3I57A

Type 2 repeat of the mucus binding protein mub from lactobacillus reuteri
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
184
structure length
184
Chain Sequence
MQKVHVQYIDGETDQMLRQDDLDGYTDETIPYSTAEGIKKFEGDGYELFKDNFPAGEKFDNDDTNDQFYTVIFKHHRENVDPNHSSADGTKGTKTLTETVHYKYANGTKAAEDQTAQVTFTRNGVLDDVTGIVAWGKWNEASQSYKALTSPTIAGYAPSEAVVKRSSNSDAEQGPTLTVIYTAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Mucus binding protein
publication title Crystal structure of a mucus binding protein repeat reveals an unexpected functional immunoglobulin binding activity.
pubmed doi rcsb
source organism Lactobacillus reuteri
total genus 43
structure length 184
sequence length 184
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17965 MucBP_2 Mucin binding domain
A PF17966 Mub_B2 Mub B2-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.460 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3i57A02
3.10.20.470 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3i57A01
3NZ3A 3LYYA 4MT5A 3I57A 3Q69A 2LFIA
chains in the Genus database with same CATH superfamily
3EFUA 3N20C 1WJ6A 2JXXA 3ZDTA 4PS8A 4ANXA 2IO3B 3GOEA 1YJIA 5DPSA 4OZAA 1FXTB 3L10B 4D2KA 2FCMA 2ZCBA 3AU4A 2NMQA 1H4RA 3BIID 2LUEA 4ZRQA 3ZJVA 2KYWA 1Z2MA 3JVZX 3HHMA 1D5ZC 2Y5PA 3DBHB 5E6NA 4FBJB 2WXGA 4US8A 2KLCA 3K9OB 2XN9C 2M8SA 5D3DA 1ZUD2 5FR6A 1LGRA 2LXCA 2N1VA 5BYRA 2PE9A 2O2VB 1FEHA 1C77A 3DWGC 2V3SA 1RLFA 2Z0DB 3ZXVA 2K8HA 3T8MA 2GMIC 2DBYA 2CU3A 1QOFA 4YTNB 3BK2A 1WIAA 2L1AA 3I5JC 3KVFB 4I6PA 3VUYA 2FAZA 2O6VB 4XWTA 4ACFA 3ABVB 1JWBD 4DWFA 3PHWB 2JZZA 3Q6BA 2WXOA 4NJ7A 1JRPA 5HFYA 3NUHB 1UGMA 1Z5SB 3QCAA 2Z0EB 3FAHA 3HUIA 2IO1B 5AZHA 4GN1A 4NQLB 2AYOB 1MFWA 1XEEA 1I4PA 1DOIA 2BKRB 4C4VA 3M3JA 2KK8A 1NVID 2KQ4X 2BT6A 1PYWD 3UQAA 2WU5B 2NPTB 4KX6B 1YN3A 1T0YA 2V1YA 3P1MA 4B6WA 1P3QU 3AEAB 4M0WB 4TKNA 2MP2A 4YL8A 3TEXA 1Q5WB 1DYQA 4IWPA 1SB3C 3ZXRA 1L6UA 4EFOA 5IP4D 2WXQA 4ASWC 4EKUA 1R4MB 1FO4A 2L52A 1P9DU 1ZE3D 2KWDA 3NZUA 2DYOA 3QX1A 1K8RB 2BGFA 1WXAA 4HXDA 1TY2A 5TSSA 2LZ6A 2BYEA 1WE6A 3AB5A 3A9JA 1PGAA 2LWPA 2YLMA 3U8ZA 1NI3A 2NPTA 4XZ4A 3ZIMA 3O65B 2ZPNA 2FIDA 4FJZA 5BMGA 1D4BA 2B76B 4DBGA 1N5WA 2DYBA 4LJOB 1WSPA 2LGSA 2KTFA 2G4SA 4JLCA 1JWMD 1AARA 3WIMA 2D10A 1BT0A 2KJRA 4W9GA 3A4RA 1WXQA 3U7DA 1UD7A 3PZDA 4K3BA 5D7GA 1QT9A 2IGHA 1MG4A 4IM2A 3MC0B 1UWMA 3N30A 3AEEB 3B08A 4AUQC 1MHHE 4GIVA 2M1MA 2KMCA 1WF9A 1NBFC 3FKYA 1TJEA 2N7EA 2KDFB 4IG7B 2HJ1A 3RN9C 2RD0A 5E6JA 4DXFA 2AEHA 2DX5B 4BAXA 3SDLC 4ZRPA 2MBHA 3MJWA 3KYCD 3VH3B 1OQQA 1E5WA 3GZNI 1WJ4A 3KH0A 3R66C 3L17A 5C3JB 2L0FA 2D3CA 5LNK1 4G50A 1E10A 2JZ3B 3MHZA 4W9LA 4JQWC 3DHIC 3TEYA 2GB1A 2OEDA 1N62A 1EU3A 3U2SC 1G6JA 2K22A 4HKZE 1E7PB 1V9JA 1HTOA 2L8JA 2ZW0A 4W9EA 3RT3B 3WAPA 3MJ5A 2W55A 3RYTA 2PW9A 4FADA 4OZCA 2JYTA 1ET9A 1ROEA 3TEZA 1WE7A 1WGGA 2UWQA 4LDTB 2OHFA 4G11A 1E0ZA 1STEA 2WXHA 5LXHA 1JW9D 2VZKB 2JRIB 2OJRA 5EE1A 2DLBA 2PEAA 3ZRFA 4REZA 1Q1OA 2PIAA 2LVQA 3MHSD 3ECIA 1V80A 4HPLB 5D3IB 1R7SA 1TKGA 2K5PA 2WXKA 4IDIA 1HQRD 4S17A 2DZMA 4DHZB 2KLGA 2NTSA 1L6VA 4RF0A 3IXSA 3NZ3A 3Q8EA 5LLIA 2MBQA 5HI1A 3E9SA 3CSFA 3Q8CA 2L83A 1UWXA 1P1AA 3PLVA 4XX5A 1VD2A 3NZSA 1OQRA 4IM0A 2MCNB 4KKJA 2V4LA 4HEA1 2PKOA 2GBRA 1QILA 2LJ5A 4OW0A 4BOSC 2KWVB 2LVOA 3R7RA 1A70A 2ACZB 1TS3A 2WDRB 3TMPB 3AE5B 1WX7A 2I1KA 1T0SC 1YD8U 2KQ7A 4XYCA 3NRZA 3OLMD 3U7ZA 3DBLB 2QIEB 3DOWA 5H8YE 4BKTA 1UGJA 2REXA 3P4PB 4URKA 2KQSA 1F1HA 3Q8BA 3PRMB 3ZVVA 2ZVOA 5HG2A 5HHDG 1VRAB 1XLPA 3AE2B 3NY5A 1VZ6A 3A33B 3H7SA 2ZVNA 4ZRKA 2MH7A 1WXSA 4JE3B 5CHVC 2LRWA 4KZCA 2BB6A 1BUIC 5AEKB 2KHWB 3TEWA 2JU6X 4K1RB 4ARIA 3AV8A 1FNUA 2HDEA 4TV3A 3VUXA 2JWUA 3L4PA 1L5PA 1DOXA 2D5GA 4ZHPA 2KTRA 2ZNVB 1EO6A 4M02A 2CJNA 2VZKD 1I7HA 3H6NA 2KVRA 4ZRIA 4KIKB 3U52E 3EC8A 3ML9A 3P2BA 3V6EB 4ZYNA 3ZDMC 4G3XB 3I3TB 1YJJA 4MGKE 2IJ0A 4QAYA 1J8CA 2KAJA 3PLUA 4O1NA 2MRPA 1LQBA 1RYJA 1M4VA 3Q3OC 2ICIA 3IT6B 4ICUA 3IAM1 4HDOA 1SIFA 4M00A 2V3PA 2A4ZA 2LEKA 1C4AA 1QKZA 2WDQB 1P7FA 3OJ3A 2J0MA 3HVZA 1R4NI 2LHDA 3R7QA 5JHAA 1WRIA 4GXBA 5G5GA 4A55A 2E6XA 3A9KA 3C19A 2WLBA 1JCKB 3N1YC 2GI9A 4IOIE 3TJPA 5G5HA 4KIKA 1K52A 2UU7A 4CO7A 3JSVA 4OZBA 4YTMB 1IBXA 4FA6A 4WWMA 4L1BA 2CU1A 3B0AA 3URYA 2D3BA 2QMTA 3SFEB 2SAKA 2CR5A 4NPNA 3DPDA 1D5XC 4YSYB 3ETRA 4X57B 2INCC 5D94A 1C4CA 3X0WA 2AX5A 4RM8A 5BMHA 1V1PA 2D07B 3UQBA 4MACA 4KDLB 1ZDVA 1T0RC 5BYSA 1NYQA 1SBBB 3BVMA 3NG0A 2IZVB 4ZOHC 1ISNA 4RNAA 1EWYC 3RD2A 3T9LA 1C78A 4S0RA 1MJDA 2KWCA 3NJTA 1WXMA 5KHQA 3ZGZA 4KGRA 2QDFA 3KUZA 4II3B 1NEKB 3FC4A 1V86A 4DHJD 4R3DA 4A9AA 2BS2B 3TL5A 4AOFA 2CS4A 3UF8A 4L23A 2HTHA 5JHBA 1VLBA 2QCZA 1HTQA 2M4NA 1X1MA 2KKCA 2WHIA 1J7AA 3U30A 3EFCA 4F7ZA 4GMVA 1N5XA 3GE3C 1VJKA 2HJ8A 2PLPA 3I57A 1ZKHA 5CHWA 1TS4A 1SJED 4K7UA 1F2RC 3CMMB 4YSZB 2HE7A 5IAAC 1SEBD 3R2IA 1XT9B 4ARCA 3WANA 2MJEA 1I4XA 3ZW3A 4FLHA 2LHEA 4C4VB 4WJPA 4WIPA 2CJOA 1XQQA 3OG5A 2ZNVC 3Q8FA 1QF6A 2C7HA 3KYDD 5C23A 2XBBC 1WMHB 2MP2B 3MP9A 4FXCA 4C7ZA 1J7BA 1YN4A 3ZTDA 1YX6B 4MGZE 1SE4A 2DNFA 3AULA 3WA0A 4IM3A 2DAJA 3AH7A 5BMIA 3AM9A 4ZDVA 1FCCC 2KX3A 2NTTA 5AZGA 