3P4RB

Crystal structure of menaquinol:fumarate oxidoreductase in complex with glutarate
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
243
structure length
243
Chain Sequence
AEMKNLKIEVVRYNPEVDTAPHSAFYEVPYDATTSLLDALGYIKDNLAPDLSYRWSCRMAICGSCGMMVNNVPKLACKTFLRDYTDGMKVEALANFPIERDLVVDMTHFIESLEAIKPYIIGNSRTADQGTNIQTPAQMAKYHQFSGCINCGLCYAACPQFGLNPEFIGPAAITLAHRYNEDSRDHGKKERMAQLNSQNGVWSCTFVGYCSEVCPKHVDPAAAIQQGKVESSKDFLIATLKPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fumarate reductase flavoprotein subunit
publication title Geometric restraint drives on- and off-pathway catalysis by the Escherichia coli menaquinol:fumarate reductase.
pubmed doi rcsb
source organism Escherichia coli 042
molecule tags Oxidoreductase
total genus 70
structure length 243
sequence length 243
chains with identical sequence N
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2010-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13183 Fer4_8 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 3p4rB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3p4rB01
4YT0B 2CJNA 3AMZA 5EE1A 1OQRA 1H7WA 1TJEA 1TKEA 3HRDD 3NVVA 4YTPB 3LXFA 1N61A 3NVWA 3AE3B 1L6VA 3NVYA 2PKOA 5GXGB 1E10A 4HRSA 2L52A 2DWQA 1E9MA 3AECB 1RM6C 4C7YA 1L6UA 3W9CB 2BS3B 1FO4A 3AH7A 1RYJA 1RWSA 3AE1B 1L0VB 3DWGC 2Q5WD 1OQQA 2WDQB 1V8CA 1ZOYB 1FXIA 1KRHA 1SIJA 3NRZA 3AEEB 1I7HA 3B9JA 1XO3A 1A70A 1DOIA 3CWIA 1FXAA 1NYQA 1FRRA 1NI3A 4IDIA 3AE2B 3P4QB 5G5GA 2WDRB 1QLBB 1N5WA 1QOFA 2ACZB 1ZUD2 2B76B 1FIQA 1E6EB 1YJJA 4WQMA 1YQ3B 2WDVB 2PIAA 1DOXA 1PFDA 3SR6A 5H92C 4US8A 1XLPA 3P63A 1JRPA 1PDXA 1IUEA 2MJDA 1CZPA 4ITKA 1WYGA 2KAJA 4C7ZA 1QF6A 2HTME 4N6EB 1NEKB 1QT9A 2KMMA 4YXDB 2N0SB 3VR8B 2CJOA 4JWUC 2BS4B 2WS3B 3AE7B 3AE8B 5AUKA 3SFDB 2M19A 2MJEA 1TKYA 2WLBA 1E7PB 1FMAD 1QOGA 2MH7A 4YSXB 1RFKA 2W54A 5EE0A 3ABVB 2AX5A 3AE5B 2QIEB 2QJLA 3LB8C 1WWTA 2WP9B 1N60A 1WRIA 3AE9B 3AN1A 4JWSC 1JW9D 3P1MA 1KFYB 2L83A 1H7XA 1WXQA 2K9XA 1E0ZA 2DBYA 1YQ4B 1OFFA 1DOYA 5AUIA 4FXCA 3AEDB 1YJIA 3AE6B 1JWBD 1J7BA 3KWLA 4ZOHC 3AEGB 2EKIA 4YTMB 1TKGA 2BS2B 1V97A 2LEKA 1VJKA 3W5UB 2G1EA 1SF0A 2CU3A 3VR9B 1B9RA 1GPXA 1ROEA 2OHFA 3RPFC 3NVZA 3AEAB 5G5HA 1JWAD 3ZYYX 3B2FA 4YSYB 2M56B 1JROA 2PVGC 2H88B 3NS1A 3P4SB 5C2TB 1N5XA 2W3SA 3FAHA 2MJ3A 5EE3A 3DWMA 4KX6B 1L5PA 3AB5A 5H8YE 1WGKA 2PVOD 3WCQA 3P4PB 2K5PA 1AYFA 3SFEB 3AEFB 3B2GA 1VDVA 3FC4A 1TYGB 3AM9A 1FFUA 1N63A 1JALA 1R7SA 2JQRB 4JX1C 1DGJA 3AE4B 2FBWB 3CF4A 1FM0D 2W3RA 4HROA 1XLQA 1XLNA 1XLOA 1KF6B 4N59A 1J7AA 1UWMA 4N58A 4US9A 3HUIA 2WQYB 1AWDA 1J7CA 1SB3C 3ETRA 2WU5B 1F0ZA 1GTHA 1PUTA 1QOAA 1EWYC 1GTEA 3L4PA 1T3QA 3EUB2 3AV8A 2E3TA 4ZHOA 1FFVA 1NENB 2W55A 2WU2B 3VRAB 1ZXIA 2Y5CA 1FRDA 1QOBA 3P4RB 1N62A 1NYRA 5EE9A 2H89B 4A9AA 4C80A 4ZHPA 1VLBA 5C3JB 4YTNB 3PO0A 4P6VF 4LTUA 2BT6A 4USAA 3BIID 4YSZB 1CJEA 3HVZA 3W5VB 3VRBB 2K22A 1JQ4A 2JX5A 1GT8A 3CIRB 1NVID 1GAQB 1ZP0B 5MPOA 3AEBB 4WWMA
chains in the Genus database with same CATH superfamily
3V05A 1XD3B 4ZYNA 3Q69A 3DHGC 4CO7A 4KSKC 2DWQA 4B0EA 5GMVA 3W9CB 2Z0EB 4MDKE 4R3DA 5IO9A 4NJ6A 3PSEB 3B9JA 1XO3A 3I3TB 5BYQA 4DHJD 3B0AA 2LVOA 1NI3A 1STEA 3VDZA 1WGRA 1YJJA 1YQ3B 2LGXA 4BKSA 3NZUA 3PVLA 1UNSA 1JRPA 1V5TA 1UH6A 2INNE 4JWUC 2WS3B 4WWOA 4GU2A 1D6EC 2JF5A 3MTNB 1WJ6A 2WP9B 4JWSC 2WXGA 5LXHA 3Q3MC 1ZXHA 2ZVOA 1OFFA 1Q5WB 1S3SG 2NBVB 2WXIA 4AWJA 2EKIA 2AWTA 5LXIB 3HVDA 3RPFC 4GSWA 3NS1A 1GJZA 4DHJB 4KX6B 3APCA 3DPDA 4RGOS 1Q0WB 4II3B 5E6PA 1R7SA 1JALA 4HROA 3TEYA 3AU4A 3X23A 2L32A 2NVUI 1WR1A 2KANA 3WA0A 1QQRA 3L0WB 4IKGA 1FCCC 5FR6A 3KLSX 2K39A 3PO0A 4IM0A 2L3ZA 2KN5A 1JMLA 3QARA 3W5VB 1TS4A 3BVZA 2MBQA 1ZP0B 2MBHA 4WJQA 2DYBA 3AE3B 1SEBD 3Q14C 3NZ3A 4RFBA 5DPWA 2G4SA 2WXJA 4AOFA 2J7QB 1XQQA 3AE2B 2QC8A 4IUMB 1C79A 1UF0A 2L76A 2BB6A 1R4MB 2WXNA 1E6EB 2CR5A 2FCQA 1EO6A 1HXYD 2IZVB 1PDXA 4RM8A 4ANXA 1WGGA 2IPKD 4LNNA 2UYZB 1FMAD 3LB8C 3V6EB 1TZ1A 3AN1A 3LDZE 4NAMA 1V1PB 2C7NB 3WAPA 4BKSD 4KKJA 1YJIA 2KTFA 2WGSA 1B9RA 1RLFA 4DXAB 2NTTA 4GDLA 2MEKA 2PVGC 2GBMA 1YMHE 2L0TA 2QCZA 3TBLD 1SJHD 1WJUA 1MFWA 3C19A 3CF4A 3NHEB 3PLUA 1KF6B 4KDLB 2WX0A 2DZMA 2IJ0A 3Q6BA 1L7YA 2AL6A 1CK1A 3EUB2 5AZHA 4LCDE 4LJPB 4NY0A 3ZNID 3DBRI 1CJEA 2LUEA 4EZLA 1SIFA 3AULA 4W9LA 4F7ZA 2OEDA 2CJNA 4A3OA 2DX5B 1FEHA 2LVQA 3N1XC 1HZ6A 1V86A 2KNBA 4HRSA 2L52A 2Y5BB 1AARA 2JVCA 1EWCA 4AJWA 4BAXA 1P3QU 3PPAA 1FO4A 3QQ8B 3AE1B 1L0VB 2KQSA 1FXIA 1SIJA 3VAWA 4IM2A 4EEWA 3L10B 1FRRA 1F52A 3GS2A 2ACZB 2B76B 1BT0A 1J19A 5AZGA 1XLPA 2BYEA 4WWNA 4C4VB 1I4XA 1AN8A 3ZNHB 2PE6B 3OJ4B 2J0MA 2ON8A 5IP4D 4NJ7A 3SFDB 2BF8B 3EFUA 5DCNA 4RMAA 3W1SC 2JYTA 2LRWA 1QKZA 2Y3AA 5IOIA 1H8CA 2DBYA 4IWOA 1C1YB 3AEDB 3W2DA 3UIPB 2WXMA 4XDDA 3M3JA 3AEAB 1XCQL 1ZKHA 3LYYA 1UWXA 4HCNB 1IPGA 5D94A 2I1KA 1IBXA 2GB1A 1TYGB 3ML8A 1OQYA 1D3ZA 3ZO5B 5FR3A 1KLVA 3BINA 1GTEA 4DDGD 2JPHA 3ONSA 1YNTE 2HD5B 1QOBA 5EE9A 4A9AA 3Q3JA 3DVGY 4C80A 3NJTA 4K7WA 1K8RB 4MGKE 4I6NB 2K22A 1WFYA 1V49A 1WX8A 4WWMA 3ECIA 3GB1A 4JL9A 4DXFA 4B95A 3NVYA 5GXGB 2DYMA 4W9EA 2DLBA 1FNWA 2BS3B 3AI5A 3B1LX 1KH0A 1FXAA 4RGTA 3RT3B 4GN1A 3MFGA 4XWTA 1PFDA 2V4IB 1MPEA 5IA7A 4GDLB 4M01A 3NS8A 5BYRA 2MW5A 2J42A 2LWPA 3I57A 3A9JA 4KIKB 3PRZA 1QT9A 2N0SB 4XGAB 2IO3B 3QX1A 1VZ6A 2D3CA 1WIAA 1UUPA 2LJ5A 3QIJA 1T0YA 3R66C 5G2NA 2KX0A 3I63C 4DDID 4K3CA 3UGBB 4M02A 1KFYB 4KZ0A 1H7XA 1WXQA 2KVRA 1TZOA 3SD5A 1JCKB 3PZ8A 3FILA 1YN3A 1R4NI 2BQQA 5CHFA 2K8BA 5C1ZA 2LXAA 2D10A 1CQVA 3A1QB 1HZ5A 3H6NA 4JE3B 4DHZB 3ZW3A 2IGHA 3P4PB 1KTKA 3C8YA 2ZNVB 1XLQA 1YN5A 2QSDA 2G45B 2WU5B 3BVMA 4MT5A 3ZQ4A 1ET6A 4M0WA 2GLSA 4LDTD 2KDIA 2Y5CA 1NI2A 1WM2A 1E8XA 2NCNA 3ZJTA 1YQBA 2MA9B 2KDFB 4A20A 1LXDA 3DBLI 5BMGA 