3GB1A

Structures of b1 domain of streptococcal protein g
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
56
structure length
56
Chain Sequence
MTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immunoglobulin binding protein
molecule keywords PROTEIN (B1 DOMAIN OF STREPTOCOCCAL PROTEIN G)
publication title Improving the Packing and Accuracy of NMR Structures with a Pseudopotential for the Radius of Gyration
pubmed doi rcsb
source organism Streptococcus sp. 'group g'
total genus 12
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 1999-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3gb1A00
2LGIA 1XCTL 4IKGA 2IGGA 1PGBA 2JXTA 1D4BA 1MVKA 1IBXB 1MHHE 2QMTA 4HJGE 1YNTE 2J52A 3FILA 1PGAA 2KQ4X 3FILB 2ZW1A 1C9FA 2QSDA 2ON8A 5BMIA 4WH4A 1UWXA 5HFYA 1XF5L 2NMQA 2JU6X 1Q10A 1QKZA 3V3XA 2RPVA 1K53A 2KWDA 3GB1A 1K51A 2KACA 2GI9A 2KDMA 5HHDG 1HZ5A 2N9LA 1EM7A 2LHDA 1FCCC 1K50A 2EELA 5JXVA 1MHXA 1ZXHA 1GB4A 2GB1A 2J53A 2JSVX 4GLSC 2JWUA 2N7JA 1K52A 1XCQL 4OZCA 5HI1A 5BMGA 2KN4A 1IGDA 4KGTA 4KGRA 2IGDA 1KH0A 2PTLA 1YMHE 1P7FA 1JMLA 2JZPA 2RMMA 2ZW0A 3MP9A 4MACA 2K0PA 2OEDA 4D2KA 5HG2A 1HEZE 4OZAA 3UI3A 1FCLA 2PW9A 2ONQA 4IOIE 1IBXA 1FD6A 1GB1A 4OZBA 1F2RC 4HKZE 1F2RI 1MPEA 2I38A 1MI0A 4KGSA 1PGXA 1P7EA 2N9KA 2LUMA 2PLPA 1HZ6A 2LHEA 2I2YA 5BMHA 2IGHA 1IGCA
chains in the Genus database with same CATH superfamily
4IM0A 1EWYC 2JYEA 4ITKA 4JQWC 2WS3B 2MHJA 4K81A 1PGBA 3APDA 2BVCA 3VQIA 3DVGY 3NVZA 1WZ3A 1F52A 2ZNVB 2CKHB 3NRZA 1YNTE 3NJTA 2C5LC 2DZMA 4ZYSA 2DENB 4FHKA 1WYWB 1SE2A 3ZQ4A 1E7UA 1WX9A 4W9KA 3MJ5A 4JL9A 4XX5A 4C7ZA 5C1ZA 3AM9A 4TQ0A 2GI9A 4DHJB 2K8BA 3R8BA 1PUTA 4W9GA 4HWIB 1OQQA 3PZ7A 5EE3A 4JX1C 5G55A 1ENFA 1FCCC 1GG3A 4KIKB 1FIQA 3AE8B 2J53A 2ZVOA 3AE4B 4HPPA 1P98A 2WXNA 2MA9B 1J0GA 2NPTB 2CHWA 4W9DA 2WXRA 2O6VA 3A1QB 2QDFA 2PKOA 4O1NA 5AUIA 4A55A 4H2AA 2N0SB 4BZAA 1NVID 3T3NA 2MBOA 2JZPA 3HM6X 4DK5A 2MX2A 1C76A 4NPNA 1T0SC 3RNBC 3PZDA 3KVFB 4JWSC 2BKRB 2PIAA 3W1SC 1EWCA 2J7QB 3TEWA 2K8CA 2V9HA 2K6QA 3PZ8A 3DHIC 2KN5A 4BKSA 3BINA 4W9IA 1TJEA 2MRPA 2DWQA 4IDIA 1JCKB 4KDIC 3GZNI 3FAHA 1V97A 3A9JB 4ACFA 4OVZA 3RNFC 1FRDA 3AEEB 3UQAA 2BTEA 2GRIA 4NY0A 3K9OB 3R2IA 3RN9C 2J0JA 2ASQA 1WM2A 1VDVA 1XLNA 1C79A 3HK0A 2KTFA 2J52A 3PRPB 2AQ3B 2FCQA 4BAXA 2GMIC 1JRPA 3V61A 4M0WB 2KC1A 2L00B 2M56B 1FO4A 3A4RA 1YQBA 2CU1A 4K7UA 3RNAC 4WURA 2LUEA 1VLBA 4BKTA 4GSWA 1WGDA 5EE1A 3V6CB 1V5TA 5HHDG 1J7CA 1MG4A 1T0YA 3EA6A 3NS8A 4G50A 2JPHA 3ML8A 5G2NA 5BO4B 3DHHC 4P1CC 3TEXA 1UF0A 3N30A 2M19A 4F1SA 1TY0A 2JWUA 2N7JA 3KUZA 4IUMB 4L1BA 3B9JA 1ET6A 3RNGC 4BKGA 2PEAA 3N20C 4EKUA 2VH2A 2CHZA 3JVZX 4NAMA 4NJCA 2LGYA 4AQ7A 1GPXA 2K1FA 2XN9C 1VCBA 2N9XA 5D3DA 2D3AA 4BBNC 1ROEA 4HROA 1FCLA 5AZHA 4C00A 2WGSA 3RULA 2LVPA 1WR1A 5BYRA 1L7YA 4P1BC 4EZJA 4M01A 3EGRA 3VR9B 1IYFA 2IGHA 2K39A 2NR2A 3VXWA 2I1KA 3FKYA 5IP4D 1D4BA 3ZXVA 4HJGE 3ZNHB 3CF6E 2MP2A 3M63B 4WAFA 3ZIMA 4KX6B 1B9RA 4ZDVA 4N9F4 3P4QB 4A3OA 1OEYJ 4B0MA 2PVGC 2M8SA 1XF5L 4USAA 3VFKA 2RD0A 1EU4A 3V3XA 1RFAA 2R61A 1Q0WB 5E6OA 1WXVA 1QOAA 3GB1A 2KMMA 4RFBA 3AEBB 4WJOA 4WAAA 4X57B 4NQKE 2JZZA 4DXGA 1HZ5A 4KIKA 4BVUC 2MBBB 2ZPNA 2INNE 3AE6B 3CMMB 4FA6A 3I63C 2BS3B 4W9FA 5G5GA 2NPTA 2HDEA 5AZFA 2L52A 4AP4C 4B9KA 1S3SG 2KN4A 3SEBA 1HTOA 3IAS1 3ZNID 4NNJB 2QJLA 2LJIA 3AE2B 5TSSA 1HQRD 2KJ6A 1I35A 3ALBA 4IG7B 2D07B 4RGMA 2NTTA 3DDCB 1KTKA 4FULA 1KLGD 3A9JA 1AYFA 1S1QB 1XLQA 1RAXA 4GOCA 4ARCA 3DHGC 1IGCA 2L32A 3RD2A 1UGJA 3NHEB 1C77A 5LLIA 1QILA 4US9A 4YTNB 2MJ3A 2INDC 2DX5B 2L0FA 2GBMA 2UU7A 5J18A 4M0WA 2YEPF 3FILB 1R7SA 1BT0A 1YQ4B 2CHXA 2DZKA 2KD0A 3KW5B 1PYWD 4M8NA 2QCZA 3LDZE 2KT7A 1XQQA 2BB5A 1WRIA 3TUOA 4NQLB 2M0XA 3Q8FA 4DHZE 1YJ1A 2PMVA 2BYVE 2LEKA 4JPSA 4YL8A 3V60A 3DBSA 3NZSA 4II3B 4HLEA 3B2GA 2BQQA 1PFDA 4W9EA 2KDEB 2D10A 1FEHA 2BF8B 1XLPA 2GBNA 1TY2A 2LJ5A 4RCOA 4B6WA 2GBJA 2KFKB 1KLVA 1YX5B 2PTLA 3PTFC 3UINB 3HVDA 2ZW0A 1WMHB 2V3SA 4FXCA 2K0PA 4C7YA 1JW9D 2WNMA 2B76B 3H7SA 1TS2A 2JQRB 1VJKA 4GIVA 1GB1A 3W1YA 2I1JA 1GOZA 3UGBB 4EFOA 5CTRC 4KGSA 2WXQA 1PGXA 4HVBA 1P7EA 5JZEB 1SE3A 2MLBA 3EC8A 2PLPA 4KZCA 1KRHA 3AH7A 3M95A 3PSEB 4G0NB 1QOBA 2N4FA 1GC7A 2KC2A 3T3OA 2IPKD 2KWCA 3O65B 2L83A 2FUHB 1KLUD 3PLVA 3Q3NC 1WX8A 1WXAA 3AULA 4AS1A 1A70A 4HJKA 1FRRA 2FUG1 2N1VA 1T3QA 1E10A 2AYOB 1KFYB 4PK1A 2L76A 3DCGA 5BMIA 3HHMA 2XEWA 4DDID 1BMLC 2IYDB 3BVZA 3BYTB 3GE8C 3ZDMC 4B0EA 3L10B 1RLFA 1Z2MA 1QOFA 1WJUA 1LGRA 4GDKB 2FNJB 3NUHB 3LXFA 3T8MA 3SD5A 2JSVX 1WRDB 1CQVA 1SXTA 1GAQB 1I7HA 4G11A 3ZUNA 3O13A 4FJYA 3GZNB 2Z8LA 3AE7B 4IWPA 3QX1A 1LM8B 2JUOA 2RDBC 1DOXA 3X0WA 5IKCM 2BKFA 4KGRA 4TKNA 3KWVA 4LNKA 4DQOC 1L2NA 4S0RA 4I6PA 1TBEA 4MM3B 2KLGA 3H6NA 4EUTA 4XZ4A 3ZTDA 3IG3A 1IBXA 2LZ6A 4XE0A 2KJRA 1R4NI 4LJOB 5CHVC 1OTRB 4RMAA 4XGAB 4KVGB 2JXXA 2MSED 1X1MA 2WXGA 2INCC 1SE4A 1J7AA 2V1YA 4IKGA 2DYMA 3PO0A 1FXAA 5GXGB 1ZUD2 3L16A 1XD3B 3AV8A 2KFJA 1MHHE 1IPGA 5T8IA 4XWTA 2BYTA 3FILA 3Q3OC 2DLBA 4A9AA 2X38A 3AU5A 2ON8A 4WWNA 4RGNA 3HUIA 3OJ3A 2NMQA 4F8CB 2A5UA 4FBJB 2FCNA 1C4PA 5H8YE 3BVMA 2KWDA 3ZYYX 3NS1A 2AL3A 3P63A 3Q8CA 2M0AA 2K25A 2ZJDA 1ZE3D 2KDMA 1V81A 3I5JC 5C3JB 4W9LA 3R66C 2C7NB 3ZRFA 5IA7A 1FM0D 2MP2B 2LHDA 3WA0A 3RCZA 2EELA 5JXVA 1LFDA 4PS3A 1VZ6A 2LMCA 3BIID 