3P4RB

Crystal structure of menaquinol:fumarate oxidoreductase in complex with glutarate
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
243
structure length
243
Chain Sequence
AEMKNLKIEVVRYNPEVDTAPHSAFYEVPYDATTSLLDALGYIKDNLAPDLSYRWSCRMAICGSCGMMVNNVPKLACKTFLRDYTDGMKVEALANFPIERDLVVDMTHFIESLEAIKPYIIGNSRTADQGTNIQTPAQMAKYHQFSGCINCGLCYAACPQFGLNPEFIGPAAITLAHRYNEDSRDHGKKERMAQLNSQNGVWSCTFVGYCSEVCPKHVDPAAAIQQGKVESSKDFLIATLKPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fumarate reductase flavoprotein subunit
publication title Geometric restraint drives on- and off-pathway catalysis by the Escherichia coli menaquinol:fumarate reductase.
pubmed doi rcsb
source organism Escherichia coli 042
molecule tags Oxidoreductase
total genus 70
structure length 243
sequence length 243
chains with identical sequence N
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2010-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13183 Fer4_8 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 3p4rB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3p4rB01
5EE1A 4YSZB 3AEAB 1QF6A 3WCQA 1N62A 3VR8B 1WWTA 1E7PB 2W3RA 1VJKA 2WU2B 1QT9A 1SF0A 3HRDD 3W5UB 1JWAD 3B2FA 1J7AA 4A9AA 2BS3B 1JWBD 1OQQA 4JX1C 3AE7B 1GTEA 1FMAD 1XLNA 2QJLA 5G5HA 2BT6A 4KX6B 2H89B 5H92C 2E3TA 2PIAA 3NVZA 3ETRA 4FXCA 3FC4A 4IDIA 1WRIA 2W55A 2BS4B 3AE9B 4ZHOA 1A70A 1GT8A 1NI3A 1E9MA 1FFVA 3HUIA 1FXIA 2M56B 4C80A 1L0VB 1NYRA 1FIQA 3AE5B 2CJOA 4N6EB 1ZUD2 3P4PB 3SFEB 4US8A 1GPXA 4N59A 2PKOA 3HVZA 4C7YA 1VDVA 1N5XA 1CJEA 1GTHA 1FFUA 3AMZA 2K5PA 5EE0A 5EE9A 3PO0A 1H7WA 3NVVA 1CZPA 5MPOA 4JWUC 3W5VB 1E6EB 3ZYYX 1ROEA 3CWIA 4ZHPA 3AEGB 1TKYA 1XLPA 2L52A 1KFYB 1JQ4A 2MJEA 1T3QA 3FAHA 5G5GA 2WDRB 1JW9D 4ZOHC 2Y5CA 1RFKA 3AE8B 2MH7A 3ABVB 1VLBA 1QOAA 1YQ3B 2BS2B 3P63A 3AE6B 1RYJA 1V8CA 2K22A 2WQYB 1NYQA 2PVGC 2WDQB 1FM0D 3AN1A 1WGKA 4YT0B 1QOBA 2MJ3A 4HROA 1XLQA 3KWLA 5AUKA 5C2TB 3LXFA 1JROA 1QOFA 2DWQA 2JX5A 1EWYC 1YJIA 2M19A 1E10A 4N58A 3AEEB 4YTMB 3AEBB 2QIEB 4WQMA 4HRSA 3AE2B 1N61A 2CJNA 4US9A 1QOGA 1PFDA 1FXAA 1PDXA 1NEKB 2WS3B 5C3JB 1N5WA 1WYGA 1H7XA 1PUTA 3W9CB 2JQRB 1XO3A 3AEDB 1TKEA 1AYFA 2K9XA 2OHFA 3AM9A 3SR6A 3DWGC 1XLOA 4JWSC 1ZP0B 2WDVB 1J7CA 1KF6B 1N60A 1TKGA 3P4QB 3NS1A 1IUEA 1GAQB 2LEKA 3RPFC 1RWSA 4USAA 3BIID 3CF4A 1WXQA 1N63A 3DWMA 4C7ZA 5H8YE 1JALA 3VRBB 4YTNB 3AE3B 2FBWB 3B2GA 1KRHA 2CU3A 2MJDA 3P4SB 3SFDB 1NENB 2G1EA 3L4PA 2B76B 2H88B 1DOYA 1L5PA 2WU5B 3AE1B 1I7HA 1ZXIA 2WLBA 3AB5A 4WWMA 3VR9B 3P4RB 2DBYA 1TJEA 1F0ZA 1SIJA 3VRAB 1OFFA 3AEFB 2EKIA 2KMMA 3AV8A 5GXGB 1FO4A 1DGJA 2L83A 3AE4B 2N0SB 3AH7A 5EE3A 1FRDA 3P1MA 4YXDB 1L6UA 2ACZB 3EUB2 1TYGB 1DOIA 1YJJA 1J7BA 1V97A 2KAJA 2Q5WD 1R7SA 3B9JA 1RM6C 1UWMA 3NVYA 5AUIA 4ITKA 3AECB 1OQRA 1NVID 4YSXB 2AX5A 1ZOYB 4YTPB 2W3SA 1E0ZA 1SB3C 4P6VF 1FRRA 2HTME 3CIRB 2WP9B 4YSYB 1JRPA 3NRZA 1AWDA 3LB8C 1QLBB 3NVWA 1YQ4B 1B9RA 1L6VA 1DOXA 4LTUA 2PVOD 2W54A
chains in the Genus database with same CATH superfamily
2CR5A 2MBOA 2MHJA 4DBGA 2NBWB 4LNKA 1SF0A 3ML8A 4LNIA 3Q14C 3RYTA 4DWFA 1OQQA 2L7RA 3MC8A 5JHBA 5G55A 3L17A 5C23A 3DBRB 1F1HA 3A4SC 1WRIA 2GBNA 3MTNB 4ZHOA 1A70A 2V0GA 5CTRC 4ZDVA 5CHVC 3AE5B 2J52A 4DDGD 1PGXA 1E90A 3DBSA 1CJEA 4W9JA 3Q8CA 1ZDXA 1TTNA 3W1SC 2EMTA 3CWIA 1JQ4A 3NJTA 1T3QA 2LHDA 3GE3C 3R3MA 2BS2B 1XF5L 1RYJA 3ZRCA 2WQYB 5AEKB 2PEAA 1QOFA 4RM8A 3Q8AA 1WE6A 4RGTA 4W9KA 1QOGA 1PDXA 2WS3B 2Y5PA 4K3BA 2AL3A 2LRWA 3V60A 3SR6A 4HEA1 3A1QB 3AULA 1J7CA 2LVQA 3RPFC 4XC2A 3LDZE 4USAA 3IHPC 4EEWA 3RI7C 1QKZA 2ON8A 2WWZA 4PS8A 2KNBA 1AARA 4OW0A 3HVDA 4P1CC 2L83A 3QCAA 2N7EA 2KDEB 3EUB2 1TYGB 4K7SA 2BYVE 3RNCC 1UNSA 3PT2B 1TT5B 3OWEB 5HG2A 3OJ3A 3KUCB 1Y8RC 4IKGA 3KLSX 4NJ6A 2R61A 2YLMA 3DBLI 1KLGD 2FCMA 2L0FA 1GTEA 5D6JB 1YN3A 2D3CA 2KD0A 2KJRA 4ANWA 3HUIA 4NJCA 1L2NA 1IPGA 1ISNA 4B6WA 4KGRA 5BMIA 2BVCA 1IBXB 4JQWC 2IGHA 4DXAB 1J8CA 4JWUC 2FCNA 2Y3AA 3W1SA 2WDRB 3MC0B 1RFKA 3WA0A 3FILA 1LXDA 1YJ1A 2A5UA 1C77A 3VVWB 1LM8B 3R66C 2BTEA 1D5XC 3S2AA 3ZJTA 1WGKA 4M02A 2RD0A 4PT5A 1N6ZA 5IOIA 4N58A 4PYZA 1UELA 1IGDA 3H7PB 4HWIB 3A9KA 1EU3A 4MEMA 4KZ0A 3I5JC 2ZPYA 3OJ4B 4PK1A 2ZEQA 1EUVB 1N60A 1RAXA 2YEPF 3ONSA 4XWWA 2MWSB 3VXWA 2MP2B 1RWSA 4F7ZA 3VRBB 4FA6A 3ECIA 5FKAC 1TY0A 3VUYA 3DBHB 2KJ6A 2H88B 4M8NA 3AE1B 2X8XX 2KMMA 4KZCA 3DCGA 1K51A 4G50A 1XQQA 4UDUC 1DOIA 3MJ5A 4A6QA 2D5GA 1WGDA 1OQRA 2IO0B 2L3ZA 4L23A 4KKJA 4A3PA 2JF5A 2NS5A 3UI3A 1VCBA 4EFOA 3ZTCA 1WF9A 4DHJB 3Q3OC 1WX9A 2PVOD 1PYWD 2JUOA 2EMSA 2ZZPB 2RDGA 1BT0A 1P0RA 2GMIC 3VR8B 1WI0A 3W5UB 1JWBD 4JE3B 2H89B 1IGCA 3H9DA 3VQIA 2KWDA 4GIVA 1NYRA 1FIQA 2JZZA 5D2MB 5IAAC 4S17A 3ZNID 2NR2A 4W9HA 3HVZA 2WXNA 1I35A 1VDVA 1YN4A 2KX0A 1GTHA 5EDSA 1CK1A 2KC2A 4P1BC 3BWUD 1ET6A 3NVVA 2WGSA 2WXRA 2N7DA 3HIZA 4LNOA 1F2RI 4HDQA 3NHEB 3UIOB 3SEBA 1VLBA 1CQVA 2O2VA 4II2B 2NVUI 1HZ6A 2KFJA 3JYUA 4P7IA 2G4DB 3KYCD 5BYSA 3MP9A 4YTMB 4IM0A 1SJHD 2FAZA 3PLVA 3GZNI 4GDLA 3OAWA 5JXVA 3AM9A 2WDVB 4KDLB 5IA7A 1S1QB 5J17A 4HK2A 3QC8B 1WGYA 3VTVA 4OVVA 4RGMA 3M63B 1Q1OA 2G1EA 1WJ4A 4K1RB 4W9IA 3TEXA 5LLIA 1F9JA 3WALA 5EE3A 1K53A 2N9KA 1JWSD 2VZKB 4O1NA 1J7BA 5BMGA 1UWMA 2GBMA 3RNEC 1TBEA 1I4XA 3R8BA 2M17A 1NVID 4RCOA 2M4NA 3PRMB 3NZUA 1D4BA 2WNMA 1QT9A 1JWAD 4NQKE 4TSSA 1TY2A 2BKFA 1XLNA 3O13A 4KX6B 4NPNA 1Q0WB 4C00A 2KWVB 2N1WA 3GB1A 1E9MA 1B1ZA 2BBCA 5D7GA 2MLBA 1XEEA 2JRHA 2WX0A 3SFEB 2KK8A 1WMHA 1LFDA 3ENEA 1RFAA 2C7NB 2FCSA 1CZPA 3AI5A 2DLBA 4RH6A 5MPOA 3W5VB 3PPAA 2BGFA 2AQ1B 4OZBA 2N1VA 2D3BA 3QQ8B 1WSPA 4ZRQA 3B0AA 2Y5BB 3P63A 1V8CA 2V4LA 4W9FA 2KFKA 2CU1A 2KLGA 4AJYB 2E6XA 1F52A 4HDOA 4HROA 3LXFA 1WJUA 3AEEB 2QIEB 1H8CA 4RF1A 1TZOA 1N5WA 3PVLA 2JQRB 1C79A 3E9SA 