2PVOD

Crystal srtucture of the ternary complex between thioredoxin f, ferredoxin, and ferredoxin: thioredoxin reductase
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
96
structure length
96
Chain Sequence
ASYTVKLITPDGESSIECSDDTYILDAAEEAGLELPYSCRAGACSTCAGKITAGSVDQSDQSFLDDDQIEAGYVLTCVAYPTSDCTIETHKEEDLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Ferredoxin-thioredoxin reductase, catalytic chain
publication title Structural snapshots along the reaction pathway of ferredoxin-thioredoxin reductase.
pubmed doi rcsb
source organism Synechocystis sp.
total genus 19
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2007-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2pvoD00
1WGKA 4HROA 5C3JB 1DOYA 4ZOHC 3SR6A 4C7ZA 3B2GA 2M56B 2Q5WD 1OQRA 3AEBB 4P6VF 1FXAA 2WU5B 1ZXIA 3AE2B 3AEFB 1QLBB 2WLBA 2KAJA 3AE5B 5AUKA 3KWLA 1AYFA 1XO3A 1FRRA 1J7AA 1XLPA 1VDVA 4JX1C 1NENB 2W55A 3W5VB 1QOFA 1SB3C 2MH7A 2W3SA 1JWBD 3AE7B 3B2FA 3FC4A 2BS3B 5EE3A 2K5PA 1E0ZA 1ROEA 2WDRB 4YXDB 1UWMA 1KRHA 2CJNA 3AE9B 1DOXA 1RM6C 1CZPA 2WS3B 1ZOYB 2WP9B 1KFYB 3LB8C 2PVGC 2Y5CA 3NVWA 2QIEB 1F0ZA 1DOIA 2G1EA 3AE1B 2H89B 1DGJA 3ABVB 2EKIA 3DWMA 1FFVA 3P4PB 3W5UB 1JWAD 4C80A 2HTME 3AMZA 4USAA 2K9XA 3LXFA 5G5HA 1FO4A 1E7PB 3WCQA 2E3TA 3AEGB 1E6EB 4HRSA 3AH7A 4YTPB 1JW9D 1L5PA 1TKEA 1YQ4B 1WRIA 2BS4B 1NYQA 1N5WA 1SF0A 3NVYA 4JWUC 1XLQA 3W9CB 1FIQA 1XLNA 4WWMA 3VRAB 1JQ4A 1N5XA 2WDQB 3P4QB 2AX5A 1PFDA 2CJOA 4ZHOA 3VR8B 2MJ3A 1YJJA 3ZYYX 1L6UA 1VJKA 4KX6B 1GPXA 3AEDB 3BIID 4YT0B 3NRZA 3AE6B 4FXCA 5GXGB 3SFEB 1A70A 2DWQA 4YTNB 2LEKA 1L0VB 3AN1A 4YSYB 3P1MA 5EE9A 2JQRB 1RFKA 1OFFA 1J7CA 4LTUA 4YTMB 2L83A 4N59A 1XLOA 3L4PA 3AE8B 5H8YE 1IUEA 1FXIA 1N63A 3P4RB 1OQQA 2JX5A 1EWYC 1GAQB 1FFUA 1SIJA 2MJEA 4US9A 2KMMA 3AB5A 3NS1A 1V97A 2FBWB 4A9AA 5MPOA 1WWTA 3HUIA 1N62A 3CWIA 3HVZA 1VLBA 2H88B 2WQYB 1QOAA 4IDIA 4YSZB 2N0SB 1TYGB 1YJIA 3AECB 4ZHPA 1RYJA 3RPFC 3AV8A 4YSXB 1NYRA 1R7SA 1CJEA 3AEEB 2MJDA 3ETRA 4JWSC 2PKOA 1NEKB 2W3RA 2W54A 2M19A 1WYGA 3AEAB 1TJEA 3VRBB 2BT6A 2OHFA 3FAHA 1NI3A 1N60A 1YQ3B 1AWDA 1I7HA 1ZP0B 5H92C 3AM9A 3CIRB 3AE3B 1QOBA 1TKGA 5C2TB 1E9MA 2K22A 4WQMA 5AUIA 5EE0A 1T3QA 2ACZB 2PVOD 2WDVB 3B9JA 5EE1A 1QOGA 2PIAA 1NVID 3HRDD 1JROA 3VR9B 1J7BA 1FM0D 1ZUD2 2WU2B 2BS2B 4US8A 2DBYA 4N58A 2L52A 1N61A 1TKYA 1E10A 1V8CA 1QF6A 1JRPA 1KF6B 2CU3A 4C7YA 1PUTA 3P63A 2B76B 3P4SB 1B9RA 1FMAD 3PO0A 3SFDB 1L6VA 1PDXA 1RWSA 2QJLA 3AE4B 3DWGC 1FRDA 5G5GA 3NVVA 4ITKA 4N6EB 1QT9A 3NVZA 1WXQA 1JALA 3EUB2
chains in the Genus database with same CATH superfamily
4F7ZA 4MJSB 4BZAA 3AE2B 2WXFA 2V0GA 2PEAA 4QAYA 1QOFA 3ZJVA 1YD8U 1WJ6A 2K5PA 1M94A 4FJVB 1KLVA 1Z5SB 3WAPA 1DOIA 5HKHA 4FJZA 4USAA 1KTKA 1I4GA 1KM7A 3PREA 4AP4C 4FHJA 1JW9D 4NAWB 2HTHA 3BVGA 2BS4B 1XLQA 2PJHA 3IHPC 1XLNA 1WMHA 1TY2A 3S2AA 4W9EA 2I1KA 2KC1A 3DBSA 4YT0B 2AQ3B 4M8MA 2N7EA 2TSSA 2MX2A 4GSWA 2C7MB 1IUEA 2NCNA 3Q3FA 1SIJA 1GAQB 5BO4B 1K8RB 2IY1B 3VH3B 2H88B 2WQYB 2JXTA 3W1SA 2GBNA 4W9CA 3UQBA 4EE2A 1NYRA 2D3BA 2FAZA 3MHSD 3VH4B 2J53A 2AL3A 3RNFC 3Q8FA 3OJ3A 1RFAA 1J8CA 1YQ3B 3OG5A 4KSKC 1AWDA 3ZNZB 1G6JA 1E5WA 3CIRB 4M02A 1UELA 4NAWA 2WDVB 1TS2A 2WXKA 3HRDD 1FM0D 3SDLC 4N58A 1GC6A 4B0MA 1E10A 2N1WA 1KF6B 3Q14C 4XDDA 3T3OA 1FXTB 2KMCA 3P4SB 2NBVB 5BMHA 1F52A 5HHDG 5C3JB 3H8HA 3QARA 5IKCM 3AI5A 4W9JA 2FCMA 2D5GA 3N32A 1XLPA 2RPVA 2N9LA 4H2AA 1UBQA 4ZHPA 3EHVA 3URYA 1EF5A 3ZTDA 3RFZB 4C4VB 3K9PB 3EA6A 4UDUC 4M8NA 2HTME 4L2YA 1WJ4A 3RUIB 4B9KA 1QKZA 1F77A 3PSEB 3N9YC 4NPNA 4G0NB 2QCZA 2N9EB 3NVYA 4HKZE 1OGWA 1WGHA 4E74A 2BB5A 2JZPA 2K3UA 4WWOA 2WX1A 3N20C 4GU2A 3DVNU 4YSYB 5E6JA 5IN7A 2MBEA 3P4RB 2JX5A 1SE9A 2DAFA 2K25A 2MBHA 4AJWA 3Q3MC 4FBJB 5IOIA 5T8IA 2PKOA 3H7SA 2M19A 4C4VA 2LRWA 4BKTA 3IAS1 2BKRB 2BYFA 4MGIE 4AOFA 3WAMA 5EE0A 4REZA 5BMGA 2BF8B 3KUCB 3L10B 2L52A 3Q3NC 3DBRB 3SFDB 3ZO5B 2KJ6A 1RAXA 2LJIA 2SEBD 5G5GA 4MDKE 5JHAA 2GBRA 4HK2A 2IPKD 1SIFA 2BKFA 4II2B 2HDEA 2C9WB 1I4RA 1XO3A 4JX1C 2LASA 3VUYA 1MI0A 4RCOA 3R3MA 3UIOB 2N1VA 1ROEA 2IGHA 3EFCA 1KRHA 1DYQA 2VH2A 2WWZA 4P1CC 3RNEC 4JE3B 1CMXB 1R4MB 3DHHC 1Q10A 4JL9A 4KZ0A 3IVFA 2PE6B 2DZKA 2ZW1A 3WCQA 1WRDB 1X1MA 2JZZA 2BYTA 3KUDB 2K6QA 1SF0A 2V3NA 3Q6BA 3QX1A 2XN9C 3OAWA 3E56A 3H6NA 3EECA 1OFFA 2ZZPB 4GDLB 4YTMB 3NZSA 3ZIMA 1P3QU 1N63A 5IO9A 1UH6A 1FCLA 3A9KB 1P7FA 1N62A 1E7UA 4IDIA 3FILA 1P1AA 3DQVA 2MBOA 2XEWA 5LXHA 2INDC 2XBBC 2W3RA 3HK0A 5I4DA 2ZPNA 3VRBB 1C4CA 3TEZA 3I57A 4LDTD 2RDBC 5IP4D 2AQ1B 2WX0A 1XF5L 4ICUA 4ZRQA 3UIPB 4FN2A 2IY0B 2KDFB 4WQMA 2PIAA 1EUVB 1J7BA 4US8A 2DBYA 4G50A 3BY4B 2CU3A 4MGZE 5E6OA 3V61A 2L32A 4F1SA 3DWGC 5JHBA 1KOTA 3MFGA 4GDLA 1JALA 1SE2A 1ZXHA 4HROA 4XYCA 1D3ZA 3T9LA 2ONQA 2Q5WD 1PYWD 4W9DA 3KH0A 2Y5BB 4ZRKA 3C0RB 4TQ1A 2GRIA 3AE7B 3B1LX 1E0ZA 3ZTCA 4P16A 1P0RA 2KQSA 2HJ1A 2KXJA 2WP9B 4HPMB 2KLCA 3OWEB 1LGRA 3OJ4B 3VVWB 1WX9A 2NPTA 3QA8A 2WXPA 4KGRA 2Y3AA 2UWQA 3PZ7A 2J0JA 2OJRA 3VHTC 4JWUC 2M17A 3W1SC 3VDZA 3VRAB 4II3B 2WDQB 2BB6A 2JWZA 3SFEB 1YN5A 4A3PA 2GBKA 2MRPA 2DZMA 3NG0A 3RZWC 2DYMA 5D7GA 3MJWA 4X57B 2M4NA 3NS1A 3P2BA 3ZNGC 3IT4B 4DXGA 2N0SB 2RPQA 1WE6A 3QHTA 2K0PA 1GJZA 3R66C 1QQRA 2OEDA 2OHFA 2JT4B 3NOBA 1MHHE 4W9FA 1S1QB 2KJRA 1I35A 2J0MA 5EE1A 4HCNB 1NVID 2N9PC 3IFWB 1WR1A 1YJ1A 1VRAB 3TIXA 3V6EB 4D2KA 4K7WA 5TSSA 1YN4A 2BW2A 4M0WB 5DCNA 3ML9A 1WE7A 4NQLB 2DX5B 5LLIA 4CYEA 1JRUA 2QSDA 1IP9A 2VZKB 1QT9A 5IAAC 3WAOA 2WU5B 3L08A 5AUKA 3ZDTA 4B0EA 4EKUA 4XDCA 3VUXA 1NI2A 2W55A 3C19A 3KYCD 3Q8EA 4A6QA 1ET9A 2W3SA 1WGGA 2LUEA 2MP2A 3SD5A 4W9KA 1JMLA 4ANUA 2FCNA 2NTSA 1XT9B 2PVGC 3U7DA 1D4BA 1STEA 3TSSA 2K9XA 