4W9LA

Pvhl:elob:eloc in complex with (2s,4r)-1-((s)-2-((s)-2-acetamido-3,3-dimethylbutanamido)-3,3-dimethylbutanoyl)-4-hydroxy-n-(4-(4-methylthiazol-5-yl)benzyl)pyrrolidine-2-carboxamide (ligand 15)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
103
structure length
101
Chain Sequence
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGEGFTSQTARPQAPATVGLAFRADDTFEALIEPFSSPPELPDVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Guided Design and Optimization of Small Molecules Targeting the Protein-Protein Interaction between the von Hippel-Lindau (VHL) E3 Ubiquitin Ligase and the Hypoxia Inducible Factor (HIF) Alpha Subunit with in Vitro Nanomolar Affinities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords Transcription elongation factor B polypeptide 2
total genus 22
structure length 101
sequence length 103
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4w9lA00
2ZVOA 2KN5A 1YJ1A 4DDGD 1V5OA 1Z5SB 4N9F4 1J19A 2L3ZA 3I3TB 3ZO5B 2G4DB 3DVGX 1E90A 5CHFA 3PLUA 2ZNVB 2ZPYA 1UD7A 2KJ6A 4EKUA 4F1SA 2DAFA 3O65B 2DZIA 2LRUA 1UGMA 4HLEA 2MX2A 1V81A 2C9WB 4AJWA 3APFA 1E7UA 1EF1A 4I6LB 4YL8A 5G55A 5DPSA 2Z0EB 4IM2A 2J0MA 2RSUA 5KHOA 3VH3B 3B08A 3Q3FA 3AU5A 2RGFA 3CSTA 1FXTB 1UBQA 1RAXA 2DX5B 3A9KB 3UF8A 1ISNA 2DZKA 2PPHA 4GU2A 2ZVNA 4K7UA 2K8HA 1OGWA 2BKFA 4J6IA 3NHEB 2LI5A 3TJPA 4BBNC 1UELA 4WAAA 4XX5A 3WAPA 1V49A 3NZSA 4FULA 4NAWA 4ZYNA 3ECIA 4BKGA 1GG3A 4OVUA 3V6CB 4GXBA 2KFJA 4EZKA 2WWZA 4HJKA 2LWPA 2UWQA 4KDLB 3HK0A 2HD5B 3RZFA 1IYFA 2KFKA 4HK2A 1P98A 2M1MA 3WAOA 3GZNI 1LXDA 2LZ6A 2KVRA 4W9KA 3TL5A 2DAJA 3U8ZA 3DVGY 2IBIB 2IO2B 2PE6B 2ZJDA 2J7QB 4GIVA 4AP4C 4ANUA 2KKCA 2BWFA 4K1RB 2EMTA 2KHWB 2A5UA 3EHVA 1XQQA 3X23A 2C60A 2KXJA 4BFRA 4FLHA 1NBFC 3VQIA 2LASA 1WXAA 4KIKA 5KHQA 3JVZX 2KC2A 1C1YB 3DCGA 3V6EB 4JGHB 1R4NI 1L2NA 1KM7A 3W1YA 2KTRB 2KWVB 3PHXB 3QARA 3CF6E 3KUCB 2C5LC 4G50A 3ZNID 3PT2B 1E5WA 3L08A 2ZPNA 4M8MA 4ANVA 2MBHA 2KNBA 3EC8A 1IPGA 2M8SA 4X57B 4TKNA 4ZRJA 4K81A 3D32A 4WWPA 4EEWA 5HKHA 2NS5A 1ZW7A 2D2QA 2N1VA 4HPLB 4NQLB 3VVWB 4TQ1A 2RD0A 2N7DA 2JWZA 3EFUA 2NBVB 1WE7A 3VTWA 3U7DA 4W9LA 4MJSB 3PV1A 1WXMA 2KOXA 3MHSD 3RULA 2ZCBA 2FCMA 4ANXA 2JF5A 3DVNV 2MW5A 4GDLB 3QQ8B 3PSEB 3CSFA 4KSLC 3WA0A 5L95C 1NDDA 4I6PA 5J17A 4CHKA 4IWPA 4G3XB 3AULA 2DYOA 1XD3B 3CMMB 4LCDE 2FIFA 4KZ0A 2BWES 2O2VA 4NPNA 2AEHA 4GDKA 4IC7B 4FJZA 2L8JA 4K7SA 4WJNA 4II3B 5L83A 4JQWC 2L7RA 3RT3B 3B0AA 1T0YA 3C0RB 2KLGA 3KUZA 4MM3A 3ZUNA 3VH4B 1LQBA 1WY8A 1P3QU 4JL9A 5CX3A 3UQBA 2ASQA 3RZWC 4ICVA 2HE7A 5AZHA 4IM3A 4WJPA 2NPTA 1LFDA 4EZJA 1YX5B 3DDCB 3RYTA 4KVGB 2WX1A 3H1UA 1BT0A 3W1SA 3N32A 3HM3A 1WR1A 2N9EB 4GN1A 3RCZA 4BOSC 1UZXB 2GMIC 4FN2A 3A9KA 1WX8A 1E8XA 1V6EA 2AL6A 2NBWB 2JRIB 2LD9A 4DXAB 3JSVB 5JZEB 2OJRA 2QHOA 4MSMB 2V4LA 2GBRA 5LLIA 1GC7A 5LXHA 4BBNF 5GMVA 1E8ZA 3VXWA 5AZFA 1LM8B 4AUQC 5TR5A 2JUOA 3ZDTA 3DBLI 4DHZE 2XK5B 2NCNA 3PRMB 3QJZA 3VTVA 4ZDVA 2MBEA 1K8RB 4TUUA 1E8WA 3RUIB 2JRHA 4A20A 4IWQA 3HM6X 4PYZA 2R2OA 4HCPB 2KTFA 3KYCD 2J0KA 1F9JA 2L00B 4XC2A 2NVUI 5CHVC 2MBOA 3PRPB 1V9JA 2D07B 1WZ0A 1S3SG 5E6PA 2DZMA 1ZKHA 3PREA 5FR6A 1KLVA 4IUMB 3QK0A 2I1JA 3PRZA 4MH0E 4NQKE 1WGHA 4GGQA 3M95A 2O6VB 4EZLA 1CMXB 4DDID 4HXDA 3L54A 2CKHB 2D11A 4NNJB 4OVVA 3TMPB 1Q0WB 4WWNA 2KMCA 4AOFA 1EF5A 3R7QA 2MRPA 4HDOA 4A3OA 5LXIB 3ZW3A 4F8CB 1AARA 2FCSA 3Q3JA 4FBJB 2CR5A 3ZNHB 2KX0A 4B9KA 1J0GA 4AJYB 4GB9A 4PS8A 1H4RA 3AU4A 4JIOU 5D94A 5E6OA 1WXSA 2ZEQA 3IG3A 4DHJD 4E74A 3A1QA 3R3MA 3TBLD 1TGZB 3ML9A 3AXCA 3ENEA 4IM0A 1SE9A 4HVBA 3WAMA 4PYUA 4ZRKA 2M4NA 4II2B 3WANA 2DHZA 3NY5A 3N3KB 5AZGA 3PHWB 1PQSA 5CHWA 2FCNA 3H6NA 1P9DU 1Y8RC 2DZJA 2BYVE 1YQBA 3ZLZA 2REXA 3SU8X 2L76A 2GBNA 3DQVA 2XEWA 3L13A 1E8YA 4ICUA 1RRBA 2CHWA 3M63B 2FNJB 3MJWA 3QX1A 3VTUA 4DHJB 2BYEA 3ALBA 4GDKB 3ZTCA 4DK5A 3JYUA 3K9PB 3ZNZB 2NPTB 3SHQA 2PJHA 2A4ZA 3R66C 4GOCA 1Q5WB 3JW0X 2V3SA 2L0FA 1GJZA 1H8CA 1YX6B 4WJQA 2MBBB 3H7SA 2AWTA 2KFKB 1WM3A 3QA8A 4EOYA 2KQ7A 3L10B 1WX7A 1V80A 3PZDA 2G4SA 2MP2A 3DVNU 3IBEA 2C7MB 4LDTB 4NJ7A 2MA9B 3DPDA 4NY0A 1I35A 3LJ3A 2XBBC 2L0TA 3PTFC 3HIZA 4BKSD 4F7ZA 1I42A 2FIDA 2MLBA 2N7EA 1WMHB 1Z2MA 1UH6A 1VCBA 3UIOB 2C7NB 1WGRA 3DBHI 4W9FA 3ZDMC 2KDFB 3UQAA 3VFKA 2O6VD 4TQ0A 2XK5A 2Z0DB 1TTNA 4DBGA 1A5RA 3ZVVA 1L7YA 4WWOA 2IO0B 2WX0A 1D3ZA 3QAQA 2IZVB 3QIJA 3BY4B 4MDKE 3M62B 2K1FA 4NAWB 4E3CA 2MSED 2KMAA 3DOWA 2Z59B 1GNUA 1WI0A 1WF9A 3N30A 2KC1A 4MEMA 4WJOA 1KOTA 5BO4B 3W1SC 2M17A 4CO7A 2CU1A 1EO6A 4RM9A 4M0WB 3UGBB 2O6VA 4HDQA 2CS4A 2CHZA 2K8BA 2KO3A 2EKEC 3BINA 3IVFA 2GBJA 4ASWC 5J2RA 4MELA 4W9EA 2WDTB 4W9JA 3ZRCA 2N1WA 2M0XA 3A4SC 3EECA 1MG8A 3H7PB 3APDA 3QWZB 3NS8A 3T9LA 4E71A 3HHMA 4BKSA 2IY0B 1X1MA 1YD8U 2KX3A 4IWOA 5EDSA 2UYZB 5C1ZA 2W9NA 2GBMA 4MJSA 1WYWB 2KANA 4GMVA 3TIXA 3OLMD 1WFYA 2JPHA 3ONSA 4W9IA 3QHTA 4HPMB 2IYDB 3IHPC 1WH3A 3A1QB 4GDLA 4K7WA 4KIKB 1Q1OA 2RR9A 2LXAA 3V62A 2N9XA 1S1QB 4P7IA 3B1LX 1WRDB 5JHBA 3VUWA 2WYQA 2LGYA 3H7PA 2AL3A 2LUEA 3V61A 2C7HA 1TZ1A 2NR2A 2I1KA 3ZRFA 1WIAA 1V5TA 4RMAA 5G2NA 1WZ3A 2KDBA 4AWJA 4W9GA 1HE8A 3UIPB 1TBEA 2LVOA 4ZRIA 3VUXA 1GUAB 3OJ4B 5J18A 4MGKE 4I6NB 2K25A 4G0NB 5D7GA 3GOEA 2L05A 2IO1B 1SIFA 3LDZE 3PLVA 2CHXA 2JZZA 3KH0A 2PEAA 3MTNB 1WX9A 2KJHB 4HCNB 4B95A 2GBKA 3NOBA 4KSKC 2AYOB 5IAAC 2KQSA 4CYEA 5JHAA 4MGIE 3UINB 1V2YA 4FADA 3T8MA 1WJ4A 1KJTA 2K6QA 3U30A 2DYMA 3DBSA 4M8NA 4DHZB 1UBIA 2EMSA 4BKTA 2IY1B 2V1YA 2KDIA 1YIWA 4WQOB 1SGHA 3S2AA 1VD2A 2Y5BB 1OQYA 4BVUC 5DPRA 4W9CA 1P1AA 4MGYE 2MWSB 2MCNB 2VRRB 3PPAA 2LXCA 1OEYJ 3QC8B 4W9HA 5D2MB 4MSQB 3APCA 4HWIB 2O2VB 2MP2B 1M94A 4LDTD 3OAWA 3JSVA 4PS3A 3SD5A 1WGYA 2ZCCA 3P2BA 3WALA 3L17A 3KVFB 2G45B 4GSWA 3SDLC 3H9DA 4EFOA 2YVCA 4B6WA 4URKA 3RD2A 3KUDB 1WJ6A 5DCNA 3PS6A 2FAZA 4FJYA 3VHTC 5E6NA 1R4MI 4LJPB 2K39A 4ANWA 3QCAA 2MBQA 2IO3B 2N4FA 2N9PC 3WIMA 4FA6A 1E7VA 2BYFA 3AI5A 2FCQA 2K6DB 4PS7A 1IP9A 2JT4B 2KWUB 2KLCA 2ZNVC 1WJNA 2FUHB 4W9DA 3TCAA 3VUYA 2LVQA 5CTRC 2B3AA 3ZIMA 2BGFA 2BKRB 3ZNGC 4G11A 1WMHA 4KZCA 2OOBB 1JRUA 5C23A 2YLMA 4FJVB 4KV2A 1WXVA 1P0RA 3A33B 3ZKJC 1J8CA 2LVPA 2KJRA 1OTRB 2BPSA 3K9OB 1RLFA 2RPQA 2PE9A 3A4RA 3A9JA 4EUTA 3KW5B 2D10A 2DENB 1WJUA 3VDZA 5DPTA 2HTHA 3L0WB 2KTRA 2KDEB 4MGZE 4FHJA 2JY6A 1OEYA 4LJOB 5DPWA 2NBUA 1NI2A 2DYBA 5D6JB 1WGDA 5JH5C 3DBRI 3ZTDA 1WGGA 2LRWA 4KDIC 1WM2A 1XT9B 2LGDA 2R2QA 4FHKA 1QZEA 4BOZB 1WE6A 3KYDD 3R7RA 2ZZPB 4NJ6A 3VAWA 3A9JB 3ML8A 3IFWB 4IG7B 1G6JA 2G3QB 2KD0A 4IW0A 3NZUA 3V60A 2LJ5A 2GOWA 2D3GA 2KWCA 1RFAA 4A3PA 2JVCA 5AEKB 4XZ4A 1WR6E 2JXXA 5IA7A 1C3TA 2HJ8A 2K8CA 2KZRA 1EUVB 2BF8B 2J0JA 1ZGUB 1GC6A 4DWFA 1U4AA 3M3JA 3L16A 2KK8A 2LGXA 3PGEA 1V86A 4RM8A 4TV3A 2MQJA 4JLCA 3PVLA 2JZ3B 3X0WA 3OJ3A
chains in the Genus database with same CATH superfamily
