3I57A

Type 2 repeat of the mucus binding protein mub from lactobacillus reuteri
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
184
structure length
184
Chain Sequence
MQKVHVQYIDGETDQMLRQDDLDGYTDETIPYSTAEGIKKFEGDGYELFKDNFPAGEKFDNDDTNDQFYTVIFKHHRENVDPNHSSADGTKGTKTLTETVHYKYANGTKAAEDQTAQVTFTRNGVLDDVTGIVAWGKWNEASQSYKALTSPTIAGYAPSEAVVKRSSNSDAEQGPTLTVIYTAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a mucus binding protein repeat reveals an unexpected functional immunoglobulin binding activity.
pubmed doi rcsb
source organism Lactobacillus reuteri
molecule tags Protein binding
molecule keywords Mucus binding protein
total genus 43
structure length 184
sequence length 184
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17965 MucBP_2 Mucin binding domain
A PF17966 Mub_B2 Mub B2-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.460 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3i57A02
3.10.20.470 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3i57A01
2LFIA 3I57A 3LYYA 4MT5A 3NZ3A 3Q69A
chains in the Genus database with same CATH superfamily
3P2BA 2MP2B 2BF8B 3K9PB 3RT3B 3MJ5A 1N5WA 3P4PB 3VH3B 5DPWA 1HTOA 2JRIB 1V8CA 3Q8CA 3L10B 3HIZA 3UF8A 2KACA 4GLSC 3TCAA 1WIAA 3N30A 4XGAB 1WGRA 3R8BA 4EE2A 1R4NI 1UGJA 3FC4A 5CX3A 4E74A 4C7ZA 4JPSA 4M0WA 5D2MB 2V1YA 5FK9C 4EEWA 1RFKA 4UDUC 4US8A 3RNAC 2CKHB 1FCLA 4LNOA 3H9DA 2GLSA 3RULA 5G5GA 2IGDA 3TEYA 4JIOU 3O13A 1FNVA 4II2B 1ET6A 1SE2A 1BMLC 1V86A 1YN5A 4W9EA 1YJIA 5BO4B 1VD2A 1T0QC 4PS7A 3AULA 3KWVA 2HTHA 1JCKB 5D3IB 2KJRA 4YTMB 2FBWB 4DWFA 3S2AA 4E3CA 1QZEA 3RD2A 3BZDB 5G55A 3HRDD 3ML9A 2ON8A 1HE8A 3KYDD 3Q3MC 5JH5C 3HVZA 4IDIA 3PZ8A 5E6JA 4HDQA 1BT0A 4G11A 5D7GA 1ZE3D 1R4NB 1OEYA 1GPXA 1YN3A 4ARCA 3ZO5B 1N62A 2MBHA 1I4PA 4K7UA 2J0JA 1QOGA 1Q0WB 1D5XC 2LI5A 5AZFA 4MSQB 1NEKB 4IM2A 2ZW0A 4I6NB 1BXTA 1P3QU 4RM9A 5EE1A 3DBLB 4X57B 2L1AA 1D4BA 2OHFA 2LFIA 3DOWA 2K25A 2RDGA 4RGTA 4K81A 2PLPA 2Q5WD 4AQ7A 2I1KA 2WXGA 2GRIA 2N0SB 3A9KA 2PE6B 3B1LX 2WDTB 4K7WA 2QHOA 3KWLA 1UH6A 3NG0A 2VZKD 3PPAA 3APDA 5FKAC 2EKIA 4L23A 3JSVA 1T3QA 4ZRKA 2HE7A 4RMAA 2KFJA 3NZSA 2DNFA 1L0YB 4N6EB 2KMAA 1EU3A 1DGJA 4XWWA 4HLEA 4MH8A 4YTPB 5IA7A 1I4RA 2CHWA 4ICUA 2IJ0A 3A9JB 3HM3A 1CJEA 3HK0A 2L3ZA 5AUIA 4JL9A 1M94A 2BYEA 1KM7A 2V3SA 1WGHA 1Q1OA 1F2RC 4OVVA 2MBEA 4NY0A 4ARIA 3I57A 1L5PA 3RNGC 4YXDB 4W9GA 3IVFA 5IOIA 1WXVA 5AEKB 3W5UB 1FD6A 3AE1B 3CSFA 2PTLA 5TSSA 1UBIA 1V6EA 2BKRB 5KHOA 3DWGC 1XLPA 3E56A 3A1QA 2M56B 2CU3A 3BWUD 1JWBD 4NAWB 3VFKA 1WE6A 2DZJA 1IYFA 4IW0A 4K1RB 3PRMB 2K9XA 3PT2B 4F1SA 2FCMA 2CJOA 1L7YA 3VXWA 3H8HA 1EWYC 1FIQA 2D3BA 2OJRA 5IKCM 4IWOA 4GSWA 1PUTA 1T0SC 5J2RA 4RCOA 2IY1B 3Q3FA 1UNSA 3DVNV 4A55A 5KHQA 1AWDA 3TJPA 5BYSA 4TQ1A 4IWPA 1WRDB 2H89B 2JZZA 3QIJA 4XX5A 1SJED 2ZCBA 3M63B 1FPYA 4KIKB 3IAS1 2K6QA 3SR6A 3H6NA 2N9XA 3MTNB 2OOBB 4MDKE 3V61A 1TS5A 3N3KB 3PLVA 3FAHA 5JZEB 2C9WB 2WXJA 3KLSX 3BVZA 1AW7A 2PPHA 4URKA 3AE9B 1C4CA 2BTEA 5G2NA 3ZDMC 2PEAA 2LGIA 2N1VA 4BZAA 3PHWB 2CHXA 2FCSA 1AN8A 2GMIC 1T6BX 1V80A 4MGYE 1ENFA 1UF0A 1ZP0B 3A9KB 3R7RA 1UBQA 5E6OA 3Q2AC 1N5XA 2BS3B 2C7NB 3AEDB 4ASWC 2LHEA 1CQVA 3E9SA 3A33B 2R2OA 3ZNID 3VUYA 4F7ZA 1P7EA 2BGFA 1WGDA 3TSSA 4DHZE 5HFYA 4CHKA 1FXIA 3M3JA 2L0TA 2WXLA 3GB1A 1TKEA 1EUVB 2MBBB 2DZMA 2IO3B 3R2TA 3R7QA 2KC2A 3TBLD 1Z2MA 3ZDTA 4YTNB 1AYFA 2R61A 2ZZPB 3AE8B 2H88B 1EF1A 3P63A 3H7PA 2LRUA 3Q8AA 1PGBA 3DBHI 2E3TA 3U8ZA 4IM0A 1BUIC 4MGZE 3K9OB 1WZ3A 4NJCA 1XEEA 1YX6B 4WURA 4A3OA 2BYFA 4BKGA 2ZPYA 4WQMA 2YVCA 1GB1A 2QDFA 1FEHA 2EMSA 4LJPB 2UYZB 3L4PA 1V2YA 2G1EA 2N7DA 2VH2A 3MC8A 3HM6X 3A9JA 1HTQA 3Q8EA 2W3RA 4LTUA 2WNMA 3KH0A 1ACCA 3MP9A 2REXA 1SB3C 4EOYA 3VHTC 2DX5B 1MFWA 2JU6X 2W9NA 3PO0A 2YEPB 2AWTA 4M8MA 3MHZA 1L4ZB 1QLBB 2IO1B 3AB5A 3C19A 1P0RA 4GDKB 3TMPB 1AARA 1V1OA 1D6EC 2K3UA 2KAJA 2MW5A 4DQOC 3AH7A 3DQVA 1SGHA 4HWIB 3AE6B 2D11A 3A4RA 4TMAB 3T8MA 4D2KA 3NZUA 1I4XA 5FR6A 3TIXA 1E9MA 3DWMA 5DCNA 2K8BA 4XE0A 1I42A 2JZ3B 4AJWA 3EGRA 1LM8B 3AE7B 3AV8A 1XO3A 1SE3A 3C0RB 3KW5B 4AUQC 2CR5A 2DYOA 2LJ5A 1V1PA 1F77A 1E5WA 2LGXA 3NVVA 3H7PB 1TGZB 4GOCA 2JRHA 1A5RA 5D3DA 4BBNF 2N9KA 3ZKJC 3EA6A 3VR9B 1P7FA 2WWZA 4HPPA 4N59A 3GS2A 2WX1A 2O6VB 3ZXRA 2ACZB 5DPRA 1TY0A 1QOAA 2W3SA 1QOFA 3IT6B 1TZOA 1EM7A 4HJGE 2JXTA 3SU8X 3ZVVA 2QCZA 4YSXB 5E6NA 3ONSA 4PYZA 4LNFA 2BWFA 5IP4D 2KN4A 4RF0A 3DHIC 1C4AA 3R2IA 2IZVB 3IFWB 5C23A 3X23A 1C3TA 2XK5B 4ZRIA 3ZLZA 1N61A 3DVNU 2JYEA 2WQYB 2PE9A 3L13A 3EC8A 2KKCA 3RN9C 3V6EB 2NMQA 4RFBA 4HCNB 1WH3A 3NVWA 1SJHD 4HPLB 3RZFA 4EZKA 1WM3A 1E8XA 4BOZB 5HKHA 3P42A 4TQ0A 2KWCA 2I2YA 4LK0M 1RYJA 4W9KA 2L8JA 5BYQA 4LJOB 4HROA 1L2NA 5IN7A 3WIMA 4B0MA 4M00A 3AMZA 3OWEB 1K52A 2NCNA 3I5JC 4HJKA 2Y3AA 2JXXA 3ZJUA 1KTKA 3AEGB 5J18A 3NHEB 1ET9A 4GIVA 2KQ4X 4M0WB 3GZNB 1DYQA 4NJ6A 4W9IA 2ZEQA 4JWUC 3PZDA 4B9KA 2INPE 4DK5A 2LHDA 3ZNZB 5LNK1 4ICVA 3AXCA 4A8XC 5HG2A 4H2AA 1OQYA 4CQNA 2G9HD 5EE0A 4EZLA 1YMHE 2VH1A 4NQKE 5CHFA 1V9JA 2NBUA 4JGHB 3TEZA 4KDLB 2MSED 2ONQA 4ZRPA 3AU4A 2W82A 4LLGM 3PV1A 3BIID 4AJYB 3HVDA 1YJ1A 1PYWD 1S3SG 3OLMD 3R66C 