3GB1A

Structures of b1 domain of streptococcal protein g
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
56
structure length
56
Chain Sequence
MTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Improving the Packing and Accuracy of NMR Structures with a Pseudopotential for the Radius of Gyration
pubmed doi rcsb
source organism Streptococcus sp. 'group g'
molecule tags Immunoglobulin binding protein
molecule keywords PROTEIN (B1 DOMAIN OF STREPTOCOCCAL PROTEIN G)
total genus 12
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 1999-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3gb1A00
2JU6X 4OZAA 1YMHE 2KQ4X 2OEDA 5HHDG 1QKZA 1JMLA 2QSDA 1P7FA 4KGSA 1YNTE 1PGBA 2K0PA 1FD6A 2QMTA 5BMIA 2J52A 1XF5L 1MI0A 3FILB 2IGHA 4MACA 2LUMA 2ON8A 2KACA 2JZPA 1Q10A 2ZW1A 1UWXA 2KN4A 2I38A 2LHEA 1K52A 3GB1A 1P7EA 4HKZE 1K51A 4GLSC 1HEZE 1C9FA 1HZ6A 1K53A 1GB4A 1F2RI 1IBXA 1F2RC 4D2KA 1K50A 2J53A 5BMHA 1MVKA 2ZW0A 5HI1A 2EELA 2LGIA 1MHXA 2NMQA 5JXVA 4OZBA 2IGGA 1MPEA 1FCCC 4WH4A 1D4BA 1IBXB 2GB1A 2ONQA 2I2YA 3UI3A 2GI9A 2KWDA 4IKGA 4HJGE 1EM7A 1XCQL 1PGXA 1IGCA 4KGRA 2N7JA 1KH0A 2RPVA 2RMMA 1PGAA 5HFYA 3FILA 2KDMA 2JXTA 2JSVX 1IGDA 2N9LA 1FCLA 2N9KA 1HZ5A 5BMGA 2PW9A 2IGDA 1XCTL 3MP9A 2JWUA 1MHHE 2LHDA 5HG2A 1ZXHA 1GB1A 2PTLA 4IOIE 2PLPA 4OZCA 4KGTA 3V3XA
chains in the Genus database with same CATH superfamily
1SEBD 1WYGA 4NAWB 3HIZA 2RDBC 2O2VB 3ZJTA 4IDIA 3TJPA 2OEDA 2L32A 1E7UA 4KKJA 1YNTE 2W3SA 3DPDA 1JW9D 1TJEA 3BK1A 2BYVE 4K81A 3WAPA 2D07B 1XT9B 2KFJA 1WGHA 1N5XA 3JYUA 3DQVA 1WX9A 4NAMA 1KFYB 2CHZA 4KZ0A 2WXKA 1VZ8A 1WFYA 2KLGA 3NS1A 1TS3A 3Q3NC 1HZ6A 3V62A 1IBXA 2NPTB 3AECB 3HM6X 1WGGA 2GLSA 3Q8BA 1FXAA 4DQOC 3C0RB 1I4GA 5BYQA 1N6ZA 2FCSA 1V1PB 4WH4A 4USAA 2UU7A 3JSVB 1N63A 1V86A 4XDDA 3P63A 4NZLB 1AARA 4DHZB 4K1RB 3AM9A 1GUAB 3RNGC 3Q3FA 4GMVA 3NZUA 3BYYB 2FE8A 4REZA 2LGSA 2Y3AA 2WDVB 3K9OB 1UELA 1GC7A 3TL5A 2CR5A 1S3SG 3SR6A 4M8MA 2WLBA 3HK0A 2QEJC 4W9CA 4YTMB 4A3PA 4BOZB 1QZEA 2HD5B 3MC9A 3WANA 2WWZA 1KF6B 3JSVA 4J6IA 1FO4A 1HXYD 3P4QB 1DOIA 2YEPB 3P4SB 4PYUA 4X57B 1VD2A 4UDUC 1QKZA 3H7SA 2R2QA 1P3QU 2TSSA 2XEWA 3EECA 4GDKB 2BKFA 1TYGB 4RMAA 4YL8A 4ZRPA 5C23A 4LNFA 2FCMA 4BAXA 3PZ8A 2WU2B 3AI5A 4XWTA 2NBUA 3QC8B 4NPNA 2ZPYA 4MSMB 4W9HA 4E74A 2EKIA 1AYFA 2V0GA 3AU4A 1ZOYB 2HJ8A 3VHTC 2DYMA 2KX3A 3DHIC 2IY0B 3ZW3A 1DOYA 4ARCA 5BMHA 4II3B 1EWCA 1WJNA 2WXIA 3KH0A 1MHXA 2Z8LA 5G55A 3UINB 3NVWA 1CJEA 1FCCC 1TKYA 3VUWA 3KUZA 2FNJB 2NTTA 3QX1A 3K9PB 3ZNZB 3IFWB 3ZDTA 2H88B 3Q2AC 2KWDA 2YVCA 3IAM1 1YQ4B 5H8YE 3UGBB 2BS3B 2BBCA 1J8CA 1TZOA 4US8A 1D5MC 3L10B 1T5XD 3ZYYX 2MEKA 1PGAA 2M4NA 3AE8B 1ZXIA 3JVZX 1JRPA 3RNCC 1OEYJ 3KUDB 3NJTA 2G4DB 3AE9B 2MSED 1UD7A 2N9KA 2WXOA 1QOGA 2D2QA 1R4NI 1WYWB 1DYQA 4LDTD 3Q6BA 1L2NA 2JWUA 3LB8C 2DBYA 2HJ1A 2VZKB 3L17A 4KIKB 3LXFA 5GXGB 3TEZA 1YQBA 3V60A 3CMMB 1WM3A 2JX5A 2N1VA 3PHXB 3AEAB 1WE7A 1XLPA 1EWYC 2KVZA 2HTHA 3U30A 1S1QB 1TS4A 2W9NA 3FC4A 3L54A 2KTFA 1RYJA 3RN9C 2J52A 5FR6A 1TKEA 4AOFA 3I63C 1FNWA 2V3PA 3OAWA 4TMAB 2KANA 3J9CA 2FCNA 2WYQA 1G6JA 1WZ0A 4A90A 4GSWA 1XQQA 3RZFA 2CHXA 3DVGY 1RFAA 1AWDA 3KYCD 3B2FA 3VH3B 2PJHA 1WSPA 4MSQB 3IBEA 3IVFA 5KHQA 3TBLD 4HCPB 5BYRA 2MW5A 2MJDA 2LGIA 4KVGB 3OWEB 2KO3A 3SD5A 4MH8A 2BF8B 2JXXA 1LGRA 2ACZB 5AEKB 1IUEA 3NVYA 1N61A 3DVNU 4MGZE 2KLCA 1VZ7A 2LWPA 4ZDVA 1PDXA 2LXCA 4ICUA 5LNK1 3NS8A 4FULA 3X23A 4IKGA 3L08A 4WURA 2V4LA 1V1OA 1PGXA 1CZPA 2ZJDA 2EKEC 4IWQA 4EZKA 1BUIC 2MHJA 1Z2MA 3DDCB 4W9LA 3KUCB 4YWGG 2OJRA 3RPFC 1TS2A 3PT2B 4IWOA 4P1BC 1T0SC 5D7GA 4ARIA 2VRRB 3SU8X 4ZRKA 1E8WA 4OVZA 4K3BA 4I6NB 1ZW7A 1IYFA 3ECIA 1T0RC 2ZCCA 1J0GA 3GZNI 1L5PA 2IBIB 3KYDD 5DPSA 2K1FA 5LXHA 3R7QA 2L0FA 1TBEA 1YMHE 3FKYA 1XEEA 1F77A 5G2NA 2N4FA 1ZDVA 4AWJA 2Q5WD 4KIKA 4IW0A 1WIAA 4N9F4 1JWSD 2C7HA 2L83A 4RGOS 3QA8A 3AEDB 1UWMA 4L2YA 3APFA 3APCA 4L1BA 2I38A 5IO9A 2RPQA 3CSFA 2D3AA 3GB1A 2L1AA 3BIID 3VDZA 5AUIA 3B1LX 2QC8A 3CWIA 2MP2B 5CTRC 3RNEC 2KFKB 4RCOA 3OG5A 2KKCA 3MJ5A 2L76A 1MVKA 2K5PA 2AQ2B 3EC8A 3MC8A 3N3KB 5D3IB 2V3NA 1WY8A 2GOWA 2XK5A 3NHEB 4MT5A 2MQJA 3PTFC 4ACFA 1I4XA 2INDC 3TEYA 1I4PA 3H7PA 2INPE 1WGYA 3GS2A 2W3RA 3ZRCA 1YX6B 2NBVB 4URKA 2RPVA 1WE6A 4F1SA 1IGDA 3KQ4A 1R4MI 2MBOA 1WR6E 4M02A 2LGXA 4HEA1 5J2RA 2CKHB 5D2MB 3MTNB 4W9DA 2JYEA 2AX5A 5LLIA 4G0NB 1YQ3B 4JIOU 3ZXRA 2MBEA 5HG2A 1I4RA 5EE0A 2Z59B 3W1SC 4IWPA 5L95C 1VJKA 1WGDA 3VTWA 1Q5WB 3H7PB 2CJOA 1IPGA 2HTME 2WDQB 2ZVOA 5DCNA 2D5GA 1WGKA 4KX6B 2W82A 1MI0A 4MACA 1JALA 2C5LC 2WXLA 3JW0X 4CQNA 1VZ6A 1F52A 2K3UA 1K52A 3IXSA 4YTNB 4WAFA 4HKZE 1K51A 1C4PA 3AV8A 3ABVB 3UQBA 2V3SA 3R2TA 4HVBA 1NENB 2KC2A 2MRPA 4TUUA 1GB4A 1SB3C 2J0MA 2PKOA 2PVGC 3C8YA 5EE3A 3Q3JA 1NBFC 2JY6A 4EEWA 4FJVB 2DLBA 4ZHPA 3AE5B 1WRIA 2KNBA 1KLUD 3DBSA 1VRAB 2OOBB 4B6WA 3EGRA 5TR5A 2DZIA 1D5ZC 3BVMA 4KV2A 3PZDA 4C7YA 2CS4A 4KDLB 3NY5A 4P16A 2I2YA 1E9MA 1FIQA 3CIRB 1V8CA 1SBBB 1SXTA 4GDKA 4WWPA 2LI5A 4FADA 2CU1A 4PYZA 5C3JB 3DBLI 2KDFB 3C19A 4WQMA 1DOXA 2PVOD 4K7SA 2BS4B 3T9LA 2L05A 1NI3A 1YJIA 2VZKD 4IM2A 4K7WA 2IY1B 5JHBA 2I1JA 3BY4B 4GOCA 4NNJB 2K25A 3AXCA 1JWMD 4LNIA 1TZ1A 1E8ZA 2LGYA 4G3XB 2DAFA 3DOWA 3W9CB 2L3ZA 3P42A 3ZNHB 1NYRA 3L4PA 1TY0A 2FBWB 4E71A 2BYEA 2KDBA 1A5RA 2G3QB 1C1YB 3RI7C 