2ZEQA

Crystal structure of ubiquitin-like domain of murine parkin
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
78
structure length
78
Chain Sequence
b'MGMIVFVRFNSSYGFPVEVDSDTSILQLKEVVAKRQGVPADQLRVIFAGKELPNHLTVQNCDLEQQSIVHIVQRPRRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 ubiquitin-protein ligase parkin
publication title Crystal structure and molecular dynamics simulation of ubiquitin-like domain of murine parkin
pubmed doi rcsb
source organism Mus musculus
molecule tags Ligase
total genus 17
structure length 78
sequence length 78
ec nomenclature ec 2.3.2.31: RBR-type E3 ubiquitin transferase.
pdb deposition date 2007-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2zeqA00
3JYUA 2KX0A 2LVQA 1OGWA 4WQOB 3R7QA 5JHAA 2JUOA 1P1AA 1Z2MA 4GIVA 2D3GA 1E8ZA 1V2YA 3OAWA 2MBEA 2AL6A 1TBEA 4KV2A 1UD7A 2G3QB 2K25A 2OOBB 4K1RB 2LRUA 3B08A 4EZJA 2CU1A 5DPTA 1QZEA 2MRPA 3WA0A 3UGBB 2BWES 3AULA 2V1YA 3KUZA 4FHKA 3W1SC 2JWZA 2WX0A 1CMXB 5LLIA 4MGYE 3DCGA 1V5OA 3DVGX 3I3TB 3VUXA 3B1LX 4W9FA 2MWSB 2JT4B 2FCNA 2AL3A 2I1JA 2KC1A 4DHJB 1Q1OA 1WXSA 2KJ6A 2O6VA 4GDKB 4IG7B 3EFUA 2ZCBA 4GSWA 2JXXA 2EMSA 1UH6A 4ANXA 3A9KB 3RZFA 3VAWA 1WZ3A 2NPTB 1IP9A 4OVVA 3DQVA 3ALBA 5AZGA 2WDTB 4YL8A 3BINA 3QIJA 4I6LB 4KSLC 4G3XB 5C1ZA 3HIZA 1UELA 3PTFC 3V60A 2MX2A 2N7DA 3TJPA 4JL9A 5C23A 2L0TA 4MSQB 4PS7A 1WZ0A 2KQSA 2N9EB 3QJZA 1UZXB 4IW0A 3QC8B 5G2NA 2V4LA 1I35A 4FJVB 3VTVA 1WGYA 4JGHB 4GDKA 3TIXA 3NS8A 2YLMA 2CS4A 5CHWA 2RGFA 2C9WB 2ASQA 4NJ7A 3LJ3A 4EUTA 3TCAA 2NVUI 1WX8A 4LDTD 2KFKA 4BOZB 2KN5A 5BO4B 4IM3A 5E6NA 4PYUA 4WJQA 3IVFA 3SD5A 1WJ6A 2KD0A 1E5WA 1I42A 2Y5BB 4II3B 4LJOB 4CYEA 3DBLI 1TTNA 4FLHA 5G55A 3UQBA 3U8ZA 4LJPB 3PVLA 2IO0B 4IM0A 2L05A 4EZLA 3L0WB 5JH5C 2KTFA 4IUMB 1KLVA 4K7WA 3JSVB 4B95A 3APDA 4MSMB 3UIOB 3L16A 3B0AA 2O2VB 3H7SA 4DHZB 1V5TA 4W9KA 4MH0E 3VTWA 5CHVC 2LWPA 4X57B 2J0MA 4A20A 2M8SA 4BBNF 3AI5A 4BFRA 1KM7A 2NBWB 2DHZA 1U4AA 3Q3JA 2KFJA 3JVZX 2KHWB 3ZVVA 3ENEA 4BBNC 5L83A 2K8HA 4ZRKA 4HPLB 3WANA 2BYFA 2NBVB 2EKEC 3AXCA 4FN2A 4WWPA 4JIOU 4MGIE 4MEMA 3OLMD 1P0RA 2C7MB 4P7IA 1Z5SB 2FNJB 2RR9A 1YX5B 4FBJB 1WX9A 1NI2A 1WGRA 2FUHB 3PLUA 3VH3B 2FCSA 3DVNV 3MJWA 4PS3A 4ANUA 4RM9A 3N30A 2M4NA 3K9OB 1IYFA 4IWPA 2AYOB 5D6JB 3N3KB 3PREA 1WY8A 2K8CA 1NDDA 4URKA 1XT9B 2N9XA 2G45B 1VCBA 4ZRIA 5HKHA 3X23A 3WAPA 2JZ3B 1IPGA 2V3SA 3VXWA 1KJTA 2ZNVB 1WXMA 1WE7A 2N4FA 4MM3A 2DYOA 2LGXA 3VH4B 4HXDA 3M95A 2O6VB 2XK5B 3CSFA 3WAMA 4GXBA 4NAWB 1EF1A 3PHWB 3ZRFA 3MTNB 5DCNA 4ANVA 2C7HA 1NBFC 2UWQA 4ASWC 1XQQA 2FAZA 2Z0DB 3ZNID 2ZPYA 3A1QB 3DPDA 2MA9B 3GOEA 1MG8A 3QAQA 1J19A 1RRBA 3DBRI 3PV1A 2C7NB 2N1WA 2KZRA 2FIFA 1WE6A 3EHVA 2DZJA 1WXVA 3KH0A 1E8XA 4TQ0A 4F1SA 1LFDA 4I6PA 2HJ8A 2AWTA 3DBHI 5AZFA 1X1MA 2WX1A 4M8MA 4GDLB 4BKGA 3MHSD 5L95C 4BOSC 2LRWA 2R2QA 1ZW7A 2DZKA 1V9JA 2Z0EB 2KQ7A 3ML8A 2RD0A 3V6CB 2XK5A 1YJ1A 3SU8X 4NAWA 5EDSA 1H8CA 3L54A 2K39A 2IY1B 2L0FA 2OJRA 3L10B 2PEAA 4RM8A 2KMCA 3NHEB 2A4ZA 2KFKB 3PZDA 1Y8RC 4BVUC 3IFWB 3EECA 1D3ZA 2KMAA 3A1QA 2KTRB 4WWOA 4K7UA 1WI0A 4GMVA 5D94A 2MCNB 4FADA 4EZKA 4HVBA 1UBIA 3R66C 3RCZA 1R4NI 2L76A 3X0WA 2IO3B 1RAXA 3CMMB 4HWIB 1P9DU 3VTUA 4BKSD 5AZHA 2KOXA 3KW5B 2BKRB 2I1KA 2KJHB 3AU5A 4GDLA 1SGHA 1WH3A 2D2QA 3A4RA 4NJ6A 5CHFA 1G6JA 3H6NA 2PJHA 3L17A 1H4RA 1E90A 5J2RA 4HDQA 4TQ1A 2HE7A 4PS8A 2J0KA 3UQAA 2REXA 1J8CA 2DZIA 3W1YA 1L7YA 3AU4A 3QA8A 1E7VA 3S2AA 4G11A 1GJZA 4AJWA 5IAAC 2KO3A 3TL5A 2LI5A 3LDZE 1WYWB 3A9JA 2KTRA 3Q3FA 1GNUA 4HDOA 3NZSA 3EC8A 1HE8A 2MQJA 2DYBA 4EOYA 1J0GA 2MLBA 2O6VD 4II2B 1OEYJ 3ZNZB 2ZNVC 4F8CB 2J0JA 4AOFA 3PS6A 2HTHA 2J7QB 1F9JA 4M8NA 2IYDB 2A5UA 3VFKA 1EO6A 1C3TA 1L2NA 3NOBA 4GU2A 5E6OA 2LGDA 3TBLD 3DVNU 4DBGA 5LXHA 2DAJA 2IO1B 2KX3A 3N32A 1GG3A 1LQBA 3ML9A 3U30A 3VQIA 2KK8A 3NZUA 5JZEB 3KVFB 3APCA 3U7DA 3ZUNA 3KUCB 2RSUA 3SHQA 4AJYB 4BKTA 3QQ8B 1T0YA 3IBEA 2ZVNA 4CO7A 3ZTDA 2L00B 4EFOA 3KYDD 2NS5A 4OVUA 3NY5A 3H9DA 4NY0A 1SIFA 3WALA 4IM2A 2K6DB 3WIMA 3VVWB 3DDCB 3ZNGC 4ZRJA 4XZ4A 2BPSA 1S1QB 1YX6B 3QARA 2R2OA 3PT2B 4DHJD 3O65B 1A5RA 4KIKB 4TKNA 1YIWA 3W1SA 1YD8U 4A3PA 3OJ4B 2LVOA 2KDBA 1K8RB 1Q5WB 2D11A 4GB9A 4G50A 3ZO5B 3K9PB 1YQBA 4MDKE 1WJ4A 2L7RA 2XBBC 3HM6X 4K7SA 2C5LC 3VUWA 3ZIMA 5KHQA 2C60A 2GOWA 1S3SG 5D2MB 2KWCA 2G4DB 2LJ5A 2D07B 3DVGY 1WX7A 3QWZB 3T9LA 3UINB 2MBQA 3UIPB 5J18A 1WIAA 4XC2A 4FULA 1RFAA 4JLCA 2BGFA 4W9IA 1KOTA 2MBBB 3M3JA 4N9F4 3HHMA 3RULA 3VUYA 2VRRB 3DOWA 4E71A 1GC6A 2ZCCA 2CHZA 4KIKA 1TZ1A 2FCMA 4NQLB 2KXJA 2LD9A 2NR2A 3CF6E 1Q0WB 2LASA 2MP2A 4HK2A 4HLEA 2LZ6A 2QHOA 3RUIB 1RLFA 3RT3B 2DX5B 3PRMB 1C1YB 1WMHB 3PGEA 4MGKE 3DBSA 4XX5A 4FJYA 5FR6A 1VD2A 3PLVA 3R7RA 5CTRC 4TUUA 4ANWA 3C0RB 2JF5A 2CHWA 3KUDB 3SDLC 2KKCA 2KLCA 2N7EA 4WAAA 4WWNA 3ZNHB 4HCNB 2DENB 3ZDMC 2HD5B 1WF9A 1EUVB 3A9JB 4KDIC 2MSED 3ECIA 4IWQA 2M17A 2DYMA 3QCAA 3PSEB 1AARA 4G0NB 1WJNA 1UBQA 3H1UA 1E8YA 1TGZB 2BKFA 2RPQA 3H7PB 2NBUA 4E74A 2YVCA 1WRDB 2CKHB 4W9HA 1WM3A 3ZTCA 3APFA 2N1VA 2B3AA 2K1FA 2MBHA 2PE6B 3IHPC 4LCDE 3VHTC 4FJZA 5IA7A 2CHXA 4MGZE 1WMHA 4JQWC 2JRIB 4F7ZA 4KZ0A 1SE9A 2KWVB 3V6EB 3QX1A 4KSKC 2IY0B 2WWZA 2D10A 1BT0A 1P98A 2IBIB 5AEKB 1WGDA 1E7UA 1P3QU 4W9CA 3UF8A 4ICVA 3RD2A 1ZGUB 3VDZA 3JW0X 3ZRCA 4DK5A 1EF5A 2PE9A 4WJOA 2GBJA 1GUAB 3PRZA 4IC7B 2M1MA 4ZDVA 4A3OA 4GOCA 2LUEA 3PPAA 3M63B 4W9LA 3WAOA 3CSTA 1M94A 4M0WB 2ZEQA 2JY6A 4EEWA 5J17A 3H7PA 3HM3A 2KDIA 4ICUA 3QHTA 4HJKA 4KVGB 1V80A 2FCQA 2GBRA 1ZKHA 2G4SA 2WYQA 1XD3B 4B9KA 4WJPA 1V86A 2MW5A 2JPHA 2W9NA 1LM8B 2KDFB 3TMPB 3A33B 4MJSB 3L08A 5DPRA 2ZVOA 1WR1A 2DZMA 1E8WA 4NPNA 2KC2A 4RMAA 4FA6A 2Z59B 2AEHA 4W9DA 3GZNI 5DPWA 2JVCA 4W9JA 4FHJA 5JHBA 2KVRA 3A9KA 4AWJA 2NPTA 5TR5A 3T8MA 4DDGD 2GBMA 1WXAA 1JRUA 2M0XA 4K81A 2BYEA 2KWUB 2NCNA 1WGGA 2LXCA 4HCPB 4NNJB 3V61A 4W9GA 3ZKJC 5LXIB 4AUQC 2DAFA 2KANA 2KNBA 5GMVA 1UGMA 2XEWA 2KLGA 1WGHA 2BWFA 1ISNA 2L8JA 4DWFA 4NQKE 1V6EA 2LGYA 4W9EA 2JRHA 4J6IA 2UYZB 4DHZE 3PHXB 2KJRA 4IWOA 2K8BA 2MP2B 3D32A 1V81A 2GMIC 2L3ZA 1WFYA 2FIDA 4HPMB 4MJSA 1R4MI 3RZWC 3R3MA 2IZVB 1PQSA 2CR5A 1GC7A 2JZZA 4GN1A 4I6NB 4CHKA 4E3CA 4DDID 4EKUA 3ZLZA 1LXDA 3KYCD 2BF8B 1V49A 3OJ3A 2ZJDA 4KZCA 2N9PC 3ONSA 1WJUA 3BY4B 3P2BA 2K6QA 1OEYA 3HK0A 4TV3A 3JSVA 4WJNA 4DXAB 2LXAA 3A4SC 4LDTB 3M62B 4AP4C 4MELA 2O2VA 3RYTA 2BYVE 2EMTA 4B6WA 2IO2B 4KDLB 1WM2A 3ZW3A 5DPSA 3ZDTA 3QK0A 3PRPB 1OTRB 3L13A 2PPHA 4ZYNA 2KDEB 5CX3A 1OQYA 4PYZA 3V62A 2GBNA 2ZZPB 2LVPA 4BKSA 2ZPNA 2GBKA 5D7GA 1WR6E 2MBOA 1FXTB 5KHOA 4GGQA 5E6PA 3IG3A
chains in the Genus database with same CATH superfamily