2R2QA 4FHKA 4WWOA 3GE8C 1JWAD 4HPMB 4LNNA 3BK1A 1TS3A 4TKNA 3EHVA 2KDBA 2A4ZA 4HVBA 3GP7A 2QC8A 4RNAA 3BYTB 4PT5A 2OEDA 3PREA 2K8CA 4HEA1 3U7DA 1FNUA 5CTRC 2KMMA 4FN2A 4WWPA 3NOBA 3BY4B 4HDOA 2BWES 2L52A 3NVYA 4K3BA 4C56C 3QQ8B 3SDLC 1ZDVA 1VCBA 2JY6A 2KFKB 1PQSA 4LDTD 2QMTA 3U52E 4C7YA 2V0GA 4HCPB 2NPTA 3W9CB 2KWUB 1WI0A 3P4SB 4GDKA 1WGGA 3Q3JA 3I9V1 4OHJA 3D32A 2MRPA 2LUEA 3DBLI 4OVUA 2KK8A 2WXPA 3AECB 1C77A 1TY2A 2UU7A 4P1BC 2RPVA 1CZPA 1D3ZA 3A4SC 3QK0A 1YJJA 1XXGA 4N9F4 1J0GA 2VZKB 3L16A 3ETRA 3B2GA 1XT9B 2WYQA 1RRBA 2WXNA 1JWUD 2N9EB 2KTRB 1I35A 1GJZA 1B1ZA 1ZUD2 4HKZE 3IT4B 3PSEB 4O1NA 2AYOB 4P16A 3L08A 1LO5D 3Q69A 3RZWC 2QSDA 1P1AA 1WR6E 4OZCA 2KO3A 2W54A 3CF6E 1IGDA 5GMVA 5C3JB 4ANUA 3Q3OC 4C80A 4GDLA 1TJEA 3M62B 1XLOA 1T0YA 2SAKA 4DDID 4FJZA 1XCQL 1WMHA 3NRZA 2HJ8A 1CMXB 4WAFA 1C1YB 4C00A 2INNE 4BKTA 2O2VA 4J3OD 3ZNHB 1MVKA 4M8NA 2DAFA 2LGSA 2RDHA 1TS4A 2OJWA 4BKSA 4MJSA 4OW0A 4BVUC 2KX3A 2WU5B 3DBHB 2GBKA 2WS3B 3J9CA 3MJWA 5JHAA 3DDCB 1K53A 3IAM1 3X0WA 4DDGD 4MJSB 5LLIA 1ZKHA 1V97A 1HZ6A 2KQSA 2ZJDA 2BB5A 1FFVA 2M0AA 3AEFB 3APCA 3MC9A 3BVMA 4DBGA 2BVCA 3SFEB 1XF5L 3W2DA 3PTFC 1RAXA 4BBNC 4GMVA 1WWTA 1UZXB 1WGYA 1J7CA 1KF6B 2JYTA 1TZ1A 3OAWA 2SEBD 1L4DB 3AE4B 4RM8A 2AL3A 3DVGY 3PGEA 1F52A 1LQBA 1VRAB 4EUTA 4L1BA 2IYDB 4WWMA 4ANVA 2DYMA 1NI3A 2Y5CA 3VR8B 4LNIA 2NS5A 2AX5A 3DCGA 3JYUA 2IDYA 2WGSA 2KDMA 2V4IB 4C4VB 2XK5A 5DPSA 1RM6C 2DENB 3EECA 3NJTA 4WQOB 3ZJTA 2KTFA 1KFYB 4N58A 1TBEA 2AQ1B 2BBCA 4YSYB 2XNAC 1V1PB 2KHWB 3NUHB 1UD7A 3T3OA 3ZJVA 1JW9D 2KYWA 2E6XA 4G3XB 3U2SC 1E10A 1F1HA 2KOXA 2RD0A 3PVLA 2JUOA 1ZW7A 2EMTA 4S0RA 2JPHA 4TUUA 2ZPNA 1WJ6A 4E71A 4II3B 1DOXA 2M4NA 2AL6A 2Z0DB 1LFDA 5HI1A 3WA0A 2MQJA 3N1XC 3B9JA 2DYBA 2J0MA 1JRPA 2G4DB 3KVFB 2I1JA 3LXFA 4PYUA 2GB1A 1GNUA 1MG4A 1LXDA 4MT5A 1ZDXA 4KVGB 3ZRFA 1G6JA 5BMGA 1L6VA 1Q10A 2LGYA 3VRAB 2HD5B 1E8YA 2D10A 4KZ0A 5D6JB 4DXAB 1EWCA 3QAQA 2MEKA 4KKIA 1VZ6A 1QQRA 2KZRA 3SHQA 3R3MA 4XWTA 5CHVC 1K50A 2GBMA 4P7IA 5IAAC 4AP4C 2M17A 1NVID 2GBNA 2DHZA 4B6WA 2Z8LA 3T9LA 4HXDA 1F9JA 3ZYYX 2XEWA 1EU4A 2A5UA 1PGXA 1OGWA 1JWSD 2JQRB 5DPTA 1NI2A 4KKJA 2G3QB 4KGSA 1V81A 2MBQA 4L2YA 4W9FA 4KGTA 4FJVB 3WCQA 2Y5BB 2N9PC 2BYVE 4XC2A 4JE3B 2Y5PA 4MGKE 4GGQA 2DWQA 1P98A 3W1SA 2N1WA 2PMVA 1H4RA 2BQQA 1ZXIA 3ZIMA 2WU2B 2KT7A 3QC8B 3H1UA 1B9RA 2IGGA 3PZ7A 4W9HA 3RCZA 1YX5B 1HEZE 1WGKA 4R3DA 1J7BA 5EE9A 2JWUA 1IP9A 3ZTDA 3ABVB 1SEBD 3KUZA 2FIDA 2HTME 1NBFC 1WJ4A 2MJ3A 4PS8A 2LWPA 3EUB2 3ZGZA 2ZCCA 1E8WA 4IUMB 4QAYA 3ZW3A 4CYEA 2NR2A 1NYQA 3PLUA 3Q14C 2WX0A 4ZRQA 5TR5A 1YD8U 1WRIA 1XCTL 1JROA 2C5LC 4JWSC 5G5HA 1HZ5A 4DHJD 3AM9A 3P4RB 4KX6B 3W5VB 4BFRA 4FHJA 2CHZA 4W9JA 2IO0B 2KJHB 3FILB 2J0KA 1I4QA 4MEMA 2IY0B 2L7RA 4HKQA 1SIJA 1TIFA 2BS4B 4LCDE 3MFGA 2V3NA 4P1CC 4HK2A 3P4QB 3AI5A 3PHXB 2KMCA 4REZA 3PRZA 2MJEA 1L0VB 1KJTA 2AQ3B 4KIKA 3NVZA 5GXGB 4XYCA 1WY8A 5AUKA 4NAWA 4FLHA 4K7SA 2EELA 3CIRB 1PFDA 2CJNA 3V6CB 3VDZA 3WAMA 1N63A 1E0ZA 3OG5A 1YQ4B 4DXFA 1S1QB 4XDCA 3DPDA 3IHPC 4PS3A 1PDXA 3ALBA 4P6VF 3VQIA 1TT5B 5FR3A 2RGFA 2JT4B 2ZNVB 1NDDA 1UUPA 3SEBA 4DHZB 2WDVB 2JF5A 1V49A 2JWZA 1QILA 4ZYSA 4WJOA 4NNJB 1JWMD 2ZVOA 1STEA 3L0WB 2AEHA 3ZNGC 5H92C 3IBEA 5I4DA 2J7QB 1YQBA 3AEAB 2WXKA 3V62A 3H7SA 1SF0A 3BINA 3B08A 1JQ4A 3WANA 2ZVNA 4RGMA 2J53A 4YWGG 1VLBA 1E7VA 1K51A 4MM3B 1FXAA 1N60A 2NBVB 4YL8A 3AE2B 2D2QA 2VRRB 1MJDA 1WXQA 3KQ4A 2FAZA 1LGRA 1R7SA 2O6VA 3QJZA 2KDFB 5IO9A 4AWJA 3VTVA 2KQ7A 1I4HA 1WXSA 1WE7A 3Q8BA 5L95C 2FNJB 1J8CA 4ZRJA 4A20A 3ECIA 2C7MB 5E6PA 4GN1A 4JQWC 4FJYA 3GOEA 3RYTA 2O2VB 5L83A 1E7PB 2XBBC 4MACA 1UWMA 4HRSA 3N9YC 2D07B 4KSKC 2BT6A 5AZGA 4EFOA 4KGRA 2KWDA 3MC0B 2M0XA 2K8HA 3ML8A 4ZDVA 1Y56A 2J52A 1EF5A 2FCQA 1FRRA 2ICIA 3RUIB 4WAAA 4ZHPA 3JW0X 5LXIB 1OQRA 3UIOB 3T3NA 3CMMB 1WSPA 3BYYB 2MBOA 1UWXA 3AE3B 2LEKA 2FUHB 2MJDA 2NTSA 1V5TA 1C78A 3QA8A 3DBSA 1E6EB 2KN5A 1VJKA 2QEJC 2V4LA 3GZNI 1MHHE 2FE8A 3Q8FA 2C7HA 2HDEA 1XQQA 4MGIE 2ZW1A 1UGMA 5C1ZA 1YNTE 2MCNB 1SSNA 3HHMA 5MPOA 3KYCD 1C79A 2ASQA 2D3AA 3VTWA 2BB6A 4RH6A 3DVGX 2N7JA 1L0XB 4CO7A 1ZPSA 3RNFC 3UI3A 3WALA 3DHHC 4MSMB 1T0RC 3FKYA 4A9AA 2BW2A 5H8YE 2BPSA 2INCC 4JX1C 2NTTA 4KSLC 4BKSD 2K6DB 1KLGD 4IC7B 1E7UA 1SE9A 4XZ4A 1OQQA 2KD0A 1U4AA 2LD9A 5AZHA 1WMHB 3NS1A 3CWIA 2YEPF 2XN9C 3N32A 4WJPA 3Q6BA 1IUEA 1ZGUB 1WR1A 4M02A 4A90A 1FFUA 3SD5A 5BYRA 1GUAB 2WXOA 2MWSB 2DZKA 1RFAA 1X1MA 2M19A 2I38A 1GB4A 1SBBB 1JRUA 2LXCA 3JSVB 3V60A 3IG3A 1WX7A 2K39A 2WXRA 3AU5A 2MHJA 3C8YA 2KDIA 5T8IA 1KRHA 2IGHA 1CK1A 4LNKA 1WXAA 2LMCA 1JMLA 1OFFA 2M1MA 2KDEB 2KWVB 2LGDA 2KANA 3APFA 3ZXVA 1JALA 1FCCC 4FBJB 2CU1A 3VAWA 1TKGA 1GAQB 2JX5A 2G45B 3DBRB 5HHDG 1NYRA 3RNEC 4RF1A 3VUWA 3A1QB 2WXQA 2JZPA 3B2FA 2L76A 4YT0B 1M4VA 2MLBA 3RI7C 3U7ZA 4TSSA 1R4MI 3P1MA 5JXVA 3U4EG 4EZJA 5CHWA 5EDSA 3N1YC 3QCAA 4G0NB 3QARA 4WH4A 2D5GA 2RPQA 1YQ3B 3JVZX 4MH0E 3M95A 4AS1A 4C4VA 4NZLB 2G4SA 1QT9A 1WFYA 3LYYA 1XD3B 2GI9A 2GBJA 3ENEA 3LDZE 4DXGA 2RDBC 2LVQA 1H8CA 1IBXB 1TKYA 5LXHA 3VTUA 1DOYA 2FUG1 1Z5SB 2RMMA 4FADA 4GB9A 1L6UA 3AN1A 4M01A 2JVCA 2LZ6A 1FNWA 4JLCA 1VZ8A 2LJIA 1IBXA 2BKFA 