4W9LA

Pvhl:elob:eloc in complex with (2s,4r)-1-((s)-2-((s)-2-acetamido-3,3-dimethylbutanamido)-3,3-dimethylbutanoyl)-4-hydroxy-n-(4-(4-methylthiazol-5-yl)benzyl)pyrrolidine-2-carboxamide (ligand 15)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
103
structure length
101
Chain Sequence
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGEGFTSQTARPQAPATVGLAFRADDTFEALIEPFSSPPELPDVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription elongation factor B polypeptide 2
publication title Structure-Guided Design and Optimization of Small Molecules Targeting the Protein-Protein Interaction between the von Hippel-Lindau (VHL) E3 Ubiquitin Ligase and the Hypoxia Inducible Factor (HIF) Alpha Subunit with in Vitro Nanomolar Affinities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 22
structure length 101
sequence length 103
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4w9lA00
3ZIMA 3R7RA 1E90A 3P2BA 4MEMA 4PYZA 2DYMA 3ZRFA 5JZEB 4MGKE 4ZYNA 2D2QA 3HIZA 5AZGA 1YQBA 3SHQA 5C1ZA 2IO1B 3HK0A 3VQIA 2N9XA 2GBJA 2K8HA 3UF8A 4WJPA 3DCGA 4XZ4A 5L95C 2A5UA 4IW0A 1E5WA 4NQKE 2N1VA 1U4AA 2C7MB 2N9EB 2RPQA 2Y5BB 3JVZX 3TL5A 2JRHA 2LVOA 4HVBA 4ZRJA 4EEWA 2LGDA 3V6EB 4EOYA 2M17A 1WFYA 2BF8B 5GMVA 4MELA 4GDLB 4JLCA 1V6EA 4WWNA 5LLIA 3ZUNA 3PSEB 5JHBA 5TR5A 2M0XA 2NBWB 3ZO5B 3O65B 1F9JA 1S3SG 2I1KA 4DDID 3PRMB 3ZNZB 1IPGA 4KDLB 4PS3A 2GBRA 4RM8A 4NJ7A 2V3SA 1K8RB 4ZRKA 3R66C 1HE8A 1Z5SB 2MA9B 2C60A 3DVNU 1MG8A 3K9OB 4GDLA 4BKTA 4DHZE 4HPLB 4G11A 5JHAA 1E8WA 4ANXA 2O6VB 2N9PC 2NS5A 4WQOB 1GG3A 2MSED 4RMAA 4PS7A 4W9EA 2WDTB 5D94A 4DHJB 1WX8A 1C1YB 4URKA 4B95A 3RYTA 3X0WA 1G6JA 2O6VA 1P0RA 4GDKB 3WALA 4CYEA 4FBJB 3CSFA 4EFOA 3QWZB 1A5RA 1IYFA 3WAPA 3NZUA 2PEAA 2O6VD 4GXBA 3WA0A 2MQJA 4IC7B 5LXIB 2KX3A 2ASQA 1WM3A 1UD7A 4MJSB 2AL6A 1V80A 3B1LX 4G3XB 4BKGA 2GMIC 4GDKA 2CU1A 1UZXB 2MRPA 5J2RA 1C3TA 1WY8A 2BWES 4DHJD 1ZW7A 2K8CA 4I6PA 5J18A 4AUQC 2KMCA 2UWQA 3D32A 4IUMB 4DWFA 3IVFA 1WRDB 2D11A 4K1RB 4MJSA 2B3AA 4IWPA 3PVLA 4KSLC 3WIMA 4EUTA 4XX5A 5D2MB 3W1SA 2KDEB 3H6NA 3Q3FA 5CHFA 3KVFB 1RRBA 3DBSA 1WX9A 1FXTB 3EC8A 3GZNI 2IO0B 2KXJA 2L3ZA 4OVUA 1WI0A 1P1AA 5CX3A 2EMTA 2LRUA 3DVGY 2BPSA 2KFKB 4HDQA 4ICVA 4KSKC 4W9KA 4WAAA 2L76A 1Q0WB 4ICUA 3VHTC 1TGZB 2KO3A 5AEKB 2GBNA 2M8SA 3RT3B 2R2QA 2MWSB 5JH5C 1SGHA 3PLUA 1WH3A 4ASWC 4II3B 2ZPYA 4HCPB 4TUUA 3TBLD 3ZLZA 3UQAA 2K1FA 2Z59B 2KFKA 3BY4B 5J17A 3NOBA 1UELA 2IYDB 2LGYA 3ZDTA 3OJ3A 4JQWC 3AI5A 3SDLC 2FUHB 4HJKA 4TV3A 2IZVB 1KM7A 2KLCA 2G45B 4GU2A 4FHJA 2KC1A 5CTRC 5AZFA 4A20A 4A3OA 2KDFB 3TMPB 4ZRIA 3HM3A 3NHEB 2MBBB 4KDIC 3EHVA 4E71A 1RAXA 4GSWA 3OLMD 2DENB 4FLHA 2EMSA 4KZCA 2KDIA 2BWFA 4DK5A 1NI2A 1WJUA 3IFWB 1WE7A 1WJNA 5IA7A 3IG3A 2FCMA 2NVUI 3ZTDA 2C5LC 3IHPC 4LJOB 2M4NA 4A3PA 3KYCD 2J0JA 2PJHA 3A9JB 3KYDD 1WGGA 2FNJB 2K6DB 3S2AA 3QJZA 1XQQA 4DBGA 2LVPA 3W1YA 5CHVC 1WR6E 2KOXA 2CKHB 2LVQA 4N9F4 3ZNID 4X57B 2N1WA 3PGEA 1R4MI 4I6LB 1E7VA 2IO3B 2ZVNA 4BOSC 4XC2A 2QHOA 1WJ6A 2MBEA 2A4ZA 3CMMB 3A9JA 2ZZPB 4WJNA 3UIOB 3PREA 1LFDA 2KWVB 3MJWA 3PZDA 2ZNVC 3EECA 5G55A 2MP2A 3A1QA 2KKCA 4CHKA 3DPDA 2WYQA 1SE9A 3A33B 1NBFC 3WAMA 4FJVB 3ZVVA 2KJHB 4KIKB 2BYVE 2KQSA 2NBVB 2LRWA 2UYZB 4IM2A 5G2NA 2G4DB 3VTWA 2YLMA 4BBNC 4F1SA 3L17A 1KOTA 1WGRA 2V1YA 4BOZB 3QX1A 1LQBA 3ZRCA 1E8ZA 3H7PB 3PHWB 2N7DA 4FN2A 2NCNA 3PRPB 3NS8A 2O2VB 4MGZE 1WYWB 2BYEA 4DDGD 4KIKA 2FIDA 4MM3A 4OVVA 5DPSA 4NQLB 1S1QB 1VD2A 2WX1A 3AXCA 4HK2A 2KWCA 4HXDA 4HPMB 1LXDA 3L54A 1RLFA 2JXXA 2LUEA 1YX5B 3B08A 4IWQA 3H7PA 3L08A 5KHOA 4FJZA 1GJZA 3KUCB 2O2VA 1T0YA 3N32A 3WANA 3HHMA 3MTNB 3AU4A 1J19A 2MW5A 4GOCA 3JSVA 4NAWB 1WF9A 4BBNF 2RR9A 3PPAA 2I1JA 3A4SC 3OJ4B 4F7ZA 2J0MA 2L0FA 2PE6B 3KH0A 3IBEA 3PV1A 4F8CB 1ISNA 3Q3JA 4YL8A 3L16A 3ZW3A 4MSMB 3TIXA 2KNBA 2BGFA 1L7YA 2K8BA 3RZFA 3H7SA 4NAWA 4NY0A 3U8ZA 2XEWA 3SD5A 2C7HA 1WM2A 3LDZE 4AOFA 3VH4B 3VVWB 2FCQA 5D7GA 3VUYA 1YX6B 1D3ZA 2KTRA 2PPHA 2KFJA 3I3TB 4TQ1A 4G0NB 3TJPA 3N30A 1YJ1A 3PLVA 1OTRB 1GUAB 2KJRA 4IWOA 4IG7B 2Z0DB 4I6NB 3V62A 3RD2A 2VRRB 3AULA 2FAZA 4GIVA 1M94A 4KVGB 1IP9A 1WXVA 2C7NB 2FCSA 2LI5A 1I35A 4WJQA 5L83A 2DZKA 2ZEQA 3VFKA 1V9JA 1Z2MA 1V86A 1ZKHA 2ZJDA 1OGWA 2L7RA 4GMVA 2JF5A 2AYOB 4WWOA 3VTVA 2G3QB 1E8XA 2DYBA 2NPTA 3PTFC 5CHWA 3VH3B 2W9NA 4TQ0A 2ZCBA 1YIWA 1GC6A 1P3QU 4B9KA 2CHXA 2BKRB 3ZNGC 4MGYE 1ZGUB 2ZCCA 3CSTA 3QHTA 4BFRA 1VCBA 3KUZA 5E6PA 3X23A 4DHZB 3R3MA 3V61A 2JY6A 1E7UA 2HTHA 2V4LA 4FADA 4K7SA 4GN1A 1V5OA 2G4SA 3M63B 2IY0B 3UIPB 5DPTA 3PT2B 1Q1OA 3RCZA 2CHZA 2NBUA 3DQVA 5C23A 1EF1A 1EO6A 2JWZA 3T9LA 2KWUB 4M8NA 1I42A 4IM0A 4K81A 4WWPA 4ZDVA 3UQBA 4GGQA 5DCNA 4W9JA 4EKUA 2MX2A 1KJTA 3NZSA 4KV2A 5D6JB 2AEHA 1V5TA 3BINA 4PYUA 2JT4B 2M1MA 4FJYA 4MGIE 3ONSA 4WJOA 1RFAA 2MLBA 5BO4B 4EZJA 2CR5A 4HCNB 4MSQB 1EUVB 4EZLA 2KHWB 3APCA 1R4NI 4W9CA 3HM6X 3MHSD 1EF5A 3SU8X 2MP2B 3A1QB 3VAWA 1OEYA 3ZDMC 4AWJA 3TCAA 3UINB 3QK0A 3EFUA 3VXWA 1WX7A 1J8CA 2DZIA 3ALBA 3V60A 3L10B 2GBMA 3ECIA 1QZEA 2MBQA 3U30A 1V81A 2ZPNA 3VUXA 3DDCB 3DOWA 2DZMA 2KK8A 1UGMA 2LJ5A 2K6QA 2KTFA 2R2OA 4NPNA 2KMAA 2JZ3B 2K25A 2RGFA 4FHKA 2RD0A 1WXAA 1TZ1A 1UBIA 2N7EA 4W9DA 3M62B 4FULA 2LXCA 1Q5WB 4HWIB 5AZHA 2D10A 2LASA 3H1UA 4E74A 2PE9A 4EZKA 1WZ0A 3GOEA 1TBEA 3L0WB 3QQ8B 4KZ0A 4PS8A 2ZNVB 2AL3A 2NR2A 2CS4A 4JL9A 3ML9A 2BYFA 1WGDA 4W9LA 5LXHA 1XD3B 3JSVB 2L0TA 3QIJA 2GBKA 3PS6A 1CMXB 1V2YA 4M0WB 4JIOU 5E6NA 2J7QB 2KQ7A 2KLGA 3A4RA 1BT0A 3DVNV 4GB9A 2K39A 2OOBB 2XBBC 4B6WA 4HLEA 2KVRA 1WJ4A 4LDTB 3QARA 3U7DA 4CO7A 3LJ3A 2BKFA 3C0RB 4AP4C 1UBQA 4NNJB 4ANVA 4ANUA 3APFA 4FA6A 3W1SC 3RULA 3DBLI 1PQSA 4MDKE 2D3GA 2CHWA 3VDZA 3KW5B 1XT9B 2OJRA 2KTRB 2DX5B 1WXSA 3PHXB 3R7QA 5DPRA 2KX0A 2DZJA 2HE7A 2JVCA 2HD5B 2HJ8A 2FCNA 4LDTD 3CF6E 3QA8A 3VTUA 2AWTA 1UH6A 2LD9A 1TTNA 3DBRI 4ANWA 2L00B 5E6OA 2DAFA 1WGHA 2DYOA 1LM8B 3ML8A 3WAOA 2RSUA 1P9DU 2IO2B 2LGXA 2Z0EB 3AU5A 3RUIB 2NPTB 3PRZA 3QC8B 1P98A 4AJWA 1JRUA 2KN5A 5FR6A 1E8YA 4BVUC 1WXMA 2LWPA 4LCDE 3QCAA 3ENEA 3KUDB 1H8CA 1AARA 3L13A 2L8JA 1SIFA 2REXA 2D07B 4W9GA 4BKSA 5EDSA 4M8MA 4II2B 4AJYB 1WGYA 3NY5A 3ZNHB 1GNUA 3M95A 2KDBA 3UGBB 4BKSD 1OQYA 1WMHB 3M3JA 2EKEC 2XK5B 3VUWA 2KZRA 4MH0E 3OAWA 4P7IA 1WZ3A 3DVGX 2YVCA 1WE6A 2N4FA 3DBHI 2MBOA 3K9PB 1Y8RC 2IY1B 2MCNB 2LZ6A 3N3KB 1J0GA 2JPHA 4DXAB 4K7WA 3JW0X 5HKHA 1L2NA 2KC2A 2WWZA 2ZVOA 2KANA 3A9KB 4HDOA 2MBHA 4LJPB 5IAAC 3QAQA 1WMHA 3B0AA 3T8MA 1V49A 2DAJA 3ZKJC 2XK5A 2C9WB 2WX0A 1X1MA 4K7UA 4NJ6A 4IM3A 4J6IA 4E3CA 2FIFA 2JUOA 4G50A 4RM9A 2J0KA 3JYUA 1GC7A 2KD0A 2GOWA 4JGHB 1KLVA 2DHZA 1WR1A 3H9DA 3A9KA 4W9FA 3RZWC 1NDDA 2JZZA 4W9HA 3ZTCA 3V6CB 2L05A 1YD8U 1H4RA 1WIAA 3APDA 2KJ6A 2JRIB 1OEYJ 5DPWA 2IBIB 5KHQA 4TKNA 2LXAA 4W9IA
chains in the Genus database with same CATH superfamily
