3VXWA

Crystal structure of saccharomyces cerevisiae atg8 complexed with atg32 aim
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
111
structure length
111
Chain Sequence
KSTFKSEYPFEKRKAESERIADRFKNRIPVICEKAEKSDIPEIDKRKYLVPADLTVGQFVYVIRKRIMLPPEKAIFIFVNDTLPPTAALMSAIYQEHKDKDGFLYVTYSGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Autophagy-related protein 8
publication title Autophagy-related protein 32 acts as autophagic degron and directly initiates mitophagy
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 32
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2012-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3vxwA00
2LWPA 3QX1A 3PHXB 5AEKB 4I6PA 2KX0A 3QCAA 4OVVA 1A5RA 1IPGA 5E6NA 3OLMD 4ANXA 4WJQA 3WALA 1T0YA 2KVRA 2IZVB 2AL6A 3A4SC 5CHFA 2KXJA 3SHQA 5CTRC 1WE6A 2WX1A 1U4AA 4B6WA 2KLCA 4KSLC 3DBRI 2CR5A 4W9IA 3VTVA 4LDTD 2MBEA 2MBBB 1Y8RC 4DBGA 5DPRA 2ZCCA 2BYVE 4GN1A 1RAXA 3I3TB 2KN5A 5JZEB 3HIZA 3ZNGC 3WAMA 3APCA 2RPQA 3VH4B 2CKHB 2KTFA 3PLUA 2N7EA 5AZFA 4AUQC 4TV3A 2MP2A 2D10A 4HDQA 1V6EA 2KD0A 3ZTDA 3IG3A 3RUIB 2EMTA 4TKNA 4URKA 1XD3B 3RT3B 3B1LX 5JHBA 1Q5WB 5LXIB 3DVGY 1UELA 1KOTA 3M3JA 1PQSA 2KMCA 1WX7A 3T9LA 4GDLB 2DHZA 3KYCD 4JL9A 5IA7A 3ZTCA 4MGKE 2L8JA 2MBHA 1SGHA 3L0WB 3PRZA 4B95A 5HKHA 3UQAA 1D3ZA 2HJ8A 3DVNV 2KNBA 3DBSA 3QIJA 2BF8B 2CS4A 4W9GA 2NCNA 1WIAA 2KWUB 1GUAB 3HM3A 2IY0B 1P1AA 1YX5B 4NJ7A 4DHZE 2M4NA 3PHWB 3WAPA 2IO0B 3A9KA 3VUWA 3TL5A 3JW0X 1E8XA 3PRMB 3ZVVA 4M8MA 1WE7A 4B9KA 1YIWA 3QARA 4LDTB 3NS8A 1OEYJ 2IYDB 2N4FA 4IUMB 2DZIA 4ZYNA 3L08A 3A1QA 2NBWB 4E74A 1GC7A 1V80A 1VCBA 3V62A 2Z59B 2M17A 3GZNI 4PYZA 4W9JA 1WMHA 2FCNA 4W9FA 3TMPB 3V60A 4EEWA 2FIDA 4HK2A 3ECIA 4FULA 4ZRIA 2D11A 2FCQA 3L10B 5E6OA 4ZDVA 3EHVA 3K9PB 4NAWA 3RZFA 4A3PA 1UZXB 3CMMB 4FA6A 1E7UA 2K8CA 2N1VA 2MCNB 3AU5A 1RLFA 1BT0A 4HJKA 4MGIE 5CHVC 2DZMA 2G45B 1Q0WB 2C7HA 2C7MB 2JWZA 2KJRA 2N9EB 2NVUI 3DBLI 3PRPB 4RM8A 1GNUA 2FIFA 1WXVA 4A20A 4AJWA 1R4NI 1AARA 1HE8A 2IY1B 3D32A 2HTHA 2DYOA 4NQLB 3P2BA 4NY0A 1V5OA 1ZW7A 1WXSA 3VTWA 1WGRA 4FADA 2C7NB 2LVPA 4K7SA 4FN2A 4KVGB 4E3CA 1WGYA 1J19A 2GBNA 3H7SA 2O2VB 4LJOB 3QWZB 3RCZA 4AOFA 4WWNA 3DBHI 2C60A 2JPHA 1S1QB 2G3QB 3WIMA 1V49A 2EMSA 4LJPB 3X0WA 4EKUA 2IO1B 3ZO5B 2RSUA 2JZ3B 4KIKB 3H9DA 2NPTB 1UBIA 3L17A 1P3QU 2BYFA 4DHZB 2G4SA 2NBVB 4AWJA 4XX5A 4M8NA 4RMAA 3PREA 4P7IA 1MG8A 3OAWA 2FNJB 2O6VA 4KDLB 2MBOA 4MH0E 2NS5A 4PS7A 2LUEA 2XEWA 2KFKA 1XT9B 4ZRJA 2G4DB 2LJ5A 4W9DA 1J8CA 4IWPA 3N3KB 1LXDA 3PV1A 4ICVA 5TR5A 2MX2A 3PZDA 5CHWA 2CHWA 2W9NA 2JRIB 3N30A 2UYZB 3DCGA 4NNJB 4LCDE 4F1SA 2KKCA 5L95C 1EUVB 3MTNB 1WJNA 3A9JA 4FLHA 4BVUC 4HWIB 1L2NA 2XK5B 4MJSA 2EKEC 5C1ZA 3U7DA 4IW0A 1WJ6A 2HD5B 3UIPB 3W1YA 3ZKJC 1LQBA 3PTFC 1WMHB 1L7YA 1WGDA 1YD8U 3A33B 3WA0A 1E8ZA 5AZGA 4XC2A 1YX6B 1P0RA 2GBRA 3QAQA 3UQBA 2KZRA 3DVNU 3EC8A 1NDDA 4W9KA 5JH5C 3TIXA 2M1MA 2L0FA 2V1YA 2YLMA 4ANVA 2ZNVB 2FAZA 1XQQA 3BINA 3K9OB 3PLVA 1CMXB 4G11A 4NJ6A 2LVQA 4PYUA 2RD0A 2QHOA 3SD5A 5KHQA 4M0WB 3U30A 2C5LC 3S2AA 4KV2A 4DDID 4HPMB 3APFA 3ENEA 2N9PC 2KJHB 4BOZB 3ZNHB 2KC2A 2JT4B 2RGFA 3JSVB 4IM3A 3U8ZA 5DCNA 1WJUA 2KDFB 3ZUNA 3ZIMA 3QK0A 4BOSC 3CF6E 4WWPA 2Z0EB 1KM7A 4FJVB 1WR6E 2CHZA 3ONSA 2BKRB 2WYQA 1E8WA 2KQSA 5AZHA 2Z0DB 2N1WA 4ZRKA 2DX5B 2L00B 4MGZE 4KZCA 2KOXA 3VTUA 2WDTB 3PPAA 4WAAA 2K8BA 4GIVA 4N9F4 4GGQA 4WQOB 2VRRB 4EZLA 4BFRA 2PJHA 3O65B 3NZUA 4HLEA 2LXCA 5J2RA 3KUCB 2BYEA 5EDSA 1UBQA 1UGMA 1TTNA 1WGHA 3QJZA 1V81A 1KLVA 3B08A 1SIFA 1WJ4A 3ML8A 3H7PA 4F7ZA 1UD7A 1OTRB 3DQVA 3QHTA 3RYTA 3DVGX 3H1UA 2KX3A 3UGBB 2V4LA 3B0AA 2GMIC 4FHKA 2BGFA 2KDBA 3DDCB 2N7DA 4W9HA 3PGEA 2IBIB 3AXCA 3L54A 3M95A 4HXDA 1F9JA 2L05A 5E6PA 4E71A 3EFUA 2J7QB 4MDKE 2JF5A 1Z2MA 2KWCA 2DYMA 4WWOA 2KC1A 3NOBA 2ZZPB 4MSQB 5D7GA 4CYEA 4MM3A 4JQWC 2REXA 3C0RB 2KWVB 2LD9A 2MWSB 4HCPB 1I35A 1GC6A 3IHPC 4MSMB 5DPWA 4ANUA 1V86A 2A4ZA 4II2B 3X23A 4F8CB 2MQJA 3NZSA 3LDZE 2JUOA 3MHSD 1WX8A 1E7VA 1WI0A 4EOYA 3A9JB 4IM0A 4GDLA 3QQ8B 2KQ7A 2D3GA 1WFYA 5J17A 2ZVNA 4DXAB 1R4MI 2K1FA 4MJSB 1TZ1A 3CSTA 1OEYA 1WF9A 5KHOA 3IVFA 2KJ6A 4WJPA 4GU2A 2FUHB 2MP2B 1EF1A 3L16A 4GXBA 5G2NA 1WM2A 3QA8A 2CHXA 2KANA 2GBJA 2R2QA 2AYOB 1WGGA 4TUUA 5C23A 2ZCBA 3W1SA 3PS6A 3UINB 2DZJA 3T8MA 2UWQA 5JHAA 3OJ4B 4WJOA 2A5UA 2WX0A 2L3ZA 1RRBA 2ZVOA 2MW5A 2LI5A 4JGHB 3Q3JA 1V9JA 2K25A 3PVLA 5BO4B 3RZWC 4DDGD 2J0JA 2L0TA 1ISNA 2KFJA 4G3XB 4EZJA 5IAAC 2J0MA 2PE6B 3KH0A 1C1YB 4ASWC 3IBEA 3QC8B 3V61A 4DK5A 1P98A 3A9KB 2OJRA 3ZLZA 4G0NB 4GOCA 1KJTA 3EECA 3SDLC 1EF5A 5DPTA 3Q3FA 3WANA 2KO3A 1S3SG 3TBLD 2N9XA 4DWFA 3IFWB 1WRDB 4XZ4A 1H8CA 2IO2B 3KYDD 2R2OA 3A1QB 3DOWA 4BBNF 2JY6A 3ZNID 4BKSA 1I42A 4W9CA 2M0XA 2AWTA 2DAFA 3LJ3A 2FCMA 3VFKA 1G6JA 2CU1A 4HCNB 3W1SC 4FJZA 4IC7B 4GSWA 4K7WA 4NPNA 1WZ3A 2BPSA 2C9WB 3H7PB 4MGYE 1NI2A 1LFDA 2B3AA 1SE9A 4IWOA 4X57B 3N32A 2WWZA 5D2MB 4G50A 2DYBA 3R7RA 2MA9B 4MELA 4NAWB 1OQYA 3VDZA 2L76A 3TCAA 4EZKA 1NBFC 2KTRA 1WM3A 1QZEA 2PE9A 4J6IA 2ASQA 4NQKE 1ZGUB 2GOWA 2O6VD 3CSFA 4GDKA 1IYFA 4HVBA 1K8RB 1OGWA 2O2VA 2M8SA 3AULA 2KDIA 3HK0A 3M63B 3RULA 1WX9A 1WXAA 2JXXA 3KVFB 3ZNZB 2FCSA 2I1KA 1EO6A 1RFAA 4IWQA 2K6QA 3KUDB 4HDOA 4BKTA 2PEAA 4IM2A 4KIKA 4ANWA 2ZPYA 2NPTA 2DZKA 2KMAA 1YJ1A 4BKSD 2RR9A 4CO7A 5G55A 1E5WA 4K81A 4PS8A 4JIOU 4IG7B 1C3TA 4EFOA 2BWFA 3JYUA 2LGDA 1P9DU 2LZ6A 3WAOA 2Y5BB 2GBKA 3V6EB 2K8HA 1Z5SB 3JVZX 4DHJD 2J0KA 1V5TA 2MLBA 3A4RA 5GMVA 2GBMA 5DPSA 1UH6A 3UF8A 1X1MA 4RM9A 1WY8A 3AU4A 2JZZA 5CX3A 4JLCA 5L83A 3NY5A 3NHEB 4KSKC 1IP9A 1WYWB 1WR1A 4ICUA 2XK5A 1YQBA 2AEHA 3VXWA 3PSEB 5LLIA 4AJYB 1FXTB 2JRHA 2LRUA 1E8YA 3SU8X 2O6VB 4I6NB 4GB9A 3APDA 4A3OA 2KFKB 4OVUA 5LXHA 1JRUA 4BBNC 4FJYA 3TJPA 2HE7A 2MRPA 3R66C 3ZDTA 3HHMA 2K39A 3VQIA 2MSED 1GJZA 1WZ0A 4HPLB 5FR6A 4FBJB 3UIOB 3M62B 4W9EA 1WXMA 4PS3A 2YVCA 2LGXA 3V6CB 2KLGA 2BWES 2JVCA 1TGZB 1WH3A 4WJNA 2LVOA 4K7UA 1GG3A 4FHJA 2ZJDA 5D6JB 3OJ3A 3ZRCA 3JSVA 1H4RA 3R7QA 3VHTC 2KK8A 4W9LA 2LRWA 5D94A 2DENB 3ML9A 2LGYA 2NBUA 3AI5A 3VVWB 2IO3B 3ZDMC 4DHJB 2KHWB 2LXAA 3L13A 2MBQA 4I6LB 3ZRFA 4MEMA 4K1RB 1ZKHA 2KTRB 2D2QA 4GMVA 3RD2A 3VUXA 4TQ1A 3PT2B 1TBEA 2LASA 2PPHA 2L7RA 3H6NA 4GDKB 4BKGA 3GOEA 4KZ0A 2D07B 3R3MA 5J18A 3HM6X 3ZW3A 3KW5B 3ALBA 1Q1OA 4CHKA 2XBBC 1J0GA 1E90A 1V2YA 3MJWA 2ZNVC 1VD2A 2KDEB 2I1JA 2AL3A 2NR2A 3VUYA 4EUTA 1M94A 4TQ0A 4YL8A 3VH3B 2BKFA 3DPDA 2ZEQA 2DAJA 1LM8B 2K6DB 2V3SA 4II3B 3VAWA 4AP4C 3KUZA 4KDIC 2OOBB 2ZPNA 3BY4B
chains in the Genus database with same CATH superfamily