2RGFA 3JSVA 4KGSA 3HM6X 4K7SA 4I6PA 4TUUA 2KDMA 3AEGB 3AH7A 1SE4A 2BWFA 3PVLA 3APDA 2YVCA 1FIQA 2LUMA 3P4QB 1IGCA 3DHGC 4M0WA 1VJKA 4K3CA 3UQAA 2CU1A 2EMTA 3NRZA 3MC0B 3IXSA 2J42A 3DBRI 4YTNB 2JQRB 1H8CA 1TIFA 4KIKB 1YN3A 1XLOA 2WHIA 2KVZA 2DYBA 3RYTA 1UGJA 2KC2A 4PS3A 4A9AA 1TZOA 1D5MC 3BZDB 2QHOA 4DHJD 1V81A 4YSZB 2PE9A 3AU4A 4K3BA 3WA0A 3CSTA 4NJCA 5HFYA 3M95A 1FD6A 1EU3A 4DHZB 3ZDMC 3M63B 1R4MI 4HVBA 4GXBA 4BKGA 1LXDA 1QOBA 1HTOA 4IWPA 4AUQC 2L7RA 2JRHA 2IGDA 4RNAA 1L0XB 1ZKHA 2B3AA 2FUHB 2JVCA 2RMMA 2RDHA 1I4QA 5L95C 4WJPA 3JYUA 1JRPA 2IDYA 3ZNHB 1V1PB 2X38A 2RD0A 1S3SG 2AEHA 3N30A 3TJPA 2MJEA 5LNK1 2IO3B 4GIVA 2CS4A 2CHWA 2G4DB 4PS7A 3AE5B 3I3TB 3A4RA 4CHKA 2BS3B 4YXDB 4MACA 4OVVA 4URKA 3RT3B 4NJ6A 4NY0A 2BVCA 1AN8A 1RM6C 1IBXB 4PS8A 1V1OA 2KOXA 4MELA 2KQ7A 4RGNA 4FJYA 3DHIC 4AS1A 4J3OD 4TQ0A 2V9HA 1V2YA 4L23A 4YWGG 2INPE 3UGBB 2ASQA 4E3CA 1TS4A 3Q3OC 1WFYA 2WXNA 2BQQA 2N9XA 3CMMB 3L0WB 4EZJA 1K50A 1V1PA 3ZYYX 2NBUA 3BIID 3VUWA 5FK9C 5IA7A 3AXCA 4XE0A 5EE9A 2HE7A 4AJYB 3H7PB 4M00A 3AE8B 1P98A 2EMSA 3RZFA 4US9A 1T6BX 3NY5A 1WY8A 5BYSA 2AWTA 2MJDA 1IBXA 3U2SC 4EZKA 4KZCA 1LO5D 2KX3A 5H92C 2V3SA 2G45B 2KZRA 3VAWA 2N7JA 1E9MA 2K22A 4FADA 1E8ZA 3R8BA 2BGFA 4IWQA 3TMPB 2RR9A 1ZUD2 1JWMD 2I38A 4HCPB 5CX3A 4KDIC 3KWVA 5JXVA 1EWCA 2MLBA 2QJLA 4EOYA 2LD9A 5KHQA 1PQSA 2KFKA 3H7PA 3L13A 1ZXIA 4IUMB 1WGYA 2L00B 2QILA 4S0RA 2M1MA 4ANWA 3RI7C 1PGBA 2MH7A 3NHEB 3T3NA 3P42A 2GI9A 4K7UA 2INNE 3LB8C 3HHMA 1M4VA 1VZ6A 2G1EA 1YOVB 2NS5A 1FFVA 2ZEQA 3A33B 4C80A 2REXA 3BWUD 4HJKA 4JGHB 4MEMA 5HG2A 4EUTA 1WRIA 2V1YA 3W9CB 4TKNA 3VR8B 3PHXB 2BPSA 1A70A 4RM8A 2LEKA 3PS6A 2LVQA 1I4XA 2J4XA 5BMIA 2L83A 4RGOS 4KVGB 1SEBD 4N59A 1HZ5A 1XEEA 2LGIA 4XWWA 2KMMA 4LNNA 2WXOA 4RF0A 4RH6A 3HVZA 3PV1A 3R2TA 1MJDA 1ESFA 2NTTA 3AECB 4HPPA 4DHZE 2KJHB 2QMTA 2L3ZA 4HDOA 4KKJA 2LHDA 2N4FA 1D5ZC 4DWFA 5C2TB 4LK0M 4MSMB 2ON8A 4MGYE 1OTRB 4GN1A 1ZDXA 1T0SC 3VFKA 3DPDA 3ONSA 1VR9A 3IG3A 1C4AA 3KQ4A 1JWSD 2B76B 2FIFA 1J19A 1WF9A 4FULA 3WIMA 4B6WA 4N6EB 4Q2JA 3EUB2 1TT5B 2IO1B 2W9NA 3L16A 3ZXRA 3V6CB 4E71A 1LQBA 1FXAA 3RN9C 1AW7A 2C5LC 1LFDA 2KN5A 5KHOA 3W5VB 1GNUA 1SB3C 3B2FA 1MHXA 3BVZA 2WDRB 3PRPB 1UWMA 2V4LA 2OOBB 1L4ZB 4FLHA 1F2RI 1VCBA 1BUIC 2H89B 1ZDVA 3DWMA 5HI1A 3W5UB 2O6VD 1SJED 3LXFA 1IGDA 2BBCA 3ZVVA 2JYTA 2KLGA 3GB1A 3APFA 2KMAA 1F1HA 2L0FA 1JQ4A 4LLGM 1T5XD 2AYOB 3FILB 4BOSC 2JUOA 1GPXA 4KX6B 1FNVA 4FXCA 4ARIA 3TEYA 1UUPA 3ZW3A 4RM9A 3H9DA 2NVUI 1EU4A 2GB1A 4K1RB 3VTWA 2MSED 2KTRA 2R61A 1JCKB 1MPEA 4RFBA 4LJOB 1I4HA 2GBMA 3DDCB 1OEYJ 3IBEA 3MJ5A 1CQVA 1SGHA 2MBQA 4WWNA 1NBFC 3NUHB 1ZP0B 2LGSA 4A20A 2IJ0A 4I6NB 5AUIA 4BBNF 2HJ8A 5C1ZA 2WU2B 4ANXA 5CHWA 3ZJUA 1F2RC 2CHZA 3ETRA 1BMLC 2DENB 3TEXA 4LNOA 4WJNA 4LDTB 1WM2A 2NPTB 2M8SA 2JRIB 1UBIA 1EM7A 2WDTB 3PRMB 2DAJA 3FC4A 3EGRA 1GOZA 3UINB 3UI3A 2JZ3B 4WIPA 4OZAA 1ZE3D 2KYWA 1ET6A 2EKIA 3AMZA 2KACA 1T0QC 1V49A 2RDGA 1L5PA 1MG8A 3TCAA 3PHWB 3U4EG 1UGMA 4MH0E 2LVOA 1YJJA 3PLVA 4FA6A 2MW5A 3MC9A 1VD2A 1J7CA 2J0KA 2LXAA 4ZRJA 5H8YE 2WXIA 2EELA 1MFWA 4NNJB 4OVUA 5DPRA 3PZDA 3GZNB 2GOWA 4JWSC 4GB9A 2INCC 1QILA 3U8ZA 2PLPA 2R2OA 2MHJA 4PYZA 1XCTL 1SXTA 3B9JA 1E8YA 5J18A 1N61A 2ZPYA 1YX6B 2KD0A 2MP2B 3ALBA 3WALA 3NVZA 3RD2A 2WXQA 3DBLB 3ZNID 1DOYA 3SR6A 4MSQB 1HEZE 3JSVB 2DNFA 3V62A 2L0TA 2IO2B 1J7AA 1L0YB 2KWCA 5CHFA 3QAQA 1JWBD 1V80A 5EE3A 4CO7A 2JU6X 2CJNA 3RCZA 3C8YA 5DPSA 2CHXA 1J0GA 3NVWA 2Y5CA 3H1UA 4KV2A 1DGJA 3ABVB 5AZGA 2KDEB 2KWUB 4MM3B 3X23A 4HRSA 1SBBB 4JIOU 3KVFB 1GC7A 1IYFA 4MGKE 3GE3C 1WR6E 1YNTE 4RGTA 2K8HA 3AE6B 1PGXA 4BKSD 3DVNV 3P1MA 3I63C 4PT5A 1MG4A 1FFUA 2LFIA 1V97A 2XNAC 5C23A 3X0WA 5E6NA 3VTUA 3QC8B 1SE3A 1QOAA 4A55A 2L1AA 3AEEB 2WYQA 1NEKB 3ZRCA 1C78A 2IGGA 1TJEA 4ZDVA 2KANA 2BTEA 2C7NB 2KQ4X 5CTRC 1I7HA 4MM3A 2DZJA 1HQRD 2JWUA 3A9JB 2G9HD 2ACZB 2PVOD 4HPLB 1QOGA 3I9V1 2KWVB 3W2DA 2KDIA 4KDLB 1L2NA 2V4IB 1PUTA 1C4PA 1C3TA 4DHJB 1EF1A 1ISNA 3V05A 3AE4B 1RWSA 4PK1A 4ANVA 1WXQA 3IAM1 4ZOHC 4C7ZA 3B2GA 3ML8A 3AEFB 3KWLA 2ZNVB 3MP9A 3K9OB 4NZLB 1WI0A 2XK5B 1R4NB 2KFJA 2I2YA 3SEBA 3AE9B 1DOXA 4ARCA 2Z0EB 4GOCA 2O2VB 1F0ZA 2DZIA 4WURA 4KSLC 3PGEA 1A5RA 3VQIA 3BK1A 1H4RA 3MHZA 1FO4A 1P7EA 3A9JA 3FKYA 4RGMA 3Q8BA 4IWOA 5JZEB 3MTNB 2PW9A 4C00A 4IM0A 1N5XA 3U30A 2CJOA 3U7ZA 2MBBB 1P9DU 1C77A 1WXSA 1WX7A 2M0XA 1L0VB 3ZKJC 4I6LB 1D6EC 4LTUA 2IO0B 3ZGZA 1N6ZA 2HD5B 2D3GA 4J6IA 1EWYC 4S17A 4HXDA 2WXRA 3PT2B 2UU7A 4WAFA 1RLFA 2XK5A 4IM3A 3RPFC 2WXMA 3ZQ4A 4P7IA 4WWPA 3VXWA 4XX5A 1E90A 2O2VA 4FHKA 2ICIA 1GB4A 3FAHA 2EKEC 2KFKB 4A8XC 1UD7A 1IPGA 1XD3B 4K81A 1V6EA 1WIAA 3B0AA 1T3QA 4OW0A 1WGRA 2K6DB 4OHJA 3V3XA 2BS2B 1V8CA 4XWTA 1UNSA 1WJUA 4HLEA 1B9RA 1FRDA 2PMVA 3NVVA 1WGKA 3TUOA 5AZHA 4P6VF 2LVPA 3D32A 3CSFA 1HXYD 1NENB 1Q5WB 1ACCA 2UYZB 3GZNI 4M01A 3BYYB 3ECIA 2PTLA 1ZOYB 2WXLA 1KFYB 1WSPA 3AULA 2L05A 3AE1B 4NAMA 4MJSA 4BBNC 1JWAD 2J7QB 5G5HA 4AWJA 4GDKB 2GMIC 4YTPB 4ASWC 1Z2MA 1YQ4B 1B1ZA 1OQYA 5AEKB 3MC8A 2KVRA 3J9CA 3RNAC 3APCA 4ZRPA 4L1BA 3GE8C 1L6UA 1HE8A 3PTFC 4EEWA 2LI5A 2NBWB 4W9GA 2LMCA 3A4SC 3KYDD 1RFKA 2VRRB 3QIJA 5J2RA 5D6JB 1TS3A 5E6PA 2G4SA 3DBLI 3GP7A 2JF5A 3AB5A 2W82A 2NR2A 2ZCCA 1VLBA 1YMHE 2KO3A 3N3KB 2D3AA 3R7RA 3PZ8A 4R3DA 1CJEA 1VZ8A 2YLMA 4LNFA 1C76A 4DXAB 3EC8A 3SHQA 1V5OA 3RNGC 5J17A 4ZYNA 1TTNA 3E9SA 4GDKA 4EZLA 3AE3B 2Y5PA 3M62B 4LCDE 2D11A 2K1FA 4EFOA 3QK0A 5D3DA 5AZFA 2PPHA 1QF6A 3GOEA 2A4ZA 2LHEA 1WXAA 1PDXA 4JLCA 2LJ5A 5FR3A 4XZ4A 1WZ3A 1OQRA 1AARA 4B95A 1UF0A 1WH3A 2IZVB 2WLBA 1FRRA 2JSVX 1TGZB 3M3JA 5G55A 5FKAC 1JWUD 3TL5A 4IC7B 5BYRA 2RSUA 5D94A 3NS8A 2GBJA 3T8MA 4HWIB 2KKCA 4JQWC 