3GB1A

Structures of b1 domain of streptococcal protein g
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
56
structure length
56
Chain Sequence
b'MTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (B1 DOMAIN OF STREPTOCOCCAL PROTEIN G)
molecule tags Immunoglobulin binding protein
source organism Streptococcus sp. 'group g'
publication title Improving the Packing and Accuracy of NMR Structures with a Pseudopotential for the Radius of Gyration
pubmed doi rcsb
total genus 12
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 1999-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3gb1A00
2KACA 1IBXB 2EELA 1JMLA 1HEZE 2JU6X 1IGCA 1YNTE 2GB1A 1F2RC 1ZXHA 2KQ4X 2PW9A 4IKGA 4KGRA 2K0PA 2IGHA 1QKZA 2KWDA 2JZPA 2GI9A 4MACA 2LHDA 1K50A 2J52A 2LHEA 3FILA 1IGDA 1FCCC 2NMQA 3FILB 2ZW0A 1C9FA 2QMTA 4WH4A 3MP9A 2RMMA 2KN4A 1K51A 2OEDA 1GB1A 2N7JA 3V3XA 5HG2A 1XCQL 1K53A 1GB4A 1MPEA 5HHDG 2I2YA 2I38A 2ONQA 5HI1A 2ZW1A 2IGGA 2QSDA 4OZAA 4OZCA 1KH0A 5BMHA 1MHXA 4D2KA 1P7FA 1UWXA 4IOIE 2LGIA 5BMGA 1FCLA 1K52A 4KGSA 1F2RI 1EM7A 2J53A 2ON8A 1PGXA 1MVKA 1MHHE 1PGAA 1D4BA 2N9KA 3GB1A 4KGTA 2KDMA 4OZBA 4HKZE 1Q10A 2JSVX 1YMHE 5HFYA 5BMIA 1P7EA 1PGBA 2PLPA 1HZ6A 1IBXA 2JXTA 4GLSC 5JXVA 2LUMA 1XF5L 1FD6A 4HJGE 2PTLA 1HZ5A 2JWUA 3UI3A 1MI0A 1XCTL 2RPVA 2IGDA 2N9LA
chains in the Genus database with same CATH superfamily
3H7PA 3MC0B 3T3NA 4MDKE 1I4GA 4FLHA 2VZKB 1C1YB 1I4XA 2RD0A 1NYQA 1STEA 2KQ4X 5T8IA 2C5LC 1AARA 3L17A 2BVCA 3P2BA 1J8CA 2WXQA 2JUOA 2V4LA 2N0SB 4DHZB 3W1SC 2N7EA 1VRAB 3TJPA 1C9FA 4K81A 3IAM1 1PUTA 3ZRFA 4KX6B 2KOXA 1WGYA 1SIFA 1J19A 1FNWA 1HTOA 1KLGD 3MHSD 4HWIB 1OEYJ 4KIKA 2M0XA 1TY2A 1XO3A 2HD5B 2KQ7A 3WCQA 2C60A 3A9KA 5CX3A 3SU8X 1F52A 1MG4A 4C7ZA 4M0WB 1VLBA 1F9JA 2PIAA 2FNJB 2K6QA 2LWPA 3N32A 1UWXA 1ZW7A 2XNAC 3ML8A 1YQ3B 3VUWA 4BBNF 1F77A 1F2RI 3ZVVA 2BQQA 3EHVA 3RULA 5J18A 2MEKA 4ZHPA 4F1SA 2L32A 1C4AA 2QIEB 5IOIA 3QARA 2M0AA 3IBEA 4OZBA 3U2SC 5G5GA 1WGKA 4RMAA 5MPOA 5HFYA 1P7EA 1L0XB 2PLPA 3HIZA 4C80A 2XK5B 2DAFA 2IYDB 3I3TB 2WDVB 2WXMA 4M8NA 4C4VB 1P9DU 1C4PA 2VZKD 3GS2A 1QLBB 2G4SA 2RPVA 2QHOA 5LXHA 1E8YA 2KACA 4XWTA 3ENEA 2K9XA 2MP2A 4NPNA 2V3NA 2AQ3B 3BK1A 2PW9A 4G0NB 3T3OA 3W1YA 2GBNA 4HDOA 1ZOYB 3ZXVA 4YSYB 3Q8BA 2N9PC 4XWWA 1I4PA 2GBMA 2AQ1B 4CO7A 1XD3B 2KQSA 2J52A 4TQ1A 2XN9C 1IP9A 1WGHA 1IGDA 3M63B 4CHKA 4E3CA 2X8XX 2MP2B 2QMTA 3AEAB 5FR6A 1IUEA 2ACZB 3MC9A 4WWPA 3A1QB 2WU5B 3JVZX 1CJEA 2CHWA 4MGZE 3HVZA 2CR5A 3W1SA 1D5MC 3ZIMA 5G55A 1GJZA 3BWUD 1T0QC 1ZDXA 1L6VA 1XLQA 4H2AA 4OVVA 3GE8C 3L4PA 3B1LX 4DHZE 4L2YA 1E0ZA 1ROEA 4BAXA 3DPDA 1LGRA 2K8CA 4M01A 3HM6X 2BYFA 3NHEB 1C79A 2KJ6A 2UU7A 2SEBD 4EZJA 3BY4B 2W3RA 2BF8B 3MJ5A 2X38A 3I57A 2D5GA 2B76B 2LXAA 4ARIA 4YTMB 2KWCA 3PT2B 1KJTA 1UH6A 1NENB 4WJOA 2KK8A 2Z0EB 3B0AA 3LXFA 3NVWA 4IG7B 4II2B 5IAAC 1I7HA 2M4NA 1VDVA 2J0JA 4REZA 1KFYB 3QIJA 1SJED 2KC1A 2KFJA 3EFUA 2DZMA 2LJIA 5LNK1 2N1VA 2V4IB 5FR3A 3JSVA 3TBLD 2NS5A 2NBVB 2PVGC 4GB9A 2IY1B 2N9EB 1FFVA 1JROA 2KX0A 1WJUA 2BKRB 1BXTA 2WX1A 3GOEA 2LGXA 3DOWA 3VH3B 3SEBA 4BKTA 3L10B 1T3QA 3MFGA 2J4XA 4MT5A 1ENFA 1GC7A 3ECIA 2A4ZA 3BVMA 2DBYA 3FILB 1TGZB 4MGIE 4KDIC 2MH7A 4WJNA 4XC2A 1WYGA 3AEGB 1N63A 1WRIA 2BKFA 1SSNA 1V49A 1ZUD2 1CZPA 2DLBA 2KO3A 2MJDA 2M56B 2LJ5A 3SDLC 4IDIA 2ONQA 2ZNVB 1X1MA 4US8A 1SF0A 5KHOA 1WJNA 1L0YB 1WR6E 3C0RB 3U52E 3ZQ4A 4FHKA 2IO3B 4HRSA 4IOIE 1YN3A 5BMGA 4G50A 1SB3C 3N1XC 2KWUB 1V1OA 2AL6A 2WDQB 2KT7A 2Z0DB 2E6XA 4RGNA 4LNOA 4ZDVA 3QCAA 2DZJA 4MEMA 4ZRQA 2D3BA 2KTFA 4W9CA 2NPTB 3R8BA 4HLEA 2NPTA 3OJ3A 1YD8U 5JHBA 1TTNA 1D5ZC 3U8ZA 3V05A 3PS6A 3LDZE 4I6PA 2V3SA 5EE3A 4HJKA 1JRPA 2L05A 4W9KA 3J9CA 1Q0WB 2ZCBA 3AMZA 1OEYA 3DBHB 1FMAD 1XEEA 4W9DA 5EE9A 4HEA1 1WMHB 4ZRKA 4B0EA 3APFA 1ZDVA 5D6JB 4P7IA 2NCNA 1E8WA 1HEZE 3N1YC 4B0MA 4AJYB 4AP4C 2DHZA 1RLFA 2V3PA 2EKEC 3IT6B 4PS3A 4B6WA 2IBIB 3AEDB 1RM6C 1XQQA 2WXKA 2IPKD 2G1EA 1T0RC 2INCC 1FFUA 3B08A 5CHFA 4IW0A 4XYCA 1I42A 4DXAB 2BYTA 2MWSB 2RMMA 1YQ4B 2PEAA 4DDGD 1MFWA 5AZGA 2L1AA 1NVID 1ISNA 4N9F4 2LUEA 3QJZA 3M62B 2LMCA 3Q69A 2D3GA 2IGGA 2OJRA 2DAJA 2G3QB 2C7NB 1ET9A 3PZ8A 2INPE 1Q1OA 2LEKA 1WM3A 1Z5SB 4EZLA 4LDTB 3ZJTA 2N1WA 3L08A 2HJ1A 1R4MB 3L13A 4KZ0A 1R4NI 4WQOB 3TIXA 1KTKA 2VH1A 3A9JB 4GN1A 5AUKA 1C76A 3R2IA 2BTEA 4FJYA 1T5XD 4HPPA 3NS8A 2MLBA 1P0RA 3L54A 1HZ5A 1ACCA 1FEHA 4AUQC 3PSEB 1GAQB 2V9HA 1N5WA 1FO4A 4W9EA 2DZKA 1FIQA 2WXOA 3QK0A 2D2QA 3ONSA 1WXQA 3VFKA 1MJDA 2LGYA 3OLMD 3DVNV 4JL9A 2KKCA 2D10A 3QC8B 2OJWA 1P1AA 3FKYA 2WWZA 2LHEA 1FCCC 3KW5B 1WZ0A 4GOCA 4WH4A 2D07B 4WAAA 1M94A 1K8RB 3PV1A 3Q8AA 2RSUA 5LXIB 5HG2A 4G3XB 1K53A 3AE6B 2YEPF 1GG3A 2QSDA 3FAHA 4YXDB 3C8YA 3Q3FA 2BB6A 2FCMA 5TR5A 1KM7A 1GNUA 3W5UB 2MX2A 1VZ8A 3DDCB 1JWMD 4HPMB 4HVBA 3UIOB 1V2YA 1TJEA 1CQVA 2E3TA 5L83A 3AE5B 5BYRA 2R61A 2BT6A 2BYVE 2KJRA 3AECB 1E7PB 5GMVA 2JSVX 2HJ8A 3R7RA 4ZRIA 3RMKC 2G45B 3AH7A 1IBXA 1TYGB 1RWSA 4LTUA 5DPRA 2NTSA 2L76A 4IUMB 1QOAA 2IZVB 2RDBC 3VXWA 4AQ7A 4GDKB 4DBGA 1TS4A 1CK1A 3DVGX 3BVZA 4RH6A 1CMXB 1AW7A 1IGCA 2WNMA 4K7WA 3H6NA 4IKGA 1FXIA 1V9JA 3IFWB 2VH2A 4NY0A 3RN9C 2H88B 3NJTA 3MC8A 3RFZB 4BZAA 1B1ZA 2WQYB 4FHJA 3SD5A 1I4QA 1WX7A 3X0WA 3ZRCA 3R3MA 5IO9A 4K7UA 4S0RA 4YSZB 1XLPA 2RDHA 2L8JA 3V3XA 1WE6A 