3DBHI 2QSDA 2V9HA 4GN1A 3MHZA 4HXDA 3TEWA 1WH3A 3P2BA 3A9KB 2B3AA 4L23A 1V5TA 1OTRB 3DCGA 2PE9A 4ASWC 1FEHA 4MM3B 1M4VA 2REXA 3KWVA 4XGAB 2GBMA 1PYWD 4GLSC 4C7ZA 3VR8B 4XDCA 2KXJA 2AQ1B 3DWGC 1P98A 2E6XA 2AL3A 3RFZB 2L00B 4FBJB 4BZAA 3U7DA 4FXCA 5GMVA 2NMQA 5I4DA 4US9A 2WXGA 4TKNA 1YJ1A 2M0AA 3A9KA 1E0ZA 3DBRB 1ET6A 3RZWC 4LTUA 3URYA 2RMMA 3H9DA 2UYZB 1L0YB 1GOZA 3KW5B 2W54A 3DVGX 4JQWC 1JRUA 1HQRD 3ZQ4A 5IAAC 1MFWA 2MH7A 3MFGA 4B9KA 1SE2A 1UGMA 3OJ4B 4HCNB 3TEXA 3WAOA 1YOVB 3ZIMA 2JPHA 2LEKA 1NDDA 1LQBA 4YSXB 1JWUD 4IM0A 4M01A 4C4VB 3Q69A 3V3XA 2YLMA 4FLHA 2PE6B 2JRIB 1ROEA 3Q8FA 2A5UA 3GE8C 5T8IA 4KGSA 3ZKJC 1I35A 3WCQA 2K6QA 2L0TA 3NUHB 4RGTA 1XXGA 2IGHA 2KACA 2JZPA 4LDTB 2QIEB 3P4RB 4A6QA 2D3CA 1XLOA 3W5UB 1OQYA 1C77A 4EE2A 2DYBA 2LD9A 3WIMA 2ZEQA 2J4XA 2K9XA 2L7RA 4DDGD 2KN5A 2JWZA 3RULA 2DWQA 3P4PB 1TS5A 1HTQA 3RYTA 4M00A 2JUOA 4MDKE 1V49A 3AB5A 3V61A 2JYTA 2NTSA 2GB1A 4DBGA 2IPKD 5C2TB 1TTNA 3BZDB 1GNUA 2L52A 1SIFA 4AJWA 4II2B 2QDFA 3M95A 1UNSA 4TV3A 2JXTA 2MLBA 3RUIB 3OJ3A 1FCLA 2K22A 2KZRA 5BMGA 4ITKA 3HVZA 3NG0A 5C1ZA 2LFIA 5IKCM 1QF6A 3ML8A 2M0XA 3DBLB 3N1ZC 5BYSA 3A9JB 1B1ZA 4NQLB 4W9FA 4C56C 4FHJA 4YT0B 3HUIA 1E7PB 3Q8CA 5E6OA 3W2DA 3IT4B 3I3TB 5J18A 2KWUB 4RH6A 3VRBB 1P1AA 2JQRB 4HJKA 4AJYB 1L4DB 3P1MA 2RR9A 3S2AA 2BW2A 4KZCA 5JH5C 2KN4A 3SHQA 2RDGA 4ANXA 3U4EG 2DZKA 3ENEA 2ZZPB 3DBHB 4JPSA 4XC2A 3QIJA 2C60A 2KX0A 4W9JA 4R3DA 1GPXA 3NVVA 4DXAB 4HLEA 1FXTB 3QK0A 4Q2JA 4WJOA 1H8CA 3IAS1 1GAQB 1QOFA 2GMIC 2LRWA 1SGHA 3SFEB 4RGNA 2LZ6A 1CMXB 4NJCA 2NPTA 3B9JA 2IZVB 1AW7A 3PPAA 3N9YC 4MJSA 3UI3A 4TQ0A 1MG8A 1UF0A 3PO0A 1J19A 1EM7A 3AE6B 1EO6A 2LVQA 3GP7A 4YXDB 1FXIA 1XD3B 1V1PA 2K39A 4YSYB 3BVGA 4B95A 4B0EA 4W9KA 3VUYA 1SE3A 2WXNA 4W9EA 3W5VB 1HA5A 2JRHA 4XX5A 1XCTL 1X1MA 2KOXA 4N6EB 4FA6A 3BWUD 1OGWA 5AUKA 3VTUA 2LGDA 2WS3B 4IOIE 4OZCA 1V2YA 2IJ0A 1WI0A 2M8SA 1Q0WB 1N60A 4OZAA 2LASA 1JQ4A 1C79A 1TIFA 1P7FA 3W1SA 4OW0A 3MJWA 3A4RA 4KDIC 4LJPB 3T3OA 4E3CA 2CHWA 2DZJA 3T8MA 2LMCA 4DK5A 2LHEA 3ZVVA 4K3CA 1V5OA 2DX5B 4P1CC 1HEZE 1CK1A 2EMSA 2VH2A 2MBQA 4EZJA 5E6NA 3NVZA 4WJQA 3KLSX 5HKHA 2WDRB 3ML9A 4D2KA 1T6BX 3VH4B 2H89B 4TQ1A 1JROA 4GB9A 2EELA 4GDLA 1RWSA 3GE3C 2DHZA 2HDEA 3ZJVA 2O6VB 2BYTA 3RNFC 1D5XC 3VVWB 1L6UA 3AE4B 3ZUNA 3AE1B 2D3BA 1LFDA 3TMPB 1C76A 1WXAA 1Z5SB 2ZCBA 3TSSA 2KJ6A 2GRIA 4IC7B 2WX1A 2KDMA 2JSVX 2PPHA 4J3OD 1V9JA 2N9LA 2V1YA 1FPYA 2QHOA 4BFRA 1C4AA 1SSNA 1RLFA 2LJ5A 2RSUA 3AE2B 2PW9A 4JX1C 1HE8A 3A33B 2LHDA 2M1MA 3HRDD 4JE3B 4PS3A 2O6VA 3V6EB 2FUG1 4JL9A 4KGTA 2BWFA 2WXMA 3DWMA 2BWES 2C7NB 3SFDB 1MJDA 4GXBA 4OHJA 1SE9A 4MGIE 4CYEA 4NJ6A 4A55A 1QOBA 1V97A 1JWAD 4FJZA 3FILB 3O65B 2ASQA 3U8ZA 3AEFB 4WJPA 5H92C 2AEHA 4BBNC 2ZW1A 5DPWA 2NS5A 3HM3A 4KKIA 1R4MB 4XZ4A 1CQVA 2LVPA 1KTKA 4GDLB 4WWMA 3W1YA 1C9FA 4FN2A 1QLBB 2LRUA 3EHVA 3UF8A 2KMAA 4M0WA 5IA7A 3DBRI 3RNAC 2KDEB 1KRHA 1K50A 2LUEA 3PRPB 4EKUA 1YN4A 5IP4D 1MPEA 2O6VD 4PS7A 3NZ3A 3PVLA 2WU5B 5CHVC 3Q14C 3T3NA 4AP4C 4WQOB 4LCDE 2NVUI 1KJTA 3L0WB 4JWUC 1TY2A 4MELA 3ZNID 4MM3A 5G5GA 3LDZE 3VFKA 1FFVA 4RGMA 3UIPB 4FJYA 3N20C 4BKSA 2BKRB 1OEYA 4N58A 1L6VA 2MBHA 5FK9C 1EF5A 1AN8A 4ZOHC 2JF5A 1OQRA 4JLCA 3ZTCA 4RNAA 3BVZA 4PT5A 3EFUA 1ZXHA 3D32A 3MC0B 2KQ7A 1YD8U 3U2SC 2HE7A 4O1NA 2IYDB 4LNNA 3R66C 5AZHA 4A9AA 2K0PA 1STEA 2BGFA 4ZRIA 4YSZB 2N9PC 1I4HA 4BOSC 2Y5CA 4BKGA 2CU3A 1L7YA 2WP9B 3A1QA 1PUTA 3RCZA 4EUTA 1F9JA 2KDIA 3H1UA 3AULA 5IOIA 2SAKA 1T0QC 4ANVA 4IG7B 3AEGB 2N7DA 2ZW0A 5HI1A 5D6JB 1C78A 1V80A 2KK8A 3U52E 3PRZA 1VLBA 4HDQA 2LVOA 4AQ7A 1WXVA 3A9JA 1JWBD 1J7CA 2L8JA 4XYCA 2WXJA 2FCQA 1ESFA 1WMHA 3Q3MC 2RD0A 3ZLZA 2WXFA 4ZYSA 1YX5B 4BVUC 3LYYA 1IGCA 5FKAC 1YN5A 5JZEB 1J7AA 1VDVA 3VQIA 3FILA 4HPLB 4DXFA 5L83A 3N30A 1VCBA 2KJRA 3VR9B 2WHIA 1NEKB 3QCAA 3ZDMC 2GBNA 1D6EC 2WXHA 3MP9A 1XO3A 4KSKC 2WQYB 5CHWA 4HPMB 3QWZB 1WM2A 1SE4A 1LM8B 4HPPA 1WXQA 5D3DA 1I7HA 1ZUD2 1KOTA 1ET9A 2EMTA 2D11A 3TIXA 5HHDG 1JMLA 5KHOA 2BPSA 1V6EA 5EE9A 1FD6A 4H2AA 3I9V1 4CHKA 3RT3B 4MJSB 2R61A 3PZ7A 1E5WA 3AMZA 1GJZA 4HK2A 4NAWA 2DNFA 1FRRA 1WWTA 1DGJA 4KSLC 1A70A 4MGYE 1P7EA 3ZXVA 1BMLC 1UBIA 2FUHB 4RF0A 1EUVB 4ZHOA 1L4ZB 2DENB 1E7VA 2WXPA 2BQQA 2J0KA 2IO2B 1RM6C 2MCNB 4B0MA 4MH0E 5JHAA 2J7QB 3RMKC 2XN9C 5IN7A 1FFUA 2J42A 4ZYNA 1IBXB 4C4VA 3CF6E 4LNKA 2KVRA 3R8BA 4EOYA 4HJGE 2FIFA 1XCQL 1IP9A 1QQRA 2DZMA 2KWCA 3I57A 1NVID 4BKSD 1C4CA 2N9EB 4G50A 4A20A 3RNBC 3AEEB 4NQKE 1YN3A 3B2GA 3Q8AA 4DWFA 1WF9A 2G1EA 4GU2A 2J0JA 2DYOA 4MGKE 2C7MB 3BINA 1WXMA 4OVUA 1GB1A 4PS8A 3QARA 1RFKA 2AYOB 1T3QA 1K8RB 2RDHA 2M56B 5E6JA 5J17A 1YJJA 4A3OA 2KYWA 2KQ4X 3QAQA 2KMMA 4JWSC 1SIJA 2M17A 3ZO5B 2SEBD 1XLNA 1M94A 3U7ZA 3SDLC 1N5WA 2A4ZA 2LUMA 1QT9A 1ZE3D 1QOAA 3R2IA 1Q10A 1ZP0B 1RRBA 4P7IA 3KWLA 4GGQA 1KLVA 2BTEA 2OJWA 3IHPC 2FAZA 1U4AA 3PS6A 5DPRA 2KT7A 2MA9B 1E90A 3EFCA 1R4NB 4HDOA 5E6PA 3E9SA 3ONSA 5LXIB 2MJ3A 1ZDXA 2KC1A 3M62B 2OHFA 2K8CA 4ZRJA 4WIPA 1VR9A 3MHSD 3V6CB 1D4BA 2JZ3B 2R2OA 3EUB2 1E10A 3ZNGC 2E3TA 2WXQA 5MPOA 1P0RA 2ZVNA 3NZSA 1UZXB 1I4QA 3NOBA 4RF1A 2NBWB 1UH6A 2WX0A 2X38A 1E8YA 2B76B 4DHJD 4PK1A 3AH7A 2WDTB 3UIOB 3OLMD 2G4SA 1OFFA 1BT0A 3QQ8B 2JVCA 2IGDA 1TT5B 2PIAA 2AQ3B 3AN1A 4I6LB 3PRMB 4F7ZA 4AS1A 3KVFB 3WA0A 4TSSA 3IT6B 2INCC 2PLPA 4A8XC 3O13A 2IO1B 