2ZEQA

Crystal structure of ubiquitin-like domain of murine parkin
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
78
structure length
78
Chain Sequence
MGMIVFVRFNSSYGFPVEVDSDTSILQLKEVVAKRQGVPADQLRVIFAGKELPNHLTVQNCDLEQQSIVHIVQRPRRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords E3 ubiquitin-protein ligase parkin
publication title Crystal structure and molecular dynamics simulation of ubiquitin-like domain of murine parkin
pubmed doi rcsb
source organism Mus musculus
total genus 17
structure length 78
sequence length 78
ec nomenclature ec 2.3.2.31: RBR-type E3 ubiquitin transferase.
pdb deposition date 2007-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2zeqA00
1WX7A 2DX5B 3WIMA 5DPTA 2V1YA 3H7SA 4HVBA 1GG3A 2QHOA 3ZUNA 1GJZA 1I35A 2ZPYA 1L2NA 2ZJDA 2MBBB 1J8CA 4HK2A 3AU5A 2KLGA 1WXVA 4HCNB 4A3OA 2MBEA 3DVNU 4BOZB 3ZKJC 1YQBA 1H4RA 3A1QA 3O65B 4B9KA 2ZVOA 2KTRB 3IHPC 3DVNV 5DPWA 4MH0E 4EFOA 3A9KB 2FAZA 3X23A 3ENEA 2FIFA 2LXCA 5DPRA 2MLBA 3TBLD 4NJ6A 1AARA 2KLCA 3IFWB 1RFAA 2J7QB 2CU1A 2O2VA 2KOXA 2RD0A 1K8RB 3H1UA 1L7YA 2DZIA 3TMPB 1KJTA 4KV2A 3L13A 2C5LC 4BOSC 1XQQA 2KDIA 2BYFA 1M94A 1WRDB 3PHXB 5GMVA 4FHJA 4CO7A 4BKGA 3BY4B 5DCNA 3MHSD 1EUVB 3N32A 4DHJD 3SDLC 5L83A 1A5RA 4PS7A 3ZNZB 2KD0A 3HIZA 4E71A 1EF1A 3WA0A 2AL6A 2KDFB 1NDDA 1P98A 3UIPB 2GBMA 2CHWA 2JT4B 2XK5A 3EHVA 2DYOA 3NOBA 1UBQA 4JLCA 1LFDA 1YIWA 5AZGA 4II3B 5J18A 1E7VA 1YX5B 1GC6A 1JRUA 3VUYA 3PV1A 3QARA 3APFA 1V81A 4HPMB 1P3QU 3ONSA 3KUZA 2KWVB 4HXDA 2KC1A 2KJ6A 3KH0A 3GOEA 3PVLA 4FJZA 4XZ4A 3IG3A 2FCNA 2AEHA 2M17A 5C23A 1SE9A 2K6DB 4TV3A 2GBRA 4MGZE 2BYVE 3QC8B 2NBWB 2LI5A 3RYTA 3V6CB 2IO1B 2WX1A 2MA9B 3LJ3A 2FUHB 2YVCA 3H7PB 1CMXB 4P7IA 3QIJA 3H7PA 2KMCA 2LWPA 3CSTA 2NBUA 4AUQC 2ZNVC 3CMMB 2I1JA 2K8CA 3U8ZA 3GZNI 1VD2A 3L16A 3UQBA 4W9FA 1NBFC 4I6PA 4IG7B 1V49A 3VDZA 5G55A 4URKA 1E8ZA 1H8CA 2KN5A 3QHTA 2JZZA 2DHZA 3SU8X 2CHXA 2A4ZA 3PRPB 1Q5WB 4DK5A 2ZCBA 3R3MA 4GN1A 2CR5A 3M62B 2HE7A 1TZ1A 2CS4A 3IVFA 3R7QA 2VRRB 1WMHA 4MJSA 1Z2MA 2JF5A 1TGZB 2EMSA 1WJ4A 2YLMA 1UGMA 1RRBA 4ICVA 4EEWA 4FJVB 3VUXA 5G2NA 2K39A 1LM8B 2L0TA 3DPDA 3HM3A 2LRUA 3VTWA 3RZFA 2N7DA 2MSED 4E3CA 1MG8A 5D94A 2UWQA 2RR9A 1WXAA 3DBRI 1VCBA 1WX9A 4KIKB 1Y8RC 5J2RA 4W9JA 4MGKE 3S2AA 5D7GA 3RZWC 4EZLA 3PGEA 3KUCB 4PYZA 5JHAA 1WJ6A 1S3SG 4JGHB 2K8HA 3HHMA 3V61A 3WANA 4I6NB 4PS3A 4LJOB 1C3TA 2J0JA 2G45B 2MBQA 3JSVB 2PJHA 3SHQA 4F1SA 3OLMD 3JSVA 3I3TB 1WGGA 2NVUI 3PREA 2V3SA 1D3ZA 2LGDA 4WJQA 2Z0EB 2N7EA 4NJ7A 3UGBB 2PEAA 1V86A 2D2QA 2MCNB 4FN2A 4FULA 4IM3A 4KZCA 5TR5A 3V60A 2M4NA 2Z0DB 2D11A 4WAAA 4RM9A 3RT3B 2JVCA 3QK0A 3QCAA 2N9PC 1ISNA 1TTNA 4IUMB 4JL9A 4N9F4 4K7SA 4NAWB 3PHWB 4W9KA 5LLIA 4A3PA 4EZJA 2KK8A 2GMIC 4HPLB 2G4DB 3X0WA 4DHJB 3PRMB 2KJHB 2A5UA 2LVQA 4DDGD 2BKRB 3ML8A 3EC8A 5LXHA 3N3KB 2NCNA 3VHTC 2IO2B 2KTRA 4X57B 1V5OA 2DZKA 2GBKA 4YL8A 3DVGY 3ZNHB 4ASWC 4BKTA 1G6JA 2AL3A 3WALA 4GDKB 3A9KA 3AI5A 4PS8A 1IPGA 1OEYA 3HK0A 4GDKA 4M0WB 4KVGB 1SGHA 1WI0A 1R4NI 2NS5A 3VTUA 2DAJA 2KHWB 2G3QB 2JWZA 2LZ6A 2LASA 3EECA 4IM0A 2MQJA 2I1KA 4MGIE 1P0RA 2L7RA 4FADA 1UD7A 4IWPA 3P2BA 1IP9A 1WGRA 4HWIB 1WY8A 5AEKB 5L95C 2KWCA 1TBEA 4OVUA 2ASQA 3PLUA 2KTFA 1V5TA 2C60A 2LD9A 5CTRC 4GB9A 2D10A 1PQSA 4IWOA 1EF5A 2LJ5A 4FJYA 4GU2A 2BGFA 4XC2A 2D07B 3JYUA 4GDLB 1V9JA 2BWFA 1WM2A 3CSFA 4M8NA 3ZO5B 1KOTA 1V2YA 3HM6X 3U7DA 2HTHA 1WF9A 2KFKB 2O6VD 2WDTB 3QJZA 3RUIB 1P9DU 2Z59B 2KFKA 3L54A 3AU4A 1XT9B 2DZJA 3UIOB 5AZFA 1WZ0A 4NPNA 2D3GA 3TJPA 3VQIA 1EO6A 3DVGX 2NBVB 3NZSA 2DYMA 1WR6E 2BWES 2LVOA 3LDZE 1XD3B 5AZHA 2IO0B 3N30A 3PRZA 3DBLI 5LXIB 3QWZB 4GXBA 1GC7A 2EKEC 2BYEA 2N9XA 2MBOA 2KX0A 3A4SC 4CHKA 2N1VA 4AJWA 1WXSA 3A9JB 2RPQA 3B08A 4ZDVA 3EFUA 4RM8A 2LGYA 4WJPA 3ZDMC 3A9JA 2ZEQA 4DWFA 2JZ3B 2KQSA 1Q0WB 1J0GA 4B95A 4ANXA 1F9JA 4FHKA 3ZIMA 1WM3A 3U30A 4G50A 4F7ZA 3V6EB 5JZEB 3K9OB 4WWNA 3W1SC 2FCSA 3QX1A 1E5WA 2N9EB 2OOBB 4MSMB 2JRIB 2K25A 2WX0A 5J17A 2KFJA 3QQ8B 2JPHA 3DBHI 3W1YA 4B6WA 2IY1B 4EKUA 3UF8A 3Q3JA 3QA8A 2XBBC 5HKHA 1T0YA 3A33B 4BKSD 4KIKA 4AP4C 2L8JA 4EZKA 2HD5B 2WWZA 3CF6E 4W9DA 2MP2B 1IYFA 1OQYA 4PYUA 2RGFA 3B1LX 3AULA 2KDBA 1Q1OA 2PE6B 3L08A 2REXA 2CKHB 2MRPA 1OTRB 2FNJB 2W9NA 3MTNB 2N4FA 2ZNVB 4KDIC 2KJRA 2M1MA 3M63B 3NS8A 4II2B 1WGDA 3DDCB 2KKCA 1WFYA 1R4MI 2MWSB 3WAOA 5BO4B 5E6PA 2NPTB 4XX5A 4DHZE 3RCZA 2K1FA 1WJNA 2NPTA 3B0AA 4IC7B 4LDTD 3RD2A 1SIFA 2JXXA 3WAMA 2KNBA 5KHQA 3ML9A 4G3XB 3APCA 1RAXA 3T8MA 4EUTA 1J19A 5EDSA 2LGXA 1V6EA 4M8MA 4NAWA 4CYEA 2J0KA 4EOYA 3NZUA 2C7MB 2OJRA 1OEYJ 3JVZX 1WIAA 4HLEA 3KYDD 2DYBA 2GBJA 2KWUB 4KSLC 4DXAB 3R7RA 2L05A 4W9HA 1UELA 3VH3B 2FIDA 4OVVA 1YX6B 4NNJB 1U4AA 4DHZB 4ZRIA 2MW5A 3BINA 3A4RA 2IO3B 4KZ0A 4W9LA 1UH6A 2FCQA 4KSKC 2XEWA 3MJWA 1FXTB 2BKFA 2IY0B 1GUAB 4IW0A 4ANVA 3VFKA 3PT2B 2NR2A 1HE8A 4GSWA 4I6LB 4K1RB 2KDEB 2O6VB 3KUDB 4E74A 4MELA 3A1QB 3L10B 4AWJA 4FLHA 2O6VA 4FA6A 3ECIA 2KANA 1WH3A 3DQVA 4GIVA 3WAPA 5FR6A 3ZNID 3UQAA 4ZRJA 1LXDA 2DZMA 1WE7A 4A20A 3IBEA 4HJKA 2O2VB 1RLFA 1WZ3A 4BVUC 4HDQA 4WQOB 1I42A 1UBIA 1UZXB 5CHFA 2FCMA 3ZRCA 3C0RB 3TCAA 2IBIB 4IM2A 1LQBA 3VTVA 3PLVA 1YD8U 4TUUA 3RULA 4ANUA 2JRHA 3T9LA 4IWQA 5CHVC 1GNUA 4GDLA 4W9CA 4NQLB 4DDID 4NY0A 3VXWA 2RSUA 2MX2A 3NY5A 4WJNA 1WR1A 2R2OA 1WYWB 4GGQA 1QZEA 2XK5B 1P1AA 3DOWA 4MM3A 4RMAA 1KM7A 3PPAA 1ZGUB 5CX3A 3JW0X 1E8XA 5E6OA 3VAWA 2KXJA 3D32A 3OJ4B 3L17A 4MSQB 4LCDE 2R2QA 4JQWC 2LRWA 3ZDTA 3H6NA 2KC2A 4LJPB 1S1QB 3M95A 2EMTA 4MDKE 5D2MB 3TIXA 4ANWA 2UYZB 4W9GA 4GOCA 3K9PB 2BPSA 5DPSA 2L00B 4BBNF 5JHBA 4BKSA 4KDLB 4BBNC 2KMAA 3R66C 3VUWA 2ZZPB 4ICUA 2C7NB 1WGHA 2K8BA 3DBSA 3UINB 4W9EA 5D6JB 1E8YA 5IAAC 2B3AA 2M8SA 4TQ0A 2JY6A 2KZRA 4K81A 1V80A 2K6QA 4HDOA 4WWPA 2KO3A 2L3ZA 3TL5A 2MBHA 5KHOA 2WYQA 2HJ8A 4GMVA 2KVRA 3ZTCA 4NQKE 2PE9A 3KVFB 3NHEB 3H9DA 1E8WA 3Q3FA 3PZDA 4AJYB 1OGWA 5CHWA 2AYOB 2PPHA 3L0WB 4LDTB 2DAFA 2GOWA 2CHZA 2JUOA 2N1WA 4F8CB 5E6NA 4K7WA 1WMHB 4WJOA 2LVPA 4MJSB 4JIOU 3ZLZA 2ZCCA 3ZNGC 2V4LA 3KYCD 1WX8A 2M0XA 3ZRFA 1WXMA 4K7UA 3ZVVA 2KX3A 2BF8B 3ZW3A 2DENB 2MP2A 1NI2A 1YJ1A 4G11A 3APDA 4MEMA 3VH4B 4TKNA 2LXAA 4AOFA 3V62A 1E90A 3PTFC 3KW5B 1E7UA 2G4SA 2C7HA 3PSEB 1BT0A 1ZW7A 3DCGA 5IA7A 4FBJB 3ALBA 3PS6A 1C1YB 2IYDB 2LUEA 3QAQA 4HCPB 4MGYE 2GBNA 4G0NB 4ZRKA 1Z5SB 2Y5BB 2IZVB 3AXCA 1ZKHA 3OAWA 2ZPNA 4DBGA 4WWOA 2J0MA 3VVWB 3M3JA 3SD5A 2AWTA 5JH5C 1WE6A 3W1SA 2L0FA 2C9WB 1WJUA 5C1ZA 4ZYNA 4TQ1A 3ZTDA 4J6IA 1WGYA 2ZVNA 1X1MA 1KLVA 3OJ3A 2L76A 4BFRA 4W9IA 2KQ7A
chains in the Genus database with same CATH superfamily
