3AEEB

Crystal structure of porcine heart mitochondrial complex ii bound with atpenin a5
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
239
structure length
239
Chain Sequence
PRIKKFAIYRWDPDKTGDKPHMQTYEIDLNNCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLDKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTGTCPKGLNPGKAIAEIKKMMATYKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Crystal structure of porcine heart mitochondrial complex II bound with Atpenin A5
rcsb
total genus 68
structure length 239
sequence length 239
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 3aeeB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3aeeB01
2N0SB 3VR9B 5C3JB 1ZXIA 2BS2B 3AE8B 2BS3B 1AYFA 2W55A 1F0ZA 4YXDB 1FM0D 4US8A 4C7ZA 1RYJA 1V8CA 1QLBB 4ITKA 3AEEB 3AEGB 3AE5B 1XLQA 4IDIA 4WWMA 1TJEA 1DOYA 1WYGA 3SFEB 2EKIA 2QJLA 3LXFA 3L4PA 5EE0A 3CF4A 4JWSC 1DGJA 4YSXB 1QOAA 4WQMA 5AUKA 2B76B 3SR6A 3AH7A 2Y5CA 3P4RB 1FO4A 3VR8B 3AE4B 2G1EA 3KWLA 3NVYA 1WGKA 2PIAA 4JX1C 2WU5B 1ZOYB 4ZHPA 1T3QA 4YT0B 2WLBA 3AMZA 1SF0A 2JQRB 4KX6B 1QT9A 5EE9A 2KMMA 3ZYYX 1PFDA 2BS4B 1JQ4A 1E6EB 1RM6C 2WS3B 1N5WA 2CJNA 2K22A 2WDVB 1H7XA 1YQ3B 1J7BA 2CJOA 4LTUA 3AE1B 1NVID 3AM9A 3W9CB 1E10A 4HRSA 1NI3A 3AV8A 3LB8C 1GPXA 1N60A 3AEFB 2MH7A 1N62A 1JRPA 3W5UB 4YSZB 1AWDA 1ZUD2 3VRAB 1YQ4B 5C2TB 1J7CA 1V97A 1NENB 3AEBB 1E7PB 1FFUA 2L52A 1TKGA 3NS1A 1GTEA 1NEKB 1OQQA 4N59A 2H88B 3SFDB 1KRHA 1JWAD 1OFFA 2M19A 3NVZA 4US9A 3AB5A 1L6VA 2WP9B 1NYQA 1SB3C 2DWQA 1E9MA 1DOIA 1FFVA 1XLNA 5AUIA 3AECB 1N63A 1JALA 1N5XA 3BIID 4N6EB 1JROA 1FXIA 3AEAB 2L83A 2M56B 2PVGC 3ETRA 4P6VF 3P4QB 1ROEA 4FXCA 3FC4A 3CWIA 3P63A 1WWTA 1L6UA 3AEDB 3P1MA 1IUEA 1WRIA 1VLBA 3W5VB 5H92C 1R7SA 2CU3A 2MJ3A 1TKEA 3B2GA 1DOXA 5GXGB 3EUB2 1YJIA 1KFYB 1ZP0B 3FAHA 5H8YE 1VDVA 1B9RA 2WDRB 1J7AA 1PUTA 1NYRA 1XLPA 3B2FA 3DWMA 5EE3A 1FRRA 4USAA 1E0ZA 1QF6A 1QOGA 2FBWB 2MJEA 1FXAA 1QOBA 2W54A 5G5HA 2JX5A 1OQRA 2HTME 3AE6B 2MJDA 3AN1A 4HROA 3NRZA 3CIRB 1TKYA 3NVWA 2E3TA 2DBYA 1KF6B 4YTPB 2WU2B 3AE2B 2LEKA 3P4PB 3HRDD 1EWYC 3AE3B 1TYGB 4N58A 1UWMA 2WDQB 4A9AA 1VJKA 2Q5WD 1WXQA 3AE7B 3NVVA 1JWBD 4JWUC 2BT6A 5MPOA 3ABVB 1YJJA 3VRBB 4ZHOA 1FRDA 1I7HA 2AX5A 1GTHA 1FIQA 2PVOD 3WCQA 2W3SA 1FMAD 4YTMB 2K5PA 2K9XA 1RFKA 2QIEB 3HVZA 4C7YA 1SIJA 4C80A 1N61A 3HUIA 5G5GA 1QOFA 3PO0A 1PDXA 1H7WA 1CJEA 2W3RA 3DWGC 3AE9B 1L0VB 1GT8A 1L5PA 1RWSA 2WQYB 1CZPA 4YTNB 1GAQB 4ZOHC 2KAJA 1XLOA 2H89B 4YSYB 1A70A 1JW9D 3B9JA 2ACZB 5EE1A 3P4SB 3RPFC 1XO3A 2PKOA 2OHFA
chains in the Genus database with same CATH superfamily
4JPSA 4PS7A 1WY8A 3A9KB 4MGIE 4G3XB 3MP9A 4ICUA 5DPSA 1TJEA 3ZXRA 3E56A 3Q8BA 2KMCA 3PRPB 1WR6E 1U4AA 2HTHA 2BTEA 1WF9A 2KVRA 3P4RB 4I6LB 2PTLA 3KWLA 3Q3NC 2N4FA 3A9JA 2CHZA 4JIOU 2ASQA 4KX6B 1QT9A 1I42A 1E6EB 3WALA 3WAOA 2WS3B 4FJZA 1EF5A 4AP4C 4GOCA 3GZNI 4AUQC 2PJHA 3DCGA 3QCAA 4XWTA 1GC6A 4TSSA 2L52A 4HK2A 5CHFA 1OQQA 3SFDB 3AB5A 4B0EA 4IUMB 1JALA 1WM2A 4P16A 1FXIA 3AEAB 4DQOC 4M8MA 4P6VF 3Q3JA 5KHQA 3ZLZA 4E71A 2CU3A 2MJ3A 1TKEA 2OEDA 3H6NA 1C78A 1KFYB 3VTWA 2L05A 2KK8A 1PUTA 2GLSA 4ZRKA 1WMHA 2HE7A 1QOGA 1I4QA 1UBQA 3AULA 3R2TA 2NBWB 3SD5A 3WAMA 4DK5A 4AJWA 2L00B 3ZGZA 2K6QA 4K1RB 2RMMA 3L08A 3BK2A 2QIEB 4C7YA 1QOFA 1JRUA 2QEJC 2D3GA 4LJPB 4BKSA 2LASA 4NY0A 1QLBB 3ENEA 3TCAA 2FUHB 1S1QB 2Y3AA 3BY4B 4X57B 2KWUB 2I38A 4YWGG 2NTSA 4MH0E 1P7FA 2NCNA 3U30A 4DDGD 1WSPA 3ZNID 3SR6A 3AE4B 1Q5WB 2K6DB 2NPTA 4JX1C 5EE9A 2IY1B 2J42A 2BS4B 5E6JA 3DBHI 2MCNB 1N5WA 4RF1A 1KTKA 2D07B 1E10A 4M01A 1V49A 1N60A 1WMHB 3KYCD 1ZXHA 1WGGA 2INCC 2KFKA 1SGHA 3DHGC 3KYDD 1WX7A 1L0YB 2K25A 4HEA1 2DWQA 1WGHA 3S2AA 1E9MA 4EKUA 2WXNA 5IAAC 2M0AA 1GJZA 5BMHA 4IM0A 2PMVA 3Q3OC 2W9NA 3KLSX 2GBMA 3H7PA 4MGYE 2ICIA 3WANA 3D32A 3DWMA 5EDSA 2JZZA 2BPSA 4LK0M 3GP7A 5G5HA 3A1QA 3CSFA 1VCBA 2WX1A 3AE6B 1TZ1A 1RFAA 5AZGA 3BVZA 4BKGA 3HRDD 4ZRIA 3W1SA 4CYEA 2L8JA 4MM3B 1A5RA 2K1FA 4MH8A 1FRDA 2BYTA 4WWOA 4W9LA 1SIJA 2K8CA 4WAFA 1SSNA 4TMAB 3PO0A 4BBNF 1RAXA 1PDXA 1ZKHA 4K7UA 3AE9B 1M94A 2W82A 3DVGX 4YTNB 4A3PA 2KAJA 2CU1A 1A70A 3B9JA 1JWUD 5EE1A 2DZJA 3PZ8A 3RPFC 3TSSA 1YN3A 2LVQA 3L17A 2L0FA 2KT7A 1CMXB 4WJPA 4M0WB 2BYEA 2IO2B 2KFKB 2KWVB 3IG3A 2EKIA 4Q2JA 2IY0B 4ZRPA 3VAWA 4RGTA 1T5XD 1QOAA 5FKAC 4GN1A 2L1AA 1UUPA 3A33B 1SIFA 2EKEC 3EC8A 1PFDA 3ZO5B 1EO6A 3H7PB 1PYWD 2PPHA 2WDVB 3Q2AC 4PK1A 2G9HD 1N62A 3A1QB 1C4AA 3UIOB 1MHHE 3ALBA 2JVCA 1UGJA 1WX8A 3B08A 3V05A 4ANWA 1OFFA 5IP4D 2WP9B 2N9XA 3Q8AA 3X23A 2N7JA 2ZW0A 3NZ3A 1H8CA 2K39A 5JH5C 1PGAA 3UIPB 1IUEA 2O2VB 4KDIC 1HE8A 3V3XA 1WXSA 3BYYB 1B9RA 3EHVA 4MACA 1IP9A 3GE3C 1WIAA 4WWPA 4A8XC 1OQRA 3VH4B 3NRZA 4EEWA 2WU2B 4W9FA 4DXFA 3IAM1 1ZDXA 4REZA 5FK9C 3RCZA 2XBBC 1V1OA 1F9JA 2GBKA 2WQYB 5L83A 1WXVA 2ACZB 3P4SB 3DHHC 1OEYJ 3W1SC 4BVUC 2R2OA 2ONQA 3GB1A 4ANUA 2KN5A 1FNUA 2L0TA 1XLQA 3R3MA 1WYGA 3LXFA 4YSXB 1E90A 1SE3A 4MGKE 2K8HA 3I9V1 4HDOA 3U2SC 4L1BA 1TZOA 4MSMB 4OZCA 1KJTA 3IHPC 2V1YA 4M8NA 3LB8C 4WH4A 1GPXA 3VTVA 4OZBA 1JRPA 4MEMA 2IGGA 2RPVA 4FHJA 2MHJA 4W9EA 1TKGA 1WZ0A 2ZJDA 2KVZA 2X38A 4A20A 3URYA 2KN4A 2LVPA 2WHIA 2GOWA 4AJYB 3DBRI 4A3OA 4PS8A 2VH2A 4EOYA 4WJNA 1Z5SB 3KH0A 3P1MA 5LLIA 4DHJD 2KDEB 2MP2B 1TGZB 1ZP0B 3JW0X 4W9JA 5EE3A 1XT9B 4TQ0A 4KZCA 4HROA 1T0RC 1TKYA 2JZ3B 3AE2B 2KFJA 2J52A 1XD3B 1TYGB 3RD2A 4DWFA 3TEWA 1PQSA 1VZ7A 1FMAD 4C80A 5IN7A 4II2B 3MHSD 2I1KA 2J0JA 1CZPA 3GOEA 1GB4A 1IBXB 1ET6A 1DOXA 2V4LA 1ZXIA 2NS5A 2INPE 3ZW3A 1F0ZA 4LNFA 2SEBD 1ZDVA 3AEEB 3ZVVA 4XGAB 2YEPF 2KLGA 2M17A 4P7IA 4K3CA 4ZYNA 2G1EA 2WXQA 3ZNHB 2WXIA 2IO3B 3NJTA 4LDTB 4KGRA 2C7HA 2RDBC 3NOBA 3M62B 3AU5A 2JXTA 2DYOA 4XE0A 2LI5A 