4LCDE 5DPWA 4F8CB 3ZDMC 3QAQA 4DHZB 2DZMA 4ZDVA 4W9IA 1E7UA 2KZRA 2K8BA 3A1QA 3ML9A 4BOSC 2Y5BB 2HD5B 3UQBA 2L7RA 1WGRA 2DX5B 5DPTA 1T0YA 2M1MA 5G2NA 3VH3B 2EKEC 4NQLB 4WJNA 4ANXA 2KQSA 1KM7A 1LQBA 2BF8B 3IFWB 2WDTB 5J18A 1WZ3A 1XD3B 2G4SA 2M4NA 1IP9A 4DK5A 2JT4B 3DBRI 3APCA 4IWQA 3S2AA 2MBHA 4K1RB 1GC6A 4RMAA 4KV2A 3R7QA 4BVUC 2BKRB 3APFA 2KNBA 2IO1B 4X57B 5TR5A 3NOBA 3HK0A 3NZSA 2KWUB 2LJ5A 4CHKA 2N1WA 4GDLA 3ZKJC 3MHSD 3W1YA 1NI2A 3AI5A 2RR9A 3JYUA 2JRHA 2D3GA 3H9DA 4MJSA 4AOFA 1P98A 3Q3FA 4II3B 4B9KA 1E8XA 3L16A 1WGHA 2KHWB 3H1UA 1V80A 2KMCA 4GU2A 4WJPA 3RZFA 4M8MA 4CYEA 4DXAB 3VFKA 2NCNA 3ALBA 3VQIA 3GOEA 2NBVB 2C5LC 2L05A 4FN2A 3ZNHB 3N3KB 5D7GA 1WXVA 2EMSA 3DCGA 3SU8X 4F1SA 1PQSA 3QA8A 1WJUA 3PS6A 4BOZB 2MWSB 4B95A 1V5OA 2KOXA 4GIVA 3DBHI 4MGIE 2O2VB 3N30A 2KFKA 4GN1A 2M8SA 4KZ0A 2ASQA 2JY6A 1AARA 2FCQA 2KTRB 4DHJD 1WMHA 3Q3JA 1M94A 4W9GA 4A3OA 2O6VA 3W1SA 1WIAA 4DWFA 1S3SG 1OEYA 2OJRA 1E8YA 3KYDD 1WM3A 2W9NA 4BKSD 2BWES 1VCBA 1E8ZA 2GOWA 3QK0A 4W9JA 4WJOA 2MA9B 1WX8A 3K9PB 4MELA 4PS7A 3ZUNA 4E3CA 2G4DB 2JZ3B 3M62B 2XBBC 5DPSA 3QARA 1D3ZA 3A1QB 5JHAA 3UIOB 3JW0X 2IYDB 3PRPB 4IM3A 4NNJB 4XZ4A 4MJSB 2LD9A 2O6VB 3MTNB 4JQWC 2KDBA 4G50A 2KXJA 3M95A 3ENEA 3V6EB 3CSTA 2MBOA 2N9EB 2LRUA 3DOWA 3AXCA 2JXXA 3V61A 1WXAA 2CS4A 1WE7A 4TUUA 2J0MA 2ZCCA 2BYFA 2JVCA 2M0XA 1EF5A 1EUVB 1VD2A 1XT9B 3O65B 4EEWA 4EZJA 1K8RB 2KLGA 1WYWB 4PYZA 2ZVOA 2KFKB 2IZVB 1WZ0A 4FHKA 1OTRB 4M8NA 3KUDB 3H7SA 2MBEA 3L08A 4KZCA 2DAJA 4GXBA 1WJ4A 1WY8A 4TV3A 1BT0A 2WX0A 3AU4A 4GB9A 4I6NB 3X23A 4W9DA 1UH6A 4PS3A 4I6LB 2LGYA 2K8HA 4IWOA 4ANVA 2B3AA 4WWOA 1MG8A 1C1YB 3MJWA 4KIKA 4MGKE 3ZRCA 3ZNID 3LDZE 3A9KB 3QHTA 2V4LA 1L7YA 2KN5A 2YLMA 2KX3A 2KDFB 2K8CA 1TZ1A 2KO3A 3A9JB 2V3SA 3CSFA 1V6EA 2CHXA 3VUXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D11 A;  1UZX B;  2ZZP B;  2RGF A;  2DYB A;  1P1A A;  3SHQ A;  2JPH A;  3KW5 B;  1TTN A;  4IM0 A;  2FCM A;  2Z0E B;  1P9D U;  4FJY A;  4GOC A;  5JH5 C;  3PLU A;  4HDO A;  5D6J B;  4BBN C;  4MSM B;  4HCN B;  3UGB B;  3L0W B;  3X0W A;  4KDL B;  2LRW A;  1WFY A;  2D2Q A;  4FBJ B;  1I42 A;  1UBQ A;  3JSV B;  2QHO A;  3B08 A;  3PHX B;  3EFU A;  2RSU A;  3RD2 A;  1OGW A;  2I1K A;  4I6P A;  5GMV A;  3U8Z A;  2Z0D B;  1SE9 A;  4NAW B;  4WWP A;  3VTV A;  2CHZ A;  2C9W B;  3A9J A;  3V62 A;  2AL6 A;  1YIW A;  3QWZ B;  2MBB B;  1I35 A;  5G55 A;  1LM8 B;  2DYM A;  4JGH B;  2LZ6 A;  4EZK A;  3DQV A;  3EHV A;  3PTF C;  2Z59 B;  4DDG D;  3RUI B;  2ZJD A;  3H7P A;  1Q5W B;  2CHW A;  1YX6 B;  3DPD A;  2MQJ A;  2ZVN A;  3ZTC A;  4ANU A;  2IO2 B;  5DPR A;  4DHJ B;  3RT3 B;  2NBU A;  3TMP B;  1WRD B;  2VRR B;  5LXI B;  2K25 A;  2KVR A;  2LVQ A;  2L3Z A;  4FUL A;  2LGD A;  4F7Z A;  4HXD A;  4EUT A;  2LVO A;  2GBR A;  2OOB B;  2L0T A;  1NDD A;  2V1Y A;  4TKN A;  2FIF A;  4J6I A;  3DVG Y;  4KDI C;  2MBQ A;  3UQA A;  1NBF C;  3ONS A;  4W9F A;  3VUY A;  1KLV A;  2CR5 A;  1V9J A;  2NVU I;  3WAM A;  1WE6 A;  4AUQ C;  2L8J A;  4OVU A;  2C7N B;  4MGY E;  2C60 A;  5IA7 A;  3HHM A;  4AJY B;  2KWV B;  2GBJ A;  2ZNV B;  2J0J A;  3C0R B;  3AUL A;  3OAW A;  4N9F 4;  4LJP B;  4M0W B;  3ZRF A;  3ZIM A;  2NS5 A;  4BFR A;  1E90 A;  5J17 A;  2IY1 B;  4K7W A;  3R7R A;  2D07 B;  2FCN A;  1V5T A;  4NY0 A;  3ZDT A;  3K9O B;  1WF9 A;  3IG3 A;  4E74 A;  3NY5 A;  1J0G A;  2LGX A;  3CF6 E;  4HPL B;  3ZW3 A;  4HVB A;  2IO0 B;  1RFA A;  3PRZ A;  2LUE A;  2KFJ A;  2N9P C;  3UIP B;  2ZPN A;  1C3T A;  3M3J A;  3PGE A;  3VH4 B;  1FXT B;  3ZLZ A;  3QX1 A;  1R4M I;  5LXH A;  3EEC A;  3NS8 A;  3W1S C;  4MEM A;  3EC8 A;  3PVL A;  4NQK E;  2O6V D;  4WQO B;  2R2Q A;  4K7S A;  3VUW A;  5IAA C;  1XQQ A;  3U7D A;  4AP4 C;  2K6Q A;  4P7I A;  1WH3 A;  3H6N A;  3NHE B;  4II2 B;  2MLB A;  2KDI A;  4K81 A;  2XEW A;  4G3X B;  4EKU A;  2RD0 A;  2J0K A;  5CHF A;  4ICU A;  3RCZ A;  4HJK A;  2LVP A;  4TQ1 A;  3L54 A;  1V49 A;  1WGG A;  3HIZ A;  1E5W A;  1WI0 A;  3WAP A;  3QQ8 B;  3JSV A;  1J19 A;  3QC8 B;  4MSQ B;  3VDZ A;  3OJ3 A;  1OQY A;  2AWT A;  3R3M A;  4URK A;  4OVV A;  3UF8 A;  4LDT D;  2L0F A;  3JVZ X;  4DBG A;  2L76 A;  2JZZ A;  4IM2 A;  2AYO B;  2R2O A;  5CHV C;  2A5U A;  2CU1 A;  1UD7 A;  3WAN A;  2FNJ B;  4PYU A;  2DYO A;  3WAO A;  2C7H A;  5JHB A;  2GBM A;  2A4Z A;  4A20 A;  2LXC A;  3KYC D;  2NPT B;  4IG7 B;  2PE9 A;  2N7E A;  1WJN A;  2DEN B;  2NR2 A;  3H7P B;  3KH0 A;  5AZF A;  5L95 C;  4BKS A;  2PE6 B;  4AJW A;  2C7M B;  