3P4RB

Crystal structure of menaquinol:fumarate oxidoreductase in complex with glutarate
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
243
structure length
243
Chain Sequence
AEMKNLKIEVVRYNPEVDTAPHSAFYEVPYDATTSLLDALGYIKDNLAPDLSYRWSCRMAICGSCGMMVNNVPKLACKTFLRDYTDGMKVEALANFPIERDLVVDMTHFIESLEAIKPYIIGNSRTADQGTNIQTPAQMAKYHQFSGCINCGLCYAACPQFGLNPEFIGPAAITLAHRYNEDSRDHGKKERMAQLNSQNGVWSCTFVGYCSEVCPKHVDPAAAIQQGKVESSKDFLIATLKPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Geometric restraint drives on- and off-pathway catalysis by the Escherichia coli menaquinol:fumarate reductase.
pubmed doi rcsb
source organism Escherichia coli 042
molecule tags Oxidoreductase
molecule keywords Fumarate reductase flavoprotein subunit
total genus 70
structure length 243
sequence length 243
chains with identical sequence N
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2010-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13183 Fer4_8 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 3p4rB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3p4rB01
1RYJA 2MH7A 1N62A 1QF6A 1DOXA 1XLOA 3VR8B 1XLQA 3AE9B 2BS4B 2CJNA 3SR6A 1SIJA 3HVZA 1EWYC 3PO0A 1JQ4A 1TYGB 2DBYA 4ZHOA 3WCQA 2OHFA 5EE3A 4N59A 1DOYA 4KX6B 3NS1A 1VLBA 1GTHA 3AE6B 2WDVB 1L6UA 2WQYB 4C80A 3VRBB 4YSYB 3SFEB 1TKYA 3CF4A 2WP9B 3VRAB 2W3RA 3AV8A 3AE7B 1FXIA 3AECB 3AEGB 4WWMA 1N60A 4YSZB 1FM0D 1RM6C 1NI3A 3SFDB 3AM9A 2WDRB 3HUIA 5AUKA 1WRIA 4HRSA 5H8YE 1GPXA 3NVVA 3BIID 2W54A 2DWQA 2PVOD 1V8CA 3NVWA 4N6EB 1FFUA 1FRRA 3AE8B 1QT9A 1N63A 3DWMA 3EUB2 4IDIA 4HROA 3FC4A 1ZOYB 1WWTA 1JW9D 1PFDA 1SB3C 4FXCA 1FRDA 1H7XA 5EE1A 3VR9B 3L4PA 1CZPA 4YTPB 3NVYA 3CIRB 2AX5A 1XLPA 3NVZA 2L52A 2MJDA 4ITKA 2PVGC 1B9RA 3AN1A 2BS3B 1NVID 1NYRA 5GXGB 4YT0B 1VJKA 2G1EA 1R7SA 5G5HA 1DOIA 2H89B 3FAHA 3RPFC 2CJOA 1NEKB 3DWGC 1FIQA 1TKGA 1H7WA 1OQQA 1FXAA 3AH7A 1JWAD 3AE5B 2QIEB 4C7YA 2WU5B 1YQ3B 1QLBB 3AEDB 2CU3A 1FFVA 3P4QB 3AE2B 1QOGA 2HTME 1FO4A 2MJEA 2K5PA 2KMMA 1J7BA 1XO3A 1YJIA 1L5PA 1AWDA 3W5UB 2L83A 3AE1B 3AEAB 5EE9A 1JROA 4JX1C 3P63A 3W5VB 1NENB 1KRHA 2FBWB 1L6VA 3HRDD 1AYFA 1N5WA 2B76B 1CJEA 3KWLA 3AEBB 1ZP0B 1OQRA 1PDXA 1E10A 4C7ZA 3P4RB 1KF6B 1PUTA 3NRZA 1J7CA 3AB5A 1E6EB 3P4SB 3P4PB 2WLBA 4JWUC 1V97A 1I7HA 2EKIA 2LEKA 4LTUA 2KAJA 3CWIA 1GT8A 2ACZB 1QOBA 1SF0A 3B2FA 1A70A 1DGJA 3AEFB 2PIAA 5MPOA 1L0VB 1YQ4B 2M19A 1JRPA 4P6VF 2Y5CA 3ETRA 2W3SA 4JWSC 2K9XA 3ABVB 1TKEA 1ZXIA 4A9AA 2WS3B 1E9MA 2QJLA 2M56B 1NYQA 1XLNA 3AMZA 3W9CB 5C2TB 1KFYB 2H88B 4YTNB 1WYGA 4YXDB 2W55A 4N58A 4YSXB 1ZUD2 4USAA 2N0SB 5G5GA 1WXQA 1QOAA 2JX5A 3AE4B 3LB8C 4ZHPA 1N5XA 5AUIA 3B9JA 1QOFA 1E0ZA 1UWMA 1GAQB 3P1MA 2PKOA 3AE3B 2Q5WD 2BS2B 3LXFA 4US9A 5H92C 1T3QA 1F0ZA 1RFKA 3AEEB 1E7PB 2JQRB 3ZYYX 4YTMB 4ZOHC 1IUEA 1VDVA 5C3JB 1TJEA 1YJJA 2BT6A 4WQMA 1OFFA 4US8A 1GTEA 1RWSA 2E3TA 1JWBD 1JALA 2K22A 1N61A 1WGKA 1FMAD 2WU2B 2MJ3A 3B2GA 1ROEA 1J7AA 5EE0A 2WDQB
chains in the Genus database with same CATH superfamily
1T0RC 2MH7A 2INNE 5IAAC 2PTLA 4A3OA 1QF6A 4J3OD 2JZZA 2C7HA 4DBGA 2LI5A 4P1CC 1XT9B 4JIOU 2M0AA 2GI9A 2LGDA 3ZRCA 3A9JA 3KW5B 4W9EA 2MHJA 2ZJDA 4NJ7A 1E8ZA 2KJ6A 2CKHB 4MGIE 2BF8B 2WXHA 3ENEA 3EUB2 2Y5BB 3A9JB 3O65B 1QQRA 3NG0A 4MGKE 2C7NB 4F7ZA 1HQRD 1XLPA 2L52A 3A4RA 4HEA1 3IG3A 3L13A 3PRZA 2G1EA 2X8XX 4IM0A 1FIQA 3VQIA 1LO5D 1QOGA 1WXAA 4YWGG 1AWDA 2SEBD 4MGYE 1WGDA 5EE9A 4JGHB 3MHZA 3L08A 3IT6B 3W1SC 1NENB 1L6VA 2WXMA 1VRAB 3GS2A 1WSPA 4K3CA 1PUTA 4EZKA 1ZKHA 1ENFA 4GSWA 2V4LA 4IWPA 2D07B 4FN2A 1V80A 1DGJA 2IYDB 4P6VF 1YN4A 2GBMA 2KVRA 2QEJC 4DQOC 1XLNA 3BVMA 3V62A 1JQ4A 3RZWC 3B0AA 3ZW3A 4NJ6A 4NZLB 3AXCA 1SE9A 1P98A 3BK2A 1T0QC 3AE3B 2DZMA 2WDTB 5H92C 2KKCA 1FCLA 4LNOA 4YTMB 2V3SA 3PREA 1IUEA 2INCC 1TJEA 1SIFA 3U2SC 3GZNB 5KHOA 4K81A 2FCQA 4WQOB 1WM2A 2LXAA 2I2YA 1R4NI 2FCNA 1ZXHA 1TYGB 4ZHOA 1EO6A 3L10B 1AN8A 1V2YA 2LHEA 3BVZA 1E8WA 1ZPSA 1HA5A 2W3RA 3AE7B 4ANWA 2ZNVB 3TIXA 3X23A 2IY0B 3NVVA 1H4RA 1QT9A 1UH6A 4LCDE 1PQSA 1YIWA 2N1VA 3QHTA 4B95A 1C3TA 5C1ZA 2K39A 1MHHE 3V6CB 4NAWB 4EFOA 4ICUA 4I6LB 4TKNA 3GB1A 1I4QA 5DPRA 1IBXA 2NTSA 4XWTA 2YEPB 5BMIA 3VDZA 2MP2A 3U8ZA 2MSED 2YLMA 2K6DB 3CSTA 5JHBA 1OQRA 1WE7A 3M62B 4B6WA 2DENB 3NZ3A 3ZNID 3QWZB 2O6VB 3R66C 4A3PA 1SF0A 2LRUA 2IZVB 1WH3A 2VZKD 1ISNA 2KX0A 2WXQA 4HPMB 4HPPA 4IWOA 3M63B 2GBNA 5AZFA 4MJSA 2VH1A 2IO0B 1E0ZA 3JYUA 2N4FA 3RMKC 4ZOHC 3ZKJC 3U7ZA 5CX3A 5IKCM 1YJJA 1RWSA 1FMAD 2K22A 3DHIC 4O1NA 1YX5B 3BYTB 1KLVA 4ZYSA 1WX9A 2PPHA 1KM7A 2ZZPB 4HK2A 2V9HA 4MSQB 1EM7A 1HE8A 2KJHB 3SU8X 2C9WB 2G3QB 2FAZA 3AECB 3DBHB 1FD6A 2WXNA 3AM9A 3HUIA 4ZRPA 4G0NB 2JY6A 2L7RA 4HJKA 2ZPYA 3R7RA 1WGGA 2KACA 3NOBA 4DDGD 2AX5A 4ARCA 4K7WA 4HLEA 4OZAA 1RFAA 1E8YA 2IGGA 3HIZA 2L1AA 3ALBA 3Q8FA 2JWZA 2L76A 4NPNA 3A9KB 4GIVA 2JWUA 5LXHA 3PPAA 2EELA 4REZA 2KMMA 2LUMA 2J42A 4RGNA 2YVCA 2KNBA 2KYWA 2L83A 1FEHA 3DBRB 4FBJB 4A8XC 4BKGA 3RNAC 1PDXA 3HM6X 4WJNA 1P7FA 2KC1A 1V49A 4IG7B 3V3XA 2ACZB 1A70A 1FNWA 3NS8A 1JMLA 2TSSA 3MC0B 4ZDVA 3TCAA 1NYQA 2UU7A 1WR6E 2AQ2B 4N58A 1YN5A 1JWMD 2W55A 4BBNC 2B3AA 2CHXA 2HJ8A 4W9GA 3JW0X 1PGAA 2UYZB 3B9JA 1GAQB 1L4ZB 2J53A 2VRRB 1T3QA 1E7PB 1ET9A 2RR9A 1Y8RC 1HEZE 2BB6A 2E6XA 1WGKA 2WU2B 5AZHA 2J4XA 4LDTD 3AE9B 4A90A 2KN5A 1SIJA 2J0JA 3N3KB 2A4ZA 2A5UA 1GTHA 1L6UA 2WDVB 3EFCA 5J2RA 2MBBB 4RM9A 3KUDB 3KUCB 3I63C 4BBNF 1RM6C 2MQJA 2XNAC 2WXLA 3AE8B 4NNJB 3KWVA 4W9KA 4BZAA 2V0GA 1WJ6A 3RYTA 2N9XA 2OJRA 2IJ0A 4MSMB 2KVZA 3B1LX 3NVYA 4FULA 4HCPB 2MJDA 2KK8A 3KQ4A 4OVVA 4ICVA 2CJOA 2OOBB 2HD5B 2KFJA 3MP9A 3BYYB 2K3UA 4HWIB 4GDKA 2QMTA 3FILB 1VR9A 3AE1B 2KTRA 3ZJTA 1PGXA 3PTFC 4DHJB 2B76B 1YNTE 4GXBA 5DPSA 1RLFA 4KV2A 3N9YC 3VH4B 5D3IB 