1UGMA

Crystal structure of lc3
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
113
structure length
113
Chain Sequence
KTFKQRRSFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESERDEDGFLYMVYASQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Microtubule-associated proteins 1A/1B light chain 3
publication title The crystal structure of microtubule-associated protein light chain 3, a mammalian homologue of Saccharomyces cerevisiae Atg8
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Structural protein
total genus 34
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2003-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1ugmA00
2ZNVB 1WGYA 3AU4A 1F9JA 3B08A 3DCGA 1V6EA 3H7PB 3HM3A 1IP9A 1GC7A 3RT3B 2BYEA 4TQ1A 1Q5WB 4FBJB 2KC2A 1RLFA 4BKGA 2DHZA 3ZDMC 1V5OA 2KJ6A 3CF6E 3VFKA 4A20A 4GDKB 3ZW3A 4BKTA 1J8CA 2KDBA 5FR6A 5C1ZA 3DBHI 3QWZB 4DHZB 1VD2A 1WFYA 2JUOA 1PQSA 4ZDVA 4A3OA 3PTFC 4XX5A 2M1MA 3DVGY 4EKUA 2LI5A 1EF1A 3X23A 3WANA 1MG8A 4HDQA 2D3GA 3ONSA 3DVNV 2LD9A 2ZNVC 2KLCA 2O2VA 2JT4B 2HD5B 4E74A 4DXAB 2KDIA 2MRPA 1IYFA 2N7EA 3ZDTA 4W9FA 2KD0A 3NOBA 1J0GA 3ZNGC 1P9DU 4RM8A 4XC2A 4JGHB 4CHKA 1U4AA 3UQAA 2KTFA 3A1QA 3PGEA 3VTVA 3A9KB 2NBUA 4MDKE 4K81A 1FXTB 4GDLA 4N9F4 3H1UA 4LJPB 1E8ZA 1EO6A 4II2B 2L76A 1WR1A 5JHBA 3N32A 5JZEB 3ZRCA 5L95C 2OJRA 3APDA 1WGGA 3PREA 5IAAC 1KM7A 2KWUB 1D3ZA 4E71A 2L8JA 3ZO5B 1KLVA 2CHWA 4HWIB 3ZUNA 4DDID 2AL6A 1OEYJ 2WYQA 3N30A 4DWFA 2KHWB 3PRZA 5D7GA 2KMCA 3QHTA 3X0WA 1R4NI 3WAMA 1WGHA 4IG7B 3OJ4B 1E8YA 1CMXB 2NBWB 3M95A 2ZZPB 3NZUA 1GG3A 4IWQA 2IO0B 2KXJA 3JYUA 1LM8B 3T9LA 1OEYA 3HHMA 2K39A 4W9CA 3L54A 3QC8B 2L00B 3R7QA 3IG3A 1Z5SB 4TUUA 2CR5A 2O2VB 4W9EA 1WIAA 1GNUA 2LRWA 2NPTA 4G0NB 4ZRJA 3U8ZA 4J6IA 3DQVA 3AULA 1WH3A 3RUIB 4BKSA 3OAWA 3D32A 3A33B 3QK0A 4HLEA 1JRUA 2Z0EB 4K1RB 4IC7B 1WM2A 3A1QB 4DHZE 3AI5A 4F1SA 1SGHA 3QJZA 3GZNI 2D2QA 4GDLB 4HPMB 4AWJA 3WAPA 4EZKA 1RRBA 3QCAA 3IFWB 3DBRI 4HK2A 2PEAA 2KKCA 2C7NB 1V49A 2Y5BB 5DCNA 4FADA 3T8MA 2IY1B 2IYDB 4FN2A 2LGDA 2R2QA 1WGRA 1S3SG 2HJ8A 3VH4B 3QA8A 2G4DB 3I3TB 3PPAA 4ZRIA 2N1WA 4WJNA 3KVFB 3W1YA 3U7DA 5DPRA 3ZLZA 4TKNA 4KZ0A 2N4FA 4FJZA 4G3XB 2KLGA 4IM0A 2KO3A 1WMHA 4MH0E 4I6LB 2XBBC 1UH6A 4GGQA 3QAQA 2NVUI 2LRUA 3RZFA 4NPNA 3L08A 4FULA 2K8BA 2PE9A 3UGBB 4EZLA 4K7WA 5EDSA 3UINB 1WX7A 2BKFA 4KDIC 4BVUC 2DZKA 1WX8A 2Z0DB 3DBLI 4MGIE 3A9JA 5LXHA 2D11A 3DVNU 2G4SA 3MTNB 2PPHA 3TMPB 3K9OB 5CTRC 2WDTB 4PYUA 2GMIC 4KZCA 2GBJA 4JLCA 4JIOU 4TQ0A 3R66C 3SU8X 2KTRA 1YQBA 2LZ6A 2IY0B 3JSVA 3WALA 2M4NA 4IWOA 4RM9A 3Q3FA 4LJOB 2K1FA 1SIFA 2KX3A 4MJSA 2ZCCA 2G3QB 3V60A 2LVPA 3H9DA 2YLMA 3HM6X 3L17A 3PRMB 4MGKE 2MLBA 2RSUA 2NCNA 4NQKE 2MX2A 2JRIB 5LXIB 2FIFA 4HCPB 1VCBA 1E7UA 3ML8A 2ZJDA 4FHKA 3DBSA 4PS3A 2BGFA 3ENEA 5DPSA 1WYWB 1OTRB 3TCAA 2HE7A 2R2OA 4AOFA 4EOYA 1I35A 3VVWB 4WWNA 2MA9B 1X1MA 1P98A 1YX6B 2V1YA 3TJPA 3ZNZB 1WE7A 2JY6A 4IM3A 2AEHA 1TBEA 2L7RA 2KMAA 2L0TA 2AYOB 2O6VD 3IBEA 1WMHB 4F8CB 3CSFA 3AXCA 1UBQA 2MBHA 1Q1OA 3LJ3A 5BO4B 4TV3A 1H8CA 5JHAA 3C0RB 1HE8A 5D2MB 4KV2A 1E8XA 2PE6B 2MP2A 2JF5A 1TTNA 3GOEA 2EKEC 2REXA 2K8CA 3L16A 1KOTA 2K6QA 2C9WB 1Q0WB 4XZ4A 3PHXB 4HXDA 4FLHA 3W1SA 2LGXA 3A9JB 3KUDB 2M8SA 1UD7A 1H4RA 3KH0A 4W9GA 5KHQA 2KJRA 4BOSC 3SD5A 1KJTA 1RFAA 4URKA 2FIDA 2KTRB 3PS6A 4W9LA 3JSVB 4WJPA 4B95A 4GMVA 2MBEA 3ZTDA 3OLMD 3VDZA 4MJSB 2DZIA 4G11A 3Q3JA 4NY0A 3PZDA 2GBMA 1UBIA 1J19A 3VUYA 5E6NA 4K7UA 2KFJA 1Y8RC 1ZW7A 2I1KA 2KDFB 1WX9A 4IW0A 4MEMA 4AP4C 2FCNA 2BF8B 4ZYNA 2KQ7A 3VQIA 2C7MB 2LUEA 2KNBA 4FJYA 4GXBA 1TGZB 3EFUA 2KDEB 3SDLC 5HKHA 2L3ZA 4NAWA 2FUHB 2JVCA 4ZRKA 3JW0X 4WAAA 3QIJA 1ZKHA 2ZPNA 1YD8U 3NHEB 4M0WB 3NZSA 2DYBA 2KC1A 3IHPC 1K8RB 4BFRA 5E6OA 2CKHB 2LVOA 4NQLB 2DAJA 2D07B 3VUWA 4CO7A 1LXDA 3CSTA 5J2RA 3A4RA 2MP2B 4W9HA 4EUTA 2D10A 2LWPA 1P3QU 5AEKB 3ZRFA 2A4ZA 5AZGA 2C60A 1C3TA 3KYCD 2KFKA 1WI0A 4ASWC 3DDCB 4ICUA 1WJUA 3PSEB 2RPQA 4E3CA 4EEWA 2JRHA 1Z2MA 4ICVA 4A3PA 4K7SA 3K9PB 1S1QB 2NS5A 3HIZA 2N9EB 5L83A 4EFOA 3PHWB 3PLUA 4PS7A 1XQQA 2BYFA 3VXWA 4MELA 2PJHA 1IPGA 3UIPB 2BWFA 1RAXA 2Z59B 2KX0A 2YVCA 2J0JA 3PLVA 4DHJD 4X57B 2KJHB 1V81A 1L7YA 2O6VA 2MBOA 3B1LX 3L0WB 4IWPA 4LCDE 4IUMB 1WZ3A 3ZIMA 1ISNA 2M17A 2WWZA 2NBVB 2J7QB 2NPTB 2CU1A 1EF5A 3NY5A 2IBIB 4NAWB 4WJOA 5CHWA 2A5UA 4B9KA 1V2YA 2IO1B 2LGYA 3M3JA 4GOCA 4OVUA 1T0YA 2JPHA 5DPTA 1E90A 3ALBA 3APCA 2VRRB 1XD3B 2XK5A 3PT2B 3LDZE 2MQJA 4WJQA 2I1JA 5G55A 4PYZA 3RCZA 1E8WA 3M62B 3PRPB 4G50A 3SHQA 1WJ4A 2ZPYA 4GSWA 4IM2A 3BINA 2M0XA 5TR5A 4KDLB 5GMVA 3ECIA 3IVFA 2KOXA 2FCSA 1YX5B 2QHOA 4GN1A 4II3B 1E7VA 1YJ1A 2C5LC 4ANWA 2KFKB 3R7RA 2KVRA 2WX1A 3KUZA 4W9DA 2DZJA 2G45B 1M94A 1WF9A 2CS4A 1I42A 1UZXB 2J0KA 1UGMA 4WWOA 3EECA 1NBFC 3VAWA 2DYMA 3M63B 2NR2A 4KIKA 2DENB 3QARA 2K8HA 4MSMB 4NJ7A 2LVQA 1G6JA 1AARA 3H7SA 5JH5C 3R3MA 2N9XA 2WX0A 5G2NA 2RGFA 3PV1A 4KSLC 1C1YB 4ANUA 1V86A 2KZRA 1QZEA 4CYEA 1E5WA 2GBRA 2V3SA 1WXAA 4W9KA 3H6NA 2N9PC 2DX5B 4WWPA 2O6VB 3VH3B 3WA0A 2CHZA 3DPDA 4EZJA 3V61A 1V80A 1GC6A 1WGDA 1WJ6A 1YIWA 2KWVB 3ZNID 4HVBA 1WXVA 2L0FA 2OOBB 1NDDA 2B3AA 3V6CB 2FCQA 3TIXA 3APFA 4AUQC 4MGZE 5IA7A 2MW5A 4MM3A 2V4LA 4M8MA 3EC8A 4HCNB 4GIVA 4RMAA 1BT0A 3RZWC 2ASQA 4BOZB 3ML9A 3QX1A 3MJWA 4DK5A 5CHVC 2FCMA 2XEWA 2XK5B 1L2NA 5KHOA 4LDTD 1UELA 2MSED 3S2AA 2MCNB 5DPWA 4ANXA 4AJWA 4MSQB 4ANVA 4W9IA 4LDTB 3RD2A 3ZKJC 1A5RA 2RR9A 1GUAB 2ZEQA 3EHVA 5CX3A 3ZVVA 3N3KB 5D6JB 1SE9A 2LXCA 1OQYA 2UWQA 3TBLD 1ZGUB 3VHTC 5E6PA 4YL8A 5LLIA 4NJ6A 3UF8A 2JZZA 3JVZX 1V5TA 2MBBB 1WR6E 2IZVB 1P0RA 4KIKB 1TZ1A 5AZHA 2K25A 3KW5B 2ZCBA 5D94A 1WM3A 2EMSA 2GBNA 2ZVOA 1OGWA 4P7IA 3O65B 1LFDA 4PS8A 2CHXA 3UQBA 3BY4B 4HPLB 5AZFA 2BYVE 3VTWA 2FAZA 3HK0A 2JZ3B 4BBNF 3DOWA 1EUVB 3UIOB 3CMMB 2FNJB 3KYDD 2BKRB 2KN5A 2BPSA 4I6NB 2MBQA 2HTHA 4WQOB 2IO2B 3VTUA 3QQ8B 5C23A 3RULA 4KVGB 3B0AA 3KUCB 3H7PA 4I6PA 2DAFA 4GB9A 3ZNHB 3WAOA 1WY8A 4FJVB 2AL3A 2N7DA 3WIMA 3P2BA 4B6WA 1WXSA 4GDKA 4NNJB 3RYTA 1GJZA 1WE6A 4GU2A 4JL9A 3A4SC 2LXAA 2K6DB 2ZVNA 4HDOA 5CHFA 1P1AA 2BWES 1WXMA 4FHJA 2L05A 1WJNA 3V6EB 4AJYB 4MGYE 4W9JA 2GOWA 4DHJB 3W1SC 2LJ5A 2KANA 2C7HA 3VUXA 4OVVA 2KK8A 2W9NA 5J18A 2DYOA 1WRDB 4M8NA 3NS8A 2UYZB 1NI2A 2JXXA 4KSKC 3TL5A 3ZTCA 3U30A 4F7ZA 2KWCA 3PVLA 2GBKA 3L10B 2IO3B 3MHSD 2DZMA 2J0MA 4JQWC 2RD0A 4FA6A 3DVGX 4DBGA 1R4MI 2JWZA 2EMTA 3A9KA 3L13A 2AWTA 1WZ0A 3V62A 1V9JA 5J17A 3OJ3A 1LQBA 3AU5A 4BKSD 2N1VA 4HJKA 1XT9B 2LASA 2MWSB 2KQSA 4BBNC 4DDGD
