3VXWA

Crystal structure of saccharomyces cerevisiae atg8 complexed with atg32 aim
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
111
structure length
111
Chain Sequence
KSTFKSEYPFEKRKAESERIADRFKNRIPVICEKAEKSDIPEIDKRKYLVPADLTVGQFVYVIRKRIMLPPEKAIFIFVNDTLPPTAALMSAIYQEHKDKDGFLYVTYSGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Autophagy-related protein 32 acts as autophagic degron and directly initiates mitophagy
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
molecule keywords Autophagy-related protein 8
total genus 32
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2012-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3vxwA00
4K7SA 4W9LA 3RYTA 4W9DA 3Q3JA 3VTUA 4LJOB 3ZIMA 3KYDD 1I35A 3PHWB 4K1RB 2C7HA 3AU4A 2N4FA 1GC6A 1C1YB 1V5OA 2CKHB 4II3B 2NVUI 1WGRA 2ZPNA 1KM7A 2C5LC 3ZNHB 5E6PA 2L05A 5J18A 1WM3A 2C60A 1LM8B 3CF6E 2R2OA 4WJNA 2I1KA 2KZRA 2ZCCA 1P3QU 3S2AA 1S3SG 2NPTB 2ZVOA 4WQOB 4P7IA 2DZKA 2K25A 1YJ1A 1P0RA 4EZKA 4A20A 5CHFA 1EUVB 2WX0A 3QJZA 2BKRB 4IWQA 2KTRA 2MW5A 4ANXA 2BF8B 1GUAB 2L76A 3AI5A 2ZEQA 1L2NA 2KWVB 2LXCA 2PE9A 3OJ3A 3UQBA 3PRPB 3ZNGC 2KC1A 2L7RA 3H7PA 4AUQC 3I3TB 3L08A 3VUYA 2CHXA 4GDKA 2OJRA 3APDA 2EMSA 2Y5BB 3TMPB 2UYZB 3QARA 4FN2A 3GZNI 4II2B 3IBEA 2LASA 3JSVA 5DPSA 2N7DA 3QHTA 2G3QB 4FJYA 1C3TA 2BPSA 3L54A 4FA6A 4MH0E 1GJZA 4DXAB 3APFA 1Q1OA 3R7RA 2DYOA 3A33B 4ZRKA 4BOSC 4YL8A 3ZRFA 1A5RA 2MLBA 2ZNVC 2J0JA 2ZVNA 3EHVA 3DBHI 4HPLB 1LFDA 3B0AA 2MRPA 4MM3A 2KVRA 4IC7B 4RM9A 3ALBA 2AL3A 2GBNA 2V1YA 2ZCBA 3HM6X 2YLMA 4GIVA 4BOZB 3O65B 3H7PB 4GXBA 4A3PA 1KLVA 2ZJDA 2LRWA 3VH4B 3QQ8B 4HDQA 2PJHA 3QAQA 4EUTA 4ZDVA 5CHVC 1WF9A 2YVCA 4BBNF 2LVQA 3V6EB 5D94A 3N3KB 2HTHA 2NBWB 2KN5A 1XD3B 3A9KA 1J19A 2IY0B 2QHOA 3H1UA 1WFYA 4TUUA 2ZPYA 4ZRJA 2A5UA 3CSFA 4W9FA 2HJ8A 3SD5A 2FIFA 5J17A 5JHAA 2GOWA 1WYWB 2KFKB 1XQQA 1FXTB 4HLEA 3A4RA 3UF8A 5L83A 3OJ4B 3DVNU 4IWPA 1NI2A 4I6NB 2KK8A 2K1FA 4HJKA 4KV2A 4BFRA 3W1YA 2FIDA 2GBMA 3KH0A 4XZ4A 3VQIA 4NQKE 4LCDE 4TQ0A 3KUCB 3C0RB 3EC8A 1T0YA 1WZ0A 2L3ZA 2O6VD 4PYZA 1R4MI 2KC2A 2G4SA 2I1JA 2N9XA 3VTWA 2G4DB 2K8CA 2BWFA 3MTNB 5G2NA 3AXCA 1UD7A 3DBSA 2KHWB 2KWCA 5EDSA 1WM2A 3VH3B 1ZW7A 2RGFA 3NHEB 2KDIA 3N30A 1WXSA 1EF1A 4M8NA 2BYEA 1OEYJ 2C7NB 2DENB 2KWUB 2IZVB 2LGYA 2RD0A 4ZYNA 2MWSB 2M4NA 4IWOA 4BKGA 3ML8A 1Z5SB 2MP2A 2BYVE 3A1QA 4W9KA 4KSLC 3RULA 2ZNVB 3HIZA 3PLUA 2XEWA 4FJVB 4WWPA 1WR1A 4WAAA 1WJNA 4K7UA 2KTRB 5CHWA 4MJSA 3WALA 4BVUC 2WDTB 4K81A 4NNJB 2KFJA 3JW0X 4TKNA 2JVCA 1Q5WB 4B9KA 1AARA 5HKHA 1H8CA 3VUXA 1E8XA 2HE7A 1WR6E 3W1SC 4GGQA 2IY1B 3TCAA 4GU2A 2MSED 2RSUA 3DBRI 2LD9A 4PS8A 3TL5A 2IO1B 4DHZB 4CYEA 3DCGA 1WXVA 1WZ3A 3PRZA 3B1LX 1D3ZA 2GBKA 4HK2A 4FBJB 2ASQA 3H6NA 3KYCD 3VXWA 4NPNA 3PTFC 2LWPA 2NPTA 3A4SC 3PREA 4J6IA 1WGYA 2DZIA 2KXJA 4W9GA 4URKA 1SIFA 5LXIB 4FJZA 2Z0DB 2LJ5A 4OVUA 2LVPA 1M94A 5BO4B 2IO0B 4F1SA 2CR5A 3KW5B 2JT4B 5AZHA 2MQJA 1WXMA 1YQBA 2DZMA 2KJHB 3WAOA 3WANA 3D32A 2AEHA 3OAWA 4MGZE 4WJQA 2DAJA 1TBEA 1TGZB 1WX9A 2M8SA 3ONSA 4JIOU 3RZWC 2LGDA 4IM0A 1UH6A 1WY8A 3ML9A 1U4AA 2ZZPB 4LDTB 3LJ3A 2Z59B 3NZUA 2KD0A 3V6CB 3AULA 1E8ZA 3P2BA 2D2QA 4GOCA 1X1MA 2NBUA 4WJPA 4MGIE 4GB9A 2JZ3B 2KTFA 4JL9A 2NS5A 2PE6B 2FAZA 3VHTC 1WH3A 4NJ6A 1OEYA 3N32A 2M0XA 2O2VB 2CU1A 5C23A 5DCNA 2Z0EB 3VVWB 4G3XB 2GBJA 4HWIB 3UIOB 1CMXB 1WJUA 2C7MB 3IFWB 5KHOA 2MCNB 2L0TA 1NBFC 1V80A 1WE7A 4WWOA 3U8ZA 1ZGUB 2DAFA 5LXHA 1XT9B 3MHSD 3B08A 1UBIA 2MP2B 5IAAC 1E90A 3QIJA 2BYFA 4EKUA 2JRIB 2JWZA 3VDZA 1P9DU 4BKTA 4ANUA 4I6LB 2XK5A 1RLFA 4LJPB 4M0WB 4CHKA 4NAWA 5D7GA 3ZNID 3M63B 2KDFB 3R66C 4RM8A 2JY6A 1YX6B 4KIKA 4GDKB 2EMTA 2BKFA 4W9EA 1V81A 2D07B 3A9JA 3DVGY 3QA8A 4AOFA 4DHJB 2KJ6A 1KJTA 3UINB 2WX1A 4XX5A 4G50A 3PZDA 2V4LA 4ICVA 3UGBB 4BKSA 3M95A 3VUWA 2KQ7A 2KQSA 2LVOA 4FULA 2L8JA 3V61A 2IYDB 3R3MA 4E74A 5KHQA 1KOTA 1ISNA 4DBGA 1WI0A 2D10A 3ENEA 1IYFA 2IO3B 3DOWA 3X23A 2FCNA 4HXDA 3ZUNA 2JF5A 2MBBB 4W9IA 2DX5B 4KZCA 4A3OA 3Q3FA 2KDEB 3EFUA 2M1MA 3PHXB 4HCPB 1V6EA 5JH5C 2KJRA 4WJOA 2REXA 1V5TA 2UWQA 4JGHB 4E71A 3DVGX 4MGYE 1H4RA 2KO3A 3RD2A 3W1SA 1V86A 3WAMA 3OLMD 2KMCA 2KNBA 2D11A 5G55A 4GN1A 1YD8U 3APCA 3QK0A 5TR5A 1EF5A 2AYOB 4EFOA 1WXAA 3ZW3A 2IBIB 3AU5A 2L00B 4MSQB 2LGXA 2J0MA 2MBQA 4BKSD 3PT2B 4HVBA 3X0WA 1NDDA 1GG3A 3BINA 3SDLC 1OTRB 2WYQA 2VRRB 4KDLB 3ZNZB 5L95C 5GMVA 1WX7A 2RPQA 1BT0A 2DYMA 1WGGA 1J8CA 2BGFA 2N1VA 3DQVA 2KFKA 2KLGA 3V60A 3ZDTA 1V2YA 4GDLA 3DBLI 3SHQA 3PRMB 4FHKA 3RUIB 1L7YA 2K39A 4X57B 4XC2A 2JUOA 3M62B 1SE9A 1E7UA 1WJ4A 4WWNA 3M3JA 1S1QB 3LDZE 3KUZA 3PGEA 3WA0A 5DPTA 1IPGA 1GNUA 5CTRC 2D3GA 3MJWA 4GMVA 1E7VA 4I6PA 4KSKC 2KDBA 2KX0A 5E6OA 4EZLA 4ANWA 1E8YA 1JRUA 3ZO5B 4EOYA 3PVLA 4RMAA 1TZ1A 2A4ZA 3NS8A 3QWZB 1RRBA 4KVGB 1IP9A 3VAWA 3U7DA 2DZJA 3JYUA 2JRHA 4MELA 3WIMA 3EECA 2DHZA 1RFAA 4AJWA 3L0WB 1WIAA 3ZTCA 4W9HA 1OQYA 3U30A 5JHBA 1E8WA 4NJ7A 1SGHA 3WAPA 2M17A 4G11A 4DHZE 3GOEA 4KIKB 4N9F4 2O6VA 4AWJA 2K8BA 1P98A 3TBLD 4DWFA 4ASWC 2KMAA 4F7ZA 3RZFA 4M8MA 5AEKB 4TQ1A 5IA7A 1G6JA 3L17A 4NY0A 4PS3A 1I42A 1TTNA 4JQWC 3NY5A 3T8MA 3V62A 2J7QB 2JPHA 1Q0WB 1RAXA 2B3AA 3PPAA 4MDKE 4KDIC 5AZFA 2KX3A 3JVZX 2CS4A 2KANA 1WE6A 3PV1A 3L16A 2KKCA 1Y8RC 4FADA 4ZRIA 4AJYB 4MJSB 4HCNB 2N9PC 3UQAA 1UBQA 2GBRA 3IVFA 2O2VA 1MG8A 3TIXA 2XBBC 3A9JB 4DDID 2CHZA 4TV3A 3K9PB 2FUHB 2MBOA 3ZLZA 3HK0A 1PQSA 4MEMA 2LUEA 1UGMA 5JZEB 4NAWB 4FLHA 4EEWA 2LZ6A 1YIWA 3ZRCA 2FCSA 3DVNV 5C1ZA 2W9NA 1J0GA 5LLIA 3NZSA 2G45B 2XK5B 3KVFB 2FCQA 3R7QA 3L10B 4MGKE 3PLVA 1E5WA 1WJ6A 4PS7A 3DDCB 1WMHA 2JXXA 2N7EA 2LRUA 2N1WA 4EZJA 2K6DB 1ZKHA 3CMMB 4ICUA 4PYUA 5FR6A 4KZ0A 5AZGA 3QCAA 1UZXB 2GMIC 1WX8A 2CHWA 4AP4C 2WWZA 2NR2A 2AL6A 3L13A 2AWTA 3H7SA 4W9CA 2MX2A 4GSWA 4MSMB 4OVVA 1K8RB 4ANVA 4CO7A 3IG3A 2DYBA 3UIPB 3DPDA 2FNJB 3PSEB 4IW0A 3QC8B 4W9JA 3T9LA 4B95A 1EO6A 4JLCA 4IUMB 1LQBA 3KUDB 1Z2MA 4GDLB 4LDTD 2N9EB 4NQLB 5E6NA 3A9KB 3RCZA 3ZTDA 2MA9B 2HD5B 1GC7A 2K6QA 3SU8X 3TJPA 3ZVVA 2LXAA 2C9WB 2IO2B 2NCNA 4G0NB 4K7WA 1HE8A 3K9OB 4IM3A 2EKEC 1WGHA 5D6JB 1UELA 2K8HA 5J2RA 1OGWA 1WMHB 1WRDB 1YX5B 1R4NI 3PS6A 2BWES 2KOXA 1V9JA 2PPHA 1VCBA 2MBHA 3QX1A 4IG7B 3BY4B 3VTVA 4DHJD 2JZZA 3VFKA 4HPMB 2LI5A 2KLCA 1VD2A 4DDGD 3ZKJC 3HHMA 4DK5A 2R2QA 3A1QB 2MBEA 2O6VB 4IM2A 5DPRA 4E3CA 1LXDA 2NBVB 2L0FA 3JSVB 2J0KA 1F9JA 2V3SA 5CX3A 4HDOA 1QZEA 4BBNC 3RT3B 4F8CB 2OOBB 5DPWA 3H9DA 2RR9A 3ZDMC 3NOBA 1WGDA 1V49A 3ECIA 2FCMA 3CSTA 3HM3A 1P1AA 4B6WA 4FHJA 3IHPC 5D2MB 2PEAA
chains in the Genus database with same CATH superfamily