3PS6A 2JPHA 1MHXA 1EWCA 2KDBA 4YSXB 2GRIA 1QZEA 1UF0A 2G4DB 3ZJVA 2LXCA 2Q5WD 3V60A 2KMCA 1TGZB 3Q3OC 5DCNA 2BWFA 4M8NA 2K8HA 2MBHA 4WJOA 2N1WA 1MJDA 1CQVA 4RF1A 3WCQA 3DHHC 3AE6B 2ZEQA 2WXPA 4YSZB 4DDID 2Z0EB 1V5OA 4NAWA 1GPXA 5CTRC 4XGAB 1T6BX 5BMGA 4TV3A 3VR9B 1R4MB 1WZ3A 4KIKA 2IO3B 2JT4B 4A55A 4HJGE 2RSUA 1WI0A 3TEYA 3RI7C 3AU5A 2LGYA 1JWAD 2QIEB 3IAM1 5LXIB 2Z0DB 3P4QB 2BQQA 4E71A 3GP7A 2N9EB 1KH0A 2WXRA 4LNFA 2C60A 3KVFB 1WE6A 1K50A 1KRHA 2KDEB 3MC8A 4AJYB 2WXGA 4KSKC 1F52A 3B08A 3CF6E 1K51A 4XX5A 2MWSB 2KAJA 4MDKE 3ZLZA 3SDLC 3CSFA 1WRDB 1I4HA 2GBJA 2GBRA 2NCNA 3MJWA 3PRPB 3SHQA 2PW9A 5C2TB 4KIKB 4YXDB 2KZRA 4WURA 2EKEC 1E90A 2LJ5A 4P7IA 3VXWA 3KUZA 3JSVB 3PZ8A 4BAXA 1GB1A 1VZ7A 1OFFA 3U52E 1J8CA 2QSDA 4DK5A 4EOYA 1E10A 3KYDD 4FJVB 3QX1A 2MLBA 5D7GA 4N59A 4A6QA 4FLHA 2MW5A 5TSSA 3MC9A 2O6VA 2IGDA 3N20C 3PSEB 4WWMA 1FM0D 2RPVA 2DLBA 1HZ6A 2FE8A 1WR1A 5I4DA 2FIDA 2MBQA 4URKA 1HZ5A 1IGDA 2K0PA 3N1YC 1ET6A 2KANA 1LXDA 1LQBA 2WXFA 2D3BA 1MPEA 2DZJA 2GOWA 4KKJA 4UDUC 4AS1A 1IP9A 4HVBA 1OGWA 4MT5A 5FR3A 1NYRA 4ZRIA 5GXGB 5G55A 2Y3AA 4MGZE 3ZQ4A 3VFKA 2CHWA 3FKYA 1TKGA 1FXAA 5EDSA 1HTQA 2KLGA 3UIPB 1DYQA 2KWUB 3V05A 4N9F4 3DDCB 1T5XD 4L2YA 1L5PA 4B0EA 4FJZA 2N7DA 4KGTA 1CJEA 3EC8A 4K1RB 1D5MC 3NRZA 1J7CA 3BVGA 2KXJA 3ZUNA 3CWIA 3NHEB 4L1BA 3UINB 3VTVA 3I3TB 5DPWA 3NZUA 1SJHD 2V4IB 2WS3B 3M3JA 3AMZA 1RRBA 2H88B 5H8YE 4MH0E 4GMVA 1D3ZA 2OEDA 2KFKA 1UWMA 1SE4A 1EU3A 1GJZA 4TQ0A 4YL8A 2WX1A 2NMQA 5E6OA 3ZYYX 2JZPA 4TUUA 1P1AA 2E3TA 1ESFA 2R2QA 1I35A 4LK0M 2IBIB 1V1PA 3RCZA 4WWPA 1L0YB 4H2AA 1F9JA 2NBUA 1P7EA 3T8MA 2JZ3B 2N9PC 3PRMB 5AEKB 1GC6A 2JRHA 3A1QB 4KDLB 3OJ3A 3GE8C 3SFEB 2VH2A 4HXDA 2IY1B 4CO7A 2WYQA 5AUKA 2DWQA 1V86A 1UGJA 2WXIA 3KLSX 2N9LA 4W9IA 3TEZA 1T0SC 2R2OA 3R3MA 2K8BA 4AQ7A 1OTRB 4FJYA 1NVID 4YT0B 2G45B 2LJIA 2WNMA 3PT2B 3OWEB 2FUHB 1WGHA 2L32A 1IGCA 3RN9C 1LFDA 3BK1A 3AE5B 1YQ3B 3W1YA 3ZRFA 3E9SA 1EUVB 3IHPC 5IN7A 4OZCA 3I9V1 2XK5B 3U7DA 4DXAB 1VCBA 3AEBB 4EZLA 2LZ6A 2BVCA 4CYEA 4JWUC 2WXJA 1L0XB 4F8CB 4LTUA 2ZW1A 5LLIA 1QOBA 4WJQA 1GG3A 5JZEB 3DOWA 3AEFB 3Q6BA 4LJOB 3KYCD 2QJLA 3QIJA 2CR5A 5BYRA 2N0SB 2MBEA 4ZYNA 3ZTDA 1Q10A 1C76A 2CU1A 2Y5PA 3AEEB 3APCA 3TSSA 4LNKA 3TJPA 1GC7A 2GBKA 3A9KA 1N61A 4NJCA 4FHJA 1EF5A 3DVGY 1C4AA 4E74A 4EKUA 1DOYA 2J0MA 1XCQL 2MCNB 2DYOA 4XDCA 3N1XC 3D32A 5GMVA 3AEGB 1NI3A 3QARA 3AI5A 2KN4A 2L00B 2DHZA 2G4SA 3BY4B 1Z5SB 2GB1A 1PFDA 4EUTA 4XWWA 2AEHA 3ZO5B 1WYWB 1CZPA 3NZSA 4HDQA 3RUIB 4ANVA 3NVZA 2QDFA 3WIMA 1VZ6A 4ITKA 1V1PB 3A4SC 3MTNB 1TS4A 1VJKA 1SEBD 4GGQA 1DOIA 1TY2A 2W9NA 3UI3A 2C5LC 3IVFA 2UWQA 3Q3FA 1FO4A 3W5UB 2ZW0A 4LJPB 1ZDXA 3Q3NC 3GZNI 3H8HA 3H7PB 2BGFA 4QAYA 2RPQA 4W9LA 3P4PB 4IM3A 4DHZE 3IFWB 1FNVA 1L7YA 1I7HA 3T9LA 4J6IA 4MM3A 4OHJA 4AOFA 1TZ1A 1IBXB 1UUPA 2QC8A 3ECIA 2KWCA 2L0FA 4IOIE 2Y5CA 4A9AA 3ZNZB 3OJ4B 1WXVA 4RF0A 5L95C 1I4PA 1SXTA 2XN9C 3K9PB 2DAJA 3UF8A 2MRPA 1ZGUB 4RCOA 3J9CA 4ZRQA 5CHFA 4OW0A 4WH4A 4M8MA 1N62A 3N1ZC 1E7UA 3HVZA 4G3XB 1EWYC 3WANA 3DCGA 4KX6B 2L05A 3AV8A 2KD0A 3RT3B 3MFGA 3ZDTA 2PEAA 4HRSA 2ONQA 2KWDA 2W54A 3BIID 4C7YA 4N6EB 2PE6B 4W9HA 5EE0A 2KTRB 3EECA 2WXKA 4HROA 5C23A 3DHGC 1E8XA 1FRDA 4NQKE 4XYCA 4ANXA 3WAMA 3NJTA 1Q0WB 3AU4A 3V6EB 4WWOA 4LNIA 3DBLB 2NPTB 4KZ0A 3RNFC 3ML9A 3DWGC 3M95A 1OQQA 3P2BA 5L83A 3PLVA 1Q5WB 2RGFA 4ACFA 1UBQA 3Q2AC 3VUYA 4GU2A 3RULA 5HFYA 4OZBA 1AW7A 4JX1C 2ZVOA 2ON8A 2GMIC 2FCSA 1ZP0B 3P4RB 2YEPF 2RMMA 2WLBA 3PZ7A 4BKSD 3PHXB 1F1HA 2LGSA 3OAWA 5LNK1 1Z2MA 3U30A 2BYVE 4PS8A 3RD2A 2AL3A 1E9MA 4JLCA 2M56B 1C77A 2ZPNA 1STEA 1YQBA 5G5GA 3AE4B 3LB8C 2IO1B 3VTWA 1QOFA 4B0MA 3ZNGC 2NPTA 5E6NA 3EA6A 1GOZA 2PLPA 1TT5B 2JQRB 5C3JB 2LD9A 2N9KA 1X1MA 4US8A 1JWBD 1P9DU 3OG5A 2WDQB 2LUEA 3ZXRA 1D4BA 4TSSA 3PV1A 4M00A 3VTUA 1PGBA 4LLGM 3VRBB 1MG8A 2RDGA 3IXSA 3TL5A 2WDRB 2O2VA 1WJ4A 1KOTA 3BZDB 1WX7A 1JRUA 4BOSC 1WWTA 2PJHA 4II3B 1LM8B 3ZNHB 3AN1A 4BFRA 1V1OA 4RFBA 2PMVA 3N30A 4MM3B 3RPFC 3W1SA 4IM2A 2WHIA 2BB5A 2L0TA 3VH3B 4C00A 2WWZA 4P16A 1TZOA 2XEWA 3IAS1 3Q8AA 4PT5A 3HHMA 2DAFA 2V1YA 3H6NA 1E7VA 1YX6B 3P63A 4ANUA 3ZGZA 3ZDMC 1N5WA 3KWLA 2D10A 2LGIA 4IW0A 4C56C 4BKTA 4EEWA 2BYEA 4RNAA 5HHDG 1IYFA 2LEKA 3H9DA 2K6QA 1SSNA 5MPOA 1JCKB 4XZ4A 4MH8A 3DVGX 2Z8LA 2JXXA 4W9DA 3W9CB 1WZ0A 2BWES 4GN1A 2AWTA 2FIFA 3FILA 3DBSA 2M0XA 3LXFA 2LASA 1QKZA 3C8YA 3CMMB 2PE9A 2AQ3B 1YD8U 3DVNU 1JALA 3RNBC 2MJ3A 2KQ7A 4LDTB 1XLOA 1CK1A 3T3NA 1WJNA 4HKQA 1GUAB 1IPGA 3ONSA 1YJ1A 1AARA 1D5XC 4WIPA 3I57A 1V5TA 1VLBA 1VD2A 4R3DA 1C4PA 1TS5A 2KT7A 1VZ8A 4EZJA 4W9CA 3EHVA 3PLUA 4IDIA 4WAFA 3FC4A 4G50A 4IUMB 5JHAA 3TMPB 4LNNA 3CIRB 1S1QB 4FHKA 4NAMA 2IDYA 1GNUA 1WJUA 5G5HA 1R4NB 3WA0A 2DYMA 3GOEA 1P0RA 3H7PA 3JVZX 4JQWC 1FFVA 4GDLA 2RDHA 3AE2B 1C1YB 2K5PA 2V3PA 2NBVB 1E5WA 3Q3JA 2W82A 1KJTA 2KFKB 4NQLB 1AYFA 4PYUA 4TQ1A 3VVWB 4XDDA 3AB5A 1TBEA 3WALA 3LJ3A 2AL6A 2IGHA 5E6PA 1WMHA 5JH5C 2PIAA 3X0WA 2N7JA 2LGXA 4KKIA 3ABVB 3Q3MC 3TEWA 4S0RA 4ZHPA 1WMHB 1QILA 1PYWD 3S2AA 1UZXB 2LVPA 3RZFA 1FCCC 3RFZB 1QOAA 3ML8A 4M0WA 1F2RI 1UGMA 3DPDA 3VHTC 3VAWA 1K52A 1F0ZA 2M8SA 3R2TA 1C9FA 4BVUC 3Q8BA 3TBLD 1C78A 2C7MB 3HM3A 2CJNA 3SR6A 4RMAA 1WXMA 2GLSA 3QC8B 5BYQA 3NS1A 4HDOA 3ZVVA 2WQYB 1A5RA 3CF4A 2KDMA 4HPLB 1N60A 1Y56A 3PZDA 5BO4B 3DQVA 3SFDB 2LVQA 3H7SA 3U4EG 2KWVB 3Q14C 2PVOD 2G9HD 4IC7B 4OVZA 4YTPB 1T0YA 2J0KA 1NI2A 4FA6A 4WJPA 2PVGC 2BS3B 3SEBA 3E56A 2QHOA 1WGYA 3ZJUA 3W2DA 2H89B 3KH0A 4ARIA 2LWPA 5HG2A 2WU5B 1WGRA 5T8IA 2VZKB 1J19A 2MJEA 2L8JA 1YJIA 1I4XA 3RNGC 3R7QA 2K8CA 3DBHI 1XXGA 1EF1A 3W5VB 2FBWB 4GDKB 1KF6B 3LYYA 1E6EB 3QCAA 3PGEA 1WX8A 1SE2A 1B1ZA 1V6EA 3C0RB 3APFA 3QJZA 3LDZE 4L23A 2ZNVC 1YQ4B 3VUXA 2W3SA 1ZXIA 2ZCBA 4A20A 4NY0A 3L54A 3ZXVA 