3U7DA 3VQIA 1M94A 1UBIA 2MLBA 3TMPB 4YT0B 1KJTA 5CHWA 4G3XB 1GUAB 1L6VA 2W9NA 1E10A 2N9EB 3ZRFA 2FCMA 2DENB 3V3XA 1UGJA 2YEPF 3ZNGC 4FULA 3IT6B 1E8WA 2N7EA 3BWUD 2Z0DB 4BKTA 2PIAA 3EFCA 5H92C 4LDTB 4NPNA 4DWFA 4YWGG 1VZ8A 3BYTB 1NEKB 2MWSB 4P1CC 4MJSA 3TEXA 1GB1A 2KJ6A 4W9IA 1WYWB 1IBXB 2LGYA 5I4DA 5T8IA 1FNUA 3M63B 2OJWA 1JWUD 2QJLA 5L95C 4ZRPA 3DHHC 2AQ1B 4KDIC 4FXCA 2DZIA 2ONQA 5CTRC 3H7PA 1PGXA 1WXSA 1GB4A 1JWAD 2BVCA 4ANWA 3B2FA 2M1MA 2BYTA 4A55A 2PVOD 4L23A 4LLGM 1WJNA 4LNOA 1AYFA 2KVZA 4NJCA 4GOCA 1N63A 1V9JA 1F2RI 4K81A 2DYOA 1L0YB 3CSTA 1KLGD 3PV1A 1PUTA 4KGTA 5JXVA 3Q8CA 2QILA 5DPRA 3VRAB 3APFA 3GP7A 3U52E 2J53A 4YL8A 4G0NB 2KACA 1JQ4A 3U30A 3RZWC 1U4AA 2RSUA 3NVVA 1V1PA 4XYCA 1N61A 5JH5C 2JUOA 1Q1OA 2HJ8A 4E74A 3ZIMA 4M00A 1FD6A 1K52A 4EKUA 3UF8A 3R2TA 4HPMB 1DOIA 1C4CA 3MHZA 4TMAB 5D3DA 3ZKJC 3PHXB 1KLUD 5HI1A 1SE2A 1ZPSA 1IUEA 5HG2A 1QF6A 1HTQA 2LHDA 2A5UA 5BMIA 3TUOA 2MJEA 1XF5L 2CHXA 2R61A 3K9PB 3AE5B 5DPSA 1WWTA 4GDKA 3E9SA 4OZBA 3KWVA 2L0FA 4W9CA 2M4NA 1C4AA 4M0WB 2MSED 2WX1A 1VCBA 3R2IA 5BYSA 4EZKA 4KV2A 3N3KB 5H8YE 2KWUB 3T9LA 3IT4B 2JQRB 2WDTB 2KWDA 4WJOA 4G11A 4RCOA 1E8ZA 4FN2A 2V4LA 1QOAA 2N7JA 4AQ7A 2FE8A 4NQKE 1FNVA 2W55A 2BYVE 4C4VA 3RNAC 3VFKA 5CHVC 1WE7A 1T0QC 3HVZA 1YX5B 3QWZB 2N9KA 4ANVA 1Y56A 3E56A 1ENFA 2ZW0A 4MJSB 4M8NA 3NVWA 1IGCA 2K6DB 4ZDVA 2SAKA 3AECB 1RM6C 3MC8A 1TS2A 2XK5A 3QAQA 3PHWB 1YN4A 1C3TA 3KYDD 4PT5A 4AP4C 1V81A 3RNGC 4XWWA 3UINB 4Q2JA 1QOFA 3H7PB 1NBFC 2VH2A 4RNAA 3SR6A 2QEJC 2L7RA 4IWQA 4NNJB 1D5MC 1IP9A 3GZNB 1SE3A 1V1OA 2BS4B 3AE7B 1ACCA 1OEYA 2MH7A 2WWZA 1WRIA 1JW9D 3EECA 3RD2A 3EA6A 5HHDG 2CHWA 3J9CA 2D11A 3HM3A 4ZYSA 3AEGB 1TKGA 4XDCA 3WAOA 2ICIA 1SF0A 4MM3A 2WXOA 4A3PA 2BBCA 2HDEA 4JGHB 1JROA 2IGDA 4PYZA 1TBEA 2WXKA 5CX3A 3AEFB 3VH3B 2AQ3B 3AM9A 3ALBA 1DGJA 2JXTA 1XLNA 1Q10A 1T0SC 1SE4A 1WX9A 4BOZB 2KHWB 4WH4A 2KDBA 3Q3FA 4HCPB 1TY2A 2JZ3B 4KIKA 1V5OA 5C3JB 3A4SC 4MELA 4CYEA 3RN9C 3R7QA 4NZLB 1GG3A 3N30A 4EE2A 1WXAA 3U7ZA 3AEBB 3LXFA 2B3AA 4GDKB 1TS3A 1RYJA 1LO5D 2JY6A 2AYOB 3V62A 3BY4B 3A1QA 4BBNF 1N5WA 4WQOB 1H4RA 2KO3A 4MH8A 4ZRKA 2EMSA 2G3QB 3ZRCA 1L2NA 2N4FA 2WHIA 2HTME 4KGRA 4YXDB 1WM3A 2NMQA 3VR8B 3N1ZC 3R3MA 5KHOA 4A90A 2LASA 3ZXVA 1QOGA 2D07B 3T3NA 4DK5A 4ANUA 5IKCM 4AJYB 2JWUA 1VRAB 2K9XA 2A4ZA 3PZ7A 4BFRA 3NG0A 4LNFA 3FKYA 1SE9A 3OLMD 2LFIA 3AE6B 1J7BA 3IAS1 1GPXA 3IG3A 2OHFA 1LFDA 4GB9A 1N5XA 2V1YA 3M95A 3SFEB 1YD8U 4LJOB 4X57B 1MVKA 3A4RA 1UGMA 2MCNB 2D5GA 1P7FA 3MC9A 4N59A 4DQOC 4IG7B 1F0ZA 4C56C 4OW0A 4HPLB 4UDUC 2V3SA 2XK5B 3KH0A 4HK2A 2XN9C 2FAZA 1NENB 3ZXRA 2BTEA 3UQBA 1LQBA 1B1ZA 2R2QA 2J0JA 1FRDA 2FNJB 4P7IA 3P42A 2OOBB 2JZZA 1WMHA 3Q2AC 2IGGA 4YSZB 1MG4A 2HE7A 3OWEB 3KUDB 1C76A 2LXCA 1NVID 3WIMA 4E71A 5EE1A 2ZZPB 1TJEA 4PK1A 3I5JC 4HKZE 2RGFA 2RMMA 2GBRA 3TJPA 3O65B 3ZNZB 1R4MI 4WJPA 4FA6A 4MGYE 1RWSA 1TTNA 2MBEA 5JHAA 2PEAA 2M0XA 2WDRB 4BBNC 4MM3B 2NR2A 2WXLA 3VUYA 5J18A 4DHZE 1RAXA 1CZPA 4H2AA 1UELA 4REZA 2N9XA 4BVUC 4ASWC 3ZUNA 3ENEA 2VH1A 2D3AA 3DVGX 3DBHB 3RUIB 2PE9A 2WXHA 2L83A 2BB5A 2XEWA 2MP2A 3PGEA 4OVUA 4GMVA 2BS2B 3RNFC 2CU3A 5HKHA 3RNBC 3NVZA 5G5HA 3ZYYX 2YVCA 4HPPA 4HLEA 2H88B 5C2TB 3FAHA 3BZDB 3RULA 1OTRB 1WGKA 1I42A 1WGHA 3PZDA 4OZCA 2CHZA 4JX1C 3S2AA 3RCZA 1K50A 3JW0X 3DDCB 3IFWB 4A6QA 3X0WA 1OEYJ 3W1YA 1K53A 1C77A 2BKFA 3A9KB 4W9HA 1L4ZB 5G55A 1Z5SB 2GBJA 4WWPA 3T3OA 4ZHPA 2IYDB 4O1NA 4YTNB 5EDSA 2PPHA 4JQWC 3EC8A 1UD7A 1WH3A 5MPOA 1MHXA 2IBIB 3C0RB 2I2YA 3QCAA 2KD0A 3AEEB 2O2VA 1NYQA 1C9FA 3RMKC 2O6VD 4TQ1A 1DOXA 3EGRA 4WURA 3ZTDA 4ACFA 4HDQA 4NAWB 4P1BC 1XXGA 2VRRB 2CU1A 3OJ3A 4XZ4A 1F1HA 4YSXB 3KUCB 2YEPB 3GE3C 1N60A 1Z2MA 2UU7A 3RYTA 1E0ZA 1E7UA 2LGDA 1WR6E 4FHKA 3W5UB 2ZW1A 4KKIA 2IDYA 1EU4A 1WMHB 2KTRA 1GC7A 2K8HA 2M56B 1F2RC 2DAFA 2C7HA 2JU6X 3MC0B 2O6VB 3FC4A 4S0RA 1FXTB 3N9YC 1EF1A 3ZTCA 1N6ZA 3ETRA 2BYFA 4WIPA 1GTHA 2BW2A 2AQ2B 2NS5A 2G4DB 2L05A 2RDBC 3BK2A 3URYA 1CMXB 2IO2B 2IO0B 1E8YA 2MHJA 1IGDA 4USAA 3QC8B 1D5ZC 1F77A 3QHTA 4GIVA 3VHTC 3L54A 3ZVVA 3RI7C 1J8CA 5E6NA 2K0PA 1WGYA 2JX5A 4AS1A 4GGQA 1OQRA 4YTPB 3PREA 4I6PA 1TS5A 4HKQA 1WRDB 2IY0B 3HIZA 3KYCD 1E9MA 1L6UA 4C00A 3BYYB 4RF0A 2MX2A 4GLSC 5DPTA 1A70A 2MP2B 2KJHB 5G5GA 3P4QB 3ZDMC 1ZUD2 2ZNVC 1FIQA 3HK0A 3W1SA 3PRPB 1PYWD 4US8A 2L8JA 2GI9A 3CF6E 4FBJB 2MJDA 2C5LC 4K3BA 4OVVA 2NBUA 3MJWA 2KX3A 5AUKA 5J17A 2KDMA 1WE6A 1L0XB 5EE0A 2AX5A 3VTUA 1QILA 4K1RB 2WYQA 2PMVA 1X1MA 3Q8AA 1YQ4B 3JYUA 2LZ6A 2IY1B 1FCLA 1GNUA 4TSSA 3SHQA 2DAJA 1VJKA 5BMHA 4HEA1 4EOYA 3Q3NC 1WGDA 4MGIE 4YSYB 4ITKA 4HVBA 3P4SB 4IM3A 2GMIC 3B2GA 3JSVA 1BMLC 1FFUA 4TQ0A 2K3UA 4ZRIA 1MHHE 1L4DB 4K7SA 1UZXB 3D32A 2UWQA 3CMMB 4FJVB 1T3QA 1SJED 1S1QB 2WU2B 2O2VB 2ZPYA 2R2OA 2INCC 2ZVNA 3AXCA 4BZAA 4IW0A 2FIFA 2KXJA 2V0GA 2KWVB 4WAFA 3ZJVA 2WXFA 1TKEA 5E6JA 3DBRB 4IWPA 3HHMA 3TCAA 3NUHB 1TT5B 5LNK1 1GOZA 2PJHA 3DQVA 5IAAC 2KFJA 1P9DU 2LUMA 1WXVA 4A8XC 2NTSA 4XE0A 1OQQA 3V61A 2EMTA 1ZOYB 4ARCA 3ZGZA 3Q8FA 3VTWA 3CWIA 2PW9A 4WJNA 3VXWA 1LM8B 1YIWA 1G6JA 4PS8A 3UI3A 2KTRB 3P63A 4MSQB 2LMCA 2M0AA 2YLMA 3AE8B 3VH4B 2M19A 2G9HD 4E3CA 4URKA 2N9LA 3AE9B 2N9PC 4B0MA 3UQAA 4QAYA 5AUIA 1I35A 3NZSA 1RFAA 4LK0M 1FPYA 1V6EA 1SXTA 4PS3A 1E5WA 2G1EA 4FJZA 2RD0A 4W9GA 2JSVX 2FUHB 3BVGA 4TV3A 1EM7A 4XX5A 1BUIC 1UBQA 2RDHA 5D3IB 3TIXA 2KN4A 5IN7A 2KLGA 2W3RA 1XLOA 4US9A 1SB3C 1T6BX 3IBEA 1MG8A 3WANA 3L4PA 1ZW7A 2JRHA 3WAMA 4HJGE 2OJRA 4MH0E 2EELA 4MGZE 3O13A 1SGHA 2HTHA 3H7SA 1JRUA 2BT6A 3BIID 2E6XA 4W9DA 4L1BA 3VRBB 2KC1A 5AEKB 1ZDVA 2IO1B 3HRDD 4PS7A 1K51A 3DHIC 3PLVA 2KK8A 1D5XC 1ISNA 2KLCA 1T5XD 2V3PA 1V8CA 1ET9A 3NRZA 1I7HA 3DOWA 3IXSA 3N20C 4J3OD 3IAM1 1HTOA 4IDIA 4M8MA 4ZRQA 4B6WA 1I4QA 1HE8A 2XNAC 1BXTA 5E6OA 