2KN4A 3R7QA 2Z0DB 2DYOA 4ZRIA 1UZXB 2L76A 3OLMD 3GS2A 2E3TA 2KTRB 1F9JA 4BOZB 2C7HA 1NYQA 1D5XC 2AQ2B 4HJGE 1U4AA 1PFDA 3ENEA 2MJ3A 4O1NA 3R2IA 3SU8X 4DK5A 2KDBA 2N9KA 3L17A 5GXGB 4WAAA 4NJ7A 2LGYA 2QC8A 2FCSA 4GLSC 3ZLZA 2LZ6A 4WQOB 3DCGA 3L4PA 4DBGA 2IBIB 1FXIA 2VH1A 3KW5B 1Q1OA 3W1YA 1Y8RC 3LDZE 4IW0A 2O6VB 1E7VA 2FIDA 3DBHB 3VTVA 3BK2A 1RYJA 1HA5A 4YL8A 4MH8A 3PRZA 2M0AA 1R4NI 1YIWA 3AEAB 2K39A 2AL6A 2N7DA 4A3OA 1NDDA 3AM9A 1TS5A 4TSSA 2KTFA 3VR9B 5CHVC 4IG7B 3LYYA 4DDID 1ZGUB 1EO6A 2Z8LA 3RULA 1ZW7A 2D2QA 3JVZX 2KWDA 1I4PA 3U52E 2K8CA 4IKGA 2BYEA 4G3XB 4ITKA 3ZXVA 4AQ7A 4KGTA 1GUAB 3DVGY 2LGXA 2M56B 3DOWA 3IT6B 3QCAA 2KAJA 2I1JA 2O6VA 4PYUA 2QDFA 1BXTA 1RRBA 2WS3B 4W9IA 2QIEB 2ZCBA 2JPHA 5FR6A 2GLSA 3P4PB 2A5UA 2WXGA 1E7PB 2R2QA 1E6EB 2ZNVC 2ZW0A 4DXFA 1FNWA 2L8JA 2WGSA 2JXXA 1KH0A 4WWMA 3TEWA 3NZ3A 3JW0X 2NMQA 3Q8AA 4G11A 4NQKE 3AN1A 4ZYSA 2IYDB 1GG3A 4OZCA 4XC2A 4MT5A 4OVZA 4TMAB 2KT7A 1FPYA 2X8XX 4TV3A 2C60A 1QZEA 2D07B 2FBWB 4LNKA 1T0YA 3HUIA 3I5JC 1WM3A 3RNCC 3EFUA 1XQQA 4BAXA 2JYEA 2V3PA 1YJIA 2WXHA 3RNBC 4YSXB 3BVMA 2FUG1 4GMVA 3NZUA 2W54A 1WYGA 1WJNA 3HIZA 3PPAA 1NI3A 1BT0A 1SJHD 1K52A 2KK8A 4WJQA 3A9KA 1JROA 3N1XC 3BYTB 2WXJA 3NJTA 1TKYA 4XGAB 1K51A 3N1YC 3RMKC 2CKHB 1KJTA 3UF8A 2DLBA 1WZ0A 3O13A 1E8WA 3N1ZC 3Q3JA 3ZUNA 1GB1A 2OJWA 4LJPB 2JY6A 4WH4A 1HZ6A 4ACFA 1QLBB 1WGDA 1VDVA 2D10A 3ZJTA 1L4DB 3Q8CA 3Q69A 2ZVNA 3HM3A 1TZ1A 5LXIB 2E6XA 3ZRFA 3KUZA 4BFRA 1KLUD 2LWPA 1CK1A 2DHZA 2FCQA 1N5WA 5BYQA 2FNJB 1XXGA 2Z59B 3AU5A 2AX5A 2SAKA 2QEJC 1VZ7A 3DVGX 3TBLD 4HEA1 1C9FA 2G3QB 4IM2A 1TY0A 1MVKA 3V60A 5D3IB 3CF6E 2D3CA 1OQQA 5D2MB 1XCQL 3HVDA 1L7YA 3CWIA 4HKQA 2MWSB 1WYWB 2VZKD 3BINA 1C1YB 2BYVE 1N60A 1LM8B 4W9LA 1Y56A 1V5TA 3LJ3A 5GMVA 2FE8A 2KX0A 2J52A 3L54A 4WJOA 1V86A 1FCCC 1V9JA 2BWES 3O65B 4DDGD 1OEYA 1FNUA 2WNMA 3KLSX 4ICVA 4RMAA 4C7YA 4W9HA 4N9F4 1FMAD 1WXMA 2MA9B 5JH5C 4CQNA 3AEBB 4JPSA 3QQ8B 4IOIE 1AYFA 3A1QB 5TR5A 4HDQA 3QJZA 3PLUA 3QWZB 2ZJDA 2KNBA 5DPTA 1HTQA 1ZPSA 4BVUC 1CZPA 3DBHI 1T0RC 4F8CB 4P1BC 5DPWA 1SSNA 4OZBA 4A90A 4BKSA 2MCNB 1KLGD 4GGQA 4KKIA 1FEHA 1TKEA 2LGDA 1I42A 2CR5A 1C79A 1PGAA 2LXCA 4ZHOA 1K53A 2LRUA 3AEDB 5G2NA 2DWQA 5EDSA 2YEPF 2K8BA 4RF1A 1ENFA 5MPOA 1WWTA 3A1QA 1Q0WB 2MQJA 1TYGB 1UWXA 3WANA 1TBEA 3AV8A 1R7SA 1WX8A 4C56C 4DQOC 1WXVA 2BT6A 2MEKA 2YEPB 4KIKA 3Q2AC 1E8XA 1TKGA 1YX5B 3B08A 2KHWB 5L83A 4LNIA 1WMHB 2ZVOA 1YQBA 3P63A 3PO0A 1L6VA
chains in the Genus database with same CATH topology
1BMLC 3TEXA 1OQRA 2WU5B 5AUKA 3AE2B 4B0EA 2WLBA 2WXFA 4XDCA 2V0GA 1FRRA 2W55A 1EM7A 3Q8EA 4A6QA 2JSVX 1QOFA 1ET9A 2W3SA 3FC4A 3ZJVA 2K5PA 3EGRA 1JMLA 5FKAC 1GOZA 1JWUD 5BYRA 3UI3A 4WIPA 2NTSA 4OZAA 1ZE3D 2PVGC 1ET6A 1DOIA 1D4BA 2KN4A 2EKIA 1STEA 3TSSA 4USAA 1KTKA 2DYOA 3AMZA 2K9XA 2KACA 1I4GA 4KGSA 3GS2A 2E3TA 2KDMA 3AEGB 3AH7A 1SE4A 1JW9D 2RDGA 1L5PA 4NAWB 3BVGA 2BS4B 1NYQA 1D5XC 2AQ2B 4HJGE 1XLQA 3U4EG 1FIQA 1XLNA 2LUMA 3P4QB 1IGCA 1PFDA 2MJ3A 4M0WA 1TY2A 1YJJA 3R2IA 4O1NA 1VJKA 4YT0B 2N9KA 3NRZA 5GXGB 3MC0B 2AQ3B 3IXSA 2J42A 4YTNB 2JQRB 1J7CA 2TSSA 4GLSC 1YN3A 1XLOA 3L4PA 5H8YE 1IUEA 1FXIA 2WXIA 2EELA 1GAQB 1SIJA 1UGJA 4A9AA 1TZOA 1D5MC 3BZDB 2H88B 2WQYB 2JXTA 4YSZB 3W1SA 3BK2A 1RYJA 1HA5A 4MH8A 4EE2A 1NYRA 4JWSC 2M0AA 4NJCA 2J53A 5HFYA 3Q8FA 3AEAB 1FD6A 1EU3A 1QILA 2PLPA 1YQ3B 1AWDA 3AM9A 3CIRB 1QOBA 1TS5A 1XCTL 4TSSA 1SXTA 2WDVB 1TS2A 2WXKA 3B9JA 2IGDA 4RNAA 1L0XB 3VR9B 3HRDD 3LYYA 1FM0D 2RMMA 2RDHA 1I4QA 4N58A 2Z8LA 4B0MA 1N61A 1E10A 1JRPA 2IDYA 1KF6B 2KWDA 4XDDA 1I4PA 1V1PB 2X38A 3T3OA 3P4SB 3U52E 4IKGA 4ITKA 4AQ7A 2MJEA 3NVZA 5LNK1 5BMHA 4KGTA 5HHDG 5C3JB 2WXQA 1DOYA 3H8HA 3SR6A 1HEZE 2M56B 3IT6B 2KAJA 3AE5B 2D5GA 1J7AA 1L0YB 1XLPA 2RPVA 2N9LA 4H2AA 4ZHPA 1JWBD 5EE3A 3URYA 2BS3B 4YXDB 2JU6X 4MACA 2CJNA 1BXTA 1AN8A 1RM6C 3C8YA 2WS3B 3RFZB 3NVWA 2Y5CA 1IBXB 2QIEB 3EA6A 1V1OA 4UDUC 1DGJA 3ABVB 3P4PB 4RGNA 4L2YA 2HTME 4MM3B 1QKZA 4J3OD 2WXGA 4TQ0A 4AS1A 1F77A 1E7PB 4HRSA 1SBBB 1E6EB 3N9YC 4L23A 2ZW0A 4YWGG 2INPE 1FNWA 4DXFA 3NVYA 4HKZE 1KH0A 1TS4A 2BB5A 4WWMA 2JZPA 2WXNA 3TEWA 1YNTE 2K3UA 1K50A 1V1PA 3ZYYX 3BIID 3NZ3A 2NMQA 4RGTA 5FK9C 3Q8AA 3AE6B 4XE0A 1PGXA 3AN1A 4ZYSA 4YSYB 3P1MA 5EE9A 4OZCA 5E6JA 3AE8B 4MT5A 3P4RB 4OVZA 4PT5A 4TMAB 2JX5A 1FFUA 2LFIA 4US9A 1T6BX 1V97A 2FBWB 2XNAC 3HUIA 1SE3A 5BYSA 1QOAA 2JYEA 2V3PA 1YJIA 2WXHA 4A55A 2L1AA 4YSXB 3AEEB 2FUG1 2MJDA 3BVMA 2PKOA 5T8IA 1NEKB 2W54A 1C78A 1IBXA 2M19A 1WYGA 3U2SC 2IGGA 1TJEA 1LO5D 2BTEA 1NI3A 3IAS1 2KQ4X 1SJHD 1I7HA 5H92C 1K52A 2N7JA 1E9MA 1HQRD 2K22A 2JWUA 2G9HD 3R8BA 5EE0A 4REZA 2ACZB 2PVOD 5BMGA 1QOGA 3I9V1 1JROA 3W2DA 1ZUD2 1JWMD 3BYTB 2I38A 2WXJA 2L52A 1TKYA 2V4IB 1PUTA 1C4PA 1K51A 3KWVA 5JXVA 1EWCA 3SFDB 3V05A 1RWSA 2QJLA 2LJIA 2SEBD 3AE4B 5G5GA 2DLBA 1WXQA 3O13A 3IAM1 1GB1A 4ZOHC 4C7ZA 3B2GA 2IPKD 4WH4A 1HZ6A 1ZXIA 2HDEA 3AEFB 1QLBB 2QILA 3KWLA 1I4RA 1XO3A 3MP9A 1VDVA 4JX1C 1MI0A 4NZLB 4RCOA 1PGBA 2MH7A 3ZJTA 1L4DB 3Q8CA 1ROEA 2IGHA 2I2YA 1KRHA 3SEBA 3AE9B 3P42A 1DYQA 2GI9A 3T3NA 3Q69A 1DOXA 4ARCA 2INNE 3LB8C 4JE3B 1M4VA 1F0ZA 1VZ6A 2G1EA 2E6XA 1Q10A 4WURA 1FFVA 4C80A 3VQIA 3BK1A 3MHZA 1FO4A 1KLUD 1P7EA 2ZW1A 3WCQA 1CK1A 3BWUD 4RGMA 2BYTA 3Q8BA 5HG2A 1WRIA 1SF0A 1N5WA 3W9CB 5BYQA 2PW9A 2V3NA 1N5XA 1XXGA 2AX5A 2SAKA 2CJOA 3VR8B 2XN9C 2QEJC 1VZ7A 3U7ZA 1C77A 3E56A 4HEA1 1C9FA 1A70A 2LEKA 1L0VB 1OFFA 1D6EC 1I4XA 1TY0A 2J4XA 4GDLB 2L83A 1MVKA 4LTUA 4RGOS 5D3IB 4YTMB 5BMIA 3ZGZA 1SEBD 4N59A 1HZ5A 1N63A 1OQQA 1XEEA 1EWYC 2LGIA 4XWWA 1FCLA 2KMMA 2WXRA 1XCQL 2WXOA 3HVDA 1P7FA 4RF0A 4RH6A 3HVZA 1N62A 3CWIA 3R2TA 4WAFA 4IDIA 4HKQA 1ESFA 2NTTA 