3VVWB 2DZKA 2JF5A 1R4NI 3N32A 1V1PA 4F1SA 2BKFA 4FBJB 3W5UB 4NAMA 1YQ4B 2Y5BB 2AL3A 1NENB 1ZW7A 3RN9C 1KRHA 3KQ4A 2R61A 5CTRC 1L6VA 1NYQA 2UU7A 1DOIA 2IZVB 3MC0B 3ETRA 4FXCA 3HM3A 3P63A 4FHKA 4MT5A 1L6UA 1WRIA 2PLPA 1R7SA 3APCA 1P3QU 2DX5B 3LDZE 3PV1A 3FAHA 3A9KA 1UNSA 4BKTA 3V62A 1FCCC 2LJIA 3M3JA 2WXHA 4EFOA 4JLCA 3AN1A 2WYQA 1KF6B 5BMIA 4IW0A 5FR6A 4HDQA 4C4VB 3VFKA 1TY0A 3JYUA 4WJOA 1L2NA 2W3SA 2LRUA 2XK5A 3ZJUA 2D3BA 2LGDA 1GAQB 4HJKA 1AARA 1V1PB 2DAJA 4LNOA 3A4SC 2BS2B 2BS3B 2MSED 2KYWA 2J0MA 2DYMA 3L13A 2BWFA 3T8MA 3DBLB 4BOZB 4HKZE 1ZGUB 1IPGA 5BMGA 4I6NB 2HDEA 5IO9A 4PYUA 5BYSA 4ARIA 2KZRA 4DXAB 4IWPA 1SF0A 1WZ3A 2CHWA 3M63B 3TIXA 1MFWA 1TY2A 1J7BA 1GNUA 1NBFC 1M4VA 4MGZE 3AV8A 4M00A 4KKJA 1FEHA 4LNNA 1K50A 2D2QA 2M1MA 5DCNA 1E7PB 1ACCA 1Y8RC 1F77A 4US9A 2MBHA 1I4RA 3RZFA 4NJCA 1FFVA 1UZXB 3Q3FA 2K3UA 2MBOA 3P4QB 2XK5B 3EECA 3QJZA 2KC2A 1Q1OA 2NBVB 1AW7A 3FILB 4IG7B 5E6PA 2WGSA 4TV3A 3SDLC 4XZ4A 3EFUA 2WXFA 4XC2A 4E3CA 3AE7B 5DPTA 2LGXA 2KJRA 2JSVX 3HUIA 1BXTA 3CMMB 2WWZA 4AOFA 1OTRB 1XO3A 1SBBB 2PKOA 3L54A 3RNBC 3ZKJC 3QHTA 1MI0A 3OJ3A 3AEGB 1WRDB 2FCQA 2GB1A 4IDIA 3VUWA 5T8IA 3L4PA 1DGJA 3L16A 3JVZX 3DBLI 1V2YA 4W9CA 2MRPA 2PIAA 2WU5B 2BW2A 2BYVE 1T3QA 4ICVA 1UGMA 2L7RA 2KMMA 2WXGA 1HXYD 2BGFA 3N1YC 4HXDA 2WXMA 4LTUA 3W9CB 1J8CA 2WXRA 2O6VD 1LXDA 2GBJA 4K81A 1F2RC 4MM3A 1NEKB 2J4XA 2H88B 2KJHB 4KV2A 4FLHA 1FPYA 4RM8A 1MVKA 2Z59B 2OJWA 2O6VB 4XX5A 3ZJTA 3CWIA 2KKCA 4GSWA 1WE7A 4II3B 4EUTA 1E7UA 5D3IB 1E8WA 3K9OB 3B2GA 1EWCA 4MDKE 4K7WA 4M0WA 2AQ1B 2JY6A 2KWDA 4USAA 2MJEA 1FXAA 1P7EA 2NTTA 3CIRB 2FCNA 4WJQA 1CK1A 1H4RA 2LVOA 4KIKB 4N58A 4JGHB 3QWZB 4W9IA 1FIQA 2KHWB 2QC8A 4ZDVA 2RGFA 4YTMB 2FIDA 2JWUA 2J53A 3ZUNA 2AWTA 2EELA 3AI5A 3MJ5A 1XLOA 2H89B 2MX2A 1MG4A 4R3DA 5D94A 1AYFA 2W55A 3BZDB 1HTQA 3ZIMA 1XQQA 4DBGA 4GU2A 2MEKA 3PZDA 2QJLA 2KWCA 4N9F4 1HTOA 1XCTL 2WXKA 3UF8A 3OLMD 3QK0A 2C9WB 1FO4A 2K0PA 3N1ZC 2O2VA 4KDLB 1ZOYB 1XF5L 3ZQ4A 1JQ4A 4HLEA 3ZNGC 3PHXB 2IGHA 1UWXA 1HEZE 3VXWA 4RGOS 3MJWA 5CHWA 3RNCC 1V97A 3AEBB 2LXAA 4PT5A 1I4HA 3NS1A 3U8ZA 3UINB 1LFDA 5J17A 1EF1A 4KGSA 1Q0WB 2EMTA 4KGTA 1V9JA 2QCZA 3N3KB 2YLMA 3OJ4B 4OVVA 4B9KA 3BVGA 1VLBA 1D5ZC 2RSUA 5H92C 1IGDA 4HPPA 1YJIA 4M02A 4S0RA 1VDVA 1J7AA 1KH0A 1YQBA 3DDCB 1QKZA 4HPMB 1QF6A 2G4SA 1MPEA 1OGWA 2KXJA 3NVWA 3I3TB 3K9PB 4ASWC 2RDGA 2KQ4X 1EWYC 3PS6A 1VJKA 2Q5WD 3ZJVA 5IA7A 1J19A 3C8YA 3NHEB 3QAQA 4A90A 4RM9A 4NZLB 1UELA 4FJYA 5TSSA 1GT8A 2LGIA 2MW5A 4IOIE 1UD7A 4WIPA 3PT2B 4WWNA 3WA0A 1V8CA 3A4RA 2JZPA 2DLBA 4WAAA 4RGNA 1DOYA 4C56C 2BF8B 3PLVA 2R2QA 3GS2A 5AZFA 2Y5CA 4NQLB 5BO4B 1TS3A 3V60A 1WGKA 5CHVC 1S3SG 1KM7A 4GB9A 1WJUA 4CO7A 2MP2A 1DYQA 2XEWA 2WDTB 1Y56A 2CJNA 2CJOA 4RMAA 2MH7A 4EZLA 2D5GA 2JPHA 3TEYA 3VRAB 1L7YA 1TTNA 5HKHA 3RYTA 3ZTCA 2M19A 5DPWA 2V3NA 1XLNA 4EE2A 2FNJB 2PE9A 1JROA 1K51A 1EU3A 2M4NA 2ON8A 1ROEA 3FC4A 4LLGM 4ZRJA 1IBXA 3Q8EA 1BUIC 2LGYA 4IWQA 2JUOA 3OAWA 1NYRA 4NJ6A 2GBNA 1L4DB 2YEPB 1KOTA 4HKQA 2AL6A 4A9AA 3HIZA 2KNBA 4FADA 2OJRA 1YJJA 1N6ZA 1C9FA 3TJPA 3WCQA 3ML8A 2K9XA 2KANA 3HVZA 1N61A 1C4PA 4FJVB 1CJEA 3PHWB 2DNFA 1RWSA 4O1NA 2ZPNA 3ML9A 4DXGA 3N30A 2LGSA 4AQ7A 1L4ZB 2OHFA 4DHJB 1T6BX 1F52A 4KVGB 1WE6A 4C7ZA 3ZRFA 2N1WA 2QILA 2V0GA 5BYQA 3L10B 3L0WB 4YL8A 3AH7A 3IVFA 4HPLB 4TQ1A 5DPRA 4YT0B 2WLBA 2WXJA 5C23A 3ZYYX 1XEEA 4K7SA 5D2MB 1V81A 4G50A 3RZWC 2MBEA 1E8ZA 4K3BA 3AE1B 3KWVA 4A6QA 1QZEA 4IC7B 2V3PA 4NNJB 1CQVA 3ZDMC 4HJGE 3VHTC 1K52A 2BVCA 4C4VA 1XCQL 4WQOB 2JT4B 4XYCA 3AECB 1N63A 1C4CA 2QHOA 1E5WA 2LJ5A 2LHEA 2MBQA 2PEAA 3H8HA 3HHMA 4FN2A 1K53A 2N9EB 2LWPA 2LUEA 5GXGB 3U52E 4G0NB 2KO3A 1UH6A 3B2FA 2ZCBA 5BYRA 2W54A 1QOBA 1R4MB 5D6JB 2N9LA 1FCLA 1X1MA 4GXBA 1QQRA 3TL5A 2DENB 1YNTE 3NVVA 2C60A 2ZZPB 4AS1A 5MPOA 3UQAA 2PVOD 3KW5B 3ZNZB 3IFWB 2Z8LA 1I35A 5E6NA 3IT6B 2JWZA 3DWGC 4GDLA 2KTFA 3I63C 5AEKB 1ENFA 1T0YA 1JW9D 3U7ZA 4I6PA 1OEYA 1EUVB 3RUIB 3AE8B 5JHAA 3GZNB 1FM0D 3PLUA 4KSKC 3RFZB 4HVBA 4ITKA 1K8RB 1UBIA 4NJ7A 4WWMA 5JZEB 1I4GA 4IKGA 1VD2A 3T9LA 4NAWB 2BB6A 1FNWA 3NS8A 3FILA 3O13A 1WI0A 3TEXA 1NVID 1NI3A 4QAYA 3KUZA 4GIVA 2KC1A 3DOWA 4LNIA 2KDBA 2J0KA 5C2TB 1I4PA 3DVGY 1WM3A 3P2BA 2LXCA 4D2KA 2Z0DB 3HM6X 3VQIA 5E6OA 3V6EB 3N1XC 2IGDA 2BBCA 2ZW1A 3LYYA 2M56B 2HD5B 1SJHD 3APDA 3B1LX 2LRWA 3AEDB 4GDLB 1KLGD 3NZUA 3NY5A 3TBLD 2FUG1 4RNAA 3AU4A 5J2RA 3ZDTA 1VRAB 2N1VA 2WDRB 4LJOB 2I2YA 2YVCA 1FD6A 2JX5A 2HTME 3DQVA 2AYOB 3MFGA 1GOZA 2LEKA 3APFA 3VTUA 3QQ8B 1PGXA 3DBSA 2N7EA 2D3AA 3PZ7A 4BFRA 3UI3A 4JL9A 2MLBA 2ZVOA 1D4BA 1RLFA 2WNMA 1L5PA 4F7ZA 3C0RB 3DBHB 2N0SB 1PGBA 4ANVA 4IWOA 1JMLA 1D3ZA 3WIMA 1YN4A 3IT4B 3Q3MC 2O6VA 3CF4A 3ECIA 4C00A 4AWJA 4HWIB 1KLVA 5TR5A 3VR8B 3R2IA 2DYBA 4CQNA 2GMIC 2CKHB 4BOSC 1JWSD 2QSDA 2LMCA 2VRRB 2A4ZA 4GDKA 4GMVA 1NDDA 2EMSA 2KJ6A 3R66C 1ET9A 3AEFB 3ZXVA 4EZJA 1Z2MA 1ZUD2 2WXOA 4KIKA 4W9DA 2KTRA 4KKIA 1FFUA 3NUHB 5HG2A 4N59A 4W9GA 1ZPSA 2QDFA 1JWAD 5JHBA 4H2AA 1P9DU 1N5XA 2K8BA 4N6EB 2IYDB 3X0WA 2KLCA 4TUUA 3DHIC 3PRZA 4OHJA 5I4DA 5L95C 2L32A 1LQBA 2FE8A 1VR9A 2ZCCA 3W5VB 3A9JB 2KD0A 3AXCA 5KHOA 1BT0A 4PYZA 1TBEA 4BZAA 5G55A 1LGRA 2FBWB 1WX9A 5C1ZA 3RNFC 4J6IA 4MJSA 1T0QC 2IJ0A 2ZVNA 1VZ8A 1AN8A 1WH3A 1UWMA 3VDZA 4URKA 2BT6A 3PGEA 5IOIA 5LXHA 1G6JA 1TIFA 1I7HA 2AX5A 3MTNB 1GTHA 2VZKD 1XXGA 1HZ5A 3RNGC 2NR2A 2ZEQA 3R7QA 1TT5B 1WGYA 4GDKB 4YSYB 4FA6A 2VZKB 5CX3A 2UYZB 2KTRB 1YIWA 2G3QB 3CSTA 2KACA 4E74A 3NG0A 3SFEB 3KVFB 1YJ1A 1F2RI 4RFBA 5AUKA 5G2NA 3M95A 3NZSA 3PSEB 5LNK1 1E7VA 4ZHPA 4BKSD 1QILA 1GG3A 3AMZA 1WYWB 3PVLA 2D11A 3PTFC 3QARA 2IPKD 5IKCM 2M8SA 3AM9A 3GE8C 1JCKB 3JSVA 5AZHA 4BBNC 1AWDA 4ZYSA 2GI9A 5GMVA 4MJSB 1SE9A 