1FM0D 4NQKE 3N1ZC 5JH5C 3VR8B 3V60A 3DVGY 4LNNA 3APDA 1NENB 3QJZA 3ZUNA 4WWOA 1I4GA 3GB1A 1WRDB 3A9JB 3PPAA 2FUHB 2L32A 3MFGA 4RGMA 4DXGA 3ZYYX 5DPWA 4W9DA 1XF5L 1WR6E 1KRHA 2NVUI 3L54A 2GBMA 1PDXA 3APFA 2GOWA 3EGRA 1CZPA 1TTNA 2FBWB 4M8NA 4YXDB 1T5XD 4A8XC 3PV1A 1WMHA 1ESFA 2HTME 2IDYA 4I6NB 1N63A 2KC2A 3GE8C 2L0TA 1WJUA 3BK1A 3S2AA 3BWUD 2NBWB 2MX2A 3PTFC 4JL9A 3QC8B 4LNFA 4FJVB 1OEYJ 3D32A 1RM6C 1AW7A 3KW5B 1CJEA 3RNEC 1S3SG 3L0WB 1MI0A 5J17A 4RM9A 4EZJA 1TS5A 1TBEA 1L0XB 1QZEA 3CIRB 1D6EC 2G45B 3UIOB 2NCNA 1UZXB 1ZGUB 2JPHA 3RNBC 4KV2A 3SR6A 2V0GA 3DBRB 2WS3B 1WGRA 2E3TA 2LASA 5C2TB 3HRDD 4KDIC 3LYYA 4HJKA 1JWSD 1E7VA 4AJWA 4XGAB 4TQ0A 2QC8A 4P1BC 3WCQA 1XCTL 1R4MI 2LGYA 3DCGA 2J4XA 4NJ6A 2I1JA 3V6CB 4C80A 3QK0A 2JF5A 3N32A 3KWLA 4US9A 2KD0A 2N9PC 1UH6A 1EU4A 1OTRB 1N61A 2YEPB 4IW0A 3PZ7A 2JX5A 2IY1B 3ZJUA 5G55A 2MEKA 1J7CA 4IWQA 5GMVA 2LUMA 4GDLA 4RFBA 3TBLD 2JXTA 3RUIB 2KFKB 4W9FA 1TKYA 3IFWB 3ZKJC 5I4DA 5E6OA 3RCZA 3JW0X 3P42A 3DVGX 5CX3A 3SU8X 2LI5A 3W1SA 4FULA 2MHJA 1AWDA 3HIZA 4F8CB 2X38A 4BZAA 1V5OA 3DQVA 1EF5A 4BKGA 1SF0A 2BS3B 2LFIA 4UDUC 2CHZA 1SSNA 4DDGD 1P0RA 2QILA 3ZQ4A 2FCQA 1RWSA 2INNE 3EECA 1UBQA 1FXIA 2WU2B 4GLSC 2BWES 2KO3A 2WNMA 3CWIA 4ITKA 4NAWA 3OWEB 2QEJC 3B1LX 3RNFC 1FD6A 4B9KA 1J0GA 2H88B 3SHQA 1FNVA 4HPPA 3HM6X 3K9PB 4HROA 1V6EA 3WALA 2WQYB 5J2RA 4PYUA 3TIXA 2KFKA 3IAS1 4P7IA 3AEDB 1ZP0B 2N7DA 3VHTC 1ZOYB 1KFYB 5H92C 4E3CA 4EZLA 4JWSC 5KHOA 4JPSA 5EE3A 2INDC 3P63A 2FIFA 4XDCA 2IY0B 2M0XA 3DBSA 5FR3A 2EMTA 3WAMA 4IKGA 2L00B 4KSLC 3PSEB 2GBJA 3AE3B 1C1YB 3DVNU 3LB8C 1WGDA 1TZ1A 4W9IA 2DZKA 3QAQA 2C60A 1BMLC 1Y8RC 1FPYA 1ZW7A 2C7NB 3P4QB 3V05A 1IUEA 4P16A 2DENB 2K9XA 2KJ6A 3Q3NC 4MH8A 1JROA 4CYEA 1JMLA 2WXIA 2K0PA 4RGOS 1V8CA 2ASQA 3VTWA 4WWNA 1Y56A 4EZKA 2DZIA 4Q2JA 2I38A 1D5MC 4GSWA 2C9WB 4MGIE 3L16A 2JRHA 3M63B 3CSTA 2J52A 2KMMA 2JY6A 4TQ1A 1WWTA 2N9KA 2NS5A 3ZJTA 2FE8A 4JIOU 4PYZA 2ZPYA 2LGDA 2W3SA 1Q0WB 3NHEB 1QOBA 1N6ZA 1E9MA 1JQ4A 2Y3AA 2KTRB 2BPSA 2PVGC 1SE2A 1C3TA 2PJHA 1MVKA 2JT4B 1VZ8A 2MJ3A 2RDGA 1L4DB 3AI5A 4EEWA 3AE9B 2IO2B 1FIQA 1TY0A 1CQVA 2W82A 1E8WA 2D11A 4G0NB 3J9CA 3QIJA 1XXGA 1ZDXA 1F52A 2IPKD 3ZNGC 3GP7A 4B0EA 1EM7A 3BYYB 4GGQA 1WGKA 2KC1A 3W2DA 5D6JB 4YSXB 2OOBB 1KOTA 1OGWA 3VH4B 4GU2A 4C56C 4NY0A 4A20A 3LDZE 2KXJA 3UGBB 1K53A 1V97A 3DHHC 4ANWA 3A9KB 3IT4B 1F9JA 3MC8A 1A5RA 1I4HA 4KGTA 4DHJB 1ZXIA 2N0SB 3BINA 4MH0E 3H8HA 3NVZA 1NI2A 4BKSD 3JSVB 2K1FA 3ZO5B 1IBXB 3E56A 1FCLA 1YQBA 2OJWA 4WJOA 1XLOA 2JUOA 4W9HA 4OVUA 1YMHE 1SGHA 3AE7B 2V4IB 3HVDA 3ZLZA 2D3GA 4MM3A 1BXTA 2FNJB 4AWJA 1TS2A 3VUWA 1F0ZA 4J6IA 5J18A 4OVZA 1J19A 1V1PB 3ENEA 4HK2A 1SJHD 3NVYA 2K8BA 3SD5A 3TUOA 1V49A 4LLGM 1YN5A 3ML8A 2DZJA 1SE9A 1WYWB 5IN7A 3AXCA 1E7UA 3N1XC 1KLUD 3DWMA 3AE8B 1EUVB 2JYEA 4GOCA 4IC7B 1D3ZA 3NVVA 1LFDA 2KX0A 3RNCC 3RMKC 2LJIA 2J7QB 2J42A 2MW5A 2MQJA 1KLGD 5FK9C 3W5VB 3DHGC 2M56B 4BVUC 1ENFA 3VXWA 2PPHA 2KVZA 2MJDA 2IBIB 2K3UA 1GUAB 1FRDA 1ZPSA 5BYQA 2V3NA 5AZFA 2AWTA 3PT2B 1V81A 1OQYA 4LCDE 3T3NA 3KLSX 4WWPA 2MBBB 3QWZB 1HZ6A 1XLQA 3AEGB 1MHXA 5DPTA 2N7JA 2RPVA 4WAAA 2WX1A 2Z59B 3HK0A 3QHTA 1P98A 3QA8A 4K7SA 1DGJA 3ZTCA 3ZNZB 3AU5A 4K81A 3IVFA 2L7RA 3TSSA 1TT5B 1WZ0A 3RI7C 3Q3JA 4WAFA 2BWFA 3CF6E 4GDKB 4RGNA 3T3OA 1GJZA 1L2NA 1WM3A 1I4QA 2KANA 4JWUC 3EHVA 4MEMA 1PGXA 3AE6B 1C9FA 1RAXA 3VTUA 4CHKA 2CHXA 3ONSA 1VR9A 3KQ4A 5EE9A 1OEYA 2TSSA 1IGCA 4N9F4 1VZ7A 5MPOA 2JQRB 3RZFA 1K51A 2AQ2B 4NAMA 3A1QB 1LM8B 1L0VB 1IGDA 3U4EG 4MGYE 1UF0A 4YT0B 5T8IA 4PK1A 3C0RB 1TIFA 4MT5A 4BBNC 3AEBB 2ZEQA 3FILB 4HRSA 1NDDA 2XEWA 2Y5BB 2AQ1B 4C00A 2J0JA 2AL3A 5JZEB 2ZCCA 1WY8A 4GDKA 2MA9B 2LRUA 1KH0A 1SE3A 1YQ3B 1FXAA 3PVLA 4B95A 4AJYB 3AE1B 4NZLB 1SXTA 3MTNB 1IPGA 4FHKA 4RCOA 2ZW1A 1KF6B 3AEFB 1L4ZB 2ZZPB 1NYRA 3PREA 2R2QA 3A1QA 1VCBA 1YOVB 3B9JA 2MWSB 1F77A 4TUUA 4BFRA 2Z8LA 1RRBA 1MG8A 2IGDA 2N4FA 1YQ4B 4W9KA 3DDCB 3VDZA 4WURA 3FILA 1PQSA 4AP4C 2WWZA 4DK5A 3RPFC 4I6LB 3C8YA 3DBHI 4K3CA 1YJ1A 4XE0A 4LK0M 2RGFA 4J3OD 2GBNA 2RDHA 1LO5D 3I63C 3AN1A 1P7EA 2N9EB 1SIJA 2EMSA 2R2OA 2J53A 1GOZA 1QOGA 3A4SC 3BVGA 2C5LC 2QSDA 2K6QA 1EWCA 3Q3FA 1WGHA 1UUPA 2K8CA 3VFKA 3UI3A 2BYTA 2WXLA 4MJSB 2KJHB 3EA6A 3H7PB 2O2VA 2WXJA 4P6VF 4ZRJA 2M17A 4YTPB 3PHXB 2BBCA 2G9HD 3PGEA 5E6PA 2BVCA 5GXGB 4NNJB 1KTKA 2WXPA 4LJPB 4N59A 1WX9A 2O6VA 1N60A 2BS4B 1WFYA 2C7MB 2GRIA 3KUCB 4GDLB 1XO3A 1CMXB 4PT5A 4ICVA 1TYGB 2MBEA 4EE2A 1WXVA 4JX1C 3APCA 4TSSA 1UBIA 1T6BX 4WJQA 5IKCM 5HKHA 2LVPA 2DYMA 1T3QA 2ON8A 3NVWA 1ET6A 2WDTB 2I2YA 1QQRA 1C79A 1FRRA 4M8MA 2CKHB 5EDSA 1RFAA 1XD3B 2G4DB 5AUIA 1AN8A 2FCNA 1WR1A 2RDBC 4MJSA 3KUDB 3H7PA 3ALBA 1GC6A 3WAOA 1ZXHA 3W9CB 4M0WA 2WYQA 2EKEC 4NAWB 3IHPC 2HD5B 2KN4A 1EF1A 2AQ3B 5TR5A 2Q5WD 2JWZA 1V5TA 4K7WA 4YWGG 1HA5A 3GZNB 2O6VD 1KLVA 4XDDA 3H9DA 3AMZA 4CQNA 2V9HA 2WXMA 3DVNV 4W9JA 4FJYA 3VVWB 3DBRI 2M19A 3Q3MC 1CK1A 3UINB 2WP9B 4LNOA 2WGSA 2QHOA 3EUB2 2KWUB 3V61A 5IA7A 2W54A 5D2MB 4BOZB 2WDVB 1KJTA 3V62A 2K6DB 2MSED 2N9XA 2SEBD 3Q14C 4F1SA 3AE4B 5IOIA 1RFKA 4NJCA 4WQMA 4ANUA 5L95C 1I4RA 4HPMB 3P4SB 1GB1A 1WGYA 4PS3A 1XLNA 3OJ4B 