1ZP0B 1D6EC 3BVGA 4IWQA 2N9XA 2CU3A 1HTOA 1NENB 1MFWA 2DYMA 3PZ7A 2C5LC 4JL9A 3U2SC 3VRAB 1HQRD 5GXGB 1LQBA 3JSVB 4IWPA 4XZ4A 4WIPA 3L10B 5E6JA 1M94A 3I57A 2UU7A 2OJWA 4NAWA 3N1XC 2TSSA 1YQ4B 1B9RA 2BKRB 5JZEB 4LTUA 3JW0X 4ZRIA 2IO2B 2M1MA 4LLGM 2KYWA 3T3NA 2RMMA 4NY0A 1SBBB 1NI3A 1WYWB 2FIDA 2R2OA 4OHJA 1SEBD 4EZLA 4IW0A 1T0SC 1FFUA 5EE0A 2WXKA 1H7WA 2KMCA 1WGHA 2C7HA 1OTRB 2ONQA 1MHXA 4OZCA 2ZVOA 4MM3A 2Y5CA 4LDTD 1ACCA 3PHXB 2VH1A 3AE6B 2AQ3B 4YT0B 3IG3A 3C8YA 4LNFA 5TR5A 5IN7A 3T8MA 4N9F4 3AEBB 2NCNA 2NTTA 3LJ3A 1T0YA 1EM7A 2Z8LA 2JZPA 1G6JA 2QDFA 1PUTA 3UGBB 4HVBA 3AEDB 4OZAA 1KF6B 2LJIA 4LNNA 3DHHC 4C7ZA 2MX2A 2DZJA 2GB1A 2K8HA 1IYFA 2J7QB 3SFDB 1MI0A 2B76B 3TIXA 1ZXIA 2DBYA 1HZ5A 3AV8A 1P7FA 3ZO5B 4BKGA 4HPMB 1SE2A 3AH7A 2IY1B 3PRPB 2L8JA 1MG4A 3MHZA 2LGIA 2L32A 4XE0A 1VRAB 4NNJB 2BW2A 2QEJC 1T6BX 5HKHA 1YQBA 1JRPA 3NRZA 4HCPB 3NVWA 1E7VA 4E74A 2W54A 4A20A 4CO7A 1JWUD 3U8ZA 1N62A 3UIPB 2MBHA 3HRDD 2BS3B 2DZKA 4S0RA 5TSSA 1BMLC 3DVGX 4W9LA 2BS4B 5BMHA 4FBJB 2KO3A 4EE2A 4TV3A 3ZDTA 2GOWA 1Z2MA 1WIAA 1ET9A 4KGTA 3SHQA 2C60A 1YX5B 2AQ2B 1HEZE 3BYTB 5EE9A 4NQLB 4TMAB 1QILA 3ZYYX 2O6VB 3RZFA 3W2DA 2OJRA 2L52A 3MC9A 3V6CB 4QAYA 1L0YB 2LMCA 3A9JA 4GDKB 1VD2A 1NYQA 4II3B 3A4RA 1WZ3A 2XK5B 4WJOA 3GP7A 3Q8BA 4ZRPA 1VZ6A 4FLHA 1FXAA 4M0WA 2FE8A 2OHFA 1NBFC 3DWGC 4JWSC 4F1SA 1GAQB 1U4AA 3CF4A 2B3AA 3DWMA 2IZVB 3RN9C 2FBWB 2RPVA 2J0MA 2WXGA 1OEYA 2I1KA 2WU5B 4FULA 3VR9B 5FR3A 1TJEA 2K1FA 3AU5A 2YVCA 4BKSA 1DGJA 2VH2A 4MT5A 5LXHA 2LFIA 3V05A 4L1BA 2G4SA 4KSKC 3B9JA 4DXGA 4GU2A 2M0AA 3A33B 4JPSA 1R4MI 3LB8C 4NJ7A 4R3DA 1OEYJ 2PW9A 4AUQC 3WIMA 4ZYSA 2JVCA 3B2FA 5KHQA 3AE7B 2QJLA 2D11A 4BAXA 1JWMD 2NMQA 2W55A 2ZNVB 2JWUA 4ARCA 1L0VB 3EFCA 2K6QA 1R4MB 3ZIMA 4K7WA 1KJTA 4DXFA 2WX1A 2PKOA 4C7YA 1I4PA 4JGHB 1Z5SB 2OOBB 3IAM1 1I42A 1V5TA 2DAFA 3FKYA 3ALBA 4K7UA 2K6DB 2HJ8A 4KIKB 2EELA 3AE8B 2MH7A 1UGJA 2FIFA 2RR9A 1C76A 3IBEA 4BFRA 4KSLC 1V1OA 2PPHA 2WXMA 1QOBA 1XLQA 1V1PA 3JVZX 5DPSA 2IBIB 2BQQA 3WAMA 2CHXA 3L08A 2KHWB 2CJNA 2I38A 1NEKB 1TS5A 4HLEA 1V86A 2KTRA 1XT9B 2NBUA 1R4NB 1WR1A 1I4GA 3NS1A 4EZKA 1WM2A 3RCZA 2WXHA 3AXCA 4FHJA 2LGYA 5H8YE 2K8BA 2IO1B 3PGEA 3PRZA 4FN2A 4BOSC 2ICIA 2ZVNA 2D10A 1L4DB 2VRRB 4ICVA 3DBHI 4TKNA 1YOVB 1OFFA 3AEFB 2JSVX 2N0SB 2XN9C 3Q69A 4G0NB 4IUMB 3UINB 1UF0A 4ACFA 2V3NA 5BO4B 4RGNA 4OVZA 3RUIB 4WWNA 3R7QA 2INPE 4YTPB 3TEWA 4P6VF 1FRRA 2MA9B 3KVFB 2JZ3B 3NOBA 2FUHB 2KTFA 2K39A 3M95A 4HJKA 3TEYA 3NUHB 5G5HA 5H92C 3U30A 4FJYA 3SDLC 1GOZA 2D07B 3OLMD 2CJOA 3IXSA 3ZJUA 2KX3A 3A1QA 3BZDB 2ZW1A 2PE6B 3VAWA 4CYEA 1V9JA 1WJNA 2J4XA 3O65B 4K3CA 4BKTA 3QX1A 3ZQ4A 2RDBC 4ZOHC 4E3CA 4MH8A 2OEDA 5FR6A 2K22A 1FPYA 1C4CA 1T0RC 1FM0D 3PZ8A 1D5MC 4MH0E 3Q8FA 2BF8B 1V80A 2N7JA 4WAAA 2LXAA 1YJIA 2KQ4X 4LJOB 1WFYA 2D3GA 2NBVB 4KGSA 1EF5A 1TS3A 3IT4B 1MPEA 2MEKA 2GBJA 5AZGA 2BB6A 2V9HA 1Y56A 3K9OB 2CKHB 4A55A 2IDYA 1T5XD 1WXQA 3L54A 1BXTA 4I6NB 1EWCA 4MELA 3RNAC 3GOEA 4BVUC 2V3PA 3R2TA 2MBEA 2K0PA 1UH6A 3HM6X 1IBXA 3TBLD 1JRUA 2LUMA 1R7SA 1AW7A 4TQ0A 1M4VA 2WYQA 3TUOA 2DAJA 2HTME 1I4HA 1V5OA 2C7MB 3PS6A 3WANA 2ASQA 3N9YC 1QLBB 1TIFA 1K50A 4MJSB 3ZRFA 3PTFC 4DDID 2ZW0A 4NAWB 2GLSA 5J2RA 3H6NA 1F77A 3ETRA 3FC4A 3QAQA 2LHEA 1FEHA 2LZ6A 3H7PA 1FXIA 3DVNU 1F2RC 2NPTB 3Q2AC 1FD6A 4EKUA 2JPHA 1XCTL 2GBRA 4BOZB 2HJ1A 2DZIA 1XCQL 5HFYA 4C4VB 2DNFA 2MP2A 1UBQA 4IM3A 1E6EB 2KDFB 3DHGC 2N4FA 4XDCA 1JW9D 1MJDA 4MGYE 1GC6A 4W9EA 4MM3B 4BZAA 3RMKC 1JROA 1UZXB 2RSUA 3EFUA 5JH5C 1K8RB 1E7UA 1H7XA 3RULA 2HTHA 3L16A 4BBNF 2JT4B 1XLOA 4NZLB 4B9KA 4MSQB 3KUZA 3AE3B 2RPQA 3ZXRA 4WAFA 1UGMA 2V3SA 2W82A 2LJ5A 3BK1A 3HHMA 3RT3B 3MFGA 2JYTA 3L13A 2GBKA 2WXOA 2KOXA 4RNAA 3BINA 1YN5A 4PS3A 2MBBB 4WWPA 5GMVA 4B95A 4LK0M 2AX5A 4EZJA 3T9LA 4EOYA 4XGAB 1VZ7A 3EA6A 1QF6A 2QMTA 4KV2A 2IPKD 3EGRA 4M01A 4HKZE 1P1AA 3RNGC 3EC8A 3KW5B 4GXBA 3TJPA 4KKIA 4CHKA 1RLFA 2LGDA 4REZA 4WWOA 1WXAA 3P4PB 1WZ0A 4US8A 3RZWC 1GJZA 3P42A 5D94A 2J42A 1N5XA 4GMVA 3RFZB 2JXTA 5BYQA 4A8XC 4DHZE 4WURA 4I6LB 3N30A 4IWOA 3ZNGC 1BUIC 5HHDG 1P9DU 3ABVB 2INNE 4BKSD 2QC8A 3AN1A 2IGGA 1E8ZA 2D2QA 2MRPA 3TSSA 4KVGB 1STEA 3U4EG 2LASA 2MBQA 2Z0EB 4US9A 3CMMB 3M3JA 3PSEB 4YL8A 1LGRA 3NS8A 2BYTA 1AN8A 1N63A 1FNVA 2KC1A 3EECA 3V61A 3NZ3A 4M00A 4F8CB 3SU8X 1FO4A 4JLCA 1UBIA 1FRDA 2FCQA 2K25A 1GB4A 1GC7A 2QSDA 4L2YA 4A3OA 5DPWA 2KVRA 1WJ6A 1TS4A 1UWXA 3AEAB 2BWFA 1ZXHA 1WWTA 1ZE3D 2HDEA 2KQSA 1FMAD 3AU4A 2LGSA 4HXDA 4NAMA 2PIAA 2RGFA 3AE9B 2JRIB 2NTSA 4LDTB 3UQBA 1PQSA 2KVZA 1HTQA 4G3XB 3GE8C 4DK5A 3APFA 4LCDE 2INDC 3PO0A 3VTWA 2MSED 1ROEA 2QHOA 2KWUB 3U7DA 2KN4A 1IP9A 2WHIA 2IYDB 3KH0A 1UD7A 3JSVA 2KKCA 2JXXA 2G45B 2DHZA 4EUTA 2G9HD 2WXJA 1EWYC 3QJZA 2M19A 2INCC 3ZVVA 5L83A 2PTLA 2BWES 3ZUNA 1PFDA 5C3JB 2Z0DB 1FCCC 2IGDA 1TKEA 1V1PB 4ZRJA 1J19A 3B08A 5KHOA 3IT6B 3U52E 1X1MA 2LRUA 1ZDVA 1KRHA 4B0MA 3PZDA 3DQVA 4WH4A 3U7ZA 4FADA 1I7HA 5HI1A 3FILB 3CSTA 4GGQA 1SIJA 2BPSA 1GNUA 4RFBA 1MHHE 1WRDB 3TL5A 1P7EA 3P1MA 4YXDB 2ACZB 2QCZA 3Q3JA 4FJVB 4XX5A 2W3SA 3A9KB 1E8WA 2PMVA 1AWDA 1L6VA 1HXYD 1DOXA 2ZCBA 3EHVA 2KACA 3VTUA 3WCQA 3WAPA 3DVNV 5D3DA 2WU2B 1EO6A 5D3IB 1YX6B 3R7RA 2BT6A 2EKEC 3L0WB 5E6PA 2Z59B 1C4AA 1XXGA 3MJWA 1GT8A 1SXTA 3ZNHB 1TZ1A 1WGRA 4HJGE 3SD5A 1WR6E 4MGIE 3UF8A 3VFKA 2ZJDA 4RGOS 4IM2A 2WXFA 2M0XA 4ZRKA 4B0EA 1FNWA 4ARIA 2MJEA 4URKA 1RRBA 3Q3MC 4GB9A 4MGKE 5G5GA 4XWTA 4PYUA 2YEPB 1SE4A 5I4DA 1YQ3B 3MHSD 4I6PA 1V81A 2C9WB 1I4QA 4ICUA 5CHFA 1J0GA 2KDMA 1WXMA 1WH3A 4WQMA 4HRSA 3AE2B 2N9EB 3PLUA 1XO3A 2KXJA 3I9V1 1TKGA 2MCNB 1IUEA 1R4NI 3VHTC 2G3QB 1C9FA 1HA5A 3IAS1 1JALA 2BYEA 4YTNB 1Q5WB 2KANA 1KOTA 2XNAC 1A5RA 3QARA 2I2YA 2ZNVC 4KDIC 3H1UA 4HPPA 3X23A 2O2VB 2CS4A 2AYOB 4IOIE 1L4ZB 