2ZVOA 2KN5A 2LUMA 1V5OA 3ZO5B 1FMAD 1TKGA 1RWSA 4C80A 3PLUA 3P42A 1XLNA 2WXIA 1N5XA 4N6EB 1QQRA 1E7UA 2W82A 1EF1A 2EELA 4YL8A 3DHGC 4ARIA 1ZE3D 2Z0EB 2J0MA 2RSUA 3AU5A 2RGFA 1FXTB 3DBHB 4YT0B 1OGWA 4J6IA 3NHEB 2BVCA 3NUHB 1N6ZA 4FULA 4NAWA 4BKGA 4OVUA 2D3AA 4EZKA 3AV8A 2HJ1A 2UWQA 3HK0A 1WWTA 2WXNA 1IYFA 4HK2A 1XO3A 2LZ6A 2KVRA 2M56B 1IBXB 5G5HA 4GIVA 5T8IA 4OW0A 2BWFA 3EHVA 1XQQA 3TEXA 1P7EA 5AUKA 5LNK1 2KC2A 3CWIA 3DCGA 3V6EB 3MJ5A 1VR9A 1KM7A 1NEKB 2VZKB 1JCKB 2DNFA 3KUCB 2C5LC 3ZNID 3PT2B 4AQ7A 4ANVA 1SF0A 2KNBA 3DBRB 3NG0A 3BYTB 1ZW7A 3BYYB 2JWZA 2I2YA 4LNOA 2W54A 1WE7A 4A6QA 2KOXA 2ZCBA 3AEFB 5L95C 5J17A 4O1NA 2DYOA 3CMMB 4LCDE 2L8JA 4WJNA 2JU6X 2HTME 3PZ8A 3B0AA 5D3DA 3C0RB 3ZUNA 3VH4B 1SEBD 2H89B 1FEHA 1FFVA 1TZOA 3UQBA 5JXVA 2ASQA 2HE7A 2NPTA 1LFDA 2JQRB 1YX5B 3AE2B 2QMTA 3H1UA 2IPKD 2N9EB 3RCZA 1UZXB 1SXTA 2GMIC 1E8XA 3C19A 2NBWB 2W3SA 2E3TA 1ZUD2 3Q69A 5LXHA 4K3BA 4AUQC 2ON8A 3PRMB 3QJZA 4ZDVA 2L32A 2JRHA 4A20A 4HCPB 2J0KA 4DQOC 2FE8A 1L5PA 3AM9A 3VRBB 4A8XC 3KLSX 1S3SG 2DZMA 1ZKHA 3PREA 4N58A 5D3IB 4NQKE 1WGHA 3M95A 4ZOHC 4EZLA 1CMXB 4HXDA 2VH2A 4L1BA 2MJEA 5LXIB 4B0EA 3ZW3A 2FCSA 3Q3JA 5IN7A 5C2TB 1J0GA 1H4RA 3IG3A 1KLUD 3IAM1 2R61A 1B1ZA 3TBLD 1ROEA 4HVBA 3WANA 4P6VF 5H8YE 1K50A 3PHWB 1P9DU 1Y8RC 3ZXRA 3H8HA 3NVWA 3SU8X 1MVKA 3DQVA 3L13A 1E8YA 2FNJB 4GDKB 3RNGC 5BYQA 1D5XC 3R66C 3FKYA 1Q5WB 2V3SA 3B9JA 2L0FA 1WXQA 2AWTA 1ZXIA 1FM0D 2Y5CA 2G4SA 2NMQA 3DVNU 3WCQA 4NJ7A 2VH1A 2MA9B 1F52A 2N7EA 1XXGA 5FK9C 2Y3AA 4S0RA 1WGRA 4TMAB 4KX6B 4TQ0A 4NZLB 1A5RA 5IP4D 5IO9A 4M02A 1EM7A 3RNBC 2WX0A 2V3NA 2K1FA 4E3CA 4C4VA 2KC1A 2M17A 2CU1A 3ZGZA 1V97A 2LHDA 3U52E 4XGAB 1Q10A 2K8BA 3RNAC 4ASWC 5FR3A 1F1HA 2I38A 3EECA 4E71A 3ETRA 2B76B 1P7FA 1X1MA 2KX3A 4C4VB 2UYZB 2W9NA 4W9IA 3T3NA 4US8A 1XF5L 2KYWA 3IHPC 1L4DB 4KIKB 3BIID 3V62A 1WRDB 2WYQA 3H7PA 2AL3A 3V61A 3ZRFA 1SJHD 2WXJA 1WZ3A 2KDBA 1HE8A 1TBEA 4A9AA 1TYGB 5HFYA 2L05A 2INPE 1TKEA 4LNNA 2CHXA 1WX9A 2KJHB 1L0XB 2GBKA 4CYEA 3HVDA 1WJ4A 2AX5A 2DYMA 3DBSA 2EMSA 2V1YA 1SGHA 2LMCA 1VJKA 3AN1A 2Y5BB 1PUTA 1I4XA 4JX1C 1QF6A 1P1AA 2MCNB 2LXCA 5IKCM 1M94A 4MT5A 2WP9B 3P2BA 3AE6B 4WH4A 4EFOA 1JRPA 4B6WA 1T0SC 2K22A 2BYFA 4M01A 4MH8A 1QOGA 3I5JC 2KWUB 1WJNA 1XCTL 4W9DA 5CTRC 2B3AA 2GLSA 3AEGB 4YXDB 2J53A 3N1ZC 2G9HD 3TEWA 1FNUA 2WXHA 2LVPA 2ZW1A 2BPSA 3K9OB 1SB3C 3A4RA 2PE9A 4WURA 2D10A 2DENB 1FPYA 1WJUA 2LHEA 3VDZA 2HTHA 2OEDA 2KTRA 3L0WB 2KDEB 4FHJA 3GS2A 1OEYA 1GB1A 4B0MA 5EE3A 3V3XA 2V4IB 1WGGA 1L0VB 2LRWA 1L6VA 3VR9B 3GP7A 1WE6A 3R7RA 2G3QB 4IW0A 3NZUA 2LGIA 1JALA 1VZ8A 3U2SC 1EU3A 1WR6E 1TS3A 2JXXA 1YN4A 1JMLA 1ZGUB 1U4AA 3PGEA 4J3OD 1BMLC 2LEKA 2W55A 1C9FA 3E56A 3X0WA 1C76A 2K5PA 2M19A 3DVGX 4C7ZA 2ZNVB 1HZ6A 3NZ3A 2JX5A 2C9WB 2NTSA 3BWUD 4I6LB 5DPSA 4IM2A 4RGTA 3Q3FA 3A9KB 2ZVNA 1SE4A 4K7UA 2BKFA 2QCZA 4P1BC 2LI5A 3KWLA 3TJPA 1M4VA 3ECIA 4XDDA 2M0AA 1GG3A 3V6CB 2WWZA 4KDLB 2RDBC 1P98A 2M1MA 3WAOA 1E7PB 1V1OA 2IBIB 2J7QB 4AP4C 4ANUA 3ZXVA 2QEJC 1QT9A 2KHWB 3R2TA 1WXAA 4TSSA 3JVZX 1C1YB 4PK1A 3IXSA 4A90A 1R4NI 1L2NA 3ZQ4A 1ZDXA 2INCC 3CF6E 1GAQB 3L08A 2ZPNA 4M8MA 2J52A 2MBHA 1T0QC 4HJGE 4A55A 2WS3B 3D32A 3SFDB 4WWPA 1D5ZC 5C3JB 2RDHA 2L1AA 2N1VA 4HPLB 4HKZE 2N7DA 3BVZA 1C4AA 4MACA 4JPSA 2NBVB 1MI0A 1IGCA 4ANXA 2FCMA 3BVGA 2JF5A 3Q3MC 1FD6A 1HQRD 4MM3B 3QQ8B 2LGSA 1NDDA 4I6PA 4US9A 5G5GA 1C78A 1MHXA 4CHKA 1XD3B 3P4RB 2FIFA 4KZ0A 2BWES 4UDUC 2O2VA 1MHHE 4IC7B 4FJZA 3C8YA 1PGXA 4JQWC 3RT3B 1T0YA 3KUZA 2BW2A 3GE8C 4XDCA 1LQBA 3FILA 5EE0A 4JL9A 3NJTA 3RNFC 3V05A 2ICIA 5TSSA 3HVZA 4EZJA 4KVGB 3IT6B 2PVGC 2QC8A 3W1SA 4BOSC 2LFIA 3RPFC 4FN2A 1WX8A 1F77A 1V6EA 5BMIA 4RH6A 4DXAB 3JSVB 2QHOA 4XYCA 4MSMB 2K3UA 5GMVA 1E8ZA 5TR5A 2JUOA 3AE1B 3DBLI 3VTVA 2MBEA 2IGHA 1K8RB 5BMHA 4HEA1 4TUUA 3Q8FA 3RUIB 2WGSA 3HM6X 1I4QA 5H92C 2BTEA 4XC2A 2NVUI 5CHVC 3P63A 1ENFA 1ET9A 1V9JA 4JE3B 5FR6A 1UNSA 2O6VB 3AEDB 3L54A 2CKHB 3TMPB 2MRPA 4A3OA 1AARA 1CQVA 2KX0A 4B9KA 1IUEA 5E6OA 2ZEQA 3A1QA 3R3MA 1TGZB 4HRSA 1FXAA 2WU2B 3ENEA 1I4HA 1DOYA 1V8CA 4ZRKA 1E6EB 2X8XX 2DHZA 3NY5A 4KKJA 5AZGA 5CHWA 2FCNA 3H6NA 2ACZB 4JWUC 1R7SA 2OJWA 1TT5B 1YQBA 2YEPB 4REZA 2L76A 4L23A 3U7ZA 2BS4B 2CHWA 3M63B 3VTUA 2BYEA 3ZTCA 4DK5A 3JYUA 3K9PB 4BZAA 3J9CA 3NVYA 4ITKA 2DLBA 2MBBB 3QA8A 1WM3A 1LGRA 1WX7A 1V80A 3PZDA 2MP2A 3IBEA 4LDTB 3O13A 3EA6A 1I35A 3LJ3A 4LNIA 2L0TA 2MLBA 1Z2MA 1UH6A 1VCBA 2QSDA 2KDMA 4RNAA 3SEBA 3UQAA 1XLOA 4WWOA 2IO0B 2WXMA 3QAQA 2LJIA 3M62B 2KMAA 4K3CA 1WI0A 2D5GA 2Q5WD 1HTQA 2PIAA 3UGBB 2O6VA 2CHZA 2KO3A 3BINA 3DHIC 4MELA 4W9EA 2IGGA 3P4QB 4W9JA 2N1WA 3W9CB 3HHMA 1YD8U 4IWOA 2BQQA 1EU4A 4RCOA 3TIXA 4OHJA 1WFYA 2JPHA 1QOAA 1UWXA 4HPMB 1TY0A 2SAKA 1WH3A 2XN9C 3A1QB 3EFCA 1Q1OA 2RR9A 3B1LX 2RPVA 1ESFA 5JHBA 2LGYA 3DWGC 4YTMB 3R2IA 4HKQA 2NR2A 1WIAA 5G2NA 2VZKD 1GUAB 3OJ4B 3NRZA 2IO1B 1SIFA 4Q2JA 5HI1A 3LDZE 2JZZA 2WXOA 3KH0A 4KGTA 5BMGA 4B95A 2AYOB 5IAAC 1J7CA 3UINB 2K6QA 3U30A 4DHZB 2KACA 1WYGA 2KDIA 1PDXA 1VD2A 1OQYA 4BVUC 2MWSB 3PPAA 3GE3C 4MSQB 2WXPA 5IOIA 2L52A 4YWGG 1UWMA 4XWTA 1WGYA 3WALA 2MEKA 3L17A 3AEAB 2G45B 3H9DA 4URKA 2UU7A 3VHTC 4FJYA 1ACCA 3WIMA 2IO3B 4FA6A 1K51A 1E7VA 2K6DB 3KQ4A 2ZNVC 3VUYA 2IJ0A 2BGFA 1FRRA 3ZNGC 4G11A 1I4GA 5C23A 4FJVB 1NVID 2XNAC 3ZKJC 2KJRA 4EUTA 1YOVB 4HPPA 3FC4A 2BYTA 3W5VB 4WQMA 1NI2A 1WGDA 2H88B 4IOIE 3DBRI 3SR6A 3ZTDA 1ZXHA 1WM2A 2LGDA 2R2QA 1QZEA 1T5XD 4XE0A 4NJ6A 1I4PA 3VAWA 3IFWB 2KAJA 2MH7A 3Q8EA 1F2RI 3UI3A 3AEEB 3AH7A 2D3GA 1DOXA 1RFAA 4A3PA 5AEKB 3MC9A 3DBLB 2KZRA 1EUVB 4DWFA 4N59A 1HTOA 1KFYB 4RM8A 1TKYA 3PO0A 1DGJA 3OJ3A 2WDRB 1YJ1A 2N9KA 4DDGD 1Z5SB 1J19A 2G4DB 1VZ7A 1E90A 1UUPA 2ZPYA 3TEYA 1UD7A 2KJ6A 4EKUA 4F1SA 3O65B 1V1PB 1ZDVA 3LXFA 1MPEA 2MX2A 1V81A 4AJWA 2Z8LA 3APFA 5G55A 4LK0M 5FKAC 1JW9D 3UF8A 2HDEA 1N60A 2DZKA 2PPHA 4GU2A 3RN9C 2K8HA 1BXTA 2BS2B 1SE2A 4BBNC 4WAAA 4XX5A 3WAPA 1V49A 4GXBA 2KFJA 2CJOA 2HD5B 3P4SB 1SSNA 1LXDA 4W9KA 2KKCA 4K1RB 2EMTA 2WXQA 2A5UA 2C60A 4BFRA 4FLHA 2KQ4X 1NBFC 3ZJTA 3VQIA 2LASA 4KIKA 5KHQA 1C4CA 4RF1A 3W1YA 2KTRB 2KWVB 3PHXB 5BYRA 1J7BA 4G50A 1E5WA 2CU3A 2AQ1B 3N20C 1IPGA 1L6UA 1A70A 2KWDA 4TKNA 4X57B 1MG4A 1D6EC 5HKHA 3Q3NC 3MFGA 4NQLB 1XLQA 2RD0A 3EFUA 4W9LA 3RFZB 1VZ6A 1WXMA 3MHSD 3PV1A 3DVNV 4GDLB 3PSEB 3CSFA 1FCCC 4KSLC 3WA0A 1KH0A 4D2KA 4ARCA 4II3B 3IAS1 5L83A 2WNMA 1B9RA 2KLGA 1K53A 3ZJVA 1KTKA 1WY8A 3BZDB 5CX3A 4XWWA 1YQ4B 3RZWC 4ICVA 3AE3B 1FFUA 4RGOS 4WJPA 1JROA 3RYTA 1BT0A 1WR1A 3AB5A 3A9KA 1GB4A 3OG5A 1BUIC 2LD9A 2FBWB 1MFWA 2V4LA 2GBRA 5LLIA 4BBNF 4HROA 2NCNA 1TS2A 2MJDA 4IWQA 1SBBB 2R2OA 2KTFA 1ZP0B 1HA5A 3PRPB 5E6PA 1WGKA 4MH0E 3FAHA 2V0GA 1JQ4A 2K0PA 4OVVA 4WWNA 1EF5A 2N7JA 2AQ2B 3I57A 1JWBD 4FBJB 2CR5A 3ZNHB 4GB9A 4PS8A 4JIOU 3AU4A 2WXKA 3CIRB 4DHJD 1YJJA 4E74A 4ZHOA 4KGRA 3WAMA 4PYUA 4II2B 1T6BX 2G1EA 4IDIA 2X38A 1F2RC 2BYVE 1C79A 3RNEC 3Q6BA 1I4RA 2REXA 1N61A 2GBNA 1PFDA 2XEWA 2WDVB 4ICUA 1RRBA 4JWSC 3QX1A 2JXTA 4DHJB 3SFEB 1IGDA 3ZNZB 4C00A 2NPTB 2D3CA 2QILA 2GRIA 2NTTA 2IGDA 3AE9B 2N9LA 1GJZA 1YX6B 3B2GA 3H7SA 3HUIA 2KFKB 5EE1A 1N5WA 5I4DA 2KQ7A 3L10B 1PGAA 3MHZA 5MPOA 3PTFC 3HIZA 4F7ZA 1I42A 2FIDA 3UIOB 4NJCA 1QILA 3LYYA 4DXGA 1AW7A 2KDFB 4RFBA 2O6VD 4EE2A 2Z0DB 4DBGA 1L7YA 1JWAD 4BAXA 1D3ZA 2IZVB 3BY4B 4GLSC 4NAWB 5HHDG 4LLGM 2GB1A 3DOWA 1GNUA 1WF9A 3N30A 4MEMA 1KOTA 5BO4B 3W1SC 4ACFA 4M0WB 2KN4A 3AE7B 4HDQA 3IVFA 3ZRCA 3QWZB 2M0XA 3A4SC 3H7PB 3T9LA 3APDA 4BKSA 2IY0B 1DYQA 3TSSA 2GBMA 4MJSA 1QOFA 3OLMD 2WXLA 3ONSA 3QHTA 2IYDB 3W5UB 2LXAA 1S1QB 4P7IA 3VUWA 2C7HA 1TZ1A 1KF6B 2I1KA 1OFFA 1V5TA 4RMAA 1C77A 4AWJA 4W9GA 3UIPB 1JWMD 2LVOA 4ZRIA 5J18A 1FCLA 4MGKE 3IT4B 5D7GA 3GOEA 1XLPA 3PLVA 3MTNB 5BYSA 2PEAA 1NYQA 4HCNB 1QLBB 2KQSA 