3VXWA

Crystal structure of saccharomyces cerevisiae atg8 complexed with atg32 aim
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
111
structure length
111
Chain Sequence
KSTFKSEYPFEKRKAESERIADRFKNRIPVICEKAEKSDIPEIDKRKYLVPADLTVGQFVYVIRKRIMLPPEKAIFIFVNDTLPPTAALMSAIYQEHKDKDGFLYVTYSGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Autophagy-related protein 32 acts as autophagic degron and directly initiates mitophagy
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
molecule keywords Autophagy-related protein 8
total genus 32
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2012-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3vxwA00
1E7VA 1WMHA 1WZ3A 4TQ1A 2CHWA 1H8CA 4K81A 1PQSA 2BWES 4HPMB 3L54A 2K25A 2C7MB 2FCSA 4NQLB 3V6CB 3VUWA 2L3ZA 2PE6B 2BYEA 3PV1A 4KVGB 2OJRA 2AYOB 3QK0A 3W1SC 5JH5C 4NAWA 4HDOA 1WGRA 3CSFA 2FNJB 3SU8X 5AZHA 4IWQA 1E8ZA 2GBRA 2NPTA 2PE9A 4GN1A 3M3JA 2HD5B 2LXCA 3NY5A 2BYVE 3PHWB 4M8NA 3RCZA 4FJVB 2CU1A 3MHSD 2KJHB 3ZTDA 4HDQA 3ML9A 1GUAB 2I1KA 3PSEB 3H7SA 2FAZA 3AULA 1J0GA 2LVPA 2KMCA 5HKHA 5AZGA 3VAWA 2M17A 4IWPA 2JVCA 3IVFA 1E7UA 1WXSA 4JLCA 4B6WA 2O6VD 1OQYA 3OJ4B 2XBBC 1NI2A 1V86A 2KTRB 4CO7A 3AU5A 2R2OA 2KDIA 3PLVA 2M8SA 4W9DA 2BWFA 1VCBA 3B08A 1RRBA 1WJ6A 1WFYA 2KDEB 2O6VB 3A9JB 2M4NA 3WALA 1XQQA 2LI5A 3IBEA 3DPDA 3PPAA 3X23A 4RMAA 2KANA 2ZCCA 3A4RA 2CR5A 2CHZA 2OOBB 4K7WA 1J8CA 2MA9B 3D32A 2DX5B 1GNUA 4W9LA 5AZFA 1EUVB 1Z5SB 5LXIB 4HJKA 2CKHB 4JL9A 3QARA 2WX0A 2K8CA 3H7PB 3QJZA 2LVQA 2WWZA 3T9LA 4W9GA 4IUMB 4BOSC 1C3TA 5DPWA 3CF6E 4G50A 4B95A 4NNJB 4PYZA 3WIMA 1E5WA 3QQ8B 2MSED 3L08A 1C1YB 3N3KB 5D94A 3QA8A 4KZ0A 4TKNA 3GOEA 2N9PC 3BY4B 4E74A 1RAXA 4W9JA 2KDBA 2GBNA 3PT2B 1SIFA 4FLHA 3NS8A 4KIKA 3NHEB 3UQBA 3H7PA 1WJUA 2EMTA 3GZNI 5CHFA 4KDIC 4DHZE 1OEYA 4GU2A 2WDTB 3IFWB 1ZGUB 1GC6A 2BF8B 4DHJB 3V62A 5TR5A 4BKGA 4MM3A 3ZO5B 2NBUA 2DYMA 5E6OA 4ASWC 3LJ3A 3PRMB 4KIKB 4AWJA 3A9KB 3JSVA 3K9PB 3UGBB 2B3AA 3EFUA 4W9KA 3ZTCA 3R66C 3QWZB 1A5RA 4LJOB 3DQVA 3QIJA 3PHXB 3TBLD 4DDID 4HWIB 2DYBA 4PYUA 1IYFA 4RM9A 3A33B 4A3PA 2C7NB 3DVNU 2GBKA 2IO1B 4ICVA 3RULA 2MCNB 1GG3A 3H1UA 4GDKA 2NR2A 1WIAA 3KYCD 4XX5A 2J0MA 1YIWA 4IM3A 2BYFA 4XC2A 4MSQB 4EFOA 4FJYA 2LUEA 2MRPA 2CHXA 2RGFA 5C23A 4DHZB 3DVGY 2FCMA 5LXHA 4NJ6A 1QZEA 1FXTB 4W9EA 2DYOA 4HCNB 1ZKHA 3WANA 4MELA 5CHVC 4EZKA 4JIOU 2GMIC 4NAWB 4DDGD 4GDKB 2A5UA 2HE7A 3OLMD 3PLUA 2D2QA 4DXAB 2JUOA 4LDTB 1LXDA 3VTWA 2LZ6A 1Y8RC 1WYWB 1Q5WB 2JRIB 3PTFC 2MWSB 3HM6X 2IO0B 2ZVNA 1P0RA 4WJPA 1MG8A 2LD9A 2LRUA 2ZPNA 3ZRFA 4IG7B 2Z0DB 3PRPB 2GBMA 2O6VA 1WX9A 1WGYA 2KK8A 5E6NA 2A4ZA 1S3SG 1UD7A 2R2QA 3UINB 2HJ8A 3EC8A 2KWVB 4WQOB 3X0WA 2IZVB 3ZRCA 2NCNA 5JZEB 3W1SA 5DPSA 3KUZA 2C5LC 3ZW3A 2K8HA 4K7UA 1UGMA 3RD2A 2FIFA 3R7QA 3UQAA 4CYEA 4TUUA 1KM7A 3PREA 5D6JB 2KNBA 1WXAA 4WWPA 2KXJA 2KKCA 3IG3A 4JGHB 4URKA 5DPRA 2KJ6A 2G4SA 3DDCB 2V1YA 4OVVA 3UIOB 2ZZPB 5IA7A 2FUHB 3DBHI 2K1FA 3M63B 4FULA 3VQIA 5D7GA 3ZLZA 1LFDA 3KW5B 4ICUA 4NQKE 3LDZE 4WWNA 2N9XA 4FADA 2DHZA 2ASQA 1JRUA 2DZJA 1OTRB 2UWQA 2K39A 2KN5A 2Z0EB 4GDLB 4FA6A 2GBJA 4JQWC 5E6PA 1V2YA 2KQ7A 2G4DB 2L8JA 1P9DU 3VHTC 2LXAA 2L05A 3HIZA 4II2B 3TL5A 2RSUA 2LGDA 3N30A 2JXXA 2MP2A 4ANWA 1GC7A 2GOWA 3M95A 2KQSA 2WX1A 3PRZA 3TCAA 2N1WA 1WRDB 3Q3JA 1X1MA 3UF8A 5EDSA 2AWTA 3QC8B 3WAMA 1L7YA 3MTNB 4MGYE 3RT3B 2L0FA 5AEKB 4ZYNA 2O2VB 3I3TB 3DBRI 3IHPC 2DZMA 4TV3A 4BBNC 1V80A 3EECA 3DCGA 1WZ0A 2KOXA 2KWCA 3L10B 3HK0A 4W9CA 2MBHA 3ZUNA 3DOWA 3KUCB 2BKFA 2AL6A 2N1VA 1OEYJ 4PS7A 2KMAA 2ZPYA 2JF5A 4GDLA 4RM8A 3S2AA 3ZNID 2C7HA 4IWOA 4YL8A 4EOYA 1V5OA 2KZRA 4ZRKA 3U8ZA 3DVGX 1GJZA 2RR9A 2M1MA 4BKSD 1WF9A 1YQBA 1E90A 4BBNF 1UBQA 1XD3B 2FCNA 2K6DB 3MJWA 3W1YA 2V3SA 1OGWA 4MJSA 4AP4C 2D07B 4PS8A 3L13A 1U4AA 3A1QA 1ISNA 1D3ZA 4GIVA 2IBIB 2KX0A 3JW0X 2ZVOA 1WM2A 2JPHA 4HVBA 3HM3A 1WGHA 1WJNA 3ZDTA 3P2BA 3U7DA 1TTNA 1M94A 2VRRB 4G0NB 2D3GA 4ZRJA 3VUXA 4II3B 4F7ZA 5CTRC 4KDLB 1E8YA 5J18A 4FHKA 2FCQA 2KFJA 2N4FA 1LQBA 3APCA 3JYUA 3L16A 3SD5A 4KSLC 2KD0A 4FBJB 3M62B 2JRHA 4WAAA 5G2NA 4E71A 2LASA 3R7RA 4W9IA 1UH6A 3SHQA 2XK5A 1R4MI 3AXCA 4N9F4 2ZNVB 4FHJA 2MQJA 3DBSA 3OJ3A 4KZCA 1TZ1A 2G45B 4GB9A 2ZNVC 2NS5A 1WE6A 4I6LB 1WM3A 3L0WB 3NOBA 3RZWC 2NBVB 2BPSA 2DAJA 3Q3FA 3A4SC 1K8RB 4ZDVA 4B9KA 2J7QB 1L2NA 4M8MA 3TIXA 3ML8A 4A20A 4MGZE 2L7RA 2MLBA 1V6EA 2LWPA 3A1QB 4CHKA 3L17A 2I1JA 3VXWA 4W9HA 4BOZB 3BINA 2REXA 3DBLI 1V81A 4GGQA 3ZDMC 3RZFA 4HLEA 2IY1B 5G55A 1H4RA 4ANVA 1WGGA 3C0RB 1KJTA 2IO3B 1HE8A 2EMSA 4KSKC 1S1QB 2NBWB 4EKUA 3WAOA 4MJSB 1WE7A 1SE9A 2DZIA 3PGEA 4W9FA 3RUIB 4BKTA 4BVUC 4E3CA 1YX6B 2IY0B 4HXDA 3H9DA 4HK2A 3AI5A 4DHJD 2Z59B 3RYTA 2UYZB 2KVRA 4G11A 4DBGA 4NPNA 1I35A 3ALBA 3PS6A 1EO6A 2ZCBA 4ANXA 5KHOA 4ANUA 1Q1OA 3ECIA 4NJ7A 1J19A 2YLMA 4ZRIA 3DVNV 2ZJDA 2G3QB 4GOCA 4WJOA 2LGYA 4WJQA 2LGXA 1WY8A 1V5TA 1XT9B 1NDDA 1R4NI 2Y5BB 3PZDA 2RD0A 2O2VA 2KFKB 3HHMA 2LJ5A 1EF1A 4WWOA 3O65B 4AJWA 4OVUA 3KUDB 1P98A 2KLCA 2PEAA 3VVWB 4EZLA 3V60A 1KOTA 3JSVB 3WAPA 2QHOA 3KVFB 1IP9A 2IO2B 3SDLC 3VH3B 1VD2A 1IPGA 1UBIA 2J0KA 2MW5A 1TGZB 4KV2A 2D11A 4F8CB 3QAQA 2M0XA 2DENB 2MX2A 3CMMB 4K7SA 4NY0A 4EUTA 4AUQC 5FR6A 4XZ4A 4AJYB 3ZVVA 2KWUB 3UIPB 4AOFA 1V49A 2MP2B 5DCNA 2JY6A 5IAAC 3VDZA 2KTFA 3VUYA 3ZKJC 3U30A 1F9JA 1NBFC 2L0TA 1KLVA 2MBEA 4LJPB 2KDFB 2L76A 1AARA 1UZXB 4IC7B 4X57B 3WA0A 5CX3A 1UELA 2XK5B 3EHVA 2MBOA 3PVLA 3ZNHB 2PJHA 2KFKA 3QX1A 2DZKA 4TQ0A 2EKEC 2JZZA 2N7DA 3TJPA 2KTRA 3K9OB 3KH0A 2V4LA 2L00B 3A9KA 2KO3A 2N9EB 4I6NB 2KC1A 4G3XB 3VH4B 1RLFA 4A3OA 2JWZA 5KHQA 3VTVA 4MSMB 2PPHA 5BO4B 1I42A 3ONSA 2HTHA 1P3QU 1WR1A 3JVZX 2BKRB 2C9WB 4EEWA 4BFRA 1YX5B 2LRWA 2DAFA 3CSTA 2K8BA 2C60A 5L95C 2KX3A 4FJZA 2AEHA 4MH0E 5CHWA 5D2MB 2MBBB 3KYDD 3VFKA 2IYDB 3NZUA 4F1SA 5L83A 1WXVA 1WI0A 4K1RB 1E8XA 1T0YA 1SGHA 4MDKE 1Z2MA 1BT0A 4HCPB 3VTUA 2FIDA 3N32A 4IM0A 3TMPB 2BGFA 4LDTD 1CMXB 4I6PA 4LCDE 2WYQA 3ZNGC 5J2RA 1ZW7A 4GMVA 4DWFA 4BKSA 2YVCA 2D10A 4IM2A 3AU4A 2KLGA 1WR6E 4MGKE 4HPLB 1WGDA 4MEMA 1WX8A 2ZEQA 2NVUI 1P1AA 1V9JA 1Q0WB 2NPTB 4FN2A 5DPTA 3V61A 3QCAA 2JZ3B 4WJNA 1WXMA 2K6QA 1YD8U 1YJ1A 2LVOA 2XEWA 3B0AA 4MGIE 2CS4A 3APFA 5JHAA 3A9JA 1TBEA 1E8WA 3ENEA 4GSWA 4PS3A 2J0JA 2N7EA 3ZIMA 2KJRA 1WMHB 2RPQA 4EZJA 2W9NA 5LLIA 3NZSA 5JHBA 2JT4B 2KC2A 3H6NA 4J6IA 1WH3A 3B1LX 1WJ4A 4GXBA 1WX7A 3APDA 3T8MA 1RFAA 4P7IA 5J17A 1EF5A 3OAWA 3R3MA 1LM8B 5GMVA 5C1ZA 4M0WB 1G6JA 2KHWB 3ZNZB 4DK5A 3QHTA 2AL3A 2MBQA 4IW0A 3V6EB
chains in the Genus database with same CATH superfamily
