3VTWA

Crystal structure of t7-tagged optineurin lir-fused human lc3b_2-119
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
125
structure length
125
Chain Sequence
EFVEIGGPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Optineurin, microtubule-associated proteins 1A/1B light chai
publication title Structural basis for phosphorylation-triggered autophagic clearance of Salmonella
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 34
structure length 125
sequence length 125
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-06-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3vtwA00
1Y8RC 2EMSA 2FIFA 4ANUA 4DWFA 2KOXA 1GC6A 3AXCA 4F7ZA 1E8XA 1GJZA 2CHWA 3H7PA 2Y5BB 2FUHB 2BWES 4J6IA 2B3AA 2JVCA 3PPAA 4FJVB 5GMVA 4A3PA 1VD2A 4KSLC 1KM7A 1H8CA 2M4NA 1OQYA 1YX6B 2EKEC 3P2BA 3N30A 4EUTA 3LDZE 4HK2A 2NPTA 1WI0A 4JLCA 1V2YA 2KFJA 1MG8A 2JRHA 4II2B 2GBRA 1OEYJ 1ISNA 3DQVA 4M0WB 4DK5A 4EFOA 4GU2A 3U7DA 4B95A 4E74A 4HVBA 2REXA 3R66C 1L7YA 2JWZA 2ZJDA 3VTWA 4TUUA 1G6JA 2KO3A 3DBLI 2GOWA 3KVFB 3EC8A 4LJOB 1E7VA 2KC1A 4BKSD 3DDCB 4B9KA 3M62B 4FULA 1WGRA 3QIJA 4OVUA 2ZEQA 3GZNI 3R7RA 2DAJA 4GIVA 3R7QA 2KQ7A 1WE7A 2ZNVC 4EZJA 3A9KB 4PS8A 4IC7B 1P1AA 4MH0E 5C1ZA 2K8HA 4G0NB 3QX1A 4AUQC 3H9DA 2KMCA 3CSTA 1WX8A 4NAWA 4XX5A 1RRBA 4PS3A 3CMMB 3RULA 3QCAA 1WXMA 1UZXB 3L0WB 5J17A 5DPWA 4JGHB 3DOWA 1K8RB 2GMIC 2LRWA 2ZCBA 4II3B 4KIKA 2EMTA 2K1FA 4AWJA 3EECA 2KFKA 1YQBA 1TZ1A 5LLIA 1Q1OA 4IM0A 2DAFA 3IFWB 3RD2A 2KTRA 3RT3B 5JHAA 3NHEB 3IBEA 2CHXA 1QZEA 3VAWA 3PLUA 2MBBB 3KUZA 4ANVA 3UQBA 4IG7B 3VVWB 4LDTB 3A1QB 2JF5A 4W9EA 2KLGA 1E8ZA 4DHZB 3MHSD 5L95C 2FAZA 2L7RA 4W9LA 5CX3A 2K25A 3SD5A 2LGDA 5CHWA 3RZFA 3V62A 5G2NA 1WGHA 1V9JA 2ZCCA 3HM6X 1IP9A 3PV1A 2RD0A 3ENEA 4WJQA 3WAPA 4ANXA 4FLHA 4FBJB 2LVPA 3N3KB 2KK8A 4XC2A 2DZIA 1YX5B 2LUEA 1SIFA 2R2QA 2WDTB 3ZNID 4MDKE 4DBGA 1TGZB 2XK5A 3PRZA 3JSVA 3VUYA 2LZ6A 2WX0A 5E6OA 4G3XB 2O6VA 2JZ3B 4W9FA 2DZJA 4HDQA 1OGWA 2LVOA 4GDKA 3CSFA 4EZKA 1WE6A 2LWPA 4DHJB 2MLBA 4N9F4 3H6NA 2J0MA 2KD0A 4MGZE 1FXTB 5LXHA 1WJUA 3C0RB 2M8SA 5L83A 3V6CB 2ZVOA 1SE9A 2L05A 1YD8U 3NOBA 1GNUA 4FADA 2KMAA 2KDFB 3MTNB 2I1KA 3BINA 1WR6E 3ZIMA 3L08A 4FHJA 1GUAB 3KYDD 2BYFA 4WJPA 2BKFA 3X0WA 2ZNVB 4M8NA 3R3MA 2AWTA 3IHPC 2UYZB 1WRDB 2JZZA 5CHFA 4ASWC 1I42A 3APFA 1F9JA 2KJRA 3DBRI 4GDLA 3VH3B 2HD5B 4KZCA 2L0FA 3H7SA 4K7WA 3UIPB 2BGFA 2G3QB 1UGMA 3QA8A 2AYOB 3ZTDA 2LVQA 4NY0A 3DPDA 4BKSA 2IBIB 3U30A 2MA9B 3I3TB 3ZDMC 4BBNC 1WXSA 3DVGY 2LXAA 4HPMB 2Z0EB 4FJZA 2AL6A 4NPNA 5D7GA 1UD7A 2BYEA 3ML8A 2M17A 4EKUA 2ZVNA 3QJZA 3QK0A 4A20A 2LI5A 2N9PC 2XBBC 2L76A 4JQWC 1PQSA 1EF1A 3L16A 2FCNA 3PLVA 3T8MA 2G4DB 1XT9B 2MP2A 4HCNB 4BVUC 3DVGX 3ZTCA 3V61A 5JZEB 5JHBA 4KZ0A 3L13A 5DCNA 3TCAA 1WJNA 3HK0A 2BKRB 2LGYA 4MGYE 1WGDA 3L17A 3ZDTA 2GBMA 2AL3A 2LD9A 4DDID 2JRIB 2IO2B 3PRMB 3PZDA 4W9IA 4CHKA 3SDLC 3IVFA 4GMVA 3H7PB 5JH5C 2IO1B 1ZW7A 2KDEB 3PRPB 3QWZB 4HCPB 2KANA 4ZRJA 4MJSA 2O2VA 4GOCA 2CKHB 5J2RA 3X23A 3ZUNA 2KDBA 2L00B 1TTNA 3W1YA 2KWCA 2WWZA 1WMHA 2GBNA 2NPTB 5D2MB 5HKHA 2ZPYA 1J8CA 1U4AA 2C7MB 1V49A 3A4SC 5DPTA 2KHWB 2G45B 2DENB 4AOFA 3UF8A 1XD3B 5E6NA 2RPQA 4F8CB 2KVRA 3QC8B 3ONSA 5J18A 5IAAC 2V1YA 4HXDA 2CR5A 2NVUI 2Z59B 2MBQA 3AULA 4JL9A 1WZ3A 1S3SG 3APCA 3M63B 2XEWA 1IPGA 4CO7A 2IYDB 2LRUA 3ZNZB 3UQAA 4ZRKA 1EUVB 3CF6E 2MQJA 2GBKA 1E7UA 3KYCD 3TL5A 3VQIA 2N7EA 1V5TA 4IW0A 2NR2A 1WJ6A 4K7SA 3L10B 1C1YB 1E8YA 2HJ8A 4PYUA 4XZ4A 3QQ8B 4ICVA 3A4RA 3JYUA 2J0JA 4NAWB 2IO3B 2RSUA 2FCSA 3DBSA 4MGIE 3V6EB 4KVGB 4X57B 4K81A 4KDLB 4KIKB 2NBVB 4ZRIA 3S2AA 1KOTA 5D94A 1JRUA 3VDZA 1P0RA 2KFKB 1R4MI 2FCMA 2L0TA 4IUMB 2PEAA 2L3ZA 2DYMA 2KTRB 3HM3A 2JPHA 2C60A 2BYVE 5CHVC 3QAQA 2MBEA 1YJ1A 2LJ5A 4EOYA 2C7HA 2KWVB 3UGBB 1P3QU 1TBEA 4LCDE 1VCBA 3UINB 4AJWA 5EDSA 2DYBA 3PSEB 3PTFC 4IM2A 4ICUA 4F1SA 3TJPA 1WFYA 1WYWB 4BFRA 2KTFA 2D07B 3IG3A 1OTRB 1WR1A 4G11A 4HWIB 3VTUA 1V80A 1EF5A 4MM3A 1YIWA 3KUDB 1RFAA 2N4FA 4E3CA 4B6WA 3JVZX 1Z2MA 3JW0X 4K1RB 3A33B 3RZWC 1LM8B 2AEHA 3VXWA 3HHMA 2J7QB 1RLFA 4WJOA 2FIDA 2D3GA 2N1WA 2N9XA 2KX0A 3PHXB 2NBWB 2XK5B 3A9JA 3K9OB 3MJWA 2VRRB 2CS4A 3T9LA 4WJNA 1WY8A 3JSVB 4WWOA 4GGQA 2K6DB 2KDIA 5KHOA 3GOEA 4GN1A 4OVVA 5D6JB 3ZNHB 2NBUA 2O6VB 2ZZPB 2K39A 3OLMD 4GDKB 2JT4B 2LXCA 4RM8A 1V86A 3WA0A 2LASA 3OJ3A 4MEMA 5AZGA 4TQ0A 2LGXA 4M8MA 3DVNU 4A3OA 2BPSA 2KNBA 2KXJA 4MSMB 2MRPA 2MCNB 2DZMA 3SHQA 1IYFA 2K6QA 2KJ6A 1WGYA 3DCGA 4DHJD 3APDA 4E71A 1I35A 4BOSC 2C5LC 4HPLB 2UWQA 4DHZE 3B0AA 3ZW3A 2JUOA 2MX2A 1CMXB 3VHTC 1UBIA 4PYZA 4KDIC 2KZRA 3V60A 4GDLB 1AARA 3H1UA 3N32A 1WZ0A 3QHTA 4FN2A 2DYOA 4EEWA 3M3JA 2I1JA 3HIZA 4URKA 1H4RA 2KX3A 1KJTA 2V3SA 4MELA 2IY1B 1WJ4A 4WWNA 2DZKA 2M0XA 3VUWA 2CHZA 3WAMA 3ZRCA 2MSED 4JIOU 4MGKE 1E8WA 3RYTA 2CU1A 3W1SA 2QHOA 3WANA 3ALBA 2WX1A 4IWPA 3PHWB 4DDGD 4W9HA 4W9DA 3NZSA 4FHKA 3DVNV 3PREA 3NS8A 2KKCA 2NS5A 2D11A 4TQ1A 5LXIB 3O65B 2J0KA 5DPSA 1SGHA 3ZO5B 3LJ3A 4ZDVA 1WF9A 2MP2B 4HJKA 1V5OA 3PGEA 4ANWA 3AU5A 4K7UA 3A9KA 4EZLA 4P7IA 4ZYNA 2KC2A 4HLEA 2Z0DB 3RUIB 1BT0A 1X1MA 2BF8B 2A5UA 4I6LB 4NNJB 4G50A 1UH6A 1XQQA 1J19A 1Z5SB 4GB9A 4W9CA 1E5WA 2JXXA 5G55A 4GXBA 2JY6A 2O2VB 4MJSB 5BO4B 4GSWA 4I6NB 2N7DA 1ZKHA 1M94A 2FCQA 3ZKJC 4BOZB 1WMHB 5TR5A 1NBFC 5FR6A 4BKTA 3KW5B 4IM3A 2L8JA 3PVLA 4I6PA 2MW5A 3NZUA 3AI5A 3KUCB 3ECIA 1WX7A 5AEKB 4FJYA 1S1QB 2BWFA 1OEYA 3U8ZA 2C7NB 1GC7A 3A1QA 3TMPB 4AP4C 1LXDA 2K8CA 2MBOA 3WIMA 3OJ4B 2RR9A 3QARA 1WM3A 2N1VA 2PE9A 3EFUA 4HDOA 1J0GA 2OOBB 3VFKA 1UBQA 2PE6B 4RMAA 2ASQA 1KLVA 3B1LX 4KSKC 5IA7A 3VTVA 3PS6A 1UELA 4NQKE 1ZGUB 2IZVB 1P98A 3TBLD 4W9GA 3DBHI 4YL8A 3Q3JA 4LJPB 1WXAA 2R2OA 3TIXA 4KV2A 1LFDA 1WXVA 1WH3A 1WGGA 5DPRA 4FA6A 3W1SC 2YVCA 4DXAB 2D2QA 2KN5A 2YLMA 3KH0A 1C3TA 1V81A 1E90A 2G4SA 3BY4B 4LDTD 5C23A 4BKGA 2OJRA 2M1MA 2D10A 1Q5WB 2GBJA 3ZNGC 3RCZA 3PT2B 5AZHA 4RM9A 2KWUB 4IWOA 1LQBA 3EHVA 3UIOB 2FNJB 1HE8A 3Q3FA 1L2NA 2MBHA 2DHZA 1NI2A 2HE7A 2NCNA 3OAWA 1A5RA 1NDDA 1WIAA 1P9DU 4NQLB 3NY5A 2KQSA 4W9JA 1WM2A 2IO0B 2K8BA 2V4LA 4W9KA 5CTRC 5AZFA 4WWPA 1V6EA 2RGFA 4WQOB 3ZRFA 4PS7A 4BBNF 2IY0B 5KHQA 2DX5B 2A4ZA 3VUXA 3M95A 3K9PB 4NJ7A 2KLCA 1R4NI 4CYEA 2KJHB 4WAAA 2C9WB 5E6PA 3SU8X 1GG3A 3A9JB 3D32A 2N9EB 3ML9A 3ZLZA 4AJYB 3L54A 1EO6A 3ZVVA 4MSQB 4TV3A 2WYQA 2MWSB 1T0YA 2ZPNA 4TKNA 3AU4A 4NJ6A 2HTHA 3WALA 1WX9A 1RAXA 3WAOA 1D3ZA 2O6VD 3VH4B 2W9NA 1Q0WB 2PPHA 3B08A 4IWQA 2PJHA
chains in the Genus database with same CATH superfamily