3QIJA 1R4MI 2Y5BB 2SAKA 2DZIA 1K8RB 3UIPB 4LK0M 1OGWA 1E9MA 2KFKA 1RYJA 2IO1B 4AWJA 3UIOB 4CYEA 4RM8A 4JGHB 1UGMA 1WMHA 3B08A 3VTUA 5CX3A 3NVWA 2LGXA 3UI3A 1WM3A 2Y3AA 4XC2A 2G1EA 5KHOA 5EDSA 4XWWA 1DYQA 1SSNA 2J0KA 1P3QU 4MGYE 2L8JA 2OHFA 1MI0A 5BYSA 1WYGA 1L0XB 4MJSB 1WX7A 1Y56A 4UDUC 2LGIA 2WQYB 4EE2A 2E6XA 2DBYA 3NY5A 4IWOA 3C8YA 5LXHA 4YXDB 4MH8A 2CR5A 3N32A 1TKYA 3JSVB 2G3QB 4KDLB 5L83A 3KUDB 2KVRA 2QSDA 2RPQA 4R3DA 2KWUB 4WWMA 1SIJA 2SEBD 2MBEA 2AQ2B 4C4VA 2RPVA 2KK8A 4FJVB 4ZOHC 3SDLC 4BOZB 4GDKA 1FXIA 2BT6A 4S17A 2DAFA 4LLGM 3A33B 1JWAD 4ZHOA 2L1AA 2N7DA 3Q8BA 2KXJA 3M3JA 2PVOD 4GLSC 2Z0EB 4CHKA 2J4XA 4RF0A 1WI0A 1N63A 1I4RA 5HI1A 1Q5WB 2H88B 1NDDA 3QJZA 3QK0A 3W5UB 3QA8A 4MM3A 4MACA 3GE3C 3VAWA 4MSMB 1YN5A 2CJNA 3PS6A 4E3CA 4IC7B 2CU3A 2GBKA 2WDVB 3HM3A 2JX5A 4AJWA 2AL6A 4RF1A 1JALA 2MH7A 2HTHA 2KANA 4OVVA 1YD8U 3ZTCA 3EHVA 4ANUA 3VUXA 4YTMB 1N61A 2FIDA 1NYRA 5IOIA 3DQVA 1MVKA 2KDIA 2Z0DB 5G5HA 2D3GA 1RFKA 4FADA 3CIRB 4XYCA 4TV3A 1SF0A 2K9XA 4EZLA 5EE9A 2ACZB 2LFIA 2LRUA 3AMZA 1M94A 1FMAD 5HFYA 3R7RA 3OG5A 2LGDA 2D5GA 2LWPA 4HCNB 4IM2A 1ISNA 4TUUA 5DPSA 3VVWB 4EOYA 4P7IA 5I4DA 3HVZA 4DWFA 2ZCBA 2N9LA 4YT0B 1VZ8A 1E8WA 4MSQB 1MHXA 2GB1A 3TIXA 3H8HA 3I3TB 2LVOA 2BBCA 3ZGZA 1HTQA 1WGYA 2Q5WD 5BYQA 2KOXA 4Q2JA 2AQ1B 2YVCA 3TL5A 3APFA 4K1RB 1P7FA 2PJHA 1SJED 3UQBA 2KWVB 4W9JA 3JW0X 3N3KB 3LYYA 2V4LA 4E74A 4LNFA 5HG2A 1AARA 1NBFC 1GNUA 1SE9A 3DWMA 3BYYB 3ENEA 4HCPB 3PVLA 4EZKA 4HKZE 1JRUA 3U7ZA 2IO3B 1MPEA 1EO6A 3A9KB 4MJSA 2KX3A 3P4SB 5GMVA 2DZJA 1DGJA 3ZNGC 2LXCA 5BMHA 3L17A 4DBGA 1XCTL 3PT2B 1I4GA 2WU5B 5CHWA 1WXQA 4HK2A 4ZRJA 5D3IB 2Z59B 2R2OA 1WJ4A 4N58A 5E6JA 1EF1A 1IBXB 5DPTA 4ZRKA 3VH4B 3JSVA 1V2YA 4GN1A 4CO7A 1N62A 1PGAA 2KQ4X 4J6IA 1E0ZA 2HJ1A 1E7VA 2LVQA 1NYQA 3ZJTA 2WX0A 4ICVA 5D6JB 4DDGD 4LNOA 1UZXB 2GOWA 2IO0B 3NVYA 2KLCA 2WXHA 1K53A 1ZGUB 2WYQA 1BUIC 1UNSA 4DHZB 3W1SA 1J7BA 3RPFC 1F77A 1CJEA 4ARIA 3VRAB 1AN8A 1GJZA 1GC6A 2BGFA 5JH5C 4IW0A 2EKEC 1I4HA 1YOVB 4ZRIA 3WAPA 4P16A 4JWUC 1L0YB 3ZJVA 1R4NB 1I4PA 4MH0E 1BXTA 2WDRB 3WANA 1HXYD 2WDQB 1UBIA 3IAM1 2B3AA 1N6ZA 1OFFA 1TT5B 4W9CA 4HPMB 4XDCA 3S2AA 3IXSA 4YSZB 2VZKD 5E6NA 5BMGA 4YSYB 1G6JA 4ZRQA 3PV1A 1V86A 3C19A 2BS2B 3W5VB 2PPHA 2NBUA 4K7WA 2C60A 3ONSA 5AUKA 2RMMA 4JLCA 3KYCD 2NBWB 1WFYA 4D2KA 2RDHA 5C2TB 1YN4A 1L6VA 4MEMA 4OZAA 3VTVA 3DBLI 2WXIA 3ETRA 4F7ZA 2KMAA 3RI7C 3DBHI 4OZBA 1VZ7A 3AE5B 1TS3A 2W54A 2LRWA 2FIFA 4NAWB 1L4ZB 3Q3JA 4FLHA 2W82A 1TIFA 2RSUA 3P2BA 2W9NA 3APCA 2MQJA 3P42A 3U4EG 2D3BA 4ZRPA 1L5PA 2OOBB 1WF9A 1T0QC 1JWSD 3R2TA 4LDTD 3RUIB 4EEWA 3X23A 3P4RB 1SGHA 5J17A 3PGEA 2QHOA 2IO2B 2QC8A 2HD5B 2JT4B 1P9DU 3WAOA 3RT3B 1JWMD 3VH3B 1R4MB 1MG8A 1NI2A 4A20A 3EFCA 1MFWA 2NBVB 3OAWA 4ICUA 2VH1A 3N9YC 1FFUA 3LJ3A 4L2YA 2L7RA 5IN7A 5DCNA 2X8XX 3KWLA 1RWSA 3DVNV 2V3PA 2QIEB 2WHIA 3U30A 3VTWA 3AE1B 3ZW3A 3AU4A 1ZW7A 3W2DA 1K50A 1WJ6A 2J0MA 4KZ0A 1CK1A 2Y5CA 2DHZA 4JIOU 2IY0B 1UD7A 3IHPC 1TZ1A 3U52E 1K52A 4DHJD 4LTUA 1QOGA 4RH6A 4A90A 4C4VB 1D6EC 3BVGA 3RYTA 1XEEA 5FK9C 2IGDA 5J2RA 1KOTA 1Z5SB 3ZVVA 2HJ8A 1HA5A 1WWTA 2IBIB 5AZGA 1L4DB 3ZDTA 3QC8B 3P1MA 4C80A 2AEHA 1STEA 3RZFA 3DOWA 2HE7A 5D2MB 1XLOA 3Q8EA 4NJ6A 4GGQA 1F2RC 4TSSA 1A5RA 3A9KA 1KF6B 2N9KA 3AN1A 5H92C 4GMVA 2WXPA 3Q6BA 4M8MA 1HZ6A 2A4ZA 2EMTA 2NCNA 4WQMA 2KNBA 3DWGC 2ZVNA 3PRZA 4KV2A 3SHQA 3V62A 1V6EA 2DAJA 3OJ4B 2M4NA 1ZOYB 2QILA 4K7SA 5D94A 3ZO5B 2VZKB 1AWDA 1CMXB 4WWPA 3L4PA 3H7PB 1SEBD 3ZKJC 2R2QA 2XNAC 1YN3A 1QKZA 1IUEA 2KZRA 2JF5A 1UELA 2KQSA 2KMCA 4AUQC 3EECA 1SJHD 1ZDVA 2KACA 3BWUD 3TEYA 3NOBA 1M4VA 4REZA 4OHJA 2D11A 2OJRA 2WXLA 1E8YA 4NZLB 3AEGB 3KYDD 4MGIE 2ZNVC 3AE9B 2KTRB 2M17A 1L0VB 3Q2AC 2WWZA 1YX6B 3VR8B 2FCSA 2L05A 2MBHA 1QZEA 4GDLA 4B95A 1IP9A 2XBBC 4ANXA 2N1WA 3EUB2 2FAZA 1TTNA 5E6PA 2MEKA 2UWQA 1WGKA 1B1ZA 1E90A 1FPYA 4W9HA 1JWBD 2OJWA 1FNUA 4N6EB 2K8HA 5DPRA 1WXSA 1FD6A 1TYGB 1P0RA 4CQNA 4NAWA 3M62B 4URKA 4WJQA 1RM6C 1FNWA 1GUAB 4LNNA 3MC0B 1FNVA 5KHQA 3DBRI 2NVUI 2G9HD 1SBBB 2MBQA 2KX0A 3PHWB 4KKJA 2V0GA 2GBRA 2IGGA 1HE8A 5CHFA 3Q14C 2BPSA 2RDGA 2BWES 2ZZPB 3HIZA 1L6UA 5FR3A 1YJIA 4ZHPA 1ZDXA 2W3SA 4HDOA 2KQ7A 2K22A 2L3ZA 1VRAB 3ZNZB 1UWMA 2G45B 1F9JA 3UF8A 3URYA 2JU6X 2D3CA 2Y5PA 1V8CA 4IM3A 1K51A 3B1LX 4KSLC 5FR6A 2K3UA 3MHSD 2WU2B 2YLMA 1C4CA 2JY6A 3RZWC 1WY8A 5EE0A 4RGTA 1JROA 3TJPA 4MDKE 3ZJUA 2IZVB 1V49A 2YEPB 5D7GA 4RGOS 1T6BX 4XDDA 1WR6E 4LJPB 4KGTA 2WXJA 4AJYB 1YMHE 2XK5A 3OLMD 2DYBA 2O2VA 2W3RA 3Q69A 1D3ZA 3ECIA 1ZP0B 4I6NB 2IJ0A 3NZ3A 2MJEA 3SFEB 1F2RI 3P4PB 2IDYA 1QLBB 3L13A 2M1MA 1V1PB 5LXIB 1KJTA 4A8XC 5TR5A 4ASWC 4TQ1A 3B0AA 3MJWA 1H8CA 3CSTA 4GXBA 2WDTB 3IBEA 3WALA 4GU2A 2ZCCA 1ZKHA 1V1OA 3RNEC 1WJNA 2REXA 1ET9A 1XO3A 1FFVA 4MGZE 1WGRA 1DOYA 3H7PA 3W9CB 4TMAB 2ZW1A 2N7EA 3H1UA 2NS5A 2DYOA 2KDFB 4OVUA 1E8ZA 3IT6B 1D5XC 3MTNB 1SB3C 4HPLB 3QWZB 4L23A 3TCAA 2KDBA 1I4QA 1TKGA 3RNCC 3DVGX 3L08A 2JZ3B 3DBLB 2LD9A 3QHTA 1WE7A 1EF5A 3DBHB 1GB4A 2KTRA 3BY4B 4E71A 1TGZB 5IAAC 2GLSA 1N60A 2FCMA 1ESFA 1EUVB 2J42A 2DNFA 3PRMB 4OZCA 1QQRA 4A3PA 2WX1A 1KH0A 2MCNB 3QARA 2FBWB 3GOEA 2PE6B 4ANVA 3WIMA 2JVCA 5JHBA 4MELA 2WXMA 1HEZE 3C0RB 1TS5A 4WQOB 2PW9A 3DVNU 4IOIE 2LGSA 2BB6A 2TSSA 2QEJC 3CSFA 4C56C 3ML9A 4PT5A 1V5OA 3FC4A 1XT9B 3ZXRA 4PYZA 4I6LB 