5HFYA 3O65B 1FXTB 3C19A 2C5LC 1E8YA 2IDYA 1D5XC 2BQQA 5AUIA 4GGQA 2JRIB 1WXAA 3QIJA 2NMQA 2MQJA 2LD9A 2NPTB 2Y5PA 2LHDA 1MG8A 3OWEB 1XLPA 1V5OA 1YX5B 3ZRCA 2MA9B 2XNAC 3RI7C 2MJDA 1YMHE 2NVUI 1SE4A 2WX0A 2C7NB 4F8CB 4DDID 1WXQA 5D7GA 1JWBD 5JXVA 4P1CC 2KX3A 3ABVB 4XWWA 3VRBB 2KQ7A 4RCOA 3I5JC 4HCNB 4L23A 2X8XX 2Z0EB 5G5GA 1H7WA 3PREA 2W3RA 3MHZA 1D6EC 1GB1A 2AQ3B 3BYTB 3JSVB 4OVZA 1UF0A 1JWMD 1HQRD 3EGRA 4W9KA 4US8A 1B1ZA 2CR5A 4HCPB 3IBEA 1SXTA 4JWSC 5D3DA 3R7RA 4WQMA 2HJ8A 3NVYA 2INDC 2V3SA 1GC7A 2JQRB 3DBRB 2FCMA 3ONSA 5J18A 3W2DA 1WJ6A 4J3OD 3W1YA 3DPDA 1L0XB 3UGBB 3H1UA 1ISNA 2FIFA 1V6EA 3CF6E 2MWSB 3Q8FA 2MBBB 2DAFA 1WFYA 1P0RA 1V80A 1IGCA 4RGMA 2JYTA 2LZ6A 3WAPA 1SB3C 1SJED 3N20C 4ZHOA 4JQWC 1C77A 2TSSA 3FKYA 4BAXA 3HK0A 2RR9A 3IXSA 2G4DB 2N9KA 2RPQA 2PW9A 2GRIA 3OG5A 5H8YE 4MSQB 1D5MC 1V86A 4S17A 1FNVA 3EA6A 3MC8A 4WURA 1F1HA 4LNKA 4YTPB 4OZAA 2IO1B 2WXPA 3BINA 4JWUC 4XDDA 2KDFB 1HZ6A 4B0MA 3R8BA 3T3NA 2K5PA 5FR3A 1SE2A 3PRMB 1WXMA 1L0VB 3VUYA 1WGRA 3U4EG 3SU8X 2CS4A 3P42A 2KX0A 3J9CA 2GBRA 2V4IB 3VR9B 2AEHA 4NPNA 2KOXA 1MJDA 1EM7A 1R4NB 1RYJA 2DHZA 2D3CA 2PE6B 1IYFA 1T0SC 3AE5B 4DHZB 1TS2A 3Q69A 2RDHA 1P1AA 5EE0A 2J7QB 4A55A 4TKNA 2LFIA 4GLSC 1VZ6A 3E9SA 1STEA 4OVUA 2ZPYA 2N7DA 2K22A 1H7XA 1YQ3B 2BYFA 2KMAA 3Q8CA 2FAZA 4ANXA 2L76A 4YSZB 1P98A 2IBIB 3H7SA 1J7CA 3ZTDA 2JYEA 2SAKA 2BWES 1GTEA 1C1YB 2V9HA 3BVMA 2A5UA 5HHDG 1EU4A 1TS5A 2I1JA 2LUMA 4P1BC 2KQSA 3U7DA 3BIID 1KLUD 3QA8A 2L83A 3RT3B 2PVGC 3TEZA 4IM3A 2QMTA 2BKRB 1WWTA 2WXLA 1YX6B 5LXIB 3LJ3A 2DZIA 4RF0A 1C76A 4MELA 3BWUD 3RMKC 4UDUC 1FRRA 3QC8B 1E8XA 1TS4A 4FULA 1WR1A 2E3TA 3P4PB 1LM8B 3IAS1 3RNEC 2WDQB 1J0GA 4NAWA 3H9DA 4LDTD 2JU6X 3VH3B 1I4XA 1WJNA 4OW0A 1LO5D 3TUOA 2UWQA 2FCSA 2KDMA 5C3JB 4W9HA 2B3AA 2INNE 2VH1A 4YXDB 3B0AA 4ZRQA 3RNAC 3MC9A 2DZMA 4EZKA 2N9PC 2B76B 2RD0A 3Q6BA 3KUDB 4KZ0A 2ZNVB 2HJ1A 1BMLC 4ARCA 1V5TA 4B95A 1WGDA 1RM6C 2JXXA 4DHZE 4HRSA 3BK1A 4PS3A 1OQYA 4ACFA 1NI2A 4JE3B 4XDCA 2M0XA 3V61A 3DVNV 3I57A 2CHXA 3T3OA 1YOVB 3NVZA 1C79A 1R4MI 3RULA 4KSLC 3PPAA 1RRBA 2REXA 3SEBA 2NBUA 1YN5A 3SHQA 2G45B 2JRHA 1YD8U 1GUAB 1C3TA 3Q14C 1WJ4A 3EUB2 2L3ZA 5HI1A 1Q10A 2AQ2B 2OOBB 1E0ZA 1MHXA 4IM2A 2DBYA 2XN9C 3EFCA 3HVDA 2ZNVC 3AE3B 4B6WA 3VUXA 2KDIA 3DVNU 4NQKE 1ESFA 2BB5A 1SEBD 2D10A 3V6CB 4L2YA 1ZE3D 2C7MB 3KUCB 4LCDE 1RFKA 4G11A 1HA5A 4CHKA 3N9YC 2E6XA 4ZOHC 3TMPB 3UQBA 3QX1A 4RH6A 2IO0B
chains in the Genus database with same CATH topology
4JPSA 1ZXIA 2INPE 1F0ZA 1V8CA 2SEBD 1ZDVA 2KACA 3AEEB 3MP9A 2JZPA 2YEPF 2DLBA 1TJEA 4RGNA 1DOYA 4C56C 3SFEB 3E56A 3Q8BA 1F2RI 3GS2A 4RFBA 5AUKA 2BTEA 2Y5CA 3P4RB 2PTLA 1TS3A 2G1EA 3KWLA 2WXQA 5LNK1 1WGKA 2WXIA 4ZHPA 4KGRA 1QILA 3AMZA 4KX6B 1DYQA 1QT9A 1E6EB 1Y56A 2WS3B 2CJNA 2CJOA 2IPKD 2JXTA 2DYOA 4XE0A 3AM9A 1JCKB 2MH7A 1V1PA 2D5GA 3W5UB 1AWDA 4NAMA 4XWTA 3TEYA 3VRAB 1YQ4B 4ZYSA 1NENB 2GI9A 4TSSA 2L52A 5HFYA 1OQQA 2M19A 3SFDB 1KRHA 3KQ4A 2R61A 2IDYA 3AB5A 1L6VA 1NYQA 4B0EA 1D5XC 2V3NA 1XLNA 1DOIA 5AUIA 4EE2A 1JALA 4P16A 3MC0B 2NMQA 1JROA 1K51A 1FXIA 3AEAB 1EU3A 3ETRA 4DQOC 2ON8A 4P6VF 1ROEA 4FXCA 3FC4A 3P63A 4MT5A 1L6UA 4LLGM 1WRIA 2PLPA 1IBXA 3Q8EA 1R7SA 2CU3A 2MJ3A 1BUIC 1TKEA 2OEDA 1DOXA 2Y5PA 1C78A 1KFYB 2LHDA 3FAHA 1UNSA 3OWEB 1PUTA 1NYRA 1XLPA 1FCCC 1QOGA 2LJIA 2WXHA 2XNAC 2MJDA 1I4QA 1YMHE 3AN1A 1SE4A 1L4DB 2YEPB 1KF6B 3R2TA 5BMIA 4HKQA 4A9AA 1WXQA 1TY0A 5D7GA 1JWBD 5JXVA 3ZGZA 3ABVB 1YJJA 4XWWA 1C9FA 3VRBB 4RCOA 2RMMA 3WCQA 2W3SA 2K9XA 3BK2A 2QIEB 4L23A 3HVZA 4C7YA 3ZJUA 1N61A 5G5GA 1C4PA 1QOFA 1H7WA 1CJEA 2W3RA 2QEJC 3MHZA 1D6EC 1GB1A 1RWSA 4O1NA 1GAQB 4DXGA 2AQ3B 3BYTB 4AQ7A 1L4ZB 4OVZA 1JWMD 1V1PB 2OHFA 1HQRD 3EGRA 2BS2B 1T6BX 2BS3B 4US8A 1B1ZA 4C7ZA 1QLBB 2Y3AA 2DYMA 2QILA 2V0GA 5BYQA 4YWGG 2I38A 2NTSA 1P7FA 1SXTA 4JWSC 5D3DA 4HKZE 4WQMA 1WSPA 5BMGA 3SR6A 2HDEA 3AH7A 4TQ1A 5BYSA 4ARIA 3AE4B 3NVYA 4JX1C 4YT0B 2WLBA 2WXJA 1SF0A 2JQRB 5EE9A 2J42A 3ZYYX 2BS4B 5E6JA 1XEEA 1N5WA 4RF1A 3W2DA 1TY2A 4J3OD 1J7BA 3AE1B 3KWVA 1KTKA 1L0XB 4A6QA 1E10A 1M4VA 3AV8A 1N60A 2V3PA 4KKJA 1FEHA 1CQVA 3Q8FA 4HJGE 1K50A 1K52A 1XCQL 1ZXHA 1E7PB 1IGCA 1ACCA 1F77A 4RGMA 1L0YB 4US9A 2JYTA 1I4RA 4HEA1 1SB3C 2DWQA 4NJCA 1E9MA 1FFVA 1SJED 4ZHOA 3AECB 1N63A 1C4CA 1C77A 2TSSA 2K3UA 2LHEA 3P4QB 2WXNA 2M0AA 3IXSA 5BMHA 2PMVA 3H8HA 3KLSX 1K53A 2N9KA 5GXGB 3U52E 2PW9A 1AW7A 2ICIA 2GRIA 5H8YE 3B2FA 3DWMA 3FILB 4LK0M 3GP7A 5BYRA 2W54A 1D5MC 5G5HA 1QOBA 1FNVA 3EA6A 3AE6B 2N9LA 1FCLA 4WURA 3BVZA 4YTPB 1QQRA 4OZAA 3HRDD 2WXFA 2WXPA 3W1SA 1YNTE 4MM3B 3NVVA 3AE7B 4JWUC 4AS1A 5MPOA 4XDDA 1HZ6A 4MH8A 1FRDA 2BYTA 4B0MA 3R8BA 2PVOD 3T3NA 2K5PA 2Z8LA 5FR3A 1SE2A 1SIJA 4WAFA 1SSNA 2JSVX 1BXTA 3HUIA 3PO0A 4TMAB 3IT6B 1PDXA 3DWGC 3AE9B 1L0VB 2W82A 4YTNB 1ENFA 2KAJA 3U4EG 1A70A 3B9JA 1JW9D 3U7ZA 1JWUD 5EE1A 3PZ8A 1XO3A 1SBBB 3P42A 3RPFC 2PKOA 3J9CA 3TSSA 1YN3A 2V4IB 3VR9B 3AE8B 1MI0A 1FM0D 1EM7A 1RYJA 3RFZB 4ITKA 3AEGB 3AE5B 1TS2A 3Q69A 2GB1A 2RDHA 4IDIA 4WWMA 4Q2JA 2EKIA 5EE0A 1I4GA 3L4PA 4ZRPA 4RGTA 5T8IA 4A55A 1T5XD 1DGJA 4IKGA 1QOAA 5FKAC 2L1AA 1UUPA 4NAWB 2LFIA 2PIAA 4GLSC 2WU5B 2BW2A 1VZ6A 2BB6A 3E9SA 1STEA 1T3QA 1FNWA 2KMMA 2WXGA 1PFDA 1HXYD 1PYWD 2K22A 2WXMA 3FILA 2WDVB 1H7XA 1YQ3B 3O13A 4LTUA 3TEXA 1NVID 3W9CB 3Q8CA 1NI3A 2G9HD 1N62A 2WXRA 1C4AA 4YSZB 1MHHE 5C2TB 1I4PA 1J7CA 1UGJA 1F2RC 2JYEA 2SAKA 3V05A 1GTEA 1NEKB 2J4XA 2H88B 4D2KA 1OFFA 3BVMA 3VQIA 5HHDG 1EU4A 2WP9B 1TS5A 2LUMA 2IGDA 1MVKA 3Q8AA 3BIID 2BBCA 2ZW1A 1KLUD 2N7JA 3LYYA 2M56B 2L83A 2ZW0A 2PVGC 3TEZA 1SJHD 3NZ3A 3ZJTA 3CWIA 2QMTA 1PGAA 1WWTA 3AEDB 2WXLA 1IUEA 1KLGD 4GDLB 5D3IB 3B2GA 1EWCA 2FUG1 4RF0A 3V3XA 4RNAA 1C76A 3BYYB 