3P4RB

Crystal structure of menaquinol:fumarate oxidoreductase in complex with glutarate
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
243
structure length
243
Chain Sequence
AEMKNLKIEVVRYNPEVDTAPHSAFYEVPYDATTSLLDALGYIKDNLAPDLSYRWSCRMAICGSCGMMVNNVPKLACKTFLRDYTDGMKVEALANFPIERDLVVDMTHFIESLEAIKPYIIGNSRTADQGTNIQTPAQMAKYHQFSGCINCGLCYAACPQFGLNPEFIGPAAITLAHRYNEDSRDHGKKERMAQLNSQNGVWSCTFVGYCSEVCPKHVDPAAAIQQGKVESSKDFLIATLKPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Geometric restraint drives on- and off-pathway catalysis by the Escherichia coli menaquinol:fumarate reductase.
pubmed doi rcsb
source organism Escherichia coli 042
molecule tags Oxidoreductase
molecule keywords Fumarate reductase flavoprotein subunit
total genus 70
structure length 243
sequence length 243
chains with identical sequence N
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2010-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13183 Fer4_8 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 3p4rB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3p4rB01
3AV8A 1QOGA 1E6EB 2H88B 3P4SB 2WU2B 1XO3A 1TKYA 1J7CA 1NYQA 1XLNA 1FXIA 2MJ3A 3BIID 1TKGA 1V97A 2KAJA 3AEEB 1A70A 3P1MA 1DOXA 1QLBB 3AE9B 4JX1C 1YJJA 1PDXA 3W9CB 3P4PB 1KF6B 2BS3B 1OQRA 1SIJA 2W3RA 3NS1A 3AE7B 1DOIA 4IDIA 5GXGB 1PFDA 1ZUD2 3WCQA 2WP9B 3FC4A 1GPXA 2QJLA 4FXCA 5C3JB 1QOFA 4N6EB 1FXAA 1TKEA 3NVZA 2M56B 5C2TB 1NENB 1WWTA 1RFKA 1T3QA 5MPOA 1GTEA 3VR9B 5EE9A 2B76B 4YTNB 1VDVA 4C80A 1FFUA 4ZHPA 3SR6A 3P4QB 2Q5WD 5G5GA 4JWSC 1E9MA 4KX6B 2WDRB 1JALA 1PUTA 4P6VF 4C7ZA 2HTME 3VR8B 3ABVB 4YT0B 2OHFA 3AE2B 1AYFA 1UWMA 3CIRB 3CWIA 3AECB 4N58A 1FFVA 5EE1A 1TYGB 1SB3C 2JX5A 4ZHOA 3AM9A 3AE6B 1IUEA 2K5PA 3VRBB 2MJEA 1KFYB 1RWSA 1J7AA 1NVID 2N0SB 3B2FA 2K22A 3AH7A 3NVVA 3PO0A 1XLPA 3HRDD 3NRZA 2M19A 2KMMA 1YQ3B 4YSZB 5G5HA 1JQ4A 3HUIA 4HRSA 1NYRA 2WS3B 1GAQB 3SFDB 1FRRA 1L5PA 2QIEB 2BS4B 1RYJA 1WYGA 2K9XA 1JWAD 1E0ZA 1FO4A 1ROEA 2L83A 1WXQA 3FAHA 2CJOA 1OQQA 2CU3A 2H89B 2Y5CA 4LTUA 2L52A 1XLOA 5H8YE 1CJEA 1N61A 3P4RB 3AE3B 3AEGB 3SFEB 2W55A 1B9RA 3AEDB 2BT6A 1FMAD 1L6VA 1V8CA 2WDQB 2AX5A 1FRDA 1DGJA 4N59A 1FM0D 1ZOYB 1L6UA 2PKOA 1YQ4B 2MJDA 2PVOD 2CJNA 2PIAA 4C7YA 1VJKA 1EWYC 1WRIA 1GTHA 2FBWB 2PVGC 2JQRB 1QT9A 4HROA 4WWMA 3AE8B 1ZP0B 2MH7A 1H7XA 3AMZA 2WQYB 3AE4B 4USAA 4US9A 1RM6C 1WGKA 1N63A 1QOBA 1SF0A 1AWDA 3AEAB 4YSXB 1CZPA 1QOAA 1E10A 3DWMA 3L4PA 5AUIA 3W5VB 3AE5B 2WLBA 1DOYA 4YTMB 3P63A 1ZXIA 3W5UB 1J7BA 1R7SA 2BS2B 3AE1B 3CF4A 1JW9D 1OFFA 3DWGC 5EE0A 3ETRA 3RPFC 1NI3A 2G1EA 3AN1A 1GT8A 2WDVB 2W3SA 3LXFA 4YXDB 1N60A 3EUB2 3LB8C 5AUKA 1F0ZA 1H7WA 3HVZA 1I7HA 2EKIA 5EE3A 4JWUC 2DWQA 4ZOHC 1NEKB 3NVYA 2E3TA 3VRAB 3AEBB 2ACZB 2LEKA 3ZYYX 1YJIA 3KWLA 4WQMA 2WU5B 3B2GA 5H92C 1QF6A 3B9JA 3NVWA 4YSYB 2W54A 1N5XA 1JROA 1KRHA 1N5WA 1N62A 4ITKA 3AEFB 1E7PB 3AB5A 4YTPB 1JRPA 1JWBD 1FIQA 4A9AA 1TJEA 1L0VB 2DBYA 1VLBA 1XLQA 4US8A
chains in the Genus database with same CATH superfamily
3M95A 2KAJA 3P1MA 1WE6A 1YJJA 3P4PB 5GXGB 1I4RA 3WCQA 1PFDA 2MBHA 2D3BA 3NG0A 3NVZA 5T8IA 4A55A 4EZLA 3Q69A 2JPHA 1JALA 1ZE3D 4RFBA 2KANA 2MX2A 3ZJUA 2J7QB 2OHFA 1WX9A 2OJWA 4RCOA 3OJ3A 2V3SA 3MJ5A 1J7AA 2RMMA 1BMLC 4HRSA 4BZAA 2PPHA 4K7UA 2Z0EB 3A1QB 1FO4A 2INPE 2LXCA 3SDLC 1OQQA 3UGBB 1V49A 1MPEA 4DHJD 1XCQL 1N61A 4US8A 4G3XB 2BT6A 2AX5A 2KX0A 4KGTA 3GE8C 4K3BA 3DQVA 4WWOA 1I42A 2FBWB 4W9IA 2IJ0A 1WM2A 4OZBA 1C4PA 2BYFA 2VZKD 2DYBA 4IWQA 4M02A 3KVFB 4P7IA 2K8CA 2IO1B 2K6QA 1CZPA 3E9SA 1ZKHA 2V3NA 2BB6A 1K53A 2IO0B 1WXAA 2KT7A 3L0WB 3NS8A 1C4AA 4FULA 3T8MA 3PRPB 3T9LA 2G3QB 4TQ1A 2C7MB 3P2BA 4WQMA 1WGGA 2K1FA 2XK5A 5CHFA 3RULA 3WAPA 2QMTA 1UELA 1FEHA 3N1YC 1ESFA 3NJTA 4MH0E 1SE9A 1SE3A 2FCSA 5KHOA 1YN5A 3C0RB 5BMIA 4R3DA 3DBRI 5IO9A 4M0WA 1YQBA 4RGOS 3KLSX 4DXGA 3SU8X 1L2NA 1ZDVA 1OEYA 4ZDVA 2VRRB 1P9DU 3DBRB 4GSWA 1E7VA 3VHTC 3AM9A 4MDKE 1H8CA 2V4IB 1R4MI 4KGSA 3U4EG 2NPTA 3ML8A 1WGHA 5L95C 4DHZE 3MC0B 1V1PA 5FR3A 3FAHA 2FCMA 1WXQA 4XX5A 2KQSA 2H89B 2L52A 5JHAA 1WJ4A 3RYTA 2KD0A 3W1YA 4GDKA 4S17A 1L6UA 4ZYSA 4NZLB 3RI7C 2BYTA 2GRIA 1FNVA 2W82A 1ENFA 2XN9C 2PVGC 1V5TA 3DHGC 1SE4A 5LXIB 1WGKA 3KYCD 3VVWB 4FJVB 5G55A 2WXJA 2BKFA 1DOYA 2ZW1A 4DDID 5BYSA 1RLFA 3JYUA 3TEYA 2KTFA 3DDCB 4W9FA 3FILB 4C00A 1NEKB 3NVYA 2KXJA 1D5XC 2LEKA 4E74A 2Z59B 5H92C 1SSNA 1N62A 1X1MA 4ITKA 5FKAC 4WJOA 3W1SC 4PK1A 2Y3AA 1K8RB 2N1VA 2HTHA 1XO3A 4KKIA 2MJ3A 1TKGA 1V80A 1ACCA 4EOYA 1J19A 3GB1A 4JPSA 3V6CB 5C2TB 1NENB 1KLVA 2N1WA 4YTNB 1HEZE 4ANWA 1HZ5A 4NJ6A 1KH0A 5CTRC 3A4RA 4DHZB 1M94A 3RNFC 1AN8A 1XXGA 2MJEA 2INCC 4F7ZA 4JL9A 3Q8AA 1HTQA 4A3OA 3PTFC 4ZYNA 2NTTA 3ZNGC 2KTRB 2RR9A 1NYRA 4IWPA 3PZDA 2QIEB 3IAS1 4ANXA 2CJOA 2KACA 1UNSA 1CJEA 2JSVX 1WY8A 2WXGA 2MLBA 1V8CA 2MSED 1TS5A 3X23A 2CKHB 1MHXA 3URYA 1XF5L 4HPPA 2L8JA 2MJDA 3Q3FA 1WXMA 3APDA 2MBEA 2V3PA 1PQSA 1D3ZA 2EMTA 4FJZA 3L08A 2JZ3B 2MBOA 1EO6A 1STEA 3UF8A 5AUKA 2LXAA 4W9EA 2PW9A 3GS2A 5IN7A 1AARA 2KWCA 1S3SG 1WZ3A 3PT2B 2NVUI 4A6QA 1N5WA 3GP7A 3ZRCA 3PHXB 5JXVA 2LUMA 3PREA 3WAOA 1SJED 2WXRA 1G6JA 2C7NB 1A70A 5D3DA 4FJYA 5HHDG 1V86A 1SIJA 1VCBA 4ARCA 2J52A 2GBRA 4X57B 3PRMB 2Y5PA 4FLHA 4EZJA 2J4XA 1EU3A 4HWIB 2ZJDA 2I1KA 4C56C 1WYWB 3KYDD 3C8YA 2L0TA 4I6LB 2KDMA 3HM6X 2IGGA 2W9NA 1WJ6A 3RN9C 1PGAA 4L2YA 4HDQA 5G5HA 3VUXA 4ANVA 3JVZX 4LTUA 2LI5A 1XLOA 4RNAA 4ACFA 4URKA 2IDYA 3AEDB 1WR1A 2KTRA 2LZ6A 2OEDA 2PIAA 2KZRA 3V3XA 3DCGA 4M8MA 4YSXB 5AZHA 1E10A 5E6JA 1FCLA 1P7EA 2GLSA 2JU6X 2WDVB 4YXDB 1CQVA 3QHTA 2RD0A 4JWUC 2DWQA 4ZRPA 4NNJB 3IT6B 3NVWA 3TMPB 1N5XA 4DXFA 4TQ0A 4W9HA 1MG8A 2R61A 4EZKA 4HKQA 2GMIC 3OAWA 3Q6BA 2JRHA 3L17A 2MBQA 5FK9C 1NDDA 4ZRKA 5L83A 2KHWB 