3AEEB

Crystal structure of porcine heart mitochondrial complex ii bound with atpenin a5
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
239
structure length
239
Chain Sequence
PRIKKFAIYRWDPDKTGDKPHMQTYEIDLNNCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLDKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTGTCPKGLNPGKAIAEIKKMMATYKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Crystal structure of porcine heart mitochondrial complex II bound with Atpenin A5
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 68
structure length 239
sequence length 239
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 3aeeB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3aeeB01
1TYGB 2H88B 3W5UB 5GXGB 1N63A 2DBYA 4FXCA 2Q5WD 5G5HA 2AX5A 1T3QA 2BS2B 1KFYB 2WDQB 3CWIA 5G5GA 4C7YA 3AE7B 3NVZA 1QT9A 2WS3B 4HRSA 1E0ZA 3P1MA 1WYGA 1SIJA 3FC4A 1FIQA 2PVOD 4YTPB 2CU3A 1J7AA 3AM9A 2MJEA 1KF6B 1L6UA 1N60A 2BT6A 4US9A 1WXQA 2WU2B 2G1EA 2EKIA 3LB8C 1SB3C 3AMZA 1CJEA 4ZHOA 1OQQA 2CJOA 2W55A 1VLBA 2W54A 1WRIA 1DOYA 5EE3A 3AE2B 3VRBB 5C3JB 4IDIA 2L52A 1R7SA 2WDRB 3NS1A 5AUKA 2PVGC 5EE0A 3AN1A 1VJKA 3SR6A 2N0SB 4LTUA 3LXFA 4N6EB 2MJDA 1QOBA 3NVWA 2LEKA 1NENB 1NI3A 1QOGA 4US8A 2BS3B 3HUIA 3P63A 3B9JA 1UWMA 1YJIA 1QOFA 1JROA 4JX1C 1GAQB 4YT0B 2WP9B 4ITKA 3AEGB 1E9MA 3AECB 4JWSC 4N59A 1NEKB 4HROA 1GPXA 1FRDA 1E10A 1VDVA 4ZOHC 1ZP0B 1E7PB 2DWQA 3B2FA 3NVYA 1TKEA 1WWTA 3NVVA 1YJJA 4JWUC 1QLBB 4P6VF 3ZYYX 1GTHA 4ZHPA 1FXAA 1JQ4A 1ZOYB 1EWYC 2ACZB 1J7CA 2W3RA 1AWDA 1L5PA 1TKGA 3WCQA 1NYRA 1PUTA 2OHFA 2Y5CA 3VR9B 1OQRA 1L0VB 1QOAA 1H7WA 2M56B 2QJLA 1H7XA 3NRZA 3AE8B 2KAJA 2FBWB 3AE6B 3W5VB 1ZXIA 1FFUA 3L4PA 1XO3A 1DOXA 1XLQA 1TJEA 4N58A 1DGJA 2QIEB 2MJ3A 4YSXB 1XLOA 3AEFB 1NYQA 1JWBD 1V8CA 1E6EB 3DWGC 1JWAD 3CF4A 1V97A 2HTME 1DOIA 1N5XA 3P4SB 5MPOA 1FO4A 3ETRA 2KMMA 3AE1B 1N5WA 1PFDA 3EUB2 2L83A 1PDXA 1FMAD 1GT8A 1J7BA 1XLPA 3CIRB 4WQMA 5EE9A 3W9CB 4C80A 1NVID 2M19A 1AYFA 1I7HA 1A70A 2B76B 3BIID 4YTNB 1N61A 3AE4B 3DWMA 3VRAB 4A9AA 1YQ4B 3P4QB 3SFDB 4YSZB 3KWLA 1YQ3B 3AH7A 4C7ZA 2PKOA 1RM6C 5H92C 1N62A 1ZUD2 1IUEA 4WWMA 3HRDD 1FFVA 1KRHA 1B9RA 5AUIA 1JW9D 3P4PB 1FRRA 2W3SA 3VR8B 1RWSA 3AEAB 1RFKA 2WDVB 2CJNA 3HVZA 1QF6A 3RPFC 1WGKA 1XLNA 1JRPA 1GTEA 2WU5B 3AE9B 1TKYA 3AEDB 2K22A 3PO0A 4KX6B 1RYJA 1OFFA 3B2GA 2JX5A 5EE1A 5H8YE 3AB5A 3AE5B 5C2TB 1FM0D 3AEBB 2K9XA 4USAA 2E3TA 2K5PA 2H89B 4YTMB 3AV8A 3P4RB 3AE3B 3SFEB 2WLBA 2MH7A 4YXDB 3FAHA 1F0ZA 1FXIA 2BS4B 4YSYB 2WQYB 1JALA 3AEEB 1CZPA 2JQRB 1SF0A 2PIAA 1L6VA 3ABVB 1ROEA
chains in the Genus database with same CATH superfamily
3BINA 1JMLA 3ONSA 3RD2A 2Z0DB 3RZWC 3AE7B 1UWXA 1SE9A 1E0ZA 2QC8A 2MSED 2PVOD 2GMIC 1KF6B 2BT6A 4WIPA 1C76A 1SB3C 1YJ1A 2D3BA 4AJWA 1WXSA 2WYQA 3D32A 3TEXA 3NS1A 2R61A 1QOGA 2NPTB 3B9JA 4IM0A 4A6QA 3AEGB 1WGDA 2D3CA 4BKSD 2KFKA 4TSSA 2IJ0A 1ET9A 3ZNHB 1E8ZA 3BVZA 1L5PA 3WCQA 2JUOA 4EUTA 1MHHE 1KM7A 1LO5D 3UGBB 4KKJA 1DOXA 1E7VA 4YSXB 5AEKB 2WXQA 2MLBA 2KC2A 1I4PA 4ZRKA 2SEBD 1V1PA 3CIRB 4HEA1 1NVID 4MGKE 4WH4A 4F8CB 4S0RA 3DBHB 2DX5B 1ENFA 2JRHA 4K81A 3VRAB 4MACA 1XCQL 1YQ4B 1N6ZA 1ZUD2 3HRDD 3GE3C 2DENB 3KWVA 1L4DB 3VXWA 3DOWA 3TEWA 3VR8B 2JYTA 2CJNA 1WGKA 1YMHE 1PGBA 3C8YA 2JX5A 2M4NA 3AE5B 1FXTB 3W1SA 1TZ1A 3TUOA 5LLIA 1RRBA 1WXMA 3P4RB 3SU8X 1F0ZA 2J52A 2WXMA 4KIKA 1CZPA 1R4NB 1D4BA 3PTFC 4M0WA 4N9F4 2CU1A 2CHXA 4HRSA 3NJTA 4KKIA 1ZW7A 3AM9A 1ZXHA 2G1EA 2L05A 3K9PB 1CJEA 4IWOA 4KZCA 2M17A 5FK9C 2ICIA 2GB1A 5LXHA 2KOXA 2MJDA 2LJIA 4US8A 1ZDXA 3B08A 2ZW1A 1TTNA 1UF0A 2AL3A 3H7PA 3ZKJC 4N59A 2MBBB 1K52A 1ZP0B 3SEBA 3R2IA 3RCZA 2AQ2B 4KGSA 5D2MB 1Q10A 2ACZB 4BFRA 5D7GA 4FJVB 4GLSC 1QOAA 1TS3A 1D5MC 2BVCA 2ON8A 3T3OA 2EMSA 4IG7B 4EE2A 3EA6A 1JWAD 1V97A 1XT9B 1N5XA 2IO1B 3JW0X 4HVBA 2K6QA 2KJRA 1P7FA 1F1HA 3KUZA 1A70A 4OW0A 3DWMA 4URKA 3SFDB 3UF8A 3TEYA 4BKTA 1ET6A 2MBHA 3OJ3A 3QCAA 1FNWA 1GC7A 1UBIA 4JL9A 2MWSB 1HE8A 4GSWA 1HQRD 3PRZA 2KHWB 1MG4A 4ICUA 3ZO5B 4AOFA 4KX6B 4NJ6A 1WJNA 1RFAA 4O1NA 4BBNC 3AEBB 1JCKB 3QWZB 2KDIA 3LJ3A 2L0FA 2KLGA 4ANVA 3X23A 1P98A 3IG3A 5BMHA 1FXIA 4E74A 4BZAA 1VZ6A 1ZE3D 2MBEA 3TBLD 2DBYA 3EFCA 4S17A 2LASA 2XNAC 2KNBA 3VQIA 1XEEA 2XBBC 4NY0A 4ANXA 2GRIA 3URYA 2FNJB 3PHXB 4CHKA 4YWGG 3J9CA 2W54A 3DDCB 1WRIA 5HHDG 3VH4B 4IDIA 5G2NA 2WDRB 4JLCA 1V5TA 2ZNVB 2GBRA 1HEZE 2KX3A 3RNAC 2LEKA 4WJOA 3P63A 2J0MA 1QOFA 3KYCD 1L4ZB 1V81A 2IYDB 4ZRIA 1BXTA 3N20C 3WIMA 4K3CA 2INNE 3VTVA 2RDGA 1ACCA 4LCDE 2LHEA 3ECIA 2Y5CA 1ZKHA 3AE8B 2KAJA 5E6PA 1EF1A 1WI0A 3E9SA 3M95A 3L4PA 4MDKE 4TV3A 3PRMB 1TT5B 1C79A 2RD0A 5CHWA 5KHOA 1WM2A 1UH6A 1J7BA 3WAPA 4C4VB 2GLSA 3DHHC 3JVZX 4B0MA 4C7ZA 2INPE 3W1SC 3ZGZA 4I6PA 2J0KA 5TSSA 5AUIA 3DBSA 2VH2A 4X57B 1KH0A 5GMVA 4HWIB 3AE9B 3RULA 1E90A 3W1YA 3O65B 1RYJA 4OVZA 3APDA 5C1ZA 4HCNB 2KN4A 4YSYB 1CMXB 2JQRB 3H9DA 4ZRJA 2OOBB 2LJ5A 1KFYB 2N1VA 4IOIE 5G5GA 4C7YA 4GN1A 3BVMA 2LXCA 4DHZE 3NVZA 2DZMA 3FC4A 4BKGA 4K7WA 3ZTCA 2KZRA 4GMVA 1V49A 2XEWA 3V3XA 4M02A 4AUQC 2NMQA 3LB8C 3AMZA 1KJTA 2KX0A 4F1SA 3MHSD 1BT0A 3AE2B 3ZJVA 1EU3A 1R7SA 4PS8A 3LXFA 4BOSC 2WXJA 1Y8RC 4MM3B 2DYOA 5J2RA 5DPTA 1MJDA 1GG3A 4TQ0A 2RDBC 2PPHA 4JE3B 2KD0A 1JQ4A 2BYFA 4DQOC 2KMCA 3RI7C 1PUTA 3EECA 1YNTE 1H7XA 2FBWB 1XO3A 3C0RB 3Q8BA 4B95A 1TS4A 2O6VB 1EWCA 1TY0A 2NBWB 3EUB2 2C7HA 2MCNB 3W9CB 3EHVA 5C23A 3ZJUA 2HTHA 3QK0A 3FKYA 3PHWB 3ZNZB 5BYQA 2KWVB 1FCCC 4DBGA 1RWSA 4W9GA 2KDMA 4KGTA 4H2AA 2N7DA 3UQBA 1KLUD 3CF6E 1EU4A 4FJZA 4AS1A 3MTNB 2E3TA 3RMKC 4KSLC 2WLBA 1WGRA 2MBOA 4HPLB 3FILA 3A9KA 4TKNA 2ASQA 2RR9A 2A4ZA 1VZ7A 2KXJA 3ZRFA 4DDGD 5JXVA 2OJRA 2KMAA 3AU4A 1QT9A 5HI1A 4ARIA 4OVVA 3A4RA 1SJHD 