1PGAA 3BVMA 3PHWB 4PS7A 2MW5A 1C78A 4AS1A 2O6VA 1E0ZA 1K52A 4GDLB 3IFWB 3QIJA 1E8YA 3CIRB 4YSYB 4AWJA 2SEBD 4GDKA 3ZNZB 3DBLB 3ZGZA 4YWGG 2J0JA 3VH3B 1GB1A 1XD3B 1JCKB 4ZYNA 2KWCA 2XK5A 3B1LX 1ZGUB 4W9DA 1NI2A 5CX3A 5J18A 3D32A 2WXLA 4C80A 3V6EB 4N6EB 4HPLB 3I3TB 1ZUD2 2IJ0A 2X38A 5FK9C 4DHJD 4OVUA 3URYA 3X0WA 2KDIA 2BB5A 2PLPA 3IVFA 1XLPA 1KFYB 2L76A 3APCA 3V3XA 2JWZA 1YNTE 2PVGC 2L05A 1L0XB 5G2NA 1SE3A 1KH0A 2MQJA 3KWLA 5AUKA 1ZPSA 4LJPB 1VZ8A 2JX5A 4AP4C 3R2IA 1S3SG 2A4ZA 1P98A 1YMHE 3W9CB 2ZCCA 2PE9A 3HM3A 1WMHB 1EU4A 1FNUA 4CQNA 1WGGA 2KLCA 4MGZE 1UUPA 1SGHA 1WXVA 4HCNB 4IG7B 2J0KA 3B2GA 2BYFA 2KMAA 4GLSC 1HE8A 3L4PA 1WX7A 2LVOA 3TMPB 3P4RB 5T8IA 1KM7A 2KFKB 3NZSA 5L95C 4J3OD 3QK0A 3BYYB 3ZJVA 4ITKA 2W9NA 3CF6E 3W1YA 2M8SA 2KT7A 1ZKHA 4KIKA 3PREA 4GN1A 3ZKJC 4YSZB 1GG3A 4MDKE 2AWTA 2PJHA 3ZXVA 1J7AA 2VZKD 4D2KA 4JX1C 1TS2A 3RNFC 2M56B 2WDTB 4BBNC 3KUDB 1T0QC 1C4PA 3H7SA 1LO5D 2KN5A 3AMZA 1SIFA 4RM9A 1E5WA 3C19A 3AEGB 2L1AA 4XYCA 5DPTA 1V2YA 3N1ZC 3CSFA 1SSNA 2REXA 1QZEA 3H8HA 1PGBA 4ANUA 2JY6A 4ASWC 5C2TB 3LYYA 2DWQA 1SE9A 1E10A 3GZNB 5BYRA 4DHZB 2QILA 3DPDA 1WY8A 2WXIA 3I63C 4TUUA 3VDZA 3UQAA 4Q2JA 1H4RA 3KQ4A 5LNK1 2LEKA 4P16A 2N9PC 2RDHA 1WM3A 5IP4D 2DENB 4K81A 1ESFA 1FCLA 4WWMA 2EKIA 1SJED 2GI9A 4A90A 2L00B 3AE4B 1L6UA 1YJJA 2KAJA 4HKQA 2FNJB 1RM6C 4WJNA 3NVYA 2KQ7A 4YSXB 2XBBC 1ZOYB 3C0RB 4IC7B 1SB3C 4AJWA 2WP9B 3RNBC 4TQ1A 1C3TA 1I4RA 4X57B 3QWZB 5EE1A 3GS2A 1E7PB 1VJKA 4E71A 3N20C 2E3TA 5DPRA 4FXCA 2N9LA 2ZPNA 2D3AA 1C1YB 1WXSA 1YD8U 3DOWA 1FFVA 4ANVA 1ENFA 3T3OA 2XEWA 1JMLA 4J6IA 3K9PB 1GUAB 2CHWA 5E6NA 2JU6X 4AOFA 3BK2A 4XDDA 1E8XA 4ZHPA 2HD5B 4ANXA 4W9GA 3FAHA 5CHWA 2DZMA 4M8MA 3E56A 2LD9A 1WX8A 2LI5A 4RMAA 2WDQB 2MJ3A 4GSWA 1D3ZA 2CHZA 3KYDD 3APDA 3ZLZA 2UYZB 1EF1A 3PV1A 1CMXB 2J53A 3VH4B 1D5ZC 2L0TA 1AYFA 2K9XA 1KTKA 4MJSA 2DYBA 2LGXA 5E6OA 4WJPA 4G11A 2MJDA 1DOYA 3A9JB 2WLBA 4FJZA 2FUG1 1F0ZA 1Q10A 5AZFA 1MG8A 4C56C 2NPTA 1KLUD 1L7YA 1QQRA 3DVGY 2V1YA 3P2BA 1P3QU 2LUEA 2WXQA 2I1JA 4C4VA 1YIWA 5AUIA 3AECB 3NY5A 4DQOC 3DHIC 1FXTB 4M0WB 3HK0A 3J9CA 4GOCA 3RD2A 4W9CA 2AEHA 3Q3NC 4WJQA 1OQYA 1DYQA 2W3RA 1ZW7A 3N3KB 4A9AA 3BY4B 4FHKA 3V62A 2IY0B 3Q8EA 3NVZA 4IDIA 2JYEA 2AL6A 3ZTDA 1GPXA 2LXCA 4N59A 3ZW3A 3NG0A 3Q6BA 3QA8A 2K5PA 2UWQA 5C1ZA 2SAKA 3N1YC 1TKYA 4JIOU 1KLVA 4MACA 4H2AA 2R2QA 3BVZA 5IKCM 5AZHA 2KJHB 1QOAA 2K8CA 5LXIB 1V6EA 3TEZA 3ML9A 1V49A 1OGWA 3DDCB 4AQ7A 2DX5B 1N61A 2O6VD 5IO9A 1WYGA 2LVPA 3WAOA 3P4QB 3BIID 3N32A 3VUXA 3ZDMC 2LWPA 2WXPA 5JHAA 1WE7A 3P4SB 1NDDA 2KZRA 1TGZB 2K3UA 1L5PA 3OG5A 3AB5A 1MVKA 3VUWA 4WQOB 3TCAA 2DYOA 3KWVA 1V97A 2IO3B 3M62B 2Q5WD 4RF0A 3DBRI 2HE7A 3Q3FA 2V4IB 3QHTA 2KDBA 4MSMB 2KTRB 5DCNA 2GRIA 1VR9A
chains in the Genus database with same CATH topology
3ZGZA 4YWGG 1SF0A 4LLGM 1OQQA 2ZW0A 4NAWB 1GB1A 1JCKB 1F77A 3ETRA 3FC4A 1WRIA 2LHEA 4ZHOA 1A70A 1FEHA 2RMMA 3T3NA 1SBBB 2V0GA 1NI3A 4OHJA 2WXLA 1FXIA 1SEBD 4C80A 1F2RC 4N6EB 3AE5B 2J52A 1ZUD2 2IJ0A 2X38A 1FD6A 5FK9C 1PGXA 1XCTL 1CJEA 1XCQL 3URYA 5HFYA 1FFUA 5EE0A 2WXKA 3Q8CA 1ZDXA 1H7WA 2BB5A 1E6EB 2PLPA 3CWIA 1XLPA 1KFYB 2ONQA 1JQ4A 1MHXA 4OZCA 1T3QA 2LHDA 4XDCA 1JW9D 2Y5CA 1ACCA 2BS2B 3V3XA 3AE6B 1RYJA 1XF5L 1YNTE 2WQYB 2PVGC 1L0XB 2AQ3B 1SE3A 4YT0B 1KH0A 3C8YA 4MM3B 3KWLA 5AUKA 1ZPSA 1JROA 1QOFA 1VZ8A 2JX5A 3R2IA 3Q8AA 3AEBB 2NTTA 4RGTA 1QOGA 1EM7A 2Z8LA 2JZPA 1PDXA 2WS3B 1YMHE 1H7XA 1PUTA 2Y5PA 3W9CB 3AEDB 3SR6A 4HEA1 1EU4A 1FNUA 4OZAA 1XLOA 4NZLB 1J7CA 1KF6B 4CQNA 2LJIA 1UUPA 3RPFC 4C7ZA 4USAA 2GB1A 1QKZA 3AE3B 4WAFA 3B2GA 2ON8A 2W82A 3SFDB 3BK1A 1MI0A 4GLSC 3L4PA 2B76B 3MFGA 2JYTA 1ZXIA 3P4RB 2DBYA 1HZ5A 5T8IA 3AV8A 1P7FA 2WXOA 3HVDA 4OW0A 2L83A 1SE2A 3AH7A 4RNAA 1YN5A 3MHZA 3EUB2 4J3OD 1TYGB 2LGIA 2L32A 3BYYB 4XE0A 1VRAB 2BW2A 1UNSA 4ITKA 3ZJVA 2QEJC 1T6BX 3OWEB 4LK0M 5HG2A 2AX5A 1JRPA 3NRZA 3NVWA 1VZ7A 3EA6A 2W54A 1JWUD 4YSZB 4IKGA 1QF6A 3KLSX 1N62A 2QMTA 4LTUA 3HRDD 1J7AA 2R61A 2VZKD 2BS3B 2IPKD 1KLGD 4JX1C 4D2KA 1GTEA 3EGRA 1YN3A 5TSSA 4HKZE 1BMLC 1TS2A 2BS4B 5BMHA 4KKIA 4EE2A 3HUIA 2M56B 4NJCA 4REZA 4KGRA 3P4PB 4US8A 5BMIA 1ET9A 3P42A 1IBXB 4KGTA 1C4PA 2J42A 1N5XA 2AQ2B 1HEZE 1LO5D 2IGHA 2JXTA 3RFZB 3BYTB 3AMZA 5EE9A 5BYQA 4A8XC 4TMAB 1QILA 4JWUC 4WURA 3ZYYX 3W2DA 3AEGB 2L52A 2L1AA 1BUIC 2Y3AA 3W1SA 1L0YB 2WDRB 2LMCA 3MC0B 1RFKA 3FILA 5HHDG 4GDKB 2INNE 3ABVB 1SSNA 1C77A 3AN1A 1NYQA 2IGGA 2BTEA 1D5XC 3H8HA 1WGKA 3ZJTA 1PGBA 3TSSA 5C2TB 3LYYA 1STEA 2DWQA 4PT5A 3U4EG 1E10A 4N58A 5BYRA 3GP7A 3Q8BA 1IGDA 1VZ6A 4US9A 4ZRPA 1FXAA 2QILA 2WXIA 1EU3A 4M0WA 2FE8A 2OHFA 3DWGC 4Q2JA 4JWSC 1N60A 3KQ4A 5LNK1 2YEPF 2BYTA 2LEKA 1GAQB 4XWWA 1AN8A 1RWSA 4P16A 3CF4A 1N63A 3DWMA 1FNVA 3VRBB 2RDHA 2FBWB 2RPVA 2WXGA 5FKAC 1TY0A 1ESFA 3NZ3A 1FCLA 2H88B 2WU5B 3AE1B 4WWMA 3VR9B 5FR3A 1TJEA 2KMMA 2EKIA 1SJED 2GI9A 1FO4A 1DGJA 4A90A 3AE4B 1K51A 1FRDA 4MT5A 4UDUC 1L6UA 2LFIA 3V05A 1DOIA 1YJJA 2KAJA 3MJ5A 2D5GA 4A6QA 4L1BA 4HKQA 3B9JA 1RM6C 4DXGA 3NVYA 1GB4A 1OQRA 2M0AA 4L23A 4KKJA 4YSXB 1ZOYB 3UI3A 1SB3C 2QSDA 4L2YA 4JPSA 2WP9B 4TQ1A 3LB8C 4R3DA 1I4RA 1TS4A 2PVOD 1PYWD 2PW9A 5EE1A 1UWXA 3AEAB 2RDGA 1ZXHA 3VR8B 1WWTA 1E7PB 3GS2A 4ZYSA 1VJKA 1ZE3D 3W5UB 2HDEA 3B2FA 1JWBD 3AE7B 2QJLA 1FMAD 4JE3B 4NAMA 2H89B 1IGCA 2E3TA 2PIAA 4FXCA 1JWMD 2NMQA 2W55A 3AE9B 2N9LA 2NTSA 3VQIA 2JWUA 2KWDA 1FFVA 4ARCA 1L0VB 1NYRA 1FIQA 4DXFA 1ENFA 2PKOA 3HVZA 3T3OA 2WXNA 4C7YA 1VDVA 1JMLA 1I4PA 1YN4A 1GTHA 1CK1A 3PO0A 3BWUD 1ET6A 3NVVA 3IAM1 2JU6X 3BK2A 4XDDA 1ROEA 4ZHPA 2WXRA 3FAHA 2KN4A 2EELA 1F2RI 3AE8B 2MH7A 3SEBA 1UGJA 1VLBA 1CQVA 3E56A 1C76A 2WDQB 1V1OA 1HZ6A 2WXMA 1QOBA 2MJ3A 1XLQA 1V1PA 2G9HD 2WXJA 1EWYC 2M19A 5BYSA 3MP9A 4YTMB 1SJHD 2CJNA 2PTLA 