2NR2A 2KLGA 2LGDA 5HG2A 3PZ7A 2K6DB 2GB1A 4GOCA 3DBLB 1F1HA 4KZ0A 4MJSB 1RFKA 4A20A 2ON8A 3W1SA 3KQ4A 1SIFA 1L7YA 2WYQA 1AYFA 2D2QA 3RD2A 5EE1A 2MA9B 1TYGB 4GGQA 1TS2A 2BF8B 3VRBB 5EE9A 1T0QC 3NVVA 2JXXA 3N9YC 4OVVA 3OG5A 2K39A 3U52E 1WYGA 2NBWB 1R4NI 4K1RB 5H8YE 3EGRA 2C5LC 1LO5D 4P1BC 3Q8BA 1P98A 1WF9A 2IO2B 3WANA 4TKNA 1TY2A 1SJHD 3LJ3A 4GN1A 2JT4B 3QIJA 2JQRB 1WM3A 3AE8B 3C19A 1WE7A 4WWPA 4DQOC 4OZCA 2D07B 1WGRA 3RFZB 2ASQA 4II2B 1V2YA 4E71A 2HD5B 2K25A 1JW9D 2KDIA 3ETRA 1BT0A 2W3SA 3B0AA 4M0WB 1SGHA 3AU5A 1J8CA 2D5GA 2QDFA 1F9JA 4EKUA 5E6OA 1TZ1A 2ZNVC 2LHEA 4YWGG 3K9PB 4ICUA 2V0GA 2XK5B 3AB5A 4YTPB 5GMVA 3OWEB 4MGIE 1XLQA 1C78A 3AV8A 2WU2B 3PLUA 3L54A 3V61A 5J2RA 5JH5C 3I3TB 4XWWA 3GOEA 2HE7A 2WXIA 1KF6B 1ZGUB 4MJSA 3FC4A 1JWSD 3N30A 2LFIA 1P3QU 2WXMA 3GZNB 2KMCA 2B76B 4ZHPA 1I4XA 2WDRB 5IP4D 4C4VB 1A5RA 3Q3MC 4DDGD 1FFVA 3V60A 2RSUA 3AE6B 1IUEA 2IY1B 1NVID 3PO0A 4W9JA 1WFYA 1JRUA 3E56A 4M00A 4IM2A 3KW5B 2YVCA 1ZPSA 2KFJA 3CMMB 4JGHB 2L7RA 3BY4B 1F52A 1KJTA 1EF5A 3ECIA 3M62B 2ZEQA 4H2AA 4FN2A 2VH2A 1ZOYB 2BWFA 2PKOA 1BXTA 3VDZA 3PLVA 4LK0M 1T6BX 2JZZA 4I6NB 3Q8CA 1WR6E 3AE4B 4USAA 2D3AA 1NI2A 3RT3B 3N1XC 2V9HA 4GDLA 3PZ8A 1ISNA 3BZDB 3IBEA 4UDUC 1E7UA 2D11A 2MBBB 4KSKC 1FNWA 4LNIA 1C77A 2QHOA 4XDDA 2E3TA 3ZIMA 4MSQB 1D5MC 3LYYA 1KOTA 1KRHA 4WJNA 4P16A 4NQLB 2DAJA 3ZJVA 2O6VD 2DBYA 1VLBA 2WXQA 2WXNA 4XDCA 1XLNA 3ZNZB 2LRWA 5C23A 4OVUA 1PYWD 4PS8A 5HKHA 3DVNU 2Y5BB 4HK2A 4RM8A 2CS4A 1VDVA 2KK8A 2Q5WD 2O2VA 2CU1A 1HE8A 3VUWA 4N58A 4XWTA 1YX5B 4PYZA 1V9JA 2N9PC 3I9V1 2RPQA 2WXHA 1YQ3B 4MM3B 1JQ4A 1GC6A 5TR5A 3RCZA 3HVDA 5DPWA 2CU3A 2D3GA 1WSPA 2BW2A 3AEGB 1FMAD 2B3AA 5I4DA 3P42A 1ZP0B 1WGDA 4NPNA 4K81A 1R4MB 1ZW7A 1QOAA 1LXDA 3IXSA 4K7SA 3P63A 3NHEB 1PGBA 3Q14C 3EFUA 1OFFA 3QARA 3R7RA 2IGDA 3LXFA 1WX7A 2J42A 4PYUA 3H6NA 3VRAB 4CHKA 3RNGC 2AQ2B 2IZVB 2M17A 3HHMA 1ET9A 3ALBA 2LD9A 4BKSA 1RAXA 1WI0A 1IBXB 3QJZA 1L0VB 3P4SB 1J7CA 1FXIA 1MVKA 5BYRA 2IBIB 4XZ4A 2BS3B 4NQKE 1OQYA 1QOFA 2FAZA 4N6EB 3U7DA 1FXAA 2JYTA 3M63B 4KIKB 1FNUA 4IW0A 1V6EA 1L4DB 1SBBB 1GB4A 3P4QB 2DAFA 1E9MA 2Z8LA 4B0EA 4WIPA 2DZIA 4MEMA 4HPLB 3CIRB 3CWIA 2KJHB 4IM3A 4AOFA 4AJYB 2K5PA 2K22A 3QA8A 3NRZA 2XBBC 1S1QB 1D6EC 2AEHA 1V1OA 1XQQA 4DXAB 1MHHE 2KQ4X 3D32A 2FE8A 4KVGB 3SHQA 3Q3JA 3P4RB 2VH1A 1VR9A 1L6VA 3ZNHB 2JYEA 3J9CA 3PPAA 4LNNA 1YIWA 1WXVA 1WMHA 4AS1A 2JXTA 5JHBA 2WQYB 2LMCA 2X8XX 4AUQC 3W5VB 4FADA 1YMHE 3QAQA 1UF0A 4KKJA 5EE0A 3UQAA 5HFYA 1UZXB 4MELA 4JE3B 2N9KA 3APCA 4MGYE 2N7DA 2X38A 2A5UA 4W9LA 4AJWA 2MP2B 1YNTE 3TL5A 1I4QA 4D2KA 3SEBA 4QAYA 2UYZB 1TS3A 3R8BA 2ONQA 2IO3B 2KN5A 2LRUA 3DVGY 1E6EB 2FNJB 4KDIC 4REZA 4OZAA 3AE9B 4GLSC 1C3TA 4GIVA 2MW5A 3AULA 1Y8RC 1ZUD2 2GBJA 1GPXA 4K3CA 2EKEC 2EELA 3TEXA 1GTEA 4BKGA 1FXTB 2NBUA 2IYDB 2RDBC 5EDSA 3TJPA 3VR8B 3AE2B 2LJIA 5LLIA 2BQQA 2M0AA 1WIAA 1KFYB 3A9KB 3KH0A 2M1MA 4DBGA 2KMMA 5AZGA 2WXPA 1UD7A 2A4ZA 1D4BA 2JY6A 2BS4B 3ZNID 4ASWC 1V81A 3MHZA 3TEZA 1FM0D 2JUOA 2LJ5A 1VJKA 2KDEB 2JVCA 4WWMA 2MH7A 1WJNA 1C76A 4NAMA 3MTNB 3U7ZA 3PGEA 1GOZA 5C1ZA 4MT5A 3O13A 1R7SA 2J0MA 3EA6A 3HIZA 3DVGX 3AN1A 1GT8A 4BBNC 3ZO5B 2KO3A 2ICIA 1I4PA 4HJKA 2BKRB 5FR6A 1HQRD 1WRDB 2WWZA 1Q1OA 2ACZB 1YJIA 3DBHB 4WWNA 2WU5B 3ZDMC 2LGSA 2I1JA 4B95A 3H9DA 1GG3A 4LNFA 2RDHA 4M01A 4TUUA 2QILA 4WAAA 4II3B 1EU4A 3U30A 2AL6A 2RGFA 3WAMA 5AZFA 3A1QA 4AP4C 2QJLA 5C3JB 1E8ZA 3V05A 1ET6A 1P0RA 4JQWC 4GB9A 2C9WB 2QC8A 1WZ0A 3SR6A 2K8HA 4KX6B 3EFCA 4S0RA 4HKZE 3X0WA 3N1ZC 2N7EA 3AECB 1E5WA 3IAM1 1T0SC 2LGIA 2V4LA 5EE3A 3SD5A 2N0SB 4OHJA 3RZFA 3RNEC 4F1SA 5IA7A 4YSZB 4XYCA 2KC1A 3CSTA 2AL3A 1WX8A 2LVOA 1FRRA 1C79A 1E0ZA 3MC9A 3RNAC 4NY0A 5D2MB 4OW0A 4IUMB 3AE3B 3SFEB 2I38A 2W55A 2I2YA 4LNOA 2G4SA 3NZ3A 4LJPB 3L16A 2WDQB 5IAAC 1P1AA 2K0PA 2JF5A 3PVLA 3ZW3A 2DLBA 4KIKA 3V6EB 2YLMA 3N32A 3JSVB 3DPDA 3AMZA 1EUVB 3DBLI 1N63A 2WXLA 2AWTA 3JSVA 3L4PA 2NS5A 4YTMB 3W5UB 1EWCA 1J7BA 4A8XC 2E6XA 2K3UA 1XT9B 2D3CA 4MGZE 1E90A 2KNBA 4B9KA 1MJDA 2FUHB 3AEBB 3KWLA 4NJCA 2G9HD 3R66C 4WQOB 5DPRA 4HXDA 1RRBA 2L00B 3ZDTA 2N7JA 3BYYB 1FIQA 3QQ8B 3VAWA 3IT4B 3OLMD 5DCNA 3Q3OC 4YL8A 2SEBD 1TZOA 3AEEB 1L4ZB 1GC7A 5D6JB 4W9CA 2GBKA 1DYQA 1HA5A 4EE2A 2GBMA 4RGTA 4TSSA 2BYVE 4DK5A 2J0KA 3DHIC 2HTME 2PMVA 1Q10A 4G50A 4C4VA 4CYEA 4ZHOA 1UH6A 2QEJC 4WAFA 2M8SA 1JMLA 1KLGD 3CF6E 3NY5A 4MM3A 2PE9A 1WXSA 4F8CB 1LGRA 4RM9A 1YD8U 3RUIB 4GMVA 3R3MA 1ROEA 4IKGA 4GXBA 2MEKA 1VD2A 2N9EB 3H7SA 5BO4B 3PV1A 3KUZA 1FRDA 1IP9A 1E8XA 1YQ4B 2EMSA 2V1YA 1UGJA 4HROA 2CHXA 2KYWA 2DENB 1QQRA 3IG3A 3ZGZA 3ZVVA 3AEAB 1EM7A 2LVQA 2WXKA 2LASA 2WLBA 2NCNA 3N20C 4PS3A 2PTLA 1NBFC 2KWVB 3RPFC 3EUB2 3DOWA 2K8BA 2EKIA 5G2NA 4RGNA 2DZJA 4W9GA 3S2AA 2PE6B 4M8NA 2OOBB 1QF6A 3B9JA 2NMQA 2W54A 1JROA 1F2RI 1GB1A 1B1ZA 2MQJA 2G4DB 2KLCA 1JRPA 2ZPNA 3KUDB 3UI3A 3V62A 4B6WA 4CQNA 3DVNV 3H7PA 3N3KB 5D3IB 1FCCC 4WH4A 3QX1A 3ZUNA 4JX1C 2DZKA 3EECA 1OQRA 1YX6B 5IOIA 1DOIA 2KFKB 1UUPA 4IOIE 4BKTA 4J3OD 2M4NA 2KWUB 5CHVC 1EF1A 5G5GA 1MI0A 4ZRIA 4W9KA 5CHWA 4RGMA 3LDZE 1D5ZC 4NAWB 3UINB 5E6PA 1RWSA 4HLEA 3AH7A 1QZEA 5J17A 4TV3A 1UBIA 4O1NA 2OJRA 3KWVA 4AWJA 4EFOA 3SFDB 2FCNA 3HK0A 3ZQ4A 4HJGE 2PJHA 5E6NA 3BK2A 1IGCA 3BVZA 1B9RA 4HVBA 4WURA 2KVRA 2NBVB 1OGWA 3MC8A 4BFRA 4ZRQA 2IGHA 4BKSD 2CR5A 2CJNA 4K7WA 1GTHA 5CX3A 3AXCA 4BVUC 3CSFA 1FD6A 1Z5SB 1SF0A 1SEBD 4IG7B 3H7PB 5AUIA 1Q0WB 3AE5B 1L0XB 3PS6A 4N9F4 1ZXIA 3VH4B 1TY0A 1NI3A 4PT5A 1SXTA 1N60A 2INDC 4E3CA 3LB8C 2ZNVB 4ZOHC 3ZXRA 3RMKC 3VH3B 3ZYYX 1PGXA 1TT5B 2FCQA 2KMAA 2IY0B 4MGKE 4YSYB 2WXFA 2ZCBA 2LUEA 1IPGA 3UIOB 3Q2AC 2FUG1 4HDOA 4Q2JA 1K51A 1QOGA 1XEEA 1VZ7A 1TKYA 3R2IA 3ZKJC 4FBJB 1Y56A 3TSSA 1V97A 3VUYA 1AW7A 2UWQA 1PDXA 1LFDA 4A90A 4IDIA 2JRIB 