2PVOD

Crystal srtucture of the ternary complex between thioredoxin f, ferredoxin, and ferredoxin: thioredoxin reductase
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
96
structure length
96
Chain Sequence
ASYTVKLITPDGESSIECSDDTYILDAAEEAGLELPYSCRAGACSTCAGKITAGSVDQSDQSFLDDDQIEAGYVLTCVAYPTSDCTIETHKEEDLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin-thioredoxin reductase, catalytic chain
publication title Structural snapshots along the reaction pathway of ferredoxin-thioredoxin reductase.
pubmed doi rcsb
source organism Synechocystis sp.
molecule tags Electron transport
total genus 19
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2007-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2pvoD00
2KMMA 1WWTA 3AE8B 3VR8B 2CJNA 2PVGC 4YSYB 4N59A 2G1EA 4YTMB 1PFDA 2BS3B 1L5PA 1NI3A 1JWBD 1PDXA 3KWLA 2CJOA 1E7PB 4ZHPA 2WLBA 5EE1A 1FFUA 2H89B 3LB8C 1F0ZA 2W54A 2B76B 1AWDA 1QOGA 1XO3A 1XLPA 4C80A 2CU3A 1WXQA 2HTME 3NS1A 1R7SA 1PUTA 1QOAA 1N63A 3FC4A 1YQ3B 3HVZA 1E9MA 2E3TA 1TKEA 3L4PA 1QF6A 1NYQA 3ETRA 1E6EB 3AE3B 4N6EB 2QJLA 4P6VF 2K5PA 3BIID 1V8CA 3CWIA 1JALA 2Y5CA 3AE6B 1FXIA 2PIAA 5AUKA 1RM6C 2JX5A 5H8YE 4ZHOA 4ITKA 1NEKB 1N5WA 1FXAA 3NVZA 3AH7A 2WS3B 3HRDD 1AYFA 3NVYA 1A70A 1J7AA 1OQQA 4IDIA 3AE2B 1EWYC 1QOFA 1TKYA 2FBWB 2PVOD 4C7YA 4USAA 2L83A 1XLQA 2M56B 1T3QA 1WRIA 2W3RA 3P63A 2EKIA 2MJ3A 3P4QB 4YXDB 1IUEA 3AEDB 3W5VB 1OFFA 1RFKA 1QOBA 1FMAD 2PKOA 3FAHA 1J7BA 3CIRB 3SR6A 3LXFA 1VLBA 3AE7B 1N61A 4N58A 2WP9B 2BS2B 3P4RB 1DOXA 3B9JA 1JQ4A 3WCQA 1N62A 1JRPA 3AMZA 3NVVA 1N5XA 1L6UA 1L0VB 5MPOA 4YSZB 1V97A 2MJEA 3SFDB 2H88B 3AE4B 1FRRA 1SF0A 1J7CA 4HRSA 2L52A 1FO4A 1KRHA 1YQ4B 2BT6A 5EE0A 1DOYA 3PO0A 2MH7A 2WQYB 1B9RA 4HROA 1GPXA 1JROA 3B2FA 2M19A 3DWMA 3EUB2 2Q5WD 3ZYYX 1I7HA 1E10A 1TYGB 1CZPA 3NVWA 3NRZA 1WYGA 1KF6B 3W9CB 2LEKA 3AEFB 1JW9D 2N0SB 1JWAD 1VDVA 3P4SB 1ZOYB 1N60A 1QLBB 1ZXIA 2DWQA 3AM9A 4YTNB 3AEGB 3AN1A 4US8A 1KFYB 1XLOA 5G5GA 1NENB 1NYRA 5H92C 4YTPB 3AB5A 4WQMA 5EE9A 2OHFA 1FM0D 3HUIA 2QIEB 5G5HA 1DOIA 2BS4B 5C2TB 3AEBB 5C3JB 3P1MA 3AE5B 1UWMA 4YSXB 1DGJA 2W3SA 2WU5B 1FIQA 3P4PB 5GXGB 2ACZB 2JQRB 2WDQB 1L6VA 4FXCA 2WU2B 1OQRA 1E0ZA 4A9AA 5AUIA 3W5UB 1YJJA 4ZOHC 2K22A 3AE9B 2DBYA 2WDVB 1RYJA 4JX1C 4WWMA 3RPFC 1FRDA 3B2GA 1NVID 4KX6B 1ZP0B 1CJEA 1TKGA 1SB3C 3SFEB 4LTUA 1XLNA 1GAQB 2KAJA 2MJDA 4JWUC 4YT0B 2AX5A 2K9XA 1WGKA 1YJIA 3AE1B 5EE3A 1RWSA 3VRAB 1SIJA 3AEAB 1VJKA 1ZUD2 3AECB 2WDRB 3AV8A 3ABVB 4C7ZA 2W55A 1FFVA 1ROEA 3VRBB 3AEEB 4JWSC 1TJEA 3DWGC 1QT9A 4US9A 3VR9B
chains in the Genus database with same CATH superfamily
4J3OD 2GLSA 3RYTA 4XWTA 4TQ0A 4HVBA 1Q10A 3Q3JA 2H89B 3UF8A 1YN5A 3N32A 2REXA 3DHHC 2MQJA 2MP2A 3L4PA 2CHZA 1TKEA 3IHPC 2BYTA 1NYQA 1YIWA 3H9DA 3I63C 3AE3B 3TBLD 1WZ3A 2PMVA 1F2RC 1EUVB 2LXAA 2V4IB 4ZDVA 4ANUA 1SE2A 2KD0A 4GN1A 3W2DA 1MHXA 1C4AA 2J53A 2DYBA 2YEPF 3AEDB 3W5VB 3OWEB 4HEA1 1QOBA 3PZ8A 3KW5B 1WJ6A 2VZKD 4BKSD 3AE7B 3P4RB 4LNNA 4DXFA 3VTWA 2IO2B 2J42A 3JYUA 1TGZB 2BKFA 4HRSA 2LGDA 1UNSA 4N9F4 2DAFA 3ZNGC 3ZYYX 3CMMB 2KT7A 3ZTCA 3BYTB 3H7PB 1JWAD 1VDVA 1ZXIA 2IGGA 1I4PA 4W9JA 4MGYE 4ARCA 2KDEB 2KJHB 5E6OA 2KX3A 4FXCA 2DYMA 5KHOA 1SE9A 3V3XA 1STEA 1H4RA 2RGFA 3QAQA 1XT9B 4KIKB 5E6JA 2V3SA 1PGXA 1L4DB 2IO0B 2N9EB 3AEAB 1ZUD2 3AV8A 3E9SA 4JIOU 3T3OA 5LXIB 2KC2A 4TQ1A 1WWTA 1WXAA 3NG0A 2KO3A 2GBRA 4IW0A 4HKZE 4NPNA 1R7SA 1J8CA 2E3TA 1GNUA 2N9KA 3IAM1 3EFCA 3OAWA 3UINB 3NZ3A 2BF8B 2BBCA 4IDIA 2VZKB 1CQVA 2O6VA 4W9LA 1M4VA 1ET9A 2BPSA 2INDC 4MM3B 1OGWA 2BW2A 1E90A 3O65B 3Q2AC 3CIRB 4GSWA 4FN2A 1SE4A 2KQ4X 1N5XA 2ZCCA 3RNAC 2BT6A 2QEJC 3H8HA 1DOYA 4L1BA 4RNAA 1UWXA 1JROA 4DXGA 1I7HA 4MSMB 4MGZE 3NVWA 1OEYA 1WE6A 2WDTB 1F52A 2RDBC 2L3ZA 3P4SB 2RSUA 1N60A 5IP4D 3H7PA 1MVKA 1V5OA 4YTPB 3RUIB 4IWOA 2E6XA 2WX0A 5LNK1 2ICIA 1LO5D 1WIAA 3P1MA 1WGRA 4URKA 2V9HA 2JQRB 2LRWA 3A9KB 2NTSA 3MP9A 1SB3C 4ICUA 4BBNC 4HCPB 3M95A 4PK1A 5DPRA 3BYYB 1FPYA 2ZVOA 2D11A 2INPE 4KGRA 4LNFA 3A9JA 3DBHI 4NNJB 2K3UA 4YWGG 3S2AA 3PLUA 1Q0WB 3PLVA 4MJSA 2M8SA 3ZTDA 4MGIE 2CJOA 4HLEA 1VZ8A 1YN4A 3RZWC 4JPSA 4HCNB 1WXQA 2ZCBA 4GOCA 1P1AA 3Q69A 1D6EC 4C4VB 2DZKA 2PEAA 2XN9C 4ZRJA 2PIAA 4RGNA 2VH1A 2N7DA 4ITKA 3WAOA 5DPWA 1C3TA 3HM3A 1EWYC 3ZGZA 4BKSA 5FKAC 2M4NA 4OW0A 4C7YA 2MSED 2JYEA 1AW7A 3Q8CA 2EMSA 5AZHA 3UI3A 1U4AA 1SXTA 2CHXA 4MM3A 4WJNA 3LXFA 3LJ3A 1I42A 4E74A 1WRDB 3GB1A 1JWSD 4F1SA 1FRRA 3GOEA 2N1WA 3DWMA 5HHDG 1R4MI 1CZPA 3QARA 1F2RI 3J9CA 2HD5B 1KH0A 1UF0A 3U8ZA 3ZQ4A 5H92C 5EE9A 3IVFA 4B6WA 2IZVB 2DHZA 1WXVA 3W1YA 1L0YB 2X38A 3UIOB 2BVCA 5AZFA 2GB1A 3Q6BA 3V05A 2GRIA 4MH0E 1RYJA 4AJYB 3QA8A 3L13A 1C4CA 5C1ZA 2M0AA 5AEKB 2K9XA 4TMAB 3WAMA 2FUG1 4KDLB 4KGSA 2LWPA 3UIPB 1FFVA 4GU2A 3VR8B 5BO4B 2RMMA 5DCNA 2D3CA 2WXHA 4WWPA 2W54A 3PGEA 1GB4A 1SIFA 2IY1B 2J0JA 1PUTA 1WF9A 3KYCD 3IFWB 2D3GA 3BIID 3W1SC 3PS6A 1RM6C 3B1LX 3SD5A 4RH6A 2V4LA 4FADA 2A4ZA 1A70A 2IO3B 3MJ5A 2KQSA 1ZDXA 1TY2A 4X57B 1RRBA 1QKZA 4B0MA 3RZFA 2EKIA 3APCA 3VUYA 1IPGA 2XEWA 4OHJA 4YL8A 2WP9B 3B9JA 1FNUA 4DHJD 2LVQA 3ZIMA 1UD7A 1YN3A 4YSZB 1RLFA 1UGMA 3AE4B 1E8XA 1P9DU 2JSVX 4QAYA 3LYYA 2MW5A 3ZRCA 2BTEA 2LHEA 4WQMA 2WXRA 1FM0D 5G5HA 2J4XA 4AWJA 4BKTA 5C3JB 1WGGA 2LZ6A 4BOSC 3ZDMC 1C79A 4HKQA 1E0ZA 3W5UB 1YJJA 3PZDA 1T0YA 4G3XB 4FJYA 3AE9B 3IBEA 3QX1A 4W9GA 1FRDA 2WXMA 4XE0A 3PPAA 1JMLA 3RT3B 4HDOA 3DVNV 1C77A 4JWUC 4YT0B 1E8WA 3VFKA 3V61A 2WGSA 2KLGA 3ZXVA 1GG3A 2IGDA 4M0WB 2RPVA 5IOIA 1FCLA 3RD2A 2PE6B 4CHKA 2BS3B 1V5TA 4A3PA 4ZHPA 1KM7A 1YX6B 2MRPA 2WYQA 2V1YA 3RPFC 1QOAA 4JE3B 3FC4A 1QF6A 1IGDA 2KVRA 2NCNA 2K1FA 2K5PA 2FAZA 2W82A 5FR3A 3CSTA 