3DBHI

Structural dissection of a gating mechanism preventing misactivation of ubiquitin by nedd8's e1 (appbp1-uba3arg190ala-nedd8ala72arg)
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
86
structure length
86
Chain Sequence
RRASVGSGGSMLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLRLRGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural dissection of a gating mechanism preventing misactivation of ubiquitin by NEDD8's E1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords NEDD8-activating enzyme E1 regulatory subunit
total genus 18
structure length 86
sequence length 86
chains with identical sequence J, K, L
ec nomenclature
pdb deposition date 2008-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3dbhI00
1F9JA 3KYDD 4BOZB 2CHWA 2JZ3B 2LD9A 3HK0A 3A9JB 4M0WB 3UF8A 2GMIC 2L8JA 3EC8A 2J7QB 3NY5A 4E3CA 1CMXB 2LGDA 2K8CA 3JSVA 4B9KA 5LXIB 1E7UA 2LRUA 4I6PA 4ZRKA 5LLIA 2EMTA 3SU8X 1IP9A 2BYEA 1C3TA 1P1AA 4WWPA 4GGQA 3W1SC 2KKCA 3OJ4B 3R7RA 3MTNB 3ZTCA 2KDIA 1I35A 2BYVE 4WAAA 2BKFA 5D6JB 3PRZA 5D7GA 3PGEA 4WJNA 5JH5C 3OAWA 3R66C 3WAOA 4EEWA 3ZUNA 1Q5WB 1R4MI 1GG3A 1JRUA 2I1KA 3L13A 4A3PA 2CU1A 4EZJA 2Y5BB 4PYZA 2AEHA 2L00B 4IUMB 3X0WA 3VQIA 2O6VB 4IWPA 1OGWA 2XEWA 4BFRA 4BOSC 2AYOB 2LASA 5CHVC 4GDLA 1WM2A 4WQOB 3VFKA 3A9KB 3PRMB 1UGMA 3VDZA 3ZRFA 1EF1A 2IO1B 1OQYA 2NBUA 1P3QU 2IBIB 5J18A 3AXCA 5JHBA 2ZZPB 3KYCD 3O65B 4W9JA 5AEKB 3TJPA 2FIDA 2HE7A 3KH0A 3P2BA 2MA9B 3V62A 2XK5A 1WH3A 4BKTA 4MJSB 3QCAA 1M94A 3L0WB 5DPWA 4MM3A 1WR1A 4HPLB 2D11A 3LJ3A 4DXAB 1U4AA 2O6VD 3MHSD 3IFWB 4XX5A 4G11A 4TQ0A 4FJYA 2YLMA 2DX5B 3V6EB 1K8RB 4MELA 1WM3A 3VXWA 2KK8A 1PQSA 4AJYB 4X57B 2JPHA 3KVFB 2K1FA 1TBEA 1WFYA 3TL5A 1WGRA 1E8ZA 1KJTA 3SD5A 4NAWB 3EECA 4NQLB 1E8XA 5AZHA 4NY0A 3PREA 3ENEA 2KANA 4OVVA 2ZNVC 2KQ7A 4DBGA 1BT0A 1ZKHA 2DZIA 3WIMA 5L95C 4LDTB 2KZRA 2NCNA 3L10B 4F1SA 5JHAA 4BBNC 1V86A 4GN1A 2LI5A 2PE6B 4DHZE 2KDBA 2AL3A 4W9DA 3N30A 3WANA 2KHWB 5E6PA 1YJ1A 1UELA 2N9EB 2BWFA 2KN5A 3QAQA 3KUDB 1EO6A 5C23A 2JF5A 4IC7B 3ML9A 4GDKB 2AL6A 3QWZB 1OEYA 2ZCBA 3IVFA 3PLUA 2BF8B 5BO4B 2ZEQA 2MWSB 4GMVA 3VUWA 2JY6A 2K6DB 3GOEA 4JLCA 2C7HA 2MBHA 4KZ0A 5JZEB 2DZJA 3H9DA 4I6LB 3D32A 2IO2B 4LDTD 2ZCCA 3VAWA 2FNJB 4KSLC 3PS6A 4IWOA 3VTWA 2KTRA 2A4ZA 2EKEC 4TV3A 4B95A 3L08A 1YX5B 2CS4A 4GU2A 4JQWC 2MCNB 3PZDA 2MQJA 2EMSA 3SDLC 2D10A 2L7RA 1SE9A 2GBRA 4FLHA 5KHOA 2KXJA 1V2YA 3M62B 5E6NA 1E7VA 3U30A 4FHKA 3PV1A 4NJ6A 1WR6E 2FCQA 1MG8A 4MGKE 2KC1A 3RD2A 2FIFA 2NBWB 3APDA 4KV2A 3ZDMC 3DPDA 2KWCA 1NBFC 4AUQC 3AULA 3PHXB 1GC6A 4DHJD 3IG3A 2QHOA 2FUHB 4IM0A 2NBVB 1RFAA 1YQBA 2REXA 2K8HA 3UQBA 2OOBB 1WJ4A 3H7PA 4NNJB 1WIAA 2YVCA 1NI2A 3JVZX 3CSTA 1GJZA 3CSFA 2J0KA 1E8WA 3PHWB 2N9PC 4KIKA 4PS7A 1YX6B 2UYZB 3H6NA 3ZLZA 2WX1A 4M8NA 3WAPA 2G3QB 4DHZB 3KUCB 2LVPA 4BKSD 5IA7A 2N9XA 2DAJA 3A33B 2KJ6A 2L05A 4DHJB 1KOTA 3N32A 2MLBA 3ZNGC 4FJVB 4ZDVA 4LJOB 1WX9A 3R7QA 2KFKB 2BPSA 1J0GA 4IM2A 2Z0EB 4II2B 4TKNA 2N7DA 1IPGA 3RT3B 4ZRJA 4MEMA 4CHKA 3UIOB 2CR5A 4MSMB 3TIXA 1WE7A 1Y8RC 4FADA 4KDIC 1WRDB 2KWUB 3A9JA 1WYWB 4W9HA 4HLEA 4E74A 2L3ZA 2MP2A 3SHQA 5LXHA 4DDGD 2LVOA 1HE8A 2A5UA 2C5LC 2I1JA 4FHJA 4IM3A 2PE9A 3DBLI 2GBNA 4KDLB 2LRWA 3ZVVA 5C1ZA 2MBQA 4K7WA 2MBOA 4WWNA 4DDID 1LXDA 4XZ4A 4NQKE 4TUUA 5J17A 4EUTA 2ZPYA 2HJ8A 3AI5A 3M63B 4J6IA 3V61A 5HKHA 2C7NB 5DPSA 2LZ6A 2ZPNA 5KHQA 1RAXA 2KMCA 4G0NB 2KDEB 4K1RB 1R4NI 1WJNA 1OTRB 2RGFA 4K7UA 2ZNVB 2KJHB 2DYMA 4GOCA 3VTUA 3A9KA 1WXSA 2LXCA 4I6NB 3W1YA 2DZMA 3I3TB 3IHPC 2XBBC 4DK5A 4W9GA 4HDQA 3ZIMA 2HD5B 3DCGA 4ANXA 3ZNHB 1XD3B 2O6VA 4WWOA 3ZO5B 1V9JA 2IO3B 2PJHA 3ECIA 3VTVA 1RRBA 1WY8A 1EF5A 2G4SA 3A1QB 4MH0E 3ZNID 4ANWA 5DPRA 1WZ3A 2M0XA 3PRPB 1A5RA 4KIKB 1L2NA 4TQ1A 2W9NA 3ZKJC 3ZTDA 2GBKA 2KFJA 2RPQA 1L7YA 3HHMA 4JL9A 2DHZA 1P9DU 1UH6A 1XT9B 2LGYA 2MP2B 3VUXA 4EZKA 3PTFC 2D2QA 3UINB 3RUIB 1IYFA 2M17A 1VCBA 4WJPA 4AJWA 4XC2A 3AU5A 2KC2A 3U8ZA 4EOYA 1ISNA 2KD0A 2KX0A 4ZYNA 3VVWB 2J0MA 2B3AA 1UD7A 3EFUA 3S2AA 4W9IA 3RULA 1RLFA 3T8MA 3TCAA 4URKA 5DCNA 3DQVA 1WGYA 1WZ0A 4RMAA 4B6WA 1T0YA 4OVUA 1NDDA 4BVUC 2JRIB 3U7DA 2J0JA 1WMHB 4PS8A 4AP4C 3EHVA 3APCA 4MJSA 4WJOA 2G45B 2N7EA 1S3SG 2WX0A 3M95A 3L54A 4PYUA 3PLVA 3PT2B 2ASQA 2CHXA 2NR2A 1GC7A 3OJ3A 1S1QB 3VH4B 1Z2MA 1TZ1A 1QZEA 2L0TA 3K9OB 1D3ZA 2KQSA 3VUYA 2O2VB 1XQQA 1YIWA 3QA8A 3ZNZB 1UBIA 2JZZA 2BKRB 4HJKA 1V5OA 2FCMA 2R2QA 3IBEA 4MDKE 1E90A 4K81A 2OJRA 2KTFA 3QQ8B 4GB9A 4NPNA 2MRPA 3PSEB 4IW0A 4F7ZA 2IY0B 3RZWC 4N9F4 2JWZA 4JGHB 2NVUI 3ALBA 3GZNI 1WXMA 1OEYJ 4GDKA 4G50A 4FULA 1G6JA 2FCSA 2N1VA 4FJZA 4AOFA 4PS3A 2LUEA 1Z5SB 4IG7B 4ICUA 2DYOA 4A20A 1P0RA 2KX3A 1C1YB 2DYBA 3A1QA 1WI0A 3KW5B 3Q3JA 2GBMA 1WJ6A 4G3XB 4ANVA 4BKGA 1V49A 1ZGUB 3BY4B 2KOXA 4CYEA 5TR5A 1X1MA 3CMMB 1GNUA 1VD2A 2V1YA 4YL8A 4A3OA 3V60A 3HM3A 4ICVA 4ZRIA 2JUOA 1V81A 4ANUA 4GDLB 5D2MB 2KVRA 4HWIB 3B1LX 2RD0A 4MGYE 5IAAC 4K7SA 2KLCA 2K8BA 5CTRC 2LVQA 2KJRA 1WXAA 2DENB 3MJWA 3ZDTA 4BKSA 1LFDA 4EZLA 2ZVNA 4RM9A 2GBJA 4HK2A 5E6OA 1ZW7A 1WX8A 2L0FA 3NZUA 3W1SA 2M8SA 4RM8A 2LWPA 3CF6E 2Z0DB 2XK5B 3RYTA 2K25A 3AU4A 4EKUA 2NPTB 5G55A 3QC8B 4HXDA 2FAZA 4BBNF 4CO7A 2M4NA 3PPAA 2BWES 3DBRI 3DVNU 3TMPB 3WAMA 3WALA 3ZRCA 3C0RB 4II3B 4MGIE 3DOWA 3X23A 4W9KA 4GXBA 1Q1OA 5DPTA 3QX1A 4MSQB 2R2OA 2ZVOA 5GMVA 2LGXA 1WGGA 3L16A 3QARA 4NAWA 5EDSA 3N3KB 5D94A 2WYQA 1TGZB 3ML8A 4HDOA 5AZFA 3QIJA 4P7IA 3HIZA 2K39A 1SGHA 2RSUA 2KWVB 2RR9A 3H7SA 2IY1B 4IWQA 2BYFA 4E71A 3DDCB 5CX3A 5G2NA 3WA0A 3K9PB 1WGDA 3NS8A 2KMAA 4HVBA 2LXAA 3BINA 2DZKA 3DVNV 3UGBB 2MBBB 4MGZE 1KM7A 2IYDB 2MBEA 2GOWA 1EUVB 1FXTB 1LM8B 1WF9A 2C7MB 2D3GA 2HTHA 3HM6X 5CHFA 1WX7A 4M8MA 2NS5A 2KDFB 3OLMD 3RZFA 3JYUA 2VRRB 4KSKC 4LJPB 2KNBA 1UZXB 4FBJB 3DVGX 4KZCA 2WWZA 2JXXA 1WGHA 4W9CA 3H7PB 3QK0A 4DWFA 3DBHI 1WE6A 2L76A 3JW0X 4ASWC 1YD8U 3JSVB 4WJQA 3DVGY 3LDZE 3VH3B 2CHZA 2FCNA 5L83A 3QHTA 4W9LA 3UIPB 2WDTB 5J2RA 3ONSA 3DBSA 4KVGB 3T9LA 2IZVB 2Z59B 4W9FA 2MSED 3R3MA 4F8CB 3H1UA 3APFA 3UQAA 3NHEB 3PVLA 1V5TA 2AWTA 1Q0WB 2UWQA 4HCPB 1E5WA 1P98A 2PPHA 2V3SA 1WJUA 1WXVA 2LJ5A 2N1WA 3A4RA 1UBQA 2DAFA 3M3JA 3B0AA 1J8CA 2JT4B 4NJ7A 2D07B 2PEAA 1E8YA 1SIFA 4HCNB 2BGFA 2C9WB 2IO0B 4EFOA 2KO3A 3QJZA 1H8CA 5FR6A 3VHTC 1TTNA 2K6QA 3Q3FA 1V6EA 2G4DB 2KTRB 4FA6A 4JIOU 2CKHB 2JRHA 1J19A 5CHWA 4FN2A 1GUAB 2M1MA 3ZW3A 1LQBA 1I42A 4GSWA 3V6CB 3TBLD 1AARA 2O2VA 1KLVA 4GIVA 2KLGA 2KFKA 4LCDE 2MW5A 2C60A 2MX2A 2NPTA 3NOBA 4W9EA 2ZJDA 3B08A 3L17A 3KUZA 2JVCA 4HPMB 3NZSA 1WMHA 1H4RA 5AZGA 2N4FA 2V4LA 4AWJA 1V80A 3A4SC 3RCZA
chains in the Genus database with same CATH superfamily