1Y8RC 4A8XC 3PZ7A 3AXCA 2CHWA 2IGDA 3H7PA 2Y5BB 2FUHB 1TKGA 2LFIA 5GMVA 1L0VB 1HZ6A 1M4VA 2J4XA 4JLCA 2JRHA 2FUG1 1OEYJ 2N7JA 3DQVA 4M0WB 4GU2A 4E74A 1L7YA 2DNFA 1G6JA 3DBLI 2E3TA 4JWUC 4BKSD 3DDCB 4B9KA 4P6VF 2V0GA 4GIVA 4KGRA 4EZJA 4PS8A 4IC7B 5C1ZA 4G0NB 3H9DA 4UDUC 4M00A 3ZGZA 1AN8A 5G5HA 3P4QB 3DWMA 4JGHB 4WURA 2GLSA 1K8RB 4KIKA 2BW2A 4RFBA 4Q2JA 1TZ1A 1Q1OA 1K51A 2IGHA 4RF0A 3A1QB 5JXVA 4DHZB 3MFGA 3MHSD 4W9LA 4C7YA 3V62A 5G2NA 1FM0D 4WJQA 3N3KB 2KK8A 2DZIA 1YX5B 1SIFA 3BWUD 1TGZB 2IPKD 3VUYA 3N9YC 2LHEA 1L6VA 4W9FA 4GDKA 2LWPA 2MLBA 3GB1A 1ZDVA 4RF1A 3Q3MC 5L83A 2M8SA 2INCC 1SE9A 2JSVX 4S17A 1YD8U 2PMVA 4YSYB 4FADA 4FHJA 3R3MA 1ENFA 2W55A 2MJEA 4OZBA 3J9CA 3GZNB 3VH3B 2HD5B 3TEWA 2BGFA 4NY0A 3Q3NC 4BKSA 1FCCC 3UI3A 1WXSA 4FJZA 1SE4A 2QJLA 3QK0A 1MVKA 1L0YB 1WRIA 3PZ8A 1PQSA 3L16A 2MP2A 3DVGX 5IP4D 1A70A 1ZXIA 5JHBA 4KZ0A 3L13A 2KACA 3TCAA 3B9JA 3HK0A 3ZDTA 3L17A 2AL3A 2IO2B 3PZDA 4W9IA 4CHKA 3SDLC 3IVFA 1YJJA 2IO1B 2KDEB 4ZRJA 2O2VA 3Q69A 4L23A 3W2DA 3W1YA 2K9XA 2NTSA 4LNOA 3O13A 2C7MB 2KHWB 2DENB 4AOFA 3UF8A 5J18A 3AE2B 1BMLC 5HI1A 3CF6E 1E7UA 3RFZB 3KYCD 3P4SB 4KGTA 1CZPA 4XZ4A 3A4RA 4NAWB 1D6EC 2MHJA 5HG2A 3V6EB 3S2AA 1KOTA 1JRUA 3VDZA 2KFKB 2FCMA 3P1MA 4AQ7A 4WH4A 1TY2A 5CHVC 2MBEA 2LJ5A 3ZXRA 5FK9C 2KWVB 3AE3B 1J7CA 4OHJA 1WGKA 3UINB 4AJWA 1JWAD 4IM2A 4F1SA 3L4PA 1WFYA 1WYWB 3IG3A 2D07B 1N61A 4HKQA 3T3NA 2KT7A 3RI7C 4E3CA 1RFAA 3RPFC 1PDXA 3JW0X 3A33B 1PGXA 1WWTA 1MFWA 2D3GA 1L5PA 2N9XA 2KX0A 3MP9A 3T9LA 4WWOA 5KHOA 3GOEA 3ZNHB 2NBUA 1QLBB 1FD6A 5AZGA 2LGXA 2BTEA 3DVNU 4S0RA 2BPSA 3FC4A 4H2AA 1B1ZA 1PFDA 2KJ6A 4DHJD 3APDA 1KLUD 1TYGB 2KZRA 1AARA 3BK2A 1KFYB 5EE1A 3OG5A 3M3JA 1H4RA 1J7BA 1T0SC 2WXMA 1E8WA 4MGKE 1QOGA 3U52E 2BQQA 3ALBA 4IWPA 4DDGD 4W9HA 4W9DA 3DVNV 3NS8A 2D11A 4TQ1A 1Y56A 5DPSA 1JCKB 1WF9A 1QOFA 2N0SB 1L0XB 1R4MB 3EFCA 3AU5A 3P63A 1K53A 2Z0DB 2N9LA 4GB9A 3DBHB 1SXTA 2JXXA 1QF6A 2AQ3B 2NMQA 4I6NB 2N7DA 1ZKHA 1WMHB 2QILA 1FNWA 5FR6A 3LYYA 2MW5A 3NZUA 1I4XA 4KX6B 2BWFA 1OEYA 1GC7A 3TMPB 1LXDA 2K8CA 2MBOA 3WIMA 3GE3C 2RR9A 1WM3A 1DGJA 1UBQA 5FR3A 3AE8B 3B1LX 2WP9B 1VZ7A 4NQKE 2K0PA 1P98A 3DBHI 4LJPB 2H89B 1WXAA 2HJ1A 2R2OA 1ZP0B 4RCOA 1WXVA 1MHHE 1WGGA 3W1SC 4DXAB 1JWSD 5C23A 2M1MA 3GS2A 4YSXB 2GBJA 3P42A 4YXDB 3PT2B 3W5UB 1LQBA 3BYYB 1HE8A 2MBHA 1A5RA 1NI2A 2HE7A 5AUIA 1NDDA 2IO0B 5CTRC 3ZRFA 3Q8CA 4MM3B 2NTTA 2QCZA 3RNGC 3BIID 3M95A 3NRZA 3NG0A 1IGDA 4CYEA 2OHFA 1I4QA 2BVCA 2N9EB 1MJDA 4AJYB 3ZVVA 4TMAB 4M02A 2WYQA 1GB4A 1SIJA 1AWDA 2CU3A 1ROEA 1D3ZA 2O6VD 3E56A 1Q0WB 5GXGB 3NHEB 2FIFA 1GC6A 1UWMA 1GJZA 4ZOHC 2BWES 2K3UA 4J6IA 2B3AA 2JVCA 3PPAA 4FJVB 1VD2A 1KM7A 2M4NA 4O1NA 4J3OD 2EKEC 2NPTA 1WI0A 2KFJA 2GBRA 3NVVA 3U7DA 4HVBA 1HQRD 1KF6B 3R66C 2JWZA 3KVFB 4LJOB 1JWBD 2KC1A 3MJ5A 2XN9C 3M62B 3QIJA 4OVUA 3TEXA 2DAJA 2ZNVC 3A9KB 4N6EB 1P1AA 4US9A 4AUQC 1E9MA 4ARIA 3B2GA 4YWGG 1I4RA 3KQ4A 1WX8A 3BK1A 3IAM1 5DPWA 1WXMA 2GMIC 4II3B 1XLNA 1HA5A 4XE0A 1XLOA 2J53A 1YQBA 4IM0A 2DAFA 3IFWB 3RD2A 4CQNA 2ZW1A 1V1PA 1FXIA 1T0QC 3IBEA 2I2YA 2CHXA 4US8A 3PLUA 1WYGA 5H92C 3KUZA 3V05A 4ANVA 2WLBA 2JF5A 4W9EA 2X38A 2KLGA 2G1EA 2W3SA 1JW9D 1YN5A 2PLPA 2ZCCA 1JRPA 3PV1A 2RD0A 3DBRB 4FLHA 4XC2A 2R2QA 1V1OA 2XK5A 3PRZA 4WQMA 3JSVA 5E6OA 2L32A 1SB3C 2O6VA 2JZ3B 4HDQA 3CSFA 2LHDA 3FILA 4N9F4 1TS4A 3H6NA 1NYQA 2MJDA 4MGZE 1C4PA 2J42A 3V6CB 4C80A 3P4PB 2KDFB 1ESFA 1WR6E 3BINA 4WJPA 3DBLB 2BYFA 3X0WA 2ZNVB 5CHFA 4IOIE 3DBRI 4C7ZA 2L0FA 2G3QB 1UWXA 2AYOB 1I4GA 2IBIB 3I3TB 2LXAA 3C8YA 2Z0EB 4EKUA 1UD7A 3ML8A 5BMGA 3AE1B 2N9PC 2G4DB 5JZEB 1WJNA 4WIPA 2BKRB 2JRIB 5C3JB 4GMVA 3H7PB 3VR8B 1ZW7A 4HCPB 4MJSA 2CKHB 1VZ8A 2KDBA 1TTNA 5HKHA 1MPEA 2JU6X 5D2MB 1TT5B 2ZPYA 4JWSC 1J8CA 3U2SC 4RGNA 2G45B 4MT5A 5IAAC 2NVUI 4HPPA 2WU2B 1IPGA 2WXRA 3ZNZB 1SE3A 1EUVB 1SBBB 4GLSC 5C2TB 4IW0A 2NR2A 4K7SA 4NAMA 2KAJA 1UGJA 1E8YA 2HJ8A 1JQ4A 3JYUA 1QILA 5BYRA 2EELA 2IO3B 1RYJA 4MGIE 3I57A 2V9HA 4KIKB 3Q8BA 1TS3A 4ZRIA 5EE3A 2L3ZA 2DYMA 1NEKB 2JPHA 3RN9C 1YJ1A 4EOYA 4OVZA 1L4DB 4LNFA 1P3QU 4MH8A 1FRRA 5EDSA 3LXFA 3AN1A 3PTFC 3TJPA 4M01A 1D5MC 1WR1A 3VTUA 1V80A 4XDDA 1EF5A 2VZKD 4MACA 3NUHB 3JVZX 1T6BX 1F52A 4K1RB 1CK1A 3VXWA 1EU3A 3HHMA 2J7QB 2N1WA 3PHXB 2NBWB 3A9JA 1RFKA 2VRRB 2CS4A 4WJNA 1WY8A 3BVGA 1TKEA 2YEPF 2KDIA 4GN1A 2ZZPB 2WU5B 2K39A 4GDKB 2JT4B 4RM8A 3AM9A 2LASA 3OJ3A 2K22A 3E9SA 5MPOA 4LLGM 1IBXA 2MRPA 2MCNB 1BXTA 2DZMA 1R7SA 4E71A 2DWQA 4BOSC 1XCQL 1C77A 3B0AA 3ZW3A 2MX2A 2RPVA 3VHTC 1VR9A 1PUTA 2LGIA 3V60A 1FO4A 3QHTA 4FN2A 4EEWA 2I1JA 1J7AA 4MELA 3VUWA 1N6ZA 4WWNA 3WAMA 3ZRCA 4ACFA 2CHZA 4JIOU 1NI3A 2QHOA 3WANA 3NZSA 3U7ZA 2RMMA 2SAKA 3ZO5B 4ZDVA 2MP2B 1KTKA 2INDC 4ANWA 2QC8A 4K7UA 1JWUD 4EZLA 4AS1A 2KC2A 3RUIB 2IGGA 2A5UA 1B9RA 4QAYA 4G50A 1MHXA 1UH6A 1Z5SB 1ZPSA 4W9CA 2FBWB 1E5WA 2V4IB 2O2VB 5BO4B 1GB1A 1N5XA 3PVLA 2PTLA 2GI9A 2WNMA 4I6PA 3RNAC 1PYWD 5BYQA 2JZPA 3KUCB 5AEKB 1S1QB 1HZ5A 1DOYA 4XDCA 3TSSA 4AP4C 4XWWA 3OJ4B 2BB6A 2PE9A 1SSNA 1SJED 3VFKA 3N1XC 2ASQA 1N63A 4YL8A 3GE8C 3Q3JA 1EU4A 5BMHA 3MC8A 4NJCA 1V8CA 2GB1A 2YVCA 2D2QA 2KN5A 1E90A 3BY4B 3ZJUA 1MI0A 4XGAB 1F0ZA 1Q5WB 3ZNGC 3WCQA 2WXFA 3NVYA 3HVZA 1VZ6A 1TS2A 2KWUB 1L2NA 1FRDA 1PGBA 4PK1A 1I4HA 1IGCA 5T8IA 1AW7A 1JROA 2V4LA 4W9KA 5AZFA 4WWPA 1V6EA 1JWMD 1GAQB 2PVGC 4NJ7A 1R4NI 2C9WB 2KQ4X 5I4DA 3AEEB 3ETRA 3D32A 3DWGC 3L54A 4P16A 3VRBB 4WAFA 1FIQA 4TV3A 1NVID 1FXAA 2HTHA 4C00A 2KN4A 1WX9A 3VH4B 3B08A 4ARCA 2EMSA 4ANUA 2KOXA 4F7ZA 4L1BA 2UU7A 3EA6A 1STEA 4A3PA 3KWLA 4KSLC 1UUPA 2Z8LA 2IDYA 2WS3B 4II2B 4EFOA 4XWTA 3I9V1 4TUUA 2D3CA 2PW9A 1QQRA 1YJIA 3N20C 1F2RC 3AEBB 4OZAA 1SF0A 2CJNA 5HFYA 2EKIA 3AMZA 4MH0E 1FEHA 2K8HA 3QX1A 1KLGD 2KMCA 2BB5A 4XX5A 2AQ2B 5IO9A 2ZW0A 1TS5A 3QCAA 5J17A 2W54A 2ZCBA 2EMTA 1XLQA 4AWJA 3EECA 5LLIA 4HEA1 5H8YE 2KTRA 3RT3B 5JHAA 1QOBA 1QZEA 4NZLB 4OZCA 4RGOS 3UQBA 2WQYB 4IG7B 2PVOD 1E8ZA 3H8HA 3OWEB 1QOAA 4RGMA 5L95C 2ON8A 3C19A 2L7RA 5CX3A 3SD5A 2LGDA 2LJIA 3RZFA 2TSSA 1F1HA 5IN7A 3HM6X 1C4AA 2WXGA 1IP9A 3ENEA 1XXGA 4ANXA 3DHHC 2WDTB 3EUB2 3MC9A 3R2IA 4G3XB 2DZJA 1OGWA 2LVOA 2LMCA 1WE6A 4DHJB 2J0MA 1EM7A 2QSDA 1WJUA 2L05A 3W5VB 2KMAA 2MH7A 3MTNB 2I1KA 3L08A 2BKFA 2AWTA 2SEBD 2AQ1B 3IHPC 3MC0B 2UYZB 3PO0A 4A90A 4C4VA 4YSZB 2JZZA 3APFA 2WGSA 2RDBC 4B0MA 4GDLA 4LNIA 4KZCA 3V3XA 3H7SA 4K7WA 3UIPB 3QA8A 3ZTDA 1HXYD 5LNK1 4FXCA 3U30A 2R61A 4BBNC 2W3RA 1VDVA 4BAXA 4HPMB 5D7GA 2AL6A 2V3NA 2BYEA 3QJZA 3RNCC 3VRAB 1CQVA 2E6XA 2XBBC 2L76A 4JQWC 2L1AA 1E7PB 1EF1A 3PLVA 3T8MA 2VH2A 4HCNB 3ZTCA 1OQQA 1F2RI 4RH6A 3IT6B 2LGYA 1WGDA 4DDID 3NVWA 5JH5C 3PRPB 2KANA 4GOCA 2N9KA 5J2RA 2QMTA 4JE3B 1JALA 2QDFA 2NPTB 3AE6B 2WXKA 5DPTA 4P1CC 1TJEA 1XD3B 1UNSA 5D3DA 2KVRA 2W82A 3ONSA 3QC8B 4LNKA 2V1YA 4HXDA 1IUEA 1FFVA 2CR5A 3IAS1 3AULA 4HROA 2MBQA 1S3SG 3APCA 3M63B 2FE8A 2IYDB 2LRUA 2GBKA 4K3CA 3NZ3A 1V5TA 3DHGC 1WJ6A 4PT5A 3L10B 3QQ8B 4ICVA 1GPXA 2J0JA 1LGRA 3ZYYX 3FKYA 2WXJA 2RSUA 1UF0A 3DBSA 4KVGB 1C79A 3AEGB 4X57B 4KDLB 5D94A 1P7FA 1P0RA 4IUMB 2PEAA 1HTOA 2YEPB 3HM3A 2C60A 1V1PB 2BYVE 1E10A 4LCDE 2DYBA 2JQRB 2Y5PA 3ZJVA 4ICUA 2KTFA 4G11A 4HWIB 2X8XX 1YIWA 1HTQA 4B6WA 1Z2MA 3N1YC 1N5WA 3RNEC 1LM8B 4R3DA 3IT4B 3Q6BA 3HUIA 1TY0A 2XK5B 2BT6A 3K9OB 5AUKA 3JSVB 4HJGE 4LNNA 2O6VB 4ZRPA 1FNUA 3OLMD 3FILB 4MEMA 1N62A 4TQ0A 2WDRB 4M8MA 5EE9A 2RDHA 2KXJA 5BYSA 2MEKA 3SHQA 1IYFA 2K6QA 3DCGA 1WGYA 1SJHD 1I35A 3BVZA 4DHZE 1CMXB 1C9FA 2M56B 4PYZA 2ACZB 1EWYC 3N32A 1YN3A 2DYOA 4A6QA 3HIZA 3Q14C 4URKA 2KX3A 1KJTA 4DXFA 2DZKA 2M0XA 4M0WA 2MSED 1P7EA 3RYTA 2CU1A 2WX1A 3PHWB 4ZHOA 2K5PA 1T0RC 2CJOA 3O65B 1SGHA 3LJ3A 1FPYA 1ZDXA 2QEJC 4WWMA 4I6LB 5E6JA 1SEBD 1XQQA 1J19A 3CIRB 3BVMA 5G55A 4GXBA 4MJSB 3TUOA 2QIEB 1PGAA 2FCQA 2OEDA 3NVZA 4BKTA 3KW5B 4IM3A 2H88B 2OJWA 4IDIA 5G5GA 4TSSA 2J52A 2INNE 3HVDA 3KWVA 1F77A 3TEYA 2XNAC 3A1QA 1DOIA 4HDOA 2N1VA 1J0GA 2OOBB 2D3AA 2PE6B 1TKYA 3ZJTA 3BZDB 4KSKC 3PS6A 1UELA 4W9GA 1AYFA 3TIXA 3NJTA 2L83A 