3E56A 1UUPA 1OQRA 3AEFB 3L54A 2WXKA 1WIAA 3L0WB 3IT4B 4RM9A 1F1HA 2O6VD 3QAQA 5HKHA 4BOSC 3VRBB 1YIWA 2N9PC 3WCQA 1SIFA 2LASA 2JWZA 3MC9A 4WH4A 4HEA1 4AOFA 2IY1B 2WXFA 2W55A 3I9V1 2HTME 3AXCA 3NZUA 1WSPA 2CJOA 3B2FA 3A1QA 4BKSD 1NI3A 2BW2A 4IWQA 3MC8A 4HRSA 4K3BA 1TZOA 4K3CA 3AE3B 5FKAC 1H4RA 3N1YC 2RR9A 2WLBA 1WH3A 2AX5A 2KYWA 3U2SC 2KHWB 3U8ZA 4KKIA 3AI5A 3D32A 3KLSX 1Q1OA 1P1AA 1NENB 2FE8A 1JMLA 3SR6A 2OEDA 2EKIA 2LXAA 1T5XD 3V05A 3SFDB 1OEYA 4US8A 4GB9A 1FXTB 4JE3B 3PREA 4P6VF 4M00A 2D2QA 3KUCB 4GDLB 1V1PA 1QF6A 2V4IB 2BYEA 3IFWB 4YTPB 3GP7A 2I2YA 2E3TA 3MHZA 1RRBA 3AEDB 4PYUA 3KQ4A 4A6QA 1VD2A 2C7HA 4FHJA 4HXDA 4ANWA 3DPDA 1I4XA 1E5WA 2JRHA 3GS2A 2QMTA 5LNK1 4WJPA 3E9SA 3AB5A 3PPAA 1PDXA 4DXAB 1ACCA 2WP9B 3VDZA 1C9FA 3VHTC 4OW0A 3NG0A 3EFUA 1I42A 1D5ZC 3Q8AA 3U7DA 1MJDA 1UBQA 1E7PB 1C4AA 1CZPA 3BZDB 1DOIA 2KVZA 1ZXIA 4RNAA 3LB8C 2ICIA 2AWTA 2EMSA 4BFRA 3MFGA 1NEKB 3R7QA 3PHXB 1ZXHA 3TSSA 2JRIB 3BK1A 1WGHA 5L95C 3J9CA 5JHAA 4G3XB 1V9JA 3N1XC 3BK2A 3N1ZC 2KJHB 5MPOA 2UYZB 5IO9A 3DBRB 1J19A 2O6VB 1IGDA 4N59A 4FJZA 5DPWA 3I57A 4HKQA 4WIPA 2C9WB 3QCAA 4YWGG 2MJDA 3RFZB 3MP9A 1QT9A 2ZEQA 3ABVB 3OWEB 1OQYA 4MT5A 1LXDA 1F0ZA 3VUYA 3KH0A 4KSKC 3ZRCA 3AECB 2KAJA 2WXOA 4LNIA 3TMPB 3Q3MC 1WGGA 3IVFA 3VUWA 2JYTA 2L0TA 2I38A 1XXGA 1N5XA 1D5MC 1UH6A 2INPE 2LHEA 2XK5B 2BWFA 1TS4A 3H9DA 2O2VB 1LO5D 4II2B 2G4DB 1T0RC 2JXTA 1Y8RC 4BBNF 3SU8X 1VR9A 3AEAB 1PQSA 1C78A 3NVVA 3WAMA 2KKCA 1WE6A 4DXFA 1C3TA 1UWXA 5AEKB 2V3NA 1Q10A 1C1YB 4NJ7A 3RMKC 2K6DB 1TKEA 4WWOA 1V80A 2CS4A 2PE9A 4QAYA 4J3OD 1EU3A 4PS8A 2LI5A 3CWIA 4WJNA 4FN2A 2MWSB 2K5PA 1EM7A 1YJJA 4YSXB 2G4SA 1J8CA 1JWUD 2KO3A 2MW5A 4MGKE 3Q3FA 1E6EB 1N5WA 1YQ3B 1XCQL 2BYFA 3K9PB 1WZ0A 2RGFA 3JYUA 4M02A 3TBLD 1E8XA 1LQBA 3TEZA 2N9EB 1ZPSA 1KM7A 2BS4B 3HRDD 4LCDE 1WXMA 2H89B 3ZLZA 2VRRB 2ONQA 1AW7A 2NTSA 3V6EB 2ZPYA 4PS7A 3R3MA 4HDQA 4LDTB 3QQ8B 1JQ4A 4ZYNA 2LUMA 3T9LA 1U4AA 5C23A 3PLUA 2C7MB 3A4SC
chains in the Genus database with same CATH topology
1KRHA 3AH7A 4TQ1A 1EWYC 1QOBA 1XCTL 2JYEA 4ITKA 1I4GA 2WS3B 2WU5B 1PGBA 1WXQA 3T3OA 2IPKD 5D3IB 3VQIA 2L83A 3NVZA 1KLUD 4N58A 5E6JA 1IBXB 1V1OA 3NRZA 1ET9A 1N62A 1YNTE 4AS1A 1PGAA 1A70A 2KQ4X 1FRRA 1FFVA 1XO3A 4ZYSA 2FUG1 1DOYA 1E0ZA 1T3QA 1E10A 3W9CB 1KFYB 1SE2A 4TMAB 2ZW1A 3ZQ4A 1NYQA 5BMIA 3ZJTA 3MJ5A 2DYOA 4C7ZA 3IT6B 3NVYA 3AM9A 4TQ0A 1D5XC 1SB3C 2WXHA 1K53A 1BMLC 3BVZA 1BUIC 1UNSA 3BYTB 4L23A 2GI9A 3W1SA 1J7BA 1I4QA 3R8BA 1PUTA 4B0EA 1TKGA 3RPFC 1F77A 1CJEA 1OQQA 1QOFA 3PZ7A 4ARIA 3VRAB 1AN8A 5EE3A 4JX1C 1ENFA 1FCCC 1I4HA 4GDKB 1FIQA 3NUHB 3LXFA 4P16A 1GB4A 4JWUC 3AE8B 1L0YB 2J53A 2JSVX 3ZJVA 3AE4B 1CQVA 1SXTA 1GAQB 1I7HA 1I4PA 1BXTA 2WDRB 1HXYD 2WDQB 2WXNA 1N60A 3IAM1 3O13A 1ESFA 2Z8LA 3AE7B 1OFFA 2J42A 2WXRA 1DOXA 4OZCA 4XDCA 3IXSA 4YSZB 2VZKD 2PKOA 1QQRA 4O1NA 5BMGA 4YSYB 5AUIA 4KGRA 4A55A 4ZRQA 1KH0A 3KWVA 2BS2B 4H2AA 3W5VB 2N0SB 2FBWB 4DQOC 5AUKA 1NVID 3T3NA 2JZPA 2RMMA 1C76A 4MM3B 4JWSC 2WXMA 4D2KA 2PIAA 2RDHA 5C2TB 1HEZE 1YN4A 1L6VA 4OZAA 1EWCA 1TS5A 2PW9A 3TEWA 4IOIE 2WXIA 3ETRA 1IBXA 2BB6A 2TSSA 4XE0A 4OZBA 2QEJC 1VZ7A 3AE5B 3PZ8A 4C56C 1TS3A 4PT5A 2W54A 3FC4A 1TJEA 2DWQA 4IDIA 4NAWB 1JCKB 1L4ZB 3E56A 2W82A 3FAHA 1V97A 1UUPA 4OVZA 1FRDA 3AEEB 1OQRA 3AEFB 3P42A 3U4EG 2WXGA 4ZRPA 1L5PA 2WXKA 2BTEA 1SE4A 1J7AA 2GRIA 4IKGA 1JWSD 3R2TA 2DYMA 3PO0A 1FXAA 3IT4B 5GXGB 3R2IA 1ZUD2 3AV8A 3P4RB 1MHHE 1VDVA 1XLNA 3VRBB 1C79A 5T8IA 4XWTA 2BYTA 2J52A 3FILA 2AQ3B 1JRPA 1JWMD 3WCQA 2DLBA 4A9AA 2X38A 2ON8A 2M56B 4WH4A 4RGNA 3HUIA 1FO4A 4HEA1 2NMQA 2WXFA 2W55A 3I9V1 2HTME 1C4PA 3N9YC 1FFUA 4WURA 1WSPA 2CJOA 5H8YE 3B2FA 3BVMA 1VLBA 4L2YA 2KWDA 3ZYYX 3NS1A 1NI3A 2BW2A 3KWLA 1RWSA 3P63A 3Q8CA 5EE1A 2M0AA 1ZE3D 2KDMA 4HRSA 5HHDG 2V3PA 1J7CA 1TZOA 2QIEB 5C3JB 3EA6A 3AE1B 1FM0D 2LHDA 3AE3B 1K50A 2EELA 5FKAC 3TEXA 3W2DA 5JXVA 1CK1A 2Y5CA 2M19A 2WLBA 1VZ6A 1TY0A 2AX5A 2JWUA 2LMCA 2N7JA 3BIID 3U52E 1K52A 4LTUA 2SAKA 1QOGA 4RH6A 4A90A 1D6EC 3BVGA 4LK0M 4L1BA 3B9JA 1XEEA 3U2SC 1E9MA 4KKIA 1ET6A 1RYJA 5FK9C 2IGDA 3KLSX 4NAMA 1NENB 2FE8A 4NJCA 1JMLA 1HA5A 1WWTA 3SR6A 4AQ7A 1GPXA 1L4DB 2OEDA 2XN9C 2EKIA 5D3DA 1T5XD 3NVWA 3V05A 3P1MA 3UI3A 1ROEA 4HROA 4C80A 1FCLA 3SFDB 1STEA 2Y3AA 4US8A 2G1EA 4JE3B 4XWWA 5BYRA 1XLOA 4P6VF 3Q8EA 1DYQA 1SSNA 1F2RC 4TSSA 2OHFA 1MI0A 1KF6B 5BYSA 4GDLB 1V1PA 1WYGA 1QF6A 2N9KA 3AN1A 5H92C 1L0XB 2V4IB 2WXPA 3EGRA 3VR9B 1HZ6A 4YTPB 3GP7A 2I2YA 2IGHA 2E3TA 1Y56A 3MHZA 4UDUC 3AEDB 2LGIA 2WQYB 3KQ4A 4WQMA 3DWGC 4EE2A 2E6XA 4A6QA 2DBYA 3C8YA 1D4BA 1I4XA 4YXDB 4MH8A 3GS2A 2QMTA 5LNK1 4HJGE 1ZOYB 1TKYA 3E9SA 3AB5A 2QILA 4WAFA 4KX6B 2VZKB 1AWDA 1B9RA 1PDXA 1ACCA 2WP9B 3L4PA 1C9FA 2QSDA 3P4QB 4R3DA 4B0MA 1SEBD 4OW0A 4WWMA 1D5ZC 1SIJA 2PVGC 2XNAC 3Q8AA 1YN3A 2SEBD 1XF5L 4USAA 1QKZA 1IUEA 1E7PB 1C4AA 1EU4A 3V3XA 2AQ2B 2RPVA 2R61A 1CZPA 3BZDB 1DOIA 4ZOHC 1QOAA 3GB1A 1SJHD 1ZDVA 2KMMA 2KACA 4RFBA 3AEBB 3BWUD 3TEYA 1ZXIA 4RNAA 1M4VA 3LB8C 4REZA 4OHJA 4DXGA 1HZ5A 2ICIA 2WXLA 3MFGA 4NZLB 1FXIA 2BT6A 3AEGB 1NEKB 4LLGM 1JWAD 1ZXHA 4ZHOA 2L1AA 3TSSA 2INNE 3AE6B 3Q8BA 3AE9B 3BK1A 2PVOD 4GLSC 2BS3B 1L0VB 3J9CA 5G5GA 2HDEA 2J4XA 3VR8B 3BK2A 4RF0A 1N63A 5MPOA 2L52A 1I4RA 5HI1A 2KN4A 1IGDA 2H88B 4N59A 3SEBA 3EUB2 3I57A 3W5UB 4HKQA 4WIPA 