2I38A 1PFDA 1TS5A 1NEKB 5C3JB 2J53A 1D5ZC 1FCCC 2IGDA 5JXVA 1TKEA 1AYFA 2K9XA 3AM9A 1KTKA 1V1PB 2WDVB 1I4GA 3NS1A 3IT6B 3U52E 2WXHA 5H8YE 1ZDVA 1KRHA 2ICIA 4B0MA 2MJDA 4RGMA 4WH4A 3U7ZA 2G1EA 1DOYA 1I7HA 2WLBA 5HI1A 1L4DB 3FILB 2FUG1 1F0ZA 1Q10A 1SIJA 1OFFA 3AEFB 3TEXA 4RFBA 4C56C 2JSVX 1KLUD 1MHHE 1QQRA 2N0SB 5EE3A 1K53A 2XN9C 1P7EA 2N9KA 1JWSD 2VZKB 3P1MA 3Q69A 4YXDB 2ACZB 4O1NA 1J7BA 2WXQA 2V3NA 5BMGA 4RGNA 1UWMA 4OVZA 5AUIA 3AECB 1I4XA 3R8BA 4RCOA 1NVID 4DQOC 2INPE 2W3SA 4YTPB 3TEWA 4P6VF 1FRRA 3J9CA 2PMVA 1AWDA 1L6VA 1HXYD 1DOXA 1D4BA 2WNMA 2KACA 3WCQA 1DYQA 5D3DA 2W3RA 2WU2B 1QT9A 5D3IB 3TEYA 1JWAD 4TSSA 1TY2A 4A9AA 3NUHB 1XLNA 3O13A 5G5HA 2BT6A 4KX6B 3Q8EA 5H92C 3NVZA 4IDIA 1C4AA 1XXGA 2JYEA 3GB1A 1GT8A 1SXTA 1E9MA 1GOZA 1B1ZA 2BBCA 4HJGE 5D7GA 2CJOA 1XEEA 3IXSA 3SFEB 3ZJUA 1GPXA 4N59A 3BZDB 2ZW1A 4RGOS 2K5PA 2J4XA 1CZPA 2WXFA 5MPOA 2DLBA 4RH6A 3W5VB 4B0EA 1FNWA 2SAKA 4ARIA 1TKYA 2AQ1B 2MJEA 4OZBA 4MACA 3ZQ4A 4H2AA 5G5GA 4ZOHC 3BVZA 1WSPA 4XWTA 2YEPB 1SE4A 4ZRQA 5I4DA 1QOAA 4MH8A 2OEDA 1YQ3B 3P63A 1V8CA 2K22A 1C4CA 1FM0D 3TEZA 2E6XA 3PZ8A 1D5MC 1I4QA 4HROA 3LXFA 3Q8FA 2N7JA 1YJIA 4AQ7A 2KDMA 2KQ4X 3AEEB 2QIEB 4WQMA 4HRSA 3AE2B 1N61A 1TS3A 1TZOA 4KGSA 4RF1A 3IT4B 1MPEA 2MEKA 1N5WA 1WYGA 2JQRB 1XO3A 2BB6A 1Y56A 1C79A 3E9SA 1ZP0B 3I9V1 4A55A 1TKGA 1D6EC 3P4QB 1IUEA 2IDYA 1C9FA 3BVGA 1T5XD 1WXQA 1HA5A 3BIID 3IAS1 1JALA 1BXTA 4YTNB 2WXPA 1EWCA 2CU3A 2XNAC 3P4SB 2I2YA 1NENB 2K3UA 1L5PA 2DYMA 3PZ7A 3AB5A 1MVKA 3U2SC 3VRAB 2V3PA 1HQRD 5GXGB 2DYOA 3R2TA 3KWVA 4IOIE 2K0PA 1IBXA 2LUMA 1L4ZB 1V97A 2Q5WD 1PGAA 3BVMA 4WIPA 1R7SA 4RF0A 1AW7A 4TQ0A 5E6JA 1M4VA 2V4IB 3I57A 1C78A 4AS1A 1E0ZA 3TUOA 1K52A 4GDLB 2HTME 3CIRB 4YSYB 1I4HA 2SEBD 2TSSA 3N9YC 1QLBB 1YQ4B 1K50A 1B9RA 2GRIA 1VR9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EE1 A;  4YSZ B;  3AEA B;  1QF6 A;  3WCQ A;  1N62 A;  3VR8 B;  1WWT A;  1E7P B;  2W3R A;  1VJK A;  2WU2 B;  1QT9 A;  1SF0 A;  3HRD D;  3W5U B;  1JWA D;  3B2F A;  1J7A A;  4A9A A;  2BS3 B;  1JWB D;  1OQQ A;  4JX1 C;  3AE7 B;  1GTE A;  1FMA D;  1XLN A;  2QJL A;  5G5H A;  2BT6 A;  4KX6 B;  2H89 B;  5H92 C;  2E3T A;  2PIA A;  3NVZ A;  3ETR A;  4FXC A;  3FC4 A;  4IDI A;  1WRI A;  2W55 A;  2BS4 B;  3AE9 B;  4ZHO A;  1A70 A;  1GT8 A;  1NI3 A;  1E9M A;  1FFV A;  3HUI A;  1FXI A;  2M56 B;  4C80 A;  1L0V B;  1NYR A;  1FIQ A;  3AE5 B;  2CJO A;  4N6E B;  1ZUD 2;  3P4P B;  3SFE B;  4US8 A;  1GPX A;  4N59 A;  2PKO A;  3HVZ A;  4C7Y A;  1VDV A;  1N5X A;  1CJE A;  1GTH A;  1FFU A;  3AMZ A;  2K5P A;  5EE0 A;  5EE9 A;  3PO0 A;  1H7W A;  3NVV A;  1CZP A;  5MPO A;  4JWU C;  3W5V B;  1E6E B;  3ZYY X;  1ROE A;  3CWI A;  4ZHP A;  3AEG B;  1TKY A;  1XLP A;  2L52 A;  1KFY B;  1JQ4 A;  2MJE A;  1T3Q A;  3FAH A;  5G5G A;  2WDR B;  1JW9 D;  4ZOH C;  2Y5C A;  1RFK A;  3AE8 B;  2MH7 A;  3ABV B;  1VLB A;  1QOA A;  1YQ3 B;  2BS2 B;  3P63 A;  3AE6 B;  1RYJ A;  1V8C A;  2K22 A;  2WQY B;  1NYQ A;  2PVG C;  2WDQ B;  1FM0 D;  3AN1 A;  1WGK A;  4YT0 B;  1QOB A;  2MJ3 A;  4HRO A;  1XLQ A;  3KWL A;  5AUK A;  5C2T B;  3LXF A;  1JRO A;  1QOF A;  2DWQ A;  2JX5 A;  1EWY C;  1YJI A;  2M19 A;  1E10 A;  4N58 A;  3AEE B;  4YTM B;  3AEB B;  2QIE B;  4WQM A;  4HRS A;  3AE2 B;  1N61 A;  2CJN A;  4US9 A;  1QOG A;  1PFD A;  1FXA A;  1PDX A;  1NEK B;  2WS3 B;  5C3J B;  1N5W A;  1WYG A;  1H7X A;  1PUT A;  3W9C B;  2JQR B;  1XO3 A;  3AED B;  1TKE A;  1AYF A;  2K9X A;  2OHF A;  3AM9 A;  3SR6 A;  3DWG C;  1XLO A;  4JWS C;  1ZP0 B;  2WDV B;  1J7C A;  1KF6 B;  1N60 A;  1TKG A;  3P4Q B;  3NS1 A;  1IUE A;  1GAQ B;  2LEK A;  3RPF C;  1RWS A;  4USA A;  3BII D;  3CF4 A;  1WXQ A;  1N63 A;  3DWM A;  4C7Z A;  5H8Y E;  1JAL A;  3VRB B;  4YTN B;  3AE3 B;  2FBW B;  3B2G A;  1KRH A;  2CU3 A;  2MJD A;  3P4S B;  3SFD B;  1NEN B;  2G1E A;  3L4P A;  2B76 B;  2H88 B;  1DOY A;  1L5P A;  2WU5 B;  3AE1 B;  1I7H A;  1ZXI A;  2WLB A;  3AB5 A;  4WWM A;  3VR9 B;  3P4R B;  2DBY A;  1TJE A;  1F0Z A;  1SIJ A;  3VRA B;  1OFF A;  3AEF B;  2EKI A;  2KMM A;  3AV8 A;  5GXG B;  1FO4 A;  1DGJ A;  2L83 A;  3AE4 B;  2N0S B;  3AH7 A;  5EE3 A;  1FRD A;  3P1M A;  4YXD B;  1L6U A;  2ACZ B;  3EUB 2;  1TYG B;  1DOI A;  1YJJ A;  1J7B A;  1V97 A;  2KAJ A;  2Q5W D;  1R7S A;  3B9J A;  1RM6 C;  1UWM A;  3NVY A;  5AUI A;  4ITK A;  3AEC B;  1OQR A;  1NVI D;  4YSX B;  2AX5 A;  1ZOY B;  4YTP B;  2W3S A;  1E0Z A;  1SB3 C;  4P6V F;  1FRR A;  2HTM E;  3CIR B;  2WP9 B;  4YSY B;  1JRP A;  3NRZ A;  1AWD A;  3LB8 C;  1QLB B;  3NVW A;  1YQ4 B;  1B9R A;  1L6V A;  1DOX A;  4LTU A;  2PVO D;  2W54 A; 
#chains in the Genus database with same CATH topology
 2CR5 A;  2MBO A;  2MHJ A;  4DBG A;  2NBW B;  4LNK A;  1SF0 A;  3ML8 A;  4LNI A;  3Q14 C;  3RYT A;  4DWF A;  1OQQ A;  2L7R A;  3MC8 A;  5JHB A;  5G55 A;  3L17 A;  5C23 A;  3DBR B;  1F1H A;  3A4S C;  1WRI A;  2GBN A;  3MTN B;  4ZHO A;  1A70 A;  2V0G A;  5CTR C;  4ZDV A;  5CHV C;  3AE5 B;  2J52 A;  4DDG D;  1PGX A;  1E90 A;  3DBS A;  1CJE A;  4W9J A;  3Q8C A;  1ZDX A;  1TTN A;  3W1S C;  2EMT A;  3CWI A;  1JQ4 A;  3NJT A;  1T3Q A;  2LHD A;  3GE3 C;  3R3M A;  2BS2 B;  1XF5 L;  1RYJ A;  3ZRC A;  2WQY B;  5AEK B;  2PEA A;  1QOF A;  4RM8 A;  3Q8A A;  1WE6 A;  4RGT A;  4W9K A;  1QOG A;  1PDX A;  2WS3 B;  2Y5P A;  4K3B A;  2AL3 A;  2LRW A;  3V60 A;  3SR6 A;  4HEA 1;  3A1Q B;  3AUL A;  1J7C A;  2LVQ A;  3RPF C;  4XC2 A;  3LDZ E;  4USA A;  3IHP C;  4EEW A;  3RI7 C;  1QKZ A;  2ON8 A;  2WWZ A;  4PS8 A;  2KNB A;  1AAR A;  4OW0 A;  3HVD A;  4P1C C;  2L83 A;  3QCA A;  2N7E A;  2KDE B;  3EUB 2;  1TYG B;  4K7S A;  2BYV E;  3RNC C;  1UNS A;  3PT2 B;  1TT5 B;  3OWE B;  5HG2 A;  3OJ3 A;  