4M0WA 1B9RA 2AQ1B 1VRAB 2WDRB 3BWUD 4UDUC 4MACA 2I2YA 1FRRA 2KWDA 4USAA 2MJEA 1FD6A 1FXAA 1P7EA 2JX5A 2NTTA 1OQRA 4A8XC 2HTME 3NRZA 3CIRB 1TS4A 3MFGA 1GOZA 2E3TA 1CK1A 2WU2B 2LEKA 3P4PB 3IAS1 4N58A 2WDQB 3IAM1 4DXFA 1PGXA 2JU6X 3PZ7A 1ZDXA 4REZA 1FIQA 5FK9C 1I4XA 4YTMB 2JWUA 4OW0A 2J53A 3UI3A 1LO5D 1V1OA 3TUOA 1D4BA 2WNMA 1L5PA 2EELA 2WQYB 3MJ5A 1XLOA 2H89B 2ACZB 3P4SB 2ONQA 2N0SB 3GB1A 2KDMA 1PGBA 5C3JB 4R3DA 2INNE 1AYFA 2W55A 4YXDB 1JMLA 3BZDB 4ZRQA 1FNUA 1XLQA 1YN4A 3IT4B 2MEKA 1WYGA 3LXFA 2QJLA 3CF4A 4YSXB 1XCTL 2WXKA 2B76B 1SE3A 1FO4A 3VR8B 2K0PA 3R2IA 4CQNA 1ZOYB 1XF5L 3I9V1 3ZQ4A 1JWSD 2QSDA 1BMLC 3U2SC 4ARCA 1JQ4A 4L1BA 2LMCA 1RM6C 1TZOA 2IGHA 1UWXA 4OZCA 1HEZE 4RGOS 4HRSA 3BK1A 3LB8C 4WH4A 1GPXA 1ET9A 3AEFB 4OZBA 4JE3B 1JRPA 1ZUD2 2IGGA 2RPVA 2WXOA 1V97A 4KKIA 4XDCA 3AEBB 1FFUA 3NUHB 1TKGA 1I4HA 3NS1A 4PT5A 5HG2A 4N59A 3I57A 1ZPSA 1JWAD 2X38A 3T3OA 3NVZA 1C79A 4H2AA 1N5XA 3URYA 2KN4A 4KGSA 4N6EB 4OHJA 5I4DA 2L32A 4KGTA 2FE8A 3SEBA 1YN5A 1VR9A 3P1MA 3BVGA 1VLBA 3W5VB 1D5ZC 5H92C 1IGDA 3EUB2 1YJIA 1ZP0B 1VDVA 5HI1A 1Q10A 2AQ2B 1J7AA 1KH0A 1QKZA 5EE3A 4TQ0A 1E0ZA 1QF6A 2FBWB 1MHXA 1MPEA 4HROA 1TKYA 3NVWA 2DBYA 2XN9C 2RDGA 3AE2B 2IJ0A 2KQ4X 1VZ8A 3HVDA 1EWYC 1AN8A 2J52A 3AE3B 1TYGB 1UWMA 1VJKA 2Q5WD 3TEWA 2BT6A 3ZJVA 1ESFA 2BB5A 1SEBD 1I7HA 3C8YA 2AX5A 4L2YA 1GTHA 2VZKD 1ZE3D 4A90A 1VZ7A 1XXGA 1FMAD 4C80A 1RFKA 1HZ5A 1HA5A 4NZLB 3N9YC 5TSSA 2E6XA 1GT8A 2LGIA 4GDKB 1CZPA 4ZOHC 4YSYB 1GB4A 4IOIE 1IBXB 4RH6A 2VZKB 1ET6A 4WIPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N0S B;  3VR9 B;  5C3J B;  1ZXI A;  2BS2 B;  3AE8 B;  2BS3 B;  1AYF A;  2W55 A;  1F0Z A;  4YXD B;  1FM0 D;  4US8 A;  4C7Z A;  1RYJ A;  1V8C A;  1QLB B;  4ITK A;  3AEE B;  3AEG B;  3AE5 B;  1XLQ A;  4IDI A;  4WWM A;  1TJE A;  1DOY A;  1WYG A;  3SFE B;  2EKI A;  2QJL A;  3LXF A;  3L4P A;  5EE0 A;  3CF4 A;  4JWS C;  1DGJ A;  4YSX B;  1QOA A;  4WQM A;  5AUK A;  2B76 B;  3SR6 A;  3AH7 A;  2Y5C A;  3P4R B;  1FO4 A;  3VR8 B;  3AE4 B;  2G1E A;  3KWL A;  3NVY A;  1WGK A;  2PIA A;  4JX1 C;  2WU5 B;  1ZOY B;  4ZHP A;  1T3Q A;  4YT0 B;  2WLB A;  3AMZ A;  1SF0 A;  2JQR B;  4KX6 B;  1QT9 A;  5EE9 A;  2KMM A;  3ZYY X;  1PFD A;  2BS4 B;  1JQ4 A;  1E6E B;  1RM6 C;  2WS3 B;  1N5W A;  2CJN A;  2K22 A;  2WDV B;  1H7X A;  1YQ3 B;  1J7B A;  2CJO A;  4LTU A;  3AE1 B;  1NVI D;  3AM9 A;  3W9C B;  1E10 A;  4HRS A;  1NI3 A;  3AV8 A;  3LB8 C;  1GPX A;  1N60 A;  3AEF B;  2MH7 A;  1N62 A;  1JRP A;  3W5U B;  4YSZ B;  1AWD A;  1ZUD 2;  3VRA B;  1YQ4 B;  5C2T B;  1J7C A;  1V97 A;  1NEN B;  3AEB B;  1E7P B;  1FFU A;  2L52 A;  1TKG A;  3NS1 A;  1GTE A;  1NEK B;  1OQQ A;  4N59 A;  2H88 B;  3SFD B;  1KRH A;  1JWA D;  1OFF A;  2M19 A;  3NVZ A;  4US9 A;  3AB5 A;  1L6V A;  2WP9 B;  1NYQ A;  1SB3 C;  2DWQ A;  1E9M A;  1DOI A;  1FFV A;  1XLN A;  5AUI A;  3AEC B;  1N63 A;  1JAL A;  1N5X A;  3BII D;  4N6E B;  1JRO A;  1FXI A;  3AEA B;  2L83 A;  2M56 B;  2PVG C;  3ETR A;  4P6V F;  3P4Q B;  1ROE A;  4FXC A;  3FC4 A;  3CWI A;  3P63 A;  1WWT A;  1L6U A;  3AED B;  3P1M A;  1IUE A;  1WRI A;  1VLB A;  3W5V B;  5H92 C;  1R7S A;  2CU3 A;  2MJ3 A;  1TKE A;  3B2G A;  1DOX A;  5GXG B;  3EUB 2;  1YJI A;  1KFY B;  1ZP0 B;  3FAH A;  5H8Y E;  1VDV A;  1B9R A;  2WDR B;  1J7A A;  1PUT A;  1NYR A;  1XLP A;  3B2F A;  3DWM A;  5EE3 A;  1FRR A;  4USA A;  1E0Z A;  1QF6 A;  1QOG A;  2FBW B;  2MJE A;  1FXA A;  1QOB A;  2W54 A;  5G5H A;  2JX5 A;  1OQR A;  2HTM E;  3AE6 B;  2MJD A;  3AN1 A;  4HRO A;  3NRZ A;  3CIR B;  1TKY A;  3NVW A;  2E3T A;  2DBY A;  1KF6 B;  4YTP B;  2WU2 B;  3AE2 B;  2LEK A;  3P4P B;  3HRD D;  1EWY C;  3AE3 B;  1TYG B;  4N58 A;  1UWM A;  2WDQ B;  4A9A A;  1VJK A;  2Q5W D;  1WXQ A;  3AE7 B;  3NVV A;  1JWB D;  4JWU C;  2BT6 A;  5MPO A;  3ABV B;  1YJJ A;  3VRB B;  4ZHO A;  1FRD A;  1I7H A;  2AX5 A;  1GTH A;  1FIQ A;  2PVO D;  3WCQ A;  2W3S A;  1FMA D;  4YTM B;  2K5P A;  2K9X A;  1RFK A;  2QIE B;  3HVZ A;  4C7Y A;  1SIJ A;  4C80 A;  1N61 A;  3HUI A;  5G5G A;  1QOF A;  3PO0 A;  1PDX A;  1H7W A;  1CJE A;  2W3R A;  3DWG C;  3AE9 B;  1L0V B;  1GT8 A;  1L5P A;  1RWS A;  2WQY B;  1CZP A;  4YTN B;  1GAQ B;  4ZOH C;  2KAJ A;  1XLO A;  2H89 B;  4YSY B;  1A70 A;  1JW9 D;  3B9J A;  2ACZ B;  5EE1 A;  3P4S B;  3RPF C;  1XO3 A;  2PKO A;  2OHF A; 
#chains in the Genus database with same CATH topology
 4JPS A;  4PS7 A;  1WY8 A;  3A9K B;  4MGI E;  4G3X B;  3MP9 A;  4ICU A;  5DPS A;  1TJE A;  3ZXR A;  3E56 A;  3Q8B A;  2KMC A;  3PRP B;  1WR6 E;  1U4A A;  2HTH A;  2BTE A;  1WF9 A;  2KVR A;  3P4R B;  4I6L B;  2PTL A;  3KWL A;  3Q3N C;  2N4F A;  3A9J A;  2CHZ A;  4JIO U;  2ASQ A;  4KX6 B;  1QT9 A;  1I42 A;  1E6E B;  3WAL A;  3WAO A;  2WS3 B;  4FJZ A;  1EF5 A;  4AP4 C;  4GOC A;  3GZN I;  4AUQ C;  2PJH A;  3DCG A;  3QCA A;  4XWT A;  1GC6 A;  4TSS A;  2L52 A;  4HK2 A;  5CHF A;  1OQQ A;  3SFD B;  3AB5 A;  4B0E A;  4IUM B;  1JAL A;  1WM2 A;  4P16 A;  1FXI A;  3AEA B;  4DQO C;  4M8M A;  4P6V F;  3Q3J A;  5KHQ A;  3ZLZ A;  4E71 A;  2CU3 A;  2MJ3 A;  1TKE A;  2OED A;  3H6N A;  1C78 A;  1KFY B;  3VTW A;  2L05 A;  2KK8 A;  1PUT A;  2GLS A;  4ZRK A;  1WMH A;  2HE7 A;  1QOG A;  1I4Q A;  1UBQ A;  3AUL A;  3R2T A;  2NBW B;  3SD5 A;  3WAM A;  4DK5 A;  4AJW A;  2L00 B;  3ZGZ A;  2K6Q A;  4K1R B;  2RMM A;  3L08 A;  3BK2 A;  2QIE B;  4C7Y A;  1QOF A;  1JRU A;  2QEJ C;  2D3G A;  4LJP B;  4BKS A;  2LAS A;  4NY0 A;  1QLB B;  3ENE A;  3TCA A;  2FUH B;  1S1Q B;  2Y3A A;  3BY4 B;  4X57 B;  2KWU B;  2I38 A;  4YWG G;  2NTS A;  4MH0 E;  1P7F A;  2NCN A;  3U30 A;  4DDG D;  1WSP A;  3ZNI D;  