3GB1A

Structures of b1 domain of streptococcal protein g
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
56
structure length
56
Chain Sequence
MTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (B1 DOMAIN OF STREPTOCOCCAL PROTEIN G)
publication title Improving the Packing and Accuracy of NMR Structures with a Pseudopotential for the Radius of Gyration
pubmed doi rcsb
source organism Streptococcus sp. 'group g'
molecule tags Immunoglobulin binding protein
total genus 12
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 1999-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3gb1A00
1IGCA 2PLPA 1F2RC 1P7EA 4MACA 1K51A 2PW9A 4OZBA 4KGRA 1XCTL 1YMHE 2JXTA 1HEZE 1Q10A 2ZW0A 3UI3A 4IOIE 2IGGA 2JZPA 1PGBA 1FCCC 5BMHA 2JWUA 1F2RI 4KGSA 1PGXA 2N9LA 2ONQA 1FD6A 1MHXA 1QKZA 1ZXHA 2KN4A 2QSDA 2KWDA 4OZAA 2LGIA 2JU6X 2J52A 1D4BA 2LHEA 1HZ5A 1EM7A 2KDMA 2KQ4X 2NMQA 1MPEA 2RMMA 1GB4A 3FILB 5HHDG 1FCLA 2KACA 4D2KA 5BMIA 2ZW1A 1XCQL 2N7JA 2IGDA 2I2YA 4WH4A 3FILA 1MHHE 2JSVX 1K52A 3GB1A 4HKZE 1YNTE 2QMTA 2N9KA 5HG2A 1KH0A 2GB1A 5BMGA 1K50A 4OZCA 2GI9A 5HFYA 1MI0A 2K0PA 4HJGE 3MP9A 1IBXB 5HI1A 4KGTA 1K53A 1PGAA 4IKGA 2LUMA 2ON8A 2RPVA 2J53A 2OEDA 1P7FA 1JMLA 1IBXA 1UWXA 4GLSC 1MVKA 1C9FA 3V3XA 2EELA 2LHDA 5JXVA 1GB1A 1HZ6A 2I38A 1XF5L 1IGDA 2IGHA 2PTLA
chains in the Genus database with same CATH superfamily
3CIRB 4BAXA 4KGRA 1M94A 1YX6B 2KK8A 2L76A 4GSWA 2ZPNA 1SIFA 3L0WB 3P1MA 5E6PA 2LFIA 1L0YB 4EZJA 4LNIA 2LI5A 2IO3B 2LXCA 1V5TA 1ZW7A 4KGSA 1PGXA 1S1QB 4KDLB 1KFYB 1LXDA 1I4GA 4ZDVA 1ZDXA 2NBWB 2G45B 2KT7A 1TYGB 3Q8CA 3H7PB 3V05A 3A9JA 3FILB 1J8CA 4FHKA 5IAAC 2G1EA 1GC7A 1OGWA 1JRUA 1V1PB 4EFOA 4NAMA 2KQ7A 4II3B 1R4MI 3BWUD 4IM3A 2DBYA 4MEMA 3RYTA 3OJ4B 1PUTA 1R4NB 2KANA 2PIAA 1FNUA 3KWLA 1P98A 4PYZA 3MC9A 4C56C 5CX3A 2MJDA 3AM9A 3LYYA 4LNFA 2WNMA 3CSTA 3NHEB 2ON8A 3B0AA 3BVZA 4GDKA 2M56B 3W1SC 2KJHB 2WDTB 4HPLB 3VH4B 3QK0A 3NG0A 2LHDA 2J42A 3AE6B 3DVGY 5JH5C 3MC8A 2KLGA 2I38A 2JXXA 2K1FA 2ZVNA 4O1NA 2MBBB 4KX6B 4DXFA 4S0RA 1N5XA 1GNUA 2WP9B 3HM3A 1TTNA 4HVBA 2J0MA 1J7AA 5G2NA 4YXDB 2JRIB 1E5WA 1ENFA 4ZHPA 1HXYD 4RCOA 1WGGA 4LLGM 1ET6A 1T6BX 3WIMA 4A8XC 2WXIA 3R7QA 1PQSA 2GBJA 4YSYB 1P0RA 1OQQA 2K9XA 2ONQA 4MGKE 1VR9A 2HE7A 2AQ3B 2QEJC 3L08A 3LJ3A 3UIOB 1UBIA 2OOBB 4HWIB 3AULA 1EM7A 2KDMA 4ASWC 3E56A 4GOCA 1T0YA 5D6JB 5BMIA 1VJKA 2XBBC 4W9LA 2LD9A 1Z2MA 2L8JA 2NBUA 2ZZPB 5FR6A 3H7PA 3FILA 2DZIA 5AUIA 5E6OA 3P4SB 4MM3A 3P4QB 1V1PA 4FJYA 4PS8A 1MI0A 2AQ1B 2C60A 2IYDB 3H9DA 1TZOA 1WRDB 1WM3A 4KKJA 3TJPA 2CS4A 1XLNA 3R7RA 3ZLZA 2KFKA 4N58A 2GLSA 3U8ZA 3ZDMC 3ONSA 3BK1A 1FFUA 3DBHB 2M4NA 2NTTA 2WXMA 3IVFA 2XK5B 3V62A 1WFYA 3Q69A 4P1CC 2PTLA 2BS2B 3Q3FA 1EO6A 2BS3B 1QLBB 3AEBB 5LXIB 1RM6C 1HE8A 2CU1A 4B6WA 4XYCA 3P2BA 3L54A 3KVFB 3AE7B 1WGHA 4ZRKA 4A55A 2XNAC 2WXKA 1XO3A 3B2FA 1I42A 3ZTCA 4LJOB 1QOFA 3NUHB 2JWUA 2D3AA 3N30A 3PRZA 2GOWA 5TR5A 4ZHOA 2KD0A 3HVZA 3IBEA 2KWDA 2WWZA 1V2YA 2J52A 4KDIC 3WA0A 1NI2A 2MBEA 2HDEA 2N1VA 4JX1C 4EUTA 1NVID 3N9YC 2PVGC 2BYVE 5HHDG 2FUHB 2UWQA 4I6NB 3D32A 2KVZA 4REZA 4KZ0A 2V1YA 2HJ1A 2CHZA 2KDEB 1UD7A 2V3NA 4K3BA 2JSVX 3U4EG 4EZKA 3BYYB 3IFWB 3H6NA 3MHZA 2V3PA 1I4RA 2L83A 4IC7B 1FNWA 3DCGA 4NJ7A 3DBSA 1SXTA 4MH8A 1VZ7A 4WWPA 2WXQA 4AJYB 1J0GA 3X0WA 2C9WB 3ZNHB 3VHTC 4NPNA 4YSZB 4WWNA 3ZUNA 4MH0E 3RMKC 1TS3A 2K3UA 2KNBA 2KO3A 3RN9C 1FRDA 3QIJA 4ZYSA 3AH7A 1I4PA 1E0ZA 3H8HA 2BYFA 2L0FA 2XK5A 1E8XA 1E8YA 3VRBB 4C80A 4X57B 1C79A 3N20C 4ARIA 1HTQA 3Q3OC 4XZ4A 1KRHA 4WAAA 1FCCC 3RPFC 3VDZA 4HPPA 1LQBA 2IO0B 1V6EA 1T0RC 3PO0A 3RNAC 4J6IA 3KQ4A 1V8CA 2KMMA 4LTUA 3GP7A 2KXJA 3PLVA 1TS5A 3RNFC 3PRMB 3RI7C 1NENB 3WAOA 5CHFA 3ZW3A 3AEEB 1GB4A 3TEZA 4JLCA 4D2KA 2KJRA 2GRIA 1SSNA 1KLGD 1UGMA 3BK2A 2KTFA 2L52A 2RGFA 2KWVB 3GE3C 5CHVC 5BYRA 2C7NB 3AEGB 3GB1A 2QMTA 3W5UB 3PZ7A 2N1WA 3QJZA 1SGHA 2ZVOA 1K50A 5J18A 1TS2A 3VTWA 4ICVA 5FK9C 1TY2A 4IWQA 4LJPB 2K25A 2MEKA 3TIXA 3ALBA 2LUMA 4G0NB 2D11A 3N1ZC 1UNSA 1FXTB 3SEBA 1QQRA 3NS1A 2WX0A 1Y8RC 1JMLA 2DZMA 4K81A 1RAXA 2L00B 4RM9A 1WSPA 5IO9A 3OAWA 5AZGA 3EUB2 1P3QU 3GZNB 2FCSA 5IN7A 2OHFA 2JY6A 2KJ6A 4YSXB 1RFAA 3AB5A 5G55A 2N7DA 4FA6A 4W9DA 5IOIA 1VDVA 4AS1A 4GIVA 1FXIA 3U7ZA 3Q3MC 1YQ4B 3EFUA 1EUVB 4NNJB 2BGFA 2KMCA 3BVGA 4R3DA 3V6EB 1QZEA 5J17A 2LGIA 1X1MA 4WQMA 3PTFC 2JT4B 1JWUD 3LB8C 4NAWB 3TSSA 4BOSC 1HZ5A 5C3JB 5IP4D 1D5MC 2X38A 3DPDA 2WDRB 1XT9B 1N63A 2ZW1A 1HQRD 5LXHA 2MQJA 1TKYA 3PRPB 1OQYA 2DX5B 3TL5A 4HPMB 4ANXA 1OFFA 3QX1A 2AWTA 1SJED 5BYSA 1MG8A 1NI3A 3MHSD 2FBWB 1F52A 2AYOB 2W55A 1WX7A 2IY1B 4ANVA 4DXGA 3T3OA 2WYQA 2JRHA 4IG7B 4A20A 2RPVA 4RM8A 4YTNB 2Z59B 1WZ3A 5HKHA 2QC8A 1MG4A 2OJWA 3NVZA 3WANA 3DBRI 1XLPA 2IJ0A 2WXGA 2SAKA 3MFGA 3Q14C 1WY8A 3AV8A 4HDOA 1TKGA 3V6CB 2WQYB 3CF6E 3I57A 3R3MA 1ET9A 2BKRB 1XLOA 3RCZA 3KH0A 1CJEA 2LXAA 3RD2A 3O65B 3VUWA 2JYEA 4P7IA 1MHXA 3P4RB 3R66C 2QSDA 1T3QA 2LEKA 2C7MB 3AE2B 3M62B 1FM0D 4M01A 2MP2A 2K8CA 2FNJB 3VFKA 4K7SA 4PS3A 4TSSA 2L0TA 2JZZA 3PGEA 4GGQA 4ZOHC 3ZYYX 1C77A 1WMHA 2L1AA 2R61A 2WXHA 5FR3A 4NAWA 3ECIA 2ZNVB 4GB9A 5TSSA 4A3OA 1I4QA 4ZYNA 3OG5A 4JWSC 4WJPA 3Q2AC 4P6VF 1XLQA 3AE5B 1SE2A 5L95C 1KH0A 1L4ZB 2BW2A 2IO1B 1R7SA 4WURA 2V9HA 2JX5A 3K9PB 2O6VA 3BYTB 3WAMA 2HTHA 4KGTA 1N6ZA 1WYWB 