1UGMA

Crystal structure of lc3
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
113
structure length
113
Chain Sequence
KTFKQRRSFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESERDEDGFLYMVYASQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Microtubule-associated proteins 1A/1B light chain 3
publication title The crystal structure of microtubule-associated protein light chain 3, a mammalian homologue of Saccharomyces cerevisiae Atg8
pubmed doi rcsb
source organism Rattus norvegicus
total genus 34
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2003-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1ugmA00
5IAAC 2KDIA 2AL3A 3OLMD 2ZZPB 4ZRKA 3BINA 3VH4B 4ANWA 1RAXA 2BGFA 4ICUA 5DPRA 1D3ZA 2J7QB 1WIAA 2ZVNA 1NBFC 4GMVA 2BYVE 3PLUA 2G3QB 1UZXB 2KOXA 3NZSA 3QQ8B 4TV3A 4DHZB 4A3OA 2K39A 4MM3A 2D07B 2D3GA 5CHFA 5FR6A 3W1SC 2M1MA 2WYQA 3ZUNA 4RM9A 2YLMA 3A4SC 4MGYE 2Y5BB 3SDLC 3ZKJC 1YD8U 2BKFA 4EEWA 2L0TA 3S2AA 1Q1OA 1VD2A 3TBLD 2ZVOA 3DDCB 4GB9A 1V6EA 2DZJA 3V6EB 2KDEB 2KWCA 2M17A 3DQVA 4WJPA 1WXSA 3A4RA 3R3MA 4RM8A 2IZVB 2C60A 1WXMA 3TJPA 2K25A 2KK8A 2GBMA 3MHSD 1WXVA 4DHJB 4GXBA 2QHOA 5KHOA 4FHJA 2WDTB 1C1YB 1IPGA 3VTWA 2KTRA 4G11A 5AZHA 2KTRB 2MBBB 3ZO5B 1ZGUB 2JZ3B 3HM6X 3QARA 1LM8B 3AU5A 2G4SA 4FBJB 2HJ8A 3UINB 2O6VA 4W9CA 4CYEA 4G50A 4FA6A 4I6NB 2L00B 2O6VB 3RZWC 3PHWB 1VCBA 2V1YA 4ANUA 1YJ1A 2N4FA 1Q0WB 3VQIA 2DYOA 3IFWB 4G3XB 2XEWA 3H1UA 4CHKA 3N32A 5D2MB 1WX9A 1WGHA 3DCGA 1LQBA 3JSVA 3KVFB 4B6WA 3ONSA 2A5UA 3OAWA 3WANA 1BT0A 2WWZA 3MTNB 4HDQA 4EFOA 1OEYJ 2BF8B 3KH0A 2V4LA 1GNUA 3KUDB 2KFJA 1P9DU 2JZZA 2IO0B 3JVZX 1WZ0A 4FULA 4NAWA 2KX3A 4MH0E 1E5WA 1Z5SB 2M0XA 3ZNGC 1KOTA 3QX1A 1V80A 4NAWB 4XC2A 5C23A 3SD5A 4K1RB 2KMCA 1YX6B 2L76A 2I1JA 3BY4B 4W9LA 2ZPNA 1SGHA 3APDA 3M63B 3PVLA 3VUXA 1C3TA 3KW5B 2KC2A 4WJQA 4HJKA 5KHQA 1E8ZA 4EZLA 3HK0A 4F8CB 5D6JB 5DPSA 4BOSC 3LDZE 4DK5A 2MX2A 4JL9A 3V62A 4N9F4 1I42A 2CS4A 2DX5B 1WGDA 4K7WA 4KVGB 3M95A 5CTRC 3AULA 1E7VA 1HE8A 3UF8A 4BVUC 2MA9B 2BPSA 4A3PA 1WMHA 1A5RA 3H6NA 4JGHB 3QAQA 3JW0X 5JH5C 1WMHB 3ZDTA 4DHZE 4KDIC 3HM3A 2LGYA 1CMXB 3ZVVA 2EMSA 2KJHB 3N3KB 3L13A 4KIKA 4GN1A 5LXHA 2MQJA 4AJYB 3DVNU 3TIXA 3WAMA 1WE7A 3T8MA 3ECIA 2C7NB 4RMAA 2UWQA 2C9WB 3L54A 5L83A 5G55A 2AYOB 4GDKA 1ZKHA 3CF6E 3NHEB 4PYUA 2DYMA 4FN2A 5IA7A 4BFRA 1MG8A 4WQOB 2NPTA 4K7SA 4IWQA 2NPTB 4ZYNA 2LUEA 2OJRA 1JRUA 2NBUA 1ISNA 1WZ3A 2N9PC 4PS3A 2A4ZA 3AXCA 4B95A 2JWZA 4II2B 4W9GA 1WJNA 2I1KA 2CKHB 3RUIB 3V60A 1WGYA 4WJNA 1V49A 3VHTC 2KQSA 1KJTA 3CMMB 4MGZE 1WJ4A 5CHWA 3RD2A 3VDZA 3DVGX 3WALA 2KDFB 5BO4B 1WI0A 4I6LB 2JY6A 3R7QA 2LZ6A 3KUCB 2EMTA 3R7RA 1UELA 1WGGA 2KDBA 4TKNA 2MBOA 3QHTA 4K81A 1Z2MA 2ZJDA 3RT3B 3ENEA 3R66C 2V3SA 4HPLB 3ZRFA 3U8ZA 1K8RB 2GOWA 1TBEA 3ZNHB 4AOFA 2FNJB 4KZCA 4F1SA 4HPMB 4IM3A 3UIOB 2RD0A 4BBNC 4GOCA 1UBQA 2KZRA 2WX1A 3H9DA 4IUMB 4II3B 5GMVA 4PS8A 2KN5A 4BBNF 4I6PA 2BKRB 3B1LX 3DVNV 3PTFC 3VVWB 2FCMA 3W1YA 1TZ1A 1XD3B 3ML8A 2KO3A 2KNBA 2PE6B 3ALBA 3V6CB 3ZNZB 4ZRJA 3RULA 3VTVA 2N7DA 3DBRI 4HLEA 4BKSD 4WWPA 2D11A 1YQBA 3B0AA 1WX7A 2C5LC 2LJ5A 2KVRA 2IO3B 2EKEC 3WA0A 4W9KA 3D32A 3WAPA 2FCNA 3L16A 2HE7A 2FIFA 1WFYA 5L95C 5J2RA 3V61A 1J8CA 4AWJA 2IO2B 3NS8A 3GZNI 3QK0A 3Q3FA 3PT2B 2KWVB 1WJ6A 3DOWA 3PV1A 2L3ZA 2GBJA 2AWTA 3UQBA 1OTRB 4W9JA 4WAAA 2ZEQA 3ZTDA 2KLGA 3NOBA 2AEHA 2VRRB 4MDKE 1E7UA 4NJ7A 4IW0A 1LFDA 2FUHB 2JUOA 2L0FA 2K1FA 3IHPC 3LJ3A 5E6PA 1SIFA 2NCNA 2DENB 3APFA 1L2NA 3T9LA 3ML9A 1OGWA 5JZEB 2RSUA 4W9HA 3H7PA 1P1AA 2M8SA 3EHVA 5CHVC 1H4RA 1GC6A 1J0GA 3H7PB 1S3SG 1OEYA 2KJRA 1ZW7A 2KX0A 1V2YA 5LXIB 2PJHA 3VUWA 2D2QA 4GGQA 4A20A 1KM7A 1IP9A 4DXAB 3CSTA 2FCSA 3AI5A 2MWSB 3B08A 4E74A 4KSLC 2K6DB 4NQLB 3L17A 4PS7A 4XX5A 2RGFA 3N30A 4FJVB 2GBRA 3L0WB 2W9NA 3UQAA 1EUVB 3QIJA 4TQ0A 2N1WA 3A9KA 1V81A 1WR6E 4J6IA 3IG3A 3A9KB 2BYEA 3C0RB 3AU4A 4G0NB 1GJZA 4E3CA 3KYCD 2JXXA 1OQYA 3DBLI 4LJPB 5D7GA 3WAOA 2Z0DB 3X0WA 4FLHA 2PE9A 2BWFA 3U7DA 1WJUA 4JQWC 2DZMA 4YL8A 2ASQA 1M94A 2GMIC 2K6QA 1Y8RC 3IVFA 3L10B 4KZ0A 4ANVA 2CR5A 4B9KA 4NY0A 4EOYA 1H8CA 3VFKA 4URKA 2NVUI 1G6JA 3ZTCA 5AEKB 2REXA 3DPDA 3CSFA 4HDOA 3UGBB 5DCNA 1NDDA 1I35A 3X23A 2KHWB 2JF5A 4W9DA 4IG7B 4GIVA 2L05A 4HCPB 4PYZA 2CHXA 3TMPB 4W9IA 2KANA 3A9JB 2KKCA 2R2OA 5JHAA 2UYZB 1R4MI 4EUTA 1P98A 1TTNA 2MBHA 4OVUA 2LRUA 3WIMA 4WWOA 5AZGA 2GBKA 4FADA 1AARA 3PRMB 4NNJB 1RLFA 3DBHI 1WRDB 2KMAA 1GUAB 2D10A 4WWNA 2B3AA 2IO1B 3PGEA 2LVOA 4XZ4A 4EZKA 3U30A 2R2QA 3EC8A 2FCQA 4ASWC 3ZLZA 3OJ3A 2DZKA 2LASA 2JPHA 4DDID 2DHZA 3ZNID 2O6VD 2G4DB 1E8XA 1T0YA 2NBWB 4NQKE 4W9FA 4M0WB 2ZCBA 1V5TA 2MLBA 5DPTA 3ZDMC 2Z59B 1EF5A 4EKUA 3DVGY 4JIOU 4IWPA 4BKTA 1QZEA 4IC7B 2OOBB 4LJOB 2BYFA 1V5OA 1UH6A 4ZRIA 2LGDA 4EZJA 2LVPA 2GBNA 2M4NA 4DWFA 2XBBC 2N9XA 3ZW3A 4IM2A 3QCAA 2KXJA 4MSMB 2LI5A 2JRIB 3IBEA 4KV2A 3RZFA 4MJSA 2N7EA 3OJ4B 2KFKA 1E8WA 1GC7A 3EFUA 4MJSB 2LVQA 2NR2A 4FJZA 2KFKB 1X1MA 4MGIE 2FIDA 3K9OB 4LDTD 1WX8A 3QJZA 5E6NA 1E8YA 1EO6A 2LWPA 3ZRCA 2ZNVB 3M3JA 1P3QU 3PZDA 1WGRA 1EF1A 2O2VA 3PPAA 2O2VB 3PREA 2JVCA 4CO7A 3TCAA 3NZUA 2CHZA 3UIPB 3DBSA 2LXAA 3L08A 3A33B 3O65B 2NBVB 5HKHA 2XK5A 5C1ZA 1UD7A 4GSWA 3P2BA 2HTHA 3SHQA 2XK5B 4GDLA 2G45B 5D94A 4LCDE 1NI2A 3APCA 4GDLB 2K8BA 1WH3A 4FJYA 2WX0A 3QC8B 2DAFA 1WM2A 2MRPA 4MSQB 5CX3A 4M8NA 1RRBA 2JT4B 5JHBA 4HK2A 3PRZA 1SE9A 2Z0EB 2ZPYA 3RCZA 2MW5A 1GG3A 4AJWA 4HCNB 2KLCA 3EECA 1IYFA 3MJWA 3JSVB 3VH3B 5AZFA 2MCNB 3KYDD 1R4NI 2MP2A 1E90A 5EDSA 2NS5A 2MP2B 3QA8A 1V86A 4IWOA 4BKSA 3W1SA 2J0MA 4W9EA 2IY1B 4KDLB 3K9PB 3M62B 3HIZA 1KLVA 2IYDB 2RPQA 2J0JA 1WYWB 4F7ZA 1F9JA 3H7SA 1TGZB 4FHKA 1XQQA 1WF9A 2CU1A 2KWUB 3JYUA 3PS6A 4LDTB 2J0KA 1FXTB 3Q3JA 1XT9B 2KC1A 1Q5WB 2PEAA 5J18A 4HXDA 4HWIB 4K7UA 2L7RA 4NJ6A 4KSKC 4WJOA 4ANXA 5G2NA 4AUQC 2DZIA 4TUUA 1WY8A 2C7MB 4DDGD 4MEMA 2CHWA 2MSED 2LRWA 1RFAA 3A1QA 2HD5B 2PPHA 2IY0B 4BKGA 1WM3A 2L8JA 1WXAA 4IM0A 3A1QB 2IBIB 5E6OA 2RR9A 5LLIA 3TL5A 2LGXA 3VUYA 1PQSA 2DYBA 2C7HA 1L7YA 1WR1A 3PHXB 4KIKB 4E71A 1LXDA 1UGMA 2KQ7A 4HVBA 3HHMA 4MELA 3PSEB 1P0RA 2MBEA 2ZCCA 3ZIMA 2N1VA 4M8MA 2FAZA 3A9JA 2KD0A 4MGKE 5TR5A 2YVCA 5J17A 2LXCA 3PLVA 4JLCA 1WE6A 2ZNVC 4BOZB 1U4AA 3I3TB 1V9JA 3KUZA 4GDKB 3NY5A 4TQ1A 2K8CA 4DHJD 2MBQA 3PRPB 4P7IA 4NPNA 2BWES 2KTFA 3VTUA 2DAJA 4X57B 4AP4C 4DBGA 2KJ6A 2LD9A 1S1QB 1YX5B 3SU8X 2N9EB 3VXWA 1J19A 3RYTA 3QWZB 4GU2A 3VAWA 2K8HA 3GOEA 5DPWA 4ZDVA 1YIWA 2JRHA 4ICVA 4OVVA 1UBIA 2AL6A
chains in the Genus database with same CATH superfamily