3FILA 3AECB 3RPFC 2WXMA 2VZKD 3ZQ4A 2QMTA 2W3RA 5I4DA 3VRBB 1C4CA 4KKJA 3TEZA 2LHDA 2ICIA 3I57A 3FAHA 1GB4A 4A8XC 1N60A 1Y56A 1D5ZC 2AQ1B 1XF5L 5C2TB 4LK0M 2ON8A 4ZRQA 4WQMA 1T3QA 2FE8A 4OW0A 1ZDXA 2PIAA 2J52A 1J7BA 4OHJA 1FCCC 3V3XA 2BS2B 4US8A 2DBYA 1VR9A 1FNUA 2WNMA 1C4AA 1V8CA 3KLSX 4XWTA 1UNSA 2CU3A 4C7YA 3KQ4A 1JWSD 2B76B 1B9RA 2L32A 1FMAD 3DWGC 1FRDA 2PMVA 3NVVA 4N6EB 3MFGA 1SE2A 1ZXHA 1JALA 3EUB2 4Q2JA 1WGKA 4HROA 2ONQA 3TUOA 4CQNA 2Q5WD 3AEBB 1PYWD 4P6VF 1FXAA 4JPSA 1AW7A 4IOIE 1AYFA 1HXYD 1NENB 4TQ1A 2GRIA 3W5VB 1ACCA 1SB3C 3AE7B 1MHXA 3B2FA 3BVZA 4P16A 1E0ZA 2WDRB 1UWMA 1ZPSA 3BYYB 1CZPA 2PTLA 1ZOYB 2WP9B 1L4ZB 1KFYB 1WSPA 2WXLA 1F2RI 1BUIC 3AE1B 2H89B 4NAMA 3OWEB 1ZDVA 1SSNA 4OZBA 3DWMA 5HI1A 3W5UB 1JWAD 4A90A 1SJED 3LXFA 1IGDA 1KLGD 5G5HA 2BBCA 4GDKB 4KKIA 2JYTA 3GB1A 2WXPA 4KGRA 2Y3AA 1FEHA 3PZ7A 4YTPB 1TKEA 1YQ4B 1B1ZA 4JWUC 1C79A 1PGAA 3VRAB 1JQ4A 4LLGM 1T5XD 2WDQB 2BB6A 3J9CA 4ZHOA 4ZRPA 4L1BA 1K53A 3FILB 1GPXA 1L6UA 4KX6B 3AEDB 1FNVA 4FXCA 3SFEB 4ARIA 1YN5A 2DWQA 2LMCA 3TEYA 1UUPA 1RFKA 1TS3A 1EU4A 2GB1A 2DYMA 2YEPF 5D7GA 2R61A 4RF1A 1ENFA 3GP7A 1JCKB 1MPEA 4RFBA 3AB5A 3NS1A 1I4HA 2W82A 5MPOA 1WWTA 3IT4B 1VLBA 1YMHE 4DXGA 2N0SB 1TYGB 1UWXA 3MJ5A 3PZ8A 3AV8A 4R3DA 1R7SA 1CJEA 1VZ8A 4C56C 2K0PA 1QQRA 2OEDA 1CQVA 4DQOC 2BT6A 2MEKA 1C76A 2OHFA 2YEPB 3NUHB 1MHHE 1ZP0B 3E9SA 3AE3B 1TKGA 2Y5PA 2IJ0A 5AUIA 5EE1A 1NVID 2WU2B 1VRAB 3ZJUA 5D3DA 1F2RC 4D2KA 1QF6A 5TSSA 1YN4A 2BW2A 3P63A 2LHEA 3PO0A 1L6VA 1PDXA 2QSDA 2VZKB 1QT9A 5FR3A 3ETRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WGK A;  4HRO A;  5C3J B;  1DOY A;  4ZOH C;  3SR6 A;  4C7Z A;  3B2G A;  2M56 B;  2Q5W D;  1OQR A;  3AEB B;  4P6V F;  1FXA A;  2WU5 B;  1ZXI A;  3AE2 B;  3AEF B;  1QLB B;  2WLB A;  2KAJ A;  3AE5 B;  5AUK A;  3KWL A;  1AYF A;  1XO3 A;  1FRR A;  1J7A A;  1XLP A;  1VDV A;  4JX1 C;  1NEN B;  2W55 A;  3W5V B;  1QOF A;  1SB3 C;  2MH7 A;  2W3S A;  1JWB D;  3AE7 B;  3B2F A;  3FC4 A;  2BS3 B;  5EE3 A;  2K5P A;  1E0Z A;  1ROE A;  2WDR B;  4YXD B;  1UWM A;  1KRH A;  2CJN A;  3AE9 B;  1DOX A;  1RM6 C;  1CZP A;  2WS3 B;  1ZOY B;  2WP9 B;  1KFY B;  3LB8 C;  2PVG C;  2Y5C A;  3NVW A;  2QIE B;  1F0Z A;  1DOI A;  2G1E A;  3AE1 B;  2H89 B;  1DGJ A;  3ABV B;  2EKI A;  3DWM A;  1FFV A;  3P4P B;  3W5U B;  1JWA D;  4C80 A;  2HTM E;  3AMZ A;  4USA A;  2K9X A;  3LXF A;  5G5H A;  1FO4 A;  1E7P B;  3WCQ A;  2E3T A;  3AEG B;  1E6E B;  4HRS A;  3AH7 A;  4YTP B;  1JW9 D;  1L5P A;  1TKE A;  1YQ4 B;  1WRI A;  2BS4 B;  1NYQ A;  1N5W A;  1SF0 A;  3NVY A;  4JWU C;  1XLQ A;  3W9C B;  1FIQ A;  1XLN A;  4WWM A;  3VRA B;  1JQ4 A;  1N5X A;  2WDQ B;  3P4Q B;  2AX5 A;  1PFD A;  2CJO A;  4ZHO A;  3VR8 B;  2MJ3 A;  1YJJ A;  3ZYY X;  1L6U A;  1VJK A;  4KX6 B;  1GPX A;  3AED B;  3BII D;  4YT0 B;  3NRZ A;  3AE6 B;  4FXC A;  5GXG B;  3SFE B;  1A70 A;  2DWQ A;  4YTN B;  2LEK A;  1L0V B;  3AN1 A;  4YSY B;  3P1M A;  5EE9 A;  2JQR B;  1RFK A;  1OFF A;  1J7C A;  4LTU A;  4YTM B;  2L83 A;  4N59 A;  1XLO A;  3L4P A;  3AE8 B;  5H8Y E;  1IUE A;  1FXI A;  1N63 A;  3P4R B;  1OQQ A;  2JX5 A;  1EWY C;  1GAQ B;  1FFU A;  1SIJ A;  2MJE A;  4US9 A;  2KMM A;  3AB5 A;  3NS1 A;  1V97 A;  2FBW B;  4A9A A;  5MPO A;  1WWT A;  3HUI A;  1N62 A;  3CWI A;  3HVZ A;  1VLB A;  2H88 B;  2WQY B;  1QOA A;  4IDI A;  4YSZ B;  2N0S B;  1TYG B;  1YJI A;  3AEC B;  4ZHP A;  1RYJ A;  3RPF C;  3AV8 A;  4YSX B;  1NYR A;  1R7S A;  1CJE A;  3AEE B;  2MJD A;  3ETR A;  4JWS C;  2PKO A;  1NEK B;  2W3R A;  2W54 A;  2M19 A;  1WYG A;  3AEA B;  1TJE A;  3VRB B;  2BT6 A;  2OHF A;  3FAH A;  1NI3 A;  1N60 A;  1YQ3 B;  1AWD A;  1I7H A;  1ZP0 B;  5H92 C;  3AM9 A;  3CIR B;  3AE3 B;  1QOB A;  1TKG A;  5C2T B;  1E9M A;  2K22 A;  4WQM A;  5AUI A;  5EE0 A;  1T3Q A;  2ACZ B;  2PVO D;  2WDV B;  3B9J A;  5EE1 A;  1QOG A;  2PIA A;  1NVI D;  3HRD D;  1JRO A;  3VR9 B;  1J7B A;  1FM0 D;  1ZUD 2;  2WU2 B;  2BS2 B;  4US8 A;  2DBY A;  4N58 A;  2L52 A;  1N61 A;  1TKY A;  1E10 A;  1V8C A;  1QF6 A;  1JRP A;  1KF6 B;  2CU3 A;  4C7Y A;  1PUT A;  3P63 A;  2B76 B;  3P4S B;  1B9R A;  1FMA D;  3PO0 A;  3SFD B;  1L6V A;  1PDX A;  1RWS A;  2QJL A;  3AE4 B;  3DWG C;  1FRD A;  5G5G A;  3NVV A;  4ITK A;  4N6E B;  1QT9 A;  3NVZ A;  1WXQ A;  1JAL A;  3EUB 2; 
#chains in the Genus database with same CATH topology
 4F7Z A;  4MJS B;  4BZA A;  3AE2 B;  2WXF A;  2V0G A;  2PEA A;  4QAY A;  1QOF A;  3ZJV A;  1YD8 U;  1WJ6 A;  2K5P A;  1M94 A;  4FJV B;  1KLV A;  1Z5S B;  3WAP A;  1DOI A;  5HKH A;  4FJZ A;  4USA A;  1KTK A;  1I4G A;  1KM7 A;  3PRE A;  4AP4 C;  4FHJ A;  1JW9 D;  4NAW B;  2HTH A;  3BVG A;  2BS4 B;  1XLQ A;  2PJH A;  3IHP C;  1XLN A;  1WMH A;  1TY2 A;  3S2A A;  4W9E A;  2I1K A;  2KC1 A;  3DBS A;  4YT0 B;  2AQ3 B;  4M8M A;  2N7E A;  2TSS A;  2MX2 A;  4GSW A;  2C7M B;  1IUE A;  2NCN A;  3Q3F A;  1SIJ A;  1GAQ B;  5BO4 B;  1K8R B;  2IY1 B;  3VH3 B;  2H88 B;  2WQY B;  2JXT A;  3W1S A;  2GBN A;  4W9C A;  3UQB A;  4EE2 A;  1NYR A;  2D3B A;  2FAZ A;  3MHS D;  3VH4 B;  2J53 A;  2AL3 A;  3RNF C;  3Q8F A;  3OJ3 A;  1RFA A;  1J8C A;  1YQ3 B;  3OG5 A;  4KSK C;  1AWD A;  3ZNZ B;  1G6J A;  1E5W A;  3CIR B;  4M02 A;  1UEL A;  4NAW A;  2WDV B;  1TS2 A;  2WXK A;  3HRD D;  1FM0 D;  3SDL C;  4N58 A;  1GC6 A;  4B0M A;  1E10 A;  2N1W A;  1KF6 B;  3Q14 C;  4XDD A;  3T3O A;  1FXT B;  2KMC A;  3P4S B;  2NBV B;  5BMH A;  1F52 A;  5HHD G;  5C3J B;  3H8H A;  3QAR A;  5IKC M;  3AI5 A;  4W9J A;  2FCM A;  2D5G A;  3N32 A;  1XLP A;  2RPV A;  2N9L A;  4H2A A;  1UBQ A;  4ZHP A;  3EHV A;  3URY A;  1EF5 A;  