4GOCA 1WYGA 3L0WB 1ZUD2 1I4GA 5AUIA 2BYFA 2Z59B 4P1BC 3IBEA 2NTTA 3P1MA 2HJ1A 3DVNV 4WAAA 4US9A 3UIOB 2DZIA 3DBRI 4F1SA 2BT6A 1DOXA 3V61A 2FUG1 4D2KA 3AULA 1XEEA 3K9OB 3L16A 5J17A 1OQYA 2LHDA 4YSYB 1WF9A 2V3NA 2WP9B 3VRAB 1FXIA 2AQ1B 2KJRA 2WXOA 4E3CA 1SJED 1WRIA 5IO9A 1MI0A 4JPSA 1D5ZC 1YN3A 1M4VA 2J7QB 4FXCA 4RH6A 2HTHA 4DWFA 3L4PA 3NY5A 2XBBC 5D6JB 3RNEC 5CHWA 2HE7A 1F77A 3C19A 4MEMA 3UQBA 1R7SA 2LFIA 2JF5A 1NEKB 2BKFA 5D3DA 4IWQA 3AH7A 1L4DB 2QCZA 4BOZB 2CU3A 1TS2A 4AWJA 2AYOB 5D2MB 2N7EA 4I6PA 4KGSA 1CMXB 4M0WB 3AEAB 2I38A 1JROA 4BKSA 1YMHE 1LGRA 1XCTL 2DZKA 4K7SA 5TR5A 3Q8CA 4C7ZA 3VUWA 1ACCA 2IPKD 1TTNA 2QILA 2O2VB 3R2IA 1FNUA 1WIAA 1L0VB 2KO3A 2M19A 1WFYA 2K9XA 3I5JC 2JRIB 2R61A 5IOIA 2EMSA 4AUQC 4AP4C 1K53A 2JXTA 5FK9C 5AZGA 2M1MA 2NVUI 2RD0A 2PKOA 3DBLI 4XC2A 1S3SG 2I1JA 1KLGD 1GTEA 5HKHA 2BYTA 3VR8B 2MP2B 1XLQA 2NR2A 3NUHB 2ZVNA 2DX5B 3P42A 3PO0A 1UBIA 2DBYA 3Q69A 1D6EC 1I4RA 4WWNA 5FKAC 1TKYA 2JU6X 2LVOA 1WY8A 3MHSD 2SAKA 2INDC 2KC2A 5G2NA 1ZDVA 2M17A 3NVWA 5HI1A 4PK1A 1G6JA 2M4NA 3WAOA 1J0GA 5EE1A 2FNJB 2LRWA 1OEYA 4PYZA 5JXVA 4DHJD 1B9RA 1WM3A 4GB9A 2D3AA 1H7WA 4AJWA 3QAQA 2BKRB 3ZIMA 1UWXA 1XO3A 4JL9A 2K25A 1F2RC 4ZRJA 3TEXA 2JVCA 3OLMD 3HRDD 3IT4B 2D2QA 2CHZA 5IP4D 2I1KA 4OVUA 2BBCA 1WXSA 4M02A 1GT8A 2NBWB 3B2FA 1SBBB 5D94A 2OJWA 5CHVC 2KDFB 1FXTB 3A33B 1JRPA 4M01A 2LMCA 3ETRA 2MBOA 1I42A 4XE0A 2NS5A 2DNFA 4ZRKA 4CQNA 4CHKA 1KFYB 3SD5A 2BPSA 4C4VB 2BS2B 2L3ZA 1R4MI 4MACA 4W9FA 4C4VA 3B2GA 1J7AA 3MJ5A 2BW2A 1RYJA 4MELA 2K1FA 2KLCA 3WAPA 1KTKA 2ICIA 2MA9B 2XK5A 4G11A 1M94A 2OHFA 1NDDA 3QQ8B 4C80A 3TUOA 3H1UA 3GE3C 3UQAA 1ZW7A 2JUOA 2WGSA 4DXFA 2MEKA 1YOVB 3JSVA 1FFUA 3DWMA 1N63A 3UGBB 1ZOYB 1H7XA 3PVLA 1UD7A 2EMTA 3QK0A 2KQSA 4DHZB 1KLUD 3O13A 3BINA 2D3GA 4W9JA 3FAHA 1L2NA 2KOXA 4KVGB 1MG4A 3AEDB 3QA8A 1TIFA 2HDEA 1BT0A 4B9KA 2WX0A 4IKGA 4Q2JA 1JWSD 3A1QA 1C4CA 5FR6A 2X38A 1EU4A 2INPE 3P4SB 1MVKA 4K3BA 4DXGA 1TY0A 2O6VD 2IO2B 3EGRA 1BXTA 1RAXA 1U4AA 1H8CA 5IA7A 4PS3A 1TKEA 4RGOS 2RDBC 3HVDA 1ZE3D 1TS3A 4KSLC 3N32A 1SE3A 5BYSA 4MJSB 3Q8EA 3PHWB 4GDLB 3EFUA 2BS4B 2REXA 4I6NB 5EE3A 2JYTA 3HK0A 1NBFC 1OEYJ 1XD3B 1XF5L 2D5GA 1K8RB 4TMAB 1UNSA 2DYBA 4RM8A 1SGHA 2KX3A 4RGTA 1V8CA 1FRRA 3URYA 1N6ZA 1JW9D 1SB3C 5DPTA 4HCNB 3BWUD 2MX2A 2JYEA 1FPYA 1XQQA 4II2B 4S17A 4ASWC 1GB4A 2KMAA 4KZCA 1P3QU 3ZTCA 2J52A 1QLBB 1HTOA 4K7UA 2KQ4X 1Q1OA 2HTME 1C79A 1J7BA 2ASQA 4KGRA 2BTEA 1MFWA 2KHWB 3APDA 4PS7A 2JSVX 5BMHA 5KHQA 2D3CA 4KDIC 4X57B 4FADA 1V97A 2EKIA 1V81A 2D11A 1JWUD 2ZCCA 4HKZE 3R8BA 3T3OA 1HXYD 1V9JA 2KDIA 3L17A 4JWSC 4RGMA 5E6JA 5J18A 4YTNB 4USAA 4EE2A 1WXQA 2JX5A 1N5XA 4JE3B 1UELA 2KTFA 1RFKA 4GLSC 1BMLC 1VDVA 2FCMA 2CS4A 3RNCC 4WQMA 1BUIC 1ROEA
chains in the Genus database with same CATH topology
2MH7A 1N62A 2INNE 2PTLA 1QF6A 1DOXA 2FUG1 4J3OD 4D2KA 3HVZA 1EWYC 1CQVA 4RF1A 1XEEA 3WCQA 4KX6B 3AE6B 2M0AA 2LHDA 4YSYB 2V3NA 2WXPA 3AV8A 2WP9B 3VRAB 2GI9A 1FXIA 3MFGA 2AQ1B 4YSZB 2WXOA 1SJED 1WRIA 4HRSA 1GPXA 2ONQA 2WXHA 2KWDA 2W54A 3BIID 1MI0A 4C7YA 4N6EB 5EE0A 4JPSA 1D5ZC 3EUB2 2WXKA 1QQRA 1T6BX 4HROA 1YN3A 1M4VA 5BMGA 4FXCA 4RH6A 1FRDA 3VR9B 3L4PA 1HQRD 1XLPA 2L52A 4HEA1 4A55A 4HJGE 1F77A 3TEYA 2G1EA 1R7SA 2LFIA 1NEKB 3DWGC 1FIQA 3VQIA 5D3DA 1OQQA 3AH7A 1JWAD 2QIEB 3IAM1 1L4DB 1LO5D 2CU3A 3P4QB 1QOGA 1TS2A 3GP7A 4KGSA 4YWGG 1KH0A 2WXRA 5HFYA 1AWDA 2SEBD 4OZBA 3AEAB 5EE9A 3MHZA 2I38A 1K50A 3IT6B 1JROA 1AW7A 4JX1C 1YMHE 1NENB 1KRHA 1L6VA 1XCTL 2ON8A 2WXMA 3Q8CA 1ZP0B 1VRAB 2WXGA 3GS2A 1WSPA 4C7ZA 3P4RB 1PUTA 1ACCA 2IPKD 2YEPF 2RMMA 2WLBA 3PZ7A 1ENFA 1K51A 2QILA 2KAJA 3R2IA 1DGJA 1FNUA 5LNK1 1L0VB 2M19A 1I4HA 4P6VF 1YN4A 2K9XA 2QEJC 1E9MA 4DQOC 2M56B 1C77A 2R61A 2PW9A 1XLNA 5C2TB 1STEA 3BVMA 1JQ4A 4YXDB 5G5GA 3AE4B 3LB8C 4NZLB 4WURA 1K53A 2JXTA 1QOFA 5FK9C 3BK2A 4B0MA 2PKOA 3AE3B 1FCLA 5H92C 3EA6A 1GOZA 2PLPA 2JQRB 4YTMB 1IUEA 3PZ8A 5C3JB 1TJEA 2N9KA 3U2SC 1GB1A 1KLGD 1OFFA 1VZ7A 1GTEA 3U52E 4US8A 2QSDA 1JWBD 1E10A 2WDQB 2BYTA 3VR8B 2I2YA 1XLQA 1D4BA 3NUHB 4TSSA 1ZXHA 3P42A 1TYGB 2DBYA 3PO0A 3Q69A 4ZHOA 5D7GA 1AN8A 4N59A 1PGBA 1D6EC 1I4RA 2LHEA 3BVZA 4A6QA 4LLGM 3VRBB 1ZPSA 1HA5A 2RDGA 5FKAC 1TKYA 2IGDA 3IXSA 5TSSA 2W3RA 3AE7B 4WWMA 1FM0D 2RPVA 2DLBA 1HZ6A 2FE8A 2JU6X 2WDRB 5I4DA 2SAKA 3NVVA 1ZDVA 3NVWA 1QT9A 5HI1A 3BZDB 1HZ5A 1IGDA 2K0PA 1WWTA 5EE1A 1MHHE 1ET6A 4NAWB 2WXFA 4UDUC 1MPEA 4KKJA 5JXVA 4AS1A 4MT5A 5FR3A 1B9RA 3AN1A 1NYRA 1V1OA 5GXGB 4RFBA 2PMVA 2Y3AA 3ZQ4A 4MM3B 3GB1A 1I4QA 3RPFC 3W1SA 1IBXA 1TKGA 1H7WA 2NTSA 1FXAA 2BB5A 1DYQA 4P16A 4XWTA 1UWXA 2YEPB 3V05A 5BMIA 1TZOA 1XO3A 1T5XD 3IAS1 4L2YA 3Q8AA 1L5PA 4PT5A 4B0EA 1F2RC 3TEXA 4KGTA 3P63A 3ZGZA 3HRDD 1N5WA 3KWLA 1CJEA 2LGIA 1D5MC 1OQRA 3IT4B 4C56C 3NRZA 1J7CA 3NZ3A 4RNAA 5HHDG 2BBCA 3BVGA 2LEKA 3CWIA 1GT8A 1SF0A 3B2FA 1SSNA 1SBBB 4L1BA 2VZKD 5MPOA 1JRPA 2LMCA 1JCKB 3ETRA 2WXQA 1SJHD 2V4IB 2WS3B 4MH8A 4XE0A 2Z8LA 4CQNA 3AMZA 3W9CB 5H8YE 1KFYB 2H88B 2OEDA 3FILA 1E0ZA 1UWMA 1SE4A 1EU3A 2BS2B 3LXFA 4TQ0A 2NMQA 3ZYYX 1QKZA 4ZOHC 3C8YA 2JZPA 4MACA 3U7ZA 2AQ3B 1YJJA 1RWSA 2E3TA 1JALA 2MJ3A 3B2GA 1FMAD 2K22A 1J7AA 3MJ5A 2BW2A 1ESFA 1RYJA 4O1NA 3BYTB 1XLOA 4LK0M 1CK1A 3T3NA 4HKQA 4ZYSA 1V1PA 1KTKA 2ICIA 1L0YB 4H2AA 1P7EA 1EM7A 1D5XC 4WIPA 3I57A 2OHFA 1VLBA 4C80A 3TUOA 4R3DA 1C4PA 1TS5A 3SFEB 3AECB 1FD6A 2WXNA 3AM9A 1VZ8A 4DXFA 3HUIA 5AUKA 2MEKA 4ZRPA 2DWQA 1FFUA 4IDIA 3DWMA 1N63A 1UGJA 4WAFA 2WXIA 3FC4A 1ZOYB 3KLSX 2N9LA 1H7XA 3TEZA 2KACA 3CIRB 4AQ7A 2AX5A 1KLUD 3O13A 1NVID 4NAMA 4ARCA 4YT0B 2LJIA 2WNMA 4OZAA 2IDYA 5G5HA 3OWEB 2IGGA 3FAHA 2L32A 1IGCA 2L1AA 3Q8FA 3BK1A 2DYMA 3AE5B 1YQ3B 3AEDB 2JWUA 1FFVA 2RDHA 3AE2B 2HDEA 2EELA 4REZA 2K5PA 2V3PA 2KMMA 2LUMA 