5BMGA 1WX7A 2DX5B 3WIMA 3IT6B 2QHOA 3VR9B 2ZJDA 4C80A 2CJNA 2KLGA 2INDC 2J4XA 4HCNB 3B2GA 4LLGM 4MT5A 1H4RA 3A1QA 3O65B 1T0RC 3ZGZA 2FIFA 2J52A 1ZUD2 1FXAA 3T3OA 4OZAA 4RGTA 2DZIA 1KJTA 1NENB 2VZKD 2RMMA 4BOSC 1R4MB 1IBXB 1TKGA 2N9LA 5GMVA 3BY4B 5DCNA 1EUVB 5EE0A 2D3CA 3SDLC 1A5RA 4ZYSA 1ZE3D 3R2IA 2JT4B 2DYOA 1UBQA 1YIWA 4II3B 5J18A 3VUYA 1UGJA 3N1ZC 4HPMB 1Y56A 1P3QU 2LHEA 1C9FA 3ETRA 2Y3AA 1OQRA 2KWVB 3GOEA 3P42A 1SE9A 1V1OA 4TV3A 2BYVE 3QC8B 4KGRA 3LJ3A 3RMKC 1YNTE 4P7IA 5BYRA 4YSXB 2KMCA 2LWPA 2NBUA 2W54A 2KT7A 2I1JA 3GZNI 4C7YA 4W9FA 2WXNA 4URKA 1V49A 2RDHA 1H8CA 1E8ZA 2KWDA 2JZZA 2DHZA 2K0PA 1TS4A 2ZCBA 3R3MA 2CR5A 3U2SC 4NZLB 2BYTA 5D3IB 1WMHA 1JWAD 2JF5A 2EMSA 1WJ4A 1UGMA 1AW7A 2V4IB 3C19A 2QMTA 5G2NA 1PFDA 2LRUA 2UWQA 4KGTA 5J2RA 3TUOA 1TYGB 4EZLA 3PGEA 5JHAA 3HHMA 4HRSA 1K50A 2PJHA 1YQ3B 3TEYA 2WDVB 1WGGA 2D5GA 5BYQA 2V3SA 1ESFA 3AEGB 3UGBB 2PEAA 1V86A 2MCNB 4KZCA 2VZKB 2Z0DB 3AV8A 4WAAA 3QCAA 4IUMB 4JL9A 4K7SA 3AE5B 1I4HA 2KK8A 4H2AA 2G4DB 2VH1A 2KAJA 2KJHB 4DDGD 3ML8A 1KLGD 3N3KB 4X57B 1C76A 2GBKA 3DVGY 4GDKB 3AMZA 1IPGA 1OEYA 1SGHA 2AQ3B 1EU3A 3VTUA 2JWZA 2LASA 4IM0A 2ONQA 1P0RA 2L7RA 1UD7A 1WY8A 4RNAA 4OVUA 1I4QA 2KTFA 1V5TA 1V1PA 1QILA 2D10A 3IAM1 4GU2A 1E9MA 1WM2A 3C8YA 3CSFA 3U7DA 3R8BA 2O6VD 1P9DU 3L54A 3BYTB 1XT9B 4IDIA 1GB1A 5AZFA 1XF5L 2D3GA 3N1XC 3Q8BA 2NBVB 1OQQA 4JX1C 1ET6A 2WNMA 4RH6A 1MFWA 1AYFA 3RNBC 2N9XA 4CHKA 2JU6X 1WXSA 3EFUA 2ZEQA 1JRPA 1FPYA 1WM3A 4F7ZA 3H8HA 2FCSA 2L32A 3PO0A 1E5WA 3ZXRA 1ZXHA 1I7HA 5J17A 2JPHA 3DBHI 4EKUA 3TEZA 1YQ4B 1T0YA 3E56A 3GS2A 1STEA 3AE6B 2L8JA 3I63C 3CF6E 2WWZA 1IYFA 4ZRPA 1OQYA 2RGFA 3AE2B 2E3TA 2MRPA 3MTNB 1L0XB 4RGOS 1R4MI 1E6EB 5E6PA 4HKZE 2GLSA 4DHZE 2K1FA 1FO4A 2NPTA 4IC7B 1NVID 2JXXA 1JMLA 3WAMA 3ML9A 2JXTA 3APCA 1RAXA 2K3UA 1J19A 1E10A 3I5JC 4M8MA 4CYEA 2C7MB 3JVZX 1WIAA 3Q8CA 4KSLC 3VH3B 1YX6B 2N0SB 4NNJB 3BVGA 4N59A 2MW5A 1YN4A 3A4RA 3BINA 3UI3A 4YSZB 2D3AA 3OWEB 5H92C 1FXTB 4US8A 4YXDB 4M0WA 2NR2A 2O6VB 3MC8A 3L10B 4FLHA 1MJDA 4GIVA 1YJJA 3ZNID 1LO5D 2DZMA 1WE7A 2INCC 2D3BA 3IBEA 2B76B 4HROA 1I42A 5CHFA 2FCMA 2AX5A 1YD8U 3RULA 4ANUA 4IWQA 4W9CA 4GLSC 4NQLB 1ZDVA 3MP9A 1I4PA 3AE9B 2BB5A 2MX2A 1SSNA 3NY5A 1WR1A 2R2OA 4JE3B 4CQNA 4GGQA 3DOWA 4ZHOA 1ZGUB 5LNK1 3L17A 4JQWC 2KC2A 4MDKE 1EM7A 2BQQA 4W9GA 4GOCA 1DOXA 3RNAC 2C7NB 3UINB 2ACZB 4W9EA 1SIJA 3DHHC 2G1EA 1C4AA 5IAAC 2WQYB 1L4ZB 5FKAC 4K81A 4D2KA 4HDOA 2K6QA 3FAHA 3TL5A 2WYQA 2KVRA 1TT5B 3Q14C 2FUG1 1CQVA 4NQKE 3H9DA 1N62A 4AJYB 1FFUA 2AYOB 2DAFA 1FXIA 2JUOA 2CHZA 2L83A 2M19A 2LVPA 4JIOU 4L2YA 2V4LA 3PZ7A 2M0XA 4LNKA 3ZRFA 4K7UA 4N6EB 3IT4B 2WXPA 2LXAA 1E90A 1RYJA 2G4SA 1SXTA 4O1NA 3DCGA 3TEWA 4XDDA 3ALBA 3BVZA 1TS3A 1C78A 4MGYE 1NYRA 4G0NB 2IZVB 2WXOA 3DBLB 3M3JA 1VZ7A 1J7BA 2HTME 3W1SA 2L0FA 1XLPA 1MG4A 2V9HA 4J6IA 1F2RC 1F52A 3ZJUA 3ZUNA 2MBBB 2JQRB 3RNCC 1QOFA 2J42A 3AU5A 5AUIA 4BOZB 3ZKJC 2ZVOA 2KTRB 3IHPC 2BS2B 3MC9A 2K5PA 2FAZA 3ENEA 3TBLD 3BIID 3IFWB 5D3DA 2CU1A 3HVDA 3N20C 4MACA 1K8RB 3TMPB 3KWVA 5BMHA 2G9HD 2GB1A 2KDIA 3Q2AC 4CO7A 4BKGA 2YEPB 3N32A 3P63A 4RCOA 1T3QA 1WGKA 4PS7A 3ZNZB 2WXQA 1EF1A 2KDFB 1P98A 2GBMA 2XK5A 4IKGA 5HI1A 5AZGA 1YX5B 1GC6A 1JRUA 3PV1A 3APFA 1V81A 2EKIA 1VLBA 2PLPA 2KC1A 4FJZA 2ZW1A 2K6DB 1KLUD 1CK1A 4QAYA 4EE2A 3RYTA 1E0ZA 2WX1A 2KN4A 3ZJVA 3H7PB 2LGSA 2PIAA 5C3JB 3QIJA 1MHXA 1FFVA 4AUQC 2ZNVC 2K8CA 3IAS1 3UQBA 4PK1A 1VZ8A 4P16A 3AE8B 5G55A 4DK5A 1HEZE 1VZ6A 1TZ1A 2CS4A 1SJED 1YJIA 1TGZB 2YLMA 2JX5A 4KGSA 1RRBA 4EEWA 1C79A 2L0TA 3HM3A 2WGSA 2MSED 1MG8A 5D94A 2RR9A 1WXAA 2LMCA 1VCBA 1T6BX 1Y8RC 3AB5A 3S2AA 3KUCB 4PYZA 5AUKA 1S3SG 2ICIA 2K8HA 4I6NB 1QKZA 4LJOB 4TMAB 4ZOHC 2G45B 2MBQA 4XDCA 3OLMD 1B1ZA 4C7ZA 1QLBB 2NVUI 1D3ZA 4WJQA 4NJ7A 1JALA 1FRRA 2D2QA 3B2FA 2M4NA 4M01A 1XLQA 3RT3B 3NVZA 5IO9A 3Q69A 1ISNA 1TTNA 4W9KA 4EZJA 3PHWB 4HPLB 1RFKA 1R7SA 5IOIA 1TY0A 2NCNA 2WU5B 3AE1B 2DZKA 4BKTA 2AL3A 3WALA 3A9KA 3AI5A 4PS8A 1FCCC 4OZCA 4GDKA 1N60A 2NS5A 2DAJA 4JPSA 1QOBA 2LZ6A 3EECA 4MGIE 1A70A 3AEBB 4WQMA 1IP9A 1EU4A 5AEKB 5HG2A 2ASQA 5BYSA 1PGAA 1GB4A 2N7JA 4XC2A 4ZRQA 4K3BA 2PKOA 3ZO5B 3FILB 1KOTA 1V2YA 3HM6X 1FNUA 1GOZA 4HPPA 2WDTB 2Z59B 4MM3B 4BAXA 1WXQA 4NPNA 3HRDD 1FMAD 3DVGX 2OJWA 1WR6E 2BWES 3LDZE 1K51A 3VRAB 1XD3B 5AZHA 5BMIA 3Q3NC 2IO0B 2FE8A 2Z8LA 3N30A 3PRZA 3DBLI 2SEBD 4A8XC 1GC7A 3NJTA 5EE9A 2IGGA 3A9JB 2RPQA 3B08A 2K9XA 4R3DA 4WJPA 2K22A 2LGYA 3ZDMC 2QIEB 1DGJA 2JZ3B 4ANXA 4G50A 5JZEB 3K9OB 3W1SC 2WHIA 3QX1A 3ZYYX 2OOBB 4MSMB 1BXTA 4C56C 2WX0A 4WURA 3QQ8B 3W1YA 1SE2A 3TSSA 1P7FA 3UF8A 3Q3JA 4XWWA 3NVVA 5HKHA 4BKSD 4KIKA 4EZKA 2HD5B 2I38A 4W9DA 2MP2B 2WDRB 2KDBA 2REXA 2W9NA 2WS3B 4JWUC 3ZXVA 3GP7A 2M1MA 1XEEA 3DDCB 2KKCA 1WFYA 1UWXA 3B0AA 3RD2A 5KHQA 4G3XB 3T8MA 4EUTA 4HKQA 4ARCA 3N9YC 1V6EA 4PT5A 4NAWA 1MHHE 2DYBA 4US9A 2KWUB 4LTUA 2L05A 4W9HA 2ZW0A 1UELA 2FIDA 4L23A 4WWMA 4KSKC 4IW0A 2BKFA 1DOIA 4ANVA 3VFKA 4Q2JA 3A1QB 2O6VA 3DBRB 2KANA 3WAPA 5FR6A 1EWYC 3UQAA 4ZRJA 1XXGA 1T0SC 1PGXA 3AECB 4BVUC 4WQOB 1UBIA 3C0RB 3TCAA 3AEEB 2IBIB 4IM2A 1WWTA 3VTVA 3T9LA 1L5PA 4IOIE 5CHVC 4GDLA 3LXFA 4DDID 2KQ4X 2RSUA 4XE0A 3NVWA 1KM7A 3JW0X 1E8XA 3DHIC 3VAWA 3D32A 3OJ4B 4LNNA 2R2QA 3NVYA 3H6NA 4LJPB 3M95A 1L4DB 2EMTA 3OG5A 1D5XC 5D2MB 3TIXA 4ZHPA 2BPSA 1WYGA 2L00B 2DBYA 3IXSA 4BBNC 2ZZPB 3DBSA 1ET9A 5G5HA 2WLBA 1BUIC 3FC4A 1R4NB 4A90A 2M8SA 3RNFC 4TQ0A 4C4VA 1SE4A 1V80A 3P4PB 1QT9A 1K53A 2PPHA 2CJOA 4F8CB 3BZDB 2WXRA 2Q5WD 1WMHB 4WJOA 1F1HA 4NJCA 2KX3A 2X38A 2BF8B 2DENB 1YJ1A 4P1CC 2NMQA 3APDA 1WRIA 3BYYB 4MH8A 2J53A 1J7CA 4FXCA 5IA7A 3PS6A 3U52E 2GBNA 3AEFB 1Z5SB 2Y5BB 1ROEA 2ZPNA 4USAA 3VVWB 1TZOA 2MH7A 2AWTA 5JH5C 2LHDA 3SR6A 2C9WB 4TQ1A 3ZTDA 1WGYA 2ZVNA 2N9KA 2L76A 4BFRA 1VDVA 1GG3A 3AM9A 1I35A 3AEDB 2ZPYA 4XGAB 4HK2A 2QDFA 4A3OA 3DVNU 1P7EA 1D5MC 3VRBB 1YN5A 4M00A 3DVNV 5DPWA 2DWQA 2FBWB 2MHJA 4S0RA 2LXCA 5DPRA 1NYQA 4NJ6A 2KLCA 2O2VA 2LJIA 2R61A 2RD0A 4OHJA 3H1UA 1L7YA 1SBBB 3L13A 2IGHA 1XQQA 2BYFA 1M94A 1WRDB 2BVCA 3HVZA 2INPE 4FHJA 2WDQB 4DHJD 5L83A 3WA0A 1NDDA 3UIPB 2CHWA 1RWSA 4JLCA 1LFDA 1E7VA 1HZ6A 1OFFA 3ONSA 3KUZA 3Q6BA 1N5WA 4HXDA 3KH0A 3PVLA 4XZ4A 2FCNA 2GBRA 3V6CB 3NS1A 2SAKA 2MA9B 3BVMA 2FUHB 2YVCA 3I9V1 1FNVA 5H8YE 3H7PA 4DQOC 5EE3A 3RPFC 1KH0A 3U8ZA 1NBFC 4I6PA 2KN5A 2OHFA 4GN1A 2IPKD 3BWUD 3M62B 4ARIA 4MJSA 2BTEA 1KTKA 2QCZA 4FJVB 1B9RA 3VUXA 4REZA 4OW0A 3DPDA 3VTWA 2AQ1B 3RZFA 4E3CA 3DBRI 1WX9A 1PGBA 3RZWC 1XO3A 1WJ6A 2WXHA 4LK0M 1M4VA 3WANA 4XWTA 1ZP0B 3JSVB 4F1SA 3KLSX 4NAMA 1FM0D 2M56B 5E6JA 2LGDA 2Z0EB 2N7EA 2MJ3A 4FN2A 4FULA 2D11A 2JVCA 3QK0A 3Q8AA 2KDMA 4A3PA 3GZNB 2GMIC 3SFDB 3X0WA 4DHJB 2LVQA 3GB1A 2BKRB 5LXHA 1FIQA 2YEPF 2IO2B 2PVOD 3KWLA 3DWMA 1G6JA 1D6EC 4YTNB 1E7PB 1PUTA 3HK0A 4S17A 4M0WB 2V0GA 1R4NI 1JQ4A 1IGDA 3ABVB 2KHWB 2MQJA 1JW9D 2I1KA 1IBXA 4FADA 3P2BA 1WGRA 4YWGG 2KWCA 3MHZA 2C60A 4IWOA 1EF5A 2LJ5A 4HEA1 4FJYA 2DLBA 2D07B 3JYUA 4TSSA 1V9JA 2BWFA 4LNOA 2KFKB 3Q8FA 3RUIB 3O13A 3VR8B 2VH2A 2MJEA 2DZJA 1I4GA 3B9JA 4YTPB 1N63A 1EO6A 2LFIA 2KVZA 2BW2A 1FNWA 2EKEC 2BYEA 2KX0A 2N1VA 1MPEA 1HZ5A 2W3RA 4ZDVA 1T5XD 4RM8A 3A9JA 2HDEA 3EUB2 2KQSA 1AN8A 1J0GA 2QJLA 1SE3A 4WWNA 4J3OD 1MVKA 2JRIB 2IY1B 3QA8A 4B0MA 3A33B 4AP4C 2PVGC 2JZPA 3MC0B 2H88B 4PYUA 3B1LX 2PE6B 1OTRB 2FNJB 2DNFA 4RF0A 2N4FA 3W9CB 2OEDA 3M63B 2W3SA 1TS2A 1WGDA 4ITKA 3W2DA 3L4PA 2BT6A 3RCZA 1WJNA 2LGIA 4LDTD 1SIFA 3AH7A 2KNBA 1FCLA 4RF1A 1JWSD 3NZUA 1PDXA 1OEYJ 2INNE 3KYDD 4OVVA 1U4AA 2IO3B 1GUAB 1QOAA 1L6VA 2QEJC 1HE8A 3PT2B 4GSWA 2KDEB 2RDBC 3DBHB 3KUDB 3SEBA 4MELA 3P4RB 4A6QA 1HTQA 2QSDA 1WH3A 1EWCA 4JWSC 1LXDA 2PW9A 3Q3OC 4RFBA 3ZRCA 3U7ZA 1LQBA 3PLVA 1UUPA 2JRHA 1I4RA 1GNUA 1WSPA 1F0ZA 4NY0A 3GE3C 1WYWB 1QZEA 2XK5B 1C4PA 1GAQB 1FEHA 4KKJA 1TJEA 3PPAA 5E6OA 2KXJA 4MSQB 3ZDTA 2LRWA 3P1MA 4ANWA 5I4DA 3K9PB 4BBNF 5JHBA 4BKSA 4HJGE 3VUWA 4WIPA 1KFYB 3RN9C 