1HZ6A

Crystal structures of the b1 domain of protein l from peptostreptococcus magnus with a tyrosine to tryptophan substitution
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
67
structure length
67
Chain Sequence
HHAMEEVTIKANLIFANGSTQTAEFKGTFEKATSEAYAYADTLKKDNGEWTVDVADKGYTLNIKFAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN L
publication title Structures of the B1 domain of protein L from Peptostreptococcus magnus with a tyrosine to tryptophan substitution.
pubmed doi rcsb
source organism Finegoldia magna
molecule tags Protein binding
total genus 17
structure length 67
sequence length 67
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2001-01-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1hz6A00
1MVKA 3UI3A 1XCTL 1XCQL 1ZXHA 4OZCA 1P7FA 2KWDA 2QMTA 4GLSC 2JWUA 2I2YA 1FD6A 3V3XA 5BMGA 1P7EA 1MPEA 2RPVA 1XF5L 2JSVX 1PGBA 1FCCC 1C9FA 2GI9A 2J53A 1HZ6A 1MHHE 1YNTE 5BMIA 4OZBA 5HG2A 1K53A 2EELA 1EM7A 2LUMA 1HEZE 1MHXA 2LHDA 3FILB 1F2RC 1QKZA 2KN4A 1UWXA 1K50A 2K0PA 2ZW0A 1K52A 1D4BA 1GB1A 3GB1A 2KQ4X 3MP9A 1K51A 2LHEA 1YMHE 2ON8A 2GB1A 1Q10A 1MI0A 1FCLA 4WH4A 2KDMA 2PW9A 2ONQA 1F2RI 1IBXB 2LGIA 2QSDA 2PTLA 2PLPA 2JXTA 1JMLA 2I38A 2JU6X 1GB4A 1IBXA 4KGSA 3FILA 2N9KA 2NMQA 4HKZE 1PGAA 4KGRA 5JXVA 2J52A 1PGXA 2KACA 2N7JA 2IGGA 2RMMA 4MACA 5HFYA 2ZW1A 2IGDA 1IGDA 2OEDA 4IOIE 2JZPA 1KH0A 1IGCA 4HJGE 4KGTA 2N9LA 4IKGA 5HI1A 4D2KA 1HZ5A 5HHDG 2IGHA 4OZAA 5BMHA
chains in the Genus database with same CATH superfamily
4DQOC 1UWMA 3AEBB 2LASA 3RNGC 1TTNA 1WJNA 2M0XA 3AXCA 3EGRA 3Q8CA 3SFDB 3DVGX 5TR5A 3QCAA 1EUVB 2MBQA 2FNJB 5DPSA 2KNBA 3QIJA 3H7SA 1J7CA 3B0AA 4TMAB 4N58A 3IBEA 1VZ7A 2JX5A 2HD5B 1WIAA 4M0WA 5EDSA 5FKAC 1KLUD 4IWPA 4LNFA 2V0GA 5AEKB 1GJZA 1L6UA 4JX1C 4IM2A 1HA5A 3PT2B 1XLNA 1SSNA 3PHXB 1I4PA 4HEA1 2X38A 4REZA 3U30A 3PO0A 3Q8EA 3P42A 4GGQA 1I7HA 3WAPA 2AWTA 3C8YA 2ZCBA 3FC4A 1JALA 2MSED 2LFIA 2SEBD 3RUIB 3NVZA 4P1CC 3BYTB 1U4AA 4W9FA 3I57A 2KDMA 2N4FA 3ZLZA 2V4LA 3RNBC 3BY4B 4NZLB 2HJ8A 4ZRQA 3ZNID 1WX7A 3TUOA 1ZKHA 2RSUA 4LJPB 3IAM1 2L83A 2FCNA 2CU1A 3PVLA 3QC8B 1V6EA 2DX5B 3ZGZA 3KLSX 2KK8A 5C3JB 1QOFA 2LUEA 1RM6C 3Q3JA 1L5PA 2AQ3B 4KSKC 1GG3A 1IGCA 4HPLB 3DPDA 4LNKA 4IKGA 4XZ4A 4HPMB 4RMAA 1L0VB 1WX9A 1QOGA 4LJOB 4IC7B 1WGYA 4DHJD 4FN2A 4FHKA 2W82A 2JWUA 3APDA 1C4CA 5H8YE 2H88B 2BS4B 2KLGA 2CKHB 2KDBA 1WRIA 2ZVOA 3UGBB 2K5PA 3RZFA 2GI9A 1PUTA 1E7UA 5C2TB 2ZCCA 1HTQA 2KXJA 1YX6B 2JZZA 3P63A 2L32A 5HG2A 2M1MA 2MW5A 2INDC 3W9CB 3WAMA 5D6JB 1FM0D 5DPRA 2C60A 1E9MA 2IO3B 1RRBA 1Q5WB 4FJVB 1GOZA 3FILB 4NPNA 3W1YA 1QOAA 3Q8BA 4F1SA 1I4RA 1TZOA 3IVFA 2DAFA 1F1HA 3HVZA 2RDGA 1OTRB 1K52A 2B76B 2QDFA 1CJEA 4C80A 1FO4A 1OEYA 4GU2A 1WF9A 3MJWA 3MHZA 3B1LX 2BKRB 2RD0A 1CK1A 4HWIB 2INCC 3RULA 1STEA 1IPGA 4M00A 4MDKE 1XLOA 1WXAA 4M02A 4C4VB 4F7ZA 4A20A 3AE3B 2DYOA 3NOBA 4II2B 3TEWA 2G1EA 1GC7A 3VXWA 3PZ7A 2WXGA 3LYYA 5L83A 3RNEC 3EFUA 2O2VB 1V86A 1UF0A 4HROA 4YTPB 2JXXA 3UF8A 4JE3B 2DWQA 3VRAB 2LMCA 4MM3A 2CJOA 3JW0X 4HRSA 1FEHA 4AOFA 4DXAB 1TS4A 4NQLB 2LJ5A 3VTVA 2EMSA 3Q69A 4KGTA 2K9XA 2WS3B 3NJTA 5HI1A 4HCNB 4K3BA 2K25A 2L0FA 5HHDG 4OZAA 2GBRA 3NG0A 1XCQL 1NI3A 2KDFB 3LB8C 4GLSC 4F8CB 3DDCB 3N1XC 2MBHA 2MA9B 4LLGM 3VH3B 3FKYA 3SEBA 3WALA 3HK0A 4RF1A 3TCAA 4P1BC 4I6PA 3QAQA 3QX1A 1T6BX 1E10A 1FRDA 3VDZA 1LO5D 1OFFA 2XK5A 2LRWA 1MHHE 3PTFC 1F0ZA 4M8MA 1OGWA 1NYQA 3AU5A 4HXDA 3URYA 1WM3A 2WXFA 2BYVE 3DWGC 3CWIA 4DHJB 3AEDB 1QKZA 1JRUA 4JIOU 2V3SA 2LZ6A 3ECIA 1BUIC 1WGDA 1Y8RC 3W2DA 5DCNA 3IT6B 1WGHA 2LI5A 2ON8A 3U4EG 2KFKA 2W9NA 1T0QC 3AM9A 2QEJC 1OQQA 1R4MI 2Y5PA 2NS5A 1BMLC 4RH6A 3OG5A 2KJHB 3RNCC 3MC8A 1SE3A 3L08A 1JWBD 3KUZA 4DK5A 2BQQA 4GMVA 4GDKA 4XWWA 4CQNA 2BGFA 2L05A 4HDOA 3BZDB 4AJWA 1UH6A 2RMMA 4AQ7A 4TUUA 3KUDB 1IGDA 3A9JA 2GMIC 2J4XA 2M56B 3U52E 3IXSA 3ZJTA 4OVVA 5G5GA 3VVWB 2D2QA 3AMZA 5AUIA 3M95A 1MJDA 3R3MA 4BKSA 1I4XA 2XNAC 3DBSA 5BMGA 1PQSA 1RFKA 2KKCA 3QQ8B 3LJ3A 2EKIA 3CIRB 4XE0A 2IDYA 3L13A 1X1MA 4B0MA 3SHQA 1D5ZC 1Y56A 3MC9A 2D3BA 4AWJA 3VQIA 3PS6A 1C77A 4JLCA 3N1YC 3APCA 1V9JA 2LUMA 3UINB 1SIFA 3N30A 3P4QB 3NVYA 1NENB 4MGYE 4A3PA 3BYYB 3GE3C 1UWXA 2Y5BB 1EF1A 3H6NA 4I6NB 1NI2A 2MJEA 3MFGA 3S2AA 1QT9A 3VR9B 1I4GA 1C78A 2NBUA 1GAQB 3PLVA 1JRPA 1MFWA 1TS2A 1Q10A 2WXRA 2I38A 3TJPA 2DBYA 4NJ7A 5FR3A 4O1NA 2NMQA 4ASWC 2FIDA 4E74A 4WJOA 4BZAA 2L76A 3AE1B 5IOIA 2J0KA 2C9WB 4K3CA 4WWPA 4IM0A 2KWVB 1GPXA 2OEDA 2KYWA 4JPSA 3T8MA 1UUPA 1WR6E 1KLGD 4AUQC 4DDGD 4KDIC 3OAWA 1C1YB 3RMKC 1E6EB 1T3QA 4II3B 2AX5A 2NCNA 3GZNI 3V3XA 2N9PC 5DPWA 1PDXA 4BKTA 3ZRFA 2MJDA 2LXAA 4YT0B 1WI0A 1PGBA 3GS2A 5KHQA 2ZJDA 1JWAD 1WZ3A 4B0EA 2V3NA 2IY1B 2GBJA 1UNSA 1L4ZB 1ZE3D 1FNUA 4MSQB 3ZW3A 2LVOA 2KWUB 1KOTA 1XLPA 2JF5A 1I4QA 1YN3A 3KUCB 3AEEB 4J3OD 3VTWA 4N9F4 4C56C 2FE8A 3U7DA 4P6VF 4A90A 3EFCA 2MBBB 3ZJVA 1YQ3B 4NNJB 3VRBB 1GB1A 1V1PB 4ZHPA 3NY5A 3PHWB 3GB1A 5AZGA 1VR9A 4PYZA 2RPQA 4ARCA 1LXDA 4C00A 1SIJA 1YMHE 1D5MC 2CHWA 2G4DB 1FCLA 3SFEB 3AECB 2L00B 2KZRA 4MT5A 2WXMA 3NZUA 1C4PA 4IUMB 4IW0A 3MC0B 4OHJA 2TSSA 3BK1A 1PGXA 2JUOA 2N7JA 2Z59B 2WDRB 5AZHA 3DVGY 1E0ZA 2O2VA 4EE2A 2FIFA 2LRUA 4IOIE 2KTRA 1I35A 1JCKB 1JWSD 3VUWA 3DBLB 3AE5B 4W9LA 1V80A 3UIOB 1SEBD 1MVKA 3Q3NC 3DBRB 4NJCA 2PEAA 1V97A 2QMTA 3NS1A 1LFDA 