2ZEQA

Crystal structure of ubiquitin-like domain of murine parkin
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
78
structure length
78
Chain Sequence
MGMIVFVRFNSSYGFPVEVDSDTSILQLKEVVAKRQGVPADQLRVIFAGKELPNHLTVQNCDLEQQSIVHIVQRPRRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure and molecular dynamics simulation of ubiquitin-like domain of murine parkin
pubmed doi rcsb
source organism Mus musculus
molecule tags Ligase
molecule keywords E3 ubiquitin-protein ligase parkin
total genus 17
structure length 78
sequence length 78
ec nomenclature ec 2.3.2.31: RBR-type E3 ubiquitin transferase.
pdb deposition date 2007-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2zeqA00
2XK5B 3PRPB 4PS8A 2KLCA 1V9JA 2KWCA 4URKA 2JXXA 3EHVA 3VUWA 2O2VA 4IWOA 5JH5C 1P98A 3VTUA 1UH6A 4FULA 3CMMB 2K39A 3H1UA 2IBIB 3EECA 1YD8U 1WR1A 3U8ZA 5CHVC 1RLFA 2UWQA 2ZNVB 3ZNHB 4TQ0A 4IG7B 2J0KA 2NS5A 3JSVB 3VAWA 4GN1A 2KJHB 2DHZA 5D2MB 3RULA 3KH0A 4AJWA 3L13A 2LGYA 2MBQA 2DAFA 4DDID 4WJOA 1GNUA 2G45B 2L0TA 1E7UA 3APCA 4KIKB 1E90A 3P2BA 3D32A 4HCNB 2Z0EB 3B0AA 3OJ4B 4XX5A 3W1YA 4ANUA 4NPNA 1HE8A 2QHOA 2CU1A 4GDLA 4JGHB 2WX0A 4GU2A 5E6NA 3A1QA 4F1SA 4J6IA 1FXTB 2KFKB 1WX7A 2Y5BB 2BKFA 2LVQA 3KVFB 3V6EB 2IO3B 4LJPB 2L0FA 5HKHA 5G55A 4HPMB 4MDKE 2ZCCA 2BGFA 3OJ3A 2JRHA 3ZO5B 1V5TA 3RCZA 1LM8B 2JY6A 4RM9A 5IAAC 3ZTCA 2K25A 3ZLZA 4HCPB 2ASQA 2KJRA 3K9OB 1WR6E 4W9IA 4LJOB 4BFRA 4FHKA 2CR5A 2KWUB 2KOXA 2DX5B 2D3GA 2LJ5A 4W9FA 2RSUA 1WXMA 3KUDB 4K7SA 1V5OA 2MBEA 3TBLD 3X23A 3RYTA 2JRIB 3H7PA 4GB9A 4MSMB 1LQBA 3NOBA 5DPTA 4NAWA 3VVWB 2O6VD 2ZEQA 1EF1A 2JVCA 3W1SA 1CMXB 1Q0WB 2M4NA 3WAMA 2IY1B 4E3CA 1NBFC 4AWJA 3DBSA 4OVVA 4G3XB 4KIKA 5KHOA 2KTFA 2AYOB 3OAWA 3Q3JA 4DHJD 2AEHA 2UYZB 4FADA 3PVLA 4XC2A 1V6EA 4ANWA 3UF8A 4HK2A 4BOSC 4AUQC 2KN5A 2RPQA 4IM2A 3L08A 3ZDMC 2KTRB 3RD2A 3V60A 1UZXB 4W9KA 4ANVA 5E6OA 4N9F4 5AZFA 1JRUA 3AULA 3U7DA 2GBMA 1E8XA 1GG3A 4MJSA 1Y8RC 5LXIB 1H8CA 3ZKJC 3VTWA 3ZNID 3ZW3A 3NZUA 3VH3B 1WGDA 4YL8A 3V62A 2KTRA 2JF5A 1XQQA 1L7YA 2C7MB 2MQJA 2NPTA 3QCAA 4MELA 4PS7A 4DK5A 2JT4B 3SD5A 2BYEA 4II2B 2MX2A 3BINA 3ML9A 2LXCA 4DWFA 2BF8B 1E8ZA 2PJHA 4II3B 2M1MA 4ANXA 4ICVA 3L17A 1GJZA 2WYQA 3WAPA 1C1YB 3WA0A 2KX0A 4DHZB 3IBEA 2IYDB 2VRRB 3O65B 3A9KA 3PHXB 3H9DA 3ZDTA 2D07B 2C9WB 4BKSA 2KLGA 2MW5A 1V81A 1VD2A 3ECIA 2J0MA 2BKRB 4MJSB 1UD7A 3BY4B 1WJUA 2A5UA 4W9LA 2KO3A 1SE9A 1WFYA 2D10A 2Z59B 2KC1A 2RGFA 4NNJB 3R7QA 4BKTA 2KQ7A 1GC7A 3UGBB 3VFKA 4GMVA 5KHQA 3RT3B 4RMAA 3IVFA 3PHWB 2MLBA 3SU8X 3W1SC 1PQSA 1EF5A 2KANA 2KDIA 4A20A 2M17A 1F9JA 5G2NA 4AP4C 1E7VA 1AARA 3CSTA 1E5WA 2REXA 2HD5B 2A4ZA 4W9EA 2GBRA 1WI0A 1ZGUB 4TUUA 2KHWB 2K8BA 3GZNI 3QJZA 4M8NA 3TIXA 3ZTDA 2WWZA 5CTRC 2MP2A 1M94A 2D11A 3CF6E 2FNJB 3LJ3A 4A3PA 3U30A 2Z0DB 3NHEB 4EZLA 2BYFA 2FIFA 2MCNB 3TL5A 3UQAA 1WY8A 1ZW7A 2KJ6A 3ENEA 1S3SG 3PTFC 2N9PC 4RM8A 4ZYNA 2HE7A 2KMAA 2CKHB 2G4DB 1E8YA 2KX3A 1GC6A 2K6QA 3UINB 1EO6A 3M3JA 3DVGY 1NI2A 4K1RB 1T0YA 4HJKA 4JQWC 5FR6A 2NCNA 3QARA 2IO0B 2GMIC 1OEYA 2DZMA 2HJ8A 3K9PB 3PSEB 5AEKB 4NAWB 5JHBA 3S2AA 4E71A 5D7GA 3QA8A 1WH3A 5AZGA 1WXSA 2BPSA 2LRUA 3MJWA 1UBIA 4BKSD 2V3SA 2K6DB 4BKGA 4DDGD 3ZNZB 2ZNVC 3JW0X 4M0WB 4EZJA 5CHWA 5GMVA 2R2QA 2ZCBA 2XEWA 3N32A 3PV1A 4JLCA 1TZ1A 4KVGB 2RR9A 1ISNA 4WQOB 2KZRA 4TKNA 4IM3A 1Z2MA 4G0NB 3QX1A 4M8MA 1WYWB 2FIDA 4GDLB 2NBVB 1WMHB 1OQYA 2D2QA 4ZRIA 2G3QB 2ZVNA 4B6WA 2MP2B 2C60A 3LDZE 3JSVA 2DZKA 4GOCA 1YJ1A 5DPRA 3UIOB 1WX9A 2AL6A 3TJPA 4MGIE 1SGHA 4HDOA 1QZEA 2DYBA 4NJ6A 1WMHA 4PYUA 2KVRA 3QWZB 3ZUNA 1D3ZA 4BBNC 2ZVOA 1IYFA 4K7WA 2OJRA 4DHZE 3WALA 2AL3A 4K81A 4XZ4A 3QHTA 2AWTA 3PRMB 3WAOA 4DXAB 4WJQA 3DOWA 5EDSA 1MG8A 4EOYA 2O6VA 4BBNF 2OOBB 1UBQA 2ZJDA 1WJ6A 4WAAA 5TR5A 4B9KA 4DHJB 1L2NA 2MBHA 1UELA 1WF9A 4AOFA 2DYOA 1WZ3A 2KMCA 4GGQA 3VUYA 4IM0A 2K1FA 3R3MA 3X0WA 4FBJB 4I6NB 2O6VB 2J7QB 2O2VB 4GIVA 4KV2A 4BVUC 2V1YA 2MA9B 4LCDE 4HLEA 3L10B 2N9XA 3A9KB 4MEMA 2NBWB 2W9NA 1TBEA 1XT9B 1GUAB 3WIMA 4LDTD 1IPGA 2KWVB 1OTRB 1WXAA 1SIFA 2L8JA 2N4FA 3A4SC 4HXDA 5DPSA 1WGRA 3A1QB 4MGZE 5JZEB 4KDIC 4KSKC 4BOZB 1WE6A 1VCBA 1S1QB 4HDQA 3QQ8B 3ZRFA 1IP9A 3EFUA 3PGEA 4ZRJA 2FAZA 3NY5A 2IO2B 3A9JB 4GDKA 4FA6A 4KDLB 2C7NB 3RZWC 3A33B 2DENB 3WANA 2V4LA 4HWIB 2I1JA 5CHFA 2DZIA 2EMSA 1WXVA 4FJVB 4FLHA 4MH0E 2L76A 5E6PA 1I42A 2JWZA 5D94A 4F8CB 4NY0A 2ZZPB 3PLVA 4MGKE 4MGYE 3HK0A 3R7RA 2DAJA 4EZKA 4AJYB 1R4MI 2C5LC 4W9DA 4A3OA 1WX8A 2DYMA 1V80A 5BO4B 4CHKA 3DVGX 1OEYJ 5J17A 3T9LA 2I1KA 2L3ZA 3KYCD 2LI5A 2IZVB 3PZDA 1Z5SB 1WGGA 5L83A 1KM7A 2IO1B 2PE9A 5L95C 3N3KB 4X57B 4IUMB 2L7RA 2PEAA 3ZNGC 2LRWA 2R2OA 4PS3A 1XD3B 1P0RA 2PPHA 3M62B 3MTNB 4ZDVA 1OGWA 3A9JA 4WWOA 3A4RA 3RZFA 5DCNA 3V6CB 2ZPYA 1J8CA 2N7EA 1WJ4A 3DVNV 3APFA 3KW5B 4G50A 3VDZA 3H6NA 2KD0A 3JVZX 5LLIA 1V2YA 1KOTA 3L16A 1TTNA 1E8WA 4NQKE 4WWPA 3R66C 2WDTB 3VHTC 2CHWA 2FCMA 3AU4A 4TV3A 3L0WB 2FCNA 1WM2A 1LXDA 1J0GA 2M0XA 2NPTB 3PPAA 3IHPC 2KFKA 3DBRI 4EUTA 2LUEA 3EC8A 4IWPA 3HHMA 4W9JA 1WE7A 2XK5A 3UQBA 5J18A 3GOEA 3T8MA 4MM3A 2N1WA 3HIZA 4CYEA 1WRDB 2G4SA 4E74A 3UIPB 2CS4A 4HVBA 4I6LB 1YQBA 3APDA 1TGZB 3CSFA 3KYDD 4ICUA 5D6JB 2LVPA 3DPDA 2KDFB 4IW0A 4W9CA 2GOWA 4FJZA 4GDKB 4GSWA 2FCSA 3DDCB 4NJ7A 2MSED 3HM3A 3KUZA 1A5RA 2N7DA 3AI5A 4I6PA 2C7HA 3H7PB 2MWSB 3PREA 4FN2A 1Q5WB 2NR2A 5DPWA 2MBBB 4JIOU 3PT2B 1R4NI 2L05A 3NZSA 3H7SA 2IY0B 4KSLC 1RRBA 1YX5B 4HPLB 3SDLC 4EKUA 2FCQA 3AXCA 2K8HA 3IFWB 2NVUI 2KXJA 1X1MA 3DVNU 1ZKHA 2GBNA 4MSQB 3Q3FA 1UGMA 2GBKA 2NBUA 2YLMA 2CHZA 3JYUA 4B95A 4DBGA 3KUCB 4CO7A 1LFDA 1YX6B 1YIWA 2KDBA 2ZPNA 1BT0A 3VH4B 4KZCA 3ZRCA 2M8SA 1P1AA 3QC8B 1P3QU 3N30A 3SHQA 1I35A 3C0RB 3ZVVA 2L00B 1NDDA 4LDTB 1G6JA 3B08A 2KKCA 1WIAA 4G11A 4W9HA 4EFOA 1K8RB 3QIJA 4PYZA 2FUHB 2JPHA 2MBOA 5C23A 5C1ZA 1J19A 1WJNA 4W9GA 2CHXA 5LXHA 1U4AA 4WJNA 3M63B 3ONSA 1V49A 1RFAA 3ML8A 3DBHI 2KC2A 1KLVA 2GBJA 5IA7A 4GXBA 2LD9A 3IG3A 1P9DU 2N9EB 2XBBC 3ZIMA 5JHAA 4P7IA 2KQSA 1WGYA 3DCGA 2BWFA 3TCAA 3VXWA 3QK0A 3NS8A 4IC7B 2KNBA 3B1LX 4NQLB 2JZZA 2B3AA 4ASWC 4WJPA 1V86A 1WM3A 3DBLI 2BWES 2DZJA 3OLMD 3HM6X 2PE6B 2K8CA 3MHSD 3I3TB 3V61A 1Q1OA 2JUOA 3PRZA 3L54A 2MRPA 4JL9A 4IWQA 2EKEC 1RAXA 4WWNA 2LXAA 2WX1A 2BYVE 2LWPA 5J2RA 3VTVA 2JZ3B 4F7ZA 2YVCA 4ZRKA 3PLUA 2LGDA 3ALBA 3M95A 4FJYA 2RD0A 4TQ1A 1C3TA 1WZ0A 3VQIA 2HTHA 2J0JA 3QAQA 1KJTA 4KZ0A 2LVOA 3RUIB 3PS6A 5AZHA 4EEWA 2KDEB 2LGXA 5CX3A 3TMPB 4K7UA 2KK8A 3VUXA 1EUVB 2KFJA 2LZ6A 2N1VA 4FHJA 1H4RA 1WGHA 3AU5A 4OVUA 3DQVA 2EMTA 2LASA
chains in the Genus database with same CATH superfamily