1VZ8A 1DOIA 2B76B 4PYZA 2DYMA 3ZRFA 1C76A 2MEKA 1YQBA 3FC4A 5C1ZA 3P4SB 2N9XA 2GBJA 3DCGA 4XZ4A 2A5UA 5FKAC 1E5WA 1L4ZB 4NQKE 2VZKB 2C7MB 2N9EB 2RPQA 4HJGE 2PKOA 4EEWA 2N9KA 2WXPA 5IN7A 3IXSA 4M00A 1PGXA 2AX5A 2D3AA 1HEZE 4GDLB 4JLCA 4WWNA 2M0AA 3PZ7A 2NBWB 1MFWA 3PRMB 3TUOA 1IPGA 4KDLB 3ZNZB 3O13A 4RM8A 1Z5SB 4GDLA 1J7CA 3DVNU 1MG8A 4HPLB 3AECB 1FEHA 3I63C 2O6VB 4R3DA 2NS5A 4RMAA 4PS7A 3ZJUA 2LHDA 1K51A 1YJIA 2WDTB 1FFVA 5D94A 4DHJB 4AS1A 1C1YB 3X0WA 3TEXA 1UF0A 2O6VA 4GDKB 4QAYA 3QWZB 1A5RA 1IYFA 4REZA 1D5ZC 3P4PB 1L0XB 3MC9A 2KX3A 2ASQA 1WM3A 1SB3C 1KLGD 1V80A 3B1LX 2BBCA 1FD6A 4GDKA 2CU1A 2MRPA 5J2RA 4I6PA 4YT0B 3NVZA 4AUQC 3D32A 3AEFB 3IVFA 1FRDA 2D11A 3PVLA 4KSLC 3WIMA 3Q3NC 1SE2A 2OEDA 2WXHA 4KX6B 5CHFA 1FIQA 1FXTB 1I4RA 3EC8A 4OVUA 1WI0A 1P1AA 2I2YA 4K3BA 4KSKC 1Q0WB 1ZE3D 2RDBC 1OFFA 1JWMD 1EWYC 5JH5C 3AEGB 1WH3A 4MT5A 4II3B 3ZLZA 3GS2A 5EE3A 3BY4B 1UELA 4JQWC 3AE1B 3SDLC 2FUHB 1FNVA 4FHJA 4ZYSA 3U7ZA 1EWCA 2MBBB 3EHVA 3LYYA 1D5MC 2FBWB 4OVZA 2KDIA 2INDC 4DK5A 3IFWB 1WJNA 5IA7A 3IG3A 4C4VB 3IHPC 1IUEA 3AM9A 1YNTE 1ROEA 2LVPA 3W1YA 5CHVC 1WR6E 2CKHB 3ZNID 4X57B 2N1WA 1R4MI 2LGSA 4I6LB 1E7VA 4BOSC 2QHOA 1WJ6A 4WJNA 3AE2B 4IDIA 4C56C 3PZDA 3ZQ4A 4CHKA 3R2IA 3A33B 4FJVB 3ZVVA 2BYVE 4MM3B 2UYZB 2WQYB 3PZ8A 3BIID 3PHWB 1L6VA 2N7DA 2MJEA 1FPYA 2SEBD 3FAHA 2D3BA 4MM3A 5DPSA 2WX1A 4HK2A 1N5WA 1XLQA 2JXXA 1YJJA 3L08A 1E0ZA 3KUCB 1DOYA 2BS4B 3BYYB 4GOCA 3URYA 3PPAA 3N1ZC 3OJ4B 2PE6B 4F8CB 3IBEA 4RF1A 3DWGC 3L16A 4MSMB 2BGFA 1L7YA 1N60A 2XEWA 3J9CA 2C7HA 1WM2A 3LDZE 5IKCM 4YTNB 1KLUD 4LK0M 4XDDA 3ZJTA 2V3PA 3PLVA 1M4VA 2Z0DB 4I6NB 3RD2A 1SIJA 1YMHE 3AULA 2C7NB 2FCSA 2ZEQA 1QOBA 1N5XA 1V9JA 1V86A 4GMVA 2JF5A 2AYOB 1YQ3B 2G3QB 2DYBA 3AE8B 2ZCBA 1YIWA 1GC6A 5HG2A 4B9KA 2WDQB 4ZHOA 1ZGUB 3QHTA 3KUZA 5E6PA 2W82A 3X23A 2QSDA 3R3MA 1DOXA 1F1HA 2MH7A 2NBUA 3DQVA 1CJEA 1UWXA 4IM0A 4ZDVA 1FNUA 3UQBA 5DCNA 4W9JA 2MX2A 2PIAA 1TJEA 4KV2A 4LNOA 4FJYA 4MGIE 4PT5A 2E3TA 1HXYD 4S0RA 2MP2B 1JW9D 1C4CA 3TCAA 3QK0A 5G5GA 1C4AA 4OZBA 3ALBA 3V60A 3Q6BA 1L5PA 4Q2JA 3VUXA 3GZNB 1UGMA 3KWVA 1FO4A 4LNKA 2NMQA 4FHKA 1TZ1A 1UBIA 2N7EA 3AE5B 3M62B 1D5XC 3SEBA 1Q5WB 4HWIB 1JROA 2D10A 3H1UA 4XGAB 4RCOA 1TBEA 1TIFA 3QQ8B 4KZ0A 4KGRA 3IAM1 2AL3A 1L0YB 1PGBA 2L1AA 1WGDA 3T3NA 1WRIA 3JSVB 2DWQA 1LO5D 1V2YA 4EE2A 4JX1C 4M0WB 4JIOU 2G9HD 1MHXA 2K39A 2XBBC 4N6EB 1RFKA 1WJ4A 2BKFA 3APFA 2VH1A 1PQSA 4MDKE 3OWEB 2PW9A 2OJRA 3GE3C 2XN9C 2KX0A 4XWTA 2FCNA 4LDTD 3CF6E 1UH6A 3DBRI 3P4RB 2JSVX 4ZRQA 2RSUA 3U52E 2Z0EB 3QC8B 1P98A 4AJWA 2KN5A 1PGAA 2LWPA 3KUDB 3AE6B 1AARA 3L13A 2OHFA 2PTLA 1SE4A 4ZOHC 2W55A 3NY5A 2N9LA 3ZNHB 4N59A 1GNUA 2KDBA 5HI1A 4BKSD 1WMHB 2KDMA 2MJ3A 3VUWA 4S17A 1AYFA 2YVCA 2EKIA 1TS4A 3N3KB 3AE7B 4DXAB 3JW0X 2ZVOA 2KANA 1WMHA 3T8MA 1V49A 4J6IA 4OZAA 2JUOA 2BQQA 2J0KA 1XF5L 4JGHB 3T3OA 4W9HA 2L05A 1WIAA 1JWUD 1GOZA 4LNNA 1V97A 3CIRB 1RM6C 4CQNA 3P2BA 2LHEA 3HIZA 2EELA 3SFEB 4C80A 2BS2B 1L6UA 3W9CB 2D5GA 4YTMB 5L95C 1A70A 2Y5BB 4HVBA 4ZRJA 5HFYA 2LGDA 3V6EB 3BVGA 1WFYA 1XO3A 5GMVA 3PSEB 1WGKA 3CWIA 2GBRA 2V3SA 3VR8B 4ZRKA 1HE8A 5G5HA 1TKGA 1K53A 3K9OB 3BVZA 4G11A 1E8WA 2N9PC 3Q8FA 3P1MA 4HRSA 1WX8A 4B95A 3RYTA 3ZYYX 5E6JA 2FUG1 4FBJB 4B0MA 2J53A 1E10A 2MQJA 4IC7B 5LXIB 3HVDA 1N62A 2ACZB 2GMIC 2WU2B 1C3TA 1T6BX 2BWES 2K8CA 2UWQA 1FMAD 4IUMB 4DWFA 1JALA 4K1RB 2B3AA 4IWPA 4EUTA 2QC8A 3W1SA 5HHDG 1WX9A 3GZNI 3I5JC 2L3ZA 5CX3A 4W9KA 4ICVA 2KFKB 4WAAA 2I38A 1TS2A 2GBNA 2M8SA 2MWSB 1SGHA 3PLUA 4WWMA 1ET6A 2KFKA 5J17A 2LGYA 3ZDTA 3AI5A 4HJKA 5D3IB 5AZFA 3DBLB 3P42A 2W54A 4ZRIA 2K5PA 1BUIC 4RGNA 1HZ6A 2Q5WD 5TSSA 2QJLA 4GSWA 3OLMD 4FLHA 2QDFA 4KZCA 1BMLC 3EA6A 5MPOA 2N7JA 2FCMA 3NRZA 3ZTDA 4LJOB 4A90A 2M4NA 1K50A 3KYCD 3A9JB 3KYDD 2FNJB 2K6DB 3S2AA 1XQQA 2KOXA 5BYQA 2WXFA 2IO3B 2ZVNA 3N1XC 1I4QA 3ZJVA 3DHGC 3CMMB 3A9JA 3PREA 5D3DA 2QILA 2ZNVC 2RMMA 3DPDA 2WYQA 2NTSA 1FRRA 1NBFC 3Q8CA 2RPVA 3WAMA 2KJHB 2G4DB 2J42A 4F1SA 2IGHA 1KOTA 2V1YA 3H7PB 2KMMA 1WYWB 4DDGD 1S1QB 3AXCA 4HXDA 2KYWA 3B08A 3H7PA 3N32A 3WANA 3HHMA 3MTNB 1ZXIA 1J19A 2MW5A 1WF9A 4BBNF 2RR9A 2I1JA 4H2AA 1ISNA 3Q3JA 2ONQA 3TIXA 3MHZA 3RZFA 3U8ZA 3SD5A 4L2YA 2D3CA 4MACA 3VH4B 2FCQA 2BB6A 1D3ZA 5AUKA 4TQ1A 3N30A 1YJ1A 1GUAB 1L4DB 2WLBA 1IP9A 4GIVA 1M94A 4KVGB 1WXVA 2W3SA 1UGJA 5L83A 2DZKA 3VFKA 1ZKHA 1NYRA 2L7RA 2CJOA 3AV8A 1TZOA 2WXIA 1E7PB 3VH3B 4K3CA 1QKZA 2CHXA 5FR3A 4BFRA 3V61A 2V4LA 5I4DA 4US8A 1V5OA 2G4SA 3M63B 3U2SC 3RCZA 2CHZA 3MJ5A 3Q69A 1ENFA 1EO6A 5FK9C 2KWUB 4M8NA 1VLBA 1IBXA 2AEHA 1KF6B 1JRPA 3DBRB 2WHIA 4DXGA 4EZJA 1FM0D 1EUVB 4YSXB 1V1PB 3APCA 4BAXA 3I57A 1AWDA 3ZXVA 1EF5A 3SU8X 1FFUA 1QILA 4KGSA 3NZ3A 5LNK1 3ZDMC 4AWJA 2WXJA 2OJWA 3EFUA 1WX7A 1J8CA 2DZIA 1HQRD 3L10B 2GBMA 3ECIA 1V1PA 1PYWD 2RDGA 1ZP0B 1V81A 3RPFC 3HUIA 2LEKA 2LJ5A 2K6QA 2KTFA 2FE8A 2KMAA 4ARCA 2JZ3B 2K25A 2RGFA 2BYTA 2RD0A 1WXAA 3ETRA 2LXCA 2H89B 4EZKA 3GOEA 3I9V1 3LB8C 4PS8A 2NR2A 2CS4A 3NVYA 2L52A 3ML9A 4W9LA 1QOAA 1XD3B 2ON8A 2LGIA 3QIJA 1VDVA 3RI7C 3AB5A 2XNAC 5E6NA 2J7QB 4HROA 2KQ7A 3DVNV 2BW2A 2GRIA 4LDTB 2V0GA 2BS3B 1YOVB 4ANVA 4ANUA 4FA6A 3DBLI 2D3GA 3RN9C 3VDZA 1YN5A 3R8BA 5DPRA 4C7YA 2JVCA 1NVID 2HJ8A 1SSNA 3QA8A 3SFDB 4ANWA 1MPEA 2CJNA 1WGHA 1WXQA 1LM8B 2IO2B 3AEEB 2YEPF 1YN4A 1GB1A 3Q3OC 1WXMA 3QCAA 1QT9A 4KGTA 4RH6A 1SIFA 4N58A 5EDSA 4BKSA 4M8MA 1WGYA 1VZ7A 2MHJA 1F2RI 4HKQA 4OZCA 2XK5B 2KZRA 4MH0E 3OAWA 4P7IA 1NYQA 1WE6A 2JQRB 2MBOA 3K9PB 1Y8RC 2BT6A 1TKEA 3ZGZA 2TSSA 3GE8C 4PK1A 1L2NA 2WWZA 3A9KB 2GB1A 4GLSC 2DAJA 2XK5A 1PUTA 4JPSA 1XLPA 4E3CA 4G50A 1AN8A 2NTTA 2IDYA 3A9KA 3LXFA 1NDDA 3NUHB 3RZWC 1OQQA 3ZTCA 3V6CB 1OEYJ 5DPWA 2IBIB 2V4IB 3TEYA 4W9IA 1HZ5A 2V3NA 3KQ4A 1F52A 5JZEB 5AZGA 4RGTA 2V9HA 3HK0A 3VQIA 2Y5CA 2HTME 3UF8A 4WJPA 4IW0A 1D4BA 3AH7A 4OHJA 2JRHA 3P63A 2KT7A 1I4XA 1IGDA 3RNFC 2M17A 4YSZB 4TSSA 1V6EA 4KKIA 5LLIA 5JHBA 5TR5A 3ZO5B 1S3SG 1Y56A 4A9AA 1HTOA 5C3JB 3Q8EA 1K8RB 1RWSA 1ZOYB 3V3XA 5EE0A 4BKTA 3DHIC 4XYCA 1HA5A 5JHAA 4ZRPA 1KRHA 1ESFA 4URKA 1C9FA 3WALA 4EFOA 3IT6B 3WAPA 3NZUA 2PEAA 4GXBA 3WA0A 4WH4A 5BYSA 1UD7A 2AL6A 4G3XB 1E6EB 1ZW7A 1FXAA 5J18A 1N6ZA 4RGOS 5D2MB 1N63A 2KDEB 3BWUD 3IT4B 1VR9A 1RRBA 2WNMA 2KXJA 3TSSA 1JWAD 2BB5A 2MJDA 2LRUA 3DVGY 2BPSA 4HDQA 3DHHC 2L76A 4ICUA 3VHTC 3EUB2 4FXCA 3RT3B 2R2QA 3RMKC 2WXKA 2ZPYA 4HCPB 3TBLD 2K1FA 1Q10A 2IYDB 3W2DA 3R2TA 2ZW1A 1JWSD 2IZVB 3FKYA 2KLCA 4GU2A 5CTRC 4A20A 2QIEB 2KDFB 4KDIC 1GAQB 1WSPA 2HJ1A 1B9RA 2WU5B 2DENB 2BWFA 2X8XX 1NI2A 1WJUA 1WE7A 2KAJA 2JX5A 4A3PA 2LVQA 4N9F4 1E9MA 4ITKA 1JMLA 3PGEA 4USAA 4XC2A 3OG5A 2ZZPB 3UIOB 1LFDA 2KWVB 3C19A 3EECA 5G55A 2JZPA 3A1QA 2KKCA 3AEDB 1SE9A 3TEWA 2CU3A 4KIKB 2NBVB 2LRWA 3DBHB 3VTWA 3L17A 1WGRA 2K3UA 4HEA1 3GB1A 4MGZE 1ZXHA 3PRPB 4ARIA 2O2VB 2WXLA 3KWLA 4KIKA 2FIDA 1VD2A 1LXDA 3L54A 1RLFA 1SBBB 2LUEA 4JE3B 4IWQA 5KHOA 1SJHD 4A55A 1GJZA 2O2VA 1T0YA 1EU3A 1PFDA 1YN3A 1TS5A 5BMHA 2AQ2B 3A4SC 1CQVA 3Q8BA 4XWWA 4F7ZA 3KH0A 3PV1A 2IGDA 5C2TB 4YL8A 2KNBA 2K8BA 4NY0A 5AUIA 5D7GA 1YX6B 2KTRA 2PPHA 2KFJA 3I3TB 3IAS1 1TY0A 1OTRB 1FXIA 1P7FA 2W3RA 4IWOA 3V62A 3TEZA 2VRRB 4J3OD 1K52A 4WWOA 3NVVA 3VTVA 1C77A 1E8XA 2NPTA 5CHWA 3E56A 2JXTA 1P3QU 2BKRB 4MGYE 3E9SA 2RDHA 2LMCA 4JWSC 1E7UA 2HTHA 1J7BA 4K7SA 4GN1A 3NVWA 3FILB 2BVCA 5DPTA 3PT2B 4P6VF 1Q1OA 3ABVB 5C23A 2GI9A 4K81A 4WWPA 1UUPA 1KJTA 1MG4A 3FILA 1V5TA 4PYUA 2QCZA 4WJOA 3ONSA 1RFAA 5BO4B 1KFYB 2CR5A 4RNAA 2H88B 2AQ1B 2KVZA 4MSQB 4W9CA 3VRBB 3H8HA 3HM6X 3MHSD 2PVOD 3VAWA 1OEYA 3AEBB 4LTUA 2WXQA 2KWDA 3U30A 3DOWA 2DZMA 3KLSX 1ZPSA 2R2OA 4DXFA 1DYQA 1SEBD 4NJCA 1GPXA 4L1BA 4FULA 1QOFA 4NAMA 2KACA 1EU4A 4WQMA 3VR9B 3L0WB 3UI3A 1L0VB 1RYJA 1TY2A 5LXHA 1QQRA 3PS6A 2M56B 1SXTA 