3P4RB

Crystal structure of menaquinol:fumarate oxidoreductase in complex with glutarate
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
243
structure length
243
Chain Sequence
AEMKNLKIEVVRYNPEVDTAPHSAFYEVPYDATTSLLDALGYIKDNLAPDLSYRWSCRMAICGSCGMMVNNVPKLACKTFLRDYTDGMKVEALANFPIERDLVVDMTHFIESLEAIKPYIIGNSRTADQGTNIQTPAQMAKYHQFSGCINCGLCYAACPQFGLNPEFIGPAAITLAHRYNEDSRDHGKKERMAQLNSQNGVWSCTFVGYCSEVCPKHVDPAAAIQQGKVESSKDFLIATLKPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Geometric restraint drives on- and off-pathway catalysis by the Escherichia coli menaquinol:fumarate reductase.
pubmed doi rcsb
source organism Escherichia coli 042
molecule tags Oxidoreductase
molecule keywords Fumarate reductase flavoprotein subunit
total genus 70
structure length 243
sequence length 243
chains with identical sequence N
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2010-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13183 Fer4_8 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 3p4rB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3p4rB01
2WU5B 1ZUD2 1WWTA 1YQ3B 1UWMA 4ITKA 2B76B 1FRRA 1SIJA 1SB3C 3BIID 3DWMA 1WGKA 3NS1A 3AE4B 2DWQA 4ZOHC 4YTMB 3SFEB 2K22A 2BS4B 3AE2B 2BS3B 1IUEA 1N63A 2K5PA 4YTNB 2N0SB 2FBWB 3VR9B 3CF4A 2BS2B 1NVID 2H88B 4LTUA 2CJNA 3P4SB 2PVOD 4P6VF 1NYQA 3AE8B 1XO3A 1E9MA 1YJJA 3LB8C 3AV8A 5G5GA 3WCQA 1N5XA 3AEGB 1J7AA 1GAQB 2W3SA 1AYFA 4YSXB 1GTHA 2QIEB 2M56B 3EUB2 1J7CA 3AE6B 1QT9A 1DGJA 2CU3A 1WRIA 1XLPA 1TKEA 5G5HA 3SR6A 1NEKB 3AECB 3AH7A 1R7SA 3AM9A 3ZYYX 4US9A 1FMAD 1ROEA 5C3JB 1T3QA 2KMMA 4USAA 3AE9B 2L83A 2HTME 1WYGA 3AEBB 3P4QB 3LXFA 3NVZA 3P63A 4HROA 1N61A 4JX1C 2K9XA 2MJDA 3VRBB 2L52A 1DOIA 2W3RA 5AUIA 2WQYB 1L6VA 5EE1A 1QF6A 1GT8A 1FFUA 1OFFA 1L6UA 3AEEB 1JW9D 1PUTA 1PFDA 2WLBA 3ETRA 4JWSC 5GXGB 4YSYB 1EWYC 4C7ZA 3AB5A 1L5PA 3HUIA 1JWBD 1E10A 3CIRB 1WXQA 1OQRA 1KF6B 1NENB 1F0ZA 1RYJA 1NYRA 2MH7A 1ZXIA 3B2FA 5AUKA 3P4PB 3W9CB 3AEFB 4A9AA 4ZHPA 2MJEA 1J7BA 1RWSA 2BT6A 1VLBA 2PVGC 3AN1A 1I7HA 3NRZA 3NVVA 2OHFA 1YQ4B 3DWGC 1ZOYB 2MJ3A 1JROA 1OQQA 1B9RA 1DOXA 2H89B 4YXDB 3FC4A 2ACZB 4N58A 1H7XA 1AWDA 1TKGA 5EE3A 2LEKA 1RFKA 2WDQB 4ZHOA 1PDXA 3PO0A 4C80A 3KWLA 2PKOA 1GTEA 2PIAA 1A70A 3AEAB 1FRDA 1TJEA 2W55A 1N62A 3AE1B 2Y5CA 3NVYA 2E3TA 4WQMA 3VRAB 1YJIA 5H92C 2KAJA 3RPFC 1N5WA 3W5UB 1ZP0B 1L0VB 3NVWA 2QJLA 2DBYA 1JWAD 1E7PB 1QLBB 1JRPA 3HVZA 3W5VB 1E0ZA 3AE5B 3CWIA 1NI3A 2WS3B 4KX6B 1XLOA 4C7YA 3VR8B 1QOAA 3B9JA 3HRDD 3P4RB 2CJOA 1FXIA 5C2TB 1KFYB 1XLNA 1DOYA 4YT0B 3ABVB 4YTPB 2EKIA 1V8CA 1XLQA 3P1MA 2AX5A 1SF0A 1RM6C 3AEDB 2JX5A 1CZPA 1FIQA 2M19A 1QOFA 3FAHA 2WU2B 3AMZA 2G1EA 2W54A 4JWUC 1TYGB 1H7WA 1GPXA 1JQ4A 4N59A 4US8A 1FO4A 1FM0D 4HRSA 1JALA 2JQRB 1E6EB 1V97A 4IDIA 1FXAA 1VJKA 4FXCA 1QOBA 5MPOA 1QOGA 1CJEA 1N60A 2WDRB 2Q5WD 4N6EB 3SFDB 4WWMA 5EE0A 1FFVA 4YSZB 1KRHA 3B2GA 1VDVA 3AE7B 5EE9A 2WDVB 1TKYA 2WP9B 5H8YE 3AE3B 3L4PA
chains in the Genus database with same CATH superfamily
2MCNB 3L13A 3U52E 1I4HA 1SB3C 2C7NB 2NVUI 2ZPYA 1N63A 1TY0A 2N0SB 3Q8AA 4FJVB 3QAQA 1SGHA 3ZVVA 3A4RA 3JVZX 1AW7A 1HE8A 1N5XA 1V1PA 1TZOA 2WXJA 3QCAA 1L2NA 2ZJDA 5G5HA 2MBQA 3EECA 3Q69A 2N7DA 1FMAD 2MLBA 4K7WA 3R2TA 2O2VB 2V9HA 1N61A 2K6QA 2L00B 2IO1B 4RNAA 2WXNA 1S1QB 4WJOA 1F77A 4ZHPA 3IAS1 2N9KA 3DBHB 2DZMA 3RULA 5HHDG 4WJQA 2RPQA 1VCBA 2FIFA 1V80A 3N30A 3PHXB 3DHGC 3KWLA 1KLGD 1I4GA 2D3CA 2Y5CA 3ML9A 3KWVA 3U4EG 1STEA 3RPFC 2WXQA 2O6VB 3NVWA 2RMMA 2R61A 4AOFA 3PHWB 1JRPA 2MBHA 3VR8B 2PE6B 3B9JA 3V62A 4IG7B 3R2IA 4EKUA 2CHZA 4G3XB 2JX5A 5E6OA 2LGDA 4WAFA 3KW5B 3K9PB 4F1SA 4US8A 1BMLC 1V97A 1V6EA 1LQBA 2N9LA 1T5XD 3SU8X 1YMHE 2KLCA 5IO9A 1P1AA 4YSZB 4GB9A 5EE9A 2MBOA 1ZUD2 2ZZPB 3AULA 1L4ZB 2R2OA 3LYYA 5FK9C 2YVCA 1KOTA 1PGAA 4YTNB 2FE8A 3DHHC 4MEMA 3CF4A 3QX1A 4B9KA 1WGHA 5JHBA 1X1MA 1WFYA 3UQAA 1P7EA 3J9CA 3RN9C 2D10A 4HXDA 3AEGB 2GBJA 1GAQB 3L0WB 4M8MA 1XXGA 1QT9A 1WGDA 3KYDD 1QKZA 4G11A 4RM9A 3T3OA 5C3JB 2M4NA 1V81A 4HROA 2K9XA 4ANWA 4W9IA 5C23A 2KZRA 4UDUC 1E5WA 1L6UA 3VTUA 1EF5A 4ANVA 3HUIA 4MGZE 3L10B 3OG5A 2IY0B 1ZXIA 3GE8C 3GZNI 4TQ0A 3TEXA 1ZE3D 5AEKB 3DWGC 2LMCA 2VH1A 5BMGA 5DPWA 1AWDA 2LEKA 1Z5SB 3H8HA 4ZHOA 2YEPB 2ZEQA 1TJEA 2LRUA 4FHKA 3FILA 2E3TA 5HFYA 1EUVB 5J17A 4TSSA 4II2B 1TTNA 4HJKA 4S17A 3Q8BA 2MA9B 1EO6A 2KX3A 2JYEA 1DOYA 3QK0A 1XLQA 2L7RA 4HCPB 3ZNID 1Y56A 2WU2B 1T0QC 4BBNC 4BKSD 4F8CB 4BOSC 3LJ3A 2DZJA 4H2AA 4AS1A 2BYVE 1TKYA 1NI2A 2WU5B 2IO0B 5IKCM 2GB1A 2BYFA 1L0YB 1P9DU 1WGYA 1FD6A 2HE7A 3PS6A 2N9XA 1WMHA 2BKRB 2KDEB 1ET6A 3BYTB 2FCNA 5I4DA 1M4VA 2JXXA 2NPTA 2EMSA 4TKNA 1JCKB 2M56B 3EUB2 1J7CA 3ZNZB 4P16A 1DGJA 2G9HD 1GNUA 4GDKB 2ZCCA 2MBEA 4IW0A 1QQRA 4DQOC 5BYRA 1WJNA 2L32A 4GDKA 2I2YA 1K51A 4OVUA 2WQYB 4GOCA 1QF6A 1EF1A 4C7ZA 3AI5A 4W9DA 1XF5L 2INCC 3C0RB 3B2FA 3WAOA 4HDQA 3JSVB 4L1BA 1C77A 3PTFC 4KGSA 1DOXA 4N58A 2EELA 1PDXA 4A6QA 1UNSA 2KWCA 2KVZA 2AWTA 1FRDA 2W55A 3AE1B 4JL9A 1RLFA 3H6NA 4A3PA 2KQ4X 1C79A 2KD0A 5HI1A 1RAXA 1RFAA 5L95C 3V61A 2WX0A 4DXAB 3KQ4A 4MH0E 3ZW3A 4KIKB 3UGBB 1H7WA 2Z59B 1K53A 1CK1A 1GB1A 1VZ6A 2KWDA 2QILA 3ZKJC 4K7UA 2K0PA 1XT9B 2PW9A 3IT4B 1WM2A 4J6IA 3PZDA 3DVGX 3SHQA 4BKSA 2H88B 2D3BA 2K6DB 1WJ6A 1E7VA 5DCNA 1E9MA 1ZDXA 5BYSA 5BMHA 2KQSA 1WXSA 3LXFA 1FCLA 2BWFA 2JWZA 2WLBA 1PFDA 2ZNVC 1JWBD 3DCGA 3ZRFA 3CIRB 2SAKA 4XYCA 1NYRA 1YOVB 4EZJA 2RDBC 1V9JA 2MJEA 4NAWB 3NRZA 1ZDVA 4URKA 3ZLZA 3R3MA 4XZ4A 4YXDB 3ZTCA 2GI9A 2G4DB 4PYUA 3B0AA 4G50A 4W9FA 5JHAA 2VZKD 3V6CB 2KWUB 3RNEC 1R4NB 2HTHA 4PS7A 2JZ3B 3P4RB 4NJ7A 3Q14C 1XLNA 2J52A 4RCOA 4YT0B 5GMVA 4YTPB 1C4PA 4JQWC 4LCDE 1JQ4A 2WXKA 3ALBA 1P7FA 3IXSA 1Z2MA 2WNMA 4OHJA 3CF6E 1FXAA 3HM3A 1UF0A 