1KM7A 1T5XD 5BMHA 3K9OB 2CHZA 1YOVB 4GU2A 4ARIA 1U4AA 2M56B 5MPOA 2DNFA 3L10B 4C80A 4JWSC 1KLUD 4P6VF 3ZRFA 2DHZA 4YT0B 2MWSB 3GZNI 2BBCA 3TEWA 1SB3C 2JX5A 4LDTB 3NOBA 2R2OA 1XLPA 2M19A 4W9DA 2HJ8A 3AI5A 3VTUA 4KDLB 3BVGA 4I6PA 1IYFA 3A4SC 3R2TA 5BYQA 2R2QA 1WGYA 2C60A 4KGRA 2O6VA 3QC8B 3R7QA 5D94A 1JWUD 1VZ8A 3QCAA 1EWYC 4LCDE 2MCNB 2WHIA 2LHDA 1OTRB 1H7XA 3JW0X 5DPTA 1RFAA 3ZTCA 4US9A 2MRPA 2SAKA 2TSSA 1AWDA 4JIOU 2KJRA 3VTWA 3L13A 1R4NB 3DWGC 2KWDA 3DHHC 2KOXA 1LM8B 1UBQA 3I57A 1Z2MA 4XC2A 4OVZA 3FILA 3QK0A 2GI9A 5D7GA 1TTNA 2HJ1A 3FKYA 3AEFB 1E7PB 1C9FA 1K52A 2BTEA 1TJEA 2JZPA 4IC7B 4L23A 2MP2A 3VTVA 4RF0A 1SE2A 3UQBA 1E8YA 5TSSA 1IGDA 2LWPA 4BAXA 1HTOA 4CO7A 1DOXA 2L3ZA 2G45B 3W9CB 1HZ6A 3NS1A 2W3RA 1ZXHA 4J6IA 3VFKA 2N4FA 1T0YA 1VZ6A 4EEWA 1TBEA 1UGMA 2N9LA 1FFUA 4BOSC 2RPVA 2UU7A 3TUOA 4IWOA 4DWFA 2ZZPB 3RZWC 3KUCB 2BYEA 2NPTB 2BB5A 2GBNA 3B2FA 2ZVOA 2L32A 3BWUD 3HUIA 5LNK1 2WS3B 3VXWA 1L5PA 1I35A 4HCNB 2L83A 4DHJB 2BWES 3DBHI 3H8HA 3IHPC 1C1YB 2ZW0A 2YEPF 2PEAA 2J0JA 2XEWA 2KVZA 3B08A 4HPMB 4IM0A 2PVOD 4G11A 1WRIA 4MACA 4GDLB 1QT9A 3A9KA 3U2SC 1XD3B 1RM6C 1GUAB 1TGZB 2QSDA 1P7FA 4B0MA 5DPSA 1C4CA 1FPYA 4G0NB 1K50A 4P1CC 4XGAB 2JWUA 1UWXA 2L76A 1KTKA 3MP9A 3IVFA 2J53A 4KZCA 3T3NA 1J0GA 4MH8A 2VZKB 1L0YB 2AQ1B 1WJUA 3O65B 1YJ1A 1QKZA 4NAWA 2H88B 4L1BA 3ZTDA 1V1PB 4FA6A 1XCTL 2WXOA 1QILA 3AE7B 2C7HA 3OJ4B 1GJZA 1H4RA 1T3QA 3VR9B 3BK1A 2KKCA 4ANUA 4HCPB 4C7ZA 3UIPB 3MFGA 1JCKB 3ABVB 2ZPYA 4AQ7A 1UWMA 3APFA 2ZCCA 1MG4A 2DYOA 5IKCM 3Q8FA 1I4HA 2O6VB 3HRDD 1WMHB 2KDBA 1CMXB 3Q8EA 1GAQB 1HXYD 5JZEB 2BGFA 1RYJA 2K9XA 3QWZB 3W2DA 2INNE 2WDTB 2O2VB 2Y5CA 3M3JA 3MJWA 2GOWA 1TIFA 2KQ7A 3AU4A 4WJPA 3EC8A 3MHSD 1DGJA 4LLGM 2WX0A 3BVMA 3EHVA 5KHQA 2FIDA 2KX3A 3VQIA 3ONSA 2WGSA 3HM3A 1QOBA 4LJOB 3RNBC 2CHWA 3DWMA 2M0XA 2PLPA 3RNCC 3AE1B 3CF4A 5J18A 2DX5B 2G1EA 3PHWB 3HVZA 1I7HA 4KSLC 4RMAA 1T0RC 2IPKD 1LQBA 4EUTA 3A33B 3B2GA 5BMGA 2WX1A 1OEYJ 3I63C 4FHKA 2L1AA 3WALA 3ZXVA 1IBXA 3NZUA 2MHJA 2FIFA 1CK1A 4GDKB 5AEKB 3BIID 1NYQA 2D10A 3ZLZA 2HDEA 1QLBB 2LGYA 4ZRJA 2LGXA 2WP9B 2YEPB 4FXCA 1YN4A 1TKEA 1WWTA 2WNMA 3BINA 3B1LX 3U8ZA 2KN4A 4WJQA 3TCAA 1PUTA 2BVCA 3GE3C 2AYOB 1ZDXA 4ICVA 4MSMB 3NUHB 2REXA 4RH6A 1MFWA 1Q5WB 4NJ7A 3A9JA 3BYTB 4LDTD 3IFWB 3A9JB 2JWZA 2N9XA 3TIXA 1WH3A 3ZJTA 2KJ6A 5HI1A 3Q3NC 1JWAD 1N6ZA 4XE0A 2DZMA 1GNUA 2AQ3B 1V5OA 3PSEB 2XNAC 2KDFB 2L05A 1YN3A 2DYMA 3TBLD 4PS7A 4RF1A 3NZSA 4N59A 4A3PA 2Z0DB 2QCZA 2NTSA 4C7YA 4BBNF 3T3OA 3DBSA 3PRZA 3H1UA 4LNKA 1M4VA 3I5JC 1F2RC 4JLCA 4TMAB 2LVPA 5LXHA 2KFKA 2BS2B 1I4GA 1E8WA 1F0ZA 4KV2A 1VRAB 1BUIC 1H7WA 2RDGA 3ENEA 4HEA1 3WIMA 3WA0A 4BOZB 1JWMD 2L0FA 4FHJA 2KC2A 2BPSA 1TS4A 1JWBD 4A9AA 2ZVNA 1F77A 3ML9A
chains in the Genus database with same CATH topology
4Q2JA 1K51A 1QOGA 1E6EB 1XEEA 1VZ7A 1TKYA 3R2IA 1Y56A 5FK9C 1V97A 2KAJA 3TSSA 3P1MA 4REZA 4OZAA 1AW7A 3AE9B 4GLSC 1YJJA 1PDXA 3P4PB 4A90A 4IDIA 5GXGB 1T5XD 5BMHA 1I4RA 5HG2A 3WCQA 1PFDA 1ZUD2 1GPXA 3PZ7A 4ARIA 2GB1A 3NVZA 2M56B 2EELA 1RFKA 3TEXA 5MPOA 1GTEA 2ON8A 5T8IA 3W1SA 4A55A 3Q69A 3KQ4A 4C80A 4JWSC 1KLUD 1JALA 1ZE3D 4RFBA 4P6VF 3ZJUA 3VR8B 2OHFA 4YT0B 3AE2B 1AYFA 2LJIA 5EE1A 2BBCA 1TYGB 1SB3C 2JX5A 3TEWA 1TS2A 4RCOA 3MJ5A 2M0AA 3VRBB 5EE9A 1KFYB 1J7AA 3NVVA 1XLPA 2RMMA 2M19A 2KMMA 3N9YC 1BMLC 2WXPA 4HRSA 1D4BA 3U52E 2BS4B 1WYGA 1FO4A 2INPE 3BVGA 1OQQA 3R2TA 1MPEA 5BYQA 5H8YE 1XCQL 3EGRA 1N61A 2BT6A 4KGRA 1LO5D 2AX5A 3MHZA 3Q8BA 4KGTA 3TEZA 1FM0D 1TY2A 1SJHD 1JWUD 1VZ8A 1VJKA 1EWYC 2FBWB 2JQRB 4WWMA 3AE8B 2LHDA 2MH7A 1H7XA 2IJ0A 4OZBA 1C4PA 2VZKD 1C76A 4US9A 4DQOC 4OZCA 2SAKA 2TSSA 1AWDA 1CZPA 3E9SA 4NAMA 3RFZB 3U7ZA 2V3NA 2BB6A 1GOZA 1K53A 4MT5A 3O13A 1R7SA 1JW9D 3DWGC 3EA6A 2KWDA 3ETRA 3AN1A 1GT8A 1C4AA 2W3SA 3I57A 2ICIA 1I4PA 4OVZA 3FILA 1HQRD 2D5GA 2GI9A 5D7GA 4TQ1A 2ACZB 1YJIA 4WQMA 2WU5B 2LHEA 3AEFB 1E7PB 4YWGG 2RDHA 1C9FA 2V0GA 3AB5A 4YTPB 1K52A 2QMTA 2BTEA 1TJEA 2JZPA 1FEHA 3OWEB 4L23A 1ESFA 1XLQA 2QILA 1C78A 3AV8A 4RF0A 1SE2A 1EU4A 2WU2B 1SE3A 5TSSA 1IGDA 4XWWA 1YN5A 1DOXA 5BMIA 4R3DA 2WXIA 3W9CB 1HZ6A 1KF6B 4M0WA 3NS1A 2W3RA 1ZXHA 3FC4A 1JWSD 2LFIA 2QJLA 5C3JB 1VZ6A 2WXMA 4RGOS 3V05A 1ET6A 3KLSX 4DXGA 2B76B 2N9LA 1ZDVA 1FFUA 4ZHPA 3SR6A 1I4XA 2RPVA 4KX6B 2WDRB 3TUOA 4HKZE 3AECB 1FFVA 3IAM1 3AM9A 2LGIA 3AE6B 1IUEA 2BB5A 5EE3A 3B2FA 1NVID 2N0SB 2V4IB 3PO0A 4OHJA 4KGSA 3U4EG 2L32A 3E56A 4YSZB 3BWUD 3HUIA 5LNK1 2WS3B 1ZPSA 1FRRA 1L5PA 1C79A 1E0ZA 3MC0B 1V1PA 5FR3A 3FAHA 2L83A 1WXQA 2H89B 3H8HA 2L52A 2ZW0A 2YEPF 4OW0A 3AE3B 3SFEB 2I38A 2W55A 2I2YA 4H2AA 3NZ3A 2WDQB 2K0PA 1ZOYB 1L6UA 2PKOA 4ZYSA 4NZLB 2PVOD 2DLBA 2BYTA 2GRIA 1BXTA 1FNVA 2W82A 1ENFA 1WRIA 2XN9C 2PVGC 4GDLB 4MACA 1QT9A 3U2SC 1SE4A 4LK0M 1T6BX 3Q8CA 3AMZA 3AE4B 4USAA 1RM6C 1WGKA 2QSDA 1N63A 1P7FA 2WXLA 4B0MA 3L4PA 1C4CA 2WXJA 3PZ8A 1K50A 3BZDB 1DOYA 4YTMB 2ZW1A 5BYSA 3W5UB 1EWCA 1J7BA 4UDUC 4A8XC 2E6XA 2JWUA 2K3UA 1FNWA 1UWXA 1KTKA 3TEYA 3MP9A 2J53A 3FILB 1C77A 4XDDA 3T3NA 1NEKB 3NVYA 2E3TA 3AEBB 1D5XC 2LEKA 3KWLA 4NJCA 2G9HD 1D5MC 4MH8A 2VZKB 3LYYA 5H92C 1SSNA 1KRHA 1N62A 4ITKA 4P16A 5FKAC 1L0YB 2AQ1B 3ZJVA 2Y3AA 2N7JA 3BYYB 1FIQA 2DBYA 1VLBA 1QKZA 3IT4B 2WXQA 2WXNA 2H88B 1XO3A 4XDCA 4KKIA 2MJ3A 1XLNA 4L1BA 1TKGA 1V1PB 2SEBD 1ACCA 1TZOA 3AEEB 1L4ZB 1XCTL 2WXOA 1QILA 1DYQA 3GB1A 3AE7B 1PYWD 1HA5A 4JPSA 4EE2A 4RGTA 5C2TB 1NENB 4TSSA 1T3QA 3VR9B 3BK1A 4YTNB 1VDVA 2Q5WD 1HEZE 4C7ZA 3MFGA 1HZ5A 2HTME 2PMVA 1JCKB 1Q10A 3ABVB 1KH0A 4AQ7A 1UWMA 4N58A 4XWTA 2DYOA 4ZHOA 2QEJC 4WAFA 3Q8FA 1I4HA 1AN8A 1XXGA 1JMLA 2MJEA 1KLGD 3I9V1 3HRDD 3Q8AA 2WXHA 2NTTA 1YQ3B 4MM3B 1JQ4A 1NYRA 3Q8EA 1GAQB 1HXYD 2QIEB 1RYJA 2K9XA 3HVDA 3W2DA 1ROEA 3IAS1 2CJOA 2CU3A 