3ZTD A;  3RFZ B;  4C4V B;  3K9P B;  3EA6 A;  4UDU C;  4M8N A;  2HTM E;  4L2Y A;  1WJ4 A;  3RUI B;  4B9K A;  1QKZ A;  1F77 A;  3PSE B;  3N9Y C;  4NPN A;  4G0N B;  2QCZ A;  2N9E B;  3NVY A;  4HKZ E;  1OGW A;  1WGH A;  4E74 A;  2BB5 A;  2JZP A;  2K3U A;  4WWO A;  2WX1 A;  3N20 C;  4GU2 A;  3DVN U;  4YSY B;  5E6J A;  5IN7 A;  2MBE A;  3P4R B;  2JX5 A;  1SE9 A;  2DAF A;  2K25 A;  2MBH A;  4AJW A;  3Q3M C;  4FBJ B;  5IOI A;  5T8I A;  2PKO A;  3H7S A;  2M19 A;  4C4V A;  2LRW A;  4BKT A;  3IAS 1;  2BKR B;  2BYF A;  4MGI E;  4AOF A;  3WAM A;  5EE0 A;  4REZ A;  5BMG A;  2BF8 B;  3KUC B;  3L10 B;  2L52 A;  3Q3N C;  3DBR B;  3SFD B;  3ZO5 B;  2KJ6 A;  1RAX A;  2LJI A;  2SEB D;  5G5G A;  4MDK E;  5JHA A;  2GBR A;  4HK2 A;  2IPK D;  1SIF A;  2BKF A;  4II2 B;  2HDE A;  2C9W B;  1I4R A;  1XO3 A;  4JX1 C;  2LAS A;  3VUY A;  1MI0 A;  4RCO A;  3R3M A;  3UIO B;  2N1V A;  1ROE A;  2IGH A;  3EFC A;  1KRH A;  1DYQ A;  2VH2 A;  2WWZ A;  4P1C C;  3RNE C;  4JE3 B;  1CMX B;  1R4M B;  3DHH C;  1Q10 A;  4JL9 A;  4KZ0 A;  3IVF A;  2PE6 B;  2DZK A;  2ZW1 A;  3WCQ A;  1WRD B;  1X1M A;  2JZZ A;  2BYT A;  3KUD B;  2K6Q A;  1SF0 A;  2V3N A;  3Q6B A;  3QX1 A;  2XN9 C;  3OAW A;  3E56 A;  3H6N A;  3EEC A;  1OFF A;  2ZZP B;  4GDL B;  4YTM B;  3NZS A;  3ZIM A;  1P3Q U;  1N63 A;  5IO9 A;  1UH6 A;  1FCL A;  3A9K B;  1P7F A;  1N62 A;  1E7U A;  4IDI A;  3FIL A;  1P1A A;  3DQV A;  2MBO A;  2XEW A;  5LXH A;  2IND C;  2XBB C;  2W3R A;  3HK0 A;  5I4D A;  2ZPN A;  3VRB B;  1C4C A;  3TEZ A;  3I57 A;  4LDT D;  2RDB C;  5IP4 D;  2AQ1 B;  2WX0 A;  1XF5 L;  4ICU A;  4ZRQ A;  3UIP B;  4FN2 A;  2IY0 B;  2KDF B;  4WQM A;  2PIA A;  1EUV B;  1J7B A;  4US8 A;  2DBY A;  4G50 A;  3BY4 B;  2CU3 A;  4MGZ E;  5E6O A;  3V61 A;  2L32 A;  4F1S A;  3DWG C;  5JHB A;  1KOT A;  3MFG A;  4GDL A;  1JAL A;  1SE2 A;  1ZXH A;  4HRO A;  4XYC A;  1D3Z A;  3T9L A;  2ONQ A;  2Q5W D;  1PYW D;  4W9D A;  3KH0 A;  2Y5B B;  4ZRK A;  3C0R B;  4TQ1 A;  2GRI A;  3AE7 B;  3B1L X;  1E0Z A;  3ZTC A;  4P16 A;  1P0R A;  2KQS A;  2HJ1 A;  2KXJ A;  2WP9 B;  4HPM B;  2KLC A;  3OWE B;  1LGR A;  3OJ4 B;  3VVW B;  1WX9 A;  2NPT A;  3QA8 A;  2WXP A;  4KGR A;  2Y3A A;  2UWQ A;  3PZ7 A;  2J0J A;  2OJR A;  3VHT C;  4JWU C;  2M17 A;  3W1S C;  3VDZ A;  3VRA B;  4II3 B;  2WDQ B;  2BB6 A;  2JWZ A;  3SFE B;  1YN5 A;  4A3P A;  2GBK A;  2MRP A;  2DZM A;  3NG0 A;  3RZW C;  2DYM A;  5D7G A;  3MJW A;  4X57 B;  2M4N A;  3NS1 A;  3P2B A;  3ZNG C;  3IT4 B;  4DXG A;  2N0S B;  2RPQ A;  1WE6 A;  3QHT A;  2K0P A;  1GJZ A;  3R66 C;  1QQR A;  2OED A;  2OHF A;  2JT4 B;  3NOB A;  1MHH E;  4W9F A;  1S1Q B;  2KJR A;  1I35 A;  2J0M A;  5EE1 A;  4HCN B;  1NVI D;  2N9P C;  3IFW B;  1WR1 A;  1YJ1 A;  1VRA B;  3TIX A;  3V6E B;  4D2K A;  4K7W A;  5TSS A;  1YN4 A;  2BW2 A;  4M0W B;  5DCN A;  3ML9 A;  1WE7 A;  4NQL B;  2DX5 B;  5LLI A;  4CYE A;  1JRU A;  2QSD A;  1IP9 A;  2VZK B;  1QT9 A;  5IAA C;  3WAO A;  2WU5 B;  3L08 A;  5AUK A;  3ZDT A;  4B0E A;  4EKU A;  4XDC A;  3VUX A;  1NI2 A;  2W55 A;  3C19 A;  3KYC D;  3Q8E A;  4A6Q A;  1ET9 A;  2W3S A;  1WGG A;  2LUE A;  2MP2 A;  3SD5 A;  4W9K A;  1JML A;  4ANU A;  2FCN A;  2NTS A;  1XT9 B;  2PVG C;  3U7D A;  1D4B A;  1STE A;  3TSS A;  2K9X A;  2RGF A;  3JSV A;  4KGS A;  3HM6 X;  4K7S A;  4I6P A;  4TUU A;  2KDM A;  3AEG B;  3AH7 A;  1SE4 A;  2BWF A;  3PVL A;  3APD A;  2YVC A;  1FIQ A;  2LUM A;  3P4Q B;  1IGC A;  3DHG C;  4M0W A;  1VJK A;  4K3C A;  3UQA A;  2CU1 A;  2EMT A;  3NRZ A;  3MC0 B;  3IXS A;  2J42 A;  3DBR I;  4YTN B;  2JQR B;  1H8C A;  1TIF A;  4KIK B;  1YN3 A;  1XLO A;  2WHI A;  2KVZ A;  2DYB A;  3RYT A;  1UGJ A;  2KC2 A;  4PS3 A;  4A9A A;  1TZO A;  1D5M C;  3BZD B;  2QHO A;  4DHJ D;  1V81 A;  4YSZ B;  2PE9 A;  3AU4 A;  4K3B A;  3WA0 A;  3CST A;  4NJC A;  5HFY A;  3M95 A;  1FD6 A;  1EU3 A;  4DHZ B;  3ZDM C;  3M63 B;  1R4M I;  4HVB A;  4GXB A;  4BKG A;  1LXD A;  1QOB A;  1HTO A;  4IWP A;  4AUQ C;  2L7R A;  2JRH A;  2IGD A;  4RNA A;  1L0X B;  1ZKH A;  2B3A A;  2FUH B;  2JVC A;  2RMM A;  2RDH A;  1I4Q A;  5L95 C;  4WJP A;  3JYU A;  1JRP A;  2IDY A;  3ZNH B;  1V1P B;  2X38 A;  2RD0 A;  1S3S G;  2AEH A;  3N30 A;  3TJP A;  2MJE A;  5LNK 1;  2IO3 B;  4GIV A;  2CS4 A;  2CHW A;  2G4D B;  4PS7 A;  3AE5 B;  3I3T B;  3A4R A;  4CHK A;  2BS3 B;  4YXD B;  4MAC A;  4OVV A;  4URK A;  3RT3 B;  4NJ6 A;  4NY0 A;  2BVC A;  1AN8 A;  1RM6 C;  1IBX B;  4PS8 A;  1V1O A;  2KOX A;  4MEL A;  2KQ7 A;  4RGN A;  4FJY A;  3DHI C;  4AS1 A;  4J3O D;  4TQ0 A;  2V9H A;  1V2Y A;  4L23 A;  4YWG G;  2INP E;  3UGB B;  2ASQ A;  4E3C A;  1TS4 A;  3Q3O C;  1WFY A;  2WXN A;  2BQQ A;  2N9X A;  3CMM B;  3L0W B;  4EZJ A;  1K50 A;  1V1P A;  3ZYY X;  2NBU A;  3BII D;  3VUW A;  5FK9 C;  5IA7 A;  3AXC A;  4XE0 A;  5EE9 A;  2HE7 A;  4AJY B;  3H7P B;  4M00 A;  3AE8 B;  1P98 A;  2EMS A;  3RZF A;  4US9 A;  1T6B X;  3NY5 A;  1WY8 A;  5BYS A;  2AWT A;  2MJD A;  1IBX A;  3U2S C;  4EZK A;  4KZC A;  1LO5 D;  2KX3 A;  5H92 C;  2V3S A;  2G45 B;  2KZR A;  3VAW A;  2N7J A;  1E9M A;  2K22 A;  4FAD A;  1E8Z A;  3R8B A;  2BGF A;  4IWQ A;  3TMP B;  2RR9 A;  1ZUD 2;  1JWM D;  2I38 A;  4HCP B;  5CX3 A;  4KDI C;  3KWV A;  5JXV A;  1EWC A;  2MLB A;  2QJL A;  4EOY A;  2LD9 A;  5KHQ A;  1PQS A;  2KFK A;  3H7P A;  3L13 A;  1ZXI A;  4IUM B;  1WGY A;  2L00 B;  2QIL A;  4S0R A;  2M1M A;  4ANW A;  3RI7 C;  1PGB A;  2MH7 A;  3NHE B;  3T3N A;  3P42 A;  2GI9 A;  4K7U A;  2INN E;  3LB8 C;  3HHM A;  1M4V A;  1VZ6 A;  2G1E A;  1YOV B;  2NS5 A;  1FFV A;  2ZEQ A;  3A33 B;  4C80 A;  2REX A;  3BWU D;  