1XLQA 2W55A 1MG8A 2X38A 3N20C 1C4PA 4XDDA 2MX2A 2D3CA 1R4MB 1VDVA 4ITKA 2WXMA 2DLBA 2K22A 2GOWA 3QX1A 4KV2A 1SXTA 4MM3A 1MPEA 2KVZA 3WAOA 4PK1A 1J7AA 2B76B 4ACFA 2EKEC 4ZHOA 1D5MC 4I6LB 4S17A 2K1FA 4ZOHC 2KTRA 1VR9A 3DBRI 2KC1A 4EKUA 1WXMA 2IO2B 2WLBA 3NZ3A 3VH4B 1V5OA 2KFKA 2KXJA 1C76A 1FM0D 1WYGA 2V3PA 2ZNVC 2BS2B 4TV3A 4NPNA 4NAMA 2KLGA 4BAXA 2B3AA 2K5PA 3ZUNA 3W1SC 2D3GA 1SE4A 1ZOYB 3UQBA 4ZYNA 2M8SA 2V9HA 3RNCC 2K0PA 2L00B 4KZCA 2NBWB 2Z0EB 1MI0A 2HJ1A 1Y8RC 2X8XX 3HUIA 2WXHA 1WJNA 4NJ7A 3PRPB 1FRDA 4RGOS 3SFDB 1ESFA 1T5XD 4I6PA 3AEBB 1VZ7A 1WX9A 2LXAA 4K3CA 2INDC 3URYA 4B0EA 3CSTA 4WWNA 2KVRA 4OZAA 1E8ZA 2KNBA 5JHBA 2L32A 2KLCA 3UINB 4KDIC 4F8CB 1NENB 4ANWA 2GBRA 3TEWA 2RR9A 4USAA 2L83A 3IXSA 3AEEB 2WDRB 4WJQA 4IOIE 3PS6A 4GDLB 1FO4A 3VVWB 3FILA 3BVGA 4W9DA 1OEYJ 3MHSD 4DHJB 3TEXA 3L17A 1IPGA 2IPKD 1PGAA 2KX0A 3AE5B 4IG7B 5D94A 2BYTA 2JSVX 4GXBA 2L05A 1SIFA 1WYWB 1ROEA 1TYGB 3W1YA 1HA5A 3QHTA 4J6IA 3RNBC 2MA9B 2QIEB 2PVOD 4FULA 2NPTB 2RSUA 2LUMA 4W9LA 4WIPA 1KLVA 1RWSA 2CS4A 2Z59B 1GC6A 1DOIA 4MELA 4OZBA 3LJ3A 2NVUI 3WAPA 1F2RI 3ZTCA 3DHGC 3EFUA 2L0FA 4FXCA 3UGBB 3UQAA 1KH0A 2IBIB 4A6QA 1I4GA 4IWQA 3KUDB 1WF9A 1P9DU 2PIAA 4NQLB 1YN4A 2DBYA 4GU2A 3I63C 3QWZB 4YSZB 2KJ6A 2LASA 1QKZA 2AQ2B 1XLNA 1TTNA 1Q5WB 4G50A 3OJ4B 1WZ0A 3U30A 3ZRCA 2DAJA 3TUOA 2PW9A 3N1ZC 2N7EA 1FMAD 1C9FA 4US9A 1WM2A 1A70A 1ZXHA 3EFCA 3V3XA 3UIPB 3Q3NC 3GE3C 1QOBA 2WXFA 4IKGA 3LB8C 4FA6A 1N6ZA 1FXTB 4WJNA 3L54A 2O6VD 4IM3A 3NS8A 1HQRD 1F0ZA 2TSSA 2J42A 2N9LA 1YOVB 1E90A 4Q2JA 2QILA 2WP9B 2LVOA 1EO6A 5J17A 3V05A 1KOTA 3KUCB 2MP2A 2UWQA 4A3PA 2PJHA 1UELA 4ANXA 2PKOA 2MH7A 1KLUD 2LRWA 5BMHA 1TS2A 1J19A 1I7HA 1QF6A 3VUXA 1YIWA 3BK2A 1ISNA 3TL5A 3RFZB 3ZQ4A 2FCNA 1HXYD 1MHXA 1WX8A 4B95A 3O65B 3OJ3A 4OVZA 4W9CA 2QJLA 1RLFA 3RMKC 3B0AA 4BOSC 2J4XA 2YLMA 5C2TB 1D5ZC 1GOZA 3RPFC 5EE3A 1WJUA 1GC7A 2FIFA 2N4FA 2DZIA 5BMIA 3VRBB 4LDTB 4AOFA 4RGNA 2LVPA 2WXIA 3I3TB 2C60A 1K8RB 2WHIA 2PVGC 3NY5A 1OTRB 2WDQB 1GG3A 1IGCA
chains in the Genus database with same CATH topology
1ZPSA 3MHZA 1L4ZB 1QLBB 3UI3A 1VRAB 4L1BA 4WWMA 3AB5A 3MJ5A 1N5WA 1NI3A 2DYMA 3P4PB 2Y5CA 2BW2A 5H8YE 4A9AA 1V8CA 3Q8CA 3VR8B 4JX1C 2KACA 4GDKB 2NTTA 4GLSC 2AX5A 2IDYA 1KLGD 2KDMA 2V4IB 1V1OA 3R8BA 1D6EC 1OQQA 2K3UA 2KAJA 1RM6C 4EE2A 4DQOC 3AH7A 1UGJA 3ZJTA 1KFYB 3AE6B 4N58A 4TMAB 2AQ1B 3FC4A 2BBCA 4D2KA 3NS1A 4YSYB 2XNAC 3CWIA 1V1PB 3NUHB 2YEPF 3T3OA 2XN9C 1I4XA 3ZJVA 1JW9D 1IUEA 2E6XA 4C7ZA 1E9MA 3DWMA 4JPSA 4M0WA 3U2SC 4XE0A 1E10A 4A90A 1FFUA 5FK9C 5BYRA 2WXOA 1RFKA 3EGRA 3AE7B 4UDUC 4US8A 3AV8A 2M19A 2I38A 1XO3A 1GB4A 1SE3A 1SBBB 1FCLA 1DOXA 2DYOA 5G5GA 1V1PA 2IGDA 2WXRA 1F77A 5HI1A 3NVVA 3C8YA 5T8IA 3TEYA 1KRHA 2IGHA 3O13A 1CK1A 1FNVA 1ET6A 2LMCA 3B9JA 1JMLA 1OFFA 5D3DA 2N9KA 1JRPA 1SE2A 1BMLC 3EA6A 3VR9B 1P7FA 3LXFA 1YN5A 1YJIA 1JALA 1FCCC 2GB1A 4MT5A 3KWVA 4N59A 1TKGA 3GS2A 1JCKB 1GAQB 1ZDXA 2JX5A 5BMGA 2ACZB 1TY0A 1QOAA 2W3SA 1QOFA 3IT6B 1L6VA 5HHDG 1NYRA 1Q10A 1EM7A 1TZOA 4HJGE 4RF1A 2JXTA 3VRAB 5D3IB 2WXQA 2JZPA 3B2FA 4YT0B 1M4VA 4YSXB 4YTMB 2FBWB 1EWCA 4KKIA 2MEKA 1VZ6A 3U7ZA 3BZDB 1QQRA 3HRDD 3P1MA 4TSSA 2ON8A 5JXVA 2KN4A 4RF0A 4XWTA 3U4EG 1K50A 1C4AA 3R2IA 3HVZA 4IDIA 3PZ8A 5E6JA 1NVID 4WH4A 2D5GA 1YQ3B 5D7GA 1ZE3D 1N61A 2Z8LA 2JYEA 2WQYB 2YEPB 4AS1A 3ZYYX 1GPXA 1YN3A 4NZLB 4ARCA 1EU4A 1N62A 1QT9A 1I4PA 2NMQA 1PGXA 3LYYA 4RFBA 2GI9A 1QOGA 1JWSD 2JQRB 3NVWA 1SJHD 4KKJA 1D5XC 4KGSA 4DXGA 3P42A 4TQ0A 2I2YA 1IBXB 1TKYA 4LK0M 1RYJA 5BYQA 1DOYA 1NEKB 4L2YA 4KGTA 2FUG1 4HROA 2RMMA 2ZW0A 3WCQA 1BXTA 4B0MA 5EE1A 3AMZA 1L6UA 3AN1A 3OWEB 1K52A 4JE3B 1FNWA 2Y3AA 2L1AA 2Y5PA 1D4BA 2OHFA 1VZ8A 3ZJUA 2LFIA 2DWQA 2LJIA 1KTKA 3AEGB 3W1SA 1IBXA 1ET9A 2PMVA 1XLQA 1ZXIA 2RDGA 2KQ4X 2W55A 4RGTA 2X38A 4XDDA 1C4PA 2WU2B 1DYQA 2PLPA 2Q5WD 1VDVA 1B9RA 2IGGA 3PZ7A 4ITKA 4AQ7A 4JWUC 2WXGA 2GRIA 2N0SB 2WXMA 2DLBA 2K22A 1HEZE 1WGKA 4R3DA 1J7BA 2INPE 1SXTA 5EE9A 2JWUA 1MPEA 3KWLA 1J7AA 2B76B 3ABVB 2LHDA 4ZHOA 1SEBD 5LNK1 1D5MC 2VZKD 4ZOHC 1VR9A 5FKAC 2EKIA 4L23A 4A8XC 5HG2A 1T3QA 3NZ3A 2WLBA 4H2AA 2HTME 4CQNA 2G9HD 5EE0A 1YMHE 2MJ3A 3EUB2 3ZGZA 1C76A 1L0YB 4N6EB 1FM0D 1WYGA 2V3PA 2BS2B 1EU3A 3TEZA 1DGJA 4XWWA 2ONQA 1NYQA 4ZRPA 4NAMA 4MH8A 4ZRQA 2W82A 4YTPB 2K5PA 1I4RA 1WRIA 4LLGM 1XCTL 1JROA 1SE4A 2IJ0A 3BIID 4JWSC 1ZOYB 5G5HA 1HZ5A 3HVDA 3AM9A 3P4RB 4KX6B 3W5VB 1CJEA 1PYWD 2K0PA 1MI0A 3FILB 5AUIA 3HUIA 3PO0A 1I4QA 2WXHA 1JWAD 1FRDA 4RGOS 4HKQA 1SIJA 1ESFA 3SFDB 1T5XD 3BK1A 1TS3A 2BS4B 3AEBB 3MFGA 2V3NA 3GP7A 1F2RC 1VZ7A 4RNAA 4ARIA 3I57A 3BYTB 1L5PA 4PT5A 4YXDB 2OEDA 3P4QB 4REZA 4HEA1 3URYA 1FNUA 2MJEA 4B0EA 2KMMA 1L0VB 4OZAA 3W5UB 2AQ3B 1FD6A 3NVZA 5GXGB 3AE1B 2L52A 3NVYA 5AUKA 2L32A 2PTLA 5TSSA 2EELA 1NENB 4C56C 3CIRB 1PFDA 1ZDVA 2CJNA 3TEWA 1N63A 3DWGC 1E0ZA 2QMTA 1XLPA 3E56A 4USAA 1YQ4B 2L83A 2M56B 2CU3A 3IXSA 3U52E 3AEEB 2WDRB 3BWUD 4DXFA 1JWBD 4IOIE 4NAWB 4C7YA 4XDCA 2V0GA 4GDLB 1PDXA 1FO4A 3W9CB 3FILA 3BVGA 4P6VF 3VQIA 5FR3A 1UUPA 3SEBA 2K9XA 3P4SB 2WDVB 3TEXA 2CJOA 2IPKD 1PGAA 1EWYC 3H8HA 3I9V1 1QILA 3AE5B 4OHJA 1FIQA 4ZYSA 1JWMD 1STEA 