3P4RB

Crystal structure of menaquinol:fumarate oxidoreductase in complex with glutarate
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
243
structure length
243
Chain Sequence
AEMKNLKIEVVRYNPEVDTAPHSAFYEVPYDATTSLLDALGYIKDNLAPDLSYRWSCRMAICGSCGMMVNNVPKLACKTFLRDYTDGMKVEALANFPIERDLVVDMTHFIESLEAIKPYIIGNSRTADQGTNIQTPAQMAKYHQFSGCINCGLCYAACPQFGLNPEFIGPAAITLAHRYNEDSRDHGKKERMAQLNSQNGVWSCTFVGYCSEVCPKHVDPAAAIQQGKVESSKDFLIATLKPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Fumarate reductase flavoprotein subunit
publication title Geometric restraint drives on- and off-pathway catalysis by the Escherichia coli menaquinol:fumarate reductase.
pubmed doi rcsb
source organism Escherichia coli 042
total genus 70
structure length 243
sequence length 243
chains with identical sequence N
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2010-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13183 Fer4_8 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 3p4rB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3p4rB01
1R7SA 1ZXIA 1GTHA 1TKEA 1V97A 2QIEB 5H92C 5C3JB 1SF0A 4P6VF 2BS3B 1CJEA 3W9CB 5G5HA 1YQ4B 2LEKA 1FMAD 1VLBA 3HUIA 4HROA 1QOGA 1JQ4A 1ROEA 2MJ3A 1QOAA 2WS3B 3BIID 2PVGC 5G5GA 3CIRB 1XLOA 1QLBB 1JALA 2KMMA 2OHFA 1KF6B 2K22A 3DWMA 3AECB 2W3SA 1L6UA 1TYGB 3AV8A 1L0VB 4YTNB 4YSXB 1UWMA 3AH7A 3B2FA 1FO4A 1T3QA 2E3TA 4C7YA 4USAA 1GPXA 4N6EB 3AEBB 1QOFA 2W3RA 4C80A 1JRPA 5EE9A 1FIQA 1H7XA 1FXAA 1N5XA 1FM0D 1N62A 1JWBD 3ETRA 1KFYB 3AMZA 3SR6A 2BT6A 1XLPA 4FXCA 3AEEB 3AEAB 1OQQA 1A70A 4YT0B 3AE1B 1L6VA 2L52A 2W55A 2WDVB 5H8YE 1B9RA 3AEDB 2MJDA 1FXIA 1FRRA 1YJIA 5AUIA 1PUTA 4A9AA 1SB3C 1GAQB 1VDVA 1KRHA 4JX1C 4YXDB 1E9MA 2MH7A 3HRDD 3KWLA 3AM9A 3NVYA 1WYGA 1AWDA 3DWGC 2WU5B 4KX6B 1PDXA 3FC4A 1NYRA 4WWMA 1SIJA 4US9A 3ZYYX 2WLBA 1IUEA 3AE2B 4YTMB 3AE3B 1N60A 3LB8C 2EKIA 3SFEB 2WQYB 1RYJA 3VRAB 1L5PA 3ABVB 1XLQA 2Q5WD 3EUB2 3SFDB 5EE0A 1F0ZA 2N0SB 1ZUD2 2CJNA 1NEKB 2JQRB 2L83A 4ZOHC 1N63A 5C2TB 2MJEA 4YTPB 1DOXA 3P4RB 5GXGB 3P4PB 2W54A 1NVID 1DGJA 1TKYA 1RM6C 3P4QB 2QJLA 4US8A 3VR9B 2CJOA 3NS1A 3NRZA 2H88B 3P1MA 5AUKA 1DOYA 3AE6B 4C7ZA 1GT8A 4ZHOA 3AE5B 4ITKA 1XO3A 2WP9B 3WCQA 3AE9B 3VRBB 1YJJA 1WRIA 1NI3A 2FBWB 1J7CA 4LTUA 3AE8B 5EE1A 1E6EB 1CZPA 1VJKA 2K5PA 1J7AA 1JWAD 3B2GA 3AE4B 4N58A 2G1EA 1OQRA 3B9JA 3AB5A 2K9XA 3NVWA 4HRSA 1TJEA 3AE7B 1NENB 2DWQA 2B76B 2BS4B 2JX5A 4ZHPA 3CWIA 2ACZB 1FFVA 4IDIA 1AYFA 3AEFB 1JROA 2WDRB 1WWTA 2KAJA 1EWYC 1QF6A 1YQ3B 1WGKA 1E7PB 2WDQB 2CU3A 4JWSC 3NVZA 4YSYB 1WXQA 3RPFC 1OFFA 1V8CA 3W5UB 2BS2B 5EE3A 2HTME 1H7WA 1ZP0B 2M56B 3PO0A 2H89B 1NYQA 1QT9A 2AX5A 2PKOA 3AN1A 3NVVA 1E0ZA 3L4PA 1I7HA 1JW9D 1FFUA 2M19A 2PVOD 4N59A 3AEGB 1QOBA 3LXFA 1RWSA 4JWUC 1N5WA 1PFDA 3W5VB 3P63A 1RFKA 2Y5CA 4WQMA 2WU2B 1FRDA 1ZOYB 3CF4A 3HVZA 4YSZB 1J7BA 1GTEA 3P4SB 3VR8B 1DOIA 1N61A 3FAHA 1TKGA 2DBYA 1XLNA 2PIAA 1E10A 5MPOA
chains in the Genus database with same CATH superfamily
3AU5A 3Q3MC 2QIEB 1CJEA 3W9CB 1FMAD 1VLBA 2Y5PA 1QOGA 3R8BA 3I5JC 4TSSA 2EELA 1L6UA 2A4ZA 1TYGB 3EHVA 1GPXA 4N6EB 2W3RA 5JZEB 2FNJB 2DENB 2M0AA 3KUDB 3Q2AC 1XT9B 2LZ6A 4M8MA 4GOCA 3KUZA 4NAWB 3AEEB 1C4CA 4GU2A 2LUMA 3EFUA 2W55A 4KGTA 4B0MA 2KO3A 4GIVA 3TJPA 4HPMB 2J4XA 3WAMA 1WI0A 4WWMA 1HZ6A 2JPHA 3V60A 2ON8A 3O13A 1UBQA 1IUEA 3AE3B 4HDOA 2JZZA 3GE8C 1WGRA 2WNMA 3ZNID 3ABVB 1WXSA 5D2MB 1E10A 2ZPNA 4MM3A 1ZUD2 2Z0EB 1RM6C 3NHEB 1PGBA 4ZRQA 5IP4D 3DHGC 2KZRA 3QARA 4W9FA 3TSSA 4ANVA 1XCQL 3B0AA 4GN1A 1NI3A 2FBWB 2MBQA 1OTRB 5EDSA 2Z8LA 4WIPA 2LGXA 3RZWC 2BQQA 2ZNVC 2I1KA 1OGWA 1EWCA 2LUEA 1I42A 2B76B 2WGSA 2CKHB 3TEYA 4EEWA 1EWYC 5HI1A 1P9DU 2KVZA 2MP2B 2WXMA 4G0NB 2RDHA 2XK5A 2BWES 2AX5A 4MH0E 1Z2MA 3EC8A 1C76A 4KZ0A 2C7NB 3M62B 3P42A 4DHJB 1ZOYB 3TUOA 3TBLD 1UD7A 3IHPC 3RNBC 2IY0B 4HPLB 2BWFA 2CHWA 5CHFA 3H8HA 3SEBA 3H9DA 5E6OA 2KMMA 1VZ7A 1VZ6A 3Q3FA 4KGRA 2WYQA 3ZNZB 4YSXB 3PTFC 3RNCC 4HXDA 4USAA 3D32A 2G9HD 4W9DA 1WZ3A 1GC6A 2JXTA 4W9KA 1YMHE 1JWUD 4NPNA 2WDVB 2HE7A 1Y56A 4FBJB 1WXVA 4DBGA 3DBHB 1E9MA 5E6PA 5AEKB 3NVYA 2V4IB 1WYGA 2Z59B 3FC4A 3MJWA 1GB4A 1YJ1A 3RNGC 3VFKA 3DVGY 2WQYB 1WM3A 2J0MA 1JRUA 2L32A 4YWGG 3M3JA 4K3CA 3DVNV 3K9PB 1AW7A 2X8XX 3VVWB 1WX8A 4FA6A 1DGJA 2BYEA 1YX5B 4C7ZA 4ZDVA 2J52A 3VH4B 2N7DA 1CZPA 3JVZX 4GDKB 2VRRB 3NY5A 1SE3A 2GB1A 3UI3A 3A4RA 4LNKA 4IM2A 2JYEA 1ET6A 1WWTA 1P0RA 3PREA 2V9HA 3FILB 1E7PB 4TV3A 4W9CA 3KW5B 3WANA 2WXRA 2MA9B 4ZRPA 3MJ5A 2NMQA 2PVOD 2D5GA 4PS3A 3W5VB 4FLHA 3P63A 1RFKA 4MH8A 3GS2A 3A1QB 1EUVB 2INNE 3IT4B 3MHZA 4GDLB 2WXNA 1GTHA 1ZW7A 2M8SA 5G5HA 2O6VD 3J9CA 2JWZA 4FULA 2K22A 2WXLA 1IGDA 1UWMA 3T3NA 4C7YA 4HDQA 3A33B 4M01A 1M94A 1RLFA 1V86A 5IKCM 2MBEA 2MW5A 1E7VA 3AMZA 3UINB 4EZLA 1C1YB 2ASQA 2M0XA 2BBCA 4MGKE 1WZ0A 2FUHB 4K7WA 3RYTA 4YXDB 1C3TA 1AWDA 4A6QA 4XX5A 3ZTDA 3DBHI 3PSEB 1WF9A 4XE0A 4I6PA 5D94A 4W9IA 1PGAA 4WURA 2O2VB 1DOYA 2H88B 3RN9C 1ZE3D 2CHZA 2WXGA 3VH3B 3OLMD 1V1PA 3KLSX 2LGYA 1EF5A 5J17A 1L0YB 2PE6B 3RFZB 4MACA 3U7ZA 4MEMA 4RF1A 4I6LB 1I4GA 2HDEA 3PVLA 3RZFA 3OJ4B 1WGYA 3QWZB 4F8CB 1WJNA 4RM9A 2WDQB 2KDEB 1YD8U 4AJYB 1EF1A 2M56B 5BO4B 4B9KA 2A5UA 2JT4B 3DPDA 2DZJA 3VAWA 2FCMA 5IO9A 2Y5CA 4WJOA 2JXXA 3ZQ4A 1ACCA 4DHZE 5JH5C 1JMLA 3LYYA 3Q3NC 1TKGA 4P1CC 3C8YA 2NVUI 3RT3B 2K0PA 5AZGA 1Q0WB 3BIID 1JALA 4NAWA 3SU8X 1T6BX 3AV8A 4A3PA 4DQOC 1SXTA 2M17A 2JZ3B 3WALA 1N5XA 3SD5A 3ZDTA 1V5OA 4BZAA 2REXA 3TIXA 1K50A 2IPKD 3DDCB 3VXWA 3DQVA 3Q69A 3ZVVA 2KJRA 3N1XC 4B95A 5J2RA 1PYWD 3AE2B 2LVPA 1RYJA 4WWNA 3ZKJC 2PW9A 2WXIA 2D11A 3GB1A 2L83A 2ZPYA 1GNUA 1PQSA 2K25A 4BOZB 1L7YA 3VR9B 2AQ1B 2N7EA 2WP9B 1F9JA 1WRIA 4KKIA 4ZRIA 2MP2A 2K5PA 1PGXA 4K3BA 1UGMA 1FCCC 4RF0A 