3KUC B;  1Y8R C;  4IKG A;  3KLS X;  4NJ6 A;  2R61 A;  2YLM A;  3DBL I;  1KLG D;  2FCM A;  2L0F A;  1GTE A;  5D6J B;  1YN3 A;  2D3C A;  2KD0 A;  2KJR A;  4ANW A;  3HUI A;  4NJC A;  1L2N A;  1IPG A;  1ISN A;  4B6W A;  4KGR A;  5BMI A;  2BVC A;  1IBX B;  4JQW C;  2IGH A;  4DXA B;  1J8C A;  4JWU C;  2FCN A;  2Y3A A;  3W1S A;  2WDR B;  3MC0 B;  1RFK A;  3WA0 A;  3FIL A;  1LXD A;  1YJ1 A;  2A5U A;  1C77 A;  3VVW B;  1LM8 B;  3R66 C;  2BTE A;  1D5X C;  3S2A A;  3ZJT A;  1WGK A;  4M02 A;  2RD0 A;  4PT5 A;  1N6Z A;  5IOI A;  4N58 A;  4PYZ A;  1UEL A;  1IGD A;  3H7P B;  4HWI B;  3A9K A;  1EU3 A;  4MEM A;  4KZ0 A;  3I5J C;  2ZPY A;  3OJ4 B;  4PK1 A;  2ZEQ A;  1EUV B;  1N60 A;  1RAX A;  2YEP F;  3ONS A;  4XWW A;  2MWS B;  3VXW A;  2MP2 B;  1RWS A;  4F7Z A;  3VRB B;  4FA6 A;  3ECI A;  5FKA C;  1TY0 A;  3VUY A;  3DBH B;  2KJ6 A;  2H88 B;  4M8N A;  3AE1 B;  2X8X X;  2KMM A;  4KZC A;  3DCG A;  1K51 A;  4G50 A;  1XQQ A;  4UDU C;  1DOI A;  3MJ5 A;  4A6Q A;  2D5G A;  1WGD A;  1OQR A;  2IO0 B;  2L3Z A;  4L23 A;  4KKJ A;  4A3P A;  2JF5 A;  2NS5 A;  3UI3 A;  1VCB A;  4EFO A;  3ZTC A;  1WF9 A;  4DHJ B;  3Q3O C;  1WX9 A;  2PVO D;  1PYW D;  2JUO A;  2EMS A;  2ZZP B;  2RDG A;  1BT0 A;  1P0R A;  2GMI C;  3VR8 B;  1WI0 A;  3W5U B;  1JWB D;  4JE3 B;  2H89 B;  1IGC A;  3H9D A;  3VQI A;  2KWD A;  4GIV A;  1NYR A;  1FIQ A;  2JZZ A;  5D2M B;  5IAA C;  4S17 A;  3ZNI D;  2NR2 A;  4W9H A;  3HVZ A;  2WXN A;  1I35 A;  1VDV A;  1YN4 A;  2KX0 A;  1GTH A;  5EDS A;  1CK1 A;  2KC2 A;  4P1B C;  3BWU D;  1ET6 A;  3NVV A;  2WGS A;  2WXR A;  2N7D A;  3HIZ A;  4LNO A;  1F2R I;  4HDQ A;  3NHE B;  3UIO B;  3SEB A;  1VLB A;  1CQV A;  2O2V A;  4II2 B;  2NVU I;  1HZ6 A;  2KFJ A;  3JYU A;  4P7I A;  2G4D B;  3KYC D;  5BYS A;  3MP9 A;  4YTM B;  4IM0 A;  1SJH D;  2FAZ A;  3PLV A;  3GZN I;  4GDL A;  3OAW A;  5JXV A;  3AM9 A;  2WDV B;  4KDL B;  5IA7 A;  1S1Q B;  5J17 A;  4HK2 A;  3QC8 B;  1WGY A;  3VTV A;  4OVV A;  4RGM A;  3M63 B;  1Q1O A;  2G1E A;  1WJ4 A;  4K1R B;  4W9I A;  3TEX A;  5LLI A;  1F9J A;  3WAL A;  5EE3 A;  1K53 A;  2N9K A;  1JWS D;  2VZK B;  4O1N A;  1J7B A;  5BMG A;  1UWM A;  2GBM A;  3RNE C;  1TBE A;  1I4X A;  3R8B A;  2M17 A;  1NVI D;  4RCO A;  2M4N A;  3PRM B;  3NZU A;  1D4B A;  2WNM A;  1QT9 A;  1JWA D;  4NQK E;  4TSS A;  1TY2 A;  2BKF A;  1XLN A;  3O13 A;  4KX6 B;  4NPN A;  1Q0W B;  4C00 A;  2KWV B;  2N1W A;  3GB1 A;  1E9M A;  1B1Z A;  2BBC A;  5D7G A;  2MLB A;  1XEE A;  2JRH A;  2WX0 A;  3SFE B;  2KK8 A;  1WMH A;  1LFD A;  3ENE A;  1RFA A;  2C7N B;  2FCS A;  1CZP A;  3AI5 A;  2DLB A;  4RH6 A;  5MPO A;  3W5V B;  3PPA A;  2BGF A;  2AQ1 B;  4OZB A;  2N1V A;  2D3B A;  3QQ8 B;  1WSP A;  4ZRQ A;  3B0A A;  2Y5B B;  3P63 A;  1V8C A;  2V4L A;  4W9F A;  2KFK A;  2CU1 A;  2KLG A;  4AJY B;  2E6X A;  1F52 A;  4HDO A;  4HRO A;  3LXF A;  1WJU A;  3AEE B;  2QIE B;  1H8C A;  4RF1 A;  1TZO A;  1N5W A;  3PVL A;  2JQR B;  1C79 A;  3E9S A;  1ZP0 B;  1D6E C;  3BVG A;  4IWQ A;  2N9X A;  2CU3 A;  1HTO A;  1NEN B;  1MFW A;  2DYM A;  3PZ7 A;  2C5L C;  4JL9 A;  3U2S C;  3VRA B;  1HQR D;  5GXG B;  1LQB A;  3JSV B;  4IWP A;  4XZ4 A;  4WIP A;  3L10 B;  5E6J A;  1M94 A;  3I57 A;  2UU7 A;  2OJW A;  4NAW A;  3N1X C;  2TSS A;  1YQ4 B;  1B9R A;  2BKR B;  5JZE B;  4LTU A;  3JW0 X;  4ZRI A;  2IO2 B;  2M1M A;  4LLG M;  2KYW A;  3T3N A;  2RMM A;  4NY0 A;  1SBB B;  1NI3 A;  1WYW B;  2FID A;  2R2O A;  4OHJ A;  1SEB D;  4EZL A;  4IW0 A;  1T0S C;  1FFU A;  5EE0 A;  2WXK A;  1H7W A;  2KMC A;  1WGH A;  2C7H A;  1OTR B;  2ONQ A;  1MHX A;  4OZC A;  2ZVO A;  4MM3 A;  2Y5C A;  4LDT D;  1ACC A;  3PHX B;  2VH1 A;  3AE6 B;  2AQ3 B;  4YT0 B;  3IG3 A;  3C8Y A;  4LNF A;  5TR5 A;  5IN7 A;  3T8M A;  4N9F 4;  3AEB B;  2NCN A;  2NTT A;  3LJ3 A;  1T0Y A;  1EM7 A;  2Z8L A;  2JZP A;  1G6J A;  2QDF A;  1PUT A;  3UGB B;  4HVB A;  3AED B;  4OZA A;  1KF6 B;  2LJI A;  4LNN A;  3DHH C;  4C7Z A;  2MX2 A;  2DZJ A;  2GB1 A;  2K8H A;  1IYF A;  2J7Q B;  3SFD B;  1MI0 A;  2B76 B;  3TIX A;  1ZXI A;  2DBY A;  1HZ5 A;  3AV8 A;  1P7F A;  3ZO5 B;  4BKG A;  4HPM B;  1SE2 A;  3AH7 A;  2IY1 B;  3PRP B;  2L8J A;  1MG4 A;  3MHZ A;  2LGI A;  2L32 A;  4XE0 A;  1VRA B;  4NNJ B;  2BW2 A;  2QEJ C;  1T6B X;  5HKH A;  1YQB A;  1JRP A;  3NRZ A;  4HCP B;  3NVW A;  1E7V A;  4E74 A;  2W54 A;  4A20 A;  4CO7 A;  1JWU D;  3U8Z A;  1N62 A;  3UIP B;  2MBH A;  3HRD D;  2BS3 B;  2DZK A;  4S0R A;  5TSS A;  1BML C;  3DVG X;  4W9L A;  2BS4 B;  5BMH A;  4FBJ B;  2KO3 A;  4EE2 A;  4TV3 A;  3ZDT A;  2GOW A;  1Z2M A;  1WIA A;  1ET9 A;  4KGT A;  3SHQ A;  2C60 A;  1YX5 B;  2AQ2 B;  1HEZ E;  3BYT B;  5EE9 A;  4NQL B;  4TMA B;  1QIL A;  3ZYY X;  2O6V B;  3RZF A;  3W2D A;  2OJR A;  2L52 A;  3MC9 A;  3V6C B;  4QAY A;  1L0Y B;  2LMC A;  3A9J A;  4GDK B;  1VD2 A;  1NYQ A;  4II3 B;  3A4R A;  1WZ3 A;  2XK5 B;  4WJO A;  3GP7 A;  3Q8B A;  4ZRP A;  1VZ6 A;  4FLH A;  1FXA A;  4M0W A;  2FE8 A;  2OHF A;  1NBF C;  3DWG C;  4JWS C;  4F1S A;  1GAQ B;  1U4A A;  3CF4 A;  2B3A A;  3DWM A;  2IZV B;  3RN9 C;  2FBW B;  2RPV A;  2J0M A;  2WXG A;  1OEY A;  2I1K A;  2WU5 B;  4FUL A;  3VR9 B;  5FR3 A;  1TJE A;  2K1F A;  3AU5 A;  2YVC A;  4BKS A;  1DGJ A;  2VH2 A;  4MT5 A;  5LXH A;  2LFI A;  3V05 A;  4L1B A;  2G4S A;  4KSK C;  3B9J A;  4DXG A;  4GU2 A;  2M0A A;  3A33 B;  4JPS A;  1R4M I;  3LB8 C;  4NJ7 A;  4R3D A;  1OEY J;  2PW9 A;  4AUQ C;  3WIM A;  4ZYS A;  2JVC A;  3B2F A;  5KHQ A;  3AE7 B;  2QJL A;  2D11 A;  4BAX A;  1JWM D;  2NMQ A;  2W55 A;  2ZNV B;  2JWU A;  4ARC A;  1L0V B;  3EFC A;  2K6Q A;  1R4M B;  3ZIM A;  4K7W A;  1KJT A;  4DXF A;  2WX1 A;  2PKO A;  4C7Y A;  1I4P A;  4JGH