4B0MA 3KYDD 1YN5A 4XDCA 3B2FA 2GMIC 2K22A 2J7QB 1CMXB 2LGSA 2ONQA 3JSVA 3DBLB 4ZRKA 1AW7A 1P1AA 1M4VA 5HI1A 3OJ4B 3R7RA 1I4HA 2BYVE 2QMTA 3GP7A 3OAWA 1R4MI 1JRUA 3U7ZA 2L00B 3ZQ4A 2O6VB 2XEWA 1WRIA 4GDLA 4WQOB 3P4PB 3RN9C 3VDZA 2IO1B 2N9LA 2DLBA 3U52E 2AQ1B 3MC8A 4PT5A 3QCAA 1M94A 5DPWA 3IT6B 1SJHD 3MHSD 4TQ0A 2AQ2B 3DBRB 1MHXA 3V6EB 2DX5B 1WM3A 1KF6B 4LNKA 2BS4B 4X57B 2JPHA 1T5XD 4HKZE 2K1FA 4M00A 3TL5A 1KJTA 1RFKA 3SD5A 2JX5A 2PLPA 3EECA 1E8XA 4JWSC 3AE9B 5AZHA 4NY0A 3PREA 3ENEA 2KQ7A 2DZIA 3WIMA 5L95C 5JHAA 4BBNC 1V86A 2PE6B 2KDBA 3WANA 5E6PA 2Q5WD 2KN5A 3KUDB 4GDKB 2ZCBA 2BF8B 1D5MC 3R2TA 5BO4B 1PFDA 1CZPA 5JZEB 3HVDA 4I6LB 2ZCCA 4IWOA 1HEZE 2A4ZA 2EKEC 1WXQA 2CS4A 2MCNB 4JQWC 4JWUC 3RNCC 1SE9A 4FLHA 1VDVA 4FHKA 2L1AA 3PV1A 2YEPF 1UUPA 2KN4A 2NBWB 4KV2A 3TEXA 1NBFC 4AUQC 4RGNA 1GC6A 2IDYA 2VZKB 2WXKA 4IM0A 1FRDA 2NBVB 1YQBA 2REXA 4N58A 4LNNA 1NVID 1WJ4A 3GZNB 4NNJB 1STEA 2N9PC 2K3UA 2VH1A 3Q8AA 5AUKA 2G3QB 4DHZB 2LGIA 3A33B 2DAJA 4DHJB 2MLBA 1QLBB 4NZLB 1VZ7A 4UDUC 1MFWA 3T3OA 3TIXA 3R8BA 4FADA 4KDIC 4D2KA 1WYWB 3LXFA 4W9HA 2L3ZA 3SHQA 2LVOA 4N59A 1TS3A 2C5LC 4FHJA 3ABVB 2GBNA 2LRWA 2J53A 1TY2A 2QIEB 2YEPB 4NQKE 3ETRA 5HKHA 4YTNB 1TS5A 2C7NB 2PTLA 5DPSA 5KHQA 1RAXA 4G0NB 2KMCA 1WJNA 4C7YA 2ZNVB 2KJHB 2PW9A 2DZMA 3I3TB 3IHPC 2XBBC 3AE5B 4W9GA 5C2TB 3ZIMA 1WYGA 3ZO5B 4ZHPA 2PJHA 1V97A 1WZ3A 3ZTDA 2RPQA 3HHMA 4YXDB 1AWDA 1XT9B 4K3BA 1L6UA 4XC2A 4EOYA 1QT9A 2B3AA 2WDRB 2WU2B 1RLFA 5I4DA 1GPXA 3DQVA 4B6WA 4BVUC 3U7DA 1K51A 2UU7A 1FNUA 1OQRA 4WJOA 2WX0A 1SE4A 3PT2B 2ASQA 1E10A 2FE8A 2PVOD 3QA8A 2V0GA 4HJKA 4KKJA 2FCMA 3IBEA 1JCKB 2OJRA 3QQ8B 4GLSC 2IY0B 3RZWC 1FXAA 3I5JC 3ALBA 1WXMA 4REZA 2FCSA 4AOFA 4FJZA 4IG7B 1P0RA 2KX3A 3HUIA 4O1NA 3J9CA 3A1QA 4BKGA 1L5PA 4ANVA 2LHDA 1V49A 5TR5A 1X1MA 4LTUA 1F77A 4ZRIA 1E6EB 2BW2A 2KVRA 4LNOA 1I4RA 4MGYE 5D3DA 3AMZA 3ZDTA 3AE3B 1LFDA 3PZ8A 1ZW7A 4RM8A 3CF6E 2Z0DB 2K25A 3AU4A 4EKUA 1TIFA 3QC8B 2GLSA 4B0EA 3DBRI 4MGIE 5DPTA 4MSQB 5GMVA 4NAWA 3AEGB 3N3KB 4YTMB 2HDEA 1TGZB 4HDOA 4MH8A 1ZXHA 2RR9A 3H7SA 4E71A 3LYYA 1TKYA 3BK2A 1F2RI 3NS8A 1XLPA 3BINA 4L2YA 3UGBB 2MBBB 3NRZA 4HRSA 2MBEA 2W3SA 1LM8B 5CHFA 3RZFA 2KWDA 1TZOA 2VRRB 2L83A 4KSKC 2WXHA 3PO0A 3DVGX 3H7PB 4RGTA 4CQNA 1YD8U 1JWMD 3KWLA 4WJQA 3EGRA 1XEEA 4W9LA 3UIPB 1PUTA 3DBSA 2CJNA 4KVGB 2IZVB 4BZAA 4C4VB 2MSED 3HVZA 4LNFA 4F8CB 5LNK1 1FIQA 1VLBA 3PVLA 4HCPB 2V3SA 2X38A 1QILA 4MT5A 5FR6A 5BMGA 2K6QA 2SEBD 2W3RA 3BYTB 3BYYB 3DHHC 5CHWA 2M1MA 2WXLA 1LQBA 3AH7A 1AARA 4ARCA 3AE1B 4GIVA 4LCDE 2RDGA 3C19A 3B08A 2G1EA 3Q8FA 4HPMB 3NZSA 2D3CA 1V80A 1F9JA 4BOZB 2JZ3B 2LD9A 1GAQB 4M0WB 2L8JA 3EC8A 2RMMA 3NY5A 3H8HA 1ZP0B 2LGDA 1C4AA 1K53A 4B9KA 5LXIB 3RMKC 5LLIA 3AE7B 4TMAB 2J52A 1C3TA 4WWPA 4GGQA 3ZTCA 2WXOA 4ITKA 1ZPSA 3W9CB 3NVYA 2E3TA 3WAOA 4EEWA 2JYTA 1OQQA 1Q5WB 3NVWA 2CU1A 4IUMB 3IAS1 4IWPA 2AYOB 1IUEA 1WSPA 4RGMA 2WXFA 1FXIA 1UGMA 3ZRFA 4TSSA 1T3QA 4C00A 2JXTA 5FK9C 1XF5L 2XN9C 3TJPA 1YN4A 2HE7A 2J42A 3V62A 3O13A 2ON8A 4BKTA 2MHJA 4HPLB 2D11A 4XX5A 1ZXIA 3OWEB 4FJYA 1I4PA 4YSZB 1AN8A 3VXWA 1SXTA 4AQ7A 1WFYA 1WGRA 3V05A 2DBYA 5IOIA 4DBGA 1ZKHA 2KZRA 3L10B 1JROA 4GN1A 2LI5A 5EE3A 1FM0D 4DHZE 4W9DA 2RDBC 5BMHA 1YJ1A 1F1HA 3KQ4A 4NJCA 2AL6A 3QWZB 1OEYA 2E6XA 3IVFA 3PLUA 2BBCA 3SEBA 2QILA 2ZEQA 2L52A 2MWSB 4JLCA 2C7HA 2MBHA 1MG4A 5IP4D 3H9DA 3D32A 2IO2B 2FNJB 4KSLC 3VTWA 2KTRA 4TV3A 1SE3A 2L32A 1XO3A 3L08A 1I4GA 1ZE3D 2EMSA 3SDLC 3MFGA 2GBRA 1V2YA 4R3DA 4JPSA 3CWIA 5E6NA 2MJEA 4C7ZA 1MG8A 4MGKE 3RD2A 3EFCA 1FO4A 1QOAA 3W5VB 3ZDMC 3N9YC 3PHXB 4DHJD 1N61A 2QHOA 2FUHB 2JWUA 1RFAA 2K8HA 1N5WA 3BZDB 5HHDG 2MEKA 3CSFA 2J0KA 4PS7A 2UYZB 2X8XX 2WX1A 4YSYB 3WAPA 3FKYA 3KUCB 2LVPA 1LO5D 2N9XA 2KJ6A 4XE0A 1MJDA 3N32A 3ZNGC 3TEZA 3TEYA 4ZDVA 1WX9A 1RWSA 1HA5A 2BPSA 2BTEA 2Z0EB 4II2B 1XXGA 3NVZA 1IPGA 2WGSA 4HJGE 5D3IB 4CHKA 3OG5A 2CR5A 4MSMB 1N5XA 1Y8RC 1SF0A 2KWUB 3A9JA 3W2DA 4HLEA 4E74A 2MP2A 5LXHA 3VR8B 2BB6A 1D5XC 4IM3A 2I1JA 2MBQA 2MBOA 4WWNA 1DOYA 5IN7A 2HJ8A 2NMQA 3AI5A 3M63B 1QQRA 1FCCC 1J7AA 2KDEB 4K7UA 4A9AA 1YQ4B 1WXSA 2LXCA 3W1YA 2INNE 4HDQA 2WQYB 4ANXA 3ZNHB 1XD3B 2M19A 1V9JA 1RRBA 2WNMA 1EF5A 1FNWA 4MH0E 1IBXA 5DPRA 2M0XA 1FPYA 3ZKJC 2GBKA 2KFJA 1V1OA 2LGYA 4ZYSA 3VUXA 4EZKA 3PTFC 3RUIB 4XWWA 2M17A 4WJPA 1UWXA 2KC2A 3U8ZA 1ISNA 1Y56A 1QF6A 2J0MA 1JWAD 3T8MA 2VZKD 4URKA 2DWQA 1T0YA 1SEBD 2Y5PA 2INPE 5EE1A 1WMHB 4PS8A 1HQRD 4AP4C 2K5PA 3EHVA 3APCA 4PYUA 3PLVA 3KLSX 1Z2MA 5HFYA 4C4VA 1D3ZA 4OZBA 2MH7A 3VUYA 3LB8C 1ENFA 1VJKA 1YIWA 2PVGC 1UBIA 2JZZA 2BKRB 4MDKE 2MRPA 4F7ZA 4L23A 4USAA 1EWYC 4N9F4 2M0AA 4DXFA 2WXJA 4KGSA 1L4ZB 4GDKA 4FULA 2WU5B 4PS3A 2DYBA 4HPPA 3KW5B 2GBMA 4G3XB 2KOXA 3CMMB 1F0ZA 4ICVA 4ACFA 1V81A 4ANUA 3Q14C 5D2MB 1FFUA 2QDFA 1TS4A 2HTME 2LHEA 4K7SA 2K8BA 1BMLC 2LVQA 4RM9A 2GBJA 5E6OA 2L0FA 4US9A 1BUIC 2M8SA 2LWPA 3RYTA 3NS1A 4RGOS 3ZYYX 3NJTA 5TSSA 5G55A 1KRHA 2FAZA 2M4NA 3NVVA 3ZRCA 5BYSA 3DOWA 4W9KA 4GXBA 1Q1OA 4YTPB 4ZOHC 1F52A 2LGXA 1WGGA 4ZHOA 3QIJA 2RSUA 2KWVB 2QCZA 2IY1B 4A8XC 1PYWD 3AB5A 2KMAA 4HVBA 4A90A 3DVNV 2GB1A 3RNFC 4KKIA 1EUVB 1WX7A 2NS5A 3OLMD 1N60A 3TEWA 2G9HD 2KNBA 4FBJB 1XLNA 1EM7A 1JALA 3IT4B 1WGHA 4DWFA 1J7CA 2K9XA 3LDZE 2FCNA 1CQVA 2B76B 2WXMA 4W9FA 3Q2AC 4IOIE 1T0SC 3N1XC 2UWQA 4S0RA 4A6QA 4XGAB 1WJUA 2LJ5A 3M3JA 3B0AA 1FNVA 1L0XB 1DGJA 2IPKD 1E8YA 3RNGC 4HCNB 1H8CA 1V6EA 4JX1C 4FA6A 3P1MA 1J19A 4FN2A 3ZW3A 1I42A 4GSWA 3V6CB 4WIPA 1A70A 2KLGA 1HZ5A 2KFKA 1DOIA 2XNAC 1TY0A 2MX2A 2NPTA 3NOBA 2ZJDA 2OEDA 4M02A 4P1CC 3AE6B 2N4FA 3FAHA 1B1ZA 1L6VA 3BVGA 3WCQA 2ZW0A 3TUOA 3A9JB 4E3CA 2K0PA 4FXCA 1E7UA 2LRUA 4JE3B 2EMTA 3SU8X 1IP9A 2BYEA 4LNIA 3W1SC 2KKCA 3MTNB 2KDIA 3PRZA 4WJNA 5JH5C 3R66C 4MM3B 3ZUNA 3L13A 1GG3A 2JSVX 1UWMA 4EZJA 2Y5BB 3X0WA 2RDHA 3B2GA 1OGWA 4BOSC 1SB3C 2LASA 5CHVC 2JYEA 1QOGA 3VFKA 3A9KB 3PRMB 3VRAB 1ROEA 3AEDB 1P3QU 2IBIB 4PK1A 1VZ6A 3AXCA 5J18A 3HRDD 3O65B 2FIDA 3KH0A 3P2BA 2MA9B 1WH3A 4MJSB 1XCTL 3SR6A 3AM9A 4M01A 4MM3A 5EE0A 3BVZA 4DXAB 1U4AA 1ET6A 2I2YA 2YLMA 1K8RB 1T0RC 2KK8A 4AJYB 1TBEA 2KANA 1KTKA 4LDTB 2NCNA 1D4BA 3AE2B 2INCC 4S17A 1UELA 2N9EB 3QAQA 2JF5A 4IC7B 3ML9A 1IGCA 5BYRA 4BAXA 3VUWA 1ESFA 4GMVA 4YSXB 2Z8LA 3GOEA 3VAWA 3DWGC 1WWTA 3AEAB 1GB4A 4B95A 1YX5B 4GU2A 1VRAB 3PZDA 2D10A 5KHOA 2KXJA 3M62B 3N20C 2KAJA 1E7VA 4C80A 4US8A 3U30A 1NEKB 2FCQA 2AX5A 4XWTA 2KYWA 1FCLA 2KC1A 2D3BA 2FIFA 3BIID 3DPDA 1SSNA 3IG3A 4MACA 3V3XA 3ZXVA 2WXRA 5FKAC 3UQBA 1ZOYB 1WIAA 1NI2A 3JVZX 3CSTA 3DHIC 1GJZA 3Q8CA 1E8WA 5IA7A 1D6EC 2QSDA 5JXVA 3R7QA 4ARIA 1ACCA 2N7DA 4TKNA 3RT3B 4ZRJA 2QJLA 4MEMA 1NENB 3UIOB 3NZ3A 4RF0A 4DDGD 3AEBB 3DBLI 1J7BA 5EE9A 4K7WA 4DDID 4HKQA 1LXDA 1TYGB 4OHJA 4TUUA 5J17A 4WQMA 3V61A 2WXIA 3IAM1 2LZ6A 2GI9A 1EU4A 4IKGA 1YOVB 1R4NI 1OTRB 2RGFA 2DYMA 3VTUA 3A9KA 1JWBD 3P63A 4I6NB 2AQ3B 2JU6X 3EA6A 3DCGA 4WWOA 4KX6B 2IO3B 3E9SA 2G4SA 3Q3OC 4LLGM 1A5RA 1HZ6A 4TQ1A 4JL9A 1P9DU 1UH6A 2MP2B 3CIRB 3ZGZA 2D2QA 3UINB 1KLGD 1VCBA 2KD0A 4LK0M 1YJJA 2EELA 3S2AA 3EUB2 3RULA 3TCAA 5BMIA 2N7JA 1TKEA 1MHHE 3B9JA 4OVUA 2JRIB 3I63C 1I4QA 2CHXA 2NR2A 1GC7A 3VH4B 1TZ1A 1QZEA 2IGGA 3K9OB 2CJOA 2KQSA 3FC4A 1XQQA 3ZNZB 1KH0A 4ZRPA 2R2QA 1E90A 4K81A 4GB9A 4IW0A 1B9RA 2JWZA 3MJ5A 1YNTE 2WXNA 3Q8BA 1OEYJ 1UNSA 4XYCA 2QC8A 2LMCA 3UI3A 1Z5SB 1IBXB 1C1YB 3Q3JA 1WJ6A 2HJ1A 3Q69A 4AS1A 4RNAA 4CYEA 3IXSA 4QAYA 1BXTA 4YL8A 4RF1A 4A3OA 2MJ3A 1QKZA 4GDLB 5IAAC 5CTRC 2KJRA 3MJWA 4BKSA 2BVCA 2ZVNA 4HK2A 2D3AA 3ZXRA 1N62A 2V4IB 2BWES 3DVNU 3WAMA 3WALA 3C0RB 4II3B 3SFDB 3QX1A 2ZVOA 3L16A 4WAFA 5EDSA 2M56B 1HXYD 4A55A 5FR3A 3ML8A 5AZFA 2WP9B 4P7IA 3HIZA 2K39A 4IWQA 4IDIA 1FD6A 2VH2A 5G2NA 3WA0A 3GS2A 1K50A 2DZKA 1RYJA 2BS2B 1V8CA 1KM7A 2GOWA 5AEKB 2HTHA 2C7MB 3HM6X 4H2AA 1YJIA 1GB1A 2OJWA 3ZJUA 4LJPB 2PKOA 1UZXB 3U4EG 2WWZA 2JXXA 4ASWC 3AE8B 3JSVB 3DVGY 3VH3B 