2BGF A;  3PPA A;  1UBI A;  2BPS A;  5FR6 A;  5HKH A;  2KC2 A;  2O2V A;  2UWQ A;  4AWJ A;  2J7Q B;  2D10 A;  3TIX A;  1YJ1 A;  2CKH B;  3V6C B;  2N7D A;  1RLF A;  2XK5 A;  3T8M A;  4B6W A;  3M63 B;  4TQ0 A;  1KOT A;  2G45 B;  2I1J A;  2PJH A;  4EZL A;  5C23 A;  5D94 A;  4CO7 A;  5D2M B;  4DDI D;  3HM3 A;  1R4N I;  1WXM A;  4EOY A;  2BYE A;  1RRB A;  4HK2 A;  1E8W A;  1ZW7 A;  4KVG B;  1TBE A;  3I3T B;  1ISN A;  2JUO A;  4ZRK A;  3TL5 A;  3R66 C;  2DZK A;  4JL9 A;  1SIF A;  5KHQ A;  3SDL C;  4MH0 E;  4ASW C;  3ZNZ B;  5C1Z A;  5CHW A;  2BYV E;  2PPH A;  2GBN A;  3ZTD A;  1GC7 A;  2XK5 B;  3QIJ A;  5CX3 A;  2WWZ A;  2RPQ A;  4FLH A;  3OJ4 B;  4KSK C;  2L00 B;  4BKT A;  1H8C A;  3B0A A;  3U30 A;  1WJ6 A;  1WX9 A;  2REX A;  5E6P A;  2ZPY A;  5KHO A;  1GJZ A;  3VAW A;  3B1L X;  4W9E A;  3RZW C;  2KTR A;  4RM8 A;  4FJZ A;  3CMM B;  2KX0 A;  2MP2 A;  2KJH B;  3N32 A;  4ZYN A;  4W9L A;  1GNU A;  4BKG A;  1YX5 B;  4W9H A;  2LI5 A;  2AEH A;  2NBW B;  4KSL C;  1QZE A;  4GMV A;  1OEY J;  3VTW A;  1EF1 A;  2HJ8 A;  1WM2 A;  2DHZ A;  4HLE A;  5EDS A;  1WR1 A;  3APD A;  1Y8R C;  2KTF A;  3DBL I;  3IBE A;  2M17 A;  3DVN U;  4GSW A;  4MM3 A;  4IC7 B;  2ZCB A;  4FHJ A;  4PS8 A;  2KQ7 A;  3PLV A;  4WAA A;  2EMT A;  5CTR C;  3PZD A;  1V81 A;  1WR6 E;  3AU5 A;  4XX5 A;  2JRI B;  2PEA A;  5JZE B;  2MP2 B;  2G3Q B;  4WJQ A;  3V60 A;  4GDL B;  4FA6 A;  2DZJ A;  3PT2 B;  4FAD A;  3IHP C;  1GUA B;  3ZNG C;  4IWP A;  1L2N A;  1LXD A;  2BWF A;  2FUH B;  3A4S C;  3PV1 A;  1WX7 A;  4IW0 A;  3RYT A;  3ZVV A;  1P0R A;  2HE7 A;  1X1M A;  2NPT A;  3ML8 A;  2KLC A;  2JWZ A;  3VVW B;  5BO4 B;  3TJP A;  1YQB A;  3KUZ A;  3T9L A;  4WWN A;  1WXS A;  4GGQ A;  5L83 A;  5AEK B;  4ICV A;  4A3P A;  3HM6 X;  2KWC A;  1WGY A;  3DVG X;  1UGM A;  1JRU A;  4G11 A;  1IPG A;  2KC1 A;  3RUL A;  2KJ6 A;  3ZO5 B;  2N4F A;  4W9K A;  1HE8 A;  4ZRJ A;  1Z2M A;  4HWI B;  4W9C A;  2IY0 B;  5J2R A;  1SGH A;  2FAZ A;  3PRM B;  1H4R A;  1P3Q U;  1ZGU B;  3BIN A;  3LJ3 A;  3PRE A;  5LLI A;  2UYZ B;  2DZI A;  2JF5 A;  2WYQ A;  4MGZ E;  3WAL A;  2KDE B;  1V2Y A;  2YVC A;  3A4R A;  4KIK B;  2LWP A;  2MSE D;  3SD5 A;  4HCP B;  2FCS A;  1Z5S B;  1A5R A;  3OLM D;  2ZEQ A;  3PHW B;  3KUC B;  4RM9 A;  2MX2 A;  3A33 B;  4GDK B;  5AZG A;  3UIN B;  4DHZ E;  4HPM B;  1IYF A;  4XC2 A;  2KK8 A;  5DCN A;  1EO6 A;  1KJT A;  4NJ6 A;  3VHT C;  2KJR A;  4E71 A;  4NJ7 A;  2BKF A;  3IVF A;  2WX1 A;  1RAX A;  2KAN A;  1CMX B;  4LDT B;  1Q0W B;  5AZH A;  2K6D B;  2N1V A;  2AL3 A;  4NPN A;  4MDK E;  3ECI A;  4JLC A;  1J8C A;  1G6J A;  2LXA A;  2IBI B;  3TBL D;  4ZRI A;  1TGZ B;  4JIO U;  2KMA A;  3D32 A;  4NAW A;  3PSE B;  1YD8 U;  4LJO B;  1WGD A;  1U4A A;  2HTH A;  1GG3 A;  1Q1O A;  2KD0 A;  4ANW A;  3DDC B;  5E6N A;  4G0N B;  4IUM B;  2IO3 B;  1E7V A;  2ZNV C;  1UEL A;  2GBK A;  2LAS A;  1F9J A;  2MCN B;  4EFO A;  3L10 B;  3L13 A;  3P2B A;  2MW5 A;  3L17 A;  3TCA A;  2DAF A;  2N9X A;  5E6O A;  1ZKH A;  4BBN F;  3QJZ A;  3WIM A;  2FID A;  3WA0 A;  1V86 A;  4FJV B;  4YL8 A;  3VXW A;  3DVN V;  4K7U A;  1WMH B;  2KKC A;  3BY4 B;  3KVF B;  3VTU A;  2K39 A;  2K1F A;  1LFD A;  2GMI C;  2MRP A;  4GDK A;  1S1Q B;  3NZU A;  4HDQ A;  3GZN I;  3DBS A;  3A9K A;  3QCA A;  4LCD E;  5DPW A;  4F8C B;  3ZDM C;  3QAQ A;  4DHZ B;  2DZM A;  4ZDV A;  4W9I A;  1E7U A;  2KZR A;  2K8B A;  3A1Q A;  3ML9 A;  4BOS C;  2Y5B B;  2HD5 B;  3UQB A;  2L7R A;  1WGR A;  2DX5 B;  5DPT A;  1T0Y A;  2M1M A;  5G2N A;  3VH3 B;  2EKE C;  4NQL B;  4WJN A;  4ANX A;  2KQS A;  1KM7 A;  1LQB A;  2BF8 B;  3IFW B;  2WDT B;  5J18 A;  1WZ3 A;  1XD3 B;  2G4S A;  2M4N A;  1IP9 A;  4DK5 A;  2JT4 B;  3DBR I;  3APC A;  4IWQ A;  3S2A A;  2MBH A;  4K1R B;  1GC6 A;  4RMA A;  4KV2 A;  3R7Q A;  4BVU C;  2BKR B;  3APF A;  2KNB A;  2IO1 B;  4X57 B;  5TR5 A;  3NOB A;  3HK0 A;  3NZS A;  2KWU B;  2LJ5 A;  4CHK A;  2N1W A;  4GDL A;  3ZKJ C;  3MHS D;  3W1Y A;  1NI2 A;  3AI5 A;  2RR9 A;  3JYU A;  2JRH A;  2D3G A;  3H9D A;  4MJS A;  4AOF A;  1P98 A;  3Q3F A;  4II3 B;  4B9K A;  1E8X A;  3L16 A;  1WGH A;  2KHW B;  3H1U A;  1V80 A;  2KMC A;  4GU2 A;  4WJP A;  3RZF A;  4M8M A;  4CYE A;  4DXA B;  3VFK A;  2NCN A;  3ALB A;  3VQI A;  3GOE A;  2NBV B;  2C5L C;  2L05 A;  4FN2 A;  3ZNH B;  3N3K B;  5D7G A;  1WXV A;  2EMS A;  3DCG A;  3SU8 X;  4F1S A;  1PQS A;  3QA8 A;  1WJU A;  3PS6 A;  4BOZ B;  2MWS B;  4B95 A;  1V5O A;  2KOX A;  4GIV A;  3DBH