1T0QC 1QQRA 2JY6A 2KZRA 4OVZA 4P1BC 1XLOA 3LYYA 4WWPA 2L3ZA 5KHOA 3PZ8A 2HJ8A 4GMVA 3U4EG 3ZTCA 1QOGA 2PE9A 3Q3FA 3PZDA 5CHWA 3FKYA 4LDTB 2JSVX 4WH4A 1YMHE 2ZCCA 1ZOYB 2V3PA 1UF0A 5HHDG 1WXMA 3ZVVA 3ZW3A 4P6VF 2ON8A 4MEMA 5GXGB 1TY2A 3PTFC 1E7UA 1NI3A 5MPOA 2C7HA 1HA5A 3PSEB 1ZW7A 2KYWA 3MFGA 2IYDB 2LUEA 1UNSA 3Q3MC 4HCPB 4ZRKA 2IDYA 2CU3A 1ZKHA 3OAWA 4XYCA 4YTMB 1WJUA 4BZAA 4ZYNA 1X1MA 3OJ3A 1D4BA 1QF6A 1VJKA 5DPTA 3W5VB 2V1YA 3H7SA 1GJZA 1L2NA 2I2YA 1J8CA 1WXVA 1RM6C 1C4CA 2MBEA 2UU7A 2PMVA 1YQBA 4B9KA 1BMLC 1JWMD 4MH0E 4EFOA 3A9KB 3X23A 2MLBA 1AARA 2IGDA 1RFAA 2J7QB 2KOXA 3BK1A 5T8IA 4KV2A 2RPVA 2WP9B 2C5LC 4OZBA 1HXYD 2L1AA 3PHXB 2E6XA 3MHSD 2WXKA 3ZQ4A 4E71A 2KD0A 3HIZA 1KRHA 2AL6A 1SJHD 1SF0A 3NOBA 3EHVA 5FK9C 1HTOA 1SB3C 3QARA 1VRAB 2WXLA 2KJ6A 5TSSA 3IG3A 2AEHA 2M17A 5C23A 1AWDA 1HQRD 4MGZE 2NBWB 2LI5A 5FR3A 2IO1B 3NUHB 1I4XA 1CMXB 2WU2B 3CSTA 3EA6A 3CMMB 4A55A 1VD2A 3L16A 3W5UB 4IG7B 3VDZA 3SU8X 3QHTA 2CHXA 2A4ZA 3PRPB 1Q5WB 1K52A 3AE4B 3GE8C 3CIRB 2HE7A 3IVFA 3R7QA 2VRRB 4C00A 4A9AA 1Z2MA 4ICVA 1ZPSA 2JWUA 2K39A 1LM8B 2N7DA 4KIKB 2JYEA 4W9JA 4MGKE 5D7GA 4AS1A 1TIFA 4JGHB 1JWBD 4DXFA 3V61A 2LEKA 2V3NA 4PS3A 3MJ5A 1C3TA 2J0JA 2XN9C 3SHQA 3BK2A 3J9CA 3JSVA 3I3TB 4K3CA 3PREA 3T3NA 3N1YC 4DXGA 3EGRA 1L6UA 3AEAB 4IM3A 5TR5A 3V60A 3LB8C 4RM9A 1KF6B 2NTTA 2N9PC 4HVBA 4N9F4 4NAWB 5LLIA 1LGRA 4YT0B 3PRMB 2A5UA 3EC8A 3DWGC 3VHTC 1FRDA 2KTRA 2BS4B 1V5OA 3ZNHB 4ASWC 3I57A 4YL8A 2WXGA 2BBCA 1D5ZC 1UWMA 4KVGB 1WI0A 2G3QB 2NTSA 1YOVB 4IWPA 2QC8A 4HWIB 3KQ4A 5L95C 4RGNA 1TBEA 1J7AA 3RNGC 1V1PB 2RDGA 3PLUA 2LD9A 2W55A 5IP4D 5CTRC 4GB9A 1PQSA 2BGFA 3AN1A 4UDUC 4GDLB 3EFCA 1CZPA 4M8NA 2HTHA 2L52A 1WF9A 3QJZA 1TS5A 2KFKA 3AU4A 1F77A 3UIOB 1WZ0A 3TJPA 1JROA 3VQIA 3NZSA 2AQ2B 2DYMA 2X8XX 2LVOA 3V3XA 3E9SA 5IKCM 3P4SB 5LXIB 3QWZB 4GXBA 2M0AA 1L0VB 1V8CA 2MBOA 3A4SC 4AJWA 4C4VB 4DWFA 1Q0WB 4B95A 1F9JA 1ZDXA 4FHKA 3ZIMA 3U30A 4RGMA 3V6EB 2WXMA 2N9EB 2W82A 2K25A 2KFJA 1ENFA 4B6WA 4YSYB 2XBBC 1JWUD 2IJ0A 2WXJA 3ZJTA 2GRIA 2HJ1A 5C2TB 3AULA 1Q1OA 3RFZB 3L08A 1L0YB 3WCQA 2CKHB 1Q10A 2ZNVB 4KDIC 2KJRA 3NS8A 4II2B 1DYQA 2MWSB 2WXFA 3WAOA 5BO4B 2NPTB 4XX5A 1ACCA 3NG0A 5EDSA 2LGXA 2KACA 2J0KA 4EOYA 2OJRA 4HLEA 3RNEC 2GBJA 4KKIA 4DXAB 3R7RA 2TSSA 1TKYA 4DHZB 4ZRIA 1VR9A 4KZ0A 2QILA 4W9LA 4B0EA 1UH6A 2FCQA 2XEWA 3MJWA 3Q8EA 2IY0B 1PYWD 3SFEB 4LNFA 4I6LB 4K1RB 4E74A 5JXVA 3HUIA 1V97A 4AWJA 2PTLA 2XNAC 4FA6A 3ECIA 1DOYA 3DQVA 3NZ3A 2MEKA 4A20A 4HJKA 1NEKB 2O2VB 1YN3A 1RLFA 1WZ3A 4HDQA 1UZXB 5HFYA 1N6ZA 2MJDA 4TUUA 1TKEA 3V05A 2GI9A 3DHGC 3FILA 3VXWA 4WJNA 3RI7C 1P1AA 4MM3A 4RMAA 2BB6A 1C77A 5CX3A 4L1BA 1XLNA 4LCDE 1S1QB 5G5GA 4WAFA 2UYZB 5DPSA 4KX6B 4KDLB 2KMAA 3R66C 4ICUA 1WGHA 2K8BA 5D6JB 1ZXIA 1N5XA 1E8YA 3R2TA 2B3AA 1IUEA 3URYA 1N61A 4AQ7A 2BS3B 2KO3A 2MBHA 1FD6A 3NHEB 3KVFB 1XCQL 1E8WA 1OGWA 3L0WB 4M02A 3TEXA 2GOWA 2N1WA 5E6NA 5EE1A 4K7WA 1SEBD 5IN7A 3ZLZA 4MJSB 1JCKB 3ZNGC 3KYCD 1MI0A 1WX8A 4N58A 2MP2A 1NI2A 2WXIA 4G11A 1IGCA 2KMMA 4TKNA 3VH4B 4AOFA 4LNIA 3V62A 3KW5B 2H89B 3AE3B 1GPXA 1BT0A 4FBJB 1C1YB 2EELA 3CWIA 3QAQA 4ACFA 1F2RI 3P4QB 3AXCA 2JYTA 4DBGA 4WWOA 2J0MA 3SD5A 1CJEA 1WE6A 2Y5CA 2LUMA 5C1ZA 1XCTL 3NRZA 2Y5PA 1KLVA 3AE7B 4W9IA 2KQ7A
chains in the Genus database with same CATH topology
1WX7A 2DX5B 3WIMA 5DPTA 2V1YA 3H7SA 4HVBA 1GG3A 2QHOA 3ZUNA 1GJZA 1I35A 2ZPYA 1L2NA 2ZJDA 2MBBB 1J8CA 4HK2A 3AU5A 2KLGA 1WXVA 4HCNB 4A3OA 2MBEA 3DVNU 4BOZB 3ZKJC 1YQBA 1H4RA 3A1QA 3O65B 4B9KA 2ZVOA 2KTRB 3IHPC 3DVNV 5DPWA 4MH0E 4EFOA 3A9KB 2FAZA 3X23A 3ENEA 2FIFA 2LXCA 5DPRA 2MLBA 3TBLD 4NJ6A 1AARA 2KLCA 3IFWB 1RFAA 2J7QB 2CU1A 2O2VA 2KOXA 2RD0A 1K8RB 3H1UA 1L7YA 2DZIA 3TMPB 1KJTA 4KV2A 3L13A 2C5LC 4BOSC 1XQQA 2KDIA 2BYFA 1M94A 1WRDB 3PHXB 5GMVA 4FHJA 4CO7A 4BKGA 3BY4B 5DCNA 3MHSD 1EUVB 3N32A 4DHJD 3SDLC 5L83A 1A5RA 4PS7A 3ZNZB 2KD0A 3HIZA 4E71A 1EF1A 3WA0A 2AL6A 2KDFB 1NDDA 1P98A 3UIPB 2GBMA 2CHWA 2JT4B 2XK5A 3EHVA 2DYOA 3NOBA 1UBQA 4JLCA 1LFDA 1YIWA 5AZGA 4II3B 5J18A 1E7VA 1YX5B 1GC6A 1JRUA 3VUYA 3PV1A 3QARA 3APFA 1V81A 4HPMB 1P3QU 3ONSA 3KUZA 2KWVB 4HXDA 2KC1A 2KJ6A 3KH0A 3GOEA 3PVLA 4FJZA 4XZ4A 3IG3A 2FCNA 2AEHA 2M17A 5C23A 1SE9A 2K6DB 4TV3A 2GBRA 4MGZE 2BYVE 3QC8B 2NBWB 2LI5A 3RYTA 3V6CB 2IO1B 2WX1A 2MA9B 3LJ3A 2FUHB 2YVCA 3H7PB 1CMXB 4P7IA 3QIJA 3H7PA 2KMCA 2LWPA 3CSTA 2NBUA 4AUQC 2ZNVC 3CMMB 2I1JA 2K8CA 3U8ZA 3GZNI 1VD2A 3L16A 3UQBA 4W9FA 1NBFC 4I6PA 4IG7B 1V49A 3VDZA 5G55A 4URKA 1E8ZA 1H8CA 2KN5A 3QHTA 2JZZA 2DHZA 3SU8X 2CHXA 2A4ZA 3PRPB 1Q5WB 4DK5A 2ZCBA 3R3MA 4GN1A 2CR5A 3M62B 2HE7A 1TZ1A 2CS4A 3IVFA 3R7QA 2VRRB 1WMHA 4MJSA 1Z2MA 2JF5A 1TGZB 2EMSA 1WJ4A 2YLMA 1UGMA 1RRBA 4ICVA 4EEWA 4FJVB 3VUXA 5G2NA 2K39A 1LM8B 2L0TA 3DPDA 3HM3A 2LRUA 3VTWA 3RZFA 2N7DA 2MSED 4E3CA 1MG8A 5D94A 2UWQA 2RR9A 1WXAA 3DBRI 1VCBA 1WX9A 4KIKB 1Y8RC 5J2RA 4W9JA 4MGKE 3S2AA 5D7GA 3RZWC 4EZLA 3PGEA 3KUCB 4PYZA 5JHAA 1WJ6A 1S3SG 4JGHB 2K8HA 3HHMA 3V61A 3WANA 4I6NB 4PS3A 4LJOB 1C3TA 2J0JA 2G45B 2MBQA 3JSVB 2PJHA 3SHQA 4F1SA 3OLMD 3JSVA 3I3TB 1WGGA 2NVUI 3PREA 2V3SA 1D3ZA 2LGDA 4WJQA 2Z0EB 2N7EA 4NJ7A 3UGBB 2PEAA 1V86A 2D2QA 2MCNB 4FN2A 4FULA 4IM3A 4KZCA 5TR5A 3V60A 2M4NA 2Z0DB 2D11A 4WAAA 4RM9A 3RT3B 2JVCA 3QK0A 3QCAA 2N9PC 1ISNA 1TTNA 4IUMB 4JL9A 4N9F4 4K7SA 4NAWB 3PHWB 4W9KA 5LLIA 4A3PA 4EZJA 2KK8A 2GMIC 4HPLB 2G4DB 3X0WA 4DHJB 3PRMB 2KJHB 2A5UA 2LVQA 4DDGD 2BKRB 3ML8A 3EC8A 5LXHA 3N3KB 2NCNA 3VHTC 2IO2B 2KTRA 4X57B 1V5OA 2DZKA 2GBKA 4YL8A 3DVGY 3ZNHB 4ASWC 4BKTA 1G6JA 2AL3A 3WALA 4GDKB 3A9KA 3AI5A 4PS8A 1IPGA 1OEYA 3HK0A 4GDKA 4M0WB 4KVGB 1SGHA 1WI0A 1R4NI 2NS5A 3VTUA 2DAJA 2KHWB 2G3QB 2JWZA 2LZ6A 2LASA 3EECA 4IM0A 2MQJA 2I1KA 4MGIE 1P0RA 2L7RA 4FADA 1UD7A 4IWPA 3P2BA 1IP9A 1WGRA 4HWIB 1WY8A 5AEKB 5L95C 2KWCA 1TBEA 4OVUA 2ASQA 3PLUA 2KTFA 1V5TA 2C60A 2LD9A 5CTRC 4GB9A 2D10A 1PQSA 4IWOA 1EF5A 2LJ5A 4FJYA 4GU2A 2BGFA 4XC2A 2D07B 3JYUA 4GDLB 1V9JA 2BWFA 1WM2A 3CSFA 4M8NA 3ZO5B 1KOTA 1V2YA 3HM6X 3U7DA 2HTHA 1WF9A 2KFKB 2O6VD 2WDTB 3QJZA 3RUIB 1P9DU 2Z59B 2KFKA 3L54A 3AU4A 1XT9B 2DZJA 3UIOB 5AZFA 1WZ0A 4NPNA 2D3GA 3TJPA 3VQIA 1EO6A 3DVGX 2NBVB 3NZSA 2DYMA 1WR6E 2BWES 2LVOA 3LDZE 1XD3B 5AZHA 2IO0B 3N30A 3PRZA 3DBLI 5LXIB 3QWZB 4GXBA 1GC7A 2EKEC 2BYEA 2N9XA 2MBOA 2KX0A 3A4SC 4CHKA 2N1VA 4AJWA 1WXSA 3A9JB 2RPQA 3B08A 4ZDVA 3EFUA 4RM8A 2LGYA 4WJPA 3ZDMC 3A9JA 2ZEQA 4DWFA 2JZ3B 2KQSA 1Q0WB 1J0GA 4B95A 4ANXA 1F9JA 4FHKA 3ZIMA 1WM3A 3U30A 4G50A 4F7ZA 3V6EB 5JZEB 3K9OB 4WWNA 3W1SC 2FCSA 3QX1A 1E5WA 2N9EB 2OOBB 4MSMB 2JRIB 2K25A 2WX0A 5J17A 2KFJA 3QQ8B 2JPHA 3DBHI 3W1YA 4B6WA 2IY1B 4EKUA 3UF8A 3Q3JA 3QA8A 2XBBC 5HKHA 1T0YA 3A33B 4BKSD 4KIKA 4AP4C 2L8JA 4EZKA 2HD5B 2WWZA 3CF6E 4W9DA 2MP2B 1IYFA 1OQYA 4PYUA 2RGFA 3B1LX 3AULA 2KDBA 1Q1OA 2PE6B 3L08A 2REXA 2CKHB 2MRPA 1OTRB 2FNJB 2W9NA 3MTNB 2N4FA 2ZNVB 4KDIC 2KJRA 2M1MA 3M63B 3NS8A 4II2B 1WGDA 3DDCB 2KKCA 1WFYA 1R4MI 2MWSB 3WAOA 5BO4B 5E6PA 2NPTB 4XX5A 4DHZE 3RCZA 2K1FA 1WJNA 2NPTA 3B0AA 4IC7B 4LDTD 3RD2A 1SIFA 2JXXA 3WAMA 2KNBA 5KHQA 3ML9A 4G3XB 3APCA 1RAXA 3T8MA 4EUTA 1J19A 5EDSA 2LGXA 1V6EA 4M8MA 4NAWA 4CYEA 2J0KA 4EOYA 3NZUA 2C7MB 2OJRA 1OEYJ 3JVZX 1WIAA 4HLEA 3KYDD 2DYBA 2GBJA 2KWUB 4KSLC 4DXAB 3R7RA 2L05A 