3NG0A 4DXGA 2WDTB 5J2RA 1KLUD 3T9LA 2WXPA 3R3MA 4RFBA 3UQAA 3NHEB 2PIAA 1Q0WB 2KMMA 4EE2A 2KT7A 2N1WA 1J8CA 1JWSD 4NJ7A 4EFOA 3AE4B 2KO3A 1UF0A 4ZRQA 3VHTC 3Q3FA 2G4DB 1GOZA 1PGAA 2KTRB 3E56A 4JIOU 2CKHB 2CU3A 1D5ZC 3U2SC 1PDXA 1GUAB 2LUMA 2WS3B 5H92C 2J4XA 3TBLD 1C77A 3SFEB 2TSSA 2Y3AA 1UGJA 3L17A 2JVCA 1WMHA 5AZGA 3RCZA 3DBHB 1JMLA 2CHWA 3HK0A 3UF8A 3RI7C 1P7EA 2K8CA 2ZW1A 4I6PA 1NYRA 1V1PB 4Q2JA 1FFVA 3AEEB 2WXQA 5IKCM 1I35A 2IGHA 5D6JB 4WAAA 2BKFA 2R61A 2DNFA 5D7GA 3PGEA 4DQOC 2I1KA 4A3PA 2WLBA 4PYZA 2LEKA 3Q3NC 2AEHA 3Q6BA 3VQIA 2INDC 1R4NB 3MP9A 4BFRA 1WM2A 1C4PA 1OFFA 1EF1A 1OQYA 2NBUA 3AN1A 5JHBA 2ZZPB 3KYCD 4W9JA 3GE8C 1C4CA 1MVKA 2XK5A 4NAMA 3ZJVA 4WH4A 3L0WB 1TKGA 1WR1A 4P16A 1E7PB 3LJ3A 3RNEC 2O6VD 3IFWB 3N1YC 1RM6C 4G11A 4MELA 1T6BX 1PQSA 3ZJTA 3VR9B 1JRPA 3KVFB 1E8ZA 4NAWB 4NQLB 2W54A 1FRRA 1JWUD 4OVVA 2ZNVC 1BT0A 4M0WA 4HROA 4F1SA 3VRBB 3L4PA 2AL3A 3N30A 2KHWB 1N63A 4YWGG 1AYFA 2BWFA 5C23A 1EO6A 1V1PA 2JY6A 2K6DB 2LJIA 4C56C 4KZ0A 2DZJA 2KVZA 1WGKA 4KGTA 4LDTD 1FEHA 3PS6A 1R7SA 2I38A 2N0SB 2W55A 4XDDA 2MQJA 2L7RA 1KFYB 1I7HA 4NJ6A 5MPOA 1WR6E 1C79A 2H88B 3APDA 2KWCA 1K52A 3AULA 1YN3A 3MC0B 2OOBB 1IGDA 2IGDA 3H7PA 2YVCA 5HG2A 4YT0B 1NYQA 1SBBB 4K3CA 3PHWB 2BS3B 4KIKA 1YX6B 3ZLZA 3H6NA 2JZPA 4M8NA 2WHIA 1XLQA 3P4SB 1HTQA 5G5GA 1T0QC 4BKSD 3P4QB 2L05A 1KOTA 2Y5CA 4FJVB 4LJOB 2KFKB 1J0GA 4IM2A 1EWCA 1P7FA 1SIJA 4P6VF 3GE3C 2NTSA 1WE7A 3FILA 4WURA 1WRDB 4OVZA 2V3PA 1ZUD2 3C8YA 1HE8A 4KDLB 1QOFA 2A5UA 2PE9A 3ZVVA 2BB5A 5C1ZA 4XZ4A 1VZ8A 4EUTA 2ZPYA 2BT6A 4J6IA 1TT5B 2ZPNA 1F2RC 1DOXA 4K1RB 5T8IA 4GOCA 3P4RB 4DK5A 3RFZB 2SAKA 2HD5B 2V3NA 2O6VA 2BQQA 3ECIA 3VTVA 1WY8A 3A1QB 3ZNID 4ANWA 3PRPB 1L2NA 3MHZA 4KIKB 2W9NA 1L7YA 3MC9A 1SJED 2GRIA 2DHZA 3AV8A 1L0YB 1E9MA 1ZDXA 1IYFA 2H89B 4AJWA 3BVMA 3AU5A 1FMAD 2KX0A 4ZYNA 3VVWB 5BYQA 3EFUA 1UD7A 4J3OD 4W9IA 1C76A 5DCNA 1WGYA 1WZ0A 4RMAA 5GXGB 1Q10A 1NDDA 2J0JA 3R2IA 1YQ3B 4MJSA 3BWUD 2G45B 2N7EA 1S3SG 3DWMA 3M95A 1MPEA 3L54A 1VR9A 5IO9A 3OJ3A 1S1QB 1NI3A 2L0TA 5G5HA 2O2VB 3FILB 3KWVA 1TJEA 1V5OA 2NTTA 3I9V1 3NUHB 1ZDVA 2KTFA 3T3NA 4NPNA 3PSEB 1SE2A 4JGHB 2NVUI 3GZNI 4RCOA 2WXGA 4G50A 1G6JA 2N1VA 2LUEA 1PGXA 4ICUA 3W5UB 2DYOA 4A20A 3I57A 1I4XA 1WI0A 1C78A 1ZGUB 3BY4B 2ICIA 1GNUA 1VD2A 2V1YA 3V60A 3HM3A 2JUOA 1L0VB 1HTOA 2QEJC 4HWIB 2WDQB 2RD0A 3B1LX 3Q8EA 1YMHE 4KGRA 2IJ0A 2KLCA 1WXAA 2DENB 2MJDA 3URYA 4EZLA 2OHFA 2V9HA 1WX8A 4WWMA 1MI0A 3NZUA 3W1SA 4OW0A 2KQ4X 2XK5B 2FUG1 2NPTB 4CO7A 4HXDA 4BBNF 3PPAA 3TMPB 4N6EB 2BYTA 3X23A 4OZAA 2R2OA 3QARA 4L1BA 5D94A 2WYQA 1DYQA 1SGHA 2EKIA 2BYFA 1ET9A 3DDCB 5CX3A 3K9PB 1WGDA 2LFIA 2LXAA 1PGBA 2W82A 3DHGC 4MGZE 3RPFC 1TS2A 2IYDB 1FXTB 2D3GA 1WF9A 1CJEA 4M8MA 2KDFB 1E0ZA 3JYUA 1JW9D 1JQ4A 4KZCA 4W9CA 2D5GA 3QK0A 3DBHI 1WE6A 2L76A 3N1ZC 3JW0X 4RH6A 1LGRA 5AUIA 2JQRB 2CHZA 5L83A 5C3JB 3QHTA 3AEFB 3BK1A 4P1BC 1EU3A 3ONSA 2Z59B 2PMVA 3H1UA 3Q3MC 2RPVA 3APFA 1V5TA 2AWTA 2N9KA 1E5WA 1P98A 4OZCA 2PPHA 1XCQL 3A4RA 1WXVA 1CK1A 1L4DB 1QOBA 1UBQA 2DAFA 5E6JA 2JT4B 2D07B 2PEAA 2WDVB 1SIFA 2BGFA 2C9WB 2IO0B 3RNAC 3QJZA 1TTNA 3GB1A 1R4MB 2JRHA 3RNBC 1C9FA 3P42A 2KDMA 2O2VA 2FBWB 1KLVA 2ACZB 1XLOA 2MW5A 2C60A 4HEA1 4W9EA 3TSSA 3PZ7A 5H8YE 3KUZA 1H4RA 1N6ZA 2V4LA 4AWJA 2KACA 3A4SC 3AECB
chains in the Genus database with same CATH topology
1F9JA 3KYDD 4BOZB 2CHWA 2JZ3B 2LD9A 3HK0A 3A9JB 4M0WB 3UF8A 2GMIC 2L8JA 3EC8A 2J7QB 3NY5A 4E3CA 1CMXB 2LGDA 2K8CA 3JSVA 4B9KA 5LXIB 1E7UA 2LRUA 4I6PA 4ZRKA 5LLIA 2EMTA 3SU8X 1IP9A 2BYEA 1C3TA 1P1AA 4WWPA 4GGQA 3W1SC 2KKCA 3OJ4B 3R7RA 3MTNB 3ZTCA 2KDIA 1I35A 2BYVE 4WAAA 2BKFA 5D6JB 3PRZA 5D7GA 3PGEA 4WJNA 5JH5C 3OAWA 3R66C 3WAOA 4EEWA 3ZUNA 1Q5WB 1R4MI 1GG3A 1JRUA 2I1KA 3L13A 4A3PA 2CU1A 4EZJA 2Y5BB 4PYZA 2AEHA 2L00B 4IUMB 3X0WA 3VQIA 2O6VB 4IWPA 1OGWA 2XEWA 4BFRA 4BOSC 2AYOB 2LASA 5CHVC 4GDLA 1WM2A 4WQOB 3VFKA 3A9KB 3PRMB 1UGMA 3VDZA 3ZRFA 1EF1A 2IO1B 1OQYA 2NBUA 1P3QU 2IBIB 5J18A 3AXCA 5JHBA 2ZZPB 3KYCD 3O65B 4W9JA 5AEKB 3TJPA 2FIDA 2HE7A 3KH0A 3P2BA 2MA9B 3V62A 2XK5A 1WH3A 4BKTA 4MJSB 3QCAA 1M94A 3L0WB 5DPWA 4MM3A 1WR1A 4HPLB 2D11A 3LJ3A 4DXAB 1U4AA 2O6VD 3MHSD 3IFWB 4XX5A 4G11A 4TQ0A 4FJYA 2YLMA 2DX5B 3V6EB 1K8RB 4MELA 1WM3A 3VXWA 2KK8A 1PQSA 4AJYB 4X57B 2JPHA 3KVFB 2K1FA 1TBEA 1WFYA 3TL5A 1WGRA 1E8ZA 1KJTA 3SD5A 4NAWB 3EECA 4NQLB 1E8XA 5AZHA 4NY0A 3PREA 3ENEA 2KANA 4OVVA 2ZNVC 2KQ7A 4DBGA 1BT0A 1ZKHA 2DZIA 3WIMA 5L95C 4LDTB 2KZRA 2NCNA 3L10B 4F1SA 5JHAA 4BBNC 1V86A 4GN1A 2LI5A 2PE6B 4DHZE 2KDBA 2AL3A 4W9DA 3N30A 3WANA 2KHWB 5E6PA 1YJ1A 1UELA 2N9EB 2BWFA 2KN5A 3QAQA 3KUDB 1EO6A 5C23A 2JF5A 4IC7B 3ML9A 4GDKB 2AL6A 3QWZB 1OEYA 2ZCBA 3IVFA 3PLUA 2BF8B 5BO4B 2ZEQA 2MWSB 4GMVA 3VUWA 2JY6A 2K6DB 3GOEA 4JLCA 2C7HA 2MBHA 4KZ0A 5JZEB 2DZJA 3H9DA 4I6LB 3D32A 2IO2B 4LDTD 2ZCCA 3VAWA 2FNJB 4KSLC 3PS6A 4IWOA 3VTWA 2KTRA 2A4ZA 2EKEC 4TV3A 4B95A 3L08A 1YX5B 2CS4A 4GU2A 4JQWC 2MCNB 3PZDA 2MQJA 2EMSA 3SDLC 2D10A 2L7RA 1SE9A 2GBRA 4FLHA 5KHOA 2KXJA 1V2YA 3M62B 5E6NA 1E7VA 3U30A 4FHKA 3PV1A 4NJ6A 1WR6E 2FCQA 1MG8A 4MGKE 2KC1A 3RD2A 2FIFA 2NBWB 3APDA 4KV2A 3ZDMC 3DPDA 2KWCA 1NBFC 4AUQC 3AULA 3PHXB 1GC6A 4DHJD 3IG3A 2QHOA 2FUHB 4IM0A 2NBVB 1RFAA 1YQBA 2REXA 2K8HA 3UQBA 2OOBB 1WJ4A 3H7PA 4NNJB 1WIAA 2YVCA 1NI2A 3JVZX 3CSTA 1GJZA 3CSFA 2J0KA 1E8WA 3PHWB 2N9PC 4KIKA 4PS7A 1YX6B 2UYZB 3H6NA 3ZLZA 2WX1A 4M8NA 3WAPA 2G3QB 4DHZB 3KUCB 2LVPA 4BKSD 5IA7A 2N9XA 2DAJA 3A33B 2KJ6A 2L05A 4DHJB 1KOTA 3N32A 2MLBA 3ZNGC 4FJVB 4ZDVA 4LJOB 1WX9A 3R7QA 2KFKB 2BPSA 1J0GA 4IM2A 2Z0EB 4II2B 4TKNA 2N7DA 1IPGA 3RT3B 4ZRJA 4MEMA 4CHKA 3UIOB 2CR5A 4MSMB 3TIXA 1WE7A 1Y8RC 4FADA 4KDIC 1WRDB 2KWUB 3A9JA 1WYWB 4W9HA 4HLEA 4E74A 2L3ZA 2MP2A 3SHQA 5LXHA 4DDGD 2LVOA 1HE8A 2A5UA 2C5LC 2I1JA 4FHJA 4IM3A 2PE9A 3DBLI 2GBNA 4KDLB 2LRWA 3ZVVA 5C1ZA 2MBQA 4K7WA 2MBOA 4WWNA 4DDID 1LXDA 4XZ4A 4NQKE 4TUUA 5J17A 4EUTA 2ZPYA 2HJ8A 3AI5A 3M63B 4J6IA 3V61A 5HKHA 2C7NB 5DPSA 2LZ6A 2ZPNA 5KHQA 1RAXA 2KMCA 4G0NB 2KDEB 4K1RB 1R4NI 1WJNA 1OTRB 2RGFA 4K7UA 2ZNVB 2KJHB 2DYMA 4GOCA 3VTUA 3A9KA 1WXSA 2LXCA 4I6NB 3W1YA 2DZMA 3I3TB 3IHPC 2XBBC 4DK5A 4W9GA 4HDQA 3ZIMA 2HD5B 3DCGA 4ANXA 3ZNHB 1XD3B 2O6VA 4WWOA 3ZO5B 1V9JA 2IO3B 2PJHA 3ECIA 3VTVA 1RRBA 1WY8A 1EF5A 2G4SA 3A1QB 4MH0E 3ZNID 4ANWA 5DPRA 1WZ3A 2M0XA 3PRPB 1A5RA 4KIKB 1L2NA 4TQ1A 2W9NA 3ZKJC 3ZTDA 2GBKA 2KFJA 2RPQA 1L7YA 3HHMA 4JL9A 2DHZA 1P9DU 1UH6A 1XT9B 2LGYA 2MP2B 3VUXA 4EZKA 3PTFC 2D2QA 3UINB 3RUIB 1IYFA 2M17A 1VCBA 4WJPA 4AJWA 4XC2A 3AU5A 2KC2A 3U8ZA 4EOYA 1ISNA 2KD0A 2KX0A 4ZYNA 3VVWB 2J0MA 2B3AA 1UD7A 3EFUA 3S2AA 4W9IA 3RULA 1RLFA 3T8MA 3TCAA 4URKA 5DCNA 3DQVA 1WGYA 1WZ0A 4RMAA 4B6WA 1T0YA 4OVUA 1NDDA 4BVUC 2JRIB 3U7DA 2J0JA 1WMHB 4PS8A 4AP4C 3EHVA 3APCA 4MJSA 4WJOA 2G45B 2N7EA 1S3SG 2WX0A 3M95A 3L54A 4PYUA 3PLVA 3PT2B 2ASQA 2CHXA 2NR2A 1GC7A 3OJ3A 1S1QB 3VH4B 1Z2MA 1TZ1A 1QZEA 2L0TA 3K9OB 1D3ZA 2KQSA 3VUYA 2O2VB 1XQQA 1YIWA 3QA8A 3ZNZB 1UBIA 2JZZA 2BKRB 4HJKA 1V5OA 2FCMA 2R2QA 3IBEA 4MDKE 1E90A 4K81A 2OJRA 2KTFA 3QQ8B 4GB9A 4NPNA 2MRPA 3PSEB 4IW0A 4F7ZA 2IY0B 3RZWC 4N9F4 2JWZA 4JGHB 2NVUI 3ALBA 3GZNI 1WXMA 1OEYJ 4GDKA 4G50A 4FULA 1G6JA 2FCSA 2N1VA 4FJZA 4AOFA 4PS3A 2LUEA 1Z5SB 4IG7B 4ICUA 2DYOA 4A20A 1P0RA 