2PVOD

Crystal srtucture of the ternary complex between thioredoxin f, ferredoxin, and ferredoxin: thioredoxin reductase
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
96
structure length
96
Chain Sequence
ASYTVKLITPDGESSIECSDDTYILDAAEEAGLELPYSCRAGACSTCAGKITAGSVDQSDQSFLDDDQIEAGYVLTCVAYPTSDCTIETHKEEDLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural snapshots along the reaction pathway of ferredoxin-thioredoxin reductase.
pubmed doi rcsb
source organism Synechocystis sp.
molecule tags Electron transport
molecule keywords Ferredoxin-thioredoxin reductase, catalytic chain
total genus 19
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2007-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2pvoD00
1XLNA 4IDIA 2WU5B 2G1EA 3AN1A 2DBYA 1QOGA 1DOIA 5EE9A 3HVZA 1FFUA 1GAQB 1RYJA 3CWIA 4N58A 3NVWA 3ZYYX 2WDVB 3CIRB 2WDRB 1NI3A 2Y5CA 1E0ZA 1RM6C 1YQ3B 1XO3A 2PKOA 2M56B 4WWMA 1GPXA 3AE1B 1AYFA 2JX5A 1N5WA 4N59A 1V8CA 3AE6B 1SIJA 1XLOA 2BS2B 2K22A 3AEAB 3NVVA 5GXGB 1E10A 3B2FA 3VR9B 2H88B 4C7YA 2EKIA 5H92C 2AX5A 2JQRB 3AE2B 1L6UA 2LEKA 4US9A 5EE0A 3AE5B 3LB8C 2FBWB 2DWQA 4ZOHC 4JWSC 4YTNB 1L6VA 1SB3C 1FMAD 2W54A 3SFEB 1QT9A 2KMMA 2W55A 1OFFA 3NVZA 3VRBB 3AECB 1JALA 4P6VF 2WDQB 3SFDB 2PVGC 3HRDD 1VDVA 1PUTA 1YJIA 3AEGB 3AE7B 3NRZA 5G5HA 1L0VB 1WXQA 1I7HA 2BS3B 3NVYA 2E3TA 1KF6B 3WCQA 1JRPA 1N62A 1VJKA 1RFKA 2MJ3A 1QOFA 3DWGC 2WQYB 2CJOA 1CJEA 1ZP0B 3DWMA 2W3SA 1NYRA 3P4PB 3W9CB 1QF6A 4YXDB 1ROEA 2MJDA 1PFDA 2N0SB 3HUIA 4ITKA 1XLQA 1NENB 3AB5A 2CU3A 2M19A 3P1MA 1FRDA 1FXIA 1DOXA 1FFVA 1IUEA 1FRRA 1VLBA 1PDXA 3P4QB 3P4RB 1J7BA 1N5XA 1TJEA 1TKGA 4YSYB 3VRAB 1JWAD 1E7PB 1E9MA 2KAJA 2MH7A 4JX1C 4US8A 1NEKB 2BT6A 3ABVB 1CZPA 3AEFB 2WP9B 3FC4A 4A9AA 4ZHOA 1J7CA 1DOYA 1L5PA 1WWTA 3KWLA 3PO0A 1QOBA 4N6EB 2K5PA 3B9JA 4FXCA 3AE8B 3W5UB 1KRHA 1RWSA 1SF0A 1T3QA 1TKEA 1TYGB 1XLPA 1ZUD2 3SR6A 1TKYA 1JROA 2CJNA 2WS3B 1E6EB 1WGKA 2K9XA 2L83A 2Q5WD 3EUB2 3P63A 2L52A 3FAHA 5AUIA 1QLBB 2OHFA 1N61A 3VR8B 1JWBD 5MPOA 3P4SB 3AE9B 1JW9D 3L4PA 1AWDA 5AUKA 3RPFC 4C80A 1A70A 2PIAA 1EWYC 2HTME 1B9RA 1DGJA 3NS1A 1FM0D 4HROA 3W5VB 5H8YE 2WLBA 3AH7A 5G5GA 2WU2B 2B76B 3AMZA 4C7ZA 3AEDB 1WRIA 1J7AA 4YTMB 3LXFA 1YQ4B 1V97A 2QIEB 2MJEA 5C2TB 1FXAA 1WYGA 4YT0B 3AEBB 4HRSA 3AE3B 3ETRA 1ZOYB 2BS4B 3AEEB 1FIQA 4JWUC 1JQ4A 3AE4B 1N60A 3B2GA 2ACZB 1YJJA 1R7SA 4USAA 1ZXIA 4ZHPA 2W3RA 1NYQA 1NVID 4YSXB 1F0ZA 3AV8A 1OQRA 1N63A 3AM9A 2H89B 4LTUA 3BIID 4YTPB 5C3JB 5EE3A 4KX6B 2PVOD 1OQQA 1QOAA 5EE1A 1KFYB 4YSZB 1FO4A 4WQMA 2QJLA 1UWMA
chains in the Genus database with same CATH superfamily
1XLNA 2EMTA 3ZTCA 2G9HD 4AJWA 3IBEA 1TY0A 2D07B 1C4AA 3NUHB 2LGDA 1ACCA 2PKOA 1AYFA 3U30A 3RD2A 3WIMA 2BVCA 1E10A 1OEYA 2JQRB 4FJZA 4D2KA 1WGGA 1L0YB 4ZRQA 1L6VA 4REZA 1XCTL 2RDHA 5LNK1 3RZFA 3AECB 2WDQB 2C7HA 1XT9B 4ICUA 2V4IB 1WX9A 1D6EC 3NVYA 1J0GA 5G55A 3N3KB 3DBLI 1RFKA 2WQYB 2VZKB 1IP9A 1L2NA 2KKCA 4LLGM 5E6NA 2NBUA 2WXMA 1NI2A 4PS7A 2CHXA 1OQYA 1STEA 2CU3A 1YOVB 4HPMB 4L23A 3P4QB 1VLBA 3H7PA 3SDLC 3P4RB 3V6CB 5D94A 3ZW3A 2MH7A 1T0RC 3Q3MC 3ZVVA 4KKJA 5DPSA 3FC4A 4GLSC 1DYQA 2KMCA 2A5UA 4NZLB 1SF0A 1TYGB 2BKFA 1KJTA 4DHJB 5IKCM 2WS3B 2RD0A 3P63A 4EE2A 3FAHA 3KUCB 1IGDA 2PEAA 4HVBA 1V9JA 4GXBA 2D2QA 2WXLA 1LFDA 2WLBA 4M8MA 4L1BA 4C7ZA 3DBHB 5AZFA 3T3OA 4JE3B 5C3JB 3TL5A 1QOAA 3R2TA 2KTRB 1HA5A 4GDLB 1NBFC 1TS3A 4W9FA 2WDTB 2Y5CA 3LYYA 2JZZA 1F9JA 1AARA 1C79A 3EFCA 3VDZA 1N6ZA 2AX5A 1K50A 2AQ1B 2JPHA 4US9A 4B9KA 2JUOA 2W55A 2BGFA 2LWPA 3RNAC 3NJTA 1YJIA 2ZW1A 2KDEB 4NNJB 1I7HA 4RM8A 5KHOA 1CJEA 2DZJA 5JXVA 1G6JA 2YVCA 1GG3A 4W9GA 4DQOC 3NZ3A 4ANXA 2K1FA 3MHSD 3O13A 4HDQA 3IAS1 3H6NA 3ZXVA 5BYQA 1PGBA 3Q8AA 2KC2A 1E7PB 3O65B 2INDC 2M1MA 2RPVA 1D5XC 2BWES 2FE8A 3QHTA 3RMKC 4LJOB 3N30A 1MJDA 3TCAA 4CO7A 2DYBA 3UIOB 2JRHA 5CTRC 1RLFA 3VXWA 3TBLD 4NJ6A 4LNIA 3Q6BA 5LXHA 4OVUA 1YN4A 3AEEB 2BQQA 2KOXA 4A55A 2W3RA 1T0SC 2MBOA 4FULA 2J52A 2H89B 3BIID 1OQQA 2KN4A 2IO2B 2ZNVC 4KSLC 1WZ0A 3TSSA 2G1EA 3A4SC 2AL6A 2C9WB 1RYJA 2FCMA 5T8IA 2C7MB 2ZVOA 3APCA 3B0AA 1HZ5A 2N7DA 2GB1A 1XLOA 2K22A 4EZKA 3B2FA 1F52A 4E74A 4JWSC 2C7NB 1TIFA 4IW0A 3ZJTA 3BVMA 2W82A 5BMGA 4LJPB 3DDCB 5J18A 4E71A 1X1MA 1YNTE 1C3TA 2HDEA 3DQVA 5BO4B 1R4MB 3MC8A 2XNAC 2PLPA 3WAPA 2K8CA 4ANWA 4F1SA 1EU3A 4XC2A 2KDMA 3Q14C 3IVFA 1UNSA 4FXCA 4LNKA 3RFZB 2INCC 3KUDB 1TKYA 2WXNA 2KDBA 4NY0A 1E6EB 1E8ZA 4OZCA 1PYWD 1V2YA 4KIKA 3NG0A 4ANUA 3B08A 1J8CA 3C8YA 1K8RB 2HTME 2MSED 1B9RA 5H8YE 4HEA1 4AS1A 2ZCCA 3LXFA 3A9JB 2JVCA 3RNEC 3OJ3A 1WGDA 1C9FA 1ZOYB 3OG5A 3PT2B 1GJZA 1NVID 2K25A 3ZXRA 2V9HA 4IDIA 2KFKA 2FUHB 4TUUA 3M3JA 4OZAA 5EE9A 3H8HA 4XWTA 4GN1A 2XK5B 2L1AA 1V6EA 4GDKA 2RMMA 5G2NA 2UYZB 5L83A 1MPEA 4HJGE 2QEJC 2BS2B 3DHGC 2MBQA 4BVUC 3W1SA 5H92C 4MEMA 3AE5B 2KX0A 2G4SA 2D3AA 2PVGC 2ZCBA 2KO3A 4YWGG 1ZDVA 2RDGA 1GC6A 1UBQA 2MJ3A 2PPHA 2ONQA 3N1XC 4XYCA 2D11A 4JLCA 3ALBA 4ITKA 2G4DB 3DBSA 2LD9A 5CX3A 1IUEA 4W9CA 3JW0X 1J7BA 3ZLZA 3AEFB 2I2YA 1I4QA 1J7CA 4NPNA 2M4NA 2LI5A 4EFOA 1SGHA 2BYTA 5FK9C 3BINA 2DLBA 3JSVA 5FR6A 1SIFA 2FUG1 3UINB 1RWSA 4ZRJA 2XK5A 2NTTA 1WJ4A 3Q8CA 4I6PA 2Y3AA 1HQRD 4KGSA 4DK5A 1QILA 2K9XA 2Q5WD 2L52A 5E6JA 2IGGA 3RNFC 5MPOA 2DZKA 4MM3A 2LZ6A 3RZWC 3ZNID 4W9LA 3WA0A 4BZAA 2N9EB 2N1VA 1JRUA 2INNE 4DWFA 1E7VA 4WAAA 1P1AA 2KVZA 1KOTA 2J0KA 3APDA 1TY2A 4AP4C 3K9OB 3VH3B 2X38A 2ZNVB 1YN3A 3EFUA 5AZGA 3V61A 2MX2A 3NZSA 1FO4A 4B95A 2Z59B 1P98A 1P7FA 3U7ZA 4MGIE 3WAOA 2WU5B 2GOWA 3ZYYX 3WALA 1NI3A 1UF0A 5C1ZA 4G0NB 2LVPA 1GPXA 3I3TB 1AW7A 1BXTA 4EZLA 2PE6B 3VR9B 2H88B 2IY1B 2MA9B 2J7QB 5J2RA 1VZ6A 1KLVA 2AL3A 3QWZB 3IAM1 