2RDHA 3RYTA 3LYYA 3PHWB 4K1RB 2MJEA 1V5OA 3NVZA 2K0PA 2I1KA 2ZCCA 3S2AA 2NPTB 1YJ1A 1FFUA 3RI7C 3N20C 2INPE 2BKRB 2MW5A 1QOGA 2Y5CA 1GUAB 4A8XC 1RM6C 1TKGA 2L7RA 3RNAC 4AUQC 2CHXA 3NG0A 1F2RC 2EMSA 3TMPB 3QARA 4C56C 5FR3A 2V3PA 4YXDB 1GJZA 1VDVA 1A5RA 2MLBA 2ZNVC 2J0JA 2ZVNA 3DBHI 2QDFA 2QC8A 4RNAA 5GXGB 4IC7B 4Q2JA 4RM9A 1JWSD 2AL3A 4BOZB 1EM7A 3HM6X 4GIVA 1A70A 1BMLC 3V3XA 1ACCA 1T6BX 2LRWA 2LMCA 1WF9A 1SB3C 1ROEA 1XLOA 3N3KB 2QHOA 1WFYA 4TUUA 2ZPYA 2IGHA 1WGKA 2M56B 2J52A 1OQRA 4C4VA 2SAKA 1FM0D 1JROA 1NI2A 3EA6A 3KWLA 4LCDE 1E6EB 4YTMB 1F77A 2D3AA 2OHFA 3N9YC 1HZ6A 2Y5PA 4TQ0A 2L3ZA 4PYZA 2O6VD 2N9XA 2G4SA 3AE5B 3VTWA 2K8CA 4BAXA 2KHWB 1ZW7A 3NHEB 1QLBB 3N30A 2LGYA 4O1NA 2Z8LA 4P1CC 5AUKA 4IWOA 3I63C 3RULA 4WWPA 4K7UA 2WDTB 4K81A 4LK0M 4TKNA 2WHIA 5HKHA 3ZYYX 1E8XA 3W1SC 2RSUA 4PS8A 3TL5A 2GBKA 3AH7A 4JWSC 2ASQA 3H6NA 4NPNA 1YNTE 1HZ5A 2NPTA 1J7AA 2LVPA 3KW5B 2MQJA 3C8YA 1YQBA 4YTNB 3WANA 4HKQA 4WJQA 1QOBA 3RZWC 4DQOC 2ZZPB 3AULA 3AEEB 2D2QA 1X1MA 4LNIA 4MGIE 2KTFA 1OEYA 3N32A 5DCNA 2GBJA 2KQ4X 3UIOB 3GP7A 3GS2A 4KGTA 1SE3A 3Q6BA 2MH7A 1XT9B 3MHSD 3B08A 2PIAA 4FXCA 1VR9A 2BYFA 4C80A 2PTLA 3KQ4A 1UGJA 4TMAB 5BMGA 2EKIA 4RM8A 2JY6A 4W9EA 1YX6B 2WDVB 4KIKA 1V81A 3QA8A 1ZOYB 1PUTA 2WX1A 3CIRB 1R7SA 3M95A 1NYRA 4FULA 3TSSA 1EU4A 3W9CB 4DBGA 2D10A 2IO3B 2G1EA 4W9IA 1PGAA 2KDEB 4H2AA 4XDCA 1V8CA 4NZLB 1T3QA 4E71A 4ARIA 2KO3A 2NTTA 4R3DA 2DLBA 1L4DB 2BB5A 2D11A 4GN1A 1YD8U 1V1PB 2QEJC 4USAA 3SFDB 3SR6A 2MEKA 2WXNA 3PT2B 3BINA 1OTRB 2WLBA 5GMVA 2DYMA 1WGGA 4A9AA 3GZNB 3N1YC 2KFKA 3V60A 1PGXA 3PRMB 4FHKA 1L7YA 1MJDA 2K39A 1WJ4A 1EU3A 2JX5A 3LDZE 3PGEA 1IPGA 4GMVA 2W55A 4I6PA 2KDBA 2KX0A 4ANWA 1E8YA 3U7ZA 1IP9A 3U7DA 2JRHA 3Q8FA 1N60A 4MELA 4LNKA 4AJWA 1WIAA 3RPFC 3ZTCA 4W9HA 3E9SA 4HPPA 1E8WA 4NJ7A 3WAPA 3GOEA 1FD6A 1K53A 1QOFA 1TS4A 1XLPA 4AWJA 1P98A 4DWFA 4F7ZA 2KMAA 1KF6B 4M8MA 4TQ1A 5IP4D 4RCOA 3IT6B 3T8MA 1ZXIA 3P4SB 3IAS1 4KDIC 5AZFA 3MHZA 1N6ZA 5BMHA 2RPVA 4K3CA 4MJSB 4HCNB 1L5PA 3TIXA 2XBBC 3U4EG 2FUHB 2IDYA 2LUEA 3URYA 4RGTA 3AEGB 1HXYD 1GOZA 1YIWA 3TEXA 2W9NA 3AM9A 3R7QA 3L10B 1YN5A 2SEBD 3R8BA 1SJHD 2JSVX 3AE6B 4KZ0A 3ETRA 1RWSA 3QCAA 1WX8A 2R61A 4AP4C 2WWZA 3VRAB 2AL6A 3L13A 4W9CA 2PMVA 3FILA 2FE8A 4GSWA 4L1BA 1XO3A 4ANVA 1FPYA 3IG3A 4CO7A 4IUMB 4GDLB 2N9EB 3BZDB 1TKEA 2FBWB 2B76B 3SU8X 3TJPA 3ZVVA 2LXAA 4ZYSA 4CQNA 3K9OB 1SJED 1WGHA 2EKEC 2J4XA 5D6JB 1UELA 2BWES 2KOXA 2PPHA 4IG7B 1V1PA 2MBHA 4DHJD 2JZZA 3VFKA 4DDGD 1YJJA 1ESFA 1YQ4B 4DK5A 3A1QB 4IM2A 2KDMA 3TUOA 1CJEA 1TS2A 4BBNC 2RR9A 1JMLA 1V49A 5EE1A 3NZ3A 4FHJA 1ZDVA 2AQ2B 4K7SA 4W9LA 1YMHE 4W9DA 3Q3JA 4LJOB 3ZIMA 3KYDD 2BVCA 2NMQA 2N4FA 1GC6A 2CKHB 2WU2B 2NVUI 4WQMA 1PDXA 5J18A 1LM8B 2R2OA 1VZ7A 4OVZA 5AUIA 4WQOB 2GB1A 2DZKA 4P7IA 2K25A 5IO9A 1LGRA 4EZKA 2WXKA 1FXAA 5CHFA 4J3OD 2KTRA 4LNOA 2BF8B 2L76A 3AI5A 2KWVB 5D3IB 3PRPB 2JU6X 3ZNGC 3FKYA 1QOAA 3L08A 4GDKA 1K52A 3GZNI 4XE0A 4FJYA 1C3TA 3L54A 4MH0E 4DXAB 4S17A 3AE1B 2H89B 1MFWA 5IOIA 4HPLB 3B0AA 2W3RA 3ALBA 3H7PB 2V9HA 4A3PA 2ZJDA 2D3BA 3BK1A 3VH4B 4HDQA 2PJHA 5CHVC 1NEKB 3GE8C 3GB1A 2YVCA 4TSSA 2LVQA 3V6EB 2KN5A 4BZAA 1KH0A 4ZRJA 2A5UA 4W9FA 4LNNA 5J17A 5JHAA 1FXTB 4HLEA 3A4RA 3BWUD 2I2YA 1B9RA 3OJ4B 1VJKA 4KV2A 3W1YA 2FIDA 2BS3B 3CWIA 4WWMA 4NQKE 2WXQA 3KUCB 4ACFA 1WZ0A 3DBRB 1MVKA 2K9XA 1R4MI 2I1JA 2BWFA 2WXHA 3MTNB 3AXCA 1HEZE 2KDIA 2IZVB 3RFZB 1KLGD 1FNVA 2MP2A 3KWVA 2ZNVB 1N63A 3PLUA 1IGCA 2XEWA 3TEWA 2LHDA 1WJNA 5CHWA 4MJSA 1WRIA 4B9KA 3VUXA 2HE7A 4AS1A 4GU2A 1M4VA 4CYEA 4IDIA 1WXVA 3PRZA 3VXWA 3PTFC 2LWPA 2DZIA 2KXJA 1D6EC 4URKA 5BO4B 2Z0DB 2LJ5A 2IO0B 4F1SA 5AZHA 2YEPF 3WAOA 2DZMA 3PZ8A 1I4QA 3RMKC 2VH2A 1BUIC 2WXPA 1TGZB 4IM0A 3ML9A 1TZOA 3I5JC 1KRHA 2Z59B 3RN9C 3VR8B 2KD0A 1E8ZA 1WXQA 4GOCA 1FRRA 2NBUA 3VR9B 4WJPA 4JL9A 1WH3A 3FILB 3B2FA 2M0XA 2CU1A 3VVWB 5JXVA 1CMXB 4OZAA 3EGRA 2N9LA 1ZGUB 1XLNA 2DAFA 1MHHE 1NI3A 2M0AA 1IBXB 1E90A 3DBLB 2JRIB 2JWZA 3AECB 1P9DU 3VDZA 4ANUA 4NAWA 1ZXHA 3AE7B 2VZKD 1ZE3D 2D07B 3A9JA 4AOFA 4DHJB 2KJ6A 1KJTA 1MPEA 1FNUA 3FC4A 4XX5A 2WDQB 1KLUD 1XF5L 4ZHPA 1RYJA 2LVOA 4LLGM 3V61A 3R3MA 1STEA 5HI1A 1MG4A 5KHQA 4C7YA 3BK2A 3X23A 4HXDA 2D3CA 4KZCA 3EFUA 2M1MA 4HCPB 2QILA 5JH5C 2LGSA 3Q3MC 2REXA 1V5TA 3DVGX 4MGYE 1V86A 2KNBA 2WXMA 3APCA 2NTSA 1DOXA 5TR5A 1CK1A 4EFOA 1WXAA 2IBIB 2L00B 4MSQB 4HJGE 4BKSD 1NDDA 4D2KA 1I4XA 2JWUA 1VZ8A 2WXRA 3P4PB 2JYEA 2N1VA 3DQVA 1E0ZA 1V2YA 3SHQA 4RGOS 4XC2A 2MJDA 2X8XX 4B0EA 3WA0A 2JZPA 1I4GA 5DPTA 1GNUA 4P16A 2D3GA 4KSKC 5E6OA 3BYTB 1JRUA 3QWZB 1KFYB 1RRBA 4KVGB 3JYUA 1NVID 1JALA 1SIJA 2WP9B 3NRZA 3EECA 2DHZA 3NVYA 3U30A 4G11A 4DHZE 2AQ1B 4KIKB 1JWMD 4N9F4 2O6VA 1ET9A 1PYWD 4ASWC 5BYSA 2WS3B 5IA7A 1G6JA 3L17A 1IBXA 5FK9C 1TTNA 4JQWC 2JPHA 2KX3A 3GE3C 3L16A 2Q5WD 2KKCA 4A6QA 2WNMA 3MP9A 1OFFA 5G5GA 1MG8A 4KKJA 3K9PB 1PQSA 2WU5B 4MEMA 3AB5A 1UGMA 4XDDA 5JZEB 2LZ6A 5BMIA 1YN4A 1TS5A 3Q14C 5LLIA 3NZSA 2G45B 3KVFB 3EFCA 3PLVA 2LUMA 3DDCB 1WMHA 2BS2B 1GB4A 2N1WA 4EZJA 2K6DB 4US9A 4ZHOA 1SF0A 3CMMB 3Q8BA 1UZXB 2GMIC 2LFIA 1N62A 2AWTA 4WAFA 1L0VB 1K8RB 2FNJB 4IW0A 1UUPA 3QC8B 4W9JA 4B95A 4JLCA 3KUDB 4NQLB 1ENFA 5E6NA 4US8A 2QCZA 2MA9B 2K6QA 2J53A 3PO0A 1SE2A 3R2IA 4G0NB 2NCNA 4K7WA 4NAMA 4IM3A 3MJ5A 1P7FA 2K8HA 2DBYA 1OGWA 1WRDB 4PS3A 1JW9D 1V9JA 4XWTA 1FCLA 3KLSX 1D4BA 2LI5A 1VD2A 2R2QA 1AN8A 2AX5A 2MBEA 2L0FA 3PZ7A 4S0RA 4HDOA 1QZEA 4JPSA 4F8CB 2OOBB 3H9DA 4M01A 3ZDMC 3ZXRA 1K51A 3B2GA 1ZP0B 3ECIA 1GPXA 2D5GA 1C77A 3IHPC 2PEAA 1D5ZC 3VTUA 1XCTL 1I35A 2WGSA 3W2DA 2C7HA 3AU4A 1ZUD2 2W3SA 1KM7A 4C4VB 5E6PA 2L05A 3CF6E 4WJNA 3P42A 1P3QU 2ZVOA 1V1OA 4OHJA 1QILA 1JWBD 1EUVB 2IGDA 2WX0A 3QJZA 1UNSA 1VLBA 4IWQA 3DWGC 2IPKD 5EE3A 2ZEQA 1L2NA 1MI0A 2LXCA 3UQBA 1VZ6A 2KC1A 2X38A 5EE9A 3I3TB 3VUYA 5TSSA 2OJRA 3FAHA 4FN2A 2KACA 4II2B 1TS3A 2LASA 2BBCA 4JX1C 1C4CA 3OWEB 3QHTA 2G3QB 4FA6A 3APFA 4ZRKA 4BOSC 3EHVA 1LFDA 1XXGA 4MM3A 2KVRA 2WXFA 2ZCBA 2BB6A 3BYYB 3O65B 4XWWA 3QQ8B 4HEA1 1MHXA 3QAQA 4EUTA 4ZDVA 2HJ1A 5D94A 2UU7A 1J19A 3NUHB 3NVWA 3H1UA 3P4RB 5H8YE 2LGIA 2KFKB 3IXSA 3UF8A 1C78A 3DVNU 5C3JB 2W54A 4I6NB 2KK8A 4HJKA 4A55A 3KH0A 2INCC 3EUB2 3C0RB 3EC8A 2KC2A 2G4DB 5G2NA 2KWCA 5EDSA 1WM2A 4N6EB 1I4RA 2BYEA 1OEYJ 2DENB 2KWUB 2V3NA 3ZXVA 2KWDA 3Q3NC 3AEDB 4BKGA 3ML8A 4UDUC 1Z5SB 2BS4B 4L2YA 4W9KA 4KSLC 3HIZA 4FJVB 3O13A 3P4QB 1L0XB 2KTRB 3B9JA 3L4PA 3JW0X 1AARA 2L32A 1WR6E 4NJCA 4GGQA 1D5MC 2RDGA 3DBRI 4DHZB 1WZ3A 3B1LX 4HK2A 4FBJB 4N58A 5G5HA 3AEBB 4PT5A 3A4SC 3PREA 1WGYA 5LXIB 1SIFA 3J9CA 1M94A 2CJNA 2CR5A 2JT4B 4ZOHC 1WXMA 1GAQB 2PVGC 4GLSC 3D32A 1N5WA 4MGZE 1TBEA 4JIOU 2LGDA 1T5XD 1UH6A 4L23A 4RFBA 5HHDG 1J7CA 2BQQA 4LDTB 3LJ3A 2BTEA 1CZPA 4DXFA 2JZ3B 3W5VB 3T3OA 2O2VB 5C23A 2DWQA 3U2SC 5HFYA 2Z0EB 1RFKA 4G3XB 2BT6A 2C7MB 3IFWB 5KHOA 3DHIC 2G9HD 1L6VA 3U8ZA 4WWOA 2AQ3B 2ON8A 3QIJA 4EKUA 1AYFA 5EE0A 4OZCA 4I6LB 4LJPB 1TYGB 3M63B 3R66C 2LHEA 4IKGA 1UWMA 4GDKB 2EMTA 2BKFA 3DVGY 2N9KA 4RGNA 4ICVA 2V4LA 4BKSA 3LXFA 3VUWA 1DYQA 2INDC 2L8JA 4E74A 2KN4A 1WI0A 2FCNA 3ZUNA 1T0QC 3P63A 4DXGA 3Q3FA 3PHXB 2GI9A 2JXTA 2ICIA 1H4RA 3W1SA 3RD2A 2INNE 2L52A 2KMCA 1DGJA 5G55A 1XCQL 1EF5A 2AYOB 2K3UA 3AU5A 1QKZA 4K3BA 2MBQA 4KKIA 2E6XA 4HVBA 3N1ZC 1GG3A 3SDLC 2WYQA 2VRRB 4KDLB 1EWCA 3ZNZB 5L95C 3MC0B 3AV8A 1WX7A 3U52E 2LEKA 1BT0A 4KGSA 2KLGA 1F0ZA 1L4ZB 3DBLI 1TY2A 1YJIA 4X57B 1QT9A 1SSNA 2OEDA 1E7UA 1JRPA 4WWNA 3Q69A 3M3JA 1S1QB 2IGGA 3KUZA 5HG2A 2MHJA 2ZW0A 5CTRC 4LNFA 4WURA 2ONQA 2KAJA 3MFGA 4RMAA 2A4ZA 3NS8A 1N61A 3VAWA 2JQRB 3WIMA 1RFAA 1AW7A 2KT7A 3L0WB 5JHBA 1SGHA 3ZJVA 2M17A 1TIFA 2RDBC 4N59A 2K8BA 5MPOA 1HTQA 4B0MA 3TBLD 5AEKB 4NY0A 2N7JA 3OG5A 1RAXA 3PPAA 4MDKE 2XN9C 3JVZX 2PW9A 2CS4A 2KANA 4FADA 1Y8RC 4ZRIA 4HKZE 4AJYB 2ZW1A 3RNBC 3UQAA 2GBRA 3IVFA 4DDID 2HDEA 1NYQA 4TV3A 3V05A 4PK1A 2MBOA 3HK0A 1SBBB 4EEWA 2FCSA 1J0GA 2XK5B 1ZPSA 4HROA 1E5WA 4PS7A 3DHGC 2LRUA 3TEYA 