2BYTA 2JSVX 1PUTA 4RCOA 1ROEA 1UNSA 1TYGB 1HA5A 4A55A 5H92C 1AWDA 5I4DA 2WXPA 5BYSA 4TQ1A 3AEAB 3AECB 1C77A 1TY2A 2H89B 2QIEB 1SJED 2PVOD 2WXKA 2RPVA 2LUMA 1CZPA 3IAS1 4WIPA 1SF0A 1YJJA 1XXGA 1RWSA 3SR6A 1JQ4A 1DOIA 2VZKB 4RGMA 2J53A 3ETRA 4OZBA 3B2GA 4YWGG 1VLBA 1F2RI 1TS5A 4FXCA 3FAHA 1K51A 4MM3B 1KH0A 2WXJA 2WXNA 3BVZA 3KLSX 1AW7A 1FXAA 4A6QA 1I4GA 1N60A 3AE9B 1C4CA 2BTEA 1JWUD 2PIAA 1YN4A 2DBYA 3AE2B 2LGIA 1WXQA 3KQ4A 1B1ZA 1R7SA 1ZUD2 1AN8A 4HKZE 3IT4B 1I4HA 1T6BX 4YSZB 1QKZA 1ENFA 2AQ2B 4O1NA 1XLNA 1ZP0B 4P16A 3Q8BA 1LO5D 1N5XA 3Q69A 3TUOA 2BS3B 2PW9A 3AEDB 2QSDA 2LHEA 1FMAD 1C9FA 4US9A 1ZXHA 1A70A 1CQVA 3V3XA 4OZCA 2W54A 3E9SA 1IGDA 5C3JB 1QOBA 2WXFA 4C80A 4IKGA 1E7PB 1TJEA 1P7EA 4MACA 3LB8C 1UWMA 4HRSA 3N9YC 3TSSA 1XLOA 2BT6A 2SAKA 1XCQL 5HFYA 3NRZA 4KGRA 2KWDA 3MC0B 1FXIA 1HQRD 1F0ZA 2TSSA 4WAFA 2J42A 2N9LA 2WXLA 3GB1A 1TKEA 4Q2JA 2INNE 2QILA 3R2TA 1Y56A 2WP9B 2J52A 4J3OD 1MVKA 3V05A 1FRRA 2ICIA 4ZHPA 4YTNB 1AYFA 2RDHA 1TS4A 2R61A 3AE8B 1OQRA 2MH7A 2H88B 2PKOA 1KLUD 4OW0A 2WU5B 5BMHA 3T3NA 1WSPA 1TS2A 2WS3B 3BYYB 3J9CA 3P63A 1PGBA 3Q8AA 1I7HA 1QF6A 1UWXA 3AE3B 2E3TA 2LEKA 1K53A 3IAM1 3BK2A 1BUIC 3RFZB 3ZQ4A 2MJDA 2NTSA 4NJCA 1C78A 1XEEA 1V97A 1HZ6A 1HXYD 1MHXA 1E6EB 4WURA 4OVZA 2QJLA 1VJKA 2BB5A 2QEJC 1FFVA 4WQMA 1MHHE 1GB1A 2FE8A 2J4XA 2M0AA 3AEFB 3Q8FA 5C2TB 1D5ZC 1GOZA 1FEHA 2HDEA 3BVMA 3RPFC 3L4PA 5EE3A 2ZW1A 2G1EA 1YNTE 3SFEB 1XF5L 1SSNA 3W2DA 3Q8EA 5MPOA 2W3RA 4LTUA 5BMIA 2WNMA 1ACCA 1C79A 1WWTA 3MP9A 3VRBB 1J7CA 1KF6B 1SB3C 4RGNA 2JYTA 2WXIA 2BB6A 4RH6A 2SEBD 2JU6X 1L4DB 2PVGC 3AE4B 2N7JA 1L0XB 2WDQB 1IGCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LFI A;  3I57 A;  3LYY A;  4MT5 A;  3NZ3 A;  3Q69 A; 
#chains in the Genus database with same CATH topology
 3P2B A;  2MP2 B;  2BF8 B;  3K9P B;  3RT3 B;  3MJ5 A;  1N5W A;  3P4P B;  3VH3 B;  5DPW A;  1HTO A;  2JRI B;  1V8C A;  3Q8C A;  3L10 B;  3HIZ A;  3UF8 A;  2KAC A;  4GLS C;  3TCA A;  1WIA A;  3N30 A;  4XGA B;  1WGR A;  3R8B A;  4EE2 A;  1R4N I;  1UGJ A;  3FC4 A;  5CX3 A;  4E74 A;  4C7Z A;  4JPS A;  4M0W A;  5D2M B;  2V1Y A;  5FK9 C;  4EEW A;  1RFK A;  4UDU C;  4US8 A;  3RNA C;  2CKH B;  1FCL A;  4LNO A;  3H9D A;  2GLS A;  3RUL A;  5G5G A;  2IGD A;  3TEY A;  4JIO U;  3O13 A;  1FNV A;  4II2 B;  1ET6 A;  1SE2 A;  1BML C;  1V86 A;  1YN5 A;  4W9E A;  1YJI A;  5BO4 B;  1VD2 A;  1T0Q C;  4PS7 A;  3AUL A;  3KWV A;  2HTH A;  1JCK B;  5D3I B;  2KJR A;  4YTM B;  2FBW B;  4DWF A;  3S2A A;  4E3C A;  1QZE A;  3RD2 A;  3BZD B;  5G55 A;  3HRD D;  3ML9 A;  2ON8 A;  1HE8 A;  3KYD D;  3Q3M C;  5JH5 C;  3HVZ A;  4IDI A;  3PZ8 A;  5E6J A;  4HDQ A;  1BT0 A;  4G11 A;  5D7G A;  1ZE3 D;  1R4N B;  1OEY A;  1GPX A;  1YN3 A;  4ARC A;  3ZO5 B;  1N62 A;  2MBH A;  1I4P A;  4K7U A;  2J0J A;  1QOG A;  1Q0W B;  1D5X C;  2LI5 A;  5AZF A;  4MSQ B;  1NEK B;  4IM2 A;  2ZW0 A;  4I6N B;  1BXT A;  1P3Q U;  4RM9 A;  5EE1 A;  3DBL B;  4X57 B;  2L1A A;  1D4B A;  2OHF A;  2LFI A;  3DOW A;  2K25 A;  2RDG A;  4RGT A;  4K81 A;  2PLP A;  2Q5W D;  4AQ7 A;  2I1K A;  2WXG A;  2GRI A;  2N0S B;  3A9K A;  2PE6 B;  3B1L X;  2WDT B;  4K7W A;  2QHO A;  3KWL A;  1UH6 A;  3NG0 A;  2VZK D;  3PPA A;  3APD A;  5FKA C;  2EKI A;  4L23 A;  3JSV A;  1T3Q A;  4ZRK A;  2HE7 A;  4RMA A;  2KFJ A;  3NZS A;  2DNF A;  1L0Y B;  4N6E B;  2KMA A;  1EU3 A;  1DGJ A;  4XWW A;  4HLE A;  4MH8 A;  4YTP B;  5IA7 A;  1I4R A;  2CHW A;  4ICU A;  2IJ0 A;  3A9J B;  3HM3 A;  1CJE A;  3HK0 A;  2L3Z A;  5AUI A;  4JL9 A;  1M94 A;  2BYE A;  1KM7 A;  2V3S A;  1WGH A;  1Q1O A;  1F2R C;  4OVV A;  2MBE A;  4NY0 A;  4ARI A;  3I57 A;  1L5P A;  3RNG C;  4YXD B;  4W9G A;  3IVF A;  5IOI A;  1WXV A;  5AEK B;  3W5U B;  1FD6 A;  3AE1 B;  3CSF A;  2PTL A;  5TSS A;  1UBI A;  1V6E A;  2BKR B;  5KHO A;  3DWG C;  1XLP A;  3E56 A;  3A1Q A;  2M56 B;  2CU3 A;  3BWU D;  1JWB D;  4NAW B;  3VFK A;  1WE6 A;  2DZJ A;  1IYF A;  4IW0 A;  4K1R B;  3PRM B;  2K9X A;  3PT2 B;  4F1S A;  2FCM A;  2CJO A;  1L7Y A;  3VXW A;  3H8H A;  1EWY C;  1FIQ A;  2D3B A;  2OJR A;  5IKC M;  4IWO A;  4GSW A;  1PUT A;  1T0S C;  5J2R A;  4RCO A;  2IY1 B;  3Q3F A;  1UNS A;  3DVN V;  4A55 A;  5KHQ A;  1AWD A;  3TJP A;  5BYS A;  4TQ1 A;  4IWP A;  1WRD B;  2H89 B;  2JZZ A;  3QIJ A;  4XX5 A;  1SJE D;  2ZCB A;  3M63 B;  1FPY A;  4KIK B;  3IAS 1;  2K6Q A;  3SR6 A;  3H6N A;  2N9X A;  3MTN B;  2OOB B;  4MDK E;  3V61 A;  1TS5 A;  3N3K B;  3PLV A;  3FAH A;  5JZE B;  2C9W B;  2WXJ A;  3KLS X;  3BVZ A;  1AW7 A;  2PPH A;  4URK A;  3AE9 B;  1C4C A;  2BTE A;  5G2N A;  3ZDM C;  2PEA A;  2LGI A;  2N1V A;  4BZA A;  3PHW B;  2CHX A;  2FCS A;  1AN8 A;  2GMI C;  1T6B X;  1V80 A;  4MGY E;  1ENF A;  1UF0 A;  1ZP0 B;  3A9K B;  3R7R A;  1UBQ A;  5E6O A;  3Q2A C;  1N5X A;  2BS3 B;  2C7N B;  3AED B;  4ASW C;  2LHE A;  1CQV A;  3E9S A;  3A33 B;  2R2O A;  3ZNI D;  3VUY A;  4F7Z A;  1P7E A;  2BGF A;  1WGD A;  3TSS A;  4DHZ E;  5HFY A;  4CHK A;  1FXI A;  3M3J A;  2L0T A;  2WXL A;  3GB1 A;  1TKE A;  1EUV B;  2MBB B;  2DZM A;  2IO3 B;  3R2T A;  3R7Q A;  2KC2 A;  