2KACA 2INNE 4IKGA 2Y5CA 1UNSA 2MEKA 1CJEA 1WSPA 2BW2A 2JSVX 3AEGB 2WXGA 1FMAD 1V8CA 1TS5A 1FRDA 1DGJA 4LLGM 1MHXA 3BVMA 3URYA 1XF5L 1YQ4B 2MJDA 5I4DA 1UGJA 4HROA 3P42A 3VQIA 1ZP0B 2V3PA 1QQRA 3ZGZA 1QOBA 3AEAB 1QOAA 1EM7A 3DWMA 3IXSA 2WXKA 2WLBA 3P63A 2PLPA 2PTLA 1PGBA 3AE1B 3CF4A 1OFFA 3RPFC 1STEA 2G1EA 2IGDA 3EUB2 3LXFA 5AUKA 2J42A 3HVZA 2PW9A 1I7HA 2EKIA 3GS2A 4RGNA 3VRAB 2IPKD 3B2GA 2AQ2B 1QF6A 3B9JA 5BMGA 2NMQA 2W54A 4A6QA 1ET9A 1JROA 1N5WA 1F2RI 1GB1A 2L1AA 3GP7A 5JXVA 1B1ZA 2LUMA 1IBXB 1IBXA 1JRPA 1L0VB 1CK1A 3UI3A 4GDKB 3P4SB 1SJED 2WXRA 3BIID 1J7CA 1NYQA 5D3IB 1FXIA 1MVKA 4CQNA 1FCCC 5BYRA 4WH4A 1A70A 5D3DA 2HDEA 1QLBB 4JX1C 5HHDG 2BS3B 1OQRA 1SIJA 1DOIA 1UUPA 4ARCA 2WP9B 2J52A 2YEPB 4FXCA 1YN4A 1QOFA 4IOIE 4N6EB 1FXAA 1TKEA 2JYTA 4J3OD 2Y5PA 1FNUA 1WWTA 2WNMA 1L4DB 1SBBB 2J4XA 1EU3A 1GB4A 3P4QB 2KN4A 5G5GA 1MI0A 1E9MA 1PUTA 2Z8LA 4B0EA 4WIPA 4C56C 4RGMA 1ZDXA 3C8YA 3NUHB 3CIRB 1D5ZC 3CWIA 4RH6A 4NAWB 2KDMA 2IGGA 2K5PA 3BYTB 1RWSA 2K22A 3AH7A 1PGAA 4L2YA 3NRZA 5G5HA 4O1NA 3KWVA 1D6EC 1V1OA 3ZJTA 5HI1A 3SFDB 1JWAD 1MHHE 4XE0A 2KQ4X 3ZQ4A 4HJGE 2FE8A 4LTUA 4RNAA 1XLOA 2AQ3B 3P4RB 2IDYA 2XNAC 3BK2A 1IGCA 3BVZA 1YN3A 3AEDB 2DYMA 1B9RA 4WURA 1VR9A 1L6VA 2JYEA 3J9CA 4RF1A 4ZRQA 4N59A 2IGHA 2CJNA 2NTSA 2OEDA 2PIAA 2JXTA 4C7YA 4AS1A 1GTHA 3T3OA 1FD6A 2WQYB 3V3XA 2LMCA 1M4VA 1SF0A 1F2RC 4YSXB 1SEBD 1E10A 4TMAB 5AUIA 5E6JA 3W5VB 1FCLA 1YMHE 3AE5B 1L0XB 1P7EA 1ZXIA 2BS2B 1I4GA 4KKJA 5EE0A 1TY0A 1NI3A 2JU6X 4PT5A 2WDVB 1SXTA 5HFYA 1F0ZA 4YXDB 1N60A 4JE3B 3LB8C 2N9KA 1VRAB 1CQVA 1BUIC 1H7WA 2RDGA 4JWUC 2DWQA 4ZOHC 2X38A 4HEA1 4ZRPA 1YNTE 3ZYYX 1PGXA 3IT6B 1JWMD 3NVWA 1I4QA 4YSYB 1N5XA 4D2KA 2WXFA 4DXFA 3SEBA 1TS4A 1TS3A 4TQ0A 3R8BA 1JWBD 4A9AA 2ONQA 2R61A 4HKQA 1F77A 2FUG1 4US8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AV8 A;  1QOG A;  1E6E B;  2H88 B;  3P4S B;  2WU2 B;  1XO3 A;  1TKY A;  1J7C A;  1NYQ A;  1XLN A;  1FXI A;  2MJ3 A;  3BII D;  1TKG A;  1V97 A;  2KAJ A;  3AEE B;  1A70 A;  3P1M A;  1DOX A;  1QLB B;  3AE9 B;  4JX1 C;  1YJJ A;  1PDX A;  3W9C B;  3P4P B;  1KF6 B;  2BS3 B;  1OQR A;  1SIJ A;  2W3R A;  3NS1 A;  3AE7 B;  1DOI A;  4IDI A;  5GXG B;  1PFD A;  1ZUD 2;  3WCQ A;  2WP9 B;  3FC4 A;  1GPX A;  2QJL A;  4FXC A;  5C3J B;  1QOF A;  4N6E B;  1FXA A;  1TKE A;  3NVZ A;  2M56 B;  5C2T B;  1NEN B;  1WWT A;  1RFK A;  1T3Q A;  5MPO A;  1GTE A;  3VR9 B;  5EE9 A;  2B76 B;  4YTN B;  1VDV A;  4C80 A;  1FFU A;  4ZHP A;  3SR6 A;  3P4Q B;  2Q5W D;  5G5G A;  4JWS C;  1E9M A;  4KX6 B;  2WDR B;  1JAL A;  1PUT A;  4P6V F;  4C7Z A;  2HTM E;  3VR8 B;  3ABV B;  4YT0 B;  2OHF A;  3AE2 B;  1AYF A;  1UWM A;  3CIR B;  3CWI A;  3AEC B;  4N58 A;  1FFV A;  5EE1 A;  1TYG B;  1SB3 C;  2JX5 A;  4ZHO A;  3AM9 A;  3AE6 B;  1IUE A;  2K5P A;  3VRB B;  2MJE A;  1KFY B;  1RWS A;  1J7A A;  1NVI D;  2N0S B;  3B2F A;  2K22 A;  3AH7 A;  3NVV A;  3PO0 A;  1XLP A;  3HRD D;  3NRZ A;  2M19 A;  2KMM A;  1YQ3 B;  4YSZ B;  5G5H A;  1JQ4 A;  3HUI A;  4HRS A;  1NYR A;  2WS3 B;  1GAQ B;  3SFD B;  1FRR A;  1L5P A;  2QIE B;  2BS4 B;  1RYJ A;  1WYG A;  2K9X A;  1JWA D;  1E0Z A;  1FO4 A;  1ROE A;  2L83 A;  1WXQ A;  3FAH A;  2CJO A;  1OQQ A;  2CU3 A;  2H89 B;  2Y5C A;  4LTU A;  2L52 A;  1XLO A;  5H8Y E;  1CJE A;  1N61 A;  3P4R B;  3AE3 B;  3AEG B;  3SFE B;  2W55 A;  1B9R A;  3AED B;  2BT6 A;  1FMA D;  1L6V A;  1V8C A;  2WDQ B;  2AX5 A;  1FRD A;  1DGJ A;  4N59 A;  1FM0 D;  1ZOY B;  1L6U A;  2PKO A;  1YQ4 B;  2MJD A;  2PVO D;  2CJN A;  2PIA A;  4C7Y A;  1VJK A;  1EWY C;  1WRI A;  1GTH A;  2FBW B;  2PVG C;  2JQR B;  1QT9 A;  4HRO A;  4WWM A;  3AE8 B;  1ZP0 B;  2MH7 A;  1H7X A;  3AMZ A;  2WQY B;  3AE4 B;  4USA A;  4US9 A;  1RM6 C;  1WGK A;  1N63 A;  1QOB A;  1SF0 A;  1AWD A;  3AEA B;  4YSX B;  1CZP A;  1QOA A;  1E10 A;  3DWM A;  3L4P A;  5AUI A;  3W5V B;  3AE5 B;  2WLB A;  1DOY A;  4YTM B;  3P63 A;  1ZXI A;  3W5U B;  1J7B A;  1R7S A;  2BS2 B;  3AE1 B;  3CF4 A;  1JW9 D;  1OFF A;  3DWG C;  5EE0 A;  3ETR A;  3RPF C;  1NI3 A;  2G1E A;  3AN1 A;  1GT8 A;  2WDV B;  2W3S A;  3LXF A;  4YXD B;  1N60 A;  3EUB 2;  3LB8 C;  5AUK A;  1F0Z A;  1H7W A;  3HVZ A;  1I7H A;  2EKI A;  5EE3 A;  4JWU C;  2DWQ A;  4ZOH C;  1NEK B;  3NVY A;  2E3T A;  3VRA B;  3AEB B;  2ACZ B;  2LEK A;  3ZYY X;  1YJI A;  3KWL A;  4WQM A;  2WU5 B;  3B2G A;  5H92 C;  1QF6 A;  3B9J A;  3NVW A;  4YSY B;  2W54 A;  1N5X A;  1JRO A;  1KRH A;  1N5W A;  1N62 A;  4ITK A;  3AEF B;  1E7P B;  3AB5 A;  4YTP B;  1JRP A;  1JWB D;  1FIQ A;  4A9A A;  1TJE A;  1L0V B;  2DBY A;  1VLB A;  1XLQ A;  4US8 A; 
#chains in the Genus database with same CATH topology
 3M95 A;  2KAJ A;  3P1M A;  1WE6 A;  1YJJ A;  3P4P B;  5GXG B;  1I4R A;  3WCQ A;  1PFD A;  2MBH A;  2D3B A;  3NG0 A;  3NVZ A;  5T8I A;  4A55 A;  4EZL A;  3Q69 A;  2JPH A;  1JAL A;  1ZE3 D;  4RFB A;  2KAN A;  2MX2 A;  3ZJU A;  2J7Q B;  2OHF A;  1WX9 A;  2OJW A;  4RCO A;  3OJ3 A;  2V3S A;  3MJ5 A;  1J7A A;  2RMM A;  1BML C;  4HRS A;  4BZA A;  2PPH A;  4K7U A;  2Z0E B;  3A1Q B;  1FO4 A;  2INP E;  2LXC A;  3SDL C;  1OQQ A;  3UGB B;  1V49 A;  1MPE A;  4DHJ D;  1XCQ L;  1N61 A;  4US8 A;  4G3X B;  2BT6 A;  2AX5 A;  2KX0 A;  4KGT A;  3GE8 C;  4K3B A;  3DQV A;  4WWO A;  1I42 A;  2FBW B;  4W9I A;  2IJ0 A;  1WM2 A;  4OZB A;  1C4P A;  2BYF A;  2VZK D;  2DYB A;  4IWQ A;  4M02 A;  3KVF B;  4P7I A;  2K8C A;  2IO1 B;  2K6Q A;  1CZP A;  3E9S A;  1ZKH A;  2V3N A;  2BB6 A;  1K53 A;  2IO0 B;  1WXA A;  2KT7 A;  3L0W B;  3NS8 A;  1C4A A;  4FUL A;  3T8M A;  3PRP B;  3T9L A;  2G3Q B;  4TQ1 A;  2C7M B;  3P2B A;  4WQM A;  1WGG A;  2K1F A;  2XK5 A;  5CHF A;  3RUL A;  3WAP A;  2QMT A;  1UEL A;  