2CHWA 2NR2A 5IKCM 2JYTA 1FCCC 3H7SA 5T8IA 1PGBA 2MX2A 4MSMB 4LTUA 2DYBA 3DPDA 1IGDA 3T9LA 1EO6A 1Z2MA 4LDTD 3A9KB 3RCZA 1GC7A 1QF6A 1J7BA 1SE4A 1QQRA 1BXTA 1HE8A 1C4PA 1Q10A 3NVVA 5J2RA 1WMHB 1YX5B 1R4NI 3PS6A 2WQYB 3QX1A 1VCBA 2WDRB 3BY4B 2BW2A 4HPMB 1HQRD 3HHMA 3ZKJC 2O6VB 2J0KA 2V3SA 5CX3A 3Q8CA 3NOBA 4AQ7A 4B6WA 1HA5A 3P1MA 1WSPA 3SFEB 4II3B 1C1YB 5E6JA 1UF0A 4EE2A 2WXIA 1WGRA 2ZPNA 1XEEA 2C5LC 3ZNHB 1WM3A 2C60A 3TEZA 2KZRA 4RGMA 1S3SG 3BVGA 1P0RA 3RNFC 4ZRQA 4A20A 4A90A 2VH1A 4ANXA 5C2TB 1EWYC 3LB8C 1C4AA 3T3NA 2V0GA 2PE9A 3OJ3A 4M00A 1R4MB 1C9FA 3E56A 3H7PA 2PVOD 4XGAB 5FKAC 3C19A 2KMMA 3APDA 2Y5BB 2UYZB 1FFVA 4P6VF 3IBEA 3JSVA 5DPSA 2N7DA 3W5UB 3Q8EA 2BPSA 1F1HA 1Q1OA 1LO5D 3R7RA 2DYOA 3A33B 4YL8A 3ZRFA 4OZBA 2PLPA 2MRPA 1DOIA 2GBNA 2V1YA 4MM3B 2YLMA 3DHHC 4P1BC 1D5XC 4GXBA 1KLVA 2CU3A 4YSXB 4BBNF 2HTHA 2NBWB 3R2TA 1XD3B 3A9KA 2IY0B 2WXLA 4YSZB 2PKOA 3CSFA 2HJ8A 3SD5A 1FXIA 2FIFA 2GOWA 1WYWB 1XQQA 5L83A 2V4IB 4IWPA 3HVZA 2K1FA 3ZJTA 4BFRA 2GBMA 1SEBD 3VQIA 4XZ4A 1T0YA 2VZKB 1FEHA 1N5XA 1KTKA 2IJ0A 3NJTA 2K5PA 1UD7A 3DBSA 3VH3B 2RGFA 4C7ZA 2TSSA 1WXSA 1EF1A 4M8NA 1SXTA 1TKYA 2C7NB 3RNGC 2RD0A 4ZYNA 2WXJA 2MWSB 3Q8AA 2M4NA 3SEBA 2QJLA 4ZRPA 2BYVE 3A1QA 2MJ3A 2QSDA 1L6UA 4QAYA 1WR1A 2H88B 4WAAA 3WALA 4BVUC 2M19A 4NNJB 2KFJA 2JVCA 1Q5WB 3UI3A 1H8CA 2IY1B 3TCAA 2MSED 2LD9A 1I4HA 2IO1B 3DCGA 4YWGG 1R4NB 2YEPB 2QIEB 1D3ZA 1CQVA 1YOVB 1JWUD 3KYCD 3ZQ4A 3ZJUA 2L1AA 4J6IA 4W9GA 1PFDA 4ITKA 4JE3B 4FJZA 4OVUA 3VRBB 2KJHB 2GRIA 2AEHA 3OAWA 2DAJA 1WX9A 2M8SA 3ONSA 1WY8A 1C76A 1U4AA 3MC9A 3NZUA 3V6CB 1E10A 3P2BA 5BYRA 4GB9A 2NS5A 2PE6B 2FAZA 3VHTC 4NJ6A 2CJOA 3RNEC 3BIID 5BYQA 4HWIB 1WJUA 4YT0B 2MCNB 2L0TA 1FMAD 1V80A 1WE7A 1FRDA 1NBFC 5LXHA 1FIQA 4YSYB 1UBIA 2MP2B 5IAAC 1YN3A 4BKTA 2XK5A 1RLFA 4M0WB 4CHKA 5D7GA 3ZNID 2I38A 1JWAD 2KDFB 4YTPB 3AE8B 1I7HA 2RMMA 4RF0A 4C00A 1XLQA 4REZA 3UINB 4G50A 3PZDA 3UGBB 2KQ7A 1TT5B 2KQSA 2W82A 1JCKB 2IYDB 1KOTA 1ISNA 3ENEA 1Y56A 1IYFA 1OQQA 3DOWA 2JF5A 2MBBB 2DX5B 4A3OA 2ACZB 3BVZA 1V6EA 3NS1A 2KJRA 4M02A 4WJOA 1F2RI 1WYGA 2UWQA 4JGHB 3WAMA 1T0SC 3OLMD 1UWXA 4KX6B 3H8HA 2E3TA 2K22A 3QK0A 3ZW3A 2LGXA 2J0MA 1B1ZA 4MACA 3X0WA 3HVDA 3IAM1 2RPQA 5H92C 1J8CA 2BGFA 4HRSA 3ZDTA 1P7EA 4GDLA 2Y3AA 3N1XC 1JQ4A 1IUEA 3RUIB 2JUOA 3M62B 1SE9A 3DBHB 4JWUC 3MJWA 1E7VA 4EZLA 3AE9B 3ZO5B 4EOYA 3PVLA 1C79A 2KVZA 1FNWA 1TZ1A 2QMTA 2KYWA 4IOIE 1DOYA 2DZJA 3RNCC 1I4PA 1OQYA 1L0YB 3I57A 4M0WA 4OW0A 2DNFA 1VRAB 3BVMA 1E7PB 3RZFA 1I42A 3WCQA 5IN7A 3NY5A 3AEFB 3V62A 2J7QB 1Q0WB 2B3AA 2LJIA 3PV1A 1WE6A 5I4DA 4XYCA 3I9V1 2OJWA 2EELA 1WWTA 1AWDA 4RF1A 1ZDXA 3AEAB 2N9PC 1UBQA 2O2VA 3A9JB 1NENB 2FUG1 2CHZA 3ZLZA 3ZGZA 2N0SB 3ABVB 4MT5A 1V97A 4NAWB 1YQ3B 4FLHA 3ZRCA 3DVNV 5C1ZA 3IT4B 2FCQA 4ARCA 2GLSA 4MGKE 1WJ6A 1K50A 2JXXA 2N7EA 1ZKHA 4ICUA 4PYUA 5FR6A 3Q3OC 1HTOA 5AZGA 1ET6A 5LNK1 4OVVA 2J42A 3DWMA 5D3DA 1TJEA 4KGRA 3UIPB 3PSEB 1E9MA 2BYTA 2L83A 1LQBA 2WXGA 4WIPA 1T0RC 3ZTDA 1FO4A 2HD5B 3HUIA 2C9WB 3AE2B 4MH8A 2IO2B 3AMZA 1F52A 2XNAC 4RH6A 2HTME 3MC8A 3VTVA 2KLCA 5DPRA 4E3CA 2WXOA 1LXDA 2NBVB 1TY0A 3JSVB 1F9JA 3AE4B 1GB1A 3RT3B 3AE3B 3HRDD 3AN1A 4WH4A 5DPWA 1WGDA 2FCMA 3CSTA 3HM3A 1P1AA 5D2MB 3Q2AC
chains in the Genus database with same CATH topology
4K7SA 4W9LA 3RYTA 4W9DA 3Q3JA 3VTUA 4LJOB 3ZIMA 3KYDD 1I35A 3PHWB 4K1RB 2C7HA 3AU4A 2N4FA 1GC6A 1C1YB 1V5OA 2CKHB 4II3B 2NVUI 1WGRA 2ZPNA 1KM7A 2C5LC 3ZNHB 5E6PA 2L05A 5J18A 1WM3A 2C60A 1LM8B 3CF6E 2R2OA 4WJNA 2I1KA 2KZRA 2ZCCA 1P3QU 3S2AA 1S3SG 2NPTB 2ZVOA 4WQOB 4P7IA 2DZKA 2K25A 1YJ1A 1P0RA 4EZKA 4A20A 5CHFA 1EUVB 2WX0A 3QJZA 2BKRB 4IWQA 2KTRA 2MW5A 4ANXA 2BF8B 1GUAB 2L76A 3AI5A 2ZEQA 1L2NA 2KWVB 2LXCA 2PE9A 3OJ3A 3UQBA 3PRPB 3ZNGC 2KC1A 2L7RA 3H7PA 4AUQC 3I3TB 3L08A 3VUYA 2CHXA 4GDKA 2OJRA 3APDA 2EMSA 2Y5BB 3TMPB 2UYZB 3QARA 4FN2A 3GZNI 4II2B 3IBEA 2LASA 3JSVA 5DPSA 2N7DA 3QHTA 2G3QB 4FJYA 1C3TA 2BPSA 3L54A 4FA6A 4MH0E 1GJZA 4DXAB 3APFA 1Q1OA 3R7RA 2DYOA 3A33B 4ZRKA 4BOSC 4YL8A 3ZRFA 1A5RA 2MLBA 2ZNVC 2J0JA 2ZVNA 3EHVA 3DBHI 4HPLB 1LFDA 3B0AA 2MRPA 4MM3A 2KVRA 4IC7B 4RM9A 3ALBA 2AL3A 2GBNA 2V1YA 2ZCBA 3HM6X 2YLMA 4GIVA 4BOZB 3O65B 3H7PB 4GXBA 4A3PA 1KLVA 2ZJDA 2LRWA 3VH4B 3QQ8B 4HDQA 2PJHA 3QAQA 4EUTA 4ZDVA 5CHVC 1WF9A 2YVCA 4BBNF 2LVQA 3V6EB 5D94A 3N3KB 2HTHA 2NBWB 2KN5A 1XD3B 3A9KA 1J19A 2IY0B 2QHOA 3H1UA 1WFYA 4TUUA 2ZPYA 4ZRJA 2A5UA 3CSFA 4W9FA 2HJ8A 3SD5A 2FIFA 5J17A 5JHAA 2GOWA 1WYWB 2KFKB 1XQQA 1FXTB 4HLEA 3A4RA 3UF8A 5L83A 3OJ4B 3DVNU 4IWPA 1NI2A 4I6NB 2KK8A 2K1FA 4HJKA 4KV2A 4BFRA 3W1YA 2FIDA 2GBMA 3KH0A 4XZ4A 3VQIA 4NQKE 4LCDE 4TQ0A 3KUCB 3C0RB 3EC8A 1T0YA 1WZ0A 2L3ZA 2O6VD 4PYZA 1R4MI 2KC2A 2G4SA 2I1JA 2N9XA 3VTWA 2G4DB 2K8CA 2BWFA 3MTNB 5G2NA 3AXCA 1UD7A 3DBSA 2KHWB 2KWCA 5EDSA 1WM2A 3VH3B 1ZW7A 2RGFA 3NHEB 2KDIA 3N30A 1WXSA 1EF1A 4M8NA 2BYEA 1OEYJ 2C7NB 2DENB 2KWUB 2IZVB 2LGYA 2RD0A 4ZYNA 2MWSB 2M4NA 4IWOA 4BKGA 3ML8A 1Z5SB 2MP2A 2BYVE 3A1QA 4W9KA 4KSLC 3RULA 2ZNVB 3HIZA 3PLUA 2XEWA 4FJVB 4WWPA 1WR1A 4WAAA 1WJNA 4K7UA 2KTRB 5CHWA 4MJSA 3WALA 4BVUC 2WDTB 4K81A 4NNJB 2KFJA 3JW0X 4TKNA 2JVCA 1Q5WB 4B9KA 1AARA 5HKHA 1H8CA 3VUXA 1E8XA 2HE7A 1WR6E 3W1SC 4GGQA 2IY1B 3TCAA 4GU2A 2MSED 2RSUA 3DBRI 2LD9A 4PS8A 3TL5A 2IO1B 4DHZB 4CYEA 3DCGA 1WXVA 1WZ3A 3PRZA 3B1LX 1D3ZA 2GBKA 4HK2A 4FBJB 2ASQA 3H6NA 3KYCD 3VXWA 4NPNA 3PTFC 2LWPA 2NPTA 3A4SC 3PREA 4J6IA 1WGYA 2DZIA 2KXJA 4W9GA 4URKA 1SIFA 5LXIB 4FJZA 2Z0DB 2LJ5A 4OVUA 2LVPA 1M94A 5BO4B 2IO0B 4F1SA 2CR5A 3KW5B 2JT4B 5AZHA 2MQJA 1WXMA 1YQBA 2DZMA 2KJHB 3WAOA 3WANA 3D32A 2AEHA 3OAWA 4MGZE 4WJQA 2DAJA 1TBEA 1TGZB 1WX9A 2M8SA 3ONSA 4JIOU 3RZWC 2LGDA 4IM0A 1UH6A 1WY8A 3ML9A 1U4AA 2ZZPB 4LDTB 3LJ3A 2Z59B 3NZUA 2KD0A 3V6CB 3AULA 1E8ZA 3P2BA 2D2QA 4GOCA 1X1MA 2NBUA 4WJPA 4MGIE 4GB9A 2JZ3B 2KTFA 4JL9A 2NS5A 2PE6B 2FAZA 3VHTC 1WH3A 4NJ6A 1OEYA 3N32A 2M0XA 2O2VB 2CU1A 5C23A 5DCNA 2Z0EB 3VVWB 4G3XB 2GBJA 4HWIB 3UIOB 1CMXB 1WJUA 2C7MB 3IFWB 5KHOA 2MCNB 2L0TA 1NBFC 1V80A 1WE7A 4WWOA 3U8ZA 1ZGUB 2DAFA 5LXHA 1XT9B 3MHSD 3B08A 1UBIA 2MP2B 5IAAC 1E90A 3QIJA 2BYFA 4EKUA 2JRIB 2JWZA 3VDZA 1P9DU 4BKTA 4ANUA 4I6LB 2XK5A 1RLFA 4LJPB 4M0WB 4CHKA 4NAWA 5D7GA 3ZNID 3M63B 2KDFB 3R66C 4RM8A 2JY6A 1YX6B 4KIKA 4GDKB 2EMTA 2BKFA 4W9EA 1V81A 2D07B 3A9JA 3DVGY 3QA8A 4AOFA 4DHJB 2KJ6A 1KJTA 3UINB 2WX1A 4XX5A 4G50A 3PZDA 2V4LA 4ICVA 3UGBB 4BKSA 3M95A 3VUWA 2KQ7A 2KQSA 2LVOA 4FULA 2L8JA 3V61A 2IYDB 3R3MA 4E74A 5KHQA 1KOTA 1ISNA 4DBGA 1WI0A 2D10A 3ENEA 1IYFA 2IO3B 3DOWA 3X23A 2FCNA 4HXDA 3ZUNA 2JF5A 2MBBB 4W9IA 2DX5B 4KZCA 4A3OA 3Q3FA 2KDEB 3EFUA 2M1MA 3PHXB 4HCPB 1V6EA 5JH5C 2KJRA 4WJOA 2REXA 1V5TA 2UWQA 4JGHB 4E71A 3DVGX 4MGYE 1H4RA 2KO3A 3RD2A 3W1SA 1V86A 3WAMA 3OLMD 2KMCA 2KNBA 2D11A 5G55A 4GN1A 1YD8U 3APCA 3QK0A 5TR5A 1EF5A 2AYOB 4EFOA 1WXAA 3ZW3A 2IBIB 3AU5A 2L00B 4MSQB 2LGXA 2J0MA 2MBQA 4BKSD 3PT2B 4HVBA 3X0WA 1NDDA 1GG3A 3BINA 3SDLC 1OTRB 2WYQA 2VRRB 4KDLB 3ZNZB 5L95C 5GMVA 1WX7A 2RPQA 1BT0A 2DYMA 1WGGA 1J8CA 2BGFA 2N1VA 3DQVA 2KFKA 2KLGA 3V60A 3ZDTA 1V2YA 4GDLA 3DBLI 3SHQA 3PRMB 4FHKA 3RUIB 1L7YA 2K39A 4X57B 4XC2A 2JUOA 3M62B 1SE9A 1E7UA 1WJ4A 4WWNA 3M3JA 1S1QB 3LDZE 3KUZA 3PGEA 3WA0A 5DPTA 1IPGA 1GNUA 5CTRC 2D3GA 3MJWA 