B;  1Z5S B;  2OOB B;  3IAM 1;  1I42 A;  1V5T A;  2DAF A;  3FKY A;  3ALB A;  4K7U A;  2K6D B;  2HJ8 A;  4KIK B;  2EEL A;  3AE8 B;  2MH7 A;  1UGJ A;  2FIF A;  2RR9 A;  1C76 A;  3IBE A;  4BFR A;  4KSL C;  1V1O A;  2PPH A;  2WXM A;  1QOB A;  1XLQ A;  1V1P A;  3JVZ X;  5DPS A;  2IBI B;  2BQQ A;  3WAM A;  2CHX A;  3L08 A;  2KHW B;  2CJN A;  2I38 A;  1NEK B;  1TS5 A;  4HLE A;  1V86 A;  2KTR A;  1XT9 B;  2NBU A;  1R4N B;  1WR1 A;  1I4G A;  3NS1 A;  4EZK A;  1WM2 A;  3RCZ A;  2WXH A;  3AXC A;  4FHJ A;  2LGY A;  5H8Y E;  2K8B A;  2IO1 B;  3PGE A;  3PRZ A;  4FN2 A;  4BOS C;  2ICI A;  2ZVN A;  2D10 A;  1L4D B;  2VRR B;  4ICV A;  3DBH I;  4TKN A;  1YOV B;  1OFF A;  3AEF B;  2JSV X;  2N0S B;  2XN9 C;  3Q69 A;  4G0N B;  4IUM B;  3UIN B;  1UF0 A;  4ACF A;  2V3N A;  5BO4 B;  4RGN A;  4OVZ A;  3RUI B;  4WWN A;  3R7Q A;  2INP E;  4YTP B;  3TEW A;  4P6V F;  1FRR A;  2MA9 B;  3KVF B;  2JZ3 B;  3NOB A;  2FUH B;  2KTF A;  2K39 A;  3M95 A;  4HJK A;  3TEY A;  3NUH B;  5G5H A;  5H92 C;  3U30 A;  4FJY A;  3SDL C;  1GOZ A;  2D07 B;  3OLM D;  2CJO A;  3IXS A;  3ZJU A;  2KX3 A;  3A1Q A;  3BZD B;  2ZW1 A;  2PE6 B;  3VAW A;  4CYE A;  1V9J A;  1WJN A;  2J4X A;  3O65 B;  4K3C A;  4BKT A;  3QX1 A;  3ZQ4 A;  2RDB C;  4ZOH C;  4E3C A;  4MH8 A;  2OED A;  5FR6 A;  2K22 A;  1FPY A;  1C4C A;  1T0R C;  1FM0 D;  3PZ8 A;  1D5M C;  4MH0 E;  3Q8F A;  2BF8 B;  1V80 A;  2N7J A;  4WAA A;  2LXA A;  1YJI A;  2KQ4 X;  4LJO B;  1WFY A;  2D3G A;  2NBV B;  4KGS A;  1EF5 A;  1TS3 A;  3IT4 B;  1MPE A;  2MEK A;  2GBJ A;  5AZG A;  2BB6 A;  2V9H A;  1Y56 A;  3K9O B;  2CKH B;  4A55 A;  2IDY A;  1T5X D;  1WXQ A;  3L54 A;  1BXT A;  4I6N B;  1EWC A;  4MEL A;  3RNA C;  3GOE A;  4BVU C;  2V3P A;  3R2T A;  2MBE A;  2K0P A;  1UH6 A;  3HM6 X;  1IBX A;  3TBL D;  1JRU A;  2LUM A;  1R7S A;  1AW7 A;  4TQ0 A;  1M4V A;  2WYQ A;  3TUO A;  2DAJ A;  2HTM E;  1I4H A;  1V5O A;  2C7M B;  3PS6 A;  3WAN A;  2ASQ A;  3N9Y C;  1QLB B;  1TIF A;  1K50 A;  4MJS B;  3ZRF A;  3PTF C;  4DDI D;  2ZW0 A;  4NAW B;  2GLS A;  5J2R A;  3H6N A;  1F77 A;  3ETR A;  3FC4 A;  3QAQ A;  2LHE A;  1FEH A;  2LZ6 A;  3H7P A;  1FXI A;  3DVN U;  1F2R C;  2NPT B;  3Q2A C;  1FD6 A;  4EKU A;  2JPH A;  1XCT L;  2GBR A;  4BOZ B;  2HJ1 A;  2DZI A;  1XCQ L;  5HFY A;  4C4V B;  2DNF A;  2MP2 A;  1UBQ A;  4IM3 A;  1E6E B;  2KDF B;  3DHG C;  2N4F A;  4XDC A;  1JW9 D;  1MJD A;  4MGY E;  1GC6 A;  4W9E A;  4MM3 B;  4BZA A;  3RMK C;  1JRO A;  1UZX B;  2RSU A;  3EFU A;  5JH5 C;  1K8R B;  1E7U A;  1H7X A;  3RUL A;  2HTH A;  3L16 A;  4BBN F;  2JT4 B;  1XLO A;  4NZL B;  4B9K A;  4MSQ B;  3KUZ A;  3AE3 B;  2RPQ A;  3ZXR A;  4WAF A;  1UGM A;  2V3S A;  2W82 A;  2LJ5 A;  3BK1 A;  3HHM A;  3RT3 B;  3MFG A;  2JYT A;  3L13 A;  2GBK A;  2WXO A;  2KOX A;  4RNA A;  3BIN A;  1YN5 A;  4PS3 A;  2MBB B;  4WWP A;  5GMV A;  4B95 A;  4LK0 M;  2AX5 A;  4EZJ A;  3T9L A;  4EOY A;  4XGA B;  1VZ7 A;  3EA6 A;  1QF6 A;  2QMT A;  4KV2 A;  2IPK D;  3EGR A;  4M01 A;  4HKZ E;  1P1A A;  3RNG C;  3EC8 A;  3KW5 B;  4GXB A;  3TJP A;  4KKI A;  4CHK A;  1RLF A;  2LGD A;  4REZ A;  4WWO A;  1WXA A;  3P4P B;  1WZ0 A;  4US8 A;  3RZW C;  1GJZ A;  3P42 A;  5D94 A;  2J42 A;  1N5X A;  4GMV A;  3RFZ B;  2JXT A;  5BYQ A;  4A8X C;  4DHZ E;  4WUR A;  4I6L B;  3N30 A;  4IWO A;  3ZNG C;  1BUI C;  5HHD G;  1P9D U;  3ABV B;  2INN E;  4BKS D;  2QC8 A;  3AN1 A;  2IGG A;  1E8Z A;  2D2Q A;  2MRP A;  3TSS A;  4KVG B;  1STE A;  3U4E G;  2LAS A;  2MBQ A;  2Z0E B;  4US9 A;  3CMM B;  3M3J A;  3PSE B;  4YL8 A;  1LGR A;  3NS8 A;  2BYT A;  1AN8 A;  1N63 A;  1FNV A;  2KC1 A;  3EEC A;  3V61 A;  3NZ3 A;  4M00 A;  4F8C B;  3SU8 X;  1FO4 A;  4JLC A;  1UBI A;  1FRD A;  2FCQ A;  2K25 A;  1GB4 A;  1GC7 A;  2QSD A;  4L2Y A;  4A3O A;  5DPW A;  2KVR A;  1WJ6 A;  1TS4 A;  1UWX A;  3AEA B;  2BWF A;  1ZXH A;  1WWT A;  1ZE3 D;  2HDE A;  2KQS A;  1FMA D;  3AU4 A;  2LGS A;  4HXD A;  4NAM A;  2PIA A;  2RGF A;  3AE9 B;  2JRI B;  2NTS A;  4LDT B;  3UQB A;  1PQS A;  2KVZ A;  1HTQ A;  4G3X B;  3GE8 C;  4DK5 A;  3APF A;  4LCD E;  2IND C;  3PO0 A;  3VTW A;  2MSE D;  1ROE A;  2QHO A;  2KWU B;  3U7D A;  2KN4 A;  1IP9 A;  2WHI A;  2IYD B;  3KH0 A;  1UD7 A;  3JSV A;  2KKC A;  2JXX A;  2G45 B;  2DHZ A;  4EUT A;  2G9H D;  2WXJ A;  1EWY C;  3QJZ A;  2M19 A;  2INC C;  3ZVV A;  5L83 A;  2PTL A;  2BWE S;  3ZUN A;  1PFD A;  5C3J B;  2Z0D B;  1FCC C;  2IGD A;  1TKE A;  1V1P B;  4ZRJ A;  1J19 A;  3B08 A;  5KHO A;  3IT6 B;  3U52 E;  1X1M A;  2LRU A;  1ZDV A;  1KRH A;  4B0M A;  3PZD A;  3DQV A;  4WH4 A;  3U7Z A;  4FAD A;  1I7H A;  5HI1 A;  3FIL B;  3CST A;  4GGQ A;  1SIJ A;  2BPS A;  1GNU A;  4RFB A;  1MHH E;  1WRD B;  3TL5 A;  1P7E A;  3P1M A;  4YXD B;  2ACZ B;  2QCZ A;  3Q3J A;  4FJV B;  4XX5 A;  2W3S A;  3A9K B;  1E8W A;  2PMV A;  1AWD A;  1L6V A;  1HXY D;  1DOX A;  2ZCB A;  3EHV A;  2KAC A;  3VTU A;  3WCQ A;  3WAP A;  3DVN V;  5D3D A;  2WU2 B;  1EO6 A;  5D3I B;  1YX6 B;  3R7R A;  2BT6 A;  2EKE C;  3L0W B;  5E6P A;  2Z59 B;  1C4A A;  1XXG A;  3MJW A;  1GT8 A;  1SXT A;  3ZNH B;  1TZ1 A;  1WGR A;  4HJG E;  3SD5 A;  1WR6 E;  4MGI E;  3UF8 A;  3VFK A;  2ZJD A;  4RGO S;  4IM2 A;  2WXF A;  2M0X A;  4ZRK A;  4B0E A;  1FNW A;  4ARI A;  2MJE A;  4URK A;  1RRB A;  3Q3M C;  4GB9 A;  4MGK E;  5G5G A;  4XWT A;  4PYU A;  2YEP B;  1SE4 A;  5I4D A;  1YQ3 B;  3MHS D;  4I6P A;  1V81 A;  2C9W B;  1I4Q A;  4ICU A;  5CHF A;  1J0G A;  2KDM A;  1WXM A;  1WH3 A;  4WQM A;  4HRS A;  3AE2 B;  2N9E B;  3PLU A;  1XO3 A;  2KXJ A;  3I9V 1;  1TKG A;  2MCN B;  1IUE A;  1R4N I;  3VHT C;  2G3Q B;  1C9F A;  1HA5 A;  3IAS 1;  1JAL A;  2BYE A;  4YTN B;  1Q5W B;  2KAN A;  1KOT