3VXWA

Crystal structure of saccharomyces cerevisiae atg8 complexed with atg32 aim
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
111
structure length
111
Chain Sequence
KSTFKSEYPFEKRKAESERIADRFKNRIPVICEKAEKSDIPEIDKRKYLVPADLTVGQFVYVIRKRIMLPPEKAIFIFVNDTLPPTAALMSAIYQEHKDKDGFLYVTYSGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Autophagy-related protein 8
publication title Autophagy-related protein 32 acts as autophagic degron and directly initiates mitophagy
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 32
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2012-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3vxwA00
4HDOA 3DOWA 2KHWB 4NQLB 4YL8A 1YIWA 2V3SA 1WJUA 3HHMA 1WMHA 3RZWC 1IPGA 3I3TB 3RYTA 1WGHA 4KSLC 3H7SA 1OGWA 2L0FA 1S1QB 4GXBA 4M0WB 1OQYA 1R4NI 4HCNB 2B3AA 3PREA 5CHFA 4CHKA 1NI2A 2ZVOA 2KDIA 4LJPB 2RSUA 3JSVA 2NBUA 3KUZA 4NJ6A 3UIOB 5CHVC 4WWPA 2REXA 4RMAA 3KUCB 2KD0A 2HD5B 2CHWA 2KTRA 2RPQA 4LDTD 2N1WA 1RAXA 2NBVB 4II2B 1F9JA 2A5UA 3QX1A 2LGXA 4FHKA 3IBEA 2HE7A 2KFJA 4BFRA 1V9JA 3WAMA 3L10B 4GDLA 2IO1B 3X23A 3PRPB 3U30A 3Q3FA 2L3ZA 4GGQA 3UQBA 4JQWC 4MSMB 4WWNA 1WZ0A 1S3SG 5AEKB 2NVUI 1E8WA 2UWQA 3LJ3A 4N9F4 2KNBA 2D2QA 3L13A 4AJYB 2K8HA 2KVRA 4W9HA 2DENB 3GOEA 4W9LA 3AULA 2C5LC 2CR5A 3T9LA 2K8CA 3PZDA 2HJ8A 3VUXA 1OEYJ 1WFYA 5DPTA 3W1SA 3R7RA 3VUWA 2NPTA 2OOBB 3ZNZB 3NZUA 3PTFC 2R2QA 2ZNVB 4I6LB 2J0JA 3DVGX 1WE6A 2GMIC 4IG7B 2DZKA 3H6NA 4DK5A 2G4DB 4ICUA 1V5TA 2BYFA 3JW0X 2ZPYA 3JVZX 3L0WB 4W9KA 4EFOA 1WX7A 2FCQA 3VHTC 4WJPA 1BT0A 2DZMA 4M8MA 3PLUA 5KHQA 2VRRB 2JWZA 3QIJA 4BKTA 2R2OA 1MG8A 2MA9B 3P2BA 4NQKE 3ZDTA 3M63B 2KZRA 2C60A 2LZ6A 3VTUA 2K25A 1Z2MA 2MP2A 3A9KA 4KDIC 3VUYA 2G3QB 2DYMA 3K9OB 4G3XB 3CSTA 4EZJA 2C7HA 4EOYA 2AWTA 1E8YA 3H9DA 2KK8A 2C9WB 2LVPA 2N7EA 2ZVNA 2ASQA 2M1MA 4MH0E 3V60A 1G6JA 4W9GA 2MQJA 3OJ4B 3ZNGC 2NS5A 1EF1A 4HPLB 3V6CB 4MGIE 3CF6E 2LVOA 2J0MA 4GMVA 1WR1A 4TUUA 2IO2B 3QK0A 4FULA 1U4AA 4PYZA 1UD7A 3VTVA 2GOWA 4IWOA 1IP9A 2LWPA 3IHPC 2FCMA 4AJWA 2O2VB 3APFA 3KH0A 2KDEB 2BWES 4W9DA 2KMCA 2OJRA 4IM0A 3RULA 4PS3A 2CU1A 2JT4B 2MBHA 2Z0DB 4G11A 3N30A 4IW0A 4K7UA 3VTWA 4BKGA 1NBFC 1A5RA 3B1LX 3EFUA 3A9JA 4EEWA 2DHZA 3VVWB 2K1FA 3PHWB 2KN5A 5JHBA 2GBMA 1GC6A 4E71A 1TGZB 1WXAA 1UBIA 2N9XA 3C0RB 4DHZB 3PV1A 4KSKC 3BINA 4B9KA 1EUVB 3R66C 4DDID 2LD9A 4G50A 2O6VB 2L76A 3UIPB 3WA0A 3UF8A 1WJNA 3R7QA 4B6WA 2AL3A 3AI5A 5JZEB 3HK0A 3JYUA 2KTFA 3PRMB 1V6EA 4P7IA 5AZHA 4PS8A 2BYVE 1WMHB 1WE7A 3A1QA 1WGYA 2L0TA 2D10A 2M4NA 2MWSB 2GBRA 2IZVB 4NPNA 4FLHA 3W1SC 2ZCBA 2KANA 4K7WA 4WJQA 4NNJB 3N3KB 4EZLA 3QHTA 3ZDMC 3PHXB 3MJWA 1D3ZA 2HTHA 3M95A 2KO3A 4MGKE 4HLEA 4ANXA 2IBIB 3R3MA 2MBQA 4FJZA 2GBNA 2LGDA 3L54A 4JIOU 2BKRB 2JRHA 4GOCA 3WALA 4IWQA 4ZRIA 2KDFB 3ONSA 2ZJDA 1YX6B 2KWVB 2Y5BB 4F7ZA 1Q0WB 1TZ1A 3VH3B 1RRBA 1WJ6A 3EECA 1TBEA 3ML8A 5AZFA 4CYEA 1GUAB 1RFAA 1E8XA 4MJSB 3KYCD 4F8CB 1EO6A 2JZ3B 2LRWA 3DBHI 4TV3A 3L16A 4HCPB 3QCAA 2O6VD 3EC8A 3OLMD 3V6EB 2N9PC 3RZFA 3U7DA 5G2NA 4J6IA 4MDKE 1XD3B 2ZCCA 1RLFA 3UGBB 1KJTA 3QJZA 4TQ0A 5DPRA 4AWJA 2JF5A 2MBBB 3KW5B 3PLVA 3DVGY 3H7PB 4AP4C 1E7VA 2LXCA 2N1VA 4BKSD 3ZNHB 4ASWC 4BOSC 5HKHA 2L05A 3NS8A 5EDSA 5J17A 3UQAA 1SGHA 2ZZPB 3RD2A 3EHVA 1WIAA 3L17A 5JH5C 2FUHB 3VAWA 4GB9A 2MP2B 3A9KB 3DDCB 3BY4B 3IVFA 4XZ4A 3T8MA 3QQ8B 4M8NA 2N7DA 4KV2A 2LRUA 4MELA 2AEHA 4HJKA 1WXVA 1VCBA 2W9NA 1V86A 2RGFA 5D6JB 3RCZA 1YJ1A 2MRPA 1WXSA 2JUOA 3ALBA 2EMTA 2BWFA 4FHJA 4ZDVA 1Q5WB 4AUQC 1T0YA 2L00B 3ZVVA 5E6OA 2PE9A 1V49A 3DBRI 4NJ7A 3TMPB 4MGYE 1C3TA 2C7MB 2PJHA 5DPWA 2KQSA 3KVFB 4HVBA 4W9EA 4BBNC 3AU5A 5CTRC 4IC7B 4KIKA 4W9JA 2KQ7A 4JGHB 4ANVA 3X0WA 3M62B 1C1YB 2KFKA 3ZNID 1P3QU 2IO3B 1XT9B 2CS4A 2MX2A 3VQIA 1NDDA 3TIXA 4GU2A 2PE6B 5J2RA 1KOTA 2KLGA 2D3GA 3A4RA 2KOXA 4FA6A 1EF5A 2IY1B 3DCGA 5TR5A 1Z5SB 4KDLB 4B95A 4K81A 3TL5A 4TKNA 2LUEA 3A1QB 3NY5A 2K8BA 4WWOA 2L8JA 3VFKA 4BVUC 3GZNI 1UH6A 3ECIA 1E8ZA 2LVQA 3HM3A 3VH4B 2IYDB 4DDGD 4NAWA 4GN1A 3APCA 2MSED 3O65B 3PSEB 4ZRKA 5IAAC 1WX8A 1WGRA 3ZIMA 4BBNF 1XQQA 1GC7A 4OVVA 3ZTDA 2N4FA 3WAOA 2I1JA 1SIFA 4PYUA 3V62A 2DZJA 2IY0B 3S2AA 4IM2A 5E6NA 4HDQA 3A33B 1WI0A 2KJHB 3KUDB 5L95C 4KVGB 2MCNB 1KLVA 2KDBA 3TCAA 3DBSA 4A3PA 3QARA 3ZLZA 3JSVB 1GG3A 2KJ6A 4I6PA 3QA8A 2M0XA 3DVNU 2LXAA 3PGEA 3WIMA 1WZ3A 2KTRB 1ISNA 3DPDA 5GMVA 2PPHA 4URKA 2DX5B 4EKUA 2N9EB 5L83A 3L08A 5CX3A 4I6NB 1V5OA 2BF8B 3M3JA 3RT3B 3ZKJC 2V1YA 3IFWB 2KWCA 4GDLB 4DBGA 1YD8U 3TJPA 2FNJB 4E3CA 3ZRCA 5FR6A 3ZRFA 4KZ0A 1WJ4A 5LXHA 1OEYA 4GDKA 3NHEB 2YLMA 3IG3A 5CHWA 3WANA 4XX5A 4E74A 4ICVA 5DCNA 3TBLD 3PVLA 2MBOA 2KKCA 1Q1OA 2MW5A 2JY6A 2RR9A 2ZEQA 1OTRB 1V80A 4FADA 4WJOA 1WR6E 2NPTB 4DXAB 4HXDA 5JHAA 2A4ZA 1M94A 2C7NB 4K1RB 4BKSA 1H8CA 2ZNVC 4PS7A 3H1UA 1P98A 2GBKA 2XK5A 2GBJA 4RM8A 5G55A 2DAFA 2K39A 3AXCA 2XBBC 3MTNB 2K6DB 1K8RB 2UYZB 2M8SA 1X1MA 2JZZA 2Z0EB 4MM3A 4NY0A 1LXDA 1J8CA 4AOFA 1LQBA 2LJ5A 2I1KA 2KX0A 4TQ1A 1ZKHA 2G4SA 2FCSA 1UGMA 1YX5B 2NCNA 2FIDA 2KJRA 1L7YA 4MJSA 4DHJB 5LXIB 4IUMB 1IYFA 1GNUA 3APDA 3QAQA 2AYOB 4FJVB 4KIKB 2M17A 1E90A 3RUIB 2CKHB 4LCDE 2EMSA 5C1ZA 2BPSA 3HIZA 3W1YA 1V2YA 1WXMA 1WGGA 3B0AA 2FAZA 2KFKB 2KC1A 2WX0A 1WYWB 1WGDA 1LM8B 4A3OA 2DAJA 2KC2A 3CMMB 4ZRJA 4EUTA 2KWUB 4G0NB 2LASA 4K7SA 3UINB 3B08A 3H7PA 1WRDB 1WM3A 2JVCA 2JPHA 2EKEC 4IWPA 1P1AA 3A9JB 2KLCA 1E7UA 3QWZB 1P9DU 3U8ZA 1QZEA 3LDZE 2D07B 1I35A 2WDTB 2WX1A 3CSFA 1PQSA 2RD0A 3DBLI 2ZPNA 3Q3JA 2AL6A 4NAWB 4GIVA 4GSWA 2XEWA 1TTNA 1WX9A 1WY8A 1UBQA 4DHZE 2NR2A 2KXJA 3ZUNA 4W9CA 1LFDA 1WF9A 4LJOB 3NZSA 4KZCA 2DYBA 3ZO5B 3V61A 3N32A 5C23A 4OVUA 4WAAA 1P0RA 2WYQA 3QC8B 3PT2B 4ANWA 4CO7A 4DHJD 3VXWA 3AU4A 1UZXB 3PRZA 5D2MB 1V81A 3HM6X 2KX3A 1ZGUB 3ML9A 4MSQB 3OAWA 4EZKA 3DVNV 1H4RA 3SU8X 2Z59B 4DWFA 2G45B 1J0GA 2KMAA 4MEMA 1R4MI 5DPSA 1J19A 2J0KA 3PPAA 5KHOA 1SE9A 2BYEA 1I42A 4ANUA 2CHZA 5E6PA 1KM7A 5BO4B 5IA7A 1AARA 2PEAA 2BGFA 4FN2A 1WH3A 2V4LA 3D32A 4MGZE 2JRIB 4HK2A 4HWIB 4LDTB 2O2VA 1FXTB 3KYDD 3OJ3A 2NBWB 2D11A 5LLIA 4WJNA 1UELA 2CHXA 2LGYA 3K9PB 1WM2A 1L2NA 4RM9A 4GDKB 4BOZB 2JXXA 4FJYA 4FBJB 3NOBA 2K6QA 3SD5A 3ZTCA 1Y8RC 3PS6A 4II3B 1VD2A 3A4SC 4A20A 5AZGA 5D7GA 2L7RA 2WWZA 2YVCA 4IM3A 3SHQA 4F1SA 1ZW7A 1YQBA 2BKFA 2DYOA 2QHOA 3ENEA 2IO0B 4W9IA 4XC2A 1GJZA 4HPMB 3MHSD 4WQOB 2LI5A 3ZW3A 1CMXB 4JLCA 4W9FA 1JRUA 2FIFA 4X57B 4ZYNA 3WAPA 3DQVA 2O6VA 5D94A 3SDLC 2FCNA 2MLBA 5J18A 3VDZA 1HE8A 2XK5B 1E5WA 4JL9A 2DZIA 2J7QB 2MBEA
chains in the Genus database with same CATH superfamily