4GMVA 1E7VA 4I6PA 4KSKC 2KDBA 2KX0A 5E6OA 4EZLA 4ANWA 1E8YA 1JRUA 3ZO5B 4EOYA 3PVLA 4RMAA 1TZ1A 2A4ZA 3NS8A 3QWZB 1RRBA 4KVGB 1IP9A 3VAWA 3U7DA 2DZJA 3JYUA 2JRHA 4MELA 3WIMA 3EECA 2DHZA 1RFAA 4AJWA 3L0WB 1WIAA 3ZTCA 4W9HA 1OQYA 3U30A 5JHBA 1E8WA 4NJ7A 1SGHA 3WAPA 2M17A 4G11A 4DHZE 3GOEA 4KIKB 4N9F4 2O6VA 4AWJA 2K8BA 1P98A 3TBLD 4DWFA 4ASWC 2KMAA 4F7ZA 3RZFA 4M8MA 5AEKB 4TQ1A 5IA7A 1G6JA 3L17A 4NY0A 4PS3A 1I42A 1TTNA 4JQWC 3NY5A 3T8MA 3V62A 2J7QB 2JPHA 1Q0WB 1RAXA 2B3AA 3PPAA 4MDKE 4KDIC 5AZFA 2KX3A 3JVZX 2CS4A 2KANA 1WE6A 3PV1A 3L16A 2KKCA 1Y8RC 4FADA 4ZRIA 4AJYB 4MJSB 4HCNB 2N9PC 3UQAA 1UBQA 2GBRA 3IVFA 2O2VA 1MG8A 3TIXA 2XBBC 3A9JB 4DDID 2CHZA 4TV3A 3K9PB 2FUHB 2MBOA 3ZLZA 3HK0A 1PQSA 4MEMA 2LUEA 1UGMA 5JZEB 4NAWB 4FLHA 4EEWA 2LZ6A 1YIWA 3ZRCA 2FCSA 3DVNV 5C1ZA 2W9NA 1J0GA 5LLIA 3NZSA 2G45B 2XK5B 3KVFB 2FCQA 3R7QA 3L10B 4MGKE 3PLVA 1E5WA 1WJ6A 4PS7A 3DDCB 1WMHA 2JXXA 2N7EA 2LRUA 2N1WA 4EZJA 2K6DB 1ZKHA 3CMMB 4ICUA 4PYUA 5FR6A 4KZ0A 5AZGA 3QCAA 1UZXB 2GMIC 1WX8A 2CHWA 4AP4C 2WWZA 2NR2A 2AL6A 3L13A 2AWTA 3H7SA 4W9CA 2MX2A 4GSWA 4MSMB 4OVVA 1K8RB 4ANVA 4CO7A 3IG3A 2DYBA 3UIPB 3DPDA 2FNJB 3PSEB 4IW0A 3QC8B 4W9JA 3T9LA 4B95A 1EO6A 4JLCA 4IUMB 1LQBA 3KUDB 1Z2MA 4GDLB 4LDTD 2N9EB 4NQLB 5E6NA 3A9KB 3RCZA 3ZTDA 2MA9B 2HD5B 1GC7A 2K6QA 3SU8X 3TJPA 3ZVVA 2LXAA 2C9WB 2IO2B 2NCNA 4G0NB 4K7WA 1HE8A 3K9OB 4IM3A 2EKEC 1WGHA 5D6JB 1UELA 2K8HA 5J2RA 1OGWA 1WMHB 1WRDB 1YX5B 1R4NI 3PS6A 2BWES 2KOXA 1V9JA 2PPHA 1VCBA 2MBHA 3QX1A 4IG7B 3BY4B 3VTVA 4DHJD 2JZZA 3VFKA 4HPMB 2LI5A 2KLCA 1VD2A 4DDGD 3ZKJC 3HHMA 4DK5A 2R2QA 3A1QB 2MBEA 2O6VB 4IM2A 5DPRA 4E3CA 1LXDA 2NBVB 2L0FA 3JSVB 2J0KA 1F9JA 2V3SA 5CX3A 4HDOA 1QZEA 4BBNC 3RT3B 4F8CB 2OOBB 5DPWA 3H9DA 2RR9A 3ZDMC 3NOBA 1WGDA 1V49A 3ECIA 2FCMA 3CSTA 3HM3A 1P1AA 4B6WA 4FHJA 3IHPC 5D2MB 2PEAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K7S A;  4W9L A;  3RYT A;  4W9D A;  3Q3J A;  3VTU A;  4LJO B;  3ZIM A;  3KYD D;  1I35 A;  3PHW B;  4K1R B;  2C7H A;  3AU4 A;  2N4F A;  1GC6 A;  1C1Y B;  1V5O A;  2CKH B;  4II3 B;  2NVU I;  1WGR A;  2ZPN A;  1KM7 A;  2C5L C;  3ZNH B;  5E6P A;  2L05 A;  5J18 A;  1WM3 A;  2C60 A;  1LM8 B;  3CF6 E;  2R2O A;  4WJN A;  2I1K A;  2KZR A;  2ZCC A;  1P3Q U;  3S2A A;  1S3S G;  2NPT B;  2ZVO A;  4WQO B;  4P7I A;  2DZK A;  2K25 A;  1YJ1 A;  1P0R A;  4EZK A;  4A20 A;  5CHF A;  1EUV B;  2WX0 A;  3QJZ A;  2BKR B;  4IWQ A;  2KTR A;  2MW5 A;  4ANX A;  2BF8 B;  1GUA B;  2L76 A;  3AI5 A;  2ZEQ A;  1L2N A;  2KWV B;  2LXC A;  2PE9 A;  3OJ3 A;  3UQB A;  3PRP B;  3ZNG C;  2KC1 A;  2L7R A;  3H7P A;  4AUQ C;  3I3T B;  3L08 A;  3VUY A;  2CHX A;  4GDK A;  2OJR A;  3APD A;  2EMS A;  2Y5B B;  3TMP B;  2UYZ B;  3QAR A;  4FN2 A;  3GZN I;  4II2 B;  3IBE A;  2LAS A;  3JSV A;  5DPS A;  2N7D A;  3QHT A;  2G3Q B;  4FJY A;  1C3T A;  2BPS A;  3L54 A;  4FA6 A;  4MH0 E;  1GJZ A;  4DXA B;  3APF A;  1Q1O A;  3R7R A;  2DYO A;  3A33 B;  4ZRK A;  4BOS C;  4YL8 A;  3ZRF A;  1A5R A;  2MLB A;  2ZNV C;  2J0J A;  2ZVN A;  3EHV A;  3DBH I;  4HPL B;  1LFD A;  3B0A A;  2MRP A;  4MM3 A;  2KVR A;  4IC7 B;  4RM9 A;  3ALB A;  2AL3 A;  2GBN A;  2V1Y A;  2ZCB A;  3HM6 X;  2YLM A;  4GIV A;  4BOZ B;  3O65 B;  3H7P B;  4GXB A;  4A3P A;  1KLV A;  2ZJD A;  2LRW A;  3VH4 B;  3QQ8 B;  4HDQ A;  2PJH A;  3QAQ A;  4EUT A;  4ZDV A;  5CHV C;  1WF9 A;  2YVC A;  4BBN F;  2LVQ A;  3V6E B;  5D94 A;  3N3K B;  2HTH A;  2NBW B;  2KN5 A;  1XD3 B;  3A9K A;  1J19 A;  2IY0 B;  2QHO A;  3H1U A;  1WFY A;  4TUU A;  2ZPY A;  4ZRJ A;  2A5U A;  3CSF A;  4W9F A;  2HJ8 A;  3SD5 A;  2FIF A;  5J17 A;  5JHA A;  2GOW A;  1WYW B;  2KFK B;  1XQQ A;  1FXT B;  4HLE A;  3A4R A;  3UF8 A;  5L83 A;  3OJ4 B;  3DVN U;  4IWP A;  1NI2 A;  4I6N B;  2KK8 A;  2K1F A;  4HJK A;  4KV2 A;  4BFR A;  3W1Y A;  2FID A;  2GBM A;  3KH0 A;  4XZ4 A;  3VQI A;  4NQK E;  4LCD E;  4TQ0 A;  3KUC B;  3C0R B;  3EC8 A;  1T0Y A;  1WZ0 A;  2L3Z A;  2O6V D;  4PYZ A;  1R4M I;  2KC2 A;  2G4S A;  2I1J A;  2N9X A;  3VTW A;  2G4D B;  2K8C A;  2BWF A;  3MTN B;  5G2N A;  3AXC A;  1UD7 A;  3DBS A;  2KHW B;  2KWC A;  5EDS A;  1WM2 A;  3VH3 B;  1ZW7 A;  2RGF A;  3NHE B;  2KDI A;  3N30 A;  1WXS A;  1EF1 A;  4M8N A;  2BYE A;  1OEY J;  2C7N B;  2DEN B;  2KWU B;  2IZV B;  2LGY A;  2RD0 A;  4ZYN A;  2MWS B;  2M4N A;  4IWO A;  4BKG A;  3ML8 A;  1Z5S B;  2MP2 A;  2BYV E;  3A1Q A;  4W9K A;  4KSL C;  3RUL A;  2ZNV B;  3HIZ A;  3PLU A;  2XEW A;  4FJV B;  4WWP A;  1WR1 A;  4WAA A;  1WJN A;  4K7U A;  2KTR B;  5CHW A;  4MJS A;  3WAL A;  4BVU C;  2WDT B;  4K81 A;  4NNJ B;  2KFJ A;  3JW0 X;  4TKN A;  2JVC A;  1Q5W B;  4B9K A;  1AAR A;  5HKH A;  1H8C A;  3VUX A;  1E8X A;  2HE7 A;  1WR6 E;  3W1S C;  4GGQ A;  2IY1 B;  3TCA A;  4GU2 A;  2MSE D;  2RSU A;  3DBR I;  2LD9 A;  4PS8 A;  3TL5 A;  2IO1 B;  4DHZ B;  4CYE A;  3DCG A;  1WXV A;  1WZ3 A;  3PRZ A;  3B1L X;  1D3Z A;  2GBK A;  4HK2 A;  4FBJ B;  2ASQ A;  3H6N A;  3KYC D;  3VXW A;  4NPN A;  3PTF C;  2LWP A;  2NPT A;  3A4S C;  3PRE A;  4J6I A;  1WGY A;  2DZI A;  2KXJ A;  4W9G A;  4URK A;  1SIF A;  5LXI B;  4FJZ A;  2Z0D B;  2LJ5 A;  4OVU A;  2LVP A;  1M94 A;  5BO4 B;  2IO0 B;  4F1S A;  2CR5 A;  3KW5 B;  2JT4 B;  5AZH A;  2MQJ A;  1WXM A;  1YQB A;  2DZM A;  2KJH B;  3WAO A;  3WAN A;  3D32 A;  2AEH A;  3OAW A;  4MGZ E;  4WJQ A;  2DAJ A;  1TBE A;  1TGZ B;  1WX9 A;  2M8S A;  3ONS A;  4JIO U;  3RZW C;  2LGD A;  4IM0 A;  1UH6 A;  1WY8 A;  3ML9 A;  1U4A A;  2ZZP B;  4LDT B;  3LJ3 A;  2Z59 B;  3NZU A;  2KD0 A;  3V6C B;  3AUL A;  1E8Z A;  3P2B A;  2D2Q A;  4GOC A;  1X1M A;  2NBU A;  4WJP A;  4MGI E;  4GB9 A;  2JZ3 B;  2KTF A;  4JL9 A;  2NS5 A;  2PE6 B;  2FAZ A;  3VHT C;  1WH3 A;  4NJ6 A;  1OEY A;  3N32 A;  2M0X A;  2O2V B;  2CU1 A;  5C23 A;  5DCN A;  2Z0E B;  3VVW B;  4G3X B;  2GBJ A;  4HWI B;  3UIO B;  1CMX B;  1WJU A;  2C7M B;  3IFW B;  5KHO A;  2MCN B;  2L0T A;  1NBF C;  1V80 A;  1WE7 A;  4WWO A;  3U8Z A;  1ZGU B;  2DAF A;  5LXH A;  1XT9 B;  3MHS D;  3B08 A;  1UBI A;  2MP2 B;  5IAA C;  1E90 A;  3QIJ A;  2BYF A;  4EKU A;  2JRI B;  2JWZ A;  3VDZ A;  1P9D U;  4BKT A;  4ANU A;  4I6L B;  2XK5 A;  1RLF A;  4LJP B;  4M0W B;  4CHK A;  4NAW A;  5D7G A;  3ZNI D;  3M63 B;  2KDF B;  3R66 C;  4RM8 A;  2JY6 A;  1YX6 B;  4KIK A;  4GDK B;  2EMT A;  2BKF A;  4W9E A;  1V81 A;  2D07 B;  3A9J A;  3DVG Y;  3QA8 A;  4AOF A;  4DHJ B;  2KJ6 A;  1KJT A;  3UIN B;  2WX1 A;  4XX5 A;  4G50 A;  3PZD A;  2V4L A;  4ICV A;  3UGB B;  4BKS A;  3M95 A;  3VUW A;  2KQ7 A;  2KQS A;  2LVO A;  4FUL A;  2L8J A;  3V61 A;  2IYD B;  3R3M A;  4E74 A;  5KHQ A;  1KOT A;  1ISN A;  4DBG A;  1WI0 A;  2D10 A;  3ENE A;  1IYF A;  2IO3 B;  3DOW A;  3X23 A;  2FCN A;  4HXD A;  3ZUN A;  2JF5 A;  2MBB B;  4W9I A;  2DX5 B;  4KZC A;  4A3O A;  3Q3F A;  2KDE B;  3EFU A;  2M1M A;  3PHX B;  4HCP B;  1V6E A;  5JH5 C;  2KJR A;  4WJO A;  2REX A;  1V5T A;  2UWQ A;  4JGH B;  4E71 A;  3DVG X;  4MGY E;  1H4R A;  2KO3 A;  3RD2 A;  3W1S A;  1V86 A;  3WAM A;  3OLM D;  2KMC A;  2KNB A;  2D11 A;  5G55 A;  4GN1 A;  1YD8 U;  3APC A;  3QK0 A;  5TR5 A;  1EF5 A;  2AYO B;  4EFO A;  1WXA A;  3ZW3 A;  2IBI B;  3AU5 A;  2L00 B;  4MSQ B;  