3DBHB 1ENFA 5H8YE 3ZUNA 2JY6A 3R8BA 1RAXA 3NVYA 1P0RA 3C8YA 4P1BC 1WY8A 1BUIC 1M94A 1WX8A 3QHTA 2WXOA 2AL3A 3P4QB 4UDUC 4P16A 2JYTA 2DLBA 2IYDB 2KHWB 1ZW7A 2MJEA 5IN7A 1BMLC 3RNEC 5I4DA 3FILA 2MH7A 2EKEC 3DBRB 2RD0A 2HTHA 3M63B 5E6PA 1SJHD 1A5RA 3VDZA 4K81A 3K9OB 1E5WA 1MFWA 2CU1A 3RNCC 1B1ZA 2G4SA 1WI0A 4JQWC 3H7SA 1UWMA 2W3SA 3C19A 2CS4A 3Q3FA 2QDFA 5D7GA 3L17A 4NY0A 2FCSA 4KX6B 3EGRA 2KTFA 1CJEA 1FXTB 4KV2A 1KOTA 1D5XC 1UH6A 3L16A 2KJRA 4M0WA 4US9A 3EFUA 1JRUA 2NPTB 4N59A 4P7IA 5J2RA 1JWBD 2BWES 3KWLA 1E7PB 2KWDA 5EE1A 1FFUA 1WM2A 5JHBA 1P3QU 1WGDA 1WJNA 2HTME 4ZRIA 2INCC 4HPMB 1ACCA 2M1MA 2WWZA 2JRHA 3PRZA 4A6QA 2IJ0A 3AXCA 1FD6A 4M01A 1EU3A 2HDEA 2WXLA 2WXPA 3BINA 2KANA 2WS3B 3NY5A 3N3KB 2KK8A 4OZBA 3PV1A 2D10A 2KYWA 2M56B 3JSVB 4NJCA 5L83A 2WXGA 1K51A 4KKIA 2JZPA 2J0MA 2BS2B 1JQ4A 4D2KA 1JRPA 4EOYA 4LJOB 2I2YA 4R3DA 4FHJA 2AEHA 4HROA 4MELA 2PE9A 1D3ZA 1V86A 1L0XB 2HJ8A 3LDZE 1LGRA 2CR5A 1KF6B 2NMQA 5JH5C 1TS5A 2KFKA 2N0SB 1QLBB 2L0FA 4LK0M 1LM8B 3ZJUA 1NYRA 4CO7A 4M8NA 2GBJA 5G55A 4M02A 3DOWA 3ZNID 1I4XA 2WU2B 5C23A 2MLBA 1WSPA 1FNWA 3L10B 3HM6X 3MFGA 2DENB 3EHVA 3C0RB 2LJ5A 3Q3OC 2KWVB 4MGKE 3Q3MC 1MI0A 1ESFA 4XZ4A 1I4QA 2GBNA 2I1KA 3BWUD 4AS1A 1HZ6A 2AL6A 4YTMB 2RDGA 2WXIA 3WIMA 3A4RA 5HI1A 2Y5PA 5LXHA 4W9KA 1V2YA 4S0RA 3NS1A 2FIDA 1LXDA 4W9FA 4ZRKA 1JALA 2R61A 4HWIB 4EZKA 2Y5CA 3I5JC 5AUKA 3QK0A 2KQ7A 2SAKA 1N5WA 2O2VA 4MACA 4BOZB 3RNFC 3R2TA 3U30A 5IO9A 3A1QB 3BK1A 1T5XD 2ZPYA 2BB6A 2CKHB 2WXQA 1NBFC 1Z5SB 4WAAA 4MDKE 5DPTA 3V60A 3R3MA 1UUPA 4PS3A 4GIVA 1JCKB 3EUB2 3MTNB 4GGQA 2K8BA 4JGHB 3OLMD 1WZ0A 2IY0B 3AEGB 4IM0A 3ONSA 3AB5A 4DDGD 1SJED 3AE5B 2L7RA 4II3B 1FIQA 1V1OA 4DDID 4DBGA 1L6VA 2GOWA 4A9AA 5AUIA 3I57A 4AOFA 3I3TB 3B2GA 2LI5A 2AWTA 3Q8EA 1FEHA 4O1NA 2QHOA 5D3DA 1ET6A 4ZYSA 2C7NB 3B08A 4KZ0A 4MH8A 1YNTE 3DCGA 2LJIA 3VR9B 3VTVA 4E71A 3DDCB 2JU6X 4RMAA 3NS8A 4ACFA 2PTLA 3ZO5B 3KWVA 4K7UA 1V49A 4XWWA 1YQBA 5HFYA 2KZRA 4KIKA 5CHVC 5BYRA 1LFDA 2LUMA 2WXNA 4XDDA 3TIXA 2ZVNA 3MHZA 3NZSA 4TKNA 3WAPA 3PTFC 1MJDA 4S17A 2XNAC 4WWOA 2QSDA 1WJ4A 1JWUD 3A1QA 2V3PA 4NAWB 1VLBA 1XD3B 4N58A 5CTRC 2ZNVB 5LLIA 3NJTA 1OTRB 2LUEA 2RR9A 2MBBB 3A4SC 1E8ZA 3L54A 2LVPA 4F7ZA 3N9YC 3T8MA 4RCOA 2N9XA 3VQIA 4ANVA 4F8CB 2J7QB 3DBRI 1VZ6A 1AARA 3EECA 3AM9A 2GBMA 1ZKHA 3N1ZC 4K7WA 4DK5A 3KQ4A 1CK1A 4ANWA 1E7UA 3DVNU 2L00B 2KMCA 3PRMB 4GLSC 2N9PC 1J0GA 4MEMA 5D94A 5D3IB 1YJIA 1WR1A 3QC8B 3EA6A 1EU4A 4B0EA 2LVOA 2V0GA 3AE8B 2CJNA 2ZNVC 2PVGC 3CSFA 4EKUA 3TSSA 3PHWB 1ZPSA 2WLBA 3A9KA 3HVDA 3RULA 2N9LA 1XF5L 1LQBA 5CHWA 4PYUA 3VH4B 4FJZA 1YQ3B 3ZKJC 3X0WA 1KJTA 2LGSA 4XDCA 2KTRB 4W9DA 2JWZA 3RNBC 3DBSA 1V1PB 2QILA 3OJ4B 1AYFA 1UBQA 4OZCA 2FBWB 2PVOD 2C7HA 3DBLB 3HHMA 3BK2A 1F77A 5J17A 5BMGA 2LGYA 1L2NA 4EEWA 2ZPNA 1N61A 4NQKE 3ZVVA 3X23A 3AMZA 3ZNZB 4NAWA 1L0VB 3APDA 1Q1OA 3SFDB 4C4VA 1J7CA 4NQLB 1KRHA 3KH0A 1H8CA 3B2FA 2LMCA 4FJVB 4ASWC 5T8IA 2Y3AA 4YTNB 3AN1A 4JLCA 2OHFA 1P98A 2IDYA 1DOIA 3VXWA 1SSNA 1DGJA 4DHZB 2WU5B 3PVLA 2DZJA 1HE8A 1OQRA 2DX5B 3QWZB 2BYVE 4K7SA 3B0AA 4WWMA 2KDMA 4K1RB 1GJZA 3PZ7A 1GAQB 5J18A 2AX5A 3VUWA 1WGKA 5EE3A 3TCAA 3W1SA 5IA7A 3IT4B 2IO1B 1SIJA 1K50A 3KVFB 2L32A 4BVUC 4EFOA 1GC7A 4WH4A 4LJPB 4TUUA 5FR6A 2PPHA 4G0NB 1F9JA 1NI3A 4PYZA 4I6LB 3LB8C 1V81A 1XO3A 1XLPA 2GBKA 1N63A 1ZXHA 3O13A 4ANXA 1TY0A 4A3OA 1AN8A 1D5MC 2Y5BB 3MC8A 3RFZB 2KWCA 4G11A 2KMAA 2IBIB 3D32A 1QOFA 4RM8A 3Q8BA 1GUAB 2KN4A 1XLQA 3TUOA 1I35A 1OFFA 1ISNA 3U7ZA 3FAHA 4XC2A 4EUTA 2G9HD 4C56C 1Y8RC 4JL9A 5TR5A 4B95A 3NVVA 2K8CA 3DPDA 3VH3B 5TSSA 1K8RB 4RGMA 2ON8A 1HQRD 3KUZA 1TYGB 1I4HA 3IAS1 1WYGA 3W9CB 3AEFB 1JW9D 4NZLB 3ZNHB 3Q8AA 1TS2A 1V9JA 1GOZA 1C76A 2TSSA 2QMTA 4HPPA 1TZOA 2ZJDA 4ICVA 1Y56A 2NBWB 1C78A 4GMVA 2FCQA 4GDKB 2WDVB 3KUDB 2ONQA 3KYDD 2MP2B 3RNGC 2LXCA 2MJDA 2JWUA 2C7MB 1RWSA 3VRBB 3I9V1 2FCNA 3RMKC 4JWSC 5GMVA 2K39A 5D2MB 3H1UA 2KMMA 2BQQA 3N30A 2GMIC 3ZW3A 2I38A 2FCMA 2L8JA 3PHXB 2RDHA 3WALA 4HJKA 2JF5A 1DYQA 3VVWB 1BT0A 3HK0A 1HZ5A 3RI7C 4LNKA 2WXFA 4WJOA 3QCAA 2G45B 3SDLC 5CX3A 4W9EA 2OJRA 1L7YA 1SEBD 4OVUA 2LRUA 2MCNB 4EZLA 3MC0B 2Z8LA 2ZEQA 2L83A 1T3QA 2WNMA 1R4NB 1IUEA 1XEEA 4HXDA 1PYWD 3UGBB 4BFRA 1L6UA 2ZW1A 3MC9A 1XCTL 2G4DB 3TEWA 1FO4A 3GE8C 2L52A 2D5GA 2WXJA 4WJPA 2WQYB 2BGFA 2D3BA 1GPXA 1SE3A 2Q5WD 1PQSA 2J0KA 2VRRB 3ML8A 2JXTA 2BKRB 2QC8A 3AU4A 2ZZPB 1S1QB 1XCQL 2LGIA 1EWCA 3P4PB 1MG4A 2JPHA 2Z0DB 1UELA 1WYWB 2AQ1B 4ZOHC 2DBYA 4JX1C 1SBBB 4GDKA 3ZJVA 2KX0A 1NVID 3JW0X 4P1CC 1IBXB 1TKGA 4LDTD 1GC6A 4ARIA 3SFEB 2BB5A 1J19A 4GB9A 3ML9A 2LASA 1UBIA 2L76A 1VRAB 3ZRFA 2WX1A 3BY4B 3Q3NC 2L05A 1WGHA 2O6VB 3AEEB 1HTOA 4M8MA 3K9PB 1QT9A 1I4GA 4BKGA 4NJ7A 1FNVA 1PFDA 4XYCA 1PDXA 4J6IA 1HXYD 2R2OA 3N20C 2R2QA 2K25A 1CMXB 1IP9A 1K53A 1TIFA 2M0XA 4C80A 1FCCC 3M62B 3APFA 3HVZA 5JZEB 2QJLA 4G50A 4P6VF 2EELA 2JXXA 3AE6B 4ZHOA 4B9KA 4FA6A 2NPTA 3IG3A 2MWSB 1YMHE 1ZDVA 3DBLI 5G2NA 3U2SC 4FLHA 1FMAD 1J7BA 1WXSA 3R7QA 3VHTC 3TEYA 1N62A 2Z0EB 2HE7A 5MPOA 3DHIC 4K3CA 2N7JA 3BZDB 4TV3A 2MBEA 2RPQA 3PREA 1WH3A 2IPKD 2KFJA 2LHDA 5KHQA 3NRZA 1S3SG 1YJ1A 1T0SC 4WAFA 3MHSD 1D5ZC 2INNE 3JSVA 4OVZA 5JHAA 1HEZE 3FKYA 1XLOA 3SU8X 3QIJA 2K6QA 1NENB 3A9JB 3GS2A 3QQ8B 2NTTA 2C60A 3HUIA 2QIEB 4LDTB 3AEBB 4MJSB 3NHEB 2BWFA 2ACZB 3M3JA 2WDQB 3L08A 4KGTA 5CHFA 4W9IA 4IOIE 2OEDA 1EM7A 2B3AA 2DNFA 2HJ1A 2K22A 3N1YC 2G3QB 1ZP0B 4LTUA 4RGOS 1IBXA 1KTKA 4ZRQA 4M00A 3V6EB 4BAXA 2XBBC 2EMTA 1MPEA 3U7DA 2Z59B 4IUMB 1PGBA 5E6NA 3AU5A 2GI9A 4A90A 1WM3A 4DWFA 2KWUB 1WX7A 1F0ZA 5AZGA 1QOGA 4HJGE 2CU3A 1WE7A 2DZMA 4Q2JA 1OQYA 3ZDTA 4IWPA 2YVCA 2NBUA 1WXMA 3N1XC 2MBHA 2JUOA 2NVUI 4HPLB 