chains in the Genus database with same CATH superfamily
3H7PB 3DCGA 1IP9A 1GC7A 2BYEA 4TQ1A 1Q5WB 2PVGC 3I63C 4RGMA 4C7ZA 3CF6E 2WXQA 1KRHA 4A3OA 1EF1A 2XN9C 3X23A 4WH4A 3IAM1 3DVNV 2LD9A 2KLCA 2O2VA 1C79A 2HD5B 3Q8EA 4E74A 2CJNA 4XE0A 4OW0A 1MPEA 3GS2A 1ZUD2 4CHKA 3SR6A 1U4AA 3VR8B 3VTVA 2NBUA 1PUTA 1ZE3D 4NAMA 2Z8LA 3H8HA 1EO6A 2L76A 1WR1A 3RMKC 3TEWA 3Q8BA 5JZEB 5L95C 3APDA 1WGGA 2QMTA 3AN1A 1ENFA 1D3ZA 2L8JA 1KLVA 4HWIB 3ZUNA 2AL6A 1OEYJ 3N30A 4OZBA 4OZAA 2KWDA 3QHTA 1WGHA 1E8YA 2DWQA 4B0EA 2ZZPB 2WGSA 2X38A 5MPOA 2IO0B 3T9LA 1OEYA 1KFYB 5HHDG 3IG3A 4C4VA 1JWMD 1A70A 3DQVA 2WXOA 3RUIB 4A90A 4HLEA 3W9CB 4F1SA 1SGHA 3QJZA 5C2TB 2B76B 3PZ8A 4KX6B 2KKCA 2C7NB 1V49A 2WNMA 2IYDB 3BVZA 4FN2A 3TEXA 1WGRA 1S3SG 3I57A 2G4DB 1VZ6A 4ZRIA 4YSXB 4OZCA 4WJNA 3ZLZA 4FJZA 3LXFA 3FAHA 1MHXA 2XBBC 2WXRA 3RZFA 1YN5A 2BKFA 3DBLI 3A9JA 3DVNU 4YXDB 5JXVA 2K9XA 3TMPB 2VH2A 4JLCA 4JIOU 4KGSA 2Y5CA 3RN9C 3SU8X 4TQ0A 2IY0B 1SSNA 4IWOA 3MC9A 1HZ6A 3Q3FA 1PGAA 4S0RA 2K1FA 1NI3A 3V60A 4H2AA 1K51A 2MX2A 1D4BA 4WIPA 1NYRA 3TCAA 2R2OA 4AOFA 4HROA 3KLSX 3VVWB 2N7JA 1WE7A 1R4NB 2E3TA 1TBEA 3EA6A 4M0WA 1SIJA 3C0RB 2MP2A 2JF5A 2REXA 2K6QA 1Q0WB 1XLQA 4B0MA 4FLHA 3P4SB 1QQRA 1IGDA 3KUDB 4BZAA 1UD7A 4RGNA 4BOSC 3MC0B 1JW9D 4W9LA 1D5XC 4US8A 2Y3AA 1J19A 3TEZA 1FNUA 4MEMA 2QSDA 1WX9A 4EE2A 3R8BA 2BF8B 3EFUA 1XF5L 2KDEB 1N60A 2JVCA 3JW0X 1ZKHA 1YD8U 3NHEB 3IHPC 5E6OA 2CKHB 4NQLB 3VUWA 2DAJA 4CO7A 3A4RA 4W9HA 1YNTE 1P3QU 5AEKB 4C7YA 5BYQA 5AZGA 3CWIA 2C60A 1WI0A 3DDCB 5I4DA 1KF6B 2WU5B 1QOGA 4PS7A 3VXWA 1XQQA 2M19A 4RGTA 3MHZA 5C3JB 2DNFA 2JXTA 2BQQA 3PLVA 2KJHB 3L0WB 2AX5A 3B1LX 2BS3B 3EGRA 5T8IA 2J42A 2CU1A 1EF5A 4B9KA 2G1EA 2LGYA 4GOCA 4OVUA 1T0YA 5DPTA 2VRRB 2XK5A 3PT2B 1IBXB 4RF1A 1E8WA 4GSWA 3BINA 2CU3A 5TR5A 5GMVA 4GN1A 1E7VA 2C5LC 3R7RA 2WX1A 1M94A 2CS4A 2J0KA 2J52A 2M56B 2DYMA 3M63B 2K8HA 1J7BA 2N9XA 4XGAB 5G2NA 2RGFA 3PV1A 3Q6BA 4ANUA 1UNSA 3Q2AC 2INNE 2RDBC 4WWPA 4B6WA 2O6VB 3AV8A 3V61A 1WJ6A 1WXVA 1NDDA 2WP9B 2H88B 2BB5A 3W5UB 2INCC 4RMAA 4A9AA 5CHVC 1TS5A 2FCMA 3FILA 1L2NA 1UELA 3S2AA 3NJTA 2MCNB 4AJWA 4ANVA 4LDTB 4AQ7A 2D3CA 1C76A 2WU2B 1SE9A 1NVID 1GOZA 4YL8A 2EKIA 3JVZX 3Q3MC 2MBBB 4KIKB 4HPPA 1DYQA 5AUIA 5D94A 1WM3A 1XO3A 4HPLB 1EU4A 3CMMB 2KN5A 2BB6A 4LTUA 4TMAB 1JMLA 3H7PA 4KGTA 1ZDVA 3WIMA 1P7EA 1GJZA 3VR9B 2K6DB 4L1BA 3PO0A 2K22A 2BWES 3HVDA 4AJYB 4DHJB 2KANA 1OQRA 3URYA 2WXFA 3NVZA 4OVVA 3SEBA 1WRDB 4M8NA 2UYZB 3BVGA 2VZKB 1N5XA 3PVLA 1J7CA 2DZMA 2J0MA 4JQWC 2QC8A 1TIFA 4MT5A 3MP9A 1WZ0A 3V62A 5J17A 3OJ3A 1ZOYB 2KQ4X 4BBNC 2LASA 2KQSA 5IN7A 2LHDA 2ZNVB 3AU4A 3B08A 1V6EA 1SB3C 3NS1A 1RLFA 4BKGA 4L23A 1MFWA 3ZDMC 3VFKA 4BKTA 1J8CA 2KDBA 3DBHI 3QWZB 1WFYA 2JUOA 1PQSA 2WLBA 4ZDVA 4XX5A 2M1MA 3DVGY 4O1NA 2MEKA 1E6EB 3ZXVA 5D3IB 5IKCM 2K0PA 2JT4B 3ABVB 3GE3C 4DXAB 4OHJA 3ZDTA 4W9FA 3ZNGC 4XC2A 3UQAA 1L6UA 3AEFB 4K81A 3P4PB 3H1UA 3ETRA 3N32A 2OJRA 1I4GA 1JCKB 4JX1C 4WQMA 2KAJA 1SJHD 2CHWA 4DDID 4XWWA 4DWFA 2KHWB 3PRZA 5D7GA 2KMCA 5HG2A 2D3AA 1DGJA 3X0WA 2WXHA 4IG7B 3OJ4B 4IWQA 3JYUA 2D3BA 5EE1A 1C4CA 2K39A 1FXIA 2L00B 3R7QA 2I38A 4TUUA 1CZPA 4W9EA 1WIAA 2LRWA 1PGXA 1ESFA 4ZRJA 3U8ZA 3AULA 1WH3A 4HRSA 3D32A 3EFCA 3QK0A 2W3SA 1JRUA 3BIID 5FK9C 4A55A 1T6BX 3A1QB 3BWUD 4RH6A 3P42A 4GDLB 2BS2B 4EZKA 1R4MB 1V1OA 4M02A 4YTPB 3DBRI 5H8YE 1V8CA 1EU3A 2LJIA 2IY1B 3VH4B 2IGHA 1V97A 3QA8A 1WXQA 3KVFB 2L83A 4N6EB 1MG4A 3U7DA 2OEDA 1I4HA 5EE9A 4G3XB 2KLGA 4MH0E 5BMGA 1YJJA 1UH6A 4JPSA 1FNWA 3BK2A 2PW9A 4A8XC 4EZLA 2FBWB 1FFVA 1JRPA 3MTNB 5CTRC 2WDTB 2GMIC 4KZCA 1OFFA 3R66C 1HXYD 2LZ6A 1SIFA 2ZCCA 2G3QB 3H9DA 3PRMB 2RSUA 2NCNA 1XCQL 1FEHA 1E7UA 3AE6B 4XDCA 1WYWB 4LNOA 2HE7A 4WWNA 1X1MA 2V1YA 1CK1A 2AEHA 2L7RA 3HRDD 2L0TA 2AYOB 2O6VD 3IBEA 1WMHB 4F8CB 1UBQA 2WHIA 3AE5B 2OHFA 1WWTA 1OQQA 4US9A 1E8XA 2EKEC 3L16A 1KOTA 5AUKA 4HXDA 3Q69A 4XYCA 1T5XD 1UF0A 1L4ZB 3KH0A 2JX5A 4NZLB 3JSVB 4WJPA 4B95A 4GMVA 2QCZA 3GZNB 1KTKA 2GBMA 3EUB2 1PDXA 5G5HA 1L0YB 2KFJA 4IW0A 4AP4C 3ZGZA 2FCNA 4FJYA 1Y56A 4ZYSA 2FUHB 1L4DB 1HZ5A 4WAAA 1C4PA 3B9JA 3NZSA 4BFRA 1IBXA 2LVOA 2D07B 2PTLA 2AQ2B 1DOYA 1SEBD 3PSEB 2JRHA 2WXGA 4ARCA 1S1QB 3HIZA 2N9EB 5L83A 4EFOA 2J53A 3PHWB 2BYFA 4MELA 3AH7A 2PJHA 3AE8B 1IPGA 2BWFA 1L5PA 2KX0A 4DHJD 1V81A 1L7YA 4JWUC 1N63A 2O6VA 4IWPA 2V0GA 2WWZA 2NBVB 2KACA 3BZDB 4NAWB 2IBIB 2VZKD 4RCOA 4RFBA 1XD3B 5G55A 2LGSA 3Q8AA 3PRPB 1WJ4A 3N1YC 1PYWD 4FXCA 1VDVA 4KDLB 3IVFA 1UGJA 2FCSA 1YX5B 2QHOA 1YJ1A 2BYTA 2KFKB 2Q5WD 4ARIA 1I42A 4YWGG 5IO9A 3RFZB 2NR2A 4KIKA 5G5GA 3N20C 1TS2A 2NTSA 3R3MA 2WX0A 2KZRA 1QZEA 4CYEA 1E5WA 2GBRA 2V3SA 4W9KA 1D6EC 1YQ3B 1V80A 1ACCA 3ZNID 4HVBA 2OOBB 3V6CB 2FCQA 4MGZE 4GIVA 3FKYA 2MSED 3AEBB 2IJ0A 1HEZE 1UWMA 3AEEB 3L4PA 3RD2A 3ZKJC 1GUAB 4M00A 2WXJA 4C80A 2LXCA 1OQYA 2UWQA 2AQ1B 3VHTC 5E6PA 5HI1A 5IOIA 4DXGA 5BYSA 1P0RA 3I9V1 5AZHA 3AB5A 1OGWA 4P7IA 1LFDA 4PS8A 2CHXA 2BYVE 2V4IB 5BMHA 1MI0A 2FNJB 2WS3B 2MBQA 2HTHA 2JZPA 4WQOB 2IO2B 3VTUA 1I7HA 1TY0A 4MM3B 1F77A 4ZRPA 3RULA 4KVGB 3KUCB 2LEKA 2DAFA 3HVZA 3ZNHB 3WAOA 1PGBA 3TUOA 2N7DA 3RNAC 3P2BA 1WXSA 2BBCA 1WRIA 4GU2A 3ZJTA 4JL9A 3A4SC 2LXAA 1VRAB 2JSVX 3IAS1 5CHFA 4FHJA 2L05A 2WDRB 3W1SC 1PFDA 1XLPA 1FIQA 2BT6A 2LMCA 1SXTA 4S17A 2W9NA 4P1BC 2ACZB 4R3DA 4KSKC 4F7ZA 3U30A 3MHSD 1XLNA 5FKAC 1AW7A 1MVKA 2EMTA 2AWTA 1V9JA 3NRZA 1LQBA 1AWDA 1EWCA 4BKSD 1C78A 3N1ZC 1SF0A 3HM3A 4AS1A 3MFGA 3RT3B 4DXFA 2KC2A 2DHZA 3O13A 4LNNA 1IUEA 1STEA 4HJGE 1V5OA 2KJ6A 1JWUD 5FR6A 5C1ZA 2WXPA 4DHZB 2DBYA 1QF6A 3PTFC 4EKUA 1KLUD 5TSSA 1E7PB 3WANA 1MG8A 1FRRA 4HDQA 3ONSA 3E56A 4MH8A 3N9YC 2ZW0A 2KDIA 1IYFA 2N7EA 1NEKB 2KD0A 4MACA 1J0GA 4RM8A 2HJ1A 1QOBA 4REZA 1I4RA 3A1QA 3T3NA 5EE0A 3PGEA 4KGRA 4MDKE 4A6QA 4GDLA 4LJPB 1BMLC 5JHBA 3GP7A 3PREA 2HDEA 5IAAC 2GB1A 3ZO5B 3UI3A 1ZP0B 3FC4A 2ON8A 1R4NI 3WAMA 1VZ7A 2NBWB 2YEPB 2L32A 1GG3A 1B1ZA 2KXJA 4YSZB 3HHMA 4W9CA 2IGGA 3L54A 3QC8B 1B9RA 1XEEA 4ZOHC 1BXTA 1GNUA 4G0NB 2NPTA 4M01A 4J6IA 1JROA 1ZDXA 3AMZA 3AM9A 4BKSA 3OAWA 4K1RB 2Z0EB 2PIAA 3AI5A 4HPMB 1RRBA 2KYWA 3IFWB 4HK2A 2QILA 4CQNA 3AE1B 5DCNA 3T8MA 1TJEA 2LGDA 3BVMA 4WWMA 2NTTA 3I3TB 2N1WA 1DOIA 3P63A 2V3NA 2Y5PA 2FE8A 2UU7A 3BK1A 3GE8C 4KZ0A 2N4FA 1JWAD 4TKNA 3V05A 4IM0A 2KO3A 1WMHA 1QOAA 4GGQA 3QAQA 2NVUI 3U4EG 4NPNA 2JQRB 3L08A 4FULA 2K8BA 4LNKA 3UINB 1TT5B 1WX8A 4MGIE 2SEBD 3K9OB 4PYUA 2GBJA 3CIRB 3WALA 1YQBA 3JSVA 4RM9A 2SAKA 4LJOB 2KX3A 2LVPA 3HM6X 2YLMA 4MGKE 2LHEA 2MJEA 2MLBA 3OWEB 1RM6C 5LXIB 2FIFA 4J3OD 5D3DA 1RYJA 2ZJDA 4PS3A 1OTRB 1I35A 2LUMA 1HTOA 2MA9B 1YX6B 1P98A 3ZNZB 4IM3A 1KH0A 2WXLA 2KMAA 3VRAB 1R7SA 3LYYA 3CSFA 3AXCA 1MHHE 3LJ3A 5BO4B 4TV3A 3I5JC 4RGOS 5EE3A 5D2MB 2BTEA 1LO5D 2K8CA 2LGIA 2C9WB 4XZ4A 3PHXB 4RF0A 2M8SA 1I4QA 4DQOC 5KHQA 2KJRA 1KJTA 4URKA 4KKIA 2FIDA 1HA5A 2KTRB 3PS6A 1C9FA 1E0ZA 1IGCA 3VDZA 4MJSB 1FD6A 1UBIA 4JWSC 2W55A 3NVVA 3VUYA 2IPKD 1Y8RC 1P7FA 3NVWA 2KQ7A 3VQIA 2C7MB 2L3ZA 4NAWA 2INDC 4UDUC 5HFYA 2V3PA 4YTNB 3ZQ4A 4YT0B 2RPVA 2KVZA 2DYBA 2KC1A 1LXDA 3CSTA 4RNAA 5J2RA 4EUTA 2D10A 2A4ZA 3KYCD 2KFKA 1D5MC 2RPQA 3DBLB 4EEWA 3V3XA 1Z2MA 2MJDA 3Q8FA 4ICVA 4K7SA 1TS4A 3W5VB 2QDFA 3UIPB 1RAXA 3AE9B 4HEA1 4LCDE 4ZHPA 2BS4B 1T3QA 4IUMB 1WZ3A 1AN8A 2M17A 2J7QB 2NPTB 3AE3B 3NY5A 5CHWA 1V2YA 2JWUA 1LGRA 2IO1B 1TY2A 1F0ZA 1MJDA 1E90A 5BYRA 4USAA 3APCA 3AE2B 3Q14C 3LDZE 2MQJA 1N6ZA 4PYZA 3ZYYX 4G50A 2ZPYA 4IM2A 3NZ3A 3AEDB 1QOFA 4BAXA 3ECIA 1FCLA 4ANWA 2W82A 2KVRA 3KUZA 4W9DA 4WWOA 1UGMA 3EECA 1NBFC 2TSSA 2PMVA 1L0VB 3RPFC 4MSMB 3H7SA 4P1CC 5JH5C 2DLBA 4KSLC 4P6VF 1V86A 1QT9A 3VH3B 3H6NA 2CHZA 1GC6A 1WGDA 1YIWA 2PLPA 1QILA 2B3AA 4AUQC 2RDHA 3TIXA 2MW5A 4MM3A 1NENB 3RZWC 1BT0A 1AYFA 4BOZB 1E9MA 3MJWA 4DK5A 5KHOA 3IT4B 4LDTD 1JQ4A 5DPWA 3AECB 4MSQB 2RR9A 2W3RA 2ZEQA 1EM7A 5CX3A 3ZVVA 4JE3B 3TBLD 1ZGUB 2JZZA 1V5TA 3R2IA 1WR6E 2IZVB 1D5ZC 2ZW1A 3DHGC 2K25A 1ZPSA 2ZCBA 4WURA 1EWYC 2EMSA 2GBNA 1UWXA 1FNVA 1GB1A 3UQBA 5AZFA 1NYQA 2FAZA 3HK0A 5LNK1 1EUVB 2RDGA 4I6NB 1WSPA 4C56C 3QQ8B 1VZ8A 3U2SC 5E6JA 4GB9A 1GAQB 1WY8A 1L6VA 1SBBB 2LFIA 1KLGD 4PT5A 4NNJB 3RYTA 1WE6A 2HTME 2ZVNA 1P1AA 1WXMA 4HKZE 1WJNA 2J4XA 4MGYE 4W9JA 2ICIA 1SJED 2WDQB 2LJ5A 1K50A 1QKZA 2KK8A 3BYYB 3NS8A 1NI2A 3ZTCA 3L10B 1R4MI 3L13A 1YOVB 3RI7C 1F52A 3NVYA 4ZHOA 4HJKA 2MWSB 2ONQA 1WGYA 1F9JA 4ZRQA 1L0XB 4FBJB 1J7AA 4A20A 4GDKB 3ZW3A 3DWGC 1VD2A 3TEYA 2LI5A 3VRBB 3KWVA 1HQRD 4N59A 2D3GA 1V1PB 4XDDA 2ZNVC 3NG0A 3DHIC 2YEPF 2XNAC 2MJ3A 2MRPA 3NOBA 3B2FA 1P9DU 4TSSA 4JGHB 2VH1A 2KTFA 5IP4D 3A9KB 1FMAD 1FXTB 4N9F4 1VLBA 1E8ZA 1RFKA 4II2B 1TZOA 2CJOA 3ZRCA 3P4RB 1FXAA 1KM7A 2KWUB 4E71A 2WYQA 1I4XA 1FCCC 4P16A 1CMXB 3M95A 3NZUA 1Q10A 1SE3A 1LM8B 4LLGM 3AEGB 1TKEA 3DHHC 1Z5SB 2K3UA 2CR5A 2O2VB 3IT6B 3B2GA 5H92C 3RNGC 3LB8C 3A33B 3RNCC 4GLSC 4IC7B 1WM2A 4K3CA 4DHZE 1T0SC 3GZNI 2D2QA 4AWJA 3WAPA 1GPXA 3QCAA 1FM0D 2MHJA 2PEAA 1K53A 4D2KA 1TS3A 1SE4A 4OVZA 3W2DA 2I2YA 2Y5BB 4FADA 2R2QA 2HJ8A 2RMMA 1CQVA 3PPAA 1ZXHA 1FPYA 3W1YA 2WDVB 5DPRA 4LNIA 3J9CA 3DBHB 1TKYA 2NMQA 1C4AA 4I6LB 4XWTA 3IXSA 1TYGB 4C4VB 2LRUA 3UGBB 2PE9A 2R61A 4K7WA 5EDSA 1WX7A 4KDIC 4KKJA 4BVUC 2DZKA 2Z0DB 5LXHA 2D11A 1F2RI 2G4SA 2L1AA 2PPHA 2D5GA 2KTRA 1ZXIA 4K3BA 2M4NA 1FRDA 1YMHE 4MJSA 1XLOA 3L17A 2MH7A 1M4VA 4NQKE 2JRIB 1N61A 3C19A 4HCPB 1VCBA 3ML8A 4FHKA 3DBSA 2BGFA 3ENEA 5DPSA 4EOYA 5FR3A 2KN4A 3TJPA 1I4PA 3Q3NC 2JY6A 1FO4A 1FFUA 4YTMB 1RWSA 2WXIA 3KWLA 2MBHA 1Q1OA 3Q8CA 1H8CA 1E10A 5JHAA 1HE8A 4KV2A 2PE6B 1TTNA 3GOEA 5BMIA 3W1SA 3PZ7A 4L2YA 2LGXA 3A9JB 1H4RA 4W9GA 3SD5A 2GRIA 1RFAA 3RNBC 2MBEA 3ZTDA 3OLMD 2DZIA 4G11A 3Q3JA 4NY0A 3PZDA 2M0AA 3DBRB 5E6NA 4K7UA 4NJCA 1ZW7A 2KDFB 2I1KA 1CJEA 1QLBB 4ZYNA 2LUEA 2KNBA 4GXBA 1TGZB 3R2TA 3SDLC 5HKHA 4ZRKA 2QEJC 3QIJA 2ZPNA 4M0WB 1K8RB 1XCTL 2KT7A 2KMMA 2MP2B 2N9KA 2LWPA 4YSYB 3ZRFA 2WXNA 1C3TA 5GXGB 4ASWC 4IDIA 1GB4A 4ICUA 1WJUA 4E3CA 2EELA 4A3PA 3K9PB 2NS5A 3HUIA 3PLUA 3C8YA 3P1MA 3P4QB 4ACFA 2Z59B 2H89B 2YVCA 2J0JA 2JYEA 2K5PA 4X57B 2MBOA 3ZIMA 3Q3OC 1ISNA 3ZXRA 4PK1A 4WJOA 4ITKA 1ET9A 2A5UA 1F2RC 3N1XC 1VJKA 3M3JA 2JPHA 3ALBA 3ZJVA 3OG5A 4WJQA 2I1JA 1WYGA 3MC8A 3RCZA 3M62B 3SHQA 1ROEA 2IGDA 2M0XA 2PVOD 1JWBD 2KOXA 4II3B 2QIEB 2DZJA 2G45B 1WF9A 1DOXA 1T0RC 1BUIC 1UZXB 3VAWA 4C00A 2DENB 2INPE 3QARA 1YJIA 1HTQA 4NJ7A 2LVQA 1G6JA 1AARA 2QJLA 3WCQA 2W54A 1TKGA 1YN4A 1N5WA 2N0SB 1C1YB 1WXAA 3SFEB 2N9PC 2DX5B 3WA0A 3DPDA 4EZJA 3T3OA 4N58A 2KWVB 1VR9A 2L0FA 3APFA 2G9HD 2PKOA 5IA7A 2V4LA 4M8MA 3EC8A 4HCNB 2N9LA 2ASQA 2BVCA 3ML9A 3QX1A 4Q2JA 2XEWA 2XK5B 2IDYA 3NUHB 4ANXA 2KDMA 4W9IA 1A5RA 3AEAB 3EHVA 3N3KB 5D6JB 3BYTB 1YN3A 1SE2A 2V9HA 5LLIA 4HKQA 4NJ6A 3UF8A 1TZ1A 3E9SA 4LK0M 3KW5B 1WGKA 3RNEC 2ZVOA 1UUPA 3O65B 1N62A 4LNFA 3BY4B 3MJ5A 3VTWA 4BBNF 2JZ3B 3DOWA 2X8XX 3UIOB 3KYDD 2BKRB 3AE4B 2BPSA 2E6XA 3RNFC 4WAFA 5C23A 3GB1A 1K52A 4QAYA 3B0AA 4I6PA 3FILB 4FJVB 2GLSA 2AL3A 1JWSD 2GI9A 4GDKA 1YQ4B 1F1HA 1JALA 2AQ3B 4HDOA 1ET6A 3V6EB 2WXKA 2FUG1 2GOWA 3TSSA 3AE7B 2OJWA 1V1PA 1T0QC 2JYTA 3DWMA 2C7HA 3VUXA 2WQYB 3U52E 5J18A 2DYOA 2JXXA 3TL5A 1C77A 2WXMA 2KWCA 2L52A 2GBKA 2BW2A 2IO3B 2JU6X 2RD0A 4FA6A 3KQ4A 3DVGX 1XXGA 4DBGA 2JWZA 3A9KA 4IOIE 3U7ZA 3SFDB 3AU5A 3ZJUA 4IKGA 2N1VA 1XT9B 4DDGD
chains in the Genus database with same CATH topology
2ZNVB 1WGYA 3AU4A 1F9JA 3B08A 3DCGA 1V6EA 3H7PB 3HM3A 1IP9A 1GC7A 3RT3B 2BYEA 4TQ1A 1Q5WB 4FBJB 2KC2A 1RLFA 4BKGA 2DHZA 3ZDMC 1V5OA 2KJ6A 3CF6E 3VFKA 4A20A 4GDKB 3ZW3A 4BKTA 1J8CA 2KDBA 5FR6A 5C1ZA 3DBHI 3QWZB 4DHZB 1VD2A 1WFYA 2JUOA 1PQSA 4ZDVA 4A3OA 3PTFC 4XX5A 2M1MA 3DVGY 4EKUA 2LI5A 1EF1A 3X23A 3WANA 1MG8A 4HDQA 2D3GA 3ONSA 3DVNV 2LD9A 2ZNVC 2KLCA 2O2VA 2JT4B 2HD5B 4E74A 4DXAB 2KDIA 2MRPA 1IYFA 2N7EA 3ZDTA 4W9FA 2KD0A 3NOBA 1J0GA 3ZNGC 1P9DU 4RM8A 4XC2A 4JGHB 4CHKA 1U4AA 3UQAA 2KTFA 3A1QA 3PGEA 3VTVA 3A9KB 2NBUA 4MDKE 4K81A 1FXTB 4GDLA 4N9F4 3H1UA 4LJPB 1E8ZA 1EO6A 4II2B 2L76A 1WR1A 5JHBA 3N32A 5JZEB 3ZRCA 5L95C 2OJRA 3APDA 1WGGA 3PREA 5IAAC 1KM7A 2KWUB 1D3ZA 4E71A 2L8JA 3ZO5B 1KLVA 2CHWA 4HWIB 3ZUNA 4DDID 2AL6A 1OEYJ 2WYQA 3N30A 4DWFA 2KHWB 3PRZA 5D7GA 2KMCA 3QHTA 3X0WA 1R4NI 3WAMA 1WGHA 4IG7B 3OJ4B 1E8YA 1CMXB 2NBWB 3M95A 2ZZPB 3NZUA 1GG3A 4IWQA 2IO0B 2KXJA 3JYUA 1LM8B 3T9LA 1OEYA 3HHMA 2K39A 4W9CA 3L54A 3QC8B 2L00B 3R7QA 3IG3A 1Z5SB 4TUUA 2CR5A 2O2VB 4W9EA 1WIAA 1GNUA 2LRWA 2NPTA 4G0NB 4ZRJA 3U8ZA 4J6IA 3DQVA 3AULA 1WH3A 3RUIB 4BKSA 3OAWA 3D32A 3A33B 3QK0A 4HLEA 1JRUA 2Z0EB 4K1RB 4IC7B 1WM2A 3A1QB 4DHZE 3AI5A 