1NYRA 3VTVA 1MPEA 5HHDG 2HTME 4WWNA 4KIKB 4HCPB 4ZHOA 3U30A 5L95C 5BMHA 3QX1A 3ABVB 1WX8A 1WF9A 4AWJA 1B9RA 3VQIA 2CHZA 4E71A 1PGXA 1E8ZA 4W9GA 3PHWB 2MBOA 4TMAB 4A9AA 3Q8EA 3PZDA 5J17A 2C7MB 5JH5C 3EECA 4ZYSA 3NUHB 3A9JA 3EFCA 1L4ZB 3R66C 1Q10A 2PKOA 3TL5A 2KMMA 1PGBA 5EDSA 1F1HA 5G5HA 4GIVA 2DNFA 4X57B 1E7UA 1I4RA 4GDLA 5HKHA 1SE3A 3VUYA 2V0GA 4I6NB 1A5RA 4TV3A 3PPAA 2KVRA 3RPFC 3UI3A 1WR1A 2UWQA 2KDEB 4P6VF 3PLUA 2JRHA 2W9NA 4P1CC 3RNFC 3TMPB 3WA0A 2L0FA 3DBRB 4ARCA 3QA8A 4ICVA 3L16A 1VR9A 1C3TA 2PVOD 3CSFA 1V5TA 4KGRA 1NI3A 3AE7B 2IGHA 2L83A 4ACFA 2MQJA 3PRPB 3DHGC 1GOZA 2BBCA 2W54A 2JF5A 1OFFA 1H8CA 3AEBB 3RNEC 4XE0A 1R4NB 1JWBD 5I4DA 3W5VB 4JGHB 1UUPA 3IG3A 2YVCA 3DBSA 4HPLB 4IM3A 3JYUA 1L4DB 4OZAA 5C23A 4OZCA 3PRMB 1LFDA 2LGDA 4Q2JA 4J3OD 4HKQA 2M8SA 3RNAC 2D3CA 1AYFA 2YLMA 4EKUA 1YN4A 2KMCA 2NVUI 5AUIA 4RF1A 2DYMA 2Y5BB 1R7SA 1UZXB 1JWSD 1ZP0B 2N9KA 1TS2A 1NEKB 1EF5A 1EU3A 4HK2A 1GC6A 4C00A 2N7DA 2AYOB 3NZSA 4A20A 1DYQA 1YMHE 3DWMA 1MG8A 1VZ6A 4RM8A 2BPSA 2IJ0A 1AN8A 1TIFA 1KLUD 4KSKC 2EMSA 1JALA 2YEPB 2MJ3A 3NS1A 4HDQA 2KN5A 3HM3A 4GGQA 3DBHI 5IN7A 2NTTA 2JPHA 3RUIB 1M4VA 4DHJD 1YIWA 4W9HA 5H92C 2W3SA 3PZ7A 2AEHA 3ZGZA 5FK9C 2HDEA 2JZPA 4MACA 3AE2B 1K50A 4YWGG 5H8YE 1D3ZA 1AWDA 3V62A 1FRDA 3E56A 4GXBA 5D94A 4GSWA 3R7QA 3I63C 2WXRA 4BKSA 3WANA 2KLGA 1EWCA 2LZ6A 3U7DA 3UINB 2ZJDA 2AWTA 2CJNA 4KV2A 4A8XC 5GXGB 2WXPA 3ZNGC 2I38A 1OTRB 3TEXA 1JCKB 3VRAB 2AX5A 1P98A 3QQ8B 1SE2A 3HUIA 2C9WB 2L3ZA 2WXIA 4ITKA 4LNFA 4WIPA 4EZKA 2KD0A 2KYWA 3U7ZA 3I5JC 2LVOA 3M3JA 1DOYA 3K9PB 1LXDA 2V1YA 4GMVA 4ASWC 2BGFA 3OJ4B 1HZ6A 2D3AA 1FNVA 4TQ0A 3PHXB 2ZZPB 2KXJA 3RNGC 4MELA 1QOFA 1RFAA 4A3OA 2JWUA 3WAPA 1S1QB 3E9SA 1ESFA 2PE6B 1V8CA 1WZ3A 1E90A 2KJHB 4BBNC 1JMLA 2MJEA 1SE4A 3OG5A 3RCZA 2O2VA 1RRBA 4YT0B 1YNTE 1ZXIA 2WDRB 1ZXHA 4RF0A 3APDA 3OAWA 4WURA 4O1NA 4N6EB 1Y56A 1OQRA 3TUOA 1QKZA 2FUG1 2DZIA 1YJIA 1E8XA 5JHAA 2AQ2B 2JYTA 3RNCC 2MA9B 3LYYA 4MSMB 1S3SG 4L23A 2DX5B 1T6BX 3P1MA 4WJQA 2I1KA 2KN4A 4WQMA 2PJHA 2FUHB 1SEBD 2BWFA 1WGGA 4FJVB 3TCAA 3VTWA 2KLCA 3OWEB 4LLGM 3AU5A 2LASA 1HA5A 1V1PB 1DOXA 4FA6A 4N58A 1P7FA 3VAWA 4AJWA 2GBKA 2LGIA 4LCDE 1E6EB 1J0GA 3VHTC 1WXVA 4PYZA 5AEKB 2LVPA 1FRRA 1K52A 3P63A 2PPHA 5D3DA 2K3UA 3CSTA 1KRHA 1VZ7A 3PGEA 1PGAA 4DXGA 2DWQA 2WS3B 3A4SC 1V86A 1FXAA 2FE8A 2LVQA 4MM3B 1WI0A 2L00B 3HRDD 5BMIA 3BVGA 4CQNA 4MSQB 3Q3MC 3O13A 2KTRB 3DBLI 4BOZB 2ZCCA 2JT4B 2C7HA 4P16A 2WXHA 3P4RB 1WH3A 2IO1B 4DWFA 3GZNI 3KUZA 2MHJA 3AU4A 3VR8B 1XCTL 4FN2A 4NJ6A 3RZFA 2IGDA 1FNUA 1BMLC 3VTUA 1E10A 1EU4A 2PE9A 1JQ4A 3AV8A 5AZFA 3Q8FA 4FULA 1E7VA 1GUAB 3DHIC 3ZNHB 3ML9A 5D7GA 3RD2A 2CU3A 3TEZA 4ANVA 5DPSA 2K22A 4K1RB 4BOSC 3ZYYX 2N4FA 4GU2A 3ZDTA 3IVFA 2ZPNA 4CYEA 2MRPA 3PVLA 2KNBA 4JLCA 3M95A 2WGSA 1D5XC 1UGJA 2GBRA 5DPTA 1OQYA 4ZYNA 4OW0A 1VD2A 1WMHA 2J7QB 1N6ZA 1PDXA 4TUUA 2NBUA 3PREA 3DQVA 3P4QB 4KSLC 3EUB2 2KZRA 3AXCA 1I4HA 2BS2B 1U4AA 4YTNB 4B9KA 2BB5A 3GB1A 3TEWA 2SAKA 3V61A 1E9MA 4FADA 3H7SA 4F7ZA 2FCSA 2KMAA 1DGJA 4ANXA 1L6UA 2G4DB 4ZOHC 1TKGA 2INDC 4QAYA 3A33B 3ZJVA 1KF6B 3RZWC 4HCNB 2FIFA 3AEFB 4IWOA 4MJSA 4J6IA 3VR9B 4PT5A 1TKYA 3ZLZA 3HHMA 4M00A 4AOFA 2EELA 4JWUC 1NI2A 4OVUA 1OGWA 4LJPB 2M1MA 3N9YC 3N20C 1T0SC 2M19A 2OHFA 3ZTDA 2HTHA 1QQRA 3ZNZB 2Z59B 3Q14C 4KKJA 4II3B 3LB8C 4N59A 2MBBB 1UWMA 3N30A 1L7YA 1XCQL 4S17A 4PK1A 1ZGUB 4C4VA 2WHIA 2DYOA 2WYQA 1MHXA 1L2NA 4TSSA 2XK5A 4RNAA 3T8MA 3KWLA 1HQRD 4M02A 2JQRB 4FJZA 4WJPA 2L0TA 3KVFB 4PS8A 1N60A 3CWIA 3VUXA 1IPGA 1VCBA 3PRZA 2I1JA 2CS4A 1D4BA 2OOBB 1DOIA 2RPQA 1RFKA 3SFDB 3W9CB 2L7RA 3P42A 3PO0A 3HVDA 5IKCM 2KDBA 1HTQA 1JWAD 2Y5CA 4GLSC 3RI7C 3NY5A 2RR9A 5JXVA 2M17A 1FD6A 2LGSA 3VDZA 5LLIA 4R3DA 2O2VB 2ICIA 4NJCA 3EGRA 3Q2AC 1FPYA 2KDFB 2XBBC 5KHQA 1T0YA 4ZRPA 2KTRA 3B2GA 3DVGY 1G6JA 3KQ4A 2JU6X 2H89B 2KX3A 3O65B 4EUTA 3EA6A 4MH8A 1SE9A 1WE7A 4M8MA 3A9KB 2K1FA 4A90A 4NNJB 2IDYA 1YX5B 4XDCA 3ZJUA 2JXXA 2KWDA 1TT5B 1UELA 1UD7A 2REXA 1GPXA 1SGHA 3Q3OC 1WRDB 2RDGA 4EFOA 2IO2B 2K25A 3MP9A 1R4MI 3GE3C 3KYDD 4P1BC 3B2FA 3C19A 1V1PA 2IO0B 3SHQA 4E74A 3P4SB 5DPWA 3SR6A 4EEWA 3KLSX 1D6EC 1V81A 1ZPSA 3AE4B 4LJOB 3NVYA 3WAMA 1FCLA 5G2NA 1XLNA 4YTPB 1WXAA 2J53A 2WXGA 4MM3A 3BK2A 3GZNB 3SFEB 3IAS1 3QAQA 3NZ3A 1YOVB 3V60A 2KFKB 3L0WB 4RCOA 4C56C 1N5XA 1XXGA 2J0MA 1QZEA 2JXTA 2VRRB 5J2RA 4I6LB 4KVGB 3CMMB 2K39A 1ET6A 4MJSB 3AE1B 4M0WA 1A70A 2LUMA 1XF5L 2PMVA 3P4PB 4JIOU 4KKIA 4A55A 2WXLA 2WU2B 4JX1C 2CU1A 2JX5A 2D11A 3DWGC 5E6OA 2TSSA 2RGFA 3A1QA 2GRIA 1IBXB 1YJ1A 1LO5D 2BWES 1QILA 1XLOA 4W9JA 3FC4A 1V5OA 4YSXB 2N9XA 3V6CB 1F2RC 4DQOC 1WGDA 3Q8CA 3MTNB 4NJ7A 4IC7B 1QOBA 3Q3JA 1KLVA 4ANUA 2DENB 4A3PA 3FILA 1YX6B 2KAJA 4XX5A 3X23A 3UQAA 1J7CA 1YQBA 3ALBA 4MGYE 2OEDA 3NZUA 5TSSA 3QHTA 3CIRB 3MJWA 5EE0A 3BIID 3ZW3A 1C4CA 4DHJB 5HI1A 3R2TA 2WX0A 2ZW1A 3ZUNA 1HE8A 3DVNU 5C3JB 4IWQA 1TKEA 2NR2A 4GDKA 5JZEB 5CHVC 1SXTA 2MCNB 4BVUC 1EM7A 1EUVB 3DHHC 3TSSA 1MVKA 1RYJA 2Z8LA 4W9LA 1FXTB 2NBWB 4MH0E 4JQWC 3H8HA 2FIDA 4HKZE 2GMIC 3IT4B 3H1UA 1WIAA 4L1BA 2FBWB 1EF1A 3KWVA 4W9FA 1SJHD 1WY8A 3H7PB 1TZ1A 1TBEA 3Q6BA 2DYBA 1WX9A 1TZOA 2KWVB 4B95A 4A6QA 3DCGA 4RGMA 3N3KB 4US9A 4HJGE 4K3BA 1J7BA 1RAXA 3WIMA 4ANWA 1MI0A 2O6VD 4C7YA 2MSED 5D2MB 3K9OB 1JWUD 5C1ZA 2N9LA 3BYTB 3CF6E 