3P4PB 4WH4A 3OLMD 2ZZPB 2BGFA 4ICUA 1D3ZA 1VRAB 1B9RA 3B2GA 2KOXA 3UI3A 4A3OA 3W1SC 4MM3B 3AE7B 2M1MA 4MGYE 1HZ5A 2DLBA 4LNIA 3S2AA 2XNAC 1V6EA 2DZJA 2FE8A 2KDEB 2KWCA 2M17A 1B1ZA 3DQVA 1FFVA 3A4RA 4RM8A 2IZVB 3W9CB 4XWTA 4GXBA 4FHJA 2K9XA 1C1YB 1TKEA 2WDTB 5AZHA 5IKCM 2MBBB 1ZGUB 4ACFA 1CJEA 4OVVA 1UWXA 2L00B 4YSYB 3TSSA 1NEKB 4A90A 4CHKA 1WGHA 1LQBA 3KVFB 1RYJA 3KH0A 1QQRA 1CZPA 2HDEA 2IO0B 1WZ0A 4FULA 1E9MA 3AE2B 1E5WA 5C23A 1YQ4B 3NZ3A 2L76A 4A6QA 1SGHA 1SJED 3APDA 3VUXA 1ZOYB 4WJQA 5KHQA 4H2AA 4EZLA 3HK0A 3NVWA 3LDZE 4BOSC 4DK5A 2MX2A 4JL9A 1I42A 4N9F4 1L0VB 1YN4A 3AULA 2RDBC 3UF8A 4YXDB 2JYTA 1WMHA 3JW0X 2H89B 2Y5CA 3ZVVA 2EMSA 1N62A 1GB4A 3N3KB 3L13A 4GN1A 2MQJA 3J9CA 3DVNU 4AJYB 2Z8LA 4RMAA 3R2IA 3H8HA 2C9WB 3L54A 4ZRPA 2AYOB 1RFKA 2DYMA 3EUB2 3NJTA 4BFRA 1MG8A 4RGNA 1VLBA 2NPTA 4RF1A 4IWQA 2OJRA 3RNBC 2L83A 4PS3A 2A4ZA 3Q8CA 2JWZA 3RUIB 4RGMA 1L6UA 4WJNA 3VHTC 1KJTA 4MGZE 1WJ4A 5CHWA 3VDZA 2LZ6A 2EMTA 4M02A 4C4VA 5FR3A 2N9LA 3QHTA 3SR6A 3LXFA 3R66C 1FPYA 4HPLB 3BYTB 2GOWA 2PW9A 2UU7A 4KZCA 4F1SA 2W3SA 5EE0A 4GOCA 5IP4D 4II3B 4BBNF 2BKRB 3W1YA 1L0YB 3ML8A 2KO3A 2PE6B 3ALBA 3V6CB 3RULA 4LTUA 3DBRI 4NAMA 4WWPA 2D11A 2N7JA 2C5LC 2KVRA 2IO3B 2EKEC 3WA0A 4W9KA 3D32A 3V3XA 3WAPA 3NS1A 2FIFA 5J2RA 2MH7A 3V61A 2PLPA 3GZNI 5IN7A 2KWVB 4US8A 1VR9A 2AWTA 3HUIA 1N5WA 4MDKE 2FUHB 1JWSD 5HHDG 5E6PA 1SIFA 2NCNA 4IKGA 3T9LA 1OGWA 1KLUD 2RSUA 1P1AA 5CHVC 1H4RA 1GC6A 1SIJA 1GB1A 2WNMA 1OEYA 1ZW7A 1MHXA 3RFZB 2D5GA 2PJHA 2D2QA 1F0ZA 3AE6B 1HXYD 2J52A 3FC4A 1IP9A 4KSLC 3U4EG 1J7AA 1NYRA 2N1WA 1V81A 3MC0B 4J6IA 3A9KB 4C7YA 1P7FA 1GJZA 4OW0A 1OQYA 3X0WA 2Z0DB 2DBYA 4XYCA 3RNAC 4JQWC 3IVFA 1Y8RC 2CR5A 3VFKA 1G6JA 5G5GA 5AEKB 1DGJA 2REXA 2I2YA 4N59A 5DCNA 2WXIA 3X23A 2JF5A 4GIVA 2CHXA 3TMPB 1L5PA 2R2OA 4YTMB 2WU5B 3GZNB 1TTNA 1BXTA 2LRUA 2GBKA 3Q8AA 1WRDB 4WWNA 2WXGA 3PGEA 2IO1B 4XZ4A 3EC8A 2AX5A 1TY0A 1KRHA 2LASA 4DDID 1QILA 3ZNID 4YTPB 2NBWB 1JMLA 2MLBA 1DOYA 1EF5A 4KKIA 4IWPA 4ARCA 2QEJC 2ON8A 2LGDA 3P4SB 2N9XA 2LUMA 3RZFA 3AEGB 4MJSA 4KX6B 3OJ4B 3EFUA 4FJZA 4MGIE 4XDDA 5E6NA 3MFGA 1EO6A 2LWPA 1UWMA 4L23A 3M3JA 1EF1A 5AUKA 2JVCA 3TCAA 1Y56A 4C7ZA 3L08A 1IGCA 3FAHA 3I63C 2HTHA 4GDLA 1NI2A 1FRDA 1WM2A 1T3QA 4RFBA 4M8NA 1RRBA 5JHBA 3RCZA 1C77A 1SE9A 2Z0EB 2ZPYA 3KQ4A 2MW5A 3BVMA 1YJJA 4P1BC 1K53A 1SEBD 1R4NI 2MP2A 2NS5A 3QA8A 1P7EA 3W1SA 4ZYSA 2IY1B 2NMQA 4B0MA 1WYWB 2OHFA 4OZAA 1TGZB 3CIRB 4FHKA 1NVID 2X8XX 1ZUD2 1E7PB 1WF9A 2KWUB 3PS6A 4LDTB 3B9JA 3Q14C 1Q5WB 1FCCC 4HXDA 4NJ6A 4KSKC 1WY8A 2FUG1 2IY0B 1WXAA 1ZDXA 2IBIB 5E6OA 2J42A 2WS3B 4JWUC 1L7YA 4KIKB 4HVBA 3AE3B 2N1VA 2WDVB 4MGKE 3Q8BA 1WE6A 3KUZA 2BQQA 1FNWA 2BWES 2KTFA 1C4CA 2DAJA 4X57B 2KJ6A 3SU8X 1C78A 4RGOS 2ACZB 2WHIA 3VXWA 2B76B 2IPKD 4A8XC 3RI7C 4J3OD 1UBIA 1TZOA 3JVZX 5G5HA 4Q2JA 2KDIA 4XGAB 2AL3A 4ANWA 5DPRA 2GRIA 4GMVA 2BYVE 4TV3A 1UZXB 4P1CC 4DHZB 4MM3A 1TKGA 2D3AA 3ZUNA 2YLMA 5BMGA 2Y5BB 3Q3MC 2AQ1B 4EEWA 2BKFA 2L0TA 1Q1OA 1VD2A 2ZVOA 3DDCB 3V6EB 4WQMA 1WXSA 2PTLA 3R3MA 2K25A 2Y5PA 4DHJB 1WXVA 3Q2AC 2QHOA 3R2TA 3VTWA 4OVZA 3ZGZA 3ZO5B 1CK1A 2G4SA 4CYEA 3PHWB 4RF0A 2V1YA 2N4FA 3ZYYX 2J53A 5D2MB 1WX9A 2LHEA 3DCGA 3JSVA 2L52A 3ONSA 4LNOA 2VZKB 1BT0A 3MTNB 4HDQA 2BF8B 1YOVB 2GB1A 3RNGC 1XLPA 2M0XA 5BYRA 5BYSA 4NAWB 4XC2A 3LYYA 1STEA 3SD5A 2W82A 3ZXRA 2V3PA 3SFEB 1YX6B 1XCQL 3TUOA 2I1JA 4W9LA 3M63B 1DYQA 3KW5B 4ZHOA 4XE0A 2KC2A 5EE1A 5C2TB 4F8CB 5D6JB 5DPSA 3OWEB 2I38A 4TSSA 2MA9B 4NJCA 1A5RA 2VH2A 3N1YC 5C3JB 5JH5C 1WSPA 1FXAA 2LGYA 1CMXB 5BMIA 5LXHA 2ONQA 1JRPA 3WAMA 3NVVA 3T8MA 2BB6A 4K3CA 1AYFA 4YT0B 4MH8A 3L4PA 5L83A 5G55A 4GDKA 3BVZA 3CF6E 5IA7A 4AQ7A 4WQOB 5JXVA 4M01A 1ISNA 1WZ3A 4N6EB 4US9A 1L4DB 3P1MA 2CKHB 2WU2B 2PVOD 3V60A 1WGYA 4S0RA 2KQSA 1N5XA 3CMMB 3WALA 3R7QA 1ZP0B 3KUCB 3R7RA 2BTEA 1WGGA 4TKNA 2MBOA 4RCOA 4K81A 3RT3B 1DOIA 1YMHE 1AW7A 2V3SA 3P63A 3U8ZA 1TBEA 4AOFA 2FNJB 1JWUD 4BBNC 2D3BA 1UBQA 2WX1A 3AE1B 1VDVA 4DQOC 3H9DA 4IUMB 1F1HA 3NVZA 5GMVA 4KKJA 2KN5A 3B1LX 2MJDA 1L6VA 1R7SA 3ZNZB 4LNNA 2N7DA 3U52E 1MFWA 4OZBA 3PZ7A 2LJ5A 1HEZE 1PGXA 2INPE 5LNK1 1WFYA 2XN9C 3V05A 5H8YE 2IO2B 2SAKA 3QK0A 1XCTL 3PT2B 1WJ6A 3PV1A 3Q3NC 3UQBA 4W9JA 4WAAA 1EU3A 2K3UA 3ZTDA 1SJHD 3GE8C 3MC9A 2AEHA 1E7UA 4NJ7A 1TS2A 1OFFA 2DENB 4P6VF 2MJEA 5JZEB 4TMAB 3EHVA 3H7PB 2KJRA 2G1EA 5LXIB 2BYTA 3T3NA 4B0EA 4WIPA 4DXAB 2WQYB 1MHHE 3B08A 4E74A 1D6EC 2WXNA 3EGRA 1QOGA 2L1AA 1HZ6A 2WXQA 1EUVB 3QIJA 4TQ0A 4HEA1 3A9KA 4YWGG 2BYEA 5TSSA 4BAXA 3AU4A 4E3CA 3T3OA 3DBLI 4LJPB 3WAOA 1WJUA 3N20C 4YL8A 2GMIC 3L10B 4JWSC 2FBWB 2BB5A 1BMLC 1NDDA 4HRSA 4W9DA 4HJGE 2DNFA 4W9IA 4UDUC 2KANA 3BZDB 3TEYA 1R4MI 1ZPSA 1P98A 2PIAA 5AZGA 1HTOA 1GUAB 2B3AA 2LVOA 3U30A 1ZE3D 2FCQA 4ASWC 4WAFA 3GP7A 3AE5B 3OJ3A 2DHZA 1QKZA 1ESFA 4M0WB 1V5TA 5DPTA 1C9FA 3ZDMC 4FXCA 1XF5L 4JIOU 1IGDA 1QZEA 1V1PB 4ZRIA 4EZJA 2LVPA 1MI0A 1NYQA 1TY2A 2LI5A 5FKAC 3IBEA 4KV2A 1E8WA 4USAA 2NR2A 1WX8A 3QJZA 1E8YA 3GB1A 3ZRCA 2ZNVB 3PZDA 2JZPA 2O2VB 3UIPB 3DBSA 2LXAA 3A33B 1SXTA 1E10A 3DBLB 5C1ZA 2XK5B 4LCDE 1ROEA 2K8BA 3KLSX 2WX0A 3QC8B 5IOIA 2MRPA 5CX3A 1PUTA 3RPFC 3IAM1 2GLSA 1GG3A 3AECB 4HCNB 1FMAD 3VH3B 3KYDD 1E90A 4C00A 1EM7A 1J7CA 1V86A 1R4MB 2J0MA 4KDLB 3M62B 1KLVA 2J0JA 1F9JA 2BS3B 1BUIC 3JYUA 1FXTB 1YJIA 3ZJUA 3C19A 2KC1A 2PEAA 4WJOA 4ANXA 4AUQC 4TUUA 1ZXHA 2C7MB 2BW2A 4MEMA 1GOZA 2LRWA 1RFAA 2HD5B 1YNTE 2L8JA 3A1QB 3VUYA 1PGAA 4L2YA 1J7BA 2JQRB 3PHXB 4E71A 3AB5A 1FD6A 3PSEB 1TYGB 4M8MA 3ETRA 3A9JA 5TR5A 2YVCA 5J17A 4JLCA 3RNEC 2ZNVC 4BOZB 3I3TB 1IUEA 4TQ1A 1I4HA 3BVGA 4PT5A 1UF0A 4NPNA 3VTUA 3BWUD 2K0PA 1J19A 3RYTA 1AWDA 2K8HA 3GOEA 5DPWA 4OZCA 4KGSA 4LNFA 4MACA 1Q10A 3VH4B 2EELA 1WIAA 2ZVNA 1NBFC 1LO5D 3PLUA 2G3QB 2CJOA 3KWVA 3Q8EA 5CHFA 5FR6A 2WYQA 1MVKA 1K52A 1UNSA 3NUHB 4WJPA 3WCQA 2C60A 1WXMA 3HRDD 3TJPA 2KK8A 2GBMA 2AQ2B 5KHOA 1IPGA 4YSXB 4G11A 1PGBA 2KTRB 1VZ8A 2JZ3B 2KQ4X 1LM8B 2Q5WD 3AU5A 2MEKA 2ICIA 4G50A 5MPOA 4I6NB 2O6VB 2KAJA 1VCBA 4ANUA 3RNCC 1KH0A 4ZRQA 3H1UA 4B6WA 4HROA 3WANA 2WWZA 4EFOA 1OEYJ 2V4LA 1GNUA 3KUDB 3PO0A 4DXGA 1I4RA 1FEHA 1P9DU 1TJEA 2KFJA 3E9SA 1JW9D 4NAWA 2KX3A 1V8CA 3QX1A 1F77A 4K1RB 2KMCA 2LJIA 3BY4B 2ZPNA 2MHJA 1E8ZA 1PFDA 2QILA 3Q69A 4C56C 1I4QA 2WXPA 2ZW0A 2CS4A 2DX5B 1WGDA 4K7WA 5CTRC 1E7VA 4BVUC 4XWWA 2PVGC 4JGHB 3QAQA 1EWYC 4DHZE 3HM3A 2KJHB 3BK1A 2K22A 2NTSA 2LGIA 2W55A 1WXQA 3FILB 1WE7A 2C7NB 2JU6X 2UWQA 1M4VA 1KTKA 3NHEB 2J4XA 3TEWA 4FN2A 1ZDVA 2QDFA 1K50A 1NI3A 4K7SA 2N9PC 3NVYA 3AXCA 4II2B 3VRAB 3AE9B 3SFDB 1WI0A 1N60A 1UELA 2KDBA 1A70A 1SE2A 1WWTA 3I9V1 3U2SC 4O1NA 4M00A 1IBXB 3ZRFA 2QSDA 2V9HA 1D5ZC 2KZRA 2AL6A 4PS8A 4REZA 4XDCA 3VVWB 2FCMA 1JQ4A 1ACCA 2KNBA 4ZRJA 5FK9C 4BKSD 2WXKA 1MG4A 1YQBA 3B0AA 1WX7A 1TT5B 2R61A 2FCNA 3L16A 2KMMA 2CJNA 5L95C 3AM9A 1YQ3B 5BYQA 1J8CA 4AWJA 3NS8A 2NTTA 3MHZA 3Q3FA 2L3ZA 1OTRB 1VZ6A 2ZEQA 4MT5A 3NOBA 1HA5A 1SBBB 2VRRB 1FRRA 4IW0A 1LFDA 2JUOA 2L0FA 3IHPC 2WDQB 3LJ3A 4HKQA 2WXOA 2N0SB 2TSSA 3APFA 2KVZA 3IT6B 3ML9A 2W3RA 1FNUA 3H7PA 3GS2A 1S3SG 3VUWA 4GGQA 1KM7A 3CSTA 3DWGC 2MWSB 3DBHB 3P42A 4PS7A 5BMHA 2QIEB 2GBRA 3IXSA 2W9NA 3AEAB 1OQRA 1JROA 1C76A 3IG3A 2KACA 3N9YC 3KYCD 3U7ZA 1YN5A 4FLHA 5EE9A 1SF0A 1SSNA 2RDHA 3U7DA 4RNAA 2LEKA 2ASQA 5D3IB 2KYWA 3Q8FA 4ANVA 4QAYA 1FO4A 4EOYA 4NY0A 5EE3A 2W54A 3ZTCA 3DPDA 3CSFA 2VH1A 1I35A 1C79A 4HCPB 2L05A 4JPSA 2UYZB 4RH6A 3WIMA 4LLGM 4WWOA 5E6JA 1AARA 3PRMB 2LFIA 4NNJB 2KMAA 2D10A 1JWMD 3AMZA 4EZKA 2H88B 2R2QA 2JX5A 1C4PA 2O6VD 4W9FA 2KWDA 3EFCA 4ITKA 2Z59B 3ZJVA 2IGDA 1JWAD 5H92C 1V1PA 1E0ZA 2GBNA 2M4NA 1QOAA 2XBBC 3ZW3A 3QCAA 2JRIB 1PDXA 1GC7A 2KFKB 2FIDA 4LDTD 2QCZA 1P3QU 1WGRA 2O2VA 3PPAA 1QT9A 3NZUA 4PK1A 5HKHA 2XK5A 4GSWA 3P2BA 2G45B 5D94A 3APCA 2YEPB 4FJYA 2DAFA 4C80A 2BT6A 2M0AA 2V0GA 3PRZA 1F2RI 3ZQ4A 4AJWA 1IYFA 3EECA 2ZW1A 3JSVB 3RMKC 4BKSA 2IJ0A 4GLSC 1C4AA 3K9PB 5D3DA 2RPQA 3EA6A 4F7ZA 1AN8A 3DWMA 1XQQA 3NRZA 2CU1A 3VR8B 