3GB1A

Structures of b1 domain of streptococcal protein g
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
56
structure length
56
Chain Sequence
b'MTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (B1 DOMAIN OF STREPTOCOCCAL PROTEIN G)
publication title Improving the Packing and Accuracy of NMR Structures with a Pseudopotential for the Radius of Gyration
pubmed doi rcsb
source organism Streptococcus sp. 'group g'
molecule tags Immunoglobulin binding protein
total genus 12
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 1999-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3gb1A00
4WH4A 2ZW0A 2PLPA 1HEZE 2KN4A 4HKZE 1IBXA 5HFYA 1Q10A 3UI3A 2JU6X 1GB4A 4OZBA 1F2RI 2I38A 1MPEA 4MACA 2QMTA 2JZPA 1ZXHA 1XCTL 1JMLA 1FCCC 1MVKA 2IGDA 2LUMA 1YMHE 4IKGA 2J52A 1EM7A 1FCLA 2JXTA 2PW9A 1F2RC 4KGRA 1QKZA 2N9KA 2ON8A 4KGTA 2QSDA 1P7FA 1IGDA 2IGHA 1K51A 3FILA 5BMHA 2PTLA 1PGBA 2IGGA 2ONQA 1MHXA 1XF5L 4OZCA 1C9FA 2GI9A 5BMIA 1K53A 5HHDG 3GB1A 2NMQA 2KACA 3V3XA 2LGIA 2N9LA 1GB1A 5HG2A 2J53A 2I2YA 1PGAA 1IBXB 2KDMA 1KH0A 2JSVX 3MP9A 2RPVA 4IOIE 1HZ6A 2GB1A 2N7JA 2LHEA 1PGXA 1MI0A 2JWUA 2KQ4X 1P7EA 1HZ5A 4D2KA 1IGCA 4HJGE 4GLSC 5JXVA 5HI1A 1K52A 5BMGA 4OZAA 1MHHE 3FILB 2EELA 1YNTE 4KGSA 1XCQL 1UWXA 2ZW1A 2K0PA 2RMMA 2LHDA 2OEDA 1FD6A 1D4BA 2KWDA 1K50A
chains in the Genus database with same CATH superfamily
1HA5A 4WQOB 5IP4D 1FRRA 1YQ3B 2CHXA 1T0RC 1V9JA 2LASA 1D6EC 3HK0A 2D5GA 3VR9B 2LWPA 1NI2A 2GBRA 2KLGA 3ZNZB 1ZPSA 3ZXVA 1ESFA 1WR1A 3PRPB 1L0VB 1FCCC 4F7ZA 5DCNA 2WDTB 5EDSA 1SE2A 1QOGA 3VHTC 2GBKA 5H92C 1P98A 4BZAA 5JZEB 1K51A 1JWMD 2HTME 1M4VA 1VZ8A 3B2GA 3RZFA 4M0WA 4DDGD 2LGYA 3TEXA 4DXFA 4ITKA 4OZCA 1VRAB 1V1PA 3QCAA 1C9FA 1JWAD 2WDVB 3VFKA 4B95A 1I35A 4HK2A 3T3OA 1UGMA 5IKCM 4CHKA 1WGGA 1T5XD 1BMLC 1SBBB 2DAJA 2BWES 1E7VA 4URKA 2M1MA 2KXJA 2GOWA 3DBRB 4W9EA 3PHWB 3RFZB 2JWUA 3NVVA 1L6VA 3T3NA 1P7EA 2C7HA 3N32A 4ICVA 1XT9B 3URYA 1HZ5A 2MJEA 5L95C 3R66C 2CHWA 4GLSC 3TEZA 3WAMA 4BOZB 4OZAA 3FILB 4GSWA 1YNTE 3P2BA 4A9AA 2JPHA 2R61A 2LI5A 1FEHA 2KWDA 3MJ5A 2K3UA 4BFRA 2IO2B 1EWYC 2VZKD 2L0FA 2AL3A 3AI5A 3ZRCA 4BOSC 2A5UA 3APDA 1OQQA 2AL6A 3PO0A 2LUEA 2BPSA 3SFEB 2WU5B 1KRHA 4R3DA 1DOYA 4W9HA 2MBHA 3APCA 4GGQA 2BVCA 5EE9A 3WAOA 3Q8CA 3NOBA 4L2YA 3TEWA 1QKZA 1DOXA 1N5XA 4N59A 3X23A 2DBYA 3T9LA 2YEPB 2QJLA 2WXKA 2PVOD 1L4DB 1V97A 3QA8A 2NTTA 3EA6A 2FAZA 1OFFA 1OQYA 4XZ4A 1WJ4A 4AUQC 1WJUA 4H2AA 3ZW3A 4MGKE 2XNAC 2ZNVB 1T6BX 5AEKB 1AN8A 1R4NI 1LFDA 2CJNA 4WJOA 4NJ6A 1DGJA 1SEBD 1B1ZA 3SEBA 3RCZA 3EUB2 3RI7C 3QK0A 1PDXA 4ZHOA 1RAXA 5DPRA 3PZDA 5CHWA 3NZSA 5TSSA 5E6PA 1OEYA 1QT9A 3EC8A 4LNOA 1WE6A 2OOBB 2NPTB 2WXHA 4WJNA 3Q2AC 1N61A 1BXTA 4FJYA 2LGDA 2EKEC 3AE1B 1VZ6A 3L10B 1YOVB 4L23A 1R4MB 3R2TA 2L32A 1OGWA 1FD6A 4GDKA 3C0RB 3UINB 4P6VF 2L8JA 4EUTA 1OEYJ 3A9JA 5AZFA 3NVWA 3ECIA 3T8MA 1IBXA 1PUTA 2D10A 2RGFA 5FK9C 3PS6A 3N3KB 2DENB 3H6NA 4PT5A 4GOCA 4FLHA 3OLMD 2WXQA 3R7QA 2ZEQA 2V3SA 1JMLA 3LXFA 2AQ3B 4JX1C 3SD5A 1TJEA 1FXTB 3MJWA 2AQ2B 4WAAA 2PW9A 3LB8C 3TCAA 5T8IA 3EFCA 3AE5B 1IGDA 1I7HA 2C5LC 1T3QA 2IJ0A 5IN7A 1P0RA 4BKGA 5TR5A 2LRUA 3IHPC 1QF6A 1B9RA 4HCNB 2KANA 3Q3OC 1I4RA 1ZKHA 3AEGB 4HLEA 2G3QB 4XWTA 1C78A 3AM9A 4B6WA 1YD8U 3IAM1 2ZJDA 2NMQA 2KACA 1SIJA 2KWVB 3Q3NC 4RF1A 3VH3B 2JWZA 4W9GA 2QDFA 3DDCB 5EE1A 3A1QB 4RM8A 3AE3B 5D94A 2L3ZA 1C4AA 3B9JA 3QWZB 1UF0A 1PGXA 2WHIA 1TS4A 2G4SA 2I1KA 2N7DA 1NBFC 3TUOA 3P42A 3WCQA 2WU2B 3IXSA 4KKJA 1JALA 4ZRKA 3PLVA 5DPTA 4BAXA 2KFJA 1E7PB 3D32A 3KUDB 3N1XC 2MQJA 4FN2A 4YTNB 3ZYYX 4GIVA 2L05A 2PEAA 3Q3JA 4II2B 2W3RA 1EU3A 2LJIA 2KMMA 1KM7A 4KSKC 2KVRA 5D2MB 1MPEA 1PFDA 4YWGG 5IOIA 1I4QA 1EM7A 2INCC 4RGOS 4W9CA 3MFGA 2K22A 2BYTA 1L0YB 5JHAA 4KGRA 4W9DA 2J0JA 2KVZA 2C7MB 3UQBA 1T0SC 2LMCA 2UU7A 1YN5A 1EU4A 4PYZA 2KDFB 3GP7A 2ONQA 4JWSC 2C7NB 1J7CA 2XBBC 3DBHI 1GUAB 3W9CB 4MJSB 3OAWA 1YX5B 3EHVA 4HPLB 3GB1A 4LNIA 1E9MA 3FKYA 1ACCA 3U4EG 2MJDA 1WJNA 1IP9A 2R2OA 5J2RA 5BYRA 4MELA 1XLNA 3NZUA 4AJYB 1EWCA 5HKHA 3VVWB 2IYDB 1YJIA 2RR9A 1YN4A 5JXVA 2WNMA 4CO7A 4M0WB 3BVZA 4NAWA 4XGAB 2J0KA 3P63A 2CHZA 1F0ZA 2BKFA 3AULA 2AX5A 1WGRA 2YVCA 1GG3A 1KLGD 2KO3A 2KFKA 1Z5SB 1JWUD 1XO3A 4P1BC 1Q10A 4LJPB 2D3AA 3ZNGC 2JRHA 2KTFA 2YEPF 3Q8AA 2LXCA 2MBBB 1E90A 2HJ1A 3NY5A 2BB6A 1WH3A 4NNJB 4I6LB 1WR6E 4IWQA 5FR3A 1V49A 1C76A 1L0XB 3MC8A 2GMIC 1FCLA 4WAFA 4YTMB 3PREA 3WA0A 2KX3A 2K9XA 3ZNHB 4KGTA 2QSDA 3A1QA 1FPYA 4O1NA 2D3BA 1I4GA 1GOZA 2BS2B 5DPWA 3VTVA 1QILA 3AU5A 2ASQA 2GI9A 4TSSA 1Y56A 3HM6X 2K6QA 2PKOA 4YTPB 1WMHB 2MBOA 4ZOHC 3HM3A 1JWBD 2PE9A 2J53A 4N6EB 1TKEA 2WXGA 3NS1A 4DHZE 3DVNU 2JY6A 2MBEA 4WJQA 1KH0A 2LVQA 3DWGC 3VUXA 2C60A 2W54A 1HE8A 3WAPA 3R7RA 5FR6A 1S1QB 2N7JA 2IPKD 2ZVOA 3GOEA 4IWPA 4MM3B 4AWJA 1WIAA 1VJKA 1J7BA 3AEFB 2KMAA 4PS7A 2UWQA 1N62A 4HJGE 1UGJA 4RCOA 2DZJA 1D5MC 4ZRJA 2K8HA 1TTNA 5G2NA 4PK1A 2Z59B 2EELA 1VD2A 1JRUA 4P1CC 3W5VB 2QC8A 2INPE 2FBWB 2K0PA 3HVDA 3TMPB 2D2QA 1WE7A 4FULA 4K3BA 2IY0B 3RNBC 2IO3B 4NJ7A 4FJVB 4KV2A 3VRAB 1V81A 2L76A 4RM9A 4KKIA 2Z0EB 3VH4B 2FNJB 3ZQ4A 3TEYA 2DZMA 4XX5A 4BKSA 3S2AA 4OZBA 2MWSB 1WRDB 4TUUA 1VR9A 3JSVA 3QX1A 4HDOA 2WXJA 4G3XB 4MJSA 2V4LA 2G9HD 3MC0B 3BYYB 1HTOA 2O6VB 3L08A 3CSTA 1RYJA 2OHFA 1SIFA 5C1ZA 4GMVA 3MTNB 