2BQQA 3LXFA 1DGJA 2FCSA 4C56C 2PW9A 3PV1A 2SAKA 2OJRA 3W1SC 4HDOA 2J52A 1WGRA 3CSFA 3GE8C 1VDVA 2NPTA 4GN1A 4YTNB 3RCZA 1V1OA 3MHSD 2QEJC 3RNAC 1TS4A 3Q2AC 3H7SA 2CU3A 1HZ5A 2KMMA 2KMCA 3VAWA 2LJIA 2K22A 2M17A 3P42A 4NAMA 2JSVX 4OHJA 1JQ4A 1YQ4B 2OEDA 1OQYA 4QAYA 2XBBC 4CO7A 4YTMB 4RH6A 2R2OA 3FILA 2KDIA 1VZ8A 2M4NA 3WALA 2LI5A 3X23A 3AE9B 3EFCA 2CR5A 2OOBB 2MA9B 3D32A 4C7YA 5LXIB 4HJKA 3QARA 2WX0A 2K8CA 3H7PB 3QJZA 4BOSC 4W9GA 3CF6E 4G50A 3AE2B 4Q2JA 5AUKA 3QQ8B 3L08A 3WCQA 3GOEA 4LTUA 2N9PC 3W5UB 1C77A 1SIFA 1F2RI 4KIKA 3NHEB 3L4PA 3IFWB 2VZKB 2JYEA 3V62A 1JWBD 2DYMA 4ASWC 5G5HA 3PRMB 4KIKB 4M02A 4AWJA 3K9PB 2PLPA 1WRIA 3R66C 1A5RA 3QIJA 3PHXB 4RGTA 4A3PA 1R4NB 2GBKA 2IO1B 2MCNB 2NR2A 1WIAA 4XX5A 1YIWA 4IM3A 1FD6A 1IUEA 4FJYA 2CHXA 4YSZB 5LXHA 2FCMA 3ZJVA 4K3CA 3NUHB 1F52A 2MH7A 4HCNB 1T3QA 2J53A 1BUIC 2WXLA 3VTWA 2NMQA 3UI3A 5H92C 4C00A 2IO0B 5G5GA 2ZVNA 1P0RA 2LD9A 1WGKA 3Q8CA 2QILA 2Z0DB 3PRPB 3RPFC 1WX9A 5E6NA 1V97A 1UD7A 2R2QA 2HJ8A 3ZW3A 1QQRA 2IDYA 2K8HA 3FAHA 3UQAA 4CYEA 3AV8A 1KM7A 3PREA 2KNBA 3VRBB 1XLQA 3R2TA 2KXJA 3IG3A 4URKA 4IDIA 3DDCB 2G4SA 1ZOYB 4OVVA 3M63B 2K1FA 3TEYA 1GAQB 1LFDA 4NQKE 1YNTE 2Y3AA 3KW5B 3Q8BA 2N9XA 4WWNA 1I4HA 2IGHA 1OTRB 2GBJA 2KQ7A 2GI9A 3P63A 2L05A 3MC9A 2RMMA 4MT5A 3AEEB 3M95A 1PDXA 3PRZA 3IT4B 3BK1A 1L7YA 3BIID 3IHPC 4BBNC 3DCGA 1XXGA 5BMHA 4W9CA 1OEYJ 3S2AA 1T6BX 1STEA 1WYGA 1FXIA 1CK1A 3DVGX 1SEBD 1E90A 1XD3B 2WDRB 2FCNA 2D3AA 4M00A 3A1QA 1ISNA 1WM2A 2K3UA 3R2IA 4HVBA 1WJNA 3P2BA 1TTNA 3FC4A 2D3GA 5C3JB 5J18A 4OW0A 3APCA 2JXTA 3JYUA 2KD0A 4E71A 2LASA 4W9IA 2XK5A 3AXCA 1QT9A 4YWGG 2ZNVB 4FHJA 1FM0D 2G45B 4GB9A 2ZNVC 1DOIA 3NOBA 1QOGA 1SF0A 2BPSA 1FIQA 1ZPSA 4TMAB 4A20A 4MGZE 1V6EA 2LWPA 3L17A 1L0VB 5HI1A 4BOZB 1V81A 4RFBA 4ANVA 1L6UA 1KJTA 1F77A 2W3RA 3GP7A 4O1NA 2I2YA 1ESFA 2J42A 4BVUC 4E3CA 1TS5A 1YX6B 4HXDA 3H9DA 3BVMA 2QSDA 4JX1C 1SJED 2YEPF 1SE4A 1Q1OA 4WH4A 4A8XC 2LGYA 4JE3B 2MJEA 1VRAB 3RI7C 3EUB2 2LJ5A 1SE2A 3P4SB 4OVUA 4AS1A 1QLBB 1P98A 2PEAA 3V60A 3DBLB 1UNSA 3KVFB 2IGDA 1IP9A 2MW5A 1FFVA 2J0KA 4USAA 1TGZB 4ZOHC 4KV2A 3J9CA 2DENB 4K7SA 4NY0A 5FR6A 4XZ4A 3ZVVA 1V49A 2WU5B 3W2DA 3VUYA 2KTFA 3ZKJC 1NBFC 1AARA 4X57B 1XLOA 2WXOA 3Q3MC 3PVLA 3ZNHB 2KFKA 2XNAC 2V4LA 5IOIA 3A9KA 5EE9A 2JWZA 3VTVA 4MSMB 2PPHA 3DBHB 2VH1A 2HTHA 1P3QU 4LLGM 1AWDA 3JVZX 1DYQA 2LRWA 3CSTA 4FJZA 5D2MB 2MBBB 3KYDD 1WI0A 4K1RB 1E8XA 1T0YA 4MDKE 4HCPB 3BWUD 1F1HA 2FIDA 2BGFA 4JWUC 1CMXB 1N5WA 1ZUD2 1ZW7A 3AEFB 4MGKE 2WGSA 2OHFA 2HTME 5DPTA 1MFWA 2NTSA 1QF6A 1YD8U 3B0AA 3P4PB 4A55A 2TSSA 4YT0B 3ENEA 1K51A 4GSWA 2J0JA 1VJKA 4ZYSA 1L6VA 2RPQA 4EZJA 1C76A 4XDCA 2KC2A 3O13A 3H6NA 4J6IA 3C8YA 2CJNA 1WJ4A 1D5XC 3T8MA 1B9RA 4P7IA 4P6VF 4M0WB 3GS2A 1I7HA 4A9AA 4DK5A 1E7VA 3Q8AA 1WMHA 1WZ3A 2KWDA 4S17A 4K81A 1E6EB 1PQSA 4HPMB 3L54A 4NQLB 3I57A 3KQ4A 3N1XC 4N6EB 2AYOB 4LNIA 4LK0M 2FNJB 5AZHA 2WNMA 1T0SC 1VZ7A 2LXCA 3M3JA 3OWEB 1L0YB 1D5ZC 1ZXHA 1KH0A 2W3SA 4HDQA 3ML9A 3SR6A 1ROEA 3PSEB 3BYYB 3TEWA 3NVWA 1FEHA 2BS2B 1PFDA 2M19A 2JVCA 3IVFA 4JLCA 4US9A 2BS4B 1LO5D 3B2FA 3OJ4B 1V8CA 1NI2A 3AH7A 3AU5A 2ICIA 2RPVA 3PLVA 4W9DA 3RNFC 2O6VB 3PPAA 3IBEA 3A4RA 3Q14C 2DX5B 1N6ZA 4W9LA 5D3IB 5TSSA 4JL9A 3T9LA 1C3TA 4IUMB 2I38A 5DPWA 3WIMA 1N62A 2FBWB 1E5WA 1YN3A 2MSED 2D5GA 1GB4A 4KZ0A 2X38A 2QC8A 1MG4A 4GLSC 4W9JA 2KDBA 1ET9A 1TIFA 1CQVA 1YJIA 2EMTA 3AEBB 4DHZE 2Q5WD 1QOAA 2WHIA 1GC6A 2BF8B 1EM7A 1YJJA 4DHJB 5TR5A 4MM3A 3NVYA 2L52A 2NBUA 2KVZA 3NZ3A 4ZHOA 4W9KA 3ZTCA 3QWZB 4M0WA 2BT6A 4PYUA 3DVNU 2WS3B 4ICVA 3W9CB 3H1UA 4GDKA 1JMLA 2BYFA 4XC2A 4MSQB 5H8YE 1QKZA 4EFOA 2RGFA 1FCCC 5C23A 4NJ6A 2H89B 4MH8A 1YOVB 4C4VA 3WANA 4MELA 4EZKA 2D3CA 4JIOU 2GMIC 3I63C 2HJ1A 1FRDA 2HDEA 2HE7A 3OLMD 3PLUA 2D2QA 2KYWA 3NVVA 3H8HA 2LRUA 1PGXA 2GBMA 2O6VA 3RN9C 2JU6X 2KK8A 1S3SG 3X0WA 4WQOB 2KWVB 3ZRCA 2NCNA 5JZEB 3KUZA 2FIFA 3R7QA 1BXTA 1HTQA 3T3OA 1ACCA 1TS2A 2WDQB 4HJGE 1GPXA 3UIOB 2ZZPB 5IA7A 3DBHI 4FULA 5D7GA 4ICUA 3Q3NC 2DHZA 1JRUA 2K39A 3KWVA 4GDLB 1V2YA 5IO9A 2L8JA 2LXAA 5I4DA 2JQRB 4RGOS 2MP2A 2BYTA 2GOWA 3I9V1 2WXPA 1WRDB 1X1MA 3UF8A 5EDSA 1HEZE 3QC8B 3WAMA 3MTNB 4MGYE 5AEKB 3LYYA 3VR8B 3DBRI 1E10A 3U4EG 4TV3A 2RDGA 1WZ0A 1EU3A 4A6QA 2BVCA 2MBHA 5FK9C 3KUCB 2BKFA 2AL6A 2N1VA 2KMAA 1ZDXA 2PIAA 5BYSA 4EOYA 1JWUD 3U8ZA 2RR9A 2M1MA 4BKSD 1WF9A 1YQBA 3W1YA 1IGCA 2V3SA 1OGWA 4MJSA 3N1YC 4PS8A 2X8XX 4GIVA 2KX0A 2EELA 3ZDTA 3U7DA 1M94A 4ZRJA 4II3B 4FHKA 3L16A 2FCQA 3SD5A 4DXFA 1B1ZA 5JXVA 4FBJB 2DLBA 2ACZB 1R4MI 3C19A 2V0GA 2MQJA 1TZ1A 2WU2B 3L0WB 3RZWC 1UWXA 3A4SC 4B9KA 2J7QB 1L2NA 4ZRQA 1XO3A 3VXWA 2I1JA 2WXHA 2REXA 3ZDMC 5G55A 3BZDB 2IO3B 4YTPB 1FXAA 2B76B 1TS3A 4EKUA 2AQ3B 3WAOA 1WE7A 1SE9A 3PGEA 2IY0B 3AI5A 2K0PA 2KVRA 4G11A 4DBGA 1WXQA 1RM6C 1F0ZA 1YMHE 2LUMA 5EE1A 3ECIA 4L23A 2WXNA 4ZRIA 4GOCA 4WJQA 2LGXA 1WY8A 5HHDG 1V5TA 1XT9B 4HKQA 1FNUA 1NDDA 1R4NI 1XLPA 1Q10A 2Y5BB 3AEAB 3EGRA 1EF1A 3O65B 1VZ6A 3KUDB 3N20C 1D5MC 4EZLA 1HA5A 4RGNA 3JSVB 1NYRA 2IO2B 4KGRA 1HQRD 1T0RC 2L1AA 2D11A 3U2SC 4F8CB 1RYJA 2M0XA 2MX2A 3NS1A 3P4QB 4AUQC 2KWUB 4NJCA 5DCNA 2JY6A 2ONQA 1F9JA 1KLVA 2WXQA 4IC7B 3WA0A 1UELA 2XK5B 3EA6A 2MBOA 2DZKA 2CJOA 4WURA 2N7DA 1FNWA 4JPSA 2KO3A 3VH4B 2SEBD 3KWLA 1RLFA 4A3OA 1C78A 3MC8A 1JW9D 3AECB 5AUIA 2BKRB 5BYRA 4EEWA 2MJ3A 2K8BA 2KX3A 1SXTA 2AEHA 5CHWA 4OZBA 2IYDB 3NZUA 3ZYYX 3AN1A 1BT0A 2UU7A 3Q69A 3Q6BA 3VTUA 3N32A 2YEPB 4IM0A 4CQNA 4LDTD 4I6PA 2WYQA 2WLBA 3ZNGC 3AEDB 3KLSX 2IGGA 4HRSA 2KN4A 5T8IA 4IM2A 2KLGA 3AE1B 4HPLB 3RNBC 1WX8A 1KLGD 4C80A 2BBCA 1P1AA 1V9JA 2J4XA 5HG2A 2NPTB 3V61A 4BZAA 1Y56A 1WXMA 4TSSA 1YJ1A 1JRPA 3APFA 1YN5A 3A9JA 1E8WA 2N7EA 2N0SB 3B9JA 5LLIA 5JHBA 4ITKA 1WH3A 1RFAA 2RDHA 3IAS1 4L1BA 5C1ZA 1G6JA 1NVID 3QHTA 2MBQA 3V6EB 2QDFA 2M0AA 4TQ1A 1H8CA 2CHWA 4XDDA 4DDID 1XCTL 1N61A 2C7MB 4KVGB 5JH5C 3SU8X 4IWQA 2GBRA 2PE9A 2QIEB 4MACA 3PHWB 2BYVE 3ZJUA 4FJVB 2M56B 3ZTDA 1GUAB 1WSPA 1UUPA 1J0GA 1MHHE 2LVPA 5HKHA 5AZGA 1SJHD 4IWPA 3AE5B 2QJLA 1E7UA 3IT6B 2GRIA 2KTRB 3LB8C 4HPPA 4XYCA 2BWFA 1RRBA 1WFYA 3A9JB 3DPDA 2ZCCA 1YN4A 5AZFA 1Z5SB 2INNE 4KX6B 2JZPA 4PK1A 4PYZA 1XF5L 1T5XD 1C1YB 4TKNA 1RAXA 1OQRA 3CIRB 4FLHA 3NS8A 3UQBA 3H7PA 1ZXIA 1WJUA 5CHFA 3GZNI 4N58A 1OEYA 5IN7A 2WDTB 4B0EA 1ENFA 4BKGA 2R61A 1J7BA 3LJ3A 4DQOC 2MHJA 2W55A 3EFUA 3AM9A 3RNCC 4LJOB 3DQVA 4N59A 4HWIB 4RM9A 2C7NB 1GG3A 3ABVB 1QILA 2J0MA 4RF0A 1JROA 1FMAD 2LUEA 1I4PA 4DHZB 3DVGY 1EU4A 4RGMA 4AQ7A 2JYTA 3RMKC 3PO0A 1ZKHA 2ZW0A 4XE0A 5CHVC 1ZP0B 3OG5A 4DDGD 2A5UA 4PT5A 4JWSC 2LGSA 3Q3OC 4DXAB 2JUOA 4LDTB 1D6EC 3PTFC 1AN8A 2AQ2B 2MWSB 2H88B 4EE2A 4REZA 4KGTA 4YSYB 4WJPA 2ZPNA 3ZRFA 4D2KA 4IG7B 1WGYA 2A4ZA 3EC8A 4BAXA 4WQMA 3W1SA 1I4QA 2C5LC 3AE6B 1UGMA 2E3TA 4ZHPA 5D6JB 1FRRA 1WXAA 4RNAA 2KJ6A 2V1YA 1XLNA 1TZOA 3ZLZA 3LDZE 2ASQA 3Q8EA 2WXIA 2UWQA 3TEXA 2KN5A 5EE3A 2Z0EB 4JQWC 5E6PA 2G4DB 1ZDVA 3MHZA 4IKGA 3VHTC 4II2B 3TL5A 1TKYA 3N30A 1N63A 1FFUA 4ANWA 2DNFA 2KQSA 3DHIC 3TCAA 2N1WA 2AWTA 3Q8FA 2V4IB 2KOXA 2AQ1B 3ZXRA 3DOWA 4P16A 4RM8A 2QCZA 4IWOA 4ZRKA 3N1ZC 2IPKD 1SBBB 2PVOD 1GJZA 1UBQA 1NEKB 5MPOA 2D07B 2IBIB 3N9YC 2ZVOA 3HM3A 1WGHA 4G0NB 4S0RA 4F7ZA 5CTRC 3ZJTA 4KDLB 1HTOA 2FUG1 1LQBA 3M62B 5G2NA 1UH6A 3SHQA 1TY0A 3DBSA 2WDVB 1WE6A 4I6LB 1WM3A 4M01A 3Q3FA 1K8RB 1J7CA 1BMLC 4KKJA 4M8MA 3ML8A 5C2TB 2L7RA 2MLBA 3A1QB 5BYQA 4CHKA 2PKOA 3BINA 4GGQA 4HLEA 3AE7B 2WQYB 2WXJA 1WGGA 1HE8A 1WWTA 4KSKC 1L0XB 2NBWB 3P4RB 2L32A 2DZIA 4W9FA 3RUIB 1HZ6A 1F2RC 4ZRPA 3URYA 1T0QC 4KKIA 4DHJD 3AE4B 2Z59B 3RYTA 2Y5PA 2AX5A 1I35A 3NVZA 1C4AA 1EO6A 2V9HA 4ANUA 1HXYD 2KACA 1J19A 2YLMA 1FNVA 2G3QB 2V3PA 4K3BA 2V3NA 1SSNA 1TYGB 3PZDA 2RD0A 2KFKB 4DXGA 3CWIA 4WWOA 4AJWA 2LMCA 3VVWB 3WAPA 2QHOA 1PUTA 3AMZA 1VD2A 1SB3C 3IXSA 1IPGA 1UBIA 1YQ3B 3TEZA 3BYTB 2N9KA 3SEBA 4EUTA 3TUOA 3UIPB 4AOFA 2MP2B 1V1PA 5IAAC 3VDZA 2L0TA 1C4CA 4LJPB 2L76A 5CX3A 5LNK1 1C9FA 3QX1A 4TQ0A 3FILB 