2LWPA 3P4PB 4I6PA 2KX0A 5E6NA 3OLMD 4WJQA 3WALA 1T0YA 5CHFA 3V05A 5CTRC 2MJEA 3VTVA 4LDTD 1D5ZC 1WRIA 2MBBB 4HRSA 2KN5A 4JWUC 3UI3A 1PUTA 3APCA 2WNMA 1I4PA 3VH4B 3PLUA 2AQ3B 1L6UA 4NZLB 3IG3A 4TKNA 5LXIB 1KOTA 5IA7A 5BYQA 2MBHA 4XDDA 5HKHA 2CS4A 2NCNA 2WXPA 2AX5A 4NJ7A 2M4NA 3Q8CA 5GXGB 3PHWB 3JW0X 2DLBA 2JZPA 2ZW0A 3NS8A 2WGSA 3NVZA 2NBWB 1V80A 1DOIA 1ZXIA 4W9FA 3V60A 3Q3OC 3ECIA 4FULA 3Q8BA 2FCQA 3NS1A 4NAWA 4HROA 3BIID 4ITKA 2N1VA 3VRAB 4RH6A 3EFCA 1RLFA 4WH4A 2G45B 1Q0WB 3ZGZA 2FIFA 3T3OA 1R4NB 1R4NI 4LNOA 1HE8A 2OHFA 4NY0A 4HEA1 1WGRA 2C7NB 2LVPA 1FCCC 2GBNA 3H7SA 5MPOA 3RCZA 2C60A 2RDBC 1S1QB 4YXDB 1V49A 1HZ5A 1TYGB 3U52E 4KIKB 2WU5B 3H9DA 4RGMA 2NPTB 1UBIA 2QJLA 4YTPB 1FD6A 1IGCA 4M8NA 3PREA 1I4RA 3TEXA 1J8CA 2LJ5A 4W9DA 3BYYB 3P42A 2CHWA 2W9NA 3N30A 2UYZB 4NNJB 2KKCA 1F0ZA 3A9JA 3AE2B 5BMGA 3R8BA 5C1ZA 3U7DA 3UIPB 3W1YA 4C56C 2VH1A 1GB4A 2W54A 4HKZE 3UQBA 4PK1A 4W9KA 3TIXA 2M1MA 2L0FA 2G1EA 2FAZA 3K9OB 1IBXA 1CMXB 5KHQA 4J3OD 1ZPSA 1SE2A 2KJHB 4BOZB 3JSVB 3P4SB 4P16A 2WXIA 5DCNA 1L0VB 3BVMA 2KT7A 1P7FA 3ONSA 1VZ7A 2L83A 4ZRKA 4YTNB 1TJEA 2K8BA 1IUEA 4HPPA 5J2RA 2LXCA 2L1AA 4WWMA 1DGJA 3NJTA 2VH2A 3QJZA 3Q3MC 4ARCA 1F1HA 1KLVA 4HJGE 2IGHA 3H7PA 1UD7A 3DVGX 2KX3A 3UGBB 2BGFA 2KDBA 2N7DA 3PGEA 1N6ZA 1F9JA 4BZAA 3EFUA 2J7QB 2KWCA 2KC1A 2ZZPB 4CYEA 4MM3A 2REXA 1JWSD 2KWVB 1I35A 2HDEA 4ANUA 2N9LA 3T3NA 2A4ZA 2MQJA 2KWDA 1E10A 1ACCA 1TKEA 3P63A 3QQ8B 3U2SC 1R4MB 1R4MI 2LJIA 2BBCA 1TZ1A 2KVZA 2KJ6A 1KRHA 3AEAB 3W5VB 1SE3A 3L16A 1RM6C 2CHXA 2RMMA 2R2QA 5C23A 3W1SA 5FKAC 2JSVX 4M01A 5JHAA 4A90A 1C78A 2A5UA 1RRBA 2ZVOA 2LI5A 1V9JA 2K25A 3PVLA 3RZWC 4DDGD 1DOXA 3Q69A 1P7EA 5IAAC 2J0MA 3B9JA 3RFZB 2W3SA 3QC8B 1P98A 3A9KB 3BVGA 4RNAA 1KJTA 1ROEA 3SDLC 1K50A 5DPTA 3WANA 3DHHC 2KO3A 4XZ4A 3Q6BA 5HFYA 3KYDD 2JY6A 3ZNID 2M0XA 3LJ3A 1AN8A 2C9WB 2K3UA 4IWOA 3SFDB 2B76B 3VDZA 1TS4A 4JE3B 1NBFC 4REZA 1QZEA 2PE9A 1GOZA 2GOWA 2O6VD 4HVBA 1OGWA 3AEFB 3AULA 3HK0A 3RULA 1XLQA 2JXXA 2Z8LA 5HHDG 1E0ZA 3Q8EA 4P6VF 2PEAA 3SFEB 4KIKA 2ZPYA 2NPTA 4CO7A 2WXNA 4NAMA 4EFOA 2BWFA 3WAOA 2GBKA 1FXAA 1V5TA 3AEEB 2D3BA 1C9FA 5DPSA 1X1MA 3AU4A 4RF0A 3P4QB 3NHEB 3ZQ4A 1WYWB 4ICUA 1QT9A 1YQBA 2G9HD 3AMZA 2JRHA 2LRUA 2D5GA 3EA6A 3APDA 4OVUA 3RNGC 4FJYA 1HZ6A 3R66C 2MSED 1WXQA 1SEBD 5FR6A 2PKOA 4W9EA 3CIRB 2LGXA 1EM7A 2KLGA 4YWGG 2QSDA 4K7UA 4FHJA 1AYFA 1N62A 3JSVA 1FEHA 5D94A 3ML9A 2LGYA 2JX5A 2PVGC 1QF6A 3KQ4A 3U7ZA 4DHJB 3L13A 4I6LB 4K3BA 2WXOA 4MEMA 4K1RB 3MC8A 2KTRB 4GMVA 3RD2A 3VUXA 1ZE3D 4TQ1A 1TBEA 3H6NA 1E6EB 1L4ZB 1WWTA 4CHKA 1IGDA 1Q1OA 1E90A 1V2YA 1T0SC 2M56B 2I1JA 1FMAD 3VUYA 3Q14C 4EUTA 4YL8A 3VH3B 2ZEQA 2DAJA 2K6DB 2I2YA 4KDIC 2ZPNA 4B0MA 3QX1A 4WAFA 3QCAA 4ANXA 2BS4B 3A4SC 1V1PB 3GE8C 2JYTA 4AS1A 1WE6A 1QKZA 1J7BA 4KSLC 4L23A 5D3DA 2WS3B 4K3CA 4DBGA 2ZCCA 1RAXA 3BVZA 2RPQA 3ZTDA 2EMTA 4KGTA 2I38A 3B1LX 1UELA 3BK1A 1PQSA 2INNE 4GDLB 4JL9A 3FC4A 1K52A 3L0WB 3PRZA 1D3ZA 2HJ8A 2KNBA 4W9GA 1A70A 1WIAA 1C79A 2EELA 1GUAB 2KQ4X 3A9KA 3VUWA 3TL5A 1WE7A 1ESFA 4B9KA 3I57A 2N4FA 3ZJVA 3L08A 4E74A 3MC0B 2UU7A 3V62A 3MC9A 3GZNB 3GZNI 4PYZA 1E7PB 3R2TA 3EGRA 4HK2A 2IGDA 1KLGD 2W55A 1TT5B 3EHVA 2WLBA 4A3PA 1E7UA 2INDC 1FXIA 2MCNB 4MGIE 4HJKA 2C7HA 2KJRA 3RN9C 4RM8A 1VDVA 4AJWA 1FRRA 3FILB 1AARA 2XNAC 2K0PA 4B0EA 1V5OA 1ZW7A 1WXSA 3AH7A 4FN2A 3MHZA 4KVGB 2V3NA 4E3CA 1J19A 2O2VB 1PGXA 1GPXA 1YN3A 3TSSA 1PYWD 2JPHA 3MP9A 2WXFA 4D2KA 1JALA 2X8XX 2IO1B 1F2RC 4XYCA 1TS3A 1SB3C 1P3QU 3OWEB 2BYFA 5EE3A 3E56A 5IP4D 4AWJA 4EE2A 1DYQA 2E6XA 2FNJB 2KYWA 2MBOA 4MH0E 2WDVB 2VZKD 4IWPA 3PV1A 5TR5A 1YJJA 2JRIB 3DCGA 4F1SA 1D5XC 1WJNA 3IAM1 4R3DA 4BVUC 2ONQA 4RCOA 1LQBA 3PTFC 1WMHB 1YD8U 3PZ7A 3A33B 3WA0A 1E8ZA 5H92C 4C7YA 1YN4A 2KZRA 4A55A 4ANVA 3HVZA 4G11A 2RD0A 4M0WB 2GB1A 4XGAB 2C5LC 3U30A 4OZCA 4KV2A 3ZXVA 4DDID 1HTOA 1MJDA 1UWXA 5BYRA 1WJUA 5HG2A 3CF6E 2Z0EB 1KM7A 2WYQA 2KQSA 2N1WA 2L00B 2KOXA 1WGKA 2BYTA 4N9F4 3NZUA 3GB1A 3VRBB 3ETRA 1VZ8A 1HXYD 1UGMA 1PGBA 1V1PA 1WJ4A 3ML8A 5T8IA 1TIFA 5IO9A 1OTRB 3DQVA 2V4LA 2GMIC 2SAKA 4W9HA 2FE8A 3M95A 1V8CA 1Z2MA 2W82A 4MSQB 1RFKA 4JQWC 1LGRA 1M4VA 3C0RB 1VRAB 2MJ3A 4WQMA 2N7JA 4MSMB 4PT5A 4II2B 3ZJTA 3BK2A 3NZSA 1KTKA 2H89B 2JUOA 1WI0A 4EOYA 1FCLA 4GDLA 2KQ7A 2ZVNA 4DXAB 2K1FA 4MJSB 2PLPA 3P4RB 1OEYA 3IVFA 4WJPA 2MP2B 1EF1A 1VR9A 3QA8A 2R61A 4ARIA 4TUUA 2AYOB 4RGNA 3RI7C 1N63A 4C7ZA 2BVCA 1TKYA 3UINB 2DZJA 3CWIA 3T8MA 5BYSA 2MW5A 3Q3JA 1D4BA 1ISNA 3KH0A 4MT5A 1C1YB 1BMLC 3IBEA 3V61A 1NI3A 3B2FA 3Q8AA 1S3SG 4TMAB 4M00A 4YSYB 1K53A 1H8CA 2IO2B 3ZYYX 2R2OA 5BMIA 4JPSA 3DOWA 4BBNF 3MFGA 4LLGM 1QOAA 3VFKA 2FCMA 1G6JA 4DQOC 3AEBB 4FJZA 4K7WA 2YEPF 1XXGA 4MGYE 2LMCA 1LFDA 2B3AA 4X57B 3FILA 3N32A 2WWZA 4G50A 1FPYA 2MA9B 4MELA 1OQYA 2D3AA 2L76A 2WHIA 4EZKA 1WM3A 1F2RI 1TS2A 5EE9A 2NMQA 4GDKA 1K8RB 2O2VA 3SEBA 1XLPA 2KDIA 1ET9A 1WX9A 1WXAA 1YJIA 3NVVA 3KVFB 2QDFA 3AE1B 3ZNZB 1RFAA 4IWQA 2INCC 2K6QA 4S17A 4BKTA 1T0QC 3DHGC 4IM2A 1YNTE 3W2DA 4USAA 2JWUA 3JYUA 1P9DU 2PTLA 4FXCA 2Y5BB 2K8HA 3IT4B 2GI9A 2PVOD 3EUB2 3URYA 2JZZA 1OFFA 1FFVA 3E9SA 1D6EC 3AB5A 3VXWA 3PSEB 5LLIA 1FXTB 3KWVA 4I6NB 2WDQB 1FNWA 2ICIA 2IPKD 3ZDTA 3HHMA 2DBYA 2BS2B 2K39A 3VQIA 1UGJA 4RFBA 1GJZA 1WZ0A 2WXGA 1AW7A 4C80A 1WXMA 1V97A 3V6CB 3Q2AC 1F77A 2K5PA 2QCZA 2ZJDA 5D6JB 3OJ3A 2AQ1B 3RNBC 3RNEC 3AI5A 2CJOA 1UUPA 3AN1A 3ZDMC 1C76A 2L52A 1MHXA 4S0RA 1Q10A 2PPHA 3GOEA 3R3MA 3HM6X 3ZW3A 3KW5B 5LNK1 3IT6B 2ZNVC 1VD2A 2KDEB 2NR2A 4IOIE 4DXFA 2PW9A 3PO0A 1YOVB 4BAXA 1ZDXA 2BKFA 2TSSA 2L32A 2V3SA 1ZDVA 2OOBB 1YQ4B 1C4PA 1L4DB 2WXRA 3PHXB 5AEKB 1KF6B 4OVVA 2QIEB 2IZVB 2KXJA 2BW2A 1J7CA 2WX1A 1U4AA 2KN4A 4B6WA 2KLCA 1ZXHA 3DBRB 3DBRI 2CR5A 4W9IA 1MI0A 2V0GA 5DPRA 4GN1A 3HIZA 4C4VB 3ZNGC 2KTFA 1EWCA 5AZFA 4AUQC 4TV3A 2MP2A 1QQRA 4HDQA 1V6EA 1SXTA 3RUIB 1XLNA 4URKA 4N59A 1XD3B 3RT3B 5JHBA 1Q5WB 2FBWB 3T9LA 4N6EB 2DHZA 2HTME 3AE3B 3ZTCA 4B95A 3UQAA 3DBSA 1CQVA 3QIJA 2BF8B 1JMLA 2CU3A 3WAPA 2JQRB 2VZKB 1KLUD 1YIWA 3QARA 4LDTB 4XWWA 4IUMB 2DZIA 4OZBA 4A8XC 1SE4A 4LK0M 1VCBA 2M17A 2ON8A 2RPVA 4EEWA 1UWMA 4RGOS 4ZRIA 2D11A 1LO5D 1JWUD 3L10B 4P1CC 1OQRA 4ZDVA 3K9PB 3KLSX 1UZXB 3CMMB 4FA6A 4MH8A 2K8CA 2WXLA 4YSZB 5CHVC 4A9AA 2QC8A 4ZRPA 3VR9B 4JX1C 3DBLB 3DBLI 3PRPB 1GNUA 1WXVA 4A20A 4LNFA 2QMTA 2IY1B 3D32A 2HTHA 5JXVA 5H8YE 2K9XA 4US9A 3W5UB 4LJOB 3QWZB 3N1XC 4WWNA 3DBHB 3DBHI 4AOFA 2G3QB 3WIMA 1FNVA 1N5XA 2EMSA 4LJPB 3X0WA 4EKUA 1WSPA 3ZO5B 3L17A 4DHZB 2INPE 4XX5A 3AEGB 2JU6X 3AE4B 4KDLB 4PS7A 4ZRJA 2LUEA 2XEWA 1XT9B 3KWLA 1KFYB 4ICVA 2MX2A 5CHWA 4LCDE 3MTNB 4HWIB 1L2NA 2XK5B 1AWDA 2EKEC 2WXQA 2GRIA 4NJCA 1FIQA 1F52A 1L7YA 2QEJC 1TKGA 1P0RA 2GBRA 3H8HA 3DVNU 3EC8A 5JH5C 1EU3A 2YLMA 2ZNVB 2M19A 1XQQA 5G5HA 4NJ6A 3SD5A 2QHOA 1PFDA 3S2AA 2PIAA 2JXTA 1C77A 3OG5A 3V3XA 3APFA 4ZOHC 2N9PC 2KC2A 2JT4B 2RGFA 3U8ZA 1TS5A 3ZIMA 3QK0A 4A6QA 4ZRQA 3L4PA 1WR6E 2CHZA 3ZXRA 5E6JA 2DX5B 5IN7A 1SF0A 3IXSA 2BB6A 4JWSC 3VTUA 2WDTB 3FAHA 4WQOB 2VRRB 4EZLA 2PJHA 3O65B 4HLEA 1L5PA 3N1ZC 1SBBB 1TTNA 1V81A 3B08A 3QHTA 3RYTA 1ZUD2 4XWTA 3B0AA 2IBIB 4E71A 4HXDA 2L05A 4MDKE 4C4VA 2JF5A 3FKYA 2KMMA 3AECB 1XCTL 2WXMA 2LD9A 2MWSB 4HCPB 3IHPC 3GE3C 1HTQA 1UF0A 1V86A 5AUIA 3X23A 3B2GA 4F8CB 3LDZE 1NYQA 1E7VA 3A9JB 2WXHA 1JROA 4IM0A 2NTTA 2D3GA 1T3QA 3CSTA 1WF9A 4GU2A 1NEKB 2FUHB 5HI1A 4GXBA 2LEKA 5G2NA 2KANA 3O13A 1WGGA 2ZCBA 1CK1A 1T0RC 1IBXB 5IOIA 2UWQA 4WJOA 1FFUA 2L3ZA 2IJ0A 1BUIC 4JGHB 4KKIA 5BO4B 2L0TA 4G3XB 2PE6B 4CQNA 4O1NA 3EECA 4M02A 3U4EG 1EF5A 2X38A 1B9RA 4OVZA 1WRDB 2LHDA 3NUHB 3A1QB 4BKSA 1I42A 2K22A 1SJED 2AWTA 2DAFA 5AUKA 3SR6A 2CU1A 4IC7B 4GSWA 3H7PB 1ENFA 3AE9B 5D2MB 3R7RA 2DYBA 1J7AA 1FNUA 3BWUD 2BTEA 3TCAA 2KTRA 2BT6A 2ASQA 4NQKE 1JWBD 1ZGUB 4MM3B 2LHEA 2N0SB 2MH7A 1L6VA 5EE1A 1EO6A 3KUDB 4HDOA 4ANWA 2DZKA 1T5XD 1YJ1A 4BKSD 5G55A 4KKJA 1E5WA 4PS8A 4JIOU 2GLSA 2BS3B 5FR3A 2WP9B 3V6EB 5G5GA 2DWQA 4DHJD 2J0KA 2MLBA 