3DBHI

Structural dissection of a gating mechanism preventing misactivation of ubiquitin by nedd8's e1 (appbp1-uba3arg190ala-nedd8ala72arg)
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
86
structure length
86
Chain Sequence
RRASVGSGGSMLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLRLRGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell cycle
molecule keywords NEDD8-activating enzyme E1 regulatory subunit
publication title Structural dissection of a gating mechanism preventing misactivation of ubiquitin by NEDD8's E1.
pubmed doi rcsb
source organism Homo sapiens
total genus 18
structure length 86
sequence length 86
chains with identical sequence J, K, L
ec nomenclature
pdb deposition date 2008-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3dbhI00
1RFAA 2KDFB 2EMSA 2N7DA 3GOEA 2ZZPB 3PRZA 4EUTA 1WY8A 2KANA 4FHKA 2FIFA 3AI5A 4KV2A 3ZDMC 3KH0A 4DHZE 1YQBA 2L0TA 3PZDA 1VCBA 2L0FA 4NPNA 3CSTA 3A4RA 3PVLA 1WX9A 4YL8A 4GMVA 3K9PB 2ZCBA 3SDLC 3WA0A 2J0KA 3PLUA 4LCDE 4J6IA 2PPHA 1UD7A 3U7DA 1V2YA 4JIOU 3C0RB 3H7SA 1P9DU 2LI5A 2R2QA 3QIJA 3KVFB 2JRIB 2V3SA 4BKTA 3H6NA 4IUMB 1I42A 3IVFA 3RCZA 3VTUA 2L00B 3DBHI 4HPLB 2JF5A 2PE9A 2GBKA 1M94A 1WE6A 2D07B 1E8XA 2DZJA 2I1JA 2K39A 2REXA 4ASWC 4AOFA 2NS5A 4B95A 3QWZB 4KIKA 4WQOB 4DK5A 3QCAA 4ANVA 3A9KB 1E8YA 2G3QB 3TBLD 2MRPA 1GC7A 3QC8B 3V6EB 4KZCA 3VVWB 1WGRA 4IM2A 4AJYB 1LQBA 2FUHB 2BYFA 2N9XA 3KUZA 5BO4B 3SHQA 3TCAA 4BKSA 2DZIA 3QAQA 1K8RB 3H1UA 1D3ZA 1OQYA 1U4AA 4RM8A 4ZYNA 2FCNA 2LGDA 2MBQA 2HJ8A 4JL9A 2J0MA 1XT9B 4FJVB 2GBMA 3ZKJC 1P98A 2G4SA 2KJ6A 3V62A 3ZVVA 3NS8A 2L3ZA 5DPSA 2CU1A 2J0JA 1UBIA 4KIKB 4GB9A 2RPQA 3DBRI 3KW5B 3JW0X 3MTNB 3R3MA 4XZ4A 1YJ1A 2KMCA 4ICVA 2K25A 2L7RA 2Z0DB 1V5TA 4FULA 5KHQA 2KKCA 2KWUB 3ZTCA 3NHEB 2DYBA 2IBIB 1YX5B 1WXVA 1EUVB 3A1QA 1R4MI 2KQSA 1X1MA 3ZNGC 1H8CA 2KFJA 2IY1B 1Y8RC 2RR9A 4F8CB 3IG3A 4IW0A 2DZKA 5LXHA 3OAWA 5C23A 2MWSB 3N32A 3HK0A 4FHJA 4KVGB 4LJOB 4ANXA 3UF8A 2N1VA 3M95A 1WIAA 2A5UA 3B1LX 3ML8A 1TZ1A 4NQKE 2KJHB 3QHTA 1GUAB 4GIVA 2KC2A 2IO3B 3H7PA 4DDGD 2N4FA 3W1YA 2JZ3B 2KDBA 3V61A 2LUEA 2LZ6A 5DCNA 2KX0A 3PPAA 4DHJB 2M8SA 2BKFA 1L2NA 3A1QB 1SGHA 4FJZA 2NPTB 2DHZA 2NBVB 1A5RA 2BF8B 2RD0A 2MP2A 2MBHA 3MHSD 5CX3A 2CKHB 5HKHA 3DDCB 3ZIMA 2L8JA 4EEWA 3PLVA 1RAXA 2L05A 1WGHA 4PS3A 4M8MA 2DX5B 1S3SG 1WFYA 4N9F4 5D94A 3L08A 4BKSD 5E6OA 3ONSA 3A9JA 5D6JB 3KUDB 4WWPA 1UBQA 4K7WA 4B6WA 1WX8A 4AJWA 3H7PB 1SIFA 3U30A 3APFA 2YVCA 5E6PA 3WAPA 3VTWA 1ZW7A 2LXAA 1WZ0A 3UQBA 4W9EA 3BY4B 1P1AA 2AYOB 4W9GA 2FCMA 1VD2A 2JPHA 3WANA 2JY6A 4DHJD 3BINA 1IP9A 4K7SA 2MP2B 2MSED 1V81A 3RT3B 4HWIB 4F7ZA 4HJKA 4JGHB 4IWOA 4LDTB 4MSQB 4WJNA 1E8ZA 4K81A 1WR1A 1FXTB 1WR6E 2KN5A 1LXDA 3L10B 4I6NB 3I3TB 3A9JB 3VFKA 3UGBB 1WMHA 3NZSA 1J0GA 2C9WB 3PRPB 2JWZA 3A33B 1NI2A 4ANWA 3WAMA 3M62B 4RMAA 4ZRKA 3VUYA 2OJRA 4W9KA 1OTRB 4GU2A 2O2VA 4MJSA 2KLCA 4KDIC 4MELA 5FR6A 1XQQA 4HCPB 5D7GA 2D10A 2JT4B 4OVUA 4HLEA 2NBUA 5AZHA 2C5LC 2LD9A 2M1MA 3R7QA 5JH5C 2M17A 3WAOA 4JQWC 3NY5A 2LVOA 2LASA 1WE7A 1P3QU 5L95C 2FCQA 3VUXA 2C60A 3EHVA 1E8WA 3TJPA 2G4DB 3PGEA 2A4ZA 2DYOA 3OJ4B 5C1ZA 3DOWA 2KDIA 3M63B 2IO0B 2J7QB 4CYEA 2K6DB 4EZJA 1YD8U 4K1RB 4TUUA 2CHZA 4PYZA 1BT0A 2K8CA 1HE8A 4LDTD 2GBRA 4IM3A 4BKGA 5JHAA 2GOWA 1Z5SB 1WMHB 3GZNI 3KUCB 1F9JA 3OLMD 3PT2B 1T0YA 2WYQA 2BPSA 4FLHA 4ICUA 3VHTC 3AU5A 2NBWB 3O65B 2ZVOA 1ISNA 2JRHA 2O2VB 4GDLA 3QJZA 4MJSB 3L0WB 1GNUA 1UGMA 2BYEA 4G0NB 4XX5A 3ZRCA 2O6VA 2DZMA 3KYDD 5IA7A 2KWVB 1EF5A 4FBJB 3P2BA 3IBEA 2KK8A 2AL6A 1YX6B 2LRWA 4NJ6A 5DPWA 4E74A 4NJ7A 2CHXA 5EDSA 5GMVA 2UYZB 3VH4B 3VTVA 1WXAA 2M0XA 2KO3A 2JXXA 1SE9A 3EECA 1Z2MA 2PEAA 3DVNV 1V5OA 4GOCA 2JUOA 4GXBA 3AU4A 5TR5A 2I1KA 2FNJB 3QX1A 4GSWA 4HDOA 3SD5A 2CHWA 1WM2A 3DVGY 2MBOA 3ECIA 1TGZB 3KYCD 5J18A 1EF1A 1EO6A 2IY0B 3VXWA 3CSFA 1WH3A 2GBJA 3ZNZB 5JHBA 3N30A 4BOZB 4GDLB 2WWZA 3HM3A 4W9DA 1C3TA 2KQ7A 4BOSC 2O6VB 3IFWB 4E3CA 4FADA 2KTFA 1WJ4A 3R66C 3B08A 3WALA 2PE6B 4DBGA 1KLVA 4WJOA 3ZLZA 1NDDA 1E7UA 3QK0A 5KHOA 3X0WA 2KVRA 1IYFA 4W9JA 4TQ0A 2LWPA 3UIPB 2KX3A 2K8BA 1UH6A 4TKNA 2NVUI 5D2MB 1Q1OA 1XD3B 5J17A 2KWCA 2YLMA 1E7VA 5L83A 1UELA 4A20A 1WGGA 2QHOA 3PSEB 3U8ZA 2Y5BB 2JZZA 2IO2B 3TIXA 4OVVA 4W9IA 4KDLB 4MSMB 2EKEC 1J19A 2BGFA 4PS7A 1WZ3A 2LVQA 1WGYA 2XEWA 3DVGX 1Q5WB 3DBLI 3N3KB 4CHKA 3AULA 2AWTA 3PS6A 3DQVA 4ZDVA 2KXJA 4I6PA 1V49A 4EFOA 2WX0A 2KOXA 3CMMB 1WJNA 2BWES 2K1FA 3ZRFA 3PRMB 4HK2A 5CHWA 1WM3A 1E90A 2LXCA 2XBBC 2ZCCA 2KZRA 4HDQA 4II3B 3LJ3A 4IWQA 4W9FA 2HE7A 5G2NA 4FA6A 2O6VD 4GDKA 5CTRC 1GG3A 2BKRB 2AL3A 4ANUA 2K8HA 1R4NI 3D32A 4HPMB 2MBBB 2ASQA 3VUWA 1J8CA 3WIMA 5AEKB 1RRBA 2K6QA 2PJHA 2MX2A 2M4NA 2N9EB 1WXMA 2WX1A 4NAWA 2MA9B 1UZXB 3A4SC 4IG7B 4MGKE 3W1SA 2KLGA 2DYMA 2V1YA 3ENEA 2KMAA 2FAZA 2MLBA 2V4LA 1TBEA 3QQ8B 2ZNVC 4X57B 5AZFA 4DWFA 5AZGA 3IHPC 1GC6A 4MM3A 4HCNB 4MGYE 4A3OA 1MG8A 1V9JA 2ZVNA 3NOBA 2D3GA 1LM8B 4NY0A 2DAFA 4WJPA 1AARA 4AUQC 4W9LA 2OOBB 4WAAA 2HD5B 3HM6X 4CO7A 2XK5A 1NBFC 2MBEA 2N9PC 1PQSA 3W1SC 2DENB 2ZPNA 3RZWC 2RGFA 1G6JA 1CMXB 1OGWA 4M8NA 4GGQA 1WJ6A 4JLCA 4GDKB 5CHFA 3UIOB 2ZNVB 3V6CB 3V60A 4BBNC 3L17A 2FCSA 2LVPA 1C1YB 4MEMA 4NNJB 3X23A 1S1QB 3S2AA 2FIDA 3TMPB 2JVCA 4WJQA 3RUIB 4IM0A 4G50A 1Q0WB 4NAWB 2KD0A 3L13A 4TV3A 3UQAA 2KTRA 3APDA 4WWOA 1WXSA 2GMIC 2W9NA 4WWNA 2ZPYA 3QARA 4G3XB 4ZRIA 3ZTDA 3ZNHB 4MDKE 2IZVB 2MQJA 3RULA 4EZKA 2R2OA 4ZRJA 2GBNA 3B0AA 3LDZE 2XK5B 2CS4A 1RLFA 3EFUA 3PREA 4PYUA 3PHWB 5JZEB 4TQ1A 2LRUA 2KDEB 2AEHA 1I35A 2MW5A 2DAJA 2EMTA 5DPRA 4DXAB 3AXCA 4XC2A 4BBNF 2KFKA 3ZDTA 3M3JA 3PHXB 2KJRA 4E71A 3JYUA 2ZEQA 3JSVA 1V6EA 1V86A 4DDID 3NZUA 2BYVE 4URKA 2D11A 3Q3JA 3MJWA 4LJPB 5IAAC 2KTRB 4RM9A 2CR5A 2LGXA 3DPDA 2RSUA 4IC7B 3L54A 1WGDA 1KJTA 4AP4C 4PS8A 3PTFC 3CF6E 1GJZA 3HHMA 1KM7A 1TTNA 4G11A 3ZO5B 3QA8A 3H9DA 3DBSA 3RD2A 2UWQA 4HVBA 4I6LB 3RYTA 4B9KA 3VAWA 4II2B 2C7MB 4FJYA 4EZLA 2NPTA 5LLIA 3ALBA 4A3PA 4GN1A 4F1SA 5LXIB 1IPGA 3PV1A 2KFKB 2BWFA 2LGYA 5G55A 5J2RA 4DHZB 3JSVB 1V80A 3RZFA 2IO1B 5E6NA 5DPTA 2KHWB 4BFRA 4EOYA 1QZEA 4IWPA 4K7UA 2ZJDA 3DCGA 5CHVC 1WYWB 3T9LA 3VH3B 1P0RA 1WI0A 2B3AA 2HTHA 1KOTA 4EKUA 2Z0EB 1L7YA 4BVUC 2LJ5A 4KZ0A 3SU8X 3R7RA 4MGZE 3DVNU 3ZNID 1ZKHA 1ZGUB 2WDTB 4P7IA 2NCNA 3VQIA 3ZW3A 4HXDA 3T8MA 2L76A 1JRUA 4W9HA 3VDZA 1WF9A 3UINB 3EC8A 3L16A 3OJ3A 2N1WA 4MGIE 2D2QA 2N7EA 1WX7A 2NR2A 3JVZX 4KSKC 1YIWA 4KSLC 2KC1A 3K9OB 1OEYJ 1WRDB 3ML9A 1WJUA 3TL5A 3ZUNA 3Q3FA 2IYDB 2KNBA 4M0WB 2VRRB 4MH0E 2Z59B 2MCNB 1OEYA 2C7NB 3APCA 1E5WA 3HIZA 1H4RA 4AWJA 2C7HA 2G45B 4FN2A 4W9CA 3A9KA 1LFDA 4NQLB
chains in the Genus database with same CATH superfamily