3RCZA 3URYA 2QCZA 2V3NA 4II2B 2LD9A 3KUCB 4LLGM 3SR6A 4OZAA 4KKJA 4AUQC 4XGAB 2N1VA 4PS7A 2FIFA 1VCBA 3DHGC 5EE0A 5L95C 1B9RA 4RGTA 3UQAA 4A8XC 2D3AA 1ZE3D 3BVZA 4RM9A 2DWQA 1KFYB 2SEBD 2C5LC 3WA0A 1KLVA 2W9NA 5IAAC 4RF1A 3TL5A 5FK9C 4W9HA 2J52A 2MHJA 2JVCA 3ZJTA 1KLGD 4L2YA 4IC7B 1TT5B 3H6NA 1SGHA 2KAJA 1RFAA 2XK5B 1YX5B 4IWQA 1YOVB 4I6PA 3QJZA 1VJKA 2WHIA 1T6BX 2WDRB 4K3BA 1ROEA 4REZA 3DWGC 4BZAA 3GE3C 4KSKC 4WURA 3DVGY 4C00A 1IYFA 2PJHA 2JRIB 3OG5A 1VR9A 2KACA 1AWDA 3NUHB 2KOXA 2YEPB 4DHZE 2JT4B 1E6EB 1V8CA 4WJQA 1TZ1A 4A20A 4ZYNA 2NR2A 1F1HA 1WX9A 3NZUA 1FXAA 3AH7A 3HRDD 1J7AA 1OQQA 3AE2B 3P42A 1GB1A 1WMHB 2MBOA 2DZIA 3T9LA 4WWNA 4DXAB 4LNOA 1VZ7A 3GZNI 2AQ2B 1RFKA 1R4NI 1NI2A 1I4RA 2KKCA 2KNBA 2L1AA 2MA9B 1QQRA 3ECIA 2K0PA 2NBVB 2KVZA 2H88B 5HKHA 2X8XX 2IGHA 3PO0A 1C1YB 1N6ZA 3L0WB 1WR6E 2A5UA 1E10A 3U52E 1JWMD 4KDIC 4HDQA 3PSEB 2LFIA 4WIPA 1EF1A 2YLMA 4US8A 3JVZX 2MX2A 2K6DB 1C4PA 1V80A 5C2TB 2MEKA 3GP7A 2D2QA 4RFBA 3NOBA 4FHKA 2BYEA 3DVGX 3SHQA 1TS3A 3DQVA 2FNJB 4A55A 3T3NA 2XK5A 3ABVB 4C7ZA 5HG2A 4CQNA 2KLCA 2KXJA 1TJEA 3VAWA 1TTNA 1WFYA 3AI5A 3E56A 2NS5A 3TJPA 2M17A 4YSYB 1KLUD 4IM2A 1P7EA 2G1EA 1L5PA 3Q8FA 1QZEA 4MSQB 4ZRPA 5EDSA 2B76B 4XX5A 1TS4A 4N6EB 3R66C 4AP4C 3CWIA 4FULA 1FXIA 3FILB 3HIZA 2D07B 1NEKB 2DAJA 4CYEA 3AULA 3ZXRA 5DPSA 1Z2MA 4NJ6A 2BYFA 1P7FA 1WMHA 1E8YA 2W3RA 4I6NB 4RF0A 2PKOA 2ASQA 1DOXA 4GDLB 4MT5A 3U4EG 4DQOC 2CHWA 4NAMA 1SF0A 1NDDA 3SEBA 2KTRA 1HA5A 2ZW0A 5BMIA 1EO6A 1T0RC 1V1PA 1BXTA 2JZZA 1L4ZB 3Q14C 2LEKA 1XXGA 3WANA 5IKCM 1HTQA 1WJUA 2UWQA 4KVGB 3V6CB 5BMHA 1K52A 3ENEA 2BS4B 3TMPB 4W9CA 2PW9A 2AQ3B 2UYZB 1WGYA 3A33B 1ZGUB 4IG7B 1OEYJ 4IKGA 1XQQA 4EE2A 1UZXB 4EZJA 4PS8A 1VD2A 3CF6E 3BVGA 4IM3A 1XLNA 2JZ3B 1C9FA 3AE1B 2KDIA 3AECB 2VH2A 4L23A 2FUHB 5BYSA 3R2IA 3IT6B 4LCDE 4DHJB 1MG8A 1QILA 4PT5A 3P2BA 3VTUA 3VUXA 2I1JA 1E9MA 3R7RA 3ETRA 4GXBA 3PT2B 2N7EA 3KLSX 2C9WB 2KDBA 3EC8A 2AYOB 1UGJA 2JX5A 1EF5A 2KJ6A 3NVZA 4BBNF 1Q5WB 2KFKB 1PGAA 1TKYA 4USAA 4AQ7A 2L0TA 1WRIA 3P63A 2MJ3A 5BYQA 4YXDB 2O6VD 1YD8U 2PLPA 2KC1A 4OVVA 4TSSA 3WCQA 1X1MA 2N4FA 4AJWA 1V97A 3OJ3A 4GDLA 1YQ4B 1TBEA 4KZCA 3TEZA 1R4MB 3IXSA 1G6JA 3PRPB 3MJWA 2M19A 2OOBB 5JXVA 2K8HA 2OJWA 3GZNB 1T0QC 2MBQA 1ZOYB 2WXKA 2KN5A 2FE8A 1D4BA 5G5GA 3ZLZA 1E7VA 3ALBA 4LNIA 4YSXB 5GXGB 1MHHE 4HK2A 3BVMA 3V62A 2KDFB 5D6JB 4KSLC 4E3CA 3RN9C 3UQBA 2DYOA 4WQOB 2UU7A 2LGXA 3TEXA 1V6EA 3VRAB 4FBJB 4H2AA 2W55A 2O2VB 1IGCA
chains in the Genus database with same CATH topology
4J3OD 2V0GA 3AE8B 4XWTA 2CJNA 2PVGC 3TSSA 2GI9A 4TQ0A 2BS3B 1Q10A 1ZPSA 4A90A 4ZHPA 2WLBA 3HVDA 2H89B 1F0ZA 2N9LA 1XF5L 1QOGA 4HJGE 1YN5A 2CU3A 3RPFC 1QOAA 4JE3B 3FC4A 3L4PA 1YQ3B 4Q2JA 1QF6A 1TKEA 1IGDA 2BYTA 1NYQA 3AE3B 2PMVA 2K5PA 4XDCA 1F2RC 2W82A 5FR3A 1ENFA 5H8YE 2V4IB 1V1PB 3R8BA 2QILA 1AYFA 3NVYA 1SE2A 3URYA 3C8YA 4OZCA 3W2DA 2FBWB 2PVOD 2V3NA 1MHXA 1C4AA 1BUIC 2J53A 2WXOA 3P4QB 4UDUC 2YEPF 3AEDB 3W5VB 4P16A 3BK2A 2JYTA 2DLBA 3OWEB 1F77A 1QOBA 4HEA1 3PZ8A 4LLGM 5BMGA 3SR6A 4OZAA 2VZKD 4KKJA 3AE7B 1N61A 3P4RB 4DXFA 3AMZA 1L0VB 2J42A 3SFDB 2MJEA 1J7CA 1BMLC 4HRSA 1KRHA 1UNSA 5EE0A 3FILA 5I4DA 2MH7A 1B9RA 3B2FA 3ZYYX 2LMCA 4RGTA 1SJHD 4A8XC 1ZE3D 3BYTB 3BVZA 5T8IA 1JWAD 1VDVA 2Y3AA 1ZXIA 2DWQA 4YTNB 3AN1A 2IGGA 1I4PA 1KFYB 2SEBD 1B1ZA 2OHFA 2IDYA 4ARCA 1DOIA 1SSNA 1UWMA 4RF1A 1DGJA 5FK9C 2W3SA 2WU5B 2J52A 4FXCA 2DYMA 1OQRA 5D7GA 3V3XA 3ZJTA 1STEA 1KLGD 4WWMA 4L2YA 2KDMA 4KX6B 3EGRA 1CJEA 5E6JA 3PZ7A 1GAQB 1PGXA 2KAJA 2AX5A 1WGKA 5EE3A 3W1SA 1L4DB 3IT4B 1D5XC 1SIJA 3AEAB 1VJKA 1K50A 1T6BX 1ZUD2 2L32A 2WDRB 3AV8A 3E9SA 1ROEA 4REZA 3T3OA 3DWGC 4M0WA 4US9A 4WURA 4TQ1A 1WWTA 4WH4A 4N59A 1NI3A 1JWBD 3KWLA 1E7PB 2KWDA 5EE1A 1FFUA 1VR9A 3LB8C 2KACA 1AWDA 1XO3A 4HKZE 1XLPA 3NUHB 2YEPB 2HTME 1R7SA 1N63A 1ZXHA 3O13A 2E3TA 1TY0A 1ACCA 1E6EB 1AN8A 2N9KA 3IAM1 1V8CA 2IJ0A 4A6QA 1D5MC 1FD6A 1EU3A 3RFZB 2HDEA 3NZ3A 2WXLA 1FXAA 2BBCA 2WXPA 3AH7A 2VZKB 2WS3B 3HRDD 4IDIA 1J7AA 1OQQA 1CQVA 3AE2B 3P42A 4OZBA 1GB1A 1QOFA 3Q8BA 1M4VA 1ET9A 2KN4A 1XLQA 2M56B 3TUOA 4NJCA 4MM3B 1VZ7A 2BW2A 2WXGA 1K51A 2AQ2B 1OFFA 1RFKA 3U7ZA 3FAHA 4KKIA 3CIRB 2JZPA 2G9HD 4C56C 1SE4A 1I4RA 2BS2B 1JQ4A 4D2KA 1JRPA 2KQ4X 3NVVA 2L1AA 1N5XA 1QQRA 2K0PA 5TSSA 2H88B 2I2YA 4RGMA 2BT6A 2QEJC 3H8HA 2IGHA 3PO0A 4R3DA 2ON8A 1HQRD 4L1BA 1DOYA 4RNAA 1UWXA 4HROA 1JROA 4DXGA 1I7HA 1E10A 1TYGB 1I4HA 3U52E 1L0XB 3IAS1 3NVWA 1WYGA 1KF6B 2NMQA 1JWMD 3W9CB 1TS5A 3AEFB 1JW9D 2LFIA 2N0SB 4WIPA 3P4SB 4NZLB 1N60A 1QLBB 3Q8AA 1TS2A 4US8A 4LK0M 1MVKA 1GOZA 3ZJUA 1NYRA 1C76A 2TSSA 4YTPB 2QMTA 1C4PA 1TZOA 2E6XA 5LNK1 5C2TB 1Y56A 1LO5D 2ICIA 3P1MA 1C78A 1I4XA 2JQRB 2MEKA 2WU2B 3GP7A 4RFBA 4GDKB 2NTSA 2WDVB 1WSPA 2ONQA 1FNWA 3MP9A 3MFGA 1SB3C 1TS3A 2MJDA 4A55A 3BYYB 1MI0A 2JWUA 3T3NA 1ESFA 1RWSA 1I4QA 3ABVB 3BWUD 5HG2A 4C7ZA 4CQNA 3VRBB 3I9V1 2INPE 4KGRA 4JWSC 1TJEA 4AS1A 2K3UA 4YWGG 3E56A 2KMMA 1HZ6A 4YSYB 1KLUD 2I38A 1P7EA 2G1EA 4YTMB 1L5PA 2RDGA 2WXIA 3Q8FA 2RDHA 2CJOA 5HI1A 2Y5PA 4ZRPA 1DYQA 1VZ8A 1YN4A 2B76B 4JPSA 1HZ5A 1TS4A 1WXQA 3NS1A 2WXFA 3Q69A 4N6EB 1D6EC 3CWIA 1JALA 2R61A 2XN9C 2Y5CA 1FXIA 2PIAA 3FILB 4RGNA 5AUKA 4ITKA 2SAKA 1N5WA 1NEKB 1SEBD 4MACA 3MC0B 2Z8LA 1EWYC 3ZGZA 5FKAC 3R2TA 4C7YA 4OW0A 2L83A 1P7FA 1T3QA 2JYEA 1AW7A 2W3RA 2WNMA 3Q8CA 3UI3A 1IUEA 1XEEA 3BK1A 4RF0A 1SXTA 1T5XD 2PKOA 3LXFA 1PYWD 2BB6A 1DOXA 2WXQA 1L6UA 2ZW1A 3GB1A 4GDLB 1JWSD 1XCTL 4MT5A 3U4EG 4DQOC 3TEWA 1UUPA 4NAMA 1FRRA 1SF0A 3SEBA 1FO4A 2L52A 1HA5A 2D5GA 2ZW0A 2WXJA 5BMIA 2WQYB 1JCKB 1GPXA 3EUB2 1V1PA 1SE3A 3DWMA 2Q5WD 5HHDG 1BXTA 1CZPA 1L4ZB 2LEKA 1XXGA 2JXTA 1F2RI 3J9CA 