3JYUA 3EGRA 4WQOB 2W54A 2QC8A 1Z2MA 2IPKD 3URYA 5FK9C 4GIVA 2D3GA 1E8ZA 2WXLA 2MBEA 2JXTA 4NJCA 2RDHA 2LRUA 3B2GA 2BWES 3KUZA 2V1YA 3P4RB 2BS3B 2WX0A 1CMXB 1V5OA 5HG2A 4N6EB 4DHJB 1Q1OA 1WXSA 2KJ6A 4GDKB 4IG7B 4OZCA 4RGMA 4D2KA 3RNCC 1R4MB 3A9KB 2FBWB 1F1HA 3Q14C 1IP9A 4OVVA 3DQVA 4YL8A 3DHIC 4KSLC 4XDDA 3V60A 4YTMB 1CJEA 4MSQB 4PS7A 4IW0A 3QC8B 1VZ8A 1FNUA 2V4LA 4FJVB 2BB6A 1WGYA 4HEA1 2C9WB 3BVZA 1VJKA 3LJ3A 4BOZB 2KN5A 4RGTA 5BO4B 5E6NA 3IVFA 4LJOB 2D3CA 2IO0B 4EZLA 3L0WB 4IUMB 1QLBB 4B95A 4MACA 2O2VB 4DHZB 4W9KA 5CHVC 2BTEA 4A20A 1F2RC 3Q3JA 3JVZX 3U7ZA 2SEBD 3ABVB 3RNEC 4ZRKA 4HPLB 2BYFA 4KKIA 3AXCA 5H92C 4MGIE 3OLMD 4P7IA 2FNJB 4FBJB 1NI2A 3ETRA 2MJ3A 3PLUA 2FCSA 2L1AA 4PS3A 4DXFA 3N30A 1XLOA 3N3KB 1MFWA 1EU3A 4KX6B 1WY8A 1XT9B 2N9XA 1XO3A 5HKHA 3X23A 3WAPA 2JZ3B 2JSVX 4NZLB 3VXWA 1WXMA 3AV8A 2N4FA 2L83A 4MM3A 3VH4B 4HXDA 3M95A 3WAMA 1GB4A 4NAWB 1EF1A 3EUB2 3MTNB 4YXDB 4GLSC 4ANVA 1XQQA 2GI9A 2FAZA 2ZPYA 3A1QB 1FNVA 2MA9B 3GOEA 1MG8A 4YSYB 1J19A 3PV1A 2QMTA 2N1WA 3HRDD 2FIFA 2TSSA 3EHVA 3NRZA 3KH0A 4YSXB 1N60A 4CQNA 2AQ2B 4IDIA 3MHSD 5L95C 2LRWA 1MPEA 2Z0EB 3N1ZC 3ML8A 2RD0A 3V6CB 4XE0A 1YJ1A 3SU8X 5EDSA 2INNE 3L54A 2K39A 2L0FA 1JALA 3PZDA 4BVUC 3CIRB 1D3ZA 2KMAA 4K7UA 4GMVA 2MCNB 1HXYD 5EE3A 4HVBA 3CMMB 4MH8A 2BB5A 2KOXA 2KJHB 2V9HA 3AU5A 2HDEA 5IN7A 3A4RA 1V1PB 3R2TA 1G6JA 1I4XA 2L52A 2PJHA 2INPE 5J2RA 4HDQA 1WRIA 3ZXRA 1C77A 2REXA 2WXQA 3AM9A 3NVYA 3R2IA 1JMLA 2K9XA 3DHGC 3LDZE 2KTRA 4HDOA 1HE8A 1OEYJ 2ZNVC 2J0JA 2J7QB 1SE2A 2N0SB 1EO6A 2EELA 1T5XD 2G1EA 3H8HA 5E6OA 1PGXA 4LLGM 2DAJA 1YOVB 3BYYB 1LQBA 3U30A 3VQIA 5JZEB 1N62A 2MHJA 2WXPA 4AJYB 1T0YA 2L00B 4DXGA 2WXIA 4IM2A 2H88B 5HI1A 3HVDA 4ZRJA 4XZ4A 3NVVA 1S1QB 1YX6B 1YIWA 2BQQA 3OJ4B 2KDBA 3W5VB 1PYWD 3K9PB 1YQBA 1CK1A 1PFDA 1GAQB 1B9RA 4US9A 3HM6X 2WXJA 5KHQA 1JWBD 2WU5B 2KWCA 1VZ6A 2G4DB 2WU2B 2OHFA 1WX7A 2YEPB 2MBQA 4FULA 4JLCA 1KOTA 4RGOS 2V0GA 1KTKA 3E9SA 2CHZA 1TZ1A 2LD9A 1K53A 1XF5L 5BMHA 2LZ6A 2DX5B 2M0AA 1KF6B 1C78A 2K3UA 3NVZA 4ANWA 3TEXA 3KUDB 2KLCA 2N7EA 4WWNA 4JWSC 1HA5A 2HD5B 1EUVB 1N5XA 3A9JB 2I2YA 2M56B 2M17A 1FPYA 1OQQA 3PSEB 1AARA 4G0NB 3H1UA 2RPQA 2BW2A 3APFA 1QT9A 3AE6B 4FJZA 1ZUD2 2CHXA 1STEA 2KWVB 3V6EB 4KSKC 2D10A 1A70A 2IBIB 3VR9B 4W9CA 4ICVA 1ZGUB 1EF5A 1F52A 2DWQA 4WJOA 2GBJA 1TS4A 4LNKA 4RF1A 4XDCA 1M94A 4M0WB 4TSSA 1UNSA 2QJLA 4AQ7A 2Y5PA 3H7PA 1ZXHA 1K50A 1KFYB 4KVGB 2FCQA 2G4SA 2WYQA 3OG5A 1XD3B 1SJED 2QIEB 4WJPA 1V86A 4B9KA 2W9NA 3TMPB 5DPRA 2GB1A 2ZVOA 1WR1A 4FA6A 2AEHA 5DPWA 3IAS1 3SFEB 2KVRA 4LK0M 2L32A 2GLSA 4DDGD 2V4IB 4K81A 5LXIB 4XYCA 1UGMA 2XEWA 2KLGA 3RNFC 2K5PA 4ZRQA 2WXFA 4DWFA 4NQKE 2LGYA 4W9EA 2JRHA 3MC8A 3PHXB 1D5MC 2MP2B 2FIDA 1UF0A 4HPMB 2IZVB 1PQSA 2JZZA 4GN1A 3KYCD 2BF8B 2BS2B 2IGHA 2EKIA 4LNFA 1OQRA 1OEYA 2RDBC 3KWLA 3JSVA 2JWUA 3A4SC 3M62B 4AP4C 2EMTA 1I7HA 4B6WA 1WM2A 3ZW3A 1JWAD 2PIAA 3QK0A 3ZDTA 3L13A 3AECB 3V62A 1K52A 3TUOA 2ZZPB 1QOBA 3BYTB 1DOYA 2MBOA 1FXTB 3IG3A 4R3DA 1D5XC 5BYSA 4WAFA 1V2YA 2AL6A 3GZNB 1TBEA 2G3QB 4P1CC 4EZJA 2VZKB 2CU1A 3DBLB 5DPTA 2K22A 3AULA 3W1SC 1C4PA 4FHKA 1UGJA 4OVZA 4N59A 3VUXA 3DVGX 1L5PA 3B1LX 2FCNA 2I1JA 1MHHE 1YN4A 1HQRD 3EFUA 2IJ0A 4GSWA 2JXXA 5IP4D 1MI0A 1KLGD 2EMSA 1UH6A 1TKGA 3RZFA 3VAWA 1C76A 3EFCA 1AN8A 4G3XB 1E7PB 1UELA 2PVOD 3W5UB 1DYQA 1N5WA 1SB3C 2MX2A 3ZQ4A 5C23A 1WZ0A 4RCOA 5G2NA 3P42A 2V3NA 4XWWA 3VTVA 1QOFA 2CS4A 2RGFA 2ASQA 4NJ7A 4QAYA 4EUTA 1Y56A 1WX8A 4LDTD 2KFKA 5FR3A 4IM3A 1DOXA 4JPSA 1XLPA 4WJQA 3SD5A 1WJ6A 1C4CA 4II3B 4EE2A 3IT6B 3DBLI 4AS1A 4FLHA 5G55A 3UQBA 3U8ZA 4LJPB 3PVLA 2GRIA 2L05A 5JH5C 1KLVA 4K7WA 3UIOB 3B0AA 1DOIA 2IGGA 4A9AA 2LWPA 3RNBC 2M8SA 1KM7A 1JW9D 2DHZA 1VRAB 2W55A 1PGBA 3ENEA 5EE0A 4WWPA 2LMCA 2RR9A 1YX5B 3R8BA 1WX9A 1WGRA 3VH3B 2WLBA 2M4NA 1BXTA 5D6JB 1TKEA 2K8CA 2G45B 1VCBA 4ZRIA 1N61A 3PO0A 2DYOA 2LGXA 2WXOA 2O6VB 3CSFA 1JCKB 3PHWB 1JROA 5DCNA 1ET9A 2UWQA 1T0SC 1RRBA 2DZJA 1WXVA 3DBHI 4HKQA 4BOSC 2R2QA 1V9JA 3RI7C 2WXGA 2KQ7A 3NS1A 1GOZA 2OJRA 1IGCA 2A4ZA 1Y8RC 3NG0A 2QILA 4O1NA 3AEBB 1ZE3D 2WXMA 2KTRB 4EZKA 1UBIA 2KN4A 2WS3B 1R4NI 2XNAC 1VZ7A 4HWIB 4A6QA 3RFZB 4BKSD 3BVGA 2I1KA 4C4VB 3J9CA 1WH3A 4NJ6A 5CHFA 2J42A 3L17A 1TYGB 4TQ1A 4C56C 1J8CA 1J7CA 3W1YA 3ZGZA 3AU4A 3GS2A 5IAAC 2LI5A 5H8YE 2Z8LA 2DYBA 2ON8A 4AOFA 1F9JA 2A5UA 3VFKA 1ZPSA 1QOAA 4GU2A 4S0RA 2LGDA 3TBLD 2BT6A 4OZAA 2IO1B 4P1BC 3ML9A 3KVFB 3APCA 3SHQA 4BKTA 2W3RA 2ZVNA 4CO7A 4A55A 2NS5A 1TJEA 1SIFA 3AE7B 3VVWB 3ZNGC 2BPSA 2HTME 2R2OA 4PT5A 4TKNA 3W1SA 1C9FA 1UWMA 1Q5WB 2D11A 2XN9C 4MDKE 3P1MA 4A8XC 1WJ4A 2XBBC 1FFUA 5D3DA 3ZIMA 4IOIE 5D2MB 1ZP0B 2D07B 2LJ5A 3DVGY 3T9LA 1GPXA 1WIAA 2BGFA 4N9F4 3HHMA 2VRRB 3MC9A 2ZCCA 4KIKA 2FCMA 3ZJTA 3AE1B 2NR2A 4HK2A 4HLEA 3RUIB 1RLFA 3I9V1 3PRMB 1C1YB 4HROA 1L6UA 3PGEA 4MGKE 3TSSA 3DBSA 4XX5A 4FJYA 5FR6A 1FEHA 4TUUA 4WAAA 3AN1A 3Q3MC 2DENB 1WGKA 1WF9A 4ARCA 1L0YB 3ECIA 3QCAA 3IT4B 1SE3A 1WJNA 1F77A 2W82A 3H7PB 2YVCA 2N1VA 2LHDA 1VLBA 4MGZE 2JX5A 1WMHA 4KZ0A 1NYQA 2BBCA 1SE9A 1ENFA 3QX1A 1EWCA 2OJWA 1P98A 5BYRA 1E7UA 2PW9A 3VR8B 3JW0X 4RF0A 2M1MA 3PPAA 3M63B 4W9LA 2ZEQA 3GE8C 2H89B 2KAJA 3HM3A 3QHTA 4HJKA 4B0EA 3ZJVA 5GXGB 2GBRA 2YEPF 1UWXA 1I4RA 3KQ4A 3A33B 3L08A 2KC2A 4RMAA 1FCCC 2JVCA 3A9KA 4OW0A 5HHDG 1WXAA 2LXCA 1F0ZA 2DAFA 3L4PA 1YQ3B 3T3OA 1E0ZA 1K51A 2UYZB 3P4PB 2N7JA 4IWOA 2K8BA 1TKYA 3D32A 1WXQA 2KQ4X 3LB8C 4MJSA 2ONQA 3VRAB 2VH2A 3ZLZA 1MJDA 3OJ3A 2K0PA 2ZJDA 4KZCA 5G5HA 1TS3A 2N9PC 2E3TA 1WJUA 3BY4B 1ZDVA 3AE2B 2KDMA 4TV3A 1VR9A 4WQMA 2O2VA 2BYVE 1WWTA 2RDGA 5FKAC 4KDLB 3V3XA 3DHHC 3AE3B 5IO9A 4BKSA 2LFIA 2GBKA 2LHEA 5D7GA 3Q8EA 2QCZA 4K3CA 2KX0A 3O13A 1OGWA 3R7QA 5JHAA 3OAWA 4KV2A 3AH7A 1QILA 4WH4A 4YWGG 1QZEA 3UGBB 2JWZA 5LLIA 4MGYE 2WDQB 1NI3A 1WSPA 2JT4B 1IUEA 1JWMD 2AQ1B 2ZCBA 1RM6C 1MVKA 1VDVA 3U52E 4NAMA 2PTLA 4ANXA 1WZ3A 2NPTB 4RFBA 5AZGA 3ALBA 3W9CB 3N20C 2WHIA 4I6LB 3CWIA 2CJNA 2N7DA 4YTNB 3TJPA 4JL9A 2N9EB 3QJZA 1I35A 3N9YC 3GB1A 3TIXA 2WXNA 4JE3B 4KGRA 3NS8A 2YLMA 5IKCM 3TCAA 3AEDB 4HRSA 5G5GA 2KD0A 1E5WA 1EWYC 4CYEA 3MHZA 1P7FA 4MSMB 1XLQA 4MH0E 2Y3AA 4REZA 4BBNF 5IOIA 2NBWB 2KFJA 2D3AA 2VZKD 4BBNC 5L83A 2NBVB 2EKEC 1SIJA 2IGDA 1P0RA 2C7MB 5JXVA 3RMKC 2LGIA 5D3IB 1FFVA 3TEWA 3BIID 1AYFA 1IYFA 4WIPA 2MH7A 1IPGA 2V3SA 3AE8B 1KJTA 1XCQL 1D4BA 1N6ZA 2C7HA 3Q3NC 4ASWC 1T0QC 2LGSA 3DPDA 2WDVB 2MJEA 3QAQA 4JWUC 3DBRI 3ZJUA 1T3QA 1WE6A 1J7BA 1SEBD 4F1SA 1LFDA 4I6PA 2HJ8A 4M8MA 1ET6A 3C19A 2DZKA 2QSDA 4C00A 2XK5A 3RN9C 2UU7A 2M19A 1HTQA 5BYQA 2IY1B 1XCTL 3N1YC 1I4QA 5E6JA 4YTPB 2B76B 4YT0B 5D94A 5AUIA 4FADA 4ITKA 2IDYA 3PZ7A 3R66C 3RCZA 2OEDA 1Q10A 1RAXA 3VTUA 5AZHA 2BKRB 4BAXA 4M02A 3RPFC 4GDLA 2KYWA 2HE7A 4PS8A 3UQAA 3Q8BA 3QA8A 3Q8AA 2CJOA 1WYWB 3A9JA 2WGSA 3DWMA 4RNAA 3NZSA 1FRDA 1SXTA 1J0GA 4II2B 2O6VD 4F8CB 3PS6A 3AMZA 4M8NA 2IYDB 4ARIA 4RH6A 3NOBA 2MJDA 3DBHB 3N32A 2KK8A 4MM3B 3KUCB 1XLNA 1JRPA 3IBEA 3ZTDA 3Q3OC 4EFOA 4A90A 3BVMA 1QKZA 3NY5A 1YN5A 3H9DA 3P4SB 1ZXIA 3WALA 1FMAD 3AE4B 2K6DB 4M0WA 3DDCB 3QARA 1NENB 4S17A 3PT2B 4DHJD 2LEKA 3O65B 1A5RA 4KIKB 2ACZB 1YD8U 4A3PA 1J7AA 2LVOA 1K8RB 1R4NB 2X8XX 3NUHB 4G50A 1DGJA 3DWGC 2WXHA 2L7RA 4K7SA 2WXKA 2C5LC 4YSZB 1YJIA 1YMHE 2FE8A 3VUWA 3Q2AC 5LNK1 2C60A 3MFGA 1N63A 1TY2A 1QQRA 3P63A 3UINB 3UIPB 4W9IA 1RFAA 2MBBB 3RULA 3VUYA 3DOWA 4P16A 3RNAC 2KVZA 3PZ8A 4E71A 1GC6A 1YJJA 1TZOA 4NQLB 1FCLA 1Q0WB 2LASA 2MP2A 4C7YA 1WMHB 1XEEA 3AEEB 1OFFA 3PLVA 2RMMA 4LNIA 5CTRC 3R7RA 1T0RC 2HJ1A 2AQ3B 2Y5CA 2KKCA 3GP7A 3NJTA 3ZNHB 3NVWA 1FXAA 4WWMA 3Q6BA 4KDIC 2MSED 4IWQA 2DYMA 1ROEA 2MEKA 1UBQA 1E8YA 4E74A 3I63C 1WRDB 1JQ4A 1FO4A 1MHXA 1M4VA 4J3OD 2MBHA 3IHPC 2PE6B 4LCDE 5IA7A 2PLPA 1CQVA 2JRIB 3FILA 2D3BA 2WXRA 2I38A 2INDC 2WWZA 2ZW1A 5AEKB 3ZYYX 1L0XB 1WGDA 1P3QU 3UF8A 3ZRCA 2BYTA 1SJHD 4DK5A 4B0MA 2PE9A 1IGDA 1GUAB 3N1XC 3PRZA 4ZHPA 1V8CA 3WAOA 3CSTA 