2J0KA 2IGGA 3Q3JA 1XT9B 1GPXA 1T6BX 2L7RA 2Y3AA 1KLGD 3C8YA 2DZIA 4JE3B 4A9AA 4DDGD 2HTME 2MSED 3A1QA 4BKGA 2PPHA 4D2KA 4IM0A 2BS4B 5LLIA 3TL5A 2LGXA 2LGSA 3OG5A 2DYBA 2C7HA 2K5PA 2WDRB 1VZ7A 1LXDA 1UGMA 2KQ7A 4MELA 1P0RA 2MBEA 4LNKA 3NG0A 2LXCA 1I4PA 3PLVA 4EE2A 4GDKB 4DHJD 2MBQA 4P7IA 1XLQA 3P4QB 1FM0D 1XXGA 4DBGA 1S1QB 1YX5B 2WLBA 3URYA 3QWZB 4GU2A 3VAWA 1FFUA 4S17A 1YIWA 3VRBB 4ZDVA 4ARIA 1LGRA 4ICVA 3N1XC 5IAAC 1T0QC 3P4RB 4ZRKA 4AS1A 3BINA 1RAXA 2KDMA 2J7QB 2VZKD 2G9HD 3NZSA 3QQ8B 1HTQA 2K39A 5IO9A 2D07B 2D3GA 3W5UB 1WYGA 4RM9A 3A4SC 3SDLC 3ZKJC 1YD8U 2SEBD 3TBLD 4GB9A 1SE3A 2WXHA 3MJ5A 2EKIA 4NZLB 3MHSD 2KTRA 3HM6X 3QARA 1FCLA 4FBJB 2HJ8A 2OEDA 3UINB 2O6VA 4W9CA 4FA6A 3RZWC 3VR9B 1TIFA 3AE8B 1YJ1A 1HQRD 1XLNA 1Q0WB 2INNE 3VQIA 2DYOA 3IFWB 4G3XB 2XEWA 3N32A 3W5VB 4YSZB 1T5XD 2A5UA 3OAWA 2JZZA 2BBCA 4LK0M 4MH0E 1Z5SB 3HVZA 3ZNGC 1KOTA 2RDGA 1V80A 2E3TA 1NENB 1JWBD 1UUPA 3PVLA 1C3TA 1L4ZB 3PZ8A 2INCC 4HJKA 3I5JC 3SEBA 5I4DA 3N1ZC 1I7HA 3V62A 4KVGB 3M95A 1HE8A 3TEZA 1F2RC 1T0RC 1D4BA 4OHJA 2BPSA 4A3PA 3H6NA 3RN9C 1WMHB 4ZOHC 3ZDTA 4KDIC 4KIKA 3FILA 3TIXA 3ECIA 1QF6A 2CU3A 1ZKHA 4A55A 4PYUA 1ZXIA 3CWIA 2NPTB 3DBRB 1N6ZA 4ZYNA 2LUEA 2LMCA 1JRUA 2NBUA 1WGKA 4B95A 2X38A 4W9GA 1WJNA 2I1KA 3AV8A 1V49A 3RD2A 3DVGX 1F52A 2KDFB 5BO4B 2YEPF 1QOBA 4I6LB 2JY6A 3W2DA 2PMVA 2KT7A 2MJ3A 4C4VB 1Z2MA 2ZJDA 3BIID 3ENEA 1IBXA 2LHDA 3ZJTA 1K8RB 3ZNHB 3AN1A 4HPMB 2WXMA 2RMMA 2WXLA 2RD0A 4IM3A 3UIOB 4HKZE 4I6PA 3DVNV 3PTFC 1TZ1A 1XD3B 3MC8A 3VTVA 4HLEA 1FXIA 3AE4B 2KN4A 2HE7A 3BYYB 2E6XA 1RM6C 2IGHA 3DOWA 2GBJA 1CQVA 2KLGA 1ET6A 3Q3OC 2K1FA 1QOFA 4YTNB 4IDIA 1D5MC 1MJDA 1L2NA 4W9HA 4WWMA 2M8SA 1J0GA 1K51A 1V1OA 3ABVB 2KX0A 1V2YA 2RPVA 2BVCA 4A20A 1XLOA 2FCSA 3AI5A 1RWSA 4CQNA 2K6DB 4NQLB 2N9KA 5HI1A 1ENFA 3L17A 2V4IB 4XX5A 2RGFA 3N30A 2JXTA 3L0WB 4FJVB 3AEEB 2OJWA 3UQAA 1WR6E 1TS3A 3C0RB 4G0NB 1TS4A 2JXXA 5D7GA 2PE9A 2BWFA 1ET9A 3BK2A 1TS5A 1VJKA 2DZMA 4KGTA 1M94A 2K6QA 4KZ0A 4B9KA 1UGJA 1H8CA 1FNVA 4HPPA 2NVUI 4URKA 1I4XA 5AUIA 4HDOA 3UGBB 4R3DA 2KHWB 4IG7B 1I4GA 4PYZA 1XO3A 3A9JB 2KKCA 1SB3C 5JHAA 1PYWD 3I57A 4EUTA 2MBHA 3DHGC 4OVUA 2M19A 3IT4B 1EWCA 4FADA 1RLFA 3DBHI 3TEXA 1GAQB 5T8IA 3ZLZA 2DZKA 3DHIC 4K3BA 2JPHA 2G4DB 1E8XA 1T0YA 1V97A 4NQKE 2ZCBA 4DXFA 1FIQA 2HJ1A 2WGSA 4EKUA 3DVGY 1XEEA 3LB8C 4BKTA 4IC7B 2OOBB 4LJOB 2BYFA 4WURA 1V5OA 1UH6A 1R4NB 4DWFA 4RGTA 2PKOA 2QC8A 4IM2A 2KXJA 4MSMB 3DHHC 2WXJA 2N7EA 2KFKA 2V3NA 4MJSB 3R8BA 5HG2A 2LVQA 1X1MA 3K9OB 2INDC 1WRIA 2JYEA 3AEBB 1MPEA 4KGRA 1T0SC 3PREA 4CO7A 4P16A 2CHZA 2AQ3B 3AH7A 4BZAA 3O65B 5HFYA 2NBVB 4L1BA 2WXRA 1UD7A 3SHQA 4GDLB 2QJLA 1WH3A 3MP9A 2QMTA 4MSQB 2JT4B 4HK2A 3RNFC 2D3CA 1TKYA 2KLCA 2GI9A 3MJWA 5AZFA 2MCNB 1KFYB 1JALA 4IOIE 1SE4A 1EU4A 2MP2B 4IWOA 5EDSA 3Q6BA 2JWUA 3GE3C 4W9EA 3HIZA 2M56B 2IYDB 3B2FA 3ZXVA 3H7SA 3IAS1 5J18A 4HWIB 4K7UA 3FKYA 1YN3A 1L0XB 5G2NA 1D5XC 2CHWA 2IDYA 1WM3A 3AEFB 2JSVX 2RR9A 2DWQA 1N63A 4JX1C 4N58A 5GXGB 1PQSA 1WR1A 2L32A 3HHMA 3HVDA 2ZCCA 3O13A 3ZIMA 2FAZA 2KD0A 1KF6B 1QLBB 1N61A 1E6EB 1U4AA 1DOXA 1V9JA 3NY5A 2K8CA 3PRPB 3KWLA 4AP4C 2LD9A 3AEDB 3E56A 2N9EB 2BS2B 2WP9B 4ZHPA 2JRHA 4M0WA 1OQQA 1JCKB 2WXFA
chains in the Genus database with same CATH topology
5IAAC 2KDIA 2AL3A 3OLMD 2ZZPB 4ZRKA 3BINA 3VH4B 4ANWA 1RAXA 2BGFA 4ICUA 5DPRA 1D3ZA 2J7QB 1WIAA 2ZVNA 1NBFC 4GMVA 2BYVE 3PLUA 2G3QB 1UZXB 2KOXA 3NZSA 3QQ8B 4TV3A 4DHZB 4A3OA 2K39A 4MM3A 2D07B 2D3GA 5CHFA 5FR6A 3W1SC 2M1MA 2WYQA 3ZUNA 4RM9A 2YLMA 3A4SC 4MGYE 2Y5BB 3SDLC 3ZKJC 1YD8U 2BKFA 4EEWA 2L0TA 3S2AA 1Q1OA 1VD2A 3TBLD 2ZVOA 3DDCB 4GB9A 1V6EA 2DZJA 3V6EB 2KDEB 2KWCA 2M17A 3DQVA 4WJPA 1WXSA 3A4RA 3R3MA 4RM8A 2IZVB 2C60A 1WXMA 3TJPA 2K25A 2KK8A 2GBMA 3MHSD 1WXVA 4DHJB 4GXBA 2QHOA 5KHOA 4FHJA 2WDTB 1C1YB 1IPGA 3VTWA 2KTRA 4G11A 5AZHA 2KTRB 2MBBB 3ZO5B 1ZGUB 2JZ3B 3HM6X 3QARA 1LM8B 3AU5A 2G4SA 4FBJB 2HJ8A 3UINB 2O6VA 4W9CA 4CYEA 4G50A 4FA6A 4I6NB 2L00B 2O6VB 3RZWC 3PHWB 1VCBA 2V1YA 4ANUA 1YJ1A 2N4FA 1Q0WB 3VQIA 2DYOA 3IFWB 4G3XB 2XEWA 3H1UA 4CHKA 3N32A 5D2MB 1WX9A 1WGHA 3DCGA 1LQBA 3JSVA 3KVFB 4B6WA 3ONSA 2A5UA 3OAWA 3WANA 1BT0A 2WWZA 3MTNB 4HDQA 4EFOA 1OEYJ 2BF8B 3KH0A 2V4LA 1GNUA 3KUDB 2KFJA 1P9DU 2JZZA 2IO0B 3JVZX 1WZ0A 4FULA 4NAWA 2KX3A 4MH0E 1E5WA 1Z5SB 2M0XA 3ZNGC 1KOTA 3QX1A 1V80A 4NAWB 4XC2A 5C23A 3SD5A 4K1RB 2KMCA 1YX6B 2L76A 2I1JA 3BY4B 4W9LA 2ZPNA 1SGHA 3APDA 3M63B 3PVLA 3VUXA 1C3TA 3KW5B 2KC2A 4WJQA 4HJKA 5KHQA 1E8ZA 4EZLA 3HK0A 4F8CB 5D6JB 5DPSA 4BOSC 3LDZE 4DK5A 2MX2A 4JL9A 3V62A 4N9F4 1I42A 2CS4A 2DX5B 1WGDA 4K7WA 4KVGB 3M95A 5CTRC 3AULA 1E7VA 1HE8A 3UF8A 4BVUC 2MA9B 2BPSA 4A3PA 1WMHA 1A5RA 3H6NA 4JGHB 3QAQA 3JW0X 5JH5C 1WMHB 3ZDTA 4DHZE 4KDIC 3HM3A 2LGYA 1CMXB 3ZVVA 2EMSA 2KJHB 3N3KB 3L13A 4KIKA 4GN1A 5LXHA 2MQJA 4AJYB 3DVNU 3TIXA 3WAMA 1WE7A 3T8MA 3ECIA 2C7NB 4RMAA 2UWQA 2C9WB 3L54A 5L83A 5G55A 2AYOB 4GDKA 1ZKHA 3CF6E 3NHEB 4PYUA 2DYMA 4FN2A 5IA7A 4BFRA 1MG8A 4WQOB 2NPTA 4K7SA 4IWQA 2NPTB 4ZYNA 2LUEA 2OJRA 1JRUA 2NBUA 1ISNA 1WZ3A 2N9PC 4PS3A 2A4ZA 3AXCA 4B95A 2JWZA 4II2B 4W9GA 1WJNA 2I1KA 2CKHB 3RUIB 3V60A 1WGYA 4WJNA 1V49A 3VHTC 2KQSA 1KJTA 3CMMB 4MGZE 1WJ4A 5CHWA 3RD2A 3VDZA 3DVGX 3WALA 2KDFB 5BO4B 1WI0A 4I6LB 2JY6A 3R7QA 2LZ6A 3KUCB 2EMTA 3R7RA 1UELA 1WGGA 2KDBA 4TKNA 2MBOA 3QHTA 4K81A 1Z2MA 2ZJDA 3RT3B 3ENEA 3R66C 2V3SA 4HPLB 3ZRFA 3U8ZA 1K8RB 2GOWA 1TBEA 3ZNHB 4AOFA 2FNJB 4KZCA 4F1SA 4HPMB 4IM3A 3UIOB 2RD0A 4BBNC 4GOCA 1UBQA 2KZRA 2WX1A 3H9DA 4IUMB 4II3B 5GMVA 4PS8A 2KN5A 4BBNF 4I6PA 2BKRB 3B1LX 3DVNV 3PTFC 3VVWB 2FCMA 3W1YA 1TZ1A 1XD3B 3ML8A 2KO3A 2KNBA 2PE6B 3ALBA 3V6CB 3ZNZB 4ZRJA 3RULA 3VTVA 2N7DA 3DBRI 4HLEA 4BKSD 4WWPA 2D11A 1YQBA 3B0AA 1WX7A 2C5LC 2LJ5A 2KVRA 2IO3B 2EKEC 3WA0A 4W9KA 3D32A 3WAPA 2FCNA 3L16A 2HE7A 2FIFA 1WFYA 5L95C 5J2RA 3V61A 1J8CA 4AWJA 2IO2B 3NS8A 3GZNI 3QK0A 3Q3FA 3PT2B 2KWVB 1WJ6A 3DOWA 3PV1A 2L3ZA 2GBJA 2AWTA 3UQBA 1OTRB 4W9JA 4WAAA 2ZEQA 3ZTDA 2KLGA 3NOBA 2AEHA 2VRRB 4MDKE 1E7UA 4NJ7A 4IW0A 1LFDA 2FUHB 2JUOA 2L0FA 2K1FA 3IHPC 3LJ3A 5E6PA 1SIFA 2NCNA 2DENB 3APFA 1L2NA 3T9LA 3ML9A 1OGWA 5JZEB 2RSUA 4W9HA 3H7PA 1P1AA 2M8SA 3EHVA 5CHVC 1H4RA 1GC6A 1J0GA 3H7PB 1S3SG 1OEYA 2KJRA 1ZW7A 2KX0A 1V2YA 5LXIB 2PJHA 3VUWA 2D2QA 4GGQA 4A20A 1KM7A 1IP9A 4DXAB 3CSTA 2FCSA 3AI5A 2MWSB 3B08A 4E74A 4KSLC 2K6DB 4NQLB 3L17A 4PS7A 4XX5A 2RGFA 3N30A 4FJVB 2GBRA 3L0WB 2W9NA 3UQAA 1EUVB 3QIJA 4TQ0A 2N1WA 3A9KA 1V81A 1WR6E 4J6IA 3IG3A 3A9KB 2BYEA 3C0RB 3AU4A 4G0NB 1GJZA 4E3CA 3KYCD 2JXXA 1OQYA 3DBLI 4LJPB 5D7GA 3WAOA 2Z0DB 3X0WA 4FLHA 2PE9A 2BWFA 3U7DA 1WJUA 4JQWC 2DZMA 4YL8A 2ASQA 1M94A 2GMIC 2K6QA 1Y8RC 3IVFA 3L10B 4KZ0A 4ANVA 2CR5A 4B9KA 4NY0A 4EOYA 1H8CA 3VFKA 4URKA 2NVUI 1G6JA 3ZTCA 5AEKB 2REXA 3DPDA 3CSFA 4HDOA 3UGBB 5DCNA 1NDDA 1I35A 3X23A 2KHWB 2JF5A 4W9DA 4IG7B 4GIVA 2L05A 4HCPB 4PYZA 2CHXA 3TMPB 4W9IA 2KANA 3A9JB 2KKCA 2R2OA 5JHAA 2UYZB 1R4MI 4EUTA 1P98A 1TTNA 2MBHA 4OVUA 2LRUA 3WIMA 4WWOA 5AZGA 2GBKA 4FADA 1AARA 3PRMB 4NNJB 1RLFA 3DBHI 1WRDB 2KMAA 1GUAB 2D10A 4WWNA 2B3AA 2IO1B 3PGEA 2LVOA 4XZ4A 4EZKA 3U30A 2R2QA 3EC8A 2FCQA 4ASWC 3ZLZA 3OJ3A 2DZKA 2LASA 2JPHA 4DDID 2DHZA 3ZNID 2O6VD 2G4DB 1E8XA 1T0YA 2NBWB 4NQKE 4W9FA 4M0WB 2ZCBA 