3KYCD 1EO6A 2WLBA 3T9LA 4OHJA 2JVCA 3S2AA 5BO4B 1XT9B 4EOYA 5DCNA 2K6DB 4XGAB 1SIJA 3TEYA 2NMQA 2B3AA 5CTRC 4W9IA 2WDTB 3W2DA 1LQBA 4NAWB 3DBRI 1I35A 3Q3NC 2K8HA 3RYTA 2Q5WD 3JW0X 1K51A 4LNNA 2N7JA 4K7SA 4AS1A 2MBQA 1GB4A 1WJ4A 1C78A 1WFYA 2I2YA 2QDFA 1WSPA 1QT9A 1IYFA 4WWOA 4D2KA 1ZE3D 1UBIA 2XEWA 1PFDA 3IXSA 4OVZA 4NAWA 2LI5A 3UF8A 1Q5WB 3URYA 1SBBB 3NOBA 5BYQA 5E6PA 1VJKA 2ZNVC 1WJ6A 2INNE 1BT0A 4G11A 3IHPC 3UQBA 2K8BA 4KGTA 1N62A 2ASQA 5E6NA 4IWPA 3NVVA 2JZZA 2LRWA 5CHWA 4BFRA 2QILA 1KOTA 3AI5A 1WYWB 4EE2A 2BW2A 5IA7A 4XZ4A 2IY0B 4MGKE 3AN1A 3BZDB 2W82A 1NBFC 3BINA 4DK5A 4BKSD 4JE3B 1JRUA 2BS4B 5D3IB 2AL3A 1V6EA 3D32A 4LK0M 4NQLB 4BKGA 2GOWA 2JRIB 2QCZA 1UGMA 2MBEA 4IM2A 5FKAC 3ZNID 4DDID 1UBQA 3I9V1 5BYSA 2KFKA 1E5WA 1QF6A 1QOGA 2UYZB 4KZCA 2J42A 2G9HD 2KVZA 4FXCA 5IP4D 3ZTCA 4K3CA 4LDTD 1HXYD 2ZW0A 2FAZA 3HK0A 1WXMA 1GB1A 2J0KA 4PS7A 2BS3B 4JPSA 2QEJC 1PYWD 4JWSC 4NQKE 1NDDA 1WM2A 4GDLB 1ZKHA 4URKA 1F0ZA 2EMTA 4KDLB 4NZLB 4KGSA 2QC8A 4WWMA 1TS3A 3BYYB 4ICUA 4PYUA 1FM0D 1JW9D 4RFBA 1V97A 1EWYC 2CJOA 1YJJA 3NRZA 3AEEB 4TKNA 2KC2A 2R2OA 4HXDA 4XDDA 1L5PA 1L0VB 4ZRJA 1UNSA 3LJ3A 1UF0A 5E6JA 3AULA 3GP7A 2WXJA 3WAOA 3UGBB 5C2TB 2L52A 2LD9A 2PTLA 3EC8A 2Y3AA 1WWTA 3NVZA 3PTFC 2LXCA 2HE7A 4RM9A 1WGRA 3A4RA 2ZVOA 1YN5A 3NG0A 3B9JA 2GB1A 3V6EB 3H9DA 2BYEA 1TS5A 4NAMA 3WALA 4WAFA 3VRBB 2K0PA 3N1ZC 4HROA 3KH0A 2MBHA 2O6VA 2GI9A 2FCQA 2LHDA 1OQQA 2JY6A 1BUIC 3QWZB 1Z2MA 4UDUC 1LM8B 1N61A 4RGOS 1P3QU 4FBJB 1C77A 2WXNA 1H4RA 3VH4B 3MHZA 3PLVA 3AB5A 4USAA 2ZEQA 4LNKA 2KANA 2FCNA 4YL8A 1KH0A 1V80A 2A5UA 3U4EG 3ZXRA 1PQSA 1Y8RC 2MW5A 2QJLA 2JYEA 3JSVB 3RNBC 2K5PA 2ZPYA 3VVWB 2ON8A 1TY0A 2CHXA 2LFIA 3UIPB 4IM0A 5EE1A 3ZO5B 1MHHE 2O6VB 2KDIA 2KHWB 3ZKJC 2Y5PA 3RT3B 5AZHA 2KDMA 4F8CB 3KUCB 2W55A 3AE8B 3AE9B 2JWZA 2ZVNA 4LNIA 1WXSA 2WP9B 2GBJA 2LRUA 2JZ3B 2CKHB 3APCA 3ETRA 4RGTA 3AE3B 2GLSA 2WXFA 3KUDB 2R2QA 1J7AA 3ZDMC 3DBLB 4DXFA 2EKIA 3AM9A
chains in the Genus database with same CATH topology
1GAQB 1V8CA 1N5WA 3MC0B 1FO4A 3T3NA 1IBXB 1I4GA 1LO5D 1JMLA 1FIQA 1QILA 1SE4A 1XLOA 2MJEA 2WXOA 3FC4A 4YT0B 1YNTE 1ZXIA 2VZKB 4YSXB 1I4XA 1WXQA 2WDRB 1NYQA 1F2RC 1STEA 1ZXHA 2KQ4X 4RF0A 5T8IA 4DQOC 4WURA 4O1NA 3Q8CA 4N6EB 1Y56A 1OQRA 3TUOA 1QKZA 2FUG1 1QOBA 1YJIA 2AQ2B 2WXQA 2JYTA 2LHEA 3FILA 2N0SB 2KAJA 3LYYA 1FCCC 4L23A 1VRAB 1T6BX 1J7CA 1C9FA 4WH4A 3P1MA 2KN4A 3IAM1 1PUTA 4WQMA 4KX6B 2OEDA 3Q8AA 5HG2A 1SEBD 1FNWA 1K53A 3AE6B 1KLGD 5TSSA 3CIRB 5EE0A 3BIID 3WCQA 1TY2A 1XO3A 1C4CA 3OWEB 2YEPF 4LLGM 5HI1A 3R2TA 2ZW1A 4C7ZA 2QSDA 1VLBA 3FAHA 1HA5A 5C3JB 1V1PB 2PIAA 1DOXA 4YXDB 1TKEA 4N58A 3C8YA 1P7FA 2BB6A 1UWXA 2XNAC 2LGIA 1E6EB 1SXTA 1YQ3B 1F77A 3W5UB 1FRRA 1K52A 1VZ8A 1F2RI 3P63A 1EM7A 1JWMD 5D3DA 2K3UA 2MEKA 4ZHPA 1KRHA 3TSSA 1MVKA 1VZ7A 2L32A 1RYJA 2Z8LA 1PGAA 1C4AA 4DXGA 1TJEA 1CQVA 2E3TA 2QIEB 2DWQA 2WS3B 4OZBA 2M0AA 3AE5B 3H8HA 5BYRA 3U2SC 1FXAA 2FE8A 2R61A 2BT6A 4HKZE 5G5GA 1WGKA 3IT4B 3AECB 4MM3B 1E7PB 2JSVX 4L1BA 3HRDD 5MPOA 5HFYA 2FBWB 5BMIA 1P7EA 3BVGA 3KWVA 1L0XB 2PLPA 1SJHD 4CQNA 4C80A 3O13A 3AH7A 1IBXA 1TZOA 1TYGB 1RWSA 4LTUA 4P16A 4A6QA 4RGMA 2WDVB 2WXHA 3P4RB 2WXMA 4US9A 2NTSA 4HJGE 1J7BA 1QOAA 1C4PA 2VZKD 3GS2A 1QLBB 1MI0A 3VR8B 4C7YA 1XCTL 1JWUD 2RPVA 2IGDA 2N9LA 1FNUA 2KACA 4GDKB 4XWTA 4AQ7A 1TS4A 1BMLC 1CK1A 2K9XA 3BVZA 1E10A 1EU4A 4RH6A 1AW7A 2V3NA 1IGCA 3BYTB 2AQ3B 1JQ4A 3AV8A 3BK1A 3Q8FA 2WNMA 2WLBA 2PW9A 4OHJA 5D7GA 3T3OA 4IKGA 1ZOYB 2CU3A 4YSYB 3Q8BA 3TEZA 1FXIA 4XWWA 1I4PA 2H88B 2AQ1B 2K22A 3RFZB 1B1ZA 2J52A 4TQ1A 3ZYYX 2XN9C 1SIJA 3TEYA 2WQYB 1IGDA 2NMQA 1I4QA 3W2DA 4NAWB 2QMTA 4YSZB 3AEAB 1IUEA 1XLPA 2ACZB 2RDHA 2Q5WD 1K51A 2N7JA 2WU5B 3V3XA 4AS1A 1NYRA 1CJEA 1GB4A 1MPEA 5HHDG 3HVZA 2HTME 1C78A 2I2YA 1WSPA 1QT9A 1D5XC 3W1SA 1D5MC 1UGJA 4ZHOA 3BWUD 5BMHA 1ZDXA 1L6VA 4D2KA 1ZE3D 4OW0A 1XLQA 4H2AA 3ABVB 3IXSA 1PFDA 3L4PA 4OVZA 4L2YA 1E0ZA 1ROEA 1PDXA 1B9RA 3URYA 3VQIA 1SBBB 5BYQA 1PGXA 1VJKA 1C79A 3P4QB 2SEBD 2INNE 3EUB2 2W3RA 1I4HA 2BS2B 4TMAB 4A9AA 3MJ5A 4YTNB 2X38A 3Q8EA 2BB5A 3GB1A 3TEWA 3I57A 2D5GA 4KGTA 4ZYSA 3NUHB 1N62A 2B76B 4ARIA 3NVVA 2SAKA 4YTMB 1L4ZB 1Q10A 1E9MA 2PKOA 1NENB 2KMMA 1DGJA 2QILA 1PGBA 5G5HA 1L6UA 4EE2A 2BW2A 3LXFA 3NVWA 4ZOHC 1I4RA 1I7HA 3AN1A 3BZDB 1SE3A 1TKGA 2W82A 1VDVA 2V0GA 4REZA 1KFYB 1SJED 4JE3B 2BS4B 5D3IB 2LJIA 5LNK1 3ZJVA 1KF6B 3RPFC 3UI3A 2V4IB 4P6VF 3AEFB 5FR3A 3VR9B 4PT5A 4LK0M 2PVGC 1TKYA 2EELA 4JWUC 4ARCA 5FKAC 1FFVA 1VR9A 1JROA 3I9V1 5BYSA 2PVOD 1BXTA 1QF6A 1QOGA 4KGRA 1NI3A 3AE7B 3N9YC 3SEBA 2IGHA 2L83A 1T3QA 3MFGA 2J4XA 1GOZA 2BBCA 2W54A 1ENFA 4MT5A 2M19A 2OHFA 2J42A 2G9HD 3BVMA 4FXCA 2DBYA 1OFFA 3AEBB 1QQRA 3FILB 1HXYD 2ZW0A 4XE0A 1JWBD 2MH7A 4KKJA 1WYGA 5I4DA 3AEGB 3LB8C 4N59A 1N63A 3W5VB 1UUPA 1WRIA 1GB1A 1SSNA 1UWMA 1XCQL 1ZUD2 1CZPA 2DLBA 2MJDA 2M56B 4IDIA 2ONQA 2BS3B 4JPSA 2QEJC 4US8A 1SF0A 1PYWD 1L4DB 2DYOA 4JWSC 4OZAA 4OZCA 1MHXA 1L0YB 4Q2JA 3ZQ4A 4TSSA 3U52E 4RNAA 4GDLB 3KWLA 4HRSA 4IOIE 4J3OD 4HKQA 1YN3A 1F0ZA 1HQRD 5BMGA 1SB3C 4NZLB 1V1OA 4KGSA 1AYFA 2WDQB 1YN4A 2JQRB 5AUIA 2E6XA 4RGNA 4WWMA 1TS3A 4RF1A 3BYYB 2DYMA 4ZRQA 1N60A 3CWIA 1FM0D 1JW9D 1R7SA 4RFBA 1V97A 1EWYC 1JWSD 3R8BA 1ZP0B 2N9KA 1D4BA 1TS2A 1NEKB 1DOIA 1EU3A 1RFKA 3SFDB 3W9CB 3PO0A 3P42A 