4HDOA 3DOWA 1YIWA 2V3SA 1WJUA 1I4PA 4KSLC 3H7SA 1OGWA 1VJKA 3ZYYX 1P7FA 5HHDG 1OQYA 2B3AA 5CHFA 2INPE 1FIQA 2KDIA 2ZVOA 3UIOB 3AE7B 5CHVC 3ZGZA 1ZE3D 2NBVB 4II2B 3NVWA 1XXGA 4FHKA 4BFRA 2JYEA 2RMMA 1NVID 3U30A 4GGQA 1WGKA 4HPPA 2W3SA 4XGAB 2UWQA 1D5MC 3CIRB 3T3OA 3L13A 4W9HA 2KVRA 4JX1C 4HROA 2CR5A 2K8CA 3N1XC 3R7RA 2ZNVB 1FPYA 4IG7B 1MJDA 3R8BA 3ZJTA 2BYFA 2V0GA 3VHTC 4WJPA 5EE9A 2INCC 3PLUA 5IN7A 3QIJA 2BVCA 3DWGC 3M63B 1TKYA 4JE3B 2C60A 2MP2A 3A9KA 4XYCA 4EOYA 2AWTA 3H9DA 2C9WB 2M1MA 4MH0E 3DHGC 4A8XC 1EF1A 3V6CB 2BS3B 4GMVA 1UD7A 3VTVA 2GOWA 4ITKA 4AJWA 3GP7A 2BWES 2KMCA 4IM0A 5GXGB 4PS3A 2CU1A 2JT4B 2MBHA 1F0ZA 4IW0A 4K7UA 4BKGA 4EEWA 3FILB 3DHIC 2KN5A 3Q3OC 1GC6A 4E71A 1TGZB 1YJIA 3PV1A 1EUVB 3R66C 4DDID 2LD9A 2LHDA 3R7QA 2N9KA 2DLBA 1V6EA 5AZHA 2MJ3A 1WMHB 1ZUD2 2YEPF 1WGYA 4FLHA 3N3KB 3QHTA 4YSXB 1F1HA 1YN3A 1C79A 2MBQA 2LGDA 2V3NA 2BKRB 1JALA 1SE2A 1F2RC 4IWQA 2QEJC 4LLGM 2BB5A 3EECA 1N60A 1TBEA 3ML8A 1DGJA 3HUIA 3DBHI 3IT4B 3V3XA 3QCAA 1AYFA 3U7DA 4J6IA 4C7YA 3GB1A 4TQ0A 3ZXVA 3KW5B 3DVGY 5IO9A 1XLQA 3J9CA 3KWLA 3NS8A 3IXSA 1E6EB 2EKIA 3U52E 1WIAA 1F2RI 1FMAD 2MJEA 3T8MA 3B2FA 4XZ4A 4M8NA 2WDRB 4A90A 2LRUA 4MELA 1HZ6A 4ZRQA 2WLBA 5D6JB 3RNBC 4ZRPA 2MRPA 1UWXA 2BWFA 4C4VA 1T0YA 5E6OA 1V49A 4MGYE 5DPWA 3Q69A 3R2IA 5D3DA 3Q8FA 3M62B 4MACA 4HKQA 4NZLB 2PE6B 5J2RA 3AV8A 2D3GA 2KOXA 4B95A 3AE1B 3NY5A 2K8BA 2MJDA 4WWOA 3GZNI 2QMTA 2WXNA 1WGRA 3ZIMA 4WURA 1XQQA 1GC7A 2K3UA 4H2AA 3WAOA 1V1PB 4PYUA 3V62A 4XWTA 2DZJA 3TUOA 5E6NA 1N6ZA 2KJHB 3KUDB 4B0MA 1KLVA 2KDBA 4CQNA 2BBCA 4LNFA 3JSVB 1GG3A 1SJED 4I6PA 3I57A 2WNMA 4URKA 4I6NB 1IBXB 1JROA 4KKIA 1QT9A 2BQQA 3DBHB 4KGSA 5CHWA 1M4VA 4M02A 2KAJA 4E74A 2KKCA 2JY6A 2TSSA 3ZJVA 2ZEQA 4WJOA 4P1BC 1K51A 2Z8LA 4AS1A 3H1UA 1P98A 2GBKA 1WRIA 1XF5L 3Q8AA 2GBJA 4RM8A 2DAFA 3AEFB 3P42A 2WXRA 4C00A 1T3QA 1N5WA 1Y56A 1VZ6A 4NY0A 1J8CA 1EWCA 3AE3B 4A9AA 2NCNA 4DHJB 2RPVA 4IUMB 2LMCA 2KQ4X 3APDA 3QAQA 4KIKB 1E90A 3RUIB 2CKHB 1VZ8A 1T6BX 4RGNA 4XE0A 1WGGA 4L1BA 1WGDA 3ETRA 3ZJUA 4MH8A 1GB1A 3Q8CA 1WXQA 4K7SA 3UINB 2JPHA 4DXGA 2EKEC 4IWPA 2PIAA 2QC8A 3CWIA 2V4IB 3LDZE 3NG0A 3CSFA 3DBLI 2ZPNA 4YTMB 3RNCC 1UBQA 4DHZE 1I4QA 5T8IA 3NZSA 3EFCA 1FFVA 2JQRB 3V61A 3GZNB 5C23A 1P0RA 4DHJD 3AEEB 3AU4A 3PRZA 1VLBA 2JSVX 3HM6X 2KX3A 3ML9A 3AE8B 2OJWA 2KMAA 2DNFA 3PPAA 1KLUD 2BYEA 2WXQA 2CHZA 1KM7A 3L4PA 4ZYSA 2BGFA 1WH3A 3ABVB 5BYQA 4MGZE 4HWIB 1HTOA 1BUIC 1FXTB 2O2VA 3KYDD 3OJ3A 2DBYA 2NBWB 2D11A 3AEBB 1KH0A 2L83A 1UELA 1WM2A 1B9RA 4GDKB 4BOZB 1C4AA 3ZTCA 3Q8BA 3PS6A 2WXIA 5D7GA 2DYOA 2PVOD 4HPMB 3MHSD 2IJ0A 4JLCA 1JRUA 4JWSC 3WAPA 3DQVA 1FFUA 2XK5B 2J7QB 1IYFA 4M00A 4YL8A 3HHMA 3RZWC 1WGHA 5E6JA 2L0FA 4FXCA 3O13A 4HCNB 4CHKA 2FE8A 2RDGA 1Q10A 1JWBD 1NI2A 3NUHB 1L0YB 2W3RA 1NYRA 2KD0A 2MEKA 3T3NA 1F9JA 2A5UA 3QX1A 3IBEA 2HE7A 2IO1B 2V9HA 3PRPB 3RNFC 2OEDA 1S3SG 5AEKB 1E8WA 4N9F4 3E9SA 2DENB 2IGGA 3VR8B 1PGBA 2L1AA 4RCOA 3VUXA 1OEYJ 5DPTA 2OOBB 3ZNZB 1F77A 3NZUA 4I6LB 2J0JA 3DVGX 1WE6A 2GB1A 1RFKA 3AE9B 2WXFA 2G4DB 3ZXRA 1T0QC 2HDEA 2K0PA 2ZPYA 1XEEA 2X38A 3DBLB 1BT0A 1MG8A 2MA9B 3VTUA 2K25A 3K9OB 4G3XB 3LYYA 2C7HA 2WDVB 2ZVNA 2N7EA 2LVPA 3MJ5A 2MQJA 4HPLB 3W5VB 1WR1A 3QK0A 1U4AA 2AQ1B 1IP9A 2LWPA 1DOXA 5H8YE 3APFA 4W9DA 2OJRA 2CJOA 1SF0A 1HEZE 4N59A 3MC0B 3A9JA 2Y5PA 1UBIA 1IGCA 4P1CC 3BINA 3GE8C 1V1OA 2O6VB 5BMIA 2L76A 3UIPB 3WA0A 4B6WA 3JYUA 4P7IA 3LXFA 4AQ7A 2M4NA 2MWSB 3HRDD 3W1SC 2ZCBA 2KANA 4NNJB 3ZDMC 4YSYB 3PHXB 2BW2A 1D3ZA 3GE3C 4MGKE 2IBIB 1VZ7A 4FJZA 4C80A 1T5XD 3IT6B 4GOCA 3WALA 4MM3B 2KDFB 2ZJDA 2KWVB 1J7AA 1GPXA 2BB6A 4F8CB 3MHZA 4YTPB 1KFYB 1KF6B 2O6VD 3EC8A 1L5PA 4MDKE 2ZCCA 5DPRA 1P7EA 2JF5A 4BOSC 5HKHA 1GB4A 2UU7A 2PW9A 2R61A 2KN4A 2ZZPB 3EHVA 2FUHB 4GB9A 2MP2B 3A9KB 3QQ8B 3FAHA 5G5GA 2AEHA 4HJKA 1WXVA 4ZOHC 2W9NA 3RCZA 2JUOA 3ALBA 4FHJA 2NTTA 4NJ7A 2C7MB 2AQ2B 4HVBA 2D3CA 2KWDA 4K3CA 4BBNC 3AU5A 4A6QA 1DOIA 4IC7B 2LHEA 3AE4B 1A70A 1L6VA 3X0WA 2KFKA 3ZNID 3HVDA 1FD6A 2CS4A 2MX2A 3TIXA 3N20C 4C7ZA 2IGDA 1DOYA 2KLGA 3A4RA 2D3BA 2IY1B 5TR5A 4FA6A 1Z5SB 4KDLB 2LUEA 3VFKA 1UH6A 3VR9B 1E8ZA 3VH4B 4DDGD 4NAWA 2MSED 3PSEB 4ZRKA 1CZPA 1WX8A 2Y5CA 1UNSA 4BBNF 3U2SC 3ZTDA 1SJHD 1SIJA 3AEAB 1L0VB 2IY0B 1N5XA 2MCNB 4YXDB 1CQVA 3AM9A 2GLSA 3QARA 3ZLZA 3QA8A 4R3DA 2M0XA 2LXAA 1WZ3A 2KTRB 3AEDB 1ISNA 2WXMA 4IDIA 1OFFA 2PPHA 3NS1A 4ARIA 4YWGG 3L08A 5CX3A 2LGSA 3M3JA 3NZ3A 2V1YA 4GDLB 4DBGA 2AQ3B 3Q3NC 4E3CA 5FR6A 1OEYA 1E7PB 3PVLA 2WXJA 1YJJA 4KX6B 1WR6E 2NPTB 5BMHA 4C56C 1B1ZA 2A4ZA 1M94A 2WXPA 2OHFA 4ZHPA 1C4CA 5G55A 4Q2JA 3RN9C 4JWUC 2N7JA 2UYZB 2M8SA 1I4GA 1LXDA 2LJ5A 1ZKHA 2G4SA 3EGRA 2E3TA 2FCSA 1UGMA 3P4QB 1I7HA 2KJRA 5FK9C 3MFGA 4FJVB 4LCDE 5C1ZA 2BPSA 1KTKA 1V2YA 1JWAD 1WXMA 2I2YA 5EE0A 2JU6X 1XLOA 2FAZA 1TY0A 5EE1A 1LM8B 2KC2A 4ZRJA 1YN4A 1RYJA 2LASA 1I4RA 1WRDB 2RDBC 2JVCA 1FNWA 3R2TA 1E7UA 2WXKA 2BS2B 2ZW0A 2N9LA 1PQSA 4YTNB 3Q3JA 2AL6A 4GIVA 4OVZA 1PGXA 2LJIA 4WQMA 1WY8A 2NR2A 5JXVA 4W9CA 3BYTB 4LJOB 4KZCA 3W9CB 3E56A 1KLGD 1PFDA 4WAAA 3AMZA 4TSSA 4RNAA 1C78A 4MSQB 3DVNV 1SB3C 2SAKA 5BYRA 3SU8X 4DWFA 3V05A 1J0GA 1R4MI 1J19A 2VH1A 2J0KA 2L32A 5BO4B 1FNVA 5IA7A 2K9XA 1T0SC 2H89B 1EM7A 4LDTB 3VRAB 1TT5B 2M0AA 2LGYA 3K9PB 4RM9A 2JXXA 4FJYA 4FBJB 3NOBA 1D4BA 4WIPA 1Y8RC 3A4SC 2L7RA 2WWZA 3SHQA 1YQBA 2QHOA 5C2TB 2IO0B 4O1NA 4K3BA 1FCLA 4LTUA 4DXFA 4ZYNA 1AW7A 2W55A 3AEGB 4OW0A 5D94A 2FCNA 5J18A 3VDZA 2DZIA 1YOVB 1ZDXA 3I3TB 4GXBA 2QCZA 4M0WB 1CK1A 3PREA 3ZQ4A 4LJPB 2RSUA 3JSVA 1IGDA 4WWPA 2NMQA 2REXA 1MFWA 1FNUA 1OQRA 3N1YC 2CHWA 2RPQA 4LDTD 2GRIA 2N1WA 4TMAB 1TS3A 2BS4B 1XCQL 1IBXA 2WXLA 1RM6C 2FBWB 3WAMA 3L10B 4OZAA 3B9JA 3Q6BA 3Q3FA 4JQWC 3P63A 4LNNA 2KNBA 2D2QA 1CJEA 4W9LA 2C5LC 2LGIA 3PZDA 2HJ8A 2GMIC 1SSNA 2DZKA 2JZPA 1V5TA 3JW0X 3L0WB 4L23A 1WX7A 1JWUD 4M8MA 2LEKA 2VRRB 4BKTA 4NQKE 3ZDTA 2LZ6A 1Z2MA 4KDIC 3VUYA 3CSTA 4EZJA 1ZXIA 4N6EB 1G6JA 4KGRA 3OJ4B 3ZNGC 1NENB 2NS5A 3CF6E 4DQOC 2J0MA 2QDFA 4TUUA 1SE4A 3MC8A 1FXIA 4IWOA 2FCMA 1R4MB 2O2VB 3BYYB 1NYQA 2BT6A 1XCTL 4G11A 1NBFC 1A5RA 3B1LX 3EFUA 2DHZA 3LB8C 2K1FA 3PHWB 3URYA 5JHBA 2GBMA 2V3PA 4LNKA 1WXAA 2N9XA 3C0RB 4DHZB 4KSKC 1D5XC 2CJNA 4B9KA 4G50A 3TEXA 1MHXA 1QQRA 3UF8A 1OQQA 3HK0A 2KTFA 3PRMB 4YT0B 1JCKB 2BYVE 4PS8A 2KT7A 1WE7A 3A1QA 2L0TA 1FCCC 2D10A 2IZVB 4LK0M 2PKOA 4WJQA 3AN1A 3KLSX 4OZCA 2KO3A 4ANXA 3NVVA 4JIOU 3NJTA 1N63A 4KGTA 4ZRIA 1SE3A 4PT5A 4WH4A 3ONSA 3BWUD 5I4DA 2Y5BB 2XN9C 1Q0WB 3AECB 3VH3B 3TEZA 1SBBB 1RRBA 4USAA 1MG4A 4CYEA 3NRZA 1RFAA 1E8XA 4UDUC 4MJSB 1N62A 3KYCD 1EO6A 2HJ1A 2JZ3B 4TV3A 3L16A 4HCPB 3V6EB 4P6VF 3OLMD 1JW9D 3HVZA 3MP9A 3RZFA 2ACZB 2PTLA 5G2NA 3C19A 4A55A 1RLFA 1V8CA 3QJZA 4HKZE 4AWJA 1TS4A 2MBBB 3PLVA 3H7PB 2LXCA 2N1VA 4BKSD 3ZNHB 2L05A 5EDSA 1D6EC 5J17A 3U4EG 3UQAA 3RD2A 3DDCB 4MT5A 5HG2A 5EE3A 2N7DA 1VCBA 1JQ4A 3RNEC 1V86A 2RGFA 1ROEA 1YJ1A 1WXSA 1NI3A 2PLPA 2EMTA 2WHIA 2KVZA 1Q5WB 4ZDVA 2L00B 2PE9A 3DBRI 2PJHA 2KQSA 3KVFB 2KQ7A 4ANVA 3U7ZA 3C8YA 3OWEB 1XT9B 4OZBA 1NDDA 3AB5A 2BTEA 3DCGA 4K81A 3TL5A 4TKNA 3BK2A 1HQRD 2B76B 2L8JA 4BVUC 2IYDB 4N58A 3APCA 3O65B 4LNIA 4HJGE 1UGJA 1ZPSA 2KACA 2I1JA 1E10A 3S2AA 4HDQA 3A33B 1WI0A 3TCAA 3DBSA 2CU3A 2KJ6A 3I5JC 3PGEA 2N9EB 1NEKB 5D3IB 2ONQA 2BF8B 3ZKJC 3IFWB 5BYSA 3TEWA 1YD8U 1TIFA 2WS3B 2ZW1A 4KZ0A 1WJ4A 2YLMA 2J53A 4XX5A 4RGOS 2ON8A 4ICVA 5DCNA 3W5UB 2MBOA 2WU2B 2W54A 1J7CA 2E6XA 4M01A 1ZP0B 1V80A 4FADA 1PGAA 4ACFA 4HRSA 4DXAB 4HXDA 5JHAA 2C7NB 4K1RB 4ZHOA 3SFEB 1DYQA 1WSPA 1ZXHA 3PZ7A 3AXCA 3MTNB 5TSSA 2VH2A 1X1MA 4MM3A 1ACCA 2Z0EB 1N61A 3BVMA 2I1KA 4TQ1A 1JWMD 3SFDB 1ZDVA 1EWYC 5LXIB 1GNUA 2AYOB 1TKEA 2M17A 2JX5A 3W1YA 3HIZA 3DBRB 2K5PA 3B0AA 4IOIE 2VZKB 3WCQA 2KFKB 1J7BA 1WYWB 1AWDA 2WXOA 1V97A 4A3OA 4EUTA 2DAJA 4WAFA 2WQYB 4G0NB 3B08A 1WM3A 2WXHA 1EU3A 1P1AA 2KLCA 3EUB2 2D07B 2WDTB 2RD0A 3EA6A 4NAWB 4GSWA 1QILA 1TTNA 1LFDA 4L2YA 4BAXA 1PYWD 2DYBA 3N9YC 2WYQA 1V81A 