3SR6 A;  3AE4 B;  1Q5W B;  2K6D B;  2NPT A;  4JX1 C;  5EE9 A;  2IY1 B;  2J42 A;  2BS4 B;  5E6J A;  3DBH I;  2MCN B;  1N5W A;  4RF1 A;  1KTK A;  2D07 B;  1E10 A;  4M01 A;  1V49 A;  1N60 A;  1WMH B;  3KYC D;  1ZXH A;  1WGG A;  2INC C;  2KFK A;  1SGH A;  3DHG C;  3KYD D;  1WX7 A;  1L0Y B;  2K25 A;  4HEA 1;  2DWQ A;  1WGH A;  3S2A A;  1E9M A;  4EKU A;  2WXN A;  5IAA C;  2M0A A;  1GJZ A;  5BMH A;  4IM0 A;  2PMV A;  3Q3O C;  2W9N A;  3KLS X;  2GBM A;  3H7P A;  4MGY E;  2ICI A;  3WAN A;  3D32 A;  3DWM A;  5EDS A;  2JZZ A;  2BPS A;  4LK0 M;  3GP7 A;  5G5H A;  3A1Q A;  3CSF A;  1VCB A;  2WX1 A;  3AE6 B;  1TZ1 A;  1RFA A;  5AZG A;  3BVZ A;  4BKG A;  3HRD D;  4ZRI A;  3W1S A;  4CYE A;  2L8J A;  4MM3 B;  1A5R A;  2K1F A;  4MH8 A;  1FRD A;  2BYT A;  4WWO A;  4W9L A;  1SIJ A;  2K8C A;  4WAF A;  1SSN A;  4TMA B;  3PO0 A;  4BBN F;  1RAX A;  1PDX A;  1ZKH A;  4K7U A;  3AE9 B;  1M94 A;  2W82 A;  3DVG X;  4YTN B;  4A3P A;  2KAJ A;  2CU1 A;  1A70 A;  3B9J A;  1JWU D;  5EE1 A;  2DZJ A;  3PZ8 A;  3RPF C;  3TSS A;  1YN3 A;  2LVQ A;  3L17 A;  2L0F A;  2KT7 A;  1CMX B;  4WJP A;  4M0W B;  2BYE A;  2IO2 B;  2KFK B;  2KWV B;  3IG3 A;  2EKI A;  4Q2J A;  2IY0 B;  4ZRP A;  3VAW A;  4RGT A;  1T5X D;  1QOA A;  5FKA C;  4GN1 A;  2L1A A;  1UUP A;  3A33 B;  1SIF A;  2EKE C;  3EC8 A;  1PFD A;  3ZO5 B;  1EO6 A;  3H7P B;  1PYW D;  2PPH A;  2WDV B;  3Q2A C;  4PK1 A;  2G9H D;  1N62 A;  3A1Q B;  1C4A A;  3UIO B;  1MHH E;  3ALB A;  2JVC A;  1UGJ A;  1WX8 A;  3B08 A;  3V05 A;  4ANW A;  1OFF A;  5IP4 D;  2WP9 B;  2N9X A;  3Q8A A;  3X23 A;  2N7J A;  2ZW0 A;  3NZ3 A;  1H8C A;  2K39 A;  5JH5 C;  1PGA A;  3UIP B;  1IUE A;  2O2V B;  4KDI C;  1HE8 A;  3V3X A;  1WXS A;  3BYY B;  1B9R A;  3EHV A;  4MAC A;  1IP9 A;  3GE3 C;  1WIA A;  4WWP A;  4A8X C;  1OQR A;  3VH4 B;  3NRZ A;  4EEW A;  2WU2 B;  4W9F A;  4DXF A;  3IAM 1;  1ZDX A;  4REZ A;  5FK9 C;  3RCZ A;  2XBB C;  1V1O A;  1F9J A;  2GBK A;  2WQY B;  5L83 A;  1WXV A;  2ACZ B;  3P4S B;  3DHH C;  1OEY J;  3W1S C;  4BVU C;  2R2O A;  2ONQ A;  3GB1 A;  4ANU A;  2KN5 A;  1FNU A;  2L0T A;  1XLQ A;  3R3M A;  1WYG A;  3LXF A;  4YSX B;  1E90 A;  1SE3 A;  4MGK E;  2K8H A;  3I9V 1;  4HDO A;  3U2S C;  4L1B A;  1TZO A;  4MSM B;  4OZC A;  1KJT A;  3IHP C;  2V1Y A;  4M8N A;  3LB8 C;  4WH4 A;  1GPX A;  3VTV A;  4OZB A;  1JRP A;  4MEM A;  2IGG A;  2RPV A;  4FHJ A;  2MHJ A;  4W9E A;  1TKG A;  1WZ0 A;  2ZJD A;  2KVZ A;  2X38 A;  4A20 A;  3URY A;  2KN4 A;  2LVP A;  2WHI A;  2GOW A;  4AJY B;  3DBR I;  4A3O A;  4PS8 A;  2VH2 A;  4EOY A;  4WJN A;  1Z5S B;  3KH0 A;  3P1M A;  5LLI A;  4DHJ D;  2KDE B;  2MP2 B;  1TGZ B;  1ZP0 B;  3JW0 X;  4W9J A;  5EE3 A;  1XT9 B;  4TQ0 A;  4KZC A;  4HRO A;  1T0R C;  1TKY A;  2JZ3 B;  3AE2 B;  2KFJ A;  2J52 A;  1XD3 B;  1TYG B;  3RD2 A;  4DWF A;  3TEW A;  1PQS A;  1VZ7 A;  1FMA D;  4C80 A;  5IN7 A;  4II2 B;  3MHS D;  2I1K A;  2J0J A;  1CZP A;  3GOE A;  1GB4 A;  1IBX B;  1ET6 A;  1DOX A;  2V4L A;  1ZXI A;  2NS5 A;  2INP E;  3ZW3 A;  1F0Z A;  4LNF A;  2SEB D;  1ZDV A;  3AEE B;  3ZVV A;  4XGA B;  2YEP F;  2KLG A;  2M17 A;  4P7I A;  4K3C A;  4ZYN A;  2G1E A;  2WXQ A;  3ZNH B;  2WXI A;  2IO3 B;  3NJT A;  4LDT B;  4KGR A;  2C7H A;  2RDB C;  3NOB A;  3M62 B;  3AU5 A;  2JXT A;  2DYO A;  4XE0 A;  2LI5 A;  3VVW B;  2DZK A;  2JF5 A;  1R4N I;  3N32 A;  1V1P A;  4F1S A;  2BKF A;  4FBJ B;  3W5U B;  4NAM A;  1YQ4 B;  2Y5B B;  2AL3 A;  1NEN B;  1ZW7 A;  3RN9 C;  1KRH A;  3KQ4 A;  2R61 A;  5CTR C;  1L6V A;  1NYQ A;  2UU7 A;  1DOI A;  2IZV B;  3MC0 B;  3ETR A;  4FXC A;  3HM3 A;  3P63 A;  4FHK A;  4MT5 A;  1L6U A;  1WRI A;  2PLP A;  1R7S A;  3APC A;  1P3Q U;  2DX5 B;  3LDZ E;  3PV1 A;  3FAH A;  3A9K A;  1UNS A;  4BKT A;  3V62 A;  1FCC C;  2LJI A;  3M3J A;  2WXH A;  4EFO A;  4JLC A;  3AN1 A;  2WYQ A;  1KF6 B;  5BMI A;  4IW0 A;  5FR6 A;  4HDQ A;  4C4V B;  3VFK A;  1TY0 A;  3JYU A;  4WJO A;  1L2N A;  2W3S A;  2LRU A;  2XK5 A;  3ZJU A;  2D3B A;  2LGD A;  1GAQ B;  4HJK A;  1AAR A;  1V1P B;  2DAJ A;  4LNO A;  3A4S C;  2BS2 B;  2BS3 B;  2MSE D;  2KYW A;  2J0M A;  2DYM A;  3L13 A;  2BWF A;  3T8M A;  3DBL B;  4BOZ B;  4HKZ E;  1ZGU B;  1IPG A;  5BMG A;  4I6N B;  2HDE A;  5IO9 A;  4PYU A;  5BYS A;  4ARI A;  2KZR A;  4DXA B;  4IWP A;  1SF0 A;  1WZ3 A;  2CHW A;  3M63 B;  3TIX A;  1MFW A;  1TY2 A;  1J7B A;  1GNU A;  1NBF C;  1M4V A;  4MGZ E;  3AV8 A;  4M00 A;  4KKJ A;  1FEH A;  4LNN A;  1K50 A;  2D2Q A;  2M1M A;  5DCN A;  1E7P B;  1ACC A;  1Y8R C;  1F77 A;  4US9 A;  2MBH A;  1I4R A;  3RZF A;  4NJC A;  1FFV A;  1UZX B;  3Q3F A;  2K3U A;  2MBO A;  3P4Q B;  2XK5 B;  3EEC A;  3QJZ A;  2KC2 A;  1Q1O A;  2NBV B;  1AW7 A;  3FIL B;  4IG7 B;  5E6P A;  2WGS A;  4TV3 A;  3SDL C;  4XZ4 A;  3EFU A;  2WXF A;  4XC2 A;  4E3C A;  3AE7 B;  5DPT A;  2LGX A;  2KJR A;  2JSV X;  3HUI A;  1BXT A;  3CMM B;  2WWZ A;  4AOF A;  1OTR B;  1XO3 A;  1SBB B;  2PKO A;  3L54 A;  3RNB C;  3ZKJ C;  3QHT A;  1MI0 A;  3OJ3 A;  3AEG B;  1WRD B;  2FCQ A;  2GB1 A;  4IDI A;  3VUW A;  5T8I A;  3L4P A;  1DGJ A;  3L16 A;  3JVZ X;  3DBL I;  1V2Y A;  4W9C A;  2MRP A;  2PIA A;  2WU5 B;  2BW2 A;  2BYV E;  1T3Q A;  4ICV A;  1UGM A;  2L7R A;  2KMM A;  2WXG A;  1HXY D;  2BGF A;  3N1Y C;  4HXD A;  2WXM A;  4LTU A;  3W9C B;  1J8C A;  2WXR A;  2O6V D;  1LXD A;  2GBJ A;  4K81 A;  1F2R C;  4MM3 A;  1NEK B;  2J4X A;  2H88 B;  2KJH B;  4KV2 A;  4FLH A;  1FPY A;  4RM8 A;  1MVK A;  2Z59 B;  2OJW A;  2O6V B;  4XX5 A;  3ZJT A;  3CWI A;  2KKC A;  4GSW A;  1WE7 A;  4II3 B;  4EUT A;  1E7U A;  5D3I B;  1E8W A;  3K9O B;  3B2G A;  1EWC A;  4MDK E;  4K7W A;  