2LGX A;  2J0M A;  2MBQ A;  4BKS D;  3PT2 B;  4HVB A;  3X0W A;  1NDD A;  1GG3 A;  3BIN A;  3SDL C;  1OTR B;  2WYQ A;  2VRR B;  4KDL B;  3ZNZ B;  5L95 C;  5GMV A;  1WX7 A;  2RPQ A;  1BT0 A;  2DYM A;  1WGG A;  1J8C A;  2BGF A;  2N1V A;  3DQV A;  2KFK A;  2KLG A;  3V60 A;  3ZDT A;  1V2Y A;  4GDL A;  3DBL I;  3SHQ A;  3PRM B;  4FHK A;  3RUI B;  1L7Y A;  2K39 A;  4X57 B;  4XC2 A;  2JUO A;  3M62 B;  1SE9 A;  1E7U A;  1WJ4 A;  4WWN A;  3M3J A;  1S1Q B;  3LDZ E;  3KUZ A;  3PGE A;  3WA0 A;  5DPT A;  1IPG A;  1GNU A;  5CTR C;  2D3G A;  3MJW A;  4GMV A;  1E7V A;  4I6P A;  4KSK C;  2KDB A;  2KX0 A;  5E6O A;  4EZL A;  4ANW A;  1E8Y A;  1JRU A;  3ZO5 B;  4EOY A;  3PVL A;  4RMA A;  1TZ1 A;  2A4Z A;  3NS8 A;  3QWZ B;  1RRB A;  4KVG B;  1IP9 A;  3VAW A;  3U7D A;  2DZJ A;  3JYU A;  2JRH A;  4MEL A;  3WIM A;  3EEC A;  2DHZ A;  1RFA A;  4AJW A;  3L0W B;  1WIA A;  3ZTC A;  4W9H A;  1OQY A;  3U30 A;  5JHB A;  1E8W A;  4NJ7 A;  1SGH A;  3WAP A;  2M17 A;  4G11 A;  4DHZ E;  3GOE A;  4KIK B;  4N9F 4;  2O6V A;  4AWJ A;  2K8B A;  1P98 A;  3TBL D;  4DWF A;  4ASW C;  2KMA A;  4F7Z A;  3RZF A;  4M8M A;  5AEK B;  4TQ1 A;  5IA7 A;  1G6J A;  3L17 A;  4NY0 A;  4PS3 A;  1I42 A;  1TTN A;  4JQW C;  3NY5 A;  3T8M A;  3V62 A;  2J7Q B;  2JPH A;  1Q0W B;  1RAX A;  2B3A A;  3PPA A;  4MDK E;  4KDI C;  5AZF A;  2KX3 A;  3JVZ X;  2CS4 A;  2KAN A;  1WE6 A;  3PV1 A;  3L16 A;  2KKC A;  1Y8R C;  4FAD A;  4ZRI A;  4AJY B;  4MJS B;  4HCN B;  2N9P C;  3UQA A;  1UBQ A;  2GBR A;  3IVF A;  2O2V A;  1MG8 A;  3TIX A;  2XBB C;  3A9J B;  4DDI D;  2CHZ A;  4TV3 A;  3K9P B;  2FUH B;  2MBO A;  3ZLZ A;  3HK0 A;  1PQS A;  4MEM A;  2LUE A;  1UGM A;  5JZE B;  4NAW B;  4FLH A;  4EEW A;  2LZ6 A;  1YIW A;  3ZRC A;  2FCS A;  3DVN V;  5C1Z A;  2W9N A;  1J0G A;  5LLI A;  3NZS A;  2G45 B;  2XK5 B;  3KVF B;  2FCQ A;  3R7Q A;  3L10 B;  4MGK E;  3PLV A;  1E5W A;  1WJ6 A;  4PS7 A;  3DDC B;  1WMH A;  2JXX A;  2N7E A;  2LRU A;  2N1W A;  4EZJ A;  2K6D B;  1ZKH A;  3CMM B;  4ICU A;  4PYU A;  5FR6 A;  4KZ0 A;  5AZG A;  3QCA A;  1UZX B;  2GMI C;  1WX8 A;  2CHW A;  4AP4 C;  2WWZ A;  2NR2 A;  2AL6 A;  3L13 A;  2AWT A;  3H7S A;  4W9C A;  2MX2 A;  4GSW A;  4MSM B;  4OVV A;  1K8R B;  4ANV A;  4CO7 A;  3IG3 A;  2DYB A;  3UIP B;  3DPD A;  2FNJ B;  3PSE B;  4IW0 A;  3QC8 B;  4W9J A;  3T9L A;  4B95 A;  1EO6 A;  4JLC A;  4IUM B;  1LQB A;  3KUD B;  1Z2M A;  4GDL B;  4LDT D;  2N9E B;  4NQL B;  5E6N A;  3A9K B;  3RCZ A;  3ZTD A;  2MA9 B;  2HD5 B;  1GC7 A;  2K6Q A;  3SU8 X;  3TJP A;  3ZVV A;  2LXA A;  2C9W B;  2IO2 B;  2NCN A;  4G0N B;  4K7W A;  1HE8 A;  3K9O B;  4IM3 A;  2EKE C;  1WGH A;  5D6J B;  1UEL A;  2K8H A;  5J2R A;  1OGW A;  1WMH B;  1WRD B;  1YX5 B;  1R4N I;  3PS6 A;  2BWE S;  2KOX A;  1V9J A;  2PPH A;  1VCB A;  2MBH A;  3QX1 A;  4IG7 B;  3BY4 B;  3VTV A;  4DHJ D;  2JZZ A;  3VFK A;  4HPM B;  2LI5 A;  2KLC A;  1VD2 A;  4DDG D;  3ZKJ C;  3HHM A;  4DK5 A;  2R2Q A;  3A1Q B;  2MBE A;  2O6V B;  4IM2 A;  5DPR A;  4E3C A;  1LXD A;  2NBV B;  2L0F A;  3JSV B;  2J0K A;  1F9J A;  2V3S A;  5CX3 A;  4HDO A;  1QZE A;  4BBN C;  3RT3 B;  4F8C B;  2OOB B;  5DPW A;  3H9D A;  2RR9 A;  3ZDM C;  3NOB A;  1WGD A;  1V49 A;  3ECI A;  2FCM A;  3CST A;  3HM3 A;  1P1A A;  4B6W A;  4FHJ A;  3IHP C;  5D2M B;  2PEA A; 
#chains in the Genus database with same CATH topology
 2RDH A;  3RYT A;  3LYY A;  3PHW B;  4K1R B;  2MJE A;  1V5O A;  3NVZ A;  2K0P A;  2I1K A;  2ZCC A;  3S2A A;  2NPT B;  1YJ1 A;  1FFU A;  3RI7 C;  3N20 C;  2INP E;  2BKR B;  2MW5 A;  1QOG A;  2Y5C A;  1GUA B;  4A8X C;  1RM6 C;  1TKG A;  2L7R A;  3RNA C;  4AUQ C;  2CHX A;  3NG0 A;  1F2R C;  2EMS A;  3TMP B;  3QAR A;  4C56 C;  5FR3 A;  2V3P A;  4YXD B;  1GJZ A;  1VDV A;  1A5R A;  2MLB A;  2ZNV C;  2J0J A;  2ZVN A;  3DBH I;  2QDF A;  2QC8 A;  4RNA A;  5GXG B;  4IC7 B;  4Q2J A;  4RM9 A;  1JWS D;  2AL3 A;  4BOZ B;  1EM7 A;  3HM6 X;  4GIV A;  1A70 A;  1BML C;  3V3X A;  1ACC A;  1T6B X;  2LRW A;  2LMC A;  1WF9 A;  1SB3 C;  1ROE A;  1XLO A;  3N3K B;  2QHO A;  1WFY A;  4TUU A;  2ZPY A;  2IGH A;  1WGK A;  2M56 B;  2J52 A;  1OQR A;  4C4V A;  2SAK A;  1FM0 D;  1JRO A;  1NI2 A;  3EA6 A;  3KWL A;  4LCD E;  1E6E B;  4YTM B;  1F77 A;  2D3A A;  2OHF A;  3N9Y C;  1HZ6 A;  2Y5P A;  4TQ0 A;  2L3Z A;  4PYZ A;  2O6V D;  2N9X A;  2G4S A;  3AE5 B;  3VTW A;  2K8C A;  4BAX A;  2KHW B;  1ZW7 A;  3NHE B;  1QLB B;  3N30 A;  2LGY A;  4O1N A;  2Z8L A;  4P1C C;  5AUK A;  4IWO A;  3I63 C;  3RUL A;  4WWP A;  4K7U A;  2WDT B;  4K81 A;  4LK0 M;  4TKN A;  2WHI A;  5HKH A;  3ZYY X;  1E8X A;  3W1S C;  2RSU A;  4PS8 A;  3TL5 A;  2GBK A;  3AH7 A;  4JWS C;  2ASQ A;  3H6N A;  4NPN A;  1YNT E;  1HZ5 A;  2NPT A;  1J7A A;  2LVP A;  3KW5 B;  2MQJ A;  3C8Y A;  1YQB A;  4YTN B;  3WAN A;  4HKQ A;  4WJQ A;  1QOB A;  3RZW C;  4DQO C;  2ZZP B;  3AUL A;  3AEE B;  2D2Q A;  1X1M A;  4LNI A;  4MGI E;  2KTF A;  1OEY A;  3N32 A;  5DCN A;  2GBJ A;  2KQ4 X;  3UIO B;  3GP7 A;  3GS2 A;  4KGT A;  1SE3 A;  3Q6B A;  2MH7 A;  1XT9 B;  3MHS D;  3B08 A;  2PIA A;  4FXC A;  1VR9 A;  2BYF A;  4C80 A;  2PTL A;  3KQ4 A;  1UGJ A;  4TMA B;  5BMG A;  2EKI A;  4RM8 A;  2JY6 A;  4W9E A;  1YX6 B;  2WDV B;  4KIK A;  1V81 A;  3QA8 A;  1ZOY B;  1PUT A;  2WX1 A;  3CIR B;  1R7S A;  3M95 A;  1NYR A;  4FUL A;  3TSS A;  1EU4 A;  3W9C B;  4DBG A;  2D10 A;  2IO3 B;  2G1E A;  4W9I A;  1PGA A;  2KDE B;  4H2A A;  4XDC A;  1V8C A;  4NZL B;  1T3Q A;  4E71 A;  4ARI A;  2KO3 A;  2NTT A;  4R3D A;  2DLB A;  1L4D B;  2BB5 A;  2D11 A;  4GN1 A;  1YD8 U;  1V1P B;  2QEJ C;  4USA A;  3SFD B;  3SR6 A;  2MEK A;  2WXN A;  3PT2 B;  3BIN A;  1OTR B;  2WLB A;  5GMV A;  2DYM A;  1WGG A;  4A9A A;  3GZN B;  3N1Y C;  2KFK A;  3V60 A;  1PGX A;  3PRM B;  4FHK A;  1L7Y A;  1MJD A;  2K39 A;  1WJ4 A;  1EU3 A;  2JX5 A;  3LDZ E;  3PGE A;  1IPG A;  4GMV A;  2W55 A;  4I6P A;  2KDB A;  2KX0 A;  4ANW A;  1E8Y A;  3U7Z A;  1IP9 A;  3U7D A;  2JRH A;  3Q8F A;  1N60 A;  4MEL A;  4LNK A;  4AJW A;  1WIA A;  3RPF C;  3ZTC A;  4W9H A;  3E9S A;  4HPP A;  1E8W A;  4NJ7 A;  3WAP A;  3GOE A;  1FD6 A;  1K53 A;  1QOF A;  1TS4 A;  1XLP A;  4AWJ A;  1P98 A;  4DWF A;  4F7Z A;  2KMA A;  1KF6 B;  4M8M A;  4TQ1 A;  5IP4 D;  4RCO A;  3IT6 B;  3T8M A;  1ZXI A;  3P4S B;  3IAS 1;  4KDI C;  5AZF A;  3MHZ A;  1N6Z A;  5BMH A;  2RPV A;  4K3C A;  4MJS B;  4HCN B;  1L5P A;  3TIX A;  2XBB C;  3U4E G;  2FUH B;  2IDY A;  2LUE A;  3URY A;  4RGT A;  3AEG B;  1HXY D;  1GOZ A;  1YIW A;  3TEX A;  2W9N A;  3AM9 A;  3R7Q A;  3L10 B;  1YN5 A;  2SEB D;  3R8B A;  1SJH D;  2JSV X;  3AE6 B;  4KZ0 A;  3ETR A;  1RWS A;  3QCA A;  1WX8 A;  2R61 A;  4AP4 C;  2WWZ A;  3VRA B;  2AL6 A;  3L13 A;  4W9C A;  2PMV A;  3FIL A;  2FE8 A;  4GSW A;  4L1B A;  1XO3 A;  4ANV A;  1FPY A;  3IG3 A;  4CO7 A;  4IUM B;  4GDL B;  2N9E B;  3BZD B;  1TKE A;  2FBW B;  2B76 B;  3SU8 X;  3TJP A;  3ZVV A;  2LXA A;  4ZYS A;  4CQN A;  3K9O B;  1SJE D;  1WGH A;  2EKE C;  2J4X A;  5D6J B;  1UEL A;  2BWE S;  2KOX A;  2PPH A;  4IG7 B;  1V1P A;  2MBH A;  4DHJ D;  2JZZ A;  3VFK A;  4DDG D;  1YJJ A;  1ESF A;  1YQ4 B;  4DK5 A;  3A1Q B;  4IM2 A;  2KDM A;  