2J42A 1WYWB 2L3ZA 3PZ8A 2PEAA 3VHTC 3Q3JA 2FCSA 2Y5BB 3KYDD 2C7MB 2Y3AA 2RMMA 4IG7B 4A55A 1I35A 3DOWA 2YEPF 5T8IA 3N20C 3NVZA 1WXQA 4PYUA 4ZYNA 2EMSA 4BKSA 5LXIB 1FCLA 3MP9A 4LLGM 4WQOB 3PHXB 1FNWA 2V3PA 1YQBA 2BW2A 3DVNU 4XYCA 3LXFA 3BINA 3P4SB 3VR8B 3KVFB 2R61A 1ZXIA 2HTHA 4ANXA 3QA8A 4KV2A 2HJ1A 5BYRA 4AQ7A 5BYQA 1F77A 5JXVA 1C78A 4TQ1A 4UDUC 3Q3OC 3ZDMC 2D2QA 2UWQA 3K9OB 2QDFA 1D3ZA 1WGDA 2NTSA 4W9JA 2ZNVB 3DHHC 4C80A 2GRIA 1WRDB 2BGFA 1T0YA 2L7RA 4MGZE 1P3QU 1TY0A 2KKCA 1LQBA 4PS7A 2K1FA 4NQLB 1GAQB 1VDVA 3ZGZA 4JX1C 3AM9A 2V0GA 1XCTL 4JIOU 1SIJA 2KTRB 3MHSD 3WIMA 2BTEA 3U7DA 4JLCA 5D3DA 1UZXB 3L17A 1UWXA 2MHJA 4BAXA 1QKZA 1DOXA 1HA5A 3NS1A 2JSVX 4KKJA 1MHHE 3WCQA 3AE9B 3FILA 1U4AA 2J0KA 2K3UA 2LASA 1WE6A 2XEWA 4ZYSA 4RGMA 1WJUA 2MLBA 3RUIB 3CWIA 1T0QC 3L08A 4YL8A 1JWSD 2RPQA 4MDKE 4RCOA 4ANWA 1GB1A 1RFAA 2J0JA 2H89B 4GDLA 2PKOA 3AN1A 4RH6A 3MC8A 2RD0A 1M4VA 3ZJTA 2PMVA 4E71A 3KQ4A 4BVUC 1OQYA 3HM3A 4EOYA 3V62A 4HWIB 3N30A 3Q8AA 2IJ0A 2ZEQA 4JGHB 1QOAA 3W1YA 3CIRB 4DK5A 1XQQA 4MSQB 1TY2A 3N9YC 1T3QA 1HTQA 3ZW3A 1LO5D 4LDTB 3T3OA 1G6JA 1KH0A 1JRPA 4JQWC 2BKFA 3BK2A 1JWBD 3R2IA 3IXSA 3SR6A 2BB6A 2I38A 2KC2A 3AE1B 1LM8B 1LGRA 1SB3C 2O2VA 1E90A 2KXJA 2OJWA 3NUHB 3DWGC 3QCAA 1HXYD 1PDXA 1VD2A 3NZSA 3I9V1 1SJED 2INCC 2WXFA 1C4PA 4KVGB 3HK0A 2BYFA 5CX3A 3QQ8B 2Q5WD 4JL9A 3CSFA 2MX2A 3ZNHB 1V6EA 1NEKB 4LNIA 3B1LX 2N9LA 3R7QA 4G50A 5GXGB 4GB9A 3P4QB 4XWTA 2JUOA 5HG2A 1WGHA 2QHOA 3R66C 4HKQA 4XGAB 2E6XA 3BZDB 1E6EB 3JYUA 2G4SA 1R4NI 1SE4A 2L0FA 1SGHA 3N32A 2KLGA 3ZIMA 4KZCA 3M95A 3Q6BA 3KWVA 1P98A 3RCZA 3IBEA 3MFGA 5E6JA 2WHIA 4DHJD 3NVVA 3UQAA 4BKSD 2NBUA 5BMIA 1QOBA 4HCNB 2KQSA 4XDDA 3V05A 2I1JA 2LWPA 2KT7A 1N61A 2NPTB 2DBYA 3TL5A 2RR9A 4O1NA 1MG8A 4HROA 3VTVA 1T0SC 1YN5A 4XC2A 1HTOA 2LHEA 1KF6B 3DWMA 4KDIC 1TS3A 1ZDXA 1FO4A 4GMVA 3VTUA 4MSMB 3HIZA 2IY1B 2XN9C 3KYCD 3ZXRA 2Z0DB 2L0TA 1MI0A 3ETRA 4S17A 2DYBA 1QZEA 4GSWA 1ET9A 3A9KB 5DPSA 5IOIA 3WAPA 2KWUB 4P16A 1D4BA 5FKAC 1IYFA 4A90A 3HRDD 3SHQA 3PRZA 1WY8A 3QK0A 1UGJA 3ZYYX 1GC7A 1WIAA 3BYTB 1EU4A 2L00B 1D6EC 2C5LC 3VRAB 1XLQA 3R3MA 3SFDB 3A4SC 2CJNA 4KSLC 2DHZA 3P4PB 1UF0A 2KWCA 3Q8CA 5IA7A 2AL6A 1X1MA 3B08A 1XO3A 5BMHA 3VRBB 2SAKA 4BOSC 3B2GA 1IBXB 3CSTA 4R3DA 3NJTA 2IO1B 2DWQA 3ONSA 2GOWA 1EU3A 4BBNC 3ZJVA 1E8ZA 2LMCA 2BYVE 1BMLC 3TEZA 1I4PA 3O65B 4YSYB 1T5XD 2UYZB 5CTRC 5BMGA 1Q10A 1YN4A 2KJ6A 3FKYA 1JW9D 2LD9A 2VH2A 4RGNA 2INDC 1HEZE 3NG0A 1XXGA 1SE2A 2KK8A 3VUWA 3UQBA 2W82A 3VUYA 2N9EB 1J19A 1R7SA 1ESFA 2V3NA 2EMTA 2BS3B 3H1UA 5G5GA 1YOVB 1JCKB 3H7PB 3I3TB 3H6NA 2LFIA 1TS5A 3AU4A 3IFWB 4DWFA 3BYYB 1ZDVA 2LGDA 4IUMB 4IC7B 2KTRA 2ZCCA 3E9SA 4L2YA 1VZ8A 2PTLA 4YT0B 3OAWA 3QIJA 4K1RB 4AUQC 2KX3A 2L1AA 4DDID 1TS4A 4TQ0A 2KDBA 1CQVA 1XF5L 4HK2A 4US9A 3QX1A 3PLUA 4PYZA 2GBRA 4GGQA 3IG3A 2GBKA 2N0SB 2W9NA 3LJ3A 5D3IB 1N63A 1IP9A 5TR5A 1VRAB 4IW0A 2QJLA 3W1SA 1C77A 1YX6B 2JF5A 4OW0A 4X57B 5IN7A 1J7CA 2KMCA 1JWAD 2NR2A 3PZ7A 2K9XA 1BT0A 4BKGA 2RPVA 2AWTA 1UH6A 4M0WB 2FAZA 4NJCA 2CU3A 2V3SA 3A9JB 3CF6E 2LJ5A 1H7WA 1ZP0B 1B1ZA 3H7SA 2OOBB 3L4PA 1V9JA 1V81A 4J6IA 1P7EA 2M19A 3PS6A 1WGGA 2BYTA 1WXAA 1FRDA 4LNNA 2D10A 1GG3A 1OEYJ 1ZKHA 1XLNA 3W2DA 3KUCB 2PIAA 4OHJA 1H4RA 5H92C 4P6VF 2B3AA 1ZXHA 4RNAA 3U30A 2ZJDA 5JHBA 4W9GA 3AECB 2BPSA 2DNFA 3EECA 2AL3A 4NY0A 1F52A 1FIQA 2UU7A 1FD6A 2PPHA 5GMVA 2N1WA 3L13A 3APFA 2XBBC 2QSDA 2MJDA 2QEJC 1FRRA 4IWQA 3MTNB 2IGHA 3HHMA 1STEA 3QC8B 4MGIE 1N60A 4LCDE 3WA0A 4DDGD 3GZNB 3ECIA 3PRPB 4REZA 3RNEC 2LXCA 2IDYA 4EZJA 3Q8BA 2KN4A 4G3XB 3V6CB 4I6NB 1QQRA 3RNAC 3PPAA 3AE5B 4N9F4 2FCQA 2DAJA 1TZOA 4II2B 4KDLB 1TT5B 3PLVA 2HJ8A 4TMAB 5BYSA 3AE7B 2CR5A 1L2NA 1AYFA 1L4ZB 2KAJA 1QF6A 4AWJA 3Q8EA 3RULA 4CHKA 1V8CA 4ZRJA 4FJZA 3IVFA 4D2KA 2NPTA 3L10B 1QT9A 4CYEA 2NTTA 4WJQA 2G3QB 1V49A 1IPGA 2GMIC 5G55A 3CF4A 3HVZA 4YSZB 4W9EA 2WXOA 5MPOA 3UIPB 1TKEA 1J8CA 3JW0X 1YQ4B 2NCNA 2MBHA 1Z5SB 1QLBB 2K8HA 3N1ZC 5HFYA 2J53A 3ALBA 3PT2B 3A9KA 2E3TA 5I4DA 1QOFA 4Q2JA 1H7XA 2J7QB 1GOZA 1C4AA 2BT6A 4QAYA 3N3KB 1SJHD 1Y8RC 4ICUA 2VZKD 3ML8A 2N9XA 3TMPB 4S0RA 3AEDB 4TKNA 4A9AA 4NAMA 2KX0A 4XZ4A 4E3CA 2GBJA 1L5PA 2L8JA 1IBXA 1KLGD 2DZKA 2D3AA 4IOIE 1MPEA 4HVBA 4NZLB 2LHDA 4E74A 3GZNI 2W54A 4OZBA 1RAXA 2QCZA 5G2NA 3ZUNA 1VJKA 3NVWA 3MC9A 2N7JA 3R2TA 2OEDA 2JX5A 3APDA 4GDKA 2WX1A 3ZLZA 2LRUA 4HLEA 1WGKA 4F1SA 4RMAA 4RGOS 1D5ZC 1LXDA 3DBSA 5KHOA 4WWOA 2KDIA 2MBOA 4NNJB 1WM2A 3APCA 4N59A 1R4NB 1FPYA 1C79A 4ANUA 2JU6X 1N5WA 1PFDA 4AP4C 3PGEA 4DXFA 1WX9A 3H7PA 4JE3B 1TGZB 3R7RA 4ZRKA 3TCAA 1JWMD 1I4QA 3UIOB 1OEYA 2NS5A 1SF0A 2DZMA 1JQ4A 2FUG1 3VDZA 3A1QA 2PVGC 4KSKC 1MHXA 2IBIB 4C4VB 2TSSA 2K39A 3VUXA 5AZFA 4BFRA 1SE9A 2K8BA 2NBWB 5EE9A 2DZIA 1SIFA 2M1MA 1C9FA 3RD2A 1N62A 1KFYB 4HJGE 1XLPA 2CS4A 2KFKB 5DPRA 4ICVA 3Q14C 3PRMB 4HPPA 4G11A 5AUIA 3KWLA 3AULA 4KX6B 4EE2A 1NYRA 4K7SA 5J18A 4IWPA 3T9LA 4FADA 4K7UA 2IO0B 4ZOHC 2CHXA 2MJEA 2D07B 3V3XA 5LNK1 4EFOA 3ZO5B 4M0WA 4ARIA 2FCNA 2PLPA 3UF8A 4LJPB 2X38A 2FIDA 2IZVB 4GXBA 1HQRD 3A9JA 2JWUA 4LK0M 5DCNA 2ZW0A 5LXHA 1N6ZA 3TEXA 1KJTA 4JWSC 2R2QA 2WXHA 1OFFA 1ISNA 4B6WA 2C60A 3U2SC 2JVCA 1RRBA 4BKTA 1KTKA 4P1BC 1V5TA 1I7HA 2L05A 4OZCA 2DYOA 1RWSA 2N9PC 3EA6A 2MBBB 1E8WA 1GTEA 2PJHA 4C56C 1YIWA 3ZJUA 3HUIA 3TEWA 3BK1A 1ENFA 1V1OA 1TS2A 4IM3A 2PE9A 3U4EG 1I4XA 2WDTB 1J0GA 1KOTA 4LNOA 1F2RC 3AEBB 2KC1A 2R2OA 1YNTE 5HKHA 4RGTA 4AJWA 1K53A 1D5XC 1S3SG 1LFDA 1TIFA 2ICIA 3ZTCA 2WX0A 4YTMB 3LB8C 2V4LA 2IGDA 2DAFA 2AYOB 3EUB2 3I57A 4W9HA 5EE0A 2BB5A 5C2TB 1NVID 2CJOA 3KH0A 3P1MA 1F1HA 1BXTA 3NS8A 1ZGUB 4AS1A 2G45B 5HHDG 1WMHB 2G1EA 2IYDB 2JRHA 3BVGA 2D3GA 2BS4B 4P7IA 1JROA 1K52A 3BVZA 4WAFA 2YLMA 5AZHA 1MFWA 2HTME 4MJSB 2ONQA 4EUTA 