I;  4MGI E;  2O2V B;  3N30 A;  2KFK A;  4GN1 A;  2M8S A;  4KZ0 A;  2ASQ A;  2JY6 A;  1AAR A;  2FCQ A;  2KTR B;  4DHJ D;  1WMH A;  3Q3J A;  1M94 A;  4W9G A;  4A3O A;  2O6V A;  3W1S A;  1WIA A;  4DWF A;  1S3S G;  1OEY A;  2OJR A;  1E8Y A;  3KYD D;  1WM3 A;  2W9N A;  4BKS D;  2BWE S;  1VCB A;  1E8Z A;  2GOW A;  3QK0 A;  4W9J A;  4WJO A;  2MA9 B;  1WX8 A;  3K9P B;  4MEL A;  4PS7 A;  3ZUN A;  4E3C A;  2G4D B;  2JZ3 B;  3M62 B;  2XBB C;  5DPS A;  3QAR A;  1D3Z A;  3A1Q B;  5JHA A;  3UIO B;  3JW0 X;  2IYD B;  3PRP B;  4IM3 A;  4NNJ B;  4XZ4 A;  4MJS B;  2LD9 A;  2O6V B;  3MTN B;  4JQW C;  2KDB A;  4G50 A;  2KXJ A;  3M95 A;  3ENE A;  3V6E B;  3CST A;  2MBO A;  2N9E B;  2LRU A;  3DOW A;  3AXC A;  2JXX A;  3V61 A;  1WXA A;  2CS4 A;  1WE7 A;  4TUU A;  2J0M A;  2ZCC A;  2BYF A;  2JVC A;  2M0X A;  1EF5 A;  1EUV B;  1VD2 A;  1XT9 B;  3O65 B;  4EEW A;  4EZJ A;  1K8R B;  2KLG A;  1WYW B;  4PYZ A;  2ZVO A;  2KFK B;  2IZV B;  1WZ0 A;  4FHK A;  1OTR B;  4M8N A;  3KUD B;  3H7S A;  2MBE A;  3L08 A;  4KZC A;  2DAJ A;  4GXB A;  1WJ4 A;  1WY8 A;  4TV3 A;  1BT0 A;  2WX0 A;  3AU4 A;  4GB9 A;  4I6N B;  3X23 A;  4W9D A;  1UH6 A;  4PS3 A;  4I6L B;  2LGY A;  2K8H A;  4IWO A;  4ANV A;  2B3A A;  4WWO A;  1MG8 A;  1C1Y B;  3MJW A;  4KIK A;  4MGK E;  3ZRC A;  3ZNI D;  3LDZ E;  3A9K B;  3QHT A;  2V4L A;  1L7Y A;  2KN5 A;  2YLM A;  2KX3 A;  2KDF B;  2K8C A;  1TZ1 A;  2KO3 A;  3A9J B;  2V3S A;  3CSF A;  1V6E A;  2CHX A;  3VUX A; 
#chains in the Genus database with same CATH topology
 1UZX B;  2QC8 A;  2RGF A;  3B9J A;  3SHQ A;  1VRA B;  2JPH A;  1OQQ A;  2FCM A;  2Z0E B;  4Q2J A;  4GOC A;  1OFF A;  1JW9 D;  4BBN C;  2QSD A;  5GXG B;  3UGB B;  1WFY A;  2D2Q A;  4FBJ B;  1DOI A;  3C19 A;  1I42 A;  2QHO A;  3B2F A;  3RD2 A;  2RSU A;  2PVO D;  1CJE A;  1QOG A;  2WXO A;  4NAW B;  3Q14 C;  3VTV A;  3A9J A;  3NUH B;  2JWU A;  4JGH B;  3V05 A;  1DYQ A;  2VH1 A;  2JYT A;  3SFD B;  2W55 A;  3H7P A;  4HRS A;  1Q5W B;  3DPD A;  3Q8E A;  4ANU A;  4DHJ B;  3SR6 A;  1WRD B;  3VRA B;  2L3Z A;  3OWE B;  4R3D A;  3MJ5 A;  4EUT A;  5LNK 1;  3IT6 B;  4TKN A;  2FIF A;  3E9S A;  1MHH E;  2MBQ A;  3ONS A;  1KLV A;  4OVZ A;  1HA5 A;  1JWA D;  2NVU I;  1YMH E;  1WE6 A;  3WAM A;  2L8J A;  3HHM A;  2GBJ A;  2ZNV B;  1ZOY B;  4N9F 4;  3OAW A;  1HTO A;  3TEZ A;  2LHE A;  3R7R A;  2D07 B;  2M0A A;  1XLN A;  3NS1 A;  1WF9 A;  3IG3 A;  1MHX A;  5FKA C;  1KF6 B;  1E9M A;  2K3U A;  2N9P C;  1EWY C;  3AE9 B;  1RWS A;  3M3J A;  3FKY A;  3ZLZ A;  5LXH A;  4NAM A;  3NS8 A;  4MEM A;  3PVL A;  4NQK E;  2O6V D;  3MC0 B;  1CQV A;  2R2Q A;  4K7S A;  4KKI A;  3U7D A;  2N7J A;  4II2 B;  3RNB C;  4G3X B;  5CHF A;  4HJK A;  2LVP A;  4TQ1 A;  3R8B A;  2PMV A;  3HIZ A;  1E5W A;  1WI0 A;  4JX1 C;  2WXK A;  4MSQ B;  5HG2 A;  5IOI A;  3UF8 A;  1BUI C;  1F1H A;  2L76 A;  2JZZ A;  2A5U A;  2DYO A;  3WAO A;  1N5X A;  4A20 A;  3KYC D;  4IG7 B;  2PE9 A;  2N7E A;  1WJN A;  2DEN B;  2NR2 A;  3PPA A;  2BGF A;  1UBI A;  4LTU A;  5H8Y E;  4AWJ A;  2J7Q B;  3V6C B;  1RLF A;  1GAQ B;  2G45 B;  4EZL A;  4CO7 A;  5D2M B;  4DDI D;  4KVG B;  4HK2 A;  1TBE A;  1WGK A;  4GLS C;  3TL5 A;  2V4I B;  5HFY A;  5CHW A;  4M0W A;  2WXP A;  3ZTD A;  4JPS A;  5CX3 A;  5IP4 D;  2RPQ A;  3AED B;  2X38 A;  2L00 B;  2BYT A;  3U30 A;  1F2R I;  1ZXI A;  3RZW C;  4RM8 A;  1DOY A;  3AE5 B;  4BKG A;  2LI5 A;  2IGG A;  4XWT A;  1L6U A;  1EF1 A;  2NTT A;  2KTF A;  4XDC A;  2ZCB A;  1WWT A;  3AE8 B;  2JRI B;  2MP2 B;  2G3Q B;  4GDL B;  4DQO C;  2DZJ A;  5MPO A;  1L2N A;  2BWF A;  1M4V A;  3A4S C;  4MAC A;  4IW0 A;  1Y56 A;  3RYT A;  1P0R A;  1TT5 B;  1D4B A;  1D5Z C;  3KUZ A;  4WWN A;  1WXS A;  4LNN A;  1WGY A;  3DVG X;  3DWG C;  1IPG A;  2MJE A;  2KJ6 A;  2N4F A;  1HE8 A;  2LMC A;  1H4R A;  1P3Q U;  3Q2A C;  4WWM A;  2DZI A;  1QOB A;  4KIK B;  2LWP A;  4OZA A;  2MHJ A;  2I2Y A;  1A5R A;  4GDK B;  5AZG A;  3UIN B;  4H2A A;  4HPM B;  3BYY B;  2KK8 A;  1EO6 A;  1KJT A;  2KJR A;  4M01 A;  1K53 A;  3NRZ A;  1JCK B;  1I4Q A;  4L2Y A;  3AE7 B;  1Q0W B;  2K6D B;  4MDK E;  3TEW A;  2EKI A;  4OZB A;  1QOA A;  1TGZ B;  2MH7 A;  4B0E A;  4WIP A;  2BT6 A;  1N60 A;  4NAW A;  2WGS A;  1YD8 U;  1PGA A;  1T0R C;  1GG3 A;  1N61 A;  2JSV X;  3DDC B;  5E6N A;  4G0N B;  2RDB C;  3L13 A;  3P2B A;  1L6V A;  2Y5C A;  4BBN F;  1ZE3 D;  3L4P A;  3Q8F A;  4K7U A;  3DBL B;  2K1F A;  3GZN I;  4US8 A;  3DBS A;  4QAY A;  3QCA A;  4LCD