5J17A 2KDIA 3I57A 4ICUA 1LGRA 1ZKHA 2MW5A 3C8YA 4LNOA 5HFYA 2N9KA 4MJSB 4W9DA 2N9LA 4W9JA 4FHJA 3FKYA 4AWJA 1L6VA 1WYGA 2NTSA 5TR5A 2FUG1 3B2FA 2GBMA 2BYEA 2NCNA 3V61A 4NNJB 4HCPB 3ZKJC 4W9GA 4Q2JA 5GMVA 2KANA 2KNBA 4KGSA 1EU4A 1WGHA 2BWFA 1GB1A 2DNFA 1ISNA 2L8JA 1IBXA 1UUPA 1V6EA 1D5ZC 4DHZE 2GMIC 1WFYA 1R4MI 3RZWC 2QDFA 1FRRA 1GC7A 4I6NB 4M01A 4CHKA 2WNMA 4DDID 1LXDA 1EM7A 2LUMA 4HKZE 4C80A 3P2BA 2K6QA 3HK0A 3SR6A 4DXAB 4MELA 3BZDB 3PRPB 2INCC 3FAHA 4HPPA 5CX3A 2GBNA 2ICIA 1ESFA 2ZPNA 1BUIC 1WR6E 4GGQA 5E6PA 1P7EA 2DLBA 2JYEA 2LVQA 3AEGB 2JUOA 1P1AA 5I4DA 3WCQA 1UD7A 2K25A 2OOBB 4K1RB 3B08A 2J53A 2J4XA 2MRPA 3WA0A 1BMLC 3U4EG 4C7ZA 3MJ5A 3DCGA 3I3TB 3OWEB 1FIQA 4W9FA 2MWSB 4DQOC 2AL3A 2KC1A 2O6VA 2NMQA 3Q8CA 1LO5D 4UDUC 2KACA 2BVCA 5EE9A 1KLUD 1YQ4B 4TMAB 2WDTB 1FNWA 3BINA 3AEFB 3QIJA 5C1ZA 3HIZA 3PTFC 4ZYSA 1E6EB 1SSNA 4OZBA 2L0TA 2KQSA 1UZXB 1CZPA 1F2RI 4JGHB 3HVZA 4GDKA 3SEBA 1FD6A 5CHWA 1JWUD 2NVUI 1MG4A 1QF6A 4PYUA 1I42A 2Y5BB 3V05A 2JYTA 4MT5A 1TTNA 1ZOYB 4IM0A 3EA6A 2KTFA 1PGAA 3JSVB 3APDA 4C4VA 3L16A 1V97A 4ZRPA 1R7SA 1NYRA 3H7SA 4KKJA 1V5TA 2R61A 3VTWA 1QOGA 4PK1A 4X57B 2J0MA 4JX1C 1V1OA 3AI5A 4L2YA 4BFRA 1U4AA 3RNGC 2KHWB 3ZVVA 2K8HA 1I4PA 3WANA 4FN2A 4JIOU 2KMMA 4MEMA 1TY0A 2JQRB 4K3BA 1Z5SB 3BWUD 5C3JB 4ZHOA 2FUHB 3DVNV 3MJWA 4ANUA 4RM9A 4M00A 3K9OB 1SBBB 4IWPA 2AYOB 1T6BX 3PREA 1NDDA 4URKA 3KWVA 1L4DB 2ZNVB 1WE7A 2XK5B 3ZRFA 4GXBA 2ZW0A 1NBFC 2Z0DB 3ZNID 1ZDXA 1RWSA 4LTUA 2C7NB 2KZRA 3T3NA 2BS4B 1E8XA 4TQ0A 4L23A 3W2DA 2AWTA 5AZFA 3MC0B 1X1MA 2WX1A 4GDLB 1ACCA 4BKGA 1L0VB 1ZW7A 2QEJC 1H8CA 1I4HA 4NAWA 4FXCA 1HEZE 3L10B 3B9JA 2PEAA 4RM8A 2KMCA 3NHEB 2KFKB 1D6EC 3IFWB 3EECA 2PVGC 5TSSA 3A1QA 2VH1A 3UI3A 4WWOA 1WI0A 5BMGA 3AEAB 2L76A 3X0WA 2IO3B 1P9DU 4IKGA 3IAM1 3KW5B 1KH0A 1RFKA 1SGHA 2D2QA 1SE4A 1TT5B 3LXFA 3I5JC 3H6NA 1H4RA 1E90A 3BK2A 2J0KA 3HUIA 2DZIA 1L7YA 5AUKA 1E7VA 3S2AA 4G11A 4P6VF 1GJZA 4AJWA 3SFDB 1C79A 2KO3A 3TL5A 2E6XA 3Q3FA 1GNUA 4XGAB 2J52A 2JZPA 3EC8A 2NTTA 2MQJA 4EOYA 2MLBA 4OHJA 3ZNZB 1I4GA 2HTHA 2LJIA 3DBRB 1E10A 3BK1A 3U2SC 1C3TA 1L2NA 1TIFA 1V1PA 3DVNU 1C4AA 4KGTA 4DBGA 3P4QB 5LXHA 2KX3A 1GG3A 3NZUA 2PMVA 3U7DA 3ZUNA 1FM0D 2RSUA 3QQ8B 4BZAA 1PDXA 3ZXVA 3KYDD 4OVUA 2AX5A 4NY0A 2W3SA 1XXGA 1PUTA 3WIMA 2DBYA 3FC4A 2WQYB 4L1BA 5MPOA 4GB9A 3ZO5B 2JU6X 4ACFA 4N58A 3NZ3A 1NVID 2GOWA 1S3SG 3QWZB 5J18A 3Q8FA 4XC2A 3M3JA 3VRBB 3AE9B 3Q69A 4US8A 2KXJA 3CF6E 2QHOA 2X38A 3RT3B 3FILB 1VD2A 3AB5A 3C0RB 2JF5A 2CHWA 3SDLC 2RPVA 2CU3A 4HCNB 3ZDMC 1YNTE 2SAKA 2G9HD 2V3PA 1B1ZA 3TEYA 1NEKB 1TGZB 2BKFA 2NBUA 1SF0A 2CKHB 1RYJA 4W9HA 1WM3A 3E56A 3ZTCA 4WURA 3TEZA 2B3AA 2K1FA 3VHTC 2KWDA 3LYYA 4JQWC 1HZ6A 4F7ZA 2Q5WD 3MP9A 1L4ZB 5BMIA 1JWSD 2IY0B 1KRHA 1BT0A 5T8IA 3AE5B 3RD2A 3VDZA 1YN3A 1HTOA 4ZDVA 4IC7B 4A3OA 4GOCA 2LUEA 4USAA 2JY6A 3GE3C 4EEWA 4H2AA 1IBXB 1AWDA 1V80A 2JPHA 4RGNA 1LM8B 2KDFB 2DZMA 1E8WA 1AW7A 4NPNA 2Z59B 3GZNI 2PKOA 5JHBA 1TS2A 2WDRB 3IXSA 2NPTA 1FXIA 3T8MA 2KT7A 1JRUA 2M0XA 2KWUB 1WGGA 4AUQC 2D5GA 4HJGE 4XWTA 4J6IA 2KJRA 1V81A 2L3ZA 1HZ5A 3R3MA 2CR5A 5EE1A 5C2TB 4E3CA 2WP9B 4ZOHC 4EKUA 1V49A 3KLSX 3ONSA 4WJNA 2LXAA 4LDTB 3RYTA 4LNNA 2IO2B 5DPSA 1OTRB 2PPHA 4ZYNA 1E9MA 2KDEB 1TS5A 1OQYA 4PYZA 2LVPA 5KHOA
chains in the Genus database with same CATH topology
3JYUA 2KX0A 2LVQA 1OGWA 4WQOB 3R7QA 5JHAA 2JUOA 1P1AA 1Z2MA 4GIVA 2D3GA 1E8ZA 1V2YA 3OAWA 2MBEA 2AL6A 1TBEA 4KV2A 1UD7A 2G3QB 2K25A 2OOBB 4K1RB 2LRUA 3B08A 4EZJA 2CU1A 5DPTA 1QZEA 2MRPA 3WA0A 3UGBB 2BWES 3AULA 2V1YA 3KUZA 4FHKA 3W1SC 2JWZA 2WX0A 1CMXB 5LLIA 4MGYE 3DCGA 1V5OA 3DVGX 3I3TB 3VUXA 3B1LX 4W9FA 2MWSB 2JT4B 2FCNA 2AL3A 2I1JA 2KC1A 4DHJB 1Q1OA 1WXSA 2KJ6A 2O6VA 4GDKB 4IG7B 3EFUA 2ZCBA 4GSWA 2JXXA 2EMSA 1UH6A 4ANXA 3A9KB 3RZFA 3VAWA 1WZ3A 2NPTB 1IP9A 4OVVA 3DQVA 3ALBA 5AZGA 2WDTB 4YL8A 3BINA 3QIJA 4I6LB 4KSLC 4G3XB 5C1ZA 3HIZA 1UELA 3PTFC 3V60A 2MX2A 2N7DA 3TJPA 4JL9A 5C23A 2L0TA 4MSQB 4PS7A 1WZ0A 2KQSA 2N9EB 3QJZA 1UZXB 4IW0A 3QC8B 5G2NA 2V4LA 1I35A 4FJVB 3VTVA 1WGYA 4JGHB 4GDKA 3TIXA 3NS8A 2YLMA 2CS4A 5CHWA 2RGFA 2C9WB 2ASQA 4NJ7A 3LJ3A 4EUTA 3TCAA 2NVUI 1WX8A 4LDTD 2KFKA 4BOZB 2KN5A 5BO4B 4IM3A 5E6NA 4PYUA 4WJQA 3IVFA 3SD5A 1WJ6A 2KD0A 1E5WA 1I42A 2Y5BB 4II3B 4LJOB 4CYEA 3DBLI 1TTNA 4FLHA 5G55A 3UQBA 3U8ZA 4LJPB 3PVLA 2IO0B 4IM0A 2L05A 4EZLA 3L0WB 5JH5C 2KTFA 4IUMB 1KLVA 4K7WA 3JSVB 4B95A 3APDA 4MSMB 3UIOB 3L16A 3B0AA 2O2VB 3H7SA 4DHZB 1V5TA 4W9KA 4MH0E 3VTWA 5CHVC 2LWPA 4X57B 2J0MA 4A20A 2M8SA 4BBNF 3AI5A 4BFRA 1KM7A 2NBWB 2DHZA 1U4AA 3Q3JA 2KFJA 3JVZX 2KHWB 3ZVVA 3ENEA 4BBNC 5L83A 2K8HA 4ZRKA 4HPLB 3WANA 2BYFA 2NBVB 2EKEC 3AXCA 4FN2A 4WWPA 4JIOU 4MGIE 4MEMA 3OLMD 1P0RA 2C7MB 4P7IA 1Z5SB 2FNJB 2RR9A 1YX5B 4FBJB 1WX9A 1NI2A 1WGRA 2FUHB 3PLUA 3VH3B 2FCSA 3DVNV 3MJWA 4PS3A 4ANUA 4RM9A 3N30A 2M4NA 3K9OB 1IYFA 4IWPA 2AYOB 5D6JB 3N3KB 3PREA 1WY8A 2K8CA 1NDDA 4URKA 1XT9B 2N9XA 2G45B 1VCBA 4ZRIA 5HKHA 3X23A 3WAPA 2JZ3B 1IPGA 2V3SA 3VXWA 1KJTA 2ZNVB 1WXMA 1WE7A 2N4FA 4MM3A 2DYOA 2LGXA 3VH4B 4HXDA 3M95A 2O6VB 2XK5B 3CSFA 3WAMA 4GXBA 4NAWB 1EF1A 3PHWB 3ZRFA 3MTNB 5DCNA 4ANVA 2C7HA 1NBFC 2UWQA 4ASWC 1XQQA 2FAZA 2Z0DB 3ZNID 2ZPYA 3A1QB 3DPDA 2MA9B 3GOEA 1MG8A 3QAQA 1J19A 1RRBA 3DBRI 3PV1A 2C7NB 2N1WA 2KZRA 2FIFA 1WE6A 3EHVA 2DZJA 1WXVA 3KH0A 1E8XA 4TQ0A 4F1SA 1LFDA 4I6PA 2HJ8A 2AWTA 3DBHI 5AZFA 1X1MA 2WX1A 4M8MA 4GDLB 4BKGA 3MHSD 5L95C 4BOSC 2LRWA 2R2QA 1ZW7A 2DZKA 1V9JA 2Z0EB 2KQ7A 3ML8A 2RD0A 3V6CB 2XK5A 1YJ1A 3SU8X 4NAWA 5EDSA 1H8CA 3L54A 2K39A 2IY1B 2L0FA 2OJRA 3L10B 2PEAA 4RM8A 2KMCA 3NHEB 2A4ZA 2KFKB 3PZDA 1Y8RC 4BVUC 3IFWB 3EECA 1D3ZA 2KMAA 3A1QA 2KTRB 4WWOA 4K7UA 1WI0A 4GMVA 5D94A 2MCNB 4FADA 4EZKA 4HVBA 1UBIA 3R66C 3RCZA 1R4NI 2L76A 3X0WA 2IO3B 1RAXA 3CMMB 4HWIB 1P9DU 3VTUA 4BKSD 5AZHA 2KOXA 3KW5B 2BKRB 2I1KA 2KJHB 3AU5A 4GDLA 1SGHA 1WH3A 2D2QA 3A4RA 4NJ6A 5CHFA 1G6JA 3H6NA 2PJHA 3L17A 1H4RA 1E90A 5J2RA 4HDQA 4TQ1A 2HE7A 4PS8A 2J0KA 3UQAA 2REXA 1J8CA 2DZIA 3W1YA 1L7YA 3AU4A 3QA8A 1E7VA 3S2AA 4G11A 1GJZA 4AJWA 5IAAC 2KO3A 3TL5A 2LI5A 3LDZE 1WYWB 3A9JA 2KTRA 3Q3FA 1GNUA 4HDOA 3NZSA 3EC8A 1HE8A 2MQJA 2DYBA 4EOYA 1J0GA 2MLBA 2O6VD 4II2B 1OEYJ 3ZNZB 2ZNVC 4F8CB 2J0JA 4AOFA 3PS6A 2HTHA 2J7QB 1F9JA 4M8NA 2IYDB 2A5UA 3VFKA 1EO6A 1C3TA 1L2NA 3NOBA 4GU2A 5E6OA 2LGDA 3TBLD 3DVNU 4DBGA 5LXHA 2DAJA 2IO1B 2KX3A 3N32A 1GG3A 1LQBA 3ML9A 3U30A 3VQIA 2KK8A 3NZUA 5JZEB 3KVFB 3APCA 3U7DA 3ZUNA 3KUCB 2RSUA 3SHQA 4AJYB 4BKTA 3QQ8B 1T0YA 3IBEA 2ZVNA 4CO7A 3ZTDA 2L00B 4EFOA 3KYDD 2NS5A 4OVUA 3NY5A 3H9DA 4NY0A 1SIFA 3WALA 4IM2A 2K6DB 3WIMA 3VVWB 3DDCB 3ZNGC 4ZRJA 4XZ4A 2BPSA 1S1QB 1YX6B 3QARA 2R2OA 3PT2B 4DHJD 3O65B 1A5RA 4KIKB 4TKNA 1YIWA 3W1SA 1YD8U 4A3PA 3OJ4B 2LVOA 2KDBA 1K8RB 1Q5WB 2D11A 4GB9A 4G50A 3ZO5B 3K9PB 1YQBA 4MDKE 1WJ4A 2L7RA 2XBBC 3HM6X 4K7SA 2C5LC 3VUWA 3ZIMA 5KHQA 2C60A 2GOWA 1S3SG 5D2MB 2KWCA 2G4DB 2LJ5A 2D07B 3DVGY 1WX7A 3QWZB 3T9LA 3UINB 2MBQA 3UIPB 5J18A 1WIAA 4XC2A 4FULA 1RFAA 4JLCA 2BGFA 4W9IA 1KOTA 2MBBB 3M3JA 4N9F4 3HHMA 3RULA 3VUYA 2VRRB 3DOWA 4E71A 1GC6A 2ZCCA 2CHZA 4KIKA 1TZ1A 2FCMA 4NQLB 2KXJA 2LD9A 2NR2A 3CF6E 1Q0WB 2LASA 2MP2A 4HK2A 4HLEA 2LZ6A 2QHOA 3RUIB 1RLFA 3RT3B 2DX5B 3PRMB 1C1YB 1WMHB 3PGEA 4MGKE 3DBSA 