A;  2XNA C;  1A5R A;  3QAR A;  2I2Y A;  2ZNV C;  4KDI C;  3H1U A;  4HPP A;  3X23 A;  2O2V B;  2CS4 A;  2AYO B;  4IOI E;  1L4Z B;  1PGA A;  3BVM A;  3PHW B;  4PS7 A;  2MW5 A;  1C78 A;  4AS1 A;  2O6V A;  1E0Z A;  1K52 A;  4GDL B;  3IFW B;  3QIJ A;  1E8Y A;  3CIR B;  4YSY B;  4AWJ A;  2SEB D;  4GDK A;  3ZNZ B;  3DBL B;  3ZGZ A;  4YWG G;  2J0J A;  3VH3 B;  1GB1 A;  1XD3 B;  1JCK B;  4ZYN A;  2KWC A;  2XK5 A;  3B1L X;  1ZGU B;  4W9D A;  1NI2 A;  5CX3 A;  5J18 A;  3D32 A;  2WXL A;  4C80 A;  3V6E B;  4N6E B;  4HPL B;  3I3T B;  1ZUD 2;  2IJ0 A;  2X38 A;  5FK9 C;  4DHJ D;  4OVU A;  3URY A;  3X0W A;  2KDI A;  2BB5 A;  2PLP A;  3IVF A;  1XLP A;  1KFY B;  2L76 A;  3APC A;  3V3X A;  2JWZ A;  1YNT E;  2PVG C;  2L05 A;  1L0X B;  5G2N A;  1SE3 A;  1KH0 A;  2MQJ A;  3KWL A;  5AUK A;  1ZPS A;  4LJP B;  1VZ8 A;  2JX5 A;  4AP4 C;  3R2I A;  1S3S G;  2A4Z A;  1P98 A;  1YMH E;  3W9C B;  2ZCC A;  2PE9 A;  3HM3 A;  1WMH B;  1EU4 A;  1FNU A;  4CQN A;  1WGG A;  2KLC A;  4MGZ E;  1UUP A;  1SGH A;  1WXV A;  4HCN B;  4IG7 B;  2J0K A;  3B2G A;  2BYF A;  2KMA A;  4GLS C;  1HE8 A;  3L4P A;  1WX7 A;  2LVO A;  3TMP B;  3P4R B;  5T8I A;  1KM7 A;  2KFK B;  3NZS A;  5L95 C;  4J3O D;  3QK0 A;  3BYY B;  3ZJV A;  4ITK A;  2W9N A;  3CF6 E;  3W1Y A;  2M8S A;  2KT7 A;  1ZKH A;  4KIK A;  3PRE A;  4GN1 A;  3ZKJ C;  4YSZ B;  1GG3 A;  4MDK E;  2AWT A;  2PJH A;  3ZXV A;  1J7A A;  2VZK D;  4D2K A;  4JX1 C;  1TS2 A;  3RNF C;  2M56 B;  2WDT B;  4BBN C;  3KUD B;  1T0Q C;  1C4P A;  3H7S A;  1LO5 D;  2KN5 A;  3AMZ A;  1SIF A;  4RM9 A;  1E5W A;  3C19 A;  3AEG B;  2L1A A;  4XYC A;  5DPT A;  1V2Y A;  3N1Z C;  3CSF A;  1SSN A;  2REX A;  1QZE A;  3H8H A;  1PGB A;  4ANU A;  2JY6 A;  4ASW C;  5C2T B;  3LYY A;  2DWQ A;  1SE9 A;  1E10 A;  3GZN B;  5BYR A;  4DHZ B;  2QIL A;  3DPD A;  1WY8 A;  2WXI A;  3I63 C;  4TUU A;  3VDZ A;  3UQA A;  4Q2J A;  1H4R A;  3KQ4 A;  5LNK 1;  2LEK A;  4P16 A;  2N9P C;  2RDH A;  1WM3 A;  5IP4 D;  2DEN B;  4K81 A;  1ESF A;  1FCL A;  4WWM A;  2EKI A;  1SJE D;  2GI9 A;  4A90 A;  2L00 B;  3AE4 B;  1L6U A;  1YJJ A;  2KAJ A;  4HKQ A;  2FNJ B;  1RM6 C;  4WJN A;  3NVY A;  2KQ7 A;  4YSX B;  2XBB C;  1ZOY B;  3C0R B;  4IC7 B;  1SB3 C;  4AJW A;  2WP9 B;  3RNB C;  4TQ1 A;  1C3T A;  1I4R A;  4X57 B;  3QWZ B;  5EE1 A;  3GS2 A;  1E7P B;  1VJK A;  4E71 A;  3N20 C;  2E3T A;  5DPR A;  4FXC A;  2N9L A;  2ZPN A;  2D3A A;  1C1Y B;  1WXS A;  1YD8 U;  3DOW A;  1FFV A;  4ANV A;  1ENF A;  3T3O A;  2XEW A;  1JML A;  4J6I A;  3K9P B;  1GUA B;  2CHW A;  5E6N A;  2JU6 X;  4AOF A;  3BK2 A;  4XDD A;  1E8X A;  4ZHP A;  2HD5 B;  4ANX A;  4W9G A;  3FAH A;  5CHW A;  2DZM A;  4M8M A;  3E56 A;  2LD9 A;  1WX8 A;  2LI5 A;  4RMA A;  2WDQ B;  2MJ3 A;  4GSW A;  1D3Z A;  2CHZ A;  3KYD D;  3APD A;  3ZLZ A;  2UYZ B;  1EF1 A;  3PV1 A;  1CMX B;  2J53 A;  3VH4 B;  1D5Z C;  2L0T A;  1AYF A;  2K9X A;  1KTK A;  4MJS A;  2DYB A;  2LGX A;  5E6O A;  4WJP A;  4G11 A;  2MJD A;  1DOY A;  3A9J B;  2WLB A;  4FJZ A;  2FUG 1;  1F0Z A;  1Q10 A;  5AZF A;  1MG8 A;  4C56 C;  2NPT A;  1KLU D;  1L7Y A;  1QQR A;  3DVG Y;  2V1Y A;  3P2B A;  1P3Q U;  2LUE A;  2WXQ A;  2I1J A;  4C4V A;  1YIW A;  5AUI A;  3AEC B;  3NY5 A;  4DQO C;  3DHI C;  1FXT B;  4M0W B;  3HK0 A;  3J9C A;  4GOC A;  3RD2 A;  4W9C A;  2AEH A;  3Q3N C;  4WJQ A;  1OQY A;  1DYQ A;  2W3R A;  1ZW7 A;  3N3K B;  4A9A A;  3BY4 B;  4FHK A;  3V62 A;  2IY0 B;  3Q8E A;  3NVZ A;  4IDI A;  2JYE A;  2AL6 A;  3ZTD A;  1GPX A;  2LXC A;  4N59 A;  3ZW3 A;  3NG0 A;  3Q6B A;  3QA8 A;  2K5P A;  2UWQ A;  5C1Z A;  2SAK A;  3N1Y C;  1TKY A;  4JIO U;  1KLV A;  4MAC A;  4H2A A;  2R2Q A;  3BVZ A;  5IKC M;  5AZH A;  2KJH B;  1QOA A;  2K8C A;  5LXI B;  1V6E A;  3TEZ A;  3ML9 A;  1V49 A;  1OGW A;  3DDC B;  4AQ7 A;  2DX5 B;  1N61 A;  2O6V D;  5IO9 A;  1WYG A;  2LVP A;  3WAO A;  3P4Q B;  3BII D;  3N32 A;  3VUX A;  3ZDM C;  2LWP A;  2WXP A;  5JHA A;  1WE7 A;  3P4S B;  1NDD A;  2KZR A;  1TGZ B;  2K3U A;  1L5P A;  3OG5 A;  3AB5 A;  1MVK A;  3VUW A;  4WQO B;  3TCA A;  2DYO A;  3KWV A;  1V97 A;  2IO3 B;  3M62 B;  2Q5W D;  4RF0 A;  3DBR I;  2HE7 A;  3Q3F A;  2V4I B;  3QHT A;  2KDB A;  4MSM B;  2KTR B;  5DCN A;  2GRI A;  1VR9 A; 
#chains in the Genus database with same CATH homology
 3ZGZ A;  4YWG G;  1SF0 A;  4LLG M;  1OQQ A;  2ZW0 A;  4NAW B;  1GB1 A;  1JCK B;  1F77 A;  3ETR A;  3FC4 A;  1WRI A;  2LHE A;  4ZHO A;  1A70 A;  1FEH A;  2RMM A;  3T3N A;  1SBB B;  2V0G A;  1NI3 A;  4OHJ A;  2WXL A;  1FXI A;  1SEB D;  4C80 A;  1F2R C;  4N6E B;  3AE5 B;  2J52 A;  1ZUD 2;  2IJ0 A;  2X38 A;  1FD6 A;  5FK9 C;  1PGX A;  1XCT L;  1CJE A;  1XCQ L;  3URY A;  5HFY A;  1FFU A;  5EE0 A;  2WXK A;  3Q8C A;  1ZDX A;  1H7W A;  2BB5 A;  1E6E B;  2PLP A;  3CWI A;  1XLP A;  1KFY B;  2ONQ A;  1JQ4 A;  1MHX A;  4OZC A;  1T3Q A;  2LHD A;  4XDC A;  1JW9 D;  2Y5C A;  1ACC A;  2BS2 B;  3V3X A;  3AE6 B;  1RYJ A;  1XF5 L;  1YNT E;  2WQY B;  2PVG C;  1L0X B;  2AQ3 B;  1SE3 A;  4YT0 B;  1KH0 A;  3C8Y A;  4MM3 B;  3KWL A;  5AUK A;  1ZPS A;  1JRO A;  1QOF A;  1VZ8 A;  2JX5 A;  3R2I A;  3Q8A A;  3AEB B;  2NTT A;  4RGT A;  1QOG A;  1EM7 A;  2Z8L A;  2JZP A;  1PDX A;  2WS3 B;  1YMH E;  1H7X A;  1PUT A;  2Y5P A;  3W9C B;  3AED B;  3SR6 A;  4HEA 1;  1EU4 A;  1FNU A;  4OZA A;  1XLO A;  4NZL B;  1J7C A;  1KF6 B;  4CQN A;  2LJI A;  1UUP A;  3RPF C;  4C7Z A;  4USA A;  2GB1 A;  1QKZ A;  3AE3 B;  4WAF A;  3B2G A;  2ON8 A;  2W82 A;  3SFD B;  3BK1 A;  1MI0 A;  4GLS C;  3L4P A;  2B76 B;  3MFG A;  2JYT A;  1ZXI A;  3P4R B;  2DBY A;  1HZ5 A;  5T8I A;  3AV8 A;  1P7F A;  2WXO A;  3HVD A;  4OW0 A;  2L83 A;  1SE2 A;  3AH7 A;  4RNA A;  1YN5 A;  