1KTKA 5EE1A 4OVUA 4MM3B 2PPHA 1DGJA 2J7QB 4N6EB 2M19A 4AOFA 4DBGA 2LUEA 1QOGA 4AQ7A 1YN5A 2G4DB 1C9FA 3E9SA 2G3QB 1WXSA 2PEAA 3RNEC 2KFKB 3ML8A 3DBLB 2LVOA 4K7UA 3NZUA 3AU5A 2KMAA 3ENEA 3PLUA 3PZ8A 2ASQA 4DHJD 4MGIE 1IUEA 2YEPF 2I1KA 1YQ3B 2KZRA 4BKTA 4RMAA 1JCKB 3N32A 4RFBA 2QILA 3A33B 1FXAA 4TQ1A 4BFRA 1FRRA 4ITKA 2NTSA 2V4LA 3I9V1 1N61A 4DHZB 1JALA 2Z0DB 1CQVA 3JSVA 3UI3A 4DHZE 1Q0WB 4C7ZA 2RPQA 2LGDA 1V97A 3KUDB 5BO4B 3FAHA 4CO7A 4TMAB 4WIPA 3R8BA 2LVQA 1D5ZC 3KUZA 4MSMB 4WJQA 2KVRA 3EECA 2KQ4X 4M0WB 2BYTA 4ARCA 1SIJA 2LJIA 4XWTA 4DXAB 3EGRA 4S17A 5FKAC 3O13A 1ISNA 4W9GA 4DDID 3JW0X 2JPHA 1VRAB 3PV1A 3AE3B 1K52A 1KOTA 4DQOC 4EE2A 2BVCA 2KTRA 3HM6X 3AE4B 4LCDE 4B9KA 1R4NI 2K0PA 2WU5B 4C7YA 4HJGE 3AEAB 2RDGA 4IKGA 2KC1A 1GOZA 1UH6A 3I63C 2KQSA 1DOXA 1KLUD 2J53A 4OVVA 2SEBD 2MJ3A 4E3CA 3ZQ4A 3AI5A 4FJZA 4C4VA 1NYQA 1C4CA 2CJOA 1V9JA 2IGHA 4NQKE 3EC8A 1P7EA 1WGYA 4B95A 4AWJA 3QHTA 4DHJB 4US9A 3L10B 2K8HA 2ZW0A 3I5JC 3JYUA 5AEKB 3MC0B 2D2QA 2MRPA 4YT0B 2LGXA 1CMXB 4E71A 2BWFA 5BMHA 4M8MA 3BVMA 2PE9A 5E6NA 4C00A 2D07B 4XDDA 3PREA 1WIAA 3DHIC 2ICIA 4M00A 1SJHD 4FN2A 2KWCA 2DYOA 2EKIA 5T8IA 4WJOA 5J2RA 2JF5A 2D3GA 2QDFA 4RGMA 2QIEB 3VTVA 5GMVA 1TS4A 2CHWA 4RF1A 4M0WA 3VR9B 1RWSA 3UIPB 2FCQA 1WJ6A 3OWEB 4IM0A 3PHXB 4RGNA 1YX5B 1J19A 4ANUA 3U2SC 4HKZE 1ROEA 2KN5A 3RNCC 3M95A 2N9KA 3NS8A 1RRBA 4XWWA 4K7WA 3IT6B 1C3TA 5HFYA 3MJWA 2D5GA 2GI9A 3A4RA 4RNAA 4HXDA 4W9IA 3RZFA 4US8A 1LM8B 1K53A 3R2IA 4URKA 1YN3A 1ZOYB 3VQIA 2IY0B 3P4PB 3PS6A 4JL9A 2NS5A 4GU2A 2ZCCA 4MT5A 4HRSA 2E3TA 3ZKJC 1PFDA 5JZEB 2KOXA 1WGRA 1WJ4A 4BKSA 3V3XA 4WWOA 1GB1A 3BY4B 3KW5B 1EF5A 2BB6A 3U30A 4IOIE 4PK1A 1V81A 3AN1A 4FADA 2UYZB 2N7EA 1YJ1A 2GBKA 2KDIA 2G4SA 4FULA 1SE3A 2NR2A 4K1RB 3FKYA 2NPTA 3DHHC 3KUCB 2YVCA 4YWGG 1I7HA 4F8CB 4KKIA 3CSFA 2NCNA 1BT0A 4P1BC 4MELA 2BF8B 1A5RA 4KV2A 2KN4A 5MPOA 3KLSX 1XD3B 1D4BA 2W9NA 1GJZA 2RR9A 4ANWA 2Y5BB 2KYWA 3SFDB 4ACFA 3VRAB 3APFA 3RT3B 1XCQL 3AEFB 3PZDA 3T3NA 2Y3AA 4W9KA 1AWDA 3UINB 3Q3JA 3ZIMA 3PT2B 5G5GA 2MH7A 2KDBA 2L32A 3UQBA 2MBHA 3A1QB 3A9KB 3T8MA 5BMGA 3GE8C 4OZCA 2CR5A 3MP9A 1IBXB 4DDGD 3M3JA 2LRWA 1FMAD 1PGAA 1H8CA 2O6VD 5E6JA 4A9AA 2NVUI 3AECB 2DZKA 2W54A 4J3OD 2ACZB 3RUIB 3W1SA 1IGDA 4LNOA 2GMIC 1EU3A 1FIQA 4L2YA 1IGCA 3AE1B 2JQRB 5L83A 3RNGC 5D3IB 4GXBA 4HKQA 2PKOA 3IHPC 1K8RB 2V4IB 1V1OA 4IWOA 1ZXIA 4PT5A 4W9CA 3TUOA 2IPKD 5JHBA 2RDBC 1SF0A 4PS7A 1PGBA 4AUQC 1SE4A 2JWZA 4K3CA 1JWMD 4DWFA 1WYGA 2XN9C 5EE9A 3C19A 1FD6A 2FUG1 4OZAA 2QCZA 1SE9A 4NJ6A 1E6EB 2I1JA 2NMQA 1C1YB 1WXVA 2B76B 4BVUC 1RFKA 3ZNGC 4BBNC 3TEXA 1UBQA 1G6JA 4KSKC 1B1ZA 2NBVB 3W1YA 2KX0A 2DWQA 4MDKE 2MP2B 2I2YA 1WX9A 2LWPA 4NQLB 1ACCA 5C2TB 2RDHA 2KAJA 1WMHB 3IT4B 2BYEA 1WGDA 2AX5A 2DZJA 1VZ6A 3ABVB 4XGAB 4GN1A 3X23A 3KWVA 3BIID 2X8XX 3TEYA 4OVZA 2LJ5A 3LXFA 4HCPB 3DHGC 2K22A 3TMPB 4N59A 3QA8A 3U52E 2FIDA 3SD5A 3A1QA 2LZ6A 3A9KA 3AEDB 2CU3A 1L4DB 2MSED 1WXQA 2O6VB 1F0ZA 1E9MA 1IBXA 2AEHA 3DWMA 2JZ3B 4G11A 2WGSA 4HK2A 1AARA 1V49A 1MJDA 2PLPA 1JWSD 3H1UA 2INNE 2J0JA 4JE3B 2UU7A 3ZJVA 4JPSA 3GZNI 1L0VB 2K6QA 3ZDTA 2L05A 1YMHE 4HJKA 4XX5A 1U4AA 4L23A 1Q10A 1OQRA 3DVNV 2K6DB 4OHJA 2M17A 3ZXRA 1PYWD 3EFCA 3SFEB 1TZ1A 3JSVB 2A4ZA 1E8ZA 2IO2B 4NY0A 1Q5WB 2N9XA 1NBFC 4Q2JA 1F9JA 3CWIA 2DYBA 1GC6A 3N3KB 1UGJA 1WWTA 2WS3B 2MWSB 4HCNB 3NVVA 2BWES 4P16A 2N7JA 3L4PA 2K39A 1P1AA 1D5XC 2N9PC 2CHXA 3QCAA 1WF9A 1A70A 2H89B 3BINA 5G5HA 1WM2A 4W9JA 4WH4A 4L1BA 2ZJDA 3SR6A 1R4MB 3VR8B 2N9EB 4XC2A 4A3PA 1E8WA 4W9EA 5KHQA 1GAQB 2MHJA 1Y56A 3B1LX 4A90A 4A6QA 1BMLC 1UELA 1WGKA 2M1MA 1D6EC 4NJCA 3SHQA 4MJSA 1L5PA 4JQWC 2Z8LA 1KLVA 3AE9B 3HK0A 1FEHA 3FC4A 2KTRB 1AYFA 3KYDD 2BBCA 3W2DA 4CQNA 2YLMA 1P7FA 1UWMA 1JWBD 1VLBA 2JYTA 1WXAA 4CHKA 3ZJUA 2FCMA 3V61A 2EELA 4BKSD 1NEKB 3R2TA 4BBNF 2PMVA 5I4DA 2W3SA 1DYQA 1F2RC 4C4VB 2WXOA 4HROA 2E6XA 2L3ZA 5CTRC 1NDDA 2JXTA 4WWMA 1JW9D 4GDLB 4EKUA 4M02A 4RF0A 3ETRA 3GS2A 4KZCA 5H92C 4LNNA 3P42A 3APDA 2MCNB 2C5LC 2BT6A 4I6PA 4XE0A 2ZEQA 4USAA 2O2VB 2M8SA 5KHOA 2Y5CA 4BKGA 3VUXA 1QT9A 1F1HA 3L17A 1QOBA 1V80A 1JROA 2D3BA 2YEPB 1UZXB 5IA7A 1E10A 1FPYA 2N4FA 1N60A 1N62A 4JGHB 4YTPB 2KKCA 3VXWA 2LVPA 1WH3A 1L7YA 1Z5SB 1ZP0B 2IZVB 3WCQA 1WJNA 2M0XA 3ZGZA 2OJRA 2FAZA 3PHWB 3TCAA 1VZ8A 1WR1A 2IDYA 4N9F4 2PJHA 3PPAA 4IWPA 2KHWB 1HA5A 4NZLB 4G50A 4BOZB 3B9JA 4WQOB 4KSLC 1CK1A 3UGBB 3DBLI 1I35A 2V0GA 2KFJA 3RNBC 3AU4A 2EMSA 3VAWA 3QWZB 4RGOS 5DPRA 1YN4A 3N1YC 5AZHA 1C76A 1UF0A 3QC8B 2VRRB 2FE8A 2DHZA 1E90A 3NRZA 3PVLA 2MA9B 2WU2B 2BTEA 2JZPA 4UDUC 3NVWA 4TUUA 5D94A 2NPTB 3AXCA 1AN8A 4GDLA 1Q1OA 1WE6A 4CYEA 4YTMB 2JVCA 2DAJA 2N9LA 3Q6BA 2MX2A 1E7VA 4WJNA 1EU4A 2KX3A 4F7ZA 3NZ3A 1J7CA 3CMMB 3HIZA 1L2NA 1YJIA 2AL3A 2D10A 1H4RA 2DENB 1L0XB 3LDZE 3BZDB 1T0QC 2O2VA 1ZUD2 3URYA 2MLBA 3IXSA 1XXGA 1MFWA 2C7HA 2KC2A 1T0SC 3SDLC 3RFZB 2LMCA 4FXCA 1QOAA 3Q8FA 3RULA 4LDTD 2XEWA 4HEA1 1D3ZA 1TT5B 1IP9A 1ESFA 1V86A 4IM2A 1CZPA 3ZNZB 5LNK1 3Q8AA 3DDCB 4MGZE 2OEDA 1GG3A 2BQQA 2FCNA 2BB5A 3ZNID 3ZRCA 4FBJB 1GUAB 2IBIB 4IUMB 4LK0M 2MJEA 4B0EA 4YL8A 2CKHB 1VCBA 3NZSA 3ZXVA 4BZAA 1YQBA 4MACA 4M8NA 4PYUA 4ZRJA 2PW9A 1KM7A 1WX8A 4KIKB 4OW0A 1IPGA 2DAFA 3Q8BA 1FNVA 5DPTA 3L16A 3DBHI 1GPXA 1WJUA 2KLCA 4WAFA 1P9DU 3ZVVA 2JUOA 1F2RI 1QF6A 1WRIA 