3TUO A;  1CJE A;  1TS2 A;  4BBN C;  2RR9 A;  1JML A;  1V49 A;  5EE1 A;  3NZ3 A;  4FHJ A;  1ZDV A;  2AQ2 B;  4K7S A;  4W9L A;  1YMH E;  4W9D A;  3Q3J A;  4LJO B;  3ZIM A;  3KYD D;  2BVC A;  2NMQ A;  2N4F A;  1GC6 A;  2CKH B;  2WU2 B;  2NVU I;  4WQM A;  1PDX A;  5J18 A;  1LM8 B;  2R2O A;  1VZ7 A;  4OVZ A;  5AUI A;  4WQO B;  2GB1 A;  2DZK A;  4P7I A;  2K25 A;  5IO9 A;  1LGR A;  4EZK A;  2WXK A;  1FXA A;  5CHF A;  4J3O D;  2KTR A;  4LNO A;  2BF8 B;  2L76 A;  3AI5 A;  2KWV B;  5D3I B;  3PRP B;  2JU6 X;  3ZNG C;  3FKY A;  1QOA A;  3L08 A;  4GDK A;  1K52 A;  3GZN I;  4XE0 A;  4FJY A;  1C3T A;  3L54 A;  4MH0 E;  4DXA B;  4S17 A;  3AE1 B;  2H89 B;  1MFW A;  5IOI A;  4HPL B;  3B0A A;  2W3R A;  3ALB A;  3H7P B;  2V9H A;  4A3P A;  2ZJD A;  2D3B A;  3BK1 A;  3VH4 B;  4HDQ A;  2PJH A;  5CHV C;  1NEK B;  3GE8 C;  3GB1 A;  2YVC A;  4TSS A;  2LVQ A;  3V6E B;  2KN5 A;  4BZA A;  1KH0 A;  4ZRJ A;  2A5U A;  4W9F A;  4LNN A;  5J17 A;  5JHA A;  1FXT B;  4HLE A;  3A4R A;  3BWU D;  2I2Y A;  1B9R A;  3OJ4 B;  1VJK A;  4KV2 A;  3W1Y A;  2FID A;  2BS3 B;  3CWI A;  4WWM A;  4NQK E;  2WXQ A;  3KUC B;  4ACF A;  1WZ0 A;  3DBR B;  1MVK A;  2K9X A;  1R4M I;  2I1J A;  2BWF A;  2WXH A;  3MTN B;  3AXC A;  1HEZ E;  2KDI A;  2IZV B;  3RFZ B;  1KLG D;  1FNV A;  2MP2 A;  3KWV A;  2ZNV B;  1N63 A;  3PLU A;  1IGC A;  2XEW A;  3TEW A;  2LHD A;  1WJN A;  5CHW A;  4MJS A;  1WRI A;  4B9K A;  3VUX A;  2HE7 A;  4AS1 A;  4GU2 A;  1M4V A;  4CYE A;  4IDI A;  1WXV A;  3PRZ A;  3VXW A;  3PTF C;  2LWP A;  2DZI A;  2KXJ A;  1D6E C;  4URK A;  5BO4 B;  2Z0D B;  2LJ5 A;  2IO0 B;  4F1S A;  5AZH A;  2YEP F;  3WAO A;  2DZM A;  3PZ8 A;  1I4Q A;  3RMK C;  2VH2 A;  1BUI C;  2WXP A;  1TGZ B;  4IM0 A;  3ML9 A;  1TZO A;  3I5J C;  1KRH A;  2Z59 B;  3RN9 C;  3VR8 B;  2KD0 A;  1E8Z A;  1WXQ A;  4GOC A;  1FRR A;  2NBU A;  3VR9 B;  4WJP A;  4JL9 A;  1WH3 A;  3FIL B;  3B2F A;  2M0X A;  2CU1 A;  3VVW B;  5JXV A;  1CMX B;  4OZA A;  3EGR A;  2N9L A;  1ZGU B;  1XLN A;  2DAF A;  1MHH E;  1NI3 A;  2M0A A;  1IBX B;  1E90 A;  3DBL B;  2JRI B;  2JWZ A;  3AEC B;  1P9D U;  3VDZ A;  4ANU A;  4NAW A;  1ZXH A;  3AE7 B;  2VZK D;  1ZE3 D;  2D07 B;  3A9J A;  4AOF A;  4DHJ B;  2KJ6 A;  1KJT A;  1MPE A;  1FNU A;  3FC4 A;  4XX5 A;  2WDQ B;  1KLU D;  1XF5 L;  4ZHP A;  1RYJ A;  2LVO A;  4LLG M;  3V61 A;  3R3M A;  1STE A;  5HI1 A;  1MG4 A;  5KHQ A;  4C7Y A;  3BK2 A;  3X23 A;  4HXD A;  2D3C A;  4KZC A;  3EFU A;  2M1M A;  4HCP B;  2QIL A;  5JH5 C;  2LGS A;  3Q3M C;  2REX A;  1V5T A;  3DVG X;  4MGY E;  1V86 A;  2KNB A;  2WXM A;  3APC A;  2NTS A;  1DOX A;  5TR5 A;  1CK1 A;  4EFO A;  1WXA A;  2IBI B;  2L00 B;  4MSQ B;  4HJG E;  4BKS D;  1NDD A;  4D2K A;  1I4X A;  2JWU A;  1VZ8 A;  2WXR A;  3P4P B;  2JYE A;  2N1V A;  3DQV A;  1E0Z A;  1V2Y A;  3SHQ A;  4RGO S;  4XC2 A;  2MJD A;  2X8X X;  4B0E A;  3WA0 A;  2JZP A;  1I4G A;  5DPT A;  1GNU A;  4P16 A;  2D3G A;  4KSK C;  5E6O A;  3BYT B;  1JRU A;  3QWZ B;  1KFY B;  1RRB A;  4KVG B;  3JYU A;  1NVI D;  1JAL A;  1SIJ A;  2WP9 B;  3NRZ A;  3EEC A;  2DHZ A;  3NVY A;  3U30 A;  4G11 A;  4DHZ E;  2AQ1 B;  4KIK B;  1JWM D;  4N9F 4;  2O6V A;  1ET9 A;  1PYW D;  4ASW C;  5BYS A;  2WS3 B;  5IA7 A;  1G6J A;  3L17 A;  1IBX A;  5FK9 C;  1TTN A;  4JQW C;  2JPH A;  2KX3 A;  3GE3 C;  3L16 A;  2Q5W D;  2KKC A;  4A6Q A;  2WNM A;  3MP9 A;  1OFF A;  5G5G A;  1MG8 A;  4KKJ A;  3K9P B;  1PQS A;  2WU5 B;  4MEM A;  3AB5 A;  1UGM A;  4XDD A;  5JZE B;  2LZ6 A;  5BMI A;  1YN4 A;  1TS5 A;  3Q14 C;  5LLI A;  3NZS A;  2G45 B;  3KVF B;  3EFC A;  3PLV A;  2LUM A;  3DDC B;  1WMH A;  2BS2 B;  1GB4 A;  2N1W A;  4EZJ A;  2K6D B;  4US9 A;  4ZHO A;  1SF0 A;  3CMM B;  3Q8B A;  1UZX B;  2GMI C;  2LFI A;  1N62 A;  2AWT A;  4WAF A;  1L0V B;  1K8R B;  2FNJ B;  4IW0 A;  1UUP A;  3QC8 B;  4W9J A;  4B95 A;  4JLC A;  3KUD B;  4NQL B;  1ENF A;  5E6N A;  4US8 A;  2QCZ A;  2MA9 B;  2K6Q A;  2J53 A;  3PO0 A;  1SE2 A;  3R2I A;  4G0N B;  2NCN A;  4K7W A;  4NAM A;  4IM3 A;  3MJ5 A;  1P7F A;  2K8H A;  2DBY A;  1OGW A;  1WRD B;  4PS3 A;  1JW9 D;  1V9J A;  4XWT A;  1FCL A;  3KLS X;  1D4B A;  2LI5 A;  1VD2 A;  2R2Q A;  1AN8 A;  2AX5 A;  2MBE A;  2L0F A;  3PZ7 A;  4S0R A;  4HDO A;  1QZE A;  4JPS A;  4F8C B;  2OOB B;  3H9D A;  4M01 A;  3ZDM C;  3ZXR A;  1K51 A;  3B2G A;  1ZP0 B;  3ECI A;  1GPX A;  2D5G A;  1C77 A;  3IHP C;  2PEA A;  1D5Z C;  3VTU A;  1XCT L;  1I35 A;  2WGS A;  3W2D A;  2C7H A;  3AU4 A;  1ZUD 2;  2W3S A;  1KM7 A;  4C4V B;  5E6P A;  2L05 A;  3CF6 E;  4WJN A;  3P42 A;  1P3Q U;  2ZVO A;  1V1O A;  4OHJ A;  1QIL A;  1JWB D;  1EUV B;  2IGD A;  2WX0 A;  3QJZ A;  1UNS A;  1VLB A;  4IWQ A;  3DWG C;  2IPK D;  5EE3 A;  2ZEQ A;  1L2N A;  1MI0 A;  2LXC A;  3UQB A;  1VZ6 A;  2KC1 A;  2X38 A;  5EE9 A;  3I3T B;  3VUY A;  5TSS A;  2OJR A;  3FAH A;  4FN2 A;  2KAC A;  4II2 B;  1TS3 A;  2LAS A;  2BBC A;  4JX1 C;  1C4C A;  3OWE B;  3QHT A;  2G3Q B;  4FA6 A;  3APF A;  4ZRK A;  4BOS C;  3EHV A;  1LFD A;  1XXG A;  4MM3 A;  2KVR A;  2WXF A;  2ZCB A;  2BB6 A;  3BYY B;  3O65 B;  4XWW A;  3QQ8 B;  4HEA 1;  1MHX A;  3QAQ A;  4EUT A;  4ZDV A;  2HJ1 A;  5D94 A;  2UU7 A;  1J19 A;  3NUH B;  3NVW A;  3H1U A;  3P4R B;  5H8Y E;  2LGI A;  2KFK B;  3IXS A;  3UF8 A;  1C78 A;  3DVN U;  5C3J B;  2W54 A;  4I6N B;  2KK8 A;  4HJK A;  4A55 A;  3KH0 A;  2INC C;  3EUB 2;  3C0R B;  3EC8 A;  2KC2 A;  2G4D B;  5G2N A;  2KWC A;  5EDS A;  1WM2 A;  4N6E B;  1I4R A;  2BYE A;  1OEY J;  2DEN B;  2KWU B;  2V3N A;  3ZXV A;  2KWD A;  3Q3N C;  3AED B;  4BKG A;  3ML8 A;  4UDU C;  1Z5S B;  2BS4 B;  4L2Y A;  4W9K A;  4KSL C;  3HIZ A;  4FJV B;  3O13 A;  3P4Q B;  1L0X B;  2KTR B;  3B9J A;  3L4P A;  3JW0 X;  1AAR A;  2L32 A;  1WR6 E;  4NJC A;  4GGQ A;  1D5M C;  2RDG A;  3DBR I;  4DHZ B;  1WZ3 A;  3B1L X;  4HK2 A;  4FBJ B;  4N58 A;  5G5H A;  3AEB B;  4PT5 A;  3A4S C;  3PRE A;  1WGY A;  5LXI B;  1SIF A;  3J9C A;  1M94 A;  2CJN A;  2CR5 A;  2JT4 B;  4ZOH C;  1WXM A;  1GAQ B;  2PVG C;  4GLS C;  3D32 A;  1N5W A;  4MGZ E;  1TBE A;  4JIO U;  2LGD A;  1T5X D;  1UH6 A;  4L23 A;  4RFB A;  5HHD G;  1J7C A;  2BQQ A;  4LDT B;  3LJ3 A;  2BTE A;  1CZP A;  4DXF A;  2JZ3 B;  3W5V B;  3T3O A;  2O2V B;  5C23 A;  2DWQ A;  3U2S C;  5HFY A;  2Z0E B;  1RFK A;  4G3X B;  2BT6 A;  2C7M B;  3IFW B;  5KHO A;  3DHI C;  2G9H D;  1L6V A;  3U8Z A;  4WWO A;  2AQ3 B;  2ON8 A;  3QIJ A;  4EKU A;  1AYF A;  5EE0 A;  4OZC A;  4I6L B;  4LJP B;  1TYG B;  3M63 B;  3R66 C;  2LHE A;  4IKG A;  1UWM A;  4GDK B;  2EMT A;  2BKF A;  3DVG Y;  2N9K A;  4RGN A;  4ICV A;  2V4L A;  4BKS A;  3LXF A;  3VUW A;  1DYQ A;  2IND C;  2L8J A;  4E74 A;  2KN4 A;  1WI0 A;  2FCN A;  3ZUN A;  1T0Q C;  3P63 A;  4DXG A;  3Q3F A;  3PHX B;  2GI9 A;  2JXT A;  2ICI A;  1H4R A;  3W1S A;  3RD2 A;  2INN E;  2L52 A;  2KMC A;  1DGJ A;  5G55 A;  1XCQ L;  1EF5 A;  2AYO B;  2K3U A;  3AU5 A;  1QKZ A;  4K3B A;  2MBQ A;  4KKI A;  2E6X A;  4HVB A;  3N1Z C;  1GG3 A;  3SDL C;  2WYQ A;  2VRR B;  4KDL B;  1EWC A;  3ZNZ B;  5L95 C;  3MC0 B;  3AV8 A;  1WX7 A;  3U52 E;  2LEK A;  1BT0 A;  4KGS A;  2KLG A;  1F0Z A;  1L4Z B;  3DBL I;  1TY2 A;  1YJI A;  4X57 