E;  1GB4 A;  2KT7 A;  2DBY A;  4DXF A;  2K8B A;  3ML9 A;  2HD5 B;  5D3D A;  2L7R A;  3AB5 A;  4RGN A;  1KLU D;  1JWU D;  1TIF A;  3VH3 B;  4WJN A;  4ANX A;  1C9F A;  4L23 A;  1WZ3 A;  1XD3 B;  2G4S A;  3APC A;  2K9X A;  2L32 A;  3BVM A;  5BMI A;  2I38 A;  2ZW1 A;  3GS2 A;  2KNB A;  4X57 B;  3NOB A;  2KWU B;  2LJ5 A;  4YSZ B;  1N6Z A;  3MHS D;  3AI5 A;  3JYU A;  3H9D A;  4AOF A;  3Q3F A;  4II3 B;  3L16 A;  4DXA B;  1FMA D;  2NCN A;  3Q8A A;  2AQ2 B;  5C3J B;  3GOE A;  2C5L C;  2K0P A;  4FN2 A;  3ZNH B;  3J9C A;  2EMS A;  2W54 A;  3SU8 X;  2R61 A;  3EGR A;  3PS6 A;  4N59 A;  1IGC A;  2AX5 A;  1SIJ A;  4MGI E;  2O2V B;  4XDD A;  1V1P B;  2D5G A;  2BBC A;  1AAR A;  3IXS A;  1FNV A;  1WMH A;  3Q3J A;  1XEE A;  4DWF A;  3RFZ B;  2OJR A;  3KYD D;  1XO3 A;  1WM3 A;  3ZQ4 A;  2KN4 A;  3FAH A;  4BKS D;  2BWE S;  2MA9 B;  4HRO A;  4WQM A;  2CJN A;  5JHA A;  1FRR A;  2IYD B;  3JW0 X;  1V97 A;  3CST A;  4TUU A;  2ZCC A;  2JVC A;  4HKQ A;  2M0X A;  1EF5 A;  1EUV B;  1VD2 A;  1XT9 B;  4EEW A;  2WU2 B;  2KLG A;  1WYW B;  4LNI A;  3AMZ A;  2KFK B;  3MP9 A;  1P7F A;  2MBE A;  3L08 A;  1WJ4 A;  1I4G A;  3AU4 A;  3X23 A;  1UH6 A;  4US9 A;  4ANV A;  1XF5 L;  3ZRC A;  3A9K B;  3LYY A;  2KN5 A;  4NZL B;  3A9J B;  3GB1 A;  3UI3 A;  1V6E A;  2D11 A;  2IND C;  2K22 A;  3BK1 A;  4RFB A;  2CJO A;  1TTN A;  1WYG A;  1JQ4 A;  4C80 A;  5D6J B;  2BS2 B;  2W3R A;  4RF1 A;  4HCN B;  5G5H A;  3L0W B;  3X0W A;  4KDL B;  2IDY A;  4KGS A;  3EFU A;  2OED A;  1ACC A;  2Z0D B;  1SE9 A;  2ON8 A;  2C9W B;  3V62 A;  3QWZ B;  1I35 A;  4EZK A;  2WXQ A;  3NVW A;  2CHW A;  2ZVN A;  3BVG A;  3ZTC A;  2IO2 B;  5DPR A;  3RT3 B;  1MVK A;  2K25 A;  2LVQ A;  4XE0 A;  2LGI A;  3AN1 A;  2LVO A;  2V1Y A;  4LLG M;  3DVG Y;  1NBF C;  1FEH A;  1HZ6 A;  3AEE B;  1V9J A;  3MHZ A;  2C60 A;  3DHG C;  3LB8 C;  3C0R B;  4N58 A;  3ZRF A;  3ZIM A;  4BFR A;  4BAX A;  5J17 A;  2BS3 B;  4LK0 M;  3ZDT A;  4NY0 A;  1KLG D;  1VLB A;  1E10 A;  3I57 A;  2NMQ A;  3NY5 A;  1J0G A;  2L1A A;  2KDM A;  1C3T A;  2ZPN A;  3TSS A;  3PGE A;  1FXT B;  1N63 A;  3QX1 A;  3W1S C;  3EC8 A;  2PVG C;  4WQO B;  1XQQ A;  5BMG A;  2Y3A A;  1QF6 A;  3RPF C;  4P7I A;  1NVI D;  1WH3 A;  4K81 A;  4EKU A;  4ICU A;  3RCZ A;  3L54 A;  2KWD A;  3JSV A;  3OJ3 A;  1OQY A;  4OVV A;  1JWS D;  1D5M C;  3B2G A;  2L0F A;  1R4N B;  3N1Z C;  4S17 A;  4IM2 A;  2AYO B;  2R2O A;  5CHV C;  4PYU A;  4YWG G;  2K5P A;  2NPT B;  4L1B A;  4AJW A;  2ACZ B;  5FR6 A;  2KC2 A;  1PDX A;  5H92 C;  1YJ1 A;  2CKH B;  2XK5 A;  1XLP A;  3M63 B;  5D3I B;  2PJH A;  4KGT A;  3AE1 B;  1NYQ A;  3AEG B;  2WS3 B;  2LEK A;  2W3S A;  4IKG A;  1ZW7 A;  3I3T B;  2JUO A;  4ZRK A;  2E6X A;  2DZK A;  3PZ8 A;  2QDF A;  5C1Z A;  1PFD A;  2GBN A;  5C2T B;  1C4P A;  4FLH A;  4BKT A;  3VR8 B;  2PIA A;  1WX9 A;  2ZPY A;  5KHO A;  3VAW A;  3MFG A;  2KX0 A;  2MP2 A;  2BB5 A;  4W9L A;  1GNU A;  1YX5 B;  1ET6 A;  4KSL C;  1QZE A;  1FCC C;  4GMV A;  3VTW A;  1WM2 A;  2DHZ A;  3IBE A;  1Y8R C;  3DBL I;  3DVN U;  4GSW A;  1NYR A;  4FHJ A;  1LO5 D;  2KQ7 A;  2WXR A;  4WAA A;  2V3N A;  1WR6 E;  2WXI A;  5JZE B;  4WJQ A;  3V60 A;  1HTQ A;  4FA6 A;  3PT2 B;  4M00 A;  3IHP C;  1FNW A;  1LXD A;  3PV1 A;  2WXL A;  2H89 B;  3VVW B;  3TJP A;  3Q8B A;  1TY0 A;  5TSS A;  2Y5P A;  1JRO A;  1TJE A;  4GGQ A;  3Q3N C;  4A3P A;  1JRU A;  2KC1 A;  1E7P B;  3HVD A;  1Z2M A;  3RN9 C;  4XGA B;  1FXA A;  1NEN B;  1UWX A;  2JF5 A;  4NJC A;  4OW0 A;  1TKG A;  2FCS A;  4C7Y A;  1XCT L;  1VJK A;  3PHW B;  3KUC B;  4DHZ E;  4TSS A;  4XC2 A;  4USA A;  3IVF A;  1SJE D;  4XYC A;  4YT0 B;  2AQ1 B;  4LDT B;  4N6E B;  3RNE C;  2WNM A;  1JML A;  1ZDX A;  2LXA A;  3MC8 A;  1YJJ A;  2B76 B;  3D32 A;  1QOF A;  1WGD A;  3WCQ A;  3P42 A;  2BB6 A;  4C00 A;  1K51 A;  3W9C B;  1FPY A;  2LAS A;  1F9J A;  1XXG A;  2MW5 A;  2BTE A;  2N9X A;  3QJZ A;  2FID A;  1I7H A;  1V86 A;  3ETR A;  3BY4 B;  2MRP A;  4GDK A;  1HZ5 A;  1S1Q B;  1WSP A;  4UDU C;  2KYW A;  1SXT A;  4F8C B;  3QAQ A;  1MI0 A;  4ZDV A;  3U4E G;  2J4X A;  2KZR A;  2IJ0 A;  4AQ7 A;  5FK9 C;  3ZJU A;  4BOS C;  2INP E;  1WGR A;  5DPT A;  2M1M A;  1RYJ A;  4NQL B;  1LQB A;  2BF8 B;  2XNA C;  2M4N A;  1IP9 A;  3DBR I;  2V9H A;  4IDI A;  1GC6 A;  2RMM A;  4KV2 A;  3AE2 B;  2BKR B;  2IO1 B;  5TR5 A;  3NZS A;  3HK0 A;  5E6J A;  4GDL A;  3ZKJ C;  1ET9 A;  2JRH A;  4MJS A;  4B9K A;  2WDR B;  1WGH A;  5EE1 A;  3VQI A;  1ZUD 