3O65B 1WY8A 1FNWA 4E74A 2M8SA 3P1MA 1A70A 4NQKE 2WS3B 5AZGA 4DHZB 4GDKB 1F9JA 3C8YA 4F8CB 4A55A 2E6XA 4LK0M 3A9KA 4C00A 3JW0X 3A9JB 2WXIA 1HXYD 3UQAA 2JZ3B 3BK2A 1AW7A 3AE7B 1IBXB 1VDVA 2K1FA 1RFAA 2JSVX 4FBJB 1WFYA 2D11A 5D3DA 4AQ7A 3DVNV 4GU2A 4NY0A 4OVVA 5IAAC 1RRBA 1ZGUB 1DOIA 4HKQA 4K7UA 1T0YA 5C2TB 2G45B 2BYVE 1TIFA 2CKHB 2KZRA 3H7SA 3B08A 2RMMA 1RFKA 2EKIA 4YSYB 4JPSA 4AS1A 4EFOA 1IPGA 3KYDD 2K6DB 1HEZE 2BW2A 1TYGB 4JIOU 2DX5B 3Q8EA 3FC4A 3W1YA 2IO0B 3L4PA 2IBIB 3AU4A 1RM6C 3HVZA 4RFBA 2KOXA 3AE2B 4KIKA 1WMHA 2ZCCA 1E5WA 2BYEA 4HEA1 4DDID 3PRMB 4USAA 4B9KA 3BVGA 2KDBA 3MHSD 1I4XA 1JWSD 2M0AA 4Q2JA 2RD0A 2KC2A 2QIEB 3Q8BA 1QQRA 5BMIA 2V0GA 4MM3A 4N58A 4X57B 1TZOA 1VZ7A 5E6NA 4DK5A 1WZ3A 4LCDE 2WXPA 1QOBA 1ISNA 2PIAA 2DZIA 1PGAA 1WI0A 2FCSA 4MH0E 3BY4B 3BZDB 2N0SB 1ET9A 3KWLA 4TQ1A 2BS4B 4I6PA 4C4VB 5CX3A 2K25A 1G6JA 3WIMA 4RGNA 1WX8A 1F1HA 1FMAD 4ASWC 2MP2A 4JLCA 3H7PA 1N6ZA 4ICUA 2N7EA 2MCNB 1UBQA 1IUEA 1TGZB 2KQ7A 1UWMA 2ZW1A 3NHEB 3RD2A 3ZTCA 4RH6A 2INDC 3SDLC 3ZIMA 2Y5PA 1KFYB 2D07B 2W55A 3DBHB 3RPFC 4K3CA 5CHVC 1SF0A 2AYOB 2O6VA 3R2IA 2DYBA 3ZJUA 1P3QU 2IO1B 3QJZA 5AZHA 1A5RA 1WF9A 3L0WB 3IAS1 4ZYSA 3APFA 2BB5A 3ZNID 5GMVA 2L1AA 2JYTA 1WGDA 4W9JA 2JZPA 2M17A 3N1YC 4AP4C 2PE6B 1MVKA 3LJ3A 1LGRA 2B76B 5MPOA 3IVFA 4P16A 4ARIA 3PSEB 2IY1B 2VRRB 1P7FA 2V4IB 1I4HA 2GBNA 1ET6A 3KYCD 5KHQA 1TY2A 1XXGA 1WM3A 2X38A 4WWOA 1GNUA 3RUIB 4MGYE 4NAWB 2M0XA 3PTFC 3WANA 2DHZA 2L0TA 4XYCA 1L5PA 2KMCA 1WX9A 2N9LA 1GB1A 4W9KA 2KFKB 3V60A 2Y5BB 2K8CA 4A6QA 4DQOC 4HROA 1KLUD 4JWUC 4YSXB 3Q3MC 3IT4B 1EF5A 2GB1A 1ZW7A 1DYQA 4NPNA 1FRDA 5D3IB 1L4ZB 3W2DA 5E6OA 1RWSA 3AMZA 3K9PB 2N1WA 4FA6A 1K52A 4TKNA 4K7WA 3ABVB 4F1SA 1WXMA 5IA7A 1LM8B 3DBRI 1WGYA 2JF5A 1NENB 2G4DB 1UWXA 4TMAB 1FIQA 4ZHPA 1ENFA 3PHXB 2Y5CA 4JL9A 4DBGA 2JX5A 1YJJA 1ZE3D 3ZRFA 2LXAA 2LJ5A 2MW5A 1SE9A 1H4RA 3H1UA 4JGHB 3RNGC 3AECB 1ZXHA 2W82A 2KJRA 2DAFA 2EMSA 2KD0A 3TSSA 4HDQA 2MJ3A 2L7RA 5C3JB 3BINA 4NQLB 3U30A 4GB9A 4MDKE 5EE0A 2INNE 2NR2A 2BF8B 1BUIC 3SFDB 2UYZB 4EZLA 3VAWA 1I42A 1UUPA 3A33B 4C4VA 2OJRA 1CZPA 4HXDA 2HD5B 3U2SC 3VUWA 1UH6A 2N9EB 2HE7A 4HJKA 2DYMA 1JRPA 3IFWB 4HPMB 3B0AA 2FUG1 2KHWB 4LDTB 2CR5A 3ZDMC 1JW9D 3DHIC 2NBWB 3KWVA 3Q6BA 3RNFC 3JSVB 3ZLZA 4HVBA 4C7YA 3AE6B 2RPQA 4YSZB 1D5ZC 4MGZE 3W5UB 4L1BA 3AEBB 4TV3A 3VTUA 4HCPB 4ANVA 3U52E 2KDIA 1IGCA 3B2FA 2ZNVC 2DLBA 1SJHD 1MG8A 3Q8FA 4II3B 4MEMA 3I5JC 3UIPB 2J0MA 4W9LA 1C79A 4IW0A 1SE4A 2DNFA 3P4QB 3UIOB 3BVMA 2RDHA 1WXAA 1SE3A 4IWOA 2V9HA 2ZCBA 3GS2A 1CMXB 2FCQA 2PLPA 2GRIA 1WXQA 2KN4A 3A9KB 4M02A 4EEWA 4OHJA 1GAQB 3IT6B 1GB4A 4EZKA 5DPSA 2CU1A 2M56B 2MHJA 3R8BA 2KDEB 4S0RA 3I63C 1MG4A 1XCTL 2YLMA 3ZVVA 3WALA 3DCGA 2IGDA 4A20A 4NJCA 4IKGA 2FCMA 2JUOA 4EE2A 4B0MA 3ALBA 2H88B 1FXAA 4UDUC 1ZOYB 1YIWA 2GBMA 5I4DA 1GJZA 1VLBA 2O6VD 3U7DA 4HPPA 3L13A 2A4ZA 3GZNI 3M95A 3PVLA 2GLSA 2FIDA 1ZUD2 2N1VA 4JE3B 3P4SB 2BQQA 4GN1A 2ZVNA 1SSNA 2NVUI 1XQQA 2LGXA 2KC1A 3QAQA 4XDDA 1UBIA 3CF6E 5JHBA 1WM2A 1WYWB 2FCNA 2I2YA 3AEDB 1ZDVA 4OVUA 1QLBB 2WYQA 4RGMA 5CHFA 4G0NB 4E3CA 2KWUB 2XK5A 4FJZA 2WWZA 2K39A 3L17A 2PMVA 1SXTA 4TQ0A 1CJEA 2RPVA 2WX1A 3W1SA 3ML8A 2O2VB 1C77A 1R7SA 3AV8A 3M3JA 4M01A 4KIKB 1WX7A 1U4AA 4K7SA 1E7UA 2B3AA 4MH8A 3ZXRA 1KLVA 4M00A 2WXRA 4A8XC 4I6NB 3BIID 3TL5A 1SJED 2JT4B 2REXA 1F52A 3OWEB 2KX0A 1E0ZA 4CQNA 1WSPA 4MSQB 4WIPA 1V1OA 2J42A 4RGTA 1XLQA 1NDDA 4PYUA 5AUIA 1N60A 4DXAB 3AB5A 3OJ4B 2JU6X 2ZPYA 3VUYA 3ZTDA 1J8CA 4YT0B 3GE8C 2N9XA 1LQBA 1NYRA 2LUMA 4ZRPA 1D3ZA 3PRZA 2KNBA 4ANXA 2N9KA 2MP2B 1L7YA 3H7PB 2SEBD 4WQMA 3VXWA 2IGGA 1R4NB 4G11A 2LEKA 1QOAA 4KSLC 3AXCA 1Q1OA 3SU8X 5JH5C 3A4RA 3U7ZA 1WRIA 1TT5B 3BYTB 2BBCA 1C4PA 1WGKA 1MFWA 3HIZA 1XD3B 2NBUA 2WGSA 4FHJA 2V3NA 1WYGA 2OJWA 4HRSA 4OVZA 3C19A 3O13A 2EMTA 4IC7B 4KDLB 1AARA 1MJDA 1OQRA 3M62B 1V5OA 5E6JA 2JVCA 5HI1A 1C1YB 1I4PA 2N9PC 2KAJA 1QOFA 4KGSA 4C80A 5L83A 2KKCA 3QC8B 2V3PA 3DOWA 4DXGA 1UD7A 4DHJB 3CIRB 1YX6B 4IDIA 1FNVA 4XE0A 3P4PB 2C9WB 1KJTA 4EKUA 5AUKA 1K8RB 3Q3FA 3UI3A 1TS5A 2CJOA 2I38A 5LNK1 4AJWA 2LRWA 2N4FA 1J0GA 1J7AA 2Q5WD 1WXSA 3KVFB 1TKGA 2WXMA 4K1RB 4IUMB 4BBNF 2BTEA 1NYQA 1EF1A 3ML9A 2J52A 3PGEA 2JXTA 3KUCB 3KUZA 4LLGM 4C7ZA 2JQRB 5BYQA 1V8CA 1EUVB 3RNCC 2KT7A 3I3TB 1XF5L 1NEKB 3SHQA 2RDBC 2O2VA 3L16A 3QARA 5LLIA 5CTRC 4OW0A 4MSMB 1ZDXA 4WURA 3BWUD 3V3XA 1WXVA 3AE9B 3J9CA 1KTKA 2MBQA 3DVGY 2JYEA 1PYWD 2DYOA 3FAHA 4IOIE 4BKTA 2KN5A 4W9IA 2LHEA 5LXIB 4N9F4 2D3CA 3V05A 3CMMB 2J4XA 3JYUA 4J3OD 2LFIA 1RLFA 2BWFA 2ACZB 1WWTA 5BMGA 1YJ1A 2QILA 4A3OA 4LTUA 4RNAA 4ANWA 4WJPA 4IM2A 2MEKA 2WX0A 4XDCA 2NBVB 1JROA 3ZO5B 4M8MA 4GXBA 2KQSA 4HKZE 3NZ3A 2GBJA 2MX2A 4M8NA 3AEAB 3DBLI 2IDYA 1EO6A 4FHKA 2W3SA 3LYYA 4REZA 4ACFA 3AE4B 4KZ0A 2K5PA 1ZXIA 1Q0WB 4C56C 3TJPA 4FADA 2J7QB 2CS4A 2AQ1B 3NJTA 1SGHA 1C4CA 1BT0A 5D6JB 1LXDA 4KX6B 4XC2A 2KK8A 1E8ZA 1P1AA 1YN3A 1YQBA 1FM0D 2WXFA 3DPDA 1WJ6A 1N63A 1P9DU 3CSFA 2VH1A 4AOFA 4E71A 2KJ6A 4GDLB 2TSSA 4MT5A 2Z0DB 2QEJC 4CYEA 5HG2A 3DBSA 3R3MA 1STEA 1F77A 5G5GA 3PPAA 2XN9C 5G55A 4LDTD 1E8XA 1PQSA 3TBLD 3V61A 1HZ6A 2LZ6A 4BKSD 2WXLA 5BYSA 2PPHA 4YXDB 2KQ4X 4KVGB 1HQRD 3ETRA 3ONSA 2BT6A 1CK1A 4PS3A 4LNFA 1UELA 3DQVA 1MHHE 3ZDTA 2D3GA 4J6IA 1E8YA 2NTSA 1XCQL 3GZNB 3DWMA 4RF0A 1GC7A 2LHDA 