4XX5A 4FJYA 5FR6A 1VD2A 3PLVA 3R7RA 5CTRC 4TUUA 4ANWA 3C0RB 2JF5A 2CHWA 3KUDB 3SDLC 2KKCA 2KLCA 2N7EA 4WAAA 4WWNA 3ZNHB 4HCNB 2DENB 3ZDMC 2HD5B 1WF9A 1EUVB 3A9JB 4KDIC 2MSED 3ECIA 4IWQA 2M17A 2DYMA 3QCAA 3PSEB 1AARA 4G0NB 1WJNA 1UBQA 3H1UA 1E8YA 1TGZB 2BKFA 2RPQA 3H7PB 2NBUA 4E74A 2YVCA 1WRDB 2CKHB 4W9HA 1WM3A 3ZTCA 3APFA 2N1VA 2B3AA 2K1FA 2MBHA 2PE6B 3IHPC 4LCDE 3VHTC 4FJZA 5IA7A 2CHXA 4MGZE 1WMHA 4JQWC 2JRIB 4F7ZA 4KZ0A 1SE9A 2KWVB 3V6EB 3QX1A 4KSKC 2IY0B 2WWZA 2D10A 1BT0A 1P98A 2IBIB 5AEKB 1WGDA 1E7UA 1P3QU 4W9CA 3UF8A 4ICVA 3RD2A 1ZGUB 3VDZA 3JW0X 3ZRCA 4DK5A 1EF5A 2PE9A 4WJOA 2GBJA 1GUAB 3PRZA 4IC7B 2M1MA 4ZDVA 4A3OA 4GOCA 2LUEA 3PPAA 3M63B 4W9LA 3WAOA 3CSTA 1M94A 4M0WB 2ZEQA 2JY6A 4EEWA 5J17A 3H7PA 3HM3A 2KDIA 4ICUA 3QHTA 4HJKA 4KVGB 1V80A 2FCQA 2GBRA 1ZKHA 2G4SA 2WYQA 1XD3B 4B9KA 4WJPA 1V86A 2MW5A 2JPHA 2W9NA 1LM8B 2KDFB 3TMPB 3A33B 4MJSB 3L08A 5DPRA 2ZVOA 1WR1A 2DZMA 1E8WA 4NPNA 2KC2A 4RMAA 4FA6A 2Z59B 2AEHA 4W9DA 3GZNI 5DPWA 2JVCA 4W9JA 4FHJA 5JHBA 2KVRA 3A9KA 4AWJA 2NPTA 5TR5A 3T8MA 4DDGD 2GBMA 1WXAA 1JRUA 2M0XA 4K81A 2BYEA 2KWUB 2NCNA 1WGGA 2LXCA 4HCPB 4NNJB 3V61A 4W9GA 3ZKJC 5LXIB 4AUQC 2DAFA 2KANA 2KNBA 5GMVA 1UGMA 2XEWA 2KLGA 1WGHA 2BWFA 1ISNA 2L8JA 4DWFA 4NQKE 1V6EA 2LGYA 4W9EA 2JRHA 4J6IA 2UYZB 4DHZE 3PHXB 2KJRA 4IWOA 2K8BA 2MP2B 3D32A 1V81A 2GMIC 2L3ZA 1WFYA 2FIDA 4HPMB 4MJSA 1R4MI 3RZWC 3R3MA 2IZVB 1PQSA 2CR5A 1GC7A 2JZZA 4GN1A 4I6NB 4CHKA 4E3CA 4DDID 4EKUA 3ZLZA 1LXDA 3KYCD 2BF8B 1V49A 3OJ3A 2ZJDA 4KZCA 2N9PC 3ONSA 1WJUA 3BY4B 3P2BA 2K6QA 1OEYA 3HK0A 4TV3A 3JSVA 4WJNA 4DXAB 2LXAA 3A4SC 4LDTB 3M62B 4AP4C 4MELA 2O2VA 3RYTA 2BYVE 2EMTA 4B6WA 2IO2B 4KDLB 1WM2A 3ZW3A 5DPSA 3ZDTA 3QK0A 3PRPB 1OTRB 3L13A 2PPHA 4ZYNA 2KDEB 5CX3A 1OQYA 4PYZA 3V62A 2GBNA 2ZZPB 2LVPA 4BKSA 2ZPNA 2GBKA 5D7GA 1WR6E 2MBOA 1FXTB 5KHOA 4GGQA 5E6PA 3IG3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JYU A;  2KX0 A;  2LVQ A;  1OGW A;  4WQO B;  3R7Q A;  5JHA A;  2JUO A;  1P1A A;  1Z2M A;  4GIV A;  2D3G A;  1E8Z A;  1V2Y A;  3OAW A;  2MBE A;  2AL6 A;  1TBE A;  4KV2 A;  1UD7 A;  2G3Q B;  2K25 A;  2OOB B;  4K1R B;  2LRU A;  3B08 A;  4EZJ A;  2CU1 A;  5DPT A;  1QZE A;  2MRP A;  3WA0 A;  3UGB B;  2BWE S;  3AUL A;  2V1Y A;  3KUZ A;  4FHK A;  3W1S C;  2JWZ A;  2WX0 A;  1CMX B;  5LLI A;  4MGY E;  3DCG A;  1V5O A;  3DVG X;  3I3T B;  3VUX A;  3B1L X;  4W9F A;  2MWS B;  2JT4 B;  2FCN A;  2AL3 A;  2I1J A;  2KC1 A;  4DHJ B;  1Q1O A;  1WXS A;  2KJ6 A;  2O6V A;  4GDK B;  4IG7 B;  3EFU A;  2ZCB A;  4GSW A;  2JXX A;  2EMS A;  1UH6 A;  4ANX A;  3A9K B;  3RZF A;  3VAW A;  1WZ3 A;  2NPT B;  1IP9 A;  4OVV A;  3DQV A;  3ALB A;  5AZG A;  2WDT B;  4YL8 A;  3BIN A;  3QIJ A;  4I6L B;  4KSL C;  4G3X B;  5C1Z A;  3HIZ A;  1UEL A;  3PTF C;  3V60 A;  2MX2 A;  2N7D A;  3TJP A;  4JL9 A;  5C23 A;  2L0T A;  4MSQ B;  4PS7 A;  1WZ0 A;  2KQS A;  2N9E B;  3QJZ A;  1UZX B;  4IW0 A;  3QC8 B;  5G2N A;  2V4L A;  1I35 A;  4FJV B;  3VTV A;  1WGY A;  4JGH B;  4GDK A;  3TIX A;  3NS8 A;  2YLM A;  2CS4 A;  5CHW A;  2RGF A;  2C9W B;  2ASQ A;  4NJ7 A;  3LJ3 A;  4EUT A;  3TCA A;  2NVU I;  1WX8 A;  4LDT D;  2KFK A;  4BOZ B;  2KN5 A;  5BO4 B;  4IM3 A;  5E6N A;  4PYU A;  4WJQ A;  3IVF A;  3SD5 A;  1WJ6 A;  2KD0 A;  1E5W A;  1I42 A;  2Y5B B;  4II3 B;  4LJO B;  4CYE A;  3DBL I;  1TTN A;  4FLH A;  5G55 A;  3UQB A;  3U8Z A;  4LJP B;  3PVL A;  2IO0 B;  4IM0 A;  2L05 A;  4EZL A;  3L0W B;  5JH5 C;  2KTF A;  4IUM B;  1KLV A;  4K7W A;  3JSV B;  4B95 A;  3APD A;  4MSM B;  3UIO B;  3L16 A;  3B0A A;  2O2V B;  3H7S A;  4DHZ B;  1V5T A;  4W9K A;  4MH0 E;  3VTW A;  5CHV C;  2LWP A;  4X57 B;  2J0M A;  4A20 A;  2M8S A;  4BBN F;  3AI5 A;  4BFR A;  1KM7 A;  2NBW B;  2DHZ A;  1U4A A;  3Q3J A;  2KFJ A;  3JVZ X;  2KHW B;  3ZVV A;  3ENE A;  4BBN C;  5L83 A;  2K8H A;  4ZRK A;  4HPL B;  3WAN A;  2BYF A;  2NBV B;  2EKE C;  3AXC A;  4FN2 A;  4WWP A;  4JIO U;  4MGI E;  4MEM A;  3OLM D;  1P0R A;  2C7M B;  4P7I A;  1Z5S B;  2FNJ B;  2RR9 A;  1YX5 B;  4FBJ B;  1WX9 A;  1NI2 A;  1WGR A;  2FUH B;  3PLU A;  3VH3 B;  2FCS A;  3DVN V;  3MJW A;  4PS3 A;  4ANU A;  4RM9 A;  3N30 A;  2M4N A;  3K9O B;  1IYF A;  4IWP A;  2AYO B;  5D6J B;  3N3K B;  3PRE A;  1WY8 A;  2K8C A;  1NDD A;  4URK A;  1XT9 B;  2N9X A;  2G45 B;  1VCB A;  4ZRI A;  5HKH A;  3X23 A;  3WAP A;  2JZ3 B;  1IPG A;  2V3S A;  3VXW A;  1KJT A;  2ZNV B;  1WXM A;  1WE7 A;  2N4F A;  4MM3 A;  2DYO A;  2LGX A;  3VH4 B;  4HXD A;  3M95 A;  2O6V B;  2XK5 B;  3CSF A;  3WAM A;  4GXB A;  4NAW B;  1EF1 A;  3PHW B;  3ZRF A;  3MTN B;  5DCN A;  4ANV A;  2C7H A;  1NBF C;  2UWQ A;  4ASW C;  1XQQ A;  2FAZ A;  2Z0D B;  3ZNI D;  2ZPY A;  3A1Q B;  3DPD A;  2MA9 B;  3GOE A;  1MG8 A;  3QAQ A;  1J19 A;  1RRB A;  3DBR I;  3PV1 A;  2C7N B;  2N1W A;  2KZR A;  2FIF A;  1WE6 A;  3EHV A;  2DZJ A;  1WXV A;  3KH0 A;  1E8X A;  4TQ0 A;  4F1S A;  1LFD A;  4I6P A;  2HJ8 A;  2AWT A;  3DBH I;  5AZF A;  1X1M A;  2WX1 A;  4M8M A;  4GDL B;  4BKG A;  3MHS D;  5L95 C;  4BOS C;  2LRW A;  2R2Q A;  1ZW7 A;  2DZK A;  1V9J A;  2Z0E B;  2KQ7 A;  3ML8 A;  2RD0 A;  3V6C B;  2XK5 A;  1YJ1 A;  3SU8 X;  4NAW A;  5EDS A;  1H8C A;  3L54 A;  2K39 A;  2IY1 B;  2L0F A;  2OJR A;  3L10 B;  2PEA A;  4RM8 A;  2KMC A;  3NHE B;  2A4Z A;  2KFK B;  3PZD A;  1Y8R C;  4BVU C;  3IFW B;  3EEC A;  1D3Z A;  2KMA A;  3A1Q A;  2KTR B;  4WWO A;  4K7U A;  1WI0 A;  4GMV A;  5D94 A;  2MCN B;  4FAD A;  4EZK A;  4HVB A;  1UBI A;  3R66 C;  3RCZ A;  1R4N I;  2L76 A;  3X0W A;  2IO3 B;  1RAX A;  3CMM B;  4HWI B;  1P9D U;  3VTU A;  4BKS D;  5AZH A;  2KOX A;  3KW5 B;  2BKR B;  2I1K A;  2KJH B;  3AU5 A;  4GDL A;  1SGH A;  1WH3 A;  2D2Q A;  3A4R A;  4NJ6 A;  5CHF A;  1G6J A;  3H6N A;  2PJH A;  3L17 A;  1H4R A;  1E90 A;  5J2R A;  4HDQ A;  4TQ1 A;  2HE7 A;  4PS8 A;  2J0K A;  3UQA A;  2REX A;  1J8C A;  2DZI A;  3W1Y A;  1L7Y A;  3AU4 A;  3QA8 A;  1E7V A;  3S2A A;  4G11 A;  1GJZ A;  4AJW A;  5IAA C;  2KO3 A;  3TL5 A;  2LI5 A;  3LDZ E;  1WYW B;  3A9J A;  2KTR A;  3Q3F A;  1GNU A;  4HDO A;  3NZS A;  3EC8 A;  1HE8 A;  2MQJ A;  2DYB A;  4EOY A;  1J0G A;  2MLB A;  2O6V D;  4II2 B;  1OEY J;  3ZNZ B;  2ZNV C;  4F8C B;  2J0J A;  4AOF A;  3PS6 A;  2HTH A;  2J7Q B;  1F9J A;  4M8N A;  2IYD B;  2A5U A;  3VFK A;  1EO6 A;  1C3T A;  1L2N A;  3NOB A;  4GU2 A;  5E6O A;  2LGD A;  3TBL D;  3DVN U;  4DBG A;  5LXH A;  2DAJ A;  2IO1 B;  2KX3 A;  3N32 A;  1GG3 A;  1LQB A;  3ML9 A;  3U30 A;  3VQI A;  2KK8 A;  3NZU A;  5JZE B;  3KVF B;  3APC A;  3U7D A;  3ZUN A;  3KUC B;  2RSU A;  3SHQ A;  4AJY B;  4BKT A;  3QQ8 B;  1T0Y A;  3IBE A;  2ZVN A;  4CO7 A;  3ZTD A;  2L00 B;  4EFO A;  3KYD D;  2NS5 A;  4OVU A;  3NY5 A;  3H9D A;  4NY0 A;  1SIF A;  3WAL A;  4IM2 A;  2K6D B;  3WIM A;  3VVW B;  3DDC B;  3ZNG C;  4ZRJ A;  4XZ4 A;  2BPS A;  1S1Q B;  1YX6 B;  3QAR A;  2R2O A;  3PT2 B;  4DHJ D;  3O65 B;  1A5R A;  4KIK B;  4TKN A;  1YIW A;  3W1S A;  1YD8 U;  4A3P A;  3OJ4 B;  2LVO A;  2KDB A;  1K8R B;  1Q5W B;  2D11 A;  4GB9 A;  4G50 A;  3ZO5 B;  3K9P B;  1YQB A;  4MDK E;  1WJ4 A;  2L7R A;  2XBB C;  3HM6 X;  4K7S A;  2C5L C;  3VUW A;  3ZIM A;  5KHQ A;  2C60 A;  2GOW A;  1S3S