4KV2A 2L52A 1LFDA 4FA6A 1WH3A 2YLMA 3KH0A 2G4SA 4LDTD 4HRSA 2OJRA 1XF5L 1BUIC 3P4RB 1OFFA 1I4PA 5AZHA 4IWOA 2FNJB 3RNBC 2BBCA 3AEDB 2KQSA 2K8BA 1TZOA 2RGFA 4WQOB 4A55A 4PS7A 4BBNF 2IY0B 2I38A 1TIFA 2DX5B 3K9PB 2KLCA 2KJHB 3RNFC 2PKOA 5E6PA 3SU8X 4ZHPA 4EE2A 3A9JB 2WXHA 3ZLZA 2BS3B 1EO6A 3Q8FA 2GRIA 1RM6C 2ZPNA 1T0YA 1ZOYB 1C78A 3AU4A 1IBXB 1VLBA 1RAXA 5D3IB 3WAOA 1XLPA 2W9NA 5BMIA 4DWFA 1E8XA 3RMKC 2WDQB 1K50A 1H8CA 1OQYA 1YX6B 3P2BA 3N30A 4EUTA 3LDZE 4HK2A 2BS2B 1V2YA 1MG8A 1ISNA 4DK5A 4B95A 4JX1C 2REXA 3R8BA 3VTWA 2ZJDA 1YOVB 2KO3A 1JMLA 2GOWA 4ZYSA 3EC8A 1YN4A 1E7VA 2JX5A 1CJEA 4FULA 1WGRA 2KMMA 2ZEQA 3GZNI 3R7RA 3R7QA 2KQ7A 1WE7A 2D5GA 2LEKA 2WXLA 3CSTA 4NAWA 1C76A 3AE5B 1RRBA 4PS3A 3CMMB 3RULA 3L0WB 1UZXB 2AX5A 3DOWA 2LRWA 3FAHA 2K1FA 2KFKA 1SE2A 4DQOC 1ET9A 3VAWA 2MBBB 2LUMA 1R4NB 2G9HD 2VZKB 3VVWB 4LDTB 2KYWA 2BS4B 3AE9B 2FAZA 3SFEB 2K25A 5CHWA 2HDEA 1WGHA 1V9JA 3AH7A 1N60A 3WAPA 4FBJB 2WXQA 1DOXA 2LVPA 2LUEA 3ZNID 4D2KA 4MDKE 4DBGA 4N58A 2MJ3A 2LZ6A 2WX0A 4HKZE 2KDMA 1XCTL 4IKGA 4EZKA 1FFUA 5HHDG 2KD0A 1FXTB 5LXHA 2PIAA 3C0RB 2JXTA 2ZVOA 3W9CB 2WXPA 3NOBA 1GNUA 3ZIMA 1GUAB 3KYDD 4M8NA 2INPE 1XO3A 1WRDB 3VR9B 4ASWC 1I42A 1F9JA 2JYTA 2KJRA 3AB5A 1ZUD2 4ITKA 1FNVA 1UGMA 2LVQA 1NYRA 3DPDA 4OW0A 3AE7B 2MA9B 3ZDMC 4DXGA 3DVGY 4NPNA 2M17A 2ZVNA 4A20A 2LI5A 1RWSA 1L4ZB 2FCNA 1XT9B 4BVUC 4C56C 3V61A 1YQ3B 2M19A 1HEZE 5DCNA 4XYCA 2JWUA 1Q10A 4MGYE 1T5XD 3HRDD 2GBMA 2LD9A 3PRMB 3SFDB 1YMHE 3QWZB 4RNAA 1XEEA 2WXNA 3U4EG 3X23A 3ZUNA 2L00B 3SEBA 2KWCA 2WWZA 1WMHA 2GBNA 3I5JC 1U4AA 1V49A 3A4SC 1ACCA 3DHIC 5E6NA 2RPQA 4F8CB 2Z59B 4JL9A 1C4CA 1WZ3A 3Q8EA 3CWIA 2XEWA 4CO7A 3UQAA 4ZRKA 2MQJA 3AV8A 3TL5A 3VQIA 4KKIA 2N7EA 2IJ0A 1C1YB 4YTMB 4PYUA 3NS1A 2DLBA 4KKJA 2FCSA 4L2YA 4B0EA 2JYEA 4K81A 2NBVB 1D4BA 1R4MI 1GOZA 2L0TA 3AE4B 3ZXVA 2KTRB 2B76B 3QAQA 2C7HA 3IXSA 3UGBB 1TBEA 1VCBA 3GP7A 3PSEB 1WXQA 4BFRA 1OTRB 3BYTB 1E6EB 3I63C 4MM3A 3KUDB 2N4FA 1DYQA 3RZWC 3ZQ4A 2AEHA 3N1ZC 1RLFA 4LK0M 1ZE3D 4WJOA 2FIDA 3MJWA 4GGQA 2K6DB 3KLSX 2WHIA 4OVVA 5D6JB 3URYA 2LXCA 1V86A 3WA0A 1K52A 3SR6A 1EWCA 4A3OA 2KNBA 4MSMB 2VH1A 2C5LC 4HPLB 2UWQA 4C4VB 4JPSA 1KH0A 2JUOA 1D5XC 1UBIA 3Q8AA 3AEFB 4KDIC 4GDLB 3H1UA 1WZ0A 2V3SA 2IY1B 1WJ4A 4KGSA 1QKZA 1D5ZC 3W1SA 1VJKA 5FKAC 1YQ4B 2Q5WD 4FHKA 3PREA 2ICIA 4BZAA 2KKCA 2NS5A 5LXIB 2J0KA 2DBYA 4HJKA 1V5OA 3PGEA 1L6UA 3A9KA 1MG4A 4P7IA 4ZYNA 4HLEA 1BT0A 1X1MA 2BF8B 1YNTE 4A9AA 4NNJB 1FCLA 2JY6A 2HTME 1ZXHA 4GSWA 3R2TA 1M94A 2WXOA 3ZKJC 4BOZB 2ONQA 5TR5A 1NBFC 2L8JA 2V3PA 3Q2AC 4YTPB 3AI5A 2KWDA 3ECIA 1WX7A 4FJYA 2WDVB 3U8ZA 2C7NB 4RGTA 2LGSA 3QARA 3AEAB 3EFUA 4N59A 2M0AA 4RMAA 1KLVA 1V97A 3ABVB 5IA7A 3VTVA 1ZGUB 2IZVB 4YTNB 3TBLD 1KRHA 1FMAD 5DPRA 1QT9A 3T3OA 1C3TA 1V81A 4BKGA 1T3QA 4YT0B 2D10A 1I7HA 3RCZA 4RM9A 3B2FA 3EHVA 3UIOB 4REZA 3Q3FA 1WSPA 2NCNA 2DHZA 3OAWA 2RDGA 1WIAA 1P9DU 4NQLB 3NY5A 4W9JA 1WM2A 5EE0A 2KVZA 5KHQA 3EGRA 4USAA 5IOIA 2A4ZA 3VUXA 3LB8C 1NENB 4K3BA 4WAAA 1GG3A 3Q3OC 2Y5CA 3ML9A 1VRAB 4MSQB 4P1BC 5IKCM 2MWSB 2BYTA 2D3BA 2Y3AA 1OQRA 4TKNA 1E0ZA 3MHZA 4NJ6A 3WALA 5TSSA 4LTUA 2WXIA 4ZRQA 1ET6A 2PPHA 1LO5D 3AECB 4IWQA 2PJHA 3TEZA
chains in the Genus database with same CATH topology
1Y8RC 2EMSA 2FIFA 4ANUA 4DWFA 2KOXA 1GC6A 3AXCA 4F7ZA 1E8XA 1GJZA 2CHWA 3H7PA 2Y5BB 2FUHB 2BWES 4J6IA 2B3AA 2JVCA 3PPAA 4FJVB 5GMVA 4A3PA 1VD2A 4KSLC 1KM7A 1H8CA 2M4NA 1OQYA 1YX6B 2EKEC 3P2BA 3N30A 4EUTA 3LDZE 4HK2A 2NPTA 1WI0A 4JLCA 1V2YA 2KFJA 1MG8A 2JRHA 4II2B 2GBRA 1OEYJ 1ISNA 3DQVA 4M0WB 4DK5A 4EFOA 4GU2A 3U7DA 4B95A 4E74A 4HVBA 2REXA 3R66C 1L7YA 2JWZA 2ZJDA 3VTWA 4TUUA 1G6JA 2KO3A 3DBLI 2GOWA 3KVFB 3EC8A 4LJOB 1E7VA 2KC1A 4BKSD 3DDCB 4B9KA 3M62B 4FULA 1WGRA 3QIJA 4OVUA 2ZEQA 3GZNI 3R7RA 2DAJA 4GIVA 3R7QA 2KQ7A 1WE7A 2ZNVC 4EZJA 3A9KB 4PS8A 4IC7B 1P1AA 4MH0E 5C1ZA 2K8HA 4G0NB 3QX1A 4AUQC 3H9DA 2KMCA 3CSTA 1WX8A 4NAWA 4XX5A 1RRBA 4PS3A 3CMMB 3RULA 3QCAA 1WXMA 1UZXB 3L0WB 5J17A 5DPWA 4JGHB 3DOWA 1K8RB 2GMIC 2LRWA 2ZCBA 4II3B 4KIKA 2EMTA 2K1FA 4AWJA 3EECA 2KFKA 1YQBA 1TZ1A 5LLIA 1Q1OA 4IM0A 2DAFA 3IFWB 3RD2A 2KTRA 3RT3B 5JHAA 3NHEB 3IBEA 2CHXA 1QZEA 3VAWA 3PLUA 2MBBB 3KUZA 4ANVA 3UQBA 4IG7B 3VVWB 4LDTB 3A1QB 2JF5A 4W9EA 2KLGA 1E8ZA 4DHZB 3MHSD 5L95C 2FAZA 2L7RA 4W9LA 5CX3A 2K25A 3SD5A 2LGDA 5CHWA 3RZFA 3V62A 5G2NA 1WGHA 1V9JA 2ZCCA 3HM6X 1IP9A 3PV1A 2RD0A 3ENEA 4WJQA 3WAPA 4ANXA 4FLHA 4FBJB 2LVPA 3N3KB 2KK8A 4XC2A 2DZIA 1YX5B 2LUEA 1SIFA 2R2QA 2WDTB 3ZNID 4MDKE 4DBGA 1TGZB 2XK5A 3PRZA 3JSVA 3VUYA 2LZ6A 2WX0A 5E6OA 4G3XB 2O6VA 2JZ3B 4W9FA 2DZJA 4HDQA 1OGWA 2LVOA 4GDKA 3CSFA 4EZKA 1WE6A 2LWPA 4DHJB 2MLBA 4N9F4 3H6NA 2J0MA 2KD0A 4MGZE 1FXTB 5LXHA 1WJUA 3C0RB 2M8SA 5L83A 3V6CB 2ZVOA 1SE9A 2L05A 1YD8U 3NOBA 1GNUA 4FADA 2KMAA 2KDFB 3MTNB 2I1KA 3BINA 1WR6E 3ZIMA 3L08A 4FHJA 1GUAB 3KYDD 2BYFA 4WJPA 2BKFA 3X0WA 2ZNVB 4M8NA 3R3MA 2AWTA 3IHPC 2UYZB 1WRDB 2JZZA 5CHFA 4ASWC 1I42A 3APFA 1F9JA 2KJRA 3DBRI 4GDLA 3VH3B 2HD5B 4KZCA 2L0FA 3H7SA 4K7WA 3UIPB 2BGFA 2G3QB 1UGMA 3QA8A 2AYOB 3ZTDA 2LVQA 4NY0A 3DPDA 4BKSA 2IBIB 3U30A 2MA9B 3I3TB 3ZDMC 4BBNC 1WXSA 3DVGY 2LXAA 4HPMB 2Z0EB 4FJZA 2AL6A 4NPNA 5D7GA 1UD7A 2BYEA 3ML8A 2M17A 4EKUA 2ZVNA 3QJZA 3QK0A 4A20A 2LI5A 2N9PC 2XBBC 2L76A 4JQWC 1PQSA 1EF1A 3L16A 2FCNA 3PLVA 3T8MA 2G4DB 1XT9B 2MP2A 4HCNB 4BVUC 3DVGX 3ZTCA 3V61A 5JZEB 5JHBA 4KZ0A 3L13A 5DCNA 3TCAA 1WJNA 3HK0A 2BKRB 2LGYA 4MGYE 1WGDA 3L17A 3ZDTA 2GBMA 2AL3A 2LD9A 4DDID 2JRIB 2IO2B 3PRMB 3PZDA 4W9IA 4CHKA 3SDLC 3IVFA 4GMVA 3H7PB 5JH5C 2IO1B 1ZW7A 2KDEB 3PRPB 3QWZB 4HCPB 2KANA 4ZRJA 4MJSA 2O2VA 4GOCA 2CKHB 5J2RA 3X23A 3ZUNA 2KDBA 2L00B 1TTNA 3W1YA 2KWCA 2WWZA 1WMHA 2GBNA 2NPTB 5D2MB 5HKHA 2ZPYA 1J8CA 1U4AA 2C7MB 1V49A 3A4SC 5DPTA 2KHWB 2G45B 2DENB 4AOFA 3UF8A 1XD3B 5E6NA 2RPQA 4F8CB 2KVRA 3QC8B 3ONSA 5J18A 5IAAC 2V1YA 4HXDA 2CR5A 2NVUI 2Z59B 2MBQA 3AULA 4JL9A 1WZ3A 1S3SG 3APCA 3M63B 2XEWA 1IPGA 4CO7A 2IYDB 2LRUA 3ZNZB 3UQAA 4ZRKA 1EUVB 3CF6E 2MQJA 2GBKA 1E7UA 3KYCD 3TL5A 3VQIA 2N7EA 1V5TA 4IW0A 2NR2A 1WJ6A 4K7SA 3L10B 1C1YB 1E8YA 2HJ8A 4PYUA 4XZ4A 3QQ8B 4ICVA 3A4RA 3JYUA 2J0JA 4NAWB 2IO3B 2RSUA 2FCSA 3DBSA 4MGIE 3V6EB 4KVGB 4X57B 4K81A 4KDLB 4KIKB 2NBVB 4ZRIA 3S2AA 1KOTA 5D94A 1JRUA 3VDZA 1P0RA 2KFKB 1R4MI 2FCMA 2L0TA 4IUMB 2PEAA 2L3ZA 2DYMA 2KTRB 3HM3A 2JPHA 2C60A 2BYVE 5CHVC 3QAQA 2MBEA 1YJ1A 2LJ5A 4EOYA 2C7HA 2KWVB 3UGBB 1P3QU 1TBEA 4LCDE 1VCBA 3UINB 4AJWA 5EDSA 2DYBA 3PSEB 3PTFC 4IM2A 4ICUA 4F1SA 3TJPA 1WFYA 1WYWB 4BFRA 2KTFA 2D07B 3IG3A 1OTRB 1WR1A 4G11A 4HWIB 3VTUA 1V80A 1EF5A 4MM3A 1YIWA 3KUDB 1RFAA 2N4FA 4E3CA 4B6WA 3JVZX 1Z2MA 3JW0X 4K1RB 3A33B 3RZWC 1LM8B 2AEHA 3VXWA 3HHMA 2J7QB 1RLFA 4WJOA 2FIDA 2D3GA 2N1WA 2N9XA 2KX0A 3PHXB 2NBWB 2XK5B 3A9JA 3K9OB 3MJWA 2VRRB 2CS4A 3T9LA 4WJNA 1WY8A 3JSVB 4WWOA 4GGQA 2K6DB 2KDIA 5KHOA 3GOEA 4GN1A 4OVVA 5D6JB 3ZNHB 2NBUA 2O6VB 2ZZPB 2K39A 3OLMD 4GDKB 2JT4B 2LXCA 4RM8A 1V86A 3WA0A 2LASA 3OJ3A 4MEMA 5AZGA 4TQ0A 2LGXA 4M8MA 3DVNU 4A3OA 2BPSA 2KNBA 2KXJA 4MSMB 2MRPA 2MCNB 2DZMA 3SHQA 1IYFA 2K6QA 2KJ6A 1WGYA 3DCGA 4DHJD 3APDA 4E71A 1I35A 4BOSC 2C5LC 4HPLB 2UWQA 4DHZE 3B0AA 3ZW3A 2JUOA 2MX2A 1CMXB 3VHTC 1UBIA 4PYZA 4KDIC 2KZRA 3V60A 4GDLB 1AARA 3H1UA 3N32A 