1FXAA 2EMTA 3ML9A 4G3XB 2KJRA 4BVUC 3R7QA 1HZ6A 3B9JA 1J19A 1YN4A 5LXIB 4UDUC 3R7RA 2IJ0A 3ZRCA 4KKIA 3N32A 4PS3A 2E6XA 3Q3FA 3PGEA 3IG3A 3ZYYX 4EOYA 1R4NI 2ICIA 4AJYB 4HDQA 4HJKA 1DOYA 5JHAA 5LLIA 2LHDA 3DVNU 3RZWC 3PV1A 2LVPA 2MRPA 2KJ6A 2JQRB 4XDCA 2YEPF 3T3OA 2MWSB 2INNE 5EE1A 3OJ3A 4KKJA 1WRDB 4DDID 4WH4A 3DHHC 1EWCA 3RD2A 4H2AA 4A3OA 2PTLA 4WAAA 1VD2A 2ZZPB 2WGSA 1T0SC 4YSYB 2AL3A 3L10B 1J0GA 1KRHA 4GN1A 1R7SA 1S1QB 4W9CA 3JVZX 1WMHA 3A9KA 2M0AA 4EUTA 3AB5A 2FAZA 1HXYD 3MTNB 3ZNGC 2NBWB 2HDEA 2NTSA 4MELA 3CSTA 4HKQA 3JYUA 2IGHA 2MP2B 5IN7A 2IY0B 1YN5A 3O65B 2KHWB 1RYJA 1VRAB 2NVUI 1KF6B 1RWSA 2CHZA 2QIEB 4AS1A 1WZ0A 1WR1A 2W3SA 3WCQA 2ZPNA 3APFA 1ZGUB 1C76A 2H89B 3JSVB 2WXPA 2WXLA 4XX5A 1YNTE 4C7YA 3TEYA 2AYOB 2WXOA 2WU2B 3AE4B 2WX1A 1GNUA 3I9V1 2ZVNA 2D10A 1QF6A 1D3ZA 2D3AA 2MLBA 2DLBA 3VUXA 2QILA 4FADA 2N7DA 1D4BA 3RN9C 4HK2A 5D3DA 2D3CA 2BWFA 2PVOD 4K1RB 3ZXVA 4RGOS 4K81A 1KM7A 1JWMD 3ZDTA 5G2NA 2FUHB 3TL5A 4EZLA 5EE9A 2RDBC 2LGXA 2PJHA 5D94A 1T0RC 2PIAA 1FFUA 3KYCD 5CHWA 3FAHA 2G3QB 5IP4D 4HKZE 2BBCA 2FCMA 1WXSA 3BVGA 1PGAA 3LDZE 3UIPB 1E8YA 2K6QA 1UZXB 2CU3A 3PREA 3B2GA 1XT9B 2WP9B 4WWNA 4K7WA 2KWCA 5CHVC 3T3NA 4R3DA 3GOEA 4ZOHC 1EWYC 1HZ5A 4P7IA 2RDHA 1N63A 4W9JA 3TEXA 3CF6E 3AEGB 1P7FA 3V6CB 2IO2B 1AN8A 3AU4A 1YIWA 3P2BA 2WNMA 4MJSB 5I4DA 1SE9A 1KFYB 3QA8A 3ZIMA 2BYFA 4TQ0A 5GMVA 1WY8A 3Q3MC 2BS2B 1MG4A 2D07B 2L52A 2IPKD 3H7PA 5G5HA 1WE7A 4US8A 3PRPB 4GDLB 4TV3A 1UD7A 4NQKE 3VTUA 4RM8A 3TBLD 3PLUA 1V5TA 4WJPA 4LDTD 3Q8AA 1S3SG 3QHTA 2CS4A 3HUIA 3SU8X 2C7MB 3ZVVA 2QJLA 4W9IA 1PFDA 5KHOA 4A9AA 1K51A 5LXHA 4FULA 1V1PA 1ZOYB 1F2RI 4FLHA 2MBEA 2WHIA 2JT4B 2QSDA 2JXTA 1NVID 2KOXA 4FBJB 4PS8A 3SD5A 1R4MB 1CZPA 4NJ6A 2WXNA 2GLSA 3PPAA 3UQBA 2J0MA 1SE2A 4YXDB 3V61A 1F77A 2G45B 4BOZB 1EU3A 5IKCM 3HM6X 1QLBB 1ZDXA 3A33B 2C7NB 5HFYA 2GOWA 2KMAA 3WA0A 2WLBA 3BIID 1D6EC 4M0WB 4M8NA 4RGMA 3BWUD 3KVFB 4FA6A 5MPOA 1UELA 4ANXA 3BVMA 2AQ1B 3B08A 2C5LC 4ZHOA 4OZCA 4DXGA 1ZDVA 3UQAA 2I2YA 1N5XA 2DZIA 2OJRA 1IP9A 2K8CA 4ICUA 1XF5L 1TGZB 2V9HA 3ZUNA 2M17A 1ENFA 2HJ1A 4WQOB 4YTNB 1HE8A 2J53A 2D3GA 2BYEA 4I6LB 3RI7C 4WJNA 4WJQA 2UWQA 1WYGA 2NPTA 3NUHB 4RGNA 1K53A 1EM7A 1WGKA 2JYEA 4C7ZA 1WGRA 1VDVA 3AEAB 2EKEC 2REXA 1F2RC 1E8ZA 4S17A 3N1ZC 1L0YB 1G6JA 2KLCA 4N59A 4KDLB 4NY0A 1YD8U 1SJHD 3RT3B 2MCNB 1L7YA 1TS3A 4B95A 3H1UA 3DQVA 4EZJA 1FMAD 3EC8A 2JPHA 4KIKB 2W3RA 4A8XC 2ONQA 1LQBA 3N9YC 1IBXB 1F9JA 4IM3A 1VZ8A 4DBGA 2WDVB 3T9LA 4ANUA 5C1ZA 4LDTB 2LXCA 2J52A 4WIPA 1OQRA 1V1OA 4YL8A 1E7PB 4DHZB 5BYRA 2DHZA 1WGGA 4ICVA 5AUKA 1ET9A 3OLMD 2G9HD 1J7AA 1V5OA 4HJGE 3HHMA 1TBEA 4W9KA 5JZEB 5BMHA 5JXVA 2B3AA 4GSWA 1IUEA 1N61A 3N20C 3GZNB 4EFOA 3C0RB 2BVCA 2OHFA 4YSZB 2Z0DB 1P9DU 4ANVA 4WQMA 2K1FA 2M19A 2HTHA 4MH0E 3JSVA 5D3IB 2SAKA 2M4NA 1TY0A 2X8XX 1K8RB 2JRIB 3NZ3A 3ABVB 1NYRA 1SB3C 1L2NA 5G55A 3AI5A 3R66C 5C23A 1YQ4B 1ZW7A 3E56A 1FXTB 2JRHA 3D32A 3N3KB 4LNNA 1FXIA 2WXQA 1WSPA 1WX8A 1FNWA 3M62B 1CQVA 5IAAC 1ET6A 4XGAB 2N1VA 2PKOA 1Q0WB 4M01A 5TSSA 4S0RA 3QJZA 4JWUC 2LGSA 2MEKA 1A70A 4AP4C 5FK9C 2KT7A 3AN1A 3FILA 5BYSA 3U2SC 2O6VD 5AZFA 1AW7A 3RFZB 2KACA 1YX5B 1ZPSA 2KDEB 1JROA 4BKGA 4RF0A 2VZKB 1FFVA 1FIQA 1SXTA 2WWZA 3DHIC 2JZPA 4ZRIA 1MG8A 2I1KA 3C19A 4BBNC 4RCOA 4C4VA 4L1BA 5EE3A 4FJZA 1AYFA 1OEYJ 2ACZB 3UI3A 1ZXHA 1FD6A 3NRZA 3DOWA 1SE4A 3V6EB 5E6JA 1E8XA 1TIFA 2JSVX 3V62A 3BK2A 3ETRA 3CSFA 4HCPB 2BWES 5BO4B 2KFKB 2V4IB 3HM3A 3W5VB 4MJSA 1WJ6A 3ZJUA 2K6DB 2BF8B 2DYBA 4ITKA 2LGDA 4NAWB 2K8HA 4GXBA 1YJIA 2R2QA 1AARA 2WXIA 3TSSA 1LGRA 4TKNA 2MJ3A 5L95C 1R4NB 4P16A 4GDLA 4IDIA 1WFYA 1SF0A 1P1AA 4E3CA 3RCZA 1KJTA 3M3JA 1IYFA 2KQ4X 5JH5C 2JZ3B 1Q1OA 2BT6A 2KQSA 2L3ZA 2V3PA 3U8ZA 1F52A 1TZ1A 2PW9A 1ISNA 3IFWB 3TIXA 1I4HA 4KX6B 4KSLC 2L1AA 2OOBB 3ZDMC 1VCBA 1I42A 3VUYA 2JWZA 5DPTA 3ZTDA 2J42A 3L16A 1E8WA 2IO1B 3RNAC 1YJ1A 2KN5A 4GB9A 3KQ4A 1P3QU 2IGGA 3WIMA 4DXFA 3TMPB 1TKGA 3PZ8A 2J0JA 2V1YA 4YTMB 2KFJA 1B1ZA 4LTUA 5D7GA 3IHPC 3QK0A 4D2KA 4JL9A 3AE9B 2WXKA 3L54A 3EECA 2L8JA 2KWDA 2KC2A 4N6EB 1LM8B 3KYDD 2O6VB 4JQWC 1L6VA 1M4VA 4HPPA 5IO9A 2ZEQA 1TKYA 2R61A 1KLVA 4OVZA 3PRZA 3ZNHB 2QCZA 1E7VA 5H92C 2PE9A 3OWEB 2BTEA 4K7UA 4MEMA 4WWMA 2N0SB 1QQRA 4EZKA 3AV8A 3L4PA 4ZYNA 3KH0A 1YOVB 1ZXIA 4OVUA 1DYQA 2ZNVC 4X57B 3MP9A 2LGYA 3M63B 2KD0A 3AE8B 1ACCA 5J2RA 3IT4B 2XBBC 2JU6X 4KIKA 3I5JC 3IAS1 1IBXA 4BFRA 1H4RA 3BVZA 3VH4B 2BB6A 1J8CA 1UBQA 3EUB2 4DWFA 5HKHA 4FJYA 2KX3A 3HRDD 2GBMA 3E9SA 4KVGB 2IGDA 2I1JA 2MBOA 1NEKB 4B6WA 4ZYSA 1DOIA 4W9DA 3ZKJC 4J6IA 4L2YA 1XCTL 4KZ0A 3RPFC 3R2TA 1V81A 2MH7A 4E71A 4URKA 3J9CA 2AEHA 2WQYB 1D5XC 2E3TA 4MGZE 4XYCA 1BXTA 4HLEA 3K9PB 3ZTCA 1FCCC 1C9FA 2MX2A 2WYQA 5CTRC 4RNAA 1WXVA 3EHVA 3A1QB 2GBKA 1RAXA 2NTTA 2KVZA 2IBIB 1P98A 2FCQA 1Z5SB 3DBHB 4GOCA 3ZQ4A 3W1SA 2KANA 1HEZE 2W55A 3PZDA 3DCGA 4XC2A 2WDTB 2INPE 2DZJA 3A4RA 2GBNA 2K22A 2N7EA 4BBNF 1AWDA 3LXFA 2Y5CA 4TSSA 2PE6B 1C79A 2DAJA 2XEWA 2LVQA 3SDLC 5JHBA 1WJ4A 3DBHI 2AQ2B 3EA6A 3PSEB 5D2MB 4FXCA 1N60A 1ZP0B 4ACFA 2KTRB 4WURA 3P1MA 2YEPB 3MHSD 5LNK1 3Q2AC 4W9EA 2IO0B 2PLPA 2DYMA 2BW2A 2KMCA 2M8SA 2WXJA 2W54A 1QILA 1SGHA 1UGMA 4FHJA 2KVRA 2VH1A 3PRMB 2QC8A 2D11A 2ZW1A 4USAA 2KDIA 4TQ1A 5EE0A 2CR5A 2WXHA 2K39A 3WAOA 1JW9D 4YSXB 4LNIA 2PPHA 1EO6A 1HQRD 1UGJA 3Q6BA 