3AEGB 1KH0A 3ZQ4A 5H92C 3AB5A 5EE9A 5BMHA 1K52A 2BS4B 1SJED 1XCQL 2LGIA 1EWCA 3AE5B 1L0YB 2X38A 2PW9A 1FIQA 1V1OA 2AQ3B 3P4PB 1L6VA 2GB1A 4A9AA 5AUIA 3I57A 2AQ1B 3V05A 2GRIA 4IKGA 4ZOHC 2DBYA 1RYJA 1SBBB 4JX1C 3ZJVA 3B2GA 1NVID 4EE2A 1IBXB 3Q8EA 1TKGA 4ARIA 1C4CA 3SFEB 1FEHA 2M0AA 4O1NA 2BB5A 3BVGA 1XLNA 2K9XA 1C9FA 3AE1B 4TMAB 5D3DA 1ET6A 2FUG1 4ZYSA 4KGSA 1VRAB 3AECB 4MH8A 1YNTE 1FFVA 3AEEB 2LJIA 4L23A 5BYSA 1QT9A 3VR9B 3R2IA 1I4GA 3VR8B 3IT6B 1FNVA 2RMMA 1PFDA 2JU6X 1PDXA 2WXHA 1HXYD 1QILA 2PTLA 4PT5A 3KWVA 2W54A 1K53A 4C80A 1GB4A 1FCCC 1PUTA 3HVZA 4XWWA 1E9MA 5HFYA 3ETRA 2QJLA 4P6VF 2EELA 3BIID 5BYRA 3KLSX 2LUMA 3AE6B 1UGJA 1RM6C 2JX5A 4ZHOA 4RH6A 3NVZA 2WXNA 4XDDA 1A70A 3MHZA 3MJ5A 1PGAA 1TKYA 1ZDXA 4USAA 1TY2A 4AQ7A 1QKZA 4B0MA 1WRIA 3P63A 2XNAC 1YMHE 1ZDVA 2EKIA 2MJ3A 5BYQA 3U2SC 4YXDB 2QSDA 1FMAD 1J7BA 4OHJA 2PLPA 1JWUD 4TSSA 2V3PA 4NAWB 1VLBA 4N58A 2WP9B 3B9JA 3TEYA 3WCQA 1N62A 1FNUA 5MPOA 1YN3A 2N7JA 4YSZB 1V97A 3BZDB 3N9YC 3AE4B 1YQ4B 3TEZA 4RCOA 3IXSA 3VQIA 2JSVX 2IPKD 2M19A 2LHDA 5JXVA 1VZ6A 3NRZA 3LYYA 4WAFA 2BTEA 2LHEA 1D5ZC 2INNE 1ZOYB 2WXKA 4OVZA 3AM9A 1HEZE 2FE8A 1XLOA 1D4BA 5G5GA 1NENB 3GS2A 4WQMA 2NTTA 2WXRA 1FM0D 3HUIA 2QIEB 2J4XA 5G5HA 3AEBB 5C3JB 4YSXB 5GXGB 2ACZB 2WDQB 1MHHE 4KGTA 1C79A 3KQ4A 1CK1A 4HKQA 1E0ZA 3BVMA 4IOIE 3W5UB 2OEDA 1YJJA 1EM7A 2K22A 3AE9B 1FRDA 4GLSC 2WXMA 4XE0A 1ZP0B 1JMLA 2DYOA 4LTUA 1C77A 4RGOS 5D3IB 4JWUC 1IBXA 4YT0B 1KTKA 1YJIA 4ZRQA 3TEXA 3VRAB 3EA6A 1EU4A 4H2AA 4B0EA 2IGDA 1MPEA 2RPVA 2W55A 1IGCA 1FCLA 1PGBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KMM A;  1WWT A;  3AE8 B;  3VR8 B;  2CJN A;  2PVG C;  4YSY B;  4N59 A;  2G1E A;  4YTM B;  1PFD A;  2BS3 B;  1L5P A;  1NI3 A;  1JWB D;  1PDX A;  3KWL A;  2CJO A;  1E7P B;  4ZHP A;  2WLB A;  5EE1 A;  1FFU A;  2H89 B;  3LB8 C;  1F0Z A;  2W54 A;  2B76 B;  1AWD A;  1QOG A;  1XO3 A;  1XLP A;  4C80 A;  2CU3 A;  1WXQ A;  2HTM E;  3NS1 A;  1R7S A;  1PUT A;  1QOA A;  1N63 A;  3FC4 A;  1YQ3 B;  3HVZ A;  1E9M A;  2E3T A;  1TKE A;  3L4P A;  1QF6 A;  1NYQ A;  3ETR A;  1E6E B;  3AE3 B;  4N6E B;  2QJL A;  4P6V F;  2K5P A;  3BII D;  1V8C A;  3CWI A;  1JAL A;  2Y5C A;  3AE6 B;  1FXI A;  2PIA A;  5AUK A;  1RM6 C;  2JX5 A;  5H8Y E;  4ZHO A;  4ITK A;  1NEK B;  1N5W A;  1FXA A;  3NVZ A;  3AH7 A;  2WS3 B;  3HRD D;  1AYF A;  3NVY A;  1A70 A;  1J7A A;  1OQQ A;  4IDI A;  3AE2 B;  1EWY C;  1QOF A;  1TKY A;  2FBW B;  2PVO D;  4C7Y A;  4USA A;  2L83 A;  1XLQ A;  2M56 B;  1T3Q A;  1WRI A;  2W3R A;  3P63 A;  2EKI A;  2MJ3 A;  3P4Q B;  4YXD B;  1IUE A;  3AED B;  3W5V B;  1OFF A;  1RFK A;  1QOB A;  1FMA D;  2PKO A;  3FAH A;  1J7B A;  3CIR B;  3SR6 A;  3LXF A;  1VLB A;  3AE7 B;  1N61 A;  4N58 A;  2WP9 B;  2BS2 B;  3P4R B;  1DOX A;  3B9J A;  1JQ4 A;  3WCQ A;  1N62 A;  1JRP A;  3AMZ A;  3NVV A;  1N5X A;  1L6U A;  1L0V B;  5MPO A;  4YSZ B;  1V97 A;  2MJE A;  3SFD B;  2H88 B;  3AE4 B;  1FRR A;  1SF0 A;  1J7C A;  4HRS A;  2L52 A;  1FO4 A;  1KRH A;  1YQ4 B;  2BT6 A;  5EE0 A;  1DOY A;  3PO0 A;  2MH7 A;  2WQY B;  1B9R A;  4HRO A;  1GPX A;  1JRO A;  3B2F A;  2M19 A;  3DWM A;  3EUB 2;  2Q5W D;  3ZYY X;  1I7H A;  1E10 A;  1TYG B;  1CZP A;  3NVW A;  3NRZ A;  1WYG A;  1KF6 B;  3W9C B;  2LEK A;  3AEF B;  1JW9 D;  2N0S B;  1JWA D;  1VDV A;  3P4S B;  1ZOY B;  1N60 A;  1QLB B;  1ZXI A;  2DWQ A;  3AM9 A;  4YTN B;  3AEG B;  3AN1 A;  4US8 A;  1KFY B;  1XLO A;  5G5G A;  1NEN B;  1NYR A;  5H92 C;  4YTP B;  3AB5 A;  4WQM A;  5EE9 A;  2OHF A;  1FM0 D;  3HUI A;  2QIE B;  5G5H A;  1DOI A;  2BS4 B;  5C2T B;  3AEB B;  5C3J B;  3P1M A;  3AE5 B;  1UWM A;  4YSX B;  1DGJ A;  2W3S A;  2WU5 B;  1FIQ A;  3P4P B;  5GXG B;  2ACZ B;  2JQR B;  2WDQ B;  1L6V A;  4FXC A;  2WU2 B;  1OQR A;  1E0Z A;  4A9A A;  5AUI A;  3W5U B;  1YJJ A;  4ZOH C;  2K22 A;  3AE9 B;  2DBY A;  2WDV B;  1RYJ A;  4JX1 C;  4WWM A;  3RPF C;  1FRD A;  3B2G A;  1NVI D;  4KX6 B;  1ZP0 B;  1CJE A;  1TKG A;  1SB3 C;  3SFE B;  4LTU A;  1XLN A;  1GAQ B;  2KAJ A;  2MJD A;  4JWU C;  4YT0 B;  2AX5 A;  2K9X A;  1WGK A;  1YJI A;  3AE1 B;  5EE3 A;  1RWS A;  3VRA B;  1SIJ A;  3AEA B;  1VJK A;  1ZUD 2;  3AEC B;  2WDR B;  3AV8 A;  3ABV B;  4C7Z A;  2W55 A;  1FFV A;  1ROE A;  3VRB B;  3AEE B;  4JWS C;  1TJE A;  3DWG C;  1QT9 A;  4US9 A;  3VR9 B; 
#chains in the Genus database with same CATH topology
 4J3O D;  2GLS A;  3RYT A;  4XWT A;  4TQ0 A;  4HVB A;  1Q10 A;  3Q3J A;  2H89 B;  3UF8 A;  1YN5 A;  3N32 A;  2REX A;  3DHH C;  2MQJ A;  2MP2 A;  3L4P A;  2CHZ A;  1TKE A;  3IHP C;  2BYT A;  1NYQ A;  1YIW A;  3H9D A;  3I63 C;  3AE3 B;  3TBL D;  1WZ3 A;  2PMV A;  1F2R C;  1EUV B;  2LXA A;  2V4I B;  4ZDV A;  4ANU A;  1SE2 A;  2KD0 A;  4GN1 A;  3W2D A;  1MHX A;  1C4A A;  2J53 A;  2DYB A;  2YEP F;  3AED B;  3W5V B;  3OWE B;  4HEA 1;  1QOB A;  3PZ8 A;  3KW5 B;  1WJ6 A;  2VZK D;  4BKS D;  3AE7 B;  3P4R B;  4LNN A;  4DXF A;  3VTW A;  2IO2 B;  2J42 A;  3JYU A;  1TGZ B;  2BKF A;  4HRS A;  2LGD A;  1UNS A;  4N9F 4;  2DAF A;  3ZNG C;  3ZYY X;  3CMM B;  2KT7 A;  3ZTC A;  3BYT B;  3H7P B;  1JWA D;  1VDV A;  1ZXI A;  2IGG A;  1I4P A;  4W9J A;  4MGY E;  4ARC A;  2KDE B;  2KJH B;  5E6O A;  2KX3 A;  4FXC A;  2DYM A;  5KHO A;  1SE9 A;  3V3X A;  1STE A;  1H4R A;  2RGF A;  3QAQ A;  1XT9 B;  4KIK B;  5E6J A;  2V3S A;  1PGX A;  1L4D B;  2IO0 B;  2N9E B;  3AEA B;  1ZUD 2;  3AV8 A;  3E9S A;  4JIO U;  3T3O A;  5LXI B;  2KC2 A;  4TQ1 A;  1WWT A;  1WXA A;  3NG0 A;  2KO3 A;  2GBR A;  4IW0 A;  4HKZ E;  4NPN A;  1R7S A;  1J8C A;  2E3T A;  1GNU A;  2N9K A;  3IAM 1;  3EFC A;  3OAW A;  3UIN B;  3NZ3 A;  2BF8 B;  2BBC A;  4IDI A;  2VZK B;  1CQV A;  2O6V A;  4W9L A;  1M4V A;  1ET9 A;  2BPS A;  2IND C;  4MM3 B;  1OGW A;  2BW2 A;  1E90 A;  3O65 B;  3Q2A C;  3CIR B;  4GSW A;  4FN2 A;  1SE4 A;  2KQ4 X;  1N5X A;  2ZCC A;  3RNA C;  2BT6 A;  2QEJ C;  3H8H A;  1DOY A;  4L1B A;  4RNA A;  1UWX A;  1JRO A;  4DXG A;  1I7H A;  4MSM B;  4MGZ E;  3NVW A;  1OEY A;  1WE6 A;  2WDT B;  1F52 A;  2RDB C;  2L3Z A;  3P4S B;  2RSU A;  1N60 A;  5IP4 D;  3H7P A;  1MVK A;  1V5O A;  4YTP B;  3RUI B;  4IWO A;  2E6X A;  2WX0 A;  5LNK 1;  2ICI A;  1LO5 D;  1WIA A;  3P1M A;  1WGR A;  4URK A;  2V9H A;  2JQR B;  2LRW A;  3A9K B;  2NTS A;  3MP9 A;  1SB3 C;  4ICU A;  4BBN C;  4HCP B;  3M95 A;  4PK1 A;  5DPR A;  3BYY B;  1FPY A;  2ZVO A;  2D11 A;  2INP E;  4KGR A;  4LNF A;  3A9J A;  3DBH I;  4NNJ B;  2K3U A;  4YWG G;  3S2A A;  3PLU A;  1Q0W B;  3PLV A;  4MJS A;  2M8S A;  3ZTD A;  4MGI E;  2CJO A;  4HLE A;  1VZ8 A;  1YN4 A;  3RZW C;  4JPS A;  4HCN B;  1WXQ A;  2ZCB A;  4GOC A;  1P1A A;  3Q69 A;  1D6E C;  4C4V B;  2DZK A;  2PEA A;  2XN9 C;  4ZRJ A;  2PIA A;  4RGN A;  2VH1 A;  2N7D A;  4ITK A;  3WAO A;  5DPW A;  1C3T A;  3HM3 A;  1EWY C;  3ZGZ A;  4BKS A;  5FKA C;  2M4N A;  4OW0 A;  4C7Y A;  2MSE D;  2JYE A;  1AW7 A;  3Q8C A;  2EMS A;  5AZH A;  3UI3 A;  1U4A A;  1SXT A;  2CHX A;  4MM3 A;  4WJN A;  3LXF A;  3LJ3 A;  1I42 A;  4E74 A;  1WRD B;  3GB1 A;  1JWS D;  4F1S A;  1FRR A;  3GOE A;  2N1W A;  3DWM A;  5HHD G;  1R4M I;  1CZP A;  3QAR A;  1F2R I;  3J9C A;  2HD5 B;  1KH0 A;  1UF0 A;  3U8Z A;  3ZQ4 A;  5H92 C;  5EE9 A;  3IVF A;  4B6W A;  2IZV B;  2DHZ A;  1WXV A;  3W1Y A;  1L0Y B;  2X38 A;  3UIO B;  2BVC A;  5AZF A;  2GB1 A;  3Q6B A;  3V05 A;  2GRI A;  4MH0 E;  1RYJ A;  4AJY B;  3QA8 A;  3L13 A;  1C4C A;  5C1Z A;  2M0A A;  5AEK B;  2K9X A;  4TMA B;  3WAM A;  2FUG 1;  4KDL B;  4KGS A;  2LWP A;  3UIP B;  1FFV A;  4GU2 A;  3VR8 B;  5BO4 B;  2RMM A;  5DCN A;  2D3C A;  2WXH A;  4WWP A;  2W54 A;  3PGE A;  1GB4 A;  1SIF A;  2IY1 B;  2J0J A;  1PUT A;  1WF9 A;  3KYC D;  3IFW B;  2D3G A;  3BII D;  3W1S C;  3PS6 A;  1RM6 C;  3B1L X;  3SD5 A;  4RH6 A;  2V4L A;  4FAD A;  2A4Z A;  1A70 A;  2IO3 B;  3MJ5 A;  2KQS A;  1ZDX A;  1TY2 A;  4X57 B;  1RRB A;  1QKZ A;  4B0M A;  3RZF A;  2EKI A;  3APC A;  3VUY A;  1IPG A;  2XEW A;  4OHJ A;  4YL8 A;  2WP9 B;  3B9J A;  1FNU A;  4DHJ D;  2LVQ A;  3ZIM A;  1UD7 A;  1YN3 A;  4YSZ B;  1RLF A;  1UGM A;  3AE4 B;  1E8X A;  1P9D U;  2JSV X;  4QAY A;  3LYY A;  2MW5 A;  3ZRC A;  2BTE A;  2LHE A;  4WQM A;  2WXR A;  1FM0 D;  5G5H A;  2J4X A;  4AWJ A;  4BKT A;  5C3J B;  1WGG A;  2LZ6 A;  4BOS C;  3ZDM C;  1C79 A;  4HKQ A;  1E0Z A;  3W5U B;  1YJJ A;  3PZD A;  1T0Y A;  4G3X B;  4FJY A;  3AE9 B;  3IBE A;  3QX1 A;  4W9G A;  1FRD A;  2WXM A;  4XE0 A;  3PPA A;  1JML A;  3RT3 B;  4HDO A;  3DVN V;  1C77 A;  4JWU C;  4YT0 B;  1E8W A;  3VFK A;  3V61 A;  2WGS A;  2KLG A;  3ZXV A;  1GG3 A;  2IGD A;  4M0W B;  2RPV A;  5IOI A;  1FCL A;  3RD2 A;  2PE6 B;  4CHK A;  2BS3 B;  1V5T A;  4A3P A;  4ZHP A;  1KM7 A;  1YX6 B;  2MRP A;  2WYQ A;  2V1Y A;  3RPF C;  1QOA A;  4JE3 B;  3FC4 A;  1QF6 A;  1IGD A;  2KVR A;  2NCN A;  2K1F A;  2K5P A;  2FAZ A;  2W82 A;  5FR3 A;  3CST A;  3DBH B;  1ENF A;  5H8Y E;  3ZUN A;  2JY6 A;  3R8B A;  1RAX A;  3NVY A;  1P0R A;  3C8Y A;  4P1B C;  1WY8 A;  1BUI C;  1M94 A;  1WX8 A;  3QHT A;  2WXO A;  2AL3 A;  3P4Q B;  4UDU C;  4P16 A;  2JYT A;  2DLB A;  2IYD B;  2KHW B;  1ZW7 A;  2MJE A;  5IN7 A;  1BML C;  3RNE C;  5I4D A;  3FIL A;  2MH7 A;  2EKE C;  3DBR B;  2RD0 A;  2HTH A;  3M63 B;  5E6P A;  1SJH D;  1A5R A;  3VDZ A;  4K81 A;  3K9O B;  1E5W A;  1MFW A;  2CU1 A;  3RNC C;  1B1Z A;  2G4S A;  1WI0 A;  4JQW C;  3H7S A;  1UWM A;  2W3S A;  3C19 A;  2CS4 A;  3Q3F A;  2QDF A;  5D7G A;  3L17 A;  4NY0 A;  2FCS A;  4KX6 B;  3EGR A;  2KTF A;  1CJE A;  1FXT B;  4KV2 A;  1KOT A;  1D5X C;  1UH6 A;  3L16 A;  2KJR A;  4M0W A;  4US9 A;  3EFU A;  1JRU A;  2NPT B;  4N59 A;  4P7I A;  5J2R A;  1JWB D;  2BWE S;  3KWL A;  1E7P B;  2KWD A;  5EE1 A;  1FFU A;  1WM2 A;  5JHB A;  1P3Q U;  1WGD A;  1WJN A;  2HTM E;  4ZRI A;  2INC C;  4HPM B;  1ACC A;  2M1M A;  2WWZ A;  2JRH A;  3PRZ A;  4A6Q A;  2IJ0 A;  3AXC A;  1FD6 A;  4M01 A;  1EU3 A;  2HDE A;  2WXL A;  2WXP A;  3BIN A;  2KAN A;  2WS3 B;  3NY5 A;  3N3K B;  2KK8 A;  4OZB A;  3PV1 A;  2D10 A;  2KYW A;  2M56 B;  3JSV B;  4NJC A;  5L83 A;  2WXG A;  1K51 A;  4KKI A;  2JZP A;  2J0M A;  2BS2 B;  1JQ4 A;  4D2K A;  1JRP A;  4EOY A;  4LJO B;  2I2Y A;  4R3D A;  4FHJ A;  2AEH A;  4HRO A;  4MEL A;  2PE9 A;  1D3Z A;  1V86 A;  1L0X B;  2HJ8 A;  3LDZ E;  1LGR A;  2CR5 A;  1KF6 B;  2NMQ A;  5JH5 C;  1TS5 A;  2KFK A;  2N0S B;  1QLB B;  2L0F A;  4LK0 M;  1LM8 B;  3ZJU A;  1NYR A;  4CO7 A;  4M8N A;  2GBJ A;  5G55 A;  4M02 A;  3DOW A;  3ZNI D;  1I4X A;  2WU2 B;  5C23 A;  2MLB A;  1WSP A;  1FNW A;  3L10 B;  3HM6 X;  3MFG A;  2DEN B;  3EHV A;  3C0R B;  2LJ5 A;  3Q3O C;  2KWV B;  4MGK E;  3Q3M C;  1MI0 A;  1ESF A;  4XZ4 A;  1I4Q A;  2GBN A;  2I1K A;  3BWU D;  4AS1 A;  1HZ6 A;  2AL6 A;  4YTM B;  2RDG A;  2WXI A;  3WIM A;  3A4R A;  5HI1 A;  2Y5P A;  5LXH A;  4W9K A;  1V2Y A;  4S0R A;  3NS1 A;  2FID A;  1LXD A;  4W9F A;  4ZRK A;  1JAL A;  2R61 A;  4HWI B;  4EZK A;  2Y5C A;  3I5J C;  5AUK A;  3QK0 A;  2KQ7 A;  2SAK A;  1N5W A;  2O2V A;  4MAC A;  4BOZ B;  3RNF C;  3R2T A;  3U30 A;  5IO9 A;  3A1Q B;  3BK1 A;  1T5X D;  2ZPY A;  2BB6 A;  2CKH B;  2WXQ A;  1NBF C;  1Z5S B;  4WAA A;  4MDK E;  5DPT A;  3V60 A;  3R3M A;  1UUP A;  4PS3 A;  4GIV A;  1JCK B;  3EUB 2;  