3VVWB 4DDID 4I6PA 3ONSA 1WI0A 3BVZA 1XCTL 3SFEB 2LJIA 3K9OB 4BZAA 1WX9A 3VR9B 2L0FA 5E6PA 1NVID 2BYTA 3ZQ4A 5J18A 3GP7A 3P42A 2CJNA 3NS8A 1KJTA 4M01A 2KFKB 2QCZA 3LB8C 2M0XA 1T0RC 1PGBA 4GXBA 2KFKA 1WXAA 4YSXB 5IAAC 2J0KA 4W9EA 1C4AA 1OEYJ 2K8BA 4JLCA 4XDDA 1DYQA 1ESFA 3AE9B 2LGIA 4REZA 4W9HA 3VXWA 4KVGB 3VRBB 2AYOB 3BK1A 5EE1A 4AUQC 2MHJA 4BOZB 1E10A 2ZVNA 2FIDA 2MH7A 1ZPSA 1OQYA 2PVGC 2KDIA 3ML8A 3H7PB 1JROA 2M8SA 2B3AA 1YX6B 2C5LC 3FKYA 1TKGA 3PO0A 3WANA 2PIAA 4OVVA 3HVDA 3T8MA 4XWWA 1RRBA 1JRUA 1E0ZA 3DBSA 4GU2A 3A9KA 5KHOA 3WAPA 1QOAA 1WF9A 2RDGA 3V3XA 1V1PB 3VUXA 2YLMA 4NQKE 1IGCA 4LNFA 2N7JA 3AEDB 2KLGA 2KFJA 3AMZA 3MFGA 3VDZA 4OZBA 5LXHA 5MPOA 4B95A 3I3TB 4PT5A 4RH6A 2V0GA 1FFVA 4MJSA 5JH5C 1R4MI 1SE9A 2INNE 5BYQA 3D32A 4WWPA 1SJED 2UYZB 3IHPC 1WRDB 4NY0A 4YTMB 3ZO5B 1A5RA 4HPLB 4L2YA 3TJPA 4MELA 2NBUA 2JRIB 5AZHA 3W1YA 3DPDA 2DAJA 1FCCC 5D6JB 2KJRA 2PJHA 1YJJA 2N7EA 2NBVB 4EOYA 2YEPF 1WE6A 1HEZE 3TEYA 2DX5B 3RNCC 1V1OA 2JU6X 1ROEA 5HKHA 2QHOA 3N3KB 3A9JA 4HDOA 1CMXB 2UU7A 3ZJVA 2BTEA 4MSMB 3VFKA 1ENFA 2BKFA 1PUTA 1H4RA 1R4MB 3I57A 3CMMB 1GJZA 2L0TA 4XDCA 1J7BA 1PQSA 4PS8A 3OJ3A 1PYWD 4FJZA 5BO4B 2MJ3A 3RMKC 3UIPB 3QC8B 1UELA 1WJUA 2HD5B 5CX3A 4CQNA 4WQMA 3VRAB 5LNK1 4C56C 1JWAD 1YJ1A 5EDSA 1WZ0A 2LD9A 1R4NI 2KVRA 4ASWC 3AXCA 3P1MA 2HJ8A 1C9FA 1G6JA 1HTQA 2MSED 3A4SC 3L08A 4N59A 2JRHA 3A1QB 4WQOB 2AQ3B 4AWJA 4A55A 4IDIA 4EFOA 1HTOA 3EFCA 3AE3B 4G0NB 1WWTA 1YQ3B 4DWFA 1H8CA 1MG4A 4IWQA 1E8YA 2K39A 4E74A 4ICVA 1L0XB 1WJ4A 1QILA 3Q8EA 4MT5A 3UQBA 4I6NB 3MHZA 3ZGZA 1C4CA 3JYUA 1NDDA 4IOIE 1IYFA 1E7UA 2D5GA 3W1SC 3ZNGC 3M62B 2WWZA 1GTHA 4OZCA 1V2YA 1IPGA 3AE6B 3L54A 2ICIA 2I1KA 2Z0DB 1NEKB 2KDBA 4RGOS 4XC2A 2M0AA 2G45B 4USAA 1I42A 2HTME 3AEBB 1I4RA 4HK2A 4S0RA 1OFFA 1B1ZA 2IDYA 2HJ1A 3DBLB 1OQRA 1NBFC 3EC8A 5BMIA 2NTSA 1BT0A 4RGNA 1SSNA 1VLBA 3L16A 1K52A 1EWCA 4KZCA 3FC4A 2CHXA 2PKOA 1GTEA 3RT3B 1I35A 2Y5BB 1GC7A 2WGSA 4DXFA 1WIAA 1ZW7A 3BVGA 2ZCBA 2ONQA 5J2RA 3DQVA 1NI3A 3PT2B 3ZNHB 1JMLA 2BBCA 2JYTA 4OW0A 5C2TB 4QAYA 2C60A 1XD3B 3PLUA 1FPYA 4IWOA 2LGSA 2M17A 1MG8A 3FAHA 2QEJC 3BYYB 3VQIA 3V6EB 4KGRA 2PTLA 3PRZA 3A9KB 3NZUA 4KV2A 4NQLB 3B2GA 4MACA 2MX2A 3SD5A 3RNBC 1VZ8A 3E56A 1SEBD 4B6WA 2KTFA 2ON8A 2JZPA 1IBXB 1EM7A 2JWUA 1TS3A 3EGRA 1LGRA 1WYWB 1ET9A 5G5GA 2PLPA 2KT7A 5CTRC 1EU3A 2X38A 3QHTA 3AM9A 3Q3FA 1P0RA 3EA6A 4OVZA 5GXGB 2DYOA 2L52A 3R66C 3HHMA 5AZGA 1XCQL 4PYZA 1JW9D 3LDZE 4LNIA 1VD2A 3Q3NC 1HZ5A 2JVCA 2XNAC 5AUKA 3I63C 3GE3C 4DHJD 3NZ3A 3GB1A 1LXDA 4RFBA 1YN4A 4KDIC 4Q2JA 1FNWA 2IO3B 3ZUNA 4DK5A 2IPKD 2SEBD 3CSFA 2IY1B 3ZJUA 4RF0A 2K8CA 4JE3B 3Q8CA 1KFYB 3Q3JA 3IT6B 2NTTA 2GBNA 1SF0A 4WJPA 4RF1A 4HPMB 2M19A 1QOFA 2CKHB 2GBRA 2G1EA 2MQJA 2A4ZA 2LVOA 5AZFA 1QOBA 1CJEA 1TIFA 1GG3A 2MWSB 3SFDB 2GBMA 4C4VB 4KKIA 3NY5A 3Q3OC 1UWMA 2G4SA 3U8ZA 3BIID 3NS1A 2BS4B 1WXVA 2LZ6A 4E3CA 3Q3MC 3WAMA 4GGQA 1UZXB 2QMTA 4FA6A 2DENB 4LNOA 5E6JA 3U7DA 2WXGA 1AYFA 4LDTD 3DVNV 2RD0A 3I5JC 1TT5B 1D5ZC 1C1YB 1K50A 2D3AA 3SR6A 5JZEB 2KKCA 3AH7A 2KOXA 3ZYYX 3L17A 2KJ6A 3SDLC 1TS4A 1BUIC 1WY8A 3P63A 1HXYD 4M02A 4MGYE 2V3SA 1TS2A 2DYMA 3GOEA 3TMPB 3EFUA 4A8XC 1WXQA 4M00A 1NENB 1RYJA 4IC7B 4BAXA 3NVVA 2WXHA 3T9LA 2IGDA 1ZOYB 2WHIA 2JZZA 3VUYA 5TSSA 2ZNVB 2WDQB 2D2QA 2L3ZA 4W9LA 1GOZA 2C9WB 2N9PC 3NVYA 3U7ZA 4WH4A 2BB6A 4ARIA 3N9YC 4KX6B 5FR6A 1IP9A 3BZDB 4LK0M 1FEHA 4MGIE 2J0JA 1LM8B 2BGFA 3WA0A 3GS2A 1Q0WB 3TCAA 4GSWA 3V05A 4YWGG 3R7RA 3TEWA 1VJKA 4GIVA 3URYA 4A3OA 1N60A 3VUWA 2Q5WD 2MW5A 3BY4B 3MP9A 4LNNA 4NZLB 4ITKA 2L8JA 2FNJB 1S3SG 4IM3A 5H8YE 4EZKA 1T0SC 2O6VA 2LVQA 4LNKA 2C7MB 3RYTA 3GZNB 3O65B 1XQQA 2BWES 3RNGC 3MJ5A 3TSSA 3UF8A 2WX1A 2KK8A 3DBLI 2BVCA 1OEYA 2BF8B 5D94A 1T3QA 2KMMA 2FUG1 2E6XA 2ZW0A 3A1QA 1PGXA 1GT8A 4KIKA 2XEWA 1V86A 4X57B 4ANXA 1ZGUB 1F0ZA 2W9NA 3P4PB 1F2RI 5L83A 1HQRD 1V5TA 2N1WA 4M8NA 4LLGM 1Y8RC 1UGJA 3APFA 1RFKA 4BVUC 3DOWA 4C80A 1U4AA 4K1RB 5T8IA 2HDEA 2OEDA 4NAMA 5JXVA 1UBQA 4K3BA 2CR5A 3ZJTA 3HRDD 2CS4A 1D4BA 2I1JA 1P98A 3M63B 1KM7A 4WWOA 4FN2A 2GRIA 3KUZA 1FIQA 3QJZA 5DPTA 2LGYA 4K7SA 3U2SC 3TBLD 5G2NA 4GLSC 2A5UA 3MC0B 2Y5PA 4N6EB 1AARA 2D3GA 1J0GA 4TMAB 5G55A 2PMVA 1WGGA 1J19A 2QC8A 5D7GA 3RNAC 1WGKA 3AE4B 3APCA 2V3PA 3AE2B 2BS3B 2LWPA 2EKEC 1SE4A 2JT4B 1L4DB 4WJNA 4EE2A 4ZRIA 4KSLC 1UWXA 2Z8LA 1HZ6A 2KNBA 1D6EC 4WIPA 1YX5B 1J7AA 1WX7A 2ZPNA 3ZXRA 3H7SA 4JIOU 2XK5B 2K8HA 4XWTA 4DBGA 2L83A 1E8ZA 2KMAA 2LGXA 2MJDA 1YQBA 1FFUA 2J7QB 4YSYB 1L5PA 2V4LA 3KH0A 3QWZB 4A9AA 1ISNA 3AEFB 3KVFB 2XK5A 3NZSA 3DBHI 3BINA 1SBBB 2JY6A 1WX8A 3UIOB 4ZDVA 4CO7A 3MC9A 4DHZE 4HLEA 1IBXA 1N62A 1WR1A 1C76A 1YJIA 4GN1A 5H92C 1SE2A 1TZ1A 5CHVC 5LLIA 1ZP0B 2LRWA 5E6NA 4A20A 2IO2B 2IZVB 1KLUD 2V1YA 3Q8FA 2G3QB 1T0YA 4F7ZA 3MC8A 1F9JA 4OZAA 3H9DA 2JSVX 3AU4A 1D5MC 2DZKA 1WSPA 4KKJA 2FCQA 3T3NA 1TYGB 3OWEB 2RDHA 2BB5A 2VRRB 1JALA 2JQRB 3P2BA 2JF5A 2RR9A 4MDKE 2LXAA 3AE7B 3N1ZC 3PRPB 3NUHB 2MP2B 1SIJA 1F2RC 3DVNU 2K22A 4XX5A 2LHDA 4EZLA 3N1XC 5IA7A 2PVOD 2JUOA 2KACA 5D3DA 2LJ5A 3ZIMA 4EEWA 2MRPA 4W9CA 2W3SA 3VHTC 3KYCD 1GUAB 1UUPA 4GDLA 3PRMB 1K8RB 1TGZB 2KDMA 1TKEA 4IM0A 3AECB 4MM3B 4N9F4 2QDFA 2MEKA 4K3CA 3NVZA 1M94A 1I4QA 3NHEB 3BK2A 3RUIB 3S2AA 1L6VA 3Q6BA 3QIJA 4JPSA 3AB5A 4W9GA 3PZ7A 3RI7C 1E8WA 1KF6B 4HJGE 3ZRCA 3JW0X 3BWUD 1OGWA 4MGKE 2OHFA 4FJYA 2AL6A 2WYQA 1SXTA 2WXMA 1FNVA 3QA8A 4MSQB 4NJCA 4RGMA 3QARA 2DBYA 3IFWB 4HKZE 3R8BA 4DDGD 2LXCA 2N4FA 2WS3B 2PEAA 4C7YA 1UGMA 4BKTA 3W2DA 2CJOA 3OAWA 2KHWB 1TBEA 3ABVB 1V8CA 5TR5A 1YIWA 4FHJA 3IVFA 4FULA 1BXTA 3DBRB 2DYBA 2W54A 3MTNB 3HM6X 2WXOA 1FM0D 4KGTA 1L7YA 2N9EB 2LHEA 4ZRKA 1UBIA 1KRHA 1JWSD 2ASQA 2LUEA 4AJWA 2DWQA 1SIFA 2K5PA 4IUMB 1I4XA 2UWQA 1AN8A 3OLMD 4WURA 3AE8B 