4F1SA 1SGHA 3QJZA 3GZNI 2D2QA 4GDLB 4HPMB 4AWJA 3WAPA 4EZKA 1RRBA 3QCAA 3IFWB 3DBRI 4HK2A 2PEAA 2KKCA 2C7NB 1V49A 2Y5BB 5DCNA 4FADA 3T8MA 2IY1B 2IYDB 4FN2A 2LGDA 2R2QA 1WGRA 1S3SG 2HJ8A 3VH4B 3QA8A 2G4DB 3I3TB 3PPAA 4ZRIA 2N1WA 4WJNA 3KVFB 3W1YA 3U7DA 5DPRA 3ZLZA 4TKNA 4KZ0A 2N4FA 4FJZA 4G3XB 2KLGA 4IM0A 2KO3A 1WMHA 4MH0E 4I6LB 2XBBC 1UH6A 4GGQA 3QAQA 2NVUI 2LRUA 3RZFA 4NPNA 3L08A 4FULA 2K8BA 2PE9A 3UGBB 4EZLA 4K7WA 5EDSA 3UINB 1WX7A 2BKFA 4KDIC 4BVUC 2DZKA 1WX8A 2Z0DB 3DBLI 4MGIE 3A9JA 5LXHA 2D11A 3DVNU 2G4SA 3MTNB 2PPHA 3TMPB 3K9OB 5CTRC 2WDTB 4PYUA 2GMIC 4KZCA 2GBJA 4JLCA 4JIOU 4TQ0A 3R66C 3SU8X 2KTRA 1YQBA 2LZ6A 2IY0B 3JSVA 3WALA 2M4NA 4IWOA 4RM9A 3Q3FA 4LJOB 2K1FA 1SIFA 2KX3A 4MJSA 2ZCCA 2G3QB 3V60A 2LVPA 3H9DA 2YLMA 3HM6X 3L17A 3PRMB 4MGKE 2MLBA 2RSUA 2NCNA 4NQKE 2MX2A 2JRIB 5LXIB 2FIFA 4HCPB 1VCBA 1E7UA 3ML8A 2ZJDA 4FHKA 3DBSA 4PS3A 2BGFA 3ENEA 5DPSA 1WYWB 1OTRB 3TCAA 2HE7A 2R2OA 4AOFA 4EOYA 1I35A 3VVWB 4WWNA 2MA9B 1X1MA 1P98A 1YX6B 2V1YA 3TJPA 3ZNZB 1WE7A 2JY6A 4IM3A 2AEHA 1TBEA 2L7RA 2KMAA 2L0TA 2AYOB 2O6VD 3IBEA 1WMHB 4F8CB 3CSFA 3AXCA 1UBQA 2MBHA 1Q1OA 3LJ3A 5BO4B 4TV3A 1H8CA 5JHAA 3C0RB 1HE8A 5D2MB 4KV2A 1E8XA 2PE6B 2MP2A 2JF5A 1TTNA 3GOEA 2EKEC 2REXA 2K8CA 3L16A 1KOTA 2K6QA 2C9WB 1Q0WB 4XZ4A 3PHXB 4HXDA 4FLHA 3W1SA 2LGXA 3A9JB 3KUDB 2M8SA 1UD7A 1H4RA 3KH0A 4W9GA 5KHQA 2KJRA 4BOSC 3SD5A 1KJTA 1RFAA 4URKA 2FIDA 2KTRB 3PS6A 4W9LA 3JSVB 4WJPA 4B95A 4GMVA 2MBEA 3ZTDA 3OLMD 3VDZA 4MJSB 2DZIA 4G11A 3Q3JA 4NY0A 3PZDA 2GBMA 1UBIA 1J19A 3VUYA 5E6NA 4K7UA 2KFJA 1Y8RC 1ZW7A 2I1KA 2KDFB 1WX9A 4IW0A 4MEMA 4AP4C 2FCNA 2BF8B 4ZYNA 2KQ7A 3VQIA 2C7MB 2LUEA 2KNBA 4FJYA 4GXBA 1TGZB 3EFUA 2KDEB 3SDLC 5HKHA 2L3ZA 4NAWA 2FUHB 2JVCA 4ZRKA 3JW0X 4WAAA 3QIJA 1ZKHA 2ZPNA 1YD8U 3NHEB 4M0WB 3NZSA 2DYBA 2KC1A 3IHPC 1K8RB 4BFRA 5E6OA 2CKHB 2LVOA 4NQLB 2DAJA 2D07B 3VUWA 4CO7A 1LXDA 3CSTA 5J2RA 3A4RA 2MP2B 4W9HA 4EUTA 2D10A 2LWPA 1P3QU 5AEKB 3ZRFA 2A4ZA 5AZGA 2C60A 1C3TA 3KYCD 2KFKA 1WI0A 4ASWC 3DDCB 4ICUA 1WJUA 3PSEB 2RPQA 4E3CA 4EEWA 2JRHA 1Z2MA 4ICVA 4A3PA 4K7SA 3K9PB 1S1QB 2NS5A 3HIZA 2N9EB 5L83A 4EFOA 3PHWB 3PLUA 4PS7A 1XQQA 2BYFA 3VXWA 4MELA 2PJHA 1IPGA 3UIPB 2BWFA 1RAXA 2Z59B 2KX0A 2YVCA 2J0JA 3PLVA 4DHJD 4X57B 2KJHB 1V81A 1L7YA 2O6VA 2MBOA 3B1LX 3L0WB 4IWPA 4LCDE 4IUMB 1WZ3A 3ZIMA 1ISNA 2M17A 2WWZA 2NBVB 2J7QB 2NPTB 2CU1A 1EF5A 3NY5A 2IBIB 4NAWB 4WJOA 5CHWA 2A5UA 4B9KA 1V2YA 2IO1B 2LGYA 3M3JA 4GOCA 4OVUA 1T0YA 2JPHA 5DPTA 1E90A 3ALBA 3APCA 2VRRB 1XD3B 2XK5A 3PT2B 3LDZE 2MQJA 4WJQA 2I1JA 5G55A 4PYZA 3RCZA 1E8WA 3M62B 3PRPB 4G50A 3SHQA 1WJ4A 2ZPYA 4GSWA 4IM2A 3BINA 2M0XA 5TR5A 4KDLB 5GMVA 3ECIA 3IVFA 2KOXA 2FCSA 1YX5B 2QHOA 4GN1A 4II3B 1E7VA 1YJ1A 2C5LC 4ANWA 2KFKB 3R7RA 2KVRA 2WX1A 3KUZA 4W9DA 2DZJA 2G45B 1M94A 1WF9A 2CS4A 1I42A 1UZXB 2J0KA 1UGMA 4WWOA 3EECA 1NBFC 3VAWA 2DYMA 3M63B 2NR2A 4KIKA 2DENB 3QARA 2K8HA 4MSMB 4NJ7A 2LVQA 1G6JA 1AARA 3H7SA 5JH5C 3R3MA 2N9XA 2WX0A 5G2NA 2RGFA 3PV1A 4KSLC 1C1YB 4ANUA 1V86A 2KZRA 1QZEA 4CYEA 1E5WA 2GBRA 2V3SA 1WXAA 4W9KA 3H6NA 2N9PC 2DX5B 4WWPA 2O6VB 3VH3B 3WA0A 2CHZA 3DPDA 4EZJA 3V61A 1V80A 1GC6A 1WGDA 1WJ6A 1YIWA 2KWVB 3ZNID 4HVBA 1WXVA 2L0FA 2OOBB 1NDDA 2B3AA 3V6CB 2FCQA 3TIXA 3APFA 4AUQC 4MGZE 5IA7A 2MW5A 4MM3A 2V4LA 4M8MA 3EC8A 4HCNB 4GIVA 4RMAA 1BT0A 3RZWC 2ASQA 4BOZB 3ML9A 3QX1A 3MJWA 4DK5A 5CHVC 2FCMA 2XEWA 2XK5B 1L2NA 5KHOA 4LDTD 1UELA 2MSED 3S2AA 2MCNB 5DPWA 4ANXA 4AJWA 4MSQB 4ANVA 4W9IA 4LDTB 3RD2A 3ZKJC 1A5RA 2RR9A 1GUAB 2ZEQA 3EHVA 5CX3A 3ZVVA 3N3KB 5D6JB 1SE9A 2LXCA 1OQYA 2UWQA 3TBLD 1ZGUB 3VHTC 5E6PA 4YL8A 5LLIA 4NJ6A 3UF8A 2JZZA 3JVZX 1V5TA 2MBBB 1WR6E 2IZVB 1P0RA 4KIKB 1TZ1A 5AZHA 2K25A 3KW5B 2ZCBA 5D94A 1WM3A 2EMSA 2GBNA 2ZVOA 1OGWA 4P7IA 3O65B 1LFDA 4PS8A 2CHXA 3UQBA 3BY4B 4HPLB 5AZFA 2BYVE 3VTWA 2FAZA 3HK0A 2JZ3B 4BBNF 3DOWA 1EUVB 3UIOB 3CMMB 2FNJB 3KYDD 2BKRB 2KN5A 2BPSA 4I6NB 2MBQA 2HTHA 4WQOB 2IO2B 3VTUA 3QQ8B 5C23A 3RULA 4KVGB 3B0AA 3KUCB 3H7PA 4I6PA 2DAFA 4GB9A 3ZNHB 3WAOA 1WY8A 4FJVB 2AL3A 2N7DA 3WIMA 3P2BA 4B6WA 1WXSA 4GDKA 4NNJB 3RYTA 1GJZA 1WE6A 4GU2A 4JL9A 3A4SC 2LXAA 2K6DB 2ZVNA 4HDOA 5CHFA 1P1AA 2BWES 1WXMA 4FHJA 2L05A 1WJNA 3V6EB 4AJYB 4MGYE 4W9JA 2GOWA 4DHJB 3W1SC 2LJ5A 2KANA 2C7HA 3VUXA 4OVVA 2KK8A 2W9NA 5J18A 2DYOA 1WRDB 4M8NA 3NS8A 2UYZB 1NI2A 2JXXA 4KSKC 3TL5A 3ZTCA 3U30A 4F7ZA 2KWCA 3PVLA 2GBKA 3L10B 2IO3B 3MHSD 2DZMA 2J0MA 4JQWC 2RD0A 4FA6A 3DVGX 4DBGA 1R4MI 2JWZA 2EMTA 3A9KA 3L13A 2AWTA 1WZ0A 3V62A 1V9JA 5J17A 3OJ3A 1LQBA 3AU5A 4BKSD 2N1VA 4HJKA 1XT9B 2LASA 2MWSB 2KQSA 4BBNC 4DDGD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZNV B;  1WGY A;  3AU4 A;  1F9J A;  3B08 A;  3DCG A;  1V6E A;  3H7P B;  3HM3 A;  1IP9 A;  1GC7 A;  3RT3 B;  2BYE A;  4TQ1 A;  1Q5W B;  4FBJ B;  2KC2 A;  1RLF A;  4BKG A;  2DHZ A;  3ZDM C;  1V5O A;  2KJ6 A;  3CF6 E;  3VFK A;  4A20 A;  4GDK B;  3ZW3 A;  4BKT A;  1J8C A;  2KDB A;  5FR6 A;  5C1Z A;  3DBH I;  3QWZ B;  4DHZ B;  1VD2 A;  1WFY A;  2JUO A;  1PQS A;  4ZDV A;  4A3O A;  3PTF C;  4XX5 A;  2M1M A;  3DVG Y;  4EKU A;  2LI5 A;  1EF1 A;  3X23 A;  3WAN A;  1MG8 A;  4HDQ A;  2D3G A;  3ONS A;  3DVN V;  2LD9 A;  2ZNV C;  2KLC A;  2O2V A;  2JT4 B;  2HD5 B;  4E74 A;  4DXA B;  2KDI A;  2MRP A;  1IYF A;  2N7E A;  3ZDT A;  4W9F A;  2KD0 A;  3NOB A;  1J0G A;  3ZNG C;  1P9D U;  4RM8 A;  4XC2 A;  4JGH B;  4CHK A;  1U4A A;  3UQA A;  2KTF A;  3A1Q A;  3PGE A;  3VTV A;  3A9K B;  2NBU A;  4MDK E;  4K81 A;  1FXT B;  4GDL A;  4N9F 4;  3H1U A;  4LJP B;  1E8Z A;  1EO6 A;  4II2 B;  2L76 A;  1WR1 A;  5JHB A;  3N32 A;  5JZE B;  3ZRC A;  5L95 C;  2OJR A;  3APD A;  1WGG A;  3PRE A;  5IAA C;  1KM7 A;  2KWU B;  1D3Z A;  4E71 A;  2L8J A;  3ZO5 B;  1KLV A;  2CHW A;  4HWI B;  3ZUN A;  4DDI D;  2AL6 A;  1OEY J;  2WYQ A;  3N30 A;  4DWF A;  2KHW B;  3PRZ A;  5D7G A;  2KMC A;  3QHT A;  3X0W A;  1R4N I;  3WAM A;  1WGH A;  4IG7 B;  3OJ4 B;  1E8Y A;  1CMX B;  2NBW B;  3M95 A;  2ZZP B;  3NZU A;  1GG3 A;  4IWQ A;  2IO0 B;  2KXJ A;  3JYU A;  1LM8 B;  3T9L A;  1OEY A;  3HHM A;  2K39 A;  4W9C A;  3L54 A;  3QC8 B;  2L00 B;  3R7Q A;  3IG3 A;  1Z5S B;  4TUU A;  2CR5 A;  2O2V B;  4W9E A;  1WIA A;  1GNU A;  2LRW A;  2NPT A;  4G0N B;  4ZRJ A;  3U8Z A;  4J6I A;  3DQV A;  3AUL A;  1WH3 A;  3RUI B;  4BKS A;  3OAW