5FKAC 1IYFA 4IUMB 3ZNHB 1XCQL 2KZRA 3R8BA 4OVVA 2GLSA 2CHWA 1Q10A 2NBVB 4KVGB 5JXVA 4P1CC 4DDID 1WX8A 4TMAB 2KMAA 2MLBA 5CTRC 2D2QA 2L76A 3GS2A 4M01A 3PS6A 3X23A 3BYTB 2MBOA 2ZJDA 2RPQA 2G3QB 2PE6B 2YEPF 4ZYSA 2KFJA 1B1ZA 1UELA 2LGIA 3VAWA 4H2AA 1T0QC 3VR9B 3VQIA 1AYFA 3UIPB 1QLBB 2W9NA 4AS1A 1YIWA 3PRPB 1E8XA 4A90A 4RF1A 3O13A 2VRRB 2IYDB 1TKEA 1E8ZA 2PMVA 5IO9A 2BYFA 1FMAD 2EELA 3QARA 4IWOA 3NS8A 4KZ0A 3SFDB 4WH4A 2KDEB 1JALA 4A6QA 1I35A 1WZ3A 3ZNID 2BYVE 4RH6A 1V2YA 3QQ8B 4RGTA 3LXFA 3OAWA 4DQOC 2NR2A 2KOXA 1C4PA 4B0MA 4C7YA 1DOYA 1M94A 3VRBB 3NS1A 1TGZB 3BVZA 3W1SC 2J0KA 1IP9A 1GG3A 5AUKA 3VTVA 3N3KB 3M95A 4DHZE 2W3RA 2JVCA 3IBEA 1WJNA 2KACA 1GB4A 2QJLA 5LXIB 1PFDA 2LD9A 2AL6A 2FUG1 4BKSA 1E6EB 4KKIA 2DWQA 5CHFA 2BTEA 3JYUA 4ANVA 5L83A 3BY4B 3H1UA 1GPXA 2XK5B 2K25A 2A5UA 2LMCA 5DCNA 2LGXA 4MM3B 3HM3A 1GC7A 2B3AA 2KDIA 3R2TA 1QOAA 4W9CA 4HJGE 4HLEA 1VDVA 4HWIB 1I42A 1U4AA 4PS7A 1LXDA 2NBUA 3L08A 2N1WA 4WJNA 4A3PA 4WQOB 3RFZB 4KSKC 4HCNB 2BKFA 2KNBA 1H8CA 4USAA 2X8XX 3Q8AA 3LJ3A 3BZDB 1L7YA 2INPE 2EKIA 3DBLI 4HCPB 3B2GA 2L3ZA 4LDTD 1R4NB 1KM7A 2XK5A 4MSQB 4MELA 4II2B 1F2RI 1JWUD 2BQQA 1E8YA 1WI0A 4HVBA 2L05A 3L13A 3PZ8A 3M62B 4AQ7A 4XWWA 4MDKE 2K39A 2WXFA 2BW2A 2KDMA 2WX0A 2IGGA 2KT7A 2DAFA 4FN2A 2PVOD 4N6EB 2KDBA 2KN5A 4MSMB 1E90A 1HZ5A 1FNWA 2LXAA 2RSUA 2R61A 3W1YA 4LNKA 3R3MA 4BBNF 3Q2AC 4XC2A 5DPRA 4OHJA 2WXRA 4KGSA 5BO4B 4EUTA 2N9LA 3I9V1 1ACCA 4ZHOA 1WM2A 1HEZE 1TZOA 1PUTA 5EE0A 1JWAD 2GBKA 1HE8A 1K50A 1B9RA 4N58A 1YX5B 2UYZB 4RMAA 3ZRCA 3P4RB 5G2NA 4HKQA 3W5UB 1V1OA 2VH2A 3V3XA 1UNSA 2BB5A 1L0YB 2JSVX 3TCAA 3RZWC 4DXAB 1YNTE 3PO0A 3AECB 3RULA 4LNIA 2D3AA 4L2YA 1WH3A 3MC9A 2G1EA 2ONQA 4HDQA 4JGHB 2XNAC 2FCSA 2RR9A 4A3OA 2M0AA 4E71A 1FFVA 3B2FA 2Y5CA 4FHJA 1C76A 3RNAC 2BF8B 3KWVA 2H89B 1JRUA 1PGBA 4EOYA 3NOBA 1FFUA 2YVCA 2DHZA 3PRZA 2WXNA 1MPEA 1WYGA 3IG3A 3RNGC 2VH1A 3N9YC 4GB9A 5C1ZA 4LTUA 1GAQB 4E74A 3Q69A 2JZPA 1HXYD 1OFFA 1GNUA 2RMMA 2IO0B 2PTLA 1S1QB 3SEBA 3VRAB
chains in the Genus database with same CATH topology
4JX1C 4TSSA 4IKGA 1T6BX 3AE3B 3U52E 3LB8C 2DYMA 1T3QA 2ON8A 3NVWA 1ET6A 2I2YA 1YJIA 1QQRA 4OZAA 1C79A 1FRRA 1BMLC 1YJJA 3P4QB 2IJ0A 5AUIA 1AN8A 2KAJA 3V05A 4D2KA 1IUEA 4O1NA 2NMQA 4P16A 3BIID 1RYJA 4ZRQA 2K9XA 1M4VA 2ICIA 3ZJVA 3IT6B 1ZXHA 4MH8A 3W9CB 1JROA 1JMLA 2WXIA 3IAM1 2K0PA 4M0WA 4RGOS 1D5ZC 2Y5PA 1V8CA 4NAWB 2WXGA 4US8A 2V3PA 2LEKA 2XN9C 1C4AA 2KN4A 5D3DA 1Y56A 2AQ3B 1ZUD2 4Q2JA 2I38A 1D5MC 1QKZA 2Q5WD 2WDQB 1P7FA 5BYRA 3HVZA 1FEHA 2LHDA 1C77A 3DWGC 4YWGG 1HA5A 1WRIA 4XDDA 5G5GA 3AMZA 4CQNA 2WXMA 4A55A 2E6XA 2J52A 2KMMA 2DBYA 4TQ1A 2M19A 1WWTA 1CK1A 2N9KA 3ZJTA 2CU3A 2WLBA 1JCKB 1QOFA 2WP9B 2GI9A 2FE8A 4IOIE 4YTNB 5G5HA 3BK2A 1K52A 2L1AA 3EUB2 4XWTA 2W3SA 3ABVB 1JWBD 4OZBA 2W54A 4YTMB 2WDVB 1IBXA 4WWMA 1QOBA 4L1BA 2WXOA 1E9MA 1JQ4A 2Y3AA 5HFYA 1JRPA 3URYA 2QMTA 3NUHB 2SEBD 2SAKA 3SFEB 2PVGC 1SE2A 3AE4B 1RFKA 3FAHA 3HUIA 1D5XC 4YSYB 4NJCA 4WQMA 1MVKA 3ETRA 1I4RA 2MJ3A 1VZ8A 2RDGA 1L4DB 3P4SB 1GB1A 1C4CA 3AE9B 1XLNA 2AX5A 5BMHA 1XEEA 1I4PA 1V1PA 1DOIA 5FKAC 4MACA 1FIQA 1TY0A 1CQVA 1ZDVA 2W82A 1NVID 2KQ4X 5BYSA 1XCQL 2BT6A 1NYQA 1PYWD 1SBBB 3BVMA 3J9CA 1XXGA 2WU5B 4KX6B 1YN3A 3R8BA 4ZOHC 4RNAA 1ZDXA 1Q10A 2IPKD 3P1MA 3GP7A 1EWYC 1C78A 3AEAB 4B0EA 1EM7A 3BYYB 5JXVA 1WGKA 3ZGZA 4KGRA 3TEXA 4TMAB 3W2DA 1DYQA 4YSXB 1SB3C 1L6UA 1NEKB 3FC4A 3GS2A 4C56C 2WXQA 1K53A 1V97A 3BYTB 4R3DA 4A9AA 2BS2B 1FO4A 2L52A 4L23A 1ZE3D 2KWDA 1VLBA 2DYOA 2YEPF 4ZYSA 3IT4B 1B1ZA 1J7AA 1I4HA 4KGTA 2LGIA 1ZXIA 2N0SB 3H8HA 3NVZA 4H2AA 1TY2A 5TSSA 1N5XA 3VR9B 1VJKA 3AB5A 1IBXB 1PGAA 3VQIA 1AYFA 2PLPA 3E56A 1FCLA 3I57A 1QLBB 1TS4A 1SJED 4AS1A 1F2RC 1XLOA 4YSZB 4A90A 1NI3A 4RF1A 3O13A 1YMHE 1SEBD 3R2IA 1TKEA 3AE7B 2V4IB 3HVDA 2PMVA 4ARCA 1BXTA 2MJEA 1TS2A 1F0ZA 1I4XA 1FMAD 2EELA 2LHEA 4OVZA 3SFDB 1V1PB 5BMGA 1D4BA 4WH4A 1JALA 2B76B 1SJHD 3NVYA 1N5WA 4WIPA 1WSPA 2CJOA 4A6QA 3TUOA 4LLGM 4RH6A 1YN5A 4RGTA 1JWMD 3Q8FA 1QF6A 3LXFA 4DQOC 1C4PA 1KLUD 4B0MA 1WXQA 4C7YA 3MP9A 3DWMA 3VRBB 3NS1A 3AE8B 1DOYA 4FXCA 2JYEA 4C7ZA 1J7BA 1YN4A 3BVZA 3NVVA 1SE4A 5AUKA 3AH7A 5BMIA 2LJIA 5D7GA 2J42A 5FK9C 1KLGD 1QT9A 3W5VB 2IGHA 3AM9A 2M56B 1FCCC 2NTTA 1FM0D 3MC0B 1ENFA 1UWMA 2W3RA 3AEEB 3VR8B 2MJDA 2K3UA 2KACA 1GB4A 1MHHE 2QJLA 1NENB 1PFDA 1FRDA 1ZPSA 2FUG1 5BYQA 2V3NA 1E6EB 1I4GA 4KKIA 3GB1A 2DWQA 2BTEA 1TJEA 3T3NA 3KLSX 2L32A 3MFGA 1HZ6A 1XLQA 4RGMA 4DXGA 3ZYYX 1GPXA 3AEGB 5E6JA 1MHXA 1XF5L 4DXFA 2N7JA 1KRHA 2RPVA 2LMCA 1PDXA 3EGRA 4MM3B 4ZRPA 1OQQA 1CZPA 2FBWB 4YXDB 1T5XD 4A8XC 3R2TA 1QOAA 4HJGE 1DGJA 1VDVA 1ESFA 3TSSA 2HTME 2IDYA 4WAFA 5C3JB 1N63A 4GDKB 5LNK1 4RGNA 3T3OA 3BK1A 1E10A 3BWUD 1I4QA 3MHZA 3RFZB 4JWUC 1PGXA 3AE6B 1C9FA 3TEYA 1RM6C 1AW7A 1CJEA 1VR9A 2GB1A 3KQ4A 5EE9A 2TSSA 2OEDA 1IGCA 1N62A 4USAA 1EU3A 1VZ7A 5MPOA 1MI0A 3Q8AA 2JQRB 3U2SC 1K51A 2K22A 2AQ2B 4HKZE 4NAMA 3BZDB 1E7PB 1TS5A 2INPE 2EKIA 1L0XB 1L0VB 2ZW0A 1IGDA 3CIRB 3B2GA 3U4EG 1D6EC 4YT0B 3MJ5A 5T8IA 2W55A 4MT5A 2PW9A 1F2RI 4OZCA 1JWUD 2JYTA 3AEBB 3FILB 1ET9A 1ROEA 4HRSA 3SR6A 2V0GA 2WS3B 3TEZA 2AQ1B 2E3TA 