3PRZA 2EMSA 2ZZPB 1WY8A 4B0EA 3AI5A 3AE8B 2L0FA 1WXQA 2WXIA 4S0RA 3PVLA 3SDLC 3K9PB 3KQ4A 3U7DA 3H7SA 1DGJA 2JRIB 1NI3A 3VTUA 1SF0A 3DBHB 2GBKA 1DOXA 2AQ3B 1JWAD 3QWZB 4DK5A 3QCAA 4ANVA 2G3QB 4AJYB 1C4PA 3KUZA 2N9XA 2V9HA 5BO4B 4BKSA 1ZDXA 2BW2A 2DZIA 3P4PB 4LLGM 2FCNA 2LGDA 4JL9A 3AEBB 1XT9B 3ZKJC 1ESFA 2D3AA 3ZVVA 4KIKB 2LGSA 3KW5B 3P4SB 4ICVA 1KF6B 3NVWA 2L7RA 4NAMA 4AQ7A 3LXFA 5BYSA 1R4MI 2KQSA 2QEJC 2JWUA 2HTME 2IY1B 1Y8RC 4LNFA 2NMQA 1CZPA 2DZKA 5LXHA 1KLGD 4ANXA 3M95A 2A5UA 1TZ1A 4NQKE 2MJEA 3GE3C 2KC2A 4M01A 4J3OD 2N4FA 3W1YA 2JZ3B 3V61A 1SXTA 3HVZA 3PPAA 2BKFA 4FJZA 2NPTB 1A5RA 1NEKB 3DDCB 4JPSA 2L8JA 2L05A 1L0VB 3Q3MC 3NVZA 1WFYA 4BKSD 3L08A 5E6OA 3A9JA 4WWPA 1UBQA 4KGRA 3LB8C 3H7PB 3FILA 1TY2A 2Y5PA 2D3CA 1HQRD 5D3IB 1ZW7A 4PT5A 1E6EB 4WH4A 1FNWA 4K7SA 2WXMA 4HWIB 4IWOA 4MSQB 1IBXA 4L23A 4K81A 1QLBB 1UF0A 1FXTB 2KN5A 4D2KA 3FAHA 3VFKA 2RDHA 2RMMA 2JWZA 2WDVB 1NI2A 4ANWA 4ZOHC 3N1XC 4ZRKA 3TEWA 4MJSA 2MJ3A 4XE0A 5FR6A 4O1NA 5D7GA 2JT4B 4OVUA 1J7CA 2NBUA 5AZHA 4HLEA 3NY5A 1D5XC 3EHVA 4RH6A 5C1ZA 2K6DB 1I4RA 1MFWA 1YD8U 2N7JA 1N5XA 4K1RB 4OZBA 4JWUC 1WMHB 3KUCB 3OLMD 1T0YA 2ZVOA 4GDLA 4HPPA 3RNGC 2DZMA 3HRDD 4FBJB 3P2BA 2IGHA 3EFCA 1YX6B 1SE2A 2JXTA 4YXDB 1T0RC 2W3RA 5DPWA 4E74A 2BQQA 4H2AA 5GMVA 5H92C 2JXXA 2K3UA 1L4DB 4GXBA 2JUOA 4JE3B 2QILA 2R61A 3SD5A 1NENB 5J18A 3KYCD 1TGZB 1JCKB 2LEKA 3CSFA 3ZNZB 5JHBA 4RCOA 1JW9D 4C4VA 4W9DA 2K9XA 3R66C 3DHGC 2INPE 4DBGA 3ZLZA 1JMLA 1VJKA 3QK0A 2KX3A 2MEKA 2KN4A 2VZKB 4XYCA 3TSSA 2L1AA 3EGRA 3RI7C 2WGSA 3Q69A 4YSZB 4MSMB 1QT9A 3SFEB 2BGFA 4PS7A 1WGYA 4RF1A 4I6PA 3BVMA 4EFOA 2WX0A 3CMMB 1WJNA 4HK2A 5CHWA 2KZRA 4KKIA 4HDQA 4II3B 2BB5A 3LJ3A 4IWQA 4USAA 4FA6A 4OW0A 3W5UB 2K8HA 1R4NI 4WWMA 3VUWA 5AEKB 2JU6X 1FMAD 2MX2A 2WX1A 4IG7B 3W1SA 2V1YA 3ENEA 1STEA 4X57B 3QQ8B 2WXPA 2ZNVC 4MM3A 4MGYE 3MC9A 3NOBA 2D3GA 1C78A 3SFDB 2EELA 4ZRPA 2N9PC 2DENB 1G6JA 2RGFA 2NTSA 4JLCA 2FBWB 5CHFA 1UGJA 2BBCA 4ACFA 2TSSA 2FIDA 3TMPB 1E0ZA 5C2TB 2JX5A 1L6VA 4G50A 1Q0WB 1V1PB 3VR9B 3UQAA 3APDA 4WWOA 1WXSA 2GMIC 4ZRIA 3QARA 1WWTA 1FD6A 2I2YA 2IGGA 3RULA 3ZJTA 2Q5WD 2FE8A 2GBNA 3B0AA 2XK5B 1RLFA 2MW5A 5DPRA 3AE1B 4IOIE 1YOVB 3M3JA 4E71A 1WSPA 2D5GA 3JYUA 3JSVA 1ZP0B 1TYGB 4IC7B 3L54A 4N59A 3CF6E 3MP9A 4UDUC 5FK9C 1XO3A 1TTNA 3QA8A 5GXGB 3DBSA 2K5PA 2UWQA 3RNEC 1D4BA 3C19A 2C7MB 1I4QA 2NPTA 3ALBA 1R4MB 2QC8A 2KFKB 1AN8A 3I5JC 1C9FA 1PGXA 2BWFA 5EE9A 3AEDB 1JWMD 1ACCA 4WAFA 5E6NA 5DPTA 4BFRA 3L4PA 3DCGA 5CHVC 3T9LA 1WYGA 2B3AA 1C4AA 2JYEA 5T8IA 4B0MA 1T5XD 2V3PA 2INDC 4KZ0A 3BVGA 3HUIA 4C56C 3ZNID 4YT0B 4C7ZA 2DBYA 1TT5B 3T8MA 5H8YE 1WF9A 4YTMB 1ET6A 1FNUA 2N9KA 1V1OA 4P6VF 2D2QA 2N7EA 4KSKC 4KSLC 2KC1A 3K9OB 1OEYJ 3Q3FA 2KNBA 3TEYA 3IT4B 3APCA 3HIZA 1SBBB 4M02A 4YTNB 3P4QB 3A9KA 3GOEA 4FHKA 4KV2A 3ZDMC 2L0TA 1F0ZA 3CSTA 1WX9A 4GMVA 1TIFA 4OHJA 2OJWA 1L0YB 3I9V1 4JIOU 4KGTA 1VLBA 3C0RB 2LI5A 1FPYA 1FRRA 3QIJA 5HG2A 3W9CB 1N60A 2V3SA 4IUMB 3AM9A 1I42A 3RCZA 4ASWC 1E8XA 5G5HA 3RNBC 2REXA 4WQOB 4N58A 3Q14C 4C80A 2K22A 2X8XX 2MRPA 4IDIA 4IM2A 2FUHB 1K8RB 4LNIA 3H1UA 4RM8A 2PLPA 5I4DA 2HDEA 4RF0A 3V62A 2QDFA 3NS8A 1JROA 4LNOA 1N5WA 2RPQA 2KVZA 3DBRB 2KWUB 2IBIB 1YX5B 1EU3A 2AQ2B 1X1MA 1H8CA 3PO0A 1RFKA 2KFJA 1EM7A 2AX5A 3AH7A 2ONQA 5TSSA 2ON8A 3IG3A 2WQYB 4ZHOA 2J42A 1EWCA 4LJOB 3GS2A 2N1VA 3B1LX 2CJNA 4ZRQA 4S17A 2KJHB 1GUAB 4GIVA 2IO3B 4JX1C 3T3NA 2PMVA 2LZ6A 4ARIA 2KX0A 4ITKA 4US9A 1MG4A 2INCC 3A1QB 2NBVB 3CIRB 5HKHA 4EEWA 1P7EA 1FFUA 4M8MA 1S3SG 4ZYSA 2WXOA 2DNFA 4K7WA 4AJWA 4LNKA 2WDQB 1ZXIA 3BYTB 3RMKC 3TUOA 3U52E 3VTWA 2GRIA 3NVYA 2J53A 4A90A 1XCQL 1NYQA 4W9EA 4WIPA 3AB5A 1VD2A 4DHJD 2MP2B 2MSED 4F7ZA 5JXVA 1DOYA 1UWMA 2H89B 2MHJA 3AE7B 4HJKA 4LDTB 4WJNA 1E8ZA 1L0XB 1WR6E 2KWDA 3PZ8A 3L10B 2FUG1 1JWUD 2C9WB 3PRPB 2VH1A 3WAMA 3M62B 2OJRA 4W9KA 1OTRB 1ZPSA 2O2VA 4GU2A 3VR8B 4LTUA 2KLCA 4MELA 4NJCA 1BMLC 1SEBD 2LD9A 4ARCA 2LVOA 2LASA 1WE7A 3VUXA 3TJPA 3PGEA 1M4VA 2DYOA 2PVGC 2KDMA 1RWSA 1DOIA 4PYZA 2GBRA 2GOWA 2LMCA 3NS1A 3GZNI 2W3SA 1F9JA 3PT2B 4FLHA 4ICUA 1YJJA 2NBWB 4K3CA 2KQ4X 3QJZA 2BYEA 4G0NB 3ZRCA 3Q8FA 2JSVX 2KWVB 3R2TA 2GLSA 2LRWA 2WXHA 4XGAB 1AYFA 4XDDA 2CHXA 5EDSA 3VH4B 2M0XA 1D5ZC 3KWVA 2WXJA 1E7PB 1TS4A 3QX1A 2CHWA 3ECIA 4WQMA 4AS1A 1EF1A 1EO6A 1FCCC 3VXWA 3W2DA 4BOZB 2KQ7A 2O6VB 3IFWB 5BMHA 4BZAA 1SJED 1WJ4A 1CJEA 1T6BX 1NDDA 1E7UA 3X0WA 4TQ0A 1I7HA 4BAXA 1QF6A 3UIPB 2WXQA 3AE3B 2NVUI 5HHDG 2YLMA 1HXYD 2BT6A 1E7VA 1AW7A 1WGGA 2QHOA 3U8ZA 2JZZA 1C77A 2BS4B 1UWXA 4KDLB 3SEBA 3DVGX 1QQRA 2AWTA 3DBLB 3DQVA 4ZDVA 2PTLA 1T0QC 2BWES 3R2IA 3ZRFA 1WM3A 1E90A 3VRAB 4W9FA 4GDKA 5CTRC 2BKRB 2BS3B 4HJGE 2WLBA 2ZW0A 3NZ3A 1C79A 4HROA 1RRBA 3DHIC 2WXRA 4YSYB 4MGKE 3Q8BA 3EA6A 2KMAA 4IKGA 3AE4B 5AZGA 3N1YC 1V9JA 1LM8B 4WJPA 4LK0M 2OOBB 2HD5B 3BK2A 1PQSA 3W1SC 1L4ZB 1OGWA 3NVVA 2ZNVB 3L17A 1RM6C 2AQ1B 1XLOA 2D3BA 2FCSA 4MEMA 4NNJB 5IOIA 4WJQA 3OWEB 2M19A 1EWYC 4NAWB 2KD0A 2E6XA 4TV3A 2KTRA 4WWNA 2SEBD 3ZNHB 4MDKE 5AUKA 1KH0A 2R2OA 4ZRJA 4DXFA 3PHWB 2W82A 4OZAA 2LRUA 2AEHA 2EKIA 5G5GA 2DAJA 4DXAB 1V6EA 4DDID 4HRSA 4URKA 3MJWA 4LJPB 4RM9A 2CR5A 2RSUA 1WGDA 4PS8A 2KYWA 1KM7A 4G11A 3ZO5B 1VZ6A 1TKGA 2PIAA 2V3NA 3H9DA 1F2RC 5BYQA 3RYTA 3W5VB 4B9KA 4RNAA 5LLIA 3AE5B 1IPGA 2KMMA 1VDVA 3IAS1 2LGYA 5J2RA 1K51A 3P63A 4REZA 4DHZB 3RZFA 1R7SA 2IO1B 4EOYA 3DWMA 4IWPA 4K7UA 2ZJDA 3VH3B 1WI0A 2HTHA 2UU7A 1TJEA 3SU8X 4M0WA 3R7RA 4MGZE 1YJIA 4MT5A 1TKYA 1XCTL 2KAJA 3E56A 2WDTB 2NCNA 3ZW3A 1JRUA 4W9HA 3UI3A 3V05A 4OVZA 3N1ZC 1YQ4B 1WX7A 3B9JA 1YIWA 1WRDB 3ML9A 3TL5A 3ZUNA 2IYDB 1HTQA 2VRRB 5FR3A 2IPKD 2BYTA 2C7NB 1E5WA 4R3DA 2C7HA 4FN2A 4P7IA 1LFDA 5D3DA 4XDCA 3DHHC 3AE2B 2KANA 1HTOA 1MI0A 3ABVB 3KH0A 3PZDA 1VCBA 3AEEB 4NZLB 4RGOS 5EE0A 4NPNA 1VR9A 3A4RA 4N6EB 4YL8A 3PLUA 4J6IA 1QOBA 3KVFB 4BKTA 3H6NA 1GPXA 1SIJA 3PZ7A 3DBHI 2PE9A 1WE6A 2DZJA 2K39A 4B95A 4AOFA 2NS5A 2WHIA 4KIKA 3BYYB 4K3BA 3TBLD 4TMAB 3V3XA 4KZCA 3VVWB 1WGRA 2LFIA 1LQBA 2BYFA 1F52A 2KACA 2BVCA 2MH7A 2H88B 3SHQA 1I4PA 1D3ZA 3VRBB 1U4AA 3GZNB 4ZYNA 2MBQA 2HJ8A 2J0MA 1FEHA 1P98A 2G4SA 2L3ZA 3AMZA 1L5PA 2CU1A 2JQRB 2J0JA 5DPSA 1UBIA 2GI9A 3TEZA 3MTNB 3JW0X 2WP9B 1YJ1A 2K25A 1NVID 1V5TA 4FULA 3ZTCA 3NHEB 1WXVA 1EUVB 2WU2B 5C3JB 1VZ8A 3J9CA 4IW0A 3OAWA 3N32A 4FHJA 1CK1A 4KVGB 3UF8A 1F2RI 1L6UA 1RYJA 3ZYYX 3H7PA 3B2FA 2PVOD 4DDGD 2LJIA 2M0AA 5DCNA 1HZ5A 3TEXA 4QAYA 1UNSA 1XXGA 4ZHPA 3AEGB 1L2NA 1SGHA 2DHZA 2BF8B 1KTKA 1XLNA 2RD0A 2MBHA 3MHSD 5E6JA 1FRDA 2CKHB 3ZIMA 4P16A 5MPOA 1RAXA 5BYRA 1HA5A 1Y56A 5D94A 1ET9A 5D6JB 4B6WA 1IGCA 4LNNA 1SIFA 2YVCA 1TZOA 2I38A 3WAPA 4FXCA 2LXAA 3U4EG 1N6ZA 1OQQA 3UQBA 1P1AA 2AYOB 1A70A 4W9GA 3WANA 1IP9A 2N9LA 1CQVA 4RGMA 3RT3B 4KKJA 3MFGA 1F1HA 4I6NB 3I3TB 3A9JB 4YTPB 3UGBB 3RFZB 1WMHA 1N62A 3NZSA 1V8CA 3A33B 3FILB 3O13A 3KLSX 4RMAA 3VUYA 4YWGG 4KDIC 1MJDA 5JH5C 4US8A 2C5LC 2M1MA 3R7QA 4HKQA 2M17A 3WAOA 1P3QU 5L95C 2FCQA 2C60A 3Q3NC 1OFFA 3DOWA 1IBXB 1K53A 2IO0B 4CYEA 4TUUA 4BKGA 1BT0A 2K8CA 1HE8A 4IM3A 3SR6A 2YEPF 2BPSA 5EE3A 3C8YA 1B1ZA 2IJ0A 4MJSB 3L0WB 1GNUA 1UGMA 4XX5A 1HZ6A 5IA7A 1GAQB 2L83A 1YNTE 4NJ6A 1TS2A 3AE9B 1D5MC 4NJ7A 3U2SC 1MHXA 2UYZB 5BMIA 3VTVA 1MVKA 4KX6B 2KO3A 3EECA 1Z2MA 2PEAA 4GOCA 3AU4A 2FNJB 1ENFA 1WM2A 3DVGY 2MBOA 2CU3A 5IP4D 2GBJA 4GDLB 3BIID 4BOSC 4E3CA 3N9YC 1VRAB 2KTFA 3NRZA 3B08A 1KLVA 4WJOA 1GB1A 3ZJUA 1IYFA 2LWPA 4WURA 1UH6A 4TKNA 5D2MB 1Q1OA 5J17A 1E10A 5L83A 4A20A 3PSEB 3TIXA 2IO2B 4W9IA 2EKEC 2ACZB 1WZ3A 2LVQA 1Q5WB 3N3KB 3AULA 3BK1A 2KT7A 3WCQA 4C4VB 1N61A 2KOXA 2K1FA 3PRMB 2V0GA 2XBBC 2ZCCA 3ZJVA 5G2NA 3BZDB 3P4RB 2AL3A 2CJOA 4HPMB 2IGDA 2MBBB 1R4NB 1J8CA 2SAKA 2K6QA 3NJTA 2PJHA 2N9EB 2QCZA 1WXMA 2MA9B 1PGAA 1V1PA 3A4SC 1DYQA 2KLGA 2VZKD 1EU4A 2LHDA 2FAZA 4DWFA 2V4LA 1TBEA 5AZFA 3IHPC 1GC6A 4HCNB 1MG8A 2ZVNA 4NY0A 