B;  1QT9 A;  1SSN A;  2OED A;  1E7U A;  1JRP A;  4WWN A;  3Q69 A;  3M3J A;  1S1Q B;  2IGG A;  3KUZ A;  5HG2 A;  2MHJ A;  2ZW0 A;  5CTR C;  4LNF A;  4WUR A;  2ONQ A;  2KAJ A;  3MFG A;  4RMA A;  2A4Z A;  3NS8 A;  1N61 A;  3VAW A;  2JQR B;  3WIM A;  1RFA A;  1AW7 A;  2KT7 A;  3L0W B;  5JHB A;  1SGH A;  3ZJV A;  2M17 A;  1TIF A;  2RDB C;  4N59 A;  2K8B A;  5MPO A;  1HTQ A;  4B0M A;  3TBL D;  5AEK B;  4NY0 A;  2N7J A;  3OG5 A;  1RAX A;  3PPA A;  4MDK E;  2XN9 C;  3JVZ X;  2PW9 A;  2CS4 A;  2KAN A;  4FAD A;  1Y8R C;  4ZRI A;  4HKZ E;  4AJY B;  2ZW1 A;  3RNB C;  3UQA A;  2GBR A;  3IVF A;  4DDI D;  2HDE A;  1NYQ A;  4TV3 A;  3V05 A;  4PK1 A;  2MBO A;  3HK0 A;  1SBB B;  4EEW A;  2FCS A;  1J0G A;  2XK5 B;  1ZPS A;  4HRO A;  1E5W A;  4PS7 A;  3DHG C;  2LRU A;  3TEY A;  2CHW A;  2NR2 A;  5IKC M;  2JYT A;  1FCC C;  3H7S A;  5T8I A;  1PGB A;  2MX2 A;  4MSM B;  4LTU A;  2DYB A;  3DPD A;  1IGD A;  3T9L A;  1EO6 A;  1Z2M A;  4LDT D;  3A9K B;  3RCZ A;  1GC7 A;  1QF6 A;  1J7B A;  1SE4 A;  1QQR A;  1BXT A;  1HE8 A;  1C4P A;  1Q10 A;  3NVV A;  5J2R A;  1WMH B;  1YX5 B;  1R4N I;  3PS6 A;  2WQY B;  3QX1 A;  1VCB A;  2WDR B;  3BY4 B;  2BW2 A;  4HPM B;  1HQR D;  3HHM A;  3ZKJ C;  2O6V B;  2J0K A;  2V3S A;  5CX3 A;  3Q8C A;  3NOB A;  4AQ7 A;  4B6W A;  1HA5 A;  3P1M A;  1WSP A;  3SFE B;  4II3 B;  1C1Y B;  5E6J A;  1UF0 A;  4EE2 A;  2WXI A;  1WGR A;  2ZPN A;  1XEE A;  2C5L C;  3ZNH B;  1WM3 A;  2C60 A;  3TEZ A;  2KZR A;  4RGM A;  1S3S G;  3BVG A;  1P0R A;  3RNF C;  4ZRQ A;  4A20 A;  4A90 A;  2VH1 A;  4ANX A;  5C2T B;  1EWY C;  3LB8 C;  1C4A A;  3T3N A;  2V0G A;  2PE9 A;  3OJ3 A;  4M00 A;  1R4M B;  1C9F A;  3E56 A;  3H7P A;  2PVO D;  4XGA B;  5FKA C;  3C19 A;  2KMM A;  3APD A;  2Y5B B;  2UYZ B;  1FFV A;  4P6V F;  3IBE A;  3JSV A;  5DPS A;  2N7D A;  3W5U B;  3Q8E A;  2BPS A;  1F1H A;  1Q1O A;  1LO5 D;  3R7R A;  2DYO A;  3A33 B;  4YL8 A;  3ZRF A;  4OZB A;  2PLP A;  2MRP A;  1DOI A;  2GBN A;  2V1Y A;  4MM3 B;  2YLM A;  3DHH C;  4P1B C;  1D5X C;  4GXB A;  1KLV A;  2CU3 A;  4YSX B;  4BBN F;  2HTH A;  2NBW B;  3R2T A;  1XD3 B;  3A9K A;  2IY0 B;  2WXL A;  4YSZ B;  2PKO A;  3CSF A;  2HJ8 A;  3SD5 A;  1FXI A;  2FIF A;  2GOW A;  1WYW B;  1XQQ A;  5L83 A;  2V4I B;  4IWP A;  3HVZ A;  2K1F A;  3ZJT A;  4BFR A;  2GBM A;  1SEB D;  3VQI A;  4XZ4 A;  1T0Y A;  2VZK B;  1FEH A;  1N5X A;  1KTK A;  2IJ0 A;  3NJT A;  2K5P A;  1UD7 A;  3DBS A;  3VH3 B;  2RGF A;  4C7Z A;  2TSS A;  1WXS A;  1EF1 A;  4M8N A;  1SXT A;  1TKY A;  2C7N B;  3RNG C;  2RD0 A;  4ZYN A;  2WXJ A;  2MWS B;  3Q8A A;  2M4N A;  3SEB A;  2QJL A;  4ZRP A;  2BYV E;  3A1Q A;  2MJ3 A;  2QSD A;  1L6U A;  4QAY A;  1WR1 A;  2H88 B;  4WAA A;  3WAL A;  4BVU C;  2M19 A;  4NNJ B;  2KFJ A;  2JVC A;  1Q5W B;  3UI3 A;  1H8C A;  2IY1 B;  3TCA A;  2MSE D;  2LD9 A;  1I4H A;  2IO1 B;  3DCG A;  4YWG G;  1R4N B;  2YEP B;  2QIE B;  1D3Z A;  1CQV A;  1YOV B;  1JWU D;  3KYC D;  3ZQ4 A;  3ZJU A;  2L1A A;  4J6I A;  4W9G A;  1PFD A;  4ITK A;  4JE3 B;  4FJZ A;  4OVU A;  3VRB B;  2KJH B;  2GRI A;  2AEH A;  3OAW A;  2DAJ A;  1WX9 A;  2M8S A;  3ONS A;  1WY8 A;  1C76 A;  1U4A A;  3MC9 A;  3NZU A;  3V6C B;  1E10 A;  3P2B A;  5BYR A;  4GB9 A;  2NS5 A;  2PE6 B;  2FAZ A;  3VHT C;  4NJ6 A;  2CJO A;  3RNE C;  3BII D;  5BYQ A;  4HWI B;  1WJU A;  4YT0 B;  2MCN B;  2L0T A;  1FMA D;  1V80 A;  1WE7 A;  1FRD A;  1NBF C;  5LXH A;  1FIQ A;  4YSY B;  1UBI A;  2MP2 B;  5IAA C;  1YN3 A;  4BKT A;  2XK5 A;  1RLF A;  4M0W B;  4CHK A;  5D7G A;  3ZNI D;  2I38 A;  1JWA D;  2KDF B;  4YTP B;  3AE8 B;  1I7H A;  2RMM A;  4RF0 A;  4C00 A;  1XLQ A;  4REZ A;  3UIN B;  4G50 A;  3PZD A;  3UGB B;  2KQ7 A;  1TT5 B;  2KQS A;  2W82 A;  1JCK B;  2IYD B;  1KOT A;  1ISN A;  3ENE A;  1Y56 A;  1IYF A;  1OQQ A;  3DOW A;  2JF5 A;  2MBB B;  2DX5 B;  4A3O A;  2ACZ B;  3BVZ A;  1V6E A;  3NS1 A;  2KJR A;  4M02 A;  4WJO A;  1F2R I;  1WYG A;  2UWQ A;  4JGH B;  3WAM A;  1T0S C;  3OLM D;  1UWX A;  4KX6 B;  3H8H A;  2E3T A;  2K22 A;  3QK0 A;  3ZW3 A;  2LGX A;  2J0M A;  1B1Z A;  4MAC A;  3X0W A;  3HVD A;  3IAM 1;  2RPQ A;  5H92 C;  1J8C A;  2BGF A;  4HRS A;  3ZDT A;  1P7E A;  4GDL A;  2Y3A A;  3N1X C;  1JQ4 A;  1IUE A;  3RUI B;  2JUO A;  3M62 B;  1SE9 A;  3DBH B;  4JWU C;  3MJW A;  1E7V A;  4EZL A;  3AE9 B;  3ZO5 B;  4EOY A;  3PVL A;  1C79 A;  2KVZ A;  1FNW A;  1TZ1 A;  2QMT A;  2KYW A;  4IOI E;  1DOY A;  2DZJ A;  3RNC C;  1I4P A;  1OQY A;  1L0Y B;  3I57 A;  4M0W A;  4OW0 A;  2DNF A;  1VRA B;  3BVM A;  1E7P B;  3RZF A;  1I42 A;  3WCQ A;  5IN7 A;  3NY5 A;  3AEF B;  3V62 A;  2J7Q B;  1Q0W B;  2B3A A;  2LJI A;  3PV1 A;  1WE6 A;  5I4D A;  4XYC A;  3I9V 1;  2OJW A;  2EEL A;  1WWT A;  1AWD A;  4RF1 A;  1ZDX A;  3AEA B;  2N9P C;  1UBQ A;  2O2V A;  3A9J B;  1NEN B;  2FUG 1;  2CHZ A;  3ZLZ A;  3ZGZ A;  2N0S B;  3ABV B;  4MT5 A;  1V97 A;  4NAW B;  1YQ3 B;  4FLH A;  3ZRC A;  3DVN V;  5C1Z A;  3IT4 B;  2FCQ A;  4ARC A;  2GLS A;  4MGK E;  1WJ6 A;  1K50 A;  2JXX A;  2N7E A;  1ZKH A;  4ICU A;  4PYU A;  5FR6 A;  3Q3O C;  1HTO A;  5AZG A;  1ET6 A;  5LNK 1;  4OVV A;  2J42 A;  3DWM A;  5D3D A;  1TJE A;  4KGR A;  3UIP B;  3PSE B;  1E9M A;  2BYT A;  2L83 A;  1LQB A;  2WXG A;  4WIP A;  1T0R C;  3ZTD A;  1FO4 A;  2HD5 B;  3HUI A;  2C9W B;  3AE2 B;  4MH8 A;  2IO2 B;  3AMZ A;  1F52 A;  2XNA C;  4RH6 A;  2HTM E;  3MC8 A;  3VTV A;  2KLC A;  5DPR A;  4E3C A;  2WXO A;  1LXD A;  2NBV B;  1TY0 A;  3JSV B;  1F9J A;  3AE4 B;  1GB1 A;  3RT3 B;  3AE3 B;  3HRD D;  3AN1 A;  4WH4 A;  5DPW A;  1WGD A;  2FCM A;  3CST A;  3HM3 A;  1P1A A;  5D2M B;  3Q2A C; 
#chains in the Genus database with same CATH homology
 4K7S A;  4W9L A;  3RYT A;  4W9D A;  3Q3J A;  3VTU A;  4LJO B;  3ZIM A;  3KYD D;  1I35 A;  3PHW B;  4K1R B;  2C7H A;  3AU4 A;  2N4F A;  1GC6 A;  1C1Y B;  1V5O A;  2CKH B;  4II3 B;  2NVU I;  1WGR A;  2ZPN A;  1KM7 A;  2C5L C;  3ZNH B;  5E6P A;  2L05 A;  5J18 A;  1WM3 A;  2C60 A;  1LM8 B;  3CF6 E;  2R2O A;  4WJN A;  2I1K A;  2KZR A;  2ZCC A;  1P3Q U;  3S2A A;  1S3S G;  2NPT B;  2ZVO A;  4WQO B;  4P7I A;  2DZK A;  2K25 A;  1YJ1 A;  1P0R A;  4EZK A;  4A20 A;  5CHF A;  1EUV B;  2WX0 A;  3QJZ A;  2BKR B;  4IWQ A;  2KTR A;  2MW5 A;  4ANX A;  2BF8 B;  1GUA B;  2L76 A;  3AI5 A;  2ZEQ A;  1L2N A;  2KWV B;  2LXC A;  2PE9 A;  3OJ3 A;  3UQB A;  3PRP B;  3ZNG C;  2KC1 A;  2L7R A;  3H7P A;  4AUQ C;  3I3T B;  3L08 A;  3VUY A;  2CHX A;  4GDK A;  2OJR A;  3APD A;  2EMS A;  2Y5B B;  3TMP B;  2UYZ B;  3QAR A;  4FN2 A;  3GZN I;  4II2 B;  3IBE A;  2LAS A;  3JSV A;  5DPS A;  2N7D A;  3QHT A;  2G3Q B;  4FJY A;  1C3T A;  2BPS A;  3L54 A;  4FA6 A;  4MH0 E;  1GJZ A;  4DXA B;  3APF A;  1Q1O A;  3R7R A;  2DYO A;  3A33 B;  4ZRK A;  4BOS C;  4YL8 A;  3ZRF A;  1A5R A;  2MLB A;  2ZNV C;  2J0J A;  2ZVN A;  3EHV A;  3DBH I;  4HPL B;  1LFD A;  3B0A A;  2MRP A;  4MM3 A;  2KVR A;  4IC7 B;  4RM9 A;  3ALB A;  2AL3 A;  2GBN A;  2V1Y A;  2ZCB A;  3HM6 X;  2YLM A;  4GIV A;  4BOZ B;  3O65 B;  3H7P B;  4GXB A;  4A3P A;  1KLV A;  2ZJD A;  2LRW A;  3VH4 B;  3QQ8 B;  4HDQ A;  2PJH A;  3QAQ A;  4EUT A;  4ZDV A;  5CHV C;  1WF9 A;  2YVC A;  4BBN