1XF5L 2KWCA 4RF1A 5E6JA 3EHVA 4IWOA 5JH5C 4HKZE 3B2GA 2IBIB 3EECA 1WR1A 1RLFA 2UWQA 3ZNHB 1IGCA 2J0KA 1OQRA 1ZPSA 2DHZA 1XCQL 3RULA 2JZPA 2LGYA 1N61A 1GNUA 2G45B 3Q3MC 1E90A 3D32A 4HCNB 3OJ4B 4NPNA 2N9KA 5E6NA 4GU2A 1SE4A 3MFGA 2Y5BB 2LVQA 3V6EB 2L0FA 5HKHA 4MDKE 1QOGA 2JRHA 1FNWA 4ZHOA 3RCZA 1LM8B 3ZTCA 2K25A 1T5XD 2WXIA 3T3OA 2KJRA 3AE8B 3K9OB 4OW0A 1HTOA 2KOXA 2LJ5A 1ZXHA 2QILA 1DOXA 2LHDA 3AEEB 4MSMB 4C7YA 2ZEQA 3WAMA 1QOAA 4P1CC 1E7PB 4G3XB 2KTFA 3OAWA 2BYTA 3PO0A 3PVLA 1V6EA 3IXSA 1XEEA 3UF8A 3L08A 1UZXB 1B9RA 1YJJA 2WXOA 5AZFA 3EFCA 1ENFA 5LXIB 1HZ6A 3ZW3A 3NZUA 5HI1A 3CIRB 1XQQA 2NPTA 4XDCA 3I9V1 4II2B 3BK2A 3ML9A 4DWFA 2LHEA 1E8ZA 2PJHA 5AUIA 3VRBB 1GJZA 1GB4A 1QOBA 3WA0A 4DHZB 2IYDB 3ZDTA 3A9KA 2D07B 2C9WB 2JXTA 1VD2A 2BKRB 4MJSB 1WJUA 5MPOA 4BKTA 1YMHE 2KQ7A 1GC7A 3UGBB 3VFKA 5HFYA 3AE5B 5KHQA 4RMAA 3V3XA 3SU8X 1ZDXA 1HTQA 2MEKA 3ZYYX 1EF5A 4A20A 1L0YB 2M17A 1T0QC 1E7VA 2H88B 3AE2B 3P63A 3PZ7A 2GBRA 4TUUA 4M8NA 3GZNI 3QJZA 5BMGA 4KX6B 5CTRC 1M94A 1FCCC 4A3PA 3NHEB 4YSZB 2KJ6A 2KX3A 4HJKA 2NCNA 2IO0B 5GXGB 5AEKB 5D7GA 5AZGA 2EELA 3WCQA 1FO4A 1KLUD 2J52A 1E0ZA 1YQ4B 2V3PA 4EZJA 1UWXA 2R2QA 3ZGZA 1TT5B 3C19A 3N32A 4KVGB 1YN3A 2KQ4X 2V9HA 2RR9A 2KZRA 4IM3A 1K52A 3URYA 1VZ8A 2FIDA 4GDLB 1WMHB 3LDZE 2C60A 3JSVA 1YJ1A 1TKGA 2AL6A 2R61A 4MGIE 1ZOYB 4ARIA 4HDOA 2ZVOA 4NAMA 3WALA 4HPPA 2AL3A 1QOFA 3QHTA 4P1BC 5EDSA 2BS3B 2O6VA 2ZJDA 4WAAA 1L2NA 1UELA 4AOFA 1C9FA 4GGQA 1I4QA 1PUTA 2K1FA 3R3MA 3X0WA 2O6VB 3I57A 1TBEA 1XT9B 1GUAB 3RNAC 4B0MA 4ITKA 2XN9C 2KWVB 3ETRA 1OTRB 2N4FA 4RFBA 4HXDA 3A1QB 2M0AA 4KDIC 1WE6A 2QMTA 4JPSA 4ZRJA 1ZE3D 3ZXRA 2BT6A 3AEFB 4KDLB 2C7NB 5D3IB 3A33B 4A6QA 3P4QB 4RGTA 2I1JA 2DZIA 2BS2B 4MH0E 2L76A 5E6PA 2JWZA 3B9JA 4F8CB 1DOIA 3Q8CA 3R8BA 1R4MI 2MH7A 3U2SC 4JWSC 4W9DA 3KYCD 4P6VF 4YWGG 2M56B 2L7RA 5IO9A 3NG0A 1D5ZC 2DLBA 1XD3B 3A9JA 2PKOA 1EWYC 2DBYA 4AS1A 1J8CA 3KW5B 3APFA 4C56C 1BXTA 3EA6A 4WWPA 2RPVA 3R66C 2WDTB 3AU4A 2K9XA 4YTMB 3J9CA 2M0XA 3IHPC 2JYTA 3FILA 2X38A 1SXTA 2JWUA 2LUEA 4IWPA 1ET9A 4W9JA 3I5JC 2XK5A 1N63A 3UQBA 2INDC 3BYTB 4CYEA 1WRDB 1V8CA 4E74A 2CS4A 3IT4B 4HVBA 5D6JB 2LVPA 2JU6X 2KDFB 4IW0A 2FCSA 3DDCB 3HM3A 1AYFA 1JALA 3KUZA 2J53A 3N20C 2C7HA 3H7PB 2MWSB 5DPWA 2MBBB 4JIOU 4KSLC 1UNSA 3Q3OC 2FCQA 3AXCA 3IFWB 1SB3C 3DVNU 4MSQB 1I4GA 2YLMA 4D2KA 3JYUA 4B95A 4DBGA 1FIQA 1YX6B 3B2FA 3TEXA 3C0RB 2L00B 2L32A 1SJHD 3W5UB 2BB6A 1U4AA 3ONSA 3NVWA 1V49A 3DBHI 4N59A 5IA7A 4GXBA 3IG3A 1P9DU 2D3CA 4KGRA 1WGYA 2QIEB 3NS8A 3Q8FA 4NQLB 2W3SA 1V86A 2BWES 3HM6X 1IBXA 2K8CA 3V61A 1Q1OA 2JUOA 2CU3A 1V97A 1C4CA 4JL9A 2Z8LA 1RAXA 2JX5A 4YT0B 3UI3A 2LUMA 4WH4A 3RFZB 2WXJA 2XNAC 3VQIA 2J0JA 5AZHA 2KDEB 3SR6A 2OEDA 3VUXA 1YNTE 3SFDB 1WGHA 2LASA 1YN4A 4XE0A 3BVMA 3PRPB 4PS8A 2KLCA 4CQNA 2W3RA 3VUWA 1P98A 1UH6A 3BVZA 4M02A 3Q8AA 3AE4B 4TQ0A 1TKYA 4GN1A 3T3NA 1BMLC 1UUPA 4AJWA 1ACCA 1E6EB 2ONQA 3L13A 4GLSC 4DDID 1L6VA 4WJOA 1E7UA 4KIKB 3B0AA 4XX5A 3W1YA 1HE8A 2QHOA 2CU1A 2X8XX 4GDLA 3A1QA 4F1SA 4J6IA 1P7FA 1HXYD 4N58A 1C79A 1PDXA 3OJ3A 1MVKA 5IAAC 1DYQA 4W9IA 1Q10A 1YN5A 4BFRA 4FHKA 5FKAC 3DWGC 2D3GA 1WXMA 2MBEA 3PZ8A 3X23A 3BWUD 4GB9A 5DPTA 4NAWA 1EF1A 1T0RC 3R2IA 1CMXB 1Q0WB 3W1SA 2IY1B 3DBSA 4KIKA 2AEHA 4FADA 2ZW1A 4ANWA 4HK2A 1JWUD 1DGJA 2NMQA 2RPQA 4IM2A 2IDYA 3V60A 3AH7A 2G9HD 4A9AA 5E6OA 4DXGA 3AULA 2E3TA 1H8CA 1I4HA 3VH3B 1WGDA 3GE8C 3BYYB 2KTRA 3QCAA 2MQJA 4DK5A 2JT4B 2BYEA 1TJEA 4II3B 2M1MA 3MC8A 3N1YC 3L17A 2MJ3A 1NYRA 3WAPA 1C1YB 1AWDA 3O65B 3PHXB 1UGJA 1V81A 4S0RA 3ECIA 3O13A 3P1MA 1D5XC 1SE9A 4NNJB 2KC1A 1TS3A 1KFYB 3DBHB 4OVZA 3RT3B 2MLBA 2CJOA 4YXDB 2OHFA 1TYGB 4YTPB 1AN8A 1QLBB 1NEKB 4WWMA 3CSTA 2REXA 1F2RI 2HD5B 3TEZA 4K3BA 3ZTDA 3CF6E 2FNJB 2PMVA 2MCNB 3UQAA 1WY8A 1XXGA 2WGSA 1S3SG 2N9PC 3P4SB 4ZYNA 2HE7A 2KMAA 2G4DB 1NI2A 2QCZA 1FNVA 3QARA 1JQ4A 4YSYB 3PSEB 2Q5WD 1FEHA 2ICIA 4E71A 4C7ZA 2BPSA 2LRUA 3MJWA 1UBIA 3GS2A 4M0WB 4M00A 1R4MB 5CHWA 1WYGA 2ZCBA 2WXHA 1GB1A 1LO5D 3NS1A 4WQOB 1Z2MA 4G0NB 2Y5CA 1WYWB 1OQYA 2G3QB 4B0EA 4B6WA 2MP2B 1Y56A 4LNFA 1GPXA 1SGHA 1QZEA 5EE0A 4BBNC 3NVZA 4K81A 2WXFA 4C4VA 1NVID 4XZ4A 4DXAB 2FBWB 1MG8A 1IUEA 3FAHA 2D3AA 3VUYA 1UF0A 4KGSA 4FBJB 4I6NB 2J7QB 2O2VB 4BVUC 2QJLA 4HLEA 1F77A 3L10B 2BVCA 2N9XA 2LGIA 1ZUD2 2WDRB 5BYQA 4LDTD 1IPGA 4HEA1 1WXAA 3A4SC 5JZEB 1WGRA 3H8HA 4MGZE 4S17A 1JCKB 4HDQA 3QQ8B 3ZRFA 2FAZA 1XO3A 3NY5A 2IO2B 3A9JB 2WXGA 4GDKA 5FR3A 3RZWC 1PGBA 2EMSA 1I42A 3Q2AC 4NY0A 4MGKE 3HK0A 3R7RA 5H8YE 1WX8A 5J17A 1OEYJ 2L3ZA 2IZVB 1Z5SB 4TMAB 1WGGA 5L83A 2WLBA 2V3NA 5EE9A 4PS3A 1XLOA 1P0RA 3AE7B 2PPHA 4WWOA 2WDQB 3DHGC 5DCNA 2G1EA 3DVNV 1WJ4A 5LLIA 1KOTA 1E8WA 3SFEB 2V0GA 4QAYA 1CZPA 4M0WA 3NVVA 2CHWA 2FCMA 3LYYA 3L0WB 2FCNA 3AN1A 1HQRD 3NUHB 2LEKA 3IAS1 4EUTA 3KLSX 3FC4A 1FXIA 3AE6B 4Q2JA 3T8MA 2N1WA 2KDMA 3MC9A 1STEA 3UIPB 3P4PB 2K3UA 3KYDD 4ICUA 1C4AA 1HEZE 1V1PB 4GDKB 3HVDA 4GSWA 2MSED 1ET6A 3NVYA 4J3OD 1RWSA 2V4IB 1RRBA 1YX5B 1IGDA 2WXQA 4XWWA 2WU2B 1UGMA 2CHZA 1JMLA 1CJEA 1LFDA 2KDBA 1BT0A 1P1AA 1P3QU 3N30A 3SHQA 4EE2A 3ZVVA 1NDDA 1KTKA 1G6JA 4KGTA 2KKCA 1WIAA 3CWIA 4G11A 4W9HA 3QIJA 3MJ5A 5C1ZA 1J19A 1WJNA 3M63B 3BZDB 3W5VB 4OZCA 5BMIA 3ML8A 4PK1A 3ZIMA 5JHAA 4P7IA 2VZKB 3DCGA 2BWFA 3VXWA 2GI9A 2KNBA 4ZYSA 3GP7A 2LMCA 3DBLI 2PE6B 3PRZA 1F2RC 1TZOA 2W54A 2MRPA 1D5MC 1TY2A 3ZJUA 4WWNA 1SIJA 2Y3AA 2BYVE 2LWPA 5J2RA 3AMZA 4KKJA 4F7ZA 2YVCA 3PLUA 4FJYA 1SE2A 2DNFA 4TQ1A 2QSDA 3AEAB 4YSXB 3DBRB 3PS6A 3MC0B 2LGXA 3TMPB 3L4PA 2LZ6A 4NZLB 4FHJA 3AU5A 4A90A 3DQVA 2XK5B 2TSSA 2VZKD 4URKA 1TY0A 3VTUA 4FULA 3ZJVA 3DHHC 4BAXA 2K39A 3RNFC 3H1UA 1JWBD 3U8ZA 1FRRA 2BQQA 1JRPA 4IG7B 3JSVB 3VAWA 5D2MB 2RDBC 2MBQA 3APCA 4OHJA 1PFDA 4ANUA 2I38A 3SEBA 3N9YC 1FXTB 2KFKB 1WX7A 2BKFA 2IO3B 2INCC 1JWAD 4HPMB 1KH0A 3ZO5B 1V5TA 3Q14C 2JYEA 2JY6A 3U4EG 1LGRA 2ASQA 1WR6E 4LJOB 1I7HA 2M19A 2QEJC 1CK1A 2CR5A 2DX5B 4K7SA 3TBLD 3RYTA 2N9LA 2JRIB 1LQBA 3NOBA 2O6VD 2L1AA 1XLQA 2JVCA 1ZP0B 4AWJA 1FCLA 5KHOA 2AYOB 2KT7A 2WXMA 2RMMA 4BOSC 1VR9A 1NI3A 4N9F4 1JRUA 1AW7A 1J7BA 3U7DA 2RDHA 4MJSA 2N0SB 3VTWA 3E9SA 3ZNID 1EWCA 4PS7A 2LXCA 2EKIA 1JROA 2VH2A 1WGKA 4ANXA 2PW9A 2KX0A 2MW5A 4C80A 2FE8A 3E56A 2J0MA 1QILA 2BB5A 3BY4B 4W9LA 2RGFA 3R7QA 3EUB2 3Q69A 2PLPA 5D3DA 4WAFA 4GMVA 3U52E 3IVFA 3PHWB 3AV8A 1PQSA 1N6ZA 4RCOA 2KANA 2KDIA 5G2NA 4AP4C 3ZQ4A 2WXRA 1AARA 4W9EA 1ZGUB 3Q3NC 2KHWB 2K8BA 2D11A 3BVGA 2AX5A 2BYFA 2FIFA 1TS4A 2E6XA 4WIPA 1CQVA 1XLNA 1ZW7A 1HZ5A 3PTFC 4RM8A 2CKHB 1KLGD 1TS5A 1UWMA 3AEBB 2WQYB 5FR6A 4K1RB 4JQWC 2GMIC 1OEYA 2K0PA 2DZMA 2HJ8A 3K9PB 1PYWD 3S2AA 1L0VB 1C78A 1WXSA 3MP9A 5BYSA 4L1BA 1L5PA 4BKSD 2V3SA 3ZNZB 1ROEA 5GMVA 2XEWA 4JLCA 1TZ1A 2UU7A 2CJNA 1ISNA 3HRDD 3QX1A 4M8MA 1C4PA 1MJDA 4ZRIA 5EE3A 4GOCA 4R3DA 2NTTA 4MH8A 3AB5A 2DYBA 1IYFA 3VR8B 5AUKA 4LNNA 1XLPA 4XDDA 3TUOA 4WJQA 3DOWA 4ZHPA 4RGNA 1UBQA 1WXQA 5TR5A 4B9KA 2MBHA 1WF9A 1FFVA 4KV2A 2MA9B 4DQOC 2AQ2B 2KAJA 1K51A 2MHJA 1L0XB 1V1OA 2GLSA 2KYWA 1SIFA 1SBBB 4XYCA 2RDGA 1VCBA 1S1QB 1IP9A 3PGEA 1E10A 4FA6A 3WANA 2V4LA 4KKIA 3VRAB 4FLHA 5D94A 4EZKA 2N7JA 2DAJA 4AJYB 4A3OA 4IDIA 5BO4B 1V80A 4CHKA 3DVGX 5HHDG 2LI5A 3PZDA 3R2TA 2JSVX 2PE9A 4LLGM 3N3KB 1JWSD 2KMMA 1OQQA 3ZNGC 2LRWA 3DBLB 3MTNB 1DOYA 1OGWA 3DHIC 3A4RA 5I4DA 3V6CB 2ZPYA 2N7EA 3H6NA 3JVZX 3AEDB 1A70A 3L16A 1TTNA 2H89B 2WDVB 4DXFA 4TV3A 3AECB 1LXDA 1N5XA 3PPAA 2KFKA 1N60A 3DBRI 4JX1C 4OZAA 3KQ4A 3EC8A 3HHMA 4HRSA 1WE7A 5J18A 5H92C 4MM3A 4O1NA 1L6UA 2G4SA 2FUG1 3CSFA 3DPDA 4W9CA 1XCTL 2SAKA 3OG5A 3OWEB 4I6PA 3AI5A 2J42A 3PREA 1Q5WB 2NR2A 2NTSA 5EE1A 2L05A 1VDVA 2AQ3B 3SDLC 4EKUA 2K8HA 2KXJA 5G5HA 3DWMA 3Q3FA 2GBKA 4WQMA 3I63C 2DWQA 2ZPNA 1PGAA 3MHZA 3U7ZA 4KZCA 3ZRCA 2M8SA 3AEGB 2QDFA 2I2YA 1D6EC 4RGMA 5HG2A 4LDTB 4ZRQA 2BS4B 4EFOA 4PYZA 5C23A 2KVZA 4WJNA 1JWMD 1RFAA 2K22A 3BK1A 2N9EB 2XBBC 4A55A 1IBXB 4UDUC 3TCAA 4FXCA 3B1LX 3NJTA 