4W9LA

Pvhl:elob:eloc in complex with (2s,4r)-1-((s)-2-((s)-2-acetamido-3,3-dimethylbutanamido)-3,3-dimethylbutanoyl)-4-hydroxy-n-(4-(4-methylthiazol-5-yl)benzyl)pyrrolidine-2-carboxamide (ligand 15)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
103
structure length
101
Chain Sequence
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGEGFTSQTARPQAPATVGLAFRADDTFEALIEPFSSPPELPDVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription elongation factor B polypeptide 2
publication title Structure-Guided Design and Optimization of Small Molecules Targeting the Protein-Protein Interaction between the von Hippel-Lindau (VHL) E3 Ubiquitin Ligase and the Hypoxia Inducible Factor (HIF) Alpha Subunit with in Vitro Nanomolar Affinities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 22
structure length 101
sequence length 103
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4w9lA00
4K7UA 1WXVA 1ZW7A 2KK8A 4J6IA 2BKFA 4G11A 2HD5B 4NNJB 3APFA 4MGYE 3DDCB 2V1YA 2DYOA 4KVGB 3IFWB 2ZJDA 5AZHA 2KX0A 3ZNGC 3Q3FA 4FADA 4BOSC 4CHKA 3A4SC 2RPQA 4M8NA 5J2RA 1WE7A 3D32A 1LQBA 4E3CA 3ZNZB 4TQ1A 4AJYB 3RZWC 5LXIB 4WWOA 3M95A 3KYDD 4OVVA 4FHKA 2O6VA 1WMHB 1WZ0A 2J0JA 2N1VA 2FCQA 4FLHA 1XD3B 2ZPNA 3B1LX 2BWFA 4EKUA 5JZEB 4JL9A 4LCDE 4W9LA 4WAAA 1J8CA 2J0MA 3AULA 1M94A 1WM3A 4HK2A 3ML9A 4ZYNA 5LXHA 4A3OA 3NZUA 1HE8A 2XK5A 4K1RB 3NHEB 4M8MA 3ZNID 2KD0A 3UINB 2R2QA 2BPSA 3RZFA 2MP2B 1WGYA 4HXDA 5G2NA 2KFKB 3QC8B 5AZGA 4I6PA 4BVUC 2MWSB 2ZCCA 3KYCD 1E8ZA 4EEWA 1WI0A 5J17A 3PPAA 1AARA 3PREA 4FJYA 4MGIE 4BKTA 1C1YB 3ECIA 2KDBA 2N9EB 3VTWA 3APCA 1H8CA 1WXMA 2B3AA 3WA0A 3H7PB 4BBNF 4W9CA 4FN2A 2LD9A 3RULA 3NZSA 3VTUA 2IYDB 4YL8A 4E71A 5C1ZA 1UZXB 2LXCA 4MSMB 4NQKE 3VQIA 1R4MI 3RYTA 2ZPYA 3ZIMA 1H4RA 4GDLB 5KHQA 3MHSD 4BKSD 4I6NB 2JUOA 2WYQA 1WJUA 2D11A 4HCNB 4RM9A 3MJWA 2L00B 2DZIA 4ICUA 2L8JA 1WGHA 1GUAB 4IG7B 2MCNB 4F1SA 1TZ1A 1RRBA 2M1MA 4MJSB 4HCPB 1WMHA 2K8CA 1WXAA 1P0RA 4MDKE 4K7SA 1MG8A 5CHWA 2D10A 2AWTA 3ALBA 2YLMA 2CHWA 2BWES 3DBHI 1JRUA 1WE6A 4EZKA 5DCNA 3RD2A 2AYOB 3U8ZA 2BF8B 2MP2A 4AWJA 5DPTA 5IA7A 1V2YA 2AEHA 4HJKA 3SHQA 3JYUA 2C7MB 2KFJA 2KFKA 5L95C 3M63B 2KC1A 2M0XA 2V3SA 4XX5A 3QK0A 3VUWA 3L13A 2L0FA 3JVZX 2KZRA 1SE9A 3OJ3A 2QHOA 3TMPB 3K9OB 3SD5A 2MRPA 2RGFA 5CX3A 1V5OA 4IC7B 5JHAA 3H7PA 3APDA 3PSEB 3WANA 1OEYJ 1WXSA 3VVWB 4MSQB 2DYBA 1Q1OA 2KJ6A 3AU4A 1GC7A 1LXDA 1V49A 2I1KA 2PE9A 4GDLA 4GXBA 4KIKB 1OEYA 4ZRIA 1I42A 4K81A 1UBQA 4ANXA 1SIFA 2DZMA 3T9LA 2KLCA 2REXA 3IVFA 4EFOA 4MJSA 3VUYA 4MELA 2D07B 3AI5A 2A5UA 1VD2A 2KC2A 2EKEC 3X0WA 4ICVA 1J19A 2KJHB 3CSFA 3RUIB 2KX3A 2G4SA 2LWPA 1YQBA 3PHXB 4WJQA 5D2MB 4W9EA 3O65B 3L17A 3VFKA 2MQJA 3WALA 4FBJB 1LFDA 4DWFA 1WZ3A 3A4RA 1UELA 3KUDB 4GDKB 4LDTB 5DPSA 5IAAC 3SU8X 2BKRB 2C7HA 3R3MA 4DBGA 3N3KB 1GG3A 1WF9A 5LLIA 4BBNC 4II3B 3DOWA 2C5LC 1WY8A 4ANVA 2LZ6A 2MBQA 4HDOA 3CF6E 3OLMD 3TBLD 2K8BA 3IBEA 3ZKJC 4DDGD 2K39A 1TBEA 1YJ1A 4WJPA 2DZKA 3BY4B 2AL3A 2L0TA 3JW0X 4G3XB 3ZW3A 1Z2MA 2RD0A 2BGFA 3K9PB 4W9FA 3IG3A 4G50A 4PS7A 2IO3B 5J18A 3PTFC 1CMXB 3GOEA 3L0WB 1RAXA 2FCMA 2N9PC 3DCGA 4IM2A 4A3PA 3V62A 2A4ZA 4MGKE 2GOWA 4JGHB 2JWZA 4HLEA 2JRHA 3HM6X 4KIKA 1WJNA 2CU1A 3V61A 3B0AA 4XC2A 4AJWA 2Z0EB 2PPHA 3A33B 4GSWA 4KSKC 4RMAA 3ZTCA 4W9GA 5E6PA 3DVNU 2JZZA 1WX9A 2PEAA 3QQ8B 5D6JB 1I35A 2LJ5A 4GB9A 1WX8A 4NY0A 1EO6A 3VTVA 3VXWA 1V5TA 2MBHA 4II2B 1WGRA 5FR6A 3W1SA 1P3QU 4DHJD 2MLBA 4NAWB 2KO3A 1XT9B 3ZTDA 4HPLB 2D2QA 2L3ZA 3PZDA 4WJNA 4GDKA 4PYUA 4TUUA 2LRWA 3VDZA 3A9JB 4WQOB 4ASWC 3AU5A 1WGGA 2O2VB 2KDIA 3DQVA 2K6DB 4KDLB 1UH6A 4FJZA 2N9XA 1GJZA 4RM8A 4E74A 2DHZA 1UBIA 4GU2A 5D94A 1WR1A 2L05A 4EOYA 1ISNA 3SDLC 3M62B 2AL6A 2O6VD 3ENEA 2EMSA 2J0KA 1KJTA 1RFAA 3Q3JA 3GZNI 2CHZA 1WM2A 3TCAA 2DENB 2DX5B 2C60A 4PS8A 2GBKA 2IO2B 1E5WA 4WJOA 4X57B 1LM8B 3RCZA 3RT3B 3VHTC 1YIWA 1L7YA 3L54A 3ZRCA 2ZCBA 4P7IA 2NCNA 4JQWC 2JT4B 2HTHA 3S2AA 3KVFB 3A9KB 4GIVA 5DPRA 4JLCA 2KJRA 2KLGA 2KOXA 3W1YA 2NBUA 4NAWA 4W9HA 2K8HA 3NOBA 5G55A 1XQQA 3C0RB 4HVBA 3PRZA 1KLVA 3EECA 3KW5B 4GOCA 2JY6A 3PS6A 3PVLA 2N1WA 3PHWB 4I6LB 4CYEA 2NBVB 3A9JA 2MBBB 2KQSA 2C7NB 4FULA 4IM0A 2O2VA 3PRPB 3R7QA 1E7UA 3DVGY 3QHTA 4A20A 1WR6E 2GBNA 1E7VA 1NI2A 3AXCA 4DXAB 2ZEQA 3TL5A 2ZNVC 3IHPC 1YX6B 1IPGA 2OOBB 3L10B 4IUMB 1IYFA 1G6JA 2IY1B 1ZKHA 1P1AA 2KN5A 1E8XA 3WAOA 2MSED 3ZDTA 3PV1A 3VAWA 2HJ8A 3L16A 2KQ7A 1R4NI 2KTFA 2LXAA 2CKHB 2Y5BB 3UQBA 1V86A 2MBEA 1X1MA 2PE6B 3H7SA 4NQLB 2M17A 3EFUA 4B6WA 4AOFA 4WWNA 5AEKB 3H9DA 2WDTB 2L7RA 1WFYA 2YVCA 4LJOB 2KKCA 3QARA 4CO7A 4KZCA 3PLVA 4KZ0A 5EDSA 4ZRKA 3VUXA 3EC8A 3M3JA 2DAJA 4TQ0A 3UIOB 2ZVNA 4FA6A 3ML8A 2ZVOA 2CS4A 2KWVB 2M4NA 1WJ4A 5JH5C 2GBRA 4F8CB 2L76A 3R66C 2GBMA 3HM3A 4URKA 2OJRA 1P98A 3OJ4B 3ZVVA 2RSUA 3MTNB 1S3SG 2UYZB 1P9DU 1IP9A 2KTRB 2FIFA 4ANUA 4FHJA 3WAMA 3HIZA 1A5RA 4JIOU 4GN1A 1ZGUB 4MGZE 3QAQA 2NBWB 2N7EA 5AZFA 3UIPB 2KVRA 4AUQC 2GMIC 3QCAA 2HE7A 3KH0A 2LGDA 3DVGX 2CHXA 2MA9B 3TJPA 1TTNA 3PRMB 2EMTA 3NY5A 2Z59B 3KUCB 1GNUA 2JXXA 4AP4C 4BFRA 4EZJA 1WGDA 4N9F4 3HK0A 2J7QB 3PT2B 5CHVC 3QA8A 4PYZA 3VH4B 1J0GA 3CMMB 3PLUA 1K8RB 3T8MA 1C3TA 4W9JA 4BKSA 3ZNHB 2LUEA 4K7WA 2K6QA 4NJ7A 1E8YA 3CSTA 2I1JA 1Q5WB 2GBJA 4KDIC 2C9WB 4DK5A 2K1FA 2CR5A 3P2BA 2JF5A 4B95A 1EF5A 2LVQA 3DBSA 3R7RA 3LDZE 2JZ3B 2LASA 3L08A 3N30A 4IWOA 2KANA 3KUZA 1Y8RC 2WWZA 1WX7A 5E6NA 4M0WB 4HPMB 4NJ6A 1TGZB 3A1QB 3UF8A 2JVCA 2KTRA 5JHBA 1PQSA 1T0YA 1V9JA 1U4AA 3HHMA 3H1UA 3PGEA 4KV2A 4ANWA 1NDDA 3DBLI 2UWQA 4DHZB 2KDFB 3EHVA 2V4LA 5CHFA 4MM3A 2Z0DB 3H6NA 3V60A 1WIAA 2IZVB 2XEWA 3QJZA 4W9KA 5KHOA 1Q0WB 2JRIB 2N4FA 1L2NA 1E8WA 2MBOA 4KSLC 4LJPB 1YX5B 2JPHA 5TR5A 1WJ6A 1EF1A 1GC6A 2NPTB 2R2OA 3ZRFA 2FIDA 3ZDMC 5CTRC 4IWQA 4TKNA 2DZJA 5C23A 1S1QB 2KDEB 2MW5A 4MEMA 4W9DA 4IWPA 5D7GA 4ZRJA 2ZZPB 3QIJA 4HDQA 4LDTD 4IW0A 2PJHA 4BKGA 1WYWB 1UGMA 3B08A 3WIMA 2XBBC 5L83A 1F9JA 2LI5A 4EUTA 1RLFA 4W9IA 1UD7A 2VRRB 4IM3A 2BYEA 4BOZB 1EUVB 1Z5SB 2KWCA 2W9NA 3U30A 3DPDA 4EZLA 3JSVB 2WX1A 1VCBA 3NS8A 3OAWA 3TIXA 2RR9A 4NPNA 5HKHA 2ASQA 2LGYA 3A1QA 2KHWB 5BO4B 2KWUB 4DHJB 3I3TB 3ZO5B 2IBIB 1V80A 3UGBB 4F7ZA 4B9KA 3UQAA 4OVUA 4FJVB 2ZNVB 1KOTA 3ZUNA 2DAFA 2KNBA 1D3ZA 2BYFA 2FCNA 3V6CB 3ZLZA 3V6EB 3VH3B 2IY0B 4XZ4A 3N32A 4DDID 2G45B 5E6OA 2G3QB 2K25A 2WX0A 2FNJB 2LRUA 1OTRB 4G0NB 1OGWA 2IO1B 2FUHB 2N7DA 1V81A 2NPTA 1YD8U 4HWIB 2D3GA 3A9KA 1E90A 5GMVA 1V6EA 1SGHA 2FAZA 3BINA 2LVOA 2O6VB 3DBRI 2IO0B 3QX1A 4PS3A 3X23A 2LGXA 4GGQA 2KXJA 1WRDB 1BT0A 5DPWA 4MH0E 3ONSA 2KMCA 2DYMA 2G4DB 2XK5B 3DVNV 4ZDVA 3WAPA 2LVPA 1QZEA 3W1SC 1OQYA 2FCSA 2NS5A 1KM7A 1NBFC 2MX2A 2NVUI 3JSVA 4DHZE 3QWZB 2NR2A 2KMAA 4TV3A 2BYVE 1WH3A 4GMVA 3LJ3A 1FXTB 4WWPA 2M8SA 3U7DA
chains in the Genus database with same CATH superfamily