1FEH A;  3N1Y C;  1ESF A;  3NJT A;  4MH0 E;  1SE9 A;  1SE3 A;  2FCS A;  5KHO A;  1YN5 A;  3C0R B;  5BMI A;  4R3D A;  3DBR I;  5IO9 A;  4M0W A;  1YQB A;  4RGO S;  3KLS X;  4DXG A;  3SU8 X;  1L2N A;  1ZDV A;  1OEY A;  4ZDV A;  2VRR B;  1P9D U;  3DBR B;  4GSW A;  1E7V A;  3VHT C;  3AM9 A;  4MDK E;  1H8C A;  2V4I B;  1R4M I;  4KGS A;  3U4E G;  2NPT A;  3ML8 A;  1WGH A;  5L95 C;  4DHZ E;  3MC0 B;  1V1P A;  5FR3 A;  3FAH A;  2FCM A;  1WXQ A;  4XX5 A;  2KQS A;  2H89 B;  2L52 A;  5JHA A;  1WJ4 A;  3RYT A;  2KD0 A;  3W1Y A;  4GDK A;  4S17 A;  1L6U A;  4ZYS A;  4NZL B;  3RI7 C;  2BYT A;  2GRI A;  1FNV A;  2W82 A;  1ENF A;  2XN9 C;  2PVG C;  1V5T A;  3DHG C;  1SE4 A;  5LXI B;  1WGK A;  3KYC D;  3VVW B;  4FJV B;  5G55 A;  2WXJ A;  2BKF A;  1DOY A;  2ZW1 A;  4DDI D;  5BYS A;  1RLF A;  3JYU A;  3TEY A;  2KTF A;  3DDC B;  4W9F A;  3FIL B;  4C00 A;  1NEK B;  3NVY A;  2KXJ A;  1D5X C;  2LEK A;  4E74 A;  2Z59 B;  5H92 C;  1SSN A;  1N62 A;  1X1M A;  4ITK A;  5FKA C;  4WJO A;  3W1S C;  4PK1 A;  2Y3A A;  1K8R B;  2N1V A;  2HTH A;  1XO3 A;  4KKI A;  2MJ3 A;  1TKG A;  1V80 A;  1ACC A;  4EOY A;  1J19 A;  3GB1 A;  4JPS A;  3V6C B;  5C2T B;  1NEN B;  1KLV A;  2N1W A;  4YTN B;  1HEZ E;  4ANW A;  1HZ5 A;  4NJ6 A;  1KH0 A;  5CTR C;  3A4R A;  4DHZ B;  1M94 A;  3RNF C;  1AN8 A;  1XXG A;  2MJE A;  2INC C;  4F7Z A;  4JL9 A;  3Q8A A;  1HTQ A;  4A3O A;  3PTF C;  4ZYN A;  2NTT A;  3ZNG C;  2KTR B;  2RR9 A;  1NYR A;  4IWP A;  3PZD A;  2QIE B;  3IAS 1;  4ANX A;  2CJO A;  2KAC A;  1UNS A;  1CJE A;  2JSV X;  1WY8 A;  2WXG A;  2MLB A;  1V8C A;  2MSE D;  1TS5 A;  3X23 A;  2CKH B;  1MHX A;  3URY A;  1XF5 L;  4HPP A;  2L8J A;  2MJD A;  3Q3F A;  1WXM A;  3APD A;  2MBE A;  2V3P A;  1PQS A;  1D3Z A;  2EMT A;  4FJZ A;  3L08 A;  2JZ3 B;  2MBO A;  1EO6 A;  1STE A;  3UF8 A;  5AUK A;  2LXA A;  4W9E A;  2PW9 A;  3GS2 A;  5IN7 A;  1AAR A;  2KWC A;  1S3S G;  1WZ3 A;  3PT2 B;  2NVU I;  4A6Q A;  1N5W A;  3GP7 A;  3ZRC A;  3PHX B;  5JXV A;  2LUM A;  3PRE A;  3WAO A;  1SJE D;  2WXR A;  1G6J A;  2C7N B;  1A70 A;  5D3D A;  4FJY A;  5HHD G;  1V86 A;  1SIJ A;  1VCB A;  4ARC A;  2J52 A;  2GBR A;  4X57 B;  3PRM B;  2Y5P A;  4FLH A;  4EZJ A;  2J4X A;  1EU3 A;  4HWI B;  2ZJD A;  2I1K A;  4C56 C;  1WYW B;  3KYD D;  3C8Y A;  2L0T A;  4I6L B;  2KDM A;  3HM6 X;  2IGG A;  2W9N A;  1WJ6 A;  3RN9 C;  1PGA A;  4L2Y A;  4HDQ A;  5G5H A;  3VUX A;  4ANV A;  3JVZ X;  4LTU A;  2LI5 A;  1XLO A;  4RNA A;  4ACF A;  4URK A;  2IDY A;  3AED B;  1WR1 A;  2KTR A;  2LZ6 A;  2OED A;  2PIA A;  2KZR A;  3V3X A;  3DCG A;  4M8M A;  4YSX B;  5AZH A;  1E10 A;  5E6J A;  1FCL A;  1P7E A;  2GLS A;  2JU6 X;  2WDV B;  4YXD B;  1CQV A;  3QHT A;  2RD0 A;  4JWU C;  2DWQ A;  4ZRP A;  4NNJ B;  3IT6 B;  3NVW A;  3TMP B;  1N5X A;  4DXF A;  4TQ0 A;  4W9H A;  1MG8 A;  2R61 A;  4EZK A;  4HKQ A;  2GMI C;  3OAW A;  3Q6B A;  2JRH A;  3L17 A;  2MBQ A;  5FK9 C;  1NDD A;  4ZRK A;  5L83 A;  2KHW B;  2NR2 A;  2KLG A;  2LGD A;  5HG2 A;  3PZ7 A;  2K6D B;  2GB1 A;  4GOC A;  3DBL B;  1F1H A;  4KZ0 A;  4MJS B;  1RFK A;  4A20 A;  2ON8 A;  3W1S A;  3KQ4 A;  1SIF A;  1L7Y A;  2WYQ A;  1AYF A;  2D2Q A;  3RD2 A;  5EE1 A;  2MA9 B;  1TYG B;  4GGQ A;  1TS2 A;  2BF8 B;  3VRB B;  5EE9 A;  1T0Q C;  3NVV A;  2JXX A;  3N9Y C;  4OVV A;  3OG5 A;  2K39 A;  3U52 E;  1WYG A;  2NBW B;  1R4N I;  4K1R B;  5H8Y E;  3EGR A;  2C5L C;  1LO5 D;  4P1B C;  3Q8B A;  1P98 A;  1WF9 A;  2IO2 B;  3WAN A;  4TKN A;  1TY2 A;  1SJH D;  3LJ3 A;  4GN1 A;  2JT4 B;  3QIJ A;  2JQR B;  1WM3 A;  3AE8 B;  3C19 A;  1WE7 A;  4WWP A;  4DQO C;  4OZC A;  2D07 B;  1WGR A;  3RFZ B;  2ASQ A;  4II2 B;  1V2Y A;  4E71 A;  2HD5 B;  2K25 A;  1JW9 D;  2KDI A;  3ETR A;  1BT0 A;  2W3S A;  3B0A A;  4M0W B;  1SGH A;  3AU5 A;  1J8C A;  2D5G A;  2QDF A;  1F9J A;  4EKU A;  5E6O A;  1TZ1 A;  2ZNV C;  2LHE A;  4YWG G;  3K9P B;  4ICU A;  2V0G A;  2XK5 B;  3AB5 A;  4YTP B;  5GMV A;  3OWE B;  4MGI E;  1XLQ A;  1C78 A;  3AV8 A;  2WU2 B;  3PLU A;  3L54 A;  3V61 A;  5J2R A;  5JH5 C;  3I3T B;  4XWW A;  3GOE A;  2HE7 A;  2WXI A;  1KF6 B;  1ZGU B;  4MJS A;  3FC4 A;  1JWS D;  3N30 A;  2LFI A;  1P3Q U;  2WXM A;  3GZN B;  2KMC A;  2B76 B;  4ZHP A;  1I4X A;  2WDR B;  5IP4 D;  4C4V B;  1A5R A;  3Q3M C;  4DDG D;  1FFV A;  3V60 A;  2RSU A;  3AE6 B;  1IUE A;  2IY1 B;  1NVI D;  3PO0 A;  4W9J A;  1WFY A;  1JRU A;  3E56 A;  4M00 A;  4IM2 A;  3KW5 B;  2YVC A;  1ZPS A;  2KFJ A;  3CMM B;  4JGH B;  2L7R A;  3BY4 B;  1F52 A;  1KJT A;  1EF5 A;  3ECI A;  3M62 B;  2ZEQ A;  4H2A A;  4FN2 A;  2VH2 A;  1ZOY B;  2BWF A;  2PKO A;  1BXT A;  3VDZ A;  3PLV A;  4LK0 M;  1T6B X;  2JZZ A;  4I6N B;  3Q8C A;  1WR6 E;  3AE4 B;  4USA A;  2D3A A;  1NI2 A;  3RT3 B;  3N1X C;  2V9H A;  4GDL A;  3PZ8 A;  1ISN A;  3BZD B;  3IBE A;  4UDU C;  1E7U A;  2D11 A;  2MBB B;  4KSK C;  1FNW A;  4LNI A;  1C77 A;  2QHO A;  4XDD A;  2E3T A;  3ZIM A;  4MSQ B;  1D5M C;  3LYY A;  1KOT A;  1KRH A;  4WJN A;  4P16 A;  4NQL B;  2DAJ A;  3ZJV A;  2O6V D;  2DBY A;  1VLB A;  2WXQ A;  2WXN A;  4XDC A;  1XLN A;  3ZNZ B;  2LRW A;  5C23 A;  4OVU A;  1PYW D;  4PS8 A;  5HKH A;  3DVN U;  2Y5B B;  4HK2 A;  4RM8 A;  2CS4 A;  1VDV A;  2KK8 A;  2Q5W D;  2O2V A;  2CU1 A;  1HE8 A;  3VUW A;  4N58 A;  4XWT A;  1YX5 B;  4PYZ A;  1V9J A;  2N9P C;  3I9V 1;  2RPQ A;  2WXH A;  1YQ3 B;  4MM3 B;  1JQ4 A;  1GC6 A;  5TR5 A;  3RCZ A;  3HVD A;  5DPW A;  2CU3 A;  2D3G A;  1WSP A;  2BW2 A;  3AEG B;  1FMA D;  2B3A A;  5I4D A;  3P42 A;  1ZP0 B;  1WGD A;  4NPN A;  4K81 A;  1R4M B;  1ZW7 A;  1QOA A;  1LXD A;  3IXS A;  4K7S A;  3P63 A;  3NHE B;  1PGB A;  3Q14 C;  3EFU A;  1OFF A;  3QAR A;  3R7R A;  2IGD