2PVOD

Crystal srtucture of the ternary complex between thioredoxin f, ferredoxin, and ferredoxin: thioredoxin reductase
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
96
structure length
96
Chain Sequence
b'ASYTVKLITPDGESSIECSDDTYILDAAEEAGLELPYSCRAGACSTCAGKITAGSVDQSDQSFLDDDQIEAGYVLTCVAYPTSDCTIETHKEEDLY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin-thioredoxin reductase, catalytic chain
publication title Structural snapshots along the reaction pathway of ferredoxin-thioredoxin reductase.
pubmed doi rcsb
source organism Synechocystis sp.
molecule tags Electron transport
total genus 19
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2007-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2pvoD00
1NENB 2PKOA 1WWTA 3P4PB 4YTNB 3ZYYX 5H8YE 1OQQA 1OFFA 2WP9B 4YXDB 3AV8A 1FFVA 3PO0A 4JX1C 3FAHA 1VDVA 3AEEB 3AEGB 4ITKA 1T3QA 4YTMB 1VJKA 2BS2B 2N0SB 3AEFB 1QOBA 2WU2B 2JX5A 2WQYB 4N59A 4N6EB 4YSYB 5H92C 1ZOYB 3B2GA 1DOIA 4HRSA 1IUEA 1VLBA 4YSXB 2QJLA 1NEKB 3AN1A 3L4PA 4P6VF 1CJEA 1JRPA 1WYGA 2W3SA 1QF6A 4IDIA 3AH7A 1QLBB 1OQRA 1N5XA 1WXQA 3B9JA 1XO3A 2MH7A 3BIID 5G5GA 1E0ZA 1N60A 1TYGB 1ZUD2 1FM0D 4USAA 4US9A 1I7HA 5MPOA 1FIQA 1DOYA 1FMAD 1SB3C 3RPFC 3AE7B 1JW9D 1E6EB 2K5PA 3W5VB 1FO4A 2Q5WD 1XLQA 5GXGB 1JALA 1XLPA 3AEBB 1NVID 3LXFA 4C7ZA 2DBYA 1N5WA 4ZOHC 4HROA 4YTPB 2G1EA 2LEKA 1DOXA 4C7YA 4JWUC 1PDXA 2CU3A 4FXCA 4KX6B 3AEDB 1ZP0B 3WCQA 1AYFA 1J7BA 3CWIA 3AE2B 1QT9A 1RM6C 1B9RA 1XLNA 3NS1A 1XLOA 1YJIA 2H88B 3HRDD 5EE3A 2W3RA 4ZHOA 1E10A 2KMMA 2QIEB 1KFYB 2WS3B 3P63A 4A9AA 4LTUA 1AWDA 3NRZA 1KF6B 3HUIA 3P4QB 1NI3A 1FRDA 2CJNA 3DWMA 5C2TB 1E7PB 2WDVB 3W5UB 4YSZB 4US8A 2H89B 4WWMA 1JROA 4JWSC 1DGJA 3P4RB 4N58A 2JQRB 2K9XA 2PIAA 1J7CA 1UWMA 1YJJA 2E3TA 3AECB 5C3JB 1ZXIA 3VRBB 1FXIA 1PFDA 1TKYA 2W55A 3NVYA 2L52A 2CJOA 1TKGA 1RFKA 2WDQB 3EUB2 1A70A 2WLBA 3LB8C 2OHFA 3FC4A 3VR9B 1R7SA 3ABVB 2PVGC 1GAQB 3AE6B 1CZPA 1JWBD 2MJDA 2K22A 1WRIA 3AMZA 3VRAB 2M56B 3P1MA 1JWAD 3B2FA 3AE3B 1FXAA 3P4SB 2DWQA 2KAJA 1SIJA 2BS3B 3DWGC 1QOGA 3AE5B 1RYJA 2Y5CA 2W54A 1N63A 3AE4B 3AE9B 3HVZA 3VR8B 1TKEA 2BT6A 3ETRA 3AB5A 1L6VA 5EE1A 4C80A 1J7AA 5AUIA 1PUTA 2PVOD 1YQ3B 3SFDB 1V8CA 2HTME 3KWLA 2MJEA 1EWYC 2MJ3A 4ZHPA 1L6UA 2FBWB 3SFEB 2ACZB 3W9CB 1E9MA 1FFUA 3NVWA 3SR6A 1FRRA 5EE0A 3CIRB 1F0ZA 1L5PA 3AE1B 3NVVA 2WDRB 1L0VB 3NVZA 2L83A 1N62A 4WQMA 1QOFA 3AEAB 5G5HA 1V97A 2BS4B 1WGKA 1TJEA 2EKIA 1KRHA 2WU5B 1GPXA 1NYRA 2AX5A 1JQ4A 1NYQA 2M19A 5EE9A 1QOAA 1RWSA 5AUKA 1SF0A 1N61A 3AE8B 3AM9A 2B76B 4YT0B 1YQ4B 1ROEA
chains in the Genus database with same CATH superfamily
2PJHA 3MP9A 5H8YE 4JX1C 2DENB 1XQQA 3BVGA 4MSMB 4NQKE 2QJLA 4ZYNA 3OAWA 1WYGA 2VRRB 4MGKE 4PYUA 4C4VA 1WXAA 1I7HA 4XYCA 4WWOA 2MSED 1ENFA 1WJ4A 2C7HA 3GB1A 2N9XA 3WANA 2DHZA 4KZ0A 1TS5A 2CHWA 2JVCA 4KDLB 1OEYJ 1YJIA 1AW7A 2FE8A 5LNK1 1C1YB 4NJCA 1N6ZA 4M00A 1AWDA 1WMHA 1KF6B 4O1NA 1YNTE 2JQRB 1L4DB 5CX3A 5BMGA 5D3DA 3EUB2 2SEBD 5LXIB 3TL5A 2MBBB 5DPTA 1Q0WB 2G4SA 3C0RB 2L7RA 4HLEA 4DDID 5D3IB 3PRPB 4NJ6A 3VAWA 3ZXRA 2I2YA 3MHSD 2BYFA 1YX5B 3PREA 1YQ3B 2MBEA 1SXTA 4HJGE 2IY0B 3DBSA 1GG3A 2ZJDA 3IT6B 5CHVC 2QILA 4HKZE 4MEMA 1R4MI 3DBRB 4XWWA 1GJZA 4FJVB 4MGYE 5EDSA 1VZ7A 3ZDTA 1SIFA 3A9KB 3Q6BA 4IWOA 5HKHA 1NYQA 3SDLC 2YEPF 2XN9C 3HM3A 5JHAA 3IG3A 4GDKB 4YTNB 2ICIA 1OFFA 2MBOA 1P1AA 2BYTA 1FFVA 4KKIA 3AEGB 3B08A 4DHZE 2FIDA 4N59A 2JF5A 3L08A 5H92C 1J19A 1VLBA 1YIWA 4W9FA 2GRIA 1FCCC 3GOEA 4EZLA 1SGHA 3QX1A 1N60A 3UIPB 3JVZX 1MFWA 2LGDA 2PEAA 2DAJA 4MJSB 1EF1A 2JZZA 1J0GA 3KLSX 2UU7A 1YQBA 4LJPB 2D3BA 4JIOU 1P7EA 2MW5A 2KC1A 2NS5A 3DBLB 3TJPA 1K50A 1ZDVA 2KWVB 4PS3A 2XNAC 1E8WA 2L05A 3T8MA 4OZCA 2KX0A 4AWJA 2WS3B 4A9AA 3SEBA 4FULA 4LNFA 4EZJA 1MPEA 1ZE3D 4JLCA 3ZVVA 2GBMA 1V5TA 2MWSB 1V1PB 1RFKA 3LB8C 4XZ4A 2K3UA 4RGMA 4B0MA 4OHJA 1XF5L 3H6NA 3SU8X 2OOBB 3BK2A 3AE3B 2DWQA 4E74A 2WXGA 1QOGA 2J53A 1IPGA 3ZTDA 3I5JC 2KMAA 4UDUC 1WX9A 2Y3AA 4MELA 1EWYC 2KN4A 2MJ3A 4ZHPA 3W9CB 4MSQB 2GB1A 3AU5A 2G4DB 3WAPA 3UF8A 2AYOB 1ZXHA 1TIFA 2JSVX 1WI0A 3L17A 2EKIA 1KRHA 1A5RA 2M19A 2IO0B 1LM8B 1F9JA 4BOZB 4KV2A 3GE8C 4XX5A 2Y5BB 3A4RA 2PKOA 2KK8A 2A5UA 2LJIA 2WU2B 1TS2A 1IUEA 2N7EA 1WXSA 4DQOC 1OQRA 5JZEB 1E0ZA 4E71A 4G0NB 4USAA 1YOVB 2J0MA 1WYWB 3HK0A 3QAQA 5DPRA 1OQYA 3O13A 2Z59B 2K8BA 2JT4B 2BYEA 4W9IA 4C7YA 1PDXA 2DZIA 3CWIA 3UGBB 2MX2A 4ACFA 2BVCA 2KJ6A 1L0YB 5EE3A 1WF9A 2QIEB 3RNGC 2Y5PA 1E7PB 3RD2A 2N1VA 2WXPA 1XXGA 2XBBC 3TEYA 1BXTA 4TQ1A 4GXBA 2L52A 2BYVE 3VR9B 5FK9C 3N1ZC 2M1MA 2W82A 1H4RA 3PTFC 3JW0X 3P4SB 3ZNID 3AE9B 1Z2MA 2V4LA 4WIPA 2BT6A 1AN8A 3ETRA 3KUZA 1SBBB 2V3NA 2RDBC 3RNAC 3Q3NC 2C7NB 4LNNA 4KSKC 3B1LX 4II3B 1SE9A 3KVFB 4PS8A 2MA9B 3E9SA 1FFUA 3J9CA 3MTNB 4HK2A 4J6IA 1QOFA 2WNMA 1QZEA 3IBEA 5DPWA 3I63C 4N9F4 4S0RA 3APCA 2EMTA 1TZOA 4YT0B 4ITKA 3RNEC 4W9CA 1I4QA 4W9KA 2KC2A 3PO0A 3H7PA 2KYWA 2NBUA 2ZEQA 4YSYB 3EGRA 3LJ3A 4FA6A 2WXKA 4YSXB 1NEKB 5HI1A 2B3AA 4KGTA 3GP7A 2MH7A 3ZIMA 1GC6A 4DHJB 4W9HA 5DPSA 4BKGA 3PRZA 2BB5A 2AQ2B 3KW5B 5LLIA 2KVRA 3RNBC 4C7ZA 3K9PB 4K7UA 1B9RA 2EMSA 4ASWC 1KFYB 2XK5A 3P4QB 3RN9C 1ET9A 2KWDA 1I4PA 3AECB 1OEYA 1UWMA 2KDIA 2E3TA 3UQAA 3DVNV 2CJOA 1T0SC 4XGAB 1MI0A 3U4EG 2L00B 4JGHB 4A6QA 3HVZA 4BZAA 3QCAA 1SJED 2NBVB 1J7AA 1Y56A 2KNBA 3L16A 3RULA 2ON8A 2K6DB 2BWFA 4PYZA 1P7FA 4FLHA 3KQ4A 3OG5A 3GZNI 3RFZB 3U30A 2KO3A 2LVPA 3ZRCA 4IM2A 4IKGA 4G50A 2FAZA 4IM3A 1IBXA 3C8YA 2BF8B 1N61A 1WH3A 2PPHA 5AZHA 4J3OD 1V86A 4EKUA 1E8ZA 2IZVB 3L13A 2N0SB 2WYQA 1ZOYB 3DCGA 5GMVA 3T9LA 3BVZA 1WGHA 5KHOA 1QF6A 4G11A 4WJNA 1DOYA 1FMAD 1E6EB 1I4GA 3V05A 2KACA 5L83A 2J4XA 3CMMB 4ZRJA 