4K7UA 3BVGA 3APFA 4JWSC 4KVGB 3IFWB 2GB1A 4CHKA 2RPQA 4C7YA 1NI3A 1CZPA 3RNBC 2JZPA 5LXIB 3L4PA 3AE5B 3KYDD 2O6VA 5JZEB 3UI3A 3B1LX 4JL9A 4ZYNA 5EE1A 3T3NA 2ON8A 4BVUC 2JU6X 1R4MB 2ZCCA 3KYCD 4BKTA 3ECIA 3APCA 1H8CA 1WXMA 2B3AA 4N58A 4FN2A 3NZSA 4KX6B 3VTUA 4YL8A 5C1ZA 1L4DB 4NQKE 1JALA 3VQIA 1R4MI 1GB1A 1H4RA 4L23A 3TEYA 2WYQA 4HCNB 2BW2A 3MJWA 2L00B 3C19A 2L8JA 3P4PB 1TZ1A 4DXFA 3AEDB 1LGRA 2D10A 2AWTA 3ALBA 2BF8B 4AWJA 3ZJVA 2WXLA 2KFJA 2KFKA 5L95C 3M63B 2KC1A 5BMGA 2M0XA 3QK0A 2L0FA 2KZRA 1SE9A 3OJ3A 2QHOA 3SD5A 2MRPA 3AEBB 3APDA 1WSPA 3WANA 1OEYJ 3MC0B 3TEXA 4TMAB 1V49A 1F2RC 1OEYA 4KIKB 4XGAB 4ZRIA 1UBQA 1SIFA 3HRDD 2REXA 1VD2A 4C7ZA 1FFVA 1AWDA 1JWBD 2KJHB 2KX3A 3MP9A 1YQBA 1SIJA 4WJQA 3J9CA 2AX5A 1GOZA 4DWFA 1T0QC 3KUDB 4GDKB 2BKRB 2R61A 2KAJA 4XYCA 4BBNC 4II3B 3NVYA 1WY8A 4ANVA 3RFZB 3N1YC 2K8BA 4DDGD 4WJPA 5EE0A 3JW0X 4G3XB 3IG3A 3RPFC 2CU3A 1RAXA 2N9PC 2A4ZA 1XEEA 2H89B 1WRIA 1V1OA 3IT6B 3B0AA 2ZW0A 4HROA 4L2YA 4GSWA 3ZTCA 4RMAA 5E6PA 2JZZA 2PEAA 2QCZA 2VH2A 5C3JB 2Y5PA 1DGJA 4GB9A 4NY0A 3TEZA 1EO6A 4YTNB 1XF5L 3W1SA 2KQ4X 2MLBA 2WDRB 2NTSA 3PZDA 4WJNA 3KQ4A 3GZNB 3ZXRA 3IXSA 3MHZA 1VR9A 1QOBA 2PLPA 1YN3A 4C4VB 2LHDA 4KDLB 1UH6A 3NUHB 2N9XA 1QOFA 3AE7B 2DHZA 4E74A 1UBIA 1IBXA 5D94A 2BVCA 3E9SA 4REZA 1SJHD 1ROEA 2D3AA 1L0YB 3GZNI 3ETRA 2C60A 1EWCA 1YIWA 3L54A 3ZRCA 4USAA 4RGMA 3KVFB 3A9KB 4GIVA 5DPRA 3MC9A 2WXKA 4ZHOA 2KOXA 3PZ7A 5G55A 3NOBA 1KFYB 3C0RB 3PRZA 3PVLA 4LTUA 3PHWB 4I6LB 4CYEA 2NBVB 2C7NB 4FULA 1K53A 2QEJC 3B9JA 3QHTA 2GBNA 4DXAB 3IHPC 4RCOA 1IPGA 1G6JA 2QMTA 4ZHPA 5C2TB 3ZDTA 3VAWA 2KQ7A 3RNGC 2LXAA 2Y3AA 2MBEA 1X1MA 3H7SA 4NQLB 1NVID 4B6WA 1J7BA 3H9DA 2WDTB 2YVCA 4LJOB 1QILA 2VZKD 4KZ0A 4ZRKA 3VUXA 1PDXA 3M3JA 2DAJA 4TQ0A 1F2RI 2KWVB 2I38A 2GBMA 4URKA 1P98A 4KKJA 2DNFA 5EE9A 3MTNB 1JQ4A 3WAMA 4GN1A 1JROA 4YSXB 2KDMA 2N7EA 5AZFA 1MG4A 2RPVA 2CHXA 3AE9B 3TJPA 3PRMB 1JWAD 4AP4C 1GNUA 3LYYA 1VJKA 3QA8A 4PYZA 3T8MA 4JPSA 2H88B 5AUIA 3RNEC 1DOIA 2K1FA 4J3OD 2GLSA 2JF5A 4B95A 1EF5A 4M01A 2QJLA 4IWOA 5EE3A 3KUZA 5FK9C 4M0WB 4HPMB 2LGIA 3CWIA 4HJGE 2J4XA 2KTRA 1TJEA 1T0YA 4BZAA 2ACZB 1SEBD 3EHVA 2V4LA 1C78A 1HTOA 4P1CC 3H6NA 3V60A 1XLNA 1Q0WB 1L2NA 2MBOA 4KSLC 5D3DA 2JPHA 4B0EA 1WJ6A 3ZDMC 4US8A 4IWQA 2DZJA 3QIJA 1Y56A 2DLBA 2J42A 3B08A 3WIMA 2LI5A 3AE4B 1Z5SB 2BBCA 1IUEA 2KWDA 3N20C 4EZLA 3JSVB 3TIXA 5HKHA 2XNAC 4O1NA 4HKZE 3A1QA 4DHJB 2IGDA 2IBIB 3P63A 3Q69A 3UQAA 1PYWD 2V0GA 3V6EB 2JSVX 3VH3B 1PGBA 3B2FA 1WGKA 1ZUD2 1J7AA 4LK0M 3Q6BA 3BYTB 1OTRB 4HPPA 1E6EB 2NPTA 1QOAA 1E90A 5GMVA 2LVOA 2IO0B 3QX1A 4PS3A 4KGSA 3I57A 3ONSA 3GP7A 1VDVA 2XK5B 2LVPA 2FCSA 2NS5A 1NBFC 3RNAC 1UWMA 1XLPA 3QWZB 2NR2A 2KMAA 2BYVE 1JWSD 1WH3A 3Q3MC 4WWPA 3U2SC 1JRPA 3DHIC 1WXVA 1ZW7A 2KK8A 4ARCA 4WIPA 4NNJB 3DDCB 2V1YA 2WXJA 4UDUC 5AZHA 2KX0A 1RM6C 3LB8C 4BOSC 3A4SC 1WE7A 3D32A 1JWMD 1LQBA 1RYJA 4OZAA 4TQ1A 4AJYB 4WWOA 2MJ3A 4FHKA 3W5VB 2J0JA 2FCQA 4Q2JA 1J8CA 1C9FA 1M4VA 4WAAA 2J0MA 5LXHA 1M94A 3ML9A 5H92C 3N1ZC 1HE8A 1C79A 1KLGD 1FCCC 3ZNID 2PMVA 1KTKA 4HXDA 3QC8B 1E8ZA 3TSSA 4XDCA 5J17A 1AARA 4FJYA 4MGIE 2SAKA 1C1YB 2KDBA 3VTWA 3H7PB 4W9CA 3RULA 3Q8CA 2J53A 4E71A 3W2DA 3U4EG 4KGTA 2D11A 2MCNB 2Y5CA 2M1MA 1V97A 2K8CA 1WXAA 4K7SA 1L5PA 4R3DA 1FRDA 3OWEB 3IT4B 2BWES 1JRUA 1WE6A 5D3IB 3SHQA 2G1EA 3JYUA 2PIAA 2V3SA 1BMLC 3P4SB 4XX5A 3VUWA 3TMPB 3HVZA 2ZW1A 3PSEB 4B0MA 3AU4A 1GC7A 4ACFA 2PE9A 4K81A 3W5UB 3IVFA 4JX1C 3AI5A 2QIEB 2EKEC 1J19A 3ABVB 2LWPA 1Q10A 1JWUD 4L1BA 3O65B 2OEDA 2MQJA 1WZ3A 1UELA 2WXPA 1DYQA 2WHIA 2C5LC 4C00A 3OLMD 1YNTE 3W9CB 3TBLD 3IBEA 4A8XC 4RF0A 1F0ZA 2AL3A 1A70A 3K9PB 2SEBD 4PS7A 2IO3B 5J18A 3PTFC 1CMXB 4A3PA 3L0WB 2FCMA 3V62A 3RNFC 1T0RC 2BB5A 4KIKA 5HFYA 3V61A 4PK1A 4AJWA 2PPHA 3URYA 2JYEA 3QQ8B 5IOIA 2LJ5A 3VRBB 3VTVA 2MBHA 3EA6A 1I7HA 1WGRA 1P3QU 4DHJD 1XCQL 4NAWB 2W82A 2K3UA 2VZKB 2L3ZA 2WLBA 4GDKA 4PYUA 4TUUA 2LRWA 1VZ6A 4RFBA 2RDHA 3A9JB 1TZOA 3P42A 1ZP0B 1FRRA 2AQ1B 2O2VB 4DXGA 1HXYD 3AB5A 2ONQA 4M00A 3M62B 4QAYA 2CJOA 3ENEA 2EMSA 1MVKA 3CIRB 3ZGZA 2WU2B 2DENB 2DX5B 4PS8A 2GBKA 2IO2B 1E5WA 2W3RA 4X57B 1K50A 2NCNA 4WURA 1D5MC 5G5GA 3W1YA 2NBUA 2V3NA 3EECA 2KYWA 4DQOC 2MBBB 2IDYA 3PRPB 3N1XC 4C4VA 1P7FA 4M02A 1IYFA 1C4PA 1P1AA 2KN5A 1GB4A 5IO9A 1OQRA 4A90A 3UQBA 2PE6B 2E3TA 1SE4A 4WWNA 5AEKB 1ACCA 1WFYA 3U7DA 2KKCA 4KZCA 3PLVA 5EDSA 2ZVNA 3ML8A 3SFEB 2GBRA 3KLSX 2L76A 3R66C 2BS3B 2OJRA 3SR6A 3OJ4B 3ZVVA 1JCKB 1S3SG 1SE2A 4ANUA 4WAFA 1ZGUB 4MGZE 4HKQA 1BUIC 2NBWB 4MM3B 4JE3B 2KVRA 3UIPB 4OVZA 2HE7A 1TS2A 1CK1A 2MA9B 2HJ1A 3AMZA 5BMIA 3NY5A 1N62A 4BFRA 3AEAB 1J0GA 3CMMB 1TKGA 3FC4A 1I4QA 2BB6A 5FKAC 2GBJA 2C9WB 2CR5A 1OQQA 2NMQA 1N6ZA 1FNVA 2HTME 3DBSA 3LDZE 2JZ3B 2WXGA 2KANA 1Y8RC 5E6NA 2QDFA 1L0VB 4NJ6A 1FMAD 3MC8A 3H1UA 4ANWA 4RF1A 1GAQB 3E56A 1D6EC 2KDFB 2NTTA 5CHFA 1DOYA 2D5GA 2IZVB 5KHOA 3QJZA 2JRIB 4LNKA 1E8WA 2OJWA 1YX5B 1J7CA 5HG2A 5TR5A 1EF1A 2R2OA 1C76A 3AE1B 2KDEB 2I2YA 2ZZPB 4IW0A 4YSYB 2XBBC 2K5PA 3U7ZA 4EUTA 1STEA 2VRRB 2BYEA 4BOZB 1ESFA 4D2KA 3AM9A 3DPDA 3HVDA 4LLGM 2WX1A 1VCBA 4M0WA 2KHWB 5BO4B 3I3TB 1MJDA 1V80A 2QSDA 4B9KA 3NZ3A 1KOTA 2DAFA 3DBRB 3AH7A 1I4PA 2BYFA 4IOIE 2FCNA 3V3XA 3ZLZA 4LNOA 1V1PB 2G45B 3RMKC 2WX0A 2FNJB 3B2GA 2RDBC 1EU4A 2HDEA 4G0NB 2IO1B 1L6VA 4K3BA 1YD8U 2YEPB 4US9A 1V6EA 4YSZB 2FAZA 2LMCA 3DBRI 3O13A 1T5XD 1WRDB 2DYMA 1YMHE 4ZDVA 3ZJUA 3WAPA 1L0XB 3BVMA 1VZ8A 1KM7A 1YQ3B 3JSVA 1SBBB 2UU7A 1D4BA 5JXVA 3LJ3A 1FXTB 2M8SA 1TIFA 4P1BC 1TYGB 4OHJA 4G11A 2HD5B 4MGYE 2DYOA 3KWLA 2ZJDA 1TS4A 1C77A 3AECB 2X38A 2Q5WD 3R2IA 2M56B 4RGTA 3RI7C 4NJCA 1HZ5A 4LNIA 4OVVA 1WMHB 1KRHA 1XD3B 2BWFA 1HEZE 4LCDE 5H8YE 3AULA 3NZUA 2XK5A 4M8MA 4EE2A 3UINB 2R2QA 3RZFA 2MP2B 3BIID 3C8YA 1CJEA 4I6PA 4EEWA 2N9EB 1FXAA 3WA0A 4BBNF 4HRSA 3KWVA 4WH4A 4MSMB 3ZQ4A 1AN8A 1FNWA 2ZPYA 1QOGA 4GDLB 1UGJA 4BKSD 1FXIA 2JUOA 3Q3NC 4RM9A 2DZIA 5HI1A 4ICUA 3SEBA 1WGHA 1GUAB 4IG7B 4F1SA 1RRBA 4MJSB 1MG8A 1HA5A 2YLMA 2CHWA 1ZXHA 2INNE 5DCNA 3RD2A 2AYOB 1C4AA 5IA7A 5DPTA 4HJKA 2C7MB 1B1ZA 4A6QA 3JVZX 4ARIA 2PTLA 3K9OB 2L83A 4IC7B 3H7PA 2LJIA 2W54A 2XN9C 3VVWB 2WDVB 1K51A 1FD6A 1ET9A 4GXBA 4WWMA 2INDC 2DZMA 3T9LA 2KLCA 2D07B 3X0WA 3FAHA 3CSFA 3RUIB 2VH1A 3AN1A 2J52A 2G4SA 5D2MB 1SSNA 3L17A 3VFKA 3GS2A 4ZOHC 2C7HA 4DBGA 1IGDA 3N3KB 1CQVA 3HUIA 5LLIA 1FFUA 3DOWA 2IJ0A 4HDOA 3CF6E 1YN4A 2K39A 1TBEA 2TSSA 2DZKA 3BY4B 2L0TA 3ZW3A 1Z2MA 2QILA 2RD0A 2BGFA 4G50A 3DWGC 4MGKE 4JWUC 2JWZA 2V9HA 4HLEA 2JRHA 1N5XA 3HM6X 1WJNA 2WQYB 4XC2A 4KSKC 4XDDA 3VR9B 3DVNU 5D6JB 1UUPA 1WX8A 2RMMA 2WXHA 1V5TA 3IAM1 3AEFB 2V4IB 1IGCA 2KO3A 1XT9B 3ZTDA 2D2QA 1EM7A 2BQQA 4WQOB 4P6VF 4ASWC 2KDIA 2N9LA 3DQVA 2PVGC 1GJZA 2Z8LA 2LGSA 1WR1A 1ISNA 5IP4D 1TY0A 1RFAA 2K0PA 2CJNA 1WM2A 3RCZA 3RT3B 1L7YA 4NZLB 2ZCBA 4P7IA 1F52A 4JQWC 1T3QA 3S2AA 4JLCA 2KJRA 2KLGA 1ENFA 4N6EB 4NAWA 4C80A 1XQQA 1HTQA 1KLVA 3KW5B 3AV8A 3PS6A 1R4NB 2N1WA 3SFDB 2M19A 3FILB 4YT0B 3A9JA 4IM0A 2O2VA 4A20A 1E7UA 3DVGY 1E7VA 1NI2A 3AXCA 3MJ5A 2ZEQA 3PZ8A 3Q3OC 2ZNVC 4IUMB 3BWUD 2IY1B 3PV1A 2HJ8A 1R4NI 2CKHB 2Y5BB 2MHJA 4RGOS 2BTEA 3BZDB 2M17A 2PW9A 3EFUA 1F77A 4AOFA 2EKIA 2L7RA 3QARA 4CO7A 3RNCC 3FKYA 3EC8A 3UIOB 1YQ4B 2CS4A 2M4NA 1WJ4A 4BAXA 2D3BA 1LO5D 3AEGB 1IP9A 3T3OA 3Q14C 4FHJA 3Q8AA 1ZDVA 1A5RA 4JIOU 2GMIC 1UWXA 3KH0A 3DVGX 3I9V1 1TT5B 4RH6A 3P1MA 1XO3A 2Z59B 2W3SA 4MACA 4EZJA 1WGDA 3PT2B 2J7QB 2LFIA 5G5HA 3PLUA 4OZCA 1C3TA 4W9JA 4BKSA 5BYQA 4K7WA 2K6QA 1E8YA 3CSTA 2I1JA 2IGGA 3AE8B 1Q5WB 3NVVA 4DK5A 1VRAB 3DBLB 3GE3C 3P2BA 3GE8C 2LVQA 4IDIA 2LASA 3U52E 1WX7A 3V05A 2OHFA 2JVCA 2WXIA 1PQSA 1V9JA 1YJIA 1FM0D 3PGEA 4KV2A 1PGXA 2W55A 3DBLI 4YWGG 4DHZB 1QT9A 1YN5A 2V3PA 3AE6B 4MM3A 2G9HD 2Z0DB 2K22A 