G;  5D2M B;  2KWC A;  2G4D B;  2LJ5 A;  2D07 B;  3DVG Y;  1WX7 A;  3QWZ B;  3T9L A;  3UIN B;  2MBQ A;  3UIP B;  5J18 A;  1WIA A;  4XC2 A;  4FUL A;  1RFA A;  4JLC A;  2BGF A;  4W9I A;  1KOT A;  2MBB B;  3M3J A;  4N9F 4;  3HHM A;  3RUL A;  3VUY A;  2VRR B;  3DOW A;  4E71 A;  1GC6 A;  2ZCC A;  2CHZ A;  4KIK A;  1TZ1 A;  2FCM A;  4NQL B;  2KXJ A;  2LD9 A;  2NR2 A;  3CF6 E;  1Q0W B;  2LAS A;  2MP2 A;  4HK2 A;  4HLE A;  2LZ6 A;  2QHO A;  3RUI B;  1RLF A;  3RT3 B;  2DX5 B;  3PRM B;  1C1Y B;  1WMH B;  3PGE A;  4MGK E;  3DBS A;  4XX5 A;  4FJY A;  5FR6 A;  1VD2 A;  3PLV A;  3R7R A;  5CTR C;  4TUU A;  4ANW A;  3C0R B;  2JF5 A;  2CHW A;  3KUD B;  3SDL C;  2KKC A;  2KLC A;  2N7E A;  4WAA A;  4WWN A;  3ZNH B;  4HCN B;  2DEN B;  3ZDM C;  2HD5 B;  1WF9 A;  1EUV B;  3A9J B;  4KDI C;  2MSE D;  3ECI A;  4IWQ A;  2M17 A;  2DYM A;  3QCA A;  3PSE B;  1AAR A;  4G0N B;  1WJN A;  1UBQ A;  3H1U A;  1E8Y A;  1TGZ B;  2BKF A;  2RPQ A;  3H7P B;  2NBU A;  4E74 A;  2YVC A;  1WRD B;  2CKH B;  4W9H A;  1WM3 A;  3ZTC A;  3APF A;  2N1V A;  2B3A A;  2K1F A;  2MBH A;  2PE6 B;  3IHP C;  4LCD E;  3VHT C;  4FJZ A;  5IA7 A;  2CHX A;  4MGZ E;  1WMH A;  4JQW C;  2JRI B;  4F7Z A;  4KZ0 A;  1SE9 A;  2KWV B;  3V6E B;  3QX1 A;  4KSK C;  2IY0 B;  2WWZ A;  2D10 A;  1BT0 A;  1P98 A;  2IBI B;  5AEK B;  1WGD A;  1E7U A;  1P3Q U;  4W9C A;  3UF8 A;  4ICV A;  3RD2 A;  1ZGU B;  3VDZ A;  3JW0 X;  3ZRC A;  4DK5 A;  1EF5 A;  2PE9 A;  4WJO A;  2GBJ A;  1GUA B;  3PRZ A;  4IC7 B;  2M1M A;  4ZDV A;  4A3O A;  4GOC A;  2LUE A;  3PPA A;  3M63 B;  4W9L A;  3WAO A;  3CST A;  1M94 A;  4M0W B;  2ZEQ A;  2JY6 A;  4EEW A;  5J17 A;  3H7P A;  3HM3 A;  2KDI A;  4ICU A;  3QHT A;  4HJK A;  4KVG B;  1V80 A;  2FCQ A;  2GBR A;  1ZKH A;  2G4S A;  2WYQ A;  1XD3 B;  4B9K A;  4WJP A;  1V86 A;  2MW5 A;  2JPH A;  2W9N A;  1LM8 B;  2KDF B;  3TMP B;  3A33 B;  4MJS B;  3L08 A;  5DPR A;  2ZVO A;  1WR1 A;  2DZM A;  1E8W A;  4NPN A;  2KC2 A;  4RMA A;  4FA6 A;  2Z59 B;  2AEH A;  4W9D A;  3GZN I;  5DPW A;  2JVC A;  4W9J A;  4FHJ A;  5JHB A;  2KVR A;  3A9K A;  4AWJ A;  2NPT A;  5TR5 A;  3T8M A;  4DDG D;  2GBM A;  1WXA A;  1JRU A;  2M0X A;  4K81 A;  2BYE A;  2KWU B;  2NCN A;  1WGG A;  2LXC A;  4HCP B;  4NNJ B;  3V61 A;  4W9G A;  3ZKJ C;  5LXI B;  4AUQ C;  2DAF A;  2KAN A;  2KNB A;  5GMV A;  1UGM A;  2XEW A;  2KLG A;  1WGH A;  2BWF A;  1ISN A;  2L8J A;  4DWF A;  4NQK E;  1V6E A;  2LGY A;  4W9E A;  2JRH A;  4J6I A;  2UYZ B;  4DHZ E;  3PHX B;  2KJR A;  4IWO A;  2K8B A;  2MP2 B;  3D32 A;  1V81 A;  2GMI C;  2L3Z A;  1WFY A;  2FID A;  4HPM B;  4MJS A;  1R4M I;  3RZW C;  3R3M A;  2IZV B;  1PQS A;  2CR5 A;  1GC7 A;  2JZZ A;  4GN1 A;  4I6N B;  4CHK A;  4E3C A;  4DDI D;  4EKU A;  3ZLZ A;  1LXD A;  3KYC D;  2BF8 B;  1V49 A;  3OJ3 A;  2ZJD A;  4KZC A;  2N9P C;  3ONS A;  1WJU A;  3BY4 B;  3P2B A;  2K6Q A;  1OEY A;  3HK0 A;  4TV3 A;  3JSV A;  4WJN A;  4DXA B;  2LXA A;  3A4S C;  4LDT B;  3M62 B;  4AP4 C;  4MEL A;  2O2V A;  3RYT A;  2BYV E;  2EMT A;  4B6W A;  2IO2 B;  4KDL B;  1WM2 A;  3ZW3 A;  5DPS A;  3ZDT A;  3QK0 A;  3PRP B;  1OTR B;  3L13 A;  2PPH A;  4ZYN A;  2KDE B;  5CX3 A;  1OQY A;  4PYZ A;  3V62 A;  2GBN A;  2ZZP B;  2LVP A;  4BKS A;  2ZPN A;  2GBK A;  5D7G A;  1WR6 E;  2MBO A;  1FXT B;  5KHO A;  4GGQ A;  5E6P A;  3IG3 A; 
#chains in the Genus database with same CATH topology
 3JYU A;  3EGR A;  4WQO B;  2W54 A;  2QC8 A;  1Z2M A;  2IPK D;  3URY A;  5FK9 C;  4GIV A;  2D3G A;  1E8Z A;  2WXL A;  2MBE A;  2JXT A;  4NJC A;  2RDH A;  2LRU A;  3B2G A;  2BWE S;  3KUZ A;  2V1Y A;  3P4R B;  2BS3 B;  2WX0 A;  1CMX B;  1V5O A;  5HG2 A;  4N6E B;  4DHJ B;  1Q1O A;  1WXS A;  2KJ6 A;  4GDK B;  4IG7 B;  4OZC A;  4RGM A;  4D2K A;  3RNC C;  1R4M B;  3A9K B;  2FBW B;  1F1H A;  3Q14 C;  1IP9 A;  4OVV A;  3DQV A;  4YL8 A;  3DHI C;  4KSL C;  4XDD A;  3V60 A;  4YTM B;  1CJE A;  4MSQ B;  4PS7 A;  4IW0 A;  3QC8 B;  1VZ8 A;  1FNU A;  2V4L A;  4FJV B;  2BB6 A;  1WGY A;  4HEA 1;  2C9W B;  3BVZ A;  1VJK A;  3LJ3 A;  4BOZ B;  2KN5 A;  4RGT A;  5BO4 B;  5E6N A;  3IVF A;  4LJO B;  2D3C A;  2IO0 B;  4EZL A;  3L0W B;  4IUM B;  1QLB B;  4B95 A;  4MAC A;  2O2V B;  4DHZ B;  4W9K A;  5CHV C;  2BTE A;  4A20 A;  1F2R C;  3Q3J A;  3JVZ X;  3U7Z A;  2SEB D;  3ABV B;  3RNE C;  4ZRK A;  4HPL B;  2BYF A;  4KKI A;  3AXC A;  5H92 C;  4MGI E;  3OLM D;  4P7I A;  2FNJ B;  4FBJ B;  1NI2 A;  3ETR A;  2MJ3 A;  3PLU A;  2FCS A;  2L1A A;  4PS3 A;  4DXF A;  3N30 A;  1XLO A;  3N3K B;  1MFW A;  1EU3 A;  4KX6 B;  1WY8 A;  1XT9 B;  2N9X A;  1XO3 A;  5HKH A;  3X23 A;  3WAP A;  2JZ3 B;  2JSV X;  4NZL B;  3VXW A;  1WXM A;  3AV8 A;  2N4F A;  2L83 A;  4MM3 A;  3VH4 B;  4HXD A;  3M95 A;  3WAM A;  1GB4 A;  4NAW B;  1EF1 A;  3EUB 2;  3MTN B;  4YXD B;  4GLS C;  4ANV A;  1XQQ A;  2GI9 A;  2FAZ A;  2ZPY A;  3A1Q B;  1FNV A;  2MA9 B;  3GOE A;  1MG8 A;  4YSY B;  1J19 A;  3PV1 A;  2QMT A;  2N1W A;  3HRD D;  2FIF A;  2TSS A;  3EHV A;  3NRZ A;  3KH0 A;  4YSX B;  1N60 A;  4CQN A;  2AQ2 B;  4IDI A;  3MHS D;  5L95 C;  2LRW A;  1MPE A;  2Z0E B;  3N1Z C;  3ML8 A;  2RD0 A;  3V6C B;  4XE0 A;  1YJ1 A;  3SU8 X;  5EDS A;  2INN E;  3L54 A;  2K39 A;  2L0F A;  1JAL A;  3PZD A;  4BVU C;  3CIR B;  1D3Z A;  2KMA A;  4K7U A;  4GMV A;  2MCN B;  1HXY D;  5EE3 A;  4HVB A;  3CMM B;  4MH8 A;  2BB5 A;  2KOX A;  2KJH B;  2V9H A;  3AU5 A;  2HDE A;  5IN7 A;  3A4R A;  1V1P B;  3R2T A;  1G6J A;  1I4X A;  2L52 A;  2PJH A;  2INP E;  5J2R A;  4HDQ A;  1WRI A;  3ZXR A;  1C77 A;  2REX A;  2WXQ A;  3AM9 A;  3NVY A;  3R2I A;  1JML A;  2K9X A;  3DHG C;  3LDZ E;  2KTR A;  4HDO A;  1HE8 A;  1OEY J;  2ZNV C;  2J0J A;  2J7Q B;  1SE2 A;  2N0S B;  1EO6 A;  2EEL A;  1T5X D;  2G1E A;  3H8H A;  5E6O A;  1PGX A;  4LLG M;  2DAJ A;  1YOV B;  3BYY B;  1LQB A;  3U30 A;  3VQI A;  5JZE B;  1N62 A;  2MHJ A;  2WXP A;  4AJY B;  1T0Y A;  2L00 B;  4DXG A;  2WXI A;  4IM2 A;  2H88 B;  5HI1 A;  3HVD A;  4ZRJ A;  4XZ4 A;  3NVV A;  1S1Q B;  1YX6 B;  1YIW A;  2BQQ A;  3OJ4 B;  2KDB A;  3W5V B;  1PYW D;  3K9P B;  1YQB A;  1CK1 A;  1PFD A;  1GAQ B;  1B9R A;  4US9 A;  3HM6 X;  2WXJ A;  5KHQ A;  1JWB D;  2WU5 B;  2KWC A;  1VZ6 A;  2G4D B;  2WU2 B;  2OHF A;  1WX7 A;  2YEP B;  2MBQ A;  4FUL A;  4JLC A;  1KOT A;  4RGO S;  2V0G A;  1KTK A;  3E9S A;  2CHZ A;  1TZ1 A;  2LD9 A;  1K53 A;  1XF5 L;  5BMH A;  2LZ6 A;  2DX5 B;  2M0A A;  1KF6 B;  1C78 A;  2K3U A;  3NVZ A;  4ANW A;  3TEX A;  3KUD B;  2KLC A;  2N7E A;  4WWN A;  4JWS C;  1HA5 A;  2HD5 B;  1EUV B;  1N5X A;  3A9J B;  2I2Y A;  2M56 B;  2M17 A;  1FPY A;  1OQQ A;  3PSE B;  1AAR A;  4G0N B;  3H1U A;  2RPQ A;  2BW2 A;  3APF A;  1QT9 A;  3AE6 B;  4FJZ A;  1ZUD 2;  2CHX A;  1STE A;  2KWV B;  3V6E B;  4KSK C;  2D10 A;  1A70 A;  2IBI B;  3VR9 B;  4W9C A;  4ICV A;  1ZGU B;  1EF5 A;  1F52 A;  2DWQ A;  4WJO A;  2GBJ A;  1TS4 A;  4LNK A;  4RF1 A;  4XDC A;  1M94 A;  4M0W B;  4TSS A;  1UNS A;  2QJL A;  4AQ7 A;  2Y5P A;  3H7P A;  1ZXH A;  1K50 A;  1KFY B;  4KVG B;  2FCQ A;  2G4S A;  2WYQ A;  3OG5 A;  1XD3 B;  1SJE D;  2QIE B;  4WJP A;  1V86 A;  4B9K A;  2W9N A;  3TMP B;  5DPR A;  2GB1 A;  2ZVO A;  1WR1 A;  