2WHIA 4LNFA 1V2YA 4FADA 3T8MA 1VDVA 1AWDA 2IY1B 1JWUD 4WQOB 1TS4A 4M00A 2QIEB 4W9CA 1RFKA 1OEYJ 4W9HA 5D2MB 2MJ3A 3APCA 4LDTD 2PLPA 3OAWA 3JSVA 1CZPA 4H2AA 4OZAA 3KVFB 1FIQA 4GSWA 3SDLC 3DHHC 2YVCA 1MJDA 1NI3A 1WJ6A 5DCNA 3PS6A 1R4MI 4RF0A 2K39A 2N4FA 1E0ZA 4PS7A 1IP9A 2JT4B 2KLCA 3TCAA 2LVQA 1N63A 1UF0A 4WAFA 3GZNB 2BKRB 3RI7C 1WMHA 2OOBB 1T3QA 4KV2A 1WXVA 2AQ3B 4M0WA 1J8CA 3P1MA 1OTRB 2JYEA 1RLFA 3NVZA 2RPQA 2YEPF 3A9JA 3N9YC 1YMHE 5DPTA 4C7YA 2JY6A 4DXFA 2NBUA 2DYBA 4FXCA 4WIPA 2BB5A 1XT9B 3BK1A 3DWMA 3A9JB 3Q14C 4IG7B 1G6JA 3PZ7A 1HEZE 2W3RA 5E6JA 4YSZB 1KLGD 2JZPA 2JVCA 2DBYA 4XZ4A 3TUOA 1C3TA 2J0JA 1GC6A 1V86A 4TV3A 2MQJA 3MP9A 3PVLA 4N9F4 2JSVX 2L3ZA 3I3TB 1WRIA 4IKGA 5CHFA 1YQ3B 2PTLA 1ZOYB 1F0ZA 2DAFA 2DZIA 2LRUA 1J7AA 3AE4B 1UGMA 4HLEA 3I63C 1STEA 3VRAB 3VH3B 2GI9A 5KHOA 3B08A 3Q8AA 3CSTA 2DX5B 1UBQA 1RAXA 1ISNA 3W2DA 1UELA 1T0RC 3NZSA 4ZYNA 1CJEA 3Q3OC 1K52A 4HJKA 2IDYA 2LWPA 4C56C 3RZFA 1XCQL 2KFKA 3B2FA 3GZNI 2EKIA 2K9XA 3AE5B 3TL5A 2JWUA 2DAJA 3U8ZA 3DVGY 2IO2B 2PE6B 2ZJDA 3BVMA 1FO4A 3MC0B 1R4MB 4P16A 3X23A 2KXJA 2Y5PA 4JGHB 1ZPSA 3RNCC 1EWYC 3QARA 2KMMA 4KGSA 3EC8A 3E9SA 2QDFA 5GXGB 2M8SA 4ZRJA 4K81A 1WSPA 1TJEA 4EEWA 2MHJA 4RGMA 2NS5A 2D2QA 3VVWB 4TQ1A 3VTWA 3U7DA 4MJSB 3RULA 2JYTA 1VRAB 2MW5A 2WDQB 3U4EG 4P1CC 3FILB 1RYJA 4AS1A 4IWPA 4G3XB 3AULA 4NPNA 2AEHA 4GDKA 4NAMA 4K7SA 3NS1A 2L7RA 3MC8A 2PMVA 3P4PB 4MM3A 3EUB2 1EWCA 1P3QU 4ZYSA 2TSSA 5AZHA 4IM3A 1OQQA 4ZHPA 3ABVB 3DDCB 1NENB 2WX1A 1GPXA 2CJNA 1E9MA 1QOBA 2WU5B 2WXGA 3HM3A 3N32A 4GN1A 3L4PA 4KKIA 2AL6A 2INDC 3R8BA 2JRIB 3BK2A 2OJRA 5JZEB 1HXYD 2SEBD 1GC7A 3VXWA 5AZFA 1LM8B 3ZDTA 2PVOD 4DHZE 2XK5B 2L83A 2WLBA 1E8WA 3AE8B 2KVZA 4RGNA 4PYZA 1IBXA 3KYCD 1F9JA 2L00B 2MBOA 2D07B 1I7HA 2E6XA 1WZ0A 1QKZA 1YJIA 1KLVA 4IUMB 3QK0A 2I1JA 3PRZA 1FRDA 4YTNB 4ZRQA 4GGQA 3URYA 3Q8BA 1RM6C 1CK1A 4DDID 2D11A 2ONQA 4NNJB 4YSXB 1Q0WB 1TS5A 2KMCA 4AOFA 3R7QA 4HDOA 1E10A 1FXIA 4F8CB 1VLBA 4AJYB 5D94A 1WXSA 2ZW0A 3ML9A 3AXCA 1PYWD 4IM0A 1SE9A 3AECB 2BS3B 5HG2A 2FUG1 2M4NA 1PGBA 1UGJA 3N3KB 1V1PA 1PQSA 2DZJA 1HZ5A 3N1XC 3ZLZA 1AYFA 3Q8CA 3MJWA 2PKOA 3ALBA 3KWVA 3Q2AC 3SHQA 2INNE 2PJHA 2A4ZA 4GOCA 4R3DA 3JW0X 1FNWA 1H8CA 4WJQA 1SJED 1JWSD 4EOYA 2V3PA 2C7MB 2BB6A 3DPDA 4NY0A 2XBBC 4S17A 3OWEB 4BKSD 2OHFA 1WMHB 3TEZA 2C7NB 3DBHI 4W9FA 3ZDMC 4CQNA 4YSYB 3VFKA 2XK5A 1TTNA 4WWMA 3ZVVA 1N62A 1D4BA 3QIJA 4MDKE 3N1YC 1LO5D 2MSED 2Z59B 3EGRA 4WJOA 4CO7A 4USAA 1EO6A 4RM9A 1DOIA 2RDGA 2CS4A 2EKEC 1D5MC 2GBJA 5J2RA 2WDTB 1YN3A 1MG8A 3NS8A 5EDSA 3T3OA 2N0SB 5C1ZA 1OQRA 1Y56A 4YTPB 4QAYA 1WYWB 2KANA 4GMVA 1YN5A 1GOZA 4K7WA 4GDLA 2N9XA 4OVZA 3RMKC 1NYRA 1TY2A 2LUEA 1AN8A 1TIFA 3VR8B 3VUXA 1R4NB 3GB1A 1C4PA 1L0YB 4I6NB 2K25A 3AMZA 4G0NB 1FNVA 3NOBA 4KSKC 5JHAA 4MGIE 1KJTA 4M8NA 1UBIA 4BKTA 2BT6A 3ZYYX 4LNKA 1YIWA 3S2AA 5DPRA 2PW9A 1SE3A 4MGYE 2QJLA 2VRRB 1SIJA 4L2YA 3QC8B 4HWIB 3AEBB 5AUIA 2O2VB 2MP2B 2J4XA 4PS3A 3SD5A 2ZCCA 1ET6A 2RMMA 2DWQA 5EE9A 3RD2A 3KUDB 2FAZA 5E6NA 4LJPB 4ANWA 3QCAA 2MBQA 2N9PC 3AI5A 2FCQA 2V9HA 2FUHB 3ZIMA 4KZCA 1JRUA 2YLMA 3I9V1 1KRHA 1P0RA 3A33B 3LB8C 4LTUA 2WQYB 3KW5B 3HRDD 4MGZE 4LJOB 5DPWA 1YNTE 4OZBA 5D6JB 4OZCA 2KT7A 5JH5C 4PT5A 3ZJUA 4KDIC 4FHKA 4BOZB 3KYDD 2ZZPB 3ML8A 2KD0A 3V60A 2LJ5A 2GOWA 2WXRA 3NVVA 2KWCA 2WXFA 5IA7A 2HJ8A 2K8CA 2J42A 2BF8B 4ZRPA 3M3JA 3L16A 2KK8A 2BBCA 2LGXA 1XEEA 4JLCA 2JZ3B 1L4ZB 2D3BA
chains in the Genus database with same CATH topology
2ZVOA 2KN5A 1YJ1A 4DDGD 1V5OA 1Z5SB 4N9F4 1J19A 2L3ZA 3I3TB 3ZO5B 2G4DB 3DVGX 1E90A 5CHFA 3PLUA 2ZNVB 2ZPYA 1UD7A 2KJ6A 4EKUA 4F1SA 2DAFA 3O65B 2DZIA 2LRUA 1UGMA 4HLEA 2MX2A 1V81A 2C9WB 4AJWA 3APFA 1E7UA 1EF1A 4I6LB 4YL8A 5G55A 5DPSA 2Z0EB 4IM2A 2J0MA 2RSUA 5KHOA 3VH3B 3B08A 3Q3FA 3AU5A 2RGFA 3CSTA 1FXTB 1UBQA 1RAXA 2DX5B 3A9KB 3UF8A 1ISNA 2DZKA 2PPHA 4GU2A 2ZVNA 4K7UA 2K8HA 1OGWA 2BKFA 4J6IA 3NHEB 2LI5A 3TJPA 4BBNC 1UELA 4WAAA 4XX5A 3WAPA 1V49A 3NZSA 4FULA 4NAWA 4ZYNA 3ECIA 4BKGA 1GG3A 4OVUA 3V6CB 4GXBA 2KFJA 4EZKA 2WWZA 4HJKA 2LWPA 2UWQA 4KDLB 3HK0A 2HD5B 3RZFA 1IYFA 2KFKA 4HK2A 1P98A 2M1MA 3WAOA 3GZNI 1LXDA 2LZ6A 2KVRA 4W9KA 3TL5A 2DAJA 3U8ZA 3DVGY 2IBIB 2IO2B 2PE6B 2ZJDA 2J7QB 4GIVA 4AP4C 4ANUA 2KKCA 2BWFA 4K1RB 2EMTA 2KHWB 2A5UA 3EHVA 1XQQA 3X23A 2C60A 2KXJA 4BFRA 4FLHA 1NBFC 3VQIA 2LASA 1WXAA 4KIKA 5KHQA 3JVZX 2KC2A 1C1YB 3DCGA 3V6EB 4JGHB 1R4NI 1L2NA 1KM7A 3W1YA 2KTRB 2KWVB 3PHXB 3QARA 3CF6E 3KUCB 2C5LC 4G50A 3ZNID 3PT2B 1E5WA 3L08A 2ZPNA 4M8MA 4ANVA 2MBHA 2KNBA 3EC8A 1IPGA 2M8SA 4X57B 4TKNA 4ZRJA 4K81A 3D32A 4WWPA 4EEWA 5HKHA 2NS5A 1ZW7A 2D2QA 2N1VA 4HPLB 4NQLB 3VVWB 4TQ1A 2RD0A 2N7DA 2JWZA 3EFUA 2NBVB 1WE7A 3VTWA 3U7DA 4W9LA 4MJSB 3PV1A 1WXMA 2KOXA 3MHSD 3RULA 2ZCBA 2FCMA 4ANXA 2JF5A 3DVNV 2MW5A 4GDLB 3QQ8B 3PSEB 3CSFA 4KSLC 3WA0A 5L95C 1NDDA 4I6PA 5J17A 4CHKA 4IWPA 4G3XB 3AULA 2DYOA 1XD3B 3CMMB 4LCDE 2FIFA 4KZ0A 2BWES 2O2VA 4NPNA 2AEHA 4GDKA 4IC7B 4FJZA 2L8JA 4K7SA 4WJNA 4II3B 5L83A 4JQWC 2L7RA 3RT3B 3B0AA 1T0YA 3C0RB 2KLGA 3KUZA 4MM3A 3ZUNA 3VH4B 1LQBA 1WY8A 1P3QU 4JL9A 5CX3A 3UQBA 2ASQA 3RZWC 4ICVA 2HE7A 5AZHA 4IM3A 4WJPA 2NPTA 1LFDA 4EZJA 1YX5B 3DDCB 3RYTA 4KVGB 2WX1A 3H1UA 1BT0A 3W1SA 3N32A 3HM3A 1WR1A 2N9EB 4GN1A 3RCZA 4BOSC 1UZXB 2GMIC 4FN2A 3A9KA 1WX8A 1E8XA 1V6EA 2AL6A 2NBWB 2JRIB 2LD9A 4DXAB 3JSVB 5JZEB 2OJRA 2QHOA 4MSMB 2V4LA 2GBRA 5LLIA 1GC7A 5LXHA 4BBNF 5GMVA 1E8ZA 3VXWA 5AZFA 1LM8B 4AUQC 5TR5A 2JUOA 3ZDTA 3DBLI 4DHZE 2XK5B 2NCNA 3PRMB 3QJZA 3VTVA 4ZDVA 2MBEA 1K8RB 4TUUA 1E8WA 3RUIB 2JRHA 4A20A 4IWQA 3HM6X 4PYZA 2R2OA 4HCPB 2KTFA 3KYCD 2J0KA 1F9JA 2L00B 4XC2A 2NVUI 5CHVC 2MBOA 3PRPB 1V9JA 2D07B 1WZ0A 1S3SG 5E6PA 2DZMA 1ZKHA 3PREA 5FR6A 1KLVA 4IUMB 3QK0A 2I1JA 3PRZA 4MH0E 4NQKE 1WGHA 4GGQA 3M95A 2O6VB 4EZLA 1CMXB 4DDID 4HXDA 3L54A 2CKHB 2D11A 4NNJB 4OVVA 3TMPB 1Q0WB 4WWNA 2KMCA 4AOFA 1EF5A 3R7QA 2MRPA 4HDOA 4A3OA 5LXIB 3ZW3A 4F8CB 1AARA 2FCSA 3Q3JA 4FBJB 2CR5A 3ZNHB 2KX0A 4B9KA 1J0GA 4AJYB 4GB9A 4PS8A 1H4RA 3AU4A 4JIOU 5D94A 5E6OA 1WXSA 2ZEQA 3IG3A 4DHJD 4E74A 3A1QA 3R3MA 3TBLD 1TGZB 3ML9A 3AXCA 3ENEA 4IM0A 1SE9A 4HVBA 3WAMA 4PYUA 4ZRKA 2M4NA 4II2B 3WANA 2DHZA 3NY5A 3N3KB 5AZGA 3PHWB 1PQSA 5CHWA 2FCNA 3H6NA 1P9DU 1Y8RC 2DZJA 2BYVE 1YQBA 3ZLZA 2REXA 3SU8X 2L76A 2GBNA 3DQVA 2XEWA 3L13A 1E8YA 4ICUA 1RRBA 2CHWA 3M63B 2FNJB 3MJWA 3QX1A 3VTUA 4DHJB 2BYEA 3ALBA 4GDKB 3ZTCA 4DK5A 3JYUA 3K9PB 3ZNZB 2NPTB 3SHQA 2PJHA 2A4ZA 3R66C 4GOCA 1Q5WB 3JW0X 2V3SA 2L0FA 1GJZA 1H8CA 1YX6B 4WJQA 2MBBB 3H7SA 2AWTA 2KFKB 1WM3A 3QA8A 4EOYA 2KQ7A 3L10B 1WX7A 1V80A 3PZDA 2G4SA 2MP2A 3DVNU 3IBEA 2C7MB 4LDTB 4NJ7A 2MA9B 3DPDA 4NY0A 1I35A 3LJ3A 2XBBC 2L0TA 3PTFC 3HIZA 4BKSD 4F7ZA 1I42A 2FIDA 2MLBA 2N7EA 1WMHB 1Z2MA 1UH6A 1VCBA 3UIOB 2C7NB 1WGRA 3DBHI 4W9FA 3ZDMC 2KDFB 3UQAA 3VFKA 2O6VD 4TQ0A 2XK5A 2Z0DB 1TTNA 4DBGA 1A5RA 3ZVVA 1L7YA 4WWOA 2IO0B 2WX0A 1D3ZA 3QAQA 2IZVB 3QIJA 3BY4B 4MDKE 3M62B 2K1FA 4NAWB 4E3CA 2MSED 2KMAA 3DOWA 2Z59B 1GNUA 1WI0A 1WF9A 3N30A 2KC1A 4MEMA 4WJOA 1KOTA 5BO4B 3W1SC 2M17A 4CO7A 2CU1A 1EO6A 4RM9A 4M0WB 3UGBB 2O6VA 4HDQA 2CS4A 2CHZA 2K8BA 2KO3A 2EKEC 3BINA 3IVFA 2GBJA 4ASWC 5J2RA 4MELA 4W9EA 2WDTB 4W9JA 3ZRCA 2N1WA 2M0XA 3A4SC 3EECA 1MG8A 3H7PB 3APDA 3QWZB 3NS8A 3T9LA 4E71A 3HHMA 4BKSA 2IY0B 