3E9SA 2J42A 4RGNA 2W82A 4OZCA 3I9V1 2L83A 1FEHA 4IKGA 4A8XC 4Q2JA 1JWSD 1AYFA 3AEBB 1C4CA 1PDXA 4TQ1A 2X38A 1EU4A 4XDDA 2INPE 3AB5A 1P7FA 3P4SB 1MVKA 4JWUC 4DXGA 2WXJA 1TY0A 1L0XB 4LTUA 2IGHA 3EGRA 2ZW1A 3V3XA 2ACZB 1QOBA 1A70A 1FNWA 1JMLA 1BXTA 3AEFB 2PIAA 2TSSA 2N7JA 3MC0B 4KKIA 3ABVB 1TKEA 3TEWA 4RGOS 2QJLA 1NYQA 4ZHPA 1QILA 2AQ2B 4N58A 1PYWD 1JWMD 1YN5A 2W55A 5BYRA 1FCCC 2N0SB 3RFZB 1QOAA 3HVDA 1ZE3D 1PGAA 3B9JA 4M0WA 1TS3A 1F2RI 1GAQB 1L4ZB 2J53A 1Q10A 1C76A 2Y5PA 1SE3A 1K52A 1T3QA 1F0ZA 3AEEB 1E7PB 5BYSA 1ET9A 3R2TA 3TSSA 1C9FA 3Q8EA 1HEZE 2BB6A 2E6XA 3Q8BA 1N61A 1WGKA 2WU2B 4GDLB 4NJCA 1C78A 2J4XA 3AE9B 2BS4B 2CJNA 4A90A 3SR6A 1SIJA 1C4AA 5EE3A 2JYTA 5BYQA 3NS1A 1DOYA 1GTHA 1L6UA 2WDVB 2WQYB 1XCQL 1XF5L 2DYOA 4XDCA 2D5GA 3CF4A 2KDMA 3AEGB 1N60A 1Y56A 4TMAB 1RM6C 1UNSA 1NI3A 3SFDB 3U4EG 4RGTA 2KN4A 2XNAC 2WXLA 2PVOD 1V8CA 1FRRA 3AE8B 2G9HD 3KWVA 3URYA 1JW9D 1PFDA 1SB3C 2GB1A 2V0GA 4XWWA 4OVZA 3BWUD 2IJ0A 1CZPA 4YTPB 3NVYA 3NVZA 1VZ6A 1V1PB 2MJDA 2JYEA 4ITKA 2PVGC 3KQ4A 2BS3B 3SEBA 3E56A 1TS4A 1VJKA 1SEBD 3ZJUA 1GB4A 3W2DA 1DOIA 2H89B 1TY2A 4ARIA 2CJOA 5HG2A 3UI3A 2J52A 2WU5B 1QLBB 3MP9A 2KQ4X 5T8IA 2VZKB 3BYYB 2HTME 1FO4A 2MJEA 1C79A 2K3UA 1J7BA 1YJIA 1I4XA 2QMTA 3FILB 3W5UB 4KGRA 1VR9A 2ZW0A 3AE1B 1ZDXA 3ZJTA 2BTEA 1PGXA 3H8HA 1XXGA 3W5VB 2FBWB 2B76B 2JSVX 1YNTE 5BMHA 4GDKB 1KF6B 3LYYA 1E6EB 3P4PB 1FNVA 1V97A 1I7HA 2EKIA 1JWUD 1SE2A 1B1ZA 3N9YC 4OHJA 4HKZE 1IBXB 1UUPA 4L23A 3R8BA 3T3OA 1HXYD 5D3IB 1YQ4B 4IOIE 2Y5CA 2W3SA 4JWSC 4RGMA 1ZXIA 5E6JA 4A9AA 1MHXA 1EWCA 4YTNB 1WYGA 4USAA 4EE2A 4YSXB 2GRIA 1ZUD2 4RF0A 1I4GA 1I4PA 1WXQA 2JX5A 1SXTA 2XN9C 1N5XA 5AUIA 3ZJVA 2NTTA 3P1MA 2Q5WD 4JE3B 4US9A 4RCOA 3J9CA 4ZRQA 1RFKA 4GLSC 1BMLC 4OW0A 4WH4A 1VDVA 2BT6A 4WQMA 1BUIC 1ROEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RYJ A;  2MH7 A;  1N62 A;  1QF6 A;  1DOX A;  1XLO A;  3VR8 B;  1XLQ A;  3AE9 B;  2BS4 B;  2CJN A;  3SR6 A;  1SIJ A;  3HVZ A;  1EWY C;  3PO0 A;  1JQ4 A;  1TYG B;  2DBY A;  4ZHO A;  3WCQ A;  2OHF A;  5EE3 A;  4N59 A;  1DOY A;  4KX6 B;  3NS1 A;  1VLB A;  1GTH A;  3AE6 B;  2WDV B;  1L6U A;  2WQY B;  4C80 A;  3VRB B;  4YSY B;  3SFE B;  1TKY A;  3CF4 A;  2WP9 B;  3VRA B;  2W3R A;  3AV8 A;  3AE7 B;  1FXI A;  3AEC B;  3AEG B;  4WWM A;  1N60 A;  4YSZ B;  1FM0 D;  1RM6 C;  1NI3 A;  3SFD B;  3AM9 A;  2WDR B;  3HUI A;  5AUK A;  1WRI A;  4HRS A;  5H8Y E;  1GPX A;  3NVV A;  3BII D;  2W54 A;  2DWQ A;  2PVO D;  1V8C A;  3NVW A;  4N6E B;  1FFU A;  1FRR A;  3AE8 B;  1QT9 A;  1N63 A;  3DWM A;  3EUB 2;  4IDI A;  4HRO A;  3FC4 A;  1ZOY B;  1WWT A;  1JW9 D;  1PFD A;  1SB3 C;  4FXC A;  1FRD A;  1H7X A;  5EE1 A;  3VR9 B;  3L4P A;  1CZP A;  4YTP B;  3NVY A;  3CIR B;  2AX5 A;  1XLP A;  3NVZ A;  2L52 A;  2MJD A;  4ITK A;  2PVG C;  1B9R A;  3AN1 A;  2BS3 B;  1NVI D;  1NYR A;  5GXG B;  4YT0 B;  1VJK A;  2G1E A;  1R7S A;  5G5H A;  1DOI A;  2H89 B;  3FAH A;  3RPF C;  2CJO A;  1NEK B;  3DWG C;  1FIQ A;  1TKG A;  1H7W A;  1OQQ A;  1FXA A;  3AH7 A;  1JWA D;  3AE5 B;  2QIE B;  4C7Y A;  2WU5 B;  1YQ3 B;  1QLB B;  3AED B;  2CU3 A;  1FFV A;  3P4Q B;  3AE2 B;  1QOG A;  2HTM E;  1FO4 A;  2MJE A;  2K5P A;  2KMM A;  1J7B A;  1XO3 A;  1YJI A;  1L5P A;  1AWD A;  3W5U B;  2L83 A;  3AE1 B;  3AEA B;  5EE9 A;  1JRO A;  4JX1 C;  3P63 A;  3W5V B;  1NEN B;  1KRH A;  2FBW B;  1L6V A;  3HRD D;  1AYF A;  1N5W A;  2B76 B;  1CJE A;  3KWL A;  3AEB B;  1ZP0 B;  1OQR A;  1PDX A;  1E10 A;  4C7Z A;  3P4R B;  1KF6 B;  1PUT A;  3NRZ A;  1J7C A;  3AB5 A;  1E6E B;  3P4S B;  3P4P B;  2WLB A;  4JWU C;  1V97 A;  1I7H A;  2EKI A;  2LEK A;  4LTU A;  2KAJ A;  3CWI A;  1GT8 A;  2ACZ B;  1QOB A;  1SF0 A;  3B2F A;  1A70 A;  1DGJ A;  3AEF B;  2PIA A;  5MPO A;  1L0V B;  1YQ4 B;  2M19 A;  1JRP A;  4P6V F;  2Y5C A;  3ETR A;  2W3S A;  4JWS C;  2K9X A;  3ABV B;  1TKE A;  1ZXI A;  4A9A A;  2WS3 B;  1E9M A;  2QJL A;  2M56 B;  1NYQ A;  1XLN A;  3AMZ A;  3W9C B;  5C2T B;  1KFY B;  2H88 B;  4YTN B;  1WYG A;  4YXD B;  2W55 A;  4N58 A;  4YSX B;  1ZUD 2;  4USA A;  2N0S B;  5G5G A;  1WXQ A;  1QOA A;  2JX5 A;  3AE4 B;  3LB8 C;  4ZHP A;  1N5X A;  5AUI A;  3B9J A;  1QOF A;  1E0Z A;  1UWM A;  1GAQ B;  3P1M A;  2PKO A;  3AE3 B;  2Q5W D;  2BS2 B;  3LXF A;  4US9 A;  5H92 C;  1T3Q A;  1F0Z A;  1RFK A;  3AEE B;  1E7P B;  2JQR B;  3ZYY X;  4YTM B;  4ZOH C;  1IUE A;  1VDV A;  5C3J B;  1TJE A;  1YJJ A;  2BT6 A;  4WQM A;  1OFF A;  4US8 A;  1GTE A;  1RWS A;  2E3T A;  1JWB D;  1JAL A;  2K22 A;  1N61 A;  1WGK A;  1FMA D;  2WU2 B;  2MJ3 A;  3B2G A;  1ROE A;  1J7A A;  5EE0 A;  2WDQ B; 
#chains in the Genus database with same CATH topology
 1T0R C;  2MH7 A;  2INN E;  5IAA C;  2PTL A;  4A3O A;  1QF6 A;  4J3O D;  2JZZ A;  2C7H A;  4DBG A;  2LI5 A;  4P1C C;  1XT9 B;  4JIO U;  2M0A A;  2GI9 A;  2LGD A;  3ZRC A;  3A9J A;  3KW5 B;  4W9E A;  2MHJ A;  2ZJD A;  4NJ7 A;  1E8Z A;  2KJ6 A;  2CKH B;  4MGI E;  2BF8 B;  2WXH A;  3ENE A;  3EUB 2;  2Y5B B;  3A9J B;  3O65 B;  1QQR A;  3NG0 A;  4MGK E;  2C7N B;  4F7Z A;  1HQR D;  1XLP A;  2L52 A;  3A4R A;  4HEA 1;  3IG3 A;  3L13 A;  3PRZ A;  2G1E A;  2X8X X;  4IM0 A;  1FIQ A;  3VQI A;  1LO5 D;  1QOG A;  1WXA A;  4YWG G;  1AWD A;  2SEB D;  4MGY E;  1WGD A;  5EE9 A;  4JGH B;  3MHZ A;  3L08 A;  3IT6 B;  3W1S C;  1NEN B;  1L6V A;  2WXM A;  1VRA B;  3GS2 A;  1WSP A;  4K3C A;  1PUT A;  4EZK A;  1ZKH A;  1ENF A;  4GSW A;  2V4L A;  4IWP A;  2D07 B;  4FN2 A;  1V80 A;  1DGJ A;  2IYD B;  4P6V F;  1YN4 A;  2GBM A;  2KVR A;  2QEJ C;  4DQO C;  1XLN A;  3BVM A;  3V62 A;  1JQ4 A;  3RZW C;  3B0A A;  3ZW3 A;  4NJ6 A;  4NZL B;  3AXC A;  1SE9 A;  1P98 A;  3BK2 A;  1T0Q C;  3AE3 B;  2DZM A;  