4FA6 A;  2AEH A;  5DPW A;  3IAS 1;  3SFE B;  2KVR A;  4LK0 M;  2L32 A;  2GLS A;  4DDG D;  2V4I B;  4K81 A;  5LXI B;  4XYC A;  1UGM A;  2XEW A;  2KLG A;  3RNF C;  2K5P A;  4ZRQ A;  2WXF A;  4DWF A;  4NQK E;  2LGY A;  4W9E A;  2JRH A;  3MC8 A;  3PHX B;  1D5M C;  2MP2 B;  2FID A;  1UF0 A;  4HPM B;  2IZV B;  1PQS A;  2JZZ A;  4GN1 A;  3KYC D;  2BF8 B;  2BS2 B;  2IGH A;  2EKI A;  4LNF A;  1OQR A;  1OEY A;  2RDB C;  3KWL A;  3JSV A;  2JWU A;  3A4S C;  3M62 B;  4AP4 C;  2EMT A;  1I7H A;  4B6W A;  1WM2 A;  3ZW3 A;  1JWA D;  2PIA A;  3QK0 A;  3ZDT A;  3L13 A;  3AEC B;  3V62 A;  1K52 A;  3TUO A;  2ZZP B;  1QOB A;  3BYT B;  1DOY A;  2MBO A;  1FXT B;  3IG3 A;  4R3D A;  1D5X C;  5BYS A;  4WAF A;  1V2Y A;  2AL6 A;  3GZN B;  1TBE A;  2G3Q B;  4P1C C;  4EZJ A;  2VZK B;  2CU1 A;  3DBL B;  5DPT A;  2K22 A;  3AUL A;  3W1S C;  1C4P A;  4FHK A;  1UGJ A;  4OVZ A;  4N59 A;  3VUX A;  3DVG X;  1L5P A;  3B1L X;  2FCN A;  2I1J A;  1MHH E;  1YN4 A;  1HQR D;  3EFU A;  2IJ0 A;  4GSW A;  2JXX A;  5IP4 D;  1MI0 A;  1KLG D;  2EMS A;  1UH6 A;  1TKG A;  3RZF A;  3VAW A;  1C76 A;  3EFC A;  1AN8 A;  4G3X B;  1E7P B;  1UEL A;  2PVO D;  3W5U B;  1DYQ A;  1N5W A;  1SB3 C;  2MX2 A;  3ZQ4 A;  5C23 A;  1WZ0 A;  4RCO A;  5G2N A;  3P42 A;  2V3N A;  4XWW A;  3VTV A;  1QOF A;  2CS4 A;  2RGF A;  2ASQ A;  4NJ7 A;  4QAY A;  4EUT A;  1Y56 A;  1WX8 A;  4LDT D;  2KFK A;  5FR3 A;  4IM3 A;  1DOX A;  4JPS A;  1XLP A;  4WJQ A;  3SD5 A;  1WJ6 A;  1C4C A;  4II3 B;  4EE2 A;  3IT6 B;  3DBL I;  4AS1 A;  4FLH A;  5G55 A;  3UQB A;  3U8Z A;  4LJP B;  3PVL A;  2GRI A;  2L05 A;  5JH5 C;  1KLV A;  4K7W A;  3UIO B;  3B0A A;  1DOI A;  2IGG A;  4A9A A;  2LWP A;  3RNB C;  2M8S A;  1KM7 A;  1JW9 D;  2DHZ A;  1VRA B;  2W55 A;  1PGB A;  3ENE A;  5EE0 A;  4WWP A;  2LMC A;  2RR9 A;  1YX5 B;  3R8B A;  1WX9 A;  1WGR A;  3VH3 B;  2WLB A;  2M4N A;  1BXT A;  5D6J B;  1TKE A;  2K8C A;  2G45 B;  1VCB A;  4ZRI A;  1N61 A;  3PO0 A;  2DYO A;  2LGX A;  2WXO A;  2O6V B;  3CSF A;  1JCK B;  3PHW B;  1JRO A;  5DCN A;  1ET9 A;  2UWQ A;  1T0S C;  1RRB A;  2DZJ A;  1WXV A;  3DBH I;  4HKQ A;  4BOS C;  2R2Q A;  1V9J A;  3RI7 C;  2WXG A;  2KQ7 A;  3NS1 A;  1GOZ A;  2OJR A;  1IGC A;  2A4Z A;  1Y8R C;  3NG0 A;  2QIL A;  4O1N A;  3AEB B;  1ZE3 D;  2WXM A;  2KTR B;  4EZK A;  1UBI A;  2KN4 A;  2WS3 B;  1R4N I;  2XNA C;  1VZ7 A;  4HWI B;  4A6Q A;  3RFZ B;  4BKS D;  3BVG A;  2I1K A;  4C4V B;  3J9C A;  1WH3 A;  4NJ6 A;  5CHF A;  2J42 A;  3L17 A;  1TYG B;  4TQ1 A;  4C56 C;  1J8C A;  1J7C A;  3W1Y A;  3ZGZ A;  3AU4 A;  3GS2 A;  5IAA C;  2LI5 A;  5H8Y E;  2Z8L A;  2DYB A;  2ON8 A;  4AOF A;  1F9J A;  2A5U A;  3VFK A;  1ZPS A;  1QOA A;  4GU2 A;  4S0R A;  2LGD A;  3TBL D;  2BT6 A;  4OZA A;  2IO1 B;  4P1B C;  3ML9 A;  3KVF B;  3APC A;  3SHQ A;  4BKT A;  2W3R A;  2ZVN A;  4CO7 A;  4A55 A;  2NS5 A;  1TJE A;  1SIF A;  3AE7 B;  3VVW B;  3ZNG C;  2BPS A;  2HTM E;  2R2O A;  4PT5 A;  4TKN A;  3W1S A;  1C9F A;  1UWM A;  1Q5W B;  2D11 A;  2XN9 C;  4MDK E;  3P1M A;  4A8X C;  1WJ4 A;  2XBB C;  1FFU A;  5D3D A;  3ZIM A;  4IOI E;  5D2M B;  1ZP0 B;  2D07 B;  2LJ5 A;  3DVG Y;  3T9L A;  1GPX A;  1WIA A;  2BGF A;  4N9F 4;  3HHM A;  2VRR B;  3MC9 A;  2ZCC A;  4KIK A;  2FCM A;  3ZJT A;  3AE1 B;  2NR2 A;  4HK2 A;  4HLE A;  3RUI B;  1RLF A;  3I9V 1;  3PRM B;  1C1Y B;  4HRO A;  1L6U A;  3PGE A;  4MGK E;  3TSS A;  3DBS A;  4XX5 A;  4FJY A;  5FR6 A;  1FEH A;  4TUU A;  4WAA A;  3AN1 A;  3Q3M C;  2DEN B;  1WGK A;  1WF9 A;  4ARC A;  1L0Y B;  3ECI A;  3QCA A;  3IT4 B;  1SE3 A;  1WJN A;  1F77 A;  2W82 A;  3H7P B;  2YVC A;  2N1V A;  2LHD A;  1VLB A;  4MGZ E;  2JX5 A;  1WMH A;  4KZ0 A;  1NYQ A;  2BBC A;  1SE9 A;  1ENF A;  3QX1 A;  1EWC A;  2OJW A;  1P98 A;  5BYR A;  1E7U A;  2PW9 A;  3VR8 B;  3JW0 X;  4RF0 A;  2M1M A;  3PPA A;  3M63 B;  4W9L A;  2ZEQ A;  3GE8 C;  2H89 B;  2KAJ A;  3HM3 A;  3QHT A;  4HJK A;  4B0E A;  3ZJV A;  5GXG B;  2GBR A;  2YEP F;  1UWX A;  1I4R A;  3KQ4 A;  3A33 B;  3L08 A;  2KC2 A;  4RMA A;  1FCC C;  2JVC A;  3A9K A;  4OW0 A;  5HHD G;  1WXA A;  2LXC A;  1F0Z A;  2DAF A;  3L4P A;  1YQ3 B;  3T3O A;  1E0Z A;  1K51 A;  2UYZ B;  3P4P B;  2N7J A;  4IWO A;  2K8B A;  1TKY A;  3D32 A;  1WXQ A;  2KQ4 X;  3LB8 C;  4MJS A;  2ONQ A;  3VRA B;  2VH2 A;  3ZLZ A;  1MJD A;  3OJ3 A;  2K0P A;  2ZJD A;  4KZC A;  5G5H A;  1TS3 A;  2N9P C;  2E3T A;  1WJU A;  3BY4 B;  1ZDV A;  3AE2 B;  2KDM A;  4TV3 A;  1VR9 A;  4WQM A;  2O2V A;  2BYV E;  1WWT A;  2RDG A;  5FKA C;  4KDL B;  3V3X A;  3DHH C;  3AE3 B;  5IO9 A;  4BKS A;  2LFI A;  2GBK A;  2LHE A;  5D7G A;  3Q8E A;  2QCZ A;  4K3C A;  2KX0 A;  3O13 A;  1OGW A;  3R7Q A;  5JHA A;  3OAW A;  4KV2 A;  3AH7 A;  1QIL A;  4WH4 A;  4YWG G;  1QZE A;  3UGB B;  2JWZ A;  5LLI A;  4MGY E;  2WDQ B;  1NI3 A;  1WSP A;  2JT4 B;  1IUE A;  1JWM D;  2AQ1 B;  2ZCB A;  1RM6 C;  1MVK A;  1VDV A;  3U52 E;  4NAM A;  2PTL A;  4ANX A;  1WZ3 A;  2NPT B;  4RFB A;  5AZG A;  3ALB A;  3W9C B;  3N20 C;  2WHI A;  4I6L B;  3CWI A;  2CJN A;  2N7D A;  4YTN B;  3TJP A;  4JL9 A;  2N9E B;  3QJZ A;  1I35 A;  3N9Y C;  3GB1 A;  3TIX A;  2WXN A;  4JE3 B;  4KGR A;  3NS8 A;  2YLM A;  5IKC M;  3TCA A;  3AED B;  4HRS A;  5G5G A;  2KD0 A;  1E5W A;  1EWY C;  4CYE A;  3MHZ A;  1P7F A;  4MSM B;  1XLQ A;  4MH0 E;  2Y3A A;  4REZ A;  4BBN F;  5IOI A;  2NBW B;  2KFJ A;  2D3A A;  2VZK D;  4BBN C;  5L83 A;  2NBV B;  2EKE C;  1SIJ A;  2IGD A;  1P0R A;  2C7M B;  5JXV A;  3RMK C;  2LGI A;  5D3I B;  1FFV A;  3TEW A;  3BII D;  1AYF A;  1IYF A;  4WIP A;  2MH7 A;  1IPG A;  2V3S A;  3AE8 B;  1KJT A;  1XCQ L;  1D4B A;  1N6Z A;  2C7H A;  3Q3N C;  4ASW C;  1T0Q C;  2LGS A;  3DPD A;  2WDV B;  2MJE A;  3QAQ A;  4JWU C;  3DBR I;  3ZJU A;  1T3Q A;  1WE6 A;  1J7B A;  1SEB D;  4F1S A;  1LFD A;  4I6P A;  2HJ8 A;  4M8M A;  1ET6 A;  3C19 A;  2DZK A;  2QSD A;  4C00 A;  2XK5 A;  3RN9 C;  2UU7 A;  2M19 A;  1HTQ A;  5BYQ A;  2IY1 B;  1XCT L;  3N1Y C;  1I4Q A;  5E6J A;  4YTP B;  2B76 B;  4YT0 B;  5D94 A;  5AUI A;  4FAD A;  4ITK A;  2IDY A;  3PZ7 A;  3R66 C;  3RCZ A;  2OED A;  1Q10 A;  1RAX A;  3VTU A;  5AZH A;  2BKR B;  4BAX A;  4M02 A;  3RPF C;  4GDL A;  2KYW A;  2HE7 A;  4PS8 A;  3UQA A;  3Q8B A;  3QA8 A;  3Q8A A;  2CJO A;  1WYW B;  3A9J A;  2WGS A;  3DWM A;  4RNA A;  3NZS A;  1FRD A;  1SXT A;  1J0G A;  4II2 B;  2O6V D;  4F8C B;  3PS6 A;  3AMZ A;  4M8N A;  2IYD B;  4ARI A;  4RH6 A;  3NOB A;  2MJD A;  3DBH B;  3N32 A;  2KK8 A;  4MM3 B;  3KUC B;  1XLN A;  1JRP A;  3IBE A;  3ZTD A;  3Q3O C;  4EFO A;  4A90 A;  3BVM A;  1QKZ A;  3NY5 A;  1YN5 A;  3H9D A;  3P4S B;  1ZXI A;  3WAL A;  1FMA D;  3AE4 B;  2K6D B;  4M0W A;  3DDC B;  3QAR A;  1NEN B;  4S17 A;  3PT2 B;  4DHJ D;  2LEK A;  3O65 B;  1A5R A;  4KIK B;  2ACZ B;  1YD8 U;  4A3P A;  1J7A A;  2LVO A;  1K8R B;  1R4N B;  2X8X X;  3NUH B;  4G50 A;  1DGJ A;  3DWG C;  2WXH A;  2L7R A;  4K7S A;  2WXK A;  2C5L C;  4YSZ B;  1YJI A;  1YMH E;  2FE8 A;  3VUW A;  3Q2A C;  5LNK 1;  2C60 A;  3MFG A;  1N63 A;  1TY2 A;  1QQR A;  3P63 A;  3UIN B;  3UIP B;  4W9I A;  1RFA A;  2MBB B;  3RUL A;  3VUY A;  3DOW A;  4P16 A;  3RNA C;  2KVZ A;  3PZ8 A;  4E71 A;  