2EMTA 1MFWA 5DPSA 3WCQA 1GB4A 1SJHD 1LO5D 2PE9A 2KC1A 2QIEB 2L05A 4W9KA 2LI5A 2NPTB 4WWNA 4US9A 4FADA 1UD7A 2KWVB 3PVLA 4FLHA 1GC6A 1WZ3A 1LFDA 3PREA 3ECIA 2DAFA 3ETRA 1EWYC 4YL8A 4B0EA 2GBKA 2WXFA 5FKAC 4L23A 4TV3A 1YN5A 1QZEA 1YN3A 2WDTB 2WXIA 2KANA 2MBBB 3IG3A 2Y3AA 1B9RA 2H89B 2V3NA 2ACZB 5EE3A 2J42A 2VH2A 1J8CA 1Q10A 3HK0A 3X23A 3TIXA 3MJWA 2FUHB 4K81A 1N5WA 4P1CC 4W9JA 3UI3A 2QJLA 1E7PB 2K3UA 1XLOA 2WXLA 3DHIC 4NAWA 2INPE 2J4XA 2AX5A 2D11A 4RM8A 2L1AA 2I38A 4LJPB 4ZYNA 2TSSA 2KX0A 1FO4A 1HA5A 3KUDB 2OJWA 4ZRJA 2LFIA 4C00A 1MHXA 4WWMA 2VZKB 2NMQA 1VDVA 2INDC 2J0MA 2WP9B 2ZW1A 2NBWB 2RSUA 3WIMA 2B76B 3DWMA 3C8YA 3OJ4B 1F52A 2FBWB 1D3ZA 3W1SA 1JWMD 4LTUA 1YD8U 1KLVA 4M0WB 1MI0A 4P6VF 2QSDA 4J3OD 2KXJA 3M95A 2BQQA 4HWIB 5DPRA 3TEZA 4CHKA 2J53A 3VAWA 2CU3A 2PPHA 1WM3A 1XLPA 3TL5A 3H1UA 2LUMA 1WYGA 1Q5WB 5AUIA 1VR9A 2KMCA 1P3QU 3DDCB 1WR6E 2IGHA 1VZ7A 3EHVA 4HEA1 1V5OA 3IBEA 4ANUA 3KUCB 1E8XA 2DZIA 3V60A 3PPAA 2GOWA 3MHSD 4TUUA 4PK1A 1YNTE 5HG2A 3M3JA 4WAAA 5D3IB 3O13A 1L0VB 1VRAB 3HVZA 1QLBB 4MM3A 3AE5B 3U30A 4DHJB 2MP2A 3IAM1 4HCNB 5FR3A 4BFRA 4HKQA 4ZYSA 1FXIA 3X0WA 2AL3A 4E71A 4HPPA 2BPSA 2NR2A 2L76A 2WXRA 3B1LX 4JWUC 1E90A 4IM2A 4HRSA 3RNFC 4O1NA 4FXCA 2KTRB 2NS5A 2WDRB 4P1BC 3DVGY 2CU1A 2K1FA 3AU5A 1MPEA 3N20C 5EE0A 1ACCA 3HIZA 4EUTA 2JPHA 4IKGA 2KQ7A 1FRRA 2FAZA 4HVBA 4II3B 1T6BX 2KN5A 2NCNA 3Q2AC 1IUEA 1TY2A 2BS2B 2LVPA 3BVMA 3P4SB 1XO3A 2V4IB 4D2KA 1SE3A 2REXA 3APDA 2KDFB 3NG0A 4NJ6A 1ZXHA 1Q1OA 4MH8A 3VH3B 4AJYB 4ARCA 1WGRA 3CSTA 4ZRQA 2WXPA 2X8XX 3C19A 2ZVOA 3VH4B 1R7SA 5CHWA 4DHZB 1FNUA 3P4QB 2AEHA 3FILB 4FBJB 2W3RA 4XE0A 3AEEB 2KN4A 4JWSC 4AP4C 3A33B 4CYEA 2KYWA 5IN7A 3QQ8B 2KTRA 3NOBA 4M0WA 1RWSA 2BT6A 3AN1A 4RMAA 1I7HA 2LASA 3RFZB 3PLVA 2BYEA 1ZKHA 1JWUD 2DNFA 1WH3A 4TQ1A 4IWPA 1A70A 1F1HA 3A9JB 1TS5A 2C7HA 4LJOB 4RGTA 3CWIA 1MHHE 2N1VA 2Z0EB 2IYDB 2EKIA 4DXGA 1V49A 4GMVA 3ZDTA 4I6LB 1CZPA 2BW2A 2RPVA 2D07B 3ZDMC 5IP4D 2R2QA 2O6VD 3RD2A 3R7QA 3ZTDA 2CHWA 4P7IA 2JXTA 1KTKA 1WE7A 3JSVA 3L4PA 4MJSB 1C78A 4B0MA 3PGEA 2W82A 4ZOHC 5LXIB 1FXTB 3WALA 3H7PA 3TUOA 3NJTA 5IOIA 2IJ0A 3I9V1 4PS3A 2DHZA 1NYQA 3AV8A 4R3DA 4NNJB 4A90A 4NPNA 3PV1A 2FCMA 2KO3A 1OTRB 4KSKC 2K25A 3VTVA 1WRIA 4AQ7A 3KLSX 2AQ1B 4JGHB 2GLSA 1I4PA 4ICUA 2XN9C 1D5XC 4JX1C 1DOIA 4BBNF 3RCZA 1IGDA 1WMHB 3PZ8A 5D2MB 3SEBA 3W9CB 4KDLB 2DLBA 3UINB 3VTWA 1N6ZA 2FCSA 2OOBB 1YQ4B 1MVKA 3B08A 2O2VA 1OQQA 4LDTB 1H7XA 1XEEA 3E9SA 2IBIB 1UH6A 2GMIC 2KC2A 3AEAB 4GDLB 5C1ZA 2KAJA 3W5UB 4XGAB 2M1MA 4BKGA 4ZRPA 2IGGA 2KJHB 3W5VB 3ZXVA 1KH0A 4ACFA 1C3TA 3ENEA 2RGFA 3PSEB 5CHFA 1RM6C 3DBRI 4KZ0A 1WXMA 1CQVA 1GPXA 4C4VA 1E6EB 3RZFA 1QOGA 3N32A 3RZWC 1EU4A 2XBBC 5KHQA 3N1YC 2OJRA 2WDVB 1MJDA 2AQ2B
chains in the Genus database with same CATH topology
3U52E 1UWMA 3BVZA 1I4HA 1XCTL 1SB3C 3BIID 3NS1A 2DWQA 3SFEB 2LJIA 2BS4B 1N63A 1TY0A 2K5PA 2N0SB 3Q8AA 1I4XA 3VR9B 1AN8A 1NVID 2QMTA 3ZQ4A 2BYTA 3GP7A 3P42A 2CJNA 4WURA 3AE8B 5E6JA 3LB8C 1AW7A 3WCQA 1GB4A 1N5XA 1PGBA 1LO5D 1SJHD 1V1PA 2WXGA 1AYFA 4YSXB 1TZOA 2WXJA 2QIEB 1D5ZC 1C4AA 1K50A 5G5HA 3SR6A 3AH7A 3Q69A 3ZYYX 4US9A 1FMAD 4XDDA 1DYQA 1ESFA 3AE9B 1TS4A 1BUIC 2LGIA 3P63A 3R2TA 4REZA 1HXYD 1N61A 3VRBB 3BK1A 5EE1A 1TS2A 2DYMA 4RNAA 2WXNA 3ETRA 1EWYC 1E10A 4A8XC 1F77A 1WXQA 4B0EA 1NENB 2WXFA 5FKAC 1RYJA 2MH7A 4ZHPA 3IAS1 1ZPSA 2N9KA 4L23A 1YN5A 2PVGC 1YN3A 5HHDG 3NVVA 2WXIA 2WXHA 2IGDA 1ZOYB 2Y3AA 1JROA 1B9RA 2H89B 2V3NA 2ACZB 5EE3A 2J42A 1TKGA 5TSSA 2WDQB 3PO0A 1Q10A 3KWLA 1GOZA 1KLGD 2PIAA 1I4GA 3HVDA 4XWWA 2Y5CA 3NVYA 3U7ZA 3KWVA 4WH4A 3U4EG 2BB6A 1STEA 1N5WA 3RPFC 2WXQA 3NVWA 2RMMA 2R61A 3UI3A 2QJLA 1E0ZA 1E7PB 2K3UA 1JRPA 4ARIA 1XLOA 4KX6B 3N9YC 3VR8B 1QOAA 3B9JA 3BZDB 4LK0M 2WXLA 2RDGA 3R2IA 1FEHA 3V3XA 2INPE 2J4XA 1V1PB 1IGCA 2AX5A 3GS2A 2N7JA 2L1AA 2I38A 3AEDB 2JX5A 2TSSA 4WAFA 3AMZA 3MFGA 3V05A 4US8A 1BMLC 1HA5A 4YWGG 1FO4A 3TEWA 1V97A 4OZBA 2LFIA 1VJKA 5MPOA 3URYA 1MHXA 2N9LA 1N60A 2Q5WD 1T5XD 3MP9A 1YMHE 4PT5A 2VZKB 2NMQA 4RH6A 4WWMA 1FFVA 2V0GA 4YSZB 1VDVA 5EE9A 2ZW1A 2WP9B 4NZLB 1ZUD2 2INNE 5BYQA 4ITKA 1L4ZB 3LYYA 2B76B 1SJED 3DWMA 5H8YE 3C8YA 4YTMB 5FK9C 4L2YA 1PGAA 4YTNB 2FE8A 2FBWB 3W1SA 3CF4A 1JWMD 4LTUA 1FCCC 1MI0A 4P6VF 1YJJA 1P7EA 2QSDA 3J9CA 4J3OD 3MJ5A 3AEGB 3TSSA 1GAQB 3TEZA 2YEPF 1XXGA 2J53A 1QT9A 2CU3A 1HEZE 1QKZA 1XLPA 3TEYA 3T3OA 1V1OA 2JU6X 1ROEA 2LUMA 5C3JB 1T3QA 2KMMA 2FUG1 2E6XA 1WYGA 2ZW0A 4HROA 2K9XA 5AUIA 1PGXA 1VR9A 3ZJVA 1GT8A 4UDUC 2BTEA 1ENFA 1L6UA 1PUTA 3I57A 3HUIA 2IGHA 1VZ7A 4HEA1 1F0ZA 1ZXIA 3P4PB 4XDCA 1F2RI 4TQ0A 1J7BA 1HQRD 3TEXA 1ZE3D 1PYWD 3DWGC 2LMCA 2MJ3A 4LLGM 5BMGA 1AWDA 2LEKA 1UGJA 1RFKA 3H8HA 4ZHOA 4C80A 5T8IA 1YNTE 2HDEA 2OEDA 2YEPB 1TJEA 5HG2A 4NAMA 5JXVA 4CQNA 5D3IB 3FILA 2E3TA 4WQMA 3VRAB 3O13A 5HFYA 5LNK1 1L0VB 1VRAB 4TSSA 3ZJTA 3HVZA 1JWAD 1QLBB 4C56C 3AE5B 3IAM1 3Q8BA 3HRDD 5FR3A 4HKQA 1D4BA 2JYEA 4ZYSA 1FXIA 1DOYA 3P1MA 1XLQA 2WXRA 2GRIA 1C9FA 1FIQA 1Y56A 2WU2B 3U2SC 4JWUC 4N59A 4GLSC 2AQ3B 4HRSA 4A55A 4IDIA 3MC0B 4O1NA 4FXCA 2Y5PA 2WDRB 4N6EB 4H2AA 5EE0A 1MPEA 1ACCA 4AS1A 1TKYA 4TMAB 3AE3B 2PMVA 2WU5B 1WWTA 1YQ3B 2GB1A 4IKGA 1FRRA 5D7GA 1L0YB 1T6BX 1WGKA 3AE4B 1FD6A 2V3PA 3AE2B 2BS3B 1IUEA 1TY2A 1SE4A 1L0XB 1QILA 1ET6A 2BS2B 1L4DB 3BYTB 3Q8EA 4MT5A 4EE2A 3BVMA 3ZGZA 3P4SB 3MHZA 1C4CA 5I4DA 1XO3A 1UWXA 2V4IB 4D2KA 2Z8LA 1M4VA 1HZ6A 4IOIE 1SE3A 1D6EC 2D5GA 4WIPA 1J7AA 1ZXHA 4MH8A 1GTHA 4ARCA 4OZCA 4ZRQA 1JCKB 2M56B 3EUB2 1J7CA 3AE6B 2WXPA 4P16A 1DGJA 2G9HD 2ICIA 4GDKB 1NEKB 4RGOS 4XWTA 1R7SA 1QQRA 4DQOC 5BYRA 2M0AA 2L32A 1FNUA 4USAA 2L83A 2I2YA 2HTME 3AEBB 3P4QB 1I4RA 1K51A 3FILB 2MJDA 2W3RA 2WQYB 1QF6A 4XE0A 1FFUA 1OFFA 1B1ZA 3AEEB 2KN4A 4JWSC 4C7ZA 