2KX3A 1C1YB 2DYBA 3A1QA 1WI0A 3KW5B 3Q3JA 2GBMA 1WJ6A 4G3XB 4ANVA 4BKGA 1V49A 1ZGUB 3BY4B 2KOXA 4CYEA 5TR5A 1X1MA 3CMMB 1GNUA 1VD2A 2V1YA 4YL8A 4A3OA 3V60A 3HM3A 4ICVA 4ZRIA 2JUOA 1V81A 4ANUA 4GDLB 5D2MB 2KVRA 4HWIB 3B1LX 2RD0A 4MGYE 5IAAC 4K7SA 2KLCA 2K8BA 5CTRC 2LVQA 2KJRA 1WXAA 2DENB 3MJWA 3ZDTA 4BKSA 1LFDA 4EZLA 2ZVNA 4RM9A 2GBJA 4HK2A 5E6OA 1ZW7A 1WX8A 2L0FA 3NZUA 3W1SA 2M8SA 4RM8A 2LWPA 3CF6E 2Z0DB 2XK5B 3RYTA 2K25A 3AU4A 4EKUA 2NPTB 5G55A 3QC8B 4HXDA 2FAZA 4BBNF 4CO7A 2M4NA 3PPAA 2BWES 3DBRI 3DVNU 3TMPB 3WAMA 3WALA 3ZRCA 3C0RB 4II3B 4MGIE 3DOWA 3X23A 4W9KA 4GXBA 1Q1OA 5DPTA 3QX1A 4MSQB 2R2OA 2ZVOA 5GMVA 2LGXA 1WGGA 3L16A 3QARA 4NAWA 5EDSA 3N3KB 5D94A 2WYQA 1TGZB 3ML8A 4HDOA 5AZFA 3QIJA 4P7IA 3HIZA 2K39A 1SGHA 2RSUA 2KWVB 2RR9A 3H7SA 2IY1B 4IWQA 2BYFA 4E71A 3DDCB 5CX3A 5G2NA 3WA0A 3K9PB 1WGDA 3NS8A 2KMAA 4HVBA 2LXAA 3BINA 2DZKA 3DVNV 3UGBB 2MBBB 4MGZE 1KM7A 2IYDB 2MBEA 2GOWA 1EUVB 1FXTB 1LM8B 1WF9A 2C7MB 2D3GA 2HTHA 3HM6X 5CHFA 1WX7A 4M8MA 2NS5A 2KDFB 3OLMD 3RZFA 3JYUA 2VRRB 4KSKC 4LJPB 2KNBA 1UZXB 4FBJB 3DVGX 4KZCA 2WWZA 2JXXA 1WGHA 4W9CA 3H7PB 3QK0A 4DWFA 3DBHI 1WE6A 2L76A 3JW0X 4ASWC 1YD8U 3JSVB 4WJQA 3DVGY 3LDZE 3VH3B 2CHZA 2FCNA 5L83A 3QHTA 4W9LA 3UIPB 2WDTB 5J2RA 3ONSA 3DBSA 4KVGB 3T9LA 2IZVB 2Z59B 4W9FA 2MSED 3R3MA 4F8CB 3H1UA 3APFA 3UQAA 3NHEB 3PVLA 1V5TA 2AWTA 1Q0WB 2UWQA 4HCPB 1E5WA 1P98A 2PPHA 2V3SA 1WJUA 1WXVA 2LJ5A 2N1WA 3A4RA 1UBQA 2DAFA 3M3JA 3B0AA 1J8CA 2JT4B 4NJ7A 2D07B 2PEAA 1E8YA 1SIFA 4HCNB 2BGFA 2C9WB 2IO0B 4EFOA 2KO3A 3QJZA 1H8CA 5FR6A 3VHTC 1TTNA 2K6QA 3Q3FA 1V6EA 2G4DB 2KTRB 4FA6A 4JIOU 2CKHB 2JRHA 1J19A 5CHWA 4FN2A 1GUAB 2M1MA 3ZW3A 1LQBA 1I42A 4GSWA 3V6CB 3TBLD 1AARA 2O2VA 1KLVA 4GIVA 2KLGA 2KFKA 4LCDE 2MW5A 2C60A 2MX2A 2NPTA 3NOBA 4W9EA 2ZJDA 3B08A 3L17A 3KUZA 2JVCA 4HPMB 3NZSA 1WMHA 1H4RA 5AZGA 2N4FA 2V4LA 4AWJA 1V80A 3A4SC 3RCZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F9J A;  3KYD D;  4BOZ B;  2CHW A;  2JZ3 B;  2LD9 A;  3HK0 A;  3A9J B;  4M0W B;  3UF8 A;  2GMI C;  2L8J A;  3EC8 A;  2J7Q B;  3NY5 A;  4E3C A;  1CMX B;  2LGD A;  2K8C A;  3JSV A;  4B9K A;  5LXI B;  1E7U A;  2LRU A;  4I6P A;  4ZRK A;  5LLI A;  2EMT A;  3SU8 X;  1IP9 A;  2BYE A;  1C3T A;  1P1A A;  4WWP A;  4GGQ A;  3W1S C;  2KKC A;  3OJ4 B;  3R7R A;  3MTN B;  3ZTC A;  2KDI A;  1I35 A;  2BYV E;  4WAA A;  2BKF A;  5D6J B;  3PRZ A;  5D7G A;  3PGE A;  4WJN A;  5JH5 C;  3OAW A;  3R66 C;  3WAO A;  4EEW A;  3ZUN A;  1Q5W B;  1R4M I;  1GG3 A;  1JRU A;  2I1K A;  3L13 A;  4A3P A;  2CU1 A;  4EZJ A;  2Y5B B;  4PYZ A;  2AEH A;  2L00 B;  4IUM B;  3X0W A;  3VQI A;  2O6V B;  4IWP A;  1OGW A;  2XEW A;  4BFR A;  4BOS C;  2AYO B;  2LAS A;  5CHV C;  4GDL A;  1WM2 A;  4WQO B;  3VFK A;  3A9K B;  3PRM B;  1UGM A;  3VDZ A;  3ZRF A;  1EF1 A;  2IO1 B;  1OQY A;  2NBU A;  1P3Q U;  2IBI B;  5J18 A;  3AXC A;  5JHB A;  2ZZP B;  3KYC D;  3O65 B;  4W9J A;  5AEK B;  3TJP A;  2FID A;  2HE7 A;  3KH0 A;  3P2B A;  2MA9 B;  3V62 A;  2XK5 A;  1WH3 A;  4BKT A;  4MJS B;  3QCA A;  1M94 A;  3L0W B;  5DPW A;  4MM3 A;  1WR1 A;  4HPL B;  2D11 A;  3LJ3 A;  4DXA B;  1U4A A;  2O6V D;  3MHS D;  3IFW B;  4XX5 A;  4G11 A;  4TQ0 A;  4FJY A;  2YLM A;  2DX5 B;  3V6E B;  1K8R B;  4MEL A;  1WM3 A;  3VXW A;  2KK8 A;  1PQS A;  4AJY B;  4X57 B;  2JPH A;  3KVF B;  2K1F A;  1TBE A;  1WFY A;  3TL5 A;  1WGR A;  1E8Z A;  1KJT A;  3SD5 A;  4NAW B;  3EEC A;  4NQL B;  1E8X A;  5AZH A;  4NY0 A;  3PRE A;  3ENE A;  2KAN A;  4OVV A;  2ZNV C;  2KQ7 A;  4DBG A;  1BT0 A;  1ZKH A;  2DZI A;  3WIM A;  5L95 C;  4LDT B;  2KZR A;  2NCN A;  3L10 B;  4F1S A;  5JHA A;  4BBN C;  1V86 A;  4GN1 A;  2LI5 A;  2PE6 B;  4DHZ E;  2KDB A;  2AL3 A;  4W9D A;  3N30 A;  3WAN A;  2KHW B;  5E6P A;  1YJ1 A;  1UEL A;  2N9E B;  2BWF A;  2KN5 A;  3QAQ A;  3KUD B;  1EO6 A;  5C23 A;  2JF5 A;  4IC7 B;  3ML9 A;  4GDK B;  2AL6 A;  3QWZ B;  1OEY A;  2ZCB A;  3IVF A;  3PLU A;  2BF8 B;  5BO4 B;  2ZEQ A;  2MWS B;  4GMV A;  3VUW A;  2JY6 A;  2K6D B;  3GOE A;  4JLC A;  2C7H A;  2MBH A;  4KZ0 A;  5JZE B;  2DZJ A;  3H9D A;  4I6L B;  3D32 A;  2IO2 B;  4LDT D;  2ZCC A;  3VAW A;  2FNJ B;  4KSL C;  3PS6 A;  4IWO A;  3VTW A;  2KTR A;  2A4Z A;  2EKE C;  4TV3 A;  4B95 A;  3L08 A;  1YX5 B;  2CS4 A;  4GU2 A;  4JQW C;  2MCN B;  3PZD A;  2MQJ A;  2EMS A;  3SDL C;  2D10 A;  2L7R A;  1SE9 A;  2GBR A;  4FLH A;  5KHO A;  2KXJ A;  1V2Y A;  3M62 B;  5E6N A;  1E7V A;  3U30 A;  4FHK A;  3PV1 A;  4NJ6 A;  1WR6 E;  2FCQ A;  1MG8 A;  4MGK E;  2KC1 A;  3RD2 A;  2FIF A;  2NBW B;  3APD A;  4KV2 A;  3ZDM C;  3DPD A;  2KWC A;  1NBF C;  4AUQ C;  3AUL A;  3PHX B;  1GC6 A;  4DHJ D;  3IG3 A;  2QHO A;  2FUH B;  4IM0 A;  2NBV B;  1RFA A;  1YQB A;  2REX A;  2K8H A;  3UQB A;  2OOB B;  1WJ4 A;  3H7P A;  4NNJ B;  1WIA A;  2YVC A;  1NI2 A;  3JVZ X;  3CST A;  1GJZ A;  3CSF A;  2J0K A;  1E8W A;  3PHW B;  2N9P C;  4KIK A;  4PS7 A;  1YX6 B;  2UYZ B;  3H6N A;  3ZLZ A;  2WX1 A;  4M8N A;  3WAP A;  2G3Q B;  4DHZ B;  3KUC B;  2LVP A;  4BKS D;  5IA7 A;  2N9X A;  2DAJ A;  3A33 B;  2KJ6 A;  2L05 A;  4DHJ B;  1KOT A;  3N32 A;  2MLB A;  3ZNG C;  4FJV B;  4ZDV A;  4LJO B;  1WX9 A;  3R7Q A;  2KFK B;  2BPS A;  1J0G A;  4IM2 A;  2Z0E B;  4II2 B;  4TKN A;  2N7D A;  1IPG A;  3RT3 B;  4ZRJ A;  4MEM A;  4CHK A;  3UIO B;  2CR5 A;  4MSM B;  3TIX A;  1WE7 A;  1Y8R C;  4FAD A;  4KDI C;  1WRD B;  2KWU B;  3A9J A;  1WYW B;  4W9H A;  4HLE A;  4E74 A;  2L3Z A;  2MP2 A;  3SHQ A;  5LXH A;  4DDG D;  2LVO A;  1HE8 A;  2A5U A;  2C5L C;  2I1J A;  4FHJ A;  4IM3 A;  2PE9 A;  3DBL I;  2GBN A;  4KDL B;  2LRW A;  3ZVV A;  5C1Z A;  2MBQ A;  4K7W A;  2MBO A;  4WWN A;  4DDI D;  1LXD A;  4XZ4 A;  4NQK E;  4TUU A;  5J17 A;  4EUT A;  2ZPY A;  2HJ8 A;  3AI5 A;  3M63 B;  4J6I A;  3V61 A;  5HKH A;  2C7N B;  5DPS A;  2LZ6 A;  2ZPN A;  5KHQ A;  1RAX A;  2KMC A;  4G0N B;  2KDE B;  4K1R B;  1R4N I;  1WJN A;  1OTR B;  2RGF A;  4K7U A;  2ZNV B;  2KJH B;  2DYM A;  4GOC A;  3VTU A;  3A9K A;  1WXS A;  2LXC A;  4I6N B;  3W1Y A;  2DZM A;  3I3T B;  3IHP C;  2XBB C;  4DK5 A;  4W9G A;  4HDQ A;  3ZIM A;  2HD5 B;  3DCG A;  4ANX A;  3ZNH B;  1XD3 B;  2O6V A;  4WWO A;  3ZO5 B;  1V9J A;  2IO3 B;  2PJH A;  3ECI A;  3VTV A;  1RRB A;  1WY8 A;  1EF5 A;  2G4S A;  3A1Q B;  4MH0 E;  3ZNI D;  4ANW A;  5DPR A;  1WZ3 A;  2M0X A;  3PRP B;  1A5R A;  4KIK B;  1L2N A;  4TQ1 A;  2W9N A;  3ZKJ C;  3ZTD A;  2GBK A;  2KFJ A;  2RPQ A;  1L7Y A;  3HHM A;  4JL9 A;  2DHZ A;  1P9D U;  1UH6 A;  1XT9 B;  2LGY A;  2MP2 B;  3VUX A;  4EZK A;  3PTF C;  2D2Q A;  3UIN B;  3RUI B;  1IYF A;  2M17 A;  1VCB A;  4WJP A;  4AJW A;  4XC2 A;  3AU5 A;  2KC2 A;  3U8Z A;  4EOY A;  1ISN A;  2KD0 A;  2KX0 A;  4ZYN A;  3VVW B;  2J0M A;  2B3A A;  1UD7 A;  3EFU A;  3S2A A;  4W9I A;  3RUL A;  1RLF A;  3T8M A;  3TCA A;  4URK A;  5DCN A;  3DQV A;  1WGY A;  1WZ0 A;  4RMA A;  4B6W A;  1T0Y A;  4OVU A;  1NDD A;  4BVU C;  2JRI B;  3U7D A;  2J0J A;  1WMH B;  4PS8 A;  4AP4 C;  3EHV A;  3APC A;  4MJS A;  4WJO A;  2G45 B;  2N7E A;  1S3S G;  2WX0 A;  3M95 A;  3L54 A;  4PYU A;  3PLV A;  3PT2 B;  2ASQ A;  2CHX A;  2NR2 A;  1GC7 A;  3OJ3 A;  1S1Q B;  3VH4 B;  1Z2M A;  1TZ1 A;  1QZE