4ACFA 2VH1A 1YD8U 3BYYB 1OQQA 3OJ4B 4LNOA 3A9JA 1WX7A 2FCQA 1FPYA 5E6OA 1AN8A 2N0SB 2WX0A 2KDBA 1QOBA 1UELA 1NENB 1LM8B 3V6EB 2KVRA 4HCPB 1I4RA 1ZDVA 1QILA 1FCLA 1E7PB 4LJOB 1GC6A 3NZ3A 2WDTB 4WJPA 1H7WA 2Y5PA 2RMMA 3KLSX 4M00A 4D2KA 2V3SA 2KN5A 3OG5A 3H8HA 4P16A 4RGOS 2Y5BB 3ML8A 4W9CA 3AE4B 1V9JA 4IC7B 4TQ1A 5EDSA 4FLHA 3MP9A 4RCOA 1RM6C 4W9HA 2A5UA 3ZJTA 5HFYA 4P7IA 3P4PB 5BMGA 3L0WB 2DZIA 1GTEA 3PO0A 3CSTA 4F7ZA 3PT2B 1Z5SB 2AL6A 5CX3A 5G55A 1FM0D 3QHTA 1YQBA 3A1QA 4ZRPA 2LVOA 1CQVA 2BS4B 1TZOA 3CSFA 1SSNA 1V2YA 3U7ZA 1EF5A 3PLVA 4FULA 3PGEA 4J6IA 1V80A 1SIJA 2CU3A 1WJUA 4MELA 4IM2A 1WXQA 1K50A 2JRIB 1OQYA 1IYFA 2JWZA 2N1WA 2IDYA 4OZCA 2AWTA 2MP2B 4BBNF 2RPQA 1NI3A 1YN4A 3VUXA 3APFA 4XWWA 3IXSA 3A33B 2BWFA 1C77A 1WR6E 1VDVA 1HZ6A 3HIZA 3NVYA 3OLMD 2IY0B 4B0EA 2UYZB 1E7UA 2UWQA 3AULA 4ANUA 2G4SA 2QJLA 4XGAB 3ZNID 2R2QA 4N58A 1DGJA 2MJ3A 2BKRB 4IWPA 2HTME 2DAFA 3V60A 5D3DA 2M1MA 4EKUA 2XK5A 1D6EC 4NQLB 1GB4A 4W9IA 1HTQA 1RAXA 1WMHB 2SAKA 4WAFA 3ZW3A 4GOCA 1JW9D 4MJSB 4HLEA 4GDKB 1C78A 3U30A 1I4GA 1XLNA 2K22A 1H4RA 4RNAA 2YEPF 4BVUC 3MFGA 3Q8AA 3DBLB 2LWPA 5C2TB 2NS5A 3PS6A 1B1ZA 2DNFA 2PE6B 4WURA 2K5PA 3GS2A 2KK8A 2RDHA 1TY2A 4HKZE 4NAWA 4EFOA 4ZHOA 4IWQA 4M8MA 1SGHA 2BS2B 2WDQB 4J3OD 4RGNA 4WJQA 3Q69A 4Q2JA 1GB1A 3VTWA 2MRPA 1S3SG 1WY8A 5JZEB 1WGHA 4A20A 2W9NA 3ZDMC 3DQVA 2WGSA 2W55A 1S1QB 3LDZE 4LNKA 2HJ8A 1OGWA 3NOBA 1IBXA 2PVGC 3JSVB 4DHJD 3NVWA 3P2BA 3MC9A 3X0WA 4BAXA 3PSEB 3DPDA 4YT0B 4NQKE 3IAM1 3APCA 2LGIA 2KDFB 2MA9B 4ZHPA 4ZDVA 2KTRB 4HXDA 2L1AA 1KOTA 4IW0A 3VUWA 4KSKC 2MBQA 2K8BA 2KDEB 3T8MA 1JWBD 3N30A 2O2VB 2LRWA 4MT5A 2LVPA 2JU6X 2NTSA 3UQAA 2LUEA 2INDC 2L83A 5AZFA 4C80A 4FJYA 4FADA 1QQRA 4ZYNA 2L8JA 2I38A 4LDTB 1WJ4A 1YQ3B 2ZVOA 2M0XA 1WX9A 4AWJA 4RGMA 3HVDA 3KUCB 1FFVA 4KDIC 2BYEA 2VZKB 1JRPA 1OFFA 5EE1A 4HJKA 1H8CA 2FE8A 2PJHA 3SFEB 1SE3A 2V9HA 1WGYA 3Q3OC 2ONQA 2C7NB 4ZYSA 2I2YA 3JYUA 2NBVB 3CWIA 3RNFC 3DBHI 4AQ7A 2BQQA 5CTRC 3IBEA 3S2AA 1UBQA 1DYQA 2C5LC 4RH6A 2JY6A 5AZHA 5J18A 4PYUA 1VRAB 2WXGA 3V62A 5IOIA 1WR1A 2ZVNA 3RFZB 3M62B 3N1ZC 2AYOB 3PZDA 1IGCA 2FCSA 1YJIA 1SXTA 4JX1C 4E3CA 1GPXA 4JPSA 2WXKA 1YJJA 3NHEB 3DVNU 2WWZA 4WWOA 1TJEA 2MEKA 2QIEB 1XD3B 3CF4A 3VVWB 3C19A 2NVUI 1OEYJ 2EKEC 1GT8A 5EE9A 2QDFA 2KACA 3P42A 2NPTA 4IKGA 1MG8A 1IPGA 1WM3A 3TEZA 2D10A 2L76A 1R4MI 2DHZA 2JXTA 3RNEC 3R7QA 2L3ZA 4CO7A 1GOZA 1V86A 1WXAA 2MHJA 3RYTA 2JZPA 3PZ7A 3W2DA 2L0TA 3VUYA 1MVKA 4AP4C 2BGFA 3QX1A 2IY1B 5LXIB 4MEMA 4W9FA 2CS4A 2WXRA 4MGIE 2INCC 2QSDA 2R2OA 1T0RC 4ZRQA 4DDID 2L52A 3ABVB 2K25A 2FCMA 1UGJA 1WIAA 1WF9A 3ZXRA 5IAAC 2IO3B 4YTPB 1J7AA 3DVNV 1YX6B 1QKZA 1C9FA 3MJWA 3NZUA 1P0RA 2ZPNA 4DWFA 5AUKA 4RM9A 4HK2A 4N6EB 3KW5B 4NNJB 1XXGA 3SD5A 4HKQA 2D3AA 2WP9B 3JSVA 3RNBC 2JVCA 2NBUA 4GXBA 4JGHB 2LMCA 4L2YA 1GTHA 4NZLB 2HJ1A 2W3RA 2K3UA 4DK5A 4W9EA 5JHAA 3HHMA 3GZNB 4HPMB 2YVCA 2KWDA 2FAZA 3ETRA 4M8NA 5TR5A 2DYBA 3M3JA 1NI2A 2O2VA 4ASWC 1IGDA 3NG0A 3BYTB 2D3GA 4NJCA 3QA8A 2EELA 2KKCA 2ZPYA 4G0NB 4PK1A 2LI5A 1FNVA 2LVQA 3BK2A 2JYEA 3V6CB 4KV2A 1V1OA 2D2QA 2BB6A 1WYWB 4OVUA 4XZ4A 1WJ6A 2MX2A 4YTMB 5HKHA 3WAMA 5IO9A 3KH0A 3R3MA 3PVLA 1T0SC 2IZVB 5EE0A 2KFKB 1ROEA 3IHPC 1P9DU 2Y3AA 2WS3B 2PE9A 4MSQB 4GDLB 1FNUA 3GP7A 2MJEA 1N60A 2PEAA 2EKIA 3TL5A 1VCBA 1VLBA 3QARA 4WWPA 4ANWA 2YEPB 4LJPB 1NDDA 1V1PB 3DBRI 2ZCCA 3I9V1 1WSPA 2WXLA 5LNK1 3DVGX 1V5OA 3I5JC 1TGZB 3Q8FA 2KC1A 3WANA 4G11A 1AWDA 4MH8A 1F2RI 4EZKA 2KQ7A 2LGDA 2JT4B 2YLMA 4GB9A 2ZZPB 3AEFB 2LGXA 1E6EB 3ZQ4A 2WXFA 2AEHA 3P4SB 4WQOB 1N5WA 2WX1A 4KIKB 1FMAD 3HM6X 4DHZB 2BTEA 2AQ1B 4M0WB 1T5XD 3NS8A 3Q3FA 2BYVE 2V4LA 4M01A 4A9AA 3P4QB 4YSZB 2QILA 5JHBA 2BBCA 1XF5L 2EMTA 3WA0A 2WDVB 3SDLC 1E8YA 2N4FA 4W9JA 1KLVA 1PGAA 2RSUA 3WALA 4B9KA 1AARA 2M8SA 2MH7A 1PYWD 4MGZE 1D5ZC 3ZXVA 2N7JA 2PIAA 5GXGB 4C4VA 2Q5WD 2V3PA 2N9LA 4IM3A 5L83A 2KT7A 3PV1A 3Q2AC 1L6UA 2V4IB 2N7EA 2G9HD 1L7YA 2WHIA 1WX8A 3T9LA 1DOYA 2B3AA 3VRBB 2IGDA 1VJKA 4PT5A 3VH3B 1D5XC 1ZPSA 3R2TA 1FD6A 2DYMA 1Q0WB 3HUIA 4RM8A 1WXVA 4XWTA 2KYWA 3Q14C 2JZ3B 1YIWA 1NEKB 2FIFA 1E10A 3KYDD 2V1YA 3OWEB 2LGYA 1WWTA 3H7SA 4NJ7A 1I42A 2I1KA 1J7CA 2FUG1 3RUIB 1Q1OA 2KQ4X 3L54A 1FFUA 1J19A 2Z59B 5MPOA 2KMMA 1ESFA 1SJED 3VTUA 1PFDA 1PDXA 4WQMA 2KANA 4FHKA 2GBJA 3HM3A 4EZJA 3AU5A 4MM3A 3RNGC 4C56C 3VDZA 1SBBB 2DAJA 2JXXA 4PS7A 3PREA 1PQSA 3RZFA 1IUEA 1HZ5A 4P1BC 2BW2A 2W3SA 4W9LA 1JWSD 3GE8C 4UDUC 2WU5B 3AEDB 2K8HA 3HK0A 2D11A 2KJHB 4YXDB 3FAHA 2D07B 3ML9A 2O6VA 4ICVA 5IKCM 2BB5A 5DPWA 2H88B 1Q5WB 3ZLZA 5IP4D 1LQBA 4XYCA 1EUVB 4RF1A 1STEA 2KWCA 4TMAB 2CJOA 4GDLA 4GIVA 3N1YC 4FBJB 1UZXB 2WXNA 3AN1A 1M4VA 1T0QC 4JIOU 2CKHB 2NCNA 4IUMB 2OEDA 2REXA 2N9PC 2LXAA 1XQQA 1AW7A 2HE7A 4E71A 2UU7A 2LHDA 3N3KB 2K6DB 2RGFA 1F9JA 1WZ3A 3L16A 4XX5A 4JWUC 5I4DA 2C60A 1ZOYB 5CHVC 3V05A 2ZNVC 3MJ5A 4AJYB 1OQRA 1X1MA 1HTOA 4K7UA 1P7EA 3AE6B 1LFDA 1V8CA 3ZUNA 2O6VD 1YN5A 3NUHB 3AE1B 1IP9A 1WE7A 2IGHA 5DPSA 1XLPA 1TIFA 4HDQA 3Q8CA 2B76B 1I4QA 2LD9A 2C7MB 3R8BA 1EM7A 5H92C 2C9WB 4WWMA 3LYYA 3AEAB 4LK0M 4QAYA 3K9OB 1L0XB 4ARCA 3AE3B 4RGTA 5E6JA 2WXIA 2MQJA 4OZAA 4II2B 1SF0A 3MC0B 4A3OA 3I3TB 3W5UB 3IAS1 5G5HA 3BWUD 1J8CA 4LNNA 1R4MB 2QHOA 1MFWA 1C3TA 3ZTDA 4MH0E 3PLUA 1MI0A 4PYZA 2LRUA 3PRPB 1WE6A 1C1YB 2FIDA 3QC8B 2JPHA 5C3JB 1WFYA 3R66C 3WAOA 3Q6BA 1OEYA 3DBLI 1F2RC 4EZLA 2GI9A 5D3IB 4WWNA 3RN9C 1I4HA 3GB1A 4HROA 1C4AA 4K3BA 4ZOHC 3B2FA 1V6EA 1QLBB 2N9EB 1EWYC 2KJ6A 1ISNA 1E5WA 4JQWC 2WNMA 3VR9B 4EEWA 3OAWA 1TBEA 2G3QB 3TJPA 3I57A 4C00A 5CHFA 2RPVA 3DWGC 3DHGC 1DOIA 1FO4A 1I35A 1C4PA 3FILB 2VRRB 2K8CA 1VD2A 3A9KB 3NZSA 3CMMB 2Z0EB 1R4NI 2MP2A 1Y56A 4WAAA 2M19A 1L0YB 1AYFA 1WGGA 4RMAA 