4HJK A;  4JGH B;  4MEM A;  5HG2 A;  4EUT A;  1WRI A;  2V1Y A;  3W9C B;  4TKN A;  3VR8 B;  3PHX B;  2BPS A;  1A70 A;  4RM8 A;  2LEK A;  3PS6 A;  2LVQ A;  1I4X A;  2J4X A;  5BMI A;  2L83 A;  4RGO S;  4KVG B;  1SEB D;  4N59 A;  1HZ5 A;  1XEE A;  2LGI A;  4XWW A;  2KMM A;  4LNN A;  2WXO A;  4RF0 A;  4RH6 A;  3HVZ A;  3PV1 A;  3R2T A;  1MJD A;  1ESF A;  2NTT A;  3AEC B;  4HPP A;  4DHZ E;  2KJH B;  2QMT A;  2L3Z A;  4HDO A;  4KKJ A;  2LHD A;  2N4F A;  1D5Z C;  4DWF A;  5C2T B;  4LK0 M;  4MSM B;  2ON8 A;  4MGY E;  1OTR B;  4GN1 A;  1ZDX A;  1T0S C;  3VFK A;  3DPD A;  3ONS A;  1VR9 A;  3IG3 A;  1C4A A;  3KQ4 A;  1JWS D;  2B76 B;  2FIF A;  1J19 A;  1WF9 A;  4FUL A;  3WIM A;  4B6W A;  4N6E B;  4Q2J A;  3EUB 2;  1TT5 B;  2IO1 B;  2W9N A;  3L16 A;  3ZXR A;  3V6C B;  4E71 A;  1LQB A;  1FXA A;  3RN9 C;  1AW7 A;  2C5L C;  1LFD A;  2KN5 A;  5KHO A;  3W5V B;  1GNU A;  1SB3 C;  3B2F A;  1MHX A;  3BVZ A;  2WDR B;  3PRP B;  1UWM A;  2V4L A;  2OOB B;  1L4Z B;  4FLH A;  1F2R I;  1VCB A;  1BUI C;  2H89 B;  1ZDV A;  3DWM A;  5HI1 A;  3W5U B;  2O6V D;  1SJE D;  3LXF A;  1IGD A;  2BBC A;  3ZVV A;  2JYT A;  2KLG A;  3GB1 A;  3APF A;  2KMA A;  1F1H A;  2L0F A;  1JQ4 A;  4LLG M;  1T5X D;  2AYO B;  3FIL B;  4BOS C;  2JUO A;  1GPX A;  4KX6 B;  1FNV A;  4FXC A;  4ARI A;  3TEY A;  1UUP A;  3ZW3 A;  4RM9 A;  3H9D A;  2NVU I;  1EU4 A;  2GB1 A;  4K1R B;  3VTW A;  2MSE D;  2KTR A;  2R61 A;  1JCK B;  1MPE A;  4RFB A;  4LJO B;  1I4H A;  2GBM A;  3DDC B;  1OEY J;  3IBE A;  3MJ5 A;  1CQV A;  1SGH A;  2MBQ A;  4WWN A;  1NBF C;  3NUH B;  1ZP0 B;  2LGS A;  4A20 A;  2IJ0 A;  4I6N B;  5AUI A;  4BBN F;  2HJ8 A;  5C1Z A;  2WU2 B;  4ANX A;  5CHW A;  3ZJU A;  1F2R C;  2CHZ A;  3ETR A;  1BML C;  2DEN B;  3TEX A;  4LNO A;  4WJN A;  4LDT B;  1WM2 A;  2NPT B;  2M8S A;  2JRI B;  1UBI A;  1EM7 A;  2WDT B;  3PRM B;  2DAJ A;  3FC4 A;  3EGR A;  1GOZ A;  3UIN B;  3UI3 A;  2JZ3 B;  4WIP A;  4OZA A;  1ZE3 D;  2KYW A;  1ET6 A;  2EKI A;  3AMZ A;  2KAC A;  1T0Q C;  1V49 A;  2RDG A;  1L5P A;  1MG8 A;  3TCA A;  3PHW B;  3U4E G;  1UGM A;  4MH0 E;  2LVO A;  1YJJ A;  3PLV A;  4FA6 A;  2MW5 A;  3MC9 A;  1VD2 A;  1J7C A;  2J0K A;  2LXA A;  4ZRJ A;  5H8Y E;  2WXI A;  2EEL A;  1MFW A;  4NNJ B;  4OVU A;  5DPR A;  3PZD A;  3GZN B;  2GOW A;  4JWS C;  4GB9 A;  2INC C;  1QIL A;  3U8Z A;  2PLP A;  2R2O A;  2MHJ A;  4PYZ A;  1XCT L;  1SXT A;  3B9J A;  1E8Y A;  5J18 A;  1N61 A;  2ZPY A;  1YX6 B;  2KD0 A;  2MP2 B;  3ALB A;  3WAL A;  3NVZ A;  3RD2 A;  2WXQ A;  3DBL B;  3ZNI D;  1DOY A;  3SR6 A;  4MSQ B;  1HEZ E;  3JSV B;  2DNF A;  3V62 A;  2L0T A;  2IO2 B;  1J7A A;  1L0Y B;  2KWC A;  5CHF A;  3QAQ A;  1JWB D;  1V80 A;  5EE3 A;  4CO7 A;  2JU6 X;  2CJN A;  3RCZ A;  3C8Y A;  5DPS A;  2CHX A;  1J0G A;  3NVW A;  2Y5C A;  3H1U A;  4KV2 A;  1DGJ A;  3ABV B;  5AZG A;  2KDE B;  2KWU B;  4MM3 B;  3X23 A;  4HRS A;  1SBB B;  4JIO U;  3KVF B;  1GC7 A;  1IYF A;  4MGK E;  3GE3 C;  1WR6 E;  1YNT E;  4RGT A;  2K8H A;  3AE6 B;  1PGX A;  4BKS D;  3DVN V;  3P1M A;  3I63 C;  4PT5 A;  1MG4 A;  1FFU A;  2LFI A;  1V97 A;  2XNA C;  5C23 A;  3X0W A;  5E6N A;  3VTU A;  3QC8 B;  1SE3 A;  1QOA A;  4A55 A;  2L1A A;  3AEE B;  2WYQ A;  1NEK B;  3ZRC A;  1C78 A;  2IGG A;  1TJE A;  4ZDV A;  2KAN A;  2BTE A;  2C7N B;  2KQ4 X;  5CTR C;  1I7H A;  4MM3 A;  2DZJ A;  1HQR D;  2JWU A;  3A9J B;  2G9H D;  2ACZ B;  2PVO D;  4HPL B;  1QOG A;  3I9V 1;  2KWV B;  3W2D A;  2KDI A;  4KDL B;  1L2N A;  2V4I B;  1PUT A;  1C4P A;  1C3T A;  4DHJ B;  1EF1 A;  1ISN A;  3V05 A;  3AE4 B;  1RWS A;  4PK1 A;  4ANV A;  1WXQ A;  3IAM 1;  4ZOH C;  4C7Z A;  3B2G A;  3ML8 A;  3AEF B;  3KWL A;  2ZNV B;  3MP9 A;  3K9O B;  4NZL B;  1WI0 A;  2XK5 B;  1R4N B;  2KFJ A;  2I2Y A;  3SEB A;  3AE9 B;  1DOX A;  4ARC A;  2Z0E B;  4GOC A;  2O2V B;  1F0Z A;  2DZI A;  4WUR A;  4KSL C;  3PGE A;  1A5R A;  3VQI A;  3BK1 A;  1H4R A;  3MHZ A;  1FO4 A;  1P7E A;  3A9J A;  3FKY A;  4RGM A;  3Q8B A;  4IWO A;  5JZE B;  3MTN B;  2PW9 A;  4C00 A;  4IM0 A;  1N5X A;  3U30 A;  2CJO A;  3U7Z A;  2MBB B;  1P9D U;  1C77 A;  1WXS A;  1WX7 A;  2M0X A;  1L0V B;  3ZKJ C;  4I6L B;  1D6E C;  4LTU A;  2IO0 B;  3ZGZ A;  1N6Z A;  2HD5 B;  2D3G A;  4J6I A;  1EWY C;  4S17 A;  4HXD A;  2WXR A;  3PT2 B;  2UU7 A;  4WAF A;  1RLF A;  2XK5 A;  4IM3 A;  3RPF C;  2WXM A;  3ZQ4 A;  4P7I A;  4WWP A;  3VXW A;  4XX5 A;  1E90 A;  2O2V A;  4FHK A;  2ICI A;  1GB4 A;  3FAH A;  2EKE C;  2KFK B;  4A8X C;  1UD7 A;  1IPG A;  1XD3 B;  4K81 A;  1V6E A;  1WIA A;  3B0A A;  1T3Q A;  4OW0 A;  1WGR A;  2K6D B;  4OHJ A;  3V3X A;  2BS2 B;  1V8C A;  4XWT A;  1UNS A;  1WJU A;  4HLE A;  1B9R A;  1FRD A;  2PMV A;  3NVV A;  1WGK A;  3TUO A;  5AZH A;  4P6V F;  2LVP A;  3D32 A;  3CSF A;  1HXY D;  1NEN B;  1Q5W B;  1ACC A;  2UYZ B;  3GZN I;  4M01 A;  3BYY B;  3ECI A;  2PTL A;  1ZOY B;  2WXL A;  1KFY B;  1WSP A;  3AUL A;  2L05 A;  3AE1 B;  4NAM A;  4MJS A;  4BBN C;  1JWA D;  2J7Q B;  5G5H A;  4AWJ A;  4GDK B;  2GMI C;  4YTP B;  4ASW C;  1Z2M A;  1YQ4 B;  1B1Z A;  1OQY A;  5AEK B;  3MC8 A;  2KVR A;  3J9C A;  3RNA C;  3APC A;  4ZRP A;  4L1B A;  3GE8 C;  1L6U A;  1HE8 A;  3PTF C;  4EEW A;  2LI5 A;  2NBW B;  4W9G A;  2LMC A;  3A4S C;  3KYD D;  1RFK A;  2VRR B;  3QIJ A;  5J2R A;  5D6J B;  1TS3 A;  5E6P A;  2G4S A;  3DBL I;  3GP7 A;  2JF5 A;  3AB5 A;  2W82 A;  2NR2 A;  2ZCC A;  1VLB A;  1YMH E;  2KO3 A;  3N3K B;  2D3A A;  3R7R A;  3PZ8 A;  4R3D A;  1CJE A;  1VZ8 A;  2YLM A;  4LNF A;  1C76 A;  4DXA B;  3EC8 A;  3SHQ A;  1V5O A;  3RNG C;  5J17 A;  4ZYN A;  1TTN A;  3E9S A;  