A;  2L0T A;  3K9O B;  1D3Z A;  2KQS A;  3VUY A;  2O2V B;  1XQQ A;  1YIW A;  3QA8 A;  3ZNZ B;  1UBI A;  2JZZ A;  2BKR B;  4HJK A;  1V5O A;  2FCM A;  2R2Q A;  3IBE A;  4MDK E;  1E90 A;  4K81 A;  2OJR A;  2KTF A;  3QQ8 B;  4GB9 A;  4NPN A;  2MRP A;  3PSE B;  4IW0 A;  4F7Z A;  2IY0 B;  3RZW C;  4N9F 4;  2JWZ A;  4JGH B;  2NVU I;  3ALB A;  3GZN I;  1WXM A;  1OEY J;  4GDK A;  4G50 A;  4FUL A;  1G6J A;  2FCS A;  2N1V A;  4FJZ A;  4AOF A;  4PS3 A;  2LUE A;  1Z5S B;  4IG7 B;  4ICU A;  2DYO A;  4A20 A;  1P0R A;  2KX3 A;  1C1Y B;  2DYB A;  3A1Q A;  1WI0 A;  3KW5 B;  3Q3J A;  2GBM A;  1WJ6 A;  4G3X B;  4ANV A;  4BKG A;  1V49 A;  1ZGU B;  3BY4 B;  2KOX A;  4CYE A;  5TR5 A;  1X1M A;  3CMM B;  1GNU A;  1VD2 A;  2V1Y A;  4YL8 A;  4A3O A;  3V60 A;  3HM3 A;  4ICV A;  4ZRI A;  2JUO A;  1V81 A;  4ANU A;  4GDL B;  5D2M B;  2KVR A;  4HWI B;  3B1L X;  2RD0 A;  4MGY E;  5IAA C;  4K7S A;  2KLC A;  2K8B A;  5CTR C;  2LVQ A;  2KJR A;  1WXA A;  2DEN B;  3MJW A;  3ZDT A;  4BKS A;  1LFD A;  4EZL A;  2ZVN A;  4RM9 A;  2GBJ A;  4HK2 A;  5E6O A;  1ZW7 A;  1WX8 A;  2L0F A;  3NZU A;  3W1S A;  2M8S A;  4RM8 A;  2LWP A;  3CF6 E;  2Z0D B;  2XK5 B;  3RYT A;  2K25 A;  3AU4 A;  4EKU A;  2NPT B;  5G55 A;  3QC8 B;  4HXD A;  2FAZ A;  4BBN F;  4CO7 A;  2M4N A;  3PPA A;  2BWE S;  3DBR I;  3DVN U;  3TMP B;  3WAM A;  3WAL A;  3ZRC A;  3C0R B;  4II3 B;  4MGI E;  3DOW A;  3X23 A;  4W9K A;  4GXB A;  1Q1O A;  5DPT A;  3QX1 A;  4MSQ B;  2R2O A;  2ZVO A;  5GMV A;  2LGX A;  1WGG A;  3L16 A;  3QAR A;  4NAW A;  5EDS A;  3N3K B;  5D94 A;  2WYQ A;  1TGZ B;  3ML8 A;  4HDO A;  5AZF A;  3QIJ A;  4P7I A;  3HIZ A;  2K39 A;  1SGH A;  2RSU A;  2KWV B;  2RR9 A;  3H7S A;  2IY1 B;  4IWQ A;  2BYF A;  4E71 A;  3DDC B;  5CX3 A;  5G2N A;  3WA0 A;  3K9P B;  1WGD A;  3NS8 A;  2KMA A;  4HVB A;  2LXA A;  3BIN A;  2DZK A;  3DVN V;  3UGB B;  2MBB B;  4MGZ E;  1KM7 A;  2IYD B;  2MBE A;  2GOW A;  1EUV B;  1FXT B;  1LM8 B;  1WF9 A;  2C7M B;  2D3G A;  2HTH A;  3HM6 X;  5CHF A;  1WX7 A;  4M8M A;  2NS5 A;  2KDF B;  3OLM D;  3RZF A;  3JYU A;  2VRR B;  4KSK C;  4LJP B;  2KNB A;  1UZX B;  4FBJ B;  3DVG X;  4KZC A;  2WWZ A;  2JXX A;  1WGH A;  4W9C A;  3H7P B;  3QK0 A;  4DWF A;  3DBH I;  1WE6 A;  2L76 A;  3JW0 X;  4ASW C;  1YD8 U;  3JSV B;  4WJQ A;  3DVG Y;  3LDZ E;  3VH3 B;  2CHZ A;  2FCN A;  5L83 A;  3QHT A;  4W9L A;  3UIP B;  2WDT B;  5J2R A;  3ONS A;  3DBS A;  4KVG B;  3T9L A;  2IZV B;  2Z59 B;  4W9F A;  2MSE D;  3R3M A;  4F8C B;  3H1U A;  3APF A;  3UQA A;  3NHE B;  3PVL A;  1V5T A;  2AWT A;  1Q0W B;  2UWQ A;  4HCP B;  1E5W A;  1P98 A;  2PPH A;  2V3S A;  1WJU A;  1WXV A;  2LJ5 A;  2N1W A;  3A4R A;  1UBQ A;  2DAF A;  3M3J A;  3B0A A;  1J8C A;  2JT4 B;  4NJ7 A;  2D07 B;  2PEA A;  1E8Y A;  1SIF A;  4HCN B;  2BGF A;  2C9W B;  2IO0 B;  4EFO A;  2KO3 A;  3QJZ A;  1H8C A;  5FR6 A;  3VHT C;  1TTN A;  2K6Q A;  3Q3F A;  1V6E A;  2G4D B;  2KTR B;  4FA6 A;  4JIO U;  2CKH B;  2JRH A;  1J19 A;  5CHW A;  4FN2 A;  1GUA B;  2M1M A;  3ZW3 A;  1LQB A;  1I42 A;  4GSW A;  3V6C B;  3TBL D;  1AAR A;  2O2V A;  1KLV A;  4GIV A;  2KLG A;  2KFK A;  4LCD E;  2MW5 A;  2C60 A;  2MX2 A;  2NPT A;  3NOB A;  4W9E A;  2ZJD A;  3B08 A;  3L17 A;  3KUZ A;  2JVC A;  4HPM B;  3NZS A;  1WMH A;  1H4R A;  5AZG A;  2N4F A;  2V4L A;  4AWJ A;  1V80 A;  3A4S C;  3RCZ A; 
#chains in the Genus database with same CATH topology
 4B0M A;  3KYD D;  1YN5 A;  4XDC A;  3B2F A;  2GMI C;  2K22 A;  2J7Q B;  1CMX B;  2LGS A;  2ONQ A;  3JSV A;  3DBL B;  4ZRK A;  1AW7 A;  1P1A A;  1M4V A;  5HI1 A;  3OJ4 B;  3R7R A;  1I4H A;  2BYV E;  2QMT A;  3GP7 A;  3OAW A;  1R4M I;  1JRU A;  3U7Z A;  2L00 B;  3ZQ4 A;  2O6V B;  2XEW A;  1WRI A;  4GDL A;  4WQO B;  3P4P B;  3RN9 C;  3VDZ A;  2IO1 B;  2N9L A;  2DLB A;  3U52 E;  2AQ1 B;  3MC8 A;  4PT5 A;  3QCA A;  1M94 A;  5DPW A;  3IT6 B;  1SJH D;  3MHS D;  4TQ0 A;  2AQ2 B;  3DBR B;  1MHX A;  3V6E B;  2DX5 B;  1WM3 A;  1KF6 B;  4LNK A;  2BS4 B;  4X57 B;  2JPH A;  1T5X D;  4HKZ E;  2K1F A;  4M00 A;  3TL5 A;  1KJT A;  1RFK A;  3SD5 A;  2JX5 A;  2PLP A;  3EEC A;  1E8X A;  4JWS C;  3AE9 B;  5AZH A;  4NY0 A;  3PRE A;  3ENE A;  2KQ7 A;  2DZI A;  3WIM A;  5L95 C;  5JHA A;  4BBN C;  1V86 A;  2PE6 B;  2KDB A;  3WAN A;  5E6P A;  2Q5W D;  2KN5 A;  3KUD B;  4GDK B;  2ZCB A;  2BF8 B;  1D5M C;  3R2T A;  5BO4 B;  1PFD A;  1CZP A;  5JZE B;  3HVD A;  4I6L B;  2ZCC A;  4IWO A;  1HEZ E;  2A4Z A;  2EKE C;  1WXQ A;  2CS4 A;  2MCN B;  4JQW C;  4JWU C;  3RNC C;  1SE9 A;  4FLH A;  1VDV A;  4FHK A;  2L1A A;  3PV1 A;  2YEP F;  1UUP A;  2KN4 A;  2NBW B;  4KV2 A;  3TEX A;  1NBF C;  4AUQ C;  4RGN A;  1GC6 A;  2IDY A;  2VZK B;  2WXK A;  4IM0 A;  1FRD A;  2NBV B;  1YQB A;  2REX A;  4N58 A;  4LNN A;  1NVI D;  1WJ4 A;  3GZN B;  4NNJ B;  1STE A;  2N9P C;  2K3U A;  2VH1 A;  3Q8A A;  5AUK A;  2G3Q B;  4DHZ B;  2LGI A;  3A33 B;  2DAJ A;  4DHJ B;  2MLB A;  1QLB B;  4NZL B;  1VZ7 A;  4UDU C;  1MFW A;  3T3O A;  3TIX A;  3R8B A;  4FAD A;  4KDI C;  4D2K A;  1WYW B;  3LXF A;  4W9H A;  2L3Z A;  3SHQ A;  2LVO A;  4N59 A;  1TS3 A;  2C5L C;  4FHJ A;  3ABV B;  2GBN A;  2LRW A;  2J53 A;  1TY2 A;  2QIE B;  2YEP B;  4NQK E;  3ETR A;  5HKH A;  4YTN B;  1TS5 A;  2C7N B;  2PTL A;  5DPS A;  5KHQ A;  1RAX A;  4G0N B;  2KMC A;  1WJN A;  4C7Y A;  2ZNV B;  2KJH B;  2PW9 A;  2DZM A;  3I3T B;  3IHP C;  2XBB C;  3AE5 B;  4W9G A;  5C2T B;  3ZIM A;  1WYG A;  3ZO5 B;  4ZHP A;  2PJH A;  1V97 A;  1WZ3 A;  3ZTD A;  2RPQ A;  3HHM A;  4YXD B;  1AWD A;  1XT9 B;  4K3B A;  1L6U A;  4XC2 A;  4EOY A;  1QT9 A;  2B3A A;  2WDR B;  2WU2 B;  1RLF A;  5I4D A;  1GPX A;  3DQV A;  4B6W A;  4BVU C;  3U7D A;  1K51 A;  2UU7 A;  1FNU A;  1OQR A;  4WJO A;  2WX0 A;  1SE4 A;  3PT2 B;  2ASQ A;  1E10 A;  2FE8 A;  2PVO D;  3QA8 A;  2V0G A;  4HJK A;  4KKJ A;  2FCM A;  3IBE A;  1JCK B;  2OJR A;  3QQ8 B;  4GLS C;  2IY0 B;  3RZW C;  1FXA A;  3I5J C;  3ALB A;  1WXM A;  4REZ A;  2FCS A;  4AOF A;  4FJZ A;  4IG7 B;  1P0R A;  2KX3 A;  3HUI A;  4O1N A;  3J9C A;  3A1Q A;  4BKG A;  1L5P A;  4ANV A;  2LHD A;  1V49 A;  5TR5 A;  1X1M A;  4LTU A;  1F77 A;  4ZRI A;  1E6E B;  2BW2 A;  2KVR A;  4LNO A;  1I4R A;  4MGY E;  5D3D A;  3AMZ A;  3ZDT A;  3AE3 B;  1LFD A;  3PZ8 A;  1ZW7 A;  4RM8 A;  3CF6 E;  2Z0D B;  2K25 A;  3AU4 A;  4EKU A;  1TIF A;  3QC8 B;  2GLS A;  4B0E A;  3DBR I;  4MGI E;  5DPT A;  4MSQ B;  5GMV A;  4NAW A;  3AEG B;  3N3K B;  4YTM B;  2HDE A;  1TGZ B;  4HDO A;  4MH8 A;  1ZXH A;  2RR9 A;  3H7S A;  4E71 A;  3LYY A;  1TKY A;  3BK2 A;  1F2R I;  3NS8 A;  1XLP A;  3BIN A;  4L2Y A;  3UGB B;  2MBB B;  3NRZ A;  4HRS A;  2MBE A;  2W3S A;  1LM8 B;  5CHF A;  3RZF A;  2KWD A;  1TZO A;  2VRR B;  2L83 A;  4KSK C;  2WXH A;  3PO0 A;  3DVG X;  3H7P B;  4RGT A;  4CQN A;  1YD8 U;  1JWM D;  3KWL A;  4WJQ A;  3EGR A;  1XEE A;  4W9L A;  3UIP B;  1PUT A;  3DBS A;  2CJN A;  4KVG B;  2IZV B;  4BZA A;  4C4V B;  2MSE D;  3HVZ A;  4LNF A;  4F8C B;  5LNK 1;  1FIQ A;  1VLB A;  3PVL A;  4HCP B;  2V3S A;  2X38 A;  1QIL A;  4MT5 A;  5FR6 A;  5BMG A;  2K6Q A;  2SEB D;  2W3R A;  3BYT B;  3BYY B;  3DHH C;  5CHW A;  2M1M A;  2WXL A;  1LQB A;  3AH7 