4GB9A 3N20C 4FXCA 3VUXA 1QT9A 1XLNA 3DBHB 2H88B 1C78A 4RM9A 3PZ8A 3NRZA 4TQ0A 3N3KB 2NPTB 4OW0A 2KTFA 2CHZA 2PE6B 3TEWA 1SE3A 3Q3JA 1YX6B 4AJWA 1E90A 1XD3B 1A70A 3V6CB 1QILA 3FC4A 2L76A 3GE3C 1I4RA 3PSEB 2PVGC 4W9LA 3S2AA 1FEHA 2YVCA 2KFJA 4PK1A 4B0EA 2KQSA 2KAJA 2WXQA 2BB6A 2BS3B 2KTRB 2GBKA 1P98A 3N9YC 3RZFA 2DZKA 4WQOB 2MCNB 1WE6A 4K1RB 3KWLA 3MFGA 2IYDB 2N1WA 2L0FA 2BQQA 4L1BA 4MM3B 3O65B 4OVUA 2ZNVC 1IGDA 1S1QB 2IY1B 4OVVA 3MJ5A 2NCNA 1FNVA 4A55A 4ZYSA 2BKRB 5IA7A 1SE2A 3IFWB 2KWUB 4A3OA 3N32A 2MEKA 4EEWA 1SF0A 3H7SA 2O6VA 1C4PA 2E6XA 3TMPB 3NOBA 1QOBA 4KIKA 2YLMA 4RCOA 3W1SA 4OZBA 3Q3MC 4NNJB 1WIAA 4P6VF 5BO4B 2Z0EB 4WURA 3BIID 2FUHB 3L10B 1WFYA 3DVGY 4LNIA 2KX3A 4HVBA 1VD2A 2AEHA 4C56C 1ZPSA 4ICVA 1PQSA 1ESFA 4KX6B 3WIMA 1J7BA 3NS1A 1LGRA 5CHFA 3H9DA 2BWES 2HE7A 3QHTA 4IOIE 2CJNA 4FJZA 1JWSD 3Q14C 4DBGA 3W1SC 1UGMA 2K9XA 1KH0A 2FNJB 3T3NA 1FXIA 2W55A 3IHPC 2MP2B 4RFBA 1LFDA 3VH3B 4K3CA 3PV1A 4HKQA 1JWBD 4GMVA 3WAOA 1JWAD 1CK1A 3A9JA 1N63A 2M4NA 4C4VB 1L0XB 2V9HA 4LDTD 4LNOA 4RMAA 3KWVA 1IGCA 2DX5B 1IYFA 3BK1A 5J18A 1V9JA 4A3PA 1D5ZC 3R8BA 2L83A 1OTRB 3Q8BA 1E8YA 2GBNA 2RDHA 3AEAB 4M8MA 1SJHD 1NYRA 1EO6A 5EE9A 1MHXA 3PHWB 1BMLC 3L0WB 2BPSA 4R3DA 1CMXB 2L0TA 2C5LC 2L32A 3LDZE 3FAHA 3H8HA 4RNAA 3NY5A 2LMCA 3EECA 1K8RB 1WZ3A 2AL6A 4WJPA 1L2NA 1XO3A 4MGZE 1PGBA 2EKEC 1KTKA 4AS1A 3A1QA 2WGSA 2Q5WD 3URYA 5GXGB 4KDIC 4C00A 4ZOHC 4EE2A 4FN2A 4AQ7A 2R2OA 2MQJA 1XLOA 2INPE 2RMMA 2IO1B 4BBNC 1LQBA 4MJSA 2IO3B 4ANXA 2FIFA 1T5XD 4XDDA 2ZPYA 4US8A 4TUUA 4KSLC 5I4DA 1C77A 2WDQB 1WRIA 4GDLB 3LYYA 3R2TA 1GB4A 3UINB 2INCC 2DNFA 1E8XA 1HZ5A 1TGZB 5IKCM 1TBEA 2D10A 2JRIB 1PUTA 4K7WA 4P1CC 2PTLA 4WWPA 4MDKE 1U4AA 2V3PA 1V1PA 2MJEA 2KT7A 1CQVA 4WAFA 3NVZA 1WR1A 3TEZA 3VUWA 1FNUA 3SD5A 1WGKA 1GPXA 3ZGZA 4I6LB 2PMVA 4YL8A 1JMLA 1Q10A 2ZW0A 2ZPNA 1EF5A 4XE0A 1P0RA 2LGSA 4AUQC 2JX5A 4N6EB 4ANVA 1DOIA 5IP4D 3KUCB 4FHJA 4DXAB 1CJEA 1QLBB 1N5XA 3B9JA 2N4FA 4KVGB 3K9OB 4Q2JA 3VQIA 2FUG1 1XLQA 1NVID 1N5WA 2J42A 1HXYD 2LEKA 3ECIA 1WJ6A 2MHJA 5TSSA 3WCQA 5D6JB 2FCMA 2KMMA 3PRMB 1FPYA 2JYTA 2RD0A 1F52A 1FNWA 4RGOS 3AU4A 4YSZB 3VUYA 3P4RB 4KGSA 1K51A 1ET6A 2WXOA 2RR9A 3PLUA 4BKSA 3DHGC 3ZNZB 2OHFA 3I9V1 3KYDD 2AQ1B 2MJDA 1E7VA 5T8IA 3B2FA 2TSSA 2JWUA 2KMCA 3VDZA 2LRUA 3AE5B 3GZNB 3AE4B 1M94A 1L6VA 2KKCA 2KVZA 4ICUA 1TZ1A 2QDFA 4MT5A 3ENEA 1JCKB 4RGTA 2LHEA 2FCQA 3IXSA 2WXMA 2ACZB 1E7UA 2LGXA 3CIRB 1X1MA 1L5PA 4BFRA 3ZNHB 1L0VB 1N62A 5JXVA 5D94A 2W9NA 3VTVA 3T3OA 1GC7A 2N9KA 1WX7A 4M0WA 3R66C 1SEBD 1WGDA 4XC2A 2PE9A 1NENB 2O2VA 2HJ1A 4EFOA 5JHBA 2KOXA 1P3QU 4NAMA 4IG7B 1ZKHA 3W1YA 3Q8EA 3X0WA 4REZA 3I57A 2KJHB 4ARIA 1Q1OA 4US9A 4FJYA 3ZJTA 2ZCCA 1XT9B 4L23A 2WX0A 3AEBB 4I6PA 4JE3B 5IAAC 2IO2B 2JUOA 3DVNU 2K6QA 4BVUC 4A90A 1RM6C 1V80A 2NMQA 3Q3OC 3RNFC 1E10A 2EELA 2LI5A 3GS2A 2PLPA 3EFUA 4B95A 2FCNA 2LXAA 4FADA 3Q8CA 2G9HD 5CHWA 2N9PC 1PYWD 2JRHA 3M62B 2ZVNA 1VZ6A 5HFYA 2D3CA 1JRUA 3NVYA 1WGYA 1GB1A 2WLBA 2KFKA 4BAXA 2J0KA 3H7PB 3NHEB 3VRAB 2M56B 2XEWA 2CR5A 3MC8A 2K1FA 4GLSC 3TCAA 2Y5CA 4TV3A 1P9DU 3RMKC 2PVOD 2PW9A 2V4IB 3FILB 2KZRA 5E6PA 4TMAB 1GUAB 1YN3A 1MJDA 1Y8RC 3QA8A 4NAWA 1C3TA 2KDMA 4WQMA 3DHHC 1WZ0A 1AARA 1VZ8A 4JQWC 2XK5B 3IT4B 3MHZA 3AE8B 3AM9A 2KDBA 1TY2A 2K8CA 4EZKA 3U7DA 3RYTA 1S3SG 2BS2B 3AEFB 5BYQA 1F2RC 2C9WB 4RM8A 4AOFA 3R3MA 3NJTA 5G55A 2IBIB 4HPMB 4L2YA 3AH7A 2JXXA 3IAS1 4I6NB 5MPOA 1FIQA 3N1YC 3AE7B 1D4BA 2L3ZA 2KANA 1WM2A 4JWUC 5DCNA 1AYFA 5J17A 1BT0A 3N1XC 1HTQA 3V60A 3P63A 4MH8A 3ZNGC 2NVUI 1IBXB 3Q2AC 3W5UB 5KHQA 1WY8A 4WWMA 1DGJA 3PS6A 2PIAA 2QSDA 1H8CA 2BTEA 4K7SA 3ZLZA 3IVFA 4FBJB 2C7MB 4W9DA 3V61A 2MBHA 3P1MA 1TT5B 2K8HA 5L95C 2SAKA 1UD7A 2JZ3B 5EE1A 4KZCA 5J2RA 1HEZE 4MH0E 2DZMA 1V8CA 4AP4C 1ZW7A 3X23A 3BY4B 2G3QB 2REXA 3TEXA 1F0ZA 4GN1A 1VR9A 1V49A 2VH1A 1KLUD 2O6VD 3AULA 2BBCA 3ZRFA 1ACCA 2YEPB 1EUVB 1R4MB 2LGYA 2D5GA 3JSVB 1KM7A 5IOIA 4FHKA 5AUKA 3NUHB 3R7RA 4S17A 1KLGD 2LUMA 5BMHA 1WWTA 1YD8U 2WP9B 2LVOA 4YXDB 3U8ZA 3ZTCA 1ISNA 4EOYA 2I1KA 2IJ0A 2HTHA 4JL9A 3U52E 4M01A 1Z5SB 3Q3FA 3AN1A 2WXHA 3TBLD 3L4PA 3KYCD 1JRPA 1TS3A 3QIJA 1WXQA 4F8CB 5IN7A 3AXCA 1V1OA 4ZRQA 1JALA 3B0AA 4P16A 4HROA 1R4NI 2LD9A 3ZUNA 2CU3A 2KJRA 2WX1A 1OGWA 2R61A 2MLBA 1C9FA 1TS4A 1EU3A 4LJOB 3BINA 4MACA 5C23A 1F2RI 5C2TB 4HWIB 2QEJC 2JY6A 1UWXA 2QMTA 3PLVA 4D2KA 1V5OA 1J7CA 3A4SC 4EUTA 3Q8AA 1ZXIA 3CSTA 1T0QC 2C60A 3ZQ4A 2INNE 4ZDVA 2GOWA 4HDOA 1GOZA 1HTOA 1C79A 1EU4A 5C1ZA 3DQVA 4KIKB 3PPAA 3OJ4B 1RAXA 2MBQA 2WXNA 4RH6A 1TKEA 3AB5A 4HJKA 4LCDE 3ML8A 1V81A 1KJTA 2MP2A 2N9EB 2KLGA 4PT5A 3EA6A 3DOWA 1FRRA 4KKJA 2WDTB 3APFA 4W9GA 1L7YA 4RF1A 4W9JA 3VTWA 4DDGD 4NQLB 2KDFB 2Z8LA 1UELA 2KHWB 1QOAA 1RWSA 2LZ6A 2RPQA 1ZDXA 4WWNA 1YQ4B 3HIZA 1HQRD 1KLVA 5AZGA 3VTUA 5G2NA 2VH2A 3ZDMC 2K0PA 4B9KA 3Q8FA 5CTRC 2W3SA 1K53A 3A9JB 3APDA 3M95A 4IC7B 4X57B 3EHVA 1ZUD2 3RUIB 1FM0D 1WMHB 1F1HA 5E6OA 2K5PA 3W5VB 2NTTA 4DK5A 4XWTA 2DBYA 3DBHI 3MJWA 5AEKB 1EWCA 2G45B 2KXJA 3DVGX 4JPSA 2ONQA 2DAFA 4K3BA 3A9KA 4H2AA 1NDDA 2LASA 4GU2A 2H89B 4GDKA 3NS8A 1UBIA 1YJJA 5C3JB 1IP9A 1UZXB 3DPDA 4HEA1 3MC0B 3DHIC 2IDYA 1R7SA 4HCPB 2V1YA 1DYQA 3RNCC 2D3GA 2RSUA 2WXFA 3NZUA 4QAYA 2RGFA 1UF0A 4LDTB 2N7JA 2N9LA 3PZDA 2AL3A 4DHZB 2L8JA 1EM7A 3UI3A 2D3AA 2M8SA 3A1QB 1UUPA 2NBWB 4OVZA 3VHTC 1ZGUB 1RLFA 3R7QA 3ONSA 3NG0A 3NVWA 2KQ4X 4GDLA 2LUEA 4P1BC 1WR6E 1QKZA 4DWFA 2ASQA 2WU5B 4TKNA 3MC9A 1QQRA 3QC8B 1JQ4A 2MRPA 4GSWA 2I1JA 1WXMA 1I35A 2B76B 3QQ8B 2IGHA 1UGJA 2QCZA 4YTMB 1RRBA 4LLGM 1C4AA 2UWQA 5BYSA 1G6JA 3D32A 4IDIA 3FKYA 1TYGB 1MG8A 3OLMD 1HZ6A 1WE7A 1J8CA 1VRAB 3RPFC 2HDEA 2LVQA 3UQBA 4II2B 4K81A 