4W9HA 1UELA 3VH3B 2FIDA 4OVVA 1YX6B 4NNJB 1U4AA 4DHZB 4ZRIA 2MW5A 3BINA 3A4RA 2IO3B 4KZ0A 4W9LA 1UH6A 2FCQA 4KSKC 2XEWA 3MJWA 1FXTB 2BKFA 2IY0B 1GUAB 4IW0A 4ANVA 3VFKA 3PT2B 2NR2A 1HE8A 4GSWA 4I6LB 4K1RB 2KDEB 2O6VB 3KUDB 4E74A 4MELA 3A1QB 3L10B 4AWJA 4FLHA 2O6VA 4FA6A 3ECIA 2KANA 1WH3A 3DQVA 4GIVA 3WAPA 5FR6A 3ZNID 3UQAA 4ZRJA 1LXDA 2DZMA 1WE7A 4A20A 3IBEA 4HJKA 2O2VB 1RLFA 1WZ3A 4BVUC 4HDQA 4WQOB 1I42A 1UBIA 1UZXB 5CHFA 2FCMA 3ZRCA 3C0RB 3TCAA 2IBIB 4IM2A 1LQBA 3VTVA 3PLVA 1YD8U 4TUUA 3RULA 4ANUA 2JRHA 3T9LA 4IWQA 5CHVC 1GNUA 4GDLA 4W9CA 4NQLB 4DDID 4NY0A 3VXWA 2RSUA 2MX2A 3NY5A 4WJNA 1WR1A 2R2OA 1WYWB 4GGQA 1QZEA 2XK5B 1P1AA 3DOWA 4MM3A 4RMAA 1KM7A 3PPAA 1ZGUB 5CX3A 3JW0X 1E8XA 5E6OA 3VAWA 2KXJA 3D32A 3OJ4B 3L17A 4MSQB 4LCDE 2R2QA 4JQWC 2LRWA 3ZDTA 3H6NA 2KC2A 4LJPB 1S1QB 3M95A 2EMTA 4MDKE 5D2MB 3TIXA 4ANWA 2UYZB 4W9GA 4GOCA 3K9PB 2BPSA 5DPSA 2L00B 4BBNF 5JHBA 4BKSA 4KDLB 4BBNC 2KMAA 3R66C 3VUWA 2ZZPB 4ICUA 2C7NB 1WGHA 2K8BA 3DBSA 3UINB 4W9EA 5D6JB 1E8YA 5IAAC 2B3AA 2M8SA 4TQ0A 2JY6A 2KZRA 4K81A 1V80A 2K6QA 4HDOA 4WWPA 2KO3A 2L3ZA 3TL5A 2MBHA 5KHOA 2WYQA 2HJ8A 4GMVA 2KVRA 3ZTCA 4NQKE 2PE9A 3KVFB 3NHEB 3H9DA 1E8WA 3Q3FA 3PZDA 4AJYB 1OGWA 5CHWA 2AYOB 2PPHA 3L0WB 4LDTB 2DAFA 2GOWA 2CHZA 2JUOA 2N1WA 4F8CB 5E6NA 4K7WA 1WMHB 4WJOA 2LVPA 4MJSB 4JIOU 3ZLZA 2ZCCA 3ZNGC 2V4LA 3KYCD 1WX8A 2M0XA 3ZRFA 1WXMA 4K7UA 3ZVVA 2KX3A 2BF8B 3ZW3A 2DENB 2MP2A 1NI2A 1YJ1A 4G11A 3APDA 4MEMA 3VH4B 4TKNA 2LXAA 4AOFA 3V62A 1E90A 3PTFC 3KW5B 1E7UA 2G4SA 2C7HA 3PSEB 1BT0A 1ZW7A 3DCGA 5IA7A 4FBJB 3ALBA 3PS6A 1C1YB 2IYDB 2LUEA 3QAQA 4HCPB 4MGYE 2GBNA 4G0NB 4ZRKA 1Z5SB 2Y5BB 2IZVB 3AXCA 1ZKHA 3OAWA 2ZPNA 4DBGA 4WWOA 2J0MA 3VVWB 3M3JA 3SD5A 2AWTA 5JH5C 1WE6A 3W1SA 2L0FA 2C9WB 1WJUA 5C1ZA 4ZYNA 4TQ1A 3ZTDA 4J6IA 1WGYA 2ZVNA 1X1MA 1KLVA 3OJ3A 2L76A 4BFRA 4W9IA 2KQ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WX7 A;  2DX5 B;  3WIM A;  5DPT A;  2V1Y A;  3H7S A;  4HVB A;  1GG3 A;  2QHO A;  3ZUN A;  1GJZ A;  1I35 A;  2ZPY A;  1L2N A;  2ZJD A;  2MBB B;  1J8C A;  4HK2 A;  3AU5 A;  2KLG A;  1WXV A;  4HCN B;  4A3O A;  2MBE A;  3DVN U;  4BOZ B;  3ZKJ C;  1YQB A;  1H4R A;  3A1Q A;  3O65 B;  4B9K A;  2ZVO A;  2KTR B;  3IHP C;  3DVN V;  5DPW A;  4MH0 E;  4EFO A;  3A9K B;  2FAZ A;  3X23 A;  3ENE A;  2FIF A;  2LXC A;  5DPR A;  2MLB A;  3TBL D;  4NJ6 A;  1AAR A;  2KLC A;  3IFW B;  1RFA A;  2J7Q B;  2CU1 A;  2O2V A;  2KOX A;  2RD0 A;  1K8R B;  3H1U A;  1L7Y A;  2DZI A;  3TMP B;  1KJT A;  4KV2 A;  3L13 A;  2C5L C;  4BOS C;  1XQQ A;  2KDI A;  2BYF A;  1M94 A;  1WRD B;  3PHX B;  5GMV A;  4FHJ A;  4CO7 A;  4BKG A;  3BY4 B;  5DCN A;  3MHS D;  1EUV B;  3N32 A;  4DHJ D;  3SDL C;  5L83 A;  1A5R A;  4PS7 A;  3ZNZ B;  2KD0 A;  3HIZ A;  4E71 A;  1EF1 A;  3WA0 A;  2AL6 A;  2KDF B;  1NDD A;  1P98 A;  3UIP B;  2GBM A;  2CHW A;  2JT4 B;  2XK5 A;  3EHV A;  2DYO A;  3NOB A;  1UBQ A;  4JLC A;  1LFD A;  1YIW A;  5AZG A;  4II3 B;  5J18 A;  1E7V A;  1YX5 B;  1GC6 A;  1JRU A;  3VUY A;  3PV1 A;  3QAR A;  3APF A;  1V81 A;  4HPM B;  1P3Q U;  3ONS A;  3KUZ A;  2KWV B;  4HXD A;  2KC1 A;  2KJ6 A;  3KH0 A;  3GOE A;  3PVL A;  4FJZ A;  4XZ4 A;  3IG3 A;  2FCN A;  2AEH A;  2M17 A;  5C23 A;  1SE9 A;  2K6D B;  4TV3 A;  2GBR A;  4MGZ E;  2BYV E;  3QC8 B;  2NBW B;  2LI5 A;  3RYT A;  3V6C B;  2IO1 B;  2WX1 A;  2MA9 B;  3LJ3 A;  2FUH B;  2YVC A;  3H7P B;  1CMX B;  4P7I A;  3QIJ A;  3H7P A;  2KMC A;  2LWP A;  3CST A;  2NBU A;  4AUQ C;  2ZNV C;  3CMM B;  2I1J A;  2K8C A;  3U8Z A;  3GZN I;  1VD2 A;  3L16 A;  3UQB A;  4W9F A;  1NBF C;  4I6P A;  4IG7 B;  1V49 A;  3VDZ A;  5G55 A;  4URK A;  1E8Z A;  1H8C A;  2KN5 A;  3QHT A;  2JZZ A;  2DHZ A;  3SU8 X;  2CHX A;  2A4Z A;  3PRP B;  1Q5W B;  4DK5 A;  2ZCB A;  3R3M A;  4GN1 A;  2CR5 A;  3M62 B;  2HE7 A;  1TZ1 A;  2CS4 A;  3IVF A;  3R7Q A;  2VRR B;  1WMH A;  4MJS A;  1Z2M A;  2JF5 A;  1TGZ B;  2EMS A;  1WJ4 A;  2YLM A;  1UGM A;  1RRB A;  4ICV A;  4EEW A;  4FJV B;  3VUX A;  5G2N A;  2K39 A;  1LM8 B;  2L0T A;  3DPD A;  3HM3 A;  2LRU A;  3VTW A;  3RZF A;  2N7D A;  2MSE D;  4E3C A;  1MG8 A;  5D94 A;  2UWQ A;  2RR9 A;  1WXA A;  3DBR I;  1VCB A;  1WX9 A;  4KIK B;  1Y8R C;  5J2R A;  4W9J A;  4MGK E;  3S2A A;  5D7G A;  3RZW C;  4EZL A;  3PGE A;  3KUC B;  4PYZ A;  5JHA A;  1WJ6 A;  1S3S G;  4JGH B;  2K8H A;  3HHM A;  3V61 A;  3WAN A;  4I6N B;  4PS3 A;  4LJO B;  1C3T A;  2J0J A;  2G45 B;  2MBQ A;  3JSV B;  2PJH A;  3SHQ A;  4F1S A;  3OLM D;  3JSV A;  3I3T B;  1WGG A;  2NVU I;  3PRE A;  2V3S A;  1D3Z A;  2LGD A;  4WJQ A;  2Z0E B;  2N7E A;  4NJ7 A;  3UGB B;  2PEA A;  1V86 A;  2D2Q A;  2MCN B;  4FN2 A;  4FUL A;  4IM3 A;  4KZC A;  5TR5 A;  3V60 A;  2M4N A;  2Z0D B;  2D11 A;  4WAA A;  4RM9 A;  3RT3 B;  2JVC A;  3QK0 A;  3QCA A;  2N9P C;  1ISN A;  1TTN A;  4IUM B;  4JL9 A;  4N9F 4;  4K7S A;  4NAW B;  3PHW B;  4W9K A;  5LLI A;  4A3P A;  4EZJ A;  2KK8 A;  2GMI C;  4HPL B;  2G4D B;  3X0W A;  4DHJ B;  3PRM B;  2KJH B;  2A5U A;  2LVQ A;  4DDG D;  2BKR B;  3ML8 A;  3EC8 A;  5LXH A;  3N3K B;  2NCN A;  3VHT C;  2IO2 B;  2KTR A;  4X57 B;  1V5O A;  2DZK A;  2GBK A;  4YL8 A;  3DVG Y;  3ZNH B;  4ASW C;  4BKT A;  1G6J A;  2AL3 A;  3WAL A;  4GDK B;  3A9K A;  3AI5 A;  4PS8 A;  1IPG A;  1OEY A;  3HK0 A;  4GDK A;  4M0W B;  4KVG B;  1SGH A;  1WI0 A;  1R4N I;  2NS5 A;  3VTU A;  2DAJ A;  2KHW B;  2G3Q B;  2JWZ A;  2LZ6 A;  2LAS A;  3EEC A;  4IM0 A;  2MQJ A;  2I1K A;  4MGI E;  1P0R A;  2L7R A;  4FAD A;  1UD7 A;  4IWP A;  3P2B A;  1IP9 A;  1WGR A;  4HWI B;  1WY8 A;  5AEK B;  5L95 C;  2KWC A;  1TBE A;  4OVU A;  2ASQ A;  3PLU A;  2KTF A;  1V5T A;  2C60 A;  2LD9 A;  5CTR C;  4GB9 A;  2D10 A;  1PQS A;  4IWO A;  1EF5 A;  2LJ5 A;  4FJY A;  4GU2 A;  2BGF A;  4XC2 A;  2D07 B;  3JYU A;  4GDL B;  1V9J A;  2BWF A;  1WM2 A;  3CSF A;  4M8N A;  3ZO5 B;  1KOT A;  1V2Y A;  3HM6 X;  3U7D A;  2HTH A;  1WF9 A;  2KFK B;  2O6V D;  2WDT B;  3QJZ A;  3RUI B;  1P9D U;  2Z59 B;  2KFK A;  3L54 A;  3AU4 A;  1XT9 B;  2DZJ A;  3UIO B;  5AZF A;  1WZ0 A;  4NPN A;  2D3G A;  3TJP A;  3VQI A;  1EO6 A;  3DVG X;  2NBV B;  3NZS A;  2DYM A;  1WR6 E;  2BWE S;  2LVO A;  3LDZ E;  1XD3 B;  5AZH A;  2IO0 B;  3N30 A;  3PRZ A;  3DBL I;  5LXI B;  3QWZ B;  4GXB A;  1GC7 A;  2EKE C;  2BYE A;  2N9X A;  2MBO A;  2KX0 A;  3A4S C;  4CHK A;  2N1V A;  4AJW A;  1WXS A;  3A9J B;  2RPQ A;  3B08 A;  4ZDV A;  3EFU A;  4RM8 A;  2LGY A;  4WJP A;  3ZDM C;  3A9J A;  2ZEQ A;  4DWF A;  2JZ3 B;  2KQS A;  1Q0W B;  1J0G A;  4B95 A;  4ANX A;  1F9J A;  4FHK A;  3ZIM A;  1WM3 A;  3U30 A;  4G50 A;  4F7Z A;  3V6E B;  5JZE B;  3K9O B;  4WWN A;  3W1S C;  2FCS A;  3QX1 A;  1E5W A;  2N9E B;  2OOB B;  4MSM B;  2JRI B;  2K25 A;  2WX0 A;  5J17 A;  2KFJ A;  3QQ8 B;  2JPH A;  3DBH I;  3W1Y A;  4B6W A;  2IY1 B;  4EKU A;  3UF8 A;  3Q3J A;  3QA8 A;  2XBB C;  5HKH A;  1T0Y A;  3A33 B;  4BKS D;  4KIK A;  4AP4 C;  2L8J A;  4EZK A;  2HD5 B;  2WWZ A;  3CF6 E;  4W9D A;  2MP2 B;  1IYF A;  1OQY A;  4PYU A;  2RGF A;  3B1L X;  3AUL A;  2KDB A;  1Q1O A;  2PE6 B;  3L08 A;  2REX A;  2CKH B;  2MRP A;  1OTR B;  2FNJ B;  2W9N A;  3MTN B;  2N4F A;  2ZNV B;  4KDI C;  2KJR A;  2M1M