4YSYB 1L5PA 2IDYA 1XF5L 1OQRA 3B2FA 4A9AA 5BMIA 3AEFB 2NTSA 4M0WA 1RWSA 1SSNA 2BT6A 4RGNA 1VLBA 3AN1A 1I7HA 4L1BA 1C77A 1K52A 4KGSA 1SBBB 1EWCA 1DOXA 3RFZB 3FC4A 4N58A 2EELA 1JWUD 4TQ1A 1PDXA 4A6QA 1UNSA 2PKOA 1GTEA 1A70A 1FRDA 1IBXA 2W55A 1N62A 3AE1B 1TS5A 1C76A 4DXFA 1YJIA 5H92C 1SE2A 3BVGA 1ZP0B 2ONQA 4RGTA 1KLUD 3CWIA 3Q8FA 1NI3A 2KQ4X 1MHHE 1C79A 1JMLA 2BBCA 2JYTA 4OW0A 5C2TB 5HI1A 4OZAA 2EKIA 2JSVX 4DXGA 1D5MC 3KQ4A 1WSPA 1CZPA 2BW2A 4KKJA 2RPVA 2QEJC 3BYYB 3FAHA 3T3NA 3VQIA 1TYGB 1H7WA 3OWEB 2RDHA 1K53A 1CK1A 2BB5A 1GB1A 1JALA 2JQRB 4KGRA 1VZ6A 2PTLA 2KWDA 2QILA 2K0PA 2PW9A 3B2GA 4MACA 2JXTA 3AE7B 1KTKA 3IT4B 3L4PA 3NUHB 1VZ8A 1C78A 1SIJA 4B0MA 2W82A 1F2RC 1SEBD 3E56A 4ZOHC 2K22A 2ON8A 2JZPA 2LHDA 3TUOA 2H88B 1IBXB 1EM7A 2JWUA 2IJ0A 3I9V1 2PVOD 1NYQA 1TS3A 2KACA 5D3DA 1E9MA 3EGRA 3AV8A 1ET9A 5G5GA 4R3DA 2PLPA 4A90A 2W3SA 1ZDXA 5BYSA 1UUPA 1EU3A 5BMHA 2KDMA 2X38A 1WRIA 1TKEA 4AQ7A 3KLSX 3AECB 4MM3B 3AM9A 2AQ1B 2MEKA 3EA6A 1I4PA 4OVZA 2XN9C 5GXGB 3LXFA 3NVZA 2DYOA 1D5XC 1I4QA 4JX1C 2L52A 3BK2A 1DOIA 1FCLA 1L6VA 1IGDA 1XCQL 1JW9D 2WLBA 1PFDA 4JPSA 3AB5A 1JWBD 3PZ8A 3SEBA 3CIRB 3PZ7A 4HJGE 1KF6B 2SAKA 1HZ5A 1NYRA 2XNAC 5AUKA 3W9CB 2DLBA 3BWUD 2MJEA 4NAWB 3NZ3A 3NRZA 2OHFA 3GB1A 1YQ4B 1MVKA 1ZDVA 4RFBA 1OQQA 4YXDB 1YN4A 1H7XA 2GI9A 1XEEA 1SXTA 4Q2JA 3E9SA 1FNWA 2WXMA 1FNVA 3AEAB 4NJCA 4GDLB 4RGMA 2VZKD 2IPKD 2SEBD 2KAJA 3W5UB 4ZRPA 2DBYA 4HKZE 2IGGA 3W5VB 3R8BA 3ZJUA 4RF0A 2WS3B 4C7YA 4JE3B 1KH0A 3W2DA 3P4RB 3Q8CA 2CJOA 1KFYB 1XLNA 2J52A 4RCOA 4YT0B 3ABVB 4YTPB 3IT6B 1V8CA 2NTTA 1C4PA 1SF0A 4RF1A 1RM6C 1BXTA 1CQVA 2M19A 1QOFA 2G1EA 2W54A 1JQ4A 2WXKA 1GPXA 1P7FA 2WXOA 1FM0D 3IXSA 4KGTA 1E6EB 2WNMA 4OHJA 1FXAA 1QOBA 2LHEA 1QOGA 1CJEA 3SFDB 1EU4A 1KRHA 2WDVB 1JWSD 2AQ2B 4KKIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WU5 B;  1ZUD 2;  1WWT A;  1YQ3 B;  1UWM A;  4ITK A;  2B76 B;  1FRR A;  1SIJ A;  1SB3 C;  3BII D;  3DWM A;  1WGK A;  3NS1 A;  3AE4 B;  2DWQ A;  4ZOH C;  4YTM B;  3SFE B;  2K22 A;  2BS4 B;  3AE2 B;  2BS3 B;  1IUE A;  1N63 A;  2K5P A;  4YTN B;  2N0S B;  2FBW B;  3VR9 B;  3CF4 A;  2BS2 B;  1NVI D;  2H88 B;  4LTU A;  2CJN A;  3P4S B;  2PVO D;  4P6V F;  1NYQ A;  3AE8 B;  1XO3 A;  1E9M A;  1YJJ A;  3LB8 C;  3AV8 A;  5G5G A;  3WCQ A;  1N5X A;  3AEG B;  1J7A A;  1GAQ B;  2W3S A;  1AYF A;  4YSX B;  1GTH A;  2QIE B;  2M56 B;  3EUB 2;  1J7C A;  3AE6 B;  1QT9 A;  1DGJ A;  2CU3 A;  1WRI A;  1XLP A;  1TKE A;  5G5H A;  3SR6 A;  1NEK B;  3AEC B;  3AH7 A;  1R7S A;  3AM9 A;  3ZYY X;  4US9 A;  1FMA D;  1ROE A;  5C3J B;  1T3Q A;  2KMM A;  4USA A;  3AE9 B;  2L83 A;  2HTM E;  1WYG A;  3AEB B;  3P4Q B;  3LXF A;  3NVZ A;  3P63 A;  4HRO A;  1N61 A;  4JX1 C;  2K9X A;  2MJD A;  3VRB B;  2L52 A;  1DOI A;  2W3R A;  5AUI A;  2WQY B;  1L6V A;  5EE1 A;  1QF6 A;  1GT8 A;  1FFU A;  1OFF A;  1L6U A;  3AEE B;  1JW9 D;  1PUT A;  1PFD A;  2WLB A;  3ETR A;  4JWS C;  5GXG B;  4YSY B;  1EWY C;  4C7Z A;  3AB5 A;  1L5P A;  3HUI A;  1JWB D;  1E10 A;  3CIR B;  1WXQ A;  1OQR A;  1KF6 B;  1NEN B;  1F0Z A;  1RYJ A;  1NYR A;  2MH7 A;  1ZXI A;  3B2F A;  5AUK A;  3P4P B;  3W9C B;  3AEF B;  4A9A A;  4ZHP A;  2MJE A;  1J7B A;  1RWS A;  2BT6 A;  1VLB A;  2PVG C;  3AN1 A;  1I7H A;  3NRZ A;  3NVV A;  2OHF A;  1YQ4 B;  3DWG C;  1ZOY B;  2MJ3 A;  1JRO A;  1OQQ A;  1B9R A;  1DOX A;  2H89 B;  4YXD B;  3FC4 A;  2ACZ B;  4N58 A;  1H7X A;  1AWD A;  1TKG A;  5EE3 A;  2LEK A;  1RFK A;  2WDQ B;  4ZHO A;  1PDX A;  3PO0 A;  4C80 A;  3KWL A;  2PKO A;  1GTE A;  2PIA A;  1A70 A;  3AEA B;  1FRD A;  1TJE A;  2W55 A;  1N62 A;  3AE1 B;  2Y5C A;  3NVY A;  2E3T A;  4WQM A;  3VRA B;  1YJI A;  5H92 C;  2KAJ A;  3RPF C;  1N5W A;  3W5U B;  1ZP0 B;  1L0V B;  3NVW A;  2QJL A;  2DBY A;  1JWA D;  1E7P B;  1QLB B;  1JRP A;  3HVZ A;  3W5V B;  1E0Z A;  3AE5 B;  3CWI A;  1NI3 A;  2WS3 B;  4KX6 B;  1XLO A;  4C7Y A;  3VR8 B;  1QOA A;  3B9J A;  3HRD D;  3P4R B;  2CJO A;  1FXI A;  5C2T B;  1KFY B;  1XLN A;  1DOY A;  4YT0 B;  3ABV B;  4YTP B;  2EKI A;  1V8C A;  1XLQ A;  3P1M A;  2AX5 A;  1SF0 A;  1RM6 C;  3AED B;  2JX5 A;  1CZP A;  1FIQ A;  2M19 A;  1QOF A;  3FAH A;  2WU2 B;  3AMZ A;  2G1E A;  2W54 A;  4JWU C;  1TYG B;  1H7W A;  1GPX A;  1JQ4 A;  4N59 A;  4US8 A;  1FO4 A;  1FM0 D;  4HRS A;  1JAL A;  2JQR B;  1E6E B;  1V97 A;  4IDI A;  1FXA A;  1VJK A;  4FXC A;  1QOB A;  5MPO A;  1QOG A;  1CJE A;  1N60 A;  2WDR B;  2Q5W D;  4N6E B;  3SFD B;  4WWM A;  5EE0 A;  1FFV A;  4YSZ B;  1KRH A;  3B2G A;  1VDV A;  3AE7 B;  5EE9 A;  2WDV B;  1TKY A;  2WP9 B;  5H8Y E;  3AE3 B;  3L4P A; 
#chains in the Genus database with same CATH topology
 2MCN B;  3L13 A;  3U52 E;  1I4H A;  1SB3 C;  2C7N B;  2NVU I;  2ZPY A;  1N63 A;  1TY0 A;  2N0S B;  3Q8A A;  4FJV B;  3QAQ A;  1SGH A;  3ZVV A;  3A4R A;  3JVZ X;  1AW7 A;  1HE8 A;  1N5X A;  1V1P A;  1TZO A;  2WXJ A;  3QCA A;  1L2N A;  2ZJD A;  5G5H A;  2MBQ A;  3EEC A;  3Q69 A;  2N7D A;  1FMA D;  2MLB A;  4K7W A;  3R2T A;  2O2V B;  2V9H A;  1N61 A;  2K6Q A;  2L00 B;  2IO1 B;  4RNA A;  2WXN A;  1S1Q B;  4WJO A;  1F77 A;  4ZHP A;  3IAS 1;  2N9K A;  3DBH B;  2DZM A;  3RUL A;  5HHD G;  4WJQ A;  2RPQ A;  1VCB A;  2FIF A;  1V80 A;  3N30 A;  3PHX B;  3DHG C;  3KWL A;  1KLG D;  1I4G A;  2D3C A;  2Y5C A;  3ML9 A;  3KWV A;  3U4E G;  1STE A;  3RPF C;  2WXQ A;  2O6V B;  3NVW A;  2RMM A;  2R61 A;  4AOF A;  3PHW B;  1JRP A;  2MBH A;  3VR8 B;  2PE6 B;  3B9J A;  3V62 A;  4IG7 B;  3R2I A;  4EKU A;  2CHZ A;  4G3X B;  2JX5 A;  5E6O A;  2LGD A;  4WAF A;  3KW5 B;  3K9P B;  4F1S A;  4US8 A;  1BML C;  1V97 A;  1V6E A;  1LQB A;  2N9L A;  1T5X D;  3SU8 X;  1YMH E;  2KLC A;  5IO9 A;  1P1A A;  