1UGMA 5KHQA 2PLPA 4YTNB 2BKFA 3KWLA 1D3ZA 4FHJA 3VHTC 2V3NA 4RFBA 2N9KA 5BMIA 1K53A 2LUMA 4GGQA 1RFKA 3H1UA 3HVZA 3A9JB 1BUIC 2L00B 4K7SA 3B2GA 2TSSA 4USAA 2X38A 5FR6A 2GBMA 4K1RB 3QIJA 4L1BA 2WQYB 1JALA 2PW9A 3EGRA 2CR5A 2ZW0A 1M94A 5L95C 4L23A 2QCZA 4BOZB 1WMHA 3TMPB 1FIQA 3BZDB 4MJSA 3ZRCA 1SE4A 1JRUA 4GDKA 3IFWB 2I1JA 2NR2A 1EO6A 3Q3JA 2IO2B 3VAWA 4I6LB 3SR6A 1E8WA 3KUDB 2KLCA 5BYSA 1A5RA 3ZNGC 5IN7A 2IO0B 3KVFB 1TS5A 4JWSC 4XDCA 2PMVA 4G3XB 4KGRA 1BMLC 1FXAA 2AQ3B 2LZ6A 1KTKA 4A8XC 2L32A 1TKGA 3EFUA 2DLBA 4GU2A 2JF5A 4DXGA 1L0VB 5IA7A 2M56B 3I63C 3N9YC 4XDDA 3EC8A 2BWES 2K1FA 3R7RA 1LXDA 1ZXIA 3A1QB 3L13A 1KLGD 3MHZA 5BYRA 3M63B 3DBRB 4A90A 1NBFC 1I7HA 3TIXA 1N61A 3BVGA 2FCNA 2IBIB 2Z8LA 2GBKA 1QZEA 2G45B 4W9KA 2KO3A 1B9RA 1KRHA 1HA5A 3PZ8A 2BYTA 1FRRA 1YX5B 1WH3A 2KTRA 3RPFC 3DCGA 5H8YE 1VZ8A 3AV8A 2BF8B 2J0JA 3B1LX 4MSMB 2N9XA 3AEEB 4YL8A 2MW5A 3IT4B 4REZA 3RT3B 3U4EG 3U52E 1TYGB 5D6JB 1N63A 1T3QA 2JWUA 5DCNA 1MHXA 2KFJA 3P1MA 3O13A 1I4XA 4US9A 4XE0A 3H6NA 4LNFA 2WU2B 3U8ZA 1UD7A 4NAMA 2LFIA 4OHJA 2J7QB 3T3NA 2QMTA 5EE3A 5AZGA 1WRDB 2JSVX 2G4DB 2KVZA 2W82A 1U4AA 2KWUB 2GOWA 4LLGM 2XK5B 2XN9C 4DHJB 2BPSA 2BS3B 3TSSA 1UWMA 1JROA 1GAQB 3BK1A 2J53A 2GBNA 3AECB 5E6NA 1GUAB 2WXPA 3QJZA 3NVVA 4P6VF 2CHZA 3ZYYX 3L17A 2NTTA 2OHFA 1Z2MA 2X8XX 3ZDTA 2L7RA 3Q3NC 2K0PA 2M0AA 2PTLA 4LNIA 3W5VB 1XLQA 5J17A 1HXYD 1NYQA 2J4XA 4KDLB 2QEJC 1JWUD 4KZ0A 2ZCBA 4NAWB 1GJZA 3A4SC 3TCAA 3BIID 2ZJDA 4RF0A 3MC8A 2IGGA 4LDTD 4MGYE 1PGXA 4CQNA 4R3DA 1N62A 2J42A 1SEBD 1JWMD 3ALBA 3QAQA 3U7DA 4WJNA 2VZKD 3AI5A 4NPNA 3ENEA 1TKYA 5FKAC 1YOVB 1IBXB 3AB5A 2JZZA 4KVGB 4EOYA 2K9XA 3PPAA 2HD5B 1OTRB 3GZNI 2H89B 2LGSA 2DZJA 4A55A 3UIPB 2WXOA 4I6NB 3L08A 3AXCA 1P1AA 1L6VA 5D94A 3U2SC 4FXCA 2KTFA 4P1CC 2AX5A 1LGRA 2CHWA 1T6BX 5FR3A 3DHIC 1WYGA 5HG2A 1VR9A 3Q8EA 4DXFA 3ZVVA 3QQ8B 1FEHA 2WXHA 3V61A 1SIFA 1WZ0A 1TS2A 3H7PB 3ZIMA 2ZEQA 4LTUA 1UUPA 3UINB 3Q3MC 4DXAB 3NY5A 5T8IA 2V0GA 1E8XA 4ITKA 4XC2A 1E9MA 1RLFA 1GNUA 1FRDA 2DWQA 1TKEA 1K8RB 4OZBA 1K51A 3E56A 1L2NA 1NYRA 1J0GA 1YN3A 3L10B 1CK1A 4II3B 3NRZA 4W9DA 5JH5C 4B6WA 3N1XC 1UNSA 1XLOA 1C4CA 3UIOB 2KQSA 3IVFA 3DVGY 4FA6A 1XCTL 1P3QU 4PS3A 1ZGUB 3UI3A 1G6JA 4G50A 3RNCC 3VFKA 4BKSA 3AH7A 2PKOA 5BO4B 1T0YA 2DZKA 4FN2A 2K39A 2FUHB 1QF6A 1F77A 3GOEA 1MPEA 2E6XA 4CYEA 2IPKD 3N32A 3B0AA 4A3PA 2D5GA 3SHQA 2OJWA 3BY4B 3IT6B 2HDEA 1SE2A 4TUUA 5DPRA 3KQ4A 4HDOA 4HJGE 4HPPA 1F52A
chains in the Genus database with same CATH topology
3W5UB 1VZ7A 3IAS1 1JMLA 1UGJA 5G5HA 5JXVA 3BWUD 3AE7B 1QT9A 1UWXA 5HI1A 1E0ZA 4ARIA 2PVOD 1MI0A 4YTPB 1J7AA 1KF6B 1SJHD 2BT6A 1QKZA 4WIPA 1C9FA 1C76A 1SB3C 3BYYB 1OQQA 5C3JB 3TEXA 3NS1A 5AUKA 1AN8A 2N0SB 2R61A 4N6EB 1QOBA 1NENB 1QOGA 1XXGA 1F2RC 3B9JA 4HKQA 2GI9A 5D3IB 2WP9B 4A6QA 1I4RA 1ZDVA 3AEGB 1I4HA 3GB1A 4HROA 4TSSA 1C4AA 1QILA 2IJ0A 4ZOHC 1FCLA 1E7PB 3B2FA 1QLBB 2LMCA 4L2YA 1GTHA 1ET9A 4NZLB 1EWYC 3NZ3A 2W3RA 2K3UA 3BVZA 1L5PA 3WCQA 2WNMA 3VR9B 1MHHE 1H7WA 2Y5PA 1LO5D 2RMMA 3KLSX 4KKJA 1DOXA 4D2KA 3I57A 4YSXB 2WXQA 2KWDA 2RPVA 3DWGC 1I4PA 1DOIA 1FO4A 1C4PA 3ETRA 3FILB 3H8HA 2SEBD 4P16A 1V1PA 4RGOS 3CIRB 1Y56A 4HEA1 1NVID 2M19A 1L0YB 1AYFA 4WH4A 1IGDA 2PLPA 1ENFA 4YTNB 3BYTB 3AE4B 3VRAB 4NJCA 4MACA 1XCQL 4TQ1A 1YQ4B 3KWLA 2EELA 3MP9A 4RCOA 1RM6C 2V3NA 1ZUD2 3HRDD 3KWVA 3ZJTA 4RFBA 5HFYA 1L4DB 1FNVA 2N9KA 5BMIA 3P4PB 5BMGA 3TEWA 1K53A 3VR8B 3BK2A 2JYEA 2LUMA 1RFKA 2JYTA 2CJNA 3HVZA 1WGKA 1V1OA 1GTEA 1YMHE 3PO0A 1BUIC 1PGBA 2BB6A 3B2GA 3C8YA 2JX5A 3AE5B 3W1SA 1FM0D 3TUOA 2TSSA 4USAA 2X38A 4ZRPA 4YTMB 1CQVA 3P4RB 1F0ZA 2BS4B 2J52A 1TZOA 2WXMA 4L1BA 2WQYB 1JALA 1CZPA 1SSNA 3U7ZA 5EE0A 2PW9A 3EGRA 1ROEA 1D4BA 2ZW0A 4M0WA 2Y3AA 4L23A 2WS3B 4HRSA 4GDLB 4KKIA 1FNUA 1SIJA 3GP7A 1FIQA 2CU3A 3BZDB 3AM9A 2MJEA 1N60A 1WXQA 1ZXHA 1SE4A 2G1EA 2EKIA 1K50A 1CJEA 1VLBA 2IDYA 5FK9C 2YEPB 2ICIA 2GB1A 4OZCA 3SR6A 5BYSA 1V1PB 2MJDA 2LJIA 1NI3A 3I9V1 1WSPA 4US8A 1ZDXA 2ZW1A 1YN4A 2WXLA 5LNK1 1TS5A 4JWSC 4N59A 2PMVA 4XDCA 3IXSA 4XWWA 4KGRA 1C77A 3Q8FA 1K52A 1HZ6A 1ZP0B 1VDVA 3NVYA 3SEBA 1BMLC 3R2IA 2AQ2B 4KGSA 1FXAA 2AQ3B 1Q10A 1KTKA 4A8XC 4B0EA 2ACZB 2L32A 1AWDA 5D7GA 4MH8A 1TKGA 1F2RI 2DLBA 4DXGA 4GLSC 1L0VB 1QOAA 2M56B 2QJLA 3N9YC 1TS3A 4XDDA 1D5MC 1ZXIA 2ON8A 3T3OA 4N58A 1DGJA 2MJ3A 3AEFB 1KLGD 4EE2A 1E6EB 3EA6A 3ZQ4A 1JWAD 2WXFA 2HTME 1V97A 3MHZA 1N5XA 3P4SB 5BYRA 1N5WA 5D3DA 1FMAD 4A90A 2BTEA 1P7FA 2AQ1B 1D6EC 1I7HA 1A70A 1T5XD 4OW0A 1GB4A 1N61A 3BVGA 3DWMA 2Z8LA 4A9AA 3P4QB 3SFDB 4YSZB 2QILA 3TEYA 2BBCA 2SAKA 4WAFA 1ET6A 1B9RA 1KRHA 1HA5A 1XF5L 1JW9D 3PZ8A 2BYTA 1FRRA 1FNWA 4GDKB 1C78A 2WDVB 1I4GA 1HQRD 3RPFC 1XLNA 2K22A 4RNAA 2YEPF 3MFGA 4KX6B 3Q8AA 5H8YE 4O1NA 1PGAA 5C2TB 4WURA 3AEBB 1B1ZA 1JCKB 1VZ8A 2K5PA 3GS2A 3AV8A 2MH7A 1PYWD 2RDHA 5BMHA 1FXIA 1TY2A 1VZ6A 3AEEB 1D5ZC 1ZE3D 3IT4B 4HKZE 4REZA 2N7JA 2PIAA 3U4EG 3U52E 1TYGB 4ZHOA 5GXGB 1N63A 2DBYA 2Q5WD 2V3PA 2XNAC 3VQIA 1T3QA 2BS2B 2WDQB 2JWUA 1XEEA 2N9LA 4J3OD 4RGNA 3Q69A 4Q2JA 1GB1A 1MHXA 3P1MA 3O13A 1I4XA 4US9A 4XE0A 1L6UA 2V4IB 2GRIA 3URYA 2WU2B 2G9HD 4NAMA 4YWGG 2LFIA 4OHJA 2W55A 3J9CA 2W54A 1WRIA 2QMTA 5HHDG 3T3NA 5EE3A 1DOYA 3VRBB 4IDIA 2JSVX 2L52A 1IBXA 2WDRB 2IGDA 2PVGC 2W82A 1VJKA 4PT5A 1HEZE 1D5XC 1ZPSA 4LLGM 3R2TA 1FD6A 3NVWA 2XN9C 2LEKA 2DYMA 2BS3B 3HUIA 3P63A 3TSSA 1UWMA 1QOFA 1JROA 4XWTA 1GAQB 1L4ZB 3BK1A 4YT0B 2J53A 3AECB 1NEKB 3IAM1 2WXPA 1E10A 1BXTA 3OWEB 1WWTA 2LGIA 3NVVA 4P6VF 2INNE 3ZYYX 4ZHPA 2RDGA 1ACCA 2LHEA 1J7CA 2FUG1 2NTTA 2Y5CA 2OHFA 2L1AA 3AE8B 2KAJA 2K0PA 2KQ4X 2M0AA 2PTLA 3W5VB 3E9SA 3L4PA 1FFUA 1XLQA 1HXYD 1NYQA 2J4XA 1JWBD 1C79A 2QEJC 4MT5A 5MPOA 2JU6X 2NTSA 