1HZ6A

Crystal structures of the b1 domain of protein l from peptostreptococcus magnus with a tyrosine to tryptophan substitution
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
67
structure length
67
Chain Sequence
HHAMEEVTIKANLIFANGSTQTAEFKGTFEKATSEAYAYADTLKKDNGEWTVDVADKGYTLNIKFAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the B1 domain of protein L from Peptostreptococcus magnus with a tyrosine to tryptophan substitution.
pubmed doi rcsb
source organism Finegoldia magna
molecule tags Protein binding
molecule keywords PROTEIN L
total genus 17
structure length 67
sequence length 67
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2001-01-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1hz6A00
1YMHE 2I38A 2N9KA 2IGGA 2N9LA 4OZAA 2IGHA 2PTLA 5HFYA 1JMLA 4KGTA 2LUMA 2RPVA 1XF5L 2JWUA 4KGRA 1MVKA 1PGXA 2QSDA 1K52A 1HZ6A 1P7EA 1D4BA 1ZXHA 2KN4A 2GI9A 1FCLA 1HEZE 2ONQA 5HHDG 1PGAA 2OEDA 1C9FA 2KWDA 4IOIE 4GLSC 3MP9A 2KACA 1YNTE 2J52A 2ZW0A 4IKGA 2ON8A 1IBXA 2JU6X 1MHHE 2KQ4X 2J53A 2EELA 5BMGA 1FCCC 3UI3A 2IGDA 1K53A 2NMQA 1GB4A 5JXVA 2LHEA 3FILB 3FILA 4OZBA 1FD6A 2QMTA 1PGBA 1MPEA 4OZCA 2I2YA 1HZ5A 5HI1A 1QKZA 5BMIA 1UWXA 2PW9A 1XCTL 1F2RI 2PLPA 4HKZE 3V3XA 1F2RC 2LGIA 2N7JA 4D2KA 5BMHA 1MI0A 5HG2A 2JXTA 4KGSA 1IBXB 1IGCA 1GB1A 4WH4A 1XCQL 2KDMA 1MHXA 1IGDA 3GB1A 4HJGE 2K0PA 1Q10A 2LHDA 1K50A 1KH0A 2JZPA 2JSVX 2GB1A 2RMMA 4MACA 1K51A 1P7FA 2ZW1A 1EM7A
chains in the Genus database with same CATH superfamily
1JWBD 1E7PB 2L3ZA 2I38A 3R66C 2KJ6A 3AN1A 1XLPA 2IPKD 4GSWA 5DPRA 4ANXA 2IO2B 4KGRA 1UUPA 1OTRB 1V86A 4REZA 2JWZA 2INPE 1KLUD 2Y3AA 2L0FA 3R8BA 3SHQA 3W1YA 4JWUC 1KM7A 2Q5WD 1Z2MA 4BKGA 2MJ3A 1PGAA 2OEDA 3VTWA 3BYTB 4WWMA 1FXTB 1TS3A 3V05A 4FN2A 2WNMA 1GNUA 2ZW0A 1WXAA 1XLNA 3C0RB 3AEAB 2MSED 3GOEA 4W9HA 4TV3A 3DBHB 2MBEA 4XWTA 3LB8C 3DBRB 1WXVA 4LK0M 2C5LC 1SEBD 1JWAD 1LM8B 2CJNA 5BMGA 1E5WA 2WYQA 3H8HA 3IG3A 4M0WB 4OZBA 3Q8AA 4KZCA 3ZGZA 2REXA 3NG0A 3NRZA 3UINB 1PUTA 4F7ZA 2RR9A 2L1AA 3BWUD 5D7GA 3LYYA 4YSXB 5BMHA 1MI0A 3N1YC 3KLSX 2JXTA 1RM6C 4IWQA 4GB9A 2G3QB 3ETRA 4LJOB 4I6NB 2MP2A 1EWYC 1WJNA 2JQRB 3VRBB 4JGHB 1K50A 2VZKB 3JSVA 3IAM1 2M19A 4PK1A 2LASA 4B9KA 4ZRJA 3VDZA 2L05A 3QK0A 3RD2A 3U7DA 1TJEA 4H2AA 4KGTA 4BOZB 4WAFA 4NZLB 2KN5A 3UQAA 3RI7C 4G0NB 5BYQA 3QC8B 1QQRA 2DYBA 3MC9A 4LCDE 3P4QB 4YT0B 3A9JA 1WYWB 2RDGA 4F8CB 3ALBA 1WX9A 2PIAA 2KK8A 2K22A 4W9KA 3IAS1 2BB5A 2K6QA 1HQRD 4RGOS 2AYOB 2KACA 3A33B 2N0SB 1P3QU 2V1YA 2LJIA 2LVOA 2WWZA 1YN5A 2QC8A 3QAQA 3OG5A 2NBWB 1WY8A 2IZVB 2D10A 3ZO5B 4LTUA 2BKFA 3ZXRA 2WXOA 1FXIA 1SIJA 5D6JB 3ZUNA 1KRHA 2GBKA 1WZ3A 2O2VA 4DK5A 2BQQA 4MELA 3I3TB 4W9IA 1E10A 3MC8A 3MTNB 1VZ7A 2KWUB 2W55A 2CR5A 1I35A 3CF6E 1F2RC 4KIKA 4FADA 3NZ3A 4NNJB 4XDCA 2N9XA 2G9HD 3JVZX 5KHQA 4KZ0A 4JL9A 2KKCA 2CS4A 3GB1A 5JHBA 1YX6B 2G1EA 1SXTA 3NVWA 2JSVX 3NUHB 2YEPF 1E0ZA 1EO6A 4XC2A 4DHJD 4RGTA 4KKJA 3SU8X 1EM7A 2D3AA 2D07B 4CHKA 2C7HA 1CZPA 1SB3C 2N4FA 2X38A 1OQYA 2WGSA 3VXWA 1NYRA 2KLGA 2WXGA 3AECB 3EFCA 2M1MA 2GBRA 5IAAC 1I4HA 1N61A 2HTHA 3WAMA 1D4BA 1SJED 3E9SA 3DHIC 4DQOC 3B2FA 2WXHA 2WDTB 3P1MA 4K81A 4PS3A 3U52E 4AUQC 1HE8A 4LNFA 2CU3A 2MJDA 2KDIA 3W9CB 4XDDA 4DDGD 2KQ7A 5FK9C 2C7MB 3AE5B 2KAJA 2PVGC 1M4VA 2J4XA 3H6NA 4BKSA 4I6PA 3AEEB 3LDZE 2KQ4X 2MBQA 3K9PB 1K53A 3DHGC 3KW5B 3QQ8B 4WJPA 4MGIE 1J7AA 2KMCA 1F52A 1DGJA 3OJ3A 1J8CA 1R7SA 4DHZB 1J7CA 3UGBB 5IO9A 4MSMB 2J0MA 1C4PA 3V3XA 5C1ZA 2QCZA 1N63A 4HPMB 4WURA 4X57B 3IHPC 2KTRB 1KLGD 3HVDA 1IGDA 3CSFA 2J0KA 4EE2A 2ZNVB 3RZWC 1KH0A 4E71A 2GB1A 3QHTA 4NPNA 3V62A 3BIID 1UBQA 2M0XA 3VHTC 3RNAC 2IGGA 2WXFA 1N5WA 3Q8EA 4HWIB 4J3OD 2KFJA 1E9MA 1SE4A 2KO3A 2JWUA 4NQLB 1UGJA 4HDOA 2PEAA 1Z5SB 4MH0E 4L1BA 1K52A 5E6NA 4AOFA 4OHJA 3RUIB 2FE8A 4MGZE 4E3CA 3DWGC 3DPDA 1P0RA 4HPLB 1T6BX 3AXCA 3L4PA 5HHDG 2X8XX 2LFIA 1UF0A 1EU4A 3OWEB 3T9LA 4DXFA 1EF5A 5DPTA 3WAPA 2DNFA 2QILA 2C9WB 2Z0EB 4GOCA 2VH1A 3IBEA 1TZ1A 2ACZB 1C1YB 3SD5A 3U2SC 3DBLI 4MT5A 1GUAB 3C8YA 3ABVB 1WXQA 2WDVB 3UIOB 3B08A 3BVGA 4HRSA 2KJHB 2DZMA 5DPSA 3PLUA 2NPTA 1Q5WB 3DQVA 4C7YA 1M94A 2A5UA 2KYWA 3Q3JA 3VAWA 1UWMA 2KJRA 1WJ4A 4BFRA 1ZDVA 1HTOA 2G45B 1RFKA 1TY0A 4ZRKA 2DZKA 5IOIA 3W5VB 4TSSA 1UGMA 2BTEA 5EE3A 1P98A 3HUIA 5G5GA 1QOBA 1YJ1A 3P63A 2INNE 4ZRQA 2IJ0A 4ZYSA 1J19A 2RMMA 2M56B 2WXLA 2VRRB 3DVGX 3MC0B 1VLBA 1YQ4B 3HRDD 1T0SC 1I4RA 2EKEC 3CMMB 2QHOA 4M01A 1ISNA 1RFAA 1MVKA 2I1KA 2LVPA 2QSDA 3M95A 4HCNB 3N3KB 2J7QB 1WR6E 2UU7A 4HVBA 1YX5B 2DYMA 4LNKA 2L8JA 3ZNHB 3PHXB 5C3JB 3IFWB 3MHZA 1I4QA 2BGFA 4YL8A 3T3OA 4A8XC 2KDFB 1IYFA 1ZPSA 1D6EC 1MG4A 2KTRA 3DDCB 3EHVA 1FNWA 4WWNA 2DENB 4AJYB 2KWCA 5LLIA 4AP4C 3GS2A 2W9NA 3X0WA 2MHJA 3E56A 3TL5A 1QOAA 1T3QA 1QOGA 5EE9A 2WX1A 1GC7A 2K3UA 2MBOA 1XEEA 4NAMA 1FD6A 2ZEQA 2QMTA 1MPEA 1ZKHA 2BS3B 4NJ6A 1E7UA 4A20A 3WIMA 1C76A 1E8WA 5D94A 4WQMA 1EWCA 2N9EB 2MH7A 1YQ3B 3ZYYX 3VFKA 2ZVNA 1F1HA 1S3SG 1JCKB 1MHXA 2SAKA 5CHFA 5J17A 4W9GA 4IC7B 2FCSA 1NENB 4BVUC 4P1CC 4MACA 2LXAA 2RDBC 2WXQA 3VR8B 1E8ZA 4JIOU 1NBFC 1ZGUB 4PS8A 1PDXA 4YSYB 4GN1A 4WJNA 4HK2A 1YQBA 2NBUA 2PTLA 2AX5A 3N1XC 2OHFA 4N59A 3EECA 3T8MA 4RCOA 3RNGC 2FBWB 1GOZA 2GI9A 3ML9A 3ONSA 4FHKA 2KHWB 4E74A 3HHMA 2K9XA 4FHJA 4IOIE 3TMPB 1WRIA 3AB5A 3ZNID 4C7ZA 2H89B 4FA6A 