4M0W A;  2AQ1 B;  2JY6 A;  2KWD A;  4USA A;  2MJE A;  1FXA A;  1P7E A;  2NTT A;  3CIR B;  2FCN A;  4WJQ A;  1CK1 A;  1H4R A;  2LVO A;  4KIK B;  4N58 A;  4JGH B;  3QWZ B;  4W9I A;  1FIQ A;  2KHW B;  2QC8 A;  4ZDV A;  2RGF A;  4YTM B;  2FID A;  2JWU A;  2J53 A;  3ZUN A;  2AWT A;  2EEL A;  3AI5 A;  3MJ5 A;  1XLO A;  2H89 B;  2MX2 A;  1MG4 A;  4R3D A;  5D94 A;  1AYF A;  2W55 A;  3BZD B;  1HTQ A;  3ZIM A;  1XQQ A;  4DBG A;  4GU2 A;  2MEK A;  3PZD A;  2QJL A;  2KWC A;  4N9F 4;  1HTO A;  1XCT L;  2WXK A;  3UF8 A;  3OLM D;  3QK0 A;  2C9W B;  1FO4 A;  2K0P A;  3N1Z C;  2O2V A;  4KDL B;  1ZOY B;  1XF5 L;  3ZQ4 A;  1JQ4 A;  4HLE A;  3ZNG C;  3PHX B;  2IGH A;  1UWX A;  1HEZ E;  3VXW A;  4RGO S;  3MJW A;  5CHW A;  3RNC C;  1V97 A;  3AEB B;  2LXA A;  4PT5 A;  1I4H A;  3NS1 A;  3U8Z A;  3UIN B;  1LFD A;  5J17 A;  1EF1 A;  4KGS A;  1Q0W B;  2EMT A;  4KGT A;  1V9J A;  2QCZ A;  3N3K B;  2YLM A;  3OJ4 B;  4OVV A;  4B9K A;  3BVG A;  1VLB A;  1D5Z C;  2RSU A;  5H92 C;  1IGD A;  4HPP A;  1YJI A;  4M02 A;  4S0R A;  1VDV A;  1J7A A;  1KH0 A;  1YQB A;  3DDC B;  1QKZ A;  4HPM B;  1QF6 A;  2G4S A;  1MPE A;  1OGW A;  2KXJ A;  3NVW A;  3I3T B;  3K9P B;  4ASW C;  2RDG A;  2KQ4 X;  1EWY C;  3PS6 A;  1VJK A;  2Q5W D;  3ZJV A;  5IA7 A;  1J19 A;  3C8Y A;  3NHE B;  3QAQ A;  4A90 A;  4RM9 A;  4NZL B;  1UEL A;  4FJY A;  5TSS A;  1GT8 A;  2LGI A;  2MW5 A;  4IOI E;  1UD7 A;  4WIP A;  3PT2 B;  4WWN A;  3WA0 A;  1V8C A;  3A4R A;  2JZP A;  2DLB A;  4WAA A;  4RGN A;  1DOY A;  4C56 C;  2BF8 B;  3PLV A;  2R2Q A;  3GS2 A;  5AZF A;  2Y5C A;  4NQL B;  5BO4 B;  1TS3 A;  3V60 A;  1WGK A;  5CHV C;  1S3S G;  1KM7 A;  4GB9 A;  1WJU A;  4CO7 A;  2MP2 A;  1DYQ A;  2XEW A;  2WDT B;  1Y56 A;  2CJN A;  2CJO A;  4RMA A;  2MH7 A;  4EZL A;  2D5G A;  2JPH A;  3TEY A;  3VRA B;  1L7Y A;  1TTN A;  5HKH A;  3RYT A;  3ZTC A;  2M19 A;  5DPW A;  2V3N A;  1XLN A;  4EE2 A;  2FNJ B;  2PE9 A;  1JRO A;  1K51 A;  1EU3 A;  2M4N A;  2ON8 A;  1ROE A;  3FC4 A;  4LLG M;  4ZRJ A;  1IBX A;  3Q8E A;  1BUI C;  2LGY A;  4IWQ A;  2JUO A;  3OAW A;  1NYR A;  4NJ6 A;  2GBN A;  1L4D B;  2YEP B;  1KOT A;  4HKQ A;  2AL6 A;  4A9A A;  3HIZ A;  2KNB A;  4FAD A;  2OJR A;  1YJJ A;  1N6Z A;  1C9F A;  3TJP A;  3WCQ A;  3ML8 A;  2K9X A;  2KAN A;  3HVZ A;  1N61 A;  1C4P A;  4FJV B;  1CJE A;  3PHW B;  2DNF A;  1RWS A;  4O1N A;  2ZPN A;  3ML9 A;  4DXG A;  3N30 A;  2LGS A;  4AQ7 A;  1L4Z B;  2OHF A;  4DHJ B;  1T6B X;  1F52 A;  4KVG B;  1WE6 A;  4C7Z A;  3ZRF A;  2N1W A;  2QIL A;  2V0G A;  5BYQ A;  3L10 B;  3L0W B;  4YL8 A;  3AH7 A;  3IVF A;  4HPL B;  4TQ1 A;  5DPR A;  4YT0 B;  2WLB A;  2WXJ A;  5C23 A;  3ZYY X;  1XEE A;  4K7S A;  5D2M B;  1V81 A;  4G50 A;  3RZW C;  2MBE A;  1E8Z A;  4K3B A;  3AE1 B;  3KWV A;  4A6Q A;  1QZE A;  4IC7 B;  2V3P A;  4NNJ B;  1CQV A;  3ZDM C;  4HJG E;  3VHT C;  1K52 A;  2BVC A;  4C4V A;  1XCQ L;  4WQO B;  2JT4 B;  4XYC A;  3AEC B;  1N63 A;  1C4C A;  2QHO A;  1E5W A;  2LJ5 A;  2LHE A;  2MBQ A;  2PEA A;  3H8H A;  3HHM A;  4FN2 A;  1K53 A;  2N9E B;  2LWP A;  2LUE A;  5GXG B;  3U52 E;  4G0N B;  2KO3 A;  1UH6 A;  3B2F A;  2ZCB A;  5BYR A;  2W54 A;  1QOB A;  1R4M B;  5D6J B;  2N9L A;  1FCL A;  1X1M A;  4GXB A;  1QQR A;  3TL5 A;  2DEN B;  1YNT E;  3NVV A;  2C60 A;  2ZZP B;  4AS1 A;  5MPO A;  3UQA A;  2PVO D;  3KW5 B;  3ZNZ B;  3IFW B;  2Z8L A;  1I35 A;  5E6N A;  3IT6 B;  2JWZ A;  3DWG C;  4GDL A;  2KTF A;  3I63 C;  5AEK B;  1ENF A;  1T0Y A;  1JW9 D;  3U7Z A;  4I6P A;  1OEY A;  1EUV B;  3RUI B;  3AE8 B;  5JHA A;  3GZN B;  1FM0 D;  3PLU A;  4KSK C;  3RFZ B;  4HVB A;  4ITK A;  1K8R B;  1UBI A;  4NJ7 A;  4WWM A;  5JZE B;  1I4G A;  4IKG A;  1VD2 A;  3T9L A;  4NAW B;  2BB6 A;  1FNW A;  3NS8 A;  3FIL A;  3O13 A;  1WI0 A;  3TEX A;  1NVI D;  1NI3 A;  4QAY A;  3KUZ A;  4GIV A;  2KC1 A;  3DOW A;  4LNI A;  2KDB A;  2J0K A;  5C2T B;  1I4P A;  3DVG Y;  1WM3 A;  3P2B A;  2LXC A;  4D2K A;  2Z0D B;  3HM6 X;  3VQI A;  5E6O A;  3V6E B;  3N1X C;  2IGD A;  2BBC A;  2ZW1 A;  3LYY A;  2M56 B;  2HD5 B;  1SJH D;  3APD A;  3B1L X;  2LRW A;  3AED B;  4GDL B;  1KLG D;  3NZU A;  3NY5 A;  3TBL D;  2FUG 1;  4RNA A;  3AU4 A;  5J2R A;  3ZDT A;  1VRA B;  2N1V A;  2WDR B;  4LJO B;  2I2Y A;  2YVC A;  1FD6 A;  2JX5 A;  2HTM E;  3DQV A;  2AYO B;  3MFG A;  1GOZ A;  2LEK A;  3APF A;  3VTU A;  3QQ8 B;  1PGX A;  3DBS A;  2N7E A;  2D3A A;  3PZ7 A;  4BFR A;  3UI3 A;  4JL9 A;  2MLB A;  2ZVO A;  1D4B A;  1RLF A;  2WNM A;  1L5P A;  4F7Z A;  3C0R B;  3DBH B;  2N0S B;  1PGB A;  4ANV A;  4IWO A;  1JML A;  1D3Z A;  3WIM A;  1YN4 A;  3IT4 B;  3Q3M C;  2O6V A;  3CF4 A;  3ECI A;  4C00 A;  4AWJ A;  4HWI B;  1KLV A;  5TR5 A;  3VR8 B;  3R2I A;  2DYB A;  4CQN A;  2GMI C;  2CKH B;  4BOS C;  1JWS D;  2QSD A;  2LMC A;  2VRR B;  2A4Z A;  4GDK A;  4GMV A;  1NDD A;  2EMS A;  2KJ6 A;  3R66 C;  1ET9 A;  3AEF B;  3ZXV A;  4EZJ A;  1Z2M A;  1ZUD 2;  2WXO A;  4KIK A;  4W9D A;  2KTR A;  4KKI A;  1FFU A;  3NUH B;  5HG2 A;  4N59 A;  4W9G A;  1ZPS A;  2QDF A;  1JWA D;  5JHB A;  4H2A A;  1P9D U;  1N5X A;  2K8B A;  4N6E B;  2IYD B;  3X0W A;  2KLC A;  4TUU A;  3DHI C;  3PRZ A;  4OHJ A;  5I4D A;  5L95 C;  2L32 A;  1LQB A;  2FE8 A;  1VR9 A;  2ZCC A;  3W5V B;  3A9J B;  2KD0 A;  3AXC A;  5KHO A;  1BT0 A;  4PYZ A;  1TBE A;  4BZA A;  5G55 A;  1LGR A;  2FBW B;  1WX9 A;  5C1Z A;  3RNF C;  4J6I A;  4MJS A;  1T0Q C;  2IJ0 A;  2ZVN A;  1VZ8 A;  1AN8 A;  1WH3 A;  1UWM A;  3VDZ A;  4URK A;  2BT6 A;  3PGE A;  5IOI A;  5LXH A;  1G6J A;  1TIF A;  1I7H A;  2AX5 A;  3MTN B;  1GTH A;  2VZK D;  1XXG A;  1HZ5 A;  3RNG C;  2NR2 A;  2ZEQ A;  3R7Q