1K50A 2DAFA 5EE1A 4WAAA 3HM6X 2XK5A 1NBFC 3RZWC 1CMXB 2BTEA 1WJ6A 4MH8A 3V6CB 4BBNC 3V60A 3IXSA 1C1YB 3AN1A 3S2AA 1YN3A 1LO5D 3RUIB 4P1CC 5HFYA 3L13A 1IGDA 2W9NA 2ZPYA 4G3XB 3ZTDA 4MM3B 2MQJA 2XNAC 2V4IB 4PYUA 3PREA 2MJDA 4Q2JA 3RNFC 2KDEB 1JWSD 2EMTA 4BBNF 2KFKA 2KJRA 1V86A 4C00A 2Y5CA 3NZUA 5FKAC 2BYVE 5IAAC 1WGKA 1T3QA 1HEZE 1KJTA 1FFVA 1GJZA 1C4CA 1KRHA 4RFBA 1XLPA 3U7ZA 4HVBA 4II2B 4FJYA 5LXIB 4F1SA 4GN1A 1VZ7A 3PV1A 1BUIC 3JSVB 2KHWB 1FCLA 2B76B 3HVDA 1TS5A 1KOTA 4EKUA 3FC4A 1L7YA 3Q8AA 2LJ5A 3DVNU 2M56B 3NG0A 1ZKHA 2RDGA 3P42A 2DWQA 3VQIA 3VDZA 3UINB 4RGTA 3EC8A 1AWDA 1FNVA 3L16A 4A6QA 2N1WA 1MHHE 2Y3AA 1FIQA 2NR2A 3T3OA 2MCNB 3Q6BA 4XWWA 4P1BC 4AWJA 1IUEA 1FXIA 2G45B 2G1EA 4W9CA 4NQLB 1RFAA 2KDFB 2N7DA 4EE2A 2PKOA 3BVZA 1LGRA 4EUTA 2FIFA 4DHZE 1YQBA 2ICIA 4CQNA 3GB1A 1SJHD 2ZCBA 3WA0A 2J0KA 4LCDE 2PPHA 1UD7A 1V2YA 1YN4A 1WRIA 1P9DU 2R2QA 2OHFA 3RN9C 3IVFA 4OZCA 3GE8C 2L00B 4HPLB 2JF5A 1M94A 2D07B 1TS3A 2I1JA 3A9KB 1QOFA 1E8YA 2J4XA 1QKZA 1GC7A 3QC8B 3V6EB 2WXGA 2RDBC 3TCAA 3QAQA 4A8XC 1OQYA 4FJVB 2GBMA 2KJ6A 2BS2B 4GB9A 2QIEB 2LUMA 3DBRI 3R3MA 4XZ4A 2KMCA 2Z0DB 5KHQA 2KKCA 2DYBA 3A1QA 3NUHB 3ZNGC 4HKZE 1QOGA 2RR9A 4F8CB 5C23A 2MWSB 3HK0A 1ZDVA 3Q3OC 1KLUD 3ML8A 1WIAA 3AECB 3QHTA 3BWUD 2K0PA 2LHEA 2KDBA 2LUEA 5BMGA 5HI1A 1QOAA 1ZXHA 4DHJB 1SE3A 2M8SA 1ROEA 3ZQ4A 2MP2A 1JRPA 5CX3A 1MPEA 3PLVA 1PGBA 1WGHA 4PS3A 2N0SB 2DX5B 1B9RA 4N9F4 2W55A 1PFDA 3ZGZA 3ONSA 3KUDB 5AUIA 1WX8A 1P7FA 1PYWD 3U30A 2BB6A 5IO9A 3APFA 1J7BA 2WXFA 3ZXRA 3AV8A 5E6PA 1TKEA 2L32A 1WZ0A 3LYYA 1XLQA 1ZOYB 3BY4B 2FCMA 1SE4A 2LGIA 4M00A 4MACA 2JPHA 2JY6A 3BINA 2PW9A 1V81A 1SB3C 4JGHB 2INNE 1WR1A 1J7AA 1LXDA 3ZXVA 1J0GA 1D6EC 2X38A 2WXNA 1XQQA 4HCPB 2D10A 2JYTA 5JHAA 4XWTA 4JQWC 2WDRB 2NTTA 1YN5A 5IN7A 2QMTA 1E8WA 2G4DB 2YEPB 2A4ZA 3OJ4B 1TY0A 2KDIA 3M63B 2J7QB 1T0SC 4EZJA 3P1MA 2CHZA 3E9SA 4LDTD 1Z5SB 1PDXA 3I57A 1BXTA 2DLBA 2WYQA 3VHTC 3AU5A 3O65B 2Z8LA 1ISNA 2JRHA 2O2VB 2O6VA 3KYDD 1EF5A 3AEAB 1QILA 3IBEA 2KK8A 2AL6A 3ETRA 4GLSC 2WXLA 1OQRA 1KFYB 1WXAA 4A9AA 1SE9A 3DVNV 1V5OA 5TR5A 3MHZA 2I1KA 3FKYA 4GSWA 4HDOA 3URYA 3RNAC 2IY0B 1WH3A 3N30A 2WWZA 3HM3A 1C3TA 1UUPA 4PK1A 2GB1A 3H8HA 4FADA 3RNCC 3WALA 2PE6B 3GP7A 5KHOA 2KVRA 4W9JA 2K8BA 4KGSA 1XD3B 2KWCA 1UELA 2Y5BB 4OVVA 1J19A 2XEWA 2E3TA 3DBLI 4CHKA 3PS6A 2KXJA 1V49A 4C7YA 2HJ1A 1PUTA 2LXCA 2IDYA 3MJ5A 2HE7A 1JWBD 2O6VD 1Q10A 1GG3A 3RPFC 2RPVA 4ANUA 3D32A 2ASQA 3WIMA 4RGNA 2WXKA 2M4NA 2WS3B 4NAWA 1UZXB 2DYMA 2MLBA 4A55A 4A3OA 5LNK1 1AARA 4AUQC 4W9LA 4CO7A 2MBEA 2ZPNA 2G9HD 2WU5B 1XEEA 4M8NA 4GGQA 4GDKB 3UIOB 2ZW1A 1K52A 2LVPA 3X23A 1S1QB 4TSSA 2JVCA 4IM0A 1FO4A 1XF5L 1GB4A 1ZE3D 2VH2A 3CWIA 4L2YA 4DXGA 2IZVB 3Q8EA 4EZKA 3N20C 3DWGC 3EUB2 3LDZE 3EFUA 2CS4A 1E9MA 5JZEB 4TQ1A 1I35A 2QJLA 1C76A 1JALA 3AXCA 3IT6B 4XC2A 3KWLA 3ZDTA 3PHXB 2ZEQA 2J52A 1N63A 2D11A 3Q3JA 1FXAA 4YSXB 1YMHE 2KTRB 1F77A 2LGXA 2WNMA 3DPDA 1GOZA 4AP4C 3PTFC 3HHMA 1V97A 1FM0D 3RD2A 4I6LB 3VAWA 2XN9C 4EZLA 3IAM1 2JZPA 2QSDA 5G55A 1V80A 3MC8A 4L1BA 3OG5A 1QZEA 3MC0B 1WYWB 1P0RA 3Q8CA 4DQOC 2Z0EB 4BVUC 1JQ4A 1NYRA 5IKCM 3B2GA 3I63C 3AEFB 1I4XA 1ZGUB 4HEA1 4HXDA 2L76A 1I4GA 1YQ3B 4JWSC 1I4HA 3OJ3A 4MGIE 3JVZX 2OEDA 3R8BA 1SSNA 3Q2AC 1WJUA 4M0WB 4MH0E 2Z59B 1OEYA 1ZUD2 3AE6B 1H4RA 2L52A 4A3PA 2W54A
chains in the Genus database with same CATH topology
1RFAA 2KDFB 2EMSA 2N7DA 3GOEA 2ZZPB 3PRZA 4EUTA 1WY8A 2KANA 4FHKA 2FIFA 3AI5A 4KV2A 3ZDMC 3KH0A 4DHZE 1YQBA 2L0TA 3PZDA 1VCBA 2L0FA 4NPNA 3CSTA 3A4RA 3PVLA 1WX9A 4YL8A 4GMVA 3K9PB 2ZCBA 3SDLC 3WA0A 2J0KA 3PLUA 4LCDE 4J6IA 2PPHA 1UD7A 3U7DA 1V2YA 4JIOU 3C0RB 3H7SA 1P9DU 2LI5A 2R2QA 3QIJA 3KVFB 2JRIB 2V3SA 4BKTA 3H6NA 4IUMB 1I42A 3IVFA 3RCZA 3VTUA 2L00B 3DBHI 4HPLB 2JF5A 2PE9A 2GBKA 1M94A 1WE6A 2D07B 1E8XA 2DZJA 2I1JA 2K39A 2REXA 4ASWC 4AOFA 2NS5A 4B95A 3QWZB 4KIKA 4WQOB 4DK5A 3QCAA 4ANVA 3A9KB 1E8YA 2G3QB 3TBLD 2MRPA 1GC7A 3QC8B 3V6EB 4KZCA 3VVWB 1WGRA 4IM2A 4AJYB 1LQBA 2FUHB 2BYFA 2N9XA 3KUZA 5BO4B 3SHQA 3TCAA 4BKSA 2DZIA 3QAQA 1K8RB 3H1UA 1D3ZA 1OQYA 1U4AA 4RM8A 4ZYNA 2FCNA 2LGDA 2MBQA 2HJ8A 4JL9A 2J0MA 1XT9B 4FJVB 2GBMA 3ZKJC 1P98A 2G4SA 2KJ6A 3V62A 3ZVVA 3NS8A 2L3ZA 5DPSA 2CU1A 2J0JA 1UBIA 4KIKB 4GB9A 2RPQA 3DBRI 3KW5B 3JW0X 3MTNB 3R3MA 4XZ4A 1YJ1A 2KMCA 4ICVA 2K25A 2L7RA 2Z0DB 1V5TA 4FULA 5KHQA 2KKCA 2KWUB 3ZTCA 3NHEB 2DYBA 2IBIB 1YX5B 1WXVA 1EUVB 3A1QA 1R4MI 2KQSA 1X1MA 3ZNGC 1H8CA 2KFJA 2IY1B 1Y8RC 2RR9A 4F8CB 3IG3A 4IW0A 2DZKA 5LXHA 3OAWA 5C23A 2MWSB 3N32A 3HK0A 4FHJA 4KVGB 4LJOB 4ANXA 3UF8A 2N1VA 3M95A 1WIAA 2A5UA 3B1LX 3ML8A 1TZ1A 4NQKE 2KJHB 3QHTA 1GUAB 4GIVA 2KC2A 2IO3B 3H7PA 4DDGD 2N4FA 3W1YA 2JZ3B 2KDBA 3V61A 2LUEA 2LZ6A 5DCNA 2KX0A 3PPAA 4DHJB 2M8SA 2BKFA 1L2NA 3A1QB 1SGHA 4FJZA 2NPTB 2DHZA 2NBVB 1A5RA 2BF8B 2RD0A 2MP2A 2MBHA 3MHSD 5CX3A 2CKHB 5HKHA 3DDCB 3ZIMA 2L8JA 4EEWA 3PLVA 1RAXA 2L05A 1WGHA 4PS3A 4M8MA 2DX5B 1S3SG 1WFYA 4N9F4 5D94A 3L08A 4BKSD 5E6OA 3ONSA 3A9JA 5D6JB 3KUDB 4WWPA 1UBQA 4K7WA 4B6WA 1WX8A 4AJWA 3H7PB 1SIFA 3U30A 3APFA 2YVCA 5E6PA 3WAPA 3VTWA 1ZW7A 2LXAA 1WZ0A 3UQBA 4W9EA 3BY4B 1P1AA 2AYOB 4W9GA 2FCMA 1VD2A 2JPHA 3WANA 2JY6A 4DHJD 3BINA 1IP9A 4K7SA 2MP2B 2MSED 1V81A 3RT3B 4HWIB 4F7ZA 4HJKA 4JGHB 4IWOA 4LDTB 4MSQB 4WJNA 1E8ZA 4K81A 1WR1A 1FXTB 1WR6E 2KN5A 1LXDA 3L10B 4I6NB 3I3TB 3A9JB 3VFKA 3UGBB 1WMHA 3NZSA 1J0GA 2C9WB 3PRPB 2JWZA 3A33B 1NI2A 4ANWA 3WAMA 3M62B 4RMAA 4ZRKA 3VUYA 2OJRA 4W9KA 1OTRB 4GU2A 2O2VA 4MJSA 2KLCA 4KDIC 4MELA 5FR6A 1XQQA 4HCPB 5D7GA 2D10A 2JT4B 4OVUA 4HLEA 2NBUA 5AZHA 2C5LC 2LD9A 2M1MA 3R7QA 5JH5C 2M17A 3WAOA 4JQWC 3NY5A 2LVOA 2LASA 1WE7A 1P3QU 5L95C 2FCQA 3VUXA 2C60A 3EHVA 1E8WA 3TJPA 2G4DB 3PGEA 2A4ZA 2DYOA 3OJ4B 5C1ZA 3DOWA 2KDIA 3M63B 2IO0B 2J7QB 4CYEA 2K6DB 4EZJA 1YD8U 4K1RB 4TUUA 2CHZA 4PYZA 1BT0A 2K8CA 1HE8A 4LDTD 2GBRA 4IM3A 4BKGA 5JHAA 2GOWA 1Z5SB 1WMHB 3GZNI 3KUCB 1F9JA 3OLMD 3PT2B 1T0YA 2WYQA 2BPSA 4FLHA 4ICUA 3VHTC 3AU5A 2NBWB 3O65B 2ZVOA 1ISNA 2JRHA 2O2VB 4GDLA 3QJZA 4MJSB 3L0WB 1GNUA 1UGMA 2BYEA 4G0NB 4XX5A 3ZRCA 2O6VA 2DZMA 3KYDD 5IA7A 2KWVB 1EF5A 4FBJB 3P2BA 3IBEA 2KK8A 2AL6A 1YX6B 2LRWA 4NJ6A 5DPWA 4E74A 4NJ7A 2CHXA 5EDSA 5GMVA 2UYZB 3VH4B 3VTVA 1WXAA 2M0XA 2KO3A 2JXXA 1SE9A 3EECA 1Z2MA 2PEAA 3DVNV 1V5OA 4GOCA 2JUOA 4GXBA 3AU4A 5TR5A 2I1KA 2FNJB 3QX1A 4GSWA 4HDOA 3SD5A 2CHWA 1WM2A 3DVGY 2MBOA 3ECIA 1TGZB 3KYCD 5J18A 1EF1A 1EO6A 2IY0B 3VXWA 3CSFA 1WH3A 2GBJA 3ZNZB 5JHBA 3N30A 4BOZB 4GDLB 2WWZA 3HM3A 4W9DA 1C3TA 2KQ7A 4BOSC 2O6VB 3IFWB 4E3CA 4FADA 2KTFA 1WJ4A 3R66C 3B08A 3WALA 2PE6B 4DBGA 1KLVA 4WJOA 3ZLZA 1NDDA 1E7UA 3QK0A 5KHOA 3X0WA 2KVRA 1IYFA 4W9JA 4TQ0A 2LWPA 3UIPB 2KX3A 2K8BA 1UH6A 4TKNA 2NVUI 5D2MB 1Q1OA 1XD3B 5J17A 2KWCA 2YLMA 1E7VA 5L83A 1UELA 4A20A 1WGGA 2QHOA 3PSEB 3U8ZA 2Y5BB 2JZZA 2IO2B 3TIXA 4OVVA 4W9IA 4KDLB 4MSMB 2EKEC 1J19A 2BGFA 4PS7A 1WZ3A 2LVQA 1WGYA 2XEWA 3DVGX 1Q5WB 3DBLI 3N3KB 4CHKA 3AULA 2AWTA 3PS6A 3DQVA 4ZDVA 2KXJA 4I6PA 1V49A 4EFOA 2WX0A 2KOXA 3CMMB 1WJNA 2BWES 2K1FA 3ZRFA 3PRMB 4HK2A 5CHWA 1WM3A 1E90A 2LXCA 2XBBC 2ZCCA 2KZRA 4HDQA 4II3B 3LJ3A 4IWQA 4W9FA 2HE7A 5G2NA 4FA6A 2O6VD 4GDKA 5CTRC 1GG3A 2BKRB 2AL3A 4ANUA 2K8HA 1R4NI 3D32A 4HPMB 2MBBB 2ASQA 3VUWA 1J8CA 3WIMA 5AEKB 1RRBA 