1FO4A 1QOAA 4EZKA 1FXAA 1H4RA 1F52A 4QAYA 2VZKD 4PK1A 3SEBA 1SE9A 1E0ZA 1I42A 2ICIA 5G5HA 4RF0A 1ET6A 3N1ZC 2PEAA 4FN2A 1TJEA 2V4LA 1FEHA 3D32A 2K22A 1C77A 5LLIA 4WJNA 4US9A 4IKGA 3IAS1 1HXYD 3TEYA 1PDXA 3FILA 3DHHC 3SD5A 4II3B 1VD2A 5AZGA 2YVCA 4HLEA 1GJZA 2BKFA 3ENEA 4W9IA 1D5ZC 4NJCA 5AUIA 4WQOB 3ZW3A 1CMXB 4X57B 1MPEA 3P4PB 4JL9A 2MBEA 2KHWB 4NQLB 1C4PA 1WMHA 1IPGA 3RYTA 1S1QB 1BMLC 1R4NI 3BIID 5IKCM 3MC9A 2NBUA 3KUZA 4NJ6A 2KDMA 4RMAA 3KUCB 2HD5B 2KTRA 1RAXA 2WDQB 4YSZB 2LGXA 4C4VB 2KFJA 1V9JA 4GDLA 4J3OD 3X23A 2L3ZA 3UQBA 4MSMB 4WWNA 1WZ0A 4S0RA 2NVUI 3Q2AC 3LJ3A 1L0XB 2L52A 4AJYB 2K8HA 3GOEA 3KWVA 3AULA 3T9LA 4ARCA 1WFYA 3W1SA 3VUWA 4RF1A 2NPTA 2WP9B 3PTFC 3RI7C 2R2QA 2M19A 2INNE 3Q14C 3H6NA 4DK5A 4ICUA 2AX5A 3JVZX 4W9KA 4EFOA 5FKAC 2FCQA 2DZMA 3AE2B 1GOZA 3H8HA 5KHQA 5LNK1 1I4HA 1SXTA 2JWZA 2NTSA 2R2OA 1WWTA 3P2BA 2KZRA 1TYGB 2G3QB 2DYMA 1QLBB 1TY2A 1E8YA 1XLPA 2KK8A 3V60A 2ASQA 1ET9A 4W9GA 4MGIE 3RNGC 2LVOA 2W82A 2G1EA 1SEBD 2IO2B 5HI1A 4FULA 4PYZA 1UF0A 3IHPC 1FRDA 3KH0A 2KDEB 1IUEA 3RULA 3DWMA 2Z0DB 1I4XA 3N30A 3VTWA 1FM0D 1MI0A 3VVWB 2LFIA 1MVKA 2JWUA 5IP4D 1R7SA 5AUKA 4P16A 4OHJA 3BK1A 1QOBA 1AN8A 1WJNA 2AL3A 3AI5A 4REZA 5JZEB 2IDYA 1QOGA 2YEPB 1L4ZB 2GBRA 4NPNA 3AE6B 3RNAC 1UUPA 4K7WA 1VR9A 4HEA1 4EZLA 2IGHA 1K50A 3MJWA 2HTHA 2FUG1 3M95A 3R3MA 4XWWA 2GBNA 1V1PA 1R4NB 3L54A 1YMHE 5FR3A 2MHJA 2JRHA 3AH7A 1YX6B 4F7ZA 1TZ1A 1WJ6A 1STEA 5AZFA 2QILA 1GUAB 1HZ5A 2LRWA 3PO0A 1UWMA 1ESFA 1YQ4B 4KKJA 1XLNA 2N9PC 1T0RC 2J42A 3BVGA 2IPKD 1XD3B 3UGBB 1KJTA 4US8A 2KYWA 2J4XA 4AP4C 1E7VA 4ASWC 1SGHA 4M0WA 2BYTA 2PVGC 5JH5C 3L17A 1RWSA 3VAWA 3BY4B 3IVFA 2INDC 4KV2A 1YNTE 4NAMA 4RFBA 1ZOYB 1QKZA 3RFZB 4AUQC 3ZVVA 1YN5A 3TMPB 2J52A 1C3TA 1GAQB 4W9EA 1BXTA 5CTRC 4KIKA 3SR6A 4W9JA 4JGHB 1K52A 3NVZA 1C1YB 1P3QU 2IO3B 1JRPA 3VQIA 3FKYA 4GU2A 1KOTA 2I38A 3Q8EA 3B2GA 1EF5A 2D5GA 3A1QB 3W2DA 3ECIA 2LVQA 3HM3A 3P4RB 4GN1A 4EE2A 1PUTA 3Q3MC 5IAAC 3FC4A 2WU5B 2X8XX 4OVVA 2N4FA 5C3JB 3RMKC 3VRBB 1TZOA 1SIFA 2RDHA 3I63C 1EU4A 2QIEB 4IM2A 2WXGA 3AE5B 4JPSA 5L95C 4KVGB 2G9HD 1TS5A 1JWSD 2XNAC 4A3PA 3DVNU 3WIMA 4B0EA 3DPDA 4WWMA 5GMVA 2DX5B 3TSSA 4EKUA 5L83A 2M56B 1MHHE 1V5OA 3RT3B 2Y3AA 2KWCA 4LNOA 3TJPA 2FNJB 4XDCA 3ZRCA 5LXHA 3ZRFA 1LO5D 4GDKA 1C9FA 3NHEB 3IG3A 3WANA 3TBLD 1Q1OA 2MW5A 2RR9A 4RH6A 1OTRB 4BKSA 1H8CA 3P4SB 2ZNVC 4PS7A 5BMGA 3NVYA 2XK5A 2DWQA 2K39A 2XBBC 1TS2A 2K6DB 1K8RB 3BZDB 5IOIA 2QSDA 1VRAB 2JZZA 1TKGA 4AOFA 1LQBA 2KX0A 3RPFC 1YX5B 3BVZA 2FIDA 4MJSA 1L7YA 2WGSA 1HTQA 3UI3A 2MH7A 2JXTA 1HA5A 1LGRA 3P1MA 2EMSA 5MPOA 4RGMA 2HTME 3I9V1 2SEBD 2KC1A 2WX0A 4RGTA 1K53A 2D3AA 3CMMB 2KWUB 3H7PA 1JMLA 3A9JB 3QWZB 1P9DU 1XO3A 3U8ZA 1QZEA 2LUMA 1I35A 3PZ8A 2WX1A 2XEWA 1WX9A 3IAM1 5H92C 3OG5A 2KXJA 3ZUNA 1WF9A 4S17A 1L4DB 2N0SB 2QJLA 3ZO5B 3N32A 4OVUA 2JYTA 3QC8B 3PT2B 5HFYA 4ANWA 4CO7A 3VXWA 1UZXB 4XDDA 5D2MB 1ZGUB 3OAWA 2H88B 2Q5WD 2Z59B 4D2KA 2G45B 4MEMA 5DPSA 1QOFA 5KHOA 3KQ4A 4ANUA 1VDVA 5E6PA 2PMVA 4BZAA 1WYGA 1AARA 1E9MA 2JRIB 4HK2A 1L6UA 1KRHA 1FRRA 2CHXA 1L2NA 1YQ3B 2GI9A 2K6QA 1C76A 2EELA 4A20A 4IM3A 4F1SA 1ZW7A 3GS2A 4XC2A 4GLSC 1ENFA 2LI5A 4W9FA 2FIFA 2KMMA 2O6VA 3SDLC 1QF6A 2MLBA 1HE8A 1E5WA
chains in the Genus database with same CATH topology
4HDOA 3DOWA 2KHWB 4NQLB 4YL8A 1YIWA 2V3SA 1WJUA 3HHMA 1WMHA 3RZWC 1IPGA 3I3TB 3RYTA 1WGHA 4KSLC 3H7SA 1OGWA 2L0FA 1S1QB 4GXBA 4M0WB 1OQYA 1R4NI 4HCNB 2B3AA 3PREA 5CHFA 4CHKA 1NI2A 2ZVOA 2KDIA 4LJPB 2RSUA 3JSVA 2NBUA 3KUZA 4NJ6A 3UIOB 5CHVC 4WWPA 2REXA 4RMAA 3KUCB 2KD0A 2HD5B 2CHWA 2KTRA 2RPQA 4LDTD 2N1WA 1RAXA 2NBVB 4II2B 1F9JA 2A5UA 3QX1A 2LGXA 4FHKA 3IBEA 2HE7A 2KFJA 4BFRA 1V9JA 3WAMA 3L10B 4GDLA 2IO1B 3X23A 3PRPB 3U30A 3Q3FA 2L3ZA 4GGQA 3UQBA 4JQWC 4MSMB 4WWNA 1WZ0A 1S3SG 5AEKB 2NVUI 1E8WA 2UWQA 3LJ3A 4N9F4 2KNBA 2D2QA 3L13A 4AJYB 2K8HA 2KVRA 4W9HA 2DENB 3GOEA 4W9LA 3AULA 2C5LC 2CR5A 3T9LA 2K8CA 3PZDA 2HJ8A 3VUXA 1OEYJ 1WFYA 5DPTA 3W1SA 3R7RA 3VUWA 2NPTA 2OOBB 3ZNZB 3NZUA 3PTFC 2R2QA 2ZNVB 4I6LB 2J0JA 3DVGX 1WE6A 2GMIC 4IG7B 2DZKA 3H6NA 4DK5A 2G4DB 4ICUA 1V5TA 2BYFA 3JW0X 2ZPYA 3JVZX 3L0WB 4W9KA 4EFOA 1WX7A 2FCQA 3VHTC 4WJPA 1BT0A 2DZMA 4M8MA 3PLUA 5KHQA 2VRRB 2JWZA 3QIJA 4BKTA 2R2OA 1MG8A 2MA9B 3P2BA 4NQKE 3ZDTA 3M63B 2KZRA 2C60A 2LZ6A 3VTUA 2K25A 1Z2MA 2MP2A 3A9KA 4KDIC 3VUYA 2G3QB 2DYMA 3K9OB 4G3XB 3CSTA 4EZJA 2C7HA 4EOYA 2AWTA 1E8YA 3H9DA 2KK8A 2C9WB 2LVPA 2N7EA 2ZVNA 2ASQA 2M1MA 4MH0E 3V60A 1G6JA 4W9GA 2MQJA 3OJ4B 3ZNGC 2NS5A 1EF1A 4HPLB 3V6CB 4MGIE 3CF6E 2LVOA 2J0MA 4GMVA 1WR1A 4TUUA 2IO2B 3QK0A 4FULA 1U4AA 4PYZA 1UD7A 3VTVA 2GOWA 4IWOA 1IP9A 2LWPA 3IHPC 2FCMA 4AJWA 2O2VB 3APFA 3KH0A 2KDEB 2BWES 4W9DA 2KMCA 2OJRA 4IM0A 3RULA 4PS3A 2CU1A 2JT4B 2MBHA 2Z0DB 4G11A 3N30A 4IW0A 4K7UA 3VTWA 4BKGA 1NBFC 1A5RA 3B1LX 3EFUA 3A9JA 4EEWA 2DHZA 3VVWB 2K1FA 3PHWB 2KN5A 5JHBA 2GBMA 1GC6A 4E71A 1TGZB 1WXAA 1UBIA 2N9XA 3C0RB 4DHZB 3PV1A 4KSKC 3BINA 4B9KA 1EUVB 3R66C 4DDID 2LD9A 4G50A 2O6VB 2L76A 3UIPB 3WA0A 3UF8A 1WJNA 3R7QA 4B6WA 2AL3A 3AI5A 5JZEB 3HK0A 3JYUA 2KTFA 3PRMB 1V6EA 4P7IA 5AZHA 4PS8A 2BYVE 1WMHB 1WE7A 3A1QA 1WGYA 2L0TA 2D10A 2M4NA 2MWSB 2GBRA 2IZVB 4NPNA 4FLHA 3W1SC 2ZCBA 2KANA 4K7WA 4WJQA 4NNJB 3N3KB 4EZLA 3QHTA 3ZDMC 3PHXB 3MJWA 1D3ZA 2HTHA 3M95A 2KO3A 4MGKE 4HLEA 4ANXA 2IBIB 3R3MA 2MBQA 4FJZA 2GBNA 2LGDA 3L54A 4JIOU 2BKRB 2JRHA 4GOCA 3WALA 4IWQA 4ZRIA 2KDFB 3ONSA 2ZJDA 1YX6B 2KWVB 2Y5BB 4F7ZA 1Q0WB 1TZ1A 3VH3B 1RRBA 1WJ6A 3EECA 1TBEA 3ML8A 5AZFA 4CYEA 1GUAB 1RFAA 1E8XA 4MJSB 3KYCD 4F8CB 1EO6A 2JZ3B 2LRWA 3DBHI 4TV3A 3L16A 4HCPB 3QCAA 2O6VD 3EC8A 3OLMD 3V6EB 2N9PC 3RZFA 3U7DA 5G2NA 4J6IA 4MDKE 1XD3B 2ZCCA 1RLFA 3UGBB 1KJTA 3QJZA 4TQ0A 5DPRA 4AWJA 2JF5A 2MBBB 3KW5B 3PLVA 3DVGY 3H7PB 4AP4C 1E7VA 2LXCA 2N1VA 4BKSD 3ZNHB 4ASWC 4BOSC 5HKHA 2L05A 3NS8A 5EDSA 5J17A 3UQAA 1SGHA 2ZZPB 3RD2A 3EHVA 1WIAA 3L17A 5JH5C 2FUHB 3VAWA 4GB9A 2MP2B 3A9KB 3DDCB 3BY4B 3IVFA 4XZ4A 3T8MA 3QQ8B 4M8NA 2N7DA 4KV2A 2LRUA 4MELA 2AEHA 4HJKA 1WXVA 1VCBA 2W9NA 1V86A 2RGFA 5D6JB 3RCZA 1YJ1A 2MRPA 1WXSA 2JUOA 3ALBA 2EMTA 2BWFA 4FHJA 4ZDVA 1Q5WB 4AUQC 1T0YA 2L00B 3ZVVA 5E6OA 2PE9A 1V49A 3DBRI 4NJ7A 3TMPB 4MGYE 1C3TA 2C7MB 2PJHA 5DPWA 2KQSA 3KVFB 4HVBA 4W9EA 4BBNC 3AU5A 5CTRC 4IC7B 4KIKA 4W9JA 2KQ7A 4JGHB 4ANVA 3X0WA 3M62B 1C1YB 2KFKA 3ZNID 1P3QU 2IO3B 1XT9B 2CS4A 2MX2A 3VQIA 1NDDA 3TIXA 4GU2A 2PE6B 5J2RA 1KOTA 2KLGA 2D3GA 3A4RA 2KOXA 4FA6A 1EF5A 2IY1B 3DCGA 5TR5A 1Z5SB 4KDLB 4B95A 4K81A 3TL5A 4TKNA 2LUEA 3A1QB 3NY5A 2K8BA 4WWOA 2L8JA 3VFKA 4BVUC 3GZNI 1UH6A 3ECIA 1E8ZA 2LVQA 3HM3A 3VH4B 2IYDB 4DDGD 4NAWA 4GN1A 3APCA 2MSED 3O65B 3PSEB 4ZRKA 5IAAC 1WX8A 1WGRA 3ZIMA 4BBNF 1XQQA 1GC7A 4OVVA 3ZTDA 2N4FA 3WAOA 2I1JA 1SIFA 4PYUA 3V62A 2DZJA 2IY0B 3S2AA 4IM2A 5E6NA 4HDQA 3A33B 1WI0A 2KJHB 3KUDB 5L95C 4KVGB 2MCNB 1KLVA 2KDBA 3TCAA 3DBSA 4A3PA 3QARA 3ZLZA 3JSVB 1GG3A 2KJ6A 4I6PA 3QA8A 2M0XA 3DVNU 2LXAA 3PGEA 3WIMA 1WZ3A 2KTRB 1ISNA 3DPDA 5GMVA 2PPHA 4URKA 2DX5B 4EKUA 2N9EB 5L83A 3L08A 5CX3A 4I6NB 1V5OA 2BF8B 3M3JA 3RT3B 3ZKJC 2V1YA 3IFWB 2KWCA 4GDLB 4DBGA 1YD8U 3TJPA 2FNJB 4E3CA 3ZRCA 5FR6A 3ZRFA 4KZ0A 1WJ4A 5LXHA 1OEYA 4GDKA 3NHEB 2YLMA 3IG3A 5CHWA 3WANA 4XX5A 4E74A 4ICVA 5DCNA 3TBLD 3PVLA 2MBOA 