2MEKA 4YWGG 2MJDA 1WGKA 3IAS1 3RFZB 2QJLA 1B1ZA 3MP9A 4MACA 2LJIA 1YN5A 2CJNA 1QT9A 3ABVB 1JWBD 1FNUA 3AE2B 5TSSA 3OWEB 4MT5A 1HQRD 1F0ZA 4N6EB 2CU3A 2WDVB 3AECB 2KAJA 2JX5A 2WXOA 1TYGB 1FD6A 4CQNA 4RGMA 2NTTA 1JALA 2JYTA 2MH7A 2I38A 4RF1A 1XXGA 1N5XA 1RM6C 1KTKA 1D5MC 2INPE 1KLGD 1FNWA 3MC0B 1FNVA 1AYFA 1XLQA 4ARCA 2LHEA 1TS4A 1IGCA 2G9HD 1SBBB 1LO5D 2L32A 4KKJA 2V0GA 2IGGA 2JXTA 4YTMB 1N61A 1NYRA 2RDGA 1UGJA 1C77A 1MVKA 1VR9A 1L6UA 5FR3A 1YJIA 3AEAB 4ZHPA 5G5HA 1QILA 1C78A 1ZDXA 4US9A 2W3SA 4YTNB 1RFKA 3NVVA 2MJ3A 3CIRB 1SF0A 2K22A 4M0WA 2K9XA 2YEPF 3FILB 1R7SA 5EE9A 1YQ4B 4DXFA 2ACZB 1VRAB 2LFIA 3AMZA 1UWXA 1FMAD 1UWMA 5HFYA 2V3NA 3URYA 2JU6X 1PYWD 1Q10A 2Y5PA 2BB5A 2D5GA 1WRIA 1V8CA 1TKEA 3TUOA 1K51A 5I4DA 3HVZA 2K3UA 4J3OD 1EU3A 3CWIA 2WU2B 3Q8FA 2N9LA 4YT0B 2K5PA 1C4CA 2PMVA 1EM7A 1YJJA 5EE0A 2LEKA 4YSXB 1VZ8A 4RGTA 1JROA 4JPSA 1MHXA 1JWUD 2GB1A 1E6EB 3H8HA 3ZJUA 1N5WA 2YEPB 2BBCA 5D7GA 4RGOS 3B2GA 3ZGZA 2Q5WD 5BYQA 1PFDA 1T6BX 4XDDA 1YQ3B 1XCQL 1FEHA 4Q2JA 1XLPA 1TY2A 4RCOA 4KGTA 2AQ1B 3TEZA 2WXJA 2PTLA 1YMHE 1ZPSA 1P7FA 3HVDA 2ZW0A 1SJED 4FXCA 2BS4B 2K0PA 2W3RA 3HRDD 4C7YA 3Q69A 1JW9D 2WNMA 2B76B 3LYYA 5HG2A 2H89B 1ZP0B 1TS2A 2JQRB 1VJKA 2ONQA 2IJ0A 3DWMA 1GB1A 3NZ3A 1AW7A 3BYYB 2NTSA 2MJEA 1GOZA 3SFEB 4HKZE 1F2RI 3P4PB 3U7ZA 1MPEA 2IDYA 1QLBB 4KGSA 2WXQA 1PGXA 1JQ4A 1P7EA 2LUMA 3P4SB 1SE3A 1V1PB 2PLPA 1DGJA 5BMHA 4A8XC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LGI A;  1XCT L;  4IKG A;  2IGG A;  1PGB A;  2JXT A;  1D4B A;  1MVK A;  1IBX B;  1MHH E;  2QMT A;  4HJG E;  1YNT E;  2J52 A;  3FIL A;  1PGA A;  2KQ4 X;  3FIL B;  2ZW1 A;  1C9F A;  2QSD A;  2ON8 A;  5BMI A;  4WH4 A;  1UWX A;  5HFY A;  1XF5 L;  2NMQ A;  2JU6 X;  1Q10 A;  1QKZ A;  3V3X A;  2RPV A;  1K53 A;  2KWD A;  3GB1 A;  1K51 A;  2KAC A;  2GI9 A;  2KDM A;  5HHD G;  1HZ5 A;  2N9L A;  1EM7 A;  2LHD A;  1FCC C;  1K50 A;  2EEL A;  5JXV A;  1MHX A;  1ZXH A;  1GB4 A;  2GB1 A;  2J53 A;  2JSV X;  4GLS C;  2JWU A;  2N7J A;  1K52 A;  1XCQ L;  4OZC A;  5HI1 A;  5BMG A;  2KN4 A;  1IGD A;  4KGT A;  4KGR A;  2IGD A;  1KH0 A;  2PTL A;  1YMH E;  1P7F A;  1JML A;  2JZP A;  2RMM A;  2ZW0 A;  3MP9 A;  4MAC A;  2K0P A;  2OED A;  4D2K A;  5HG2 A;  1HEZ E;  4OZA A;  3UI3 A;  1FCL A;  2PW9 A;  2ONQ A;  4IOI E;  1IBX A;  1FD6 A;  1GB1 A;  4OZB A;  1F2R C;  4HKZ E;  1F2R I;  1MPE A;  2I38 A;  1MI0 A;  4KGS A;  1PGX A;  1P7E A;  2N9K A;  2LUM A;  2PLP A;  1HZ6 A;  2LHE A;  2I2Y A;  5BMH A;  2IGH A;  1IGC A; 
#chains in the Genus database with same CATH topology
 4IM0 A;  1EWY C;  2JYE A;  4ITK A;  4JQW C;  2WS3 B;  2MHJ A;  4K81 A;  1PGB A;  3APD A;  2BVC A;  3VQI A;  3DVG Y;  3NVZ A;  1WZ3 A;  1F52 A;  2ZNV B;  2CKH B;  3NRZ A;  1YNT E;  3NJT A;  2C5L C;  2DZM A;  4ZYS A;  2DEN B;  4FHK A;  1WYW B;  1SE2 A;  3ZQ4 A;  1E7U A;  1WX9 A;  4W9K A;  3MJ5 A;  4JL9 A;  4XX5 A;  4C7Z A;  5C1Z A;  3AM9 A;  4TQ0 A;  2GI9 A;  4DHJ B;  2K8B A;  3R8B A;  1PUT A;  4W9G A;  4HWI B;  1OQQ A;  3PZ7 A;  5EE3 A;  4JX1 C;  5G55 A;  1ENF A;  1FCC C;  1GG3 A;  4KIK B;  1FIQ A;  3AE8 B;  2J53 A;  2ZVO A;  3AE4 B;  4HPP A;  1P98 A;  2WXN A;  2MA9 B;  1J0G A;  2NPT B;  2CHW A;  4W9D A;  2WXR A;  2O6V A;  3A1Q B;  2QDF A;  2PKO A;  4O1N A;  5AUI A;  4A55 A;  4H2A A;  2N0S B;  4BZA A;  1NVI D;  3T3N A;  2MBO A;  2JZP A;  3HM6 X;  4DK5 A;  2MX2 A;  1C76 A;  4NPN A;  1T0S C;  3RNB C;  3PZD A;  3KVF B;  4JWS C;  2BKR B;  2PIA A;  3W1S C;  1EWC A;  2J7Q B;  3TEW A;  2K8C A;  2V9H A;  2K6Q A;  3PZ8 A;  3DHI C;  2KN5 A;  4BKS A;  3BIN A;  4W9I A;  1TJE A;  2MRP A;  2DWQ A;  4IDI A;  1JCK B;  4KDI C;  3GZN I;  3FAH A;  1V97 A;  3A9J B;  4ACF A;  4OVZ A;  3RNF C;  1FRD A;  3AEE B;  3UQA A;  2BTE A;  2GRI A;  4NY0 A;  3K9O B;  3R2I A;  3RN9 C;  2J0J A;  2ASQ A;  1WM2 A;  1VDV A;  1XLN A;  1C79 A;  3HK0 A;  2KTF A;  2J52 A;  3PRP B;  2AQ3 B;  2FCQ A;  4BAX A;  2GMI C;  1JRP A;  3V61 A;  4M0W B;  2KC1 A;  2L00 B;  2M56 B;  1FO4 A;  3A4R A;  1YQB A;  2CU1 A;  4K7U A;  3RNA C;  4WUR A;  2LUE A;  1VLB A;  4BKT A;  4GSW A;  1WGD A;  5EE1 A;  3V6C B;  1V5T A;  5HHD G;  1J7C A;  1MG4 A;  1T0Y A;  3EA6 A;  3NS8 A;  4G50 A;  2JPH A;  3ML8 A;  5G2N A;  5BO4 B;  3DHH C;  4P1C C;  3TEX A;  1UF0 A;  3N30 A;  2M19 A;  4F1S A;  1TY0 A;  2JWU A;  2N7J A;  3KUZ A;  4IUM B;  4L1B A;  3B9J A;  1ET6 A;  3RNG C;  4BKG A;  2PEA A;  3N20 C;  4EKU A;  2VH2 A;  2CHZ A;  3JVZ X;  4NAM A;  4NJC A;  2LGY A;  4AQ7 A;  1GPX A;  2K1F A;  2XN9 C;  1VCB A;  2N9X A;  5D3D A;  2D3A A;  4BBN C;  1ROE A;  4HRO A;  1FCL A;  5AZH A;  4C00 A;  2WGS A;  3RUL A;  2LVP A;  1WR1 A;  5BYR A;  1L7Y A;  4P1B C;  4EZJ A;  4M01 A;  3EGR A;  3VR9 B;  1IYF A;  2IGH A;  2K39 A;  2NR2 A;  3VXW A;  2I1K A;  3FKY A;  5IP4 D;  1D4B A;  3ZXV A;  4HJG E;  3ZNH B;  3CF6 E;  2MP2 A;  3M63 B;  4WAF A;  3ZIM A;  4KX6 B;  1B9R A;  4ZDV A;  4N9F 4;  3P4Q B;  4A3O A;  1OEY J;  4B0M A;  2PVG C;  2M8S A;  1XF5 L;  4USA A;  3VFK A;  2RD0 A;  1EU4 A;  3V3X A;  1RFA A;  2R61 A;  1Q0W B;  5E6O A;  1WXV A;  1QOA A;  3GB1 A;  2KMM A;  4RFB A;  3AEB B;  4WJO A;  4WAA A;  4X57 B;  4NQK E;  2JZZ A;  4DXG A;  1HZ5 A;  4KIK A;  4BVU C;  2MBB B;  2ZPN A;  2INN E;  3AE6 