2KQ7A 4ASWC 2MWSB 3JSVB 2AEHA 3W1SC 2BVCA 1E8YA 1J7BA 3NOBA 3DBRB 2KNBA 2ZVNA 1L0XB 1FNUA 2KANA 1V97A 2GBMA 3ZRCA 1K8RB 1ROEA 4TUUA 2LJIA 2KACA 2M4NA 4L1BA 1BUIC 1V80A 4MELA 5IAAC 1FXAA 2N9KA 2L52A 2RDBC 1B9RA 1XD3B 1PUTA 1WJ6A 2MH7A 1VR9A 1I4RA 4A20A 4OVUA 2KDMA 3BVMA 2WLBA 4IWOA 5E6NA 3SFEB 1T0RC 2OJRA 2AQ3B 2LVOA 1F0ZA 1FXTB 4KIKB 2ZZPB 4M00A 3U52E 5AUKA 1YN3A 1Q5WB 1R4MB 4FHJA 1WFYA 4HEA1 4WWPA 1YJJA 4LTUA 5EE1A 4DHZB 5DPTA 2D3CA 3B9JA 3IT6B 1K51A 5FR3A 4FHKA 4J3OD 2MQJA 1V2YA 1ZPSA 4ZHPA 2ACZB 1FFVA 4IDIA 3UGBB 5JHAA 2JYTA 2DLBA 4RM8A 3ENEA 2JRIB 5D6JB 4B0EA 2BS2B 5EE3A 1A5RA 2HD5B 2MCNB 1AARA 1MVKA 1H8CA 1KM7A 3Q8FA 3S2AA 2AQ2B 2WXJA 5CHVC 1IGCA 1SEBD 4C4VA 2ZCBA 3P2BA 3DBRI 4K81A 5C3JB 2IO2B 2RGFA 4GLSC 3RNFC 5TSSA 2FE8A 1XLOA 2MEKA 3L0WB 3CMMB 3DBLB 2KFKA 2MRPA 2O6VB 4XWWA 4ARCA 1XEEA 2RDGA 4HCPB 2KD0A 2KLCA 1CMXB 1E5WA 3HM6X 2DYMA 2K8CA 4L23A 2FIFA 4FJVB 3ZRFA 2LVQA 1Q1OA 1OQQA 1A70A 3OJ3A 3URYA 2QILA 1L6VA 5H8YE 4LNFA 3AXCA 1FXIA 1WJ4A 3T8MA 1YJIA 4OVZA 4IM0A 4EKUA 1WE7A 2WU5B 4FJYA 1WX7A 3IAM1 2XNAC 2G4DB 3QAQA 2I2YA 2DX5B 2EKIA 1L4DB 1EO6A 2KYWA 2LGIA 3SDLC 3AI5A 4MGYE 2JQRB 4XDCA 2N4FA 2BF8B 2IO3B 4US8A 3NRZA 3NZUA 1TBEA 3AE6B 2YVCA 4ZHOA 3IAS1 2WWZA 4ITKA 1AN8A 1WR6E 1R4MI 5DPWA 4CQNA 3RMKC 1J7AA 3AE4B 3DVGX 4MM3B 1OQRA 3AB5A 4WJPA 3V61A 5CHWA 3PV1A 2WXKA 2K6QA 4M8NA 3BY4B 3AEFB 2WXQA 3DHIC 1I4HA 4LJOB 2LXAA 2EKEC 1WSPA 1NYQA 1E0ZA 1FFUA 2RSUA 3AEGB 2C9WB 2VH1A 2ZVOA 3OG5A 2XK5B 4PS8A 4DXGA 1DYQA 3OWEB 2QC8A 2LEKA 3QJZA 2KMAA 2WS3B 4CO7A 2KQ4X 1TZ1A 4OZAA 4ACFA 4M02A 3B2FA 4HJKA 1UBIA 3DBLI 4PT5A 3X23A 1NI2A 2GI9A 4BBNF 4IKGA 5KHQA 3ZXVA 4FN2A 4WH4A 3PHWB 2KTFA 2LGSA 2GBNA 2KJHB 3EFCA 3U8ZA 2N1VA 1HE8A 3MC0B 1KLVA 1KRHA 3GOEA 2K6DB 1GJZA 2JZPA 4W9LA 4WJNA 2KDFB 4NJ6A 1WMHA 3VQIA 1KLUD 1TKYA 1FEHA 1WR1A 3L16A 1GT8A 2BKRB 3RI7C 4OVVA 3V6EB 2JY6A 2QMTA 5C1ZA 3L54A 1P7FA 4A3OA 4MJSA 1HZ5A 4H2AA 3JSVA 5D7GA 3E56A 1E8XA 4WAAA 3C19A 4KGSA 2GLSA 3PO0A 2KOXA 1GUAB 2KWDA 3I63C 3M63B 4JWUC 1S1QB 4WQMA 2WU2B 5L83A 2L76A 2ZW1A 4F7ZA 2WXPA 5FK9C 4URKA 2V1YA 2MJ3A 1UNSA 3C0RB 3BWUD 3ML9A 2OHFA 2VZKB 3WAOA 2W3SA 4RFBA 1L0VB 4YTNB 3AH7A 2INPE 1FM0D 1D5MC 4FXCA 3AEAB 1TTNA 3HVDA 4KIKA 3VTWA 4HKZE 1CK1A 1UELA 2IGGA 4AOFA 4C00A 5L95C 4LDTD 3N1YC 2NBVB 1QILA 1FNVA 5C23A 1SBBB 2LI5A 3PZDA 2KFJA 1WXMA 4YTPB 3P4RB 1P1AA 3QHTA 3ZNGC 2KHWB 1NBFC 1MG4A 2MSED 1NDDA 2D3BA 3AE8B 4N58A 4NJ7A 2KVRA 4II3B 4HRSA 1TJEA 3EGRA 1NENB 4PK1A 5LLIA 4MT5A 4DXAB 3GP7A 2KWVB 2WDRB 1V1PB 1F2RI 1YQ3B 3RPFC 3X0WA 2SEBD 4A8XC 1WH3A 2LRWA 2C7HA 2YEPB 3NZ3A 5FR6A 3W5UB 3GE3C 1E7UA 1VCBA 4EZKA 2KN5A 1EM7A 4JPSA 1DOIA 2O6VA 3LDZE 1UUPA 2CU1A 1MJDA 3FAHA 4NQKE 1SSNA 3DCGA
chains in the Genus database with same CATH topology
1FNUA 2R61A 1ZXIA 1V97A 2QIEB 5H92C 4P6VF 1CJEA 3W9CB 1ZXHA 1FMAD 1VLBA 2Y5PA 5BYRA 1QOGA 4RNAA 1ROEA 5BYQA 1F77A 3R8BA 4AQ7A 5JXVA 1C78A 4TQ1A 2LJIA 4UDUC 2KACA 4TSSA 2EELA 3AECB 4L1BA 1L6UA 1TYGB 1BUIC 1GPXA 2NTSA 4N6EB 2W3RA 4C80A 2GRIA 1FIQA 2M0AA 1FXAA 2N9KA 1FD6A 4NAWB 3AEEB 1C4CA 1TY0A 2LUMA 2W55A 2L52A 4KGTA 1B9RA 2QSDA 2MJDA 2QEJC 1FRRA 1PUTA 4B0MA 1GAQB 1VDVA 3ZGZA 4JX1C 2MH7A 2IGHA 1VR9A 1I4RA 2J4XA 3AM9A 1STEA 4WWMA 1HZ6A 2V0GA 1XCTL 2KDMA 1SIJA 2ON8A 3O13A 3BVMA 2WLBA 1IUEA 3AE3B 1N60A 2BTEA 3SFEB 5D3DA 2WNMA 3ABVB 2AQ3B 1F0ZA 1ZUD2 1UWXA 4REZA 3U52E 1QKZA 1DOXA 2IDYA 1HA5A 1RM6C 3Q8BA 2KN4A 1PGBA 2JSVX 3NS1A 1QQRA 1YN3A 4ZRQA 5AUKA 4KKJA 1MHHE 3AE5B 3TSSA 4HEA1 3WCQA 3AE9B 3FILA 1YJJA 1XCQL 1NI3A 1TZOA 2FBWB 4LTUA 5EE1A 2K3UA 3IT6B 3B9JA 4ZYSA 1K51A 4RGMA 2Z8LA 4WIPA 5FR3A 4TMAB 5BYSA 3AE7B 4J3OD 1EWCA 1ZPSA 2B76B 4ZHPA 3CWIA 2ACZB 1FFVA 4IDIA 3TEYA 1AYFA 1L4ZB 2KAJA 1JWSD 1EWYC 1QF6A 2JYTA 2DLBA 5HI1A 3Q8EA 1V8CA 2WXMA 4RCOA 1GB1A 4D2KA 2RDHA 4B0EA 2BS2B 5EE3A 2H89B 1MVKA 1QT9A 2AX5A 2PKOA 3AN1A 4RH6A 2NTTA 3Q8FA 1M4VA 1C76A 2AQ2B 3ZJTA 2WXJA 2PMVA 3P42A 3KQ4A 1IGCA 1ZOYB 3TUOA 3CF4A 1SEBD 4YSZB 3HVZA 3Q8AA 2WXOA 2IJ0A 5MPOA 1TKEA 5C3JB 1YQ4B 3H8HA 4GLSC 1QOAA 3SEBA 5TSSA 3CIRB 1XLOA 1QLBB 2FE8A 2KMMA 2MEKA 1VZ7A 1VZ6A 1TY2A 4KGRA 5HFYA 2J53A 3N9YC 4XWWA 4YSXB 4ARCA 1T3QA 2E3TA 1LO5D 4USAA 1XEEA 2RDGA 5I4DA 3T3OA 2G9HD 1KH0A 1QOFA 4Q2JA 1JRPA 1H7XA 2DYMA 2JXTA 4L23A 3BK2A 1JWBD 1YMHE 1GOZA 1C4AA 3IXSA 3R2IA 3SR6A 2BB6A 2BT6A 2I38A 1JWUD 1A70A 1OQQA 1SJHD 3URYA 2VZKD 3AE1B 1L6VA 2QILA 2WDVB 5H8YE 1Y56A 3AEDB 1FXIA 1YJIA 4OVZA 4A9AA 4NAMA 1SB3C 1E9MA 3NUHB 3NVYA 2V4IB 1WYGA 3DWGC 2WU5B 1HXYD 1PDXA 3FC4A 3I9V1 1SJED 2WXFA 1GB4A 1C4PA 3IAM1 2XNAC 2I2YA 2EKIA 2WQYB 1L4DB 2L32A 1L5PA 2Q5WD 1IBXA 1KLGD 4IOIE 1MPEA 4YWGG 4NZLB 2LGIA 2LHDA 1NEKB 2JQRB 1AW7A 2N9LA 4XDCA 5GXGB 2W54A 4OZBA 1DGJA 3P4QB 4US8A 4XWTA 3NRZA 5HG2A 3AE6B 4C7ZA 4ZHOA 3IAS1 4ITKA 1AN8A 2J52A 4HKQA 2E6XA 3BZDB 4CQNA 1E6EB 1CZPA 1VJKA 4GDKB 1J7AA 3AE4B 4MM3B 1OQRA 1SE3A 3AB5A 2GB1A 3UI3A 3NVWA 1SE4A 2N7JA 2WXKA 3R2TA 2OEDA 2JX5A 2JYEA 3AEFB 1ET6A 1WWTA 2WXQA 3FILB 1WGKA 1E7PB 3KWVA 1I4HA 4RGOS 1D5ZC 3MFGA 1WSPA 2WXRA 5E6JA 1NYQA 3NVVA 4ZRPA 1E0ZA 3MJ5A 2NMQA 4N59A 2PVOD 1FFUA 5BMIA 2D5GA 1C79A 3AEGB 1QOBA 4XDDA 3V05A 2JU6X 1N5WA 1PFDA 3W5VB 3P63A 1RFKA 4DXFA 4JE3B 4MH8A 3GS2A 1N61A 2DBYA 2INNE 4O1NA 1JWMD 1I4QA 3IT4B 4DXGA 3MHZA 4GDLB 2WXNA 1GTHA 1DYQA 3OWEB 1SF0A 5G5HA 2LEKA 1JQ4A 4HROA 2FUG1 2WS3B 3J9CA 2PVGC 1MHXA 1YN5A 2KQ4X 2LHEA 1KF6B 2K22A 2WXLA 3DWMA 1IGDA 4OZAA 1TS3A 1ZDXA 1UWMA 2TSSA 3B2FA 3T3NA 1FO4A 4C7YA 4PT5A 2XN9C 2GI9A 5EE9A 1C9FA 1N62A 4IKGA 1MI0A 3ETRA 1KFYB 3AMZA 4HJGE 1XLPA 4WH4A 1ET9A 2BBCA 5AUIA 4P16A 3MC0B 1D4BA 5FKAC 1KRHA 4A90A 4YXDB 3KWLA 3HRDD 1AWDA 4A6QA 4KX6B 4EE2A 1UGJA 1NYRA 3ZYYX 4XE0A 3BYTB 1EU4A 2JZPA 1D6EC 3VRAB 1XLQA 3SFDB 