1X1MA 1YD8U 2KX3A 4IWOA 5EDSA 2UYZB 5C1ZA 2W9NA 2GBMA 4MJSA 1WYWB 2KANA 4GMVA 3TIXA 3OLMD 1WFYA 2JPHA 3ONSA 4W9IA 3QHTA 4HPMB 2IYDB 3IHPC 1WH3A 3A1QB 4GDLA 4K7WA 4KIKB 1Q1OA 2RR9A 2LXAA 3V62A 2N9XA 1S1QB 4P7IA 3B1LX 1WRDB 5JHBA 3VUWA 2WYQA 2LGYA 3H7PA 2AL3A 2LUEA 3V61A 2C7HA 1TZ1A 2NR2A 2I1KA 3ZRFA 1WIAA 1V5TA 4RMAA 5G2NA 1WZ3A 2KDBA 4AWJA 4W9GA 1HE8A 3UIPB 1TBEA 2LVOA 4ZRIA 3VUXA 1GUAB 3OJ4B 5J18A 4MGKE 4I6NB 2K25A 4G0NB 5D7GA 3GOEA 2L05A 2IO1B 1SIFA 3LDZE 3PLVA 2CHXA 2JZZA 3KH0A 2PEAA 3MTNB 1WX9A 2KJHB 4HCNB 4B95A 2GBKA 3NOBA 4KSKC 2AYOB 5IAAC 2KQSA 4CYEA 5JHAA 4MGIE 3UINB 1V2YA 4FADA 3T8MA 1WJ4A 1KJTA 2K6QA 3U30A 2DYMA 3DBSA 4M8NA 4DHZB 1UBIA 2EMSA 4BKTA 2IY1B 2V1YA 2KDIA 1YIWA 4WQOB 1SGHA 3S2AA 1VD2A 2Y5BB 1OQYA 4BVUC 5DPRA 4W9CA 1P1AA 4MGYE 2MWSB 2MCNB 2VRRB 3PPAA 2LXCA 1OEYJ 3QC8B 4W9HA 5D2MB 4MSQB 3APCA 4HWIB 2O2VB 2MP2B 1M94A 4LDTD 3OAWA 3JSVA 4PS3A 3SD5A 1WGYA 2ZCCA 3P2BA 3WALA 3L17A 3KVFB 2G45B 4GSWA 3SDLC 3H9DA 4EFOA 2YVCA 4B6WA 4URKA 3RD2A 3KUDB 1WJ6A 5DCNA 3PS6A 2FAZA 4FJYA 3VHTC 5E6NA 1R4MI 4LJPB 2K39A 4ANWA 3QCAA 2MBQA 2IO3B 2N4FA 2N9PC 3WIMA 4FA6A 1E7VA 2BYFA 3AI5A 2FCQA 2K6DB 4PS7A 1IP9A 2JT4B 2KWUB 2KLCA 2ZNVC 1WJNA 2FUHB 4W9DA 3TCAA 3VUYA 2LVQA 5CTRC 2B3AA 3ZIMA 2BGFA 2BKRB 3ZNGC 4G11A 1WMHA 4KZCA 2OOBB 1JRUA 5C23A 2YLMA 4FJVB 4KV2A 1WXVA 1P0RA 3A33B 3ZKJC 1J8CA 2LVPA 2KJRA 1OTRB 2BPSA 3K9OB 1RLFA 2RPQA 2PE9A 3A4RA 3A9JA 4EUTA 3KW5B 2D10A 2DENB 1WJUA 3VDZA 5DPTA 2HTHA 3L0WB 2KTRA 2KDEB 4MGZE 4FHJA 2JY6A 1OEYA 4LJOB 5DPWA 2NBUA 1NI2A 2DYBA 5D6JB 1WGDA 5JH5C 3DBRI 3ZTDA 1WGGA 2LRWA 4KDIC 1WM2A 1XT9B 2LGDA 2R2QA 4FHKA 1QZEA 4BOZB 1WE6A 3KYDD 3R7RA 2ZZPB 4NJ6A 3VAWA 3A9JB 3ML8A 3IFWB 4IG7B 1G6JA 2G3QB 2KD0A 4IW0A 3NZUA 3V60A 2LJ5A 2GOWA 2D3GA 2KWCA 1RFAA 4A3PA 2JVCA 5AEKB 4XZ4A 1WR6E 2JXXA 5IA7A 1C3TA 2HJ8A 2K8CA 2KZRA 1EUVB 2BF8B 2J0JA 1ZGUB 1GC6A 4DWFA 1U4AA 3M3JA 3L16A 2KK8A 2LGXA 3PGEA 1V86A 4RM8A 4TV3A 2MQJA 4JLCA 3PVLA 2JZ3B 3X0WA 3OJ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZVO A;  2KN5 A;  1YJ1 A;  4DDG D;  1V5O A;  1Z5S B;  4N9F 4;  1J19 A;  2L3Z A;  3I3T B;  3ZO5 B;  2G4D B;  3DVG X;  1E90 A;  5CHF A;  3PLU A;  2ZNV B;  2ZPY A;  1UD7 A;  2KJ6 A;  4EKU A;  4F1S A;  2DAF A;  3O65 B;  2DZI A;  2LRU A;  1UGM A;  4HLE A;  2MX2 A;  1V81 A;  2C9W B;  4AJW A;  3APF A;  1E7U A;  1EF1 A;  4I6L B;  4YL8 A;  5G55 A;  5DPS A;  2Z0E B;  4IM2 A;  2J0M A;  2RSU A;  5KHO A;  3VH3 B;  3B08 A;  3Q3F A;  3AU5 A;  2RGF A;  3CST A;  1FXT B;  1UBQ A;  1RAX A;  2DX5 B;  3A9K B;  3UF8 A;  1ISN A;  2DZK A;  2PPH A;  4GU2 A;  2ZVN A;  4K7U A;  2K8H A;  1OGW A;  2BKF A;  4J6I A;  3NHE B;  2LI5 A;  3TJP A;  4BBN C;  1UEL A;  4WAA A;  4XX5 A;  3WAP A;  1V49 A;  3NZS A;  4FUL A;  4NAW A;  4ZYN A;  3ECI A;  4BKG A;  1GG3 A;  4OVU A;  3V6C B;  4GXB A;  2KFJ A;  4EZK A;  2WWZ A;  4HJK A;  2LWP A;  2UWQ A;  4KDL B;  3HK0 A;  2HD5 B;  3RZF A;  1IYF A;  2KFK A;  4HK2 A;  1P98 A;  2M1M A;  3WAO A;  3GZN I;  1LXD A;  2LZ6 A;  2KVR A;  4W9K A;  3TL5 A;  2DAJ A;  3U8Z A;  3DVG Y;  2IBI B;  2IO2 B;  2PE6 B;  2ZJD A;  2J7Q B;  4GIV A;  4AP4 C;  4ANU A;  2KKC A;  2BWF A;  4K1R B;  2EMT A;  2KHW B;  2A5U A;  3EHV A;  1XQQ A;  3X23 A;  2C60 A;  2KXJ A;  4BFR A;  4FLH A;  1NBF C;  3VQI A;  2LAS A;  1WXA A;  4KIK A;  5KHQ A;  3JVZ X;  2KC2 A;  1C1Y B;  3DCG A;  3V6E B;  4JGH B;  1R4N I;  1L2N A;  1KM7 A;  3W1Y A;  2KTR B;  2KWV B;  3PHX B;  3QAR A;  3CF6 E;  3KUC B;  2C5L C;  4G50 A;  3ZNI D;  3PT2 B;  1E5W A;  3L08 A;  2ZPN A;  4M8M A;  4ANV A;  2MBH A;  2KNB A;  3EC8 A;  1IPG A;  2M8S A;  4X57 B;  4TKN A;  4ZRJ A;  4K81 A;  3D32 A;  4WWP A;  4EEW A;  5HKH A;  2NS5 A;  1ZW7 A;  2D2Q A;  2N1V A;  4HPL B;  4NQL B;  3VVW B;  4TQ1 A;  2RD0 A;  2N7D A;  2JWZ A;  3EFU A;  2NBV B;  1WE7 A;  3VTW A;  3U7D A;  4W9L A;  4MJS B;  3PV1 A;  1WXM A;  2KOX A;  3MHS D;  3RUL A;  2ZCB A;  2FCM A;  4ANX A;  2JF5 A;  3DVN V;  2MW5 A;  4GDL B;  3QQ8 B;  3PSE B;  3CSF A;  4KSL C;  3WA0 A;  5L95 C;  1NDD A;  4I6P A;  5J17 A;  4CHK A;  4IWP A;  4G3X B;  3AUL A;  2DYO A;  1XD3 B;  3CMM B;  4LCD E;  2FIF A;  4KZ0 A;  2BWE S;  2O2V A;  4NPN A;  2AEH A;  4GDK A;  4IC7 B;  4FJZ A;  2L8J A;  4K7S A;  4WJN A;  4II3 B;  5L83 A;  4JQW C;  2L7R A;  3RT3 B;  3B0A A;  1T0Y A;  3C0R B;  2KLG A;  3KUZ A;  4MM3 A;  3ZUN A;  3VH4 B;  1LQB A;  1WY8 A;  1P3Q U;  4JL9 A;  5CX3 A;  3UQB A;  2ASQ A;  3RZW C;  4ICV A;  2HE7 A;  5AZH A;  4IM3 A;  4WJP A;  2NPT A;  1LFD A;  4EZJ A;  1YX5 B;  3DDC B;  3RYT A;  4KVG B;  2WX1 A;  3H1U A;  1BT0 A;  3W1S A;  3N32 A;  3HM3 A;  1WR1 A;  2N9E B;  4GN1 A;  3RCZ A;  4BOS C;  1UZX B;  2GMI C;  4FN2 A;  3A9K A;  1WX8 A;  1E8X A;  1V6E A;  2AL6 A;  2NBW B;  2JRI B;  2LD9 A;  4DXA B;  3JSV B;  5JZE B;  2OJR A;  2QHO A;  4MSM B;  2V4L A;  2GBR A;  5LLI A;  1GC7 A;  5LXH A;  4BBN F;  5GMV A;  1E8Z A;  3VXW A;  5AZF A;  1LM8 B;  4AUQ C;  5TR5 A;  2JUO A;  3ZDT A;  3DBL I;  4DHZ E;  2XK5 B;  2NCN A;  3PRM B;  3QJZ A;  3VTV A;  4ZDV A;  2MBE A;  1K8R B;  4TUU A;  1E8W A;  3RUI B;  2JRH A;  4A20 A;  4IWQ A;  3HM6 X;  4PYZ A;  2R2O A;  4HCP B;  2KTF A;  3KYC D;  2J0K A;  1F9J A;  2L00 B;  4XC2 A;  2NVU I;  5CHV C;  2MBO A;  3PRP B;  1V9J A;  2D07 B;  1WZ0 A;  1S3S G;  5E6P A;  2DZM A;  1ZKH A;  3PRE A;  5FR6 A;  1KLV A;  4IUM B;  3QK0 A;  2I1J A;  3PRZ A;  4MH0 E;  4NQK E;  1WGH A;  4GGQ A;  3M95 A;  2O6V B;  4EZL A;  1CMX B;  4DDI D;  4HXD A;  3L54 A;  2CKH B;  2D11 A;  4NNJ B;  4OVV A;  3TMP B;  1Q0W B;  4WWN A;  2KMC A;  4AOF A;  1EF5 A;  3R7Q A;  2MRP A;  4HDO A;  4A3O A;  5LXI B;  3ZW3 A;  4F8C B;  1AAR A;  2FCS A;  3Q3J A;  4FBJ B;  2CR5 A;  3ZNH B;  2KX0 A;  4B9K A;  1J0G A;  4AJY B;  4GB9 A;  4PS8 A;  1H4R A;  3AU4 A;  4JIO U;  5D94 A;  5E6O A;  1WXS A;  2ZEQ A;  3IG3 A;  4DHJ D;  4E74 A;  3A1Q A;  3R3M A;  3TBL D;  1TGZ B;  3ML9 A;  3AXC A;  3ENE A;  4IM0 A;  1SE9 A;  4HVB A;  3WAM A;  4PYU A;  4ZRK A;  2M4N A;  4II2 B;  3WAN A;  2DHZ A;  3NY5 A;  3N3K B;  5AZG A;  3PHW B;  1PQS A;  5CHW A;  2FCN A;  3H6N A;  1P9D U;  1Y8R C;  2DZJ A;  2BYV E;  1YQB A;  3ZLZ A;  2REX A;  3SU8 X;  2L76 A;  2GBN A;  3DQV A;  2XEW A;  3L13 A;  1E8Y A;  4ICU A;  1RRB A;  2CHW A;  3M63 B;  2FNJ B;  3MJW A;  3QX1 A;  3VTU A;  4DHJ B;  2BYE A;  3ALB A;  4GDK B;  3ZTC A;  4DK5 A;  3JYU A;  3K9P B;  3ZNZ B;  2NPT B;  3SHQ A;  2PJH A;  2A4Z A;  3R66 C;  4GOC A;  1Q5W B;  3JW0 X;  2V3S A;  2L0F A;  1GJZ A;  1H8C A;  1YX6 B;  4WJQ A;  2MBB B;  3H7S A;  2AWT A;  2KFK B;  1WM3 A;  3QA8 A;  4EOY A;  2KQ7 A;  3L10 B;  1WX7 A;  1V80 A;  3PZD A;  2G4S A;  2MP2 A;  3DVN U;  3IBE A;  2C7M B;  4LDT B;  4NJ7 A;  2MA9 B;  3DPD A;  4NY0 A;  1I35 A;  3LJ3 A;  2XBB C;  2L0T A;  3PTF C;  3HIZ A;  4BKS D;  4F7Z A;  1I42 A;  2FID A;  2MLB A;  2N7E A;  1WMH B;  1Z2M A;  1UH6 A;  1VCB A;  3UIO B;  2C7N B;  1WGR A;  3DBH I;  4W9F A;  3ZDM C;  2KDF B;  3UQA A;  3VFK A;  2O6V D;  4TQ0 A;  2XK5 A;  2Z0D B;  1TTN A;  4DBG A;  1A5R A;  3ZVV A;  1L7Y A;  4WWO A;  2IO0 B;  2WX0 A;  1D3Z A;  3QAQ A;  2IZV B;  3QIJ A;  3BY4 B;  4MDK E;  3M62 B;  2K1F A;  4NAW B;  4E3C A;  2MSE D;  2KMA A;  3DOW