2N9EB 5J18A 2VH2A 3ENEA 4YWGG 1J7BA 1EU4A 1L4DB 4RFBA 4DHZE 1V49A 3WANA 1XEEA 3NZSA 2GRIA 3ZXRA 4JGHB 4PYUA 1B9RA 1RFAA 3KWVA 2RPVA 2JVCA 2KAJA 4PK1A 2LJIA 3L0WB 4Q2JA 3KW5B 5CX3A 1RLFA 3AE7B 5BYQA 2G4SA 3V60A 3V05A 3U7ZA 3SR6A 2NBVB 2BPSA 4WWOA 2A4ZA 3A4SC 1TYGB 2JYTA 1WM2A 4OW0A 4PS7A 1DOXA 4NAWA 4LNOA 4MGKE 2RR9A 2WU5B 2FCSA 1ROEA 1WMHB 1T0YA 3A9KB 4HVBA 2MHJA 1VZ6A 3AULA 2GB1A 1MI0A 4W9GA 3KWLA 4CHKA 2KQ7A 2DZMA 2BS3B 1E90A 4CO7A 3K9OB 2VRRB 2VZKD 2NR2A 4ZRJA 2L0TA 1WE6A 1H8CA 1NBFC 4PT5A 1N62A 2YVCA 4MH8A 1JWUD 1ZUD2 2Y3AA 1TKEA 2Z0EB 4RM9A 4XWTA 3QARA 2WX0A 2WDQB 1GC6A 3AE2B 2N9XA 1T5XD 5CHFA 4MSMB 2KX0A 2ASQA 2KTFA 2JY6A 2UU7A 4QAYA 4G11A 1XD3B 1WJUA 3GE8C 4LCDE 3X0WA 2DNFA 1WWTA 2PMVA 5FR6A 4EKUA 2KC1A 2AL6A 2L7RA 2O6VA 5BMIA 2OJWA 4OZBA 5T8IA 4ARIA 3AEFB 3OJ4B 5E6OA 2EELA 2R2OA 2D5GA 4ZRKA 3VAWA 2MP2A 1V2YA 1N5WA 1MHXA 2K3UA 4IWOA 1GUAB 1TS5A 2KN4A 1C4AA 2KMMA 1Z2MA 2C7HA 1K50A 1M94A 2K0PA 3BINA 3HVDA 4WAFA 3L17A 3GP7A 1VLBA 1HTOA 2CJNA 4IG7B 3B2FA 2YLMA 4XDDA 1CMXB 3W5UB 4BOSC 4BKSD 1EF5A 2HE7A 4ZRPA 3H8HA 4LK0M 1JMLA 1P0RA 3ZO5B 1GB4A 1XO3A 2MQJA 3R2IA 4US9A 2N9KA 3ONSA 4ANWA 3ZNZB 2J7QB 4MM3B 3CMMB 2RGFA 5J17A 2KO3A 3R8BA 1UBIA 1OQYA 2QHOA 3TEZA 4MACA 2BB5A 3RYTA 3DVNV 2DENB 4IWQA 2BKFA 1L0XB 1KH0A 3RNFC 1WYWB 2LWPA 2Z8LA 2A5UA 2Q5WD 3H7PB 2FUG1 4BAXA 3I63C 2LD9A 2BYTA 2LEKA 4W9HA 1NDDA 4EEWA 3VR8B 1WXMA 1N6ZA 5E6NA 1P7EA 1MPEA 4RGTA 2XK5B 3ML8A 1QOBA 4G50A 5E6PA 4G0NB 1E5WA 5IA7A 1FNVA 4A6QA 1XXGA 1YJJA 4MGIE 3P4SB 1WXQA 3I3TB 4KZCA 1SJED 4NAMA 2IYDB 3O13A 3Q3OC 1XLQA 3HIZA 3Q14C 1FPYA 3A1QA 1V8CA 2FBWB 1VJKA 3VHTC 1KTKA 3MJ5A 2XN9C 4ZDVA 1BT0A 2ZW0A 4K7SA 1A5RA 2HTME 3AH7A 1FRRA 3VFKA 4CYEA 3P4RB 3X23A 2LHEA 3QWZB 1SBBB 1ESFA 1TT5B 2UYZB 3NHEB 3Q8FA 2DZKA 2LGIA 4JWSC 5GXGB 3W1SC 3NVVA 4GIVA 4KGSA 4GDKB 2K8BA 3AE6B 2PVGC 4B9KA 1YQBA 3P4PB 4L23A 4KGRA 1TJEA 3A9JB 2CHXA 1C3TA 1DGJA 3ALBA 4KV2A 3DWMA 1XQQA 2ZNVB 2ZPYA 3NVWA 2IZVB 3NS8A 1QZEA 3DHGC 3H9DA 3DBLI 1TY2A 2NPTB 2N9LA 3DBRI 2N1WA 4A55A 1JQ4A 1PYWD 1WH3A
chains in the Genus database with same CATH topology
1E6EB 4DQOC 4ZHOA 1XCTL 1UWMA 3AEBB 4OZCA 1T3QA 3RPFC 3R2TA 4DXGA 3EGRA 2AX5A 3Q8CA 1ZDVA 2MH7A 3SFDB 2I2YA 1N5XA 3V3XA 3J9CA 2WQYB 1PDXA 1D5XC 1XF5L 2MJDA 2E3TA 1BXTA 1ENFA 4YT0B 1PGBA 3GS2A 1FCCC 1C9FA 1J7CA 1JWAD 4TMAB 4N58A 4YTNB 2J53A 1VZ7A 4B0EA 2V3NA 2JX5A 4M0WA 4RNAA 1UNSA 1L4ZB 1ZE3D 1FNUA 5FKAC 1KLUD 1WYGA 3NUHB 2V0GA 2NTTA 4RGNA 1K53A 1EM7A 1WGKA 1XLPA 1L6UA 1I4QA 2JYEA 4JX1C 1YN3A 3ZQ4A 4C7ZA 3W1SA 1HA5A 1VDVA 1XLNA 1HEZE 3AEAB 1SSNA 3AEEB 2W55A 4J3OD 1I4PA 2INPE 4HEA1 1F2RC 2K22A 2X38A 4REZA 3PO0A 4C56C 3Q8EA 1AWDA 3LXFA 1L0YB 2FE8A 2Y5CA 4TSSA 3P42A 4P6VF 4A90A 1C79A 1I7HA 3ZJVA 1YQ3B 4N59A 3VRBB 1GB1A 3C8YA 1V1PB 4ZHPA 3FC4A 1SJHD 1JALA 2LFIA 3GB1A 1VR9A 2SEBD 2AQ2B 3EA6A 1TS3A 3NVZA 3BYTB 4ARCA 4FXCA 1N60A 1ZP0B 1SIJA 1YMHE 1D5MC 1FMAD 3I57A 1FCLA 4WURA 2W3RA 2KDMA 3SFEB 3AECB 3P1MA 2YEPB 4A8XC 2ONQA 3N9YC 1IBXB 5LNK1 1VZ8A 2PLPA 2WDVB 4NZLB 4MT5A 2DYMA 2BW2A 2WXMA 4ZRQA 1C4PA 3TUOA 2WXJA 3MC0B 3IAM1 2L83A 4OHJA 2W54A 2TSSA 2J52A 1QILA 3BK1A 1PGXA 4WIPA 2N7JA 3ZGZA 2WDRB 3KLSX 1E0ZA 1OQRA 2ZW1A 5C3JB 1V1OA 1QOFA 1E7PB 4USAA 1RM6C 5BYRA 4TQ1A 1L5PA 4EE2A 5EE0A 5AUKA 1ET9A 2AQ3B 2WXHA 4IOIE 2G9HD 1J7AA 1JW9D 4YSXB 1IGCA 4HJGE 4IKGA 1JCKB 1JWSD 1HQRD 1UGJA 3AE5B 1L0VB 1SEBD 5BMHA 5JXVA 1MVKA 1QOGA 4YWGG 1J7BA 4NJCA 1EU4A 1L4DB 2W82A 1IUEA 1V97A 2QMTA 3NS1A 2JWUA 4RFBA 1XEEA 1N61A 2GRIA 1B9RA 1C4CA 5H8YE 2H88B 2BS4B 3KWVA 2RPVA 1FXAA 2KAJA 1WRIA 2LJIA 2OHFA 2K5PA 4YSZB 2GI9A 4Q2JA 1PUTA 5C2TB 1HZ6A 3B9JA 1YN4A 4UDUC 4WQMA 2M19A 3AE7B 2IJ0A 5BYQA 4KKIA 3P63A 2E6XA 2L32A 5HG2A 3V05A 3W9CB 3ZYYX 5D3IB 3U7ZA 2ICIA 2SAKA 3SR6A 1FM0D 1TY0A 1DOYA 1E9MA 1GOZA 1TYGB 2JYTA 2LHDA 3FILB 4OW0A 3NZ3A 1QOAA 3Q8BA 3ABVB 1NYRA 1DOXA 1SB3C 1I4RA 1TZOA 3HVZA 2WU5B 2RDGA 2B76B 1K52A 1ROEA 2JQRB 4XDCA 1YQ4B 1CJEA 2YEPF 3T3OA 3E56A 4C80A 1FO4A 1FXIA 2WXQA 1VZ6A 1WSPA 3MHZA 1FNWA 2INNE 1CQVA 5EE1A 1CK1A 2GB1A 1ET6A 1MI0A 1STEA 4KKJA 1XLOA 4WH4A 2PKOA 3KWLA 1EWCA 5TSSA 4H2AA 3AE3B 2DYOA 2PTLA 2BS3B 4JWUC 2MEKA 1A70A 3TEWA 5FK9C 2G1EA 3AN1A 3FILA 4YSYB 5BYSA 2VZKD 3PZ7A 3U2SC 2WXGA 1KRHA 3LYYA 1AW7A 1R7SA 3RFZB 2KACA 4HROA 4YTPB 1ZPSA 4JE3B 1JROA 2DWQA 3VRAB 4PT5A 2M0AA 1N62A 4MH8A 4RF0A 1JWUD 1ZUD2 1FFVA 2CJOA 2LMCA 2VZKB 3AB5A 1FIQA 1SXTA 1FEHA 1TKEA 2Y3AA 1HXYD 4HRSA 1TS4A 2JZPA 2HDEA 2NTSA 4XWTA 3Q69A 4KGTA 2WDQB 2K9XA 3AE2B 2WS3B 4HKQA 5HI1A 4RCOA 1T5XD 4L1BA 2IGHA 5EE3A 5HHDG 4OZAA 1AYFA 2ACZB 3UI3A 1XCQL 1ZXHA 1NI3A 1YN5A 3LB8C 1RYJA 4GLSC 1FD6A 1VRAB 3NRZA 1KF6B 1SE4A 1RWSA 4LLGM 2QIEB 4AS1A 5E6JA 3SEBA 2W3SA 4RF1A 3WCQA 1WWTA 2JSVX 2PMVA 1C76A 1T6BX 3BK2A 3ETRA 1E10A 1FRDA 1LO5D 1OFFA 2H89B 2WXPA 1MHHE 2WXLA 2V4IB 3W5VB 1YNTE 1F0ZA 5BMIA 4C7YA 3TEYA 4OZBA 5T8IA 3ZJUA 4ARIA 2WXOA 4ITKA 1NYQA 2WU2B 3AEFB 2EELA 3AE4B 2D5GA 4NAWB 3URYA 2WXFA 1YJIA 1N5WA 3I9V1 1MHXA 2WXIA 3DWGC 3CWIA 3TSSA 2K3UA 2MJ3A 1QF6A 1TS5A 1QKZA 2KN4A 3AEDB 1C4AA 4P16A 2DLBA 4IDIA 2KMMA 2QILA 1K50A 1BUIC 1SF0A 2K0PA 3HVDA 1D4BA 4WAFA 3W2DA 2KQ4X 3IT6B 3GP7A 5D3DA 1VLBA 2CJNA 3B2FA 2BT6A 2ON8A 3U4EG 4XDDA 2PVOD 3W5UB 2V3PA 4RGOS 1JWMD 3AM9A 2PW9A 2QEJC 5EE9A 4ZRPA 3H8HA 1OQQA 1I4HA 2PIAA 