3IHPC 3K9PB 1MG8A 2BB6A 1QT9A 1UH6A 3L08A 1OEYJ 4FJVB 1VDVA 1GC7A 3AE7B 2G45B 3P2BA 1WXQA 1KF6B 1JRPA 3BK2A 1XD3B 2W3SA 3QJZA 2X8XX 1WYWB 1NENB 2ASQA 2GI9A 2KWDA 1DOXA 2IGDA 1CZPA 1SE9A 4TSSA 1C76A 3AULA 3L54A 5FR3A 3KW5B 3I5JC 1L5PA 4LNOA 4M02A 3B9JA 1T5XD 1SSNA 1KRHA 1WGYA 3A1QA 4ASWC 3UI3A 3MC9A 3QC8B 2LHDA 1WGKA 4PK1A 2KTFA 4A20A 1V1PA 1ZKHA 2ZW0A 3VUXA 1HTQA 4GOCA 3W5VB 3ZUNA 2CU1A 1YQ4B 1V97A 2QIEB 4RFBA 3KLSX 1LO5D 3AE4B 1YN5A 5D3IB 1NYQA 4FA6A 4BAXA 1OQRA 4KV2A 5EE3A 1P7EA 2LRUA 5EE1A 3VTUA 1WE6A 1UWMA 4WJQA 5BYSA 5LXIB 2KX3A 3AN1A 1QOGA 1DOIA 1C4PA 1I4XA 2ON8A 3H7SA 2FIFA 4IWPA 3CWIA 1YIWA 3DBLB 4GDKB 3BWUD 3DPDA 2MLBA 3AE1B 1N5WA 3Q3JA 4URKA 1MI0A 1I4GA 4ZYNA 1ENFA 4AJYB 2R61A 3W1YA 2MBHA 1QOFA 1TTNA 4H2AA 2MJDA 1PFDA 2K6DB 3HUIA 4K3BA 1UUPA 4B6WA 5D3DA 3ZDMC 1FRDA 1FXIA 2CKHB 1JWAD 2ZZPB 2BT6A 3SHQA 1HEZE 1DOYA 4OVVA 2J42A 5FKAC 1H4RA 3ZO5B 2LJ5A 2KMAA 1EU4A 4W9IA 2N7EA 1SJED 1JCKB 4FADA 5AUIA 3JYUA 3BYYB 4ARCA 4GMVA 2O6VB 2FIDA 1EWYC 2CS4A 3DHIC 2V0GA 3PZ8A 4EOYA 3ZIMA 4ICVA 3AE3B 2CHWA 3DHHC 4DHZE 4MACA 4HJKA 4GSWA 1V1PB 3ZNGC 3AV8A 2L8JA 1WH3A 1KFYB 3AEAB 2XBBC 3JVZX 1E8YA 2L76A 4G50A 4XWWA 2VH1A 5IAAC 3T3NA 3KH0A 4JIOU 4XGAB 3GZNB 1C1YB 5KHQA 3AI5A 2IZVB 3IFWB 4FHJA 4R3DA 4M8NA 1L6UA 4ZOHC 1SB3C 1FMAD 3DOWA 2VRRB 4WWPA 1Y8RC 4RGTA 4P6VF 1CMXB 2YLMA 2WNMA 3RNCC 3W2DA 3VVWB 2M8SA 2BYFA 1GB4A 3W9CB 1NDDA 1ZE3D 4HKQA 3E56A 1P3QU 1I4PA 1FNWA 1PDXA 3L17A 1TJEA 3DVGY 3ZQ4A 1FPYA 4JQWC 1V86A 1PGXA 2GRIA 4GB9A 1Q1OA 1WWTA 2WXOA 4XX5A 2ZVNA 5E6PA 4OHJA 1XEEA 3EUB2 2MW5A 2BYEA 3VR8B 4NQLB 1SXTA 2WXFA 2G3QB 4WWOA 1A70A 2PIAA 2LASA 1C77A 4CYEA 1MFWA 1MG4A 2BTEA 2K6QA 2KQSA 3A4RA 3PRZA 3TIXA 1C4CA 3PHXB 1V1OA 1N60A 1YJJA 4HPPA 1WE7A 1N63A 4ACFA 3U8ZA 4YSZB 2EELA 3ZTDA 2L0FA 2KFKB 4WAFA 1FNVA 2EKEC 3M63B 1I35A 2IPKD 3HVZA 3M95A 3VAWA 2NTSA 2WDVB 5HKHA 1RM6C 1E5WA 3GP7A 1XO3A 4BKTA 2BW2A 4QAYA 3NVVA 1I42A 2C5LC 3ML9A 1B1ZA 2RGFA 2FBWB 4RNAA 2WX1A 2Y5PA 1ZDXA 1F2RI 4LNNA 1R4NI 5CHWA 4CQNA 3VRBB 4AOFA 2WWZA 2KDFB 2WXJA 3S2AA 5CHVC 2K8BA 3DBRB 2LGXA 2KT7A 4YXDB 2LMCA 2LFIA 2KQ4X 2PMVA 3Q8BA 3P1MA 1D5MC 2NVUI 5LLIA 4II2B 1N5XA 3Q69A 2FCQA 1V5TA 5D6JB 2BWFA 2J53A 3KWLA 1TBEA 2WXKA 3KYDD 3GE8C 4I6LB 1XLPA 2HJ8A 4AUQC 4OVZA 3GB1A 1UBIA 3D32A 1KLGD 2QMTA 5E6OA 1YMHE 3DCGA 2FNJB 3APFA 5IOIA 2B76B 2DAFA 5JZEB 2QHOA 2DYOA 2ZEQA 4M0WB 4BFRA 4B0EA 1E8WA 3ZRFA 2CR5A 2R2QA 3ML8A 2QCZA 3I57A 1WJNA 2GBRA 2FCNA 2KZRA 4WQMA 1WGHA 4BKSA 2KNBA 5BYRA 3PVLA 2LXCA 1XXGA 1YX5B 3BZDB 3MFGA 1S3SG 3HHMA 2D3GA 3TMPB 4EZJA 2YEPF 1FCLA 3EA6A 5C23A 1T6BX 4G11A 1JWUD 1UWXA 3L13A 1D3ZA 1PUTA 1KLUD 3NZUA 2E3TA 2MRPA 3BY4B 4NAWA 1QZEA 2JZPA 1ZP0B 3Q8FA 4FHKA 4ANVA 2WHIA 4XZ4A 5AZHA 1ROEA 1RAXA 2IO3B 2N0SB 2FCSA 4PT5A 4NAWB 4EEWA 2IO0B 4IWOA 1WY8A 2KVRA 4Q2JA 3PLVA 1S1QB 2D10A 4DDID 1V5OA 4LK0M 2O6VD 2WP9B 1GB1A 2DYMA 5HI1A 4A8XC 4W9JA 2KJHB 3OLMD 3VH4B 2LUEA 2OOBB 3N1YC 3NHEB 2R2OA 4F7ZA 1BMLC 3RN9C 4ZDVA 1WX8A 4W9KA 3VUWA 1GUAB 2TSSA 1TGZB 4C80A 1IBXB 2KK8A 2MHJA 2W9NA 3AH7A 3PREA 5G5GA 3PZ7A 4FLHA 2JRIB 1K53A 1FXAA 3OJ4B 1EF5A 1Q10A 2XEWA 2L0TA 5D2MB 2LGIA 2LHEA 4DXFA 1FD6A 1VZ8A 2QJLA 1JWSD 2KLGA 1RFAA 1IBXA 4F8CB 1GAQB 1WXAA 2KXJA 3EGRA 1ZW7A 2NMQA 2V3NA 2N9XA 4N9F4 2WYQA 2N1WA 2J0MA 2M56B 4NJ7A 2RR9A 5GXGB 1WJUA 2Z0DB 4C7YA 4RGOS 2LEKA 1WXVA 3LB8C 1TS4A 3PTFC 2V3PA 3RNGC 4DXAB 4K81A 2QILA 5IA7A 3HK0A 1HXYD 4PYUA 2MCNB 5HHDG 2HE7A 2WXQA 2D3BA 3VTVA 1EWCA 4IG7B 4K7SA 2KYWA 3NVWA 4MT5A 2LVQA 3ENEA 1HZ6A 3I63C 3FKYA 2GLSA 3L10B 3DBRI 3L16A 1WM2A 3ZNZB 4M00A 3U52E 5DPTA 1FRRA 4BKSD 1L4DB 2C60A 3VRAB 1E9MA 4C56C 2DX5B 2J0JA 2AQ2B 2ZJDA 4A9AA 1R4NB 4O1NA 2BPSA 1ZUD2 3MC0B 2IDYA 1WFYA 1KM7A 3A9KB 4NQKE 2JU6X 2OHFA 3T9LA 3RCZA 3UF8A 4FJYA 1U4AA 3AE9B 2LXAA 3DVGX 2ICIA 4DXGA 4GGQA 2DZIA 2NBVB 3A33B 5IN7A 4FBJB 1J7AA 2QSDA 2Y5BB 2MJEA 5C2TB 4HRSA 4HLEA 1LM8B 1CQVA 2PW9A 1ZXIA 4AQ7A 4YSXB 4MSMB 4YTPB 3AM9A 4LTUA 4HXDA 4M01A 2BB5A 2PVOD 3C0RB 2JXTA 4TMAB 2BYVE 1OGWA 1QKZA 3ZGZA 4J6IA 4YL8A 3CIRB 2K3UA 1E0ZA 3U4EG 3QARA 3U2SC 3SD5A 2B3AA 3NY5A 1F2RC 1ISNA 3R7RA 2JT4B 1PQSA 3AU4A 3H7PB 2L05A 3VUYA 3KYCD 1WX7A 3BK1A 1Q5WB 1XF5L 4DBGA 2GBNA 3GS2A 3VQIA 4BOSC 3GOEA 1SE4A 1VJKA 3P42A 3DWMA 2N9LA 3ZJVA 2I1JA 4TQ0A 1JWMD 3AB5A 4KGRA 1UZXB 2KWUB 3Q3FA 1LXDA 4XE0A 2GBKA 1WRDB 2KWCA 1Y56A 2MEKA 3R7QA 1WMHA 3V62A 2KAJA 1Z2MA 4US8A 2L3ZA 1PGAA 3IXSA 4TQ1A 3ZJUA 3VTWA 1YX6B 3BVZA 3R66C 4WH4A 3PLUA 2MP2A 4MDKE 1M4VA 2NCNA 3SR6A 4HDOA 1LQBA 2GMIC 2KFJA 4MSQB 3QX1A 1A5RA 4I6NB 1JWBD 1L0XB 2LGSA 1H8CA 3Q3NC 2K8HA 1WZ3A 3NS1A 1FM0D 3HIZA 4MH0E 3AMZA 3R3MA 4WJOA 3MJ5A 4FN2A 2V3SA 2UWQA 5J17A 3H9DA 1VZ7A 4RGNA 2PJHA 4ZRKA 2QDFA 1KH0A 3GE3C 3DVNV 4MJSA 3FILB 1D5ZC 1SBBB 3NOBA 4MELA 1XQQA 2HJ1A 1IYFA 4JPSA 2AWTA 4HCPB 2KACA 2WXGA 4KVGB 4WWMA 3EC8A 4PS8A 2JX5A 2JY6A 1VRAB 1BT0A 4DHJD 2N9PC 2A4ZA 2I1KA 3MP9A 4PS3A 4YTNB 2JYTA 3RUIB 1P9DU 3NVZA 1JALA 4OW0A 4LCDE 3V6EB 4XDDA 1VCBA 2N7JA 3NRZA 5G5HA 4LDTD 3V05A 3ZNHB 2JZ3B 1NYRA 2IO1B 5JHAA 2EMSA 4K3CA 4MJSB 1V49A 2VZKD 3M62B 5GMVA 2KANA 4JL9A 1OTRB 1GOZA 1ZXHA 4YSYB 4JX1C 3ABVB 1TZOA 2K0PA 2NPTB 3URYA 3BYTB 2QC8A 1WI0A 2K5PA 4PYZA 3UQAA 3W5UB 1T3QA 1TKEA 1SEBD 2IJ0A 1TZ1A 2O6VA 1T0QC 3J9CA 2CHZA 2KJ6A 3P4SB 3N20C 2E6XA 4LDTB 3E9SA 3TEWA 4OZBA 1JMLA 2JXXA 2M17A 1WR6E 1BUIC 4HROA 4IM3A 4HWIB 3DVNU 1WRIA 2RDBC 5JH5C 4P7IA 1YJ1A 3AU5A 3AEBB 4P1BC 1ESFA 2WXRA 2BS4B 1JQ4A 4USAA 4KIKB 2WXPA 3QK0A 1F0ZA 4RH6A 3PHWB 4HCNB 1L7YA 3IT6B 2I38A 4EUTA 4RF1A 4IKGA 2D5GA 4N58A 1EM7A 3A9JA 2MBBB 4WWNA 5HFYA 4WJPA 3AE6B 3MJWA 3ZRCA 2KTRA 2MBEA 3QA8A 5CHFA 3QIJA 5EE0A 2DHZA 1WSPA 