2KKCA 1Q1OA 2MW5A 2JY6A 2RR9A 2ZEQA 1OTRB 1V80A 4FADA 4WJOA 1WR6E 2NPTB 4DXAB 4HXDA 5JHAA 2A4ZA 1M94A 2C7NB 4K1RB 4BKSA 1H8CA 2ZNVC 4PS7A 3H1UA 1P98A 2GBKA 2XK5A 2GBJA 4RM8A 5G55A 2DAFA 2K39A 3AXCA 2XBBC 3MTNB 2K6DB 1K8RB 2UYZB 2M8SA 1X1MA 2JZZA 2Z0EB 4MM3A 4NY0A 1LXDA 1J8CA 4AOFA 1LQBA 2LJ5A 2I1KA 2KX0A 4TQ1A 1ZKHA 2G4SA 2FCSA 1UGMA 1YX5B 2NCNA 2FIDA 2KJRA 1L7YA 4MJSA 4DHJB 5LXIB 4IUMB 1IYFA 1GNUA 3APDA 3QAQA 2AYOB 4FJVB 4KIKB 2M17A 1E90A 3RUIB 2CKHB 4LCDE 2EMSA 5C1ZA 2BPSA 3HIZA 3W1YA 1V2YA 1WXMA 1WGGA 3B0AA 2FAZA 2KFKB 2KC1A 2WX0A 1WYWB 1WGDA 1LM8B 4A3OA 2DAJA 2KC2A 3CMMB 4ZRJA 4EUTA 2KWUB 4G0NB 2LASA 4K7SA 3UINB 3B08A 3H7PA 1WRDB 1WM3A 2JVCA 2JPHA 2EKEC 4IWPA 1P1AA 3A9JB 2KLCA 1E7UA 3QWZB 1P9DU 3U8ZA 1QZEA 3LDZE 2D07B 1I35A 2WDTB 2WX1A 3CSFA 1PQSA 2RD0A 3DBLI 2ZPNA 3Q3JA 2AL6A 4NAWB 4GIVA 4GSWA 2XEWA 1TTNA 1WX9A 1WY8A 1UBQA 4DHZE 2NR2A 2KXJA 3ZUNA 4W9CA 1LFDA 1WF9A 4LJOB 3NZSA 4KZCA 2DYBA 3ZO5B 3V61A 3N32A 5C23A 4OVUA 4WAAA 1P0RA 2WYQA 3QC8B 3PT2B 4ANWA 4CO7A 4DHJD 3VXWA 3AU4A 1UZXB 3PRZA 5D2MB 1V81A 3HM6X 2KX3A 1ZGUB 3ML9A 4MSQB 3OAWA 4EZKA 3DVNV 1H4RA 3SU8X 2Z59B 4DWFA 2G45B 1J0GA 2KMAA 4MEMA 1R4MI 5DPSA 1J19A 2J0KA 3PPAA 5KHOA 1SE9A 2BYEA 1I42A 4ANUA 2CHZA 5E6PA 1KM7A 5BO4B 5IA7A 1AARA 2PEAA 2BGFA 4FN2A 1WH3A 2V4LA 3D32A 4MGZE 2JRIB 4HK2A 4HWIB 4LDTB 2O2VA 1FXTB 3KYDD 3OJ3A 2NBWB 2D11A 5LLIA 4WJNA 1UELA 2CHXA 2LGYA 3K9PB 1WM2A 1L2NA 4RM9A 4GDKB 4BOZB 2JXXA 4FJYA 4FBJB 3NOBA 2K6QA 3SD5A 3ZTCA 1Y8RC 3PS6A 4II3B 1VD2A 3A4SC 4A20A 5AZGA 5D7GA 2L7RA 2WWZA 2YVCA 4IM3A 3SHQA 4F1SA 1ZW7A 1YQBA 2BKFA 2DYOA 2QHOA 3ENEA 2IO0B 4W9IA 4XC2A 1GJZA 4HPMB 3MHSD 4WQOB 2LI5A 3ZW3A 1CMXB 4JLCA 4W9FA 1JRUA 2FIFA 4X57B 4ZYNA 3WAPA 3DQVA 2O6VA 5D94A 3SDLC 2FCNA 2MLBA 5J18A 3VDZA 1HE8A 2XK5B 1E5WA 4JL9A 2DZIA 2J7QB 2MBEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HDO A;  3DOW A;  2KHW B;  4NQL B;  4YL8 A;  1YIW A;  2V3S A;  1WJU A;  3HHM A;  1WMH A;  3RZW C;  1IPG A;  3I3T B;  3RYT A;  1WGH A;  4KSL C;  3H7S A;  1OGW A;  2L0F A;  1S1Q B;  4GXB A;  4M0W B;  1OQY A;  1R4N I;  4HCN B;  2B3A A;  3PRE A;  5CHF A;  4CHK A;  1NI2 A;  2ZVO A;  2KDI A;  4LJP B;  2RSU A;  3JSV A;  2NBU A;  3KUZ A;  4NJ6 A;  3UIO B;  5CHV C;  4WWP A;  2REX A;  4RMA A;  3KUC B;  2KD0 A;  2HD5 B;  2CHW A;  2KTR A;  2RPQ A;  4LDT D;  2N1W A;  1RAX A;  2NBV B;  4II2 B;  1F9J A;  2A5U A;  3QX1 A;  2LGX A;  4FHK A;  3IBE A;  2HE7 A;  2KFJ A;  4BFR A;  1V9J A;  3WAM A;  3L10 B;  4GDL A;  2IO1 B;  3X23 A;  3PRP B;  3U30 A;  3Q3F A;  2L3Z A;  4GGQ A;  3UQB A;  4JQW C;  4MSM B;  4WWN A;  1WZ0 A;  1S3S G;  5AEK B;  2NVU I;  1E8W A;  2UWQ A;  3LJ3 A;  4N9F 4;  2KNB A;  2D2Q A;  3L13 A;  4AJY B;  2K8H A;  2KVR A;  4W9H A;  2DEN B;  3GOE A;  4W9L A;  3AUL A;  2C5L C;  2CR5 A;  3T9L A;  2K8C A;  3PZD A;  2HJ8 A;  3VUX A;  1OEY J;  1WFY A;  5DPT A;  3W1S A;  3R7R A;  3VUW A;  2NPT A;  2OOB B;  3ZNZ B;  3NZU A;  3PTF C;  2R2Q A;  2ZNV B;  4I6L B;  2J0J A;  3DVG X;  1WE6 A;  2GMI C;  4IG7 B;  2DZK A;  3H6N A;  4DK5 A;  2G4D B;  4ICU A;  1V5T A;  2BYF A;  3JW0 X;  2ZPY A;  3JVZ X;  3L0W B;  4W9K A;  4EFO A;  1WX7 A;  2FCQ A;  3VHT C;  4WJP A;  1BT0 A;  2DZM A;  4M8M A;  3PLU A;  5KHQ A;  2VRR B;  2JWZ A;  3QIJ A;  4BKT A;  2R2O A;  1MG8 A;  2MA9 B;  3P2B A;  4NQK E;  3ZDT A;  3M63 B;  2KZR A;  2C60 A;  2LZ6 A;  3VTU A;  2K25 A;  1Z2M A;  2MP2 A;  3A9K A;  4KDI C;  3VUY A;  2G3Q B;  2DYM A;  3K9O B;  4G3X B;  3CST A;  4EZJ A;  2C7H A;  4EOY A;  2AWT A;  1E8Y A;  3H9D A;  2KK8 A;  2C9W B;  2LVP A;  2N7E A;  2ZVN A;  2ASQ A;  2M1M A;  4MH0 E;  3V60 A;  1G6J A;  4W9G A;  2MQJ A;  3OJ4 B;  3ZNG C;  2NS5 A;  1EF1 A;  4HPL B;  3V6C B;  4MGI E;  3CF6 E;  2LVO A;  2J0M A;  4GMV A;  1WR1 A;  4TUU A;  2IO2 B;  3QK0 A;  4FUL A;  1U4A A;  4PYZ A;  1UD7 A;  3VTV A;  2GOW A;  4IWO A;  1IP9 A;  2LWP A;  3IHP C;  2FCM A;  4AJW A;  2O2V B;  3APF A;  3KH0 A;  2KDE B;  2BWE S;  4W9D A;  2KMC A;  2OJR A;  4IM0 A;  3RUL A;  4PS3 A;  2CU1 A;  2JT4 B;  2MBH A;  2Z0D B;  4G11 A;  3N30 A;  4IW0 A;  4K7U A;  3VTW A;  4BKG A;  1NBF C;  1A5R A;  3B1L X;  3EFU A;  3A9J A;  4EEW A;  2DHZ A;  3VVW B;  2K1F A;  3PHW B;  2KN5 A;  5JHB A;  2GBM A;  1GC6 A;  4E71 A;  1TGZ B;  1WXA A;  1UBI A;  2N9X A;  3C0R B;  4DHZ B;  3PV1 A;  4KSK C;  3BIN A;  4B9K A;  1EUV B;  3R66 C;  4DDI D;  2LD9 A;  4G50 A;  2O6V B;  2L76 A;  3UIP B;  3WA0 A;  3UF8 A;  1WJN A;  3R7Q A;  4B6W A;  2AL3 A;  3AI5 A;  5JZE B;  3HK0 A;  3JYU A;  2KTF A;  3PRM B;  1V6E A;  4P7I A;  5AZH A;  4PS8 A;  2BYV E;  1WMH B;  1WE7 A;  3A1Q A;  1WGY A;  2L0T A;  2D10 A;  2M4N A;  2MWS B;  2GBR A;  2IZV B;  4NPN A;  4FLH A;  3W1S C;  2ZCB A;  2KAN A;  4K7W A;  4WJQ A;  4NNJ B;  3N3K B;  4EZL A;  3QHT A;  3ZDM C;  3PHX B;  3MJW A;  1D3Z A;  2HTH A;  3M95 A;  2KO3 A;  4MGK E;  4HLE A;  4ANX A;  2IBI B;  3R3M A;  2MBQ A;  4FJZ A;  2GBN A;  2LGD A;  3L54 A;  4JIO U;  2BKR B;  2JRH A;  4GOC A;  3WAL A;  4IWQ A;  4ZRI A;  2KDF B;  3ONS A;  2ZJD A;  1YX6 B;  2KWV B;  2Y5B B;  4F7Z A;  1Q0W B;  1TZ1 A;  3VH3 B;  1RRB A;  1WJ6 A;  3EEC A;  1TBE A;  3ML8 A;  5AZF A;  4CYE A;  1GUA B;  1RFA A;  1E8X A;  4MJS B;  3KYC D;  4F8C B;  1EO6 A;  2JZ3 B;  2LRW A;  3DBH I;  4TV3 A;  3L16 A;  4HCP B;  3QCA A;  2O6V D;  3EC8 A;  3OLM D;  3V6E B;  2N9P C;  3RZF A;  3U7D A;  5G2N A;  4J6I A;  4MDK E;  1XD3 B;  2ZCC A;  1RLF A;  3UGB B;  1KJT A;  3QJZ A;  4TQ0 A;  5DPR A;  4AWJ A;  2JF5 A;  2MBB B;  3KW5 B;  3PLV A;  3DVG Y;  3H7P B;  4AP4 C;  1E7V A;  2LXC A;  2N1V A;  4BKS D;  3ZNH B;  4ASW C;  4BOS C;  5HKH A;  2L05 A;  3NS8 A;  5EDS A;  5J17 A;  3UQA A;  1SGH A;  2ZZP B;  3RD2 A;  3EHV A;  1WIA A;  3L17 A;  5JH5 C;  2FUH B;  3VAW A;  4GB9 A;  2MP2 B;  3A9K B;  3DDC B;  3BY4 B;  3IVF A;  4XZ4 A;  3T8M A;  3QQ8 B;  4M8N A;  2N7D A;  4KV2 A;  2LRU A;  4MEL A;  2AEH A;  4HJK A;  1WXV A;  1VCB A;  2W9N A;  1V86 A;  2RGF A;  5D6J B;  3RCZ A;  1YJ1 A;  2MRP A;  1WXS A;  2JUO A;  3ALB A;  2EMT A;  2BWF A;  4FHJ A;  4ZDV A;  1Q5W B;  4AUQ C;  1T0Y A;  2L00 B;  3ZVV A;  5E6O A;  2PE9 A;  1V49 A;  3DBR I;  4NJ7 A;  3TMP B;  4MGY E;  1C3T A;  2C7M B;  2PJH A;  5DPW A;  2KQS A;  3KVF B;  4HVB A;  4W9E A;  4BBN C;  3AU5 A;  5CTR C;  4IC7 B;  4KIK A;  4W9J A;  2KQ7 A;  4JGH B;  4ANV A;  3X0W A;  3M62 B;  1C1Y B;  2KFK A;  3ZNI D;  1P3Q U;  2IO3 B;  1XT9 B;  2CS4 A;  2MX2 A;  3VQI A;  1NDD A;  3TIX A;  4GU2 A;  2PE6 B;  5J2R A;  1KOT A;  2KLG A;  2D3G A;  3A4R A;  2KOX A;  4FA6 A;  1EF5 A;  2IY1 B;  3DCG A;  5TR5 A;  1Z5S B;  4KDL B;  4B95 A;  4K81 A;  3TL5 A;  4TKN A;  2LUE A;  3A1Q B;  3NY5 A;  2K8B A;  4WWO A;  2L8J A;  3VFK A;  4BVU C;  3GZN I;  1UH6 A;  3ECI A;  1E8Z A;  2LVQ A;  3HM3 A;  3VH4 B;  2IYD B;  4DDG D;  4NAW A;  4GN1 A;  3APC A;  2MSE D;  3O65 B;  3PSE B;  4ZRK A;  5IAA C;  1WX8 A;  1WGR A;  3ZIM A;  4BBN F;  1XQQ A;  1GC7 A;  4OVV A;  3ZTD A;  2N4F A;  3WAO A;  2I1J A;  1SIF A;  4PYU A;  3V62 A;  2DZJ A;  2IY0 B;  3S2A A;  4IM2 A;  5E6N A;  4HDQ A;  3A33 B;  1WI0 A;  2KJH B;  3KUD B;  5L95 C;  4KVG B;  2MCN B;  1KLV A;  2KDB A;  3TCA A;  3DBS