1I4GA 4HLEA 3QARA 3U7DA 1R7SA 4LLGM 1UBQA 4TMAB 4AQ7A 2WDVB 2UU7A 3W1SC 3RULA 1XEEA 1XT9B 3KW5B 1WXSA 3EGRA 3R7QA 3W5UB 4ACFA 2HD5B 4IOIE 4BZAA 2LD9A 2L00B 5E6OA 2DAFA 2DYOA 3U4EG 1C78A 3WAOA 1P9DU 2PMVA 4XDCA 3RUIB 5IOIA 1JRUA 4OW0A 1E8YA 3AEAB 5T8IA 1DGJA 4LCDE 4RGMA 3ENEA 2QEJC 1XCTL 1H8CA 3W5VB 2L8JA 1UWMA 2REXA 3N1YC 1OQYA 3M3JA 1IBXB 3DVGX 1WZ3A 4MH8A 1CZPA 3DBHI 2MCNB 2IY1B 2JPHA 5JXVA 4K7WA 2MBHA 2JYTA 4RFBA 3ZKJC 2C9WB 2WX0A 3L4PA 4K7UA 3BYTB 4NJ6A 1T0RC 4YTPB 4RM9A 3Q3MC 3JYUA 4UDUC 1GC7A 3BK2A 2KD0A 4P16A 2DHZA 1WR1A 3H9DA 4W9FA 1B1ZA 1FCCC 1H4RA 2KJ6A 1ACCA 4NZLB 1KH0A 5KHQA 3VTUA 3ZIMA 3R7RA 1E90A 3AE3B 4MEMA 4MGKE 1TKYA 4ZYNA 2D2QA 3SHQA 2IO1B 5IO9A 2WXGA 2K8HA 1SE3A 2INCC 2J52A 2IGGA 2E6XA 4B0EA 1F2RC 2N1VA 1U4AA 3JVZX 3TL5A 2LVOA 1UNSA 3AN1A 4C4VA 4EOYA 2BF8B 4MELA 4P1CC 4M01A 3ZUNA 4YWGG 2M0XA 1PDXA 3O65B 2VZKD 1F9JA 2I1KA 2LUMA 4DDID 4PS3A 2ZW0A 4NJ7A 1XLOA 3DWMA 1NI3A 3C8YA 3R66C 2MA9B 2C60A 4DHZE 4XE0A 4ANXA 4WQOB 1GG3A 2MSED 4W9EA 2J4XA 1NENB 1G6JA 1P0RA 1XCQL 2WS3B 4CYEA 3CSFA 1STEA 2O6VD 4L23A 1GB4A 3RNAC 1R4NB 4P1BC 4MJSB 4BKGA 2DLBA 1UZXB 5IP4D 3V05A 1WY8A 4DHJD 1QF6A 2KMCA 1I4PA 1WRDB 4C7ZA 4MJSA 4XX5A 3BVMA 1SF0A 1T3QA 4A8XC 3H6NA 3Q3FA 2BTEA 1IGCA 3KVFB 3DBSA 2IO0B 3MFGA 3RFZB 2EMTA 5BMGA 2WXRA 1TGZB 2KO3A 5AEKB 1V1OA 4ASWC 1QLBB 4TUUA 2SAKA 3UQAA 2Z59B 3NOBA 4YXDB 3OJ3A 1TT5B 2K0PA 4TV3A 1KM7A 2G45B 2KC1A 4A3OA 3TMPB 3N20C 3HM3A 3NHEB 2ICIA 4E71A 1F0ZA 1RAXA 1FNWA 1JQ4A 2GLSA 1LGRA 2EMSA 1JWBD 1VRAB 4IKGA 4YSYB 2NVUI 3PO0A 2C5LC 1MJDA 3P4QB 2J0JA 2PJHA 3MP9A 1I4HA 1WGGA 2INPE 3QJZA 3SR6A 4DBGA 1T5XD 1ZDXA 2JU6X 1CK1A 3WCQA 4WURA 1XXGA 1T0SC 3AE4B 2MBEA 2A4ZA 2WGSA 3Q2AC 1QOGA 3MJWA 2MP2A 2KQSA 4IM2A 1N61A 5G2NA 4BBNC 2YLMA 2Z8LA 4BOZB 3QX1A 2JWUA 1LQBA 3ZRCA 1E8ZA 4FN2A 2NCNA 3NS8A 1KTKA 2BYEA 4OVVA 4NQLB 2KWCA 4HPMB 1YX5B 3NJTA 4FJZA 2Y3AA 2YEPB 3AU4A 1HTQA 1WWTA 3JSVA 4NAWB 3AE9B 4M0WA 2J0MA 2L0FA 1SJED 2JYEA 3EFCA 3ZW3A 3H7SA 4NAWA 3B2FA 4AOFA 1AW7A 3VVWB 4M02A 3HRDD 1OQRA 3VUYA 4RF0A 4G0NB 3TJPA 5H8YE 2DBYA 2N0SB 2KJRA 1EM7A 4IG7B 3Q8AA 2FAZA 4HPPA 1V8CA 2LI5A 1I35A 4WJQA 1NEKB 1Z2MA 2LFIA 2INNE 2R61A 2ZJDA 1OGWA 3PTFC 3B9JA 2LJIA 2W9NA 2WXOA 1JCKB 2L32A 3VRAB 4TQ0A 3ZXRA 2WP9B 3ZNGC 2ZCCA 3CSTA 1J7AA 1VCBA 4DHZB 2JY6A 4FADA 1TYGB 5BMIA 3UIPB 2IY0B 5GXGB 1EF1A 1MHHE 1C4PA 2JWZA 3T9LA 4C00A 1I42A 4GGQA 4EKUA 2M19A 1ZUD2 3NZSA 5D6JB 3NS1A 3BINA 2JT4B 2M1MA 2MLBA 2PLPA 1MVKA 1YQ4B 4HCNB 1ZDVA 4EZLA 4O1NA 2KHWB 3RNEC 1R4NI 3NG0A 1ET9A 3A1QB 2K9XA 3UINB 3VXWA 1QZEA 1VJKA 1BXTA 2MBQA 2ZPNA 3DDCB 2KK8A 1FCLA 1T0QC 4NPNA 2KQ4X 4JWUC 2IPKD 4W9DA 1VZ6A 5AZHA 2LASA 4E74A 2PE9A 1WZ0A 3B2GA 3RNGC 2ZNVB 3RNCC 4JL9A 2QMTA 2BYFA 2L0TA 4A6QA 2GBKA 1CMXB 1WYGA 2KN4A 2AQ3B 3BK1A 4D2KA 2PVGC 4GB9A 3A4RA 2KLGA 4LNIA 1BT0A 2OOBB 4B6WA 2IJ0A 2KVRA 4CO7A 3LJ3A 3GP7A 3C0RB 1MI0A 4AP4C 4KKJA 4NNJB 2CHWA 2HDEA 2KTRB 2DX5B 3MC8A 3PHXB 4ZHPA 2DZJA 2HE7A 3RNBC 3HVZA 4DQOC 2X38A 2WXMA 2AWTA 2G1EA 1TTNA 3MC0B 3N9YC 1R4MB 3ML8A 3BZDB 2LGXA 3AU5A 2NPTB 3PRZA 2VH2A 4WIPA 5FR6A 2WXNA 4HKZE 4BVUC 4LNFA 5H92C 4US9A 1D6EC 2D07B 4W9GA 4II2B 4AJYB 1C79A 2DNFA 3M95A 3UGBB 2EKEC 1TS3A 5BYRA 2L83A 1P7EA 2N4FA 2LZ6A 3AMZA 1J0GA 5HKHA 2KC2A 5IAAC 4HDOA 4LJPB 3QAQA 3B0AA 1X1MA 5EE1A 1F77A 4IM3A 2FIFA 1XLNA 2WDRB 2GOWA 1KLVA 2JZZA 5EE9A 1I7HA 1YD8U 3Q14C 3APDA 2Y5PA 2JRIB 4WAFA 4TKNA 2LXAA 2K22A
chains in the Genus database with same CATH topology
3ZIMA 3R7RA 1E90A 3P2BA 4MEMA 4PYZA 2DYMA 3ZRFA 5JZEB 4MGKE 4ZYNA 2D2QA 3HIZA 5AZGA 1YQBA 3SHQA 5C1ZA 2IO1B 3HK0A 3VQIA 2N9XA 2GBJA 2K8HA 3UF8A 4WJPA 3DCGA 4XZ4A 5L95C 2A5UA 4IW0A 1E5WA 4NQKE 2N1VA 1U4AA 2C7MB 2N9EB 2RPQA 2Y5BB 3JVZX 3TL5A 2JRHA 2LVOA 4HVBA 4ZRJA 4EEWA 2LGDA 3V6EB 4EOYA 2M17A 1WFYA 2BF8B 5GMVA 4MELA 4GDLB 4JLCA 1V6EA 4WWNA 5LLIA 3ZUNA 3PSEB 5JHBA 5TR5A 2M0XA 2NBWB 3ZO5B 3O65B 1F9JA 1S3SG 2I1KA 4DDID 3PRMB 3ZNZB 1IPGA 4KDLB 4PS3A 2GBRA 4RM8A 4NJ7A 2V3SA 1K8RB 4ZRKA 3R66C 1HE8A 1Z5SB 2MA9B 2C60A 3DVNU 1MG8A 3K9OB 4GDLA 4BKTA 4DHZE 4HPLB 4G11A 5JHAA 1E8WA 4ANXA 2O6VB 2N9PC 2NS5A 4WQOB 1GG3A 2MSED 4RMAA 4PS7A 4W9EA 2WDTB 5D94A 4DHJB 1WX8A 1C1YB 4URKA 4B95A 3RYTA 3X0WA 1G6JA 2O6VA 1P0RA 4GDKB 3WALA 4CYEA 4FBJB 3CSFA 4EFOA 3QWZB 1A5RA 1IYFA 3WAPA 3NZUA 2PEAA 2O6VD 4GXBA 3WA0A 2MQJA 4IC7B 5LXIB 2KX3A 2ASQA 1WM3A 1UD7A 4MJSB 2AL6A 1V80A 3B1LX 4G3XB 4BKGA 2GMIC 4GDKA 2CU1A 1UZXB 2MRPA 5J2RA 1C3TA 1WY8A 2BWES 4DHJD 1ZW7A 2K8CA 4I6PA 5J18A 4AUQC 2KMCA 2UWQA 3D32A 4IUMB 4DWFA 3IVFA 1WRDB 2D11A 4K1RB 4MJSA 2B3AA 4IWPA 3PVLA 4KSLC 3WIMA 4EUTA 4XX5A 5D2MB 3W1SA 2KDEB 3H6NA 3Q3FA 5CHFA 3KVFB 1RRBA 3DBSA 1WX9A 1FXTB 3EC8A 3GZNI 2IO0B 2KXJA 2L3ZA 4OVUA 1WI0A 1P1AA 5CX3A 2EMTA 2LRUA 3DVGY 2BPSA 2KFKB 4HDQA 4ICVA 4KSKC 4W9KA 4WAAA 2L76A 1Q0WB 4ICUA 3VHTC 1TGZB 2KO3A 5AEKB 2GBNA 2M8SA 3RT3B 2R2QA 2MWSB 5JH5C 1SGHA 3PLUA 1WH3A 4ASWC 4II3B 2ZPYA 4HCPB 4TUUA 3TBLD 3ZLZA 3UQAA 2K1FA 2Z59B 2KFKA 3BY4B 5J17A 3NOBA 1UELA 2IYDB 2LGYA 3ZDTA 3OJ3A 4JQWC 3AI5A 3SDLC 2FUHB 4HJKA 4TV3A 2IZVB 1KM7A 2KLCA 2G45B 4GU2A 4FHJA 2KC1A 5CTRC 5AZFA 4A20A 4A3OA 2KDFB 3TMPB 4ZRIA 3HM3A 3NHEB 2MBBB 4KDIC 3EHVA 4E71A 1RAXA 4GSWA 3OLMD 2DENB 4FLHA 2EMSA 4KZCA 2KDIA 2BWFA 4DK5A 1NI2A 1WJUA 3IFWB 1WE7A 1WJNA 5IA7A 3IG3A 2FCMA 2NVUI 3ZTDA 2C5LC 3IHPC 4LJOB 2M4NA 4A3PA 3KYCD 2J0JA 2PJHA 3A9JB 3KYDD 1WGGA 2FNJB 2K6DB 3S2AA 3QJZA 1XQQA 4DBGA 2LVPA 3W1YA 5CHVC 1WR6E 2KOXA 2CKHB 2LVQA 4N9F4 3ZNID 4X57B 2N1WA 3PGEA 1R4MI 4I6LB 1E7VA 2IO3B 2ZVNA 4BOSC 4XC2A 2QHOA 1WJ6A 2MBEA 2A4ZA 3CMMB 3A9JA 2ZZPB 4WJNA 3UIOB 3PREA 1LFDA 2KWVB 3MJWA 3PZDA 2ZNVC 3EECA 5G55A 2MP2A 3A1QA 2KKCA 4CHKA 3DPDA 2WYQA 1SE9A 3A33B 1NBFC 3WAMA 4FJVB 3ZVVA 2KJHB 4KIKB 2BYVE 2KQSA 2NBVB 2LRWA 2UYZB 4IM2A 5G2NA 2G4DB 3VTWA 2YLMA 4BBNC 4F1SA 3L17A 1KOTA 1WGRA 2V1YA 4BOZB 3QX1A 1LQBA 3ZRCA 1E8ZA 3H7PB 3PHWB 2N7DA 4FN2A 2NCNA 3PRPB 3NS8A 2O2VB 4MGZE 1WYWB 2BYEA 4DDGD 4KIKA 2FIDA 4MM3A 4OVVA 5DPSA 4NQLB 1S1QB 1VD2A 2WX1A 3AXCA 4HK2A 2KWCA 4HXDA 4HPMB 1LXDA 3L54A 1RLFA 2JXXA 2LUEA 1YX5B 3B08A 4IWQA 3H7PA 3L08A 5KHOA 4FJZA 1GJZA 3KUCB 2O2VA 1T0YA 3N32A 3WANA 3HHMA 3MTNB 3AU4A 1J19A 2MW5A 4GOCA 3JSVA 4NAWB 1WF9A 4BBNF 2RR9A 3PPAA 2I1JA 3A4SC 3OJ4B 4F7ZA 2J0MA 2L0FA 2PE6B 3KH0A 3IBEA 3PV1A 4F8CB 1ISNA 3Q3JA 4YL8A 3L16A 3ZW3A 4MSMB 3TIXA 2KNBA 2BGFA 1L7YA 2K8BA 3RZFA 3H7SA 4NAWA 4NY0A 3U8ZA 2XEWA 3SD5A 2C7HA 1WM2A 3LDZE 4AOFA 3VH4B 3VVWB 2FCQA 5D7GA 3VUYA 1YX6B 1D3ZA 2KTRA 2PPHA 2KFJA 3I3TB 4TQ1A 4G0NB 3TJPA 3N30A 1YJ1A 3PLVA 1OTRB 1GUAB 2KJRA 4IWOA 4IG7B 2Z0DB 4I6NB 3V62A 3RD2A 2VRRB 3AULA 2FAZA 4GIVA 1M94A 4KVGB 1IP9A 1WXVA 2C7NB 2FCSA 2LI5A 1I35A 4WJQA 5L83A 2DZKA 2ZEQA 3VFKA 1V9JA 1Z2MA 1V86A 1ZKHA 2ZJDA 1OGWA 2L7RA 4GMVA 2JF5A 2AYOB 4WWOA 3VTVA 2G3QB 1E8XA 2DYBA 2NPTA 3PTFC 5CHWA 3VH3B 2W9NA 4TQ0A 2ZCBA 1YIWA 1GC6A 1P3QU 4B9KA 2CHXA 2BKRB 3ZNGC 4MGYE 1ZGUB 2ZCCA 3CSTA 3QHTA 4BFRA 1VCBA 3KUZA 5E6PA 3X23A 4DHZB 3R3MA 3V61A 2JY6A 1E7UA 2HTHA 2V4LA 4FADA 4K7SA 4GN1A 1V5OA 2G4SA 3M63B 2IY0B 3UIPB 5DPTA 3PT2B 1Q1OA 3RCZA 2CHZA 2NBUA 3DQVA 5C23A 1EF1A 1EO6A 2JWZA 3T9LA 2KWUB 4M8NA 1I42A 4IM0A 4K81A 4WWPA 4ZDVA 3UQBA 4GGQA 5DCNA 4W9JA 4EKUA 2MX2A 1KJTA 3NZSA 4KV2A 5D6JB 2AEHA 1V5TA 