A;  3D32 A;  3A33 B;  3QK0 A;  4HLE A;  1JRU A;  2Z0E B;  4K1R B;  4IC7 B;  1WM2 A;  3A1Q B;  4DHZ E;  3AI5 A;  4F1S A;  1SGH A;  3QJZ A;  3GZN I;  2D2Q A;  4GDL B;  4HPM B;  4AWJ A;  3WAP A;  4EZK A;  1RRB A;  3QCA A;  3IFW B;  3DBR I;  4HK2 A;  2PEA A;  2KKC A;  2C7N B;  1V49 A;  2Y5B B;  5DCN A;  4FAD A;  3T8M A;  2IY1 B;  2IYD B;  4FN2 A;  2LGD A;  2R2Q A;  1WGR A;  1S3S G;  2HJ8 A;  3VH4 B;  3QA8 A;  2G4D B;  3I3T B;  3PPA A;  4ZRI A;  2N1W A;  4WJN A;  3KVF B;  3W1Y A;  3U7D A;  5DPR A;  3ZLZ A;  4TKN A;  4KZ0 A;  2N4F A;  4FJZ A;  4G3X B;  2KLG A;  4IM0 A;  2KO3 A;  1WMH A;  4MH0 E;  4I6L B;  2XBB C;  1UH6 A;  4GGQ A;  3QAQ A;  2NVU I;  2LRU A;  3RZF A;  4NPN A;  3L08 A;  4FUL A;  2K8B A;  2PE9 A;  3UGB B;  4EZL A;  4K7W A;  5EDS A;  3UIN B;  1WX7 A;  2BKF A;  4KDI C;  4BVU C;  2DZK A;  1WX8 A;  2Z0D B;  3DBL I;  4MGI E;  3A9J A;  5LXH A;  2D11 A;  3DVN U;  2G4S A;  3MTN B;  2PPH A;  3TMP B;  3K9O B;  5CTR C;  2WDT B;  4PYU A;  2GMI C;  4KZC A;  2GBJ A;  4JLC A;  4JIO U;  4TQ0 A;  3R66 C;  3SU8 X;  2KTR A;  1YQB A;  2LZ6 A;  2IY0 B;  3JSV A;  3WAL A;  2M4N A;  4IWO A;  4RM9 A;  3Q3F A;  4LJO B;  2K1F A;  1SIF A;  2KX3 A;  4MJS A;  2ZCC A;  2G3Q B;  3V60 A;  2LVP A;  3H9D A;  2YLM A;  3HM6 X;  3L17 A;  3PRM B;  4MGK E;  2MLB A;  2RSU A;  2NCN A;  4NQK E;  2MX2 A;  2JRI B;  5LXI B;  2FIF A;  4HCP B;  1VCB A;  1E7U A;  3ML8 A;  2ZJD A;  4FHK A;  3DBS A;  4PS3 A;  2BGF A;  3ENE A;  5DPS A;  1WYW B;  1OTR B;  3TCA A;  2HE7 A;  2R2O A;  4AOF A;  4EOY A;  1I35 A;  3VVW B;  4WWN A;  2MA9 B;  1X1M A;  1P98 A;  1YX6 B;  2V1Y A;  3TJP A;  3ZNZ B;  1WE7 A;  2JY6 A;  4IM3 A;  2AEH A;  1TBE A;  2L7R A;  2KMA A;  2L0T A;  2AYO B;  2O6V D;  3IBE A;  1WMH B;  4F8C B;  3CSF A;  3AXC A;  1UBQ A;  2MBH A;  1Q1O A;  3LJ3 A;  5BO4 B;  4TV3 A;  1H8C A;  5JHA A;  3C0R B;  1HE8 A;  5D2M B;  4KV2 A;  1E8X A;  2PE6 B;  2MP2 A;  2JF5 A;  1TTN A;  3GOE A;  2EKE C;  2REX A;  2K8C A;  3L16 A;  1KOT A;  2K6Q A;  2C9W B;  1Q0W B;  4XZ4 A;  3PHX B;  4HXD A;  4FLH A;  3W1S A;  2LGX A;  3A9J B;  3KUD B;  2M8S A;  1UD7 A;  1H4R A;  3KH0 A;  4W9G A;  5KHQ A;  2KJR A;  4BOS C;  3SD5 A;  1KJT A;  1RFA A;  4URK A;  2FID A;  2KTR B;  3PS6 A;  4W9L A;  3JSV B;  4WJP A;  4B95 A;  4GMV A;  2MBE A;  3ZTD A;  3OLM D;  3VDZ A;  4MJS B;  2DZI A;  4G11 A;  3Q3J A;  4NY0 A;  3PZD A;  2GBM A;  1UBI A;  1J19 A;  3VUY A;  5E6N A;  4K7U A;  2KFJ A;  1Y8R C;  1ZW7 A;  2I1K A;  2KDF B;  1WX9 A;  4IW0 A;  4MEM A;  4AP4 C;  2FCN A;  2BF8 B;  4ZYN A;  2KQ7 A;  3VQI A;  2C7M B;  2LUE A;  2KNB A;  4FJY A;  4GXB A;  1TGZ B;  3EFU A;  2KDE B;  3SDL C;  5HKH A;  2L3Z A;  4NAW A;  2FUH B;  2JVC A;  4ZRK A;  3JW0 X;  4WAA A;  3QIJ A;  1ZKH A;  2ZPN A;  1YD8 U;  3NHE B;  4M0W B;  3NZS A;  2DYB A;  2KC1 A;  3IHP C;  1K8R B;  4BFR A;  5E6O A;  2CKH B;  2LVO A;  4NQL B;  2DAJ A;  2D07 B;  3VUW A;  4CO7 A;  1LXD A;  3CST A;  5J2R A;  3A4R A;  2MP2 B;  4W9H A;  4EUT A;  2D10 A;  2LWP A;  1P3Q U;  5AEK B;  3ZRF A;  2A4Z A;  5AZG A;  2C60 A;  1C3T A;  3KYC D;  2KFK A;  1WI0 A;  4ASW C;  3DDC B;  4ICU A;  1WJU A;  3PSE B;  2RPQ A;  4E3C A;  4EEW A;  2JRH A;  1Z2M A;  4ICV A;  4A3P A;  4K7S A;  3K9P B;  1S1Q B;  2NS5 A;  3HIZ A;  2N9E B;  5L83 A;  4EFO A;  3PHW B;  3PLU A;  4PS7 A;  1XQQ A;  2BYF A;  3VXW A;  4MEL A;  2PJH A;  1IPG A;  3UIP B;  2BWF A;  1RAX A;  2Z59 B;  2KX0 A;  2YVC A;  2J0J A;  3PLV A;  4DHJ D;  4X57 B;  2KJH B;  1V81 A;  1L7Y A;  2O6V A;  2MBO A;  3B1L X;  3L0W B;  4IWP A;  4LCD E;  4IUM B;  1WZ3 A;  3ZIM A;  1ISN A;  2M17 A;  2WWZ A;  2NBV B;  2J7Q B;  2NPT B;  2CU1 A;  1EF5 A;  3NY5 A;  2IBI B;  4NAW B;  4WJO A;  5CHW A;  2A5U A;  4B9K A;  1V2Y A;  2IO1 B;  2LGY A;  3M3J A;  4GOC A;  4OVU A;  1T0Y A;  2JPH A;  5DPT A;  1E90 A;  3ALB A;  3APC A;  2VRR B;  1XD3 B;  2XK5 A;  3PT2 B;  3LDZ E;  2MQJ A;  4WJQ A;  2I1J A;  5G55 A;  4PYZ A;  3RCZ A;  1E8W A;  3M62 B;  3PRP B;  4G50 A;  3SHQ A;  1WJ4 A;  2ZPY A;  4GSW A;  4IM2 A;  3BIN A;  2M0X A;  5TR5 A;  4KDL B;  5GMV A;  3ECI A;  3IVF A;  2KOX A;  2FCS A;  1YX5 B;  2QHO A;  4GN1 A;  4II3 B;  1E7V A;  1YJ1 A;  2C5L C;  4ANW A;  2KFK B;  3R7R A;  2KVR A;  2WX1 A;  3KUZ A;  4W9D A;  2DZJ A;  2G45 B;  1M94 A;  1WF9 A;  2CS4 A;  1I42 A;  1UZX B;  2J0K A;  1UGM A;  4WWO A;  3EEC A;  1NBF C;  3VAW A;  2DYM A;  3M63 B;  2NR2 A;  4KIK A;  2DEN B;  3QAR A;  2K8H A;  4MSM B;  4NJ7 A;  2LVQ A;  1G6J A;  1AAR A;  3H7S A;  5JH5 C;  3R3M A;  2N9X A;  2WX0 A;  5G2N A;  2RGF A;  3PV1 A;  4KSL C;  1C1Y B;  4ANU A;  1V86 A;  2KZR A;  1QZE A;  4CYE A;  1E5W A;  2GBR A;  2V3S A;  1WXA A;  4W9K A;  3H6N A;  2N9P C;  2DX5 B;  4WWP A;  2O6V B;  3VH3 B;  3WA0 A;  2CHZ A;  3DPD A;  4EZJ A;  3V61 A;  1V80 A;  1GC6 A;  1WGD A;  1WJ6 A;  1YIW A;  2KWV B;  3ZNI D;  4HVB A;  1WXV A;  2L0F A;  2OOB B;  1NDD A;  2B3A A;  3V6C B;  2FCQ A;  3TIX A;  3APF A;  4AUQ C;  4MGZ E;  5IA7 A;  2MW5 A;  4MM3 A;  2V4L A;  4M8M A;  3EC8 A;  4HCN B;  4GIV A;  4RMA A;  1BT0 A;  3RZW C;  2ASQ A;  4BOZ B;  3ML9 A;  3QX1 A;  3MJW A;  4DK5 A;  5CHV C;  2FCM A;  2XEW A;  2XK5 B;  1L2N A;  5KHO A;  4LDT D;  1UEL A;  2MSE D;  3S2A A;  2MCN B;  5DPW A;  4ANX A;  4AJW A;  4MSQ B;  4ANV A;  4W9I A;  4LDT B;  3RD2 A;  3ZKJ C;  1A5R A;  2RR9 A;  1GUA B;  2ZEQ A;  3EHV A;  5CX3 A;  3ZVV A;  3N3K B;  5D6J B;  1SE9 A;  2LXC A;  1OQY A;  2UWQ A;  3TBL D;  1ZGU B;  3VHT C;  5E6P A;  4YL8 A;  5LLI A;  4NJ6 A;  3UF8 A;  2JZZ A;  3JVZ X;  1V5T A;  2MBB B;  1WR6 E;  2IZV B;  1P0R A;  4KIK B;  1TZ1 A;  5AZH A;  2K25 A;  3KW5 B;  2ZCB A;  5D94 A;  1WM3 A;  2EMS A;  2GBN A;  2ZVO A;  1OGW A;  4P7I A;  3O65 B;  1LFD A;  4PS8 A;  2CHX A;  3UQB A;  3BY4 B;  4HPL B;  5AZF A;  2BYV E;  3VTW A;  2FAZ A;  3HK0 A;  2JZ3 B;  4BBN F;  3DOW A;  1EUV B;  3UIO B;  3CMM B;  2FNJ B;  3KYD D;  2BKR B;  2KN5 A;  2BPS A;  4I6N B;  2MBQ A;  2HTH A;  4WQO B;  2IO2 B;  3VTU A;  3QQ8 B;  5C23 A;  3RUL A;  4KVG B;  3B0A A;  3KUC B;  3H7P A;  4I6P A;  2DAF A;  4GB9 A;  3ZNH B;  3WAO A;  1WY8 A;  4FJV B;  2AL3 A;  2N7D A;  3WIM A;  3P2B A;  4B6W A;  1WXS A;  4GDK A;  4NNJ B;  3RYT A;  1GJZ A;  1WE6 A;  4GU2 A;  4JL9 A;  3A4S C;  2LXA A;  2K6D B;  2ZVN A;  4HDO A;  5CHF A;  1P1A A;  2BWE S;  1WXM A;  4FHJ A;  2L05 A;  1WJN A;  3V6E B;  4AJY B;  4MGY E;  4W9J A;  2GOW A;  4DHJ B;  3W1S C;  2LJ5 A;  2KAN A;  2C7H A;  3VUX A;  4OVV A;  2KK8 A;  2W9N A;  5J18 A;  2DYO A;  1WRD B;  4M8N A;  3NS8 A;  2UYZ B;  1NI2 A;  2JXX A;  4KSK C;  3TL5 A;  3ZTC A;  3U30 A;  4F7Z A;  2KWC A;  3PVL A;  2GBK A;  3L10 B;  2IO3 B;  3MHS D;  2DZM A;  2J0M A;  4JQW C;  2RD0 A;  4FA6 A;  3DVG X;  4DBG A;  1R4M I;  2JWZ A;  2EMT A;  3A9K A;  3L13 A;  2AWT A;  1WZ0 A;  3V62 A;  1V9J A;  5J17 A;  3OJ3 A;  1LQB A;  3AU5 A;  4BKS D;  2N1V A;  4HJK A;  1XT9 B;  2LAS A;  2MWS B;  2KQS A;  4BBN C;  4DDG D; 