2K6QA 2PJHA 2MX2A 2M4NA 2N9EB 1WXMA 2WX1A 4NAWA 2MA9B 1UZXB 3A4SC 4IG7B 4MGKE 3W1SA 2KLGA 2DYMA 2V1YA 3ENEA 2KMAA 2FAZA 2MLBA 2V4LA 1TBEA 3QQ8B 2ZNVC 4X57B 5AZFA 4DWFA 5AZGA 3IHPC 1GC6A 4MM3A 4HCNB 4MGYE 4A3OA 1MG8A 1V9JA 2ZVNA 3NOBA 2D3GA 1LM8B 4NY0A 2DAFA 4WJPA 1AARA 4AUQC 4W9LA 2OOBB 4WAAA 2HD5B 3HM6X 4CO7A 2XK5A 1NBFC 2MBEA 2N9PC 1PQSA 3W1SC 2DENB 2ZPNA 3RZWC 2RGFA 1G6JA 1CMXB 1OGWA 4M8NA 4GGQA 1WJ6A 4JLCA 4GDKB 5CHFA 3UIOB 2ZNVB 3V6CB 3V60A 4BBNC 3L17A 2FCSA 2LVPA 1C1YB 4MEMA 4NNJB 3X23A 1S1QB 3S2AA 2FIDA 3TMPB 2JVCA 4WJQA 3RUIB 4IM0A 4G50A 1Q0WB 4NAWB 2KD0A 3L13A 4TV3A 3UQAA 2KTRA 3APDA 4WWOA 1WXSA 2GMIC 2W9NA 4WWNA 2ZPYA 3QARA 4G3XB 4ZRIA 3ZTDA 3ZNHB 4MDKE 2IZVB 2MQJA 3RULA 4EZKA 2R2OA 4ZRJA 2GBNA 3B0AA 3LDZE 2XK5B 2CS4A 1RLFA 3EFUA 3PREA 4PYUA 3PHWB 5JZEB 4TQ1A 2LRUA 2KDEB 2AEHA 1I35A 2MW5A 2DAJA 2EMTA 5DPRA 4DXAB 3AXCA 4XC2A 4BBNF 2KFKA 3ZDTA 3M3JA 3PHXB 2KJRA 4E71A 3JYUA 2ZEQA 3JSVA 1V6EA 1V86A 4DDID 3NZUA 2BYVE 4URKA 2D11A 3Q3JA 3MJWA 4LJPB 5IAAC 2KTRB 4RM9A 2CR5A 2LGXA 3DPDA 2RSUA 4IC7B 3L54A 1WGDA 1KJTA 4AP4C 4PS8A 3PTFC 3CF6E 1GJZA 3HHMA 1KM7A 1TTNA 4G11A 3ZO5B 3QA8A 3H9DA 3DBSA 3RD2A 2UWQA 4HVBA 4I6LB 3RYTA 4B9KA 3VAWA 4II2B 2C7MB 4FJYA 4EZLA 2NPTA 5LLIA 3ALBA 4A3PA 4GN1A 4F1SA 5LXIB 1IPGA 3PV1A 2KFKB 2BWFA 2LGYA 5G55A 5J2RA 4DHZB 3JSVB 1V80A 3RZFA 2IO1B 5E6NA 5DPTA 2KHWB 4BFRA 4EOYA 1QZEA 4IWPA 4K7UA 2ZJDA 3DCGA 5CHVC 1WYWB 3T9LA 3VH3B 1P0RA 1WI0A 2B3AA 2HTHA 1KOTA 4EKUA 2Z0EB 1L7YA 4BVUC 2LJ5A 4KZ0A 3SU8X 3R7RA 4MGZE 3DVNU 3ZNID 1ZKHA 1ZGUB 2WDTB 4P7IA 2NCNA 3VQIA 3ZW3A 4HXDA 3T8MA 2L76A 1JRUA 4W9HA 3VDZA 1WF9A 3UINB 3EC8A 3L16A 3OJ3A 2N1WA 4MGIE 2D2QA 2N7EA 1WX7A 2NR2A 3JVZX 4KSKC 1YIWA 4KSLC 2KC1A 3K9OB 1OEYJ 1WRDB 3ML9A 1WJUA 3TL5A 3ZUNA 3Q3FA 2IYDB 2KNBA 4M0WB 2VRRB 4MH0E 2Z59B 2MCNB 1OEYA 2C7NB 3APCA 1E5WA 3HIZA 1H4RA 4AWJA 2C7HA 2G45B 4FN2A 4W9CA 3A9KA 1LFDA 4NQLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RFA A;  2KDF B;  2EMS A;  2N7D A;  3GOE A;  2ZZP B;  3PRZ A;  4EUT A;  1WY8 A;  2KAN A;  4FHK A;  2FIF A;  3AI5 A;  4KV2 A;  3ZDM C;  3KH0 A;  4DHZ E;  1YQB A;  2L0T A;  3PZD A;  1VCB A;  2L0F A;  4NPN A;  3CST A;  3A4R A;  3PVL A;  1WX9 A;  4YL8 A;  4GMV A;  3K9P B;  2ZCB A;  3SDL C;  3WA0 A;  2J0K A;  3PLU A;  4LCD E;  4J6I A;  2PPH A;  1UD7 A;  3U7D A;  1V2Y A;  4JIO U;  3C0R B;  3H7S A;  1P9D U;  2LI5 A;  2R2Q A;  3QIJ A;  3KVF B;  2JRI B;  2V3S A;  4BKT A;  3H6N A;  4IUM B;  1I42 A;  3IVF A;  3RCZ A;  3VTU A;  2L00 B;  3DBH I;  4HPL B;  2JF5 A;  2PE9 A;  2GBK A;  1M94 A;  1WE6 A;  2D07 B;  1E8X A;  2DZJ A;  2I1J A;  2K39 A;  2REX A;  4ASW C;  4AOF A;  2NS5 A;  4B95 A;  3QWZ B;  4KIK A;  4WQO B;  4DK5 A;  3QCA A;  4ANV A;  3A9K B;  1E8Y A;  2G3Q B;  3TBL D;  2MRP A;  1GC7 A;  3QC8 B;  3V6E B;  4KZC A;  3VVW B;  1WGR A;  4IM2 A;  4AJY B;  1LQB A;  2FUH B;  2BYF A;  2N9X A;  3KUZ A;  5BO4 B;  3SHQ A;  3TCA A;  4BKS A;  2DZI A;  3QAQ A;  1K8R B;  3H1U A;  1D3Z A;  1OQY A;  1U4A A;  4RM8 A;  4ZYN A;  2FCN A;  2LGD A;  2MBQ A;  2HJ8 A;  4JL9 A;  2J0M A;  1XT9 B;  4FJV B;  2GBM A;  3ZKJ C;  1P98 A;  2G4S A;  2KJ6 A;  3V62 A;  3ZVV A;  3NS8 A;  2L3Z A;  5DPS A;  2CU1 A;  2J0J A;  1UBI A;  4KIK B;  4GB9 A;  2RPQ A;  3DBR I;  3KW5 B;  3JW0 X;  3MTN B;  3R3M A;  4XZ4 A;  1YJ1 A;  2KMC A;  4ICV A;  2K25 A;  2L7R A;  2Z0D B;  1V5T A;  4FUL A;  5KHQ A;  2KKC A;  2KWU B;  3ZTC A;  3NHE B;  2DYB A;  2IBI B;  1YX5 B;  1WXV A;  1EUV B;  3A1Q A;  1R4M I;  2KQS A;  1X1M A;  3ZNG C;  1H8C A;  2KFJ A;  2IY1 B;  1Y8R C;  2RR9 A;  4F8C B;  3IG3 A;  4IW0 A;  2DZK A;  5LXH A;  3OAW A;  5C23 A;  2MWS B;  3N32 A;  3HK0 A;  4FHJ A;  4KVG B;  4LJO B;  4ANX A;  3UF8 A;  2N1V A;  3M95 A;  1WIA A;  2A5U A;  3B1L X;  3ML8 A;  1TZ1 A;  4NQK E;  2KJH B;  3QHT A;  1GUA B;  4GIV A;  2KC2 A;  2IO3 B;  3H7P A;  4DDG D;  2N4F A;  3W1Y A;  2JZ3 B;  2KDB A;  3V61 A;  2LUE A;  2LZ6 A;  5DCN A;  2KX0 A;  3PPA A;  4DHJ B;  2M8S A;  2BKF A;  1L2N A;  3A1Q B;  1SGH A;  4FJZ A;  2NPT B;  2DHZ A;  2NBV B;  1A5R A;  2BF8 B;  2RD0 A;  2MP2 A;  2MBH A;  3MHS D;  5CX3 A;  2CKH B;  5HKH A;  3DDC B;  3ZIM A;  2L8J A;  4EEW A;  3PLV A;  1RAX A;  2L05 A;  1WGH A;  4PS3 A;  4M8M A;  2DX5 B;  1S3S G;  1WFY A;  4N9F 4;  5D94 A;  3L08 A;  4BKS D;  5E6O A;  3ONS A;  3A9J A;  5D6J B;  3KUD B;  4WWP A;  1UBQ A;  4K7W A;  4B6W A;  1WX8 A;  4AJW A;  3H7P B;  1SIF A;  3U30 A;  3APF A;  2YVC A;  5E6P A;  3WAP A;  3VTW A;  1ZW7 A;  2LXA A;  1WZ0 A;  3UQB A;  4W9E A;  3BY4 B;  1P1A A;  2AYO B;  4W9G A;  2FCM A;  1VD2 A;  2JPH A;  3WAN A;  2JY6 A;  4DHJ D;  3BIN A;  1IP9 A;  4K7S A;  2MP2 B;  2MSE D;  1V81 A;  3RT3 B;  4HWI B;  4F7Z A;  4HJK A;  4JGH B;  4IWO A;  4LDT B;  4MSQ B;  4WJN A;  1E8Z A;  4K81 A;  1WR1 A;  1FXT B;  1WR6 E;  2KN5 A;  1LXD A;  3L10 B;  4I6N B;  3I3T B;  3A9J B;  3VFK A;  3UGB B;  1WMH A;  3NZS A;  1J0G A;  2C9W B;  3PRP B;  2JWZ A;  3A33 B;  1NI2 A;  4ANW A;  3WAM A;  3M62 B;  4RMA A;  4ZRK A;  3VUY A;  2OJR A;  4W9K A;  1OTR B;  4GU2 A;  2O2V A;  4MJS A;  2KLC A;  4KDI C;  4MEL A;  5FR6 A;  1XQQ A;  4HCP B;  5D7G A;  2D10 A;  2JT4 B;  4OVU A;  4HLE A;  2NBU A;  5AZH A;  2C5L C;  2LD9 A;  2M1M A;  3R7Q A;  5JH5 C;  2M17 A;  3WAO A;  4JQW C;  3NY5 A;  2LVO A;  2LAS A;  1WE7 A;  1P3Q U;  5L95 C;  2FCQ A;  3VUX A;  2C60 A;  3EHV A;  1E8W A;  3TJP A;  2G4D B;  3PGE A;  2A4Z A;  2DYO A;  3OJ4 B;  5C1Z A;  3DOW A;  2KDI A;  3M63 B;  2IO0 B;  2J7Q B;  4CYE A;  2K6D B;  4EZJ A;  1YD8 U;  4K1R B;  4TUU A;  2CHZ A;  4PYZ A;  1BT0 A;  2K8C A;  1HE8 A;  4LDT D;  2GBR A;  4IM3 A;  4BKG A;  5JHA A;  2GOW A;  1Z5S B;  1WMH B;  3GZN I;  3KUC B;  1F9J A;  3OLM D;  3PT2 B;  1T0Y A;  2WYQ A;  2BPS A;  4FLH A;  4ICU A;  3VHT C;  3AU5 A;  2NBW B;  3O65 B;  2ZVO A;  1ISN A;  2JRH A;  2O2V B;  4GDL A;  3QJZ A;  4MJS B;  3L0W B;  1GNU A;  1UGM A;  2BYE A;  4G0N B;  4XX5 A;  3ZRC A;  2O6V A;  2DZM A;  3KYD D;  5IA7 A;  2KWV B;  1EF5 A;  4FBJ B;  3P2B A;  3IBE A;  2KK8 A;  2AL6 A;  1YX6 B;  2LRW A;  4NJ6 A;  5DPW A;  4E74 A;  4NJ7 A;  2CHX A;  5EDS A;  5GMV A;  2UYZ B;  3VH4 B;  3VTV A;  1WXA A;  2M0X A;  2KO3 A;  2JXX A;  1SE9 A;  3EEC A;  1Z2M A;  2PEA A;  3DVN V;  1V5O A;  4GOC A;  2JUO A;  4GXB A;  3AU4 A;  5TR5 A;  2I1K A;  2FNJ B;  3QX1 A;  4GSW A;  4HDO A;  3SD5 A;  2CHW A;  1WM2 A;  3DVG Y;  2MBO A;  3ECI A;  1TGZ B;  3KYC D;  5J18 A;  1EF1 A;  1EO6 A;  2IY0 B;  3VXW A;  3CSF A;  1WH3 A;  2GBJ A;  3ZNZ B;  5JHB A;  3N30 A;  4BOZ B;  4GDL B;  2WWZ A;  3HM3 A;  4W9D A;  1C3T A;  2KQ7 A;  4BOS C;  2O6V B;  3IFW B;  4E3C A;  4FAD A;  2KTF A;  1WJ4 A;  3R66 C;  3B08 A;  3WAL A;  2PE6 B;  4DBG A;  1KLV A;  4WJO A;  3ZLZ A;  1NDD A;  1E7U A;  3QK0 A;  5KHO A;  3X0W A;  2KVR A;  1IYF A;  4W9J A;  4TQ0 A;  2LWP A;  3UIP B;  2KX3 A;  2K8B A;  1UH6 A;  4TKN A;  2NVU I;  5D2M B;  1Q1O A;  1XD3 B;  5J17 A;  2KWC A;  2YLM A;  1E7V A;  5L83 A;  1UEL A;  4A20 A;  1WGG A;  2QHO A;  3PSE B;  3U8Z A;  2Y5B B;  2JZZ A;  2IO2 B;  3TIX A;  4OVV A;  4W9I A;  4KDL B;  4MSM B;  2EKE C;  1J19 A;  2BGF A;  4PS7 A;  1WZ3 A;  2LVQ A;  1WGY A;  2XEW A;  3DVG X;  