3MTN B;  4GGQ A;  2K8B A;  4JGH B;  3OLM D;  1WZ0 A;  2IY0 B;  3AEG B;  4IM0 A;  3ONS A;  3AB5 A;  4DDG D;  1SJE D;  3AE5 B;  2L7R A;  4II3 B;  1FIQ A;  1V1O A;  4DDI D;  4DBG A;  1L6V A;  2GOW A;  4A9A A;  5AUI A;  3I57 A;  4AOF A;  3I3T B;  3B2G A;  2LI5 A;  2AWT A;  3Q8E A;  1FEH A;  4O1N A;  2QHO A;  5D3D A;  1ET6 A;  4ZYS A;  2C7N B;  3B08 A;  4KZ0 A;  4MH8 A;  1YNT E;  3DCG A;  2LJI A;  3VR9 B;  3VTV A;  4E71 A;  3DDC B;  2JU6 X;  4RMA A;  3NS8 A;  4ACF A;  2PTL A;  3ZO5 B;  3KWV A;  4K7U A;  1V49 A;  4XWW A;  1YQB A;  5HFY A;  2KZR A;  4KIK A;  5CHV C;  5BYR A;  1LFD A;  2LUM A;  2WXN A;  4XDD A;  3TIX A;  2ZVN A;  3MHZ A;  3NZS A;  4TKN A;  3WAP A;  3PTF C;  1MJD A;  4S17 A;  2XNA C;  4WWO A;  2QSD A;  1WJ4 A;  1JWU D;  3A1Q A;  2V3P A;  4NAW B;  1VLB A;  1XD3 B;  4N58 A;  5CTR C;  2ZNV B;  5LLI A;  3NJT A;  1OTR B;  2LUE A;  2RR9 A;  2MBB B;  3A4S C;  1E8Z A;  3L54 A;  2LVP A;  4F7Z A;  3N9Y C;  3T8M A;  4RCO A;  2N9X A;  3VQI A;  4ANV A;  4F8C B;  2J7Q B;  3DBR I;  1VZ6 A;  1AAR A;  3EEC A;  3AM9 A;  2GBM A;  1ZKH A;  3N1Z C;  4K7W A;  4DK5 A;  3KQ4 A;  1CK1 A;  4ANW A;  1E7U A;  3DVN U;  2L00 B;  2KMC A;  3PRM B;  4GLS C;  2N9P C;  1J0G A;  4MEM A;  5D94 A;  5D3I B;  1YJI A;  1WR1 A;  3QC8 B;  3EA6 A;  1EU4 A;  4B0E A;  2LVO A;  2V0G A;  3AE8 B;  2CJN A;  2ZNV C;  2PVG C;  3CSF A;  4EKU A;  3TSS A;  3PHW B;  1ZPS A;  2WLB A;  3A9K A;  3HVD A;  3RUL A;  2N9L A;  1XF5 L;  1LQB A;  5CHW A;  4PYU A;  3VH4 B;  4FJZ A;  1YQ3 B;  3ZKJ C;  3X0W A;  1KJT A;  2LGS A;  4XDC A;  2KTR B;  4W9D A;  2JWZ A;  3RNB C;  3DBS A;  1V1P B;  2QIL A;  3OJ4 B;  1AYF A;  1UBQ A;  4OZC A;  2FBW B;  2PVO D;  2C7H A;  3DBL B;  3HHM A;  3BK2 A;  1F77 A;  5J17 A;  5BMG A;  2LGY A;  1L2N A;  4EEW A;  2ZPN A;  1N61 A;  4NQK E;  3ZVV A;  3X23 A;  3AMZ A;  3ZNZ B;  4NAW A;  1L0V B;  3APD A;  1Q1O A;  3SFD B;  4C4V A;  1J7C A;  4NQL B;  1KRH A;  3KH0 A;  1H8C A;  3B2F A;  2LMC A;  4FJV B;  4ASW C;  5T8I A;  2Y3A A;  4YTN B;  3AN1 A;  4JLC A;  2OHF A;  1P98 A;  2IDY A;  1DOI A;  3VXW A;  1SSN A;  1DGJ A;  4DHZ B;  2WU5 B;  3PVL A;  2DZJ A;  1HE8 A;  1OQR A;  2DX5 B;  3QWZ B;  2BYV E;  4K7S A;  3B0A A;  4WWM A;  2KDM A;  4K1R B;  1GJZ A;  3PZ7 A;  1GAQ B;  5J18 A;  2AX5 A;  3VUW A;  1WGK A;  5EE3 A;  3TCA A;  3W1S A;  5IA7 A;  3IT4 B;  2IO1 B;  1SIJ A;  1K50 A;  3KVF B;  2L32 A;  4BVU C;  4EFO A;  1GC7 A;  4WH4 A;  4LJP B;  4TUU A;  5FR6 A;  2PPH A;  4G0N B;  1F9J A;  1NI3 A;  4PYZ A;  4I6L B;  3LB8 C;  1V81 A;  1XO3 A;  1XLP A;  2GBK A;  1N63 A;  1ZXH A;  3O13 A;  4ANX A;  1TY0 A;  4A3O A;  1AN8 A;  1D5M C;  2Y5B B;  3MC8 A;  3RFZ B;  2KWC A;  4G11 A;  2KMA A;  2IBI B;  3D32 A;  1QOF A;  4RM8 A;  3Q8B A;  1GUA B;  2KN4 A;  1XLQ A;  3TUO A;  1I35 A;  1OFF A;  1ISN A;  3U7Z A;  3FAH A;  4XC2 A;  4EUT A;  2G9H D;  4C56 C;  1Y8R C;  4JL9 A;  5TR5 A;  4B95 A;  3NVV A;  2K8C A;  3DPD A;  3VH3 B;  5TSS A;  1K8R B;  4RGM A;  2ON8 A;  1HQR D;  3KUZ A;  1TYG B;  1I4H A;  3IAS 1;  1WYG A;  3W9C B;  3AEF B;  1JW9 D;  4NZL B;  3ZNH B;  3Q8A A;  1TS2 A;  1V9J A;  1GOZ A;  1C76 A;  2TSS A;  2QMT A;  4HPP A;  1TZO A;  2ZJD A;  4ICV A;  1Y56 A;  2NBW B;  1C78 A;  4GMV A;  2FCQ A;  4GDK B;  2WDV B;  3KUD B;  2ONQ A;  3KYD D;  2MP2 B;  3RNG C;  2LXC A;  2MJD A;  2JWU A;  2C7M B;  1RWS A;  3VRB B;  3I9V 1;  2FCN A;  3RMK C;  4JWS C;  5GMV A;  2K39 A;  5D2M B;  3H1U A;  2KMM A;  2BQQ A;  3N30 A;  2GMI C;  3ZW3 A;  2I38 A;  2FCM A;  2L8J A;  3PHX B;  2RDH A;  3WAL A;  4HJK A;  2JF5 A;  1DYQ A;  3VVW B;  1BT0 A;  3HK0 A;  1HZ5 A;  3RI7 C;  4LNK A;  2WXF A;  4WJO A;  3QCA A;  2G45 B;  3SDL C;  5CX3 A;  4W9E A;  2OJR A;  1L7Y A;  1SEB D;  4OVU A;  2LRU A;  2MCN B;  4EZL A;  3MC0 B;  2Z8L A;  2ZEQ A;  2L83 A;  1T3Q A;  2WNM A;  1R4N B;  1IUE A;  1XEE A;  4HXD A;  1PYW D;  3UGB B;  4BFR A;  1L6U A;  2ZW1 A;  3MC9 A;  1XCT L;  2G4D B;  3TEW A;  1FO4 A;  3GE8 C;  2L52 A;  2D5G A;  2WXJ A;  4WJP A;  2WQY B;  2BGF A;  2D3B A;  1GPX A;  1SE3 A;  2Q5W D;  1PQS A;  2J0K A;  2VRR B;  3ML8 A;  2JXT A;  2BKR B;  2QC8 A;  3AU4 A;  2ZZP B;  1S1Q B;  1XCQ L;  2LGI A;  1EWC A;  3P4P B;  1MG4 A;  2JPH A;  2Z0D B;  1UEL A;  1WYW B;  2AQ1 B;  4ZOH C;  2DBY A;  4JX1 C;  1SBB B;  4GDK A;  3ZJV A;  2KX0 A;  1NVI D;  3JW0 X;  4P1C C;  1IBX B;  1TKG A;  4LDT D;  1GC6 A;  4ARI A;  3SFE B;  2BB5 A;  1J19 A;  4GB9 A;  3ML9 A;  2LAS A;  1UBI A;  2L76 A;  1VRA B;  3ZRF A;  2WX1 A;  3BY4 B;  3Q3N C;  2L05 A;  1WGH A;  2O6V B;  3AEE B;  1HTO A;  4M8M A;  3K9P B;  1QT9 A;  1I4G A;  4BKG A;  4NJ7 A;  1FNV A;  1PFD A;  4XYC A;  1PDX A;  4J6I A;  1HXY D;  2R2O A;  3N20 C;  2R2Q A;  2K25 A;  1CMX B;  1IP9 A;  1K53 A;  1TIF A;  2M0X A;  4C80 A;  1FCC C;  3M62 B;  3APF A;  3HVZ A;  5JZE B;  2QJL A;  4G50 A;  4P6V F;  2EEL A;  2JXX A;  3AE6 B;  4ZHO A;  4B9K A;  4FA6 A;  2NPT A;  3IG3 A;  2MWS B;  1YMH E;  1ZDV A;  3DBL I;  5G2N A;  3U2S C;  4FLH A;  1FMA D;  1J7B A;  1WXS A;  3R7Q A;  3VHT C;  3TEY A;  1N62 A;  2Z0E B;  2HE7 A;  5MPO A;  3DHI C;  4K3C A;  2N7J A;  3BZD B;  4TV3 A;  2MBE A;  2RPQ A;  3PRE A;  1WH3 A;  2IPK D;  2KFJ A;  2LHD A;  5KHQ A;  3NRZ A;  1S3S G;  1YJ1 A;  1T0S C;  4WAF A;  3MHS D;  1D5Z C;  2INN E;  3JSV A;  4OVZ A;  5JHA A;  1HEZ E;  3FKY A;  1XLO A;  3SU8 X;  3QIJ A;  2K6Q A;  1NEN B;  3A9J B;  3GS2 A;  3QQ8 B;  2NTT A;  2C60 A;  3HUI A;  2QIE B;  4LDT B;  3AEB B;  4MJS B;  3NHE B;  2BWF A;  2ACZ B;  3M3J A;  2WDQ B;  3L08 A;  4KGT A;  5CHF A;  4W9I A;  4IOI E;  2OED A;  1EM7 A;  2B3A A;  2DNF A;  2HJ1 