2JZZA 3TJPA 1JCKB 3ZXVA 2KC1A 4G3XB 1TJEA 3E56A 2Y5CA 3HRDD 1FO4A 1JWMD 4MM3B 4BFRA 1YX5B 4LNOA 2DAFA 2C60A 1I4GA 4MH0E 3HVDA 1RFKA 1R7SA 1C79A 1Z2MA 2LFIA 3TMPB 4LCDE 5HFYA 5J2RA 4GMVA 4UDUC 1N5XA 4DWFA 2YVCA 3GE3C 2K9XA 3AU4A 1DOYA 2FE8A 1WGDA 4MEMA 2ZEQA 3DBRB 2NVUI 3AE3B 4FN2A 3FKYA 3MP9A 4WJNA 2BB6A 1VR9A 2K6QA 4KGSA 1E0ZA 2L83A 1PGBA 3DHGC 4MGIE 5JHAA 1I4RA 1TBEA 3R8BA 2KJRA 1WMHB 2JX5A 1IBXA 3NZSA 1KFYB 1WX7A 3APDA 2KAJA 1EF5A 1I4XA 2DBYA 2MEKA 5GMVA 2IJ0A 2BWES 3V6CB 2K25A 3VUWA 2L3ZA 2PE6B 2BYEA 3T3NA 3QK0A 4NAWA 1E8ZA 2WXFA 4M8NA 2HD5B 3NY5A 2INPE 2CU1A 1MPEA 2KJHB 1IGDA 2I1KA 1TT5B 4IOIE 2FAZA 1PYWD 3AULA 4P1BC 1ET6A 1K52A 1NYQA 2DWQA 1WXSA 4B6WA 2W82A 1SE3A 2OJWA 2O6VD 5FKAC 1V86A 1E7PB 2M8SA 3U52E 1UGJA 1VCBA 3B08A 1WJ6A 2KDEB 1XQQA 2G1EA 2XN9C 4RMAA 2KANA 1PGAA 3VRAB 2CHZA 3GB1A 4K7WA 1TKGA 1J8CA 1FPYA 1A70A 1GNUA 1EUVB 2MJDA 4P1CC 2CKHB 1TKEA 2LVQA 1EWYC 2WWZA 2WXRA 4B95A 4NNJB 1JALA 1DOXA 1R4MB 3N3KB 5D94A 3QA8A 3MC0B 4ACFA 3BY4B 4E74A 1C4PA 4R3DA 2GBNA 1KTKA 3PT2B 2ZW1A 1FCLA 2LHEA 4KDIC 4GU2A 3MJ5A 1ZGUB 4WWMA 2N9LA 2PVGC 3ZO5B 3DWGC 5E6OA 4RCOA 3A9KB 3I5JC 3JSVA 3UGBB 1GOZA 2B3AA 4B0MA 3TSSA 3TBLD 2DYBA 1IYFA 3RFZB 3A33B 4HEA1 3ETRA 3RULA 3KYCD 2Z8LA 4FXCA 2MRPA 4OVZA 3V3XA 1QZEA 1FXTB 3AEGB 4W9EA 2DYOA 2GB1A 1J7AA 4NAWB 2LHDA 1MHXA 4GDKB 1KLUD 3W5VB 1LXDA 2LZ6A 3HVZA 1OQQA 2EKIA 1Y8RC 3MFGA 1LGRA 1Q5WB 1K50A 1UF0A 1WYWB 2JRIB 2RDBC 3HM6X 1IBXB 2ON8A 1MG8A 3NG0A 1NI3A 4WIPA 1MVKA 3UINB 2IZVB 2G9HD 3PZ7A 5DPSA 1JWAD 3NJTA 4K7UA 3RD2A 3HUIA 4TUUA 2E6XA 4WWPA 2KKCA 1L4ZB 4JGHB 5DPRA 2FUHB 3VQIA 2D3BA 4FADA 2DZJA 4FA6A 1XCQL 1P9DU 3AE8B 1KRHA 3HIZA 2RSUA 5IP4D 2LGDA 2JXXA 1QOFA 1GC7A 2WX1A 1MJDA 3Q3JA 3RT3B 2L0FA 4ZYNA 3IAM1 2O2VB 3I3TB 2DZMA 1V80A 3EECA 4RF1A 2KWCA 3L10B 3HK0A 3ZUNA 4PS7A 2ZPYA 4GDLA 2JF5A 3ZNID 2C7HA 4YL8A 1V5OA 2KZRA 5BMGA 1V1PB 1K53A 4BBNF 3DHHC 2K6DB 3MJWA 4US8A 4AP4C 3L13A 2NTTA 3U7ZA 4J3OD 1U4AA 2QMTA 1D3ZA 2GLSA 1L4DB 3JW0X 2JPHA 2N7JA 4C4VB 2VRRB 3E9SA 3VUXA 3V05A 1E8YA 4LNNA 2N4FA 2KFJA 1E9MA 4KSLC 3RNEC 2JRHA 4OZCA 4WAAA 3R7RA 2WXGA 4A90A 1GB1A 4HKZE 4N9F4 1CJEA 4KZCA 3AB5A 3OJ3A 2BB5A 2NS5A 2NBVB 2K5PA 1QOBA 1OFFA 2DAJA 4ZDVA 1N60A 3TIXA 4XWTA 4YSXB 1ZE3D 4W9HA 1UWMA 3DBLI 3RZFA 4YXDB 2IY1B 1H4RA 3C0RB 2EMSA 4C7ZA 1S1QB 2PTLA 4MJSB 4BKTA 4NZLB 1CZPA 1TY2A 1XEEA 4HK2A 3BVZA 2UYZB 2VZKD 4NPNA 3ALBA 3PS6A 2ZCBA 4ANXA 5KHOA 4NJ7A 4WJOA 3DVNV 2ZJDA 3B2GA 4LNFA 4WAFA 1KF6B 2O2VA 2KQ4X 3HHMA 2BTEA 2W54A 1AW7A 1JWSD 3VR9B 2KLCA 4LNKA 1AYFA 1M4VA 3BK2A 1KOTA 3SDLC 4ARIA 3VH3B 4H2AA 3P1MA 3RNGC 2INDC 3QAQA 3CMMB 2PMVA 4AJYB 1VLBA 3U30A 2MBEA 2KDFB 2WP9B 4L2YA 1UZXB 3NRZA 3EHVA 2PJHA 2EKEC 3ZQ4A 2KTRA 3K9OB 4XGAB 3KH0A 2L00B 4I6NB 2N9EB 3BVGA 2LGIA 5KHQA 5BO4B 1I42A 1MI0A 3ONSA 2BS3B 1WR1A 3SFDB 3PZ8A 2C9WB 1SIJA 5L95C 4ARCA 5L83A 3VFKA 4F1SA 1WXVA 4OZAA 1SGHA 1RWSA 2WXMA 1EWCA 2BW2A 1NENB 5D3DA 2LEKA 3DWMA 4HROA 4BKSA 2D10A 1P7FA 2KDMA 1WR6E 5BMIA 2WXKA 2KT7A 2JWUA 1Q0WB 3QCAA 5IKCM 3GZNB 2JZ3B 4XWWA 2LVOA 3ZGZA 2XEWA 1L5PA 3SFEB 5EE0A 1D4BA 2CS4A 4PS3A 3ZIMA 2VH2A 2W9NA 5FR3A 2JT4B 5GXGB 3B1LX 4GXBA 5J17A 3OAWA 3R3MA 1LM8B 1P7EA 2INCC 2KHWB 3ZNZB 2AL3A 4IW0A 5E6JA
chains in the Genus database with same CATH topology
1E7VA 1WMHA 1WZ3A 4TQ1A 2CHWA 1H8CA 4K81A 1PQSA 2BWES 4HPMB 3L54A 2K25A 2C7MB 2FCSA 4NQLB 3V6CB 3VUWA 2L3ZA 2PE6B 2BYEA 3PV1A 4KVGB 2OJRA 2AYOB 3QK0A 3W1SC 5JH5C 4NAWA 4HDOA 1WGRA 3CSFA 2FNJB 3SU8X 5AZHA 4IWQA 1E8ZA 2GBRA 2NPTA 2PE9A 4GN1A 3M3JA 2HD5B 2LXCA 3NY5A 2BYVE 3PHWB 4M8NA 3RCZA 4FJVB 2CU1A 3MHSD 2KJHB 3ZTDA 4HDQA 3ML9A 1GUAB 2I1KA 3PSEB 3H7SA 2FAZA 3AULA 1J0GA 2LVPA 2KMCA 5HKHA 5AZGA 3VAWA 2M17A 4IWPA 2JVCA 3IVFA 1E7UA 1WXSA 4JLCA 4B6WA 2O6VD 1OQYA 3OJ4B 2XBBC 1NI2A 1V86A 2KTRB 4CO7A 3AU5A 2R2OA 2KDIA 3PLVA 2M8SA 4W9DA 2BWFA 1VCBA 3B08A 1RRBA 1WJ6A 1WFYA 2KDEB 2O6VB 3A9JB 2M4NA 3WALA 1XQQA 2LI5A 3IBEA 3DPDA 3PPAA 3X23A 4RMAA 2KANA 2ZCCA 3A4RA 2CR5A 2CHZA 2OOBB 4K7WA 1J8CA 2MA9B 3D32A 2DX5B 1GNUA 4W9LA 5AZFA 1EUVB 1Z5SB 5LXIB 4HJKA 2CKHB 4JL9A 3QARA 2WX0A 2K8CA 3H7PB 3QJZA 2LVQA 2WWZA 3T9LA 4W9GA 4IUMB 4BOSC 1C3TA 5DPWA 3CF6E 4G50A 4B95A 4NNJB 4PYZA 3WIMA 1E5WA 3QQ8B 2MSED 3L08A 1C1YB 3N3KB 5D94A 3QA8A 4KZ0A 4TKNA 3GOEA 2N9PC 3BY4B 4E74A 1RAXA 4W9JA 2KDBA 2GBNA 3PT2B 1SIFA 4FLHA 3NS8A 4KIKA 3NHEB 3UQBA 3H7PA 1WJUA 2EMTA 3GZNI 5CHFA 4KDIC 4DHZE 1OEYA 4GU2A 2WDTB 3IFWB 1ZGUB 1GC6A 2BF8B 4DHJB 3V62A 5TR5A 4BKGA 4MM3A 3ZO5B 2NBUA 2DYMA 5E6OA 4ASWC 3LJ3A 3PRMB 4KIKB 4AWJA 3A9KB 3JSVA 3K9PB 3UGBB 2B3AA 3EFUA 4W9KA 3ZTCA 3R66C 3QWZB 1A5RA 4LJOB 3DQVA 3QIJA 3PHXB 3TBLD 4DDID 4HWIB 2DYBA 4PYUA 1IYFA 4RM9A 3A33B 4A3PA 2C7NB 3DVNU 2GBKA 2IO1B 4ICVA 3RULA 2MCNB 1GG3A 3H1UA 4GDKA 2NR2A 1WIAA 3KYCD 4XX5A 2J0MA 1YIWA 4IM3A 2BYFA 4XC2A 4MSQB 4EFOA 4FJYA 2LUEA 2MRPA 2CHXA 2RGFA 5C23A 4DHZB 3DVGY 2FCMA 5LXHA 4NJ6A 1QZEA 1FXTB 4W9EA 2DYOA 4HCNB 1ZKHA 3WANA 4MELA 5CHVC 4EZKA 4JIOU 2GMIC 4NAWB 4DDGD 4GDKB 2A5UA 2HE7A 3OLMD 3PLUA 2D2QA 4DXAB 2JUOA 4LDTB 1LXDA 3VTWA 2LZ6A 1Y8RC 1WYWB 1Q5WB 2JRIB 3PTFC 2MWSB 3HM6X 2IO0B 2ZVNA 1P0RA 4WJPA 1MG8A 2LD9A 2LRUA 2ZPNA 3ZRFA 4IG7B 2Z0DB 3PRPB 2GBMA 2O6VA 1WX9A 1WGYA 2KK8A 5E6NA 2A4ZA 1S3SG 1UD7A 2R2QA 3UINB 2HJ8A 3EC8A 2KWVB 4WQOB 3X0WA 2IZVB 3ZRCA 2NCNA 5JZEB 3W1SA 5DPSA 3KUZA 2C5LC 3ZW3A 2K8HA 4K7UA 1UGMA 3RD2A 2FIFA 3R7QA 3UQAA 4CYEA 4TUUA 1KM7A 3PREA 5D6JB 2KNBA 1WXAA 4WWPA 2KXJA 2KKCA 3IG3A 4JGHB 4URKA 5DPRA 2KJ6A 2G4SA 3DDCB 2V1YA 4OVVA 3UIOB 2ZZPB 5IA7A 2FUHB 3DBHI 2K1FA 3M63B 4FULA 3VQIA 5D7GA 3ZLZA 1LFDA 3KW5B 4ICUA 4NQKE 3LDZE 4WWNA 2N9XA 4FADA 2DHZA 2ASQA 1JRUA 2DZJA 1OTRB 2UWQA 2K39A 2KN5A 2Z0EB 4GDLB 4FA6A 2GBJA 4JQWC 5E6PA 1V2YA 2KQ7A 2G4DB 2L8JA 1P9DU 3VHTC 2LXAA 2L05A 3HIZA 4II2B 3TL5A 2RSUA 2LGDA 3N30A 2JXXA 2MP2A 4ANWA 1GC7A 2GOWA 3M95A 2KQSA 2WX1A 3PRZA 3TCAA 2N1WA 1WRDB 3Q3JA 1X1MA 3UF8A 5EDSA 2AWTA 3QC8B 3WAMA 1L7YA 3MTNB 4MGYE 3RT3B 2L0FA 5AEKB 4ZYNA 2O2VB 3I3TB 3DBRI 3IHPC 2DZMA 4TV3A 4BBNC 1V80A 3EECA 3DCGA 1WZ0A 2KOXA 2KWCA 3L10B 3HK0A 4W9CA 2MBHA 3ZUNA 3DOWA 3KUCB 2BKFA 2AL6A 2N1VA 1OEYJ 4PS7A 2KMAA 2ZPYA 2JF5A 4GDLA 4RM8A 3S2AA 3ZNID 2C7HA 4IWOA 4YL8A 4EOYA 1V5OA 2KZRA 4ZRKA 3U8ZA 3DVGX 1GJZA 2RR9A 2M1MA 4BKSD 1WF9A 1YQBA 1E90A 4BBNF 1UBQA 1XD3B 2FCNA 2K6DB 3MJWA 3W1YA 2V3SA 1OGWA 4MJSA 4AP4C 2D07B 4PS8A 3L13A 1U4AA 3A1QA 1ISNA 1D3ZA 4GIVA 2IBIB 2KX0A 3JW0X 2ZVOA 1WM2A 2JPHA 4HVBA 3HM3A 1WGHA 1WJNA 3ZDTA 3P2BA 3U7DA 1TTNA 1M94A 2VRRB 4G0NB 2D3GA 4ZRJA 3VUXA 4II3B 4F7ZA 5CTRC 4KDLB 1E8YA 5J18A 4FHKA 2FCQA 2KFJA 2N4FA 1LQBA 3APCA 3JYUA 3L16A 3SD5A 4KSLC 2KD0A 4FBJB 3M62B 2JRHA 4WAAA 5G2NA 4E71A 2LASA 3R7RA 4W9IA 1UH6A 3SHQA 2XK5A 1R4MI 3AXCA 4N9F4 2ZNVB 4FHJA 2MQJA 3DBSA 3OJ3A 4KZCA 1TZ1A 2G45B 4GB9A 2ZNVC 2NS5A 1WE6A 4I6LB 1WM3A 3L0WB 3NOBA 3RZWC 2NBVB 2BPSA 2DAJA 3Q3FA 3A4SC 1K8RB 4ZDVA 4B9KA 2J7QB 1L2NA 4M8MA 3TIXA 3ML8A 4A20A 4MGZE 2L7RA 2MLBA 1V6EA 2LWPA 3A1QB 4CHKA 3L17A 2I1JA 3VXWA 4W9HA 4BOZB 3BINA 2REXA 3DBLI 1V81A 4GGQA 3ZDMC 3RZFA 4HLEA 2IY1B 5G55A 1H4RA 4ANVA 1WGGA 3C0RB 1KJTA 2IO3B 1HE8A 2EMSA 4KSKC 1S1QB 2NBWB 4EKUA 3WAOA 4MJSB 1WE7A 1SE9A 2DZIA 3PGEA 4W9FA 3RUIB 4BKTA 4BVUC 4E3CA 1YX6B 