2L7RA 1XEEA 2INDC 3UQAA 1TY0A 3HVDA 3B08A 2LRUA 5D2MB 2JU6X 2Y5PA 2TSSA 5DCNA 2WHIA 2RSUA 3J9CA 2RMMA 2Q5WD 1S3SG 1AW7A 5DPSA 1UUPA 2BS4B 2KACA 2INPE 3VVWB 1TIFA 1C4PA 3NJTA 3H7SA 2IGDA 2WDVB 5EE3A 4W9HA 3Q3NC 4RGTA 4ZRQA 4EZLA 1T5XD 1WE7A 2EKEC 3IAM1 4II2B 5AZFA 2DLBA 2V3SA 2R2OA 1N5WA 3EHVA 4LNKA 4TKNA 1YOVB 5HG2A 2GB1A 4XDCA 4LDTB 4QAYA 4G3XB 3RZWC 1KJTA 2LASA 2VH1A 5HI1A 5AUKA 3NVYA 1PDXA 5EDSA 1TKEA 2WXLA 3W5VB 3KYCD 5DPWA 3MJ5A 1WXMA 2HD5B 2N0SB 2VH2A 3JVZX 4GLSC 4EOYA 1TJEA 3GOEA 5D3DA 4JIOU 2WDQB 2J4XA 2Z0EB 3AE8B 3ZJTA 4TV3A 1XF5L 1HTOA 3U7DA 5LLIA 2H88B 2B3AA 1JQ4A 5GXGB 5CHWA 2AL6A 1YD8U 1HEZE 1WI0A 3WAPA 3DVGX 3NOBA 4IW0A 3DOWA 1E7UA 3SU8X 4AJWA 4H2AA 3TBLD 4DK5A 2IGGA 2AQ2B 1QILA 3N1XC 3C8YA 2WXNA 2GBRA 1OEYJ 3K9OB 1ZDVA 2LGYA 3APCA 1WR6E 2D3CA 4KIKA 2QJLA 5JHAA 1DOYA 2GBMA 1BXTA 1QKZA 2WX1A 2PVOD 4AP4C 4B0MA 3ML9A 1WZ0A 4I6LB 3VUYA 1FCLA 2DYMA 4E74A 1ZPSA 2BKFA 4JWUC 4FJVB 2WXPA 2VZKD 4ICUA 4ZRIA 1NYRA 1STEA 5EE0A 2ZNVC 1OEYA 4EEWA 2DNFA 2KDFB 1YNTE 3ZRFA 1LGRA 1EWCA 3S2AA 5H8YE 3UF8A 3PSEB 2EMTA 2FIFA 1JWAD 1EWYC 3OLMD 4GMVA 3NY5A 2BPSA 3ZO5B 3W9CB 1EF1A 1B9RA 3M63B 4HDQA 4MJSB 1UWXA 4HLEA 2WXJA 3QARA 1KF6B 1I4XA 1ZGUB 1XQQA 2MBQA 3MTNB 1HZ6A 3DBRB 3QQ8B 1F77A 2RD0A 2MBOA 4F1SA 2WXRA 1OTRB 1K51A 4OZBA 3WALA 3VH3B 1XCTL 1L6VA 1VD2A 2M0AA 3TEWA 1SB3C 1TBEA 1RYJA 1L6UA 3HUIA 3EA6A 2MW5A 1I4HA 5IKCM 2WLBA 3C0RB 1FO4A 2HTME 4FLHA 2QHOA 4W9FA 3A9JB 1ZXHA 2GBNA 1LFDA 2KWUB 2LHEA 1FFVA 1ZE3D 2INCC 1MPEA 5C23A 3DWGC 1SBBB 2HJ8A 2K5PA 3L13A 1YIWA 3IG3A 4RH6A 4IDIA 3HHMA 3VTUA 1YJJA 5D7GA 2K8BA 3P63A 3V60A 1RLFA 1SEBD 3I3TB 1LO5D 3T9LA 3Q8EA 4KVGB 3DQVA 2WXFA 1C78A 3IAS1 1MHHE 1E7PB 3AMZA 1J7BA 4MGYE 2VZKB 3HRDD 1IYFA 2W3RA 2R2QA 2ZCBA 5C1ZA 4FHJA 4MSQB 1M4VA 5BYQA 4GDKB 3OJ3A 2ZPYA 2G9HD 2J0KA 1ZKHA 4ZRPA 3A4SC 2PE6B 3ZTDA 2LGSA 1C4AA 2CJNA 4TQ0A 1JRPA 1MVKA 3QAQA 1BUIC 1TGZB 2REXA 2W82A 5JXVA 1DOIA 3B2GA 3DVNU 1V5OA 2A5UA
chains in the Genus database with same CATH topology
3EUB2 3CIRB 4RGOS 3AN1A 1YN4A 4KGRA 1C76A 1SE3A 2OHFA 2FE8A 3NRZA 4YSXB 3P1MA 3AB5A 2LFIA 4YWGG 1I7HA 2WU2B 1L0YB 4KKIA 2BTEA 2JZPA 1VDVA 4AS1A 4UDUC 3NVWA 1FXIA 3U7ZA 1AN8A 4YTMB 4KGSA 1PGXA 1KFYB 1I4GA 1YQ4B 2N9LA 1ZDXA 2KN4A 3BVGA 1EU4A 4R3DA 2LGIA 4WQMA 5MPOA 3KLSX 1TYGB 3NZ3A 1J7CA 3LB8C 1JWUD 4NAWB 1D4BA 3TSSA 1HZ5A 1YJIA 3Q8CA 3V05A 3FILB 5C3JB 1D5MC 2X38A 2G1EA 2WDRB 3SFDB 1L0XB 3VRAB 3BZDB 1N63A 2ZW1A 1HQRD 1ZUD2 1XCQL 3AEFB 3URYA 3T3NA 1TKYA 2Y3AA 1AWDA 3IXSA 1XXGA 1V1PB 5G5GA 2MH7A 4NAMA 2L32A 1OFFA 3RFZB 2LMCA 4FXCA 1QOAA 3Q8FA 1SJED 4HEA1 3BWUD 2DBYA 5BYSA 1NI3A 1PUTA 5BMGA 2PIAA 1FNUA 4OZCA 2FBWB 3KWLA 2W55A 3MP9A 1IBXB 1ESFA 4C56C 1FMAD 2MJDA 3AM9A 3LYYA 1PGAA 4DXGA 3T3OA 2WNMA 1CZPA 5E6JA 5LNK1 2ON8A 3Q8AA 2RPVA 4A9AA 2OEDA 3BVZA 4YTNB 2BB5A 3AECB 2M56B 2W54A 4LK0M 2MJEA 2LHDA 2J42A 4B0EA 3AE6B 4J3OD 2ACZB 3NVZA 3W1SA 2I38A 1IGDA 4O1NA 1EU3A 1FIQA 4L2YA 1IGCA 3AE1B 4KX6B 4DXFA 1N5XA 2JQRB 1XLPA 2IJ0A 2WP9B 5D3IB 2WXGA 2SAKA 4MACA 4HKQA 2PKOA 2V4IB 2PW9A 1V1OA 4PT5A 1ZXIA 1J7AA 3MFGA 4YXDB 1ENFA 4ZHPA 3AV8A 4OW0A 1HXYD 4RCOA 3TUOA 1TKGA 2IPKD 3Q8BA 1FNVA 2WQYB 4LLGM 3I57A 1ET6A 1SF0A 1ET9A 1GPXA 1XLOA 4WAFA 1PGBA 1T6BX 1CJEA 1SE4A 4A8XC 2WXIA 1JWMD 1F2RI 1WYGA 2XN9C 1QF6A 1WRIA 2JYEA 4YSYB 5EE9A 1XEEA 1OQQA 2K9XA 2ONQA 1FD6A 1TY0A 1MHXA 1VR9A 3P4RB 2FUG1 2QSDA 3HVDA 2AQ3B 4OZAA 1T3QA 2QEJC 2LEKA 2JU6X 2Y5PA 3AE2B 2TSSA 1E6EB 1FM0D 1EM7A 2KDMA 2NMQA 3E56A 2RMMA 2Q5WD 3J9CA 1AW7A 2B76B 1UUPA 2BS4B 4TSSA 2KACA 2INPE 1RFKA 4ZOHC 3TEXA 5BMIA 3ZYYX 1VJKA 1C77A 1C4PA 1B1ZA 2IGDA 2L1AA 2R61A 2WDVB 5EE3A 2DWQA 2WXHA 5FR3A 2I2YA 4RGTA 5TSSA 4ZRQA 1T5XD 1I4QA 3FILA 3IAM1 1ACCA 2DLBA 4JWSC 5AUIA 1N5WA 2RDHA 4P6VF 5C2TB 1XLQA 2KAJA 3AE5B 3IT4B 1SE2A 2AX5A 5HG2A 1KH0A 2GB1A 3P4SB 1L4ZB 1VZ6A 2BW2A 3P4QB 1V1PA 4XDCA 1R7SA 3ABVB 4WURA 2JX5A 3KWVA 1MI0A 3BIID 3TEYA 2AQ1B 4OVZA 3LXFA 1TZOA 3BYTB 2K22A 4N59A 5HI1A 4KGTA 5AUKA 3NVYA 3U52E 1PDXA 4KKJA 1KTKA 1TKEA 2WXLA 5EE1A 3AEDB 3W5VB 2CU3A 1XLNA 4MM3B 1DGJA 4N6EB 1L4DB 2M19A 4N58A 1WXQA 3MJ5A 2N0SB 1QOGA 1E9MA 1FFUA 3BK1A 4GLSC 4AQ7A 1TJEA 1F0ZA 1IBXA 1YN5A 5D3DA 1C9FA 2WDQB 3E9SA 2J4XA 3DWMA 2NTTA 2WXMA 3AE8B 3ZJTA 3PZ8A 3Q69A 1XF5L 2PTLA 2BS2B 2H88B 1JWSD 2BS3B 2PLPA 1QLBB 2INNE 1IUEA 2YEPF 4JE3B 1JQ4A 5GXGB 1YQ3B 3AEBB 1RM6C 3ZJVA 1JCKB 4JPSA 1L0VB 4RFBA 2QILA 1YMHE 1HEZE 1FXAA 4TQ1A 3AE7B 4L23A 4A55A 1FRRA 1Q10A 1OQRA 4ITKA 2NTSA 3I9V1 2XNAC 1N61A 2WXKA 1XO3A 3B2FA 1JALA 4H2AA 1CQVA 3UI3A 2IGGA 2AQ2B 1QILA 3C8YA 2WXNA 4C7ZA 1QOFA 3NUHB 4OHJA 1ZDVA 1PYWD 1V97A 2JWUA 2QJLA 3SFEB 3FAHA 4TMAB 4WIPA 3R8BA 1DOYA 4ZHOA 1BXTA 1D5ZC 4Q2JA 1QKZA 3HVZA 3CWIA 2KWDA 2PVOD 4B0MA 2J52A 2HDEA 2KQ4X 4JX1C 1UGJA 1NVID 3N9YC 1WWTA 2PVGC 2WS3B 5HHDG 1FCLA 2BYTA 2DYMA 4ARCA 3NVVA 1SIJA 2LJIA 4P16A 4REZA 4XWTA 2N7JA 3L4PA 3EGRA 1ZPSA 1D5XC 4JWUC 5FKAC 1A70A 2H89B 5G5HA 3O13A 2WXPA 2VZKD 4WH4A 1NYRA 4L1BA 2V3NA 1STEA 3SR6A 5EE0A 2JSVX 3U4EG 1VRAB 3AE3B 3BYYB 3VR8B 1K52A 4DQOC 4EE2A 1YNTE 3MHZA 1EWCA 1GAQB 2V3PA 5H8YE 1I4RA 1Y56A 2L83A 4A90A 1JWAD 3AE4B 1EWYC 4A6QA 1FNWA 1BMLC 1WGKA 2K0PA 2WU5B 4C7YA 1D6EC 4HJGE 3AEAB 4NJCA 1L5PA 1SXTA 2Z8LA 3AE9B 3W9CB 2RDGA 4IKGA 1FEHA 1VZ7A 3FC4A 1GOZA 4MH8A 1B9RA 