A;  2K22 A;  3N1Y C;  2G3Q B;  1ZP0 B;  4LTU A;  4RGO S;  1IBX A;  1KTK A;  4ZRQ A;  4M00 A;  3V6E B;  4BAX A;  2XBB C;  2EMT A;  1MPE A;  3U7D A;  2Z59 B;  4IUM B;  1PGB A;  5E6N A;  3AU5 A;  2GI9 A;  4A90 A;  1WM3 A;  4DWF A;  2KWU B;  1WX7 A;  1F0Z A;  5AZG A;  1QOG A;  4HJG E;  2CU3 A;  1WE7 A;  2DZM A;  4Q2J A;  1OQY A;  3ZDT A;  4IWP A;  2YVC A;  2NBU A;  1WXM A;  3N1X C;  2MBH A;  2JUO A;  2NVU I;  4HPL B;  3RCZ A;  3URY A;  2QCZ A;  2V3N A;  4II2 B;  2LD9 A;  3KUC B;  4LLG M;  3SR6 A;  4OZA A;  4KKJ A;  4AUQ C;  4XGA B;  2N1V A;  4PS7 A;  2FIF A;  1VCB A;  3DHG C;  5EE0 A;  5L95 C;  1B9R A;  4RGT A;  3UQA A;  4A8X C;  2D3A A;  1ZE3 D;  3BVZ A;  4RM9 A;  2DWQ A;  1KFY B;  2SEB D;  2C5L C;  3WA0 A;  1KLV A;  2W9N A;  5IAA C;  4RF1 A;  3TL5 A;  5FK9 C;  4W9H A;  2J52 A;  2MHJ A;  2JVC A;  3ZJT A;  1KLG D;  4L2Y A;  4IC7 B;  1TT5 B;  3H6N A;  1SGH A;  2KAJ A;  1RFA A;  2XK5 B;  1YX5 B;  4IWQ A;  1YOV B;  4I6P A;  3QJZ A;  1VJK A;  2WHI A;  1T6B X;  2WDR B;  4K3B A;  1ROE A;  4REZ A;  3DWG C;  4BZA A;  3GE3 C;  4KSK C;  4WUR A;  3DVG Y;  4C00 A;  1IYF A;  2PJH A;  2JRI B;  3OG5 A;  1VR9 A;  2KAC A;  1AWD A;  3NUH B;  2KOX A;  2YEP B;  4DHZ E;  2JT4 B;  1E6E B;  1V8C A;  4WJQ A;  1TZ1 A;  4A20 A;  4ZYN A;  2NR2 A;  1F1H A;  1WX9 A;  3NZU A;  1FXA A;  3AH7 A;  3HRD D;  1J7A A;  1OQQ A;  3AE2 B;  3P42 A;  1GB1 A;  1WMH B;  2MBO A;  2DZI A;  3T9L A;  4WWN A;  4DXA B;  4LNO A;  1VZ7 A;  3GZN I;  2AQ2 B;  1RFK A;  1R4N I;  1NI2 A;  1I4R A;  2KKC A;  2KNB A;  2L1A A;  2MA9 B;  1QQR A;  3ECI A;  2K0P A;  2NBV B;  2KVZ A;  2H88 B;  5HKH A;  2X8X X;  2IGH A;  3PO0 A;  1C1Y B;  1N6Z A;  3L0W B;  1WR6 E;  2A5U A;  1E10 A;  3U52 E;  1JWM D;  4KDI C;  4HDQ A;  3PSE B;  2LFI A;  4WIP A;  1EF1 A;  2YLM A;  4US8 A;  3JVZ X;  2MX2 A;  2K6D B;  1C4P A;  1V80 A;  5C2T B;  2MEK A;  3GP7 A;  2D2Q A;  4RFB A;  3NOB A;  4FHK A;  2BYE A;  3DVG X;  3SHQ A;  1TS3 A;  3DQV A;  2FNJ B;  4A55 A;  3T3N A;  2XK5 A;  3ABV B;  4C7Z A;  5HG2 A;  4CQN A;  2KLC A;  2KXJ A;  1TJE A;  3VAW A;  1TTN A;  1WFY A;  3AI5 A;  3E56 A;  2NS5 A;  3TJP A;  2M17 A;  4YSY B;  1KLU D;  4IM2 A;  1P7E A;  2G1E A;  1L5P A;  3Q8F A;  1QZE A;  4MSQ B;  4ZRP A;  5EDS A;  2B76 B;  4XX5 A;  1TS4 A;  4N6E B;  3R66 C;  4AP4 C;  3CWI A;  4FUL A;  1FXI A;  3FIL B;  3HIZ A;  2D07 B;  1NEK B;  2DAJ A;  4CYE A;  3AUL A;  3ZXR A;  5DPS A;  1Z2M A;  4NJ6 A;  2BYF A;  1P7F A;  1WMH A;  1E8Y A;  2W3R A;  4I6N B;  4RF0 A;  2PKO A;  2ASQ A;  1DOX A;  4GDL B;  4MT5 A;  3U4E G;  4DQO C;  2CHW A;  4NAM A;  1SF0 A;  1NDD A;  3SEB A;  2KTR A;  1HA5 A;  2ZW0 A;  5BMI A;  1EO6 A;  1T0R C;  1V1P A;  1BXT A;  2JZZ A;  1L4Z B;  3Q14 C;  2LEK A;  1XXG A;  3WAN A;  5IKC M;  1HTQ A;  1WJU A;  2UWQ A;  4KVG B;  3V6C B;  5BMH A;  1K52 A;  3ENE A;  2BS4 B;  3TMP B;  4W9C A;  2PW9 A;  2AQ3 B;  2UYZ B;  1WGY A;  3A33 B;  1ZGU B;  4IG7 B;  1OEY J;  4IKG A;  1XQQ A;  4EE2 A;  1UZX B;  4EZJ A;  4PS8 A;  1VD2 A;  3CF6 E;  3BVG A;  4IM3 A;  1XLN A;  2JZ3 B;  1C9F A;  3AE1 B;  2KDI A;  3AEC B;  2VH2 A;  4L23 A;  2FUH B;  5BYS A;  3R2I A;  3IT6 B;  4LCD E;  4DHJ B;  1MG8 A;  1QIL A;  4PT5 A;  3P2B A;  3VTU A;  3VUX A;  2I1J A;  1E9M A;  3R7R A;  3ETR A;  4GXB A;  3PT2 B;  2N7E A;  3KLS X;  2C9W B;  2KDB A;  3EC8 A;  2AYO B;  1UGJ A;  2JX5 A;  1EF5 A;  2KJ6 A;  3NVZ A;  4BBN F;  1Q5W B;  2KFK B;  1PGA A;  1TKY A;  4USA A;  4AQ7 A;  2L0T A;  1WRI A;  3P63 A;  2MJ3 A;  5BYQ A;  4YXD B;  2O6V D;  1YD8 U;  2PLP A;  2KC1 A;  4OVV A;  4TSS A;  3WCQ A;  1X1M A;  2N4F A;  4AJW A;  1V97 A;  3OJ3 A;  4GDL A;  1YQ4 B;  1TBE A;  4KZC A;  3TEZ A;  1R4M B;  3IXS A;  1G6J A;  3PRP B;  3MJW A;  2M19 A;  2OOB B;  5JXV A;  2K8H A;  2OJW A;  3GZN B;  1T0Q C;  2MBQ A;  1ZOY B;  2WXK A;  2KN5 A;  2FE8 A;  1D4B A;  5G5G A;  3ZLZ A;  1E7V A;  3ALB A;  4LNI A;  4YSX B;  5GXG B;  1MHH E;  4HK2 A;  3BVM A;  3V62 A;  2KDF B;  5D6J B;  4KSL C;  4E3C A;  3RN9 C;  3UQB A;  2DYO A;  4WQO B;  2UU7 A;  2LGX A;  3TEX A;  1V6E A;  3VRA B;  4FBJ B;  4H2A A;  2W55 A;  2O2V B;  1IGC A; 
#chains in the Genus database with same CATH homology
 4J3O D;  2V0G A;  3AE8 B;  4XWT A;  2CJN A;  2PVG C;  3TSS A;  2GI9 A;  4TQ0 A;  2BS3 B;  1Q10 A;  1ZPS A;  4A90 A;  4ZHP A;  2WLB A;  3HVD A;  2H89 B;  1F0Z A;  2N9L A;  1XF5 L;  1QOG A;  4HJG E;  1YN5 A;  2CU3 A;  3RPF C;  1QOA A;  4JE3 B;  3FC4 A;  3L4P A;  1YQ3 B;  4Q2J A;  1QF6 A;  1TKE A;  1IGD A;  2BYT A;  1NYQ A;  3AE3 B;  2PMV A;  2K5P A;  4XDC A;  1F2R C;  2W82 A;  5FR3 A;  1ENF A;  5H8Y E;  2V4I B;  1V1P B;  3R8B A;  2QIL A;  1AYF A;  3NVY A;  1SE2 A;  3URY A;  3C8Y A;  4OZC A;  3W2D A;  2FBW B;  2PVO D;  2V3N A;  1MHX A;  1C4A A;  1BUI C;  2J53 A;  2WXO A;  3P4Q B;  4UDU C;  2YEP F;  3AED B;  3W5V B;  4P16 A;  3BK2 A;  2JYT A;  2DLB A;  3OWE B;  1F77 A;  1QOB A;  4HEA 1;  3PZ8 A;  4LLG M;  5BMG A;  3SR6 A;  4OZA A;  2VZK D;  4KKJ A;  3AE7 B;  1N61 A;  3P4R B;  4DXF A;  3AMZ A;  1L0V B;  2J42 A;  3SFD B;  2MJE A;  1J7C A;  1BML C;  4HRS A;  1KRH A;  1UNS A;  5EE0 A;  3FIL A;  5I4D A;  2MH7 A;  1B9R A;  3B2F A;  3ZYY X;  2LMC A;  4RGT A;  1SJH D;  4A8X C;  1ZE3 D;  3BYT B;  3BVZ A;  5T8I A;  1JWA D;  1VDV A;  2Y3A A;  1ZXI A;  2DWQ A;  4YTN B;  3AN1 A;  2IGG A;  1I4P A;  1KFY B;  2SEB D;  1B1Z A;  2OHF A;  2IDY A;  4ARC A;  1DOI A;  1SSN A;  1UWM A;  4RF1 A;  1DGJ A;  5FK9 C;  2W3S A;  2WU5 B;  2J52 A;  4FXC A;  2DYM A;  1OQR A;  5D7G A;  3V3X A;  3ZJT A;  1STE A;  1KLG D;  4WWM A;  4L2Y A;  2KDM A;  4KX6 B;  3EGR A;  1CJE