3BINA 4PYUA 2JT4B 2M1MA 4FJYA 4MGIE 3ONSA 4WJOA 1RFAA 2MLBA 5BO4B 4EZJA 2CR5A 4HCNB 4MSQB 1EUVB 4EZLA 2KHWB 3APCA 1R4NI 4W9CA 3HM6X 3MHSD 1EF5A 3SU8X 2MP2B 3A1QB 3VAWA 1OEYA 3ZDMC 4AWJA 3TCAA 3UINB 3QK0A 3EFUA 3VXWA 1WX7A 1J8CA 2DZIA 3ALBA 3V60A 3L10B 2GBMA 3ECIA 1QZEA 2MBQA 3U30A 1V81A 2ZPNA 3VUXA 3DDCB 3DOWA 2DZMA 2KK8A 1UGMA 2LJ5A 2K6QA 2KTFA 2R2OA 4NPNA 2KMAA 2JZ3B 2K25A 2RGFA 4FHKA 2RD0A 1WXAA 1TZ1A 1UBIA 2N7EA 4W9DA 3M62B 4FULA 2LXCA 1Q5WB 4HWIB 5AZHA 2D10A 2LASA 3H1UA 4E74A 2PE9A 4EZKA 1WZ0A 3GOEA 1TBEA 3L0WB 3QQ8B 4KZ0A 4PS8A 2ZNVB 2AL3A 2NR2A 2CS4A 4JL9A 3ML9A 2BYFA 1WGDA 4W9LA 5LXHA 1XD3B 3JSVB 2L0TA 3QIJA 2GBKA 3PS6A 1CMXB 1V2YA 4M0WB 4JIOU 5E6NA 2J7QB 2KQ7A 2KLGA 3A4RA 1BT0A 3DVNV 4GB9A 2K39A 2OOBB 2XBBC 4B6WA 4HLEA 2KVRA 1WJ4A 4LDTB 3QARA 3U7DA 4CO7A 3LJ3A 2BKFA 3C0RB 4AP4C 1UBQA 4NNJB 4ANVA 4ANUA 3APFA 4FA6A 3W1SC 3RULA 3DBLI 1PQSA 4MDKE 2D3GA 2CHWA 3VDZA 3KW5B 1XT9B 2OJRA 2KTRB 2DX5B 1WXSA 3PHXB 3R7QA 5DPRA 2KX0A 2DZJA 2HE7A 2JVCA 2HD5B 2HJ8A 2FCNA 4LDTD 3CF6E 3QA8A 3VTUA 2AWTA 1UH6A 2LD9A 1TTNA 3DBRI 4ANWA 2L00B 5E6OA 2DAFA 1WGHA 2DYOA 1LM8B 3ML8A 3WAOA 2RSUA 1P9DU 2IO2B 2LGXA 2Z0EB 3AU5A 3RUIB 2NPTB 3PRZA 3QC8B 1P98A 4AJWA 1JRUA 2KN5A 5FR6A 1E8YA 4BVUC 1WXMA 2LWPA 4LCDE 3QCAA 3ENEA 3KUDB 1H8CA 1AARA 3L13A 2L8JA 1SIFA 2REXA 2D07B 4W9GA 4BKSA 5EDSA 4M8MA 4II2B 4AJYB 1WGYA 3NY5A 3ZNHB 1GNUA 3M95A 2KDBA 3UGBB 4BKSD 1OQYA 1WMHB 3M3JA 2EKEC 2XK5B 3VUWA 2KZRA 4MH0E 3OAWA 4P7IA 1WZ3A 3DVGX 2YVCA 1WE6A 2N4FA 3DBHI 2MBOA 3K9PB 1Y8RC 2IY1B 2MCNB 2LZ6A 3N3KB 1J0GA 2JPHA 4DXAB 4K7WA 3JW0X 5HKHA 1L2NA 2KC2A 2WWZA 2ZVOA 2KANA 3A9KB 4HDOA 2MBHA 4LJPB 5IAAC 3QAQA 1WMHA 3B0AA 3T8MA 1V49A 2DAJA 3ZKJC 2XK5A 2C9WB 2WX0A 1X1MA 4K7UA 4NJ6A 4IM3A 4J6IA 4E3CA 2FIFA 2JUOA 4G50A 4RM9A 2J0KA 3JYUA 1GC7A 2KD0A 2GOWA 4JGHB 1KLVA 2DHZA 1WR1A 3H9DA 3A9KA 4W9FA 3RZWC 1NDDA 2JZZA 4W9HA 3ZTCA 3V6CB 2L05A 1YD8U 1H4RA 1WIAA 3APDA 2KJ6A 2JRIB 1OEYJ 5DPWA 2IBIB 5KHQA 4TKNA 2LXAA 4W9IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZIM A;  3R7R A;  1E90 A;  3P2B A;  4MEM A;  4PYZ A;  2DYM A;  3ZRF A;  5JZE B;  4MGK E;  4ZYN A;  2D2Q A;  3HIZ A;  5AZG A;  1YQB A;  3SHQ A;  5C1Z A;  2IO1 B;  3HK0 A;  3VQI A;  2N9X A;  2GBJ A;  2K8H A;  3UF8 A;  4WJP A;  3DCG A;  4XZ4 A;  5L95 C;  2A5U A;  4IW0 A;  1E5W A;  4NQK E;  2N1V A;  1U4A A;  2C7M B;  2N9E B;  2RPQ A;  2Y5B B;  3JVZ X;  3TL5 A;  2JRH A;  2LVO A;  4HVB A;  4ZRJ A;  4EEW A;  2LGD A;  3V6E B;  4EOY A;  2M17 A;  1WFY A;  2BF8 B;  5GMV A;  4MEL A;  4GDL B;  4JLC A;  1V6E A;  4WWN A;  5LLI A;  3ZUN A;  3PSE B;  5JHB A;  5TR5 A;  2M0X A;  2NBW B;  3ZO5 B;  3O65 B;  1F9J A;  1S3S G;  2I1K A;  4DDI D;  3PRM B;  3ZNZ B;  1IPG A;  4KDL B;  4PS3 A;  2GBR A;  4RM8 A;  4NJ7 A;  2V3S A;  1K8R B;  4ZRK A;  3R66 C;  1HE8 A;  1Z5S B;  2MA9 B;  2C60 A;  3DVN U;  1MG8 A;  3K9O B;  4GDL A;  4BKT A;  4DHZ E;  4HPL B;  4G11 A;  5JHA A;  1E8W A;  4ANX A;  2O6V B;  2N9P C;  2NS5 A;  4WQO B;  1GG3 A;  2MSE D;  4RMA A;  4PS7 A;  4W9E A;  2WDT B;  5D94 A;  4DHJ B;  1WX8 A;  1C1Y B;  4URK A;  4B95 A;  3RYT A;  3X0W A;  1G6J A;  2O6V A;  1P0R A;  4GDK B;  3WAL A;  4CYE A;  4FBJ B;  3CSF A;  4EFO A;  3QWZ B;  1A5R A;  1IYF A;  3WAP A;  3NZU A;  2PEA A;  2O6V D;  4GXB A;  3WA0 A;  2MQJ A;  4IC7 B;  5LXI B;  2KX3 A;  2ASQ A;  1WM3 A;  1UD7 A;  4MJS B;  2AL6 A;  1V80 A;  3B1L X;  4G3X B;  4BKG A;  2GMI C;  4GDK A;  2CU1 A;  1UZX B;  2MRP A;  5J2R A;  1C3T A;  1WY8 A;  2BWE S;  4DHJ D;  1ZW7 A;  2K8C A;  4I6P A;  5J18 A;  4AUQ C;  2KMC A;  2UWQ A;  3D32 A;  4IUM B;  4DWF A;  3IVF A;  1WRD B;  2D11 A;  4K1R B;  4MJS A;  2B3A A;  4IWP A;  3PVL A;  4KSL C;  3WIM A;  4EUT A;  4XX5 A;  5D2M B;  3W1S A;  2KDE B;  3H6N A;  3Q3F A;  5CHF A;  3KVF B;  1RRB A;  3DBS A;  1WX9 A;  1FXT B;  3EC8 A;  3GZN I;  2IO0 B;  2KXJ A;  2L3Z A;  4OVU A;  1WI0 A;  1P1A A;  5CX3 A;  2EMT A;  2LRU A;  3DVG Y;  2BPS A;  2KFK B;  4HDQ A;  4ICV A;  4KSK C;  4W9K A;  4WAA A;  2L76 A;  1Q0W B;  4ICU A;  3VHT C;  1TGZ B;  2KO3 A;  5AEK B;  2GBN A;  2M8S A;  3RT3 B;  2R2Q A;  2MWS B;  5JH5 C;  1SGH A;  3PLU A;  1WH3 A;  4ASW C;  4II3 B;  2ZPY A;  4HCP B;  4TUU A;  3TBL D;  3ZLZ A;  3UQA A;  2K1F A;  2Z59 B;  2KFK A;  3BY4 B;  5J17 A;  3NOB A;  1UEL A;  2IYD B;  2LGY A;  3ZDT A;  3OJ3 A;  4JQW C;  3AI5 A;  3SDL C;  2FUH B;  4HJK A;  4TV3 A;  2IZV B;  1KM7 A;  2KLC A;  2G45 B;  4GU2 A;  4FHJ A;  2KC1 A;  5CTR C;  5AZF A;  4A20 A;  4A3O A;  2KDF B;  3TMP B;  4ZRI A;  3HM3 A;  3NHE B;  2MBB B;  4KDI C;  3EHV A;  4E71 A;  1RAX A;  4GSW A;  3OLM D;  2DEN B;  4FLH A;  2EMS A;  4KZC A;  2KDI A;  2BWF A;  4DK5 A;  1NI2 A;  1WJU A;  3IFW B;  1WE7 A;  1WJN A;  5IA7 A;  3IG3 A;  2FCM A;  2NVU I;  3ZTD A;  2C5L C;  3IHP C;  4LJO B;  2M4N A;  4A3P A;  3KYC D;  2J0J A;  2PJH A;  3A9J B;  3KYD D;  1WGG A;  2FNJ B;  2K6D B;  3S2A A;  3QJZ A;  1XQQ A;  4DBG A;  2LVP A;  3W1Y A;  5CHV C;  1WR6 E;  2KOX A;  2CKH B;  2LVQ A;  4N9F 4;  3ZNI D;  4X57 B;  2N1W A;  3PGE A;  1R4M I;  4I6L B;  1E7V A;  2IO3 B;  2ZVN A;  4BOS C;  4XC2 A;  2QHO A;  1WJ6 A;  2MBE A;  2A4Z A;  3CMM B;  3A9J A;  2ZZP B;  4WJN A;  3UIO B;  3PRE A;  1LFD A;  2KWV B;  3MJW A;  3PZD A;  2ZNV C;  3EEC A;  5G55 A;  2MP2 A;  3A1Q A;  2KKC A;  4CHK A;  3DPD A;  2WYQ A;  1SE9 A;  3A33 B;  1NBF C;  3WAM A;  4FJV B;  3ZVV A;  2KJH B;  4KIK B;  2BYV E;  2KQS A;  2NBV B;  2LRW A;  2UYZ B;  4IM2 A;  5G2N A;  2G4D B;  3VTW A;  2YLM A;  4BBN C;  4F1S A;  3L17 A;  1KOT A;  1WGR A;  2V1Y A;  4BOZ B;  3QX1 A;  1LQB A;  3ZRC A;  1E8Z A;  3H7P B;  3PHW B;  2N7D A;  4FN2 A;  2NCN A;  3PRP B;  3NS8 A;  2O2V B;  4MGZ E;  1WYW B;  2BYE A;  4DDG D;  4KIK A;  2FID A;  4MM3 A;  4OVV A;  5DPS A;  4NQL B;  1S1Q B;  1VD2 A;  2WX1 A;  3AXC A;  4HK2 A;  2KWC A;  4HXD A;  4HPM B;  1LXD A;  3L54 A;  1RLF A;  2JXX A;  2LUE A;  1YX5 B;  3B08 A;  4IWQ A;  3H7P A;  3L08 A;  5KHO A;  4FJZ A;  1GJZ A;  3KUC B;  2O2V A;  1T0Y A;  3N32 A;  3WAN A;  3HHM A;  3MTN B;  3AU4 A;  1J19 A;  2MW5 A;  4GOC A;  3JSV A;  4NAW B;  1WF9 A;  4BBN F;  2RR9 A;  3PPA A;  2I1J A;  3A4S C;  3OJ4 B;  4F7Z A;  2J0M A;  2L0F A;  2PE6 B;  3KH0 A;  3IBE A;  3PV1 A;  4F8C B;  1ISN A;  3Q3J A;  4YL8 A;  3L16 A;  3ZW3 A;  4MSM B;  3TIX A;  2KNB A;  2BGF A;  1L7Y A;  2K8B A;  3RZF A;  3H7S A;  4NAW A;  4NY0 A;  3U8Z A;  2XEW A;  3SD5 A;  2C7H A;  1WM2 A;  3LDZ E;  4AOF A;  3VH4 B;  3VVW B;  2FCQ A;  5D7G A;  3VUY A;  1YX6 B;  1D3Z A;  2KTR A;  2PPH A;  2KFJ A;  3I3T B;  4TQ1 A;  4G0N B;  3TJP A;  3N30 A;  1YJ1 A;  3PLV A;  1OTR B;  1GUA B;  2KJR A;  4IWO A;  4IG7 B;  2Z0D B;  4I6N B;  3V62 A;  3RD2 A;  2VRR B;  3AUL A;  2FAZ A;  4GIV A;  1M94 A;  4KVG B;  1IP9 A;  1WXV A;  2C7N B;  2FCS A;  2LI5 A;  1I35 A;  4WJQ A;  5L83 A;  2DZK A;  2ZEQ A;  3VFK A;  1V9J A;  1Z2M A;  1V86 A;  1ZKH A;  2ZJD A;  1OGW A;  2L7R A;  4GMV A;  2JF5 A;  2AYO B;  4WWO A;  3VTV A;  2G3Q B;  1E8X A;  2DYB A;  2NPT A;  3PTF C;  5CHW A;  3VH3 B;  2W9N A;  4TQ0 A;  2ZCB A;  1YIW A;  1GC6 A;  1P3Q U;  4B9K A;  2CHX A;  2BKR B;  3ZNG C;  4MGY E;  1ZGU B;  2ZCC A;  3CST A;  3QHT A;  4BFR A;  1VCB A;  3KUZ A;  5E6P A;  3X23 A;  4DHZ B;  3R3M A;  3V61 A;  2JY6 A;  1E7U A;  2HTH A;  2V4L A;  4FAD A;  4K7S A;  4GN1 A;  1V5O A;  2G4S A;  3M63 B;  2IY0 B;  3UIP B;  5DPT A;  3PT2 B;  1Q1O A;  3RCZ A;  2CHZ A;  2NBU A;  3DQV A;  5C23 A;  1EF1 A;  1EO6 A;  2JWZ A;  3T9L A;  2KWU B;  4M8N A;  1I42 A;  4IM0 A;  4K81 A;  4WWP A;  4ZDV A;  3UQB A;  4GGQ A;  5DCN A;  4W9J A;  4EKU A;  2MX2 A;  1KJT A;  3NZS A;  4KV2 A;  5D6J B;  2AEH A;  1V5T A;  3BIN A;  4PYU A;  2JT4 B;  2M1M A;  4FJY A;  4MGI E;  3ONS A;  4WJO A;  1RFA A;  2MLB A;  5BO4 B;  4EZJ A;  2CR5 A;  4HCN B;  4MSQ B;  1EUV B;  4EZL A;  2KHW B;  3APC A;  1R4N I;  4W9C A;  3HM6 X;  3MHS D;  1EF5 A;  3SU8 X;  2MP2 B;  3A1Q B;  3VAW A;  1OEY A;  3ZDM C;  4AWJ A;  3TCA A;  3UIN B;  3QK0 A;  3EFU A;  3VXW A;  1WX7 A;  1J8C A;  2DZI A;  3ALB A;  3V60 A;  3L10 B;  2GBM A;  3ECI A;  1QZE A;  2MBQ A;  3U30 A;  1V81 A;  2ZPN A;  3VUX A;  3DDC B;  3DOW A;  2DZM A;  2KK8 A;  1UGM A;  2LJ5 A;  2K6Q A;  2KTF A;  2R2O A;  4NPN A;  2KMA A;  2JZ3 B;  2K25 A;  2RGF A;  4FHK A;  2RD0 A;  1WXA A;  1TZ1 A;  1UBI A;  2N7E A;  4W9D A;  3M62 B;  4FUL A;  2LXC A;  1Q5W B;  4HWI B;  5AZH A;  2D10 A;  2LAS A;  3H1U A;  4E74 A;  2PE9 A;  4EZK A;  1WZ0 A;  3GOE A;  1TBE A;  3L0W B;  3QQ8 B;  4KZ0 A;  4PS8 A;  2ZNV B;  2AL3 A;  2NR2 A;  2CS4 A;  4JL9 A;  3ML9 A;  2BYF A;  1WGD A;  4W9L A;  5LXH A;  1XD3 B;  3JSV B;  2L0T A;  3QIJ A;  2GBK A;  3PS6 A;  1CMX B;  1V2Y A;  4M0W B;  4JIO U;  5E6N A;  2J7Q B;  2KQ7 A;  2KLG A;  3A4R A;  1BT0 A;  3DVN V;  4GB9 A;  2K39 A;  2OOB B;  2XBB C;  4B6W A;  4HLE A;  2KVR A;  1WJ4 A;  4LDT B;  3QAR A;  3U7D A;  4CO7 A;  3LJ3 A;  2BKF A;  3C0R B;  4AP4 C;  1UBQ A;  4NNJ B;  4ANV A;  4ANU A;  3APF A;  4FA6 A;  3W1S C;  3RUL A;  3DBL I;  1PQS A;  4MDK E;  2D3G A;  2CHW A;  3VDZ A;  3KW5 B;  1XT9 B;  2OJR A;  2KTR B;  2DX5 B;  1WXS A;  3PHX B;  3R7Q A;  5DPR A;  2KX0 A;  2DZJ A;  2HE7 A;  2JVC A;  2HD5 B;  2HJ8 A;  2FCN A;  4LDT D;  3CF6 E;  3QA8 A;  3VTU A;  2AWT A;  1UH6 A;  2LD9 A;  1TTN A;  3DBR I;  4ANW A;  2L00 B;  5E6O A;  2DAF A;  1WGH A;  2DYO A;  1LM8 B;  3ML8 A;  3WAO A;  2RSU A;  1P9D U;  2IO2 B;  2LGX A;  2Z0E B;  3AU5 A;  3RUI B;  2NPT B;  3PRZ A;  3QC8 B;  1P98 A;  4AJW A;  1JRU A;  2KN5 A;  5FR6 A;  1E8Y A;  4BVU C;  1WXM A;  2LWP A;  4LCD E;  3QCA A;  3ENE A;  3KUD B;  1H8C A;  1AAR A;  3L13 A;  2L8J A;  1SIF A;  2REX A;  2D07 B;  4W9G A;  4BKS A;  5EDS A;  4M8M A;  4II2 B;  4AJY B;  1WGY A;  3NY5 A;  3ZNH B;  1GNU A;  3M95 A;  2KDB A;  3UGB B;  4BKS D;  1OQY A;  1WMH B;  3M3J A;  2EKE C;  2XK5 B;  3VUW A;  2KZR A;  4MH0 E;  3OAW A;  4P7I A;  1WZ3 A;  3DVG X;  2YVC A;  1WE6 A;  2N4F A;  3DBH I;  2MBO A;  3K9P B;  1Y8R C;  2IY1 B;  2MCN B;  2LZ6 A;  3N3K B;  1J0G A;  2JPH A;  4DXA B;  4K7W A;  3JW0 X;  5HKH A;  1L2N A;  2KC2 A;  2WWZ A;  2ZVO A;  2KAN A;  3A9K B;  4HDO A;  2MBH A;  4LJP B;  5IAA C;  3QAQ A;  1WMH A;  3B0A A;  3T8M A;  1V49 A;  2DAJ A;  3ZKJ C;  2XK5 A;  2C9W B;  2WX0 A;  1X1M A;  4K7U A;  4NJ6 A;  4IM3 A;  4J6I A;  4E3C A;  2FIF A;  2JUO A;  4G50 A;  4RM9 A;  2J0K A;  3JYU A;  1GC7 A;  2KD0 A;  2GOW A;  4JGH B;  1KLV A;  2DHZ A;  1WR1 A;  3H9D A;  3A9K A;  4W9F A;  3RZW C;  1NDD A;  2JZZ A;  4W9H A;  3ZTC A;  3V6C B;  2L05 A;  1YD8 U;  1H4R A;  1WIA A;  3APD A;  2KJ6 A;  2JRI B;  1OEY J;  5DPW A;  2IBI B;  5KHQ A;  4TKN A;  2LXA A;  4W9I A; 
#chains in the Genus database with same CATH topology
 1VZ8 A;  1DOI A;  2B76 B;  4PYZ A;  2DYM A;  3ZRF A;  1C76 A;  2MEK A;  1YQB A;  3FC4 A;  5C1Z A;  3P4S B;  2N9X A;  2GBJ A;  3DCG A;  4XZ4 A;  2A5U A;  5FKA C;  1E5W A;  1L4Z B;  4NQK E;  2VZK B;  2C7M B;  2N9E B;  2RPQ A;  4HJG E;  2PKO A;  4EEW A;  2N9K A;  2WXP A;  5IN7 A;  3IXS A;  4M00 A;  1PGX A;  2AX5 A;  2D3A A;  1HEZ E;  4GDL B;  4JLC A;  4WWN A;  2M0A A;  3PZ7 A;  2NBW B;  1MFW A;  3PRM B;  3TUO A;  1IPG A;  4KDL B;  3ZNZ B;  3O13 A;  4RM8 A;  1Z5S B;  4GDL A;  1J7C A;  3DVN U;  1MG8 A;  4HPL B;  3AEC B;  1FEH A;  3I63 C;  2O6V B;  4R3D A;  2NS5 A;  4RMA A;  4PS7 A;  3ZJU A;  2LHD A;  1K51 A;  1YJI A;  2WDT B;  1FFV A;  5D94 A;  4DHJ B;  4AS1 A;  1C1Y B;  3X0W A;  3TEX A;  1UF0 A;  2O6V A;  4GDK B;  4QAY A;  3QWZ B;  1A5R A;  1IYF A;  4REZ A;  1D5Z C;  3P4P B;  1L0X B;  3MC9 A;  2KX3 A;  2ASQ A;  1WM3 A;  1SB3 C;  1KLG D;  1V80 A;  3B1L X;  2BBC A;  1FD6 A;  4GDK A;  2CU1 A;  2MRP A;  5J2R A;  4I6P A;  4YT0 B;  3NVZ A;  4AUQ C;  3D32 A;  3AEF B;  3IVF A;  1FRD A;  2D11 A;  3PVL A;  4KSL C;  3WIM A;  3Q3N C;  1SE2 A;  2OED A;  2WXH A;  4KX6 B;  5CHF A;  1FIQ A;  1FXT B;  1I4R A;  3EC8 A;  4OVU A;  1WI0 A;  1P1A A;  2I2Y A;  4K3B A;  4KSK C;  1Q0W B;  1ZE3 D;  2RDB C;  1OFF A;  1JWM D;  1EWY C;  5JH5 C;  3AEG B;  1WH3 A;  4MT5 A;  4II3 B;  3ZLZ A;  3GS2 A;  5EE3 A;  3BY4 B;  1UEL A;  4JQW C;  3AE1 B;  3SDL C;  2FUH B;  1FNV A;  4FHJ A;  4ZYS A;  3U7Z A;  1EWC A;  2MBB B;  3EHV A;  3LYY A;  1D5M C;  2FBW B;  4OVZ A;  2KDI A;  2IND C;  4DK5 A;  3IFW B;  1WJN A;  5IA7 A;  3IG3 A;  4C4V B;  3IHP C;  1IUE A;  3AM9 A;  1YNT E;  1ROE A;  2LVP A;  3W1Y A;  5CHV C;  1WR6 E;  2CKH B;  3ZNI D;  4X57 B;  2N1W A;  1R4M I;  2LGS A;  4I6L B;  1E7V A;  4BOS C;  2QHO A;  1WJ6 A;  4WJN A;  3AE2 B;  4IDI A;  4C56 C;  3PZD A;  3ZQ4 A;  4CHK A;  3R2I A;  3A33 B;  4FJV B;  3ZVV A;  2BYV E;  4MM3 B;  2UYZ B;  2WQY B;  3PZ8 A;  3BII D;  3PHW B;  1L6V A;  2N7D A;  2MJE A;  1FPY A;  2SEB D;  3FAH A;  2D3B A;  4MM3 A;  5DPS A;  2WX1 A;  4HK2 A;  1N5W A;  1XLQ A;  2JXX A;  1YJJ A;  3L08 A;  1E0Z A;  3KUC B;  1DOY A;  2BS4 B;  3BYY B;  4GOC A;  3URY A;  3PPA A;  3N1Z C;  3OJ4 B;  2PE6 B;  4F8C B;  3IBE A;  4RF1 A;  3DWG C;  3L16 A;  4MSM B;  2BGF A;  1L7Y A;  1N60 A;  2XEW A;  3J9C A;  2C7H A;  1WM2 A;  3LDZ E;  5IKC M;  4YTN B;  1KLU D;  4LK0 M;  4XDD A;  3ZJT A;  2V3P A;  3PLV A;  1M4V A;  2Z0D B;  4I6N B;  3RD2 A;  1SIJ A;  1YMH E;  3AUL A;  2C7N B;  2FCS A;  2ZEQ A;  1QOB A;  1N5X A;  1V9J A;  1V86 A;  4GMV A;  2JF5 A;  2AYO B;  1YQ3 B;  2G3Q B;  2DYB A;  3AE8 B;  2ZCB A;  1YIW A;  1GC6 A;  5HG2 A;  4B9K A;  2WDQ B;  4ZHO A;  1ZGU B;  3QHT A;  3KUZ A;  5E6P A;  2W82 A;  3X23 A;  2QSD A;  3R3M A;  1DOX A;  1F1H A;  2MH7 A;  2NBU A;  3DQV A;  1CJE A;  1UWX A;  4IM0 A;  4ZDV A;  1FNU A;  3UQB A;  5DCN A;  4W9J A;  2MX2 A;  2PIA A;  1TJE A;  4KV2 A;  4LNO A;  4FJY A;  4MGI E;  4PT5 A;  2E3T A;  1HXY D;  4S0R A;  2MP2 B;  1JW9 D;  1C4C A;  3TCA A;  3QK0 A;  5G5G A;  1C4A A;  4OZB A;  3ALB A;  3V60 A;  3Q6B A;  1L5P A;  4Q2J A;  3VUX A;  3GZN B;  1UGM A;  3KWV A;  1FO4 A;  4LNK A;  2NMQ A;  4FHK A;  1TZ1 A;  1UBI A;  2N7E A;  3AE5 B;  3M62 B;  1D5X C;  3SEB A;  1Q5W B;  4HWI B;  1JRO A;  2D10 A;  3H1U A;  4XGA B;  4RCO A;  1TBE A;  1TIF A;  3QQ8 B;  4KZ0 A;  4KGR A;  3IAM 1;  2AL3 A;  1L0Y B;  1PGB A;  2L1A A;  1WGD A;  3T3N A;  1WRI A;  3JSV B;  2DWQ A;  1LO5 D;  1V2Y A;  4EE2 A;  4JX1 C;  4M0W B;  4JIO U;  2G9H D;  1MHX A;  2K39 A;  2XBB C;  4N6E B;  1RFK A;  1WJ4 A;  2BKF A;  3APF A;  2VH1 A;  1PQS A;  4MDK E;  3OWE B;  2PW9 A;  2OJR A;  3GE3 C;  2XN9 C;  2KX0 A;  4XWT A;  