2Y5PA 1BMLC 1FFUA 4KX6B 4LK0M 1JMLA 2L1AA 1GB4A 1XO3A 4RH6A 3FAHA 3R2IA 4US9A 1SE3A 2N9KA 4HKZE 2BBCA 3BVGA 4MM3B 1JWBD 1PGAA 2J42A 4XWWA 4CQNA 3BZDB 3KQ4A 3R8BA 3TEZA 2IGGA 2RMMA 4MACA 4AQ7A 2BB5A 2CU3A 4DXFA 1IGDA 1TKGA 2J4XA 3PZ8A 2M56B 3U52E 4YTMB 3B2GA 3IXSA 1L0XB 3ZJTA 1KH0A 2WP9B 2Z8LA 1B1ZA 2Q5WD 4LTUA 5D7GA 5G5GA 3T3NA 4R3DA 4ZOHC 1EWYC 2FUG1 1HZ5A 4D2KA 2RDHA 3AE9B 3AMZA 5AUIA 1N63A 3TEXA 2BYTA 2LEKA 2WXKA 3AEGB 1P7FA 2KWDA 1I4XA 3VR8B 2XNAC 5BMGA 1P7EA 1MPEA 4N6EB 4RGTA 1RFKA 1AN8A 2EKIA 1L6VA 3CIRB 1M4VA 4XE0A 2IDYA 2WNMA 1QOBA 5I4DA 1KFYB 1TKYA 2R61A 4TQ0A 4OVZA 4B0MA 2BS2B 1D5ZC 1Y56A 3VQIA 1C77A 1FNVA 4A6QA 2L52A 2IPKD 5H92C 1XXGA 3OWEB 5G5HA 1YJJA 4US8A 3P4SB 1WXQA 2BTEA 2LUMA 4GDLB 1SJED 4NAMA 3O13A 1XLQA 4WWMA 2N0SB 3P4QB 1V8CA 1NENB 2FBWB 3NVYA 1VJKA 3Q8AA 1KTKA 3BYYB 1QQRA 1UWXA 2XN9C 3MJ5A 3HUIA 2ZW0A 2MJEA 3AV8A 3MFGA 3L4PA 2HTME 2QJLA 3AH7A 1QT9A 3VR9B 1I4GA 1FRRA 1C78A 1PFDA 1ZXIA 1GAQB 1JRPA 1DYQA 4A9AA 3MP9A 1K51A 2LHEA 3P4RB 1TS2A 1V1PA 1Q10A 1SBBB 1ESFA 1ACCA 3AE8B 1ZOYB 3Q8FA 2WXRA 1F2RI 3IT4B 2LGIA 4JWSC 2QSDA 5GXGB 2JXTA 3NVVA 1NVID 2I38A 2JU6X 3IAS1 2DBYA 5FR3A 1IBXA 4KGSA 4GDKB 1CZPA 3AE6B 3BVZA 2WXNA 2NMQA 4O1NA 2BB6A 2PVGC 3P4PB 4L23A 3EUB2 4KGRA 1SE2A 1TJEA 4YXDB 3AE1B 1F77A 1EU3A 1QLBB 1DGJA 1ZDXA 3DWMA 3HRDD 5HFYA 3E9SA 3NVWA 2IGDA 2WLBA 3BIID 1D6EC 4RGMA 3BWUD 1GPXA 1NEKB 2OEDA 1TY2A 4ZYSA 4JPSA 5MPOA 3BVMA 1UUPA 1DOIA 2N9LA 1KLGD 2AQ1B 4A55A 1JQ4A 1PYWD 4L2YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MVK A;  3UI3 A;  1XCT L;  1XCQ L;  1ZXH A;  4OZC A;  1P7F A;  2KWD A;  2QMT A;  4GLS C;  2JWU A;  2I2Y A;  1FD6 A;  3V3X A;  5BMG A;  1P7E A;  1MPE A;  2RPV A;  1XF5 L;  2JSV X;  1PGB A;  1FCC C;  1C9F A;  2GI9 A;  2J53 A;  1HZ6 A;  1MHH E;  1YNT E;  5BMI A;  4OZB A;  5HG2 A;  1K53 A;  2EEL A;  1EM7 A;  2LUM A;  1HEZ E;  1MHX A;  2LHD A;  3FIL B;  1F2R C;  1QKZ A;  2KN4 A;  1UWX A;  1K50 A;  2K0P A;  2ZW0 A;  1K52 A;  1D4B A;  1GB1 A;  3GB1 A;  2KQ4 X;  3MP9 A;  1K51 A;  2LHE A;  1YMH E;  2ON8 A;  2GB1 A;  1Q10 A;  1MI0 A;  1FCL A;  4WH4 A;  2KDM A;  2PW9 A;  2ONQ A;  1F2R I;  1IBX B;  2LGI A;  2QSD A;  2PTL A;  2PLP A;  2JXT A;  1JML A;  2I38 A;  2JU6 X;  1GB4 A;  1IBX A;  4KGS A;  3FIL A;  2N9K A;  2NMQ A;  4HKZ E;  1PGA A;  4KGR A;  5JXV A;  2J52 A;  1PGX A;  2KAC A;  2N7J A;  2IGG A;  2RMM A;  4MAC A;  5HFY A;  2ZW1 A;  2IGD A;  1IGD A;  2OED A;  4IOI E;  2JZP A;  1KH0 A;  1IGC A;  4HJG E;  4KGT A;  2N9L A;  4IKG A;  5HI1 A;  4D2K A;  1HZ5 A;  5HHD G;  2IGH A;  4OZA A;  5BMH A; 
#chains in the Genus database with same CATH topology
 4DQO C;  1UWM A;  3AEB B;  2LAS A;  3RNG C;  1TTN A;  1WJN A;  2M0X A;  3AXC A;  3EGR A;  3Q8C A;  3SFD B;  3DVG X;  5TR5 A;  3QCA A;  1EUV B;  2MBQ A;  2FNJ B;  5DPS A;  2KNB A;  3QIJ A;  3H7S A;  1J7C A;  3B0A A;  4TMA B;  4N58 A;  3IBE A;  1VZ7 A;  2JX5 A;  2HD5 B;  1WIA A;  4M0W A;  5EDS A;  5FKA C;  1KLU D;  4IWP A;  4LNF A;  2V0G A;  5AEK B;  1GJZ A;  1L6U A;  4JX1 C;  4IM2 A;  1HA5 A;  3PT2 B;  1XLN A;  1SSN A;  3PHX B;  1I4P A;  4HEA 1;  2X38 A;  4REZ A;  3U30 A;  3PO0 A;  3Q8E A;  3P42 A;  4GGQ A;  1I7H A;  3WAP A;  2AWT A;  3C8Y A;  2ZCB A;  3FC4 A;  1JAL A;  2MSE D;  2LFI A;  2SEB D;  3RUI B;  3NVZ A;  4P1C C;  3BYT B;  1U4A A;  4W9F A;  3I57 A;  2KDM A;  2N4F A;  3ZLZ A;  2V4L A;  3RNB C;  3BY4 B;  4NZL B;  2HJ8 A;  4ZRQ A;  3ZNI D;  1WX7 A;  3TUO A;  1ZKH A;  2RSU A;  4LJP B;  3IAM 1;  2L83 A;  2FCN A;  2CU1 A;  3PVL A;  3QC8 B;  1V6E A;  2DX5 B;  3ZGZ A;  3KLS X;  2KK8 A;  5C3J B;  1QOF A;  2LUE A;  1RM6 C;  3Q3J A;  1L5P A;  2AQ3 B;  4KSK C;  1GG3 A;  1IGC A;  4HPL B;  3DPD A;  4LNK A;  4IKG A;  4XZ4 A;  4HPM B;  4RMA A;  1L0V B;  1WX9 A;  1QOG A;  4LJO B;  4IC7 B;  1WGY A;  4DHJ D;  4FN2 A;  4FHK A;  2W82 A;  2JWU A;  3APD A;  1C4C A;  5H8Y E;  2H88 B;  2BS4 B;  2KLG A;  2CKH B;  2KDB A;  1WRI A;  2ZVO A;  3UGB B;  2K5P A;  3RZF A;  2GI9 A;  1PUT A;  1E7U A;  5C2T B;  2ZCC A;  1HTQ A;  2KXJ A;  1YX6 B;  2JZZ A;  3P63 A;  2L32 A;  5HG2 A;  2M1M A;  2MW5 A;  2IND C;  3W9C B;  3WAM A;  5D6J B;  1FM0 D;  5DPR A;  2C60 A;  1E9M A;  2IO3 B;  1RRB A;  1Q5W B;  4FJV B;  1GOZ A;  3FIL B;  4NPN A;  3W1Y A;  1QOA A;  3Q8B A;  4F1S A;  1I4R A;  1TZO A;  3IVF A;  2DAF A;  1F1H A;  3HVZ A;  2RDG A;  1OTR B;  1K52 A;  2B76 B;  2QDF A;  1CJE A;  4C80 A;  1FO4 A;  1OEY A;  4GU2 A;  1WF9 A;  3MJW A;  3MHZ A;  3B1L X;  2BKR B;  2RD0 A;  1CK1 A;  4HWI B;  2INC C;  3RUL A;  1STE A;  1IPG A;  4M00 A;  4MDK E;  1XLO A;  1WXA A;  4M02 A;  4C4V B;  4F7Z A;  4A20 A;  3AE3 B;  2DYO A;  3NOB A;  4II2 B;  3TEW A;  2G1E A;  1GC7 A;  3VXW A;  3PZ7 A;  2WXG A;  3LYY A;  5L83 A;  3RNE C;  3EFU A;  2O2V B;  1V86 A;  1UF0 A;  4HRO A;  4YTP B;  2JXX A;  3UF8 A;  4JE3 B;  2DWQ A;  3VRA B;  2LMC A;  4MM3 A;  2CJO A;  3JW0 X;  4HRS A;  1FEH A;  4AOF A;  4DXA B;  1TS4 A;  4NQL B;  2LJ5 A;  3VTV A;  2EMS A;  3Q69 A;  4KGT A;  2K9X A;  2WS3 B;  3NJT A;  5HI1 A;  4HCN B;  4K3B A;  2K25 A;  2L0F A;  5HHD G;  4OZA A;  2GBR A;  3NG0 A;  1XCQ L;  1NI3 A;  2KDF B;  3LB8 C;  4GLS C;  4F8C B;  3DDC B;  3N1X C;  2MBH A;  2MA9 B;  4LLG M;  3VH3 B;  3FKY A;  3SEB A;  3WAL A;  