1V5TA 2MLBA 5DPTA 3ZDMC 2Z59B 1EF5A 4EKUA 3DVGY 4JIOU 4IWPA 4BKTA 1QZEA 4IC7B 2OOBB 4LJOB 2BYFA 1V5OA 1UH6A 4ZRIA 2LGDA 4EZJA 2LVPA 2GBNA 2M4NA 4DWFA 2XBBC 2N9XA 3ZW3A 4IM2A 3QCAA 2KXJA 4MSMB 2LI5A 2JRIB 3IBEA 4KV2A 3RZFA 4MJSA 2N7EA 3OJ4B 2KFKA 1E8WA 1GC7A 3EFUA 4MJSB 2LVQA 2NR2A 4FJZA 2KFKB 1X1MA 4MGIE 2FIDA 3K9OB 4LDTD 1WX8A 3QJZA 5E6NA 1E8YA 1EO6A 2LWPA 3ZRCA 2ZNVB 3M3JA 1P3QU 3PZDA 1WGRA 1EF1A 2O2VA 3PPAA 2O2VB 3PREA 2JVCA 4CO7A 3TCAA 3NZUA 2CHZA 3UIPB 3DBSA 2LXAA 3L08A 3A33B 3O65B 2NBVB 5HKHA 2XK5A 5C1ZA 1UD7A 4GSWA 3P2BA 2HTHA 3SHQA 2XK5B 4GDLA 2G45B 5D94A 4LCDE 1NI2A 3APCA 4GDLB 2K8BA 1WH3A 4FJYA 2WX0A 3QC8B 2DAFA 1WM2A 2MRPA 4MSQB 5CX3A 4M8NA 1RRBA 2JT4B 5JHBA 4HK2A 3PRZA 1SE9A 2Z0EB 2ZPYA 3RCZA 2MW5A 1GG3A 4AJWA 4HCNB 2KLCA 3EECA 1IYFA 3MJWA 3JSVB 3VH3B 5AZFA 2MCNB 3KYDD 1R4NI 2MP2A 1E90A 5EDSA 2NS5A 2MP2B 3QA8A 1V86A 4IWOA 4BKSA 3W1SA 2J0MA 4W9EA 2IY1B 4KDLB 3K9PB 3M62B 3HIZA 1KLVA 2IYDB 2RPQA 2J0JA 1WYWB 4F7ZA 1F9JA 3H7SA 1TGZB 4FHKA 1XQQA 1WF9A 2CU1A 2KWUB 3JYUA 3PS6A 4LDTB 2J0KA 1FXTB 3Q3JA 1XT9B 2KC1A 1Q5WB 2PEAA 5J18A 4HXDA 4HWIB 4K7UA 2L7RA 4NJ6A 4KSKC 4WJOA 4ANXA 5G2NA 4AUQC 2DZIA 4TUUA 1WY8A 2C7MB 4DDGD 4MEMA 2CHWA 2MSED 2LRWA 1RFAA 3A1QA 2HD5B 2PPHA 2IY0B 4BKGA 1WM3A 2L8JA 1WXAA 4IM0A 3A1QB 2IBIB 5E6OA 2RR9A 5LLIA 3TL5A 2LGXA 3VUYA 1PQSA 2DYBA 2C7HA 1L7YA 1WR1A 3PHXB 4KIKB 4E71A 1LXDA 1UGMA 2KQ7A 4HVBA 3HHMA 4MELA 3PSEB 1P0RA 2MBEA 2ZCCA 3ZIMA 2N1VA 4M8MA 2FAZA 3A9JA 2KD0A 4MGKE 5TR5A 2YVCA 5J17A 2LXCA 3PLVA 4JLCA 1WE6A 2ZNVC 4BOZB 1U4AA 3I3TB 1V9JA 3KUZA 4GDKB 3NY5A 4TQ1A 2K8CA 4DHJD 2MBQA 3PRPB 4P7IA 4NPNA 2BWES 2KTFA 3VTUA 2DAJA 4X57B 4AP4C 4DBGA 2KJ6A 2LD9A 1S1QB 1YX5B 3SU8X 2N9EB 3VXWA 1J19A 3RYTA 3QWZB 4GU2A 3VAWA 2K8HA 3GOEA 5DPWA 4ZDVA 1YIWA 2JRHA 4ICVA 4OVVA 1UBIA 2AL6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IAA C;  2KDI A;  2AL3 A;  3OLM D;  2ZZP B;  4ZRK A;  3BIN A;  3VH4 B;  4ANW A;  1RAX A;  2BGF A;  4ICU A;  5DPR A;  1D3Z A;  2J7Q B;  1WIA A;  2ZVN A;  1NBF C;  4GMV A;  2BYV E;  3PLU A;  2G3Q B;  1UZX B;  2KOX A;  3NZS A;  3QQ8 B;  4TV3 A;  4DHZ B;  4A3O A;  2K39 A;  4MM3 A;  2D07 B;  2D3G A;  5CHF A;  5FR6 A;  3W1S C;  2M1M A;  2WYQ A;  3ZUN A;  4RM9 A;  2YLM A;  3A4S C;  4MGY E;  2Y5B B;  3SDL C;  3ZKJ C;  1YD8 U;  2BKF A;  4EEW A;  2L0T A;  3S2A A;  1Q1O A;  1VD2 A;  3TBL D;  2ZVO A;  3DDC B;  4GB9 A;  1V6E A;  2DZJ A;  3V6E B;  2KDE B;  2KWC A;  2M17 A;  3DQV A;  4WJP A;  1WXS A;  3A4R A;  3R3M A;  4RM8 A;  2IZV B;  2C60 A;  1WXM A;  3TJP A;  2K25 A;  2KK8 A;  2GBM A;  3MHS D;  1WXV A;  4DHJ B;  4GXB A;  2QHO A;  5KHO A;  4FHJ A;  2WDT B;  1C1Y B;  1IPG A;  3VTW A;  2KTR A;  4G11 A;  5AZH A;  2KTR B;  2MBB B;  3ZO5 B;  1ZGU B;  2JZ3 B;  3HM6 X;  3QAR A;  1LM8 B;  3AU5 A;  2G4S A;  4FBJ B;  2HJ8 A;  3UIN B;  2O6V A;  4W9C A;  4CYE A;  4G50 A;  4FA6 A;  4I6N B;  2L00 B;  2O6V B;  3RZW C;  3PHW B;  1VCB A;  2V1Y A;  4ANU A;  1YJ1 A;  2N4F A;  1Q0W B;  3VQI A;  2DYO A;  3IFW B;  4G3X B;  2XEW A;  3H1U A;  4CHK A;  3N32 A;  5D2M B;  1WX9 A;  1WGH A;  3DCG A;  1LQB A;  3JSV A;  3KVF B;  4B6W A;  3ONS A;  2A5U A;  3OAW A;  3WAN A;  1BT0 A;  2WWZ A;  3MTN B;  4HDQ A;  4EFO A;  1OEY J;  2BF8 B;  3KH0 A;  2V4L A;  1GNU A;  3KUD B;  2KFJ A;  1P9D U;  2JZZ A;  2IO0 B;  3JVZ X;  1WZ0 A;  4FUL A;  4NAW A;  2KX3 A;  4MH0 E;  1E5W A;  1Z5S B;  2M0X A;  3ZNG C;  1KOT A;  3QX1 A;  1V80 A;  4NAW B;  4XC2 A;  5C23 A;  3SD5 A;  4K1R B;  2KMC A;  1YX6 B;  2L76 A;  2I1J A;  3BY4 B;  4W9L A;  2ZPN A;  1SGH A;  3APD A;  3M63 B;  3PVL A;  3VUX A;  1C3T A;  3KW5 B;  2KC2 A;  4WJQ A;  4HJK A;  5KHQ A;  1E8Z A;  4EZL A;  3HK0 A;  4F8C B;  5D6J B;  5DPS A;  4BOS C;  3LDZ E;  4DK5 A;  2MX2 A;  4JL9 A;  3V62 A;  4N9F 4;  1I42 A;  2CS4 A;  2DX5 B;  1WGD A;  4K7W A;  4KVG B;  3M95 A;  5CTR C;  3AUL A;  1E7V A;  1HE8 A;  3UF8 A;  4BVU C;  2MA9 B;  2BPS A;  4A3P A;  1WMH A;  1A5R A;  3H6N A;  4JGH B;  3QAQ A;  3JW0 X;  5JH5 C;  1WMH B;  3ZDT A;  4DHZ E;  4KDI C;  3HM3 A;  2LGY A;  1CMX B;  3ZVV A;  2EMS A;  2KJH B;  3N3K B;  3L13 A;  4KIK A;  4GN1 A;  5LXH A;  2MQJ A;  4AJY B;  3DVN U;  3TIX A;  3WAM A;  1WE7 A;  3T8M A;  3ECI A;  2C7N B;  4RMA A;  2UWQ A;  2C9W B;  3L54 A;  5L83 A;  5G55 A;  2AYO B;  4GDK A;  1ZKH A;  3CF6 E;  3NHE B;  4PYU A;  2DYM A;  4FN2 A;  5IA7 A;  4BFR A;  1MG8 A;  4WQO B;  2NPT A;  4K7S A;  4IWQ A;  2NPT B;  4ZYN A;  2LUE A;  2OJR A;  1JRU A;  2NBU A;  1ISN A;  1WZ3 A;  2N9P C;  4PS3 A;  2A4Z A;  3AXC A;  4B95 A;  2JWZ A;  4II2 B;  4W9G A;  1WJN A;  2I1K A;  2CKH B;  3RUI B;  3V60 A;  1WGY A;  4WJN A;  1V49 A;  3VHT C;  2KQS A;  1KJT A;  3CMM B;  4MGZ E;  1WJ4 A;  5CHW A;  3RD2 A;  3VDZ A;  3DVG X;  3WAL A;  2KDF B;  5BO4 B;  1WI0 A;  4I6L B;  2JY6 A;  3R7Q A;  2LZ6 A;  3KUC B;  2EMT A;  3R7R A;  1UEL A;  1WGG A;  2KDB A;  4TKN A;  2MBO A;  3QHT A;  4K81 A;  1Z2M A;  2ZJD A;  3RT3 B;  3ENE A;  3R66 C;  2V3S A;  4HPL B;  3ZRF A;  3U8Z A;  1K8R B;  2GOW A;  1TBE A;  3ZNH B;  4AOF A;  2FNJ B;  4KZC A;  4F1S A;  4HPM B;  4IM3 A;  3UIO B;  2RD0 A;  4BBN C;  4GOC A;  1UBQ A;  2KZR A;  2WX1 A;  3H9D A;  4IUM B;  4II3 B;  5GMV A;  4PS8 A;  2KN5 A;  4BBN F;  4I6P A;  2BKR B;  3B1L X;  3DVN V;  3PTF C;  3VVW B;  2FCM A;  3W1Y A;  1TZ1 A;  1XD3 B;  3ML8 A;  2KO3 A;  2KNB A;  2PE6 B;  3ALB A;  3V6C B;  3ZNZ B;  4ZRJ A;  3RUL A;  3VTV A;  2N7D A;  3DBR I;  4HLE A;  4BKS D;  4WWP A;  2D11 A;  1YQB A;  3B0A A;  1WX7 A;  2C5L C;  2LJ5 A;  2KVR A;  2IO3 B;  2EKE C;  3WA0 A;  4W9K A;  3D32 A;  3WAP A;  2FCN A;  3L16 A;  2HE7 A;  2FIF A;  1WFY A;  5L95 C;  5J2R A;  3V61 A;  1J8C A;  4AWJ A;  2IO2 B;  3NS8 A;  3GZN I;  3QK0 A;  3Q3F A;  3PT2 B;  2KWV B;  1WJ6 A;  3DOW A;  3PV1 A;  2L3Z A;  2GBJ A;  2AWT A;  3UQB A;  1OTR B;  4W9J A;  4WAA A;  2ZEQ A;  3ZTD A;  2KLG A;  3NOB A;  2AEH A;  2VRR B;  4MDK E;  1E7U A;  4NJ7 A;  4IW0 A;  1LFD A;  2FUH B;  2JUO A;  2L0F A;  2K1F A;  3IHP C;  3LJ3 A;  5E6P A;  1SIF A;  2NCN A;  2DEN B;  3APF A;  1L2N A;  3T9L A;  3ML9 A;  1OGW A;  5JZE B;  2RSU A;  4W9H A;  3H7P A;  1P1A A;  2M8S A;  3EHV A;  5CHV C;  1H4R A;  1GC6 A;  1J0G A;  3H7P B;  1S3S G;  1OEY A;  2KJR A;  1ZW7 A;  2KX0 A;  1V2Y A;  5LXI B;  2PJH A;  3VUW A;  2D2Q A;  4GGQ A;  4A20 A;  1KM7 A;  1IP9 A;  4DXA B;  3CST A;  2FCS A;  3AI5 A;  2MWS B;  3B08 A;  4E74 A;  4KSL C;  2K6D B;  4NQL B;  3L17 A;  4PS7 A;  4XX5 A;  2RGF A;  3N30 A;  4FJV B;  2GBR A;  3L0W B;  2W9N A;  3UQA A;  1EUV B;  3QIJ A;  4TQ0 A;  2N1W A;  3A9K A;  1V81 A;  1WR6 E;  4J6I A;  3IG3 A;  3A9K B;  2BYE A;  3C0R B;  3AU4 A;  4G0N B;  1GJZ A;  4E3C A;  3KYC D;  2JXX A;  1OQY A;  3DBL I;  4LJP B;  5D7G A;  3WAO A;  2Z0D B;  3X0W A;  4FLH A;  2PE9 A;  2BWF A;  3U7D A;  1WJU A;  4JQW C;  2DZM A;  4YL8 A;  2ASQ A;  1M94 A;  2GMI C;  2K6Q A;  1Y8R C;  3IVF A;  3L10 B;  4KZ0 A;  4ANV A;  2CR5 A;  4B9K A;  4NY0 A;  4EOY A;  1H8C A;  3VFK A;  4URK A;  2NVU I;  1G6J A;  3ZTC A;  5AEK B;  2REX A;  3DPD A;  3CSF A;  4HDO A;  3UGB B;  5DCN A;  1NDD A;  1I35 A;  3X23 A;  2KHW B;  2JF5 A;  4W9D A;  4IG7 B;  4GIV A;  2L05 