4YSZ B;  4GB9 A;  5EE9 A;  2MBO A;  1ZUD 2;  2ZZP B;  3AUL A;  1L4Z B;  2R2O A;  3LYY A;  5FK9 C;  2YVC A;  1KOT A;  1PGA A;  4YTN B;  2FE8 A;  3DHH C;  4MEM A;  3CF4 A;  3QX1 A;  4B9K A;  1WGH A;  5JHB A;  1X1M A;  1WFY A;  3UQA A;  1P7E A;  3J9C A;  3RN9 C;  2D10 A;  4HXD A;  3AEG B;  2GBJ A;  1GAQ B;  3L0W B;  4M8M A;  1XXG A;  1QT9 A;  1WGD A;  3KYD D;  1QKZ A;  4G11 A;  4RM9 A;  3T3O A;  5C3J B;  2M4N A;  1V81 A;  4HRO A;  2K9X A;  4ANW A;  4W9I A;  5C23 A;  2KZR A;  4UDU C;  1E5W A;  1L6U A;  3VTU A;  1EF5 A;  4ANV A;  3HUI A;  4MGZ E;  3L10 B;  3OG5 A;  2IY0 B;  1ZXI A;  3GE8 C;  3GZN I;  4TQ0 A;  3TEX A;  1ZE3 D;  5AEK B;  3DWG C;  2LMC A;  2VH1 A;  5BMG A;  5DPW A;  1AWD A;  2LEK A;  1Z5S B;  3H8H A;  4ZHO A;  2YEP B;  2ZEQ A;  1TJE A;  2LRU A;  4FHK A;  3FIL A;  2E3T A;  5HFY A;  1EUV B;  5J17 A;  4TSS A;  4II2 B;  1TTN A;  4HJK A;  4S17 A;  3Q8B A;  2MA9 B;  1EO6 A;  2KX3 A;  2JYE A;  1DOY A;  3QK0 A;  1XLQ A;  2L7R A;  4HCP B;  3ZNI D;  1Y56 A;  2WU2 B;  1T0Q C;  4BBN C;  4BKS D;  4F8C B;  4BOS C;  3LJ3 A;  2DZJ A;  4H2A A;  4AS1 A;  2BYV E;  1TKY A;  1NI2 A;  2WU5 B;  2IO0 B;  5IKC M;  2GB1 A;  2BYF A;  1L0Y B;  1P9D U;  1WGY A;  1FD6 A;  2HE7 A;  3PS6 A;  2N9X A;  1WMH A;  2BKR B;  2KDE B;  1ET6 A;  3BYT B;  2FCN A;  5I4D A;  1M4V A;  2JXX A;  2NPT A;  2EMS A;  4TKN A;  1JCK B;  2M56 B;  3EUB 2;  1J7C A;  3ZNZ B;  4P16 A;  1DGJ A;  2G9H D;  1GNU A;  4GDK B;  2ZCC A;  2MBE A;  4IW0 A;  1QQR A;  4DQO C;  5BYR A;  1WJN A;  2L32 A;  4GDK A;  2I2Y A;  1K51 A;  4OVU A;  2WQY B;  4GOC A;  1QF6 A;  1EF1 A;  4C7Z A;  3AI5 A;  4W9D A;  1XF5 L;  2INC C;  3C0R B;  3B2F A;  3WAO A;  4HDQ A;  3JSV B;  4L1B A;  1C77 A;  3PTF C;  4KGS A;  1DOX A;  4N58 A;  2EEL A;  1PDX A;  4A6Q A;  1UNS A;  2KWC A;  2KVZ A;  2AWT A;  1FRD A;  2W55 A;  3AE1 B;  4JL9 A;  1RLF A;  3H6N A;  4A3P A;  2KQ4 X;  1C79 A;  2KD0 A;  5HI1 A;  1RAX A;  1RFA A;  5L95 C;  3V61 A;  2WX0 A;  4DXA B;  3KQ4 A;  4MH0 E;  3ZW3 A;  4KIK B;  3UGB B;  1H7W A;  2Z59 B;  1K53 A;  1CK1 A;  1GB1 A;  1VZ6 A;  2KWD A;  2QIL A;  3ZKJ C;  4K7U A;  2K0P A;  1XT9 B;  2PW9 A;  3IT4 B;  1WM2 A;  4J6I A;  3PZD A;  3DVG X;  3SHQ A;  4BKS A;  2H88 B;  2D3B A;  2K6D B;  1WJ6 A;  1E7V A;  5DCN A;  1E9M A;  1ZDX A;  5BYS A;  5BMH A;  2KQS A;  1WXS A;  3LXF A;  1FCL A;  2BWF A;  2JWZ A;  2WLB A;  1PFD A;  2ZNV C;  1JWB D;  3DCG A;  3ZRF A;  3CIR B;  2SAK A;  4XYC A;  1NYR A;  1YOV B;  4EZJ A;  2RDB C;  1V9J A;  2MJE A;  4NAW B;  3NRZ A;  1ZDV A;  4URK A;  3ZLZ A;  3R3M A;  4XZ4 A;  4YXD B;  3ZTC A;  2GI9 A;  2G4D B;  4PYU A;  3B0A A;  4G50 A;  4W9F A;  5JHA A;  2VZK D;  3V6C B;  2KWU B;  3RNE C;  1R4N B;  2HTH A;  4PS7 A;  2JZ3 B;  3P4R B;  4NJ7 A;  3Q14 C;  1XLN A;  2J52 A;  4RCO A;  4YT0 B;  5GMV A;  4YTP B;  1C4P A;  4JQW C;  4LCD E;  1JQ4 A;  2WXK A;  3ALB A;  1P7F A;  3IXS A;  1Z2M A;  2WNM A;  4OHJ A;  3CF6 E;  1FXA A;  3HM3 A;  1UF0 A;  3VVW B;  4DDI D;  4I6P A;  3ONS A;  1WI0 A;  3BVZ A;  1XCT L;  3SFE B;  2LJI A;  3K9O B;  4BZA A;  1WX9 A;  3VR9 B;  2L0F A;  5E6P A;  1NVI D;  2BYT A;  3ZQ4 A;  5J18 A;  3GP7 A;  3P42 A;  2CJN A;  3NS8 A;  1KJT A;  4M01 A;  2KFK B;  2QCZ A;  3LB8 C;  2M0X A;  1T0R C;  1PGB A;  4GXB A;  2KFK A;  1WXA A;  4YSX B;  5IAA C;  2J0K A;  4W9E A;  1C4A A;  1OEY J;  2K8B A;  4JLC A;  4XDD A;  1DYQ A;  1ESF A;  3AE9 B;  2LGI A;  4REZ A;  4W9H A;  3VXW A;  4KVG B;  3VRB B;  2AYO B;  3BK1 A;  5EE1 A;  4AUQ C;  2MHJ A;  4BOZ B;  1E10 A;  2ZVN A;  2FID A;  2MH7 A;  1ZPS A;  1OQY A;  2PVG C;  2KDI A;  3ML8 A;  3H7P B;  1JRO A;  2M8S A;  2B3A A;  1YX6 B;  2C5L C;  3FKY A;  1TKG A;  3PO0 A;  3WAN A;  2PIA A;  4OVV A;  3HVD A;  3T8M A;  4XWW A;  1RRB A;  1JRU A;  1E0Z A;  3DBS A;  4GU2 A;  3A9K A;  5KHO A;  3WAP A;  1QOA A;  1WF9 A;  2RDG A;  3V3X A;  1V1P B;  3VUX A;  2YLM A;  4NQK E;  1IGC A;  4LNF A;  2N7J A;  3AED B;  2KLG A;  2KFJ A;  3AMZ A;  3MFG A;  3VDZ A;  4OZB A;  5LXH A;  5MPO A;  4B95 A;  3I3T B;  4PT5 A;  4RH6 A;  2V0G A;  1FFV A;  4MJS A;  5JH5 C;  1R4M I;  1SE9 A;  2INN E;  5BYQ A;  3D32 A;  4WWP A;  1SJE D;  2UYZ B;  3IHP C;  1WRD B;  4NY0 A;  4YTM B;  3ZO5 B;  1A5R A;  4HPL B;  4L2Y A;  3TJP A;  4MEL A;  2NBU A;  2JRI B;  5AZH A;  3W1Y A;  3DPD A;  2DAJ A;  1FCC C;  5D6J B;  2KJR A;  2PJH A;  1YJJ A;  2N7E A;  2NBV B;  4EOY A;  2YEP F;  1WE6 A;  1HEZ E;  3TEY A;  2DX5 B;  3RNC C;  1V1O A;  2JU6 X;  1ROE A;  5HKH A;  2QHO A;  3N3K B;  3A9J A;  4HDO A;  1CMX B;  2UU7 A;  3ZJV A;  2BTE A;  4MSM B;  3VFK A;  1ENF A;  2BKF A;  1PUT A;  1H4R A;  1R4M B;  3I57 A;  3CMM B;  1GJZ A;  2L0T A;  4XDC A;  1J7B A;  1PQS A;  4PS8 A;  3OJ3 A;  1PYW D;  4FJZ A;  5BO4 B;  2MJ3 A;  3RMK C;  3UIP B;  3QC8 B;  1UEL A;  1WJU A;  2HD5 B;  5CX3 A;  4CQN A;  4WQM A;  3VRA B;  5LNK 1;  4C56 C;  1JWA D;  1YJ1 A;  5EDS A;  1WZ0 A;  2LD9 A;  1R4N I;  2KVR A;  4ASW C;  3AXC A;  3P1M A;  2HJ8 A;  1C9F A;  1G6J A;  1HTQ A;  2MSE D;  3A4S C;  3L08 A;  4N59 A;  2JRH A;  3A1Q B;  4WQO B;  2AQ3 B;  4AWJ A;  4A55 A;  4IDI A;  4EFO A;  1HTO A;  3EFC A;  3AE3 B;  4G0N B;  1WWT A;  1YQ3 B;  4DWF A;  1H8C A;  1MG4 A;  4IWQ A;  1E8Y A;  2K39 A;  4E74 A;  4ICV A;  1L0X B;  1WJ4 A;  1QIL A;  3Q8E A;  4MT5 A;  3UQB A;  4I6N B;  3MHZ A;  3ZGZ A;  1C4C A;  3JYU A;  1NDD A;  4IOI E;  1IYF A;  1E7U A;  2D5G A;  3W1S C;  3ZNG C;  3M62 B;  2WWZ A;  1GTH A;  4OZC A;  1V2Y A;  1IPG A;  3AE6 B;  3L54 A;  2ICI A;  2I1K A;  2Z0D B;  1NEK B;  2KDB A;  4RGO S;  4XC2 A;  2M0A A;  2G45 B;  4USA A;  1I42 A;  2HTM E;  3AEB B;  1I4R A;  4HK2 A;  4S0R A;  1OFF A;  1B1Z A;  2IDY A;  2HJ1 A;  3DBL B;  1OQR A;  1NBF C;  3EC8 A;  5BMI A;  2NTS A;  1BT0 A;  4RGN A;  1SSN A;  1VLB A;  3L16 A;  1K52 A;  1EWC A;  4KZC A;  3FC4 A;  2CHX A;  2PKO A;  1GTE A;  3RT3 B;  1I35 A;  2Y5B B;  1GC7 A;  2WGS A;  4DXF A;  1WIA A;  1ZW7 A;  3BVG A;  2ZCB A;  2ONQ A;  5J2R A;  3DQV A;  1NI3 A;  3PT2 B;  3ZNH B;  1JML A;  2BBC A;  2JYT A;  4OW0 A;  5C2T B;  4QAY A;  2C60 A;  1XD3 B;  3PLU A;  1FPY A;  4IWO A;  2LGS A;  2M17 A;  1MG8 A;  3FAH A;  2QEJ C;  3BYY B;  3VQI A;  3V6E B;  4KGR A;  2PTL A;  3PRZ A;  3A9K B;  3NZU A;  4KV2 A;  4NQL B;  3B2G A;  4MAC A;  2MX2 A;  3SD5 A;  3RNB C;  1VZ8 A;  3E56 A;  1SEB D;  4B6W A;  2KTF A;  2ON8 A;  2JZP A;  1IBX B;  1EM7 A;  2JWU A;  1TS3 A;  3EGR A;  1LGR A;  1WYW B;  1ET9 A;  5G5G A;  2PLP A;  2KT7 A;  5CTR C;  1EU3 A;  2X38 A;  3QHT A;  3AM9 A;  3Q3F A;  1P0R A;  3EA6 A;  4OVZ A;  5GXG B;  2DYO A;  2L52 A;  3R66 C;  3HHM A;  5AZG A;  1XCQ L;  4PYZ A;  1JW9 D;  3LDZ E;  4LNI A;  1VD2 A;  3Q3N C;  1HZ5 A;  2JVC A;  2XNA C;  5AUK A;  3I63 C;  3GE3 C;  4DHJ D;  3NZ3 A;  3GB1 A;  1LXD A;  4RFB A;  1YN4 A;  4KDI C;  4Q2J A;  1FNW A;  2IO3 B;  3ZUN A;  4DK5 A;  2IPK D;  2SEB D;  3CSF A;  2IY1 B;  3ZJU A;  4RF0 A;  2K8C A;  4JE3 B;  3Q8C A;  1KFY B;  3Q3J A;  3IT6 B;  2NTT A;  2GBN A;  1SF0 A;  4WJP A;  4RF1 A;  4HPM B;  2M19 A;  1QOF A;  2CKH B;  2GBR A;  2G1E A;  2MQJ A;  2A4Z A;  2LVO A;  5AZF A;  1QOB A;  1CJE A;  1TIF A;  1GG3 A;  2MWS B;  3SFD B;  2GBM A;  4C4V B;  4KKI A;  3NY5 A;  3Q3O C;  1UWM A;  2G4S A;  3U8Z A;  3BII D;  3NS1 A;  2BS4 B;  1WXV A;  2LZ6 A;  4E3C A;  3Q3M C;  3WAM A;  4GGQ A;  1UZX B;  2QMT A;  4FA6 A;  2DEN B;  4LNO A;  5E6J A;  3U7D A;  2WXG A;  1AYF A;  4LDT D;  3DVN V;  2RD0 A;  3I5J C;  1TT5 B;  1D5Z C;  1C1Y B;  1K50 A;  2D3A A;  3SR6 A;  5JZE B;  2KKC A;  3AH7 A;  2KOX A;  3ZYY X;  3L17 A;  2KJ6 A;  3SDL C;  1TS4 A;  1BUI C;  1WY8 A;  3P63 A;  1HXY D;  4M02 A;  4MGY E;  2V3S A;  1TS2 A;  2DYM A;  3GOE A;  3TMP B;  3EFU A;  4A8X C;  1WXQ A;  4M00 A;  1NEN B;  1RYJ A;  4IC7 B;  4BAX A;  3NVV A;  2WXH A;  3T9L A;  2IGD A;  1ZOY B;  2WHI A;  2JZZ A;  3VUY A;  5TSS A;  2ZNV B;  2WDQ B;  2D2Q A;  2L3Z A;  4W9L A;  1GOZ A;  2C9W B;  2N9P C;  3NVY A;  3U7Z A;  4WH4 A;  2BB6 A;  4ARI A;  3N9Y C;  4KX6 B;  5FR6 A;  1IP9 A;  3BZD B;  4LK0 M;  1FEH A;  4MGI E;  2J0J A;  1LM8 B;  2BGF A;  3WA0 A;  3GS2 A;  1Q0W B;  3TCA A;  4GSW A;  3V05 A;  4YWG G;  3R7R A;  3TEW A;  1VJK A;  4GIV A;  3URY A;  4A3O A;  1N60 A;  3VUW A;  2Q5W D;  2MW5 A;  3BY4 B;  3MP9 A;  4LNN A;  4NZL B;  4ITK A;  2L8J A;  2FNJ B;  1S3S G;  4IM3 A;  5H8Y E;  4EZK A;  1T0S C;  2O6V A;  2LVQ A;  4LNK A;  2C7M B;  3RYT A;  3GZN B;  3O65 B;  1XQQ A;  2BWE S;  3RNG C;  3MJ5 A;  3TSS A;  3UF8 A;  2WX1 A;  2KK8 A;  3DBL I;  2BVC A;  1OEY A;  2BF8 B;  5D94 A;  1T3Q A;  2KMM A;  2FUG 1;  2E6X A;  2ZW0 A;  3A1Q A;  1PGX A;  1GT8 A;  4KIK A;  2XEW A;  1V86 A;  4X57 B;  4ANX A;  1ZGU B;  1F0Z A;  2W9N A;  3P4P B;  1F2R I;  5L83 A;  1HQR D;  1V5T A;  2N1W A;  4M8N A;  4LLG M;  1Y8R C;  1UGJ A;  3APF A;  1RFK A;  4BVU C;  3DOW A;  4C80 A;  1U4A A;  4K1R B;  5T8I A;  2HDE A;  2OED A;  4NAM A;  5JXV A;  1UBQ A;  4K3B A;  2CR5 A;  3ZJT A;  3HRD D;  2CS4 A;  1D4B A;  2I1J A;  1P98 A;  3M63 B;  1KM7 A;  4WWO A;  4FN2 A;  2GRI A;  3KUZ A;  1FIQ A;  3QJZ A;  5DPT A;  2LGY A;  4K7S A;  3U2S C;  3TBL D;  5G2N A;  4GLS C;  2A5U A;  3MC0 B;  2Y5P A;  4N6E B;  1AAR A;  2D3G A;  1J0G A;  4TMA B;  5G55 A;  2PMV A;  1WGG A;  1J19 A;  2QC8 A;  5D7G A;  3RNA C;  1WGK A;  3AE4 B;  3APC A;  2V3P A;  3AE2 B;  2BS3 B;  2LWP A;  2EKE C;  1SE4 A;  2JT4 B;  1L4D B;  4WJN A;  4EE2 A;  4ZRI A;  4KSL C;  1UWX A;  2Z8L A;  1HZ6 A;  2KNB A;  1D6E C;  4WIP A;  1YX5 B;  1J7A A;  1WX7 A;  2ZPN A;  3ZXR A;  3H7S A;  4JIO U;  2XK5 B;  2K8H A;  4XWT A;  4DBG A;  2L83 A;  1E8Z A;  2KMA A;  2LGX A;  2MJD A;  1YQB A;  1FFU A;  2J7Q B;  4YSY B;  1L5P A;  2V4L A;  3KH0 A;  3QWZ B;  4A9A A;  1ISN A;  3AEF B;  3KVF B;  2XK5 A;  3NZS A;  3DBH I;  3BIN A;  1SBB B;  2JY6 A;  1WX8 A;  3UIO B;  4ZDV A;  4CO7 A;  3MC9 A;  4DHZ E;  4HLE A;  1IBX A;  1N62 A;  1WR1 A;  1C76 A;  1YJI A;  4GN1 A;  5H92 C;  1SE2 A;  1TZ1 A;  5CHV C;  5LLI A;  1ZP0 B;  2LRW A;  5E6N A;  4A20 A;  2IO2 B;  2IZV B;  1KLU D;  2V1Y A;  3Q8F A;  2G3Q B;  1T0Y A;  4F7Z A;  3MC8 A;  1F9J A;  4OZA A;  3H9D A;  2JSV X;  3AU4 A;  1D5M C;  2DZK A;  1WSP A;  4KKJ A;  2FCQ A;  3T3N A;  1TYG B;  3OWE B;  2RDH A;  2BB5 A;  2VRR B;  1JAL A;  2JQR B;  3P2B A;  2JF5 A;  2RR9 A;  4MDK E;  2LXA A;  3AE7 B;  3N1Z C;  3PRP B;  3NUH B;  2MP2 B;  1SIJ A;  1F2R C;  3DVN U;  2K22 A;  4XX5 A;  2LHD A;  4EZL A;  3N1X C;  5IA7 A;  2PVO D;  2JUO A;  2KAC A;  5D3D A;  2LJ5 A;  3ZIM A;  4EEW A;  2MRP A;  4W9C A;  2W3S A;  3VHT C;  3KYC D;  1GUA B;  1UUP A;  4GDL A;  3PRM B;  1K8R B;  1TGZ B;  2KDM A;  1TKE A;  4IM0 A;  3AEC B;  4MM3 B;  4N9F 4;  2QDF A;  2MEK A;  4K3C A;  3NVZ A;  1M94 A;  1I4Q A;  3NHE B;  3BK2 A;  3RUI B;  3S2A A;  1L6V A;  3Q6B A;  3QIJ A;  4JPS A;  3AB5 A;  4W9G A;  3PZ7 A;  3RI7 C;  1E8W A;  1KF6 B;  4HJG E;  3ZRC A;  3JW0 X;  3BWU D;  1OGW A;  4MGK E;  2OHF A;  4FJY A;  2AL6 A;  2WYQ A;  1SXT A;  2WXM A;  1FNV A;  3QA8 A;  4MSQ B;  4NJC A;  4RGM A;  3QAR A;  2DBY A;  3IFW B;  4HKZ E;  3R8B A;  4DDG D;  2LXC A;  2N4F A;  2WS3 B;  2PEA A;  4C7Y A;  1UGM A;  4BKT A;  3W2D A;  2CJO A;  3OAW A;  2KHW B;  1TBE A;  3ABV B;  1V8C A;  5TR5 A;  1YIW A;  4FHJ A;  3IVF A;  4FUL A;  1BXT A;  3DBR B;  2DYB A;  2W54 A;  3MTN B;  3HM6 X;  2WXO A;  1FM0 D;  4KGT A;  1L7Y A;  2N9E B;  2LHE A;  4ZRK A;  1UBI A;  1KRH