3ZW3A 3AE2B 1JWUD 2M0XA 4ZHOA 2W3RA 2HD5B 4BKSD 2ZW1A 4LTUA 3PGEA 4WJQA 3RCZA 3QJZA 3DWMA 2WDVB 2RDGA 3M63B 4JWSC 2M17A 1I4HA 3BYYB 3U2SC 1PFDA 4DXGA 2UYZB 3KH0A 2QHOA 3ABVB 3NZ3A 2WXIA 1GAQB 1CZPA 2K22A 2JPHA 2R2QA 2KWCA 1VCBA 1WJUA 3DWGC 5BMIA 5HHDG 2GLSA 4ANUA 4C80A 2HJ8A 1MG4A 2HTME 1T6BX 3TUOA 5HG2A 2OJWA 4GIVA 4NY0A 1V97A 2BS4B 4ANWA 1PGXA 4LNKA 1TJEA 1F77A 4XDCA 4DXFA 4CQNA 2INDC 2VZKD 3P4PB 2L1AA 5D7GA 2QC8A 3AV8A 3P2BA 2CKHB 3DBRI 1T3QA 1VJKA 1XCQL 3B2GA 2I38A 3ZO5B 2Z0DB 1TTNA 1FXTB 1SE4A 4BBNF 3RI7C 5TR5A 2JXTA 5G5GA 2J0JA 1SB3C 3TSSA 1FO4A 1D6EC 4DHJD 1XLPA 2OJRA 2J52A 5E6NA 1D3ZA 1NI2A 5FR3A 4B6WA 3CF6E 3ZXVA 3AI5A 1XCTL 3EFCA 5JH5C 5AZFA 2ZVOA 3HUIA 1NI3A 3BVMA 2WXLA 4ZRPA 1FRDA 2J7QB 1LXDA 2K39A 3VFKA 1C4CA 3M3JA 3RT3B 4M0WB 3ML9A 3N30A 3VRBB 1TKYA 2O2VB 3DBLI 2AQ3B 1PGAA 3PT2B 1TKGA 2X38A 4A20A 2LGIA 2X8XX 4IW0A 2JYEA 2AWTA 4ZRIA 2VZKB 3C19A 3QARA 4BOSC 2RPVA 1RYJA 3VR8B 2DLBA 2M0AA 2DYOA 1V6EA 2GMIC 2LRWA 4RGNA 3A33B 3ALBA 1LO5D 2KQ7A 4A8XC 2FBWB 3SFEB 5E6JA 5EE0A 3H1UA 4OZAA 1FD6A 3NVVA 2JZPA 2WDRB 1T0YA 2ZZPB 4F7ZA 5G5HA 1C76A 1MHHE 4HDQA 4HCNB 1Q5WB 1TY0A 1YN4A 2AX5A 1I42A 3FILA 3SHQA 4HPLB 3Q69A 2JWZA 1ROEA 1L4ZB 3RZWC 1I4XA 2DZJA 1WRDB 3HM6X 2KFKB 3QWZB 4HRSA 1R4NB 3IAM1 1WJNA 2KD0A 2DYBA 3PVLA 4E3CA 4BKTA 1WSPA 2WHIA 3LXFA 1WM3A 1DOXA 3OWEB 3V3XA 1WXVA 3WA0A 4NAWB 4HPPA 2BGFA 2LFIA 2CS4A 4LK0M 3BYTB 1SSNA 4N58A 1D5MC 3U7ZA 1FCLA 2BKFA 3HVDA 1GNUA 4ARCA 3DDCB 1YN5A 4TSSA 3QK0A 2V3SA 3W2DA 4AJYB 1M4VA 4RF0A 3L54A 1V2YA 4IWPA 2NR2A 5LXHA 3OJ3A 1YMHE 4IM0A 5BYRA 2D11A 3WAMA 5AUIA 1BUIC 1K52A 4HXDA 2KLCA 4W9EA 1L6UA 2WXRA 1E9MA 3SR6A 2LXCA 3AE1B 1YJ1A 3TIXA 1HE8A 3V62A 3KUDB 2N7DA 1JWMD 3PZ7A 2GBJA 2OEDA 1WGGA 4PS7A 2NPTA 3EC8A 3VH4B 1HA5A 4CHKA 1MVKA 1B1ZA 3ZYYX 4M8NA 1OQQA 3PHXB 4IWQA 1RFAA 1VDVA 2K25A 3AEEB 2WQYB 2BW2A 3BWUD 1KOTA 1STEA 2KTRA 3JSVA 3WALA 3I3TB 2CHXA 4KGRA 1JW9D 4G3XB 4MGIE 4WAAA 4CYEA 2ZNVB 1XEEA 4MM3A 4IUMB 4YTPB 2G1EA 2JU6X 4URKA 3AEDB 1ZP0B 1UH6A 3HHMA 4CO7A 3HRDD 4YWGG 2A4ZA 2GI9A 5IO9A 2CU1A 2FCSA 2LJ5A 2WXJA 1WX8A 2NTSA 1JROA 2KN5A 4WH4A 4M02A 3BZDB 4NJ7A 4F1SA 5D2MB 5FR6A 3ZKJC 3AE6B 3AMZA 4NPNA 1FXAA 2ZCBA 1E5WA 1SIJA 1WGRA 4GGQA 3R2IA 1UNSA 2GBRA 2W54A 2IGGA 3SFDB 1T0RC 4NZLB 2WWZA 3ZJUA 4GOCA 2KDEB 2IGDA 3CSFA 2O6VB 3UIOB 3V6EB 2IPKD 3VXWA 1UBQA 2LWPA 4P7IA 2D07B 4WJOA 4ZRKA 3NZSA 3ZJVA 1NBFC 1D5XC 5FKAC 2LHDA 2DYMA 2V0GA 3VVWB 3JYUA 3E56A 3P42A 2D2QA
chains in the Genus database with same CATH topology
1NENB 5H8YE 3MP9A 4JX1C 2IGHA 1UGJA 3BVGA 4YTMB 2N0SB 4NAMA 1ZOYB 4LLGM 1C4AA 5BYSA 2QJLA 3BVZA 3Q8EA 1WYGA 1QF6A 4IDIA 4REZA 3I57A 1TYGB 4ARIA 1HZ6A 4US9A 1I7HA 1DOYA 1FMAD 1VRAB 3RPFC 3ZJTA 1E6EB 1I4GA 2HDEA 1ENFA 3V05A 2KACA 4L23A 3GB1A 3AEBB 2J4XA 4JE3B 1TS5A 4FXCA 3AE2B 1QT9A 4A90A 1RM6C 1XLNA 2NMQA 1JWUD 1YJIA 2H88B 4ZHOA 2W3RA 1E10A 1AW7A 2EELA 2FE8A 1C78A 3GS2A 5LNK1 2PLPA 4NJCA 3PZ8A 2ZW1A 4LTUA 1AWDA 3NRZA 1KF6B 4TQ0A 4O1NA 4OW0A 1YNTE 3DWMA 3Q8CA 2WDVB 2G9HD 2RDGA 4JWSC 3TEWA 1PYWD 1SE3A 2JQRB 1I4HA 1L4DB 3BYYB 5BMGA 3U2SC 1VZ6A 1PFDA 4DXGA 5D3DA 5HFYA 3NVYA 1GB1A 3EUB2 1A70A 2WLBA 1QILA 3FC4A 2SEBD 1I4RA 3ABVB 2PVGC 3NZ3A 2WXIA 1FEHA 1GAQB 1CZPA 4B0EA 2K22A 3VRAB 2M56B 2KAJA 2WXQA 2BB6A 2BS3B 3DWGC 4GLSC 5D3IB 2Y5CA 5BMIA 2I2YA 5HHDG 3N9YC 4C80A 2PVOD 2PW9A 2V4IB 1YQ3B 3FILB 2HTME 1SXTA 4HJGE 3KWLA 3MFGA 3IT6B 4TMAB 1T6BX 4L1BA 3TUOA 1YN3A 4MM3B 2QILA 4HKZE 1IGDA 5HG2A 2KDMA 3MJ5A 4XWWA 1VZ7A 1FNVA 4WQMA 4A55A 1V97A 2BS4B 4ZYSA 1VZ8A 1PGXA 1TJEA 1F77A 4XDCA 1NYQA 1SE2A 3IT4B 3MHZA 4DXFA 4CQNA 2MEKA 1SF0A 2YEPF 3AE8B 2VZKD 3AM9A 2XN9C 1TY2A 1C4PA 4GDKB 3P4PB 2L1AA 4YTNB 5D7GA 2ICIA 1OFFA 2E6XA 3AV8A 1FFVA 4KKIA 2BYTA 3AEGB 1T3QA 1VJKA 2BS2B 3AEFB 5BYQA 1QOBA 1F2RC 4RCOA 4N59A 1XCQL 5H92C 3B2GA 1VLBA 2I38A 3W1SA 4OZBA 2GRIA 4P6VF 1FCCC 1SE4A 4L2YA 3AH7A 4WURA 2JXTA 5G5GA 3BIID 3IAS1 1N60A 5MPOA 1FIQA 3TSSA 1SB3C 3AE7B 3KLSX 1D6EC 1FO4A 4C56C 1D4BA 1ZPSA 1XLPA 2J52A 1P7EA 4JWUC 5FR3A 1ESFA 4KX6B 1AYFA 1J7BA 3NS1A 1K50A 1XCTL 1ZDVA 2XNAC 4OZCA 2WS3B 3P63A 3SEBA 4MH8A 4A9AA 3HUIA 1NI3A 3BVMA 2WXLA 4IOIE 4ZRPA 1FRDA 2CJNA 1IBXB 1JWSD 1MPEA 3W5UB 4WWMA 1C4CA 1DGJA 1ZE3D 2K9XA 2PIAA 1KH0A 2QSDA 3VRBB 3T3NA 1FXIA 1TKYA 2W55A 2AQ3B 1PGAA 2BTEA 4RFBA 1TKGA 1RFKA 1V1PB 2X38A 3LB8C 2K3UA 2LGIA 4RGMA 4B0MA 4OHJA 4HKQA 1JWBD 1XF5L 2JYEA 3P1MA 1JWAD 3BK2A 3AE3B 1CK1A 2DWQA 2SAKA 2VZKB 2WXGA 1QOGA 2RPVA 1RYJA 1N63A 3VR8B 2DLBA 2J53A 5EE1A 2M0AA 2DYOA 4RGNA 4UDUC 1HEZE 1L0XB 2Y3AA 1V8CA 3KWVA 1IGCA 1EWYC 2KN4A 2MJ3A 3BK1A 1LO5D 4ZHPA 4A8XC 2FBWB 3SFEB 3W9CB 5E6JA 5EE0A 4OZAA 3TEXA 2GB1A 1D5ZC 3R8BA 3NVVA 2JZPA 1F0ZA 1FD6A 1VR9A 1KLUD 2WDRB 2L83A 3Q8BA 2BBCA 1ZXHA 2RDHA 3AEAB 5G5HA 1C76A 2JSVX 1ACCA 1MHHE 2YEPB 1SJHD 2EKIA 1KRHA 1NYRA 1TY0A 1YN4A 2AX5A 2D5GA 3FILA 2M19A 5EE9A 1MHXA 5AUKA 3NUHB 1BMLC 3Q69A 4R3DA 1KLGD 1ROEA 2LUMA 5BMHA 2PKOA 1WWTA 1L4ZB 2WP9B 4YXDB 2L32A 3FAHA 1I4XA 3H8HA 2IJ0A 2LJIA 2WU2B 4RNAA 3U52E 4HRSA 1TS2A 1IUEA 3AN1A 2LMCA 3IAM1 2WXHA 3L4PA 1JRPA 1TS3A 4DQOC 1OQRA 1WXQA 1XO3A 1E0ZA 1PGBA 4USAA 1KTKA 4AS1A 1WSPA 1V1OA 2Q5WD 3URYA 5GXGB 3O13A 4ZRQA 1JALA 3LXFA 4P16A 4ZOHC 4HROA 4EE2A 1DOXA 3OWEB 4AQ7A 4C7YA 1PDXA 2CU3A 3V3XA 3CWIA 4NAWB 2R61A 1L0YB 1C9FA 1XLOA 5EE3A 1TS4A 1EU3A 2INPE 2LFIA 2RMMA 2QIEB 4MACA 4LK0M 2Y5PA 1F2RI 3BYTB 5C2TB 1E7PB 1T5XD 2QEJC 4XDDA 2WXPA 1SSNA 4US8A 1UWXA 1XXGA 2QMTA 4N58A 4D2KA 1D5MC 5I4DA 3TEYA 1J7CA 3U7ZA 1FCLA 1BXTA 3Q8AA 1ZXIA 4TQ1A 3HVDA 3ZQ4A 1C77A 2INNE 1GOZA 2L52A 4ARCA 1YN5A 2WDQB 4TSSA 3VR9B 5FK9C 1C79A 3W2DA 1EU4A 1M4VA 4RF0A 2W82A 1WRIA 4GDLB 3LYYA 3R2TA 1GB4A 2WXNA 3P4SB 1YMHE 4RH6A 3AE9B 4WIPA 1HZ5A 5BYRA 1TKEA 2BT6A 1AN8A 3ETRA 3AB5A 1SBBB 2V3NA 5AUIA 1PUTA 1BUIC 2PTLA 1K52A 2V3PA 1V1PA 2MJEA 4PT5A 1L6UA 3EA6A 2WXRA 1E9MA 3E9SA 1FFUA 3J9CA 3SR6A 1FRRA 4KKJA 3AE1B 1CQVA 4WAFA 3NVZA 3TEZA 1JWMD 1QOFA 2WNMA 3PZ7A 1FNUA 4RF1A 2OEDA 1WGKA 1GPXA 3ZGZA 2PMVA 2Z8LA 1QOAA 1RWSA 1JMLA 1HA5A 1TZOA 1Q10A 1ZDXA 2ZW0A 1MVKA 1YQ4B 4ITKA 4YT0B 1B1ZA 3ZYYX 1I4QA 1OQQA 4XE0A 3PO0A 1HQRD 1VDVA 3AEEB 2JX5A 2WQYB 2BW2A 4N6EB 3BWUD 4YSYB 3EGRA 1DOIA 2WXKA 1STEA 4YSXB 2K0PA 1NEKB 5HI1A 3Q8FA 1CJEA 2W3SA 1K53A 4KGTA 1QLBB 1N5XA 3B9JA 3GP7A 2MH7A 1ZUD2 1FM0D 4Q2JA 4KGRA 3VQIA 1JW9D 2K5PA 3W5VB 2NTTA 2FUG1 1XEEA 1XLQA 2AQ2B 2BB5A 1NVID 4XWTA 4C7ZA 2DBYA 1N5WA 4YTPB 2J42A 1HXYD 2G1EA 2LEKA 1EWCA 2JU6X 4JPSA 5TSSA 3AEDB 1ZP0B 2ONQA 3WCQA 1B9RA 3HRDD 4H2AA 2KMMA 4YWGG 1KFYB 2JYTA 2GI9A 3P4QB 2WXJA 1ET9A 1FNWA 4RGOS 2KWDA 4YSZB 1I4PA 2H89B 1JROA 2NTSA 4WH4A 3P4RB 4KGSA 1K51A 3BZDB 3AECB 1UWMA 1YJJA 2E3TA 5C3JB 1ET6A 2WXOA 4HEA1 2CJOA 3MC0B 2IDYA 2OHFA 1R7SA 3I9V1 3AE6B 1DYQA 1MI0A 3U4EG 2AQ1B 2MJDA 3AMZA 5T8IA 3B2FA 2TSSA 2JWUA 1FXAA 2WXFA 1SIJA 4A6QA 3AE5B 1UNSA 3R2IA 3HVZA 2W54A 3AE4B 2N7JA 2N9LA 1SJED 2IGGA 1L6VA 1J7AA 1EM7A 3UI3A 1Y56A 4MT5A 3SFDB 4NZLB 1JCKB 4RGTA 1UUPA 2LHEA 4OVZA 3ZJUA 3IXSA 2IGDA 2WXMA 2ACZB 2ON8A 3NVWA 2IPKD 2KQ4X 1L5PA 3CIRB 1L0VB 1P7FA 3KQ4A 1N62A 3RFZB 3ZJVA 1D5XC 5JXVA 5FKAC 2LHDA 1QKZA 3T3OA 4IKGA 2DYMA 2N9KA 2WU5B 2V0GA 1IBXA 1QQRA 3C8YA 1JQ4A 3E56A 3P42A 4M0WA 1SEBD 1N61A 2B76B 4J3OD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NEN B;  2PKO A;  1WWT A;  3P4P B;  4YTN B;  3ZYY X;  5H8Y E;  1OQQ A;  1OFF A;  2WP9 B;  4YXD B;  3AV8 A;  1FFV A;  3PO0 A;  4JX1 C;  3FAH A;  1VDV A;  3AEE B;  3AEG B;  4ITK A;  1T3Q A;  4YTM B;  1VJK A;  2BS2 B;  2N0S B;  3AEF B;  1QOB A;  2WU2 B;  2JX5 A;  2WQY B;  4N59 A;  4N6E B;  4YSY B;  5H92 C;  1ZOY B;  3B2G A;  1DOI A;  4HRS A;  1IUE A;  1VLB A;  4YSX B;  2QJL A;  1NEK B;  3AN1 A;  3L4P A;  4P6V F;  1CJE A;  1JRP A;  1WYG A;  2W3S A;  1QF6 A;  4IDI A;  3AH7 A;  1QLB B;  1OQR A;  1N5X A;  1WXQ A;  3B9J A;  1XO3 A;  2MH7 A;  3BII D;  5G5G A;  1E0Z A;  1N60 A;  1TYG B;  1ZUD 2;  1FM0 D;  4USA A;  4US9 A;  1I7H A;  5MPO A;  1FIQ A;  1DOY A;  1FMA D;  1SB3 C;  3RPF C;  3AE7 B;  1JW9 D;  1E6E B;  2K5P A;  3W5V B;  1FO4 A;  2Q5W D;  1XLQ A;  5GXG B;  1JAL A;  1XLP A;  3AEB B;  1NVI D;  3LXF A;  4C7Z A;  2DBY A;  1N5W A;  4ZOH C;  4HRO A;  4YTP B;  2G1E A;  2LEK A;  1DOX A;  4C7Y A;  4JWU C;  1PDX A;  2CU3 A;  4FXC A;  4KX6 B;  3AED B;  1ZP0 B;  3WCQ A;  1AYF A;  1J7B A;  3CWI A;  3AE2 B;  1QT9 A;  1RM6 C;  1B9R A;  1XLN A;  3NS1 A;  1XLO A;  1YJI A;  2H88 B;  3HRD D;  5EE3 A;  2W3R A;  4ZHO A;  1E10 A;  2KMM A;  2QIE B;  1KFY B;  2WS3 B;  3P63 A;  4A9A A;  4LTU A;  1AWD A;  3NRZ A;  1KF6 B;  3HUI A;  3P4Q B;  1NI3 A;  1FRD A;  2CJN A;  3DWM A;  5C2T B;  1E7P B;  2WDV B;  3W5U B;  4YSZ B;  4US8 A;  2H89 B;  4WWM A;  1JRO A;  4JWS C;  1DGJ A;  3P4R B;  4N58 A;  2JQR B;  2K9X A;  2PIA A;  1J7C A;  1UWM A;  1YJJ A;  2E3T A;  3AEC B;  5C3J B;  1ZXI A;  3VRB B;  1FXI A;  1PFD A;  1TKY A;  2W55 A;  3NVY A;  2L52 A;  2CJO A;  1TKG A;  1RFK A;  2WDQ B;  3EUB 2;  1A70 A;  2WLB A;  3LB8 C;  2OHF A;  3FC4 A;  3VR9 B;  1R7S A;  3ABV B;  2PVG C;  1GAQ B;  3AE6 B;  1CZP A;  1JWB D;  2MJD A;  2K22 A;  1WRI A;  3AMZ A;  3VRA B;  2M56 B;  3P1M A;  1JWA D;  3B2F A;  3AE3 B;  1FXA A;  3P4S B;  2DWQ A;  2KAJ A;  1SIJ A;  2BS3 B;  3DWG C;  1QOG A;  3AE5 B;  1RYJ A;  2Y5C A;  2W54 A;  1N63 A;  3AE4 B;  3AE9 B;  3HVZ A;  3VR8 B;  1TKE A;  2BT6 A;  3ETR A;  3AB5 A;  1L6V A;  5EE1 A;  4C80 A;  1J7A A;  5AUI A;  1PUT A;  2PVO D;  1YQ3 B;  3SFD B;  1V8C A;  2HTM E;  3KWL A;  2MJE A;  1EWY C;  2MJ3 A;  4ZHP A;  1L6U A;  2FBW B;  3SFE B;  2ACZ B;  3W9C B;  1E9M A;  1FFU A;  3NVW A;  3SR6 A;  1FRR A;  5EE0 A;  3CIR B;  1F0Z A;  1L5P A;  3AE1 B;  3NVV A;  2WDR B;  1L0V B;  3NVZ A;  2L83 A;  1N62 A;  4WQM A;  1QOF A;  3AEA B;  5G5H A;  1V97 A;  2BS4 B;  1WGK A;  1TJE A;  2EKI A;  1KRH A;  2WU5 B;  1GPX A;  1NYR A;  2AX5 A;  1JQ4 A;  1NYQ A;  2M19 A;  5EE9 A;  1QOA A;  1RWS A;  5AUK A;  1SF0 A;  1N61 A;  3AE8 B;  3AM9 A;  2B76 B;  4YT0 B;  1YQ4 B;  1ROE A; 
#chains in the Genus database with same CATH topology
 2PJH A;  3MP9 A;  5H8Y E;  4JX1 C;  2DEN B;  1XQQ A;  3BVG A;  4MSM B;  4NQK E;  2QJL A;  4ZYN A;  3OAW A;  1WYG A;  2VRR B;  4MGK E;  4PYU A;  4C4V A;  1WXA A;  1I7H A;  4XYC A;  4WWO A;  2MSE D;  1ENF A;  1WJ4 A;  2C7H A;  3GB1 A;  2N9X A;  3WAN A;  2DHZ A;  4KZ0 A;  1TS5 A;  2CHW A;  2JVC A;  4KDL B;  1OEY J;  1YJI A;  1AW7 A;  2FE8 A;  5LNK 1;  1C1Y B;  4NJC A;  1N6Z A;  4M00 A;  1AWD A;  1WMH A;  1KF6 B;  4O1N A;  1YNT E;  2JQR B;  1L4D B;  5CX3 A;  5BMG A;  5D3D A;  3EUB 2;  2SEB D;  5LXI B;  3TL5 A;  2MBB B;  5DPT A;  1Q0W B;  2G4S A;  3C0R B;  2L7R A;  4HLE A;  4DDI D;  5D3I B;  3PRP B;  4NJ6 A;  3VAW A;  3ZXR A;  2I2Y A;  3MHS D;  2BYF A;  1YX5 B;  3PRE A;  1YQ3 B;  2MBE A;  1SXT A;  4HJG E;  2IY0 B;  3DBS A;  1GG3 A;  2ZJD A;  3IT6 B;  5CHV C;  2QIL A;  4HKZ E;  4MEM A;  1R4M I;  3DBR B;  4XWW A;  1GJZ A;  4FJV B;  4MGY E;  5EDS A;  1VZ7 A;  3ZDT A;  1SIF A;  3A9K B;  3Q6B A;  4IWO A;  5HKH A;  1NYQ A;  3SDL C;  2YEP F;  2XN9 C;  3HM3 A;  5JHA A;  3IG3 A;  4GDK B;  4YTN B;  2ICI A;  1OFF A;  2MBO A;  1P1A A;  2BYT A;  1FFV A;  4KKI A;  3AEG B;  3B08 A;  4DHZ E;  2FID A;  4N59 A;  2JF5 A;  3L08 A;  5H92 C;  1J19 A;  1VLB A;  1YIW A;  4W9F A;  2GRI