2INNE 2JU6X 4XWWA 2M19A 1EU3A 2KQSA 4MEMA 1ACCA 3IG3A 2BS2B 1PGBA 1TGZB 1JCKB 4WWOA 1SJED 2QMTA 3N1XC 3HHMA 3R3MA 4K7UA 2CJNA 4XE0A 1XF5L 3M3JA 2K8HA 3H8HA 2BB5A 3A4SC 1OQQA 2GBKA 4W9GA 3BYTB 1ISNA 2YEPF 4RFBA 2BYFA 1F2RC 2IDYA 2PMVA 1RAXA 4P6VF 3EA6A 4DDID 3PV1A 2KAJA 3VXWA 4OZBA 4LLGM 3ZJUA 2IO3B 1WZ3A 1H4RA 4G11A 5CHFA 3M63B 3VTVA 4WWNA 2ONQA 3ZRFA 2UWQA 2WNMA 1WJ6A 4NY0A 1WX8A 3PHWB 2I1KA 3B0AA 2C9WB 3GZNB 2MBBB 1EF1A 3BK2A 1I42A 1Q1OA 4C80A 1WXSA 2KHWB 3DVNV 1FM0D 4DXGA 4HKQA 3QJZA 1HZ5A 2N1WA 3LJ3A 4ANWA 2QCZA 5BO4B 1F0ZA 3E56A 3N1YC 3QHTA 3WALA 2AL6A 3ALBA 3PSEB 1D3ZA 4LNOA 1N62A 4YTPB 1ZGUB 2WGSA 2BVCA 3I5JC 3X0WA 3AE7B 1J7BA 1ENFA 2ZPNA 3DHHC 1E8XA 3H6NA 3CSTA 2JZZA 2MP2A 1WJUA 4W9IA 4LK0M 2ON8A 4QAYA 3R7RA 2MX2A 3ZTDA 1UWXA 1F1HA 3PREA 1WR1A 1KLGD 5EDSA 1NI2A 2XK5B 3UQAA 1SJHD 1K53A 1UBQA 2ZNVB 1F2RI 1NYQA 4RM8A 2W55A 5AZFA 2MJEA 4CO7A 2J53A 1L0VB 4M8NA 4C00A 1FNUA 3N32A 1UUPA 2LJIA 1HTOA 1WJ4A 1C3TA 5JXVA 2IGGA 3B08A 3ETRA 3NRZA 3AU5A 4NJ7A 1P9DU 2KMCA 4M0WB 2KWVB 4WAAA 2AWTA 2KFKA 2ICIA 2GI9A 3VUXA 1GG3A 2KTRB 3SEBA 2IO0B 2N7EA 4KGRA 2N7JA 3DHGC 2KJHB 1FNVA 3TUOA 3AE3B 4GIVA 4BKTA 3V05A 4RM9A 1LO5D 4BBNF 2FIDA 3PLVA 5AZGA 2N9XA 1V81A 1SF0A 2NCNA 3AEBB 4N59A 4WJNA 1MHHE 4IM3A 1R7SA 2VH1A 5TSSA 2XNAC 1PQSA 1UGJA 2N0SB 2X8XX 1FRDA 3FAHA 4AUQC 4ICVA 4FHKA 3VAWA 1BXTA 4I6PA 2G45B 2QILA 2D3GA 2BB6A 4LJOB 1Y8RC 5BMIA 1WGRA 2RGFA 2Y5PA 5EE1A 2Z0EB 1T0YA 2K8BA 3ZGZA 2QJLA 4ANUA 4S0RA 2ZNVC 4ZRQA 1ZPSA 1PFDA 1QILA 3VRAB 2NR2A 1WRDB 3Q3OC 3WAMA 2DAJA 1LXDA 1TKGA 1ZKHA 1GC6A 5G5HA 2KTRA 2PEAA 2Z0DB 4HRSA 3A1QB 4IUMB 2Y5BB 4S17A 1FMAD 4HROA 4F8CB 4DHJB 2O2VA 4HWIB 2WXRA 4EFOA 2D10A 3GOEA 3Q8EA 1E6EB 2XBBC 3HVDA 3PLUA 3TCAA 2MWSB 2G9HD 5CX3A 3PGEA 1XLQA 1WX7A 1KH0A 4JGHB 5HFYA 2BT6A 3RD2A 1WMHB 2KD0A 4DHZE 1YIWA 2JT4B 1L0XB 5DPTA 1KM7A 2GBJA 3APDA 1MG4A 3L16A 2V4IB 4OVVA 5FR3A 1EU4A 2K6DB 2LXAA 4EZLA 2PTLA 1B9RA 2GBRA 5D94A 1Y56A 3L13A
chains in the Genus database with same CATH topology
1SEBD 1VJKA 1WYGA 4NAWB 3ZJTA 5E6JA 1N60A 4IDIA 4OZAA 1YJJA 2CJOA 1JQ4A 1C79A 2KQ4X 2HTME 2L32A 2OEDA 4KKJA 2WDQB 1P7FA 2KMMA 1YNTE 2W3SA 1JW9D 1TJEA 3W1SA 4OW0A 4JWSC 1SIJA 3BK1A 2SEBD 1XLNA 2D5GA 1WGKA 3U7ZA 3T3OA 4KX6B 2W82A 1MI0A 1N5WA 4MACA 2LUMA 1JALA 1QT9A 1ZE3D 1QOAA 1N5XA 1Q10A 3R2IA 1ZP0B 2WXLA 2LMCA 4CQNA 1VZ6A 2K3UA 2LHEA 1K52A 3IXSA 3KWLA 4NAMA 4YTNB 2BTEA 4WAFA 1KFYB 4HKZE 1K51A 1C4PA 2WXKA 1VZ8A 1HEZE 3AV8A 1CK1A 3ABVB 3NS1A 1TS3A 3R2TA 1NENB 1HZ6A 1GB4A 1IBXA 1SB3C 3AECB 2PKOA 3NVZA 2PVGC 3C8YA 3KLSX 5EE3A 3Q8BA 2WDRB 1FXAA 4D2KA 1T6BX 3E9SA 4DQOC 2MJ3A 2DLBA 2H89B 4TQ1A 1I4GA 1ZDXA 4ZHPA 3AE5B 1FO4A 5BYQA 1JROA 1WRIA 2OHFA 1KLUD 2EELA 1RWSA 1VRAB 1V1PB 4WIPA 2HDEA 3EGRA 1VR9A 4WH4A 1D4BA 4USAA 3ZJVA 1D5ZC 3EUB2 1N63A 4XDDA 2BYTA 1E10A 3BVMA 1D5XC 3P63A 1L6UA 2E3TA 2WXQA 4NZLB 4C7YA 3AE4B 5MPOA 3AE1B 4P16A 2I2YA 3AM9A 1E9MA 1FIQA 3CIRB 1V8CA 1I4QA 1SBBB 4RF1A 1C76A 1SXTA 3TSSA 5C3JB 3BYYB 2FE8A 2X38A 4REZA 2B76B 4WQMA 2GRIA 2Y3AA 1DOXA 2WDVB 2PVOD 2BS4B 1NI3A 1YJIA 2KDMA 2JSVX 2VZKD 3AH7A 4J3OD 2N9LA 1C4AA 1SSNA 3SR6A 2WLBA 1OFFA 2QEJC 1JWMD 3AE2B 2PW9A 2IGDA 2PIAA 4JX1C 2AQ3B 3AN1A 4YTMB 2LHDA 4AS1A 3W9CB 1KF6B 4TSSA 3IT6B 3HRDD 3P42A 4JE3B 1NYRA 2PLPA 3L4PA 3O13A 2FUG1 1TY0A 2FBWB 1HXYD 3P4QB 2INNE 1DOIA 2JU6X 2YEPB 3P4SB 4KGTA 4XWWA 2M19A 2WXMA 1EU3A 3DWMA 4UDUC 3SFDB 1QKZA 2QSDA 4OHJA 1ACCA 3MHZA 2TSSA 2BS2B 1PGBA 4GDKB 4A55A 1JCKB 1QOBA 1SJED 3TEWA 2QMTA 1TYGB 1V97A 1JWAD 4ZRPA 2CJNA 4L23A 1XF5L 3FILB 3PZ8A 4XE0A 2WU2B 3AEFB 5H92C 2ZW1A 3H8HA 2BB5A 4XWTA 1FEHA 1OQQA 4MM3B 1M4VA 4KKIA 3KWVA 1CQVA 1PYWD 1KTKA 4GDLB 4GLSC 4WWMA 4C7ZA 2EKIA 3BYTB 3VR8B 1AYFA 2V0GA 1C9FA 2YEPF 4XDCA 1QLBB 4RFBA 1ZOYB 2AQ1B 4M0WA 3DWGC 1F2RC 2IDYA 2DYMA 2PMVA 2E6XA 1DOYA 4P6VF 3RFZB 1KRHA 1K50A 5BMHA 1EWCA 4ARCA 2WXIA 3EA6A 4FXCA 1MHXA 2NMQA 2KAJA 2Z8LA 1YN4A 5I4DA 4OZBA 1MPEA 4US9A 3NVWA 1CJEA 1FCCC 4LLGM 1TKYA 2WXGA 3ZJUA 2NTTA 3NZ3A 2WU5B 2M0AA 3T3NA 1E0ZA 2ONQA 2H88B 2KWDA 2WNMA 4JWUC 3IAM1 1YQ4B 1TY2A 5H8YE 2BS3B 2BBCA 1ET6A 1TZOA 4US8A 1D5MC 1T5XD 3ZYYX 4LTUA 2MEKA 5G5GA 3URYA 2RMMA 1PGAA 3AE8B 1L0YB 1GOZA 1ZXIA 1FFVA 4RGMA 3BK2A 1JRPA 2W54A 4C80A 1FM0D 3AE9B 4DXGA 2N9KA 4N58A 1HQRD 1L6VA 3ZQ4A 2MH7A 2WXOA 3MFGA 4HKQA 1SE2A 1QOGA 1HZ5A 1DYQA 3TEXA 5FK9C 1AN8A 4ZOHC 1F0ZA 1OQRA 3E56A 4RNAA 2JWUA 3BVZA 4PT5A 2LEKA 3LB8C 2DBYA 2VZKB 1ZXHA 3MC0B 4YSXB 3LXFA 1JWUD 5GXGB 3TEZA 3Q69A 3V3XA 1N62A 2JX5A 4YTPB 3AEAB 3U2SC 1XLPA 1EWYC 4O1NA 1ROEA 3Q8FA 1TS4A 3AE7B 5T8IA 4KGSA 3FC4A 1J7BA 3WCQA 1ENFA 4A9AA 2K0PA 1RYJA 3NUHB 4RGTA 1STEA 2J52A 1XXGA 4YSZB 2IGHA 1TKEA 4LK0M 1FNWA 1I4HA 2KACA 2JZPA 2ON8A 2V3PA 2Y5CA 2QIEB 3P4RB 4A6QA 1UWXA 1KLGD 2CU3A 1XLOA 4TMAB 2WP9B 3J9CA 3W5UB 1PUTA 1SJHD 4A90A 1C77A 4A8XC 1K53A 4EE2A 1F2RI 1NYQA 2J4XA 2K9XA 2W55A 1AWDA 3B2FA 2MJEA 1WSPA 2SAKA 2J53A 1L0VB 3AEGB 5BYRA 2ZW0A 5HI1A 1FNUA 2MJDA 1UUPA 2LJIA 2DWQA 2LGIA 3OWEB 3P4PB 1C78A 5JXVA 3U52E 1TS5A 2IGGA 3ETRA 1VLBA 4MH8A 3NRZA 4AQ7A 2ACZB 1IUEA 1JWBD 3NVYA 1N61A 1J7CA 3AB5A 2WXJA 1VZ7A 2JYTA 2NTSA 1PDXA 1ESFA 2GB1A 2IPKD 2ICIA 5LNK1 2GI9A 4IKGA 2WXFA 4ZYSA 5C2TB 4WURA 1V1OA 1PGXA 3SEBA 3LYYA 1CZPA 1IGCA 4KGRA 3BZDB 5FKAC 2L52A 2N7JA 1YN5A 1BUIC 