A;  2Z59 B;  1GNU A;  1WI0 A;  1WF9 A;  3N30 A;  2KC1 A;  4MEM A;  4WJO A;  1KOT A;  5BO4 B;  3W1S C;  2M17 A;  4CO7 A;  2CU1 A;  1EO6 A;  4RM9 A;  4M0W B;  3UGB B;  2O6V A;  4HDQ A;  2CS4 A;  2CHZ A;  2K8B A;  2KO3 A;  2EKE C;  3BIN A;  3IVF A;  2GBJ A;  4ASW C;  5J2R A;  4MEL A;  4W9E A;  2WDT B;  4W9J A;  3ZRC A;  2N1W A;  2M0X A;  3A4S C;  3EEC A;  1MG8 A;  3H7P B;  3APD A;  3QWZ B;  3NS8 A;  3T9L A;  4E71 A;  3HHM A;  4BKS A;  2IY0 B;  1X1M A;  1YD8 U;  2KX3 A;  4IWO A;  5EDS A;  2UYZ B;  5C1Z A;  2W9N A;  2GBM A;  4MJS A;  1WYW B;  2KAN A;  4GMV A;  3TIX A;  3OLM D;  1WFY A;  2JPH A;  3ONS A;  4W9I A;  3QHT A;  4HPM B;  2IYD B;  3IHP C;  1WH3 A;  3A1Q B;  4GDL A;  4K7W A;  4KIK B;  1Q1O A;  2RR9 A;  2LXA A;  3V62 A;  2N9X A;  1S1Q B;  4P7I A;  3B1L X;  1WRD B;  5JHB A;  3VUW A;  2WYQ A;  2LGY A;  3H7P A;  2AL3 A;  2LUE A;  3V61 A;  2C7H A;  1TZ1 A;  2NR2 A;  2I1K A;  3ZRF A;  1WIA A;  1V5T A;  4RMA A;  5G2N A;  1WZ3 A;  2KDB A;  4AWJ A;  4W9G A;  1HE8 A;  3UIP B;  1TBE A;  2LVO A;  4ZRI A;  3VUX A;  1GUA B;  3OJ4 B;  5J18 A;  4MGK E;  4I6N B;  2K25 A;  4G0N B;  5D7G A;  3GOE A;  2L05 A;  2IO1 B;  1SIF A;  3LDZ E;  3PLV A;  2CHX A;  2JZZ A;  3KH0 A;  2PEA A;  3MTN B;  1WX9 A;  2KJH B;  4HCN B;  4B95 A;  2GBK A;  3NOB A;  4KSK C;  2AYO B;  5IAA C;  2KQS A;  4CYE A;  5JHA A;  4MGI E;  3UIN B;  1V2Y A;  4FAD A;  3T8M A;  1WJ4 A;  1KJT A;  2K6Q A;  3U30 A;  2DYM A;  3DBS A;  4M8N A;  4DHZ B;  1UBI A;  2EMS A;  4BKT A;  2IY1 B;  2V1Y A;  2KDI A;  1YIW A;  4WQO B;  1SGH A;  3S2A A;  1VD2 A;  2Y5B B;  1OQY A;  4BVU C;  5DPR A;  4W9C A;  1P1A A;  4MGY E;  2MWS B;  2MCN B;  2VRR B;  3PPA A;  2LXC A;  1OEY J;  3QC8 B;  4W9H A;  5D2M B;  4MSQ B;  3APC A;  4HWI B;  2O2V B;  2MP2 B;  1M94 A;  4LDT D;  3OAW A;  3JSV A;  4PS3 A;  3SD5 A;  1WGY A;  2ZCC A;  3P2B A;  3WAL A;  3L17 A;  3KVF B;  2G45 B;  4GSW A;  3SDL C;  3H9D A;  4EFO A;  2YVC A;  4B6W A;  4URK A;  3RD2 A;  3KUD B;  1WJ6 A;  5DCN A;  3PS6 A;  2FAZ A;  4FJY A;  3VHT C;  5E6N A;  1R4M I;  4LJP B;  2K39 A;  4ANW A;  3QCA A;  2MBQ A;  2IO3 B;  2N4F A;  2N9P C;  3WIM A;  4FA6 A;  1E7V A;  2BYF A;  3AI5 A;  2FCQ A;  2K6D B;  4PS7 A;  1IP9 A;  2JT4 B;  2KWU B;  2KLC A;  2ZNV C;  1WJN A;  2FUH B;  4W9D A;  3TCA A;  3VUY A;  2LVQ A;  5CTR C;  2B3A A;  3ZIM A;  2BGF A;  2BKR B;  3ZNG C;  4G11 A;  1WMH A;  4KZC A;  2OOB B;  1JRU A;  5C23 A;  2YLM A;  4FJV B;  4KV2 A;  1WXV A;  1P0R A;  3A33 B;  3ZKJ C;  1J8C A;  2LVP A;  2KJR A;  1OTR B;  2BPS A;  3K9O B;  1RLF A;  2RPQ A;  2PE9 A;  3A4R A;  3A9J A;  4EUT A;  3KW5 B;  2D10 A;  2DEN B;  1WJU A;  3VDZ A;  5DPT A;  2HTH A;  3L0W B;  2KTR A;  2KDE B;  4MGZ E;  4FHJ A;  2JY6 A;  1OEY A;  4LJO B;  5DPW A;  2NBU A;  1NI2 A;  2DYB A;  5D6J B;  1WGD A;  5JH5 C;  3DBR I;  3ZTD A;  1WGG A;  2LRW A;  4KDI C;  1WM2 A;  1XT9 B;  2LGD A;  2R2Q A;  4FHK A;  1QZE A;  4BOZ B;  1WE6 A;  3KYD D;  3R7R A;  2ZZP B;  4NJ6 A;  3VAW A;  3A9J B;  3ML8 A;  3IFW B;  4IG7 B;  1G6J A;  2G3Q B;  2KD0 A;  4IW0 A;  3NZU A;  3V60 A;  2LJ5 A;  2GOW A;  2D3G A;  2KWC A;  1RFA A;  4A3P A;  2JVC A;  5AEK B;  4XZ4 A;  1WR6 E;  2JXX A;  5IA7 A;  1C3T A;  2HJ8 A;  2K8C A;  2KZR A;  1EUV B;  2BF8 B;  2J0J A;  1ZGU B;  1GC6 A;  4DWF A;  1U4A A;  3M3J A;  3L16 A;  2KK8 A;  2LGX A;  3PGE A;  1V86 A;  4RM8 A;  4TV3 A;  2MQJ A;  4JLC A;  3PVL A;  2JZ3 B;  3X0W A;  3OJ3 A; 
#chains in the Genus database with same CATH topology
 2ZVO A;  2KN5 A;  2LUM A;  1V5O A;  3ZO5 B;  1FMA D;  1TKG A;  1RWS A;  4C80 A;  3PLU A;  3P42 A;  1XLN A;  2WXI A;  1N5X A;  4N6E B;  1QQR A;  1E7U A;  2W82 A;  1EF1 A;  2EEL A;  4YL8 A;  3DHG C;  4ARI A;  1ZE3 D;  2Z0E B;  2J0M A;  2RSU A;  3AU5 A;  2RGF A;  1FXT B;  3DBH B;  4YT0 B;  1OGW A;  4J6I A;  3NHE B;  2BVC A;  3NUH B;  1N6Z A;  4FUL A;  4NAW A;  4BKG A;  4OVU A;  2D3A A;  4EZK A;  3AV8 A;  2HJ1 A;  2UWQ A;  3HK0 A;  1WWT A;  2WXN A;  1IYF A;  4HK2 A;  1XO3 A;  2LZ6 A;  2KVR A;  2M56 B;  1IBX B;  5G5H A;  4GIV A;  5T8I A;  4OW0 A;  2BWF A;  3EHV A;  1XQQ A;  3TEX A;  1P7E A;  5AUK A;  5LNK 1;  2KC2 A;  3CWI A;  3DCG A;  3V6E B;  3MJ5 A;  1VR9 A;  1KM7 A;  1NEK B;  2VZK B;  1JCK B;  2DNF A;  3KUC B;  2C5L C;  3ZNI D;  3PT2 B;  4AQ7 A;  4ANV A;  1SF0 A;  2KNB A;  3DBR B;  3NG0 A;  3BYT B;  1ZW7 A;  3BYY B;  2JWZ A;  2I2Y A;  4LNO A;  2W54 A;  1WE7 A;  4A6Q A;  2KOX A;  2ZCB A;  3AEF B;  5L95 C;  5J17 A;  4O1N A;  2DYO A;  3CMM B;  4LCD E;  2L8J A;  4WJN A;  2JU6 X;  2HTM E;  3PZ8 A;  3B0A A;  5D3D A;  3C0R B;  3ZUN A;  3VH4 B;  1SEB D;  2H89 B;  1FEH A;  1FFV A;  1TZO A;  3UQB A;  5JXV A;  2ASQ A;  2HE7 A;  2NPT A;  1LFD A;  2JQR B;  1YX5 B;  3AE2 B;  2QMT A;  3H1U A;  2IPK D;  2N9E B;  3RCZ A;  1UZX B;  1SXT A;  2GMI C;  1E8X A;  3C19 A;  2NBW B;  2W3S A;  2E3T A;  1ZUD 2;  3Q69 A;  5LXH A;  4K3B A;  4AUQ C;  2ON8 A;  3PRM B;  3QJZ A;  4ZDV A;  2L32 A;  2JRH A;  4A20 A;  4HCP B;  2J0K A;  4DQO C;  2FE8 A;  1L5P A;  3AM9 A;  3VRB B;  4A8X C;  3KLS X;  1S3S G;  2DZM A;  1ZKH A;  3PRE A;  4N58 A;  5D3I B;  4NQK E;  1WGH A;  3M95 A;  4ZOH C;  4EZL A;  1CMX B;  4HXD A;  2VH2 A;  4L1B A;  2MJE A;  5LXI B;  4B0E A;  3ZW3 A;  2FCS A;  3Q3J A;  5IN7 A;  5C2T B;  1J0G A;  1H4R A;  3IG3 A;  1KLU D;  3IAM 1;  2R61 A;  1B1Z A;  3TBL D;  1ROE A;  4HVB A;  3WAN A;  4P6V F;  5H8Y E;  1K50 A;  3PHW B;  1P9D U;  1Y8R C;  3ZXR A;  3H8H A;  3NVW A;  3SU8 X;  1MVK A;  3DQV A;  3L13 A;  1E8Y A;  2FNJ B;  4GDK B;  3RNG C;  5BYQ A;  1D5X C;  3R66 C;  3FKY A;  1Q5W B;  2V3S A;  3B9J A;  2L0F A;  1WXQ A;  2AWT A;  1ZXI A;  1FM0 D;  2Y5C A;  2G4S A;  2NMQ A;  3DVN U;  3WCQ A;  4NJ7 A;  2VH1 A;  2MA9 B;  1F52 A;  2N7E A;  1XXG A;  5FK9 C;  2Y3A A;  4S0R A;  1WGR A;  4TMA B;  4KX6 B;  4TQ0 A;  4NZL B;  1A5R A;  5IP4 D;  5IO9 A;  4M02 A;  1EM7 A;  3RNB C;  2WX0 A;  2V3N A;  2K1F A;  4E3C A;  4C4V A;  2KC1 A;  2M17 A;  2CU1 A;  3ZGZ A;  1V97 A;  2LHD A;  3U52 E;  4XGA B;  1Q10 A;  2K8B A;  3RNA C;  4ASW C;  5FR3 A;  1F1H A;  2I38 A;  3EEC A;  4E71 A;  3ETR A;  2B76 B;  1P7F A;  1X1M A;  2KX3 A;  4C4V B;  2UYZ B;  2W9N A;  4W9I A;  3T3N A;  4US8 A;  1XF5 L;  2KYW A;  3IHP C;  1L4D B;  4KIK B;  3BII D;  3V62 A;  1WRD B;  2WYQ A;  3H7P A;  2AL3 A;  3V61 A;  3ZRF A;  1SJH D;  2WXJ A;  1WZ3 A;  2KDB A;  1HE8 A;  1TBE A;  4A9A A;  1TYG B;  5HFY A;  2L05 A;  2INP E;  1TKE A;  4LNN A;  2CHX A;  1WX9 A;  2KJH B;  1L0X B;  2GBK A;  4CYE A;  3HVD A;  1WJ4 A;  2AX5 A;  2DYM A;  3DBS A;  2EMS A;  2V1Y A;  1SGH A;  2LMC A;  1VJK A;  3AN1 A;  2Y5B B;  1PUT A;  1I4X A;  4JX1 C;  1QF6 A;  1P1A A;  2MCN B;  2LXC A;  5IKC M;  1M94 A;  4MT5 A;  2WP9 B;  3P2B A;  3AE6 B;  4WH4 A;  4EFO A;  1JRP A;  4B6W A;  1T0S C;  2K22 A;  2BYF A;  4M01 A;  4MH8 A;  1QOG A;  3I5J C;  2KWU B;  1WJN A;  1XCT L;  4W9D A;  5CTR C;  2B3A A;  2GLS A;  3AEG B;  4YXD B;  2J53 A;  3N1Z C;  2G9H D;  3TEW A;  1FNU A;  2WXH A;  2LVP A;  2ZW1 A;  2BPS A;  3K9O B;  1SB3 C;  3A4R A;  2PE9 A;  4WUR A;  2D10 A;  2DEN B;  1FPY A;  1WJU A;  2LHE A;  3VDZ A;  2HTH A;  2OED A;  2KTR A;  3L0W B;  2KDE B;  4FHJ A;  3GS2 A;  1OEY A;  