3VTWA

Crystal structure of t7-tagged optineurin lir-fused human lc3b_2-119
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
125
structure length
125
Chain Sequence
EFVEIGGPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Optineurin, microtubule-associated proteins 1A/1B light chai
publication title Structural basis for phosphorylation-triggered autophagic clearance of Salmonella
pubmed doi rcsb
source organism Homo sapiens
total genus 34
structure length 125
sequence length 125
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-06-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3vtwA00
4NJ6A 4FJZA 5D2MB 2DZIA 2KLCA 3U8ZA 2KFJA 1GG3A 3QCAA 4DHZB 2KKCA 2ASQA 1RFAA 1TGZB 1C1YB 3NZUA 5CHFA 3TIXA 1WYWB 3UGBB 4W9JA 4KVGB 3SHQA 2ZNVB 2NR2A 3HM3A 3HM6X 4JQWC 4E74A 4EEWA 4HVBA 1SE9A 3PZDA 1QZEA 1Q0WB 4JLCA 2DZJA 1VD2A 2PEAA 1LQBA 4W9FA 4TQ1A 4WWPA 2FCNA 2G4DB 2AWTA 2KWCA 3L10B 3ZRFA 2AYOB 3D32A 2KO3A 4W9KA 1U4AA 2CHZA 2CU1A 1YQBA 1CMXB 4G0NB 2HTHA 4OVVA 5C1ZA 1T0YA 3IVFA 2LASA 3V60A 4W9IA 1GC6A 1WH3A 2HE7A 3TL5A 2GBKA 1PQSA 3BINA 4G3XB 4CYEA 3AU5A 1XD3B 1WXSA 4BBNF 3BY4B 2JY6A 3I3TB 5LXHA 5KHQA 1UELA 4PYZA 2NBUA 2RGFA 2DZMA 2KX0A 3PHWB 1E8ZA 3ZDMC 2N7DA 4EZJA 4RM9A 4GDKA 3IFWB 3A33B 4KIKA 3LDZE 4MSMB 3SD5A 3A9KB 2MBEA 2KMAA 4LJPB 2GBNA 2BYFA 2L7RA 3HK0A 2KTFA 3W1YA 1E7UA 4JIOU 2KQ7A 1OEYA 1ZKHA 1ZW7A 2LZ6A 2CR5A 2KOXA 2XK5B 3B08A 4M8MA 2L00B 4K7WA 5J2RA 3RCZA 4EFOA 4MGKE 3H9DA 3RZFA 1Y8RC 1RRBA 2Z0EB 3A1QA 1IYFA 2DENB 2VRRB 2JPHA 2M4NA 3DQVA 4I6NB 3KH0A 4LDTB 3AULA 5D94A 1I35A 2RR9A 3A9JA 3RULA 1IP9A 2O6VB 2R2QA 1KLVA 1WF9A 4PS7A 2L8JA 1OQYA 3APDA 4GB9A 4HPLB 3AI5A 2PJHA 2LXCA 2WX0A 4W9GA 2L76A 3O65B 1V5TA 4RM8A 3X0WA 2KMCA 2V4LA 4IWQA 4J6IA 3CSFA 1S1QB 5G2NA 2L3ZA 2ZJDA 1V9JA 1SGHA 3QK0A 2MWSB 3EECA 3H1UA 4KDIC 4M0WB 3EHVA 1J19A 4HK2A 5D7GA 1OTRB 1VCBA 2MBHA 3H6NA 4ANUA 2KHWB 1WX8A 2L05A 3P2BA 1P0RA 2N1WA 2KTRA 3CSTA 3PVLA 3KUCB 2JRIB 2B3AA 3UIOB 1WMHB 1J0GA 2W9NA 3QHTA 1WM3A 2IY1B 3R66C 4LCDE 5LXIB 4FLHA 4HDOA 1MG8A 2J0KA 4II3B 4MEMA 2G45B 4MH0E 3JSVB 4F8CB 2JZ3B 1Q5WB 3IG3A 4E71A 4ZYNA 2EKEC 1Z5SB 4FN2A 2REXA 1KOTA 2FCSA 2LVPA 3DVGX 2ZNVC 4ANVA 4IM2A 2KN5A 4ANWA 3KW5B 4LDTD 2BWES 3DVGY 3WAMA 4BKSA 3VXWA 4M8NA 1WJNA 2GBJA 3GOEA 1WGRA 1E8XA 2O6VD 1WR6E 2K8HA 3WAOA 1L2NA 2KD0A 3ZTCA 4II2B 3MJWA 3OAWA 2KK8A 2KFKA 4GDKB 2GBMA 4DBGA 3Q3FA 3DDCB 2FCQA 2LGXA 5J18A 2MP2A 4MJSA 1WE6A 3L16A 3JYUA 1KM7A 4FA6A 2NPTB 1NDDA 4HWIB 4XX5A 1YJ1A 2M8SA 3CF6E 1WXVA 3JW0X 2GMIC 2K1FA 1GUAB 1K8RB 1WJ4A 3PLUA 3UIPB 4WJQA 3APCA 4KSLC 1WRDB 2A5UA 4MGZE 3V6EB 1Z2MA 4ZRIA 2JUOA 5FR6A 2XEWA 2C7MB 2LVOA 4HDQA 2DX5B 2BKFA 2IBIB 3TCAA 2CKHB 2KX3A 5CTRC 4KZCA 3H7PA 2JXXA 5TR5A 5BO4B 4DHJD 4EZLA 2DYBA 3VH3B 4B6WA 4BKTA 1J8CA 4A3PA 1E8WA 5DCNA 1OGWA 3NHEB 3VQIA 3VUWA 3PRZA 5GMVA 2UYZB 1I42A 1M94A 1V49A 2K8CA 3M95A 4MGYE 3ENEA 2KLGA 4XC2A 4BOSC 2IO1B 2K39A 1WZ0A 2K6QA 2O2VB 3PHXB 3UQAA 2RD0A 2GBRA 1WGDA 1EF1A 1WFYA 3NOBA 3B0AA 3QJZA 3EFUA 1E90A 2MLBA 3L13A 2FAZA 3TBLD 2IO3B 4MGIE 2DAFA 3VVWB 1P3QU 3W1SA 4EZKA 2ZPYA 3AXCA 3U7DA 2Z0DB 4FHJA 1D3ZA 3Q3JA 1LXDA 2L0FA 2DAJA 3ZNGC 3K9OB 4DK5A 2KVRA 4W9HA 3L17A 2IYDB 4FBJB 1H4RA 3ALBA 3T9LA 3B1LX 1YX5B 4FULA 4P7IA 3L54A 1V80A 5D6JB 1V86A 4WJNA 4K7UA 4GU2A 1WGYA 5L95C 3DCGA 4HXDA 3KVFB 2JZZA 3LJ3A 4NAWB 1WX7A 2KC1A 2YLMA 1WM2A 4K1RB 2C7NB 4WQOB 1H8CA 2MBQA 3PT2B 2KANA 3A4SC 4GDLA 4DDGD 3PRPB 3DVNV 3ZLZA 3U30A 2CHXA 4MELA 2MP2B 2LGDA 4AP4C 5G55A 2HJ8A 1G6JA 2FUHB 1EO6A 3N32A 2CHWA 1WE7A 2KWVB 4BBNC 2A4ZA 1WGHA 2M17A 4ASWC 2LD9A 2CS4A 3VTVA 1AARA 1TZ1A 3RUIB 2DYMA 3ML9A 2M1MA 3QC8B 4HPMB 3V6CB 3QAQA 2GOWA 3VDZA 1BT0A 2C60A 3PREA 4FJVB 3MHSD 3VUXA 4ZRJA 4W9DA 2NBWB 1UD7A 4TV3A 2ZCBA 2J7QB 4DDID 2IY0B 3KUZA 3X23A 2J0JA 1GNUA 1OEYJ 2MSED 2KXJA 3PS6A 4NNJB 3PLVA 5DPSA 1WIAA 4BFRA 1WXAA 4MDKE 3ZTDA 4B95A 4FADA 3NY5A 3APFA 3ZNID 1WJ6A 1YX6B 2PPHA 2IO2B 4A3OA 3R7RA 1UZXB 3MTNB 3DBRI 2RPQA 4CHKA 3A9KA 1ZGUB 1GC7A 2N9EB 2C7HA 5E6NA 4BKSD 2KC2A 3DBLI 2LJ5A 4PS8A 2KNBA 2KJRA 3L0WB 2XK5A 3JVZX 3PSEB 5E6OA 3SU8X 3R3MA 1V5OA 4BVUC 2ZZPB 4G50A 4W9CA 5CHWA 5CX3A 5DPTA 4AUQC 4KIKB 3ZUNA 4F1SA 3ZIMA 5DPWA 4GIVA 3QIJA 2NBVB 2L0TA 3V62A 1UH6A 2MRPA 3M63B 4FJYA 1LM8B 1V81A 1JRUA 2D10A 2AL6A 4TUUA 4IG7B 4EKUA 1UBQA 2BPSA 2D2QA 2J0MA 2BWFA 2MX2A 2O6VA 4WWOA 3VAWA 1RAXA 2C5LC 2KJHB 4A20A 2AEHA 2NCNA 5JH5C 4HJKA 5IA7A 1WZ3A 1E8YA 1F9JA 2KQSA 5E6PA 5AZFA 3RT3B 3A1QB 4IM0A 4AWJA 2KDIA 2EMSA 1RLFA 2ZEQA 2V3SA 1GJZA 3IHPC 4WJOA 1R4MI 3A9JB 3PV1A 2ZVNA 3R7QA 4BOZB 3QA8A 2HD5B 3N30A 4HCPB 4URKA 3T8MA 4GGQA 4GOCA 3NS8A 2KDEB 3C0RB 2BGFA 2MA9B 3QX1A 1ISNA 4IC7B 4NQLB 4DHZE 2MCNB 1C3TA 2ZCCA 4MSQB 5LLIA 4NPNA 4GDLB 4GXBA 5KHOA 4NQKE 3ZKJC 3ZW3A 2I1JA 3EC8A 4BKGA 1WMHA 3H7SA 4ZRKA 5HKHA 4X57B 4AOFA 2OOBB 3OJ3A 3ZO5B 4GN1A 3ZNHB 4CO7A 2DHZA 4IM3A 2EMTA 3SDLC 3VH4B 4GSWA 5DPRA 2MW5A 2MBBB 3JSVA 2JT4B 2G4SA 2OJRA 1EUVB 4RMAA 2KTRB 2D11A 2KDBA 5JHBA 2WX1A 4PS3A 1EF5A 5L83A 5AZHA 3L08A 2V1YA 2KJ6A 5CHVC 2BYVE 3TJPA 3ONSA 4KDLB 4DWFA 1WJUA 1E5WA 1XQQA 5AZGA 3NZSA 1S3SG 2FCMA 2FIDA 2JWZA 5J17A 3DPDA 2DZKA 3UF8A 3WANA 3VUYA 1NI2A 2YVCA 2N4FA 4PYUA 2IO0B 2NPTA 4HCNB 2WYQA 3WALA 5AEKB 2BF8B 2ZPNA 3QQ8B 3GZNI 4KSKC 3DVNU 4E3CA 4WAAA 2KFKB 1YIWA 4W9LA 4KZ0A 4TQ0A 4JL9A 2RSUA 1XT9B 4ICUA 3VFKA 5JZEB 1Q1OA 2Y5BB 2D07B 4F7ZA 2JVCA 4MJSB 1A5RA 2N9XA 2XBBC 2KDFB 2R2OA 2LUEA 2IZVB 2LXAA 3M62B 4NY0A 4ANXA 1UGMA 3QARA 3RZWC 4W9EA 2DYOA 3HHMA 3K9PB 3TMPB 4I6PA 3VTWA 1WI0A 3PRMB 2K6DB 1WR1A 1P98A 2LRWA 4EUTA 3KYDD 4B9KA 2D3GA 2FNJB 4XZ4A 2Z59B 2LGYA 2K8BA 1HE8A 4OVUA 1IPGA 3DBSA 3OLMD 3ZDTA 1V6EA 1WGGA 1L7YA 2LRUA 3ECIA 2PE9A 2WDTB 3ZVVA 1P9DU 4AJWA 3W1SC 4WWNA 2PE6B 4HLEA 4ZDVA 3H7PB 3RYTA 4DXAB 4GMVA 2N1VA 4MM3A 2O2VA 1FXTB 4AJYB 4DHJB 5C23A 5JHAA 2KZRA 1SIFA 4IWPA 2NVUI 3A4RA 3WIMA 2JF5A 3PPAA 2K25A 4I6LB 3KUDB 4IW0A 4K81A 2LI5A 1YD8U 4IUMB 3WAPA 2JRHA 3PTFC 3V61A 2LWPA 1V2YA 4ICVA 3HIZA 3AU4A 5EDSA 1WY8A 2UWQA 3S2AA 1TBEA 2WWZA 1LFDA 3UINB 4FHKA 1E7VA 1WXMA 3ML8A 2C9WB 2M0XA 4EOYA 4WJPA 2AL3A 1P1AA 3QWZB 2I1KA 3PGEA 2N7EA 3ZNZB 4TKNA 3DOWA 1UBIA 4N9F4 3WA0A 3VTUA 2LVQA 5IAAC 2FIFA 3ZRCA 2ZVOA 2KWUB 4G11A 2G3QB 3UQBA 1NBFC 3IBEA 1X1MA 3DBHI 4KV2A 1KJTA 1R4NI 4LJOB 4NAWA 2MQJA 2NS5A 3M3JA 3OJ4B 4IWOA 4NJ7A 4JGHB 2MBOA 1TTNA 4YL8A 3KYCD 1WX9A 2BYEA 4K7SA 2QHOA 3VHTC 2BKRB 2N9PC 3CMMB 3RD2A 3N3KB
chains in the Genus database with same CATH superfamily