A;  4A3P A;  3QAR A;  3ZLZ A;  3JSV B;  1GG3 A;  2KJ6 A;  4I6P A;  3QA8 A;  2M0X A;  3DVN U;  2LXA A;  3PGE A;  3WIM A;  1WZ3 A;  2KTR B;  1ISN A;  3DPD A;  5GMV A;  2PPH A;  4URK A;  2DX5 B;  4EKU A;  2N9E B;  5L83 A;  3L08 A;  5CX3 A;  4I6N B;  1V5O A;  2BF8 B;  3M3J A;  3RT3 B;  3ZKJ C;  2V1Y A;  3IFW B;  2KWC A;  4GDL B;  4DBG A;  1YD8 U;  3TJP A;  2FNJ B;  4E3C A;  3ZRC A;  5FR6 A;  3ZRF A;  4KZ0 A;  1WJ4 A;  5LXH A;  1OEY A;  4GDK A;  3NHE B;  2YLM A;  3IG3 A;  5CHW A;  3WAN A;  4XX5 A;  4E74 A;  4ICV A;  5DCN A;  3TBL D;  3PVL A;  2MBO A;  2KKC A;  1Q1O A;  2MW5 A;  2JY6 A;  2RR9 A;  2ZEQ A;  1OTR B;  1V80 A;  4FAD A;  4WJO A;  1WR6 E;  2NPT B;  4DXA B;  4HXD A;  5JHA A;  2A4Z A;  1M94 A;  2C7N B;  4K1R B;  4BKS A;  1H8C A;  2ZNV C;  4PS7 A;  3H1U A;  1P98 A;  2GBK A;  2XK5 A;  2GBJ A;  4RM8 A;  5G55 A;  2DAF A;  2K39 A;  3AXC A;  2XBB C;  3MTN B;  2K6D B;  1K8R B;  2UYZ B;  2M8S A;  1X1M A;  2JZZ A;  2Z0E B;  4MM3 A;  4NY0 A;  1LXD A;  1J8C A;  4AOF A;  1LQB A;  2LJ5 A;  2I1K A;  2KX0 A;  4TQ1 A;  1ZKH A;  2G4S A;  2FCS A;  1UGM A;  1YX5 B;  2NCN A;  2FID A;  2KJR A;  1L7Y A;  4MJS A;  4DHJ B;  5LXI B;  4IUM B;  1IYF A;  1GNU A;  3APD A;  3QAQ A;  2AYO B;  4FJV B;  4KIK B;  2M17 A;  1E90 A;  3RUI B;  2CKH B;  4LCD E;  2EMS A;  5C1Z A;  2BPS A;  3HIZ A;  3W1Y A;  1V2Y A;  1WXM A;  1WGG A;  3B0A A;  2FAZ A;  2KFK B;  2KC1 A;  2WX0 A;  1WYW B;  1WGD A;  1LM8 B;  4A3O A;  2DAJ A;  2KC2 A;  3CMM B;  4ZRJ A;  4EUT A;  2KWU B;  4G0N B;  2LAS A;  4K7S A;  3UIN B;  3B08 A;  3H7P A;  1WRD B;  1WM3 A;  2JVC A;  2JPH A;  2EKE C;  4IWP A;  1P1A A;  3A9J B;  2KLC A;  1E7U A;  3QWZ B;  1P9D U;  3U8Z A;  1QZE A;  3LDZ E;  2D07 B;  1I35 A;  2WDT B;  2WX1 A;  3CSF A;  1PQS A;  2RD0 A;  3DBL I;  2ZPN A;  3Q3J A;  2AL6 A;  4NAW B;  4GIV A;  4GSW A;  2XEW A;  1TTN A;  1WX9 A;  1WY8 A;  1UBQ A;  4DHZ E;  2NR2 A;  2KXJ A;  3ZUN A;  4W9C A;  1LFD A;  1WF9 A;  4LJO B;  3NZS A;  4KZC A;  2DYB A;  3ZO5 B;  3V61 A;  3N32 A;  5C23 A;  4OVU A;  4WAA A;  1P0R A;  2WYQ A;  3QC8 B;  3PT2 B;  4ANW A;  4CO7 A;  4DHJ D;  3VXW A;  3AU4 A;  1UZX B;  3PRZ A;  5D2M B;  1V81 A;  3HM6 X;  2KX3 A;  1ZGU B;  3ML9 A;  4MSQ B;  3OAW A;  4EZK A;  3DVN V;  1H4R A;  3SU8 X;  2Z59 B;  4DWF A;  2G45 B;  1J0G A;  2KMA A;  4MEM A;  1R4M I;  5DPS A;  1J19 A;  2J0K A;  3PPA A;  5KHO A;  1SE9 A;  2BYE A;  1I42 A;  4ANU A;  2CHZ A;  5E6P A;  1KM7 A;  5BO4 B;  5IA7 A;  1AAR A;  2PEA A;  2BGF A;  4FN2 A;  1WH3 A;  2V4L A;  3D32 A;  4MGZ E;  2JRI B;  4HK2 A;  4HWI B;  4LDT B;  2O2V A;  1FXT B;  3KYD D;  3OJ3 A;  2NBW B;  2D11 A;  5LLI A;  4WJN A;  1UEL A;  2CHX A;  2LGY A;  3K9P B;  1WM2 A;  1L2N A;  4RM9 A;  4GDK B;  4BOZ B;  2JXX A;  4FJY A;  4FBJ B;  3NOB A;  2K6Q A;  3SD5 A;  3ZTC A;  1Y8R C;  3PS6 A;  4II3 B;  1VD2 A;  3A4S C;  4A20 A;  5AZG A;  5D7G A;  2L7R A;  2WWZ A;  2YVC A;  4IM3 A;  3SHQ A;  4F1S A;  1ZW7 A;  1YQB A;  2BKF A;  2DYO A;  2QHO A;  3ENE A;  2IO0 B;  4W9I A;  4XC2 A;  1GJZ A;  4HPM B;  3MHS D;  4WQO B;  2LI5 A;  3ZW3 A;  1CMX B;  4JLC A;  4W9F A;  1JRU A;  2FIF A;  4X57 B;  4ZYN A;  3WAP A;  3DQV A;  2O6V A;  5D94 A;  3SDL C;  2FCN A;  2MLB A;  5J18 A;  3VDZ A;  1HE8 A;  2XK5 B;  1E5W A;  4JL9 A;  2DZI A;  2J7Q B;  2MBE A; 
#chains in the Genus database with same CATH topology
 4HDO A;  3DOW A;  1YIW A;  2V3S A;  1WJU A;  1I4P A;  4KSL C;  3H7S A;  1OGW A;  1VJK A;  3ZYY X;  1P7F A;  5HHD G;  1OQY A;  2B3A A;  5CHF A;  2INP E;  1FIQ A;  2KDI A;  2ZVO A;  3UIO B;  3AE7 B;  5CHV C;  3ZGZ A;  1ZE3 D;  2NBV B;  4II2 B;  3NVW A;  1XXG A;  4FHK A;  4BFR A;  2JYE A;  2RMM A;  1NVI D;  3U30 A;  4GGQ A;  1WGK A;  4HPP A;  2W3S A;  4XGA B;  2UWQ A;  1D5M C;  3CIR B;  3T3O A;  3L13 A;  4W9H A;  2KVR A;  4JX1 C;  4HRO A;  2CR5 A;  2K8C A;  3N1X C;  3R7R A;  2ZNV B;  1FPY A;  4IG7 B;  1MJD A;  3R8B A;  3ZJT A;  2BYF A;  2V0G A;  3VHT C;  4WJP A;  5EE9 A;  2INC C;  3PLU A;  5IN7 A;  3QIJ A;  2BVC A;  3DWG C;  3M63 B;  1TKY A;  4JE3 B;  2C60 A;  2MP2 A;  3A9K A;  4XYC A;  4EOY A;  2AWT A;  3H9D A;  2C9W B;  2M1M A;  4MH0 E;  3DHG C;  4A8X C;  1EF1 A;  3V6C B;  2BS3 B;  4GMV A;  1UD7 A;  3VTV A;  2GOW A;  4ITK A;  4AJW A;  3GP7 A;  2BWE S;  2KMC A;  4IM0 A;  5GXG B;  4PS3 A;  2CU1 A;  2JT4 B;  2MBH A;  1F0Z A;  4IW0 A;  4K7U A;  4BKG A;  4EEW A;  3FIL B;  3DHI C;  2KN5 A;  3Q3O C;  1GC6 A;  4E71 A;  1TGZ B;  1YJI A;  3PV1 A;  1EUV B;  3R66 C;  4DDI D;  2LD9 A;  2LHD A;  3R7Q A;  2N9K A;  2DLB A;  1V6E A;  5AZH A;  2MJ3 A;  1WMH B;  1ZUD 2;  2YEP F;  1WGY A;  4FLH A;  3N3K B;  3QHT A;  4YSX B;  1F1H A;  1YN3 A;  1C79 A;  2MBQ A;  2LGD A;  2V3N A;  2BKR B;  1JAL A;  1SE2 A;  1F2R C;  4IWQ A;  2QEJ C;  4LLG M;  2BB5 A;  3EEC A;  1N60 A;  1TBE A;  3ML8 A;  1DGJ A;  3HUI A;  3DBH I;  3IT4 B;  3V3X A;  3QCA A;  1AYF A;  3U7D A;  4J6I A;  4C7Y A;  3GB1 A;  4TQ0 A;  3ZXV A;  3KW5 B;  3DVG Y;  5IO9 A;  1XLQ A;  3J9C A;  3KWL A;  3NS8 A;  3IXS A;  1E6E B;  2EKI A;  3U52 E;  1WIA A;  1F2R I;  1FMA D;  2MJE A;  3T8M A;  3B2F A;  4XZ4 A;  4M8N A;  2WDR B;  4A90 A;  2LRU A;  4MEL A;  1HZ6 A;  4ZRQ A;  2WLB A;  5D6J B;  3RNB C;  4ZRP A;  2MRP A;  1UWX A;  2BWF A;  4C4V A;  1T0Y A;  5E6O A;  1V49 A;  4MGY E;  5DPW A;  3Q69 A;  3R2I A;  5D3D A;  3Q8F A;  3M62 B;  4MAC A;  4HKQ A;  4NZL B;  2PE6 B;  5J2R A;  3AV8 A;  2D3G A;  2KOX A;  4B95 A;  3AE1 B;  3NY5 A;  2K8B A;  2MJD A;  4WWO A;  3GZN I;  2QMT A;  2WXN A;  1WGR A;  3ZIM A;  4WUR A;  1XQQ A;  1GC7 A;  2K3U A;  4H2A A;  3WAO A;  1V1P B;  4PYU A;  3V62 A;  4XWT A;  2DZJ A;  3TUO A;  5E6N A;  1N6Z A;  2KJH B;  3KUD B;  4B0M A;  1KLV A;  2KDB A;  4CQN A;  2BBC A;  4LNF A;  3JSV B;  1GG3 A;  1SJE D;  4I6P A;  3I57 A;  2WNM A;  4URK A;  4I6N B;  1IBX B;  1JRO A;  4KKI A;  1QT9 A;  2BQQ A;  3DBH B;  4KGS A;  5CHW A;  1M4V A;  4M02 A;  2KAJ A;  4E74 A;  2KKC A;  2JY6 A;  2TSS A;  3ZJV A;  2ZEQ A;  4WJO A;  4P1B C;  1K51 A;  2Z8L A;  4AS1 A;  3H1U A;  1P98 A;  2GBK A;  1WRI A;  1XF5 L;  3Q8A A;  2GBJ A;  4RM8 A;  2DAF A;  3AEF B;  3P42 A;  2WXR A;  4C00 A;  1T3Q A;  1N5W A;  1Y56 A;  1VZ6 A;  4NY0 A;  1J8C A;  1EWC A;  3AE3 B;  4A9A A;  2NCN A;  4DHJ B;  2RPV A;  4IUM B;  2LMC A;  2KQ4 X;  3APD A;  3QAQ A;  4KIK B;  1E90 A;  3RUI B;  2CKH B;  1VZ8 A;  1T6B X;  4RGN A;  4XE0 A;  1WGG A;  4L1B A;  1WGD A;  3ETR A;  3ZJU A;  4MH8 A;  1GB1 A;  3Q8C A;  1WXQ A;  4K7S A;  3UIN B;  2JPH A;  4DXG A;  2EKE C;  4IWP A;  2PIA A;  2QC8 A;  3CWI A;  2V4I B;  3LDZ E;  3NG0 A;  3CSF A;  3DBL I;  2ZPN A;  4YTM B;  3RNC C;  1UBQ A;  4DHZ E;  1I4Q A;  5T8I A;  3NZS A;  3EFC A;  1FFV A;  2JQR B;  3V61 A;  3GZN B;  5C23 A;  1P0R A;  4DHJ D;  3AEE B;  3AU4 A;  3PRZ A;  1VLB A;  2JSV X;  3HM6 X;  2KX3 A;  3ML9 A;  3AE8 B;  2OJW A;  2KMA A;  2DNF A;  3PPA A;  1KLU D;  2BYE A;  2WXQ A;  2CHZ A;  1KM7 A;  3L4P A;  4ZYS A;  2BGF A;  1WH3 A;  3ABV B;  5BYQ A;  4MGZ E;  4HWI B;  1HTO A;  1BUI C;  1FXT B;  2O2V A;  3KYD D;  3OJ3 A;  2DBY A;  2NBW B;  2D11 A;  3AEB B;  1KH0 A;  2L83 A;  1UEL A;  1WM2 A;  1B9R A;  4GDK B;  4BOZ B;  1C4A