3MFGA 1E0ZA 1GC6A 4MH8A 1N60A 2MW5A 4MEMA 2KN4A 2WXOA 2MH7A 2DBYA 4HDQA 1R7SA 1QQRA 3TEWA 2PJHA 4BKGA 1WYWB 5L83A 1N5WA 4N59A 2JX5A 1F9JA 2KT7A 4W9IA 1UD7A 4IM3A 2KMMA 3NG0A 2KWCA 2W9NA 3U30A 2KVZA 1SXTA 3OAWA 4NPNA 4KGRA 3R8BA 3DHHC 1V8CA 3Q8FA 3UGBB 1TY2A 1YJJA 4OVUA 2ZNVB 4RGNA 3ZUNA 1SJED 1FIQA 1D3ZA 2WXQA 2IY0B 1MI0A 3N32A 4S0RA 4DDID 1ET6A 4GLSC 5E6OA 1WXQA 1OGWA 2FUHB 2D3GA 3A9KA 4XWWA 1SGHA 2O6VB 3BK1A 3X23A 3TUOA 1BT0A 4MH0E 5AUKA 2FE8A 2G4DB 2GRIA 1FNUA 2FBWB 3W1SC 1OQYA 1KLUD 5LNK1 2MX2A 2BYTA 4DHZE 4TV3A 2L52A 2INCC 4GMVA 2X8XX 1FO4A 4J6IA 2BKFA 4ITKA 1VZ7A 3WCQA 1V1PA 3ZNGC 3Q3FA 4FADA 1I4XA 3LXFA 4M8NA 5J2RA 1T0SC 3NRZA 4E3CA 3ZNZB 3RZWC 3VR8B 1ZDXA 3M95A 1WZ0A 2N1VA 5JHBA 4FLHA 2ZPNA 4EKUA 2JYTA 4W9LA 4HK2A 1WM3A 4ZRPA 3VRAB 4A3OA 4K1RB 3NHEB 2INPE 2KD0A 1VLBA 1SE3A 4AQ7A 2BPSA 1WGYA 5G2NA 2KFKB 5AZGA 2MWSB 1XLQA 2JWUA 1WI0A 4P16A 3PPAA 5BYRA 3PREA 1MPEA 5BYSA 3P4RB 2LD9A 4ZRQA 1AW7A 2IYDB 3ZXVA 1RWSA 1UZXB 2LXCA 4H2AA 2LHEA 1T6BX 3DBHB 3RYTA 2WXNA 3ZIMA 4PT5A 5KHQA 3MHSD 4I6NB 2WDQB 1WJUA 2K9XA 5GXGB 4HCPB 1WMHA 2BS2B 1P0RA 4MDKE 5CHWA 3Q2AC 1E9MA 3I5JC 1EU3A 3DBHI 3RN9C 3DHGC 4EZKA 3U8ZA 4HEA1 2MP2A 1V2YA 2AEHA 5I4DA 3P4QB 3Q8EA 1OFFA 3L13A 3R2TA 2RGFA 5CX3A 1V5OA 1HZ6A 5JHAA 2FUG1 4XWTA 1B9RA 2EELA 2RDGA 2MJEA 1JMLA 1TS3A 1WXSA 1FEHA 4MSQB 2DYBA 1Q1OA 2KJ6A 1NEKB 1LXDA 2I1KA 3BVZA 4GDLA 3EGRA 1I42A 4ANXA 3GB1A 1D5ZC 4EFOA 4MJSA 3VUYA 4MELA 3AE2B 1E7PB 2A5UA 2KC2A 4ICVA 3BK2A 3PHXB 4W9EA 2DWQA 1EWYC 2WXFA 1KH0A 3WALA 4FBJB 1LFDA 1SB3C 1FPYA 3A4RA 1KF6B 4LDTB 5DPSA 5IAAC 3SU8X 2M0AA 3R3MA 3H8HA 1GG3A 1WF9A 1YOVB 4YXDB 2L1AA 1TKEA 2LZ6A 2MBQA 2AQ3B 3ZKJC 1YJ1A 1IBXB 1QF6A 4W9FA 1NYQA 4IM2A 3GOEA 3DCGA 1L4ZB 2GOWA 4JGHB 1AYFA 5TSSA 2CU1A 1I4GA 2Z0EB 3A33B 1D5XC 4W9GA 2PVOD 1I35A 1WX9A 1I4RA 1UF0A 3IAS1 1NYRA 3VXWA 2YEPF 4II2B 3ZYYX 5FR6A 1FCLA 4AS1A 2PKOA 2N7JA 4HPLB 3BYYB 2B76B 3VDZA 1PGAA 4OZBA 3AU5A 1F1HA 1WGGA 2K6DB 2LUMA 2IPKD 4FJZA 4RM8A 1ZOYB 4GU2A 4YTPB 1RFKA 2AQ2B 2L05A 4EOYA 3SDLC 2AL6A 2O6VD 1QKZA 2J0KA 1KJTA 1L6UA 3Q3JA 3EUB2 2CHZA 3TCAA 4C56C 4WJOA 1LM8B 3VHTC 1N61A 2JT4B 2HTHA 2WXMA 2JQRB 3I63C 4W9HA 2K8HA 1C4CA 4HVBA 4GOCA 2JY6A 1P7EA 1DOXA 1TKYA 2MEKA 4TSSA 2KQSA 5E6JA 3R7QA 1WR6E 5BMHA 3OG5A 4FXCA 3TL5A 1YX6B 2OOBB 3L10B 1E10A 1ZE3D 1ZKHA 3N9YC 1E8XA 3WAOA 2MSED 1K52A 3L16A 1MHXA 4K3CA 2KTFA 4YTMB 1V86A 1ZXIA 2WNMA 5T8IA 1PFDA 1QLBB 4A55A 2BT6A 1SF0A 3Q8BA 5IN7A 4KKIA 4WQMA 4FA6A 2KACA 2ZVOA 5JH5C 3AEEB 4F8CB 3HM3A 3FILA 1PUTA 2RSUA 2UYZB 1P9DU 2KTRB 2FIFA 3NVWA 3HIZA 2IGHA 3QAQA 3ZJTA 4AUQC 2BS4B 4OW0A 4XE0A 1I4HA 3QCAA 2LGDA 1TTNA 2EMTA 4LNFA 3KUCB 2JXXA 5FR3A 4N9F4 3HK0A 3NVZA 5CHVC 3VH4B 2L32A 1K8RB 1MHHE 2ICIA 3ZNHB 2LUEA 4NJ7A 2MJDA 4KDIC 4A9AA 3R7RA 3L08A 3N30A 2WWZA 1GPXA 1TGZB 2WP9B 3A1QB 3UF8A 4S17A 3NS1A 1U4AA 2E6XA 3HHMA 3AE3B 1NDDA 3PO0A 2UWQA 1WIAA 2XEWA 4W9KA 2N0SB 2N4FA 4LJPB 5IKCM 4IKGA 2NPTB 3ZRFA 2FIDA 2N9KA 1N63A 5CTRC 4TKNA 4ZYSA 5C23A 1S1QB 2JXTA 3EFCA 1BXTA 4IWPA 4W9DA 5D7GA 4ZRJA 4LDTD 1JW9D 1UGMA 2WXRA 1XLOA 1RLFA 4MT5A 1EUVB 1NENB 1UNSA 3NS8A 2WS3B 2RR9A 2ASQA 2LGYA 2KWUB 3ZO5B 4F7ZA 2WU5B 4FJVB 2WGSA 1XCTL 4CQNA 2KNBA 3NJTA 3V6CB 4XZ4A 4LNNA 2G3QB 2K25A 2LRUA 1MFWA 1HQRD 3DWMA 2N7DA 1V81A 4RNAA 4HWIB 1ZPSA 3BINA 4NAMA 2LEKA 2GI9A 2LGXA 4GGQA 2KXJA 1WYGA 5DPWA 1XXGA 2KMCA 3DVNV 1QZEA 2QC8A 5HHDG 2NVUI 2D3CA 5MPOA 1TS5A 1WWTA
chains in the Genus database with same CATH topology
4K7UA 1WXVA 1ZW7A 2KK8A 4J6IA 2BKFA 4G11A 2HD5B 4NNJB 3APFA 4MGYE 3DDCB 2V1YA 2DYOA 4KVGB 3IFWB 2ZJDA 5AZHA 2KX0A 3ZNGC 3Q3FA 4FADA 4BOSC 4CHKA 3A4SC 2RPQA 4M8NA 5J2RA 1WE7A 3D32A 1LQBA 4E3CA 3ZNZB 4TQ1A 4AJYB 3RZWC 5LXIB 4WWOA 3M95A 3KYDD 4OVVA 4FHKA 2O6VA 1WMHB 1WZ0A 2J0JA 2N1VA 2FCQA 4FLHA 1XD3B 2ZPNA 3B1LX 2BWFA 4EKUA 5JZEB 4JL9A 4LCDE 4W9LA 4WAAA 1J8CA 2J0MA 3AULA 1M94A 1WM3A 4HK2A 3ML9A 4ZYNA 5LXHA 4A3OA 3NZUA 1HE8A 2XK5A 4K1RB 3NHEB 4M8MA 3ZNID 2KD0A 3UINB 2R2QA 2BPSA 3RZFA 2MP2B 1WGYA 4HXDA 5G2NA 2KFKB 3QC8B 5AZGA 4I6PA 4BVUC 2MWSB 2ZCCA 3KYCD 1E8ZA 4EEWA 1WI0A 5J17A 3PPAA 1AARA 3PREA 4FJYA 4MGIE 4BKTA 1C1YB 3ECIA 2KDBA 2N9EB 3VTWA 3APCA 1H8CA 1WXMA 2B3AA 3WA0A 3H7PB 4BBNF 4W9CA 4FN2A 2LD9A 3RULA 3NZSA 3VTUA 2IYDB 4YL8A 4E71A 5C1ZA 1UZXB 2LXCA 4MSMB 4NQKE 3VQIA 1R4MI 3RYTA 2ZPYA 3ZIMA 1H4RA 4GDLB 5KHQA 3MHSD 4BKSD 4I6NB 2JUOA 2WYQA 1WJUA 2D11A 4HCNB 4RM9A 3MJWA 2L00B 2DZIA 4ICUA 2L8JA 1WGHA 1GUAB 4IG7B 2MCNB 4F1SA 1TZ1A 1RRBA 2M1MA 4MJSB 4HCPB 1WMHA 2K8CA 1WXAA 1P0RA 4MDKE 4K7SA 1MG8A 5CHWA 2D10A 2AWTA 3ALBA 2YLMA 2CHWA 2BWES 3DBHI 1JRUA 1WE6A 4EZKA 5DCNA 3RD2A 2AYOB 3U8ZA 2BF8B 2MP2A 4AWJA 5DPTA 5IA7A 1V2YA 2AEHA 4HJKA 3SHQA 3JYUA 2C7MB 2KFJA 2KFKA 5L95C 3M63B 2KC1A 2M0XA 2V3SA 4XX5A 3QK0A 3VUWA 3L13A 2L0FA 3JVZX 2KZRA 1SE9A 3OJ3A 2QHOA 3TMPB 3K9OB 3SD5A 2MRPA 2RGFA 5CX3A 1V5OA 4IC7B 5JHAA 3H7PA 3APDA 3PSEB 3WANA 1OEYJ 1WXSA 3VVWB 4MSQB 2DYBA 1Q1OA 2KJ6A 3AU4A 1GC7A 1LXDA 1V49A 2I1KA 2PE9A 4GDLA 4GXBA 4KIKB 1OEYA 4ZRIA 1I42A 4K81A 1UBQA 4ANXA 1SIFA 2DZMA 3T9LA 2KLCA 2REXA 3IVFA 4EFOA 4MJSA 3VUYA 4MELA 2D07B 3AI5A 2A5UA 1VD2A 2KC2A 2EKEC 3X0WA 4ICVA 1J19A 2KJHB 3CSFA 3RUIB 2KX3A 2G4SA 2LWPA 1YQBA 3PHXB 4WJQA 5D2MB 4W9EA 3O65B 3L17A 3VFKA 2MQJA 3WALA 4FBJB 1LFDA 4DWFA 1WZ3A 3A4RA 1UELA 3KUDB 4GDKB 4LDTB 5DPSA 5IAAC 3SU8X 2BKRB 2C7HA 3R3MA 4DBGA 3N3KB 1GG3A 1WF9A 5LLIA 4BBNC 4II3B 3DOWA 2C5LC 1WY8A 4ANVA 2LZ6A 2MBQA 4HDOA 3CF6E 3OLMD 3TBLD 2K8BA 3IBEA 3ZKJC 4DDGD 2K39A 1TBEA 1YJ1A 4WJPA 2DZKA 3BY4B 2AL3A 2L0TA 3JW0X 4G3XB 3ZW3A 1Z2MA 2RD0A 2BGFA 3K9PB 4W9FA 3IG3A 4G50A 4PS7A 2IO3B 5J18A 3PTFC 1CMXB 3GOEA 3L0WB 1RAXA 2FCMA 2N9PC 3DCGA 4IM2A 4A3PA 3V62A 2A4ZA 4MGKE 2GOWA 4JGHB 2JWZA 4HLEA 2JRHA 3HM6X 4KIKA 1WJNA 2CU1A 3V61A 3B0AA 4XC2A 4AJWA 2Z0EB 2PPHA 3A33B 4GSWA 4KSKC 4RMAA 3ZTCA 4W9GA 5E6PA 3DVNU 2JZZA 1WX9A 2PEAA 3QQ8B 5D6JB 1I35A 2LJ5A 4GB9A 1WX8A 4NY0A 1EO6A 3VTVA 3VXWA 1V5TA 2MBHA 4II2B 1WGRA 5FR6A 3W1SA 1P3QU 4DHJD 2MLBA 4NAWB 2KO3A 1XT9B 3ZTDA 4HPLB 2D2QA 2L3ZA 3PZDA 4WJNA 4GDKA 4PYUA 4TUUA 2LRWA 3VDZA 3A9JB 4WQOB 4ASWC 3AU5A 1WGGA 2O2VB 2KDIA 3DQVA 2K6DB 4KDLB 1UH6A 4FJZA 2N9XA 1GJZA 4RM8A 4E74A 2DHZA 1UBIA 4GU2A 5D94A 1WR1A 2L05A 4EOYA 1ISNA 3SDLC 3M62B 2AL6A 2O6VD 3ENEA 2EMSA 2J0KA 1KJTA 1RFAA 3Q3JA 3GZNI 2CHZA 1WM2A 3TCAA 2DENB 2DX5B 2C60A 4PS8A 2GBKA 2IO2B 1E5WA 4WJOA 4X57B 1LM8B 3RCZA 3RT3B 3VHTC 1YIWA 1L7YA 3L54A 3ZRCA 2ZCBA 4P7IA 2NCNA 4JQWC 2JT4B 2HTHA 3S2AA 3KVFB 3A9KB 4GIVA 5DPRA 4JLCA 2KJRA 2KLGA 2KOXA 3W1YA 2NBUA 4NAWA 4W9HA 2K8HA 3NOBA 5G55A 1XQQA 3C0RB 4HVBA 3PRZA 1KLVA 3EECA 3KW5B 4GOCA 2JY6A 3PS6A 3PVLA 2N1WA 3PHWB 4I6LB 4CYEA 2NBVB 3A9JA 2MBBB 2KQSA 2C7NB 4FULA 4IM0A 2O2VA 3PRPB 3R7QA 1E7UA 3DVGY 3QHTA 4A20A 1WR6E 2GBNA 1E7VA 1NI2A 3AXCA 4DXAB 2ZEQA 3TL5A 2ZNVC 3IHPC 1YX6B 1IPGA 2OOBB 3L10B 4IUMB 1IYFA 1G6JA 2IY1B 1ZKHA 1P1AA 2KN5A 1E8XA 3WAOA 2MSED 3ZDTA 3PV1A 3VAWA 2HJ8A 3L16A 2KQ7A 1R4NI 2KTFA 2LXAA 2CKHB 2Y5BB 3UQBA 1V86A 2MBEA 1X1MA 2PE6B 3H7SA 4NQLB 2M17A 3EFUA 4B6WA 4AOFA 4WWNA 5AEKB 3H9DA 2WDTB 2L7RA 1WFYA 2YVCA 4LJOB 2KKCA 3QARA 4CO7A 4KZCA 3PLVA 4KZ0A 5EDSA 4ZRKA 3VUXA 3EC8A 3M3JA 2DAJA 4TQ0A 3UIOB 2ZVNA 4FA6A 3ML8A 2ZVOA 2CS4A 2KWVB 2M4NA 1WJ4A 5JH5C 2GBRA 