2DZIA 3RMKC 1XF5L 4DHZB 5E6JA 1AW7A 3TIXA 3UGBB 3SHQA 1EM7A 3PZ7A 3O13A 3PZDA 3NVVA 2PEAA 1ESFA 4W9FA 1MJDA 4WWPA 2FCNA 3L10B 2JXTA 1FIQA 2CU1A 4G0NB 1JRPA 1T0YA 2LASA 1GC6A 1SEBD 4TMAB 3FAHA 2XN9C 4CYEA 3AU5A 1FNUA 3BY4B 2JY6A 5LXHA 2WXIA 4PYZA 2NBUA 5C3JB 3PHWB 1JROA 3IFWB 4KIKA 1T0RC 2ICIA 2L7RA 5IOIA 4JIOU 2KQ7A 1ZKHA 2GB1A 5J2RA 4K7WA 1YN3A 3T3OA 3Q8CA 4NAMA 4LNNA 2LUMA 1Y8RC 1XLNA 3HUIA 1RRBA 2Z0EB 2DENB 3DQVA 3Q6BA 5EE3A 5D94A 3Q2AC 3RULA 1IP9A 1FFVA 4K3CA 4YSXB 2L8JA 3APDA 4HPLB 2PJHA 1DOXA 2LHEA 4W9GA 3U52E 3X0WA 2V4LA 3RN9C 3CSFA 5G2NA 2ZJDA 4MT5A 1YQ4B 3H1UA 1FD6A 1B9RA 1JMLA 1XCTL 5D7GA 1VCBA 4ANUA 3PVLA 2B3AA 2E6XA 5AUIA 2W9NA 3R66C 4LCDE 1VZ6A 4HDOA 1DGJA 1Q5WB 1JWSD 1RFKA 4REZA 4ANVA 1QLBB 3DBHB 1R4NB 3GOEA 1WGRA 1SB3C 1WR6E 2HJ1A 5BMIA 2KD0A 2ON8A 3ZTCA 2M19A 3MJWA 4LTUA 1FFUA 4DBGA 3DDCB 2LGXA 4HKQA 2WXHA 1K50A 2K0PA 2M56B 1WE6A 1JWAD 2V3PA 4HWIB 1YJ1A 2M8SA 3CF6E 4WJQA 4KSLC 2A5UA 2RMMA 4MGZE 2JUOA 2C7MB 2DX5B 2BKFA 2MH7A 3TCAA 2CKHB 2KX3A 3AV8A 3Q8AA 4KZCA 1ET9A 3H7PA 3SFEB 2X38A 5BO4B 3PO0A 4HPPA 2D5GA 4WH4A 3VH3B 1J8CA 4A3PA 3VQIA 3VUWA 1I42A 4J3OD 2K8CA 1XLOA 4L1BA 2SEBD 3ENEA 4YWGG 2KLGA 1E7PB 4BOSC 2IO1B 2JU6X 2K39A 1ZXHA 3UQAA 5BMHA 3DHHC 3B0AA 3QJZA 3LB8C 1SIJA 2MLBA 1GPXA 1EU3A 1JW9D 5C2TB 3W1SA 1SBBB 2Z0DB 3Q3OC 4US9A 4P1BC 3AE5B 2DAJA 3ZNGC 2ZW0A 3OWEB 2KVRA 2K9XA 3ALBA 3T9LA 1KLUD 3TEXA 1FNWA 4RF1A 1FCLA 2JYEA 5L95C 4NAWB 2KC1A 2YLMA 1WM2A 1FRDA 3PT2B 4IKGA 4DDGD 3PRPB 4US8A 1OQQA 1EO6A 2KWVB 3RI7C 4BBNC 4ASWC 2M17A 4C00A 1MHHE 1C4CA 1E6EB 3VTVA 4HPMB 3V6CB 3VDZA 4NJCA 2C60A 3B9JA 3MHSD 4ZRJA 1RWSA 4RGTA 4DDID 3KUZA 3NUHB 2MSED 5LNK1 1HQRD 3PS6A 4BFRA 1WIAA 4B95A 4FADA 3NY5A 3APFA 1WJ6A 1YX6B 3ZJVA 4A3OA 4TSSA 3DBRI 2BS4B 1ZGUB 4KKJA 3I57A 5E6NA 2KC2A 2LJ5A 3IT6B 3T3NA 2ZZPB 3ZGZA 4G50A 5DPTA 3ZUNA 4GIVA 3QIJA 5HHDG 1F2RC 2D10A 2AL6A 2W82A 2L1AA 1FPYA 2XNAC 4WWOA 1XCQL 2C5LC 1L5PA 1MHXA 1OFFA 5E6PA 1TKYA 2LEKA 4JE3B 4AWJA 3J9CA 1UWMA 2V3SA 1PGBA 3R7QA 1C76A 1YN4A 2K22A 4HCPB 4URKA 4GGQA 2PVOD 3EGRA 4IC7B 4N58A 4KKIA 2ZCCA 3DHIC 2WP9B 4GDLB 5HKHA 3MHZA 4IM3A 2EMTA 3SDLC 2WXKA 3GP7A 2BT6A 3AM9A 2DBYA 2D11A 1HA5A 4PS3A 5AZHA 1Q10A 3L08A 2D3CA 3TJPA 4DWFA 2WS3B 1XQQA 2Y5CA 5G5HA 5AZGA 3SEBA 2FIDA 2JWZA 4XGAB 2JZPA 3DPDA 4LNKA 3VUYA 3DWMA 2N4FA 4P6VF 4HCNB 2WYQA 3BK2A 3EFCA 2N7JA 4E3CA 1AWDA 2INNE 1FNVA 3RFZB 3SR6A 1BXTA 1YIWA 1KF6B 5IKCM 1CZPA 1XT9B 4ICUA 3CIRB 2AQ2B 4MJSB 1R7SA 4ZRQA 1NVID 1QQRA 1UGMA 3QARA 3RZWC 2QILA 4M01A 4EUTA 2D3GA 2FNJB 4XZ4A 2Z59B 3ZDTA 1PGXA 1V6EA 3ECIA 2PE9A 2WDTB 1P9DU 1QT9A 2PE6B 4ZDVA 4A9AA 1XLQA 1TYGB 1E10A 5JHAA 1DOIA 4IWPA 2NVUI 1VLBA 2J52A 3DBLB 3KUDB 4A55A 4IUMB 1SSNA 4ICVA 2KYWA 3HIZA 3ZXRA 1WY8A 2UWQA 1TBEA 2WWZA 4FHKA 1NYQA 2WGSA 2M0XA 1TY2A 2J4XA 1EWYC 2I1KA 2VH1A 3ZNZB 4TKNA 3DOWA 1N5WA 3BYTB 3DBHI 1R4NI 4LJOB 4NAWA 2NS5A 3OJ4B 4IWOA 4WAFA 2MBOA 1N61A 4YL8A 3KLSX 3LYYA 1WX9A 1WXQA 2OHFA 2VZKB 3VHTC 2RPVA 1XEEA 1T0SC 2N9PC 5HFYA 3CMMB 3IAM1 3N3KB 2KLCA 3BIID 2WXRA 5HI1A 2KKCA 3N1XC 1TIFA 1TS3A 3TEYA 3NZUA 4E74A 4KVGB 3HM3A 4JWSC 4EEWA 1QZEA 2G4DB 2KWCA 1C77A 2AYOB 4W9KA 1YQBA 1CMXB 4OVVA 1I4RA 4KGRA 1ACCA 1WH3A 2GBKA 1PQSA 4LNOA 4G3XB 3ZJUA 4XWWA 1F2RI 3I3TB 1JWUD 2RGFA 2DZMA 3FILB 3ZDMC 1E8ZA 1NYRA 4RM9A 4GDKA 3RNBC 4MSMB 2NTSA 2MBEA 2KMAA 2GBNA 3GZNB 3W1YA 1OEYA 2VZKD 2L83A 1GB4A 4OW0A 3RZFA 4ZHPA 3MC8A 3NVWA 1L4DB 2AQ1B 1L0VB 3RNEC 3KH0A 2KDMA 4LDTB 3AULA 1FEHA 2O6VB 1WF9A 5JXVA 1WSPA 3PZ8A 1OQYA 3O65B 1V5TA 4IWQA 4L2YA 2NTTA 3QK0A 4KDIC 1OTRB 3H6NA 3AE1B 4RGOS 2L05A 3P2BA 2N1WA 5H92C 3CSTA 3KUCB 2JRIB 2WXMA 1KLGD 1PDXA 1J0GA 3E9SA 2IY1B 3W5VB 5G5GA 1JWBD 2J0KA 4OHJA 2QMTA 2UU7A 5AUKA 1EWCA 3U2SC 4E71A 2CU3A 1Z5SB 1KOTA 2FCSA 3DVGX 4IM2A 2KN5A 4ANWA 4LDTD 2BWES 4BKSA 3WAMA 2GBJA 2PW9A 1E8XA 2O6VD 2K8HA 3WAOA 2JWUA 4YSYB 2K5PA 1L2NA 5IO9A 3OAWA 1T5XD 2GBMA 3VRAB 3Q8FA 1I4HA 4WQMA 1JQ4A 2MP2A 4MJSA 3L16A 3AEBB 4ZRPA 1WXVA 2K1FA 1WRDB 1YQ3B 3VR9B 1Z2MA 1T3QA 2LVOA 2PVGC 1TS4A 4KGSA 2OJWA 5CTRC 1QOGA 4N6EB 2BTEA 4BKTA 1FM0D 1OGWA 2MJEA 3PRZA 5GMVA 4MGYE 3U7ZA 4XC2A 1QOFA 3PHXB 2GBRA 1WFYA 3NOBA 1UGJA 2B76B 2RDBC 1TJEA 4WIPA 2MJ3A 4MGIE 2DAFA 3VVWB 2PLPA 2ZPYA 4EE2A 3U7DA 1LO5D 1UWXA 1LXDA 2FBWB 3K9OB 2QEJC 4DK5A 1Y56A 4W9HA 2WU5B 2IYDB 2BYTA 3B1LX 4WJNA 4K7UA 1BMLC 4GU2A 1BUIC 3KVFB 2I2YA 2C7NB 4WQOB 3ZLZA 3DVNV 2FUHB 2JQRB 1WE7A 4C56C 2A4ZA 2INDC 3ML9A 3QC8B 1WWTA 3QAQA 2GOWA 3IT4B 3VUXA 1IGDA 3AEDB 3BWUD 2NBWB 1UD7A 1WRIA 1T6BX 1F0ZA 2J7QB 1SJED 2IY0B 3NVZA 2V4IB 2KXJA 3PLVA 4C80A 4C7ZA 4MDKE 2W3SA 2RDGA 3ZNID 3BVZA 3MTNB 2WXOA 3AEEB 1GC7A 2N9EB 1SE2A 4N59A 4PS8A 3DBLI 3PSEB 3AE8B 3SU8X 2Q5WD 4BVUC 2Y3AA 5DPWA 2X8XX 2L0TA 1UH6A 3M63B 1V81A 1JRUA 1TKGA 2CJNA 4TUUA 4EKUA 2BPSA 2MX2A 2KACA 2O6VA 2H88B 3I5JC 1RAXA 3FC4A 2KJHB 3R2IA 4A20A 4ZYSA 2NCNA 5JH5C 1WZ3A 1E8YA 3LXFA 4M00A 3A1QB 3RT3B 2KDIA 4C4VB 1RLFA 3IHPC 1R4MI 4BOZB 3W9CB 2HD5B 3Q14C 4DHZE 3TSSA 4RGMA 4NQKE 2I1JA 1L4ZB 4X57B 2OOBB 3OJ3A 4GN1A 4CO7A 3VH4B 2OJRA 2KTRB 3KWLA 2KDBA 2WX1A 5L83A 2V1YA 4HEA1 1WGKA 2BYVE 2DNFA 2ONQA 1I7HA 1C79A 2H89B 1KH0A 4ACFA 5HG2A 2PKOA 1D6EC 2IO0B 3ZYYX 2BF8B 3GZNI 3MP9A 4KSKC 3WCQA 3DVNU 3ABVB 1UF0A 4ZHOA 4KZ0A 4TQ0A 1ZUD2 2RSUA 1L6VA 2Y5BB 2D07B 4RCOA 2N9XA 2XBBC 2KDFB 4ANXA 1K53A 2LUEA 3TMPB 3HHMA 2NMQA 3VTWA 4HROA 1WR1A 1XLPA 1SE3A 2LGYA 1HE8A 4H2AA 1VZ7A 1L7YA 1YJIA 2LRUA 2BW2A 2TSSA 2Y5PA 5BMGA 3ZVVA 4DXFA 5EE1A 3AH7A 2N1VA 4YTPB 2J53A 2KZRA 4PT5A 3P4SB 1CJEA 3R8BA 4K81A 3V61A 1N60A 3RPFC 2WXGA 1E7VA 3ML8A 2C9WB 4AQ7A 3AE3B 4WWMA 4WJPA 2AL3A 1P1AA 3PGEA 1V1OA 1IBXB 1UBIA 1QKZA 5IAAC 1ZDXA 2FIFA 3ZRCA 1ZOYB 2KWUB 2G3QB 1NBFC 4KV2A 1KJTA 1EU4A 2MQJA 5BYRA 1TTNA 2QHOA 4FJZA 5D2MB 1GG3A 2VH2A 1STEA 4YTNB 1VDVA 4RF0A 1RFAA 1C1YB 5CHFA 1I4QA 3AE4B 2DZJA 1VD2A 1LQBA 4TQ1A 2HDEA 2G1EA 2AWTA 3ZRFA 3D32A 2CHZA 2HTHA 3IVFA 3V60A 4W9IA 1VZ8A 3BINA 4MACA 4MM3B 1MFWA 1WXSA 1XD3B 2WXFA 3Q8EA 4BBNF 1ZE3D 4JX1C 2KX0A 2N7DA 1P7EA 4EZJA 4YXDB 1TT5B 3SD5A 3A9KB 2BYFA 1LGRA 2BB5A 2KTFA 1E7UA 2XK5B 2LZ6A 2CR5A 2KOXA 1D5XC 3B08A 1FCCC 4MGKE 2PTLA 3A1QA 4I6NB 4XYCA 4LK0M 4C4VA 5GXGB 3HVDA 3TUOA 3FKYA 2R2QA 1KLVA 4PS7A 2LGSA 2KT7A 3RNFC 2IDYA 2LXCA 2L76A 3NG0A 2JSVX 3C19A 2IJ0A 1UUPA 1SGHA 3EECA 1TZOA 3E56A 4M0WB 3EHVA 2WXLA 2EELA 4HRSA 2KHWB 2WXQA 1P0RA 2KTRA 3UIOB 1F77A 2IGGA 4FLHA 5LXIB 1MG8A 4II3B 2G45B 4MH0E 4XDCA 3HVZA 3JSVB 2RDHA 2JZ3B 1VJKA 4ZYNA 4FN2A 2FE8A 2REXA 1UNSA 2BBCA 3DVGY 4M8NA 1WJNA 3I9V1 2INPE 2MJDA 4II2B 1R4MB 3Q3FA 2FCQA 1KM7A 1N6ZA 1KFYB 2NPTB 1AN8A 4XX5A 4LLGM 1GOZA 4BZAA 4R3DA 3JW0X 3Q3MC 1GUAB 3PLUA 3UIPB 4A8XC 3AE9B 1TY0A 3APCA 3U4EG 5FR6A 2XEWA 2L32A 2IBIB 4BAXA 4M02A 4EZLA 4HJGE 3N9YC 4B6WA 1E8WA 5DCNA 2UYZB 3AB5A 3M95A 2O2VB 2K6QA 3NJTA 4P1CC 2AQ3B 2HTME 2N9LA 3L4PA 1P7FA 3EFUA 1E90A 3L13A 1PYWD 2L52A 4OZAA 3TBLD 1HZ5A 2IO3B 1IBXA 1ENFA 3AXCA 3Q3JA 2L0FA 1HEZE 3DHGC 3L17A 4FBJB 2PMVA 3W2DA 4FULA 4P7IA 1V80A 1WGYA 3DCGA 1QF6A 1WX7A 1H8CA 2MBQA 1SJHD 4GDLA 1HTOA 1IUEA 4MELA 2LGDA 4AP4C 5G55A 3N32A 1OQRA 1QILA 3UI3A 2LD9A 1AARA 1TZ1A 2DLBA 2DYMA 3TEZA 2M1MA 3BK1A 4ITKA 2KMMA 1BT0A 2BS2B 3V3XA 5IP4D 3TEWA 1ZPSA 4FJVB 4W9DA 4RFBA 4S0RA 4TV3A 2ZCBA 1L0YB 1YJJA 1N5XA 1GNUA 5DPSA 1WXAA 2PPHA 5BYSA 4CHKA 3A9KA 1FXAA 4C7YA 2C7HA 2WXJA 2IGHA 2KNBA 3Q8BA 2QCZA 2XK5A 3JVZX 3P4RB 2D3AA 3R3MA 1V5OA 5CHWA 5CX3A 4AUQC 1L6UA 1KRHA 4FJYA 1B1ZA 3I63C 1UBQA 2D2QA 2GRIA 2EKIA 2KQ4X 4CQNA 3VAWA 2AEHA 4HJKA 2WU2B 2JYTA 5AZFA 4IM0A 5H8YE 2EMSA 2ZEQA 4FXCA 1PFDA 3BYYB 4WJOA 4B0MA 3A9JB 2ZVNA 3MFGA 3QA8A 3NS1A 4GOCA 2KDEB 4M0WA 2BGFA 2MA9B 4NQLB 2MCNB 1C3TA 4MSQB 4QAYA 4GXBA 5KHOA 2WXNA 4RH6A 3VRBB 3ZKJC 3ZW3A 3H7SA 4ZRKA 1V8CA 3ZO5B 2OEDA 1A70A 4GSWA 5DPRA 2MBBB 3JSVA 1EUVB 1EF5A 2KJ6A 5CHVC 3ONSA 1E5WA 3NZSA 2AX5A 1S3SG 2V0GA 5J17A 3UF8A 4LNFA 1YNTE 2YVCA 2NPTA 3WALA 3QQ8B 1JALA 3W5UB 4AS1A 4WAAA 2KFKB 2LFIA 3VFKA 4OZCA 4F7ZA 