A;  3ZTC A;  3Q8B A;  3PS6 A;  2WXI A;  5D7G A;  2DYO A;  2PVO D;  4HPM B;  3MHS D;  2IJ0 A;  4JLC A;  1JRU A;  4JWS C;  3WAP A;  3DQV A;  1FFU A;  2XK5 B;  2J7Q B;  1IYF A;  4M00 A;  4YL8 A;  3HHM A;  3RZW C;  1WGH A;  5E6J A;  2L0F A;  4FXC A;  3O13 A;  4HCN B;  4CHK A;  2FE8 A;  2RDG A;  1Q10 A;  1JWB D;  1NI2 A;  3NUH B;  1L0Y B;  2W3R A;  1NYR A;  2KD0 A;  2MEK A;  3T3N A;  1F9J A;  2A5U A;  3QX1 A;  3IBE A;  2HE7 A;  2IO1 B;  2V9H A;  3PRP B;  3RNF C;  2OED A;  1S3S G;  5AEK B;  1E8W A;  4N9F 4;  3E9S A;  2DEN B;  2IGG A;  3VR8 B;  1PGB A;  2L1A A;  4RCO A;  3VUX A;  1OEY J;  5DPT A;  2OOB B;  3ZNZ B;  1F77 A;  3NZU A;  4I6L B;  2J0J A;  3DVG X;  1WE6 A;  2GB1 A;  1RFK A;  3AE9 B;  2WXF A;  2G4D B;  3ZXR A;  1T0Q C;  2HDE A;  2K0P A;  2ZPY A;  1XEE A;  2X38 A;  3DBL B;  1BT0 A;  1MG8 A;  2MA9 B;  3VTU A;  2K25 A;  3K9O B;  4G3X B;  3LYY A;  2C7H A;  2WDV B;  2ZVN A;  2N7E A;  2LVP A;  3MJ5 A;  2MQJ A;  4HPL B;  3W5V B;  1WR1 A;  3QK0 A;  1U4A A;  2AQ1 B;  1IP9 A;  2LWP A;  1DOX A;  5H8Y E;  3APF A;  4W9D A;  2OJR A;  2CJO A;  1SF0 A;  1HEZ E;  4N59 A;  3MC0 B;  3A9J A;  2Y5P A;  1UBI A;  1IGC A;  4P1C C;  3BIN A;  3GE8 C;  1V1O A;  2O6V B;  5BMI A;  2L76 A;  3UIP B;  3WA0 A;  4B6W A;  3JYU A;  4P7I A;  3LXF A;  4AQ7 A;  2M4N A;  2MWS B;  3HRD D;  3W1S C;  2ZCB A;  2KAN A;  4NNJ B;  3ZDM C;  4YSY B;  3PHX B;  2BW2 A;  1D3Z A;  3GE3 C;  4MGK E;  2IBI B;  1VZ7 A;  4FJZ A;  4C80 A;  1T5X D;  3IT6 B;  4GOC A;  3WAL A;  4MM3 B;  2KDF B;  2ZJD A;  2KWV B;  1J7A A;  1GPX A;  2BB6 A;  4F8C B;  3MHZ A;  4YTP B;  1KFY B;  1KF6 B;  2O6V D;  3EC8 A;  1L5P A;  4MDK E;  2ZCC A;  5DPR A;  1P7E A;  2JF5 A;  4BOS C;  5HKH A;  1GB4 A;  2UU7 A;  2PW9 A;  2R61 A;  2KN4 A;  2ZZP B;  3EHV A;  2FUH B;  4GB9 A;  2MP2 B;  3A9K B;  3QQ8 B;  3FAH A;  5G5G A;  2AEH A;  4HJK A;  1WXV A;  4ZOH C;  2W9N A;  3RCZ A;  2JUO A;  3ALB A;  4FHJ A;  2NTT A;  4NJ7 A;  2C7M B;  2AQ2 B;  4HVB A;  2D3C A;  2KWD A;  4K3C A;  4BBN C;  3AU5 A;  4A6Q A;  1DOI A;  4IC7 B;  2LHE A;  3AE4 B;  1A70 A;  1L6V A;  3X0W A;  2KFK A;  3ZNI D;  3HVD A;  1FD6 A;  2CS4 A;  2MX2 A;  3TIX A;  3N20 C;  4C7Z A;  2IGD A;  1DOY A;  2KLG A;  3A4R A;  2D3B A;  2IY1 B;  5TR5 A;  4FA6 A;  1Z5S B;  4KDL B;  2LUE A;  3VFK A;  1UH6 A;  3VR9 B;  1E8Z A;  3VH4 B;  4DDG D;  4NAW A;  2MSE D;  3PSE B;  4ZRK A;  1CZP A;  1WX8 A;  2Y5C A;  1UNS A;  4BBN F;  3U2S C;  3ZTD A;  1SJH D;  1SIJ A;  3AEA B;  1L0V B;  2IY0 B;  1N5X A;  2MCN B;  4YXD B;  1CQV A;  3AM9 A;  2GLS A;  3QAR A;  3ZLZ A;  3QA8 A;  4R3D A;  2M0X A;  2LXA A;  1WZ3 A;  2KTR B;  3AED B;  1ISN A;  2WXM A;  4IDI A;  1OFF A;  2PPH A;  3NS1 A;  4ARI A;  4YWG G;  3L08 A;  5CX3 A;  2LGS A;  3M3J A;  3NZ3 A;  2V1Y A;  4GDL B;  4DBG A;  2AQ3 B;  3Q3N C;  4E3C A;  5FR6 A;  1OEY A;  1E7P B;  3PVL A;  2WXJ A;  1YJJ A;  4KX6 B;  1WR6 E;  2NPT B;  5BMH A;  4C56 C;  1B1Z A;  2A4Z A;  1M94 A;  2WXP A;  2OHF A;  4ZHP A;  1C4C A;  5G55 A;  4Q2J A;  3RN9 C;  4JWU C;  2N7J A;  2UYZ B;  2M8S A;  1I4G A;  1LXD A;  2LJ5 A;  1ZKH A;  2G4S A;  3EGR A;  2E3T A;  2FCS A;  1UGM A;  3P4Q B;  1I7H A;  2KJR A;  5FK9 C;  3MFG A;  4FJV B;  4LCD E;  5C1Z A;  2BPS A;  1KTK A;  1V2Y A;  1JWA D;  1WXM A;  2I2Y A;  5EE0 A;  2JU6 X;  1XLO A;  2FAZ A;  1TY0 A;  5EE1 A;  1LM8 B;  2KC2 A;  4ZRJ A;  1YN4 A;  1RYJ A;  2LAS A;  1I4R A;  1WRD B;  2RDB C;  2JVC A;  1FNW A;  3R2T A;  1E7U A;  2WXK A;  2BS2 B;  2ZW0 A;  2N9L A;  1PQS A;  4YTN B;  3Q3J A;  2AL6 A;  4GIV A;  4OVZ A;  1PGX A;  2LJI A;  4WQM A;  1WY8 A;  2NR2 A;  5JXV A;  4W9C A;  3BYT B;  4LJO B;  4KZC A;  3W9C B;  3E56 A;  1KLG D;  1PFD A;  4WAA A;  3AMZ A;  4TSS A;  4RNA A;  1C78 A;  4MSQ B;  3DVN V;  1SB3 C;  2SAK A;  5BYR A;  3SU8 X;  4DWF A;  3V05 A;  1J0G A;  1R4M I;  1J19 A;  2VH1 A;  2J0K A;  2L32 A;  5BO4 B;  1FNV A;  5IA7 A;  2K9X A;  1T0S C;  2H89 B;  1EM7 A;  4LDT B;  3VRA B;  1TT5 B;  2M0A A;  2LGY A;  3K9P B;  4RM9 A;  2JXX A;  4FJY A;  4FBJ B;  3NOB A;  1D4B A;  4WIP A;  1Y8R C;  3A4S C;  2L7R A;  2WWZ A;  3SHQ A;  1YQB A;  2QHO A;  5C2T B;  2IO0 B;  4O1N A;  4K3B A;  1FCL A;  4LTU A;  4DXF A;  4ZYN A;  1AW7 A;  2W55 A;  3AEG B;  4OW0 A;  5D94 A;  2FCN A;  5J18 A;  3VDZ A;  2DZI A;  1YOV B;  1ZDX A;  3I3T B;  4GXB A;  2QCZ A;  4M0W B;  1CK1 A;  3PRE A;  3ZQ4 A;  4LJP B;  2RSU A;  3JSV A;  1IGD A;  4WWP A;  2NMQ A;  2REX A;  1MFW A;  1FNU A;  1OQR A;  3N1Y C;  2CHW A;  2RPQ A;  4LDT D;  2GRI A;  2N1W A;  4TMA B;  1TS3 A;  2BS4 B;  1XCQ L;  1IBX A;  2WXL A;  1RM6 C;  2FBW B;  3WAM A;  3L10 B;  4OZA A;  3B9J A;  3Q6B A;  3Q3F A;  4JQW C;  3P63 A;  4LNN A;  2KNB A;  2D2Q A;  1CJE A;  4W9L A;  2C5L C;  2LGI A;  3PZD A;  2HJ8 A;  2GMI C;  1SSN A;  2DZK A;  2JZP A;  1V5T A;  3JW0 X;  3L0W B;  4L23 A;  1WX7 A;  1JWU D;  4M8M A;  2LEK A;  2VRR B;  4BKT A;  4NQK E;  3ZDT A;  2LZ6 A;  1Z2M A;  4KDI C;  3VUY A;  3CST A;  4EZJ A;  1ZXI A;  4N6E B;  1G6J A;  4KGR A;  3OJ4 B;  3ZNG C;  1NEN B;  2NS5 A;  3CF6 E;  4DQO C;  2J0M A;  2QDF A;  4TUU A;  1SE4 A;  3MC8 A;  1FXI A;  4IWO A;  2FCM A;  1R4M B;  2O2V B;  3BYY B;  1NYQ A;  2BT6 A;  1XCT L;  4G11 A;  1NBF C;  1A5R A;  3B1L X;  3EFU A;  2DHZ A;  3LB8 C;  2K1F A;  3PHW B;  3URY A;  5JHB A;  2GBM A;  2V3P A;  4LNK A;  1WXA A;  2N9X A;  3C0R B;  4DHZ B;  4KSK C;  1D5X C;  2CJN A;  4B9K A;  4G50 A;  3TEX A;  1MHX A;  1QQR A;  3UF8 A;  1OQQ A;  3HK0 A;  2KTF A;  3PRM B;  4YT0 B;  1JCK B;  2BYV E;  4PS8 A;  2KT7 A;  1WE7 A;  3A1Q A;  2L0T A;  1FCC C;  2D10 A;  2IZV B;  4LK0 M;  2PKO A;  4WJQ A;  3AN1 A;  3KLS X;  4OZC A;  2KO3 A;  4ANX A;  3NVV A;  4JIO U;  3NJT A;  1N63 A;  4KGT A;  4ZRI A;  1SE3 A;  4PT5 A;  4WH4 A;  3ONS A;  3BWU D;  5I4D A;  2Y5B B;  2XN9 C;  1Q0W B;  3AEC B;  3VH3 B;  3TEZ A;  1SBB B;  1RRB A;  4USA A;  1MG4 A;  4CYE A;  3NRZ A;  1RFA A;  1E8X A;  4UDU C;  4MJS B;  1N62 A;  3KYC D;  1EO6 A;  2HJ1 A;  2JZ3 B;  4TV3 A;  3L16 A;  4HCP B;  3V6E B;  4P6V F;  3OLM D;  1JW9 D;  3HVZ A;  3MP9 A;  3RZF A;  2ACZ B;  2PTL A;  5G2N A;  3C19 A;  4A55 A;  1RLF A;  1V8C A;  3QJZ A;  4HKZ E;  4AWJ A;  1TS4 A;  2MBB B;  3PLV A;  3H7P B;  2LXC A;  2N1V A;  4BKS D;  3ZNH B;  2L05 A;  5EDS A;  1D6E C;  5J17 A;  3U4E G;  3UQA A;  3RD2 A;  3DDC B;  4MT5 A;  5HG2 A;  5EE3 A;  2N7D A;  1VCB A;  1JQ4 A;  3RNE C;  1V86 A;  2RGF A;  1ROE A;  1YJ1 A;  1WXS A;  1NI3 A;  2PLP A;  2EMT A;  2WHI A;  2KVZ A;  1Q5W B;  4ZDV A;  2L00 B;  2PE9 A;  3DBR I;  2PJH A;  2KQS A;  3KVF B;  2KQ7 A;  4ANV A;  3U7Z A;  3C8Y A;  3OWE B;  1XT9 B;  4OZB A;  1NDD A;  3AB5 A;  2BTE A;  3DCG A;  4K81 A;  3TL5 A;  4TKN A;  3BK2 A;  1HQR D;  2B76 B;  2L8J A;  4BVU C;  2IYD B;  4N58 A;  3APC A;  3O65 B;  4LNI A;  4HJG E;  1UGJ A;  1ZPS A;  2KAC A;  2I1J A;  1E10 A;  3S2A A;  4HDQ A;  3A33 B;  1WI0 A;  3TCA A;  3DBS A;  2CU3 A;  2KJ6 A;  3I5J C;  3PGE A;  2N9E B;  1NEK B;  5D3I B;  2ONQ A;  2BF8 B;  3ZKJ C;  3IFW B;  5BYS A;  3TEW A;  1YD8 U;  1TIF A;  2WS3 B;  2ZW1 A;  4KZ0 A;  1WJ4 A;  2YLM A;  2J53 A;  4XX5 A;  4RGO S;  2ON8 A;  4ICV A;  5DCN A;  3W5U B;  2MBO A;  2WU2 