A;  1JWS D;  2ASQ A;  2LUE A;  4AJW A;  2DWQ A;  1SIF A;  2K5P A;  4IUM B;  1I4X A;  2UWQ A;  1AN8 A;  3OLM D;  4WUR A;  3AE8 B;  2EMT A;  1MFW A;  5DPS A;  3WCQ A;  1GB4 A;  1SJH D;  1LO5 D;  2PE9 A;  2KC1 A;  2QIE B;  2L05 A;  4W9K A;  2LI5 A;  2NPT B;  4WWN A;  4US9 A;  4FAD A;  1UD7 A;  2KWV B;  3PVL A;  4FLH A;  1GC6 A;  1WZ3 A;  1LFD A;  3PRE A;  3ECI A;  2DAF A;  3ETR A;  1EWY C;  4YL8 A;  4B0E A;  2GBK A;  2WXF A;  5FKA C;  4L23 A;  4TV3 A;  1YN5 A;  1QZE A;  1YN3 A;  2WDT B;  2WXI A;  2KAN A;  2MBB B;  3IG3 A;  2Y3A A;  1B9R A;  2H89 B;  2V3N A;  2ACZ B;  5EE3 A;  2J42 A;  2VH2 A;  1J8C A;  1Q10 A;  3HK0 A;  3X23 A;  3TIX A;  3MJW A;  2FUH B;  4K81 A;  1N5W A;  4P1C C;  4W9J A;  3UI3 A;  2QJL A;  1E7P B;  2K3U A;  1XLO A;  2WXL A;  3DHI C;  4NAW A;  2INP E;  2J4X A;  2AX5 A;  2D11 A;  4RM8 A;  2L1A A;  2I38 A;  4LJP B;  4ZYN A;  2TSS A;  2KX0 A;  1FO4 A;  1HA5 A;  3KUD B;  2OJW A;  4ZRJ A;  2LFI A;  4C00 A;  1MHX A;  4WWM A;  2VZK B;  2NMQ A;  1VDV A;  2IND C;  2J0M A;  2WP9 B;  2ZW1 A;  2NBW B;  2RSU A;  3WIM A;  2B76 B;  3DWM A;  3C8Y A;  3OJ4 B;  1F52 A;  2FBW B;  1D3Z A;  3W1S A;  1JWM D;  4LTU A;  1YD8 U;  1KLV A;  4M0W B;  1MI0 A;  4P6V F;  2QSD A;  4J3O D;  2KXJ A;  3M95 A;  2BQQ A;  4HWI B;  5DPR A;  3TEZ A;  4CHK A;  2J53 A;  3VAW A;  2CU3 A;  2PPH A;  1WM3 A;  1XLP A;  3TL5 A;  3H1U A;  2LUM A;  1WYG A;  1Q5W B;  5AUI A;  1VR9 A;  2KMC A;  1P3Q U;  3DDC B;  1WR6 E;  2IGH A;  1VZ7 A;  3EHV A;  4HEA 1;  1V5O A;  3IBE A;  4ANU A;  3KUC B;  1E8X A;  2DZI A;  3V60 A;  3PPA A;  2GOW A;  3MHS D;  4TUU A;  4PK1 A;  1YNT E;  5HG2 A;  3M3J A;  4WAA A;  5D3I B;  3O13 A;  1L0V B;  1VRA B;  3HVZ A;  1QLB B;  4MM3 A;  3AE5 B;  3U30 A;  4DHJ B;  2MP2 A;  3IAM 1;  4HCN B;  5FR3 A;  4BFR A;  4HKQ A;  4ZYS A;  1FXI A;  3X0W A;  2AL3 A;  4E71 A;  4HPP A;  2BPS A;  2NR2 A;  2L76 A;  2WXR A;  3B1L X;  4JWU C;  1E90 A;  4IM2 A;  4HRS A;  3RNF C;  4O1N A;  4FXC A;  2KTR B;  2NS5 A;  2WDR B;  4P1B C;  3DVG Y;  2CU1 A;  2K1F A;  3AU5 A;  1MPE A;  3N20 C;  5EE0 A;  1ACC A;  3HIZ A;  4EUT A;  2JPH A;  4IKG A;  2KQ7 A;  1FRR A;  2FAZ A;  4HVB A;  4II3 B;  1T6B X;  2KN5 A;  2NCN A;  3Q2A C;  1IUE A;  1TY2 A;  2BS2 B;  2LVP A;  3BVM A;  3P4S B;  1XO3 A;  2V4I B;  4D2K A;  1SE3 A;  2REX A;  3APD A;  2KDF B;  3NG0 A;  4NJ6 A;  1ZXH A;  1Q1O A;  4MH8 A;  3VH3 B;  4AJY B;  4ARC A;  1WGR A;  3CST A;  4ZRQ A;  2WXP A;  2X8X X;  3C19 A;  2ZVO A;  3VH4 B;  1R7S A;  5CHW A;  4DHZ B;  1FNU A;  3P4Q B;  2AEH A;  3FIL B;  4FBJ B;  2W3R A;  4XE0 A;  3AEE B;  2KN4 A;  4JWS C;  4AP4 C;  3A33 B;  4CYE A;  2KYW A;  5IN7 A;  3QQ8 B;  2KTR A;  3NOB A;  4M0W A;  1RWS A;  2BT6 A;  3AN1 A;  4RMA A;  1I7H A;  2LAS A;  3RFZ B;  3PLV A;  2BYE A;  1ZKH A;  1JWU D;  2DNF A;  1WH3 A;  4TQ1 A;  4IWP A;  1A70 A;  1F1H A;  3A9J B;  1TS5 A;  2C7H A;  4LJO B;  4RGT A;  3CWI A;  1MHH E;  2N1V A;  2Z0E B;  2IYD B;  2EKI A;  4DXG A;  1V49 A;  4GMV A;  3ZDT A;  4I6L B;  1CZP A;  2BW2 A;  2RPV A;  2D07 B;  3ZDM C;  5IP4 D;  2R2Q A;  2O6V D;  3RD2 A;  3R7Q A;  3ZTD A;  2CHW A;  4P7I A;  2JXT A;  1KTK A;  1WE7 A;  3JSV A;  3L4P A;  4MJS B;  1C78 A;  4B0M A;  3PGE A;  2W82 A;  4ZOH C;  5LXI B;  1FXT B;  3WAL A;  3H7P A;  3TUO A;  3NJT A;  5IOI A;  2IJ0 A;  3I9V 1;  4PS3 A;  2DHZ A;  1NYQ A;  3AV8 A;  4R3D A;  4NNJ B;  4A90 A;  4NPN A;  3PV1 A;  2FCM A;  2KO3 A;  1OTR B;  4KSK C;  2K25 A;  3VTV A;  1WRI A;  4AQ7 A;  3KLS X;  2AQ1 B;  4JGH B;  2GLS A;  1I4P A;  4ICU A;  2XN9 C;  1D5X C;  4JX1 C;  1DOI A;  4BBN F;  3RCZ A;  1IGD A;  1WMH B;  3PZ8 A;  5D2M B;  3SEB A;  3W9C B;  4KDL B;  2DLB A;  3UIN B;  3VTW A;  1N6Z A;  2FCS A;  2OOB B;  1YQ4 B;  1MVK A;  3B08 A;  2O2V A;  1OQQ A;  4LDT B;  1H7X A;  1XEE A;  3E9S A;  2IBI B;  1UH6 A;  2GMI C;  2KC2 A;  3AEA B;  4GDL B;  5C1Z A;  2KAJ A;  3W5U B;  4XGA B;  2M1M A;  4BKG A;  4ZRP A;  2IGG A;  2KJH B;  3W5V B;  3ZXV A;  1KH0 A;  4ACF A;  1C3T A;  3ENE A;  2RGF A;  3PSE B;  5CHF A;  1RM6 C;  3DBR I;  4KZ0 A;  1WXM A;  1CQV A;  1GPX A;  4C4V A;  1E6E B;  3RZF A;  1QOG A;  3N32 A;  3RZW C;  1EU4 A;  2XBB C;  5KHQ A;  3N1Y C;  2OJR A;  2WDV B;  1MJD A;  2AQ2 B; 
#chains in the Genus database with same CATH homology
 3U52 E;  1UWM A;  3BVZ A;  1I4H A;  1XCT L;  1SB3 C;  3BII D;  3NS1 A;  2DWQ A;  3SFE B;  2LJI A;  2BS4 B;  1N63 A;  1TY0 A;  2K5P A;  2N0S B;  3Q8A A;  1I4X A;  3VR9 B;  1AN8 A;  1NVI D;  2QMT A;  3ZQ4 A;  2BYT A;  3GP7 A;  3P42 A;  2CJN A;  4WUR A;  3AE8 B;  5E6J A;  3LB8 C;  1AW7 A;  3WCQ A;  1GB4 A;  1N5X A;  1PGB A;  1LO5 D;  1SJH D;  1V1P A;  2WXG A;  1AYF A;  4YSX B;  1TZO A;  2WXJ A;  2QIE B;  1D5Z C;  1C4A A;  1K50 A;  5G5H A;  3SR6 A;  3AH7 A;  3Q69 A;  3ZYY X;  4US9 A;  1FMA D;  4XDD A;  1DYQ A;  1ESF A;  3AE9 B;  1TS4 A;  1BUI C;  2LGI A;  3P63 A;  3R2T A;  4REZ A;  1HXY D;  1N61 A;  3VRB B;  3BK1 A;  5EE1 A;  1TS2 A;  2DYM A;  4RNA A;  2WXN A;  3ETR A;  1EWY C;  1E10 A;  4A8X C;  1F77 A;  1WXQ A;  4B0E A;  1NEN B;  2WXF A;  5FKA C;  1RYJ A;  2MH7 A;  4ZHP A;  3IAS 1;  1ZPS A;  2N9K A;  4L23 A;  1YN5 A;  2PVG C;  1YN3 A;  5HHD G;  3NVV A;  2WXI A;  2WXH A;  2IGD A;  1ZOY B;  2Y3A A;  1JRO A;  1B9R A;  2H89 B;  2V3N A;  2ACZ B;  5EE3 A;  2J42 A;  1TKG A;  5TSS A;  2WDQ B;  3PO0 A;  1Q10 A;  3KWL A;  1GOZ A;  1KLG D;  2PIA A;  1I4G A;  3HVD A;  4XWW A;  2Y5C A;  3NVY A;  3U7Z A;  3KWV A;  4WH4 A;  3U4E G;  2BB6 A;  1STE A;  1N5W A;  3RPF C;  2WXQ A;  3NVW A;  2RMM A;  2R61 A;  3UI3 A;  2QJL A;  1E0Z A;  1E7P B;  2K3U A;  1JRP A;  4ARI A;  1XLO A;  4KX6 B;  3N9Y C;  3VR8 B;  1QOA A;  3B9J A;  3BZD B;  