4F8CB 2L76A 3R66C 2GBMA 3HM3A 4URKA 2OJRA 1P98A 3OJ4B 3ZVVA 2RSUA 3MTNB 1S3SG 2UYZB 1P9DU 1IP9A 2KTRB 2FIFA 4ANUA 4FHJA 3WAMA 3HIZA 1A5RA 4JIOU 4GN1A 1ZGUB 4MGZE 3QAQA 2NBWB 2N7EA 5AZFA 3UIPB 2KVRA 4AUQC 2GMIC 3QCAA 2HE7A 3KH0A 2LGDA 3DVGX 2CHXA 2MA9B 3TJPA 1TTNA 3PRMB 2EMTA 3NY5A 2Z59B 3KUCB 1GNUA 2JXXA 4AP4C 4BFRA 4EZJA 1WGDA 4N9F4 3HK0A 2J7QB 3PT2B 5CHVC 3QA8A 4PYZA 3VH4B 1J0GA 3CMMB 3PLUA 1K8RB 3T8MA 1C3TA 4W9JA 4BKSA 3ZNHB 2LUEA 4K7WA 2K6QA 4NJ7A 1E8YA 3CSTA 2I1JA 1Q5WB 2GBJA 4KDIC 2C9WB 4DK5A 2K1FA 2CR5A 3P2BA 2JF5A 4B95A 1EF5A 2LVQA 3DBSA 3R7RA 3LDZE 2JZ3B 2LASA 3L08A 3N30A 4IWOA 2KANA 3KUZA 1Y8RC 2WWZA 1WX7A 5E6NA 4M0WB 4HPMB 4NJ6A 1TGZB 3A1QB 3UF8A 2JVCA 2KTRA 5JHBA 1PQSA 1T0YA 1V9JA 1U4AA 3HHMA 3H1UA 3PGEA 4KV2A 4ANWA 1NDDA 3DBLI 2UWQA 4DHZB 2KDFB 3EHVA 2V4LA 5CHFA 4MM3A 2Z0DB 3H6NA 3V60A 1WIAA 2IZVB 2XEWA 3QJZA 4W9KA 5KHOA 1Q0WB 2JRIB 2N4FA 1L2NA 1E8WA 2MBOA 4KSLC 4LJPB 1YX5B 2JPHA 5TR5A 1WJ6A 1EF1A 1GC6A 2NPTB 2R2OA 3ZRFA 2FIDA 3ZDMC 5CTRC 4IWQA 4TKNA 2DZJA 5C23A 1S1QB 2KDEB 2MW5A 4MEMA 4W9DA 4IWPA 5D7GA 4ZRJA 2ZZPB 3QIJA 4HDQA 4LDTD 4IW0A 2PJHA 4BKGA 1WYWB 1UGMA 3B08A 3WIMA 2XBBC 5L83A 1F9JA 2LI5A 4EUTA 1RLFA 4W9IA 1UD7A 2VRRB 4IM3A 2BYEA 4BOZB 1EUVB 1Z5SB 2KWCA 2W9NA 3U30A 3DPDA 4EZLA 3JSVB 2WX1A 1VCBA 3NS8A 3OAWA 3TIXA 2RR9A 4NPNA 5HKHA 2ASQA 2LGYA 3A1QA 2KHWB 5BO4B 2KWUB 4DHJB 3I3TB 3ZO5B 2IBIB 1V80A 3UGBB 4F7ZA 4B9KA 3UQAA 4OVUA 4FJVB 2ZNVB 1KOTA 3ZUNA 2DAFA 2KNBA 1D3ZA 2BYFA 2FCNA 3V6CB 3ZLZA 3V6EB 3VH3B 2IY0B 4XZ4A 3N32A 4DDID 2G45B 5E6OA 2G3QB 2K25A 2WX0A 2FNJB 2LRUA 1OTRB 4G0NB 1OGWA 2IO1B 2FUHB 2N7DA 1V81A 2NPTA 1YD8U 4HWIB 2D3GA 3A9KA 1E90A 5GMVA 1V6EA 1SGHA 2FAZA 3BINA 2LVOA 2O6VB 3DBRI 2IO0B 3QX1A 4PS3A 3X23A 2LGXA 4GGQA 2KXJA 1WRDB 1BT0A 5DPWA 4MH0E 3ONSA 2KMCA 2DYMA 2G4DB 2XK5B 3DVNV 4ZDVA 3WAPA 2LVPA 1QZEA 3W1SC 1OQYA 2FCSA 2NS5A 1KM7A 1NBFC 2MX2A 2NVUI 3JSVA 4DHZE 3QWZB 2NR2A 2KMAA 4TV3A 2BYVE 1WH3A 4GMVA 3LJ3A 1FXTB 4WWPA 2M8SA 3U7DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K7U A;  1WXV A;  1ZW7 A;  2KK8 A;  4J6I A;  2BKF A;  4G11 A;  2HD5 B;  4NNJ B;  3APF A;  4MGY E;  3DDC B;  2V1Y A;  2DYO A;  4KVG B;  3IFW B;  2ZJD A;  5AZH A;  2KX0 A;  3ZNG C;  3Q3F A;  4FAD A;  4BOS C;  4CHK A;  3A4S C;  2RPQ A;  4M8N A;  5J2R A;  1WE7 A;  3D32 A;  1LQB A;  4E3C A;  3ZNZ B;  4TQ1 A;  4AJY B;  3RZW C;  5LXI B;  4WWO A;  3M95 A;  3KYD D;  4OVV A;  4FHK A;  2O6V A;  1WMH B;  1WZ0 A;  2J0J A;  2N1V A;  2FCQ A;  4FLH A;  1XD3 B;  2ZPN A;  3B1L X;  2BWF A;  4EKU A;  5JZE B;  4JL9 A;  4LCD E;  4W9L A;  4WAA A;  1J8C A;  2J0M A;  3AUL A;  1M94 A;  1WM3 A;  4HK2 A;  3ML9 A;  4ZYN A;  5LXH A;  4A3O A;  3NZU A;  1HE8 A;  2XK5 A;  4K1R B;  3NHE B;  4M8M A;  3ZNI D;  2KD0 A;  3UIN B;  2R2Q A;  2BPS A;  3RZF A;  2MP2 B;  1WGY A;  4HXD A;  5G2N A;  2KFK B;  3QC8 B;  5AZG A;  4I6P A;  4BVU C;  2MWS B;  2ZCC A;  3KYC D;  1E8Z A;  4EEW A;  1WI0 A;  5J17 A;  3PPA A;  1AAR A;  3PRE A;  4FJY A;  4MGI E;  4BKT A;  1C1Y B;  3ECI A;  2KDB A;  2N9E B;  3VTW A;  3APC A;  1H8C A;  1WXM A;  2B3A A;  3WA0 A;  3H7P B;  4BBN F;  4W9C A;  4FN2 A;  2LD9 A;  3RUL A;  3NZS A;  3VTU A;  2IYD B;  4YL8 A;  4E71 A;  5C1Z A;  1UZX B;  2LXC A;  4MSM B;  4NQK E;  3VQI A;  1R4M I;  3RYT A;  2ZPY A;  3ZIM A;  1H4R A;  4GDL B;  5KHQ A;  3MHS D;  4BKS D;  4I6N B;  2JUO A;  2WYQ A;  1WJU A;  2D11 A;  4HCN B;  4RM9 A;  3MJW A;  2L00 B;  2DZI A;  4ICU A;  2L8J A;  1WGH A;  1GUA B;  4IG7 B;  2MCN B;  4F1S A;  1TZ1 A;  1RRB A;  2M1M A;  4MJS B;  4HCP B;  1WMH A;  2K8C A;  1WXA A;  1P0R A;  4MDK E;  4K7S A;  1MG8 A;  5CHW A;  2D10 A;  2AWT A;  3ALB A;  2YLM A;  2CHW A;  2BWE S;  3DBH I;  1JRU A;  1WE6 A;  4EZK A;  5DCN A;  3RD2 A;  2AYO B;  3U8Z A;  2BF8 B;  2MP2 A;  4AWJ A;  5DPT A;  5IA7 A;  1V2Y A;  2AEH A;  4HJK A;  3SHQ A;  3JYU A;  2C7M B;  2KFJ A;  2KFK A;  5L95 C;  3M63 B;  2KC1 A;  2M0X A;  2V3S A;  4XX5 A;  3QK0 A;  3VUW A;  3L13 A;  2L0F A;  3JVZ X;  2KZR A;  1SE9 A;  3OJ3 A;  2QHO A;  3TMP B;  3K9O B;  3SD5 A;  2MRP A;  2RGF A;  5CX3 A;  1V5O A;  4IC7 B;  5JHA A;  3H7P A;  3APD A;  3PSE B;  3WAN A;  1OEY J;  1WXS A;  3VVW B;  4MSQ B;  2DYB A;  1Q1O A;  2KJ6 A;  3AU4 A;  1GC7 A;  1LXD A;  1V49 A;  2I1K A;  2PE9 A;  4GDL A;  4GXB A;  4KIK B;  1OEY A;  4ZRI A;  1I42 A;  4K81 A;  1UBQ A;  4ANX A;  1SIF A;  2DZM A;  3T9L A;  2KLC A;  2REX A;  3IVF A;  4EFO A;  4MJS A;  3VUY A;  4MEL A;  2D07 B;  3AI5 A;  2A5U A;  1VD2 A;  2KC2 A;  2EKE C;  3X0W A;  4ICV A;  1J19 A;  2KJH B;  3CSF A;  3RUI B;  2KX3 A;  2G4S A;  2LWP A;  1YQB A;  3PHX B;  4WJQ A;  5D2M B;  4W9E A;  3O65 B;  3L17 A;  3VFK A;  2MQJ A;  3WAL A;  4FBJ B;  1LFD A;  4DWF A;  1WZ3 A;  3A4R A;  1UEL A;  3KUD B;  4GDK B;  4LDT B;  5DPS A;  5IAA C;  3SU8 X;  2BKR B;  2C7H A;  3R3M A;  4DBG A;  3N3K B;  1GG3 A;  1WF9 A;  5LLI A;  4BBN C;  4II3 B;  3DOW A;  2C5L C;  1WY8 A;  4ANV A;  2LZ6 A;  2MBQ A;  4HDO A;  3CF6 E;  3OLM D;  3TBL D;  2K8B A;  3IBE A;  3ZKJ C;  4DDG D;  2K39 A;  1TBE A;  1YJ1 A;  4WJP A;  2DZK A;  3BY4 B;  2AL3 A;  2L0T A;  3JW0 X;  4G3X B;  3ZW3 A;  1Z2M A;  2RD0 A;  2BGF A;  3K9P B;  4W9F A;  3IG3 A;  4G50 A;  4PS7 A;  2IO3 B;  5J18 A;  3PTF C;  1CMX B;  3GOE A;  3L0W B;  1RAX A;  2FCM A;  2N9P C;  3DCG A;  4IM2 A;  4A3P A;  3V62 A;  2A4Z A;  4MGK E;  2GOW A;  4JGH B;  2JWZ A;  4HLE A;  2JRH A;  3HM6 X;  4KIK A;  1WJN A;  2CU1 A;  3V61 A;  3B0A A;  4XC2 A;  4AJW A;  2Z0E B;  2PPH A;  3A33 B;  4GSW A;  4KSK C;  4RMA A;  3ZTC A;  4W9G A;  5E6P A;  3DVN U;  2JZZ A;  1WX9 A;  2PEA A;  3QQ8 B;  5D6J B;  1I35 A;  2LJ5 A;  4GB9 A;  1WX8 A;  4NY0 A;  1EO6 A;  3VTV A;  3VXW A;  1V5T A;  2MBH A;  4II2 B;  1WGR A;  5FR6 A;  3W1S A;  1P3Q U;  4DHJ D;  2MLB A;  4NAW B;  2KO3 A;  1XT9 B;  3ZTD A;  4HPL B;  2D2Q A;  2L3Z A;  3PZD A;  4WJN A;  4GDK A;  4PYU A;  4TUU A;  2LRW A;  3VDZ A;  3A9J B;  4WQO B;  4ASW C;  3AU5 A;  1WGG A;  2O2V B;  2KDI A;  3DQV A;  2K6D B;  4KDL B;  1UH6 A;  4FJZ A;  2N9X A;  1GJZ A;  4RM8 A;  4E74 A;  2DHZ A;  1UBI A;  4GU2 A;  5D94 A;  1WR1 A;  2L05 A;  4EOY A;  1ISN A;  3SDL C;  3M62 B;  2AL6 A;  2O6V D;  3ENE A;  2EMS A;  2J0K A;  1KJT A;  1RFA A;  3Q3J A;  3GZN I;  2CHZ A;  1WM2 A;  3TCA A;  2DEN B;  2DX5 B;  2C60 A;  4PS8 A;  2GBK A;  2IO2 B;  1E5W A;  4WJO A;  4X57 B;  1LM8 B;  3RCZ A;  3RT3 B;  3VHT C;  1YIW A;  1L7Y A;  3L54 A;  3ZRC A;  2ZCB A;  4P7I A;  2NCN A;  4JQW C;  2JT4 B;  2HTH A;  3S2A A;  3KVF B;  3A9K B;  4GIV A;  5DPR A;  4JLC A;  2KJR A;  2KLG A;  2KOX A;  3W1Y A;  2NBU A;  4NAW A;  4W9H A;  2K8H A;  3NOB A;  5G55 A;  1XQQ A;  3C0R B;  4HVB A;  3PRZ A;  1KLV A;  3EEC A;  3KW5 B;  4GOC A;  2JY6 A;  3PS6 A;  3PVL A;  2N1W A;  3PHW B;  4I6L B;  4CYE A;  2NBV B;  3A9J A;  2MBB B;  2KQS A;  2C7N B;  4FUL A;  4IM0 A;  2O2V A;  3PRP B;  3R7Q A;  1E7U A;  3DVG Y;  3QHT A;  4A20 A;  1WR6 E;  2GBN A;  1E7V A;  1NI2 A;  3AXC A;  4DXA B;  2ZEQ A;  3TL5 A;  2ZNV C;  3IHP C;  1YX6 B;  1IPG A;  2OOB B;  3L10 B;  4IUM B;  1IYF A;  1G6J A;  2IY1 B;  1ZKH A;  1P1A A;  2KN5 A;  1E8X A;  3WAO A;  2MSE D;  3ZDT A;  3PV1 A;  3VAW A;  2HJ8 A;  3L16 A;  2KQ7 