2IY0B 4HXDA 3H9DA 4HK2A 3AI5A 4DHJD 2Z59B 3RYTA 2UYZB 2KVRA 4G11A 4DBGA 4NPNA 1I35A 3ALBA 3PS6A 1EO6A 2ZCBA 4ANXA 5KHOA 4ANUA 1Q1OA 3ECIA 4NJ7A 1J19A 2YLMA 4ZRIA 3DVNV 2ZJDA 2G3QB 4GOCA 4WJOA 2LGYA 4WJQA 2LGXA 1WY8A 1V5TA 1XT9B 1NDDA 1R4NI 2Y5BB 3PZDA 2RD0A 2O2VA 2KFKB 3HHMA 2LJ5A 1EF1A 4WWOA 3O65B 4AJWA 4OVUA 3KUDB 1P98A 2KLCA 2PEAA 3VVWB 4EZLA 3V60A 1KOTA 3JSVB 3WAPA 2QHOA 3KVFB 1IP9A 2IO2B 3SDLC 3VH3B 1VD2A 1IPGA 1UBIA 2J0KA 2MW5A 1TGZB 4KV2A 2D11A 4F8CB 3QAQA 2M0XA 2DENB 2MX2A 3CMMB 4K7SA 4NY0A 4EUTA 4AUQC 5FR6A 4XZ4A 4AJYB 3ZVVA 2KWUB 3UIPB 4AOFA 1V49A 2MP2B 5DCNA 2JY6A 5IAAC 3VDZA 2KTFA 3VUYA 3ZKJC 3U30A 1F9JA 1NBFC 2L0TA 1KLVA 2MBEA 4LJPB 2KDFB 2L76A 1AARA 1UZXB 4IC7B 4X57B 3WA0A 5CX3A 1UELA 2XK5B 3EHVA 2MBOA 3PVLA 3ZNHB 2PJHA 2KFKA 3QX1A 2DZKA 4TQ0A 2EKEC 2JZZA 2N7DA 3TJPA 2KTRA 3K9OB 3KH0A 2V4LA 2L00B 3A9KA 2KO3A 2N9EB 4I6NB 2KC1A 4G3XB 3VH4B 1RLFA 4A3OA 2JWZA 5KHQA 3VTVA 4MSMB 2PPHA 5BO4B 1I42A 3ONSA 2HTHA 1P3QU 1WR1A 3JVZX 2BKRB 2C9WB 4EEWA 4BFRA 1YX5B 2LRWA 2DAFA 3CSTA 2K8BA 2C60A 5L95C 2KX3A 4FJZA 2AEHA 4MH0E 5CHWA 5D2MB 2MBBB 3KYDD 3VFKA 2IYDB 3NZUA 4F1SA 5L83A 1WXVA 1WI0A 4K1RB 1E8XA 1T0YA 1SGHA 4MDKE 1Z2MA 1BT0A 4HCPB 3VTUA 2FIDA 3N32A 4IM0A 3TMPB 2BGFA 4LDTD 1CMXB 4I6PA 4LCDE 2WYQA 3ZNGC 5J2RA 1ZW7A 4GMVA 4DWFA 4BKSA 2YVCA 2D10A 4IM2A 3AU4A 2KLGA 1WR6E 4MGKE 4HPLB 1WGDA 4MEMA 1WX8A 2ZEQA 2NVUI 1P1AA 1V9JA 1Q0WB 2NPTB 4FN2A 5DPTA 3V61A 3QCAA 2JZ3B 4WJNA 1WXMA 2K6QA 1YD8U 1YJ1A 2LVOA 2XEWA 3B0AA 4MGIE 2CS4A 3APFA 5JHAA 3A9JA 1TBEA 1E8WA 3ENEA 4GSWA 4PS3A 2J0JA 2N7EA 3ZIMA 2KJRA 1WMHB 2RPQA 4EZJA 2W9NA 5LLIA 3NZSA 5JHBA 2JT4B 2KC2A 3H6NA 4J6IA 1WH3A 3B1LX 1WJ4A 4GXBA 1WX7A 3APDA 3T8MA 1RFAA 4P7IA 5J17A 1EF5A 3OAWA 3R3MA 1LM8B 5GMVA 5C1ZA 4M0WB 1G6JA 2KHWB 3ZNZB 4DK5A 3QHTA 2AL3A 2MBQA 4IW0A 3V6EB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E7V A;  1WMH A;  1WZ3 A;  4TQ1 A;  2CHW A;  1H8C A;  4K81 A;  1PQS A;  2BWE S;  4HPM B;  3L54 A;  2K25 A;  2C7M B;  2FCS A;  4NQL B;  3V6C B;  3VUW A;  2L3Z A;  2PE6 B;  2BYE A;  3PV1 A;  4KVG B;  2OJR A;  2AYO B;  3QK0 A;  3W1S C;  5JH5 C;  4NAW A;  4HDO A;  1WGR A;  3CSF A;  2FNJ B;  3SU8 X;  5AZH A;  4IWQ A;  1E8Z A;  2GBR A;  2NPT A;  2PE9 A;  4GN1 A;  3M3J A;  2HD5 B;  2LXC A;  3NY5 A;  2BYV E;  3PHW B;  4M8N A;  3RCZ A;  4FJV B;  2CU1 A;  3MHS D;  2KJH B;  3ZTD A;  4HDQ A;  3ML9 A;  1GUA B;  2I1K A;  3PSE B;  3H7S A;  2FAZ A;  3AUL A;  1J0G A;  2LVP A;  2KMC A;  5HKH A;  5AZG A;  3VAW A;  2M17 A;  4IWP A;  2JVC A;  3IVF A;  1E7U A;  1WXS A;  4JLC A;  4B6W A;  2O6V D;  1OQY A;  3OJ4 B;  2XBB C;  1NI2 A;  1V86 A;  2KTR B;  4CO7 A;  3AU5 A;  2R2O A;  2KDI A;  3PLV A;  2M8S A;  4W9D A;  2BWF A;  1VCB A;  3B08 A;  1RRB A;  1WJ6 A;  1WFY A;  2KDE B;  2O6V B;  3A9J B;  2M4N A;  3WAL A;  1XQQ A;  2LI5 A;  3IBE A;  3DPD A;  3PPA A;  3X23 A;  4RMA A;  2KAN A;  2ZCC A;  3A4R A;  2CR5 A;  2CHZ A;  2OOB B;  4K7W A;  1J8C A;  2MA9 B;  3D32 A;  2DX5 B;  1GNU A;  4W9L A;  5AZF A;  1EUV B;  1Z5S B;  5LXI B;  4HJK A;  2CKH B;  4JL9 A;  3QAR A;  2WX0 A;  2K8C A;  3H7P B;  3QJZ A;  2LVQ A;  2WWZ A;  3T9L A;  4W9G A;  4IUM B;  4BOS C;  1C3T A;  5DPW A;  3CF6 E;  4G50 A;  4B95 A;  4NNJ B;  4PYZ A;  3WIM A;  1E5W A;  3QQ8 B;  2MSE D;  3L08 A;  1C1Y B;  3N3K B;  5D94 A;  3QA8 A;  4KZ0 A;  4TKN A;  3GOE A;  2N9P C;  3BY4 B;  4E74 A;  1RAX A;  4W9J A;  2KDB A;  2GBN A;  3PT2 B;  1SIF A;  4FLH A;  3NS8 A;  4KIK A;  3NHE B;  3UQB A;  3H7P A;  1WJU A;  2EMT A;  3GZN I;  5CHF A;  4KDI C;  4DHZ E;  1OEY A;  4GU2 A;  2WDT B;  3IFW B;  1ZGU B;  1GC6 A;  2BF8 B;  4DHJ B;  3V62 A;  5TR5 A;  4BKG A;  4MM3 A;  3ZO5 B;  2NBU A;  2DYM A;  5E6O A;  4ASW C;  3LJ3 A;  3PRM B;  4KIK B;  4AWJ A;  3A9K B;  3JSV A;  3K9P B;  3UGB B;  2B3A A;  3EFU A;  4W9K A;  3ZTC A;  3R66 C;  3QWZ B;  1A5R A;  4LJO B;  3DQV A;  3QIJ A;  3PHX B;  3TBL D;  4DDI D;  4HWI B;  2DYB A;  4PYU A;  1IYF A;  4RM9 A;  3A33 B;  4A3P A;  2C7N B;  3DVN U;  2GBK A;  2IO1 B;  4ICV A;  3RUL A;  2MCN B;  1GG3 A;  3H1U A;  4GDK A;  2NR2 A;  1WIA A;  3KYC D;  4XX5 A;  2J0M A;  1YIW A;  4IM3 A;  2BYF A;  4XC2 A;  4MSQ B;  4EFO A;  4FJY A;  2LUE A;  2MRP A;  2CHX A;  2RGF A;  5C23 A;  4DHZ B;  3DVG Y;  2FCM A;  5LXH A;  4NJ6 A;  1QZE A;  1FXT B;  4W9E A;  2DYO A;  4HCN B;  1ZKH A;  3WAN A;  4MEL A;  5CHV C;  4EZK A;  4JIO U;  2GMI C;  4NAW B;  4DDG D;  4GDK B;  2A5U A;  2HE7 A;  3OLM D;  3PLU A;  2D2Q A;  4DXA B;  2JUO A;  4LDT B;  1LXD A;  3VTW A;  2LZ6 A;  1Y8R C;  1WYW B;  1Q5W B;  2JRI B;  3PTF C;  2MWS B;  3HM6 X;  2IO0 B;  2ZVN A;  1P0R A;  4WJP A;  1MG8 A;  2LD9 A;  2LRU A;  2ZPN A;  3ZRF A;  4IG7 B;  2Z0D B;  3PRP B;  2GBM A;  2O6V A;  1WX9 A;  1WGY A;  2KK8 A;  5E6N A;  2A4Z A;  1S3S G;  1UD7 A;  2R2Q A;  3UIN B;  2HJ8 A;  3EC8 A;  2KWV B;  4WQO B;  3X0W A;  2IZV B;  3ZRC A;  2NCN A;  5JZE B;  3W1S A;  5DPS A;  3KUZ A;  2C5L C;  3ZW3 A;  2K8H A;  4K7U A;  1UGM A;  3RD2 A;  2FIF A;  3R7Q A;  3UQA A;  4CYE A;  4TUU A;  1KM7 A;  3PRE A;  5D6J B;  2KNB A;  1WXA A;  4WWP A;  2KXJ A;  2KKC A;  3IG3 A;  4JGH B;  4URK A;  5DPR A;  2KJ6 A;  2G4S A;  3DDC B;  2V1Y A;  4OVV A;  3UIO B;  2ZZP B;  5IA7 A;  2FUH B;  3DBH I;  2K1F A;  3M63 B;  4FUL A;  3VQI A;  5D7G A;  3ZLZ A;  1LFD A;  3KW5 B;  4ICU A;  4NQK E;  3LDZ E;  4WWN A;  2N9X A;  4FAD A;  2DHZ A;  2ASQ A;  1JRU A;  2DZJ A;  1OTR B;  2UWQ A;  2K39 A;  2KN5 A;  2Z0E B;  4GDL B;  4FA6 A;  2GBJ A;  4JQW C;  5E6P A;  1V2Y A;  2KQ7 A;  2G4D B;  2L8J A;  1P9D U;  3VHT C;  2LXA A;  2L05 A;  3HIZ A;  4II2 B;  3TL5 A;  2RSU A;  2LGD A;  3N30 A;  2JXX A;  2MP2 A;  4ANW A;  1GC7 A;  2GOW A;  3M95 A;  2KQS A;  2WX1 A;  3PRZ A;  3TCA A;  2N1W A;  1WRD B;  3Q3J A;  1X1M A;  3UF8 A;  5EDS A;  2AWT A;  3QC8 B;  3WAM A;  1L7Y A;  3MTN B;  4MGY E;  3RT3 B;  2L0F A;  5AEK B;  4ZYN A;  2O2V B;  3I3T B;  3DBR I;  3IHP C;  2DZM A;  4TV3 A;  4BBN C;  1V80 A;  3EEC A;  3DCG A;  1WZ0 A;  2KOX A;  2KWC A;  3L10 B;  3HK0 A;  4W9C A;  2MBH A;  3ZUN A;  3DOW A;  3KUC B;  2BKF A;  2AL6 A;  2N1V A;  1OEY J;  4PS7 A;  2KMA A;  2ZPY A;  2JF5 A;  4GDL A;  4RM8 A;  3S2A A;  3ZNI D;  2C7H A;  4IWO A;  4YL8 A;  4EOY A;  1V5O A;  2KZR A;  4ZRK A;  3U8Z A;  3DVG X;  1GJZ A;  2RR9 A;  2M1M A;  4BKS D;  1WF9 A;  1YQB A;  1E90 A;  4BBN F;  1UBQ A;  1XD3 B;  2FCN A;  2K6D B;  3MJW A;  3W1Y A;  2V3S A;  1OGW A;  4MJS A;  4AP4 C;  2D07 B;  4PS8 A;  3L13 A;  1U4A A;  3A1Q A;  1ISN A;  1D3Z A;  4GIV A;  2IBI B;  2KX0 A;  3JW0 X;  2ZVO A;  1WM2 A;  2JPH A;  4HVB A;  3HM3 A;  1WGH A;  1WJN A;  3ZDT A;  3P2B A;  3U7D A;  1TTN A;  1M94 A;  2VRR B;  4G0N B;  2D3G A;  4ZRJ A;  3VUX A;  4II3 B;  4F7Z A;  5CTR C;  4KDL B;  1E8Y A;  5J18 A;  4FHK A;  2FCQ A;  2KFJ A;  2N4F A;  1LQB A;  3APC A;  3JYU A;  3L16 A;  3SD5 A;  4KSL C;  2KD0 A;  4FBJ B;  3M62 B;  2JRH A;  4WAA A;  5G2N A;  4E71 A;  2LAS A;  3R7R A;  4W9I A;  1UH6 A;  3SHQ A;  2XK5 A;  1R4M I;  3AXC A;  4N9F 4;  2ZNV B;  4FHJ A;  2MQJ A;  3DBS A;  3OJ3 A;  4KZC A;  1TZ1 A;  2G45 B;  4GB9 A;  2ZNV C;  2NS5 A;  1WE6 A;  4I6L B;  1WM3 A;  3L0W B;  3NOB A;  