3MHZ A;  3EUB 2;  4J3O D;  1TYG B;  2LGI A;  2L32 A;  3BYY B;  4XE0 A;  1VRA B;  2BW2 A;  1UNS A;  4ITK A;  3ZJV A;  2QEJ C;  1T6B X;  3OWE B;  4LK0 M;  5HG2 A;  2AX5 A;  1JRP A;  3NRZ A;  3NVW A;  1VZ7 A;  3EA6 A;  2W54 A;  1JWU D;  4YSZ B;  4IKG A;  1QF6 A;  3KLS X;  1N62 A;  2QMT A;  4LTU A;  3HRD D;  1J7A A;  2R61 A;  2VZK D;  2BS3 B;  2IPK D;  1KLG D;  4JX1 C;  4D2K A;  1GTE A;  3EGR A;  1YN3 A;  5TSS A;  4HKZ E;  1BML C;  1TS2 A;  2BS4 B;  5BMH A;  4KKI A;  4EE2 A;  3HUI A;  2M56 B;  4NJC A;  4REZ A;  4KGR A;  3P4P B;  4US8 A;  5BMI A;  1ET9 A;  3P42 A;  1IBX B;  4KGT A;  1C4P A;  2J42 A;  1N5X A;  2AQ2 B;  1HEZ E;  1LO5 D;  2IGH A;  2JXT A;  3RFZ B;  3BYT B;  3AMZ A;  5EE9 A;  5BYQ A;  4A8X C;  4TMA B;  1QIL A;  4JWU C;  4WUR A;  3ZYY X;  3W2D A;  3AEG B;  2L52 A;  2L1A A;  1BUI C;  2Y3A A;  3W1S A;  1L0Y B;  2WDR B;  2LMC A;  3MC0 B;  1RFK A;  3FIL A;  5HHD G;  4GDK B;  2INN E;  3ABV B;  1SSN A;  1C77 A;  3AN1 A;  1NYQ A;  2IGG A;  2BTE A;  1D5X C;  3H8H A;  1WGK A;  3ZJT A;  1PGB A;  3TSS A;  5C2T B;  3LYY A;  1STE A;  2DWQ A;  4PT5 A;  3U4E G;  1E10 A;  4N58 A;  5BYR A;  3GP7 A;  3Q8B A;  1IGD A;  1VZ6 A;  4US9 A;  4ZRP A;  1FXA A;  2QIL A;  2WXI A;  1EU3 A;  4M0W A;  2FE8 A;  2OHF A;  3DWG C;  4Q2J A;  4JWS C;  1N60 A;  3KQ4 A;  5LNK 1;  2YEP F;  2BYT A;  2LEK A;  1GAQ B;  4XWW A;  1AN8 A;  1RWS A;  4P16 A;  3CF4 A;  1N63 A;  3DWM A;  1FNV A;  3VRB B;  2RDH A;  2FBW B;  2RPV A;  2WXG A;  5FKA C;  1TY0 A;  1ESF A;  3NZ3 A;  1FCL A;  2H88 B;  2WU5 B;  3AE1 B;  4WWM A;  3VR9 B;  5FR3 A;  1TJE A;  2KMM A;  2EKI A;  1SJE D;  2GI9 A;  1FO4 A;  1DGJ A;  4A90 A;  3AE4 B;  1K51 A;  1FRD A;  4MT5 A;  4UDU C;  1L6U A;  2LFI A;  3V05 A;  1DOI A;  1YJJ A;  2KAJ A;  3MJ5 A;  2D5G A;  4A6Q A;  4L1B A;  4HKQ A;  3B9J A;  1RM6 C;  4DXG A;  3NVY A;  1GB4 A;  1OQR A;  2M0A A;  4L23 A;  4KKJ A;  4YSX B;  1ZOY B;  3UI3 A;  1SB3 C;  2QSD A;  4L2Y A;  4JPS A;  2WP9 B;  4TQ1 A;  3LB8 C;  4R3D A;  1I4R A;  1TS4 A;  2PVO D;  1PYW D;  2PW9 A;  5EE1 A;  1UWX A;  3AEA B;  2RDG A;  1ZXH A;  3VR8 B;  1WWT A;  1E7P B;  3GS2 A;  4ZYS A;  1VJK A;  1ZE3 D;  3W5U B;  2HDE A;  3B2F A;  1JWB D;  3AE7 B;  2QJL A;  1FMA D;  4JE3 B;  4NAM A;  2H89 B;  1IGC A;  2E3T A;  2PIA A;  4FXC A;  1JWM D;  2NMQ A;  2W55 A;  3AE9 B;  2N9L A;  2NTS A;  3VQI A;  2JWU A;  2KWD A;  1FFV A;  4ARC A;  1L0V B;  1NYR A;  1FIQ A;  4DXF A;  1ENF A;  2PKO A;  3HVZ A;  3T3O A;  2WXN A;  4C7Y A;  1VDV A;  1JML A;  1I4P A;  1YN4 A;  1GTH A;  1CK1 A;  3PO0 A;  3BWU D;  1ET6 A;  3NVV A;  3IAM 1;  2JU6 X;  3BK2 A;  4XDD A;  1ROE A;  4ZHP A;  2WXR A;  3FAH A;  2KN4 A;  2EEL A;  1F2R I;  3AE8 B;  2MH7 A;  3SEB A;  1UGJ A;  1VLB A;  1CQV A;  3E56 A;  1C76 A;  2WDQ B;  1V1O A;  1HZ6 A;  2WXM A;  1QOB A;  2MJ3 A;  1XLQ A;  1V1P A;  2G9H D;  2WXJ A;  1EWY C;  2M19 A;  5BYS A;  3MP9 A;  4YTM B;  1SJH D;  2CJN A;  2PTL A;  2I38 A;  1PFD A;  1TS5 A;  1NEK B;  5C3J B;  2J53 A;  1D5Z C;  1FCC C;  2IGD A;  5JXV A;  1TKE A;  1AYF A;  2K9X A;  3AM9 A;  1KTK A;  1V1P B;  2WDV B;  1I4G A;  3NS1 A;  3IT6 B;  3U52 E;  2WXH A;  5H8Y E;  1ZDV A;  1KRH A;  2ICI A;  4B0M A;  2MJD A;  4RGM A;  4WH4 A;  3U7Z A;  2G1E A;  1DOY A;  1I7H A;  2WLB A;  5HI1 A;  1L4D B;  3FIL B;  2FUG 1;  1F0Z A;  1Q10 A;  1SIJ A;  1OFF A;  3AEF B;  3TEX A;  4RFB A;  4C56 C;  2JSV X;  1KLU D;  1MHH E;  1QQR A;  2N0S B;  5EE3 A;  1K53 A;  2XN9 C;  1P7E A;  2N9K A;  1JWS D;  2VZK B;  3P1M A;  3Q69 A;  4YXD B;  2ACZ B;  4O1N A;  1J7B A;  2WXQ A;  2V3N A;  5BMG A;  4RGN A;  1UWM A;  4OVZ A;  5AUI A;  3AEC B;  1I4X A;  3R8B A;  4RCO A;  1NVI D;  4DQO C;  2INP E;  2W3S A;  4YTP B;  3TEW A;  4P6V F;  1FRR A;  3J9C A;  2PMV A;  1AWD A;  1L6V A;  1HXY D;  1DOX A;  1D4B A;  2WNM A;  2KAC A;  3WCQ A;  1DYQ A;  5D3D A;  2W3R A;  2WU2 B;  1QT9 A;  5D3I B;  3TEY A;  1JWA D;  4TSS A;  1TY2 A;  4A9A A;  3NUH B;  1XLN A;  3O13 A;  5G5H A;  2BT6 A;  4KX6 B;  3Q8E A;  5H92 C;  3NVZ A;  4IDI A;  1C4A A;  1XXG A;  2JYE A;  3GB1 A;  1GT8 A;  1SXT A;  1E9M A;  1GOZ A;  1B1Z A;  2BBC A;  4HJG E;  5D7G A;  2CJO A;  1XEE A;  3IXS A;  3SFE B;  3ZJU A;  1GPX A;  4N59 A;  3BZD B;  2ZW1 A;  4RGO S;  2K5P A;  2J4X A;  1CZP A;  2WXF A;  5MPO A;  2DLB A;  4RH6 A;  3W5V B;  4B0E A;  1FNW A;  2SAK A;  4ARI A;  1TKY A;  2AQ1 B;  2MJE A;  4OZB A;  4MAC A;  3ZQ4 A;  4H2A A;  5G5G A;  4ZOH C;  3BVZ A;  1WSP A;  4XWT A;  2YEP B;  1SE4 A;  4ZRQ A;  5I4D A;  1QOA A;  4MH8 A;  2OED A;  1YQ3 B;  3P63 A;  1V8C A;  2K22 A;  1C4C A;  1FM0 D;  3TEZ A;  2E6X A;  3PZ8 A;  1D5M C;  1I4Q A;  4HRO A;  3LXF A;  3Q8F A;  2N7J A;  1YJI A;  4AQ7 A;  2KDM A;  2KQ4 X;  3AEE B;  2QIE B;  4WQM A;  4HRS A;  3AE2 B;  1N61 A;  1TS3 A;  1TZO A;  4KGS A;  4RF1 A;  3IT4 B;  1MPE A;  2MEK A;  1N5W A;  1WYG A;  2JQR B;  1XO3 A;  2BB6 A;  1Y56 A;  1C79 A;  3E9S A;  1ZP0 B;  3I9V 1;  4A55 A;  1TKG A;  1D6E C;  3P4Q B;  1IUE A;  2IDY A;  1C9F A;  3BVG A;  1T5X D;  1WXQ A;  1HA5 A;  3BII D;  3IAS 1;  1JAL A;  1BXT A;  4YTN B;  2WXP A;  1EWC A;  2CU3 A;  2XNA C;  3P4S B;  2I2Y A;  1NEN B;  2K3U A;  1L5P A;  2DYM A;  3PZ7 A;  3AB5 A;  1MVK A;  3U2S C;  3VRA B;  2V3P A;  1HQR D;  5GXG B;  2DYO A;  3R2T A;  3KWV A;  4IOI E;  2K0P A;  1IBX A;  2LUM A;  1L4Z B;  1V97 A;  2Q5W D;  1PGA A;  3BVM A;  4WIP A;  1R7S A;  4RF0 A;  1AW7 A;  4TQ0 A;  5E6J A;  1M4V A;  2V4I B;  3I57 A;  1C78 A;  4AS1 A;  1E0Z A;  3TUO A;  1K52 A;  4GDL B;  2HTM E;  3CIR B;  4YSY B;  1I4H A;  2SEB D;  2TSS A;  3N9Y C;  1QLB B;  1YQ4 B;  1K50 A;  1B9R A;  2GRI A;  1VR9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...