A;  1FCC C;  3GOE A;  4EZL A;  1SGH A;  3QX1 A;  1N60 A;  3UIP B;  3JVZ X;  1MFW A;  2LGD A;  2PEA A;  2DAJ A;  4MJS B;  1EF1 A;  2JZZ A;  1J0G A;  3KLS X;  2UU7 A;  1YQB A;  4LJP B;  2D3B A;  4JIO U;  1P7E A;  2MW5 A;  2KC1 A;  2NS5 A;  3DBL B;  3TJP A;  1K50 A;  1ZDV A;  2KWV B;  4PS3 A;  2XNA C;  1E8W A;  2L05 A;  3T8M A;  4OZC A;  2KX0 A;  4AWJ A;  2WS3 B;  4A9A A;  3SEB A;  4FUL A;  4LNF A;  4EZJ A;  1MPE A;  1ZE3 D;  4JLC A;  3ZVV A;  2GBM A;  1V5T A;  2MWS B;  1V1P B;  1RFK A;  3LB8 C;  4XZ4 A;  2K3U A;  4RGM A;  4B0M A;  4OHJ A;  1XF5 L;  3H6N A;  3SU8 X;  2OOB B;  3BK2 A;  3AE3 B;  2DWQ A;  4E74 A;  2WXG A;  1QOG A;  2J53 A;  1IPG A;  3ZTD A;  3I5J C;  2KMA A;  4UDU C;  1WX9 A;  2Y3A A;  4MEL A;  1EWY C;  2KN4 A;  2MJ3 A;  4ZHP A;  3W9C B;  4MSQ B;  2GB1 A;  3AU5 A;  2G4D B;  3WAP A;  3UF8 A;  2AYO B;  1ZXH A;  1TIF A;  2JSV X;  1WI0 A;  3L17 A;  2EKI A;  1KRH A;  1A5R A;  2M19 A;  2IO0 B;  1LM8 B;  1F9J A;  4BOZ B;  4KV2 A;  3GE8 C;  4XX5 A;  2Y5B B;  3A4R A;  2PKO A;  2KK8 A;  2A5U A;  2LJI A;  2WU2 B;  1TS2 A;  1IUE A;  2N7E A;  1WXS A;  4DQO C;  1OQR A;  5JZE B;  1E0Z A;  4E71 A;  4G0N B;  4USA A;  1YOV B;  2J0M A;  1WYW B;  3HK0 A;  3QAQ A;  5DPR A;  1OQY A;  3O13 A;  2Z59 B;  2K8B A;  2JT4 B;  2BYE A;  4W9I A;  4C7Y A;  1PDX A;  2DZI A;  3CWI A;  3UGB B;  2MX2 A;  4ACF A;  2BVC A;  2KJ6 A;  1L0Y B;  5EE3 A;  1WF9 A;  2QIE B;  3RNG C;  2Y5P A;  1E7P B;  3RD2 A;  2N1V A;  2WXP A;  1XXG A;  2XBB C;  3TEY A;  1BXT A;  4TQ1 A;  4GXB A;  2L52 A;  2BYV E;  3VR9 B;  5FK9 C;  3N1Z C;  2M1M A;  2W82 A;  1H4R A;  3PTF C;  3JW0 X;  3P4S B;  3ZNI D;  3AE9 B;  1Z2M A;  2V4L A;  4WIP A;  2BT6 A;  1AN8 A;  3ETR A;  3KUZ A;  1SBB B;  2V3N A;  2RDB C;  3RNA C;  3Q3N C;  2C7N B;  4LNN A;  4KSK C;  3B1L X;  4II3 B;  1SE9 A;  3KVF B;  4PS8 A;  2MA9 B;  3E9S A;  1FFU A;  3J9C A;  3MTN B;  4HK2 A;  4J6I A;  1QOF A;  2WNM A;  1QZE A;  3IBE A;  5DPW A;  3I63 C;  4N9F 4;  4S0R A;  3APC A;  2EMT A;  1TZO A;  4YT0 B;  4ITK A;  3RNE C;  4W9C A;  1I4Q A;  4W9K A;  2KC2 A;  3PO0 A;  3H7P A;  2KYW A;  2NBU A;  2ZEQ A;  4YSY B;  3EGR A;  3LJ3 A;  4FA6 A;  2WXK A;  4YSX B;  1NEK B;  5HI1 A;  2B3A A;  4KGT A;  3GP7 A;  2MH7 A;  3ZIM A;  1GC6 A;  4DHJ B;  4W9H A;  5DPS A;  4BKG A;  3PRZ A;  2BB5 A;  2AQ2 B;  3KW5 B;  5LLI A;  2KVR A;  3RNB C;  4C7Z A;  3K9P B;  4K7U A;  1B9R A;  2EMS A;  4ASW C;  1KFY B;  2XK5 A;  3P4Q B;  3RN9 C;  1ET9 A;  2KWD A;  1I4P A;  3AEC B;  1OEY A;  1UWM A;  2KDI A;  2E3T A;  3UQA A;  3DVN V;  2CJO A;  1T0S C;  4XGA B;  1MI0 A;  3U4E G;  2L00 B;  4JGH B;  4A6Q A;  3HVZ A;  4BZA A;  3QCA A;  1SJE D;  2NBV B;  1J7A A;  1Y56 A;  2KNB A;  3L16 A;  3RUL A;  2ON8 A;  2K6D B;  2BWF A;  4PYZ A;  1P7F A;  4FLH A;  3KQ4 A;  3OG5 A;  3GZN I;  3RFZ B;  3U30 A;  2KO3 A;  2LVP A;  3ZRC A;  4IM2 A;  4IKG A;  4G50 A;  2FAZ A;  4IM3 A;  1IBX A;  3C8Y A;  2BF8 B;  1N61 A;  1WH3 A;  2PPH A;  5AZH A;  4J3O D;  1V86 A;  4EKU A;  1E8Z A;  2IZV B;  3L13 A;  2N0S B;  2WYQ A;  1ZOY B;  3DCG A;  5GMV A;  3T9L A;  3BVZ A;  1WGH A;  5KHO A;  1QF6 A;  4G11 A;  4WJN A;  1DOY A;  1FMA D;  1E6E B;  1I4G A;  3V05 A;  2KAC A;  5L83 A;  2J4X A;  3CMM B;  4ZRJ A;  4GB9 A;  3N20 C;  4FXC A;  3VUX A;  1QT9 A;  1XLN A;  3DBH B;  2H88 B;  1C78 A;  4RM9 A;  3PZ8 A;  3NRZ A;  4TQ0 A;  3N3K B;  2NPT B;  4OW0 A;  2KTF A;  2CHZ A;  2PE6 B;  3TEW A;  1SE3 A;  3Q3J A;  1YX6 B;  4AJW A;  1E90 A;  1XD3 B;  1A70 A;  3V6C B;  1QIL A;  3FC4 A;  2L76 A;  3GE3 C;  1I4R A;  3PSE B;  2PVG C;  4W9L A;  3S2A A;  1FEH A;  2YVC A;  2KFJ A;  4PK1 A;  4B0E A;  2KQS A;  2KAJ A;  2WXQ A;  2BB6 A;  2BS3 B;  2KTR B;  2GBK A;  1P98 A;  3N9Y C;  3RZF A;  2DZK A;  4WQO B;  2MCN B;  1WE6 A;  4K1R B;  3KWL A;  3MFG A;  2IYD B;  2N1W A;  2L0F A;  2BQQ A;  4L1B A;  4MM3 B;  3O65 B;  4OVU A;  2ZNV C;  1IGD A;  1S1Q B;  2IY1 B;  4OVV A;  3MJ5 A;  2NCN A;  1FNV A;  4A55 A;  4ZYS A;  2BKR B;  5IA7 A;  1SE2 A;  3IFW B;  2KWU B;  4A3O A;  3N32 A;  2MEK A;  4EEW A;  1SF0 A;  3H7S A;  2O6V A;  1C4P A;  2E6X A;  3TMP B;  3NOB A;  1QOB A;  4KIK A;  2YLM A;  4RCO A;  3W1S A;  4OZB A;  3Q3M C;  4NNJ B;  1WIA A;  4P6V F;  5BO4 B;  2Z0E B;  4WUR A;  3BII D;  2FUH B;  3L10 B;  1WFY A;  3DVG Y;  4LNI A;  2KX3 A;  4HVB A;  1VD2 A;  2AEH A;  4C56 C;  1ZPS A;  4ICV A;  1PQS A;  1ESF A;  4KX6 B;  3WIM A;  1J7B A;  3NS1 A;  1LGR A;  5CHF A;  3H9D A;  2BWE S;  2HE7 A;  3QHT A;  4IOI E;  2CJN A;  4FJZ A;  1JWS D;  3Q14 C;  4DBG A;  3W1S C;  1UGM A;  2K9X A;  1KH0 A;  2FNJ B;  3T3N A;  1FXI A;  2W55 A;  3IHP C;  2MP2 B;  4RFB A;  1LFD A;  3VH3 B;  4K3C A;  3PV1 A;  4HKQ A;  1JWB D;  4GMV A;  3WAO A;  1JWA D;  1CK1 A;  3A9J A;  1N63 A;  2M4N A;  4C4V B;  1L0X B;  2V9H A;  4LDT D;  4LNO A;  4RMA A;  3KWV A;  1IGC A;  2DX5 B;  1IYF A;  3BK1 A;  5J18 A;  1V9J A;  4A3P A;  1D5Z C;  3R8B A;  2L83 A;  1OTR B;  3Q8B A;  1E8Y A;  2GBN A;  2RDH A;  3AEA B;  4M8M A;  1SJH D;  1NYR A;  1EO6 A;  5EE9 A;  1MHX A;  3PHW B;  1BML C;  3L0W B;  2BPS A;  4R3D A;  1CMX B;  2L0T A;  2C5L C;  2L32 A;  3LDZ E;  3FAH A;  3H8H A;  4RNA A;  3NY5 A;  2LMC A;  3EEC A;  1K8R B;  1WZ3 A;  2AL6 A;  4WJP A;  1L2N A;  1XO3 A;  4MGZ E;  1PGB A;  2EKE C;  1KTK A;  4AS1 A;  3A1Q A;  2WGS A;  2Q5W D;  3URY A;  5GXG B;  4KDI C;  4C00 A;  4ZOH C;  4EE2 A;  4FN2 A;  4AQ7 A;  2R2O A;  2MQJ A;  1XLO A;  2INP E;  2RMM A;  2IO1 B;  4BBN C;  1LQB A;  4MJS A;  2IO3 B;  4ANX A;  2FIF A;  1T5X D;  4XDD A;  2ZPY A;  4US8 A;  4TUU A;  4KSL C;  5I4D A;  1C77 A;  2WDQ B;  1WRI A;  