2KMMA 1ESFA 1SJED 1PFDA 1JWUD 4NAWB 2L83A 1PDXA 4WQMA 1J7BA 4C80A 3BIID 4C56C 1QQRA 4RF0A 1SBBB 2IGGA 2I38A 4B0MA 1YQ3B 1PGXA 4CQNA 4C7ZA 2INPE 3ZGZA 4R3DA 1N62A 2J42A 1IUEA 3HVDA 4RGMA 1FFVA 1JWMD 1HZ5A 1SEBD 5AUIA 5TSSA 2BW2A 2VZKD 2W3SA 1JWSD 2VZKB 1KH0A 4UDUC 1JRPA 2WU5B 3AE9B 1TKYA 3AEDB 5FKAC 1IBXB 1RYJA 1OFFA 5EE1A 4OVZA 3AB5A 2K9XA 2FE8A 2H89B 4A55A 3SFEB 1SE3A 2KN4A 4YXDB 3FAHA 4YSYB 2WXOA 2JQRB 2BB5A 1L6VA 2ONQA 3U2SC 2H88B 4FXCA 4ZYSA 2I2YA 2AX5A 1KFYB 3CWIA 4IOIE 5G5GA 4C7YA 3BVMA 4AQ7A 3NVZA 1T6BX 5FR3A 1WYGA 5HG2A 3FC4A 1DYQA 1VR9A 3Q8EA 4RF1A 4DXFA 4RH6A 1STEA 3V3XA 4TMAB 2NMQA 3LB8C 1FEHA 2WXHA 3AMZA 2CJOA 1VRAB 2WXGA 3AE2B 3ZJVA 1EU3A 1R7SA 3RFZB 1TS2A 2WXNA 3AN1A 1M4VA 4LTUA 3LXFA 2WXJA 2OEDA 1IGCA 1UUPA 1AW7A 1YJIA 1SXTA 2DYOA 4JX1C 4MM3B 5T8IA 2V0GA 4ITKA 2LHDA 4TQ0A 1E9MA 1GPXA 4JPSA 2WXKA 1FRDA 2DWQA 1TKEA 1YJJA 4JWUC 4JE3B 5I4DA 1JQ4A 4OZBA 1ZOYB 1K51A 4DQOC 3E56A 3V05A 1NYRA 1PUTA 3MJ5A 1YN3A 1OQRA 1CK1A 1YNTE 1H7XA 1P7EA 3NRZA 2FBWB 3AE6B 1XO3A 1TJEA 2MEKA 2QIEB 3Q8BA 1UNSA 1XLOA 1V8CA 1C4CA 1TS4A 3CF4A 1YN5A 3NUHB 1EWCA 1TY0A 3AE1B 1XCTL 2IGHA 3EUB2 1XLPA 1GT8A 5EE9A 3W9CB 2KACA 3P42A 3ZJUA 3UI3A 3Q8CA 2B76B 1I4QA 4IKGA 3TEZA 3R8BA 1EM7A 2JXTA 3AH7A 2PKOA 5H92C 4WWMA 1GOZA 5BYQA 3LYYA 1FCCC 1RWSA 3AEAB 4LK0M 2JZPA 3PZ7A 2KDMA 4KGTA 3W2DA 1QF6A 1F77A 1MPEA 2E6XA 1MVKA 4H2AA 1KLUD 2IPKD 1EU4A 1L0XB 4ARCA 4AS1A 2E3TA 2D5GA 3AE3B 2WLBA 2WXRA 3IT6B 4RGTA 5E6JA 2WXIA 2HDEA 3FILA 2QSDA 4OZAA 1SE2A 4ZRQA 1SF0A 3KQ4A 3MC0B 4HJGE 3ABVB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TYG B;  2H88 B;  3W5U B;  5GXG B;  1N63 A;  2DBY A;  4FXC A;  2Q5W D;  5G5H A;  2AX5 A;  1T3Q A;  2BS2 B;  1KFY B;  2WDQ B;  3CWI A;  5G5G A;  4C7Y A;  3AE7 B;  3NVZ A;  1QT9 A;  2WS3 B;  4HRS A;  1E0Z A;  3P1M A;  1WYG A;  1SIJ A;  3FC4 A;  1FIQ A;  2PVO D;  4YTP B;  2CU3 A;  1J7A A;  3AM9 A;  2MJE A;  1KF6 B;  1L6U A;  1N60 A;  2BT6 A;  4US9 A;  1WXQ A;  2WU2 B;  2G1E A;  2EKI A;  3LB8 C;  1SB3 C;  3AMZ A;  1CJE A;  4ZHO A;  1OQQ A;  2CJO A;  2W55 A;  1VLB A;  2W54 A;  1WRI A;  1DOY A;  5EE3 A;  3AE2 B;  3VRB B;  5C3J B;  4IDI A;  2L52 A;  1R7S A;  2WDR B;  3NS1 A;  5AUK A;  2PVG C;  5EE0 A;  3AN1 A;  1VJK A;  3SR6 A;  2N0S B;  4LTU A;  3LXF A;  4N6E B;  2MJD A;  1QOB A;  3NVW A;  2LEK A;  1NEN B;  1NI3 A;  1QOG A;  4US8 A;  2BS3 B;  3HUI A;  3P63 A;  3B9J A;  1UWM A;  1YJI A;  1QOF A;  1JRO A;  4JX1 C;  1GAQ B;  4YT0 B;  2WP9 B;  4ITK A;  3AEG B;  1E9M A;  3AEC B;  4JWS C;  4N59 A;  1NEK B;  4HRO A;  1GPX A;  1FRD A;  1E10 A;  1VDV A;  4ZOH C;  1ZP0 B;  1E7P B;  2DWQ A;  3B2F A;  3NVY A;  1TKE A;  1WWT A;  3NVV A;  1YJJ A;  4JWU C;  1QLB B;  4P6V F;  3ZYY X;  1GTH A;  4ZHP A;  1FXA A;  1JQ4 A;  1ZOY B;  1EWY C;  2ACZ B;  1J7C A;  2W3R A;  1AWD A;  1L5P A;  1TKG A;  3WCQ A;  1NYR A;  1PUT A;  2OHF A;  2Y5C A;  3VR9 B;  1OQR A;  1L0V B;  1QOA A;  1H7W A;  2M56 B;  2QJL A;  1H7X A;  3NRZ A;  3AE8 B;  2KAJ A;  2FBW B;  3AE6 B;  3W5V B;  1ZXI A;  1FFU A;  3L4P A;  1XO3 A;  1DOX A;  1XLQ A;  1TJE A;  4N58 A;  1DGJ A;  2QIE B;  2MJ3 A;  4YSX B;  1XLO A;  3AEF B;  1NYQ A;  1JWB D;  1V8C A;  1E6E B;  3DWG C;  1JWA D;  3CF4 A;  1V97 A;  2HTM E;  1DOI A;  1N5X A;  3P4S B;  5MPO A;  1FO4 A;  3ETR A;  2KMM A;  3AE1 B;  1N5W A;  1PFD A;  3EUB 2;  2L83 A;  1PDX A;  1FMA D;  1GT8 A;  1J7B A;  1XLP A;  3CIR B;  4WQM A;  5EE9 A;  3W9C B;  4C80 A;  1NVI D;  2M19 A;  1AYF A;  1I7H A;  1A70 A;  2B76 B;  3BII D;  4YTN B;  1N61 A;  3AE4 B;  3DWM A;  3VRA B;  4A9A A;  1YQ4 B;  3P4Q B;  3SFD B;  4YSZ B;  3KWL A;  1YQ3 B;  3AH7 A;  4C7Z A;  2PKO A;  1RM6 C;  5H92 C;  1N62 A;  1ZUD 2;  1IUE A;  4WWM A;  3HRD D;  1FFV A;  1KRH A;  1B9R A;  5AUI A;  1JW9 D;  3P4P B;  1FRR A;  2W3S A;  3VR8 B;  1RWS A;  3AEA B;  1RFK A;  2WDV B;  2CJN A;  3HVZ A;  1QF6 A;  3RPF C;  1WGK A;  1XLN A;  1JRP A;  1GTE A;  2WU5 B;  3AE9 B;  1TKY A;  3AED B;  2K22 A;  3PO0 A;  4KX6 B;  1RYJ A;  1OFF A;  3B2G A;  2JX5 A;  5EE1 A;  5H8Y E;  3AB5 A;  3AE5 B;  5C2T B;  1FM0 D;  3AEB B;  2K9X A;  4USA A;  2E3T A;  2K5P A;  2H89 B;  4YTM B;  3AV8 A;  3P4R B;  3AE3 B;  3SFE B;  2WLB A;  2MH7 A;  4YXD B;  3FAH A;  1F0Z A;  1FXI A;  2BS4 B;  4YSY B;  2WQY B;  1JAL A;  3AEE B;  1CZP A;  2JQR B;  1SF0 A;  2PIA A;  1L6V A;  3ABV B;  1ROE A; 
#chains in the Genus database with same CATH topology
 3BIN A;  1JML A;  3ONS A;  3RD2 A;  2Z0D B;  3RZW C;  3AE7 B;  1UWX A;  1SE9 A;  1E0Z A;  2QC8 A;  2MSE D;  2PVO D;  2GMI C;  1KF6 B;  2BT6 A;  4WIP A;  1C76 A;  1SB3 C;  1YJ1 A;  2D3B A;  4AJW A;  1WXS A;  2WYQ A;  3D32 A;  3TEX A;  3NS1 A;  2R61 A;  1QOG A;  2NPT B;  3B9J A;  4IM0 A;  4A6Q A;  3AEG B;  1WGD A;  2D3C A;  4BKS D;  2KFK A;  4TSS A;  2IJ0 A;  1ET9 A;  3ZNH B;  1E8Z A;  3BVZ A;  1L5P A;  3WCQ A;  2JUO A;  4EUT A;  1MHH E;  1KM7 A;  1LO5 D;  3UGB B;  4KKJ A;  1DOX A;  1E7V A;  4YSX B;  5AEK B;  2WXQ A;  2MLB A;  2KC2 A;  1I4P A;  4ZRK A;  2SEB D;  1V1P A;  3CIR B;  4HEA 1;  1NVI D;  4MGK E;  4WH4 A;  4F8C B;  4S0R A;  3DBH B;  2DX5 B;  1ENF A;  2JRH A;  4K81 A;  3VRA B;  4MAC A;  1XCQ L;  1YQ4 B;  1N6Z A;  1ZUD 2;  3HRD D;  3GE3 C;  2DEN B;  3KWV A;  1L4D B;  3VXW A;  3DOW A;  3TEW A;  3VR8 B;  2JYT A;  2CJN A;  1WGK A;  1YMH E;  1PGB A;  3C8Y A;  2JX5 A;  2M4N A;  3AE5 B;  1FXT B;  3W1S A;  1TZ1 A;  3TUO A;  5LLI A;  1RRB A;  1WXM A;  3P4R B;  3SU8 X;  1F0Z A;  2J52 A;  2WXM A;  4KIK A;  1CZP A;  1R4N B;  1D4B A;  3PTF C;  4M0W A;  4N9F 4;  2CU1 A;  2CHX A;  4HRS A;  3NJT A;  4KKI A;  1ZW7 A;  3AM9 A;  1ZXH A;  2G1E A;  2L05 A;  