2WXQA 1AYFA 1DOXA 1KLUD 2BBCA 3W2DA 2J53A 4CQNA 1P7FA 2SEBD 1UWMA 2MJ3A 4YSZB 1JWBD 1VLBA 2JYTA 3ZQ4A 1UWXA 3ZJUA 1TS3A 2WXJA 1KF6B 1I4XA 2EELA 1NYQA 1C4CA 2K3UA 2CJOA 1HZ6A 1NEKB 3R2TA 2IGHA 1F77A 2PMVA 5I4DA 2W3SA 1FRDA 1DYQA 4ZYSA 1F2RC 3AH7A 1I4PA 2WXRA 1P7EA 1E0ZA 2WXOA 4HROA 2E6XA 3H8HA 1K51A 4OZBA 4US9A 1XCTL 1L6VA 2JXTA 4WWMA 1JW9D 2M0AA 4GDLB 3TEWA 1SB3C 4RF0A 3VRBB 1RYJA 2ZW0A 3MC0B 4C80A 1C79A 1L6UA 3HUIA 3ETRA 3EA6A 3GS2A 5H92C 4ARIA 4YT0B 1I4HA 3P42A 1KRHA 1FCCC 5BMHA 3RPFC 2WLBA 3BVMA 1FO4A 2HTME 3PO0A 2BT6A 3KQ4A 1V8CA 2KMMA 4LTUA 3GP7A 4XDDA 4XE0A 1ZXHA 1TS5A 4USAA 2ICIA 1NENB 1SJHD 2Y5CA 2LHEA 1FFVA 1ZE3D 1QT9A 1MPEA 2DYOA 2EKIA 3AEEB 3DWGC 5T8IA 3TEZA 1QOBA 1GB4A 1JROA 1SBBB 4RGMA 4D2KA 2YEPB 2K5PA 2QIEB 2GRIA 1SSNA 4RH6A 1KLGD 1E10A 4IDIA 1N60A 1N62A 1YJJA 4YTPB 3BK2A 1TS4A 5D7GA 4RF1A 3P63A 4M0WA 1SEBD 1LO5D 2L52A 3VR9B 3Q8EA 1RWSA 2WXFA 1C78A 3IAS1 1ZP0B 1MHHE 5BYRA 1E7PB 3AMZA 1J7BA 3OWEB 4RGNA 2VZKB 3HRDD 3AEGB 3WCQA 3GB1A 4HKZE 3U2SC 2W3RA 1ROEA 2QMTA 3W5UB 2N9KA 3PZ7A 4XWWA 3IT6B 1M4VA 5BYQA 1K50A 4GDKB 2D5GA 1TS2A 2GI9A 4RNAA 4US8A 5HFYA 3ZGZA 5FK9C 1TY2A 2G9HD 4ZRPA 2MEKA 1K53A 3R2IA 1YN3A 1VZ8A 1ZOYB 2LUMA 3VQIA 2IDYA 1C4AA 1UNSA 3P4PB 3SEBA 1QQRA 2CJNA 4TQ0A 3NS1A 4MT5A 1JMLA 1JRPA 2E3TA 4HRSA 1PFDA 1MVKA 1BUIC 1HA5A 2W82A 3V3XA 4NZLB 5JXVA 1WSPA 1GB1A 3B9JA 1DOIA 3B2GA 1CK1A 2BB6A 4IOIE 2V0GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IGC A;  2PLP A;  1F2R C;  1P7E A;  4MAC A;  1K51 A;  2PW9 A;  4OZB A;  4KGR A;  1XCT L;  1YMH E;  2JXT A;  1HEZ E;  1Q10 A;  2ZW0 A;  3UI3 A;  4IOI E;  2IGG A;  2JZP A;  1PGB A;  1FCC C;  5BMH A;  2JWU A;  1F2R I;  4KGS A;  1PGX A;  2N9L A;  2ONQ A;  1FD6 A;  1MHX A;  1QKZ A;  1ZXH A;  2KN4 A;  2QSD A;  2KWD A;  4OZA A;  2LGI A;  2JU6 X;  2J52 A;  1D4B A;  2LHE A;  1HZ5 A;  1EM7 A;  2KDM A;  2KQ4 X;  2NMQ A;  1MPE A;  2RMM A;  1GB4 A;  3FIL B;  5HHD G;  1FCL A;  2KAC A;  4D2K A;  5BMI A;  2ZW1 A;  1XCQ L;  2N7J A;  2IGD A;  2I2Y A;  4WH4 A;  3FIL A;  1MHH E;  2JSV X;  1K52 A;  3GB1 A;  4HKZ E;  1YNT E;  2QMT A;  2N9K A;  5HG2 A;  1KH0 A;  2GB1 A;  5BMG A;  1K50 A;  4OZC A;  2GI9 A;  5HFY A;  1MI0 A;  2K0P A;  4HJG E;  3MP9 A;  1IBX B;  5HI1 A;  4KGT A;  1K53 A;  1PGA A;  4IKG A;  2LUM A;  2ON8 A;  2RPV A;  2J53 A;  2OED A;  1P7F A;  1JML A;  1IBX A;  1UWX A;  4GLS C;  1MVK A;  1C9F A;  3V3X A;  2EEL A;  2LHD A;  5JXV A;  1GB1 A;  1HZ6 A;  2I38 A;  1XF5 L;  1IGD A;  2IGH A;  2PTL A; 
#chains in the Genus database with same CATH topology
 3CIR B;  4BAX A;  4KGR A;  1M94 A;  1YX6 B;  2KK8 A;  2L76 A;  4GSW A;  2ZPN A;  1SIF A;  3L0W B;  3P1M A;  5E6P A;  2LFI A;  1L0Y B;  4EZJ A;  4LNI A;  2LI5 A;  2IO3 B;  2LXC A;  1V5T A;  1ZW7 A;  4KGS A;  1PGX A;  1S1Q B;  4KDL B;  1KFY B;  1LXD A;  1I4G A;  4ZDV A;  1ZDX A;  2NBW B;  2G45 B;  2KT7 A;  1TYG B;  3Q8C A;  3H7P B;  3V05 A;  3A9J A;  3FIL B;  1J8C A;  4FHK A;  5IAA C;  2G1E A;  1GC7 A;  1OGW A;  1JRU A;  1V1P B;  4EFO A;  4NAM A;  2KQ7 A;  4II3 B;  1R4M I;  3BWU D;  4IM3 A;  2DBY A;  4MEM A;  3RYT A;  3OJ4 B;  1PUT A;  1R4N B;  2KAN A;  2PIA A;  1FNU A;  3KWL A;  1P98 A;  4PYZ A;  3MC9 A;  4C56 C;  5CX3 A;  2MJD A;  3AM9 A;  3LYY A;  4LNF A;  2WNM A;  3CST A;  3NHE B;  2ON8 A;  3B0A A;  3BVZ A;  4GDK A;  2M56 B;  3W1S C;  2KJH B;  2WDT B;  4HPL B;  3VH4 B;  3QK0 A;  3NG0 A;  2LHD A;  2J42 A;  3AE6 B;  3DVG Y;  5JH5 C;  3MC8 A;  2KLG A;  2I38 A;  2JXX A;  2K1F A;  2ZVN A;  4O1N A;  2MBB B;  4KX6 B;  4DXF A;  4S0R A;  1N5X A;  1GNU A;  2WP9 B;  3HM3 A;  1TTN A;  4HVB A;  2J0M A;  1J7A A;  5G2N A;  4YXD B;  2JRI B;  1E5W A;  1ENF A;  4ZHP A;  1HXY D;  4RCO A;  1WGG A;  4LLG M;  1ET6 A;  1T6B X;  3WIM A;  4A8X C;  2WXI A;  3R7Q A;  1PQS A;  2GBJ A;  4YSY B;  1P0R A;  1OQQ A;  2K9X A;  2ONQ A;  4MGK E;  1VR9 A;  2HE7 A;  2AQ3 B;  2QEJ C;  3L08 A;  3LJ3 A;  3UIO B;  1UBI A;  2OOB B;  4HWI B;  3AUL A;  1EM7 A;  2KDM A;  4ASW C;  3E56 A;  4GOC A;  1T0Y A;  5D6J B;  5BMI A;  1VJK A;  2XBB C;  4W9L A;  2LD9 A;  1Z2M A;  2L8J A;  2NBU A;  2ZZP B;  5FR6 A;  3H7P A;  3FIL A;  2DZI A;  5AUI A;  5E6O A;  3P4S B;  4MM3 A;  3P4Q B;  1V1P A;  4FJY A;  4PS8 A;  1MI0 A;  2AQ1 B;  2C60 A;  2IYD B;  3H9D A;  1TZO A;  1WRD B;  1WM3 A;  4KKJ A;  3TJP A;  2CS4 A;  1XLN A;  3R7R A;  3ZLZ A;  2KFK A;  4N58 A;  2GLS A;  3U8Z A;  3ZDM C;  3ONS A;  3BK1 A;  1FFU A;  3DBH B;  2M4N A;  2NTT A;  2WXM A;  3IVF A;  2XK5 B;  3V62 A;  1WFY A;  3Q69 A;  4P1C C;  2PTL A;  2BS2 B;  3Q3F A;  1EO6 A;  2BS3 B;  1QLB B;  3AEB B;  5LXI B;  1RM6 C;  1HE8 A;  2CU1 A;  4B6W A;  4XYC A;  3P2B A;  3L54 A;  3KVF B;  3AE7 B;  1WGH A;  4ZRK A;  4A55 A;  2XNA C;  2WXK A;  1XO3 A;  3B2F A;  1I42 A;  3ZTC A;  4LJO B;  1QOF A;  3NUH B;  2JWU A;  2D3A A;  3N30 A;  3PRZ A;  2GOW A;  5TR5 A;  4ZHO A;  2KD0 A;  3HVZ A;  3IBE A;  2KWD A;  2WWZ A;  1V2Y A;  2J52 A;  4KDI C;  3WA0 A;  1NI2 A;  2MBE A;  2HDE A;  2N1V A;  4JX1 C;  4EUT A;  1NVI D;  3N9Y C;  2PVG C;  2BYV E;  5HHD G;  2FUH B;  2UWQ A;  4I6N B;  3D32 A;  2KVZ A;  4REZ A;  4KZ0 A;  2V1Y A;  2HJ1 A;  2CHZ A;  2KDE B;  1UD7 A;  2V3N A;  4K3B A;  2JSV X;  3U4E G;  4EZK A;  3BYY B;  3IFW B;  