B;  3CMM B;  4FA6 A;  3I63 C;  2BS3 B;  4W9F A;  5G5G A;  2NPT A;  2HDE A;  5AZF A;  2L52 A;  4AP4 C;  4B9K A;  1S3S G;  2KN4 A;  3SEB A;  1HTO A;  3IAS 1;  3ZNI D;  4NNJ B;  2QJL A;  2LJI A;  3AE2 B;  5TSS A;  1HQR D;  2KJ6 A;  1I35 A;  3ALB A;  4IG7 B;  2D07 B;  4RGM A;  2NTT A;  3DDC B;  1KTK A;  4FUL A;  1KLG D;  3A9J A;  1AYF A;  1S1Q B;  1XLQ A;  1RAX A;  4GOC A;  4ARC A;  3DHG C;  1IGC A;  2L32 A;  3RD2 A;  1UGJ A;  3NHE B;  1C77 A;  5LLI A;  1QIL A;  4US9 A;  4YTN B;  2MJ3 A;  2IND C;  2DX5 B;  2L0F A;  2GBM A;  2UU7 A;  5J18 A;  4M0W A;  2YEP F;  3FIL B;  1R7S A;  1BT0 A;  1YQ4 B;  2CHX A;  2DZK A;  2KD0 A;  3KW5 B;  1PYW D;  4M8N A;  2QCZ A;  3LDZ E;  2KT7 A;  1XQQ A;  2BB5 A;  1WRI A;  3TUO A;  4NQL B;  2M0X A;  3Q8F A;  4DHZ E;  1YJ1 A;  2PMV A;  2BYV E;  2LEK A;  4JPS A;  4YL8 A;  3V60 A;  3DBS A;  3NZS A;  4II3 B;  4HLE A;  3B2G A;  2BQQ A;  1PFD A;  4W9E A;  2KDE B;  2D10 A;  1FEH A;  2BF8 B;  1XLP A;  2GBN A;  1TY2 A;  2LJ5 A;  4RCO A;  4B6W A;  2GBJ A;  2KFK B;  1KLV A;  1YX5 B;  2PTL A;  3PTF C;  3UIN B;  3HVD A;  2ZW0 A;  1WMH B;  2V3S A;  4FXC A;  2K0P A;  4C7Y A;  1JW9 D;  2WNM A;  2B76 B;  3H7S A;  1TS2 A;  2JQR B;  1VJK A;  4GIV A;  1GB1 A;  3W1Y A;  2I1J A;  1GOZ A;  3UGB B;  4EFO A;  5CTR C;  4KGS A;  2WXQ A;  1PGX A;  4HVB A;  1P7E A;  5JZE B;  1SE3 A;  2MLB A;  3EC8 A;  2PLP A;  4KZC A;  1KRH A;  3AH7 A;  3M95 A;  3PSE B;  4G0N B;  1QOB A;  2N4F A;  1GC7 A;  2KC2 A;  3T3O A;  2IPK D;  2KWC A;  3O65 B;  2L83 A;  2FUH B;  1KLU D;  3PLV A;  3Q3N C;  1WX8 A;  1WXA A;  3AUL A;  4AS1 A;  1A70 A;  4HJK A;  1FRR A;  2FUG 1;  2N1V A;  1T3Q A;  1E10 A;  2AYO B;  1KFY B;  4PK1 A;  2L76 A;  3DCG A;  5BMI A;  3HHM A;  2XEW A;  4DDI D;  1BML C;  2IYD B;  3BVZ A;  3BYT B;  3GE8 C;  3ZDM C;  4B0E A;  3L10 B;  1RLF A;  1Z2M A;  1QOF A;  1WJU A;  1LGR A;  4GDK B;  2FNJ B;  3NUH B;  3LXF A;  3T8M A;  3SD5 A;  2JSV X;  1WRD B;  1CQV A;  1SXT A;  1GAQ B;  1I7H A;  4G11 A;  3ZUN A;  3O13 A;  4FJY A;  3GZN B;  2Z8L A;  3AE7 B;  4IWP A;  3QX1 A;  1LM8 B;  2JUO A;  2RDB C;  1DOX A;  3X0W A;  5IKC M;  2BKF A;  4KGR A;  4TKN A;  3KWV A;  4LNK A;  4DQO C;  1L2N A;  4S0R A;  4I6P A;  1TBE A;  4MM3 B;  2KLG A;  3H6N A;  4EUT A;  4XZ4 A;  3ZTD A;  3IG3 A;  1IBX A;  2LZ6 A;  4XE0 A;  2KJR A;  1R4N I;  4LJO B;  5CHV C;  1OTR B;  4RMA A;  4XGA B;  4KVG B;  2JXX A;  2MSE D;  1X1M A;  2WXG A;  2INC C;  1SE4 A;  1J7A A;  2V1Y A;  4IKG A;  2DYM A;  3PO0 A;  1FXA A;  5GXG B;  1ZUD 2;  3L16 A;  1XD3 B;  3AV8 A;  2KFJ A;  1MHH E;  1IPG A;  5T8I A;  4XWT A;  2BYT A;  3FIL A;  3Q3O C;  2DLB A;  4A9A A;  2X38 A;  3AU5 A;  2ON8 A;  4WWN A;  4RGN A;  3HUI A;  3OJ3 A;  2NMQ A;  4F8C B;  2A5U A;  4FBJ B;  2FCN A;  1C4P A;  5H8Y E;  3BVM A;  2KWD A;  3ZYY X;  3NS1 A;  2AL3 A;  3P63 A;  3Q8C A;  2M0A A;  2K25 A;  2ZJD A;  1ZE3 D;  2KDM A;  1V81 A;  3I5J C;  5C3J B;  4W9L A;  3R66 C;  2C7N B;  3ZRF A;  5IA7 A;  1FM0 D;  2MP2 B;  2LHD A;  3WA0 A;  3RCZ A;  2EEL A;  5JXV A;  1LFD A;  4PS3 A;  1VZ6 A;  2LMC A;  3BII D;  3QIJ A;  1R4M I;  2Y5B B;  2SAK A;  2DZI A;  1K8R B;  3UIP B;  4LK0 M;  1OGW A;  1E9M A;  2KFK A;  1RYJ A;  2IO1 B;  4AWJ A;  3UIO B;  4CYE A;  4RM8 A;  4JGH B;  1UGM A;  1WMH A;  3B08 A;  3VTU A;  5CX3 A;  3NVW A;  2LGX A;  3UI3 A;  1WM3 A;  2Y3A A;  4XC2 A;  2G1E A;  5KHO A;  5EDS A;  4XWW A;  1DYQ A;  1SSN A;  2J0K A;  1P3Q U;  4MGY E;  2L8J A;  2OHF A;  1MI0 A;  5BYS A;  1WYG A;  1L0X B;  4MJS B;  1WX7 A;  1Y56 A;  4UDU C;  2LGI A;  2WQY B;  4EE2 A;  2E6X A;  2DBY A;  3NY5 A;  4IWO A;  3C8Y A;  5LXH A;  4YXD B;  4MH8 A;  2CR5 A;  3N32 A;  1TKY A;  3JSV B;  2G3Q B;  4KDL B;  5L83 A;  3KUD B;  2KVR A;  2QSD A;  2RPQ A;  4R3D A;  2KWU B;  4WWM A;  1SIJ A;  2SEB D;  2MBE A;  2AQ2 B;  4C4V A;  2RPV A;  2KK8 A;  4FJV B;  4ZOH C;  3SDL C;  4BOZ B;  4GDK A;  1FXI A;  2BT6 A;  4S17 A;  2DAF A;  4LLG M;  3A33 B;  1JWA D;  4ZHO A;  2L1A A;  2N7D A;  3Q8B A;  2KXJ A;  3M3J A;  2PVO D;  4GLS C;  2Z0E B;  4CHK A;  2J4X A;  4RF0 A;  1WI0 A;  1N63 A;  1I4R A;  5HI1 A;  1Q5W B;  2H88 B;  1NDD A;  3QJZ A;  3QK0 A;  3W5U B;  3QA8 A;  4MM3 A;  4MAC A;  3GE3 C;  3VAW A;  4MSM B;  1YN5 A;  2CJN A;  3PS6 A;  4E3C A;  4IC7 B;  2CU3 A;  2GBK A;  2WDV B;  3HM3 A;  2JX5 A;  4AJW A;  2AL6 A;  4RF1 A;  1JAL A;  2MH7 A;  2HTH A;  2KAN A;  4OVV A;  1YD8 U;  3ZTC A;  3EHV A;  4ANU A;  3VUX A;  4YTM B;  1N61 A;  2FID A;  1NYR A;  5IOI A;  3DQV A;  1MVK A;  2KDI A;  2Z0D B;  5G5H A;  2D3G A;  1RFK A;  4FAD A;  3CIR B;  4XYC A;  4TV3 A;  1SF0 A;  2K9X A;  4EZL A;  5EE9 A;  2ACZ B;  2LFI A;  2LRU A;  3AMZ A;  1M94 A;  1FMA D;  5HFY A;  3R7R A;  3OG5 A;  2LGD A;  2D5G A;  2LWP A;  4HCN B;  4IM2 A;  1ISN A;  4TUU A;  5DPS A;  3VVW B;  4EOY A;  4P7I A;  5I4D A;  3HVZ A;  4DWF A;  2ZCB A;  2N9L A;  4YT0 B;  1VZ8 A;  1E8W A;  4MSQ B;  1MHX A;  2GB1 A;  3TIX A;  3H8H A;  3I3T B;  2LVO A;  2BBC A;  3ZGZ A;  1HTQ A;  1WGY A;  2Q5W D;  5BYQ A;  2KOX A;  4Q2J A;  2AQ1 B;  2YVC A;  3TL5 A;  3APF A;  4K1R B;  1P7F A;  2PJH A;  1SJE D;  3UQB A;  2KWV B;  4W9J A;  3JW0 X;  3N3K B;  3LYY A;  2V4L A;  4E74 A;  4LNF A;  5HG2 A;  1AAR A;  1NBF C;  1GNU A;  1SE9 A;  