3TBL D;  1Z2M A;  3ZDT A;  4YTN B;  1AYF A;  2R61 A;  2ZZP B;  3AE8 B;  2H88 B;  1EF1 A;  3P63 A;  3H7P A;  2LRU A;  3Q8A A;  1PGB A;  3DBH I;  2E3T A;  3U8Z A;  4IM0 A;  1BUI C;  4MGZ E;  3K9O B;  1WZ3 A;  4NJC A;  1XEE A;  1YX6 B;  4WUR A;  4A3O A;  2BYF A;  4BKG A;  2ZPY A;  4WQM A;  2YVC A;  1GB1 A;  2QDF A;  1FEH A;  2EMS A;  4LJP B;  2UYZ B;  3L4P A;  1V2Y A;  2G1E A;  2N7D A;  2VH2 A;  3MC8 A;  3HM6 X;  3A9J A;  1HTQ A;  3Q8E A;  2W3R A;  4LTU A;  2WNM A;  3KH0 A;  1ACC A;  3MP9 A;  2REX A;  1SB3 C;  4EOY A;  3VHT C;  2DX5 B;  1MFW A;  2JU6 X;  2W9N A;  3PO0 A;  2YEP B;  2AWT A;  4M8M A;  3MHZ A;  1L4Z B;  1QLB B;  2IO1 B;  3AB5 A;  3C19 A;  1P0R A;  4GDK B;  3TMP B;  1AAR A;  1V1O A;  1D6E C;  2K3U A;  2KAJ A;  2MW5 A;  4DQO C;  3AH7 A;  3DQV A;  1SGH A;  4HWI B;  3AE6 B;  2D11 A;  3A4R A;  4TMA B;  3T8M A;  4D2K A;  3NZU A;  1I4X A;  5FR6 A;  3TIX A;  1E9M A;  3DWM A;  5DCN A;  2K8B A;  4XE0 A;  1I42 A;  2JZ3 B;  4AJW A;  3EGR A;  1LM8 B;  3AE7 B;  3AV8 A;  1XO3 A;  1SE3 A;  3C0R B;  3KW5 B;  4AUQ C;  2CR5 A;  2DYO A;  2LJ5 A;  1V1P A;  1F77 A;  1E5W A;  2LGX A;  3NVV A;  3H7P B;  1TGZ B;  4GOC A;  2JRH A;  1A5R A;  5D3D A;  4BBN F;  2N9K A;  3ZKJ C;  3EA6 A;  3VR9 B;  1P7F A;  2WWZ A;  4HPP A;  4N59 A;  3GS2 A;  2WX1 A;  2O6V B;  3ZXR A;  2ACZ B;  5DPR A;  1TY0 A;  1QOA A;  2W3S A;  1QOF A;  3IT6 B;  1TZO A;  1EM7 A;  4HJG E;  2JXT A;  3SU8 X;  3ZVV A;  2QCZ A;  4YSX B;  5E6N A;  3ONS A;  4PYZ A;  4LNF A;  2BWF A;  5IP4 D;  2KN4 A;  4RF0 A;  3DHI C;  1C4A A;  3R2I A;  2IZV B;  3IFW B;  5C23 A;  3X23 A;  1C3T A;  2XK5 B;  4ZRI A;  3ZLZ A;  1N61 A;  3DVN U;  2JYE A;  2WQY B;  2PE9 A;  3L13 A;  3EC8 A;  2KKC A;  3RN9 C;  3V6E B;  2NMQ A;  4RFB A;  4HCN B;  1WH3 A;  3NVW A;  1SJH D;  4HPL B;  3RZF A;  4EZK A;  1WM3 A;  1E8X A;  4BOZ B;  5HKH A;  3P42 A;  4TQ0 A;  2KWC A;  2I2Y A;  4LK0 M;  1RYJ A;  4W9K A;  2L8J A;  5BYQ A;  4LJO B;  4HRO A;  1L2N A;  5IN7 A;  3WIM A;  4B0M A;  4M00 A;  3AMZ A;  3OWE B;  1K52 A;  2NCN A;  3I5J C;  4HJK A;  2Y3A A;  2JXX A;  3ZJU A;  1KTK A;  3AEG B;  5J18 A;  3NHE B;  1ET9 A;  4GIV A;  2KQ4 X;  4M0W B;  3GZN B;  1DYQ A;  4NJ6 A;  4W9I A;  2ZEQ A;  4JWU C;  3PZD A;  4B9K A;  2INP E;  4DK5 A;  2LHD A;  3ZNZ B;  5LNK 1;  4ICV A;  3AXC A;  4A8X C;  5HG2 A;  4H2A A;  1OQY A;  4CQN A;  2G9H D;  5EE0 A;  4EZL A;  1YMH E;  2VH1 A;  4NQK E;  5CHF A;  1V9J A;  2NBU A;  4JGH B;  3TEZ A;  4KDL B;  2MSE D;  2ONQ A;  4ZRP A;  3AU4 A;  2W82 A;  4LLG M;  3PV1 A;  3BII D;  4AJY B;  3HVD A;  1YJ1 A;  1PYW D;  1S3S G;  3OLM D;  3R66 C;  2R2Q A;  4FHK A;  4WWO A;  3GE8 C;  1JWA D;  4HPM B;  4LNN A;  3BK1 A;  1TS3 A;  4TKN A;  3EHV A;  2KDB A;  2A4Z A;  4HVB A;  3GP7 A;  2QC8 A;  4RNA A;  3BYT B;  4PT5 A;  2OED A;  3PRE A;  2K8C A;  4HEA 1;  3U7D A;  1FNU A;  5CTR C;  2KMM A;  4FN2 A;  4WWP A;  3NOB A;  3BY4 B;  4HDO A;  2BWE S;  2L52 A;  3NVY A;  4K3B A;  4C56 C;  3QQ8 B;  3SDL C;  1ZDV A;  1VCB A;  2JY6 A;  2KFK B;  1PQS A;  4LDT D;  2QMT A;  3U52 E;  4C7Y A;  2V0G A;  4HCP B;  2NPT A;  3W9C B;  2KWU B;  1WI0 A;  3P4S B;  4GDK A;  1WGG A;  3Q3J A;  3I9V 1;  4OHJ A;  3D32 A;  2MRP A;  2LUE A;  3DBL I;  4OVU A;  2KK8 A;  2WXP A;  3AEC B;  1C77 A;  1TY2 A;  2UU7 A;  4P1B C;  2RPV A;  1CZP A;  1D3Z A;  3A4S C;  3QK0 A;  1YJJ A;  1XXG A;  4N9F 4;  1J0G A;  2VZK B;  3L16 A;  3ETR A;  3B2G A;  1XT9 B;  2WYQ A;  1RRB A;  2WXN A;  1JWU D;  2N9E B;  2KTR B;  1I35 A;  1GJZ A;  1B1Z A;  1ZUD 2;  4HKZ E;  3IT4 B;  3PSE B;  4O1N A;  2AYO B;  4P16 A;  3L08 A;  1LO5 D;  3Q69 A;  3RZW C;  2QSD A;  1P1A A;  1WR6 E;  4OZC A;  2KO3 A;  2W54 A;  3CF6 E;  1IGD A;  5GMV A;  5C3J B;  4ANU A;  3Q3O C;  4C80 A;  4GDL A;  1TJE A;  3M62 B;  1XLO A;  1T0Y A;  2SAK A;  4DDI D;  4FJZ A;  1XCQ L;  1WMH A;  3NRZ A;  2HJ8 A;  1CMX B;  4WAF A;  1C1Y B;  4C00 A;  2INN E;  4BKT A;  2O2V A;  4J3O D;  3ZNH B;  1MVK A;  4M8N A;  2DAF A;  2LGS A;  2RDH A;  1TS4 A;  2OJW A;  4BKS A;  4MJS A;  4OW0 A;  4BVU C;  2KX3 A;  2WU5 B;  3DBH B;  2GBK A;  2WS3 B;  3J9C A;  3MJW A;  5JHA A;  3DDC B;  1K53 A;  3IAM 1;  3X0W A;  4DDG D;  4MJS B;  5LLI A;  1ZKH A;  1V97 A;  1HZ6 A;  2KQS A;  2ZJD A;  2BB5 A;  1FFV A;  2M0A A;  3AEF B;  3APC A;  3MC9 A;  3BVM A;  4DBG A;  2BVC A;  3SFE B;  1XF5 L;  3W2D A;  3PTF C;  1RAX A;  4BBN C;  4GMV A;  1WWT A;  1UZX B;  1WGY A;  1J7C A;  1KF6 B;  2JYT A;  1TZ1 A;  3OAW A;  2SEB D;  1L4D B;  3AE4 B;  4RM8 A;  2AL3 A;  3DVG Y;  3PGE A;  1F52 A;  1LQB A;  1VRA B;  4EUT A;  4L1B A;  2IYD B;  4WWM A;  4ANV A;  2DYM A;  1NI3 A;  2Y5C A;  3VR8 B;  4LNI A;  2NS5 A;  2AX5 A;  3DCG A;  3JYU A;  2IDY A;  2WGS A;  2KDM A;  2V4I B;  4C4V B;  2XK5 A;  5DPS A;  1RM6 C;  2DEN B;  3EEC A;  3NJT A;  4WQO B;  3ZJT A;  2KTF A;  1KFY B;  4N58 A;  1TBE A;  2AQ1 B;  2BBC A;  4YSY B;  2XNA C;  1V1P B;  2KHW B;  3NUH B;  1UD7 A;  3T3O A;  3ZJV A;  1JW9 D;  2KYW A;  2E6X A;  4G3X B;  3U2S C;  1E10 A;  1F1H A;  2KOX A;  2RD0 A;  3PVL A;  2JUO A;  1ZW7 A;  2EMT A;  4S0R A;  2JPH A;  