3RZW C;  2NBV B;  2BPS A;  2DAJ A;  3Q3F A;  3A4S C;  1K8R B;  4ZDV A;  4B9K A;  2J7Q B;  1L2N A;  4M8M A;  3TIX A;  3ML8 A;  4A20 A;  4MGZ E;  2L7R A;  2MLB A;  1V6E A;  2LWP A;  3A1Q B;  4CHK A;  3L17 A;  2I1J A;  3VXW A;  4W9H A;  4BOZ B;  3BIN A;  2REX A;  3DBL I;  1V81 A;  4GGQ A;  3ZDM C;  3RZF A;  4HLE A;  2IY1 B;  5G55 A;  1H4R A;  4ANV A;  1WGG A;  3C0R B;  1KJT A;  2IO3 B;  1HE8 A;  2EMS A;  4KSK C;  1S1Q B;  2NBW B;  4EKU A;  3WAO A;  4MJS B;  1WE7 A;  1SE9 A;  2DZI A;  3PGE A;  4W9F A;  3RUI B;  4BKT A;  4BVU C;  4E3C A;  1YX6 B;  2IY0 B;  4HXD A;  3H9D A;  4HK2 A;  3AI5 A;  4DHJ D;  2Z59 B;  3RYT A;  2UYZ B;  2KVR A;  4G11 A;  4DBG A;  4NPN A;  1I35 A;  3ALB A;  3PS6 A;  1EO6 A;  2ZCB A;  4ANX A;  5KHO A;  4ANU A;  1Q1O A;  3ECI A;  4NJ7 A;  1J19 A;  2YLM A;  4ZRI A;  3DVN V;  2ZJD A;  2G3Q B;  4GOC A;  4WJO A;  2LGY A;  4WJQ A;  2LGX A;  1WY8 A;  1V5T A;  1XT9 B;  1NDD A;  1R4N I;  2Y5B B;  3PZD A;  2RD0 A;  2O2V A;  2KFK B;  3HHM A;  2LJ5 A;  1EF1 A;  4WWO A;  3O65 B;  4AJW A;  4OVU A;  3KUD B;  1P98 A;  2KLC A;  2PEA A;  3VVW B;  4EZL A;  3V60 A;  1KOT A;  3JSV B;  3WAP A;  2QHO A;  3KVF B;  1IP9 A;  2IO2 B;  3SDL C;  3VH3 B;  1VD2 A;  1IPG A;  1UBI A;  2J0K A;  2MW5 A;  1TGZ B;  4KV2 A;  2D11 A;  4F8C B;  3QAQ A;  2M0X A;  2DEN B;  2MX2 A;  3CMM B;  4K7S A;  4NY0 A;  4EUT A;  4AUQ C;  5FR6 A;  4XZ4 A;  4AJY B;  3ZVV A;  2KWU B;  3UIP B;  4AOF A;  1V49 A;  2MP2 B;  5DCN A;  2JY6 A;  5IAA C;  3VDZ A;  2KTF A;  3VUY A;  3ZKJ C;  3U30 A;  1F9J A;  1NBF C;  2L0T A;  1KLV A;  2MBE A;  4LJP B;  2KDF B;  2L76 A;  1AAR A;  1UZX B;  4IC7 B;  4X57 B;  3WA0 A;  5CX3 A;  1UEL A;  2XK5 B;  3EHV A;  2MBO A;  3PVL A;  3ZNH B;  2PJH A;  2KFK A;  3QX1 A;  2DZK A;  4TQ0 A;  2EKE C;  2JZZ A;  2N7D A;  3TJP A;  2KTR A;  3K9O B;  3KH0 A;  2V4L A;  2L00 B;  3A9K A;  2KO3 A;  2N9E B;  4I6N B;  2KC1 A;  4G3X B;  3VH4 B;  1RLF A;  4A3O A;  2JWZ A;  5KHQ A;  3VTV A;  4MSM B;  2PPH A;  5BO4 B;  1I42 A;  3ONS A;  2HTH A;  1P3Q U;  1WR1 A;  3JVZ X;  2BKR B;  2C9W B;  4EEW A;  4BFR A;  1YX5 B;  2LRW A;  2DAF A;  3CST A;  2K8B A;  2C60 A;  5L95 C;  2KX3 A;  4FJZ A;  2AEH A;  4MH0 E;  5CHW A;  5D2M B;  2MBB B;  3KYD D;  3VFK A;  2IYD B;  3NZU A;  4F1S A;  5L83 A;  1WXV A;  1WI0 A;  4K1R B;  1E8X A;  1T0Y A;  1SGH A;  4MDK E;  1Z2M A;  1BT0 A;  4HCP B;  3VTU A;  2FID A;  3N32 A;  4IM0 A;  3TMP B;  2BGF A;  4LDT D;  1CMX B;  4I6P A;  4LCD E;  2WYQ A;  3ZNG C;  5J2R A;  1ZW7 A;  4GMV A;  4DWF A;  4BKS A;  2YVC A;  2D10 A;  4IM2 A;  3AU4 A;  2KLG A;  1WR6 E;  4MGK E;  4HPL B;  1WGD A;  4MEM A;  1WX8 A;  2ZEQ A;  2NVU I;  1P1A A;  1V9J A;  1Q0W B;  2NPT B;  4FN2 A;  5DPT A;  3V61 A;  3QCA A;  2JZ3 B;  4WJN A;  1WXM A;  2K6Q A;  1YD8 U;  1YJ1 A;  2LVO A;  2XEW A;  3B0A A;  4MGI E;  2CS4 A;  3APF A;  5JHA A;  3A9J A;  1TBE A;  1E8W A;  3ENE A;  4GSW A;  4PS3 A;  2J0J A;  2N7E A;  3ZIM A;  2KJR A;  1WMH B;  2RPQ A;  4EZJ A;  2W9N A;  5LLI A;  3NZS A;  5JHB A;  2JT4 B;  2KC2 A;  3H6N A;  4J6I A;  1WH3 A;  3B1L X;  1WJ4 A;  4GXB A;  1WX7 A;  3APD A;  3T8M A;  1RFA A;  4P7I A;  5J17 A;  1EF5 A;  3OAW A;  3R3M A;  1LM8 B;  5GMV A;  5C1Z A;  4M0W B;  1G6J A;  2KHW B;  3ZNZ B;  4DK5 A;  3QHT A;  2AL3 A;  2MBQ A;  4IW0 A;  3V6E B; 
#chains in the Genus database with same CATH topology
 2BQQ A;  3LXF A;  1DGJ A;  2FCS A;  4C56 C;  2PW9 A;  3PV1 A;  2SAK A;  2OJR A;  3W1S C;  4HDO A;  2J52 A;  1WGR A;  3CSF A;  3GE8 C;  1VDV A;  2NPT A;  4GN1 A;  4YTN B;  3RCZ A;  1V1O A;  3MHS D;  2QEJ C;  3RNA C;  1TS4 A;  3Q2A C;  3H7S A;  2CU3 A;  1HZ5 A;  2KMM A;  2KMC A;  3VAW A;  2LJI A;  2K22 A;  2M17 A;  3P42 A;  4NAM A;  2JSV X;  4OHJ A;  1JQ4 A;  1YQ4 B;  2OED A;  1OQY A;  4QAY A;  2XBB C;  4CO7 A;  4YTM B;  4RH6 A;  2R2O A;  3FIL A;  2KDI A;  1VZ8 A;  2M4N A;  3WAL A;  2LI5 A;  3X23 A;  3AE9 B;  3EFC A;  2CR5 A;  2OOB B;  2MA9 B;  3D32 A;  4C7Y A;  5LXI B;  4HJK A;  3QAR A;  2WX0 A;  2K8C A;  3H7P B;  3QJZ A;  4BOS C;  4W9G A;  3CF6 E;  4G50 A;  3AE2 B;  4Q2J A;  5AUK A;  3QQ8 B;  3L08 A;  3WCQ A;  3GOE A;  4LTU A;  2N9P C;  3W5U B;  1C77 A;  1SIF A;  1F2R I;  4KIK A;  3NHE B;  3L4P A;  3IFW B;  2VZK B;  2JYE A;  3V62 A;  1JWB D;  2DYM A;  4ASW C;  5G5H A;  3PRM B;  4KIK B;  4M02 A;  4AWJ A;  3K9P B;  2PLP A;  1WRI A;  3R66 C;  1A5R A;  3QIJ A;  3PHX B;  4RGT A;  4A3P A;  1R4N B;  2GBK A;  2IO1 B;  2MCN B;  2NR2 A;  1WIA A;  4XX5 A;  1YIW A;  4IM3 A;  1FD6 A;  1IUE A;  4FJY A;  2CHX A;  4YSZ B;  5LXH A;  2FCM A;  3ZJV A;  4K3C A;  3NUH B;  1F52 A;  2MH7 A;  4HCN B;  1T3Q A;  2J53 A;  1BUI C;  2WXL A;  3VTW A;  2NMQ A;  3UI3 A;  5H92 C;  4C00 A;  2IO0 B;  5G5G A;  2ZVN A;  1P0R A;  2LD9 A;  1WGK A;  3Q8C A;  2QIL A;  2Z0D B;  3PRP B;  3RPF C;  1WX9 A;  5E6N A;  1V97 A;  1UD7 A;  2R2Q A;  2HJ8 A;  3ZW3 A;  1QQR A;  2IDY A;  2K8H A;  3FAH A;  3UQA A;  4CYE A;  3AV8 A;  1KM7 A;  3PRE A;  2KNB A;  3VRB B;  1XLQ A;  3R2T A;  2KXJ A;  3IG3 A;  4URK A;  4IDI A;  3DDC B;  2G4S A;  1ZOY B;  4OVV A;  3M63 B;  2K1F A;  3TEY A;  1GAQ B;  1LFD A;  4NQK E;  1YNT E;  2Y3A A;  3KW5 B;  3Q8B A;  2N9X A;  4WWN A;  1I4H A;  2IGH A;  1OTR B;  2GBJ A;  2KQ7 A;  2GI9 A;  3P63 A;  2L05 A;  3MC9 A;  2RMM A;  4MT5 A;  3AEE B;  3M95 A;  1PDX A;  3PRZ A;  3IT4 B;  3BK1 A;  1L7Y A;  3BII D;  3IHP C;  4BBN C;  3DCG A;  1XXG A;  5BMH A;  4W9C A;  1OEY J;  3S2A A;  1T6B X;  1STE A;  1WYG A;  1FXI A;  1CK1 A;  3DVG X;  1SEB D;  1E90 A;  1XD3 B;  2WDR B;  2FCN A;  2D3A A;  4M00 A;  3A1Q A;  1ISN A;  1WM2 A;  2K3U A;  3R2I A;  4HVB A;  1WJN A;  3P2B A;  1TTN A;  3FC4 A;  2D3G A;  5C3J B;  5J18 A;  4OW0 A;  3APC A;  2JXT A;  3JYU A;  2KD0 A;  4E71 A;  2LAS A;  4W9I A;  2XK5 A;  3AXC A;  1QT9 A;  4YWG G;  2ZNV B;  4FHJ A;  1FM0 D;  2G45 B;  4GB9 A;  2ZNV C;  1DOI A;  3NOB A;  1QOG A;  1SF0 A;  2BPS A;  1FIQ A;  1ZPS A;  4TMA B;  4A20 A;  4MGZ E;  1V6E A;  2LWP A;  3L17 A;  1L0V B;  5HI1 A;  4BOZ B;  1V81 A;  4RFB A;  4ANV A;  1L6U A;  1KJT A;  1F77 A;  2W3R A;  3GP7 A;  4O1N A;  2I2Y A;  1ESF A;  2J42 A;  4BVU C;  4E3C A;  1TS5 A;  1YX6 B;  4HXD A;  3H9D A;  3BVM A;  2QSD A;  4JX1 C;  1SJE D;  2YEP F;  1SE4 A;  1Q1O A;  4WH4 A;  4A8X C;  2LGY A;  4JE3 B;  2MJE A;  1VRA B;  3RI7 C;  3EUB 2;  2LJ5 A;  1SE2 A;  3P4S B;  4OVU A;  4AS1 A;  1QLB B;  1P98 A;  2PEA A;  3V60 A;  3DBL B;  1UNS A;  3KVF B;  2IGD A;  1IP9 A;  2MW5 A;  1FFV A;  2J0K A;  4USA A;  1TGZ B;  4ZOH C;  4KV2 A;  3J9C A;  2DEN B;  4K7S A;  4NY0 A;  5FR6 A;  4XZ4 A;  3ZVV A;  1V49 A;  2WU5 B;  3W2D A;  3VUY A;  2KTF A;  3ZKJ C;  1NBF C;  1AAR A;  4X57 B;  1XLO A;  2WXO A;  3Q3M C;  3PVL A;  3ZNH B;  2KFK A;  2XNA C;  2V4L A;  5IOI A;  3A9K A;  5EE9 A;  2JWZ A;  3VTV A;  4MSM B;  2PPH A;  3DBH B;  2VH1 A;  2HTH A;  1P3Q U;  4LLG M;  1AWD A;  3JVZ X;  1DYQ A;  2LRW A;  3CST A;  4FJZ A;  5D2M B;  2MBB B;  3KYD D;  1WI0 A;  4K1R B;  1E8X A;  1T0Y A;  4MDK E;  4HCP B;  3BWU D;  1F1H A;  2FID A;  2BGF A;  4JWU C;  1CMX B;  1N5W A;  1ZUD 2;  1ZW7 A;  3AEF B;  4MGK E;  2WGS A;  2OHF A;  2HTM E;  5DPT A;  1MFW A;  