3T8MA 3RZFA 2KMCA 2KAJA 2BWES 2AEHA 2ASQA 1A5RA 2ZJDA 4N6EB 4PYUA 3L16A 4BKGA 3ZDTA 3JSVB 2FCSA 2ZCCA 2W54A 4FHJA 2QIEB 3A9KA 3I9V1 3MHSD 1DOYA 1I4HA 2WXRA 2KT7A 2ZPNA 3KQ4A 4J6IA 2PTLA 2KMAA 1M4VA 2BWFA 2RPVA 3H8HA 5TR5A 2JWZA 1VZ7A 5FKAC 1Y8RC 3DVNU 3TSSA 3DWMA 1R4NB 2K5PA 2DNFA 2WXQA 1AW7A 2SEBD 3AE4B 3PT2B 2BGFA 1J7AA 3NY5A 4N58A 4TKNA 2WNMA 3L13A 2NBWB 3VUWA 3Q8BA 2DZKA 3P4RB 3HM6X 4ICVA 3RFZB 4NAWA 1VLBA 2REXA 1ZGUB 4DBGA 3RNCC 2CS4A 1T0RC 2RDGA 2KC2A 4HDOA 2I38A 4ZRJA 3PTFC 1JWMD 3AU5A 1C4PA 1WX7A 4GXBA 3DBLB 2PKOA 3IHPC 2N7DA 2DHZA 2JZPA 5LLIA 1J0GA 4C7YA 4AUQC 3NOBA 2CKHB 2L1AA 3EHVA 4D2KA 4JLCA 4DXGA 2Q5WD 2WDQB 1I4GA 2QDFA 2LHEA 4S17A 3DCGA 3GZNI 4FJYA 2J0KA 1V2YA 2O6VA 4WQMA 2KYWA 2WDVB 1F9JA 2FCNA 4WAAA 3ZJUA 2KFKA 4RM9A 3U8ZA 4F8CB 1V80A 1MJDA 2KMMA 1P0RA 4KVGB 1E7PB 5D6JB 4NQLB 4C7ZA 4EZJA 3ABVB 5JHBA 1I4PA 2FUG1 4XC2A 2M8SA 3B08A 3KWLA 4ZOHC 5D2MB 3U4EG 1V97A 4RGNA 1GC6A 3VR9B 2K8CA 2Z8LA 3RNEC 2KDEB 3OAWA 4OVZA 3CSFA 2MJ3A 2WXPA 1RRBA 1L5PA 3AB5A 3WCQA 1I4RA 1KM7A 1WJ4A 4G50A 1NDDA 1VDVA 1VD2A 2LI5A 1YX6B 1WZ3A 3VVWB 1UWMA 5KHQA 2KJRA 1XCTL 2Z59B 2E3TA 4ZHOA 4FLHA 2KWCA 1ZXIA 4JIOU 4N9F4 3QA8A 3H9DA 1NYRA 3A33B 4IOIE 4LTUA 2K25A 3APDA 1HA5A 4CHKA 1YJ1A 4L2YA 3ML9A 3L17A 3AMZA 2X8XX 2HJ1A 4TUUA 3TEWA 2RR9A 1PGBA 5AZFA 4KZCA 1SBBB 3AH7A 2NPTA 4W9KA 4HXDA 2C60A 2C7MB 3SU8X 2N1WA 4HJKA 1QLBB 2N1VA 4RGMA 1LGRA 5C23A 1TIFA 3R8BA 5J2RA 2JYEA 2J52A 1XT9B 4IC7B 4HWIB 2DZJA 2INDC 1P1AA 2Y5PA 2VZKD 2D3GA 2INPE 2LRUA 2J4XA 2BPSA 1RFKA 3MJ5A 2K1FA 4FADA 3GOEA 1XEEA 3VTVA 2QHOA 3BK1A 1KOTA 3WALA 1JWBD 1WI0A 3MP9A 2ZCBA 1WZ0A 2KQ7A 3IVFA 4OHJA 3N32A 4OZAA 2V9HA 4KSLC 2I1JA 2W3SA 5EE3A 1MI0A 2FIDA 3M62B 1PQSA 2MQJA 4KGSA 2RPQA 2KQ4X 3SEBA 4ARIA 1FM0D 1QZEA 3HUIA 2WQYB 1AWDA 3Q3OC 2X38A 2MBBB 2VZKB 3K9OB 1P98A 4B9KA 2BKRB 5HFYA 1TY0A 3V60A 1EU3A 3AV8A 2EKEC 4MACA 5JZEB 4II2B 5FK9C 1N62A 2H89B 3KVFB 1ZDXA 4JPSA 1YOVB 3H1UA 2C9WB 1HQRD 4P6VF 3QK0A 1HEZE 2KFKB 2GBKA 4W9FA 4F1SA 2ZEQA 3CIRB 2JXXA 3OG5A 2K6QA 1H7WA 3QJZA 4ICUA 3DVNV 5BO4B 2M17A 1D4BA 3DWGC 3PS6A 2KZRA 1SSNA 1KRHA 2GRIA 4I6LB 2JT4B 3P2BA 3PRMB 1PGAA 3N1YC 2TSSA 1ESFA 3Q8EA 3LJ3A 4LNKA 3GE8C 3DBHI 4RH6A 1WYGA 2LD9A 4P16A 4CQNA 1P7EA 2D3BA 2CJOA 1WXMA 2JRIB 3V6CB 2WLBA 1TKYA 5D7GA 1DYQA 1TGZB 4BOSC 3U2SC 2AL3A 4EUTA 1OGWA 1E7VA 3P1MA 1JWSD 4MEMA 1VR9A 2D2QA 2LVPA 1C78A 1E90A 3ZLZA 4YTMB 2LEKA 2LJIA 2PLPA 1ROEA 3DBSA 3TL5A 4K7UA 2KKCA 2KOXA 3TEZA 5TSSA 4RF1A 1ZE3D 2LGIA 1WF9A 2FBWB 2QMTA 3VUXA 4EFOA 3KUZA 3A9JB 4LNIA 1J7CA 4W9JA 4MSMB 3UIOB 1WSPA 2L00B 1EWYC 3R7RA 3SDLC 2NPTB 1FFVA 2GOWA 3KW5B 2GBNA 2MBOA 1IYFA 3JVZX 3L08A 5L83A 3FILB 2MRPA 1EUVB 2LGSA 2V3NA 1EF5A 1WY8A 1GT8A 1GAQB 2XBBC 2W82A
chains in the Genus database with same CATH topology
4YT0B 5EE1A 3HRDD 1TJEA 3V05A 1K51A 1L6VA 4HKZE 3Q69A 2RMMA 1E10A 2DWQA 4B0EA 1D5XC 3W9CB 4R3DA 3V3XA 1UGJA 1RWSA 2YEPF 1T5XD 2V3PA 1V8CA 1ET9A 3NRZA 3IT6B 1I7HA 3B9JA 3BWUD 1XO3A 3IXSA 4J3OD 5BYQA 1NI3A 3IAM1 1STEA 4IDIA 4ZRQA 2WDRB 1I4QA 2XNAC 1YJJA 1YQ3B 1BXTA 2PIAA 4MM3B 2WXLA 5H92C 1UNSA 1JRPA 1CZPA 2KAJA 4H2AA 4YWGG 1VZ8A 3BYTB 4N6EB 1NEKB 4REZA 2INNE 4JWUC 3TEXA 1GB1A 2WS3B 1IBXB 5I4DA 1D6EC 5T8IA 1FNUA 2W54A 1JWUD 2QIEB 2QJLA 2WP9B 4ZRPA 3I9V1 4JWSC 2AQ1B 2WXHA 2WXGA 2L83A 2BB5A 1ZXHA 1OFFA 1DOYA 1I4HA 2WXRA 3KQ4A 4FXCA 2ONQA 2WXIA 2PTLA 2EKIA 2BS2B 1M4VA 1PGXA 2CU3A 1GB4A 2RPVA 3H8HA 3HVDA 3RPFC 3NVZA 5G5HA 3ZYYX 1JWAD 3B2FA 3NS1A 1VZ7A 2H88B 5FKAC 5C2TB 3FAHA 3TSSA 3BZDB 2BYTA 3DWMA 4KX6B 4A55A 1WGKA 2PVOD 4LLGM 4L23A 4RGOS 2K5PA 1AYFA 4OZCA 4NJCA 2WXQA 1AW7A 2SEBD 1R7SA 1N63A 1JALA 4JX1C 3AE4B 4HROA 3TEYA 1F2RI 2DYOA 1J7AA 1L0YB 4N58A 2L32A 1KLGD 1K50A 2WNMA 4A6QA 1PUTA 4KGTA 1QQRA 5JXVA 3Q8CA 1K53A 2QILA 1C77A 4IKGA 3VRAB 3Q8BA 1FCCC 1L4ZB 3GP7A 3P4RB 3RFZB 3T3OA 4ZHPA 3U52E 1VLBA 3KLSX 2J53A 4O1NA 4YTNB 3PO0A 1JMLA 3W5VB 2KACA 2RDGA 1JQ4A 1TS4A 3BVZA 2I38A 1ZP0B 5MPOA 1JWMD 1C4PA 1MHXA 3NVVA 1V1PA 1N61A 3AE3B 2PKOA 1SEBD 2JZPA 4C7YA 2L1AA 1FD6A 1K52A 2I2YA 3NZ3A 4D2KA 4RFBA 4DXGA 2Q5WD 2WXJA 2WDQB 3R2TA 1I4GA 3AEEB 1DOIA 1C4CA 1NYQA 3MHZA 2LHEA 3AE2B 1C9FA 1C79A 2BB6A 4TMAB 2WXNA 4TQ1A 1E6EB 4WQMA 5D3DA 2WDVB 1DOXA 3EGRA 1HXYD 4WURA 1KLUD 5HI1A 3ZJUA 1SE2A 1ZPSA 1PDXA 1IUEA 5HG2A 1QF6A 4NAWB 1XXGA 2LHDA 5BMIA 2IPKD 2KMMA 3TUOA 2MJEA 1E7PB 1XF5L 1FMAD 2R61A 4YSXB 4C7ZA 3ABVB 3LB8C 3AE5B 2YEPB 1WWTA 1N60A 3E9SA 3AN1A 4OZBA 1I4PA 2FUG1 3KWVA 4NAMA 1V1PB 1E0ZA 1C4AA 4KKJA 1YJIA 3KWLA 4ZOHC 3U4EG 1V97A 4RGNA 3W5UB 1B9RA 3VR9B 3R2IA 5BYSA 2ZW1A 2NTTA 4KKIA 2IDYA 2MEKA 1EU4A 2Z8LA 2M56B 2PVGC 1F2RC 4OVZA 1YMHE 2JU6X 2MJ3A 2WXPA 5H8YE 1L5PA 3AB5A 3MC0B 3WCQA 1I4RA 1SJHD 3FC4A 1VDVA 3IT4B 2JQRB 3CF4A 2KWDA 3N9YC 1KF6B 1UWMA 3ETRA 4RCOA 2IJ0A 1XCTL 4WIPA 1GTHA 1QOAA 2BW2A 2N7JA 2AQ2B 4AQ7A 2FE8A 1CK1A 3EUB2 1FNVA 2E3TA 4ZHOA 3BK2A 2W55A 3URYA 1ZXIA 1NYRA 4IOIE 1IGDA 4USAA 4LTUA 1D5ZC 1F77A 1CJEA 1HA5A 3HVZA 4L2YA 2K0PA 2JX5A 2N9KA 2OEDA 4AS1A 1Y56A 3AMZA 1ENFA 2CJNA 2ZW0A 3E56A 1OQRA 4YTPB 4HKQA 1FEHA 1TS5A 1HZ6A 1IGCA 3NVWA 3TEWA 4HRSA 1PGBA 2L52A 2SAKA 1E9MA 3AECB 1RM6C 1SBBB 1L6UA 1EWCA 1TS2A 3BYYB 1FO4A 3AH7A 4RF0A 3AE1B 1L0VB 1YN4A 1FXIA 1SIJA 4PT5A 4GLSC 4XWWA 1A70A 1FRRA 4Q2JA 5G5GA 3P4QB 1QLBB 1QOFA 3GS2A 2ACZB 1ZUD2 4RNAA 2B76B 1FIQA 4RGMA 3W1SA 3R8BA 1PYWD 3SR6A 2JYEA 4US8A 1XLPA 2GI9A 2QEJC 1I4XA 2J52A 2MJDA 1AN8A 2Y5PA 2VZKD 1D5MC 2INPE 1SE3A 1V1OA 2BS4B 3AE7B 2J4XA 1ACCA 2ON8A 3SFDB 5AUKA 2KDMA 1L0XB 2MH7A 5EE0A 1RFKA 2AX5A 3MJ5A 1QILA 1WRIA 1XEEA 2JYTA 1JW9D 2PMVA 1QKZA 2Y3AA 3Q8AA 2DBYA 1YQ4B 3EA6A 5HHDG 3J9CA 3BK1A 4ZYSA 1FCLA 3AEDB 3W2DA 1JWBD 3MP9A 4TSSA 3AEGB 1TKGA 4XDCA 1VJKA 2ICIA 1SF0A 