2WDT B;  5H92 C;  2KKC A;  1FCL A;  4LNO A;  4YTM B;  2V3S A;  3PRE A;  1IUE A;  2INC C;  1TJE A;  1SIF A;  3U2S C;  3GZN B;  5KHO A;  4K81 A;  2FCQ A;  4WQO B;  1WM2 A;  2LXA A;  2I2Y A;  1R4N I;  2FCN A;  1ZXH A;  1TYG B;  4ZHO A;  1EO6 A;  3L10 B;  1AN8 A;  1V2Y A;  2LHE A;  3BVZ A;  1E8W A;  1ZPS A;  1HA5 A;  2W3R A;  3AE7 B;  4ANW A;  2ZNV B;  3TIX A;  3X23 A;  2IY0 B;  3NVV A;  1H4R A;  1QT9 A;  1UH6 A;  4LCD E;  1PQS A;  1YIW A;  2N1V A;  3QHT A;  4B95 A;  1C3T A;  5C1Z A;  2K39 A;  1MHH E;  3V6C B;  4NAW B;  4EFO A;  4ICU A;  4I6L B;  4TKN A;  3GB1 A;  1I4Q A;  5DPR A;  1IBX A;  2NTS A;  4XWT A;  2YEP B;  5BMI A;  3VDZ A;  2MP2 A;  3U8Z A;  2MSE D;  2YLM A;  2K6D B;  3CST A;  5JHB A;  1OQR A;  1WE7 A;  3M62 B;  4B6W A;  2DEN B;  3NZ3 A;  3ZNI D;  3QWZ B;  2O6V B;  3R66 C;  4A3P A;  1SF0 A;  2LRU A;  2IZV B;  1WH3 A;  2VZK D;  1ISN A;  2KX0 A;  2WXQ A;  4HPM B;  4HPP A;  4IWO A;  3M63 B;  2GBN A;  5AZF A;  4MJS A;  2VH1 A;  2IO0 B;  1E0Z A;  3JYU A;  2N4F A;  3RMK C;  4ZOH C;  3ZKJ C;  3U7Z A;  5CX3 A;  5IKC M;  1YJJ A;  1RWS A;  1FMA D;  2K22 A;  3DHI C;  4O1N A;  1YX5 B;  3BYT B;  1KLV A;  4ZYS A;  1WX9 A;  2PPH A;  1KM7 A;  2ZZP B;  4HK2 A;  2V9H A;  4MSQ B;  1EM7 A;  1HE8 A;  2KJH B;  3SU8 X;  2C9W B;  2G3Q B;  2FAZ A;  3AEC B;  3DBH B;  1FD6 A;  2WXN A;  3AM9 A;  3HUI A;  4ZRP A;  4G0N B;  2JY6 A;  2L7R A;  4HJK A;  2ZPY A;  3R7R A;  1WGG A;  2KAC A;  3NOB A;  4DDG D;  2AX5 A;  4ARC A;  4K7W A;  4HLE A;  4OZA A;  1RFA A;  1E8Y A;  2IGG A;  3HIZ A;  2L1A A;  3ALB A;  3Q8F A;  2JWZ A;  2L76 A;  4NPN A;  3A9K B;  4GIV A;  2JWU A;  5LXH A;  3PPA A;  2EEL A;  4REZ A;  2KMM A;  2LUM A;  2J42 A;  4RGN A;  2YVC A;  2KNB A;  2KYW A;  2L83 A;  1FEH A;  3DBR B;  4FBJ B;  4A8X C;  4BKG A;  3RNA C;  1PDX A;  3HM6 X;  4WJN A;  1P7F A;  2KC1 A;  1V49 A;  4IG7 B;  3V3X A;  2ACZ B;  1A70 A;  1FNW A;  3NS8 A;  1JML A;  2TSS A;  3MC0 B;  4ZDV A;  3TCA A;  1NYQ A;  2UU7 A;  1WR6 E;  2AQ2 B;  4N58 A;  1YN5 A;  1JWM D;  2W55 A;  4BBN C;  2B3A A;  2CHX A;  2HJ8 A;  4W9G A;  3JW0 X;  1PGA A;  2UYZ B;  3B9J A;  1GAQ B;  1L4Z B;  2J53 A;  2VRR B;  1T3Q A;  1E7P B;  1ET9 A;  2RR9 A;  1Y8R C;  1HEZ E;  2BB6 A;  2E6X A;  1WGK A;  2WU2 B;  5AZH A;  2J4X A;  4LDT D;  3AE9 B;  4A90 A;  2KN5 A;  1SIJ A;  2J0J A;  3N3K B;  2A4Z A;  2A5U A;  1GTH A;  1L6U A;  2WDV B;  3EFC A;  5J2R A;  2MBB B;  4RM9 A;  3KUD B;  3KUC B;  3I63 C;  4BBN F;  1RM6 C;  2MQJ A;  2XNA C;  2WXL A;  3AE8 B;  4NNJ B;  3KWV A;  4W9K A;  4BZA A;  2V0G A;  1WJ6 A;  3RYT A;  2N9X A;  2OJR A;  2IJ0 A;  4MSM B;  2KVZ A;  3B1L X;  3NVY A;  4FUL A;  4HCP B;  2MJD A;  2KK8 A;  3KQ4 A;  4OVV A;  4ICV A;  2CJO A;  2OOB B;  2HD5 B;  2KFJ A;  3MP9 A;  3BYY B;  2K3U A;  4HWI B;  4GDK A;  2QMT A;  3FIL B;  1VR9 A;  3AE1 B;  2KTR A;  3ZJT A;  1PGX A;  3PTF C;  4DHJ B;  2B76 B;  1YNT E;  4GXB A;  5DPS A;  1RLF A;  4KV2 A;  3N9Y C;  3VH4 B;  5D3I B;  3PS6 A;  2JPH A;  1MHX A;  1EWC A;  2KDB A;  4YSX B;  2GRI A;  1QZE A;  1UF0 A;  2G4D B;  3ZJV A;  2LXC A;  2Q5W D;  3V60 A;  2KMC A;  1TGZ B;  3Q3O C;  5DCN A;  2BWF A;  4M8N A;  2K8H A;  2MBH A;  4WJO A;  2N1W A;  1MJD A;  1CQV A;  4RF1 A;  3WCQ A;  3DHH C;  3AE6 B;  2ZEQ A;  2WXP A;  4YSZ B;  4DDI D;  2Z0E B;  1V5O A;  4NAW A;  1GPX A;  5CTR C;  4XGA B;  1T6B X;  5BMG A;  4TV3 A;  3VR9 B;  1R4M B;  1WZ3 A;  4KIK A;  2IO3 B;  2JT4 B;  4A55 A;  4HJG E;  2RSU A;  1WI0 A;  3TEY A;  3RI7 C;  3AU5 A;  2LGY A;  1JWA D;  2QIE B;  3IAM 1;  5LXI B;  2Z0D B;  3P4Q B;  2BQQ A;  4E71 A;  3GP7 A;  2N9E B;  1KH0 A;  2WXR A;  4LNF A;  2C60 A;  3KVF B;  1WE6 A;  1K50 A;  1KRH A;  2KDE B;  3MC8 A;  4AJY B;  2WXG A;  4KSK C;  1F52 A;  3B08 A;  3CF6 E;  1K51 A;  4XX5 A;  2MWS B;  2KAJ A;  4MDK E;  3ZLZ A;  3SDL C;  3CSF A;  1WRD B;  1I4H A;  2GBJ A;  2GBR A;  2NCN A;  3MJW A;  3PRP B;  3SHQ A;  2PW9 A;  5C2T B;  4KIK B;  4YXD B;  2KZR A;  4WUR A;  2EKE C;  1E90 A;  2LJ5 A;  4P7I A;  3VXW A;  3KUZ A;  3JSV B;  3PZ8 A;  4BAX A;  1GB1 A;  1VZ7 A;  1OFF A;  3U52 E;  1J8C A;  2QSD A;  4DK5 A;  4EOY A;  1E10 A;  3KYD D;  4FJV B;  3QX1 A;  2MLB A;  5D7G A;  4N59 A;  4A6Q A;  4FLH A;  2MW5 A;  5TSS A;  3MC9 A;  2O6V A;  2IGD A;  3N20 C;  3PSE B;  4WWM A;  1FM0 D;  2RPV A;  2DLB A;  1HZ6 A;  2FE8 A;  1WR1 A;  5I4D A;  2FID A;  2MBQ A;  4URK A;  1HZ5 A;  1IGD A;  2K0P A;  3N1Y C;  1ET6 A;  2KAN A;  1LXD A;  1LQB A;  2WXF A;  2D3B A;  1MPE A;  2DZJ A;  2GOW A;  4KKJ A;  4UDU C;  4AS1 A;  1IP9 A;  4HVB A;  1OGW A;  4MT5 A;  5FR3 A;  1NYR A;  4ZRI A;  5GXG B;  5G55 A;  2Y3A A;  4MGZ E;  3ZQ4 A;  3VFK A;  2CHW A;  3FKY A;  1TKG A;  1FXA A;  5EDS A;  1HTQ A;  2KLG A;  3UIP B;  1DYQ A;  2KWU B;  3V05 A;  4N9F 4;  3DDC B;  1T5X D;  4L2Y A;  1L5P A;  4B0E A;  4FJZ A;  2N7D A;  4KGT A;  1CJE A;  3EC8 A;  4K1R B;  1D5M C;  3NRZ A;  1J7C A;  3BVG A;  2KXJ A;  3ZUN A;  3CWI A;  3NHE B;  4L1B A;  3UIN B;  3VTV A;  3I3T B;  5DPW A;  3NZU A;  1SJH D;  2V4I B;  2WS3 B;  3M3J A;  3AMZ A;  1RRB A;  2H88 B;  5H8Y E;  4MH0 E;  4GMV A;  1D3Z A;  2OED A;  2KFK A;  1UWM A;  1SE4 A;  1EU3 A;  1GJZ A;  4TQ0 A;  4YL8 A;  2WX1 A;  2NMQ A;  5E6O A;  3ZYY X;  2JZP A;  4TUU A;  1P1A A;  2E3T A;  1ESF A;  2R2Q A;  1I35 A;  4LK0 M;  2IBI B;  1V1P A;  3RCZ A;  4WWP A;  1L0Y B;  4H2A A;  1F9J A;  2NBU A;  1P7E A;  3T8M A;  2JZ3 B;  2N9P C;  3PRM B;  5AEK B;  1GC6 A;  2JRH A;  3A1Q B;  4KDL B;  3OJ3 A;  3GE8 C;  3SFE B;  2VH2 A;  4HXD A;  2IY1 B;  4CO7 A;  2WYQ A;  5AUK A;  2DWQ A;  1V86 A;  1UGJ A;  2WXI A;  3KLS X;  2N9L A;  4W9I A;  3TEZ A;  1T0S C;  2R2O A;  3R3M A;  2K8B A;  4AQ7 A;  1OTR