1GC6 A;  1YJJ A;  1TZO A;  4NQL B;  1FCL A;  1Q0W B;  2LAS A;  2MP2 A;  4C7Y A;  1WMH B;  1XEE A;  3AEE B;  1OFF A;  3PLV A;  2RMM A;  4LNI A;  5CTR C;  3R7R A;  1T0R C;  2HJ1 A;  2AQ3 B;  2Y5C A;  2KKC A;  3GP7 A;  3NJT A;  3ZNH B;  3NVW A;  1FXA A;  4WWM A;  3Q6B A;  4KDI C;  2MSE D;  4IWQ A;  2DYM A;  1ROE A;  2MEK A;  1UBQ A;  1E8Y A;  4E74 A;  3I63 C;  1WRD B;  1JQ4 A;  1FO4 A;  1MHX A;  1M4V A;  4J3O D;  2MBH A;  3IHP C;  2PE6 B;  4LCD E;  5IA7 A;  2PLP A;  1CQV A;  2JRI B;  3FIL A;  2D3B A;  2WXR A;  2I38 A;  2IND C;  2WWZ A;  2ZW1 A;  5AEK B;  3ZYY X;  1L0X B;  1WGD A;  1P3Q U;  3UF8 A;  3ZRC A;  2BYT A;  1SJH D;  4DK5 A;  4B0M A;  2PE9 A;  1IGD A;  1GUA B;  3N1X C;  3PRZ A;  4ZHP A;  1V8C A;  3WAO A;  3CST A;  5J17 A;  2KDI A;  3I57 A;  4ICU A;  1LGR A;  1ZKH A;  2MW5 A;  3C8Y A;  4LNO A;  5HFY A;  2N9K A;  4MJS B;  4W9D A;  2N9L A;  4W9J A;  4FHJ A;  3FKY A;  4AWJ A;  1L6V A;  1WYG A;  2NTS A;  5TR5 A;  2FUG 1;  3B2F A;  2GBM A;  2BYE A;  2NCN A;  3V61 A;  4NNJ B;  4HCP B;  3ZKJ C;  4W9G A;  4Q2J A;  5GMV A;  2KAN A;  2KNB A;  4KGS A;  1EU4 A;  1WGH A;  2BWF A;  1GB1 A;  2DNF A;  1ISN A;  2L8J A;  1IBX A;  1UUP A;  1V6E A;  1D5Z C;  4DHZ E;  2GMI C;  1WFY A;  1R4M I;  3RZW C;  2QDF A;  1FRR A;  1GC7 A;  4I6N B;  4M01 A;  4CHK A;  2WNM A;  4DDI D;  1LXD A;  1EM7 A;  2LUM A;  4HKZ E;  4C80 A;  3P2B A;  2K6Q A;  3HK0 A;  3SR6 A;  4DXA B;  4MEL A;  3BZD B;  3PRP B;  2INC C;  3FAH A;  4HPP A;  5CX3 A;  2GBN A;  2ICI A;  1ESF A;  2ZPN A;  1BUI C;  1WR6 E;  4GGQ A;  5E6P A;  1P7E A;  2DLB A;  2JYE A;  2LVQ A;  3AEG B;  2JUO A;  1P1A A;  5I4D A;  3WCQ A;  1UD7 A;  2K25 A;  2OOB B;  4K1R B;  3B08 A;  2J53 A;  2J4X A;  2MRP A;  3WA0 A;  1BML C;  3U4E G;  4C7Z A;  3MJ5 A;  3DCG A;  3I3T B;  3OWE B;  1FIQ A;  4W9F A;  2MWS B;  4DQO C;  2AL3 A;  2KC1 A;  2O6V A;  2NMQ A;  3Q8C A;  1LO5 D;  4UDU C;  2KAC A;  2BVC A;  5EE9 A;  1KLU D;  1YQ4 B;  4TMA B;  2WDT B;  1FNW A;  3BIN A;  3AEF B;  3QIJ A;  5C1Z A;  3HIZ A;  3PTF C;  4ZYS A;  1E6E B;  1SSN A;  4OZB A;  2L0T A;  2KQS A;  1UZX B;  1CZP A;  1F2R I;  4JGH B;  3HVZ A;  4GDK A;  3SEB A;  1FD6 A;  5CHW A;  1JWU D;  2NVU I;  1MG4 A;  1QF6 A;  4PYU A;  1I42 A;  2Y5B B;  3V05 A;  2JYT A;  4MT5 A;  1TTN A;  1ZOY B;  4IM0 A;  3EA6 A;  2KTF A;  1PGA A;  3JSV B;  3APD A;  4C4V A;  3L16 A;  1V97 A;  4ZRP A;  1R7S A;  1NYR A;  3H7S A;  4KKJ A;  1V5T A;  2R61 A;  3VTW A;  1QOG A;  4PK1 A;  4X57 B;  2J0M A;  4JX1 C;  1V1O A;  3AI5 A;  4L2Y A;  4BFR A;  1U4A A;  3RNG C;  2KHW B;  3ZVV A;  2K8H A;  1I4P A;  3WAN A;  4FN2 A;  4JIO U;  2KMM A;  4MEM A;  1TY0 A;  2JQR B;  4K3B A;  1Z5S B;  3BWU D;  5C3J B;  4ZHO A;  2FUH B;  3DVN V;  3MJW A;  4ANU A;  4RM9 A;  4M00 A;  3K9O B;  1SBB B;  4IWP A;  2AYO B;  1T6B X;  3PRE A;  1NDD A;  4URK A;  3KWV A;  1L4D B;  2ZNV B;  1WE7 A;  2XK5 B;  3ZRF A;  4GXB A;  2ZW0 A;  1NBF C;  2Z0D B;  3ZNI D;  1ZDX A;  1RWS A;  4LTU A;  2C7N B;  2KZR A;  3T3N A;  2BS4 B;  1E8X A;  4TQ0 A;  4L23 A;  3W2D A;  2AWT A;  5AZF A;  3MC0 B;  1X1M A;  2WX1 A;  4GDL B;  1ACC A;  4BKG A;  1L0V B;  1ZW7 A;  2QEJ C;  1H8C A;  1I4H A;  4NAW A;  4FXC A;  1HEZ E;  3L10 B;  3B9J A;  2PEA A;  4RM8 A;  2KMC A;  3NHE B;  2KFK B;  1D6E C;  3IFW B;  3EEC A;  2PVG C;  5TSS A;  3A1Q A;  2VH1 A;  3UI3 A;  4WWO A;  1WI0 A;  5BMG A;  3AEA B;  2L76 A;  3X0W A;  2IO3 B;  1P9D U;  4IKG A;  3IAM 1;  3KW5 B;  1KH0 A;  1RFK A;  1SGH A;  2D2Q A;  1SE4 A;  1TT5 B;  3LXF A;  3I5J C;  3H6N A;  1H4R A;  1E90 A;  3BK2 A;  2J0K A;  3HUI A;  2DZI A;  1L7Y A;  5AUK A;  1E7V A;  3S2A A;  4G11 A;  4P6V F;  1GJZ A;  4AJW A;  3SFD B;  1C79 A;  2KO3 A;  3TL5 A;  2E6X A;  3Q3F A;  1GNU A;  4XGA B;  2J52 A;  2JZP A;  3EC8 A;  2NTT A;  2MQJ A;  4EOY A;  2MLB A;  4OHJ A;  3ZNZ B;  1I4G A;  2HTH A;  2LJI A;  3DBR B;  1E10 A;  3BK1 A;  3U2S C;  1C3T A;  1L2N A;  1TIF A;  1V1P A;  3DVN U;  1C4A A;  4KGT A;  4DBG A;  3P4Q B;  5LXH A;  2KX3 A;  1GG3 A;  3NZU A;  2PMV A;  3U7D A;  3ZUN A;  1FM0 D;  2RSU A;  3QQ8 B;  4BZA A;  1PDX A;  3ZXV A;  3KYD D;  4OVU A;  2AX5 A;  4NY0 A;  2W3S A;  1XXG A;  1PUT A;  3WIM A;  2DBY A;  3FC4 A;  2WQY B;  4L1B A;  5MPO A;  4GB9 A;  3ZO5 B;  2JU6 X;  4ACF A;  4N58 A;  3NZ3 A;  1NVI D;  2GOW A;  1S3S G;  3QWZ B;  5J18 A;  3Q8F A;  4XC2 A;  3M3J A;  3VRB B;  3AE9 B;  3Q69 A;  4US8 A;  2KXJ A;  3CF6 E;  2QHO A;  2X38 A;  3RT3 B;  3FIL B;  1VD2 A;  3AB5 A;  3C0R B;  2JF5 A;  2CHW A;  3SDL C;  2RPV A;  2CU3 A;  4HCN B;  3ZDM C;  1YNT E;  2SAK A;  2G9H D;  2V3P A;  1B1Z A;  3TEY A;  1NEK B;  1TGZ B;  2BKF A;  2NBU A;  1SF0 A;  2CKH B;  1RYJ A;  4W9H A;  1WM3 A;  3E56 A;  3ZTC A;  4WUR A;  3TEZ A;  2B3A A;  2K1F A;  3VHT C;  2KWD A;  3LYY A;  4JQW C;  1HZ6 A;  4F7Z A;  2Q5W D;  3MP9 A;  1L4Z B;  5BMI A;  1JWS D;  2IY0 B;  1KRH A;  1BT0 A;  5T8I A;  3AE5 B;  3RD2 A;  3VDZ A;  1YN3 A;  1HTO A;  4ZDV A;  4IC7 B;  4A3O A;  4GOC A;  2LUE A;  4USA A;  2JY6 A;  3GE3 C;  4EEW A;  4H2A A;  1IBX B;  1AWD A;  1V80 A;  2JPH A;  4RGN A;  1LM8 B;  2KDF B;  2DZM A;  1E8W A;  1AW7 A;  4NPN A;  2Z59 B;  3GZN I;  2PKO A;  5JHB A;  1TS2 A;  2WDR B;  3IXS A;  2NPT A;  1FXI A;  3T8M A;  2KT7 A;  1JRU A;  2M0X A;  2KWU B;  1WGG A;  4AUQ C;  2D5G A;  4HJG E;  4XWT A;  4J6I A;  2KJR A;  1V81 A;  2L3Z A;  1HZ5 A;  3R3M A;  2CR5 A;  5EE1 A;  5C2T B;  4E3C A;  2WP9 B;  4ZOH C;  4EKU A;  1V49 A;  3KLS X;  3ONS A;  4WJN A;  2LXA A;  4LDT B;  3RYT A;  4LNN A;  2IO2 B;  5DPS A;  1OTR B;  2PPH A;  4ZYN A;  1E9M A;  2KDE B;  1TS5 A;  1OQY A;  4PYZ A;  2LVP A;  5KHO A; 
#chains in the Genus database with same CATH homology
 3JYU A;  2KX0 A;  2LVQ A;  1OGW A;  4WQO B;  3R7Q A;  5JHA A;  2JUO A;  1P1A A;  1Z2M A;  4GIV A;  2D3G A;  1E8Z A;  1V2Y A;  3OAW A;  2MBE A;  2AL6 A;  1TBE A;  4KV2 A;  1UD7 A;  2G3Q B;  2K25 A;  2OOB B;  4K1R B;  2LRU A;  3B08 A;  4EZJ A;  2CU1 A;  5DPT A;  1QZE A;  2MRP A;  3WA0 A;  3UGB B;  2BWE S;  3AUL A;  2V1Y A;  3KUZ A;  4FHK A;  3W1S C;  2JWZ A;  2WX0 A;  1CMX B;  5LLI A;  4MGY E;  3DCG A;  1V5O A;  3DVG X;  3I3T B;  3VUX A;  3B1L X;  4W9F A;  2MWS B;  2JT4 B;  2FCN A;  2AL3 A;  2I1J A;  2KC1 A;  4DHJ B;  1Q1O A;  1WXS A;  2KJ6 A;  2O6V A;  4GDK B;  4IG7 B;  3EFU A;  2ZCB A;  4GSW A;  2JXX A;  2EMS A;  1UH6 A;  4ANX A;  3A9K B;  3RZF A;  3VAW A;  1WZ3 A;  2NPT B;  1IP9 A;  4OVV A;  3DQV A;  3ALB A;  5AZG A;  2WDT B;  4YL8 A;  3BIN A;  3QIJ A;  4I6L B;  4KSL C;  4G3X B;  5C1Z A;  3HIZ A;  1UEL A;  3PTF C;  3V60 A;  2MX2 A;  2N7D A;  3TJP A;  4JL9 A;  5C23 A;  2L0T A;  4MSQ B;  4PS7 A;  1WZ0 A;  2KQS A;  2N9E B;  3QJZ A;  1UZX B;  4IW0 A;  3QC8 B;  5G2N A;  2V4L A;  1I35 A;  4FJV B;  3VTV A;  1WGY A;  4JGH B;  4GDK A;  3TIX A;  3NS8 A;  2YLM A;  2CS4 A;  5CHW A;  2RGF A;  2C9W B;  2ASQ A;  4NJ7 A;  3LJ3 A;  4EUT A;  3TCA A;  2NVU I;  1WX8 A;  4LDT D;  2KFK A;  4BOZ B;  2KN5 A;  5BO4 B;  4IM3 A;  5E6N A;  4PYU A;  4WJQ A;  3IVF A;  3SD5 A;  1WJ6 A;  2KD0 A;  1E5W A;  1I42 A;  2Y5B B;  4II3 B;  4LJO B;  4CYE A;  3DBL I;  1TTN A;  4FLH A;  5G55 A;  3UQB A;  3U8Z A;  4LJP B;  3PVL A;  