4ASWC 2WHIA 4WJPA 1P7EA 2DZJA 4M01A 3MHSD 4C00A 4LNKA 4HROA 1N62A 2EKEC 3W2DA 2LXAA 1FXAA 2WX1A 1MPEA 4ZRKA 2LGDA 3V05A 3ALBA 3GE3C 2RD0A 2W55A 2KACA 4L2YA 3QAQA 1WSPA 2LVOA 3RUIB 5CX3A 4H2AA 2KK8A 2ZW0A 4N6EB 4OVUA 2EMTA 1V9JA 4NJCA 2WXLA 4OZBA 2JXXA 3N1XC 2O2VA 3IT6B 4LK0M 3CMMB 5T8IA 1YD8U 1E9MA 5CHVC 1QQRA 2ZNVB 2YEPB 1MHHE 2NS5A 1YOVB 1J7AA 2WXPA 2KJHB 3KH0A 1T0SC 2K5PA 2DAFA 1J7CA 3ZJTA 3HUIA 2L0TA 1VJKA 3P2BA 1MI0A 2Z0EB 3P4RB 3Q6BA 3TSSA 5IOIA 1FMAD 4WURA 3Q8EA 4MT5A 4US8A 4JGHB 2WX0A 1RYJA 4REZA 3N1ZC 1FD6A 2IGHA 3KVFB 4RNAA 2KWDA 4LJPB 3RNCC 5G55A 2ZCCA 2BGFA 2ON8A 3RNEC 4RM9A 3ZLZA 4HCPB 3RNGC 4JWUC 2KWUB 4W9FA 2RSUA 3KUDB 1V5OA 4MACA 2WU5B 3H7PA 1K50A 2BW2A 3VVWB 4IOIE 2M4NA 4E3CA 1NBFC 4OVVA 2HTME 5IP4D 3Q3JA 4DHJD 1SJED 2UYZB 1N5WA 4XC2A 3RI7C 4AUQC 2KN5A 1HA5A 3ZDMC 2JQRB 2KTRB 3RD2A 4W9KA 4ANVA 2WNMA 1RFKA 2GBMA 1E8XA 1GG3A 1Y8RC 3ZKJC 4YL8A 3V62A 2JF5A 1L7YA 2C7MB 4MELA 3SD5A 2MX2A 3BINA 2QC8A 1WWTA 2WXKA 2BF8B 2BBCA 3ZXVA 4AQ7A 3AE1B 4ICVA 2WYQA 1SSNA 2GB1A 4MM3B 3IBEA 2VRRB 4BKSA 3H9DA 3NZ3A 1GAQB 2KLGA 2MJDA 3KWLA 2BTEA 1F0ZA 1I4RA 1UD7A 2A5UA 2Z59B 1VRAB 1I4XA 1WFYA 2D10A 2KO3A 2HDEA 4XGAB 2LGSA 1TS2A 2L52A 3W1SC 1OFFA 3AE9B 5G5GA 1F9JA 1SF0A 3GB1A 5C3JB 1E5WA 1ZXIA 2A4ZA 1WI0A 2PVGC 3TIXA 1NYQA 1TKEA 2WWZA 5FK9C 2MP2A 2PIAA 3LJ3A 3U30A 2Z0DB 4EZLA 3TL5A 3ABVB 2D3BA 3ENEA 1E8YA 2K6QA 1GC6A 3UINB 4US9A 1R4NB 3RPFC 1EO6A 2ACZB 3M3JA 3DVGY 3C8YA 1T0YA 2B76B 1ESFA 4TSSA 2VH1A 5JHBA 4NAWB 2GRIA 1F52A 3QA8A 1WH3A 4RF0A 4RH6A 2IGDA 2K6DB 4BKGA 1JW9D 4DDGD 2ZNVC 3JW0X 3PV1A 4LNIA 4YTNB 1NENB 4TKNA 1EU3A 2NBVB 2D2QA 3TEWA 1KRHA 2WS3B 2ZVNA 2DZKA 3UIOB 5DPRA 3TEYA 1WX9A 3TJPA 4L23A 1TIFA 1I4PA 3BIID 1FNUA 4NJ6A 1WMHA 4PYUA 2KVRA 3FILB 3QWZB 3ZUNA 1D3ZA 4K7WA 2OJRA 2LJIA 4DHZE 1YQ3B 4ACFA 3WAOA 2AWTA 3PRMB 1VZ7A 4EOYA 4BBNF 2OOBB 4DHJB 1WJ6A 2DYOA 5TSSA 1WZ3A 2KMCA 4IM0A 1PGXA 4GIVA 2V1YA 4LCDE 4BZAA 3HVZA 2WXNA 3A9KB 2J4XA 2NBWB 4MEMA 2W9NA 2IGGA 3WIMA 1RM6C 2L8JA 5DPSA 4KSKC 4BOZB 3EFUA 2IPKD 2DENB 4HWIB 5CHFA 4FJVB 1WXVA 5JXVA 2ZZPB 3PLVA 2HJ1A 4MGYE 4K3CA 2C5LC 5BMHA 2DYMA 3T9LA 2I1KA 4JE3B 1KM7A 2IO1B 5L95C 5C2TB 4X57B 4IUMB 1MFWA 2KN4A 2PEAA 2R2OA 1KF6B 5IKCM 1EU4A 1FPYA 2AQ1B 3M62B 4ZDVA 3RZFA 1MG4A 2L83A 1R7SA 1K53A 2INNE 3RN9C 4G50A 3VDZA 2KD0A 1V2YA 3AM9A 3Q8BA 2WP9B 4NQKE 3VHTC 1GOZA 1EM7A 4HKQA 1WM2A 1J0GA 2NPTB 1F1HA 3W9CB 3LB8C 4XWTA 1FFUA 5IN7A 3GOEA 1FRDA 3HIZA 2INPE 1SEBD 4I6LB 1YQBA 3APDA 1TGZB 4ARCA 1MHXA 3NRZA 2GOWA 2PTLA 2W82A 4FJZA 2IJ0A 4NJ7A 2D5GA 1A5RA 2N7DA 4P16A 4FN2A 1YJIA 1QF6A 3PT2B 1R4NI 1L4ZB 3NZSA 3H7SA 2IY0B 4RGOS 4HPLB 1VLBA 3LXFA 1QT9A 2NVUI 3RMKC 1X1MA 3AE3B 1ZKHA 2GBNA 2NBUA 3KUCB 4CO7A 3IAM1 4ZOHC 1YIWA 3VH4B 4A8XC 3QC8B 4ZRPA 1T3QA 4IKGA 1I35A 1D4BA 1C76A 3B08A 4USAA 1K8RB 2FUHB 2JPHA 2MBOA 3RNBC 4W9GA 2CHXA 5LXHA 3FKYA 3EGRA 1C77A 1BUIC 2KC2A 2GBJA 1KLVA 5LNK1 2LD9A 2YEPF 1V1PA 1VZ6A 2KQSA 3QK0A 4IC7B 2PVOD 2SEBD 2JZZA 2B3AA 1WM3A 1M4VA 4LTUA 3OLMD 3GZNB 2Y5PA 4PT5A 3I3TB 4C4VB 1WRIA 3L54A 2MJEA 2LFIA 1QKZA 3P42A 4IWQA 4LNOA 3VR9B 3VTVA 2JZ3B 1T6BX 3M95A 1C3TA 1WZ0A 2HTHA 3KWVA 1KJTA 4KZ0A 4HJGE 1B1ZA 4EEWA 1ZDVA 4K7UA 1L4DB 1EUVB 2KFJA 2OJWA 2N1VA 5BYRA 1H4RA 1FM0D 1SE3A
chains in the Genus database with same CATH topology
2XK5B 3PRPB 4PS8A 2KLCA 1V9JA 2KWCA 4URKA 2JXXA 3EHVA 3VUWA 2O2VA 4IWOA 5JH5C 1P98A 3VTUA 1UH6A 4FULA 3CMMB 2K39A 3H1UA 2IBIB 3EECA 1YD8U 1WR1A 3U8ZA 5CHVC 1RLFA 2UWQA 2ZNVB 3ZNHB 4TQ0A 4IG7B 2J0KA 2NS5A 3JSVB 3VAWA 4GN1A 2KJHB 2DHZA 5D2MB 3RULA 3KH0A 4AJWA 3L13A 2LGYA 2MBQA 2DAFA 4DDID 4WJOA 1GNUA 2G45B 2L0TA 1E7UA 3APCA 4KIKB 1E90A 3P2BA 3D32A 4HCNB 2Z0EB 3B0AA 3OJ4B 4XX5A 3W1YA 4ANUA 4NPNA 1HE8A 2QHOA 2CU1A 4GDLA 4JGHB 2WX0A 4GU2A 5E6NA 3A1QA 4F1SA 4J6IA 1FXTB 2KFKB 1WX7A 2Y5BB 2BKFA 2LVQA 3KVFB 3V6EB 2IO3B 4LJPB 2L0FA 5HKHA 5G55A 4HPMB 4MDKE 2ZCCA 2BGFA 3OJ3A 2JRHA 3ZO5B 1V5TA 3RCZA 1LM8B 2JY6A 4RM9A 5IAAC 3ZTCA 2K25A 3ZLZA 4HCPB 2ASQA 2KJRA 3K9OB 1WR6E 4W9IA 4LJOB 4BFRA 4FHKA 2CR5A 2KWUB 2KOXA 2DX5B 2D3GA 2LJ5A 4W9FA 2RSUA 1WXMA 3KUDB 4K7SA 1V5OA 2MBEA 3TBLD 3X23A 3RYTA 2JRIB 3H7PA 4GB9A 4MSMB 1LQBA 3NOBA 5DPTA 4NAWA 3VVWB 2O6VD 2ZEQA 1EF1A 2JVCA 3W1SA 1CMXB 1Q0WB 2M4NA 3WAMA 2IY1B 4E3CA 1NBFC 4AWJA 3DBSA 4OVVA 4G3XB 4KIKA 5KHOA 2KTFA 2AYOB 3OAWA 3Q3JA 4DHJD 2AEHA 2UYZB 4FADA 3PVLA 4XC2A 1V6EA 4ANWA 3UF8A 4HK2A 4BOSC 4AUQC 2KN5A 2RPQA 4IM2A 3L08A 3ZDMC 2KTRB 3RD2A 3V60A 1UZXB 4W9KA 4ANVA 5E6OA 4N9F4 5AZFA 1JRUA 3AULA 3U7DA 2GBMA 1E8XA 1GG3A 4MJSA 1Y8RC 5LXIB 1H8CA 3ZKJC 3VTWA 3ZNID 3ZW3A 3NZUA 3VH3B 1WGDA 4YL8A 3V62A 2KTRA 2JF5A 1XQQA 1L7YA 2C7MB 2MQJA 2NPTA 3QCAA 4MELA 4PS7A 4DK5A 2JT4B 3SD5A 2BYEA 4II2B 2MX2A 3BINA 3ML9A 2LXCA 4DWFA 2BF8B 1E8ZA 2PJHA 4II3B 2M1MA 4ANXA 4ICVA 3L17A 1GJZA 2WYQA 3WAPA 1C1YB 3WA0A 2KX0A 4DHZB 3IBEA 2IYDB 2VRRB 3O65B 3A9KA 3PHXB 3H9DA 3ZDTA 2D07B 2C9WB 4BKSA 2KLGA 2MW5A 1V81A 1VD2A 3ECIA 2J0MA 2BKRB 4MJSB 1UD7A 3BY4B 1WJUA 2A5UA 4W9LA 2KO3A 1SE9A 1WFYA 2D10A 2Z59B 2KC1A 2RGFA 4NNJB 3R7QA 4BKTA 2KQ7A 1GC7A 3UGBB 3VFKA 4GMVA 5KHQA 3RT3B 4RMAA 3IVFA 3PHWB 2MLBA 3SU8X 3W1SC 1PQSA 1EF5A 2KANA 2KDIA 4A20A 2M17A 1F9JA 5G2NA 4AP4C 1E7VA 1AARA 3CSTA 1E5WA 2REXA 2HD5B 2A4ZA 4W9EA 2GBRA 1WI0A 1ZGUB 4TUUA 2KHWB 2K8BA 3GZNI 3QJZA 4M8NA 3TIXA 3ZTDA 2WWZA 5CTRC 2MP2A 1M94A 2D11A 3CF6E 2FNJB 3LJ3A 4A3PA 3U30A 2Z0DB 3NHEB 4EZLA 2BYFA 2FIFA 2MCNB 3TL5A 3UQAA 1WY8A 1ZW7A 2KJ6A 3ENEA 1S3SG 3PTFC 2N9PC 4RM8A 4ZYNA 2HE7A 2KMAA 2CKHB 2G4DB 1E8YA 2KX3A 1GC6A 2K6QA 3UINB 1EO6A 3M3JA 3DVGY 1NI2A 4K1RB 1T0YA 4HJKA 4JQWC 5FR6A 2NCNA 3QARA 2IO0B 2GMIC 1OEYA 2DZMA 2HJ8A 3K9PB 3PSEB 5AEKB 4NAWB 5JHBA 3S2AA 4E71A 5D7GA 3QA8A 1WH3A 5AZGA 1WXSA 2BPSA 2LRUA 3MJWA 1UBIA 4BKSD 2V3SA 2K6DB 4BKGA 4DDGD 3ZNZB 2ZNVC 3JW0X 4M0WB 4EZJA 5CHWA 5GMVA 2R2QA 2ZCBA 2XEWA 3N32A 3PV1A 4JLCA 1TZ1A 4KVGB 2RR9A 1ISNA 4WQOB 2KZRA 4TKNA 4IM3A 1Z2MA 4G0NB 3QX1A 4M8MA 1WYWB 2FIDA 4GDLB 2NBVB 1WMHB 1OQYA 2D2QA 4ZRIA 2G3QB 2ZVNA 4B6WA 2MP2B 2C60A 3LDZE 3JSVA 2DZKA 4GOCA 1YJ1A 5DPRA 3UIOB 1WX9A 2AL6A 3TJPA 4MGIE 1SGHA 4HDOA 1QZEA 2DYBA 4NJ6A 1WMHA 4PYUA 2KVRA 3QWZB 3ZUNA 1D3ZA 4BBNC 2ZVOA 1IYFA 4K7WA 2OJRA 4DHZE 3WALA 2AL3A 4K81A 4XZ4A 3QHTA 2AWTA 3PRMB 3WAOA 4DXAB 4WJQA 3DOWA 5EDSA 1MG8A 4EOYA 2O6VA 4BBNF 2OOBB 1UBQA 2ZJDA 1WJ6A 4WAAA 5TR5A 4B9KA 4DHJB 1L2NA 2MBHA 1UELA 1WF9A 4AOFA 2DYOA 1WZ3A 2KMCA 4GGQA 3VUYA 4IM0A 2K1FA 3R3MA 3X0WA 4FBJB 4I6NB 2O6VB 2J7QB 2O2VB 4GIVA 4KV2A 4BVUC 2V1YA 2MA9B 4LCDE 4HLEA 3L10B 2N9XA 3A9KB 4MEMA 2NBWB 2W9NA 1TBEA 1XT9B 1GUAB 3WIMA 4LDTD 1IPGA 2KWVB 1OTRB 1WXAA 1SIFA 2L8JA 2N4FA 3A4SC 4HXDA 5DPSA 1WGRA 3A1QB 4MGZE 5JZEB 4KDIC 4KSKC 4BOZB 1WE6A 1VCBA 1S1QB 4HDQA 3QQ8B 3ZRFA 1IP9A 3EFUA 3PGEA 4ZRJA 2FAZA 3NY5A 2IO2B 3A9JB 4GDKA 4FA6A 4KDLB 2C7NB 3RZWC 3A33B 2DENB 3WANA 2V4LA 4HWIB 2I1JA 5CHFA 2DZIA 2EMSA 1WXVA 4FJVB 4FLHA 4MH0E 2L76A 5E6PA 1I42A 2JWZA 5D94A 4F8CB 4NY0A 2ZZPB 3PLVA 4MGKE 4MGYE 3HK0A 3R7RA 2DAJA 4EZKA 4AJYB 1R4MI 2C5LC 4W9DA 4A3OA 1WX8A 2DYMA 1V80A 5BO4B 4CHKA 3DVGX 1OEYJ 5J17A 3T9LA 2I1KA 2L3ZA 3KYCD 2LI5A 2IZVB 3PZDA 1Z5SB 1WGGA 5L83A 1KM7A 2IO1B 2PE9A 5L95C 3N3KB 4X57B 4IUMB 2L7RA 2PEAA 3ZNGC 2LRWA 2R2OA 