5C2TB 2OHFA 1E0ZA 1STEA 3HRDD 2WXHA 3PZ8A 1JW9D 3LYYA 2VZKB 1JWSD 4AQ7A 4XWWA 5EE1A 2DLBA 4TQ0A 2WXFA 4REZA 2PIAA 2BW2A 2KDMA 3WCQA 2IGGA 1XCTL 1KH0A 1SE3A 1YQ3B 5D3IB 1FXAA 2J4XA 1R7SA 1TKGA 2K5PA 2WXKA 2PVOD 4N6EB 4IDIA 3AE1B 4C80A 1HQRD 1HZ5A 1FNWA 4NZLB 1SXTA 2R61A 3KWLA 4US9A 2NTSA 1EU4A 1L6VA 4RF0A 4RCOA 2ZW1A 1N61A 3IXSA 1KF6B 2YEPB 3AEFB 1L4ZB 3PZ7A 1NYRA 4OHJA 2JX5A 3NZ3A 3Q8EA 2WXRA 4KGSA 2N9LA 3I9V1 3ZJUA 3B9JA 5HI1A 1ACCA 3E9SA 2MEKA 1F77A 4ZHOA 1J7CA 2LUMA 2L83A 1UWXA 3Q8CA 2Z8LA 4RFBA 2JXTA 1HEZE 1TZOA 1PUTA 2IGDA 5EE0A 1JWAD 1OQRA 1YQ4B 1K50A 1B9RA 1TKYA 4N58A 4WURA 3FILA 4KKJA 5I4DA 4HEA1 2PKOA 3P42A 3P4RB 4HKQA 1QILA 3W5UB 1V1OA 4OW0A 3RPFC 3C8YA 3W1SA 3V3XA 1UNSA 1A70A 1AWDA 2ACZB 1TS3A 2BB5A 2WDRB 1L0YB 2JSVX 3AE5B 4XE0A 2X38A 4LK0M 1YNTE 3PO0A 4J3OD 3AECB 2RDHA 1LO5D 3AN1A 1P7EA 1SF0A 2BS3B 1SIJA 4L2YA 2LFIA 2J53A 4UDUC 1SSNA 1GOZA 1QOGA 3BVGA 2G1EA 2ONQA 2QILA 3NRZA 3ZQ4A 3U7ZA 2XNAC 1RWSA 2INNE 2QIEB 2QSDA 1FXIA 1EWCA 2WU2B 4GLSC 5H8YE 1UGJA 2WNMA 3CWIA 4ITKA 1UUPA 3P4PB 3OWEB 2M0AA 2QEJC 3UI3A 2BYTA 1FFVA 2WXLA 3B2FA 2Y5CA 3Q8BA 3EA6A 1C76A 5HG2A 5HHDG 1VRAB 3KWVA 1FD6A 2H89B 2WXJA 1XLPA 2H88B 3AE2B 1VZ6A 4P6VF 1FNVA 1PGBA 4HROA 4YTPB 2BBCA 2G9HD 2WQYB 2MH7A 1FFUA 3IAS1 2WXNA 3AEDB 1ZP0B 4JE3B 2BB6A 1BUIC 5GXGB 3TEWA 1MPEA 2JU6X 1KTKA 1WYGA 1ZOYB 1KFYB 5H92C 4ARIA 2WXPA 3AV8A 4N59A 1FNUA 4JWSC 2HDEA 4JPSA 5EE3A 1N60A 2JWUA 3L4PA 3P63A 1L5PA 3N9YC 4XDCA 2BS4B 4LTUA 2GRIA 1GAQB 4GDLB 2D5GA 1DOXA 3Q69A 1XO3A 2JZPA 1HXYD 4ZHPA 1OFFA 4PT5A 1TYGB 2CJNA 2RMMA 1I7HA 2PTLA 2VZKD 3SEBA 5FR3A 3VRAB 4EE2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NZ3 A;  3LYY A;  4MT5 A;  3I57 A;  3Q69 A;  2LFI A; 
#chains in the Genus database with same CATH topology
 3EFU A;  3N20 C;  1WJ6 A;  2JXX A;  3ZDT A;  4PS8 A;  4ANX A;  2IO3 B;  3GOE A;  1YJI A;  5DPS A;  4OZA A;  1FXT B;  3L10 B;  4D2K A;  2FCM A;  2ZCB A;  3AU4 A;  2NMQ A;  1H4R A;  3BII D;  2LUE A;  4ZRQ A;  3ZJV A;  2KYW A;  1Z2M A;  3JVZ X;  3HHM A;  1D5Z C;  2Y5P A;  3DBH B;  5E6N A;  4FBJ B;  2WXG A;  4US8 A;  2KLC A;  3K9O B;  2XN9 C;  2M8S A;  5D3D A;  1ZUD 2;  5FR6 A;  1LGR A;  2LXC A;  2N1V A;  5BYR A;  2PE9 A;  2O2V B;  1FEH A;  1C77 A;  3DWG C;  2V3S A;  1RLF A;  2Z0D B;  3ZXV A;  2K8H A;  3T8M A;  2GMI C;  2DBY A;  2CU3 A;  1QOF A;  4YTN B;  3BK2 A;  1WIA A;  2L1A A;  3I5J C;  3KVF B;  4I6P A;  3VUY A;  2FAZ A;  2O6V B;  4XWT A;  4ACF A;  3ABV B;  1JWB D;  4DWF A;  3PHW B;  2JZZ A;  3Q6B A;  2WXO A;  4NJ7 A;  1JRP A;  5HFY A;  3NUH B;  1UGM A;  1Z5S B;  3QCA A;  2Z0E B;  3FAH A;  3HUI A;  2IO1 B;  5AZH A;  4GN1 A;  4NQL B;  2AYO B;  1MFW A;  1XEE A;  1I4P A;  1DOI A;  2BKR B;  4C4V A;  3M3J A;  2KK8 A;  1NVI D;  2KQ4 X;  2BT6 A;  1PYW D;  3UQA A;  2WU5 B;  2NPT B;  4KX6 B;  1YN3 A;  1T0Y A;  2V1Y A;  3P1M A;  4B6W A;  1P3Q U;  3AEA B;  4M0W B;  4TKN A;  2MP2 A;  4YL8 A;  3TEX A;  1Q5W B;  1DYQ A;  4IWP A;  1SB3 C;  3ZXR A;  1L6U A;  4EFO A;  5IP4 D;  2WXQ A;  4ASW C;  4EKU A;  1R4M B;  1FO4 A;  2L52 A;  1P9D U;  1ZE3 D;  2KWD A;  3NZU A;  2DYO A;  3QX1 A;  1K8R B;  2BGF A;  1WXA A;  4HXD A;  1TY2 A;  5TSS A;  2LZ6 A;  2BYE A;  1WE6 A;  3AB5 A;  3A9J A;  1PGA A;  2LWP A;  2YLM A;  3U8Z A;  1NI3 A;  2NPT A;  4XZ4 A;  3ZIM A;  3O65 B;  2ZPN A;  2FID A;  4FJZ A;  5BMG A;  1D4B A;  2B76 B;  4DBG A;  1N5W A;  2DYB A;  4LJO B;  1WSP A;  2LGS A;  2KTF A;  2G4S A;  4JLC A;  1JWM D;  1AAR A;  3WIM A;  2D10 A;  1BT0 A;  2KJR A;  4W9G A;  3A4R A;  1WXQ A;  3U7D A;  1UD7 A;  3PZD A;  4K3B A;  5D7G A;  1QT9 A;  2IGH A;  1MG4 A;  4IM2 A;  3MC0 B;  1UWM A;  3N30 A;  3AEE B;  3B08 A;  4AUQ C;  1MHH E;  4GIV A;  2M1M A;  2KMC A;  1WF9 A;  1NBF C;  3FKY A;  1TJE A;  2N7E A;  2KDF B;  4IG7 B;  2HJ1 A;  3RN9 C;  2RD0 A;  5E6J A;  4DXF A;  2AEH A;  2DX5 B;  4BAX A;  3SDL C;  4ZRP A;  2MBH A;  3MJW A;  3KYC D;  3VH3 B;  1OQQ A;  1E5W A;  3GZN I;  1WJ4 A;  3KH0 A;  3R66 C;  3L17 A;  5C3J B;  2L0F A;  2D3C A;  5LNK 1;  4G50 A;  1E10 A;  2JZ3 B;  3MHZ A;  4W9L A;  4JQW C;  3DHI C;  3TEY A;  2GB1 A;  2OED A;  1N62 A;  1EU3 A;  3U2S C;  1G6J A;  2K22 A;  4HKZ E;  1E7P B;  1V9J A;  1HTO A;  2L8J A;  2ZW0 A;  4W9E A;  3RT3 B;  3WAP A;  3MJ5 A;  2W55 A;  3RYT A;  2PW9 A;  4FAD A;  4OZC A;  2JYT A;  1ET9 A;  1ROE A;  3TEZ A;  1WE7 A;  1WGG A;  2UWQ A;  4LDT B;  2OHF A;  4G11 A;  1E0Z A;  1STE A;  2WXH A;  5LXH A;  1JW9 D;  2VZK B;  2JRI B;  2OJR A;  5EE1 A;  2DLB A;  2PEA A;  3ZRF A;  4REZ A;  1Q1O A;  2PIA A;  2LVQ A;  3MHS D;  3ECI A;  1V80 A;  4HPL B;  5D3I B;  1R7S A;  1TKG A;  2K5P A;  2WXK A;  4IDI A;  1HQR D;  4S17 A;  2DZM A;  4DHZ B;  2KLG A;  2NTS A;  1L6V A;  4RF0 A;  3IXS A;  3NZ3 A;  3Q8E A;  5LLI A;  2MBQ A;  5HI1 A;  3E9S A;  3CSF A;  3Q8C A;  2L83 A;  1UWX A;  1P1A A;  3PLV A;  4XX5 A;  1VD2 A;  3NZS A;  1OQR A;  4IM0 A;  2MCN B;  4KKJ A;  2V4L A;  4HEA 1;  2PKO A;  2GBR A;  1QIL A;  2LJ5 A;  4OW0 A;  4BOS C;  2KWV B;  2LVO A;  3R7R A;  1A70 A;  2ACZ B;  1TS3 A;  2WDR B;  3TMP B;  3AE5 B;  1WX7 