A;  3M63 B;  3NS8 A;  4II2 B;  1WGD A;  3DDC B;  2KKC A;  1WFY A;  1R4M I;  2MWS B;  3WAO A;  5BO4 B;  5E6P A;  2NPT B;  4XX5 A;  4DHZ E;  3RCZ A;  2K1F A;  1WJN A;  2NPT A;  3B0A A;  4IC7 B;  4LDT D;  3RD2 A;  1SIF A;  2JXX A;  3WAM A;  2KNB A;  5KHQ A;  3ML9 A;  4G3X B;  3APC A;  1RAX A;  3T8M A;  4EUT A;  1J19 A;  5EDS A;  2LGX A;  1V6E A;  4M8M A;  4NAW A;  4CYE A;  2J0K A;  4EOY A;  3NZU A;  2C7M B;  2OJR A;  1OEY J;  3JVZ X;  1WIA A;  4HLE A;  3KYD D;  2DYB A;  2GBJ A;  2KWU B;  4KSL C;  4DXA B;  3R7R A;  2L05 A;  4W9H A;  1UEL A;  3VH3 B;  2FID A;  4OVV A;  1YX6 B;  4NNJ B;  1U4A A;  4DHZ B;  4ZRI A;  2MW5 A;  3BIN A;  3A4R A;  2IO3 B;  4KZ0 A;  4W9L A;  1UH6 A;  2FCQ A;  4KSK C;  2XEW A;  3MJW A;  1FXT B;  2BKF A;  2IY0 B;  1GUA B;  4IW0 A;  4ANV A;  3VFK A;  3PT2 B;  2NR2 A;  1HE8 A;  4GSW A;  4I6L B;  4K1R B;  2KDE B;  2O6V B;  3KUD B;  4E74 A;  4MEL A;  3A1Q B;  3L10 B;  4AWJ A;  4FLH A;  2O6V A;  4FA6 A;  3ECI A;  2KAN A;  1WH3 A;  3DQV A;  4GIV A;  3WAP A;  5FR6 A;  3ZNI D;  3UQA A;  4ZRJ A;  1LXD A;  2DZM A;  1WE7 A;  4A20 A;  3IBE A;  4HJK A;  2O2V B;  1RLF A;  1WZ3 A;  4BVU C;  4HDQ A;  4WQO B;  1I42 A;  1UBI A;  1UZX B;  5CHF A;  2FCM A;  3ZRC A;  3C0R B;  3TCA A;  2IBI B;  4IM2 A;  1LQB A;  3VTV A;  3PLV A;  1YD8 U;  4TUU A;  3RUL A;  4ANU A;  2JRH A;  3T9L A;  4IWQ A;  5CHV C;  1GNU A;  4GDL A;  4W9C A;  4NQL B;  4DDI D;  4NY0 A;  3VXW A;  2RSU A;  2MX2 A;  3NY5 A;  4WJN A;  1WR1 A;  2R2O A;  1WYW B;  4GGQ A;  1QZE A;  2XK5 B;  1P1A A;  3DOW A;  4MM3 A;  4RMA A;  1KM7 A;  3PPA A;  1ZGU B;  5CX3 A;  3JW0 X;  1E8X A;  5E6O A;  3VAW A;  2KXJ A;  3D32 A;  3OJ4 B;  3L17 A;  4MSQ B;  4LCD E;  2R2Q A;  4JQW C;  2LRW A;  3ZDT A;  3H6N A;  2KC2 A;  4LJP B;  1S1Q B;  3M95 A;  2EMT A;  4MDK E;  5D2M B;  3TIX A;  4ANW A;  2UYZ B;  4W9G A;  4GOC A;  3K9P B;  2BPS A;  5DPS A;  2L00 B;  4BBN F;  5JHB A;  4BKS A;  4KDL B;  4BBN C;  2KMA A;  3R66 C;  3VUW A;  2ZZP B;  4ICU A;  2C7N B;  1WGH A;  2K8B A;  3DBS A;  3UIN B;  4W9E A;  5D6J B;  1E8Y A;  5IAA C;  2B3A A;  2M8S A;  4TQ0 A;  2JY6 A;  2KZR A;  4K81 A;  1V80 A;  2K6Q A;  4HDO A;  4WWP A;  2KO3 A;  2L3Z A;  3TL5 A;  2MBH A;  5KHO A;  2WYQ A;  2HJ8 A;  4GMV A;  2KVR A;  3ZTC A;  4NQK E;  2PE9 A;  3KVF B;  3NHE B;  3H9D A;  1E8W A;  3Q3F A;  3PZD A;  4AJY B;  1OGW A;  5CHW A;  2AYO B;  2PPH A;  3L0W B;  4LDT B;  2DAF A;  2GOW A;  2CHZ A;  2JUO A;  2N1W A;  4F8C B;  5E6N A;  4K7W A;  1WMH B;  4WJO A;  2LVP A;  4MJS B;  4JIO U;  3ZLZ A;  2ZCC A;  3ZNG C;  2V4L A;  3KYC D;  1WX8 A;  2M0X A;  3ZRF A;  1WXM A;  4K7U A;  3ZVV A;  2KX3 A;  2BF8 B;  3ZW3 A;  2DEN B;  2MP2 A;  1NI2 A;  1YJ1 A;  4G11 A;  3APD A;  4MEM A;  3VH4 B;  4TKN A;  2LXA A;  4AOF A;  3V62 A;  1E90 A;  3PTF C;  3KW5 B;  1E7U A;  2G4S A;  2C7H A;  3PSE B;  1BT0 A;  1ZW7 A;  3DCG A;  5IA7 A;  4FBJ B;  3ALB A;  3PS6 A;  1C1Y B;  2IYD B;  2LUE A;  3QAQ A;  4HCP B;  4MGY E;  2GBN A;  4G0N B;  4ZRK A;  1Z5S B;  2Y5B B;  2IZV B;  3AXC A;  1ZKH A;  3OAW A;  2ZPN A;  4DBG A;  4WWO A;  2J0M A;  3VVW B;  3M3J A;  3SD5 A;  2AWT A;  5JH5 C;  1WE6 A;  3W1S A;  2L0F A;  2C9W B;  1WJU A;  5C1Z A;  4ZYN A;  4TQ1 A;  3ZTD A;  4J6I A;  1WGY A;  2ZVN A;  1X1M A;  1KLV A;  3OJ3 A;  2L76 A;  4BFR A;  4W9I A;  2KQ7 A; 
#chains in the Genus database with same CATH topology
 5BMG A;  1WX7 A;  2DX5 B;  3WIM A;  3IT6 B;  2QHO A;  3VR9 B;  2ZJD A;  4C80 A;  2CJN A;  2KLG A;  2IND C;  2J4X A;  4HCN B;  3B2G A;  4LLG M;  4MT5 A;  1H4R A;  3A1Q A;  3O65 B;  1T0R C;  3ZGZ A;  2FIF A;  2J52 A;  1ZUD 2;  1FXA A;  3T3O A;  4OZA A;  4RGT A;  2DZI A;  1KJT A;  1NEN B;  2VZK D;  2RMM A;  4BOS C;  1R4M B;  1IBX B;  1TKG A;  2N9L A;  5GMV A;  3BY4 B;  5DCN A;  1EUV B;  5EE0 A;  2D3C A;  3SDL C;  1A5R A;  4ZYS A;  1ZE3 D;  3R2I A;  2JT4 B;  2DYO A;  1UBQ A;  1YIW A;  4II3 B;  5J18 A;  3VUY A;  1UGJ A;  3N1Z C;  4HPM B;  1Y56 A;  1P3Q U;  2LHE A;  1C9F A;  3ETR A;  2Y3A A;  1OQR A;  2KWV B;  3GOE A;  3P42 A;  1SE9 A;  1V1O A;  4TV3 A;  2BYV E;  3QC8 B;  4KGR A;  3LJ3 A;  3RMK C;  1YNT E;  4P7I A;  5BYR A;  4YSX B;  2KMC A;  2LWP A;  2NBU A;  2W54 A;  2KT7 A;  2I1J A;  3GZN I;  4C7Y A;  4W9F A;  2WXN A;  4URK A;  1V49 A;  2RDH A;  1H8C A;  1E8Z A;  2KWD A;  2JZZ A;  2DHZ A;  2K0P A;  1TS4 A;  2ZCB A;  3R3M A;  2CR5 A;  3U2S C;  4NZL B;  2BYT A;  5D3I B;  1WMH A;  1JWA D;  2JF5 A;  2EMS A;  1WJ4 A;  1UGM A;  1AW7 A;  2V4I B;  3C19 A;  2QMT A;  5G2N A;  1PFD A;  2LRU A;  2UWQ A;  4KGT A;  5J2R A;  3TUO A;  1TYG B;  4EZL A;  3PGE A;  5JHA A;  3HHM A;  4HRS A;  1K50 A;  2PJH A;  1YQ3 B;  3TEY A;  2WDV B;  1WGG A;  2D5G A;  5BYQ A;  2V3S A;  1ESF A;  3AEG B;  3UGB B;  2PEA A;  1V86 A;  2MCN B;  4KZC A;  2VZK B;  2Z0D B;  3AV8 A;  4WAA A;  3QCA A;  4IUM B;  4JL9 A;  4K7S A;  3AE5 B;  1I4H A;  2KK8 A;  4H2A A;  2G4D B;  2VH1 A;  2KAJ A;  2KJH B;  4DDG D;  3ML8 A;  1KLG D;  3N3K B;  4X57 B;  1C76 A;  2GBK A;  3DVG Y;  4GDK B;  3AMZ A;  1IPG A;  1OEY A;  1SGH A;  2AQ3 B;  1EU3 A;  3VTU A;  2JWZ A;  2LAS A;  4IM0 A;  2ONQ A;  1P0R A;  2L7R A;  1UD7 A;  1WY8 A;  4RNA A;  4OVU A;  1I4Q A;  2KTF A;  1V5T A;  1V1P A;  1QIL A;  2D10 A;  3IAM 1;  4GU2 A;  1E9M A;  1WM2 A;  3C8Y A;  3CSF A;  3U7D A;  3R8B A;  2O6V D;  1P9D U;  3L54 A;  3BYT B;  1XT9 B;  4IDI A;  1GB1 A;  5AZF A;  1XF5 L;  2D3G A;  3N1X C;  3Q8B A;  2NBV B;  1OQQ A;  4JX1 C;  1ET6 A;  2WNM A;  4RH6 A;  1MFW A;  1AYF A;  3RNB C;  2N9X A;  4CHK A;  2JU6 X;  1WXS A;  3EFU A;  2ZEQ A;  1JRP A;  1FPY A;  1WM3 A;  4F7Z A;  3H8H A;  2FCS A;  2L32 A;  3PO0 A;  1E5W A;  3ZXR A;  1ZXH A;  1I7H A;  5J17 A;  2JPH A;  3DBH I;  4EKU A;  3TEZ A;  1YQ4 B;  1T0Y A;  3E56 A;  3GS2 A;  1STE A;  3AE6 B;  2L8J A;  3I63 C;  3CF6 E;  2WWZ A;  1IYF A;  4ZRP A;  1OQY A;  2RGF A;  3AE2 B;  2E3T A;  2MRP A;  3MTN B;  1L0X B;  4RGO S;  1R4M I;  1E6E B;  5E6P A;  4HKZ E;  2GLS A;  4DHZ E;  2K1F A;  1FO4 A;  2NPT A;  4IC7 B;  1NVI D;  2JXX A;  1JML A;  3WAM A;  3ML9 A;  2JXT A;  3APC A;  1RAX A;  2K3U A;  1J19 A;  1E10 A;  3I5J C;  4M8M A;  4CYE A;  2C7M B;  3JVZ X;  1WIA A;  3Q8C A;  4KSL C;  3VH3 B;  1YX6 B;  2N0S B;  4NNJ B;  3BVG A;  4N59 A;  2MW5 A;  1YN4 A;  3A4R A;  3BIN A;  3UI3 A;  4YSZ B;  2D3A A;  3OWE B;  5H92 C;  1FXT B;  4US8 A;  4YXD B;  4M0W A;  2NR2 A;  2O6V B;  3MC8 A;  3L10 B;  4FLH A;  1MJD A;  4GIV A;  1YJJ A;  3ZNI D;  1LO5 D;  2DZM A;  1WE7 A;  2INC C;  2D3B A;  3IBE A;  2B76 B;  4HRO A;  1I42 A;  5CHF A;  2FCM A;  2AX5 A;  1YD8 U;  3RUL A;  4ANU A;  4IWQ A;  4W9C A;  4GLS C;  4NQL B;  1ZDV A;  3MP9 A;  1I4P A;  3AE9 B;  2BB5 A;  2MX2 A;  1SSN A;  3NY5 A;  1WR1 A;  2R2O A;  4JE3 B;  4CQN A;  4GGQ A;  3DOW A;  4ZHO A;  1ZGU B;  5LNK 1;  3L17 A;  4JQW C;  2KC2 A;  4MDK E;  1EM7 A;  2BQQ A;  4W9G A;  4GOC A;  1DOX A;  3RNA C;  2C7N B;  3UIN B;  2ACZ B;  4W9E A;  1SIJ A;  3DHH C;  2G1E A;  1C4A A;  5IAA C;  2WQY B;  1L4Z B;  5FKA C;  4K81 A;  4D2K A;  4HDO A;  2K6Q A;  3FAH A;  3TL5 A;  2WYQ A;  2KVR A;  1TT5 B;  3Q14 C;  2FUG 1;  1CQV A;  4NQK E;  3H9D A;  1N62 A;  4AJY B;  1FFU A;  