A;  1TT5 B;  1WGY A;  4GDK B;  4YSY B;  4FA6 A;  2VZK B;  5CX3 A;  2UYZ B;  2KTR B;  1YIW A;  2G3Q B;  3CST A;  2KAC A;  4E74 A;  3NG0 A;  3SFE B;  3KVF B;  1YJ1 A;  1F2R I;  4RFB A;  5AUK A;  5G2N A;  3M95 A;  3NZS A;  3PSE B;  5LNK 1;  1E7V A;  4ZHP A;  4BKS D;  1QIL A;  1GG3 A;  3AMZ A;  1WYW B;  3PVL A;  2D11 A;  3PTF C;  3QAR A;  2IPK D;  5IKC M;  2M8S A;  3AM9 A;  3GE8 C;  1JCK B;  3JSV A;  5AZH A;  4BBN C;  1AWD A;  4ZYS A;  2GI9 A;  5GMV A;  4MJS B;  1SE9 A;  5HFY A;  3O65 B;  1FXT B;  3C19 A;  2C5L C;  1E8Y A;  2IDY A;  1D5X C;  2BQQ A;  5AUI A;  4GGQ A;  2JRI B;  1WXA A;  3QIJ A;  2NMQ A;  2MQJ A;  2LD9 A;  2NPT B;  2Y5P A;  2LHD A;  1MG8 A;  3OWE B;  1XLP A;  1V5O A;  1YX5 B;  3ZRC A;  2MA9 B;  2XNA C;  3RI7 C;  2MJD A;  1YMH E;  2NVU I;  1SE4 A;  2WX0 A;  2C7N B;  4F8C B;  4DDI D;  1WXQ A;  5D7G A;  1JWB D;  5JXV A;  4P1C C;  2KX3 A;  3ABV B;  4XWW A;  3VRB B;  2KQ7 A;  4RCO A;  3I5J C;  4HCN B;  4L23 A;  2X8X X;  2Z0E B;  5G5G A;  1H7W A;  3PRE A;  2W3R A;  3MHZ A;  1D6E C;  1GB1 A;  2AQ3 B;  3BYT B;  3JSV B;  4OVZ A;  1UF0 A;  1JWM D;  1HQR D;  3EGR A;  4W9K A;  4US8 A;  1B1Z A;  2CR5 A;  4HCP B;  3IBE A;  1SXT A;  4JWS C;  5D3D A;  3R7R A;  4WQM A;  2HJ8 A;  3NVY A;  2IND C;  2V3S A;  1GC7 A;  2JQR B;  3DBR B;  2FCM A;  3ONS A;  5J18 A;  3W2D A;  1WJ6 A;  4J3O D;  3W1Y A;  3DPD A;  1L0X B;  3UGB B;  3H1U A;  1ISN A;  2FIF A;  1V6E A;  3CF6 E;  2MWS B;  3Q8F A;  2MBB B;  2DAF A;  1WFY A;  1P0R A;  1V80 A;  1IGC A;  4RGM A;  2JYT A;  2LZ6 A;  3WAP A;  1SB3 C;  1SJE D;  3N20 C;  4ZHO A;  4JQW C;  1C77 A;  2TSS A;  3FKY A;  4BAX A;  3HK0 A;  2RR9 A;  3IXS A;  2G4D B;  2N9K A;  2RPQ A;  2PW9 A;  2GRI A;  3OG5 A;  5H8Y E;  4MSQ B;  1D5M C;  1V86 A;  4S17 A;  1FNV A;  3EA6 A;  3MC8 A;  4WUR A;  1F1H A;  4LNK A;  4YTP B;  4OZA A;  2IO1 B;  2WXP A;  3BIN A;  4JWU C;  4XDD A;  2KDF B;  1HZ6 A;  4B0M A;  3R8B A;  3T3N A;  2K5P A;  5FR3 A;  1SE2 A;  3PRM B;  1WXM A;  1L0V B;  3VUY A;  1WGR A;  3U4E G;  3SU8 X;  2CS4 A;  3P42 A;  2KX0 A;  3J9C A;  2GBR A;  2V4I B;  3VR9 B;  2AEH A;  4NPN A;  2KOX A;  1MJD A;  1EM7 A;  1R4N B;  1RYJ A;  2DHZ A;  2D3C A;  2PE6 B;  1IYF A;  1T0S C;  3AE5 B;  4DHZ B;  1TS2 A;  3Q69 A;  2RDH A;  1P1A A;  5EE0 A;  2J7Q B;  4A55 A;  4TKN A;  2LFI A;  4GLS C;  1VZ6 A;  3E9S A;  1STE A;  4OVU A;  2ZPY A;  2N7D A;  2K22 A;  1H7X A;  1YQ3 B;  2BYF A;  2KMA A;  3Q8C A;  2FAZ A;  4ANX A;  2L76 A;  4YSZ B;  1P98 A;  2IBI B;  3H7S A;  1J7C A;  3ZTD A;  2JYE A;  2SAK A;  2BWE S;  1GTE A;  1C1Y B;  2V9H A;  3BVM A;  2A5U A;  5HHD G;  1EU4 A;  1TS5 A;  2I1J A;  2LUM A;  4P1B C;  2KQS A;  3U7D A;  3BII D;  1KLU D;  3QA8 A;  2L83 A;  3RT3 B;  2PVG C;  3TEZ A;  4IM3 A;  2QMT A;  2BKR B;  1WWT A;  2WXL A;  1YX6 B;  5LXI B;  3LJ3 A;  2DZI A;  4RF0 A;  1C76 A;  4MEL A;  3BWU D;  3RMK C;  4UDU C;  1FRR A;  3QC8 B;  1E8X A;  1TS4 A;  4FUL A;  1WR1 A;  2E3T A;  3P4P B;  1LM8 B;  3IAS 1;  3RNE C;  2WDQ B;  1J0G A;  4NAW A;  3H9D A;  4LDT D;  2JU6 X;  3VH3 B;  1I4X A;  1WJN A;  4OW0 A;  1LO5 D;  3TUO A;  2UWQ A;  2FCS A;  2KDM A;  5C3J B;  4W9H A;  2B3A A;  2INN E;  2VH1 A;  4YXD B;  3B0A A;  4ZRQ A;  3RNA C;  3MC9 A;  2DZM A;  4EZK A;  2N9P C;  2B76 B;  2RD0 A;  3Q6B A;  3KUD B;  4KZ0 A;  2ZNV B;  2HJ1 A;  1BML C;  4ARC A;  1V5T A;  4B95 A;  1WGD A;  1RM6 C;  2JXX A;  4DHZ E;  4HRS A;  3BK1 A;  4PS3 A;  1OQY A;  4ACF A;  1NI2 A;  4JE3 B;  4XDC A;  2M0X A;  3V61 A;  3DVN V;  3I57 A;  2CHX A;  3T3O A;  1YOV B;  3NVZ A;  1C79 A;  1R4M I;  3RUL A;  4KSL C;  3PPA A;  1RRB A;  2REX A;  3SEB A;  2NBU A;  1YN5 A;  3SHQ A;  2G45 B;  2JRH A;  1YD8 U;  1GUA B;  1C3T A;  3Q14 C;  1WJ4 A;  3EUB 2;  2L3Z A;  5HI1 A;  1Q10 A;  2AQ2 B;  2OOB B;  1E0Z A;  1MHX A;  4IM2 A;  2DBY A;  2XN9 C;  3EFC A;  3HVD A;  2ZNV C;  3AE3 B;  4B6W A;  3VUX A;  2KDI A;  3DVN U;  4NQK E;  1ESF A;  2BB5 A;  1SEB D;  2D10 A;  3V6C B;  4L2Y A;  1ZE3 D;  2C7M B;  3KUC B;  4LCD E;  1RFK A;  4G11 A;  1HA5 A;  4CHK A;  3N9Y C;  2E6X A;  4ZOH C;  3TMP B;  3UQB A;  3QX1 A;  4RH6 A;  2IO0 B; 
#chains in the Genus database with same CATH homology
 4JPS A;  1ZXI A;  2INP E;  1F0Z A;  1V8C A;  2SEB D;  1ZDV A;  2KAC A;  3AEE B;  3MP9 A;  2JZP A;  2YEP F;  2DLB A;  1TJE A;  4RGN A;  1DOY A;  4C56 C;  3SFE B;  3E56 A;  3Q8B A;  1F2R I;  3GS2 A;  4RFB A;  5AUK A;  2BTE A;  2Y5C A;  3P4R B;  2PTL A;  1TS3 A;  2G1E A;  3KWL A;  2WXQ A;  5LNK 1;  1WGK A;  2WXI A;  4ZHP A;  4KGR A;  1QIL A;  3AMZ A;  4KX6 B;  1DYQ A;  1QT9 A;  1E6E B;  1Y56 A;  2WS3 B;  2CJN A;  2CJO A;  2IPK D;  2JXT A;  2DYO A;  4XE0 A;  3AM9 A;  1JCK B;  2MH7 A;  1V1P A;  2D5G A;  3W5U B;  1AWD A;  4NAM A;  4XWT A;  3TEY A;  3VRA B;  1YQ4 B;  4ZYS A;  1NEN B;  2GI9 A;  4TSS A;  2L52 A;  5HFY A;  1OQQ A;  2M19 A;  3SFD B;  1KRH A;  3KQ4 A;  2R61 A;  2IDY A;  3AB5 A;  1L6V A;  1NYQ A;  4B0E A;  1D5X C;  2V3N A;  1XLN A;  1DOI A;  5AUI A;  4EE2 A;  1JAL A;  4P16 A;  3MC0 B;  2NMQ A;  1JRO A;  1K51 A;  1FXI A;  3AEA B;  1EU3 A;  3ETR A;  4DQO C;  2ON8 A;  4P6V F;  1ROE A;  4FXC A;  3FC4 A;  3P63 A;  4MT5 A;  1L6U A;  4LLG M;  1WRI A;  2PLP A;  1IBX A;  3Q8E A;  1R7S A;  2CU3 A;  2MJ3 A;  1BUI C;  1TKE A;  2OED A;  1DOX A;  2Y5P A;  1C78 A;  1KFY B;  2LHD A;  3FAH A;  1UNS A;  3OWE B;  1PUT A;  1NYR A;  1XLP A;  1FCC C;  1QOG A;  2LJI A;  2WXH A;  2XNA C;  2MJD A;  1I4Q A;  1YMH E;  3AN1 A;  1SE4 A;  1L4D B;  2YEP B;  1KF6 B;  3R2T A;  5BMI A;  4HKQ A;  4A9A A;  1WXQ A;  1TY0 A;  5D7G A;  1JWB D;  5JXV A;  3ZGZ A;  3ABV B;  1YJJ A;  4XWW A;  1C9F