1Q5W B;  3DBL I;  3N3K B;  4CHK A;  3AUL A;  2AWT A;  3PS6 A;  3DQV A;  4ZDV A;  2KXJ A;  4I6P A;  1V49 A;  4EFO A;  2WX0 A;  2KOX A;  3CMM B;  1WJN A;  2BWE S;  2K1F A;  3ZRF A;  3PRM B;  4HK2 A;  5CHW A;  1WM3 A;  1E90 A;  2LXC A;  2XBB C;  2ZCC A;  2KZR A;  4HDQ A;  4II3 B;  3LJ3 A;  4IWQ A;  4W9F A;  2HE7 A;  5G2N A;  4FA6 A;  2O6V D;  4GDK A;  5CTR C;  1GG3 A;  2BKR B;  2AL3 A;  4ANU A;  2K8H A;  1R4N I;  3D32 A;  4HPM B;  2MBB B;  2ASQ A;  3VUW A;  1J8C A;  3WIM A;  5AEK B;  1RRB A;  2K6Q A;  2PJH A;  2MX2 A;  2M4N A;  2N9E B;  1WXM A;  2WX1 A;  4NAW A;  2MA9 B;  1UZX B;  3A4S C;  4IG7 B;  4MGK E;  3W1S A;  2KLG A;  2DYM A;  2V1Y A;  3ENE A;  2KMA A;  2FAZ A;  2MLB A;  2V4L A;  1TBE A;  3QQ8 B;  2ZNV C;  4X57 B;  5AZF A;  4DWF A;  5AZG A;  3IHP C;  1GC6 A;  4MM3 A;  4HCN B;  4MGY E;  4A3O A;  1MG8 A;  1V9J A;  2ZVN A;  3NOB A;  2D3G A;  1LM8 B;  4NY0 A;  2DAF A;  4WJP A;  1AAR A;  4AUQ C;  4W9L A;  2OOB B;  4WAA A;  2HD5 B;  3HM6 X;  4CO7 A;  2XK5 A;  1NBF C;  2MBE A;  2N9P C;  1PQS A;  3W1S C;  2DEN B;  2ZPN A;  3RZW C;  2RGF A;  1G6J A;  1CMX B;  1OGW A;  4M8N A;  4GGQ A;  1WJ6 A;  4JLC A;  4GDK B;  5CHF A;  3UIO B;  2ZNV B;  3V6C B;  3V60 A;  4BBN C;  3L17 A;  2FCS A;  2LVP A;  1C1Y B;  4MEM A;  4NNJ B;  3X23 A;  1S1Q B;  3S2A A;  2FID A;  3TMP B;  2JVC A;  4WJQ A;  3RUI B;  4IM0 A;  4G50 A;  1Q0W B;  4NAW B;  2KD0 A;  3L13 A;  4TV3 A;  3UQA A;  2KTR A;  3APD A;  4WWO A;  1WXS A;  2GMI C;  2W9N A;  4WWN A;  2ZPY A;  3QAR A;  4G3X B;  4ZRI A;  3ZTD A;  3ZNH B;  4MDK E;  2IZV B;  2MQJ A;  3RUL A;  4EZK A;  2R2O A;  4ZRJ A;  2GBN A;  3B0A A;  3LDZ E;  2XK5 B;  2CS4 A;  1RLF A;  3EFU A;  3PRE A;  4PYU A;  3PHW B;  5JZE B;  4TQ1 A;  2LRU A;  2KDE B;  2AEH A;  1I35 A;  2MW5 A;  2DAJ A;  2EMT A;  5DPR A;  4DXA B;  3AXC A;  4XC2 A;  4BBN F;  2KFK A;  3ZDT A;  3M3J A;  3PHX B;  2KJR A;  4E71 A;  3JYU A;  2ZEQ A;  3JSV A;  1V6E A;  1V86 A;  4DDI D;  3NZU A;  2BYV E;  4URK A;  2D11 A;  3Q3J A;  3MJW A;  4LJP B;  5IAA C;  2KTR B;  4RM9 A;  2CR5 A;  2LGX A;  3DPD A;  2RSU A;  4IC7 B;  3L54 A;  1WGD A;  1KJT A;  4AP4 C;  4PS8 A;  3PTF C;  3CF6 E;  1GJZ A;  3HHM A;  1KM7 A;  1TTN A;  4G11 A;  3ZO5 B;  3QA8 A;  3H9D A;  3DBS A;  3RD2 A;  2UWQ A;  4HVB A;  4I6L B;  3RYT A;  4B9K A;  3VAW A;  4II2 B;  2C7M B;  4FJY A;  4EZL A;  2NPT A;  5LLI A;  3ALB A;  4A3P A;  4GN1 A;  4F1S A;  5LXI B;  1IPG A;  3PV1 A;  2KFK B;  2BWF A;  2LGY A;  5G55 A;  5J2R A;  4DHZ B;  3JSV B;  1V80 A;  3RZF A;  2IO1 B;  5E6N A;  5DPT A;  2KHW B;  4BFR A;  4EOY A;  1QZE A;  4IWP A;  4K7U A;  2ZJD A;  3DCG A;  5CHV C;  1WYW B;  3T9L A;  3VH3 B;  1P0R A;  1WI0 A;  2B3A A;  2HTH A;  1KOT A;  4EKU A;  2Z0E B;  1L7Y A;  4BVU C;  2LJ5 A;  4KZ0 A;  3SU8 X;  3R7R A;  4MGZ E;  3DVN U;  3ZNI D;  1ZKH A;  1ZGU B;  2WDT B;  4P7I A;  2NCN A;  3VQI A;  3ZW3 A;  4HXD A;  3T8M A;  2L76 A;  1JRU A;  4W9H A;  3VDZ A;  1WF9 A;  3UIN B;  3EC8 A;  3L16 A;  3OJ3 A;  2N1W A;  4MGI E;  2D2Q A;  2N7E A;  1WX7 A;  2NR2 A;  3JVZ X;  4KSK C;  1YIW A;  4KSL C;  2KC1 A;  3K9O B;  1OEY J;  1WRD B;  3ML9 A;  1WJU A;  3TL5 A;  3ZUN A;  3Q3F A;  2IYD B;  2KNB A;  4M0W B;  2VRR B;  4MH0 E;  2Z59 B;  2MCN B;  1OEY A;  2C7N B;  3APC A;  1E5W A;  3HIZ A;  1H4R A;  4AWJ A;  2C7H A;  2G45 B;  4FN2 A;  4W9C A;  3A9K A;  1LFD A;  4NQL B; 
#chains in the Genus database with same CATH topology
 3PRZ A;  2EMS A;  2ZZP B;  1WY8 A;  4B0E A;  3AI5 A;  3AE8 B;  2L0F A;  1WXQ A;  2WXI A;  4S0R A;  3PVL A;  3SDL C;  3K9P B;  3KQ4 A;  3U7D A;  3H7S A;  1DGJ A;  2JRI B;  1NI3 A;  3VTU A;  1SF0 A;  3DBH B;  2GBK A;  1DOX A;  2AQ3 B;  1JWA D;  3QWZ B;  4DK5 A;  3QCA A;  4ANV A;  2G3Q B;  4AJY B;  1C4P A;  3KUZ A;  2N9X A;  2V9H A;  5BO4 B;  4BKS A;  1ZDX A;  2BW2 A;  2DZI A;  3P4P B;  4LLG M;  2FCN A;  2LGD A;  4JL9 A;  3AEB B;  1XT9 B;  3ZKJ C;  1ESF A;  2D3A A;  3ZVV A;  4KIK B;  2LGS A;  3KW5 B;  3P4S B;  4ICV A;  1KF6 B;  3NVW A;  2L7R A;  4NAM A;  4AQ7 A;  3LXF A;  5BYS A;  1R4M I;  2KQS A;  2QEJ C;  2JWU A;  2HTM E;  2IY1 B;  1Y8R C;  4LNF A;  2NMQ A;  1CZP A;  2DZK A;  5LXH A;  1KLG D;  4ANX A;  3M95 A;  2A5U A;  1TZ1 A;  4NQK E;  2MJE A;  3GE3 C;  2KC2 A;  4M01 A;  4J3O D;  2N4F A;  3W1Y A;  2JZ3 B;  3V61 A;  1SXT A;  3HVZ A;  3PPA A;  2BKF A;  4FJZ A;  2NPT B;  1A5R A;  1NEK B;  3DDC B;  4JPS A;  2L8J A;  2L05 A;  1L0V B;  3Q3M C;  3NVZ A;  1WFY A;  4BKS D;  3L08 A;  5E6O A;  3A9J A;  4WWP A;  1UBQ A;  4KGR A;  3LB8 C;  3H7P B;  3FIL A;  1TY2 A;  2Y5P A;  2D3C A;  1HQR D;  5D3I B;  1ZW7 A;  4PT5 A;  1E6E B;  4WH4 A;  1FNW A;  4K7S A;  2WXM A;  4HWI B;  4IWO A;  4MSQ B;  1IBX A;  4L23 A;  4K81 A;  1QLB B;  1UF0 A;  1FXT B;  2KN5 A;  4D2K A;  3FAH A;  3VFK A;  2RDH A;  2RMM A;  2JWZ A;  2WDV B;  1NI2 A;  4ANW A;  4ZOH C;  3N1X C;  4ZRK A;  3TEW A;  4MJS A;  2MJ3 A;  4XE0 A;  5FR6 A;  4O1N A;  5D7G A;  2JT4 B;  4OVU A;  1J7C A;  2NBU A;  5AZH A;  4HLE A;  3NY5 A;  1D5X C;  3EHV A;  4RH6 A;  5C1Z A;  2K6D B;  1I4R A;  1MFW A;  1YD8 U;  2N7J A;  1N5X A;  4K1R B;  4OZB A;  4JWU C;  1WMH B;  3KUC B;  3OLM D;  1T0Y A;  2ZVO A;  4GDL A;  4HPP A;  3RNG C;  2DZM A;  3HRD D;  4FBJ B;  3P2B A;  2IGH A;  3EFC A;  1YX6 B;  1SE2 A;  2JXT A;  4YXD B;  1T0R C;  2W3R A;  5DPW A;  4E74 A;  2BQQ A;  4H2A A;  5GMV A;  5H92 C;  2JXX A;  2K3U A;  1L4D B;  4GXB A;  2JUO A;  4JE3 B;  2QIL A;  2R61 A;  3SD5 A;  1NEN B;  5J18 A;  3KYC D;  1TGZ B;  1JCK B;  2LEK A;  3CSF A;  3ZNZ B;  5JHB A;  4RCO A;  1JW9 D;  4C4V A;  4W9D A;  2K9X A;  3R66 C;  3DHG C;  2INP E;  4DBG A;  3ZLZ A;  1JML A;  1VJK A;  3QK0 A;  2KX3 A;  2MEK A;  2KN4 A;  2VZK B;  4XYC A;  3TSS A;  2L1A A;  3EGR A;  3RI7 C;  2WGS A;  3Q69 A;  4YSZ B;  4MSM B;  1QT9 A;  3SFE B;  2BGF A;  4PS7 A;  1WGY A;  4RF1 A;  4I6P A;  3BVM A;  4EFO A;  2WX0 A;  3CMM B;  1WJN A;  4HK2 A;  5CHW A;  2KZR A;  4KKI A;  4HDQ A;  4II3 B;  2BB5 A;  3LJ3 A;  4IWQ A;  4USA A;  4FA6 A;  4OW0 A;  3W5U B;  2K8H A;  1R4N I;  4WWM A;  3VUW A;  5AEK B;  2JU6 X;  1FMA D;  2MX2 A;  2WX1 A;  4IG7 B;  3W1S A;  2V1Y A;  3ENE A;  1STE A;  4X57 B;  3QQ8 B;  2WXP A;  2ZNV C;  4MM3 A;  4MGY E;  3MC9 A;  3NOB A;  2D3G A;  1C78 A;  3SFD B;  2EEL A;  4ZRP A;  2N9P C;  2DEN B;  1G6J A;  2RGF A;  2NTS A;  4JLC A;  2FBW B;  5CHF A;  1UGJ A;  2BBC A;  4ACF A;  2TSS A;  2FID A;  3TMP B;  1E0Z A;  5C2T B;  2JX5 A;  1L6V A;  4G50 A;  1Q0W B;  1V1P B;  3VR9 B;  3UQA A;  3APD A;  4WWO A;  1WXS A;  2GMI C;  4ZRI A;  3QAR A;  1WWT A;  1FD6 A;  2I2Y A;  2IGG A;  3RUL A;  3ZJT A;  2Q5W D;  2FE8 A;  2GBN A;  3B0A A;  2XK5 B;  1RLF A;  2MW5 A;  5DPR A;  3AE1 B;  4IOI E;  1YOV B;  3M3J A;  4E71 A;  1WSP A;  2D5G A;  3JYU A;  3JSV A;  1ZP0 B;  1TYG B;  4IC7 B;  3L54 A;  4N59 A;  3CF6 E;  3MP9 A;  4UDU C;  5FK9 C;  1XO3 A;  1TTN A;  3QA8 A;  5GXG B;  3DBS A;  2K5P A;  2UWQ A;  3RNE C;  1D4B A;  3C19 A;  2C7M B;  1I4Q A;  2NPT A;  3ALB A;  1R4M B;  2QC8 A;  2KFK B;  1AN8 A;  3I5J C;  1C9F A;  1PGX A;  2BWF A;  5EE9 A;  3AED B;  1JWM D;  1ACC A;  4WAF A;  5E6N A;  5DPT A;  4BFR A;  3L4P A;  3DCG A;  5CHV C;  3T9L A;  