#chains in the Genus database with same CATH topology
 3H7P B;  3DCG A;  1IP9 A;  1GC7 A;  2BYE A;  4TQ1 A;  1Q5W B;  2PVG C;  3I63 C;  4RGM A;  4C7Z A;  3CF6 E;  2WXQ A;  1KRH A;  4A3O A;  1EF1 A;  2XN9 C;  3X23 A;  4WH4 A;  3IAM 1;  3DVN V;  2LD9 A;  2KLC A;  2O2V A;  1C79 A;  2HD5 B;  3Q8E A;  4E74 A;  2CJN A;  4XE0 A;  4OW0 A;  1MPE A;  3GS2 A;  1ZUD 2;  4CHK A;  3SR6 A;  1U4A A;  3VR8 B;  3VTV A;  2NBU A;  1PUT A;  1ZE3 D;  4NAM A;  2Z8L A;  3H8H A;  1EO6 A;  2L76 A;  1WR1 A;  3RMK C;  3TEW A;  3Q8B A;  5JZE B;  5L95 C;  3APD A;  1WGG A;  2QMT A;  3AN1 A;  1ENF A;  1D3Z A;  2L8J A;  1KLV A;  4HWI B;  3ZUN A;  2AL6 A;  1OEY J;  3N30 A;  4OZB A;  4OZA A;  2KWD A;  3QHT A;  1WGH A;  1E8Y A;  2DWQ A;  4B0E A;  2ZZP B;  2WGS A;  2X38 A;  5MPO A;  2IO0 B;  3T9L A;  1OEY A;  1KFY B;  5HHD G;  3IG3 A;  4C4V A;  1JWM D;  1A70 A;  3DQV A;  2WXO A;  3RUI B;  4A90 A;  4HLE A;  3W9C B;  4F1S A;  1SGH A;  3QJZ A;  5C2T B;  2B76 B;  3PZ8 A;  4KX6 B;  2KKC A;  2C7N B;  1V49 A;  2WNM A;  2IYD B;  3BVZ A;  4FN2 A;  3TEX A;  1WGR A;  1S3S G;  3I57 A;  2G4D B;  1VZ6 A;  4ZRI A;  4YSX B;  4OZC A;  4WJN A;  3ZLZ A;  4FJZ A;  3LXF A;  3FAH A;  1MHX A;  2XBB C;  2WXR A;  3RZF A;  1YN5 A;  2BKF A;  3DBL I;  3A9J A;  3DVN U;  4YXD B;  5JXV A;  2K9X A;  3TMP B;  2VH2 A;  4JLC A;  4JIO U;  4KGS A;  2Y5C A;  3RN9 C;  3SU8 X;  4TQ0 A;  2IY0 B;  1SSN A;  4IWO A;  3MC9 A;  1HZ6 A;  3Q3F A;  1PGA A;  4S0R A;  2K1F A;  1NI3 A;  3V60 A;  4H2A A;  1K51 A;  2MX2 A;  1D4B A;  4WIP A;  1NYR A;  3TCA A;  2R2O A;  4AOF A;  4HRO A;  3KLS X;  3VVW B;  2N7J A;  1WE7 A;  1R4N B;  2E3T A;  1TBE A;  3EA6 A;  4M0W A;  1SIJ A;  3C0R B;  2MP2 A;  2JF5 A;  2REX A;  2K6Q A;  1Q0W B;  1XLQ A;  4B0M A;  4FLH A;  3P4S B;  1QQR A;  1IGD A;  3KUD B;  4BZA A;  1UD7 A;  4RGN A;  4BOS C;  3MC0 B;  1JW9 D;  4W9L A;  1D5X C;  4US8 A;  2Y3A A;  1J19 A;  3TEZ A;  1FNU A;  4MEM A;  2QSD A;  1WX9 A;  4EE2 A;  3R8B A;  2BF8 B;  3EFU A;  1XF5 L;  2KDE B;  1N60 A;  2JVC A;  3JW0 X;  1ZKH A;  1YD8 U;  3NHE B;  3IHP C;  5E6O A;  2CKH B;  4NQL B;  3VUW A;  2DAJ A;  4CO7 A;  3A4R A;  4W9H A;  1YNT E;  1P3Q U;  5AEK B;  4C7Y A;  5BYQ A;  5AZG A;  3CWI A;  2C60 A;  1WI0 A;  3DDC B;  5I4D A;  1KF6 B;  2WU5 B;  1QOG A;  4PS7 A;  3VXW A;  1XQQ A;  2M19 A;  4RGT A;  3MHZ A;  5C3J B;  2DNF A;  2JXT A;  2BQQ A;  3PLV A;  2KJH B;  3L0W B;  2AX5 A;  3B1L X;  2BS3 B;  3EGR A;  5T8I A;  2J42 A;  2CU1 A;  1EF5 A;  4B9K A;  2G1E A;  2LGY A;  4GOC A;  4OVU A;  1T0Y A;  5DPT A;  2VRR B;  2XK5 A;  3PT2 B;  1IBX B;  4RF1 A;  1E8W A;  4GSW A;  3BIN A;  2CU3 A;  5TR5 A;  5GMV A;  4GN1 A;  1E7V A;  2C5L C;  3R7R A;  2WX1 A;  1M94 A;  2CS4 A;  2J0K A;  2J52 A;  2M56 B;  2DYM A;  3M63 B;  2K8H A;  1J7B A;  2N9X A;  4XGA B;  5G2N A;  2RGF A;  3PV1 A;  3Q6B A;  4ANU A;  1UNS A;  3Q2A C;  2INN E;  2RDB C;  4WWP A;  4B6W A;  2O6V B;  3AV8 A;  3V61 A;  1WJ6 A;  1WXV A;  1NDD A;  2WP9 B;  2H88 B;  2BB5 A;  3W5U B;  2INC C;  4RMA A;  4A9A A;  5CHV C;  1TS5 A;  2FCM A;  3FIL A;  1L2N A;  1UEL A;  3S2A A;  3NJT A;  2MCN B;  4AJW A;  4ANV A;  4LDT B;  4AQ7 A;  2D3C A;  1C76 A;  2WU2 B;  1SE9 A;  1NVI D;  1GOZ A;  4YL8 A;  2EKI A;  3JVZ X;  3Q3M C;  2MBB B;  4KIK B;  4HPP A;  1DYQ A;  5AUI A;  5D94 A;  1WM3 A;  1XO3 A;  4HPL B;  1EU4 A;  3CMM B;  2KN5 A;  2BB6 A;  4LTU A;  4TMA B;  1JML A;  3H7P A;  4KGT A;  1ZDV A;  3WIM A;  1P7E A;  1GJZ A;  3VR9 B;  2K6D B;  4L1B A;  3PO0 A;  2K22 A;  2BWE S;  3HVD A;  4AJY B;  4DHJ B;  2KAN A;  1OQR A;  3URY A;  2WXF A;  3NVZ A;  4OVV A;  3SEB A;  1WRD B;  4M8N A;  2UYZ B;  3BVG A;  2VZK B;  1N5X A;  3PVL A;  1J7C A;  2DZM A;  2J0M A;  4JQW C;  2QC8 A;  1TIF A;  4MT5 A;  3MP9 A;  1WZ0 A;  3V62 A;  5J17 A;  3OJ3 A;  1ZOY B;  2KQ4 X;  4BBN C;  2LAS A;  2KQS A;  5IN7 A;  2LHD A;  2ZNV B;  3AU4 A;  3B08 A;  1V6E A;  1SB3 C;  3NS1 A;  1RLF A;  4BKG A;  4L23 A;  1MFW A;  3ZDM C;  3VFK A;  4BKT A;  1J8C A;  2KDB A;  3DBH I;  3QWZ B;  1WFY A;  2JUO A;  1PQS A;  2WLB A;  4ZDV A;  4XX5 A;  2M1M A;  3DVG Y;  4O1N A;  2MEK A;  1E6E B;  3ZXV A;  5D3I B;  5IKC M;  2K0P A;  2JT4 B;  3ABV B;  3GE3 C;  4DXA B;  4OHJ A;  3ZDT A;  4W9F A;  3ZNG C;  4XC2 A;  3UQA A;  1L6U A;  3AEF B;  4K81 A;  3P4P B;  3H1U A;  3ETR A;  3N32 A;  2OJR A;  1I4G A;  1JCK B;  4JX1 C;  4WQM A;  2KAJ A;  1SJH D;  2CHW A;  4DDI D;  4XWW A;  4DWF A;  2KHW B;  3PRZ A;  5D7G A;  2KMC A;  5HG2 A;  2D3A A;  1DGJ A;  3X0W A;  2WXH A;  4IG7 B;  3OJ4 B;  4IWQ A;  3JYU A;  2D3B A;  5EE1 A;  1C4C A;  2K39 A;  1FXI A;  2L00 B;  3R7Q A;  2I38 A;  4TUU A;  1CZP A;  4W9E A;  1WIA A;  2LRW A;  1PGX A;  1ESF A;  4ZRJ A;  3U8Z A;  3AUL A;  1WH3 A;  4HRS A;  3D32 A;  3EFC A;  3QK0 A;  2W3S A;  1JRU A;  3BII D;  5FK9 C;  4A55 A;  1T6B X;  3A1Q B;  3BWU D;  4RH6 A;  3P42 A;  4GDL B;  2BS2 B;  4EZK A;  1R4M B;  1V1O A;  4M02 A;  4YTP B;  3DBR I;  5H8Y E;  1V8C A;  1EU3 A;  2LJI A;  2IY1 B;  3VH4 B;  2IGH A;  1V97 A;  3QA8 A;  1WXQ A;  3KVF B;  2L83 A;  4N6E B;  1MG4 A;  3U7D A;  2OED A;  1I4H A;  5EE9 A;  4G3X B;  2KLG A;  4MH0 E;  5BMG A;  1YJJ A;  1UH6 A;  4JPS A;  1FNW A;  3BK2 A;  2PW9 A;  4A8X C;  4EZL A;  2FBW B;  1FFV A;  1JRP A;  3MTN B;  5CTR C;  2WDT B;  2GMI C;  4KZC A;  1OFF A;  3R66 C;  1HXY D;  2LZ6 A;  1SIF A;  2ZCC A;  2G3Q B;  3H9D A;  3PRM B;  2RSU A;  2NCN A;  1XCQ L;  1FEH A;  1E7U A;  3AE6 B;  4XDC A;  1WYW B;  4LNO A;  2HE7 A;  4WWN A;  1X1M A;  2V1Y A;  1CK1 A;  2AEH A;  2L7R A;  3HRD D;  2L0T A;  2AYO B;  2O6V D;  3IBE A;  1WMH