2AYO B;  2DAF A;  1FXI A;  2JUO A;  2CHZ A;  2L83 A;  2M19 A;  2LVP A;  4JIO U;  4L2Y A;  2V4L A;  3PZ7 A;  2M0X A;  4LNK A;  3ZRF A;  4K7U A;  4N6E B;  3IT4 B;  2WXP A;  2LXA A;  1E90 A;  1RYJ A;  2G4S A;  1SXT A;  4O1N A;  3DCG A;  3TEW A;  4XDD A;  3ALB A;  3BVZ A;  1TS3 A;  1C78 A;  4MGY E;  1NYR A;  4G0N B;  2IZV B;  2WXO A;  3DBL B;  3M3J A;  1VZ7 A;  1J7B A;  2HTM E;  3W1S A;  2L0F A;  1XLP A;  1MG4 A;  2V9H A;  4J6I A;  1F2R C;  1F52 A;  3ZJU A;  3ZUN A;  2MBB B;  2JQR B;  3RNC C;  1QOF A;  2J42 A;  3AU5 A;  5AUI A;  4BOZ B;  3ZKJ C;  2ZVO A;  2KTR B;  3IHP C;  2BS2 B;  3MC9 A;  2K5P A;  2FAZ A;  3ENE A;  3TBL D;  3BII D;  3IFW B;  5D3D A;  2CU1 A;  3HVD A;  3N20 C;  4MAC A;  1K8R B;  3TMP B;  3KWV A;  5BMH A;  2G9H D;  2GB1 A;  2KDI A;  3Q2A C;  4CO7 A;  4BKG A;  2YEP B;  3N32 A;  3P63 A;  4RCO A;  1T3Q A;  1WGK A;  4PS7 A;  3ZNZ B;  2WXQ A;  1EF1 A;  2KDF B;  1P98 A;  2GBM A;  2XK5 A;  4IKG A;  5HI1 A;  5AZG A;  1YX5 B;  1GC6 A;  1JRU A;  3PV1 A;  3APF A;  1V81 A;  2EKI A;  1VLB A;  2PLP A;  2KC1 A;  4FJZ A;  2ZW1 A;  2K6D B;  1KLU D;  1CK1 A;  4QAY A;  4EE2 A;  3RYT A;  1E0Z A;  2WX1 A;  2KN4 A;  3ZJV A;  3H7P B;  2LGS A;  2PIA A;  5C3J B;  3QIJ A;  1MHX A;  1FFV A;  4AUQ C;  2ZNV C;  2K8C A;  3IAS 1;  3UQB A;  4PK1 A;  1VZ8 A;  4P16 A;  3AE8 B;  5G55 A;  4DK5 A;  1HEZ E;  1VZ6 A;  1TZ1 A;  2CS4 A;  1SJE D;  1YJI A;  1TGZ B;  2YLM A;  2JX5 A;  4KGS A;  1RRB A;  4EEW A;  1C79 A;  2L0T A;  3HM3 A;  2WGS A;  2MSE D;  1MG8 A;  5D94 A;  2RR9 A;  1WXA A;  2LMC A;  1VCB A;  1T6B X;  1Y8R C;  3AB5 A;  3S2A A;  3KUC B;  4PYZ A;  5AUK A;  1S3S G;  2ICI A;  2K8H A;  4I6N B;  1QKZ A;  4LJO B;  4TMA B;  4ZOH C;  2G45 B;  2MBQ A;  4XDC A;  3OLM D;  1B1Z A;  4C7Z A;  1QLB B;  2NVU I;  1D3Z A;  4WJQ A;  4NJ7 A;  1JAL A;  1FRR A;  2D2Q A;  3B2F A;  2M4N A;  4M01 A;  1XLQ A;  3RT3 B;  3NVZ A;  5IO9 A;  3Q69 A;  1ISN A;  1TTN A;  4W9K A;  4EZJ A;  3PHW B;  4HPL B;  1RFK A;  1R7S A;  5IOI A;  1TY0 A;  2NCN A;  2WU5 B;  3AE1 B;  2DZK A;  4BKT A;  2AL3 A;  3WAL A;  3A9K A;  3AI5 A;  4PS8 A;  1FCC C;  4OZC A;  4GDK A;  1N60 A;  2NS5 A;  2DAJ A;  4JPS A;  1QOB A;  2LZ6 A;  3EEC A;  4MGI E;  1A70 A;  3AEB B;  4WQM A;  1IP9 A;  1EU4 A;  5AEK B;  5HG2 A;  2ASQ A;  5BYS A;  1PGA A;  1GB4 A;  2N7J A;  4XC2 A;  4ZRQ A;  4K3B A;  2PKO A;  3ZO5 B;  3FIL B;  1KOT A;  1V2Y A;  3HM6 X;  1FNU A;  1GOZ A;  4HPP A;  2WDT B;  2Z59 B;  4MM3 B;  4BAX A;  1WXQ A;  4NPN A;  3HRD D;  1FMA D;  3DVG X;  2OJW A;  1WR6 E;  2BWE S;  3LDZ E;  1K51 A;  3VRA B;  1XD3 B;  5AZH A;  5BMI A;  3Q3N C;  2IO0 B;  2FE8 A;  2Z8L A;  3N30 A;  3PRZ A;  3DBL I;  2SEB D;  4A8X C;  1GC7 A;  3NJT A;  5EE9 A;  2IGG A;  3A9J B;  2RPQ A;  3B08 A;  2K9X A;  4R3D A;  4WJP A;  2K22 A;  2LGY A;  3ZDM C;  2QIE B;  1DGJ A;  2JZ3 B;  4ANX A;  4G50 A;  5JZE B;  3K9O B;  3W1S C;  2WHI A;  3QX1 A;  3ZYY X;  2OOB B;  4MSM B;  1BXT A;  4C56 C;  2WX0 A;  4WUR A;  3QQ8 B;  3W1Y A;  1SE2 A;  3TSS A;  1P7F A;  3UF8 A;  3Q3J A;  4XWW A;  3NVV A;  5HKH A;  4BKS D;  4KIK A;  4EZK A;  2HD5 B;  2I38 A;  4W9D A;  2MP2 B;  2WDR B;  2KDB A;  2REX A;  2W9N A;  2WS3 B;  4JWU C;  3ZXV A;  3GP7 A;  2M1M A;  1XEE A;  3DDC B;  2KKC A;  1WFY A;  1UWX A;  3B0A A;  3RD2 A;  5KHQ A;  4G3X B;  3T8M A;  4EUT A;  4HKQ A;  4ARC A;  3N9Y C;  1V6E A;  4PT5 A;  4NAW A;  1MHH E;  2DYB A;  4US9 A;  2KWU B;  4LTU A;  2L05 A;  4W9H A;  2ZW0 A;  1UEL A;  2FID A;  4L23 A;  4WWM A;  4KSK C;  4IW0 A;  2BKF A;  1DOI A;  4ANV A;  3VFK A;  4Q2J A;  3A1Q B;  2O6V A;  3DBR B;  2KAN A;  3WAP A;  5FR6 A;  1EWY C;  3UQA A;  4ZRJ A;  1XXG A;  1T0S C;  1PGX A;  3AEC B;  4BVU C;  4WQO B;  1UBI A;  3C0R B;  3TCA A;  3AEE B;  2IBI B;  4IM2 A;  1WWT A;  3VTV A;  3T9L A;  1L5P A;  4IOI E;  5CHV C;  4GDL A;  3LXF A;  4DDI D;  2KQ4 X;  2RSU A;  4XE0 A;  3NVW A;  1KM7 A;  3JW0 X;  1E8X A;  3DHI C;  3VAW A;  3D32 A;  3OJ4 B;  4LNN A;  2R2Q A;  3NVY A;  3H6N A;  4LJP B;  3M95 A;  1L4D B;  2EMT A;  3OG5 A;  1D5X C;  5D2M B;  3TIX A;  4ZHP A;  2BPS A;  1WYG A;  2L00 B;  2DBY A;  3IXS A;  4BBN C;  2ZZP B;  3DBS A;  1ET9 A;  5G5H A;  2WLB A;  1BUI C;  3FC4 A;  1R4N B;  4A90 A;  2M8S A;  3RNF C;  4TQ0 A;  4C4V A;  1SE4 A;  1V80 A;  3P4P B;  1QT9 A;  1K53 A;  2PPH A;  2CJO A;  4F8C B;  3BZD B;  2WXR A;  2Q5W D;  1WMH B;  4WJO A;  1F1H A;  4NJC A;  2KX3 A;  2X38 A;  2BF8 B;  2DEN B;  1YJ1 A;  4P1C C;  2NMQ A;  3APD A;  1WRI A;  3BYY B;  4MH8 A;  2J53 A;  1J7C A;  4FXC A;  5IA7 A;  3PS6 A;  3U52 E;  2GBN A;  3AEF B;  1Z5S B;  2Y5B B;  1ROE A;  2ZPN A;  4USA A;  3VVW B;  1TZO A;  2MH7 A;  2AWT A;  5JH5 C;  2LHD A;  3SR6 A;  2C9W B;  4TQ1 A;  3ZTD A;  1WGY A;  2ZVN A;  2N9K A;  2L76 A;  4BFR A;  1VDV A;  1GG3 A;  3AM9 A;  1I35 A;  3AED B;  2ZPY A;  4XGA B;  4HK2 A;  2QDF A;  4A3O A;  3DVN U;  1P7E A;  1D5M C;  3VRB B;  1YN5 A;  4M00 A;  3DVN V;  5DPW A;  2DWQ A;  2FBW B;  2MHJ A;  4S0R A;  2LXC A;  5DPR A;  1NYQ A;  4NJ6 A;  2KLC A;  2O2V A;  2LJI A;  2R61 A;  2RD0 A;  4OHJ A;  3H1U A;  1L7Y A;  1SBB B;  3L13 A;  2IGH A;  1XQQ A;  2BYF A;  1M94 A;  1WRD B;  2BVC A;  3HVZ A;  2INP E;  4FHJ A;  2WDQ B;  4DHJ D;  5L83 A;  3WA0 A;  1NDD A;  3UIP B;  2CHW A;  1RWS A;  4JLC A;  1LFD A;  1E7V A;  1HZ6 A;  1OFF A;  3ONS A;  3KUZ A;  3Q6B A;  1N5W A;  4HXD A;  3KH0 A;  3PVL A;  4XZ4 A;  2FCN A;  2GBR A;  3V6C B;  3NS1 A;  2SAK A;  2MA9 B;  3BVM A;  2FUH B;  2YVC A;  3I9V 1;  1FNV A;  5H8Y E;  3H7P A;  4DQO C;  5EE3 A;  3RPF C;  1KH0 A;  3U8Z A;  1NBF C;  4I6P A;  2KN5 A;  2OHF A;  4GN1 A;  2IPK D;  3BWU D;  3M62 B;  4ARI A;  4MJS A;  2BTE A;  1KTK A;  2QCZ A;  4FJV B;  1B9R A;  3VUX A;  4REZ A;  4OW0 A;  3DPD A;  3VTW A;  2AQ1 B;  3RZF A;  4E3C A;  3DBR I;  1WX9 A;  1PGB A;  3RZW C;  1XO3 A;  1WJ6 A;  2WXH A;  4LK0 M;  1M4V A;  3WAN A;  4XWT A;  1ZP0 B;  3JSV B;  4F1S A;  3KLS X;  4NAM A;  1FM0 D;  2M56 B;  5E6J A;  2LGD A;  2Z0E B;  2N7E A;  2MJ3 A;  4FN2 A;  4FUL A;  2D11 A;  2JVC A;  3QK0 A;  3Q8A A;  2KDM A;  4A3P A;  3GZN B;  2GMI C;  3SFD B;  3X0W A;  4DHJ B;  2LVQ A;  3GB1 A;  2BKR B;  5LXH A;  1FIQ A;  2YEP F;  2IO2 B;  2PVO D;  3KWL A;  3DWM A;  1G6J A;  1D6E C;  4YTN B;  1E7P B;  1PUT A;  3HK0 A;  4S17 A;  4M0W B;  2V0G A;  1R4N I;  1JQ4 A;  1IGD A;  3ABV B;  2KHW B;  2MQJ A;  1JW9 D;  2I1K A;  1IBX A;  4FAD A;  3P2B A;  1WGR A;  4YWG G;  2KWC A;  3MHZ A;  2C60 A;  4IWO A;  1EF5 A;  2LJ5 A;  4HEA 1;  4FJY A;  2DLB A;  2D07 B;  3JYU A;  4TSS A;  1V9J A;  2BWF A;  4LNO A;  2KFK B;  3Q8F A;  3RUI B;  3O13 A;  3VR8 B;  2VH2 A;  2MJE A;  2DZJ A;  1I4G A;  3B9J A;  4YTP B;  1N63 A;  1EO6 A;  2LFI A;  2KVZ A;  2BW2 A;  1FNW A;  2EKE C;  2BYE A;  2KX0 A;  2N1V A;  1MPE A;  1HZ5 A;  2W3R A;  4ZDV A;  1T5X D;  4RM8 A;  3A9J A;  2HDE A;  3EUB 2;  2KQS A;  1AN8 A;  1J0G A;  2QJL A;  1SE3 A;  4WWN A;  4J3O D;  1MVK A;  2JRI B;  2IY1 B;  3QA8 A;  4B0M A;  3A33 B;  4AP4 C;  2PVG C;  2JZP A;  3MC0 B;  2H88 B;  4PYU A;  3B1L X;  2PE6 B;  1OTR B;  2FNJ B;  2DNF A;  4RF0 A;  2N4F A;  3W9C B;  2OED A;  3M63 B;  2W3S A;  1TS2 A;  1WGD A;  4ITK A;  3W2D