A;  4HCP B;  4PYZ A;  2CHX A;  3TMP B;  4W9I A;  2KAN A;  3A9J B;  2KKC A;  2R2O A;  5JHA A;  2UYZ B;  1R4M I;  4EUT A;  1P98 A;  1TTN A;  2MBH A;  4OVU A;  2LRU A;  3WIM A;  4WWO A;  5AZG A;  2GBK A;  4FAD A;  1AAR A;  3PRM B;  4NNJ B;  1RLF A;  3DBH I;  1WRD B;  2KMA A;  1GUA B;  2D10 A;  4WWN A;  2B3A A;  2IO1 B;  3PGE A;  2LVO A;  4XZ4 A;  4EZK A;  3U30 A;  2R2Q A;  3EC8 A;  2FCQ A;  4ASW C;  3ZLZ A;  3OJ3 A;  2DZK A;  2LAS A;  2JPH A;  4DDI D;  2DHZ A;  3ZNI D;  2O6V D;  2G4D B;  1E8X A;  1T0Y A;  2NBW B;  4NQK E;  4W9F A;  4M0W B;  2ZCB A;  1V5T A;  2MLB A;  5DPT A;  3ZDM C;  2Z59 B;  1EF5 A;  4EKU A;  3DVG Y;  4JIO U;  4IWP A;  4BKT A;  1QZE A;  4IC7 B;  2OOB B;  4LJO B;  2BYF A;  1V5O A;  1UH6 A;  4ZRI A;  2LGD A;  4EZJ A;  2LVP A;  2GBN A;  2M4N A;  4DWF A;  2XBB C;  2N9X A;  3ZW3 A;  4IM2 A;  3QCA A;  2KXJ A;  4MSM B;  2LI5 A;  2JRI B;  3IBE A;  4KV2 A;  3RZF A;  4MJS A;  2N7E A;  3OJ4 B;  2KFK A;  1E8W A;  1GC7 A;  3EFU A;  4MJS B;  2LVQ A;  2NR2 A;  4FJZ A;  2KFK B;  1X1M A;  4MGI E;  2FID A;  3K9O B;  4LDT D;  1WX8 A;  3QJZ A;  5E6N A;  1E8Y A;  1EO6 A;  2LWP A;  3ZRC A;  2ZNV B;  3M3J A;  1P3Q U;  3PZD A;  1WGR A;  1EF1 A;  2O2V A;  3PPA A;  2O2V B;  3PRE A;  2JVC A;  4CO7 A;  3TCA A;  3NZU A;  2CHZ A;  3UIP B;  3DBS A;  2LXA A;  3L08 A;  3A33 B;  3O65 B;  2NBV B;  5HKH A;  2XK5 A;  5C1Z A;  1UD7 A;  4GSW A;  3P2B A;  2HTH A;  3SHQ A;  2XK5 B;  4GDL A;  2G45 B;  5D94 A;  4LCD E;  1NI2 A;  3APC A;  4GDL B;  2K8B A;  1WH3 A;  4FJY A;  2WX0 A;  3QC8 B;  2DAF A;  1WM2 A;  2MRP A;  4MSQ B;  5CX3 A;  4M8N A;  1RRB A;  2JT4 B;  5JHB A;  4HK2 A;  3PRZ A;  1SE9 A;  2Z0E B;  2ZPY A;  3RCZ A;  2MW5 A;  1GG3 A;  4AJW A;  4HCN B;  2KLC A;  3EEC A;  1IYF A;  3MJW A;  3JSV B;  3VH3 B;  5AZF A;  2MCN B;  3KYD D;  1R4N I;  2MP2 A;  1E90 A;  5EDS A;  2NS5 A;  2MP2 B;  3QA8 A;  1V86 A;  4IWO A;  4BKS A;  3W1S A;  2J0M A;  4W9E A;  2IY1 B;  4KDL B;  3K9P B;  3M62 B;  3HIZ A;  1KLV A;  2IYD B;  2RPQ A;  2J0J A;  1WYW B;  4F7Z A;  1F9J A;  3H7S A;  1TGZ B;  4FHK A;  1XQQ A;  1WF9 A;  2CU1 A;  2KWU B;  3JYU A;  3PS6 A;  4LDT B;  2J0K A;  1FXT B;  3Q3J A;  1XT9 B;  2KC1 A;  1Q5W B;  2PEA A;  5J18 A;  4HXD A;  4HWI B;  4K7U A;  2L7R A;  4NJ6 A;  4KSK C;  4WJO A;  4ANX A;  5G2N A;  4AUQ C;  2DZI A;  4TUU A;  1WY8 A;  2C7M B;  4DDG D;  4MEM A;  2CHW A;  2MSE D;  2LRW A;  1RFA A;  3A1Q A;  2HD5 B;  2PPH A;  2IY0 B;  4BKG A;  1WM3 A;  2L8J A;  1WXA A;  4IM0 A;  3A1Q B;  2IBI B;  5E6O A;  2RR9 A;  5LLI A;  3TL5 A;  2LGX A;  3VUY A;  1PQS A;  2DYB A;  2C7H A;  1L7Y A;  1WR1 A;  3PHX B;  4KIK B;  4E71 A;  1LXD A;  1UGM A;  2KQ7 A;  4HVB A;  3HHM A;  4MEL A;  3PSE B;  1P0R A;  2MBE A;  2ZCC A;  3ZIM A;  2N1V A;  4M8M A;  2FAZ A;  3A9J A;  2KD0 A;  4MGK E;  5TR5 A;  2YVC A;  5J17 A;  2LXC A;  3PLV A;  4JLC A;  1WE6 A;  2ZNV C;  4BOZ B;  1U4A A;  3I3T B;  1V9J A;  3KUZ A;  4GDK B;  3NY5 A;  4TQ1 A;  2K8C A;  4DHJ D;  2MBQ A;  3PRP B;  4P7I A;  4NPN A;  2BWE S;  2KTF A;  3VTU A;  2DAJ A;  4X57 B;  4AP4 C;  4DBG A;  2KJ6 A;  2LD9 A;  1S1Q B;  1YX5 B;  3SU8 X;  2N9E B;  3VXW A;  1J19 A;  3RYT A;  3QWZ B;  4GU2 A;  3VAW A;  2K8H A;  3GOE A;  5DPW A;  4ZDV A;  1YIW A;  2JRH A;  4ICV A;  4OVV A;  1UBI A;  2AL6 A; 
#chains in the Genus database with same CATH topology
 3P4P B;  4WH4 A;  3OLM D;  2ZZP B;  2BGF A;  4ICU A;  1D3Z A;  1VRA B;  1B9R A;  3B2G A;  2KOX A;  3UI3 A;  4A3O A;  3W1S C;  4MM3 B;  3AE7 B;  2M1M A;  4MGY E;  1HZ5 A;  2DLB A;  4LNI A;  3S2A A;  2XNA C;  1V6E A;  2DZJ A;  2FE8 A;  2KDE B;  2KWC A;  2M17 A;  1B1Z A;  3DQV A;  1FFV A;  3A4R A;  4RM8 A;  2IZV B;  3W9C B;  4XWT A;  4GXB A;  4FHJ A;  2K9X A;  1C1Y B;  1TKE A;  2WDT B;  5AZH A;  5IKC M;  2MBB B;  1ZGU B;  4ACF A;  1CJE A;  4OVV A;  1UWX A;  2L00 B;  4YSY B;  3TSS A;  1NEK B;  4A90 A;  4CHK A;  1WGH A;  1LQB A;  3KVF B;  1RYJ A;  3KH0 A;  1QQR A;  1CZP A;  2HDE A;  2IO0 B;  1WZ0 A;  4FUL A;  1E9M A;  3AE2 B;  1E5W A;  5C23 A;  1YQ4 B;  3NZ3 A;  2L76 A;  4A6Q A;  1SGH A;  1SJE D;  3APD A;  3VUX A;  1ZOY B;  4WJQ A;  5KHQ A;  4H2A A;  4EZL A;  3HK0 A;  3NVW A;  3LDZ E;  4BOS C;  4DK5 A;  2MX2 A;  4JL9 A;  1I42 A;  4N9F 4;  1L0V B;  1YN4 A;  3AUL A;  2RDB C;  3UF8 A;  4YXD B;  2JYT A;  1WMH A;  3JW0 X;  2H89 B;  2Y5C A;  3ZVV A;  2EMS A;  1N62 A;  1GB4 A;  3N3K B;  3L13 A;  4GN1 A;  2MQJ A;  3J9C A;  3DVN U;  4AJY B;  2Z8L A;  4RMA A;  3R2I A;  3H8H A;  2C9W B;  3L54 A;  4ZRP A;  2AYO B;  1RFK A;  2DYM A;  3EUB 2;  3NJT A;  4BFR A;  1MG8 A;  4RGN A;  1VLB A;  2NPT A;  4RF1 A;  4IWQ A;  2OJR A;  3RNB C;  2L83 A;  4PS3 A;  2A4Z A;  3Q8C A;  2JWZ A;  3RUI B;  4RGM A;  1L6U A;  4WJN A;  3VHT C;  1KJT A;  4MGZ E;  1WJ4 A;  5CHW A;  3VDZ A;  2LZ6 A;  2EMT A;  4M02 A;  4C4V A;  5FR3 A;  2N9L A;  3QHT A;  3SR6 A;  3LXF A;  3R66 C;  1FPY A;  4HPL B;  3BYT B;  2GOW A;  2PW9 A;  2UU7 A;  4KZC A;  4F1S A;  2W3S A;  5EE0 A;  4GOC A;  5IP4 D;  4II3 B;  4BBN F;  2BKR B;  3W1Y A;  1L0Y B;  3ML8 A;  2KO3 A;  2PE6 B;  3ALB A;  3V6C B;  3RUL A;  4LTU A;  3DBR I;  4NAM A;  4WWP A;  2D11 A;  2N7J A;  2C5L C;  2KVR A;  2IO3 B;  2EKE C;  3WA0 A;  4W9K A;  3D32 A;  3V3X A;  3WAP A;  3NS1 A;  2FIF A;  5J2R A;  2MH7 A;  3V61 A;  2PLP A;  3GZN I;  5IN7 A;  2KWV B;  4US8 A;  1VR9 A;  2AWT A;  3HUI A;  1N5W A;  4MDK E;  2FUH B;  1JWS D;  5HHD G;  5E6P A;  1SIF A;  2NCN A;  4IKG A;  3T9L A;  1OGW A;  1KLU D;  2RSU A;  1P1A A;  5CHV C;  1H4R A;  1GC6 A;  1SIJ A;  1GB1 A;  2WNM A;  1OEY A;  1ZW7 A;  1MHX A;  3RFZ B;  2D5G A;  2PJH A;  2D2Q A;  1F0Z A;  3AE6 B;  1HXY D;  2J52 A;  3FC4 A;  1IP9 A;  4KSL C;  3U4E G;  1J7A A;  1NYR A;  2N1W A;  1V81 A;  3MC0 B;  4J6I A;  3A9K B;  4C7Y A;  1P7F A;  1GJZ A;  4OW0 A;  1OQY A;  3X0W A;  2Z0D B;  2DBY A;  4XYC A;  3RNA C;  4JQW C;  3IVF A;  1Y8R C;  2CR5 A;  3VFK A;  1G6J A;  5G5G A;  5AEK B;  1DGJ A;  2REX A;  2I2Y A;  4N59 A;  5DCN A;  2WXI A;  3X23 A;  2JF5 A;  4GIV A;  2CHX A;  3TMP B;  1L5P A;  2R2O A;  4YTM B;  2WU5 B;  3GZN B;  1TTN A;  1BXT A;  2LRU A;  2GBK A;  3Q8A A;  1WRD B;  4WWN A;  2WXG A;  3PGE A;  2IO1 B;  4XZ4 A;  3EC8 A;  2AX5 A;  1TY0 A;  1KRH A;  2LAS A;  4DDI D;  1QIL A;  3ZNI D;  4YTP B;  2NBW B;  1JML A;  2MLB A;  1DOY A;  1EF5 A;  4KKI A;  4IWP A;  4ARC A;  2QEJ C;  2ON8 A;  2LGD A;  3P4S B;  2N9X A;  2LUM A;  3RZF A;  3AEG B;  4MJS A;  4KX6 B;  3OJ4 B;  3EFU A;  4FJZ A;  4MGI E;  4XDD A;  5E6N A;  3MFG A;  1EO6 A;  2LWP A;  1UWM A;  4L23 A;  3M3J A;  1EF1 A;  5AUK A;  2JVC A;  3TCA A;  1Y56 A;  4C7Z A;  3L08 A;  1IGC A;  3FAH A;  3I63 C;  2HTH A;  4GDL A;  1NI2 A;  1FRD A;  1WM2 A;  1T3Q A;  4RFB A;  4M8N A;  1RRB A;  5JHB A;  3RCZ A;  1C77 A;  1SE9 A;  2Z0E B;  2ZPY A;  3KQ4 A;  2MW5 A;  3BVM A;  1YJJ A;  4P1B C;  1K53 A;  1SEB D;  1R4N I;  2MP2 A;  2NS5 A;  3QA8 A;  1P7E A;  3W1S A;  4ZYS A;  2IY1 B;  2NMQ A;  4B0M A;  1WYW B;  2OHF A;  4OZA A;  1TGZ B;  3CIR B;  4FHK A;  1NVI D;  2X8X X;  1ZUD 2;  1E7P B;  1WF9 A;  2KWU B;  3PS6 A;  4LDT B;  3B9J A;  3Q14 C;  1Q5W B;  1FCC C;  4HXD A;  4NJ6 A;  4KSK C;  