A;  1AAR A;  4ARC A;  3AE1 B;  4GIV A;  4LCD E;  2RDG A;  3C19 A;  3B08 A;  2G1E A;  3Q8F A;  4HPM B;  3NZS A;  2D3C A;  1V80 A;  1F9J A;  4BOZ B;  2JZ3 B;  2LD9 A;  1GAQ B;  4M0W B;  2L8J A;  3EC8 A;  2RMM A;  3NY5 A;  3H8H A;  1ZP0 B;  2LGD A;  1C4A A;  1K53 A;  4B9K A;  5LXI B;  3RMK C;  5LLI A;  3AE7 B;  4TMA B;  2J52 A;  1C3T A;  4WWP A;  4GGQ A;  3ZTC A;  2WXO A;  4ITK A;  1ZPS A;  3W9C B;  3NVY A;  2E3T A;  3WAO A;  4EEW A;  2JYT A;  1OQQ A;  1Q5W B;  3NVW A;  2CU1 A;  4IUM B;  3IAS 1;  4IWP A;  2AYO B;  1IUE A;  1WSP A;  4RGM A;  2WXF A;  1FXI A;  1UGM A;  3ZRF A;  4TSS A;  1T3Q A;  4C00 A;  2JXT A;  5FK9 C;  1XF5 L;  2XN9 C;  3TJP A;  1YN4 A;  2HE7 A;  2J42 A;  3V62 A;  3O13 A;  2ON8 A;  4BKT A;  2MHJ A;  4HPL B;  2D11 A;  4XX5 A;  1ZXI A;  3OWE B;  4FJY A;  1I4P A;  4YSZ B;  1AN8 A;  3VXW A;  1SXT A;  4AQ7 A;  1WFY A;  1WGR A;  3V05 A;  2DBY A;  5IOI A;  4DBG A;  1ZKH A;  2KZR A;  3L10 B;  1JRO A;  4GN1 A;  2LI5 A;  5EE3 A;  1FM0 D;  4DHZ E;  4W9D A;  2RDB C;  5BMH A;  1YJ1 A;  1F1H A;  3KQ4 A;  4NJC A;  2AL6 A;  3QWZ B;  1OEY A;  2E6X A;  3IVF A;  3PLU A;  2BBC A;  3SEB A;  2QIL A;  2ZEQ A;  2L52 A;  2MWS B;  4JLC A;  2C7H A;  2MBH A;  1MG4 A;  5IP4 D;  3H9D A;  3D32 A;  2IO2 B;  2FNJ B;  4KSL C;  3VTW A;  2KTR A;  4TV3 A;  1SE3 A;  2L32 A;  1XO3 A;  3L08 A;  1I4G A;  1ZE3 D;  2EMS A;  3SDL C;  3MFG A;  2GBR A;  1V2Y A;  4R3D A;  4JPS A;  3CWI A;  5E6N A;  2MJE A;  4C7Z A;  1MG8 A;  4MGK E;  3RD2 A;  3EFC A;  1FO4 A;  1QOA A;  3W5V B;  3ZDM C;  3N9Y C;  3PHX B;  4DHJ D;  1N61 A;  2QHO A;  2FUH B;  2JWU A;  1RFA A;  2K8H A;  1N5W A;  3BZD B;  5HHD G;  2MEK A;  3CSF A;  2J0K A;  4PS7 A;  2UYZ B;  2X8X X;  2WX1 A;  4YSY B;  3WAP A;  3FKY A;  3KUC B;  2LVP A;  1LO5 D;  2N9X A;  2KJ6 A;  4XE0 A;  1MJD A;  3N32 A;  3ZNG C;  3TEZ A;  3TEY A;  4ZDV A;  1WX9 A;  1RWS A;  1HA5 A;  2BPS A;  2BTE A;  2Z0E B;  4II2 B;  1XXG A;  3NVZ A;  1IPG A;  2WGS A;  4HJG E;  5D3I B;  4CHK A;  3OG5 A;  2CR5 A;  4MSM B;  1N5X A;  1Y8R C;  1SF0 A;  2KWU B;  3A9J A;  3W2D A;  4HLE A;  4E74 A;  2MP2 A;  5LXH A;  3VR8 B;  2BB6 A;  1D5X C;  4IM3 A;  2I1J A;  2MBQ A;  2MBO A;  4WWN A;  1DOY A;  5IN7 A;  2HJ8 A;  2NMQ A;  3AI5 A;  3M63 B;  1QQR A;  1FCC C;  1J7A A;  2KDE B;  4K7U A;  4A9A A;  1YQ4 B;  1WXS A;  2LXC A;  3W1Y A;  2INN E;  4HDQ A;  2WQY B;  4ANX A;  3ZNH B;  1XD3 B;  2M19 A;  1V9J A;  1RRB A;  2WNM A;  1EF5 A;  1FNW A;  4MH0 E;  1IBX A;  5DPR A;  2M0X A;  1FPY A;  3ZKJ C;  2GBK A;  2KFJ A;  1V1O A;  2LGY A;  4ZYS A;  3VUX A;  4EZK A;  3PTF C;  3RUI B;  4XWW A;  2M17 A;  4WJP A;  1UWX A;  2KC2 A;  3U8Z A;  1ISN A;  1Y56 A;  1QF6 A;  2J0M A;  1JWA D;  3T8M A;  2VZK D;  4URK A;  2DWQ A;  1T0Y A;  1SEB D;  2Y5P A;  2INP E;  5EE1 A;  1WMH B;  4PS8 A;  1HQR D;  4AP4 C;  2K5P A;  3EHV A;  3APC A;  4PYU A;  3PLV A;  3KLS X;  1Z2M A;  5HFY A;  4C4V A;  1D3Z A;  4OZB A;  2MH7 A;  3VUY A;  3LB8 C;  1ENF A;  1VJK A;  1YIW A;  2PVG C;  1UBI A;  2JZZ A;  2BKR B;  4MDK E;  2MRP A;  4F7Z A;  4L23 A;  4USA A;  1EWY C;  4N9F 4;  2M0A A;  4DXF A;  2WXJ A;  4KGS A;  1L4Z B;  4GDK A;  4FUL A;  2WU5 B;  4PS3 A;  2DYB A;  4HPP A;  3KW5 B;  2GBM A;  4G3X B;  2KOX A;  3CMM B;  1F0Z A;  4ICV A;  4ACF A;  1V81 A;  4ANU A;  3Q14 C;  5D2M B;  1FFU A;  2QDF A;  1TS4 A;  2HTM E;  2LHE A;  4K7S A;  2K8B A;  1BML C;  2LVQ A;  4RM9 A;  2GBJ A;  5E6O A;  2L0F A;  4US9 A;  1BUI C;  2M8S A;  2LWP A;  3RYT A;  3NS1 A;  4RGO S;  3ZYY X;  3NJT A;  5TSS A;  5G55 A;  1KRH A;  2FAZ A;  2M4N A;  3NVV A;  3ZRC A;  5BYS A;  3DOW A;  4W9K A;  4GXB A;  1Q1O A;  4YTP B;  4ZOH C;  1F52 A;  2LGX A;  1WGG A;  4ZHO A;  3QIJ A;  2RSU A;  2KWV B;  2QCZ A;  2IY1 B;  4A8X C;  1PYW D;  3AB5 A;  2KMA A;  4HVB A;  4A90 A;  3DVN V;  2GB1 A;  3RNF C;  4KKI A;  1EUV B;  1WX7 A;  2NS5 A;  3OLM D;  1N60 A;  3TEW A;  2G9H D;  2KNB A;  4FBJ B;  1XLN A;  1EM7 A;  1JAL A;  3IT4 B;  1WGH A;  4DWF A;  1J7C A;  2K9X A;  3LDZ E;  2FCN A;  1CQV A;  2B76 B;  2WXM A;  4W9F A;  3Q2A C;  4IOI E;  1T0S C;  3N1X C;  2UWQ A;  4S0R A;  4A6Q A;  4XGA B;  1WJU A;  2LJ5 A;  3M3J A;  3B0A A;  1FNV A;  1L0X B;  1DGJ A;  2IPK D;  1E8Y A;  3RNG C;  4HCN B;  1H8C A;  1V6E A;  4JX1 C;  4FA6 A;  3P1M A;  1J19 A;  4FN2 A;  3ZW3 A;  1I42 A;  4GSW A;  3V6C B;  4WIP A;  1A70 A;  2KLG A;  1HZ5 A;  2KFK A;  1DOI A;  2XNA C;  1TY0 A;  2MX2 A;  2NPT A;  3NOB A;  2ZJD A;  2OED A;  4M02 A;  4P1C C;  3AE6 B;  2N4F A;  3FAH A;  1B1Z A;  1L6V A;  3BVG A;  3WCQ A;  2ZW0 A;  3TUO A;  3A9J B;  4E3C A;  2K0P A;  4FXC A;  1E7U A;  2LRU A;  4JE3 B;  2EMT A;  3SU8 X;  1IP9 A;  2BYE A;  4LNI A;  3W1S C;  2KKC A;  3MTN B;  2KDI A;  3PRZ A;  4WJN A;  5JH5 C;  3R66 C;  4MM3 B;  3ZUN A;  3L13 A;  1GG3 A;  2JSV X;  1UWM A;  4EZJ A;  2Y5B B;  3X0W A;  2RDH A;  3B2G A;  1OGW A;  4BOS C;  1SB3 C;  2LAS A;  5CHV C;  2JYE A;  1QOG A;  3VFK A;  3A9K B;  3PRM B;  3VRA B;  1ROE A;  3AED B;  1P3Q U;  2IBI B;  4PK1 A;  1VZ6 A;  3AXC A;  5J18 A;  3HRD D;  3O65 B;  2FID A;  3KH0 A;  3P2B A;  2MA9 B;  1WH3 A;  4MJS B;  1XCT L;  3SR6 A;  3AM9 A;  4M01 A;  4MM3 A;  5EE0 A;  3BVZ A;  4DXA B;  1U4A A;  1ET6 A;  2I2Y A;  2YLM A;  1K8R B;  1T0R C;  2KK8 A;  4AJY B;  1TBE A;  2KAN A;  1KTK A;  4LDT B;  2NCN A;  1D4B A;  3AE2 B;  2INC C;  4S17 A;  1UEL A;  2N9E B;  3QAQ A;  2JF5 A;  4IC7 B;  3ML9 A;  1IGC A;  5BYR A;  4BAX A;  3VUW A;  1ESF A;  4GMV A;  4YSX B;  2Z8L A;  3GOE A;  3VAW A;  3DWG C;  1WWT A;  3AEA B;  1GB4 A;  4B95 A;  1YX5 B;  4GU2 A;  1VRA B;  3PZD A;  2D10 A;  5KHO A;  2KXJ A;  3M62 B;  3N20 C;  2KAJ A;  1E7V A;  4C80 A;  4US8 A;  3U30 A;  1NEK B;  2FCQ A;  2AX5 A;  4XWT A;  2KYW A;  1FCL A;  2KC1 A;  2D3B A;  2FIF A;  3BII D;  3DPD A;  1SSN A;  3IG3 A;  4MAC A;  3V3X A;  3ZXV A;  2WXR A;  5FKA C;  3UQB A;  1ZOY B;  1WIA A;  1NI2 A;  3JVZ X;  3CST A;  3DHI C;  1GJZ A;  3Q8C A;  1E8W A;  5IA7 A;  1D6E C;  2QSD A;  5JXV A;  3R7Q A;  4ARI A;  1ACC A;  2N7D A;  4TKN A;  3RT3 B;  4ZRJ A;  2QJL A;  4MEM A;  1NEN B;  3UIO B;  3NZ3 A;  4RF0 A;  4DDG D;  3AEB B;  3DBL I;  1J7B A;  5EE9 A;  4K7W A;  4DDI D;  4HKQ A;  1LXD A;  1TYG B;  4OHJ A;  4TUU A;  5J17 A;  4WQM A;  3V61 A;  2WXI A;  3IAM 1;  2LZ6 A;  2GI9 A;  1EU4 A;  4IKG A;  1YOV B;  1R4N I;  1OTR B;  2RGF A;  2DYM A;  3VTU A;  3A9K A;  1JWB D;  3P63 A;  4I6N B;  2AQ3 B;  2JU6 X;  3EA6 A;  3DCG A;  4WWO A;  4KX6 B;  2IO3 B;  3E9S A;  2G4S A;  3Q3O C;  4LLG M;  1A5R A;  1HZ6 A;  4TQ1 A;  4JL9 A;  1P9D U;  1UH6 A;  2MP2 B;  3CIR B;  3ZGZ A;  2D2Q A;  3UIN B;  1KLG D;  1VCB A;  2KD0 A;  4LK0 M;  1YJJ A;  2EEL A;  3S2A A;  3EUB 2;  3RUL A;  3TCA A;  5BMI A;  2N7J A;  1TKE A;  1MHH E;  3B9J A;  4OVU A;  2JRI B;  3I63 C;  1I4Q A;  2CHX A;  2NR2 A;  1GC7 A;  3VH4 B;  1TZ1 A;  1QZE A;  2IGG A;  3K9O B;  2CJO A;  2KQS A;  3FC4 A;  1XQQ A;  3ZNZ B;  1KH0 A;  4ZRP A;  2R2Q A;  1E90 A;  4K81 A;  4GB9 A;  4IW0 A;  1B9R A;  2JWZ A;  3MJ5 A;  1YNT E;  2WXN A;  3Q8B A;  1OEY J;  1UNS A;  4XYC A;  2QC8 A;  2LMC A;  3UI3 A;  1Z5S B;  1IBX B;  1C1Y B;  3Q3J A;  1WJ6 A;  2HJ1 A;  3Q69 A;  4AS1 A;  4RNA A;  