2JVCA 1A5RA 2KVZA 2R2OA 2LXAA 3M62B 4NY0A 1HXYD 3K9PB 1J7CA 1WI0A 2K6DB 1P98A 2LRWA 3KYDD 4B9KA 2V3NA 1FXIA 3SFDB 3W1SC 3ETRA 3DWGC 1I4GA 1I4PA 3RYTA 2O2VA 1FXTB 4AJYB 1JCKB 5C23A 3FILA 1SIFA 3WIMA 2QJLA 2DWQA 4IW0A 4JPSA 5EE9A 2LI5A 1YD8U 2N0SB 2JRHA 3PTFC 2LWPA 5EDSA 1RYJA 1LFDA 4B0EA 1M4VA 5FKAC 3QWZB 2N7EA 5IN7A 4N9F4 1E0ZA 3VTUA 1J7AA 2LVQA 1FMAD 2ZVOA 4G11A 3IBEA 3P1MA 3AN1A 4KX6B 3M3JA 4JGHB 3BVMA 1NI3A 2BYEA 2W3RA 3P4PB 3R7RA 4NJ6A 3U8ZA 2KFJA 3P42A 3QCAA 3RNGC 2ASQA 1TGZB 5FK9C 1YMHE 4IOIE 1WYWB 4W9JA 1DOYA 2ZNVB 2NR2A 2QSDA 3HM6X 4JQWC 4HVBA 1SE9A 3R2TA 1Q0WB 4JLCA 3GE8C 5TSSA 2KO3A 1U4AA 1HZ6A 4IDIA 5C1ZA 2IGDA 2HE7A 2WDQB 3TL5A 4LNIA 5KHQA 1KTKA 1UELA 3A33B 3BZDB 3LDZE 4LJPB 3HK0A 3C8YA 1IGCA 1ZW7A 4M8MA 4Q2JA 1TS5A 2L00B 4JWUC 3RCZA 2QIEB 4EFOA 3RNCC 2KN4A 3B2FA 3H9DA 4YT0B 4RGNA 2YEPB 1IYFA 3MC0B 2VRRB 2JPHA 2M4NA 1MI0A 1I35A 2RR9A 3A9JA 1XO3A 3MC9A 4GB9A 3AI5A 1C9FA 2WX0A 5EE0A 3AEAB 4RM8A 2KMCA 2QDFA 4J6IA 2W55A 1S1QB 3NZ3A 2L3ZA 1V9JA 2LGIA 2MWSB 1J19A 4HK2A 4NZLB 2MBHA 4PK1A 1WX8A 1WMHB 1V1PB 1WM3A 2BB6A 3QHTA 1D5ZC 4O1NA 4MEMA 3N1ZC 1RM6C 2WDRB 4F8CB 4KGTA 3IG3A 4D2KA 2EKEC 2LVPA 2ZNVC 3KW5B 3VXWA 1QOAA 2KAJA 2KWDA 2KK8A 2KFKA 1SE4A 4GDKB 3VR8B 5J18A 2PIAA 3JYUA 4FA6A 2I38A 1NDDA 4ARCA 2Z8LA 2ZW1A 2GMIC 1K8RB 5BYQA 1WJ4A 4OZBA 1E9MA 3V6EB 4YSZB 4ZRIA 4HDQA 2JXXA 5TR5A 3ZJTA 4OVZA 1DYQA 2DYBA 1D4BA 3NHEB 1JWMD 1M94A 1V49A 1I4XA 3AE2B 1WZ0A 2E3TA 2RD0A 2WNMA 1WGDA 2WLBA 1EF1A 2CJOA 1VR9A 3GE3C 2WXPA 1K51A 2FAZA 1P3QU 4EZKA 4FHJA 1D3ZA 1HTQA 3AECB 1SF0A 4P16A 1H4RA 3IXSA 1YX5B 3L54A 5D6JB 1V86A 3IAS1 2SAKA 1SXTA 4RNAA 1C4AA 1K52A 4HXDA 2V9HA 2JZZA 3LJ3A 1TKEA 4K1RB 3AMZA 3NRZA 3GB1A 1N62A 2BS3B 4L23A 1NEKB 2KANA 3A4SC 4WURA 1FO4A 3U30A 2CHXA 2MP2B 2K3UA 1G6JA 2HJ8A 2CHWA 2N9KA 2R61A 4USAA 1WGHA 2CS4A 1QOBA 3RUIB 2D3BA 1V97A 5FR3A 4ZOHC 3PREA 3ZXVA 1XXGA 1ZXIA 3H8HA 1J7BA 3X23A 2J0JA 3NVYA 1OEYJ 4NNJB 3ZTDA 2IO2B 4UDUC 1UZXB 1C78A 1GAQB 2RPQA 1F1HA 4BKSD 2KJRA 3L0WB 2BQQA 3AE7B 5E6OA 1VRAB 4W9CA 1CK1A 4KIKB 4F1SA 1D5MC 3ZIMA 1AYFA 1GB1A 2NBVB 3V62A 2MRPA 2GLSA 1LM8B 1NENB 2YEPF 4IG7B 2J0MA 2BWFA 5IA7A 1F9JA 2KQSA 3GS2A 4GLSC 2WQYB 4XDDA 1GJZA 1YOVB 3PV1A 3URYA 3N30A 3T8MA 3NS8A 3C0RB 3QX1A 1ISNA 1T0QC 4XWTA 2JX5A 5LLIA 2GI9A 4NPNA 2G9HD 2WDVB 3EC8A 4BKGA 1WMHA 4DQOC 1V1PA 4AOFA 5T8IA 3ZNHB 4A90A 2DHZA 5I4DA 2MW5A 1MVKA 2JT4B 2G4SA 4RMAA 1TS2A 2LHDA 1YN5A 3EUB2 3B2GA 5JHBA 3N1YC 3RNAC 3BVGA 1WJUA 2INCC 2LJIA 2W54A 2IPKD 3P4QB 2LMCA 2FCMA 3AEGB 1ROEA 3Q3NC 2DZKA 3WANA 3AEFB 2BVCA 1NI2A 3P63A 4PYUA 5AEKB 2ZPNA 1N63A 1MPEA 4W9LA 3MJ5A 4JL9A 3V05A 5JZEB 1Q1OA 2MEKA 2IZVB 3EA6A 4W9EA 2DYOA 4I6PA 3PRMB 1PGAA 5MPOA 2K8BA 4OVUA 1IPGA 2M0AA 3DBSA 1WYGA 3OLMD 4K3BA 1WGGA 5D3IB 4MH8A 3KWVA 3CWIA 4AJWA 2FUG1 4WWNA 4HLEA 1L0XB 3H7PB 4DXAB 4GMVA 1C4PA 4MM3A 2QC8A 4S17A 2J42A 4DHJB 3DBRB 3HRDD 3A4RA 3N20C 1MG4A 5D3DA 2JF5A 3PPAA 2K25A 4I6LB 2MHJA 3WAPA 2WHIA 1PUTA 1V2YA 3AE6B 3ZQ4A 3AU4A 3S2AA 3UINB 1WXMA 1ZDVA 1ZP0B 4EOYA 4ARIA 3WA0A 4YTMB 4A6QA 1CQVA 3UQBA 1ET6A 4XE0A 1F52A 1X1MA 3OG5A 4NJ7A 1FRRA 3KQ4A 3KYCD 2ACZB 4HKZE 4K7SA 3Q69A 2BKRB 4DHJD 4DXGA 3RD2A 4KDLB
chains in the Genus database with same CATH topology
4NJ6A 4FJZA 5D2MB 2DZIA 2KLCA 3U8ZA 2KFJA 1GG3A 3QCAA 4DHZB 2KKCA 2ASQA 1RFAA 1TGZB 1C1YB 3NZUA 5CHFA 3TIXA 1WYWB 3UGBB 4W9JA 4KVGB 3SHQA 2ZNVB 2NR2A 3HM3A 3HM6X 4JQWC 4E74A 4EEWA 4HVBA 1SE9A 3PZDA 1QZEA 1Q0WB 4JLCA 2DZJA 1VD2A 2PEAA 1LQBA 4W9FA 4TQ1A 4WWPA 2FCNA 2G4DB 2AWTA 2KWCA 3L10B 3ZRFA 2AYOB 3D32A 2KO3A 4W9KA 1U4AA 2CHZA 2CU1A 1YQBA 1CMXB 4G0NB 2HTHA 4OVVA 5C1ZA 1T0YA 3IVFA 2LASA 3V60A 4W9IA 1GC6A 1WH3A 2HE7A 3TL5A 2GBKA 1PQSA 3BINA 4G3XB 4CYEA 3AU5A 1XD3B 1WXSA 4BBNF 3BY4B 2JY6A 3I3TB 5LXHA 5KHQA 1UELA 4PYZA 2NBUA 2RGFA 2DZMA 2KX0A 3PHWB 1E8ZA 3ZDMC 2N7DA 4EZJA 4RM9A 4GDKA 3IFWB 3A33B 4KIKA 3LDZE 4MSMB 3SD5A 3A9KB 2MBEA 2KMAA 4LJPB 2GBNA 2BYFA 2L7RA 3HK0A 2KTFA 3W1YA 1E7UA 4JIOU 2KQ7A 1OEYA 1ZKHA 1ZW7A 2LZ6A 2CR5A 2KOXA 2XK5B 3B08A 4M8MA 2L00B 4K7WA 5J2RA 3RCZA 4EFOA 4MGKE 3H9DA 3RZFA 1Y8RC 1RRBA 2Z0EB 3A1QA 1IYFA 2DENB 2VRRB 2JPHA 2M4NA 3DQVA 4I6NB 3KH0A 4LDTB 3AULA 5D94A 1I35A 2RR9A 3A9JA 3RULA 1IP9A 2O6VB 2R2QA 1KLVA 1WF9A 4PS7A 2L8JA 1OQYA 3APDA 4GB9A 4HPLB 3AI5A 2PJHA 2LXCA 2WX0A 4W9GA 2L76A 3O65B 1V5TA 4RM8A 3X0WA 2KMCA 2V4LA 4IWQA 4J6IA 3CSFA 1S1QB 5G2NA 2L3ZA 2ZJDA 1V9JA 1SGHA 3QK0A 2MWSB 3EECA 3H1UA 4KDIC 4M0WB 3EHVA 1J19A 4HK2A 5D7GA 1OTRB 1VCBA 2MBHA 3H6NA 4ANUA 2KHWB 1WX8A 2L05A 3P2BA 1P0RA 2N1WA 2KTRA 3CSTA 3PVLA 3KUCB 2JRIB 2B3AA 3UIOB 1WMHB 1J0GA 2W9NA 3QHTA 1WM3A 2IY1B 3R66C 4LCDE 5LXIB 4FLHA 4HDOA 1MG8A 2J0KA 4II3B 4MEMA 2G45B 4MH0E 3JSVB 4F8CB 2JZ3B 1Q5WB 3IG3A 4E71A 4ZYNA 2EKEC 1Z5SB 4FN2A 2REXA 1KOTA 2FCSA 2LVPA 3DVGX 2ZNVC 4ANVA 4IM2A 2KN5A 4ANWA 3KW5B 4LDTD 2BWES 3DVGY 3WAMA 4BKSA 3VXWA 4M8NA 1WJNA 2GBJA 3GOEA 1WGRA 1E8XA 2O6VD 1WR6E 2K8HA 3WAOA 1L2NA 2KD0A 3ZTCA 4II2B 3MJWA 3OAWA 2KK8A 2KFKA 4GDKB 2GBMA 4DBGA 3Q3FA 3DDCB 2FCQA 2LGXA 5J18A 2MP2A 4MJSA 1WE6A 3L16A 3JYUA 1KM7A 4FA6A 2NPTB 1NDDA 4HWIB 4XX5A 1YJ1A 2M8SA 3CF6E 1WXVA 3JW0X 2GMIC 2K1FA 1GUAB 1K8RB 1WJ4A 3PLUA 3UIPB 4WJQA 3APCA 4KSLC 1WRDB 2A5UA 4MGZE 3V6EB 1Z2MA 4ZRIA 2JUOA 5FR6A 2XEWA 2C7MB 2LVOA 4HDQA 2DX5B 2BKFA 2IBIB 3TCAA 2CKHB 2KX3A 5CTRC 4KZCA 3H7PA 2JXXA 5TR5A 5BO4B 4DHJD 4EZLA 2DYBA 3VH3B 4B6WA 4BKTA 1J8CA 4A3PA 1E8WA 5DCNA 1OGWA 3NHEB 3VQIA 3VUWA 3PRZA 5GMVA 2UYZB 1I42A 1M94A 1V49A 2K8CA 3M95A 4MGYE 3ENEA 2KLGA 4XC2A 4BOSC 2IO1B 2K39A 1WZ0A 2K6QA 2O2VB 3PHXB 3UQAA 2RD0A 2GBRA 1WGDA 1EF1A 1WFYA 3NOBA 3B0AA 3QJZA 3EFUA 1E90A 2MLBA 3L13A 2FAZA 3TBLD 2IO3B 4MGIE 2DAFA 3VVWB 1P3QU 3W1SA 4EZKA 2ZPYA 3AXCA 3U7DA 2Z0DB 4FHJA 1D3ZA 3Q3JA 1LXDA 2L0FA 2DAJA 3ZNGC 3K9OB 4DK5A 2KVRA 4W9HA 3L17A 2IYDB 4FBJB 1H4RA 3ALBA 3T9LA 3B1LX 1YX5B 4FULA 4P7IA 3L54A 1V80A 5D6JB 1V86A 4WJNA 4K7UA 4GU2A 1WGYA 5L95C 3DCGA 4HXDA 3KVFB 2JZZA 3LJ3A 4NAWB 1WX7A 2KC1A 2YLMA 1WM2A 4K1RB 2C7NB 4WQOB 1H8CA 2MBQA 3PT2B 2KANA 3A4SC 4GDLA 4DDGD 3PRPB 3DVNV 3ZLZA 3U30A 2CHXA 4MELA 2MP2B 2LGDA 4AP4C 5G55A 2HJ8A 1G6JA 2FUHB 1EO6A 3N32A 2CHWA 1WE7A 2KWVB 4BBNC 2A4ZA 1WGHA 2M17A 4ASWC 2LD9A 2CS4A 3VTVA 1AARA 1TZ1A 3RUIB 2DYMA 3ML9A 2M1MA 3QC8B 4HPMB 3V6CB 3QAQA 2GOWA 3VDZA 1BT0A 2C60A 3PREA 4FJVB 3MHSD 3VUXA 4ZRJA 4W9DA 2NBWB 1UD7A 4TV3A 2ZCBA 2J7QB 4DDID 2IY0B 3KUZA 3X23A 2J0JA 1GNUA 1OEYJ 2MSED 2KXJA 3PS6A 4NNJB 3PLVA 5DPSA 1WIAA 4BFRA 1WXAA 4MDKE 3ZTDA 4B95A 4FADA 3NY5A 3APFA 3ZNID 1WJ6A 1YX6B 2PPHA 2IO2B 4A3OA 3R7RA 1UZXB 3MTNB 3DBRI 2RPQA 4CHKA 3A9KA 1ZGUB 1GC7A 2N9EB 2C7HA 5E6NA 4BKSD 2KC2A 3DBLI 2LJ5A 4PS8A 2KNBA 2KJRA 3L0WB 2XK5A 3JVZX 3PSEB 5E6OA 3SU8X 3R3MA 1V5OA 4BVUC 2ZZPB 4G50A 4W9CA 5CHWA 5CX3A 5DPTA 4AUQC 4KIKB 3ZUNA 4F1SA 3ZIMA 5DPWA 4GIVA 3QIJA 2NBVB 2L0TA 3V62A 1UH6A 2MRPA 3M63B 4FJYA 1LM8B 1V81A 1JRUA 2D10A 2AL6A 4TUUA 4IG7B 4EKUA 1UBQA 2BPSA 2D2QA 2J0MA 2BWFA 2MX2A 2O6VA 4WWOA 3VAWA 1RAXA 2C5LC 2KJHB 4A20A 2AEHA 2NCNA 5JH5C 4HJKA 5IA7A 1WZ3A 1E8YA 1F9JA 2KQSA 5E6PA 5AZFA 3RT3B 3A1QB 4IM0A 4AWJA 2KDIA 2EMSA 1RLFA 2ZEQA 2V3SA 1GJZA 3IHPC 4WJOA 1R4MI 3A9JB 3PV1A 2ZVNA 3R7QA 4BOZB 3QA8A 2HD5B 3N30A 4HCPB 4URKA 