1PGAA 2CJNA 4ZOHC 2MJEA 3VQIA 4WURA 1KLUD 3V3XA 3P4PB 5LNK1 1TKYA 1FEHA 1DOYA 3Q8CA 2H88B 4M0WA 1ZE3D 4ARIA 1GT8A 2PLPA 1XO3A 2WXGA 5BMHA 1V1PA 3VRBB 2X38A 3KLSX 2SAKA 3B2GA 1IBXB 1HQRD 1L0YB 3RFZB 2JWUA 4R3DA 2QMTA 4LK0M 4MACA 3U7ZA 1P7FA 4RF1A 2DWQA 1I4GA 2HDEA 1EU3A 2ZW0A 3ZJVA 1HZ5A 4H2AA 2LMCA 3TEXA 4JWSC 1BMLC 2WDQB 5D7GA 3TEZA 1I4PA 3E56A 4YSYB 2WXHA 1OFFA 1T5XD 3U2SC 4KGSA 5BMGA 2M56B 3PO0A 1Q10A 1YN4A 1KTKA 1I7HA 1JW9D 4OZCA 2DYOA 2KWDA 4RGNA 1RWSA 4JWUC 1HEZE 4WQMA 2Y5CA 2WU2B 3EA6A 1XXGA 3ZQ4A 1ACCA 1SE2A 1GTEA 1JMLA 2ZW1A 3LYYA 1TKGA 2W82A 3C8YA 2WXPA 1R7SA 1ESFA 2K0PA 5FK9C 2V3NA 4C56C 2BS3B 3ZJUA 3HUIA 3TEWA 2MJ3A 3BK1A 5G5GA 3BIID 1ENFA 1V1OA 1UNSA 1TS2A 1JALA 3U4EG 3BWUD 1JCKB 2OHFA 2VZKB 2W3SA 1T6BX 1I4XA 1L0VB 4YTNB 3AV8A 4RFBA 3AH7A 2LFIA 1TS5A 4DQOC 1SXTA 1F2RC 3AEBB 3BYYB 1ZDVA 2INPE 1N5XA 1FM0D 1D5MC 4FXCA 3E9SA 3AEAB 1K50A 2IPKD 4L2YA 1VZ8A 2PTLA 4YT0B 1YNTE 3HVDA 4RGTA 3Q69A 2L1AA 4HKZE 1K53A 1D5XC 1TS4A 1CK1A 2IGGA 2ICIA 4TQ0A 1QILA 1CQVA 1XF5L 4US9A 1FNVA 1SBBB 1PYWD 3AE2B 4YTMB 3LB8C 1RYJA 2IGDA 2PW9A 2WXIA 3EUB2 3I57A 5EE0A 2N0SB 2BB5A 2L83A 3GB1A 5D3IB 1N63A 5C2TB 4YTPB 3P4RB 1NVID 1VRAB 2QJLA 3VR9B 2CJOA 3P1MA 3W1SA 2AQ1B 1BXTA 1C77A 2WP9B 4OW0A 1WRIA 4AS1A 4KKIA 1J7CA 3AE8B 5HHDG 2K5PA 1JWAD 1PGXA 3PZ7A 4N58A 2G1EA 1FCCC 4RF0A 2K9XA 4HRSA 1TJEA 2J42A 3BVGA 3EGRA 1NENB 2RPVA 3PZ8A 4MT5A 2BS4B 3GP7A 1JROA 2Y3AA 2WDRB 1K52A 2RMMA 4A55A 1V1PB 4NJCA 1F2RI 1YQ3B 2YEPF 2CU3A 5T8IA 3NVZA 1WXQA 2SEBD 3BVZA 3RPFC 4A8XC 4WAFA 2YEPB 3NZ3A 3MP9A 1FCLA 3W5UB 4LLGM 1FNWA 2HTME 1H7WA 1ZP0B 1B1ZA 2V3PA 2ONQA 2BW2A 3L4PA 1P7EA 2M19A 3LXFA 2BYTA 1EM7A 1FRDA 1J7BA 3P4SB 4JPSA 3VR8B 1DOIA 1UUPA 3FAHA 1XLNA 3W2DA 2PIAA 4OHJA 1E10A 1SSNA 1L0XB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R7S A;  1ZXI A;  1GTH A;  1TKE A;  1V97 A;  2QIE B;  5H92 C;  5C3J B;  1SF0 A;  4P6V F;  2BS3 B;  1CJE A;  3W9C B;  5G5H A;  1YQ4 B;  2LEK A;  1FMA D;  1VLB A;  3HUI A;  4HRO A;  1QOG A;  1JQ4 A;  1ROE A;  2MJ3 A;  1QOA A;  2WS3 B;  3BII D;  2PVG C;  5G5G A;  3CIR B;  1XLO A;  1QLB B;  1JAL A;  2KMM A;  2OHF A;  1KF6 B;  2K22 A;  3DWM A;  3AEC B;  2W3S A;  1L6U A;  1TYG B;  3AV8 A;  1L0V B;  4YTN B;  4YSX B;  1UWM A;  3AH7 A;  3B2F A;  1FO4 A;  1T3Q A;  2E3T A;  4C7Y A;  4USA A;  1GPX A;  4N6E B;  3AEB B;  1QOF A;  2W3R A;  4C80 A;  1JRP A;  5EE9 A;  1FIQ A;  1H7X A;  1FXA A;  1N5X A;  1FM0 D;  1N62 A;  1JWB D;  3ETR A;  1KFY B;  3AMZ A;  3SR6 A;  2BT6 A;  1XLP A;  4FXC A;  3AEE B;  3AEA B;  1OQQ A;  1A70 A;  4YT0 B;  3AE1 B;  1L6V A;  2L52 A;  2W55 A;  2WDV B;  5H8Y E;  1B9R A;  3AED B;  2MJD A;  1FXI A;  1FRR A;  1YJI A;  5AUI A;  1PUT A;  4A9A A;  1SB3 C;  1GAQ B;  1VDV A;  1KRH A;  4JX1 C;  4YXD B;  1E9M A;  2MH7 A;  3HRD D;  3KWL A;  3AM9 A;  3NVY A;  1WYG A;  1AWD A;  3DWG C;  2WU5 B;  4KX6 B;  1PDX A;  3FC4 A;  1NYR A;  4WWM A;  1SIJ A;  4US9 A;  3ZYY X;  2WLB A;  1IUE A;  3AE2 B;  4YTM B;  3AE3 B;  1N60 A;  3LB8 C;  2EKI A;  3SFE B;  2WQY B;  1RYJ A;  3VRA B;  1L5P A;  3ABV B;  1XLQ A;  2Q5W D;  3EUB 2;  3SFD B;  5EE0 A;  1F0Z A;  2N0S B;  1ZUD 2;  2CJN A;  1NEK B;  2JQR B;  2L83 A;  4ZOH C;  1N63 A;  5C2T B;  2MJE A;  4YTP B;  1DOX A;  3P4R B;  5GXG B;  3P4P B;  2W54 A;  1NVI D;  1DGJ A;  1TKY A;  1RM6 C;  3P4Q B;  2QJL A;  4US8 A;  3VR9 B;  2CJO A;  3NS1 A;  3NRZ A;  2H88 B;  3P1M A;  5AUK A;  1DOY A;  3AE6 B;  4C7Z A;  1GT8 A;  4ZHO A;  3AE5 B;  4ITK A;  1XO3 A;  2WP9 B;  3WCQ A;  3AE9 B;  3VRB B;  1YJJ A;  1WRI A;  1NI3 A;  2FBW B;  1J7C A;  4LTU A;  3AE8 B;  5EE1 A;  1E6E B;  1CZP A;  1VJK A;  2K5P A;  1J7A A;  1JWA D;  3B2G A;  3AE4 B;  4N58 A;  2G1E A;  1OQR A;  3B9J A;  3AB5 A;  2K9X A;  3NVW A;  4HRS A;  1TJE A;  3AE7 B;  1NEN B;  2DWQ A;  2B76 B;  2BS4 B;  2JX5 A;  4ZHP A;  3CWI A;  2ACZ B;  1FFV A;  4IDI A;  1AYF A;  3AEF B;  1JRO A;  2WDR B;  1WWT A;  2KAJ A;  1EWY C;  1QF6 A;  1YQ3 B;  1WGK A;  1E7P B;  2WDQ B;  2CU3 A;  4JWS C;  3NVZ A;  4YSY B;  1WXQ A;  3RPF C;  1OFF A;  1V8C A;  3W5U B;  2BS2 B;  5EE3 A;  2HTM E;  1H7W A;  1ZP0 B;  2M56 B;  3PO0 A;  2H89 B;  1NYQ A;  1QT9 A;  2AX5 A;  2PKO A;  3AN1 A;  3NVV A;  1E0Z A;  3L4P A;  1I7H A;  1JW9 D;  1FFU A;  2M19 A;  2PVO D;  4N59 A;  3AEG B;  1QOB A;  3LXF A;  1RWS A;  4JWU C;  1N5W A;  1PFD A;  3W5V B;  3P63 A;  1RFK A;  2Y5C A;  4WQM A;  2WU2 B;  1FRD A;  1ZOY B;  3CF4 A;  3HVZ A;  4YSZ B;  1J7B A;  1GTE A;  3P4S B;  3VR8 B;  1DOI A;  1N61 A;  3FAH A;  1TKG A;  2DBY A;  1XLN A;  2PIA A;  1E10 A;  5MPO A; 
#chains in the Genus database with same CATH topology
 3AU5 A;  3Q3M C;  2QIE B;  1CJE A;  3W9C B;  1FMA D;  1VLB A;  2Y5P A;  1QOG A;  3R8B A;  3I5J C;  4TSS A;  2EEL A;  1L6U A;  2A4Z A;  1TYG B;  3EHV A;  1GPX A;  4N6E B;  2W3R A;  5JZE B;  2FNJ B;  2DEN B;  2M0A A;  3KUD B;  3Q2A C;  1XT9 B;  2LZ6 A;  4M8M A;  4GOC A;  3KUZ A;  4NAW B;  3AEE B;  1C4C A;  4GU2 A;  2LUM A;  3EFU A;  2W55 A;  4KGT A;  4B0M A;  2KO3 A;  4GIV A;  3TJP A;  4HPM B;  2J4X A;  3WAM A;  1WI0 A;  4WWM A;  1HZ6 A;  2JPH A;  3V60 A;  2ON8 A;  3O13 A;  1UBQ A;  1IUE A;  3AE3 B;  4HDO A;  2JZZ A;  3GE8 C;  1WGR A;  2WNM A;  3ZNI D;  3ABV B;  1WXS A;  5D2M B;  1E10 A;  2ZPN A;  4MM3 A;  1ZUD 2;  2Z0E B;  1RM6 C;  3NHE B;  1PGB A;  4ZRQ A;  5IP4 D;  3DHG C;  2KZR A;  3QAR A;  4W9F A;  3TSS A;  4ANV A;  1XCQ L;  3B0A A;  4GN1 A;  1NI3 A;  2FBW B;  2MBQ A;  1OTR B;  5EDS A;  2Z8L A;  4WIP A;  2LGX A;  3RZW C;  2BQQ A;  2ZNV C;  2I1K A;  1OGW A;  1EWC A;  2LUE A;  1I42 A;  2B76 B;  2WGS A;  2CKH B;  3TEY A;  4EEW A;  1EWY C;  5HI1 A;  1P9D U;  2KVZ A;  2MP2 B;  2WXM