B;  4FJY A;  1NVI D;  4YT0 B;  2G45 B;  2LJI A;  2WNM A;  3PT2 B;  3OWE B;  2FUH B;  1WGH A;  2L32 A;  1IGC A;  3RN9 C;  1LFD A;  3BK1 A;  3AE5 B;  1YQ3 B;  3W1Y A;  3ZRF A;  3E9S A;  1EUV B;  3IHP C;  5IN7 A;  4OZC A;  3I9V 1;  2XK5 B;  3U7D A;  4DXA B;  1VCB A;  3AEB B;  4EZL A;  2LZ6 A;  2BVC A;  4CYE A;  4JWU C;  2WXJ A;  1L0X B;  4F8C B;  4LTU A;  2ZW1 A;  5LLI A;  1QOB A;  4WJQ A;  1GG3 A;  5JZE B;  3DOW A;  3AEF B;  3Q6B A;  4LJO B;  3KYC D;  2QJL A;  3QIJ A;  2CR5 A;  5BYR A;  2N0S B;  2MBE A;  4ZYN A;  3ZTD A;  1Q10 A;  1C76 A;  2CU1 A;  2Y5P A;  3AEE B;  3APC A;  3TSS A;  4LNK A;  3TJP A;  1GC7 A;  2GBK A;  3A9K A;  1N61 A;  4NJC A;  4FHJ A;  1EF5 A;  3DVG Y;  1C4A A;  4E74 A;  4EKU A;  1DOY A;  2J0M A;  1XCQ L;  2MCN B;  2DYO A;  4XDC A;  3N1X C;  3D32 A;  5GMV A;  3AEG B;  1NI3 A;  3QAR A;  3AI5 A;  2KN4 A;  2L00 B;  2DHZ A;  2G4S A;  3BY4 B;  1Z5S B;  2GB1 A;  1PFD A;  4EUT A;  4XWW A;  2AEH A;  3ZO5 B;  1WYW B;  1CZP A;  3NZS A;  4HDQ A;  3RUI B;  4ANV A;  3NVZ A;  2QDF A;  3WIM A;  1VZ6 A;  4ITK A;  1V1P B;  3A4S C;  3MTN B;  1TS4 A;  1VJK A;  1SEB D;  4GGQ A;  1DOI A;  1TY2 A;  2W9N A;  3UI3 A;  2C5L C;  3IVF A;  2UWQ A;  3Q3F A;  1FO4 A;  3W5U B;  2ZW0 A;  4LJP B;  1ZDX A;  3Q3N C;  3GZN I;  3H8H A;  3H7P B;  2BGF A;  4QAY A;  2RPQ A;  4W9L A;  3P4P B;  4IM3 A;  4DHZ E;  3IFW B;  1FNV A;  1L7Y A;  1I7H A;  3T9L A;  4J6I A;  4MM3 A;  4OHJ A;  4AOF A;  1TZ1 A;  1IBX B;  1UUP A;  2QC8 A;  3ECI A;  2KWC A;  2L0F A;  4IOI E;  2Y5C A;  4A9A A;  3ZNZ B;  3OJ4 B;  1WXV A;  4RF0 A;  5L95 C;  1I4P A;  1SXT A;  2XN9 C;  3K9P B;  2DAJ A;  3UF8 A;  2MRP A;  1ZGU B;  4RCO A;  3J9C A;  4ZRQ A;  5CHF A;  4OW0 A;  4WH4 A;  4M8M A;  1N62 A;  3N1Z C;  1E7U A;  3HVZ A;  4G3X B;  1EWY C;  3WAN A;  3DCG A;  4KX6 B;  2L05 A;  3AV8 A;  2KD0 A;  3RT3 B;  3MFG A;  3ZDT A;  2PEA A;  4HRS A;  2ONQ A;  2KWD A;  2W54 A;  3BII D;  4C7Y A;  4N6E B;  2PE6 B;  4W9H A;  5EE0 A;  2KTR B;  3EEC A;  2WXK A;  4HRO A;  5C23 A;  3DHG C;  1E8X A;  1FRD A;  4NQK E;  4XYC A;  4ANX A;  3WAM A;  3NJT A;  1Q0W B;  3AU4 A;  3V6E B;  4WWO A;  4LNI A;  3DBL B;  2NPT B;  4KZ0 A;  3RNF C;  3ML9 A;  3DWG C;  3M95 A;  1OQQ A;  3P2B A;  5L83 A;  3PLV A;  1Q5W B;  2RGF A;  4ACF A;  1UBQ A;  3Q2A C;  3VUY A;  4GU2 A;  3RUL A;  5HFY A;  4OZB A;  1AW7 A;  4JX1 C;  2ZVO A;  2ON8 A;  2GMI C;  2FCS A;  1ZP0 B;  3P4R B;  2YEP F;  2RMM A;  2WLB A;  3PZ7 A;  4BKS D;  3PHX B;  1F1H A;  2LGS A;  3OAW A;  5LNK 1;  1Z2M A;  3U30 A;  2BYV E;  4PS8 A;  3RD2 A;  2AL3 A;  1E9M A;  4JLC A;  2M56 B;  1C77 A;  2ZPN A;  1STE A;  1YQB A;  5G5G A;  3AE4 B;  3LB8 C;  2IO1 B;  3VTW A;  1QOF A;  4B0M A;  3ZNG C;  2NPT A;  5E6N A;  3EA6 A;  1GOZ A;  2PLP A;  1TT5 B;  2JQR B;  5C3J B;  2LD9 A;  2N9K A;  1X1M A;  4US8 A;  1JWB D;  1P9D U;  3OG5 A;  2WDQ B;  2LUE A;  3ZXR A;  1D4B A;  4TSS A;  3PV1 A;  4M00 A;  3VTU A;  1PGB A;  4LLG M;  3VRB B;  1MG8 A;  2RDG A;  3IXS A;  3TL5 A;  2WDR B;  2O2V A;  1WJ4 A;  1KOT A;  3BZD B;  1WX7 A;  1JRU A;  4BOS C;  1WWT A;  2PJH A;  4II3 B;  1LM8 B;  3ZNH B;  3AN1 A;  4BFR A;  1V1O A;  4RFB A;  2PMV A;  3N30 A;  4MM3 B;  3RPF C;  3W1S A;  4IM2 A;  2WHI A;  2BB5 A;  2L0T A;  3VH3 B;  4C00 A;  2WWZ A;  4P16 A;  1TZO A;  2XEW A;  3IAS 1;  3Q8A A;  4PT5 A;  3HHM A;  2DAF A;  2V1Y A;  3H6N A;  1E7V A;  1YX6 B;  3P63 A;  4ANU A;  3ZGZ A;  3ZDM C;  1N5W A;  3KWL A;  2D10 A;  2LGI A;  4IW0 A;  4C56 C;  4BKT A;  4EEW A;  2BYE A;  4RNA A;  5HHD G;  1IYF A;  2LEK A;  3H9D A;  2K6Q A;  1SSN A;  5MPO A;  1JCK B;  4XZ4 A;  4MH8 A;  3DVG X;  2Z8L A;  2JXX A;  4W9D A;  3W9C B;  1WZ0 A;  2BWE S;  4GN1 A;  2AWT A;  2FIF A;  3FIL A;  3DBS A;  2M0X A;  3LXF A;  2LAS A;  1QKZ A;  3C8Y A;  3CMM B;  2PE9 A;  2AQ3 B;  1YD8 U;  3DVN U;  1JAL A;  3RNB C;  2MJ3 A;  2KQ7 A;  4LDT B;  1XLO A;  1CK1 A;  3T3N A;  1WJN A;  4HKQ A;  1GUA B;  1IPG A;  3ONS A;  1YJ1 A;  1AAR A;  1D5X C;  4WIP A;  3I57 A;  1V5T A;  1VLB A;  1VD2 A;  4R3D A;  1C4P A;  1TS5 A;  2KT7 A;  1VZ8 A;  4EZJ A;  4W9C A;  3EHV A;  3PLU A;  4IDI A;  4WAF A;  3FC4 A;  4G50 A;  4IUM B;  5JHA A;  3TMP B;  4LNN A;  3CIR B;  1S1Q B;  4FHK A;  4NAM A;  2IDY A;  1GNU A;  1WJU A;  5G5H A;  1R4N B;  3WA0 A;  2DYM A;  3GOE A;  1P0R A;  3H7P A;  3JVZ X;  4JQW C;  1FFV A;  4GDL A;  2RDH A;  3AE2 B;  1C1Y B;  2K5P A;  2V3P A;  2NBV B;  1E5W A;  3Q3J A;  2W82 A;  1KJT A;  2KFK B;  4NQL B;  1AYF A;  4PYU A;  4TQ1 A;  3VVW B;  4XDD A;  3AB5 A;  1TBE A;  3WAL A;  3LJ3 A;  2AL6 A;  2IGH A;  5E6P A;  1WMH A;  5JH5 C;  2PIA A;  3X0W A;  2N7J A;  2LGX A;  4KKI A;  3ABV B;  3Q3M C;  3TEW A;  4S0R A;  4ZHP A;  1WMH B;  1QIL A;  1PYW D;  3S2A A;  1UZX B;  2LVP A;  3RZF A;  1FCC C;  3RFZ B;  1QOA A;  3ML8 A;  4M0W A;  1F2R I;  1UGM A;  3DPD A;  3VHT C;  3VAW A;  1K52 A;  1F0Z A;  2M8S A;  3R2T A;  1C9F A;  4BVU C;  3Q8B A;  3TBL D;  1C78 A;  2C7M B;  3HM3 A;  2CJN A;  3SR6 A;  4RMA A;  1WXM A;  2GLS A;  3QC8 B;  5BYQ A;  3NS1 A;  4HDO A;  3ZVV A;  2WQY B;  1A5R A;  3CF4 A;  2KDM A;  4HPL B;  1N60 A;  1Y56 A;  3PZD A;  5BO4 B;  3DQV A;  3SFD B;  2LVQ A;  3H7S A;  3U4E G;  2KWV B;  3Q14 C;  2PVO D;  2G9H D;  4IC7 B;  4OVZ A;  4YTP B;  1T0Y A;  2J0K A;  1NI2 A;  4FA6 A;  4WJP A;  2PVG C;  2BS3 B;  3SEB A;  3E56 A;  2QHO A;  1WGY A;  3ZJU A;  3W2D A;  2H89 B;  3KH0 A;  4ARI A;  2LWP A;  5HG2 A;  2WU5 B;  1WGR A;  5T8I A;  2VZK B;  1J19 A;  2MJE A;  2L8J A;  1YJI A;  1I4X A;  3RNG C;  3R7Q A;  2K8C A;  3DBH I;  1XXG A;  1EF1 A;  3W5V B;  2FBW B;  4GDK B;  1KF6 B;  3LYY A;  1E6E B;  3QCA A;  3PGE A;  1WX8 A;  1SE2 A;  1B1Z A;  1V6E A;  3C0R