3T8MA 4GGQA 4GOCA 3NS8A 2KDEB 3C0RB 2BGFA 2MA9B 3QX1A 1ISNA 4IC7B 4NQLB 4DHZE 2MCNB 1C3TA 2ZCCA 4MSQB 5LLIA 4NPNA 4GDLB 4GXBA 5KHOA 4NQKE 3ZKJC 3ZW3A 2I1JA 3EC8A 4BKGA 1WMHA 3H7SA 4ZRKA 5HKHA 4X57B 4AOFA 2OOBB 3OJ3A 3ZO5B 4GN1A 3ZNHB 4CO7A 2DHZA 4IM3A 2EMTA 3SDLC 3VH4B 4GSWA 5DPRA 2MW5A 2MBBB 3JSVA 2JT4B 2G4SA 2OJRA 1EUVB 4RMAA 2KTRB 2D11A 2KDBA 5JHBA 2WX1A 4PS3A 1EF5A 5L83A 5AZHA 3L08A 2V1YA 2KJ6A 5CHVC 2BYVE 3TJPA 3ONSA 4KDLB 4DWFA 1WJUA 1E5WA 1XQQA 5AZGA 3NZSA 1S3SG 2FCMA 2FIDA 2JWZA 5J17A 3DPDA 2DZKA 3UF8A 3WANA 3VUYA 1NI2A 2YVCA 2N4FA 4PYUA 2IO0B 2NPTA 4HCNB 2WYQA 3WALA 5AEKB 2BF8B 2ZPNA 3QQ8B 3GZNI 4KSKC 3DVNU 4E3CA 4WAAA 2KFKB 1YIWA 4W9LA 4KZ0A 4TQ0A 4JL9A 2RSUA 1XT9B 4ICUA 3VFKA 5JZEB 1Q1OA 2Y5BB 2D07B 4F7ZA 2JVCA 4MJSB 1A5RA 2N9XA 2XBBC 2KDFB 2R2OA 2LUEA 2IZVB 2LXAA 3M62B 4NY0A 4ANXA 1UGMA 3QARA 3RZWC 4W9EA 2DYOA 3HHMA 3K9PB 3TMPB 4I6PA 3VTWA 1WI0A 3PRMB 2K6DB 1WR1A 1P98A 2LRWA 4EUTA 3KYDD 4B9KA 2D3GA 2FNJB 4XZ4A 2Z59B 2LGYA 2K8BA 1HE8A 4OVUA 1IPGA 3DBSA 3OLMD 3ZDTA 1V6EA 1WGGA 1L7YA 2LRUA 3ECIA 2PE9A 2WDTB 3ZVVA 1P9DU 4AJWA 3W1SC 4WWNA 2PE6B 4HLEA 4ZDVA 3H7PB 3RYTA 4DXAB 4GMVA 2N1VA 4MM3A 2O2VA 1FXTB 4AJYB 4DHJB 5C23A 5JHAA 2KZRA 1SIFA 4IWPA 2NVUI 3A4RA 3WIMA 2JF5A 3PPAA 2K25A 4I6LB 3KUDB 4IW0A 4K81A 2LI5A 1YD8U 4IUMB 3WAPA 2JRHA 3PTFC 3V61A 2LWPA 1V2YA 4ICVA 3HIZA 3AU4A 5EDSA 1WY8A 2UWQA 3S2AA 1TBEA 2WWZA 1LFDA 3UINB 4FHKA 1E7VA 1WXMA 3ML8A 2C9WB 2M0XA 4EOYA 4WJPA 2AL3A 1P1AA 3QWZB 2I1KA 3PGEA 2N7EA 3ZNZB 4TKNA 3DOWA 1UBIA 4N9F4 3WA0A 3VTUA 2LVQA 5IAAC 2FIFA 3ZRCA 2ZVOA 2KWUB 4G11A 2G3QB 3UQBA 1NBFC 3IBEA 1X1MA 3DBHI 4KV2A 1KJTA 1R4NI 4LJOB 4NAWA 2MQJA 2NS5A 3M3JA 3OJ4B 4IWOA 4NJ7A 4JGHB 2MBOA 1TTNA 4YL8A 3KYCD 1WX9A 2BYEA 4K7SA 2QHOA 3VHTC 2BKRB 2N9PC 3CMMB 3RD2A 3N3KB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NJ6 A;  4FJZ A;  5D2M B;  2DZI A;  2KLC A;  3U8Z A;  2KFJ A;  1GG3 A;  3QCA A;  4DHZ B;  2KKC A;  2ASQ A;  1RFA A;  1TGZ B;  1C1Y B;  3NZU A;  5CHF A;  3TIX A;  1WYW B;  3UGB B;  4W9J A;  4KVG B;  3SHQ A;  2ZNV B;  2NR2 A;  3HM3 A;  3HM6 X;  4JQW C;  4E74 A;  4EEW A;  4HVB A;  1SE9 A;  3PZD A;  1QZE A;  1Q0W B;  4JLC A;  2DZJ A;  1VD2 A;  2PEA A;  1LQB A;  4W9F A;  4TQ1 A;  4WWP A;  2FCN A;  2G4D B;  2AWT A;  2KWC A;  3L10 B;  3ZRF A;  2AYO B;  3D32 A;  2KO3 A;  4W9K A;  1U4A A;  2CHZ A;  2CU1 A;  1YQB A;  1CMX B;  4G0N B;  2HTH A;  4OVV A;  5C1Z A;  1T0Y A;  3IVF A;  2LAS A;  3V60 A;  4W9I A;  1GC6 A;  1WH3 A;  2HE7 A;  3TL5 A;  2GBK A;  1PQS A;  3BIN A;  4G3X B;  4CYE A;  3AU5 A;  1XD3 B;  1WXS A;  4BBN F;  3BY4 B;  2JY6 A;  3I3T B;  5LXH A;  5KHQ A;  1UEL A;  4PYZ A;  2NBU A;  2RGF A;  2DZM A;  2KX0 A;  3PHW B;  1E8Z A;  3ZDM C;  2N7D A;  4EZJ A;  4RM9 A;  4GDK A;  3IFW B;  3A33 B;  4KIK A;  3LDZ E;  4MSM B;  3SD5 A;  3A9K B;  2MBE A;  2KMA A;  4LJP B;  2GBN A;  2BYF A;  2L7R A;  3HK0 A;  2KTF A;  3W1Y A;  1E7U A;  4JIO U;  2KQ7 A;  1OEY A;  1ZKH A;  1ZW7 A;  2LZ6 A;  2CR5 A;  2KOX A;  2XK5 B;  3B08 A;  4M8M A;  2L00 B;  4K7W A;  5J2R A;  3RCZ A;  4EFO A;  4MGK E;  3H9D A;  3RZF A;  1Y8R C;  1RRB A;  2Z0E B;  3A1Q A;  1IYF A;  2DEN B;  2VRR B;  2JPH A;  2M4N A;  3DQV A;  4I6N B;  3KH0 A;  4LDT B;  3AUL A;  5D94 A;  1I35 A;  2RR9 A;  3A9J A;  3RUL A;  1IP9 A;  2O6V B;  2R2Q A;  1KLV A;  1WF9 A;  4PS7 A;  2L8J A;  1OQY A;  3APD A;  4GB9 A;  4HPL B;  3AI5 A;  2PJH A;  2LXC A;  2WX0 A;  4W9G A;  2L76 A;  3O65 B;  1V5T A;  4RM8 A;  3X0W A;  2KMC A;  2V4L A;  4IWQ A;  4J6I A;  3CSF A;  1S1Q B;  5G2N A;  2L3Z A;  2ZJD A;  1V9J A;  1SGH A;  3QK0 A;  2MWS B;  3EEC A;  3H1U A;  4KDI C;  4M0W B;  3EHV A;  1J19 A;  4HK2 A;  5D7G A;  1OTR B;  1VCB A;  2MBH A;  3H6N A;  4ANU A;  2KHW B;  1WX8 A;  2L05 A;  3P2B A;  1P0R A;  2N1W A;  2KTR A;  3CST A;  3PVL A;  3KUC B;  2JRI B;  2B3A A;  3UIO B;  1WMH B;  1J0G A;  2W9N A;  3QHT A;  1WM3 A;  2IY1 B;  3R66 C;  4LCD E;  5LXI B;  4FLH A;  4HDO A;  1MG8 A;  2J0K A;  4II3 B;  4MEM A;  2G45 B;  4MH0 E;  3JSV B;  4F8C B;  2JZ3 B;  1Q5W B;  3IG3 A;  4E71 A;  4ZYN A;  2EKE C;  1Z5S B;  4FN2 A;  2REX A;  1KOT A;  2FCS A;  2LVP A;  3DVG X;  2ZNV C;  4ANV A;  4IM2 A;  2KN5 A;  4ANW A;  3KW5 B;  4LDT D;  2BWE S;  3DVG Y;  3WAM A;  4BKS A;  3VXW A;  4M8N A;  1WJN A;  2GBJ A;  3GOE A;  1WGR A;  1E8X A;  2O6V D;  1WR6 E;  2K8H A;  3WAO A;  1L2N A;  2KD0 A;  3ZTC A;  4II2 B;  3MJW A;  3OAW A;  2KK8 A;  2KFK A;  4GDK B;  2GBM A;  4DBG A;  3Q3F A;  3DDC B;  2FCQ A;  2LGX A;  5J18 A;  2MP2 A;  4MJS A;  1WE6 A;  3L16 A;  3JYU A;  1KM7 A;  4FA6 A;  2NPT B;  1NDD A;  4HWI B;  4XX5 A;  1YJ1 A;  2M8S A;  3CF6 E;  1WXV A;  3JW0 X;  2GMI C;  2K1F A;  1GUA B;  1K8R B;  1WJ4 A;  3PLU A;  3UIP B;  4WJQ A;  3APC A;  4KSL C;  1WRD B;  2A5U A;  4MGZ E;  3V6E B;  1Z2M A;  4ZRI A;  2JUO A;  5FR6 A;  2XEW A;  2C7M B;  2LVO A;  4HDQ A;  2DX5 B;  2BKF A;  2IBI B;  3TCA A;  2CKH B;  2KX3 A;  5CTR C;  4KZC A;  3H7P A;  2JXX A;  5TR5 A;  5BO4 B;  4DHJ D;  4EZL A;  2DYB A;  3VH3 B;  4B6W A;  4BKT A;  1J8C A;  4A3P A;  1E8W A;  5DCN A;  1OGW A;  3NHE B;  3VQI A;  3VUW A;  3PRZ A;  5GMV A;  2UYZ B;  1I42 A;  1M94 A;  1V49 A;  2K8C A;  3M95 A;  4MGY E;  3ENE A;  2KLG A;  4XC2 A;  4BOS C;  2IO1 B;  2K39 A;  1WZ0 A;  2K6Q A;  2O2V B;  3PHX B;  3UQA A;  2RD0 A;  2GBR A;  1WGD A;  1EF1 A;  1WFY A;  3NOB A;  3B0A A;  3QJZ A;  3EFU A;  1E90 A;  2MLB A;  3L13 A;  2FAZ A;  3TBL D;  2IO3 B;  4MGI E;  2DAF A;  3VVW B;  1P3Q U;  3W1S A;  4EZK A;  2ZPY A;  3AXC A;  3U7D A;  2Z0D B;  4FHJ A;  1D3Z A;  3Q3J A;  1LXD A;  2L0F A;  2DAJ A;  3ZNG C;  3K9O B;  4DK5 A;  2KVR A;  4W9H A;  3L17 A;  2IYD B;  4FBJ B;  1H4R A;  3ALB A;  3T9L A;  3B1L X;  1YX5 B;  4FUL A;  4P7I A;  3L54 A;  1V80 A;  5D6J B;  1V86 A;  4WJN A;  4K7U A;  4GU2 A;  1WGY A;  5L95 C;  3DCG A;  4HXD A;  3KVF B;  2JZZ A;  3LJ3 A;  4NAW B;  1WX7 A;  2KC1 A;  2YLM A;  1WM2 A;  4K1R B;  2C7N B;  4WQO B;  1H8C A;  2MBQ A;  3PT2 B;  2KAN A;  3A4S C;  4GDL A;  4DDG D;  3PRP B;  3DVN V;  3ZLZ A;  3U30 A;  2CHX A;  4MEL A;  2MP2 B;  2LGD A;  4AP4 C;  5G55 A;  2HJ8 A;  1G6J A;  2FUH B;  1EO6 A;  3N32 A;  2CHW A;  1WE7 A;  2KWV B;  4BBN C;  2A4Z A;  1WGH A;  2M17 A;  4ASW C;  2LD9 A;  2CS4 A;  3VTV A;  1AAR A;  1TZ1 A;  3RUI B;  2DYM A;  3ML9 A;  2M1M A;  3QC8 B;  4HPM B;  3V6C B;  3QAQ A;  2GOW A;  3VDZ A;  1BT0 A;  2C60 A;  3PRE A;  4FJV B;  3MHS D;  3VUX A;  4ZRJ A;  4W9D A;  2NBW B;  1UD7 A;  4TV3 A;  2ZCB A;  2J7Q B;  4DDI D;  2IY0 B;  3KUZ A;  3X23 A;  2J0J A;  1GNU A;  1OEY J;  2MSE D;  2KXJ A;  3PS6 A;  4NNJ B;  3PLV A;  5DPS A;  1WIA A;  4BFR A;  1WXA A;  4MDK E;  3ZTD A;  4B95 A;  4FAD A;  3NY5 A;  3APF A;  3ZNI D;  1WJ6 A;  1YX6 B;  2PPH A;  2IO2 B;  4A3O A;  3R7R A;  1UZX B;  3MTN B;  3DBR I;  2RPQ A;  4CHK A;  3A9K A;  1ZGU B;  1GC7 A;  2N9E B;  2C7H A;  5E6N A;  4BKS D;  2KC2 A;  3DBL I;  2LJ5 A;  4PS8 A;  2KNB A;  2KJR A;  3L0W B;  2XK5 A;  3JVZ X;  3PSE B;  5E6O A;  3SU8 X;  3R3M A;  1V5O A;  4BVU C;  2ZZP B;  4G50 A;  4W9C A;  5CHW A;  5CX3 A;  5DPT A;  4AUQ C;  4KIK B;  3ZUN A;  4F1S A;  3ZIM A;  5DPW A;  4GIV A;  