4LK0 M;  2WXL A;  2RDG A;  3R2I A;  1FEH A;  3V3X A;  2INP E;  2J4X A;  1V1P B;  1IGC A;  2AX5 A;  3GS2 A;  2N7J A;  2L1A A;  2I38 A;  3AED B;  2JX5 A;  2TSS A;  4WAF A;  3AMZ A;  3MFG A;  3V05 A;  4US8 A;  1BML C;  1HA5 A;  4YWG G;  1FO4 A;  3TEW A;  1V97 A;  4OZB A;  2LFI A;  1VJK A;  5MPO A;  3URY A;  1MHX A;  2N9L A;  1N60 A;  2Q5W D;  1T5X D;  3MP9 A;  1YMH E;  4PT5 A;  2VZK B;  2NMQ A;  4RH6 A;  4WWM A;  1FFV A;  2V0G A;  4YSZ B;  1VDV A;  5EE9 A;  2ZW1 A;  2WP9 B;  4NZL B;  1ZUD 2;  2INN E;  5BYQ A;  4ITK A;  1L4Z B;  3LYY A;  2B76 B;  1SJE D;  3DWM A;  5H8Y E;  3C8Y A;  4YTM B;  5FK9 C;  4L2Y A;  1PGA A;  4YTN B;  2FE8 A;  2FBW B;  3W1S A;  3CF4 A;  1JWM D;  4LTU A;  1FCC C;  1MI0 A;  4P6V F;  1YJJ A;  1P7E A;  2QSD A;  3J9C A;  4J3O D;  3MJ5 A;  3AEG B;  3TSS A;  1GAQ B;  3TEZ A;  2YEP F;  1XXG A;  2J53 A;  1QT9 A;  2CU3 A;  1HEZ E;  1QKZ A;  1XLP A;  3TEY A;  3T3O A;  1V1O A;  2JU6 X;  1ROE A;  2LUM A;  5C3J B;  1T3Q A;  2KMM A;  2FUG 1;  2E6X A;  1WYG A;  2ZW0 A;  4HRO A;  2K9X A;  5AUI A;  1PGX A;  1VR9 A;  3ZJV A;  1GT8 A;  4UDU C;  2BTE A;  1ENF A;  1L6U A;  1PUT A;  3I57 A;  3HUI A;  2IGH A;  1VZ7 A;  4HEA 1;  1F0Z A;  1ZXI A;  3P4P B;  4XDC A;  1F2R I;  4TQ0 A;  1J7B A;  1HQR D;  3TEX A;  1ZE3 D;  1PYW D;  3DWG C;  2LMC A;  2MJ3 A;  4LLG M;  5BMG A;  1AWD A;  2LEK A;  1UGJ A;  1RFK A;  3H8H A;  4ZHO A;  4C80 A;  5T8I A;  1YNT E;  2HDE A;  2OED A;  2YEP B;  1TJE A;  5HG2 A;  4NAM A;  5JXV A;  4CQN A;  5D3I B;  3FIL A;  2E3T A;  4WQM A;  3VRA B;  3O13 A;  5HFY A;  5LNK 1;  1L0V B;  1VRA B;  4TSS A;  3ZJT A;  3HVZ A;  1JWA D;  1QLB B;  4C56 C;  3AE5 B;  3IAM 1;  3Q8B A;  3HRD D;  5FR3 A;  4HKQ A;  1D4B A;  2JYE A;  4ZYS A;  1FXI A;  1DOY A;  3P1M A;  1XLQ A;  2WXR A;  2GRI A;  1C9F A;  1FIQ A;  1Y56 A;  2WU2 B;  3U2S C;  4JWU C;  4N59 A;  4GLS C;  2AQ3 B;  4HRS A;  4A55 A;  4IDI A;  3MC0 B;  4O1N A;  4FXC A;  2Y5P A;  2WDR B;  4N6E B;  4H2A A;  5EE0 A;  1MPE A;  1ACC A;  4AS1 A;  1TKY A;  4TMA B;  3AE3 B;  2PMV A;  2WU5 B;  1WWT A;  1YQ3 B;  2GB1 A;  4IKG A;  1FRR A;  5D7G A;  1L0Y B;  1T6B X;  1WGK A;  3AE4 B;  1FD6 A;  2V3P A;  3AE2 B;  2BS3 B;  1IUE A;  1TY2 A;  1SE4 A;  1L0X B;  1QIL A;  1ET6 A;  2BS2 B;  1L4D B;  3BYT B;  3Q8E A;  4MT5 A;  4EE2 A;  3BVM A;  3ZGZ A;  3P4S B;  3MHZ A;  1C4C A;  5I4D A;  1XO3 A;  1UWX A;  2V4I B;  4D2K A;  2Z8L A;  1M4V A;  1HZ6 A;  4IOI E;  1SE3 A;  1D6E C;  2D5G A;  4WIP A;  1J7A A;  1ZXH A;  4MH8 A;  1GTH A;  4ARC A;  4OZC A;  4ZRQ A;  1JCK B;  2M56 B;  3EUB 2;  1J7C A;  3AE6 B;  2WXP A;  4P16 A;  1DGJ A;  2G9H D;  2ICI A;  4GDK B;  1NEK B;  4RGO S;  4XWT A;  1R7S A;  1QQR A;  4DQO C;  5BYR A;  2M0A A;  2L32 A;  1FNU A;  4USA A;  2L83 A;  2I2Y A;  2HTM E;  3AEB B;  3P4Q B;  1I4R A;  1K51 A;  3FIL B;  2MJD A;  2W3R A;  2WQY B;  1QF6 A;  4XE0 A;  1FFU A;  1OFF A;  1B1Z A;  3AEE B;  2KN4 A;  4JWS C;  4C7Z A;  4YSY B;  1L5P A;  2IDY A;  1XF5 L;  1OQR A;  3B2F A;  4A9A A;  5BMI A;  3AEF B;  2NTS A;  4M0W A;  1RWS A;  1SSN A;  2BT6 A;  4RGN A;  1VLB A;  3AN1 A;  1I7H A;  4L1B A;  1C77 A;  1K52 A;  4KGS A;  1SBB B;  1EWC A;  1DOX A;  3RFZ B;  3FC4 A;  4N58 A;  2EEL A;  1JWU D;  4TQ1 A;  1PDX A;  4A6Q A;  1UNS A;  2PKO A;  1GTE A;  1A70 A;  1FRD A;  1IBX A;  2W55 A;  1N62 A;  3AE1 B;  1TS5 A;  1C76 A;  4DXF A;  1YJI A;  5H92 C;  1SE2 A;  3BVG A;  1ZP0 B;  2ONQ A;  4RGT A;  1KLU D;  3CWI A;  3Q8F A;  1NI3 A;  2KQ4 X;  1MHH E;  1C79 A;  1JML A;  2BBC A;  2JYT A;  4OW0 A;  5C2T B;  5HI1 A;  4OZA A;  2EKI A;  2JSV X;  4DXG A;  1D5M C;  3KQ4 A;  1WSP A;  1CZP A;  2BW2 A;  4KKJ A;  2RPV A;  2QEJ C;  3BYY B;  3FAH A;  3T3N A;  3VQI A;  1TYG B;  1H7W A;  3OWE B;  2RDH A;  1K53 A;  1CK1 A;  2BB5 A;  1GB1 A;  1JAL A;  2JQR B;  4KGR A;  1VZ6 A;  2PTL A;  2KWD A;  2QIL A;  2K0P A;  2PW9 A;  3B2G A;  4MAC A;  2JXT A;  3AE7 B;  1KTK A;  3IT4 B;  3L4P A;  3NUH B;  1VZ8 A;  1C78 A;  1SIJ A;  4B0M A;  2W82 A;  1F2R C;  1SEB D;  3E56 A;  4ZOH C;  2K22 A;  2ON8 A;  2JZP A;  2LHD A;  3TUO A;  2H88 B;  1IBX B;  1EM7 A;  2JWU A;  2IJ0 A;  3I9V 1;  2PVO D;  1NYQ A;  1TS3 A;  2KAC A;  5D3D A;  1E9M A;  3EGR A;  3AV8 A;  1ET9 A;  5G5G A;  4R3D A;  2PLP A;  4A90 A;  2W3S A;  1ZDX A;  5BYS A;  1UUP A;  1EU3 A;  5BMH A;  2KDM A;  2X38 A;  1WRI A;  1TKE A;  4AQ7 A;  3KLS X;  3AEC B;  4MM3 B;  3AM9 A;  2AQ1 B;  2MEK A;  3EA6 A;  1I4P A;  4OVZ A;  2XN9 C;  5GXG B;  3LXF A;  3NVZ A;  2DYO A;  1D5X C;  1I4Q A;  4JX1 C;  2L52 A;  3BK2 A;  1DOI A;  1FCL A;  1L6V A;  1IGD A;  1XCQ L;  1JW9 D;  2WLB A;  1PFD A;  4JPS A;  3AB5 A;  1JWB D;  3PZ8 A;  3SEB A;  3CIR B;  3PZ7 A;  4HJG E;  1KF6 B;  2SAK A;  1HZ5 A;  1NYR A;  2XNA C;  5AUK A;  3W9C B;  2DLB A;  3BWU D;  2MJE A;  4NAW B;  3NZ3 A;  3NRZ A;  2OHF A;  3GB1 A;  1YQ4 B;  1MVK A;  1ZDV A;  4RFB A;  1OQQ A;  4YXD B;  1YN4 A;  1H7X A;  2GI9 A;  1XEE A;  1SXT A;  4Q2J A;  3E9S A;  1FNW A;  2WXM A;  1FNV A;  3AEA B;  4NJC A;  4GDL B;  4RGM A;  2VZK D;  2IPK D;  2SEB D;  2KAJ A;  3W5U B;  4ZRP A;  2DBY A;  4HKZ E;  2IGG A;  3W5V B;  3R8B A;  3ZJU A;  4RF0 A;  2WS3 B;  4C7Y A;  4JE3 B;  1KH0 A;  3W2D A;  3P4R B;  3Q8C A;  2CJO A;  1KFY B;  1XLN A;  2J52 A;  4RCO A;  4YT0 B;  3ABV B;  4YTP B;  3IT6 B;  1V8C A;  2NTT A;  1C4P A;  1SF0 A;  4RF1 A;  1RM6 C;  1BXT A;  1CQV A;  2M19 A;  1QOF A;  2G1E A;  2W54 A;  1JQ4 A;  2WXK A;  1GPX A;  1P7F A;  2WXO A;  1FM0 D;  3IXS A;  4KGT A;  1E6E B;  2WNM A;  4OHJ A;  1FXA A;  1QOB A;  2LHE A;  1QOG A;  1CJE A;  3SFD B;  1EU4 A;  1KRH A;  2WDV B;  1JWS D;  2AQ2 B;  4KKI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...