3A4RA 5GMVA 1UH6A 3NVWA 4RM9A 4UDUC 1WY8A 4JLCA 2XN9C 1IP9A 1FO4A 2J53A 2XK5A 1JCKB 1XF5L 2WXKA 1MPEA 2Y5CA 4RF1A 4AJYB 3SU8X 3RPFC 3N1YC 2O6VB 4GB9A 4GLSC 2KFKB 5LXHA 4BBNC 2HE7A 1I7HA 2MRPA 4KGRA 4HPLB 3UIOB 5TSSA 1XO3A 2JVCA 4L1BA 4KGSA 3ABVB 4C00A 4WJNA 2EKIA 2LVOA 1GG3A 2IGGA 1H4RA 3R7QA 2RDGA 2KK8A 2LRWA 2KAJA 2DENB 2SEBD 3VVWB 2IO3B 1KH0A 2J4XA 2KHWB 2LXAA 2MBQA 2IDYA 1R7SA 2D2QA 2WXJA 1SJHD 3PT2B 2LASA 2L7RA 3NRZA 4KZ0A 5J18A 3MJWA 1M94A 4TQ0A 4N58A 3DPDA 3RNCC 1LM8B 4AP4C 3VAWA 3KUZA 4OZAA 4HKQA 2Z0DB 1YQ3B 2V3PA 3BY4B 4RGTA 1A5RA 1IPGA 2KVRA 2AL6A 1DOYA 1HA5A 3SHQA 1MFWA 3AE7B 3TEYA 4IKGA 2MBEA 2BQQA 4YSXB 1Y8RC 2BYVE 2PMVA 3I3TB 4P1BC 5JZEB 2J52A 2KACA 3N20C 3WAMA 1EU4A 2CKHB 2N7EA 1HEZE 2D10A 1N61A 1YMHE 2KD0A 3GS2A 3DVGY 1PDXA 4Q2JA 3M3JA 2KDMA 2KMCA 1WX7A 2DNFA 3RNFC 3KYCD 4MGKE 2L8JA 1SGHA 3DVNV 3NZ3A 1I4HA 2KWUB 3HM3A 2IY0B 1P1AA 1YX5B 4DHZE 2IO0B 2CJNA 1MVKA 1EWYC 2LUMA 1E8XA 1VJKA 3C19A 3HUIA 3PRMB 4M8MA 1ZOYB 3ZVVA 1BXTA 1TY0A 3I5JC 4LNNA 1WYGA 2ACZB 1OEYJ 1JW9D 2IYDB 4ZYNA 3A1QA 1GC7A 2Z59B 4W9JA 1WMHA 2FCNA 1I4QA 3J9CA 3TMPB 2FIDA 4XDCA 2MJDA 5E6OA 1N5WA 3RZFA 3WCQA 4M0WA 5IKCM 3AU5A 1BT0A 2NTSA 2DZMA 4ZHOA 1L0YB 2C7MB 2JWZA 3TEWA 2N9EB 2NVUI 3VR8B 1FM0D 3MJ5A 4QAYA 3NG0A 2DYOA 4NQLB 3P2BA 3N9YC 3LYYA 3VTWA 3PZ8A 4FADA 4K7SA 1RWSA 2FUG1 1WGYA 2WDRB 3DWGC 1RYJA 3I9V1 2RSUA 2H88B 2JZ3B 4LNKA 2N9KA 2HJ1A 2YEPB 2G4SA 2NBVB 4MACA 4RMAA 4P7IA 1MG8A 3OAWA 2O6VA 2NS5A 2KFKA 2G4DB 3N3KB 1LXDA 3PZDA 1QLBB 3RNAC 5L95C 1EUVB 3AE8B 4FLHA 4MJSA 2OEDA 5C3JB 1TZOA 1WJ6A 2HD5B 4IW0A 1QOBA 3ZKJC 1WGDA 5AZGA 4XC2A 1YX6B 3QAQA 1NDDA 1I4XA 1MHHE 2V1YA 3BINA 3PLVA 4PYUA 2LVQA 1JQ4A 4WURA 1K51A 2WU2B 3ENEA 2ZW1A 4HPMB 3LXFA 3LB8C 3ZNHB 4IM3A 2KDFB 3ZUNA 4BOSC 4WWPA 4FJVB 2BKRB 1E8WA 5AZHA 3DWMA 4OW0A 2AQ2B 4MGZE 4KZCA 3DHIC 4H2AA 3PPAA 1XCQL 4WAAA 4GIVA 4L2YA 4GGQA 2M0AA 5EE0A 4BFRA 5C2TB 3KUCB 2BYEA 5EDSA 1UBQA 1WGHA 1SIFA 1NVID 3AE6B 4F7ZA 3H1UA 1VZ6A 4FHKA 3DDCB 3AXCA 3L54A 5E6PA 2DYMA 4WWOA 3NOBA 5D7GA 1QOFA 1GAQB 2Y5PA 4AQ7A 1GC6A 5DPWA 1UNSA 3TEZA 4TSSA 2LGSA 4OHJA 3MHSD 1WX8A 2D3CA 3C8YA 1WFYA 5J17A 3BZDB 3AEDB 1NYRA 1OQQA 5KHOA 2V9HA 1WM2A 2GBJA 3PS6A 1MG4A 1NENB 3OJ4B 2WX0A 2J0JA 2RDHA 2KFJA 4EZJA 4ASWC 3HVDA 4DK5A 3ZLZA 1JRPA 2OJRA 1SIJA 4G0NB 4GOCA 1TY2A 3Q3FA 1XEEA 1JWMD 3TBLD 2N9XA 4DWFA 3IFWB 2E3TA 2LFIA 2QILA 4W9CA 2BB5A 3AV8A 4HCNB 4WIPA 3GP7A 3W1SC 1C4AA 1WZ3A 2BPSA 4NPNA 1NI2A 1SE9A 3RMKC 1FRDA 1XLOA 4NAWB 1VLBA 1ZP0B 3W9CB 4J6IA 3BYTB 3CSFA 2J42A 2M8SA 3ZJUA 3M63B 4LNIA 2FCSA 1CJEA 2I1KA 1HQRD 2KMAA 2RR9A 1PGAA 2V4IB 4LTUA 2OJWA 1QOGA 4K81A 5D3IB 4IG7B 5FK9C 1C3TA 1C4CA 2LGDA 2LZ6A 1B1ZA 1Z5SB 3JVZX 1JWAD 2GBMA 3UF8A 5BMHA 2Q5WD 5CX3A 5L83A 1V1OA 3NY5A 4KSKC 1WR1A 1STEA 3HRDD 4KX6B 1QILA 1I4GA 2AEHA 2MHJA 3AE5B 3TUOA 1E8YA 4ZYSA 1T6BX 4A3OA 1JRUA 3Q3NC 3TJPA 4ACFA 1ET6A 1D5MC 5I4DA 1E9MA 4FBJB 3M62B 1L0XB 4PS3A 2YVCA 2BWES 1TGZB 1WH3A 3NVYA 1SSNA 4DXGA 2MEKA 4XE0A 1CZPA 3IAS1 3ZRCA 3VHTC 2LGIA 2JYEA 4W9LA 2NBUA 1N60A 3R2IA 3I63C 3ZRFA 2W3RA 1ZKHA 4YTMB 2Y3AA 4YT0B 1Y56A 4GDKB 4BKGA 2D07B 3ALBA 2XBBC 1J0GA 2AL3A 3P1MA 4US8A 2WQYB 4ZHPA 3Q8FA 4IDIA 1GB1A 1YN5A 3AM9A 4II3B 1IYFA
chains in the Genus database with same CATH topology
2LWPA 3QX1A 3PHXB 5AEKB 4I6PA 2KX0A 3QCAA 4OVVA 1A5RA 1IPGA 5E6NA 3OLMD 4ANXA 4WJQA 3WALA 1T0YA 2KVRA 2IZVB 2AL6A 3A4SC 5CHFA 2KXJA 3SHQA 5CTRC 1WE6A 2WX1A 1U4AA 4B6WA 2KLCA 4KSLC 3DBRI 2CR5A 4W9IA 3VTVA 4LDTD 2MBEA 2MBBB 1Y8RC 4DBGA 5DPRA 2ZCCA 2BYVE 4GN1A 1RAXA 3I3TB 2KN5A 5JZEB 3HIZA 3ZNGC 3WAMA 3APCA 2RPQA 3VH4B 2CKHB 2KTFA 3PLUA 2N7EA 5AZFA 4AUQC 4TV3A 2MP2A 2D10A 4HDQA 1V6EA 2KD0A 3ZTDA 3IG3A 3RUIB 2EMTA 4TKNA 4URKA 1XD3B 3RT3B 3B1LX 5JHBA 1Q5WB 5LXIB 3DVGY 1UELA 1KOTA 3M3JA 1PQSA 2KMCA 1WX7A 3T9LA 4GDLB 2DHZA 3KYCD 4JL9A 5IA7A 3ZTCA 4MGKE 2L8JA 2MBHA 1SGHA 3L0WB 3PRZA 4B95A 5HKHA 3UQAA 1D3ZA 2HJ8A 3DVNV 2KNBA 3DBSA 3QIJA 2BF8B 2CS4A 4W9GA 2NCNA 1WIAA 2KWUB 1GUAB 3HM3A 2IY0B 1P1AA 1YX5B 4NJ7A 4DHZE 2M4NA 3PHWB 3WAPA 2IO0B 3A9KA 3VUWA 3TL5A 3JW0X 1E8XA 3PRMB 3ZVVA 4M8MA 1WE7A 4B9KA 1YIWA 3QARA 4LDTB 3NS8A 1OEYJ 2IYDB 2N4FA 4IUMB 2DZIA 4ZYNA 3L08A 3A1QA 2NBWB 4E74A 1GC7A 1V80A 1VCBA 3V62A 2Z59B 2M17A 3GZNI 4PYZA 4W9JA 1WMHA 2FCNA 4W9FA 3TMPB 3V60A 4EEWA 2FIDA 4HK2A 3ECIA 4FULA 4ZRIA 2D11A 2FCQA 3L10B 5E6OA 4ZDVA 3EHVA 3K9PB 4NAWA 3RZFA 4A3PA 1UZXB 3CMMB 4FA6A 1E7UA 2K8CA 2N1VA 2MCNB 3AU5A 1RLFA 1BT0A 4HJKA 4MGIE 5CHVC 2DZMA 2G45B 1Q0WB 2C7HA 2C7MB 2JWZA 2KJRA 2N9EB 2NVUI 3DBLI 3PRPB 4RM8A 1GNUA 2FIFA 1WXVA 4A20A 4AJWA 1R4NI 1AARA 1HE8A 2IY1B 3D32A 2HTHA 2DYOA 4NQLB 3P2BA 4NY0A 1V5OA 1ZW7A 1WXSA 3VTWA 1WGRA 4FADA 2C7NB 2LVPA 4K7SA 4FN2A 4KVGB 4E3CA 1WGYA 1J19A 2GBNA 3H7SA 2O2VB 4LJOB 3QWZB 3RCZA 4AOFA 4WWNA 3DBHI 2C60A 2JPHA 1S1QB 2G3QB 3WIMA 1V49A 2EMSA 4LJPB 3X0WA 4EKUA 2IO1B 3ZO5B 2RSUA 2JZ3B 4KIKB 3H9DA 2NPTB 1UBIA 3L17A 1P3QU 2BYFA 4DHZB 2G4SA 2NBVB 4AWJA 4XX5A 4M8NA 4RMAA 3PREA 4P7IA 1MG8A 3OAWA 2FNJB 2O6VA 4KDLB 2MBOA 4MH0E 2NS5A 4PS7A 2LUEA 2XEWA 2KFKA 1XT9B 4ZRJA 2G4DB 2LJ5A 4W9DA 1J8CA 4IWPA 3N3KB 1LXDA 3PV1A 4ICVA 5TR5A 2MX2A 3PZDA 5CHWA 2CHWA 2W9NA 2JRIB 3N30A 2UYZB 3DCGA 4NNJB 4LCDE 4F1SA 2KKCA 5L95C 1EUVB 3MTNB 1WJNA 3A9JA 4FLHA 4BVUC 4HWIB 1L2NA 2XK5B 4MJSA 2EKEC 5C1ZA 3U7DA 4IW0A 1WJ6A 2HD5B 3UIPB 3W1YA 3ZKJC 1LQBA 3PTFC 1WMHB 1L7YA 1WGDA 1YD8U 3A33B 3WA0A 1E8ZA 5AZGA 4XC2A 1YX6B 1P0RA 2GBRA 3QAQA 3UQBA 2KZRA 3DVNU 3EC8A 1NDDA 4W9KA 5JH5C 3TIXA 2M1MA 2L0FA 2V1YA 2YLMA 4ANVA 2ZNVB 2FAZA 1XQQA 3BINA 3K9OB 3PLVA 1CMXB 4G11A 4NJ6A 2LVQA 4PYUA 2RD0A 2QHOA 3SD5A 5KHQA 4M0WB 3U30A 2C5LC 3S2AA 4KV2A 4DDID 4HPMB 3APFA 3ENEA 2N9PC 2KJHB 4BOZB 3ZNHB 2KC2A 2JT4B 2RGFA 3JSVB 4IM3A 3U8ZA 5DCNA 1WJUA 2KDFB 3ZUNA 3ZIMA 3QK0A 4BOSC 3CF6E 4WWPA 2Z0EB 1KM7A 4FJVB 1WR6E 2CHZA 3ONSA 2BKRB 2WYQA 1E8WA 2KQSA 5AZHA 2Z0DB 2N1WA 4ZRKA 2DX5B 2L00B 4MGZE 4KZCA 2KOXA 3VTUA 2WDTB 3PPAA 4WAAA 2K8BA 4GIVA 4N9F4 4GGQA 4WQOB 2VRRB 4EZLA 4BFRA 2PJHA 3O65B 3NZUA 4HLEA 2LXCA 5J2RA 3KUCB 2BYEA 5EDSA 1UBQA 1UGMA 1TTNA 1WGHA 3QJZA 1V81A 1KLVA 3B08A 1SIFA 1WJ4A 3ML8A 3H7PA 4F7ZA 1UD7A 1OTRB 3DQVA 3QHTA 3RYTA 3DVGX 3H1UA 2KX3A 3UGBB 2V4LA 3B0AA 2GMIC 4FHKA 2BGFA 2KDBA 3DDCB 2N7DA 4W9HA 3PGEA 2IBIB 3AXCA 3L54A 3M95A 4HXDA 1F9JA 2L05A 5E6PA 4E71A 3EFUA 2J7QB 4MDKE 2JF5A 1Z2MA 2KWCA 2DYMA 4WWOA 2KC1A 3NOBA 2ZZPB 4MSQB 5D7GA 4CYEA 4MM3A 4JQWC 2REXA 3C0RB 2KWVB 2LD9A 2MWSB 4HCPB 1I35A 1GC6A 3IHPC 4MSMB 5DPWA 4ANUA 1V86A 2A4ZA 4II2B 3X23A 4F8CB 2MQJA 3NZSA 3LDZE 2JUOA 3MHSD 1WX8A 1E7VA 1WI0A 4EOYA 3A9JB 4IM0A 4GDLA 3QQ8B 2KQ7A 2D3GA 1WFYA 5J17A 2ZVNA 4DXAB 1R4MI 2K1FA 4MJSB 1TZ1A 3CSTA 1OEYA 1WF9A 5KHOA 3IVFA 2KJ6A 4WJPA 4GU2A 2FUHB 2MP2B 1EF1A 3L16A 4GXBA 5G2NA 1WM2A 3QA8A 2CHXA 2KANA 2GBJA 2R2QA 2AYOB 1WGGA 4TUUA 5C23A 2ZCBA 3W1SA 3PS6A 3UINB 2DZJA 3T8MA 2UWQA 5JHAA 3OJ4B 4WJOA 2A5UA 2WX0A 2L3ZA 1RRBA 2ZVOA 2MW5A 2LI5A 4JGHB 3Q3JA 1V9JA 2K25A 3PVLA 5BO4B 3RZWC 4DDGD 2J0JA 2L0TA 1ISNA 2KFJA 4G3XB 4EZJA 5IAAC 2J0MA 2PE6B 3KH0A 1C1YB 4ASWC 3IBEA 3QC8B 3V61A 4DK5A 1P98A 3A9KB 2OJRA 3ZLZA 4G0NB 4GOCA 1KJTA 3EECA 3SDLC 1EF5A 5DPTA 3Q3FA 3WANA 2KO3A 1S3SG 3TBLD 2N9XA 4DWFA 3IFWB 1WRDB 4XZ4A 