1TIFA 2LWPA 3AE2B 3CWIA 1TKGA 2O6VD 3KH0A 2INDC 4DXGA 4ACFA 2O2VB 5AUIA 2LZ6A 4FBJB 1SF0A 2AQ2B 2NTSA 2NS5A 1A5RA 1C77A 1R4MB 2WS3B 1F0ZA 3ZRCA 2JVCA 2FAZA 3PTFC 1I4PA 4LNOA 1E90A 2H88B 1L0VB 2KMMA 2D11A 4BKSD 3AMZA 2AWTA 3LXFA 3U4EG 1SSNA 3KYDD 5E6PA 5C23A 2V3PA 1WYGA 2DX5B 2KC1A 4JQWC 3WA0A 2L00B 4ZYNA 4XZ4A 2DAFA 1AARA 3B9JA 5LXHA 2ZPNA 2V0GA 3P42A 4UDUC 1OQRA 3ZNZB 4ZRIA 1RWSA 1A70A 3A4RA 1JALA 3L54A 3VR9B 5GMVA 4YTMB 2D3CA 2IO1B 3ZIMA 4HXDA 1XLQA 3ZLZA 2LGYA 4USAA 3RT3B 3WCQA 4W9EA 5TR5A 5BYSA 3UF8A 4B0EA 4ARIA 3EFUA 1L2NA 2CHWA 2MA9B 1WXMA 3JSVB 1V1OA 2M8SA 2MBBB 5JHAA 4HCPB 2BBCA 2MLBA 4K3BA 2KWDA 2MEKA 4GDKA 4NQKE 5AUKA 1FIQA 1WSPA 3MP9A 1L0YB 3ZJUA 3N32A 5DPWA 2VH2A 3TEZA 4WWOA 4M8MA 4US8A 4JE3B 3KUDB 3JYUA 3Q3MC 2ICIA 4TQ0A 1MHHE 2KQSA 4P6VF 1L5PA 1J7BA 1NI3A 1WGHA 2PE9A 3AULA 4PS7A 3FILB 3B2GA 1L6UA 4HKQA 3NZUA 1NVID 1OEYA 1QF6A 3PREA 1UD7A 1SJHD 2FCQA 1UWXA 2Y5BB 4DXAB 3AU5A 1NEKB 2XK5A 1KOTA 1EUVB 5E6OA 4MEMA 1WGKA 3OAWA 4GDLB 4XGAB 2KZRA 3VUYA 2TSSA 2K6DB 1Q10A 2D3GA 2YLMA 3BYYB 3QIJA 1B1ZA 1V49A 2NR2A 3W1SA 2HJ1A 4RMAA 3Q69A 2FUHB 2GOWA 5LNK1 4KV2A 3EGRA 1DYQA 5JZEB 2V9HA 2XBBC 1D3ZA 1C4AA 4XWWA 3NVVA 1TS4A 4BBNC 5BYRA 4O1NA 2IDYA 2NVUI 4K3CA 5AZHA 2MCNB 1C79A 2IY0B 5LXIB 1C78A 1PGXA 3Q2AC 3K9OB 1ESFA 3NVZA 4ICVA 1TZOA 1WJUA 2MBHA 1PFDA 3Q8CA 3HK0A 4W9LA 4M8NA 4US9A 2E6XA 1EF1A 4IM0A 4GDLA 1YNTE 3BY4B 3NVYA 3WALA 2M4NA 4S0RA 1R4NB 2BW2A 2KANA 2XK5B 3N30A 4GIVA 3TCAA 1Q0WB 5D3DA 1R4MI 1FXAA 5CTRC 4HPPA 5I4DA 2R2QA 1FCCC 4WIPA 3H9DA 2N1WA 2LRWA 1WGRA 3FILA 2MWSB 1F77A 4A55A 3BVMA 1XD3B 4KSLC 2DYOA 1H4RA 4N58A 1E8XA 4ZRPA 2BYFA 4W9JA 3WANA 2K8CA 3L0WB 1LFDA 2KX0A 1JWUD 2DAJA 3I57A 5IKCM 1GB1A 2DWQA 4EKUA 2L52A 4P16A 4OVUA 1V5TA 3P4RB 3ZTCA 4GDKB 2JYEA 2K0PA 1NYQA 1NI2A 1V1PB 2KT7A 2WXMA 2V3NA 4NJCA 2Y5PA 1TYGB 2W3SA 4A9AA 3I63C 4G11A 1WWTA 2AQ1B 2BPSA 1SIFA 4A6QA 3IT6B 2N1VA 1L7YA 1LGRA 2AL3A 4B0MA 3Q14C 1TS2A 4W9FA 3ZRFA 2ZNVC 2DHZA 1OFFA 1WX7A 1VRAB 2WXJA 2C7NB 1G6JA 1CMXB 1ZW7A 4ICUA 1FCLA 4LJPB 3TJPA 3BZDB 2OJRA 4ZHOA 1WRDB 2MW5A 2L7RA 1FM0D 2Y5CA 4BKTA 2EKIA 4KX6B 2IYDB 3QCAA 1T0RC 2ON8A 1SE3A 2DBYA 2BWES 4KIKB 1WZ0A 2WP9B 1S1QB 1CQVA 2FIFA 3O65B 1GJZA 3M63B 1C4CA 3U8ZA 4DWFA 1AN8A 3QJZA 2J53A 2K8HA 3VVWB 2I1JA 1Q1OA 1RLFA 1GG3A 2HTME 4K1RB 1KJTA 5JXVA 1AWDA 3ZXVA 2W82A 2ZCBA 2WXIA 1PGBA 2XEWA 1BXTA 3EUB2 2WHIA 3B0AA 1WM2A 1QKZA 2BKRB 3DBRI 3DHHC 4TQ1A 3NOBA 1WI0A 1L6VA 2R61A 3V61A 3KYCD 2RDHA 2MQJA 2KDEB 3KWVA 1WH3A 2LGDA 1H8CA 2WX0A 3PT2B 3GE8C 2JZPA 1D5XC 2LRUA 4IW0A 1WFYA 5D3IB 2G4SA 4NAWA 4OW0A 3R7QA 1WXSA 2K5PA 1FRRA 4OZAA 4FULA 4FXCA 4RM9A 1WGYA 5HFYA 1JMLA 2LMCA 2RPVA 5T8IA 2YVCA 2WU2B 1SBBB 1P7EA 4MJSB 4II3B 1I4GA 4KKIA 3X23A 3L08A 2WQYB 1DOYA 3VH3B 3APFA 4XX5A 4J6IA 3N9YC 2FCMA 2BYEA 2JRIB 1L0XB 3GP7A 4CQNA 2MJEA 1B9RA 2CHZA 3RULA 3QARA 2J52A 3TSSA 2Z59B 1JRUA 4FJZA 1UZXB 2W3RA 3PZ8A 1TKYA 2CHXA 1J0GA 3CSTA 3IXSA 2BS2B 3APDA 4N9F4 3AE4B 1FRDA 4ARCA 4TMAB 2AQ3B 1FFVA 2I2YA 1C3TA 5HI1A 2KTFA 5BMIA 4KVGB 1WE7A 3AE7B 2RPQA 1ZDXA 5TSSA 2N7DA 1ZXIA 2NCNA 1N62A 1PYWD 4HROA 4KGSA 2QDFA 4AWJA 1PQSA 2FCNA 2HJ8A 3PGEA 5L83A 4A3OA 1XCQL 2KDMA 1DOXA 1VZ6A 2N7EA 2LGSA 2KD0A 4JPSA 2KVRA 2OOBB 2N9PC 1T5XD 3TUOA 2JYTA 3VUXA 3H7SA 1K51A 2JZZA 3RCZA 2ZW1A 3HVZA 1LQBA 2JXXA 2ZVOA 3I9V1 5FR3A 3NS1A 2LUMA 1YD8U 2BF8B 5HKHA 5BO4B 3BK1A 5G55A 4YWGG 3RPFC 1QT9A 2L0TA 2LI5A 4HLEA 3A4SC 1WIAA 2IO0B 4ANWA 5MPOA 2BYVE 1ZE3D 5CHWA 3CIRB 3RNEC 1WX8A 2FUG1 3GZNI 3GZNB 3PV1A 1N6ZA 1ZP0B 2LGXA 1WGGA 4GLSC 3DWMA 4I6LB 1OEYJ 3M62B 3MJWA 3HM6X 4HDQA 2DZIA 1XQQA 2HD5B 4DBGA 3LJ3A 1TBEA 3JW0X 3DVNU 2PVOD 1GAQB 1V8CA 1FO4A 1OQQA 1NDDA 3H7PB 1WM3A 2VZKD 2UYZB 2NPTB 1I42A 1YJJA 3R7RA 3PZDA 4OZCA 2WXRA 1HZ5A 1XCTL 2V3SA 1ROEA 5J18A 4XE0A 5HG2A 4M00A 1EU3A 1K8RB 1MJDA 2MRPA 3PPAA 2GRIA 3Q8BA 4HJKA 4HJGE 3KWLA 2GBJA 1YN4A 2LUEA 1TTNA 3FKYA 3R2IA 3AV8A 4BZAA 2W54A 3U7ZA 3MFGA 1I7HA 1P7FA 3VUWA 3AE9B 3PRZA 2V4LA 3GE3C 3Q3FA 1VDVA 4ASWC 1QILA 2L32A 2IGHA 4EZKA 3EC8A 3U30A 1P1AA 2KC2A 1XF5L 1HZ6A 4IWOA 2KWVB 3IT4B 3P2BA 2ZJDA 1ZOYB 3DOWA 1FNUA 1VJKA 1LO5D 1RYJA 4MDKE 2LD9A 5KHOA 3DCGA 4WJQA 3ENEA 3J9CA 3VQIA 1WMHA 3O13A 1QLBB 4F1SA 3OLMD 2J0JA 3AE1B 5EE0A 2IY1B 4MGKE 3RNFC 2E3TA 3AH7A 3TBLD 3S2AA 1DOIA 4C00A 1V81A 2WLBA 1VR9A 3BVZA 3PZ7A 5FR6A 3AEDB 2IGDA 2NMQA 1SE9A 4BOSC 5D2MB 1XXGA 5G5HA 4C4VA 1E6EB 3D32A 4DHJB 4K7WA 2CJOA 2IO3B 1ACCA 1F2RI 4Q2JA 5J2RA 1T0YA 2SEBD 2PPHA 2INCC 4JX1C 5EE1A 1CK1A 1KFYB 2KXJA 2WDRB 4W9DA 5H8YE 4K7UA 2Z0DB 2LEKA 3APCA 3AEFB 3HM3A 4WAAA 3L10B 4G50A 2QIEB 3PRMB 2NBVB 1I4XA 4URKA 4RF0A 1UELA 1V2YA 3ZVVA 2JY6A 1AW7A 1BT0A 4GU2A 3WAOA 5AEKB 2KVZA 2QJLA 2N9KA 5IN7A 2JUOA 4LNIA 1F9JA 2AL6A 2RSUA 4ITKA 4MM3B 3ZQ4A 5E6JA 1GC6A 1RRBA 4IM3A 3SFEB 5JH5C 1ZXHA 2KX3A 2KN4A 2B76B 2BVCA 3SDLC 2KFKB 4DHZE 3ZTDA 3VH4B 2A4ZA 3NY5A 2WXKA 4LNNA 4OVZA 1JW9D 4FJVB 2WXPA 4R3DA 2O6VB 2MX2A 2L76A 2ASQA 5IA7A 3KUZA 1P9DU 1RAXA 1JQ4A 3A9KB 5GXGB 2DLBA 1GPXA 1GB4A 2FNJB 1V9JA 2LXCA 3RNBC 4EOYA 1BUIC 3PRPB 1WF9A 3W5UB 3DVNV 2K39A 3H7PA 3MHSD 3RZFA 4OVVA 4NY0A 1L4ZB 3DBHI 2M17A 1WGDA 3PLVA 4TKNA 4YSZB 3AE8B 1TS5A 4P7IA 4LDTB 1JRPA 1TY2A 4NJ7A 3SEBA 1IP9A 2LHDA 1YN3A 1KLVA 1YOVB 1QZEA 2G4DB 3A9JB 1ET9A 4TUUA 1FMAD 3PO0A 3P4SB 1ZUD2 2WDQB 