3DWM A;  3BYY B;  3ENE A;  4HCP B;  3PVL A;  4EZK A;  4HKZ E;  1JRU A;  3U7Z A;  2IO3 B;  1MPE A;  1EO6 A;  3A9K B;  4MJS A;  2KX3 A;  3P4S B;  5GMV A;  2DZJ A;  1DGJ A;  3ZNG C;  2LXC A;  5BMH A;  3L17 A;  4DBG A;  1XCT L;  3PT2 B;  1I4G A;  2WU5 B;  5CHW A;  1WXQ A;  4HK2 A;  4ZRJ A;  5D3I B;  2Z59 B;  2R2O A;  1WJ4 A;  4N58 A;  5E6J A;  1EF1 A;  1IBX B;  5DPT A;  4ZRK A;  3VH4 B;  3JSV A;  1V2Y A;  4GN1 A;  4CO7 A;  1N62 A;  1PGA A;  2KQ4 X;  4J6I A;  1E0Z A;  2HJ1 A;  1E7V A;  2LVQ A;  1NYQ A;  3ZJT A;  2WX0 A;  4ICV A;  5D6J B;  4DDG D;  4LNO A;  1UZX B;  2GOW A;  2IO0 B;  3NVY A;  2KLC A;  2WXH A;  1K53 A;  1ZGU B;  2WYQ A;  1BUI C;  1UNS A;  4DHZ B;  3W1S A;  1J7B A;  3RPF C;  1F77 A;  1CJE A;  4ARI A;  3VRA B;  1AN8 A;  1GJZ A;  1GC6 A;  2BGF A;  5JH5 C;  4IW0 A;  2EKE C;  1I4H A;  1YOV B;  4ZRI A;  3WAP A;  4P16 A;  4JWU C;  1L0Y B;  3ZJV A;  1R4N B;  1I4P A;  4MH0 E;  1BXT A;  2WDR B;  3WAN A;  1HXY D;  2WDQ B;  1UBI A;  3IAM 1;  2B3A A;  1N6Z A;  1OFF A;  1TT5 B;  4W9C A;  4HPM B;  4XDC A;  3S2A A;  3IXS A;  4YSZ B;  2VZK D;  5E6N A;  5BMG A;  4YSY B;  1G6J A;  4ZRQ A;  3PV1 A;  1V86 A;  3C19 A;  2BS2 B;  3W5V B;  2PPH A;  2NBU A;  4K7W A;  2C60 A;  3ONS A;  5AUK A;  2RMM A;  4JLC A;  3KYC D;  2NBW B;  1WFY A;  4D2K A;  2RDH A;  5C2T B;  1YN4 A;  1L6V A;  4MEM A;  4OZA A;  3VTV A;  3DBL I;  2WXI A;  3ETR A;  4F7Z A;  2KMA A;  3RI7 C;  3DBH I;  4OZB A;  1VZ7 A;  3AE5 B;  1TS3 A;  2W54 A;  2LRW A;  2FIF A;  4NAW B;  1L4Z B;  3Q3J A;  4FLH A;  2W82 A;  1TIF A;  2RSU A;  3P2B A;  2W9N A;  3APC A;  2MQJ A;  3P42 A;  3U4E G;  2D3B A;  4ZRP A;  1L5P A;  2OOB B;  1WF9 A;  1T0Q C;  1JWS D;  3R2T A;  4LDT D;  3RUI B;  4EEW A;  3X23 A;  3P4R B;  1SGH A;  5J17 A;  3PGE A;  2QHO A;  2IO2 B;  2QC8 A;  2HD5 B;  2JT4 B;  1P9D U;  3WAO A;  3RT3 B;  1JWM D;  3VH3 B;  1R4M B;  1MG8 A;  1NI2 A;  4A20 A;  3EFC A;  1MFW A;  2NBV B;  3OAW A;  4ICU A;  2VH1 A;  3N9Y C;  1FFU A;  3LJ3 A;  4L2Y A;  2L7R A;  5IN7 A;  5DCN A;  2X8X X;  3KWL A;  1RWS A;  3DVN V;  2V3P A;  2QIE B;  2WHI A;  3U30 A;  3VTW A;  3AE1 B;  3ZW3 A;  3AU4 A;  1ZW7 A;  3W2D A;  1K50 A;  1WJ6 A;  2J0M A;  4KZ0 A;  1CK1 A;  2Y5C A;  2DHZ A;  4JIO U;  2IY0 B;  1UD7 A;  3IHP C;  1TZ1 A;  3U52 E;  1K52 A;  4DHJ D;  4LTU A;  1QOG A;  4RH6 A;  4A90 A;  4C4V B;  1D6E C;  3BVG A;  3RYT A;  1XEE A;  5FK9 C;  2IGD A;  5J2R A;  1KOT A;  1Z5S B;  3ZVV A;  2HJ8 A;  1HA5 A;  1WWT A;  2IBI B;  5AZG A;  1L4D B;  3ZDT A;  3QC8 B;  3P1M A;  4C80 A;  2AEH A;  1STE A;  3RZF A;  3DOW A;  2HE7 A;  5D2M B;  1XLO A;  3Q8E A;  4NJ6 A;  4GGQ A;  1F2R C;  4TSS A;  1A5R A;  3A9K A;  1KF6 B;  2N9K A;  3AN1 A;  5H92 C;  4GMV A;  2WXP A;  3Q6B A;  4M8M A;  1HZ6 A;  2A4Z A;  2EMT A;  2NCN A;  4WQM A;  2KNB A;  3DWG C;  2ZVN A;  3PRZ A;  4KV2 A;  3SHQ A;  3V62 A;  1V6E A;  2DAJ A;  3OJ4 B;  2M4N A;  1ZOY B;  2QIL A;  4K7S A;  5D94 A;  3ZO5 B;  2VZK B;  1AWD A;  1CMX B;  4WWP A;  3L4P A;  3H7P B;  1SEB D;  3ZKJ C;  2R2Q A;  2XNA C;  1YN3 A;  1QKZ A;  1IUE A;  2KZR A;  2JF5 A;  1UEL A;  2KQS A;  2KMC A;  4AUQ C;  3EEC A;  1SJH D;  1ZDV A;  2KAC A;  3BWU D;  3TEY A;  3NOB A;  1M4V A;  4REZ A;  4OHJ A;  2D11 A;  2OJR A;  2WXL A;  1E8Y A;  4NZL B;  3AEG B;  3KYD D;  4MGI E;  2ZNV C;  3AE9 B;  2KTR B;  2M17 A;  1L0V B;  3Q2A C;  2WWZ A;  1YX6 B;  3VR8 B;  2FCS A;  2L05 A;  2MBH A;  1QZE A;  4GDL A;  4B95 A;  1IP9 A;  2XBB C;  4ANX A;  2N1W A;  3EUB 2;  2FAZ A;  1TTN A;  5E6P A;  2MEK A;  2UWQ A;  1WGK A;  1B1Z A;  1E90 A;  1FPY A;  4W9H A;  1JWB D;  2OJW A;  1FNU A;  4N6E B;  2K8H A;  5DPR A;  1WXS A;  1FD6 A;  1TYG B;  1P0R A;  4CQN A;  4NAW A;  3M62 B;  4URK A;  4WJQ A;  1RM6 C;  1FNW A;  1GUA B;  4LNN A;  3MC0 B;  1FNV A;  5KHQ A;  3DBR I;  2NVU I;  2G9H D;  1SBB B;  2MBQ A;  2KX0 A;  3PHW B;  4KKJ A;  2V0G A;  2GBR A;  2IGG A;  1HE8 A;  5CHF A;  3Q14 C;  2BPS A;  2RDG A;  2BWE S;  2ZZP B;  3HIZ A;  1L6U A;  5FR3 A;  1YJI A;  4ZHP A;  1ZDX A;  2W3S A;  4HDO A;  2KQ7 A;  2K22 A;  2L3Z A;  1VRA B;  3ZNZ B;  1UWM A;  2G45 B;  1F9J A;  3UF8 A;  3URY A;  2JU6 X;  2D3C A;  2Y5P A;  1V8C A;  4IM3 A;  1K51 A;  3B1L X;  4KSL C;  5FR6 A;  2K3U A;  3MHS D;  2WU2 B;  2YLM A;  1C4C A;  2JY6 A;  3RZW C;  1WY8 A;  5EE0 A;  4RGT A;  1JRO A;  3TJP A;  4MDK E;  3ZJU A;  2IZV B;  1V49 A;  2YEP B;  5D7G A;  4RGO S;  1T6B X;  4XDD A;  1WR6 E;  4LJP B;  4KGT A;  2WXJ A;  4AJY B;  1YMH E;  2XK5 A;  3OLM D;  2DYB A;  2O2V A;  2W3R A;  3Q69 A;  1D3Z A;  3ECI A;  1ZP0 B;  4I6N B;  2IJ0 A;  3NZ3 A;  2MJE A;  3SFE B;  1F2R I;  3P4P B;  2IDY A;  1QLB B;  3L13 A;  2M1M A;  1V1P B;  5LXI B;  1KJT A;  4A8X C;  5TR5 A;  4ASW C;  4TQ1 A;  3B0A A;  3MJW A;  1H8C A;  3CST A;  4GXB A;  2WDT B;  3IBE A;  3WAL A;  4GU2 A;  2ZCC A;  1ZKH A;  1V1O A;  3RNE C;  1WJN A;  2REX A;  1ET9 A;  1XO3 A;  1FFV A;  4MGZ E;  1WGR A;  1DOY A;  3H7P A;  3W9C B;  4TMA B;  2ZW1 A;  2N7E A;  3H1U A;  2NS5 A;  2DYO A;  2KDF B;  4OVU A;  1E8Z A;  3IT6 B;  1D5X C;  3MTN B;  1SB3 C;  4HPL B;  3QWZ B;  4L23 A;  3TCA A;  2KDB A;  1I4Q A;  1TKG A;  3RNC C;  3DVG X;  3L08 A;  2JZ3 B;  3DBL B;  2LD9 A;  3QHT A;  1WE7 A;  1EF5 A;  3DBH B;  1GB4 A;  2KTR