2WXMA 2WXOA 5BMHA 4HEA1 2BBCA 4OHJA 4XDDA 2HDEA 3AEAB 4OZAA 1XCQL 4YSYB 4ITKA 1JROA 3LYYA 3P4SB 1UWXA 2IGDA 2W3SA 5EE3A 2WXKA 3AEFB 1MI0A 3B2GA 1IBXA 2GB1A 1TYGB 1BMLC 2AQ3B 4KGSA 3AM9A 2KQ4X 1FFUA 3SEBA 4TQ0A 1DGJA 2JXTA 4ARIA 1FM0D 2K3UA 1XLNA 1MHHE 1Q10A 1L4DB 3HUIA 2WQYB 1AWDA 1SE4A 2X38A 2VZKB 5FR3A 1GTEA 5HFYA 1TY0A 1T3QA 1EU3A 1SJED 3AV8A 4MACA 1YNTE 2WU2B 5FK9C 1QOBA 5EE9A 4WH4A 1N62A 4A9AA 2H89B 4C80A 1TY2A 1ZDXA 4JPSA 5C3JB 1HQRD 4P6VF 4NZLB 4EE2A 2K22A 1HEZE 3U7ZA 2V0GA 3CIRB 4WAFA 3AEBB 4WWMA 3ZJVA 2WXFA 1TKEA 1H7WA 3GB1A 5E6JA 3LXFA 4DXFA 3NUHB 3NVYA 5GXGB 5LNK1 2DYMA 1GOZA 4GDKB 2DLBA 1D4BA 1FNWA 2BS3B 2LUMA 1TS3A 1RYJA 1LO5D 3DWGC 4A8XC 2NTSA 4XE0A 1OQQA 1SSNA 1ZOYB 4ARCA 1KRHA 2GRIA 3Q8FA 3ZGZA 1KH0A 3CWIA 2PW9A 1FXAA 4RGTA 1PGAA 1N5WA 2TSSA 1ESFA 3Q8EA 4MH8A 3MFGA 4XWTA 3UI3A 1PFDA 2V4IB 1MPEA 4GDLB 3P63A 4RH6A 1WYGA 5BYRA 2HTME 2J42A 3I57A 4KGRA 4P16A 1QT9A 4CQNA 4YXDB 1P7EA 2LMCA 3VR8B 2CJOA 2N0SB 2NMQA 2M0AA 4A90A 3AE8B 2M19A 2WLBA 1TKYA 5D7GA 1QOGA 1VZ6A 1UUPA 2G9HD 1DYQA 3T3NA 2N9LA 3U2SC 3AE9B 2JWUA 3P1MA 1KFYB 1JWSD 1VRAB 1H7XA 1WXQA 4B0MA 2K9XA 1TZOA 1VR9A 1JCKB 3PZ7A 3PZ8A 5AUIA 3FILA 4LK0M 2LFIA 1C78A 1YN3A 3AE6B 1J7BA 1SXTA 4YTMB 3IAS1 2LEKA 2G1EA 2LJIA 2PLPA 1GPXA 1ROEA 2OHFA 1CQVA 2JSVX 1N5XA 3BVGA 3TEZA 1EM7A 1HZ5A 1BUIC 4JE3B 5TSSA 4RF1A 1ZE3D 2IGHA 3P4PB 1KTKA 3SFEB 2RDHA 5D3IB 2LGIA 1MVKA 2KN4A 3C8YA 2FBWB 2D5GA 2W3RA 1P7FA 2QMTA 1XLQA 1XLOA 4N59A 1YN5A 2QSDA 4US9A 1J7CA 1SB3C 4DQOC 2WU5B 1F0ZA 1T6BX 3BVMA 4C56C 4OW0A 1WSPA 4UDUC 1EWYC 4MT5A 3ZQ4A 3L4PA 1ET6A 4M0WA 1FFVA 2XN9C 4HJGE 1NENB 2Y5CA 2BTEA 2EELA 1B1ZA 1FRDA 3O13A 3P42A 3ZJTA 3FILB 5BMGA 2BT6A 2IGGA 3BIID 4YSZB 2V3NA 3OWEB 2E6XA 3VQIA 4L1BA 3VRBB 1C76A 1GT8A 1ZDVA 1NVID 1GAQB 2W82A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YT0 B;  2CJN A;  3AMZ A;  5EE1 A;  1OQR A;  1H7W A;  1TJE A;  1TKE A;  3HRD D;  3NVV A;  4YTP B;  3LXF A;  1N61 A;  3NVW A;  3AE3 B;  1L6V A;  3NVY A;  2PKO A;  5GXG B;  1E10 A;  4HRS A;  2L52 A;  2DWQ A;  1E9M A;  3AEC B;  1RM6 C;  4C7Y A;  1L6U A;  3W9C B;  2BS3 B;  1FO4 A;  3AH7 A;  1RYJ A;  1RWS A;  3AE1 B;  1L0V B;  3DWG C;  2Q5W D;  1OQQ A;  2WDQ B;  1V8C A;  1ZOY B;  1FXI A;  1KRH A;  1SIJ A;  3NRZ A;  3AEE B;  1I7H A;  3B9J A;  1XO3 A;  1A70 A;  1DOI A;  3CWI A;  1FXA A;  1NYQ A;  1FRR A;  1NI3 A;  4IDI A;  3AE2 B;  3P4Q B;  5G5G A;  2WDR B;  1QLB B;  1N5W A;  1QOF A;  2ACZ B;  1ZUD 2;  2B76 B;  1FIQ A;  1E6E B;  1YJJ A;  4WQM A;  1YQ3 B;  2WDV B;  2PIA A;  1DOX A;  1PFD A;  3SR6 A;  5H92 C;  4US8 A;  1XLP A;  3P63 A;  1JRP A;  1PDX A;  1IUE A;  2MJD A;  1CZP A;  4ITK A;  1WYG A;  2KAJ A;  4C7Z A;  1QF6 A;  2HTM E;  4N6E B;  1NEK B;  1QT9 A;  2KMM A;  4YXD B;  2N0S B;  3VR8 B;  2CJO A;  4JWU C;  2BS4 B;  2WS3 B;  3AE7 B;  3AE8 B;  5AUK A;  3SFD B;  2M19 A;  2MJE A;  1TKY A;  2WLB A;  1E7P B;  1FMA D;  1QOG A;  2MH7 A;  4YSX B;  1RFK A;  2W54 A;  5EE0 A;  3ABV B;  2AX5 A;  3AE5 B;  2QIE B;  2QJL A;  3LB8 C;  1WWT A;  2WP9 B;  1N60 A;  1WRI A;  3AE9 B;  3AN1 A;  4JWS C;  1JW9 D;  3P1M A;  1KFY B;  2L83 A;  1H7X A;  1WXQ A;  2K9X A;  1E0Z A;  2DBY A;  1YQ4 B;  1OFF A;  1DOY A;  5AUI A;  4FXC A;  3AED B;  1YJI A;  3AE6 B;  1JWB D;  1J7B A;  3KWL A;  4ZOH C;  3AEG B;  2EKI A;  4YTM B;  1TKG A;  2BS2 B;  1V97 A;  2LEK A;  1VJK A;  3W5U B;  2G1E A;  1SF0 A;  2CU3 A;  3VR9 B;  1B9R A;  1GPX A;  1ROE A;  2OHF A;  3RPF C;  3NVZ A;  3AEA B;  5G5H A;  1JWA D;  3ZYY X;  3B2F A;  4YSY B;  2M56 B;  1JRO A;  2PVG C;  2H88 B;  3NS1 A;  3P4S B;  5C2T B;  1N5X A;  2W3S A;  3FAH A;  2MJ3 A;  5EE3 A;  3DWM A;  4KX6 B;  1L5P A;  3AB5 A;  5H8Y E;  1WGK A;  2PVO D;  3WCQ A;  3P4P B;  2K5P A;  1AYF A;  3SFE B;  3AEF B;  3B2G A;  1VDV A;  3FC4 A;  1TYG B;  3AM9 A;  1FFU A;  1N63 A;  1JAL A;  1R7S A;  2JQR B;  4JX1 C;  1DGJ A;  3AE4 B;  2FBW B;  3CF4 A;  1FM0 D;  2W3R A;  4HRO A;  1XLQ A;  1XLN A;  1XLO A;  1KF6 B;  4N59 A;  1J7A A;  1UWM A;  4N58 A;  4US9 A;  3HUI A;  2WQY B;  1AWD A;  1J7C A;  1SB3 C;  3ETR A;  2WU5 B;  1F0Z A;  1GTH A;  1PUT A;  1QOA A;  1EWY C;  1GTE A;  3L4P A;  1T3Q A;  3EUB 2;  3AV8 A;  2E3T A;  4ZHO A;  1FFV A;  1NEN B;  2W55 A;  2WU2 B;  3VRA B;  1ZXI A;  2Y5C A;  1FRD A;  1QOB A;  3P4R B;  1N62 A;  1NYR A;  5EE9 A;  2H89 B;  4A9A A;  4C80 A;  4ZHP A;  1VLB A;  5C3J B;  4YTN B;  3PO0 A;  4P6V F;  4LTU A;  2BT6 A;  4USA A;  3BII D;  4YSZ B;  1CJE A;  3HVZ A;  3W5V B;  3VRB B;  2K22 A;  1JQ4 A;  2JX5 A;  1GT8 A;  3CIR B;  1NVI D;  1GAQ B;  1ZP0 B;  5MPO A;  3AEB B;  4WWM A; 
#chains in the Genus database with same CATH topology
 3V05 A;  1XD3 B;  4ZYN A;  3Q69 A;  3DHG C;  4CO7 A;  4KSK C;  2DWQ A;  4B0E A;  5GMV A;  3W9C B;  2Z0E B;  4MDK E;  4R3D A;  5IO9 A;  4NJ6 A;  3PSE B;  3B9J A;  1XO3 A;  3I3T B;  5BYQ A;  4DHJ D;  3B0A A;  2LVO A;  1NI3 A;  1STE A;  3VDZ A;  1WGR A;  1YJJ A;  1YQ3 B;  2LGX A;  4BKS A;  3NZU A;  3PVL A;  1UNS A;  1JRP A;  1V5T A;  1UH6 A;  2INN E;  4JWU C;  2WS3 B;  4WWO A;  4GU2 A;  1D6E C;  2JF5 A;  3MTN B;  1WJ6 A;  2WP9 B;  4JWS C;  2WXG A;  5LXH A;  3Q3M C;  1ZXH A;  2ZVO A;  1OFF A;  1Q5W B;  1S3S G;  2NBV B;  2WXI A;  4AWJ A;  2EKI A;  2AWT A;  5LXI B;  3HVD A;  3RPF C;  4GSW A;  3NS1 A;  1GJZ A;  4DHJ B;  4KX6 B;  3APC A;  3DPD A;  4RGO S;  1Q0W B;  4II3 B;  5E6P A;  1R7S A;  1JAL A;  4HRO A;  3TEY A;  3AU4 A;  3X23 A;  2L32 A;  2NVU I;  1WR1 A;  2KAN A;  3WA0 A;  1QQR A;  3L0W B;  4IKG A;  1FCC C;  5FR6 A;  3KLS X;  2K39 A;  3PO0 A;  4IM0 A;  2L3Z A;  2KN5 A;  1JML A;  3QAR A;  3W5V B;  1TS4 A;  3BVZ A;  2MBQ A;  1ZP0 B;  2MBH A;  4WJQ A;  2DYB A;  3AE3 B;  