1WYG A;  2B3A A;  1C4A A;  2JYE A;  5T8I A;  4B0M A;  1T5X D;  2V3P A;  2IND C;  4KZ0 A;  3BVG A;  3HUI A;  4C56 C;  3ZNI D;  4YT0 B;  4C7Z A;  2DBY A;  1TT5 B;  3T8M A;  5H8Y E;  1WF9 A;  4YTM B;  1ET6 A;  1FNU A;  2N9K A;  1V1O A;  4P6V F;  2D2Q A;  2N7E A;  4KSK C;  4KSL C;  2KC1 A;  3K9O B;  1OEY J;  3Q3F A;  2KNB A;  3TEY A;  3IT4 B;  3APC A;  3HIZ A;  1SBB B;  4M02 A;  4YTN B;  3P4Q B;  3A9K A;  3GOE A;  4FHK A;  4KV2 A;  3ZDM C;  2L0T A;  1F0Z A;  3CST A;  1WX9 A;  4GMV A;  1TIF A;  4OHJ A;  2OJW A;  1L0Y B;  3I9V 1;  4JIO U;  4KGT A;  1VLB A;  3C0R B;  2LI5 A;  1FPY A;  1FRR A;  3QIJ A;  5HG2 A;  3W9C B;  1N60 A;  2V3S A;  4IUM B;  3AM9 A;  1I42 A;  3RCZ A;  4ASW C;  1E8X A;  5G5H A;  3RNB C;  2REX A;  4WQO B;  4N58 A;  3Q14 C;  4C80 A;  2K22 A;  2X8X X;  2MRP A;  4IDI A;  4IM2 A;  2FUH B;  1K8R B;  4LNI A;  3H1U A;  4RM8 A;  2PLP A;  5I4D A;  2HDE A;  4RF0 A;  3V62 A;  2QDF A;  3NS8 A;  1JRO A;  4LNO A;  1N5W A;  2RPQ A;  2KVZ A;  3DBR B;  2KWU B;  2IBI B;  1YX5 B;  1EU3 A;  2AQ2 B;  1X1M A;  1H8C A;  3PO0 A;  1RFK A;  2KFJ A;  1EM7 A;  2AX5 A;  3AH7 A;  2ONQ A;  5TSS A;  2ON8 A;  3IG3 A;  2WQY B;  4ZHO A;  2J42 A;  1EWC A;  4LJO B;  3GS2 A;  2N1V A;  3B1L X;  2CJN A;  4ZRQ A;  4S17 A;  2KJH B;  1GUA B;  4GIV A;  2IO3 B;  4JX1 C;  3T3N A;  2PMV A;  2LZ6 A;  4ARI A;  2KX0 A;  4ITK A;  4US9 A;  1MG4 A;  2INC C;  3A1Q B;  2NBV B;  3CIR B;  5HKH A;  4EEW A;  1P7E A;  1FFU A;  4M8M A;  1S3S G;  4ZYS A;  2WXO A;  2DNF A;  4K7W A;  4AJW A;  4LNK A;  2WDQ B;  1ZXI A;  3BYT B;  3RMK C;  3TUO A;  3U52 E;  3VTW A;  2GRI A;  3NVY A;  2J53 A;  4A90 A;  1XCQ L;  1NYQ A;  4W9E A;  4WIP A;  3AB5 A;  1VD2 A;  4DHJ D;  2MP2 B;  2MSE D;  4F7Z A;  5JXV A;  1DOY A;  1UWM A;  2H89 B;  2MHJ A;  3AE7 B;  4HJK A;  4LDT B;  4WJN A;  1E8Z A;  1L0X B;  1WR6 E;  2KWD A;  3PZ8 A;  3L10 B;  2FUG 1;  1JWU D;  2C9W B;  3PRP B;  2VH1 A;  3WAM A;  3M62 B;  2OJR A;  4W9K A;  1OTR B;  1ZPS A;  2O2V A;  4GU2 A;  3VR8 B;  4LTU A;  2KLC A;  4MEL A;  4NJC A;  1BML C;  1SEB D;  2LD9 A;  4ARC A;  2LVO A;  2LAS A;  1WE7 A;  3VUX A;  3TJP A;  3PGE A;  1M4V A;  2DYO A;  2PVG C;  2KDM A;  1RWS A;  1DOI A;  4PYZ A;  2GBR A;  2GOW A;  2LMC A;  3NS1 A;  3GZN I;  2W3S A;  1F9J A;  3PT2 B;  4FLH A;  4ICU A;  1YJJ A;  2NBW B;  4K3C A;  2KQ4 X;  3QJZ A;  2BYE A;  4G0N B;  3ZRC A;  3Q8F A;  2JSV X;  2KWV B;  3R2T A;  2GLS A;  2LRW A;  2WXH A;  4XGA B;  1AYF A;  4XDD A;  2CHX A;  5EDS A;  3VH4 B;  2M0X A;  1D5Z C;  3KWV A;  2WXJ A;  1E7P B;  1TS4 A;  3QX1 A;  2CHW A;  3ECI A;  4WQM A;  4AS1 A;  1EF1 A;  1EO6 A;  1FCC C;  3VXW A;  3W2D A;  4BOZ B;  2KQ7 A;  2O6V B;  3IFW B;  5BMH A;  4BZA A;  1SJE D;  1WJ4 A;  1CJE A;  1T6B X;  1NDD A;  1E7U A;  3X0W A;  4TQ0 A;  1I7H A;  4BAX A;  1QF6 A;  3UIP B;  2WXQ A;  3AE3 B;  2NVU I;  5HHD G;  2YLM A;  1HXY D;  2BT6 A;  1E7V A;  1AW7 A;  1WGG A;  2QHO A;  3U8Z A;  2JZZ A;  1C77 A;  2BS4 B;  1UWX A;  4KDL B;  3SEB A;  3DVG X;  1QQR A;  2AWT A;  3DBL B;  3DQV A;  4ZDV A;  2PTL A;  1T0Q C;  2BWE S;  3R2I A;  3ZRF A;  1WM3 A;  1E90 A;  3VRA B;  4W9F A;  4GDK A;  5CTR C;  2BKR B;  2BS3 B;  4HJG E;  2WLB A;  2ZW0 A;  3NZ3 A;  1C79 A;  4HRO A;  1RRB A;  3DHI C;  2WXR A;  4YSY B;  4MGK E;  3Q8B A;  3EA6 A;  2KMA A;  4IKG A;  3AE4 B;  5AZG A;  3N1Y C;  1V9J A;  1LM8 B;  4WJP A;  4LK0 M;  2OOB B;  2HD5 B;  3BK2 A;  1PQS A;  3W1S C;  1L4Z B;  1OGW A;  3NVV A;  2ZNV B;  3L17 A;  1RM6 C;  2AQ1 B;  1XLO A;  2D3B A;  2FCS A;  4MEM A;  4NNJ B;  5IOI A;  4WJQ A;  3OWE B;  2M19 A;  1EWY C;  4NAW B;  2KD0 A;  2E6X A;  4TV3 A;  2KTR A;  4WWN A;  2SEB D;  3ZNH B;  4MDK E;  5AUK A;  1KH0 A;  2R2O A;  4ZRJ A;  4DXF A;  3PHW B;  2W82 A;  4OZA A;  2LRU A;  2AEH A;  2EKI A;  5G5G A;  2DAJ A;  4DXA B;  1V6E A;  4DDI D;  4HRS A;  4URK A;  3MJW A;  4LJP B;  4RM9 A;  2CR5 A;  2RSU A;  1WGD A;  4PS8 A;  2KYW A;  1KM7 A;  4G11 A;  3ZO5 B;  1VZ6 A;  1TKG A;  2PIA A;  2V3N A;  3H9D A;  1F2R C;  5BYQ A;  3RYT A;  3W5V B;  4B9K A;  4RNA A;  5LLI A;  3AE5 B;  1IPG A;  2KMM A;  1VDV A;  3IAS 1;  2LGY A;  5J2R A;  1K51 A;  3P63 A;  4REZ A;  4DHZ B;  3RZF A;  1R7S A;  2IO1 B;  4EOY A;  3DWM A;  4IWP A;  4K7U A;  2ZJD A;  3VH3 B;  1WI0 A;  2HTH A;  2UU7 A;  1TJE A;  3SU8 X;  4M0W A;  3R7R A;  4MGZ E;  1YJI A;  4MT5 A;  1TKY A;  1XCT L;  2KAJ A;  3E56 A;  2WDT B;  2NCN A;  3ZW3 A;  1JRU A;  4W9H A;  3UI3 A;  3V05 A;  4OVZ A;  3N1Z C;  1YQ4 B;  1WX7 A;  3B9J A;  1YIW A;  1WRD B;  3ML9 A;  3TL5 A;  3ZUN A;  2IYD B;  1HTQ A;  2VRR B;  5FR3 A;  2IPK D;  2BYT A;  2C7N B;  1E5W A;  4R3D A;  2C7H A;  4FN2 A;  4P7I A;  1LFD A;  5D3D A;  4XDC A;  3DHH C;  3AE2 B;  2KAN A;  1HTO A;  1MI0 A;  3ABV B;  3KH0 A;  3PZD A;  1VCB A;  3AEE B;  4NZL B;  4RGO S;  5EE0 A;  4NPN A;  1VR9 A;  3A4R A;  4N6E B;  4YL8 A;  3PLU A;  4J6I A;  1QOB A;  3KVF B;  4BKT A;  3H6N A;  1GPX A;  1SIJ A;  3PZ7 A;  3DBH I;  2PE9 A;  1WE6 A;  2DZJ A;  2K39 A;  4B95 A;  4AOF A;  2NS5 A;  2WHI A;  4KIK A;  3BYY B;  4K3B A;  3TBL D;  4TMA B;  3V3X A;  4KZC A;  3VVW B;  1WGR A;  2LFI A;  1LQB A;  2BYF A;  1F52 A;  2KAC A;  2BVC A;  2MH7 A;  2H88 B;  3SHQ A;  1I4P A;  1D3Z A;  3VRB B;  1U4A A;  3GZN B;  4ZYN A;  2MBQ A;  2HJ8 A;  2J0M A;  1FEH A;  1P98 A;  2G4S A;  2L3Z A;  3AMZ A;  1L5P A;  2CU1 A;  2JQR B;  2J0J A;  5DPS A;  1UBI A;  2GI9 A;  3TEZ A;  3MTN B;  3JW0 X;  2WP9 B;  1YJ1 A;  2K25 A;  1NVI D;  1V5T A;  4FUL A;  3ZTC A;  3NHE B;  1WXV A;  1EUV B;  2WU2 B;  5C3J B;  1VZ8 A;  3J9C A;  4IW0 A;  3OAW A;  3N32 A;  4FHJ A;  1CK1 A;  4KVG B;  3UF8 A;  1F2R I;  1L6U A;  1RYJ A;  3ZYY X;  3H7P A;  3B2F A;  2PVO D;  4DDG D;  2LJI A;  2M0A A;  5DCN A;  1HZ5 A;  3TEX A;  4QAY A;  1UNS A;  1XXG A;  4ZHP A;  3AEG B;  1L2N A;  1SGH A;  2DHZ A;  2BF8 B;  1KTK A;  1XLN A;  2RD0 A;  2MBH A;  3MHS D;  5E6J A;  1FRD A;  2CKH B;  3ZIM A;  4P16 A;  5MPO A;  1RAX A;  5BYR A;  1HA5 A;  1Y56 A;  5D94 A;  1ET9 A;  5D6J B;  4B6W A;  1IGC A;  4LNN A;  1SIF A;  2YVC A;  1TZO A;  2I38 A;  3WAP A;  4FXC A;  2LXA A;  3U4E G;  1N6Z A;  1OQQ A;  3UQB A;  1P1A A;  2AYO B;  1A70 A;  4W9G A;  3WAN A;  1IP9 A;  2N9L A;  1CQV A;  4RGM A;  3RT3 B;  4KKJ A;  3MFG A;  1F1H A;  4I6N B;  3I3T B;  3A9J B;  4YTP B;  3UGB B;  3RFZ B;  1WMH A;  1N62 A;  3NZS A;  1V8C A;  3A33 B;  3FIL B;  3O13 A;  3KLS X;  4RMA A;  3VUY A;  4YWG G;  4KDI C;  1MJD A;  5JH5 C;  4US8 A;  2C5L C;  2M1M A;  3R7Q A;  4HKQ A;  2M17 A;  3WAO A;  1P3Q U;  5L95 C;  2FCQ A;  2C60 A;  3Q3N C;  1OFF A;  3DOW A;  1IBX B;  1K53 A;  2IO0 B;  4CYE A;  4TUU A;  4BKG A;  1BT0 A;  2K8C A;  1HE8 A;  4IM3 A;  3SR6 A;  2YEP F;  2BPS A;  5EE3 A;  3C8Y A;  1B1Z A;  2IJ0 A;  4MJS B;  3L0W B;  1GNU A;  1UGM A;  4XX5 A;  1HZ6 A;  5IA7 A;  1GAQ B;  2L83 A;  1YNT E;  4NJ6 A;  1TS2 A;  3AE9 B;  1D5M C;  4NJ7 A;  3U2S C;  1MHX A;  2UYZ B;  5BMI A;  3VTV A;  1MVK A;  4KX6 B;  2KO3 A;  3EEC A;  1Z2M A;  2PEA A;  4GOC A;  3AU4 A;  2FNJ B;  1ENF A;  1WM2 A;  3DVG Y;  2MBO A;  2CU3 A;  5IP4 D;  2GBJ A;  4GDL B;  3BII D;  4BOS C;  4E3C A;  3N9Y C;  1VRA B;  2KTF A;  3NRZ A;  3B08 A;  1KLV A;  