4NAMA 3EGRA 3N1ZC 5IO9A 2VZKB 2PVGC 2W9NA 2ZW0A 3QHTA 5C23A 5HFYA 2LVPA 4IG7B 3ENEA 1L6UA 3ZJVA 1F2RI 2M19A 2K8BA 4KDIC 4MACA 1GC6A 1XLOA 2XK5B 5G5HA 2FIFA 2BGFA 3Q69A 5J18A 2FUHB 4PS8A 2JZZA 2ICIA 3NG0A 1F2RC 1V86A 3HHMA 2HDEA 2ON8A 3FILA 3X0WA 5BMHA 2PTLA 1TS3A 3HRDD 2LD9A 3JVZX 3QQ8B 2MRPA 1SB3C 3N20C 1JCKB 1V80A 1IYFA 1TZ1A 2WDQB 2LVOA 2JXXA 5LXHA 2JRIB 3SR6A 2M4NA 2WQYB 3P4RB 1KOTA 2KTRB 2ZPNA 3L54A 2MLBA 1Y8RC 2KDMA 2HJ8A 3CWIA 1S3SG 3NUHB 3Q14C 4P7IA 1NVID 5FKAC 4US9A 1ROEA 4XWWA 3NRZA 3AE8B 1E10A 4IM0A 3IG3A 3KQ4A 4A90A 3AH7A 5D7GA 4WWMA 4JQWC 3VDZA 1H8CA 1LO5D 2DZKA 1FO4A 3RNEC 2DWQA 3RYTA 3OG5A 2CU3A 2G1EA 1TY0A 4QAYA 3V62A 3VQIA 1XEEA 3ZGZA 3UF8A 2MSED 1GPXA 2QHOA 3PT2B 3V6EB 4ZRQA 1X1MA 5GXGB 3GE3C 1OTRB 1YQ4B 2BS3B 1XLPA 2QMTA 1AWDA 1AYFA 2FE8A 1E8WA 1ZP0B 4IM3A 1YMHE 2NPTA 3VR8B 4GDLA 2MH7A 4ARCA 1TS2A 2WXNA 3PLUA 1FFVA 1KF6B 3AN1A 4S17A 3N9YC 4W9FA 1R4MI 4B0EA 1V6EA 2NS5A 5J17A 2WP9B 1PGBA 2QCZA 3MC9A 1E6EB 3B1LX 2VH2A 2WLBA 4YL8A 2KJHB 4MGIE 3E56A 2L83A 5HHDG 4ZDVA 2KYWA 2WXOA 3DHGC 1D5XC 2NCNA 4LJOB 4KZCA 3VRBB 4LNNA 3DHHC 4ZYNA 1M94A 2RDGA 1Q5WB 3ZKJC 3KH0A 2HTHA 1JQ4A 3DVGX 1V1PB 1V2YA 1V5TA 4FXCA 2LGSA 5KHOA 3LDZE 4BVUC 3EFUA 1C3TA 3BK1A 2KLCA 2RSUA 1HTQA 2MA9B 3MHZA 1TKYA 2PJHA 4DWFA 2L52A 3IBEA 1Z2MA 2IZVB 3H8HA 3RT3B 3PV1A 1L2NA 3RULA 1J19A 2Y3AA 1UZXB 4WH4A 4DHJD 3RN9C 2KWCA 3HUIA 3RMKC 2SAKA 4WWPA 3M63B 4RMAA 1FXIA 3V6CB 1FNUA 5EE3A 3ZUNA 3W1SC 2KTRA 4ANUA 2AWTA 2AEHA 2IGHA 3N30A 1QZEA 3AEEB 3I9V1 3TIXA 2Z8LA 4ZRIA 4EOYA 4HWIB 1MHXA 1T0QC 5H8YE 2X8XX 3UGBB 2R2QA 3ZJTA 1CQVA 2I1JA 4US8A 1K53A 2E3TA 2BYFA 1WZ0A 3PZ7A 1NI3A 3QIJA 2LGIA 3A4SC 3NVYA 1FFUA 1N5WA 4NZLB 3MP9A 3I57A 4K81A 4A3PA 3PZ8A 3NVZA 3EECA 4EZJA 3K9OB 4LNKA 1MI0A 3DBLB 3OJ3A 2WDRB 3RNAC 2XEWA 4BBNC 3NS8A 2H89B 4D2KA 2ZZPB 4G50A 3H9DA 5BO4B 3E9SA 1VCBA 3KLSX 3RZWC 2V1YA 4WWNA 3KW5B 3U8ZA 2BKRB 2OEDA 1UNSA 1D4BA 1WGHA 2L00B 1TBEA 1K50A 3VTWA
chains in the Genus database with same CATH topology
2AX5A 1HA5A 1JROA 1KLGD 2JX5A 1FRRA 1YQ3B 1YJJA 1JWUD 4HKZE 1XO3A 3NZ3A 1ZE3D 1Q10A 1D6EC 2D5GA 3VR9B 2YEPF 3Q8AA 3AEAB 1ZPSA 3AECB 1ZXHA 2W82A 2BB6A 1ESFA 2IDYA 5FR3A 1L0VB 1FCCC 1C76A 1L0XB 2W3SA 3LYYA 4REZA 3TSSA 1SE2A 1QOGA 3AE4B 2MJ3A 1FCLA 2K5PA 4WAFA 5C3JB 1ZXIA 4YTMB 5H92C 4C56C 2K9XA 4KGTA 2QSDA 2AQ1B 5EE0A 2INNE 1C4CA 1K51A 4O1NA 1JWMD 4KX6B 2HTME 1I4GA 1M4VA 1BUIC 1VZ8A 3B2GA 4M0WA 3SFDB 1GOZA 1YN3A 3TEXA 2BS2B 4DXFA 4ITKA 1UUPA 1FM0D 2WXFA 4OZCA 1QILA 1VRAB 1V1PA 1C9FA 1N63A 2GI9A 4TSSA 1Y56A 1CZPA 1JWAD 2WDVB 3U2SC 3T3OA 2PKOA 4YTPB 4GDLB 2TSSA 4MT5A 2DYMA 4ZOHC 1JWBD 2QEJC 1JRPA 5HG2A 2J53A 4N6EB 1TKEA 2WXGA 3NS1A 1STEA 1F77A 5G5GA 2FUG1 1T5XD 2XN9C 1BMLC 1KH0A 1SBBB 1JW9D 3DWGC 3KWVA 2W54A 1HZ6A 4C7YA 3AE6B 4YSZB 1D5ZC 2N7JA 2IPKD 4MM3B 3W5UB 2WXLA 5BYSA 3RFZB 4L1BA 3AEBB 2JWUA 3NVVA 4YXDB 1L6VA 2KQ4X 3T3NA 1P7EA 1HQRD 3ETRA 3U52E 1VJKA 3URYA 1J7BA 3AEFB 1HZ5A 2MJEA 2BT6A 1CK1A 1IGCA 1N62A 3B2FA 1UGJA 4GLSC 4HJGE 4RCOA 1D5MC 2DLBA 1SJHD 3TEZA 3Q8FA 4OZAA 1MHHE 3FILB 2EELA 1YNTE 3W5VB 2NTSA 2INPE 1XCQL 4RF0A 3DWMA 4A9AA 1C79A 2FBWB 2K0PA 1SE4A 2LHDA 3HVDA 3P4QB 2R61A 4NAMA 3EGRA 1FEHA 3BVMA 2RDHA 2KWDA 3MJ5A 2VZKB 2K3UA 1SE3A 2PVGC 3VRAB 1EWYC 2VZKD 3GS2A 2ZW0A 2PLPA 4KKIA 2GRIA 1OQQA 1WXQA 2KN4A 3PO0A 4OHJA 5HFYA 1GAQB 3ZQ4A 3IT6B 3TEYA 1L6UA 1GB4A 3SFEB 2WU5B 4OZBA 3ZJVA 1F2RI 2M19A 2M56B 3R8BA 1VR9A 4MACA 1XLOA 2WXJA 5G5HA 1XCTL 1KRHA 4R3DA 2G9HD 1DOYA 2IGDA 3MC0B 3Q69A 4NJCA 4IKGA 4EE2A 4B0MA 2H88B 3BYYB 5EE9A 1FXAA 4UDUC 1ZOYB 3Q8CA 2ICIA 1F2RC 5I4DA 4L2YA 1RYJA 2OHFA 1VLBA 3TEWA 1QKZA 1DOXA 2HDEA 2ON8A 1N5XA 4N59A 3FILA 5BMHA 2DBYA 2PTLA 1TS3A 1ZUD2 2YEPB 4JE3B 3P4SB 3HRDD 2QJLA 2WXKA 2PVOD 1L4DB 1V97A 1FNWA 1SB3C 1JCKB 1SSNA 1A70A 2NTTA 3EA6A 3P1MA 2WDQB 1OFFA 2WS3B 3SR6A 4H2AA 4GDKB 3C8YA 4A55A 2WQYB 2E6XA 2XNAC 4LK0M 1T6BX 4XDDA 3P4RB 1AN8A 2CJNA 1DGJA 1SEBD 1B1ZA 2WXIA 3SEBA 3EUB2 2I2YA 1HXYD 3AEDB 3BK2A 1AW7A 1ZDVA 2KDMA 1QLBB 1VDVA 3AE7B 1IBXB 3CWIA 3NUHB 4RGMA 1PDXA 4ZHOA 1NVID 5FKAC 2JSVX 4US9A 1ROEA 5D3DA 4AQ7A 4XWWA 2PMVA 1SXTA 3AE8B 3NRZA 4TQ0A 1CJEA 2RPVA 5TSSA 3W1SA 1E10A 1QT9A 1C77A 1DOIA 1R7SA 3AV8A 4HKQA 3KQ4A 4A90A 3AH7A 5D7GA 2WXHA 4WWMA 4MH8A 1N61A 1BXTA 2WXRA 1LO5D 5C2TB 1FO4A 3AE1B 4A8XC 3BIID 1VZ6A 4L23A 1SJED 2DWQA 3OWEB 2CU3A 2RMMA 3R2TA 2G1EA 2L32A 1TY0A 1FD6A 1RFKA 2EKIA 1E0ZA 3VQIA 4CQNA 1XEEA 4YSYB 1WSPA 3ZGZA 4JPSA 4WIPA 4P6VF 1V1OA 2J42A 4AS1A 1GPXA 4RGTA 1XLQA 4ZRQA 5AUIA 1HEZE 1N60A 2BW2A 3NVWA 3AB5A 1IBXA 1TYGB 1PUTA 3Q8EA 5GXGB 3FC4A 2JU6X 5FK9C 1YQ4B 3L4PA 4PT5A 2BS3B 2WXQA 1XLPA 2QMTA 1RM6C 1AWDA 4YT0B 3HVZA 1JMLA 3LXFA 1AYFA 2FE8A 4RFBA 1ZP0B 2AQ3B 4JX1C 3AE2B 1NYRA 2LUMA 1YMHE 4ZRPA 1TJEA 3VR8B 4ARCA 2AQ2B 2MH7A 1TS2A 4HEA1 2PW9A 2WXNA 3LB8C 1FFVA 1KF6B 3AN1A 5T8IA 3N9YC 2N9KA 3AE5B 1IGDA 1I7HA 4B0EA 1T3QA 2SEBD 4WQMA 2IJ0A 4USAA 4XDCA 2WP9B 1PGBA 3BVGA 2IGGA 1I4XA 1E6EB 1JWSD 2M0AA 4Q2JA 1QF6A 1B9RA 2LEKA 2WLBA 1QOAA 1I4RA 2QIEB 3Q8BA 1QQRA 5BMIA 3AEGB 2V0GA 3U7ZA 4N58A 1WRIA 1TZOA 1VZ7A 1C78A 3E56A 4XWTA 2L83A 5HHDG 3AM9A 3IAM1 2WXPA 3BYTB 2NMQA 2KACA 2BBCA 2WXOA 1SIJA 1D5XC 4RF1A 1QOBA 1C4PA 3VRBB 2PIAA 1WGKA 5EE1A 1PGAA 3BZDB 2N0SB 1ET9A 3AE3B 3KWLA 2RDGA 4TQ1A 2BS4B 