1WZ0A 3QHTA 4FN2A 2DYOA 4EEWA 3M3JA 2I1JA 3HIZA 4URKA 1H4RA 2KX3A 1KJTA 2V3SA 4MELA 2IY1B 1WJ4A 4WWNA 2DZKA 2M0XA 3VUWA 2CHZA 3WAMA 3ZRCA 2MSED 4JIOU 4MGKE 1E8WA 3RYTA 2CU1A 3W1SA 2QHOA 3WANA 3ALBA 2WX1A 4IWPA 3PHWB 4DDGD 4W9HA 4W9DA 3NZSA 4FHKA 3DVNV 3PREA 3NS8A 2KKCA 2NS5A 2D11A 4TQ1A 5LXIB 3O65B 2J0KA 5DPSA 1SGHA 3ZO5B 3LJ3A 4ZDVA 1WF9A 2MP2B 4HJKA 1V5OA 3PGEA 4ANWA 3AU5A 4K7UA 3A9KA 4EZLA 4P7IA 4ZYNA 2KC2A 4HLEA 2Z0DB 3RUIB 1BT0A 1X1MA 2BF8B 2A5UA 4I6LB 4NNJB 4G50A 1UH6A 1XQQA 1J19A 1Z5SB 4GB9A 4W9CA 1E5WA 2JXXA 5G55A 4GXBA 2JY6A 2O2VB 4MJSB 5BO4B 4GSWA 4I6NB 2N7DA 1ZKHA 1M94A 2FCQA 3ZKJC 4BOZB 1WMHB 5TR5A 1NBFC 5FR6A 4BKTA 3KW5B 4IM3A 2L8JA 3PVLA 4I6PA 2MW5A 3NZUA 3AI5A 3KUCB 3ECIA 1WX7A 5AEKB 4FJYA 1S1QB 2BWFA 1OEYA 3U8ZA 2C7NB 1GC7A 3A1QA 3TMPB 4AP4C 1LXDA 2K8CA 2MBOA 3WIMA 3OJ4B 2RR9A 3QARA 1WM3A 2N1VA 2PE9A 3EFUA 4HDOA 1J0GA 2OOBB 3VFKA 1UBQA 2PE6B 4RMAA 2ASQA 1KLVA 3B1LX 4KSKC 5IA7A 3VTVA 3PS6A 1UELA 4NQKE 1ZGUB 2IZVB 1P98A 3TBLD 4W9GA 3DBHI 4YL8A 3Q3JA 4LJPB 1WXAA 2R2OA 3TIXA 4KV2A 1LFDA 1WXVA 1WH3A 1WGGA 5DPRA 4FA6A 3W1SC 2YVCA 4DXAB 2D2QA 2KN5A 2YLMA 3KH0A 1C3TA 1V81A 1E90A 2G4SA 3BY4B 4LDTD 5C23A 4BKGA 2OJRA 2M1MA 2D10A 1Q5WB 2GBJA 3ZNGC 3RCZA 3PT2B 5AZHA 4RM9A 2KWUB 4IWOA 1LQBA 3EHVA 3UIOB 2FNJB 1HE8A 3Q3FA 1L2NA 2MBHA 2DHZA 1NI2A 2HE7A 2NCNA 3OAWA 1A5RA 1NDDA 1WIAA 1P9DU 4NQLB 3NY5A 2KQSA 4W9JA 1WM2A 2IO0B 2K8BA 2V4LA 4W9KA 5CTRC 5AZFA 4WWPA 1V6EA 2RGFA 4WQOB 3ZRFA 4PS7A 4BBNF 2IY0B 5KHQA 2DX5B 2A4ZA 3VUXA 3M95A 3K9PB 4NJ7A 2KLCA 1R4NI 4CYEA 2KJHB 4WAAA 2C9WB 5E6PA 3SU8X 1GG3A 3A9JB 3D32A 2N9EB 3ML9A 3ZLZA 4AJYB 3L54A 1EO6A 3ZVVA 4MSQB 4TV3A 2WYQA 2MWSB 1T0YA 2ZPNA 4TKNA 3AU4A 4NJ6A 2HTHA 3WALA 1WX9A 1RAXA 3WAOA 1D3ZA 2O6VD 3VH4B 2W9NA 1Q0WB 2PPHA 3B08A 4IWQA 2PJHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y8R C;  2EMS A;  2FIF A;  4ANU A;  4DWF A;  2KOX A;  1GC6 A;  3AXC A;  4F7Z A;  1E8X A;  1GJZ A;  2CHW A;  3H7P A;  2Y5B B;  2FUH B;  2BWE S;  4J6I A;  2B3A A;  2JVC A;  3PPA A;  4FJV B;  5GMV A;  4A3P A;  1VD2 A;  4KSL C;  1KM7 A;  1H8C A;  2M4N A;  1OQY A;  1YX6 B;  2EKE C;  3P2B A;  3N30 A;  4EUT A;  3LDZ E;  4HK2 A;  2NPT A;  1WI0 A;  4JLC A;  1V2Y A;  2KFJ A;  1MG8 A;  2JRH A;  4II2 B;  2GBR A;  1OEY J;  1ISN A;  3DQV A;  4M0W B;  4DK5 A;  4EFO A;  4GU2 A;  3U7D A;  4B95 A;  4E74 A;  4HVB A;  2REX A;  3R66 C;  1L7Y A;  2JWZ A;  2ZJD A;  3VTW A;  4TUU A;  1G6J A;  2KO3 A;  3DBL I;  2GOW A;  3KVF B;  3EC8 A;  4LJO B;  1E7V A;  2KC1 A;  4BKS D;  3DDC B;  4B9K A;  3M62 B;  4FUL A;  1WGR A;  3QIJ A;  4OVU A;  2ZEQ A;  3GZN I;  3R7R A;  2DAJ A;  4GIV A;  3R7Q A;  2KQ7 A;  1WE7 A;  2ZNV C;  4EZJ A;  3A9K B;  4PS8 A;  4IC7 B;  1P1A A;  4MH0 E;  5C1Z A;  2K8H A;  4G0N B;  3QX1 A;  4AUQ C;  3H9D A;  2KMC A;  3CST A;  1WX8 A;  4NAW A;  4XX5 A;  1RRB A;  4PS3 A;  3CMM B;  3RUL A;  3QCA A;  1WXM A;  1UZX B;  3L0W B;  5J17 A;  5DPW A;  4JGH B;  3DOW A;  1K8R B;  2GMI C;  2LRW A;  2ZCB A;  4II3 B;  4KIK A;  2EMT A;  2K1F A;  4AWJ A;  3EEC A;  2KFK A;  1YQB A;  1TZ1 A;  5LLI A;  1Q1O A;  4IM0 A;  2DAF A;  3IFW B;  3RD2 A;  2KTR A;  3RT3 B;  5JHA A;  3NHE B;  3IBE A;  2CHX A;  1QZE A;  3VAW A;  3PLU A;  2MBB B;  3KUZ A;  4ANV A;  3UQB A;  4IG7 B;  3VVW B;  4LDT B;  3A1Q B;  2JF5 A;  4W9E A;  2KLG A;  1E8Z A;  4DHZ B;  3MHS D;  5L95 C;  2FAZ A;  2L7R A;  4W9L A;  5CX3 A;  2K25 A;  3SD5 A;  2LGD A;  5CHW A;  3RZF A;  3V62 A;  5G2N A;  1WGH A;  1V9J A;  2ZCC A;  3HM6 X;  1IP9 A;  3PV1 A;  2RD0 A;  3ENE A;  4WJQ A;  3WAP A;  4ANX A;  4FLH A;  4FBJ B;  2LVP A;  3N3K B;  2KK8 A;  4XC2 A;  2DZI A;  1YX5 B;  2LUE A;  1SIF A;  2R2Q A;  2WDT B;  3ZNI D;  4MDK E;  4DBG A;  1TGZ B;  2XK5 A;  3PRZ A;  3JSV A;  3VUY A;  2LZ6 A;  2WX0 A;  5E6O A;  4G3X B;  2O6V A;  2JZ3 B;  4W9F A;  2DZJ A;  4HDQ A;  1OGW A;  2LVO A;  4GDK A;  3CSF A;  4EZK A;  1WE6 A;  2LWP A;  4DHJ B;  2MLB A;  4N9F 4;  3H6N A;  2J0M A;  2KD0 A;  4MGZ E;  1FXT B;  5LXH A;  1WJU A;  3C0R B;  2M8S A;  5L83 A;  3V6C B;  2ZVO A;  1SE9 A;  2L05 A;  1YD8 U;  3NOB A;  1GNU A;  4FAD A;  2KMA A;  2KDF B;  3MTN B;  2I1K A;  3BIN A;  1WR6 E;  3ZIM A;  3L08 A;  4FHJ A;  1GUA B;  3KYD D;  2BYF A;  4WJP A;  2BKF A;  3X0W A;  2ZNV B;  4M8N A;  3R3M A;  2AWT A;  3IHP C;  2UYZ B;  1WRD B;  2JZZ A;  5CHF A;  4ASW C;  1I42 A;  3APF A;  1F9J A;  2KJR A;  3DBR I;  4GDL A;  3VH3 B;  2HD5 B;  4KZC A;  2L0F A;  3H7S A;  4K7W A;  3UIP B;  2BGF A;  2G3Q B;  1UGM A;  3QA8 A;  2AYO B;  3ZTD A;  2LVQ A;  4NY0 A;  3DPD A;  4BKS A;  2IBI B;  3U30 A;  2MA9 B;  3I3T B;  3ZDM C;  4BBN C;  1WXS A;  3DVG Y;  2LXA A;  4HPM B;  2Z0E B;  4FJZ A;  2AL6 A;  4NPN A;  5D7G A;  1UD7 A;  2BYE A;  3ML8 A;  2M17 A;  4EKU A;  2ZVN A;  3QJZ A;  3QK0 A;  4A20 A;  2LI5 A;  2N9P C;  2XBB C;  2L76 A;  4JQW C;  1PQS A;  1EF1 A;  3L16 A;  2FCN A;  3PLV A;  3T8M A;  2G4D B;  1XT9 B;  2MP2 A;  4HCN B;  4BVU C;  3DVG X;  3ZTC A;  3V61 A;  5JZE B;  5JHB A;  4KZ0 A;  3L13 A;  5DCN A;  3TCA A;  1WJN A;  3HK0 A;  2BKR B;  2LGY A;  4MGY E;  1WGD A;  3L17 A;  3ZDT A;  2GBM A;  2AL3 A;  2LD9 A;  4DDI D;  2JRI B;  2IO2 B;  3PRM B;  3PZD A;  4W9I A;  4CHK A;  3SDL C;  3IVF A;  4GMV A;  3H7P B;  5JH5 C;  2IO1 B;  1ZW7 A;  2KDE B;  3PRP B;  3QWZ B;  4HCP B;  2KAN A;  4ZRJ A;  4MJS A;  2O2V A;  4GOC A;  2CKH B;  5J2R A;  3X23 A;  3ZUN A;  2KDB A;  2L00 B;  1TTN A;  3W1Y A;  2KWC A;  2WWZ A;  1WMH A;  2GBN A;  2NPT B;  5D2M B;  5HKH A;  2ZPY A;  1J8C A;  1U4A A;  2C7M B;  1V49 A;  3A4S C;  5DPT A;  2KHW B;  2G45 B;  2DEN B;  4AOF A;  3UF8 A;  1XD3 B;  5E6N A;  2RPQ A;  4F8C B;  2KVR A;  3QC8 B;  3ONS A;  5J18 A;  5IAA C;  2V1Y A;  4HXD A;  2CR5 A;  2NVU I;  2Z59 B;  2MBQ A;  3AUL A;  4JL9 A;  1WZ3 A;  1S3S G;  3APC A;  3M63 B;  2XEW A;  1IPG A;  4CO7 A;  2IYD B;  2LRU A;  3ZNZ B;  3UQA A;  4ZRK A;  1EUV B;  3CF6 E;  2MQJ A;  2GBK A;  1E7U A;  3KYC D;  3TL5 A;  3VQI A;  2N7E A;  1V5T A;  4IW0 A;  2NR2 A;  1WJ6 A;  4K7S A;  3L10 B;  1C1Y B;  1E8Y A;  2HJ8 A;  4PYU A;  4XZ4 A;  3QQ8 B;  4ICV A;  3A4R A;  3JYU A;  2J0J A;  4NAW B;  2IO3 B;  2RSU A;  2FCS A;  3DBS A;  4MGI E;  3V6E B;  4KVG B;  4X57 B;  4K81 A;  4KDL B;  4KIK B;  2NBV B;  4ZRI A;  3S2A A;  1KOT A;  5D94 A;  1JRU A;  3VDZ A;  1P0R A;  2KFK B;  1R4M I;  2FCM A;  2L0T A;  4IUM B;  2PEA A;  2L3Z A;  2DYM A;  2KTR B;  3HM3 A;  2JPH A;  2C60 A;  2BYV E;  5CHV C;  3QAQ A;  2MBE A;  1YJ1 A;  2LJ5 A;  4EOY A;  2C7H A;  2KWV B;  3UGB B;  1P3Q U;  1TBE A;  4LCD E;  1VCB A;  3UIN B;  4AJW A;  5EDS A;  2DYB A;  3PSE B;  3PTF C;  4IM2 A;  4ICU A;  4F1S A;  3TJP A;  1WFY A;  1WYW B;  4BFR A;  2KTF A;  2D07 B;  3IG3 A;  1OTR B;  1WR1 A;  4G11 A;  4HWI B;  3VTU A;  1V80 A;  1EF5 A;  4MM3 A;  1YIW A;  3KUD B;  1RFA A;  2N4F A;  4E3C A;  4B6W A;  3JVZ X;  1Z2M A;  3JW0 X;  4K1R B;  3A33 B;  3RZW C;  1LM8 B;  2AEH A;  3VXW A;  3HHM A;  2J7Q B;  1RLF A;  4WJO A;  2FID A;  2D3G A;  2N1W A;  2N9X A;  2KX0 A;  3PHX B;  2NBW B;  2XK5 B;  3A9J A;  3K9O B;  3MJW A;  2VRR B;  2CS4 A;  3T9L A;  4WJN A;  1WY8 A;  3JSV B;  4WWO A;  4GGQ A;  2K6D B;  2KDI A;  