2;  2NBV B;  2L05 A;  5D7G A;  3P4P B;  3DCG A;  1PQS A;  3NZ3 A;  5AUK A;  4BOZ B;  2MWS B;  4C4V A;  3HRD D;  3DBH I;  4GN1 A;  2M8S A;  3OG5 A;  1YJI A;  1M94 A;  1S3S G;  1HXY D;  2ICI A;  1VCB A;  2GOW A;  4PS7 A;  1WX8 A;  3ZUN A;  4E3C A;  1GB1 A;  1D6E C;  1D3Z A;  3A1Q B;  1UWM A;  3AH7 A;  3UIO B;  4NNJ B;  4IM3 A;  2J52 A;  3MTN B;  3ENE A;  2MBO A;  1IGD A;  2J42 A;  3AXC A;  1WXA A;  3AEC B;  1WE7 A;  1E0Z A;  3Q3O C;  3AE4 B;  1BML C;  2IGH A;  3O65 B;  4PYZ A;  1RM6 C;  2ZVO A;  1C78 A;  1OTR B;  2PKO A;  1CK1 A;  4S0R A;  4ACF A;  4GB9 A;  2WX0 A;  4HPP A;  1D5X C;  2WXM A;  2LGY A;  4IOI E;  4IWO A;  2B3A A;  1PUT A;  4WWO A;  4XWW A;  1MPE A;  4KX6 B;  3E56 A;  1AN8 A;  2YLM A;  2KX3 A;  4RGT A;  2KO3 A;  2CHX A;  3VUX A;  2ZZP B;  1IUE A;  2WLB A;  1YQ4 B;  3KW5 B;  4IM0 A;  1AYF A;  1P9D U;  5JH5 C;  1L0X B;  1STE A;  1B9R A;  4MSM B;  2DWQ A;  2LRW A;  1F52 A;  1UBQ A;  3PHX B;  1OGW A;  2I1K A;  4I6P A;  4P6V F;  5GMV A;  2G9H D;  2AL6 A;  3P4S B;  3GE8 C;  1LM8 B;  1JRP A;  1XLO A;  2LZ6 A;  3DQV A;  3EHV A;  2Z59 B;  2GI9 A;  3RUI B;  2ZJD A;  4ITK A;  2VRR B;  5LXI B;  3TEX A;  2G1E A;  1C77 A;  5IO9 A;  4CQN A;  4F7Z A;  1SE4 A;  4HXD A;  3T3O A;  3TEY A;  4M02 A;  2L0T A;  4J6I A;  3BZD B;  1KRH A;  4AUQ C;  2QEJ C;  4OVU A;  4MGY E;  5IA7 A;  2MEK A;  2J53 A;  4LJP B;  2NS5 A;  3BYT B;  2IY1 B;  4K7W A;  2FCN A;  4MM3 B;  2ONQ A;  4E74 A;  4YTN B;  3CF6 E;  3ZW3 A;  3IAM 1;  1RFA A;  3PRZ A;  3UIP B;  3VH4 B;  2PW9 A;  1ZDV A;  1EU4 A;  1QLB B;  4J3O D;  5IAA C;  2K6Q A;  3H6N A;  2WXF A;  3KWV A;  2RD0 A;  2J0K A;  2WXH A;  2YEP F;  4MT5 A;  5IN7 A;  1V49 A;  1QT9 A;  3WAP A;  1WXQ A;  3QQ8 B;  1J19 A;  3VDZ A;  1I4P A;  2AWT A;  2HJ1 A;  3R3M A;  3FC4 A;  1GOZ A;  1AWD A;  4DBG A;  3WAN A;  1UD7 A;  2FNJ B;  5BYS A;  2C7H A;  5JHB A;  2GBM A;  2A4Z A;  2LXC A;  3ZXR A;  4DXG A;  3KH0 A;  5L95 C;  2KAC A;  2PE6 B;  1JWM D;  2BPS A;  5HKH A;  2O2V A;  2UWQ A;  1I4H A;  2D10 A;  3TIX A;  2WP9 B;  3T8M A;  1KOT A;  4ZRQ A;  2I1J A;  5D94 A;  3EFC A;  1R4N I;  1E8W A;  1JAL A;  1ISN A;  1VZ6 A;  1SIF A;  3HUI A;  5KHQ A;  4P1C C;  4ASW C;  1FFU A;  3U52 E;  3N1X C;  1C4A A;  2BYV E;  2PPH A;  2VZK B;  4JE3 B;  2KQ4 X;  1GC7 A;  3GZN B;  2LGS A;  3OJ4 B;  4KSK C;  4PT5 A;  4HJG E;  1HQR D;  2HDE A;  1A70 A;  3N1Y C;  4W9E A;  2Q5W D;  2KTR A;  2LFI A;  4C56 C;  2QIL A;  3N32 A;  1V1O A;  2AEH A;  2NBW B;  2BW2 A;  2HJ8 A;  3RNC C;  4HLE A;  3APD A;  4IC7 B;  4PS8 A;  3NVV A;  3PLV A;  2EMT A;  2N9L A;  3Q6B A;  1F2R C;  3AU5 A;  4XX5 A;  3ZJV A;  4FAD A;  3ZNG C;  1FFV A;  2FUH B;  3AM9 A;  4K3B A;  3ZJT A;  1X1M A;  2NPT A;  3CWI A;  2JQR B;  3ML8 A;  2KLC A;  2JWZ A;  1F77 A;  1QIL A;  4YSY B;  1YQB A;  3NG0 A;  2QJL A;  1SJH D;  1ZXH A;  5AEK B;  2MJD A;  2RPV A;  4ICV A;  1FCL A;  2VZK D;  3C8Y A;  1R4M B;  3IAS 1;  2IY0 B;  4B0M A;  2FAZ A;  1VZ7 A;  1T6B X;  1ZGU B;  1MJD A;  3BIN A;  3LJ3 A;  4MGZ E;  1T3Q A;  1YN3 A;  2KDE B;  3A4R A;  1FRD A;  1K50 A;  4HCP B;  1Z5S B;  4RM9 A;  2MX2 A;  1K52 A;  3A33 B;  1IYF A;  3VHT C;  2H88 B;  2BKF A;  2KAN A;  1J7A A;  5AZH A;  2N1V A;  2AL3 A;  4NPN A;  4BZA A;  3TBL D;  3PSE B;  2GLS A;  4ZHO A;  2HTH A;  4ZHP A;  4RF0 A;  1FD6 A;  4IUM B;  2GBK A;  3ZYY X;  4EFO A;  1J7C A;  1C76 A;  1UGJ A;  4YXD B;  5E6O A;  1ZKH A;  1KFY B;  3WA0 A;  3VXW A;  1YQ3 B;  1WMH B;  2KKC A;  3VTU A;  3RMK C;  2K39 A;  3R2T A;  2GMI C;  3NZU A;  4HDQ A;  3IT4 B;  4KGR A;  1TS4 A;  4ARI A;  4HEA 1;  1ZP0 B;  4ZOH C;  2DZM A;  2E3T A;  3TUO A;  1E7U A;  2DX5 B;  5G2N A;  3H8H A;  1KM7 A;  1YOV B;  3IFW B;  2WDT B;  2WQY B;  2JT4 B;  1V8C A;  1L4Z B;  4O1N A;  4IWQ A;  3S2A A;  2MBH A;  4K1R B;  4RMA A;  4BVU C;  4WAF A;  3APF A;  2BQQ A;  1TY2 A;  4P1B C;  3RNG C;  3W1Y A;  1NI2 A;  2OJW A;  4LNO A;  5EE9 A;  3H1U A;  3RZF A;  2N0S B;  1T0Q C;  3EA6 A;  3ALB A;  1TS2 A;  4ZRP A;  3BVZ A;  2SEB D;  3CIR B;  3PZ7 A;  1WXV A;  3GP7 A;  1SF0 A;  3QA8 A;  1WJU A;  3P1M A;  4B95 A;  2WU5 B;  1V5O A;  1SSN A;  2KOX A;  2TSS A;  2KFK A;  4KZ0 A;  2KAJ A;  2ASQ A;  2MJ3 A;  2JY6 A;  2FCQ A;  2O6V A;  3W1S A;  1WIA A;  1OEY A;  1L0V B;  1I4X A;  4A9A A;  4C7Z A;  4C4V B;  3URY A;  3T3N A;  4W9J A;  1E8Z A;  3QK0 A;  3N20 C;  3K9P B;  3P63 A;  1FNU A;  2G4D B;  2JZ3 B;  5DPS A;  4A90 A;  3QAR A;  2WDV B;  3PRP B;  1N5W A;  2OHF A;  4XZ4 A;  