4CYE A;  3IXS A;  4QAY A;  1BXT A;  4YL8 A;  4RF1 A;  4A3O A;  2MJ3 A;  1QKZ A;  4GDL B;  5IAA C;  5CTR C;  2KJR A;  3MJW A;  4BKS A;  2BVC A;  2ZVN A;  4HK2 A;  2D3A A;  3ZXR A;  1N62 A;  2V4I B;  2BWE S;  3DVN U;  3WAM A;  3WAL A;  3C0R B;  4II3 B;  3SFD B;  3QX1 A;  2ZVO A;  3L16 A;  4WAF A;  5EDS A;  2M56 B;  1HXY D;  4A55 A;  5FR3 A;  3ML8 A;  5AZF A;  2WP9 B;  4P7I A;  3HIZ A;  2K39 A;  4IWQ A;  4IDI A;  1FD6 A;  2VH2 A;  5G2N A;  3WA0 A;  3GS2 A;  1K50 A;  2DZK A;  1RYJ A;  2BS2 B;  1V8C A;  1KM7 A;  2GOW A;  5AEK B;  2HTH A;  2C7M B;  3HM6 X;  4H2A A;  1YJI A;  1GB1 A;  2OJW A;  3ZJU A;  4LJP B;  2PKO A;  1UZX B;  3U4E G;  2WWZ A;  2JXX A;  4ASW C;  3AE8 B;  3JSV B;  3DVG Y;  3VH3 B;  3NG0 A;  4DXG A;  2WDT B;  5J2R A;  1KLU D;  3T9L A;  2WXP A;  3R3M A;  4RFB A;  3UQA A;  3NHE B;  2PIA A;  1Q0W B;  2KMM A;  4EE2 A;  2KT7 A;  2N1W A;  1J8C A;  1JWS D;  4NJ7 A;  4EFO A;  3AE4 B;  2KO3 A;  1UF0 A;  4ZRQ A;  3VHT C;  3Q3F A;  2G4D B;  1GOZ A;  1PGA A;  2KTR B;  3E56 A;  4JIO U;  2CKH B;  2CU3 A;  1D5Z C;  3U2S C;  1PDX A;  1GUA B;  2LUM A;  2WS3 B;  5H92 C;  2J4X A;  3TBL D;  1C77 A;  3SFE B;  2TSS A;  2Y3A A;  1UGJ A;  3L17 A;  2JVC A;  1WMH A;  5AZG A;  3RCZ A;  3DBH B;  1JML A;  2CHW A;  3HK0 A;  3UF8 A;  3RI7 C;  1P7E A;  2K8C A;  2ZW1 A;  4I6P A;  1NYR A;  1V1P B;  4Q2J A;  1FFV A;  3AEE B;  2WXQ A;  5IKC M;  1I35 A;  2IGH A;  5D6J B;  4WAA A;  2BKF A;  2R61 A;  2DNF A;  5D7G A;  3PGE A;  4DQO C;  2I1K A;  4A3P A;  2WLB A;  4PYZ A;  2LEK A;  3Q3N C;  2AEH A;  3Q6B A;  3VQI A;  2IND C;  1R4N B;  3MP9 A;  4BFR A;  1WM2 A;  1C4P A;  1OFF A;  1EF1 A;  1OQY A;  2NBU A;  3AN1 A;  5JHB A;  2ZZP B;  3KYC D;  4W9J A;  3GE8 C;  1C4C A;  1MVK A;  2XK5 A;  4NAM A;  3ZJV A;  4WH4 A;  3L0W B;  1TKG A;  1WR1 A;  4P16 A;  1E7P B;  3LJ3 A;  3RNE C;  2O6V D;  3IFW B;  3N1Y C;  1RM6 C;  4G11 A;  4MEL A;  1T6B X;  1PQS A;  3ZJT A;  3VR9 B;  1JRP A;  3KVF B;  1E8Z A;  4NAW B;  4NQL B;  2W54 A;  1FRR A;  1JWU D;  4OVV A;  2ZNV C;  1BT0 A;  4M0W A;  4HRO A;  4F1S A;  3VRB B;  3L4P A;  2AL3 A;  3N30 A;  2KHW B;  1N63 A;  4YWG G;  1AYF A;  2BWF A;  5C23 A;  1EO6 A;  1V1P A;  2JY6 A;  2K6D B;  2LJI A;  4C56 C;  4KZ0 A;  2DZJ A;  2KVZ A;  1WGK A;  4KGT A;  4LDT D;  1FEH A;  3PS6 A;  1R7S A;  2I38 A;  2N0S B;  2W55 A;  4XDD A;  2MQJ A;  2L7R A;  1KFY B;  1I7H A;  4NJ6 A;  5MPO A;  1WR6 E;  1C79 A;  2H88 B;  3APD A;  2KWC A;  1K52 A;  3AUL A;  1YN3 A;  3MC0 B;  2OOB B;  1IGD A;  2IGD A;  3H7P A;  2YVC A;  5HG2 A;  4YT0 B;  1NYQ A;  1SBB B;  4K3C A;  3PHW B;  2BS3 B;  4KIK A;  1YX6 B;  3ZLZ A;  3H6N A;  2JZP A;  4M8N A;  2WHI A;  1XLQ A;  3P4S B;  1HTQ A;  5G5G A;  1T0Q C;  4BKS D;  3P4Q B;  2L05 A;  1KOT A;  2Y5C A;  4FJV B;  4LJO B;  2KFK B;  1J0G A;  4IM2 A;  1EWC A;  1P7F A;  1SIJ A;  4P6V F;  3GE3 C;  2NTS A;  1WE7 A;  3FIL A;  4WUR A;  1WRD B;  4OVZ A;  2V3P A;  1ZUD 2;  3C8Y A;  1HE8 A;  4KDL B;  1QOF A;  2A5U A;  2PE9 A;  3ZVV A;  2BB5 A;  5C1Z A;  4XZ4 A;  1VZ8 A;  4EUT A;  2ZPY A;  2BT6 A;  4J6I A;  1TT5 B;  2ZPN A;  1F2R C;  1DOX A;  4K1R B;  5T8I A;  4GOC A;  3P4R B;  4DK5 A;  3RFZ B;  2SAK A;  2HD5 B;  2V3N A;  2O6V A;  2BQQ A;  3ECI A;  3VTV A;  1WY8 A;  3A1Q B;  3ZNI D;  4ANW A;  3PRP B;  1L2N A;  3MHZ A;  4KIK B;  2W9N A;  1L7Y A;  3MC9 A;  1SJE D;  2GRI A;  2DHZ A;  3AV8 A;  1L0Y B;  1E9M A;  1ZDX A;  1IYF A;  2H89 B;  4AJW A;  3BVM A;  3AU5 A;  1FMA D;  2KX0 A;  4ZYN A;  3VVW B;  5BYQ A;  3EFU A;  1UD7 A;  4J3O D;  4W9I A;  1C76 A;  5DCN A;  1WGY A;  1WZ0 A;  4RMA A;  5GXG B;  1Q10 A;  1NDD A;  2J0J A;  3R2I A;  1YQ3 B;  4MJS A;  3BWU D;  2G45 B;  2N7E A;  1S3S G;  3DWM A;  3M95 A;  1MPE A;  3L54 A;  1VR9 A;  5IO9 A;  3OJ3 A;  1S1Q B;  1NI3 A;  2L0T A;  5G5H A;  2O2V B;  3FIL B;  3KWV A;  1TJE A;  1V5O A;  2NTT A;  3I9V 1;  3NUH B;  1ZDV A;  2KTF A;  3T3N A;  4NPN A;  3PSE B;  1SE2 A;  4JGH B;  2NVU I;  3GZN I;  4RCO A;  2WXG A;  4G50 A;  1G6J A;  2N1V A;  2LUE A;  1PGX A;  4ICU A;  3W5U B;  2DYO A;  4A20 A;  3I57 A;  1I4X A;  1WI0 A;  1C78 A;  1ZGU B;  3BY4 B;  2ICI A;  1GNU A;  1VD2 A;  2V1Y A;  3V60 A;  3HM3 A;  2JUO A;  1L0V B;  1HTO A;  2QEJ C;  4HWI B;  2WDQ B;  2RD0 A;  3B1L X;  3Q8E A;  1YMH E;  4KGR A;  2IJ0 A;  2KLC A;  1WXA A;  2DEN B;  2MJD A;  3URY A;  4EZL A;  2OHF A;  2V9H A;  1WX8 A;  4WWM A;  1MI0 A;  3NZU A;  3W1S A;  4OW0 A;  2KQ4 X;  2XK5 B;  2FUG 1;  2NPT B;  4CO7 A;  4HXD A;  4BBN F;  3PPA A;  3TMP B;  4N6E B;  2BYT A;  3X23 A;  4OZA A;  2R2O A;  3QAR A;  4L1B A;  5D94 A;  2WYQ A;  1DYQ A;  1SGH A;  2EKI A;  2BYF A;  1ET9 A;  3DDC B;  5CX3 A;  3K9P B;  1WGD A;  2LFI A;  2LXA A;  1PGB A;  2W82 A;  3DHG C;  4MGZ E;  3RPF C;  1TS2 A;  2IYD B;  1FXT B;  2D3G A;  1WF9 A;  1CJE A;  4M8M A;  2KDF B;  1E0Z A;  3JYU A;  1JW9 D;  1JQ4 A;  4KZC A;  4W9C A;  2D5G A;  3QK0 A;  3DBH I;  1WE6 A;  2L76 A;  3N1Z C;  3JW0 X;  4RH6 A;  1LGR A;  5AUI A;  2JQR B;  2CHZ A;  5L83 A;  5C3J B;  3QHT A;  3AEF B;  3BK1 A;  4P1B C;  1EU3 A;  3ONS A;  2Z59 B;  2PMV A;  3H1U A;  3Q3M C;  2RPV A;  3APF A;  1V5T A;  2AWT A;  2N9K A;  1E5W A;  1P98 A;  4OZC A;  2PPH A;  1XCQ L;  3A4R A;  1WXV A;  1CK1 A;  1L4D B;  1QOB A;  1UBQ A;  2DAF A;  5E6J A;  2JT4 B;  2D07 B;  2PEA A;  2WDV B;  1SIF A;  2BGF A;  2C9W B;  2IO0 B;  3RNA C;  3QJZ A;  1TTN A;  3GB1 A;  1R4M B;  2JRH A;  3RNB C;  1C9F A;  3P42 A;  2KDM A;  2O2V A;  2FBW B;  1KLV A;  2ACZ B;  1XLO A;  2MW5 A;  2C60 A;  4HEA 1;  4W9E A;  3TSS A;  3PZ7 A;  5H8Y E;  3KUZ A;  1H4R A;  1N6Z A;  2V4L A;  4AWJ A;  2KAC A;  3A4S C;  3AEC B; 
#chains in the Genus database with same CATH homology
 1F9J A;  3KYD D;  4BOZ B;  2CHW A;  2JZ3 B;  2LD9 A;  3HK0 A;  3A9J B;  4M0W B;  3UF8 A;  2GMI C;  2L8J A;  3EC8 A;  2J7Q B;  3NY5 A;  4E3C A;  1CMX B;  2LGD A;  2K8C A;  3JSV A;  4B9K A;  5LXI B;  1E7U A;  2LRU A;  4I6P A;  4ZRK A;  5LLI A;  2EMT A;  3SU8 X;  1IP9 A;  2BYE A;  1C3T A;  1P1A A;  4WWP A;  4GGQ A;  3W1S C;  2KKC A;  3OJ4 B;  3R7R A;  3MTN B;  3ZTC A;  2KDI A;  1I35 A;  2BYV E;  4WAA A;  2BKF A;  5D6J B;  3PRZ A;  5D7G A;  3PGE A;  4WJN A;  5JH5 C;  3OAW A;  3R66 C;  3WAO A;  4EEW A;  3ZUN A;  1Q5W B;  1R4M I;  1GG3 A;  1JRU A;  2I1K A;  3L13 A;  4A3P A;  2CU1 A;  4EZJ A;  2Y5B B;  4PYZ A;  2AEH A;  2L00 B;  4IUM B;  3X0W A;  3VQI A;  2O6V B;  4IWP A;  1OGW A;  2XEW A;  4BFR A;  4BOS C;  2AYO B;  2LAS A;  5CHV C;  4GDL A;  1WM2 A;  4WQO B;  3VFK A;  3A9K B;  3PRM B;  1UGM A;  3VDZ A;  3ZRF A;  1EF1 A;  2IO1 B;  1OQY A;  2NBU A;  1P3Q U;  2IBI B;  5J18 A;  3AXC A;  5JHB A;  2ZZP B;  3KYC D;  3O65 B;  4W9J A;  5AEK B;  3TJP A;  2FID A;  2HE7 A;  3KH0 A;  3P2B A;  2MA9 B;  3V62 A;  2XK5 A;  1WH3 A;  4BKT A;  4MJS B;  3QCA A;  1M94 A;  3L0W B;  5DPW A;  4MM3 A;  1WR1 A;  4HPL B;  2D11 A;  3LJ3 A;  4DXA B;  1U4A A;  2O6V D;  3MHS D;  3IFW B;  4XX5 A;  4G11 A;  4TQ0 A;  4FJY A;  2YLM A;  2DX5 B;  3V6E B;  1K8R B;  4MEL A;  1WM3 A;  3VXW A;  2KK8 A;  1PQS A;  4AJY B;  4X57 B;  2JPH A;  3KVF B;  2K1F A;  1TBE A;  1WFY A;  3TL5 A;  1WGR A;  1E8Z A;  1KJT A;  3SD5 A;  4NAW B;  3EEC