B;  4F8C B;  1UBQ A;  2WHI A;  3AE5 B;  2OHF A;  1WWT A;  1OQQ A;  4US9 A;  1E8X A;  2EKE C;  3L16 A;  1KOT A;  5AUK A;  4HXD A;  3Q69 A;  4XYC A;  1T5X D;  1UF0 A;  1L4Z B;  3KH0 A;  2JX5 A;  4NZL B;  3JSV B;  4WJP A;  4B95 A;  4GMV A;  2QCZ A;  3GZN B;  1KTK A;  2GBM A;  3EUB 2;  1PDX A;  5G5H A;  1L0Y B;  2KFJ A;  4IW0 A;  4AP4 C;  3ZGZ A;  2FCN A;  4FJY A;  1Y56 A;  4ZYS A;  2FUH B;  1L4D B;  1HZ5 A;  4WAA A;  1C4P A;  3B9J A;  3NZS A;  4BFR A;  1IBX A;  2LVO A;  2D07 B;  2PTL A;  2AQ2 B;  1DOY A;  1SEB D;  3PSE B;  2JRH A;  2WXG A;  4ARC A;  1S1Q B;  3HIZ A;  2N9E B;  5L83 A;  4EFO A;  2J53 A;  3PHW B;  2BYF A;  4MEL A;  3AH7 A;  2PJH A;  3AE8 B;  1IPG A;  2BWF A;  1L5P A;  2KX0 A;  4DHJ D;  1V81 A;  1L7Y A;  4JWU C;  1N63 A;  2O6V A;  4IWP A;  2V0G A;  2WWZ A;  2NBV B;  2KAC A;  3BZD B;  4NAW B;  2IBI B;  2VZK D;  4RCO A;  4RFB A;  1XD3 B;  5G55 A;  2LGS A;  3Q8A A;  3PRP B;  1WJ4 A;  3N1Y C;  1PYW D;  4FXC A;  1VDV A;  4KDL B;  3IVF A;  1UGJ A;  2FCS A;  1YX5 B;  2QHO A;  1YJ1 A;  2BYT A;  2KFK B;  2Q5W D;  4ARI A;  1I42 A;  4YWG G;  5IO9 A;  3RFZ B;  2NR2 A;  4KIK A;  5G5G A;  3N20 C;  1TS2 A;  2NTS A;  3R3M A;  2WX0 A;  2KZR A;  1QZE A;  4CYE A;  1E5W A;  2GBR A;  2V3S A;  4W9K A;  1D6E C;  1YQ3 B;  1V80 A;  1ACC A;  3ZNI D;  4HVB A;  2OOB B;  3V6C B;  2FCQ A;  4MGZ E;  4GIV A;  3FKY A;  2MSE D;  3AEB B;  2IJ0 A;  1HEZ E;  1UWM A;  3AEE B;  3L4P A;  3RD2 A;  3ZKJ C;  1GUA B;  4M00 A;  2WXJ A;  4C80 A;  2LXC A;  1OQY A;  2UWQ A;  2AQ1 B;  3VHT C;  5E6P A;  5HI1 A;  5IOI A;  4DXG A;  5BYS A;  1P0R A;  3I9V 1;  5AZH A;  3AB5 A;  1OGW A;  4P7I A;  1LFD A;  4PS8 A;  2CHX A;  2BYV E;  2V4I B;  5BMH A;  1MI0 A;  2FNJ B;  2WS3 B;  2MBQ A;  2HTH A;  2JZP A;  4WQO B;  2IO2 B;  3VTU A;  1I7H A;  1TY0 A;  4MM3 B;  1F77 A;  4ZRP A;  3RUL A;  4KVG B;  3KUC B;  2LEK A;  2DAF A;  3HVZ A;  3ZNH B;  3WAO A;  1PGB A;  3TUO A;  2N7D A;  3RNA C;  3P2B A;  1WXS A;  2BBC A;  1WRI A;  4GU2 A;  3ZJT A;  4JL9 A;  3A4S C;  2LXA A;  1VRA B;  2JSV X;  3IAS 1;  5CHF A;  4FHJ A;  2L05 A;  2WDR B;  3W1S C;  1PFD A;  1XLP A;  1FIQ A;  2BT6 A;  2LMC A;  1SXT A;  4S17 A;  2W9N A;  4P1B C;  2ACZ B;  4R3D A;  4KSK C;  4F7Z A;  3U30 A;  3MHS D;  1XLN A;  5FKA C;  1AW7 A;  1MVK A;  2EMT A;  2AWT A;  1V9J A;  3NRZ A;  1LQB A;  1AWD A;  1EWC A;  4BKS D;  1C78 A;  3N1Z C;  1SF0 A;  3HM3 A;  4AS1 A;  3MFG A;  3RT3 B;  4DXF A;  2KC2 A;  2DHZ A;  3O13 A;  4LNN A;  1IUE A;  1STE A;  4HJG E;  1V5O A;  2KJ6 A;  1JWU D;  5FR6 A;  5C1Z A;  2WXP A;  4DHZ B;  2DBY A;  1QF6 A;  3PTF C;  4EKU A;  1KLU D;  5TSS A;  1E7P B;  3WAN A;  1MG8 A;  1FRR A;  4HDQ A;  3ONS A;  3E56 A;  4MH8 A;  3N9Y C;  2ZW0 A;  2KDI A;  1IYF A;  2N7E A;  1NEK B;  2KD0 A;  4MAC A;  1J0G A;  4RM8 A;  2HJ1 A;  1QOB A;  4REZ A;  1I4R A;  3A1Q A;  3T3N A;  5EE0 A;  3PGE A;  4KGR A;  4MDK E;  4A6Q A;  4GDL A;  4LJP B;  1BML C;  5JHB A;  3GP7 A;  3PRE A;  2HDE A;  5IAA C;  2GB1 A;  3ZO5 B;  3UI3 A;  1ZP0 B;  3FC4 A;  2ON8 A;  1R4N I;  3WAM A;  1VZ7 A;  2NBW B;  2YEP B;  2L32 A;  1GG3 A;  1B1Z A;  2KXJ A;  4YSZ B;  3HHM A;  4W9C A;  2IGG A;  3L54 A;  3QC8 B;  1B9R A;  1XEE A;  4ZOH C;  1BXT A;  1GNU A;  4G0N B;  2NPT A;  4M01 A;  4J6I A;  1JRO A;  1ZDX A;  3AMZ A;  3AM9 A;  4BKS A;  3OAW A;  4K1R B;  2Z0E B;  2PIA A;  3AI5 A;  4HPM B;  1RRB A;  2KYW A;  3IFW B;  4HK2 A;  2QIL A;  4CQN A;  3AE1 B;  5DCN A;  3T8M A;  1TJE A;  2LGD A;  3BVM A;  4WWM A;  2NTT A;  3I3T B;  2N1W A;  1DOI A;  3P63 A;  2V3N A;  2Y5P A;  2FE8 A;  2UU7 A;  3BK1 A;  3GE8 C;  4KZ0 A;  2N4F A;  1JWA D;  4TKN A;  3V05 A;  4IM0 A;  2KO3 A;  1WMH A;  1QOA A;  4GGQ A;  3QAQ A;  2NVU I;  3U4E G;  4NPN A;  2JQR B;  3L08 A;  4FUL A;  2K8B A;  4LNK A;  3UIN B;  1TT5 B;  1WX8 A;  4MGI E;  2SEB D;  3K9O B;  4PYU A;  2GBJ A;  3CIR B;  3WAL A;  1YQB A;  3JSV A;  4RM9 A;  2SAK A;  4LJO B;  2KX3 A;  2LVP A;  3HM6 X;  2YLM A;  4MGK E;  2LHE A;  2MJE A;  2MLB A;  3OWE B;  1RM6 C;  5LXI B;  2FIF A;  4J3O D;  5D3D A;  1RYJ A;  2ZJD A;  4PS3 A;  1OTR B;  1I35 A;  2LUM A;  1HTO A;  2MA9 B;  1YX6 B;  1P98 A;  3ZNZ B;  4IM3 A;  1KH0 A;  2WXL A;  2KMA A;  3VRA B;  1R7S A;  3LYY A;  3CSF A;  3AXC A;  1MHH E;  3LJ3 A;  5BO4 B;  4TV3 A;  3I5J C;  4RGO S;  5EE3 A;  5D2M B;  2BTE A;  1LO5 D;  2K8C A;  2LGI A;  2C9W B;  4XZ4 A;  3PHX B;  4RF0 A;  2M8S A;  1I4Q A;  4DQO C;  5KHQ A;  2KJR A;  1KJT A;  4URK A;  4KKI A;  2FID A;  1HA5 A;  2KTR B;  3PS6 A;  1C9F A;  1E0Z A;  1IGC A;  3VDZ A;  4MJS B;  1FD6 A;  1UBI A;  4JWS C;  2W55 A;  3NVV A;  3VUY A;  2IPK D;  1Y8R C;  1P7F A;  3NVW A;  2KQ7 A;  3VQI A;  2C7M B;  2L3Z A;  4NAW A;  2IND C;  4UDU C;  5HFY A;  2V3P A;  4YTN B;  3ZQ4 A;  4YT0 B;  2RPV A;  2KVZ A;  2DYB A;  2KC1 A;  1LXD A;  3CST A;  4RNA A;  5J2R A;  4EUT A;  2D10 A;  2A4Z A;  3KYC D;  2KFK A;  1D5M C;  2RPQ A;  3DBL B;  4EEW A;  3V3X A;  1Z2M A;  2MJD A;  3Q8F A;  4ICV A;  4K7S A;  1TS4 A;  3W5V B;  2QDF A;  3UIP B;  1RAX A;  3AE9 B;  4HEA 1;  4LCD E;  4ZHP A;  2BS4 B;  1T3Q A;  4IUM B;  1WZ3 A;  1AN8 A;  2M17 A;  2J7Q B;  2NPT B;  3AE3 B;  3NY5 A;  5CHW A;  1V2Y A;  2JWU A;  1LGR A;  2IO1 B;  1TY2 A;  1F0Z A;  1MJD A;  1E90 A;  5BYR A;  4USA A;  3APC A;  3AE2 B;  3Q14 C;  3LDZ E;  2MQJ A;  1N6Z A;  4PYZ A;  3ZYY X;  4G50 A;  2ZPY A;  4IM2 A;  3NZ3 A;  3AED B;  1QOF A;  4BAX A;  3ECI A;  1FCL A;  4ANW A;  2W82 A;  2KVR A;  3KUZ A;  4W9D A;  4WWO A;  1UGM A;  3EEC A;  1NBF C;  2TSS A;  2PMV A;  1L0V B;  3RPF C;  4MSM B;  3H7S A;  4P1C C;  5JH5 C;  2DLB A;  4KSL C;  4P6V F;  1V86 A;  1QT9 A;  3VH3 B;  3H6N A;  2CHZ A;  1GC6 A;  1WGD A;  1YIW A;  2PLP A;  1QIL A;  2B3A A;  4AUQ C;  2RDH A;  3TIX A;  2MW5 A;  4MM3 A;  1NEN B;  3RZW C;  1BT0 A;  1AYF A;  4BOZ B;  1E9M A;  3MJW A;  4DK5 A;  5KHO A;  3IT4 B;  4LDT D;  1JQ4 A;  5DPW A;  3AEC B;  4MSQ B;  2RR9 A;  2W3R A;  2ZEQ A;  1EM7 A;  5CX3 A;  3ZVV A;  4JE3 B;  3TBL D;  1ZGU B;  2JZZ A;  1V5T A;  3R2I A;  1WR6 E;  2IZV B;  1D5Z C;  2ZW1 A;  3DHG C;  2K25 A;  1ZPS A;  2ZCB A;  4WUR A;  1EWY C;  2EMS A;  2GBN A;  1UWX A;  1FNV A;  1GB1 A;  3UQB A;  5AZF A;  1NYQ A;  2FAZ A;  3HK0 A;  5LNK 1;  1EUV B;  2RDG A;  4I6N B;  1WSP A;  