2NTS A;  1QF6 A;  1YD8 U;  3B0A A;  3P4P B;  4A55 A;  2TSS A;  4YT0 B;  3ENE A;  1K51 A;  4GSW A;  2J0J A;  1VJK A;  4ZYS A;  1L6V A;  2RPQ A;  4EZJ A;  1C76 A;  4XDC A;  2KC2 A;  3O13 A;  3H6N A;  4J6I A;  3C8Y A;  2CJN A;  1WJ4 A;  1D5X C;  3T8M A;  1B9R A;  4P7I A;  4P6V F;  4M0W B;  3GS2 A;  1I7H A;  4A9A A;  4DK5 A;  1E7V A;  3Q8A A;  1WMH A;  1WZ3 A;  2KWD A;  4S17 A;  4K81 A;  1E6E B;  1PQS A;  4HPM B;  3L54 A;  4NQL B;  3I57 A;  3KQ4 A;  3N1X C;  4N6E B;  2AYO B;  4LNI A;  4LK0 M;  2FNJ B;  5AZH A;  2WNM A;  1T0S C;  1VZ7 A;  2LXC A;  3M3J A;  3OWE B;  1L0Y B;  1D5Z C;  1ZXH A;  1KH0 A;  2W3S A;  4HDQ A;  3ML9 A;  3SR6 A;  1ROE A;  3PSE B;  3BYY B;  3TEW A;  3NVW A;  1FEH A;  2BS2 B;  1PFD A;  2M19 A;  2JVC A;  3IVF A;  4JLC A;  4US9 A;  2BS4 B;  1LO5 D;  3B2F A;  3OJ4 B;  1V8C A;  1NI2 A;  3AH7 A;  3AU5 A;  2ICI A;  2RPV A;  3PLV A;  4W9D A;  3RNF C;  2O6V B;  3PPA A;  3IBE A;  3A4R A;  3Q14 C;  2DX5 B;  1N6Z A;  4W9L A;  5D3I B;  5TSS A;  4JL9 A;  3T9L A;  1C3T A;  4IUM B;  2I38 A;  5DPW A;  3WIM A;  1N62 A;  2FBW B;  1E5W A;  1YN3 A;  2MSE D;  2D5G A;  1GB4 A;  4KZ0 A;  2X38 A;  2QC8 A;  1MG4 A;  4GLS C;  4W9J A;  2KDB A;  1ET9 A;  1TIF A;  1CQV A;  1YJI A;  2EMT A;  3AEB B;  4DHZ E;  2Q5W D;  1QOA A;  2WHI A;  1GC6 A;  2BF8 B;  1EM7 A;  1YJJ A;  4DHJ B;  5TR5 A;  4MM3 A;  3NVY A;  2L52 A;  2NBU A;  2KVZ A;  3NZ3 A;  4ZHO A;  4W9K A;  3ZTC A;  3QWZ B;  4M0W A;  2BT6 A;  4PYU A;  3DVN U;  2WS3 B;  4ICV A;  3W9C B;  3H1U A;  4GDK A;  1JML A;  2BYF A;  4XC2 A;  4MSQ B;  5H8Y E;  1QKZ A;  4EFO A;  2RGF A;  1FCC C;  5C23 A;  4NJ6 A;  2H89 B;  4MH8 A;  1YOV B;  4C4V A;  3WAN A;  4MEL A;  4EZK A;  2D3C A;  4JIO U;  2GMI C;  3I63 C;  2HJ1 A;  1FRD A;  2HDE A;  2HE7 A;  3OLM D;  3PLU A;  2D2Q A;  2KYW A;  3NVV A;  3H8H A;  2LRU A;  1PGX A;  2GBM A;  2O6V A;  3RN9 C;  2JU6 X;  2KK8 A;  1S3S G;  3X0W A;  4WQO B;  2KWV B;  3ZRC A;  2NCN A;  5JZE B;  3KUZ A;  2FIF A;  3R7Q A;  1BXT A;  1HTQ A;  3T3O A;  1ACC A;  1TS2 A;  2WDQ B;  4HJG E;  1GPX A;  3UIO B;  2ZZP B;  5IA7 A;  3DBH I;  4FUL A;  5D7G A;  4ICU A;  3Q3N C;  2DHZ A;  1JRU A;  2K39 A;  3KWV A;  4GDL B;  1V2Y A;  5IO9 A;  2L8J A;  2LXA A;  5I4D A;  2JQR B;  4RGO S;  2MP2 A;  2BYT A;  2GOW A;  3I9V 1;  2WXP A;  1WRD B;  1X1M A;  3UF8 A;  5EDS A;  1HEZ E;  3QC8 B;  3WAM A;  3MTN B;  4MGY E;  5AEK B;  3LYY A;  3VR8 B;  3DBR I;  1E10 A;  3U4E G;  4TV3 A;  2RDG A;  1WZ0 A;  1EU3 A;  4A6Q A;  2BVC A;  2MBH A;  5FK9 C;  3KUC B;  2BKF A;  2AL6 A;  2N1V A;  2KMA A;  1ZDX A;  2PIA A;  5BYS A;  4EOY A;  1JWU D;  3U8Z A;  2RR9 A;  2M1M A;  4BKS D;  1WF9 A;  1YQB A;  3W1Y A;  1IGC A;  2V3S A;  1OGW A;  4MJS A;  3N1Y C;  4PS8 A;  2X8X X;  4GIV A;  2KX0 A;  2EEL A;  3ZDT A;  3U7D A;  1M94 A;  4ZRJ A;  4II3 B;  4FHK A;  3L16 A;  2FCQ A;  3SD5 A;  4DXF A;  1B1Z A;  5JXV A;  4FBJ B;  2DLB A;  2ACZ B;  1R4M I;  3C19 A;  2V0G A;  2MQJ A;  1TZ1 A;  2WU2 B;  3L0W B;  3RZW C;  1UWX A;  3A4S C;  4B9K A;  2J7Q B;  1L2N A;  4ZRQ A;  1XO3 A;  3VXW A;  2I1J A;  2WXH A;  2REX A;  3ZDM C;  5G55 A;  3BZD B;  2IO3 B;  4YTP B;  1FXA A;  2B76 B;  1TS3 A;  4EKU A;  2AQ3 B;  3WAO A;  1WE7 A;  1SE9 A;  3PGE A;  2IY0 B;  3AI5 A;  2K0P A;  2KVR A;  4G11 A;  4DBG A;  1WXQ A;  1RM6 C;  1F0Z A;  1YMH E;  2LUM A;  5EE1 A;  3ECI A;  4L23 A;  2WXN A;  4ZRI A;  4GOC A;  4WJQ A;  2LGX A;  1WY8 A;  5HHD G;  1V5T A;  1XT9 B;  4HKQ A;  1FNU A;  1NDD A;  1R4N I;  1XLP A;  1Q10 A;  2Y5B B;  3AEA B;  3EGR A;  1EF1 A;  3O65 B;  1VZ6 A;  3KUD B;  3N20 C;  1D5M C;  4EZL A;  1HA5 A;  4RGN A;  3JSV B;  1NYR A;  2IO2 B;  4KGR A;  1HQR D;  1T0R C;  2L1A A;  2D11 A;  3U2S C;  4F8C B;  1RYJ A;  2M0X A;  2MX2 A;  3NS1 A;  3P4Q B;  4AUQ C;  2KWU B;  4NJC A;  5DCN A;  2JY6 A;  2ONQ A;  1F9J A;  1KLV A;  2WXQ A;  4IC7 B;  3WA0 A;  1UEL A;  2XK5 B;  3EA6 A;  2MBO A;  2DZK A;  2CJO A;  4WUR A;  2N7D A;  1FNW A;  4JPS A;  2KO3 A;  3VH4 B;  2SEB D;  3KWL A;  1RLF A;  4A3O A;  1C78 A;  3MC8 A;  1JW9 D;  3AEC B;  5AUI A;  2BKR B;  5BYR A;  4EEW A;  2MJ3 A;  2K8B A;  2KX3 A;  1SXT A;  2AEH A;  5CHW A;  4OZB A;  2IYD B;  3NZU A;  3ZYY X;  3AN1 A;  1BT0 A;  2UU7 A;  3Q69 A;  3Q6B A;  3VTU A;  3N32 A;  2YEP B;  4IM0 A;  4CQN A;  4LDT D;  4I6P A;  2WYQ A;  2WLB A;  3ZNG C;  3AED B;  3KLS X;  2IGG A;  4HRS A;  2KN4 A;  5T8I A;  4IM2 A;  2KLG A;  3AE1 B;  4HPL B;  3RNB C;  1WX8 A;  1KLG D;  4C80 A;  2BBC A;  1P1A A;  1V9J A;  2J4X A;  5HG2 A;  2NPT B;  3V61 A;  4BZA A;  1Y56 A;  1WXM A;  4TSS A;  1YJ1 A;  1JRP A;  3APF A;  1YN5 A;  3A9J A;  1E8W A;  2N7E A;  2N0S B;  3B9J A;  5LLI A;  5JHB A;  4ITK A;  1WH3 A;  1RFA A;  2RDH A;  3IAS 1;  4L1B A;  5C1Z A;  1G6J A;  1NVI D;  3QHT A;  2MBQ A;  3V6E B;  2QDF A;  2M0A A;  4TQ1 A;  1H8C A;  2CHW A;  4XDD A;  4DDI D;  1XCT L;  1N61 A;  2C7M B;  4KVG B;  5JH5 C;  3SU8 X;  4IWQ A;  2GBR A;  2PE9 A;  2QIE B;  4MAC A;  3PHW B;  2BYV E;  3ZJU A;  4FJV B;  2M56 B;  3ZTD A;  1GUA B;  1WSP A;  1UUP A;  1J0G A;  1MHH E;  2LVP A;  5HKH A;  5AZG A;  1SJH D;  4IWP A;  3AE5 B;  2QJL A;  1E7U A;  3IT6 B;  2GRI A;  2KTR B;  3LB8 C;  4HPP A;  4XYC A;  2BWF A;  1RRB A;  1WFY A;  3A9J B;  3DPD A;  2ZCC A;  1YN4 A;  5AZF A;  1Z5S B;  2INN E;  4KX6 B;  2JZP A;  4PK1 A;  4PYZ A;  1XF5 L;  1T5X D;  1C1Y B;  4TKN A;  1RAX A;  1OQR A;  3CIR B;  4FLH A;  3NS8 A;  3UQB A;  3H7P A;  1ZXI A;  1WJU A;  5CHF A;  3GZN I;  4N58 A;  1OEY A;  5IN7 A;  2WDT B;  4B0E A;  1ENF A;  4BKG A;  2R61 A;  1J7B A;  3LJ3 A;  4DQO C;  2MHJ A;  2W55 A;  3EFU A;  3AM9 A;  3RNC C;  4LJO B;  3DQV A;  4N59 A;  4HWI B;  4RM9 A;  2C7N B;  1GG3 A;  3ABV B;  1QIL A;  2J0M A;  4RF0 A;  1JRO A;  1FMA D;  2LUE A;  1I4P A;  4DHZ B;  3DVG Y;  1EU4 A;  4RGM A;  4AQ7 A;  2JYT A;  3RMK C;  3PO0 A;  1ZKH A;  2ZW0 A;  4XE0 A;  5CHV C;  1ZP0 B;  3OG5 A;  4DDG D;  2A5U A;  4PT5 A;  4JWS C;  2LGS A;  3Q3O C;  4DXA B;  2JUO A;  4LDT B;  1D6E C;  3PTF C;  1AN8 A;  2AQ2 B;  2MWS B;  2H88 B;  4EE2 A;  4REZ A;  4KGT A;  4YSY B;  4WJP A;  2ZPN A;  3ZRF A;  4D2K A;  4IG7 B;  1WGY A;  2A4Z A;  3EC8 A;  4BAX A;  4WQM A;  3W1S A;  1I4Q A;  2C5L C;  3AE6 B;  1UGM A;  2E3T A;  4ZHP A;  5D6J B;  1FRR A;  1WXA A;  4RNA A;  2KJ6 A;  2V1Y A;  1XLN A;  1TZO A;  3ZLZ A;  3LDZ E;  2ASQ A;  3Q8E A;  2WXI A;  2UWQ A;  3TEX A;  2KN5 A;  5EE3 A;  2Z0E B;  4JQW C;  5E6P A;  2G4D B;  1ZDV A;  3MHZ A;  4IKG A;  3VHT C;  4II2 B;  3TL5 A;  1TKY A;  3N30 A;  1N63 A;  1FFU A;  4ANW A;  2DNF A;  2KQS A;  3DHI C;  3TCA A;  2N1W A;  2AWT A;  3Q8F A;  2V4I B;  2KOX A;  2AQ1 B;  3ZXR A;  3DOW A;  4P16 A;  4RM8 A;  2QCZ A;  4IWO A;  4ZRK A;  3N1Z C;  2IPK D;  1SBB B;  2PVO D;  1GJZ A;  1UBQ A;  1NEK B;  5MPO A;  2D07 B;  2IBI B;  3N9Y C;  2ZVO A;  3HM3 A;  1WGH A;  4G0N B;  4S0R A;  4F7Z A;  5CTR C;  3ZJT A;  4KDL B;  1HTO A;  2FUG 1;  1LQB A;  3M62 B;  5G2N A;  1UH6 A;  3SHQ A;  1TY0 A;  3DBS A;  2WDV B;  1WE6 A;  4I6L B;  1WM3 A;  4M01 A;  3Q3F A;  1K8R B;  1J7C A;  1BML C;  4KKJ A;  4M8M A;  3ML8 A;  5C2T B;  2L7R A;  2MLB A;  3A1Q B;  5BYQ A;  4CHK A;  2PKO A;  3BIN A;  4GGQ A;  4HLE A;  3AE7 B;  2WQY B;  2WXJ A;  1WGG A;  1HE8 A;  1WWT A;  4KSK C;  1L0X B;  2NBW B;  3P4R B;  2L32 A;  2DZI A;  4W9F A;  3RUI B;  1HZ6 A;  1F2R C;  4ZRP A;  3URY A;  1T0Q C;  4KKI A;  4DHJ D;  3AE4 B;  2Z59 B;  3RYT A;  2Y5P A;  2AX5 A;  1I35 A;  3NVZ A;  1C4A A;  1EO6 A;  2V9H A;  4ANU A;  1HXY D;  2KAC A;  1J19 A;  2YLM A;  1FNV A;  2G3Q B;  2V3P A;  4K3B A;  2V3N A;  1SSN A;  1TYG B;  3PZD A;  2RD0 A;  2KFK B;  4DXG A;  3CWI A;  4WWO A;  4AJW A;  2LMC A;  3VVW B;  3WAP A;  2QHO A;  1PUT A;  3AMZ A;  1VD2 A;  1SB3 C;  3IXS A;  1IPG A;  1UBI A;  1YQ3 B;  3TEZ A;  3BYT B;  2N9K A;  3SEB A;  4EUT A;  3TUO A;  3UIP B;  4AOF A;  2MP2 B;  1V1P A;  5IAA C;  3VDZ A;  2L0T A;  1C4C A;  4LJP B;  2L76 A;  5CX3 A;  5LNK 1;  1C9F A;  3QX1 A;  4TQ0 A;  3FIL B;  2JZZ A;  3TJP A;  1JCK B;  3ZXV A;  2KC1 A;  4G3X B;  1TJE A;  3E56 A;  2Y5C A;  3HRD D;  1FO4 A;  1JWM D;  4MM3 B;  4BFR A;  1YX5 B;  4LNO A;  2DAF A;  2C60 A;  1I4G A;  4MH0 E;  3HVD A;  1RFK A;  1R7S A;  1C79 A;  1Z2M A;  2LFI A;  3TMP B;  4LCD E;  5HFY A;  5J2R A;  4GMV A;  4UDU C;  1N5X A;  4DWF A;  2YVC A;  3GE3 C;  2K9X A;  3AU4 A;  1DOY A;  2FE8 A;  1WGD A;  4MEM A;  2ZEQ A;  3DBR B;  2NVU I;  3AE3 B;  4FN2 A;  3FKY A;  3MP9 A;  4WJN A;  2BB6 A;  1VR9 A;  2K6Q A;  4KGS A;  1E0Z A;  2L83 A;  1PGB A;  3DHG C;  4MGI E;  5JHA A;  1I4R A;  1TBE A;  3R8B A;  2KJR A;  1WMH B;  2JX5 A;  1IBX A;  3NZS A;  1KFY B;  1WX7 A;  3APD A;  2KAJ A;  1EF5 A;  1I4X A;  2DBY A;  2MEK A;  5GMV A;  2IJ0 A;  2BWE S;  3V6C B;  2K25 A;  3VUW A;  2L3Z A;  2PE6 B;  2BYE A;  3T3N A;  3QK0 A;  4NAW A;  1E8Z A;  2WXF A;  4M8N A;  2HD5 B;  3NY5 A;  2INP E;  2CU1 A;  1MPE A;  2KJH B;  1IGD A;  2I1K A;  1TT5 B;  4IOI E;  2FAZ A;  1PYW D;  3AUL A;  4P1B C;  1ET6 A;  1K52 A;  1NYQ A;  2DWQ A;  1WXS A;  4B6W A;  2W82 A;  1SE3 A;  2OJW A;  2O6V D;  5FKA C;  1V86 A;  1E7P B;  2M8S A;  3U52 E;  1UGJ A;  1VCB A;  3B08 A;  1WJ6 A;  2KDE B;  1XQQ A;  2G1E A;  2XN9 C;  4RMA A;  2KAN A;  1PGA A;  3VRA B;  2CHZ A;  3GB1 A;  4K7W A;  1TKG A;  1J8C A;  1FPY A;  1A70 A;  1GNU A;  1EUV B;  2MJD A;  4P1C C;  2CKH B;  1TKE A;  2LVQ A;  1EWY C;  2WWZ A;  2WXR A;  4B95 A;  4NNJ B;  1JAL A;  1DOX A;  1R4M B;  3N3K B;  5D94 A;  3QA8 A;  3MC0 B;  4ACF A;  3BY4 B;  4E74 A;  1C4P A;  4R3D A;  2GBN A;  1KTK A;  3PT2 B;  2ZW1 A;  1FCL A;  2LHE A;  4KDI C;  4GU2 A;  3MJ5 A;  1ZGU B;  4WWM A;  2N9L A;  2PVG C;  3ZO5 B;  3DWG C;  5E6O A;  4RCO A;  3A9K B;  3I5J C;  3JSV A;  3UGB B;  1GOZ A;  2B3A A;  4B0M A;  3TSS A;  3TBL D;  2DYB A;  1IYF A;  3RFZ B;  3A33 B;  4HEA 1;  3ETR A;  3RUL A;  3KYC D;  2Z8L A;  4FXC A;  2MRP A;  4OVZ A;  3V3X A;  1QZE A;  1FXT B;  3AEG B;  4W9E A;  2DYO A;  2GB1 A;  1J7A A;  4NAW B;  2LHD A;  1MHX A;  4GDK B;  1KLU D;  3W5V B;  1LXD A;  2LZ6 A;  3HVZ A;  1OQQ A;  2EKI A;  1Y8R C;  3MFG A;  1LGR A;  1Q5W B;  1K50 A;  1UF0 A;  1WYW B;  2JRI B;  2RDB C;  3HM6 X;  1IBX B;  2ON8 A;  1MG8 A;  3NG0 A;  1NI3 A;  4WIP A;  1MVK A;  3UIN B;  2IZV B;  2G9H D;  3PZ7 A;  5DPS A;  1JWA D;  3NJT A;  4K7U A;  3RD2 A;  3HUI A;  4TUU A;  2E6X A;  4WWP A;  2KKC A;  1L4Z B;  4JGH B;  5DPR A;  2FUH B;  3VQI A;  2D3B A;  4FAD A;  2DZJ A;  4FA6 A;  1XCQ L;  1P9D U;  3AE8 B;  1KRH A;  3HIZ A;  2RSU A;  5IP4 D;  2LGD A;  2JXX A;  1QOF A;  1GC7 A;  2WX1 A;  1MJD A;  3Q3J A;  3RT3 B;  2L0F A;  4ZYN A;  3IAM 1;  2O2V B;  3I3T B;  2DZM A;  1V80 A;  3EEC A;  4RF1 A;  2KWC A;  3L10 B;  3HK0 A;  3ZUN A;  4PS7 A;  2ZPY A;  4GDL A;  2JF5 A;  3ZNI D;  2C7H A;  4YL8 A;  1V5O A;  2KZR A;  5BMG A;  1V1P B;  1K53 A;  4BBN F;  3DHH C;  2K6D B;  3MJW A;  4US8 A;  4AP4 C;  3L13 A;  2NTT A;  3U7Z A;  4J3O D;  1U4A A;  2QMT A;  1D3Z A;  2GLS A;  1L4D B;  3JW0 X;  2JPH A;  2N7J A;  4C4V B;  2VRR B;  3E9S A;  3VUX A;  3V05 A;  1E8Y A;  4LNN A;  2N4F A;  2KFJ A;  1E9M A;  4KSL C;  3RNE C;  2JRH A;  4OZC A;  4WAA A;  3R7R A;  2WXG A;  4A90 A;  1GB1 A;  4HKZ E;  4N9F 4;  1CJE A;  4KZC A;  3AB5 A;  3OJ3 A;  2BB5 A;  2NS5 A;  2NBV B;  2K5P A;  1QOB A;  1OFF A;  2DAJ A;  4ZDV A;  1N60 A;  3TIX A;  4XWT A;  4YSX B;  1ZE3 D;  4W9H A;  1UWM A;  3DBL I;  3RZF A;  4YXD B;  2IY1 B;  1H4R A;  3C0R B;  2EMS A;  4C7Z A;  1S1Q B;  2PTL A;  4MJS B;  4BKT A;  4NZL B;  1CZP A;  1TY2 A;  1XEE A;  4HK2 A;  3BVZ A;  2UYZ B;  2VZK D;  4NPN A;  3ALB A;  3PS6 A;  2ZCB A;  4ANX A;  5KHO A;  4NJ7 A;  4WJO A;  3DVN V;  2ZJD A;  3B2G A;  4LNF A;  4WAF A;  1KF6 B;  2O2V A;  2KQ4 X;  3HHM A;  2BTE A;  2W54 A;  1AW7 A;  1JWS D;  3VR9 B;  2KLC A;  4LNK A;  1AYF A;  1M4V A;  3BK2 A;  1KOT A;  3SDL C;  4ARI A;  3VH3 B;  4H2A A;  3P1M A;  3RNG C;  2IND C;  3QAQ A;  3CMM B;  2PMV A;  4AJY B;  1VLB A;  3U30 A;  2MBE A;  2KDF B;  2WP9 B;  4L2Y A;  1UZX B;  3NRZ A;  3EHV A;  2PJH A;  2EKE C;  3ZQ4 A;  2KTR A;  3K9O B;  4XGA B;  3KH0 A;  2L00 B;  4I6N B;  2N9E B;  3BVG A;  2LGI A;  5KHQ A;  5BO4 B;  1I42 A;  1MI0 A;  3ONS A;  2BS3 B;  1WR1 A;  3SFD B;  3PZ8 A;  2C9W B;  1SIJ A;  5L95 C;  4ARC A;  5L83 A;  3VFK A;  4F1S A;  1WXV A;  4OZA A;  1SGH A;  1RWS A;  2WXM A;  1EWC A;  2BW2 A;  1NEN B;  5D3D A;  2LEK A;  3DWM A;  4HRO A;  4BKS A;  2D10 A;  1P7F A;  2KDM A;  1WR6 E;  5BMI A;  2WXK A;  2KT7 A;  2JWU A;  1Q0W B;  3QCA A;  5IKC M;  3GZN B;  2JZ3 B;  4XWW A;  2LVO A;  3ZGZ A;  2XEW A;  1L5P A;  3SFE B;  5EE0 A;  1D4B A;  2CS4 A;  4PS3 A;  3ZIM A;  2VH2 A;  2W9N A;  5FR3 A;  2JT4 B;  5GXG B;  3B1L X;  4GXB A;  5J17 A;  3OAW A;  3R3M A;  1LM8 B;  1P7E A;  2INC C;  2KHW B;  3ZNZ B;  2AL3 A;  4IW0 A;  5E6J A; 
#chains in the Genus database with same CATH homology
 1E7V A;  1WMH A;  1WZ3 A;  4TQ1 A;  2CHW A;  1H8C A;  4K81 A;  1PQS A;  2BWE S;  4HPM B;  3L54 A;  2K25 A;  2C7M B;  2FCS A;  4NQL B;  3V6C B;  3VUW A;  2L3Z A;  2PE6 B;  2BYE A;  3PV1 A;  4KVG B;  2OJR A;  2AYO B;  3QK0 A;  3W1S C;  5JH5 C;  4NAW A;  4HDO A;  1WGR A;  3CSF A;  2FNJ B;  3SU8 X;  5AZH A;  4IWQ A;  1E8Z A;  2GBR A;  2NPT A;  2PE9 A;  4GN1 A;  3M3J A;  2HD5 B;  2LXC A;  3NY5 A;  2BYV E;  3PHW B;  4M8N A;  3RCZ A;  4FJV B;  2CU1 A;  3MHS D;  2KJH B;  3ZTD A;  4HDQ A;  3ML9 A;  1GUA B;  2I1K A;  3PSE B;  3H7S A;  2FAZ A;  3AUL A;  1J0G A;  2LVP A;  2KMC A;  5HKH A;  5AZG A;  3VAW A;  2M17 A;  4IWP A;  2JVC A;  3IVF A;  1E7U A;  1WXS A;  4JLC A;  4B6W A;  2O6V D;  1OQY A;  3OJ4 B;  2XBB C;  1NI2 A;  1V86 A;  2KTR B;  4CO7 A;  3AU5 A;  2R2O A;  2KDI A;  3PLV A;  2M8S A;  4W9D A;  2BWF A;  1VCB A;  3B08 A;  1RRB A;  1WJ6 A;  1WFY A;  2KDE B;  2O6V B;  3A9J B;  2M4N A;  3WAL A;  1XQQ A;  2LI5 A;  3IBE A;  3DPD A;  3PPA A;  3X23 A;  4RMA A;  2KAN A;  2ZCC A;  3A4R A;  2CR5 A;  2CHZ A;  2OOB B;  4K7W A;  1J8C A;  2MA9 B;  3D32 A;  2DX5 B;  1GNU A;  4W9L A;  5AZF A;  1EUV B;  1Z5S B;  5LXI B;  4HJK A;  2CKH B;  4JL9 A;  3QAR A;  2WX0 A;  2K8C A;  3H7P B;  3QJZ A;  2LVQ A;  2WWZ A;  3T9L A;  4W9G A;  4IUM B;  4BOS C;  1C3T A;  5DPW A;  3CF6 E;  4G50 A;  4B95 A;  4NNJ B;  4PYZ A;  3WIM A;  1E5W A;  3QQ8 B;  2MSE D;  3L08 A;  1C1Y B;  3N3K B;  5D94 A;  3QA8 A;  4KZ0 A;  4TKN A;  3GOE A;  2N9P