1H8CA 2IO2B 3KYDD 2R2OA 3A1QB 3DOWA 4BBNF 2JY6A 3ZNID 4BKSA 1I42A 4W9CA 2M0XA 2AWTA 2DAFA 3LJ3A 2FCMA 3VFKA 1G6JA 2CU1A 4HCNB 3W1SC 4FJZA 4IC7B 4GSWA 4K7WA 4NPNA 1WZ3A 2BPSA 2C9WB 3H7PB 4MGYE 1NI2A 1LFDA 2B3AA 1SE9A 4IWOA 4X57B 3N32A 2WWZA 5D2MB 4G50A 2DYBA 3R7RA 2MA9B 4MELA 4NAWB 1OQYA 3VDZA 2L76A 3TCAA 4EZKA 1NBFC 2KTRA 1WM3A 1QZEA 2PE9A 4J6IA 2ASQA 4NQKE 1ZGUB 2GOWA 2O6VD 3CSFA 4GDKA 1IYFA 4HVBA 1K8RB 1OGWA 2O2VA 2M8SA 3AULA 2KDIA 3HK0A 3M63B 3RULA 1WX9A 1WXAA 2JXXA 3KVFB 3ZNZB 2FCSA 2I1KA 1EO6A 1RFAA 4IWQA 2K6QA 3KUDB 4HDOA 4BKTA 2PEAA 4IM2A 4KIKA 4ANWA 2ZPYA 2NPTA 2DZKA 2KMAA 1YJ1A 4BKSD 2RR9A 4CO7A 5G55A 1E5WA 4K81A 4PS8A 4JIOU 4IG7B 1C3TA 4EFOA 2BWFA 3JYUA 2LGDA 1P9DU 2LZ6A 3WAOA 2Y5BB 2GBKA 3V6EB 2K8HA 1Z5SB 3JVZX 4DHJD 2J0KA 1V5TA 2MLBA 3A4RA 5GMVA 2GBMA 5DPSA 1UH6A 3UF8A 1X1MA 4RM9A 1WY8A 3AU4A 2JZZA 5CX3A 4JLCA 5L83A 3NY5A 3NHEB 4KSKC 1IP9A 1WYWB 1WR1A 4ICUA 2XK5A 1YQBA 2AEHA 3VXWA 3PSEB 5LLIA 4AJYB 1FXTB 2JRHA 2LRUA 1E8YA 3SU8X 2O6VB 4I6NB 4GB9A 3APDA 4A3OA 2KFKB 4OVUA 5LXHA 1JRUA 4BBNC 4FJYA 3TJPA 2HE7A 2MRPA 3R66C 3ZDTA 3HHMA 2K39A 3VQIA 2MSED 1GJZA 1WZ0A 4HPLB 5FR6A 4FBJB 3UIOB 3M62B 4W9EA 1WXMA 4PS3A 2YVCA 2LGXA 3V6CB 2KLGA 2BWES 2JVCA 1TGZB 1WH3A 4WJNA 2LVOA 4K7UA 1GG3A 4FHJA 2ZJDA 5D6JB 3OJ3A 3ZRCA 3JSVA 1H4RA 3R7QA 3VHTC 2KK8A 4W9LA 2LRWA 5D94A 2DENB 3ML9A 2LGYA 2NBUA 3AI5A 3VVWB 2IO3B 3ZDMC 4DHJB 2KHWB 2LXAA 3L13A 2MBQA 4I6LB 3ZRFA 4MEMA 4K1RB 1ZKHA 2KTRB 2D2QA 4GMVA 3RD2A 3VUXA 4TQ1A 3PT2B 1TBEA 2LASA 2PPHA 2L7RA 3H6NA 4GDKB 4BKGA 3GOEA 4KZ0A 2D07B 3R3MA 5J18A 3HM6X 3ZW3A 3KW5B 3ALBA 1Q1OA 4CHKA 2XBBC 1J0GA 1E90A 1V2YA 3MJWA 2ZNVC 1VD2A 2KDEB 2I1JA 2AL3A 2NR2A 3VUYA 4EUTA 1M94A 4TQ0A 4YL8A 3VH3B 2BKFA 3DPDA 2ZEQA 2DAJA 1LM8B 2K6DB 2V3SA 4II3B 3VAWA 4AP4C 3KUZA 4KDIC 2OOBB 2ZPNA 3BY4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LWP A;  3QX1 A;  3PHX B;  5AEK B;  4I6P A;  2KX0 A;  3QCA A;  4OVV A;  1A5R A;  1IPG A;  5E6N A;  3OLM D;  4ANX A;  4WJQ A;  3WAL A;  1T0Y A;  2KVR A;  2IZV B;  2AL6 A;  3A4S C;  5CHF A;  2KXJ A;  3SHQ A;  5CTR C;  1WE6 A;  2WX1 A;  1U4A A;  4B6W A;  2KLC A;  4KSL C;  3DBR I;  2CR5 A;  4W9I A;  3VTV A;  4LDT D;  2MBE A;  2MBB B;  1Y8R C;  4DBG A;  5DPR A;  2ZCC A;  2BYV E;  4GN1 A;  1RAX A;  3I3T B;  2KN5 A;  5JZE B;  3HIZ A;  3ZNG C;  3WAM A;  3APC A;  2RPQ A;  3VH4 B;  2CKH B;  2KTF A;  3PLU A;  2N7E A;  5AZF A;  4AUQ C;  4TV3 A;  2MP2 A;  2D10 A;  4HDQ A;  1V6E A;  2KD0 A;  3ZTD A;  3IG3 A;  3RUI B;  2EMT A;  4TKN A;  4URK A;  1XD3 B;  3RT3 B;  3B1L X;  5JHB A;  1Q5W B;  5LXI B;  3DVG Y;  1UEL A;  1KOT A;  3M3J A;  1PQS A;  2KMC A;  1WX7 A;  3T9L A;  4GDL B;  2DHZ A;  3KYC D;  4JL9 A;  5IA7 A;  3ZTC A;  4MGK E;  2L8J A;  2MBH A;  1SGH A;  3L0W B;  3PRZ A;  4B95 A;  5HKH A;  3UQA A;  1D3Z A;  2HJ8 A;  3DVN V;  2KNB A;  3DBS A;  3QIJ A;  2BF8 B;  2CS4 A;  4W9G A;  2NCN A;  1WIA A;  2KWU B;  1GUA B;  3HM3 A;  2IY0 B;  1P1A A;  1YX5 B;  4NJ7 A;  4DHZ E;  2M4N A;  3PHW B;  3WAP A;  2IO0 B;  3A9K A;  3VUW A;  3TL5 A;  3JW0 X;  1E8X A;  3PRM B;  3ZVV A;  4M8M A;  1WE7 A;  4B9K A;  1YIW A;  3QAR A;  4LDT B;  3NS8 A;  1OEY J;  2IYD B;  2N4F A;  4IUM B;  2DZI A;  4ZYN A;  3L08 A;  3A1Q A;  2NBW B;  4E74 A;  1GC7 A;  1V80 A;  1VCB A;  3V62 A;  2Z59 B;  2M17 A;  3GZN I;  4PYZ A;  4W9J A;  1WMH A;  2FCN A;  4W9F A;  3TMP B;  3V60 A;  4EEW A;  2FID A;  4HK2 A;  3ECI A;  4FUL A;  4ZRI A;  2D11 A;  2FCQ A;  3L10 B;  5E6O A;  4ZDV A;  3EHV A;  3K9P B;  4NAW A;  3RZF A;  4A3P A;  1UZX B;  3CMM B;  4FA6 A;  1E7U A;  2K8C A;  2N1V A;  2MCN B;  3AU5 A;  1RLF A;  1BT0 A;  4HJK A;  4MGI E;  5CHV C;  2DZM A;  2G45 B;  1Q0W B;  2C7H A;  2C7M B;  2JWZ A;  2KJR A;  2N9E B;  2NVU I;  3DBL I;  3PRP B;  4RM8 A;  1GNU A;  2FIF A;  1WXV A;  4A20 A;  4AJW A;  1R4N I;  1AAR A;  1HE8 A;  2IY1 B;  3D32 A;  2HTH A;  2DYO A;  4NQL B;  3P2B A;  4NY0 A;  1V5O A;  1ZW7 A;  1WXS A;  3VTW A;  1WGR A;  4FAD A;  2C7N B;  2LVP A;  4K7S A;  4FN2 A;  4KVG B;  4E3C A;  1WGY A;  1J19 A;  2GBN A;  3H7S A;  2O2V B;  4LJO B;  3QWZ B;  3RCZ A;  4AOF A;  4WWN A;  3DBH I;  2C60 A;  2JPH A;  1S1Q B;  2G3Q B;  3WIM A;  1V49 A;  2EMS A;  4LJP B;  3X0W A;  4EKU A;  2IO1 B;  3ZO5 B;  2RSU A;  2JZ3 B;  4KIK B;  3H9D A;  2NPT B;  1UBI A;  3L17 A;  1P3Q U;  2BYF A;  4DHZ B;  2G4S A;  2NBV B;  4AWJ A;  4XX5 A;  4M8N A;  4RMA A;  3PRE A;  4P7I A;  1MG8 A;  3OAW A;  2FNJ B;  2O6V A;  4KDL B;  2MBO A;  4MH0 E;  2NS5 A;  4PS7 A;  2LUE A;  2XEW A;  2KFK A;  1XT9 B;  4ZRJ A;  2G4D B;  2LJ5 A;  4W9D A;  1J8C A;  4IWP A;  3N3K B;  1LXD A;  3PV1 A;  4ICV A;  5TR5 A;  2MX2 A;  3PZD A;  5CHW A;  2CHW A;  2W9N A;  2JRI B;  3N30 A;  2UYZ B;  3DCG A;  4NNJ B;  4LCD E;  4F1S A;  2KKC A;  5L95 C;  1EUV B;  3MTN B;  1WJN A;  3A9J A;  4FLH A;  4BVU C;  4HWI B;  1L2N A;  2XK5 B;  4MJS A;  2EKE C;  5C1Z A;  3U7D A;  4IW0 A;  1WJ6 A;  2HD5 B;  3UIP B;  3W1Y A;  3ZKJ C;  1LQB A;  3PTF C;  1WMH B;  1L7Y A;  1WGD A;  1YD8 U;  3A33 B;  3WA0 A;  1E8Z A;  5AZG A;  4XC2 A;  1YX6 B;  1P0R A;  2GBR A;  3QAQ A;  3UQB A;  2KZR A;  3DVN U;  3EC8 A;  1NDD A;  4W9K A;  5JH5 C;  3TIX A;  2M1M A;  2L0F A;  2V1Y A;  2YLM A;  4ANV A;  2ZNV B;  2FAZ A;  1XQQ A;  3BIN A;  3K9O B;  3PLV A;  1CMX B;  4G11 A;  4NJ6 A;  2LVQ A;  4PYU A;  2RD0 A;  2QHO A;  3SD5 A;  5KHQ A;  4M0W B;  3U30 A;  2C5L C;  3S2A A;  4KV2 A;  4DDI D;  4HPM B;  3APF A;  3ENE A;  2N9P C;  2KJH B;  4BOZ B;  3ZNH B;  2KC2 A;  2JT4 B;  2RGF A;  3JSV B;  4IM3 A;  3U8Z A;  5DCN A;  1WJU A;  2KDF B;  3ZUN A;  3ZIM A;  3QK0 A;  4BOS C;  3CF6 E;  4WWP A;  2Z0E B;  1KM7 A;  4FJV B;  1WR6 E;  2CHZ A;  3ONS A;  2BKR B;  2WYQ A;  1E8W A;  2KQS A;  5AZH A;  2Z0D B;  2N1W A;  4ZRK A;  2DX5 B;  2L00 B;  4MGZ E;  4KZC A;  2KOX A;  3VTU A;  2WDT B;  3PPA A;  4WAA A;  2K8B A;  4GIV A;  4N9F 4;  4GGQ A;  4WQO B;  2VRR B;  4EZL A;  4BFR A;  2PJH A;  3O65 B;  3NZU A;  4HLE A;  2LXC A;  5J2R A;  3KUC B;  2BYE A;  5EDS A;  1UBQ A;  1UGM A;  1TTN A;  1WGH A;  3QJZ A;  1V81 A;  1KLV A;  3B08 A;  1SIF A;  1WJ4 A;  3ML8 A;  3H7P A;  4F7Z A;  1UD7 A;  1OTR B;  3DQV A;  3QHT A;  3RYT A;  3DVG X;  3H1U A;  2KX3 A;  3UGB B;  2V4L A;  3B0A A;  2GMI C;  4FHK A;  2BGF A;  2KDB A;  3DDC B;  2N7D A;  4W9H A;  3PGE A;  2IBI B;  3AXC A;  3L54 A;  3M95 A;  4HXD A;  1F9J A;  2L05 A;  5E6P A;  4E71 A;  3EFU A;  2J7Q B;  4MDK E;  2JF5 A;  1Z2M A;  2KWC A;  2DYM A;  4WWO A;  2KC1 A;  3NOB A;  2ZZP B;  4MSQ B;  5D7G A;  4CYE A;  4MM3 A;  4JQW C;  2REX A;  3C0R B;  2KWV B;  2LD9 A;  2MWS B;  4HCP B;  1I35 A;  1GC6 A;  3IHP C;  4MSM B;  5DPW A;  4ANU A;  1V86 A;  2A4Z A;  4II2 B;  3X23 A;  4F8C B;  2MQJ A;  3NZS A;  3LDZ E;  2JUO A;  3MHS D;  1WX8 A;  1E7V A;  1WI0 A;  4EOY A;  3A9J B;  4IM0 A;  4GDL A;  3QQ8 B;  2KQ7 A;  2D3G A;  1WFY A;  5J17 A;  2ZVN A;  4DXA B;  1R4M I;  2K1F A;  4MJS B;  1TZ1 A;  3CST A;  1OEY A;  1WF9 A;  5KHO A;  3IVF A;  2KJ6 A;  4WJP A;  4GU2 A;  2FUH B;  2MP2 B;  1EF1 A;  3L16 A;  4GXB A;  5G2N A;  1WM2 A;  3QA8 A;  2CHX A;  2KAN A;  2GBJ A;  2R2Q A;  2AYO B;  1WGG A;  4TUU A;  5C23 A;  2ZCB