3ZW3A 1SE2A 1LXDA 2N9LA 3UIPB 5FKAC 1TT5B 3VTUA 1E7VA 3ECIA 3AU4A 3URYA 4MSQB 2PKOA 4P1BC 1FNVA 4JLCA 3PVLA 1JWSD 1CJEA 4FJYA 1HEZE 2UWQA 1YJIA 3TEXA 4PYUA 3BK2A 2ONQA 1XT9B 3C19A 2JF5A 2L83A 2GLSA 3DVGY 1C9FA 1STEA 5G2NA 2MP2B 2WU5B 2BWFA 4PYZA 1L4DB 2CKHB 5C2TB 3SFDB 1UNSA 3L13A 3TIXA 3SR6A 2BB6A 1U4AA 4EZJA 4WQOB 3TEYA 4YXDB 4GGQA 4M0WA 1N5XA 4S17A 1YIWA 4IG7B 4EFOA 2BS4B 2K25A 4CYEA 1OGWA 2PW9A 2EMSA 2LGIA 4DDID 3OJ4B 1ENFA 2HE7A 2O6VA 2K1FA 2BT6A 1TKEA 4WH4A 2FIDA 4G3XB 1JROA 4KDIC 2JRHA 2ZPYA 2GMIC 2KNBA 2KOXA 2KFKA 3DBLB 3NHEB 1VD2A 4MJSA 1R4NI 3EA6A 4IDIA 1D5MC 3Q6BA 4B6WA 4GMVA 4MM3A 4RH6A 1UBIA 1FPYA 2OJWA 3ML8A 5IP4D 3N20C 1N60A 1HA5A 1Y8RC 4M02A 3W2DA 3RN9C 3Q3OC 3ZDMC 2C60A 2LJ5A 1V5OA 4GXBA 4NAWB 2Z8LA 3KVFB 2EMTA 4LLGM 5AZFA 2QEJC 3TEWA 3L17A 1HTQA 1ET6A 4XYCA 2BYTA 4W9CA 3PHWB 3R3MA 4FLHA 4IKGA 1KTKA 1IBXA 2V4IB 4ANUA 2JU6X 4A3PA 4ZDVA 2GBNA 3ZNGC 1V6EA 3VRAB 3NZSA 4MGYE 3V60A 4WWPA 2HDEA 4JWSC 4L23A 5EDSA 4YTPB 2JPHA 2KDBA 4C4VB 3AE6B 1E8YA 3NJTA 2XN9C 4RNAA 3VTVA 3ZKJC 2J42A 3RYTA 4C80A 5L95C 1WR1A 2D3BA 3FAHA 3A9KA 4N6EB 3QA8A 3RMKC 1D5ZC 2CU1A 5CX3A 4QAYA 4HKZE 4AQ7A 1KF6B 3N1ZC 3ZJVA 1WE6A 1JWMD 3NS8A 4IWPA 1BMLC 3M3JA 3KQ4A 3RNCC 3FC4A 2NTTA 2IBIB 4CO7A 4HEA1 1X1MA 3Q8FA 1HXYD 4C56C 3A1QA 4KSKC 4WJOA 4RM8A 2D2QA 4YTNB 4LDTD 1MG8A 5AZGA 4BAXA 1AYFA 1FFUA 3RFZB 4RFBA 3V6EB 3AE3B 4RF1A 1YMHE 3QWZB 3R2TA 4BBNF 2JT4B 1UH6A 1V97A 2PJHA 5H92C 2R2OA 2JZ3B 2M0AA 1XLOA 4EEWA 3PSEB 1IPGA 2RGFA 1T0QC 2YEPB 3ZJTA 3AI5A 3AEBB 5CHVC 2ZZPB 2PE6B 3T3NA 3Q3NC 4IM2A 1V1PA 3A1QB 3AM9A 1FEHA 4KDLB 4EZLA 1V80A 3B1LX 4RGMA 2JX5A 3H1UA 4EUTA 2ZCCA 1SGHA 3BINA 3I5JC 4II2B 2KMAA 3P4PB 4IUMB 2K8BA 4ZHPA 1VZ8A 5DCNA 3W1SC 1TGZB 2RD0A 2EELA 4RGNA 3UI3A 4ANVA 1VCBA 4L2YA 2LHEA 1Y56A 4A90A 3MJ5A 4K7SA 1XO3A 4ZOHC 3QX1A 2AEHA 1IUEA 3V6CB 4AJWA 2KLCA 2PLPA 2N7JA 4D2KA 3IVFA 4B95A 3L16A 3ZDTA 1WJ6A 1IBXB 3DBSA 1IGCA 1QOFA 4MH8A 3UQBA 1WMHB 2D5GA 2PMVA 2WXNA 4PT5A 3HIZA 2DZJA 4AS1A 3PS6A 1MFWA 2GBMA 3KUCB 3AEGB 2B3AA 2LVQA 2XNAC
chains in the Genus database with same CATH topology
1JWBD 3MC0B 1AW7A 1VLBA 1E7PB 1YQ4B 3HRDD 4A6QA 2I38A 2QJLA 2N9KA 3IT6B 1I4RA 3AN1A 1XLPA 4B0MA 2IPKD 4ITKA 1TS2A 1MVKA 4KGRA 1UUPA 4MM3B 3ZQ4A 5E6JA 2QSDA 4REZA 1OFFA 1VRAB 2WXJA 2INPE 1KLUD 3SFEB 2Y3AA 3R8BA 1ZXHA 2KN4A 4JWUC 2B76B 2DYMA 1FCLA 2Q5WD 5C3JB 4ZHOA 3BZDB 1FM0D 2MJ3A 3MHZA 1I4QA 1PGAA 3T3OA 2OEDA 2Y5CA 4A8XC 3BYTB 4WWMA 3V05A 1TS3A 1ZPSA 2EKIA 2WXKA 1D6EC 2WNMA 4KX6B 4OVZA 1JW9D 1FNWA 2WXPA 4R3DA 2ZW0A 2ON8A 1SE3A 2DBYA 1XLNA 3AEAB 2WP9B 1CQVA 1C4CA 4XWTA 3LB8C 3GS2A 1JQ4A 1AN8A 4LK0M 2J53A 1SEBD 1JWAD 2CJNA 5BMGA 3E56A 2DLBA 5GXGB 1QOAA 2HTME 1T3QA 1GPXA 1QOGA 1GB4A 5JXVA 5EE9A 3H8HA 1AWDA 1BUIC 4OZBA 3Q8AA 2K3UA 3ZGZA 2W82A 1XEEA 3NRZA 4NAMA 3W5UB 1FD6A 2QMTA 2WXIA 1PGBA 1MPEA 1PUTA 1BXTA 3EUB2 2BS3B 1QKZA 2L1AA 3BWUD 4TQ1A 3LYYA 5D7GA 1C76A 1L4ZB 4YSXB 4WQMA 1L6VA 5BMHA 1EWCA 2R61A 1MI0A 2MH7A 3KLSX 2RDHA 2JXTA 1RM6C 4YSZB 1YQ3B 3ZYYX 3ETRA 3AE8B 3KWVA 1TS5A 1EWYC 1JCKB 1MHXA 2SAKA 2JQRB 1JRPA 3VRBB 1TY2A 3SEBA 2LHDA 1YN3A 1K50A 2JZPA 2VZKB 1D5XC 1NENB 3IAM1 2M19A 4MACA 1ET9A 5D3IB 2WXQA 3VR8B 1FMAD 3PO0A 3P4SB 1ZUD2 2WDQB 4OW0A 1PDXA 4YSYB 1SE2A 2K5PA 1FRRA 2N9LA 4OZAA 1TJEA 4H2AA 4FXCA 2PTLA 5FKAC 2AX5A 5HFYA 1JMLA 4KGTA 2LMCA 2RPVA 2OHFA 4N59A 5T8IA 4WAFA 3URYA 4NZLB 4RCOA 2PKOA 2WU2B 1SBBB 1FNVA 1P7EA 1JWSD 2FBWB 1GOZA 5BYQA 1I4GA 1QQRA 2GI9A 3P4QB 1CJEA 4YT0B 4KKIA 2WQYB 1DOYA 1HEZE 1YJIA 2RDGA 3TEXA 3N9YC 2PIAA 3BK2A 2ONQA 2L83A 1C9FA 1STEA 1L0XB 2K22A 2K9XA 3GP7A 3IAS1 4CQNA 2BB5A 4IOIE 1WRIA 1HQRD 2WU5B 3AB5A 2MJEA 4RGOS 4C7ZA 1B9RA 2KACA 1L4DB 3TSSA 2J52A 2N0SB 2H89B 5C2TB 3SFDB 1UNSA 3AE2B 2LJIA 3CWIA 1YN5A 1TKGA 3SR6A 2W3RA 2BB6A 3PZ8A 1TKYA 4DXGA 3TEYA 4LTUA 4YXDB 3IXSA 2BS2B 2WXOA 1FXIA 1SIJA 4M0WA 1N5XA 1KRHA 5AUIA 3AE4B 1SF0A 2AQ2B 1FRDA 2NTSA 4ARCA 4TMAB 1E10A 2BS4B 1C77A 2AQ3B 1FFVA 2I2YA 5HI1A 5BMIA 1VZ7A 2WS3B 2PW9A 2W55A 1F0ZA 3AE7B 1ZDXA 5TSSA 1ZXIA 1F2RC 2LGIA 1I4PA 1N62A 1PYWD 1ENFA 4HROA 3NZ3A 2H88B 1L0VB 4KGSA 4XDCA 2G9HD 2KMMA 2BT6A 3AMZA 3LXFA 3U4EG 1SSNA 1TKEA 4WH4A 1XCQL 2V3PA 2KDMA 1JROA 1WYGA 1DOXA 1VZ6A 3GB1A 4JPSA 2G1EA 1SXTA 1T5XD 3TUOA 2JYTA 3NVWA 2JSVX 3B9JA 2YEPF 3NUHB 1E0ZA 2V0GA 1K51A 3P42A 4UDUC 4RGTA 1OQRA 4KKJA 2ZW1A 1EM7A 3HVZA 1RWSA 3EA6A 1A70A 1CZPA 1JALA 1SB3C 4IDIA 3I9V1 1D5MC 5FR3A 2X38A 4RH6A 1NYRA 3VR9B 2WXGA 3AECB 4YTMB 3NS1A 2LUMA 1N60A 1HA5A 1XLQA 1I4HA 1N61A 3BK1A 4YWGG 3RPFC 3W2DA 1QT9A 4USAA 1D4BA 1SJED 4NAWB 3WCQA 2Z8LA 3E9SA 4DQOC 5BYSA 4B0EA 3B2FA 4LLGM 5MPOA 4ARIA 2QEJC 1ZE3D 2WXHA 3TEWA 1V1OA 3CIRB 2FUG1 3P1MA 2BBCA 3U52E 1ET6A 2KWDA 2MEKA 1ZP0B 5AUKA 2CU3A 1FIQA 1WSPA 2MJDA 4GLSC 3W9CB 4XDDA 3DWMA 3MP9A 2BYTA 1L0YB 3ZJUA 4IKGA 1KTKA 1IBXA 2V4IB 5FK9C 2JU6X 3TEZA 3AE5B 2KAJA 2PVGC 3VRAB 1M4VA 4US8A 2J4XA 4JE3B 2PVOD 2ICIA 1GAQB 1V8CA 3AEEB 1MHHE 4TQ0A 2HDEA 2KQ4X 4JWSC 4L23A 1FO4A 4P6VF 1L5PA 4YTPB 1OQQA 1J7BA 1NI3A 1K53A 3AE6B 2VZKD 3FILB 1YJJA 1L6UA 3B2GA 2XN9C 4RNAA 4C80A 2J42A 4HKQA 1NVID 3FAHA 1J7AA 4N6EB 4OZCA 1DGJA 1D5ZC 2WXRA 1QF6A 1R7SA 1HZ5A 1SJHD 1J7CA 1UWXA 1XCTL 4HKZE 1C4PA 1NEKB 3V3XA 4AQ7A 1KF6B 3ZJVA 1ROEA 1JWMD 4XE0A 1BMLC 5HG2A 1N63A 4WURA 1EU3A 1WGKA 4GDLB 3KQ4A 