A;  3LXF A;  1WX7 A;  2J42 A;  4PYU A;  3H6N A;  3VRA B;  4CHK A;  3RNG C;  2AQ2 B;  2IZV B;  2M17 A;  3HHM A;  1ET9 A;  3ALB A;  2LD9 A;  4BKS A;  1RAX A;  1WI0 A;  1IBX B;  3QJZ A;  1L0V B;  3P4S B;  1J7C A;  1FXI A;  1MVK A;  5BYR A;  2IBI B;  4XZ4 A;  2BS3 B;  4NQK E;  1OQY A;  1QOF A;  2FAZ A;  4N6E B;  3U7D A;  1FXA A;  2JYT A;  3M63 B;  4KIK B;  1FNU A;  4IW0 A;  1V6E A;  1L4D B;  1SBB B;  1GB4 A;  3P4Q B;  2DAF A;  1E9M A;  2Z8L A;  4B0E A;  4WIP A;  2DZI A;  4MEM A;  4HPL B;  3CIR B;  3CWI A;  2KJH B;  4IM3 A;  4AOF A;  4AJY B;  2K5P A;  2K22 A;  3QA8 A;  3NRZ A;  2XBB C;  1S1Q B;  1D6E C;  2AEH A;  1V1O A;  1XQQ A;  4DXA B;  1MHH E;  2KQ4 X;  3D32 A;  2FE8 A;  4KVG B;  3SHQ A;  3Q3J A;  3P4R B;  2VH1 A;  1VR9 A;  1L6V A;  3ZNH B;  2JYE A;  3J9C A;  3PPA A;  4LNN A;  1YIW A;  1WXV A;  1WMH A;  4AS1 A;  2JXT A;  5JHB A;  2WQY B;  2LMC A;  2X8X X;  4AUQ C;  3W5V B;  4FAD A;  1YMH E;  3QAQ A;  1UF0 A;  4KKJ A;  5EE0 A;  3UQA A;  5HFY A;  1UZX B;  4MEL A;  4JE3 B;  2N9K A;  3APC A;  4MGY E;  2N7D A;  2X38 A;  2A5U A;  4W9L A;  4AJW A;  2MP2 B;  1YNT E;  3TL5 A;  1I4Q A;  4D2K A;  3SEB A;  4QAY A;  2UYZ B;  1TS3 A;  3R8B A;  2ONQ A;  2IO3 B;  2KN5 A;  2LRU A;  3DVG Y;  1E6E B;  2FNJ B;  4KDI C;  4REZ A;  4OZA A;  3AE9 B;  4GLS C;  1C3T A;  4GIV A;  2MW5 A;  3AUL A;  1Y8R C;  1ZUD 2;  2GBJ A;  1GPX A;  4K3C A;  2EKE C;  2EEL A;  3TEX A;  1GTE A;  4BKG A;  1FXT B;  2NBU A;  2IYD B;  2RDB C;  5EDS A;  3TJP A;  3VR8 B;  3AE2 B;  2LJI A;  5LLI A;  2BQQ A;  2M0A A;  1WIA A;  1KFY B;  3A9K B;  3KH0 A;  2M1M A;  4DBG A;  2KMM A;  5AZG A;  2WXP A;  1UD7 A;  2A4Z A;  1D4B A;  2JY6 A;  2BS4 B;  3ZNI D;  4ASW C;  1V81 A;  3MHZ A;  3TEZ A;  1FM0 D;  2JUO A;  2LJ5 A;  1VJK A;  2KDE B;  2JVC A;  4WWM A;  2MH7 A;  1WJN A;  1C76 A;  4NAM A;  3MTN B;  3U7Z A;  3PGE A;  1GOZ A;  5C1Z A;  4MT5 A;  3O13 A;  1R7S A;  2J0M A;  3EA6 A;  3HIZ A;  3DVG X;  3AN1 A;  1GT8 A;  4BBN C;  3ZO5 B;  2KO3 A;  2ICI A;  1I4P A;  4HJK A;  2BKR B;  5FR6 A;  1HQR D;  1WRD B;  2WWZ A;  1Q1O A;  2ACZ B;  1YJI A;  3DBH B;  4WWN A;  2WU5 B;  3ZDM C;  2LGS A;  2I1J A;  4B95 A;  3H9D A;  1GG3 A;  4LNF A;  2RDH A;  4M01 A;  4TUU A;  2QIL A;  4WAA A;  4II3 B;  1EU4 A;  3U30 A;  2AL6 A;  2RGF A;  3WAM A;  5AZF A;  3A1Q A;  4AP4 C;  2QJL A;  5C3J B;  1E8Z A;  3V05 A;  1ET6 A;  1P0R A;  4JQW C;  4GB9 A;  2C9W B;  2QC8 A;  1WZ0 A;  3SR6 A;  2K8H A;  4KX6 B;  3EFC A;  4S0R A;  4HKZ E;  3X0W A;  3N1Z C;  2N7E A;  3AEC B;  1E5W A;  3IAM 1;  1T0S C;  2LGI A;  2V4L A;  5EE3 A;  3SD5 A;  2N0S B;  4OHJ A;  3RZF A;  3RNE C;  4F1S A;  5IA7 A;  4YSZ B;  4XYC A;  2KC1 A;  3CST A;  2AL3 A;  1WX8 A;  2LVO A;  1FRR A;  1C79 A;  1E0Z A;  3MC9 A;  3RNA C;  4NY0 A;  5D2M B;  4OW0 A;  4IUM B;  3AE3 B;  3SFE B;  2I38 A;  2W55 A;  2I2Y A;  4LNO A;  2G4S A;  3NZ3 A;  4LJP B;  3L16 A;  2WDQ B;  5IAA C;  1P1A A;  2K0P A;  2JF5 A;  3PVL A;  3ZW3 A;  2DLB A;  4KIK A;  3V6E B;  2YLM A;  3N32 A;  3JSV B;  3DPD A;  3AMZ A;  1EUV B;  3DBL I;  1N63 A;  2WXL A;  2AWT A;  3JSV A;  3L4P A;  2NS5 A;  4YTM B;  3W5U B;  1EWC A;  1J7B A;  4A8X C;  2E6X A;  2K3U A;  1XT9 B;  2D3C A;  4MGZ E;  1E90 A;  2KNB A;  4B9K A;  1MJD A;  2FUH B;  3AEB B;  3KWL A;  4NJC A;  2G9H D;  3R66 C;  4WQO B;  5DPR A;  4HXD A;  1RRB A;  2L00 B;  3ZDT A;  2N7J A;  3BYY B;  1FIQ A;  3QQ8 B;  3VAW A;  3IT4 B;  3OLM D;  5DCN A;  3Q3O C;  4YL8 A;  2SEB D;  1TZO A;  3AEE B;  1L4Z B;  1GC7 A;  5D6J B;  4W9C A;  2GBK A;  1DYQ A;  1HA5 A;  4EE2 A;  2GBM A;  4RGT A;  4TSS A;  2BYV E;  4DK5 A;  2J0K A;  3DHI C;  2HTM E;  2PMV A;  1Q10 A;  4G50 A;  4C4V A;  4CYE A;  4ZHO A;  1UH6 A;  2QEJ C;  4WAF A;  2M8S A;  1JML A;  1KLG D;  3CF6 E;  3NY5 A;  4MM3 A;  2PE9 A;  1WXS A;  4F8C B;  1LGR A;  4RM9 A;  1YD8 U;  3RUI B;  4GMV A;  3R3M A;  1ROE A;  4IKG A;  4GXB A;  2MEK A;  1VD2 A;  2N9E B;  3H7S A;  5BO4 B;  3PV1 A;  3KUZ A;  1FRD A;  1IP9 A;  1E8X A;  1YQ4 B;  2EMS A;  2V1Y A;  1UGJ A;  4HRO A;  2CHX A;  2KYW A;  2DEN B;  1QQR A;  3IG3 A;  3ZGZ A;  3ZVV A;  3AEA B;  1EM7 A;  2LVQ A;  2WXK A;  2LAS A;  2WLB A;  2NCN A;  3N20 C;  4PS3 A;  2PTL A;  1NBF C;  2KWV B;  3RPF C;  3EUB 2;  3DOW A;  2K8B A;  2EKI A;  5G2N A;  4RGN A;  2DZJ A;  4W9G A;  3S2A A;  2PE6 B;  4M8N A;  2OOB B;  1QF6 A;  3B9J A;  2NMQ A;  2W54 A;  1JRO A;  1F2R I;  1GB1 A;  1B1Z A;  2MQJ A;  2G4D B;  2KLC A;  1JRP A;  2ZPN A;  3KUD B;  3UI3 A;  3V62 A;  4B6W A;  4CQN A;  3DVN V;  3H7P A;  3N3K B;  5D3I B;  1FCC C;  4WH4 A;  3QX1 A;  3ZUN A;  4JX1 C;  2DZK A;  3EEC A;  1OQR A;  1YX6 B;  5IOI A;  1DOI A;  2KFK B;  1UUP A;  4IOI E;  4BKT A;  4J3O D;  2M4N A;  2KWU B;  5CHV C;  1EF1 A;  5G5G A;  1MI0 A;  4ZRI A;  4W9K A;  5CHW A;  4RGM A;  3LDZ E;  1D5Z C;  4NAW B;  3UIN B;  5E6P A;  1RWS A;  4HLE A;  3AH7 A;  1QZE A;  5J17 A;  4TV3 A;  1UBI A;  4O1N A;  2OJR A;  3KWV A;  4AWJ A;  4EFO A;  3SFD B;  2FCN A;  3HK0 A;  3ZQ4 A;  4HJG E;  2PJH A;  5E6N A;  3BK2 A;  1IGC A;  3BVZ A;  1B9R A;  4HVB A;  4WUR A;  2KVR A;  2NBV B;  1OGW A;  3MC8 A;  4BFR A;  4ZRQ A;  2IGH A;  4BKS D;  2CR5 A;  2CJN A;  4K7W A;  1GTH A;  5CX3 A;  3AXC A;  4BVU C;  3CSF A;  1FD6 A;  1Z5S B;  1SF0 A;  1SEB D;  4IG7 B;  3H7P B;  5AUI A;  1Q0W B;  3AE5 B;  1L0X B;  3PS6 A;  4N9F 4;  1ZXI A;  3VH4 B;  1TY0 A;  1NI3 A;  4PT5 A;  1SXT A;  1N60 A;  2IND C;  4E3C A;  3LB8 C;  2ZNV B;  4ZOH C;  3ZXR A;  3RMK C;  3VH3 B;  3ZYY X;  1PGX A;  1TT5 B;  2FCQ A;  2KMA A;  2IY0 B;  4MGK E;  4YSY B;  2WXF A;  2ZCB A;  2LUE A;  1IPG A;  3UIO B;  3Q2A C;  2FUG 1;  4HDO A;  4Q2J A;  1K51 A;  1QOG A;  1XEE A;  1VZ7 A;  1TKY