3HK0 A;  4RF1 A;  3TCA A;  4P1B C;  4I6P A;  3QAQ A;  3QX1 A;  1T6B X;  1E10 A;  1FRD A;  3VDZ A;  1LO5 D;  1OFF A;  2XK5 A;  2LRW A;  1MHH E;  3PTF C;  1F0Z A;  4M8M A;  1OGW A;  1NYQ A;  3AU5 A;  4HXD A;  3URY A;  1WM3 A;  2WXF A;  2BYV E;  3DWG C;  3CWI A;  4DHJ B;  3AED B;  1QKZ A;  1JRU A;  4JIO U;  2V3S A;  2LZ6 A;  3ECI A;  1BUI C;  1WGD A;  1Y8R C;  3W2D A;  5DCN A;  3IT6 B;  1WGH A;  2LI5 A;  2ON8 A;  3U4E G;  2KFK A;  2W9N A;  1T0Q C;  3AM9 A;  2QEJ C;  1OQQ A;  1R4M I;  2Y5P A;  2NS5 A;  1BML C;  4RH6 A;  3OG5 A;  2KJH B;  3RNC C;  3MC8 A;  1SE3 A;  3L08 A;  1JWB D;  3KUZ A;  4DK5 A;  2BQQ A;  4GMV A;  4GDK A;  4XWW A;  4CQN A;  2BGF A;  2L05 A;  4HDO A;  3BZD B;  4AJW A;  1UH6 A;  2RMM A;  4AQ7 A;  4TUU A;  3KUD B;  1IGD A;  3A9J A;  2GMI C;  2J4X A;  2M56 B;  3U52 E;  3IXS A;  3ZJT A;  4OVV A;  5G5G A;  3VVW B;  2D2Q A;  3AMZ A;  5AUI A;  3M95 A;  1MJD A;  3R3M A;  4BKS A;  1I4X A;  2XNA C;  3DBS A;  5BMG A;  1PQS A;  1RFK A;  2KKC A;  3QQ8 B;  3LJ3 A;  2EKI A;  3CIR B;  4XE0 A;  2IDY A;  3L13 A;  1X1M A;  4B0M A;  3SHQ A;  1D5Z C;  1Y56 A;  3MC9 A;  2D3B A;  4AWJ A;  3VQI A;  3PS6 A;  1C77 A;  4JLC A;  3N1Y C;  3APC A;  1V9J A;  2LUM A;  3UIN B;  1SIF A;  3N30 A;  3P4Q B;  3NVY A;  1NEN B;  4MGY E;  4A3P A;  3BYY B;  3GE3 C;  1UWX A;  2Y5B B;  1EF1 A;  3H6N A;  4I6N B;  1NI2 A;  2MJE A;  3MFG A;  3S2A A;  1QT9 A;  3VR9 B;  1I4G A;  1C78 A;  2NBU A;  1GAQ B;  3PLV A;  1JRP A;  1MFW A;  1TS2 A;  1Q10 A;  2WXR A;  2I38 A;  3TJP A;  2DBY A;  4NJ7 A;  5FR3 A;  4O1N A;  2NMQ A;  4ASW C;  2FID A;  4E74 A;  4WJO A;  4BZA A;  2L76 A;  3AE1 B;  5IOI A;  2J0K A;  2C9W B;  4K3C A;  4WWP A;  4IM0 A;  2KWV B;  1GPX A;  2OED A;  2KYW A;  4JPS A;  3T8M A;  1UUP A;  1WR6 E;  1KLG D;  4AUQ C;  4DDG D;  4KDI C;  3OAW A;  1C1Y B;  3RMK C;  1E6E B;  1T3Q A;  4II3 B;  2AX5 A;  2NCN A;  3GZN I;  3V3X A;  2N9P C;  5DPW A;  1PDX A;  4BKT A;  3ZRF A;  2MJD A;  2LXA A;  4YT0 B;  1WI0 A;  1PGB A;  3GS2 A;  5KHQ A;  2ZJD A;  1JWA D;  1WZ3 A;  4B0E A;  2V3N A;  2IY1 B;  2GBJ A;  1UNS A;  1L4Z B;  1ZE3 D;  1FNU A;  4MSQ B;  3ZW3 A;  2LVO A;  2KWU B;  1KOT A;  1XLP A;  2JF5 A;  1I4Q A;  1YN3 A;  3KUC B;  3AEE B;  4J3O D;  3VTW A;  4N9F 4;  4C56 C;  2FE8 A;  3U7D A;  4P6V F;  4A90 A;  3EFC A;  2MBB B;  3ZJV A;  1YQ3 B;  4NNJ B;  3VRB B;  1GB1 A;  1V1P B;  4ZHP A;  3NY5 A;  3PHW B;  3GB1 A;  5AZG A;  1VR9 A;  4PYZ A;  2RPQ A;  4ARC A;  1LXD A;  4C00 A;  1SIJ A;  1YMH E;  1D5M C;  2CHW A;  2G4D B;  1FCL A;  3SFE B;  3AEC B;  2L00 B;  2KZR A;  4MT5 A;  2WXM A;  3NZU A;  1C4P A;  4IUM B;  4IW0 A;  3MC0 B;  4OHJ A;  2TSS A;  3BK1 A;  1PGX A;  2JUO A;  2N7J A;  2Z59 B;  2WDR B;  5AZH A;  3DVG Y;  1E0Z A;  2O2V A;  4EE2 A;  2FIF A;  2LRU A;  4IOI E;  2KTR A;  1I35 A;  1JCK B;  1JWS D;  3VUW A;  3DBL B;  3AE5 B;  4W9L A;  1V80 A;  3UIO B;  1SEB D;  1MVK A;  3Q3N C;  3DBR B;  4NJC A;  2PEA A;  1V97 A;  2QMT A;  3NS1 A;  1LFD A;  1FXA A;  2EMT A;  3ML9 A;  4G3X B;  2KJR A;  4BVU C;  3R7Q A;  1HZ6 A;  3B9J A;  1J19 A;  1YN4 A;  5LXI B;  4UDU C;  3R7R A;  2IJ0 A;  3ZRC A;  4KKI A;  3N32 A;  4PS3 A;  2E6X A;  3Q3F A;  3PGE A;  3IG3 A;  3ZYY X;  4EOY A;  1R4N I;  2ICI A;  4AJY B;  4HDQ A;  4HJK A;  1DOY A;  5JHA A;  5LLI A;  2LHD A;  3DVN U;  3RZW C;  3PV1 A;  2LVP A;  2MRP A;  2KJ6 A;  2JQR B;  4XDC A;  2YEP F;  3T3O A;  2MWS B;  2INN E;  5EE1 A;  3OJ3 A;  4KKJ A;  1WRD B;  4DDI D;  4WH4 A;  3DHH C;  1EWC A;  3RD2 A;  4H2A A;  4A3O A;  2PTL A;  4WAA A;  1VD2 A;  2ZZP B;  2WGS A;  1T0S C;  4YSY B;  2AL3 A;  3L10 B;  1J0G A;  1KRH A;  4GN1 A;  1R7S A;  1S1Q B;  4W9C A;  3JVZ X;  1WMH A;  3A9K A;  2M0A A;  4EUT A;  3AB5 A;  2FAZ A;  1HXY D;  3MTN B;  3ZNG C;  2NBW B;  2HDE A;  2NTS A;  4MEL A;  3CST A;  4HKQ A;  3JYU A;  2IGH A;  2MP2 B;  5IN7 A;  2IY0 B;  1YN5 A;  3O65 B;  2KHW B;  1RYJ A;  1VRA B;  2NVU I;  1KF6 B;  1RWS A;  2CHZ A;  2QIE B;  4AS1 A;  1WZ0 A;  1WR1 A;  2W3S A;  3WCQ A;  2ZPN A;  3APF A;  1ZGU B;  1C76 A;  2H89 B;  3JSV B;  2WXP A;  2WXL A;  4XX5 A;  1YNT E;  4C7Y A;  3TEY A;  2AYO B;  2WXO A;  2WU2 B;  3AE4 B;  2WX1 A;  1GNU A;  3I9V 1;  2ZVN A;  2D10 A;  1QF6 A;  1D3Z A;  2D3A A;  2MLB A;  2DLB A;  3VUX A;  2QIL A;  4FAD A;  2N7D A;  1D4B A;  3RN9 C;  4HK2 A;  5D3D A;  2D3C A;  2BWF A;  2PVO D;  4K1R B;  3ZXV A;  4RGO S;  4K81 A;  1KM7 A;  1JWM D;  3ZDT A;  5G2N A;  2FUH B;  3TL5 A;  4EZL A;  5EE9 A;  2RDB C;  2LGX A;  2PJH A;  5D94 A;  1T0R C;  2PIA A;  1FFU A;  3KYC D;  5CHW A;  3FAH A;  2G3Q B;  5IP4 D;  4HKZ E;  2BBC A;  2FCM A;  1WXS A;  3BVG A;  1PGA A;  3LDZ E;  3UIP B;  1E8Y A;  2K6Q A;  1UZX B;  2CU3 A;  3PRE A;  3B2G A;  1XT9 B;  2WP9 B;  4WWN A;  4K7W A;  2KWC A;  5CHV C;  3T3N A;  4R3D A;  3GOE A;  4ZOH C;  1EWY C;  1HZ5 A;  4P7I A;  2RDH A;  1N63 A;  4W9J A;  3TEX A;  3CF6 E;  3AEG B;  1P7F A;  3V6C B;  2IO2 B;  1AN8 A;  3AU4 A;  1YIW A;  3P2B A;  2WNM A;  4MJS B;  5I4D A;  1SE9 A;  1KFY B;  3QA8 A;  3ZIM A;  2BYF A;  4TQ0 A;  5GMV A;  1WY8 A;  3Q3M C;  2BS2 B;  1MG4 A;  2D07 B;  2L52 A;  2IPK D;  3H7P A;  5G5H A;  1WE7 A;  4US8 A;  3PRP B;  4GDL B;  4TV3 A;  1UD7 A;  4NQK E;  3VTU A;  4RM8 A;  3TBL D;  3PLU A;  1V5T A;  