1J7AA 1VDVA 1UNSA 3VQIA 3FILA 2JXTA 4DXFA 4YWGG 1FNVA 3TUOA 3AE3B 3RPFC 1TS2A 3VR9B 3V05A 1LO5D 1FCLA 1NEKB 5D7GA 4ARIA 2K22A 5BMGA 1D6EC 1SF0A 2WXHA 3AEBB 3HVZA 4ITKA 4N59A 4OVZA 3MP9A 2LFIA 1MHHE 1XO3A 1QF6A 2WQYB 1R7SA 5TSSA 5BYSA 1SE4A 1B1ZA 2XNAC 1L5PA 4C56C 4YT0B 1UGJA 2N0SB 1WXQA 3HUIA 5D3DA 1E7PB 3Q8CA 1I7HA 1ZUD2 1FRDA 1ET9A 3W2DA 3IT4B 3FAHA 1YMHE 1XEEA 1F77A 5HHDG 1JMLA 4RH6A 1BXTA 3VRBB 2JQRB 1ZDVA 5EE9A 2QILA 1FD6A 4H2AA 3I9V1 1L4DB 2Q5WD 2BB6A 3P1MA 2R61A 5BMIA 3PZ7A 1JWSD 2BW2A 2L83A 3AMZA 4RGOS 1FRRA 3AEDB 1WWTA 2Y5PA 1DGJA 1UWMA 4L2YA 4L1BA 5EE1A 2I38A 2KN4A 1A70A 2RDGA 3ZGZA 2QJLA 3GB1A 1P7EA 2L1AA 3U4EG 1BMLC 4RF0A 3BIID 4JPSA 4ZRQA 5AUIA 4ZHOA 1ZPSA 1L4ZB 3CWIA 4R3DA 2M56B 1GPXA 3NVVA 1PFDA 2WXPA 1QILA 3VRAB 4RCOA 4Q2JA 1RM6C 3MJ5A 1TKGA 4B0MA 5G5HA 1MVKA 2K5PA 2AQ2B 3IAS1 5D3IB 2V3NA 1GAQB 1QOFA 4HRSA 2XN9C 3SFEB 4RGNA 1FFUA 1FMAD 2J42A 4MT5A 4HROA 4NJCA 1IBXB 3B9JA 1AW7A 3N9YC 1I4XA 3TEYA 1I4PA 3R8BA 2WXRA 2INPE 3UI3A 3Q8EA 4TQ0A 4HJGE 1E6EB 3GS2A 3HVDA 3PO0A 1EM7A 1XCQL 1QQRA 3AE6B 4YXDB 2W3RA 3GP7A 2G9HD 1FXIA 1XLQA 3I57A 1V1PA 1NVID 4YSYB 1KH0A 2RPVA 3BVGA 5HFYA 1C4CA 2BT6A 4B0EA 3AEEB 1IGDA 1YN3A 3B2GA 3Q8AA 3KQ4A 1SE3A 1L0XB 2G1EA 2WXNA 4HEA1 3W5VB 1HA5A 2JYEA 2AX5A 1XCTL 4N6EB 2V4IB 1YQ3B 3BWUD 2DYOA 5AUKA 5FR3A 5HG2A 1I4RA 5EE0A 1EU4A 2WS3B 1GB1A 2PTLA 1B9RA 1RFKA 4IOIE 1T3QA 4OZCA 2RDHA 1Y56A 2IJ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JU6 X;  4OZA A;  1YMH E;  2KQ4 X;  2OED A;  5HHD G;  1QKZ A;  1JML A;  2QSD A;  1P7F A;  4KGS A;  1YNT E;  1PGB A;  2K0P A;  1FD6 A;  2QMT A;  5BMI A;  2J52 A;  1XF5 L;  1MI0 A;  3FIL B;  2IGH A;  4MAC A;  2LUM A;  2ON8 A;  2KAC A;  2JZP A;  1Q10 A;  2ZW1 A;  1UWX A;  2KN4 A;  2I38 A;  2LHE A;  1K52 A;  3GB1 A;  1P7E A;  4HKZ E;  1K51 A;  4GLS C;  1HEZ E;  1C9F A;  1HZ6 A;  1K53 A;  1GB4 A;  1F2R I;  1IBX A;  1F2R C;  4D2K A;  1K50 A;  2J53 A;  5BMH A;  1MVK A;  2ZW0 A;  5HI1 A;  2EEL A;  2LGI A;  1MHX A;  2NMQ A;  5JXV A;  4OZB A;  2IGG A;  1MPE A;  1FCC C;  4WH4 A;  1D4B A;  1IBX B;  2GB1 A;  2ONQ A;  2I2Y A;  3UI3 A;  2GI9 A;  2KWD A;  4IKG A;  4HJG E;  1EM7 A;  1XCQ L;  1PGX A;  1IGC A;  4KGR A;  2N7J A;  1KH0 A;  2RPV A;  2RMM A;  1PGA A;  5HFY A;  3FIL A;  2KDM A;  2JXT A;  2JSV X;  1IGD A;  2N9L A;  1FCL A;  2N9K A;  1HZ5 A;  5BMG A;  2PW9 A;  2IGD A;  1XCT L;  3MP9 A;  2JWU A;  1MHH E;  2LHD A;  5HG2 A;  1ZXH A;  1GB1 A;  2PTL A;  4IOI E;  2PLP A;  4OZC A;  4KGT A;  3V3X A; 
#chains in the Genus database with same CATH topology
 1SEB D;  1WYG A;  4NAW B;  3HIZ A;  2RDB C;  2O2V B;  3ZJT A;  4IDI A;  3TJP A;  2OED A;  2L32 A;  1E7U A;  4KKJ A;  1YNT E;  2W3S A;  3DPD A;  1JW9 D;  1TJE A;  3BK1 A;  2BYV E;  4K81 A;  3WAP A;  2D07 B;  1XT9 B;  2KFJ A;  1WGH A;  1N5X A;  3JYU A;  3DQV A;  1WX9 A;  4NAM A;  1KFY B;  2CHZ A;  4KZ0 A;  2WXK A;  1VZ8 A;  1WFY A;  2KLG A;  3NS1 A;  1TS3 A;  3Q3N C;  1HZ6 A;  3V62 A;  1IBX A;  2NPT B;  3AEC B;  3HM6 X;  1WGG A;  2GLS A;  3Q8B A;  1FXA A;  4DQO C;  3C0R B;  1I4G A;  5BYQ A;  1N6Z A;  2FCS A;  1V1P B;  4WH4 A;  4USA A;  2UU7 A;  3JSV B;  1N63 A;  1V86 A;  4XDD A;  3P63 A;  4NZL B;  1AAR A;  4DHZ B;  4K1R B;  3AM9 A;  1GUA B;  3RNG C;  3Q3F A;  4GMV A;  3NZU A;  3BYY B;  2FE8 A;  4REZ A;  2LGS A;  2Y3A A;  2WDV B;  3K9O B;  1UEL A;  1GC7 A;  3TL5 A;  2CR5 A;  1S3S G;  3SR6 A;  4M8M A;  2WLB A;  3HK0 A;  2QEJ C;  4W9C A;  4YTM B;  4A3P A;  4BOZ B;  1QZE A;  2HD5 B;  3MC9 A;  3WAN A;  2WWZ A;  1KF6 B;  3JSV A;  4J6I A;  1FO4 A;  1HXY D;  3P4Q B;  1DOI A;  2YEP B;  3P4S B;  4PYU A;  4X57 B;  1VD2 A;  4UDU C;  1QKZ A;  3H7S A;  2R2Q A;  1P3Q U;  2TSS A;  2XEW A;  3EEC A;  4GDK B;  2BKF A;  1TYG B;  4RMA A;  4YL8 A;  4ZRP A;  5C23 A;  4LNF A;  2FCM A;  4BAX A;  3PZ8 A;  2WU2 B;  3AI5 A;  4XWT A;  2NBU A;  3QC8 B;  4NPN A;  2ZPY A;  4MSM B;  4W9H A;  4E74 A;  2EKI A;  1AYF A;  2V0G A;  3AU4 A;  1ZOY B;  2HJ8 A;  3VHT C;  2DYM A;  2KX3 A;  3DHI C;  2IY0 B;  3ZW3 A;  1DOY A;  4ARC A;  5BMH A;  4II3 B;  1EWC A;  1WJN A;  2WXI A;  3KH0 A;  1MHX A;  2Z8L A;  5G55 A;  3UIN B;  3NVW A;  1CJE A;  1FCC C;  1TKY A;  3VUW A;  3KUZ A;  2FNJ B;  2NTT A;  3QX1 A;  3K9P B;  3ZNZ B;  3IFW B;  3ZDT A;  2H88 B;  3Q2A C;  2KWD A;  2YVC A;  3IAM 1;  1YQ4 B;  5H8Y E;  3UGB B;  2BS3 B;  2BBC A;  1J8C A;  1TZO A;  4US8 A;  1D5M C;  3L10 B;  1T5X D;  3ZYY X;  2MEK A;  1PGA A;  2M4N A;  3AE8 B;  1ZXI A;  3JVZ X;  1JRP A;  3RNC C;  1OEY J;  3KUD B;  3NJT A;  2G4D B;  3AE9 B;  2MSE D;  1UD7 A;  2N9K A;  2WXO A;  1QOG A;  2D2Q A;  1R4N I;  1WYW B;  1DYQ A;  4LDT D;  3Q6B A;  1L2N A;  2JWU A;  3LB8 C;  2DBY A;  2HJ1 A;  2VZK B;  3L17 A;  4KIK B;  3LXF A;  5GXG B;  3TEZ A;  1YQB A;  3V60 A;  3CMM B;  1WM3 A;  2JX5 A;  2N1V A;  3PHX B;  3AEA B;  1WE7 A;  1XLP A;  1EWY C;  2KVZ A;  2HTH A;  3U30 A;  1S1Q B;  1TS4 A;  2W9N A;  3FC4 A;  3L54 A;  2KTF A;  1RYJ A;  3RN9 C;  2J52 A;  5FR6 A;  1TKE A;  4AOF A;  3I63 C;  1FNW A;  2V3P A;  3OAW A;  4TMA B;  2KAN A;  3J9C A;  2FCN A;  2WYQ A;  1G6J A;  1WZ0 A;  4A90 A;  4GSW A;  1XQQ A;  3RZF A;  2CHX A;  3DVG Y;  1RFA A;  1AWD A;  3KYC D;  3B2F A;  3VH3 B;  2PJH A;  1WSP A;  4MSQ B;  3IBE A;  3IVF A;  5KHQ A;  3TBL D;  4HCP B;  5BYR A;  2MW5 A;  2MJD A;  2LGI A;  4KVG B;  3OWE B;  2KO3 A;  3SD5 A;  4MH8 A;  2BF8 B;  2JXX A;  1LGR A;  2ACZ B;  5AEK B;  1IUE A;  3NVY A;  1N61 A;  3DVN U;  4MGZ E;  2KLC A;  1VZ7 A;  2LWP A;  4ZDV A;  1PDX A;  2LXC A;  4ICU A;  5LNK 1;  3NS8 A;  4FUL A;  3X23 A;  4IKG A;  3L08 A;  4WUR A;  2V4L A;  1V1O A;  1PGX A;  1CZP A;  2ZJD A;  2EKE C;  4IWQ A;  4EZK A;  1BUI C;  2MHJ A;  1Z2M A;  3DDC B;  4W9L A;  3KUC B;  4YWG G;  2OJR A;  3RPF C;  1TS2 A;  3PT2 B;  4IWO A;  4P1B C;  1T0S C;  5D7G A;  4ARI A;  2VRR B;  3SU8 X;  4ZRK A;  1E8W A;  4OVZ A;  4K3B A;  4I6N B;  1ZW7 A;  1IYF A;  3ECI A;  1T0R C;  2ZCC A;  1J0G A;  3GZN I;  1L5P A;  2IBI B;  3KYD D;  5DPS A;  2K1F A;  5LXH A;  3R7Q A;  2L0F A;  1TBE A;  1YMH E;  3FKY A;  1XEE A;  1F77 A;  5G2N A;  2N4F A;  1ZDV A;  4AWJ A;  2Q5W D;  4KIK A;  4IW0 A;  1WIA A;  4N9F 4;  1JWS D;  2C7H A;  2L83 A;  4RGO S;  3QA8 A;  3AED B;  1UWM A;  4L2Y A;  3APF A;  3APC A;  4L1B A;  2I38 A;  5IO9 A;  2RPQ A;  3CSF A;  2D3A A;  3GB1 A;  2L1A A;  3BII D;  3VDZ A;  5AUI A;  3B1L X;  2QC8 A;  3CWI A;  2MP2 B;  5CTR C;  3RNE C;  2KFK B;  4RCO A;  3OG5 A;  2KKC A;  3MJ5 A;  2L76 A;  1MVK A;  2K5P A;  2AQ2 B;  3EC8 A;  3MC8 A;  3N3K B;  5D3I B;  2V3N A;  1WY8 A;  2GOW A;  2XK5 A;  3NHE B;  4MT5 A;  2MQJ A;  3PTF C;  4ACF A;  1I4X A;  2IND C;  3TEY A;  1I4P A;  3H7P A;  2INP E;  1WGY A;  3GS2 A;  2W3R A;  3ZRC A;  1YX6 B;  2NBV B;  4URK A;  2RPV A;  1WE6 A;  4F1S A;  1IGD A;  3KQ4 A;  1R4M I;  2MBO A;  1WR6 E;  4M02 A;  2LGX A;  4HEA 1;  5J2R A;  2CKH B;  5D2M B;  3MTN B;  4W9D A;  2JYE A;  2AX5 A;  5LLI A;  4G0N B;  1YQ3 B;  4JIO U;  3ZXR A;  2MBE A;  5HG2 A;  1I4R A;  5EE0 A;  2Z59 B;  3W1S C;  4IWP A;  5L95 C;  1VJK A;  1WGD A;  3VTW A;  1Q5W B;  3H7P B;  2CJO A;  1IPG A;  2HTM E;  2WDQ B;  2ZVO A;  5DCN A;  2D5G A;  1WGK A;  4KX6 B;  2W82 A;  1MI0 A;  4MAC A;  1JAL A;  2C5L C;  2WXL A;  3JW0 X;  4CQN A;  1VZ6 A;  1F52 A;  2K3U A;  1K52 A;  3IXS A;  4YTN B;  4WAF A;  4HKZ E;  1K51 A;  1C4P A;  3AV8 A;  3ABV B;  3UQB A;  2V3S A;  3R2T A;  4HVB A;  1NEN B;  2KC2 A;  2MRP A;  4TUU A;  1GB4 A;  1SB3 C;  2J0M A;  2PKO A;  2PVG C;  3C8Y A;  5EE3 A;  3Q3J A;  1NBF C;  2JY6 A;  4EEW A;  4FJV B;  2DLB A;  4ZHP A;  3AE5 B;  1WRI A;  2KNB A;  1KLU D;  3DBS A;  1VRA B;  2OOB B;  4B6W A;  3EGR A;  5TR5 A;  2DZI A;  1D5Z C;  3BVM A;  4KV2 A;  3PZD A;  4C7Y A;  2CS4 A;  4KDL B;  3NY5 A;  4P16 A;  2I2Y A;  1E9M A;  1FIQ A;  3CIR B;  1V8C A;  1SBB B;  1SXT A;  4GDK A;  4WWP A;  2LI5 A;  4FAD A;  2CU1 A;  4PYZ A;  5C3J B;  3DBL I;  2KDF B;  3C19 A;  4WQM A;  1DOX A;  2PVO D;  4K7S A;  2BS4 B;  3T9L A;  2L05 A;  1NI3 A;  1YJI A;  2VZK D;  4IM2 A;  4K7W A;  2IY1 B;  5JHB A;  2I1J A;  3BY4 B;  4GOC A;  4NNJ B;  2K25 A;  3AXC A;  1JWM D;  4LNI A;  1TZ1 A;  1E8Z A;  2LGY A;  4G3X B;  2DAF A;  3DOW A;  3W9C B;  2L3Z A;  3P42 A;  3ZNH B;  1NYR A;  3L4P A;  1TY0 A;  2FBW B;  4E71 A;  2BYE A;  2KDB A;  1A5R A;  2G3Q B;  1C1Y B;  3RI7 C;  3DBH I;  2QSD A;  2V9H A;  4GN1 A;  3MHZ A;  4HXD A;  3TEW A;  1WH3 A;  3P2B A;  3A9K B;  2B3A A;  4L23 A;  1V5T A;  1OTR B;  3DCG A;  2PE9 A;  4ASW C;  1FEH A;  4MM3 B;  1M4V A;  2REX A;  3KWV A;  4XGA B;  2GBM A;  1PYW D;  4GLS C;  4C7Z A;  3VR8 B;  4XDC A;  2KXJ A;  2AQ1 B;  3DWG C;  1P98 A;  2E6X A;  2AL3 A;  3RFZ B;  2L00 B;  4FBJ B;  4BZA A;  3U7D A;  4FXC A;  5GMV A;  2NMQ A;  5I4D A;  4US9 A;  2WXG A;  4TKN A;  1YJ1 A;  2M0A A;  3A9K A;  1E0Z A;  3DBR B;  1ET6 A;  3RZW C;  4LTU A;  3URY A;  2RMM A;  3H9D A;  2UYZ B;  1L0Y B;  1GOZ A;  3KW5 B;  2W54 A;  3DVG X;  4JQW C;  1JRU A;  1HQR D;  3ZQ4 A;  5IAA C;  1MFW A;  2MH7 A;  3MFG A;  4B9K A;  1SE2 A;  1UGM A;  3OJ4 B;  4HCN B;  3TEX A;  3WAO A;  1YOV B;  3ZIM A;  2JPH A;  2LEK A;  1NDD A;  1LQB A;  4YSX B;  1JWU D;  4IM0 A;  4M01 A;  4C4V B;  3Q69 A;  3V3X A;  2YLM A;  4FLH A;  2PE6 B;  2JRI B;  1ROE A;  3Q8F A;  2A5U A;  3GE8 C;  5T8I A;  4KGS A;  3ZKJ C;  1I35 A;  3WCQ A;  2K6Q A;  2L0T A;  3NUH B;  4RGT A;  1XXG A;  2IGH A;  2KAC A;  2JZP A;  4LDT B;  2QIE B;  3P4R B;  4A6Q A;  2D3C A;  1XLO A;  3W5U B;  1OQY A;  1C77 A;  4EE2 A;  2DYB A;  2LD9 A;  3WIM A;  2ZEQ A;  2J4X A;  2K9X A;  2L7R A;  4DDG D;  2KN5 A;  2JWZ A;  3RUL A;  2DWQ A;  3P4P B;  1TS5 A;  1HTQ A;  3RYT A;  4M00 A;  2JUO A;  4MDK E;  1V49 A;  3AB5 A;  3V61 A;  2JYT A;  2NTS A;  2GB1 A;  4DBG A;  2IPK D;  5C2T B;  1TTN A;  3BZD B;  1GNU A;  2L52 A;  1SIF A;  4AJW A;  4II2 B;  2QDF A;  3M95 A;  1UNS A;  4TV3 A;  2JXT A;  2MLB A;  3RUI B;  3OJ3 A;  1FCL A;  2K22 A;  2KZR A;  5BMG A;  4ITK A;  3HVZ A;  3NG0 A;  5C1Z A;  2LFI A;  5IKC M;  1QF6 A;  3ML8 A;  2M0X A;  3DBL B;  3N1Z C;  5BYS A;  3A9J B;  1B1Z A;  4NQL B;  4W9F A;  4C56 C;  4FHJ A;  4YT0 B;  3HUI A;  1E7P B;  3Q8C A;  5E6O A;  3W2D A;  3IT4 B;  3I3T B;  5J18 A;  2KWU B;  4RH6 A;  3VRB B;  1P1A A;  2JQR B;  4HJK A;  4AJY B;  1L4D B;  3P1M A;  2RR9 A;  3S2A A;  2BW2 A;  4KZC A;  5JH5 C;  2KN4 A;  3SHQ A;  2RDG A;  4ANX A;  3U4E G;  2DZK A;  3ENE A;  2ZZP B;  3DBH B;  4JPS A;  4XC2 A;  3QIJ A;  2C60 A;  2KX0 A;  4W9J A;  4R3D A;  1GPX A;  