A;  5E6J A;  3PZ7 A;  1GAQ B;  1PGX A;  2KAJ A;  2AX5 A;  1WGK A;  5EE3 A;  3W1S A;  1L4D B;  3IT4 B;  1D5X C;  1SIJ A;  3AEA B;  1VJK A;  1K50 A;  1T6B X;  1ZUD 2;  2L32 A;  2WDR B;  3AV8 A;  3E9S A;  1ROE A;  4REZ A;  3T3O A;  3DWG C;  4M0W A;  4US9 A;  4WUR A;  4TQ1 A;  1WWT A;  4WH4 A;  4N59 A;  1NI3 A;  1JWB D;  3KWL A;  1E7P B;  2KWD A;  5EE1 A;  1FFU A;  1VR9 A;  3LB8 C;  2KAC A;  1AWD A;  1XO3 A;  4HKZ E;  1XLP A;  3NUH B;  2YEP B;  2HTM E;  1R7S A;  1N63 A;  1ZXH A;  3O13 A;  2E3T A;  1TY0 A;  1ACC A;  1E6E B;  1AN8 A;  2N9K A;  3IAM 1;  1V8C A;  2IJ0 A;  4A6Q A;  1D5M C;  1FD6 A;  1EU3 A;  3RFZ B;  2HDE A;  3NZ3 A;  2WXL A;  1FXA A;  2BBC A;  2WXP A;  3AH7 A;  2VZK B;  2WS3 B;  3HRD D;  4IDI A;  1J7A A;  1OQQ A;  1CQV A;  3AE2 B;  3P42 A;  4OZB A;  1GB1 A;  1QOF A;  3Q8B A;  1M4V A;  1ET9 A;  2KN4 A;  1XLQ A;  2M56 B;  3TUO A;  4NJC A;  4MM3 B;  1VZ7 A;  2BW2 A;  2WXG A;  1K51 A;  2AQ2 B;  1OFF A;  1RFK A;  3U7Z A;  3FAH A;  4KKI A;  3CIR B;  2JZP A;  2G9H D;  4C56 C;  1SE4 A;  1I4R A;  2BS2 B;  1JQ4 A;  4D2K A;  1JRP A;  2KQ4 X;  3NVV A;  2L1A A;  1N5X A;  1QQR A;  2K0P A;  5TSS A;  2H88 B;  2I2Y A;  4RGM A;  2BT6 A;  2QEJ C;  3H8H A;  2IGH A;  3PO0 A;  4R3D A;  2ON8 A;  1HQR D;  4L1B A;  1DOY A;  4RNA A;  1UWX A;  4HRO A;  1JRO A;  4DXG A;  1I7H A;  1E10 A;  1TYG B;  1I4H A;  3U52 E;  1L0X B;  3IAS 1;  3NVW A;  1WYG A;  1KF6 B;  2NMQ A;  1JWM D;  3W9C B;  1TS5 A;  3AEF B;  1JW9 D;  2LFI A;  2N0S B;  4WIP A;  3P4S B;  4NZL B;  1N60 A;  1QLB B;  3Q8A A;  1TS2 A;  4US8 A;  4LK0 M;  1MVK A;  1GOZ A;  3ZJU A;  1NYR A;  1C76 A;  2TSS A;  4YTP B;  2QMT A;  1C4P A;  1TZO A;  2E6X A;  5LNK 1;  5C2T B;  1Y56 A;  1LO5 D;  2ICI A;  3P1M A;  1C78 A;  1I4X A;  2JQR B;  2MEK A;  2WU2 B;  3GP7 A;  4RFB A;  4GDK B;  2NTS A;  2WDV B;  1WSP A;  2ONQ A;  1FNW A;  3MP9 A;  3MFG A;  1SB3 C;  1TS3 A;  2MJD A;  4A55 A;  3BYY B;  1MI0 A;  2JWU A;  3T3N A;  1ESF A;  1RWS A;  1I4Q A;  3ABV B;  3BWU D;  5HG2 A;  4C7Z A;  4CQN A;  3VRB B;  3I9V 1;  2INP E;  4KGR A;  4JWS C;  1TJE A;  4AS1 A;  2K3U A;  4YWG G;  3E56 A;  2KMM A;  1HZ6 A;  4YSY B;  1KLU D;  2I38 A;  1P7E A;  2G1E A;  4YTM B;  1L5P A;  2RDG A;  2WXI A;  3Q8F A;  2RDH A;  2CJO A;  5HI1 A;  2Y5P A;  4ZRP A;  1DYQ A;  1VZ8 A;  1YN4 A;  2B76 B;  4JPS A;  1HZ5 A;  1TS4 A;  1WXQ A;  3NS1 A;  2WXF A;  3Q69 A;  4N6E B;  1D6E C;  3CWI A;  1JAL A;  2R61 A;  2XN9 C;  2Y5C A;  1FXI A;  2PIA A;  3FIL B;  4RGN A;  5AUK A;  4ITK A;  2SAK A;  1N5W A;  1NEK B;  1SEB D;  4MAC A;  3MC0 B;  2Z8L A;  1EWY C;  3ZGZ A;  5FKA C;  3R2T A;  4C7Y A;  4OW0 A;  2L83 A;  1P7F A;  1T3Q A;  2JYE A;  1AW7 A;  2W3R A;  2WNM A;  3Q8C A;  3UI3 A;  1IUE A;  1XEE A;  3BK1 A;  4RF0 A;  1SXT A;  1T5X D;  2PKO A;  3LXF A;  1PYW D;  2BB6 A;  1DOX A;  2WXQ A;  1L6U A;  2ZW1 A;  3GB1 A;  4GDL B;  1JWS D;  1XCT L;  4MT5 A;  3U4E G;  4DQO C;  3TEW A;  1UUP A;  4NAM A;  1FRR A;  1SF0 A;  3SEB A;  1FO4 A;  2L52 A;  1HA5 A;  2D5G A;  2ZW0 A;  2WXJ A;  5BMI A;  2WQY B;  1JCK B;  1GPX A;  3EUB 2;  1V1P A;  1SE3 A;  3DWM A;  2Q5W D;  5HHD G;  1BXT A;  1CZP A;  1L4Z B;  2LEK A;  1XXG A;  2JXT A;  1F2R I;  3J9C A;  3AEG B;  1KH0 A;  3ZQ4 A;  5H92 C;  3AB5 A;  5EE9 A;  5BMH A;  1K52 A;  2BS4 B;  1SJE D;  1XCQ L;  2LGI A;  1EWC A;  3AE5 B;  1L0Y B;  2X38 A;  2PW9 A;  1FIQ A;  1V1O A;  2AQ3 B;  3P4P B;  1L6V A;  2GB1 A;  4A9A A;  5AUI A;  3I57 A;  2AQ1 B;  3V05 A;  2GRI A;  4IKG A;  4ZOH C;  2DBY A;  1RYJ A;  1SBB B;  4JX1 C;  3ZJV A;  3B2G A;  1NVI D;  4EE2 A;  1IBX B;  3Q8E A;  1TKG A;  4ARI A;  1C4C A;  3SFE B;  1FEH A;  2M0A A;  4O1N A;  2BB5 A;  3BVG A;  1XLN A;  2K9X A;  1C9F A;  3AE1 B;  4TMA B;  5D3D A;  1ET6 A;  2FUG 1;  4ZYS A;  4KGS A;  1VRA B;  3AEC B;  4MH8 A;  1YNT E;  1FFV A;  3AEE B;  2LJI A;  4L23 A;  5BYS A;  1QT9 A;  3VR9 B;  3R2I A;  1I4G A;  3VR8 B;  3IT6 B;  1FNV A;  2RMM A;  1PFD A;  2JU6 X;  1PDX A;  2WXH A;  1HXY D;  1QIL A;  2PTL A;  4PT5 A;  3KWV A;  2W54 A;  1K53 A;  4C80 A;  1GB4 A;  1FCC C;  1PUT A;  3HVZ A;  4XWW A;  1E9M A;  5HFY A;  3ETR A;  2QJL A;  4P6V F;  2EEL A;  3BII D;  5BYR A;  3KLS X;  2LUM A;  3AE6 B;  1UGJ A;  1RM6 C;  2JX5 A;  4ZHO A;  4RH6 A;  3NVZ A;  2WXN A;  4XDD A;  1A70 A;  3MHZ A;  3MJ5 A;  1PGA A;  1TKY A;  1ZDX A;  4USA A;  1TY2 A;  4AQ7 A;  1QKZ A;  4B0M A;  1WRI A;  3P63 A;  2XNA C;  1YMH E;  1ZDV A;  2EKI A;  2MJ3 A;  5BYQ A;  3U2S C;  4YXD B;  2QSD A;  1FMA D;  1J7B A;  4OHJ A;  2PLP A;  1JWU D;  4TSS A;  2V3P A;  4NAW B;  1VLB A;  4N58 A;  2WP9 B;  3B9J A;  3TEY A;  3WCQ A;  1N62 A;  1FNU A;  5MPO A;  1YN3 A;  2N7J A;  4YSZ B;  1V97 A;  3BZD B;  3N9Y C;  3AE4 B;  1YQ4 B;  3TEZ A;  4RCO A;  3IXS A;  3VQI A;  2JSV X;  2IPK D;  2M19 A;  2LHD A;  5JXV A;  1VZ6 A;  3NRZ A;  3LYY A;  4WAF A;  2BTE A;  2LHE A;  1D5Z C;  2INN E;  1ZOY B;  2WXK A;  4OVZ A;  3AM9 A;  1HEZ E;  2FE8 A;  1XLO A;  1D4B A;  5G5G A;  1NEN B;  3GS2 A;  4WQM A;  2NTT A;  2WXR A;  1FM0 D;  3HUI A;  2QIE B;  2J4X A;  5G5H A;  3AEB B;  5C3J B;  4YSX B;  5GXG B;  2ACZ B;  2WDQ B;  1MHH E;  4KGT A;  1C79 A;  3KQ4 A;  1CK1 A;  4HKQ A;  1E0Z A;  3BVM A;  4IOI E;  3W5U B;  2OED A;  1YJJ A;  1EM7 A;  2K22 A;  3AE9 B;  1FRD A;  4GLS C;  2WXM A;  4XE0 A;  1ZP0 B;  1JML A;  2DYO A;  4LTU A;  1C77 A;  4RGO S;  5D3I B;  4JWU C;  1IBX A;  4YT0 B;  1KTK A;  1YJI A;  4ZRQ A;  3TEX A;  3VRA B;  3EA6 A;  1EU4 A;  4H2A A;  4B0E A;  2IGD A;  1MPE A;  2RPV A;  2W55 A;  1IGC A;  1FCL A;  1PGB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...