1WY8 A;  2FUG 1;  2IY0 B;  1WXA A;  1ZDX A;  2IBI B;  5E6O A;  2J42 A;  2WS3 B;  4JWU C;  1L7Y A;  4KIK B;  4HVB A;  3AE3 B;  2N1V A;  2WDV B;  4MGK E;  3Q8B A;  1WE6 A;  3KUZ A;  2BQQ A;  1FNW A;  2BWE S;  2KTF A;  1C4C A;  2DAJ A;  4X57 B;  2KJ6 A;  3SU8 X;  1C78 A;  4RGO S;  2ACZ B;  2WHI A;  3VXW A;  2B76 B;  2IPK D;  4A8X C;  3RI7 C;  4J3O D;  1UBI A;  1TZO A;  3JVZ X;  5G5H A;  4Q2J A;  2KDI A;  4XGA B;  2AL3 A;  4ANW A;  5DPR A;  2GRI A;  4GMV A;  2BYV E;  4TV3 A;  1UZX B;  4P1C C;  4DHZ B;  4MM3 A;  1TKG A;  2D3A A;  3ZUN A;  2YLM A;  5BMG A;  2Y5B B;  3Q3M C;  2AQ1 B;  4EEW A;  2BKF A;  2L0T A;  1Q1O A;  1VD2 A;  2ZVO A;  3DDC B;  3V6E B;  4WQM A;  1WXS A;  2PTL A;  3R3M A;  2K25 A;  2Y5P A;  4DHJ B;  1WXV A;  3Q2A C;  2QHO A;  3R2T A;  3VTW A;  4OVZ A;  3ZGZ A;  3ZO5 B;  1CK1 A;  2G4S A;  4CYE A;  3PHW B;  4RF0 A;  2V1Y A;  2N4F A;  3ZYY X;  2J53 A;  5D2M B;  1WX9 A;  2LHE A;  3DCG A;  3JSV A;  2L52 A;  3ONS A;  4LNO A;  2VZK B;  1BT0 A;  3MTN B;  4HDQ A;  2BF8 B;  1YOV B;  2GB1 A;  3RNG C;  1XLP A;  2M0X A;  5BYR A;  5BYS A;  4NAW B;  4XC2 A;  3LYY A;  1STE A;  3SD5 A;  2W82 A;  3ZXR A;  2V3P A;  3SFE B;  1YX6 B;  1XCQ L;  3TUO A;  2I1J A;  4W9L A;  3M63 B;  1DYQ A;  3KW5 B;  4ZHO A;  4XE0 A;  2KC2 A;  5EE1 A;  5C2T B;  4F8C B;  5D6J B;  5DPS A;  3OWE B;  2I38 A;  4TSS A;  2MA9 B;  4NJC A;  1A5R A;  2VH2 A;  3N1Y C;  5C3J B;  5JH5 C;  1WSP A;  1FXA A;  2LGY A;  1CMX B;  5BMI A;  5LXH A;  2ONQ A;  1JRP A;  3WAM A;  3NVV A;  3T8M A;  2BB6 A;  4K3C A;  1AYF A;  4YT0 B;  4MH8 A;  3L4P A;  5L83 A;  5G55 A;  4GDK A;  3BVZ A;  3CF6 E;  5IA7 A;  4AQ7 A;  4WQO B;  5JXV A;  4M01 A;  1ISN A;  1WZ3 A;  4N6E B;  4US9 A;  1L4D B;  3P1M A;  2CKH B;  2WU2 B;  2PVO D;  3V60 A;  1WGY A;  4S0R A;  2KQS A;  1N5X A;  3CMM B;  3WAL A;  3R7Q A;  1ZP0 B;  3KUC B;  3R7R A;  2BTE A;  1WGG A;  4TKN A;  2MBO A;  4RCO A;  4K81 A;  3RT3 B;  1DOI A;  1YMH E;  1AW7 A;  2V3S A;  3P63 A;  3U8Z A;  1TBE A;  4AOF A;  2FNJ B;  1JWU D;  4BBN C;  2D3B A;  1UBQ A;  2WX1 A;  3AE1 B;  1VDV A;  4DQO C;  3H9D A;  4IUM B;  1F1H A;  3NVZ A;  5GMV A;  4KKJ A;  2KN5 A;  3B1L X;  2MJD A;  1L6V A;  1R7S A;  3ZNZ B;  4LNN A;  2N7D A;  3U52 E;  1MFW A;  4OZB A;  3PZ7 A;  2LJ5 A;  1HEZ E;  1PGX A;  2INP E;  5LNK 1;  1WFY A;  2XN9 C;  3V05 A;  5H8Y E;  2IO2 B;  2SAK A;  3QK0 A;  1XCT L;  3PT2 B;  1WJ6 A;  3PV1 A;  3Q3N C;  3UQB A;  4W9J A;  4WAA A;  1EU3 A;  2K3U A;  3ZTD A;  1SJH D;  3GE8 C;  3MC9 A;  2AEH A;  1E7U A;  4NJ7 A;  1TS2 A;  1OFF A;  2DEN B;  4P6V F;  2MJE A;  5JZE B;  4TMA B;  3EHV A;  3H7P B;  2KJR A;  2G1E A;  5LXI B;  2BYT A;  3T3N A;  4B0E A;  4WIP A;  4DXA B;  2WQY B;  1MHH E;  3B08 A;  4E74 A;  1D6E C;  2WXN A;  3EGR A;  1QOG A;  2L1A A;  1HZ6 A;  2WXQ A;  1EUV B;  3QIJ A;  4TQ0 A;  4HEA 1;  3A9K A;  4YWG G;  2BYE A;  5TSS A;  4BAX A;  3AU4 A;  4E3C A;  3T3O A;  3DBL I;  4LJP B;  3WAO A;  1WJU A;  3N20 C;  4YL8 A;  2GMI C;  3L10 B;  4JWS C;  2FBW B;  2BB5 A;  1BML C;  1NDD A;  4HRS A;  4W9D A;  4HJG E;  2DNF A;  4W9I A;  4UDU C;  2KAN A;  3BZD B;  3TEY A;  1R4M I;  1ZPS A;  1P98 A;  2PIA A;  5AZG A;  1HTO A;  1GUA B;  2B3A A;  2LVO A;  3U30 A;  1ZE3 D;  2FCQ A;  4ASW C;  4WAF A;  3GP7 A;  3AE5 B;  3OJ3 A;  2DHZ A;  1QKZ A;  1ESF A;  4M0W B;  1V5T A;  5DPT A;  1C9F A;  3ZDM C;  4FXC A;  1XF5 L;  4JIO U;  1IGD A;  1QZE A;  1V1P B;  4ZRI A;  4EZJ A;  2LVP A;  1MI0 A;  1NYQ A;  1TY2 A;  2LI5 A;  5FKA C;  3IBE A;  4KV2 A;  1E8W A;  4USA A;  2NR2 A;  1WX8 A;  3QJZ A;  1E8Y A;  3GB1 A;  3ZRC A;  2ZNV B;  3PZD A;  2JZP A;  2O2V B;  3UIP B;  3DBS A;  2LXA A;  3A33 B;  1SXT A;  1E10 A;  3DBL B;  5C1Z A;  2XK5 B;  4LCD E;  1ROE A;  2K8B A;  3KLS X;  2WX0 A;  3QC8 B;  5IOI A;  2MRP A;  5CX3 A;  1PUT A;  3RPF C;  3IAM 1;  2GLS A;  1GG3 A;  3AEC B;  4HCN B;  1FMA D;  3VH3 B;  3KYD D;  1E90 A;  4C00 A;  1EM7 A;  1J7C A;  1V86 A;  1R4M B;  2J0M A;  4KDL B;  3M62 B;  1KLV A;  2J0J A;  1F9J A;  2BS3 B;  1BUI C;  3JYU A;  1FXT B;  1YJI A;  3ZJU A;  3C19 A;  2KC1 A;  2PEA A;  4WJO A;  4ANX A;  4AUQ C;  4TUU A;  1ZXH A;  2C7M B;  2BW2 A;  4MEM A;  1GOZ A;  2LRW A;  1RFA A;  2HD5 B;  1YNT E;  2L8J A;  3A1Q B;  3VUY A;  1PGA A;  4L2Y A;  1J7B A;  2JQR B;  3PHX B;  4E71 A;  3AB5 A;  1FD6 A;  3PSE B;  1TYG B;  4M8M A;  3ETR A;  3A9J A;  5TR5 A;  2YVC A;  5J17 A;  4JLC A;  3RNE C;  2ZNV C;  4BOZ B;  3I3T B;  1IUE A;  4TQ1 A;  1I4H A;  3BVG A;  4PT5 A;  1UF0 A;  4NPN A;  3VTU A;  3BWU D;  2K0P A;  1J19 A;  3RYT A;  1AWD A;  2K8H A;  3GOE A;  5DPW A;  4OZC A;  4KGS A;  4LNF A;  4MAC A;  1Q10 A;  3VH4 B;  2EEL A;  1WIA A;  2ZVN A;  1NBF C;  1LO5 D;  3PLU A;  2G3Q B;  2CJO A;  3KWV A;  3Q8E A;  5CHF A;  5FR6 A;  2WYQ A;  1MVK A;  1K52 A;  1UNS A;  3NUH B;  4WJP A;  3WCQ A;  2C60 A;  1WXM A;  3HRD D;  3TJP A;  2KK8 A;  2GBM A;  2AQ2 B;  5KHO A;  1IPG A;  4YSX B;  4G11 A;  1PGB A;  2KTR B;  1VZ8 A;  2JZ3 B;  2KQ4 X;  1LM8 B;  2Q5W D;  3AU5 A;  2MEK A;  2ICI A;  4G50 A;  5MPO A;  4I6N B;  2O6V B;  2KAJ A;  1VCB A;  4ANU A;  3RNC C;  1KH0 A;  4ZRQ A;  3H1U A;  4B6W A;  4HRO A;  3WAN A;  2WWZ A;  4EFO A;  1OEY J;  2V4L A;  1GNU A;  3KUD B;  3PO0 A;  4DXG A;  1I4R A;  1FEH A;  1P9D U;  1TJE A;  2KFJ A;  3E9S A;  1JW9 D;  4NAW A;  2KX3 A;  1V8C A;  3QX1 A;  1F77 A;  4K1R B;  2KMC A;  2LJI A;  3BY4 B;  2ZPN A;  2MHJ A;  1E8Z A;  1PFD A;  2QIL A;  3Q69 A;  4C56 C;  1I4Q A;  2WXP A;  2ZW0 A;  2CS4 A;  2DX5 B;  1WGD A;  4K7W A;  5CTR C;  1E7V A;  4BVU C;  4XWW A;  2PVG C;  4JGH B;  3QAQ A;  1EWY C;  4DHZ E;  3HM3 A;  2KJH B;  3BK1 A;  2K22 A;  2NTS A;  2LGI A;  2W55 A;  1WXQ A;  3FIL B;  1WE7 A;  2C7N B;  2JU6 X;  2UWQ A;  1M4V A;  1KTK A;  3NHE B;  2J4X A;  3TEW A;  4FN2 A;  1ZDV A;  2QDF A;  1K50 A;  1NI3 A;  4K7S A;  2N9P C;  3NVY A;  3AXC A;  4II2 B;  3VRA B;  3AE9 B;  3SFD B;  1WI0 A;  1N60 A;  1UEL A;  2KDB A;  1A70 A;  1SE2 A;  1WWT A;  3I9V 1;  3U2S C;  4O1N A;  4M00 A;  1IBX B;  3ZRF A;  2QSD A;  2V9H A;  1D5Z C;  2KZR A;  2AL6 A;  4PS8 A;  4REZ A;  4XDC A;  3VVW B;  2FCM A;  1JQ4 A;  1ACC A;  2KNB A;  4ZRJ A;  5FK9 C;  4BKS D;  2WXK A;  1MG4 A;  1YQB A;  3B0A A;  1WX7 A;  1TT5 B;  2R61 A;  2FCN A;  3L16 A;  2KMM A;  2CJN A;  5L95 C;  3AM9 A;  1YQ3 B;  5BYQ A;  1J8C A;  4AWJ A;  3NS8 A;  2NTT A;  3MHZ A;  3Q3F A;  2L3Z A;  1OTR B;  1VZ6 A;  2ZEQ A;  4MT5 A;  3NOB A;  1HA5 A;  1SBB B;  2VRR B;  1FRR A;  4IW0 A;  1LFD A;  2JUO A;  2L0F A;  3IHP C;  2WDQ B;  3LJ3 A;  4HKQ A;  2WXO A;  2N0S B;  2TSS A;  3APF A;  2KVZ A;  3IT6 B;  3ML9 A;  2W3R A;  1FNU A;  3H7P A;  3GS2 A;  1S3S G;  3VUW A;  4GGQ A;  1KM7 A;  3CST A;  3DWG C;  2MWS B;  3DBH B;  3P42 A;  4PS7 A;  5BMH A;  2QIE B;  2GBR A;  3IXS A;  2W9N A;  3AEA B;  1OQR A;  1JRO A;  1C76 A;  3IG3 A;  2KAC A;  3N9Y C;  3KYC D;  3U7Z A;  1YN5 A;  4FLH A;  5EE9 A;  1SF0 A;  1SSN A;  2RDH A;  3U7D A;  4RNA A;  2LEK A;  2ASQ A;  5D3I B;  2KYW A;  3Q8F A;  4ANV A;  4QAY A;  1FO4 A;  4EOY A;  4NY0 A;  5EE3 A;  2W54 A;  3ZTC A;  3DPD A;  3CSF A;  2VH1 A;  1I35 A;  1C79 A;  4HCP B;  2L05 A;  4JPS A;  2UYZ B;  