1SEB D;  3Q14 C;  3NZ3 A;  4RFB A;  5DPW A;  2G4S A;  2WXJ A;  4AOF A;  2J7Q B;  1XQQ A;  3AE2 B;  2QC8 A;  4IUM B;  1C79 A;  1UF0 A;  2L76 A;  2BB6 A;  1R4M B;  2WXN A;  1E6E B;  2CR5 A;  2FCQ A;  1EO6 A;  1HXY D;  2IZV B;  1PDX A;  4RM8 A;  4ANX A;  1WGG A;  2IPK D;  4LNN A;  2UYZ B;  1FMA D;  3LB8 C;  3V6E B;  1TZ1 A;  3AN1 A;  3LDZ E;  4NAM A;  1V1P B;  2C7N B;  3WAP A;  4BKS D;  4KKJ A;  1YJI A;  2KTF A;  2WGS A;  1B9R A;  1RLF A;  4DXA B;  2NTT A;  4GDL A;  2MEK A;  2PVG C;  2GBM A;  1YMH E;  2L0T A;  2QCZ A;  3TBL D;  1SJH D;  1WJU A;  1MFW A;  3C19 A;  3CF4 A;  3NHE B;  3PLU A;  1KF6 B;  4KDL B;  2WX0 A;  2DZM A;  2IJ0 A;  3Q6B A;  1L7Y A;  2AL6 A;  1CK1 A;  3EUB 2;  5AZH A;  4LCD E;  4LJP B;  4NY0 A;  3ZNI D;  3DBR I;  1CJE A;  2LUE A;  4EZL A;  1SIF A;  3AUL A;  4W9L A;  4F7Z A;  2OED A;  2CJN A;  4A3O A;  2DX5 B;  1FEH A;  2LVQ A;  3N1X C;  1HZ6 A;  1V86 A;  2KNB A;  4HRS A;  2L52 A;  2Y5B B;  1AAR A;  2JVC A;  1EWC A;  4AJW A;  4BAX A;  1P3Q U;  3PPA A;  1FO4 A;  3QQ8 B;  3AE1 B;  1L0V B;  2KQS A;  1FXI A;  1SIJ A;  3VAW A;  4IM2 A;  4EEW A;  3L10 B;  1FRR A;  1F52 A;  3GS2 A;  2ACZ B;  2B76 B;  1BT0 A;  1J19 A;  5AZG A;  1XLP A;  2BYE A;  4WWN A;  4C4V B;  1I4X A;  1AN8 A;  3ZNH B;  2PE6 B;  3OJ4 B;  2J0M A;  2ON8 A;  5IP4 D;  4NJ7 A;  3SFD B;  2BF8 B;  3EFU A;  5DCN A;  4RMA A;  3W1S C;  2JYT A;  2LRW A;  1QKZ A;  2Y3A A;  5IOI A;  1H8C A;  2DBY A;  4IWO A;  1C1Y B;  3AED B;  3W2D A;  3UIP B;  2WXM A;  4XDD A;  3M3J A;  3AEA B;  1XCQ L;  1ZKH A;  3LYY A;  1UWX A;  4HCN B;  1IPG A;  5D94 A;  2I1K A;  1IBX A;  2GB1 A;  1TYG B;  3ML8 A;  1OQY A;  1D3Z A;  3ZO5 B;  5FR3 A;  1KLV A;  3BIN A;  1GTE A;  4DDG D;  2JPH A;  3ONS A;  1YNT E;  2HD5 B;  1QOB A;  5EE9 A;  4A9A A;  3Q3J A;  3DVG Y;  4C80 A;  3NJT A;  4K7W A;  1K8R B;  4MGK E;  4I6N B;  2K22 A;  1WFY A;  1V49 A;  1WX8 A;  4WWM A;  3ECI A;  3GB1 A;  4JL9 A;  4DXF A;  4B95 A;  3NVY A;  5GXG B;  2DYM A;  4W9E A;  2DLB A;  1FNW A;  2BS3 B;  3AI5 A;  3B1L X;  1KH0 A;  1FXA A;  4RGT A;  3RT3 B;  4GN1 A;  3MFG A;  4XWT A;  1PFD A;  2V4I B;  1MPE A;  5IA7 A;  4GDL B;  4M01 A;  3NS8 A;  5BYR A;  2MW5 A;  2J42 A;  2LWP A;  3I57 A;  3A9J A;  4KIK B;  3PRZ A;  1QT9 A;  2N0S B;  4XGA B;  2IO3 B;  3QX1 A;  1VZ6 A;  2D3C A;  1WIA A;  1UUP A;  2LJ5 A;  3QIJ A;  1T0Y A;  3R66 C;  5G2N A;  2KX0 A;  3I63 C;  4DDI D;  4K3C A;  3UGB B;  4M02 A;  1KFY B;  4KZ0 A;  1H7X A;  1WXQ A;  2KVR A;  1TZO A;  3SD5 A;  1JCK B;  3PZ8 A;  3FIL A;  1YN3 A;  1R4N I;  2BQQ A;  5CHF A;  2K8B A;  5C1Z A;  2LXA A;  2D10 A;  1CQV A;  3A1Q B;  1HZ5 A;  3H6N A;  4JE3 B;  4DHZ B;  3ZW3 A;  2IGH A;  3P4P B;  1KTK A;  3C8Y A;  2ZNV B;  1XLQ A;  1YN5 A;  2QSD A;  2G45 B;  2WU5 B;  3BVM A;  4MT5 A;  3ZQ4 A;  1ET6 A;  4M0W A;  2GLS A;  4LDT D;  2KDI A;  2Y5C A;  1NI2 A;  1WM2 A;  1E8X A;  2NCN A;  3ZJT A;  1YQB A;  2MA9 B;  2KDF B;  4A20 A;  1LXD A;  3DBL I;  5BMG A;  3U7D A;  3VQI A;  1M94 A;  1UBI A;  2MLB A;  3TMP B;  4YT0 B;  1KJT A;  5CHW A;  4G3X B;  1GUA B;  1L6V A;  2W9N A;  1E10 A;  2N9E B;  3ZRF A;  2FCM A;  2DEN B;  3V3X A;  1UGJ A;  2YEP F;  3ZNG C;  4FUL A;  3IT6 B;  1E8W A;  2N7E A;  3BWU D;  2Z0D B;  4BKT A;  2PIA A;  3EFC A;  5H92 C;  4LDT B;  4NPN A;  4DWF A;  4YWG G;  1VZ8 A;  3BYT B;  1NEK B;  2MWS B;  4P1C C;  4MJS A;  3TEX A;  1GB1 A;  2KJ6 A;  4W9I A;  1WYW B;  1IBX B;  2LGY A;  5I4D A;  5T8I A;  1FNU A;  3M63 B;  2OJW A;  1JWU D;  2QJL A;  5L95 C;  4ZRP A;  3DHH C;  2AQ1 B;  4KDI C;  4FXC A;  2DZI A;  2ONQ A;  5CTR C;  3H7P A;  1PGX A;  1WXS A;  1GB4 A;  1JWA D;  2BVC A;  4ANW A;  3B2F A;  2M1M A;  2BYT A;  4A55 A;  2PVO D;  4L23 A;  4LLG M;  1WJN A;  4LNO A;  1AYF A;  2KVZ A;  4NJC A;  4GOC A;  1N63 A;  1V9J A;  1F2R I;  4K81 A;  2DYO A;  1L0Y B;  3CST A;  1KLG D;  3PV1 A;  1PUT A;  4KGT A;  5JXV A;  3Q8C A;  2QIL A;  5DPR A;  3VRA B;  3APF A;  3GP7 A;  3U52 E;  2J53 A;  4YL8 A;  4G0N B;  2KAC A;  1JQ4 A;  3U30 A;  3RZW C;  1U4A A;  2RSU A;  3NVV A;  1V1P A;  4XYC A;  1N61 A;  5JH5 C;  2JUO A;  1Q1O A;  2HJ8 A;  4E74 A;  3ZIM A;  4M00 A;  1FD6 A;  1K52 A;  4EKU A;  3UF8 A;  3R2T A;  4HPM B;  1DOI A;  1C4C A;  3MHZ A;  4TMA B;  5D3D A;  3ZKJ C;  3PHX B;  1KLU D;  5HI1 A;  1SE2 A;  1ZPS A;  1IUE A;  5HG2 A;  1QF6 A;  1HTQ A;  2LHD A;  2A5U A;  5BMI A;  3TUO A;  2MJE A;  1XF5 L;  2CHX A;  2R61 A;  3K9P B;  3AE5 B;  5DPS A;  1WWT A;  4GDK A;  3E9S A;  4OZB A;  3KWV A;  2L0F A;  4W9C A;  2M4N A;  1C4A A;  4M0W B;  2MSE D;  2WX1 A;  1VCB A;  3R2I A;  5BYS A;  4EZK A;  4KV2 A;  3N3K B;  5H8Y E;  2KWU B;  3T9L A;  3IT4 B;  2JQR B;  2WDT B;  2KWD A;  4WJO A;  4G11 A;  4RCO A;  1E8Z A;  4FN2 A;  2V4L A;  1QOA A;  2N7J A;  4AQ7 A;  2FE8 A;  4NQK E;  1FNV A;  2W55 A;  2BYV E;  4C4V A;  3RNA C;  3VFK A;  5CHV C;  1WE7 A;  1T0Q C;  3HVZ A;  1YX5 B;  3QWZ B;  2N9K A;  4ANV A;  1Y56 A;  3E56 A;  1ENF A;  2ZW0 A;  4MJS B;  4M8N A;  3NVW A;  1IGC A;  2K6D B;  4ZDV A;  2SAK A;  3AEC B;  1RM6 C;  3MC8 A;  1TS2 A;  2XK5 A;  3QAQ A;  3PHW B;  1YN4 A;  1C3T A;  3KYD D;  4PT5 A;  4AP4 C;  1V81 A;  3RNG C;  4XWW A;  3UIN B;  4Q2J A;  1QOF A;  3H7P B;  1NBF C;  2VH2 A;  4RNA A;  3SR6 A;  2QEJ C;  2L7R A;  4IWQ A;  4NNJ B;  1D5M C;  1IP9 A;  3GZN B;  1SE3 A;  1V1O A;  2BS4 B;  3AE7 B;  1ACC A;  1OEY A;  2MH7 A;  2WWZ A;  1WRI A;  1JW9 D;  3EEC A;  3RD2 A;  3EA6 A;  5HHD G;  2CHW A;  3J9C A;  2D11 A;  3HM3 A;  4ZYS A;  3AEG B;  1TKG A;  4XDC A;  3WAO A;  2ICI A;  1SF0 A;  4MM3 A;  2WXO A;  4A3P A;  2BBC A;  2HDE A;  4JGH B;  1JRO A;  2IGD A;  4PYZ A;  1TBE A;  2WXK A;  5CX3 A;  3AEF B;  3VH3 B;  2AQ3 