2CJOA 1YJJA 3NRZA 3AEEB 1DYQA 1YMHE 3HVDA 1D5ZC 4XDDA 1L5PA 3DWMA 1VZ6A 1L0VB 1JWAD 2IJ0A 2Y5CA 4GLSC 1UNSA 5E6JA 3V05A 3GP7A 5JXVA 1AN8A 2WXJA 5EE3A 1FD6A 5C2TB 2L52A 1JRPA 3J9CA 1KLUD 2PTLA 4R3DA 1JALA 2YEPB 3AMZA 2MJ3A 1FMAD 2ICIA 4NJCA 3EGRA 1XEEA 2Y3AA 3NS1A 1WWTA 5EE9A 3NVZA 4HEA1 4ZRPA 4B0EA 3B2GA 1ZDVA 1HEZE 3KQ4A 1YN5A 2JU6X 2H89B 2NTTA 4B0MA 3B9JA 2GB1A 3EA6A 4MH8A 1M4VA 2V3PA 3IT6B 1TS5A 4A90A 4NAMA 2IDYA 4WAFA 3AEDB 1RM6C 3VRBB 4XDCA 2K0PA 5H92C 2WXKA 3ZJUA 2W3SA 3PZ7A 4HROA 3ZGZA 2KWDA 2IPKD 5FK9C 2G1EA 2HDEA 2JZPA 2GI9A 4MACA 2LHDA 1K50A 1OQQA 3AE2B 4YWGG 1FFUA 5H8YE 1AWDA 1FRDA 1GPXA 1BUIC 2RDGA 3E56A 4UDUC 2BYTA 1N61A 4RGOS 2WXRA 3MP9A 2RMMA 1C77A 2WXNA 1EWCA 3B2FA 1YQ4B 1V1PA 2CJNA 1NVID 2L1AA 4A8XC 5GXGB 2WXPA 3MHZA 2I38A 2LMCA 3AB5A 3P4SB 4USAA 3Q69A 3SR6A 2IGGA 3KLSX 3TEXA 1JCKB 3VRAB 2AX5A 1D6EC 1KH0A 1ZPSA 1SE2A 1ET9A 3AE4B 3U4EG 3HUIA 3PZ8A 3NVYA 2INPE 2QJLA 1FCLA 2JYEA 2LEKA 1XLNA 4YTPB 2K5PA 2J53A 2ON8A 1TY0A 2WXGA 2LFIA 2WXIA 4ITKA 4WIPA 5EE1A 3ZJTA 1MHHE 3BK2A 3U7ZA 3SFEB 3IAS1 2Y5PA 3NZ3A 2KDMA 1DOYA 2W55A 3AE8B 3AE9B 4RCOA 4C56C 1N5XA 1XXGA 2WP9B 1KTKA 1HZ6A 2JXTA 5AUKA 1C76A 1FNVA 3R2IA 3ETRA 4TQ0A 2BTEA 1ET6A 4RGTA 3AE1B 4M0WA 1A70A 1T5XD 2LUMA 3AE3B 1XF5L 2PMVA 3P4PB 1QOFA 4KKIA 4A55A 2WXLA 2WU2B 4JX1C 2WXFA 1HZ5A 1ACCA 2JWUA 2JX5A 1J7AA 4DXFA 1FEHA 3DWGC 3E9SA 2EKIA 3AM9A 2TSSA 1ESFA 2GRIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KAC A;  1IBX B;  2EEL A;  1JML A;  1HEZ E;  2JU6 X;  1IGC A;  1YNT E;  2GB1 A;  1F2R C;  1ZXH A;  2KQ4 X;  2PW9 A;  4IKG A;  4KGR A;  2K0P A;  2IGH A;  1QKZ A;  2KWD A;  2JZP A;  2GI9 A;  4MAC A;  2LHD A;  1K50 A;  2J52 A;  2LHE A;  3FIL A;  1IGD A;  1FCC C;  2NMQ A;  3FIL B;  2ZW0 A;  1C9F A;  2QMT A;  4WH4 A;  3MP9 A;  2RMM A;  2KN4 A;  1K51 A;  2OED A;  1GB1 A;  2N7J A;  3V3X A;  5HG2 A;  1XCQ L;  1K53 A;  1GB4 A;  1MPE A;  5HHD G;  2I2Y A;  2I38 A;  2ONQ A;  5HI1 A;  2ZW1 A;  2IGG A;  2QSD A;  4OZA A;  4OZC A;  1KH0 A;  5BMH A;  1MHX A;  4D2K A;  1P7F A;  1UWX A;  4IOI E;  2LGI A;  5BMG A;  1FCL A;  1K52 A;  4KGS A;  1F2R I;  1EM7 A;  2J53 A;  2ON8 A;  1PGX A;  1MVK A;  1MHH E;  1PGA A;  1D4B A;  2N9K A;  3GB1 A;  4KGT A;  2KDM A;  4OZB A;  4HKZ E;  1Q10 A;  2JSV X;  1YMH E;  5HFY A;  5BMI A;  1P7E A;  1PGB A;  2PLP A;  1HZ6 A;  1IBX A;  2JXT A;  4GLS C;  5JXV A;  2LUM A;  1XF5 L;  1FD6 A;  4HJG E;  2PTL A;  1HZ5 A;  2JWU A;  3UI3 A;  1MI0 A;  1XCT L;  2RPV A;  2IGD A;  2N9L A; 
#chains in the Genus database with same CATH topology
 3H7P A;  3MC0 B;  3T3N A;  4MDK E;  1I4G A;  4FLH A;  2VZK B;  1C1Y B;  1I4X A;  2RD0 A;  1NYQ A;  1STE A;  2KQ4 X;  5T8I A;  2C5L C;  1AAR A;  3L17 A;  2BVC A;  3P2B A;  1J8C A;  2WXQ A;  2JUO A;  2V4L A;  2N0S B;  4DHZ B;  3W1S C;  2N7E A;  1VRA B;  3TJP A;  1C9F A;  4K81 A;  3IAM 1;  1PUT A;  3ZRF A;  4KX6 B;  2KOX A;  1WGY A;  1SIF A;  1J19 A;  1FNW A;  1HTO A;  1KLG D;  3MHS D;  4HWI B;  1OEY J;  4KIK A;  2M0X A;  1TY2 A;  1XO3 A;  2HD5 B;  2KQ7 A;  3WCQ A;  2C60 A;  3A9K A;  5CX3 A;  3SU8 X;  1F52 A;  1MG4 A;  4C7Z A;  4M0W B;  1VLB A;  1F9J A;  2PIA A;  2FNJ B;  2K6Q A;  2LWP A;  3N32 A;  1UWX A;  1ZW7 A;  2XNA C;  3ML8 A;  1YQ3 B;  3VUW A;  4BBN F;  1F77 A;  1F2R I;  3ZVV A;  2BQQ A;  3EHV A;  3RUL A;  5J18 A;  2MEK A;  4ZHP A;  4F1S A;  2L32 A;  1C4A A;  2QIE B;  5IOI A;  3QAR A;  2M0A A;  3IBE A;  4OZB A;  3U2S C;  5G5G A;  1WGK A;  4RMA A;  5MPO A;  5HFY A;  1P7E A;  1L0X B;  2PLP A;  3HIZ A;  4C80 A;  2XK5 B;  2DAF A;  2IYD B;  3I3T B;  2WDV B;  2WXM A;  4M8N A;  4C4V B;  1P9D U;  1C4P A;  2VZK D;  3GS2 A;  1QLB B;  2G4S A;  2RPV A;  2QHO A;  5LXH A;  1E8Y A;  2KAC A;  4XWT A;  3ENE A;  2K9X A;  2MP2 A;  4NPN A;  2V3N A;  2AQ3 B;  3BK1 A;  2PW9 A;  4G0N B;  3T3O A;  3W1Y A;  2GBN A;  4HDO A;  1ZOY B;  3ZXV A;  4YSY B;  3Q8B A;  2N9P C;  4XWW A;  1I4P A;  2GBM A;  2AQ1 B;  4CO7 A;  1XD3 B;  2KQS A;  2J52 A;  4TQ1 A;  2XN9 C;  1IP9 A;  1WGH A;  1IGD A;  3M63 B;  4CHK A;  4E3C A;  2X8X X;  2MP2 B;  2QMT A;  3AEA B;  5FR6 A;  1IUE A;  2ACZ B;  3MC9 A;  4WWP A;  3A1Q B;  2WU5 B;  3JVZ X;  1CJE A;  2CHW A;  4MGZ E;  3HVZ A;  2CR5 A;  3W1S A;  1D5M C;  3ZIM A;  5G55 A;  1GJZ A;  3BWU D;  1T0Q C;  1ZDX A;  1L6V A;  1XLQ A;  4H2A A;  4OVV A;  3GE8 C;  3L4P A;  3B1L X;  4DHZ E;  4L2Y A;  1E0Z A;  1ROE A;  4BAX A;  3DPD A;  1LGR A;  2K8C A;  4M01 A;  3HM6 X;  2BYF A;  3NHE B;  1C79 A;  2KJ6 A;  2UU7 A;  2SEB D;  4EZJ A;  3BY4 B;  2W3R A;  2BF8 B;  3MJ5 A;  2X38 A;  3I57 A;  2D5G A;  2B76 B;  2LXA A;  4ARI A;  4YTM B;  2KWC A;  3PT2 B;  1KJT A;  1UH6 A;  1NEN B;  4WJO A;  2KK8 A;  2Z0E B;  3B0A A;  3LXF A;  3NVW A;  4IG7 B;  4II2 B;  5IAA C;  1I7H A;  2M4N A;  1VDV A;  2J0J A;  4REZ A;  1KFY B;  3QIJ A;  1SJE D;  2KC1 A;  2KFJ A;  3EFU A;  2DZM A;  2LJI A;  5LNK 1;  2N1V A;  2V4I B;  5FR3 A;  3JSV A;  3TBL D;  2NS5 A;  2NBV B;  2PVG C;  4GB9 A;  2IY1 B;  2N9E B;  1FFV A;  1JRO A;  2KX0 A;  1WJU A;  2BKR B;  1BXT A;  2WX1 A;  3GOE A;  2LGX A;  3DOW A;  3VH3 B;  3SEB A;  4BKT A;  3L10 B;  1T3Q A;  3MFG A;  2J4X A;  4MT5 A;  1ENF A;  1GC7 A;  3ECI A;  2A4Z A;  3BVM A;  2DBY A;  3FIL B;  1TGZ B;  4MGI E;  