4GDK A;  4EZL A;  3AE3 B;  2Y5P A;  3M62 B;  4LCD E;  2D11 A;  2K1F A;  4EFO A;  3QK0 A;  5D3D A;  5AZF A;  2PPH A;  1QF6 A;  3GOE A;  2A4Z A;  2LHE A;  1WXA A;  1PDX A;  4JLC A;  2LJ5 A;  5FR3 A;  4XZ4 A;  1WZ3 A;  1OQR A;  1AAR A;  4B95 A;  1UF0 A;  1WH3 A;  2IZV B;  2WLB A;  1FRR A;  2JSV X;  1TGZ B;  3M3J A;  5G55 A;  5FKA C;  1JWU D;  3TL5 A;  4IC7 B;  5BYR A;  2RSU A;  5D94 A;  3NS8 A;  2GBJ A;  3T8M A;  4HWI B;  2KKC A;  4JQW C;  2KN4 A;  3R7Q A;  2Z0D B;  2DYO A;  4ZRI A;  1UZX B;  2L76 A;  3OLM D;  3GS2 A;  2E3T A;  2KTR B;  1F9J A;  4BOZ B;  2C7H A;  1NYQ A;  1D5X C;  2AQ2 B;  4HJG E;  1U4A A;  1PFD A;  3ENE A;  2MJ3 A;  4O1N A;  3R2I A;  3SU8 X;  4DK5 A;  2KDB A;  2N9K A;  3L17 A;  5GXG B;  4WAA A;  4NJ7 A;  2LGY A;  2QC8 A;  2FCS A;  4GLS C;  3ZLZ A;  2LZ6 A;  4WQO B;  3DCG A;  3L4P A;  4DBG A;  2IBI B;  1FXI A;  2VH1 A;  3KW5 B;  1Q1O A;  3W1Y A;  1Y8R C;  3LDZ E;  4IW0 A;  2O6V B;  1E7V A;  2FID A;  3DBH B;  3VTV A;  3BK2 A;  1RYJ A;  1HA5 A;  4YL8 A;  4MH8 A;  3PRZ A;  2M0A A;  1R4N I;  1YIW A;  3AEA B;  2K39 A;  2AL6 A;  2N7D A;  4A3O A;  1NDD A;  3AM9 A;  1TS5 A;  4TSS A;  2KTF A;  3VR9 B;  5CHV C;  4IG7 B;  3LYY A;  4DDI D;  1ZGU B;  1EO6 A;  2Z8L A;  3RUL A;  1ZW7 A;  2D2Q A;  3JVZ X;  2KWD A;  1I4P A;  3U52 E;  2K8C A;  4IKG A;  2BYE A;  4G3X B;  4ITK A;  3ZXV A;  4AQ7 A;  4KGT A;  1GUA B;  3DVG Y;  2LGX A;  2M56 B;  3DOW A;  3IT6 B;  3QCA A;  2KAJ A;  2I1J A;  2O6V A;  4PYU A;  2QDF A;  1BXT A;  1RRB A;  2WS3 B;  4W9I A;  2QIE B;  2ZCB A;  2JPH A;  5FR6 A;  2GLS A;  3P4P B;  2A5U A;  2WXG A;  1E7P B;  2R2Q A;  1E6E B;  2ZNV C;  2ZW0 A;  4DXF A;  1FNW A;  2L8J A;  2WGS A;  2JXX A;  1KH0 A;  4WWM A;  3TEW A;  3NZ3 A;  3JW0 X;  2NMQ A;  3Q8A A;  4G11 A;  4NQK E;  3AN1 A;  4ZYS A;  2IYD B;  1GG3 A;  4OZC A;  4XC2 A;  4MT5 A;  4OVZ A;  4TMA B;  2KT7 A;  1FPY A;  2X8X X;  4TV3 A;  2C60 A;  1QZE A;  2D07 B;  2FBW B;  4LNK A;  1T0Y A;  3HUI A;  3I5J C;  1WM3 A;  3RNC C;  3EFU A;  1XQQ A;  4BAX A;  2JYE A;  2V3P A;  1YJI A;  2WXH A;  3RNB C;  4YSX B;  3BVM A;  2FUG 1;  4GMV A;  3NZU A;  2W54 A;  1WYG A;  1WJN A;  3HIZ A;  3PPA A;  1NI3 A;  1BT0 A;  1SJH D;  1K52 A;  2KK8 A;  4WJQ A;  3A9K A;  1JRO A;  3N1X C;  3BYT B;  2WXJ A;  3NJT A;  1TKY A;  4XGA B;  1K51 A;  3N1Y C;  3RMK C;  2CKH B;  1KJT A;  3UF8 A;  2DLB A;  1WZ0 A;  3O13 A;  1E8W A;  3N1Z C;  3Q3J A;  3ZUN A;  1GB1 A;  2OJW A;  4LJP B;  2JY6 A;  4WH4 A;  1HZ6 A;  4ACF A;  1QLB B;  1WGD A;  1VDV A;  2D10 A;  3ZJT A;  1L4D B;  3Q8C A;  3Q69 A;  2ZVN A;  3HM3 A;  1TZ1 A;  5LXI B;  2E6X A;  3ZRF A;  3KUZ A;  4BFR A;  1KLU D;  2LWP A;  1CK1 A;  2DHZ A;  2FCQ A;  1N5W A;  5BYQ A;  2FNJ B;  1XXG A;  2Z59 B;  3AU5 A;  2AX5 A;  2SAK A;  2QEJ C;  1VZ7 A;  3DVG X;  3TBL D;  4HEA 1;  1C9F A;  2G3Q B;  4IM2 A;  1TY0 A;  1MVK A;  3V60 A;  5D3I B;  3CF6 E;  2D3C A;  1OQQ A;  5D2M B;  1XCQ L;  3HVD A;  1L7Y A;  3CWI A;  4HKQ A;  2MWS B;  1WYW B;  2VZK D;  3BIN A;  1C1Y B;  2BYV E;  1N60 A;  1LM8 B;  4W9L A;  1Y56 A;  1V5T A;  3LJ3 A;  5GMV A;  2FE8 A;  2KX0 A;  2J52 A;  3L54 A;  4WJO A;  1V86 A;  1FCC C;  1V9J A;  2BWE S;  3O65 B;  4DDG D;  1OEY A;  1FNU A;  2WNM A;  3KLS X;  4ICV A;  4RMA A;  4C7Y A;  4W9H A;  4N9F 4;  1FMA D;  1WXM A;  2MA9 B;  5JH5 C;  4CQN A;  3AEB B;  4JPS A;  3QQ8 B;  4IOI E;  1AYF A;  3A1Q B;  5TR5 A;  4HDQ A;  3QJZ A;  3PLU A;  3QWZ B;  2ZJD A;  2KNB A;  5DPT A;  1HTQ A;  1ZPS A;  4BVU C;  1CZP A;  3DBH I;  1T0R C;  4F8C B;  4P1B C;  5DPW A;  1SSN A;  4OZB A;  4A90 A;  4BKS A;  2MCN B;  1KLG D;  4GGQ A;  4KKI A;  1FEH A;  1TKE A;  2LGD A;  1I42 A;  2CR5 A;  1C79 A;  1PGA A;  2LXC A;  4ZHO A;  1K53 A;  2LRU A;  3AED B;  5G2N A;  2DWQ A;  5EDS A;  2YEP F;  2K8B A;  4RF1 A;  1ENF A;  5MPO A;  1WWT A;  3A1Q A;  1Q0W B;  2MQJ A;  1TYG B;  1UWX A;  3WAN A;  1TBE A;  3AV8 A;  1R7S A;  1WX8 A;  4C56 C;  4DQO C;  1WXV A;  2BT6 A;  2MEK A;  2YEP B;  4KIK A;  3Q2A C;  1E8X A;  1TKG A;  1YX5 B;  3B08 A;  2KHW B;  5L83 A;  4LNI A;  1WMH B;  2ZVO A;  1YQB A;  3P63 A;  3PO0 A;  1L6V A; 
#chains in the Genus database with same CATH homology
 1BML C;  3TEX A;  1OQR A;  2WU5 B;  5AUK A;  3AE2 B;  4B0E A;  2WLB A;  2WXF A;  4XDC A;  2V0G A;  1FRR A;  2W55 A;  1EM7 A;  3Q8E A;  4A6Q A;  2JSV X;  1QOF A;  1ET9 A;  2W3S A;  3FC4 A;  3ZJV A;  2K5P A;  3EGR A;  1JML A;  5FKA C;  1GOZ A;  1JWU D;  5BYR A;  3UI3 A;  4WIP A;  2NTS A;  4OZA A;  1ZE3 D;  2PVG C;  1ET6 A;  1DOI A;  1D4B A;  2KN4 A;  2EKI A;  1STE A;  3TSS A;  4USA A;  1KTK A;  2DYO A;  3AMZ A;  2K9X A;  2KAC A;  1I4G A;  4KGS A;  3GS2 A;  2E3T A;  2KDM A;  3AEG B;  3AH7 A;  1SE4 A;  1JW9 D;  2RDG A;  1L5P A;  4NAW B;  3BVG A;  2BS4 B;  1NYQ A;  1D5X C;  2AQ2 B;  4HJG E;  1XLQ A;  3U4E G;  1FIQ A;  1XLN A;  2LUM A;  3P4Q B;  1IGC A;  1PFD A;  2MJ3 A;  4M0W A;  1TY2 A;  1YJJ A;  3R2I A;  4O1N A;  1VJK A;  4YT0 B;  2N9K A;  3NRZ A;  5GXG B;  3MC0 B;  2AQ3 B;  3IXS A;  2J42 A;  4YTN B;  2JQR B;  1J7C A;  2TSS A;  4GLS C;  1YN3 A;  1XLO A;  3L4P A;  5H8Y E;  1IUE A;  1FXI A;  2WXI A;  2EEL A;  1GAQ B;  1SIJ A;  1UGJ A;  4A9A A;  1TZO A;  1D5M C;  3BZD B;  2H88 B;  2WQY B;  2JXT A;  4YSZ B;  3W1S A;  3BK2 A;  1RYJ A;  1HA5 A;  4MH8 A;  4EE2 A;  1NYR A;  4JWS C;  2M0A A;  4NJC A;  2J53 A;  5HFY A;  3Q8F A;  3AEA B;  1FD6 A;  1EU3 A;  1QIL A;  2PLP A;  1YQ3 B;  1AWD A;  3AM9 A;  3CIR B;  1QOB A;  1TS5 A;  1XCT L;  4TSS A;  1SXT A;  2WDV B;  1TS2 A;  2WXK A;  3B9J A;  2IGD A;  4RNA A;  1L0X B;  3VR9 B;  3HRD D;  3LYY A;  1FM0 