A;  3BY4 B;  4E71 A;  1TGZ B;  5IAA C;  2GLS A;  1N60 A;  2FCM A;  1ESF A;  1EUV B;  2J42 A;  2DNF A;  3PRM B;  4OZC A;  1QQR A;  4A3P A;  2WX1 A;  1KH0 A;  2MCN B;  3QAR A;  2FBW B;  3GOE A;  2PE6 B;  4ANV A;  3WIM A;  2JVC A;  5JHB A;  4MEL A;  2WXM A;  1HEZ E;  3C0R B;  1TS5 A;  4WQO B;  2PW9 A;  3DVN U;  4IOI E;  2LGS A;  2BB6 A;  2TSS A;  2QEJ C;  3CSF A;  4C56 C;  3ML9 A;  4PT5 A;  1V5O A;  3FC4 A;  1XT9 B;  3ZXR A;  4PYZ A;  4I6L B;  3E56 A;  1UUP A;  1OQR A;  3AEF B;  3L54 A;  2WXK A;  1WIA A;  3L0W B;  3IT4 B;  4RM9 A;  1F1H A;  2O6V D;  3QAQ A;  5HKH A;  4BOS C;  3VRB B;  1YIW A;  2N9P C;  3WCQ A;  1SIF A;  2LAS A;  2JWZ A;  3MC9 A;  4WH4 A;  4HEA 1;  4AOF A;  2IY1 B;  2WXF A;  2W55 A;  3I9V 1;  2HTM E;  3AXC A;  3NZU A;  1WSP A;  2CJO A;  3B2F A;  3A1Q A;  4BKS D;  1NI3 A;  2BW2 A;  4IWQ A;  3MC8 A;  4HRS A;  4K3B A;  1TZO A;  4K3C A;  3AE3 B;  5FKA C;  1H4R A;  3N1Y C;  2RR9 A;  2WLB A;  1WH3 A;  2AX5 A;  2KYW A;  3U2S C;  2KHW B;  3U8Z A;  4KKI A;  3AI5 A;  3D32 A;  3KLS X;  1Q1O A;  1P1A A;  1NEN B;  2FE8 A;  1JML A;  3SR6 A;  2OED A;  2EKI A;  2LXA A;  1T5X D;  3V05 A;  3SFD B;  1OEY A;  4US8 A;  4GB9 A;  1FXT B;  4JE3 B;  3PRE A;  4P6V F;  4M00 A;  2D2Q A;  3KUC B;  4GDL B;  1V1P A;  1QF6 A;  2V4I B;  2BYE A;  3IFW B;  4YTP B;  3GP7 A;  2I2Y A;  2E3T A;  3MHZ A;  1RRB A;  3AED B;  4PYU A;  3KQ4 A;  4A6Q A;  1VD2 A;  2C7H A;  4FHJ A;  4HXD A;  4ANW A;  3DPD A;  1I4X A;  1E5W A;  2JRH A;  3GS2 A;  2QMT A;  5LNK 1;  4WJP A;  3E9S A;  3AB5 A;  3PPA A;  1PDX A;  4DXA B;  1ACC A;  2WP9 B;  3VDZ A;  1C9F A;  3VHT C;  4OW0 A;  3NG0 A;  3EFU A;  1I42 A;  1D5Z C;  3Q8A A;  3U7D A;  1MJD A;  1UBQ A;  1E7P B;  1C4A A;  1CZP A;  3BZD B;  1DOI A;  2KVZ A;  1ZXI A;  4RNA A;  3LB8 C;  2ICI A;  2AWT A;  2EMS A;  4BFR A;  3MFG A;  1NEK B;  3R7Q A;  3PHX B;  1ZXH A;  3TSS A;  2JRI B;  3BK1 A;  1WGH A;  5L95 C;  3J9C A;  5JHA A;  4G3X B;  1V9J A;  3N1X C;  3BK2 A;  3N1Z C;  2KJH B;  5MPO A;  2UYZ B;  5IO9 A;  3DBR B;  1J19 A;  2O6V B;  1IGD A;  4N59 A;  4FJZ A;  5DPW A;  3I57 A;  4HKQ A;  4WIP A;  2C9W B;  3QCA A;  4YWG G;  2MJD A;  3RFZ B;  3MP9 A;  1QT9 A;  2ZEQ A;  3ABV B;  3OWE B;  1OQY A;  4MT5 A;  1LXD A;  1F0Z A;  3VUY A;  3KH0 A;  4KSK C;  3ZRC A;  3AEC B;  2KAJ A;  2WXO A;  4LNI A;  3TMP B;  3Q3M C;  1WGG A;  3IVF A;  3VUW A;  2JYT A;  2L0T A;  2I38 A;  1XXG A;  1N5X A;  1D5M C;  1UH6 A;  2INP E;  2LHE A;  2XK5 B;  2BWF A;  1TS4 A;  3H9D A;  2O2V B;  1LO5 D;  4II2 B;  2G4D B;  1T0R C;  2JXT A;  1Y8R C;  4BBN F;  3SU8 X;  1VR9 A;  3AEA B;  1PQS A;  1C78 A;  3NVV A;  3WAM A;  2KKC A;  1WE6 A;  4DXF A;  1C3T A;  1UWX A;  5AEK B;  2V3N A;  1Q10 A;  1C1Y B;  4NJ7 A;  3RMK C;  2K6D B;  1TKE A;  4WWO A;  1V80 A;  2CS4 A;  2PE9 A;  4QAY A;  4J3O D;  1EU3 A;  4PS8 A;  2LI5 A;  3CWI A;  4WJN A;  4FN2 A;  2MWS B;  2K5P A;  1EM7 A;  1YJJ A;  4YSX B;  2G4S A;  1J8C A;  1JWU D;  2KO3 A;  2MW5 A;  4MGK E;  3Q3F A;  1E6E B;  1N5W A;  1YQ3 B;  1XCQ L;  2BYF A;  3K9P B;  1WZ0 A;  2RGF A;  3JYU A;  4M02 A;  3TBL D;  1E8X A;  1LQB A;  3TEZ A;  2N9E B;  1ZPS A;  1KM7 A;  2BS4 B;  3HRD D;  4LCD E;  1WXM A;  2H89 B;  3ZLZ A;  2VRR B;  2ONQ A;  1AW7 A;  2NTS A;  3V6E B;  2ZPY A;  4PS7 A;  3R3M A;  4HDQ A;  4LDT B;  3QQ8 B;  1JQ4 A;  4ZYN A;  2LUM A;  3T9L A;  1U4A A;  5C23 A;  3PLU A;  2C7M B;  3A4S C; 
#chains in the Genus database with same CATH homology
 1KRH A;  3AH7 A;  4TQ1 A;  1EWY C;  1QOB A;  1XCT L;  2JYE A;  4ITK A;  1I4G A;  2WS3 B;  2WU5 B;  1PGB A;  1WXQ A;  3T3O A;  2IPK D;  5D3I B;  3VQI A;  2L83 A;  3NVZ A;  1KLU D;  4N58 A;  5E6J A;  1IBX B;  1V1O A;  3NRZ A;  1ET9 A;  1N62 A;  1YNT E;  4AS1 A;  1PGA A;  1A70 A;  2KQ4 X;  1FRR A;  1FFV A;  1XO3 A;  4ZYS A;  2FUG 1;  1DOY A;  1E0Z A;  1T3Q A;  1E10 A;  3W9C B;  1KFY B;  1SE2 A;  4TMA B;  2ZW1 A;  3ZQ4 A;  1NYQ A;  5BMI A;  3ZJT A;  3MJ5 A;  2DYO A;  4C7Z A;  3IT6 B;  3NVY A;  3AM9 A;  4TQ0 A;  1D5X C;  1SB3 C;  2WXH A;  1K53 A;  1BML C;  3BVZ A;  1BUI C;  1UNS A;  3BYT B;  4L23 A;  2GI9 A;  3W1S A;  1J7B A;  1I4Q A;  3R8B A;  1PUT A;  4B0E A;  1TKG A;  3RPF C;  1F77 A;  1CJE A;  1OQQ A;  1QOF A;  3PZ7 A;  4ARI A;  3VRA B;  1AN8 A;  5EE3 A;  4JX1 C;  1ENF A;  1FCC C;  1I4H A;  4GDK B;  1FIQ A;  3NUH B;  3LXF A;  4P16 A;  1GB4 A;  4JWU C;  3AE8 B;  1L0Y B;  2J53 A;  2JSV X;  3ZJV A;  3AE4 B;  1CQV A;  1SXT A;  1GAQ B;  1I7H A;  1I4P A;  1BXT A;  2WDR B;  1HXY D;  2WDQ B;  2WXN A;  1N60 A;  3IAM 1;  3O13 A;  1ESF A;  2Z8L A;  3AE7 B;  1OFF A;  2J42 A;  2WXR A;  1DOX A;  4OZC A;  4XDC A;  3IXS A;  4YSZ B;  2VZK D;  2PKO A;  1QQR A;  4O1N A;  5BMG A;  4YSY B;  5AUI A;  4KGR A;  4A55 A;  4ZRQ A;  1KH0 A;  3KWV A;  2BS2 B;  4H2A A;  3W5V B;  2N0S B;  2FBW B;  4DQO C;  5AUK A;  1NVI D;  3T3N A;  2JZP A;  2RMM A;  1C76 A;  4MM3 B;  4JWS C;  2WXM A;  4D2K A;  2PIA A;  2RDH A;  5C2T B;  1HEZ E;  1YN4 A;  1L6V A;  4OZA A;  1EWC A;  1TS5 A;  2PW9 A;  3TEW A;  4IOI E;  2WXI A;  3ETR A;  1IBX A;  2BB6 A;  2TSS A;  4XE0 A;  4OZB A;  2QEJ C;  1VZ7 A;  3AE5 B;  3PZ8 A;  4C56 C;  1TS3 A;  4PT5 A;  2W54 A;  3FC4 A;  1TJE A;  2DWQ A;  4IDI A;  4NAW B;  1JCK B;  1L4Z B;  3E56 