4TUU A;  2ZPN A;  1WJ6 A;  4E71 A;  4II3 B;  1DOX A;  2M4N A;  2AL6 A;  2Z0D B;  1LFD A;  5HI1 A;  3WA0 A;  2MQJ A;  3N1X C;  3B9J A;  2DYB A;  2J0M A;  1JRP A;  2G4D B;  3KVF B;  2I1J A;  3LXF A;  4PYU A;  2GB1 A;  1GNU A;  1MG4 A;  1LXD A;  4MT5 A;  1ZDX A;  4KVG B;  3ZRF A;  1G6J A;  5BMG A;  1L6V A;  1Q10 A;  2LGY A;  3VRA B;  2HD5 B;  1E8Y A;  2D10 A;  4KZ0 A;  5D6J B;  4DXA B;  1EWC A;  3QAQ A;  2MEK A;  4KKI A;  1VZ6 A;  1QQR A;  2KZR A;  3SHQ A;  3R3M A;  4XWT A;  5CHV C;  1K50 A;  2GBM A;  4P7I A;  5IAA C;  4AP4 C;  2M17 A;  1NVI D;  2GBN A;  2DHZ A;  4B6W A;  2Z8L A;  3T9L A;  4HXD A;  1F9J A;  3ZYY X;  2XEW A;  1EU4 A;  2A5U A;  1PGX A;  1OGW A;  1JWS D;  2JQR B;  5DPT A;  1NI2 A;  4KKJ A;  2G3Q B;  4KGS A;  1V81 A;  2MBQ A;  4L2Y A;  4W9F A;  4KGT A;  4FJV B;  3WCQ A;  2Y5B B;  2N9P C;  2BYV E;  4XC2 A;  4JE3 B;  2Y5P A;  4MGK E;  4GGQ A;  2DWQ A;  1P98 A;  3W1S A;  2N1W A;  2PMV A;  1H4R A;  2BQQ A;  1ZXI A;  3ZIM A;  2WU2 B;  2KT7 A;  3QC8 B;  3H1U A;  1B9R A;  2IGG A;  3PZ7 A;  4W9H A;  3RCZ A;  1YX5 B;  1HEZ E;  1WGK A;  4R3D A;  1J7B A;  5EE9 A;  2JWU A;  1IP9 A;  3ZTD A;  3ABV B;  1SEB D;  3KUZ A;  2FID A;  2HTM E;  1NBF C;  1WJ4 A;  2MJ3 A;  4PS8 A;  2LWP A;  3EUB 2;  3ZGZ A;  2ZCC A;  1E8W A;  4IUM B;  4QAY A;  3ZW3 A;  4CYE A;  2NR2 A;  1NYQ A;  3PLU A;  3Q14 C;  2WX0 A;  4ZRQ A;  5TR5 A;  1YD8 U;  1WRI A;  1XCT L;  1JRO A;  2C5L C;  4JWS C;  5G5H A;  1HZ5 A;  4DHJ D;  3AM9 A;  3P4R B;  4KX6 B;  3W5V B;  4BFR A;  4FHJ A;  2CHZ A;  4W9J A;  2IO0 B;  2KJH B;  3FIL B;  2J0K A;  1I4Q A;  4MEM A;  2IY0 B;  2L7R A;  4HKQ A;  1SIJ A;  1TIF A;  2BS4 B;  4LCD E;  3MFG A;  2V3N A;  4P1C C;  4HK2 A;  3P4Q B;  3AI5 A;  3PHX B;  2KMC A;  4REZ A;  3PRZ A;  2MJE A;  1L0V B;  1KJT A;  2AQ3 B;  4KIK A;  3NVZ A;  5GXG B;  4XYC A;  1WY8 A;  5AUK A;  4NAW A;  4FLH A;  4K7S A;  2EEL A;  3CIR B;  1PFD A;  2CJN A;  3V6C B;  3VDZ A;  3WAM A;  1N63 A;  1E0Z A;  3OG5 A;  1YQ4 B;  4DXF A;  1S1Q B;  4XDC A;  3DPD A;  3IHP C;  4PS3 A;  1PDX A;  3ALB A;  4P6V F;  3VQI A;  1TT5 B;  5FR3 A;  2RGF A;  2JT4 B;  2ZNV B;  1NDD A;  1UUP A;  3SEB A;  4DHZ B;  2WDV B;  2JF5 A;  1V49 A;  2JWZ A;  1QIL A;  4ZYS A;  4WJO A;  4NNJ B;  1JWM D;  2ZVO A;  1STE A;  3L0W B;  2AEH A;  3ZNG C;  5H92 C;  3IBE A;  5I4D A;  2J7Q B;  1YQB A;  3AEA B;  2WXK A;  3V62 A;  3H7S A;  1SF0 A;  3BIN A;  3B08 A;  1JQ4 A;  3WAN A;  2ZVN A;  4RGM A;  2J53 A;  4YWG G;  1VLB A;  1E7V A;  1K51 A;  4MM3 B;  1FXA A;  1N60 A;  2NBV B;  4YL8 A;  3AE2 B;  2D2Q A;  2VRR B;  1MJD A;  1WXQ A;  3KQ4 A;  2FAZ A;  1LGR A;  1R7S A;  2O6V A;  3QJZ A;  2KDF B;  5IO9 A;  4AWJ A;  3VTV A;  2KQ7 A;  1I4H A;  1WXS A;  1WE7 A;  3Q8B A;  5L95 C;  2FNJ B;  1J8C A;  4ZRJ A;  4A20 A;  3ECI A;  2C7M B;  5E6P A;  4GN1 A;  4JQW C;  4FJY A;  3GOE A;  3RYT A;  2O2V B;  5L83 A;  1E7P B;  2XBB C;  4MAC A;  1UWM A;  4HRS A;  3N9Y C;  2D07 B;  4KSK C;  2BT6 A;  5AZG A;  4EFO A;  4KGR A;  2KWD A;  3MC0 B;  2M0X A;  2K8H A;  3ML8 A;  4ZDV A;  1Y56 A;  2J52 A;  1EF5 A;  2FCQ A;  1FRR A;  2ICI A;  3RUI B;  4WAA A;  4ZHP A;  3JW0 X;  5LXI B;  1OQR A;  3UIO B;  3T3N A;  3CMM B;  1WSP A;  3BYY B;  2MBO A;  1UWX A;  3AE3 B;  2LEK A;  2FUH B;  2MJD A;  2NTS A;  1V5T A;  1C78 A;  3QA8 A;  3DBS A;  1E6E B;  2KN5 A;  1VJK A;  2QEJ C;  2V4L A;  3GZN I;  1MHH E;  2FE8 A;  3Q8F A;  2C7H A;  2HDE A;  1XQQ A;  4MGI E;  2ZW1 A;  1UGM A;  5C1Z A;  1YNT E;  2MCN B;  1SSN A;  3HHM A;  5MPO A;  3KYC D;  1C79 A;  2ASQ A;  2D3A A;  3VTW A;  2BB6 A;  4RH6 A;  3DVG X;  2N7J A;  1L0X B;  4CO7 A;  1ZPS A;  3RNF C;  3UI3 A;  3WAL A;  3DHH C;  4MSM B;  1T0R C;  3FKY A;  4A9A A;  2BW2 A;  5H8Y E;  2BPS A;  2INC C;  4JX1 C;  2NTT A;  4KSL C;  4BKS D;  2K6D B;  1KLG D;  4IC7 B;  1E7U A;  1SE9 A;  4XZ4 A;  1OQQ A;  2KD0 A;  1U4A A;  2LD9 A;  5AZH A;  1WMH B;  3NS1 A;  3CWI A;  2YEP F;  2XN9 C;  3N32 A;  4WJP A;  3Q6B A;  1IUE A;  1ZGU B;  1WR1 A;  4M02 A;  4A90 A;  1FFU A;  3SD5 A;  5BYR A;  1GUA B;  2WXO A;  2MWS B;  2DZK A;  1RFA A;  1X1M A;  2M19 A;  2I38 A;  1GB4 A;  1SBB B;  1JRU A;  2LXC A;  3JSV B;  3V60 A;  3IG3 A;  1WX7 A;  2K39 A;  2WXR A;  3AU5 A;  2MHJ A;  3C8Y A;  2KDI A;  5T8I A;  1KRH A;  2IGH A;  1CK1 A;  4LNK A;  1WXA A;  2LMC A;  1JML A;  1OFF A;  2M1M A;  2KDE B;  2KWV B;  2LGD A;  2KAN A;  3APF A;  3ZXV A;  1JAL A;  1FCC C;  4FBJ B;  2CU1 A;  3VAW A;  1TKG A;  1GAQ B;  2JX5 A;  2G45 B;  3DBR B;  5HHD G;  1NYR A;  3RNE C;  4RF1 A;  3VUW A;  3A1Q B;  2WXQ A;  2JZP A;  3B2F A;  2L76 A;  4YT0 B;  1M4V A;  2MLB A;  3RI7 C;  3U7Z A;  4TSS A;  1R4M I;  3P1M A;  5JXV A;  3U4E G;  4EZJ A;  5CHW A;  5EDS A;  3N1Y C;  3QCA A;  4G0N B;  3QAR A;  4WH4 A;  2D5G A;  2RPQ A;  1YQ3 B;  3JVZ X;  4MH0 E;  3M95 A;  4AS1 A;  4C4V A;  4NZL B;  2G4S A;  1QT9 A;  1WFY A;  3LYY A;  1XD3 B;  2GI9 A;  2GBJ A;  3ENE A;  3LDZ E;  4DXG A;  2RDB C;  2LVQ A;  1H8C A;  1IBX B;  1TKY A;  5LXH A;  3VTU A;  1DOY A;  2FUG 1;  1Z5S B;  2RMM A;  4FAD A;  4GB9 A;  1L6U A;  3AN1 A;  4M01 