2FCN A;  4LDT D;  3CF6 E;  1UH6 A;  3DBR I;  3P4R B;  2JSV X;  4ZRQ A;  2RSU A;  3U52 E;  2Z0E B;  3QC8 B;  1P98 A;  4AJW A;  2KN5 A;  1PGA A;  2LWP A;  3KUD B;  3AE6 B;  1AAR A;  3L13 A;  2OHF A;  2PTL A;  1SE4 A;  4ZOH C;  2W55 A;  3NY5 A;  2N9L A;  3ZNH B;  4N59 A;  1GNU A;  2KDB A;  5HI1 A;  4BKS D;  1WMH B;  2KDM A;  2MJ3 A;  3VUW A;  4S17 A;  1AYF A;  2YVC A;  2EKI A;  1TS4 A;  3N3K B;  3AE7 B;  4DXA B;  3JW0 X;  2ZVO A;  2KAN A;  1WMH A;  3T8M A;  1V49 A;  4J6I A;  4OZA A;  2JUO A;  2BQQ A;  2J0K A;  1XF5 L;  4JGH B;  3T3O A;  4W9H A;  2L05 A;  1WIA A;  1JWU D;  1GOZ A;  4LNN A;  1V97 A;  3CIR B;  1RM6 C;  4CQN A;  3P2B A;  2LHE A;  3HIZ A;  2EEL A;  3SFE B;  4C80 A;  2BS2 B;  1L6U A;  3W9C B;  2D5G A;  4YTM B;  5L95 C;  1A70 A;  2Y5B B;  4HVB A;  4ZRJ A;  5HFY A;  2LGD A;  3V6E B;  3BVG A;  1WFY A;  1XO3 A;  5GMV A;  3PSE B;  1WGK A;  3CWI A;  2GBR A;  2V3S A;  3VR8 B;  4ZRK A;  1HE8 A;  5G5H A;  1TKG A;  1K53 A;  3K9O B;  3BVZ A;  4G11 A;  1E8W A;  2N9P C;  3Q8F A;  3P1M A;  4HRS A;  1WX8 A;  4B95 A;  3RYT A;  3ZYY X;  5E6J A;  2FUG 1;  4FBJ B;  4B0M A;  2J53 A;  1E10 A;  2MQJ A;  4IC7 B;  5LXI B;  3HVD A;  1N62 A;  2ACZ B;  2GMI C;  2WU2 B;  1C3T A;  1T6B X;  2BWE S;  2K8C A;  2UWQ A;  1FMA D;  4IUM B;  4DWF A;  1JAL A;  4K1R B;  2B3A A;  4IWP A;  4EUT A;  2QC8 A;  3W1S A;  5HHD G;  1WX9 A;  3GZN I;  3I5J C;  2L3Z A;  5CX3 A;  4W9K A;  4ICV A;  2KFK B;  4WAA A;  2I38 A;  1TS2 A;  2GBN A;  2M8S A;  2MWS B;  1SGH A;  3PLU A;  4WWM A;  1ET6 A;  2KFK A;  5J17 A;  2LGY A;  3ZDT A;  3AI5 A;  4HJK A;  5D3I B;  5AZF A;  3DBL B;  3P42 A;  2W54 A;  4ZRI A;  2K5P A;  1BUI C;  4RGN A;  1HZ6 A;  2Q5W D;  5TSS A;  2QJL A;  4GSW A;  3OLM D;  4FLH A;  2QDF A;  4KZC A;  1BML C;  3EA6 A;  5MPO A;  2N7J A;  2FCM A;  3NRZ A;  3ZTD A;  4LJO B;  4A90 A;  2M4N A;  1K50 A;  3KYC D;  3A9J B;  3KYD D;  2FNJ B;  2K6D B;  3S2A A;  1XQQ A;  2KOX A;  5BYQ A;  2WXF A;  2IO3 B;  2ZVN A;  3N1X C;  1I4Q A;  3ZJV A;  3DHG C;  3CMM B;  3A9J A;  3PRE A;  5D3D A;  2QIL A;  2ZNV C;  2RMM A;  3DPD A;  2WYQ A;  2NTS A;  1FRR A;  1NBF C;  3Q8C A;  2RPV A;  3WAM A;  2KJH B;  2G4D B;  2J42 A;  4F1S A;  2IGH A;  1KOT A;  2V1Y A;  3H7P B;  2KMM A;  1WYW B;  4DDG D;  1S1Q B;  3AXC A;  4HXD A;  2KYW A;  3B08 A;  3H7P A;  3N32 A;  3WAN A;  3HHM A;  3MTN B;  1ZXI A;  1J19 A;  2MW5 A;  1WF9 A;  4BBN F;  2RR9 A;  2I1J A;  4H2A A;  1ISN A;  3Q3J A;  2ONQ A;  3TIX A;  3MHZ A;  3RZF A;  3U8Z A;  3SD5 A;  4L2Y A;  2D3C A;  4MAC A;  3VH4 B;  2FCQ A;  2BB6 A;  1D3Z A;  5AUK A;  4TQ1 A;  3N30 A;  1YJ1 A;  1GUA B;  1L4D B;  2WLB A;  1IP9 A;  4GIV A;  1M94 A;  4KVG B;  1WXV A;  2W3S A;  1UGJ A;  5L83 A;  2DZK A;  3VFK A;  1ZKH A;  1NYR A;  2L7R A;  2CJO A;  3AV8 A;  1TZO A;  2WXI A;  1E7P B;  3VH3 B;  4K3C A;  1QKZ A;  2CHX A;  5FR3 A;  4BFR A;  3V61 A;  2V4L A;  5I4D A;  4US8 A;  1V5O A;  2G4S A;  3M63 B;  3U2S C;  3RCZ A;  2CHZ A;  3MJ5 A;  3Q69 A;  1ENF A;  1EO6 A;  5FK9 C;  2KWU B;  4M8N A;  1VLB A;  1IBX A;  2AEH A;  1KF6 B;  1JRP A;  3DBR B;  2WHI A;  4DXG A;  4EZJ A;  1FM0 D;  1EUV B;  4YSX B;  1V1P B;  3APC A;  4BAX A;  3I57 A;  1AWD A;  3ZXV A;  1EF5 A;  3SU8 X;  1FFU A;  1QIL A;  4KGS A;  3NZ3 A;  5LNK 1;  3ZDM C;  4AWJ A;  2WXJ A;  2OJW A;  3EFU A;  1WX7 A;  1J8C A;  2DZI A;  1HQR D;  3L10 B;  2GBM A;  3ECI A;  1V1P A;  1PYW D;  2RDG A;  1ZP0 B;  1V81 A;  3RPF C;  3HUI A;  2LEK A;  2LJ5 A;  2K6Q A;  2KTF A;  2FE8 A;  2KMA A;  4ARC A;  2JZ3 B;  2K25 A;  2RGF A;  2BYT A;  2RD0 A;  1WXA A;  3ETR A;  2LXC A;  2H89 B;  4EZK A;  3GOE A;  3I9V 1;  3LB8 C;  4PS8 A;  2NR2 A;  2CS4 A;  3NVY A;  2L52 A;  3ML9 A;  4W9L A;  1QOA A;  1XD3 B;  2ON8 A;  2LGI A;  3QIJ A;  1VDV A;  3RI7 C;  3AB5 A;  2XNA C;  5E6N A;  2J7Q B;  4HRO A;  2KQ7 A;  3DVN V;  2BW2 A;  2GRI A;  4LDT B;  2V0G A;  2BS3 B;  1YOV B;  4ANV A;  4ANU A;  4FA6 A;  3DBL I;  2D3G A;  3RN9 C;  3VDZ A;  1YN5 A;  3R8B A;  5DPR A;  4C7Y A;  2JVC A;  1NVI D;  2HJ8 A;  1SSN A;  3QA8 A;  3SFD B;  4ANW A;  1MPE A;  2CJN A;  1WGH A;  1WXQ A;  1LM8 B;  2IO2 B;  3AEE B;  2YEP F;  1YN4 A;  1GB1 A;  3Q3O C;  1WXM A;  3QCA A;  1QT9 A;  4KGT A;  4RH6 A;  1SIF A;  4N58 A;  5EDS A;  4BKS A;  4M8M A;  1WGY A;  1VZ7 A;  2MHJ A;  1F2R I;  4HKQ A;  4OZC A;  2XK5 B;  2KZR A;  4MH0 E;  3OAW A;  4P7I A;  1NYQ A;  1WE6 A;  2JQR B;  2MBO A;  3K9P B;  1Y8R C;  2BT6 A;  1TKE A;  3ZGZ A;  2TSS A;  3GE8 C;  4PK1 A;  1L2N A;  2WWZ A;  3A9K B;  2GB1 A;  4GLS C;  2DAJ A;  2XK5 A;  1PUT A;  4JPS A;  1XLP A;  4E3C A;  4G50 A;  1AN8 A;  2NTT A;  2IDY A;  3A9K A;  3LXF A;  1NDD A;  3NUH B;  3RZW C;  1OQQ A;  3ZTC A;  3V6C B;  1OEY J;  5DPW A;  2IBI B;  2V4I B;  3TEY A;  4W9I A;  1HZ5 A;  2V3N A;  3KQ4 A;  1F52 A;  5JZE B;  5AZG A;  4RGT A;  2V9H A;  3HK0 A;  3VQI A;  2Y5C A;  2HTM E;  3UF8 A;  4WJP A;  4IW0 A;  1D4B A;  3AH7 A;  4OHJ A;  2JRH A;  3P63 A;  2KT7 A;  1I4X A;  1IGD A;  3RNF C;  2M17 A;  4YSZ B;  4TSS A;  1V6E A;  4KKI A;  5LLI A;  5JHB A;  5TR5 A;  3ZO5 B;  1S3S G;  1Y56 A;  4A9A A;  1HTO A;  5C3J B;  3Q8E A;  1K8R B;  1RWS A;  1ZOY B;  3V3X A;  5EE0 A;  4BKT A;  3DHI C;  4XYC A;  1HA5 A;  5JHA A;  4ZRP A;  1KRH A;  1ESF A;  4URK A;  1C9F A;  3WAL A;  4EFO A;  3IT6 B;  3WAP A;  3NZU A;  2PEA A;  4GXB A;  3WA0 A;  4WH4 A;  5BYS A;  1UD7 A;  2AL6 A;  4G3X B;  1E6E B;  1ZW7 A;  1FXA A;  5J18 A;  1N6Z A;  4RGO S;  5D2M B;  1N63 A;  2KDE B;  3BWU D;  3IT4 B;  1VR9 A;  1RRB A;  2WNM A;  2KXJ A;  3TSS A;  1JWA D;  2BB5 A;  2MJD A;  2LRU A;  3DVG Y;  2BPS A;  4HDQ A;  3DHH C;  2L76 A;  4ICU A;  3VHT C;  3EUB 2;  4FXC A;  3RT3 B;  2R2Q A;  3RMK C;  2WXK A;  2ZPY A;  4HCP B;  3TBL D;  2K1F A;  1Q10 A;  2IYD B;  3W2D A;  3R2T A;  2ZW1 A;  1JWS D;  2IZV B;  3FKY A;  2KLC A;  4GU2 A;  5CTR C;  4A20 A;  2QIE B;  2KDF B;  4KDI C;  1GAQ B;  1WSP A;  2HJ1 A;  1B9R A;  2WU5 B;  2DEN B;  2BWF A;  2X8X X;  1NI2 A;  1WJU A;  1WE7 A;  2KAJ A;  2JX5 A;  4A3P A;  2LVQ A;  4N9F 4;  1E9M A;  4ITK A;  1JML A;  3PGE A;  4USA A;  4XC2 A;  3OG5 A;  2ZZP B;  3UIO B;  1LFD A;  2KWV B;  3C19 A;  3EEC A;  5G55 A;  2JZP A;  3A1Q A;  2KKC A;  3AED B;  1SE9 A;  3TEW A;  2CU3 A;  4KIK B;  2NBV B;  2LRW A;  3DBH B;  3VTW A;  3L17 A;  1WGR A;  2K3U A;  4HEA 1;  3GB1 A;  4MGZ E;  1ZXH A;  3PRP B;  4ARI A;  2O2V B;  2WXL A;  3KWL A;  4KIK A;  2FID A;  1VD2 A;  1LXD A;  3L54 A;  1RLF A;  1SBB B;  2LUE A;  4JE3 B;  4IWQ A;  5KHO A;  1SJH D;  4A55 A;  1GJZ A;  2O2V A;  1T0Y A;  1EU3 A;  1PFD A;  1YN3 A;  1TS5 A;  5BMH A;  2AQ2 B;  3A4S C;  1CQV A;  3Q8B A;  4XWW A;  4F7Z A;  3KH0 A;  3PV1 A;  2IGD A;  5C2T B;  4YL8 A;  2KNB A;  2K8B A;  4NY0 A;  5AUI A;  5D7G A;  1YX6 B;  2KTR A;  2PPH A;  2KFJ A;  3I3T B;  3IAS 1;  1TY0 A;  1OTR B;  1FXI A;  1P7F A;  2W3R A;  4IWO A;  3V62 A;  3TEZ A;  2VRR B;  4J3O D;  1K52 A;  4WWO A;  3NVV A;  3VTV A;  1C77 A;  1E8X A;  2NPT A;  5CHW A;  3E56 A;  2JXT A;  1P3Q U;  2BKR B;  4MGY E;  3E9S A;  2RDH A;  2LMC A;  4JWS C;  1E7U A;  2HTH A;  1J7B A;  4K7S A;  4GN1 A;  3NVW A;  3FIL B;  2BVC A;  5DPT A;  3PT2 B;  4P6V F;  1Q1O A;  3ABV B;  5C23 A;  2GI9 