A;  4G0N B;  2RDH A;  2XK5 A;  2BWE S;  2AX5 A;  4MH0 E;  1Z2M A;  3EC8 A;  1C76 A;  4KZ0 A;  2C7N B;  3M62 B;  3P42 A;  4DHJ B;  1ZOY B;  3TUO A;  3TBL D;  1UD7 A;  3IHP C;  3RNB C;  2IY0 B;  4HPL B;  2BWF A;  2CHW A;  5CHF A;  3H8H A;  3SEB A;  3H9D A;  5E6O A;  2KMM A;  1VZ7 A;  1VZ6 A;  3Q3F A;  4KGR A;  2WYQ A;  3ZNZ B;  4YSX B;  3PTF C;  3RNC C;  4HXD A;  4USA A;  3D32 A;  2G9H D;  4W9D A;  1WZ3 A;  1GC6 A;  2JXT A;  4W9K A;  1YMH E;  1JWU D;  4NPN A;  2WDV B;  2HE7 A;  1Y56 A;  4FBJ B;  1WXV A;  4DBG A;  3DBH B;  1E9M A;  5E6P A;  5AEK B;  3NVY A;  2V4I B;  1WYG A;  2Z59 B;  3FC4 A;  3MJW A;  1GB4 A;  1YJ1 A;  3RNG C;  3VFK A;  3DVG Y;  2WQY B;  1WM3 A;  2J0M A;  1JRU A;  2L32 A;  4YWG G;  3M3J A;  4K3C A;  3DVN V;  3K9P B;  1AW7 A;  2X8X X;  3VVW B;  1WX8 A;  4FA6 A;  1DGJ A;  2BYE A;  1YX5 B;  4C7Z A;  4ZDV A;  2J52 A;  3VH4 B;  2N7D A;  1CZP A;  3JVZ X;  4GDK B;  2VRR B;  3NY5 A;  1SE3 A;  2GB1 A;  3UI3 A;  3A4R A;  4LNK A;  4IM2 A;  2JYE A;  1ET6 A;  1WWT A;  1P0R A;  3PRE A;  2V9H A;  3FIL B;  1E7P B;  4TV3 A;  4W9C A;  3KW5 B;  3WAN A;  2WXR A;  2MA9 B;  4ZRP A;  3MJ5 A;  2NMQ A;  2PVO D;  2D5G A;  4PS3 A;  3W5V B;  4FLH A;  3P63 A;  1RFK A;  4MH8 A;  3GS2 A;  3A1Q B;  1EUV B;  2INN E;  3IT4 B;  3MHZ A;  4GDL B;  2WXN A;  1GTH A;  1ZW7 A;  2M8S A;  5G5H A;  2O6V D;  3J9C A;  2JWZ A;  4FUL A;  2K22 A;  2WXL A;  1IGD A;  1UWM A;  3T3N A;  4C7Y A;  4HDQ A;  3A33 B;  4M01 A;  1M94 A;  1RLF A;  1V86 A;  5IKC M;  2MBE A;  2MW5 A;  1E7V A;  3AMZ A;  3UIN B;  4EZL A;  1C1Y B;  2ASQ A;  2M0X A;  2BBC A;  4MGK E;  1WZ0 A;  2FUH B;  4K7W A;  3RYT A;  4YXD B;  1C3T A;  1AWD A;  4A6Q A;  4XX5 A;  3ZTD A;  3DBH I;  3PSE B;  1WF9 A;  4XE0 A;  4I6P A;  5D94 A;  4W9I A;  1PGA A;  4WUR A;  2O2V B;  1DOY A;  2H88 B;  3RN9 C;  1ZE3 D;  2CHZ A;  2WXG A;  3VH3 B;  3OLM D;  1V1P A;  3KLS X;  2LGY A;  1EF5 A;  5J17 A;  1L0Y B;  2PE6 B;  3RFZ B;  4MAC A;  3U7Z A;  4MEM A;  4RF1 A;  4I6L B;  1I4G A;  2HDE A;  3PVL A;  3RZF A;  3OJ4 B;  1WGY A;  3QWZ B;  4F8C B;  1WJN A;  4RM9 A;  2WDQ B;  2KDE B;  1YD8 U;  4AJY B;  1EF1 A;  2M56 B;  5BO4 B;  4B9K A;  2A5U A;  2JT4 B;  3DPD A;  2DZJ A;  3VAW A;  2FCM A;  5IO9 A;  2Y5C A;  4WJO A;  2JXX A;  3ZQ4 A;  1ACC A;  4DHZ E;  5JH5 C;  1JML A;  3LYY A;  3Q3N C;  1TKG A;  4P1C C;  3C8Y A;  2NVU I;  3RT3 B;  2K0P A;  5AZG A;  1Q0W B;  3BII D;  1JAL A;  4NAW A;  3SU8 X;  1T6B X;  3AV8 A;  4A3P A;  4DQO C;  1SXT A;  2M17 A;  2JZ3 B;  3WAL A;  1N5X A;  3SD5 A;  3ZDT A;  1V5O A;  4BZA A;  2REX A;  3TIX A;  1K50 A;  2IPK D;  3DDC B;  3VXW A;  3DQV A;  3Q69 A;  3ZVV A;  2KJR A;  3N1X C;  4B95 A;  5J2R A;  1PYW D;  3AE2 B;  2LVP A;  1RYJ A;  4WWN A;  3ZKJ C;  2PW9 A;  2WXI A;  2D11 A;  3GB1 A;  2L83 A;  2ZPY A;  1GNU A;  1PQS A;  2K25 A;  4BOZ B;  1L7Y A;  3VR9 B;  2AQ1 B;  2N7E A;  2WP9 B;  1F9J A;  1WRI A;  4KKI A;  4ZRI A;  2MP2 A;  2K5P A;  1PGX A;  4K3B A;  1UGM A;  1FCC C;  4RF0 A;  2J42 A;  1WYW B;  2L3Z A;  3PZ8 A;  2PEA A;  3VHT C;  3Q3J A;  2FCS A;  2Y5B B;  3KYD D;  2C7M B;  2Y3A A;  2RMM A;  4IG7 B;  4A55 A;  1I35 A;  3DOW A;  2YEP F;  5T8I A;  3N20 C;  3NVZ A;  1WXQ A;  4PYU A;  4ZYN A;  2EMS A;  4BKS A;  5LXI B;  1FCL A;  3MP9 A;  4LLG M;  4WQO B;  3PHX B;  1FNW A;  2V3P A;  1YQB A;  2BW2 A;  3DVN U;  4XYC A;  3LXF A;  3BIN A;  3P4S B;  3VR8 B;  3KVF B;  2R61 A;  1ZXI A;  2HTH A;  4ANX A;  3QA8 A;  4KV2 A;  2HJ1 A;  5BYR A;  4AQ7 A;  5BYQ A;  1F77 A;  5JXV A;  1C78 A;  4TQ1 A;  4UDU C;  3Q3O C;  3ZDM C;  2D2Q A;  2UWQ A;  3K9O B;  2QDF A;  1D3Z A;  1WGD A;  2NTS A;  4W9J A;  2ZNV B;  3DHH C;  4C80 A;  2GRI A;  1WRD B;  2BGF A;  1T0Y A;  2L7R A;  4MGZ E;  1P3Q U;  1TY0 A;  2KKC A;  1LQB A;  4PS7 A;  2K1F A;  4NQL B;  1GAQ B;  1VDV A;  3ZGZ A;  4JX1 C;  3AM9 A;  2V0G A;  1XCT L;  4JIO U;  1SIJ A;  2KTR B;  3MHS D;  3WIM A;  2BTE A;  3U7D A;  4JLC A;  5D3D A;  1UZX B;  3L17 A;  1UWX A;  2MHJ A;  4BAX A;  1QKZ A;  1DOX A;  1HA5 A;  3NS1 A;  2JSV X;  4KKJ A;  1MHH E;  3WCQ A;  3AE9 B;  3FIL A;  1U4A A;  2J0K A;  2K3U A;  2LAS A;  1WE6 A;  2XEW A;  4ZYS A;  4RGM A;  1WJU A;  2MLB A;  3RUI B;  3CWI A;  1T0Q C;  3L08 A;  4YL8 A;  1JWS D;  2RPQ A;  4MDK E;  4RCO A;  4ANW A;  1GB1 A;  1RFA A;  2J0J A;  2H89 B;  4GDL A;  2PKO A;  3AN1 A;  4RH6 A;  3MC8 A;  2RD0 A;  1M4V A;  3ZJT A;  2PMV A;  4E71 A;  3KQ4 A;  4BVU C;  1OQY A;  3HM3 A;  4EOY A;  3V62 A;  4HWI B;  3N30 A;  3Q8A A;  2IJ0 A;  2ZEQ A;  4JGH B;  1QOA A;  3W1Y A;  3CIR B;  4DK5 A;  1XQQ A;  4MSQ B;  1TY2 A;  3N9Y C;  1T3Q A;  1HTQ A;  3ZW3 A;  1LO5 D;  4LDT B;  3T3O A;  1G6J A;  1KH0 A;  1JRP A;  4JQW C;  2BKF A;  3BK2 A;  1JWB D;  3R2I A;  3IXS A;  3SR6 A;  2BB6 A;  2I38 A;  2KC2 A;  3AE1 B;  1LM8 B;  1LGR A;  1SB3 C;  2O2V A;  1E90 A;  2KXJ A;  2OJW A;  3NUH B;  3DWG C;  3QCA A;  1HXY D;  1PDX A;  1VD2 A;  3NZS A;  3I9V 1;  1SJE D;  2INC C;  2WXF A;  1C4P A;  4KVG B;  3HK0 A;  2BYF A;  5CX3 A;  3QQ8 B;  2Q5W D;  4JL9 A;  3CSF A;  2MX2 A;  3ZNH B;  1V6E A;  1NEK B;  4LNI A;  3B1L X;  2N9L A;  3R7Q A;  4G50 A;  5GXG B;  4GB9 A;  3P4Q B;  4XWT A;  2JUO A;  5HG2 A;  1WGH A;  2QHO A;  3R66 C;  4HKQ A;  4XGA B;  2E6X A;  3BZD B;  1E6E B;  3JYU A;  2G4S A;  1R4N I;  1SE4 A;  2L0F A;  1SGH A;  3N32 A;  2KLG A;  3ZIM A;  4KZC A;  3M95 A;  3Q6B A;  3KWV A;  1P98 A;  3RCZ A;  3IBE A;  3MFG A;  5E6J A;  2WHI A;  4DHJ D;  3NVV A;  3UQA A;  4BKS D;  2NBU A;  5BMI A;  1QOB A;  4HCN B;  2KQS A;  4XDD A;  3V05 A;  2I1J A;  2LWP A;  2KT7 A;  1N61 A;  2NPT B;  2DBY A;  3TL5 A;  2RR9 A;  4O1N A;  1MG8 A;  4HRO A;  3VTV A;  1T0S C;  1YN5 A;  4XC2 A;  