3K9P B;  1CJE A;  4IWO A;  4KZC A;  2M17 A;  5FK9 C;  2ICI A;  2GB1 A;  5LXH A;  2KOX A;  2MJD A;  2LJI A;  4US8 A;  1ZDX A;  3B08 A;  2ZW1 A;  1TTN A;  1UF0 A;  2AL3 A;  3H7P A;  3ZKJ C;  4N59 A;  2MBB B;  1K52 A;  1ZP0 B;  3SEB A;  3R2I A;  3RCZ A;  2AQ2 B;  4KGS A;  5D2M B;  1Q10 A;  2ACZ B;  4BFR A;  5D7G A;  4FJV B;  4GLS C;  1QOA A;  1TS3 A;  1D5M C;  2BVC A;  2ON8 A;  3T3O A;  2EMS A;  4IG7 B;  4EE2 A;  3EA6 A;  1JWA D;  1V97 A;  1XT9 B;  1N5X A;  2IO1 B;  3JW0 X;  4HVB A;  2K6Q A;  2KJR A;  1P7F A;  1F1H A;  3KUZ A;  1A70 A;  4OW0 A;  3DWM A;  4URK A;  3SFD B;  3UF8 A;  3TEY A;  4BKT A;  1ET6 A;  2MBH A;  3OJ3 A;  3QCA A;  1FNW A;  1GC7 A;  1UBI A;  4JL9 A;  2MWS B;  1HE8 A;  4GSW A;  1HQR D;  3PRZ A;  2KHW B;  1MG4 A;  4ICU A;  3ZO5 B;  4AOF A;  4KX6 B;  4NJ6 A;  1WJN A;  1RFA A;  4O1N A;  4BBN C;  3AEB B;  1JCK B;  3QWZ B;  2KDI A;  3LJ3 A;  2L0F A;  2KLG A;  4ANV A;  3X23 A;  1P98 A;  3IG3 A;  5BMH A;  1FXI A;  4E74 A;  4BZA A;  1VZ6 A;  1ZE3 D;  2MBE A;  3TBL D;  2DBY A;  3EFC A;  4S17 A;  2LAS A;  2XNA C;  2KNB A;  3VQI A;  1XEE A;  2XBB C;  4NY0 A;  4ANX A;  2GRI A;  3URY A;  2FNJ B;  3PHX B;  4CHK A;  4YWG G;  3J9C A;  2W54 A;  3DDC B;  1WRI A;  5HHD G;  3VH4 B;  4IDI A;  5G2N A;  2WDR B;  4JLC A;  1V5T A;  2ZNV B;  2GBR A;  1HEZ E;  2KX3 A;  3RNA C;  2LEK A;  4WJO A;  3P63 A;  2J0M A;  1QOF A;  3KYC D;  1L4Z B;  1V81 A;  2IYD B;  4ZRI A;  1BXT A;  3N20 C;  3WIM A;  4K3C A;  2INN E;  3VTV A;  2RDG A;  1ACC A;  4LCD E;  2LHE A;  3ECI A;  2Y5C A;  1ZKH A;  3AE8 B;  2KAJ A;  5E6P A;  1EF1 A;  1WI0 A;  3E9S A;  3M95 A;  3L4P A;  4MDK E;  4TV3 A;  3PRM B;  1TT5 B;  1C79 A;  2RD0 A;  5CHW A;  5KHO A;  1WM2 A;  1UH6 A;  1J7B A;  3WAP A;  4C4V B;  2GLS A;  3DHH C;  3JVZ X;  4B0M A;  4C7Z A;  2INP E;  3W1S C;  3ZGZ A;  4I6P A;  2J0K A;  5TSS A;  5AUI A;  3DBS A;  2VH2 A;  4X57 B;  1KH0 A;  5GMV A;  4HWI B;  3AE9 B;  3RUL A;  1E90 A;  3W1Y A;  3O65 B;  1RYJ A;  4OVZ A;  3APD A;  5C1Z A;  4HCN B;  2KN4 A;  4YSY B;  1CMX B;  2JQR B;  3H9D A;  4ZRJ A;  2OOB B;  2LJ5 A;  1KFY B;  2N1V A;  4IOI E;  5G5G A;  4C7Y A;  4GN1 A;  3BVM A;  2LXC A;  4DHZ E;  3NVZ A;  2DZM A;  3FC4 A;  4BKG A;  4K7W A;  3ZTC A;  2KZR A;  4GMV A;  1V49 A;  2XEW A;  3V3X A;  4M02 A;  4AUQ C;  2NMQ A;  3LB8 C;  3AMZ A;  1KJT A;  2KX0 A;  4F1S A;  3MHS D;  1BT0 A;  3AE2 B;  3ZJV A;  1EU3 A;  1R7S A;  4PS8 A;  3LXF A;  4BOS C;  2WXJ A;  1Y8R C;  4MM3 B;  2DYO A;  5J2R A;  5DPT A;  1MJD A;  1GG3 A;  4TQ0 A;  2RDB C;  2PPH A;  4JE3 B;  2KD0 A;  1JQ4 A;  2BYF A;  4DQO C;  2KMC A;  3RI7 C;  1PUT A;  3EEC A;  1YNT E;  1H7X A;  2FBW B;  1XO3 A;  3C0R B;  3Q8B A;  4B95 A;  1TS4 A;  2O6V B;  1EWC A;  1TY0 A;  2NBW B;  3EUB 2;  2C7H A;  2MCN B;  3W9C B;  3EHV A;  5C23 A;  3ZJU A;  2HTH A;  3QK0 A;  3FKY A;  3PHW B;  3ZNZ B;  5BYQ A;  2KWV B;  1FCC C;  4DBG A;  1RWS A;  4W9G A;  2KDM A;  4KGT A;  4H2A A;  2N7D A;  3UQB A;  1KLU D;  3CF6 E;  1EU4 A;  4FJZ A;  4AS1 A;  3MTN B;  2E3T A;  3RMK C;  4KSL C;  2WLB A;  1WGR A;  2MBO A;  4HPL B;  3FIL A;  3A9K A;  4TKN A;  2ASQ A;  2RR9 A;  2A4Z A;  1VZ7 A;  2KXJ A;  3ZRF A;  4DDG D;  5JXV A;  2OJR A;  2KMA A;  3AU4 A;  1QT9 A;  5HI1 A;  4ARI A;  4OVV A;  3A4R A;  1SJH D;  4ACF A;  2VH1 A;  1YD8 U;  3BYY B;  1OQQ A;  3OJ4 B;  4LNO A;  3A9J A;  1WX7 A;  2FCQ A;  1FPY A;  5E6O A;  1AN8 A;  2N0S B;  2WX0 A;  2KDB A;  1QOB A;  1UEL A;  1NEN B;  1LM8 B;  3V6E B;  2KVR A;  4HCP B;  1I4R A;  1ZDV A;  1QIL A;  1FCL A;  1E7P B;  4LJO B;  1GC6 A;  3NZ3 A;  2WDT B;  4WJP A;  1H7W A;  2Y5P A;  2RMM A;  3KLS X;  4M00 A;  4D2K A;  2V3S A;  2KN5 A;  3OG5 A;  3H8H A;  4P16 A;  4RGO S;  2Y5B B;  3ML8 A;  4W9C A;  3AE4 B;  1V9J A;  4IC7 B;  4TQ1 A;  5EDS A;  4FLH A;  3MP9 A;  4RCO A;  1RM6 C;  4W9H A;  2A5U A;  3ZJT A;  5HFY A;  4P7I A;  3P4P B;  5BMG A;  3L0W B;  2DZI A;  1GTE A;  3PO0 A;  3CST A;  4F7Z A;  3PT2 B;  1Z5S B;  2AL6 A;  5CX3 A;  5G55 A;  1FM0 D;  3QHT A;  1YQB A;  3A1Q A;  4ZRP A;  2LVO A;  1CQV A;  2BS4 B;  1TZO A;  3CSF A;  1SSN A;  1V2Y A;  3U7Z A;  1EF5 A;  3PLV A;  4FUL A;  3PGE A;  4J6I A;  1V80 A;  1SIJ A;  2CU3 A;  1WJU A;  4MEL A;  4IM2 A;  1WXQ A;  1K50 A;  2JRI B;  1OQY A;  1IYF A;  2JWZ A;  2N1W A;  2IDY A;  4OZC A;  2AWT A;  2MP2 B;  4BBN F;  2RPQ A;  1NI3 A;  1YN4 A;  3VUX A;  3APF A;  4XWW A;  3IXS A;  3A33 B;  2BWF A;  1C77 A;  1WR6 E;  1VDV A;  1HZ6 A;  3HIZ A;  3NVY A;  3OLM D;  2IY0 B;  4B0E A;  2UYZ B;  1E7U A;  2UWQ A;  3AUL A;  4ANU A;  2G4S A;  2QJL A;  4XGA B;  3ZNI D;  2R2Q A;  4N58 A;  1DGJ A;  2MJ3 A;  2BKR B;  4IWP A;  2HTM E;  2DAF A;  3V60 A;  5D3D A;  2M1M A;  4EKU A;  2XK5 A;  1D6E C;  4NQL B;  1GB4 A;  4W9I A;  1HTQ A;  1RAX A;  1WMH B;  2SAK A;  4WAF A;  3ZW3 A;  4GOC A;  1JW9 D;  4MJS B;  4HLE A;  4GDK B;  1C78 A;  3U30 A;  1I4G A;  1XLN A;  2K22 A;  1H4R A;  4RNA A;  2YEP F;  4BVU C;  3MFG A;  3Q8A A;  3DBL B;  2LWP A;  5C2T B;  2NS5 A;  3PS6 A;  1B1Z A;  2DNF A;  2PE6 B;  4WUR A;  2K5P A;  3GS2 A;  2KK8 A;  2RDH A;  1TY2 A;  4HKZ E;  4NAW A;  4EFO A;  4ZHO A;  4IWQ A;  4M8M A;  1SGH A;  2BS2 B;  2WDQ B;  4J3O D;  4RGN A;  4WJQ A;  3Q69 A;  4Q2J A;  1GB1 A;  3VTW A;  2MRP A;  1S3S G;  1WY8 A;  5JZE B;  1WGH A;  4A20 A;  2W9N A;  3ZDM C;  3DQV A;  2WGS A;  2W55 A;  1S1Q B;  3LDZ E;  4LNK A;  2HJ8 A;  1OGW A;  3NOB A;  1IBX A;  2PVG C;  3JSV B;  4DHJ D;  3NVW A;  3P2B A;  3MC9 A;  3X0W A;  4BAX A;  3PSE B;  3DPD A;  4YT0 B;  4NQK E;  3IAM 1;  3APC A;  2LGI A;  2KDF B;  2MA9 B;  4ZHP A;  4ZDV A;  2KTR B;  4HXD A;  2L1A A;  1KOT A;  4IW0 A;  