A;  3L4P A;  2BT6 A;  3RCZ A;  1WJN A;  2LGI A;  4LDT D;  1SIF A;  3AH7 A;  2KNB A;  1FCL A;  4RF1 A;  1JWS D;  3NZU A;  1PDX A;  1OEY J;  2INN E;  3KYD D;  4OVV A;  1U4A A;  2IO3 B;  1GUA B;  1QOA A;  1L6V A;  2QEJ C;  1HE8 A;  3PT2 B;  4GSW A;  2KDE B;  2RDB C;  3DBH B;  3KUD B;  3SEB A;  4MEL A;  3P4R B;  4A6Q A;  1HTQ A;  2QSD A;  1WH3 A;  1EWC A;  4JWS C;  1LXD A;  2PW9 A;  3Q3O C;  4RFB A;  3ZRC A;  3U7Z A;  1LQB A;  3PLV A;  1UUP A;  2JRH A;  1I4R A;  1GNU A;  1WSP A;  1F0Z A;  4NY0 A;  3GE3 C;  1WYW B;  1QZE A;  2XK5 B;  1C4P A;  1GAQ B;  1FEH A;  4KKJ A;  1TJE A;  3PPA A;  5E6O A;  2KXJ A;  4MSQ B;  3ZDT A;  2LRW A;  3P1M A;  4ANW A;  5I4D A;  3K9P B;  4BBN F;  5JHB A;  4BKS A;  4HJG E;  3VUW A;  4WIP A;  1KFY B;  3RN9 C;  1T0Q C;  1QQR A;  2JY6 A;  2KZR A;  4OVZ A;  4P1B C;  1XLO A;  3LYY A;  4WWP A;  2L3Z A;  5KHO A;  3PZ8 A;  2HJ8 A;  4GMV A;  3U4E G;  3ZTC A;  1QOG A;  2PE9 A;  3Q3F A;  3PZD A;  5CHW A;  3FKY A;  4LDT B;  2JSV X;  4WH4 A;  1YMH E;  2ZCC A;  1ZOY B;  2V3P A;  1UF0 A;  5HHD G;  1WXM A;  3ZVV A;  3ZW3 A;  4P6V F;  2ON8 A;  4MEM A;  5GXG B;  1TY2 A;  3PTF C;  1E7U A;  1NI3 A;  5MPO A;  2C7H A;  1HA5 A;  3PSE B;  1ZW7 A;  2KYW A;  3MFG A;  2IYD B;  2LUE A;  1UNS A;  3Q3M C;  4HCP B;  4ZRK A;  2IDY A;  2CU3 A;  1ZKH A;  3OAW A;  4XYC A;  4YTM B;  1WJU A;  4BZA A;  4ZYN A;  1X1M A;  3OJ3 A;  1D4B A;  1QF6 A;  1VJK A;  5DPT A;  3W5V B;  2V1Y A;  3H7S A;  1GJZ A;  1L2N A;  2I2Y A;  1J8C A;  1WXV A;  1RM6 C;  1C4C A;  2MBE A;  2UU7 A;  2PMV A;  1YQB A;  4B9K A;  1BML C;  1JWM D;  4MH0 E;  4EFO A;  3A9K B;  3X23 A;  2MLB A;  1AAR A;  2IGD A;  1RFA A;  2J7Q B;  2KOX A;  3BK1 A;  5T8I A;  4KV2 A;  2RPV A;  2WP9 B;  2C5L C;  4OZB A;  1HXY D;  2L1A A;  3PHX B;  2E6X A;  3MHS D;  2WXK A;  3ZQ4 A;  4E71 A;  2KD0 A;  3HIZ A;  1KRH A;  2AL6 A;  1SJH D;  1SF0 A;  3NOB A;  3EHV A;  5FK9 C;  1HTO A;  1SB3 C;  3QAR A;  1VRA B;  2WXL A;  2KJ6 A;  5TSS A;  3IG3 A;  2AEH A;  2M17 A;  5C23 A;  1AWD A;  1HQR D;  4MGZ E;  2NBW B;  2LI5 A;  5FR3 A;  2IO1 B;  3NUH B;  1I4X A;  1CMX B;  2WU2 B;  3CST A;  3EA6 A;  3CMM B;  4A55 A;  1VD2 A;  3L16 A;  3W5U B;  4IG7 B;  3VDZ A;  3SU8 X;  3QHT A;  2CHX A;  2A4Z A;  3PRP B;  1Q5W B;  1K52 A;  3AE4 B;  3GE8 C;  3CIR B;  2HE7 A;  3IVF A;  3R7Q A;  2VRR B;  4C00 A;  4A9A A;  1Z2M A;  4ICV A;  1ZPS A;  2JWU A;  2K39 A;  1LM8 B;  2N7D A;  4KIK B;  2JYE A;  4W9J A;  4MGK E;  5D7G A;  4AS1 A;  1TIF A;  4JGH B;  1JWB D;  4DXF A;  3V61 A;  2LEK A;  2V3N A;  4PS3 A;  3MJ5 A;  1C3T A;  2J0J A;  2XN9 C;  3SHQ A;  3BK2 A;  3J9C A;  3JSV A;  3I3T B;  4K3C A;  3PRE A;  3T3N A;  3N1Y C;  4DXG A;  3EGR A;  1L6U A;  3AEA B;  4IM3 A;  5TR5 A;  3V60 A;  3LB8 C;  4RM9 A;  1KF6 B;  2NTT A;  2N9P C;  4HVB A;  4N9F 4;  4NAW B;  5LLI A;  1LGR A;  4YT0 B;  3PRM B;  2A5U A;  3EC8 A;  3DWG C;  3VHT C;  1FRD A;  2KTR A;  2BS4 B;  1V5O A;  3ZNH B;  4ASW C;  3I57 A;  4YL8 A;  2WXG A;  2BBC A;  1D5Z C;  1UWM A;  4KVG B;  1WI0 A;  2G3Q B;  2NTS A;  1YOV B;  4IWP A;  2QC8 A;  4HWI B;  3KQ4 A;  5L95 C;  4RGN A;  1TBE A;  1J7A A;  3RNG C;  1V1P B;  2RDG A;  3PLU A;  2LD9 A;  2W55 A;  5IP4 D;  5CTR C;  4GB9 A;  1PQS A;  2BGF A;  3AN1 A;  4UDU C;  4GDL B;  3EFC A;  1CZP A;  4M8N A;  2HTH A;  2L52 A;  1WF9 A;  3QJZ A;  1TS5 A;  2KFK A;  3AU4 A;  1F77 A;  3UIO B;  1WZ0 A;  3TJP A;  1JRO A;  3VQI A;  3NZS A;  2AQ2 B;  2DYM A;  2X8X X;  2LVO A;  3V3X A;  3E9S A;  5IKC M;  3P4S B;  5LXI B;  3QWZ B;  4GXB A;  2M0A A;  1L0V B;  1V8C A;  2MBO A;  3A4S C;  4AJW A;  4C4V B;  4DWF A;  1Q0W B;  4B95 A;  1F9J A;  1ZDX A;  4FHK A;  3ZIM A;  3U30 A;  4RGM A;  3V6E B;  2WXM A;  2N9E B;  2W82 A;  2K25 A;  2KFJ A;  1ENF A;  4B6W A;  4YSY B;  2XBB C;  1JWU D;  2IJ0 A;  2WXJ A;  3ZJT A;  2GRI A;  2HJ1 A;  5C2T B;  3AUL A;  1Q1O A;  3RFZ B;  3L08 A;  1L0Y B;  3WCQ A;  2CKH B;  1Q10 A;  2ZNV B;  4KDI C;  2KJR A;  3NS8 A;  4II2 B;  1DYQ A;  2MWS B;  2WXF A;  3WAO A;  5BO4 B;  2NPT B;  4XX5 A;  1ACC A;  3NG0 A;  5EDS A;  2LGX A;  2KAC A;  2J0K A;  4EOY A;  2OJR A;  4HLE A;  3RNE C;  2GBJ A;  4KKI A;  4DXA B;  3R7R A;  2TSS A;  1TKY A;  4DHZ B;  4ZRI A;  1VR9 A;  4KZ0 A;  2QIL A;  4W9L A;  4B0E A;  1UH6 A;  2FCQ A;  2XEW A;  3MJW A;  3Q8E A;  2IY0 B;  1PYW D;  3SFE B;  4LNF A;  4I6L B;  4K1R B;  4E74 A;  5JXV A;  3HUI A;  1V97 A;  4AWJ A;  2PTL A;  2XNA C;  4FA6 A;  3ECI A;  1DOY A;  3DQV A;  3NZ3 A;  2MEK A;  4A20 A;  4HJK A;  1NEK B;  2O2V B;  1YN3 A;  1RLF A;  1WZ3 A;  4HDQ A;  1UZX B;  5HFY A;  1N6Z A;  2MJD A;  4TUU A;  1TKE A;  3V05 A;  2GI9 A;  3DHG C;  3FIL A;  3VXW A;  4WJN A;  3RI7 C;  1P1A A;  4MM3 A;  4RMA A;  2BB6 A;  1C77 A;  5CX3 A;  4L1B A;  1XLN A;  4LCD E;  1S1Q B;  5G5G A;  4WAF A;  2UYZ B;  5DPS A;  4KX6 B;  4KDL B;  2KMA A;  3R66 C;  4ICU A;  1WGH A;  2K8B A;  5D6J B;  1ZXI A;  1N5X A;  1E8Y A;  3R2T A;  2B3A A;  1IUE A;  3URY A;  1N61 A;  4AQ7 A;  2BS3 B;  2KO3 A;  2MBH A;  1FD6 A;  3NHE B;  3KVF B;  1XCQ L;  1E8W A;  1OGW A;  3L0W B;  4M02 A;  3TEX A;  2GOW A;  2N1W A;  5E6N A;  5EE1 A;  4K7W A;  1SEB D;  5IN7 A;  3ZLZ A;  4MJS B;  1JCK B;  3ZNG C;  3KYC D;  1MI0 A;  1WX8 A;  4N58 A;  2MP2 A;  1NI2 A;  2WXI A;  4G11 A;  1IGC A;  2KMM A;  4TKN A;  3VH4 B;  4AOF A;  4LNI A;  3V62 A;  3KW5 B;  2H89 B;  3AE3 B;  1GPX A;  1BT0 A;  4FBJ B;  1C1Y B;  2EEL A;  3CWI A;  3QAQ A;  4ACF A;  1F2R I;  3P4Q B;  3AXC A;  2JYT A;  4DBG A;  4WWO A;  2J0M A;  3SD5 A;  1CJE A;  1WE6 A;  2Y5C A;  2LUM A;  5C1Z A;  1XCT L;  3NRZ A;  2Y5P A;  1KLV A;  3AE7 B;  4W9I A;  2KQ7 A; 
#chains in the Genus database with same CATH homology
 1WX7 A;  2DX5 B;  3WIM A;  5DPT A;  2V1Y A;  3H7S A;  4HVB A;  1GG3 A;  2QHO A;  3ZUN A;  1GJZ A;  1I35 A;  2ZPY A;  1L2N A;  2ZJD A;  2MBB B;  1J8C A;  4HK2 A;  3AU5 A;  2KLG A;  1WXV A;  4HCN B;  4A3O A;  2MBE A;  3DVN U;  4BOZ B;  3ZKJ C;  1YQB A;  1H4R A;  3A1Q A;  3O65 B;  4B9K A;  2ZVO A;  2KTR B;  3IHP C;  3DVN V;  5DPW A;  4MH0 E;  4EFO A;  3A9K B;  2FAZ A;  3X23 A;  3ENE A;  2FIF A;  2LXC A;  5DPR A;  2MLB A;  3TBL D;  4NJ6 A;  1AAR A;  2KLC A;  3IFW B;  1RFA A;  2J7Q B;  2CU1 A;  2O2V A;  2KOX A;  2RD0 A;  1K8R B;  3H1U A;  1L7Y A;  2DZI A;  3TMP B;  1KJT A;  4KV2 A;  3L13 A;  2C5L C;  4BOS C;  1XQQ A;  2KDI A;  2BYF A;  1M94 A;  1WRD B;  3PHX B;  5GMV A;  4FHJ A;  4CO7 A;  4BKG A;  3BY4 B;  5DCN A;  3MHS D;  1EUV B;  3N32 A;  4DHJ D;  3SDL C;  5L83 A;  1A5R A;  4PS7 A;  3ZNZ B;  2KD0 A;  3HIZ A;  4E71 A;  1EF1 A;  3WA0 A;  2AL6 A;  2KDF B;  1NDD A;  1P98 A;  3UIP B;  2GBM A;  2CHW A;  2JT4 B;  2XK5 A;  3EHV A;  2DYO A;  3NOB A;  1UBQ A;  4JLC A;  1LFD A;  1YIW A;  5AZG A;  4II3 B;  5J18 A;  1E7V A;  1YX5 B;  1GC6 A;  1JRU A;  3VUY A;  3PV1 A;  3QAR A;  3APF A;  1V81 A;  4HPM B;  1P3Q U;  3ONS A;  3KUZ A;  2KWV B;  4HXD A;  2KC1 A;  2KJ6 A;  3KH0 A;  3GOE A;  3PVL A;  4FJZ A;  4XZ4 A;  3IG3 A;  2FCN A;  2AEH A;  2M17 A;  5C23 A;  1SE9 A;  2K6D B;  4TV3 A;  2GBR A;  4MGZ E;  2BYV E;  3QC8 B;  2NBW B;  2LI5 A;  3RYT A;  3V6C B;  2IO1 B;  2WX1 A;  2MA9 B;  3LJ3 A;  2FUH B;  2YVC A;  