A;  4NQL B;  1E8X A;  5AZH A;  4NY0 A;  3PRE A;  3ENE A;  2KAN A;  4OVV A;  2ZNV C;  2KQ7 A;  4DBG A;  1BT0 A;  1ZKH A;  2DZI A;  3WIM A;  5L95 C;  4LDT B;  2KZR A;  2NCN A;  3L10 B;  4F1S A;  5JHA A;  4BBN C;  1V86 A;  4GN1 A;  2LI5 A;  2PE6 B;  4DHZ E;  2KDB A;  2AL3 A;  4W9D A;  3N30 A;  3WAN A;  2KHW B;  5E6P A;  1YJ1 A;  1UEL A;  2N9E B;  2BWF A;  2KN5 A;  3QAQ A;  3KUD B;  1EO6 A;  5C23 A;  2JF5 A;  4IC7 B;  3ML9 A;  4GDK B;  2AL6 A;  3QWZ B;  1OEY A;  2ZCB A;  3IVF A;  3PLU A;  2BF8 B;  5BO4 B;  2ZEQ A;  2MWS B;  4GMV A;  3VUW A;  2JY6 A;  2K6D B;  3GOE A;  4JLC A;  2C7H A;  2MBH A;  4KZ0 A;  5JZE B;  2DZJ A;  3H9D A;  4I6L B;  3D32 A;  2IO2 B;  4LDT D;  2ZCC A;  3VAW A;  2FNJ B;  4KSL C;  3PS6 A;  4IWO A;  3VTW A;  2KTR A;  2A4Z A;  2EKE C;  4TV3 A;  4B95 A;  3L08 A;  1YX5 B;  2CS4 A;  4GU2 A;  4JQW C;  2MCN B;  3PZD A;  2MQJ A;  2EMS A;  3SDL C;  2D10 A;  2L7R A;  1SE9 A;  2GBR A;  4FLH A;  5KHO A;  2KXJ A;  1V2Y A;  3M62 B;  5E6N A;  1E7V A;  3U30 A;  4FHK A;  3PV1 A;  4NJ6 A;  1WR6 E;  2FCQ A;  1MG8 A;  4MGK E;  2KC1 A;  3RD2 A;  2FIF A;  2NBW B;  3APD A;  4KV2 A;  3ZDM C;  3DPD A;  2KWC A;  1NBF C;  4AUQ C;  3AUL A;  3PHX B;  1GC6 A;  4DHJ D;  3IG3 A;  2QHO A;  2FUH B;  4IM0 A;  2NBV B;  1RFA A;  1YQB A;  2REX A;  2K8H A;  3UQB A;  2OOB B;  1WJ4 A;  3H7P A;  4NNJ B;  1WIA A;  2YVC A;  1NI2 A;  3JVZ X;  3CST A;  1GJZ A;  3CSF A;  2J0K A;  1E8W A;  3PHW B;  2N9P C;  4KIK A;  4PS7 A;  1YX6 B;  2UYZ B;  3H6N A;  3ZLZ A;  2WX1 A;  4M8N A;  3WAP A;  2G3Q B;  4DHZ B;  3KUC B;  2LVP A;  4BKS D;  5IA7 A;  2N9X A;  2DAJ A;  3A33 B;  2KJ6 A;  2L05 A;  4DHJ B;  1KOT A;  3N32 A;  2MLB A;  3ZNG C;  4FJV B;  4ZDV A;  4LJO B;  1WX9 A;  3R7Q A;  2KFK B;  2BPS A;  1J0G A;  4IM2 A;  2Z0E B;  4II2 B;  4TKN A;  2N7D A;  1IPG A;  3RT3 B;  4ZRJ A;  4MEM A;  4CHK A;  3UIO B;  2CR5 A;  4MSM B;  3TIX A;  1WE7 A;  1Y8R C;  4FAD A;  4KDI C;  1WRD B;  2KWU B;  3A9J A;  1WYW B;  4W9H A;  4HLE A;  4E74 A;  2L3Z A;  2MP2 A;  3SHQ A;  5LXH A;  4DDG D;  2LVO A;  1HE8 A;  2A5U A;  2C5L C;  2I1J A;  4FHJ A;  4IM3 A;  2PE9 A;  3DBL I;  2GBN A;  4KDL B;  2LRW A;  3ZVV A;  5C1Z A;  2MBQ A;  4K7W A;  2MBO A;  4WWN A;  4DDI D;  1LXD A;  4XZ4 A;  4NQK E;  4TUU A;  5J17 A;  4EUT A;  2ZPY A;  2HJ8 A;  3AI5 A;  3M63 B;  4J6I A;  3V61 A;  5HKH A;  2C7N B;  5DPS A;  2LZ6 A;  2ZPN A;  5KHQ A;  1RAX A;  2KMC A;  4G0N B;  2KDE B;  4K1R B;  1R4N I;  1WJN A;  1OTR B;  2RGF A;  4K7U A;  2ZNV B;  2KJH B;  2DYM A;  4GOC A;  3VTU A;  3A9K A;  1WXS A;  2LXC A;  4I6N B;  3W1Y A;  2DZM A;  3I3T B;  3IHP C;  2XBB C;  4DK5 A;  4W9G A;  4HDQ A;  3ZIM A;  2HD5 B;  3DCG A;  4ANX A;  3ZNH B;  1XD3 B;  2O6V A;  4WWO A;  3ZO5 B;  1V9J A;  2IO3 B;  2PJH A;  3ECI A;  3VTV A;  1RRB A;  1WY8 A;  1EF5 A;  2G4S A;  3A1Q B;  4MH0 E;  3ZNI D;  4ANW A;  5DPR A;  1WZ3 A;  2M0X A;  3PRP B;  1A5R A;  4KIK B;  1L2N A;  4TQ1 A;  2W9N A;  3ZKJ C;  3ZTD A;  2GBK A;  2KFJ A;  2RPQ A;  1L7Y A;  3HHM A;  4JL9 A;  2DHZ A;  1P9D U;  1UH6 A;  1XT9 B;  2LGY A;  2MP2 B;  3VUX A;  4EZK A;  3PTF C;  2D2Q A;  3UIN B;  3RUI B;  1IYF A;  2M17 A;  1VCB A;  4WJP A;  4AJW A;  4XC2 A;  3AU5 A;  2KC2 A;  3U8Z A;  4EOY A;  1ISN A;  2KD0 A;  2KX0 A;  4ZYN A;  3VVW B;  2J0M A;  2B3A A;  1UD7 A;  3EFU A;  3S2A A;  4W9I A;  3RUL A;  1RLF A;  3T8M A;  3TCA A;  4URK A;  5DCN A;  3DQV A;  1WGY A;  1WZ0 A;  4RMA A;  4B6W A;  1T0Y A;  4OVU A;  1NDD A;  4BVU C;  2JRI B;  3U7D A;  2J0J A;  1WMH B;  4PS8 A;  4AP4 C;  3EHV A;  3APC A;  4MJS A;  4WJO A;  2G45 B;  2N7E A;  1S3S G;  2WX0 A;  3M95 A;  3L54 A;  4PYU A;  3PLV A;  3PT2 B;  2ASQ A;  2CHX A;  2NR2 A;  1GC7 A;  3OJ3 A;  1S1Q B;  3VH4 B;  1Z2M A;  1TZ1 A;  1QZE A;  2L0T A;  3K9O B;  1D3Z A;  2KQS A;  3VUY A;  2O2V B;  1XQQ A;  1YIW A;  3QA8 A;  3ZNZ B;  1UBI A;  2JZZ A;  2BKR B;  4HJK A;  1V5O A;  2FCM A;  2R2Q A;  3IBE A;  4MDK E;  1E90 A;  4K81 A;  2OJR A;  2KTF A;  3QQ8 B;  4GB9 A;  4NPN A;  2MRP A;  3PSE B;  4IW0 A;  4F7Z A;  2IY0 B;  3RZW C;  4N9F 4;  2JWZ A;  4JGH B;  2NVU I;  3ALB A;  3GZN I;  1WXM A;  1OEY J;  4GDK A;  4G50 A;  4FUL A;  1G6J A;  2FCS A;  2N1V A;  4FJZ A;  4AOF A;  4PS3 A;  2LUE A;  1Z5S B;  4IG7 B;  4ICU A;  2DYO A;  4A20 A;  1P0R A;  2KX3 A;  1C1Y B;  2DYB A;  3A1Q A;  1WI0 A;  3KW5 B;  3Q3J A;  2GBM A;  1WJ6 A;  4G3X B;  4ANV A;  4BKG A;  1V49 A;  1ZGU B;  3BY4 B;  2KOX A;  4CYE A;  5TR5 A;  1X1M A;  3CMM B;  1GNU A;  1VD2 A;  2V1Y A;  4YL8 A;  4A3O A;  3V60 A;  3HM3 A;  4ICV A;  4ZRI A;  2JUO A;  1V81 A;  4ANU A;  4GDL B;  5D2M B;  2KVR A;  4HWI B;  3B1L X;  2RD0 A;  4MGY E;  5IAA C;  4K7S A;  2KLC A;  2K8B A;  5CTR C;  2LVQ A;  2KJR A;  1WXA A;  2DEN B;  3MJW A;  3ZDT A;  4BKS A;  1LFD A;  4EZL A;  2ZVN A;  4RM9 A;  2GBJ A;  4HK2 A;  5E6O A;  1ZW7 A;  1WX8 A;  2L0F A;  3NZU A;  3W1S A;  2M8S A;  4RM8 A;  2LWP A;  3CF6 E;  2Z0D B;  2XK5 B;  3RYT A;  2K25 A;  3AU4 A;  4EKU A;  2NPT B;  5G55 A;  3QC8 B;  4HXD A;  2FAZ A;  4BBN F;  4CO7 A;  2M4N A;  3PPA A;  2BWE S;  3DBR I;  3DVN U;  3TMP B;  3WAM A;  3WAL A;  3ZRC A;  3C0R B;  4II3 B;  4MGI E;  3DOW A;  3X23 A;  4W9K A;  4GXB A;  1Q1O A;  5DPT A;  3QX1 A;  4MSQ B;  2R2O A;  2ZVO A;  5GMV A;  2LGX A;  1WGG A;  3L16 A;  3QAR A;  4NAW A;  5EDS A;  3N3K B;  5D94 A;  2WYQ A;  1TGZ B;  3ML8 A;  4HDO A;  5AZF A;  3QIJ A;  4P7I A;  3HIZ A;  2K39 A;  1SGH A;  2RSU A;  2KWV B;  2RR9 A;  3H7S A;  2IY1 B;  4IWQ A;  2BYF A;  4E71 A;  3DDC B;  5CX3 A;  5G2N A;  3WA0 A;  3K9P B;  1WGD A;  3NS8 A;  2KMA A;  4HVB A;  2LXA A;  3BIN A;  2DZK A;  3DVN V;  3UGB B;  2MBB B;  4MGZ E;  1KM7 A;  2IYD B;  2MBE A;  2GOW A;  1EUV B;  1FXT B;  1LM8 B;  1WF9 A;  2C7M B;  2D3G A;  2HTH A;  3HM6 X;  5CHF A;  1WX7 A;  4M8M A;  2NS5 A;  2KDF B;  3OLM D;  3RZF A;  3JYU A;  2VRR B;  4KSK C;  4LJP B;  2KNB A;  1UZX B;  4FBJ B;  3DVG X;  4KZC A;  2WWZ A;  2JXX A;  1WGH A;  4W9C A;  3H7P B;  3QK0 A;  4DWF A;  3DBH I;  1WE6 A;  2L76 A;  3JW0 X;  4ASW C;  1YD8 U;  3JSV B;  4WJQ A;  3DVG Y;  3LDZ E;  3VH3 B;  2CHZ A;  2FCN A;  5L83 A;  3QHT A;  4W9L A;  3UIP B;  2WDT B;  5J2R A;  3ONS A;  3DBS A;  4KVG B;  3T9L A;  2IZV B;  2Z59 B;  4W9F A;  2MSE D;  3R3M A;  4F8C B;  3H1U A;  3APF A;  3UQA A;  3NHE B;  3PVL A;  1V5T A;  2AWT A;  1Q0W B;  2UWQ A;  4HCP B;  1E5W A;  1P98 A;  2PPH A;  2V3S A;  1WJU A;  1WXV A;  2LJ5 A;  2N1W A;  3A4R A;  1UBQ A;  2DAF A;  3M3J A;  3B0A A;  1J8C A;  2JT4 B;  4NJ7 A;  2D07 B;  2PEA A;  1E8Y A;  1SIF A;  4HCN B;  2BGF A;  2C9W B;  2IO0 B;  4EFO A;  2KO3 A;  3QJZ A;  1H8C A;  5FR6 A;  3VHT C;  1TTN A;  2K6Q A;  3Q3F A;  1V6E A;  2G4D B;  2KTR B;  4FA6 A;  4JIO U;  2CKH B;  2JRH A;  1J19 A;  5CHW A;  4FN2 A;  1GUA B;  2M1M A;  3ZW3 A;  1LQB A;  1I42 A;  4GSW A;  3V6C B;  3TBL D;  1AAR A;  2O2V A;  1KLV A;  4GIV A;  2KLG A;  2KFK A;  4LCD E;  2MW5 A;  2C60 A;  2MX2 A;  2NPT A;  3NOB A;  4W9E A;  2ZJD A;  3B08 A;  3L17 A;  3KUZ A;  2JVC A;  4HPM B;  3NZS A;  1WMH A;  1H4R A;  5AZG A;  2N4F A;  2V4L A;  4AWJ A;  1V80 A;  3A4S C;  3RCZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...