1JQ4A 2V3NA 1WYGA 4HRSA 4OVZA 1C4AA 1V1PB 3B9JA 3O13A 1PGXA 1TS4A 4RGNA 4FXCA 1FMAD 1OQRA 3TUOA 3BK1A 5E6JA 3P42A 5HI1A 3WCQA 2WU2B 3MHZA 3IXSA 4KKJA 1JALA 1I4PA 2KAJA 1QOFA 1IUEA 4KGSA 4C80A 1TKYA 1E7PB 2L52A 1UWMA 2ZW1A 2V3PA 4RH6A 4YTNB 4DXGA 2Y5PA 3H8HA 3ZYYX 1KFYB 2W55A 3RPFC 1SF0A 3CIRB 2Y3AA 1FNVA 3R2IA 4IDIA 4XE0A 3ZJUA 4WH4A 2W3RA 3HUIA 3P4PB 3IAS1 4ZYSA 1EU3A 5AUKA 2LJIA 2BB5A 2SAKA 3UI3A 1TS5A 2KMMA 2L1AA 2CJOA 2I38A 1MPEA 2JYTA 5LNK1 1PFDA 4YWGG 1FXIA 2JZPA 1J7AA 2Q5WD 1TKGA 2WXMA 1MVKA 1I4QA 1FNUA 5EE3A 2BTEA 1NYQA 2J52A 1EM7A 2B76B 5MPOA 4RGOS 3MFGA 2JXTA 2K22A 2BYTA 4P16A 4ARIA 1L0YB 4LLGM 4C7ZA 4KGRA 2JQRB 5BYQA 1P7FA 2V4IB 2IGHA 1I4HA 2LMCA 1V8CA 1ET6A 1EU4A 1YN5A 3AEEB 3I9V1 1TY2A 1XXGA 3GP7A 2ONQA 2Z8LA 2X38A 4JWSC 1MHXA 1J7CA 1XF5L 1NEKB 5H8YE 3W9CB 4NAWB 3ZJTA 1CQVA 4US8A 1K53A 2E3TA 3GB1A 4OW0A 1ZDXA 1L5PA 4WURA 3PZ7A 1NI3A 3BWUD 3V3XA 2LGIA 1E9MA 2N9LA 1GB1A 3AE9B 1ACCA 3J9CA 3U4EG 2MJDA 1KTKA 4A6QA 3NVYA 1FFUA 4DQOC 1N5WA 4NZLB 4HROA 1KLUD 4JWUC 2JYEA 1PYWD 3MP9A 2DYOA 3FAHA 3IT4B 4YSXB 3I57A 4IOIE 5BYRA 3PZ8A 1XLNA 3NVZA 2GB1A 2LHEA 3V05A 1EWCA 2J4XA 1MI0A 1DYQA 1FRDA 2WDRB 5D3IB 1L4ZB 3W2DA 1YJIA 2H89B 2LFIA 4J3OD 1YN4A 1RWSA 3AMZA 4D2KA 5JXVA 2ACZB 1WWTA 1K52A 5BMGA 3E9SA 3ABVB 2WNMA 2QILA 3KLSX 1NENB 3BVZA 1UWXA 4TMAB 1FIQA 4LTUA 4RNAA 4ZHPA 2OEDA 3P63A 1UNSA 1D4BA 1F0ZA 2MEKA 1ENFA 1K50A 2Y5CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WH4 A;  2ZW0 A;  2PLP A;  1HEZ E;  2KN4 A;  4HKZ E;  1IBX A;  5HFY A;  1Q10 A;  3UI3 A;  2JU6 X;  1GB4 A;  4OZB A;  1F2R I;  2I38 A;  1MPE A;  4MAC A;  2QMT A;  2JZP A;  1ZXH A;  1XCT L;  1JML A;  1FCC C;  1MVK A;  2IGD A;  2LUM A;  1YMH E;  4IKG A;  2J52 A;  1EM7 A;  1FCL A;  2JXT A;  2PW9 A;  1F2R C;  4KGR A;  1QKZ A;  2N9K A;  2ON8 A;  4KGT A;  2QSD A;  1P7F A;  1IGD A;  2IGH A;  1K51 A;  3FIL A;  5BMH A;  2PTL A;  1PGB A;  2IGG A;  2ONQ A;  1MHX A;  1XF5 L;  4OZC A;  1C9F A;  2GI9 A;  5BMI A;  1K53 A;  5HHD G;  3GB1 A;  2NMQ A;  2KAC A;  3V3X A;  2LGI A;  2N9L A;  1GB1 A;  5HG2 A;  2J53 A;  2I2Y A;  1PGA A;  1IBX B;  2KDM A;  1KH0 A;  2JSV X;  3MP9 A;  2RPV A;  4IOI E;  1HZ6 A;  2GB1 A;  2N7J A;  2LHE A;  1PGX A;  1MI0 A;  2JWU A;  2KQ4 X;  1P7E A;  1HZ5 A;  4D2K A;  1IGC A;  4HJG E;  4GLS C;  5JXV A;  5HI1 A;  1K52 A;  5BMG A;  4OZA A;  1MHH E;  3FIL B;  2EEL A;  1YNT E;  4KGS A;  1XCQ L;  1UWX A;  2ZW1 A;  2K0P A;  2RMM A;  2LHD A;  2OED A;  1FD6 A;  1D4B A;  2KWD A;  1K50 A; 
#chains in the Genus database with same CATH topology
 1HA5 A;  4WQO B;  5IP4 D;  1FRR A;  1YQ3 B;  2CHX A;  1T0R C;  1V9J A;  2LAS A;  1D6E C;  3HK0 A;  2D5G A;  3VR9 B;  2LWP A;  1NI2 A;  2GBR A;  2KLG A;  3ZNZ B;  1ZPS A;  3ZXV A;  1ESF A;  1WR1 A;  3PRP B;  1L0V B;  1FCC C;  4F7Z A;  5DCN A;  2WDT B;  5EDS A;  1SE2 A;  1QOG A;  3VHT C;  2GBK A;  5H92 C;  1P98 A;  4BZA A;  5JZE B;  1K51 A;  1JWM D;  2HTM E;  1M4V A;  1VZ8 A;  3B2G A;  3RZF A;  4M0W A;  4DDG D;  2LGY A;  3TEX A;  4DXF A;  4ITK A;  4OZC A;  1VRA B;  1V1P A;  3QCA A;  1C9F A;  1JWA D;  2WDV B;  3VFK A;  4B95 A;  1I35 A;  4HK2 A;  3T3O A;  1UGM A;  5IKC M;  4CHK A;  1WGG A;  1T5X D;  1BML C;  1SBB B;  2DAJ A;  2BWE S;  1E7V A;  4URK A;  2M1M A;  2KXJ A;  2GOW A;  3DBR B;  4W9E A;  3PHW B;  3RFZ B;  2JWU A;  3NVV A;  1L6V A;  3T3N A;  1P7E A;  2C7H A;  3N32 A;  4ICV A;  1XT9 B;  3URY A;  1HZ5 A;  2MJE A;  5L95 C;  3R66 C;  2CHW A;  4GLS C;  3TEZ A;  3WAM A;  4BOZ B;  4OZA A;  3FIL B;  4GSW A;  1YNT E;  3P2B A;  4A9A A;  2JPH A;  2R61 A;  2LI5 A;  1FEH A;  2KWD A;  3MJ5 A;  2K3U A;  4BFR A;  2IO2 B;  1EWY C;  2VZK D;  2L0F A;  2AL3 A;  3AI5 A;  3ZRC A;  4BOS C;  2A5U A;  3APD A;  1OQQ A;  2AL6 A;  3PO0 A;  2LUE A;  2BPS A;  3SFE B;  2WU5 B;  1KRH A;  4R3D A;  1DOY A;  4W9H A;  2MBH A;  3APC A;  4GGQ A;  2BVC A;  5EE9 A;  3WAO A;  3Q8C A;  3NOB A;  4L2Y A;  3TEW A;  1QKZ A;  1DOX A;  1N5X A;  4N59 A;  3X23 A;  2DBY A;  3T9L A;  2YEP B;  2QJL A;  2WXK A;  2PVO D;  1L4D B;  1V97 A;  3QA8 A;  2NTT A;  3EA6 A;  2FAZ A;  1OFF A;  1OQY A;  4XZ4 A;  1WJ4 A;  4AUQ C;  1WJU A;  4H2A A;  3ZW3 A;  4MGK E;  2XNA C;  2ZNV B;  1T6B X;  5AEK B;  1AN8 A;  1R4N I;  1LFD A;  2CJN A;  4WJO A;  4NJ6 A;  1DGJ A;  1SEB D;  1B1Z A;  3SEB A;  3RCZ A;  3EUB 2;  3RI7 C;  3QK0 A;  1PDX A;  4ZHO A;  1RAX A;  5DPR A;  3PZD A;  5CHW A;  3NZS A;  5TSS A;  5E6P A;  1OEY A;  1QT9 A;  3EC8 A;  4LNO A;  1WE6 A;  2OOB B;  2NPT B;  2WXH A;  4WJN A;  3Q2A C;  1N61 A;  1BXT A;  4FJY A;  2LGD A;  2EKE C;  3AE1 B;  1VZ6 A;  3L10 B;  1YOV B;  4L23 A;  1R4M B;  3R2T A;  2L32 A;  1OGW A;  1FD6 A;  4GDK A;  3C0R B;  3UIN B;  4P6V F;  2L8J A;  4EUT A;  1OEY J;  3A9J A;  5AZF A;  3NVW A;  3ECI A;  3T8M A;  1IBX A;  1PUT A;  2D10 A;  2RGF A;  5FK9 C;  3PS6 A;  3N3K B;  2DEN B;  3H6N A;  4PT5 A;  4GOC A;  4FLH A;  3OLM D;  2WXQ A;  3R7Q A;  2ZEQ A;  2V3S A;  1JML A;  3LXF A;  2AQ3 B;  4JX1 C;  3SD5 A;  1TJE A;  1FXT B;  3MJW A;  2AQ2 B;  4WAA A;  2PW9 A;  3LB8 C;  3TCA A;  5T8I A;  3EFC A;  3AE5 B;  1IGD A;  1I7H A;  2C5L C;  1T3Q A;  2IJ0 A;  5IN7 A;  1P0R A;  4BKG A;  5TR5 A;  2LRU A;  3IHP C;  1QF6 A;  1B9R A;  4HCN B;  2KAN A;  3Q3O C;  