A;  3W1S A;  3PS6 A;  3UIN B;  2DZJ A;  3T8M A;  2UWQ A;  5JHA A;  3OJ4 B;  4WJO A;  2A5U A;  2WX0 A;  2L3Z A;  1RRB A;  2ZVO A;  2MW5 A;  2LI5 A;  4JGH B;  3Q3J A;  1V9J A;  2K25 A;  3PVL A;  5BO4 B;  3RZW C;  4DDG D;  2J0J A;  2L0T A;  1ISN A;  2KFJ A;  4G3X B;  4EZJ A;  5IAA C;  2J0M A;  2PE6 B;  3KH0 A;  1C1Y B;  4ASW C;  3IBE A;  3QC8 B;  3V61 A;  4DK5 A;  1P98 A;  3A9K B;  2OJR A;  3ZLZ A;  4G0N B;  4GOC A;  1KJT A;  3EEC A;  3SDL C;  1EF5 A;  5DPT A;  3Q3F A;  3WAN A;  2KO3 A;  1S3S G;  3TBL D;  2N9X A;  4DWF A;  3IFW B;  1WRD B;  4XZ4 A;  1H8C A;  2IO2 B;  3KYD D;  2R2O A;  3A1Q B;  3DOW A;  4BBN F;  2JY6 A;  3ZNI D;  4BKS A;  1I42 A;  4W9C A;  2M0X A;  2AWT A;  2DAF A;  3LJ3 A;  2FCM A;  3VFK A;  1G6J A;  2CU1 A;  4HCN B;  3W1S C;  4FJZ A;  4IC7 B;  4GSW A;  4K7W A;  4NPN A;  1WZ3 A;  2BPS A;  2C9W B;  3H7P B;  4MGY E;  1NI2 A;  1LFD A;  2B3A A;  1SE9 A;  4IWO A;  4X57 B;  3N32 A;  2WWZ A;  5D2M B;  4G50 A;  2DYB A;  3R7R A;  2MA9 B;  4MEL A;  4NAW B;  1OQY A;  3VDZ A;  2L76 A;  3TCA A;  4EZK A;  1NBF C;  2KTR A;  1WM3 A;  1QZE A;  2PE9 A;  4J6I A;  2ASQ A;  4NQK E;  1ZGU B;  2GOW A;  2O6V D;  3CSF A;  4GDK A;  1IYF A;  4HVB A;  1K8R B;  1OGW A;  2O2V A;  2M8S A;  3AUL A;  2KDI A;  3HK0 A;  3M63 B;  3RUL A;  1WX9 A;  1WXA A;  2JXX A;  3KVF B;  3ZNZ B;  2FCS A;  2I1K A;  1EO6 A;  1RFA A;  4IWQ A;  2K6Q A;  3KUD B;  4HDO A;  4BKT A;  2PEA A;  4IM2 A;  4KIK A;  4ANW A;  2ZPY A;  2NPT A;  2DZK A;  2KMA A;  1YJ1 A;  4BKS D;  2RR9 A;  4CO7 A;  5G55 A;  1E5W A;  4K81 A;  4PS8 A;  4JIO U;  4IG7 B;  1C3T A;  4EFO A;  2BWF A;  3JYU A;  2LGD A;  1P9D U;  2LZ6 A;  3WAO A;  2Y5B B;  2GBK A;  3V6E B;  2K8H A;  1Z5S B;  3JVZ X;  4DHJ D;  2J0K A;  1V5T A;  2MLB A;  3A4R A;  5GMV A;  2GBM A;  5DPS A;  1UH6 A;  3UF8 A;  1X1M A;  4RM9 A;  1WY8 A;  3AU4 A;  2JZZ A;  5CX3 A;  4JLC A;  5L83 A;  3NY5 A;  3NHE B;  4KSK C;  1IP9 A;  1WYW B;  1WR1 A;  4ICU A;  2XK5 A;  1YQB A;  2AEH A;  3VXW A;  3PSE B;  5LLI A;  4AJY B;  1FXT B;  2JRH A;  2LRU A;  1E8Y A;  3SU8 X;  2O6V B;  4I6N B;  4GB9 A;  3APD A;  4A3O A;  2KFK B;  4OVU A;  5LXH A;  1JRU A;  4BBN C;  4FJY A;  3TJP A;  2HE7 A;  2MRP A;  3R66 C;  3ZDT A;  3HHM A;  2K39 A;  3VQI A;  2MSE D;  1GJZ A;  1WZ0 A;  4HPL B;  5FR6 A;  4FBJ B;  3UIO B;  3M62 B;  4W9E A;  1WXM A;  4PS3 A;  2YVC A;  2LGX A;  3V6C B;  2KLG A;  2BWE S;  2JVC A;  1TGZ B;  1WH3 A;  4WJN A;  2LVO A;  4K7U A;  1GG3 A;  4FHJ A;  2ZJD A;  5D6J B;  3OJ3 A;  3ZRC A;  3JSV A;  1H4R A;  3R7Q A;  3VHT C;  2KK8 A;  4W9L A;  2LRW A;  5D94 A;  2DEN B;  3ML9 A;  2LGY A;  2NBU A;  3AI5 A;  3VVW B;  2IO3 B;  3ZDM C;  4DHJ B;  2KHW B;  2LXA A;  3L13 A;  2MBQ A;  4I6L B;  3ZRF A;  4MEM A;  4K1R B;  1ZKH A;  2KTR B;  2D2Q A;  4GMV A;  3RD2 A;  3VUX A;  4TQ1 A;  3PT2 B;  1TBE A;  2LAS A;  2PPH A;  2L7R A;  3H6N A;  4GDK B;  4BKG A;  3GOE A;  4KZ0 A;  2D07 B;  3R3M A;  5J18 A;  3HM6 X;  3ZW3 A;  3KW5 B;  3ALB A;  1Q1O A;  4CHK A;  2XBB C;  1J0G A;  1E90 A;  1V2Y A;  3MJW A;  2ZNV C;  1VD2 A;  2KDE B;  2I1J A;  2AL3 A;  2NR2 A;  3VUY A;  4EUT A;  1M94 A;  4TQ0 A;  4YL8 A;  3VH3 B;  2BKF A;  3DPD A;  2ZEQ A;  2DAJ A;  1LM8 B;  2K6D B;  2V3S A;  4II3 B;  3VAW A;  4AP4 C;  3KUZ A;  4KDI C;  2OOB B;  2ZPN A;  3BY4 B; 
#chains in the Genus database with same CATH topology
 2LWP A;  3P4P B;  4I6P A;  2KX0 A;  5E6N A;  3OLM D;  4WJQ A;  3WAL A;  1T0Y A;  5CHF A;  3V05 A;  5CTR C;  2MJE A;  3VTV A;  4LDT D;  1D5Z C;  1WRI A;  2MBB B;  4HRS A;  2KN5 A;  4JWU C;  3UI3 A;  1PUT A;  3APC A;  2WNM A;  1I4P A;  3VH4 B;  3PLU A;  2AQ3 B;  1L6U A;  4NZL B;  3IG3 A;  4TKN A;  5LXI B;  1KOT A;  5IA7 A;  5BYQ A;  2MBH A;  4XDD A;  5HKH A;  2CS4 A;  2NCN A;  2WXP A;  2AX5 A;  4NJ7 A;  2M4N A;  3Q8C A;  5GXG B;  3PHW B;  3JW0 X;  2DLB A;  2JZP A;  2ZW0 A;  3NS8 A;  2WGS A;  3NVZ A;  2NBW B;  1V80 A;  1DOI A;  1ZXI A;  4W9F A;  3V60 A;  3Q3O C;  3ECI A;  4FUL A;  3Q8B A;  2FCQ A;  3NS1 A;  4NAW A;  4HRO A;  3BII D;  4ITK A;  2N1V A;  3VRA B;  4RH6 A;  3EFC A;  1RLF A;  4WH4 A;  2G45 B;  1Q0W B;  3ZGZ A;  2FIF A;  3T3O A;  1R4N B;  1R4N I;  4LNO A;  1HE8 A;  2OHF A;  4NY0 A;  4HEA 1;  1WGR A;  2C7N B;  2LVP A;  1FCC C;  2GBN A;  3H7S A;  5MPO A;  3RCZ A;  2C60 A;  2RDB C;  1S1Q B;  4YXD B;  1V49 A;  1HZ5 A;  1TYG B;  3U52 E;  4KIK B;  2WU5 B;  3H9D A;  4RGM A;  2NPT B;  1UBI A;  2QJL A;  4YTP B;  1FD6 A;  1IGC A;  4M8N A;  3PRE A;  1I4R A;  3TEX A;  1J8C A;  2LJ5 A;  4W9D A;  3BYY B;  3P42 A;  2CHW A;  2W9N A;  3N30 A;  2UYZ B;  4NNJ B;  2KKC A;  1F0Z A;  3A9J A;  3AE2 B;  5BMG A;  3R8B A;  5C1Z A;  3U7D A;  3UIP B;  3W1Y A;  4C56 C;  2VH1 A;  1GB4 A;  2W54 A;  4HKZ E;  3UQB A;  4PK1 A;  4W9K A;  3TIX A;  2M1M A;  2L0F A;  2G1E A;  2FAZ A;  3K9O B;  1IBX A;  1CMX B;  5KHQ A;  4J3O D;  1ZPS A;  1SE2 A;  2KJH B;  4BOZ B;  3JSV B;  3P4S B;  4P16 A;  2WXI A;  5DCN A;  1L0V B;  3BVM A;  2KT7 A;  1P7F A;  3ONS A;  1VZ7 A;  2L83 A;  4ZRK A;  4YTN B;  1TJE A;  2K8B A;  1IUE A;  4HPP A;  5J2R A;  2LXC A;  2L1A A;  4WWM A;  1DGJ A;  3NJT A;  2VH2 A;  3QJZ A;  3Q3M C;  4ARC A;  1F1H A;  1KLV A;  4HJG E;  2IGH A;  3H7P A;  1UD7 A;  3DVG X;  2KX3 A;  3UGB B;  2BGF A;  2KDB A;  2N7D A;  3PGE A;  1N6Z A;  1F9J A;  4BZA A;  3EFU A;  2J7Q B;  2KWC A;  2KC1 A;  2ZZP B;  4CYE A;  4MM3 A;  2REX A;  1JWS D;  2KWV B;  1I35 A;  2HDE A;  4ANU A;  2N9L A;  3T3N A;  2A4Z A;  2MQJ A;  2KWD A;  1E10 A;  1ACC A;  1TKE A;  3P63 A;  3QQ8 B;  3U2S C;  1R4M B;  1R4M I;  2LJI A;  2BBC A;  1TZ1 A;  2KVZ A;  2KJ6 A;  1KRH A;  3AEA B;  3W5V B;  1SE3 A;  3L16 A;  1RM6 C;  2CHX A;  2RMM A;  2R2Q A;  5C23 A;  3W1S A;  5FKA C;  2JSV X;  4M01 A;  5JHA A;  4A90 A;  1C78 A;  2A5U A;  1RRB A;  2ZVO A;  2LI5 A;  1V9J A;  2K25 A;  3PVL A;  3RZW C;  4DDG D;  1DOX A;  3Q69 A;  1P7E A;  5IAA C;  2J0M A;  3B9J A;  3RFZ B;  2W3S A;  3QC8 B;  1P98 A;  3A9K B;  3BVG A;  4RNA A;  1KJT A;  1ROE A;  3SDL C;  1K50 A;  5DPT A;  3WAN A;  3DHH C;  2KO3 A;  4XZ4 A;  3Q6B A;  5HFY A;  3KYD D;  2JY6 A;  3ZNI D;  2M0X A;  3LJ3 A;  1AN8 A;  2C9W B;  2K3U A;  4IWO A;  3SFD B;  2B76 B;  3VDZ A;  1TS4 A;  4JE3 B;  1NBF C;  4REZ A;  1QZE A;  2PE9 A;  1GOZ A;  2GOW A;  2O6V D;  4HVB A;  1OGW A;  3AEF B;  3AUL A;  3HK0 A;  3RUL A;  1XLQ A;  2JXX A;  2Z8L A;  5HHD G;  1E0Z A;  3Q8E A;  4P6V F;  2PEA A;  3SFE B;  4KIK A;  2ZPY A;  2NPT A;  4CO7 A;  2WXN A;  4NAM A;  4EFO A;  2BWF A;  3WAO A;  2GBK A;  1FXA A;  1V5T A;  3AEE B;  2D3B A;  1C9F A;  5DPS A;  1X1M A;  3AU4 A;  4RF0 A;  3P4Q B;  3NHE B;  3ZQ4 A;  1WYW B;  4ICU A;  1QT9 A;  1YQB A;  2G9H D;  3AMZ A;  2JRH A;  2LRU A;  2D5G A;  3EA6 A;  3APD A;  4OVU A;  3RNG C;  4FJY A;  1HZ6 A;  3R66 C;  2MSE D;  1WXQ A;  1SEB D;  5FR6 A;  2PKO A;  4W9E A;  3CIR B;  2LGX A;  1EM7 A;  2KLG A;  4YWG G;  2QSD A;  4K7U A;  4FHJ A;  1AYF A;  1N62 A;  3JSV A;  1FEH A;  5D94 A;  3ML9 A;  2LGY A;  2JX5 A;  2PVG C;  1QF6 A;  3KQ4 A;  3U7Z A;  4DHJ B;  3L13 A;  4I6L B;  4K3B A;  2WXO A;  4MEM A;  4K1R B;  3MC8 A;  2KTR B;  4GMV A;  3RD2 A;  3VUX A;  1ZE3 D;  4TQ1 A;  1TBE