3FC4A 1KLGD 3HVDA 2NTTA 1IGDA 2GRIA 3Q8BA 4EE2A 2TSSA 4HJGE 3KWLA 1YN4A 4HEA1 1Q10A 3BYYB 1HXYD 3Q8FA 4C56C 3R2IA 1KH0A 3AV8A 1B1ZA 2W54A 3U7ZA 4YTNB 3W1SA 2GB1A 1AYFA 1I7HA 3MFGA 1FFUA 3RFZB 3Q69A 4RFBA 5LNK1 1P7FA 3EGRA 1DYQA 3AE3B 4RF1A 3BIID 3AE9B 1YMHE 1C4AA 4XWWA 3NVVA 1TS4A 3R2TA 5BYRA 4O1NA 1V97A 2IGGA 1VDVA 2WXFA 1N5WA 2IDYA 5H92C 1QILA 2L32A 2IGHA 3Q8EA 1C79A 4J3OD 1E9MA 1SE4A 2M0AA 1XF5L 1XLOA 2JWUA 1UGJA 1C78A 1PGXA 2YEPB 4L1BA 1K52A 1HZ6A 4OHJA 3NVZA 1ESFA 3ZJTA 2FE8A 3AEBB 1TZOA 3DWGC 3IT4B 1PFDA 1ZOYB 1FNUA 1VJKA 3Q8CA 3T3NA 1LO5D 1RYJA 1T6BX 1V1PA 3L4PA 5HHDG 2LFIA 3AM9A 1EU4A 3OWEB 1FEHA 3J9CA 3VQIA 4US9A 3O13A 1QLBB 2E6XA 4RGMA 2JX5A 4DXFA 3AE1B 1YNTE 5EE0A 3NVYA 2BW2A 2QILA 2E3TA 3AH7A 1DOIA 3P4PB 2ACZB 3U2SC 5D3DA 4ZHPA 1VZ8A 4MT5A 2WLBA 1FXAA 3C8YA 3ABVB 2EELA 5I4DA 1VR9A 1WXQA 2WDVB 1FCCC 3BVZA 3PZ7A 4RGNA 3UI3A 3AEDB 2IGDA 3BVGA 2NMQA 4HRSA 4WIPA 4L2YA 2LHEA 1Y56A 4A90A 3MJ5A 3FILA 1XXGA 5G5HA 1F77A 1E6EB 4A55A 1XO3A 3BVMA 4ZOHC 2CJOA 1IUEA 4C7YA 2DYOA 1ACCA 4N58A 1F2RI 2PLPA 4Q2JA 4ZRPA 2N7JA 4D2KA 1UWMA 2SEBD 1ZDVA 4JX1C 5EE1A 1CK1A 1KFYB 2WDRB 1IBXB 5H8YE 1JWUD 3I57A 1IGCA 1RFKA 1TY0A 1GB1A 2DWQA 2LEKA 1QOFA 3AEFB 4MH8A 2L52A 4P16A 3W5VB 4TSSA 2D5GA 3P4RB 2QIEB 4GDKB 2JYEA 2K0PA 2BTEA 2PMVA 2WXNA 4PT5A 5EE3A 3HUIA 5G5GA 1NYQA 1QOBA 3P63A 1I4XA 2INNE 1V1PB 4AS1A 4ZRQA 2IJ0A 4ZYSA 2WXMA 2V3NA 3AEGB 4RF0A 4NJCA 2Y5PA 2RMMA 1TYGB 2M56B 2W3SA 4A9AA 2WXLA 1WWTA 2XNAC 2AQ1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YMH E;  2I38 A;  2N9K A;  2IGG A;  2N9L A;  4OZA A;  2IGH A;  2PTL A;  5HFY A;  1JML A;  4KGT A;  2LUM A;  2RPV A;  1XF5 L;  2JWU A;  4KGR A;  1MVK A;  1PGX A;  2QSD A;  1K52 A;  1HZ6 A;  1P7E A;  1D4B A;  1ZXH A;  2KN4 A;  2GI9 A;  1FCL A;  1HEZ E;  2ONQ A;  5HHD G;  1PGA A;  2OED A;  1C9F A;  2KWD A;  4IOI E;  4GLS C;  3MP9 A;  2KAC A;  1YNT E;  2J52 A;  2ZW0 A;  4IKG A;  2ON8 A;  1IBX A;  2JU6 X;  1MHH E;  2KQ4 X;  2J53 A;  2EEL A;  5BMG A;  1FCC C;  3UI3 A;  2IGD A;  1K53 A;  2NMQ A;  1GB4 A;  5JXV A;  2LHE A;  3FIL B;  3FIL A;  4OZB A;  1FD6 A;  2QMT A;  1PGB A;  1MPE A;  4OZC A;  2I2Y A;  1HZ5 A;  5HI1 A;  1QKZ A;  5BMI A;  1UWX A;  2PW9 A;  1XCT L;  1F2R I;  2PLP A;  4HKZ E;  3V3X A;  1F2R C;  2LGI A;  2N7J A;  4D2K A;  5BMH A;  1MI0 A;  5HG2 A;  2JXT A;  4KGS A;  1IBX B;  1IGC A;  1GB1 A;  4WH4 A;  1XCQ L;  2KDM A;  1MHX A;  1IGD A;  3GB1 A;  4HJG E;  2K0P A;  1Q10 A;  2LHD A;  1K50 A;  1KH0 A;  2JZP A;  2JSV X;  2GB1 A;  2RMM A;  4MAC A;  1K51 A;  1P7F A;  2ZW1 A;  1EM7 A; 
#chains in the Genus database with same CATH topology
 1JWB D;  1E7P B;  2L3Z A;  2I38 A;  3R66 C;  2KJ6 A;  3AN1 A;  1XLP A;  2IPK D;  4GSW A;  5DPR A;  4ANX A;  2IO2 B;  4KGR A;  1UUP A;  1OTR B;  1V86 A;  4REZ A;  2JWZ A;  2INP E;  1KLU D;  2Y3A A;  2L0F A;  3R8B A;  3SHQ A;  3W1Y A;  4JWU C;  1KM7 A;  2Q5W D;  1Z2M A;  4BKG A;  2MJ3 A;  1PGA A;  2OED A;  3VTW A;  3BYT B;  4WWM A;  1FXT B;  1TS3 A;  3V05 A;  4FN2 A;  2WNM A;  1GNU A;  2ZW0 A;  1WXA A;  1XLN A;  3C0R B;  3AEA B;  2MSE D;  3GOE A;  4W9H A;  4TV3 A;  3DBH B;  2MBE A;  4XWT A;  3LB8 C;  3DBR B;  1WXV A;  4LK0 M;  2C5L C;  1SEB D;  1JWA D;  1LM8 B;  2CJN A;  5BMG A;  1E5W A;  2WYQ A;  3H8H A;  3IG3 A;  4M0W B;  4OZB A;  3Q8A A;  4KZC A;  3ZGZ A;  2REX A;  3NG0 A;  3NRZ A;  3UIN B;  1PUT A;  4F7Z A;  2RR9 A;  2L1A A;  3BWU D;  5D7G A;  3LYY A;  4YSX B;  5BMH A;  1MI0 A;  3N1Y C;  3KLS X;  2JXT A;  1RM6 C;  4IWQ A;  4GB9 A;  2G3Q B;  3ETR A;  4LJO B;  4I6N B;  2MP2 A;  1EWY C;  1WJN A;  2JQR B;  3VRB B;  4JGH B;  1K50 A;  2VZK B;  3JSV A;  3IAM 1;  2M19 A;  4PK1 A;  2LAS A;  4B9K A;  4ZRJ A;  3VDZ A;  2L05 A;  3QK0 A;  3RD2 A;  3U7D A;  1TJE A;  4H2A A;  4KGT A;  4BOZ B;  4WAF A;  4NZL B;  2KN5 A;  3UQA A;  3RI7 C;  4G0N B;  5BYQ A;  3QC8 B;  1QQR A;  2DYB A;  3MC9 A;  4LCD E;  3P4Q B;  4YT0 B;  3A9J A;  1WYW B;  2RDG A;  4F8C B;  3ALB A;  1WX9 A;  2PIA A;  2KK8 A;  2K22 A;  4W9K A;  3IAS 1;  2BB5 A;  2K6Q A;  1HQR D;  4RGO S;  2AYO B;  2KAC A;  3A33 B;  2N0S B;  1P3Q U;  2V1Y A;  2LJI A;  2LVO A;  2WWZ A;  1YN5 A;  2QC8 A;  3QAQ A;  3OG5 A;  2NBW B;  1WY8 A;  2IZV B;  2D10 A;  3ZO5 B;  4LTU A;  2BKF A;  3ZXR A;  2WXO A;  1FXI A;  1SIJ A;  5D6J B;  3ZUN A;  1KRH A;  2GBK A;  1WZ3 A;  2O2V A;  4DK5 A;  2BQQ A;  4MEL A;  3I3T B;  4W9I A;  1E10 A;  3MC8 A;  3MTN B;  1VZ7 A;  2KWU B;  2W55 A;  2CR5 A;  1I35 A;  3CF6 E;  1F2R C;  4KIK A;  4FAD A;  3NZ3 A;  4NNJ B;  4XDC A;  2N9X A;  2G9H D;  3JVZ X;  5KHQ A;  4KZ0 A;  4JL9 A;  2KKC A;  2CS4 A;  3GB1 A;  5JHB A;  1YX6 B;  2G1E A;  1SXT A;  3NVW A;  2JSV X;  3NUH B;  2YEP F;  1E0Z A;  1EO6 A;  4XC2 A;  4DHJ D;  4RGT A;  4KKJ A;  3SU8 X;  1EM7 A;  2D3A A;  2D07 B;  4CHK A;  2C7H A;  1CZP A;  1SB3 C;  2N4F A;  2X38 A;  1OQY A;  2WGS A;  3VXW A;  1NYR A;  2KLG A;  2WXG A;  3AEC B;  3EFC A;  2M1M A;  2GBR A;  5IAA C;  1I4H A;  1N61 A;  2HTH A;  3WAM A;  1D4B A;  1SJE D;  3E9S A;  3DHI C;  4DQO C;  3B2F A;  2WXH A;  2WDT B;  3P1M A;  4K81 A;  4PS3 A;  3U52 E;  4AUQ C;  1HE8 A;  4LNF A;  2CU3 A;  2MJD A;  2KDI A;  3W9C B;  4XDD A;  4DDG D;  2KQ7 A;  5FK9 C;  2C7M B;  3AE5 B;  2KAJ A;  2PVG C;  1M4V