3QIJ A;  2NBV B;  2L0T A;  3V62 A;  1UH6 A;  2MRP A;  3M63 B;  4FJY A;  1LM8 B;  1V81 A;  1JRU A;  2D10 A;  2AL6 A;  4TUU A;  4IG7 B;  4EKU A;  1UBQ A;  2BPS A;  2D2Q A;  2J0M A;  2BWF A;  2MX2 A;  2O6V A;  4WWO A;  3VAW A;  1RAX A;  2C5L C;  2KJH B;  4A20 A;  2AEH A;  2NCN A;  5JH5 C;  4HJK A;  5IA7 A;  1WZ3 A;  1E8Y A;  1F9J A;  2KQS A;  5E6P A;  5AZF A;  3RT3 B;  3A1Q B;  4IM0 A;  4AWJ A;  2KDI A;  2EMS A;  1RLF A;  2ZEQ A;  2V3S A;  1GJZ A;  3IHP C;  4WJO A;  1R4M I;  3A9J B;  3PV1 A;  2ZVN A;  3R7Q A;  4BOZ B;  3QA8 A;  2HD5 B;  3N30 A;  4HCP B;  4URK A;  3T8M A;  4GGQ A;  4GOC A;  3NS8 A;  2KDE B;  3C0R B;  2BGF A;  2MA9 B;  3QX1 A;  1ISN A;  4IC7 B;  4NQL B;  4DHZ E;  2MCN B;  1C3T A;  2ZCC A;  4MSQ B;  5LLI A;  4NPN A;  4GDL B;  4GXB A;  5KHO A;  4NQK E;  3ZKJ C;  3ZW3 A;  2I1J A;  3EC8 A;  4BKG A;  1WMH A;  3H7S A;  4ZRK A;  5HKH A;  4X57 B;  4AOF A;  2OOB B;  3OJ3 A;  3ZO5 B;  4GN1 A;  3ZNH B;  4CO7 A;  2DHZ A;  4IM3 A;  2EMT A;  3SDL C;  3VH4 B;  4GSW A;  5DPR A;  2MW5 A;  2MBB B;  3JSV A;  2JT4 B;  2G4S A;  2OJR A;  1EUV B;  4RMA A;  2KTR B;  2D11 A;  2KDB A;  5JHB A;  2WX1 A;  4PS3 A;  1EF5 A;  5L83 A;  5AZH A;  3L08 A;  2V1Y A;  2KJ6 A;  5CHV C;  2BYV E;  3TJP A;  3ONS A;  4KDL B;  4DWF A;  1WJU A;  1E5W A;  1XQQ A;  5AZG A;  3NZS A;  1S3S G;  2FCM A;  2FID A;  2JWZ A;  5J17 A;  3DPD A;  2DZK A;  3UF8 A;  3WAN A;  3VUY A;  1NI2 A;  2YVC A;  2N4F A;  4PYU A;  2IO0 B;  2NPT A;  4HCN B;  2WYQ A;  3WAL A;  5AEK B;  2BF8 B;  2ZPN A;  3QQ8 B;  3GZN I;  4KSK C;  3DVN U;  4E3C A;  4WAA A;  2KFK B;  1YIW A;  4W9L A;  4KZ0 A;  4TQ0 A;  4JL9 A;  2RSU A;  1XT9 B;  4ICU A;  3VFK A;  5JZE B;  1Q1O A;  2Y5B B;  2D07 B;  4F7Z A;  2JVC A;  4MJS B;  1A5R A;  2N9X A;  2XBB C;  2KDF B;  2R2O A;  2LUE A;  2IZV B;  2LXA A;  3M62 B;  4NY0 A;  4ANX A;  1UGM A;  3QAR A;  3RZW C;  4W9E A;  2DYO A;  3HHM A;  3K9P B;  3TMP B;  4I6P A;  3VTW A;  1WI0 A;  3PRM B;  2K6D B;  1WR1 A;  1P98 A;  2LRW A;  4EUT A;  3KYD D;  4B9K A;  2D3G A;  2FNJ B;  4XZ4 A;  2Z59 B;  2LGY A;  2K8B A;  1HE8 A;  4OVU A;  1IPG A;  3DBS A;  3OLM D;  3ZDT A;  1V6E A;  1WGG A;  1L7Y A;  2LRU A;  3ECI A;  2PE9 A;  2WDT B;  3ZVV A;  1P9D U;  4AJW A;  3W1S C;  4WWN A;  2PE6 B;  4HLE A;  4ZDV A;  3H7P B;  3RYT A;  4DXA B;  4GMV A;  2N1V A;  4MM3 A;  2O2V A;  1FXT B;  4AJY B;  4DHJ B;  5C23 A;  5JHA A;  2KZR A;  1SIF A;  4IWP A;  2NVU I;  3A4R A;  3WIM A;  2JF5 A;  3PPA A;  2K25 A;  4I6L B;  3KUD B;  4IW0 A;  4K81 A;  2LI5 A;  1YD8 U;  4IUM B;  3WAP A;  2JRH A;  3PTF C;  3V61 A;  2LWP A;  1V2Y A;  4ICV A;  3HIZ A;  3AU4 A;  5EDS A;  1WY8 A;  2UWQ A;  3S2A A;  1TBE A;  2WWZ A;  1LFD A;  3UIN B;  4FHK A;  1E7V A;  1WXM A;  3ML8 A;  2C9W B;  2M0X A;  4EOY A;  4WJP A;  2AL3 A;  1P1A A;  3QWZ B;  2I1K A;  3PGE A;  2N7E A;  3ZNZ B;  4TKN A;  3DOW A;  1UBI A;  4N9F 4;  3WA0 A;  3VTU A;  2LVQ A;  5IAA C;  2FIF A;  3ZRC A;  2ZVO A;  2KWU B;  4G11 A;  2G3Q B;  3UQB A;  1NBF C;  3IBE A;  1X1M A;  3DBH I;  4KV2 A;  1KJT A;  1R4N I;  4LJO B;  4NAW A;  2MQJ A;  2NS5 A;  3M3J A;  3OJ4 B;  4IWO A;  4NJ7 A;  4JGH B;  2MBO A;  1TTN A;  4YL8 A;  3KYC D;  1WX9 A;  2BYE A;  4K7S A;  2QHO A;  3VHT C;  2BKR B;  2N9P C;  3CMM B;  3RD2 A;  3N3K B; 
#chains in the Genus database with same CATH topology
 2DZI A;  3RMK C;  1XF5 L;  4DHZ B;  5E6J A;  1AW7 A;  3TIX A;  3UGB B;  3SHQ A;  1EM7 A;  3PZ7 A;  3O13 A;  3PZD A;  3NVV A;  2PEA A;  1ESF A;  4W9F A;  1MJD A;  4WWP A;  2FCN A;  3L10 B;  2JXT A;  1FIQ A;  2CU1 A;  4G0N B;  1JRP A;  1T0Y A;  2LAS A;  1GC6 A;  1SEB D;  4TMA B;  3FAH A;  2XN9 C;  4CYE A;  3AU5 A;  1FNU A;  3BY4 B;  2JY6 A;  5LXH A;  2WXI A;  4PYZ A;  2NBU A;  5C3J B;  3PHW B;  1JRO A;  3IFW B;  4KIK A;  1T0R C;  2ICI A;  2L7R A;  5IOI A;  4JIO U;  2KQ7 A;  1ZKH A;  2GB1 A;  5J2R A;  4K7W A;  1YN3 A;  3T3O A;  3Q8C A;  4NAM A;  4LNN A;  2LUM A;  1Y8R C;  1XLN A;  3HUI A;  1RRB A;  2Z0E B;  2DEN B;  3DQV A;  3Q6B A;  5EE3 A;  5D94 A;  3Q2A C;  3RUL A;  1IP9 A;  1FFV A;  4K3C A;  4YSX B;  2L8J A;  3APD A;  4HPL B;  2PJH A;  1DOX A;  2LHE A;  4W9G A;  3U52 E;  3X0W A;  2V4L A;  3RN9 C;  3CSF A;  5G2N A;  2ZJD A;  4MT5 A;  1YQ4 B;  3H1U A;  1FD6 A;  1B9R A;  1JML A;  1XCT L;  5D7G A;  1VCB A;  4ANU A;  3PVL A;  2B3A A;  2E6X A;  5AUI A;  2W9N A;  3R66 C;  4LCD E;  1VZ6 A;  4HDO A;  1DGJ A;  1Q5W B;  1JWS D;  1RFK A;  4REZ A;  4ANV A;  1QLB B;  3DBH B;  1R4N B;  3GOE A;  1WGR A;  1SB3 C;  1WR6 E;  2HJ1 A;  5BMI A;  2KD0 A;  2ON8 A;  3ZTC A;  2M19 A;  3MJW A;  4LTU A;  1FFU A;  4DBG A;  3DDC B;  2LGX A;  4HKQ A;  2WXH A;  1K50 A;  2K0P A;  2M56 B;  1WE6 A;  1JWA D;  2V3P A;  4HWI B;  1YJ1 A;  2M8S A;  3CF6 E;  4WJQ A;  4KSL C;  2A5U A;  2RMM A;  4MGZ E;  2JUO A;  2C7M B;  2DX5 B;  2BKF A;  2MH7 A;  3TCA A;  2CKH B;  2KX3 A;  3AV8 A;  3Q8A A;  4KZC A;  1ET9 A;  3H7P A;  3SFE B;  2X38 A;  5BO4 B;  3PO0 A;  4HPP A;  2D5G A;  4WH4 A;  3VH3 B;  1J8C A;  4A3P A;  3VQI A;  3VUW A;  1I42 A;  4J3O D;  2K8C A;  1XLO A;  4L1B A;  2SEB D;  3ENE A;  4YWG G;  2KLG A;  1E7P B;  4BOS C;  2IO1 B;  2JU6 X;  2K39 A;  1ZXH A;  3UQA A;  5BMH A;  3DHH C;  3B0A A;  3QJZ A;  3LB8 C;  1SIJ A;  2MLB A;  1GPX A;  1EU3 A;  1JW9 D;  5C2T B;  3W1S A;  1SBB B;  2Z0D B;  3Q3O C;  4US9 A;  4P1B C;  3AE5 B;  2DAJ A;  3ZNG C;  2ZW0 A;  3OWE B;  2KVR A;  2K9X A;  3ALB A;  3T9L A;  1KLU D;  3TEX A;  1FNW A;  4RF1 A;  1FCL A;  2JYE A;  5L95 C;  4NAW B;  2KC1 A;  2YLM A;  1WM2 A;  1FRD A;  3PT2 B;  4IKG A;  4DDG D;  3PRP B;  4US8 A;  1OQQ A;  1EO6 A;  2KWV B;  3RI7 C;  4BBN C;  4ASW C;  2M17 A;  4C00 A;  1MHH E;  1C4C A;  1E6E B;  3VTV A;  4HPM B;  3V6C B;  3VDZ A;  4NJC A;  2C60 A;  3B9J A;  3MHS D;  4ZRJ A;  1RWS A;  4RGT A;  4DDI D;  3KUZ A;  3NUH B;  2MSE D;  5LNK 1;  1HQR D;  3PS6 A;  4BFR A;  1WIA A;  4B95 A;  4FAD A;  3NY5 A;  3APF A;  1WJ6 A;  1YX6 B;  3ZJV A;  4A3O A;  4TSS A;  3DBR I;  2BS4 B;  1ZGU B;  4KKJ A;  3I57 A;  5E6N A;  2KC2 A;  2LJ5 A;  3IT6 B;  3T3N A;  2ZZP B;  3ZGZ A;  4G50 A;  5DPT A;  3ZUN A;  4GIV A;  3QIJ A;  5HHD G;  1F2R C;  2D10 A;  2AL6 A;  2W82 A;  2L1A A;  1FPY A;  2XNA C;  4WWO A;  1XCQ L;  2C5L C;  1L5P A;  1MHX A;  1OFF A;  5E6P A;  1TKY A;  2LEK A;  4JE3 B;  4AWJ A;  3J9C A;  1UWM A;  2V3S A;  1PGB A;  3R7Q A;  1C76 A;  1YN4 A;  2K22 A;  4HCP B;  4URK A;  4GGQ A;  2PVO D;  3EGR A;  4IC7 B;  4N58 A;  4KKI A;  2ZCC A;  3DHI C;  2WP9 B;  4GDL B;  5HKH A;  3MHZ A;  4IM3 A;  2EMT A;  3SDL C;  2WXK A;  3GP7 A;  2BT6 A;  3AM9 A;  2DBY A;  2D11 A;  1HA5 A;  4PS3 A;  5AZH A;  1Q10 A;  3L08 A;  2D3C A;  3TJP A;  4DWF A;  2WS3 B;  1XQQ A;  2Y5C A;  5G5H A;  5AZG A;  3SEB A;  2FID A;  2JWZ A;  4XGA B;  2JZP A;  3DPD A;  4LNK A;  3VUY A;  3DWM A;  2N4F A;  4P6V F;  4HCN B;  2WYQ A;  3BK2 A;  3EFC A;  2N7J A;  4E3C A;  1AWD A;  2INN E;  1FNV A;  3RFZ B;  3SR6 A;  1BXT A;  1YIW A;  1KF6 B;  5IKC M;  1CZP A;  1XT9 B;  4ICU A;  3CIR B;  2AQ2 B;  4MJS B;  1R7S A;  4ZRQ A;  1NVI D;  1QQR A;  1UGM A;  3QAR A;  3RZW C;  2QIL A;  4M01 A;  4EUT A;  2D3G A;  2FNJ B;  4XZ4 A;  2Z59 