3VUW A;  4KSK C;  2MBQ A;  2K8B A;  2KDE B;  3T8M A;  1JWB D;  3N30 A;  2O2V B;  2LRW A;  4MT5 A;  2LVP A;  2JU6 X;  2NTS A;  3UQA A;  2LUE A;  2IND C;  2L83 A;  5AZF A;  4C80 A;  4FJY A;  4FAD A;  1QQR A;  4ZYN A;  2L8J A;  2I38 A;  4LDT B;  1WJ4 A;  1YQ3 B;  2ZVO A;  2M0X A;  1WX9 A;  4AWJ A;  4RGM A;  3HVD A;  3KUC B;  1FFV A;  4KDI C;  2BYE A;  2VZK B;  1JRP A;  1OFF A;  5EE1 A;  4HJK A;  1H8C A;  2FE8 A;  2PJH A;  3SFE B;  1SE3 A;  2V9H A;  1WGY A;  3Q3O C;  2ONQ A;  2C7N B;  4ZYS A;  2I2Y A;  3JYU A;  2NBV B;  3CWI A;  3RNF C;  3DBH I;  4AQ7 A;  2BQQ A;  5CTR C;  3IBE A;  3S2A A;  1UBQ A;  1DYQ A;  2C5L C;  4RH6 A;  2JY6 A;  5AZH A;  5J18 A;  4PYU A;  1VRA B;  2WXG A;  3V62 A;  5IOI A;  1WR1 A;  2ZVN A;  3RFZ B;  3M62 B;  3N1Z C;  2AYO B;  3PZD A;  1IGC A;  2FCS A;  1YJI A;  1SXT A;  4JX1 C;  4E3C A;  1GPX A;  4JPS A;  2WXK A;  1YJJ A;  3NHE B;  3DVN U;  2WWZ A;  4WWO A;  1TJE A;  2MEK A;  2QIE B;  1XD3 B;  3CF4 A;  3VVW B;  3C19 A;  2NVU I;  1OEY J;  2EKE C;  1GT8 A;  5EE9 A;  2QDF A;  2KAC A;  3P42 A;  2NPT A;  4IKG A;  1MG8 A;  1IPG A;  1WM3 A;  3TEZ A;  2D10 A;  2L76 A;  1R4M I;  2DHZ A;  2JXT A;  3RNE C;  3R7Q A;  2L3Z A;  4CO7 A;  1GOZ A;  1V86 A;  1WXA A;  2MHJ A;  3RYT A;  2JZP A;  3PZ7 A;  3W2D A;  2L0T A;  3VUY A;  1MVK A;  4AP4 C;  2BGF A;  3QX1 A;  2IY1 B;  5LXI B;  4MEM A;  4W9F A;  2CS4 A;  2WXR A;  4MGI E;  2INC C;  2QSD A;  2R2O A;  1T0R C;  4ZRQ A;  4DDI D;  2L52 A;  3ABV B;  2K25 A;  2FCM A;  1UGJ A;  1WIA A;  1WF9 A;  3ZXR A;  5IAA C;  2IO3 B;  4YTP B;  1J7A A;  3DVN V;  1YX6 B;  1QKZ A;  1C9F A;  3MJW A;  3NZU A;  1P0R A;  2ZPN A;  4DWF A;  5AUK A;  4RM9 A;  4HK2 A;  4N6E B;  3KW5 B;  4NNJ B;  1XXG A;  3SD5 A;  4HKQ A;  2D3A A;  2WP9 B;  3JSV A;  3RNB C;  2JVC A;  2NBU A;  4GXB A;  4JGH B;  2LMC A;  4L2Y A;  1GTH A;  4NZL B;  2HJ1 A;  2W3R A;  2K3U A;  4DK5 A;  4W9E A;  5JHA A;  3HHM A;  3GZN B;  4HPM B;  2YVC A;  2KWD A;  2FAZ A;  3ETR A;  4M8N A;  5TR5 A;  2DYB A;  3M3J A;  1NI2 A;  2O2V A;  4ASW C;  1IGD A;  3NG0 A;  3BYT B;  2D3G A;  4NJC A;  3QA8 A;  2EEL A;  2KKC A;  2ZPY A;  4G0N B;  4PK1 A;  2LI5 A;  1FNV A;  2LVQ A;  3BK2 A;  2JYE A;  3V6C B;  4KV2 A;  1V1O A;  2D2Q A;  2BB6 A;  1WYW B;  4OVU A;  4XZ4 A;  1WJ6 A;  2MX2 A;  4YTM B;  5HKH A;  3WAM A;  5IO9 A;  3KH0 A;  3R3M A;  3PVL A;  1T0S C;  2IZV B;  5EE0 A;  2KFK B;  1ROE A;  3IHP C;  1P9D U;  2Y3A A;  2WS3 B;  2PE9 A;  4MSQ B;  4GDL B;  1FNU A;  3GP7 A;  2MJE A;  1N60 A;  2PEA A;  2EKI A;  3TL5 A;  1VCB A;  1VLB A;  3QAR A;  4WWP A;  4ANW A;  2YEP B;  4LJP B;  1NDD A;  1V1P B;  3DBR I;  2ZCC A;  3I9V 1;  1WSP A;  2WXL A;  5LNK 1;  3DVG X;  1V5O A;  3I5J C;  1TGZ B;  3Q8F A;  2KC1 A;  3WAN A;  4G11 A;  1AWD A;  4MH8 A;  1F2R I;  4EZK A;  2KQ7 A;  2LGD A;  2JT4 B;  2YLM A;  4GB9 A;  2ZZP B;  3AEF B;  2LGX A;  1E6E B;  3ZQ4 A;  2WXF A;  2AEH A;  3P4S B;  4WQO B;  1N5W A;  2WX1 A;  4KIK B;  1FMA D;  3HM6 X;  4DHZ B;  2BTE A;  2AQ1 B;  4M0W B;  1T5X D;  3NS8 A;  3Q3F A;  2BYV E;  2V4L A;  4M01 A;  4A9A A;  3P4Q B;  4YSZ B;  2QIL A;  5JHB A;  2BBC A;  1XF5 L;  2EMT A;  3WA0 A;  2WDV B;  3SDL C;  1E8Y A;  2N4F A;  4W9J A;  1KLV A;  1PGA A;  2RSU A;  3WAL A;  4B9K A;  1AAR A;  2M8S A;  2MH7 A;  1PYW D;  4MGZ E;  1D5Z C;  3ZXV A;  2N7J A;  2PIA A;  5GXG B;  4C4V A;  2Q5W D;  2V3P A;  2N9L A;  4IM3 A;  5L83 A;  2KT7 A;  3PV1 A;  3Q2A C;  1L6U A;  2V4I B;  2N7E A;  2G9H D;  1L7Y A;  2WHI A;  1WX8 A;  3T9L A;  1DOY A;  2B3A A;  3VRB B;  2IGD A;  1VJK A;  4PT5 A;  3VH3 B;  1D5X C;  1ZPS A;  3R2T A;  1FD6 A;  2DYM A;  1Q0W B;  3HUI A;  4RM8 A;  1WXV A;  4XWT A;  2KYW A;  3Q14 C;  2JZ3 B;  1YIW A;  1NEK B;  2FIF A;  1E10 A;  3KYD D;  2V1Y A;  3OWE B;  2LGY A;  1WWT A;  3H7S A;  4NJ7 A;  1I42 A;  2I1K A;  1J7C A;  2FUG 1;  3RUI B;  1Q1O A;  2KQ4 X;  3L54 A;  1FFU A;  1J19 A;  2Z59 B;  5MPO A;  2KMM A;  1ESF A;  1SJE D;  3VTU A;  1PFD A;  1PDX A;  4WQM A;  2KAN A;  4FHK A;  2GBJ A;  3HM3 A;  4EZJ A;  3AU5 A;  4MM3 A;  3RNG C;  4C56 C;  3VDZ A;  1SBB B;  2DAJ A;  2JXX A;  4PS7 A;  3PRE A;  1PQS A;  3RZF A;  1IUE A;  1HZ5 A;  4P1B C;  2BW2 A;  2W3S A;  4W9L A;  1JWS D;  3GE8 C;  4UDU C;  2WU5 B;  3AED B;  2K8H A;  3HK0 A;  2D11 A;  2KJH B;  4YXD B;  3FAH A;  2D07 B;  3ML9 A;  2O6V A;  4ICV A;  5IKC M;  2BB5 A;  5DPW A;  2H88 B;  1Q5W B;  3ZLZ A;  5IP4 D;  1LQB A;  4XYC A;  1EUV B;  4RF1 A;  1STE A;  2KWC A;  4TMA B;  2CJO A;  4GDL A;  4GIV A;  3N1Y C;  4FBJ B;  1UZX B;  2WXN A;  3AN1 A;  1M4V A;  1T0Q C;  4JIO U;  2CKH B;  2NCN A;  4IUM B;  2OED A;  2REX A;  2N9P C;  2LXA A;  1XQQ A;  1AW7 A;  2HE7 A;  4E71 A;  2UU7 A;  2LHD A;  3N3K B;  2K6D B;  2RGF A;  1F9J A;  1WZ3 A;  3L16 A;  4XX5 A;  4JWU C;  5I4D A;  2C60 A;  1ZOY B;  5CHV C;  3V05 A;  2ZNV C;  3MJ5 A;  4AJY B;  1OQR A;  1X1M A;  1HTO A;  4K7U A;  1P7E A;  3AE6 B;  1LFD A;  1V8C A;  3ZUN A;  2O6V D;  1YN5 A;  3NUH B;  3AE1 B;  1IP9 A;  1WE7 A;  2IGH A;  5DPS A;  1XLP A;  1TIF A;  4HDQ A;  3Q8C A;  2B76 B;  1I4Q A;  2LD9 A;  2C7M B;  3R8B A;  1EM7 A;  5H92 C;  2C9W B;  4WWM A;  3LYY A;  3AEA B;  4LK0 M;  4QAY A;  3K9O B;  1L0X B;  4ARC A;  3AE3 B;  4RGT A;  5E6J A;  2WXI A;  2MQJ A;  4OZA A;  4II2 B;  1SF0 A;  3MC0 B;  4A3O A;  3I3T B;  3W5U B;  3IAS 1;  5G5H A;  3BWU D;  1J8C A;  4LNN A;  1R4M B;  2QHO A;  1MFW A;  1C3T A;  3ZTD A;  4MH0 E;  3PLU A;  1MI0 A;  4PYZ A;  2LRU A;  3PRP B;  1WE6 A;  1C1Y B;  2FID A;  3QC8 B;  2JPH A;  5C3J B;  1WFY A;  3R66 C;  3WAO A;  3Q6B A;  1OEY A;  3DBL I;  1F2R C;  4EZL A;  2GI9 A;  5D3I B;  4WWN A;  3RN9 