B;  3AM9 A;  3ALB A;  1DGJ A;  2JXT A;  1XLN A;  1Q10 A;  1T0S C;  1SE4 A;  1WX9 A;  4BOZ B;  2KHW B;  4WH4 A;  2KDB A;  3Q3F A;  4HCP B;  1TY2 A;  2JZ3 B;  4KIK A;  1V5O A;  5C3J B;  3A4S C;  4MEL A;  4CYE A;  3RN9 C;  3R7Q A;  4NZL B;  1GG3 A;  3N30 A;  4EE2 A;  1WXA A;  3U7Z A;  3AEB B;  3LXF A;  2B3A A;  4GDK B;  1TS3 A;  1RYJ A;  1LO5 D;  2JY6 A;  2AYO B;  3V62 A;  3BY4 B;  3A1Q A;  4BBN F;  1N5W A;  4WQO B;  1H4R A;  2KO3 A;  4MH8 A;  4ZRK A;  2EMS A;  2G3Q B;  3ZRC A;  1L2N A;  2N4F A;  2WHI A;  2HTM E;  4KGR A;  4YXD B;  1WM3 A;  2NMQ A;  3VR8 B;  3N1Z C;  3R3M A;  5KHO A;  4A90 A;  2LAS A;  3ZXV A;  1QOG A;  2D07 B;  3T3N A;  4DK5 A;  4ANU A;  5IKC M;  4AJY B;  2JWU A;  1VRA B;  2K9X A;  2A4Z A;  3PZ7 A;  4BFR A;  3NG0 A;  4LNF A;  3FKY A;  1SE9 A;  3OLM D;  2LFI A;  3AE6 B;  1J7B A;  3IAS 1;  1GPX A;  3IG3 A;  2OHF A;  1LFD A;  4GB9 A;  1N5X A;  2V1Y A;  3M95 A;  3SFE B;  1YD8 U;  4LJO B;  4X57 B;  1MVK A;  3A4R A;  1UGM A;  2MCN B;  2D5G A;  1P7F A;  3MC9 A;  4N59 A;  4DQO C;  4IG7 B;  1F0Z A;  4C56 C;  4OW0 A;  4HPL B;  4UDU C;  2V3S A;  2XK5 B;  3KH0 A;  4HK2 A;  2XN9 C;  2FAZ A;  1NEN B;  3ZXR A;  2BTE A;  3UQB A;  1LQB A;  1B1Z A;  2R2Q A;  2J0J A;  1FRD A;  2FNJ B;  4P7I A;  3P42 A;  2OOB B;  2JZZ A;  1WMH A;  3Q2A C;  2IGG A;  4YSZ B;  1MG4 A;  2HE7 A;  3OWE B;  3KUD B;  1C76 A;  2LXC A;  1NVI D;  3WIM A;  4E71 A;  5EE1 A;  2ZZP B;  1TJE A;  4PK1 A;  3I5J C;  4HKZ E;  2RGF A;  2RMM A;  2GBR A;  3TJP A;  3O65 B;  3ZNZ B;  1R4M I;  4WJP A;  4FA6 A;  4MGY E;  1RWS A;  1TTN A;  2MBE A;  5JHA A;  2PEA A;  2M0X A;  2WDR B;  4BBN C;  4MM3 B;  2NR2 A;  2WXL A;  3VUY A;  5J18 A;  4DHZ E;  1RAX A;  1CZP A;  4H2A A;  1UEL A;  4REZ A;  2N9X A;  4BVU C;  4ASW C;  3ZUN A;  3ENE A;  2VH1 A;  2D3A A;  3DVG X;  3DBH B;  3RUI B;  2PE9 A;  2WXH A;  2L83 A;  2BB5 A;  2XEW A;  2MP2 A;  3PGE A;  4OVU A;  4GMV A;  2BS2 B;  3RNF C;  2CU3 A;  5HKH A;  3RNB C;  3NVZ A;  5G5H A;  3ZYY X;  2YVC A;  4HPP A;  4HLE A;  2H88 B;  5C2T B;  3FAH A;  3BZD B;  3RUL A;  1OTR B;  1WGK A;  1I42 A;  1WGH A;  3PZD A;  4OZC A;  2CHZ A;  4JX1 C;  3S2A A;  3RCZ A;  1K50 A;  3JW0 X;  3DDC B;  3IFW B;  4A6Q A;  3X0W A;  1OEY J;  3W1Y A;  1K53 A;  1C77 A;  2BKF A;  3A9K B;  4W9H A;  1L4Z B;  5G55 A;  1Z5S B;  2GBJ A;  4WWP A;  3T3O A;  4ZHP A;  2IYD B;  4O1N A;  4YTN B;  5EDS A;  2PPH A;  4JQW C;  3EC8 A;  1UD7 A;  1WH3 A;  5MPO A;  1MHX A;  2IBI B;  3C0R B;  2I2Y A;  3QCA A;  2KD0 A;  3AEE B;  2O2V A;  1NYQ A;  1C9F A;  3RMK C;  2O6V D;  4TQ1 A;  1DOX A;  3EGR A;  4WUR A;  3ZTD A;  4ACF A;  4HDQ A;  4NAW B;  4P1B C;  1XXG A;  2VRR B;  2CU1 A;  3OJ3 A;  4XZ4 A;  1F1H A;  4YSX B;  3KUC B;  2YEP B;  3GE3 C;  1N60 A;  1Z2M A;  2UU7 A;  3RYT A;  1E0Z A;  1E7U A;  2LGD A;  1WR6 E;  4FHK A;  3W5U B;  2ZW1 A;  4KKI A;  2IDY A;  1EU4 A;  1WMH B;  2KTR A;  1GC7 A;  2K8H A;  2M56 B;  1F2R C;  2DAF A;  2C7H A;  2JU6 X;  3MC0 B;  2O6V B;  3FC4 A;  4S0R A;  1FXT B;  3N9Y C;  1EF1 A;  3ZTC A;  1N6Z A;  3ETR A;  2BYF A;  4WIP A;  1GTH A;  2BW2 A;  2AQ2 B;  2NS5 A;  2G4D B;  2L05 A;  2RDB C;  3BK2 A;  3URY A;  1CMX B;  2IO2 B;  2IO0 B;  1E8Y A;  2MHJ A;  1IGD A;  4USA A;  3QC8 B;  1D5Z C;  1F77 A;  3QHT A;  4GIV A;  3VHT C;  3L54 A;  3ZVV A;  3RI7 C;  1J8C A;  5E6N A;  2K0P A;  1WGY A;  2JX5 A;  4AS1 A;  4GGQ A;  1OQR A;  4YTP B;  3PRE A;  4I6P A;  1TS5 A;  4HKQ A;  1WRD B;  2IY0 B;  3HIZ A;  3KYC D;  1E9M A;  1L6U A;  4C00 A;  3BYY B;  4RF0 A;  2MX2 A;  4GLS C;  5DPT A;  1A70 A;  2MP2 B;  2KJH B;  5G5G A;  3P4Q B;  3ZDM C;  1ZUD 2;  2ZNV C;  1FIQ A;  3HK0 A;  3W1S A;  3PRP B;  1PYW D;  4US8 A;  2L8J A;  2GI9 A;  3CF6 E;  4FBJ B;  2MJD A;  2C5L C;  4K3B A;  4OVV A;  2NBU A;  3MJW A;  2KX3 A;  5AUK A;  5J17 A;  2KDM A;  1WE6 A;  1L0X B;  5EE0 A;  2AX5 A;  3VTU A;  1QIL A;  4K1R B;  2WYQ A;  2PMV A;  1X1M A;  3Q8A A;  1YQ4 B;  3JYU A;  2LZ6 A;  2IY1 B;  1FCL A;  1GNU A;  4TSS A;  3SHQ A;  2DAJ A;  1VJK A;  5BMH A;  4HEA 1;  4EOY A;  3Q3N C;  1WGD A;  4MGI E;  4YSY B;  4ITK A;  4HVB A;  3P4S B;  4IM3 A;  2GMI C;  3B2G A;  3JSV A;  1BML C;  1FFU A;  4TQ0 A;  2K3U A;  4ZRI A;  1MHH E;  1L4D B;  4K7S A;  1UZX B;  3D32 A;  2UWQ A;  3CMM B;  4FJV B;  1T3Q A;  1SJE D;  1S1Q B;  2WU2 B;  2O2V B;  2ZPY A;  2R2O A;  2INC C;  2ZVN A;  3AXC A;  4BZA A;  4IW0 A;  2FIF A;  2KXJ A;  2V0G A;  2KWV B;  4WAF A;  3ZJV A;  2WXF A;  1TKE A;  5E6J A;  3DBR B;  4IWP A;  3HHM A;  3TCA A;  3NUH B;  1TT5 B;  5LNK 1;  1GOZ A;  2PJH A;  3DQV A;  5IAA C;  2KFJ A;  1P9D U;  2LUM A;  1WXV A;  4A8X C;  2NTS A;  4XE0 A;  1OQQ A;  3V61 A;  2EMT A;  1ZOY B;  4ARC A;  3ZGZ A;  3Q8F A;  3VTW A;  3CWI A;  2PW9 A;  4WJN A;  3VXW A;  1LM8 B;  1YIW A;  1G6J A;  4PS8 A;  3UI3 A;  2KTR B;  3P63 A;  4MSQ B;  2LMC A;  2M0A A;  2YLM A;  3AE8 B;  3VH4 B;  2M19 A;  2G9H D;  4E3C A;  4URK A;  2N9L A;  3AE9 B;  2N9P C;  4B0M A;  3UQA A;  4QAY A;  5AUI A;  1I35 A;  3NZS A;  1RFA A;  4LK0 M;  1FPY A;  1V6E A;  1SXT A;  4PS3 A;  1E5W A;  2G1E A;  4FJZ A;  2RD0 A;  4W9G A;  2JSV X;  2FUH B;  3BVG A;  4TV3 A;  1EM7 A;  4XX5 A;  1BUI C;  1UBQ A;  2RDH A;  5D3I B;  3TIX A;  2KN4 A;  5IN7 A;  2KLG A;  2W3R A;  1XLO A;  4US9 A;  1SB3 C;  1T6B X;  3IBE A;  1MG8 A;  3WAN A;  3L4P A;  1ZW7 A;  2JRH A;  3WAM A;  4HJG E;  2OJR A;  4MH0 E;  2EEL A;  4MGZ E;  3O13 A;  1SGH A;  2HTH A;  3H7S A;  1JRU A;  2BT6 A;  3BII D;  2E6X A;  4W9D A;  4L1B A;  3VRB B;  2KC1 A;  5AEK B;  1ZDV A;  2IO1 B;  3HRD D;  4PS7 A;  1K51 A;  3DHI C;  3PLV A;  2KK8 A;  1D5X C;  1ISN A;  2KLC A;  1T5X D;  2V3P A;  1V8C A;  1ET9 A;  3NRZ A;  1I7H A;  3DOW