B;  3ZDT A;  1PGX A;  1V6E A;  3ECI A;  2PE9 A;  2WDT B;  1P9D U;  1QT9 A;  2PE6 B;  4ZDV A;  4A9A A;  1XLQ A;  1TYG B;  1E10 A;  5JHA A;  1DOI A;  4IWP A;  2NVU I;  1VLB A;  2J52 A;  3DBL B;  3KUD B;  4A55 A;  4IUM B;  1SSN A;  4ICV A;  2KYW A;  3HIZ A;  3ZXR A;  1WY8 A;  2UWQ A;  1TBE A;  2WWZ A;  4FHK A;  1NYQ A;  2WGS A;  2M0X A;  1TY2 A;  2J4X A;  1EWY C;  2I1K A;  2VH1 A;  3ZNZ B;  4TKN A;  3DOW A;  1N5W A;  3BYT B;  3DBH I;  1R4N I;  4LJO B;  4NAW A;  2NS5 A;  3OJ4 B;  4IWO A;  4WAF A;  2MBO A;  1N61 A;  4YL8 A;  3KLS X;  3LYY A;  1WX9 A;  1WXQ A;  2OHF A;  2VZK B;  3VHT C;  2RPV A;  1XEE A;  1T0S C;  2N9P C;  5HFY A;  3CMM B;  3IAM 1;  3N3K B;  2KLC A;  3BII D;  2WXR A;  5HI1 A;  2KKC A;  3N1X C;  1TIF A;  1TS3 A;  3TEY A;  3NZU A;  4E74 A;  4KVG B;  3HM3 A;  4JWS C;  4EEW A;  1QZE A;  2G4D B;  2KWC A;  1C77 A;  2AYO B;  4W9K A;  1YQB A;  1CMX B;  4OVV A;  1I4R A;  4KGR A;  1ACC A;  1WH3 A;  2GBK A;  1PQS A;  4LNO A;  4G3X B;  3ZJU A;  4XWW A;  1F2R I;  3I3T B;  1JWU D;  2RGF A;  2DZM A;  3FIL B;  3ZDM C;  1E8Z A;  1NYR A;  4RM9 A;  4GDK A;  3RNB C;  4MSM B;  2NTS A;  2MBE A;  2KMA A;  2GBN A;  3GZN B;  3W1Y A;  1OEY A;  2VZK D;  2L83 A;  1GB4 A;  4OW0 A;  3RZF A;  4ZHP A;  3MC8 A;  3NVW A;  1L4D B;  2AQ1 B;  1L0V B;  3RNE C;  3KH0 A;  2KDM A;  4LDT B;  3AUL A;  1FEH A;  2O6V B;  1WF9 A;  5JXV A;  1WSP A;  3PZ8 A;  1OQY A;  3O65 B;  1V5T A;  4IWQ A;  4L2Y A;  2NTT A;  3QK0 A;  4KDI C;  1OTR B;  3H6N A;  3AE1 B;  4RGO S;  2L05 A;  3P2B A;  2N1W A;  5H92 C;  3CST A;  3KUC B;  2JRI B;  2WXM A;  1KLG D;  1PDX A;  1J0G A;  3E9S A;  2IY1 B;  3W5V B;  5G5G A;  1JWB D;  2J0K A;  4OHJ A;  2QMT A;  2UU7 A;  5AUK A;  1EWC A;  3U2S C;  4E71 A;  2CU3 A;  1Z5S B;  1KOT A;  2FCS A;  3DVG X;  4IM2 A;  2KN5 A;  4ANW A;  4LDT D;  2BWE S;  4BKS A;  3WAM A;  2GBJ A;  2PW9 A;  1E8X A;  2O6V D;  2K8H A;  3WAO A;  2JWU A;  4YSY B;  2K5P A;  1L2N A;  5IO9 A;  3OAW A;  1T5X D;  2GBM A;  3VRA B;  3Q8F A;  1I4H A;  4WQM A;  1JQ4 A;  2MP2 A;  4MJS A;  3L16 A;  3AEB B;  4ZRP A;  1WXV A;  2K1F A;  1WRD B;  1YQ3 B;  3VR9 B;  1Z2M A;  1T3Q A;  2LVO A;  2PVG C;  1TS4 A;  4KGS A;  2OJW A;  5CTR C;  1QOG A;  4N6E B;  2BTE A;  4BKT A;  1FM0 D;  1OGW A;  2MJE A;  3PRZ A;  5GMV A;  4MGY E;  3U7Z A;  4XC2 A;  1QOF A;  3PHX B;  2GBR A;  1WFY A;  3NOB A;  1UGJ A;  2B76 B;  2RDB C;  1TJE A;  4WIP A;  2MJ3 A;  4MGI E;  2DAF A;  3VVW B;  2PLP A;  2ZPY A;  4EE2 A;  3U7D A;  1LO5 D;  1UWX A;  1LXD A;  2FBW B;  3K9O B;  2QEJ C;  4DK5 A;  1Y56 A;  4W9H A;  2WU5 B;  2IYD B;  2BYT A;  3B1L X;  4WJN A;  4K7U A;  1BML C;  4GU2 A;  1BUI C;  3KVF B;  2I2Y A;  2C7N B;  4WQO B;  3ZLZ A;  3DVN V;  2FUH B;  2JQR B;  1WE7 A;  4C56 C;  2A4Z A;  2IND C;  3ML9 A;  3QC8 B;  1WWT A;  3QAQ A;  2GOW A;  3IT4 B;  3VUX A;  1IGD A;  3AED B;  3BWU D;  2NBW B;  1UD7 A;  1WRI A;  1T6B X;  1F0Z A;  2J7Q B;  1SJE D;  2IY0 B;  3NVZ A;  2V4I B;  2KXJ A;  3PLV A;  4C80 A;  4C7Z A;  4MDK E;  2W3S A;  2RDG A;  3ZNI D;  3BVZ A;  3MTN B;  2WXO A;  3AEE B;  1GC7 A;  2N9E B;  1SE2 A;  4N59 A;  4PS8 A;  3DBL I;  3PSE B;  3AE8 B;  3SU8 X;  2Q5W D;  4BVU C;  2Y3A A;  5DPW A;  2X8X X;  2L0T A;  1UH6 A;  3M63 B;  1V81 A;  1JRU A;  1TKG A;  2CJN A;  4TUU A;  4EKU A;  2BPS A;  2MX2 A;  2KAC A;  2O6V A;  2H88 B;  3I5J C;  1RAX A;  3FC4 A;  2KJH B;  3R2I A;  4A20 A;  4ZYS A;  2NCN A;  5JH5 C;  1WZ3 A;  1E8Y A;  3LXF A;  4M00 A;  3A1Q B;  3RT3 B;  2KDI A;  4C4V B;  1RLF A;  3IHP C;  1R4M I;  4BOZ B;  3W9C B;  2HD5 B;  3Q14 C;  4DHZ E;  3TSS A;  4RGM A;  4NQK E;  2I1J A;  1L4Z B;  4X57 B;  2OOB B;  3OJ3 A;  4GN1 A;  4CO7 A;  3VH4 B;  2OJR A;  2KTR B;  3KWL A;  2KDB A;  2WX1 A;  5L83 A;  2V1Y A;  4HEA 1;  1WGK A;  2BYV E;  2DNF A;  2ONQ A;  1I7H A;  1C79 A;  2H89 B;  1KH0 A;  4ACF A;  5HG2 A;  2PKO A;  1D6E C;  2IO0 B;  3ZYY X;  2BF8 B;  3GZN I;  3MP9 A;  4KSK C;  3WCQ A;  3DVN U;  3ABV B;  1UF0 A;  4ZHO A;  4KZ0 A;  4TQ0 A;  1ZUD 2;  2RSU A;  1L6V A;  2Y5B B;  2D07 B;  4RCO A;  2N9X A;  2XBB C;  2KDF B;  4ANX A;  1K53 A;  2LUE A;  3TMP B;  3HHM A;  2NMQ A;  3VTW A;  4HRO A;  1WR1 A;  1XLP A;  1SE3 A;  2LGY A;  1HE8 A;  4H2A A;  1VZ7 A;  1L7Y A;  1YJI A;  2LRU A;  2BW2 A;  2TSS A;  2Y5P A;  5BMG A;  3ZVV A;  4DXF A;  5EE1 A;  3AH7 A;  2N1V A;  4YTP B;  2J53 A;  2KZR A;  4PT5 A;  3P4S B;  1CJE A;  3R8B A;  4K81 A;  3V61 A;  1N60 A;  3RPF C;  2WXG A;  1E7V A;  3ML8 A;  2C9W B;  4AQ7 A;  3AE3 B;  4WWM A;  4WJP A;  2AL3 A;  1P1A A;  3PGE A;  1V1O A;  1IBX B;  1UBI A;  1QKZ A;  5IAA C;  1ZDX A;  2FIF A;  3ZRC A;  1ZOY B;  2KWU B;  2G3Q B;  1NBF C;  4KV2 A;  1KJT A;  1EU4 A;  2MQJ A;  5BYR A;  1TTN A;  2QHO A;  4FJZ A;  5D2M B;  1GG3 A;  2VH2 A;  1STE A;  4YTN B;  1VDV A;  4RF0 A;  1RFA A;  1C1Y B;  5CHF A;  1I4Q A;  3AE4 B;  2DZJ A;  1VD2 A;  1LQB A;  4TQ1 A;  2HDE A;  2G1E A;  2AWT A;  3ZRF A;  3D32 A;  2CHZ A;  2HTH A;  3IVF A;  3V60 A;  4W9I A;  1VZ8 A;  3BIN A;  4MAC A;  4MM3 B;  1MFW A;  1WXS A;  1XD3 B;  2WXF A;  3Q8E A;  4BBN F;  1ZE3 D;  4JX1 C;  2KX0 A;  2N7D A;  1P7E A;  4EZJ A;  4YXD B;  1TT5 B;  3SD5 A;  3A9K B;  2BYF A;  1LGR A;  2BB5 A;  2KTF A;  1E7U A;  2XK5 B;  2LZ6 A;  2CR5 A;  2KOX A;  1D5X C;  3B08 A;  1FCC C;  4MGK E;  2PTL A;  3A1Q A;  4I6N B;  4XYC A;  4LK0 M;  4C4V A;  5GXG B;  3HVD A;  3TUO A;  3FKY A;  2R2Q A;  1KLV A;  4PS7 A;  2LGS A;  2KT7 A;  3RNF C;  2IDY A;  2LXC A;  2L76 A;  3NG0 A;  2JSV X;  3C19 A;  2IJ0 A;  1UUP A;  1SGH A;  3EEC A;  1TZO A;  3E56 A;  4M0W B;  3EHV A;  2WXL A;  2EEL A;  4HRS A;  2KHW B;  2WXQ A;  1P0R A;  2KTR A;  3UIO B;  1F77 A;  2IGG A;  4FLH A;  5LXI B;  1MG8 A;  4II3 B;  2G45 B;  4MH0 E;  4XDC A;  3HVZ A;  3JSV B;  2RDH A;  2JZ3 B;  1VJK A;  4ZYN A;  4FN2 A;  2FE8 A;  2REX A;  1UNS A;  2BBC A;  3DVG Y;  4M8N A;  1WJN A;  3I9V 1;  2INP E;  2MJD A;  4II2 B;  1R4M B;  3Q3F A;  2FCQ A;  1KM7 A;  1N6Z A;  1KFY B;  2NPT B;  1AN8 A;  4XX5 A;  4LLG M;  1GOZ A;  4BZA A;  4R3D A;  3JW0 X;  3Q3M C;  1GUA B;  3PLU A;  3UIP B;  4A8X C;  3AE9 B;  1TY0 A;  3APC A;  3U4E G;  5FR6 A;  2XEW A;  2L32 A;  2IBI B;  4BAX A;  4M02 A;  4EZL A;  4HJG E;  3N9Y C;  4B6W A;  1E8W A;  5DCN A;  2UYZ B;  3AB5 A;  3M95 A;  2O2V B;  2K6Q A;  3NJT A;  4P1C C;  2AQ3 B;  2HTM E;  2N9L A;  3L4P A;  1P7F A;  3EFU A;  1E90 A;  3L13 A;  1PYW D;  2L52 A;  4OZA A;  3TBL D;  1HZ5 A;  2IO3 B;  1IBX A;  1ENF A;  3AXC A;  3Q3J A;  2L0F A;  1HEZ E;  3DHG C;  3L17 A;  4FBJ B;  2PMV A;  3W2D A;  4FUL A;  4P7I A;  1V80 A;  1WGY A;  3DCG A;  1QF6 A;  1WX7 A;  1H8C A;  2MBQ A;  1SJH D;  4GDL A;  1HTO A;  1IUE A;  4MEL A;  2LGD A;  4AP4 C;  5G55 A;  3N32 A;  1OQR A;  1QIL A;  3UI3 A;  2LD9 A;  1AAR A;  1TZ1 A;  2DLB A;  2DYM A;  3TEZ A;  2M1M A;  3BK1 A;  4ITK A;  2KMM A;  1BT0 A;  2BS2 B;  3V3X A;  5IP4 D;  3TEW A;  1ZPS A;  4FJV B;  4W9D A;  4RFB A;  4S0R A;  4TV3 A;  2ZCB A;  1L0Y B;  1YJJ A;  1N5X A;  1GNU A;  5DPS A;  1WXA A;  2PPH A;  5BYS A;  4CHK A;  3A9K A;  1FXA A;  4C7Y A;  2C7H A;  2WXJ A;  2IGH A;  2KNB A;  3Q8B A;  2QCZ A;  2XK5 A;  3JVZ X;  3P4R B;  2D3A A;  