B;  3APF A;  3QJZ A;  3LDZ E;  4L23 A;  2ZNV C;  1YQ4 B;  3VUX A;  2W3S A;  1ZXI A;  2ZCB A;  4A20 A;  4NY0 A;  3L54 A;  3ZXV A;  4GOC A;  1WYG A;  3L0W B;  1ZUD 2;  1I4G A;  5AUI A;  2BYF A;  2Z59 B;  4P1B C;  3IBE A;  2NTT A;  3P1M A;  2HJ1 A;  3DVN V;  4WAA A;  4US9 A;  3UIO B;  2DZI A;  3DBR I;  4F1S A;  2BT6 A;  1DOX A;  3V61 A;  2FUG 1;  4D2K A;  3AUL A;  1XEE A;  3K9O B;  3L16 A;  5J17 A;  1OQY A;  2LHD A;  4YSY B;  1WF9 A;  2V3N A;  2WP9 B;  3VRA B;  1FXI A;  2AQ1 B;  2KJR A;  2WXO A;  4E3C A;  1SJE D;  1WRI A;  5IO9 A;  1MI0 A;  4JPS A;  1D5Z C;  1YN3 A;  1M4V A;  2J7Q B;  4FXC A;  4RH6 A;  2HTH A;  4DWF A;  3L4P A;  3NY5 A;  2XBB C;  5D6J B;  3RNE C;  5CHW A;  2HE7 A;  1F77 A;  3C19 A;  4MEM A;  3UQB A;  1R7S A;  2LFI A;  2JF5 A;  1NEK B;  2BKF A;  5D3D A;  4IWQ A;  3AH7 A;  1L4D B;  2QCZ A;  4BOZ B;  2CU3 A;  1TS2 A;  4AWJ A;  2AYO B;  5D2M B;  2N7E A;  4I6P A;  4KGS A;  1CMX B;  4M0W B;  3AEA B;  2I38 A;  1JRO A;  4BKS A;  1YMH E;  1LGR A;  1XCT L;  2DZK A;  4K7S A;  5TR5 A;  3Q8C A;  4C7Z A;  3VUW A;  1ACC A;  2IPK D;  1TTN A;  2QIL A;  2O2V B;  3R2I A;  1FNU A;  1WIA A;  1L0V B;  2KO3 A;  2M19 A;  1WFY A;  2K9X A;  3I5J C;  2JRI B;  2R61 A;  5IOI A;  2EMS A;  4AUQ C;  4AP4 C;  1K53 A;  2JXT A;  5FK9 C;  5AZG A;  2M1M A;  2NVU I;  2RD0 A;  2PKO A;  3DBL I;  4XC2 A;  1S3S G;  2I1J A;  1KLG D;  1GTE A;  5HKH A;  2BYT A;  3VR8 B;  2MP2 B;  1XLQ A;  2NR2 A;  3NUH B;  2ZVN A;  2DX5 B;  3P42 A;  3PO0 A;  1UBI A;  2DBY A;  3Q69 A;  1D6E C;  1I4R A;  4WWN A;  5FKA C;  1TKY A;  2JU6 X;  2LVO A;  1WY8 A;  3MHS D;  2SAK A;  2IND C;  2KC2 A;  5G2N A;  1ZDV A;  2M17 A;  3NVW A;  5HI1 A;  4PK1 A;  1G6J A;  2M4N A;  3WAO A;  1J0G A;  5EE1 A;  2FNJ B;  2LRW A;  1OEY A;  4PYZ A;  5JXV A;  4DHJ D;  1B9R A;  1WM3 A;  4GB9 A;  2D3A A;  1H7W A;  4AJW A;  3QAQ A;  2BKR B;  3ZIM A;  1UWX A;  1XO3 A;  4JL9 A;  2K25 A;  1F2R C;  4ZRJ A;  3TEX A;  2JVC A;  3OLM D;  3HRD D;  3IT4 B;  2D2Q A;  2CHZ A;  5IP4 D;  2I1K A;  4OVU A;  2BBC A;  1WXS A;  4M02 A;  1GT8 A;  2NBW B;  3B2F A;  1SBB B;  5D94 A;  2OJW A;  5CHV C;  2KDF B;  1FXT B;  3A33 B;  1JRP A;  4M01 A;  2LMC A;  3ETR A;  2MBO A;  1I42 A;  4XE0 A;  2NS5 A;  2DNF A;  4ZRK A;  4CQN A;  4CHK A;  1KFY B;  3SD5 A;  2BPS A;  4C4V B;  2BS2 B;  2L3Z A;  1R4M I;  4MAC A;  4W9F A;  4C4V A;  3B2G A;  1J7A A;  3MJ5 A;  2BW2 A;  1RYJ A;  4MEL A;  2K1F A;  2KLC A;  3WAP A;  1KTK A;  2ICI A;  2MA9 B;  2XK5 A;  4G11 A;  1M94 A;  2OHF A;  1NDD A;  3QQ8 B;  4C80 A;  3TUO A;  3H1U A;  3GE3 C;  3UQA A;  1ZW7 A;  2JUO A;  2WGS A;  4DXF A;  2MEK A;  1YOV B;  3JSV A;  1FFU A;  3DWM A;  1N63 A;  3UGB B;  1ZOY B;  1H7X A;  3PVL A;  1UD7 A;  2EMT A;  3QK0 A;  2KQS A;  4DHZ B;  1KLU D;  3O13 A;  3BIN A;  2D3G A;  4W9J A;  3FAH A;  1L2N A;  2KOX A;  4KVG B;  1MG4 A;  3AED B;  3QA8 A;  1TIF A;  2HDE A;  1BT0 A;  4B9K A;  2WX0 A;  4IKG A;  4Q2J A;  1JWS D;  3A1Q A;  1C4C A;  5FR6 A;  2X38 A;  1EU4 A;  2INP E;  3P4S B;  1MVK A;  4K3B A;  4DXG A;  1TY0 A;  2O6V D;  2IO2 B;  3EGR A;  1BXT A;  1RAX A;  1U4A A;  1H8C A;  5IA7 A;  4PS3 A;  1TKE A;  4RGO S;  2RDB C;  3HVD A;  1ZE3 D;  1TS3 A;  4KSL C;  3N32 A;  1SE3 A;  5BYS A;  4MJS B;  3Q8E A;  3PHW B;  4GDL B;  3EFU A;  2BS4 B;  2REX A;  4I6N B;  5EE3 A;  2JYT A;  3HK0 A;  1NBF C;  1OEY J;  1XD3 B;  1XF5 L;  2D5G A;  1K8R B;  4TMA B;  1UNS A;  2DYB A;  4RM8 A;  1SGH A;  2KX3 A;  4RGT A;  1V8C A;  1FRR A;  3URY A;  1N6Z A;  1JW9 D;  1SB3 C;  5DPT A;  4HCN B;  3BWU D;  2MX2 A;  2JYE A;  1FPY A;  1XQQ A;  4II2 B;  4S17 A;  4ASW C;  1GB4 A;  2KMA A;  4KZC A;  1P3Q U;  3ZTC A;  2J52 A;  1QLB B;  1HTO A;  4K7U A;  2KQ4 X;  1Q1O A;  2HTM E;  1C79 A;  1J7B A;  2ASQ A;  4KGR A;  2BTE A;  1MFW A;  2KHW B;  3APD A;  4PS7 A;  2JSV X;  5BMH A;  5KHQ A;  2D3C A;  4KDI C;  4X57 B;  4FAD A;  1V97 A;  2EKI A;  1V81 A;  2D11 A;  1JWU D;  2ZCC A;  4HKZ E;  3R8B A;  3T3O A;  1HXY D;  1V9J A;  2KDI A;  3L17 A;  4JWS C;  4RGM A;  5E6J A;  5J18 A;  4YTN B;  4USA A;  4EE2 A;  1WXQ A;  2JX5 A;  1N5X A;  4JE3 B;  1UEL A;  2KTF A;  1RFK A;  4GLS C;  1BML C;  1VDV A;  2FCM A;  2CS4 A;  3RNC C;  4WQM A;  1BUI C;  1ROE A; 
#chains in the Genus database with same CATH homology
 2MH7 A;  1N62 A;  2INN E;  2PTL A;  1QF6 A;  1DOX A;  2FUG 1;  4J3O D;  4D2K A;  3HVZ A;  1EWY C;  1CQV A;  4RF1 A;  1XEE A;  3WCQ A;  4KX6 B;  3AE6 B;  2M0A A;  2LHD A;  4YSY B;  2V3N A;  2WXP A;  3AV8 A;  2WP9 B;  3VRA B;  2GI9 A;  1FXI A;  3MFG A;  2AQ1 B;  4YSZ B;  2WXO A;  1SJE D;  1WRI A;  4HRS A;  1GPX A;  2ONQ A;  2WXH A;  2KWD A;  2W54 A;  3BII D;  1MI0 A;  4C7Y A;  4N6E B;  5EE0 A;  4JPS A;  1D5Z C;  3EUB 2;  2WXK A;  1QQR A;  1T6B X;  4HRO A;  1YN3 A;  1M4V A;  5BMG A;  4FXC A;  4RH6 A;  1FRD A;  3VR9 B;  3L4P A;  1HQR D;  1XLP A;  2L52 A;  4HEA 1;  4A55 A;  4HJG E;  1F77 A;  3TEY A;  2G1E A;  1R7S A;  2LFI A;  1NEK B;  3DWG C;  1FIQ A;  3VQI A;  5D3D A;  1OQQ A;  3AH7 A;  1JWA D;  2QIE B;  3IAM 1;  1L4D B;  1LO5 D;  2CU3 A;  3P4Q B;  1QOG A;  1TS2 A;  3GP7 A;  4KGS A;  4YWG G;  1KH0 A;  2WXR A;  5HFY A;  1AWD A;  2SEB D;  4OZB A;  3AEA B;  5EE9 A;  3MHZ A;  2I38 A;  1K50 A;  3IT6 B;  1JRO A;  1AW7 A;  4JX1 C;  1YMH E;  1NEN B;  1KRH A;  1L6V A;  1XCT L;  2ON8 A;  2WXM A;  3Q8C A;  1ZP0 B;  1VRA B;  2WXG A;  3GS2 A;  1WSP A;  4C7Z A;  3P4R B;  1PUT A;  1ACC A;  2IPK D;  2YEP F;  2RMM A;  2WLB A;  3PZ7 A;  1ENF A;  1K51 A;  2QIL A;  2KAJ A;  3R2I A;  1DGJ A;  1FNU A;  5LNK 1;  1L0V B;  2M19 A;  1I4H A;  4P6V F;  1YN4 A;  2K9X A;  2QEJ C;  1E9M A;  4DQO C;  2M56 B;  1C77 A;  2R61 A;  2PW9 A;  1XLN A;  