A;  2JVC A;  2LZ6 A;  1FNW A;  4JLC A;  1VZ8 A;  2LJI A;  1IBX A;  2BKF A;  1XLQ A;  2W55 A;  1MG8 A;  2X38 A;  3N20 C;  1C4P A;  4XDD A;  2MX2 A;  2D3C A;  1R4M B;  1VDV A;  4ITK A;  2WXM A;  2DLB A;  2K22 A;  2GOW A;  3QX1 A;  4KV2 A;  1SXT A;  4MM3 A;  1MPE A;  2KVZ A;  3WAO A;  4PK1 A;  1J7A A;  2B76 B;  4ACF A;  2EKE C;  4ZHO A;  1D5M C;  4I6L B;  4S17 A;  2K1F A;  4ZOH C;  2KTR A;  1VR9 A;  3DBR I;  2KC1 A;  4EKU A;  1WXM A;  2IO2 B;  2WLB A;  3NZ3 A;  3VH4 B;  1V5O A;  2KFK A;  2KXJ A;  1C76 A;  1FM0 D;  1WYG A;  2V3P A;  2ZNV C;  2BS2 B;  4TV3 A;  4NPN A;  4NAM A;  2KLG A;  4BAX A;  2B3A A;  2K5P A;  3ZUN A;  3W1S C;  2D3G A;  1SE4 A;  1ZOY B;  3UQB A;  4ZYN A;  2M8S A;  2V9H A;  3RNC C;  2K0P A;  2L00 B;  4KZC A;  2NBW B;  2Z0E B;  1MI0 A;  2HJ1 A;  1Y8R C;  2X8X X;  3HUI A;  2WXH A;  1WJN A;  4NJ7 A;  3PRP B;  1FRD A;  4RGO S;  3SFD B;  1ESF A;  1T5X D;  4I6P A;  3AEB B;  1VZ7 A;  1WX9 A;  2LXA A;  4K3C A;  2IND C;  3URY A;  4B0E A;  3CST A;  4WWN A;  2KVR A;  4OZA A;  1E8Z A;  2KNB A;  5JHB A;  2L32 A;  2KLC A;  3UIN B;  4KDI C;  4F8C B;  1NEN B;  4ANW A;  2GBR A;  3TEW A;  2RR9 A;  4USA A;  2L83 A;  3IXS A;  3AEE B;  2WDR B;  4WJQ A;  4IOI E;  3PS6 A;  4GDL B;  1FO4 A;  3VVW B;  3FIL A;  3BVG A;  4W9D A;  1OEY J;  3MHS D;  4DHJ B;  3TEX A;  3L17 A;  1IPG A;  2IPK D;  1PGA A;  2KX0 A;  3AE5 B;  4IG7 B;  5D94 A;  2BYT A;  2JSV X;  4GXB A;  2L05 A;  1SIF A;  1WYW B;  1ROE A;  1TYG B;  3W1Y A;  1HA5 A;  3QHT A;  4J6I A;  3RNB C;  2MA9 B;  2QIE B;  2PVO D;  4FUL A;  2NPT B;  2RSU A;  2LUM A;  4W9L A;  4WIP A;  1KLV A;  1RWS A;  2CS4 A;  2Z59 B;  1GC6 A;  1DOI A;  4MEL A;  4OZB A;  3LJ3 A;  2NVU I;  3WAP A;  1F2R I;  3ZTC A;  3DHG C;  3EFU A;  2L0F A;  4FXC A;  3UGB B;  3UQA A;  1KH0 A;  2IBI B;  4A6Q A;  1I4G A;  4IWQ A;  3KUD B;  1WF9 A;  1P9D U;  2PIA A;  4NQL B;  1YN4 A;  2DBY A;  4GU2 A;  3I63 C;  3QWZ B;  4YSZ B;  2KJ6 A;  2LAS A;  1QKZ A;  2AQ2 B;  1XLN A;  1TTN A;  1Q5W B;  4G50 A;  3OJ4 B;  1WZ0 A;  3U30 A;  3ZRC A;  2DAJ A;  3TUO A;  2PW9 A;  3N1Z C;  2N7E A;  1FMA D;  1C9F A;  4US9 A;  1WM2 A;  1A70 A;  1ZXH A;  3EFC A;  3V3X A;  3UIP B;  3Q3N C;  3GE3 C;  1QOB A;  2WXF A;  4IKG A;  3LB8 C;  4FA6 A;  1N6Z A;  1FXT B;  4WJN A;  3L54 A;  2O6V D;  4IM3 A;  3NS8 A;  1HQR D;  1F0Z A;  2TSS A;  2J42 A;  2N9L A;  1YOV B;  1E90 A;  4Q2J A;  2QIL A;  2WP9 B;  2LVO A;  1EO6 A;  5J17 A;  3V05 A;  1KOT A;  3KUC B;  2MP2 A;  2UWQ A;  4A3P A;  2PJH A;  1UEL A;  4ANX A;  2PKO A;  2MH7 A;  1KLU D;  2LRW A;  5BMH A;  1TS2 A;  1J19 A;  1I7H A;  1QF6 A;  3VUX A;  1YIW A;  3BK2 A;  1ISN A;  3TL5 A;  3RFZ B;  3ZQ4 A;  2FCN A;  1HXY D;  1MHX A;  1WX8 A;  4B95 A;  3O65 B;  3OJ3 A;  4OVZ A;  4W9C A;  2QJL A;  1RLF A;  3RMK C;  3B0A A;  4BOS C;  2J4X A;  2YLM A;  5C2T B;  1D5Z C;  1GOZ A;  3RPF C;  5EE3 A;  1WJU A;  1GC7 A;  2FIF A;  2N4F A;  2DZI A;  5BMI A;  3VRB B;  4LDT B;  4AOF A;  4RGN A;  2LVP A;  2WXI A;  3I3T B;  2C60 A;  1K8R B;  2WHI A;  2PVG C;  3NY5 A;  1OTR B;  2WDQ B;  1GG3 A;  1IGC A; 
#chains in the Genus database with same CATH homology
 1ZPS A;  3MHZ A;  1L4Z B;  1QLB B;  3UI3 A;  1VRA B;  4L1B A;  4WWM A;  3AB5 A;  3MJ5 A;  1N5W A;  1NI3 A;  2DYM A;  3P4P B;  2Y5C A;  2BW2 A;  5H8Y E;  4A9A A;  1V8C A;  3Q8C A;  3VR8 B;  4JX1 C;  2KAC A;  4GDK B;  2NTT A;  4GLS C;  2AX5 A;  2IDY A;  1KLG D;  2KDM A;  2V4I B;  1V1O A;  3R8B A;  1D6E C;  1OQQ A;  2K3U A;  2KAJ A;  1RM6 C;  4EE2 A;  4DQO C;  3AH7 A;  1UGJ A;  3ZJT A;  1KFY B;  3AE6 B;  4N58 A;  4TMA B;  2AQ1 B;  3FC4 A;  2BBC A;  4D2K A;  3NS1 A;  4YSY B;  2XNA C;  3CWI A;  1V1P B;  3NUH B;  2YEP F;  3T3O A;  2XN9 C;  1I4X A;  3ZJV A;  1JW9 D;  1IUE A;  2E6X A;  4C7Z A;  1E9M A;  3DWM A;  4JPS A;  4M0W A;  3U2S C;  4XE0 A;  1E10 A;  4A90 A;  1FFU A;  5FK9 C;  5BYR A;  2WXO A;  1RFK A;  3EGR A;  3AE7 B;  4UDU C;  4US8 A;  3AV8 A;  2M19 A;  2I38 A;  1XO3 A;  1GB4 A;  1SE3 A;  1SBB B;  1FCL A;  1DOX A;  2DYO A;  5G5G A;  1V1P A;  2IGD A;  2WXR A;  1F77 A;  5HI1 A;  3NVV A;  3C8Y A;  5T8I A;  3TEY A;  1KRH A;  2IGH A;  3O13 A;  1CK1 A;  1FNV A;  1ET6 A;  2LMC A;  3B9J A;  1JML A;  1OFF A;  5D3D A;  2N9K A;  1JRP A;  1SE2 A;  1BML C;  3EA6 A;  3VR9 B;  1P7F A;  3LXF A;  1YN5 A;  1YJI A;  1JAL A;  1FCC C;  2GB1 A;  4MT5 A;  3KWV A;  4N59 A;  1TKG A;  3GS2 A;  1JCK B;  1GAQ B;  1ZDX A;  2JX5 A;  5BMG A;  2ACZ B;  1TY0 A;  1QOA A;  2W3S A;  1QOF A;  3IT6 B;  1L6V A;  5HHD G;  1NYR A;  1Q10 A;  1EM7 A;  1TZO A;  4HJG E;  4RF1 A;  2JXT A;  3VRA B;  5D3I B;  2WXQ A;  2JZP A;  3B2F A;  4YT0 B;  1M4V A;  4YSX B;  4YTM B;  2FBW B;  1EWC A;  4KKI A;  2MEK A;  1VZ6 A;  3U7Z A;  3BZD B;  1QQR A;  3HRD D;  3P1M A;  4TSS A;  2ON8 A;  5JXV A;  2KN4 A;  4RF0 A;  4XWT A;  3U4E G;  1K50 A;  1C4A A;  3R2I A;  3HVZ A;  4IDI A;  3PZ8 A;  5E6J A;  1NVI D;  4WH4 A;  2D5G A;  1YQ3 B;  5D7G A;  1ZE3 D;  1N61 A;  2Z8L A;  2JYE A;  2WQY B;  2YEP B;  4AS1 A;  3ZYY X;  1GPX A;  1YN3 A;  4NZL B;  4ARC A;  1EU4 A;  1N62 A;  1QT9 A;  