4GDL B;  3LYY A;  3R2T A;  1GB4 A;  3UIN B;  2INC C;  2DNF A;  1E8X A;  1HZ5 A;  1TGZ B;  5IKC M;  1TBE A;  2D10 A;  2JRI B;  1PUT A;  4K7W A;  4P1C C;  2PTL A;  4WWP A;  4MDK E;  1U4A A;  2V3P A;  1V1P A;  2MJE A;  2KT7 A;  1CQV A;  4WAF A;  3NVZ A;  1WR1 A;  3TEZ A;  3VUW A;  1FNU A;  3SD5 A;  1WGK A;  1GPX A;  3ZGZ A;  4I6L B;  2PMV A;  4YL8 A;  1JML A;  1Q10 A;  2ZW0 A;  2ZPN A;  1EF5 A;  4XE0 A;  1P0R A;  2LGS A;  4AUQ C;  2JX5 A;  4N6E B;  4ANV A;  1DOI A;  5IP4 D;  3KUC B;  4FHJ A;  4DXA B;  1CJE A;  1QLB B;  1N5X A;  3B9J A;  2N4F A;  4KVG B;  3K9O B;  4Q2J A;  3VQI A;  2FUG 1;  1XLQ A;  1NVI D;  1N5W A;  2J42 A;  1HXY D;  2LEK A;  3ECI A;  1WJ6 A;  2MHJ A;  5TSS A;  3WCQ A;  5D6J B;  2FCM A;  2KMM A;  3PRM B;  1FPY A;  2JYT A;  2RD0 A;  1F52 A;  1FNW A;  4RGO S;  3AU4 A;  4YSZ B;  3VUY A;  3P4R B;  4KGS A;  1K51 A;  1ET6 A;  2WXO A;  2RR9 A;  3PLU A;  4BKS A;  3DHG C;  3ZNZ B;  2OHF A;  3I9V 1;  3KYD D;  2AQ1 B;  2MJD A;  1E7V A;  5T8I A;  3B2F A;  2TSS A;  2JWU A;  2KMC A;  3VDZ A;  2LRU A;  3AE5 B;  3GZN B;  3AE4 B;  1M94 A;  1L6V A;  2KKC A;  2KVZ A;  4ICU A;  1TZ1 A;  2QDF A;  4MT5 A;  3ENE A;  1JCK B;  4RGT A;  2LHE A;  2FCQ A;  3IXS A;  2WXM A;  2ACZ B;  1E7U A;  2LGX A;  3CIR B;  1X1M A;  1L5P A;  4BFR A;  3ZNH B;  1L0V B;  1N62 A;  5JXV A;  5D94 A;  2W9N A;  3VTV A;  3T3O A;  1GC7 A;  2N9K A;  1WX7 A;  4M0W A;  3R66 C;  1SEB D;  1WGD A;  4XC2 A;  2PE9 A;  1NEN B;  2O2V A;  2HJ1 A;  4EFO A;  5JHB A;  2KOX A;  1P3Q U;  4NAM A;  4IG7 B;  1ZKH A;  3W1Y A;  3Q8E A;  3X0W A;  4REZ A;  3I57 A;  2KJH B;  4ARI A;  1Q1O A;  4US9 A;  4FJY A;  3ZJT A;  2ZCC A;  1XT9 B;  4L23 A;  2WX0 A;  3AEB B;  4I6P A;  4JE3 B;  5IAA C;  2IO2 B;  2JUO A;  3DVN U;  2K6Q A;  4BVU C;  4A90 A;  1RM6 C;  1V80 A;  2NMQ A;  3Q3O C;  3RNF C;  1E10 A;  2EEL A;  2LI5 A;  3GS2 A;  2PLP A;  3EFU A;  4B95 A;  2FCN A;  2LXA A;  4FAD A;  3Q8C A;  2G9H D;  5CHW A;  2N9P C;  1PYW D;  2JRH A;  3M62 B;  2ZVN A;  1VZ6 A;  5HFY A;  2D3C A;  1JRU A;  3NVY A;  1WGY A;  1GB1 A;  2WLB A;  2KFK A;  4BAX A;  2J0K A;  3H7P B;  3NHE B;  3VRA B;  2M56 B;  2XEW A;  2CR5 A;  3MC8 A;  2K1F A;  4GLS C;  3TCA A;  2Y5C A;  4TV3 A;  1P9D U;  3RMK C;  2PVO D;  2PW9 A;  2V4I B;  3FIL B;  2KZR A;  5E6P A;  4TMA B;  1GUA B;  1YN3 A;  1MJD A;  1Y8R C;  3QA8 A;  4NAW A;  1C3T A;  2KDM A;  4WQM A;  3DHH C;  1WZ0 A;  1AAR A;  1VZ8 A;  4JQW C;  2XK5 B;  3IT4 B;  3MHZ A;  3AE8 B;  3AM9 A;  2KDB A;  1TY2 A;  2K8C A;  4EZK A;  3U7D A;  3RYT A;  1S3S G;  2BS2 B;  3AEF B;  5BYQ A;  1F2R C;  2C9W B;  4RM8 A;  4AOF A;  3R3M A;  3NJT A;  5G55 A;  2IBI B;  4HPM B;  4L2Y A;  3AH7 A;  2JXX A;  3IAS 1;  4I6N B;  5MPO A;  1FIQ A;  3N1Y C;  3AE7 B;  1D4B A;  2L3Z A;  2KAN A;  1WM2 A;  4JWU C;  5DCN A;  1AYF A;  5J17 A;  1BT0 A;  3N1X C;  1HTQ A;  3V60 A;  3P63 A;  4MH8 A;  3ZNG C;  2NVU I;  1IBX B;  3Q2A C;  3W5U B;  5KHQ A;  1WY8 A;  4WWM A;  1DGJ A;  3PS6 A;  2PIA A;  2QSD A;  1H8C A;  2BTE A;  4K7S A;  3ZLZ A;  3IVF A;  4FBJ B;  2C7M B;  4W9D A;  3V61 A;  2MBH A;  3P1M A;  1TT5 B;  2K8H A;  5L95 C;  2SAK A;  1UD7 A;  2JZ3 B;  5EE1 A;  4KZC A;  5J2R A;  1HEZ E;  4MH0 E;  2DZM A;  1V8C A;  4AP4 C;  1ZW7 A;  3X23 A;  3BY4 B;  2G3Q B;  2REX A;  3TEX A;  1F0Z A;  4GN1 A;  1VR9 A;  1V49 A;  2VH1 A;  1KLU D;  2O6V D;  3AUL A;  2BBC A;  3ZRF A;  1ACC A;  2YEP B;  1EUV B;  1R4M B;  2LGY A;  2D5G A;  3JSV B;  1KM7 A;  5IOI A;  4FHK A;  5AUK A;  3NUH B;  3R7R A;  4S17 A;  1KLG D;  2LUM A;  5BMH A;  1WWT A;  1YD8 U;  2WP9 B;  2LVO A;  4YXD B;  3U8Z A;  3ZTC A;  1ISN A;  4EOY A;  2I1K A;  2IJ0 A;  2HTH A;  4JL9 A;  3U52 E;  4M01 A;  1Z5S B;  3Q3F A;  3AN1 A;  2WXH A;  3TBL D;  3L4P A;  3KYC D;  1JRP A;  1TS3 A;  3QIJ A;  1WXQ A;  4F8C B;  5IN7 A;  3AXC A;  1V1O A;  4ZRQ A;  1JAL A;  3B0A A;  4P16 A;  4HRO A;  1R4N I;  2LD9 A;  3ZUN A;  2CU3 A;  2KJR A;  2WX1 A;  1OGW A;  2R61 A;  2MLB A;  1C9F A;  1TS4 A;  1EU3 A;  4LJO B;  3BIN A;  4MAC A;  5C23 A;  1F2R I;  5C2T B;  4HWI B;  2QEJ C;  2JY6 A;  1UWX A;  2QMT A;  3PLV A;  4D2K A;  1V5O A;  1J7C A;  3A4S C;  4EUT A;  3Q8A A;  1ZXI A;  3CST A;  1T0Q C;  2C60 A;  3ZQ4 A;  2INN E;  4ZDV A;  2GOW A;  4HDO A;  1GOZ A;  1HTO A;  1C79 A;  1EU4 A;  5C1Z A;  3DQV A;  4KIK B;  3PPA A;  3OJ4 B;  1RAX A;  2MBQ A;  2WXN A;  4RH6 A;  1TKE A;  3AB5 A;  4HJK A;  4LCD E;  3ML8 A;  1V81 A;  1KJT A;  2MP2 A;  2N9E B;  2KLG A;  4PT5 A;  3EA6 A;  3DOW A;  1FRR A;  4KKJ A;  2WDT B;  3APF A;  4W9G A;  1L7Y A;  4RF1 A;  4W9J A;  3VTW A;  4DDG D;  4NQL B;  2KDF B;  2Z8L A;  1UEL A;  2KHW B;  1QOA A;  1RWS A;  2LZ6 A;  2RPQ A;  1ZDX A;  4WWN A;  1YQ4 B;  3HIZ A;  1HQR D;  1KLV A;  5AZG A;  3VTU A;  5G2N A;  2VH2 A;  3ZDM C;  2K0P A;  4B9K A;  3Q8F A;  5CTR C;  2W3S A;  1K53 A;  3A9J B;  3APD A;  3M95 A;  4IC7 B;  4X57 B;  3EHV A;  1ZUD 2;  3RUI B;  1FM0 D;  1WMH B;  1F1H A;  5E6O A;  2K5P A;  3W5V B;  2NTT A;  4DK5 A;  4XWT A;  2DBY A;  3DBH I;  3MJW A;  5AEK B;  1EWC A;  2G45 B;  2KXJ A;  3DVG X;  4JPS A;  2ONQ A;  2DAF A;  4K3B A;  3A9K A;  4H2A A;  1NDD A;  2LAS A;  4GU2 A;  2H89 B;  4GDK A;  3NS8 A;  1UBI A;  1YJJ A;  5C3J B;  1IP9 A;  1UZX B;  3DPD A;  4HEA 1;  3MC0 B;  3DHI C;  2IDY A;  1R7S A;  4HCP B;  2V1Y A;  1DYQ A;  3RNC C;  2D3G A;  2RSU A;  2WXF A;  3NZU A;  4QAY A;  2RGF A;  1UF0 A;  4LDT B;  2N7J A;  2N9L A;  3PZD A;  2AL3 A;  4DHZ B;  2L8J A;  1EM7 A;  3UI3 A;  2D3A A;  2M8S A;  3A1Q B;  1UUP A;  2NBW B;  4OVZ A;  3VHT C;  1ZGU B;  1RLF A;  3R7Q A;  3ONS A;  3NG0 A;  3NVW A;  2KQ4 