2DWQA 3IG3A 3T8MA 2W54A 2OEDA 2AEHA 2MWSB 1FNUA 3H1UA 1V80A 4GIVA 3KVFB 2DAJA 4IOIE 3C19A 2MP2B 2GBMA 4KKIA 2JYEA 2Z8LA 2KDIA 1XLQA 3PV1A 4TKNA 2INPE 2WXHA 3MHZA 3CSFA 3MTNB 1WIAA 1GNUA 4IUMB 3N9YC 3PO0A 4MGZE 3QCAA 4IC7B 1MHHE 3V60A 4A90A 3N32A 4NAMA 2N4FA 1FXTB 2L32A 3A9KA 3RULA 4HKZE 2JSVX 4UDUC 1FCCC 5BMIA 3L4PA 1TS5A 4GDLA 3R2IA 3PRPB 4KDIC 2HTHA 2O2VA 1UGJA 1EO6A 1WR1A 1M94A 2RPQA 3L0WB 1R7SA 2LJIA 4RCOA 3U7DA 2NR2A 2NBWB 5I4DA 1WYGA 1YD8U 3X23A 4J3OD 5AEKB 3R8BA 2DBYA 2JWZA 2LUMA 3Q8EA 3AXCA 4RMAA 1FFUA 3RI7C 3TEYA 5JHBA 4KZ0A 2LGYA 5TR5A 3N1ZC 1WGRA 2VH2A 5EDSA 3OWEB 3AE2B 2D3CA 2NS5A 3V3XA 2V1YA 2IYDB 2IBIB 2N9KA 3SFEB 2KMMA 1OFFA 4KGTA 4II3B 3SFDB 2JWUA 4GU2A 2IY0B 1L0VB 2BS3B 3WCQA 3SEBA 2MQJA 1WJ6A 2PTLA 1I4RA 4ZRIA 2V4LA 3P4PB 1QQRA 4BKGA 1T0YA 1L4ZB 2KJRA 3UGBB 2M19A 2M0XA 3EHVA 4IWQA 2IGHA 4S0RA 1NEKB 5D7GA 2AYOB 4ZHOA 1UGMA 3LJ3A 1HTOA 5IP4D 4ZRPA 4B0MA 1E90A 3KUZA 1RRBA 3KWVA 1WMHB 1IPGA 1QLBB 3VFKA 3QQ8B 4NJCA 2REXA 1JW9D 4P16A 1AWDA 5DCNA 2UU7A 3JSVB 2WU2B 1Z5SB 3AEDB 4IM0A 3PSEB 1FEHA 2HD5B 1FIQA 4JWUC 4TV3A 4W9EA 3PZDA 4ZHPA 3I9V1 5BMHA 2WGSA 4HPLB 4L2YA 2WX0A 4HK2A 1R4MI 2OJRA 3HVDA 3CF6E 3TJPA 3ZKJC 3EECA 1YQ3B 3LDZE 4KDLB 4N59A 3PS6A 4BBNC 2ZPNA 4M0WA 4C00A 4MGKE 2LVOA 5HG2A 1WF9A 1VD2A 1IGCA 1D4BA 1XCQL 1F77A 1ZGUB 3IT4B 3HRDD 1AN8A 2SAKA 4WQOB 4DHZB 2L00B 3UQBA 2OJWA 2Z0EB 4WJNA 3TUOA 1ZPSA 2PE9A 2SEBD 4LNFA 1QF6A 1Q0WB 3OAWA 4IM2A 2KN5A 3W1SC 2BF8B 2BBCA 3RYTA 1FFVA 2DENB 1ET6A 2XN9C 1SE2A 4EKUA 3WANA 4KZCA 4P1CC 3ECIA 1F1HA 4MGYE 3PRMB 4RGMA 4N6EB 3CSTA 2LRWA 4MM3B 1TT5B 2CJNA 4RM9A 4K1RB 1I4HA 3GZNI 1VR9A 3UIPB 1KTKA 2NPTA 5AUKA 3RPFC 3Q3OC 3CMMB 3Q2AC 1HE8A 3ZDTA 4S17A 4YTMB 4MH8A 2AQ3B 4BOZB 1UD7A 3BVGA 1ET9A 3KQ4A 3NS8A 4DDGD 3RT3B 3ONSA 3B2GA 2ACZB 2KLCA 4W9DA 3PGEA 3VHTC 4KX6B 4E3CA 4WURA 3TEXA 1EUVB 2KWVB 1K52A 2FAZA 2BKRB 2WDRB 4K7UA 4A6QA 1K51A 1V8CA 1P0RA 1SIJA 2DNFA 2EKIA 2M0AA 4KSKC 1CK1A 2KQ7A 4ZYSA 5TSSA 1WXMA 1EF1A 2K39A 3HM3A 1V81A 2J4XA 2KD0A 4WIPA 2O2VB 4A3PA 2JF5A 4CHKA 3AEGB 1E8XA 5DPRA 2L7RA 1N62A 1TS2A 1YQBA 3DWGC 2CJOA 3FILA 3HM6X 4C4VA 2RSUA 3B1LX 5DPWA 2DZMA 1TKGA 3X0WA 4C4VB 3SU8X 3WAMA 1SE3A 2KC1A 1SJHD 3RNBC 2WXIA 1UELA 5IO9A 1MHXA 1QOBA 4W9HA 3AE8B 1J19A 4XDCA 1WM3A 4RF0A 3TEZA 1JROA 4K7WA 4X57B 3PPAA 2L83A 1E7UA 4BBNF 1N61A 2KHWB 1LGRA 1MVKA 1WXSA 4JGHB 4G3XB 1DGJA 4AWJA 2YEPB 2GBJA 3QAQA 4YT0B 1C78A 3ETRA 2ZPYA 3A1QB 5L95C 4ARIA 4A3OA 3DBHI
chains in the Genus database with same CATH topology
4IKGA 1XLNA 2WU5B 2G9HD 5BYRA 2D5GA 1TY0A 1XXGA 3BZDB 4N58A 3ZYYX 3MFGA 1NI3A 1C4AA 3NUHB 1EM7A 1ACCA 2PKOA 5HFYA 1GPXA 1AW7A 1AYFA 3AE6B 1BXTA 2YEPF 1E10A 3VR9B 1FCLA 2H88B 3EA6A 1T6BX 2JQRB 1VZ6A 4D2KA 1JWUD 1UWXA 5EE0A 1L0YB 1WSPA 2DWQA 4ZRQA 1L6VA 3IAM1 2W54A 4REZA 2BB6A 1QT9A 1XCTL 2RDHA 5LNK1 2OEDA 3AECB 2WDQB 1FNUA 2V4IB 1VDVA 1PUTA 1KLUD 3AE7B 1D6EC 1WXQA 3NVYA 2E3TA 1KF6B 1JRPA 3BK2A 1RFKA 2WQYB 2JZPA 2VZKB 1ZP0B 3Q8FA 4IOIE 4LLGM 2W3SA 2WXMA 1ROEA 4KKIA 2JYEA 2N0SB 2Z8LA 4PT5A 1XLQA 1NENB 4NAWB 1STEA 2CU3A 2GI9A 2KWDA 1DOXA 4L23A 4Q2JA 3P4QB 1VLBA 2INPE 3P4RB 2WXHA 2IGDA 3MHZA 2MH7A 4LK0M 1CZPA 4TSSA 4KKJA 1C76A 2WP9B 1GB1A 2DYMA 3FC4A 5HI1A 5FR3A 4GLSC 1L5PA 4A8XC 3N9YC 3PO0A 1DYQA 3B9JA 1MHHE 1T5XD 1SSNA 1KRHA 1SF0A 1TYGB 4NZLB 3UI3A 4A90A 2WS3B 2LHDA 1WGKA 3P63A 4NAMA 4EE2A 3FAHA 1BMLC 1IGDA 1V1PA 2L32A 2ZW0A 4HKZE 2JSVX 4UDUC 1FCCC 5BMIA 2TSSA 3L4PA 1TS5A 4C80A 1IBXB 2WXLA 3W5VB 3R2IA 2WLBA 3AH7A 4L1BA 5G5GA 4C7ZA 3PZ7A 1YQ4B 1V97A 2QIEB 1K53A 4RFBA 3KLSX 1FXAA 1LO5D 1UGJA 1Q10A 3AE4B 1YN5A 1R7SA 2LGIA 5D3IB 2LJIA 1NYQA 3T3OA 2LHEA 1OQRA 4JE3B 4RCOA 5C3JB 5EE3A 4DXFA 1P7EA 5EE1A 1QOAA 3R2TA 1FD6A 1VZ8A 5I4DA 2QJLA 1UWMA 1WYGA 1JWSD 1HA5A 4GDLB 4J3OD 5BYSA 3AN1A 3R8BA 1IBXA 2DBYA 1QOGA 1DOIA 1C4PA 1I4XA 1TS3A 2LUMA 1FFUA 1GAQB 2ON8A 3CWIA 3EGRA 3TEYA 2V3NA 2NMQA 2Y5CA 4GDKB 3Q8EA 3BWUD 2M56B 3LYYA 3AE1B 1N5WA 5GXGB 1C79A 3OWEB 4C7YA 2AX5A 1K50A 2AQ1B 3AE2B 4RGOS 2LEKA 4US9A 3V3XA 3LB8C 1TS4A 2N9KA 3SFEB 1MI0A 2KMMA 2W55A 1OFFA 4KGTA 1I4GA 2V3PA 3SFDB 2QILA 1HXYD 1ENFA 2JWUA 1YJIA 2R61A 5HHDG 2WXQA 2ZW1A 1L0VB 1I7HA 2BS3B 1EWCA 3WCQA 3SEBA 3NVWA 2PTLA 1I4RA 1QOFA 1CJEA 5JXVA 4MT5A 4H2AA 3P4PB 1QQRA 2MJDA 1PFDA 3HUIA 1HZ6A 3NZ3A 4DQOC 1UUPA 3O13A 1L4ZB 3IAS1 2M19A 5D3DA 1FRDA 1FXIA 3U52E 1FRRA 5BYQA 1PGBA 1L4DB 3Q8AA 3VRAB 2IGHA 1JWAD 1E7PB 1E9MA 1NEKB 2BT6A 5D7GA 4C56C 2RPVA 2AQ2B 1HEZE 4A9AA 4ZHOA 1D5XC 1DOYA 2FE8A 4O1NA 2J42A 5FKAC 4ZRPA 4B0MA 1EU4A 1ZUD2 3KWVA 3MC0B 2IDYA 1SJED 1JCKB 5AUIA 1QLBB 2JU6X 2OHFA 3BYYB 4NJCA 3AE9B 4ARCA 1JW9D 4P16A 1AWDA 1EWYC 2ICIA 4DXGA 2WU2B 3AEDB 2V0GA 1J7AA 2QSDA 3PZ8A 1FEHA 1YN4A 2MJEA 5C2TB 4HRSA 3AE3B 1CQVA 2PW9A 3AEEB 1FIQA 4JWUC 4MACA 4A55A 4ZHPA 1ZXIA 1V1PB 2W3RA 4YSXB 4AQ7A 2J52A 3AV8A 3I9V1 3AM9A 2H89B 4LTUA 3BIID 4YTPB 5BMHA 2BB5A 1OQQA 2KN4A 2PVOD 1KFYB 2JXTA 4TMAB 3AEAB 3TSSA 4L2YA 2G1EA 1QKZA 3ZGZA 4XWWA 1RYJA 3HVDA 3T3NA 3CIRB 5T8IA 2K3UA 1E0ZA 3U4EG 1YQ3B 3U2SC 1HZ5A 2GB1A 4N59A 1XLOA 2K22A 1F2RC 4M0WA 3B2FA 4R3DA 1L6UA 4ZOHC 4JWSC 1SB3C 1FMAD 5HG2A 3BK1A 1XF5L 1IGCA 3VQIA 3GS2A 4RGTA 4P6VF 1XCQL 1D4BA 1F77A 3IT4B 3ZJTA 3HRDD 3BVMA 2W82A 5BMGA 2WNMA 1AN8A 2SAKA 3W2DA 1SE4A 1VJKA 3P42A 3TUOA 1ZPSA 3DWMA 2N9LA 1GB4A 3W9CB 2SEBD 1QF6A 3ZJVA 1ZE3D 4TQ0A 1JWMD 4HKQA 1YNTE 3E56A 3AB5A 2HDEA 1I4PA 2BBCA 4KGRA 4XE0A 1FFVA 1FNWA 2MEKA 1ET6A 1PDXA 1Y56A 1TJEA 2XN9C 2XNAC 2PLPA 1SE2A 2KAJA 3ZQ4A 4US8A 3IXSA 1PGAA 4TQ1A 1EU3A 2GRIA 1PGXA 3ZJUA 1WWTA 2WXOA 2KDMA 3BVZA 4RGMA 1UNSA 4N6EB 4WH4A 4FXCA 1M4VA 3RFZB 3SR6A 1TKYA 4MM3B 4OHJA 2WXNA 2CJNA 