4KDI C;  2MH7 A;  4WJN A;  4XC2 A;  1WYG A;  3AEG B;  1N63 A;  1WRI A;  2BKF A;  1SSN A;  1V49 A;  1ZUD 2;  1CZP A;  2DLB A;  2KO3 A;  2MJD A;  2M56 B;  2LJ5 A;  3SDL C;  4IDI A;  2ONQ A;  2ZNV B;  1X1M A;  4US8 A;  1SF0 A;  5KHO A;  1WJN A;  1L0Y B;  1WR6 E;  3C0R B;  3U52 E;  3ZQ4 A;  4FHK A;  2IO3 B;  4HRS A;  4IOI E;  1YN3 A;  5BMG A;  4G50 A;  1SB3 C;  3N1X C;  2KWU B;  1V1O A;  2AL6 A;  2WDQ B;  2KT7 A;  2Z0D B;  2E6X A;  4RGN A;  4LNO A;  4ZDV A;  3QCA A;  2DZJ A;  4MEM A;  4ZRQ A;  2D3B A;  2KTF A;  4W9C A;  2NPT B;  3R8B A;  4HLE A;  2NPT A;  3OJ3 A;  1YD8 U;  5JHB A;  1TTN A;  1D5Z C;  3U8Z A;  3V05 A;  3PS6 A;  3LDZ E;  4I6P A;  2V3S A;  5EE3 A;  4HJK A;  1JRP A;  2L05 A;  4W9K A;  3J9C A;  1Q0W B;  2ZCB A;  3AMZ A;  1OEY A;  3DBH B;  1FMA D;  1XEE A;  4W9D A;  5EE9 A;  4HEA 1;  1WMH B;  4ZRK A;  4B0E A;  3APF A;  1ZDV A;  5D6J B;  4P7I A;  2NCN A;  1E8W A;  1HEZ E;  3N1Y C;  4B0M A;  4AJY B;  4AP4 C;  2DHZ A;  1RLF A;  2V3P A;  2EKE C;  3IT6 B;  4PS3 A;  4B6W A;  2IBI B;  3AED B;  1RM6 C;  1XQQ A;  2WXK A;  2IPK D;  2G1E A;  1T0R C;  2INC C;  1FFU A;  3B08 A;  5CHF A;  4IW0 A;  4XYC A;  1I42 A;  4DXA B;  2BYT A;  2MWS B;  2RMM A;  1YQ4 B;  2PEA A;  4DDG D;  1MFW A;  5AZG A;  2L1A A;  1NVI D;  1ISN A;  4N9F 4;  2LUE A;  3QJZ A;  3M62 B;  2LMC A;  3Q69 A;  2D3G A;  2IGG A;  2OJR A;  2DAJ A;  2G3Q B;  2C7N B;  1ET9 A;  3PZ8 A;  2INP E;  1Q1O A;  2LEK A;  1WM3 A;  1Z5S B;  4EZL A;  4LDT B;  3ZJT A;  2N1W A;  3L08 A;  2HJ1 A;  1R4M B;  3L13 A;  4KZ0 A;  1R4N I;  4WQO B;  3TIX A;  1KTK A;  2VH1 A;  3A9J B;  4GN1 A;  5AUK A;  1C76 A;  3R2I A;  2BTE A;  4FJY A;  1T5X D;  4HPP A;  3NS8 A;  2MLB A;  1P0R A;  3L54 A;  1HZ5 A;  1ACC A;  1FEH A;  4AUQ C;  3PSE B;  1GAQ B;  2V9H A;  1N5W A;  1FO4 A;  4W9E A;  2DZK A;  1FIQ A;  2WXO A;  3QK0 A;  2D2Q A;  3ONS A;  1WXQ A;  3VFK A;  1MJD A;  2LGY A;  3OLM D;  3DVN V;  4JL9 A;  2KKC A;  2D10 A;  3QC8 B;  2OJW A;  1P1A A;  3FKY A;  2WWZ A;  2LHE A;  1FCC C;  3KW5 B;  1WZ0 A;  4GOC A;  4WH4 A;  2D07 B;  4WAA A;  1M94 A;  1K8R B;  3PV1 A;  3Q8A A;  2RSU A;  5LXI B;  5HG2 A;  4G3X B;  1K53 A;  3AE6 B;  2YEP F;  1GG3 A;  2QSD A;  3FAH A;  4YXD B;  3C8Y A;  3Q3F A;  2BB6 A;  2FCM A;  5TR5 A;  1KM7 A;  1GNU A;  3W5U B;  2MX2 A;  1VZ8 A;  3DDC B;  1JWM D;  4HPM B;  4HVB A;  3UIO B;  1V2Y A;  1TJE A;  1CQV A;  2E3T A;  5L83 A;  3AE5 B;  5BYR A;  2R61 A;  2BT6 A;  2BYV E;  2KJR A;  3AEC B;  1E7P B;  5GMV A;  2JSV X;  2HJ8 A;  3R7R A;  4ZRI A;  3RMK C;  2G45 B;  3AH7 A;  1IBX A;  1TYG B;  1RWS A;  4LTU A;  5DPR A;  2NTS A;  2L76 A;  4IUM B;  1QOA A;  2IZV B;  2RDB C;  3VXW A;  4AQ7 A;  4GDK B;  4DBG A;  1TS4 A;  1CK1 A;  3DVG X;  3BVZ A;  4RH6 A;  1CMX B;  1AW7 A;  1IGC A;  2WNM A;  4K7W A;  3H6N A;  4IKG A;  1FXI A;  1V9J A;  3IFW B;  2VH2 A;  4NY0 A;  3RN9 C;  2H88 B;  3NJT A;  3MC8 A;  3RFZ B;  4BZA A;  1B1Z A;  2WQY B;  4FHJ A;  3SD5 A;  1I4Q A;  1WX7 A;  3X0W A;  3ZRC A;  3R3M A;  5IO9 A;  4K7U A;  4S0R A;  4YSZ B;  1XLP A;  2RDH A;  2L8J A;  3V3X A;  1WE6 A;  1NYR A;  3VTV A;  1MPE A;  5HHD G;  2HTM E;  4WWN A;  4KIK B;  4HCP B;  4ZHO A;  3U30 A;  5L95 C;  5BMH A;  3QX1 A;  3ABV B;  1WX8 A;  1WF9 A;  4AWJ A;  1B9R A;  3VQI A;  2CHZ A;  4E71 A;  1PGX A;  1E8Z A;  4W9G A;  3PHW B;  2MBO A;  4TMA B;  4A9A A;  3Q8E A;  3PZD A;  5J17 A;  2C7M B;  5JH5 C;  3EEC A;  4ZYS A;  3NUH B;  3A9J A;  3EFC A;  1L4Z B;  3R66 C;  1Q10 A;  2PKO A;  3TL5 A;  2KMM A;  1PGB A;  5EDS A;  1F1H A;  5G5H A;  4GIV A;  2DNF A;  4X57 B;  1E7U A;  1I4R A;  4GDL A;  5HKH A;  1SE3 A;  3VUY A;  2V0G A;  4I6N B;  1A5R A;  4TV3 A;  3PPA A;  2KVR A;  3RPF C;  3UI3 A;  1WR1 A;  2UWQ A;  2KDE B;  4P6V F;  3PLU A;  2JRH A;  2W9N A;  4P1C C;  3RNF C;  3TMP B;  3WA0 A;  2L0F A;  3DBR B;  4ARC A;  3QA8 A;  4ICV A;  3L16 A;  1VR9 A;  1C3T A;  2PVO D;  3CSF A;  1V5T A;  4KGR A;  1NI3 A;  3AE7 B;  2IGH A;  2L83 A;  4ACF A;  2MQJ A;  3PRP B;  3DHG C;  1GOZ A;  2BBC A;  2W54 A;  2JF5 A;  1OFF A;  1H8C A;  3AEB B;  3RNE C;  4XE0 A;  1R4N B;  1JWB D;  5I4D A;  3W5V B;  4JGH B;  1UUP A;  3IG3 A;  2YVC A;  3DBS A;  4HPL B;  4IM3 A;  3JYU A;  1L4D B;  4OZA A;  5C23 A;  4OZC A;  3PRM B;  1LFD A;  2LGD A;  4Q2J A;  4J3O D;  4HKQ A;  2M8S A;  3RNA C;  2D3C A;  1AYF A;  2YLM A;  4EKU A;  1YN4 A;  2KMC A;  2NVU I;  5AUI A;  4RF1 A;  2DYM A;  2Y5B B;  1R7S A;  1UZX B;  1JWS D;  1ZP0 B;  2N9K A;  1TS2 A;  1NEK B;  1EF5 A;  1EU3 A;  4HK2 A;  1GC6 A;  4C00 A;  2N7D A;  2AYO B;  3NZS A;  4A20 A;  1DYQ A;  1YMH E;  3DWM A;  1MG8 A;  1VZ6 A;  4RM8 A;  2BPS A;  2IJ0 A;  1AN8 A;  1TIF A;  1KLU D;  4KSK C;  2EMS A;  1JAL A;  2YEP B;  2MJ3 A;  3NS1 A;  4HDQ A;  2KN5 A;  3HM3 A;  4GGQ A;  3DBH I;  5IN7 A;  2NTT A;  2JPH A;  3RUI B;  1M4V A;  4DHJ D;  1YIW A;  4W9H A;  5H92 C;  2W3S A;  3PZ7 A;  2AEH A;  3ZGZ A;  5FK9 C;  2HDE A;  2JZP A;  4MAC A;  3AE2 B;  1K50 A;  4YWG G;  5H8Y E;  1D3Z A;  1AWD A;  3V62 A;  1FRD A;  3E56 A;  4GXB A;  5D94 A;  4GSW A;  3R7Q A;  3I63 C;  2WXR A;  4BKS A;  3WAN A;  2KLG A;  1EWC A;  2LZ6 A;  3U7D A;  3UIN B;  2ZJD A;  2AWT A;  2CJN A;  4KV2 A;  4A8X C;  5GXG B;  2WXP A;  3ZNG C;  2I38 A;  1OTR B;  