4MJS B;  2LD9 A;  4A55 A;  4AS1 A;  4JQW C;  2KDB A;  2KXJ A;  3ZGZ A;  3V6E B;  4YSX B;  1TKY A;  1SB3 C;  2LRU A;  3ABV B;  3V61 A;  2JXX A;  5FR3 A;  2FE8 A;  3AEF B;  2NTS A;  1SE2 A;  4EZJ A;  1MFW A;  4FHK A;  2KVZ A;  2WHI A;  2IGD A;  3H7S A;  4RH6 A;  4KZC A;  3AE3 B;  1WY8 A;  2WXN A;  4I6N B;  4W9D A;  1VR9 A;  3R2I A;  1XCQ L;  3AEA B;  4I6L B;  3I9V 1;  1EM7 A;  3MJW A;  4KIK A;  3AE6 B;  4MGK E;  3ZNI D;  2LUM A;  2SAK A;  3QHT A;  2V4L A;  2IPK D;  1PGB A;  5G5G A;  1FM0 D;  2KDF B;  2W82 A;  2DYB A;  1P1A A;  3N9Y C;  3MC9 A;  4FJY A;  3PLU A;  4HDO A;  1ESF A;  2M56 B;  1T0S C;  2JZP A;  3JSV B;  3B08 A;  2BVC A;  1QQR A;  1CZP A;  2INN E;  1L0Y B;  4OZC A;  3U8Z A;  4WWP A;  2CHZ A;  2N9K A;  5BYQ A;  1FO4 A;  1YIW A;  2MBB B;  2L52 A;  5G55 A;  3W5U B;  2DYM A;  1L5P A;  5EE3 A;  2FUG 1;  1OQR A;  3PTF C;  2DLB A;  4DDG D;  2X8X X;  2WDQ B;  1YX6 B;  1J7B A;  2MQJ A;  3PO0 A;  2NBU A;  3TMP B;  2KVR A;  5JXV A;  4FUL A;  2LGD A;  2GBR A;  2OOB B;  1NDD A;  2INC C;  3DHH C;  1P7E A;  4KDI C;  3UQA A;  3AV8 A;  4W9F A;  3VUY A;  2CR5 A;  2QCZ A;  2C7N B;  2EEL A;  4AJY B;  2KWV B;  2J0J A;  3AUL A;  1YN4 A;  4M0W B;  1VZ8 A;  1E90 A;  1Q10 A;  1TS3 A;  1V5T A;  1LGR A;  3K9O B;  2LGX A;  4HPL B;  4HVB A;  2IO0 B;  2LUE A;  2KFJ A;  1R4M I;  3EEC A;  2VH2 A;  1N62 A;  3ZXV A;  3NJT A;  3VUW A;  4AP4 C;  3NHE B;  3Q3M C;  2CU3 A;  2ZW0 A;  2MLB A;  2KDI A;  2WXG A;  2XEW A;  1BXT A;  3W2D A;  3FIL A;  1WGG A;  4JWU C;  3DWM A;  1AW7 A;  1MG4 A;  3QC8 B;  4WH4 A;  1TS5 A;  4URK A;  4RGO S;  4LDT D;  4KKJ A;  3JVZ X;  3DHI C;  2CU1 A;  4PK1 A;  3H7P B;  2JU6 X;  5AZF A;  1KTK A;  4BKS A;  2QIE B;  2JX5 A;  2C7M B;  4EE2 A;  4B6W A;  2N7D A;  2GB1 A;  2LJI A;  4TQ0 A;  1YN5 A;  5C23 A;  1UF0 A;  3HM3 A;  1WXM A;  4EOY A;  2BYE A;  1RRB A;  1L4D B;  3P4Q B;  2YEP B;  3R66 C;  1E6E B;  3VRB B;  4REZ A;  4JL9 A;  3SDL C;  4MH0 E;  2D3C A;  3ZNZ B;  2V0G A;  1UUP A;  3BK2 A;  2XK5 B;  3QIJ A;  2WWZ A;  1H8C A;  3B0A A;  1WRI A;  2BS4 B;  1WJ6 A;  2REX A;  5E6P A;  1XLQ A;  1GJZ A;  3B1L X;  3W5V B;  5IKC M;  4FJZ A;  3CMM B;  2KJH B;  3HVZ A;  4ZYN A;  3AEB B;  4W9H A;  2KMM A;  1ZPS A;  5BMH A;  1OEY J;  3I63 C;  2LHD A;  4WUR A;  5EDS A;  1WR1 A;  1DOX A;  2M17 A;  4MM3 A;  1EU3 A;  5CTR C;  3PZD A;  1V81 A;  3VR9 B;  1SE3 A;  2PEA A;  2QMT A;  5EE0 A;  4HKZ E;  1GUA B;  2UU7 A;  4IWP A;  1V1P A;  1WX7 A;  3ZVV A;  1HEZ E;  1R7S A;  1ENF A;  2HE7 A;  1KH0 A;  2D3B A;  3DBH B;  5BO4 B;  3I5J C;  3T9L A;  4P16 A;  5L83 A;  3HM6 X;  2KWC A;  1B1Z A;  1UGM A;  4G11 A;  3RUL A;  1T5X D;  3ZO5 B;  4W9K A;  3FIL B;  4ZRJ A;  4HWI B;  4W9C A;  5J2R A;  1SGH A;  4YTM B;  3BII D;  3PRM B;  1FXI A;  1UNS A;  3V3X A;  1QKZ A;  3PRE A;  4TMA B;  5LLI A;  2UYZ B;  1PGX A;  2WYQ A;  3WAL A;  1V2Y A;  2YVC A;  2PTL A;  2MSE D;  1F0Z A;  3SD5 A;  3P4R B;  3OLM D;  2ZEQ A;  1GPX A;  5DCN A;  4NJ6 A;  4E71 A;  4NJ7 A;  2WX1 A;  1RAX A;  5BYR A;  1CMX B;  3NVZ A;  3RNF C;  3ECI A;  4JLC A;  1J8C A;  1G6J A;  2RDH A;  2IBI B;  1TYG B;  4ZRI A;  4JIO U;  4MH8 A;  2KMA A;  4LJO B;  3DBR B;  1U4A A;  2GRI A;  1Q1O A;  2XN9 C;  2KD0 A;  3KWL A;  1NEK B;  4ANW A;  2IO3 B;  1NI3 A;  1E7V A;  2ZNV C;  1UEL A;  3U7Z A;  2MCN B;  3L10 B;  3L17 A;  3TCA A;  2DAF A;  3WIM A;  1DGJ A;  4FJV B;  4YL8 A;  1RFK A;  3DVN V;  3KVF B;  4RCO A;  1LFD A;  2WXJ A;  4RNA A;  3A9K A;  5I4D A;  3Q8C A;  5DPW A;  3ZDM C;  4ARC A;  1C79 A;  4A6Q A;  4DHZ B;  4W9I A;  4ZYS A;  3A1Q A;  4OHJ A;  2AQ3 B;  2Y5B B;  3UQB A;  5HI1 A;  1T0Y A;  3LXF A;  2EKE C;  2KQS A;  2L83 A;  1PYW D;  5J18 A;  4DK5 A;  3R7Q A;  2M19 A;  4CHK A;  2JXT A;  2N1W A;  2RR9 A;  1TKE A;  2D3G A;  3SFE B;  1P98 A;  3RNA C;  1E8X A;  2KHW B;  1V80 A;  2KMC A;  4GU2 A;  4WJP A;  5T8I A;  4M8M A;  4CYE A;  2DNF A;  3VFK A;  2Z8L A;  3N3K B;  4FXC A;  3NVY A;  3RI7 C;  2RDG A;  1ROE A;  4F1S A;  4GIV A;  3N30 A;  2FBW B;  4LNF A;  5AUI A;  2KTR B;  1VDV A;  4DHJ D;  4A3O A;  4W9G A;  2V3P A;  1YNT E;  4LNK A;  3KLS X;  1E8Y A;  3BWU D;  1I4R A;  2W9N A;  5HHD G;  2HTM E;  4RGM A;  4WJO A;  1IBX B;  4MEL A;  4K3C A;  3M62 B;  2XBB C;  3GE3 C;  1IBX A;  4JWS C;  1C4C A;  2O6V B;  2JYE A;  4G50 A;  3M95 A;  1EWC A;  2N9E B;  3DOW A;  2CS4 A;  2J0M A;  4D2K A;  3U2S C;  2BYF A;  3KQ4 A;  1K8R B;  2IZV B;  1WZ0 A;  4M8N A;  3KUD B;  2DAJ A;  4GXB A;  2PLP A;  1BT0 A;  4TV3 A;  2D3A A;  4PS3 A;  4A8X C;  1FIQ A;  2K8H A;  4YTP B;  3SEB A;  1JWB D;  1MG8 A;  1C1Y B;  3LDZ E;  1SEB D;  3Q69 A;  1L7Y A;  1TZO A;  1SBB B;  2K8C A;  1TZ1 A;  3CSF A;  2V3S A;  3O13 A;  3EUB 2; 