A;  3H6N A;  1E6E B;  1L4Z B;  1WWT A;  4CHK A;  1IGD A;  1Q1O A;  1E90 A;  1V2Y A;  1T0S C;  2M56 B;  2I1J A;  1FMA D;  3VUY A;  3Q14 C;  4EUT A;  4YL8 A;  3VH3 B;  2ZEQ A;  2DAJ A;  2K6D B;  2I2Y A;  4KDI C;  2ZPN A;  4B0M A;  3QX1 A;  4WAF A;  3QCA A;  4ANX A;  2BS4 B;  3A4S C;  1V1P B;  3GE8 C;  2JYT A;  4AS1 A;  1WE6 A;  1QKZ A;  1J7B A;  4KSL C;  4L23 A;  5D3D A;  2WS3 B;  4K3C A;  4DBG A;  2ZCC A;  1RAX A;  3BVZ A;  2RPQ A;  3ZTD A;  2EMT A;  4KGT A;  2I38 A;  3B1L X;  1UEL A;  3BK1 A;  1PQS A;  2INN E;  4GDL B;  4JL9 A;  3FC4 A;  1K52 A;  3L0W B;  3PRZ A;  1D3Z A;  2HJ8 A;  2KNB A;  4W9G A;  1A70 A;  1WIA A;  1C79 A;  2EEL A;  1GUA B;  2KQ4 X;  3A9K A;  3VUW A;  3TL5 A;  1WE7 A;  1ESF A;  4B9K A;  3I57 A;  2N4F A;  3ZJV A;  3L08 A;  4E74 A;  3MC0 B;  2UU7 A;  3V62 A;  3MC9 A;  3GZN B;  3GZN I;  4PYZ A;  1E7P B;  3R2T A;  3EGR A;  4HK2 A;  2IGD A;  1KLG D;  2W55 A;  1TT5 B;  3EHV A;  2WLB A;  4A3P A;  1E7U A;  2IND C;  1FXI A;  2MCN B;  4MGI E;  4HJK A;  2C7H A;  2KJR A;  3RN9 C;  4RM8 A;  1VDV A;  4AJW A;  1FRR A;  3FIL B;  1AAR A;  2XNA C;  2K0P A;  4B0E A;  1V5O A;  1ZW7 A;  1WXS A;  3AH7 A;  4FN2 A;  3MHZ A;  4KVG B;  2V3N A;  4E3C A;  1J19 A;  2O2V B;  1PGX A;  1GPX A;  1YN3 A;  3TSS A;  1PYW D;  2JPH A;  3MP9 A;  2WXF A;  4D2K A;  1JAL A;  2X8X X;  2IO1 B;  1F2R C;  4XYC A;  1TS3 A;  1SB3 C;  1P3Q U;  3OWE B;  2BYF A;  5EE3 A;  3E56 A;  5IP4 D;  4AWJ A;  4EE2 A;  1DYQ A;  2E6X A;  2FNJ B;  2KYW A;  2MBO A;  4MH0 E;  2WDV B;  2VZK D;  4IWP A;  3PV1 A;  5TR5 A;  1YJJ A;  2JRI B;  3DCG A;  4F1S A;  1D5X C;  1WJN A;  3IAM 1;  4R3D A;  4BVU C;  2ONQ A;  4RCO A;  1LQB A;  3PTF C;  1WMH B;  1YD8 U;  3PZ7 A;  3A33 B;  3WA0 A;  1E8Z A;  5H92 C;  4C7Y A;  1YN4 A;  2KZR A;  4A55 A;  4ANV A;  3HVZ A;  4G11 A;  2RD0 A;  4M0W B;  2GB1 A;  4XGA B;  2C5L C;  3U30 A;  4OZC A;  4KV2 A;  3ZXV A;  4DDI D;  1HTO A;  1MJD A;  1UWX A;  5BYR A;  1WJU A;  5HG2 A;  3CF6 E;  2Z0E B;  1KM7 A;  2WYQ A;  2KQS A;  2N1W A;  2L00 B;  2KOX A;  1WGK A;  2BYT A;  4N9F 4;  3NZU A;  3GB1 A;  3VRB B;  3ETR A;  1VZ8 A;  1HXY D;  1UGM A;  1PGB A;  1V1P A;  1WJ4 A;  3ML8 A;  5T8I A;  1TIF A;  5IO9 A;  1OTR B;  3DQV A;  2V4L A;  2GMI C;  2SAK A;  4W9H A;  2FE8 A;  3M95 A;  1V8C A;  1Z2M A;  2W82 A;  4MSQ B;  1RFK A;  4JQW C;  1LGR A;  1M4V A;  3C0R B;  1VRA B;  2MJ3 A;  4WQM A;  2N7J A;  4MSM B;  4PT5 A;  4II2 B;  3ZJT A;  3BK2 A;  3NZS A;  1KTK A;  2H89 B;  2JUO A;  1WI0 A;  4EOY A;  1FCL A;  4GDL A;  2KQ7 A;  2ZVN A;  4DXA B;  2K1F A;  4MJS B;  2PLP A;  3P4R B;  1OEY A;  3IVF A;  4WJP A;  2MP2 B;  1EF1 A;  1VR9 A;  3QA8 A;  2R61 A;  4ARI A;  4TUU A;  2AYO B;  4RGN A;  3RI7 C;  1N63 A;  4C7Z A;  2BVC A;  1TKY A;  3UIN B;  2DZJ A;  3CWI A;  3T8M A;  5BYS A;  2MW5 A;  3Q3J A;  1D4B A;  1ISN A;  3KH0 A;  4MT5 A;  1C1Y B;  1BML C;  3IBE A;  3V61 A;  1NI3 A;  3B2F A;  3Q8A A;  1S3S G;  4TMA B;  4M00 A;  4YSY B;  1K53 A;  1H8C A;  2IO2 B;  3ZYY X;  2R2O A;  5BMI A;  4JPS A;  3DOW A;  4BBN F;  3MFG A;  4LLG M;  1QOA A;  3VFK A;  2FCM A;  1G6J A;  4DQO C;  3AEB B;  4FJZ A;  4K7W A;  2YEP F;  1XXG A;  4MGY E;  2LMC A;  1LFD A;  2B3A A;  4X57 B;  3FIL A;  3N32 A;  2WWZ A;  4G50 A;  1FPY A;  2MA9 B;  4MEL A;  1OQY A;  2D3A A;  2L76 A;  2WHI A;  4EZK A;  1WM3 A;  1F2R I;  1TS2 A;  5EE9 A;  2NMQ A;  4GDK A;  1K8R B;  2O2V A;  3SEB A;  1XLP A;  2KDI A;  1ET9 A;  1WX9 A;  1WXA A;  1YJI A;  3NVV A;  3KVF B;  2QDF A;  3AE1 B;  3ZNZ B;  1RFA A;  4IWQ A;  2INC C;  2K6Q A;  4S17 A;  4BKT A;  1T0Q C;  3DHG C;  4IM2 A;  1YNT E;  3W2D A;  4USA A;  2JWU A;  3JYU A;  1P9D U;  2PTL A;  4FXC A;  2Y5B B;  2K8H A;  3IT4 B;  2GI9 A;  2PVO D;  3EUB 2;  3URY A;  2JZZ A;  1OFF A;  1FFV A;  3E9S A;  1D6E C;  3AB5 A;  3VXW A;  3PSE B;  5LLI A;  1FXT B;  3KWV A;  4I6N B;  2WDQ B;  1FNW A;  2ICI A;  2IPK D;  3ZDT A;  3HHM A;  2DBY A;  2BS2 B;  2K39 A;  3VQI A;  1UGJ A;  4RFB A;  1GJZ A;  1WZ0 A;  2WXG A;  1AW7 A;  4C80 A;  1WXM A;  1V97 A;  3V6C B;  3Q2A C;  1F77 A;  2K5P A;  2QCZ A;  2ZJD A;  5D6J B;  3OJ3 A;  2AQ1 B;  3RNB C;  3RNE C;  3AI5 A;  2CJO A;  1UUP A;  3AN1 A;  3ZDM C;  1C76 A;  2L52 A;  1MHX A;  4S0R A;  1Q10 A;  2PPH A;  3GOE A;  3R3M A;  3HM6 X;  3ZW3 A;  3KW5 B;  5LNK 1;  3IT6 B;  2ZNV C;  1VD2 A;  2KDE B;  2NR2 A;  4IOI E;  4DXF A;  2PW9 A;  3PO0 A;  1YOV B;  4BAX A;  1ZDX A;  2BKF A;  2TSS A;  2L32 A;  2V3S A;  1ZDV A;  2OOB B;  1YQ4 B;  1C4P A;  1L4D B;  2WXR A;  3PHX B;  5AEK B;  1KF6 B;  4OVV A;  2QIE B;  2IZV B;  2KXJ A;  2BW2 A;  1J7C A;  2WX1 A;  1U4A A;  2KN4 A;  4B6W A;  2KLC A;  1ZXH A;  3DBR B;  3DBR I;  2CR5 A;  4W9I A;  1MI0 A;  2V0G A;  5DPR A;  4GN1 A;  3HIZ A;  4C4V B;  3ZNG C;  2KTF A;  1EWC A;  5AZF A;  4AUQ C;  4TV3 A;  2MP2 A;  1QQR A;  4HDQ A;  1V6E A;  1SXT A;  3RUI B;  1XLN A;  4URK A;  4N59 A;  1XD3 B;  3RT3 B;  5JHB A;  1Q5W B;  2FBW B;  3T9L A;  4N6E B;  2DHZ A;  2HTM E;  3AE3 B;  3ZTC A;  4B95 A;  3UQA A;  3DBS A;  1CQV A;  3QIJ A;  2BF8 B;  1JML A;  2CU3 A;  3WAP A;  2JQR B;  2VZK B;  1KLU D;  1YIW A;  3QAR A;  4LDT B;  4XWW A;  4IUM B;  2DZI A;  4OZB A;  4A8X C;  1SE4 A;  4LK0 M;  1VCB A;  2M17 A;  2ON8 A;  2RPV A;  4EEW A;  1UWM A;  4RGO S;  4ZRI A;  2D11 A;  1LO5 D;  1JWU D;  3L10 B;  4P1C C;  1OQR A;  4ZDV A;  3K9P B;  3KLS X;  1UZX B;  3CMM B;  4FA6 A;  4MH8 A;  2K8C A;  2WXL A;  4YSZ B;  5CHV C;  4A9A A;  2QC8 A;  4ZRP A;  3VR9 B;  4JX1 C;  3DBL B;  3DBL I;  3PRP B;  1GNU A;  1WXV A;  4A20 A;  4LNF A;  2QMT A;  2IY1 B;  3D32 A;  2HTH A;  5JXV A;  5H8Y E;  2K9X A;  4US9 A;  3W5U B;  4LJO B;  3QWZ B;  3N1X C;  4WWN A;  3DBH B;  3DBH I;  4AOF A;  2G3Q B;  3WIM A;  1FNV A;  1N5X A;  2EMS A;  4LJP B;  3X0W A;  4EKU A;  1WSP A;  3ZO5 B;  3L17 A;  4DHZ B;  2INP E;  4XX5 A;  3AEG B;  2JU6 X;  3AE4 B;  4KDL B;  4PS7 A;  4ZRJ A;  2LUE A;  2XEW A;  1XT9 B;  3KWL A;  1KFY B;  4ICV A;  2MX2 A;  5CHW A;  4LCD E;  3MTN B;  4HWI B;  1L2N A;  2XK5 B;  1AWD A;  2EKE C;  2WXQ A;  2GRI A;  4NJC A;  1FIQ A;  1F52 A;  1L7Y A;  2QEJ C;  1TKG A;  1P0R A;  2GBR A;  3H8H A;  3DVN U;  3EC8 A;  5JH5 C;  1EU3 A;  2YLM A;  2ZNV B;  2M19 A;  1XQQ A;  5G5H A;  4NJ6 A;  3SD5 A;  2QHO A;  1PFD A;  3S2A A;  2PIA A;  2JXT A;  1C77 A;  3OG5 A;  3V3X A;  3APF A;  4ZOH C;  2N9P C;  2KC2 A;  2JT4 B;  2RGF A;  3U8Z A;  1TS5 A;  3ZIM A;  3QK0 A;  4A6Q A;  4ZRQ A;  3L4P A;  1WR6 E;  2CHZ A;  3ZXR A;  5E6J A;  2DX5 B;  5IN7 A;  1SF0 A;  3IXS A;  2BB6 A;  4JWS C;  3VTU A;  2WDT B;  3FAH A;  4WQO B;  2VRR B;  4EZL A;  2PJH A;  3O65 B;  4HLE A;  1L5P A;  3N1Z C;  1SBB B;  1TTN A;  1V81 A;  3B08 A;  3QHT A;  3RYT A;  1ZUD 2;  4XWT A;  3B0A A;  2IBI B;  4E71 A;  4HXD A;  2L05 A;  4MDK E;  4C4V A;  2JF5 A;  3FKY A;  2KMM A;  3AEC B;  1XCT L;  2WXM A;  2LD9 A;  2MWS B;  4HCP B;  3IHP C;  3GE3 C;  1HTQ A;  1UF0 A;  1V86 A;  5AUI A;  3X23 A;  3B2G A;  4F8C B;  3LDZ E;  1NYQ A;  1E7V A;  3A9J B;  2WXH A;  1JRO A;  4IM0 A;  2NTT A;  2D3G A;  1T3Q A;  3CST A;  1WF9 A;  4GU2 A;  1NEK B;  2FUH B;  5HI1 A;  4GXB A;  2LEK A;  5G2N A;  2KAN A;  3O13 A;  1WGG A;  2ZCB