1I4R A;  1ZKH A;  3AEG B;  4HLE A;  2G3Q B;  4XWT A;  1C78 A;  3AM9 A;  4B6W A;  1YD8 U;  3IAM 1;  2ZJD A;  2NMQ A;  2KAC A;  1SIJ A;  2KWV B;  3Q3N C;  4RF1 A;  3VH3 B;  2JWZ A;  4W9G A;  2QDF A;  3DDC B;  5EE1 A;  3A1Q B;  4RM8 A;  3AE3 B;  5D94 A;  2L3Z A;  1C4A A;  3B9J A;  3QWZ B;  1UF0 A;  1PGX A;  2WHI A;  1TS4 A;  2G4S A;  2I1K A;  2N7D A;  1NBF C;  3TUO A;  3P42 A;  3WCQ A;  2WU2 B;  3IXS A;  4KKJ A;  1JAL A;  4ZRK A;  3PLV A;  5DPT A;  4BAX A;  2KFJ A;  1E7P B;  3D32 A;  3KUD B;  3N1X C;  2MQJ A;  4FN2 A;  4YTN B;  3ZYY X;  4GIV A;  2L05 A;  2PEA A;  3Q3J A;  4II2 B;  2W3R A;  1EU3 A;  2LJI A;  2KMM A;  1KM7 A;  4KSK C;  2KVR A;  5D2M B;  1MPE A;  1PFD A;  4YWG G;  5IOI A;  1I4Q A;  1EM7 A;  2INC C;  4RGO S;  4W9C A;  3MFG A;  2K22 A;  2BYT A;  1L0Y B;  5JHA A;  4KGR A;  4W9D A;  2J0J A;  2KVZ A;  2C7M B;  3UQB A;  1T0S C;  2LMC A;  2UU7 A;  1YN5 A;  1EU4 A;  4PYZ A;  2KDF B;  3GP7 A;  2ONQ A;  4JWS C;  2C7N B;  1J7C A;  2XBB C;  3DBH I;  1GUA B;  3W9C B;  4MJS B;  3OAW A;  1YX5 B;  3EHV A;  4HPL B;  3GB1 A;  4LNI A;  1E9M A;  3FKY A;  1ACC A;  3U4E G;  2MJD A;  1WJN A;  1IP9 A;  2R2O A;  5J2R A;  5BYR A;  4MEL A;  1XLN A;  3NZU A;  4AJY B;  1EWC A;  5HKH A;  3VVW B;  2IYD B;  1YJI A;  2RR9 A;  1YN4 A;  5JXV A;  2WNM A;  4CO7 A;  4M0W B;  3BVZ A;  4NAW A;  4XGA B;  2J0K A;  3P63 A;  2CHZ A;  1F0Z A;  2BKF A;  3AUL A;  2AX5 A;  1WGR A;  2YVC A;  1GG3 A;  1KLG D;  2KO3 A;  2KFK A;  1Z5S B;  1JWU D;  1XO3 A;  4P1B C;  1Q10 A;  4LJP B;  2D3A A;  3ZNG C;  2JRH A;  2KTF A;  2YEP F;  3Q8A A;  2LXC A;  2MBB B;  1E90 A;  2HJ1 A;  3NY5 A;  2BB6 A;  1WH3 A;  4NNJ B;  4I6L B;  1WR6 E;  4IWQ A;  5FR3 A;  1V49 A;  1C76 A;  1L0X B;  3MC8 A;  2GMI C;  1FCL A;  4WAF A;  4YTM B;  3PRE A;  3WA0 A;  2KX3 A;  2K9X A;  3ZNH B;  4KGT A;  2QSD A;  3A1Q A;  1FPY A;  4O1N A;  2D3B A;  1I4G A;  1GOZ A;  2BS2 B;  5DPW A;  3VTV A;  1QIL A;  3AU5 A;  2ASQ A;  2GI9 A;  4TSS A;  1Y56 A;  3HM6 X;  2K6Q A;  2PKO A;  4YTP B;  1WMH B;  2MBO A;  4ZOH C;  3HM3 A;  1JWB D;  2PE9 A;  2J53 A;  4N6E B;  1TKE A;  2WXG A;  3NS1 A;  4DHZ E;  3DVN U;  2JY6 A;  2MBE A;  4WJQ A;  1KH0 A;  2LVQ A;  3DWG C;  3VUX A;  2C60 A;  2W54 A;  1HE8 A;  3WAP A;  3R7R A;  5FR6 A;  1S1Q B;  2N7J A;  2IPK D;  2ZVO A;  3GOE A;  4IWP A;  4MM3 B;  4AWJ A;  1WIA A;  1VJK A;  1J7B A;  3AEF B;  2KMA A;  4PS7 A;  2UWQ A;  1N62 A;  4HJG E;  1UGJ A;  4RCO A;  2DZJ A;  1D5M C;  4ZRJ A;  2K8H A;  1TTN A;  5G2N A;  4PK1 A;  2Z59 B;  2EEL A;  1VD2 A;  1JRU A;  4P1C C;  3W5V B;  2QC8 A;  2INP E;  2FBW B;  2K0P A;  3HVD A;  3TMP B;  2D2Q A;  1WE7 A;  4FUL A;  4K3B A;  2IY0 B;  3RNB C;  2IO3 B;  4NJ7 A;  4FJV B;  4KV2 A;  3VRA B;  1V81 A;  2L76 A;  4RM9 A;  4KKI A;  2Z0E B;  3VH4 B;  2FNJ B;  3ZQ4 A;  3TEY A;  2DZM A;  4XX5 A;  4BKS A;  3S2A A;  4OZB A;  2MWS B;  1WRD B;  4TUU A;  1VR9 A;  3JSV A;  3QX1 A;  4HDO A;  2WXJ A;  4G3X B;  4MJS A;  2V4L A;  2G9H D;  3MC0 B;  3BYY B;  1HTO A;  2O6V B;  3L08 A;  3CST A;  1RYJ A;  2OHF A;  1SIF A;  5C1Z A;  4GMV A;  3MTN B;  3O65 B;  1WY8 A;  1FNW A;  4E74 A;  2M8S A;  3P1M A;  1A70 A;  4NQK E;  2WS3 B;  5AZG A;  4DHZ B;  4GDK B;  1F9J A;  3C8Y A;  4F8C B;  4A55 A;  2E6X A;  4LK0 M;  3A9K A;  4C00 A;  3JW0 X;  3A9J B;  2WXI A;  1HXY D;  3UQA A;  2JZ3 B;  3BK2 A;  1AW7 A;  3AE7 B;  1IBX B;  1VDV A;  2K1F A;  1RFA A;  2JSV X;  4FBJ B;  1WFY A;  2D11 A;  5D3D A;  4AQ7 A;  3DVN V;  4GU2 A;  4NY0 A;  4OVV A;  5IAA C;  1RRB A;  1ZGU B;  1DOI A;  4HKQ A;  4K7U A;  1T0Y A;  5C2T B;  2G45 B;  2BYV E;  1TIF A;  2CKH B;  2KZR A;  3H7S A;  3B08 A;  2RMM A;  1RFK A;  2EKI A;  4YSY B;  4JPS A;  4AS1 A;  4EFO A;  1IPG A;  3KYD D;  2K6D B;  1HEZ E;  2BW2 A;  1TYG B;  4JIO U;  2DX5 B;  3Q8E A;  3FC4 A;  3W1Y A;  2IO0 B;  3L4P A;  2IBI B;  3AU4 A;  1RM6 C;  3HVZ A;  4RFB A;  2KOX A;  3AE2 B;  4KIK A;  1WMH A;  2ZCC A;  1E5W A;  2BYE A;  4HEA 1;  4DDI D;  3PRM B;  4USA A;  4B9K A;  3BVG A;  2KDB A;  3MHS D;  1I4X A;  1JWS D;  2M0A A;  4Q2J A;  2RD0 A;  2KC2 A;  2QIE B;  3Q8B A;  1QQR A;  5BMI A;  2V0G A;  4MM3 A;  4N58 A;  4X57 B;  1TZO A;  1VZ7 A;  5E6N A;  4DK5 A;  1WZ3 A;  4LCD E;  2WXP A;  1QOB A;  1ISN A;  2PIA A;  2DZI A;  1PGA A;  1WI0 A;  2FCS A;  4MH0 E;  3BY4 B;  3BZD B;  2N0S B;  1ET9 A;  3KWL A;  4TQ1 A;  2BS4 B;  4I6P A;  4C4V B;  5CX3 A;  2K25 A;  1G6J A;  3WIM A;  4RGN A;  1WX8 A;  1F1H A;  1FMA D;  4ASW C;  2MP2 A;  4JLC A;  3H7P A;  1N6Z A;  4ICU A;  2N7E A;  2MCN B;  1UBQ A;  1IUE A;  1TGZ B;  2KQ7 A;  1UWM A;  2ZW1 A;  3NHE B;  3RD2 A;  3ZTC A;  4RH6 A;  2IND C;  3SDL C;  3ZIM A;  2Y5P A;  1KFY B;  2D07 B;  2W55 A;  3DBH B;  3RPF C;  4K3C A;  5CHV C;  1SF0 A;  2AYO B;  2O6V A;  3R2I A;  2DYB A;  3ZJU A;  1P3Q U;  2IO1 B;  3QJZ A;  5AZH A;  1A5R A;  1WF9 A;  3L0W B;  3IAS 1;  4ZYS A;  3APF A;  2BB5 A;  3ZNI D;  5GMV A;  2L1A A;  2JYT A;  1WGD A;  4W9J A;  2JZP A;  2M17 A;  3N1Y C;  4AP4 C;  2PE6 B;  1MVK A;  3LJ3 A;  1LGR A;  2B76 B;  5MPO A;  3IVF A;  4P16 A;  4ARI A;  3PSE B;  2IY1 B;  2VRR B;  1P7F A;  2V4I B;  1I4H A;  2GBN A;  1ET6 A;  3KYC D;  5KHQ A;  1TY2 A;  1XXG A;  1WM3 A;  2X38 A;  4WWO A;  1GNU A;  3RUI B;  4MGY E;  