5KHO A;  3GOE A;  4GN1 A;  4OVV A;  5D6J B;  3ZNH B;  2NBU A;  2O6V B;  2ZZP B;  2K39 A;  3OLM D;  4GDK B;  2JT4 B;  2LXC A;  4RM8 A;  1V86 A;  3WA0 A;  2LAS A;  3OJ3 A;  4MEM A;  5AZG A;  4TQ0 A;  2LGX A;  4M8M A;  3DVN U;  4A3O A;  2BPS A;  2KNB A;  2KXJ A;  4MSM B;  2MRP A;  2MCN B;  2DZM A;  3SHQ A;  1IYF A;  2K6Q A;  2KJ6 A;  1WGY A;  3DCG A;  4DHJ D;  3APD A;  4E71 A;  1I35 A;  4BOS C;  2C5L C;  4HPL B;  2UWQ A;  4DHZ E;  3B0A A;  3ZW3 A;  2JUO A;  2MX2 A;  1CMX B;  3VHT C;  1UBI A;  4PYZ A;  4KDI C;  2KZR A;  3V60 A;  4GDL B;  1AAR A;  3H1U A;  3N32 A;  1WZ0 A;  3QHT A;  4FN2 A;  2DYO A;  4EEW A;  3M3J A;  2I1J A;  3HIZ A;  4URK A;  1H4R A;  2KX3 A;  1KJT A;  2V3S A;  4MEL A;  2IY1 B;  1WJ4 A;  4WWN A;  2DZK A;  2M0X A;  3VUW A;  2CHZ A;  3WAM A;  3ZRC A;  2MSE D;  4JIO U;  4MGK E;  1E8W A;  3RYT A;  2CU1 A;  3W1S A;  2QHO A;  3WAN A;  3ALB A;  2WX1 A;  4IWP A;  3PHW B;  4DDG D;  4W9H A;  4W9D A;  3NZS A;  4FHK A;  3DVN V;  3PRE A;  3NS8 A;  2KKC A;  2NS5 A;  2D11 A;  4TQ1 A;  5LXI B;  3O65 B;  2J0K A;  5DPS A;  1SGH A;  3ZO5 B;  3LJ3 A;  4ZDV A;  1WF9 A;  2MP2 B;  4HJK A;  1V5O A;  3PGE A;  4ANW A;  3AU5 A;  4K7U A;  3A9K A;  4EZL A;  4P7I A;  4ZYN A;  2KC2 A;  4HLE A;  2Z0D B;  3RUI B;  1BT0 A;  1X1M A;  2BF8 B;  2A5U A;  4I6L B;  4NNJ B;  4G50 A;  1UH6 A;  1XQQ A;  1J19 A;  1Z5S B;  4GB9 A;  4W9C A;  1E5W A;  2JXX A;  5G55 A;  4GXB A;  2JY6 A;  2O2V B;  4MJS B;  5BO4 B;  4GSW A;  4I6N B;  2N7D A;  1ZKH A;  1M94 A;  2FCQ A;  3ZKJ C;  4BOZ B;  1WMH B;  5TR5 A;  1NBF C;  5FR6 A;  4BKT A;  3KW5 B;  4IM3 A;  2L8J A;  3PVL A;  4I6P A;  2MW5 A;  3NZU A;  3AI5 A;  3KUC B;  3ECI A;  1WX7 A;  5AEK B;  4FJY A;  1S1Q B;  2BWF A;  1OEY A;  3U8Z A;  2C7N B;  1GC7 A;  3A1Q A;  3TMP B;  4AP4 C;  1LXD A;  2K8C A;  2MBO A;  3WIM A;  3OJ4 B;  2RR9 A;  3QAR A;  1WM3 A;  2N1V A;  2PE9 A;  3EFU A;  4HDO A;  1J0G A;  2OOB B;  3VFK A;  1UBQ A;  2PE6 B;  4RMA A;  2ASQ A;  1KLV A;  3B1L X;  4KSK C;  5IA7 A;  3VTV A;  3PS6 A;  1UEL A;  4NQK E;  1ZGU B;  2IZV B;  1P98 A;  3TBL D;  4W9G A;  3DBH I;  4YL8 A;  3Q3J A;  4LJP B;  1WXA A;  2R2O A;  3TIX A;  4KV2 A;  1LFD A;  1WXV A;  1WH3 A;  1WGG A;  5DPR A;  4FA6 A;  3W1S C;  2YVC A;  4DXA B;  2D2Q A;  2KN5 A;  2YLM A;  3KH0 A;  1C3T A;  1V81 A;  1E90 A;  2G4S A;  3BY4 B;  4LDT D;  5C23 A;  4BKG A;  2OJR A;  2M1M A;  2D10 A;  1Q5W B;  2GBJ A;  3ZNG C;  3RCZ A;  3PT2 B;  5AZH A;  4RM9 A;  2KWU B;  4IWO A;  1LQB A;  3EHV A;  3UIO B;  2FNJ B;  1HE8 A;  3Q3F A;  1L2N A;  2MBH A;  2DHZ A;  1NI2 A;  2HE7 A;  2NCN A;  3OAW A;  1A5R A;  1NDD A;  1WIA A;  1P9D U;  4NQL B;  3NY5 A;  2KQS A;  4W9J A;  1WM2 A;  2IO0 B;  2K8B A;  2V4L A;  4W9K A;  5CTR C;  5AZF A;  4WWP A;  1V6E A;  2RGF A;  4WQO B;  3ZRF A;  4PS7 A;  4BBN F;  2IY0 B;  5KHQ A;  2DX5 B;  2A4Z A;  3VUX A;  3M95 A;  3K9P B;  4NJ7 A;  2KLC A;  1R4N I;  4CYE A;  2KJH B;  4WAA A;  2C9W B;  5E6P A;  3SU8 X;  1GG3 A;  3A9J B;  3D32 A;  2N9E B;  3ML9 A;  3ZLZ A;  4AJY B;  3L54 A;  1EO6 A;  3ZVV A;  4MSQ B;  4TV3 A;  2WYQ A;  2MWS B;  1T0Y A;  2ZPN A;  4TKN A;  3AU4 A;  4NJ6 A;  2HTH A;  3WAL A;  1WX9 A;  1RAX A;  3WAO A;  1D3Z A;  2O6V D;  3VH4 B;  2W9N A;  1Q0W B;  2PPH A;  3B08 A;  4IWQ A;  2PJH A; 
#chains in the Genus database with same CATH topology
 1Y8R C;  4A8X C;  3PZ7 A;  3AXC A;  2CHW A;  2IGD A;  3H7P A;  2Y5B B;  2FUH B;  1TKG A;  2LFI A;  5GMV A;  1L0V B;  1HZ6 A;  1M4V A;  2J4X A;  4JLC A;  2JRH A;  2FUG 1;  1OEY J;  2N7J A;  3DQV A;  4M0W B;  4GU2 A;  4E74 A;  1L7Y A;  2DNF A;  1G6J A;  3DBL I;  2E3T A;  4JWU C;  4BKS D;  3DDC B;  4B9K A;  4P6V F;  2V0G A;  4GIV A;  4KGR A;  4EZJ A;  4PS8 A;  4IC7 B;  5C1Z A;  4G0N B;  3H9D A;  4UDU C;  4M00 A;  3ZGZ A;  1AN8 A;  5G5H A;  3P4Q B;  3DWM A;  4JGH B;  4WUR A;  2GLS A;  1K8R B;  4KIK A;  2BW2 A;  4RFB A;  4Q2J A;  1TZ1 A;  1Q1O A;  1K51 A;  2IGH A;  4RF0 A;  3A1Q B;  5JXV A;  4DHZ B;  3MFG A;  3MHS D;  4W9L A;  4C7Y A;  3V62 A;  5G2N A;  1FM0 D;  4WJQ A;  3N3K B;  2KK8 A;  2DZI A;  1YX5 B;  1SIF A;  3BWU D;  1TGZ B;  2IPK D;  3VUY A;  3N9Y C;  2LHE A;  1L6V A;  4W9F A;  4GDK A;  2LWP A;  2MLB A;  3GB1 A;  1ZDV A;  4RF1 A;  3Q3M C;  5L83 A;  2M8S A;  2INC C;  1SE9 A;  2JSV X;  4S17 A;  1YD8 U;  2PMV A;  4YSY B;  4FAD A;  4FHJ A;  3R3M A;  1ENF A;  2W55 A;  2MJE A;  4OZB A;  3J9C A;  3GZN B;  3VH3 B;  2HD5 B;  3TEW A;  2BGF A;  4NY0 A;  3Q3N C;  4BKS A;  1FCC C;  3UI3 A;  1WXS A;  4FJZ A;  1SE4 A;  2QJL A;  3QK0 A;  1MVK A;  1L0Y B;  1WRI A;  3PZ8 A;  1PQS A;  3L16 A;  2MP2 A;  3DVG X;  5IP4 D;  1A70 A;  1ZXI A;  5JHB A;  4KZ0 A;  3L13 A;  2KAC A;  3TCA A;  3B9J A;  3HK0 A;  3ZDT A;  3L17 A;  2AL3 A;  2IO2 B;  3PZD A;  4W9I A;  4CHK A;  3SDL C;  3IVF A;  1YJJ A;  2IO1 B;  2KDE B;  4ZRJ A;  2O2V A;  3Q69 A;  4L23 A;  3W2D A;  3W1Y A;  2K9X A;  2NTS A;  4LNO A;  3O13 A;  2C7M B;  2KHW B;  2DEN B;  4AOF A;  3UF8 A;  5J18 A;  3AE2 B;  1BML C;  5HI1 A;  3CF6 E;  1E7U A;  3RFZ B;  3KYC D;  3P4S B;  4KGT A;  1CZP A;  4XZ4 A;  3A4R A;  4NAW B;  1D6E C;  2MHJ A;  5HG2 A;  3V6E B;  3S2A A;  1KOT A;  1JRU A;  3VDZ A;  2KFK B;  2FCM A;  3P1M A;  4AQ7 A;  4WH4 A;  1TY2 A;  5CHV C;  2MBE A;  2LJ5 A;  3ZXR A;  5FK9 C;  2KWV B;  3AE3 B;  1J7C A;  4OHJ A;  1WGK A;  3UIN B;  4AJW A;  1JWA D;  4IM2 A;  4F1S A;  3L4P A;  1WFY A;  1WYW B;  3IG3 A;  2D07 B;  1N61 A;  4HKQ A;  3T3N A;  2KT7 A;  3RI7 C;  4E3C A;  1RFA A;  3RPF C;  1PDX A;  3JW0 X;  3A33 B;  1PGX A;  1WWT A;  1MFW A;  2D3G A;  1L5P A;  2N9X A;  2KX0 A;  3MP9 A;  3T9L A;  4WWO A;  5KHO A;  3GOE A;  3ZNH B;  2NBU A;  1QLB B;  1FD6 A;  5AZG A;  2LGX A;  2BTE A;  3DVN U;  4S0R A;  2BPS A;  3FC4 A;  4H2A A;  1B1Z A;  1PFD A;  2KJ6 A;  4DHJ D;  3APD A;  1KLU D;  1TYG B;  2KZR A;  1AAR A;  3BK2 A;  1KFY B;  5EE1 A;  3OG5 A;  3M3J A;  1H4R A;  1J7B A;  1T0S C;  2WXM A;  1E8W A;  4MGK E;  1QOG A;  3U52 E;  2BQQ A;  3ALB A;  4IWP A;  4DDG D;  4W9H A;  4W9D A;  3DVN V;  3NS8 A;  2D11 A;  4TQ1 A;  1Y56 A;  5DPS A;  1JCK B;  1WF9 A;  1QOF A;  2N0S B;  1L0X B;  1R4M B;  3EFC A;  3AU5 A;  3P63 A;  1K53 A;  2Z0D B;  2N9L A;  4GB9 A;  3DBH B;  1SXT A;  2JXX A;  1QF6 A;  2AQ3 B;  2NMQ A;  4I6N B;  2N7D A;  1ZKH A;  1WMH B;  2QIL A;  1FNW A;  5FR6 A;  3LYY A;  2MW5 A;  3NZU A;  1I4X A;  4KX6 B;  2BWF A;  1OEY A;  1GC7 A;  3TMP B;  1LXD A;  2K8C A;  2MBO A;  3WIM A;  3GE3 C;  2RR9 A;  1WM3 A;  1DGJ A;  1UBQ A;  5FR3 A;  3AE8 B;  3B1L X;  2WP9 B;  1VZ7 A;  4NQK E;  2K0P A;  1P98 A;  3DBH I;  4LJP B;  2H89 B;  1WXA A;  2HJ1 A;  2R2O A;  1ZP0 B;  4RCO A;  1WXV A;  1MHH E;  1WGG A;  3W1S C;  4DXA B;  1JWS D;  5C23 A;  2M1M A;  3GS2 A;  4YSX B;  2GBJ A;  3P42 A;  4YXD B;  3PT2 B;  3W5U B;  1LQB A;  3BYY B;  1HE8 A;  2MBH A;  1A5R A;  1NI2 A;  2HE7 A;  5AUI A;  1NDD A;  2IO0 B;  5CTR C;  3ZRF A;  3Q8C A;  4MM3 B;  2NTT A;  2QCZ A;  3RNG C;  3BII D;  3M95 A;  3NRZ A;  3NG0 A;  1IGD A;  4CYE A;  2OHF A;  1I4Q A;  2BVC A;  2N9E B;  1MJD A;  4AJY B;  3ZVV A;  4TMA B;  4M02 A;  2WYQ A;  1GB4 A;  1SIJ A;  1AWD A;  2CU3 A;  1ROE A;  1D3Z A;  2O6V