A;  2J4X A;  3H6N A;  4BKS A;  4I6P A;  3AEE B;  3LDZ E;  2KQ4 X;  2MBQ A;  3K9P B;  1K53 A;  3DHG C;  3KW5 B;  3QQ8 B;  4WJP A;  4MGI E;  1J7A A;  2KMC A;  1F52 A;  1DGJ A;  3OJ3 A;  1J8C A;  1R7S A;  4DHZ B;  1J7C A;  3UGB B;  5IO9 A;  4MSM B;  2J0M A;  1C4P A;  3V3X A;  5C1Z A;  2QCZ A;  1N63 A;  4HPM B;  4WUR A;  4X57 B;  3IHP C;  2KTR B;  1KLG D;  3HVD A;  1IGD A;  3CSF A;  2J0K A;  4EE2 A;  2ZNV B;  3RZW C;  1KH0 A;  4E71 A;  2GB1 A;  3QHT A;  4NPN A;  3V62 A;  3BII D;  1UBQ A;  2M0X A;  3VHT C;  3RNA C;  2IGG A;  2WXF A;  1N5W A;  3Q8E A;  4HWI B;  4J3O D;  2KFJ A;  1E9M A;  1SE4 A;  2KO3 A;  2JWU A;  4NQL B;  1UGJ A;  4HDO A;  2PEA A;  1Z5S B;  4MH0 E;  4L1B A;  1K52 A;  5E6N A;  4AOF A;  4OHJ A;  3RUI B;  2FE8 A;  4MGZ E;  4E3C A;  3DWG C;  3DPD A;  1P0R A;  4HPL B;  1T6B X;  3AXC A;  3L4P A;  5HHD G;  2X8X X;  2LFI A;  1UF0 A;  1EU4 A;  3OWE B;  3T9L A;  4DXF A;  1EF5 A;  5DPT A;  3WAP A;  2DNF A;  2QIL A;  2C9W B;  2Z0E B;  4GOC A;  2VH1 A;  3IBE A;  1TZ1 A;  2ACZ B;  1C1Y B;  3SD5 A;  3U2S C;  3DBL I;  4MT5 A;  1GUA B;  3C8Y A;  3ABV B;  1WXQ A;  2WDV B;  3UIO B;  3B08 A;  3BVG A;  4HRS A;  2KJH B;  2DZM A;  5DPS A;  3PLU A;  2NPT A;  1Q5W B;  3DQV A;  4C7Y A;  1M94 A;  2A5U A;  2KYW A;  3Q3J A;  3VAW A;  1UWM A;  2KJR A;  1WJ4 A;  4BFR A;  1ZDV A;  1HTO A;  2G45 B;  1RFK A;  1TY0 A;  4ZRK A;  2DZK A;  5IOI A;  3W5V B;  4TSS A;  1UGM A;  2BTE A;  5EE3 A;  1P98 A;  3HUI A;  5G5G A;  1QOB A;  1YJ1 A;  3P63 A;  2INN E;  4ZRQ A;  2IJ0 A;  4ZYS A;  1J19 A;  2RMM A;  2M56 B;  2WXL A;  2VRR B;  3DVG X;  3MC0 B;  1VLB A;  1YQ4 B;  3HRD D;  1T0S C;  1I4R A;  2EKE C;  3CMM B;  2QHO A;  4M01 A;  1ISN A;  1RFA A;  1MVK A;  2I1K A;  2LVP A;  2QSD A;  3M95 A;  4HCN B;  3N3K B;  2J7Q B;  1WR6 E;  2UU7 A;  4HVB A;  1YX5 B;  2DYM A;  4LNK A;  2L8J A;  3ZNH B;  3PHX B;  5C3J B;  3IFW B;  3MHZ A;  1I4Q A;  2BGF A;  4YL8 A;  3T3O A;  4A8X C;  2KDF B;  1IYF A;  1ZPS A;  1D6E C;  1MG4 A;  2KTR A;  3DDC B;  3EHV A;  1FNW A;  4WWN A;  2DEN B;  4AJY B;  2KWC A;  5LLI A;  4AP4 C;  3GS2 A;  2W9N A;  3X0W A;  2MHJ A;  3E56 A;  3TL5 A;  1QOA A;  1T3Q A;  1QOG A;  5EE9 A;  2WX1 A;  1GC7 A;  2K3U A;  2MBO A;  1XEE A;  4NAM A;  1FD6 A;  2ZEQ A;  2QMT A;  1MPE A;  1ZKH A;  2BS3 B;  4NJ6 A;  1E7U A;  4A20 A;  3WIM A;  1C76 A;  1E8W A;  5D94 A;  4WQM A;  1EWC A;  2N9E B;  2MH7 A;  1YQ3 B;  3ZYY X;  3VFK A;  2ZVN A;  1F1H A;  1S3S G;  1JCK B;  1MHX A;  2SAK A;  5CHF A;  5J17 A;  4W9G A;  4IC7 B;  2FCS A;  1NEN B;  4BVU C;  4P1C C;  4MAC A;  2LXA A;  2RDB C;  2WXQ A;  3VR8 B;  1E8Z A;  4JIO U;  1NBF C;  1ZGU B;  4PS8 A;  1PDX A;  4YSY B;  4GN1 A;  4WJN A;  4HK2 A;  1YQB A;  2NBU A;  2PTL A;  2AX5 A;  3N1X C;  2OHF A;  4N59 A;  3EEC A;  3T8M A;  4RCO A;  3RNG C;  2FBW B;  1GOZ A;  2GI9 A;  3ML9 A;  3ONS A;  4FHK A;  2KHW B;  4E74 A;  3HHM A;  2K9X A;  4FHJ A;  4IOI E;  3TMP B;  1WRI A;  3AB5 A;  3ZNI D;  4C7Z A;  2H89 B;  4FA6 A;  1TIF A;  2LWP A;  3AE2 B;  3CWI A;  1TKG A;  2O6V D;  3KH0 A;  2IND C;  4DXG A;  4ACF A;  2O2V B;  5AUI A;  2LZ6 A;  4FBJ B;  1SF0 A;  2AQ2 B;  2NTS A;  2NS5 A;  1A5R A;  1C77 A;  1R4M B;  2WS3 B;  1F0Z A;  3ZRC A;  2JVC A;  2FAZ A;  3PTF C;  1I4P A;  4LNO A;  1E90 A;  2H88 B;  1L0V B;  2KMM A;  2D11 A;  4BKS D;  3AMZ A;  2AWT A;  3LXF A;  3U4E G;  1SSN A;  3KYD D;  5E6P A;  5C23 A;  2V3P A;  1WYG A;  2DX5 B;  2KC1 A;  4JQW C;  3WA0 A;  2L00 B;  4ZYN A;  4XZ4 A;  2DAF A;  1AAR A;  3B9J A;  5LXH A;  2ZPN A;  2V0G A;  3P42 A;  4UDU C;  1OQR A;  3ZNZ B;  4ZRI A;  1RWS A;  1A70 A;  3A4R A;  1JAL A;  3L54 A;  3VR9 B;  5GMV A;  4YTM B;  2D3C A;  2IO1 B;  3ZIM A;  4HXD A;  1XLQ A;  3ZLZ A;  2LGY A;  4USA A;  3RT3 B;  3WCQ A;  4W9E A;  5TR5 A;  5BYS A;  3UF8 A;  4B0E A;  4ARI A;  3EFU A;  1L2N A;  2CHW A;  2MA9 B;  1WXM A;  3JSV B;  1V1O A;  2M8S A;  2MBB B;  5JHA A;  4HCP B;  2BBC A;  2MLB A;  4K3B A;  2KWD A;  2MEK A;  4GDK A;  4NQK E;  5AUK A;  1FIQ A;  1WSP A;  3MP9 A;  1L0Y B;  3ZJU A;  3N32 A;  5DPW A;  2VH2 A;  3TEZ A;  4WWO A;  4M8M A;  4US8 A;  4JE3 B;  3KUD B;  3JYU A;  3Q3M C;  2ICI A;  4TQ0 A;  1MHH E;  2KQS A;  4P6V F;  1L5P A;  1J7B A;  1NI3 A;  1WGH A;  2PE9 A;  3AUL A;  4PS7 A;  3FIL B;  3B2G A;  1L6U A;  4HKQ A;  3NZU A;  1NVI D;  1OEY A;  1QF6 A;  3PRE A;  1UD7 A;  1SJH D;  2FCQ A;  1UWX A;  2Y5B B;  4DXA B;  3AU5 A;  1NEK B;  2XK5 A;  1KOT A;  1EUV B;  5E6O A;  4MEM A;  1WGK A;  3OAW A;  4GDL B;  4XGA B;  2KZR A;  3VUY A;  2TSS A;  2K6D B;  1Q10 A;  2D3G A;  2YLM A;  3BYY B;  3QIJ A;  1B1Z A;  1V49 A;  2NR2 A;  3W1S A;  2HJ1 A;  4RMA A;  3Q69 A;  2FUH B;  2GOW A;  5LNK 1;  4KV2 A;  3EGR A;  1DYQ A;  5JZE B;  2V9H A;  2XBB C;  1D3Z A;  1C4A A;  4XWW A;  3NVV A;  1TS4 A;  4BBN C;  5BYR A;  4O1N A;  2IDY A;  2NVU I;  4K3C A;  5AZH A;  2MCN B;  1C79 A;  2IY0 B;  5LXI B;  1C78 A;  1PGX A;  3Q2A C;  3K9O B;  1ESF A;  3NVZ A;  4ICV A;  1TZO A;  1WJU A;  2MBH A;  1PFD A;  3Q8C A;  3HK0 A;  4W9L A;  4M8N A;  4US9 A;  2E6X A;  1EF1 A;  4IM0 A;  4GDL A;  1YNT E;  3BY4 B;  3NVY A;  3WAL A;  2M4N A;  4S0R A;  1R4N B;  2BW2 A;  2KAN A;  2XK5 B;  3N30 A;  4GIV A;  3TCA A;  1Q0W B;  5D3D A;  1R4M I;  1FXA A;  5CTR C;  4HPP