3NVV A;  4DXA B;  4HLE A;  1FXT B;  3QK0 A;  4Q2J A;  4WJO A;  1H8C A;  3IAS 1;  1GAQ B;  1QOF A;  2GMI C;  2LRW A;  1SGH A;  3SFE B;  4RGN A;  2LZ6 A;  1CMX B;  4NJC A;  2NPT A;  3B9J A;  2IZV B;  1AW7 A;  3PPA A;  3N9Y C;  4MJS A;  3UI3 A;  4TQ0 A;  1MG8 A;  1UF0 A;  3PO0 A;  1J19 A;  1EM7 A;  3AE6 B;  1EO6 A;  2LVQ A;  3GP7 A;  4YXD B;  1FXI A;  1XD3 B;  1V1P A;  2K39 A;  4YSY B;  3BVG A;  4B95 A;  4B0E A;  4W9K A;  3VUY A;  1SE3 A;  2WXN A;  4W9E A;  3W5V B;  1HA5 A;  2JRH A;  4XX5 A;  1XCT L;  1X1M A;  2KOX A;  4N6E B;  4FA6 A;  3BWU D;  1OGW A;  5AUK A;  3VTU A;  2LGD A;  2WS3 B;  4IOI E;  4OZC A;  1V2Y A;  2IJ0 A;  1WI0 A;  2M8S A;  1Q0W B;  1N60 A;  4OZA A;  2LAS A;  1JQ4 A;  1C79 A;  1TIF A;  1P7F A;  3W1S A;  4OW0 A;  3MJW A;  3A4R A;  4KDI C;  4LJP B;  3T3O A;  4E3C A;  2CHW A;  2DZJ A;  3T8M A;  2LMC A;  4DK5 A;  2LHE A;  3ZVV A;  4K3C A;  1V5O A;  2DX5 B;  4P1C C;  1HEZ E;  1CK1 A;  2EMS A;  2VH2 A;  2MBQ A;  4EZJ A;  5E6N A;  3NVZ A;  4WJQ A;  3KLS X;  5HKH A;  2WDR B;  3ML9 A;  4D2K A;  1T6B X;  3VH4 B;  2H89 B;  4TQ1 A;  1JRO A;  4GB9 A;  2EEL A;  4GDL A;  1RWS A;  3GE3 C;  2DHZ A;  2HDE A;  3ZJV A;  2O6V B;  2BYT A;  3RNF C;  1D5X C;  3VVW B;  1L6U A;  3AE4 B;  3ZUN A;  3AE1 B;  2D3B A;  1LFD A;  3TMP B;  1C76 A;  1WXA A;  1Z5S B;  2ZCB A;  3TSS A;  2KJ6 A;  2GRI A;  4IC7 B;  2WX1 A;  2KDM A;  2JSV X;  2PPH A;  4J3O D;  1V9J A;  2N9L A;  2V1Y A;  1FPY A;  2QHO A;  4BFR A;  1C4A A;  1SSN A;  1RLF A;  2LJ5 A;  2RSU A;  3AE2 B;  2PW9 A;  4JX1 C;  1HE8 A;  3A33 B;  2LHD A;  2M1M A;  3HRD D;  4JE3 B;  4PS3 A;  2O6V A;  3V6E B;  2FUG 1;  4JL9 A;  4KGT A;  2BWF A;  2WXM A;  3DWM A;  2BWE S;  2C7N B;  3SFD B;  1MJD A;  4GXB A;  4OHJ A;  1SE9 A;  4MGI E;  4CYE A;  4NJ6 A;  4A55 A;  1QOB A;  1V97 A;  1JWA D;  4FJZ A;  3FIL B;  3O65 B;  2ASQ A;  3U8Z A;  3AEF B;  4WJP A;  5H92 C;  2AEH A;  4BBN C;  2ZW1 A;  5DPW A;  2NS5 A;  3HM3 A;  4KKI A;  1R4M B;  4XZ4 A;  1CQV A;  2LVP A;  1KTK A;  4GDL B;  4WWM A;  3W1Y A;  1C9F A;  4FN2 A;  1QLB B;  2LRU A;  3EHV A;  3UF8 A;  2KMA A;  4M0W A;  5IA7 A;  3DBR I;  3RNA C;  2KDE B;  1KRH A;  1K50 A;  2LUE A;  3PRP B;  4EKU A;  1YN4 A;  5IP4 D;  1MPE A;  2O6V D;  4PS7 A;  3NZ3 A;  3PVL A;  2WU5 B;  5CHV C;  3Q14 C;  3T3N A;  4AP4 C;  4WQO B;  4LCD E;  2NVU I;  1KJT A;  3L0W B;  4JWU C;  1TY2 A;  4MEL A;  3ZNI D;  4MM3 A;  5G5G A;  3LDZ E;  3VFK A;  1FFV A;  4RGM A;  3UIP B;  4FJY A;  3N20 C;  4BKS A;  2BKR B;  1OEY A;  4N58 A;  1L6V A;  2MBH A;  5FK9 C;  1EF5 A;  1AN8 A;  4ZOH C;  2JF5 A;  1OQR A;  4JLC A;  3ZTC A;  4RNA A;  3BVZ A;  4PT5 A;  3EFU A;  1ZXH A;  3D32 A;  3MC0 B;  2KQ7 A;  1YD8 U;  3U2S C;  2HE7 A;  4O1N A;  2IYD B;  4LNN A;  3R66 C;  5AZH A;  4A9A A;  2K0P A;  1STE A;  2BGF A;  4ZRI A;  4YSZ B;  2N9P C;  1I4H A;  4BOS C;  2Y5C A;  4BKG A;  2CU3 A;  1L7Y A;  2WP9 B;  3A1Q A;  1PUT A;  3RCZ A;  4EUT A;  1F9J A;  2KDI A;  3H1U A;  3AUL A;  5IOI A;  2SAK A;  1T0Q C;  4ANV A;  4IG7 B;  3AEG B;  2N7D A;  2ZW0 A;  5HI1 A;  5D6J B;  1C78 A;  1V80 A;  2KK8 A;  3U52 E;  3PRZ A;  1VLB A;  4HDQ A;  2LVO A;  4AQ7 A;  1WXV A;  3A9J A;  1JWB D;  1J7C A;  2L8J A;  4XYC A;  2WXJ A;  2FCQ A;  1ESF A;  1WMH A;  3Q3M C;  2RD0 A;  3ZLZ A;  2WXF A;  4ZYS A;  1YX5 B;  4BVU C;  3LYY A;  1IGC A;  5FKA C;  1YN5 A;  5JZE B;  1J7A A;  1VDV A;  3VQI A;  3FIL A;  4HPL B;  4DXF A;  5L83 A;  3N30 A;  1VCB A;  2KJR A;  3VR9 B;  2WHI A;  1NEK B;  3QCA A;  3ZDM C;  2GBN A;  1D6E C;  2WXH A;  3MP9 A;  1XO3 A;  4KSK C;  2WQY B;  5CHW A;  4HPM B;  3QWZ B;  1WM2 A;  1SE4 A;  1LM8 B;  4HPP A;  1WXQ A;  5D3D A;  1I7H A;  1ZUD 2;  1KOT A;  1ET9 A;  2EMT A;  2D11 A;  3TIX A;  5HHD G;  1JML A;  5KHO A;  2BPS A;  1V6E A;  5EE9 A;  1FD6 A;  4H2A A;  3I9V 1;  4CHK A;  3RT3 B;  4MJS B;  2R61 A;  3PZ7 A;  1E5W A;  3AMZ A;  1GJZ A;  4HK2 A;  4NAW A;  2DNF A;  1FRR A;  1WWT A;  1DGJ A;  4KSL C;  1A70 A;  4MGY E;  1P7E A;  3ZXV A;  1BML C;  1UBI A;  2FUH B;  4RF0 A;  1EUV B;  4ZHO A;  1L4Z B;  2DEN B;  1E7V A;  2WXP A;  2BQQ A;  2J0K A;  2IO2 B;  1RM6 C;  2MCN B;  4B0M A;  4MH0 E;  5JHA A;  2J7Q B;  3RMK C;  2XN9 C;  5IN7 A;  1FFU A;  2J42 A;  4ZYN A;  1IBX B;  4C4V A;  3CF6 E;  4LNK A;  2KVR A;  3R8B A;  4EOY A;  4HJG E;  2FIF A;  1XCQ L;  1IP9 A;  1QQR A;  2DZM A;  2KWC A;  3I57 A;  1NVI D;  4BKS D;  1C4C A;  2N9E B;  4G50 A;  4A20 A;  3RNB C;  3AEE B;  4NQK E;  1YN3 A;  3B2G A;  3Q8A A;  4DWF A;  1WF9 A;  2G1E A;  4GU2 A;  2J0J A;  2DYO A;  4MGK E;  2C7M B;  3BIN A;  1WXM A;  4OVU A;  1GB1 A;  4PS8 A;  3QAR A;  1RFK A;  2AYO B;  1T3Q A;  1K8R B;  2RDH A;  2M56 B;  5E6J A;  5J17 A;  1YJJ A;  4A3O A;  2KYW A;  2KQ4 X;  3QAQ A;  2KMM A;  4JWS C;  1SIJ A;  2M17 A;  3ZO5 B;  2SEB D;  1XLN A;  1M94 A;  3U7Z A;  3SDL C;  1N5W A;  2A4Z A;  2LUM A;  1QT9 A;  1ZE3 D;  1QOA A;  3R2I A;  1Q10 A;  1ZP0 B;  1RRB A;  4P7I A;  3KWL A;  4GGQ A;  1KLV A;  2BTE A;  2OJW A;  3IHP C;  2FAZ A;  1U4A A;  3PS6 A;  5DPR A;  2KT7 A;  2MA9 B;  1E90 A;  3EFC A;  1R4N B;  4HDO A;  5E6P A;  3E9S A;  3ONS A;  5LXI B;  2MJ3 A;  1ZDX A;  2KC1 A;  3M62 B;  2OHF A;  2K8C A;  4ZRJ A;  4WIP A;  1VR9 A;  3MHS D;  3V6C B;  1D4B A;  