D;  3E56 A;  1Q0W B;  5GXG B;  3NHE B;  2FIF A;  1GC6 A;  1UWM A;  1GJZ A;  4ZOH C;  2BWE S;  2K3U A;  4J6I A;  2B3A A;  2JVC A;  3PPA A;  4FJV B;  1VD2 A;  1KM7 A;  2M4N A;  4O1N A;  4J3O D;  2EKE C;  2NPT A;  1WI0 A;  2KFJ A;  2GBR A;  3NVV A;  3U7D A;  4HVB A;  1HQR D;  1KF6 B;  3R66 C;  2JWZ A;  3KVF B;  4LJO B;  1JWB D;  2KC1 A;  3MJ5 A;  2XN9 C;  3M62 B;  3QIJ A;  4OVU A;  3TEX A;  2DAJ A;  2ZNV C;  3A9K B;  4N6E B;  1P1A A;  4US9 A;  4AUQ C;  1E9M A;  4ARI A;  3B2G A;  4YWG G;  1I4R A;  3KQ4 A;  1WX8 A;  3BK1 A;  3IAM 1;  5DPW A;  1WXM A;  2GMI C;  4II3 B;  1XLN A;  1HA5 A;  4XE0 A;  1XLO A;  2J53 A;  1YQB A;  4IM0 A;  2DAF A;  3IFW B;  3RD2 A;  4CQN A;  2ZW1 A;  1V1P A;  1FXI A;  1T0Q C;  3IBE A;  2I2Y A;  2CHX A;  4US8 A;  3PLU A;  1WYG A;  5H92 C;  3KUZ A;  3V05 A;  4ANV A;  2WLB A;  2JF5 A;  4W9E A;  2X38 A;  2KLG A;  2G1E A;  2W3S A;  1JW9 D;  1YN5 A;  2PLP A;  2ZCC A;  1JRP A;  3PV1 A;  2RD0 A;  3DBR B;  4FLH A;  4XC2 A;  2R2Q A;  1V1O A;  2XK5 A;  3PRZ A;  4WQM A;  3JSV A;  5E6O A;  2L32 A;  1SB3 C;  2O6V A;  2JZ3 B;  4HDQ A;  3CSF A;  2LHD A;  3FIL A;  4N9F 4;  1TS4 A;  3H6N A;  1NYQ A;  2MJD A;  4MGZ E;  1C4P A;  2J42 A;  3V6C B;  4C80 A;  3P4P B;  2KDF B;  1ESF A;  1WR6 E;  3BIN A;  4WJP A;  3DBL B;  2BYF A;  3X0W A;  2ZNV B;  5CHF A;  4IOI E;  3DBR I;  4C7Z A;  2L0F A;  2G3Q B;  1UWX A;  2AYO B;  1I4G A;  2IBI B;  3I3T B;  2LXA A;  3C8Y A;  2Z0E B;  4EKU A;  1UD7 A;  3ML8 A;  5BMG A;  3AE1 B;  2N9P C;  2G4D B;  5JZE B;  1WJN A;  4WIP A;  2BKR B;  2JRI B;  5C3J B;  4GMV A;  3H7P B;  3VR8 B;  1ZW7 A;  4HCP B;  4MJS A;  2CKH B;  1VZ8 A;  2KDB A;  1TTN A;  5HKH A;  1MPE A;  2JU6 X;  5D2M B;  1TT5 B;  2ZPY A;  4JWS C;  1J8C A;  3U2S C;  4RGN A;  2G45 B;  4MT5 A;  5IAA C;  2NVU I;  4HPP A;  2WU2 B;  1IPG A;  2WXR A;  3ZNZ B;  1SE3 A;  1EUV B;  1SBB B;  4GLS C;  5C2T B;  4IW0 A;  2NR2 A;  4K7S A;  4NAM A;  2KAJ A;  1UGJ A;  1E8Y A;  2HJ8 A;  1JQ4 A;  3JYU A;  1QIL A;  5BYR A;  2EEL A;  2IO3 B;  1RYJ A;  4MGI E;  3I57 A;  2V9H A;  4KIK B;  3Q8B A;  1TS3 A;  4ZRI A;  5EE3 A;  2L3Z A;  2DYM A;  1NEK B;  2JPH A;  3RN9 C;  1YJ1 A;  4EOY A;  4OVZ A;  1L4D B;  4LNF A;  1P3Q U;  4MH8 A;  1FRR A;  5EDS A;  3LXF A;  3AN1 A;  3PTF C;  3TJP A;  4M01 A;  1D5M C;  1WR1 A;  3VTU A;  1V80 A;  4XDD A;  1EF5 A;  2VZK D;  4MAC A;  3NUH B;  3JVZ X;  1T6B X;  1F52 A;  4K1R B;  1CK1 A;  3VXW A;  1EU3 A;  3HHM A;  2J7Q B;  2N1W A;  3PHX B;  2NBW B;  3A9J A;  1RFK A;  2VRR B;  2CS4 A;  4WJN A;  1WY8 A;  3BVG A;  1TKE A;  2YEP F;  2KDI A;  4GN1 A;  2ZZP B;  2WU5 B;  2K39 A;  4GDK B;  2JT4 B;  4RM8 A;  3AM9 A;  2LAS A;  3OJ3 A;  2K22 A;  3E9S A;  5MPO A;  4LLG M;  1IBX A;  2MRP A;  2MCN B;  1BXT A;  2DZM A;  1R7S A;  4E71 A;  2DWQ A;  4BOS C;  1XCQ L;  1C77 A;  3B0A A;  3ZW3 A;  2MX2 A;  2RPV A;  3VHT C;  1VR9 A;  1PUT A;  2LGI A;  3V60 A;  1FO4 A;  3QHT A;  4FN2 A;  4EEW A;  2I1J A;  1J7A A;  4MEL A;  3VUW A;  1N6Z A;  4WWN A;  3WAM A;  3ZRC A;  4ACF A;  2CHZ A;  4JIO U;  1NI3 A;  2QHO A;  3WAN A;  3NZS A;  3U7Z A;  2RMM A;  2SAK A;  3ZO5 B;  4ZDV A;  2MP2 B;  1KTK A;  2IND C;  4ANW A;  2QC8 A;  4K7U A;  1JWU D;  4EZL A;  4AS1 A;  2KC2 A;  3RUI B;  2IGG A;  2A5U A;  1B9R A;  4QAY A;  4G50 A;  1MHX A;  1UH6 A;  1Z5S B;  1ZPS A;  4W9C A;  2FBW B;  1E5W A;  2V4I B;  2O2V B;  5BO4 B;  1GB1 A;  1N5X A;  3PVL A;  2PTL A;  2GI9 A;  2WNM A;  4I6P A;  3RNA C;  1PYW D;  5BYQ A;  2JZP A;  3KUC B;  5AEK B;  1S1Q B;  1HZ5 A;  1DOY A;  4XDC A;  3TSS A;  4AP4 C;  4XWW A;  3OJ4 B;  2BB6 A;  2PE9 A;  1SSN A;  1SJE D;  3VFK A;  3N1X C;  2ASQ A;  1N63 A;  4YL8 A;  3GE8 C;  3Q3J A;  1EU4 A;  5BMH A;  3MC8 A;  4NJC A;  1V8C A;  2GB1 A;  2YVC A;  2D2Q A;  2KN5 A;  1E90 A;  3BY4 B;  3ZJU A;  1MI0 A;  4XGA B;  1F0Z A;  1Q5W B;  3ZNG C;  3WCQ A;  2WXF A;  3NVY A;  3HVZ A;  1VZ6 A;  1TS2 A;  2KWU B;  1L2N A;  1FRD A;  1PGB A;  4PK1 A;  1I4H A;  1IGC A;  5T8I A;  1AW7 A;  1JRO A;  2V4L A;  4W9K A;  5AZF A;  4WWP A;  1V6E A;  1JWM D;  1GAQ B;  2PVG C;  4NJ7 A;  1R4N I;  2C9W B;  2KQ4 X;  5I4D A;  3AEE B;  3ETR A;  3D32 A;  3DWG C;  3L54 A;  4P16 A;  3VRB B;  4WAF A;  1FIQ A;  4TV3 A;  1NVI D;  1FXA A;  2HTH A;  4C00 A;  2KN4 A;  1WX9 A;  3VH4 B;  3B08 A;  4ARC A;  2EMS A;  4ANU A;  2KOX A;  4F7Z A;  4L1B A;  2UU7 A;  3EA6 A;  1STE A;  4A3P A;  3KWL A;  4KSL C;  1UUP A;  2Z8L A;  2IDY A;  2WS3 B;  4II2 B;  4EFO A;  4XWT A;  3I9V 1;  4TUU A;  2D3C A;  2PW9 A;  1QQR A;  1YJI A;  3N20 C;  1F2R C;  3AEB B;  4OZA A;  1SF0 A;  2CJN A;  5HFY A;  2EKI A;  3AMZ A;  4MH0 E;  1FEH A;  2K8H A;  3QX1 A;  1KLG D;  2KMC A;  2BB5 A;  4XX5 A;  2AQ2 B;  5IO9 A;  2ZW0 A;  1TS5 A;  3QCA A;  5J17 A;  2W54 A;  2ZCB A;  2EMT A;  1XLQ A;  4AWJ A;  3EEC A;  5LLI A;  4HEA 1;  5H8Y E;  2KTR A;  3RT3 B;  5JHA A;  1QOB A;  1QZE A;  4NZL B;  4OZC A;  4RGO S;  3UQB A;  2WQY B;  4IG7 B;  2PVO D;  1E8Z A;  3H8H A;  3OWE B;  1QOA A;  4RGM A;  5L95 C;  2ON8 A;  3C19 A;  2L7R A;  5CX3 A;  3SD5 A;  2LGD A;  2LJI A;  3RZF A;  2TSS A;  1F1H A;  5IN7 A;  3HM6 X;  1C4A A;  2WXG A;  1IP9 A;  3ENE A;  1XXG A;  4ANX A;  3DHH C;  2WDT B;  3EUB 2;  3MC9 A;  3R2I A;  4G3X B;  2DZJ A;  1OGW A;  2LVO A;  2LMC A;  1WE6 A;  4DHJ B;  2J0M A;  1EM7 A;  2QSD A;  1WJU A;  2L05 A;  3W5V B;  2KMA A;  2MH7 A;  3MTN B;  2I1K A;  3L08 A;  2BKF A;  2AWT A;  2SEB D;  2AQ1 B;  3IHP C;  3MC0 B;  2UYZ B;  3PO0 A;  4A90 A;  4C4V A;  4YSZ B;  2JZZ A;  3APF A;  2WGS A;  2RDB C;  4B0M A;  4GDL A;  4LNI A;  4KZC A;  3V3X A;  3H7S A;  4K7W A;  3UIP B;  3QA8 A;  3ZTD A;  1HXY D;  5LNK 1;  4FXC A;  3U30 A;  2R61 A;  4BBN C;  2W3R A;  1VDV A;  4BAX A;  4HPM B;  5D7G A;  2AL6 A;  2V3N A;  2BYE A;  3QJZ A;  3RNC C;  3VRA B;  1CQV A;  2E6X A;  2XBB C;  2L76 A;  4JQW C;  2L1A A;  1E7P B;  1EF1 A;  3PLV A;  3T8M A;  2VH2 A;  4HCN B;  3ZTC A;  1OQQ A;  1F2R I;  4RH6 A;  3IT6 B;  2LGY A;  1WGD A;  4DDI D;  3NVW A;  5JH5 C;  3PRP B;  2KAN A;  4GOC A;  2N9K A;  5J2R A;  2QMT A;  4JE3 B;  1JAL A;  2QDF A;  2NPT B;  3AE6 B;  2WXK A;  5DPT A;  4P1C C;  1TJE A;  1XD3 B;  1UNS A;  5D3D A;  2KVR A;  2W82 A;  3ONS A;  3QC8 B;  4LNK A;  2V1Y A;  4HXD A;  1IUE A;  1FFV A;  2CR5 A;  3IAS 1;  3AUL A;  4HRO A;  2MBQ A;  1S3S G;  3APC A;  3M63 B;  2FE8 A;  2IYD B;  2LRU A;  2GBK A;  4K3C A;  3NZ3 A;  1V5T A;  3DHG C;  1WJ6 A;  4PT5 A;  3L10 B;  3QQ8 B;  4ICV A;  1GPX A;  2J0J A;  1LGR A;  3ZYY X;  3FKY A;  2WXJ A;  2RSU A;  1UF0 A;  3DBS A;  4KVG B;  1C79 A;  3AEG B;  4X57 B;  4KDL B;  5D94 A;  1P7F A;  1P0R A;  4IUM B;  2PEA A;  1HTO A;  2YEP B;  3HM3 A;  2C60 A;  1V1P B;  2BYV E;  1E10 A;  4LCD E;  2DYB A;  2JQR B;  2Y5P A;  3ZJV A;  4ICU A;  2KTF A;  4G11 A;  4HWI B;  2X8X X;  1YIW A;  1HTQ A;  4B6W A;  1Z2M A;  3N1Y C;  1N5W A;  3RNE C;  1LM8 B;  4R3D A;  3IT4 B;  3Q6B A;  3HUI A;  1TY0 A;  2XK5 B;  2BT6 A;  3K9O B;  5AUK A;  3JSV B;  4HJG E;  4LNN A;  2O6V B;  4ZRP A;  1FNU A;  3OLM D;  3FIL B;  4MEM A;  1N62 A;  4TQ0 A;  2WDR B;  4M8M A;  5EE9 A;  2RDH A;  2KXJ A;  5BYS A;  2MEK A;  3SHQ A;  1IYF A;  2K6Q A;  3DCG A;  