1E6EB 1XEEA 4OZCA 3EUB2 1PYWD 1I4HA 3VR8B 1JWBD 1VR9A 1SXTA 1L0XB 2WXFA 1KTKA 5AUKA 3RPFC 1A70A 2PIAA 3C8YA 1C77A 2HTME 1B9RA 3NS1A 1FM0D 5H8YE 4HEA1 4AS1A 3AMZA 2BTEA 4YTMB 4MH8A 2AQ3B 3LXFA 3MJ5A 3BVGA 1ET9A 3KQ4A 1C9FA 4RGNA 1VZ7A 1ZOYB 1C4CA 1V1OA 1N60A 3B2GA 2ACZB 1KH0A 1YJJA 1NVID 1N63A 3FILB 4KX6B 4YSZB 1D5ZC 1SBBB 2EELA 4WAFA 4IDIA 1FNVA 4WURA 4OZAA 2IPKD 5EE9A 4JPSA 3TEXA 3HVZA 3H8HA 4XWTA 1K52A 2NTSA 2WDVB 2WDRB 2L1AA 2KACA 2WXGA 1RM6C 2RMMA 3GP7A 1XO3A 4WWMA 1MPEA 4A6QA 2BW2A 2JX5A 1K51A 2QEJC 1V8CA 4HJGE 1SIJA 1VRAB 2BS2B 3NVVA 3MP9A 3W1SA 2EKIA 5H92C 2M0AA 1CK1A 1B1ZA 3AE5B 2FBWB 4ZYSA 5TSSA 2Y5PA 4RNAA 4YTNB 1ZDXA 1F2RI 2JYTA 2J4XA 4CQNA 3NVZA 3VRBB 1JALA 4OW0A 2WXJA 2PVGC 4WIPA 4XDDA 1ZDVA 4YWGG 2RDGA 3AEGB 2N7JA 3NRZA 5G5HA 3V05A 1N62A 1TS2A 2MJ3A 3DWGC 2CJOA 3FILA 1NYRA 2ONQA 4YXDB 2LMCA 2LFIA 2KQ4X 4ITKA 2PMVA 3Q8BA 2VZKD 3P1MA 1D5MC 1IUEA 1J7BA 1GOZA 1N5XA 1ZXHA 1TKGA 4YSYB 4JX1C 3Q69A 3ABVB 3AEFB 2I2YA 1I4QA 1TZOA 1J7CA 1SE3A 2K0PA 2J53A 1SJHD 2WXIA 3KWLA 3BYTB 3URYA 2WXKA 1MHXA 5FK9C 2BYTA 1QOBA 2DLBA 2K5PA 2FUG1 3AE8B 3W5UB 1RWSA 1T3QA 1XLPA 4XDCA 1TKEA 2NTTA 1SEBD 2IJ0A 3Q8CA 4RF0A 1JROA 3TEZA 2Y3AA 1HQRD 4KGSA 1QILA 2K9XA 2L83A 2Q5WD 2L52A 5E6JA 2IGGA 3J9CA 4OVZA 3GB1A 1N61A 1MVKA 5MPOA 3P4SB 2E6XA 1KLGD 2QMTA 3E9SA 3TEWA 4OZBA 1YMHE 1JMLA 1DGJA 1BUIC 4HROA 2B76B 2YEPB 1WRIA 2INNE 2DYOA 4YT0B 3AEBB 1C78A 1ESFA 4B0EA 2WXRA 3ETRA 2BS4B 1TY2A 2X38A 1JQ4A 4USAA 1YN3A 2WXPA 1F0ZA 4RH6A 3I57A 3IT6B 1FO4A 2I38A 4ARIA 4WQMA 1P7FA 3U7ZA 4RF1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XLN A;  4IDI A;  2WU5 B;  2G1E A;  3AN1 A;  2DBY A;  1QOG A;  1DOI A;  5EE9 A;  3HVZ A;  1FFU A;  1GAQ B;  1RYJ A;  3CWI A;  4N58 A;  3NVW A;  3ZYY X;  2WDV B;  3CIR B;  2WDR B;  1NI3 A;  2Y5C A;  1E0Z A;  1RM6 C;  1YQ3 B;  1XO3 A;  2PKO A;  2M56 B;  4WWM A;  1GPX A;  3AE1 B;  1AYF A;  2JX5 A;  1N5W A;  4N59 A;  1V8C A;  3AE6 B;  1SIJ A;  1XLO A;  2BS2 B;  2K22 A;  3AEA B;  3NVV A;  5GXG B;  1E10 A;  3B2F A;  3VR9 B;  2H88 B;  4C7Y A;  2EKI A;  5H92 C;  2AX5 A;  2JQR B;  3AE2 B;  1L6U A;  2LEK A;  4US9 A;  5EE0 A;  3AE5 B;  3LB8 C;  2FBW B;  2DWQ A;  4ZOH C;  4JWS C;  4YTN B;  1L6V A;  1SB3 C;  1FMA D;  2W54 A;  3SFE B;  1QT9 A;  2KMM A;  2W55 A;  1OFF A;  3NVZ A;  3VRB B;  3AEC B;  1JAL A;  4P6V F;  2WDQ B;  3SFD B;  2PVG C;  3HRD D;  1VDV A;  1PUT A;  1YJI A;  3AEG B;  3AE7 B;  3NRZ A;  5G5H A;  1L0V B;  1WXQ A;  1I7H A;  2BS3 B;  3NVY A;  2E3T A;  1KF6 B;  3WCQ A;  1JRP A;  1N62 A;  1VJK A;  1RFK A;  2MJ3 A;  1QOF A;  3DWG C;  2WQY B;  2CJO A;  1CJE A;  1ZP0 B;  3DWM A;  2W3S A;  1NYR A;  3P4P B;  3W9C B;  1QF6 A;  4YXD B;  1ROE A;  2MJD A;  1PFD A;  2N0S B;  3HUI A;  4ITK A;  1XLQ A;  1NEN B;  3AB5 A;  2CU3 A;  2M19 A;  3P1M A;  1FRD A;  1FXI A;  1DOX A;  1FFV A;  1IUE A;  1FRR A;  1VLB A;  1PDX A;  3P4Q B;  3P4R B;  1J7B A;  1N5X A;  1TJE A;  1TKG A;  4YSY B;  3VRA B;  1JWA D;  1E7P B;  1E9M A;  2KAJ A;  2MH7 A;  4JX1 C;  4US8 A;  1NEK B;  2BT6 A;  3ABV B;  1CZP A;  3AEF B;  2WP9 B;  3FC4 A;  4A9A A;  4ZHO A;  1J7C A;  1DOY A;  1L5P A;  1WWT A;  3KWL A;  3PO0 A;  1QOB A;  4N6E B;  2K5P A;  3B9J A;  4FXC A;  3AE8 B;  3W5U B;  1KRH A;  1RWS A;  1SF0 A;  1T3Q A;  1TKE A;  1TYG B;  1XLP A;  1ZUD 2;  3SR6 A;  1TKY A;  1JRO A;  2CJN A;  2WS3 B;  1E6E B;  1WGK A;  2K9X A;  2L83 A;  2Q5W D;  3EUB 2;  3P63 A;  2L52 A;  3FAH A;  5AUI A;  1QLB B;  2OHF A;  1N61 A;  3VR8 B;  1JWB D;  5MPO A;  3P4S B;  3AE9 B;  1JW9 D;  3L4P A;  1AWD A;  5AUK A;  3RPF C;  4C80 A;  1A70 A;  2PIA A;  1EWY C;  2HTM E;  1B9R A;  1DGJ A;  3NS1 A;  1FM0 D;  4HRO A;  3W5V B;  5H8Y E;  2WLB A;  3AH7 A;  5G5G A;  2WU2 B;  2B76 B;  3AMZ A;  4C7Z A;  3AED B;  1WRI A;  1J7A A;  4YTM B;  3LXF A;  1YQ4 B;  1V97 A;  2QIE B;  2MJE A;  5C2T B;  1FXA A;  1WYG A;  4YT0 B;  3AEB B;  4HRS A;  3AE3 B;  3ETR A;  1ZOY B;  2BS4 B;  3AEE B;  1FIQ A;  4JWU C;  1JQ4 A;  3AE4 B;  1N60 A;  3B2G A;  2ACZ B;  1YJJ A;  1R7S A;  4USA A;  1ZXI A;  4ZHP A;  2W3R A;  1NYQ A;  1NVI D;  4YSX B;  1F0Z A;  3AV8 A;  1OQR A;  1N63 A;  3AM9 A;  2H89 B;  4LTU A;  3BII D;  4YTP B;  5C3J B;  5EE3 A;  4KX6 B;  2PVO D;  1OQQ A;  1QOA A;  5EE1 A;  1KFY B;  4YSZ B;  1FO4 A;  4WQM A;  2QJL A;  1UWM A; 
#chains in the Genus database with same CATH topology
 1XLN A;  2EMT A;  3ZTC A;  2G9H D;  4AJW A;  3IBE A;  1TY0 A;  2D07 B;  1C4A A;  3NUH B;  2LGD A;  1ACC A;  2PKO A;  1AYF A;  3U30 A;  3RD2 A;  3WIM A;  2BVC A;  1E10 A;  1OEY A;  2JQR B;  4FJZ A;  4D2K A;  1WGG A;  1L0Y B;  4ZRQ A;  1L6V A;  4REZ A;  1XCT L;  2RDH A;  5LNK 1;  3RZF A;  3AEC B;  2WDQ B;  2C7H A;  1XT9 B;  4ICU A;  2V4I B;  1WX9 A;  1D6E C;  3NVY A;  1J0G A;  5G55 A;  3N3K B;  3DBL I;  1RFK A;  2WQY B;  2VZK B;  1IP9 A;  1L2N A;  2KKC A;  4LLG M;  5E6N A;  2NBU A;  2WXM A;  1NI2 A;  4PS7 A;  2CHX A;  1OQY A;  1STE A;  2CU3 A;  1YOV B;  4HPM B;  4L23 A;  3P4Q B;  1VLB A;  3H7P A;  3SDL C;  3P4R B;  3V6C B;  5D94 A;  3ZW3 A;  2MH7 A;  1T0R C;  3Q3M C;  3ZVV A;  4KKJ A;  5DPS A;  3FC4 A;  4GLS C;  1DYQ A;  2KMC A;  2A5U A;  4NZL B;  1SF0 A;  1TYG B;  2BKF A;  1KJT A;  4DHJ B;  5IKC M;  2WS3 B;  2RD0 A;  3P63 A;  4EE2 A;  3FAH A;  3KUC B;  1IGD A;  2PEA A;  4HVB A;  1V9J A;  4GXB A;  2D2Q A;  2WXL A;  1LFD A;  2WLB A;  4M8M A;  4L1B A;  4C7Z A;  3DBH B;  5AZF A;  3T3O A;  4JE3 B;  5C3J B;  3TL5 A;  1QOA A;  3R2T A;  2KTR B;  1HA5 A;  4GDL B;  1NBF C;  1TS3 A;  4W9F A;  2WDT B;  2Y5C A;  3LYY A;  2JZZ A;  1F9J A;  1AAR A;  1C79 A;  3EFC A;  3VDZ A;  1N6Z A;  2AX5 A;  1K50 A;  2AQ1 B;  2JPH A;  4US9 A;  4B9K A;  2JUO A;  2W55 A;  2BGF A;  2LWP A;  3RNA C;  3NJT A;  1YJI A;  2ZW1 A;  2KDE B;  4NNJ B;  1I7H A;  4RM8 A;  5KHO A;  1CJE A;  2DZJ A;  5JXV A;  1G6J A;  2YVC A;  1GG3 A;  4W9G A;  4DQO C;  3NZ3 A;  4ANX A;  2K1F A;  3MHS D;  3O13 A;  4HDQ A;  3IAS 1;  3H6N A;  3ZXV A;  5BYQ A;  1PGB A;  3Q8A A;  2KC2 A;  1E7P B;  3O65 B;  2IND C;  2M1M A;  2RPV A;  1D5X C;  2BWE S;  2FE8 A;  3QHT A;  3RMK C;  4LJO B;  3N30 A;  1MJD A;  3TCA A;  4CO7 A;  2DYB A;  3UIO B;  2JRH A;  5CTR C;  1RLF A;  3VXW A;  3TBL D;  4NJ6 A;  4LNI A;  3Q6B A;  5LXH A;  4OVU A;  1YN4 A;  3AEE B;  2BQQ A;  2KOX A;  4A55 A;  2W3R A;  1T0S C;  2MBO A;  4FUL A;  2J52 A;  2H89 B;  3BII D;  1OQQ A;  2KN4 A;  2IO2 B;  2ZNV C;  4KSL C;  1WZ0 A;  3TSS A;  2G1E A;  3A4S C;  2AL6 A;  2C9W B;  1RYJ A;  2FCM A;  5T8I A;  2C7M B;  2ZVO A;  3APC A;  3B0A A;  1HZ5 A;  2N7D A;  2GB1 A;  1XLO A;  2K22 A;  4EZK A;  3B2F A;  1F52 A;  4E74 A;  4JWS C;  2C7N B;  1TIF A;  4IW0 A;  3ZJT A;  3BVM A;  2W82 A;  5BMG A;  4LJP B;  3DDC B;  5J18 A;  4E71 A;  1X1M A;  1YNT E;  1C3T A;  2HDE A;  3DQV A;  5BO4 B;  1R4M B;  3MC8 A;  2XNA C;  2PLP A;  3WAP A;  2K8C A;  4ANW A;  4F1S A;  1EU3 A;  4XC2 A;  2KDM A;  3Q14 C;  3IVF A;  1UNS A;  4FXC A;  4LNK A;  3RFZ B;  2INC C;  3KUD B;  1TKY A;  2WXN A;  2KDB A;  4NY0 A;  1E6E B;  1E8Z A;  4OZC A;  1PYW D;  1V2Y A;  4KIK A;  3NG0 A;  4ANU A;  3B08 A;  1J8C A;  3C8Y A;  1K8R B;  2HTM E;  2MSE D;  1B9R A;  5H8Y E;  4HEA 1;  4AS1 A;  2ZCC A;  3LXF A;  3A9J B;  2JVC A;  3RNE C;  3OJ3 A;  1WGD A;  1C9F A;  1ZOY B;  3OG5 A;  3PT2 B;  1GJZ A;  1NVI D;  2K25 A;  3ZXR A;  2V9H A;  4IDI A;  2KFK A;  2FUH B;  4TUU A;  3M3J A;  4OZA A;  5EE9 A;  3H8H A;  4XWT A;  4GN1 A;  2XK5 B;  2L1A A;  1V6E A;  4GDK A;  2RMM A;  5G2N A;  2UYZ B;  5L83 A;  1MPE A;  4HJG E;  2QEJ C;  2BS2 B;  3DHG C;  2MBQ A;  4BVU C;  3W1S A;  5H92 C;  4MEM A;  3AE5 B;  2KX0 A;  2G4S A;  2D3A A;  2PVG C;  2ZCB A;  2KO3 A;  4YWG G;  1ZDV A;  2RDG A;  1GC6 A;  1UBQ A;  2MJ3 A;  2PPH A;  2ONQ A;  3N1X C;  4XYC A;  2D11 A;  4JLC A;  3ALB A;  4ITK A;  2G4D B;  3DBS A;  2LD9 A;  5CX3 A;  1IUE A;  4W9C A;  3JW0 X;  1J7B A;  3ZLZ A;  3AEF B;  2I2Y A;  1I4Q A;  1J7C A;  4NPN A;  2M4N A;  2LI5 A;  4EFO A;  1SGH A;  2BYT A;  5FK9 C;  3BIN A;  2DLB A;  3JSV A;  5FR6 A;  1SIF A;  2FUG 1;  3UIN B;  1RWS A;  4ZRJ A;  2XK5 A;  2NTT A;  1WJ4 A;  3Q8C A;  4I6P A;  2Y3A A;  1HQR D;  4KGS A;  4DK5 A;  1QIL A;  2K9X A;  2Q5W D;  2L52 A;  5E6J A;  2IGG A;  3RNF C;  5MPO A;  2DZK A;  4MM3 A;  2LZ6 A;  3RZW C;  3ZNI D;  4W9L A;  3WA0 A;  4BZA A;  2N9E B;  2N1V A;  1JRU A;  2INN E;  4DWF A;  1E7V A;  4WAA A;  1P1A A;  2KVZ A;  1KOT A;  2J0K A;  3APD A;  1TY2 A;  4AP4 C;  3K9O B;  3VH3 B;  2X38 A;  2ZNV B;  1YN3 A;  3EFU A;  5AZG A;  3V61 A;  2MX2 A;  3NZS A;  1FO4 A;  4B95 A;  2Z59 B;  1P98 A;  1P7F A;  3U7Z A;  4MGI E;  3WAO A;  2WU5 B;  2GOW A;  3ZYY X;  3WAL A;  1NI3 A;  1UF0 A;  5C1Z A;  4G0N B;  2LVP A;  1GPX A;  3I3T B;  1AW7 A;  1BXT A;  4EZL A;  2PE6 B;  3VR9 B;  2H88 B;  2IY1 B;  2MA9 B;  2J7Q B;  5J2R A;  1VZ6 A;  1KLV A;  2AL3 A;  3QWZ B;  3IAM 1;  3IHP C;  3K9P B;  1MG8 A;  2BB6 A;  1QT9 A;  1UH6 A;  3L08 A;  1OEY J;  4FJV B;  1VDV A;  1GC7 A;  3AE7 B;  2G45 B;  3P2B A;  1WXQ A;  1KF6 B;  1JRP A;  3BK2 A;  1XD3 B;  2W3S A;  3QJZ A;  2X8X X;  1WYW B;  1NEN B;  2ASQ A;  2GI9 A;  2KWD A;  1DOX A;  2IGD A;  1CZP A;  1SE9 A;  4TSS A;  1C76 A;  3AUL A;  3L54 A;  5FR3 A;  3KW5 B;  3I5J C;  1L5P A;  4LNO A;  4M02 A;  3B9J A;  1T5X D;  1SSN A;  1KRH A;  1WGY A;  3A1Q A;  4ASW C;  3UI3 A;  3MC9 A;  3QC8 B;  2LHD A;  1WGK A;  4PK1 A;  2KTF A;  4A20 A;  1V1P A;  1ZKH A;  2ZW0 A;  3VUX A;  1HTQ A;  4GOC A;  3W5V B;  3ZUN A;  2CU1 A;  1YQ4 B;  1V97 A;  2QIE B;  4RFB A;  3KLS X;  1LO5 D;  3AE4 B;  1YN5 A;  5D3I B;  1NYQ A;  4FA6 A;  4BAX A;  1OQR A;  4KV2 A;  5EE3 A;  1P7E A;  2LRU A;  5EE1 A;  3VTU A;  1WE6 A;  1UWM A;  4WJQ A;  5BYS A;  5LXI B;  2KX3 A;  3AN1 A;  1QOG A;  1DOI A;  1C4P A;  1I4X A;  2ON8 A;  3H7S A;  2FIF A;  4IWP A;  3CWI A;  1YIW A;  3DBL B;  4GDK B;  3BWU D;  3DPD A;  2MLB A;  3AE1 B;  1N5W A;  3Q3J A;  4URK A;  1MI0 A;  1I4G A;  4ZYN A;  1ENF A;  4AJY B;  2R61 A;  3W1Y A;  2MBH A;  1QOF A;  1TTN A;  4H2A A;  2MJD A;  1PFD A;  2K6D B;  3HUI A;  4K3B A;  1UUP A;  4B6W A;  5D3D A;  3ZDM C;  1FRD A;  1FXI A;  2CKH B;  1JWA D;  2ZZP B;  2BT6 A;  3SHQ A;  1HEZ E;  1DOY A;  4OVV A;  2J42 A;  5FKA C;  1H4R A;  3ZO5 B;  2LJ5 A;  2KMA A;  1EU4 A;  4W9I A;  2N7E A;  1SJE D;  1JCK B;  4FAD A;  5AUI A;  3JYU A;  3BYY B;  4ARC A;  4GMV A;  2O6V B;  2FID A;  1EWY C;  2CS4 A;  3DHI C;  2V0G A;  3PZ8 A;  4EOY A;  3ZIM A;  4ICV A;  3AE3 B;  2CHW A;  3DHH C;  4DHZ E;  4MAC A;  4HJK A;  4GSW A;  1V1P B;  3ZNG C;  3AV8 A;  2L8J A;  1WH3 A;  1KFY B;  3AEA B;  2XBB C;  3JVZ X;  1E8Y A;  2L76 A;  4G50 A;  4XWW A;  2VH1 A;  5IAA C;  3T3N A;  3KH0 A;  4JIO U;  4XGA B;  3GZN B;  1C1Y B;  5KHQ A;  3AI5 A;  2IZV B;  3IFW B;  4FHJ A;  4R3D A;  4M8N A;  1L6U A;  4ZOH C;  1SB3 C;  1FMA D;  3DOW A;  2VRR B;  4WWP A;  1Y8R C;  4RGT A;  4P6V F;  1CMX B;  2YLM A;  2WNM A;  3RNC C;  3W2D A;  3VVW B;  2M8S A;  2BYF A;  1GB4 A;  3W9C B;  1NDD A;  1ZE3 D;  4HKQ A;  3E56 A;  1P3Q U;  1I4P A;  1FNW A;  1PDX A;  3L17 A;  1TJE A;  3DVG Y;  3ZQ4 A;  1FPY A;  4JQW C;  1V86 A;  1PGX A;  2GRI A;  4GB9 A;  1Q1O A;  1WWT A;  2WXO A;  4XX5 A;  2ZVN A;  5E6P A;  4OHJ A;  1XEE A;  3EUB 2;  2MW5 A;  