4WJP A;  4LDT D;  3Q8A A;  1S3S G;  3QHT A;  2CS4 A;  3HUI A;  3SU8 X;  2C7M B;  3ZVV A;  2QJL A;  4W9I A;  1PFD A;  5KHO A;  4A9A A;  1K51 A;  5LXH A;  4FUL A;  1V1P A;  1ZOY B;  1F2R I;  4FLH A;  2MBE A;  2WHI A;  2JT4 B;  2QSD A;  2JXT A;  1NVI D;  2KOX A;  4FBJ B;  4PS8 A;  3SD5 A;  1R4M B;  1CZP A;  4NJ6 A;  2WXN A;  2GLS A;  3PPA A;  3UQB A;  2J0M A;  1SE2 A;  4YXD B;  3V61 A;  1F77 A;  2G45 B;  4BOZ B;  1EU3 A;  5IKC M;  3HM6 X;  1QLB B;  1ZDX A;  3A33 B;  2C7N B;  5HFY A;  2GOW A;  2KMA A;  3WA0 A;  2WLB A;  3BII D;  1D6E C;  4M0W B;  4M8N A;  4RGM A;  3BWU D;  3KVF B;  4FA6 A;  5MPO A;  1UEL A;  4ANX A;  3BVM A;  2AQ1 B;  3B08 A;  2C5L C;  4ZHO A;  4OZC A;  4DXG A;  1ZDV A;  3UQA A;  2I2Y A;  1N5X A;  2DZI A;  2OJR A;  1IP9 A;  2K8C A;  4ICU A;  1XF5 L;  1TGZ B;  2V9H A;  3ZUN A;  2M17 A;  1ENF A;  2HJ1 A;  4WQO B;  4YTN B;  1HE8 A;  2J53 A;  2D3G A;  2BYE A;  4I6L B;  3RI7 C;  4WJN A;  4WJQ A;  2UWQ A;  1WYG A;  2NPT A;  3NUH B;  4RGN A;  1K53 A;  1EM7 A;  1WGK A;  2JYE A;  4C7Z A;  1WGR A;  1VDV A;  3AEA B;  2EKE C;  2REX A;  1F2R C;  1E8Z A;  4S17 A;  3N1Z C;  1L0Y B;  1G6J A;  2KLC A;  4N59 A;  4KDL B;  4NY0 A;  1YD8 U;  1SJH D;  3RT3 B;  2MCN B;  1L7Y A;  1TS3 A;  4B95 A;  3H1U A;  3DQV A;  4EZJ A;  1FMA D;  3EC8 A;  2JPH A;  4KIK B;  2W3R A;  4A8X C;  2ONQ A;  1LQB A;  3N9Y C;  1IBX B;  1F9J A;  4IM3 A;  1VZ8 A;  4DBG A;  2WDV B;  3T9L A;  4ANU A;  5C1Z A;  4LDT B;  2LXC A;  2J52 A;  4WIP A;  1OQR A;  1V1O A;  4YL8 A;  1E7P B;  4DHZ B;  5BYR A;  2DHZ A;  1WGG A;  4ICV A;  5AUK A;  1ET9 A;  3OLM D;  2G9H D;  1J7A A;  1V5O A;  4HJG E;  3HHM A;  1TBE A;  4W9K A;  5JZE B;  5BMH A;  5JXV A;  2B3A A;  4GSW A;  1IUE A;  1N61 A;  3N20 C;  3GZN B;  4EFO A;  3C0R B;  2BVC A;  2OHF A;  4YSZ B;  2Z0D B;  1P9D U;  4ANV A;  4WQM A;  2K1F A;  2M19 A;  2HTH A;  4MH0 E;  3JSV A;  5D3I B;  2SAK A;  2M4N A;  1TY0 A;  2X8X X;  1K8R B;  2JRI B;  3NZ3 A;  3ABV B;  1NYR A;  1SB3 C;  1L2N A;  5G55 A;  3AI5 A;  3R66 C;  5C23 A;  1YQ4 B;  1ZW7 A;  3E56 A;  1FXT B;  2JRH A;  3D32 A;  3N3K B;  4LNN A;  1FXI A;  2WXQ A;  1WSP A;  1WX8 A;  1FNW A;  3M62 B;  1CQV A;  5IAA C;  1ET6 A;  4XGA B;  2N1V A;  2PKO A;  1Q0W B;  4M01 A;  5TSS A;  4S0R A;  3QJZ A;  4JWU C;  2LGS A;  2MEK A;  1A70 A;  4AP4 C;  5FK9 C;  2KT7 A;  3AN1 A;  3FIL A;  5BYS A;  3U2S C;  2O6V D;  5AZF A;  1AW7 A;  3RFZ B;  2KAC A;  1YX5 B;  1ZPS A;  2KDE B;  1JRO A;  4BKG A;  4RF0 A;  2VZK B;  1FFV A;  1FIQ A;  1SXT A;  2WWZ A;  3DHI C;  2JZP A;  4ZRI A;  1MG8 A;  2I1K A;  3C19 A;  4BBN C;  4RCO A;  4C4V A;  4L1B A;  5EE3 A;  4FJZ A;  1AYF A;  1OEY J;  2ACZ B;  3UI3 A;  1ZXH A;  1FD6 A;  3NRZ A;  3DOW A;  1SE4 A;  3V6E B;  5E6J A;  1E8X A;  1TIF A;  2JSV X;  3V62 A;  3BK2 A;  3ETR A;  3CSF A;  4HCP B;  2BWE S;  5BO4 B;  2KFK B;  2V4I B;  3HM3 A;  3W5V B;  4MJS A;  1WJ6 A;  3ZJU A;  2K6D B;  2BF8 B;  2DYB A;  4ITK A;  2LGD A;  4NAW B;  2K8H A;  4GXB A;  1YJI A;  2R2Q A;  1AAR A;  2WXI A;  3TSS A;  1LGR A;  4TKN A;  2MJ3 A;  5L95 C;  1R4N B;  4P16 A;  4GDL A;  4IDI A;  1WFY A;  1SF0 A;  1P1A A;  4E3C A;  3RCZ A;  1KJT A;  3M3J A;  1IYF A;  2KQ4 X;  5JH5 C;  2JZ3 B;  1Q1O A;  2BT6 A;  2KQS A;  2L3Z A;  2V3P A;  3U8Z A;  1F52 A;  1TZ1 A;  2PW9 A;  1ISN A;  3IFW B;  3TIX A;  1I4H A;  4KX6 B;  4KSL C;  2L1A A;  2OOB B;  3ZDM C;  1VCB A;  1I42 A;  3VUY A;  2JWZ A;  5DPT A;  3ZTD A;  2J42 A;  3L16 A;  1E8W A;  2IO1 B;  3RNA C;  1YJ1 A;  2KN5 A;  4GB9 A;  3KQ4 A;  1P3Q U;  2IGG A;  3WIM A;  4DXF A;  3TMP B;  1TKG A;  3PZ8 A;  2J0J A;  2V1Y A;  4YTM B;  2KFJ A;  1B1Z A;  4LTU A;  5D7G A;  3IHP C;  3QK0 A;  4D2K A;  4JL9 A;  3AE9 B;  2WXK A;  3L54 A;  3EEC A;  2L8J A;  2KWD A;  2KC2 A;  4N6E B;  1LM8 B;  3KYD D;  2O6V B;  4JQW C;  1L6V A;  1M4V A;  4HPP A;  5IO9 A;  2ZEQ A;  1TKY A;  2R61 A;  1KLV A;  4OVZ A;  3PRZ A;  3ZNH B;  2QCZ A;  1E7V A;  5H92 C;  2PE9 A;  3OWE B;  2BTE A;  4K7U A;  4MEM A;  4WWM A;  2N0S B;  1QQR A;  4EZK A;  3AV8 A;  3L4P A;  4ZYN A;  3KH0 A;  1YOV B;  1ZXI A;  4OVU A;  1DYQ A;  2ZNV C;  4X57 B;  3MP9 A;  2LGY A;  3M63 B;  2KD0 A;  3AE8 B;  1ACC A;  5J2R A;  3IT4 B;  2XBB C;  2JU6 X;  4KIK A;  3I5J C;  3IAS 1;  1IBX A;  4BFR A;  1H4R A;  3BVZ A;  3VH4 B;  2BB6 A;  1J8C A;  1UBQ A;  3EUB 2;  4DWF A;  5HKH A;  4FJY A;  2KX3 A;  3HRD D;  2GBM A;  3E9S A;  4KVG B;  2IGD A;  2I1J A;  2MBO A;  1NEK B;  4B6W A;  4ZYS A;  1DOI A;  4W9D A;  3ZKJ C;  4J6I A;  4L2Y A;  1XCT L;  4KZ0 A;  3RPF C;  3R2T A;  1V81 A;  2MH7 A;  4E71 A;  4URK A;  3J9C A;  2AEH A;  2WQY B;  1D5X C;  2E3T A;  4MGZ E;  4XYC A;  1BXT A;  4HLE A;  3K9P B;  3ZTC A;  1FCC C;  1C9F A;  2MX2 A;  2WYQ A;  5CTR C;  4RNA A;  1WXV A;  3EHV A;  3A1Q B;  2GBK A;  1RAX A;  2NTT A;  2KVZ A;  2IBI B;  1P98 A;  2FCQ A;  1Z5S B;  3DBH B;  4GOC A;  3ZQ4 A;  3W1S A;  2KAN A;  1HEZ E;  2W55 A;  3PZD A;  3DCG A;  4XC2 A;  2WDT B;  2INP E;  2DZJ A;  3A4R A;  2GBN A;  2K22 A;  2N7E A;  4BBN F;  1AWD A;  3LXF A;  2Y5C A;  4TSS A;  2PE6 B;  1C79 A;  2DAJ A;  2XEW A;  2LVQ A;  3SDL C;  5JHB A;  1WJ4 A;  3DBH I;  2AQ2 B;  3EA6 A;  3PSE B;  5D2M B;  4FXC A;  1N60 A;  1ZP0 B;  4ACF A;  2KTR B;  4WUR A;  3P1M A;  2YEP B;  