4PS3A 1XD3B 1P0RA 2PPHA 3M62B 3MTNB 4ZDVA 1OGWA 3A9JA 4WWOA 3A4RA 3RZFA 5DCNA 3V6CB 2ZPYA 1J8CA 2N7EA 1WJ4A 3DVNV 3APFA 3KW5B 4G50A 3VDZA 3H6NA 2KD0A 3JVZX 5LLIA 1V2YA 1KOTA 3L16A 1TTNA 1E8WA 4NQKE 4WWPA 3R66C 2WDTB 3VHTC 2CHWA 2FCMA 3AU4A 4TV3A 3L0WB 2FCNA 1WM2A 1LXDA 1J0GA 2M0XA 2NPTB 3PPAA 3IHPC 2KFKA 3DBRI 4EUTA 2LUEA 3EC8A 4IWPA 3HHMA 4W9JA 1WE7A 2XK5A 3UQBA 5J18A 3GOEA 3T8MA 4MM3A 2N1WA 3HIZA 4CYEA 1WRDB 2G4SA 4E74A 3UIPB 2CS4A 4HVBA 4I6LB 1YQBA 3APDA 1TGZB 3CSFA 3KYDD 4ICUA 5D6JB 2LVPA 3DPDA 2KDFB 4IW0A 4W9CA 2GOWA 4FJZA 4GDKB 4GSWA 2FCSA 3DDCB 4NJ7A 2MSED 3HM3A 3KUZA 1A5RA 2N7DA 3AI5A 4I6PA 2C7HA 3H7PB 2MWSB 3PREA 4FN2A 1Q5WB 2NR2A 5DPWA 2MBBB 4JIOU 3PT2B 1R4NI 2L05A 3NZSA 3H7SA 2IY0B 4KSLC 1RRBA 1YX5B 4HPLB 3SDLC 4EKUA 2FCQA 3AXCA 2K8HA 3IFWB 2NVUI 2KXJA 1X1MA 3DVNU 1ZKHA 2GBNA 4MSQB 3Q3FA 1UGMA 2GBKA 2NBUA 2YLMA 2CHZA 3JYUA 4B95A 4DBGA 3KUCB 4CO7A 1LFDA 1YX6B 1YIWA 2KDBA 2ZPNA 1BT0A 3VH4B 4KZCA 3ZRCA 2M8SA 1P1AA 3QC8B 1P3QU 3N30A 3SHQA 1I35A 3C0RB 3ZVVA 2L00B 1NDDA 4LDTB 1G6JA 3B08A 2KKCA 1WIAA 4G11A 4W9HA 4EFOA 1K8RB 3QIJA 4PYZA 2FUHB 2JPHA 2MBOA 5C23A 5C1ZA 1J19A 1WJNA 4W9GA 2CHXA 5LXHA 1U4AA 4WJNA 3M63B 3ONSA 1V49A 1RFAA 3ML8A 3DBHI 2KC2A 1KLVA 2GBJA 5IA7A 4GXBA 2LD9A 3IG3A 1P9DU 2N9EB 2XBBC 3ZIMA 5JHAA 4P7IA 2KQSA 1WGYA 3DCGA 2BWFA 3TCAA 3VXWA 3QK0A 3NS8A 4IC7B 2KNBA 3B1LX 4NQLB 2JZZA 2B3AA 4ASWC 4WJPA 1V86A 1WM3A 3DBLI 2BWES 2DZJA 3OLMD 3HM6X 2PE6B 2K8CA 3MHSD 3I3TB 3V61A 1Q1OA 2JUOA 3PRZA 3L54A 2MRPA 4JL9A 4IWQA 2EKEC 1RAXA 4WWNA 2LXAA 2WX1A 2BYVE 2LWPA 5J2RA 3VTVA 2JZ3B 4F7ZA 2YVCA 4ZRKA 3PLUA 2LGDA 3ALBA 3M95A 4FJYA 2RD0A 4TQ1A 1C3TA 1WZ0A 3VQIA 2HTHA 2J0JA 3QAQA 1KJTA 4KZ0A 2LVOA 3RUIB 3PS6A 5AZHA 4EEWA 2KDEB 2LGXA 5CX3A 3TMPB 4K7UA 2KK8A 3VUXA 1EUVB 2KFJA 2LZ6A 2N1VA 4FHJA 1H4RA 1WGHA 3AU5A 4OVUA 3DQVA 2EMTA 2LASA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XK5 B;  3PRP B;  4PS8 A;  2KLC A;  1V9J A;  2KWC A;  4URK A;  2JXX A;  3EHV A;  3VUW A;  2O2V A;  4IWO A;  5JH5 C;  1P98 A;  3VTU A;  1UH6 A;  4FUL A;  3CMM B;  2K39 A;  3H1U A;  2IBI B;  3EEC A;  1YD8 U;  1WR1 A;  3U8Z A;  5CHV C;  1RLF A;  2UWQ A;  2ZNV B;  3ZNH B;  4TQ0 A;  4IG7 B;  2J0K A;  2NS5 A;  3JSV B;  3VAW A;  4GN1 A;  2KJH B;  2DHZ A;  5D2M B;  3RUL A;  3KH0 A;  4AJW A;  3L13 A;  2LGY A;  2MBQ A;  2DAF A;  4DDI D;  4WJO A;  1GNU A;  2G45 B;  2L0T A;  1E7U A;  3APC A;  4KIK B;  1E90 A;  3P2B A;  3D32 A;  4HCN B;  2Z0E B;  3B0A A;  3OJ4 B;  4XX5 A;  3W1Y A;  4ANU A;  4NPN A;  1HE8 A;  2QHO A;  2CU1 A;  4GDL A;  4JGH B;  2WX0 A;  4GU2 A;  5E6N A;  3A1Q A;  4F1S A;  4J6I A;  1FXT B;  2KFK B;  1WX7 A;  2Y5B B;  2BKF A;  2LVQ A;  3KVF B;  3V6E B;  2IO3 B;  4LJP B;  2L0F A;  5HKH A;  5G55 A;  4HPM B;  4MDK E;  2ZCC A;  2BGF A;  3OJ3 A;  2JRH A;  3ZO5 B;  1V5T A;  3RCZ A;  1LM8 B;  2JY6 A;  4RM9 A;  5IAA C;  3ZTC A;  2K25 A;  3ZLZ A;  4HCP B;  2ASQ A;  2KJR A;  3K9O B;  1WR6 E;  4W9I A;  4LJO B;  4BFR A;  4FHK A;  2CR5 A;  2KWU B;  2KOX A;  2DX5 B;  2D3G A;  2LJ5 A;  4W9F A;  2RSU A;  1WXM A;  3KUD B;  4K7S A;  1V5O A;  2MBE A;  3TBL D;  3X23 A;  3RYT A;  2JRI B;  3H7P A;  4GB9 A;  4MSM B;  1LQB A;  3NOB A;  5DPT A;  4NAW A;  3VVW B;  2O6V D;  2ZEQ A;  1EF1 A;  2JVC A;  3W1S A;  1CMX B;  1Q0W B;  2M4N A;  3WAM A;  2IY1 B;  4E3C A;  1NBF C;  4AWJ A;  3DBS A;  4OVV A;  4G3X B;  4KIK A;  5KHO A;  2KTF A;  2AYO B;  3OAW A;  3Q3J A;  4DHJ D;  2AEH A;  2UYZ B;  4FAD A;  3PVL A;  4XC2 A;  1V6E A;  4ANW A;  3UF8 A;  4HK2 A;  4BOS C;  4AUQ C;  2KN5 A;  2RPQ A;  4IM2 A;  3L08 A;  3ZDM C;  2KTR B;  3RD2 A;  3V60 A;  1UZX B;  4W9K A;  4ANV A;  5E6O A;  4N9F 4;  5AZF A;  1JRU A;  3AUL A;  3U7D A;  2GBM A;  1E8X A;  1GG3 A;  4MJS A;  1Y8R C;  5LXI B;  1H8C A;  3ZKJ C;  3VTW A;  3ZNI D;  3ZW3 A;  3NZU A;  3VH3 B;  1WGD A;  4YL8 A;  3V62 A;  2KTR A;  2JF5 A;  1XQQ A;  1L7Y A;  2C7M B;  2MQJ A;  2NPT A;  3QCA A;  4MEL A;  4PS7 A;  4DK5 A;  2JT4 B;  3SD5 A;  2BYE A;  4II2 B;  2MX2 A;  3BIN A;  3ML9 A;  2LXC A;  4DWF A;  2BF8 B;  1E8Z A;  2PJH A;  4II3 B;  2M1M A;  4ANX A;  4ICV A;  3L17 A;  1GJZ A;  2WYQ A;  3WAP A;  1C1Y B;  3WA0 A;  2KX0 A;  4DHZ B;  3IBE A;  2IYD B;  2VRR B;  3O65 B;  3A9K A;  3PHX B;  3H9D A;  3ZDT A;  2D07 B;  2C9W B;  4BKS A;  2KLG A;  2MW5 A;  1V81 A;  1VD2 A;  3ECI A;  2J0M A;  2BKR B;  4MJS B;  1UD7 A;  3BY4 B;  1WJU A;  2A5U A;  4W9L A;  2KO3 A;  1SE9 A;  1WFY A;  2D10 A;  2Z59 B;  2KC1 A;  2RGF A;  4NNJ B;  3R7Q A;  4BKT A;  2KQ7 A;  1GC7 A;  3UGB B;  3VFK A;  4GMV A;  5KHQ A;  3RT3 B;  4RMA A;  3IVF A;  3PHW B;  2MLB A;  3SU8 X;  3W1S C;  1PQS A;  1EF5 A;  2KAN A;  2KDI A;  4A20 A;  2M17 A;  1F9J A;  5G2N A;  4AP4 C;  1E7V A;  1AAR A;  3CST A;  1E5W A;  2REX A;  2HD5 B;  2A4Z A;  4W9E A;  2GBR A;  1WI0 A;  1ZGU B;  4TUU A;  2KHW B;  2K8B A;  3GZN I;  3QJZ A;  4M8N A;  3TIX A;  3ZTD A;  2WWZ A;  5CTR C;  2MP2 A;  1M94 A;  2D11 A;  3CF6 E;  2FNJ B;  3LJ3 A;  4A3P A;  3U30 A;  2Z0D B;  3NHE B;  4EZL A;  2BYF A;  2FIF A;  2MCN B;  3TL5 A;  3UQA A;  1WY8 A;  1ZW7 A;  2KJ6 A;  3ENE A;  1S3S G;  3PTF C;  2N9P C;  4RM8 A;  4ZYN A;  2HE7 A;  2KMA A;  2CKH B;  2G4D B;  1E8Y A;  2KX3 A;  1GC6 A;  2K6Q A;  3UIN B;  1EO6 A;  3M3J A;  3DVG Y;  1NI2 A;  4K1R B;  1T0Y A;  4HJK A;  4JQW C;  5FR6 A;  2NCN A;  3QAR A;  2IO0 B;  2GMI C;  1OEY A;  2DZM A;  2HJ8 A;  3K9P B;  3PSE B;  5AEK B;  4NAW B;  5JHB A;  3S2A A;  4E71 A;  5D7G A;  3QA8 A;  1WH3 A;  5AZG A;  1WXS A;  2BPS A;  2LRU A;  3MJW A;  1UBI A;  4BKS D;  2V3S A;  2K6D B;  4BKG A;  4DDG D;  3ZNZ B;  2ZNV C;  3JW0 X;  4M0W B;  4EZJ A;  5CHW A;  5GMV A;  2R2Q A;  2ZCB A;  2XEW A;  3N32 A;  3PV1 A;  4JLC A;  1TZ1 A;  4KVG B;  2RR9 A;  1ISN A;  4WQO B;  2KZR A;  4TKN A;  4IM3 A;  1Z2M A;  4G0N B;  3QX1 A;  4M8M A;  1WYW B;  2FID A;  4GDL B;  2NBV B;  1WMH B;  1OQY A;  2D2Q A;  4ZRI A;  2G3Q B;  2ZVN A;  4B6W A;  2MP2 B;  2C60 A;  3LDZ E;  3JSV A;  2DZK A;  4GOC A;  1YJ1 A;  5DPR A;  3UIO B;  1WX9 A;  2AL6 A;  3TJP A;  4MGI E;  1SGH A;  4HDO A;  1QZE A;  2DYB A;  4NJ6 A;  1WMH A;  4PYU A;  2KVR A;  3QWZ B;  3ZUN A;  1D3Z A;  4BBN C;  2ZVO A;  1IYF A;  4K7W A;  2OJR A;  4DHZ E;  3WAL A;  2AL3 A;  4K81 A;  4XZ4 A;  3QHT A;  2AWT A;  3PRM B;  3WAO A;  4DXA B;  4WJQ A;  3DOW A;  5EDS A;  1MG8 A;  4EOY A;  2O6V A;  4BBN F;  2OOB B;  1UBQ A;  2ZJD A;  1WJ6 A;  4WAA A;  5TR5 A;  4B9K A;  4DHJ B;  1L2N A;  2MBH A;  1UEL A;  1WF9 A;  4AOF A;  2DYO A;  1WZ3 A;  2KMC A;  4GGQ A;  3VUY A;  4IM0 A;  2K1F A;  3R3M A;  3X0W A;  4FBJ B;  4I6N B;  2O6V B;  2J7Q B;  2O2V B;  4GIV A;  4KV2 A;  4BVU C;  2V1Y A;  2MA9 B;  4LCD E;  4HLE A;  3L10 B;  2N9X A;  3A9K B;  4MEM A;  2NBW B;  2W9N A;  1TBE A;  1XT9 B;  1GUA B;  3WIM A;  4LDT D;  1IPG A;  2KWV B;  1OTR B;  1WXA A;  1SIF A;  2L8J A;  2N4F A;  3A4S C;  4HXD A;  5DPS A;  1WGR A;  3A1Q B;  4MGZ E;  5JZE B;  4KDI C;  4KSK C;  4BOZ B;  1WE6 A;  1VCB A;  1S1Q B;  4HDQ A;  3QQ8 B;  3ZRF A;  1IP9 A;  3EFU A;  3PGE A;  4ZRJ A;  2FAZ A;  3NY5 A;  2IO2 B;  3A9J B;  4GDK A;  4FA6 A;  4KDL B;  2C7N B;  3RZW C;  3A33 B;  2DEN B;  3WAN A;  2V4L A;  