A;  1CK1 A;  1T0R C;  1IBX B;  5IOI A;  2UWQ A;  4WJO A;  1FFU A;  2L3Z A;  2IJ0 A;  1BUI C;  4JGH B;  4KKI A;  5BO4 B;  2L0T A;  4G3X B;  2PE6 B;  4CQN A;  4O1N A;  3EEC A;  4M02 A;  3U4E G;  1EF5 A;  2X38 A;  1B9R A;  4OVZ A;  1WRD B;  2LHD A;  3NUH B;  3A1Q B;  4BKS A;  1I42 A;  2K22 A;  1SJE D;  2AWT A;  2DAF A;  5AUK A;  3SR6 A;  2CU1 A;  4IC7 B;  4GSW A;  3H7P B;  1ENF A;  3AE9 B;  5D2M B;  3R7R A;  2DYB A;  1J7A A;  1FNU A;  3BWU D;  2BTE A;  3TCA A;  2KTR A;  2BT6 A;  2ASQ A;  4NQK E;  1JWB D;  1ZGU B;  4MM3 B;  2LHE A;  2N0S B;  2MH7 A;  1L6V A;  5EE1 A;  1EO6 A;  3KUD B;  4HDO A;  4ANW A;  2DZK A;  1T5X D;  1YJ1 A;  4BKS D;  5G55 A;  4KKJ A;  1E5W A;  4PS8 A;  4JIO U;  2GLS A;  2BS3 B;  5FR3 A;  2WP9 B;  3V6E B;  5G5G A;  2DWQ A;  4DHJ D;  2J0K A;  2MLB A;  3A4R A;  5GMV A;  1UH6 A;  3NVW A;  4RM9 A;  4UDU C;  1WY8 A;  4JLC A;  2XN9 C;  1IP9 A;  1FO4 A;  2J53 A;  2XK5 A;  1JCK B;  1XF5 L;  2WXK A;  1MPE A;  2Y5C A;  4RF1 A;  4AJY B;  3SU8 X;  3RPF C;  3N1Y C;  2O6V B;  4GB9 A;  4GLS C;  2KFK B;  5LXH A;  4BBN C;  2HE7 A;  1I7H A;  2MRP A;  4KGR A;  4HPL B;  3UIO B;  5TSS A;  1XO3 A;  2JVC A;  4L1B A;  4KGS A;  3ABV B;  4C00 A;  4WJN A;  2EKI A;  2LVO A;  1GG3 A;  2IGG A;  1H4R A;  3R7Q A;  2RDG A;  2KK8 A;  2LRW A;  2KAJ A;  2DEN B;  2SEB D;  3VVW B;  2IO3 B;  1KH0 A;  2J4X A;  2KHW B;  2LXA A;  2MBQ A;  2IDY A;  1R7S A;  2D2Q A;  2WXJ A;  1SJH D;  3PT2 B;  2LAS A;  2L7R A;  3NRZ A;  4KZ0 A;  5J18 A;  3MJW A;  1M94 A;  4TQ0 A;  4N58 A;  3DPD A;  3RNC C;  1LM8 B;  4AP4 C;  3VAW A;  3KUZ A;  4OZA A;  4HKQ A;  2Z0D B;  1YQ3 B;  2V3P A;  3BY4 B;  4RGT A;  1A5R A;  1IPG A;  2KVR A;  2AL6 A;  1DOY A;  1HA5 A;  3SHQ A;  1MFW A;  3AE7 B;  3TEY A;  4IKG A;  2MBE A;  2BQQ A;  4YSX B;  1Y8R C;  2BYV E;  2PMV A;  3I3T B;  4P1B C;  5JZE B;  2J52 A;  2KAC A;  3N20 C;  3WAM A;  1EU4 A;  2CKH B;  2N7E A;  1HEZ E;  2D10 A;  1N61 A;  1YMH E;  2KD0 A;  3GS2 A;  3DVG Y;  1PDX A;  4Q2J A;  3M3J A;  2KDM A;  2KMC A;  1WX7 A;  2DNF A;  3RNF C;  3KYC D;  4MGK E;  2L8J A;  1SGH A;  3DVN V;  3NZ3 A;  1I4H A;  2KWU B;  3HM3 A;  2IY0 B;  1P1A A;  1YX5 B;  4DHZ E;  2IO0 B;  2CJN A;  1MVK A;  1EWY C;  2LUM A;  1E8X A;  1VJK A;  3C19 A;  3HUI A;  3PRM B;  4M8M A;  1ZOY B;  3ZVV A;  1BXT A;  1TY0 A;  3I5J C;  4LNN A;  1WYG A;  2ACZ B;  1OEY J;  1JW9 D;  2IYD B;  4ZYN A;  3A1Q A;  1GC7 A;  2Z59 B;  4W9J A;  1WMH A;  2FCN A;  1I4Q A;  3J9C A;  3TMP B;  2FID A;  4XDC A;  2MJD A;  5E6O A;  1N5W A;  3RZF A;  3WCQ A;  4M0W A;  5IKC M;  3AU5 A;  1BT0 A;  2NTS A;  2DZM A;  4ZHO A;  1L0Y B;  2C7M B;  2JWZ A;  3TEW A;  2N9E B;  2NVU I;  3VR8 B;  1FM0 D;  3MJ5 A;  4QAY A;  3NG0 A;  2DYO A;  4NQL B;  3P2B A;  3N9Y C;  3LYY A;  3VTW A;  3PZ8 A;  4FAD A;  4K7S A;  1RWS A;  2FUG 1;  1WGY A;  2WDR B;  3DWG C;  1RYJ A;  3I9V 1;  2RSU A;  2H88 B;  2JZ3 B;  4LNK A;  2N9K A;  2HJ1 A;  2YEP B;  2G4S A;  2NBV B;  4MAC A;  4RMA A;  4P7I A;  1MG8 A;  3OAW A;  2O6V A;  2NS5 A;  2KFK A;  2G4D B;  3N3K B;  1LXD A;  3PZD A;  1QLB B;  3RNA C;  5L95 C;  1EUV B;  3AE8 B;  4FLH A;  4MJS A;  2OED A;  5C3J B;  1TZO A;  1WJ6 A;  2HD5 B;  4IW0 A;  1QOB A;  3ZKJ C;  1WGD A;  5AZG A;  4XC2 A;  1YX6 B;  3QAQ A;  1NDD A;  1I4X A;  1MHH E;  2V1Y A;  3BIN A;  3PLV A;  4PYU A;  2LVQ A;  1JQ4 A;  4WUR A;  1K51 A;  2WU2 B;  3ENE A;  2ZW1 A;  4HPM B;  3LXF A;  3LB8 C;  3ZNH B;  4IM3 A;  2KDF B;  3ZUN A;  4BOS C;  4WWP A;  4FJV B;  2BKR B;  1E8W A;  5AZH A;  3DWM A;  4OW0 A;  2AQ2 B;  4MGZ E;  4KZC A;  3DHI C;  4H2A A;  3PPA A;  1XCQ L;  4WAA A;  4GIV A;  4L2Y A;  4GGQ A;  2M0A A;  5EE0 A;  4BFR A;  5C2T B;  3KUC B;  2BYE A;  5EDS A;  1UBQ A;  1WGH A;  1SIF A;  1NVI D;  3AE6 B;  4F7Z A;  3H1U A;  1VZ6 A;  4FHK A;  3DDC B;  3AXC A;  3L54 A;  5E6P A;  2DYM A;  4WWO A;  3NOB A;  5D7G A;  1QOF A;  1GAQ B;  2Y5P A;  4AQ7 A;  1GC6 A;  5DPW A;  1UNS A;  3TEZ A;  4TSS A;  2LGS A;  4OHJ A;  3MHS D;  1WX8 A;  2D3C A;  3C8Y A;  1WFY A;  5J17 A;  3BZD B;  3AED B;  1NYR A;  1OQQ A;  5KHO A;  2V9H A;  1WM2 A;  2GBJ A;  3PS6 A;  1MG4 A;  1NEN B;  3OJ4 B;  2WX0 A;  2J0J A;  2RDH A;  2KFJ A;  4EZJ A;  4ASW C;  3HVD A;  4DK5 A;  3ZLZ A;  1JRP A;  2OJR A;  1SIJ A;  4G0N B;  4GOC A;  1TY2 A;  3Q3F A;  1XEE A;  1JWM D;  3TBL D;  2N9X A;  4DWF A;  3IFW B;  2E3T A;  2LFI A;  2QIL A;  4W9C A;  2BB5 A;  3AV8 A;  4HCN B;  4WIP A;  3GP7 A;  3W1S C;  1C4A A;  1WZ3 A;  2BPS A;  4NPN A;  1NI2 A;  1SE9 A;  3RMK C;  1FRD A;  1XLO A;  4NAW B;  1VLB A;  1ZP0 B;  3W9C B;  4J6I A;  3BYT B;  3CSF A;  2J42 A;  2M8S A;  3ZJU A;  3M63 B;  4LNI A;  2FCS A;  1CJE A;  2I1K A;  1HQR D;  2KMA A;  2RR9 A;  1PGA A;  2V4I B;  4LTU A;  2OJW A;  1QOG A;  4K81 A;  5D3I B;  4IG7 B;  5FK9 C;  1C3T A;  1C4C A;  2LGD A;  2LZ6 A;  1B1Z A;  1Z5S B;  3JVZ X;  1JWA D;  2GBM A;  3UF8 A;  5BMH A;  2Q5W D;  5CX3 A;  5L83 A;  1V1O A;  3NY5 A;  4KSK C;  1WR1 A;  1STE A;  3HRD D;  4KX6 B;  1QIL A;  1I4G A;  2AEH A;  2MHJ A;  3AE5 B;  3TUO A;  1E8Y A;  4ZYS A;  1T6B X;  4A3O A;  1JRU A;  3Q3N C;  3TJP A;  4ACF A;  1ET6 A;  1D5M C;  5I4D A;  1E9M A;  4FBJ B;  3M62 B;  1L0X B;  4PS3 A;  2YVC A;  2BWE S;  1TGZ B;  1WH3 A;  3NVY A;  1SSN A;  4DXG A;  2MEK A;  4XE0 A;  1CZP A;  3IAS 1;  3ZRC A;  3VHT C;  2LGI A;  2JYE A;  4W9L A;  2NBU A;  1N60 A;  3R2I A;  3I63 C;  3ZRF A;  2W3R A;  1ZKH A;  4YTM B;  2Y3A A;  4YT0 B;  1Y56 A;  4GDK B;  4BKG A;  2D07 B;  3ALB A;  2XBB C;  1J0G A;  2AL3 A;  3P1M A;  4US8 A;  2WQY B;  4ZHP A;  3Q8F A;  4IDI A;  1GB1 A;  1YN5 A;  3AM9 A;  4II3 B;  1IYF A; 
#chains in the Genus database with same CATH homology
 2LWP A;  3QX1 A;  3PHX B;  5AEK B;  4I6P A;  2KX0 A;  3QCA A;  4OVV A;  1A5R A;  1IPG A;  5E6N A;  3OLM D;  4ANX A;  4WJQ A;  3WAL A;  1T0Y A;  2KVR A;  2IZV B;  2AL6 A;  3A4S C;  5CHF A;  2KXJ A;  3SHQ A;  5CTR C;  1WE6 A;  2WX1 A;  1U4A A;  4B6W A;  2KLC A;  4KSL C;  3DBR I;  2CR5 A;  4W9I A;  3VTV A;  4LDT D;  2MBE A;  2MBB B;  1Y8R C;  4DBG A;  5DPR A;  2ZCC A;  2BYV E;  4GN1 A;  1RAX A;  3I3T B;  2KN5 A;  5JZE B;  3HIZ A;  3ZNG C;  3WAM A;  3APC A;  2RPQ A;  3VH4 B;  2CKH B;  2KTF A;  3PLU A;  2N7E A;  5AZF A;  4AUQ C;  4TV3 A;  2MP2 A;  2D10 A;  4HDQ A;  1V6E A;  2KD0 A;  3ZTD A;  3IG3 A;  3RUI B;  2EMT A;  4TKN A;  4URK A;  1XD3 B;  3RT3 B;  3B1L X;  5JHB A;  1Q5W B;  5LXI B;  3DVG Y;  1UEL A;  1KOT A;  3M3J A;  1PQS A;  2KMC A;  1WX7 A;  3T9L A;  4GDL B;  2DHZ A;  3KYC D;  4JL9 A;  5IA7 A;  3ZTC A;  4MGK E;  2L8J A;  2MBH A;  1SGH A;  3L0W B;  3PRZ A;  4B95 A;  5HKH A;  3UQA A;  1D3Z A;  2HJ8 A;  3DVN V;  2KNB A;  3DBS A;  3QIJ A;  2BF8 B;  2CS4 A;  4W9G A;  2NCN A;  1WIA A;  2KWU B;  1GUA B;  3HM3 A;  2IY0 B;  1P1A A;  1YX5 B;  4NJ7 A;  4DHZ E;  2M4N A;  3PHW B;  3WAP A;  2IO0 B;  3A9K A;  3VUW A;  3TL5 A;  3JW0 X;  1E8X A;  3PRM B;  3ZVV A;  4M8M A;  1WE7 A;  4B9K A;  1YIW A;  3QAR A;  4LDT B;  3NS8 A;  1OEY J;  2IYD B;  2N4F A;  4IUM B;  2DZI A;  4ZYN A;  3L08 A;  3A1Q A;  2NBW B;  4E74 A;  1GC7 A;  1V80 A;  1VCB A;  3V62 A;  2Z59 B;  2M17 A;  3GZN I;  4PYZ A;  4W9J A;  1WMH A;  2FCN