2BYE A;  3VR8 B;  4NQL B;  1SXT A;  2WXF A;  2G3Q B;  4WWO A;  1A70 A;  2PIA A;  2LAS A;  1C77 A;  4CYE A;  1MFW A;  1MG4 A;  2BTE A;  2K6Q A;  2KQS A;  3A4R A;  3PRZ A;  3TIX A;  1C4C A;  3PHX B;  1V1O A;  1N60 A;  1YJJ A;  4HPP A;  1WE7 A;  1N63 A;  4ACF A;  3U8Z A;  4YSZ B;  2EEL A;  3ZTD A;  2L0F A;  2KFK B;  4WAF A;  1FNV A;  2EKE C;  3M63 B;  1I35 A;  2IPK D;  3HVZ A;  3M95 A;  3VAW A;  2NTS A;  2WDV B;  5HKH A;  1RM6 C;  1E5W A;  3GP7 A;  1XO3 A;  4BKT A;  2BW2 A;  4QAY A;  3NVV A;  1I42 A;  2C5L C;  3ML9 A;  1B1Z A;  2RGF A;  2FBW B;  4RNA A;  2WX1 A;  2Y5P A;  1ZDX A;  1F2R I;  4LNN A;  1R4N I;  5CHW A;  4CQN A;  3VRB B;  4AOF A;  2WWZ A;  2KDF B;  2WXJ A;  3S2A A;  5CHV C;  2K8B A;  3DBR B;  2LGX A;  2KT7 A;  4YXD B;  2LMC A;  2LFI A;  2KQ4 X;  2PMV A;  3Q8B A;  3P1M A;  1D5M C;  2NVU I;  5LLI A;  4II2 B;  1N5X A;  3Q69 A;  2FCQ A;  1V5T A;  5D6J B;  2BWF A;  2J53 A;  3KWL A;  1TBE A;  2WXK A;  3KYD D;  3GE8 C;  4I6L B;  1XLP A;  2HJ8 A;  4AUQ C;  4OVZ A;  3GB1 A;  1UBI A;  3D32 A;  1KLG D;  2QMT A;  5E6O A;  1YMH E;  3DCG A;  2FNJ B;  3APF A;  5IOI A;  2B76 B;  2DAF A;  5JZE B;  2QHO A;  2DYO A;  2ZEQ A;  4M0W B;  4BFR A;  4B0E A;  1E8W A;  3ZRF A;  2CR5 A;  2R2Q A;  3ML8 A;  2QCZ A;  3I57 A;  1WJN A;  2GBR A;  2FCN A;  2KZR A;  4WQM A;  1WGH A;  4BKS A;  2KNB A;  5BYR A;  3PVL A;  2LXC A;  1XXG A;  1YX5 B;  3BZD B;  3MFG A;  1S3S G;  3HHM A;  2D3G A;  3TMP B;  4EZJ A;  2YEP F;  1FCL A;  3EA6 A;  5C23 A;  1T6B X;  4G11 A;  1JWU D;  1UWX A;  3L13 A;  1D3Z A;  1PUT A;  1KLU D;  3NZU A;  2E3T A;  2MRP A;  3BY4 B;  4NAW A;  1QZE A;  2JZP A;  1ZP0 B;  3Q8F A;  4FHK A;  4ANV A;  2WHI A;  4XZ4 A;  5AZH A;  1ROE A;  1RAX A;  2IO3 B;  2N0S B;  2FCS A;  4PT5 A;  4NAW B;  4EEW A;  2IO0 B;  4IWO A;  1WY8 A;  2KVR A;  4Q2J A;  3PLV A;  1S1Q B;  2D10 A;  4DDI D;  1V5O A;  4LK0 M;  2O6V D;  2WP9 B;  1GB1 A;  2DYM A;  5HI1 A;  4A8X C;  4W9J A;  2KJH B;  3OLM D;  3VH4 B;  2LUE A;  2OOB B;  3N1Y C;  3NHE B;  2R2O A;  4F7Z A;  1BML C;  3RN9 C;  4ZDV A;  1WX8 A;  4W9K A;  3VUW A;  1GUA B;  2TSS A;  1TGZ B;  4C80 A;  1IBX B;  2KK8 A;  2MHJ A;  2W9N A;  3AH7 A;  3PRE A;  5G5G A;  3PZ7 A;  4FLH A;  2JRI B;  1K53 A;  1FXA A;  3OJ4 B;  1EF5 A;  1Q10 A;  2XEW A;  2L0T A;  5D2M B;  2LGI A;  2LHE A;  4DXF A;  1FD6 A;  1VZ8 A;  2QJL A;  1JWS D;  2KLG A;  1RFA A;  1IBX A;  4F8C B;  1GAQ B;  1WXA A;  2KXJ A;  3EGR A;  1ZW7 A;  2NMQ A;  2V3N A;  2N9X A;  4N9F 4;  2WYQ A;  2N1W A;  2J0M A;  2M56 B;  4NJ7 A;  2RR9 A;  5GXG B;  1WJU A;  2Z0D B;  4C7Y A;  4RGO S;  2LEK A;  1WXV A;  3LB8 C;  1TS4 A;  3PTF C;  2V3P A;  3RNG C;  4DXA B;  4K81 A;  2QIL A;  5IA7 A;  3HK0 A;  1HXY D;  4PYU A;  2MCN B;  5HHD G;  2HE7 A;  2WXQ A;  2D3B A;  3VTV A;  1EWC A;  4IG7 B;  4K7S A;  2KYW A;  3NVW A;  4MT5 A;  2LVQ A;  3ENE A;  1HZ6 A;  3I63 C;  3FKY A;  2GLS A;  3L10 B;  3DBR I;  3L16 A;  1WM2 A;  3ZNZ B;  4M00 A;  3U52 E;  5DPT A;  1FRR A;  4BKS D;  1L4D B;  2C60 A;  3VRA B;  1E9M A;  4C56 C;  2DX5 B;  2J0J A;  2AQ2 B;  2ZJD A;  4A9A A;  1R4N B;  4O1N A;  2BPS A;  1ZUD 2;  3MC0 B;  2IDY A;  1WFY A;  1KM7 A;  3A9K B;  4NQK E;  2JU6 X;  2OHF A;  3T9L A;  3RCZ A;  3UF8 A;  4FJY A;  1U4A A;  3AE9 B;  2LXA A;  3DVG X;  2ICI A;  4DXG A;  4GGQ A;  2DZI A;  2NBV B;  3A33 B;  5IN7 A;  4FBJ B;  1J7A A;  2QSD A;  2Y5B B;  2MJE A;  5C2T B;  4HRS A;  4HLE A;  1LM8 B;  1CQV A;  2PW9 A;  1ZXI A;  4AQ7 A;  4YSX B;  4MSM B;  4YTP B;  3AM9 A;  4LTU A;  4HXD A;  4M01 A;  2BB5 A;  2PVO D;  3C0R B;  2JXT A;  4TMA B;  2BYV E;  1OGW A;  1QKZ A;  3ZGZ A;  4J6I A;  4YL8 A;  3CIR B;  2K3U A;  1E0Z A;  3U4E G;  3QAR A;  3U2S C;  3SD5 A;  2B3A A;  3NY5 A;  1F2R C;  1ISN A;  3R7R A;  2JT4 B;  1PQS A;  3AU4 A;  3H7P B;  2L05 A;  3VUY A;  3KYC D;  1WX7 A;  3BK1 A;  1Q5W B;  1XF5 L;  4DBG A;  2GBN A;  3GS2 A;  3VQI A;  4BOS C;  3GOE A;  1SE4 A;  1VJK A;  3P42 A;  3DWM A;  2N9L A;  3ZJV A;  2I1J A;  4TQ0 A;  1JWM D;  3AB5 A;  4KGR A;  1UZX B;  2KWU B;  3Q3F A;  1LXD A;  4XE0 A;  2GBK A;  1WRD B;  2KWC A;  1Y56 A;  2MEK A;  3R7Q A;  1WMH A;  3V62 A;  2KAJ A;  1Z2M A;  4US8 A;  2L3Z A;  1PGA A;  3IXS A;  4TQ1 A;  3ZJU A;  3VTW A;  1YX6 B;  3BVZ A;  3R66 C;  4WH4 A;  3PLU A;  2MP2 A;  4MDK E;  1M4V A;  2NCN A;  3SR6 A;  4HDO A;  1LQB A;  2GMI C;  2KFJ A;  4MSQ B;  3QX1 A;  1A5R A;  4I6N B;  1JWB D;  1L0X B;  2LGS A;  1H8C A;  3Q3N C;  2K8H A;  1WZ3 A;  3NS1 A;  1FM0 D;  3HIZ A;  4MH0 E;  3AMZ A;  3R3M A;  4WJO A;  3MJ5 A;  4FN2 A;  2V3S A;  2UWQ A;  5J17 A;  3H9D A;  1VZ7 A;  4RGN A;  2PJH A;  4ZRK A;  2QDF A;  1KH0 A;  3GE3 C;  3DVN V;  4MJS A;  3FIL B;  1D5Z C;  1SBB B;  3NOB A;  4MEL A;  1XQQ A;  2HJ1 A;  1IYF A;  4JPS A;  2AWT A;  4HCP B;  2KAC A;  2WXG A;  4KVG B;  4WWM A;  3EC8 A;  4PS8 A;  2JX5 A;  2JY6 A;  1VRA B;  1BT0 A;  4DHJ D;  2N9P C;  2A4Z A;  2I1K A;  3MP9 A;  4PS3 A;  4YTN B;  2JYT A;  3RUI B;  1P9D U;  3NVZ A;  1JAL A;  4OW0 A;  4LCD E;  3V6E B;  4XDD A;  1VCB A;  2N7J A;  3NRZ A;  5G5H A;  4LDT D;  3V05 A;  3ZNH B;  2JZ3 B;  1NYR A;  2IO1 B;  5JHA A;  2EMS A;  4K3C A;  4MJS B;  1V49 A;  2VZK D;  3M62 B;  5GMV A;  2KAN A;  4JL9 A;  1OTR B;  1GOZ A;  1ZXH A;  4YSY B;  4JX1 C;  3ABV B;  1TZO A;  2K0P A;  2NPT B;  3URY A;  3BYT B;  2QC8 A;  1WI0 A;  2K5P A;  4PYZ A;  3UQA A;  3W5U B;  1T3Q A;  1TKE A;  1SEB D;  2IJ0 A;  1TZ1 A;  2O6V A;  1T0Q C;  3J9C A;  2CHZ A;  2KJ6 A;  3P4S B;  3N20 C;  2E6X A;  4LDT B;  3E9S A;  3TEW A;  4OZB A;  1JML A;  2JXX A;  2M17 A;  1WR6 E;  1BUI C;  4HRO A;  4IM3 A;  