D;  2RMM A;  2RDH A;  1I4Q A;  4N58 A;  2Z8L A;  4B0M A;  1N61 A;  1E10 A;  1JRP A;  2IDY A;  1KF6 B;  2KWD A;  4XDD A;  1I4P A;  1V1P B;  2X38 A;  3T3O A;  3P4S B;  3U52 E;  4IKG A;  4ITK A;  4AQ7 A;  2MJE A;  3NVZ A;  5LNK 1;  5BMH A;  4KGT A;  5HHD G;  5C3J B;  2WXQ A;  1DOY A;  3H8H A;  3SR6 A;  1HEZ E;  2M56 B;  3IT6 B;  2KAJ A;  3AE5 B;  2D5G A;  1J7A A;  1L0Y B;  1XLP A;  2RPV A;  2N9L A;  4H2A A;  4ZHP A;  1JWB D;  5EE3 A;  3URY A;  2BS3 B;  4YXD B;  2JU6 X;  4MAC A;  2CJN A;  1BXT A;  1AN8 A;  1RM6 C;  3C8Y A;  2WS3 B;  3RFZ B;  3NVW A;  2Y5C A;  1IBX B;  2QIE B;  3EA6 A;  1V1O A;  4UDU C;  1DGJ A;  3ABV B;  3P4P B;  4RGN A;  4L2Y A;  2HTM E;  4MM3 B;  1QKZ A;  4J3O D;  2WXG A;  4TQ0 A;  4AS1 A;  1F77 A;  1E7P B;  4HRS A;  1SBB B;  1E6E B;  3N9Y C;  4L23 A;  2ZW0 A;  4YWG G;  2INP E;  1FNW A;  4DXF A;  3NVY A;  4HKZ E;  1KH0 A;  1TS4 A;  2BB5 A;  4WWM A;  2JZP A;  2WXN A;  3TEW A;  1YNT E;  2K3U A;  1K50 A;  1V1P A;  3ZYY X;  3BII D;  3NZ3 A;  2NMQ A;  4RGT A;  5FK9 C;  3Q8A A;  3AE6 B;  4XE0 A;  1PGX A;  3AN1 A;  4ZYS A;  4YSY B;  3P1M A;  5EE9 A;  4OZC A;  5E6J A;  3AE8 B;  4MT5 A;  3P4R B;  4OVZ A;  4PT5 A;  4TMA B;  2JX5 A;  1FFU A;  2LFI A;  4US9 A;  1T6B X;  1V97 A;  2FBW B;  2XNA C;  3HUI A;  1SE3 A;  5BYS A;  1QOA A;  2JYE A;  2V3P A;  1YJI A;  2WXH A;  4A55 A;  2L1A A;  4YSX B;  3AEE B;  2FUG 1;  2MJD A;  3BVM A;  2PKO A;  5T8I A;  1NEK B;  2W54 A;  1C78 A;  1IBX A;  2M19 A;  1WYG A;  3U2S C;  2IGG A;  1TJE A;  1LO5 D;  2BTE A;  1NI3 A;  3IAS 1;  2KQ4 X;  1SJH D;  1I7H A;  5H92 C;  1K52 A;  2N7J A;  1E9M A;  1HQR D;  2K22 A;  2JWU A;  2G9H D;  3R8B A;  5EE0 A;  4REZ A;  2ACZ B;  2PVO D;  5BMG A;  1QOG A;  3I9V 1;  1JRO A;  3W2D A;  1ZUD 2;  1JWM D;  3BYT B;  2I38 A;  2WXJ A;  2L52 A;  1TKY A;  2V4I B;  1PUT A;  1C4P A;  1K51 A;  3KWV A;  5JXV A;  1EWC A;  3SFD B;  3V05 A;  1RWS A;  2QJL A;  2LJI A;  2SEB D;  3AE4 B;  5G5G A;  2DLB A;  1WXQ A;  3O13 A;  3IAM 1;  1GB1 A;  4ZOH C;  4C7Z A;  3B2G A;  2IPK D;  4WH4 A;  1HZ6 A;  1ZXI A;  2HDE A;  3AEF B;  1QLB B;  2QIL A;  3KWL A;  1I4R A;  1XO3 A;  3MP9 A;  1VDV A;  4JX1 C;  1MI0 A;  4NZL B;  4RCO A;  1PGB A;  2MH7 A;  3ZJT A;  1L4D B;  3Q8C A;  1ROE A;  2IGH A;  2I2Y A;  1KRH A;  3SEB A;  3AE9 B;  3P42 A;  1DYQ A;  2GI9 A;  3T3N A;  3Q69 A;  1DOX A;  4ARC A;  2INN E;  3LB8 C;  4JE3 B;  1M4V A;  1F0Z A;  1VZ6 A;  2G1E A;  2E6X A;  1Q10 A;  4WUR A;  1FFV A;  4C80 A;  3VQI A;  3BK1 A;  3MHZ A;  1FO4 A;  1KLU D;  1P7E A;  2ZW1 A;  3WCQ A;  1CK1 A;  3BWU D;  4RGM A;  2BYT A;  3Q8B A;  5HG2 A;  1WRI A;  1SF0 A;  1N5W A;  3W9C B;  5BYQ A;  2PW9 A;  2V3N A;  1N5X A;  1XXG A;  2AX5 A;  2SAK A;  2CJO A;  3VR8 B;  2XN9 C;  2QEJ C;  1VZ7 A;  3U7Z A;  1C77 A;  3E56 A;  4HEA 1;  1C9F A;  1A70 A;  2LEK A;  1L0V B;  1OFF A;  1D6E C;  1I4X A;  1TY0 A;  2J4X A;  4GDL B;  2L83 A;  1MVK A;  4LTU A;  4RGO S;  5D3I B;  4YTM B;  5BMI A;  3ZGZ A;  1SEB D;  4N59 A;  1HZ5 A;  1N63 A;  1OQQ A;  1XEE A;  1EWY C;  2LGI A;  4XWW A;  1FCL A;  2KMM A;  2WXR A;  1XCQ L;  2WXO A;  3HVD A;  1P7F A;  4RF0 A;  4RH6 A;  3HVZ A;  1N62 A;  3CWI A;  3R2T A;  4WAF A;  4IDI A;  4HKQ A;  1ESF A;  2NTT A;  3FIL A;  3AEC B;  3RPF C;  2WXM A;  2VZK D;  3ZQ4 A;  2QMT A;  2W3R A;  5I4D A;  3VRB B;  1C4C A;  4KKJ A;  3TEZ A;  2LHD A;  2ICI A;  3I57 A;  3FAH A;  1GB4 A;  4A8X C;  1N60 A;  1Y56 A;  1D5Z C;  2AQ1 B;  1XF5 L;  5C2T B;  4LK0 M;  2ON8 A;  4ZRQ A;  4WQM A;  1T3Q A;  2FE8 A;  4OW0 A;  1ZDX A;  2PIA A;  2J52 A;  1J7B A;  4OHJ A;  1FCC C;  3V3X A;  2BS2 B;  4US8 A;  2DBY A;  1VR9 A;  1FNU A;  2WNM A;  1C4A A;  1V8C A;  3KLS X;  4XWT A;  1UNS A;  2CU3 A;  4C7Y A;  3KQ4 A;  1JWS D;  2B76 B;  1B9R A;  2L32 A;  1FMA D;  3DWG C;  1FRD A;  2PMV A;  3NVV A;  4N6E B;  3MFG A;  1SE2 A;  1ZXH A;  1JAL A;  3EUB 2;  4Q2J A;  1WGK A;  4HRO A;  2ONQ A;  3TUO A;  4CQN A;  2Q5W D;  3AEB B;  1PYW D;  4P6V F;  1FXA A;  4JPS A;  1AW7 A;  4IOI E;  1AYF A;  1HXY D;  1NEN B;  4TQ1 A;  2GRI A;  3W5V B;  1ACC A;  1SB3 C;  3AE7 B;  1MHX A;  3B2F A;  3BVZ A;  4P16 A;  1E0Z A;  2WDR B;  1UWM A;  1ZPS A;  3BYY B;  1CZP A;  2PTL A;  1ZOY B;  2WP9 B;  1L4Z B;  1KFY B;  1WSP A;  2WXL A;  1F2R I;  1BUI C;  3AE1 B;  2H89 B;  4NAM A;  3OWE B;  1ZDV A;  1SSN A;  4OZB A;  3DWM A;  5HI1 A;  3W5U B;  1JWA D;  4A90 A;  1SJE D;  3LXF A;  1IGD A;  1KLG D;  5G5H A;  2BBC A;  4GDK B;  4KKI A;  2JYT A;  3GB1 A;  2WXP A;  4KGR A;  2Y3A A;  1FEH A;  3PZ7 A;  4YTP B;  1TKE A;  1YQ4 B;  1B1Z A;  4JWU C;  1C79 A;  1PGA A;  3VRA B;  1JQ4 A;  4LLG M;  1T5X D;  2WDQ B;  2BB6 A;  3J9C A;  4ZHO A;  4ZRP A;  4L1B A;  1K53 A;  3FIL B;  1GPX A;  1L6U A;  4KX6 B;  3AED B;  1FNV A;  4FXC A;  3SFE B;  4ARI A;  1YN5 A;  2DWQ A;  2LMC A;  3TEY A;  1UUP A;  1RFK A;  1TS3 A;  1EU4 A;  2GB1 A;  2DYM A;  2YEP F;  5D7G A;  2R61 A;  4RF1 A;  1ENF A;  3GP7 A;  1JCK B;  1MPE A;  4RFB A;  3AB5 A;  3NS1 A;  1I4H A;  2W82 A;  5MPO A;  1WWT A;  3IT4 B;  1VLB A;  1YMH E;  4DXG A;  2N0S B;  1TYG B;  1UWX A;  3MJ5 A;  3PZ8 A;  3AV8 A;  4R3D A;  1R7S A;  1CJE A;  1VZ8 A;  4C56 C;  2K0P A;  1QQR A;  2OED A;  1CQV A;  4DQO C;  2BT6 A;  2MEK A;  1C76 A;  2OHF A;  2YEP B;  3NUH B;  1MHH E;  1ZP0 B;  3E9S A;  3AE3 B;  1TKG A;  2Y5P A;  2IJ0 A;  5AUI A;  5EE1 A;  1NVI D;  2WU2 B;  1VRA B;  3ZJU A;  5D3D A;  1F2R C;  4D2K A;  1QF6 A;  5TSS A;  1YN4 A;  2BW2 A;  3P63 A;  2LHE A;  3PO0 A;  1L6V A;  1PDX A;  2QSD A;  2VZK B;  1QT9 A;  5FR3 A;  3ETR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...