A;  2I1K A;  1T0S C;  1YD8 U;  2KQ7 A;  4XYC A;  3NRZ A;  3OLM D;  3U7Z A;  3DBL B;  2QIE B;  3DOW A;  5H8Y E;  4BKT A;  1UGJ A;  2REX A;  3P4P B;  4URK A;  2KQS A;  1F1H A;  3Q8B A;  3PRM B;  3ZVV A;  2ZVO A;  5HG2 A;  5HHD G;  1VRA B;  1XLP A;  3AE2 B;  3NY5 A;  1VZ6 A;  3A33 B;  3H7S A;  2ZVN A;  4ZRK A;  2MH7 A;  1WXS A;  4JE3 B;  5CHV C;  2LRW A;  4KZC A;  2BB6 A;  1BUI C;  5AEK B;  2KHW B;  3TEW A;  2JU6 X;  4K1R B;  4ARI A;  3AV8 A;  1FNU A;  2HDE A;  4TV3 A;  3VUX A;  2JWU A;  3L4P A;  1L5P A;  1DOX A;  2D5G A;  4ZHP A;  2KTR A;  2ZNV B;  1EO6 A;  4M02 A;  2CJN A;  2VZK D;  1I7H A;  3H6N A;  2KVR A;  4ZRI A;  4KIK B;  3U52 E;  3EC8 A;  3ML9 A;  3P2B A;  3V6E B;  4ZYN A;  3ZDM C;  4G3X B;  3I3T B;  1YJJ A;  4MGK E;  2IJ0 A;  4QAY A;  1J8C A;  2KAJ A;  3PLU A;  4O1N A;  2MRP A;  1LQB A;  1RYJ A;  1M4V A;  3Q3O C;  2ICI A;  3IT6 B;  4ICU A;  3IAM 1;  4HDO A;  1SIF A;  4M00 A;  2V3P A;  2A4Z A;  2LEK A;  1C4A A;  1QKZ A;  2WDQ B;  1P7F A;  3OJ3 A;  2J0M A;  3HVZ A;  1R4N I;  2LHD A;  3R7Q A;  5JHA A;  1WRI A;  4GXB A;  5G5G A;  4A55 A;  2E6X A;  3A9K A;  3C19 A;  2WLB A;  1JCK B;  3N1Y C;  2GI9 A;  4IOI E;  3TJP A;  5G5H A;  4KIK A;  1K52 A;  2UU7 A;  4CO7 A;  3JSV A;  4OZB A;  4YTM B;  1IBX A;  4FA6 A;  4WWM A;  4L1B A;  2CU1 A;  3B0A A;  3URY A;  2D3B A;  2QMT A;  3SFE B;  2SAK A;  2CR5 A;  4NPN A;  3DPD A;  1D5X C;  4YSY B;  3ETR A;  4X57 B;  2INC C;  5D94 A;  1C4C A;  3X0W A;  2AX5 A;  4RM8 A;  5BMH A;  1V1P A;  2D07 B;  3UQB A;  4MAC A;  4KDL B;  1ZDV A;  1T0R C;  5BYS A;  1NYQ A;  1SBB B;  3BVM A;  3NG0 A;  2IZV B;  4ZOH C;  1ISN A;  4RNA A;  1EWY C;  3RD2 A;  3T9L A;  1C78 A;  4S0R A;  1MJD A;  2KWC A;  3NJT A;  1WXM A;  5KHQ A;  3ZGZ A;  4KGR A;  2QDF A;  3KUZ A;  4II3 B;  1NEK B;  3FC4 A;  1V86 A;  4DHJ D;  4R3D A;  4A9A A;  2BS2 B;  3TL5 A;  4AOF A;  2CS4 A;  3UF8 A;  4L23 A;  2HTH A;  5JHB A;  1VLB A;  2QCZ A;  1HTQ A;  2M4N A;  1X1M A;  2KKC A;  2WHI A;  1J7A A;  3U30 A;  3EFC A;  4F7Z A;  4GMV A;  1N5X A;  3GE3 C;  1VJK A;  2HJ8 A;  2PLP A;  3I57 A;  1ZKH A;  5CHW A;  1TS4 A;  1SJE D;  4K7U A;  1F2R C;  3CMM B;  4YSZ B;  2HE7 A;  5IAA C;  1SEB D;  3R2I A;  1XT9 B;  4ARC A;  3WAN A;  2MJE A;  1I4X A;  3ZW3 A;  4FLH A;  2LHE A;  4C4V B;  4WJP A;  4WIP A;  2CJO A;  1XQQ A;  3OG5 A;  2ZNV C;  3Q8F A;  1QF6 A;  2C7H A;  3KYD D;  5C23 A;  2XBB C;  1WMH B;  2MP2 B;  3MP9 A;  4FXC A;  4C7Z A;  1J7B A;  1YN4 A;  3ZTD A;  1YX6 B;  4MGZ E;  1SE4 A;  2DNF A;  3AUL A;  3WA0 A;  4IM3 A;  2DAJ A;  3AH7 A;  5BMI A;  3AM9 A;  4ZDV A;  1FCC C;  2KX3 A;  2NTT A;  5AZG A;  1FM0 D;  4NQK E;  3N1Z C;  5JH5 C;  3VR8 B;  3V60 A;  3DVG Y;  4LNN A;  3APD A;  1NEN B;  3QJZ A;  3ZUN A;  4WWO A;  1I4G A;  3GB1 A;  1WRD B;  3A9J B;  3PPA A;  2FUH B;  2L32 A;  3MFG A;  4RGM A;  4DXG A;  3ZYY X;  5DPW A;  4W9D A;  1XF5 L;  1WR6 E;  1KRH A;  2NVU I;  3L54 A;  2GBM A;  1PDX A;  3APF A;  2GOW A;  3EGR A;  1CZP A;  1TTN A;  2FBW B;  4M8N A;  4YXD B;  1T5X D;  4A8X C;  3PV1 A;  1WMH A;  1ESF A;  2HTM E;  2IDY A;  4I6N B;  1N63 A;  2KC2 A;  3GE8 C;  2L0T A;  1WJU A;  3BK1 A;  3S2A A;  3BWU D;  2NBW B;  2MX2 A;  3PTF C;  4JL9 A;  3QC8 B;  4LNF A;  4FJV B;  1OEY J;  3D32 A;  1RM6 C;  1AW7 A;  3KW5 B;  1CJE A;  3RNE C;  1S3S G;  3L0W B;  1MI0 A;  5J17 A;  4RM9 A;  4EZJ A;  1TS5 A;  1TBE A;  1L0X B;  1QZE A;  3CIR B;  1D6E C;  2G45 B;  3UIO B;  2NCN A;  1UZX B;  1ZGU B;  2JPH A;  3RNB C;  4KV2 A;  3SR6 A;  2V0G A;  3DBR B;  2WS3 B;  1WGR A;  2E3T A;  2LAS A;  5C2T B;  3HRD D;  4KDI C;  3LYY A;  4HJK A;  1JWS D;  1E7V A;  4AJW A;  4XGA B;  4TQ0 A;  2QC8 A;  4P1B C;  3WCQ A;  1XCT L;  1R4M I;  2LGY A;  3DCG A;  2J4X A;  4NJ6 A;  2I1J A;  3V6C B;  4C80 A;  3QK0 A;  2JF5 A;  3N32 A;  3KWL A;  4US9 A;  2KD0 A;  2N9P C;  1UH6 A;  1EU4 A;  1OTR B;  1N61 A;  2YEP B;  4IW0 A;  3PZ7 A;  2JX5 A;  2IY1 B;  3ZJU A;  5G55 A;  2MEK A;  1J7C A;  4IWQ A;  5GMV A;  2LUM A;  4GDL A;  4RFB A;  3TBL D;  2JXT A;  3RUI B;  2KFK B;  4W9F A;  1TKY A;  3IFW B;  3ZKJ C;  5I4D A;  5E6O A;  3RCZ A;  3JW0 X;  3P42 A;  3DVG X;  5CX3 A;  3SU8 X;  2LI5 A;  3W1S A;  4FUL A;  2MHJ A;  1AWD A;  3HIZ A;  4F8C B;  2X38 A;  4BZA A;  1V5O A;  3DQV A;  1EF5 A;  4BKG A;  1SF0 A;  2BS3 B;  2LFI A;  4UDU C;  2CHZ A;  1SSN A;  4DDG D;  1P0R A;  2QIL A;  3ZQ4 A;  2FCQ A;  1RWS A;  2INN E;  3EEC A;  1UBQ A;  1FXI A;  2WU2 B;  4GLS C;  2BWE S;  2KO3 A;  2WNM A;  3CWI A;  4ITK A;  4NAW A;  3OWE B;  2QEJ C;  3B1L X;  3RNF C;  1FD6 A;  4B9K A;  1J0G A;  2H88 B;  3SHQ A;  1FNV A;  4HPP A;  3HM6 X;  3K9P B;  4HRO A;  1V6E A;  3WAL A;  2WQY B;  5J2R A;  4PYU A;  3TIX A;  2KFK A;  3IAS 1;  4P7I A;  3AED B;  1ZP0 B;  2N7D A;  3VHT C;  1ZOY B;  1KFY B;  5H92 C;  4E3C A;  4EZL A;  4JWS C;  5KHO A;  4JPS A;  5EE3 A;  2IND C;  3P63 A;  2FIF A;  4XDC A;  2IY0 B;  2M0X A;  3DBS A;  5FR3 A;  2EMT A;  3WAM A;  4IKG A;  2L00 B;  4KSL C;  3PSE B;  2GBJ A;  3AE3 B;  1C1Y B;  3DVN U;  3LB8 C;  1WGD A;  1TZ1 A;  4W9I A;  2DZK A;  3QAQ A;  2C60 A;  