1GB1 A;  4B0M A;  5EE3 A;  3V3X A;  2V4I B;  1WGG A;  1L0V B;  2LRW A;  1L6V A;  3VR9 B;  3GP7 A;  1WE6 A;  3R7R A;  2G3Q B;  4IW0 A;  3NZU A;  2LGI A;  1JAL A;  1VZ8 A;  3U2S C;  1EU3 A;  1WR6 E;  1TS3 A;  2JXX A;  1YN4 A;  1JML A;  1ZGU B;  1U4A A;  3PGE A;  4J3O D;  1BML C;  2LEK A;  2W55 A;  1C9F A;  3E56 A;  3X0W A;  1C76 A;  2K5P A;  2M19 A;  3DVG X;  4C7Z A;  2ZNV B;  1HZ6 A;  3NZ3 A;  2JX5 A;  2C9W B;  2NTS A;  3BWU D;  4I6L B;  5DPS A;  4IM2 A;  4RGT A;  3Q3F A;  3A9K B;  2ZVN A;  1SE4 A;  4K7U A;  2BKF A;  2QCZ A;  4P1B C;  2LI5 A;  3KWL A;  3TJP A;  1M4V A;  3ECI A;  4XDD A;  2M0A A;  1GG3 A;  3V6C B;  2WWZ A;  4KDL B;  2RDB C;  1P98 A;  2M1M A;  3WAO A;  1E7P B;  1V1O A;  2IBI B;  2J7Q B;  4AP4 C;  4ANU A;  3ZXV A;  2QEJ C;  1QT9 A;  2KHW B;  3R2T A;  1WXA A;  4TSS A;  3JVZ X;  1C1Y B;  4PK1 A;  3IXS A;  4A90 A;  1R4N I;  1L2N A;  3ZQ4 A;  1ZDX A;  2INC C;  3CF6 E;  1GAQ B;  3L08 A;  2ZPN A;  4M8M A;  2J52 A;  2MBH A;  1T0Q C;  4HJG E;  4A55 A;  2WS3 B;  3D32 A;  3SFD B;  4WWP A;  1D5Z C;  5C3J B;  2RDH A;  2L1A A;  2N1V A;  4HPL B;  4HKZ E;  2N7D A;  3BVZ A;  1C4A A;  4MAC A;  4JPS A;  2NBV B;  1MI0 A;  1IGC A;  4ANX A;  2FCM A;  3BVG A;  2JF5 A;  3Q3M C;  1FD6 A;  1HQR D;  4MM3 B;  3QQ8 B;  2LGS A;  1NDD A;  4I6P A;  4US9 A;  5G5G A;  1C78 A;  1MHX A;  4CHK A;  1XD3 B;  3P4R B;  2FIF A;  4KZ0 A;  2BWE S;  4UDU C;  2O2V A;  1MHH E;  4IC7 B;  4FJZ A;  3C8Y A;  1PGX A;  4JQW C;  3RT3 B;  1T0Y A;  3KUZ A;  2BW2 A;  3GE8 C;  4XDC A;  1LQB A;  3FIL A;  5EE0 A;  4JL9 A;  3NJT A;  3RNF C;  3V05 A;  2ICI A;  5TSS A;  3HVZ A;  4EZJ A;  4KVG B;  3IT6 B;  2PVG C;  2QC8 A;  3W1S A;  4BOS C;  2LFI A;  3RPF C;  4FN2 A;  1WX8 A;  1F77 A;  1V6E A;  5BMI A;  4RH6 A;  4DXA B;  3JSV B;  2QHO A;  4XYC A;  4MSM B;  2K3U A;  5GMV A;  1E8Z A;  5TR5 A;  2JUO A;  3AE1 B;  3DBL I;  3VTV A;  2MBE A;  2IGH A;  1K8R B;  5BMH A;  4HEA 1;  4TUU A;  3Q8F A;  3RUI B;  2WGS A;  3HM6 X;  1I4Q A;  5H92 C;  2BTE A;  4XC2 A;  2NVU I;  5CHV C;  3P63 A;  1ENF A;  1ET9 A;  1V9J A;  4JE3 B;  5FR6 A;  1UNS A;  2O6V B;  3AED B;  3L54 A;  2CKH B;  3TMP B;  2MRP A;  4A3O A;  1AAR A;  1CQV A;  2KX0 A;  4B9K A;  1IUE A;  5E6O A;  2ZEQ A;  3A1Q A;  3R3M A;  1TGZ B;  4HRS A;  1FXA A;  2WU2 B;  3ENE A;  1I4H A;  1DOY A;  1V8C A;  4ZRK A;  1E6E B;  2X8X X;  2DHZ A;  3NY5 A;  4KKJ A;  5AZG A;  5CHW A;  2FCN A;  3H6N A;  2ACZ B;  4JWU C;  1R7S A;  2OJW A;  1TT5 B;  1YQB A;  2YEP B;  4REZ A;  2L76 A;  4L23 A;  3U7Z A;  2BS4 B;  2CHW A;  3M63 B;  3VTU A;  2BYE A;  3ZTC A;  4DK5 A;  3JYU A;  3K9P B;  4BZA A;  3J9C A;  3NVY A;  4ITK A;  2DLB A;  2MBB B;  3QA8 A;  1WM3 A;  1LGR A;  1WX7 A;  1V80 A;  3PZD A;  2MP2 A;  3IBE A;  4LDT B;  3O13 A;  3EA6 A;  1I35 A;  3LJ3 A;  4LNI A;  2L0T A;  2MLB A;  1Z2M A;  1UH6 A;  1VCB A;  2QSD A;  2KDM A;  4RNA A;  3SEB A;  3UQA A;  1XLO A;  4WWO A;  2IO0 B;  2WXM A;  3QAQ A;  2LJI A;  3M62 B;  2KMA A;  4K3C A;  1WI0 A;  2D5G A;  2Q5W D;  1HTQ A;  2PIA A;  3UGB B;  2O6V A;  2CHZ A;  2KO3 A;  3BIN A;  3DHI C;  4MEL A;  4W9E A;  2IGG A;  3P4Q B;  4W9J A;  2N1W A;  3W9C B;  3HHM A;  1YD8 U;  4IWO A;  2BQQ A;  1EU4 A;  4RCO A;  3TIX A;  4OHJ A;  1WFY A;  2JPH A;  1QOA A;  1UWX A;  4HPM B;  1TY0 A;  2SAK A;  1WH3 A;  2XN9 C;  3A1Q B;  3EFC A;  1Q1O A;  2RR9 A;  3B1L X;  2RPV A;  1ESF A;  5JHB A;  2LGY A;  3DWG C;  4YTM B;  3R2I A;  4HKQ A;  2NR2 A;  1WIA A;  5G2N A;  2VZK D;  1GUA B;  3OJ4 B;  3NRZ A;  2IO1 B;  1SIF A;  4Q2J A;  5HI1 A;  3LDZ E;  2JZZ A;  2WXO A;  3KH0 A;  4KGT A;  5BMG A;  4B95 A;  2AYO B;  5IAA C;  1J7C A;  3UIN B;  2K6Q A;  3U30 A;  4DHZ B;  2KAC A;  1WYG A;  2KDI A;  1PDX A;  1VD2 A;  1OQY A;  4BVU C;  2MWS B;  3PPA A;  3GE3 C;  4MSQ B;  2WXP A;  5IOI A;  2L52 A;  4YWG G;  1UWM A;  4XWT A;  1WGY A;  3WAL A;  2MEK A;  3L17 A;  3AEA B;  2G45 B;  3H9D A;  4URK A;  2UU7 A;  3VHT C;  4FJY A;  1ACC A;  3WIM A;  2IO3 B;  4FA6 A;  1K51 A;  1E7V A;  2K6D B;  3KQ4 A;  2ZNV C;  3VUY A;  2IJ0 A;  2BGF A;  1FRR A;  3ZNG C;  4G11 A;  1I4G A;  5C23 A;  4FJV B;  1NVI D;  2XNA C;  3ZKJ C;  2KJR A;  4EUT A;  1YOV B;  4HPP A;  3FC4 A;  2BYT A;  3W5V B;  4WQM A;  1NI2 A;  1WGD A;  2H88 B;  4IOI E;  3DBR I;  3SR6 A;  3ZTD A;  1ZXH A;  1WM2 A;  2LGD A;  2R2Q A;  1QZE A;  1T5X D;  4XE0 A;  4NJ6 A;  1I4P A;  3VAW A;  3IFW B;  2KAJ A;  2MH7 A;  3Q8E A;  1F2R I;  3UI3 A;  3AEE B;  3AH7 A;  2D3G A;  1DOX A;  1RFA A;  4A3P A;  5AEK B;  3MC9 A;  3DBL B;  2KZR A;  1EUV B;  4DWF A;  4N59 A;  1HTO A;  1KFY B;  4RM8 A;  1TKY A;  3PO0 A;  1DGJ A;  3OJ3 A;  2WDR B;  1YJ1 A;  2N9K A;  4DDG D;  1Z5S B;  1J19 A;  2G4D B;  1VZ7 A;  1E90 A;  1UUP A;  2ZPY A;  3TEY A;  1UD7 A;  2KJ6 A;  4EKU A;  4F1S A;  3O65 B;  1V1P B;  1ZDV A;  3LXF A;  1MPE A;  2MX2 A;  1V81 A;  4AJW A;  2Z8L A;  3APF A;  5G55 A;  4LK0 M;  5FKA C;  1JW9 D;  3UF8 A;  2HDE A;  1N60 A;  2DZK A;  2PPH A;  4GU2 A;  3RN9 C;  2K8H A;  1BXT A;  2BS2 B;  1SE2 A;  4BBN C;  4WAA A;  4XX5 A;  3WAP A;  1V49 A;  4GXB A;  2KFJ A;  2CJO A;  2HD5 B;  3P4S B;  1SSN A;  1LXD A;  4W9K A;  2KKC A;  4K1R B;  2EMT A;  2WXQ A;  2A5U A;  2C60 A;  4BFR A;  4FLH A;  2KQ4 X;  1NBF C;  3ZJT A;  3VQI A;  2LAS A;  4KIK A;  5KHQ A;  1C4C A;  4RF1 A;  3W1Y A;  2KTR B;  2KWV B;  3PHX B;  5BYR A;  1J7B A;  4G50 A;  1E5W A;  2CU3 A;  2AQ1 B;  3N20 C;  1IPG A;  1L6U A;  1A70 A;  2KWD A;  4TKN A;  4X57 B;  1MG4 A;  1D6E C;  5HKH A;  3Q3N C;  3MFG A;  4NQL B;  1XLQ A;  2RD0 A;  3EFU A;  4W9L A;  3RFZ B;  1VZ6 A;  1WXM A;  3MHS D;  3PV1 A;  3DVN V;  4GDL B;  3PSE B;  3CSF A;  1FCC C;  4KSL C;  3WA0 A;  1KH0 A;  4D2K A;  4ARC A;  4II3 B;  3IAS 1;  5L83 A;  2WNM A;  1B9R A;  2KLG A;  1K53 A;  3ZJV A;  1KTK A;  1WY8 A;  3BZD B;  5CX3 A;  4XWW A;  1YQ4 B;  3RZW C;  4ICV A;  3AE3 B;  1FFU A;  4RGO S;  4WJP A;  1JRO A;  3RYT A;  1BT0 A;  1WR1 A;  3AB5 A;  3A9K A;  1GB4 A;  3OG5 A;  1BUI C;  2LD9 A;  2FBW B;  1MFW A;  2V4L A;  2GBR A;  5LLI A;  4BBN F;  4HRO A;  2NCN A;  1TS2 A;  2MJD A;  4IWQ A;  1SBB B;  2R2O A;  2KTF A;  1ZP0 B;  1HA5 A;  3PRP B;  5E6P A;  1WGK A;  4MH0 E;  3FAH A;  2V0G A;  1JQ4 A;  2K0P A;  4OVV A;  4WWN A;  1EF5 A;  2N7J A;  2AQ2 B;  3I57 A;  1JWB D;  4FBJ B;  2CR5 A;  3ZNH B;  4GB9 A;  4PS8 A;  4JIO U;  3AU4 A;  2WXK A;  3CIR B;  4DHJ D;  1YJJ A;  4E74 A;  4ZHO A;  4KGR A;  3WAM A;  4PYU A;  4II2 B;  1T6B X;  2G1E A;  4IDI A;  2X38 A;  1F2R C;  2BYV E;  1C79 A;  3RNE C;  3Q6B A;  1I4R A;  2REX A;  1N61 A;  2GBN A;  1PFD A;  2XEW A;  2WDV B;  4ICU A;  1RRB A;  4JWS C;  3QX1 A;  2JXT A;  4DHJ B;  3SFE B;  1IGD A;  3ZNZ B;  4C00 A;  2NPT B;  2D3C A;  2QIL A;  2GRI A;  2NTT A;  2IGD A;  3AE9 B;  2N9L A;  1GJZ A;  1YX6 B;  3B2G A;  3H7S A;  3HUI A;  2KFK B;  5EE1 A;  1N5W A;  5I4D A;  2KQ7 A;  3L10 B;  1PGA A;  3MHZ A;  5MPO A;  3PTF C;  3HIZ A;  4F7Z A;  1I42 A;  2FID A;  3UIO B;  4NJC A;  1QIL A;  3LYY A;  4DXG A;  1AW7 A;  2KDF B;  4RFB A;  2O6V D;  4EE2 A;  2Z0D B;  4DBG A;  1L7Y A;  1JWA D;  4BAX A;  1D3Z A;  2IZV B;  3BY4 B;  4GLS C;  4NAW B;  5HHD G;  4LLG M;  2GB1 A;  3DOW A;  1GNU A;  1WF9 A;  3N30 A;  4MEM