3MHS D;  5LNK 1;  3Q2A C;  4W9E A;  2IO0 B;  2PLP A;  2DYM A;  2BW2 A;  2KMC A;  2M8S A;  2WXJ A;  2W54 A;  1QIL A;  1SGH A;  1UGM A;  4FHJ A;  2KVR A;  2VH1 A;  3PRM B;  2QC8 A;  2D11 A;  2ZW1 A;  4USA A;  2KDI A;  4TQ1 A;  5EE0 A;  2CR5 A;  2WXH A;  2K39 A;  3WAO A;  1JW9 D;  4YSX B;  4LNI A;  2PPH A;  1EO6 A;  1HQR D;  1UGJ A;  3Q6B A;  2N9E B;  5J18 A;  2VH2 A;  3ENE A;  4YWG G;  1J7B A;  1EU4 A;  1L4D B;  4RFB A;  4DHZ E;  1V49 A;  3WAN A;  1XEE A;  3NZS A;  2GRI A;  3ZXR A;  4JGH B;  4PYU A;  1B9R A;  1RFA A;  3KWV A;  2RPV A;  2JVC A;  2KAJ A;  4PK1 A;  2LJI A;  3L0W B;  4Q2J A;  3KW5 B;  5CX3 A;  1RLF A;  3AE7 B;  5BYQ A;  2G4S A;  3V60 A;  3V05 A;  3U7Z A;  3SR6 A;  2NBV B;  2BPS A;  4WWO A;  2A4Z A;  3A4S C;  1TYG B;  2JYT A;  1WM2 A;  4OW0 A;  4PS7 A;  1DOX A;  4NAW A;  4LNO A;  4MGK E;  2RR9 A;  2WU5 B;  2FCS A;  1ROE A;  1WMH B;  1T0Y A;  3A9K B;  4HVB A;  2MHJ A;  1VZ6 A;  3AUL A;  2GB1 A;  1MI0 A;  4W9G A;  3KWL A;  4CHK A;  2KQ7 A;  2DZM A;  2BS3 B;  1E90 A;  4CO7 A;  3K9O B;  2VRR B;  2VZK D;  2NR2 A;  4ZRJ A;  2L0T A;  1WE6 A;  1H8C A;  1NBF C;  4PT5 A;  1N62 A;  2YVC A;  4MH8 A;  1JWU D;  1ZUD 2;  2Y3A A;  1TKE A;  2Z0E B;  4RM9 A;  4XWT A;  3QAR A;  2WX0 A;  2WDQ B;  1GC6 A;  3AE2 B;  2N9X A;  1T5X D;  5CHF A;  4MSM B;  2KX0 A;  2ASQ A;  2KTF A;  2JY6 A;  2UU7 A;  4QAY A;  4G11 A;  1XD3 B;  1WJU A;  3GE8 C;  4LCD E;  3X0W A;  2DNF A;  1WWT A;  2PMV A;  5FR6 A;  4EKU A;  2KC1 A;  2AL6 A;  2L7R A;  2O6V A;  5BMI A;  2OJW A;  4OZB A;  5T8I A;  4ARI A;  3AEF B;  3OJ4 B;  5E6O A;  2EEL A;  2R2O A;  2D5G A;  4ZRK A;  3VAW A;  2MP2 A;  1V2Y A;  1N5W A;  1MHX A;  2K3U A;  4IWO A;  1GUA B;  1TS5 A;  2KN4 A;  1C4A A;  2KMM A;  1Z2M A;  2C7H A;  1K50 A;  1M94 A;  2K0P A;  3BIN A;  3HVD A;  4WAF A;  3L17 A;  3GP7 A;  1VLB A;  1HTO A;  2CJN A;  4IG7 B;  3B2F A;  2YLM A;  4XDD A;  1CMX B;  3W5U B;  4BOS C;  4BKS D;  1EF5 A;  2HE7 A;  4ZRP A;  3H8H A;  4LK0 M;  1JML A;  1P0R A;  3ZO5 B;  1GB4 A;  1XO3 A;  2MQJ A;  3R2I A;  4US9 A;  2N9K A;  3ONS A;  4ANW A;  3ZNZ B;  2J7Q B;  4MM3 B;  3CMM B;  2RGF A;  5J17 A;  2KO3 A;  3R8B A;  1UBI A;  1OQY A;  2QHO A;  3TEZ A;  4MAC A;  2BB5 A;  3RYT A;  3DVN V;  2DEN B;  4IWQ A;  2BKF A;  1L0X B;  1KH0 A;  3RNF C;  1WYW B;  2LWP A;  2Z8L A;  2A5U A;  2Q5W D;  3H7P B;  2FUG 1;  4BAX A;  3I63 C;  2LD9 A;  2BYT A;  2LEK A;  4W9H A;  1NDD A;  4EEW A;  3VR8 B;  1WXM A;  1N6Z A;  5E6N A;  1P7E A;  1MPE A;  4RGT A;  2XK5 B;  3ML8 A;  1QOB A;  4G50 A;  5E6P A;  4G0N B;  1E5W A;  5IA7 A;  1FNV A;  4A6Q A;  1XXG A;  1YJJ A;  4MGI E;  3P4S B;  1WXQ A;  3I3T B;  4KZC A;  1SJE D;  4NAM A;  2IYD B;  3O13 A;  3Q3O C;  1XLQ A;  3HIZ A;  3Q14 C;  1FPY A;  3A1Q A;  1V8C A;  2FBW B;  1VJK A;  3VHT C;  1KTK A;  3MJ5 A;  2XN9 C;  4ZDV A;  1BT0 A;  2ZW0 A;  4K7S A;  1A5R A;  2HTM E;  3AH7 A;  1FRR A;  3VFK A;  4CYE A;  3P4R B;  3X23 A;  2LHE A;  3QWZ B;  1SBB B;  1ESF A;  1TT5 B;  2UYZ B;  3NHE B;  3Q8F A;  2DZK A;  2LGI A;  4JWS C;  5GXG B;  3W1S C;  3NVV A;  4GIV A;  4KGS A;  4GDK B;  2K8B A;  3AE6 B;  2PVG C;  4B9K A;  1YQB A;  3P4P B;  4L23 A;  4KGR A;  1TJE A;  3A9J B;  2CHX A;  1C3T A;  1DGJ A;  3ALB A;  4KV2 A;  3DWM A;  1XQQ A;  2ZNV B;  2ZPY A;  3NVW A;  2IZV B;  3NS8 A;  1QZE A;  3DHG C;  3H9D A;  3DBL I;  1TY2 A;  2NPT B;  2N9L A;  3DBR I;  2N1W A;  4A55 A;  1JQ4 A;  1PYW D;  1WH3 A; 
#chains in the Genus database with same CATH homology
 1E6E B;  4DQO C;  4ZHO A;  1XCT L;  1UWM A;  3AEB B;  4OZC A;  1T3Q A;  3RPF C;  3R2T A;  4DXG A;  3EGR A;  2AX5 A;  3Q8C A;  1ZDV A;  2MH7 A;  3SFD B;  2I2Y A;  1N5X A;  3V3X A;  3J9C A;  2WQY B;  1PDX A;  1D5X C;  1XF5 L;  2MJD A;  2E3T A;  1BXT A;  1ENF A;  4YT0 B;  1PGB A;  3GS2 A;  1FCC C;  1C9F A;  1J7C A;  1JWA D;  4TMA B;  4N58 A;  4YTN B;  2J53 A;  1VZ7 A;  4B0E A;  2V3N A;  2JX5 A;  4M0W A;  4RNA A;  1UNS A;  1L4Z B;  1ZE3 D;  1FNU A;  5FKA C;  1KLU D;  1WYG A;  3NUH B;  2V0G A;  2NTT A;  4RGN A;  1K53 A;  1EM7 A;  1WGK A;  1XLP A;  1L6U A;  1I4Q A;  2JYE A;  4JX1 C;  1YN3 A;  3ZQ4 A;  4C7Z A;  3W1S A;  1HA5 A;  1VDV A;  1XLN A;  1HEZ E;  3AEA B;  1SSN A;  3AEE B;  2W55 A;  4J3O D;  1I4P A;  2INP E;  4HEA 1;  1F2R C;  2K22 A;  2X38 A;  4REZ A;  3PO0 A;  4C56 C;  3Q8E A;  1AWD A;  3LXF A;  1L0Y B;  2FE8 A;  2Y5C A;  4TSS A;  3P42 A;  4P6V F;  4A90 A;  1C79 A;  1I7H A;  3ZJV A;  1YQ3 B;  4N59 A;  3VRB B;  1GB1 A;  3C8Y A;  1V1P B;  4ZHP A;  3FC4 A;  1SJH D;  1JAL A;  2LFI A;  3GB1 A;  1VR9 A;  2SEB D;  2AQ2 B;  3EA6 A;  1TS3 A;  3NVZ A;  3BYT B;  4ARC A;  4FXC A;  1N60 A;  1ZP0 B;  1SIJ A;  1YMH E;  1D5M C;  1FMA D;  3I57 A;  1FCL A;  4WUR A;  2W3R A;  2KDM A;  3SFE B;  3AEC B;  3P1M A;  2YEP B;  4A8X C;  2ONQ A;  3N9Y C;  1IBX B;  5LNK 1;  1VZ8 A;  2PLP A;  2WDV B;  4NZL B;  4MT5 A;  2DYM A;  2BW2 A;  2WXM A;  4ZRQ A;  1C4P A;  3TUO A;  2WXJ A;  3MC0 B;  3IAM 1;  2L83 A;  4OHJ A;  2W54 A;  2TSS A;  2J52 A;  1QIL A;  3BK1 A;  1PGX A;  4WIP A;  2N7J A;  3ZGZ A;  2WDR B;  3KLS X;  1E0Z A;  1OQR A;  2ZW1 A;  5C3J B;  1V1O A;  1QOF A;  1E7P B;  4USA A;  1RM6 C;  5BYR A;  4TQ1 A;  1L5P A;  4EE2 A;  5EE0 A;  5AUK A;  1ET9 A;  2AQ3 B;  2WXH A;  4IOI