3H6N A;  3MHZ A;  2V3P A;  1I4R A;  2L83 A;  4IC7 B;  1FNW A;  3DCG A;  4NJ7 A;  3DBS A;  1SXT A;  4MH8 A;  1VZ7 A;  4WWP A;  2WXQ A;  4AJY B;  1J0G A;  3X0W A;  2C9W B;  3ZNH B;  3VHT C;  4NPN A;  4YSZ B;  4WWN A;  3ZUN A;  4MH0 E;  3RMK C;  1TS3 A;  2K3U A;  2KNB A;  2KO3 A;  3RN9 C;  1FRD A;  3QIJ A;  4ZYS A;  3AH7 A;  1I4P A;  1E0Z A;  3H8H A;  2BYF A;  2L0F A;  2XK5 A;  1E8X A;  1E8Y A;  3VRB B;  4C80 A;  4X57 B;  1C79 A;  3N20 C;  4ARI A;  1HTQ A;  3Q3O C;  4XZ4 A;  1KRH A;  4WAA A;  1FCC C;  3RPF C;  3VDZ A;  4HPP A;  1LQB A;  2IO0 B;  1V6E A;  1T0R C;  3PO0 A;  3RNA C;  4J6I A;  3KQ4 A;  1V8C A;  2KMM A;  4LTU A;  3GP7 A;  2KXJ A;  3PLV A;  1TS5 A;  3RNF C;  3PRM B;  3RI7 C;  1NEN B;  3WAO A;  5CHF A;  3ZW3 A;  3AEE B;  1GB4 A;  3TEZ A;  4JLC A;  4D2K A;  2KJR A;  2GRI A;  1SSN A;  1KLG D;  1UGM A;  3BK2 A;  2KTF A;  2L52 A;  2RGF A;  2KWV B;  3GE3 C;  5CHV C;  5BYR A;  2C7N B;  3AEG B;  3GB1 A;  2QMT A;  3W5U B;  3PZ7 A;  2N1W A;  3QJZ A;  1SGH A;  2ZVO A;  1K50 A;  5J18 A;  1TS2 A;  3VTW A;  4ICV A;  5FK9 C;  1TY2 A;  4IWQ A;  4LJP B;  2K25 A;  2MEK A;  3TIX A;  3ALB A;  2LUM A;  4G0N B;  2D11 A;  3N1Z C;  1UNS A;  1FXT B;  3SEB A;  1QQR A;  3NS1 A;  2WX0 A;  1Y8R C;  1JML A;  2DZM A;  4K81 A;  1RAX A;  2L00 B;  4RM9 A;  1WSP A;  5IO9 A;  3OAW A;  5AZG A;  3EUB 2;  1P3Q U;  3GZN B;  2FCS A;  5IN7 A;  2OHF A;  2JY6 A;  2KJ6 A;  4YSX B;  1RFA A;  3AB5 A;  5G55 A;  2N7D A;  4FA6 A;  4W9D A;  5IOI A;  1VDV A;  4AS1 A;  4GIV A;  1FXI A;  3U7Z A;  3Q3M C;  1YQ4 B;  3EFU A;  1EUV B;  4NNJ B;  2BGF A;  2KMC A;  3BVG A;  4R3D A;  3V6E B;  1QZE A;  5J17 A;  2LGI A;  1X1M A;  4WQM A;  3PTF C;  2JT4 B;  1JWU D;  3LB8 C;  4NAW B;  3TSS A;  4BOS C;  1HZ5 A;  5C3J B;  5IP4 D;  1D5M C;  2X38 A;  3DPD A;  2WDR B;  1XT9 B;  1N63 A;  2ZW1 A;  1HQR D;  5LXH A;  2MQJ A;  1TKY A;  3PRP B;  1OQY A;  2DX5 B;  3TL5 A;  4HPM B;  4ANX A;  1OFF A;  3QX1 A;  2AWT A;  1SJE D;  5BYS A;  1MG8 A;  1NI3 A;  3MHS D;  2FBW B;  1F52 A;  2AYO B;  2W55 A;  1WX7 A;  2IY1 B;  4ANV A;  4DXG A;  3T3O A;  2WYQ A;  2JRH A;  4IG7 B;  4A20 A;  2RPV A;  4RM8 A;  4YTN B;  2Z59 B;  1WZ3 A;  5HKH A;  2QC8 A;  1MG4 A;  2OJW A;  3NVZ A;  3WAN A;  3DBR I;  1XLP A;  2IJ0 A;  2WXG A;  2SAK A;  3MFG A;  3Q14 C;  1WY8 A;  3AV8 A;  4HDO A;  1TKG A;  3V6C B;  2WQY B;  3CF6 E;  3I57 A;  3R3M A;  1ET9 A;  2BKR B;  1XLO A;  3RCZ A;  3KH0 A;  1CJE A;  2LXA A;  3RD2 A;  3O65 B;  3VUW A;  2JYE A;  4P7I A;  1MHX A;  3P4R B;  3R66 C;  2QSD A;  1T3Q A;  2LEK A;  2C7M B;  3AE2 B;  3M62 B;  1FM0 D;  4M01 A;  2MP2 A;  2K8C A;  2FNJ B;  3VFK A;  4K7S A;  4PS3 A;  4TSS A;  2L0T A;  2JZZ A;  3PGE A;  4GGQ A;  4ZOH C;  3ZYY X;  1C77 A;  1WMH A;  2L1A A;  2R61 A;  2WXH A;  5FR3 A;  4NAW A;  3ECI A;  2ZNV B;  4GB9 A;  5TSS A;  4A3O A;  1I4Q A;  4ZYN A;  3OG5 A;  4JWS C;  4WJP A;  3Q2A C;  4P6V F;  1XLQ A;  3AE5 B;  1SE2 A;  5L95 C;  1KH0 A;  1L4Z B;  2BW2 A;  2IO1 B;  1R7S A;  4WUR A;  2V9H A;  2JX5 A;  3K9P B;  2O6V A;  3BYT B;  3WAM A;  2HTH A;  4KGT A;  1N6Z A;  1WYW B;  1KTK A;  5EE1 A;  4OVU A;  4MM3 B;  2PPH A;  1DGJ A;  2J7Q B;  4N6E B;  2M19 A;  4AOF A;  4DBG A;  2LUE A;  1QOG A;  4AQ7 A;  1YN5 A;  2G4D B;  1C9F A;  3E9S A;  2G3Q B;  1WXS A;  2PEA A;  3RNE C;  2KFK B;  3ML8 A;  3DBL B;  2LVO A;  4K7U A;  3NZU A;  3AU5 A;  2KMA A;  3ENE A;  3PLU A;  3PZ8 A;  2ASQ A;  4DHJ D;  4MGI E;  1IUE A;  2YEP F;  2I1K A;  1YQ3 B;  2KZR A;  4BKT A;  4RMA A;  1JCK B;  3N32 A;  4RFB A;  2QIL A;  3A33 B;  1FXA A;  4TQ1 A;  4BFR A;  1FRR A;  4ITK A;  2NTS A;  2V4L A;  3I9V 1;  1N61 A;  4DHZ B;  1JAL A;  2Z0D B;  1CQV A;  3JSV A;  3UI3 A;  4DHZ E;  1Q0W B;  4C7Z A;  2RPQ A;  2LGD A;  1V97 A;  3KUD B;  5BO4 B;  3FAH A;  4CO7 A;  4TMA B;  4WIP A;  3R8B A;  2LVQ A;  1D5Z C;  3KUZ A;  4MSM B;  4WJQ A;  2KVR A;  3EEC A;  2KQ4 X;  4M0W B;  2BYT A;  4ARC A;  1SIJ A;  2LJI A;  4XWT A;  4DXA B;  3EGR A;  4S17 A;  5FKA C;  3O13 A;  1ISN A;  4W9G A;  4DDI D;  3JW0 X;  2JPH A;  1VRA B;  3PV1 A;  3AE3 B;  1K52 A;  1KOT A;  4DQO C;  4EE2 A;  2BVC A;  2KTR A;  3HM6 X;  3AE4 B;  4LCD E;  4B9K A;  1R4N I;  2K0P A;  2WU5 B;  4C7Y A;  4HJG E;  3AEA B;  2RDG A;  4IKG A;  2KC1 A;  1GOZ A;  1UH6 A;  3I63 C;  2KQS A;  1DOX A;  1KLU D;  2J53 A;  4OVV A;  2SEB D;  2MJ3 A;  4E3C A;  3ZQ4 A;  3AI5 A;  4FJZ A;  4C4V A;  1NYQ A;  1C4C A;  2CJO A;  1V9J A;  2IGH A;  4NQK E;  3EC8 A;  1P7E A;  1WGY A;  4B95 A;  4AWJ A;  3QHT A;  4DHJ B;  4US9 A;  3L10 B;  2K8H A;  2ZW0 A;  3I5J C;  3JYU A;  5AEK B;  3MC0 B;  2D2Q A;  2MRP A;  4YT0 B;  2LGX A;  1CMX B;  4E71 A;  2BWF A;  5BMH A;  4M8M A;  3BVM A;  2PE9 A;  5E6N A;  4C00 A;  2D07 B;  4XDD A;  3PRE A;  1WIA A;  3DHI C;  2ICI A;  4M00 A;  1SJH D;  4FN2 A;  2KWC A;  2DYO A;  2EKI A;  5T8I A;  4WJO A;  5J2R A;  2JF5 A;  2D3G A;  2QDF A;  4RGM A;  2QIE B;  3VTV A;  5GMV A;  1TS4 A;  2CHW A;  4RF1 A;  4M0W A;  3VR9 B;  1RWS A;  3UIP B;  2FCQ A;  1WJ6 A;  3OWE B;  4IM0 A;  3PHX B;  4RGN A;  1YX5 B;  1J19 A;  4ANU A;  3U2S C;  4HKZ E;  1ROE A;  2KN5 A;  3RNC C;  3M95 A;  2N9K A;  3NS8 A;  1RRB A;  4XWW A;  4K7W A;  3IT6 B;  1C3T A;  5HFY A;  3MJW A;  2D5G A;  2GI9 A;  3A4R