A;  1R4N I;  2KTF A;  2LXA A;  2CKH B;  2Y5B B;  3UQB A;  1V86 A;  2MBE A;  1X1M A;  2PE6 B;  3H7S A;  4NQL B;  2M17 A;  3EFU A;  4B6W A;  4AOF A;  4WWN A;  5AEK B;  3H9D A;  2WDT B;  2L7R A;  1WFY A;  2YVC A;  4LJO B;  2KKC A;  3QAR A;  4CO7 A;  4KZC A;  3PLV A;  4KZ0 A;  5EDS A;  4ZRK A;  3VUX A;  3EC8 A;  3M3J A;  2DAJ A;  4TQ0 A;  3UIO B;  2ZVN A;  4FA6 A;  3ML8 A;  2ZVO A;  2CS4 A;  2KWV B;  2M4N A;  1WJ4 A;  5JH5 C;  2GBR A;  4F8C B;  2L76 A;  3R66 C;  2GBM A;  3HM3 A;  4URK A;  2OJR A;  1P98 A;  3OJ4 B;  3ZVV A;  2RSU A;  3MTN B;  1S3S G;  2UYZ B;  1P9D U;  1IP9 A;  2KTR B;  2FIF A;  4ANU A;  4FHJ A;  3WAM A;  3HIZ A;  1A5R A;  4JIO U;  4GN1 A;  1ZGU B;  4MGZ E;  3QAQ A;  2NBW B;  2N7E A;  5AZF A;  3UIP B;  2KVR A;  4AUQ C;  2GMI C;  3QCA A;  2HE7 A;  3KH0 A;  2LGD A;  3DVG X;  2CHX A;  2MA9 B;  3TJP A;  1TTN A;  3PRM B;  2EMT A;  3NY5 A;  2Z59 B;  3KUC B;  1GNU A;  2JXX A;  4AP4 C;  4BFR A;  4EZJ A;  1WGD A;  4N9F 4;  3HK0 A;  2J7Q B;  3PT2 B;  5CHV C;  3QA8 A;  4PYZ A;  3VH4 B;  1J0G A;  3CMM B;  3PLU A;  1K8R B;  3T8M A;  1C3T A;  4W9J A;  4BKS A;  3ZNH B;  2LUE A;  4K7W A;  2K6Q A;  4NJ7 A;  1E8Y A;  3CST A;  2I1J A;  1Q5W B;  2GBJ A;  4KDI C;  2C9W B;  4DK5 A;  2K1F A;  2CR5 A;  3P2B A;  2JF5 A;  4B95 A;  1EF5 A;  2LVQ A;  3DBS A;  3R7R A;  3LDZ E;  2JZ3 B;  2LAS A;  3L08 A;  3N30 A;  4IWO A;  2KAN A;  3KUZ A;  1Y8R C;  2WWZ A;  1WX7 A;  5E6N A;  4M0W B;  4HPM B;  4NJ6 A;  1TGZ B;  3A1Q B;  3UF8 A;  2JVC A;  2KTR A;  5JHB A;  1PQS A;  1T0Y A;  1V9J A;  1U4A A;  3HHM A;  3H1U A;  3PGE A;  4KV2 A;  4ANW A;  1NDD A;  3DBL I;  2UWQ A;  4DHZ B;  2KDF B;  3EHV A;  2V4L A;  5CHF A;  4MM3 A;  2Z0D B;  3H6N A;  3V60 A;  1WIA A;  2IZV B;  2XEW A;  3QJZ A;  4W9K A;  5KHO A;  1Q0W B;  2JRI B;  2N4F A;  1L2N A;  1E8W A;  2MBO A;  4KSL C;  4LJP B;  1YX5 B;  2JPH A;  5TR5 A;  1WJ6 A;  1EF1 A;  1GC6 A;  2NPT B;  2R2O A;  3ZRF A;  2FID A;  3ZDM C;  5CTR C;  4IWQ A;  4TKN A;  2DZJ A;  5C23 A;  1S1Q B;  2KDE B;  2MW5 A;  4MEM A;  4W9D A;  4IWP A;  5D7G A;  4ZRJ A;  2ZZP B;  3QIJ A;  4HDQ A;  4LDT D;  4IW0 A;  2PJH A;  4BKG A;  1WYW B;  1UGM A;  3B08 A;  3WIM A;  2XBB C;  5L83 A;  1F9J A;  2LI5 A;  4EUT A;  1RLF A;  4W9I A;  1UD7 A;  2VRR B;  4IM3 A;  2BYE A;  4BOZ B;  1EUV B;  1Z5S B;  2KWC A;  2W9N A;  3U30 A;  3DPD A;  4EZL A;  3JSV B;  2WX1 A;  1VCB A;  3NS8 A;  3OAW A;  3TIX A;  2RR9 A;  4NPN A;  5HKH A;  2ASQ A;  2LGY A;  3A1Q A;  2KHW B;  5BO4 B;  2KWU B;  4DHJ B;  3I3T B;  3ZO5 B;  2IBI B;  1V80 A;  3UGB B;  4F7Z A;  4B9K A;  3UQA A;  4OVU A;  4FJV B;  2ZNV B;  1KOT A;  3ZUN A;  2DAF A;  2KNB A;  1D3Z A;  2BYF A;  2FCN A;  3V6C B;  3ZLZ A;  3V6E B;  3VH3 B;  2IY0 B;  4XZ4 A;  3N32 A;  4DDI D;  2G45 B;  5E6O A;  2G3Q B;  2K25 A;  2WX0 A;  2FNJ B;  2LRU A;  1OTR B;  4G0N B;  1OGW A;  2IO1 B;  2FUH B;  2N7D A;  1V81 A;  2NPT A;  1YD8 U;  4HWI B;  2D3G A;  3A9K A;  1E90 A;  5GMV A;  1V6E A;  1SGH A;  2FAZ A;  3BIN A;  2LVO A;  2O6V B;  3DBR I;  2IO0 B;  3QX1 A;  4PS3 A;  3X23 A;  2LGX A;  4GGQ A;  2KXJ A;  1WRD B;  1BT0 A;  5DPW A;  4MH0 E;  3ONS A;  2KMC A;  2DYM A;  2G4D B;  2XK5 B;  3DVN V;  4ZDV A;  3WAP A;  2LVP A;  1QZE A;  3W1S C;  1OQY A;  2FCS A;  2NS5 A;  1KM7 A;  1NBF C;  2MX2 A;  2NVU I;  3JSV A;  4DHZ E;  3QWZ B;  2NR2 A;  2KMA A;  4TV3 A;  2BYV E;  1WH3 A;  4GMV A;  3LJ3 A;  1FXT B;  4WWP A;  2M8S A;  3U7D A; 
#chains in the Genus database with same CATH topology
 4K7U A;  3BVG A;  3APF A;  4JWS C;  4KVG B;  3IFW B;  2GB1 A;  4CHK A;  2RPQ A;  4C7Y A;  1NI3 A;  1CZP A;  3RNB C;  2JZP A;  5LXI B;  3L4P A;  3AE5 B;  3KYD D;  2O6V A;  5JZE B;  3UI3 A;  3B1L X;  4JL9 A;  4ZYN A;  5EE1 A;  3T3N A;  2ON8 A;  4BVU C;  2JU6 X;  1R4M B;  2ZCC A;  3KYC D;  4BKT A;  3ECI A;  3APC A;  1H8C A;  1WXM A;  2B3A A;  4N58 A;  4FN2 A;  3NZS A;  4KX6 B;  3VTU A;  4YL8 A;  5C1Z A;  1L4D B;  4NQK E;  1JAL A;  3VQI A;  1R4M I;  1GB1 A;  1H4R A;  4L23 A;  3TEY A;  2WYQ A;  4HCN B;  2BW2 A;  3MJW A;  2L00 B;  3C19 A;  2L8J A;  3P4P B;  1TZ1 A;  4DXF A;  3AED B;  1LGR A;  2D10 A;  2AWT A;  3ALB A;  2BF8 B;  4AWJ A;  3ZJV A;  2WXL A;  2KFJ A;  2KFK A;  5L95 C;  3M63 B;  2KC1 A;  5BMG A;  2M0X A;  3QK0 A;  2L0F A;  2KZR A;  1SE9 A;  3OJ3 A;  2QHO A;  3SD5 A;  2MRP A;  3AEB B;  3APD A;  1WSP A;  3WAN A;  1OEY J;  3MC0 B;  3TEX A;  4TMA B;  1V49 A;  1F2R C;  1OEY A;  4KIK B;  4XGA B;  4ZRI A;  1UBQ A;  1SIF A;  3HRD D;  2REX A;  1VD2 A;  4C7Z A;  1FFV A;  1AWD A;  1JWB D;  2KJH B;  2KX3 A;  3MP9 A;  1YQB A;  1SIJ A;  4WJQ A;  3J9C A;  2AX5 A;  1GOZ A;  4DWF A;  1T0Q C;  3KUD B;  4GDK B;  2BKR B;  2R61 A;  2KAJ A;  4XYC A;  4BBN C;  4II3 B;  3NVY A;  1WY8 A;  4ANV A;  3RFZ B;  3N1Y C;  2K8B A;  4DDG D;  4WJP A;  5EE0 A;  3JW0 X;  4G3X B;  3IG3 A;  3RPF C;  2CU3 A;  1RAX A;  2N9P C;  2A4Z A;  1XEE A;  2H89 B;  1WRI A;  1V1O A;  3IT6 B;  3B0A A;  2ZW0 A;  4HRO A;  4L2Y A;  4GSW A;  3ZTC A;  4RMA A;  5E6P A;  2JZZ A;  2PEA A;  2QCZ A;  2VH2 A;  5C3J B;  2Y5P A;  1DGJ A;  4GB9 A;  4NY0 A;  3TEZ A;  1EO6 A;  4YTN B;  1XF5 L;  3W1S A;  2KQ4 X;  2MLB A;  2WDR B;  2NTS A;  3PZD A;  4WJN A;  3KQ4 A;  3GZN B;  3ZXR A;  3IXS A;  3MHZ A;  1VR9 A;  1QOB A;  2PLP A;  1YN3 A;  4C4V B;  2LHD A;  4KDL B;  1UH6 A;  3NUH B;  2N9X A;  1QOF A;  3AE7 B;  2DHZ A;  4E74 A;  1UBI A;  1IBX A;  5D94 A;  2BVC A;  3E9S A;  4REZ A;  1SJH D;  1ROE A;  2D3A A;  1L0Y B;  3GZN I;  3ETR A;  2C60 A;  1EWC A;  1YIW A;  3L54 A;  3ZRC A;  4USA A;  4RGM A;  3KVF B;  3A9K B;  4GIV A;  5DPR A;  3MC9 A;  2WXK A;  4ZHO A;  2KOX A;  3PZ7 A;  5G55 A;  3NOB A;  1KFY B;  3C0R B;  3PRZ A;  3PVL A;  4LTU A;  3PHW B;  4I6L B;  4CYE A;  2NBV B;  2C7N B;  4FUL A;  1K53 A;  2QEJ C;  3B9J A;  3QHT A;  2GBN A;  4DXA B;  3IHP C;  4RCO A;  1IPG A;  1G6J A;  2QMT A;  4ZHP A;  5C2T B;  3ZDT A;  3VAW A;  2KQ7 A;  3RNG C;  2LXA A;  2Y3A A;  2MBE A;  1X1M A;  3H7S A;  4NQL B;  1NVI D;  4B6W A;  1J7B A;  3H9D A;  2WDT B;  2YVC A;  4LJO B;  1QIL A;  2VZK D;  4KZ0 A;  4ZRK A;  3VUX A;  1PDX A;  3M3J A;  2DAJ A;  4TQ0 A;  1F2R I;  2KWV B;  2I38 A;  2GBM A;  4URK A;  1P98 A;  4KKJ A;  2DNF A;  5EE9 A;  3MTN B;  1JQ4 A;  3WAM A;  4GN1 A;  1JRO A;  4YSX B;  2KDM A;  2N7E A;  5AZF A;  1MG4 A;  2RPV A;  2CHX A;  3AE9 B;  3TJP A;  3PRM B;  1JWA D;  4AP4 C;  1GNU A;  3LYY A;  1VJK A;  3QA8 A;  4PYZ A;  3T8M A;  4JPS A;  2H88 B;  5AUI A;  3RNE C;  1DOI A;  2K1F A;  4J3O D;  2GLS A;  2JF5 A;  4B95 A;  1EF5 A;  4M01 A;  2QJL A;  4IWO A;  5EE3 A;  3KUZ A;  5FK9 C;  4M0W B;  4HPM B;  2LGI A;  3CWI A;  4HJG E;  2J4X A;  2KTR A;  1TJE A;  1T0Y A;  4BZA A;  2ACZ B;  1SEB D;  3EHV A;  2V4L A;  1C78 A;  1HTO A;  4P1C C;  3H6N A;  3V60 A;  1XLN A;  1Q0W B;  1L2N A;  2MBO A;  4KSL C;  5D3D A;  2JPH A;  4B0E A;  1WJ6 A;  3ZDM C;  4US8 A;  4IWQ A;  2DZJ A;  3QIJ A;  1Y56 A;  2DLB A;  2J42 A;  3B08 A;  3WIM A;  2LI5 A;  3AE4 B;  1Z5S B;  2BBC A;  1IUE A;  2KWD A;  3N20 C;  4EZL A;  3JSV B;  3TIX A;  5HKH A;  2XNA C;  4O1N A;  4HKZ E;  3A1Q A;  4DHJ B;  2IGD A;  2IBI B;  3P63 A;  3Q69 A;  3UQA A;  1PYW D;  2V0G A;  3V6E B;  2JSV X;  