4HWI B;  2I1J A;  5CHF A;  2DZI A;  2EMS A;  1WXV A;  4FJV B;  4FLH A;  4MH0 E;  2L76 A;  5E6P A;  1I42 A;  2JWZ A;  5D94 A;  4F8C B;  4NY0 A;  2ZZP B;  3PLV A;  4MGK E;  4MGY E;  3HK0 A;  3R7R A;  2DAJ A;  4EZK A;  4AJY B;  1R4M I;  2C5L C;  4W9D A;  4A3O A;  1WX8 A;  2DYM A;  1V80 A;  5BO4 B;  4CHK A;  3DVG X;  1OEY J;  5J17 A;  3T9L A;  2I1K A;  2L3Z A;  3KYC D;  2LI5 A;  2IZV B;  3PZD A;  1Z5S B;  1WGG A;  5L83 A;  1KM7 A;  2IO1 B;  2PE9 A;  5L95 C;  3N3K B;  4X57 B;  4IUM B;  2L7R A;  2PEA A;  3ZNG C;  2LRW A;  2R2O A;  4PS3 A;  1XD3 B;  1P0R A;  2PPH A;  3M62 B;  3MTN B;  4ZDV A;  1OGW A;  3A9J A;  4WWO A;  3A4R A;  3RZF A;  5DCN A;  3V6C B;  2ZPY A;  1J8C A;  2N7E A;  1WJ4 A;  3DVN V;  3APF A;  3KW5 B;  4G50 A;  3VDZ A;  3H6N A;  2KD0 A;  3JVZ X;  5LLI A;  1V2Y A;  1KOT A;  3L16 A;  1TTN A;  1E8W A;  4NQK E;  4WWP A;  3R66 C;  2WDT B;  3VHT C;  2CHW A;  2FCM A;  3AU4 A;  4TV3 A;  3L0W B;  2FCN A;  1WM2 A;  1LXD A;  1J0G A;  2M0X A;  2NPT B;  3PPA A;  3IHP C;  2KFK A;  3DBR I;  4EUT A;  2LUE A;  3EC8 A;  4IWP A;  3HHM A;  4W9J A;  1WE7 A;  2XK5 A;  3UQB A;  5J18 A;  3GOE A;  3T8M A;  4MM3 A;  2N1W A;  3HIZ A;  4CYE A;  1WRD B;  2G4S A;  4E74 A;  3UIP B;  2CS4 A;  4HVB A;  4I6L B;  1YQB A;  3APD A;  1TGZ B;  3CSF A;  3KYD D;  4ICU A;  5D6J B;  2LVP A;  3DPD A;  2KDF B;  4IW0 A;  4W9C A;  2GOW A;  4FJZ A;  4GDK B;  4GSW A;  2FCS A;  3DDC B;  4NJ7 A;  2MSE D;  3HM3 A;  3KUZ A;  1A5R A;  2N7D A;  3AI5 A;  4I6P A;  2C7H A;  3H7P B;  2MWS B;  3PRE A;  4FN2 A;  1Q5W B;  2NR2 A;  5DPW A;  2MBB B;  4JIO U;  3PT2 B;  1R4N I;  2L05 A;  3NZS A;  3H7S A;  2IY0 B;  4KSL C;  1RRB A;  1YX5 B;  4HPL B;  3SDL C;  4EKU A;  2FCQ A;  3AXC A;  2K8H A;  3IFW B;  2NVU I;  2KXJ A;  1X1M A;  3DVN U;  1ZKH A;  2GBN A;  4MSQ B;  3Q3F A;  1UGM A;  2GBK A;  2NBU A;  2YLM A;  2CHZ A;  3JYU A;  4B95 A;  4DBG A;  3KUC B;  4CO7 A;  1LFD A;  1YX6 B;  1YIW A;  2KDB A;  2ZPN A;  1BT0 A;  3VH4 B;  4KZC A;  3ZRC A;  2M8S A;  1P1A A;  3QC8 B;  1P3Q U;  3N30 A;  3SHQ A;  1I35 A;  3C0R B;  3ZVV A;  2L00 B;  1NDD A;  4LDT B;  1G6J A;  3B08 A;  2KKC A;  1WIA A;  4G11 A;  4W9H A;  4EFO A;  1K8R B;  3QIJ A;  4PYZ A;  2FUH B;  2JPH A;  2MBO A;  5C23 A;  5C1Z A;  1J19 A;  1WJN A;  4W9G A;  2CHX A;  5LXH A;  1U4A A;  4WJN A;  3M63 B;  3ONS A;  1V49 A;  1RFA A;  3ML8 A;  3DBH I;  2KC2 A;  1KLV A;  2GBJ A;  5IA7 A;  4GXB A;  2LD9 A;  3IG3 A;  1P9D U;  2N9E B;  2XBB C;  3ZIM A;  5JHA A;  4P7I A;  2KQS A;  1WGY A;  3DCG A;  2BWF A;  3TCA A;  3VXW A;  3QK0 A;  3NS8 A;  4IC7 B;  2KNB A;  3B1L X;  4NQL B;  2JZZ A;  2B3A A;  4ASW C;  4WJP A;  1V86 A;  1WM3 A;  3DBL I;  2BWE S;  2DZJ A;  3OLM D;  3HM6 X;  2PE6 B;  2K8C A;  3MHS D;  3I3T B;  3V61 A;  1Q1O A;  2JUO A;  3PRZ A;  3L54 A;  2MRP A;  4JL9 A;  4IWQ A;  2EKE C;  1RAX A;  4WWN A;  2LXA A;  2WX1 A;  2BYV E;  2LWP A;  5J2R A;  3VTV A;  2JZ3 B;  4F7Z A;  2YVC A;  4ZRK A;  3PLU A;  2LGD A;  3ALB A;  3M95 A;  4FJY A;  2RD0 A;  4TQ1 A;  1C3T A;  1WZ0 A;  3VQI A;  2HTH A;  2J0J A;  3QAQ A;  1KJT A;  4KZ0 A;  2LVO A;  3RUI B;  3PS6 A;  5AZH A;  4EEW A;  2KDE B;  2LGX A;  5CX3 A;  3TMP B;  4K7U A;  2KK8 A;  3VUX A;  1EUV B;  2KFJ A;  2LZ6 A;  2N1V A;  4FHJ A;  1H4R A;  1WGH A;  3AU5 A;  4OVU A;  3DQV A;  2EMT A;  2LAS A; 
#chains in the Genus database with same CATH topology
 1XF5 L;  2KWC A;  4RF1 A;  5E6J A;  3EHV A;  4IWO A;  5JH5 C;  4HKZ E;  3B2G A;  2IBI B;  3EEC A;  1WR1 A;  1RLF A;  2UWQ A;  3ZNH B;  1IGC A;  2J0K A;  1OQR A;  1ZPS A;  2DHZ A;  1XCQ L;  3RUL A;  2JZP A;  2LGY A;  1N61 A;  1GNU A;  2G45 B;  3Q3M C;  1E90 A;  3D32 A;  4HCN B;  3OJ4 B;  4NPN A;  2N9K A;  5E6N A;  4GU2 A;  1SE4 A;  3MFG A;  2Y5B B;  2LVQ A;  3V6E B;  2L0F A;  5HKH A;  4MDK E;  1QOG A;  2JRH A;  1FNW A;  4ZHO A;  3RCZ A;  1LM8 B;  3ZTC A;  2K25 A;  1T5X D;  2WXI A;  3T3O A;  2KJR A;  3AE8 B;  3K9O B;  4OW0 A;  1HTO A;  2KOX A;  2LJ5 A;  1ZXH A;  2QIL A;  1DOX A;  2LHD A;  3AEE B;  4MSM B;  4C7Y A;  2ZEQ A;  3WAM A;  1QOA A;  4P1C C;  1E7P B;  4G3X B;  2KTF A;  3OAW A;  2BYT A;  3PO0 A;  3PVL A;  1V6E A;  3IXS A;  1XEE A;  3UF8 A;  3L08 A;  1UZX B;  1B9R A;  1YJJ A;  2WXO A;  5AZF A;  3EFC A;  1ENF A;  5LXI B;  1HZ6 A;  3ZW3 A;  3NZU A;  5HI1 A;  3CIR B;  1XQQ A;  2NPT A;  4XDC A;  3I9V 1;  4II2 B;  3BK2 A;  3ML9 A;  4DWF A;  2LHE A;  1E8Z A;  2PJH A;  5AUI A;  3VRB B;  1GJZ A;  1GB4 A;  1QOB A;  3WA0 A;  4DHZ B;  2IYD B;  3ZDT A;  3A9K A;  2D07 B;  2C9W B;  2JXT A;  1VD2 A;  2BKR B;  4MJS B;  1WJU A;  5MPO A;  4BKT A;  1YMH E;  2KQ7 A;  1GC7 A;  3UGB B;  3VFK A;  5HFY A;  3AE5 B;  5KHQ A;  4RMA A;  3V3X A;  3SU8 X;  1ZDX A;  1HTQ A;  2MEK A;  3ZYY X;  1EF5 A;  4A20 A;  1L0Y B;  2M17 A;  1T0Q C;  1E7V A;  2H88 B;  3AE2 B;  3P63 A;  3PZ7 A;  2GBR A;  4TUU A;  4M8N A;  3GZN I;  3QJZ A;  5BMG A;  4KX6 B;  5CTR C;  1M94 A;  1FCC C;  4A3P A;  3NHE B;  4YSZ B;  2KJ6 A;  2KX3 A;  4HJK A;  2NCN A;  2IO0 B;  5GXG B;  5AEK B;  5D7G A;  5AZG A;  2EEL A;  3WCQ A;  1FO4 A;  1KLU D;  2J52 A;  1E0Z A;  1YQ4 B;  2V3P A;  4EZJ A;  1UWX A;  2R2Q A;  3ZGZ A;  1TT5 B;  3C19 A;  3N32 A;  4KVG B;  1YN3 A;  2KQ4 X;  2V9H A;  2RR9 A;  2KZR A;  4IM3 A;  1K52 A;  3URY A;  1VZ8 A;  2FID A;  4GDL B;  1WMH B;  3LDZ E;  2C60 A;  3JSV A;  1YJ1 A;  1TKG A;  2AL6 A;  2R61 A;  4MGI E;  1ZOY B;  4ARI A;  4HDO A;  2ZVO A;  4NAM A;  3WAL A;  4HPP A;  2AL3 A;  1QOF A;  3QHT A;  4P1B C;  5EDS A;  2BS3 B;  2O6V A;  2ZJD A;  4WAA A;  1L2N A;  1UEL A;  4AOF A;  1C9F A;  4GGQ A;  1I4Q A;  1PUT A;  2K1F A;  3R3M A;  3X0W A;  2O6V B;  3I57 A;  1TBE A;  1XT9 B;  1GUA B;  3RNA C;  4B0M A;  4ITK A;  2XN9 C;  2KWV B;  3ETR A;  1OTR B;  2N4F A;  4RFB A;  4HXD A;  3A1Q B;  2M0A A;  4KDI C;  1WE6 A;  2QMT A;  4JPS A;  4ZRJ A;  1ZE3 D;  3ZXR A;  2BT6 A;  3AEF B;  4KDL B;  2C7N B;  5D3I B;  3A33 B;  4A6Q A;  3P4Q B;  4RGT A;  2I1J A;  2DZI A;  2BS2 B;  4MH0 E;  2L76 A;  5E6P A;  2JWZ A;  3B9J A;  4F8C B;  1DOI A;  3Q8C A;  3R8B A;  1R4M I;  2MH7 A;  3U2S C;  4JWS C;  4W9D A;  3KYC D;  4P6V F;  4YWG G;  2M56 B;  2L7R A;  5IO9 A;  3NG0 A;  1D5Z C;  2DLB A;  1XD3 B;  3A9J A;  2PKO A;  1EWY C;  2DBY A;  4AS1 A;  1J8C A;  3KW5 B;  3APF A;  4C56 C;  1BXT A;  3EA6 A;  4WWP A;  2RPV A;  3R66 C;  2WDT B;  3AU4 A;  2K9X A;  4YTM B;  3J9C A;  2M0X A;  3IHP C;  2JYT A;  3FIL A;  2X38 A;  1SXT A;  2JWU A;  2LUE A;  4IWP A;  1ET9 A;  4W9J A;  3I5J C;  2XK5 A;  1N63 A;  3UQB A;  2IND C;  3BYT B;  4CYE A;  1WRD B;  1V8C A;  4E74 A;  2CS4 A;  3IT4 B;  4HVB A;  5D6J B;  2LVP A;  2JU6 X;  2KDF B;  4IW0 A;  2FCS A;  3DDC B;  3HM3 A;  1AYF A;  1JAL A;  3KUZ A;  2J53 A;  3N20 C;  2C7H A;  3H7P B;  2MWS B;  5DPW A;  2MBB B;  4JIO U;  4KSL C;  1UNS A;  3Q3O C;  2FCQ A;  3AXC A;  3IFW B;  1SB3 C;  3DVN U;  4MSQ B;  1I4G A;  2YLM A;  4D2K A;  3JYU A;  4B95 A;  4DBG A;  1FIQ A;  1YX6 B;  3B2F A;  3TEX A;  3C0R B;  2L00 B;  2L32 A;  1SJH D;  3W5U B;  2BB6 A;  1U4A A;  3ONS A;  3NVW A;  1V49 A;  3DBH I;  4N59 A;  5IA7 A;  4GXB A;  3IG3 A;  1P9D U;  2D3C A;  4KGR A;  1WGY A;  2QIE B;  3NS8 A;  3Q8F A;  