5C2T B;  1STE A;  3BVM A;  1JQ4 A;  4YXD B;  5G5G A;  3AE4 B;  3LB8 C;  4NZL B;  4WUR A;  1K53 A;  2JXT A;  1QOF A;  5FK9 C;  3BK2 A;  4B0M A;  2PKO A;  3AE3 B;  1FCL A;  5H92 C;  3EA6 A;  1GOZ A;  2PLP A;  2JQR B;  4YTM B;  1IUE A;  3PZ8 A;  5C3J B;  1TJE A;  2N9K A;  3U2S C;  1GB1 A;  1KLG D;  1OFF A;  1VZ7 A;  1GTE A;  3U52 E;  4US8 A;  2QSD A;  1JWB D;  1E10 A;  2WDQ B;  2BYT A;  3VR8 B;  2I2Y A;  1XLQ A;  1D4B A;  3NUH B;  4TSS A;  1ZXH A;  3P42 A;  1TYG B;  2DBY A;  3PO0 A;  3Q69 A;  4ZHO A;  5D7G A;  1AN8 A;  4N59 A;  1PGB A;  1D6E C;  1I4R A;  2LHE A;  3BVZ A;  4A6Q A;  4LLG M;  3VRB B;  1ZPS A;  1HA5 A;  2RDG A;  5FKA C;  1TKY A;  2IGD A;  3IXS A;  5TSS A;  2W3R A;  3AE7 B;  4WWM A;  1FM0 D;  2RPV A;  2DLB A;  1HZ6 A;  2FE8 A;  2JU6 X;  2WDR B;  5I4D A;  2SAK A;  3NVV A;  1ZDV A;  3NVW A;  1QT9 A;  5HI1 A;  3BZD B;  1HZ5 A;  1IGD A;  2K0P A;  1WWT A;  5EE1 A;  1MHH E;  1ET6 A;  4NAW B;  2WXF A;  4UDU C;  1MPE A;  4KKJ A;  5JXV A;  4AS1 A;  4MT5 A;  5FR3 A;  1B9R A;  3AN1 A;  1NYR A;  1V1O A;  5GXG B;  4RFB A;  2PMV A;  2Y3A A;  3ZQ4 A;  4MM3 B;  3GB1 A;  1I4Q A;  3RPF C;  3W1S A;  1IBX A;  1TKG A;  1H7W A;  2NTS A;  1FXA A;  2BB5 A;  1DYQ A;  4P16 A;  4XWT A;  1UWX A;  2YEP B;  3V05 A;  5BMI A;  1TZO A;  1XO3 A;  1T5X D;  3IAS 1;  4L2Y A;  3Q8A A;  1L5P A;  4PT5 A;  4B0E A;  1F2R C;  3TEX A;  4KGT A;  3P63 A;  3ZGZ A;  3HRD D;  1N5W A;  3KWL A;  1CJE A;  2LGI A;  1D5M C;  1OQR A;  3IT4 B;  4C56 C;  3NRZ A;  1J7C A;  3NZ3 A;  4RNA A;  5HHD G;  2BBC A;  3BVG A;  2LEK A;  3CWI A;  1GT8 A;  1SF0 A;  3B2F A;  1SSN A;  1SBB B;  4L1B A;  2VZK D;  5MPO A;  1JRP A;  2LMC A;  1JCK B;  3ETR A;  2WXQ A;  1SJH D;  2V4I B;  2WS3 B;  4MH8 A;  4XE0 A;  2Z8L A;  4CQN A;  3AMZ A;  3W9C B;  5H8Y E;  1KFY B;  2H88 B;  2OED A;  3FIL A;  1E0Z A;  1UWM A;  1SE4 A;  1EU3 A;  2BS2 B;  3LXF A;  4TQ0 A;  2NMQ A;  3ZYY X;  1QKZ A;  4ZOH C;  3C8Y A;  2JZP A;  4MAC A;  3U7Z A;  2AQ3 B;  1YJJ A;  1RWS A;  2E3T A;  1JAL A;  2MJ3 A;  3B2G A;  1FMA D;  2K22 A;  1J7A A;  3MJ5 A;  2BW2 A;  1ESF A;  1RYJ A;  4O1N A;  3BYT B;  1XLO A;  4LK0 M;  1CK1 A;  3T3N A;  4HKQ A;  4ZYS A;  1V1P A;  1KTK A;  2ICI A;  1L0Y B;  4H2A A;  1P7E A;  1EM7 A;  1D5X C;  4WIP A;  3I57 A;  2OHF A;  1VLB A;  4C80 A;  3TUO A;  4R3D A;  1C4P A;  1TS5 A;  3SFE B;  3AEC B;  1FD6 A;  2WXN A;  3AM9 A;  1VZ8 A;  4DXF A;  3HUI A;  5AUK A;  2MEK A;  4ZRP A;  2DWQ A;  1FFU A;  4IDI A;  3DWM A;  1N63 A;  1UGJ A;  4WAF A;  2WXI A;  3FC4 A;  1ZOY B;  3KLS X;  2N9L A;  1H7X A;  3TEZ A;  2KAC A;  3CIR B;  4AQ7 A;  2AX5 A;  1KLU D;  3O13 A;  1NVI D;  4NAM A;  4ARC A;  4YT0 B;  2LJI A;  2WNM A;  4OZA A;  2IDY A;  5G5H A;  3OWE B;  2IGG A;  3FAH A;  2L32 A;  1IGC A;  2L1A A;  3Q8F A;  3BK1 A;  2DYM A;  3AE5 B;  1YQ3 B;  3AED B;  2JWU A;  1FFV A;  2RDH A;  3AE2 B;  2HDE A;  2EEL A;  4REZ A;  2K5P A;  2V3P A;  2KMM A;  2LUM A;  3E9S A;  2J42 A;  4RGN A;  2W82 A;  4OZC A;  3I9V 1;  2L83 A;  1FEH A;  4IKG A;  4A8X C;  4Q2J A;  1JWS D;  1AYF A;  3AEB B;  1C4C A;  1PDX A;  4TQ1 A;  2X38 A;  1EU4 A;  4XDD A;  2INP E;  3AB5 A;  1P7F A;  3P4S B;  1MVK A;  4JWU C;  4DXG A;  2WXJ A;  1TY0 A;  1L0X B;  4LTU A;  2IGH A;  3EGR A;  2ZW1 A;  3V3X A;  2ACZ B;  1QOB A;  1A70 A;  1FNW A;  1JML A;  1BXT A;  3AEF B;  2PIA A;  2TSS A;  2N7J A;  3MC0 B;  4KKI A;  3ABV B;  1TKE A;  3TEW A;  4RGO S;  2QJL A;  1NYQ A;  4ZHP A;  1QIL A;  2AQ2 B;  4N58 A;  1PYW D;  1JWM D;  1YN5 A;  2W55 A;  5BYR A;  1FCC C;  2N0S B;  3RFZ B;  1QOA A;  3HVD A;  1ZE3 D;  1PGA A;  3B9J A;  4M0W A;  1TS3 A;  1F2R I;  1GAQ B;  1L4Z B;  2J53 A;  1Q10 A;  1C76 A;  2Y5P A;  1SE3 A;  1K52 A;  1T3Q A;  1F0Z A;  3AEE B;  1E7P B;  5BYS A;  1ET9 A;  3R2T A;  3TSS A;  1C9F A;  3Q8E A;  1HEZ E;  2BB6 A;  2E6X A;  3Q8B A;  1N61 A;  1WGK A;  2WU2 B;  4GDL B;  4NJC A;  1C78 A;  2J4X A;  3AE9 B;  2BS4 B;  2CJN A;  4A90 A;  3SR6 A;  1SIJ A;  1C4A A;  5EE3 A;  2JYT A;  5BYQ A;  3NS1 A;  1DOY A;  1GTH A;  1L6U A;  2WDV B;  2WQY B;  1XCQ L;  1XF5 L;  2DYO A;  4XDC A;  2D5G A;  3CF4 A;  2KDM A;  3AEG B;  1N60 A;  1Y56 A;  4TMA B;  1RM6 C;  1UNS A;  1NI3 A;  3SFD B;  3U4E G;  4RGT A;  2KN4 A;  2XNA C;  2WXL A;  2PVO D;  1V8C A;  1FRR A;  3AE8 B;  2G9H D;  3KWV A;  3URY A;  1JW9 D;  1PFD A;  1SB3 C;  2GB1 A;  2V0G A;  4XWW A;  4OVZ A;  3BWU D;  2IJ0 A;  1CZP A;  4YTP B;  3NVY A;  3NVZ A;  1VZ6 A;  1V1P B;  2MJD A;  2JYE A;  4ITK A;  2PVG C;  3KQ4 A;  2BS3 B;  3SEB A;  3E56 A;  1TS4 A;  1VJK A;  1SEB D;  3ZJU A;  1GB4 A;  3W2D A;  1DOI A;  2H89 B;  1TY2 A;  4ARI A;  2CJO A;  5HG2 A;  3UI3 A;  2J52 A;  2WU5 B;  1QLB B;  3MP9 A;  2KQ4 X;  5T8I A;  2VZK B;  3BYY B;  2HTM E;  1FO4 A;  2MJE A;  1C79 A;  2K3U A;  1J7B A;  1YJI A;  1I4X A;  2QMT A;  3FIL B;  3W5U B;  4KGR A;  1VR9 A;  2ZW0 A;  3AE1 B;  1ZDX A;  3ZJT A;  2BTE A;  1PGX A;  3H8H A;  1XXG A;  3W5V B;  2FBW B;  2B76 B;  2JSV X;  1YNT E;  5BMH A;  4GDK B;  1KF6 B;  3LYY A;  1E6E B;  3P4P B;  1FNV A;  1V97 A;  1I7H A;  2EKI A;  1JWU D;  1SE2 A;  1B1Z A;  3N9Y C;  4OHJ A;  4HKZ E;  1IBX B;  1UUP A;  4L23 A;  3R8B A;  3T3O A;  1HXY D;  5D3I B;  1YQ4 B;  4IOI E;  2Y5C A;  2W3S A;  4JWS C;  4RGM A;  1ZXI A;  5E6J A;  4A9A A;  1MHX A;  1EWC A;  4YTN B;  1WYG A;  4USA A;  4EE2 A;  4YSX B;  2GRI A;  1ZUD 2;  4RF0 A;  1I4G A;  1I4P A;  1WXQ A;  2JX5 A;  1SXT A;  2XN9 C;  1N5X A;  5AUI A;  3ZJV A;  2NTT A;  3P1M A;  2Q5W D;  4JE3 B;  4US9 A;  4RCO A;  3J9C A;  4ZRQ A;  1RFK A;  4GLS C;  1BML C;  4OW0 A;  4WH4 A;  1VDV A;  2BT6 A;  4WQM A;  1BUI C;  1ROE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...