1I4P A;  2NMQ A;  1PGX A;  3LYY A;  4RFB A;  2GI9 A;  1QOG A;  1JWS D;  2JQR B;  3NVW A;  1SJH D;  4KKJ A;  1D5X C;  4KGS A;  4DXG A;  3P42 A;  4TQ0 A;  2I2Y A;  1IBX B;  1TKY A;  4LK0 M;  1RYJ A;  5BYQ A;  1DOY A;  1NEK B;  4L2Y A;  4KGT A;  2FUG 1;  4HRO A;  2RMM A;  2ZW0 A;  3WCQ A;  1BXT A;  4B0M A;  5EE1 A;  3AMZ A;  1L6U A;  3AN1 A;  3OWE B;  1K52 A;  4JE3 B;  1FNW A;  2Y3A A;  2L1A A;  2Y5P A;  1D4B A;  2OHF A;  1VZ8 A;  3ZJU A;  2LFI A;  2DWQ A;  2LJI A;  1KTK A;  3AEG B;  3W1S A;  1IBX A;  1ET9 A;  2PMV A;  1XLQ A;  1ZXI A;  2RDG A;  2KQ4 X;  2W55 A;  4RGT A;  2X38 A;  4XDD A;  1C4P A;  2WU2 B;  1DYQ A;  2PLP A;  2Q5W D;  1VDV A;  1B9R A;  2IGG A;  3PZ7 A;  4ITK A;  4AQ7 A;  4JWU C;  2WXG A;  2GRI A;  2N0S B;  2WXM A;  2DLB A;  2K22 A;  1HEZ E;  1WGK A;  4R3D A;  1J7B A;  2INP E;  1SXT A;  5EE9 A;  2JWU A;  1MPE A;  3KWL A;  1J7A A;  2B76 B;  3ABV B;  2LHD A;  4ZHO A;  1SEB D;  5LNK 1;  1D5M C;  2VZK D;  4ZOH C;  1VR9 A;  5FKA C;  2EKI A;  4L23 A;  4A8X C;  5HG2 A;  1T3Q A;  3NZ3 A;  2WLB A;  4H2A A;  2HTM E;  4CQN A;  2G9H D;  5EE0 A;  1YMH E;  2MJ3 A;  3EUB 2;  3ZGZ A;  1C76 A;  1L0Y B;  4N6E B;  1FM0 D;  1WYG A;  2V3P A;  2BS2 B;  1EU3 A;  3TEZ A;  1DGJ A;  4XWW A;  2ONQ A;  1NYQ A;  4ZRP A;  4NAM A;  4MH8 A;  4ZRQ A;  2W82 A;  4YTP B;  2K5P A;  1I4R A;  1WRI A;  4LLG M;  1XCT L;  1JRO A;  1SE4 A;  2IJ0 A;  3BII D;  4JWS C;  1ZOY B;  5G5H A;  1HZ5 A;  3HVD A;  3AM9 A;  3P4R B;  4KX6 B;  3W5V B;  1CJE A;  1PYW D;  2K0P A;  1MI0 A;  3FIL B;  5AUI A;  3HUI A;  3PO0 A;  1I4Q A;  2WXH A;  1JWA D;  1FRD A;  4RGO S;  4HKQ A;  1SIJ A;  1ESF A;  3SFD B;  1T5X D;  3BK1 A;  1TS3 A;  2BS4 B;  3AEB B;  3MFG A;  2V3N A;  3GP7 A;  1F2R C;  1VZ7 A;  4RNA A;  4ARI A;  3I57 A;  3BYT B;  1L5P A;  4PT5 A;  4YXD B;  2OED A;  3P4Q B;  4REZ A;  4HEA 1;  3URY A;  1FNU A;  2MJE A;  4B0E A;  2KMM A;  1L0V B;  4OZA A;  3W5U B;  2AQ3 B;  1FD6 A;  3NVZ A;  5GXG B;  3AE1 B;  2L52 A;  3NVY A;  5AUK A;  2L32 A;  2PTL A;  5TSS A;  2EEL A;  1NEN B;  4C56 C;  3CIR B;  1PFD A;  1ZDV A;  2CJN A;  3TEW A;  1N63 A;  3DWG C;  1E0Z A;  2QMT A;  1XLP A;  3E56 A;  4USA A;  1YQ4 B;  2L83 A;  2M56 B;  2CU3 A;  3IXS A;  3U52 E;  3AEE B;  2WDR B;  3BWU D;  4DXF A;  1JWB D;  4IOI E;  4NAW B;  4C7Y A;  4XDC A;  2V0G A;  4GDL B;  1PDX A;  1FO4 A;  3W9C B;  3FIL A;  3BVG A;  4P6V F;  3VQI A;  5FR3 A;  1UUP A;  3SEB A;  2K9X A;  3P4S B;  2WDV B;  3TEX A;  2CJO A;  2IPK D;  1PGA A;  1EWY C;  3H8H A;  3I9V 1;  1QIL A;  3AE5 B;  4OHJ A;  1FIQ A;  4ZYS A;  1JWM D;  1STE A;  2BYT A;  2JSV X;  1PUT A;  4RCO A;  1ROE A;  1UNS A;  1TYG B;  1HA5 A;  4A55 A;  5H92 C;  1AWD A;  5I4D A;  2WXP A;  5BYS A;  4TQ1 A;  3AEA B;  3AEC B;  1C77 A;  1TY2 A;  2H89 B;  2QIE B;  1SJE D;  2PVO D;  2WXK A;  2RPV A;  2LUM A;  1CZP A;  3IAS 1;  4WIP A;  1SF0 A;  1YJJ A;  1XXG A;  1RWS A;  3SR6 A;  1JQ4 A;  1DOI A;  2VZK B;  4RGM A;  2J53 A;  3ETR A;  4OZB A;  3B2G A;  4YWG G;  1VLB A;  1F2R I;  1TS5 A;  4FXC A;  3FAH A;  1K51 A;  4MM3 B;  1KH0 A;  2WXJ A;  2WXN A;  3BVZ A;  3KLS X;  1AW7 A;  1FXA A;  4A6Q A;  1I4G A;  1N60 A;  3AE9 B;  1C4C A;  2BTE A;  1JWU D;  2PIA A;  1YN4 A;  2DBY A;  3AE2 B;  2LGI A;  1WXQ A;  3KQ4 A;  1B1Z A;  1R7S A;  1ZUD 2;  1AN8 A;  4HKZ E;  3IT4 B;  1I4H A;  1T6B X;  4YSZ B;  1QKZ A;  1ENF A;  2AQ2 B;  4O1N A;  1XLN A;  1ZP0 B;  4P16 A;  3Q8B A;  1LO5 D;  1N5X A;  3Q69 A;  3TUO A;  2BS3 B;  2PW9 A;  3AED B;  2QSD A;  2LHE A;  1FMA D;  1C9F A;  4US9 A;  1ZXH A;  1A70 A;  1CQV A;  3V3X A;  4OZC A;  2W54 A;  3E9S A;  1IGD A;  5C3J B;  1QOB A;  2WXF A;  4C80 A;  4IKG A;  1E7P B;  1TJE A;  1P7E A;  4MAC A;  3LB8 C;  1UWM A;  4HRS A;  3N9Y C;  3TSS A;  1XLO A;  2BT6 A;  2SAK A;  1XCQ L;  5HFY A;  3NRZ A;  4KGR A;  2KWD A;  3MC0 B;  1FXI A;  1HQR D;  1F0Z A;  2TSS A;  4WAF A;  2J42 A;  2N9L A;  2WXL A;  3GB1 A;  1TKE A;  4Q2J A;  2INN E;  2QIL A;  3R2T A;  1Y56 A;  2WP9 B;  2J52 A;  4J3O D;  1MVK A;  3V05 A;  1FRR A;  2ICI A;  4ZHP A;  4YTN B;  1AYF A;  2RDH A;  1TS4 A;  2R61 A;  3AE8 B;  1OQR A;  2MH7 A;  2H88 B;  2PKO A;  1KLU D;  4OW0 A;  2WU5 B;  5BMH A;  3T3N A;  1WSP A;  1TS2 A;  2WS3 B;  3BYY B;  3J9C A;  3P63 A;  1PGB A;  3Q8A A;  1I7H A;  1QF6 A;  1UWX A;  3AE3 B;  2E3T A;  2LEK A;  1K53 A;  3IAM 1;  3BK2 A;  1BUI C;  3RFZ B;  3ZQ4 A;  2MJD A;  2NTS A;  4NJC A;  1C78 A;  1XEE A;  1V97 A;  1HZ6 A;  1HXY D;  1MHX A;  1E6E B;  4WUR A;  4OVZ A;  2QJL A;  1VJK A;  2BB5 A;  2QEJ C;  1FFV A;  4WQM A;  1MHH E;  1GB1 A;  2FE8 A;  2J4X A;  2M0A A;  3AEF B;  3Q8F A;  5C2T B;  1D5Z C;  1GOZ A;  1FEH A;  2HDE A;  3BVM A;  3RPF C;  3L4P A;  5EE3 A;  2ZW1 A;  2G1E A;  1YNT E;  3SFE B;  1XF5 L;  1SSN A;  3W2D A;  3Q8E A;  5MPO A;  2W3R A;  4LTU A;  5BMI A;  2WNM A;  1ACC A;  1C79 A;  1WWT A;  3MP9 A;  3VRB B;  1J7C A;  1KF6 B;  1SB3 C;  4RGN A;  2JYT A;  2WXI A;  2BB6 A;  4RH6 A;  2SEB D;  2JU6 X;  1L4D B;  2PVG C;  3AE4 B;  2N7J A;  1L0X B;  2WDQ B;  1IGC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...