4NQL B;  2W3S A;  1V86 A;  2BWE S;  3HM6 X;  1IBX A;  2K8C A;  3V61 A;  1Q1O A;  2JUO A;  2CU3 A;  1V97 A;  1C4C A;  4JL9 A;  2Z8L A;  1RAX A;  2JX5 A;  4YT0 B;  3UI3 A;  2LUM A;  4WH4 A;  3RFZ B;  2WXJ A;  2XNA C;  3VQI A;  2J0J A;  5AZH A;  2KDE B;  3SR6 A;  2OED A;  3VUX A;  1YNT E;  3SFD B;  1WGH A;  2LAS A;  1YN4 A;  4XE0 A;  3BVM A;  3PRP B;  4PS8 A;  2KLC A;  4CQN A;  2W3R A;  3VUW A;  1P98 A;  1UH6 A;  3BVZ A;  4M02 A;  3Q8A A;  3AE4 B;  4TQ0 A;  1TKY A;  4GN1 A;  3T3N A;  1BML C;  1UUP A;  4AJW A;  1ACC A;  1E6E B;  2ONQ A;  3L13 A;  4GLS C;  4DDI D;  1L6V A;  4WJO A;  1E7U A;  4KIK B;  3B0A A;  4XX5 A;  3W1Y A;  1HE8 A;  2QHO A;  2CU1 A;  2X8X X;  4GDL A;  3A1Q A;  4F1S A;  4J6I A;  1P7F A;  1HXY D;  4N58 A;  1C79 A;  1PDX A;  3OJ3 A;  1MVK A;  5IAA C;  1DYQ A;  4W9I A;  1Q10 A;  1YN5 A;  4BFR A;  4FHK A;  5FKA C;  3DWG C;  2D3G A;  1WXM A;  2MBE A;  3PZ8 A;  3X23 A;  3BWU D;  4GB9 A;  5DPT A;  4NAW A;  1EF1 A;  1T0R C;  3R2I A;  1CMX B;  1Q0W B;  3W1S A;  2IY1 B;  3DBS A;  4KIK A;  2AEH A;  4FAD A;  2ZW1 A;  4ANW A;  4HK2 A;  1JWU D;  1DGJ A;  2NMQ A;  2RPQ A;  4IM2 A;  2IDY A;  3V60 A;  3AH7 A;  2G9H D;  4A9A A;  5E6O A;  4DXG A;  3AUL A;  2E3T A;  1H8C A;  1I4H A;  3VH3 B;  1WGD A;  3GE8 C;  3BYY B;  2KTR A;  3QCA A;  2MQJ A;  4DK5 A;  2JT4 B;  2BYE A;  1TJE A;  4II3 B;  2M1M A;  3MC8 A;  3N1Y C;  3L17 A;  2MJ3 A;  1NYR A;  3WAP A;  1C1Y B;  1AWD A;  3O65 B;  3PHX B;  1UGJ A;  1V81 A;  4S0R A;  3ECI A;  3O13 A;  3P1M A;  1D5X C;  1SE9 A;  4NNJ B;  2KC1 A;  1TS3 A;  1KFY B;  3DBH B;  4OVZ A;  3RT3 B;  2MLB A;  2CJO A;  4YXD B;  2OHF A;  1TYG B;  4YTP B;  1AN8 A;  1QLB B;  1NEK B;  4WWM A;  3CST A;  2REX A;  1F2R I;  2HD5 B;  3TEZ A;  4K3B A;  3ZTD A;  3CF6 E;  2FNJ B;  2PMV A;  2MCN B;  3UQA A;  1WY8 A;  1XXG A;  2WGS A;  1S3S G;  2N9P C;  3P4S B;  4ZYN A;  2HE7 A;  2KMA A;  2G4D B;  1NI2 A;  2QCZ A;  1FNV A;  3QAR A;  1JQ4 A;  4YSY B;  3PSE B;  2Q5W D;  1FEH A;  2ICI A;  4E71 A;  4C7Z A;  2BPS A;  2LRU A;  3MJW A;  1UBI A;  3GS2 A;  4M0W B;  4M00 A;  1R4M B;  5CHW A;  1WYG A;  2ZCB A;  2WXH A;  1GB1 A;  1LO5 D;  3NS1 A;  4WQO B;  1Z2M A;  4G0N B;  2Y5C A;  1WYW B;  1OQY A;  2G3Q B;  4B0E A;  4B6W A;  2MP2 B;  1Y56 A;  4LNF A;  1GPX A;  1SGH A;  1QZE A;  5EE0 A;  4BBN C;  3NVZ A;  4K81 A;  2WXF A;  4C4V A;  1NVI D;  4XZ4 A;  4DXA B;  2FBW B;  1MG8 A;  1IUE A;  3FAH A;  2D3A A;  3VUY A;  1UF0 A;  4KGS A;  4FBJ B;  4I6N B;  2J7Q B;  2O2V B;  4BVU C;  2QJL A;  4HLE A;  1F77 A;  3L10 B;  2BVC A;  2N9X A;  2LGI A;  1ZUD 2;  2WDR B;  5BYQ A;  4LDT D;  1IPG A;  4HEA 1;  1WXA A;  3A4S C;  5JZE B;  1WGR A;  3H8H A;  4MGZ E;  4S17 A;  1JCK B;  4HDQ A;  3QQ8 B;  3ZRF A;  2FAZ A;  1XO3 A;  3NY5 A;  2IO2 B;  3A9J B;  2WXG A;  4GDK A;  5FR3 A;  3RZW C;  1PGB A;  2EMS A;  1I42 A;  3Q2A C;  4NY0 A;  4MGK E;  3HK0 A;  3R7R A;  5H8Y E;  1WX8 A;  5J17 A;  1OEY J;  2L3Z A;  2IZV B;  1Z5S B;  4TMA B;  1WGG A;  5L83 A;  2WLB A;  2V3N A;  5EE9 A;  4PS3 A;  1XLO A;  1P0R A;  3AE7 B;  2PPH A;  4WWO A;  2WDQ B;  3DHG C;  5DCN A;  2G1E A;  3DVN V;  1WJ4 A;  5LLI A;  1KOT A;  1E8W A;  3SFE B;  2V0G A;  4QAY A;  1CZP A;  4M0W A;  3NVV A;  2CHW A;  2FCM A;  3LYY A;  3L0W B;  2FCN A;  3AN1 A;  1HQR D;  3NUH B;  2LEK A;  3IAS 1;  4EUT A;  3KLS X;  3FC4 A;  1FXI A;  3AE6 B;  4Q2J A;  3T8M A;  2N1W A;  2KDM A;  3MC9 A;  1STE A;  3UIP B;  3P4P B;  2K3U A;  3KYD D;  4ICU A;  1C4A A;  1HEZ E;  1V1P B;  4GDK B;  3HVD A;  4GSW A;  2MSE D;  1ET6 A;  3NVY A;  4J3O D;  1RWS A;  2V4I B;  1RRB A;  1YX5 B;  1IGD A;  2WXQ A;  4XWW A;  2WU2 B;  1UGM A;  2CHZ A;  1JML A;  1CJE A;  1LFD A;  2KDB A;  1BT0 A;  1P1A A;  1P3Q U;  3N30 A;  3SHQ A;  4EE2 A;  3ZVV A;  1NDD A;  1KTK A;  1G6J A;  4KGT A;  2KKC A;  1WIA A;  3CWI A;  4G11 A;  4W9H A;  3QIJ A;  3MJ5 A;  5C1Z A;  1J19 A;  1WJN A;  3M63 B;  3BZD B;  3W5V B;  4OZC A;  5BMI A;  3ML8 A;  4PK1 A;  3ZIM A;  5JHA A;  4P7I A;  2VZK B;  3DCG A;  2BWF A;  3VXW A;  2GI9 A;  2KNB A;  4ZYS A;  3GP7 A;  2LMC A;  3DBL I;  2PE6 B;  3PRZ A;  1F2R C;  1TZO A;  2W54 A;  2MRP A;  1D5M C;  1TY2 A;  3ZJU A;  4WWN A;  1SIJ A;  2Y3A A;  2BYV E;  2LWP A;  5J2R A;  3AMZ A;  4KKJ A;  4F7Z A;  2YVC A;  3PLU A;  4FJY A;  1SE2 A;  2DNF A;  4TQ1 A;  2QSD A;  3AEA B;  4YSX B;  3DBR B;  3PS6 A;  3MC0 B;  2LGX A;  3TMP B;  3L4P A;  2LZ6 A;  4NZL B;  4FHJ A;  3AU5 A;  4A90 A;  3DQV A;  2XK5 B;  2TSS A;  2VZK D;  4URK A;  1TY0 A;  3VTU A;  4FUL A;  3ZJV A;  3DHH C;  4BAX A;  2K39 A;  3RNF C;  3H1U A;  1JWB D;  3U8Z A;  1FRR A;  2BQQ A;  1JRP A;  4IG7 B;  3JSV B;  3VAW A;  5D2M B;  2RDB C;  2MBQ A;  3APC A;  4OHJ A;  1PFD A;  4ANU A;  2I38 A;  3SEB A;  3N9Y C;  1FXT B;  2KFK B;  1WX7 A;  2BKF A;  2IO3 B;  2INC C;  1JWA D;  4HPM B;  1KH0 A;  3ZO5 B;  1V5T A;  3Q14 C;  2JYE A;  2JY6 A;  3U4E G;  1LGR A;  2ASQ A;  1WR6 E;  4LJO B;  1I7H A;  2M19 A;  2QEJ C;  1CK1 A;  2CR5 A;  2DX5 B;  4K7S A;  3TBL D;  3RYT A;  2N9L A;  2JRI B;  1LQB A;  3NOB A;  2O6V D;  2L1A A;  1XLQ A;  2JVC A;  1ZP0 B;  4AWJ A;  1FCL A;  5KHO A;  2AYO B;  2KT7 A;  2WXM A;  2RMM A;  4BOS C;  1VR9 A;  1NI3 A;  4N9F 4;  1JRU A;  1AW7 A;  1J7B A;  3U7D A;  2RDH A;  4MJS A;  2N0S B;  3VTW A;  3E9S A;  3ZNI D;  1EWC A;  4PS7 A;  2LXC A;  2EKI A;  1JRO A;  2VH2 A;  1WGK A;  4ANX A;  2PW9 A;  2KX0 A;  2MW5 A;  4C80 A;  2FE8 A;  3E56 A;  2J0M A;  1QIL A;  2BB5 A;  3BY4 B;  4W9L A;  2RGF A;  3R7Q A;  3EUB 2;  3Q69 A;  2PLP A;  5D3D A;  4WAF A;  4GMV A;  3U52 E;  3IVF A;  3PHW B;  3AV8 A;  1PQS A;  1N6Z A;  4RCO A;  2KAN A;  2KDI A;  5G2N A;  4AP4 C;  3ZQ4 A;  2WXR A;  1AAR A;  4W9E A;  1ZGU B;  3Q3N C;  2KHW B;  2K8B A;  2D11 A;  3BVG A;  2AX5 A;  2BYF A;  2FIF A;  1TS4 A;  2E6X A;  4WIP A;  1CQV A;  1XLN A;  1ZW7 A;  1HZ5 A;  3PTF C;  4RM8 A;  2CKH B;  1KLG D;  1TS5 A;  1UWM A;  3AEB B;  2WQY B;  5FR6 A;  4K1R B;  4JQW C;  2GMI C;  1OEY A;  2K0P A;  2DZM A;  2HJ8 A;  3K9P B;  1PYW D;  3S2A A;  1L0V B;  1C78 A;  1WXS A;  3MP9 A;  5BYS A;  4L1B A;  1L5P A;  4BKS D;  2V3S A;  3ZNZ B;  1ROE A;  5GMV A;  2XEW A;  4JLC A;  1TZ1 A;  2UU7 A;  2CJN A;  1ISN A;  3HRD D;  3QX1 A;  4M8M A;  1C4P A;  1MJD A;  4ZRI A;  5EE3 A;  4GOC A;  4R3D A;  2NTT A;  4MH8 A;  3AB5 A;  2DYB A;  1IYF A;  3VR8 B;  5AUK A;  4LNN A;  1XLP A;  4XDD A;  3TUO A;  4WJQ A;  3DOW A;  4ZHP A;  4RGN A;  1UBQ A;  1WXQ A;  5TR5 A;  4B9K A;  2MBH A;  1WF9 A;  1FFV A;  4KV2 A;  2MA9 B;  4DQO C;  2AQ2 B;  2KAJ A;  1K51 A;  2MHJ A;  1L0X B;  1V1O A;  2GLS A;  2KYW A;  1SIF A;  1SBB B;  4XYC A;  2RDG A;  1VCB A;  1S1Q B;  1IP9 A;  3PGE A;  1E10 A;  4FA6 A;  3WAN A;  2V4L A;  4KKI A;  3VRA B;  4FLH A;  5D94 A;  4EZK A;  2N7J A;  2DAJ A;  4AJY B;  4A3O A;  4IDI A;  5BO4 B;  1V80 A;  4CHK A;  3DVG X;  5HHD G;  2LI5 A;  3PZD A;  3R2T A;  2JSV X;  2PE9 A;  4LLG M;  3N3K B;  1JWS D;  2KMM A;  1OQQ A;  3ZNG C;  2LRW A;  3DBL B;  3MTN B;  1DOY A;  1OGW A;  3DHI C;  3A4R A;  5I4D A;  3V6C B;  2ZPY A;  2N7E A;  3H6N A;  3JVZ X;  3AED B;  1A70 A;  3L16 A;  1TTN A;  2H89 B;  2WDV B;  4DXF A;  4TV3 A;  3AEC B;  1LXD