X;  4GDL A;  2LUE A;  4P1B C;  1WR6 E;  1QKZ A;  4DWF A;  2ASQ A;  2WU5 B;  4TKN A;  3MC9 A;  1QQR A;  3QC8 B;  1JQ4 A;  2MRP A;  4GSW A;  2I1J A;  1WXM A;  1I35 A;  2B76 B;  3QQ8 B;  2IGH A;  1UGJ A;  2QCZ A;  4YTM B;  1RRB A;  4LLG M;  1C4A A;  2UWQ A;  5BYS A;  1G6J A;  3D32 A;  4IDI A;  3FKY A;  1TYG B;  1MG8 A;  3OLM D;  1HZ6 A;  1WE7 A;  1J8C A;  1VRA B;  3RPF C;  2HDE A;  2LVQ A;  3UQB A;  4II2 B;  4K81 A;  3ZW3 A;  3AE2 B;  1JWU D;  2M0X A;  4ZHO A;  2W3R A;  2HD5 B;  4BKS D;  2ZW1 A;  4LTU A;  3PGE A;  4WJQ A;  3RCZ A;  3QJZ A;  3DWM A;  2WDV B;  2RDG A;  3M63 B;  4JWS C;  2M17 A;  1I4H A;  3BYY B;  3U2S C;  1PFD A;  4DXG A;  2UYZ B;  3KH0 A;  2QHO A;  3ABV B;  3NZ3 A;  2WXI A;  1GAQ B;  1CZP A;  2K22 A;  2JPH A;  2R2Q A;  2KWC A;  1VCB A;  1WJU A;  3DWG C;  5BMI A;  5HHD G;  2GLS A;  4ANU A;  4C80 A;  2HJ8 A;  1MG4 A;  2HTM E;  1T6B X;  3TUO A;  5HG2 A;  2OJW A;  4GIV A;  4NY0 A;  1V97 A;  2BS4 B;  4ANW A;  1PGX A;  4LNK A;  1TJE A;  1F77 A;  4XDC A;  4DXF A;  4CQN A;  2IND C;  2VZK D;  3P4P B;  2L1A A;  5D7G A;  2QC8 A;  3AV8 A;  3P2B A;  2CKH B;  3DBR I;  1T3Q A;  1VJK A;  1XCQ L;  3B2G A;  2I38 A;  3ZO5 B;  2Z0D B;  1TTN A;  1FXT B;  1SE4 A;  4BBN F;  3RI7 C;  5TR5 A;  2JXT A;  5G5G A;  2J0J A;  1SB3 C;  3TSS A;  1FO4 A;  1D6E C;  4DHJ D;  1XLP A;  2OJR A;  2J52 A;  5E6N A;  1D3Z A;  1NI2 A;  5FR3 A;  4B6W A;  3CF6 E;  3ZXV A;  3AI5 A;  1XCT L;  3EFC A;  5JH5 C;  5AZF A;  2ZVO A;  3HUI A;  1NI3 A;  3BVM A;  2WXL A;  4ZRP A;  1FRD A;  2J7Q B;  1LXD A;  2K39 A;  3VFK A;  1C4C A;  3M3J A;  3RT3 B;  4M0W B;  3ML9 A;  3N30 A;  3VRB B;  1TKY A;  2O2V B;  3DBL I;  2AQ3 B;  1PGA A;  3PT2 B;  1TKG A;  2X38 A;  4A20 A;  2LGI A;  2X8X X;  4IW0 A;  2JYE A;  2AWT A;  4ZRI A;  2VZK B;  3C19 A;  3QAR A;  4BOS C;  2RPV A;  1RYJ A;  3VR8 B;  2DLB A;  2M0A A;  2DYO A;  1V6E A;  2GMI C;  2LRW A;  4RGN A;  3A33 B;  3ALB A;  1LO5 D;  2KQ7 A;  4A8X C;  2FBW B;  3SFE B;  5E6J A;  5EE0 A;  3H1U A;  4OZA A;  1FD6 A;  3NVV A;  2JZP A;  2WDR B;  1T0Y A;  2ZZP B;  4F7Z A;  5G5H A;  1C76 A;  1MHH E;  4HDQ A;  4HCN B;  1Q5W B;  1TY0 A;  1YN4 A;  2AX5 A;  1I42 A;  3FIL A;  3SHQ A;  4HPL B;  3Q69 A;  2JWZ A;  1ROE A;  1L4Z B;  3RZW C;  1I4X A;  2DZJ A;  1WRD B;  3HM6 X;  2KFK B;  3QWZ B;  4HRS A;  1R4N B;  3IAM 1;  1WJN A;  2KD0 A;  2DYB A;  3PVL A;  4E3C A;  4BKT A;  1WSP A;  2WHI A;  3LXF A;  1WM3 A;  1DOX A;  3OWE B;  3V3X A;  1WXV A;  3WA0 A;  4NAW B;  4HPP A;  2BGF A;  2LFI A;  2CS4 A;  4LK0 M;  3BYT B;  1SSN A;  4N58 A;  1D5M C;  3U7Z A;  1FCL A;  2BKF A;  3HVD A;  1GNU A;  4ARC A;  3DDC B;  1YN5 A;  4TSS A;  3QK0 A;  2V3S A;  3W2D A;  4AJY B;  1M4V A;  4RF0 A;  3L54 A;  1V2Y A;  4IWP A;  2NR2 A;  5LXH A;  3OJ3 A;  1YMH E;  4IM0 A;  5BYR A;  2D11 A;  3WAM A;  5AUI A;  1BUI C;  1K52 A;  4HXD A;  2KLC A;  4W9E A;  1L6U A;  2WXR A;  1E9M A;  3SR6 A;  2LXC A;  3AE1 B;  1YJ1 A;  3TIX A;  1HE8 A;  3V62 A;  3KUD B;  2N7D A;  1JWM D;  3PZ7 A;  2GBJ A;  2OED A;  1WGG A;  4PS7 A;  2NPT A;  3EC8 A;  3VH4 B;  1HA5 A;  4CHK A;  1MVK A;  1B1Z A;  3ZYY X;  4M8N A;  1OQQ A;  3PHX B;  4IWQ A;  1RFA A;  1VDV A;  2K25 A;  3AEE B;  2WQY B;  2BW2 A;  3BWU D;  1KOT A;  1STE A;  2KTR A;  3JSV A;  3WAL A;  3I3T B;  2CHX A;  4KGR A;  1JW9 D;  4G3X B;  4MGI E;  4WAA A;  4CYE A;  2ZNV B;  1XEE A;  4MM3 A;  4IUM B;  4YTP B;  2G1E A;  2JU6 X;  4URK A;  3AED B;  1ZP0 B;  1UH6 A;  3HHM A;  4CO7 A;  3HRD D;  4YWG G;  2A4Z A;  2GI9 A;  5IO9 A;  2CU1 A;  2FCS A;  2LJ5 A;  2WXJ A;  1WX8 A;  2NTS A;  1JRO A;  2KN5 A;  4WH4 A;  4M02 A;  3BZD B;  4NJ7 A;  4F1S A;  5D2M B;  5FR6 A;  3ZKJ C;  3AE6 B;  3AMZ A;  4NPN A;  1FXA A;  2ZCB A;  1E5W A;  1SIJ A;  1WGR A;  4GGQ A;  3R2I A;  1UNS A;  2GBR A;  2W54 A;  2IGG A;  3SFD B;  1T0R C;  4NZL B;  2WWZ A;  3ZJU A;  4GOC A;  2KDE B;  2IGD A;  3CSF A;  2O6V B;  3UIO B;  3V6E B;  2IPK D;  3VXW A;  1UBQ A;  2LWP A;  4P7I A;  2D07 B;  4WJO A;  4ZRK A;  3NZS A;  3ZJV A;  1NBF C;  1D5X C;  5FKA C;  2LHD A;  2DYM A;  2V0G A;  3VVW B;  3JYU A;  3E56 A;  3P42 A;  2D2Q A; 
#chains in the Genus database with same CATH homology
 1NEN B;  5H8Y E;  3MP9 A;  4JX1 C;  2IGH A;  1UGJ A;  3BVG A;  4YTM B;  2N0S B;  4NAM A;  1ZOY B;  4LLG M;  1C4A A;  5BYS A;  2QJL A;  3BVZ A;  3Q8E A;  1WYG A;  1QF6 A;  4IDI A;  4REZ A;  3I57 A;  1TYG B;  4ARI A;  1HZ6 A;  4US9 A;  1I7H A;  1DOY A;  1FMA D;  1VRA B;  3RPF C;  3ZJT A;  1E6E B;  1I4G A;  2HDE A;  1ENF A;  3V05 A;  2KAC A;  4L23 A;  3GB1 A;  3AEB B;  2J4X A;  4JE3 B;  1TS5 A;  4FXC A;  3AE2 B;  1QT9 A;  4A90 A;  1RM6 C;  1XLN A;  2NMQ A;  1JWU D;  1YJI A;  2H88 B;  4ZHO A;  2W3R A;  1E10 A;  1AW7 A;  2EEL A;  2FE8 A;  1C78 A;  3GS2 A;  5LNK 1;  2PLP A;  4NJC A;  3PZ8 A;  2ZW1 A;  4LTU A;  1AWD A;  3NRZ A;  1KF6 B;  4TQ0 A;  4O1N A;  4OW0 A;  1YNT E;  3DWM A;  3Q8C A;  2WDV B;  2G9H D;  2RDG A;  4JWS C;  3TEW A;  1PYW D;  1SE3 A;  2JQR B;  1I4H A;  1L4D B;  3BYY B;  5BMG A;  3U2S C;  1VZ6 A;  1PFD A;  4DXG A;  5D3D A;  5HFY A;  3NVY A;  1GB1 A;  3EUB 2;  1A70 A;  2WLB A;  1QIL A;  3FC4 A;  2SEB D;  1I4R A;  3ABV B;  2PVG C;  3NZ3 A;  2WXI A;  1FEH A;  1GAQ B;  1CZP A;  4B0E A;  2K22 A;  3VRA B;  2M56 B;  2KAJ A;  2WXQ A;  2BB6 A;  2BS3 B;  3DWG C;  4GLS C;  5D3I B;  2Y5C A;  5BMI A;  2I2Y A;  5HHD G;  3N9Y C;  4C80 A;  2PVO D;  2PW9 A;  2V4I B;  1YQ3 B;  3FIL B;  2HTM E;  1SXT A;  4HJG E;  3KWL A;  3MFG A;  3IT6 B;  4TMA B;  1T6B X;  4L1B A;  3TUO A;  1YN3 A;  4MM3 B;  2QIL A;  4HKZ E;  1IGD A;  5HG2 A;  2KDM A;  3MJ5 