4NAW B;  2M0X A;  3PTF C;  3WAN A;  2DHZ A;  2L0T A;  4XYC A;  1L5P A;  2KMC A;  1WX9 A;  2N9L A;  1GB1 A;  4W9K A;  2KFK B;  3V60 A;  2Y5B B;  2K8C A;  4A6Q A;  4DQO C;  4HRO A;  1KLU D;  4JWU C;  4YSX B;  3Q3M C;  3IT4 B;  1EF5 A;  2GB1 A;  1ZW7 A;  1DYQ A;  4NPN A;  1FRD A;  5D3I B;  1L4Z B;  3W2D A;  5E6O A;  1RWS A;  3AMZ A;  3K9P B;  2N1W A;  4FA6 A;  1K52 A;  4TKN A;  4K7W A;  3ABV B;  4F1S A;  1WXM A;  5IA7 A;  1LM8 B;  3DBR I;  1WGY A;  2JF5 A;  1NEN B;  2G4D B;  1UWX A;  4TMA B;  1FIQ A;  4ZHP A;  1ENF A;  3PHX B;  2Y5C A;  4JL9 A;  4DBG A;  2JX5 A;  1YJJ A;  1ZE3 D;  3ZRF A;  2LXA A;  2LJ5 A;  2MW5 A;  1SE9 A;  1H4R A;  3H1U A;  4JGH B;  3RNG C;  3AEC B;  1ZXH A;  2W82 A;  2KJR A;  2DAF A;  2EMS A;  2KD0 A;  3TSS A;  4HDQ A;  2MJ3 A;  2L7R A;  5C3J B;  3BIN A;  4NQL B;  3U30 A;  4GB9 A;  4MDK E;  5EE0 A;  2INN E;  2NR2 A;  2BF8 B;  1BUI C;  3SFD B;  2UYZ B;  4EZL A;  3VAW A;  1I42 A;  1UUP A;  3A33 B;  4C4V A;  2OJR A;  1CZP A;  4HXD A;  2HD5 B;  3U2S C;  3VUW A;  1UH6 A;  2N9E B;  2HE7 A;  4HJK A;  2DYM A;  1JRP A;  3IFW B;  4HPM B;  3B0A A;  2FUG 1;  2KHW B;  4LDT B;  2CR5 A;  3ZDM C;  1JW9 D;  3DHI C;  2NBW B;  3KWV A;  3Q6B A;  3RNF C;  3JSV B;  3ZLZ A;  4HVB A;  4C7Y A;  3AE6 B;  2RPQ A;  4YSZ B;  1D5Z C;  4MGZ E;  3W5U B;  4L1B A;  3AEB B;  4TV3 A;  3VTU A;  4HCP B;  4ANV A;  3U52 E;  2KDI A;  1IGC A;  3B2F A;  2ZNV C;  2DLB A;  1SJH D;  1MG8 A;  3Q8F A;  4II3 B;  4MEM A;  3I5J C;  3UIP B;  2J0M A;  4W9L A;  1C79 A;  4IW0 A;  1SE4 A;  2DNF A;  3P4Q B;  3UIO B;  3BVM A;  2RDH A;  1WXA A;  1SE3 A;  4IWO A;  2V9H A;  2ZCB A;  3GS2 A;  1CMX B;  2FCQ A;  2PLP A;  2GRI A;  1WXQ A;  2KN4 A;  3A9K B;  4M02 A;  4EEW A;  4OHJ A;  1GAQ B;  3IT6 B;  1GB4 A;  4EZK A;  5DPS A;  2CU1 A;  2M56 B;  2MHJ A;  3R8B A;  2KDE B;  4S0R A;  3I63 C;  1MG4 A;  1XCT L;  2YLM A;  3ZVV A;  3WAL A;  3DCG A;  2IGD A;  4A20 A;  4NJC A;  4IKG A;  2FCM A;  2JUO A;  4EE2 A;  4B0M A;  3ALB A;  2H88 B;  1FXA A;  4UDU C;  1ZOY B;  1YIW A;  2GBM A;  5I4D A;  1GJZ A;  1VLB A;  2O6V D;  3U7D A;  4HPP A;  3L13 A;  2A4Z A;  3GZN I;  3M95 A;  3PVL A;  2GLS A;  2FID A;  1ZUD 2;  2N1V A;  4JE3 B;  3P4S B;  2BQQ A;  4GN1 A;  2ZVN A;  1SSN A;  2NVU I;  1XQQ A;  2LGX A;  2KC1 A;  3QAQ A;  4XDD A;  1UBI A;  3CF6 E;  5JHB A;  1WM2 A;  1WYW B;  2FCN A;  2I2Y A;  3AED B;  1ZDV A;  4OVU A;  1QLB B;  2WYQ A;  4RGM A;  5CHF A;  4G0N B;  4E3C A;  2KWU B;  2XK5 A;  4FJZ A;  2WWZ A;  2K39 A;  3L17 A;  2PMV A;  1SXT A;  4TQ0 A;  1CJE A;  2RPV A;  2WX1 A;  3W1S A;  3ML8 A;  2O2V B;  1C77 A;  1R7S A;  3AV8 A;  3M3J A;  4M01 A;  4KIK B;  1WX7 A;  1U4A A;  4K7S A;  1E7U A;  2B3A A;  4MH8 A;  3ZXR A;  1KLV A;  4M00 A;  2WXR A;  4A8X C;  4I6N B;  3BII D;  3TL5 A;  1SJE D;  2JT4 B;  2REX A;  1F52 A;  3OWE B;  2KX0 A;  1E0Z A;  4CQN A;  1WSP A;  4MSQ B;  4WIP A;  1V1O A;  2J42 A;  4RGT A;  1XLQ A;  1NDD A;  4PYU A;  5AUI A;  1N60 A;  4DXA B;  3AB5 A;  3OJ4 B;  2JU6 X;  2ZPY A;  3VUY A;  3ZTD A;  1J8C A;  4YT0 B;  3GE8 C;  2N9X A;  1LQB A;  1NYR A;  2LUM A;  4ZRP A;  1D3Z A;  3PRZ A;  2KNB A;  4ANX A;  2N9K A;  2MP2 B;  1L7Y A;  3H7P B;  2SEB D;  4WQM A;  3VXW A;  2IGG A;  1R4N B;  4G11 A;  2LEK A;  1QOA A;  4KSL C;  3AXC A;  1Q1O A;  3SU8 X;  5JH5 C;  3A4R A;  3U7Z A;  1WRI A;  1TT5 B;  3BYT B;  2BBC A;  1C4P A;  1WGK A;  1MFW A;  3HIZ A;  1XD3 B;  2NBU A;  2WGS A;  4FHJ A;  2V3N A;  1WYG A;  2OJW A;  4HRS A;  4OVZ A;  3C19 A;  3O13 A;  2EMT A;  4IC7 B;  4KDL B;  1AAR A;  1MJD A;  1OQR A;  3M62 B;  1V5O A;  5E6J A;  2JVC A;  5HI1 A;  1C1Y B;  1I4P A;  2N9P C;  2KAJ A;  1QOF A;  4KGS A;  4C80 A;  5L83 A;  2KKC A;  3QC8 B;  2V3P A;  3DOW A;  4DXG A;  1UD7 A;  4DHJ B;  3CIR B;  1YX6 B;  4IDI A;  1FNV A;  4XE0 A;  3P4P B;  2C9W B;  1KJT A;  4EKU A;  5AUK A;  1K8R B;  3Q3F A;  3UI3 A;  1TS5 A;  2CJO A;  2I38 A;  5LNK 1;  4AJW A;  2LRW A;  2N4F A;  1J0G A;  1J7A A;  2Q5W D;  1WXS A;  3KVF B;  1TKG A;  2WXM A;  4K1R B;  4IUM B;  4BBN F;  2BTE A;  1NYQ A;  1EF1 A;  3ML9 A;  2J52 A;  3PGE A;  2JXT A;  3KUC B;  3KUZ A;  4LLG M;  4C7Z A;  2JQR B;  5BYQ A;  1V8C A;  1EUV B;  3RNC C;  2KT7 A;  3I3T B;  1XF5 L;  1NEK B;  3SHQ A;  2RDB C;  2O2V A;  3L16 A;  3QAR A;  5LLI A;  5CTR C;  4OW0 A;  4MSM B;  1ZDX A;  4WUR A;  3BWU D;  3V3X A;  1WXV A;  3AE9 B;  3J9C A;  1KTK A;  2MBQ A;  3DVG Y;  2JYE A;  1PYW D;  2DYO A;  3FAH A;  4IOI E;  4BKT A;  2KN5 A;  4W9I A;  2LHE A;  5LXI B;  4N9F 4;  2D3C A;  3V05 A;  3CMM B;  2J4X A;  3JYU A;  4J3O D;  2LFI A;  1RLF A;  2BWF A;  2ACZ B;  1WWT A;  5BMG A;  1YJ1 A;  2QIL A;  4A3O A;  4LTU A;  4RNA A;  4ANW A;  4WJP A;  4IM2 A;  2MEK A;  2WX0 A;  4XDC A;  2NBV B;  1JRO A;  3ZO5 B;  4M8M A;  4GXB A;  2KQS A;  4HKZ E;  3NZ3 A;  2GBJ A;  2MX2 A;  4M8N A;  3AEA B;  3DBL I;  2IDY A;  1EO6 A;  4FHK A;  2W3S A;  3LYY A;  4REZ A;  4ACF A;  3AE4 B;  4KZ0 A;  2K5P A;  1ZXI A;  1Q0W B;  4C56 C;  3TJP A;  4FAD A;  2J7Q B;  2CS4 A;  2AQ1 B;  3NJT A;  1SGH A;  1C4C A;  1BT0 A;  5D6J B;  1LXD A;  4KX6 B;  4XC2 A;  2KK8 A;  1E8Z A;  1P1A A;  1YN3 A;  1YQB A;  1FM0 D;  2WXF A;  3DPD A;  1WJ6 A;  1N63 A;  1P9D U;  3CSF A;  2VH1 A;  4AOF A;  4E71 A;  2KJ6 