A;  3IXS A;  3N20 C;  4J3O D;  3IAM 1;  1HTO A;  4IDI A;  4M8M A;  4ZRQ A;  4B6W A;  1I4Q A;  1HE8 A;  2XNA C;  1BXT A;  5E6O A;  3T8M A;  3RZF A;  2KMC A;  2KAJ A;  2BWE S;  2AEH A;  2ASQ A;  1A5R A;  2ZJD A;  4N6E B;  4PYU A;  3L16 A;  4BKG A;  3ZDT A;  3JSV B;  2FCS A;  2ZCC A;  2W54 A;  4FHJ A;  2QIE B;  3A9K A;  3I9V 1;  3MHS D;  1DOY A;  1I4H A;  2WXR A;  2KT7 A;  2ZPN A;  3KQ4 A;  4J6I A;  2PTL A;  2KMA A;  1M4V A;  2BWF A;  2RPV A;  3H8H A;  5TR5 A;  2JWZ A;  1VZ7 A;  5FKA C;  1Y8R C;  3DVN U;  3TSS A;  3DWM A;  1R4N B;  2K5P A;  2DNF A;  2WXQ A;  1AW7 A;  2SEB D;  3AE4 B;  3PT2 B;  2BGF A;  1J7A A;  3NY5 A;  4N58 A;  4TKN A;  2WNM A;  3L13 A;  2NBW B;  3VUW A;  3Q8B A;  2DZK A;  3P4R B;  3HM6 X;  4ICV A;  3RFZ B;  4NAW A;  1VLB A;  2REX A;  1ZGU B;  4DBG A;  3RNC C;  2CS4 A;  1T0R C;  2RDG A;  2KC2 A;  4HDO A;  2I38 A;  4ZRJ A;  3PTF C;  1JWM D;  3AU5 A;  1C4P A;  1WX7 A;  4GXB A;  3DBL B;  2PKO A;  3IHP C;  2N7D A;  2DHZ A;  2JZP A;  5LLI A;  1J0G A;  4C7Y A;  4AUQ C;  3NOB A;  2CKH B;  2L1A A;  3EHV A;  4D2K A;  4JLC A;  4DXG A;  2Q5W D;  2WDQ B;  1I4G A;  2QDF A;  2LHE A;  4S17 A;  3DCG A;  3GZN I;  4FJY A;  2J0K A;  1V2Y A;  2O6V A;  4WQM A;  2KYW A;  2WDV B;  1F9J A;  2FCN A;  4WAA A;  3ZJU A;  2KFK A;  4RM9 A;  3U8Z A;  4F8C B;  1V80 A;  1MJD A;  2KMM A;  1P0R A;  4KVG B;  1E7P B;  5D6J B;  4NQL B;  4C7Z A;  4EZJ A;  3ABV B;  5JHB A;  1I4P A;  2FUG 1;  4XC2 A;  2M8S A;  3B08 A;  3KWL A;  4ZOH C;  5D2M B;  3U4E G;  1V97 A;  4RGN A;  1GC6 A;  3VR9 B;  2K8C A;  2Z8L A;  3RNE C;  2KDE B;  3OAW A;  4OVZ A;  3CSF A;  2MJ3 A;  2WXP A;  1RRB A;  1L5P A;  3AB5 A;  3WCQ A;  1I4R A;  1KM7 A;  1WJ4 A;  4G50 A;  1NDD A;  1VDV A;  1VD2 A;  2LI5 A;  1YX6 B;  1WZ3 A;  3VVW B;  1UWM A;  5KHQ A;  2KJR A;  1XCT L;  2Z59 B;  2E3T A;  4ZHO A;  4FLH A;  2KWC A;  1ZXI A;  4JIO U;  4N9F 4;  3QA8 A;  3H9D A;  1NYR A;  3A33 B;  4IOI E;  4LTU A;  2K25 A;  3APD A;  1HA5 A;  4CHK A;  1YJ1 A;  4L2Y A;  3ML9 A;  3L17 A;  3AMZ A;  2X8X X;  2HJ1 A;  4TUU A;  3TEW A;  2RR9 A;  1PGB A;  5AZF A;  4KZC A;  1SBB B;  3AH7 A;  2NPT A;  4W9K A;  4HXD A;  2C60 A;  2C7M B;  3SU8 X;  2N1W A;  4HJK A;  1QLB B;  2N1V A;  4RGM A;  1LGR A;  5C23 A;  1TIF A;  3R8B A;  5J2R A;  2JYE A;  2J52 A;  1XT9 B;  4IC7 B;  4HWI B;  2DZJ A;  2IND C;  1P1A A;  2Y5P A;  2VZK D;  2D3G A;  2INP E;  2LRU A;  2J4X A;  2BPS A;  1RFK A;  3MJ5 A;  2K1F A;  4FAD A;  3GOE A;  1XEE A;  3VTV A;  2QHO A;  3BK1 A;  1KOT A;  3WAL A;  1JWB D;  1WI0 A;  3MP9 A;  2ZCB A;  1WZ0 A;  2KQ7 A;  3IVF A;  4OHJ A;  3N32 A;  4OZA A;  2V9H A;  4KSL C;  2I1J A;  2W3S A;  5EE3 A;  1MI0 A;  2FID A;  3M62 B;  1PQS A;  2MQJ A;  4KGS A;  2RPQ A;  2KQ4 X;  3SEB A;  4ARI A;  1FM0 D;  1QZE A;  3HUI A;  2WQY B;  1AWD A;  3Q3O C;  2X38 A;  2MBB B;  2VZK B;  3K9O B;  1P98 A;  4B9K A;  2BKR B;  5HFY A;  1TY0 A;  3V60 A;  1EU3 A;  3AV8 A;  2EKE C;  4MAC A;  5JZE B;  4II2 B;  5FK9 C;  1N62 A;  2H89 B;  3KVF B;  1ZDX A;  4JPS A;  1YOV B;  3H1U A;  2C9W B;  1HQR D;  4P6V F;  3QK0 A;  1HEZ E;  2KFK B;  2GBK A;  4W9F A;  4F1S A;  2ZEQ A;  3CIR B;  2JXX A;  3OG5 A;  2K6Q A;  1H7W A;  3QJZ A;  4ICU A;  3DVN V;  5BO4 B;  2M17 A;  1D4B A;  3DWG C;  3PS6 A;  2KZR A;  1SSN A;  1KRH A;  2GRI A;  4I6L B;  2JT4 B;  3P2B A;  3PRM B;  1PGA A;  3N1Y C;  2TSS A;  1ESF A;  3Q8E A;  3LJ3 A;  4LNK A;  3GE8 C;  3DBH I;  4RH6 A;  1WYG A;  2LD9 A;  4P16 A;  4CQN A;  1P7E A;  2D3B A;  2CJO A;  1WXM A;  2JRI B;  3V6C B;  2WLB A;  1TKY A;  5D7G A;  1DYQ A;  1TGZ B;  4BOS C;  3U2S C;  2AL3 A;  4EUT A;  1OGW A;  1E7V A;  3P1M A;  1JWS D;  4MEM A;  1VR9 A;  2D2Q A;  2LVP A;  1C78 A;  1E90 A;  3ZLZ A;  4YTM B;  2LEK A;  2LJI A;  2PLP A;  1ROE A;  3DBS A;  3TL5 A;  4K7U A;  2KKC A;  2KOX A;  3TEZ A;  5TSS A;  4RF1 A;  1ZE3 D;  2LGI A;  1WF9 A;  2FBW B;  2QMT A;  3VUX A;  4EFO A;  3KUZ A;  3A9J B;  4LNI A;  1J7C A;  4W9J A;  4MSM B;  3UIO B;  1WSP A;  2L00 B;  1EWY C;  3R7R A;  3SDL C;  2NPT B;  1FFV A;  2GOW A;  3KW5 B;  2GBN A;  2MBO A;  1IYF A;  3JVZ X;  3L08 A;  5L83 A;  3FIL B;  2MRP A;  1EUV B;  2LGS A;  2V3N A;  1EF5 A;  1WY8 A;  1GT8 A;  1GAQ B;  2XBB C;  2W82 A; 
#chains in the Genus database with same CATH homology
 4YT0 B;  5EE1 A;  3HRD D;  1TJE A;  3V05 A;  1K51 A;  1L6V A;  4HKZ E;  3Q69 A;  2RMM A;  1E10 A;  2DWQ A;  4B0E A;  1D5X C;  3W9C B;  4R3D A;  3V3X A;  1UGJ A;  1RWS A;  2YEP F;  1T5X D;  2V3P A;  1V8C A;  1ET9 A;  3NRZ A;  3IT6 B;  1I7H A;  3B9J A;  3BWU D;  1XO3 A;  3IXS A;  4J3O D;  5BYQ A;  1NI3 A;  3IAM 1;  1STE A;  4IDI A;  4ZRQ A;  2WDR B;  1I4Q A;  2XNA C;  1YJJ A;  1YQ3 B;  1BXT A;  2PIA A;  4MM3 B;  2WXL A;  5H92 C;  1UNS A;  1JRP A;  1CZP A;  2KAJ A;  4H2A A;  4YWG G;  1VZ8 A;  3BYT B;  4N6E B;  1NEK B;  4REZ A;  2INN E;  4JWU C;  3TEX A;  1GB1 A;  2WS3 B;  1IBX B;  5I4D A;  1D6E C;  5T8I A;  1FNU A;  2W54 A;  1JWU D;  2QIE B;  2QJL A;  2WP9 B;  4ZRP A;  3I9V 1;  4JWS C;  2AQ1 B;  2WXH A;  2WXG A;  2L83 A;  2BB5 A;  1ZXH A;  1OFF A;  1DOY A;  1I4H A;  2WXR A;  3KQ4 A;  4FXC A;  2ONQ A;  2WXI A;  2PTL A;  2EKI A;  2BS2 B;  1M4V A;  1PGX A;  2CU3 A;  1GB4 A;  2RPV A;  3H8H A;  3HVD A;  3RPF C;  3NVZ A;  5G5H A;  3ZYY X;  1JWA D;  3B2F A;  3NS1 A;  1VZ7 A;  2H88 B;  5FKA C;  5C2T B;  3FAH A;  3TSS A;  3BZD B;  2BYT A;  3DWM A;  4KX6 B;  4A55 A;  1WGK A;  2PVO D;  4LLG M;  4L23 A;  4RGO S;  2K5P A;  1AYF A;  4OZC A;  4NJC A;  2WXQ A;  1AW7 A;  2SEB D;  1R7S A;  1N63 A;  1JAL A;  4JX1 C;  3AE4 B;  4HRO A;  3TEY A;  1F2R I;  2DYO A;  1J7A A;  1L0Y B;  4N58 A;  2L32 A;  1KLG D;  1K50 A;  2WNM A;  4A6Q A;  