A;  5I4D A;  2R2Q A;  1FCC C;  4WIP A;  3H9D A;  2N1W A;  2LRW A;  1WGR A;  3FIL A;  2MWS B;  1F77 A;  4A55 A;  3BVM A;  1XD3 B;  4KSL C;  2DYO A;  1H4R A;  4N58 A;  1E8X A;  4ZRP A;  2BYF A;  4W9J A;  3WAN A;  2K8C A;  3L0W B;  1LFD A;  2KX0 A;  1JWU D;  2DAJ A;  3I57 A;  5IKC M;  1GB1 A;  2DWQ A;  4EKU A;  2L52 A;  4P16 A;  4OVU A;  1V5T A;  3P4R B;  3ZTC A;  4GDK B;  2JYE A;  2K0P A;  1NYQ A;  1NI2 A;  1V1P B;  2KT7 A;  2WXM A;  2V3N A;  4NJC A;  2Y5P A;  1TYG B;  2W3S A;  4A9A A;  3I63 C;  4G11 A;  1WWT A;  2AQ1 B;  2BPS A;  1SIF A;  4A6Q A;  3IT6 B;  2N1V A;  1L7Y A;  1LGR A;  2AL3 A;  4B0M A;  3Q14 C;  1TS2 A;  4W9F A;  3ZRF A;  2ZNV C;  2DHZ A;  1OFF A;  1WX7 A;  1VRA B;  2WXJ A;  2C7N B;  1G6J A;  1CMX B;  1ZW7 A;  4ICU A;  1FCL A;  4LJP B;  3TJP A;  3BZD B;  2OJR A;  4ZHO A;  1WRD B;  2MW5 A;  2L7R A;  1FM0 D;  2Y5C A;  4BKT A;  2EKI A;  4KX6 B;  2IYD B;  3QCA A;  1T0R C;  2ON8 A;  1SE3 A;  2DBY A;  2BWE S;  4KIK B;  1WZ0 A;  2WP9 B;  1S1Q B;  1CQV A;  2FIF A;  3O65 B;  1GJZ A;  3M63 B;  1C4C A;  3U8Z A;  4DWF A;  1AN8 A;  3QJZ A;  2J53 A;  2K8H A;  3VVW B;  2I1J A;  1Q1O A;  1RLF A;  1GG3 A;  2HTM E;  4K1R B;  1KJT A;  5JXV A;  1AWD A;  3ZXV A;  2W82 A;  2ZCB A;  2WXI A;  1PGB A;  2XEW A;  1BXT A;  3EUB 2;  2WHI A;  3B0A A;  1WM2 A;  1QKZ A;  2BKR B;  3DBR I;  3DHH C;  4TQ1 A;  3NOB A;  1WI0 A;  1L6V A;  2R61 A;  3V61 A;  3KYC D;  2RDH A;  2MQJ A;  2KDE B;  3KWV A;  1WH3 A;  2LGD A;  1H8C A;  2WX0 A;  3PT2 B;  3GE8 C;  2JZP A;  1D5X C;  2LRU A;  4IW0 A;  1WFY A;  5D3I B;  2G4S A;  4NAW A;  4OW0 A;  3R7Q A;  1WXS A;  2K5P A;  1FRR A;  4OZA A;  4FUL A;  4FXC A;  4RM9 A;  1WGY A;  5HFY A;  1JML A;  2LMC A;  2RPV A;  5T8I A;  2YVC A;  2WU2 B;  1SBB B;  1P7E A;  4MJS B;  4II3 B;  1I4G A;  4KKI A;  3X23 A;  3L08 A;  2WQY B;  1DOY A;  3VH3 B;  3APF A;  4XX5 A;  4J6I A;  3N9Y C;  2FCM A;  2BYE A;  2JRI B;  1L0X B;  3GP7 A;  4CQN A;  2MJE A;  1B9R A;  2CHZ A;  3RUL A;  3QAR A;  2J52 A;  3TSS A;  2Z59 B;  1JRU A;  4FJZ A;  1UZX B;  2W3R A;  3PZ8 A;  1TKY A;  2CHX A;  1J0G A;  3CST A;  3IXS A;  2BS2 B;  3APD A;  4N9F 4;  3AE4 B;  1FRD A;  4ARC A;  4TMA B;  2AQ3 B;  1FFV A;  2I2Y A;  1C3T A;  5HI1 A;  2KTF A;  5BMI A;  4KVG B;  1WE7 A;  3AE7 B;  2RPQ A;  1ZDX A;  5TSS A;  2N7D A;  1ZXI A;  2NCN A;  1N62 A;  1PYW D;  4HRO A;  4KGS A;  2QDF A;  4AWJ A;  1PQS A;  2FCN A;  2HJ8 A;  3PGE A;  5L83 A;  4A3O A;  1XCQ L;  2KDM A;  1DOX A;  1VZ6 A;  2N7E A;  2LGS A;  2KD0 A;  4JPS A;  2KVR A;  2OOB B;  2N9P C;  1T5X D;  3TUO A;  2JYT A;  3VUX A;  3H7S A;  1K51 A;  2JZZ A;  3RCZ A;  2ZW1 A;  3HVZ A;  1LQB A;  2JXX A;  2ZVO A;  3I9V 1;  5FR3 A;  3NS1 A;  2LUM A;  1YD8 U;  2BF8 B;  5HKH A;  5BO4 B;  3BK1 A;  5G55 A;  4YWG G;  3RPF C;  1QT9 A;  2L0T A;  2LI5 A;  4HLE A;  3A4S C;  1WIA A;  2IO0 B;  4ANW A;  5MPO A;  2BYV E;  1ZE3 D;  5CHW A;  3CIR B;  3RNE C;  1WX8 A;  2FUG 1;  3GZN I;  3GZN B;  3PV1 A;  1N6Z A;  1ZP0 B;  2LGX A;  1WGG A;  4GLS C;  3DWM A;  4I6L B;  1OEY J;  3M62 B;  3MJW A;  3HM6 X;  4HDQ A;  2DZI A;  1XQQ A;  2HD5 B;  4DBG A;  3LJ3 A;  1TBE A;  3JW0 X;  3DVN U;  2PVO D;  1GAQ B;  1V8C A;  1FO4 A;  1OQQ A;  1NDD A;  3H7P B;  1WM3 A;  2VZK D;  2UYZ B;  2NPT B;  1I42 A;  1YJJ A;  3R7R A;  3PZD A;  4OZC A;  2WXR A;  1HZ5 A;  1XCT L;  2V3S A;  1ROE A;  5J18 A;  4XE0 A;  5HG2 A;  4M00 A;  1EU3 A;  1K8R B;  1MJD A;  2MRP A;  3PPA A;  2GRI A;  3Q8B A;  4HJK A;  4HJG E;  3KWL A;  2GBJ A;  1YN4 A;  2LUE A;  1TTN A;  3FKY A;  3R2I A;  3AV8 A;  4BZA A;  2W54 A;  3U7Z A;  3MFG A;  1I7H A;  1P7F A;  3VUW A;  3AE9 B;  3PRZ A;  2V4L A;  3GE3 C;  3Q3F A;  1VDV A;  4ASW C;  1QIL A;  2L32 A;  2IGH A;  4EZK A;  3EC8 A;  3U30 A;  1P1A A;  2KC2 A;  1XF5 L;  1HZ6 A;  4IWO A;  2KWV B;  3IT4 B;  3P2B A;  2ZJD A;  1ZOY B;  3DOW A;  1FNU A;  1VJK A;  1LO5 D;  1RYJ A;  4MDK E;  2LD9 A;  5KHO A;  3DCG A;  4WJQ A;  3ENE A;  3J9C A;  3VQI A;  1WMH A;  3O13 A;  1QLB B;  4F1S A;  3OLM D;  2J0J A;  3AE1 B;  5EE0 A;  2IY1 B;  4MGK E;  3RNF C;  2E3T A;  3AH7 A;  3TBL D;  3S2A A;  1DOI A;  4C00 A;  1V81 A;  2WLB A;  1VR9 A;  3BVZ A;  3PZ7 A;  5FR6 A;  3AED B;  2IGD A;  2NMQ A;  1SE9 A;  4BOS C;  5D2M B;  1XXG A;  5G5H A;  4C4V A;  1E6E B;  3D32 A;  4DHJ B;  4K7W A;  2CJO A;  2IO3 B;  1ACC A;  1F2R I;  4Q2J A;  5J2R A;  1T0Y A;  2SEB D;  2PPH A;  2INC C;  4JX1 C;  5EE1 A;  1CK1 A;  1KFY B;  2KXJ A;  2WDR B;  4W9D A;  5H8Y E;  4K7U A;  2Z0D B;  2LEK A;  3APC A;  3AEF B;  3HM3 A;  4WAA A;  3L10 B;  4G50 A;  2QIE B;  3PRM B;  2NBV B;  1I4X A;  4URK A;  4RF0 A;  1UEL A;  1V2Y A;  3ZVV A;  2JY6 A;  1AW7 A;  1BT0 A;  4GU2 A;  3WAO A;  5AEK B;  2KVZ A;  2QJL A;  2N9K A;  5IN7 A;  2JUO A;  4LNI A;  1F9J A;  2AL6 A;  2RSU A;  4ITK A;  4MM3 B;  3ZQ4 A;  5E6J A;  1GC6 A;  1RRB A;  4IM3 A;  3SFE B;  5JH5 C;  1ZXH A;  2KX3 A;  2KN4 A;  2B76 B;  2BVC A;  3SDL C;  2KFK B;  4DHZ E;  3ZTD A;  3VH4 B;  2A4Z A;  3NY5 A;  2WXK A;  4LNN A;  4OVZ A;  1JW9 D;  4FJV B;  2WXP A;  4R3D A;  2O6V B;  2MX2 A;  2L76 A;  2ASQ A;  5IA7 A;  3KUZ A;  1P9D U;  1RAX A;  1JQ4 A;  3A9K B;  5GXG B;  2DLB A;  1GPX A;  1GB4 A;  2FNJ B;  1V9J A;  2LXC A;  3RNB C;  4EOY A;  1BUI C;  3PRP B;  