C;  1I4H A;  3GB1 A;  4HRO A;  1C4A A;  4K3B A;  4ZOH C;  3B2F A;  1V6E A;  1QLB B;  2N9E B;  1EWY C;  2KJ6 A;  1ISN A;  1E5W A;  4JQW C;  2WNM A;  3VR9 B;  4EEW A;  3OAW A;  1TBE A;  2G3Q B;  3TJP A;  3I57 A;  4C00 A;  5CHF A;  2RPV A;  3DWG C;  3DHG C;  1DOI A;  1FO4 A;  1I35 A;  1C4P A;  3FIL B;  2VRR B;  2K8C A;  1VD2 A;  3A9K B;  3NZS A;  3CMM B;  2Z0E B;  1R4N I;  2MP2 A;  1Y56 A;  4WAA A;  2M19 A;  1L0Y B;  1AYF A;  1WGG A;  4RMA A;  1UGM A;  5KHQ A;  2PLP A;  4YTN B;  2BKF A;  3KWL A;  1D3Z A;  4FHJ A;  3VHT C;  2V3N A;  4RFB A;  2N9K A;  5BMI A;  1K53 A;  2LUM A;  4GGQ A;  1RFK A;  3H1U A;  3HVZ A;  3A9J B;  1BUI C;  2L00 B;  4K7S A;  3B2G A;  2TSS A;  4USA A;  2X38 A;  5FR6 A;  2GBM A;  4K1R B;  3QIJ A;  4L1B A;  2WQY B;  1JAL A;  2PW9 A;  3EGR A;  2CR5 A;  2ZW0 A;  1M94 A;  5L95 C;  4L23 A;  2QCZ A;  4BOZ B;  1WMH A;  3TMP B;  1FIQ A;  3BZD B;  4MJS A;  3ZRC A;  1SE4 A;  1JRU A;  4GDK A;  3IFW B;  2I1J A;  2NR2 A;  1EO6 A;  3Q3J A;  2IO2 B;  3VAW A;  4I6L B;  3SR6 A;  1E8W A;  3KUD B;  2KLC A;  5BYS A;  1A5R A;  3ZNG C;  5IN7 A;  2IO0 B;  3KVF B;  1TS5 A;  4JWS C;  4XDC A;  2PMV A;  4G3X B;  4KGR A;  1BML C;  1FXA A;  2AQ3 B;  2LZ6 A;  1KTK A;  4A8X C;  2L32 A;  1TKG A;  3EFU A;  2DLB A;  4GU2 A;  2JF5 A;  4DXG A;  1L0V B;  5IA7 A;  2M56 B;  3I63 C;  3N9Y C;  4XDD A;  3EC8 A;  2BWE S;  2K1F A;  3R7R A;  1LXD A;  1ZXI A;  3A1Q B;  3L13 A;  1KLG D;  3MHZ A;  5BYR A;  3M63 B;  3DBR B;  4A90 A;  1NBF C;  1I7H A;  3TIX A;  1N61 A;  3BVG A;  2FCN A;  2IBI B;  2Z8L A;  2GBK A;  1QZE A;  2G45 B;  4W9K A;  2KO3 A;  1B9R A;  1KRH A;  1HA5 A;  3PZ8 A;  2BYT A;  1FRR A;  1YX5 B;  1WH3 A;  2KTR A;  3RPF C;  3DCG A;  5H8Y E;  1VZ8 A;  3AV8 A;  2BF8 B;  2J0J A;  3B1L X;  4MSM B;  2N9X A;  3AEE B;  4YL8 A;  2MW5 A;  3IT4 B;  4REZ A;  3RT3 B;  3U4E G;  3U52 E;  1TYG B;  5D6J B;  1N63 A;  1T3Q A;  2JWU A;  5DCN A;  1MHX A;  2KFJ A;  3P1M A;  3O13 A;  1I4X A;  4US9 A;  4XE0 A;  3H6N A;  4LNF A;  2WU2 B;  3U8Z A;  1UD7 A;  4NAM A;  2LFI A;  4OHJ A;  2J7Q B;  3T3N A;  2QMT A;  5EE3 A;  5AZG A;  1WRD B;  2JSV X;  2G4D B;  2KVZ A;  2W82 A;  1U4A A;  2KWU B;  2GOW A;  4LLG M;  2XK5 B;  2XN9 C;  4DHJ B;  2BPS A;  2BS3 B;  3TSS A;  1UWM A;  1JRO A;  1GAQ B;  3BK1 A;  2J53 A;  2GBN A;  3AEC B;  5E6N A;  1GUA B;  2WXP A;  3QJZ A;  3NVV A;  4P6V F;  2CHZ A;  3ZYY X;  3L17 A;  2NTT A;  2OHF A;  1Z2M A;  2X8X X;  3ZDT A;  2L7R A;  3Q3N C;  2K0P A;  2M0A A;  2PTL A;  4LNI A;  3W5V B;  1XLQ A;  5J17 A;  1HXY D;  1NYQ A;  2J4X A;  4KDL B;  2QEJ C;  1JWU D;  4KZ0 A;  2ZCB A;  4NAW B;  1GJZ A;  3A4S C;  3TCA A;  3BII D;  2ZJD A;  4RF0 A;  3MC8 A;  2IGG A;  4LDT D;  4MGY E;  1PGX A;  4CQN A;  4R3D A;  1N62 A;  2J42 A;  1SEB D;  1JWM D;  3ALB A;  3QAQ A;  3U7D A;  4WJN A;  2VZK D;  3AI5 A;  4NPN A;  3ENE A;  1TKY A;  5FKA C;  1YOV B;  1IBX B;  3AB5 A;  2JZZ A;  4KVG B;  4EOY A;  2K9X A;  3PPA A;  2HD5 B;  1OTR B;  3GZN I;  2H89 B;  2LGS A;  2DZJ A;  4A55 A;  3UIP B;  2WXO A;  4I6N B;  3L08 A;  3AXC A;  1P1A A;  1L6V A;  5D94 A;  3U2S C;  4FXC A;  2KTF A;  4P1C C;  2AX5 A;  1LGR A;  2CHW A;  1T6B X;  5FR3 A;  3DHI C;  1WYG A;  5HG2 A;  1VR9 A;  3Q8E A;  4DXF A;  3ZVV A;  3QQ8 B;  1FEH A;  2WXH A;  3V61 A;  1SIF A;  1WZ0 A;  1TS2 A;  3H7P B;  3ZIM A;  2ZEQ A;  4LTU A;  1UUP A;  3UIN B;  3Q3M C;  4DXA B;  3NY5 A;  5T8I A;  2V0G A;  1E8X A;  4ITK A;  4XC2 A;  1E9M A;  1RLF A;  1GNU A;  1FRD A;  2DWQ A;  1TKE A;  1K8R B;  4OZB A;  1K51 A;  3E56 A;  1L2N A;  1NYR A;  1J0G A;  1YN3 A;  3L10 B;  1CK1 A;  4II3 B;  3NRZ A;  4W9D A;  5JH5 C;  4B6W A;  3N1X C;  1UNS A;  1XLO A;  1C4C A;  3UIO B;  2KQS A;  3IVF A;  3DVG Y;  4FA6 A;  1XCT L;  1P3Q U;  4PS3 A;  1ZGU B;  3UI3 A;  1G6J A;  4G50 A;  3RNC C;  3VFK A;  4BKS A;  3AH7 A;  2PKO A;  5BO4 B;  1T0Y A;  2DZK A;  4FN2 A;  2K39 A;  2FUH B;  1QF6 A;  1F77 A;  3GOE A;  1MPE A;  2E6X A;  4CYE A;  2IPK D;  3N32 A;  3B0A A;  4A3P A;  2D5G A;  3SHQ A;  2OJW A;  3BY4 B;  3IT6 B;  2HDE A;  1SE2 A;  4TUU A;  5DPR A;  3KQ4 A;  4HDO A;  4HJG E;  4HPP A;  1F52 A; 
#chains in the Genus database with same CATH homology
 3W5U B;  1VZ7 A;  3IAS 1;  1JML A;  1UGJ A;  5G5H A;  5JXV A;  3BWU D;  3AE7 B;  1QT9 A;  1UWX A;  5HI1 A;  1E0Z A;  4ARI A;  2PVO D;  1MI0 A;  4YTP B;  1J7A A;  1KF6 B;  1SJH D;  2BT6 A;  1QKZ A;  4WIP A;  1C9F A;  1C76 A;  1SB3 C;  3BYY B;  1OQQ A;  5C3J B;  3TEX A;  3NS1 A;  5AUK A;  1AN8 A;  2N0S B;  2R61 A;  4N6E B;  1QOB A;  1NEN B;  1QOG A;  1XXG A;  1F2R C;  3B9J A;  4HKQ A;  2GI9 A;  5D3I B;  2WP9 B;  4A6Q A;  1I4R A;  1ZDV A;  3AEG B;  1I4H A;  3GB1 A;  4HRO A;  4TSS A;  1C4A A;  1QIL A;  2IJ0 A;  4ZOH C;  1FCL A;  1E7P B;  3B2F A;  1QLB B;  2LMC A;  4L2Y A;  1GTH A;  1ET9 A;  4NZL B;  1EWY C;  3NZ3 A;  2W3R A;  2K3U A;  3BVZ A;  1L5P A;  3WCQ A;  2WNM A;  3VR9 B;  1MHH E;  1H7W A;  2Y5P A;  1LO5 D;  2RMM A;  3KLS X;  4KKJ A;  1DOX A;  4D2K A;  3I57 A;  4YSX B;  2WXQ A;  2KWD A;  2RPV A;  3DWG C;  1I4P A;  1DOI A;  1FO4 A;  1C4P A;  3ETR A;  3FIL B;  3H8H A;  2SEB D;  4P16 A;  1V1P A;  4RGO S;  3CIR B;  1Y56 A;  4HEA 1;  1NVI D;  2M19 A;  1L0Y B;  1AYF A;  4WH4 A;  1IGD A;  2PLP A;  1ENF A;  4YTN B;  3BYT B;  3AE4 B;  3VRA B;  4NJC A;  4MAC A;  1XCQ L;  4TQ1 A;  1YQ4 B;  3KWL A;  2EEL A;  3MP9 A;  4RCO A;  1RM6 C;  2V3N A;  1ZUD 2;  3HRD D;  3KWV A;  3ZJT A;  4RFB A;  5HFY A;  1L4D B;  1FNV A;  2N9K A;  5BMI A;  3P4P B;  5BMG A;  3TEW A;  1K53 A;  3VR8 B;  3BK2 A;  2JYE A;  2LUM A;  1RFK A;  2JYT A;  2CJN A;  3HVZ A;  1WGK A;  1V1O A;  1GTE A;  