4HWI B;  3DVN U;  1WRI A;  2RDB C;  5JH5 C;  4P7I A;  1YJ1 A;  3AU5 A;  3AEB B;  4P1B C;  1ESF A;  2WXR A;  2BS4 B;  1JQ4 A;  4USA A;  4KIK B;  2WXP A;  3QK0 A;  1F0Z A;  4RH6 A;  3PHW B;  4HCN B;  1L7Y A;  3IT6 B;  2I38 A;  4EUT A;  4RF1 A;  4IKG A;  2D5G A;  4N58 A;  1EM7 A;  3A9J A;  2MBB B;  4WWN A;  5HFY A;  4WJP A;  3AE6 B;  3MJW A;  3ZRC A;  2KTR A;  2MBE A;  3QA8 A;  5CHF A;  3QIJ A;  5EE0 A;  2DHZ A;  1WSP A;  2DWQ A;  3IG3 A;  3T8M A;  2W54 A;  2OED A;  2AEH A;  2MWS B;  1FNU A;  3H1U A;  1V80 A;  4GIV A;  3KVF B;  2DAJ A;  4IOI E;  3C19 A;  2MP2 B;  2GBM A;  4KKI A;  2JYE A;  2Z8L A;  2KDI A;  1XLQ A;  3PV1 A;  4TKN A;  2INP E;  2WXH A;  3MHZ A;  3CSF A;  3MTN B;  1WIA A;  1GNU A;  4IUM B;  3N9Y C;  3PO0 A;  4MGZ E;  3QCA A;  4IC7 B;  1MHH E;  3V60 A;  4A90 A;  3N32 A;  4NAM A;  2N4F A;  1FXT B;  2L32 A;  3A9K A;  3RUL A;  4HKZ E;  2JSV X;  4UDU C;  1FCC C;  5BMI A;  3L4P A;  1TS5 A;  4GDL A;  3R2I A;  3PRP B;  4KDI C;  2HTH A;  2O2V A;  1UGJ A;  1EO6 A;  1WR1 A;  1M94 A;  2RPQ A;  3L0W B;  1R7S A;  2LJI A;  4RCO A;  3U7D A;  2NR2 A;  2NBW B;  5I4D A;  1WYG A;  1YD8 U;  3X23 A;  4J3O D;  5AEK B;  3R8B A;  2DBY A;  2JWZ A;  2LUM A;  3Q8E A;  3AXC A;  4RMA A;  1FFU A;  3RI7 C;  3TEY A;  5JHB A;  4KZ0 A;  2LGY A;  5TR5 A;  3N1Z C;  1WGR A;  2VH2 A;  5EDS A;  3OWE B;  3AE2 B;  2D3C A;  2NS5 A;  3V3X A;  2V1Y A;  2IYD B;  2IBI B;  2N9K A;  3SFE B;  2KMM A;  1OFF A;  4KGT A;  4II3 B;  3SFD B;  2JWU A;  4GU2 A;  2IY0 B;  1L0V B;  2BS3 B;  3WCQ A;  3SEB A;  2MQJ A;  1WJ6 A;  2PTL A;  1I4R A;  4ZRI A;  2V4L A;  3P4P B;  1QQR A;  4BKG A;  1T0Y A;  1L4Z B;  2KJR A;  3UGB B;  2M19 A;  2M0X A;  3EHV A;  4IWQ A;  2IGH A;  4S0R A;  1NEK B;  5D7G A;  2AYO B;  4ZHO A;  1UGM A;  3LJ3 A;  1HTO A;  5IP4 D;  4ZRP A;  4B0M A;  1E90 A;  3KUZ A;  1RRB A;  3KWV A;  1WMH B;  1IPG A;  1QLB B;  3VFK A;  3QQ8 B;  4NJC A;  2REX A;  1JW9 D;  4P16 A;  1AWD A;  5DCN A;  2UU7 A;  3JSV B;  2WU2 B;  1Z5S B;  3AED B;  4IM0 A;  3PSE B;  1FEH A;  2HD5 B;  1FIQ A;  4JWU C;  4TV3 A;  4W9E A;  3PZD A;  4ZHP A;  3I9V 1;  5BMH A;  2WGS A;  4HPL B;  4L2Y A;  2WX0 A;  4HK2 A;  1R4M I;  2OJR A;  3HVD A;  3CF6 E;  3TJP A;  3ZKJ C;  3EEC A;  1YQ3 B;  3LDZ E;  4KDL B;  4N59 A;  3PS6 A;  4BBN C;  2ZPN A;  4M0W A;  4C00 A;  4MGK E;  2LVO A;  5HG2 A;  1WF9 A;  1VD2 A;  1IGC A;  1D4B A;  1XCQ L;  1F77 A;  1ZGU B;  3IT4 B;  3HRD D;  1AN8 A;  2SAK A;  4WQO B;  4DHZ B;  2L00 B;  3UQB A;  2OJW A;  2Z0E B;  4WJN A;  3TUO A;  1ZPS A;  2PE9 A;  2SEB D;  4LNF A;  1QF6 A;  1Q0W B;  3OAW A;  4IM2 A;  2KN5 A;  3W1S C;  2BF8 B;  2BBC A;  3RYT A;  1FFV A;  2DEN B;  1ET6 A;  2XN9 C;  1SE2 A;  4EKU A;  3WAN A;  4KZC A;  4P1C C;  3ECI A;  1F1H A;  4MGY E;  3PRM B;  4RGM A;  4N6E B;  3CST A;  2LRW A;  4MM3 B;  1TT5 B;  2CJN A;  4RM9 A;  4K1R B;  1I4H A;  3GZN I;  1VR9 A;  3UIP B;  1KTK A;  2NPT A;  5AUK A;  3RPF C;  3Q3O C;  3CMM B;  3Q2A C;  1HE8 A;  3ZDT A;  4S17 A;  4YTM B;  4MH8 A;  2AQ3 B;  4BOZ B;  1UD7 A;  3BVG A;  1ET9 A;  3KQ4 A;  3NS8 A;  4DDG D;  3RT3 B;  3ONS A;  3B2G A;  2ACZ B;  2KLC A;  4W9D A;  3PGE A;  3VHT C;  4KX6 B;  4E3C A;  4WUR A;  3TEX A;  1EUV B;  2KWV B;  1K52 A;  2FAZ A;  2BKR B;  2WDR B;  4K7U A;  4A6Q A;  1K51 A;  1V8C A;  1P0R A;  1SIJ A;  2DNF A;  2EKI A;  2M0A A;  4KSK C;  1CK1 A;  2KQ7 A;  4ZYS A;  5TSS A;  1WXM A;  1EF1 A;  2K39 A;  3HM3 A;  1V81 A;  2J4X A;  2KD0 A;  4WIP A;  2O2V B;  4A3P A;  2JF5 A;  4CHK A;  3AEG B;  1E8X A;  5DPR A;  2L7R A;  1N62 A;  1TS2 A;  1YQB A;  3DWG C;  2CJO A;  3FIL A;  3HM6 X;  4C4V A;  2RSU A;  3B1L X;  5DPW A;  2DZM A;  1TKG A;  3X0W A;  4C4V B;  3SU8 X;  3WAM A;  1SE3 A;  2KC1 A;  1SJH D;  3RNB C;  2WXI A;  1UEL A;  5IO9 A;  1MHX A;  1QOB A;  4W9H A;  3AE8 B;  1J19 A;  4XDC A;  1WM3 A;  4RF0 A;  3TEZ A;  1JRO A;  4K7W A;  4X57 B;  3PPA A;  2L83 A;  1E7U A;  4BBN F;  1N61 A;  2KHW B;  1LGR A;  1MVK A;  1WXS A;  4JGH B;  4G3X B;  1DGJ A;  4AWJ A;  2YEP B;  2GBJ A;  3QAQ A;  4YT0 B;  1C78 A;  3ETR A;  2ZPY A;  3A1Q B;  5L95 C;  4ARI A;  4A3O A;  3DBH I; 
#chains in the Genus database with same CATH homology
 4IKG A;  1XLN A;  2WU5 B;  2G9H D;  5BYR A;  2D5G A;  1TY0 A;  1XXG A;  3BZD B;  4N58 A;  3ZYY X;  3MFG A;  1NI3 A;  1C4A A;  3NUH B;  1EM7 A;  1ACC A;  2PKO A;  5HFY A;  1GPX A;  1AW7 A;  1AYF A;  3AE6 B;  1BXT A;  2YEP F;  1E10 A;  3VR9 B;  1FCL A;  2H88 B;  3EA6 A;  1T6B X;  2JQR B;  1VZ6 A;  4D2K A;  1JWU D;  1UWX A;  5EE0 A;  1L0Y B;  1WSP A;  2DWQ A;  4ZRQ A;  1L6V A;  3IAM 1;  2W54 A;  4REZ A;  2BB6 A;  1QT9 A;  1XCT L;  2RDH A;  5LNK 1;  2OED A;  3AEC B;  2WDQ B;  1FNU A;  2V4I B;  1VDV A;  1PUT A;  1KLU D;  3AE7 B;  1D6E C;  1WXQ A;  3NVY A;  2E3T A;  1KF6 B;  1JRP A;  3BK2 A;  1RFK A;  2WQY B;  2JZP A;  2VZK B;  1ZP0 B;  3Q8F A;  4IOI E;  4LLG M;  2W3S A;  2WXM A;  1ROE A;  4KKI A;  2JYE A;  2N0S B;  2Z8L A;  4PT5 A;  1XLQ A;  1NEN B;  4NAW B;  1STE A;  2CU3 A;  2GI9 A;  2KWD A;  1DOX A;  4L23 A;  4Q2J A;  3P4Q B;  1VLB A;  2INP E;  3P4R B;  2WXH A;  2IGD A;  3MHZ A;  2MH7 A;  4LK0 M;  1CZP A;  4TSS A;  4KKJ A;  1C76 A;  2WP9 B;  1GB1 A;  2DYM A;  3FC4 A;  5HI1 A;  5FR3 A;  4GLS C;  1L5P A;  4A8X C;  3N9Y C;  3PO0 A;  1DYQ A;  3B9J A;  1MHH E;  1T5X D;  1SSN A;  1KRH A;  1SF0 A;  1TYG B;  4NZL B;  3UI3 A;  4A90 A;  2WS3 B;  2LHD A;  1WGK A;  3P63 A;  4NAM A;  4EE2 A;  3FAH A;  1BML C;  1IGD A;  1V1P A;  2L32 A;  2ZW0 A;  4HKZ E;  2JSV X;  4UDU C;  1FCC C;  5BMI A;  2TSS A;  3L4P A;  1TS5 A;  4C80 A;  1IBX B;  2WXL A;  3W5V