1BML C;  1Y8R C;  1FPY A;  1ZW7 A;  2C7N B;  3P4Q B;  3V05 A;  1IUE A;  4P16 A;  2DEN B;  2K9X A;  2KJ6 A;  3Q3N C;  4MH8 A;  1JRO A;  4CYE A;  1JML A;  2WXI A;  2K0P A;  4RGO S;  1V8C A;  2ASQ A;  3VTW A;  4WWN A;  1Y56 A;  4EZK A;  2DZI A;  4Q2J A;  2I38 A;  1D5M C;  4GSW A;  2C9W B;  4MGI E;  3L16 A;  2JRH A;  3M63 B;  3CST A;  2J52 A;  2KMM A;  2JY6 A;  4TQ1 A;  1WWT A;  2N9K A;  2NS5 A;  3ZJT A;  2FE8 A;  4JIO U;  4PYZ A;  2ZPY A;  2LGD A;  2W3S A;  1Q0W B;  3NHE B;  1QOB A;  1N6Z A;  1E9M A;  1JQ4 A;  2Y3A A;  2KTR B;  2BPS A;  2PVG C;  1SE2 A;  1C3T A;  2PJH A;  1MVK A;  2JT4 B;  1VZ8 A;  2MJ3 A;  2RDG A;  1L4D B;  3AI5 A;  4EEW A;  3AE9 B;  2IO2 B;  1FIQ A;  1TY0 A;  1CQV A;  2W82 A;  1E8W A;  2D11 A;  4G0N B;  3J9C A;  3QIJ A;  1XXG A;  1ZDX A;  1F52 A;  2IPK D;  3ZNG C;  3GP7 A;  4B0E A;  1EM7 A;  3BYY B;  4GGQ A;  1WGK A;  2KC1 A;  3W2D A;  5D6J B;  4YSX B;  2OOB B;  1KOT A;  1OGW A;  3VH4 B;  4GU2 A;  4C56 C;  4NY0 A;  4A20 A;  3LDZ E;  2KXJ A;  3UGB B;  1K53 A;  1V97 A;  3DHH C;  4ANW A;  3A9K B;  3IT4 B;  1F9J A;  3MC8 A;  1A5R A;  1I4H A;  4KGT A;  4DHJ B;  1ZXI A;  2N0S B;  3BIN A;  4MH0 E;  3H8H A;  3NVZ A;  1NI2 A;  4BKS D;  3JSV B;  2K1F A;  3ZO5 B;  1IBX B;  3E56 A;  1FCL A;  1YQB A;  2OJW A;  4WJO A;  1XLO A;  2JUO A;  4W9H A;  4OVU A;  1YMH E;  1SGH A;  3AE7 B;  2V4I B;  3HVD A;  3ZLZ A;  2D3G A;  4MM3 A;  1BXT A;  2FNJ B;  4AWJ A;  1TS2 A;  3VUW A;  1F0Z A;  4J6I A;  5J18 A;  4OVZ A;  1J19 A;  1V1P B;  3ENE A;  4HK2 A;  1SJH D;  3NVY A;  2K8B A;  3SD5 A;  3TUO A;  1V49 A;  4LLG M;  1YN5 A;  3ML8 A;  2DZJ A;  1SE9 A;  1WYW B;  5IN7 A;  3AXC A;  1E7U A;  3N1X C;  1KLU D;  3DWM A;  3AE8 B;  1EUV B;  2JYE A;  4GOC A;  4IC7 B;  1D3Z A;  3NVV A;  1LFD A;  2KX0 A;  3RNC C;  3RMK C;  2LJI A;  2J7Q B;  2J42 A;  2MW5 A;  2MQJ A;  1KLG D;  5FK9 C;  3W5V B;  3DHG C;  2M56 B;  4BVU C;  1ENF A;  3VXW A;  2PPH A;  2KVZ A;  2MJD A;  2IBI B;  2K3U A;  1GUA B;  1FRD A;  1ZPS A;  5BYQ A;  2V3N A;  5AZF A;  2AWT A;  3PT2 B;  1V81 A;  1OQY A;  4LCD E;  3T3N A;  3KLS X;  4WWP A;  2MBB B;  3QWZ B;  1HZ6 A;  1XLQ A;  3AEG B;  1MHX A;  5DPT A;  2N7J A;  2RPV A;  4WAA A;  2WX1 A;  2Z59 B;  3HK0 A;  3QHT A;  1P98 A;  3QA8 A;  4K7S A;  1DGJ A;  3ZTC A;  3ZNZ B;  3AU5 A;  4K81 A;  3IVF A;  2L7R A;  3TSS A;  1TT5 B;  1WZ0 A;  3RI7 C;  3Q3J A;  4WAF A;  2BWF A;  3CF6 E;  4GDK B;  4RGN A;  3T3O A;  1GJZ A;  1L2N A;  1WM3 A;  1I4Q A;  2KAN A;  4JWU C;  3EHV A;  4MEM A;  1PGX A;  3AE6 B;  1C9F A;  1RAX A;  3VTU A;  4CHK A;  2CHX A;  3ONS A;  1VR9 A;  3KQ4 A;  5EE9 A;  1OEY A;  2TSS A;  1IGC A;  4N9F 4;  1VZ7 A;  5MPO A;  2JQR B;  3RZF A;  1K51 A;  2AQ2 B;  4NAM A;  3A1Q B;  1LM8 B;  1L0V B;  1IGD A;  3U4E G;  4MGY E;  1UF0 A;  4YT0 B;  5T8I A;  4PK1 A;  3C0R B;  1TIF A;  4MT5 A;  4BBN C;  3AEB B;  2ZEQ A;  3FIL B;  4HRS A;  1NDD A;  2XEW A;  2Y5B B;  2AQ1 B;  4C00 A;  2J0J A;  2AL3 A;  5JZE B;  2ZCC A;  1WY8 A;  4GDK A;  2MA9 B;  2LRU A;  1KH0 A;  1SE3 A;  1YQ3 B;  1FXA A;  3PVL A;  4B95 A;  4AJY B;  3AE1 B;  4NZL B;  1SXT A;  3MTN B;  1IPG A;  4FHK A;  4RCO A;  2ZW1 A;  1KF6 B;  3AEF B;  1L4Z B;  2ZZP B;  1NYR A;  3PRE A;  2R2Q A;  3A1Q A;  1VCB A;  1YOV B;  3B9J A;  2MWS B;  1F77 A;  4TUU A;  4BFR A;  2Z8L A;  1RRB A;  1MG8 A;  2IGD A;  2N4F A;  1YQ4 B;  4W9K A;  3DDC B;  3VDZ A;  4WUR A;  3FIL A;  1PQS A;  4AP4 C;  2WWZ A;  4DK5 A;  3RPF C;  4I6L B;  3C8Y A;  3DBH I;  4K3C A;  1YJ1 A;  4XE0 A;  4LK0 M;  2RGF A;  4J3O D;  2GBN A;  2RDH A;  1LO5 D;  3I63 C;  3AN1 A;  1P7E A;  2N9E B;  1SIJ A;  2EMS A;  2R2O A;  2J53 A;  1GOZ A;  1QOG A;  3A4S C;  3BVG A;  2C5L C;  2QSD A;  2K6Q A;  1EWC A;  3Q3F A;  1WGH A;  1UUP A;  2K8C A;  3VFK A;  3UI3 A;  2BYT A;  2WXL A;  4MJS B;  2KJH B;  3EA6 A;  3H7P B;  2O2V A;  2WXJ A;  4P6V F;  4ZRJ A;  2M17 A;  4YTP B;  3PHX B;  2BBC A;  2G9H D;  3PGE A;  5E6P A;  2BVC A;  5GXG B;  4NNJ B;  1KTK A;  2WXP A;  4LJP B;  4N59 A;  1WX9 A;  2O6V A;  1N60 A;  2BS4 B;  1WFY A;  2C7M B;  2GRI A;  3KUC B;  4GDL B;  1XO3 A;  1CMX B;  4PT5 A;  4ICV A;  1TYG B;  2MBE A;  4EE2 A;  1WXV A;  4JX1 C;  3APC A;  4TSS A;  1UBI A;  1T6B X;  4WJQ A;  5IKC M;  5HKH A;  2LVP A;  2DYM A;  1T3Q A;  2ON8 A;  3NVW A;  1ET6 A;  2WDT B;  2I2Y A;  1QQR A;  1C79 A;  1FRR A;  4M8M A;  2CKH B;  5EDS A;  1RFA A;  1XD3 B;  2G4D B;  5AUI A;  1AN8 A;  2FCN A;  1WR1 A;  2RDB C;  4MJS A;  3KUD B;  3H7P A;  3ALB A;  1GC6 A;  3WAO A;  1ZXH A;  3W9C B;  4M0W A;  2WYQ A;  2EKE C;  4NAW B;  3IHP C;  2HD5 B;  2KN4 A;  1EF1 A;  2AQ3 B;  5TR5 A;  2Q5W D;  2JWZ A;  1V5T A;  4K7W A;  4YWG G;  1HA5 A;  3GZN B;  2O6V D;  1KLV A;  4XDD A;  3H9D A;  3AMZ A;  4CQN A;  2V9H A;  2WXM A;  3DVN V;  4W9J A;  4FJY A;  3VVW B;  3DBR I;  2M19 A;  3Q3M C;  1CK1 A;  3UIN B;  2WP9 B;  4LNO A;  2WGS A;  2QHO A;  3EUB 2;  2KWU B;  3V61 A;  5IA7 A;  2W54 A;  5D2M B;  4BOZ B;  2WDV B;  1KJT A;  3V62 A;  2K6D B;  2MSE D;  2N9X A;  2SEB D;  3Q14 C;  4F1S A;  3AE4 B;  5IOI A;  1RFK A;  4NJC A;  4WQM A;  4ANU