C;  3BY4 B;  4E74 A;  1RAX A;  4W9J A;  2KDB A;  2GBN A;  3PT2 B;  1SIF A;  4FLH A;  3NS8 A;  4KIK A;  3NHE B;  3UQB A;  3H7P A;  1WJU A;  2EMT A;  3GZN I;  5CHF A;  4KDI C;  4DHZ E;  1OEY A;  4GU2 A;  2WDT B;  3IFW B;  1ZGU B;  1GC6 A;  2BF8 B;  4DHJ B;  3V62 A;  5TR5 A;  4BKG A;  4MM3 A;  3ZO5 B;  2NBU A;  2DYM A;  5E6O A;  4ASW C;  3LJ3 A;  3PRM B;  4KIK B;  4AWJ A;  3A9K B;  3JSV A;  3K9P B;  3UGB B;  2B3A A;  3EFU A;  4W9K A;  3ZTC A;  3R66 C;  3QWZ B;  1A5R A;  4LJO B;  3DQV A;  3QIJ A;  3PHX B;  3TBL D;  4DDI D;  4HWI B;  2DYB A;  4PYU A;  1IYF A;  4RM9 A;  3A33 B;  4A3P A;  2C7N B;  3DVN U;  2GBK A;  2IO1 B;  4ICV A;  3RUL A;  2MCN B;  1GG3 A;  3H1U A;  4GDK A;  2NR2 A;  1WIA A;  3KYC D;  4XX5 A;  2J0M A;  1YIW A;  4IM3 A;  2BYF A;  4XC2 A;  4MSQ B;  4EFO A;  4FJY A;  2LUE A;  2MRP A;  2CHX A;  2RGF A;  5C23 A;  4DHZ B;  3DVG Y;  2FCM A;  5LXH A;  4NJ6 A;  1QZE A;  1FXT B;  4W9E A;  2DYO A;  4HCN B;  1ZKH A;  3WAN A;  4MEL A;  5CHV C;  4EZK A;  4JIO U;  2GMI C;  4NAW B;  4DDG D;  4GDK B;  2A5U A;  2HE7 A;  3OLM D;  3PLU A;  2D2Q A;  4DXA B;  2JUO A;  4LDT B;  1LXD A;  3VTW A;  2LZ6 A;  1Y8R C;  1WYW B;  1Q5W B;  2JRI B;  3PTF C;  2MWS B;  3HM6 X;  2IO0 B;  2ZVN A;  1P0R A;  4WJP A;  1MG8 A;  2LD9 A;  2LRU A;  2ZPN A;  3ZRF A;  4IG7 B;  2Z0D B;  3PRP B;  2GBM A;  2O6V A;  1WX9 A;  1WGY A;  2KK8 A;  5E6N A;  2A4Z A;  1S3S G;  1UD7 A;  2R2Q A;  3UIN B;  2HJ8 A;  3EC8 A;  2KWV B;  4WQO B;  3X0W A;  2IZV B;  3ZRC A;  2NCN A;  5JZE B;  3W1S A;  5DPS A;  3KUZ A;  2C5L C;  3ZW3 A;  2K8H A;  4K7U A;  1UGM A;  3RD2 A;  2FIF A;  3R7Q A;  3UQA A;  4CYE A;  4TUU A;  1KM7 A;  3PRE A;  5D6J B;  2KNB A;  1WXA A;  4WWP A;  2KXJ A;  2KKC A;  3IG3 A;  4JGH B;  4URK A;  5DPR A;  2KJ6 A;  2G4S A;  3DDC B;  2V1Y A;  4OVV A;  3UIO B;  2ZZP B;  5IA7 A;  2FUH B;  3DBH I;  2K1F A;  3M63 B;  4FUL A;  3VQI A;  5D7G A;  3ZLZ A;  1LFD A;  3KW5 B;  4ICU A;  4NQK E;  3LDZ E;  4WWN A;  2N9X A;  4FAD A;  2DHZ A;  2ASQ A;  1JRU A;  2DZJ A;  1OTR B;  2UWQ A;  2K39 A;  2KN5 A;  2Z0E B;  4GDL B;  4FA6 A;  2GBJ A;  4JQW C;  5E6P A;  1V2Y A;  2KQ7 A;  2G4D B;  2L8J A;  1P9D U;  3VHT C;  2LXA A;  2L05 A;  3HIZ A;  4II2 B;  3TL5 A;  2RSU A;  2LGD A;  3N30 A;  2JXX A;  2MP2 A;  4ANW A;  1GC7 A;  2GOW A;  3M95 A;  2KQS A;  2WX1 A;  3PRZ A;  3TCA A;  2N1W A;  1WRD B;  3Q3J A;  1X1M A;  3UF8 A;  5EDS A;  2AWT A;  3QC8 B;  3WAM A;  1L7Y A;  3MTN B;  4MGY E;  3RT3 B;  2L0F A;  5AEK B;  4ZYN A;  2O2V B;  3I3T B;  3DBR I;  3IHP C;  2DZM A;  4TV3 A;  4BBN C;  1V80 A;  3EEC A;  3DCG A;  1WZ0 A;  2KOX A;  2KWC A;  3L10 B;  3HK0 A;  4W9C A;  2MBH A;  3ZUN A;  3DOW A;  3KUC B;  2BKF A;  2AL6 A;  2N1V A;  1OEY J;  4PS7 A;  2KMA A;  2ZPY A;  2JF5 A;  4GDL A;  4RM8 A;  3S2A A;  3ZNI D;  2C7H A;  4IWO A;  4YL8 A;  4EOY A;  1V5O A;  2KZR A;  4ZRK A;  3U8Z A;  3DVG X;  1GJZ A;  2RR9 A;  2M1M A;  4BKS D;  1WF9 A;  1YQB A;  1E90 A;  4BBN F;  1UBQ A;  1XD3 B;  2FCN A;  2K6D B;  3MJW A;  3W1Y A;  2V3S A;  1OGW A;  4MJS A;  4AP4 C;  2D07 B;  4PS8 A;  3L13 A;  1U4A A;  3A1Q A;  1ISN A;  1D3Z A;  4GIV A;  2IBI B;  2KX0 A;  3JW0 X;  2ZVO A;  1WM2 A;  2JPH A;  4HVB A;  3HM3 A;  1WGH A;  1WJN A;  3ZDT A;  3P2B A;  3U7D A;  1TTN A;  1M94 A;  2VRR B;  4G0N B;  2D3G A;  4ZRJ A;  3VUX A;  4II3 B;  4F7Z A;  5CTR C;  4KDL B;  1E8Y A;  5J18 A;  4FHK A;  2FCQ A;  2KFJ A;  2N4F A;  1LQB A;  3APC A;  3JYU A;  3L16 A;  3SD5 A;  4KSL C;  2KD0 A;  4FBJ B;  3M62 B;  2JRH A;  4WAA A;  5G2N A;  4E71 A;  2LAS A;  3R7R A;  4W9I A;  1UH6 A;  3SHQ A;  2XK5 A;  1R4M I;  3AXC A;  4N9F 4;  2ZNV B;  4FHJ A;  2MQJ A;  3DBS A;  3OJ3 A;  4KZC A;  1TZ1 A;  2G45 B;  4GB9 A;  2ZNV C;  2NS5 A;  1WE6 A;  4I6L B;  1WM3 A;  3L0W B;  3NOB A;  3RZW C;  2NBV B;  2BPS A;  2DAJ A;  3Q3F A;  3A4S C;  1K8R B;  4ZDV A;  4B9K A;  2J7Q B;  1L2N A;  4M8M A;  3TIX A;  3ML8 A;  4A20 A;  4MGZ E;  2L7R A;  2MLB A;  1V6E A;  2LWP A;  3A1Q B;  4CHK A;  3L17 A;  2I1J A;  3VXW A;  4W9H A;  4BOZ B;  3BIN A;  2REX A;  3DBL I;  1V81 A;  4GGQ A;  3ZDM C;  3RZF A;  4HLE A;  2IY1 B;  5G55 A;  1H4R A;  4ANV A;  1WGG A;  3C0R B;  1KJT A;  2IO3 B;  1HE8 A;  2EMS A;  4KSK C;  1S1Q B;  2NBW B;  4EKU A;  3WAO A;  4MJS B;  1WE7 A;  1SE9 A;  2DZI A;  3PGE A;  4W9F A;  3RUI B;  4BKT A;  4BVU C;  4E3C A;  1YX6 B;  2IY0 B;  4HXD A;  3H9D A;  4HK2 A;  3AI5 A;  4DHJ D;  2Z59 B;  3RYT A;  2UYZ B;  2KVR A;  4G11 A;  4DBG A;  4NPN A;  1I35 A;  3ALB A;  3PS6 A;  1EO6 A;  2ZCB A;  4ANX A;  5KHO A;  4ANU A;  1Q1O A;  3ECI A;  4NJ7 A;  1J19 A;  2YLM A;  4ZRI A;  3DVN V;  2ZJD A;  2G3Q B;  4GOC A;  4WJO A;  2LGY A;  4WJQ A;  2LGX A;  1WY8 A;  1V5T A;  1XT9 B;  1NDD A;  1R4N I;  2Y5B B;  3PZD A;  2RD0 A;  2O2V A;  2KFK B;  3HHM A;  2LJ5 A;  1EF1 A;  4WWO A;  3O65 B;  4AJW A;  4OVU A;  3KUD B;  1P98 A;  2KLC A;  2PEA A;  3VVW B;  4EZL A;  3V60 A;  1KOT A;  3JSV B;  3WAP A;  2QHO A;  3KVF B;  1IP9 A;  2IO2 B;  3SDL C;  3VH3 B;  1VD2 A;  1IPG A;  1UBI A;  2J0K A;  2MW5 A;  1TGZ B;  4KV2 A;  2D11 A;  4F8C B;  3QAQ A;  2M0X A;  2DEN B;  2MX2 A;  3CMM B;  4K7S A;  4NY0 A;  4EUT A;  4AUQ C;  5FR6 A;  4XZ4 A;  4AJY B;  3ZVV A;  2KWU B;  3UIP B;  4AOF A;  1V49 A;  2MP2 B;  5DCN A;  2JY6 A;  5IAA C;  3VDZ A;  2KTF A;  3VUY A;  3ZKJ C;  3U30 A;  1F9J A;  1NBF C;  2L0T A;  1KLV A;  2MBE A;  4LJP B;  2KDF B;  2L76 A;  1AAR A;  1UZX B;  4IC7 B;  4X57 B;  3WA0 A;  5CX3 A;  1UEL A;  2XK5 B;  3EHV A;  2MBO A;  3PVL A;  3ZNH B;  2PJH A;  2KFK A;  3QX1 A;  2DZK A;  4TQ0 A;  2EKE C;  2JZZ A;  2N7D A;  3TJP A;  2KTR A;  3K9O B;  3KH0 A;  2V4L A;  2L00 B;  3A9K A;  2KO3 A;  2N9E B;  4I6N B;  2KC1 A;  4G3X B;  3VH4 B;  1RLF A;  4A3O A;  2JWZ A;  5KHQ A;  3VTV A;  4MSM B;  2PPH A;  5BO4 B;  1I42 A;  3ONS A;  2HTH A;  1P3Q U;  1WR1 A;  3JVZ X;  2BKR B;  2C9W B;  4EEW A;  4BFR A;  1YX5 B;  2LRW A;  2DAF A;  3CST A;  2K8B A;  2C60 A;  5L95 C;  2KX3 A;  4FJZ A;  2AEH A;  4MH0 E;  5CHW A;  5D2M B;  2MBB B;  3KYD D;  3VFK A;  2IYD B;  3NZU A;  4F1S A;  5L83 A;  1WXV A;  1WI0 A;  4K1R B;  1E8X A;  1T0Y A;  1SGH A;  4MDK E;  1Z2M A;  1BT0 A;  4HCP B;  3VTU A;  2FID A;  3N32 A;  4IM0 A;  3TMP B;  2BGF A;  4LDT D;  1CMX B;  4I6P A;  4LCD E;  2WYQ A;  3ZNG C;  5J2R A;  1ZW7 A;  4GMV A;  4DWF A;  4BKS A;  2YVC A;  2D10 A;  4IM2 A;  3AU4 A;  2KLG A;  1WR6 E;  4MGK E;  4HPL B;  1WGD A;  4MEM A;  1WX8 A;  2ZEQ A;  2NVU I;  1P1A A;  1V9J A;  1Q0W B;  2NPT B;  4FN2 A;  5DPT A;  3V61 A;  3QCA A;  2JZ3 B;  4WJN A;  1WXM A;  2K6Q A;  1YD8 U;  1YJ1 A;  2LVO A;  2XEW A;  3B0A A;  4MGI E;  2CS4 A;  3APF A;  5JHA A;  3A9J A;  1TBE A;  1E8W A;  3ENE A;  4GSW A;  4PS3 A;  2J0J A;  2N7E A;  3ZIM A;  2KJR A;  1WMH B;  2RPQ A;  4EZJ A;  2W9N A;  5LLI A;  3NZS A;  5JHB A;  2JT4 B;  2KC2 A;  3H6N A;  4J6I A;  1WH3 A;  3B1L X;  1WJ4 A;  4GXB A;  1WX7 A;  3APD A;  3T8M A;  1RFA A;  4P7I A;  5J17 A;  1EF5 A;  3OAW A;  3R3M A;  1LM8 B;  5GMV A;  5C1Z A;  4M0W B;  1G6J A;  2KHW B;  3ZNZ B;  4DK5 A;  3QHT A;  2AL3 A;  2MBQ A;  4IW0 A;  3V6E B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...