A;  4W9F A;  3TMP B;  3V60 A;  4EEW A;  2FID A;  4HK2 A;  3ECI A;  4FUL A;  4ZRI A;  2D11 A;  2FCQ A;  3L10 B;  5E6O A;  4ZDV A;  3EHV A;  3K9P B;  4NAW A;  3RZF A;  4A3P A;  1UZX B;  3CMM B;  4FA6 A;  1E7U A;  2K8C A;  2N1V A;  2MCN B;  3AU5 A;  1RLF A;  1BT0 A;  4HJK A;  4MGI E;  5CHV C;  2DZM A;  2G45 B;  1Q0W B;  2C7H A;  2C7M B;  2JWZ A;  2KJR A;  2N9E B;  2NVU I;  3DBL I;  3PRP B;  4RM8 A;  1GNU A;  2FIF A;  1WXV A;  4A20 A;  4AJW A;  1R4N I;  1AAR A;  1HE8 A;  2IY1 B;  3D32 A;  2HTH A;  2DYO A;  4NQL B;  3P2B A;  4NY0 A;  1V5O A;  1ZW7 A;  1WXS A;  3VTW A;  1WGR A;  4FAD A;  2C7N B;  2LVP A;  4K7S A;  4FN2 A;  4KVG B;  4E3C A;  1WGY A;  1J19 A;  2GBN A;  3H7S A;  2O2V B;  4LJO B;  3QWZ B;  3RCZ A;  4AOF A;  4WWN A;  3DBH I;  2C60 A;  2JPH A;  1S1Q B;  2G3Q B;  3WIM A;  1V49 A;  2EMS A;  4LJP B;  3X0W A;  4EKU A;  2IO1 B;  3ZO5 B;  2RSU A;  2JZ3 B;  4KIK B;  3H9D A;  2NPT B;  1UBI A;  3L17 A;  1P3Q U;  2BYF A;  4DHZ B;  2G4S A;  2NBV B;  4AWJ A;  4XX5 A;  4M8N A;  4RMA A;  3PRE A;  4P7I A;  1MG8 A;  3OAW A;  2FNJ B;  2O6V A;  4KDL B;  2MBO A;  4MH0 E;  2NS5 A;  4PS7 A;  2LUE A;  2XEW A;  2KFK A;  1XT9 B;  4ZRJ A;  2G4D B;  2LJ5 A;  4W9D A;  1J8C A;  4IWP A;  3N3K B;  1LXD A;  3PV1 A;  4ICV A;  5TR5 A;  2MX2 A;  3PZD A;  5CHW A;  2CHW A;  2W9N A;  2JRI B;  3N30 A;  2UYZ B;  3DCG A;  4NNJ B;  4LCD E;  4F1S A;  2KKC A;  5L95 C;  1EUV B;  3MTN B;  1WJN A;  3A9J A;  4FLH A;  4BVU C;  4HWI B;  1L2N A;  2XK5 B;  4MJS A;  2EKE C;  5C1Z A;  3U7D A;  4IW0 A;  1WJ6 A;  2HD5 B;  3UIP B;  3W1Y A;  3ZKJ C;  1LQB A;  3PTF C;  1WMH B;  1L7Y A;  1WGD A;  1YD8 U;  3A33 B;  3WA0 A;  1E8Z A;  5AZG A;  4XC2 A;  1YX6 B;  1P0R A;  2GBR A;  3QAQ A;  3UQB A;  2KZR A;  3DVN U;  3EC8 A;  1NDD A;  4W9K A;  5JH5 C;  3TIX A;  2M1M A;  2L0F A;  2V1Y A;  2YLM A;  4ANV A;  2ZNV B;  2FAZ A;  1XQQ A;  3BIN A;  3K9O B;  3PLV A;  1CMX B;  4G11 A;  4NJ6 A;  2LVQ A;  4PYU A;  2RD0 A;  2QHO A;  3SD5 A;  5KHQ A;  4M0W B;  3U30 A;  2C5L C;  3S2A A;  4KV2 A;  4DDI D;  4HPM B;  3APF A;  3ENE A;  2N9P C;  2KJH B;  4BOZ B;  3ZNH B;  2KC2 A;  2JT4 B;  2RGF A;  3JSV B;  4IM3 A;  3U8Z A;  5DCN A;  1WJU A;  2KDF B;  3ZUN A;  3ZIM A;  3QK0 A;  4BOS C;  3CF6 E;  4WWP A;  2Z0E B;  1KM7 A;  4FJV B;  1WR6 E;  2CHZ A;  3ONS A;  2BKR B;  2WYQ A;  1E8W A;  2KQS A;  5AZH A;  2Z0D B;  2N1W A;  4ZRK A;  2DX5 B;  2L00 B;  4MGZ E;  4KZC A;  2KOX A;  3VTU A;  2WDT B;  3PPA A;  4WAA A;  2K8B A;  4GIV A;  4N9F 4;  4GGQ A;  4WQO B;  2VRR B;  4EZL A;  4BFR A;  2PJH A;  3O65 B;  3NZU A;  4HLE A;  2LXC A;  5J2R A;  3KUC B;  2BYE A;  5EDS A;  1UBQ A;  1UGM A;  1TTN A;  1WGH A;  3QJZ A;  1V81 A;  1KLV A;  3B08 A;  1SIF A;  1WJ4 A;  3ML8 A;  3H7P A;  4F7Z A;  1UD7 A;  1OTR B;  3DQV A;  3QHT A;  3RYT A;  3DVG X;  3H1U A;  2KX3 A;  3UGB B;  2V4L A;  3B0A A;  2GMI C;  4FHK A;  2BGF A;  2KDB A;  3DDC B;  2N7D A;  4W9H A;  3PGE A;  2IBI B;  3AXC A;  3L54 A;  3M95 A;  4HXD A;  1F9J A;  2L05 A;  5E6P A;  4E71 A;  3EFU A;  2J7Q B;  4MDK E;  2JF5 A;  1Z2M A;  2KWC A;  2DYM A;  4WWO A;  2KC1 A;  3NOB A;  2ZZP B;  4MSQ B;  5D7G A;  4CYE A;  4MM3 A;  4JQW C;  2REX A;  3C0R B;  2KWV B;  2LD9 A;  2MWS B;  4HCP B;  1I35 A;  1GC6 A;  3IHP C;  4MSM B;  5DPW A;  4ANU A;  1V86 A;  2A4Z A;  4II2 B;  3X23 A;  4F8C B;  2MQJ A;  3NZS A;  3LDZ E;  2JUO A;  3MHS D;  1WX8 A;  1E7V A;  1WI0 A;  4EOY A;  3A9J B;  4IM0 A;  4GDL A;  3QQ8 B;  2KQ7 A;  2D3G A;  1WFY A;  5J17 A;  2ZVN A;  4DXA B;  1R4M I;  2K1F A;  4MJS B;  1TZ1 A;  3CST A;  1OEY A;  1WF9 A;  5KHO A;  3IVF A;  2KJ6 A;  4WJP A;  4GU2 A;  2FUH B;  2MP2 B;  1EF1 A;  3L16 A;  4GXB A;  5G2N A;  1WM2 A;  3QA8 A;  2CHX A;  2KAN A;  2GBJ A;  2R2Q A;  2AYO B;  1WGG A;  4TUU A;  5C23 A;  2ZCB A;  3W1S A;  3PS6 A;  3UIN B;  2DZJ A;  3T8M A;  2UWQ A;  5JHA A;  3OJ4 B;  4WJO A;  2A5U A;  2WX0 A;  2L3Z A;  1RRB A;  2ZVO A;  2MW5 A;  2LI5 A;  4JGH B;  3Q3J A;  1V9J A;  2K25 A;  3PVL A;  5BO4 B;  3RZW C;  4DDG D;  2J0J A;  2L0T A;  1ISN A;  2KFJ A;  4G3X B;  4EZJ A;  5IAA C;  2J0M A;  2PE6 B;  3KH0 A;  1C1Y B;  4ASW C;  3IBE A;  3QC8 B;  3V61 A;  4DK5 A;  1P98 A;  3A9K B;  2OJR A;  3ZLZ A;  4G0N B;  4GOC A;  1KJT A;  3EEC A;  3SDL C;  1EF5 A;  5DPT A;  3Q3F A;  3WAN A;  2KO3 A;  1S3S G;  3TBL D;  2N9X A;  4DWF A;  3IFW B;  1WRD B;  4XZ4 A;  1H8C A;  2IO2 B;  3KYD D;  2R2O A;  3A1Q B;  3DOW A;  4BBN F;  2JY6 A;  3ZNI D;  4BKS A;  1I42 A;  4W9C A;  2M0X A;  2AWT A;  2DAF A;  3LJ3 A;  2FCM A;  3VFK A;  1G6J A;  2CU1 A;  4HCN B;  3W1S C;  4FJZ A;  4IC7 B;  4GSW A;  4K7W A;  4NPN A;  1WZ3 A;  2BPS A;  2C9W B;  3H7P B;  4MGY E;  1NI2 A;  1LFD A;  2B3A A;  1SE9 A;  4IWO A;  4X57 B;  3N32 A;  2WWZ A;  5D2M B;  4G50 A;  2DYB A;  3R7R A;  2MA9 B;  4MEL A;  4NAW B;  1OQY A;  3VDZ A;  2L76 A;  3TCA A;  4EZK A;  1NBF C;  2KTR A;  1WM3 A;  1QZE A;  2PE9 A;  4J6I A;  2ASQ A;  4NQK E;  1ZGU B;  2GOW A;  2O6V D;  3CSF A;  4GDK A;  1IYF A;  4HVB A;  1K8R B;  1OGW A;  2O2V A;  2M8S A;  3AUL A;  2KDI A;  3HK0 A;  3M63 B;  3RUL A;  1WX9 A;  1WXA A;  2JXX A;  3KVF B;  3ZNZ B;  2FCS A;  2I1K A;  1EO6 A;  1RFA A;  4IWQ A;  2K6Q A;  3KUD B;  4HDO A;  4BKT A;  2PEA A;  4IM2 A;  4KIK A;  4ANW A;  2ZPY A;  2NPT A;  2DZK A;  2KMA A;  1YJ1 A;  4BKS D;  2RR9 A;  4CO7 A;  5G55 A;  1E5W A;  4K81 A;  4PS8 A;  4JIO U;  4IG7 B;  1C3T A;  4EFO A;  2BWF A;  3JYU A;  2LGD A;  1P9D U;  2LZ6 A;  3WAO A;  2Y5B B;  2GBK A;  3V6E B;  2K8H A;  1Z5S B;  3JVZ X;  4DHJ D;  2J0K A;  1V5T A;  2MLB A;  3A4R A;  5GMV A;  2GBM A;  5DPS A;  1UH6 A;  3UF8 A;  1X1M A;  4RM9 A;  1WY8 A;  3AU4 A;  2JZZ A;  5CX3 A;  4JLC A;  5L83 A;  3NY5 A;  3NHE B;  4KSK C;  1IP9 A;  1WYW B;  1WR1 A;  4ICU A;  2XK5 A;  1YQB A;  2AEH A;  3VXW A;  3PSE B;  5LLI A;  4AJY B;  1FXT B;  2JRH A;  2LRU A;  1E8Y A;  3SU8 X;  2O6V B;  4I6N B;  4GB9 A;  3APD A;  4A3O A;  2KFK B;  4OVU A;  5LXH A;  1JRU A;  4BBN C;  4FJY A;  3TJP A;  2HE7 A;  2MRP A;  3R66 C;  3ZDT A;  3HHM A;  2K39 A;  3VQI A;  2MSE D;  1GJZ A;  1WZ0 A;  4HPL B;  5FR6 A;  4FBJ B;  3UIO B;  3M62 B;  4W9E A;  1WXM A;  4PS3 A;  2YVC A;  2LGX A;  3V6C B;  2KLG A;  2BWE S;  2JVC A;  1TGZ B;  1WH3 A;  4WJN A;  2LVO A;  4K7U A;  1GG3 A;  4FHJ A;  2ZJD A;  5D6J B;  3OJ3 A;  3ZRC A;  3JSV A;  1H4R A;  3R7Q A;  3VHT C;  2KK8 A;  4W9L A;  2LRW A;  5D94 A;  2DEN B;  3ML9 A;  2LGY A;  2NBU A;  3AI5 A;  3VVW B;  2IO3 B;  3ZDM C;  4DHJ B;  2KHW B;  2LXA A;  3L13 A;  2MBQ A;  4I6L B;  3ZRF A;  4MEM A;  4K1R B;  1ZKH A;  2KTR B;  2D2Q A;  4GMV A;  3RD2 A;  3VUX A;  4TQ1 A;  3PT2 B;  1TBE A;  2LAS A;  2PPH A;  2L7R A;  3H6N A;  4GDK B;  4BKG A;  3GOE A;  4KZ0 A;  2D07 B;  3R3M A;  5J18 A;  3HM6 X;  3ZW3 A;  3KW5 B;  3ALB A;  1Q1O A;  4CHK A;  2XBB C;  1J0G A;  1E90 A;  1V2Y A;  3MJW A;  2ZNV C;  1VD2 A;  2KDE B;  2I1J A;  2AL3 A;  2NR2 A;  3VUY A;  4EUT A;  1M94 A;  4TQ0 A;  4YL8 A;  3VH3 B;  2BKF A;  3DPD A;  2ZEQ A;  2DAJ A;  1LM8 B;  2K6D B;  2V3S A;  4II3 B;  3VAW A;  4AP4 C;  3KUZ A;  4KDI C;  2OOB B;  2ZPN A;  3BY4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...