2JZ3 B;  2R2O A;  3EUB 2;  1E10 A;  3ZNG C;  2E3T A;  2WXQ A;  5MPO A;  1P0R A;  2ZVN A;  3NZS A;  1UZX B;  1I4Q A;  3NOB A;  4RF1 A;  2NBW B;  1UH6 A;  2WX0 A;  2X38 A;  1E8Y A;  2B76 B;  4DHJ D;  4PK1 A;  3AH7 A;  2WDT B;  3UIO B;  3OLM D;  2G4S A;  1OFF A;  1BT0 A;  3QQ8 B;  2JVC A;  2IGD A;  1TT5 B;  2PIA A;  2AQ3 B;  3AN1 A;  4I6L B;  3PRM B;  4F7Z A;  4AS1 A;  3KVF B;  3WA0 A;  4TSS A;  3IT6 B;  2INC C;  2PLP A;  4A8X C;  3O13 A;  2IO1 B;  2INN E;  2JU6 X;  4XWW A;  2M19 A;  1EU3 A;  2KQS A;  4MEM A;  1ACC A;  3IG3 A;  2BS2 B;  1PGB A;  1TGZ B;  1JCK B;  4WWO A;  1SJE D;  2QMT A;  3N1X C;  3HHM A;  3R3M A;  4K7U A;  2CJN A;  4XE0 A;  1XF5 L;  3M3J A;  2K8H A;  3H8H A;  2BB5 A;  3A4S C;  1OQQ A;  2GBK A;  4W9G A;  3BYT B;  1ISN A;  2YEP F;  4RFB A;  2BYF A;  1F2R C;  2IDY A;  2PMV A;  1RAX A;  4P6V F;  3EA6 A;  4DDI D;  3PV1 A;  2KAJ A;  3VXW A;  4OZB A;  4LLG M;  3ZJU A;  2IO3 B;  1WZ3 A;  1H4R A;  4G11 A;  5CHF A;  3M63 B;  3VTV A;  4WWN A;  2ONQ A;  3ZRF A;  2UWQ A;  2WNM A;  1WJ6 A;  4NY0 A;  1WX8 A;  3PHW B;  2I1K A;  3B0A A;  2C9W B;  3GZN B;  2MBB B;  1EF1 A;  3BK2 A;  1I42 A;  1Q1O A;  4C80 A;  1WXS A;  2KHW B;  3DVN V;  1FM0 D;  4DXG A;  4HKQ A;  3QJZ A;  1HZ5 A;  2N1W A;  3LJ3 A;  4ANW A;  2QCZ A;  5BO4 B;  1F0Z A;  3E56 A;  3N1Y C;  3QHT A;  3WAL A;  2AL6 A;  3ALB A;  3PSE B;  1D3Z A;  4LNO A;  1N62 A;  4YTP B;  1ZGU B;  2WGS A;  2BVC A;  3I5J C;  3X0W A;  3AE7 B;  1J7B A;  1ENF A;  2ZPN A;  3DHH C;  1E8X A;  3H6N A;  3CST A;  2JZZ A;  2MP2 A;  1WJU A;  4W9I A;  4LK0 M;  2ON8 A;  4QAY A;  3R7R A;  2MX2 A;  3ZTD A;  1UWX A;  1F1H A;  3PRE A;  1WR1 A;  1KLG D;  5EDS A;  1NI2 A;  2XK5 B;  3UQA A;  1SJH D;  1K53 A;  1UBQ A;  2ZNV B;  1F2R I;  1NYQ A;  4RM8 A;  2W55 A;  5AZF A;  2MJE A;  4CO7 A;  2J53 A;  1L0V B;  4M8N A;  4C00 A;  1FNU A;  3N32 A;  1UUP A;  2LJI A;  1HTO A;  1WJ4 A;  1C3T A;  5JXV A;  2IGG A;  3B08 A;  3ETR A;  3NRZ A;  3AU5 A;  4NJ7 A;  1P9D U;  2KMC A;  4M0W B;  2KWV B;  4WAA A;  2AWT A;  2KFK A;  2ICI A;  2GI9 A;  3VUX A;  1GG3 A;  2KTR B;  3SEB A;  2IO0 B;  2N7E A;  4KGR A;  2N7J A;  3DHG C;  2KJH B;  1FNV A;  3TUO A;  3AE3 B;  4GIV A;  4BKT A;  3V05 A;  4RM9 A;  1LO5 D;  4BBN F;  2FID A;  3PLV A;  5AZG A;  2N9X A;  1V81 A;  1SF0 A;  2NCN A;  3AEB B;  4N59 A;  4WJN A;  1MHH E;  4IM3 A;  1R7S A;  2VH1 A;  5TSS A;  2XNA C;  1PQS A;  1UGJ A;  2N0S B;  2X8X X;  1FRD A;  3FAH A;  4AUQ C;  4ICV A;  4FHK A;  3VAW A;  1BXT A;  4I6P A;  2G45 B;  2QIL A;  2D3G A;  2BB6 A;  4LJO B;  1Y8R C;  5BMI A;  1WGR A;  2RGF A;  2Y5P A;  5EE1 A;  2Z0E B;  1T0Y A;  2K8B A;  3ZGZ A;  2QJL A;  4ANU A;  4S0R A;  2ZNV C;  4ZRQ A;  1ZPS A;  1PFD A;  1QIL A;  3VRA B;  2NR2 A;  1WRD B;  3Q3O C;  3WAM A;  2DAJ A;  1LXD A;  1TKG A;  1ZKH A;  1GC6 A;  5G5H A;  2KTR A;  2PEA A;  2Z0D B;  4HRS A;  3A1Q B;  4IUM B;  2Y5B B;  4S17 A;  1FMA D;  4HRO A;  4F8C B;  4DHJ B;  2O2V A;  4HWI B;  2WXR A;  4EFO A;  2D10 A;  3GOE A;  3Q8E A;  1E6E B;  2XBB C;  3HVD A;  3PLU A;  3TCA A;  2MWS B;  2G9H D;  5CX3 A;  3PGE A;  1XLQ A;  1WX7 A;  1KH0 A;  4JGH B;  5HFY A;  2BT6 A;  3RD2 A;  1WMH B;  2KD0 A;  4DHZ E;  1YIW A;  2JT4 B;  1L0X B;  5DPT A;  1KM7 A;  2GBJ A;  3APD A;  1MG4 A;  3L16 A;  2V4I B;  4OVV A;  5FR3 A;  1EU4 A;  2K6D B;  2LXA A;  4EZL A;  2PTL A;  1B9R A;  2GBR A;  5D94 A;  1Y56 A;  3L13 A; 
#chains in the Genus database with same CATH homology
 1SEB D;  1VJK A;  1WYG A;  4NAW B;  3ZJT A;  5E6J A;  1N60 A;  4IDI A;  4OZA A;  1YJJ A;  2CJO A;  1JQ4 A;  1C79 A;  2KQ4 X;  2HTM E;  2L32 A;  2OED A;  4KKJ A;  2WDQ B;  1P7F A;  2KMM A;  1YNT E;  2W3S A;  1JW9 D;  1TJE A;  3W1S A;  4OW0 A;  4JWS C;  1SIJ A;  3BK1 A;  2SEB D;  1XLN A;  2D5G A;  1WGK A;  3U7Z A;  3T3O A;  4KX6 B;  2W82 A;  1MI0 A;  1N5W A;  4MAC A;  2LUM A;  1JAL A;  1QT9 A;  1ZE3 D;  1QOA A;  1N5X A;  1Q10 A;  3R2I A;  1ZP0 B;  2WXL A;  2LMC A;  4CQN A;  1VZ6 A;  2K3U A;  2LHE A;  1K52 A;  3IXS A;  3KWL A;  4NAM A;  4YTN B;  2BTE A;  4WAF A;  1KFY B;  4HKZ E;  1K51 A;  1C4P A;  2WXK A;  1VZ8 A;  1HEZ E;  3AV8 A;  1CK1 A;  3ABV B;  3NS1 A;  1TS3 A;  3R2T A;  1NEN B;  1HZ6 A;  1GB4 A;  1IBX A;  1SB3 C;  3AEC B;  2PKO A;  3NVZ A;  2PVG C;  3C8Y A;  3KLS X;  5EE3 A;  3Q8B A;  2WDR B;  1FXA A;  4D2K A;  1T6B X;  3E9S A;  4DQO C;  2MJ3 A;  2DLB A;  2H89 B;  4TQ1 A;  1I4G A;  1ZDX A;  4ZHP A;  3AE5 B;  1FO4 A;  5BYQ A;  1JRO A;  1WRI A;  2OHF A;  1KLU D;  2EEL A;  1RWS A;  1VRA B;  1V1P B;  4WIP A;  2HDE A;  3EGR A;  1VR9 A;  4WH4 A;  1D4B A;  4USA A;  3ZJV A;  1D5Z C;  3EUB 2;  1N63 A;  4XDD A;  2BYT A;  1E10 A;  3BVM A;  1D5X C;  3P63 A;  1L6U A;  2E3T A;  2WXQ A;  4NZL B;  4C7Y A;  3AE4 B;  5MPO A;  3AE1 B;  4P16 A;  2I2Y A;  3AM9 A;  1E9M A;  1FIQ A;  3CIR B;  1V8C A;  1I4Q A;  1SBB B;  4RF1 A;  1C76 A;  1SXT A;  3TSS A;  5C3J B;  3BYY B;  2FE8 A;  2X38 A;  4REZ A;  2B76 B;  4WQM A;  2GRI A;  2Y3A A;  1DOX A;  2WDV B;  2PVO D;  2BS4 B;  1NI3 A;  1YJI A;  2KDM A;  2JSV X;  2VZK D;  3AH7 A;  4J3O D;  2N9L A;  1C4A A;  1SSN A;  3SR6 A;  2WLB A;  1OFF A;  2QEJ C;  1JWM D;  3AE2 B;  2PW9 A;  2IGD A;  2PIA A;  4JX1 C;  2AQ3 B;  3AN1 A;  4YTM B;  2LHD A;  4AS1 