A;  4K81 A;  4WWP A;  1UUP A;  1KJT A;  1MG4 A;  3FIL A;  1V5T A;  4PYU A;  2QCZ A;  4WJO A;  3ONS A;  1RFA A;  5BO4 B;  1KFY B;  2CR5 A;  4RNA A;  2H88 B;  2AQ1 B;  2KVZ A;  4MSQ B;  4W9C A;  3VRB B;  3H8H A;  3HM6 X;  3MHS D;  2PVO D;  3VAW A;  1OEY A;  3AEB B;  4LTU A;  2WXQ A;  2KWD A;  3U30 A;  3DOW A;  2DZM A;  3KLS X;  1ZPS A;  2R2O A;  4DXF A;  1DYQ A;  1SEB D;  4NJC A;  1GPX A;  4L1B A;  4FUL A;  1QOF A;  4NAM A;  2KAC A;  1EU4 A;  4WQM A;  3VR9 B;  3L0W B;  3UI3 A;  1L0V B;  1RYJ A;  1TY2 A;  5LXH A;  1QQR A;  3PS6 A;  2M56 B;  1SXT A;  1I4G A;  4HLE A;  3QAR A;  3U7D A;  1R7S A;  4LLG M;  1UBQ A;  4TMA B;  4AQ7 A;  2WDV B;  2UU7 A;  3W1S C;  3RUL A;  1XEE A;  1XT9 B;  3KW5 B;  1WXS A;  3EGR A;  3R7Q A;  3W5U B;  4ACF A;  2HD5 B;  4IOI E;  4BZA A;  2LD9 A;  2L00 B;  5E6O A;  2DAF A;  2DYO A;  3U4E G;  1C78 A;  3WAO A;  1P9D U;  2PMV A;  4XDC A;  3RUI B;  5IOI A;  1JRU A;  4OW0 A;  1E8Y A;  3AEA B;  5T8I A;  1DGJ A;  4LCD E;  4RGM A;  3ENE A;  2QEJ C;  1XCT L;  1H8C A;  3W5V B;  2L8J A;  1UWM A;  2REX A;  3N1Y C;  1OQY A;  3M3J A;  1IBX B;  3DVG X;  1WZ3 A;  4MH8 A;  1CZP A;  3DBH I;  2MCN B;  2IY1 B;  2JPH A;  5JXV A;  4K7W A;  2MBH A;  2JYT A;  4RFB A;  3ZKJ C;  2C9W B;  2WX0 A;  3L4P A;  4K7U A;  3BYT B;  4NJ6 A;  1T0R C;  4YTP B;  4RM9 A;  3Q3M C;  3JYU A;  4UDU C;  1GC7 A;  3BK2 A;  2KD0 A;  4P16 A;  2DHZ A;  1WR1 A;  3H9D A;  4W9F A;  1B1Z A;  1FCC C;  1H4R A;  2KJ6 A;  1ACC A;  4NZL B;  1KH0 A;  5KHQ A;  3VTU A;  3ZIM A;  3R7R A;  1E90 A;  3AE3 B;  4MEM A;  4MGK E;  1TKY A;  4ZYN A;  2D2Q A;  3SHQ A;  2IO1 B;  5IO9 A;  2WXG A;  2K8H A;  1SE3 A;  2INC C;  2J52 A;  2IGG A;  2E6X A;  4B0E A;  1F2R C;  2N1V A;  1U4A A;  3JVZ X;  3TL5 A;  2LVO A;  1UNS A;  3AN1 A;  4C4V A;  4EOY A;  2BF8 B;  4MEL A;  4P1C C;  4M01 A;  3ZUN A;  4YWG G;  2M0X A;  1PDX A;  3O65 B;  2VZK D;  1F9J A;  2I1K A;  2LUM A;  4DDI D;  4PS3 A;  2ZW0 A;  4NJ7 A;  1XLO A;  3DWM A;  1NI3 A;  3C8Y A;  3R66 C;  2MA9 B;  2C60 A;  4DHZ E;  4XE0 A;  4ANX A;  4WQO B;  1GG3 A;  2MSE D;  4W9E A;  2J4X A;  1NEN B;  1G6J A;  1P0R A;  1XCQ L;  2WS3 B;  4CYE A;  3CSF A;  1STE A;  2O6V D;  4L23 A;  1GB4 A;  3RNA C;  1R4N B;  4P1B C;  4MJS B;  4BKG A;  2DLB A;  1UZX B;  5IP4 D;  3V05 A;  1WY8 A;  4DHJ D;  1QF6 A;  2KMC A;  1I4P A;  1WRD B;  4C7Z A;  4MJS A;  4XX5 A;  3BVM A;  1SF0 A;  1T3Q A;  4A8X C;  3H6N A;  3Q3F A;  2BTE A;  1IGC A;  3KVF B;  3DBS A;  2IO0 B;  3MFG A;  3RFZ B;  2EMT A;  5BMG A;  2WXR A;  1TGZ B;  2KO3 A;  5AEK B;  1V1O A;  4ASW C;  1QLB B;  4TUU A;  2SAK A;  3UQA A;  2Z59 B;  3NOB A;  4YXD B;  3OJ3 A;  1TT5 B;  2K0P A;  4TV3 A;  1KM7 A;  2G45 B;  2KC1 A;  4A3O A;  3TMP B;  3N20 C;  3HM3 A;  3NHE B;  2ICI A;  4E71 A;  1F0Z A;  1RAX A;  1FNW A;  1JQ4 A;  2GLS A;  1LGR A;  2EMS A;  1JWB D;  1VRA B;  4IKG A;  4YSY B;  2NVU I;  3PO0 A;  2C5L C;  1MJD A;  3P4Q B;  2J0J A;  2PJH A;  3MP9 A;  1I4H A;  1WGG A;  2INP E;  3QJZ A;  3SR6 A;  4DBG A;  1T5X D;  1ZDX A;  2JU6 X;  1CK1 A;  3WCQ A;  4WUR A;  1XXG A;  1T0S C;  3AE4 B;  2MBE A;  2A4Z A;  2WGS A;  3Q2A C;  1QOG A;  3MJW A;  2MP2 A;  2KQS A;  4IM2 A;  1N61 A;  5G2N A;  4BBN C;  2YLM A;  2Z8L A;  4BOZ B;  3QX1 A;  2JWU A;  1LQB A;  3ZRC A;  1E8Z A;  4FN2 A;  2NCN A;  3NS8 A;  1KTK A;  2BYE A;  4OVV A;  4NQL B;  2KWC A;  4HPM B;  1YX5 B;  3NJT A;  4FJZ A;  2Y3A A;  2YEP B;  3AU4 A;  1HTQ A;  1WWT A;  3JSV A;  4NAW B;  3AE9 B;  4M0W A;  2J0M A;  2L0F A;  1SJE D;  2JYE A;  3EFC A;  3ZW3 A;  3H7S A;  4NAW A;  3B2F A;  4AOF A;  1AW7 A;  3VVW B;  4M02 A;  3HRD D;  1OQR A;  3VUY A;  4RF0 A;  4G0N B;  3TJP A;  5H8Y E;  2DBY A;  2N0S B;  2KJR A;  1EM7 A;  4IG7 B;  3Q8A A;  2FAZ A;  4HPP A;  1V8C A;  2LI5 A;  1I35 A;  4WJQ A;  1NEK B;  1Z2M A;  2LFI A;  2INN E;  2R61 A;  2ZJD A;  1OGW A;  3PTF C;  3B9J A;  2LJI A;  2W9N A;  2WXO A;  1JCK B;  2L32 A;  3VRA B;  4TQ0 A;  3ZXR A;  2WP9 B;  3ZNG C;  2ZCC A;  3CST A;  1J7A A;  1VCB A;  4DHZ B;  2JY6 A;  4FAD A;  1TYG B;  5BMI A;  3UIP B;  2IY0 B;  5GXG B;  1EF1 A;  1MHH E;  1C4P A;  2JWZ A;  3T9L A;  4C00 A;  1I42 A;  4GGQ A;  4EKU A;  2M19 A;  1ZUD 2;  3NZS A;  5D6J B;  3NS1 A;  3BIN A;  2JT4 B;  2M1M A;  2MLB A;  2PLP A;  1MVK A;  1YQ4 B;  4HCN B;  1ZDV A;  4EZL A;  4O1N A;  2KHW B;  3RNE C;  1R4N I;  3NG0 A;  1ET9 A;  3A1Q B;  2K9X A;  3UIN B;  3VXW A;  1QZE A;  1VJK A;  1BXT A;  2MBQ A;  2ZPN A;  3DDC B;  2KK8 A;  1FCL A;  1T0Q C;  4NPN A;  2KQ4 X;  4JWU C;  2IPK D;  4W9D A;  1VZ6 A;  5AZH A;  2LAS A;  4E74 A;  2PE9 A;  1WZ0 A;  3B2G A;  3RNG C;  2ZNV B;  3RNC C;  4JL9 A;  2QMT A;  2BYF A;  2L0T A;  4A6Q A;  2GBK A;  1CMX B;  1WYG A;  2KN4 A;  2AQ3 B;  3BK1 A;  4D2K A;  2PVG C;  4GB9 A;  3A4R A;  2KLG A;  4LNI A;  1BT0 A;  2OOB B;  4B6W A;  2IJ0 A;  2KVR A;  4CO7 A;  3LJ3 A;  3GP7 A;  3C0R B;  1MI0 A;  4AP4 C;  4KKJ A;  4NNJ B;  2CHW A;  2HDE A;  2KTR B;  2DX5 B;  3MC8 A;  3PHX B;  4ZHP A;  2DZJ A;  2HE7 A;  3RNB C;  3HVZ A;  4DQO C;  2X38 A;  2WXM A;  2AWT A;  2G1E A;  1TTN A;  3MC0 B;  3N9Y C;  1R4M B;  3ML8 A;  3BZD B;  2LGX A;  3AU5 A;  2NPT B;  3PRZ A;  2VH2 A;  4WIP A;  5FR6 A;  2WXN A;  4HKZ E;  4BVU C;  4LNF A;  5H92 C;  4US9 A;  1D6E C;  2D07 B;  4W9G A;  4II2 B;  4AJY B;  1C79 A;  2DNF A;  3M95 A;  3UGB B;  2EKE C;  1TS3 A;  5BYR A;  2L83 A;  1P7E A;  2N4F A;  2LZ6 A;  3AMZ A;  1J0G A;  5HKH A;  2KC2 A;  5IAA C;  4HDO A;  4LJP B;  3QAQ A;  3B0A A;  1X1M A;  5EE1 A;  1F77 A;  4IM3 A;  2FIF A;  1XLN A;  2WDR B;  2GOW A;  1KLV A;  2JZZ A;  5EE9 A;  1I7H A;  1YD8 U;  3Q14 C;  3APD A;  2Y5P A;  2JRI B;  4WAF A;  4TKN A;  2LXA A;  2K22 A; 
#chains in the Genus database with same CATH homology
 3ZIM A;  3R7R A;  1E90 A;  3P2B A;  4MEM A;  4PYZ A;  2DYM A;  3ZRF A;  5JZE B;  4MGK E;  4ZYN A;  2D2Q A;  3HIZ A;  5AZG A;  1YQB A;  3SHQ A;  5C1Z A;  2IO1 B;  3HK0 A;  3VQI A;  2N9X A;  2GBJ A;  2K8H A;  3UF8 A;  4WJP A;  3DCG A;  4XZ4 A;  5L95 C;  2A5U A;  4IW0 A;  1E5W A;  4NQK E;  2N1V A;  1U4A A;  2C7M B;  2N9E B;  2RPQ A;  2Y5B B;  3JVZ X;  3TL5 A;  2JRH A;  2LVO A;  4HVB A;  4ZRJ A;  4EEW A;  2LGD A;  3V6E B;  4EOY A;  2M17 A;  1WFY A;  2BF8 B;  5GMV A;  4MEL A;  4GDL B;  4JLC A;  1V6E A;  4WWN A;  5LLI A;  3ZUN A;  3PSE B;  5JHB A;  5TR5 A;  2M0X A;  2NBW B;  3ZO5 B;  3O65 B;  1F9J A;  1S3S G;  2I1K A;  4DDI D;  3PRM B;  3ZNZ B;  1IPG A;  4KDL B;  4PS3 A;  2GBR A;  4RM8 A;  4NJ7 A;  2V3S A;  1K8R B;  4ZRK A;  3R66 C;  1HE8 A;  1Z5S B;  2MA9 B;  2C60 A;  3DVN U;  1MG8 A;  3K9O B;  4GDL A;  4BKT A;  4DHZ E;  4HPL B;  4G11 A;  5JHA A;  1E8W A;  4ANX A;  2O6V B;  2N9P C;  2NS5 A;  4WQO B;  1GG3 A;  2MSE D;  4RMA A;  4PS7 A;  4W9E A;  2WDT B;  5D94 A;  4DHJ B;  1WX8 A;  1C1Y B;  4URK A;  4B95 A;  3RYT A;  3X0W A;  1G6J A;  2O6V A;  1P0R A;  4GDK B;  3WAL A;  4CYE A;  4FBJ B;  3CSF A;  4EFO A;  3QWZ B;  1A5R A;  1IYF A;  3WAP A;  3NZU A;  2PEA A;  2O6V D;  4GXB A;  3WA0 A;  2MQJ A;  4IC7 B;  5LXI B;  2KX3 A;  2ASQ A;  1WM3 A;  1UD7 A;  4MJS B;  2AL6 A;  1V80 A;  3B1L X;  4G3X B;  4BKG A;  2GMI C;  4GDK A;  2CU1 A;  1UZX B;  2MRP A;  5J2R A;  1C3T A;  1WY8 A;  