A;  1KOT A;  5BO4 B;  3W1S C;  4ACF A;  4M0W B;  2KN4 A;  3AE7 B;  4HDQ A;  3IVF A;  3ZRC A;  3QWZ B;  2M0X A;  3A4S C;  3H7P B;  3T9L A;  3APD A;  4BKS A;  2IY0 B;  1DYQ A;  3TSS A;  2GBM A;  4MJS A;  1QOF A;  3OLM D;  2WXL A;  3ONS A;  3QHT A;  2IYD B;  3W5U B;  2LXA A;  1S1Q B;  4P7I A;  3VUW A;  2C7H A;  1TZ1 A;  1KF6 B;  2I1K A;  1OFF A;  1V5T A;  4RMA A;  1C77 A;  4AWJ A;  4W9G A;  3UIP B;  1JWM D;  2LVO A;  4ZRI A;  5J18 A;  1FCL A;  4MGK E;  3IT4 B;  5D7G A;  3GOE A;  1XLP A;  3PLV A;  3MTN B;  5BYS A;  2PEA A;  1NYQ A;  4HCN B;  1QLB B;  2KQS A;  2WHI A;  4LNF A;  1V2Y A;  4FAD A;  3T8M A;  1VDV A;  1AWD A;  2IY1 B;  1JWU D;  4WQO B;  1TS4 A;  4M00 A;  2QIE B;  4W9C A;  1RFK A;  1OEY J;  4W9H A;  5D2M B;  2MJ3 A;  3APC A;  4LDT D;  2PLP A;  3OAW A;  3JSV A;  1CZP A;  4H2A A;  4OZA A;  3KVF B;  1FIQ A;  4GSW A;  3SDL C;  3DHH C;  2YVC A;  1MJD A;  1NI3 A;  1WJ6 A;  5DCN A;  3PS6 A;  1R4M I;  4RF0 A;  2K39 A;  2N4F A;  1E0Z A;  4PS7 A;  1IP9 A;  2JT4 B;  2KLC A;  3TCA A;  2LVQ A;  1N63 A;  1UF0 A;  4WAF A;  3GZN B;  2BKR B;  3RI7 C;  1WMH A;  2OOB B;  1T3Q A;  4KV2 A;  1WXV A;  2AQ3 B;  4M0W A;  1J8C A;  3P1M A;  1OTR B;  2JYE A;  1RLF A;  3NVZ A;  2RPQ A;  2YEP F;  3A9J A;  3N9Y C;  1YMH E;  5DPT A;  4C7Y A;  2JY6 A;  4DXF A;  2NBU A;  2DYB A;  4FXC A;  4WIP A;  2BB5 A;  1XT9 B;  3BK1 A;  3DWM A;  3A9J B;  3Q14 C;  4IG7 B;  1G6J A;  3PZ7 A;  1HEZ E;  2W3R A;  5E6J A;  4YSZ B;  1KLG D;  2JZP A;  2JVC A;  2DBY A;  4XZ4 A;  3TUO A;  1C3T A;  2J0J A;  1GC6 A;  1V86 A;  4TV3 A;  2MQJ A;  3MP9 A;  3PVL A;  4N9F 4;  2JSV X;  2L3Z A;  3I3T B;  1WRI A;  4IKG A;  5CHF A;  1YQ3 B;  2PTL A;  1ZOY B;  1F0Z A;  2DAF A;  2DZI A;  2LRU A;  1J7A A;  3AE4 B;  1UGM A;  4HLE A;  3I63 C;  1STE A;  3VRA B;  3VH3 B;  2GI9 A;  5KHO A;  3B08 A;  3Q8A A;  3CST A;  2DX5 B;  1UBQ A;  1RAX A;  1ISN A;  3W2D A;  1UEL A;  1T0R C;  3NZS A;  4ZYN A;  1CJE A;  3Q3O C;  1K52 A;  4HJK A;  2IDY A;  2LWP A;  4C56 C;  3RZF A;  1XCQ L;  2KFK A;  3B2F A;  3GZN I;  2EKI A;  2K9X A;  3AE5 B;  3TL5 A;  2JWU A;  2DAJ A;  3U8Z A;  3DVG Y;  2IO2 B;  2PE6 B;  2ZJD A;  3BVM A;  1FO4 A;  3MC0 B;  1R4M B;  4P16 A;  3X23 A;  2KXJ A;  2Y5P A;  4JGH B;  1ZPS A;  3RNC C;  1EWY C;  3QAR A;  2KMM A;  4KGS A;  3EC8 A;  3E9S A;  2QDF A;  5GXG B;  2M8S A;  4ZRJ A;  4K81 A;  1WSP A;  1TJE A;  4EEW A;  2MHJ A;  4RGM A;  2NS5 A;  2D2Q A;  3VVW B;  4TQ1 A;  3VTW A;  3U7D A;  4MJS B;  3RUL A;  2JYT A;  1VRA B;  2MW5 A;  2WDQ B;  3U4E G;  4P1C C;  3FIL B;  1RYJ A;  4AS1 A;  4IWP A;  4G3X B;  3AUL A;  4NPN A;  2AEH A;  4GDK A;  4NAM A;  4K7S A;  3NS1 A;  2L7R A;  3MC8 A;  2PMV A;  3P4P B;  4MM3 A;  3EUB 2;  1EWC A;  1P3Q U;  4ZYS A;  2TSS A;  5AZH A;  4IM3 A;  1OQQ A;  4ZHP A;  3ABV B;  3DDC B;  1NEN B;  2WX1 A;  1GPX A;  2CJN A;  1E9M A;  1QOB A;  2WU5 B;  2WXG A;  3HM3 A;  3N32 A;  4GN1 A;  3L4P A;  4KKI A;  2AL6 A;  2IND C;  3R8B A;  2JRI B;  3BK2 A;  2OJR A;  5JZE B;  1HXY D;  2SEB D;  1GC7 A;  3VXW A;  5AZF A;  1LM8 B;  3ZDT A;  2PVO D;  4DHZ E;  2XK5 B;  2L83 A;  2WLB A;  1E8W A;  3AE8 B;  2KVZ A;  4RGN A;  4PYZ A;  1IBX A;  3KYC D;  1F9J A;  2L00 B;  2MBO A;  2D07 B;  1I7H A;  2E6X A;  1WZ0 A;  1QKZ A;  1YJI A;  1KLV A;  4IUM B;  3QK0 A;  2I1J A;  3PRZ A;  1FRD A;  4YTN B;  4ZRQ A;  4GGQ A;  3URY A;  3Q8B A;  1RM6 C;  1CK1 A;  4DDI D;  2D11 A;  2ONQ A;  4NNJ B;  4YSX B;  1Q0W B;  1TS5 A;  2KMC A;  4AOF A;  3R7Q A;  4HDO A;  1E10 A;  1FXI A;  4F8C B;  1VLB A;  4AJY B;  5D94 A;  1WXS A;  2ZW0 A;  3ML9 A;  3AXC A;  1PYW D;  4IM0 A;  1SE9 A;  3AEC B;  2BS3 B;  5HG2 A;  2FUG 1;  2M4N A;  1PGB A;  1UGJ A;  3N3K B;  1V1P A;  1PQS A;  2DZJ A;  1HZ5 A;  3N1X C;  3ZLZ A;  1AYF A;  3Q8C A;  3MJW A;  2PKO A;  3ALB A;  3KWV A;  3Q2A C;  3SHQ A;  2INN E;  2PJH A;  2A4Z A;  4GOC A;  4R3D A;  3JW0 X;  1FNW A;  1H8C A;  4WJQ A;  1SJE D;  1JWS D;  4EOY A;  2V3P A;  2C7M B;  2BB6 A;  3DPD A;  4NY0 A;  2XBB C;  4S17 A;  3OWE B;  4BKS D;  2OHF A;  1WMH B;  3TEZ A;  2C7N B;  3DBH I;  4W9F A;  3ZDM C;  4CQN A;  4YSY B;  3VFK A;  2XK5 A;  1TTN A;  4WWM A;  3ZVV A;  1N62 A;  1D4B A;  3QIJ A;  4MDK E;  3N1Y C;  1LO5 D;  2MSE D;  2Z59 B;  3EGR A;  4WJO A;  4CO7 A;  4USA A;  1EO6 A;  4RM9 A;  1DOI A;  2RDG A;  2CS4 A;  2EKE C;  1D5M C;  2GBJ A;  5J2R A;  2WDT B;  1YN3 A;  1MG8 A;  3NS8 A;  5EDS A;  3T3O A;  2N0S B;  5C1Z A;  1OQR A;  1Y56 A;  4YTP B;  4QAY A;  1WYW B;  2KAN A;  4GMV A;  1YN5 A;  1GOZ A;  4K7W A;  4GDL A;  2N9X A;  4OVZ A;  3RMK C;  1NYR A;  1TY2 A;  2LUE A;  1AN8 A;  1TIF A;  3VR8 B;  3VUX A;  1R4N B;  3GB1 A;  1C4P A;  1L0Y B;  4I6N B;  2K25 A;  3AMZ A;  4G0N B;  1FNV A;  3NOB A;  4KSK C;  5JHA A;  4MGI E;  1KJT A;  4M8N A;  1UBI A;  4BKT A;  2BT6 A;  3ZYY X;  4LNK A;  1YIW A;  3S2A A;  5DPR A;  2PW9 A;  1SE3 A;  4MGY E;  2QJL A;  2VRR B;  1SIJ A;  4L2Y A;  3QC8 B;  4HWI B;  3AEB B;  5AUI A;  2O2V B;  2MP2 B;  2J4X A;  4PS3 A;  3SD5 A;  2ZCC A;  1ET6 A;  2RMM A;  2DWQ A;  5EE9 A;  3RD2 A;  3KUD B;  2FAZ A;  5E6N A;  4LJP B;  4ANW A;  3QCA A;  2MBQ A;  2N9P C;  3AI5 A;  2FCQ A;  2V9H A;  2FUH B;  3ZIM A;  4KZC A;  1JRU A;  2YLM A;  3I9V 1;  1KRH A;  1P0R A;  3A33 B;  3LB8 C;  4LTU A;  2WQY B;  3KW5 B;  3HRD D;  4MGZ E;  4LJO B;  5DPW A;  1YNT E;  4OZB A;  5D6J B;  4OZC A;  2KT7 A;  5JH5 C;  4PT5 A;  3ZJU A;  4KDI C;  4FHK A;  4BOZ B;  3KYD D;  2ZZP B;  3ML8 A;  2KD0 A;  3V60 A;  2LJ5 A;  2GOW A;  2WXR A;  3NVV A;  2KWC A;  2WXF A;  5IA7 A;  2HJ8 A;  2K8C A;  2J42 A;  2BF8 B;  4ZRP A;  3M3J A;  3L16 A;  2KK8 A;  2BBC A;  2LGX A;  1XEE A;  4JLC A;  2JZ3 B;  1L4Z B;  2D3B A; 
#chains in the Genus database with same CATH homology
 2ZVO A;  2KN5 A;  1YJ1 A;  4DDG D;  1V5O A;  1Z5S B;  4N9F 4;  1J19 A;  2L3Z A;  3I3T B;  3ZO5 B;  2G4D B;  3DVG X;  1E90 A;  5CHF A;  3PLU A;  2ZNV B;  2ZPY A;  1UD7 A;  2KJ6 A;  4EKU A;  4F1S A;  2DAF A;  3O65 B;  2DZI A;  2LRU A;  1UGM A;  4HLE A;  2MX2 A;  1V81 A;  2C9W B;  4AJW A;  3APF A;  1E7U A;  1EF1 A;  4I6L B;  4YL8 A;  5G55 A;  5DPS A;  2Z0E B;  4IM2 A;  2J0M A;  2RSU A;  5KHO A;  3VH3 B;  3B08 A;  3Q3F A;  3AU5 A;  2RGF A;  3CST A;  1FXT B;  1UBQ A;  1RAX A;  2DX5 B;  3A9K B;  3UF8 A;  1ISN A;  2DZK A;  2PPH A;  4GU2 A;  2ZVN A;  4K7U A;  2K8H A;  1OGW A;  2BKF A;  4J6I A;  3NHE B;  2LI5 A;  3TJP A;  4BBN C;  1UEL A;  4WAA A;  4XX5 A;  3WAP A;  1V49 A;  3NZS A;  4FUL A;  4NAW A;  4ZYN A;  3ECI A;  4BKG A;  1GG3 A;  4OVU A;  3V6C B;  4GXB A;  2KFJ A;  4EZK A;  2WWZ A;  4HJK A;  2LWP A;  2UWQ A;  4KDL B;  3HK0 A;  2HD5 B;  3RZF A;  1IYF A;  2KFK A;  4HK2 A;  1P98 A;  2M1M A;  3WAO A;  3GZN I;  1LXD A;  2LZ6 A;  2KVR A;  4W9K A;  3TL5 A;  2DAJ A;  3U8Z A;  3DVG Y;  2IBI B;  2IO2 B;  2PE6 B;  2ZJD A;  2J7Q B;  4GIV A;  4AP4 C;  4ANU A;  2KKC A;  2BWF A;  4K1R B;  2EMT A;  2KHW B;  2A5U A;  3EHV A;  1XQQ A;  3X23 A;  2C60 A;  2KXJ A;  4BFR A;  4FLH A;  1NBF C;  3VQI A;  2LAS A;  1WXA A;  4KIK A;  5KHQ A;  3JVZ X;  2KC2 A;  1C1Y B;  3DCG A;  3V6E B;  4JGH B;  1R4N I;  1L2N A;  1KM7 A;  3W1Y A;  2KTR B;  2KWV B;  3PHX B;  3QAR A;  3CF6 E;  3KUC B;  2C5L C;  