4RH6 A;  3WIM A;  4LLG M;  4WWO A;  5E6J A;  1AAR A;  3PRM B;  2LFI A;  4NNJ B;  2KMA A;  2D10 A;  1JWM D;  3AMZ A;  4EZK A;  2H88 B;  2R2Q A;  2JX5 A;  1C4P A;  2O6V D;  4W9F A;  2KWD A;  3EFC A;  4ITK A;  2Z59 B;  3ZJV A;  2IGD A;  1JWA D;  5H92 C;  1V1P A;  1E0Z A;  2GBN A;  2M4N A;  1QOA A;  2XBB C;  3ZW3 A;  3QCA A;  2JRI B;  1PDX A;  1GC7 A;  2KFK B;  2FID A;  4LDT D;  2QCZ A;  1P3Q U;  1WGR A;  2O2V A;  3PPA A;  1QT9 A;  3NZU A;  4PK1 A;  5HKH A;  2XK5 A;  4GSW A;  3P2B A;  2G45 B;  5D94 A;  3APC A;  2YEP B;  4FJY A;  2DAF A;  4C80 A;  2BT6 A;  2M0A A;  2V0G A;  3PRZ A;  1F2R I;  3ZQ4 A;  4AJW A;  1IYF A;  3EEC A;  2ZW1 A;  3JSV B;  3RMK C;  4BKS A;  2IJ0 A;  4GLS C;  1C4A A;  3K9P B;  5D3D A;  2RPQ A;  3EA6 A;  4F7Z A;  1AN8 A;  3DWM A;  1XQQ A;  3NRZ A;  2CU1 A;  3VR8 B;  2J0K A;  2IGG A;  3Q3J A;  1XT9 B;  1GPX A;  1T6B X;  2L7R A;  2Y3A A;  1KLG D;  3C8Y A;  2DZI A;  4JE3 B;  4A9A A;  4DDG D;  2HTM E;  2MSE D;  3A1Q A;  4BKG A;  2PPH A;  4D2K A;  4IM0 A;  2BS4 B;  5LLI A;  3TL5 A;  2LGX A;  2LGS A;  3OG5 A;  2DYB A;  2C7H A;  2K5P A;  2WDR B;  1VZ7 A;  1LXD A;  1UGM A;  2KQ7 A;  4MEL A;  1P0R A;  2MBE A;  4LNK A;  3NG0 A;  2LXC A;  1I4P A;  3PLV A;  4EE2 A;  4GDK B;  4DHJ D;  2MBQ A;  4P7I A;  1XLQ A;  3P4Q B;  1FM0 D;  1XXG A;  4DBG A;  1S1Q B;  1YX5 B;  2WLB A;  3URY A;  3QWZ B;  4GU2 A;  3VAW A;  1FFU A;  4S17 A;  1YIW A;  3VRB B;  4ZDV A;  4ARI A;  1LGR A;  4ICV A;  3N1X C;  5IAA C;  1T0Q C;  3P4R B;  4ZRK A;  4AS1 A;  3BIN A;  1RAX A;  2KDM A;  2J7Q B;  2VZK D;  2G9H D;  3NZS A;  3QQ8 B;  1HTQ A;  2K39 A;  5IO9 A;  2D07 B;  2D3G A;  3W5U B;  1WYG A;  4RM9 A;  3A4S C;  3SDL C;  3ZKJ C;  1YD8 U;  2SEB D;  3TBL D;  4GB9 A;  1SE3 A;  2WXH A;  3MJ5 A;  2EKI A;  4NZL B;  3MHS D;  2KTR A;  3HM6 X;  3QAR A;  1FCL A;  4FBJ B;  2HJ8 A;  2OED A;  3UIN B;  2O6V A;  4W9C A;  4FA6 A;  3RZW C;  3VR9 B;  1TIF A;  3AE8 B;  1YJ1 A;  1HQR D;  1XLN A;  1Q0W B;  2INN E;  3VQI A;  2DYO A;  3IFW B;  4G3X B;  2XEW A;  3N32 A;  3W5V B;  4YSZ B;  1T5X D;  2A5U A;  3OAW A;  2JZZ A;  2BBC A;  4LK0 M;  4MH0 E;  1Z5S B;  3HVZ A;  3ZNG C;  1KOT A;  2RDG A;  1V80 A;  2E3T A;  1NEN B;  1JWB D;  1UUP A;  3PVL A;  1C3T A;  1L4Z B;  3PZ8 A;  2INC C;  4HJK A;  3I5J C;  3SEB A;  5I4D A;  3N1Z C;  1I7H A;  3V62 A;  4KVG B;  3M95 A;  1HE8 A;  3TEZ A;  1F2R C;  1T0R C;  1D4B A;  4OHJ A;  2BPS A;  4A3P A;  3H6N A;  3RN9 C;  1WMH B;  4ZOH C;  3ZDT A;  4KDI C;  4KIK A;  3FIL A;  3TIX A;  3ECI A;  1QF6 A;  2CU3 A;  1ZKH A;  4A55 A;  4PYU A;  1ZXI A;  3CWI A;  2NPT B;  3DBR B;  1N6Z A;  4ZYN A;  2LUE A;  2LMC A;  1JRU A;  2NBU A;  1WGK A;  4B95 A;  2X38 A;  4W9G A;  1WJN A;  2I1K A;  3AV8 A;  1V49 A;  3RD2 A;  3DVG X;  1F52 A;  2KDF B;  5BO4 B;  2YEP F;  1QOB A;  4I6L B;  2JY6 A;  3W2D A;  2PMV A;  2KT7 A;  2MJ3 A;  4C4V B;  1Z2M A;  2ZJD A;  3BII D;  3ENE A;  1IBX A;  2LHD A;  3ZJT A;  1K8R B;  3ZNH B;  3AN1 A;  4HPM B;  2WXM A;  2RMM A;  2WXL A;  2RD0 A;  4IM3 A;  3UIO B;  4HKZ E;  4I6P A;  3DVN V;  3PTF C;  1TZ1 A;  1XD3 B;  3MC8 A;  3VTV A;  4HLE A;  1FXI A;  3AE4 B;  2KN4 A;  2HE7 A;  3BYY B;  2E6X A;  1RM6 C;  2IGH A;  3DOW A;  2GBJ A;  1CQV A;  2KLG A;  1ET6 A;  3Q3O C;  2K1F A;  1QOF A;  4YTN B;  4IDI A;  1D5M C;  1MJD A;  1L2N A;  4W9H A;  4WWM A;  2M8S A;  1J0G A;  1K51 A;  1V1O A;  3ABV B;  2KX0 A;  1V2Y A;  2RPV A;  2BVC A;  4A20 A;  1XLO A;  2FCS A;  3AI5 A;  1RWS A;  4CQN A;  2K6D B;  4NQL B;  2N9K A;  5HI1 A;  1ENF A;  3L17 A;  2V4I B;  4XX5 A;  2RGF A;  3N30 A;  2JXT A;  3L0W B;  4FJV B;  3AEE B;  2OJW A;  3UQA A;  1WR6 E;  1TS3 A;  3C0R B;  4G0N B;  1TS4 A;  2JXX A;  5D7G A;  2PE9 A;  2BWF A;  1ET9 A;  3BK2 A;  1TS5 A;  1VJK A;  2DZM A;  4KGT A;  1M94 A;  2K6Q A;  4KZ0 A;  4B9K A;  1UGJ A;  1H8C A;  1FNV A;  4HPP A;  2NVU I;  4URK A;  1I4X A;  5AUI A;  4HDO A;  3UGB B;  4R3D A;  2KHW B;  4IG7 B;  1I4G A;  4PYZ A;  1XO3 A;  3A9J B;  2KKC A;  1SB3 C;  5JHA A;  1PYW D;  3I57 A;  4EUT A;  2MBH A;  3DHG C;  4OVU A;  2M19 A;  3IT4 B;  1EWC A;  4FAD A;  1RLF A;  3DBH I;  3TEX A;  1GAQ B;  5T8I A;  3ZLZ A;  2DZK A;  3DHI C;  4K3B A;  2JPH A;  2G4D B;  1E8X A;  1T0Y A;  1V97 A;  4NQK E;  2ZCB A;  4DXF A;  1FIQ A;  2HJ1 A;  2WGS A;  4EKU A;  3DVG Y;  1XEE A;  3LB8 C;  4BKT A;  4IC7 B;  2OOB B;  4LJO B;  2BYF A;  4WUR A;  1V5O A;  1UH6 A;  1R4N B;  4DWF A;  4RGT A;  2PKO A;  2QC8 A;  4IM2 A;  2KXJ A;  4MSM B;  3DHH C;  2WXJ A;  2N7E A;  2KFK A;  2V3N A;  4MJS B;  3R8B A;  5HG2 A;  2LVQ A;  1X1M A;  3K9O B;  2IND C;  1WRI A;  2JYE A;  3AEB B;  1MPE A;  4KGR A;  1T0S C;  3PRE A;  4CO7 A;  4P16 A;  2CHZ A;  2AQ3 B;  3AH7 A;  4BZA A;  3O65 B;  5HFY A;  2NBV B;  4L1B A;  2WXR A;  1UD7 A;  3SHQ A;  4GDL B;  2QJL A;  1WH3 A;  3MP9 A;  2QMT A;  4MSQ B;  2JT4 B;  4HK2 A;  3RNF C;  2D3C A;  1TKY A;  2KLC A;  2GI9 A;  3MJW A;  5AZF A;  2MCN B;  1KFY B;  1JAL A;  4IOI E;  1SE4 A;  1EU4 A;  2MP2 B;  4IWO A;  5EDS A;  3Q6B A;  2JWU A;  3GE3 C;  4W9E A;  3HIZ A;  2M56 B;  2IYD B;  3B2F A;  3ZXV A;  3H7S A;  3IAS 1;  5J18 A;  4HWI B;  4K7U A;  3FKY A;  1YN3 A;  1L0X B;  5G2N A;  1D5X C;  2CHW A;  2IDY A;  1WM3 A;  3AEF B;  2JSV X;  2RR9 A;  2DWQ A;  1N63 A;  4JX1 C;  4N58 A;  5GXG B;  1PQS A;  1WR1 A;  2L32 A;  3HHM A;  3HVD A;  2ZCC A;  3O13 A;  3ZIM A;  2FAZ A;  2KD0 A;  1KF6 B;  1QLB B;  1N61 A;  1E6E B;  1U4A A;  1DOX A;  1V9J A;  3NY5 A;  2K8C A;  3PRP B;  3KWL A;  4AP4 C;  2LD9 A;  3AED B;  3E56 A;  2N9E B;  2BS2 B;  2WP9 B;  4ZHP A;  2JRH A;  4M0W A;  1OQQ A;  1JCK B;  2WXF A; 
#chains in the Genus database with same CATH homology
 5IAA C;  2KDI A;  2AL3 A;  3OLM D;  2ZZP B;  4ZRK A;  3BIN A;  3VH4 B;  4ANW A;  1RAX A;  2BGF A;  4ICU A;  5DPR A;  1D3Z A;  2J7Q B;  1WIA A;  2ZVN A;  1NBF C;  4GMV A;  2BYV E;  3PLU A;  2G3Q B;  1UZX B;  2KOX A;  3NZS A;  3QQ8 B;  4TV3 A;  4DHZ B;  4A3O A;  2K39 A;  4MM3 A;  2D07 B;  2D3G A;  5CHF A;  5FR6 A;  3W1S C;  2M1M A;  2WYQ A;  3ZUN A;  4RM9 A;  2YLM A;  3A4S C;  4MGY E;  2Y5B B;  3SDL C;  3ZKJ C;  1YD8 U;  2BKF A;  4EEW A;  2L0T A;  3S2A A;  1Q1O A;  1VD2 A;  3TBL D;  2ZVO A;  3DDC B;  4GB9 A;  1V6E A;  2DZJ A;  3V6E B;  2KDE B;  2KWC A;  2M17 A;  3DQV A;  4WJP A;  1WXS A;  3A4R A;  3R3M A;  4RM8 A;  2IZV B;  2C60 A;  1WXM A;  3TJP A;  2K25 A;  2KK8 A;  2GBM A;  3MHS D;  1WXV A;  4DHJ B;  4GXB A;  2QHO A;  5KHO A;  4FHJ A;  2WDT B;  1C1Y B;  1IPG A;  3VTW A;  2KTR A;  4G11 A;  5AZH A;  2KTR B;  2MBB B;  3ZO5 B;  1ZGU B;  2JZ3 B;  3HM6 X;  3QAR A;  1LM8 B;  3AU5 A;  2G4S A;  4FBJ B;  2HJ8 A;  3UIN B;  2O6V A;  4W9C A;  4CYE A;  4G50 A;  4FA6 A;  4I6N B;  2L00 B;  2O6V B;  3RZW C;  3PHW B;  1VCB A;  2V1Y A;  4ANU A;  1YJ1 A;  2N4F A;  1Q0W B;  3VQI A;  2DYO A;  3IFW B;  4G3X B;  2XEW A;  3H1U A;  4CHK A;  3N32 A;  5D2M B;  1WX9 A;  1WGH A;  3DCG A;  1LQB A;  3JSV A;  3KVF B;  4B6W A;  3ONS A;  2A5U A;  3OAW A;  3WAN A;  1BT0 A;  2WWZ A;  3MTN B;  4HDQ A;  4EFO A;  1OEY J;  2BF8 B;  3KH0 A;  2V4L A;  1GNU A;  3KUD B;  2KFJ A;  1P9D U;  2JZZ A;  2IO0 B;  3JVZ X;  1WZ0 A;  4FUL A;  4NAW