3VH3 B;  1PGB A;  3B2F A;  1WGK A;  1ZUD 2;  1J7A A;  4LK0 M;  3Q6B A;  3BYT B;  1OTR B;  4HPP A;  1E6E B;  2NPT A;  1QOA A;  1E90 A;  5GMV A;  2LVO A;  2IO0 B;  3QX1 A;  4PS3 A;  4KGS A;  3I57 A;  3ONS A;  3GP7 A;  1VDV A;  2XK5 B;  2LVP A;  2FCS A;  2NS5 A;  1NBF C;  3RNA C;  1UWM A;  1XLP A;  3QWZ B;  2NR2 A;  2KMA A;  2BYV E;  1JWS D;  1WH3 A;  3Q3M C;  4WWP A;  3U2S C;  1JRP A;  3DHI C;  1WXV A;  1ZW7 A;  2KK8 A;  4ARC A;  4WIP A;  4NNJ B;  3DDC B;  2V1Y A;  2WXJ A;  4UDU C;  5AZH A;  2KX0 A;  1RM6 C;  3LB8 C;  4BOS C;  3A4S C;  1WE7 A;  3D32 A;  1JWM D;  1LQB A;  1RYJ A;  4OZA A;  4TQ1 A;  4AJY B;  4WWO A;  2MJ3 A;  4FHK A;  3W5V B;  2J0J A;  2FCQ A;  4Q2J A;  1J8C A;  1C9F A;  1M4V A;  4WAA A;  2J0M A;  5LXH A;  1M94 A;  3ML9 A;  5H92 C;  3N1Z C;  1HE8 A;  1C79 A;  1KLG D;  1FCC C;  3ZNI D;  2PMV A;  1KTK A;  4HXD A;  3QC8 B;  1E8Z A;  3TSS A;  4XDC A;  5J17 A;  1AAR A;  4FJY A;  4MGI E;  2SAK A;  1C1Y B;  2KDB A;  3VTW A;  3H7P B;  4W9C A;  3RUL A;  3Q8C A;  2J53 A;  4E71 A;  3W2D A;  3U4E G;  4KGT A;  2D11 A;  2MCN B;  2Y5C A;  2M1M A;  1V97 A;  2K8C A;  1WXA A;  4K7S A;  1L5P A;  4R3D A;  1FRD A;  3OWE B;  3IT4 B;  2BWE S;  1JRU A;  1WE6 A;  5D3I B;  3SHQ A;  2G1E A;  3JYU A;  2PIA A;  2V3S A;  1BML C;  3P4S B;  4XX5 A;  3VUW A;  3TMP B;  3HVZ A;  2ZW1 A;  3PSE B;  4B0M A;  3AU4 A;  1GC7 A;  4ACF A;  2PE9 A;  4K81 A;  3W5U B;  3IVF A;  4JX1 C;  3AI5 A;  2QIE B;  2EKE C;  1J19 A;  3ABV B;  2LWP A;  1Q10 A;  1JWU D;  4L1B A;  3O65 B;  2OED A;  2MQJ A;  1WZ3 A;  1UEL A;  2WXP A;  1DYQ A;  2WHI A;  2C5L C;  4C00 A;  3OLM D;  1YNT E;  3W9C B;  3TBL D;  3IBE A;  4A8X C;  4RF0 A;  1F0Z A;  2AL3 A;  1A70 A;  3K9P B;  2SEB D;  4PS7 A;  2IO3 B;  5J18 A;  3PTF C;  1CMX B;  4A3P A;  3L0W B;  2FCM A;  3V62 A;  3RNF C;  1T0R C;  2BB5 A;  4KIK A;  5HFY A;  3V61 A;  4PK1 A;  4AJW A;  2PPH A;  3URY A;  2JYE A;  3QQ8 B;  5IOI A;  2LJ5 A;  3VRB B;  3VTV A;  2MBH A;  3EA6 A;  1I7H A;  1WGR A;  1P3Q U;  4DHJ D;  1XCQ L;  4NAW B;  2W82 A;  2K3U A;  2VZK B;  2L3Z A;  2WLB A;  4GDK A;  4PYU A;  4TUU A;  2LRW A;  1VZ6 A;  4RFB A;  2RDH A;  3A9J B;  1TZO A;  3P42 A;  1ZP0 B;  1FRR A;  2AQ1 B;  2O2V B;  4DXG A;  1HXY D;  3AB5 A;  2ONQ A;  4M00 A;  3M62 B;  4QAY A;  2CJO A;  3ENE A;  2EMS A;  1MVK A;  3CIR B;  3ZGZ A;  2WU2 B;  2DEN B;  2DX5 B;  4PS8 A;  2GBK A;  2IO2 B;  1E5W A;  2W3R A;  4X57 B;  1K50 A;  2NCN A;  4WUR A;  1D5M C;  5G5G A;  3W1Y A;  2NBU A;  2V3N A;  3EEC A;  2KYW A;  4DQO C;  2MBB B;  2IDY A;  3PRP B;  3N1X C;  4C4V A;  1P7F A;  4M02 A;  1IYF A;  1C4P A;  1P1A A;  2KN5 A;  1GB4 A;  5IO9 A;  1OQR A;  4A90 A;  3UQB A;  2PE6 B;  2E3T A;  1SE4 A;  4WWN A;  5AEK B;  1ACC A;  1WFY A;  3U7D A;  2KKC A;  4KZC A;  3PLV A;  5EDS A;  2ZVN A;  3ML8 A;  3SFE B;  2GBR A;  3KLS X;  2L76 A;  3R66 C;  2BS3 B;  2OJR A;  3SR6 A;  3OJ4 B;  3ZVV A;  1JCK B;  1S3S G;  1SE2 A;  4ANU A;  4WAF A;  1ZGU B;  4MGZ E;  4HKQ A;  1BUI C;  2NBW B;  4MM3 B;  4JE3 B;  2KVR A;  3UIP B;  4OVZ A;  2HE7 A;  1TS2 A;  1CK1 A;  2MA9 B;  2HJ1 A;  3AMZ A;  5BMI A;  3NY5 A;  1N62 A;  4BFR A;  3AEA B;  1J0G A;  3CMM B;  1TKG A;  3FC4 A;  1I4Q A;  2BB6 A;  5FKA C;  2GBJ A;  2C9W B;  2CR5 A;  1OQQ A;  2NMQ A;  1N6Z A;  1FNV A;  2HTM E;  3DBS A;  3LDZ E;  2JZ3 B;  2WXG A;  2KAN A;  1Y8R C;  5E6N A;  2QDF A;  1L0V B;  4NJ6 A;  1FMA D;  3MC8 A;  3H1U A;  4ANW A;  4RF1 A;  1GAQ B;  3E56 A;  1D6E C;  2KDF B;  2NTT A;  5CHF A;  1DOY A;  2D5G A;  2IZV B;  5KHO A;  3QJZ A;  2JRI B;  4LNK A;  1E8W A;  2OJW A;  1YX5 B;  1J7C A;  5HG2 A;  5TR5 A;  1EF1 A;  2R2O A;  1C76 A;  3AE1 B;  2KDE B;  2I2Y A;  2ZZP B;  4IW0 A;  4YSY B;  2XBB C;  2K5P A;  3U7Z A;  4EUT A;  1STE A;  2VRR B;  2BYE A;  4BOZ B;  1ESF A;  4D2K A;  3AM9 A;  3DPD A;  3HVD A;  4LLG M;  2WX1 A;  1VCB A;  4M0W A;  2KHW B;  5BO4 B;  3I3T B;  1MJD A;  1V80 A;  2QSD A;  4B9K A;  3NZ3 A;  1KOT A;  2DAF A;  3DBR B;  3AH7 A;  1I4P A;  2BYF A;  4IOI E;  2FCN A;  3V3X A;  3ZLZ A;  4LNO A;  1V1P B;  2G45 B;  3RMK C;  2WX0 A;  2FNJ B;  3B2G A;  2RDB C;  1EU4 A;  2HDE A;  4G0N B;  2IO1 B;  1L6V A;  4K3B A;  1YD8 U;  2YEP B;  4US9 A;  1V6E A;  4YSZ B;  2FAZ A;  2LMC A;  3DBR I;  3O13 A;  1T5X D;  1WRD B;  2DYM A;  1YMH E;  4ZDV A;  3ZJU A;  3WAP A;  1L0X B;  3BVM A;  1VZ8 A;  1KM7 A;  1YQ3 B;  3JSV A;  1SBB B;  2UU7 A;  1D4B A;  5JXV A;  3LJ3 A;  1FXT B;  2M8S A;  1TIF A;  4P1B C;  1TYG B;  4OHJ A;  4G11 A;  2HD5 B;  4MGY E;  2DYO A;  3KWL A;  2ZJD A;  1TS4 A;  1C77 A;  3AEC B;  2X38 A;  2Q5W D;  3R2I A;  2M56 B;  4RGT A;  3RI7 C;  4NJC A;  1HZ5 A;  4LNI A;  4OVV A;  1WMH B;  1KRH A;  1XD3 B;  2BWF A;  1HEZ E;  4LCD E;  5H8Y E;  3AUL A;  3NZU A;  2XK5 A;  4M8M A;  4EE2 A;  3UIN B;  2R2Q A;  3RZF A;  2MP2 B;  3BII D;  3C8Y A;  1CJE A;  4I6P A;  4EEW A;  2N9E B;  1FXA A;  3WA0 A;  4BBN F;  4HRS A;  3KWV A;  4WH4 A;  4MSM B;  3ZQ4 A;  1AN8 A;  1FNW A;  2ZPY A;  1QOG A;  4GDL B;  1UGJ A;  4BKS D;  1FXI A;  2JUO A;  3Q3N C;  4RM9 A;  2DZI A;  5HI1 A;  4ICU A;  3SEB A;  1WGH A;  1GUA B;  4IG7 B;  4F1S A;  1RRB A;  4MJS B;  1MG8 A;  1HA5 A;  2YLM A;  2CHW A;  1ZXH A;  2INN E;  5DCN A;  3RD2 A;  2AYO B;  1C4A A;  5IA7 A;  5DPT A;  4HJK A;  2C7M B;  1B1Z A;  4A6Q A;  3JVZ X;  4ARI A;  2PTL A;  3K9O B;  2L83 A;  4IC7 B;  3H7P A;  2LJI A;  2W54 A;  2XN9 C;  3VVW B;  2WDV B;  1K51 A;  1FD6 A;  1ET9 A;  4GXB A;  4WWM A;  2IND C;  2DZM A;  3T9L A;  2KLC A;  2D07 B;  3X0W A;  3FAH A;  3CSF A;  3RUI B;  2VH1 A;  3AN1 A;  2J52 A;  2G4S A;  5D2M B;  1SSN A;  3L17 A;  3VFK A;  3GS2 A;  4ZOH C;  2C7H A;  4DBG A;  1IGD A;  3N3K B;  1CQV A;  3HUI A;  5LLI A;  1FFU A;  3DOW A;  2IJ0 A;  4HDO A;  3CF6 E;  1YN4 A;  2K39 A;  1TBE A;  2TSS A;  2DZK A;  3BY4 B;  2L0T A;  3ZW3 A;  1Z2M A;  2QIL A;  2RD0 A;  2BGF A;  4G50 A;  3DWG C;  4MGK E;  4JWU C;  2JWZ A;  2V9H A;  4HLE A;  2JRH A;  1N5X A;  3HM6 X;  1WJN A;  2WQY B;  4XC2 A;  4KSK C;  4XDD A;  3VR9 B;  3DVN U;  5D6J B;  1UUP A;  1WX8 A;  2RMM A;  2WXH A;  1V5T A;  3IAM 1;  3AEF B;  2V4I B;  1IGC A;  2KO3 A;  1XT9 B;  3ZTD A;  2D2Q A;  1EM7 A;  2BQQ A;  4WQO B;  4P6V F;  4ASW C;  2KDI A;  2N9L A;  3DQV A;  2PVG C;  1GJZ A;  2Z8L A;  2LGS A;  1WR1 A;  1ISN A;  5IP4 D;  1TY0 A;  1RFA A;  2K0P A;  2CJN A;  1WM2 A;  3RCZ A;  3RT3 B;  1L7Y A;  4NZL B;  2ZCB A;  4P7I A;  1F52 A;  4JQW C;  1T3Q A;  3S2A A;  4JLC A;  2KJR A;  2KLG A;  1ENF A;  4N6E B;  4NAW A;  4C80 A;  1XQQ A;  1HTQ A;  1KLV A;  3KW5 B;  3AV8 A;  3PS6 A;  1R4N B;  2N1W A;  3SFD B;  2M19 A;  3FIL B;  4YT0 B;  3A9J A;  4IM0 A;  2O2V A;  4A20 A;  1E7U A;  3DVG Y;  1E7V A;  1NI2 A;  3AXC A;  3MJ5 A;  2ZEQ A;  3PZ8 A;  3Q3O C;  2ZNV C;  4IUM B;  3BWU D;  2IY1 B;  3PV1 A;  2HJ8 A;  1R4N I;  2CKH B;  2Y5B B;  2MHJ A;  4RGO S;  2BTE A;  3BZD B;  2M17 A;  2PW9 A;  3EFU A;  1F77 A;  4AOF A;  2EKI A;  2L7R A;  3QAR A;  4CO7 A;  3RNC C;  3FKY A;  3EC8 A;  3UIO B;  1YQ4 B;  2CS4 A;  2M4N A;  1WJ4 A;  4BAX A;  2D3B A;  1LO5 D;  3AEG B;  1IP9 A;  3T3O A;  3Q14 C;  4FHJ A;  3Q8A A;  1ZDV A;  1A5R A;  4JIO U;  2GMI C;  1UWX A;  3KH0 A;  3DVG X;  3I9V 1;  1TT5 B;  4RH6 A;  3P1M A;  1XO3 A;  2Z59 B;  2W3S A;  4MAC A;  4EZJ A;  1WGD A;  3PT2 B;  2J7Q B;  2LFI A;  5G5H A;  3PLU A;  4OZC A;  1C3T A;  4W9J A;  4BKS A;  5BYQ A;  4K7W A;  2K6Q A;  1E8Y A;  3CST A;  2I1J A;  2IGG A;  3AE8 B;  1Q5W B;  3NVV A;  4DK5 A;  1VRA B;  3DBL B;  3GE3 C;  3P2B A;  3GE8 C;  2LVQ A;  4IDI A;  2LAS A;  3U52 E;  1WX7 A;  3V05 A;  2OHF A;  2JVC A;  2WXI A;  1PQS A;  1V9J A;  1YJI A;  1FM0 D;  3PGE A;  4KV2 A;  1PGX A;  2W55 A;  3DBL I;  4YWG G;  4DHZ B;  1QT9 A;  1YN5 A;  2V3P A;  3AE6 B;  4MM3 A;  2G9H D;  2Z0D B;  2K22 A;  3MFG A;  1E0Z A;  1GC6 A;  4MH8 A;  1N60 A;  2MW5 A;  4MEM A;  2KN4 A;  2WXO A;  2MH7 A;  2DBY A;  4HDQ A;  1R7S A;  1QQR A;  3TEW A;  2PJH A;  4BKG A;  1WYW B;  5L83 A;  1N5W A;  4N59 A;  2JX5 A;  1F9J A;  2KT7 A;  4W9I A;  1UD7 A;  4IM3 A;  2KMM A;  3NG0 A;  2KWC A;  2W9N A;  3U30 A;  2KVZ A;  1SXT A;  3OAW A;  4NPN A;  4KGR A;  3R8B A;  3DHH C;  1V8C A;  3Q8F A;  3UGB B;  1TY2 A;  1YJJ A;  4OVU A;  2ZNV B;  4RGN A;  3ZUN A;  1SJE D;  1FIQ A;  1D3Z A;  2WXQ A;  2IY0 B;  1MI0 A;  3N32 A;  4S0R A;  4DDI D;  1ET6 A;  4GLS C;  5E6O A;  1WXQ A;  1OGW A;  2FUH B;  2D3G A;  3A9K A;  4XWW A;  1SGH A;  2O6V B;  3BK1 A;  3X23 A;  3TUO A;  1BT0 A;  4MH0 E;  5AUK A;  2FE8 A;  2G4D B;  2GRI A;  1FNU A;  2FBW B;  3W1S C;  1OQY A;  1KLU D;  5LNK 1;  2MX2 A;  2BYT A;  4DHZ E;  4TV3 A;  2L52 A;  2INC C;  4GMV A;  2X8X X;  1FO4 A;  4J6I A;  2BKF A;  4ITK A;  1VZ7 A;  3WCQ A;  1V1P A;  3ZNG C;  3Q3F A;  4FAD A;  1I4X A;  3LXF A;  4M8N A;  5J2R A;  1T0S C;  3NRZ A;  4E3C A;  3ZNZ B;  3RZW C;  3VR8 B;  1ZDX A;  3M95 A;  1WZ0 A;  2N1V A;  5JHB A;  4FLH A;  2ZPN A;  4EKU A;  2JYT A;  4W9L A;  4HK2 A;  1WM3 A;  4ZRP A;  3VRA B;  4A3O A;  4K1R B;  3NHE B;  2INP E;  2KD0 A;  1VLB A;  1SE3 A;  4AQ7 A;  2BPS A;  1WGY A;  5G2N A;  2KFK B;  5AZG A;  2MWS B;  1XLQ A;  2JWU A;  1WI0 A;  4P16 A;  3PPA A;  5BYR A;  3PRE A;  1MPE A;  5BYS A;  3P4R B;  2LD9 A;  4ZRQ A;  1AW7 A;  2IYD B;  3ZXV A;  1RWS A;  1UZX B;  2LXC A;  4H2A A;  2LHE A;  1T6B X;  3DBH B;  3RYT A;  2WXN A;  3ZIM A;  4PT5 A;  5KHQ A;  3MHS D;  4I6N B;  2WDQ B;  1WJU A;  2K9X A;  5GXG B;  4HCP B;  1WMH A;  2BS2 B;  1P0R A;  4MDK E;  5CHW A;  3Q2A C;  1E9M A;  3I5J C;  1EU3 A;  3DBH I;  3RN9 C;  3DHG C;  4EZK A;  3U8Z A;  4HEA 1;  2MP2 A;  1V2Y A;  2AEH A;  5I4D A;  3P4Q B;  3Q8E A;  1OFF A;  3L13 A;  3R2T A;  2RGF A;  5CX3 A;  1V5O A;  1HZ6 A;  5JHA A;  2FUG 1;  4XWT A;  1B9R A;  2EEL A;  2RDG A;  2MJE A;  1JML A;  1TS3 A;  1WXS A;  1FEH A;  4MSQ B;  2DYB A;  1Q1O A;  2KJ6 A;  1NEK B;  1LXD A;  2I1K A;  3BVZ A;  4GDL A;  3EGR A;  1I42 A;  4ANX A;  3GB1 A;  1D5Z C;  4EFO A;  4MJS A;  3VUY A;  4MEL A;  3AE2 B;  1E7P B;  2A5U A;  2KC2 A;  4ICV A;  3BK2 A;  3PHX B;  4W9E A;  2DWQ A;  1EWY C;  2WXF A;  1KH0 A;  3WAL A;  4FBJ B;  1LFD A;  1SB3 C;  1FPY A;  3A4R A;  1KF6 B;  4LDT B;  5DPS A;  5IAA C;  3SU8 X;  2M0A A;  3R3M A;  3H8H A;  1GG3 A;  1WF9 A;  1YOV B;  4YXD B;  2L1A A;  1TKE A;  2LZ6 A;  2MBQ A;  2AQ3 B;  3ZKJ C;  1YJ1 A;  1IBX B;  1QF6 A;  4W9F A;  1NYQ A;  4IM2 A;  3GOE A;  3DCG A;  1L4Z B;  2GOW A;  4JGH B;  1AYF A;  5TSS A;  2CU1 A;  1I4G A;  2Z0E B;  3A33 B;  1D5X C;  4W9G A;  2PVO D;  1I35 A;  1WX9 A;  1I4R A;  1UF0 A;  3IAS 1;  1NYR A;  3VXW A;  2YEP F;  4II2 B;  3ZYY X;  5FR6 A;  1FCL A;  4AS1 A;  2PKO A;  2N7J A;  4HPL B;  3BYY B;  2B76 B;  3VDZ A;  1PGA A;  4OZB A;  3AU5 A;  1F1H A;  1WGG A;  2K6D B;  2LUM A;  2IPK D;  4FJZ A;  4RM8 A;  1ZOY B;  4GU2 A;  4YTP B;  1RFK A;  2AQ2 B;  2L05 A;  4EOY A;  3SDL C;  2AL6 A;  2O6V D;  1QKZ A;  2J0K A;  1KJT A;  1L6U A;  3Q3J A;  3EUB 2;  2CHZ A;  3TCA A;  4C56 C;  4WJO A;  1LM8 B;  3VHT C;  1N61 A;  2JT4 B;  2HTH A;  2WXM A;  2JQR B;  3I63 C;  4W9H A;  2K8H A;  1C4C A;  4HVB A;  4GOC A;  2JY6 A;  1P7E A;  1DOX A;  1TKY A;  2MEK A;  4TSS A;  2KQS A;  5E6J A;  3R7Q A;  1WR6 E;  5BMH A;  3OG5 A;  4FXC A;  3TL5 A;  1YX6 B;  2OOB B;  3L10 B;  1E10 A;  1ZE3 D;  1ZKH A;  3N9Y C;  1E8X A;  3WAO A;  2MSE D;  1K52 A;  3L16 A;  1MHX A;  4K3C A;  2KTF A;  4YTM B;  1V86 A;  1ZXI A;  2WNM A;  5T8I A;  1PFD A;  1QLB B;  4A55 A;  2BT6 A;  1SF0 A;  3Q8B A;  5IN7 A;  4KKI A;  4WQM A;  4FA6 A;  2KAC A;  2ZVO A;  5JH5 C;  3AEE B;  4F8C B;  3HM3 A;  3FIL A;  1PUT A;  2RSU A;  2UYZ B;  1P9D U;  2KTR B;  2FIF A;  3NVW A;  3HIZ A;  2IGH A;  3QAQ A;  3ZJT A;  4AUQ C;  2BS4 B;  4OW0 A;  4XE0 A;  1I4H A;  3QCA A;  2LGD A;  1TTN A;  2EMT A;  4LNF A;  3KUC B;  2JXX A;  5FR3 A;  4N9F 4;  3HK0 A;  3NVZ A;  5CHV C;  3VH4 B;  2L32 A;  1K8R B;  1MHH E;  2ICI A;  3ZNH B;  2LUE A;  4NJ7 A;  2MJD A;  4KDI C;  4A9A A;  3R7R A;  3L08 A;  3N30 A;  2WWZ A;  1GPX A;  1TGZ B;  2WP9 B;  3A1Q B;  3UF8 A;  4S17 A;  3NS1 A;  1U4A A;  2E6X A;  3HHM A;  3AE3 B;  1NDD A;  3PO0 A;  2UWQ A;  1WIA A;  2XEW A;  4W9K A;  2N0S B;  2N4F A;  4LJP B;  5IKC M;  4IKG A;  2NPT B;  3ZRF A;  2FID A;  2N9K A;  1N63 A;  5CTR C;  4TKN A;  4ZYS A;  5C23 A;  1S1Q B;  2JXT A;  3EFC A;  1BXT A;  4IWP A;  4W9D A;  5D7G A;  4ZRJ A;  4LDT D;  1JW9 D;  1UGM A;  2WXR A;  1XLO A;  1RLF A;  4MT5 A;  1EUV B;  1NEN B;  1UNS A;  3NS8 A;  2WS3 B;  2RR9 A;  2ASQ A;  2LGY A;  2KWU B;  3ZO5 B;  4F7Z A;  2WU5 B;  4FJV B;  2WGS A;  1XCT L;  4CQN A;  2KNB A;  3NJT A;  3V6C B;  4XZ4 A;  4LNN A;  2G3Q B;  2K25 A;  2LRU A;  1MFW A;  1HQR D;  3DWM A;  2N7D A;  1V81 A;  4RNA A;  4HWI B;  1ZPS A;  3BIN A;  4NAM A;  2LEK A;  2GI9 A;  2LGX A;  4GGQ A;  2KXJ A;  1WYG A;  5DPW A;  1XXG A;  2KMC A;  3DVN V;  1QZE A;  2QC8 A;  5HHD G;  2NVU I;  2D3C A;  5MPO A;  1TS5 A;  1WWT A; 
#chains in the Genus database with same CATH homology
 4K7U A;  1WXV A;  1ZW7 A;  2KK8 A;  4J6I A;  2BKF A;  4G11 A;  2HD5 B;  4NNJ B;  3APF A;  4MGY E;  3DDC B;  2V1Y A;  2DYO A;  4KVG B;  3IFW B;  2ZJD A;  5AZH A;  2KX0 A;  3ZNG C;  3Q3F A;  4FAD A;  4BOS C;  4CHK A;  3A4S C;  2RPQ A;  4M8N A;  5J2R A;  1WE7 A;  3D32 A;  1LQB A;  4E3C A;  3ZNZ B;  4TQ1 A;  4AJY B;  3RZW C;  5LXI B;  4WWO A;  3M95 A;  3KYD D;  4OVV A;  4FHK A;  2O6V A;  1WMH B;  1WZ0 A;  2J0J A;  2N1V A;  2FCQ A;  4FLH A;  1XD3 B;  2ZPN A;  3B1L X;  2BWF A;  4EKU A;  5JZE B;  4JL9 A;  4LCD E;  4W9L A;  4WAA A;  1J8C A;  2J0M A;  3AUL A;  1M94 A;  1WM3 A;  4HK2 A;  3ML9 A;  4ZYN A;  5LXH A;  4A3O A;  3NZU A;  1HE8 A;  2XK5 A;  4K1R B;  3NHE B;  4M8M A;  3ZNI D;  2KD0 A;  3UIN B;  2R2Q A;  2BPS A;  3RZF A;  2MP2 B;  1WGY A;  4HXD A;  5G2N A;  2KFK B;  3QC8 B;  5AZG A;  4I6P A;  4BVU C;  2MWS B;  2ZCC A;  3KYC D;  1E8Z A;  4EEW A;  1WI0 A;  5J17 A;  3PPA A;  1AAR A;  3PRE A;  4FJY A;  4MGI E;  4BKT A;  1C1Y B;  3ECI A;  2KDB A;  2N9E B;  3VTW A;  3APC A;  1H8C A;  1WXM A;  2B3A A;  3WA0 A;  3H7P B;  4BBN F;  4W9C A;  4FN2 A;  2LD9 A;  3RUL A;  3NZS A;  3VTU A;  2IYD B;  4YL8 A;  4E71 A;  5C1Z A;  1UZX B;  2LXC A;  4MSM B;  4NQK E;  3VQI A;  1R4M I;  3RYT A;  2ZPY A;  3ZIM A;  1H4R A;  4GDL B;  5KHQ A;  3MHS D;  4BKS D;  4I6N B;  2JUO A;  2WYQ A;  1WJU A;  2D11 A;  4HCN B;  4RM9 A;  3MJW A;  2L00 B;  2DZI A;  4ICU A;  2L8J A;  1WGH A;  1GUA B;  4IG7 B;  