A;  5L95 C;  1I4R A;  4HPM B;  3P4S B;  1GB1 A;  1WGY A;  4PS3 A;  1XLN A;  3OJ4 B;  5FKA C;  1IYF A;  4IUM B;  3ZNH B;  1XCQ L;  2KZR A;  3R8B A;  4OVV A;  2GLS A;  2CHW A;  1Q10 A;  2NBV B;  4KVG B;  5JXV A;  4P1C C;  4DDI D;  1WX8 A;  4TMA B;  2KMA A;  2MLB A;  5CTR C;  2D2Q A;  2L76 A;  3GS2 A;  4M01 A;  3PS6 A;  3X23 A;  3BYT B;  2MBO A;  2ZJD A;  2RPQ A;  2G3Q B;  2PE6 B;  2YEP F;  4ZYS A;  2KFJ A;  1B1Z A;  1UEL A;  2LGI A;  3VAW A;  4H2A A;  1T0Q C;  3VR9 B;  3VQI A;  1AYF A;  3UIP B;  1QLB B;  2W9N A;  4AS1 A;  1YIW A;  3PRP B;  1E8X A;  4A90 A;  4RF1 A;  3O13 A;  2VRR B;  2IYD B;  1TKE A;  1E8Z A;  2PMV A;  5IO9 A;  2BYF A;  1FMA D;  2EEL A;  3QAR A;  4IWO A;  3NS8 A;  4KZ0 A;  3SFD B;  4WH4 A;  2KDE B;  1JAL A;  4A6Q A;  1I35 A;  1WZ3 A;  3ZNI D;  2BYV E;  4RH6 A;  1V2Y A;  3QQ8 B;  4RGT A;  3LXF A;  3OAW A;  4DQO C;  2NR2 A;  2KOX A;  1C4P A;  4B0M A;  4C7Y A;  1DOY A;  1M94 A;  3VRB B;  3NS1 A;  1TGZ B;  3BVZ A;  3W1S C;  2J0K A;  1IP9 A;  1GG3 A;  5AUK A;  3VTV A;  3N3K B;  3M95 A;  4DHZ E;  2W3R A;  2JVC A;  3IBE A;  1WJN A;  2KAC A;  1GB4 A;  2QJL A;  5LXI B;  1PFD A;  2LD9 A;  2AL6 A;  2FUG 1;  4BKS A;  1E6E B;  4KKI A;  2DWQ A;  5CHF A;  2BTE A;  3JYU A;  4ANV A;  5L83 A;  3BY4 B;  3H1U A;  1GPX A;  2XK5 B;  2K25 A;  2A5U A;  2LMC A;  5DCN A;  2LGX A;  4MM3 B;  3HM3 A;  1GC7 A;  2B3A A;  2KDI A;  3R2T A;  1QOA A;  4W9C A;  4HJG E;  4HLE A;  1VDV A;  4HWI B;  1I42 A;  1U4A A;  4PS7 A;  1LXD A;  2NBU A;  3L08 A;  2N1W A;  4WJN A;  4A3P A;  4WQO B;  3RFZ B;  4KSK C;  4HCN B;  2BKF A;  2KNB A;  1H8C A;  4USA A;  2X8X X;  3Q8A A;  3LJ3 A;  3BZD B;  1L7Y A;  2INP E;  2EKI A;  3DBL I;  4HCP B;  3B2G A;  2L3Z A;  4LDT D;  1R4N B;  1KM7 A;  2XK5 A;  4MSQ B;  4MEL A;  4II2 B;  1F2R I;  1JWU D;  2BQQ A;  1E8Y A;  1WI0 A;  4HVB A;  2L05 A;  3L13 A;  3PZ8 A;  3M62 B;  4AQ7 A;  4XWW A;  4MDK E;  2K39 A;  2WXF A;  2BW2 A;  2KDM A;  2WX0 A;  2IGG A;  2KT7 A;  2DAF A;  4FN2 A;  2PVO D;  4N6E B;  2KDB A;  2KN5 A;  4MSM B;  1E90 A;  1HZ5 A;  1FNW A;  2LXA A;  2RSU A;  2R61 A;  3W1Y A;  4LNK A;  3R3M A;  4BBN F;  3Q2A C;  4XC2 A;  5DPR A;  4OHJ A;  2WXR A;  4KGS A;  5BO4 B;  4EUT A;  2N9L A;  3I9V 1;  1ACC A;  4ZHO A;  1WM2 A;  1HEZ E;  1TZO A;  1PUT A;  5EE0 A;  1JWA D;  2GBK A;  1HE8 A;  1K50 A;  1B9R A;  4N58 A;  1YX5 B;  2UYZ B;  4RMA A;  3ZRC A;  3P4R B;  5G2N A;  4HKQ A;  3W5U B;  1V1O A;  2VH2 A;  3V3X A;  1UNS A;  2BB5 A;  1L0Y B;  2JSV X;  3TCA A;  3RZW C;  4DXA B;  1YNT E;  3PO0 A;  3AEC B;  3RUL A;  4LNI A;  2D3A A;  4L2Y A;  1WH3 A;  3MC9 A;  2G1E A;  2ONQ A;  4HDQ A;  4JGH B;  2XNA C;  2FCS A;  2RR9 A;  4A3O A;  2M0A A;  4E71 A;  1FFV A;  3B2F A;  2Y5C A;  4FHJ A;  1C76 A;  3RNA C;  2BF8 B;  3KWV A;  2H89 B;  1JRU A;  1PGB A;  4EOY A;  3NOB A;  1FFU A;  2YVC A;  2DHZ A;  3PRZ A;  2WXN A;  1MPE A;  1WYG A;  3IG3 A;  3RNG C;  2VH1 A;  3N9Y C;  4GB9 A;  5C1Z A;  4LTU A;  1GAQ B;  4E74 A;  3Q69 A;  2JZP A;  1HXY D;  1OFF A;  1GNU A;  2RMM A;  2IO0 B;  2PTL A;  1S1Q B;  3SEB A;  3VRA B; 
#chains in the Genus database with same CATH homology
 4JX1 C;  4TSS A;  4IKG A;  1T6B X;  3AE3 B;  3U52 E;  3LB8 C;  2DYM A;  1T3Q A;  2ON8 A;  3NVW A;  1ET6 A;  2I2Y A;  1YJI A;  1QQR A;  4OZA A;  1C79 A;  1FRR A;  1BML C;  1YJJ A;  3P4Q B;  2IJ0 A;  5AUI A;  1AN8 A;  2KAJ A;  3V05 A;  4D2K A;  1IUE A;  4O1N A;  2NMQ A;  4P16 A;  3BII D;  1RYJ A;  4ZRQ A;  2K9X A;  1M4V A;  2ICI A;  3ZJV A;  3IT6 B;  1ZXH A;  4MH8 A;  3W9C B;  1JRO A;  1JML A;  2WXI A;  3IAM 1;  2K0P A;  4M0W A;  4RGO S;  1D5Z C;  2Y5P A;  1V8C A;  4NAW B;  2WXG A;  4US8 A;  2V3P A;  2LEK A;  2XN9 C;  1C4A A;  2KN4 A;  5D3D A;  1Y56 A;  2AQ3 B;  1ZUD 2;  4Q2J A;  2I38 A;  1D5M C;  1QKZ A;  2Q5W D;  2WDQ B;  1P7F A;  5BYR A;  3HVZ A;  1FEH A;  2LHD A;  1C77 A;  3DWG C;  4YWG G;  1HA5 A;  1WRI A;  4XDD A;  5G5G A;  3AMZ A;  4CQN A;  2WXM A;  4A55 A;  2E6X A;  2J52 A;  2KMM A;  2DBY A;  4TQ1 A;  2M19 A;  1WWT A;  1CK1 A;  2N9K A;  3ZJT A;  2CU3 A;  2WLB A;  1JCK B;  1QOF A;  2WP9 B;  2GI9 A;  2FE8 A;  4IOI E;  4YTN B;  5G5H A;  3BK2 A;  1K52 A;  2L1A A;  3EUB 2;  4XWT A;  2W3S A;  3ABV B;  1JWB D;  4OZB A;  2W54 A;  4YTM B;  2WDV B;  1IBX A;  4WWM A;  1QOB A;  4L1B A;  2WXO A;  1E9M A;  1JQ4 A;  2Y3A A;  5HFY A;  1JRP A;  3URY A;  2QMT A;  3NUH B;  2SEB D;  2SAK A;  3SFE B;  2PVG C;  1SE2 A;  3AE4 B;  1RFK A;  3FAH A;  3HUI A;  1D5X C;  4YSY B;  4NJC A;  4WQM A;  1MVK A;  3ETR A;  1I4R A;  2MJ3 A;  1VZ8 A;  2RDG A;  1L4D B;  3P4S B;  1GB1 A;  1C4C A;  3AE9 B;  1XLN A;  2AX5 A;  5BMH A;  1XEE A;  1I4P A;  1V1P A;  1DOI A;  5FKA C;  4MAC A;  1FIQ A;  1TY0 A;  1CQV A;  1ZDV A;  2W82 A;  1NVI D;  2KQ4 X;  5BYS A;  1XCQ L;  2BT6 A;  1NYQ A;  1PYW D;  1SBB B;  3BVM A;  3J9C A;  1XXG A;  2WU5 B;  4KX6 B;  1YN3 A;  3R8B A;  4ZOH C;  4RNA A;  1ZDX A;  1Q10 A;  2IPK D;  3P1M A;  3GP7 A;  1EWY C;  1C78 A;  3AEA B;  4B0E A;  1EM7 A;  3BYY B;  5JXV A;  1WGK A;  3ZGZ A;  4KGR A;  3TEX A;  4TMA B;  3W2D A;  1DYQ A;  