A;  2KX3 A;  4MH0 E;  1E5W A;  1Z5S B;  2M0X A;  3ZNG C;  1KOT A;  3QX1 A;  1V80 A;  4NAW B;  4XC2 A;  5C23 A;  3SD5 A;  4K1R B;  2KMC A;  1YX6 B;  2L76 A;  2I1J A;  3BY4 B;  4W9L A;  2ZPN A;  1SGH A;  3APD A;  3M63 B;  3PVL A;  3VUX A;  1C3T A;  3KW5 B;  2KC2 A;  4WJQ A;  4HJK A;  5KHQ A;  1E8Z A;  4EZL A;  3HK0 A;  4F8C B;  5D6J B;  5DPS A;  4BOS C;  3LDZ E;  4DK5 A;  2MX2 A;  4JL9 A;  3V62 A;  4N9F 4;  1I42 A;  2CS4 A;  2DX5 B;  1WGD A;  4K7W A;  4KVG B;  3M95 A;  5CTR C;  3AUL A;  1E7V A;  1HE8 A;  3UF8 A;  4BVU C;  2MA9 B;  2BPS A;  4A3P A;  1WMH A;  1A5R A;  3H6N A;  4JGH B;  3QAQ A;  3JW0 X;  5JH5 C;  1WMH B;  3ZDT A;  4DHZ E;  4KDI C;  3HM3 A;  2LGY A;  1CMX B;  3ZVV A;  2EMS A;  2KJH B;  3N3K B;  3L13 A;  4KIK A;  4GN1 A;  5LXH A;  2MQJ A;  4AJY B;  3DVN U;  3TIX A;  3WAM A;  1WE7 A;  3T8M A;  3ECI A;  2C7N B;  4RMA A;  2UWQ A;  2C9W B;  3L54 A;  5L83 A;  5G55 A;  2AYO B;  4GDK A;  1ZKH A;  3CF6 E;  3NHE B;  4PYU A;  2DYM A;  4FN2 A;  5IA7 A;  4BFR A;  1MG8 A;  4WQO B;  2NPT A;  4K7S A;  4IWQ A;  2NPT B;  4ZYN A;  2LUE A;  2OJR A;  1JRU A;  2NBU A;  1ISN A;  1WZ3 A;  2N9P C;  4PS3 A;  2A4Z A;  3AXC A;  4B95 A;  2JWZ A;  4II2 B;  4W9G A;  1WJN A;  2I1K A;  2CKH B;  3RUI B;  3V60 A;  1WGY A;  4WJN A;  1V49 A;  3VHT C;  2KQS A;  1KJT A;  3CMM B;  4MGZ E;  1WJ4 A;  5CHW A;  3RD2 A;  3VDZ A;  3DVG X;  3WAL A;  2KDF B;  5BO4 B;  1WI0 A;  4I6L B;  2JY6 A;  3R7Q A;  2LZ6 A;  3KUC B;  2EMT A;  3R7R A;  1UEL A;  1WGG A;  2KDB A;  4TKN A;  2MBO A;  3QHT A;  4K81 A;  1Z2M A;  2ZJD A;  3RT3 B;  3ENE A;  3R66 C;  2V3S A;  4HPL B;  3ZRF A;  3U8Z A;  1K8R B;  2GOW A;  1TBE A;  3ZNH B;  4AOF A;  2FNJ B;  4KZC A;  4F1S A;  4HPM B;  4IM3 A;  3UIO B;  2RD0 A;  4BBN C;  4GOC A;  1UBQ A;  2KZR A;  2WX1 A;  3H9D A;  4IUM B;  4II3 B;  5GMV A;  4PS8 A;  2KN5 A;  4BBN F;  4I6P A;  2BKR B;  3B1L X;  3DVN V;  3PTF C;  3VVW B;  2FCM A;  3W1Y A;  1TZ1 A;  1XD3 B;  3ML8 A;  2KO3 A;  2KNB A;  2PE6 B;  3ALB A;  3V6C B;  3ZNZ B;  4ZRJ A;  3RUL A;  3VTV A;  2N7D A;  3DBR I;  4HLE A;  4BKS D;  4WWP A;  2D11 A;  1YQB A;  3B0A A;  1WX7 A;  2C5L C;  2LJ5 A;  2KVR A;  2IO3 B;  2EKE C;  3WA0 A;  4W9K A;  3D32 A;  3WAP A;  2FCN A;  3L16 A;  2HE7 A;  2FIF A;  1WFY A;  5L95 C;  5J2R A;  3V61 A;  1J8C A;  4AWJ A;  2IO2 B;  3NS8 A;  3GZN I;  3QK0 A;  3Q3F A;  3PT2 B;  2KWV B;  1WJ6 A;  3DOW A;  3PV1 A;  2L3Z A;  2GBJ A;  2AWT A;  3UQB A;  1OTR B;  4W9J A;  4WAA A;  2ZEQ A;  3ZTD A;  2KLG A;  3NOB A;  2AEH A;  2VRR B;  4MDK E;  1E7U A;  4NJ7 A;  4IW0 A;  1LFD A;  2FUH B;  2JUO A;  2L0F A;  2K1F A;  3IHP C;  3LJ3 A;  5E6P A;  1SIF A;  2NCN A;  2DEN B;  3APF A;  1L2N A;  3T9L A;  3ML9 A;  1OGW A;  5JZE B;  2RSU A;  4W9H A;  3H7P A;  1P1A A;  2M8S A;  3EHV A;  5CHV C;  1H4R A;  1GC6 A;  1J0G A;  3H7P B;  1S3S G;  1OEY A;  2KJR A;  1ZW7 A;  2KX0 A;  1V2Y A;  5LXI B;  2PJH A;  3VUW A;  2D2Q A;  4GGQ A;  4A20 A;  1KM7 A;  1IP9 A;  4DXA B;  3CST A;  2FCS A;  3AI5 A;  2MWS B;  3B08 A;  4E74 A;  4KSL C;  2K6D B;  4NQL B;  3L17 A;  4PS7 A;  4XX5 A;  2RGF A;  3N30 A;  4FJV B;  2GBR A;  3L0W B;  2W9N A;  3UQA A;  1EUV B;  3QIJ A;  4TQ0 A;  2N1W A;  3A9K A;  1V81 A;  1WR6 E;  4J6I A;  3IG3 A;  3A9K B;  2BYE A;  3C0R B;  3AU4 A;  4G0N B;  1GJZ A;  4E3C A;  3KYC D;  2JXX A;  1OQY A;  3DBL I;  4LJP B;  5D7G A;  3WAO A;  2Z0D B;  3X0W A;  4FLH A;  2PE9 A;  2BWF A;  3U7D A;  1WJU A;  4JQW C;  2DZM A;  4YL8 A;  2ASQ A;  1M94 A;  2GMI C;  2K6Q A;  1Y8R C;  3IVF A;  3L10 B;  4KZ0 A;  4ANV A;  2CR5 A;  4B9K A;  4NY0 A;  4EOY A;  1H8C A;  3VFK A;  4URK A;  2NVU I;  1G6J A;  3ZTC A;  5AEK B;  2REX A;  3DPD A;  3CSF A;  4HDO A;  3UGB B;  5DCN A;  1NDD A;  1I35 A;  3X23 A;  2KHW B;  2JF5 A;  4W9D A;  4IG7 B;  4GIV A;  2L05 A;  4HCP B;  4PYZ A;  2CHX A;  3TMP B;  4W9I A;  2KAN A;  3A9J B;  2KKC A;  2R2O A;  5JHA A;  2UYZ B;  1R4M I;  4EUT A;  1P98 A;  1TTN A;  2MBH A;  4OVU A;  2LRU A;  3WIM A;  4WWO A;  5AZG A;  2GBK A;  4FAD A;  1AAR A;  3PRM B;  4NNJ B;  1RLF A;  3DBH I;  1WRD B;  2KMA A;  1GUA B;  2D10 A;  4WWN A;  2B3A A;  2IO1 B;  3PGE A;  2LVO A;  4XZ4 A;  4EZK A;  3U30 A;  2R2Q A;  3EC8 A;  2FCQ A;  4ASW C;  3ZLZ A;  3OJ3 A;  2DZK A;  2LAS A;  2JPH A;  4DDI D;  2DHZ A;  3ZNI D;  2O6V D;  2G4D B;  1E8X A;  1T0Y A;  2NBW B;  4NQK E;  4W9F A;  4M0W B;  2ZCB A;  1V5T A;  2MLB A;  5DPT A;  3ZDM C;  2Z59 B;  1EF5 A;  4EKU A;  3DVG Y;  4JIO U;  4IWP A;  4BKT A;  1QZE A;  4IC7 B;  2OOB B;  4LJO B;  2BYF A;  1V5O A;  1UH6 A;  4ZRI A;  2LGD A;  4EZJ A;  2LVP A;  2GBN A;  2M4N A;  4DWF A;  2XBB C;  2N9X A;  3ZW3 A;  4IM2 A;  3QCA A;  2KXJ A;  4MSM B;  2LI5 A;  2JRI B;  3IBE A;  4KV2 A;  3RZF A;  4MJS A;  2N7E A;  3OJ4 B;  2KFK A;  1E8W A;  1GC7 A;  3EFU A;  4MJS B;  2LVQ A;  2NR2 A;  4FJZ A;  2KFK B;  1X1M A;  4MGI E;  2FID A;  3K9O B;  4LDT D;  1WX8 A;  3QJZ A;  5E6N A;  1E8Y A;  1EO6 A;  2LWP A;  3ZRC A;  2ZNV B;  3M3J A;  1P3Q U;  3PZD A;  1WGR A;  1EF1 A;  2O2V A;  3PPA A;  2O2V B;  3PRE A;  2JVC A;  4CO7 A;  3TCA A;  3NZU A;  2CHZ A;  3UIP B;  3DBS A;  2LXA A;  3L08 A;  3A33 B;  3O65 B;  2NBV B;  5HKH A;  2XK5 A;  5C1Z A;  1UD7 A;  4GSW A;  3P2B A;  2HTH A;  3SHQ A;  2XK5 B;  4GDL A;  2G45 B;  5D94 A;  4LCD E;  1NI2 A;  3APC A;  4GDL B;  2K8B A;  1WH3 A;  4FJY A;  2WX0 A;  3QC8 B;  2DAF A;  1WM2 A;  2MRP A;  4MSQ B;  5CX3 A;  4M8N A;  1RRB A;  2JT4 B;  5JHB A;  4HK2 A;  3PRZ A;  1SE9 A;  2Z0E B;  2ZPY A;  3RCZ A;  2MW5 A;  1GG3 A;  4AJW A;  4HCN B;  2KLC A;  3EEC A;  1IYF A;  3MJW A;  3JSV B;  3VH3 B;  5AZF A;  2MCN B;  3KYD D;  1R4N I;  2MP2 A;  1E90 A;  5EDS A;  2NS5 A;  2MP2 B;  3QA8 A;  1V86 A;  4IWO A;  4BKS A;  3W1S A;  2J0M A;  4W9E A;  2IY1 B;  4KDL B;  3K9P B;  3M62 B;  3HIZ A;  1KLV A;  2IYD B;  2RPQ A;  2J0J A;  1WYW B;  4F7Z A;  1F9J A;  3H7S A;  1TGZ B;  4FHK A;  1XQQ A;  1WF9 A;  2CU1 A;  2KWU B;  3JYU A;  3PS6 A;  4LDT B;  2J0K A;  1FXT B;  3Q3J A;  1XT9 B;  2KC1 A;  1Q5W B;  2PEA A;  5J18 A;  4HXD A;  4HWI B;  4K7U A;  2L7R A;  4NJ6 A;  4KSK C;  4WJO A;  4ANX A;  5G2N A;  4AUQ C;  2DZI A;  4TUU A;  1WY8 A;  2C7M B;  4DDG D;  4MEM A;  2CHW A;  2MSE D;  2LRW A;  1RFA A;  3A1Q A;  2HD5 B;  2PPH A;  2IY0 B;  4BKG A;  1WM3 A;  2L8J A;  1WXA A;  4IM0 A;  3A1Q B;  2IBI B;  5E6O A;  2RR9 A;  5LLI A;  3TL5 A;  2LGX A;  3VUY A;  1PQS A;  2DYB A;  2C7H A;  1L7Y A;  1WR1 A;  3PHX B;  4KIK B;  4E71 A;  1LXD A;  1UGM A;  2KQ7 A;  4HVB A;  3HHM A;  4MEL A;  3PSE B;  1P0R A;  2MBE A;  2ZCC A;  3ZIM A;  2N1V A;  4M8M A;  2FAZ A;  3A9J A;  2KD0 A;  4MGK E;  5TR5 A;  2YVC A;  5J17 A;  2LXC A;  3PLV A;  4JLC A;  1WE6 A;  2ZNV C;  4BOZ B;  1U4A A;  3I3T B;  1V9J A;  3KUZ A;  4GDK B;  3NY5 A;  4TQ1 A;  2K8C A;  4DHJ D;  2MBQ A;  3PRP B;  4P7I A;  4NPN A;  2BWE S;  2KTF A;  3VTU A;  2DAJ A;  4X57 B;  4AP4 C;  4DBG A;  2KJ6 A;  2LD9 A;  1S1Q B;  1YX5 B;  3SU8 X;  2N9E B;  3VXW A;  1J19 A;  3RYT A;  3QWZ B;  4GU2 A;  3VAW A;  2K8H A;  3GOE A;  5DPW A;  4ZDV A;  1YIW A;  2JRH A;  4ICV A;  4OVV A;  1UBI A;  2AL6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...