A;  3VRB B;  4RCO A;  2RMM A;  3WCQ A;  2W3S A;  2K9X A;  3BK2 A;  2QIE B;  4L23 A;  3HVZ A;  4C7Y A;  3ZJU A;  1N61 A;  5G5G A;  1C4P A;  1QOF A;  1H7W A;  1CJE A;  2W3R A;  2QEJ C;  3MHZ A;  1D6E C;  1GB1 A;  1RWS A;  4O1N A;  1GAQ B;  4DXG A;  2AQ3 B;  3BYT B;  4AQ7 A;  1L4Z B;  4OVZ A;  1JWM D;  1V1P B;  2OHF A;  1HQR D;  3EGR A;  2BS2 B;  1T6B X;  2BS3 B;  4US8 A;  1B1Z A;  4C7Z A;  1QLB B;  2Y3A A;  2DYM A;  2QIL A;  2V0G A;  5BYQ A;  4YWG G;  2I38 A;  2NTS A;  1P7F A;  1SXT A;  4JWS C;  5D3D A;  4HKZ E;  4WQM A;  1WSP A;  5BMG A;  3SR6 A;  2HDE A;  3AH7 A;  4TQ1 A;  5BYS A;  4ARI A;  3AE4 B;  3NVY A;  4JX1 C;  4YT0 B;  2WLB A;  2WXJ A;  1SF0 A;  2JQR B;  5EE9 A;  2J42 A;  3ZYY X;  2BS4 B;  5E6J A;  1XEE A;  1N5W A;  4RF1 A;  3W2D A;  1TY2 A;  4J3O D;  1J7B A;  3AE1 B;  3KWV A;  1KTK A;  1L0X B;  4A6Q A;  1E10 A;  1M4V A;  3AV8 A;  1N60 A;  2V3P A;  4KKJ A;  1FEH A;  1CQV A;  3Q8F A;  4HJG E;  1K50 A;  1K52 A;  1XCQ L;  1ZXH A;  1E7P B;  1IGC A;  1ACC A;  1F77 A;  4RGM A;  1L0Y B;  4US9 A;  2JYT A;  1I4R A;  4HEA 1;  1SB3 C;  2DWQ A;  4NJC A;  1E9M A;  1FFV A;  1SJE D;  4ZHO A;  3AEC B;  1N63 A;  1C4C A;  1C77 A;  2TSS A;  2K3U A;  2LHE A;  3P4Q B;  2WXN A;  2M0A A;  3IXS A;  5BMH A;  2PMV A;  3H8H A;  3KLS X;  1K53 A;  2N9K A;  5GXG B;  3U52 E;  2PW9 A;  1AW7 A;  2ICI A;  2GRI A;  5H8Y E;  3B2F A;  3DWM A;  3FIL B;  4LK0 M;  3GP7 A;  5BYR A;  2W54 A;  1D5M C;  5G5H A;  1QOB A;  1FNV A;  3EA6 A;  3AE6 B;  2N9L A;  1FCL A;  4WUR A;  3BVZ A;  4YTP B;  1QQR A;  4OZA A;  3HRD D;  2WXF A;  2WXP A;  3W1S A;  1YNT E;  4MM3 B;  3NVV A;  3AE7 B;  4JWU C;  4AS1 A;  5MPO A;  4XDD A;  1HZ6 A;  4MH8 A;  1FRD A;  2BYT A;  4B0M A;  3R8B A;  2PVO D;  3T3N A;  2K5P A;  2Z8L A;  5FR3 A;  1SE2 A;  1SIJ A;  4WAF A;  1SSN A;  2JSV X;  1BXT A;  3HUI A;  3PO0 A;  4TMA B;  3IT6 B;  1PDX A;  3DWG C;  3AE9 B;  1L0V B;  2W82 A;  4YTN B;  1ENF A;  2KAJ A;  3U4E G;  1A70 A;  3B9J A;  1JW9 D;  3U7Z A;  1JWU D;  5EE1 A;  3PZ8 A;  1XO3 A;  1SBB B;  3P42 A;  3RPF C;  2PKO A;  3J9C A;  3TSS A;  1YN3 A;  2V4I B;  3VR9 B;  3AE8 B;  1MI0 A;  1FM0 D;  1EM7 A;  1RYJ A;  3RFZ B;  4ITK A;  3AEG B;  3AE5 B;  1TS2 A;  3Q69 A;  2GB1 A;  2RDH A;  4IDI A;  4WWM A;  4Q2J A;  2EKI A;  5EE0 A;  1I4G A;  3L4P A;  4ZRP A;  4RGT A;  5T8I A;  4A55 A;  1T5X D;  1DGJ A;  4IKG A;  1QOA A;  5FKA C;  2L1A A;  1UUP A;  4NAW B;  2LFI A;  2PIA A;  4GLS C;  2WU5 B;  2BW2 A;  1VZ6 A;  2BB6 A;  3E9S A;  1STE A;  1T3Q A;  1FNW A;  2KMM A;  2WXG A;  1PFD A;  1HXY D;  1PYW D;  2K22 A;  2WXM A;  3FIL A;  2WDV B;  1H7X A;  1YQ3 B;  3O13 A;  4LTU A;  3TEX A;  1NVI D;  3W9C B;  3Q8C A;  1NI3 A;  2G9H D;  1N62 A;  2WXR A;  1C4A A;  4YSZ B;  1MHH E;  5C2T B;  1I4P A;  1J7C A;  1UGJ A;  1F2R C;  2JYE A;  2SAK A;  3V05 A;  1GTE A;  1NEK B;  2J4X A;  2H88 B;  4D2K A;  1OFF A;  3BVM A;  3VQI A;  5HHD G;  1EU4 A;  2WP9 B;  1TS5 A;  2LUM A;  2IGD A;  1MVK A;  3Q8A A;  3BII D;  2BBC A;  2ZW1 A;  1KLU D;  2N7J A;  3LYY A;  2M56 B;  2L83 A;  2ZW0 A;  2PVG C;  3TEZ A;  1SJH D;  3NZ3 A;  3ZJT A;  3CWI A;  2QMT A;  1PGA A;  1WWT A;  3AED B;  2WXL A;  1IUE A;  1KLG D;  4GDL B;  5D3I B;  3B2G A;  1EWC A;  2FUG 1;  4RF0 A;  3V3X A;  4RNA A;  1C76 A;  3BYY B;  4M0W A;  1B9R A;  2AQ1 B;  1VRA B;  2WDR B;  3BWU D;  4UDU C;  4MAC A;  2I2Y A;  1FRR A;  2KWD A;  4USA A;  2MJE A;  1FD6 A;  1FXA A;  1P7E A;  2JX5 A;  2NTT A;  1OQR A;  4A8X C;  2HTM E;  3NRZ A;  3CIR B;  1TS4 A;  3MFG A;  1GOZ A;  2E3T A;  1CK1 A;  2WU2 B;  2LEK A;  3P4P B;  3IAS 1;  4N58 A;  2WDQ B;  3IAM 1;  4DXF A;  1PGX A;  2JU6 X;  3PZ7 A;  1ZDX A;  4REZ A;  1FIQ A;  5FK9 C;  1I4X A;  4YTM B;  2JWU A;  4OW0 A;  2J53 A;  3UI3 A;  1LO5 D;  1V1O A;  3TUO A;  1D4B A;  2WNM A;  1L5P A;  2EEL A;  2WQY B;  3MJ5 A;  1XLO A;  2H89 B;  2ACZ B;  3P4S B;  2ONQ A;  2N0S B;  3GB1 A;  2KDM A;  1PGB A;  5C3J B;  4R3D A;  2INN E;  1AYF A;  2W55 A;  4YXD B;  1JML A;  3BZD B;  4ZRQ A;  1FNU A;  1XLQ A;  1YN4 A;  3IT4 B;  2MEK A;  1WYG A;  3LXF A;  2QJL A;  3CF4 A;  4YSX B;  1XCT L;  2WXK A;  2B76 B;  1SE3 A;  1FO4 A;  3VR8 B;  2K0P A;  3R2I A;  4CQN A;  1ZOY B;  1XF5 L;  3I9V 1;  3ZQ4 A;  1JWS D;  2QSD A;  1BML C;  3U2S C;  4ARC A;  1JQ4 A;  4L1B A;  2LMC A;  1RM6 C;  1TZO A;  2IGH A;  1UWX A;  4OZC A;  1HEZ E;  4RGO S;  4HRS A;  3BK1 A;  3LB8 C;  4WH4 A;  1GPX A;  1ET9 A;  3AEF B;  4OZB A;  4JE3 B;  1JRP A;  1ZUD 2;  2IGG A;  2RPV A;  2WXO A;  1V97 A;  4KKI A;  4XDC A;  3AEB B;  1FFU A;  3NUH B;  1TKG A;  1I4H A;  3NS1 A;  4PT5 A;  5HG2 A;  4N59 A;  3I57 A;  1ZPS A;  1JWA D;  2X38 A;  3T3O A;  3NVZ A;  1C79 A;  4H2A A;  1N5X A;  3URY A;  2KN4 A;  4KGS A;  4N6E B;  4OHJ A;  5I4D A;  2L32 A;  4KGT A;  2FE8 A;  3SEB A;  1YN5 A;  1VR9 A;  3P1M A;  3BVG A;  1VLB A;  3W5V B;  1D5Z C;  5H92 C;  1IGD A;  3EUB 2;  1YJI A;  1ZP0 B;  1VDV A;  5HI1 A;  1Q10 A;  2AQ2 B;  1J7A A;  1KH0 A;  1QKZ A;  5EE3 A;  4TQ0 A;  1E0Z A;  1QF6 A;  2FBW B;  1MHX A;  1MPE A;  4HRO A;  1TKY A;  3NVW A;  2DBY A;  2XN9 C;  2RDG A;  3AE2 B;  2IJ0 A;  2KQ4 X;  1VZ8 A;  3HVD A;  1EWY C;  1AN8 A;  2J52 A;  3AE3 B;  1TYG B;  1UWM A;  1VJK A;  2Q5W D;  3TEW A;  2BT6 A;  3ZJV A;  1ESF A;  2BB5 A;  1SEB D;  1I7H A;  3C8Y A;  2AX5 A;  4L2Y A;  1GTH A;  2VZK D;  1ZE3 D;  4A90 A;  1VZ7 A;  1XXG A;  1FMA D;  4C80 A;  1RFK A;  1HZ5 A;  1HA5 A;  4NZL B;  3N9Y C;  5TSS A;  2E6X A;  1GT8 A;  2LGI A;  4GDK B;  1CZP A;  4ZOH C;  4YSY B;  1GB4 A;  4IOI E;  1IBX B;  4RH6 A;  2VZK B;  1ET6 A;  4WIP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...