4WJO A;  1GB1 A;  3ZJU A;  1IYF A;  2LWP A;  4WUR A;  1UH6 A;  4TKN A;  5D2M B;  1Q1O A;  5J17 A;  1E10 A;  5L83 A;  4A20 A;  3PSE B;  3TIX A;  2IO2 B;  4W9I A;  2EKE C;  2ACZ B;  1WZ3 A;  2LVQ A;  1Q5W B;  3N3K B;  3AUL A;  3BK1 A;  2KT7 A;  3WCQ A;  4C4V B;  1N61 A;  2KOX A;  2K1F A;  3PRM B;  2V0G A;  2XBB C;  2ZCC A;  3ZJV A;  5G2N A;  3BZD B;  3P4R B;  2AL3 A;  2CJO A;  4HPM B;  2IGD A;  2MBB B;  1R4N B;  1J8C A;  2SAK A;  2K6Q A;  3NJT A;  2PJH A;  2N9E B;  2QCZ A;  1WXM A;  2MA9 B;  1PGA A;  1V1P A;  3A4S C;  1DYQ A;  2KLG A;  2VZK D;  1EU4 A;  2LHD A;  2FAZ A;  4DWF A;  2V4L A;  1TBE A;  5AZF A;  3IHP C;  1GC6 A;  4HCN B;  1MG8 A;  2ZVN A;  4NY0 A;  1K50 A;  2DAF A;  5EE1 A;  4WAA A;  3HM6 X;  2XK5 A;  1NBF C;  3RZW C;  1CMX B;  2BTE A;  1WJ6 A;  4MH8 A;  3V6C B;  4BBN C;  3V60 A;  3IXS A;  1C1Y B;  3AN1 A;  3S2A A;  1YN3 A;  1LO5 D;  3RUI B;  4P1C C;  5HFY A;  3L13 A;  1IGD A;  2W9N A;  2ZPY A;  4G3X B;  3ZTD A;  4MM3 B;  2MQJ A;  2XNA C;  2V4I B;  4PYU A;  3PRE A;  2MJD A;  4Q2J A;  3RNF C;  2KDE B;  1JWS D;  2EMT A;  4BBN F;  2KFK A;  2KJR A;  1V86 A;  4C00 A;  2Y5C A;  3NZU A;  5FKA C;  2BYV E;  5IAA C;  1WGK A;  1T3Q A;  1HEZ E;  1KJT A;  1FFV A;  1GJZ A;  1C4C A;  1KRH A;  4RFB A;  1XLP A;  3U7Z A;  4HVB A;  4II2 B;  4FJY A;  5LXI B;  4F1S A;  4GN1 A;  1VZ7 A;  3PV1 A;  1BUI C;  3JSV B;  2KHW B;  1FCL A;  2B76 B;  3HVD A;  1TS5 A;  1KOT A;  4EKU A;  3FC4 A;  1L7Y A;  3Q8A A;  2LJ5 A;  3DVN U;  2M56 B;  3NG0 A;  1ZKH A;  2RDG A;  3P42 A;  2DWQ A;  3VQI A;  3VDZ A;  3UIN B;  4RGT A;  3EC8 A;  1AWD A;  1FNV A;  3L16 A;  4A6Q A;  2N1W A;  1MHH E;  2Y3A A;  1FIQ A;  2NR2 A;  3T3O A;  2MCN B;  3Q6B A;  4XWW A;  4P1B C;  4AWJ A;  1IUE A;  1FXI A;  2G45 B;  2G1E A;  4W9C A;  4NQL B;  1RFA A;  2KDF B;  2N7D A;  4EE2 A;  2PKO A;  3BVZ A;  1LGR A;  4EUT A;  2FIF A;  4DHZ E;  1YQB A;  2ICI A;  4CQN A;  3GB1 A;  1SJH D;  2ZCB A;  3WA0 A;  2J0K A;  4LCD E;  2PPH A;  1UD7 A;  1V2Y A;  1YN4 A;  1WRI A;  1P9D U;  2R2Q A;  2OHF A;  3RN9 C;  3IVF A;  4OZC A;  3GE8 C;  2L00 B;  4HPL B;  2JF5 A;  1M94 A;  2D07 B;  1TS3 A;  2I1J A;  3A9K B;  1QOF A;  1E8Y A;  2J4X A;  1QKZ A;  1GC7 A;  3QC8 B;  3V6E B;  2WXG A;  2RDB C;  3TCA A;  3QAQ A;  4A8X C;  1OQY A;  4FJV B;  2GBM A;  2KJ6 A;  2BS2 B;  4GB9 A;  2QIE B;  2LUM A;  3DBR I;  3R3M A;  4XZ4 A;  2KMC A;  2Z0D B;  5KHQ A;  2KKC A;  2DYB A;  3A1Q A;  3NUH B;  3ZNG C;  4HKZ E;  1QOG A;  2RR9 A;  4F8C B;  5C23 A;  2MWS B;  3HK0 A;  1ZDV A;  3Q3O C;  1KLU D;  3ML8 A;  1WIA A;  3AEC B;  3QHT A;  3BWU D;  2K0P A;  2LHE A;  2KDB A;  2LUE A;  5BMG A;  5HI1 A;  1QOA A;  1ZXH A;  4DHJ B;  1SE3 A;  2M8S A;  1ROE A;  3ZQ4 A;  2MP2 A;  1JRP A;  5CX3 A;  1MPE A;  3PLV A;  1PGB A;  1WGH A;  4PS3 A;  2N0S B;  2DX5 B;  1B9R A;  4N9F 4;  2W55 A;  1PFD A;  3ZGZ A;  3ONS A;  3KUD B;  5AUI A;  1WX8 A;  1P7F A;  1PYW D;  3U30 A;  2BB6 A;  5IO9 A;  3APF A;  1J7B A;  2WXF A;  3ZXR A;  3AV8 A;  5E6P A;  1TKE A;  2L32 A;  1WZ0 A;  3LYY A;  1XLQ A;  1ZOY B;  3BY4 B;  2FCM A;  1SE4 A;  2LGI A;  4M00 A;  4MAC A;  2JPH A;  2JY6 A;  3BIN A;  2PW9 A;  1V81 A;  1SB3 C;  4JGH B;  2INN E;  1WR1 A;  1J7A A;  1LXD A;  3ZXV A;  1J0G A;  1D6E C;  2X38 A;  2WXN A;  1XQQ A;  4HCP B;  2D10 A;  2JYT A;  5JHA A;  4XWT A;  4JQW C;  2WDR B;  2NTT A;  1YN5 A;  5IN7 A;  2QMT A;  1E8W A;  2G4D B;  2YEP B;  2A4Z A;  3OJ4 B;  1TY0 A;  2KDI A;  3M63 B;  2J7Q B;  1T0S C;  4EZJ A;  3P1M A;  2CHZ A;  3E9S A;  4LDT D;  1Z5S B;  1PDX A;  3I57 A;  1BXT A;  2DLB A;  2WYQ A;  3VHT C;  3AU5 A;  3O65 B;  2Z8L A;  1ISN A;  2JRH A;  2O2V B;  2O6V A;  3KYD D;  1EF5 A;  3AEA B;  1QIL A;  3IBE A;  2KK8 A;  2AL6 A;  3ETR A;  4GLS C;  2WXL A;  1OQR A;  1KFY B;  1WXA A;  4A9A A;  1SE9 A;  3DVN V;  1V5O A;  5TR5 A;  3MHZ A;  2I1K A;  3FKY A;  4GSW A;  4HDO A;  3URY A;  3RNA C;  2IY0 B;  1WH3 A;  3N30 A;  2WWZ A;  3HM3 A;  1C3T A;  1UUP A;  4PK1 A;  2GB1 A;  3H8H A;  4FAD A;  3RNC C;  3WAL A;  2PE6 B;  3GP7 A;  5KHO A;  2KVR A;  4W9J A;  2K8B A;  4KGS A;  1XD3 B;  2KWC A;  1UEL A;  2Y5B B;  4OVV A;  1J19 A;  2XEW A;  2E3T A;  3DBL I;  4CHK A;  3PS6 A;  2KXJ A;  1V49 A;  4C7Y A;  2HJ1 A;  1PUT A;  2LXC A;  2IDY A;  3MJ5 A;  2HE7 A;  1JWB D;  2O6V D;  1Q10 A;  1GG3 A;  3RPF C;  2RPV A;  4ANU A;  3D32 A;  2ASQ A;  3WIM A;  4RGN A;  2WXK A;  2M4N A;  2WS3 B;  4NAW A;  1UZX B;  2DYM A;  2MLB A;  4A55 A;  4A3O A;  5LNK 1;  1AAR A;  4AUQ C;  4W9L A;  4CO7 A;  2MBE A;  2ZPN A;  2G9H D;  2WU5 B;  1XEE A;  4M8N A;  4GGQ A;  4GDK B;  3UIO B;  2ZW1 A;  1K52 A;  2LVP A;  3X23 A;  1S1Q B;  4TSS A;  2JVC A;  4IM0 A;  1FO4 A;  1XF5 L;  1GB4 A;  1ZE3 D;  2VH2 A;  3CWI A;  4L2Y A;  4DXG A;  2IZV B;  3Q8E A;  4EZK A;  3N20 C;  3DWG C;  3EUB 2;  3LDZ E;  3EFU A;  2CS4 A;  1E9M A;  5JZE B;  4TQ1 A;  1I35 A;  2QJL A;  1C76 A;  1JAL A;  3AXC A;  3IT6 B;  4XC2 A;  3KWL A;  3ZDT A;  3PHX B;  2ZEQ A;  2J52 A;  1N63 A;  2D11 A;  3Q3J A;  1FXA A;  4YSX B;  1YMH E;  2KTR B;  1F77 A;  2LGX A;  2WNM A;  3DPD A;  1GOZ A;  4AP4 C;  3PTF C;  3HHM A;  1V97 A;  1FM0 D;  3RD2 A;  4I6L B;  3VAW A;  2XN9 C;  4EZL A;  3IAM 1;  2JZP A;  2QSD A;  5G55 A;  1V80 A;  3MC8 A;  4L1B A;  3OG5 A;  1QZE A;  3MC0 B;  1WYW B;  1P0R A;  3Q8C A;  4DQO C;  2Z0E B;  4BVU C;  1JQ4 A;  1NYR A;  5IKC M;  3B2G A;  3I63 C;  3AEF B;  1I4X A;  1ZGU B;  4HEA 1;  4HXD A;  2L76 A;  1I4G A;  1YQ3 B;  4JWS C;  1I4H A;  3OJ3 A;  4MGI E;  3JVZ X;  2OED A;  3R8B A;  1SSN A;  3Q2A C;  1WJU A;  4M0W B;  4MH0 E;  2Z59 B;  1OEY A;  1ZUD 2;  3AE6 B;  1H4R A;  2L52 A;  4A3P A;  2W54 A; 
#chains in the Genus database with same CATH homology
 1RFA A;  2KDF B;  2EMS A;  2N7D A;  3GOE A;  2ZZP B;  3PRZ A;  4EUT A;  1WY8 A;  2KAN A;  4FHK A;  2FIF A;  3AI5 A;  4KV2 A;  3ZDM C;  3KH0 A;  4DHZ E;  1YQB A;  2L0T A;  3PZD A;  1VCB A;  2L0F A;  4NPN A;  3CST A;  3A4R A;  3PVL A;  1WX9 A;  4YL8 A;  4GMV A;  3K9P B;  2ZCB A;  3SDL C;  3WA0 A;  2J0K A;  3PLU A;  4LCD E;  4J6I A;  2PPH A;  1UD7 A;  3U7D A;  1V2Y A;  4JIO U;  3C0R B;  3H7S A;  1P9D U;  2LI5 A;  2R2Q A;  3QIJ A;  3KVF B;  2JRI B;  2V3S A;  4BKT A;  3H6N A;  4IUM B;  1I42 A;  3IVF A;  3RCZ A;  3VTU A;  2L00 B;  3DBH I;  4HPL B;  2JF5 A;  2PE9 A;  2GBK A;  1M94 A;  1WE6 A;  2D07 B;  1E8X A;  2DZJ A;  2I1J A;  2K39 A;  2REX A;  4ASW C;  4AOF A;  2NS5 A;  4B95 A;  3QWZ B;  4KIK A;  4WQO B;  4DK5 A;  3QCA A;  4ANV A;  3A9K B;  1E8Y A;  2G3Q B;  3TBL D;  2MRP A;  1GC7 A;  3QC8 B;  3V6E B;  4KZC A;  3VVW B;  1WGR A;  4IM2 A;  4AJY B;  1LQB A;  2FUH B;  2BYF A;  2N9X A;  3KUZ A;  5BO4 B;  3SHQ A;  3TCA A;  4BKS A;  2DZI A;  3QAQ A;  1K8R B;  3H1U A;  1D3Z A;  1OQY A;  1U4A A;  4RM8 A;  4ZYN A;  2FCN A;  2LGD A;  2MBQ A;  2HJ8 A;  4JL9 A;  2J0M A;  1XT9 B;  4FJV B;  2GBM A;  3ZKJ C;  1P98 A;  2G4S A;  2KJ6 A;  3V62 A;  3ZVV A;  3NS8 A;  2L3Z A;  5DPS A;  2CU1 A;  2J0J A;  1UBI A;  4KIK B;  4GB9 A;  2RPQ A;  3DBR I;  3KW5 B;  3JW0 X;  3MTN B;  3R3M A;  4XZ4 A;  1YJ1 A;  2KMC A;  4ICV A;  2K25 A;  2L7R A;  2Z0D B;  1V5T A;  4FUL A;  5KHQ A;  2KKC A;  2KWU B;  3ZTC A;  3NHE