#chains in the Genus database with same CATH homology
 2D11 A;  1UZX B;  2ZZP B;  2RGF A;  2DYB A;  1P1A A;  3SHQ A;  2JPH A;  3KW5 B;  1TTN A;  4IM0 A;  2FCM A;  2Z0E B;  1P9D U;  4FJY A;  4GOC A;  5JH5 C;  3PLU A;  4HDO A;  5D6J B;  4BBN C;  4MSM B;  4HCN B;  3UGB B;  3L0W B;  3X0W A;  4KDL B;  2LRW A;  1WFY A;  2D2Q A;  4FBJ B;  1I42 A;  1UBQ A;  3JSV B;  2QHO A;  3B08 A;  3PHX B;  3EFU A;  2RSU A;  3RD2 A;  1OGW A;  2I1K A;  4I6P A;  5GMV A;  3U8Z A;  2Z0D B;  1SE9 A;  4NAW B;  4WWP A;  3VTV A;  2CHZ A;  2C9W B;  3A9J A;  3V62 A;  2AL6 A;  1YIW A;  3QWZ B;  2MBB B;  1I35 A;  5G55 A;  1LM8 B;  2DYM A;  4JGH B;  2LZ6 A;  4EZK A;  3DQV A;  3EHV A;  3PTF C;  2Z59 B;  4DDG D;  3RUI B;  2ZJD A;  3H7P A;  1Q5W B;  2CHW A;  1YX6 B;  3DPD A;  2MQJ A;  2ZVN A;  3ZTC A;  4ANU A;  2IO2 B;  5DPR A;  4DHJ B;  3RT3 B;  2NBU A;  3TMP B;  1WRD B;  2VRR B;  5LXI B;  2K25 A;  2KVR A;  2LVQ A;  2L3Z A;  4FUL A;  2LGD A;  4F7Z A;  4HXD A;  4EUT A;  2LVO A;  2GBR A;  2OOB B;  2L0T A;  1NDD A;  2V1Y A;  4TKN A;  2FIF A;  4J6I A;  3DVG Y;  4KDI C;  2MBQ A;  3UQA A;  1NBF C;  3ONS A;  4W9F A;  3VUY A;  1KLV A;  2CR5 A;  1V9J A;  2NVU I;  3WAM A;  1WE6 A;  4AUQ C;  2L8J A;  4OVU A;  2C7N B;  4MGY E;  2C60 A;  5IA7 A;  3HHM A;  4AJY B;  2KWV B;  2GBJ A;  2ZNV B;  2J0J A;  3C0R B;  3AUL A;  3OAW A;  4N9F 4;  4LJP B;  4M0W B;  3ZRF A;  3ZIM A;  2NS5 A;  4BFR A;  1E90 A;  5J17 A;  2IY1 B;  4K7W A;  3R7R A;  2D07 B;  2FCN A;  1V5T A;  4NY0 A;  3ZDT A;  3K9O B;  1WF9 A;  3IG3 A;  4E74 A;  3NY5 A;  1J0G A;  2LGX A;  3CF6 E;  4HPL B;  3ZW3 A;  4HVB A;  2IO0 B;  1RFA A;  3PRZ A;  2LUE A;  2KFJ A;  2N9P C;  3UIP B;  2ZPN A;  1C3T A;  3M3J A;  3PGE A;  3VH4 B;  1FXT B;  3ZLZ A;  3QX1 A;  1R4M I;  5LXH A;  3EEC A;  3NS8 A;  3W1S C;  4MEM A;  3EC8 A;  3PVL A;  4NQK E;  2O6V D;  4WQO B;  2R2Q A;  4K7S A;  3VUW A;  5IAA C;  1XQQ A;  3U7D A;  4AP4 C;  2K6Q A;  4P7I A;  1WH3 A;  3H6N A;  3NHE B;  4II2 B;  2MLB A;  2KDI A;  4K81 A;  2XEW A;  4G3X B;  4EKU A;  2RD0 A;  2J0K A;  5CHF A;  4ICU A;  3RCZ A;  4HJK A;  2LVP A;  4TQ1 A;  3L54 A;  1V49 A;  1WGG A;  3HIZ A;  1E5W A;  1WI0 A;  3WAP A;  3QQ8 B;  3JSV A;  1J19 A;  3QC8 B;  4MSQ B;  3VDZ A;  3OJ3 A;  1OQY A;  2AWT A;  3R3M A;  4URK A;  4OVV A;  3UF8 A;  4LDT D;  2L0F A;  3JVZ X;  4DBG A;  2L76 A;  2JZZ A;  4IM2 A;  2AYO B;  2R2O A;  5CHV C;  2A5U A;  2CU1 A;  1UD7 A;  3WAN A;  2FNJ B;  4PYU A;  2DYO A;  3WAO A;  2C7H A;  5JHB A;  2GBM A;  2A4Z A;  4A20 A;  2LXC A;  3KYC D;  2NPT B;  4IG7 B;  2PE9 A;  2N7E A;  1WJN A;  2DEN B;  2NR2 A;  3H7P B;  3KH0 A;  5AZF A;  5L95 C;  4BKS A;  2PE6 B;  4AJW A;  2C7M B;  2BGF A;  3PPA A;  1UBI A;  2BPS A;  5FR6 A;  5HKH A;  2KC2 A;  2O2V A;  2UWQ A;  4AWJ A;  2J7Q B;  2D10 A;  3TIX A;  1YJ1 A;  2CKH B;  3V6C B;  2N7D A;  1RLF A;  2XK5 A;  3T8M A;  4B6W A;  3M63 B;  4TQ0 A;  1KOT A;  2G45 B;  2I1J A;  2PJH A;  4EZL A;  5C23 A;  5D94 A;  4CO7 A;  5D2M B;  4DDI D;  3HM3 A;  1R4N I;  1WXM A;  4EOY A;  2BYE A;  1RRB A;  4HK2 A;  1E8W A;  1ZW7 A;  4KVG B;  1TBE A;  3I3T B;  1ISN A;  2JUO A;  4ZRK A;  3TL5 A;  3R66 C;  2DZK A;  4JL9 A;  1SIF A;  5KHQ A;  3SDL C;  4MH0 E;  4ASW C;  3ZNZ B;  5C1Z A;  5CHW A;  2BYV E;  2PPH A;  2GBN A;  3ZTD A;  1GC7 A;  2XK5 B;  3QIJ A;  5CX3 A;  2WWZ A;  2RPQ A;  4FLH A;  3OJ4 B;  4KSK C;  2L00 B;  4BKT A;  1H8C A;  3B0A A;  3U30 A;  1WJ6 A;  1WX9 A;  2REX A;  5E6P A;  2ZPY A;  5KHO A;  1GJZ A;  3VAW A;  3B1L X;  4W9E A;  3RZW C;  2KTR A;  4RM8 A;  4FJZ A;  3CMM B;  2KX0 A;  2MP2 A;  2KJH B;  3N32 A;  4ZYN A;  4W9L A;  1GNU A;  4BKG A;  1YX5 B;  4W9H A;  2LI5 A;  2AEH A;  2NBW B;  4KSL C;  1QZE A;  4GMV A;  1OEY J;  3VTW A;  1EF1 A;  2HJ8 A;  1WM2 A;  2DHZ A;  4HLE A;  5EDS A;  1WR1 A;  3APD A;  1Y8R C;  2KTF A;  3DBL I;  3IBE A;  2M17 A;  3DVN U;  4GSW A;  4MM3 A;  4IC7 B;  2ZCB A;  4FHJ A;  4PS8 A;  2KQ7 A;  3PLV A;  4WAA A;  2EMT A;  5CTR C;  3PZD A;  1V81 A;  1WR6 E;  3AU5 A;  4XX5 A;  2JRI B;  2PEA A;  5JZE B;  2MP2 B;  2G3Q B;  4WJQ A;  3V60 A;  4GDL B;  4FA6 A;  2DZJ A;  3PT2 B;  4FAD A;  3IHP C;  1GUA B;  3ZNG C;  4IWP A;  1L2N A;  1LXD A;  2BWF A;  2FUH B;  3A4S C;  3PV1 A;  1WX7 