A;  4RNA A;  4HXD A;  4W9I A;  3RZF A;  4US8 A;  1LM8 B;  1K53 A;  3R2I A;  4URK A;  1YN3 A;  1ZOY B;  3VQI A;  2IY0 B;  3P4P B;  3PS6 A;  4JL9 A;  2NS5 A;  4GU2 A;  2ZCC A;  4MT5 A;  4HRS A;  2E3T A;  3ZKJ C;  1PFD A;  5JZE B;  2KOX A;  1WGR A;  1WJ4 A;  4BKS A;  3V3X A;  4WWO A;  1GB1 A;  3BY4 B;  3KW5 B;  1EF5 A;  2BB6 A;  3U30 A;  4IOI E;  4PK1 A;  1V81 A;  3AN1 A;  4FAD A;  2UYZ B;  2N7E A;  1YJ1 A;  2GBK A;  2KDI A;  2G4S A;  4FUL A;  1SE3 A;  2NR2 A;  4K1R B;  3FKY A;  2NPT A;  3DHH C;  3KUC B;  2YVC A;  4YWG G;  1I7H A;  4F8C B;  4KKI A;  3CSF A;  2NCN A;  1BT0 A;  4P1B C;  4MEL A;  2BF8 B;  1A5R A;  4KV2 A;  2KN4 A;  5MPO A;  3KLS X;  1XD3 B;  1D4B A;  2W9N A;  1GJZ A;  2RR9 A;  4ANW A;  2Y5B B;  2KYW A;  3SFD B;  4ACF A;  3VRA B;  3APF A;  3RT3 B;  1XCQ L;  3AEF B;  3PZD A;  3T3N A;  2Y3A A;  4W9K A;  1AWD A;  3UIN B;  3Q3J A;  3ZIM A;  3PT2 B;  5G5G A;  2MH7 A;  2KDB A;  2L32 A;  3UQB A;  2MBH A;  3A1Q B;  3A9K B;  3T8M A;  5BMG A;  3GE8 C;  4OZC A;  2CR5 A;  3MP9 A;  1IBX B;  4DDG D;  3M3J A;  2LRW A;  1FMA D;  1PGA A;  1H8C A;  2O6V D;  5E6J A;  4A9A A;  2NVU I;  3AEC B;  2DZK A;  2W54 A;  4J3O D;  2ACZ B;  3RUI B;  3W1S A;  1IGD A;  4LNO A;  2GMI C;  1EU3 A;  1FIQ A;  4L2Y A;  1IGC A;  3AE1 B;  2JQR B;  5L83 A;  3RNG C;  5D3I B;  4GXB A;  4HKQ A;  2PKO A;  3IHP C;  1K8R B;  2V4I B;  1V1O A;  4IWO A;  1ZXI A;  4PT5 A;  4W9C A;  3TUO A;  2IPK D;  5JHB A;  2RDB C;  1SF0 A;  4PS7 A;  1PGB A;  4AUQ C;  1SE4 A;  2JWZ A;  4K3C A;  1JWM D;  4DWF A;  1WYG A;  2XN9 C;  5EE9 A;  3C19 A;  1FD6 A;  2FUG 1;  4OZA A;  2QCZ A;  1SE9 A;  4NJ6 A;  1E6E B;  2I1J A;  2NMQ A;  1C1Y B;  1WXV A;  2B76 B;  4BVU C;  1RFK A;  3ZNG C;  4BBN C;  3TEX A;  1UBQ A;  1G6J A;  4KSK C;  1B1Z A;  2NBV B;  3W1Y A;  2KX0 A;  2DWQ A;  4MDK E;  2MP2 B;  2I2Y A;  1WX9 A;  2LWP A;  4NQL B;  1ACC A;  5C2T B;  2RDH A;  2KAJ A;  1WMH B;  3IT4 B;  2BYE A;  1WGD A;  2AX5 A;  2DZJ A;  1VZ6 A;  3ABV B;  4XGA B;  4GN1 A;  3X23 A;  3KWV A;  3BII D;  2X8X X;  3TEY A;  4OVZ A;  2LJ5 A;  3LXF A;  4HCP B;  3DHG C;  2K22 A;  3TMP B;  4N59 A;  3QA8 A;  3U52 E;  2FID A;  3SD5 A;  3A1Q A;  2LZ6 A;  3A9K A;  3AED B;  2CU3 A;  1L4D B;  2MSE D;  1WXQ A;  2O6V B;  1F0Z A;  1E9M A;  1IBX A;  2AEH A;  3DWM A;  2JZ3 B;  4G11 A;  2WGS A;  4HK2 A;  1AAR A;  1V49 A;  1MJD A;  2PLP A;  1JWS D;  3H1U A;  2INN E;  2J0J A;  4JE3 B;  2UU7 A;  3ZJV A;  4JPS A;  3GZN I;  1L0V B;  2K6Q A;  3ZDT A;  2L05 A;  1YMH E;  4HJK A;  4XX5 A;  1U4A A;  4L23 A;  1Q10 A;  1OQR A;  3DVN V;  2K6D B;  4OHJ A;  2M17 A;  3ZXR A;  1PYW D;  3EFC A;  3SFE B;  1TZ1 A;  3JSV B;  2A4Z A;  1E8Z A;  2IO2 B;  4NY0 A;  1Q5W B;  2N9X A;  1NBF C;  4Q2J A;  1F9J A;  3CWI A;  2DYB A;  1GC6 A;  3N3K B;  1UGJ A;  1WWT A;  2WS3 B;  2MWS B;  4HCN B;  3NVV A;  2BWE S;  4P16 A;  2N7J A;  3L4P A;  2K39 A;  1P1A A;  1D5X C;  2N9P C;  2CHX A;  3QCA A;  1WF9 A;  1A70 A;  2H89 B;  3BIN A;  5G5H A;  1WM2 A;  4W9J A;  4WH4 A;  4L1B A;  2ZJD A;  3SR6 A;  1R4M B;  3VR8 B;  2N9E B;  4XC2 A;  4A3P A;  1E8W A;  4W9E A;  5KHQ A;  1GAQ B;  2MHJ A;  1Y56 A;  3B1L X;  4A90 A;  4A6Q A;  1BML C;  1UEL A;  1WGK A;  2M1M A;  1D6E C;  4NJC A;  3SHQ A;  4MJS A;  1L5P A;  4JQW C;  2Z8L A;  1KLV A;  3AE9 B;  3HK0 A;  1FEH A;  3FC4 A;  2KTR B;  1AYF A;  3KYD D;  2BBC A;  3W2D A;  4CQN A;  2YLM A;  1P7F A;  1UWM A;  1JWB D;  1VLB A;  2JYT A;  1WXA A;  4CHK A;  3ZJU A;  2FCM A;  3V61 A;  2EEL A;  4BKS D;  1NEK B;  3R2T A;  4BBN F;  2PMV A;  5I4D A;  2W3S A;  1DYQ A;  1F2R C;  4C4V B;  2WXO A;  4HRO A;  2E6X A;  2L3Z A;  5CTR C;  1NDD A;  2JXT A;  4WWM A;  1JW9 D;  4GDL B;  4EKU A;  4M02 A;  4RF0 A;  3ETR A;  3GS2 A;  4KZC A;  5H92 C;  4LNN A;  3P42 A;  3APD A;  2MCN B;  2C5L C;  2BT6 A;  4I6P A;  4XE0 A;  2ZEQ A;  4USA A;  2O2V B;  2M8S A;  5KHO A;  2Y5C A;  4BKG A;  3VUX A;  1QT9 A;  1F1H A;  3L17 A;  1QOB A;  1V80 A;  1JRO A;  2D3B A;  2YEP B;  1UZX B;  5IA7 A;  1E10 A;  1FPY A;  2N4F A;  1N60 A;  1N62 A;  4JGH B;  4YTP B;  2KKC A;  3VXW A;  2LVP A;  1WH3 A;  1L7Y A;  1Z5S B;  1ZP0 B;  2IZV B;  3WCQ A;  1WJN A;  2M0X A;  3ZGZ A;  2OJR A;  2FAZ A;  3PHW B;  3TCA A;  1VZ8 A;  1WR1 A;  2IDY A;  4N9F 4;  2PJH A;  3PPA A;  4IWP A;  2KHW B;  1HA5 A;  4NZL B;  4G50 A;  4BOZ B;  3B9J A;  4WQO B;  4KSL C;  1CK1 A;  3UGB B;  3DBL I;  1I35 A;  2V0G A;  2KFJ A;  3RNB C;  3AU4 A;  2EMS A;  3VAW A;  3QWZ B;  4RGO S;  5DPR A;  1YN4 A;  3N1Y C;  5AZH A;  1C76 A;  1UF0 A;  3QC8 B;  2VRR B;  2FE8 A;  2DHZ A;  1E90 A;  3NRZ A;  3PVL A;  2MA9 B;  2WU2 B;  2BTE A;  2JZP A;  4UDU C;  3NVW A;  4TUU A;  5D94 A;  2NPT B;  3AXC A;  1AN8 A;  4GDL A;  1Q1O A;  1WE6 A;  4CYE A;  4YTM B;  2JVC A;  2DAJ A;  2N9L A;  3Q6B A;  2MX2 A;  1E7V A;  4WJN A;  1EU4 A;  2KX3 A;  4F7Z A;  3NZ3 A;  1J7C A;  3CMM B;  3HIZ A;  1L2N A;  1YJI A;  2AL3 A;  2D10 A;  1H4R A;  2DEN B;  1L0X B;  3LDZ E;  3BZD B;  1T0Q C;  2O2V A;  1ZUD 2;  3URY A;  2MLB A;  3IXS A;  1XXG A;  1MFW A;  2C7H A;  2KC2 A;  1T0S C;  3SDL C;  3RFZ B;  2LMC A;  4FXC A;  1QOA A;  3Q8F A;  3RUL A;  4LDT D;  2XEW A;  4HEA 1;  1D3Z A;  1TT5 B;  1IP9 A;  1ESF A;  1V86 A;  4IM2 A;  1CZP A;  3ZNZ B;  5LNK 