4YSX B;  1SB3 C;  1L6U A;  1NEK B;  3FC4 A;  3GS2 A;  4C56 C;  2WXQ A;  1K53 A;  1V97 A;  3BYT B;  4R3D A;  4A9A A;  2BS2 B;  1FO4 A;  2L52 A;  4L23 A;  1ZE3 D;  2KWD A;  1VLB A;  2DYO A;  2YEP F;  4ZYS A;  3IT4 B;  1B1Z A;  1J7A A;  1I4H A;  4KGT A;  2LGI A;  1ZXI A;  2N0S B;  3H8H A;  3NVZ A;  4H2A A;  1TY2 A;  5TSS A;  1N5X A;  3VR9 B;  1VJK A;  3AB5 A;  1IBX B;  1PGA A;  3VQI A;  1AYF A;  2PLP A;  3E56 A;  1FCL A;  3I57 A;  1QLB B;  1TS4 A;  1SJE D;  4AS1 A;  1F2R C;  1XLO A;  4YSZ B;  4A90 A;  1NI3 A;  4RF1 A;  3O13 A;  1YMH E;  1SEB D;  3R2I A;  1TKE A;  3AE7 B;  2V4I B;  3HVD A;  2PMV A;  4ARC A;  1BXT A;  2MJE A;  1TS2 A;  1F0Z A;  1I4X A;  1FMA D;  2EEL A;  2LHE A;  4OVZ A;  3SFD B;  1V1P B;  5BMG A;  1D4B A;  4WH4 A;  1JAL A;  2B76 B;  1SJH D;  3NVY A;  1N5W A;  4WIP A;  1WSP A;  2CJO A;  4A6Q A;  3TUO A;  4LLG M;  4RH6 A;  1YN5 A;  4RGT A;  1JWM D;  3Q8F A;  1QF6 A;  3LXF A;  4DQO C;  1C4P A;  1KLU D;  4B0M A;  1WXQ A;  4C7Y A;  3MP9 A;  3DWM A;  3VRB B;  3NS1 A;  3AE8 B;  1DOY A;  4FXC A;  2JYE A;  4C7Z A;  1J7B A;  1YN4 A;  3BVZ A;  3NVV A;  1SE4 A;  5AUK A;  3AH7 A;  5BMI A;  2LJI A;  5D7G A;  2J42 A;  5FK9 C;  1KLG D;  1QT9 A;  3W5V B;  2IGH A;  3AM9 A;  2M56 B;  1FCC C;  2NTT A;  1FM0 D;  3MC0 B;  1ENF A;  1UWM A;  2W3R A;  3AEE B;  3VR8 B;  2MJD A;  2K3U A;  2KAC A;  1GB4 A;  1MHH E;  2QJL A;  1NEN B;  1PFD A;  1FRD A;  1ZPS A;  2FUG 1;  5BYQ A;  2V3N A;  1E6E B;  1I4G A;  4KKI A;  3GB1 A;  2DWQ A;  2BTE A;  1TJE A;  3T3N A;  3KLS X;  2L32 A;  3MFG A;  1HZ6 A;  1XLQ A;  4RGM A;  4DXG A;  3ZYY X;  1GPX A;  3AEG B;  5E6J A;  1MHX A;  1XF5 L;  4DXF A;  2N7J A;  1KRH A;  2RPV A;  2LMC A;  1PDX A;  3EGR A;  4MM3 B;  4ZRP A;  1OQQ A;  1CZP A;  2FBW B;  4YXD B;  1T5X D;  4A8X C;  3R2T A;  1QOA A;  4HJG E;  1DGJ A;  1VDV A;  1ESF A;  3TSS A;  2HTM E;  2IDY A;  4WAF A;  5C3J B;  1N63 A;  4GDK B;  5LNK 1;  4RGN A;  3T3O A;  3BK1 A;  1E10 A;  3BWU D;  1I4Q A;  3MHZ A;  3RFZ B;  4JWU C;  1PGX A;  3AE6 B;  1C9F A;  3TEY A;  1RM6 C;  1AW7 A;  1CJE A;  1VR9 A;  2GB1 A;  3KQ4 A;  5EE9 A;  2TSS A;  2OED A;  1IGC A;  1N62 A;  4USA A;  1EU3 A;  1VZ7 A;  5MPO A;  1MI0 A;  3Q8A A;  2JQR B;  3U2S C;  1K51 A;  2K22 A;  2AQ2 B;  4HKZ E;  4NAM A;  3BZD B;  1E7P B;  1TS5 A;  2INP E;  2EKI A;  1L0X B;  1L0V B;  2ZW0 A;  1IGD A;  3CIR B;  3B2G A;  3U4E G;  1D6E C;  4YT0 B;  3MJ5 A;  5T8I A;  2W55 A;  4MT5 A;  2PW9 A;  1F2R I;  4OZC A;  1JWU D;  2JYT A;  3AEB B;  3FIL B;  1ET9 A;  1ROE A;  4HRS A;  3SR6 A;  2V0G A;  2WS3 B;  3TEZ A;  2AQ1 B;  2E3T A;  5C2T B;  2OHF A;  1E0Z A;  1STE A;  3HRD D;  2WXH A;  3PZ8 A;  1JW9 D;  3LYY A;  2VZK B;  1JWS D;  4AQ7 A;  4XWW A;  5EE1 A;  2DLB A;  4TQ0 A;  2WXF A;  4REZ A;  2PIA A;  2BW2 A;  2KDM A;  3WCQ A;  2IGG A;  1XCT L;  1KH0 A;  1SE3 A;  1YQ3 B;  5D3I B;  1FXA A;  2J4X A;  1R7S A;  1TKG A;  2K5P A;  2WXK A;  2PVO D;  4N6E B;  4IDI A;  3AE1 B;  4C80 A;  1HQR D;  1HZ5 A;  1FNW A;  4NZL B;  1SXT A;  2R61 A;  3KWL A;  4US9 A;  2NTS A;  1EU4 A;  1L6V A;  4RF0 A;  4RCO A;  2ZW1 A;  1N61 A;  3IXS A;  1KF6 B;  2YEP B;  3AEF B;  1L4Z B;  3PZ7 A;  1NYR A;  4OHJ A;  2JX5 A;  3NZ3 A;  3Q8E A;  2WXR A;  4KGS A;  2N9L A;  3I9V 1;  3ZJU A;  3B9J A;  5HI1 A;  1ACC A;  3E9S A;  2MEK A;  1F77 A;  4ZHO A;  1J7C A;  2LUM A;  2L83 A;  1UWX A;  3Q8C A;  2Z8L A;  4RFB A;  2JXT A;  1HEZ E;  1TZO A;  1PUT A;  2IGD A;  5EE0 A;  1JWA D;  1OQR A;  1YQ4 B;  1K50 A;  1B9R A;  1TKY A;  4N58 A;  4WUR A;  3FIL A;  4KKJ A;  5I4D A;  4HEA 1;  2PKO A;  3P42 A;  3P4R B;  4HKQ A;  1QIL A;  3W5U B;  1V1O A;  4OW0 A;  3RPF C;  3C8Y A;  3W1S A;  3V3X A;  1UNS A;  1A70 A;  1AWD A;  2ACZ B;  1TS3 A;  2BB5 A;  2WDR B;  1L0Y B;  2JSV X;  3AE5 B;  4XE0 A;  2X38 A;  4LK0 M;  1YNT E;  3PO0 A;  4J3O D;  3AEC B;  2RDH A;  1LO5 D;  3AN1 A;  1P7E A;  1SF0 A;  2BS3 B;  1SIJ A;  4L2Y A;  2LFI A;  2J53 A;  4UDU C;  1SSN A;  1GOZ A;  1QOG A;  3BVG A;  2G1E A;  2ONQ A;  2QIL A;  3NRZ A;  3ZQ4 A;  3U7Z A;  2XNA C;  1RWS A;  2INN E;  2QIE B;  2QSD A;  1FXI A;  1EWC A;  2WU2 B;  4GLS C;  5H8Y E;  1UGJ A;  2WNM A;  3CWI A;  4ITK A;  1UUP A;  3P4P B;  3OWE B;  2M0A A;  2QEJ C;  3UI3 A;  2BYT A;  1FFV A;  2WXL A;  3B2F A;  2Y5C A;  3Q8B A;  3EA6 A;  1C76 A;  5HG2 A;  5HHD G;  1VRA B;  3KWV A;  1FD6 A;  2H89 B;  2WXJ A;  1XLP A;  2H88 B;  3AE2 B;  1VZ6 A;  4P6V F;  1FNV A;  1PGB A;  4HRO A;  4YTP B;  2BBC A;  2G9H D;  2WQY B;  2MH7 A;  1FFU A;  3IAS 1;  2WXN A;  3AED B;  1ZP0 B;  4JE3 B;  2BB6 A;  1BUI C;  5GXG B;  3TEW A;  1MPE A;  2JU6 X;  1KTK A;  1WYG A;  1ZOY B;  1KFY B;  5H92 C;  4ARI A;  2WXP A;  3AV8 A;  4N59 A;  1FNU A;  4JWS C;  2HDE A;  4JPS A;  5EE3 A;  1N60 A;  2JWU A;  3L4P A;  3P63 A;  1L5P A;  3N9Y C;  4XDC A;  2BS4 B;  4LTU A;  2GRI A;  1GAQ B;  4GDL B;  2D5G A;  1DOX A;  3Q69 A;  1XO3 A;  2JZP A;  1HXY D;  4ZHP A;  1OFF A;  4PT5 A;  1TYG B;  2CJN A;  2RMM A;  1I7H A;  2PTL A;  2VZK D;  3SEB A;  5FR3 A;  3VRA B;  4EE2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...