3TEX A;  1JCK B;  3VRA B;  2AX5 A;  1P98 A;  3QQ8 B;  1SE2 A;  3HUI A;  2C9W B;  2L3Z A;  2WXI A;  4ITK A;  4LNF A;  4WIP A;  4EZK A;  2KD0 A;  2KYW A;  3U7Z A;  3I5J C;  2LVO A;  3M3J A;  1DOY A;  3K9P B;  1LXD A;  2V1Y A;  4GMV A;  4ASW C;  2BGF A;  3OJ4 B;  1HZ6 A;  2D3A A;  1FNV A;  4TQ0 A;  3PHX B;  2ZZP B;  2KXJ A;  3RNG C;  4MEL A;  1QOF A;  1RFA A;  4A3O A;  2JWU A;  3WAP A;  1S1Q B;  3E9S A;  1ESF A;  2PE6 B;  1V8C A;  1WZ3 A;  1E90 A;  2KJH B;  4BBN C;  1JML A;  2MJE A;  1SE4 A;  3OG5 A;  3RCZ A;  2O2V A;  1RRB A;  4YT0 B;  1YNT E;  1ZXI A;  2WDR B;  1ZXH A;  4RF0 A;  3APD A;  3OAW A;  4WUR A;  4O1N A;  4N6E B;  1Y56 A;  1OQR A;  3TUO A;  1QKZ A;  2FUG 1;  2DZI A;  1YJI A;  1E8X A;  5JHA A;  2AQ2 B;  2JYT A;  3RNC C;  2MA9 B;  3LYY A;  4MSM B;  1S3S G;  4L23 A;  2DX5 B;  1T6B X;  3P1M A;  4WJQ A;  2I1K A;  2KN4 A;  4WQM A;  2PJH A;  2FUH B;  1SEB D;  2BWF A;  1WGG A;  4FJV B;  3TCA A;  3VTW A;  2KLC A;  3OWE B;  4LLG M;  3AU5 A;  2LAS A;  1HA5 A;  1V1P B;  1DOX A;  4FA6 A;  4N58 A;  1P7F A;  3VAW A;  4AJW A;  2GBK A;  2LGI A;  4LCD E;  1E6E B;  1J0G A;  3VHT C;  1WXV A;  4PYZ A;  5AEK B;  2LVP A;  1FRR A;  1K52 A;  3P63 A;  2PPH A;  5D3D A;  2K3U A;  3CST A;  1KRH A;  1VZ7 A;  3PGE A;  1PGA A;  4DXG A;  2DWQ A;  2WS3 B;  3A4S C;  1V86 A;  1FXA A;  2FE8 A;  2LVQ A;  4MM3 B;  1WI0 A;  2L00 B;  3HRD D;  5BMI A;  3BVG A;  4CQN A;  4MSQ B;  3Q3M C;  3O13 A;  2KTR B;  3DBL I;  4BOZ B;  2ZCC A;  2JT4 B;  2C7H A;  4P16 A;  2WXH A;  3P4R B;  1WH3 A;  2IO1 B;  4DWF A;  3GZN I;  3KUZ A;  2MHJ A;  3AU4 A;  3VR8 B;  1XCT L;  4FN2 A;  4NJ6 A;  3RZF A;  2IGD A;  1FNU A;  1BML C;  3VTU A;  1E10 A;  1EU4 A;  2PE9 A;  1JQ4 A;  3AV8 A;  5AZF A;  3Q8F A;  4FUL A;  1E7V A;  1GUA B;  3DHI C;  3ZNH B;  3ML9 A;  5D7G A;  3RD2 A;  2CU3 A;  3TEZ A;  4ANV A;  5DPS A;  2K22 A;  4K1R B;  4BOS C;  3ZYY X;  2N4F A;  4GU2 A;  3ZDT A;  3IVF A;  2ZPN A;  4CYE A;  2MRP A;  3PVL A;  2KNB A;  4JLC A;  3M95 A;  2WGS A;  1D5X C;  1UGJ A;  2GBR A;  5DPT A;  1OQY A;  4ZYN A;  4OW0 A;  1VD2 A;  1WMH A;  2J7Q B;  1N6Z A;  1PDX A;  4TUU A;  2NBU A;  3PRE A;  3DQV A;  3P4Q B;  4KSL C;  3EUB 2;  2KZR A;  3AXC A;  1I4H A;  2BS2 B;  1U4A A;  4YTN B;  4B9K A;  2BB5 A;  3GB1 A;  3TEW A;  2SAK A;  3V61 A;  1E9M A;  4FAD A;  3H7S A;  4F7Z A;  2FCS A;  2KMA A;  1DGJ A;  4ANX A;  1L6U A;  2G4D B;  4ZOH C;  1TKG A;  2IND C;  4QAY A;  3A33 B;  3ZJV A;  1KF6 B;  3RZW C;  4HCN B;  2FIF A;  3AEF B;  4IWO A;  4MJS A;  4J6I A;  3VR9 B;  4PT5 A;  1TKY A;  3ZLZ A;  3HHM A;  4M00 A;  4AOF A;  2EEL A;  4JWU C;  1NI2 A;  4OVU A;  1OGW A;  4LJP B;  2M1M A;  3N9Y C;  3N20 C;  1T0S C;  2M19 A;  2OHF A;  3ZTD A;  2HTH A;  1QQR A;  3ZNZ B;  2Z59 B;  3Q14 C;  4KKJ A;  4II3 B;  3LB8 C;  4N59 A;  2MBB B;  1UWM A;  3N30 A;  1L7Y A;  1XCQ L;  4S17 A;  4PK1 A;  1ZGU B;  4C4V A;  2WHI A;  2DYO A;  2WYQ A;  1MHX A;  1L2N A;  4TSS A;  2XK5 A;  4RNA A;  3T8M A;  3KWL A;  1HQR D;  4M02 A;  2JQR B;  4FJZ A;  4WJP A;  2L0T A;  3KVF B;  4PS8 A;  1N60 A;  3CWI A;  3VUX A;  1IPG A;  1VCB A;  3PRZ A;  2I1J A;  2CS4 A;  1D4B A;  2OOB B;  1DOI A;  2RPQ A;  1RFK A;  3SFD B;  3W9C B;  2L7R A;  3P42 A;  3PO0 A;  3HVD A;  5IKC M;  2KDB A;  1HTQ A;  1JWA D;  2Y5C A;  4GLS C;  3RI7 C;  3NY5 A;  2RR9 A;  5JXV A;  2M17 A;  1FD6 A;  2LGS A;  3VDZ A;  5LLI A;  4R3D A;  2O2V B;  2ICI A;  4NJC A;  3EGR A;  3Q2A C;  1FPY A;  2KDF B;  2XBB C;  5KHQ A;  1T0Y A;  4ZRP A;  2KTR A;  3B2G A;  3DVG Y;  1G6J A;  3KQ4 A;  2JU6 X;  2H89 B;  2KX3 A;  3O65 B;  4EUT A;  3EA6 A;  4MH8 A;  1SE9 A;  1WE7 A;  4M8M A;  3A9K B;  2K1F A;  4A90 A;  4NNJ B;  2IDY A;  1YX5 B;  4XDC A;  3ZJU A;  2JXX A;  2KWD A;  1TT5 B;  1UEL A;  1UD7 A;  2REX A;  1GPX A;  1SGH A;  3Q3O C;  1WRD B;  2RDG A;  4EFO A;  2IO2 B;  2K25 A;  3MP9 A;  1R4M I;  3GE3 C;  3KYD D;  4P1B C;  3B2F A;  3C19 A;  1V1P A;  2IO0 B;  3SHQ A;  4E74 A;  3P4S B;  5DPW A;  3SR6 A;  4EEW A;  3KLS X;  1D6E C;  1V81 A;  1ZPS A;  3AE4 B;  4LJO B;  3NVY A;  3WAM A;  1FCL A;  5G2N A;  1XLN A;  4YTP B;  1WXA A;  2J53 A;  2WXG A;  4MM3 A;  3BK2 A;  3GZN B;  3SFE B;  3IAS 1;  3QAQ A;  3NZ3 A;  1YOV B;  3V60 A;  2KFK B;  3L0W B;  4RCO A;  4C56 C;  1N5X A;  1XXG A;  2J0M A;  1QZE A;  2JXT A;  2VRR B;  5J2R A;  4I6L B;  4KVG B;  3CMM B;  2K39 A;  1ET6 A;  4MJS B;  3AE1 B;  4M0W A;  1A70 A;  2LUM A;  1XF5 L;  2PMV A;  3P4P B;  4JIO U;  4KKI A;  4A55 A;  2WXL A;  2WU2 B;  4JX1 C;  2CU1 A;  2JX5 A;  2D11 A;  3DWG C;  5E6O A;  2TSS A;  2RGF A;  3A1Q A;  2GRI A;  1IBX B;  1YJ1 A;  1LO5 D;  2BWE S;  1QIL A;  1XLO A;  4W9J A;  3FC4 A;  1V5O A;  4YSX B;  2N9X A;  3V6C B;  1F2R C;  4DQO C;  1WGD A;  3Q8C A;  3MTN B;  4NJ7 A;  4IC7 B;  1QOB A;  3Q3J A;  1KLV A;  4ANU A;  2DEN B;  4A3P A;  3FIL A;  1YX6 B;  2KAJ A;  4XX5 A;  3X23 A;  3UQA A;  1J7C A;  1YQB A;  3ALB A;  4MGY E;  2OED A;  3NZU A;  5TSS A;  3QHT A;  3CIR B;  3MJW A;  5EE0 A;  3BII D;  3ZW3 A;  1C4C A;  4DHJ B;  5HI1 A;  3R2T A;  2WX0 A;  2ZW1 A;  3ZUN A;  1HE8 A;  3DVN U;  5C3J B;  4IWQ A;  1TKE A;  2NR2 A;  4GDK A;  5JZE B;  5CHV C;  1SXT A;  2MCN B;  4BVU C;  1EM7 A;  1EUV B;  3DHH C;  3TSS A;  1MVK A;  1RYJ A;  2Z8L