3H7P B;  1CMX B;  4P7I A;  3QIJ A;  3H7P A;  2KMC A;  2LWP A;  3CST A;  2NBU A;  4AUQ C;  2ZNV C;  3CMM B;  2I1J A;  2K8C A;  3U8Z A;  3GZN I;  1VD2 A;  3L16 A;  3UQB A;  4W9F A;  1NBF C;  4I6P A;  4IG7 B;  1V49 A;  3VDZ A;  5G55 A;  4URK A;  1E8Z A;  1H8C A;  2KN5 A;  3QHT A;  2JZZ A;  2DHZ A;  3SU8 X;  2CHX A;  2A4Z A;  3PRP B;  1Q5W B;  4DK5 A;  2ZCB A;  3R3M A;  4GN1 A;  2CR5 A;  3M62 B;  2HE7 A;  1TZ1 A;  2CS4 A;  3IVF A;  3R7Q A;  2VRR B;  1WMH A;  4MJS A;  1Z2M A;  2JF5 A;  1TGZ B;  2EMS A;  1WJ4 A;  2YLM A;  1UGM A;  1RRB A;  4ICV A;  4EEW A;  4FJV B;  3VUX A;  5G2N A;  2K39 A;  1LM8 B;  2L0T A;  3DPD A;  3HM3 A;  2LRU A;  3VTW A;  3RZF A;  2N7D A;  2MSE D;  4E3C A;  1MG8 A;  5D94 A;  2UWQ A;  2RR9 A;  1WXA A;  3DBR I;  1VCB A;  1WX9 A;  4KIK B;  1Y8R C;  5J2R A;  4W9J A;  4MGK E;  3S2A A;  5D7G A;  3RZW C;  4EZL A;  3PGE A;  3KUC B;  4PYZ A;  5JHA A;  1WJ6 A;  1S3S G;  4JGH B;  2K8H A;  3HHM A;  3V61 A;  3WAN A;  4I6N B;  4PS3 A;  4LJO B;  1C3T A;  2J0J A;  2G45 B;  2MBQ A;  3JSV B;  2PJH A;  3SHQ A;  4F1S A;  3OLM D;  3JSV A;  3I3T B;  1WGG A;  2NVU I;  3PRE A;  2V3S A;  1D3Z A;  2LGD A;  4WJQ A;  2Z0E B;  2N7E A;  4NJ7 A;  3UGB B;  2PEA A;  1V86 A;  2D2Q A;  2MCN B;  4FN2 A;  4FUL A;  4IM3 A;  4KZC A;  5TR5 A;  3V60 A;  2M4N A;  2Z0D B;  2D11 A;  4WAA A;  4RM9 A;  3RT3 B;  2JVC A;  3QK0 A;  3QCA A;  2N9P C;  1ISN A;  1TTN A;  4IUM B;  4JL9 A;  4N9F 4;  4K7S A;  4NAW B;  3PHW B;  4W9K A;  5LLI A;  4A3P A;  4EZJ A;  2KK8 A;  2GMI C;  4HPL B;  2G4D B;  3X0W A;  4DHJ B;  3PRM B;  2KJH B;  2A5U A;  2LVQ A;  4DDG D;  2BKR B;  3ML8 A;  3EC8 A;  5LXH A;  3N3K B;  2NCN A;  3VHT C;  2IO2 B;  2KTR A;  4X57 B;  1V5O A;  2DZK A;  2GBK A;  4YL8 A;  3DVG Y;  3ZNH B;  4ASW C;  4BKT A;  1G6J A;  2AL3 A;  3WAL A;  4GDK B;  3A9K A;  3AI5 A;  4PS8 A;  1IPG A;  1OEY A;  3HK0 A;  4GDK A;  4M0W B;  4KVG B;  1SGH A;  1WI0 A;  1R4N I;  2NS5 A;  3VTU A;  2DAJ A;  2KHW B;  2G3Q B;  2JWZ A;  2LZ6 A;  2LAS A;  3EEC A;  4IM0 A;  2MQJ A;  2I1K A;  4MGI E;  1P0R A;  2L7R A;  4FAD A;  1UD7 A;  4IWP A;  3P2B A;  1IP9 A;  1WGR A;  4HWI B;  1WY8 A;  5AEK B;  5L95 C;  2KWC A;  1TBE A;  4OVU A;  2ASQ A;  3PLU A;  2KTF A;  1V5T A;  2C60 A;  2LD9 A;  5CTR C;  4GB9 A;  2D10 A;  1PQS A;  4IWO A;  1EF5 A;  2LJ5 A;  4FJY A;  4GU2 A;  2BGF A;  4XC2 A;  2D07 B;  3JYU A;  4GDL B;  1V9J A;  2BWF A;  1WM2 A;  3CSF A;  4M8N A;  3ZO5 B;  1KOT A;  1V2Y A;  3HM6 X;  3U7D A;  2HTH A;  1WF9 A;  2KFK B;  2O6V D;  2WDT B;  3QJZ A;  3RUI B;  1P9D U;  2Z59 B;  2KFK A;  3L54 A;  3AU4 A;  1XT9 B;  2DZJ A;  3UIO B;  5AZF A;  1WZ0 A;  4NPN A;  2D3G A;  3TJP A;  3VQI A;  1EO6 A;  3DVG X;  2NBV B;  3NZS A;  2DYM A;  1WR6 E;  2BWE S;  2LVO A;  3LDZ E;  1XD3 B;  5AZH A;  2IO0 B;  3N30 A;  3PRZ A;  3DBL I;  5LXI B;  3QWZ B;  4GXB A;  1GC7 A;  2EKE C;  2BYE A;  2N9X A;  2MBO A;  2KX0 A;  3A4S C;  4CHK A;  2N1V A;  4AJW A;  1WXS A;  3A9J B;  2RPQ A;  3B08 A;  4ZDV A;  3EFU A;  4RM8 A;  2LGY A;  4WJP A;  3ZDM C;  3A9J A;  2ZEQ A;  4DWF A;  2JZ3 B;  2KQS A;  1Q0W B;  1J0G A;  4B95 A;  4ANX A;  1F9J A;  4FHK A;  3ZIM A;  1WM3 A;  3U30 A;  4G50 A;  4F7Z A;  3V6E B;  5JZE B;  3K9O B;  4WWN A;  3W1S C;  2FCS A;  3QX1 A;  1E5W A;  2N9E B;  2OOB B;  4MSM B;  2JRI B;  2K25 A;  2WX0 A;  5J17 A;  2KFJ A;  3QQ8 B;  2JPH A;  3DBH I;  3W1Y A;  4B6W A;  2IY1 B;  4EKU A;  3UF8 A;  3Q3J A;  3QA8 A;  2XBB C;  5HKH A;  1T0Y A;  3A33 B;  4BKS D;  4KIK A;  4AP4 C;  2L8J A;  4EZK A;  2HD5 B;  2WWZ A;  3CF6 E;  4W9D A;  2MP2 B;  1IYF A;  1OQY A;  4PYU A;  2RGF A;  3B1L X;  3AUL A;  2KDB A;  1Q1O A;  2PE6 B;  3L08 A;  2REX A;  2CKH B;  2MRP A;  1OTR B;  2FNJ B;  2W9N A;  3MTN B;  2N4F A;  2ZNV B;  4KDI C;  2KJR A;  2M1M A;  3M63 B;  3NS8 A;  4II2 B;  1WGD A;  3DDC B;  2KKC A;  1WFY A;  1R4M I;  2MWS B;  3WAO A;  5BO4 B;  5E6P A;  2NPT B;  4XX5 A;  4DHZ E;  3RCZ A;  2K1F A;  1WJN A;  2NPT A;  3B0A A;  4IC7 B;  4LDT D;  3RD2 A;  1SIF A;  2JXX A;  3WAM A;  2KNB A;  5KHQ A;  3ML9 A;  4G3X B;  3APC A;  1RAX A;  3T8M A;  4EUT A;  1J19 A;  5EDS A;  2LGX A;  1V6E A;  4M8M A;  4NAW A;  4CYE A;  2J0K A;  4EOY A;  3NZU A;  2C7M B;  2OJR A;  1OEY J;  3JVZ X;  1WIA A;  4HLE A;  3KYD D;  2DYB A;  2GBJ A;  2KWU B;  4KSL C;  4DXA B;  3R7R A;  2L05 A;  4W9H A;  1UEL A;  3VH3 B;  2FID A;  4OVV A;  1YX6 B;  4NNJ B;  1U4A A;  4DHZ B;  4ZRI A;  2MW5 A;  3BIN A;  3A4R A;  2IO3 B;  4KZ0 A;  4W9L A;  1UH6 A;  2FCQ A;  4KSK C;  2XEW A;  3MJW A;  1FXT B;  2BKF A;  2IY0 B;  1GUA B;  4IW0 A;  4ANV A;  3VFK A;  3PT2 B;  2NR2 A;  1HE8 A;  4GSW A;  4I6L B;  4K1R B;  2KDE B;  2O6V B;  3KUD B;  4E74 A;  4MEL A;  3A1Q B;  3L10 B;  4AWJ A;  4FLH A;  2O6V A;  4FA6 A;  3ECI A;  2KAN A;  1WH3 A;  3DQV A;  4GIV A;  3WAP A;  5FR6 A;  3ZNI D;  3UQA A;  4ZRJ A;  1LXD A;  2DZM A;  1WE7 A;  4A20 A;  3IBE A;  4HJK A;  2O2V B;  1RLF A;  1WZ3 A;  4BVU C;  4HDQ A;  4WQO B;  1I42 A;  1UBI A;  1UZX B;  5CHF A;  2FCM A;  3ZRC A;  3C0R B;  3TCA A;  2IBI B;  4IM2 A;  1LQB A;  3VTV A;  3PLV A;  1YD8 U;  4TUU A;  3RUL A;  4ANU A;  2JRH A;  3T9L A;  4IWQ A;  5CHV C;  1GNU A;  4GDL A;  4W9C A;  4NQL B;  4DDI D;  4NY0 A;  3VXW A;  2RSU A;  2MX2 A;  3NY5 A;  4WJN A;  1WR1 A;  2R2O A;  1WYW B;  4GGQ A;  1QZE A;  2XK5 B;  1P1A A;  3DOW A;  4MM3 A;  4RMA A;  1KM7 A;  3PPA A;  1ZGU B;  5CX3 A;  3JW0 X;  1E8X A;  5E6O A;  3VAW A;  2KXJ A;  3D32 A;  3OJ4 B;  3L17 A;  4MSQ B;  4LCD E;  2R2Q A;  4JQW C;  2LRW A;  3ZDT A;  3H6N A;  2KC2 A;  4LJP B;  1S1Q B;  3M95 A;  2EMT A;  4MDK E;  5D2M B;  3TIX A;  4ANW A;  2UYZ B;  4W9G A;  4GOC A;  3K9P B;  2BPS A;  5DPS A;  2L00 B;  4BBN F;  5JHB A;  4BKS A;  4KDL B;  4BBN C;  2KMA A;  3R66 C;  3VUW A;  2ZZP B;  4ICU A;  2C7N B;  1WGH A;  2K8B A;  3DBS A;  3UIN B;  4W9E A;  5D6J B;  1E8Y A;  5IAA C;  2B3A A;  2M8S A;  4TQ0 A;  2JY6 A;  2KZR A;  4K81 A;  1V80 A;  2K6Q A;  4HDO A;  4WWP A;  2KO3 A;  2L3Z A;  3TL5 A;  2MBH A;  5KHO A;  2WYQ A;  2HJ8 A;  4GMV A;  2KVR A;  3ZTC A;  4NQK E;  2PE9 A;  3KVF B;  3NHE B;  3H9D A;  1E8W A;  3Q3F A;  3PZD A;  4AJY B;  1OGW A;  5CHW A;  2AYO B;  2PPH A;  3L0W B;  4LDT B;  2DAF A;  2GOW A;  2CHZ A;  2JUO A;  2N1W A;  4F8C B;  5E6N A;  4K7W A;  1WMH B;  4WJO A;  2LVP A;  4MJS B;  4JIO U;  3ZLZ A;  2ZCC A;  3ZNG C;  2V4L A;  3KYC D;  1WX8 A;  2M0X A;  3ZRF A;  1WXM A;  4K7U A;  3ZVV A;  2KX3 A;  2BF8 B;  3ZW3 A;  2DEN B;  2MP2 A;  1NI2 A;  1YJ1 A;  4G11 A;  3APD A;  4MEM A;  3VH4 B;  4TKN A;  2LXA A;  4AOF A;  3V62 A;  1E90 A;  3PTF C;  3KW5 B;  1E7U A;  2G4S A;  2C7H A;  3PSE B;  1BT0 A;  1ZW7 A;  3DCG A;  5IA7 A;  4FBJ B;  3ALB A;  3PS6 A;  1C1Y B;  2IYD B;  2LUE A;  3QAQ A;  4HCP B;  4MGY E;  2GBN A;  4G0N B;  4ZRK A;  1Z5S B;  2Y5B B;  2IZV B;  3AXC A;  1ZKH A;  3OAW A;  2ZPN A;  4DBG A;  4WWO A;  2J0M A;  3VVW B;  3M3J A;  3SD5 A;  2AWT A;  5JH5 C;  1WE6 A;  3W1S A;  2L0F A;  2C9W B;  1WJU A;  5C1Z A;  4ZYN A;  4TQ1 A;  3ZTD A;  4J6I A;  1WGY A;  2ZVN A;  1X1M A;  1KLV A;  3OJ3 A;  2L76 A;  4BFR A;  4W9I A;  2KQ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...