B;  2W54 A;  1J7C A;  2E6X A;  4M01 A;  1ZP0 B;  1V80 A;  4FAD A;  1PGA A;  4ACF A;  4HRS A;  4DXA B;  4HXD A;  5JHA A;  2C7N B;  4K1R B;  4ZHO A;  3SFE B;  1DYQ A;  1WSP A;  1ZXH A;  3PZ7 A;  3AXC A;  3MTN B;  5TSS A;  2VH2 A;  1X1M A;  4MM3 A;  1ACC A;  2Z0E B;  1N61 A;  3BVM A;  2I1K A;  4TQ1 A;  1JWM D;  3SFD B;  1ZDV A;  1EWY C;  5LXI B;  1GNU A;  2AYO B;  1TKE A;  2M17 A;  2JX5 A;  3W1Y A;  3HIZ A;  3DBR B;  2K5P A;  3B0A A;  4IOI E;  2VZK B;  3WCQ A;  2KFK B;  1J7B A;  1WYW B;  1AWD A;  2WXO A;  1V97 A;  4A3O A;  4EUT A;  2DAJ A;  4WAF A;  2WQY B;  4G0N B;  3B08 A;  1WM3 A;  2WXH A;  1EU3 A;  1P1A A;  2KLC A;  3EUB 2;  2D07 B;  2WDT B;  2RD0 A;  3EA6 A;  4NAW B;  4GSW A;  1QIL A;  1TTN A;  1LFD A;  4L2Y A;  4BAX A;  1PYW D;  2DYB A;  3N9Y C;  2WYQ A;  1V81 A;  1FO4 A;  1QOA A;  4EZK A;  1FXA A;  1H4R A;  1F52 A;  4QAY A;  2VZK D;  4PK1 A;  3SEB A;  1SE9 A;  1E0Z A;  1I42 A;  2ICI A;  5G5H A;  4RF0 A;  1ET6 A;  3N1Z C;  2PEA A;  4FN2 A;  1TJE A;  2V4L A;  1FEH A;  3D32 A;  2K22 A;  1C77 A;  5LLI A;  4WJN A;  4US9 A;  4IKG A;  3IAS 1;  1HXY D;  3TEY A;  1PDX A;  3FIL A;  3DHH C;  3SD5 A;  4II3 B;  1VD2 A;  5AZG A;  2YVC A;  4HLE A;  1GJZ A;  2BKF A;  3ENE A;  4W9I A;  1D5Z C;  4NJC A;  5AUI A;  4WQO B;  3ZW3 A;  1CMX B;  4X57 B;  1MPE A;  3P4P B;  4JL9 A;  2MBE A;  2KHW B;  4NQL B;  1C4P A;  1WMH A;  1IPG A;  3RYT A;  1S1Q B;  1BML C;  1R4N I;  3BII D;  5IKC M;  3MC9 A;  2NBU A;  3KUZ A;  4NJ6 A;  2KDM A;  4RMA A;  3KUC B;  2HD5 B;  2KTR A;  1RAX A;  2WDQ B;  4YSZ B;  2LGX A;  4C4V B;  2KFJ A;  1V9J A;  4GDL A;  4J3O D;  3X23 A;  2L3Z A;  3UQB A;  4MSM B;  4WWN A;  1WZ0 A;  4S0R A;  2NVU I;  3Q2A C;  3LJ3 A;  1L0X B;  2L52 A;  4AJY B;  2K8H A;  3GOE A;  3KWV A;  3AUL A;  3T9L A;  4ARC A;  1WFY A;  3W1S A;  3VUW A;  4RF1 A;  2NPT A;  2WP9 B;  3PTF C;  3RI7 C;  2R2Q A;  2M19 A;  2INN E;  3Q14 C;  3H6N A;  4DK5 A;  4ICU A;  2AX5 A;  3JVZ X;  4W9K A;  4EFO A;  5FKA C;  2FCQ A;  2DZM A;  3AE2 B;  1GOZ A;  3H8H A;  5KHQ A;  5LNK 1;  1I4H A;  1SXT A;  2JWZ A;  2NTS A;  2R2O A;  1WWT A;  3P2B A;  2KZR A;  1TYG B;  2G3Q B;  2DYM A;  1QLB B;  1TY2 A;  1E8Y A;  1XLP A;  2KK8 A;  3V60 A;  2ASQ A;  1ET9 A;  4W9G A;  4MGI E;  3RNG C;  2LVO A;  2W82 A;  2G1E A;  1SEB D;  2IO2 B;  5HI1 A;  4FUL A;  4PYZ A;  1UF0 A;  3IHP C;  1FRD A;  3KH0 A;  2KDE B;  1IUE A;  3RUL A;  3DWM A;  2Z0D B;  1I4X A;  3N30 A;  3VTW A;  1FM0 D;  1MI0 A;  3VVW B;  2LFI A;  1MVK A;  2JWU A;  5IP4 D;  1R7S A;  5AUK A;  4P16 A;  4OHJ A;  3BK1 A;  1QOB A;  1AN8 A;  1WJN A;  2AL3 A;  3AI5 A;  4REZ A;  5JZE B;  2IDY A;  1QOG A;  2YEP B;  1L4Z B;  2GBR A;  4NPN A;  3AE6 B;  3RNA C;  1UUP A;  4K7W A;  1VR9 A;  4HEA 1;  4EZL A;  2IGH A;  1K50 A;  3MJW A;  2HTH A;  2FUG 1;  3M95 A;  3R3M A;  4XWW A;  2GBN A;  1V1P A;  1R4N B;  3L54 A;  1YMH E;  5FR3 A;  2MHJ A;  2JRH A;  3AH7 A;  1YX6 B;  4F7Z A;  1TZ1 A;  1WJ6 A;  1STE A;  5AZF A;  2QIL A;  1GUA B;  1HZ5 A;  2LRW A;  3PO0 A;  1UWM A;  1ESF A;  1YQ4 B;  4KKJ A;  1XLN A;  2N9P C;  1T0R C;  2J42 A;  3BVG A;  2IPK D;  1XD3 B;  3UGB B;  1KJT A;  4US8 A;  2KYW A;  2J4X A;  4AP4 C;  1E7V A;  4ASW C;  1SGH A;  4M0W A;  2BYT A;  2PVG C;  5JH5 C;  3L17 A;  1RWS A;  3VAW A;  3BY4 B;  3IVF A;  2IND C;  4KV2 A;  1YNT E;  4NAM A;  4RFB A;  1ZOY B;  1QKZ A;  3RFZ B;  4AUQ C;  3ZVV A;  1YN5 A;  3TMP B;  2J52 A;  1C3T A;  1GAQ B;  4W9E A;  1BXT A;  5CTR C;  4KIK A;  3SR6 A;  4W9J A;  4JGH B;  1K52 A;  3NVZ A;  1C1Y B;  1P3Q U;  2IO3 B;  1JRP A;  3VQI A;  3FKY A;  4GU2 A;  1KOT A;  2I38 A;  3Q8E A;  3B2G A;  1EF5 A;  2D5G A;  3A1Q B;  3W2D A;  3ECI A;  2LVQ A;  3HM3 A;  3P4R B;  4GN1 A;  4EE2 A;  1PUT A;  3Q3M C;  5IAA C;  3FC4 A;  2WU5 B;  2X8X X;  4OVV A;  2N4F A;  5C3J B;  3RMK C;  3VRB B;  1TZO A;  1SIF A;  2RDH A;  3I63 C;  1EU4 A;  2QIE B;  4IM2 A;  2WXG A;  3AE5 B;  4JPS A;  5L95 C;  4KVG B;  2G9H D;  1TS5 A;  1JWS D;  2XNA C;  4A3P A;  3DVN U;  3WIM A;  4B0E A;  3DPD A;  4WWM A;  5GMV A;  2DX5 B;  3TSS A;  4EKU A;  5L83 A;  2M56 B;  1MHH E;  1V5O A;  3RT3 B;  2Y3A A;  2KWC A;  4LNO A;  3TJP A;  2FNJ B;  4XDC A;  3ZRC A;  5LXH A;  3ZRF A;  1LO5 D;  4GDK A;  1C9F A;  3NHE B;  3IG3 A;  3WAN A;  3TBL D;  1Q1O A;  2MW5 A;  2RR9 A;  4RH6 A;  1OTR B;  4BKS A;  1H8C A;  3P4S B;  2ZNV C;  4PS7 A;  5BMG A;  3NVY A;  2XK5 A;  2DWQ A;  2K39 A;  2XBB C;  1TS2 A;  2K6D B;  1K8R B;  3BZD B;  5IOI A;  2QSD A;  1VRA B;  2JZZ A;  1TKG A;  4AOF A;  1LQB A;  2KX0 A;  3RPF C;  1YX5 B;  3BVZ A;  2FID A;  4MJS A;  1L7Y A;  2WGS A;  1HTQ A;  3UI3 A;  2MH7 A;  2JXT A;  1HA5 A;  1LGR A;  3P1M A;  2EMS A;  5MPO A;  4RGM A;  2HTM E;  3I9V 1;  2SEB D;  2KC1 A;  2WX0 A;  4RGT A;  1K53 A;  2D3A A;  3CMM B;  2KWU B;  3H7P A;  1JML A;  3A9J B;  3QWZ B;  1P9D U;  1XO3 A;  3U8Z A;  1QZE A;  2LUM A;  1I35 A;  3PZ8 A;  2WX1 A;  2XEW A;  1WX9 A;  3IAM 1;  5H92 C;  3OG5 A;  2KXJ A;  3ZUN A;  1WF9 A;  4S17 A;  1L4D B;  2N0S B;  2QJL A;  3ZO5 B;  3N32 A;  4OVU A;  2JYT A;  3QC8 B;  3PT2 B;  5HFY A;  4ANW A;  4CO7 A;  3VXW A;  1UZX B;  4XDD A;  5D2M B;  1ZGU B;  3OAW A;  2H88 B;  2Q5W D;  2Z59 B;  4D2K A;  2G45 B;  4MEM A;  5DPS A;  1QOF A;  5KHO A;  3KQ4 A;  4ANU A;  1VDV A;  5E6P A;  2PMV A;  4BZA A;  1WYG A;  1AAR A;  1E9M A;  2JRI B;  4HK2 A;  1L6U A;  1KRH A;  1FRR A;  2CHX A;  1L2N A;  1YQ3 B;  2GI9 A;  2K6Q A;  1C76 A;  2EEL A;  4A20 A;  4IM3 A;  4F1S A;  1ZW7 A;  3GS2 A;  4XC2 A;  4GLS C;  1ENF A;  2LI5 A;  4W9F A;  2FIF A;  2KMM A;  2O6V A;  3SDL C;  1QF6 A;  2MLB A;  1HE8 A;  1E5W A; 
#chains in the Genus database with same CATH homology
 4HDO A;  3DOW A;  2KHW B;  4NQL B;  4YL8 A;  1YIW A;  2V3S A;  1WJU A;  3HHM A;  1WMH A;  3RZW C;  1IPG A;  3I3T B;  3RYT A;  1WGH A;  4KSL C;  3H7S A;  1OGW A;  2L0F A;  1S1Q B;  4GXB A;  4M0W B;  1OQY A;  1R4N I;  4HCN B;  2B3A A;  3PRE A;  5CHF A;  4CHK A;  1NI2 A;  2ZVO A;  2KDI A;  4LJP B;  2RSU A;  3JSV A;  2NBU A;  3KUZ A;  4NJ6 A;  3UIO B;  5CHV C;  4WWP A;  2REX A;  4RMA A;  3KUC B;  2KD0 A;  2HD5 B;  2CHW A;  2KTR A;  2RPQ A;  4LDT D;  2N1W A;  1RAX A;  2NBV B;  4II2 B;  1F9J A;  2A5U A;  3QX1 A;  2LGX A;  4FHK A;  3IBE A;  2HE7 A;  2KFJ A;  4BFR A;  1V9J A;  3WAM A;  3L10 B;  4GDL A;  2IO1 B;  3X23 A;  3PRP B;  3U30 A;  3Q3F A;  2L3Z A;  4GGQ A;  3UQB A;  4JQW C;  4MSM B;  4WWN A;  1WZ0 A;  1S3S G;  5AEK B;  2NVU I;  1E8W A;  2UWQ A;  3LJ3 A;  4N9F 4;  2KNB A;  2D2Q A;  3L13 A;  4AJY B;  2K8H A;  2KVR A;  4W9H A;  2DEN B;  3GOE A;  4W9L A;  3AUL A;  2C5L C;  2CR5 A;  3T9L A;  2K8C A;  3PZD A;  2HJ8 A;  3VUX A;  1OEY J;  1WFY A;  5DPT A;  3W1S A;  3R7R A;  3VUW A;  2NPT A;  2OOB B;  3ZNZ B;  3NZU A;  3PTF C;  2R2Q A;  2ZNV B;  4I6L B;  2J0J A;  3DVG X;  1WE6 A;  2GMI C;  4IG7 B;  2DZK A;  3H6N A;  4DK5 A;  2G4D B;  4ICU A;  1V5T A;  2BYF A;  3JW0 X;  2ZPY A;  3JVZ X;  3L0W B;  4W9K A;  4EFO A;  1WX7 A;  2FCQ A;  3VHT C;  4WJP A;  1BT0 A;  2DZM A;  4M8M A;  3PLU A;  5KHQ A;  2VRR B;  2JWZ A;  3QIJ A;  4BKT A;  2R2O A;  1MG8 A;  2MA9 B;  3P2B A;  4NQK E;  3ZDT A;  3M63 B;  2KZR A;  2C60 