A;  4W9L A;  1FXT B;  2NBW B;  4MH0 E;  4JQW C;  3H8H A;  2FID A;  4HKZ E;  2GMI C;  3IT4 B;  3H1U A;  1WIA A;  4L1B A;  2FBW B;  1EF1 A;  3KWV A;  4W9F A;  1SJH D;  1WY8 A;  3H7P B;  1TZ1 A;  1TBE A;  3Q6B A;  2DYB A;  1WX9 A;  1TZO A;  2KWV B;  4B95 A;  4A6Q A;  3DCG A;  4RGM A;  3N3K B;  4US9 A;  4HJG E;  4K3B A;  1J7B A;  1RAX A;  3WIM A;  4ANW A;  1MI0 A;  2O6V D;  4C7Y A;  2MSE D;  5D2M B;  3K9O B;  1JWU D;  5C1Z A;  2N9L A;  3BYT B;  3CF6 E;  3KYC D;  1EO6 A;  2WLB A;  3T9L A;  4OHJ A;  2JVC A;  3S2A A;  5BO4 B;  1XT9 B;  4EOY A;  5DCN A;  2K6D B;  4XGA B;  1SIJ A;  3TEY A;  2NMQ A;  2B3A A;  5CTR C;  4W9I A;  2WDT B;  3W2D A;  1LQB A;  4NAW B;  3DBR I;  1I35 A;  3Q3N C;  2K8H A;  3RYT A;  2Q5W D;  3JW0 X;  1K51 A;  4LNN A;  2N7J A;  4K7S A;  4AS1 A;  2MBQ A;  1GB4 A;  1WJ4 A;  1C78 A;  1WFY A;  2I2Y A;  2QDF A;  1WSP A;  1QT9 A;  1IYF A;  4WWO A;  4D2K A;  1ZE3 D;  1UBI A;  2XEW A;  1PFD A;  3IXS A;  4OVZ A;  4NAW A;  2LI5 A;  3UF8 A;  1Q5W B;  3URY A;  1SBB B;  3NOB A;  5BYQ A;  5E6P A;  1VJK A;  2ZNV C;  1WJ6 A;  2INN E;  1BT0 A;  4G11 A;  3IHP C;  3UQB A;  2K8B A;  4KGT A;  1N62 A;  2ASQ A;  5E6N A;  4IWP A;  3NVV A;  2JZZ A;  2LRW A;  5CHW A;  4BFR A;  2QIL A;  1KOT A;  3AI5 A;  1WYW B;  4EE2 A;  2BW2 A;  5IA7 A;  4XZ4 A;  2IY0 B;  4MGK E;  3AN1 A;  3BZD B;  2W82 A;  1NBF C;  3BIN A;  4DK5 A;  4BKS D;  4JE3 B;  1JRU A;  2BS4 B;  5D3I B;  2AL3 A;  1V6E A;  3D32 A;  4LK0 M;  4NQL B;  4BKG A;  2GOW A;  2JRI B;  2QCZ A;  1UGM A;  2MBE A;  4IM2 A;  5FKA C;  3ZNI D;  4DDI D;  1UBQ A;  3I9V 1;  5BYS A;  2KFK A;  1E5W A;  1QF6 A;  1QOG A;  2UYZ B;  4KZC A;  2J42 A;  2G9H D;  2KVZ A;  4FXC A;  5IP4 D;  3ZTC A;  4K3C A;  4LDT D;  1HXY D;  2ZW0 A;  2FAZ A;  3HK0 A;  1WXM A;  1GB1 A;  2J0K A;  4PS7 A;  2BS3 B;  4JPS A;  2QEJ C;  1PYW D;  4JWS C;  4NQK E;  1NDD A;  1WM2 A;  4GDL B;  1ZKH A;  4URK A;  1F0Z A;  2EMT A;  4KDL B;  4NZL B;  4KGS A;  2QC8 A;  4WWM A;  1TS3 A;  3BYY B;  4ICU A;  4PYU A;  1FM0 D;  1JW9 D;  4RFB A;  1V97 A;  1EWY C;  2CJO A;  1YJJ A;  3NRZ A;  3AEE B;  4TKN A;  2KC2 A;  2R2O A;  4HXD A;  4XDD A;  1L5P A;  1L0V B;  4ZRJ A;  1UNS A;  3LJ3 A;  1UF0 A;  5E6J A;  3AUL A;  3GP7 A;  2WXJ A;  3WAO A;  3UGB B;  5C2T B;  2L52 A;  2LD9 A;  2PTL A;  3EC8 A;  2Y3A A;  1WWT A;  3NVZ A;  3PTF C;  2LXC A;  2HE7 A;  4RM9 A;  1WGR A;  3A4R A;  2ZVO A;  1YN5 A;  3NG0 A;  3B9J A;  2GB1 A;  3V6E B;  3H9D A;  2BYE A;  1TS5 A;  4NAM A;  3WAL A;  4WAF A;  3VRB B;  2K0P A;  3N1Z C;  4HRO A;  3KH0 A;  2MBH A;  2O6V A;  2GI9 A;  2FCQ A;  2LHD A;  1OQQ A;  2JY6 A;  1BUI C;  3QWZ B;  1Z2M A;  4UDU C;  1LM8 B;  1N61 A;  4RGO S;  1P3Q U;  4FBJ B;  1C77 A;  2WXN A;  1H4R A;  3VH4 B;  3MHZ A;  3PLV A;  3AB5 A;  4USA A;  2ZEQ A;  4LNK A;  2KAN A;  2FCN A;  4YL8 A;  1KH0 A;  1V80 A;  2A5U A;  3U4E G;  3ZXR A;  1PQS A;  1Y8R C;  2MW5 A;  2QJL A;  2JYE A;  3JSV B;  3RNB C;  2K5P A;  2ZPY A;  3VVW B;  2ON8 A;  1TY0 A;  2CHX A;  2LFI A;  3UIP B;  4IM0 A;  5EE1 A;  3ZO5 B;  1MHH E;  2O6V B;  2KDI A;  2KHW B;  3ZKJ C;  2Y5P A;  3RT3 B;  5AZH A;  2KDM A;  4F8C B;  3KUC B;  2W55 A;  3AE8 B;  3AE9 B;  2JWZ A;  2ZVN A;  4LNI A;  1WXS A;  2WP9 B;  2GBJ A;  2LRU A;  2JZ3 B;  2CKH B;  3APC A;  3ETR A;  4RGT A;  3AE3 B;  2GLS A;  2WXF A;  3KUD B;  2R2Q A;  1J7A A;  3ZDM C;  3DBL B;  4DXF A;  2EKI A;  3AM9 A; 
#chains in the Genus database with same CATH homology
 1GAQ B;  1V8C A;  1N5W A;  3MC0 B;  1FO4 A;  3T3N A;  1IBX B;  1I4G A;  1LO5 D;  1JML A;  1FIQ A;  1QIL A;  1SE4 A;  1XLO A;  2MJE A;  2WXO A;  3FC4 A;  4YT0 B;  1YNT E;  1ZXI A;  2VZK B;  4YSX B;  1I4X A;  1WXQ A;  2WDR B;  1NYQ A;  1F2R C;  1STE A;  1ZXH A;  2KQ4 X;  4RF0 A;  5T8I A;  4DQO C;  4WUR A;  4O1N A;  3Q8C A;  4N6E B;  1Y56 A;  1OQR A;  3TUO A;  1QKZ A;  2FUG 1;  1QOB A;  1YJI A;  2AQ2 B;  2WXQ A;  2JYT A;  2LHE A;  3FIL A;  2N0S B;  2KAJ A;  3LYY A;  1FCC C;  4L23 A;  1VRA B;  1T6B X;  1J7C A;  1C9F A;  4WH4 A;  3P1M A;  2KN4 A;  3IAM 1;  1PUT A;  4WQM A;  4KX6 B;  2OED A;  3Q8A A;  5HG2 A;  1SEB D;  1FNW A;  1K53 A;  3AE6 B;  1KLG D;  5TSS A;  3CIR B;  5EE0 A;  3BII D;  3WCQ A;  1TY2 A;  1XO3 A;  1C4C A;  3OWE B;  2YEP F;  4LLG M;  5HI1 A;  3R2T A;  2ZW1 A;  4C7Z A;  2QSD A;  1VLB A;  3FAH A;  1HA5 A;  5C3J B;  1V1P B;  2PIA A;  1DOX A;  4YXD B;  1TKE A;  4N58 A;  3C8Y A;  1P7F A;  2BB6 A;  1UWX A;  2XNA C;  2LGI A;  1E6E B;  1SXT A;  1YQ3 B;  1F77 A;  3W5U B;  1FRR A;  1K52 A;  1VZ8 A;  1F2R I;  3P63 A;  1EM7 A;  1JWM D;  5D3D A;  2K3U A;  2MEK A;  4ZHP A;  1KRH A;  3TSS A;  1MVK A;  1VZ7 A;  2L32 A;  1RYJ A;  2Z8L A;  1PGA A;  1C4A A;  4DXG A;  1TJE A;  1CQV A;  2E3T A;  2QIE B;  2DWQ A;  2WS3 B;  4OZB A;  2M0A A;  3AE5 B;  3H8H A;  5BYR A;  3U2S C;  1FXA A;  2FE8 A;  2R61 A;  2BT6 A;  4HKZ E;  5G5G A;  1WGK A;  3IT4 B;  3AEC B;  4MM3 B;  1E7P B;  2JSV X;  4L1B A;  3HRD D;  5MPO A;  5HFY A;  2FBW B;  5BMI A;  1P7E A;  3BVG A;  3KWV A;  1L0X B;  2PLP A;  1SJH D;  4CQN A;  4C80 A;  3O13 A;  3AH7 A;  1IBX A;  1TZO A;  1TYG B;  1RWS A;  4LTU A;  4P16 A;  4A6Q A;  4RGM A;  2WDV B;  2WXH A;  3P4R B;  2WXM A;  4US9 A;  2NTS A;  4HJG E;  1J7B A;  1QOA A;  1C4P