1;  3Q8A A;  3DDC B;  4MGZ E;  2OED A;  1GG3 A;  2BQQ A;  2FCN A;  2BB5 A;  3ZNI D;  3ZRC A;  4FBJ B;  1GUA B;  2IBI B;  4IUM B;  4LK0 M;  2MJE A;  4B0E A;  4YL8 A;  2CKH B;  1VCB A;  3NZS A;  3ZXV A;  4BZA A;  1YQB A;  4MAC A;  4M8N A;  4PYU A;  4ZRJ A;  2PW9 A;  1KM7 A;  1WX8 A;  4KIK B;  4OW0 A;  1IPG A;  2DAF A;  3Q8B A;  1FNV A;  5DPT A;  3L16 A;  3DBH I;  1GPX A;  1WJU A;  2KLC A;  4WAF A;  1P9D U;  3ZVV A;  2JUO A;  1F2R I;  1QF6 A;  1WRI A;  2L7R A;  1XEE A;  2IND C;  3UQA A;  1TY0 A;  3HVD A;  3B08 A;  2LRU A;  5D2M B;  2JU6 X;  2Y5P A;  2TSS A;  5DCN A;  2WHI A;  2RSU A;  3J9C A;  2RMM A;  2Q5W D;  1S3S G;  1AW7 A;  5DPS A;  1UUP A;  2BS4 B;  2KAC A;  2INP E;  3VVW B;  1TIF A;  1C4P A;  3NJT A;  3H7S A;  2IGD A;  2WDV B;  5EE3 A;  4W9H A;  3Q3N C;  4RGT A;  4ZRQ A;  4EZL A;  1T5X D;  1WE7 A;  2EKE C;  3IAM 1;  4II2 B;  5AZF A;  2DLB A;  2V3S A;  2R2O A;  1N5W A;  3EHV A;  4LNK A;  4TKN A;  1YOV B;  5HG2 A;  2GB1 A;  4XDC A;  4LDT B;  4QAY A;  4G3X B;  3RZW C;  1KJT A;  2LAS A;  2VH1 A;  5HI1 A;  5AUK A;  3NVY A;  1PDX A;  5EDS A;  1TKE A;  2WXL A;  3W5V B;  3KYC D;  5DPW A;  3MJ5 A;  1WXM A;  2HD5 B;  2N0S B;  2VH2 A;  3JVZ X;  4GLS C;  4EOY A;  1TJE A;  3GOE A;  5D3D A;  4JIO U;  2WDQ B;  2J4X A;  2Z0E B;  3AE8 B;  3ZJT A;  4TV3 A;  1XF5 L;  1HTO A;  3U7D A;  5LLI A;  2H88 B;  2B3A A;  1JQ4 A;  5GXG B;  5CHW A;  2AL6 A;  1YD8 U;  1HEZ E;  1WI0 A;  3WAP A;  3DVG X;  3NOB A;  4IW0 A;  3DOW A;  1E7U A;  3SU8 X;  4AJW A;  4H2A A;  3TBL D;  4DK5 A;  2IGG A;  2AQ2 B;  1QIL A;  3N1X C;  3C8Y A;  2WXN A;  2GBR A;  1OEY J;  3K9O B;  1ZDV A;  2LGY A;  3APC A;  1WR6 E;  2D3C A;  4KIK A;  2QJL A;  5JHA A;  1DOY A;  2GBM A;  1BXT A;  1QKZ A;  2WX1 A;  2PVO D;  4AP4 C;  4B0M A;  3ML9 A;  1WZ0 A;  4I6L B;  3VUY A;  1FCL A;  2DYM A;  4E74 A;  1ZPS A;  2BKF A;  4JWU C;  4FJV B;  2WXP A;  2VZK D;  4ICU A;  4ZRI A;  1NYR A;  1STE A;  5EE0 A;  2ZNV C;  1OEY A;  4EEW A;  2DNF A;  2KDF B;  1YNT E;  3ZRF A;  1LGR A;  1EWC A;  3S2A A;  5H8Y E;  3UF8 A;  3PSE B;  2EMT A;  2FIF A;  1JWA D;  1EWY C;  3OLM D;  4GMV A;  3NY5 A;  2BPS A;  3ZO5 B;  3W9C B;  1EF1 A;  1B9R A;  3M63 B;  4HDQ A;  4MJS B;  1UWX A;  4HLE A;  2WXJ A;  3QAR A;  1KF6 B;  1I4X A;  1ZGU B;  1XQQ A;  2MBQ A;  3MTN B;  1HZ6 A;  3DBR B;  3QQ8 B;  1F77 A;  2RD0 A;  2MBO A;  4F1S A;  2WXR A;  1OTR B;  1K51 A;  4OZB A;  3WAL A;  3VH3 B;  1XCT L;  1L6V A;  1VD2 A;  2M0A A;  3TEW A;  1SB3 C;  1TBE A;  1RYJ A;  1L6U A;  3HUI A;  3EA6 A;  2MW5 A;  1I4H A;  5IKC M;  2WLB A;  3C0R B;  1FO4 A;  2HTM E;  4FLH A;  2QHO A;  4W9F A;  3A9J B;  1ZXH A;  2GBN A;  1LFD A;  2KWU B;  2LHE A;  1FFV A;  1ZE3 D;  2INC C;  1MPE A;  5C23 A;  3DWG C;  1SBB B;  2HJ8 A;  2K5P A;  3L13 A;  1YIW A;  3IG3 A;  4RH6 A;  4IDI A;  3HHM A;  3VTU A;  1YJJ A;  5D7G A;  2K8B A;  3P63 A;  3V60 A;  1RLF A;  1SEB D;  3I3T B;  1LO5 D;  3T9L A;  3Q8E A;  4KVG B;  3DQV A;  2WXF A;  1C78 A;  3IAS 1;  1MHH E;  1E7P B;  3AMZ A;  1J7B A;  4MGY E;  2VZK B;  3HRD D;  1IYF A;  2W3R A;  2R2Q A;  2ZCB A;  5C1Z A;  4FHJ A;  4MSQ B;  1M4V A;  5BYQ A;  4GDK B;  3OJ3 A;  2ZPY A;  2G9H D;  2J0K A;  1ZKH A;  4ZRP A;  3A4S C;  2PE6 B;  3ZTD A;  2LGS A;  1C4A A;  2CJN A;  4TQ0 A;  1JRP A;  1MVK A;  3QAQ A;  1BUI C;  1TGZ B;  2REX A;  2W82 A;  5JXV A;  1DOI A;  3B2G A;  3DVN U;  1V5O A;  2A5U A; 
#chains in the Genus database with same CATH homology
 3EUB 2;  3CIR B;  4RGO S;  3AN1 A;  1YN4 A;  4KGR A;  1C76 A;  1SE3 A;  2OHF A;  2FE8 A;  3NRZ A;  4YSX B;  3P1M A;  3AB5 A;  2LFI A;  4YWG G;  1I7H A;  2WU2 B;  1L0Y B;  4KKI A;  2BTE A;  2JZP A;  1VDV A;  4AS1 A;  4UDU C;  3NVW A;  1FXI A;  3U7Z A;  1AN8 A;  4YTM B;  4KGS A;  1PGX A;  1KFY B;  1I4G A;  1YQ4 B;  2N9L A;  1ZDX A;  2KN4 A;  3BVG A;  1EU4 A;  4R3D A;  2LGI A;  4WQM A;  5MPO A;  3KLS X;  1TYG B;  3NZ3 A;  1J7C A;  3LB8 C;  1JWU D;  4NAW B;  1D4B A;  3TSS A;  1HZ5 A;  1YJI A;  3Q8C A;  3V05 A;  3FIL B;  5C3J B;  1D5M C;  2X38 A;  2G1E A;  2WDR B;  3SFD B;  1L0X B;  3VRA B;  3BZD B;  1N63 A;  2ZW1 A;  1HQR D;  1ZUD 2;  1XCQ L;  3AEF B;  3URY A;  3T3N A;  1TKY A;  2Y3A A;  1AWD A;  3IXS A;  1XXG A;  1V1P B;  5G5G A;  2MH7 A;  4NAM A;  2L32 A;  1OFF A;  3RFZ B;  2LMC A;  4FXC A;  1QOA A;  3Q8F A;  1SJE D;  4HEA 1;  3BWU D;  2DBY A;  5BYS A;  1NI3 A;  1PUT A;  5BMG A;  2PIA A;  1FNU A;  4OZC A;  2FBW B;  3KWL A;  2W55 A;  3MP9 A;  1IBX B;  1ESF A;  4C56 C;  1FMA D;  2MJD A;  3AM9 A;  3LYY A;  1PGA A;  4DXG A;  3T3O A;  2WNM A;  1CZP A;  5E6J A;  5LNK 1;  2ON8 A;  3Q8A A;  2RPV A;  4A9A A;  2OED A;  3BVZ A;  4YTN B;  2BB5 A;  3AEC B;  2M56 B;  2W54 A;  4LK0 M;  2MJE A;  2LHD A;  2J42 A;  4B0E A;  3AE6 B;  4J3O D;  2ACZ B;  3NVZ A;  3W1S A;  2I38 A;  1IGD A;  4O1N A;  1EU3 A;  1FIQ A;  4L2Y A;  1IGC A;  3AE1 B;  4KX6 B;  4DXF A;  1N5X A;  2JQR B;  1XLP A;  2IJ0 A;  2WP9 B;  5D3I B;  2WXG A;  2SAK A;  4MAC A;  4HKQ A;  2PKO A;  2V4I B;  2PW9 A;  1V1O A;  4PT5 A;  1ZXI A;  1J7A A;  3MFG A;  4YXD B;  1ENF A;  4ZHP A;  3AV8 A;  4OW0 A;  1HXY D;  4RCO A;  3TUO A;  1TKG A;  2IPK D;  3Q8B A;  1FNV A;  2WQY B;  4LLG M;  3I57 A;  1ET6 A;  1SF0 A;  1ET9 A;  1GPX A;  1XLO