1WGY A;  1SJH D;  1I35 A;  3BVZ A;  4DHZ E;  1CMX B;  1C9F A;  2M56 B;  4PYZ A;  2ACZ B;  1EWY C;  3N32 A;  1YN3 A;  2DYO A;  4A6Q A;  3HIZ A;  3Q14 C;  4URK A;  2KX3 A;  1KJT A;  4DXF A;  2DZK A;  2M0X A;  4M0W A;  2MSE D;  1P7E A;  3RYT A;  2CU1 A;  2WX1 A;  3PHW B;  4ZHO A;  2K5P A;  1T0R C;  2CJO A;  3O65 B;  1SGH A;  3LJ3 A;  1FPY A;  1ZDX A;  2QEJ C;  4WWM A;  4I6L B;  5E6J A;  1SEB D;  1XQQ A;  1J19 A;  3CIR B;  3BVM A;  5G55 A;  4GXB A;  4MJS B;  3TUO A;  2QIE B;  1PGA A;  2FCQ A;  2OED A;  3NVZ A;  4BKT A;  3KW5 B;  4IM3 A;  2H88 B;  2OJW A;  4IDI A;  5G5G A;  4TSS A;  2J52 A;  2INN E;  3HVD A;  3KWV A;  1F77 A;  3TEY A;  2XNA C;  3A1Q A;  1DOI A;  4HDO A;  2N1V A;  1J0G A;  2OOB B;  2D3A A;  2PE6 B;  1TKY A;  3ZJT A;  3BZD B;  4KSK C;  3PS6 A;  1UEL A;  4W9G A;  1AYF A;  3TIX A;  3NJT A;  2L83 A;  4KV2 A;  2L52 A;  1LFD A;  4FA6 A;  1WH3 A;  2YLM A;  3KH0 A;  2G4S A;  4LDT D;  4HRS A;  2OJR A;  1XF5 L;  1BUI C;  3P4R B;  1OFF A;  1I4P A;  5AZH A;  4IWO A;  2FNJ B;  3RNB C;  2BBC A;  3AED B;  2KQS A;  2K8B A;  1TZO A;  2RGF A;  4WQO B;  4A55 A;  4PS7 A;  4BBN F;  2IY0 B;  2I38 A;  1TIF A;  2DX5 B;  3K9P B;  2KLC A;  2KJH B;  3RNF C;  2PKO A;  5E6P A;  3SU8 X;  4ZHP A;  4EE2 A;  3A9J B;  2WXH A;  3ZLZ A;  2BS3 B;  1EO6 A;  3Q8F A;  2GRI A;  1RM6 C;  2ZPN A;  1T0Y A;  1ZOY B;  1C78 A;  3AU4 A;  1IBX B;  1VLB A;  1RAX A;  5D3I B;  3WAO A;  1XLP A;  2W9N A;  5BMI A;  4DWF A;  1E8X A;  3RMK C;  2WDQ B;  1K50 A;  1H8C A;  1OQY A;  1YX6 B;  3P2B A;  3N30 A;  4EUT A;  3LDZ E;  4HK2 A;  2BS2 B;  1V2Y A;  1MG8 A;  1ISN A;  4DK5 A;  4B95 A;  4JX1 C;  2REX A;  3R8B A;  3VTW A;  2ZJD A;  1YOV B;  2KO3 A;  1JML A;  2GOW A;  4ZYS A;  3EC8 A;  1YN4 A;  1E7V A;  2JX5 A;  1CJE A;  4FUL A;  1WGR A;  2KMM A;  2ZEQ A;  3GZN I;  3R7R A;  3R7Q A;  2KQ7 A;  1WE7 A;  2D5G A;  2LEK A;  2WXL A;  3CST A;  4NAW A;  1C76 A;  3AE5 B;  1RRB A;  4PS3 A;  3CMM B;  3RUL A;  3L0W B;  1UZX B;  2AX5 A;  3DOW A;  2LRW A;  3FAH A;  2K1F A;  2KFK A;  1SE2 A;  4DQO C;  1ET9 A;  3VAW A;  2MBB B;  2LUM A;  1R4N B;  2G9H D;  2VZK B;  3VVW B;  4LDT B;  2KYW A;  2BS4 B;  3AE9 B;  2FAZ A;  3SFE B;  2K25 A;  5CHW A;  2HDE A;  1WGH A;  1V9J A;  3AH7 A;  1N60 A;  3WAP A;  4FBJ B;  2WXQ A;  1DOX A;  2LVP A;  2LUE A;  3ZNI D;  4D2K A;  4MDK E;  4DBG A;  4N58 A;  2MJ3 A;  2LZ6 A;  2WX0 A;  4HKZ E;  2KDM A;  1XCT L;  4IKG A;  4EZK A;  1FFU A;  5HHD G;  2KD0 A;  1FXT B;  5LXH A;  2PIA A;  3C0R B;  2JXT A;  2ZVO A;  3W9C B;  2WXP A;  3NOB A;  1GNU A;  3ZIM A;  1GUA B;  3KYD D;  4M8N A;  2INP E;  1XO3 A;  1WRD B;  3VR9 B;  4ASW C;  1I42 A;  1F9J A;  2JYT A;  2KJR A;  3AB5 A;  1ZUD 2;  4ITK A;  1FNV A;  1UGM A;  2LVQ A;  1NYR A;  3DPD A;  4OW0 A;  3AE7 B;  2MA9 B;  3ZDM C;  4DXG A;  3DVG Y;  4NPN A;  2M17 A;  2ZVN A;  4A20 A;  2LI5 A;  1RWS A;  1L4Z B;  2FCN A;  1XT9 B;  4BVU C;  4C56 C;  3V61 A;  1YQ3 B;  2M19 A;  1HEZ E;  5DCN A;  4XYC A;  2JWU A;  1Q10 A;  4MGY E;  1T5X D;  3HRD D;  2GBM A;  2LD9 A;  3PRM B;  3SFD B;  1YMH E;  3QWZ B;  4RNA A;  1XEE A;  2WXN A;  3U4E G;  3X23 A;  3ZUN A;  2L00 B;  3SEB A;  2KWC A;  2WWZ A;  1WMH A;  2GBN A;  3I5J C;  1U4A A;  1V49 A;  3A4S C;  1ACC A;  3DHI C;  5E6N A;  2RPQ A;  4F8C B;  2Z59 B;  4JL9 A;  1C4C A;  1WZ3 A;  3Q8E A;  3CWI A;  2XEW A;  4CO7 A;  3UQA A;  4ZRK A;  2MQJ A;  3AV8 A;  3TL5 A;  3VQI A;  4KKI A;  2N7E A;  2IJ0 A;  1C1Y B;  4YTM B;  4PYU A;  3NS1 A;  2DLB A;  4KKJ A;  2FCS A;  4L2Y A;  4B0E A;  2JYE A;  4K81 A;  2NBV B;  1D4B A;  1R4M I;  1GOZ A;  2L0T A;  3AE4 B;  3ZXV A;  2KTR B;  2B76 B;  3QAQ A;  2C7H A;  3IXS A;  3UGB B;  1TBE A;  1VCB A;  3GP7 A;  3PSE B;  1WXQ A;  4BFR A;  1OTR B;  3BYT B;  1E6E B;  3I63 C;  4MM3 A;  3KUD B;  2N4F A;  1DYQ A;  3RZW C;  3ZQ4 A;  2AEH A;  3N1Z C;  1RLF A;  4LK0 M;  1ZE3 D;  4WJO A;  2FID A;  3MJW A;  4GGQ A;  2K6D B;  3KLS X;  2WHI A;  4OVV A;  5D6J B;  3URY A;  2LXC A;  1V86 A;  3WA0 A;  1K52 A;  3SR6 A;  1EWC A;  4A3O A;  2KNB A;  4MSM B;  2VH1 A;  2C5L C;  4HPL B;  2UWQ A;  4C4V B;  4JPS A;  1KH0 A;  2JUO A;  1D5X C;  1UBI A;  3Q8A A;  3AEF B;  4KDI C;  4GDL B;  3H1U A;  1WZ0 A;  2V3S A;  2IY1 B;  1WJ4 A;  4KGS A;  1QKZ A;  1D5Z C;  3W1S A;  1VJK A;  5FKA C;  1YQ4 B;  2Q5W D;  4FHK A;  3PRE A;  2ICI A;  4BZA A;  2KKC A;  2NS5 A;  5LXI B;  2J0K A;  2DBY A;  4HJK A;  1V5O A;  3PGE A;  1L6U A;  3A9K A;  1MG4 A;  4P7I A;  4ZYN A;  4HLE A;  1BT0 A;  1X1M A;  2BF8 B;  1YNT E;  4A9A A;  4NNJ B;  1FCL A;  2JY6 A;  2HTM E;  1ZXH A;  4GSW A;  3R2T A;  1M94 A;  2WXO A;  3ZKJ C;  4BOZ B;  2ONQ A;  5TR5 A;  1NBF C;  2L8J A;  2V3P A;  3Q2A C;  4YTP B;  3AI5 A;  2KWD A;  3ECI A;  1WX7 A;  4FJY A;  2WDV B;  3U8Z A;  2C7N B;  4RGT A;  2LGS A;  3QAR A;  3AEA B;  3EFU A;  4N59 A;  2M0A A;  4RMA A;  1KLV A;  1V97 A;  3ABV B;  5IA7 A;  3VTV A;  1ZGU B;  2IZV B;  4YTN B;  3TBL D;  1KRH A;  1FMA D;  5DPR A;  1QT9 A;  3T3O A;  1C3T A;  1V81 A;  4BKG A;  1T3Q A;  4YT0 B;  2D10 A;  1I7H A;  3RCZ A;  4RM9 A;  3B2F A;  3EHV A;  3UIO B;  4REZ A;  3Q3F A;  1WSP A;  2NCN A;  2DHZ A;  3OAW A;  2RDG A;  1WIA A;  1P9D U;  4NQL B;  3NY5 A;  4W9J A;  1WM2 A;  5EE0 A;  2KVZ A;  5KHQ A;  3EGR A;  4USA A;  5IOI A;  2A4Z A;  3VUX A;  3LB8 C;  1NEN B;  4K3B A;  4WAA A;  1GG3 A;  3Q3O C;  2Y5C A;  3ML9 A;  1VRA B;  4MSQ B;  4P1B C;  5IKC M;  2MWS B;  2BYT A;  2D3B A;  2Y3A A;  1OQR A;  4TKN A;  1E0Z A;  3MHZ A;  4NJ6 A;  3WAL A;  5TSS A;  4LTU A;  2WXI A;  4ZRQ A;  1ET6 A;  2PPH A;  1LO5 D;  3AEC B;  4IWQ A;  2PJH A;  3TEZ A; 
#chains in the Genus database with same CATH homology
 1Y8R C;  2EMS A;  2FIF A;  4ANU A;  4DWF A;  2KOX A;  1GC6 A;  3AXC A;  4F7Z A;  1E8X A;  1GJZ A;  2CHW A;  3H7P A;  2Y5B B;  2FUH B;  2BWE S;  4J6I A;  2B3A A;  2JVC A;  3PPA A;  4FJV B;  5GMV A;  4A3P A;  1VD2 A;  4KSL C;  1KM7 A;  1H8C A;  2M4N A;  1OQY A;  1YX6 B;  2EKE C;  3P2B A;  3N30 A;  4EUT A;  3LDZ E;  4HK2 A;  2NPT A;  1WI0 A;  4JLC A;  1V2Y A;  2KFJ A;  1MG8 A;  2JRH A;  4II2 B;  2GBR A;  1OEY J;  1ISN A;  3DQV A;  4M0W B;  4DK5 A;  4EFO A;  4GU2 A;  3U7D A;  4B95 A;  4E74 A;  4HVB A;  2REX A;  3R66 C;  1L7Y A;  2JWZ A;  2ZJD A;  3VTW A;  4TUU A;  1G6J A;  2KO3 A;  3DBL I;  2GOW A;  3KVF B;  3EC8 A;  4LJO B;  1E7V A;  2KC1 A;  4BKS D;  3DDC B;  4B9K A;  3M62 B;  4FUL A;  1WGR A;  3QIJ A;  4OVU A;  2ZEQ A;  3GZN I;  3R7R A;  2DAJ A;  4GIV A;  3R7Q A;  2KQ7 A;  1WE7 A;  2ZNV C;  4EZJ A;  3A9K B;  4PS8 A;  4IC7 B;  1P1A A;  4MH0 E;  5C1Z A;  2K8H A;  4G0N B;  3QX1 A;  4AUQ C;  3H9D A;  2KMC A;  3CST A;  1WX8 A;  4NAW A;  4XX5 A;  1RRB A;  4PS3 A;  3CMM B;  3RUL A;  3QCA A;  1WXM A;  1UZX B;  3L0W B;  5J17 A;  5DPW A;  4JGH B;  3DOW A;  1K8R B;  2GMI C;  2LRW A;  2ZCB A;  4II3 B;  4KIK A;  2EMT A;  2K1F A;  4AWJ A;  3EEC A;  2KFK A;  1YQB A;  1TZ1 A;  5LLI A;  1Q1O A;  4IM0 A;  2DAF A;  3IFW B;  3RD2 A;  2KTR A;  3RT3 B;  5JHA A;  3NHE B;  3IBE A;  2CHX A;  1QZE A;  3VAW A;  3PLU A;  2MBB B;  3KUZ A;  4ANV A;  3UQB A;  4IG7 B;  3VVW B;  4LDT B;  3A1Q B;  2JF5 A;  4W9E A;  2KLG A;  1E8Z A;  