A;  1N5X A;  3PPA A;  2KFK A;  1N60 A;  3DBR I;  4JX1 C;  4OZA A;  3KQ4 A;  3EC8 A;  3HHM A;  4HRS A;  1WE7 A;  5J18 A;  5H92 C;  4MM3 A;  4O1N A;  1L6U A;  2G4S A;  2FUG 1;  3CSF A;  3DPD A;  4W9C A;  1XCT L;  2SAK A;  3OG5 A;  3OWE B;  4I6P A;  3AI5 A;  2J42 A;  3PRE A;  1Q5W B;  2NR2 A;  2NTS A;  5EE1 A;  2L05 A;  1VDV A;  2AQ3 B;  3SDL C;  4EKU A;  2K8H A;  2KXJ A;  5G5H A;  3DWM A;  3Q3F A;  2GBK A;  4WQM A;  3I63 C;  2DWQ A;  2ZPN A;  1PGA A;  3MHZ A;  3U7Z A;  4KZC A;  3ZRC A;  2M8S A;  3AEG B;  2QDF A;  2I2Y A;  1D6E C;  4RGM A;  5HG2 A;  4LDT B;  4ZRQ A;  2BS4 B;  4EFO A;  4PYZ A;  5C23 A;  2KVZ A;  4WJN A;  1JWM D;  1RFA A;  2K22 A;  3BK1 A;  2N9E B;  2XBB C;  4A55 A;  1IBX B;  4UDU C;  3TCA A;  4FXC A;  3B1L X;  3NJT A;  4ASW C;  2WHI A;  4WJP A;  1P7E A;  2DZJ A;  4M01 A;  3MHS D;  4C00 A;  4LNK A;  4HRO A;  1N62 A;  2EKE C;  3W2D A;  2LXA A;  1FXA A;  2WX1 A;  1MPE A;  4ZRK A;  2LGD A;  3V05 A;  3ALB A;  3GE3 C;  2RD0 A;  2W55 A;  2KAC A;  4L2Y A;  3QAQ A;  1WSP A;  2LVO A;  3RUI B;  5CX3 A;  4H2A A;  2KK8 A;  2ZW0 A;  4N6E B;  4OVU A;  2EMT A;  1V9J A;  4NJC A;  2WXL A;  4OZB A;  2JXX A;  3N1X C;  2O2V A;  3IT6 B;  4LK0 M;  3CMM B;  5T8I A;  1YD8 U;  1E9M A;  5CHV C;  1QQR A;  2ZNV B;  2YEP B;  1MHH E;  2NS5 A;  1YOV B;  1J7A A;  2WXP A;  2KJH B;  3KH0 A;  1T0S C;  2K5P A;  2DAF A;  1J7C A;  3ZJT A;  3HUI A;  2L0T A;  1VJK A;  3P2B A;  1MI0 A;  2Z0E B;  3P4R B;  3Q6B A;  3TSS A;  5IOI A;  1FMA D;  4WUR A;  3Q8E A;  4MT5 A;  4US8 A;  4JGH B;  2WX0 A;  1RYJ A;  4REZ A;  3N1Z C;  1FD6 A;  2IGH A;  3KVF B;  4RNA A;  2KWD A;  4LJP B;  3RNC C;  5G55 A;  2ZCC A;  2BGF A;  2ON8 A;  3RNE C;  4RM9 A;  3ZLZ A;  4HCP B;  3RNG C;  4JWU C;  2KWU B;  4W9F A;  2RSU A;  3KUD B;  1V5O A;  4MAC A;  2WU5 B;  3H7P A;  1K50 A;  2BW2 A;  3VVW B;  4IOI E;  2M4N A;  4E3C A;  1NBF C;  4OVV A;  2HTM E;  5IP4 D;  3Q3J A;  4DHJ D;  1SJE D;  2UYZ B;  1N5W A;  4XC2 A;  3RI7 C;  4AUQ C;  2KN5 A;  1HA5 A;  3ZDM C;  2JQR B;  2KTR B;  3RD2 A;  4W9K A;  4ANV A;  2WNM A;  1RFK A;  2GBM A;  1E8X A;  1GG3 A;  1Y8R C;  3ZKJ C;  4YL8 A;  3V62 A;  2JF5 A;  1L7Y A;  2C7M B;  4MEL A;  3SD5 A;  2MX2 A;  3BIN A;  2QC8 A;  1WWT A;  2WXK A;  2BF8 B;  2BBC A;  3ZXV A;  4AQ7 A;  3AE1 B;  4ICV A;  2WYQ A;  1SSN A;  2GB1 A;  4MM3 B;  3IBE A;  2VRR B;  4BKS A;  3H9D A;  3NZ3 A;  1GAQ B;  2KLG A;  2MJD A;  3KWL A;  2BTE A;  1F0Z A;  1I4R A;  1UD7 A;  2A5U A;  2Z59 B;  1VRA B;  1I4X A;  1WFY A;  2D10 A;  2KO3 A;  2HDE A;  4XGA B;  2LGS A;  1TS2 A;  2L52 A;  3W1S C;  1OFF A;  3AE9 B;  5G5G A;  1F9J A;  1SF0 A;  3GB1 A;  5C3J B;  1E5W A;  1ZXI A;  2A4Z A;  1WI0 A;  2PVG C;  3TIX A;  1NYQ A;  1TKE A;  2WWZ A;  5FK9 C;  2MP2 A;  2PIA A;  3LJ3 A;  3U30 A;  2Z0D B;  4EZL A;  3TL5 A;  3ABV B;  2D3B A;  3ENE A;  1E8Y A;  2K6Q A;  1GC6 A;  3UIN B;  4US9 A;  1R4N B;  3RPF C;  1EO6 A;  2ACZ B;  3M3J A;  3DVG Y;  3C8Y A;  1T0Y A;  2B76 B;  1ESF A;  4TSS A;  2VH1 A;  5JHB A;  4NAW B;  2GRI A;  1F52 A;  3QA8 A;  1WH3 A;  4RF0 A;  4RH6 A;  2IGD A;  2K6D B;  4BKG A;  1JW9 D;  4DDG D;  2ZNV C;  3JW0 X;  3PV1 A;  4LNI A;  4YTN B;  1NEN B;  4TKN A;  1EU3 A;  2NBV B;  2D2Q A;  3TEW A;  1KRH A;  2WS3 B;  2ZVN A;  2DZK A;  3UIO B;  5DPR A;  3TEY A;  1WX9 A;  3TJP A;  4L23 A;  1TIF A;  1I4P A;  3BII D;  1FNU A;  4NJ6 A;  1WMH A;  4PYU A;  2KVR A;  3FIL B;  3QWZ B;  3ZUN A;  1D3Z A;  4K7W A;  2OJR A;  2LJI A;  4DHZ E;  1YQ3 B;  4ACF A;  3WAO A;  2AWT A;  3PRM B;  1VZ7 A;  4EOY A;  4BBN F;  2OOB B;  4DHJ B;  1WJ6 A;  2DYO A;  5TSS A;  1WZ3 A;  2KMC A;  4IM0 A;  1PGX A;  4GIV A;  2V1Y A;  4LCD E;  4BZA A;  3HVZ A;  2WXN A;  3A9K B;  2J4X A;  2NBW B;  4MEM A;  2W9N A;  2IGG A;  3WIM A;  1RM6 C;  2L8J A;  5DPS A;  4KSK C;  4BOZ B;  3EFU A;  2IPK D;  2DEN B;  4HWI B;  5CHF A;  4FJV B;  1WXV A;  5JXV A;  2ZZP B;  3PLV A;  2HJ1 A;  4MGY E;  4K3C A;  2C5L C;  5BMH A;  2DYM A;  3T9L A;  2I1K A;  4JE3 B;  1KM7 A;  2IO1 B;  5L95 C;  5C2T B;  4X57 B;  4IUM B;  1MFW A;  2KN4 A;  2PEA A;  2R2O A;  1KF6 B;  5IKC M;  1EU4 A;  1FPY A;  2AQ1 B;  3M62 B;  4ZDV A;  3RZF A;  1MG4 A;  2L83 A;  1R7S A;  1K53 A;  2INN E;  3RN9 C;  4G50 A;  3VDZ A;  2KD0 A;  1V2Y A;  3AM9 A;  3Q8B A;  2WP9 B;  4NQK E;  3VHT C;  1GOZ A;  1EM7 A;  4HKQ A;  1WM2 A;  1J0G A;  2NPT B;  1F1H A;  3W9C B;  3LB8 C;  4XWT A;  1FFU A;  5IN7 A;  3GOE A;  1FRD A;  3HIZ A;  2INP E;  1SEB D;  4I6L B;  1YQB A;  3APD A;  1TGZ B;  4ARC A;  1MHX A;  3NRZ A;  2GOW A;  2PTL A;  2W82 A;  4FJZ A;  2IJ0 A;  4NJ7 A;  2D5G A;  1A5R A;  2N7D A;  4P16 A;  4FN2 A;  1YJI A;  1QF6 A;  3PT2 B;  1R4N I;  1L4Z B;  3NZS A;  3H7S A;  2IY0 B;  4RGO S;  4HPL B;  1VLB A;  3LXF A;  1QT9 A;  2NVU I;  3RMK C;  1X1M A;  3AE3 B;  1ZKH A;  2GBN A;  2NBU A;  3KUC B;  4CO7 A;  3IAM 1;  4ZOH C;  1YIW A;  3VH4 B;  4A8X C;  3QC8 B;  4ZRP A;  1T3Q A;  4IKG A;  1I35 A;  1D4B A;  1C76 A;  3B08 A;  4USA A;  1K8R B;  2FUH B;  2JPH A;  2MBO A;  3RNB C;  4W9G A;  2CHX A;  5LXH A;  3FKY A;  3EGR A;  1C77 A;  1BUI C;  2KC2 A;  2GBJ A;  1KLV A;  5LNK 1;  2LD9 A;  2YEP F;  1V1P A;  1VZ6 A;  2KQS A;  3QK0 A;  4IC7 B;  2PVO D;  2SEB D;  2JZZ A;  2B3A A;  1WM3 A;  1M4V A;  4LTU A;  3OLM D;  3GZN B;  2Y5P A;  4PT5 A;  3I3T B;  4C4V B;  1WRI A;  3L54 A;  2MJE A;  2LFI A;  1QKZ A;  3P42 A;  4IWQ A;  4LNO A;  3VR9 B;  3VTV A;  2JZ3 B;  1T6B X;  3M95 A;  1C3T A;  1WZ0 A;  2HTH A;  3KWV A;  1KJT A;  4KZ0 A;  4HJG E;  1B1Z A;  4EEW A;  1ZDV A;  4K7U A;  1L4D B;  1EUV B;  2KFJ A;  2OJW A;  2N1V A;  5BYR A;  1H4R A;  1FM0 D;  1SE3 A; 
#chains in the Genus database with same CATH homology
 2XK5 B;  3PRP B;  4PS8 A;  2KLC A;  1V9J A;  2KWC A;  4URK A;  2JXX A;  3EHV A;  3VUW A;  2O2V A;  4IWO A;  5JH5 C;  1P98 A;  3VTU A;  1UH6 A;  4FUL A;  3CMM B;  2K39 A;  3H1U A;  2IBI B;  3EEC A;  1YD8 U;  1WR1 A;  3U8Z A;  5CHV C;  1RLF A;  2UWQ A;  2ZNV B;  3ZNH B;  4TQ0 A;  4IG7 B;  2J0K A;  2NS5 A;  3JSV B;  3VAW A;  4GN1 A;  2KJH B;  2DHZ A;  5D2M B;  3RUL A;  3KH0 A;  4AJW A;  3L13 A;  2LGY A;  2MBQ A;  2DAF A;  4DDI D;  4WJO A;  1GNU A;  2G45 B;  2L0T A;  1E7U A;  3APC A;  4KIK B;  1E90 A;  3P2B A;  3D32 A;  4HCN B;  2Z0E B;  3B0A A;  3OJ4 B;  4XX5 A;  3W1Y A;  4ANU A;  4NPN A;  1HE8 A;  2QHO A;  2CU1 A;  4GDL A;  4JGH B;  2WX0 A;  4GU2 A;  5E6N A;  3A1Q A;  4F1S A;  4J6I A;  1FXT B;  2KFK B;  1WX7 A;  2Y5B B;  2BKF A;  2LVQ A;  3KVF B;  3V6E B;  2IO3 B;  4LJP B;  2L0F A;  5HKH A;  5G55 A;  4HPM B;  4MDK E;  2ZCC A;  2BGF A;  3OJ3 A;  2JRH A;  3ZO5 B;  1V5T A;  3RCZ A;  1LM8 B;  2JY6 A;  4RM9 A;  5IAA C;  3ZTC A;  2K25 A;  3ZLZ A;  4HCP B;  2ASQ A;  2KJR A;  3K9O B;  1WR6 E;  4W9I A;  4LJO B;  4BFR A;  4FHK A;  2CR5 A;  2KWU B;  2KOX A;  2DX5 B;  2D3G A;  2LJ5 A;  4W9F A;  2RSU A;  1WXM A;  3KUD B;  4K7S A;  1V5O A;  2MBE A;  3TBL D;  3X23 A;  3RYT A;  2JRI B;  3H7P A;  4GB9 A;  4MSM B;  1LQB A;  3NOB A;  5DPT A;  4NAW A;  3VVW B;  2O6V D;  2ZEQ A;  1EF1 A;  2JVC A;  3W1S A;  1CMX B;  1Q0W B;  2M4N A;  3WAM A;  2IY1 B;  4E3C A;  1NBF C;  4AWJ A;  3DBS A;  4OVV A;  4G3X B;  4KIK A;  