3R3M A;  1V5O A;  5CHW A;  5CX3 A;  4AUQ C;  1L6U A;  1KRH A;  4FJY A;  1B1Z A;  3I63 C;  1UBQ A;  2D2Q A;  2GRI A;  2EKI A;  2KQ4 X;  4CQN A;  3VAW A;  2AEH A;  4HJK A;  2WU2 B;  2JYT A;  5AZF A;  4IM0 A;  5H8Y E;  2EMS A;  2ZEQ A;  4FXC A;  1PFD A;  3BYY B;  4WJO A;  4B0M A;  3A9J B;  2ZVN A;  3MFG A;  3QA8 A;  3NS1 A;  4GOC A;  2KDE B;  4M0W A;  2BGF A;  2MA9 B;  4NQL B;  2MCN B;  1C3T A;  4MSQ B;  4QAY A;  4GXB A;  5KHO A;  2WXN A;  4RH6 A;  3VRB B;  3ZKJ C;  3ZW3 A;  3H7S A;  4ZRK A;  1V8C A;  3ZO5 B;  2OED A;  1A70 A;  4GSW A;  5DPR A;  2MBB B;  3JSV A;  1EUV B;  1EF5 A;  2KJ6 A;  5CHV C;  3ONS A;  1E5W A;  3NZS A;  2AX5 A;  1S3S G;  2V0G A;  5J17 A;  3UF8 A;  4LNF A;  1YNT E;  2YVC A;  2NPT A;  3WAL A;  3QQ8 B;  1JAL A;  3W5U B;  4AS1 A;  4WAA A;  2KFK B;  2LFI A;  3VFK A;  4OZC A;  4F7Z A;  2JVC A;  1A5R A;  2KVZ A;  2R2O A;  2LXA A;  3M62 B;  4NY0 A;  1HXY D;  3K9P B;  1J7C A;  1WI0 A;  2K6D B;  1P98 A;  2LRW A;  3KYD D;  4B9K A;  2V3N A;  1FXI A;  3SFD B;  3W1S C;  3ETR A;  3DWG C;  1I4G A;  1I4P A;  3RYT A;  2O2V A;  1FXT B;  4AJY B;  1JCK B;  5C23 A;  3FIL A;  1SIF A;  3WIM A;  2QJL A;  2DWQ A;  4IW0 A;  4JPS A;  5EE9 A;  2LI5 A;  1YD8 U;  2N0S B;  2JRH A;  3PTF C;  2LWP A;  5EDS A;  1RYJ A;  1LFD A;  4B0E A;  1M4V A;  5FKA C;  3QWZ B;  2N7E A;  5IN7 A;  4N9F 4;  1E0Z A;  3VTU A;  1J7A A;  2LVQ A;  1FMA D;  2ZVO A;  4G11 A;  3IBE A;  3P1M A;  3AN1 A;  4KX6 B;  3M3J A;  4JGH B;  3BVM A;  1NI3 A;  2BYE A;  2W3R A;  3P4P B;  3R7R A;  4NJ6 A;  3U8Z A;  2KFJ A;  3P42 A;  3QCA A;  3RNG C;  2ASQ A;  1TGZ B;  5FK9 C;  1YMH E;  4IOI E;  1WYW B;  4W9J A;  1DOY A;  2ZNV B;  2NR2 A;  2QSD A;  3HM6 X;  4JQW C;  4HVB A;  1SE9 A;  3R2T A;  1Q0W B;  4JLC A;  3GE8 C;  5TSS A;  2KO3 A;  1U4A A;  1HZ6 A;  4IDI A;  5C1Z A;  2IGD A;  2HE7 A;  2WDQ B;  3TL5 A;  4LNI A;  5KHQ A;  1KTK A;  1UEL A;  3A33 B;  3BZD B;  3LDZ E;  4LJP B;  3HK0 A;  3C8Y A;  1IGC A;  1ZW7 A;  4M8M A;  4Q2J A;  1TS5 A;  2L00 B;  4JWU C;  3RCZ A;  2QIE B;  4EFO A;  3RNC C;  2KN4 A;  3B2F A;  3H9D A;  4YT0 B;  4RGN A;  2YEP B;  1IYF A;  3MC0 B;  2VRR B;  2JPH A;  2M4N A;  1MI0 A;  1I35 A;  2RR9 A;  3A9J A;  1XO3 A;  3MC9 A;  4GB9 A;  3AI5 A;  1C9F A;  2WX0 A;  5EE0 A;  3AEA B;  4RM8 A;  2KMC A;  2QDF A;  4J6I A;  2W55 A;  1S1Q B;  3NZ3 A;  2L3Z A;  1V9J A;  2LGI A;  2MWS B;  1J19 A;  4HK2 A;  4NZL B;  2MBH A;  4PK1 A;  1WX8 A;  1WMH B;  1V1P B;  1WM3 A;  2BB6 A;  3QHT A;  1D5Z C;  4O1N A;  4MEM A;  3N1Z C;  1RM6 C;  2WDR B;  4F8C B;  4KGT A;  3IG3 A;  4D2K A;  2EKE C;  2LVP A;  2ZNV C;  3KW5 B;  3VXW A;  1QOA A;  2KAJ A;  2KWD A;  2KK8 A;  2KFK A;  1SE4 A;  4GDK B;  3VR8 B;  5J18 A;  2PIA A;  3JYU A;  4FA6 A;  2I38 A;  1NDD A;  4ARC A;  2Z8L A;  2ZW1 A;  2GMI C;  1K8R B;  5BYQ A;  1WJ4 A;  4OZB A;  1E9M A;  3V6E B;  4YSZ B;  4ZRI A;  4HDQ A;  2JXX A;  5TR5 A;  3ZJT A;  4OVZ A;  1DYQ A;  2DYB A;  1D4B A;  3NHE B;  1JWM D;  1M94 A;  1V49 A;  1I4X A;  3AE2 B;  1WZ0 A;  2E3T A;  2RD0 A;  2WNM A;  1WGD A;  2WLB A;  1EF1 A;  2CJO A;  1VR9 A;  3GE3 C;  2WXP A;  1K51 A;  2FAZ A;  1P3Q U;  4EZK A;  4FHJ A;  1D3Z A;  1HTQ A;  3AEC B;  1SF0 A;  4P16 A;  1H4R A;  3IXS A;  1YX5 B;  3L54 A;  5D6J B;  1V86 A;  3IAS 1;  2SAK A;  1SXT A;  4RNA A;  1C4A A;  1K52 A;  4HXD A;  2V9H A;  2JZZ A;  3LJ3 A;  1TKE A;  4K1R B;  3AMZ A;  3NRZ A;  3GB1 A;  1N62 A;  2BS3 B;  4L23 A;  1NEK B;  2KAN A;  3A4S C;  4WUR A;  1FO4 A;  3U30 A;  2CHX A;  2MP2 B;  2K3U A;  1G6J A;  2HJ8 A;  2CHW A;  2N9K A;  2R61 A;  4USA A;  1WGH A;  2CS4 A;  1QOB A;  3RUI B;  2D3B A;  1V97 A;  5FR3 A;  4ZOH C;  3PRE A;  3ZXV A;  1XXG A;  1ZXI A;  3H8H A;  1J7B A;  3X23 A;  2J0J A;  3NVY A;  1OEY J;  4NNJ B;  3ZTD A;  2IO2 B;  4UDU C;  1UZX B;  1C78 A;  1GAQ B;  2RPQ A;  1F1H A;  4BKS D;  2KJR A;  3L0W B;  2BQQ A;  3AE7 B;  5E6O A;  1VRA B;  4W9C A;  1CK1 A;  4KIK B;  4F1S A;  1D5M C;  3ZIM A;  1AYF A;  1GB1 A;  2NBV B;  3V62 A;  2MRP A;  2GLS A;  1LM8 B;  1NEN B;  2YEP F;  4IG7 B;  2J0M A;  2BWF A;  5IA7 A;  1F9J A;  2KQS A;  3GS2 A;  4GLS C;  2WQY B;  4XDD A;  1GJZ A;  1YOV B;  3PV1 A;  3URY A;  3N30 A;  3T8M A;  3NS8 A;  3C0R B;  3QX1 A;  1ISN A;  1T0Q C;  4XWT A;  2JX5 A;  5LLI A;  2GI9 A;  4NPN A;  2G9H D;  2WDV B;  3EC8 A;  4BKG A;  1WMH A;  4DQO C;  1V1P A;  4AOF A;  5T8I A;  3ZNH B;  4A90 A;  2DHZ A;  5I4D A;  2MW5 A;  1MVK A;  2JT4 B;  2G4S A;  4RMA A;  1TS2 A;  2LHD A;  1YN5 A;  3EUB 2;  3B2G A;  5JHB A;  3N1Y C;  3RNA C;  3BVG A;  1WJU A;  2INC C;  2LJI A;  2W54 A;  2IPK D;  3P4Q B;  2LMC A;  2FCM A;  3AEG B;  1ROE A;  3Q3N C;  2DZK A;  3WAN A;  3AEF B;  2BVC A;  1NI2 A;  3P63 A;  4PYU A;  5AEK B;  2ZPN A;  1N63 A;  1MPE A;  4W9L A;  3MJ5 A;  4JL9 A;  3V05 A;  5JZE B;  1Q1O A;  2MEK A;  2IZV B;  3EA6 A;  4W9E A;  2DYO A;  4I6P A;  3PRM B;  1PGA A;  5MPO A;  2K8B A;  4OVU A;  1IPG A;  2M0A A;  3DBS A;  1WYG A;  3OLM D;  4K3B A;  1WGG A;  5D3I B;  4MH8 A;  3KWV A;  3CWI A;  4AJW A;  2FUG 1;  4WWN A;  4HLE A;  1L0X B;  3H7P B;  4DXA B;  4GMV A;  1C4P A;  4MM3 A;  2QC8 A;  4S17 A;  2J42 A;  4DHJ B;  3DBR B;  3HRD D;  3A4R A;  3N20 C;  1MG4 A;  5D3D A;  2JF5 A;  3PPA A;  2K25 A;  4I6L B;  2MHJ A;  3WAP A;  2WHI A;  1PUT A;  1V2Y A;  3AE6 B;  3ZQ4 A;  3AU4 A;  3S2A A;  3UIN B;  1WXM A;  1ZDV A;  1ZP0 B;  4EOY A;  4ARI A;  3WA0 A;  4YTM B;  4A6Q A;  1CQV A;  3UQB A;  1ET6 A;  4XE0 A;  1F52 A;  1X1M A;  3OG5 A;  4NJ7 A;  1FRR A;  3KQ4 A;  3KYC D;  2ACZ B;  4HKZ E;  4K7S A;  3Q69 A;  2BKR B;  4DHJ D;  4DXG A;  3RD2 A;  4KDL B; 
#chains in the Genus database with same CATH homology
 4NJ6 A;  4FJZ A;  5D2M B;  2DZI A;  2KLC A;  3U8Z A;  2KFJ A;  1GG3 A;  3QCA A;  4DHZ B;  2KKC A;  2ASQ A;  1RFA A;  1TGZ B;  1C1Y B;  3NZU A;  5CHF A;  3TIX A;  1WYW B;  3UGB B;  4W9J A;  4KVG B;  3SHQ A;  2ZNV B;  2NR2 A;  3HM3 A;  3HM6 X;  4JQW C;  4E74 A;  4EEW A;  4HVB A;  1SE9 A;  3PZD A;  1QZE A;  1Q0W B;  4JLC A;  2DZJ A;  1VD2 A;  2PEA A;  1LQB A;  4W9F A;  4TQ1 A;  4WWP A;  2FCN A;  2G4D B;  2AWT A;  2KWC A;  3L10 B;  3ZRF A;  2AYO B;  3D32 A;  2KO3 A;  4W9K A;  1U4A A;  2CHZ A;  2CU1 A;  1YQB A;  1CMX B;  4G0N B;  2HTH A;  4OVV A;  5C1Z A;  1T0Y A;  3IVF A;  2LAS A;  3V60 A;  4W9I A;  1GC6 A;  1WH3 A;  2HE7 A;  3TL5 A;  2GBK A;  1PQS A;  3BIN A;  4G3X B;  4CYE A;  3AU5 A;  1XD3 B;  1WXS A;  4BBN F;  3BY4 B;  2JY6 A;  3I3T B;  5LXH A;  5KHQ A;  1UEL A;  4PYZ A;  2NBU A;  2RGF A;  2DZM A;  2KX0 A;  3PHW B;  1E8Z A;  3ZDM C;  2N7D A;  4EZJ A;  4RM9 A;  4GDK A;  3IFW B;  3A33 B;  4KIK A;  3LDZ E;  4MSM B;  3SD5 A;  3A9K B;  2MBE A;  2KMA A;  4LJP B;  2GBN A;  2BYF A;  2L7R A;  3HK0 A;  2KTF A;  3W1Y A;  1E7U A;  4JIO U;  2KQ7 A;  1OEY A;  1ZKH A;  1ZW7 A;  2LZ6 A;  2CR5 A;  2KOX A;  2XK5 B;  3B08 A;  4M8M A;  2L00 B;  4K7W A;  5J2R A;  3RCZ A;  4EFO A;  4MGK E;  3H9D A;  3RZF A;  1Y8R C;  1RRB A;  2Z0E B;  3A1Q A;  1IYF A;  2DEN B;  2VRR B;  2JPH A;  2M4N A;  3DQV A;  4I6N B;  3KH0 A;  4LDT B;  3AUL A;  5D94 A;  1I35 A;  2RR9 A;  3A9J A;  3RUL A;  1IP9 A;  2O6V B;  2R2Q A;  1KLV A;  1WF9 A;  4PS7 