E;  2G9H D;  1J7A A;  1JW9 D;  4YSX B;  1IGC A;  4HJG E;  4IKG A;  1JCK B;  1JWS D;  1HQR D;  1UGJ A;  3AE5 B;  1L0V B;  1SEB D;  5BMH A;  5JXV A;  1MVK A;  1QOG A;  4YWG G;  1J7B A;  4NJC A;  1EU4 A;  1L4D B;  2W82 A;  1IUE A;  1V97 A;  2QMT A;  3NS1 A;  2JWU A;  4RFB A;  1XEE A;  1N61 A;  2GRI A;  1B9R A;  1C4C A;  5H8Y E;  2H88 B;  2BS4 B;  3KWV A;  2RPV A;  1FXA A;  2KAJ A;  1WRI A;  2LJI A;  2OHF A;  2K5P A;  4YSZ B;  2GI9 A;  4Q2J A;  1PUT A;  5C2T B;  1HZ6 A;  3B9J A;  1YN4 A;  4UDU C;  4WQM A;  2M19 A;  3AE7 B;  2IJ0 A;  5BYQ A;  4KKI A;  3P63 A;  2E6X A;  2L32 A;  5HG2 A;  3V05 A;  3W9C B;  3ZYY X;  5D3I B;  3U7Z A;  2ICI A;  2SAK A;  3SR6 A;  1FM0 D;  1TY0 A;  1DOY A;  1E9M A;  1GOZ A;  1TYG B;  2JYT A;  2LHD A;  3FIL B;  4OW0 A;  3NZ3 A;  1QOA A;  3Q8B A;  3ABV B;  1NYR A;  1DOX A;  1SB3 C;  1I4R A;  1TZO A;  3HVZ A;  2WU5 B;  2RDG A;  2B76 B;  1K52 A;  1ROE A;  2JQR B;  4XDC A;  1YQ4 B;  1CJE A;  2YEP F;  3T3O A;  3E56 A;  4C80 A;  1FO4 A;  1FXI A;  2WXQ A;  1VZ6 A;  1WSP A;  3MHZ A;  1FNW A;  2INN E;  1CQV A;  5EE1 A;  1CK1 A;  2GB1 A;  1ET6 A;  1MI0 A;  1STE A;  4KKJ A;  1XLO A;  4WH4 A;  2PKO A;  3KWL A;  1EWC A;  5TSS A;  4H2A A;  3AE3 B;  2DYO A;  2PTL A;  2BS3 B;  4JWU C;  2MEK A;  1A70 A;  3TEW A;  5FK9 C;  2G1E A;  3AN1 A;  3FIL A;  4YSY B;  5BYS A;  2VZK D;  3PZ7 A;  3U2S C;  2WXG A;  1KRH A;  3LYY A;  1AW7 A;  1R7S A;  3RFZ B;  2KAC A;  4HRO A;  4YTP B;  1ZPS A;  4JE3 B;  1JRO A;  2DWQ A;  3VRA B;  4PT5 A;  2M0A A;  1N62 A;  4MH8 A;  4RF0 A;  1JWU D;  1ZUD 2;  1FFV A;  2CJO A;  2LMC A;  2VZK B;  3AB5 A;  1FIQ A;  1SXT A;  1FEH A;  1TKE A;  2Y3A A;  1HXY D;  4HRS A;  1TS4 A;  2JZP A;  2HDE A;  2NTS A;  4XWT A;  3Q69 A;  4KGT A;  2WDQ B;  2K9X A;  3AE2 B;  2WS3 B;  4HKQ A;  5HI1 A;  4RCO A;  1T5X D;  4L1B A;  2IGH A;  5EE3 A;  5HHD G;  4OZA A;  1AYF A;  2ACZ B;  3UI3 A;  1XCQ L;  1ZXH A;  1NI3 A;  1YN5 A;  3LB8 C;  1RYJ A;  4GLS C;  1FD6 A;  1VRA B;  3NRZ A;  1KF6 B;  1SE4 A;  1RWS A;  4LLG M;  2QIE B;  4AS1 A;  5E6J A;  3SEB A;  2W3S A;  4RF1 A;  3WCQ A;  1WWT A;  2JSV X;  2PMV A;  1C76 A;  1T6B X;  3BK2 A;  3ETR A;  1E10 A;  1FRD A;  1LO5 D;  1OFF A;  2H89 B;  2WXP A;  1MHH E;  2WXL A;  2V4I B;  3W5V B;  1YNT E;  1F0Z A;  5BMI A;  4C7Y A;  3TEY A;  4OZB A;  5T8I A;  3ZJU A;  4ARI A;  2WXO A;  4ITK A;  1NYQ A;  2WU2 B;  3AEF B;  2EEL A;  3AE4 B;  2D5G A;  4NAW B;  3URY A;  2WXF A;  1YJI A;  1N5W A;  3I9V 1;  1MHX A;  2WXI A;  3DWG C;  3CWI A;  3TSS A;  2K3U A;  2MJ3 A;  1QF6 A;  1TS5 A;  1QKZ A;  2KN4 A;  3AED B;  1C4A A;  4P16 A;  2DLB A;  4IDI A;  2KMM A;  2QIL A;  1K50 A;  1BUI C;  1SF0 A;  2K0P A;  3HVD A;  1D4B A;  4WAF A;  3W2D A;  2KQ4 X;  3IT6 B;  3GP7 A;  5D3D A;  1VLB A;  2CJN A;  3B2F A;  2BT6 A;  2ON8 A;  3U4E G;  4XDD A;  2PVO D;  3W5U B;  2V3P A;  4RGO S;  1JWM D;  3AM9 A;  2PW9 A;  2QEJ C;  5EE9 A;  4ZRP A;  3H8H A;  1OQQ A;  1I4H A;  2PIA A;  2Y5P A;  1BML C;  1FFU A;  4KX6 B;  4LK0 M;  1JML A;  2L1A A;  1GB4 A;  1XO3 A;  4RH6 A;  3FAH A;  3R2I A;  4US9 A;  1SE3 A;  2N9K A;  4HKZ E;  2BBC A;  3BVG A;  4MM3 B;  1JWB D;  1PGA A;  2J42 A;  4XWW A;  4CQN A;  3BZD B;  3KQ4 A;  3R8B A;  3TEZ A;  2IGG A;  2RMM A;  4MAC A;  4AQ7 A;  2BB5 A;  2CU3 A;  4DXF A;  1IGD A;  1TKG A;  2J4X A;  3PZ8 A;  2M56 B;  3U52 E;  4YTM B;  3B2G A;  3IXS A;  1L0X B;  3ZJT A;  1KH0 A;  2WP9 B;  2Z8L A;  1B1Z A;  2Q5W D;  4LTU A;  5D7G A;  5G5G A;  3T3N A;  4R3D A;  4ZOH C;  1EWY C;  2FUG 1;  1HZ5 A;  4D2K A;  2RDH A;  3AE9 B;  3AMZ A;  5AUI A;  1N63 A;  3TEX A;  2BYT A;  2LEK A;  2WXK A;  3AEG B;  1P7F A;  2KWD A;  1I4X A;  3VR8 B;  2XNA C;  5BMG A;  1P7E A;  1MPE A;  4N6E B;  4RGT A;  1RFK A;  1AN8 A;  2EKI A;  1L6V A;  3CIR B;  1M4V A;  4XE0 A;  2IDY A;  2WNM A;  1QOB A;  5I4D A;  1KFY B;  1TKY A;  2R61 A;  4TQ0 A;  4OVZ A;  4B0M A;  2BS2 B;  1D5Z C;  1Y56 A;  3VQI A;  1C77 A;  1FNV A;  4A6Q A;  2L52 A;  2IPK D;  5H92 C;  1XXG A;  3OWE B;  5G5H A;  1YJJ A;  4US8 A;  3P4S B;  1WXQ A;  2BTE A;  2LUM A;  4GDL B;  1SJE D;  4NAM A;  3O13 A;  1XLQ A;  4WWM A;  2N0S B;  3P4Q B;  1V8C A;  1NEN B;  2FBW B;  3NVY A;  1VJK A;  3Q8A A;  1KTK A;  3BYY B;  1QQR A;  1UWX A;  2XN9 C;  3MJ5 A;  3HUI A;  2ZW0 A;  2MJE A;  3AV8 A;  3MFG A;  3L4P A;  2HTM E;  2QJL A;  3AH7 A;  1QT9 A;  3VR9 B;  1I4G A;  1FRR A;  1C78 A;  1PFD A;  1ZXI A;  1GAQ B;  1JRP A;  1DYQ A;  4A9A A;  3MP9 A;  1K51 A;  2LHE A;  3P4R B;  1TS2 A;  1V1P A;  1Q10 A;  1SBB B;  1ESF A;  1ACC A;  3AE8 B;  1ZOY B;  3Q8F A;  2WXR A;  1F2R I;  3IT4 B;  2LGI A;  4JWS C;  2QSD A;  5GXG B;  2JXT A;  3NVV A;  1NVI D;  2I38 A;  2JU6 X;  3IAS 1;  2DBY A;  5FR3 A;  1IBX A;  4KGS A;  4GDK B;  1CZP A;  3AE6 B;  3BVZ A;  2WXN A;  2NMQ A;  4O1N A;  2BB6 A;  2PVG C;  3P4P B;  4L23 A;  3EUB 2;  4KGR A;  1SE2 A;  1TJE A;  4YXD B;  3AE1 B;  1F77 A;  1EU3 A;  1QLB B;  1DGJ A;  1ZDX A;  3DWM A;  3HRD D;  5HFY A;  3E9S A;  3NVW A;  2IGD A;  2WLB A;  3BII D;  1D6E C;  4RGM A;  3BWU D;  1GPX A;  1NEK B;  2OED A;  1TY2 A;  4ZYS A;  4JPS A;  5MPO A;  3BVM A;  1UUP A;  1DOI A;  2N9L A;  1KLG D;  2AQ1 B;  4A55 A;  1JQ4 A;  1PYW D;  4L2Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...