2MCN B;  4F1S A;  1TZ1 A;  1RRB A;  2M1M A;  4MJS B;  4HCP B;  1WMH A;  2K8C A;  1WXA A;  1P0R A;  4MDK E;  4K7S A;  1MG8 A;  5CHW A;  2D10 A;  2AWT A;  3ALB A;  2YLM A;  2CHW A;  2BWE S;  3DBH I;  1JRU A;  1WE6 A;  4EZK A;  5DCN A;  3RD2 A;  2AYO B;  3U8Z A;  2BF8 B;  2MP2 A;  4AWJ A;  5DPT A;  5IA7 A;  1V2Y A;  2AEH A;  4HJK A;  3SHQ A;  3JYU A;  2C7M B;  2KFJ A;  2KFK A;  5L95 C;  3M63 B;  2KC1 A;  2M0X A;  2V3S A;  4XX5 A;  3QK0 A;  3VUW A;  3L13 A;  2L0F A;  3JVZ X;  2KZR A;  1SE9 A;  3OJ3 A;  2QHO A;  3TMP B;  3K9O B;  3SD5 A;  2MRP A;  2RGF A;  5CX3 A;  1V5O A;  4IC7 B;  5JHA A;  3H7P A;  3APD A;  3PSE B;  3WAN A;  1OEY J;  1WXS A;  3VVW B;  4MSQ B;  2DYB A;  1Q1O A;  2KJ6 A;  3AU4 A;  1GC7 A;  1LXD A;  1V49 A;  2I1K A;  2PE9 A;  4GDL A;  4GXB A;  4KIK B;  1OEY A;  4ZRI A;  1I42 A;  4K81 A;  1UBQ A;  4ANX A;  1SIF A;  2DZM A;  3T9L A;  2KLC A;  2REX A;  3IVF A;  4EFO A;  4MJS A;  3VUY A;  4MEL A;  2D07 B;  3AI5 A;  2A5U A;  1VD2 A;  2KC2 A;  2EKE C;  3X0W A;  4ICV A;  1J19 A;  2KJH B;  3CSF A;  3RUI B;  2KX3 A;  2G4S A;  2LWP A;  1YQB A;  3PHX B;  4WJQ A;  5D2M B;  4W9E A;  3O65 B;  3L17 A;  3VFK A;  2MQJ A;  3WAL A;  4FBJ B;  1LFD A;  4DWF A;  1WZ3 A;  3A4R A;  1UEL A;  3KUD B;  4GDK B;  4LDT B;  5DPS A;  5IAA C;  3SU8 X;  2BKR B;  2C7H A;  3R3M A;  4DBG A;  3N3K B;  1GG3 A;  1WF9 A;  5LLI A;  4BBN C;  4II3 B;  3DOW A;  2C5L C;  1WY8 A;  4ANV A;  2LZ6 A;  2MBQ A;  4HDO A;  3CF6 E;  3OLM D;  3TBL D;  2K8B A;  3IBE A;  3ZKJ C;  4DDG D;  2K39 A;  1TBE A;  1YJ1 A;  4WJP A;  2DZK A;  3BY4 B;  2AL3 A;  2L0T A;  3JW0 X;  4G3X B;  3ZW3 A;  1Z2M A;  2RD0 A;  2BGF A;  3K9P B;  4W9F A;  3IG3 A;  4G50 A;  4PS7 A;  2IO3 B;  5J18 A;  3PTF C;  1CMX B;  3GOE A;  3L0W B;  1RAX A;  2FCM A;  2N9P C;  3DCG A;  4IM2 A;  4A3P A;  3V62 A;  2A4Z A;  4MGK E;  2GOW A;  4JGH B;  2JWZ A;  4HLE A;  2JRH A;  3HM6 X;  4KIK A;  1WJN A;  2CU1 A;  3V61 A;  3B0A A;  4XC2 A;  4AJW A;  2Z0E B;  2PPH A;  3A33 B;  4GSW A;  4KSK C;  4RMA A;  3ZTC A;  4W9G A;  5E6P A;  3DVN U;  2JZZ A;  1WX9 A;  2PEA A;  3QQ8 B;  5D6J B;  1I35 A;  2LJ5 A;  4GB9 A;  1WX8 A;  4NY0 A;  1EO6 A;  3VTV A;  3VXW A;  1V5T A;  2MBH A;  4II2 B;  1WGR A;  5FR6 A;  3W1S A;  1P3Q U;  4DHJ D;  2MLB A;  4NAW B;  2KO3 A;  1XT9 B;  3ZTD A;  4HPL B;  2D2Q A;  2L3Z A;  3PZD A;  4WJN A;  4GDK A;  4PYU A;  4TUU A;  2LRW A;  3VDZ A;  3A9J B;  4WQO B;  4ASW C;  3AU5 A;  1WGG A;  2O2V B;  2KDI A;  3DQV A;  2K6D B;  4KDL B;  1UH6 A;  4FJZ A;  2N9X A;  1GJZ A;  4RM8 A;  4E74 A;  2DHZ A;  1UBI A;  4GU2 A;  5D94 A;  1WR1 A;  2L05 A;  4EOY A;  1ISN A;  3SDL C;  3M62 B;  2AL6 A;  2O6V D;  3ENE A;  2EMS A;  2J0K A;  1KJT A;  1RFA A;  3Q3J A;  3GZN I;  2CHZ A;  1WM2 A;  3TCA A;  2DEN B;  2DX5 B;  2C60 A;  4PS8 A;  2GBK A;  2IO2 B;  1E5W A;  4WJO A;  4X57 B;  1LM8 B;  3RCZ A;  3RT3 B;  3VHT C;  1YIW A;  1L7Y A;  3L54 A;  3ZRC A;  2ZCB A;  4P7I A;  2NCN A;  4JQW C;  2JT4 B;  2HTH A;  3S2A A;  3KVF B;  3A9K B;  4GIV A;  5DPR A;  4JLC A;  2KJR A;  2KLG A;  2KOX A;  3W1Y A;  2NBU A;  4NAW A;  4W9H A;  2K8H A;  3NOB A;  5G55 A;  1XQQ A;  3C0R B;  4HVB A;  3PRZ A;  1KLV A;  3EEC A;  3KW5 B;  4GOC A;  2JY6 A;  3PS6 A;  3PVL A;  2N1W A;  3PHW B;  4I6L B;  4CYE A;  2NBV B;  3A9J A;  2MBB B;  2KQS A;  2C7N B;  4FUL A;  4IM0 A;  2O2V A;  3PRP B;  3R7Q A;  1E7U A;  3DVG Y;  3QHT A;  4A20 A;  1WR6 E;  2GBN A;  1E7V A;  1NI2 A;  3AXC A;  4DXA B;  2ZEQ A;  3TL5 A;  2ZNV C;  3IHP C;  1YX6 B;  1IPG A;  2OOB B;  3L10 B;  4IUM B;  1IYF A;  1G6J A;  2IY1 B;  1ZKH A;  1P1A A;  2KN5 A;  1E8X A;  3WAO A;  2MSE D;  3ZDT A;  3PV1 A;  3VAW A;  2HJ8 A;  3L16 A;  2KQ7 A;  1R4N I;  2KTF A;  2LXA A;  2CKH B;  2Y5B B;  3UQB A;  1V86 A;  2MBE A;  1X1M A;  2PE6 B;  3H7S A;  4NQL B;  2M17 A;  3EFU A;  4B6W A;  4AOF A;  4WWN A;  5AEK B;  3H9D A;  2WDT B;  2L7R A;  1WFY A;  2YVC A;  4LJO B;  2KKC A;  3QAR A;  4CO7 A;  4KZC A;  3PLV A;  4KZ0 A;  5EDS A;  4ZRK A;  3VUX A;  3EC8 A;  3M3J A;  2DAJ A;  4TQ0 A;  3UIO B;  2ZVN A;  4FA6 A;  3ML8 A;  2ZVO A;  2CS4 A;  2KWV B;  2M4N A;  1WJ4 A;  5JH5 C;  2GBR A;  4F8C B;  2L76 A;  3R66 C;  2GBM A;  3HM3 A;  4URK A;  2OJR A;  1P98 A;  3OJ4 B;  3ZVV A;  2RSU A;  3MTN B;  1S3S G;  2UYZ B;  1P9D U;  1IP9 A;  2KTR B;  2FIF A;  4ANU A;  4FHJ A;  3WAM A;  3HIZ A;  1A5R A;  4JIO U;  4GN1 A;  1ZGU B;  4MGZ E;  3QAQ A;  2NBW B;  2N7E A;  5AZF A;  3UIP B;  2KVR A;  4AUQ C;  2GMI C;  3QCA A;  2HE7 A;  3KH0 A;  2LGD A;  3DVG X;  2CHX A;  2MA9 B;  3TJP A;  1TTN A;  3PRM B;  2EMT A;  3NY5 A;  2Z59 B;  3KUC B;  1GNU A;  2JXX A;  4AP4 C;  4BFR A;  4EZJ A;  1WGD A;  4N9F 4;  3HK0 A;  2J7Q B;  3PT2 B;  5CHV C;  3QA8 A;  4PYZ A;  3VH4 B;  1J0G A;  3CMM B;  3PLU A;  1K8R B;  3T8M A;  1C3T A;  4W9J A;  4BKS A;  3ZNH B;  2LUE A;  4K7W A;  2K6Q A;  4NJ7 A;  1E8Y A;  3CST A;  2I1J A;  1Q5W B;  2GBJ A;  4KDI C;  2C9W B;  4DK5 A;  2K1F A;  2CR5 A;  3P2B A;  2JF5 A;  4B95 A;  1EF5 A;  2LVQ A;  3DBS A;  3R7R A;  3LDZ E;  2JZ3 B;  2LAS A;  3L08 A;  3N30 A;  4IWO A;  2KAN A;  3KUZ A;  1Y8R C;  2WWZ A;  1WX7 A;  5E6N A;  4M0W B;  4HPM B;  4NJ6 A;  1TGZ B;  3A1Q B;  3UF8 A;  2JVC A;  2KTR A;  5JHB A;  1PQS A;  1T0Y A;  1V9J A;  1U4A A;  3HHM A;  3H1U A;  3PGE A;  4KV2 A;  4ANW A;  1NDD A;  3DBL I;  2UWQ A;  4DHZ B;  2KDF B;  3EHV A;  2V4L A;  5CHF A;  4MM3 A;  2Z0D B;  3H6N A;  3V60 A;  1WIA A;  2IZV B;  2XEW A;  3QJZ A;  4W9K A;  5KHO A;  1Q0W B;  2JRI B;  2N4F A;  1L2N A;  1E8W A;  2MBO A;  4KSL C;  4LJP B;  1YX5 B;  2JPH A;  5TR5 A;  1WJ6 A;  1EF1 A;  1GC6 A;  2NPT B;  2R2O A;  3ZRF A;  2FID A;  3ZDM C;  5CTR C;  4IWQ A;  4TKN A;  2DZJ A;  5C23 A;  1S1Q B;  2KDE B;  2MW5 A;  4MEM A;  4W9D A;  4IWP A;  5D7G A;  4ZRJ A;  2ZZP B;  3QIJ A;  4HDQ A;  4LDT D;  4IW0 A;  2PJH A;  4BKG A;  1WYW B;  1UGM A;  3B08 A;  3WIM A;  2XBB C;  5L83 A;  1F9J A;  2LI5 A;  4EUT A;  1RLF A;  4W9I A;  1UD7 A;  2VRR B;  4IM3 A;  2BYE A;  4BOZ B;  1EUV B;  1Z5S B;  2KWC A;  2W9N A;  3U30 A;  3DPD A;  4EZL A;  3JSV B;  2WX1 A;  1VCB A;  3NS8 A;  3OAW A;  3TIX A;  2RR9 A;  4NPN A;  5HKH A;  2ASQ A;  2LGY A;  3A1Q A;  2KHW B;  5BO4 B;  2KWU B;  4DHJ B;  3I3T B;  3ZO5 B;  2IBI B;  1V80 A;  3UGB B;  4F7Z A;  4B9K A;  3UQA A;  4OVU A;  4FJV B;  2ZNV B;  1KOT A;  3ZUN A;  2DAF A;  2KNB A;  1D3Z A;  2BYF A;  2FCN A;  3V6C B;  3ZLZ A;  3V6E B;  3VH3 B;  2IY0 B;  4XZ4 A;  3N32 A;  4DDI D;  2G45 B;  5E6O A;  2G3Q B;  2K25 A;  2WX0 A;  2FNJ B;  2LRU A;  1OTR B;  4G0N B;  1OGW A;  2IO1 B;  2FUH B;  2N7D A;  1V81 A;  2NPT A;  1YD8 U;  4HWI B;  2D3G A;  3A9K A;  1E90 A;  5GMV A;  1V6E A;  1SGH A;  2FAZ A;  3BIN A;  2LVO A;  2O6V B;  3DBR I;  2IO0 B;  3QX1 A;  4PS3 A;  3X23 A;  2LGX A;  4GGQ A;  2KXJ A;  1WRD B;  1BT0 A;  5DPW A;  4MH0 E;  3ONS A;  2KMC A;  2DYM A;  2G4D B;  2XK5 B;  3DVN V;  4ZDV A;  3WAP A;  2LVP A;  1QZE A;  3W1S C;  1OQY A;  2FCS A;  2NS5 A;  1KM7 A;  1NBF C;  2MX2 A;  2NVU I;  3JSV A;  4DHZ E;  3QWZ B;  2NR2 A;  2KMA A;  4TV3 A;  2BYV E;  1WH3 A;  4GMV A;  3LJ3 A;  1FXT B;  4WWP A;  2M8S A;  3U7D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...