1YMH E;  3PO0 A;  1BUI C;  1PGB A;  2BB6 A;  3B2G A;  3C8Y A;  2JX5 A;  3AE5 B;  3W1S A;  1FM0 D;  3TUO A;  2TSS A;  4USA A;  2X38 A;  4ZRP A;  4YTM B;  1CQV A;  3P4R B;  1F0Z A;  2BS4 B;  2J52 A;  1TZO A;  2WXM A;  4L1B A;  2WQY B;  1JAL A;  1CZP A;  1SSN A;  3U7Z A;  5EE0 A;  2PW9 A;  3EGR A;  1ROE A;  1D4B A;  2ZW0 A;  4M0W A;  2Y3A A;  4L23 A;  2WS3 B;  4HRS A;  4GDL B;  4KKI A;  1FNU A;  1SIJ A;  3GP7 A;  1FIQ A;  2CU3 A;  3BZD B;  3AM9 A;  2MJE A;  1N60 A;  1WXQ A;  1ZXH A;  1SE4 A;  2G1E A;  2EKI A;  1K50 A;  1CJE A;  1VLB A;  2IDY A;  5FK9 C;  2YEP B;  2ICI A;  2GB1 A;  4OZC A;  3SR6 A;  5BYS A;  1V1P B;  2MJD A;  2LJI A;  1NI3 A;  3I9V 1;  1WSP A;  4US8 A;  1ZDX A;  2ZW1 A;  1YN4 A;  2WXL A;  5LNK 1;  1TS5 A;  4JWS C;  4N59 A;  2PMV A;  4XDC A;  3IXS A;  4XWW A;  4KGR A;  1C77 A;  3Q8F A;  1K52 A;  1HZ6 A;  1ZP0 B;  1VDV A;  3NVY A;  3SEB A;  1BML C;  3R2I A;  2AQ2 B;  4KGS A;  1FXA A;  2AQ3 B;  1Q10 A;  1KTK A;  4A8X C;  4B0E A;  2ACZ B;  2L32 A;  1AWD A;  5D7G A;  4MH8 A;  1TKG A;  1F2R I;  2DLB A;  4DXG A;  4GLS C;  1L0V B;  1QOA A;  2M56 B;  2QJL A;  3N9Y C;  1TS3 A;  4XDD A;  1D5M C;  1ZXI A;  2ON8 A;  3T3O A;  4N58 A;  1DGJ A;  2MJ3 A;  3AEF B;  1KLG D;  4EE2 A;  1E6E B;  3EA6 A;  3ZQ4 A;  1JWA D;  2WXF A;  2HTM E;  1V97 A;  3MHZ A;  1N5X A;  3P4S B;  5BYR A;  1N5W A;  5D3D A;  1FMA D;  4A90 A;  2BTE A;  1P7F A;  2AQ1 B;  1D6E C;  1I7H A;  1A70 A;  1T5X D;  4OW0 A;  1GB4 A;  1N61 A;  3BVG A;  3DWM A;  2Z8L A;  4A9A A;  3P4Q B;  3SFD B;  4YSZ B;  2QIL A;  3TEY A;  2BBC A;  2SAK A;  4WAF A;  1ET6 A;  1B9R A;  1KRH A;  1HA5 A;  1XF5 L;  1JW9 D;  3PZ8 A;  2BYT A;  1FRR A;  1FNW A;  4GDK B;  1C78 A;  2WDV B;  1I4G A;  1HQR D;  3RPF C;  1XLN A;  2K22 A;  4RNA A;  2YEP F;  3MFG A;  4KX6 B;  3Q8A A;  5H8Y E;  4O1N A;  1PGA A;  5C2T B;  4WUR A;  3AEB B;  1B1Z A;  1JCK B;  1VZ8 A;  2K5P A;  3GS2 A;  3AV8 A;  2MH7 A;  1PYW D;  2RDH A;  5BMH A;  1FXI A;  1TY2 A;  1VZ6 A;  3AEE B;  1D5Z C;  1ZE3 D;  3IT4 B;  4HKZ E;  4REZ A;  2N7J A;  2PIA A;  3U4E G;  3U52 E;  1TYG B;  4ZHO A;  5GXG B;  1N63 A;  2DBY A;  2Q5W D;  2V3P A;  2XNA C;  3VQI A;  1T3Q A;  2BS2 B;  2WDQ B;  2JWU A;  1XEE A;  2N9L A;  4J3O D;  4RGN A;  3Q69 A;  4Q2J A;  1GB1 A;  1MHX A;  3P1M A;  3O13 A;  1I4X A;  4US9 A;  4XE0 A;  1L6U A;  2V4I B;  2GRI A;  3URY A;  2WU2 B;  2G9H D;  4NAM A;  4YWG G;  2LFI A;  4OHJ A;  2W55 A;  3J9C A;  2W54 A;  1WRI A;  2QMT A;  5HHD G;  3T3N A;  5EE3 A;  1DOY A;  3VRB B;  4IDI A;  2JSV X;  2L52 A;  1IBX A;  2WDR B;  2IGD A;  2PVG C;  2W82 A;  1VJK A;  4PT5 A;  1HEZ E;  1D5X C;  1ZPS A;  4LLG M;  3R2T A;  1FD6 A;  3NVW A;  2XN9 C;  2LEK A;  2DYM A;  2BS3 B;  3HUI A;  3P63 A;  3TSS A;  1UWM A;  1QOF A;  1JRO A;  4XWT A;  1GAQ B;  1L4Z B;  3BK1 A;  4YT0 B;  2J53 A;  3AEC B;  1NEK B;  3IAM 1;  2WXP A;  1E10 A;  1BXT A;  3OWE B;  1WWT A;  2LGI A;  3NVV A;  4P6V F;  2INN E;  3ZYY X;  4ZHP A;  2RDG A;  1ACC A;  2LHE A;  1J7C A;  2FUG 1;  2NTT A;  2Y5C A;  2OHF A;  2L1A A;  3AE8 B;  2KAJ A;  2K0P A;  2KQ4 X;  2M0A A;  2PTL A;  3W5V B;  3E9S A;  3L4P A;  1FFU A;  1XLQ A;  1HXY D;  1NYQ A;  2J4X A;  1JWB D;  1C79 A;  2QEJ C;  4MT5 A;  5MPO A;  2JU6 X;  2NTS A;  2KMM A;  1ESF A;  1SJE D;  1PFD A;  1JWU D;  4NAW B;  2L83 A;  1PDX A;  4WQM A;  1J7B A;  4C80 A;  3BII D;  4C56 C;  1QQR A;  4RF0 A;  1SBB B;  2IGG A;  2I38 A;  4B0M A;  1YQ3 B;  1PGX A;  4CQN A;  4C7Z A;  2INP E;  3ZGZ A;  4R3D A;  1N62 A;  2J42 A;  1IUE A;  3HVD A;  4RGM A;  1FFV A;  1JWM D;  1HZ5 A;  1SEB D;  5AUI A;  5TSS A;  2BW2 A;  2VZK D;  2W3S A;  1JWS D;  2VZK B;  1KH0 A;  4UDU C;  1JRP A;  2WU5 B;  3AE9 B;  1TKY A;  3AED B;  5FKA C;  1IBX B;  1RYJ A;  1OFF A;  5EE1 A;  4OVZ A;  3AB5 A;  2K9X A;  2FE8 A;  2H89 B;  4A55 A;  3SFE B;  1SE3 A;  2KN4 A;  4YXD B;  3FAH A;  4YSY B;  2WXO A;  2JQR B;  2BB5 A;  1L6V A;  2ONQ A;  3U2S C;  2H88 B;  4FXC A;  4ZYS A;  2I2Y A;  2AX5 A;  1KFY B;  3CWI A;  4IOI E;  5G5G A;  4C7Y A;  3BVM A;  4AQ7 A;  3NVZ A;  1T6B X;  5FR3 A;  1WYG A;  5HG2 A;  3FC4 A;  1DYQ A;  1VR9 A;  3Q8E A;  4RF1 A;  4DXF A;  4RH6 A;  1STE A;  3V3X A;  4TMA B;  2NMQ A;  3LB8 C;  1FEH A;  2WXH A;  3AMZ A;  2CJO A;  1VRA B;  2WXG A;  3AE2 B;  3ZJV A;  1EU3 A;  1R7S A;  3RFZ B;  1TS2 A;  2WXN A;  3AN1 A;  1M4V A;  4LTU A;  3LXF A;  2WXJ A;  2OED A;  1IGC A;  1UUP A;  1AW7 A;  1YJI A;  1SXT A;  2DYO A;  4JX1 C;  4MM3 B;  5T8I A;  2V0G A;  4ITK A;  2LHD A;  4TQ0 A;  1E9M A;  1GPX A;  4JPS A;  2WXK A;  1FRD A;  2DWQ A;  1TKE A;  1YJJ A;  4JWU C;  4JE3 B;  5I4D A;  1JQ4 A;  4OZB A;  1ZOY B;  1K51 A;  4DQO C;  3E56 A;  3V05 A;  1NYR A;  1PUT A;  3MJ5 A;  1YN3 A;  1OQR A;  1CK1 A;  1YNT E;  1H7X A;  1P7E A;  3NRZ A;  2FBW B;  3AE6 B;  1XO3 A;  1TJE A;  2MEK A;  2QIE B;  3Q8B A;  1UNS A;  1XLO A;  1V8C A;  1C4C A;  1TS4 A;  3CF4 A;  1YN5 A;  3NUH B;  1EWC A;  1TY0 A;  3AE1 B;  1XCT L;  2IGH A;  3EUB 2;  1XLP A;  1GT8 A;  5EE9 A;  3W9C B;  2KAC A;  3P42 A;  3ZJU A;  3UI3 A;  3Q8C A;  2B76 B;  1I4Q A;  4IKG A;  3TEZ A;  3R8B A;  1EM7 A;  2JXT A;  3AH7 A;  2PKO A;  5H92 C;  4WWM A;  1GOZ A;  5BYQ A;  3LYY A;  1FCC C;  1RWS A;  3AEA B;  4LK0 M;  2JZP A;  3PZ7 A;  2KDM A;  4KGT A;  3W2D A;  1QF6 A;  1F77 A;  1MPE A;  2E6X A;  1MVK A;  4H2A A;  1KLU D;  2IPK D;  1EU4 A;  1L0X B;  4ARC A;  4AS1 A;  2E3T A;  2D5G A;  3AE3 B;  2WLB A;  2WXR A;  3IT6 B;  4RGT A;  5E6J A;  2WXI A;  2HDE A;  3FIL A;  2QSD A;  4OZA A;  1SE2 A;  4ZRQ A;  1SF0 A;  3KQ4 A;  3MC0 B;  4HJG E;  3ABV B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...