A;  2L8J A;  1OQY A;  3APD A;  4GB9 A;  4HPL B;  3AI5 A;  2PJH A;  2LXC A;  2WX0 A;  4W9G A;  2L76 A;  3O65 B;  1V5T A;  4RM8 A;  3X0W A;  2KMC A;  2V4L A;  4IWQ A;  4J6I A;  3CSF A;  1S1Q B;  5G2N A;  2L3Z A;  2ZJD A;  1V9J A;  1SGH A;  3QK0 A;  2MWS B;  3EEC A;  3H1U A;  4KDI C;  4M0W B;  3EHV A;  1J19 A;  4HK2 A;  5D7G A;  1OTR B;  1VCB A;  2MBH A;  3H6N A;  4ANU A;  2KHW B;  1WX8 A;  2L05 A;  3P2B A;  1P0R A;  2N1W A;  2KTR A;  3CST A;  3PVL A;  3KUC B;  2JRI B;  2B3A A;  3UIO B;  1WMH B;  1J0G A;  2W9N A;  3QHT A;  1WM3 A;  2IY1 B;  3R66 C;  4LCD E;  5LXI B;  4FLH A;  4HDO A;  1MG8 A;  2J0K A;  4II3 B;  4MEM A;  2G45 B;  4MH0 E;  3JSV B;  4F8C B;  2JZ3 B;  1Q5W B;  3IG3 A;  4E71 A;  4ZYN A;  2EKE C;  1Z5S B;  4FN2 A;  2REX A;  1KOT A;  2FCS A;  2LVP A;  3DVG X;  2ZNV C;  4ANV A;  4IM2 A;  2KN5 A;  4ANW A;  3KW5 B;  4LDT D;  2BWE S;  3DVG Y;  3WAM A;  4BKS A;  3VXW A;  4M8N A;  1WJN A;  2GBJ A;  3GOE A;  1WGR A;  1E8X A;  2O6V D;  1WR6 E;  2K8H A;  3WAO A;  1L2N A;  2KD0 A;  3ZTC A;  4II2 B;  3MJW A;  3OAW A;  2KK8 A;  2KFK A;  4GDK B;  2GBM A;  4DBG A;  3Q3F A;  3DDC B;  2FCQ A;  2LGX A;  5J18 A;  2MP2 A;  4MJS A;  1WE6 A;  3L16 A;  3JYU A;  1KM7 A;  4FA6 A;  2NPT B;  1NDD A;  4HWI B;  4XX5 A;  1YJ1 A;  2M8S A;  3CF6 E;  1WXV A;  3JW0 X;  2GMI C;  2K1F A;  1GUA B;  1K8R B;  1WJ4 A;  3PLU A;  3UIP B;  4WJQ A;  3APC A;  4KSL C;  1WRD B;  2A5U A;  4MGZ E;  3V6E B;  1Z2M A;  4ZRI A;  2JUO A;  5FR6 A;  2XEW A;  2C7M B;  2LVO A;  4HDQ A;  2DX5 B;  2BKF A;  2IBI B;  3TCA A;  2CKH B;  2KX3 A;  5CTR C;  4KZC A;  3H7P A;  2JXX A;  5TR5 A;  5BO4 B;  4DHJ D;  4EZL A;  2DYB A;  3VH3 B;  4B6W A;  4BKT A;  1J8C A;  4A3P A;  1E8W A;  5DCN A;  1OGW A;  3NHE B;  3VQI A;  3VUW A;  3PRZ A;  5GMV A;  2UYZ B;  1I42 A;  1M94 A;  1V49 A;  2K8C A;  3M95 A;  4MGY E;  3ENE A;  2KLG A;  4XC2 A;  4BOS C;  2IO1 B;  2K39 A;  1WZ0 A;  2K6Q A;  2O2V B;  3PHX B;  3UQA A;  2RD0 A;  2GBR A;  1WGD A;  1EF1 A;  1WFY A;  3NOB A;  3B0A A;  3QJZ A;  3EFU A;  1E90 A;  2MLB A;  3L13 A;  2FAZ A;  3TBL D;  2IO3 B;  4MGI E;  2DAF A;  3VVW B;  1P3Q U;  3W1S A;  4EZK A;  2ZPY A;  3AXC A;  3U7D A;  2Z0D B;  4FHJ A;  1D3Z A;  3Q3J A;  1LXD A;  2L0F A;  2DAJ A;  3ZNG C;  3K9O B;  4DK5 A;  2KVR A;  4W9H A;  3L17 A;  2IYD B;  4FBJ B;  1H4R A;  3ALB A;  3T9L A;  3B1L X;  1YX5 B;  4FUL A;  4P7I A;  3L54 A;  1V80 A;  5D6J B;  1V86 A;  4WJN A;  4K7U A;  4GU2 A;  1WGY A;  5L95 C;  3DCG A;  4HXD A;  3KVF B;  2JZZ A;  3LJ3 A;  4NAW B;  1WX7 A;  2KC1 A;  2YLM A;  1WM2 A;  4K1R B;  2C7N B;  4WQO B;  1H8C A;  2MBQ A;  3PT2 B;  2KAN A;  3A4S C;  4GDL A;  4DDG D;  3PRP B;  3DVN V;  3ZLZ A;  3U30 A;  2CHX A;  4MEL A;  2MP2 B;  2LGD A;  4AP4 C;  5G55 A;  2HJ8 A;  1G6J A;  2FUH B;  1EO6 A;  3N32 A;  2CHW A;  1WE7 A;  2KWV B;  4BBN C;  2A4Z A;  1WGH A;  2M17 A;  4ASW C;  2LD9 A;  2CS4 A;  3VTV A;  1AAR A;  1TZ1 A;  3RUI B;  2DYM A;  3ML9 A;  2M1M A;  3QC8 B;  4HPM B;  3V6C B;  3QAQ A;  2GOW A;  3VDZ A;  1BT0 A;  2C60 A;  3PRE A;  4FJV B;  3MHS D;  3VUX A;  4ZRJ A;  4W9D A;  2NBW B;  1UD7 A;  4TV3 A;  2ZCB A;  2J7Q B;  4DDI D;  2IY0 B;  3KUZ A;  3X23 A;  2J0J A;  1GNU A;  1OEY J;  2MSE D;  2KXJ A;  3PS6 A;  4NNJ B;  3PLV A;  5DPS A;  1WIA A;  4BFR A;  1WXA A;  4MDK E;  3ZTD A;  4B95 A;  4FAD A;  3NY5 A;  3APF A;  3ZNI D;  1WJ6 A;  1YX6 B;  2PPH A;  2IO2 B;  4A3O A;  3R7R A;  1UZX B;  3MTN B;  3DBR I;  2RPQ A;  4CHK A;  3A9K A;  1ZGU B;  1GC7 A;  2N9E B;  2C7H A;  5E6N A;  4BKS D;  2KC2 A;  3DBL I;  2LJ5 A;  4PS8 A;  2KNB A;  2KJR A;  3L0W B;  2XK5 A;  3JVZ X;  3PSE B;  5E6O A;  3SU8 X;  3R3M A;  1V5O A;  4BVU C;  2ZZP B;  4G50 A;  4W9C A;  5CHW A;  5CX3 A;  5DPT A;  4AUQ C;  4KIK B;  3ZUN A;  4F1S A;  3ZIM A;  5DPW A;  4GIV A;  3QIJ A;  2NBV B;  2L0T A;  3V62 A;  1UH6 A;  2MRP A;  3M63 B;  4FJY A;  1LM8 B;  1V81 A;  1JRU A;  2D10 A;  2AL6 A;  4TUU A;  4IG7 B;  4EKU A;  1UBQ A;  2BPS A;  2D2Q A;  2J0M A;  2BWF A;  2MX2 A;  2O6V A;  4WWO A;  3VAW A;  1RAX A;  2C5L C;  2KJH B;  4A20 A;  2AEH A;  2NCN A;  5JH5 C;  4HJK A;  5IA7 A;  1WZ3 A;  1E8Y A;  1F9J A;  2KQS A;  5E6P A;  5AZF A;  3RT3 B;  3A1Q B;  4IM0 A;  4AWJ A;  2KDI A;  2EMS A;  1RLF A;  2ZEQ A;  2V3S A;  1GJZ A;  3IHP C;  4WJO A;  1R4M I;  3A9J B;  3PV1 A;  2ZVN A;  3R7Q A;  4BOZ B;  3QA8 A;  2HD5 B;  3N30 A;  4HCP B;  4URK A;  3T8M A;  4GGQ A;  4GOC A;  3NS8 A;  2KDE B;  3C0R B;  2BGF A;  2MA9 B;  3QX1 A;  1ISN A;  4IC7 B;  4NQL B;  4DHZ E;  2MCN B;  1C3T A;  2ZCC A;  4MSQ B;  5LLI A;  4NPN A;  4GDL B;  4GXB A;  5KHO A;  4NQK E;  3ZKJ C;  3ZW3 A;  2I1J A;  3EC8 A;  4BKG A;  1WMH A;  3H7S A;  4ZRK A;  5HKH A;  4X57 B;  4AOF A;  2OOB B;  3OJ3 A;  3ZO5 B;  4GN1 A;  3ZNH B;  4CO7 A;  2DHZ A;  4IM3 A;  2EMT A;  3SDL C;  3VH4 B;  4GSW A;  5DPR A;  2MW5 A;  2MBB B;  3JSV A;  2JT4 B;  2G4S A;  2OJR A;  1EUV B;  4RMA A;  2KTR B;  2D11 A;  2KDB A;  5JHB A;  2WX1 A;  4PS3 A;  1EF5 A;  5L83 A;  5AZH A;  3L08 A;  2V1Y A;  2KJ6 A;  5CHV C;  2BYV E;  3TJP A;  3ONS A;  4KDL B;  4DWF A;  1WJU A;  1E5W A;  1XQQ A;  5AZG A;  3NZS A;  1S3S G;  2FCM A;  2FID A;  2JWZ A;  5J17 A;  3DPD A;  2DZK A;  3UF8 A;  3WAN A;  3VUY A;  1NI2 A;  2YVC A;  2N4F A;  4PYU A;  2IO0 B;  2NPT A;  4HCN B;  2WYQ A;  3WAL A;  5AEK B;  2BF8 B;  2ZPN A;  3QQ8 B;  3GZN I;  4KSK C;  3DVN U;  4E3C A;  4WAA A;  2KFK B;  1YIW A;  4W9L A;  4KZ0 A;  4TQ0 A;  4JL9 A;  2RSU A;  1XT9 B;  4ICU A;  3VFK A;  5JZE B;  1Q1O A;  2Y5B B;  2D07 B;  4F7Z A;  2JVC A;  4MJS B;  1A5R A;  2N9X A;  2XBB C;  2KDF B;  2R2O A;  2LUE A;  2IZV B;  2LXA A;  3M62 B;  4NY0 A;  4ANX A;  1UGM A;  3QAR A;  3RZW C;  4W9E A;  2DYO A;  3HHM A;  3K9P B;  3TMP B;  4I6P A;  3VTW A;  1WI0 A;  3PRM B;  2K6D B;  1WR1 A;  1P98 A;  2LRW A;  4EUT A;  3KYD D;  4B9K A;  2D3G A;  2FNJ B;  4XZ4 A;  2Z59 B;  2LGY A;  2K8B A;  1HE8 A;  4OVU A;  1IPG A;  3DBS A;  3OLM D;  3ZDT A;  1V6E A;  1WGG A;  1L7Y A;  2LRU A;  3ECI A;  2PE9 A;  2WDT B;  3ZVV A;  1P9D U;  4AJW A;  3W1S C;  4WWN A;  2PE6 B;  4HLE A;  4ZDV A;  3H7P B;  3RYT A;  4DXA B;  4GMV A;  2N1V A;  4MM3 A;  2O2V A;  1FXT B;  4AJY B;  4DHJ B;  5C23 A;  5JHA A;  2KZR A;  1SIF A;  4IWP A;  2NVU I;  3A4R A;  3WIM A;  2JF5 A;  3PPA A;  2K25 A;  4I6L B;  3KUD B;  4IW0 A;  4K81 A;  2LI5 A;  1YD8 U;  4IUM B;  3WAP A;  2JRH A;  3PTF C;  3V61 A;  2LWP A;  1V2Y A;  4ICV A;  3HIZ A;  3AU4 A;  5EDS A;  1WY8 A;  2UWQ A;  3S2A A;  1TBE A;  2WWZ A;  1LFD A;  3UIN B;  4FHK A;  1E7V A;  1WXM A;  3ML8 A;  2C9W B;  2M0X A;  4EOY A;  4WJP A;  2AL3 A;  1P1A A;  3QWZ B;  2I1K A;  3PGE A;  2N7E A;  3ZNZ B;  4TKN A;  3DOW A;  1UBI A;  4N9F 4;  3WA0 A;  3VTU A;  2LVQ A;  5IAA C;  2FIF A;  3ZRC A;  2ZVO A;  2KWU B;  4G11 A;  2G3Q B;  3UQB A;  1NBF C;  3IBE A;  1X1M A;  3DBH I;  4KV2 A;  1KJT A;  1R4N I;  4LJO B;  4NAW A;  2MQJ A;  2NS5 A;  3M3J A;  3OJ4 B;  4IWO A;  4NJ7 A;  4JGH B;  2MBO A;  1TTN A;  4YL8 A;  3KYC D;  1WX9 A;  2BYE A;  4K7S A;  2QHO A;  3VHT C;  2BKR B;  2N9P C;  3CMM B;  3RD2 A;  3N3K B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...