A;  4IW0 A;  3RYT A;  3ZVV A;  1P0R A;  2HE7 A;  1X1M A;  2NPT A;  3ML8 A;  2KLC A;  2JWZ A;  3VVW B;  5BO4 B;  3TJP A;  1YQB A;  3KUZ A;  3T9L A;  4WWN A;  1WXS A;  4GGQ A;  5L83 A;  5AEK B;  4ICV A;  4A3P A;  3HM6 X;  2KWC A;  1WGY A;  3DVG X;  1UGM A;  1JRU A;  4G11 A;  1IPG A;  2KC1 A;  3RUL A;  2KJ6 A;  3ZO5 B;  2N4F A;  4W9K A;  1HE8 A;  4ZRJ A;  1Z2M A;  4HWI B;  4W9C A;  2IY0 B;  5J2R A;  1SGH A;  2FAZ A;  3PRM B;  1H4R A;  1P3Q U;  1ZGU B;  3BIN A;  3LJ3 A;  3PRE A;  5LLI A;  2UYZ B;  2DZI A;  2JF5 A;  2WYQ A;  4MGZ E;  3WAL A;  2KDE B;  1V2Y A;  2YVC A;  3A4R A;  4KIK B;  2LWP A;  2MSE D;  3SD5 A;  4HCP B;  2FCS A;  1Z5S B;  1A5R A;  3OLM D;  2ZEQ A;  3PHW B;  3KUC B;  4RM9 A;  2MX2 A;  3A33 B;  4GDK B;  5AZG A;  3UIN B;  4DHZ E;  4HPM B;  1IYF A;  4XC2 A;  2KK8 A;  5DCN A;  1EO6 A;  1KJT A;  4NJ6 A;  3VHT C;  2KJR A;  4E71 A;  4NJ7 A;  2BKF A;  3IVF A;  2WX1 A;  1RAX A;  2KAN A;  1CMX B;  4LDT B;  1Q0W B;  5AZH A;  2K6D B;  2N1V A;  2AL3 A;  4NPN A;  4MDK E;  3ECI A;  4JLC A;  1J8C A;  1G6J A;  2LXA A;  2IBI B;  3TBL D;  4ZRI A;  1TGZ B;  4JIO U;  2KMA A;  3D32 A;  4NAW A;  3PSE B;  1YD8 U;  4LJO B;  1WGD A;  1U4A A;  2HTH A;  1GG3 A;  1Q1O A;  2KD0 A;  4ANW A;  3DDC B;  5E6N A;  4G0N B;  4IUM B;  2IO3 B;  1E7V A;  2ZNV C;  1UEL A;  2GBK A;  2LAS A;  1F9J A;  2MCN B;  4EFO A;  3L10 B;  3L13 A;  3P2B A;  2MW5 A;  3L17 A;  3TCA A;  2DAF A;  2N9X A;  5E6O A;  1ZKH A;  4BBN F;  3QJZ A;  3WIM A;  2FID A;  3WA0 A;  1V86 A;  4FJV B;  4YL8 A;  3VXW A;  3DVN V;  4K7U A;  1WMH B;  2KKC A;  3BY4 B;  3KVF B;  3VTU A;  2K39 A;  2K1F A;  1LFD A;  2GMI C;  2MRP A;  4GDK A;  1S1Q B;  3NZU A;  4HDQ A;  3GZN I;  3DBS A;  3A9K A;  3QCA A;  4LCD E;  5DPW A;  4F8C B;  3ZDM C;  3QAQ A;  4DHZ B;  2DZM A;  4ZDV A;  4W9I A;  1E7U A;  2KZR A;  2K8B A;  3A1Q A;  3ML9 A;  4BOS C;  2Y5B B;  2HD5 B;  3UQB A;  2L7R A;  1WGR A;  2DX5 B;  5DPT A;  1T0Y A;  2M1M A;  5G2N A;  3VH3 B;  2EKE C;  4NQL B;  4WJN A;  4ANX A;  2KQS A;  1KM7 A;  1LQB A;  2BF8 B;  3IFW B;  2WDT B;  5J18 A;  1WZ3 A;  1XD3 B;  2G4S A;  2M4N A;  1IP9 A;  4DK5 A;  2JT4 B;  3DBR I;  3APC A;  4IWQ A;  3S2A A;  2MBH A;  4K1R B;  1GC6 A;  4RMA A;  4KV2 A;  3R7Q A;  4BVU C;  2BKR B;  3APF A;  2KNB A;  2IO1 B;  4X57 B;  5TR5 A;  3NOB A;  3HK0 A;  3NZS A;  2KWU B;  2LJ5 A;  4CHK A;  2N1W A;  4GDL A;  3ZKJ C;  3MHS D;  3W1Y A;  1NI2 A;  3AI5 A;  2RR9 A;  3JYU A;  2JRH A;  2D3G A;  3H9D A;  4MJS A;  4AOF A;  1P98 A;  3Q3F A;  4II3 B;  4B9K A;  1E8X A;  3L16 A;  1WGH A;  2KHW B;  3H1U A;  1V80 A;  2KMC A;  4GU2 A;  4WJP A;  3RZF A;  4M8M A;  4CYE A;  4DXA B;  3VFK A;  2NCN A;  3ALB A;  3VQI A;  3GOE A;  2NBV B;  2C5L C;  2L05 A;  4FN2 A;  3ZNH B;  3N3K B;  5D7G A;  1WXV A;  2EMS A;  3DCG A;  3SU8 X;  4F1S A;  1PQS A;  3QA8 A;  1WJU A;  3PS6 A;  4BOZ B;  2MWS B;  4B95 A;  1V5O A;  2KOX A;  4GIV A;  3DBH I;  4MGI E;  2O2V B;  3N30 A;  2KFK A;  4GN1 A;  2M8S A;  4KZ0 A;  2ASQ A;  2JY6 A;  1AAR A;  2FCQ A;  2KTR B;  4DHJ D;  1WMH A;  3Q3J A;  1M94 A;  4W9G A;  4A3O A;  2O6V A;  3W1S A;  1WIA A;  4DWF A;  1S3S G;  1OEY A;  2OJR A;  1E8Y A;  3KYD D;  1WM3 A;  2W9N A;  4BKS D;  2BWE S;  1VCB A;  1E8Z A;  2GOW A;  3QK0 A;  4W9J A;  4WJO A;  2MA9 B;  1WX8 A;  3K9P B;  4MEL A;  4PS7 A;  3ZUN A;  4E3C A;  2G4D B;  2JZ3 B;  3M62 B;  2XBB C;  5DPS A;  3QAR A;  1D3Z A;  3A1Q B;  5JHA A;  3UIO B;  3JW0 X;  2IYD B;  3PRP B;  4IM3 A;  4NNJ B;  4XZ4 A;  4MJS B;  2LD9 A;  2O6V B;  3MTN B;  4JQW C;  2KDB A;  4G50 A;  2KXJ A;  3M95 A;  3ENE A;  3V6E B;  3CST A;  2MBO A;  2N9E B;  2LRU A;  3DOW A;  3AXC A;  2JXX A;  3V61 A;  1WXA A;  2CS4 A;  1WE7 A;  4TUU A;  2J0M A;  2ZCC A;  2BYF A;  2JVC A;  2M0X A;  1EF5 A;  1EUV B;  1VD2 A;  1XT9 B;  3O65 B;  4EEW A;  4EZJ A;  1K8R B;  2KLG A;  1WYW B;  4PYZ A;  2ZVO A;  2KFK B;  2IZV B;  1WZ0 A;  4FHK A;  1OTR B;  4M8N A;  3KUD B;  3H7S A;  2MBE A;  3L08 A;  4KZC A;  2DAJ A;  4GXB A;  1WJ4 A;  1WY8 A;  4TV3 A;  1BT0 A;  2WX0 A;  3AU4 A;  4GB9 A;  4I6N B;  3X23 A;  4W9D A;  1UH6 A;  4PS3 A;  4I6L B;  2LGY A;  2K8H A;  4IWO A;  4ANV A;  2B3A A;  4WWO A;  1MG8 A;  1C1Y B;  3MJW A;  4KIK A;  4MGK E;  3ZRC A;  3ZNI D;  3LDZ E;  3A9K B;  3QHT A;  2V4L A;  1L7Y A;  2KN5 A;  2YLM A;  2KX3 A;  2KDF B;  2K8C A;  1TZ1 A;  2KO3 A;  3A9J B;  2V3S A;  3CSF A;  1V6E A;  2CHX A;  3VUX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...