1PUT A;  4KGT A;  1QQR A;  5JXV A;  3Q8C A;  1K53 A;  2QIL A;  1C77 A;  4IKG A;  3VRA B;  3Q8B A;  1FCC C;  1L4Z B;  3GP7 A;  3P4R B;  3RFZ B;  3T3O A;  4ZHP A;  3U52 E;  1VLB A;  3KLS X;  2J53 A;  4O1N A;  4YTN B;  3PO0 A;  1JML A;  3W5V B;  2KAC A;  2RDG A;  1JQ4 A;  1TS4 A;  3BVZ A;  2I38 A;  1ZP0 B;  5MPO A;  1JWM D;  1C4P A;  1MHX A;  3NVV A;  1V1P A;  1N61 A;  3AE3 B;  2PKO A;  1SEB D;  2JZP A;  4C7Y A;  2L1A A;  1FD6 A;  1K52 A;  2I2Y A;  3NZ3 A;  4D2K A;  4RFB A;  4DXG A;  2Q5W D;  2WXJ A;  2WDQ B;  3R2T A;  1I4G A;  3AEE B;  1DOI A;  1C4C A;  1NYQ A;  3MHZ A;  2LHE A;  3AE2 B;  1C9F A;  1C79 A;  2BB6 A;  4TMA B;  2WXN A;  4TQ1 A;  1E6E B;  4WQM A;  5D3D A;  2WDV B;  1DOX A;  3EGR A;  1HXY D;  4WUR A;  1KLU D;  5HI1 A;  3ZJU A;  1SE2 A;  1ZPS A;  1PDX A;  1IUE A;  5HG2 A;  1QF6 A;  4NAW B;  1XXG A;  2LHD A;  5BMI A;  2IPK D;  2KMM A;  3TUO A;  2MJE A;  1E7P B;  1XF5 L;  1FMA D;  2R61 A;  4YSX B;  4C7Z A;  3ABV B;  3LB8 C;  3AE5 B;  2YEP B;  1WWT A;  1N60 A;  3E9S A;  3AN1 A;  4OZB A;  1I4P A;  2FUG 1;  3KWV A;  4NAM A;  1V1P B;  1E0Z A;  1C4A A;  4KKJ A;  1YJI A;  3KWL A;  4ZOH C;  3U4E G;  1V97 A;  4RGN A;  3W5U B;  1B9R A;  3VR9 B;  3R2I A;  5BYS A;  2ZW1 A;  2NTT A;  4KKI A;  2IDY A;  2MEK A;  1EU4 A;  2Z8L A;  2M56 B;  2PVG C;  1F2R C;  4OVZ A;  1YMH E;  2JU6 X;  2MJ3 A;  2WXP A;  5H8Y E;  1L5P A;  3AB5 A;  3MC0 B;  3WCQ A;  1I4R A;  1SJH D;  3FC4 A;  1VDV A;  3IT4 B;  2JQR B;  3CF4 A;  2KWD A;  3N9Y C;  1KF6 B;  1UWM A;  3ETR A;  4RCO A;  2IJ0 A;  1XCT L;  4WIP A;  1GTH A;  1QOA A;  2BW2 A;  2N7J A;  2AQ2 B;  4AQ7 A;  2FE8 A;  1CK1 A;  3EUB 2;  1FNV A;  2E3T A;  4ZHO A;  3BK2 A;  2W55 A;  3URY A;  1ZXI A;  1NYR A;  4IOI E;  1IGD A;  4USA A;  4LTU A;  1D5Z C;  1F77 A;  1CJE A;  1HA5 A;  3HVZ A;  4L2Y A;  2K0P A;  2JX5 A;  2N9K A;  2OED A;  4AS1 A;  1Y56 A;  3AMZ A;  1ENF A;  2CJN A;  2ZW0 A;  3E56 A;  1OQR A;  4YTP B;  4HKQ A;  1FEH A;  1TS5 A;  1HZ6 A;  1IGC A;  3NVW A;  3TEW A;  4HRS A;  1PGB A;  2L52 A;  2SAK A;  1E9M A;  3AEC B;  1RM6 C;  1SBB B;  1L6U A;  1EWC A;  1TS2 A;  3BYY B;  1FO4 A;  3AH7 A;  4RF0 A;  3AE1 B;  1L0V B;  1YN4 A;  1FXI A;  1SIJ A;  4PT5 A;  4GLS C;  4XWW A;  1A70 A;  1FRR A;  4Q2J A;  5G5G A;  3P4Q B;  1QLB B;  1QOF A;  3GS2 A;  2ACZ B;  1ZUD 2;  4RNA A;  2B76 B;  1FIQ A;  4RGM A;  3W1S A;  3R8B A;  1PYW D;  3SR6 A;  2JYE A;  4US8 A;  1XLP A;  2GI9 A;  2QEJ C;  1I4X A;  2J52 A;  2MJD A;  1AN8 A;  2Y5P A;  2VZK D;  1D5M C;  2INP E;  1SE3 A;  1V1O A;  2BS4 B;  3AE7 B;  2J4X A;  1ACC A;  2ON8 A;  3SFD B;  5AUK A;  2KDM A;  1L0X B;  2MH7 A;  5EE0 A;  1RFK A;  2AX5 A;  3MJ5 A;  1QIL A;  1WRI A;  1XEE A;  2JYT A;  1JW9 D;  2PMV A;  1QKZ A;  2Y3A A;  3Q8A A;  2DBY A;  1YQ4 B;  3EA6 A;  5HHD G;  3J9C A;  3BK1 A;  4ZYS A;  1FCL A;  3AED B;  3W2D A;  1JWB D;  3MP9 A;  4TSS A;  3AEG B;  1TKG A;  4XDC A;  1VJK A;  2ICI A;  1SF0 A;  2WXM A;  2WXO A;  5BMH A;  4HEA 1;  2BBC A;  4OHJ A;  4XDD A;  2HDE A;  3AEA B;  4OZA A;  1XCQ L;  4YSY B;  4ITK A;  1JRO A;  3LYY A;  3P4S B;  1UWX A;  2IGD A;  2W3S A;  5EE3 A;  2WXK A;  3AEF B;  1MI0 A;  3B2G A;  1IBX A;  2GB1 A;  1TYG B;  1BML C;  2AQ3 B;  4KGS A;  3AM9 A;  2KQ4 X;  1FFU A;  3SEB A;  4TQ0 A;  1DGJ A;  2JXT A;  4ARI A;  1FM0 D;  2K3U A;  1XLN A;  1MHH E;  1Q10 A;  1L4D B;  3HUI A;  2WQY B;  1AWD A;  1SE4 A;  2X38 A;  2VZK B;  5FR3 A;  1GTE A;  5HFY A;  1TY0 A;  1T3Q A;  1EU3 A;  1SJE D;  3AV8 A;  4MAC A;  1YNT E;  2WU2 B;  5FK9 C;  1QOB A;  5EE9 A;  4WH4 A;  1N62 A;  4A9A A;  2H89 B;  4C80 A;  1TY2 A;  1ZDX A;  4JPS A;  5C3J B;  1HQR D;  4P6V F;  4NZL B;  4EE2 A;  2K22 A;  1HEZ E;  3U7Z A;  2V0G A;  3CIR B;  4WAF A;  3AEB B;  4WWM A;  3ZJV A;  2WXF A;  1TKE A;  1H7W A;  3GB1 A;  5E6J A;  3LXF A;  4DXF A;  3NUH B;  3NVY A;  5GXG B;  5LNK 1;  2DYM A;  1GOZ A;  4GDK B;  2DLB A;  1D4B A;  1FNW A;  2BS3 B;  2LUM A;  1TS3 A;  1RYJ A;  1LO5 D;  3DWG C;  4A8X C;  2NTS A;  4XE0 A;  1OQQ A;  1SSN A;  1ZOY B;  4ARC A;  1KRH A;  2GRI A;  3Q8F A;  3ZGZ A;  1KH0 A;  3CWI A;  2PW9 A;  1FXA A;  4RGT A;  1PGA A;  1N5W A;  2TSS A;  1ESF A;  3Q8E A;  4MH8 A;  3MFG A;  4XWT A;  3UI3 A;  1PFD A;  2V4I B;  1MPE A;  4GDL B;  3P63 A;  4RH6 A;  1WYG A;  5BYR A;  2HTM E;  2J42 A;  3I57 A;  4KGR A;  4P16 A;  1QT9 A;  4CQN A;  4YXD B;  1P7E A;  2LMC A;  3VR8 B;  2CJO A;  2N0S B;  2NMQ A;  2M0A A;  4A90 A;  3AE8 B;  2M19 A;  2WLB A;  1TKY A;  5D7G A;  1QOG A;  1VZ6 A;  1UUP A;  2G9H D;  1DYQ A;  3T3N A;  2N9L A;  3U2S C;  3AE9 B;  2JWU A;  3P1M A;  1KFY B;  1JWS D;  1VRA B;  1H7X A;  1WXQ A;  4B0M A;  2K9X A;  1TZO A;  1VR9 A;  1JCK B;  3PZ7 A;  3PZ8 A;  5AUI A;  3FIL A;  4LK0 M;  2LFI A;  1C78 A;  1YN3 A;  3AE6 B;  1J7B A;  1SXT A;  4YTM B;  3IAS 1;  2LEK A;  2G1E A;  2LJI A;  2PLP A;  1GPX A;  1ROE A;  2OHF A;  1CQV A;  2JSV X;  1N5X A;  3BVG A;  3TEZ A;  1EM7 A;  1HZ5 A;  1BUI C;  4JE3 B;  5TSS A;  4RF1 A;  1ZE3 D;  2IGH A;  3P4P B;  1KTK A;  3SFE B;  2RDH A;  5D3I B;  2LGI A;  1MVK A;  2KN4 A;  3C8Y A;  2FBW B;  2D5G A;  2W3R A;  1P7F A;  2QMT A;  1XLQ A;  1XLO A;  4N59 A;  1YN5 A;  2QSD A;  4US9 A;  1J7C A;  1SB3 C;  4DQO C;  2WU5 B;  1F0Z A;  1T6B X;  3BVM A;  4C56 C;  4OW0 A;  1WSP A;  4UDU C;  1EWY C;  4MT5 A;  3ZQ4 A;  3L4P A;  1ET6 A;  4M0W A;  1FFV A;  2XN9 C;  4HJG E;  1NEN B;  2Y5C A;  2BTE A;  2EEL A;  1B1Z A;  1FRD A;  3O13 A;  3P42 A;  3ZJT A;  3FIL B;  5BMG A;  2BT6 A;  2IGG A;  3BII D;  4YSZ B;  2V3N A;  3OWE B;  2E6X A;  3VQI A;  4L1B A;  3VRB B;  1C76 A;  1GT8 A;  1ZDV A;  1NVI D;  1GAQ B;  2W82 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...