1WF9 A;  3W5U B;  3DVN V;  2K39 A;  3H7P A;  3MHS D;  3RZF A;  4OVV A;  4NY0 A;  1L4Z B;  3DBH I;  2M17 A;  1WGD A;  3PLV A;  4TKN A;  4YSZ B;  3AE8 B;  1TS5 A;  4P7I A;  4LDT B;  1JRP A;  1TY2 A;  4NJ7 A;  3SEB A;  1IP9 A;  2LHD A;  1YN3 A;  1KLV A;  1YOV B;  1QZE A;  2G4D B;  3A9J B;  1ET9 A;  4TUU A;  1FMA D;  3PO0 A;  3P4S B;  1ZUD 2;  2WDQ B;  3ZW3 A;  1SE2 A;  1LXD A;  2N9L A;  3UIP B;  5FKA C;  1TT5 B;  3VTU A;  1E7V A;  3ECI A;  3AU4 A;  3URY A;  4MSQ B;  2PKO A;  4P1B C;  1FNV A;  4JLC A;  3PVL A;  1JWS D;  1CJE A;  4FJY A;  1HEZ E;  2UWQ A;  1YJI A;  3TEX A;  4PYU A;  3BK2 A;  2ONQ A;  1XT9 B;  3C19 A;  2JF5 A;  2L83 A;  2GLS A;  3DVG Y;  1C9F A;  1STE A;  5G2N A;  2MP2 B;  2WU5 B;  2BWF A;  4PYZ A;  1L4D B;  2CKH B;  5C2T B;  3SFD B;  1UNS A;  3L13 A;  3TIX A;  3SR6 A;  2BB6 A;  1U4A A;  4EZJ A;  4WQO B;  3TEY A;  4YXD B;  4GGQ A;  4M0W A;  1N5X A;  4S17 A;  1YIW A;  4IG7 B;  4EFO A;  2BS4 B;  2K25 A;  4CYE A;  1OGW A;  2PW9 A;  2EMS A;  2LGI A;  4DDI D;  3OJ4 B;  1ENF A;  2HE7 A;  2O6V A;  2K1F A;  2BT6 A;  1TKE A;  4WH4 A;  2FID A;  4G3X B;  1JRO A;  4KDI C;  2JRH A;  2ZPY A;  2GMI C;  2KNB A;  2KOX A;  2KFK A;  3DBL B;  3NHE B;  1VD2 A;  4MJS A;  1R4N I;  3EA6 A;  4IDI A;  1D5M C;  3Q6B A;  4B6W A;  4GMV A;  4MM3 A;  4RH6 A;  1UBI A;  1FPY A;  2OJW A;  3ML8 A;  5IP4 D;  3N20 C;  1N60 A;  1HA5 A;  1Y8R C;  4M02 A;  3W2D A;  3RN9 C;  3Q3O C;  3ZDM C;  2C60 A;  2LJ5 A;  1V5O A;  4GXB A;  4NAW B;  2Z8L A;  3KVF B;  2EMT A;  4LLG M;  5AZF A;  2QEJ C;  3TEW A;  3L17 A;  1HTQ A;  1ET6 A;  4XYC A;  2BYT A;  4W9C A;  3PHW B;  3R3M A;  4FLH A;  4IKG A;  1KTK A;  1IBX A;  2V4I B;  4ANU A;  2JU6 X;  4A3P A;  4ZDV A;  2GBN A;  3ZNG C;  1V6E A;  3VRA B;  3NZS A;  4MGY E;  3V60 A;  4WWP A;  2HDE A;  4JWS C;  4L23 A;  5EDS A;  4YTP B;  2JPH A;  2KDB A;  4C4V B;  3AE6 B;  1E8Y A;  3NJT A;  2XN9 C;  4RNA A;  3VTV A;  3ZKJ C;  2J42 A;  3RYT A;  4C80 A;  5L95 C;  1WR1 A;  2D3B A;  3FAH A;  3A9K A;  4N6E B;  3QA8 A;  3RMK C;  1D5Z C;  2CU1 A;  5CX3 A;  4QAY A;  4HKZ E;  4AQ7 A;  1KF6 B;  3N1Z C;  3ZJV A;  1WE6 A;  1JWM D;  3NS8 A;  4IWP A;  1BML C;  3M3J A;  3KQ4 A;  3RNC C;  3FC4 A;  2NTT A;  2IBI B;  4CO7 A;  4HEA 1;  1X1M A;  3Q8F A;  1HXY D;  4C56 C;  3A1Q A;  4KSK C;  4WJO A;  4RM8 A;  2D2Q A;  4YTN B;  4LDT D;  1MG8 A;  5AZG A;  4BAX A;  1AYF A;  1FFU A;  3RFZ B;  4RFB A;  3V6E B;  3AE3 B;  4RF1 A;  1YMH E;  3QWZ B;  3R2T A;  4BBN F;  2JT4 B;  1UH6 A;  1V97 A;  2PJH A;  5H92 C;  2R2O A;  2JZ3 B;  2M0A A;  1XLO A;  4EEW A;  3PSE B;  1IPG A;  2RGF A;  1T0Q C;  2YEP B;  3ZJT A;  3AI5 A;  3AEB B;  5CHV C;  2ZZP B;  2PE6 B;  3T3N A;  3Q3N C;  4IM2 A;  1V1P A;  3A1Q B;  3AM9 A;  1FEH A;  4KDL B;  4EZL A;  1V80 A;  3B1L X;  4RGM A;  2JX5 A;  3H1U A;  4EUT A;  2ZCC A;  1SGH A;  3BIN A;  3I5J C;  4II2 B;  2KMA A;  3P4P B;  4IUM B;  2K8B A;  4ZHP A;  1VZ8 A;  5DCN A;  3W1S C;  1TGZ B;  2RD0 A;  2EEL A;  4RGN A;  3UI3 A;  4ANV A;  1VCB A;  4L2Y A;  2LHE A;  1Y56 A;  4A90 A;  3MJ5 A;  4K7S A;  1XO3 A;  4ZOH C;  3QX1 A;  2AEH A;  1IUE A;  3V6C B;  4AJW A;  2KLC A;  2PLP A;  2N7J A;  4D2K A;  3IVF A;  4B95 A;  3L16 A;  3ZDT A;  1WJ6 A;  1IBX B;  3DBS A;  1IGC A;  1QOF A;  4MH8 A;  3UQB A;  1WMH B;  2D5G A;  2PMV A;  2WXN A;  4PT5 A;  3HIZ A;  2DZJ A;  4AS1 A;  3PS6 A;  1MFW A;  2GBM A;  3KUC B;  3AEG B;  2B3A A;  2LVQ A;  2XNA C; 
#chains in the Genus database with same CATH homology
 1JWB D;  3MC0 B;  1AW7 A;  1VLB A;  1E7P B;  1YQ4 B;  3HRD D;  4A6Q A;  2I38 A;  2QJL A;  2N9K A;  3IT6 B;  1I4R A;  3AN1 A;  1XLP A;  4B0M A;  2IPK D;  4ITK A;  1TS2 A;  1MVK A;  4KGR A;  1UUP A;  4MM3 B;  3ZQ4 A;  5E6J A;  2QSD A;  4REZ A;  1OFF A;  1VRA B;  2WXJ A;  2INP E;  1KLU D;  3SFE B;  2Y3A A;  3R8B A;  1ZXH A;  2KN4 A;  4JWU C;  2B76 B;  2DYM A;  1FCL A;  2Q5W D;  5C3J B;  4ZHO A;  3BZD B;  1FM0 D;  2MJ3 A;  3MHZ A;  1I4Q A;  1PGA A;  3T3O A;  2OED A;  2Y5C A;  4A8X C;  3BYT B;  4WWM A;  3V05 A;  1TS3 A;  1ZPS A;  2EKI A;  2WXK A;  1D6E C;  2WNM A;  4KX6 B;  4OVZ A;  1JW9 D;  1FNW A;  2WXP A;  4R3D A;  2ZW0 A;  2ON8 A;  1SE3 A;  2DBY A;  1XLN A;  3AEA B;  2WP9 B;  1CQV A;  1C4C A;  4XWT A;  3LB8 C;  3GS2 A;  1JQ4 A;  1AN8 A;  4LK0 M;  2J53 A;  1SEB D;  1JWA D;  2CJN A;  5BMG A;  3E56 A;  2DLB A;  5GXG B;  1QOA A;  2HTM E;  1T3Q A;  1GPX A;  1QOG A;  1GB4 A;  5JXV A;  5EE9 A;  3H8H A;  1AWD A;  1BUI C;  4OZB A;  3Q8A A;  2K3U A;  3ZGZ A;  2W82 A;  1XEE A;  3NRZ A;  4NAM A;  3W5U B;  1FD6 A;  2QMT A;  2WXI A;  1PGB A;  1MPE A;  1PUT A;  1BXT A;  3EUB 2;  2BS3 B;  1QKZ A;  2L1A A;  3BWU D;  4TQ1 A;  3LYY A;  5D7G A;  1C76 A;  1L4Z B;  4YSX B;  4WQM A;  1L6V A;  5BMH A;  1EWC A;  2R61 A;  1MI0 A;  2MH7 A;  3KLS X;  2RDH A;  2JXT A;  1RM6 C;  4YSZ B;  1YQ3 B;  3ZYY X;  3ETR A;  3AE8 B;  3KWV A;  1TS5 A;  1EWY C;  1JCK B;  1MHX A;  2SAK A;  2JQR B;  1JRP A;  3VRB B;  1TY2 A;  3SEB A;  2LHD A;  1YN3 A;  1K50 A;  2JZP A;  2VZK B;  1D5X C;  1NEN B;  3IAM 1;  2M19 A;  4MAC A;  1ET9 A;  5D3I B;  2WXQ A;  3VR8 B;  1FMA D;  3PO0 A;  3P4S B;  1ZUD 2;  2WDQ B;  4OW0 A;  1PDX A;  4YSY B;  1SE2 A;  2K5P A;  1FRR A;  2N9L A;  4OZA A;  1TJE A;  4H2A A;  4FXC A;  