A;  4XWW A;  1VZ7 A;  1FNV A;  4WQM A;  4A55 A;  1V97 A;  2BS4 B;  4ZYS A;  1VZ8 A;  1PGX A;  1TJE A;  1F77 A;  4XDC A;  1NYQ A;  1SE2 A;  3IT4 B;  3MHZ A;  4DXF A;  4CQN A;  2MEK A;  1SF0 A;  2YEP F;  3AE8 B;  2VZK D;  3AM9 A;  2XN9 C;  1TY2 A;  1C4P A;  4GDK B;  3P4P B;  2L1A A;  4YTN B;  5D7G A;  2ICI A;  1OFF A;  2E6X A;  3AV8 A;  1FFV A;  4KKI A;  2BYT A;  3AEG B;  1T3Q A;  1VJK A;  2BS2 B;  3AEF B;  5BYQ A;  1QOB A;  1F2R C;  4RCO A;  4N59 A;  1XCQ L;  5H92 C;  3B2G A;  1VLB A;  2I38 A;  3W1S A;  4OZB A;  2GRI A;  4P6V F;  1FCC C;  1SE4 A;  4L2Y A;  3AH7 A;  4WUR A;  2JXT A;  5G5G A;  3BII D;  3IAS 1;  1N60 A;  5MPO A;  1FIQ A;  3TSS A;  1SB3 C;  3AE7 B;  3KLS X;  1D6E C;  1FO4 A;  4C56 C;  1D4B A;  1ZPS A;  1XLP A;  2J52 A;  1P7E A;  4JWU C;  5FR3 A;  1ESF A;  4KX6 B;  1AYF A;  1J7B A;  3NS1 A;  1K50 A;  1XCT L;  1ZDV A;  2XNA C;  4OZC A;  2WS3 B;  3P63 A;  3SEB A;  4MH8 A;  4A9A A;  3HUI A;  1NI3 A;  3BVM A;  2WXL A;  4IOI E;  4ZRP A;  1FRD A;  2CJN A;  1IBX B;  1JWS D;  1MPE A;  3W5U B;  4WWM A;  1C4C A;  1DGJ A;  1ZE3 D;  2K9X A;  2PIA A;  1KH0 A;  2QSD A;  3VRB B;  3T3N A;  1FXI A;  1TKY A;  2W55 A;  2AQ3 B;  1PGA A;  2BTE A;  4RFB A;  1TKG A;  1RFK A;  1V1P B;  2X38 A;  3LB8 C;  2K3U A;  2LGI A;  4RGM A;  4B0M A;  4OHJ A;  4HKQ A;  1JWB D;  1XF5 L;  2JYE A;  3P1M A;  1JWA D;  3BK2 A;  3AE3 B;  1CK1 A;  2DWQ A;  2SAK A;  2VZK B;  2WXG A;  1QOG A;  2RPV A;  1RYJ A;  1N63 A;  3VR8 B;  2DLB A;  2J53 A;  5EE1 A;  2M0A A;  2DYO A;  4RGN A;  4UDU C;  1HEZ E;  1L0X B;  2Y3A A;  1V8C A;  3KWV A;  1IGC A;  1EWY C;  2KN4 A;  2MJ3 A;  3BK1 A;  1LO5 D;  4ZHP A;  4A8X C;  2FBW B;  3SFE B;  3W9C B;  5E6J A;  5EE0 A;  4OZA A;  3TEX A;  2GB1 A;  1D5Z C;  3R8B A;  3NVV A;  2JZP A;  1F0Z A;  1FD6 A;  1VR9 A;  1KLU D;  2WDR B;  2L83 A;  3Q8B A;  2BBC A;  1ZXH A;  2RDH A;  3AEA B;  5G5H A;  1C76 A;  2JSV X;  1ACC A;  1MHH E;  2YEP B;  1SJH D;  2EKI A;  1KRH A;  1NYR A;  1TY0 A;  1YN4 A;  2AX5 A;  2D5G A;  3FIL A;  2M19 A;  5EE9 A;  1MHX A;  5AUK A;  3NUH B;  1BML C;  3Q69 A;  4R3D A;  1KLG D;  1ROE A;  2LUM A;  5BMH A;  2PKO A;  1WWT A;  1L4Z B;  2WP9 B;  4YXD B;  2L32 A;  3FAH A;  1I4X A;  3H8H A;  2IJ0 A;  2LJI A;  2WU2 B;  4RNA A;  3U52 E;  4HRS A;  1TS2 A;  1IUE A;  3AN1 A;  2LMC A;  3IAM 1;  2WXH A;  3L4P A;  1JRP A;  1TS3 A;  4DQO C;  1OQR A;  1WXQ A;  1XO3 A;  1E0Z A;  1PGB A;  4USA A;  1KTK A;  4AS1 A;  1WSP A;  1V1O A;  2Q5W D;  3URY A;  5GXG B;  3O13 A;  4ZRQ A;  1JAL A;  3LXF A;  4P16 A;  4ZOH C;  4HRO A;  4EE2 A;  1DOX A;  3OWE B;  4AQ7 A;  4C7Y A;  1PDX A;  2CU3 A;  3V3X A;  3CWI A;  4NAW B;  2R61 A;  1L0Y B;  1C9F A;  1XLO A;  5EE3 A;  1TS4 A;  1EU3 A;  2INP E;  2LFI A;  2RMM A;  2QIE B;  4MAC A;  4LK0 M;  2Y5P A;  1F2R I;  3BYT B;  5C2T B;  1E7P B;  1T5X D;  2QEJ C;  4XDD A;  2WXP A;  1SSN A;  4US8 A;  1UWX A;  1XXG A;  2QMT A;  4N58 A;  4D2K A;  1D5M C;  5I4D A;  3TEY A;  1J7C A;  3U7Z A;  1FCL A;  1BXT A;  3Q8A A;  1ZXI A;  4TQ1 A;  3HVD A;  3ZQ4 A;  1C77 A;  2INN E;  1GOZ A;  2L52 A;  4ARC A;  1YN5 A;  2WDQ B;  4TSS A;  3VR9 B;  5FK9 C;  1C79 A;  3W2D A;  1EU4 A;  1M4V A;  4RF0 A;  2W82 A;  1WRI A;  4GDL B;  3LYY A;  3R2T A;  1GB4 A;  2WXN A;  3P4S B;  1YMH E;  4RH6 A;  3AE9 B;  4WIP A;  1HZ5 A;  5BYR A;  1TKE A;  2BT6 A;  1AN8 A;  3ETR A;  3AB5 A;  1SBB B;  2V3N A;  5AUI A;  1PUT A;  1BUI C;  2PTL A;  1K52 A;  2V3P A;  1V1P A;  2MJE A;  4PT5 A;  1L6U A;  3EA6 A;  2WXR A;  1E9M A;  3E9S A;  1FFU A;  3J9C A;  3SR6 A;  1FRR A;  4KKJ A;  3AE1 B;  1CQV A;  4WAF A;  3NVZ A;  3TEZ A;  1JWM D;  1QOF A;  2WNM A;  3PZ7 A;  1FNU A;  4RF1 A;  2OED A;  1WGK A;  1GPX A;  3ZGZ A;  2PMV A;  2Z8L A;  1QOA A;  1RWS A;  1JML A;  1HA5 A;  1TZO A;  1Q10 A;  1ZDX A;  2ZW0 A;  1MVK A;  1YQ4 B;  4ITK A;  4YT0 B;  1B1Z A;  3ZYY X;  1I4Q A;  1OQQ A;  4XE0 A;  3PO0 A;  1HQR D;  1VDV A;  3AEE B;  2JX5 A;  2WQY B;  2BW2 A;  4N6E B;  3BWU D;  4YSY B;  3EGR A;  1DOI A;  2WXK A;  1STE A;  4YSX B;  2K0P A;  1NEK B;  5HI1 A;  3Q8F A;  1CJE A;  2W3S A;  1K53 A;  4KGT A;  1QLB B;  1N5X A;  3B9J A;  3GP7 A;  2MH7 A;  1ZUD 2;  1FM0 D;  4Q2J A;  4KGR A;  3VQI A;  1JW9 D;  2K5P A;  3W5V B;  2NTT A;  2FUG 1;  1XEE A;  1XLQ A;  2AQ2 B;  2BB5 A;  1NVI D;  4XWT A;  4C7Z A;  2DBY A;  1N5W A;  4YTP B;  2J42 A;  1HXY D;  2G1E A;  2LEK A;  1EWC A;  2JU6 X;  4JPS A;  5TSS A;  3AED B;  1ZP0 B;  2ONQ A;  3WCQ A;  1B9R A;  3HRD D;  4H2A A;  2KMM A;  4YWG G;  1KFY B;  2JYT A;  2GI9 A;  3P4Q B;  2WXJ A;  1ET9 A;  1FNW A;  4RGO S;  2KWD A;  4YSZ B;  1I4P A;  2H89 B;  1JRO A;  2NTS A;  4WH4 A;  3P4R B;  4KGS A;  1K51 A;  3BZD B;  3AEC B;  1UWM A;  1YJJ A;  2E3T A;  5C3J B;  1ET6 A;  2WXO A;  4HEA 1;  2CJO A;  3MC0 B;  2IDY A;  2OHF A;  1R7S A;  3I9V 1;  3AE6 B;  1DYQ A;  1MI0 A;  3U4E G;  2AQ1 B;  2MJD A;  3AMZ A;  5T8I A;  3B2F A;  2TSS A;  2JWU A;  1FXA A;  2WXF A;  1SIJ A;  4A6Q A;  3AE5 B;  1UNS A;  3R2I A;  3HVZ A;  2W54 A;  3AE4 B;  2N7J A;  2N9L A;  1SJE D;  2IGG A;  1L6V A;  1J7A A;  1EM7 A;  3UI3 A;  1Y56 A;  4MT5 A;  3SFD B;  4NZL B;  1JCK B;  4RGT A;  1UUP A;  2LHE A;  4OVZ A;  3ZJU A;  3IXS A;  2IGD A;  2WXM A;  2ACZ B;  2ON8 A;  3NVW A;  2IPK D;  2KQ4 X;  1L5P A;  3CIR B;  1L0V B;  1P7F A;  3KQ4 A;  1N62 A;  3RFZ B;  3ZJV A;  1D5X C;  5JXV A;  5FKA C;  2LHD A;  1QKZ A;  3T3O A;  4IKG A;  2DYM A;  2N9K A;  2WU5 B;  2V0G A;  1IBX A;  1QQR A;  3C8Y A;  1JQ4 A;  3E56 A;  3P42 A;  4M0W A;  1SEB D;  1N61 A;  2B76 B;  4J3O D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...