4G50 A;  3ZNI D;  3PT2 B;  1E5W A;  3L08 A;  2ZPN A;  4M8M A;  4ANV A;  2MBH A;  2KNB A;  3EC8 A;  1IPG A;  2M8S A;  4X57 B;  4TKN A;  4ZRJ A;  4K81 A;  3D32 A;  4WWP A;  4EEW A;  5HKH A;  2NS5 A;  1ZW7 A;  2D2Q A;  2N1V A;  4HPL B;  4NQL B;  3VVW B;  4TQ1 A;  2RD0 A;  2N7D A;  2JWZ A;  3EFU A;  2NBV B;  1WE7 A;  3VTW A;  3U7D A;  4W9L A;  4MJS B;  3PV1 A;  1WXM A;  2KOX A;  3MHS D;  3RUL A;  2ZCB A;  2FCM A;  4ANX A;  2JF5 A;  3DVN V;  2MW5 A;  4GDL B;  3QQ8 B;  3PSE B;  3CSF A;  4KSL C;  3WA0 A;  5L95 C;  1NDD A;  4I6P A;  5J17 A;  4CHK A;  4IWP A;  4G3X B;  3AUL A;  2DYO A;  1XD3 B;  3CMM B;  4LCD E;  2FIF A;  4KZ0 A;  2BWE S;  2O2V A;  4NPN A;  2AEH A;  4GDK A;  4IC7 B;  4FJZ A;  2L8J A;  4K7S A;  4WJN A;  4II3 B;  5L83 A;  4JQW C;  2L7R A;  3RT3 B;  3B0A A;  1T0Y A;  3C0R B;  2KLG A;  3KUZ A;  4MM3 A;  3ZUN A;  3VH4 B;  1LQB A;  1WY8 A;  1P3Q U;  4JL9 A;  5CX3 A;  3UQB A;  2ASQ A;  3RZW C;  4ICV A;  2HE7 A;  5AZH A;  4IM3 A;  4WJP A;  2NPT A;  1LFD A;  4EZJ A;  1YX5 B;  3DDC B;  3RYT A;  4KVG B;  2WX1 A;  3H1U A;  1BT0 A;  3W1S A;  3N32 A;  3HM3 A;  1WR1 A;  2N9E B;  4GN1 A;  3RCZ A;  4BOS C;  1UZX B;  2GMI C;  4FN2 A;  3A9K A;  1WX8 A;  1E8X A;  1V6E A;  2AL6 A;  2NBW B;  2JRI B;  2LD9 A;  4DXA B;  3JSV B;  5JZE B;  2OJR A;  2QHO A;  4MSM B;  2V4L A;  2GBR A;  5LLI A;  1GC7 A;  5LXH A;  4BBN F;  5GMV A;  1E8Z A;  3VXW A;  5AZF A;  1LM8 B;  4AUQ C;  5TR5 A;  2JUO A;  3ZDT A;  3DBL I;  4DHZ E;  2XK5 B;  2NCN A;  3PRM B;  3QJZ A;  3VTV A;  4ZDV A;  2MBE A;  1K8R B;  4TUU A;  1E8W A;  3RUI B;  2JRH A;  4A20 A;  4IWQ A;  3HM6 X;  4PYZ A;  2R2O A;  4HCP B;  2KTF A;  3KYC D;  2J0K A;  1F9J A;  2L00 B;  4XC2 A;  2NVU I;  5CHV C;  2MBO A;  3PRP B;  1V9J A;  2D07 B;  1WZ0 A;  1S3S G;  5E6P A;  2DZM A;  1ZKH A;  3PRE A;  5FR6 A;  1KLV A;  4IUM B;  3QK0 A;  2I1J A;  3PRZ A;  4MH0 E;  4NQK E;  1WGH A;  4GGQ A;  3M95 A;  2O6V B;  4EZL A;  1CMX B;  4DDI D;  4HXD A;  3L54 A;  2CKH B;  2D11 A;  4NNJ B;  4OVV A;  3TMP B;  1Q0W B;  4WWN A;  2KMC A;  4AOF A;  1EF5 A;  3R7Q A;  2MRP A;  4HDO A;  4A3O A;  5LXI B;  3ZW3 A;  4F8C B;  1AAR A;  2FCS A;  3Q3J A;  4FBJ B;  2CR5 A;  3ZNH B;  2KX0 A;  4B9K A;  1J0G A;  4AJY B;  4GB9 A;  4PS8 A;  1H4R A;  3AU4 A;  4JIO U;  5D94 A;  5E6O A;  1WXS A;  2ZEQ A;  3IG3 A;  4DHJ D;  4E74 A;  3A1Q A;  3R3M A;  3TBL D;  1TGZ B;  3ML9 A;  3AXC A;  3ENE A;  4IM0 A;  1SE9 A;  4HVB A;  3WAM A;  4PYU A;  4ZRK A;  2M4N A;  4II2 B;  3WAN A;  2DHZ A;  3NY5 A;  3N3K B;  5AZG A;  3PHW B;  1PQS A;  5CHW A;  2FCN A;  3H6N A;  1P9D U;  1Y8R C;  2DZJ A;  2BYV E;  1YQB A;  3ZLZ A;  2REX A;  3SU8 X;  2L76 A;  2GBN A;  3DQV A;  2XEW A;  3L13 A;  1E8Y A;  4ICU A;  1RRB A;  2CHW A;  3M63 B;  2FNJ B;  3MJW A;  3QX1 A;  3VTU A;  4DHJ B;  2BYE A;  3ALB A;  4GDK B;  3ZTC A;  4DK5 A;  3JYU A;  3K9P B;  3ZNZ B;  2NPT B;  3SHQ A;  2PJH A;  2A4Z A;  3R66 C;  4GOC A;  1Q5W B;  3JW0 X;  2V3S A;  2L0F A;  1GJZ A;  1H8C A;  1YX6 B;  4WJQ A;  2MBB B;  3H7S A;  2AWT A;  2KFK B;  1WM3 A;  3QA8 A;  4EOY A;  2KQ7 A;  3L10 B;  1WX7 A;  1V80 A;  3PZD A;  2G4S A;  2MP2 A;  3DVN U;  3IBE A;  2C7M B;  4LDT B;  4NJ7 A;  2MA9 B;  3DPD A;  4NY0 A;  1I35 A;  3LJ3 A;  2XBB C;  2L0T A;  3PTF C;  3HIZ A;  4BKS D;  4F7Z A;  1I42 A;  2FID A;  2MLB A;  2N7E A;  1WMH B;  1Z2M A;  1UH6 A;  1VCB A;  3UIO B;  2C7N B;  1WGR A;  3DBH I;  4W9F A;  3ZDM C;  2KDF B;  3UQA A;  3VFK A;  2O6V D;  4TQ0 A;  2XK5 A;  2Z0D B;  1TTN A;  4DBG A;  1A5R A;  3ZVV A;  1L7Y A;  4WWO A;  2IO0 B;  2WX0 A;  1D3Z A;  3QAQ A;  2IZV B;  3QIJ A;  3BY4 B;  4MDK E;  3M62 B;  2K1F A;  4NAW B;  4E3C A;  2MSE D;  2KMA A;  3DOW A;  2Z59 B;  1GNU A;  1WI0 A;  1WF9 A;  3N30 A;  2KC1 A;  4MEM A;  4WJO A;  1KOT A;  5BO4 B;  3W1S C;  2M17 A;  4CO7 A;  2CU1 A;  1EO6 A;  4RM9 A;  4M0W B;  3UGB B;  2O6V A;  4HDQ A;  2CS4 A;  2CHZ A;  2K8B A;  2KO3 A;  2EKE C;  3BIN A;  3IVF A;  2GBJ A;  4ASW C;  5J2R A;  4MEL A;  4W9E A;  2WDT B;  4W9J A;  3ZRC A;  2N1W A;  2M0X A;  3A4S C;  3EEC A;  1MG8 A;  3H7P B;  3APD A;  3QWZ B;  3NS8 A;  3T9L A;  4E71 A;  3HHM A;  4BKS A;  2IY0 B;  1X1M A;  1YD8 U;  2KX3 A;  4IWO A;  5EDS A;  2UYZ B;  5C1Z A;  2W9N A;  2GBM A;  4MJS A;  1WYW B;  2KAN A;  4GMV A;  3TIX A;  3OLM D;  1WFY A;  2JPH A;  3ONS A;  4W9I A;  3QHT A;  4HPM B;  2IYD B;  3IHP C;  1WH3 A;  3A1Q B;  4GDL A;  4K7W A;  4KIK B;  1Q1O A;  2RR9 A;  2LXA A;  3V62 A;  2N9X A;  1S1Q B;  4P7I A;  3B1L X;  1WRD B;  5JHB A;  3VUW A;  2WYQ A;  2LGY A;  3H7P A;  2AL3 A;  2LUE A;  3V61 A;  2C7H A;  1TZ1 A;  2NR2 A;  2I1K A;  3ZRF A;  1WIA A;  1V5T A;  4RMA A;  5G2N A;  1WZ3 A;  2KDB A;  4AWJ A;  4W9G A;  1HE8 A;  3UIP B;  1TBE A;  2LVO A;  4ZRI A;  3VUX A;  1GUA B;  3OJ4 B;  5J18 A;  4MGK E;  4I6N B;  2K25 A;  4G0N B;  5D7G A;  3GOE A;  2L05 A;  2IO1 B;  1SIF A;  3LDZ E;  3PLV A;  2CHX A;  2JZZ A;  3KH0 A;  2PEA A;  3MTN B;  1WX9 A;  2KJH B;  4HCN B;  4B95 A;  2GBK A;  3NOB A;  4KSK C;  2AYO B;  5IAA C;  2KQS A;  4CYE A;  5JHA A;  4MGI E;  3UIN B;  1V2Y A;  4FAD A;  3T8M A;  1WJ4 A;  1KJT A;  2K6Q A;  3U30 A;  2DYM A;  3DBS A;  4M8N A;  4DHZ B;  1UBI A;  2EMS A;  4BKT A;  2IY1 B;  2V1Y A;  2KDI A;  1YIW A;  4WQO B;  1SGH A;  3S2A A;  1VD2 A;  2Y5B B;  1OQY A;  4BVU C;  5DPR A;  4W9C A;  1P1A A;  4MGY E;  2MWS B;  2MCN B;  2VRR B;  3PPA A;  2LXC A;  1OEY J;  3QC8 B;  4W9H A;  5D2M B;  4MSQ B;  3APC A;  4HWI B;  2O2V B;  2MP2 B;  1M94 A;  4LDT D;  3OAW A;  3JSV A;  4PS3 A;  3SD5 A;  1WGY A;  2ZCC A;  3P2B A;  3WAL A;  3L17 A;  3KVF B;  2G45 B;  4GSW A;  3SDL C;  3H9D A;  4EFO A;  2YVC A;  4B6W A;  4URK A;  3RD2 A;  3KUD B;  1WJ6 A;  5DCN A;  3PS6 A;  2FAZ A;  4FJY A;  3VHT C;  5E6N A;  1R4M I;  4LJP B;  2K39 A;  4ANW A;  3QCA A;  2MBQ A;  2IO3 B;  2N4F A;  2N9P C;  3WIM A;  4FA6 A;  1E7V A;  2BYF A;  3AI5 A;  2FCQ A;  2K6D B;  4PS7 A;  1IP9 A;  2JT4 B;  2KWU B;  2KLC A;  2ZNV C;  1WJN A;  2FUH B;  4W9D A;  3TCA A;  3VUY A;  2LVQ A;  5CTR C;  2B3A A;  3ZIM A;  2BGF A;  2BKR B;  3ZNG C;  4G11 A;  1WMH A;  4KZC A;  2OOB B;  1JRU A;  5C23 A;  2YLM A;  4FJV B;  4KV2 A;  1WXV A;  1P0R A;  3A33 B;  3ZKJ C;  1J8C A;  2LVP A;  2KJR A;  1OTR B;  2BPS A;  3K9O B;  1RLF A;  2RPQ A;  2PE9 A;  3A4R A;  3A9J A;  4EUT A;  3KW5 B;  2D10 A;  2DEN B;  1WJU A;  3VDZ A;  5DPT A;  2HTH A;  3L0W B;  2KTR A;  2KDE B;  4MGZ E;  4FHJ A;  2JY6 A;  1OEY A;  4LJO B;  5DPW A;  2NBU A;  1NI2 A;  2DYB A;  5D6J B;  1WGD A;  5JH5 C;  3DBR I;  3ZTD A;  1WGG A;  2LRW A;  4KDI C;  1WM2 A;  1XT9 B;  2LGD A;  2R2Q A;  4FHK A;  1QZE A;  4BOZ B;  1WE6 A;  3KYD D;  3R7R A;  2ZZP B;  4NJ6 A;  3VAW A;  3A9J B;  3ML8 A;  3IFW B;  4IG7 B;  1G6J A;  2G3Q B;  2KD0 A;  4IW0 A;  3NZU A;  3V60 A;  2LJ5 A;  2GOW A;  2D3G A;  2KWC A;  1RFA A;  4A3P A;  2JVC A;  5AEK B;  4XZ4 A;  1WR6 E;  2JXX A;  5IA7 A;  1C3T A;  2HJ8 A;  2K8C A;  2KZR A;  1EUV B;  2BF8 B;  2J0J A;  1ZGU B;  1GC6 A;  4DWF A;  1U4A A;  3M3J A;  3L16 A;  2KK8 A;  2LGX A;  3PGE A;  1V86 A;  4RM8 A;  4TV3 A;  2MQJ A;  4JLC A;  3PVL A;  2JZ3 B;  3X0W A;  3OJ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...