A;  2LZ6 A;  3VTU A;  2K25 A;  1Z2M A;  2MP2 A;  3A9K A;  4KDI C;  3VUY A;  2G3Q B;  2DYM A;  3K9O B;  4G3X B;  3CST A;  4EZJ A;  2C7H A;  4EOY A;  2AWT A;  1E8Y A;  3H9D A;  2KK8 A;  2C9W B;  2LVP A;  2N7E A;  2ZVN A;  2ASQ A;  2M1M A;  4MH0 E;  3V60 A;  1G6J A;  4W9G A;  2MQJ A;  3OJ4 B;  3ZNG C;  2NS5 A;  1EF1 A;  4HPL B;  3V6C B;  4MGI E;  3CF6 E;  2LVO A;  2J0M A;  4GMV A;  1WR1 A;  4TUU A;  2IO2 B;  3QK0 A;  4FUL A;  1U4A A;  4PYZ A;  1UD7 A;  3VTV A;  2GOW A;  4IWO A;  1IP9 A;  2LWP A;  3IHP C;  2FCM A;  4AJW A;  2O2V B;  3APF A;  3KH0 A;  2KDE B;  2BWE S;  4W9D A;  2KMC A;  2OJR A;  4IM0 A;  3RUL A;  4PS3 A;  2CU1 A;  2JT4 B;  2MBH A;  2Z0D B;  4G11 A;  3N30 A;  4IW0 A;  4K7U A;  3VTW A;  4BKG A;  1NBF C;  1A5R A;  3B1L X;  3EFU A;  3A9J A;  4EEW A;  2DHZ A;  3VVW B;  2K1F A;  3PHW B;  2KN5 A;  5JHB A;  2GBM A;  1GC6 A;  4E71 A;  1TGZ B;  1WXA A;  1UBI A;  2N9X A;  3C0R B;  4DHZ B;  3PV1 A;  4KSK C;  3BIN A;  4B9K A;  1EUV B;  3R66 C;  4DDI D;  2LD9 A;  4G50 A;  2O6V B;  2L76 A;  3UIP B;  3WA0 A;  3UF8 A;  1WJN A;  3R7Q A;  4B6W A;  2AL3 A;  3AI5 A;  5JZE B;  3HK0 A;  3JYU A;  2KTF A;  3PRM B;  1V6E A;  4P7I A;  5AZH A;  4PS8 A;  2BYV E;  1WMH B;  1WE7 A;  3A1Q A;  1WGY A;  2L0T A;  2D10 A;  2M4N A;  2MWS B;  2GBR A;  2IZV B;  4NPN A;  4FLH A;  3W1S C;  2ZCB A;  2KAN A;  4K7W A;  4WJQ A;  4NNJ B;  3N3K B;  4EZL A;  3QHT A;  3ZDM C;  3PHX B;  3MJW A;  1D3Z A;  2HTH A;  3M95 A;  2KO3 A;  4MGK E;  4HLE A;  4ANX A;  2IBI B;  3R3M A;  2MBQ A;  4FJZ A;  2GBN A;  2LGD A;  3L54 A;  4JIO U;  2BKR B;  2JRH A;  4GOC A;  3WAL A;  4IWQ A;  4ZRI A;  2KDF B;  3ONS A;  2ZJD A;  1YX6 B;  2KWV B;  2Y5B B;  4F7Z A;  1Q0W B;  1TZ1 A;  3VH3 B;  1RRB A;  1WJ6 A;  3EEC A;  1TBE A;  3ML8 A;  5AZF A;  4CYE A;  1GUA B;  1RFA A;  1E8X A;  4MJS B;  3KYC D;  4F8C B;  1EO6 A;  2JZ3 B;  2LRW A;  3DBH I;  4TV3 A;  3L16 A;  4HCP B;  3QCA A;  2O6V D;  3EC8 A;  3OLM D;  3V6E B;  2N9P C;  3RZF A;  3U7D A;  5G2N A;  4J6I A;  4MDK E;  1XD3 B;  2ZCC A;  1RLF A;  3UGB B;  1KJT A;  3QJZ A;  4TQ0 A;  5DPR A;  4AWJ A;  2JF5 A;  2MBB B;  3KW5 B;  3PLV A;  3DVG Y;  3H7P B;  4AP4 C;  1E7V A;  2LXC A;  2N1V A;  4BKS D;  3ZNH B;  4ASW C;  4BOS C;  5HKH A;  2L05 A;  3NS8 A;  5EDS A;  5J17 A;  3UQA A;  1SGH A;  2ZZP B;  3RD2 A;  3EHV A;  1WIA A;  3L17 A;  5JH5 C;  2FUH B;  3VAW A;  4GB9 A;  2MP2 B;  3A9K B;  3DDC B;  3BY4 B;  3IVF A;  4XZ4 A;  3T8M A;  3QQ8 B;  4M8N A;  2N7D A;  4KV2 A;  2LRU A;  4MEL A;  2AEH A;  4HJK A;  1WXV A;  1VCB A;  2W9N A;  1V86 A;  2RGF A;  5D6J B;  3RCZ A;  1YJ1 A;  2MRP A;  1WXS A;  2JUO A;  3ALB A;  2EMT A;  2BWF A;  4FHJ A;  4ZDV A;  1Q5W B;  4AUQ C;  1T0Y A;  2L00 B;  3ZVV A;  5E6O A;  2PE9 A;  1V49 A;  3DBR I;  4NJ7 A;  3TMP B;  4MGY E;  1C3T A;  2C7M B;  2PJH A;  5DPW A;  2KQS A;  3KVF B;  4HVB A;  4W9E A;  4BBN C;  3AU5 A;  5CTR C;  4IC7 B;  4KIK A;  4W9J A;  2KQ7 A;  4JGH B;  4ANV A;  3X0W A;  3M62 B;  1C1Y B;  2KFK A;  3ZNI D;  1P3Q U;  2IO3 B;  1XT9 B;  2CS4 A;  2MX2 A;  3VQI A;  1NDD A;  3TIX A;  4GU2 A;  2PE6 B;  5J2R A;  1KOT A;  2KLG A;  2D3G A;  3A4R A;  2KOX A;  4FA6 A;  1EF5 A;  2IY1 B;  3DCG A;  5TR5 A;  1Z5S B;  4KDL B;  4B95 A;  4K81 A;  3TL5 A;  4TKN A;  2LUE A;  3A1Q B;  3NY5 A;  2K8B A;  4WWO A;  2L8J A;  3VFK A;  4BVU C;  3GZN I;  1UH6 A;  3ECI A;  1E8Z A;  2LVQ A;  3HM3 A;  3VH4 B;  2IYD B;  4DDG D;  4NAW A;  4GN1 A;  3APC A;  2MSE D;  3O65 B;  3PSE B;  4ZRK A;  5IAA C;  1WX8 A;  1WGR A;  3ZIM A;  4BBN F;  1XQQ A;  1GC7 A;  4OVV A;  3ZTD A;  2N4F A;  3WAO A;  2I1J A;  1SIF A;  4PYU A;  3V62 A;  2DZJ A;  2IY0 B;  3S2A A;  4IM2 A;  5E6N A;  4HDQ A;  3A33 B;  1WI0 A;  2KJH B;  3KUD B;  5L95 C;  4KVG B;  2MCN B;  1KLV A;  2KDB A;  3TCA A;  3DBS A;  4A3P A;  3QAR A;  3ZLZ A;  3JSV B;  1GG3 A;  2KJ6 A;  4I6P A;  3QA8 A;  2M0X A;  3DVN U;  2LXA A;  3PGE A;  3WIM A;  1WZ3 A;  2KTR B;  1ISN A;  3DPD A;  5GMV A;  2PPH A;  4URK A;  2DX5 B;  4EKU A;  2N9E B;  5L83 A;  3L08 A;  5CX3 A;  4I6N B;  1V5O A;  2BF8 B;  3M3J A;  3RT3 B;  3ZKJ C;  2V1Y A;  3IFW B;  2KWC A;  4GDL B;  4DBG A;  1YD8 U;  3TJP A;  2FNJ B;  4E3C A;  3ZRC A;  5FR6 A;  3ZRF A;  4KZ0 A;  1WJ4 A;  5LXH A;  1OEY A;  4GDK A;  3NHE B;  2YLM A;  3IG3 A;  5CHW A;  3WAN A;  4XX5 A;  4E74 A;  4ICV A;  5DCN A;  3TBL D;  3PVL A;  2MBO A;  2KKC A;  1Q1O A;  2MW5 A;  2JY6 A;  2RR9 A;  2ZEQ A;  1OTR B;  1V80 A;  4FAD A;  4WJO A;  1WR6 E;  2NPT B;  4DXA B;  4HXD A;  5JHA A;  2A4Z A;  1M94 A;  2C7N B;  4K1R B;  4BKS A;  1H8C A;  2ZNV C;  4PS7 A;  3H1U A;  1P98 A;  2GBK A;  2XK5 A;  2GBJ A;  4RM8 A;  5G55 A;  2DAF A;  2K39 A;  3AXC A;  2XBB C;  3MTN B;  2K6D B;  1K8R B;  2UYZ B;  2M8S A;  1X1M A;  2JZZ A;  2Z0E B;  4MM3 A;  4NY0 A;  1LXD A;  1J8C A;  4AOF A;  1LQB A;  2LJ5 A;  2I1K A;  2KX0 A;  4TQ1 A;  1ZKH A;  2G4S A;  2FCS A;  1UGM A;  1YX5 B;  2NCN A;  2FID A;  2KJR A;  1L7Y A;  4MJS A;  4DHJ B;  5LXI B;  4IUM B;  1IYF A;  1GNU A;  3APD A;  3QAQ A;  2AYO B;  4FJV B;  4KIK B;  2M17 A;  1E90 A;  3RUI B;  2CKH B;  4LCD E;  2EMS A;  5C1Z A;  2BPS A;  3HIZ A;  3W1Y A;  1V2Y A;  1WXM A;  1WGG A;  3B0A A;  2FAZ A;  2KFK B;  2KC1 A;  2WX0 A;  1WYW B;  1WGD A;  1LM8 B;  4A3O A;  2DAJ A;  2KC2 A;  3CMM B;  4ZRJ A;  4EUT A;  2KWU B;  4G0N B;  2LAS A;  4K7S A;  3UIN B;  3B08 A;  3H7P A;  1WRD B;  1WM3 A;  2JVC A;  2JPH A;  2EKE C;  4IWP A;  1P1A A;  3A9J B;  2KLC A;  1E7U A;  3QWZ B;  1P9D U;  3U8Z A;  1QZE A;  3LDZ E;  2D07 B;  1I35 A;  2WDT B;  2WX1 A;  3CSF A;  1PQS A;  2RD0 A;  3DBL I;  2ZPN A;  3Q3J A;  2AL6 A;  4NAW B;  4GIV A;  4GSW A;  2XEW A;  1TTN A;  1WX9 A;  1WY8 A;  1UBQ A;  4DHZ E;  2NR2 A;  2KXJ A;  3ZUN A;  4W9C A;  1LFD A;  1WF9 A;  4LJO B;  3NZS A;  4KZC A;  2DYB A;  3ZO5 B;  3V61 A;  3N32 A;  5C23 A;  4OVU A;  4WAA A;  1P0R A;  2WYQ A;  3QC8 B;  3PT2 B;  4ANW A;  4CO7 A;  4DHJ D;  3VXW A;  3AU4 A;  1UZX B;  3PRZ A;  5D2M B;  1V81 A;  3HM6 X;  2KX3 A;  1ZGU B;  3ML9 A;  4MSQ B;  3OAW A;  4EZK A;  3DVN V;  1H4R A;  3SU8 X;  2Z59 B;  4DWF A;  2G45 B;  1J0G A;  2KMA A;  4MEM A;  1R4M I;  5DPS A;  1J19 A;  2J0K A;  3PPA A;  5KHO A;  1SE9 A;  2BYE A;  1I42 A;  4ANU A;  2CHZ A;  5E6P A;  1KM7 A;  5BO4 B;  5IA7 A;  1AAR A;  2PEA A;  2BGF A;  4FN2 A;  1WH3 A;  2V4L A;  3D32 A;  4MGZ E;  2JRI B;  4HK2 A;  4HWI B;  4LDT B;  2O2V A;  1FXT B;  3KYD D;  3OJ3 A;  2NBW B;  2D11 A;  5LLI A;  4WJN A;  1UEL A;  2CHX A;  2LGY A;  3K9P B;  1WM2 A;  1L2N A;  4RM9 A;  4GDK B;  4BOZ B;  2JXX A;  4FJY A;  4FBJ B;  3NOB A;  2K6Q A;  3SD5 A;  3ZTC A;  1Y8R C;  3PS6 A;  4II3 B;  1VD2 A;  3A4S C;  4A20 A;  5AZG A;  5D7G A;  2L7R A;  2WWZ A;  2YVC A;  4IM3 A;  3SHQ A;  4F1S A;  1ZW7 A;  1YQB A;  2BKF A;  2DYO A;  2QHO A;  3ENE A;  2IO0 B;  4W9I A;  4XC2 A;  1GJZ A;  4HPM B;  3MHS D;  4WQO B;  2LI5 A;  3ZW3 A;  1CMX B;  4JLC A;  4W9F A;  1JRU A;  2FIF A;  4X57 B;  4ZYN A;  3WAP A;  3DQV A;  2O6V A;  5D94 A;  3SDL C;  2FCN A;  2MLB A;  5J18 A;  3VDZ A;  1HE8 A;  2XK5 B;  1E5W A;  4JL9 A;  2DZI A;  2J7Q B;  2MBE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...