2PTL A;  5FKA C;  2AX5 A;  5HFY A;  1JML A;  4KGT A;  2LMC A;  2RPV A;  2OHF A;  4N59 A;  5T8I A;  4WAF A;  3URY A;  4NZL B;  4RCO A;  2PKO A;  2WU2 B;  1SBB B;  1FNV A;  1P7E A;  1JWS D;  2FBW B;  1GOZ A;  5BYQ A;  1I4G A;  1QQR A;  2GI9 A;  3P4Q B;  1CJE A;  4YT0 B;  4KKI A;  2WQY B;  1DOY A;  1HEZ E;  1YJI A;  2RDG A;  3TEX A;  3N9Y C;  2PIA A;  3BK2 A;  2ONQ A;  2L83 A;  1C9F A;  1STE A;  1L0X B;  2K22 A;  2K9X A;  3GP7 A;  3IAS 1;  4CQN A;  2BB5 A;  4IOI E;  1WRI A;  1HQR D;  2WU5 B;  3AB5 A;  2MJE A;  4RGO S;  4C7Z A;  1B9R A;  2KAC A;  1L4D B;  3TSS A;  2J52 A;  2N0S B;  2H89 B;  5C2T B;  3SFD B;  1UNS A;  3AE2 B;  2LJI A;  3CWI A;  1YN5 A;  1TKG A;  3SR6 A;  2W3R A;  2BB6 A;  3PZ8 A;  1TKY A;  4DXG A;  3TEY A;  4LTU A;  4YXD B;  3IXS A;  2BS2 B;  2WXO A;  1FXI A;  1SIJ A;  4M0W A;  1N5X A;  1KRH A;  5AUI A;  3AE4 B;  1SF0 A;  2AQ2 B;  1FRD A;  2NTS A;  4ARC A;  4TMA B;  1E10 A;  2BS4 B;  1C77 A;  2AQ3 B;  1FFV A;  2I2Y A;  5HI1 A;  5BMI A;  1VZ7 A;  2WS3 B;  2PW9 A;  2W55 A;  1F0Z A;  3AE7 B;  1ZDX A;  5TSS A;  1ZXI A;  1F2R C;  2LGI A;  1I4P A;  1N62 A;  1PYW D;  1ENF A;  4HRO A;  3NZ3 A;  2H88 B;  1L0V B;  4KGS A;  4XDC A;  2G9H D;  2KMM A;  2BT6 A;  3AMZ A;  3LXF A;  3U4E G;  1SSN A;  1TKE A;  4WH4 A;  1XCQ L;  2V3P A;  2KDM A;  1JRO A;  1WYG A;  1DOX A;  1VZ6 A;  3GB1 A;  4JPS A;  2G1E A;  1SXT A;  1T5X D;  3TUO A;  2JYT A;  3NVW A;  2JSV X;  3B9J A;  2YEP F;  3NUH B;  1E0Z A;  2V0G A;  1K51 A;  3P42 A;  4UDU C;  4RGT A;  1OQR A;  4KKJ A;  2ZW1 A;  1EM7 A;  3HVZ A;  1RWS A;  3EA6 A;  1A70 A;  1CZP A;  1JAL A;  1SB3 C;  4IDI A;  3I9V 1;  1D5M C;  5FR3 A;  2X38 A;  4RH6 A;  1NYR A;  3VR9 B;  2WXG A;  3AEC B;  4YTM B;  3NS1 A;  2LUM A;  1N60 A;  1HA5 A;  1XLQ A;  1I4H A;  1N61 A;  3BK1 A;  4YWG G;  3RPF C;  3W2D A;  1QT9 A;  4USA A;  1D4B A;  1SJE D;  4NAW B;  3WCQ A;  2Z8L A;  3E9S A;  4DQO C;  5BYS A;  4B0E A;  3B2F A;  4LLG M;  5MPO A;  4ARI A;  2QEJ C;  1ZE3 D;  2WXH A;  3TEW A;  1V1O A;  3CIR B;  2FUG 1;  3P1M A;  2BBC A;  3U52 E;  1ET6 A;  2KWD A;  2MEK A;  1ZP0 B;  5AUK A;  2CU3 A;  1FIQ A;  1WSP A;  2MJD A;  4GLS C;  3W9C B;  4XDD A;  3DWM A;  3MP9 A;  2BYT A;  1L0Y B;  3ZJU A;  4IKG A;  1KTK A;  1IBX A;  2V4I B;  5FK9 C;  2JU6 X;  3TEZ A;  3AE5 B;  2KAJ A;  2PVG C;  3VRA B;  1M4V A;  4US8 A;  2J4X A;  4JE3 B;  2PVO D;  2ICI A;  1GAQ B;  1V8C A;  3AEE B;  1MHH E;  4TQ0 A;  2HDE A;  2KQ4 X;  4JWS C;  4L23 A;  1FO4 A;  4P6V F;  1L5P A;  4YTP B;  1OQQ A;  1J7B A;  1NI3 A;  1K53 A;  3AE6 B;  2VZK D;  3FIL B;  1YJJ A;  1L6U A;  3B2G A;  2XN9 C;  4RNA A;  4C80 A;  2J42 A;  4HKQ A;  1NVI D;  3FAH A;  1J7A A;  4N6E B;  4OZC A;  1DGJ A;  1D5Z C;  2WXR A;  1QF6 A;  1R7S A;  1HZ5 A;  1SJH D;  1J7C A;  1UWX A;  1XCT L;  4HKZ E;  1C4P A;  1NEK B;  3V3X A;  4AQ7 A;  1KF6 B;  3ZJV A;  1ROE A;  1JWM D;  4XE0 A;  1BML C;  5HG2 A;  1N63 A;  4WUR A;  1EU3 A;  1WGK A;  4GDL B;  3KQ4 A;  3FC4 A;  1KLG D;  3HVD A;  2NTT A;  1IGD A;  2GRI A;  3Q8B A;  4EE2 A;  2TSS A;  4HJG E;  3KWL A;  1YN4 A;  4HEA 1;  1Q10 A;  3BYY B;  1HXY D;  3Q8F A;  4C56 C;  3R2I A;  1KH0 A;  3AV8 A;  1B1Z A;  2W54 A;  3U7Z A;  4YTN B;  3W1S A;  2GB1 A;  1AYF A;  1I7H A;  3MFG A;  1FFU A;  3RFZ B;  3Q69 A;  4RFB A;  5LNK 1;  1P7F A;  3EGR A;  1DYQ A;  3AE3 B;  4RF1 A;  3BII D;  3AE9 B;  1YMH E;  1C4A A;  4XWW A;  3NVV A;  1TS4 A;  3R2T A;  5BYR A;  4O1N A;  1V97 A;  2IGG A;  1VDV A;  2WXF A;  1N5W A;  2IDY A;  5H92 C;  1QIL A;  2L32 A;  2IGH A;  3Q8E A;  1C79 A;  4J3O D;  1E9M A;  1SE4 A;  2M0A A;  1XF5 L;  1XLO A;  2JWU A;  1UGJ A;  1C78 A;  1PGX A;  2YEP B;  4L1B A;  1K52 A;  1HZ6 A;  4OHJ A;  3NVZ A;  1ESF A;  3ZJT A;  2FE8 A;  3AEB B;  1TZO A;  3DWG C;  3IT4 B;  1PFD A;  1ZOY B;  1FNU A;  1VJK A;  3Q8C A;  3T3N A;  1LO5 D;  1RYJ A;  1T6B X;  1V1P A;  3L4P A;  5HHD G;  2LFI A;  3AM9 A;  1EU4 A;  3OWE B;  1FEH A;  3J9C A;  3VQI A;  4US9 A;  3O13 A;  1QLB B;  2E6X A;  4RGM A;  2JX5 A;  4DXF A;  3AE1 B;  1YNT E;  5EE0 A;  3NVY A;  2BW2 A;  2QIL A;  2E3T A;  3AH7 A;  1DOI A;  3P4P B;  2ACZ B;  3U2S C;  5D3D A;  4ZHP A;  1VZ8 A;  4MT5 A;  2WLB A;  1FXA A;  3C8Y A;  3ABV B;  2EEL A;  5I4D A;  1VR9 A;  1WXQ A;  2WDV B;  1FCC C;  3BVZ A;  3PZ7 A;  4RGN A;  3UI3 A;  3AED B;  2IGD A;  3BVG A;  2NMQ A;  4HRS A;  4WIP A;  4L2Y A;  2LHE A;  1Y56 A;  4A90 A;  3MJ5 A;  3FIL A;  1XXG A;  5G5H A;  1F77 A;  1E6E B;  4A55 A;  1XO3 A;  3BVM A;  4ZOH C;  2CJO A;  1IUE A;  4C7Y A;  2DYO A;  1ACC A;  4N58 A;  1F2R I;  2PLP A;  4Q2J A;  4ZRP A;  2N7J A;  4D2K A;  1UWM A;  2SEB D;  1ZDV A;  4JX1 C;  5EE1 A;  1CK1 A;  1KFY B;  2WDR B;  1IBX B;  5H8Y E;  1JWU D;  3I57 A;  1IGC A;  1RFK A;  1TY0 A;  1GB1 A;  2DWQ A;  2LEK A;  1QOF A;  3AEF B;  4MH8 A;  2L52 A;  4P16 A;  3W5V B;  4TSS A;  2D5G A;  3P4R B;  2QIE B;  4GDK B;  2JYE A;  2K0P A;  2BTE A;  2PMV A;  2WXN A;  4PT5 A;  5EE3 A;  3HUI A;  5G5G A;  1NYQ A;  1QOB A;  3P63 A;  1I4X A;  2INN E;  1V1P B;  4AS1 A;  4ZRQ A;  2IJ0 A;  4ZYS A;  2WXM A;  2V3N A;  3AEG B;  4RF0 A;  4NJC A;  2Y5P A;  2RMM A;  1TYG B;  2M56 B;  2W3S A;  4A9A A;  2WXL A;  1WWT A;  2XNA C;  2AQ1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...