A;  4GDL B;  2TSS A;  4MT5 A;  2Z0D B;  2QEJ C;  4CYE A;  5HG2 A;  3DBS A;  3R3M A;  1STE A;  1F77 A;  5G5G A;  3PPA A;  2XN9 C;  5G55 A;  4LDT D;  1E8X A;  1PQS A;  3TBL D;  3V61 A;  1HZ6 A;  2LZ6 A;  4BKS D;  2WXL A;  5BYS A;  2PPH A;  4YXD B;  2KQ4 X;  4KVG B;  1HQR D;  3ETR A;  3ONS A;  2BT6 A;  1CK1 A;  4PS3 A;  4LNF A;  1UEL A;  3DQV A;  1MHH E;  3ZDT A;  2D3G A;  4J6I A;  1E8Y A;  2NTS A;  1XCQ L;  3GZN B;  3DWM A;  4RF0 A;  1GC7 A;  2LHD A;  4NAM A;  3EGR A;  3N1Z C;  5IO9 A;  2VZK B;  2PVG C;  2W9N A;  2ZW0 A;  3QHT A;  5C23 A;  5HFY A;  2LVP A;  4IG7 B;  3ENE A;  1L6U A;  3ZJV A;  1F2R I;  2M19 A;  2K8B A;  4KDI C;  4MAC A;  1GC6 A;  1XLO A;  2XK5 B;  5G5H A;  2FIF A;  2BGF A;  3Q69 A;  5J18 A;  2FUH B;  4PS8 A;  2JZZ A;  2ICI A;  3NG0 A;  1F2R C;  1V86 A;  3HHM A;  2HDE A;  2ON8 A;  3FIL A;  3X0W A;  5BMH A;  2PTL A;  1TS3 A;  3HRD D;  2LD9 A;  3JVZ X;  3QQ8 B;  2MRP A;  1SB3 C;  3N20 C;  1JCK B;  1V80 A;  1IYF A;  1TZ1 A;  2WDQ B;  2LVO A;  2JXX A;  5LXH A;  2JRI B;  3SR6 A;  2M4N A;  2WQY B;  3P4R B;  1KOT A;  2KTR B;  2ZPN A;  3L54 A;  2MLB A;  1Y8R C;  2KDM A;  2HJ8 A;  3CWI A;  1S3S G;  3NUH B;  3Q14 C;  4P7I A;  1NVI D;  5FKA C;  4US9 A;  1ROE A;  4XWW A;  3NRZ A;  3AE8 B;  1E10 A;  4IM0 A;  3IG3 A;  3KQ4 A;  4A90 A;  3AH7 A;  5D7G A;  4WWM A;  4JQW C;  3VDZ A;  1H8C A;  1LO5 D;  2DZK A;  1FO4 A;  3RNE C;  2DWQ A;  3RYT A;  3OG5 A;  2CU3 A;  2G1E A;  1TY0 A;  4QAY A;  3V62 A;  3VQI A;  1XEE A;  3ZGZ A;  3UF8 A;  2MSE D;  1GPX A;  2QHO A;  3PT2 B;  3V6E B;  4ZRQ A;  1X1M A;  5GXG B;  3GE3 C;  1OTR B;  1YQ4 B;  2BS3 B;  1XLP A;  2QMT A;  1AWD A;  1AYF A;  2FE8 A;  1E8W A;  1ZP0 B;  4IM3 A;  1YMH E;  2NPT A;  3VR8 B;  4GDL A;  2MH7 A;  4ARC A;  1TS2 A;  2WXN A;  3PLU A;  1FFV A;  1KF6 B;  3AN1 A;  4S17 A;  3N9Y C;  4W9F A;  1R4M I;  4B0E A;  1V6E A;  2NS5 A;  5J17 A;  2WP9 B;  1PGB A;  2QCZ A;  3MC9 A;  1E6E B;  3B1L X;  2VH2 A;  2WLB A;  4YL8 A;  2KJH B;  4MGI E;  3E56 A;  2L83 A;  5HHD G;  4ZDV A;  2KYW A;  2WXO A;  3DHG C;  1D5X C;  2NCN A;  4LJO B;  4KZC A;  3VRB B;  4LNN A;  3DHH C;  4ZYN A;  1M94 A;  2RDG A;  1Q5W B;  3ZKJ C;  3KH0 A;  2HTH A;  1JQ4 A;  3DVG X;  1V1P B;  1V2Y A;  1V5T A;  4FXC A;  2LGS A;  5KHO A;  3LDZ E;  4BVU C;  3EFU A;  1C3T A;  3BK1 A;  2KLC A;  2RSU A;  1HTQ A;  2MA9 B;  3MHZ A;  1TKY A;  2PJH A;  4DWF A;  2L52 A;  3IBE A;  1Z2M A;  2IZV B;  3H8H A;  3RT3 B;  3PV1 A;  1L2N A;  3RUL A;  1J19 A;  2Y3A A;  1UZX B;  4WH4 A;  4DHJ D;  3RN9 C;  2KWC A;  3HUI A;  3RMK C;  2SAK A;  4WWP A;  3M63 B;  4RMA A;  1FXI A;  3V6C B;  1FNU A;  5EE3 A;  3ZUN A;  3W1S C;  2KTR A;  4ANU A;  2AWT A;  2AEH A;  2IGH A;  3N30 A;  1QZE A;  3AEE B;  3I9V 1;  3TIX A;  2Z8L A;  4ZRI A;  4EOY A;  4HWI B;  1MHX A;  1T0Q C;  5H8Y E;  2X8X X;  3UGB B;  2R2Q A;  3ZJT A;  1CQV A;  2I1J A;  4US8 A;  1K53 A;  2E3T A;  2BYF A;  1WZ0 A;  3PZ7 A;  1NI3 A;  3QIJ A;  2LGI A;  3A4S C;  3NVY A;  1FFU A;  1N5W A;  4NZL B;  3MP9 A;  3I57 A;  4K81 A;  4A3P A;  3PZ8 A;  3NVZ A;  3EEC A;  4EZJ A;  3K9O B;  4LNK A;  1MI0 A;  3DBL B;  3OJ3 A;  2WDR B;  3RNA C;  2XEW A;  4BBN C;  3NS8 A;  2H89 B;  4D2K A;  2ZZP B;  4G50 A;  3H9D A;  5BO4 B;  3E9S A;  1VCB A;  3KLS X;  3RZW C;  2V1Y A;  4WWN A;  3KW5 B;  3U8Z A;  2BKR B;  2OED A;  1UNS A;  1D4B A;  1WGH A;  2L00 B;  1TBE A;  1K50 A;  3VTW A; 
#chains in the Genus database with same CATH homology
 2AX5 A;  1HA5 A;  1JRO A;  1KLG D;  2JX5 A;  1FRR A;  1YQ3 B;  1YJJ A;  1JWU D;  4HKZ E;  1XO3 A;  3NZ3 A;  1ZE3 D;  1Q10 A;  1D6E C;  2D5G A;  3VR9 B;  2YEP F;  3Q8A A;  3AEA B;  1ZPS A;  3AEC B;  1ZXH A;  2W82 A;  2BB6 A;  1ESF A;  2IDY A;  5FR3 A;  1L0V B;  1FCC C;  1C76 A;  1L0X B;  2W3S A;  3LYY A;  4REZ A;  3TSS A;  1SE2 A;  1QOG A;  3AE4 B;  2MJ3 A;  1FCL A;  2K5P A;  4WAF A;  5C3J B;  1ZXI A;  4YTM B;  5H92 C;  4C56 C;  2K9X A;  4KGT A;  2QSD A;  2AQ1 B;  5EE0 A;  2INN E;  1C4C A;  1K51 A;  4O1N A;  1JWM D;  4KX6 B;  2HTM E;  1I4G A;  1M4V A;  1BUI C;  1VZ8 A;  3B2G A;  4M0W A;  3SFD B;  1GOZ A;  1YN3 A;  3TEX A;  2BS2 B;  4DXF A;  4ITK A;  1UUP A;  1FM0 D;  2WXF A;  4OZC A;  1QIL A;  1VRA B;  1V1P A;  1C9F A;  1N63 A;  2GI9 A;  4TSS A;  1Y56 A;  1CZP A;  1JWA D;  2WDV B;  3U2S C;  3T3O A;  2PKO A;  4YTP B;  4GDL B;  2TSS A;  4MT5 A;  2DYM A;  4ZOH C;  1JWB D;  2QEJ C;  1JRP A;  5HG2 A;  2J53 A;  4N6E B;  1TKE A;  2WXG A;  3NS1 A;  1STE A;  1F77 A;  5G5G A;  2FUG 1;  1T5X D;  2XN9 C;  1BML C;  1KH0 A;  1SBB B;  1JW9 D;  3DWG C;  3KWV A;  2W54 A;  1HZ6 A;  4C7Y A;  3AE6 B;  4YSZ B;  1D5Z C;  2N7J A;  2IPK D;  4MM3 B;  3W5U B;  2WXL A;  5BYS A;  3RFZ B;  4L1B A;  3AEB B;  2JWU A;  3NVV A;  4YXD B;  1L6V A;  2KQ4 X;  3T3N A;  1P7E A;  1HQR D;  3ETR A;  3U52 E;  1VJK A;  3URY A;  1J7B A;  3AEF B;  1HZ5 A;  2MJE A;  2BT6 A;  1CK1 A;  1IGC A;  1N62 A;  3B2F A;  1UGJ A;  4GLS C;  4HJG E;  4RCO A;  1D5M C;  2DLB A;  1SJH D;  3TEZ A;  3Q8F A;  4OZA A;  1MHH E;  3FIL B;  2EEL A;  1YNT E;  3W5V B;  2NTS A;  2INP E;  1XCQ L;  4RF0 A;  3DWM A;  4A9A A;  1C79 A;  2FBW B;  2K0P A;  1SE4 A;  2LHD A;  3HVD A;  3P4Q B;  2R61 A;  4NAM A;  3EGR A;  1FEH A;  3BVM A;  2RDH A;  2KWD