A;  4WAF A;  1PGB A;  1T6B X;  1CJE A;  1SE4 A;  4A8X C;  2WXI A;  1JWM D;  1F2R I;  1WYG A;  2XN9 C;  1QF6 A;  1WRI A;  2JYE A;  4YSY B;  5EE9 A;  1XEE A;  1OQQ A;  2K9X A;  2ONQ A;  1FD6 A;  1TY0 A;  1MHX A;  1VR9 A;  3P4R B;  2FUG 1;  2QSD A;  3HVD A;  2AQ3 B;  4OZA A;  1T3Q A;  2QEJ C;  2LEK A;  2JU6 X;  2Y5P A;  3AE2 B;  2TSS A;  1E6E B;  1FM0 D;  1EM7 A;  2KDM A;  2NMQ A;  3E56 A;  2RMM A;  2Q5W D;  3J9C A;  1AW7 A;  2B76 B;  1UUP A;  2BS4 B;  4TSS A;  2KAC A;  2INP E;  1RFK A;  4ZOH C;  3TEX A;  5BMI A;  3ZYY X;  1VJK A;  1C77 A;  1C4P A;  1B1Z A;  2IGD A;  2L1A A;  2R61 A;  2WDV B;  5EE3 A;  2DWQ A;  2WXH A;  5FR3 A;  2I2Y A;  4RGT A;  5TSS A;  4ZRQ A;  1T5X D;  1I4Q A;  3FIL A;  3IAM 1;  1ACC A;  2DLB A;  4JWS C;  5AUI A;  1N5W A;  2RDH A;  4P6V F;  5C2T B;  1XLQ A;  2KAJ A;  3AE5 B;  3IT4 B;  1SE2 A;  2AX5 A;  5HG2 A;  1KH0 A;  2GB1 A;  3P4S B;  1L4Z B;  1VZ6 A;  2BW2 A;  3P4Q B;  1V1P A;  4XDC A;  1R7S A;  3ABV B;  4WUR A;  2JX5 A;  3KWV A;  1MI0 A;  3BII D;  3TEY A;  2AQ1 B;  4OVZ A;  3LXF A;  1TZO A;  3BYT B;  2K22 A;  4N59 A;  5HI1 A;  4KGT A;  5AUK A;  3NVY A;  3U52 E;  1PDX A;  4KKJ A;  1KTK A;  1TKE A;  2WXL A;  5EE1 A;  3AED B;  3W5V B;  2CU3 A;  1XLN A;  4MM3 B;  1DGJ A;  4N6E B;  1L4D B;  2M19 A;  4N58 A;  1WXQ A;  3MJ5 A;  2N0S B;  1QOG A;  1E9M A;  1FFU A;  3BK1 A;  4GLS C;  4AQ7 A;  1TJE A;  1F0Z A;  1IBX A;  1YN5 A;  5D3D A;  1C9F A;  2WDQ B;  3E9S A;  2J4X A;  3DWM A;  2NTT A;  2WXM A;  3AE8 B;  3ZJT A;  3PZ8 A;  3Q69 A;  1XF5 L;  2PTL A;  2BS2 B;  2H88 B;  1JWS D;  2BS3 B;  2PLP A;  1QLB B;  2INN E;  1IUE A;  2YEP F;  4JE3 B;  1JQ4 A;  5GXG B;  1YQ3 B;  3AEB B;  1RM6 C;  3ZJV A;  1JCK B;  4JPS A;  1L0V B;  4RFB A;  2QIL A;  1YMH E;  1HEZ E;  1FXA A;  4TQ1 A;  3AE7 B;  4L23 A;  4A55 A;  1FRR A;  1Q10 A;  1OQR A;  4ITK A;  2NTS A;  3I9V 1;  2XNA C;  1N61 A;  2WXK A;  1XO3 A;  3B2F A;  1JAL A;  4H2A A;  1CQV A;  3UI3 A;  2IGG A;  2AQ2 B;  1QIL A;  3C8Y A;  2WXN A;  4C7Z A;  1QOF A;  3NUH B;  4OHJ A;  1ZDV A;  1PYW D;  1V97 A;  2JWU A;  2QJL A;  3SFE B;  3FAH A;  4TMA B;  4WIP A;  3R8B A;  1DOY A;  4ZHO A;  1BXT A;  1D5Z C;  4Q2J A;  1QKZ A;  3HVZ A;  3CWI A;  2KWD A;  2PVO D;  4B0M A;  2J52 A;  2HDE A;  2KQ4 X;  4JX1 C;  1UGJ A;  1NVI D;  3N9Y C;  1WWT A;  2PVG C;  2WS3 B;  5HHD G;  1FCL A;  2BYT A;  2DYM A;  4ARC A;  3NVV A;  1SIJ A;  2LJI A;  4P16 A;  4REZ A;  4XWT A;  2N7J A;  3L4P A;  3EGR A;  1ZPS A;  1D5X C;  4JWU C;  5FKA C;  1A70 A;  2H89 B;  5G5H A;  3O13 A;  2WXP A;  2VZK D;  4WH4 A;  1NYR A;  4L1B A;  2V3N A;  1STE A;  3SR6 A;  5EE0 A;  2JSV X;  3U4E G;  1VRA B;  3AE3 B;  3BYY B;  3VR8 B;  1K52 A;  4DQO C;  4EE2 A;  1YNT E;  3MHZ A;  1EWC A;  1GAQ B;  2V3P A;  5H8Y E;  1I4R A;  1Y56 A;  2L83 A;  4A90 A;  1JWA D;  3AE4 B;  1EWY C;  4A6Q A;  1FNW A;  1BML C;  1WGK A;  2K0P A;  2WU5 B;  4C7Y A;  1D6E C;  4HJG E;  3AEA B;  4NJC A;  1L5P A;  1SXT A;  2Z8L A;  3AE9 B;  3W9C B;  2RDG A;  4IKG A;  1FEH A;  1VZ7 A;  3FC4 A;  1GOZ A;  4MH8 A;  1B9R A;  2WXQ A;  1AYF A;  1DOX A;  1KLU D;  2BBC A;  3W2D A;  2J53 A;  4CQN A;  1P7F A;  2SEB D;  1UWM A;  2MJ3 A;  4YSZ B;  1JWB D;  1VLB A;  2JYT A;  3ZQ4 A;  1UWX A;  3ZJU A;  1TS3 A;  2WXJ A;  1KF6 B;  1I4X A;  2EEL A;  1NYQ A;  1C4C A;  2K3U A;  2CJO A;  1HZ6 A;  1NEK B;  3R2T A;  2IGH A;  1F77 A;  2PMV A;  5I4D A;  2W3S A;  1FRD A;  1DYQ A;  4ZYS A;  1F2R C;  3AH7 A;  1I4P A;  2WXR A;  1P7E A;  1E0Z A;  2WXO A;  4HRO A;  2E6X A;  3H8H A;  1K51 A;  4OZB A;  4US9 A;  1XCT L;  1L6V A;  2JXT A;  4WWM A;  1JW9 D;  2M0A A;  4GDL B;  3TEW A;  1SB3 C;  4RF0 A;  3VRB B;  1RYJ A;  2ZW0 A;  3MC0 B;  4C80 A;  1C79 A;  1L6U A;  3HUI A;  3ETR A;  3EA6 A;  3GS2 A;  5H92 C;  4ARI A;  4YT0 B;  1I4H A;  3P42 A;  1KRH A;  1FCC C;  5BMH A;  3RPF C;  2WLB A;  3BVM A;  1FO4 A;  2HTM E;  3PO0 A;  2BT6 A;  3KQ4 A;  1V8C A;  2KMM A;  4LTU A;  3GP7 A;  4XDD A;  4XE0 A;  1ZXH A;  1TS5 A;  4USA A;  2ICI A;  1NEN B;  1SJH D;  2Y5C A;  2LHE A;  1FFV A;  1ZE3 D;  1QT9 A;  1MPE A;  2DYO A;  2EKI A;  3AEE B;  3DWG C;  5T8I A;  3TEZ A;  1QOB A;  1GB4 A;  1JRO A;  1SBB B;  4RGM A;  4D2K A;  2YEP B;  2K5P A;  2QIE B;  2GRI A;  1SSN A;  4RH6 A;  1KLG D;  1E10 A;  4IDI A;  1N60 A;  1N62 A;  1YJJ A;  4YTP B;  3BK2 A;  1TS4 A;  5D7G A;  4RF1 A;  3P63 A;  4M0W A;  1SEB D;  1LO5 D;  2L52 A;  3VR9 B;  3Q8E A;  1RWS A;  2WXF A;  1C78 A;  3IAS 1;  1ZP0 B;  1MHH E;  5BYR A;  1E7P B;  3AMZ A;  1J7B A;  3OWE B;  4RGN A;  2VZK B;  3HRD D;  3AEG B;  3WCQ A;  3GB1 A;  4HKZ E;  3U2S C;  2W3R A;  1ROE A;  2QMT A;  3W5U B;  2N9K A;  3PZ7 A;  4XWW A;  3IT6 B;  1M4V A;  5BYQ A;  1K50 A;  4GDK B;  2D5G A;  1TS2 A;  2GI9 A;  4RNA A;  4US8 A;  5HFY A;  3ZGZ A;  5FK9 C;  1TY2 A;  2G9H D;  4ZRP A;  2MEK A;  1K53 A;  3R2I A;  1YN3 A;  1VZ8 A;  1ZOY B;  2LUM A;  3VQI A;  2IDY A;  1C4A A;  1UNS A;  3P4P B;  3SEB A;  1QQR A;  2CJN A;  4TQ0 A;  3NS1 A;  4MT5 A;  1JML A;  1JRP A;  2E3T A;  4HRS A;  1PFD A;  1MVK A;  1BUI C;  1HA5 A;  2W82 A;  3V3X A;  4NZL B;  5JXV A;  1WSP A;  1GB1 A;  3B9J A;  1DOI A;  3B2G A;  1CK1 A;  2BB6 A;  4IOI E;  2V0G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...