1HTO A;  2LHE A;  1KF6 B;  3DWM A;  4KDI C;  1TS3 A;  1ZDX A;  1FO4 A;  4GMV A;  3VTU A;  4MSM B;  3HIZ A;  2IY1 B;  2XN9 C;  3KYC D;  3ZXR A;  2Z0D B;  2L0T A;  1MI0 A;  3ETR A;  4S17 A;  2DYB A;  1QZE A;  4GSW A;  1ET9 A;  3A9K B;  5DPS A;  5IOI A;  3WAP A;  2KWU B;  4P16 A;  1D4B A;  5FKA C;  1IYF A;  4A90 A;  3HRD D;  3SHQ A;  3PRZ A;  1WY8 A;  3QK0 A;  1UGJ A;  3ZYY X;  1GC7 A;  1WIA A;  3BYT B;  1EU4 A;  2L00 B;  1D6E C;  2C5L C;  3VRA B;  1XLQ A;  3R3M A;  3SFD B;  3A4S C;  2CJN A;  4KSL C;  2DHZ A;  3P4P B;  1UF0 A;  2KWC A;  3Q8C A;  5IA7 A;  2AL6 A;  1X1M A;  3B08 A;  1XO3 A;  5BMH A;  3VRB B;  2SAK A;  4BOS C;  3B2G A;  1IBX B;  3CST A;  4R3D A;  3NJT A;  2IO1 B;  2DWQ A;  3ONS A;  2GOW A;  1EU3 A;  4BBN C;  3ZJV A;  1E8Z A;  2LMC A;  2BYV E;  1BML C;  3TEZ A;  1I4P A;  3O65 B;  4YSY B;  1T5X D;  2UYZ B;  5CTR C;  5BMG A;  1Q10 A;  1YN4 A;  2KJ6 A;  3FKY A;  1JW9 D;  2LD9 A;  2VH2 A;  4RGN A;  2IND C;  1HEZ E;  3NG0 A;  1XXG A;  1SE2 A;  2KK8 A;  3VUW A;  3UQB A;  2W82 A;  3VUY A;  2N9E B;  1J19 A;  1R7S A;  1ESF A;  2V3N A;  2EMT A;  2BS3 B;  3H1U A;  5G5G A;  1YOV B;  1JCK B;  3H7P B;  3I3T B;  3H6N A;  2LFI A;  1TS5 A;  3AU4 A;  3IFW B;  4DWF A;  3BYY B;  1ZDV A;  2LGD A;  4IUM B;  4IC7 B;  2KTR A;  2ZCC A;  3E9S A;  4L2Y A;  1VZ8 A;  2PTL A;  4YT0 B;  3OAW A;  3QIJ A;  4K1R B;  4AUQ C;  2KX3 A;  2L1A A;  4DDI D;  1TS4 A;  4TQ0 A;  2KDB A;  1CQV A;  1XF5 L;  4HK2 A;  4US9 A;  3QX1 A;  3PLU A;  4PYZ A;  2GBR A;  4GGQ A;  3IG3 A;  2GBK A;  2N0S B;  2W9N A;  3LJ3 A;  5D3I B;  1N63 A;  1IP9 A;  5TR5 A;  1VRA B;  4IW0 A;  2QJL A;  3W1S A;  1C77 A;  1YX6 B;  2JF5 A;  4OW0 A;  4X57 B;  5IN7 A;  1J7C A;  2KMC A;  1JWA D;  2NR2 A;  3PZ7 A;  2K9X A;  1BT0 A;  4BKG A;  2RPV A;  2AWT A;  1UH6 A;  4M0W B;  2FAZ A;  4NJC A;  2CU3 A;  2V3S A;  3A9J B;  3CF6 E;  2LJ5 A;  1H7W A;  1ZP0 B;  1B1Z A;  3H7S A;  2OOB B;  3L4P A;  1V9J A;  1V81 A;  4J6I A;  1P7E A;  2M19 A;  3PS6 A;  1WGG A;  2BYT A;  1WXA A;  1FRD A;  4LNN A;  2D10 A;  1GG3 A;  1OEY J;  1ZKH A;  1XLN A;  3W2D A;  3KUC B;  2PIA A;  4OHJ A;  1H4R A;  5H92 C;  4P6V F;  2B3A A;  1ZXH A;  4RNA A;  3U30 A;  2ZJD A;  5JHB A;  4W9G A;  3AEC B;  2BPS A;  2DNF A;  3EEC A;  2AL3 A;  4NY0 A;  1F52 A;  1FIQ A;  2UU7 A;  1FD6 A;  2PPH A;  5GMV A;  2N1W A;  3L13 A;  3APF A;  2XBB C;  2QSD A;  2MJD A;  2QEJ C;  1FRR A;  4IWQ A;  3MTN B;  2IGH A;  3HHM A;  1STE A;  3QC8 B;  4MGI E;  1N60 A;  4LCD E;  3WA0 A;  4DDG D;  3GZN B;  3ECI A;  3PRP B;  4REZ A;  3RNE C;  2LXC A;  2IDY A;  4EZJ A;  3Q8B A;  2KN4 A;  4G3X B;  3V6C B;  4I6N B;  1QQR A;  3RNA C;  3PPA A;  3AE5 B;  4N9F 4;  2FCQ A;  2DAJ A;  1TZO A;  4II2 B;  4KDL B;  1TT5 B;  3PLV A;  2HJ8 A;  4TMA B;  5BYS A;  3AE7 B;  2CR5 A;  1L2N A;  1AYF A;  1L4Z B;  2KAJ A;  1QF6 A;  4AWJ A;  3Q8E A;  3RUL A;  4CHK A;  1V8C A;  4ZRJ A;  4FJZ A;  3IVF A;  4D2K A;  2NPT A;  3L10 B;  1QT9 A;  4CYE A;  2NTT A;  4WJQ A;  2G3Q B;  1V49 A;  1IPG A;  2GMI C;  5G55 A;  3CF4 A;  3HVZ A;  4YSZ B;  4W9E A;  2WXO A;  5MPO A;  3UIP B;  1TKE A;  1J8C A;  3JW0 X;  1YQ4 B;  2NCN A;  2MBH A;  1Z5S B;  1QLB B;  2K8H A;  3N1Z C;  5HFY A;  2J53 A;  3ALB A;  3PT2 B;  3A9K A;  2E3T A;  5I4D A;  1QOF A;  4Q2J A;  1H7X A;  2J7Q B;  1GOZ A;  1C4A A;  2BT6 A;  4QAY A;  3N3K B;  1SJH D;  1Y8R C;  4ICU A;  2VZK D;  3ML8 A;  2N9X A;  3TMP B;  4S0R A;  3AED B;  4TKN A;  4A9A A;  4NAM A;  2KX0 A;  4XZ4 A;  4E3C A;  2GBJ A;  1L5P A;  2L8J A;  1IBX A;  1KLG D;  2DZK A;  2D3A A;  4IOI E;  1MPE A;  4HVB A;  4NZL B;  2LHD A;  4E74 A;  3GZN I;  2W54 A;  4OZB A;  1RAX A;  2QCZ A;  5G2N A;  3ZUN A;  1VJK A;  3NVW A;  3MC9 A;  2N7J A;  3R2T A;  2OED A;  2JX5 A;  3APD A;  4GDK A;  2WX1 A;  3ZLZ A;  2LRU A;  4HLE A;  1WGK A;  4F1S A;  4RMA A;  4RGO S;  1D5Z C;  1LXD A;  3DBS A;  5KHO A;  4WWO A;  2KDI A;  2MBO A;  4NNJ B;  1WM2 A;  3APC A;  4N59 A;  1R4N B;  1FPY A;  1C79 A;  4ANU A;  2JU6 X;  1N5W A;  1PFD A;  4AP4 C;  3PGE A;  4DXF A;  1WX9 A;  3H7P A;  4JE3 B;  1TGZ B;  3R7R A;  4ZRK A;  3TCA A;  1JWM D;  1I4Q A;  3UIO B;  1OEY A;  2NS5 A;  1SF0 A;  2DZM A;  1JQ4 A;  2FUG 1;  3VDZ A;  3A1Q A;  2PVG C;  4KSK C;  1MHX A;  2IBI B;  4C4V B;  2TSS A;  2K39 A;  3VUX A;  5AZF A;  4BFR A;  1SE9 A;  2K8B A;  2NBW B;  5EE9 A;  2DZI A;  1SIF A;  2M1M A;  1C9F A;  3RD2 A;  1N62 A;  1KFY B;  4HJG E;  1XLP A;  2CS4 A;  2KFK B;  5DPR A;  4ICV A;  3Q14 C;  3PRM B;  4HPP A;  4G11 A;  5AUI A;  3KWL A;  3AUL A;  4KX6 B;  4EE2 A;  1NYR A;  4K7S A;  5J18 A;  4IWP A;  3T9L A;  4FAD A;  4K7U A;  2IO0 B;  4ZOH C;  2CHX A;  2MJE A;  2D07 B;  3V3X A;  5LNK 1;  4EFO A;  3ZO5 B;  4M0W A;  4ARI A;  2FCN A;  2PLP A;  3UF8 A;  4LJP B;  2X38 A;  2FID A;  2IZV B;  4GXB A;  1HQR D;  3A9J A;  2JWU A;  4LK0 M;  5DCN A;  2ZW0 A;  5LXH A;  1N6Z A;  3TEX A;  1KJT A;  4JWS C;  2R2Q A;  2WXH A;  1OFF A;  1ISN A;  4B6W A;  2C60 A;  3U2S C;  2JVC A;  1RRB A;  4BKT A;  1KTK A;  4P1B C;  1V5T A;  1I7H A;  2L05 A;  4OZC A;  2DYO A;  1RWS A;  2N9P C;  3EA6 A;  2MBB B;  1E8W A;  1GTE A;  2PJH A;  4C56 C;  1YIW A;  3ZJU A;  3HUI A;  3TEW A;  3BK1 A;  1ENF A;  1V1O A;  1TS2 A;  4IM3 A;  2PE9 A;  3U4E G;  1I4X A;  2WDT B;  1J0G A;  1KOT A;  4LNO A;  1F2R C;  3AEB B;  2KC1 A;  2R2O A;  1YNT E;  5HKH A;  4RGT A;  4AJW A;  1K53 A;  1D5X C;  1S3S G;  1LFD A;  1TIF A;  2ICI A;  3ZTC A;  2WX0 A;  4YTM B;  3LB8 C;  2V4L A;  2IGD A;  2DAF A;  2AYO B;  3EUB 2;  3I57 A;  4W9H A;  5EE0 A;  2BB5 A;  5C2T B;  1NVI D;  2CJO A;  3KH0 A;  3P1M A;  1F1H A;  1BXT A;  3NS8 A;  1ZGU B;  4AS1 A;  2G45 B;  5HHD G;  1WMH B;  2G1E A;  2IYD