A;  2VZK D;  3GS2 A;  1QLB B;  1MI0 A;  3VR8 B;  4C7Y A;  1XCT L;  1JWU D;  2RPV A;  2IGD A;  2N9L A;  1FNU A;  2KAC A;  4GDK B;  4XWT A;  4AQ7 A;  1TS4 A;  1BML C;  1CK1 A;  2K9X A;  3BVZ A;  1E10 A;  1EU4 A;  4RH6 A;  1AW7 A;  2V3N A;  1IGC A;  3BYT B;  2AQ3 B;  1JQ4 A;  3AV8 A;  3BK1 A;  3Q8F A;  2WNM A;  2WLB A;  2PW9 A;  4OHJ A;  5D7G A;  3T3O A;  4IKG A;  1ZOY B;  2CU3 A;  4YSY B;  3Q8B A;  3TEZ A;  1FXI A;  4XWW A;  1I4P A;  2H88 B;  2AQ1 B;  2K22 A;  3RFZ B;  1B1Z A;  2J52 A;  4TQ1 A;  3ZYY X;  2XN9 C;  1SIJ A;  3TEY A;  2WQY B;  1IGD A;  2NMQ A;  1I4Q A;  3W2D A;  4NAW B;  2QMT A;  4YSZ B;  3AEA B;  1IUE A;  1XLP A;  2ACZ B;  2RDH A;  2Q5W D;  1K51 A;  2N7J A;  2WU5 B;  3V3X A;  4AS1 A;  1NYR A;  1CJE A;  1GB4 A;  1MPE A;  5HHD G;  3HVZ A;  2HTM E;  1C78 A;  2I2Y A;  1WSP A;  1QT9 A;  1D5X C;  3W1S A;  1D5M C;  1UGJ A;  4ZHO A;  3BWU D;  5BMH A;  1ZDX A;  1L6V A;  4D2K A;  1ZE3 D;  4OW0 A;  1XLQ A;  4H2A A;  3ABV B;  3IXS A;  1PFD A;  3L4P A;  4OVZ A;  4L2Y A;  1E0Z A;  1ROE A;  1PDX A;  1B9R A;  3URY A;  3VQI A;  1SBB B;  5BYQ A;  1PGX A;  1VJK A;  1C79 A;  3P4Q B;  2SEB D;  2INN E;  3EUB 2;  2W3R A;  1I4H A;  2BS2 B;  4TMA B;  4A9A A;  3MJ5 A;  4YTN B;  2X38 A;  3Q8E A;  2BB5 A;  3GB1 A;  3TEW A;  3I57 A;  2D5G A;  4KGT A;  4ZYS A;  3NUH B;  1N62 A;  2B76 B;  4ARI A;  3NVV A;  2SAK A;  4YTM B;  1L4Z B;  1Q10 A;  1E9M A;  2PKO A;  1NEN B;  2KMM A;  1DGJ A;  2QIL A;  1PGB A;  5G5H A;  1L6U A;  4EE2 A;  2BW2 A;  3LXF A;  3NVW A;  4ZOH C;  1I4R A;  1I7H A;  3AN1 A;  3BZD B;  1SE3 A;  1TKG A;  2W82 A;  1VDV A;  2V0G A;  4REZ A;  1KFY B;  1SJE D;  4JE3 B;  2BS4 B;  5D3I B;  2LJI A;  5LNK 1;  3ZJV A;  1KF6 B;  3RPF C;  3UI3 A;  2V4I B;  4P6V F;  3AEF B;  5FR3 A;  3VR9 B;  4PT5 A;  4LK0 M;  2PVG C;  1TKY A;  2EEL A;  4JWU C;  4ARC A;  5FKA C;  1FFV A;  1VR9 A;  1JRO A;  3I9V 1;  5BYS A;  2PVO D;  1BXT A;  1QF6 A;  1QOG A;  4KGR A;  1NI3 A;  3AE7 B;  3N9Y C;  3SEB A;  2IGH A;  2L83 A;  1T3Q A;  3MFG A;  2J4X A;  1GOZ A;  2BBC A;  2W54 A;  1ENF A;  4MT5 A;  2M19 A;  2OHF A;  2J42 A;  2G9H D;  3BVM A;  4FXC A;  2DBY A;  1OFF A;  3AEB B;  1QQR A;  3FIL B;  1HXY D;  2ZW0 A;  4XE0 A;  1JWB D;  2MH7 A;  4KKJ A;  1WYG A;  5I4D A;  3AEG B;  3LB8 C;  4N59 A;  1N63 A;  3W5V B;  1UUP A;  1WRI A;  1GB1 A;  1SSN A;  1UWM A;  1XCQ L;  1ZUD 2;  1CZP A;  2DLB A;  2MJD A;  2M56 B;  4IDI A;  2ONQ A;  2BS3 B;  4JPS A;  2QEJ C;  4US8 A;  1SF0 A;  1PYW D;  1L4D B;  2DYO A;  4JWS C;  4OZA A;  4OZC A;  1MHX A;  1L0Y B;  4Q2J A;  3ZQ4 A;  4TSS A;  3U52 E;  4RNA A;  4GDL B;  3KWL A;  4HRS A;  4IOI E;  4J3O D;  4HKQ A;  1YN3 A;  1F0Z A;  1HQR D;  5BMG A;  1SB3 C;  4NZL B;  1V1O A;  4KGS A;  1AYF A;  2WDQ B;  1YN4 A;  2JQR B;  5AUI A;  2E6X A;  4RGN A;  4WWM A;  1TS3 A;  4RF1 A;  3BYY B;  2DYM A;  4ZRQ A;  1N60 A;  3CWI A;  1FM0 D;  1JW9 D;  1R7S A;  4RFB A;  1V97 A;  1EWY C;  1JWS D;  3R8B A;  1ZP0 B;  2N9K A;  1D4B A;  1TS2 A;  1NEK B;  1DOI A;  1EU3 A;  1RFK A;  3SFD B;  3W9C B;  3PO0 A;  3P42 A;  2CJO A;  1YJJ A;  3NRZ A;  3AEE B;  1DYQ A;  1YMH E;  3HVD A;  1D5Z C;  4XDD A;  1L5P A;  3DWM A;  1VZ6 A;  1L0V B;  1JWA D;  2IJ0 A;  2Y5C A;  4GLS C;  1UNS A;  5E6J A;  3V05 A;  3GP7 A;  5JXV A;  1AN8 A;  2WXJ A;  5EE3 A;  1FD6 A;  5C2T B;  2L52 A;  1JRP A;  3J9C A;  1KLU D;  2PTL A;  4R3D A;  1JAL A;  2YEP B;  3AMZ A;  2MJ3 A;  1FMA D;  2ICI A;  4NJC A;  3EGR A;  1XEE A;  2Y3A A;  3NS1 A;  1WWT A;  5EE9 A;  3NVZ A;  4HEA 1;  4ZRP A;  4B0E A;  3B2G A;  1ZDV A;  1HEZ E;  3KQ4 A;  1YN5 A;  2JU6 X;  2H89 B;  2NTT A;  4B0M A;  3B9J A;  2GB1 A;  3EA6 A;  4MH8 A;  1M4V A;  2V3P A;  3IT6 B;  1TS5 A;  4A90 A;  4NAM A;  2IDY A;  4WAF A;  3AED B;  1RM6 C;  3VRB B;  4XDC A;  2K0P A;  5H92 C;  2WXK A;  3ZJU A;  2W3S A;  3PZ7 A;  4HRO A;  3ZGZ A;  2KWD A;  2IPK D;  5FK9 C;  2G1E A;  2HDE A;  2JZP A;  2GI9 A;  4MAC A;  2LHD A;  1K50 A;  1OQQ A;  3AE2 B;  4YWG G;  1FFU A;  5H8Y E;  1AWD A;  1FRD A;  1GPX A;  1BUI C;  2RDG A;  3E56 A;  4UDU C;  2BYT A;  1N61 A;  4RGO S;  2WXR A;  3MP9 A;  2RMM A;  1C77 A;  2WXN A;  1EWC A;  3B2F A;  1YQ4 B;  1V1P A;  2CJN A;  1NVI D;  2L1A A;  4A8X C;  5GXG B;  2WXP A;  3MHZ A;  2I38 A;  2LMC A;  3AB5 A;  3P4S B;  4USA A;  3Q69 A;  3SR6 A;  2IGG A;  3KLS X;  3TEX A;  1JCK B;  3VRA B;  2AX5 A;  1D6E C;  1KH0 A;  1ZPS A;  1SE2 A;  1ET9 A;  3AE4 B;  3U4E G;  3HUI A;  3PZ8 A;  3NVY A;  2INP E;  2QJL A;  1FCL A;  2JYE A;  2LEK A;  1XLN A;  4YTP B;  2K5P A;  2J53 A;  2ON8 A;  1TY0 A;  2WXG A;  2LFI A;  2WXI A;  4ITK A;  4WIP A;  5EE1 A;  3ZJT A;  1MHH E;  3BK2 A;  3U7Z A;  3SFE B;  3IAS 1;  2Y5P A;  3NZ3 A;  2KDM A;  1DOY A;  2W55 A;  3AE8 B;  3AE9 B;  4RCO A;  4C56 C;  1N5X A;  1XXG A;  2WP9 B;  1KTK A;  1HZ6 A;  2JXT A;  5AUK A;  1C76 A;  1FNV A;  3R2I A;  3ETR A;  4TQ0 A;  2BTE A;  1ET6 A;  4RGT A;  3AE1 B;  4M0W A;  1A70 A;  1T5X D;  2LUM A;  3AE3 B;  1XF5 L;  2PMV A;  3P4P B;  1QOF A;  4KKI A;  4A55 A;  2WXL A;  2WU2 B;  4JX1 C;  2WXF A;  1HZ5 A;  1ACC A;  2JWU A;  2JX5 A;  1J7A A;  4DXF A;  1FEH A;  3DWG C;  3E9S A;  2EKI A;  3AM9 A;  2TSS A;  1ESF A;  2GRI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...