A;  3R2I A;  3ZKJ C;  4FBJ B;  1Y56 A;  3TSS A;  1V97 A;  3VUY A;  1AW7 A;  2UWQ A;  1PDX A;  1LFD A;  4A90 A;  4IDI A;  2JRI B;  1KM7 A;  1T5X D;  5BMH A;  3K9O B;  2CHZ A;  1YOV B;  4GU2 A;  4ARI A;  1U4A A;  2M56 B;  5MPO A;  2DNF A;  3L10 B;  4C80 A;  4JWS C;  1KLU D;  4P6V F;  3ZRF A;  2DHZ A;  4YT0 B;  2MWS B;  3GZN I;  2BBC A;  3TEW A;  1SB3 C;  2JX5 A;  4LDT B;  3NOB A;  2R2O A;  1XLP A;  2M19 A;  4W9D A;  2HJ8 A;  3AI5 A;  3VTU A;  4KDL B;  3BVG A;  4I6P A;  1IYF A;  3A4S C;  3R2T A;  5BYQ A;  2R2Q A;  1WGY A;  2C60 A;  4KGR A;  2O6V A;  3QC8 B;  3R7Q A;  5D94 A;  1JWU D;  1VZ8 A;  3QCA A;  1EWY C;  4LCD E;  2MCN B;  2WHI A;  2LHD A;  1OTR B;  1H7X A;  3JW0 X;  5DPT A;  1RFA A;  3ZTC A;  4US9 A;  2MRP A;  2SAK A;  2TSS A;  1AWD A;  4JIO U;  2KJR A;  3VTW A;  3L13 A;  1R4N B;  3DWG C;  2KWD A;  3DHH C;  2KOX A;  1LM8 B;  1UBQ A;  3I57 A;  1Z2M A;  4XC2 A;  4OVZ A;  3FIL A;  3QK0 A;  2GI9 A;  5D7G A;  1TTN A;  2HJ1 A;  3FKY A;  3AEF B;  1E7P B;  1C9F A;  1K52 A;  2BTE A;  1TJE A;  2JZP A;  4IC7 B;  4L23 A;  2MP2 A;  3VTV A;  4RF0 A;  1SE2 A;  3UQB A;  1E8Y A;  5TSS A;  1IGD A;  2LWP A;  4BAX A;  1HTO A;  4CO7 A;  1DOX A;  2L3Z A;  2G45 B;  3W9C B;  1HZ6 A;  3NS1 A;  2W3R A;  1ZXH A;  4J6I A;  3VFK A;  2N4F A;  1T0Y A;  1VZ6 A;  4EEW A;  1TBE A;  1UGM A;  2N9L A;  1FFU A;  4BOS C;  2RPV A;  2UU7 A;  3TUO A;  4IWO A;  4DWF A;  2ZZP B;  3RZW C;  3KUC B;  2BYE A;  2NPT B;  2BB5 A;  2GBN A;  3B2F A;  2ZVO A;  2L32 A;  3BWU D;  3HUI A;  5LNK 1;  2WS3 B;  3VXW A;  1L5P A;  1I35 A;  4HCN B;  2L83 A;  4DHJ B;  2BWE S;  3DBH I;  3H8H A;  3IHP C;  1C1Y B;  2ZW0 A;  2YEP F;  2PEA A;  2J0J A;  2XEW A;  2KVZ A;  3B08 A;  4HPM B;  4IM0 A;  2PVO D;  4G11 A;  1WRI A;  4MAC A;  4GDL B;  1QT9 A;  3A9K A;  3U2S C;  1XD3 B;  1RM6 C;  1GUA B;  1TGZ B;  2QSD A;  1P7F A;  4B0M A;  5DPS A;  1C4C A;  1FPY A;  4G0N B;  1K50 A;  4P1C C;  4XGA B;  2JWU A;  1UWX A;  2L76 A;  1KTK A;  3MP9 A;  3IVF A;  2J53 A;  4KZC A;  3T3N A;  1J0G A;  4MH8 A;  2VZK B;  1L0Y B;  2AQ1 B;  1WJU A;  3O65 B;  1YJ1 A;  1QKZ A;  4NAW A;  2H88 B;  4L1B A;  3ZTD A;  1V1P B;  4FA6 A;  1XCT L;  2WXO A;  1QIL A;  3AE7 B;  2C7H A;  3OJ4 B;  1GJZ A;  1H4R A;  1T3Q A;  3VR9 B;  3BK1 A;  2KKC A;  4ANU A;  4HCP B;  4C7Z A;  3UIP B;  3MFG A;  1JCK B;  3ABV B;  2ZPY A;  4AQ7 A;  1UWM A;  3APF A;  2ZCC A;  1MG4 A;  2DYO A;  5IKC M;  3Q8F A;  1I4H A;  2O6V B;  3HRD D;  1WMH B;  2KDB A;  1CMX B;  3Q8E A;  1GAQ B;  1HXY D;  5JZE B;  2BGF A;  1RYJ A;  2K9X A;  3QWZ B;  3W2D A;  2INN E;  2WDT B;  2O2V B;  2Y5C A;  3M3J A;  3MJW A;  2GOW A;  1TIF A;  2KQ7 A;  3AU4 A;  4WJP A;  3EC8 A;  3MHS D;  1DGJ A;  4LLG M;  2WX0 A;  3BVM A;  3EHV A;  5KHQ A;  2FID A;  2KX3 A;  3VQI A;  3ONS A;  2WGS A;  3HM3 A;  1QOB A;  4LJO B;  3RNB C;  2CHW A;  3DWM A;  2M0X A;  2PLP A;  3RNC C;  3AE1 B;  3CF4 A;  5J18 A;  2DX5 B;  2G1E A;  3PHW B;  3HVZ A;  1I7H A;  4KSL C;  4RMA A;  1T0R C;  2IPK D;  1LQB A;  4EUT A;  3A33 B;  3B2G A;  5BMG A;  2WX1 A;  1OEY J;  3I63 C;  4FHK A;  2L1A A;  3WAL A;  3ZXV A;  1IBX A;  3NZU A;  2MHJ A;  2FIF A;  1CK1 A;  4GDK B;  5AEK B;  3BII D;  1NYQ A;  2D10 A;  3ZLZ A;  2HDE A;  1QLB B;  2LGY A;  4ZRJ A;  2LGX A;  2WP9 B;  2YEP B;  4FXC A;  1YN4 A;  1TKE A;  1WWT A;  2WNM A;  3BIN A;  3B1L X;  3U8Z A;  2KN4 A;  4WJQ A;  3TCA A;  1PUT A;  2BVC A;  3GE3 C;  2AYO B;  1ZDX A;  4ICV A;  4MSM B;  3NUH B;  2REX A;  4RH6 A;  1MFW A;  1Q5W B;  4NJ7 A;  3A9J A;  3BYT B;  4LDT D;  3IFW B;  3A9J B;  2JWZ A;  2N9X A;  3TIX A;  1WH3 A;  3ZJT A;  2KJ6 A;  5HI1 A;  3Q3N C;  1JWA D;  1N6Z A;  4XE0 A;  2DZM A;  1GNU A;  2AQ3 B;  1V5O A;  3PSE B;  2XNA C;  2KDF B;  2L05 A;  1YN3 A;  2DYM A;  3TBL D;  4PS7 A;  4RF1 A;  3NZS A;  4N59 A;  4A3P A;  2Z0D B;  2QCZ A;  2NTS A;  4C7Y A;  4BBN F;  3T3O A;  3DBS A;  3PRZ A;  3H1U A;  4LNK A;  1M4V A;  3I5J C;  1F2R C;  4JLC A;  4TMA B;  2LVP A;  5LXH A;  2KFK A;  2BS2 B;  1I4G A;  1E8W A;  1F0Z A;  4KV2 A;  1VRA B;  1BUI C;  1H7W A;  2RDG A;  3ENE A;  4HEA 1;  3WIM A;  3WA0 A;  4BOZ B;  1JWM D;  2L0F A;  4FHJ A;  2KC2 A;  2BPS A;  1TS4 A;  1JWB D;  4A9A A;  2ZVN A;  1F77 A;  3ML9 A; 
#chains in the Genus database with same CATH homology
 4Q2J A;  1K51 A;  1QOG A;  1E6E B;  1XEE A;  1VZ7 A;  1TKY A;  3R2I A;  1Y56 A;  5FK9 C;  1V97 A;  2KAJ A;  3TSS A;  3P1M A;  4REZ A;  4OZA A;  1AW7 A;  3AE9 B;  4GLS C;  1YJJ A;  1PDX A;  3P4P B;  4A90 A;  4IDI A;  5GXG B;  1T5X D;  5BMH A;  1I4R A;  5HG2 A;  3WCQ A;  1PFD A;  1ZUD 2;  1GPX A;  3PZ7 A;  4ARI A;  2GB1 A;  3NVZ A;  2M56 B;  2EEL A;  1RFK A;  3TEX A;  5MPO A;  1GTE A;  2ON8 A;  5T8I A;  3W1S A;  4A55 A;  3Q69 A;  3KQ4 A;  4C80 A;  4JWS C;  1KLU D;  1JAL A;  1ZE3 D;  4RFB A;  4P6V F;  3ZJU A;  3VR8 B;  2OHF A;  4YT0 B;  3AE2 B;  1AYF A;  2LJI A;  5EE1 A;  2BBC A;  1TYG B;  1SB3 C;  2JX5 A;  3TEW A;  1TS2 A;  4RCO A;  3MJ5 A;  2M0A A;  3VRB B;  5EE9 A;  1KFY B;  1J7A A;  3NVV A;  1XLP A;  2RMM A;  2M19 A;  2KMM A;  3N9Y C;  1BML C;  2WXP A;  4HRS A;  1D4B A;  3U52 E;  2BS4 B;  1WYG A;  1FO4 A;  2INP E;  3BVG A;  1OQQ A;  3R2T A;  1MPE A;  5BYQ A;  5H8Y E;  1XCQ L;  3EGR A;  1N61 A;  2BT6 A;  4KGR A;  1LO5 D;  2AX5 A;  3MHZ A;  3Q8B A;  4KGT A;  3TEZ A;  1FM0 D;  1TY2 A;  1SJH D;  1JWU D;  1VZ8 A;  1VJK A;  1EWY C;  2FBW B;  2JQR B;  4WWM A;  3AE8 B;  2LHD A;  2MH7 A;  1H7X A;  2IJ0 A;  4OZB A;  1C4P A;  2VZK D;  1C76 A;  4US9 A;  4DQO C;  4OZC A;  2SAK A;  2TSS A;  1AWD A;  1CZP A;  3E9S A;  4NAM A;  3RFZ B;  3U7Z A;  2V3N A;  2BB6 A;  1GOZ A;  1K53 A;  4MT5 A;  3O13 A;  1R7S A;  1JW9 D;  3DWG C;  