4DHZ B;  3MHS D;  5L95 C;  2FAZ A;  2L7R A;  4W9L A;  5CX3 A;  2K25 A;  3SD5 A;  2LGD A;  5CHW A;  3RZF A;  3V62 A;  5G2N A;  1WGH A;  1V9J A;  2ZCC A;  3HM6 X;  1IP9 A;  3PV1 A;  2RD0 A;  3ENE A;  4WJQ A;  3WAP A;  4ANX A;  4FLH A;  4FBJ B;  2LVP A;  3N3K B;  2KK8 A;  4XC2 A;  2DZI A;  1YX5 B;  2LUE A;  1SIF A;  2R2Q A;  2WDT B;  3ZNI D;  4MDK E;  4DBG A;  1TGZ B;  2XK5 A;  3PRZ A;  3JSV A;  3VUY A;  2LZ6 A;  2WX0 A;  5E6O A;  4G3X B;  2O6V A;  2JZ3 B;  4W9F A;  2DZJ A;  4HDQ A;  1OGW A;  2LVO A;  4GDK A;  3CSF A;  4EZK A;  1WE6 A;  2LWP A;  4DHJ B;  2MLB A;  4N9F 4;  3H6N A;  2J0M A;  2KD0 A;  4MGZ E;  1FXT B;  5LXH A;  1WJU A;  3C0R B;  2M8S A;  5L83 A;  3V6C B;  2ZVO A;  1SE9 A;  2L05 A;  1YD8 U;  3NOB A;  1GNU A;  4FAD A;  2KMA A;  2KDF B;  3MTN B;  2I1K A;  3BIN A;  1WR6 E;  3ZIM A;  3L08 A;  4FHJ A;  1GUA B;  3KYD D;  2BYF A;  4WJP A;  2BKF A;  3X0W A;  2ZNV B;  4M8N A;  3R3M A;  2AWT A;  3IHP C;  2UYZ B;  1WRD B;  2JZZ A;  5CHF A;  4ASW C;  1I42 A;  3APF A;  1F9J A;  2KJR A;  3DBR I;  4GDL A;  3VH3 B;  2HD5 B;  4KZC A;  2L0F A;  3H7S A;  4K7W A;  3UIP B;  2BGF A;  2G3Q B;  1UGM A;  3QA8 A;  2AYO B;  3ZTD A;  2LVQ A;  4NY0 A;  3DPD A;  4BKS A;  2IBI B;  3U30 A;  2MA9 B;  3I3T B;  3ZDM C;  4BBN C;  1WXS A;  3DVG Y;  2LXA A;  4HPM B;  2Z0E B;  4FJZ A;  2AL6 A;  4NPN A;  5D7G A;  1UD7 A;  2BYE A;  3ML8 A;  2M17 A;  4EKU A;  2ZVN A;  3QJZ A;  3QK0 A;  4A20 A;  2LI5 A;  2N9P C;  2XBB C;  2L76 A;  4JQW C;  1PQS A;  1EF1 A;  3L16 A;  2FCN A;  3PLV A;  3T8M A;  2G4D B;  1XT9 B;  2MP2 A;  4HCN B;  4BVU C;  3DVG X;  3ZTC A;  3V61 A;  5JZE B;  5JHB A;  4KZ0 A;  3L13 A;  5DCN A;  3TCA A;  1WJN A;  3HK0 A;  2BKR B;  2LGY A;  4MGY E;  1WGD A;  3L17 A;  3ZDT A;  2GBM A;  2AL3 A;  2LD9 A;  4DDI D;  2JRI B;  2IO2 B;  3PRM B;  3PZD A;  4W9I A;  4CHK A;  3SDL C;  3IVF A;  4GMV A;  3H7P B;  5JH5 C;  2IO1 B;  1ZW7 A;  2KDE B;  3PRP B;  3QWZ B;  4HCP B;  2KAN A;  4ZRJ A;  4MJS A;  2O2V A;  4GOC A;  2CKH B;  5J2R A;  3X23 A;  3ZUN A;  2KDB A;  2L00 B;  1TTN A;  3W1Y A;  2KWC A;  2WWZ A;  1WMH A;  2GBN A;  2NPT B;  5D2M B;  5HKH A;  2ZPY A;  1J8C A;  1U4A A;  2C7M B;  1V49 A;  3A4S C;  5DPT A;  2KHW B;  2G45 B;  2DEN B;  4AOF A;  3UF8 A;  1XD3 B;  5E6N A;  2RPQ A;  4F8C B;  2KVR A;  3QC8 B;  3ONS A;  5J18 A;  5IAA C;  2V1Y A;  4HXD A;  2CR5 A;  2NVU I;  2Z59 B;  2MBQ A;  3AUL A;  4JL9 A;  1WZ3 A;  1S3S G;  3APC A;  3M63 B;  2XEW A;  1IPG A;  4CO7 A;  2IYD B;  2LRU A;  3ZNZ B;  3UQA A;  4ZRK A;  1EUV B;  3CF6 E;  2MQJ A;  2GBK A;  1E7U A;  3KYC D;  3TL5 A;  3VQI A;  2N7E A;  1V5T A;  4IW0 A;  2NR2 A;  1WJ6 A;  4K7S A;  3L10 B;  1C1Y B;  1E8Y A;  2HJ8 A;  4PYU A;  4XZ4 A;  3QQ8 B;  4ICV A;  3A4R A;  3JYU A;  2J0J A;  4NAW B;  2IO3 B;  2RSU A;  2FCS A;  3DBS A;  4MGI E;  3V6E B;  4KVG B;  4X57 B;  4K81 A;  4KDL B;  4KIK B;  2NBV B;  4ZRI A;  3S2A A;  1KOT A;  5D94 A;  1JRU A;  3VDZ A;  1P0R A;  2KFK B;  1R4M I;  2FCM A;  2L0T A;  4IUM B;  2PEA A;  2L3Z A;  2DYM A;  2KTR B;  3HM3 A;  2JPH A;  2C60 A;  2BYV E;  5CHV C;  3QAQ A;  2MBE A;  1YJ1 A;  2LJ5 A;  4EOY A;  2C7H A;  2KWV B;  3UGB B;  1P3Q U;  1TBE A;  4LCD E;  1VCB A;  3UIN B;  4AJW A;  5EDS A;  2DYB A;  3PSE B;  3PTF C;  4IM2 A;  4ICU A;  4F1S A;  3TJP A;  1WFY A;  1WYW B;  4BFR A;  2KTF A;  2D07 B;  3IG3 A;  1OTR B;  1WR1 A;  4G11 A;  4HWI B;  3VTU A;  1V80 A;  1EF5 A;  4MM3 A;  1YIW A;  3KUD B;  1RFA A;  2N4F A;  4E3C A;  4B6W A;  3JVZ X;  1Z2M A;  3JW0 X;  4K1R B;  3A33 B;  3RZW C;  1LM8 B;  2AEH A;  3VXW A;  3HHM A;  2J7Q B;  1RLF A;  4WJO A;  2FID A;  2D3G A;  2N1W A;  2N9X A;  2KX0 A;  3PHX B;  2NBW B;  2XK5 B;  3A9J A;  3K9O B;  3MJW A;  2VRR B;  2CS4 A;  3T9L A;  4WJN A;  1WY8 A;  3JSV B;  4WWO A;  4GGQ A;  2K6D B;  2KDI A;  5KHO A;  3GOE A;  4GN1 A;  4OVV A;  5D6J B;  3ZNH B;  2NBU A;  2O6V B;  2ZZP B;  2K39 A;  3OLM D;  4GDK B;  2JT4 B;  2LXC A;  4RM8 A;  1V86 A;  3WA0 A;  2LAS A;  3OJ3 A;  4MEM A;  5AZG A;  4TQ0 A;  2LGX A;  4M8M A;  3DVN U;  4A3O A;  2BPS A;  2KNB A;  2KXJ A;  4MSM B;  2MRP A;  2MCN B;  2DZM A;  3SHQ A;  1IYF A;  2K6Q A;  2KJ6 A;  1WGY A;  3DCG A;  4DHJ D;  3APD A;  4E71 A;  1I35 A;  4BOS C;  2C5L C;  4HPL B;  2UWQ A;  4DHZ E;  3B0A A;  3ZW3 A;  2JUO A;  2MX2 A;  1CMX B;  3VHT C;  1UBI A;  4PYZ A;  4KDI C;  2KZR A;  3V60 A;  4GDL B;  1AAR A;  3H1U A;  3N32 A;  1WZ0 A;  3QHT A;  4FN2 A;  2DYO A;  4EEW A;  3M3J A;  2I1J A;  3HIZ A;  4URK A;  1H4R A;  2KX3 A;  1KJT A;  2V3S A;  4MEL A;  2IY1 B;  1WJ4 A;  4WWN A;  2DZK A;  2M0X A;  3VUW A;  2CHZ A;  3WAM A;  3ZRC A;  2MSE D;  4JIO U;  4MGK E;  1E8W A;  3RYT A;  2CU1 A;  3W1S A;  2QHO A;  3WAN A;  3ALB A;  2WX1 A;  4IWP A;  3PHW B;  4DDG D;  4W9H A;  4W9D A;  3NZS A;  4FHK A;  3DVN V;  3PRE A;  3NS8 A;  2KKC A;  2NS5 A;  2D11 A;  4TQ1 A;  5LXI B;  3O65 B;  2J0K A;  5DPS A;  1SGH A;  3ZO5 B;  3LJ3 A;  4ZDV A;  1WF9 A;  2MP2 B;  4HJK A;  1V5O A;  3PGE A;  4ANW A;  3AU5 A;  4K7U A;  3A9K A;  4EZL A;  4P7I A;  4ZYN A;  2KC2 A;  4HLE A;  2Z0D B;  3RUI B;  1BT0 A;  1X1M A;  2BF8 B;  2A5U A;  4I6L B;  4NNJ B;  4G50 A;  1UH6 A;  1XQQ A;  1J19 A;  1Z5S B;  4GB9 A;  4W9C A;  1E5W A;  2JXX A;  5G55 A;  4GXB A;  2JY6 A;  2O2V B;  4MJS B;  5BO4 B;  4GSW A;  4I6N B;  2N7D A;  1ZKH A;  1M94 A;  2FCQ A;  3ZKJ C;  4BOZ B;  1WMH B;  5TR5 A;  1NBF C;  5FR6 A;  4BKT A;  3KW5 B;  4IM3 A;  2L8J A;  3PVL A;  4I6P A;  2MW5 A;  3NZU A;  3AI5 A;  3KUC B;  3ECI A;  1WX7 A;  5AEK B;  4FJY A;  1S1Q B;  2BWF A;  1OEY A;  3U8Z A;  2C7N B;  1GC7 A;  3A1Q A;  3TMP B;  4AP4 C;  1LXD A;  2K8C A;  2MBO A;  3WIM A;  3OJ4 B;  2RR9 A;  3QAR A;  1WM3 A;  2N1V A;  2PE9 A;  3EFU A;  4HDO A;  1J0G A;  2OOB B;  3VFK A;  1UBQ A;  2PE6 B;  4RMA A;  2ASQ A;  1KLV A;  3B1L X;  4KSK C;  5IA7 A;  3VTV A;  3PS6 A;  1UEL A;  4NQK E;  1ZGU B;  2IZV B;  1P98 A;  3TBL D;  4W9G A;  3DBH I;  4YL8 A;  3Q3J A;  4LJP B;  1WXA A;  2R2O A;  3TIX A;  4KV2 A;  1LFD A;  1WXV A;  1WH3 A;  1WGG A;  5DPR A;  4FA6 A;  3W1S C;  2YVC A;  4DXA B;  2D2Q A;  2KN5 A;  2YLM A;  3KH0 A;  1C3T A;  1V81 A;  1E90 A;  2G4S A;  3BY4 B;  4LDT D;  5C23 A;  4BKG A;  2OJR A;  2M1M A;  2D10 A;  1Q5W B;  2GBJ A;  3ZNG C;  3RCZ A;  3PT2 B;  5AZH A;  4RM9 A;  2KWU B;  4IWO A;  1LQB A;  3EHV A;  3UIO B;  2FNJ B;  1HE8 A;  3Q3F A;  1L2N A;  2MBH A;  2DHZ A;  1NI2 A;  2HE7 A;  2NCN A;  3OAW A;  1A5R A;  1NDD A;  1WIA A;  1P9D U;  4NQL B;  3NY5 A;  2KQS A;  4W9J A;  1WM2 A;  2IO0 B;  2K8B A;  2V4L A;  4W9K A;  5CTR C;  5AZF A;  4WWP A;  1V6E A;  2RGF A;  4WQO B;  3ZRF A;  4PS7 A;  4BBN F;  2IY0 B;  5KHQ A;  2DX5 B;  2A4Z A;  3VUX A;  3M95 A;  3K9P B;  4NJ7 A;  2KLC A;  1R4N I;  4CYE A;  2KJH B;  4WAA A;  2C9W B;  5E6P A;  3SU8 X;  1GG3 A;  3A9J B;  3D32 A;  2N9E B;  3ML9 A;  3ZLZ A;  4AJY B;  3L54 A;  1EO6 A;  3ZVV A;  4MSQ B;  4TV3 A;  2WYQ A;  2MWS B;  1T0Y A;  2ZPN A;  4TKN A;  3AU4 A;  4NJ6 A;  2HTH A;  3WAL A;  1WX9 A;  1RAX A;  3WAO A;  1D3Z A;  2O6V D;  3VH4 B;  2W9N A;  1Q0W B;  2PPH A;  3B08 A;  4IWQ A;  2PJH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...