B;  3R2I A;  2WLB A;  3AH7 A;  4L1B A;  5G5G A;  4C7Z A;  3PZ7 A;  1YQ4 B;  1V97 A;  2QIE B;  1K53 A;  4RFB A;  3KLS X;  1FXA A;  1LO5 D;  1UGJ A;  1Q10 A;  3AE4 B;  1YN5 A;  1R7S A;  2LGI A;  5D3I B;  2LJI A;  1NYQ A;  3T3O A;  2LHE A;  1OQR A;  4JE3 B;  4RCO A;  5C3J B;  5EE3 A;  4DXF A;  1P7E A;  5EE1 A;  1QOA A;  3R2T A;  1FD6 A;  1VZ8 A;  5I4D A;  2QJL A;  1UWM A;  1WYG A;  1JWS D;  1HA5 A;  4GDL B;  4J3O D;  5BYS A;  3AN1 A;  3R8B A;  1IBX A;  2DBY A;  1QOG A;  1DOI A;  1C4P A;  1I4X A;  1TS3 A;  2LUM A;  1FFU A;  1GAQ B;  2ON8 A;  3CWI A;  3EGR A;  3TEY A;  2V3N A;  2NMQ A;  2Y5C A;  4GDK B;  3Q8E A;  3BWU D;  2M56 B;  3LYY A;  3AE1 B;  1N5W A;  5GXG B;  1C79 A;  3OWE B;  4C7Y A;  2AX5 A;  1K50 A;  2AQ1 B;  3AE2 B;  4RGO S;  2LEK A;  4US9 A;  3V3X A;  3LB8 C;  1TS4 A;  2N9K A;  3SFE B;  1MI0 A;  2KMM A;  2W55 A;  1OFF A;  4KGT A;  1I4G A;  2V3P A;  3SFD B;  2QIL A;  1HXY D;  1ENF A;  2JWU A;  1YJI A;  2R61 A;  5HHD G;  2WXQ A;  2ZW1 A;  1L0V B;  1I7H A;  2BS3 B;  1EWC A;  3WCQ A;  3SEB A;  3NVW A;  2PTL A;  1I4R A;  1QOF A;  1CJE A;  5JXV A;  4MT5 A;  4H2A A;  3P4P B;  1QQR A;  2MJD A;  1PFD A;  3HUI A;  1HZ6 A;  3NZ3 A;  4DQO C;  1UUP A;  3O13 A;  1L4Z B;  3IAS 1;  2M19 A;  5D3D A;  1FRD A;  1FXI A;  3U52 E;  1FRR A;  5BYQ A;  1PGB A;  1L4D B;  3Q8A A;  3VRA B;  2IGH A;  1JWA D;  1E7P B;  1E9M A;  1NEK B;  2BT6 A;  5D7G A;  4C56 C;  2RPV A;  2AQ2 B;  1HEZ E;  4A9A A;  4ZHO A;  1D5X C;  1DOY A;  2FE8 A;  4O1N A;  2J42 A;  5FKA C;  4ZRP A;  4B0M A;  1EU4 A;  1ZUD 2;  3KWV A;  3MC0 B;  2IDY A;  1SJE D;  1JCK B;  5AUI A;  1QLB B;  2JU6 X;  2OHF A;  3BYY B;  4NJC A;  3AE9 B;  4ARC A;  1JW9 D;  4P16 A;  1AWD A;  1EWY C;  2ICI A;  4DXG A;  2WU2 B;  3AED B;  2V0G A;  1J7A A;  2QSD A;  3PZ8 A;  1FEH A;  1YN4 A;  2MJE A;  5C2T B;  4HRS A;  3AE3 B;  1CQV A;  2PW9 A;  3AEE B;  1FIQ A;  4JWU C;  4MAC A;  4A55 A;  4ZHP A;  1ZXI A;  1V1P B;  2W3R A;  4YSX B;  4AQ7 A;  2J52 A;  3AV8 A;  3I9V 1;  3AM9 A;  2H89 B;  4LTU A;  3BII D;  4YTP B;  5BMH A;  2BB5 A;  1OQQ A;  2KN4 A;  2PVO D;  1KFY B;  2JXT A;  4TMA B;  3AEA B;  3TSS A;  4L2Y A;  2G1E A;  1QKZ A;  3ZGZ A;  4XWW A;  1RYJ A;  3HVD A;  3T3N A;  3CIR B;  5T8I A;  2K3U A;  1E0Z A;  3U4E G;  1YQ3 B;  3U2S C;  1HZ5 A;  2GB1 A;  4N59 A;  1XLO A;  2K22 A;  1F2R C;  4M0W A;  3B2F A;  4R3D A;  1L6U A;  4ZOH C;  4JWS C;  1SB3 C;  1FMA D;  5HG2 A;  3BK1 A;  1XF5 L;  1IGC A;  3VQI A;  3GS2 A;  4RGT A;  4P6V F;  1XCQ L;  1D4B A;  1F77 A;  3IT4 B;  3ZJT A;  3HRD D;  3BVM A;  2W82 A;  5BMG A;  2WNM A;  1AN8 A;  2SAK A;  3W2D A;  1SE4 A;  1VJK A;  3P42 A;  3TUO A;  1ZPS A;  3DWM A;  2N9L A;  1GB4 A;  3W9C B;  2SEB D;  1QF6 A;  3ZJV A;  1ZE3 D;  4TQ0 A;  1JWM D;  4HKQ A;  1YNT E;  3E56 A;  3AB5 A;  2HDE A;  1I4P A;  2BBC A;  4KGR A;  4XE0 A;  1FFV A;  1FNW A;  2MEK A;  1ET6 A;  1PDX A;  1Y56 A;  1TJE A;  2XN9 C;  2XNA C;  2PLP A;  1SE2 A;  2KAJ A;  3ZQ4 A;  4US8 A;  3IXS A;  1PGA A;  4TQ1 A;  1EU3 A;  2GRI A;  1PGX A;  3ZJU A;  1WWT A;  2WXO A;  2KDM A;  3BVZ A;  4RGM A;  1UNS A;  4N6E B;  4WH4 A;  4FXC A;  1M4V A;  3RFZ B;  3SR6 A;  1TKY A;  4MM3 B;  4OHJ A;  2WXN A;  2CJN A;  1E6E B;  1XEE A;  4OZC A;  3EUB 2;  1PYW D;  1I4H A;  3VR8 B;  1JWB D;  1VR9 A;  1SXT A;  1L0X B;  2WXF A;  1KTK A;  5AUK A;  3RPF C;  1A70 A;  2PIA A;  3C8Y A;  1C77 A;  2HTM E;  1B9R A;  3NS1 A;  1FM0 D;  5H8Y E;  4HEA 1;  4AS1 A;  3AMZ A;  2BTE A;  4YTM B;  4MH8 A;  2AQ3 B;  3LXF A;  3MJ5 A;  3BVG A;  1ET9 A;  3KQ4 A;  1C9F A;  4RGN A;  1VZ7 A;  1ZOY B;  1C4C A;  1V1O A;  1N60 A;  3B2G A;  2ACZ B;  1KH0 A;  1YJJ A;  1NVI D;  1N63 A;  3FIL B;  4KX6 B;  4YSZ B;  1D5Z C;  1SBB B;  2EEL A;  4WAF A;  4IDI A;  1FNV A;  4WUR A;  4OZA A;  2IPK D;  5EE9 A;  4JPS A;  3TEX A;  3HVZ A;  3H8H A;  4XWT A;  1K52 A;  2NTS A;  2WDV B;  2WDR B;  2L1A A;  2KAC A;  2WXG A;  1RM6 C;  2RMM A;  3GP7 A;  1XO3 A;  4WWM A;  1MPE A;  4A6Q A;  2BW2 A;  2JX5 A;  1K51 A;  2QEJ C;  1V8C A;  4HJG E;  1SIJ A;  1VRA B;  2BS2 B;  3NVV A;  3MP9 A;  3W1S A;  2EKI A;  5H92 C;  2M0A A;  1CK1 A;  1B1Z A;  3AE5 B;  2FBW B;  4ZYS A;  5TSS A;  2Y5P A;  4RNA A;  4YTN B;  1ZDX A;  1F2R I;  2JYT A;  2J4X A;  4CQN A;  3NVZ A;  3VRB B;  1JAL A;  4OW0 A;  2WXJ A;  2PVG C;  4WIP A;  4XDD A;  1ZDV A;  4YWG G;  2RDG A;  3AEG B;  2N7J A;  3NRZ A;  5G5H A;  3V05 A;  1N62 A;  1TS2 A;  2MJ3 A;  3DWG C;  2CJO A;  3FIL A;  1NYR A;  2ONQ A;  4YXD B;  2LMC A;  2LFI A;  2KQ4 X;  4ITK A;  2PMV A;  3Q8B A;  2VZK D;  3P1M A;  1D5M C;  1IUE A;  1J7B A;  1GOZ A;  1N5X A;  1ZXH A;  1TKG A;  4YSY B;  4JX1 C;  3Q69 A;  3ABV B;  3AEF B;  2I2Y A;  1I4Q A;  1TZO A;  1J7C A;  1SE3 A;  2K0P A;  2J53 A;  1SJH D;  2WXI A;  3KWL A;  3BYT B;  3URY A;  2WXK A;  1MHX A;  5FK9 C;  2BYT A;  1QOB A;  2DLB A;  2K5P A;  2FUG 1;  3AE8 B;  3W5U B;  1RWS A;  1T3Q A;  1XLP A;  4XDC A;  1TKE A;  2NTT A;  1SEB D;  2IJ0 A;  3Q8C A;  4RF0 A;  1JRO A;  3TEZ A;  2Y3A A;  1HQR D;  4KGS A;  1QIL A;  2K9X A;  2L83 A;  2Q5W D;  2L52 A;  5E6J A;  2IGG A;  3J9C A;  4OVZ A;  3GB1 A;  1N61 A;  1MVK A;  5MPO A;  3P4S B;  2E6X A;  1KLG D;  2QMT A;  3E9S A;  3TEW A;  4OZB A;  1YMH E;  1JML A;  1DGJ A;  1BUI C;  4HRO A;  2B76 B;  2YEP B;  1WRI A;  2INN E;  2DYO A;  4YT0 B;  3AEB B;  1C78 A;  1ESF A;  4B0E A;  2WXR A;  3ETR A;  2BS4 B;  1TY2 A;  2X38 A;  1JQ4 A;  4USA A;  1YN3 A;  2WXP A;  1F0Z A;  4RH6 A;  3I57 A;  3IT6 B;  1FO4 A;  2I38 A;  4ARI A;  4WQM A;  1P7F A;  3U7Z A;  4RF1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...