2IO0 B;  4IM0 A;  2L05 A;  4EZL A;  3L0W B;  5JH5 C;  2KTF A;  4IUM B;  1KLV A;  4K7W A;  3JSV B;  4B95 A;  3APD A;  4MSM B;  3UIO B;  3L16 A;  3B0A A;  2O2V B;  3H7S A;  4DHZ B;  1V5T A;  4W9K A;  4MH0 E;  3VTW A;  5CHV C;  2LWP A;  4X57 B;  2J0M A;  4A20 A;  2M8S A;  4BBN F;  3AI5 A;  4BFR A;  1KM7 A;  2NBW B;  2DHZ A;  1U4A A;  3Q3J A;  2KFJ A;  3JVZ X;  2KHW B;  3ZVV A;  3ENE A;  4BBN C;  5L83 A;  2K8H A;  4ZRK A;  4HPL B;  3WAN A;  2BYF A;  2NBV B;  2EKE C;  3AXC A;  4FN2 A;  4WWP A;  4JIO U;  4MGI E;  4MEM A;  3OLM D;  1P0R A;  2C7M B;  4P7I A;  1Z5S B;  2FNJ B;  2RR9 A;  1YX5 B;  4FBJ B;  1WX9 A;  1NI2 A;  1WGR A;  2FUH B;  3PLU A;  3VH3 B;  2FCS A;  3DVN V;  3MJW A;  4PS3 A;  4ANU A;  4RM9 A;  3N30 A;  2M4N A;  3K9O B;  1IYF A;  4IWP A;  2AYO B;  5D6J B;  3N3K B;  3PRE A;  1WY8 A;  2K8C A;  1NDD A;  4URK A;  1XT9 B;  2N9X A;  2G45 B;  1VCB A;  4ZRI A;  5HKH A;  3X23 A;  3WAP A;  2JZ3 B;  1IPG A;  2V3S A;  3VXW A;  1KJT A;  2ZNV B;  1WXM A;  1WE7 A;  2N4F A;  4MM3 A;  2DYO A;  2LGX A;  3VH4 B;  4HXD A;  3M95 A;  2O6V B;  2XK5 B;  3CSF A;  3WAM A;  4GXB A;  4NAW B;  1EF1 A;  3PHW B;  3ZRF A;  3MTN B;  5DCN A;  4ANV A;  2C7H A;  1NBF C;  2UWQ A;  4ASW C;  1XQQ A;  2FAZ A;  2Z0D B;  3ZNI D;  2ZPY A;  3A1Q B;  3DPD A;  2MA9 B;  3GOE A;  1MG8 A;  3QAQ A;  1J19 A;  1RRB A;  3DBR I;  3PV1 A;  2C7N B;  2N1W A;  2KZR A;  2FIF A;  1WE6 A;  3EHV A;  2DZJ A;  1WXV A;  3KH0 A;  1E8X A;  4TQ0 A;  4F1S A;  1LFD A;  4I6P A;  2HJ8 A;  2AWT A;  3DBH I;  5AZF A;  1X1M A;  2WX1 A;  4M8M A;  4GDL B;  4BKG A;  3MHS D;  5L95 C;  4BOS C;  2LRW A;  2R2Q A;  1ZW7 A;  2DZK A;  1V9J A;  2Z0E B;  2KQ7 A;  3ML8 A;  2RD0 A;  3V6C B;  2XK5 A;  1YJ1 A;  3SU8 X;  4NAW A;  5EDS A;  1H8C A;  3L54 A;  2K39 A;  2IY1 B;  2L0F A;  2OJR A;  3L10 B;  2PEA A;  4RM8 A;  2KMC A;  3NHE B;  2A4Z A;  2KFK B;  3PZD A;  1Y8R C;  4BVU C;  3IFW B;  3EEC A;  1D3Z A;  2KMA A;  3A1Q A;  2KTR B;  4WWO A;  4K7U A;  1WI0 A;  4GMV A;  5D94 A;  2MCN B;  4FAD A;  4EZK A;  4HVB A;  1UBI A;  3R66 C;  3RCZ A;  1R4N I;  2L76 A;  3X0W A;  2IO3 B;  1RAX A;  3CMM B;  4HWI B;  1P9D U;  3VTU A;  4BKS D;  5AZH A;  2KOX A;  3KW5 B;  2BKR B;  2I1K A;  2KJH B;  3AU5 A;  4GDL A;  1SGH A;  1WH3 A;  2D2Q A;  3A4R A;  4NJ6 A;  5CHF A;  1G6J A;  3H6N A;  2PJH A;  3L17 A;  1H4R A;  1E90 A;  5J2R A;  4HDQ A;  4TQ1 A;  2HE7 A;  4PS8 A;  2J0K A;  3UQA A;  2REX A;  1J8C A;  2DZI A;  3W1Y A;  1L7Y A;  3AU4 A;  3QA8 A;  1E7V A;  3S2A A;  4G11 A;  1GJZ A;  4AJW A;  5IAA C;  2KO3 A;  3TL5 A;  2LI5 A;  3LDZ E;  1WYW B;  3A9J A;  2KTR A;  3Q3F A;  1GNU A;  4HDO A;  3NZS A;  3EC8 A;  1HE8 A;  2MQJ A;  2DYB A;  4EOY A;  1J0G A;  2MLB A;  2O6V D;  4II2 B;  1OEY J;  3ZNZ B;  2ZNV C;  4F8C B;  2J0J A;  4AOF A;  3PS6 A;  2HTH A;  2J7Q B;  1F9J A;  4M8N A;  2IYD B;  2A5U A;  3VFK A;  1EO6 A;  1C3T A;  1L2N A;  3NOB A;  4GU2 A;  5E6O A;  2LGD A;  3TBL D;  3DVN U;  4DBG A;  5LXH A;  2DAJ A;  2IO1 B;  2KX3 A;  3N32 A;  1GG3 A;  1LQB A;  3ML9 A;  3U30 A;  3VQI A;  2KK8 A;  3NZU A;  5JZE B;  3KVF B;  3APC A;  3U7D A;  3ZUN A;  3KUC B;  2RSU A;  3SHQ A;  4AJY B;  4BKT A;  3QQ8 B;  1T0Y A;  3IBE A;  2ZVN A;  4CO7 A;  3ZTD A;  2L00 B;  4EFO A;  3KYD D;  2NS5 A;  4OVU A;  3NY5 A;  3H9D A;  4NY0 A;  1SIF A;  3WAL A;  4IM2 A;  2K6D B;  3WIM A;  3VVW B;  3DDC B;  3ZNG C;  4ZRJ A;  4XZ4 A;  2BPS A;  1S1Q B;  1YX6 B;  3QAR A;  2R2O A;  3PT2 B;  4DHJ D;  3O65 B;  1A5R A;  4KIK B;  4TKN A;  1YIW A;  3W1S A;  1YD8 U;  4A3P A;  3OJ4 B;  2LVO A;  2KDB A;  1K8R B;  1Q5W B;  2D11 A;  4GB9 A;  4G50 A;  3ZO5 B;  3K9P B;  1YQB A;  4MDK E;  1WJ4 A;  2L7R A;  2XBB C;  3HM6 X;  4K7S A;  2C5L C;  3VUW A;  3ZIM A;  5KHQ A;  2C60 A;  2GOW A;  1S3S G;  5D2M B;  2KWC A;  2G4D B;  2LJ5 A;  2D07 B;  3DVG Y;  1WX7 A;  3QWZ B;  3T9L A;  3UIN B;  2MBQ A;  3UIP B;  5J18 A;  1WIA A;  4XC2 A;  4FUL A;  1RFA A;  4JLC A;  2BGF A;  4W9I A;  1KOT A;  2MBB B;  3M3J A;  4N9F 4;  3HHM A;  3RUL A;  3VUY A;  2VRR B;  3DOW A;  4E71 A;  1GC6 A;  2ZCC A;  2CHZ A;  4KIK A;  1TZ1 A;  2FCM A;  4NQL B;  2KXJ A;  2LD9 A;  2NR2 A;  3CF6 E;  1Q0W B;  2LAS A;  2MP2 A;  4HK2 A;  4HLE A;  2LZ6 A;  2QHO A;  3RUI B;  1RLF A;  3RT3 B;  2DX5 B;  3PRM B;  1C1Y B;  1WMH B;  3PGE A;  4MGK E;  3DBS A;  4XX5 A;  4FJY A;  5FR6 A;  1VD2 A;  3PLV A;  3R7R A;  5CTR C;  4TUU A;  4ANW A;  3C0R B;  2JF5 A;  2CHW A;  3KUD B;  3SDL C;  2KKC A;  2KLC A;  2N7E A;  4WAA A;  4WWN A;  3ZNH B;  4HCN B;  2DEN B;  3ZDM C;  2HD5 B;  1WF9 A;  1EUV B;  3A9J B;  4KDI C;  2MSE D;  3ECI A;  4IWQ A;  2M17 A;  2DYM A;  3QCA A;  3PSE B;  1AAR A;  4G0N B;  1WJN A;  1UBQ A;  3H1U A;  1E8Y A;  1TGZ B;  2BKF A;  2RPQ A;  3H7P B;  2NBU A;  4E74 A;  2YVC A;  1WRD B;  2CKH B;  4W9H A;  1WM3 A;  3ZTC A;  3APF A;  2N1V A;  2B3A A;  2K1F A;  2MBH A;  2PE6 B;  3IHP C;  4LCD E;  3VHT C;  4FJZ A;  5IA7 A;  2CHX A;  4MGZ E;  1WMH A;  4JQW C;  2JRI B;  4F7Z A;  4KZ0 A;  1SE9 A;  2KWV B;  3V6E B;  3QX1 A;  4KSK C;  2IY0 B;  2WWZ A;  2D10 A;  1BT0 A;  1P98 A;  2IBI B;  5AEK B;  1WGD A;  1E7U A;  1P3Q U;  4W9C A;  3UF8 A;  4ICV A;  3RD2 A;  1ZGU B;  3VDZ A;  3JW0 X;  3ZRC A;  4DK5 A;  1EF5 A;  2PE9 A;  4WJO A;  2GBJ A;  1GUA B;  3PRZ A;  4IC7 B;  2M1M A;  4ZDV A;  4A3O A;  4GOC A;  2LUE A;  3PPA A;  3M63 B;  4W9L A;  3WAO A;  3CST A;  1M94 A;  4M0W B;  2ZEQ A;  2JY6 A;  4EEW A;  5J17 A;  3H7P A;  3HM3 A;  2KDI A;  4ICU A;  3QHT A;  4HJK A;  4KVG B;  1V80 A;  2FCQ A;  2GBR A;  1ZKH A;  2G4S A;  2WYQ A;  1XD3 B;  4B9K A;  4WJP A;  1V86 A;  2MW5 A;  2JPH A;  2W9N A;  1LM8 B;  2KDF B;  3TMP B;  3A33 B;  4MJS B;  3L08 A;  5DPR A;  2ZVO A;  1WR1 A;  2DZM A;  1E8W A;  4NPN A;  2KC2 A;  4RMA A;  4FA6 A;  2Z59 B;  2AEH A;  4W9D A;  3GZN I;  5DPW A;  2JVC A;  4W9J A;  4FHJ A;  5JHB A;  2KVR A;  3A9K A;  4AWJ A;  2NPT A;  5TR5 A;  3T8M A;  4DDG D;  2GBM A;  1WXA A;  1JRU A;  2M0X A;  4K81 A;  2BYE A;  2KWU B;  2NCN A;  1WGG A;  2LXC A;  4HCP B;  4NNJ B;  3V61 A;  4W9G A;  3ZKJ C;  5LXI B;  4AUQ C;  2DAF A;  2KAN A;  2KNB A;  5GMV A;  1UGM A;  2XEW A;  2KLG A;  1WGH A;  2BWF A;  1ISN A;  2L8J A;  4DWF A;  4NQK E;  1V6E A;  2LGY A;  4W9E A;  2JRH A;  4J6I A;  2UYZ B;  4DHZ E;  3PHX B;  2KJR A;  4IWO A;  2K8B A;  2MP2 B;  3D32 A;  1V81 A;  2GMI C;  2L3Z A;  1WFY A;  2FID A;  4HPM B;  4MJS A;  1R4M I;  3RZW C;  3R3M A;  2IZV B;  1PQS A;  2CR5 A;  1GC7 A;  2JZZ A;  4GN1 A;  4I6N B;  4CHK A;  4E3C A;  4DDI D;  4EKU A;  3ZLZ A;  1LXD A;  3KYC D;  2BF8 B;  1V49 A;  3OJ3 A;  2ZJD A;  4KZC A;  2N9P C;  3ONS A;  1WJU A;  3BY4 B;  3P2B A;  2K6Q A;  1OEY A;  3HK0 A;  4TV3 A;  3JSV A;  4WJN A;  4DXA B;  2LXA A;  3A4S C;  4LDT B;  3M62 B;  4AP4 C;  4MEL A;  2O2V A;  3RYT A;  2BYV E;  2EMT A;  4B6W A;  2IO2 B;  4KDL B;  1WM2 A;  3ZW3 A;  5DPS A;  3ZDT A;  3QK0 A;  3PRP B;  1OTR B;  3L13 A;  2PPH A;  4ZYN A;  2KDE B;  5CX3 A;  1OQY A;  4PYZ A;  3V62 A;  2GBN A;  2ZZP B;  2LVP A;  4BKS A;  2ZPN A;  2GBK A;  5D7G A;  1WR6 E;  2MBO A;  1FXT B;  5KHO A;  4GGQ A;  5E6P A;  3IG3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...