A;  2W82 A;  3FAH A;  1V97 A;  1UUP A;  4OVZ A;  1FRD A;  3AEE B;  1OQR A;  3AEF B;  3P42 A;  3U4E G;  2WXG A;  4ZRP A;  1L5P A;  2WXK A;  2BTE A;  1SE4 A;  1J7A A;  2GRI A;  4IKG A;  1JWS D;  3R2T A;  2DYM A;  3PO0 A;  1FXA A;  3IT4 B;  5GXG B;  3R2I A;  1ZUD 2;  3AV8 A;  3P4R B;  1MHH E;  1VDV A;  1XLN A;  3VRB B;  1C79 A;  5T8I A;  4XWT A;  2BYT A;  2J52 A;  3FIL A;  2AQ3 B;  1JRP A;  1JWM D;  3WCQ A;  2DLB A;  4A9A A;  2X38 A;  2ON8 A;  2M56 B;  4WH4 A;  4RGN A;  3HUI A;  1FO4 A;  4HEA 1;  2NMQ A;  2WXF A;  2W55 A;  3I9V 1;  2HTM E;  1C4P A;  3N9Y C;  1FFU A;  4WUR A;  1WSP A;  2CJO A;  5H8Y E;  3B2F A;  3BVM A;  1VLB A;  4L2Y A;  2KWD A;  3ZYY X;  3NS1 A;  1NI3 A;  2BW2 A;  3KWL A;  1RWS A;  3P63 A;  3Q8C A;  5EE1 A;  2M0A A;  1ZE3 D;  2KDM A;  4HRS A;  5HHD G;  2V3P A;  1J7C A;  1TZO A;  2QIE B;  5C3J B;  3EA6 A;  3AE1 B;  1FM0 D;  2LHD A;  3AE3 B;  1K50 A;  2EEL A;  5FKA C;  3TEX A;  3W2D A;  5JXV A;  1CK1 A;  2Y5C A;  2M19 A;  2WLB A;  1VZ6 A;  1TY0 A;  2AX5 A;  2JWU A;  2LMC A;  2N7J A;  3BII D;  3U52 E;  1K52 A;  4LTU A;  2SAK A;  1QOG A;  4RH6 A;  4A90 A;  1D6E C;  3BVG A;  4LK0 M;  4L1B A;  3B9J A;  1XEE A;  3U2S C;  1E9M A;  4KKI A;  1ET6 A;  1RYJ A;  5FK9 C;  2IGD A;  3KLS X;  4NAM A;  1NEN B;  2FE8 A;  4NJC A;  1JML A;  1HA5 A;  1WWT A;  3SR6 A;  4AQ7 A;  1GPX A;  1L4D B;  2OED A;  2XN9 C;  2EKI A;  5D3D A;  1T5X D;  3NVW A;  3V05 A;  3P1M A;  3UI3 A;  1ROE A;  4HRO A;  4C80 A;  1FCL A;  3SFD B;  1STE A;  2Y3A A;  4US8 A;  2G1E A;  4JE3 B;  4XWW A;  5BYR A;  1XLO A;  4P6V F;  3Q8E A;  1DYQ A;  1SSN A;  1F2R C;  4TSS A;  2OHF A;  1MI0 A;  1KF6 B;  5BYS A;  4GDL B;  1V1P A;  1WYG A;  1QF6 A;  2N9K A;  3AN1 A;  5H92 C;  1L0X B;  2V4I B;  2WXP A;  3EGR A;  3VR9 B;  1HZ6 A;  4YTP B;  3GP7 A;  2I2Y A;  2IGH A;  2E3T A;  1Y56 A;  3MHZ A;  4UDU C;  3AED B;  2LGI A;  2WQY B;  3KQ4 A;  4WQM A;  3DWG C;  4EE2 A;  2E6X A;  4A6Q A;  2DBY A;  3C8Y A;  1D4B A;  1I4X A;  4YXD B;  4MH8 A;  3GS2 A;  2QMT A;  5LNK 1;  4HJG E;  1ZOY B;  1TKY A;  3E9S A;  3AB5 A;  2QIL A;  4WAF A;  4KX6 B;  2VZK B;  1AWD A;  1B9R A;  1PDX A;  1ACC A;  2WP9 B;  3L4P A;  1C9F A;  2QSD A;  3P4Q B;  4R3D A;  4B0M A;  1SEB D;  4OW0 A;  4WWM A;  1D5Z C;  1SIJ A;  2PVG C;  2XNA C;  3Q8A A;  1YN3 A;  2SEB D;  1XF5 L;  4USA A;  1QKZ A;  1IUE A;  1E7P B;  1C4A A;  1EU4 A;  3V3X A;  2AQ2 B;  2RPV A;  2R61 A;  1CZP A;  3BZD B;  1DOI A;  4ZOH C;  1QOA A;  3GB1 A;  1SJH D;  1ZDV A;  2KMM A;  2KAC A;  4RFB A;  3AEB B;  3BWU D;  3TEY A;  1ZXI A;  4RNA A;  1M4V A;  3LB8 C;  4REZ A;  4OHJ A;  4DXG A;  1HZ5 A;  2ICI A;  2WXL A;  3MFG A;  4NZL B;  1FXI A;  2BT6 A;  3AEG B;  1NEK B;  4LLG M;  1JWA D;  1ZXH A;  4ZHO A;  2L1A A;  3TSS A;  2INN E;  3AE6 B;  3Q8B A;  3AE9 B;  3BK1 A;  2PVO D;  4GLS C;  2BS3 B;  1L0V B;  3J9C A;  5G5G A;  2HDE A;  2J4X A;  3VR8 B;  3BK2 A;  4RF0 A;  1N63 A;  5MPO A;  2L52 A;  1I4R A;  5HI1 A;  2KN4 A;  1IGD A;  2H88 B;  4N59 A;  3SEB A;  3EUB 2;  3I57 A;  3W5U B;  4HKQ A;  4WIP A;  2MEK A;  4YWG G;  2MJD A;  1WGK A;  3IAS 1;  3RFZ B;  2QJL A;  1B1Z A;  3MP9 A;  4MAC A;  2LJI A;  1YN5 A;  2CJN A;  1QT9 A;  3ABV B;  1JWB D;  1FNU A;  3AE2 B;  5TSS A;  3OWE B;  4MT5 A;  1HQR D;  1F0Z A;  4N6E B;  2CU3 A;  2WDV B;  3AEC B;  2KAJ A;  2JX5 A;  2WXO A;  1TYG B;  1FD6 A;  4CQN A;  4RGM A;  2NTT A;  1JAL A;  2JYT A;  2MH7 A;  2I38 A;  4RF1 A;  1XXG A;  1N5X A;  1RM6 C;  1KTK A;  1D5M C;  2INP E;  1KLG D;  1FNW A;  3MC0 B;  1FNV A;  1AYF A;  1XLQ A;  4ARC A;  2LHE A;  1TS4 A;  1IGC A;  2G9H D;  1SBB B;  1LO5 D;  2L32 A;  4KKJ A;  2V0G A;  2IGG A;  2JXT A;  4YTM B;  1N61 A;  1NYR A;  2RDG A;  1UGJ A;  1C77 A;  1MVK A;  1VR9 A;  1L6U A;  5FR3 A;  1YJI A;  3AEA B;  4ZHP A;  5G5H A;  1QIL A;  1C78 A;  1ZDX A;  4US9 A;  2W3S A;  4YTN B;  1RFK A;  3NVV A;  2MJ3 A;  3CIR B;  1SF0 A;  2K22 A;  4M0W A;  2K9X A;  2YEP F;  3FIL B;  1R7S A;  5EE9 A;  1YQ4 B;  4DXF A;  2ACZ B;  1VRA B;  2LFI A;  3AMZ A;  1UWX A;  1FMA D;  1UWM A;  5HFY A;  2V3N A;  3URY A;  2JU6 X;  1PYW D;  1Q10 A;  2Y5P A;  2BB5 A;  2D5G A;  1WRI A;  1V8C A;  1TKE A;  3TUO A;  1K51 A;  5I4D A;  3HVZ A;  2K3U A;  4J3O D;  1EU3 A;  3CWI A;  2WU2 B;  3Q8F A;  2N9L A;  4YT0 B;  2K5P A;  1C4C A;  2PMV A;  1EM7 A;  1YJJ A;  5EE0 A;  2LEK A;  4YSX B;  1VZ8 A;  4RGT A;  1JRO A;  4JPS A;  1MHX A;  1JWU D;  2GB1 A;  1E6E B;  3H8H A;  3ZJU A;  1N5W A;  2YEP B;  2BBC A;  5D7G A;  4RGO S;  3B2G A;  3ZGZ A;  2Q5W D;  5BYQ A;  1PFD A;  1T6B X;  4XDD A;  1YQ3 B;  1XCQ L;  1FEH A;  4Q2J A;  1XLP A;  1TY2 A;  4RCO A;  4KGT A;  2AQ1 B;  3TEZ A;  2WXJ A;  2PTL A;  1YMH E;  1ZPS A;  1P7F A;  3HVD A;  2ZW0 A;  1SJE D;  4FXC A;  2BS4 B;  2K0P A;  2W3R A;  3HRD D;  4C7Y A;  3Q69 A;  1JW9 D;  2WNM A;  2B76 B;  3LYY A;  5HG2 A;  2H89 B;  1ZP0 B;  1TS2 A;  2JQR B;  1VJK A;  2ONQ A;  2IJ0 A;  3DWM A;  1GB1 A;  3NZ3 A;  1AW7 A;  3BYY B;  2NTS A;  2MJE A;  1GOZ A;  3SFE B;  4HKZ E;  1F2R I;  3P4P B;  3U7Z A;  1MPE A;  2IDY A;  1QLB B;  4KGS A;  2WXQ A;  1PGX A;  1JQ4 A;  1P7E A;  2LUM A;  3P4S B;  1SE3 A;  1V1P B;  2PLP A;  1DGJ A;  5BMH A;  4A8X C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...