3EA6 A;  2KWD A;  3ETR A;  3AN1 A;  1GT8 A;  1C4A A;  2W3S A;  3I57 A;  2ICI A;  1I4P A;  4OVZ A;  3FIL A;  1HQR D;  2D5G A;  2GI9 A;  5D7G A;  4TQ1 A;  2ACZ B;  1YJI A;  4WQM A;  2WU5 B;  2LHE A;  3AEF B;  1E7P B;  4YWG G;  2RDH A;  1C9F A;  2V0G A;  3AB5 A;  4YTP B;  1K52 A;  2QMT A;  2BTE A;  1TJE A;  2JZP A;  1FEH A;  3OWE B;  4L23 A;  1ESF A;  1XLQ A;  2QIL A;  1C78 A;  3AV8 A;  4RF0 A;  1SE2 A;  1EU4 A;  2WU2 B;  1SE3 A;  5TSS A;  1IGD A;  4XWW A;  1YN5 A;  1DOX A;  5BMI A;  4R3D A;  2WXI A;  3W9C B;  1HZ6 A;  1KF6 B;  4M0W A;  3NS1 A;  2W3R A;  1ZXH A;  3FC4 A;  1JWS D;  2LFI A;  2QJL A;  5C3J B;  1VZ6 A;  2WXM A;  4RGO S;  3V05 A;  1ET6 A;  3KLS X;  4DXG A;  2B76 B;  2N9L A;  1ZDV A;  1FFU A;  4ZHP A;  3SR6 A;  1I4X A;  2RPV A;  4KX6 B;  2WDR B;  3TUO A;  4HKZ E;  3AEC B;  1FFV A;  3IAM 1;  3AM9 A;  2LGI A;  3AE6 B;  1IUE A;  2BB5 A;  5EE3 A;  3B2F A;  1NVI D;  2N0S B;  2V4I B;  3PO0 A;  4OHJ A;  4KGS A;  3U4E G;  2L32 A;  3E56 A;  4YSZ B;  3BWU D;  3HUI A;  5LNK 1;  2WS3 B;  1ZPS A;  1FRR A;  1L5P A;  1C79 A;  1E0Z A;  3MC0 B;  1V1P A;  5FR3 A;  3FAH A;  2L83 A;  1WXQ A;  2H89 B;  3H8H A;  2L52 A;  2ZW0 A;  2YEP F;  4OW0 A;  3AE3 B;  3SFE B;  2I38 A;  2W55 A;  2I2Y A;  4H2A A;  3NZ3 A;  2WDQ B;  2K0P A;  1ZOY B;  1L6U A;  2PKO A;  4ZYS A;  4NZL B;  2PVO D;  2DLB A;  2BYT A;  2GRI A;  1BXT A;  1FNV A;  2W82 A;  1ENF A;  1WRI A;  2XN9 C;  2PVG C;  4GDL B;  4MAC A;  1QT9 A;  3U2S C;  1SE4 A;  4LK0 M;  1T6B X;  3Q8C A;  3AMZ A;  3AE4 B;  4USA A;  1RM6 C;  1WGK A;  2QSD A;  1N63 A;  1P7F A;  2WXL A;  4B0M A;  3L4P A;  1C4C A;  2WXJ A;  3PZ8 A;  1K50 A;  3BZD B;  1DOY A;  4YTM B;  2ZW1 A;  5BYS A;  3W5U B;  1EWC A;  1J7B A;  4UDU C;  4A8X C;  2E6X A;  2JWU A;  2K3U A;  1FNW A;  1UWX A;  1KTK A;  3TEY A;  3MP9 A;  2J53 A;  3FIL B;  1C77 A;  4XDD A;  3T3N A;  1NEK B;  3NVY A;  2E3T A;  3AEB B;  1D5X C;  2LEK A;  3KWL A;  4NJC A;  2G9H D;  1D5M C;  4MH8 A;  2VZK B;  3LYY A;  5H92 C;  1SSN A;  1KRH A;  1N62 A;  4ITK A;  4P16 A;  5FKA C;  1L0Y B;  2AQ1 B;  3ZJV A;  2Y3A A;  2N7J A;  3BYY B;  1FIQ A;  2DBY A;  1VLB A;  1QKZ A;  3IT4 B;  2WXQ A;  2WXN A;  2H88 B;  1XO3 A;  4XDC A;  4KKI A;  2MJ3 A;  1XLN A;  4L1B A;  1TKG A;  1V1P B;  2SEB D;  1ACC A;  1TZO A;  3AEE B;  1L4Z B;  1XCT L;  2WXO A;  1QIL A;  1DYQ A;  3GB1 A;  3AE7 B;  1PYW D;  1HA5 A;  4JPS A;  4EE2 A;  4RGT A;  5C2T B;  1NEN B;  4TSS A;  1T3Q A;  3VR9 B;  3BK1 A;  4YTN B;  1VDV A;  2Q5W D;  1HEZ E;  4C7Z A;  3MFG A;  1HZ5 A;  2HTM E;  2PMV A;  1JCK B;  1Q10 A;  3ABV B;  1KH0 A;  4AQ7 A;  1UWM A;  4N58 A;  4XWT A;  2DYO A;  4ZHO A;  2QEJ C;  4WAF A;  3Q8F A;  1I4H A;  1AN8 A;  1XXG A;  1JML A;  2MJE A;  1KLG D;  3I9V 1;  3HRD D;  3Q8A A;  2WXH A;  2NTT A;  1YQ3 B;  4MM3 B;  1JQ4 A;  1NYR A;  3Q8E A;  1GAQ B;  1HXY D;  2QIE B;  1RYJ A;  2K9X A;  3HVD A;  3W2D A;  1ROE A;  3IAS 1;  2CJO A;  2CU3 A;  2KAC A;  2INN E;  4IKG A;  2Y5C A;  1UNS A;  2MEK A;  1CJE A;  1WSP A;  2BW2 A;  2JSV X;  3AEG B;  2WXG A;  1FMA D;  1V8C A;  1TS5 A;  1FRD A;  1DGJ A;  4LLG M;  1MHX A;  3BVM A;  3URY A;  1XF5 L;  1YQ4 B;  2MJD A;  5I4D A;  1UGJ A;  4HRO A;  3P42 A;  3VQI A;  1ZP0 B;  2V3P A;  1QQR A;  3ZGZ A;  1QOB A;  3AEA B;  1QOA A;  1EM7 A;  3DWM A;  3IXS A;  2WXK A;  2WLB A;  3P63 A;  2PLP A;  2PTL A;  1PGB A;  3AE1 B;  3CF4 A;  1OFF A;  3RPF C;  1STE A;  2G1E A;  2IGD A;  3EUB 2;  3LXF A;  5AUK A;  2J42 A;  3HVZ A;  2PW9 A;  1I7H A;  2EKI A;  3GS2 A;  4RGN A;  3VRA B;  2IPK D;  3B2G A;  2AQ2 B;  1QF6 A;  3B9J A;  5BMG A;  2NMQ A;  2W54 A;  4A6Q A;  1ET9 A;  1JRO A;  1N5W A;  1F2R I;  1GB1 A;  2L1A A;  3GP7 A;  5JXV A;  1B1Z A;  2LUM A;  1IBX B;  1IBX A;  1JRP A;  1L0V B;  1CK1 A;  3UI3 A;  4GDK B;  3P4S B;  1SJE D;  2WXR A;  3BII D;  1J7C A;  1NYQ A;  5D3I B;  1FXI A;  1MVK A;  4CQN A;  1FCC C;  5BYR A;  4WH4 A;  1A70 A;  5D3D A;  2HDE A;  1QLB B;  4JX1 C;  5HHD G;  2BS3 B;  1OQR A;  1SIJ A;  1DOI A;  1UUP A;  4ARC A;  2WP9 B;  2J52 A;  2YEP B;  4FXC A;  1YN4 A;  1QOF A;  4IOI E;  4N6E B;  1FXA A;  1TKE A;  2JYT A;  4J3O D;  2Y5P A;  1FNU A;  1WWT A;  2WNM A;  1L4D B;  1SBB B;  2J4X A;  1EU3 A;  1GB4 A;  3P4Q B;  2KN4 A;  5G5G A;  1MI0 A;  1E9M A;  1PUT A;  2Z8L A;  4B0E A;  4WIP A;  4C56 C;  4RGM A;  1ZDX A;  3C8Y A;  3NUH B;  3CIR B;  1D5Z C;  3CWI A;  4RH6 A;  4NAW B;  2KDM A;  2IGG A;  2K5P A;  3BYT B;  1RWS A;  2K22 A;  3AH7 A;  1PGA A;  4L2Y A;  3NRZ A;  5G5H A;  4O1N A;  3KWV A;  1D6E C;  1V1O A;  3ZJT A;  5HI1 A;  3SFD B;  1JWA D;  1MHH E;  4XE0 A;  2KQ4 X;  3ZQ4 A;  4HJG E;  2FE8 A;  4LTU A;  4RNA A;  1XLO A;  2AQ3 B;  3P4R B;  2IDY A;  2XNA C;  3BK2 A;  1IGC A;  3BVZ A;  1YN3 A;  3AED B;  2DYM A;  1B9R A;  4WUR A;  1VR9 A;  1L6V A;  2JYE A;  3J9C A;  4RF1 A;  4ZRQ A;  4N59 A;  2IGH A;  2CJN A;  2NTS A;  2OED A;  2PIA A;  2JXT A;  4C7Y A;  4AS1 A;  1GTH A;  3T3O A;  1FD6 A;  2WQY B;  3V3X A;  2LMC A;  1M4V A;  1SF0 A;  1F2R C;  4YSX B;  1SEB D;  1E10 A;  4TMA B;  5AUI A;  5E6J A;  3W5V B;  1FCL A;  1YMH E;  3AE5 B;  1L0X B;  1P7E A;  1ZXI A;  2BS2 B;  1I4G A;  4KKJ A;  5EE0 A;  1TY0 A;  1NI3 A;  2JU6 X;  4PT5 A;  2WDV B;  1SXT A;  5HFY A;  1F0Z A;  4YXD B;  1N60 A;  4JE3 B;  3LB8 C;  2N9K A;  1VRA B;  1CQV A;  1BUI C;  1H7W A;  2RDG A;  4JWU C;  2DWQ A;  4ZOH C;  2X38 A;  4HEA 1;  4ZRP A;  1YNT E;  3ZYY X;  1PGX A;  3IT6 B;  1JWM D;  3NVW A;  1I4Q A;  4YSY B;  1N5X A;  4D2K A;  2WXF A;  4DXF A;  3SEB A;  1TS4 A;  1TS3 A;  4TQ0 A;  3R8B A;  1JWB D;  4A9A A;  2ONQ A;  2R61 A;  4HKQ A;  1F77 A;  2FUG 1;  4US8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...