2BWE S;  4DHJ D;  1ZW7 A;  2K8C A;  4I6P A;  5J18 A;  4AUQ C;  2KMC A;  2UWQ A;  3D32 A;  4IUM B;  4DWF A;  3IVF A;  1WRD B;  2D11 A;  4K1R B;  4MJS A;  2B3A A;  4IWP A;  3PVL A;  4KSL C;  3WIM A;  4EUT A;  4XX5 A;  5D2M B;  3W1S A;  2KDE B;  3H6N A;  3Q3F A;  5CHF A;  3KVF B;  1RRB A;  3DBS A;  1WX9 A;  1FXT B;  3EC8 A;  3GZN I;  2IO0 B;  2KXJ A;  2L3Z A;  4OVU A;  1WI0 A;  1P1A A;  5CX3 A;  2EMT A;  2LRU A;  3DVG Y;  2BPS A;  2KFK B;  4HDQ A;  4ICV A;  4KSK C;  4W9K A;  4WAA A;  2L76 A;  1Q0W B;  4ICU A;  3VHT C;  1TGZ B;  2KO3 A;  5AEK B;  2GBN A;  2M8S A;  3RT3 B;  2R2Q A;  2MWS B;  5JH5 C;  1SGH A;  3PLU A;  1WH3 A;  4ASW C;  4II3 B;  2ZPY A;  4HCP B;  4TUU A;  3TBL D;  3ZLZ A;  3UQA A;  2K1F A;  2Z59 B;  2KFK A;  3BY4 B;  5J17 A;  3NOB A;  1UEL A;  2IYD B;  2LGY A;  3ZDT A;  3OJ3 A;  4JQW C;  3AI5 A;  3SDL C;  2FUH B;  4HJK A;  4TV3 A;  2IZV B;  1KM7 A;  2KLC A;  2G45 B;  4GU2 A;  4FHJ A;  2KC1 A;  5CTR C;  5AZF A;  4A20 A;  4A3O A;  2KDF B;  3TMP B;  4ZRI A;  3HM3 A;  3NHE B;  2MBB B;  4KDI C;  3EHV A;  4E71 A;  1RAX A;  4GSW A;  3OLM D;  2DEN B;  4FLH A;  2EMS A;  4KZC A;  2KDI A;  2BWF A;  4DK5 A;  1NI2 A;  1WJU A;  3IFW B;  1WE7 A;  1WJN A;  5IA7 A;  3IG3 A;  2FCM A;  2NVU I;  3ZTD A;  2C5L C;  3IHP C;  4LJO B;  2M4N A;  4A3P A;  3KYC D;  2J0J A;  2PJH A;  3A9J B;  3KYD D;  1WGG A;  2FNJ B;  2K6D B;  3S2A A;  3QJZ A;  1XQQ A;  4DBG A;  2LVP A;  3W1Y A;  5CHV C;  1WR6 E;  2KOX A;  2CKH B;  2LVQ A;  4N9F 4;  3ZNI D;  4X57 B;  2N1W A;  3PGE A;  1R4M I;  4I6L B;  1E7V A;  2IO3 B;  2ZVN A;  4BOS C;  4XC2 A;  2QHO A;  1WJ6 A;  2MBE A;  2A4Z A;  3CMM B;  3A9J A;  2ZZP B;  4WJN A;  3UIO B;  3PRE A;  1LFD A;  2KWV B;  3MJW A;  3PZD A;  2ZNV C;  3EEC A;  5G55 A;  2MP2 A;  3A1Q A;  2KKC A;  4CHK A;  3DPD A;  2WYQ A;  1SE9 A;  3A33 B;  1NBF C;  3WAM A;  4FJV B;  3ZVV A;  2KJH B;  4KIK B;  2BYV E;  2KQS A;  2NBV B;  2LRW A;  2UYZ B;  4IM2 A;  5G2N A;  2G4D B;  3VTW A;  2YLM A;  4BBN C;  4F1S A;  3L17 A;  1KOT A;  1WGR A;  2V1Y A;  4BOZ B;  3QX1 A;  1LQB A;  3ZRC A;  1E8Z A;  3H7P B;  3PHW B;  2N7D A;  4FN2 A;  2NCN A;  3PRP B;  3NS8 A;  2O2V B;  4MGZ E;  1WYW B;  2BYE A;  4DDG D;  4KIK A;  2FID A;  4MM3 A;  4OVV A;  5DPS A;  4NQL B;  1S1Q B;  1VD2 A;  2WX1 A;  3AXC A;  4HK2 A;  2KWC A;  4HXD A;  4HPM B;  1LXD A;  3L54 A;  1RLF A;  2JXX A;  2LUE A;  1YX5 B;  3B08 A;  4IWQ A;  3H7P A;  3L08 A;  5KHO A;  4FJZ A;  1GJZ A;  3KUC B;  2O2V A;  1T0Y A;  3N32 A;  3WAN A;  3HHM A;  3MTN B;  3AU4 A;  1J19 A;  2MW5 A;  4GOC A;  3JSV A;  4NAW B;  1WF9 A;  4BBN F;  2RR9 A;  3PPA A;  2I1J A;  3A4S C;  3OJ4 B;  4F7Z A;  2J0M A;  2L0F A;  2PE6 B;  3KH0 A;  3IBE A;  3PV1 A;  4F8C B;  1ISN A;  3Q3J A;  4YL8 A;  3L16 A;  3ZW3 A;  4MSM B;  3TIX A;  2KNB A;  2BGF A;  1L7Y A;  2K8B A;  3RZF A;  3H7S A;  4NAW A;  4NY0 A;  3U8Z A;  2XEW A;  3SD5 A;  2C7H A;  1WM2 A;  3LDZ E;  4AOF A;  3VH4 B;  3VVW B;  2FCQ A;  5D7G A;  3VUY A;  1YX6 B;  1D3Z A;  2KTR A;  2PPH A;  2KFJ A;  3I3T B;  4TQ1 A;  4G0N B;  3TJP A;  3N30 A;  1YJ1 A;  3PLV A;  1OTR B;  1GUA B;  2KJR A;  4IWO A;  4IG7 B;  2Z0D B;  4I6N B;  3V62 A;  3RD2 A;  2VRR B;  3AUL A;  2FAZ A;  4GIV A;  1M94 A;  4KVG B;  1IP9 A;  1WXV A;  2C7N B;  2FCS A;  2LI5 A;  1I35 A;  4WJQ A;  5L83 A;  2DZK A;  2ZEQ A;  3VFK A;  1V9J A;  1Z2M A;  1V86 A;  1ZKH A;  2ZJD A;  1OGW A;  2L7R A;  4GMV A;  2JF5 A;  2AYO B;  4WWO A;  3VTV A;  2G3Q B;  1E8X A;  2DYB A;  2NPT A;  3PTF C;  5CHW A;  3VH3 B;  2W9N A;  4TQ0 A;  2ZCB A;  1YIW A;  1GC6 A;  1P3Q U;  4B9K A;  2CHX A;  2BKR B;  3ZNG C;  4MGY E;  1ZGU B;  2ZCC A;  3CST A;  3QHT A;  4BFR A;  1VCB A;  3KUZ A;  5E6P A;  3X23 A;  4DHZ B;  3R3M A;  3V61 A;  2JY6 A;  1E7U A;  2HTH A;  2V4L A;  4FAD A;  4K7S A;  4GN1 A;  1V5O A;  2G4S A;  3M63 B;  2IY0 B;  3UIP B;  5DPT A;  3PT2 B;  1Q1O A;  3RCZ A;  2CHZ A;  2NBU A;  3DQV A;  5C23 A;  1EF1 A;  1EO6 A;  2JWZ A;  3T9L A;  2KWU B;  4M8N A;  1I42 A;  4IM0 A;  4K81 A;  4WWP A;  4ZDV A;  3UQB A;  4GGQ A;  5DCN A;  4W9J A;  4EKU A;  2MX2 A;  1KJT A;  3NZS A;  4KV2 A;  5D6J B;  2AEH A;  1V5T A;  3BIN A;  4PYU A;  2JT4 B;  2M1M A;  4FJY A;  4MGI E;  3ONS A;  4WJO A;  1RFA A;  2MLB A;  5BO4 B;  4EZJ A;  2CR5 A;  4HCN B;  4MSQ B;  1EUV B;  4EZL A;  2KHW B;  3APC A;  1R4N I;  4W9C A;  3HM6 X;  3MHS D;  1EF5 A;  3SU8 X;  2MP2 B;  3A1Q B;  3VAW A;  1OEY A;  3ZDM C;  4AWJ A;  3TCA A;  3UIN B;  3QK0 A;  3EFU A;  3VXW A;  1WX7 A;  1J8C A;  2DZI A;  3ALB A;  3V60 A;  3L10 B;  2GBM A;  3ECI A;  1QZE A;  2MBQ A;  3U30 A;  1V81 A;  2ZPN A;  3VUX A;  3DDC B;  3DOW A;  2DZM A;  2KK8 A;  1UGM A;  2LJ5 A;  2K6Q A;  2KTF A;  2R2O A;  4NPN A;  2KMA A;  2JZ3 B;  2K25 A;  2RGF A;  4FHK A;  2RD0 A;  1WXA A;  1TZ1 A;  1UBI A;  2N7E A;  4W9D A;  3M62 B;  4FUL A;  2LXC A;  1Q5W B;  4HWI B;  5AZH A;  2D10 A;  2LAS A;  3H1U A;  4E74 A;  2PE9 A;  4EZK A;  1WZ0 A;  3GOE A;  1TBE A;  3L0W B;  3QQ8 B;  4KZ0 A;  4PS8 A;  2ZNV B;  2AL3 A;  2NR2 A;  2CS4 A;  4JL9 A;  3ML9 A;  2BYF A;  1WGD A;  4W9L A;  5LXH A;  1XD3 B;  3JSV B;  2L0T A;  3QIJ A;  2GBK A;  3PS6 A;  1CMX B;  1V2Y A;  4M0W B;  4JIO U;  5E6N A;  2J7Q B;  2KQ7 A;  2KLG A;  3A4R A;  1BT0 A;  3DVN V;  4GB9 A;  2K39 A;  2OOB B;  2XBB C;  4B6W A;  4HLE A;  2KVR A;  1WJ4 A;  4LDT B;  3QAR A;  3U7D A;  4CO7 A;  3LJ3 A;  2BKF A;  3C0R B;  4AP4 C;  1UBQ A;  4NNJ B;  4ANV A;  4ANU A;  3APF A;  4FA6 A;  3W1S C;  3RUL A;  3DBL I;  1PQS A;  4MDK E;  2D3G A;  2CHW A;  3VDZ A;  3KW5 B;  1XT9 B;  2OJR A;  2KTR B;  2DX5 B;  1WXS A;  3PHX B;  3R7Q A;  5DPR A;  2KX0 A;  2DZJ A;  2HE7 A;  2JVC A;  2HD5 B;  2HJ8 A;  2FCN A;  4LDT D;  3CF6 E;  3QA8 A;  3VTU A;  2AWT A;  1UH6 A;  2LD9 A;  1TTN A;  3DBR I;  4ANW A;  2L00 B;  5E6O A;  2DAF A;  1WGH A;  2DYO A;  1LM8 B;  3ML8 A;  3WAO A;  2RSU A;  1P9D U;  2IO2 B;  2LGX A;  2Z0E B;  3AU5 A;  3RUI B;  2NPT B;  3PRZ A;  3QC8 B;  1P98 A;  4AJW A;  1JRU A;  2KN5 A;  5FR6 A;  1E8Y A;  4BVU C;  1WXM A;  2LWP A;  4LCD E;  3QCA A;  3ENE A;  3KUD B;  1H8C A;  1AAR A;  3L13 A;  2L8J A;  1SIF A;  2REX A;  2D07 B;  4W9G A;  4BKS A;  5EDS A;  4M8M A;  4II2 B;  4AJY B;  1WGY A;  3NY5 A;  3ZNH B;  1GNU A;  3M95 A;  2KDB A;  3UGB B;  4BKS D;  1OQY A;  1WMH B;  3M3J A;  2EKE C;  2XK5 B;  3VUW A;  2KZR A;  4MH0 E;  3OAW A;  4P7I A;  1WZ3 A;  3DVG X;  2YVC A;  1WE6 A;  2N4F A;  3DBH I;  2MBO A;  3K9P B;  1Y8R C;  2IY1 B;  2MCN B;  2LZ6 A;  3N3K B;  1J0G A;  2JPH A;  4DXA B;  4K7W A;  3JW0 X;  5HKH A;  1L2N A;  2KC2 A;  2WWZ A;  2ZVO A;  2KAN A;  3A9K B;  4HDO A;  2MBH A;  4LJP B;  5IAA C;  3QAQ A;  1WMH A;  3B0A A;  3T8M A;  1V49 A;  2DAJ A;  3ZKJ C;  2XK5 A;  2C9W B;  2WX0 A;  1X1M A;  4K7U A;  4NJ6 A;  4IM3 A;  4J6I A;  4E3C A;  2FIF A;  2JUO A;  4G50 A;  4RM9 A;  2J0K A;  3JYU A;  1GC7 A;  2KD0 A;  2GOW A;  4JGH B;  1KLV A;  2DHZ A;  1WR1 A;  3H9D A;  3A9K A;  4W9F A;  3RZW C;  1NDD A;  2JZZ A;  4W9H A;  3ZTC A;  3V6C B;  2L05 A;  1YD8 U;  1H4R A;  1WIA A;  3APD A;  2KJ6 A;  2JRI B;  1OEY J;  5DPW A;  2IBI B;  5KHQ A;  4TKN A;  2LXA A;  4W9I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...