B;  2JRH A;  3BVG A;  2D3G A;  2BS4 B;  4P7I A;  1JRO A;  1K52 A;  3BVZ A;  4WAF A;  2YLM A;  5AZH A;  1MFW A;  2HTM E;  4MJS B;  2ONQ A;  4EUT A;  2KQ7 A;  4ASW C;  2MWS B;  3JSV B;  2AEH A;  3W1S C;  2BVC A;  1E8Y A;  1J7B A;  3NOB A;  3DBR B;  2KNB A;  2ZVN A;  1L0X B;  1FNU A;  2KAN A;  1V97 A;  2GBM A;  3ZRC A;  1K8R B;  1ROE A;  4TUU A;  2LJI A;  2KAC A;  2M4N A;  4L1B A;  1BUI C;  1V80 A;  4MEL A;  5IAA C;  1FXA A;  2N9K A;  2L52 A;  2RDB C;  1B9R A;  1XD3 B;  1PUT A;  1WJ6 A;  2MH7 A;  1VR9 A;  1I4R A;  4A20 A;  4OVU A;  2KDM A;  3BVM A;  2WLB A;  4IWO A;  5E6N A;  3SFE B;  1T0R C;  2OJR A;  2AQ3 B;  2LVO A;  1F0Z A;  1FXT B;  4KIK B;  2ZZP B;  4M00 A;  3U52 E;  5AUK A;  1YN3 A;  1Q5W B;  1R4M B;  4FHJ A;  1WFY A;  4HEA 1;  4WWP A;  1YJJ A;  4LTU A;  5EE1 A;  4DHZ B;  5DPT A;  2D3C A;  3B9J A;  3IT6 B;  1K51 A;  5FR3 A;  4FHK A;  4J3O D;  2MQJ A;  1V2Y A;  1ZPS A;  4ZHP A;  2ACZ B;  1FFV A;  4IDI A;  3UGB B;  5JHA A;  2JYT A;  2DLB A;  4RM8 A;  3ENE A;  2JRI B;  5D6J B;  4B0E A;  2BS2 B;  5EE3 A;  1A5R A;  2HD5 B;  2MCN B;  1AAR A;  1MVK A;  1H8C A;  1KM7 A;  3Q8F A;  3S2A A;  2AQ2 B;  2WXJ A;  5CHV C;  1IGC A;  1SEB D;  4C4V A;  2ZCB A;  3P2B A;  3DBR I;  4K81 A;  5C3J B;  2IO2 B;  2RGF A;  4GLS C;  3RNF C;  5TSS A;  2FE8 A;  1XLO A;  2MEK A;  3L0W B;  3CMM B;  3DBL B;  2KFK A;  2MRP A;  2O6V B;  4XWW A;  4ARC A;  1XEE A;  2RDG A;  4HCP B;  2KD0 A;  2KLC A;  1CMX B;  1E5W A;  3HM6 X;  2DYM A;  2K8C A;  4L23 A;  2FIF A;  4FJV B;  3ZRF A;  2LVQ A;  1Q1O A;  1OQQ A;  1A70 A;  3OJ3 A;  3URY A;  2QIL A;  1L6V A;  5H8Y E;  4LNF A;  3AXC A;  1FXI A;  1WJ4 A;  3T8M A;  1YJI A;  4OVZ A;  4IM0 A;  4EKU A;  1WE7 A;  2WU5 B;  4FJY A;  1WX7 A;  3IAM 1;  2XNA C;  2G4D B;  3QAQ A;  2I2Y A;  2DX5 B;  2EKI A;  1L4D B;  1EO6 A;  2KYW A;  2LGI A;  3SDL C;  3AI5 A;  4MGY E;  2JQR B;  4XDC A;  2N4F A;  2BF8 B;  2IO3 B;  4US8 A;  3NRZ A;  3NZU A;  1TBE A;  3AE6 B;  2YVC A;  4ZHO A;  3IAS 1;  2WWZ A;  4ITK A;  1AN8 A;  1WR6 E;  1R4M I;  5DPW A;  4CQN A;  3RMK C;  1J7A A;  3AE4 B;  3DVG X;  4MM3 B;  1OQR A;  3AB5 A;  4WJP A;  3V61 A;  5CHW A;  3PV1 A;  2WXK A;  2K6Q A;  4M8N A;  3BY4 B;  3AEF B;  2WXQ A;  3DHI C;  1I4H A;  4LJO B;  2LXA A;  2EKE C;  1WSP A;  1NYQ A;  1E0Z A;  1FFU A;  2RSU A;  3AEG B;  2C9W B;  2VH1 A;  2ZVO A;  3OG5 A;  2XK5 B;  4PS8 A;  4DXG A;  1DYQ A;  3OWE B;  2QC8 A;  2LEK A;  3QJZ A;  2KMA A;  2WS3 B;  4CO7 A;  2KQ4 X;  1TZ1 A;  4OZA A;  4ACF A;  4M02 A;  3B2F A;  4HJK A;  1UBI A;  3DBL I;  4PT5 A;  3X23 A;  1NI2 A;  2GI9 A;  4BBN F;  4IKG A;  5KHQ A;  3ZXV A;  4FN2 A;  4WH4 A;  3PHW B;  2KTF A;  2LGS A;  2GBN A;  2KJH B;  3EFC A;  3U8Z A;  2N1V A;  1HE8 A;  3MC0 B;  1KLV A;  1KRH A;  3GOE A;  2K6D B;  1GJZ A;  2JZP A;  4W9L A;  4WJN A;  2KDF B;  4NJ6 A;  1WMH A;  3VQI A;  1KLU D;  1TKY A;  1FEH A;  1WR1 A;  3L16 A;  1GT8 A;  2BKR B;  3RI7 C;  4OVV A;  3V6E B;  2JY6 A;  2QMT A;  5C1Z A;  3L54 A;  1P7F A;  4A3O A;  4MJS A;  1HZ5 A;  4H2A A;  3JSV A;  5D7G A;  3E56 A;  1E8X A;  4WAA A;  3C19 A;  4KGS A;  2GLS A;  3PO0 A;  2KOX A;  1GUA B;  2KWD A;  3I63 C;  3M63 B;  4JWU C;  1S1Q B;  4WQM A;  2WU2 B;  5L83 A;  2L76 A;  2ZW1 A;  4F7Z A;  2WXP A;  5FK9 C;  4URK A;  2V1Y A;  2MJ3 A;  1UNS A;  3C0R B;  3BWU D;  3ML9 A;  2OHF A;  2VZK B;  3WAO A;  2W3S A;  4RFB A;  1L0V B;  4YTN B;  3AH7 A;  2INP E;  1FM0 D;  1D5M C;  4FXC A;  3AEA B;  1TTN A;  3HVD A;  4KIK A;  3VTW A;  4HKZ E;  1CK1 A;  1UEL A;  2IGG A;  4AOF A;  4C00 A;  5L95 C;  4LDT D;  3N1Y C;  2NBV B;  1QIL A;  1FNV A;  5C23 A;  1SBB B;  2LI5 A;  3PZD A;  2KFJ A;  1WXM A;  4YTP B;  3P4R B;  1P1A A;  3QHT A;  3ZNG C;  2KHW B;  1NBF C;  1MG4 A;  2MSE D;  1NDD A;  2D3B A;  3AE8 B;  4N58 A;  4NJ7 A;  2KVR A;  4II3 B;  4HRS A;  1TJE A;  3EGR A;  1NEN B;  4PK1 A;  5LLI A;  4MT5 A;  4DXA B;  3GP7 A;  2KWV B;  2WDR B;  1V1P B;  1F2R I;  1YQ3 B;  3RPF C;  3X0W A;  2SEB D;  4A8X C;  1WH3 A;  2LRW A;  2C7H A;  2YEP B;  3NZ3 A;  5FR6 A;  3W5U B;  3GE3 C;  1E7U A;  1VCB A;  4EZK A;  2KN5 A;  1EM7 A;  4JPS A;  1DOI A;  2O6V A;  3LDZ E;  1UUP A;  2CU1 A;  1MJD A;  3FAH A;  4NQK E;  1SSN A;  3DCG A; 
#chains in the Genus database with same CATH homology
 1FNU A;  2R61 A;  1ZXI A;  1V97 A;  2QIE B;  5H92 C;  4P6V F;  1CJE A;  3W9C B;  1ZXH A;  1FMA D;  1VLB A;  2Y5P A;  5BYR A;  1QOG A;  4RNA A;  1ROE A;  5BYQ A;  1F77 A;  3R8B A;  4AQ7 A;  5JXV A;  1C78 A;  4TQ1 A;  2LJI A;  4UDU C;  2KAC A;  4TSS A;  2EEL A;  3AEC B;  4L1B A;  1L6U A;  1TYG B;  1BUI C;  1GPX A;  2NTS A;  4N6E B;  2W3R A;  4C80 A;  2GRI A;  1FIQ A;  2M0A A;  1FXA A;  2N9K A;  1FD6 A;  4NAW B;  3AEE B;  1C4C A;  1TY0 A;  2LUM A;  2W55 A;  2L52 A;  4KGT A;  1B9R A;  2QSD A;  2MJD A;  2QEJ C;  1FRR A;  1PUT A;  4B0M A;  1GAQ B;  1VDV A;  3ZGZ A;  4JX1 C;  2MH7 A;  2IGH A;  1VR9 A;  1I4R A;  2J4X A;  3AM9 A;  1STE A;  4WWM A;  1HZ6 A;  2V0G A;  1XCT L;  2KDM A;  1SIJ A;  2ON8 A;  3O13 A;  3BVM A;  2WLB A;  1IUE A;  3AE3 B;  1N60 A;  2BTE A;  3SFE B;  5D3D A;  2WNM A;  3ABV B;  2AQ3 B;  1F0Z A;  1ZUD 2;  1UWX A;  4REZ A;  3U52 E;  1QKZ A;  1DOX A;  2IDY A;  1HA5 A;  1RM6 C;  3Q8B A;  2KN4 A;  1PGB A;  2JSV X;  3NS1 A;  1QQR A;  1YN3 A;  4ZRQ A;  5AUK A;  4KKJ A;  1MHH E;  3AE5 B;  3TSS A;  4HEA 1;  3WCQ A;  3AE9 B;  3FIL A;  1YJJ A;  1XCQ L;  1NI3 A;  1TZO A;  2FBW B;  4LTU A;  5EE1 A;  2K3U A;  3IT6 B;  3B9J A;  4ZYS A;  1K51 A;  4RGM A;  2Z8L A;  4WIP A;  5FR3 A;  4TMA B;  5BYS A;  3AE7 B;  4J3O D;  1EWC A;  1ZPS A;  2B76 B;  4ZHP A;  3CWI A;  2ACZ B;  1FFV A;  4IDI A;  3TEY A;  1AYF A;  1L4Z B;  2KAJ A;  1JWS D;  1EWY C;  1QF6 A;  2JYT A;  2DLB A;  5HI1 A;  3Q8E A;  1V8C A;  2WXM A;  4RCO A;  1GB1 A;  4D2K A;  2RDH A;  4B0E A;  2BS2 B;  5EE3 A;  2H89 B;  1MVK A;  1QT9 A;  2AX5 A;  2PKO A;  3AN1 A;  4RH6 A;  2NTT A;  3Q8F A;  1M4V A;  1C76 A;  2AQ2 B;  3ZJT A;  2WXJ A;  2PMV A;  3P42 A;  3KQ4 A;  1IGC A;  1ZOY B;  3TUO A;  3CF4 A;  1SEB D;  4YSZ B;  3HVZ A;  3Q8A A;  2WXO A;  2IJ0 A;  5MPO A;  1TKE A;  5C3J B;  1YQ4 B;  3H8H A;  4GLS C;  1QOA A;  3SEB A;  5TSS A;  3CIR B;  1XLO A;  1QLB B;  2FE8 A;  2KMM A;  2MEK A;  1VZ7 A;  1VZ6 A;  1TY2 A;  4KGR A;  5HFY A;  2J53 A;  3N9Y C;  4XWW A;  4YSX B;  4ARC A;  1T3Q A;  2E3T A;  1LO5 D;  4USA A;  1XEE A;  2RDG A;  5I4D A;  3T3O A;  2G9H D;  1KH0 A;  1QOF A;  4Q2J A;  1JRP A;  1H7X A;  2DYM A;  2JXT A;  4L23 A;  3BK2 A;  1JWB D;  1YMH E;  1GOZ A;  1C4A A;  3IXS A;  3R2I A;  3SR6 A;  2BB6 A;  2BT6 A;  2I38 A;  1JWU D;  1A70 A;  1OQQ A;  1SJH D;  3URY A;  2VZK D;  3AE1 B;  1L6V A;  2QIL A;  2WDV B;  5H8Y E;  1Y56 A;  3AED B;  1FXI A;  1YJI A;  4OVZ A;  4A9A A;  4NAM A;  1SB3 C;  1E9M A;  3NUH B;  3NVY A;  2V4I B;  1WYG A;  3DWG C;  2WU5 B;  1HXY D;  1PDX A;  3FC4 A;  3I9V 1;  1SJE D;  2WXF A;  1GB4 A;  1C4P A;  3IAM 1;  2XNA C;  2I2Y A;  2EKI A;  2WQY B;  1L4D B;  2L32 A;  1L5P A;  2Q5W D;  1IBX A;  1KLG D;  4IOI E;  1MPE A;  4YWG G;  4NZL B;  2LGI A;  2LHD A;  1NEK B;  2JQR B;  1AW7 A;  2N9L A;  4XDC A;  5GXG B;  2W54 A;  4OZB A;  1DGJ A;  3P4Q B;  4US8 A;  4XWT A;  3NRZ A;  5HG2 A;  3AE6 B;  4C7Z A;  4ZHO A;  3IAS 1;  4ITK A;  1AN8 A;  2J52 A;  4HKQ A;  2E6X A;  3BZD B;  4CQN A;  1E6E B;  1CZP A;  1VJK A;  4GDK B;  1J7A A;  3AE4 B;  4MM3 B;  1OQR A;  1SE3 A;  3AB5 A;  2GB1 A;  3UI3 A;  3NVW A;  1SE4 A;  2N7J A;  2WXK A;  3R2T A;  2OED A;  2JX5 A;  2JYE A;  3AEF B;  1ET6 A;  1WWT A;  2WXQ A;  3FIL B;  1WGK A;  1E7P B;  3KWV A;  1I4H A;  4RGO S;  1D5Z C;  3MFG A;  1WSP A;  2WXR A;  5E6J A;  1NYQ A;  3NVV A;  4ZRP A;  1E0Z A;  3MJ5 A;  2NMQ A;  4N59 A;  2PVO D;  1FFU A;  5BMI A;  2D5G A;  1C79 A;  3AEG B;  1QOB A;  4XDD A;  3V05 A;  2JU6 X;  1N5W A;  1PFD A;  3W5V B;  3P63 A;  1RFK A;  4DXF A;  4JE3 B;  4MH8 A;  3GS2 A;  1N61 A;  2DBY A;  2INN E;  4O1N A;  1JWM D;  1I4Q A;  3IT4 B;  4DXG A;  3MHZ A;  4GDL B;  2WXN A;  1GTH A;  1DYQ A;  3OWE B;  1SF0 A;  5G5H A;  2LEK A;  1JQ4 A;  4HRO A;  2FUG 1;  2WS3 B;  3J9C A;  2PVG C;  1MHX A;  1YN5 A;  2KQ4 X;  2LHE A;  1KF6 B;  2K22 A;  2WXL A;  3DWM A;  1IGD A;  4OZA A;  1TS3 A;  1ZDX A;  1UWM A;  2TSS A;  3B2F A;  3T3N A;  1FO4 A;  4C7Y A;  4PT5 A;  2XN9 C;  2GI9 A;  5EE9 A;  1C9F A;  1N62 A;  4IKG A;  1MI0 A;  3ETR A;  1KFY B;  3AMZ A;  4HJG E;  1XLP A;  4WH4 A;  1ET9 A;  2BBC A;  5AUI A;  4P16 A;  3MC0 B;  1D4B A;  5FKA C;  1KRH A;  4A90 A;  4YXD B;  3KWL A;  3HRD D;  1AWD A;  4A6Q A;  4KX6 B;  4EE2 A;  1UGJ A;  1NYR A;  3ZYY X;  4XE0 A;  3BYT B;  1EU4 A;  2JZP A;  1D6E C;  3VRA B;  1XLQ A;  3SFD B;  1PGA A;  2CJN A;  4ZOH C;  2MJE A;  3VQI A;  4WUR A;  1KLU D;  3V3X A;  3P4P B;  5LNK 1;  1TKY A;  1FEH A;  1DOY A;  3Q8C A;  2H88 B;  4M0W A;  1ZE3 D;  4ARI A;  1GT8 A;  2PLP A;  1XO3 A;  2WXG A;  5BMH A;  1V1P A;  3VRB B;  2X38 A;  3KLS X;  2SAK A;  3B2G A;  1IBX B;  1HQR D;  1L0Y B;  3RFZ B;  2JWU A;  4R3D A;  2QMT A;  4LK0 M;  4MAC A;  3U7Z A;  1P7F A;  4RF1 A;  2DWQ A;  1I4G A;  2HDE A;  1EU3 A;  2ZW0 A;  3ZJV A;  1HZ5 A;  4H2A A;  2LMC A;  3TEX A;  4JWS C;  1BML C;  2WDQ B;  5D7G A;  3TEZ A;  1I4P A;  3E56 A;  4YSY B;  2WXH A;  1OFF A;  1T5X D;  3U2S C;  4KGS A;  5BMG A;  2M56 B;  3PO0 A;  1Q10 A;  1YN4 A;  1KTK A;  1I7H A;  1JW9 D;  4OZC A;  2DYO A;  2KWD A;  4RGN A;  1RWS A;  4JWU C;  1HEZ E;  4WQM A;  2Y5C A;  2WU2 B;  3EA6 A;  1XXG A;  3ZQ4 A;  1ACC A;  1SE2 A;  1GTE A;  1JML A;  2ZW1 A;  3LYY A;  1TKG A;  2W82 A;  3C8Y A;  2WXP A;  1R7S A;  1ESF A;  2K0P A;  5FK9 C;  2V3N A;  4C56 C;  2BS3 B;  3ZJU A;  3HUI A;  3TEW A;  2MJ3 A;  3BK1 A;  5G5G A;  3BII D;  1ENF A;  1V1O A;  1UNS A;  1TS2 A;  1JAL A;  3U4E G;  3BWU D;  1JCK B;  2OHF A;  2VZK B;  2W3S A;  1T6B X;  1I4X A;  1L0V B;  4YTN B;  3AV8 A;  4RFB A;  3AH7 A;  2LFI A;  1TS5 A;  4DQO C;  1SXT A;  1F2R C;  3AEB B;  3BYY B;  1ZDV A;  2INP E;  1N5X A;  1FM0 D;  1D5M C;  4FXC A;  3E9S A;  3AEA B;  1K50 A;  2IPK D;  4L2Y A;  1VZ8 A;  2PTL A;  4YT0 B;  1YNT E;  3HVD A;  4RGT A;  3Q69 A;  2L1A A;  4HKZ E;  1K53 A;  1D5X C;  1TS4 A;  1CK1 A;  2IGG A;  2ICI A;  4TQ0 A;  1QIL A;  1CQV A;  1XF5 L;  4US9 A;  1FNV A;  1SBB B;  1PYW D;  3AE2 B;  4YTM B;  3LB8 C;  1RYJ A;  2IGD A;  2PW9 A;  2WXI A;  3EUB 2;  3I57 A;  5EE0 A;  2N0S B;  2BB5 A;  2L83 A;  3GB1 A;  5D3I B;  1N63 A;  5C2T B;  4YTP B;  3P4R B;  1NVI D;  1VRA B;  2QJL A;  3VR9 B;  2CJO A;  3P1M A;  3W1S A;  2AQ1 B;  1BXT A;  1C77 A;  2WP9 B;  4OW0 A;  1WRI A;  4AS1 A;  4KKI A;  1J7C A;  3AE8 B;  5HHD G;  2K5P A;  1JWA D;  1PGX A;  3PZ7 A;  4N58 A;  2G1E A;  1FCC C;  4RF0 A;  2K9X A;  4HRS A;  1TJE A;  2J42 A;  3BVG A;  3EGR A;  1NEN B;  2RPV A;  3PZ8 A;  4MT5 A;  2BS4 B;  3GP7 A;  1JRO A;  2Y3A A;  2WDR B;  1K52 A;  2RMM A;  4A55 A;  1V1P B;  4NJC A;  1F2R I;  1YQ3 B;  2YEP F;  2CU3 A;  5T8I A;  3NVZ A;  1WXQ A;  2SEB D;  3BVZ A;  3RPF C;  4A8X C;  4WAF A;  2YEP B;  3NZ3 A;  3MP9 A;  1FCL A;  3W5U B;  4LLG M;  1FNW A;  2HTM E;  1H7W A;  1ZP0 B;  1B1Z A;  2V3P A;  2ONQ A;  2BW2 A;  3L4P A;  1P7E A;  2M19 A;  3LXF A;  2BYT A;  1EM7 A;  1FRD A;  1J7B A;  3P4S B;  4JPS A;  3VR8 B;  1DOI A;  1UUP A;  3FAH A;  1XLN A;  3W2D A;  2PIA A;  4OHJ A;  1E10 A;  1SSN A;  1L0X B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...