B;  2DYB A;  2IBI B;  1YX5 B;  1WXV A;  1EUV B;  3A1Q A;  1R4M I;  2KQS A;  1X1M A;  3ZNG C;  1H8C A;  2KFJ A;  2IY1 B;  1Y8R C;  2RR9 A;  4F8C B;  3IG3 A;  4IW0 A;  2DZK A;  5LXH A;  3OAW A;  5C23 A;  2MWS B;  3N32 A;  3HK0 A;  4FHJ A;  4KVG B;  4LJO B;  4ANX A;  3UF8 A;  2N1V A;  3M95 A;  1WIA A;  2A5U A;  3B1L X;  3ML8 A;  1TZ1 A;  4NQK E;  2KJH B;  3QHT A;  1GUA B;  4GIV A;  2KC2 A;  2IO3 B;  3H7P A;  4DDG D;  2N4F A;  3W1Y A;  2JZ3 B;  2KDB A;  3V61 A;  2LUE A;  2LZ6 A;  5DCN A;  2KX0 A;  3PPA A;  4DHJ B;  2M8S A;  2BKF A;  1L2N A;  3A1Q B;  1SGH A;  4FJZ A;  2NPT B;  2DHZ A;  2NBV B;  1A5R A;  2BF8 B;  2RD0 A;  2MP2 A;  2MBH A;  3MHS D;  5CX3 A;  2CKH B;  5HKH A;  3DDC B;  3ZIM A;  2L8J A;  4EEW A;  3PLV A;  1RAX A;  2L05 A;  1WGH A;  4PS3 A;  4M8M A;  2DX5 B;  1S3S G;  1WFY A;  4N9F 4;  5D94 A;  3L08 A;  4BKS D;  5E6O A;  3ONS A;  3A9J A;  5D6J B;  3KUD B;  4WWP A;  1UBQ A;  4K7W A;  4B6W A;  1WX8 A;  4AJW A;  3H7P B;  1SIF A;  3U30 A;  3APF A;  2YVC A;  5E6P A;  3WAP A;  3VTW A;  1ZW7 A;  2LXA A;  1WZ0 A;  3UQB A;  4W9E A;  3BY4 B;  1P1A A;  2AYO B;  4W9G A;  2FCM A;  1VD2 A;  2JPH A;  3WAN A;  2JY6 A;  4DHJ D;  3BIN A;  1IP9 A;  4K7S A;  2MP2 B;  2MSE D;  1V81 A;  3RT3 B;  4HWI B;  4F7Z A;  4HJK A;  4JGH B;  4IWO A;  4LDT B;  4MSQ B;  4WJN A;  1E8Z A;  4K81 A;  1WR1 A;  1FXT B;  1WR6 E;  2KN5 A;  1LXD A;  3L10 B;  4I6N B;  3I3T B;  3A9J B;  3VFK A;  3UGB B;  1WMH A;  3NZS A;  1J0G A;  2C9W B;  3PRP B;  2JWZ A;  3A33 B;  1NI2 A;  4ANW A;  3WAM A;  3M62 B;  4RMA A;  4ZRK A;  3VUY A;  2OJR A;  4W9K A;  1OTR B;  4GU2 A;  2O2V A;  4MJS A;  2KLC A;  4KDI C;  4MEL A;  5FR6 A;  1XQQ A;  4HCP B;  5D7G A;  2D10 A;  2JT4 B;  4OVU A;  4HLE A;  2NBU A;  5AZH A;  2C5L C;  2LD9 A;  2M1M A;  3R7Q A;  5JH5 C;  2M17 A;  3WAO A;  4JQW C;  3NY5 A;  2LVO A;  2LAS A;  1WE7 A;  1P3Q U;  5L95 C;  2FCQ A;  3VUX A;  2C60 A;  3EHV A;  1E8W A;  3TJP A;  2G4D B;  3PGE A;  2A4Z A;  2DYO A;  3OJ4 B;  5C1Z A;  3DOW A;  2KDI A;  3M63 B;  2IO0 B;  2J7Q B;  4CYE A;  2K6D B;  4EZJ A;  1YD8 U;  4K1R B;  4TUU A;  2CHZ A;  4PYZ A;  1BT0 A;  2K8C A;  1HE8 A;  4LDT D;  2GBR A;  4IM3 A;  4BKG A;  5JHA A;  2GOW A;  1Z5S B;  1WMH B;  3GZN I;  3KUC B;  1F9J A;  3OLM D;  3PT2 B;  1T0Y A;  2WYQ A;  2BPS A;  4FLH A;  4ICU A;  3VHT C;  3AU5 A;  2NBW B;  3O65 B;  2ZVO A;  1ISN A;  2JRH A;  2O2V B;  4GDL A;  3QJZ A;  4MJS B;  3L0W B;  1GNU A;  1UGM A;  2BYE A;  4G0N B;  4XX5 A;  3ZRC A;  2O6V A;  2DZM A;  3KYD D;  5IA7 A;  2KWV B;  1EF5 A;  4FBJ B;  3P2B A;  3IBE A;  2KK8 A;  2AL6 A;  1YX6 B;  2LRW A;  4NJ6 A;  5DPW A;  4E74 A;  4NJ7 A;  2CHX A;  5EDS A;  5GMV A;  2UYZ B;  3VH4 B;  3VTV A;  1WXA A;  2M0X A;  2KO3 A;  2JXX A;  1SE9 A;  3EEC A;  1Z2M A;  2PEA A;  3DVN V;  1V5O A;  4GOC A;  2JUO A;  4GXB A;  3AU4 A;  5TR5 A;  2I1K A;  2FNJ B;  3QX1 A;  4GSW A;  4HDO A;  3SD5 A;  2CHW A;  1WM2 A;  3DVG Y;  2MBO A;  3ECI A;  1TGZ B;  3KYC D;  5J18 A;  1EF1 A;  1EO6 A;  2IY0 B;  3VXW A;  3CSF A;  1WH3 A;  2GBJ A;  3ZNZ B;  5JHB A;  3N30 A;  4BOZ B;  4GDL B;  2WWZ A;  3HM3 A;  4W9D A;  1C3T A;  2KQ7 A;  4BOS C;  2O6V B;  3IFW B;  4E3C A;  4FAD A;  2KTF A;  1WJ4 A;  3R66 C;  3B08 A;  3WAL A;  2PE6 B;  4DBG A;  1KLV A;  4WJO A;  3ZLZ A;  1NDD A;  1E7U A;  3QK0 A;  5KHO A;  3X0W A;  2KVR A;  1IYF A;  4W9J A;  4TQ0 A;  2LWP A;  3UIP B;  2KX3 A;  2K8B A;  1UH6 A;  4TKN A;  2NVU I;  5D2M B;  1Q1O A;  1XD3 B;  5J17 A;  2KWC A;  2YLM A;  1E7V A;  5L83 A;  1UEL A;  4A20 A;  1WGG A;  2QHO A;  3PSE B;  3U8Z A;  2Y5B B;  2JZZ A;  2IO2 B;  3TIX A;  4OVV A;  4W9I A;  4KDL B;  4MSM B;  2EKE C;  1J19 A;  2BGF A;  4PS7 A;  1WZ3 A;  2LVQ A;  1WGY A;  2XEW A;  3DVG X;  1Q5W B;  3DBL I;  3N3K B;  4CHK A;  3AUL A;  2AWT A;  3PS6 A;  3DQV A;  4ZDV A;  2KXJ A;  4I6P A;  1V49 A;  4EFO A;  2WX0 A;  2KOX A;  3CMM B;  1WJN A;  2BWE S;  2K1F A;  3ZRF A;  3PRM B;  4HK2 A;  5CHW A;  1WM3 A;  1E90 A;  2LXC A;  2XBB C;  2ZCC A;  2KZR A;  4HDQ A;  4II3 B;  3LJ3 A;  4IWQ A;  4W9F A;  2HE7 A;  5G2N A;  4FA6 A;  2O6V D;  4GDK A;  5CTR C;  1GG3 A;  2BKR B;  2AL3 A;  4ANU A;  2K8H A;  1R4N I;  3D32 A;  4HPM B;  2MBB B;  2ASQ A;  3VUW A;  1J8C A;  3WIM A;  5AEK B;  1RRB A;  2K6Q A;  2PJH A;  2MX2 A;  2M4N A;  2N9E B;  1WXM A;  2WX1 A;  4NAW A;  2MA9 B;  1UZX B;  3A4S C;  4IG7 B;  4MGK E;  3W1S A;  2KLG A;  2DYM A;  2V1Y A;  3ENE A;  2KMA A;  2FAZ A;  2MLB A;  2V4L A;  1TBE A;  3QQ8 B;  2ZNV C;  4X57 B;  5AZF A;  4DWF A;  5AZG A;  3IHP C;  1GC6 A;  4MM3 A;  4HCN B;  4MGY E;  4A3O A;  1MG8 A;  1V9J A;  2ZVN A;  3NOB A;  2D3G A;  1LM8 B;  4NY0 A;  2DAF A;  4WJP A;  1AAR A;  4AUQ C;  4W9L A;  2OOB B;  4WAA A;  2HD5 B;  3HM6 X;  4CO7 A;  2XK5 A;  1NBF C;  2MBE A;  2N9P C;  1PQS A;  3W1S C;  2DEN B;  2ZPN A;  3RZW C;  2RGF A;  1G6J A;  1CMX B;  1OGW A;  4M8N A;  4GGQ A;  1WJ6 A;  4JLC A;  4GDK B;  5CHF A;  3UIO B;  2ZNV B;  3V6C B;  3V60 A;  4BBN C;  3L17 A;  2FCS A;  2LVP A;  1C1Y B;  4MEM A;  4NNJ B;  3X23 A;  1S1Q B;  3S2A A;  2FID A;  3TMP B;  2JVC A;  4WJQ A;  3RUI B;  4IM0 A;  4G50 A;  1Q0W B;  4NAW B;  2KD0 A;  3L13 A;  4TV3 A;  3UQA A;  2KTR A;  3APD A;  4WWO A;  1WXS A;  2GMI C;  2W9N A;  4WWN A;  2ZPY A;  3QAR A;  4G3X B;  4ZRI A;  3ZTD A;  3ZNH B;  4MDK E;  2IZV B;  2MQJ A;  3RUL A;  4EZK A;  2R2O A;  4ZRJ A;  2GBN A;  3B0A A;  3LDZ E;  2XK5 B;  2CS4 A;  1RLF A;  3EFU A;  3PRE A;  4PYU A;  3PHW B;  5JZE B;  4TQ1 A;  2LRU A;  2KDE B;  2AEH A;  1I35 A;  2MW5 A;  2DAJ A;  2EMT A;  5DPR A;  4DXA B;  3AXC A;  4XC2 A;  4BBN F;  2KFK A;  3ZDT A;  3M3J A;  3PHX B;  2KJR A;  4E71 A;  3JYU A;  2ZEQ A;  3JSV A;  1V6E A;  1V86 A;  4DDI D;  3NZU A;  2BYV E;  4URK A;  2D11 A;  3Q3J A;  3MJW A;  4LJP B;  5IAA C;  2KTR B;  4RM9 A;  2CR5 A;  2LGX A;  3DPD A;  2RSU A;  4IC7 B;  3L54 A;  1WGD A;  1KJT A;  4AP4 C;  4PS8 A;  3PTF C;  3CF6 E;  1GJZ A;  3HHM A;  1KM7 A;  1TTN A;  4G11 A;  3ZO5 B;  3QA8 A;  3H9D A;  3DBS A;  3RD2 A;  2UWQ A;  4HVB A;  4I6L B;  3RYT A;  4B9K A;  3VAW A;  4II2 B;  2C7M B;  4FJY A;  4EZL A;  2NPT A;  5LLI A;  3ALB A;  4A3P A;  4GN1 A;  4F1S A;  5LXI B;  1IPG A;  3PV1 A;  2KFK B;  2BWF A;  2LGY A;  5G55 A;  5J2R A;  4DHZ B;  3JSV B;  1V80 A;  3RZF A;  2IO1 B;  5E6N A;  5DPT A;  2KHW B;  4BFR A;  4EOY A;  1QZE A;  4IWP A;  4K7U A;  2ZJD A;  3DCG A;  5CHV C;  1WYW B;  3T9L A;  3VH3 B;  1P0R A;  1WI0 A;  2B3A A;  2HTH A;  1KOT A;  4EKU A;  2Z0E B;  1L7Y A;  4BVU C;  2LJ5 A;  4KZ0 A;  3SU8 X;  3R7R A;  4MGZ E;  3DVN U;  3ZNI D;  1ZKH A;  1ZGU B;  2WDT B;  4P7I A;  2NCN A;  3VQI A;  3ZW3 A;  4HXD A;  3T8M A;  2L76 A;  1JRU A;  4W9H A;  3VDZ A;  1WF9 A;  3UIN B;  3EC8 A;  3L16 A;  3OJ3 A;  2N1W A;  4MGI E;  2D2Q A;  2N7E A;  1WX7 A;  2NR2 A;  3JVZ X;  4KSK C;  1YIW A;  4KSL C;  2KC1 A;  3K9O B;  1OEY J;  1WRD B;  3ML9 A;  1WJU A;  3TL5 A;  3ZUN A;  3Q3F A;  2IYD B;  2KNB A;  4M0W B;  2VRR B;  4MH0 E;  2Z59 B;  2MCN B;  1OEY A;  2C7N B;  3APC A;  1E5W A;  3HIZ A;  1H4R A;  4AWJ A;  2C7H A;  2G45 B;  4FN2 A;  4W9C A;  3A9K A;  1LFD A;  4NQL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...