F;  2LVQ A;  3V6E B;  5D94 A;  3N3K B;  2HTH A;  2NBW B;  2KN5 A;  1XD3 B;  3A9K A;  1J19 A;  2IY0 B;  2QHO A;  3H1U A;  1WFY A;  4TUU A;  2ZPY A;  4ZRJ A;  2A5U A;  3CSF A;  4W9F A;  2HJ8 A;  3SD5 A;  2FIF A;  5J17 A;  5JHA A;  2GOW A;  1WYW B;  2KFK B;  1XQQ A;  1FXT B;  4HLE A;  3A4R A;  3UF8 A;  5L83 A;  3OJ4 B;  3DVN U;  4IWP A;  1NI2 A;  4I6N B;  2KK8 A;  2K1F A;  4HJK A;  4KV2 A;  4BFR A;  3W1Y A;  2FID A;  2GBM A;  3KH0 A;  4XZ4 A;  3VQI A;  4NQK E;  4LCD E;  4TQ0 A;  3KUC B;  3C0R B;  3EC8 A;  1T0Y A;  1WZ0 A;  2L3Z A;  2O6V D;  4PYZ A;  1R4M I;  2KC2 A;  2G4S A;  2I1J A;  2N9X A;  3VTW A;  2G4D B;  2K8C A;  2BWF A;  3MTN B;  5G2N A;  3AXC A;  1UD7 A;  3DBS A;  2KHW B;  2KWC A;  5EDS A;  1WM2 A;  3VH3 B;  1ZW7 A;  2RGF A;  3NHE B;  2KDI A;  3N30 A;  1WXS A;  1EF1 A;  4M8N A;  2BYE A;  1OEY J;  2C7N B;  2DEN B;  2KWU B;  2IZV B;  2LGY A;  2RD0 A;  4ZYN A;  2MWS B;  2M4N A;  4IWO A;  4BKG A;  3ML8 A;  1Z5S B;  2MP2 A;  2BYV E;  3A1Q A;  4W9K A;  4KSL C;  3RUL A;  2ZNV B;  3HIZ A;  3PLU A;  2XEW A;  4FJV B;  4WWP A;  1WR1 A;  4WAA A;  1WJN A;  4K7U A;  2KTR B;  5CHW A;  4MJS A;  3WAL A;  4BVU C;  2WDT B;  4K81 A;  4NNJ B;  2KFJ A;  3JW0 X;  4TKN A;  2JVC A;  1Q5W B;  4B9K A;  1AAR A;  5HKH A;  1H8C A;  3VUX A;  1E8X A;  2HE7 A;  1WR6 E;  3W1S C;  4GGQ A;  2IY1 B;  3TCA A;  4GU2 A;  2MSE D;  2RSU A;  3DBR I;  2LD9 A;  4PS8 A;  3TL5 A;  2IO1 B;  4DHZ B;  4CYE A;  3DCG A;  1WXV A;  1WZ3 A;  3PRZ A;  3B1L X;  1D3Z A;  2GBK A;  4HK2 A;  4FBJ B;  2ASQ A;  3H6N A;  3KYC D;  3VXW A;  4NPN A;  3PTF C;  2LWP A;  2NPT A;  3A4S C;  3PRE A;  4J6I A;  1WGY A;  2DZI A;  2KXJ A;  4W9G A;  4URK A;  1SIF A;  5LXI B;  4FJZ A;  2Z0D B;  2LJ5 A;  4OVU A;  2LVP A;  1M94 A;  5BO4 B;  2IO0 B;  4F1S A;  2CR5 A;  3KW5 B;  2JT4 B;  5AZH A;  2MQJ A;  1WXM A;  1YQB A;  2DZM A;  2KJH B;  3WAO A;  3WAN A;  3D32 A;  2AEH A;  3OAW A;  4MGZ E;  4WJQ A;  2DAJ A;  1TBE A;  1TGZ B;  1WX9 A;  2M8S A;  3ONS A;  4JIO U;  3RZW C;  2LGD A;  4IM0 A;  1UH6 A;  1WY8 A;  3ML9 A;  1U4A A;  2ZZP B;  4LDT B;  3LJ3 A;  2Z59 B;  3NZU A;  2KD0 A;  3V6C B;  3AUL A;  1E8Z A;  3P2B A;  2D2Q A;  4GOC A;  1X1M A;  2NBU A;  4WJP A;  4MGI E;  4GB9 A;  2JZ3 B;  2KTF A;  4JL9 A;  2NS5 A;  2PE6 B;  2FAZ A;  3VHT C;  1WH3 A;  4NJ6 A;  1OEY A;  3N32 A;  2M0X A;  2O2V B;  2CU1 A;  5C23 A;  5DCN A;  2Z0E B;  3VVW B;  4G3X B;  2GBJ A;  4HWI B;  3UIO B;  1CMX B;  1WJU A;  2C7M B;  3IFW B;  5KHO A;  2MCN B;  2L0T A;  1NBF C;  1V80 A;  1WE7 A;  4WWO A;  3U8Z A;  1ZGU B;  2DAF A;  5LXH A;  1XT9 B;  3MHS D;  3B08 A;  1UBI A;  2MP2 B;  5IAA C;  1E90 A;  3QIJ A;  2BYF A;  4EKU A;  2JRI B;  2JWZ A;  3VDZ A;  1P9D U;  4BKT A;  4ANU A;  4I6L B;  2XK5 A;  1RLF A;  4LJP B;  4M0W B;  4CHK A;  4NAW A;  5D7G A;  3ZNI D;  3M63 B;  2KDF B;  3R66 C;  4RM8 A;  2JY6 A;  1YX6 B;  4KIK A;  4GDK B;  2EMT A;  2BKF A;  4W9E A;  1V81 A;  2D07 B;  3A9J A;  3DVG Y;  3QA8 A;  4AOF A;  4DHJ B;  2KJ6 A;  1KJT A;  3UIN B;  2WX1 A;  4XX5 A;  4G50 A;  3PZD A;  2V4L A;  4ICV A;  3UGB B;  4BKS A;  3M95 A;  3VUW A;  2KQ7 A;  2KQS A;  2LVO A;  4FUL A;  2L8J A;  3V61 A;  2IYD B;  3R3M A;  4E74 A;  5KHQ A;  1KOT A;  1ISN A;  4DBG A;  1WI0 A;  2D10 A;  3ENE A;  1IYF A;  2IO3 B;  3DOW A;  3X23 A;  2FCN A;  4HXD A;  3ZUN A;  2JF5 A;  2MBB B;  4W9I A;  2DX5 B;  4KZC A;  4A3O A;  3Q3F A;  2KDE B;  3EFU A;  2M1M A;  3PHX B;  4HCP B;  1V6E A;  5JH5 C;  2KJR A;  4WJO A;  2REX A;  1V5T A;  2UWQ A;  4JGH B;  4E71 A;  3DVG X;  4MGY E;  1H4R A;  2KO3 A;  3RD2 A;  3W1S A;  1V86 A;  3WAM A;  3OLM D;  2KMC A;  2KNB A;  2D11 A;  5G55 A;  4GN1 A;  1YD8 U;  3APC A;  3QK0 A;  5TR5 A;  1EF5 A;  2AYO B;  4EFO A;  1WXA A;  3ZW3 A;  2IBI B;  3AU5 A;  2L00 B;  4MSQ B;  2LGX A;  2J0M A;  2MBQ A;  4BKS D;  3PT2 B;  4HVB A;  3X0W A;  1NDD A;  1GG3 A;  3BIN A;  3SDL C;  1OTR B;  2WYQ A;  2VRR B;  4KDL B;  3ZNZ B;  5L95 C;  5GMV A;  1WX7 A;  2RPQ A;  1BT0 A;  2DYM A;  1WGG A;  1J8C A;  2BGF A;  2N1V A;  3DQV A;  2KFK A;  2KLG A;  3V60 A;  3ZDT A;  1V2Y A;  4GDL A;  3DBL I;  3SHQ A;  3PRM B;  4FHK A;  3RUI B;  1L7Y A;  2K39 A;  4X57 B;  4XC2 A;  2JUO A;  3M62 B;  1SE9 A;  1E7U A;  1WJ4 A;  4WWN A;  3M3J A;  1S1Q B;  3LDZ E;  3KUZ A;  3PGE A;  3WA0 A;  5DPT A;  1IPG A;  1GNU A;  5CTR C;  2D3G A;  3MJW A;  4GMV A;  1E7V A;  4I6P A;  4KSK C;  2KDB A;  2KX0 A;  5E6O A;  4EZL A;  4ANW A;  1E8Y A;  1JRU A;  3ZO5 B;  4EOY A;  3PVL A;  4RMA A;  1TZ1 A;  2A4Z A;  3NS8 A;  3QWZ B;  1RRB A;  4KVG B;  1IP9 A;  3VAW A;  3U7D A;  2DZJ A;  3JYU A;  2JRH A;  4MEL A;  3WIM A;  3EEC A;  2DHZ A;  1RFA A;  4AJW A;  3L0W B;  1WIA A;  3ZTC A;  4W9H A;  1OQY A;  3U30 A;  5JHB A;  1E8W A;  4NJ7 A;  1SGH A;  3WAP A;  2M17 A;  4G11 A;  4DHZ E;  3GOE A;  4KIK B;  4N9F 4;  2O6V A;  4AWJ A;  2K8B A;  1P98 A;  3TBL D;  4DWF A;  4ASW C;  2KMA A;  4F7Z A;  3RZF A;  4M8M A;  5AEK B;  4TQ1 A;  5IA7 A;  1G6J A;  3L17 A;  4NY0 A;  4PS3 A;  1I42 A;  1TTN A;  4JQW C;  3NY5 A;  3T8M A;  3V62 A;  2J7Q B;  2JPH A;  1Q0W B;  1RAX A;  2B3A A;  3PPA A;  4MDK E;  4KDI C;  5AZF A;  2KX3 A;  3JVZ X;  2CS4 A;  2KAN A;  1WE6 A;  3PV1 A;  3L16 A;  2KKC A;  1Y8R C;  4FAD A;  4ZRI A;  4AJY B;  4MJS B;  4HCN B;  2N9P C;  3UQA A;  1UBQ A;  2GBR A;  3IVF A;  2O2V A;  1MG8 A;  3TIX A;  2XBB C;  3A9J B;  4DDI D;  2CHZ A;  4TV3 A;  3K9P B;  2FUH B;  2MBO A;  3ZLZ A;  3HK0 A;  1PQS A;  4MEM A;  2LUE A;  1UGM A;  5JZE B;  4NAW B;  4FLH A;  4EEW A;  2LZ6 A;  1YIW A;  3ZRC A;  2FCS A;  3DVN V;  5C1Z A;  2W9N A;  1J0G A;  5LLI A;  3NZS A;  2G45 B;  2XK5 B;  3KVF B;  2FCQ A;  3R7Q A;  3L10 B;  4MGK E;  3PLV A;  1E5W A;  1WJ6 A;  4PS7 A;  3DDC B;  1WMH A;  2JXX A;  2N7E A;  2LRU A;  2N1W A;  4EZJ A;  2K6D B;  1ZKH A;  3CMM B;  4ICU A;  4PYU A;  5FR6 A;  4KZ0 A;  5AZG A;  3QCA A;  1UZX B;  2GMI C;  1WX8 A;  2CHW A;  4AP4 C;  2WWZ A;  2NR2 A;  2AL6 A;  3L13 A;  2AWT A;  3H7S A;  4W9C A;  2MX2 A;  4GSW A;  4MSM B;  4OVV A;  1K8R B;  4ANV A;  4CO7 A;  3IG3 A;  2DYB A;  3UIP B;  3DPD A;  2FNJ B;  3PSE B;  4IW0 A;  3QC8 B;  4W9J A;  3T9L A;  4B95 A;  1EO6 A;  4JLC A;  4IUM B;  1LQB A;  3KUD B;  1Z2M A;  4GDL B;  4LDT D;  2N9E B;  4NQL B;  5E6N A;  3A9K B;  3RCZ A;  3ZTD A;  2MA9 B;  2HD5 B;  1GC7 A;  2K6Q A;  3SU8 X;  3TJP A;  3ZVV A;  2LXA A;  2C9W B;  2IO2 B;  2NCN A;  4G0N B;  4K7W A;  1HE8 A;  3K9O B;  4IM3 A;  2EKE C;  1WGH A;  5D6J B;  1UEL A;  2K8H A;  5J2R A;  1OGW A;  1WMH B;  1WRD B;  1YX5 B;  1R4N I;  3PS6 A;  2BWE S;  2KOX A;  1V9J A;  2PPH A;  1VCB A;  2MBH A;  3QX1 A;  4IG7 B;  3BY4 B;  3VTV A;  4DHJ D;  2JZZ A;  3VFK A;  4HPM B;  2LI5 A;  2KLC A;  1VD2 A;  4DDG D;  3ZKJ C;  3HHM A;  4DK5 A;  2R2Q A;  3A1Q B;  2MBE A;  2O6V B;  4IM2 A;  5DPR A;  4E3C A;  1LXD A;  2NBV B;  2L0F A;  3JSV B;  2J0K A;  1F9J A;  2V3S A;  5CX3 A;  4HDO A;  1QZE A;  4BBN C;  3RT3 B;  4F8C B;  2OOB B;  5DPW A;  3H9D A;  2RR9 A;  3ZDM C;  3NOB A;  1WGD A;  1V49 A;  3ECI A;  2FCM A;  3CST A;  3HM3 A;  1P1A A;  4B6W A;  4FHJ A;  3IHP C;  5D2M B;  2PEA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...