A;  3W9C B;  1KF6 B;  4TSS A;  3IT6 B;  3HRD D;  3P42 A;  4JE3 B;  1NYR A;  2PLP A;  3L4P A;  3O13 A;  2FUG 1;  1TY0 A;  2FBW B;  1HXY D;  3P4Q B;  2INN E;  1DOI A;  2JU6 X;  2YEP B;  3P4S B;  4KGT A;  4XWW A;  2M19 A;  2WXM A;  1EU3 A;  3DWM A;  4UDU C;  3SFD B;  1QKZ A;  2QSD A;  4OHJ A;  1ACC A;  3MHZ A;  2TSS A;  2BS2 B;  1PGB A;  4GDK B;  4A55 A;  1JCK B;  1QOB A;  1SJE D;  3TEW A;  2QMT A;  1TYG B;  1V97 A;  1JWA D;  4ZRP A;  2CJN A;  4L23 A;  1XF5 L;  3FIL B;  3PZ8 A;  4XE0 A;  2WU2 B;  3AEF B;  5H92 C;  2ZW1 A;  3H8H A;  2BB5 A;  4XWT A;  1FEH A;  1OQQ A;  4MM3 B;  1M4V A;  4KKI A;  3KWV A;  1CQV A;  1PYW D;  1KTK A;  4GDL B;  4GLS C;  4WWM A;  4C7Z A;  2EKI A;  3BYT B;  3VR8 B;  1AYF A;  2V0G A;  1C9F A;  2YEP F;  4XDC A;  1QLB B;  4RFB A;  1ZOY B;  2AQ1 B;  4M0W A;  3DWG C;  1F2R C;  2IDY A;  2DYM A;  2PMV A;  2E6X A;  1DOY A;  4P6V F;  3RFZ B;  1KRH A;  1K50 A;  5BMH A;  1EWC A;  4ARC A;  2WXI A;  3EA6 A;  4FXC A;  1MHX A;  2NMQ A;  2KAJ A;  2Z8L A;  1YN4 A;  5I4D A;  4OZB A;  1MPE A;  4US9 A;  3NVW A;  1CJE A;  1FCC C;  4LLG M;  1TKY A;  2WXG A;  3ZJU A;  2NTT A;  3NZ3 A;  2WU5 B;  2M0A A;  3T3N A;  1E0Z A;  2ONQ A;  2H88 B;  2KWD A;  2WNM A;  4JWU C;  3IAM 1;  1YQ4 B;  1TY2 A;  5H8Y E;  2BS3 B;  2BBC A;  1ET6 A;  1TZO A;  4US8 A;  1D5M C;  1T5X D;  3ZYY X;  4LTU A;  2MEK A;  5G5G A;  3URY A;  2RMM A;  1PGA A;  3AE8 B;  1L0Y B;  1GOZ A;  1ZXI A;  1FFV A;  4RGM A;  3BK2 A;  1JRP A;  2W54 A;  4C80 A;  1FM0 D;  3AE9 B;  4DXG A;  2N9K A;  4N58 A;  1HQR D;  1L6V A;  3ZQ4 A;  2MH7 A;  2WXO A;  3MFG A;  4HKQ A;  1SE2 A;  1QOG A;  1HZ5 A;  1DYQ A;  3TEX A;  5FK9 C;  1AN8 A;  4ZOH C;  1F0Z A;  1OQR A;  3E56 A;  4RNA A;  2JWU A;  3BVZ A;  4PT5 A;  2LEK A;  3LB8 C;  2DBY A;  2VZK B;  1ZXH A;  3MC0 B;  4YSX B;  3LXF A;  1JWU D;  5GXG B;  3TEZ A;  3Q69 A;  3V3X A;  1N62 A;  2JX5 A;  4YTP B;  3AEA B;  3U2S C;  1XLP A;  1EWY C;  4O1N A;  1ROE A;  3Q8F A;  1TS4 A;  3AE7 B;  5T8I A;  4KGS A;  3FC4 A;  1J7B A;  3WCQ A;  1ENF A;  4A9A A;  2K0P A;  1RYJ A;  3NUH B;  4RGT A;  1STE A;  2J52 A;  1XXG A;  4YSZ B;  2IGH A;  1TKE A;  4LK0 M;  1FNW A;  1I4H A;  2KAC A;  2JZP A;  2ON8 A;  2V3P A;  2Y5C A;  2QIE B;  3P4R B;  4A6Q A;  1UWX A;  1KLG D;  2CU3 A;  1XLO A;  4TMA B;  2WP9 B;  3J9C A;  3W5U B;  1PUT A;  1SJH D;  4A90 A;  1C77 A;  4A8X C;  1K53 A;  4EE2 A;  1F2R I;  1NYQ A;  2J4X A;  2K9X A;  2W55 A;  1AWD A;  3B2F A;  2MJE A;  1WSP A;  2SAK A;  2J53 A;  1L0V B;  3AEG B;  5BYR A;  2ZW0 A;  5HI1 A;  1FNU A;  2MJD A;  1UUP A;  2LJI A;  2DWQ A;  2LGI A;  3OWE B;  3P4P B;  1C78 A;  5JXV A;  3U52 E;  1TS5 A;  2IGG A;  3ETR A;  1VLB A;  4MH8 A;  3NRZ A;  4AQ7 A;  2ACZ B;  1IUE A;  1JWB D;  3NVY A;  1N61 A;  1J7C A;  3AB5 A;  2WXJ A;  1VZ7 A;  2JYT A;  2NTS A;  1PDX A;  1ESF A;  2GB1 A;  2IPK D;  2ICI A;  5LNK 1;  2GI9 A;  4IKG A;  2WXF A;  4ZYS A;  5C2T B;  4WUR A;  1V1O A;  1PGX A;  3SEB A;  3LYY A;  1CZP A;  1IGC A;  4KGR A;  3BZD B;  5FKA C;  2L52 A;  2N7J A;  1YN5 A;  1BUI C;  1J7A A;  1VDV A;  1UNS A;  3VQI A;  3FIL A;  2JXT A;  4DXF A;  4YWG G;  1FNV A;  3TUO A;  3AE3 B;  3RPF C;  1TS2 A;  3VR9 B;  3V05 A;  1LO5 D;  1FCL A;  1NEK B;  5D7G A;  4ARI A;  2K22 A;  5BMG A;  1D6E C;  1SF0 A;  2WXH A;  3AEB B;  3HVZ A;  4ITK A;  4N59 A;  4OVZ A;  3MP9 A;  2LFI A;  1MHH E;  1XO3 A;  1QF6 A;  2WQY B;  1R7S A;  5TSS A;  5BYS A;  1SE4 A;  1B1Z A;  2XNA C;  1L5P A;  4C56 C;  4YT0 B;  1UGJ A;  2N0S B;  1WXQ A;  3HUI A;  5D3D A;  1E7P B;  3Q8C A;  1I7H A;  1ZUD 2;  1FRD A;  1ET9 A;  3W2D A;  3IT4 B;  3FAH A;  1YMH E;  1XEE A;  1F77 A;  5HHD G;  1JML A;  4RH6 A;  1BXT A;  3VRB B;  2JQR B;  1ZDV A;  5EE9 A;  2QIL A;  1FD6 A;  4H2A A;  3I9V 1;  1L4D B;  2Q5W D;  2BB6 A;  3P1M A;  2R61 A;  5BMI A;  3PZ7 A;  1JWS D;  2BW2 A;  2L83 A;  3AMZ A;  4RGO S;  1FRR A;  3AED B;  1WWT A;  2Y5P A;  1DGJ A;  1UWM A;  4L2Y A;  4L1B A;  5EE1 A;  2I38 A;  2KN4 A;  1A70 A;  2RDG A;  3ZGZ A;  2QJL A;  3GB1 A;  1P7E A;  2L1A A;  3U4E G;  1BML C;  4RF0 A;  3BII D;  4JPS A;  4ZRQ A;  5AUI A;  4ZHO A;  1ZPS A;  1L4Z B;  3CWI A;  4R3D A;  2M56 B;  1GPX A;  3NVV A;  1PFD A;  2WXP A;  1QIL A;  3VRA B;  4RCO A;  4Q2J A;  1RM6 C;  3MJ5 A;  1TKG A;  4B0M A;  5G5H A;  1MVK A;  2K5P A;  2AQ2 B;  3IAS 1;  5D3I B;  2V3N A;  1GAQ B;  1QOF A;  4HRS A;  2XN9 C;  3SFE B;  4RGN A;  1FFU A;  1FMA D;  2J42 A;  4MT5 A;  4HRO A;  4NJC A;  1IBX B;  3B9J A;  1AW7 A;  3N9Y C;  1I4X A;  3TEY A;  1I4P A;  3R8B A;  2WXR A;  2INP E;  3UI3 A;  3Q8E A;  4TQ0 A;  4HJG E;  1E6E B;  3GS2 A;  3HVD A;  3PO0 A;  1EM7 A;  1XCQ L;  1QQR A;  3AE6 B;  4YXD B;  2W3R A;  3GP7 A;  2G9H D;  1FXI A;  1XLQ A;  3I57 A;  1V1P A;  1NVI D;  4YSY B;  1KH0 A;  2RPV A;  3BVG A;  5HFY A;  1C4C A;  2BT6 A;  4B0E A;  3AEE B;  1IGD A;  1YN3 A;  3B2G A;  3Q8A A;  3KQ4 A;  1SE3 A;  1L0X B;  2G1E A;  2WXN A;  4HEA 1;  3W5V B;  1HA5 A;  2JYE A;  2AX5 A;  1XCT L;  4N6E B;  2V4I B;  1YQ3 B;  3BWU D;  2DYO A;  5AUK A;  5FR3 A;  5HG2 A;  1I4R A;  5EE0 A;  1EU4 A;  2WS3 B;  1GB1 A;  2PTL A;  1B9R A;  1RFK A;  4IOI E;  1T3Q A;  4OZC A;  2RDH A;  1Y56 A;  2IJ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...