A;  3MJ5 A;  2VZK B;  2K3U A;  1SE3 A;  2PVG C;  3VRA B;  1EWY C;  2VZK D;  3GS2 A;  2ZW0 A;  2PLP A;  4KKI A;  2GRI A;  1OQQ A;  1WXQ A;  2KN4 A;  3PO0 A;  4OHJ A;  5HFY A;  1GAQ B;  3ZQ4 A;  3IT6 B;  3TEY A;  1L6U A;  1GB4 A;  3SFE B;  2WU5 B;  4OZB A;  3ZJV A;  1F2R I;  2M19 A;  2M56 B;  3R8B A;  1VR9 A;  4MAC A;  1XLO A;  2WXJ A;  5G5H A;  1XCT L;  1KRH A;  4R3D A;  2G9H D;  1DOY A;  2IGD A;  3MC0 B;  3Q69 A;  4NJC A;  4IKG A;  4EE2 A;  4B0M A;  2H88 B;  3BYY B;  5EE9 A;  1FXA A;  4UDU C;  1ZOY B;  3Q8C A;  2ICI A;  1F2R C;  5I4D A;  4L2Y A;  1RYJ A;  2OHF A;  1VLB A;  3TEW A;  1QKZ A;  1DOX A;  2HDE A;  2ON8 A;  1N5X A;  4N59 A;  3FIL A;  5BMH A;  2DBY A;  2PTL A;  1TS3 A;  1ZUD 2;  2YEP B;  4JE3 B;  3P4S B;  3HRD D;  2QJL A;  2WXK A;  2PVO D;  1L4D B;  1V97 A;  1FNW A;  1SB3 C;  1JCK B;  1SSN A;  1A70 A;  2NTT A;  3EA6 A;  3P1M A;  2WDQ B;  1OFF A;  2WS3 B;  3SR6 A;  4H2A A;  4GDK B;  3C8Y A;  4A55 A;  2WQY B;  2E6X A;  2XNA C;  4LK0 M;  1T6B X;  4XDD A;  3P4R B;  1AN8 A;  2CJN A;  1DGJ A;  1SEB D;  1B1Z A;  2WXI A;  3SEB A;  3EUB 2;  2I2Y A;  1HXY D;  3AED B;  3BK2 A;  1AW7 A;  1ZDV A;  2KDM A;  1QLB B;  1VDV A;  3AE7 B;  1IBX B;  3CWI A;  3NUH B;  4RGM A;  1PDX A;  4ZHO A;  1NVI D;  5FKA C;  2JSV X;  4US9 A;  1ROE A;  5D3D A;  4AQ7 A;  4XWW A;  2PMV A;  1SXT A;  3AE8 B;  3NRZ A;  4TQ0 A;  1CJE A;  2RPV A;  5TSS A;  3W1S A;  1E10 A;  1QT9 A;  1C77 A;  1DOI A;  1R7S A;  3AV8 A;  4HKQ A;  3KQ4 A;  4A90 A;  3AH7 A;  5D7G A;  2WXH A;  4WWM A;  4MH8 A;  1N61 A;  1BXT A;  2WXR A;  1LO5 D;  5C2T B;  1FO4 A;  3AE1 B;  4A8X C;  3BII D;  1VZ6 A;  4L23 A;  1SJE D;  2DWQ A;  3OWE B;  2CU3 A;  2RMM A;  3R2T A;  2G1E A;  2L32 A;  1TY0 A;  1FD6 A;  1RFK A;  2EKI A;  1E0Z A;  3VQI A;  4CQN A;  1XEE A;  4YSY B;  1WSP A;  3ZGZ A;  4JPS A;  4WIP A;  4P6V F;  1V1O A;  2J42 A;  4AS1 A;  1GPX A;  4RGT A;  1XLQ A;  4ZRQ A;  5AUI A;  1HEZ E;  1N60 A;  2BW2 A;  3NVW A;  3AB5 A;  1IBX A;  1TYG B;  1PUT A;  3Q8E A;  5GXG B;  3FC4 A;  2JU6 X;  5FK9 C;  1YQ4 B;  3L4P A;  4PT5 A;  2BS3 B;  2WXQ A;  1XLP A;  2QMT A;  1RM6 C;  1AWD A;  4YT0 B;  3HVZ A;  1JML A;  3LXF A;  1AYF A;  2FE8 A;  4RFB A;  1ZP0 B;  2AQ3 B;  4JX1 C;  3AE2 B;  1NYR A;  2LUM A;  1YMH E;  4ZRP A;  1TJE A;  3VR8 B;  4ARC A;  2AQ2 B;  2MH7 A;  1TS2 A;  4HEA 1;  2PW9 A;  2WXN A;  3LB8 C;  1FFV A;  1KF6 B;  3AN1 A;  5T8I A;  3N9Y C;  2N9K A;  3AE5 B;  1IGD A;  1I7H A;  4B0E A;  1T3Q A;  2SEB D;  4WQM A;  2IJ0 A;  4USA A;  4XDC A;  2WP9 B;  1PGB A;  3BVG A;  2IGG A;  1I4X A;  1E6E B;  1JWS D;  2M0A A;  4Q2J A;  1QF6 A;  1B9R A;  2LEK A;  2WLB A;  1QOA A;  1I4R A;  2QIE B;  3Q8B A;  1QQR A;  5BMI A;  3AEG B;  2V0G A;  3U7Z A;  4N58 A;  1WRI A;  1TZO A;  1VZ7 A;  1C78 A;  3E56 A;  4XWT A;  2L83 A;  5HHD G;  3AM9 A;  3IAM 1;  2WXP A;  3BYT B;  2NMQ A;  2KAC A;  2BBC A;  2WXO A;  1SIJ A;  1D5X C;  4RF1 A;  1QOB A;  1C4P A;  3VRB B;  2PIA A;  1WGK A;  5EE1 A;  1PGA A;  3BZD B;  2N0S B;  1ET9 A;  3AE3 B;  3KWL A;  2RDG A;  4TQ1 A;  2BS4 B;  1JQ4 A;  2V3N A;  1WYG A;  4HRS A;  4OVZ A;  1C4A A;  1V1P B;  3B9J A;  3O13 A;  1PGX A;  1TS4 A;  4RGN A;  4FXC A;  1FMA D;  1OQR A;  3TUO A;  3BK1 A;  5E6J A;  3P42 A;  5HI1 A;  3WCQ A;  2WU2 B;  3MHZ A;  3IXS A;  4KKJ A;  1JAL A;  1I4P A;  2KAJ A;  1QOF A;  1IUE A;  4KGS A;  4C80 A;  1TKY A;  1E7P B;  2L52 A;  1UWM A;  2ZW1 A;  2V3P A;  4RH6 A;  4YTN B;  4DXG A;  2Y5P A;  3H8H A;  3ZYY X;  1KFY B;  2W55 A;  3RPF C;  1SF0 A;  3CIR B;  2Y3A A;  1FNV A;  3R2I A;  4IDI A;  4XE0 A;  3ZJU A;  4WH4 A;  2W3R A;  3HUI A;  3P4P B;  3IAS 1;  4ZYS A;  1EU3 A;  5AUK A;  2LJI A;  2BB5 A;  2SAK A;  3UI3 A;  1TS5 A;  2KMM A;  2L1A A;  2CJO A;  2I38 A;  1MPE A;  2JYT A;  5LNK 1;  1PFD A;  4YWG G;  1FXI A;  2JZP A;  1J7A A;  2Q5W D;  1TKG A;  2WXM A;  1MVK A;  1I4Q A;  1FNU A;  5EE3 A;  2BTE A;  1NYQ A;  2J52 A;  1EM7 A;  2B76 B;  5MPO A;  4RGO S;  3MFG A;  2JXT A;  2K22 A;  2BYT A;  4P16 A;  4ARI A;  1L0Y B;  4LLG M;  4C7Z A;  4KGR A;  2JQR B;  5BYQ A;  1P7F A;  2V4I B;  2IGH A;  1I4H A;  2LMC A;  1V8C A;  1ET6 A;  1EU4 A;  1YN5 A;  3AEE B;  3I9V 1;  1TY2 A;  1XXG A;  3GP7 A;  2ONQ A;  2Z8L A;  2X38 A;  4JWS C;  1MHX A;  1J7C A;  1XF5 L;  1NEK B;  5H8Y E;  3W9C B;  4NAW B;  3ZJT A;  1CQV A;  4US8 A;  1K53 A;  2E3T A;  3GB1 A;  4OW0 A;  1ZDX A;  1L5P A;  4WUR A;  3PZ7 A;  1NI3 A;  3BWU D;  3V3X A;  2LGI A;  1E9M A;  2N9L A;  1GB1 A;  3AE9 B;  1ACC A;  3J9C A;  3U4E G;  2MJD A;  1KTK A;  4A6Q A;  3NVY A;  1FFU A;  4DQO C;  1N5W A;  4NZL B;  4HRO A;  1KLU D;  4JWU C;  2JYE A;  1PYW D;  3MP9 A;  2DYO A;  3FAH A;  3IT4 B;  4YSX B;  3I57 A;  4IOI E;  5BYR A;  3PZ8 A;  1XLN A;  3NVZ A;  2GB1 A;  2LHE A;  3V05 A;  1EWC A;  2J4X A;  1MI0 A;  1DYQ A;  1FRD A;  2WDR B;  5D3I B;  1L4Z B;  3W2D A;  1YJI A;  2H89 B;  2LFI A;  4J3O D;  1YN4 A;  1RWS A;  3AMZ A;  4D2K A;  5JXV A;  2ACZ B;  1WWT A;  1K52 A;  5BMG A;  3E9S A;  3ABV B;  2WNM A;  2QIL A;  3KLS X;  1NEN B;  3BVZ A;  1UWX A;  4TMA B;  1FIQ A;  4LTU A;  4RNA A;  4ZHP A;  2OED A;  3P63 A;  1UNS A;  1D4B A;  1F0Z A;  2MEK A;  1ENF A;  1K50 A;  2Y5C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...