5KHO A;  2KTF A;  2AYO B;  3OAW A;  3Q3J A;  4DHJ D;  2AEH A;  2UYZ B;  4FAD A;  3PVL A;  4XC2 A;  1V6E A;  4ANW A;  3UF8 A;  4HK2 A;  4BOS C;  4AUQ C;  2KN5 A;  2RPQ A;  4IM2 A;  3L08 A;  3ZDM C;  2KTR B;  3RD2 A;  3V60 A;  1UZX B;  4W9K A;  4ANV A;  5E6O A;  4N9F 4;  5AZF A;  1JRU A;  3AUL A;  3U7D A;  2GBM A;  1E8X A;  1GG3 A;  4MJS A;  1Y8R C;  5LXI B;  1H8C A;  3ZKJ C;  3VTW A;  3ZNI D;  3ZW3 A;  3NZU A;  3VH3 B;  1WGD A;  4YL8 A;  3V62 A;  2KTR A;  2JF5 A;  1XQQ A;  1L7Y A;  2C7M B;  2MQJ A;  2NPT A;  3QCA A;  4MEL A;  4PS7 A;  4DK5 A;  2JT4 B;  3SD5 A;  2BYE A;  4II2 B;  2MX2 A;  3BIN A;  3ML9 A;  2LXC A;  4DWF A;  2BF8 B;  1E8Z A;  2PJH A;  4II3 B;  2M1M A;  4ANX A;  4ICV A;  3L17 A;  1GJZ A;  2WYQ A;  3WAP A;  1C1Y B;  3WA0 A;  2KX0 A;  4DHZ B;  3IBE A;  2IYD B;  2VRR B;  3O65 B;  3A9K A;  3PHX B;  3H9D A;  3ZDT A;  2D07 B;  2C9W B;  4BKS A;  2KLG A;  2MW5 A;  1V81 A;  1VD2 A;  3ECI A;  2J0M A;  2BKR B;  4MJS B;  1UD7 A;  3BY4 B;  1WJU A;  2A5U A;  4W9L A;  2KO3 A;  1SE9 A;  1WFY A;  2D10 A;  2Z59 B;  2KC1 A;  2RGF A;  4NNJ B;  3R7Q A;  4BKT A;  2KQ7 A;  1GC7 A;  3UGB B;  3VFK A;  4GMV A;  5KHQ A;  3RT3 B;  4RMA A;  3IVF A;  3PHW B;  2MLB A;  3SU8 X;  3W1S C;  1PQS A;  1EF5 A;  2KAN A;  2KDI A;  4A20 A;  2M17 A;  1F9J A;  5G2N A;  4AP4 C;  1E7V A;  1AAR A;  3CST A;  1E5W A;  2REX A;  2HD5 B;  2A4Z A;  4W9E A;  2GBR A;  1WI0 A;  1ZGU B;  4TUU A;  2KHW B;  2K8B A;  3GZN I;  3QJZ A;  4M8N A;  3TIX A;  3ZTD A;  2WWZ A;  5CTR C;  2MP2 A;  1M94 A;  2D11 A;  3CF6 E;  2FNJ B;  3LJ3 A;  4A3P A;  3U30 A;  2Z0D B;  3NHE B;  4EZL A;  2BYF A;  2FIF A;  2MCN B;  3TL5 A;  3UQA A;  1WY8 A;  1ZW7 A;  2KJ6 A;  3ENE A;  1S3S G;  3PTF C;  2N9P C;  4RM8 A;  4ZYN A;  2HE7 A;  2KMA A;  2CKH B;  2G4D B;  1E8Y A;  2KX3 A;  1GC6 A;  2K6Q A;  3UIN B;  1EO6 A;  3M3J A;  3DVG Y;  1NI2 A;  4K1R B;  1T0Y A;  4HJK A;  4JQW C;  5FR6 A;  2NCN A;  3QAR A;  2IO0 B;  2GMI C;  1OEY A;  2DZM A;  2HJ8 A;  3K9P B;  3PSE B;  5AEK B;  4NAW B;  5JHB A;  3S2A A;  4E71 A;  5D7G A;  3QA8 A;  1WH3 A;  5AZG A;  1WXS A;  2BPS A;  2LRU A;  3MJW A;  1UBI A;  4BKS D;  2V3S A;  2K6D B;  4BKG A;  4DDG D;  3ZNZ B;  2ZNV C;  3JW0 X;  4M0W B;  4EZJ A;  5CHW A;  5GMV A;  2R2Q A;  2ZCB A;  2XEW A;  3N32 A;  3PV1 A;  4JLC A;  1TZ1 A;  4KVG B;  2RR9 A;  1ISN A;  4WQO B;  2KZR A;  4TKN A;  4IM3 A;  1Z2M A;  4G0N B;  3QX1 A;  4M8M A;  1WYW B;  2FID A;  4GDL B;  2NBV B;  1WMH B;  1OQY A;  2D2Q A;  4ZRI A;  2G3Q B;  2ZVN A;  4B6W A;  2MP2 B;  2C60 A;  3LDZ E;  3JSV A;  2DZK A;  4GOC A;  1YJ1 A;  5DPR A;  3UIO B;  1WX9 A;  2AL6 A;  3TJP A;  4MGI E;  1SGH A;  4HDO A;  1QZE A;  2DYB A;  4NJ6 A;  1WMH A;  4PYU A;  2KVR A;  3QWZ B;  3ZUN A;  1D3Z A;  4BBN C;  2ZVO A;  1IYF A;  4K7W A;  2OJR A;  4DHZ E;  3WAL A;  2AL3 A;  4K81 A;  4XZ4 A;  3QHT A;  2AWT A;  3PRM B;  3WAO A;  4DXA B;  4WJQ A;  3DOW A;  5EDS A;  1MG8 A;  4EOY A;  2O6V A;  4BBN F;  2OOB B;  1UBQ A;  2ZJD A;  1WJ6 A;  4WAA A;  5TR5 A;  4B9K A;  4DHJ B;  1L2N A;  2MBH A;  1UEL A;  1WF9 A;  4AOF A;  2DYO A;  1WZ3 A;  2KMC A;  4GGQ A;  3VUY A;  4IM0 A;  2K1F A;  3R3M A;  3X0W A;  4FBJ B;  4I6N B;  2O6V B;  2J7Q B;  2O2V B;  4GIV A;  4KV2 A;  4BVU C;  2V1Y A;  2MA9 B;  4LCD E;  4HLE A;  3L10 B;  2N9X A;  3A9K B;  4MEM A;  2NBW B;  2W9N A;  1TBE A;  1XT9 B;  1GUA B;  3WIM A;  4LDT D;  1IPG A;  2KWV B;  1OTR B;  1WXA A;  1SIF A;  2L8J A;  2N4F A;  3A4S C;  4HXD A;  5DPS A;  1WGR A;  3A1Q B;  4MGZ E;  5JZE B;  4KDI C;  4KSK C;  4BOZ B;  1WE6 A;  1VCB A;  1S1Q B;  4HDQ A;  3QQ8 B;  3ZRF A;  1IP9 A;  3EFU A;  3PGE A;  4ZRJ A;  2FAZ A;  3NY5 A;  2IO2 B;  3A9J B;  4GDK A;  4FA6 A;  4KDL B;  2C7N B;  3RZW C;  3A33 B;  2DEN B;  3WAN A;  2V4L A;  4HWI B;  2I1J A;  5CHF A;  2DZI A;  2EMS A;  1WXV A;  4FJV B;  4FLH A;  4MH0 E;  2L76 A;  5E6P A;  1I42 A;  2JWZ A;  5D94 A;  4F8C B;  4NY0 A;  2ZZP B;  3PLV A;  4MGK E;  4MGY E;  3HK0 A;  3R7R A;  2DAJ A;  4EZK A;  4AJY B;  1R4M I;  2C5L C;  4W9D A;  4A3O A;  1WX8 A;  2DYM A;  1V80 A;  5BO4 B;  4CHK A;  3DVG X;  1OEY J;  5J17 A;  3T9L A;  2I1K A;  2L3Z A;  3KYC D;  2LI5 A;  2IZV B;  3PZD A;  1Z5S B;  1WGG A;  5L83 A;  1KM7 A;  2IO1 B;  2PE9 A;  5L95 C;  3N3K B;  4X57 B;  4IUM B;  2L7R A;  2PEA A;  3ZNG C;  2LRW A;  2R2O A;  4PS3 A;  1XD3 B;  1P0R A;  2PPH A;  3M62 B;  3MTN B;  4ZDV A;  1OGW A;  3A9J A;  4WWO A;  3A4R A;  3RZF A;  5DCN A;  3V6C B;  2ZPY A;  1J8C A;  2N7E A;  1WJ4 A;  3DVN V;  3APF A;  3KW5 B;  4G50 A;  3VDZ A;  3H6N A;  2KD0 A;  3JVZ X;  5LLI A;  1V2Y A;  1KOT A;  3L16 A;  1TTN A;  1E8W A;  4NQK E;  4WWP A;  3R66 C;  2WDT B;  3VHT C;  2CHW A;  2FCM A;  3AU4 A;  4TV3 A;  3L0W B;  2FCN A;  1WM2 A;  1LXD A;  1J0G A;  2M0X A;  2NPT B;  3PPA A;  3IHP C;  2KFK A;  3DBR I;  4EUT A;  2LUE A;  3EC8 A;  4IWP A;  3HHM A;  4W9J A;  1WE7 A;  2XK5 A;  3UQB A;  5J18 A;  3GOE A;  3T8M A;  4MM3 A;  2N1W A;  3HIZ A;  4CYE A;  1WRD B;  2G4S A;  4E74 A;  3UIP B;  2CS4 A;  4HVB A;  4I6L B;  1YQB A;  3APD A;  1TGZ B;  3CSF A;  3KYD D;  4ICU A;  5D6J B;  2LVP A;  3DPD A;  2KDF B;  4IW0 A;  4W9C A;  2GOW A;  4FJZ A;  4GDK B;  4GSW A;  2FCS A;  3DDC B;  4NJ7 A;  2MSE D;  3HM3 A;  3KUZ A;  1A5R A;  2N7D A;  3AI5 A;  4I6P A;  2C7H A;  3H7P B;  2MWS B;  3PRE A;  4FN2 A;  1Q5W B;  2NR2 A;  5DPW A;  2MBB B;  4JIO U;  3PT2 B;  1R4N I;  2L05 A;  3NZS A;  3H7S A;  2IY0 B;  4KSL C;  1RRB A;  1YX5 B;  4HPL B;  3SDL C;  4EKU A;  2FCQ A;  3AXC A;  2K8H A;  3IFW B;  2NVU I;  2KXJ A;  1X1M A;  3DVN U;  1ZKH A;  2GBN A;  4MSQ B;  3Q3F A;  1UGM A;  2GBK A;  2NBU A;  2YLM A;  2CHZ A;  3JYU A;  4B95 A;  4DBG A;  3KUC B;  4CO7 A;  1LFD A;  1YX6 B;  1YIW A;  2KDB A;  2ZPN A;  1BT0 A;  3VH4 B;  4KZC A;  3ZRC A;  2M8S A;  1P1A A;  3QC8 B;  1P3Q U;  3N30 A;  3SHQ A;  1I35 A;  3C0R B;  3ZVV A;  2L00 B;  1NDD A;  4LDT B;  1G6J A;  3B08 A;  2KKC A;  1WIA A;  4G11 A;  4W9H A;  4EFO A;  1K8R B;  3QIJ A;  4PYZ A;  2FUH B;  2JPH A;  2MBO A;  5C23 A;  5C1Z A;  1J19 A;  1WJN A;  4W9G A;  2CHX A;  5LXH A;  1U4A A;  4WJN A;  3M63 B;  3ONS A;  1V49 A;  1RFA A;  3ML8 A;  3DBH I;  2KC2 A;  1KLV A;  2GBJ A;  5IA7 A;  4GXB A;  2LD9 A;  3IG3 A;  1P9D U;  2N9E B;  2XBB C;  3ZIM A;  5JHA A;  4P7I A;  2KQS A;  1WGY A;  3DCG A;  2BWF A;  3TCA A;  3VXW A;  3QK0 A;  3NS8 A;  4IC7 B;  2KNB A;  3B1L X;  4NQL B;  2JZZ A;  2B3A A;  4ASW C;  4WJP A;  1V86 A;  1WM3 A;  3DBL I;  2BWE S;  2DZJ A;  3OLM D;  3HM6 X;  2PE6 B;  2K8C A;  3MHS D;  3I3T B;  3V61 A;  1Q1O A;  2JUO A;  3PRZ A;  3L54 A;  2MRP A;  4JL9 A;  4IWQ A;  2EKE C;  1RAX A;  4WWN A;  2LXA A;  2WX1 A;  2BYV E;  2LWP A;  5J2R A;  3VTV A;  2JZ3 B;  4F7Z A;  2YVC A;  4ZRK A;  3PLU A;  2LGD A;  3ALB A;  3M95 A;  4FJY A;  2RD0 A;  4TQ1 A;  1C3T A;  1WZ0 A;  3VQI A;  2HTH A;  2J0J A;  3QAQ A;  1KJT A;  4KZ0 A;  2LVO A;  3RUI B;  3PS6 A;  5AZH A;  4EEW A;  2KDE B;  2LGX A;  5CX3 A;  3TMP B;  4K7U A;  2KK8 A;  3VUX A;  1EUV B;  2KFJ A;  2LZ6 A;  2N1V A;  4FHJ A;  1H4R A;  1WGH A;  3AU5 A;  4OVU A;  3DQV A;  2EMT A;  2LAS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...