4C56 C;  3QQ8 B;  1VZ8 A;  3U2S C;  5E6J A;  4GB9 A;  1GAQ B;  1WY8 A;  1L6V A;  1SBB B;  2LFI A;  1KLG D;  4PT5 A;  4NNJ B;  3RYT A;  1WE6 A;  2HTM E;  2ZVN A;  1P1A A;  1WXM A;  4HKZ E;  1WJN A;  2J4X A;  4MGY E;  4W9J A;  2ICI A;  1SJE D;  2WDQ B;  2LJ5 A;  1K50 A;  1QKZ A;  2KK8 A;  3BYY B;  3NS8 A;  1NI2 A;  3ZTC A;  3L10 B;  1R4M I;  3L13 A;  1YOV B;  3RI7 C;  1F52 A;  3NVY A;  4ZHO A;  4HJK A;  2MWS B;  2ONQ A;  1WGY A;  1F9J A;  4ZRQ A;  1L0X B;  4FBJ B;  1J7A A;  4A20 A;  4GDK B;  3ZW3 A;  3DWG C;  1VD2 A;  3TEY A;  2LI5 A;  3VRB B;  3KWV A;  1HQR D;  4N59 A;  2D3G A;  1V1P B;  4XDD A;  2ZNV C;  3NG0 A;  3DHI C;  2YEP F;  2XNA C;  2MJ3 A;  2MRP A;  3NOB A;  3B2F A;  1P9D U;  4TSS A;  4JGH B;  2VH1 A;  2KTF A;  5IP4 D;  3A9K B;  1FMA D;  1FXT B;  4N9F 4;  1VLB A;  1E8Z A;  1RFK A;  4II2 B;  1TZO A;  2CJO A;  3ZRC A;  3P4R B;  1FXA A;  1KM7 A;  2KWU B;  4E71 A;  2WYQ A;  1I4X A;  1FCC C;  4P16 A;  1CMX B;  3M95 A;  3NZU A;  1Q10 A;  1SE3 A;  1LM8 B;  4LLG M;  3AEG B;  1TKE A;  3DHH C;  1Z5S B;  2K3U A;  2CR5 A;  2O2V B;  3IT6 B;  3B2G A;  5H92 C;  3RNG C;  3LB8 C;  3A33 B;  3RNC C;  4GLS C;  4IC7 B;  1WM2 A;  4K3C A;  4DHZ E;  1T0S C;  3GZN I;  2D2Q A;  4AWJ A;  3WAP A;  1GPX A;  3QCA A;  1FM0 D;  2MHJ A;  2PEA A;  1K53 A;  4D2K A;  1TS3 A;  1SE4 A;  4OVZ A;  3W2D A;  2I2Y A;  2Y5B B;  4FAD A;  2R2Q A;  2HJ8 A;  2RMM A;  1CQV A;  3PPA A;  1ZXH A;  1FPY A;  3W1Y A;  2WDV B;  5DPR A;  4LNI A;  3J9C A;  3DBH B;  1TKY A;  2NMQ A;  1C4A A;  4I6L B;  4XWT A;  3IXS A;  1TYG B;  4C4V B;  2LRU A;  3UGB B;  2PE9 A;  2R61 A;  4K7W A;  5EDS A;  1WX7 A;  4KDI C;  4KKJ A;  4BVU C;  2DZK A;  2Z0D B;  5LXH A;  2D11 A;  1F2R I;  2G4S A;  2L1A A;  2PPH A;  2D5G A;  2KTR A;  1ZXI A;  4K3B A;  2M4N A;  1FRD A;  1YMH E;  4MJS A;  1XLO A;  3L17 A;  2MH7 A;  1M4V A;  4NQK E;  2JRI B;  1N61 A;  3C19 A;  4HCP B;  1VCB A;  3ML8 A;  4FHK A;  3DBS A;  2BGF A;  3ENE A;  5DPS A;  4EOY A;  5FR3 A;  2KN4 A;  3TJP A;  1I4P A;  3Q3N C;  2JY6 A;  1FO4 A;  1FFU A;  4YTM B;  1RWS A;  2WXI A;  3KWL A;  2MBH A;  1Q1O A;  3Q8C A;  1H8C A;  1E10 A;  5JHA A;  1HE8 A;  4KV2 A;  2PE6 B;  1TTN A;  3GOE A;  5BMI A;  3W1S A;  3PZ7 A;  4L2Y A;  2LGX A;  3A9J B;  1H4R A;  4W9G A;  3SD5 A;  2GRI A;  1RFA A;  3RNB C;  2MBE A;  3ZTD A;  3OLM D;  2DZI A;  4G11 A;  3Q3J A;  4NY0 A;  3PZD A;  2M0A A;  3DBR B;  5E6N A;  4K7U A;  4NJC A;  1ZW7 A;  2KDF B;  2I1K A;  1CJE A;  1QLB B;  4ZYN A;  2LUE A;  2KNB A;  4GXB A;  1TGZ B;  3R2T A;  3SDL C;  5HKH A;  4ZRK A;  2QEJ C;  3QIJ A;  2ZPN A;  4M0W B;  1K8R B;  1XCT L;  2KT7 A;  2KMM A;  2MP2 B;  2N9K A;  2LWP A;  4YSY B;  3ZRF A;  2WXN A;  1C3T A;  5GXG B;  4ASW C;  4IDI A;  1GB4 A;  4ICU A;  1WJU A;  4E3C A;  2EEL A;  4A3P A;  3K9P B;  2NS5 A;  3HUI A;  3PLU A;  3C8Y A;  3P1M A;  3P4Q B;  4ACF A;  2Z59 B;  2H89 B;  2YVC A;  2J0J A;  2JYE A;  2K5P A;  4X57 B;  2MBO A;  3ZIM A;  3Q3O C;  1ISN A;  3ZXR A;  4PK1 A;  4WJO A;  4ITK A;  1ET9 A;  2A5U A;  1F2R C;  3N1X C;  1VJK A;  3M3J A;  2JPH A;  3ALB A;  3ZJV A;  3OG5 A;  4WJQ A;  2I1J A;  1WYG A;  3MC8 A;  3RCZ A;  3M62 B;  3SHQ A;  1ROE A;  2IGD A;  2M0X A;  2PVO D;  1JWB D;  2KOX A;  4II3 B;  2QIE B;  2DZJ A;  2G45 B;  1WF9 A;  1DOX A;  1T0R C;  1BUI C;  1UZX B;  3VAW A;  4C00 A;  2DEN B;  2INP E;  3QAR A;  1YJI A;  1HTQ A;  4NJ7 A;  2LVQ A;  1G6J A;  1AAR A;  2QJL A;  3WCQ A;  2W54 A;  1TKG A;  1YN4 A;  1N5W A;  2N0S B;  1C1Y B;  1WXA A;  3SFE B;  2N9P C;  2DX5 B;  3WA0 A;  3DPD A;  4EZJ A;  3T3O A;  4N58 A;  2KWV B;  1VR9 A;  2L0F A;  3APF A;  2G9H D;  2PKO A;  5IA7 A;  2V4L A;  4M8M A;  3EC8 A;  4HCN B;  2N9L A;  2ASQ A;  2BVC A;  3ML9 A;  3QX1 A;  4Q2J A;  2XEW A;  2XK5 B;  2IDY A;  3NUH B;  4ANX A;  2KDM A;  4W9I A;  1A5R A;  3AEA B;  3EHV A;  3N3K B;  5D6J B;  3BYT B;  1YN3 A;  1SE2 A;  2V9H A;  5LLI A;  4HKQ A;  4NJ6 A;  3UF8 A;  1TZ1 A;  3E9S A;  4LK0 M;  3KW5 B;  1WGK A;  3RNE C;  2ZVO A;  1UUP A;  3O65 B;  1N62 A;  4LNF A;  3BY4 B;  3MJ5 A;  3VTW A;  4BBN F;  2JZ3 B;  3DOW A;  2X8X X;  3UIO B;  3KYD D;  2BKR B;  3AE4 B;  2BPS A;  2E6X A;  3RNF C;  4WAF A;  5C23 A;  3GB1 A;  1K52 A;  4QAY A;  3B0A A;  4I6P A;  3FIL B;  4FJV B;  2GLS A;  2AL3 A;  1JWS D;  2GI9 A;  4GDK A;  1YQ4 B;  1F1H A;  1JAL A;  2AQ3 B;  4HDO A;  1ET6 A;  3V6E B;  2WXK A;  2FUG 1;  2GOW A;  3TSS A;  3AE7 B;  2OJW A;  1V1P A;  1T0Q C;  2JYT A;  3DWM A;  2C7H A;  3VUX A;  2WQY B;  3U52 E;  5J18 A;  2DYO A;  2JXX A;  3TL5 A;  1C77 A;  2WXM A;  2KWC A;  2L52 A;  2GBK A;  2BW2 A;  2IO3 B;  2JU6 X;  2RD0 A;  4FA6 A;  3KQ4 A;  3DVG X;  1XXG A;  4DBG A;  2JWZ A;  3A9K A;  4IOI E;  3U7Z A;  3SFD B;  3AU5 A;  3ZJU A;  4IKG A;  2N1V A;  1XT9 B;  4DDG D; 
#chains in the Genus database with same CATH homology
 2ZNV B;  1WGY A;  3AU4 A;  1F9J A;  3B08 A;  3DCG A;  1V6E A;  3H7P B;  3HM3 A;  1IP9 A;  1GC7 A;  3RT3 B;  2BYE A;  4TQ1 A;  1Q5W B;  4FBJ B;  2KC2 A;  1RLF A;  4BKG A;  2DHZ A;  3ZDM C;  1V5O A;  2KJ6 A;  3CF6 E;  3VFK A;  4A20 A;  4GDK B;  3ZW3 A;  4BKT A;  1J8C A;  2KDB A;  5FR6 A;  5C1Z A;  3DBH I;  3QWZ B;  4DHZ B;  1VD2 A;  1WFY A;  2JUO A;  1PQS A;  4ZDV A;  4A3O A;  3PTF C;  4XX5 A;  2M1M A;  3DVG Y;  4EKU A;  2LI5 A;  1EF1 A;  3X23 A;  3WAN A;  1MG8 A;  4HDQ A;  2D3G A;  3ONS A;  3DVN V;  2LD9 A;  2ZNV C;  2KLC A;  2O2V A;  2JT4 B;  2HD5 B;  4E74 A;  4DXA B;  2KDI A;  2MRP A;  1IYF A;  2N7E A;  3ZDT A;  4W9F A;  2KD0 A;  3NOB A;  1J0G A;  3ZNG C;  1P9D U;  4RM8 A;  4XC2 A;  4JGH B;  4CHK A;  1U4A A;  3UQA A;  2KTF A;  3A1Q A;  3PGE A;  3VTV A;  3A9K B;  2NBU A;  4MDK E;  4K81 A;  1FXT B;  4GDL A;  4N9F 4;  3H1U A;  4LJP B;  1E8Z A;  1EO6 A;  4II2 B;  2L76 A;  1WR1 A;  5JHB A;  3N32 A;  5JZE B;  3ZRC A;  5L95 C;  2OJR A;  3APD A;  1WGG A;  3PRE A;  5IAA C;  1KM7 A;  2KWU B;  1D3Z A;  4E71 A;  2L8J A;  3ZO5 B;  1KLV A;  2CHW A;  4HWI B;  3ZUN A;  4DDI D;  2AL6 A;  1OEY J;  2WYQ A;  3N30 A;  4DWF A;  2KHW B;  3PRZ A;  5D7G A;  2KMC A;  3QHT A;  3X0W A;  1R4N I;  3WAM A;  1WGH A;  4IG7 B;  3OJ4 B;  1E8Y A;  1CMX B;  2NBW B;  3M95 A;  2ZZP B;  3NZU A;  1GG3 A;  4IWQ A;  2IO0 B;  2KXJ A;  3JYU A;  1LM8 B;  3T9L A;  1OEY A;  3HHM A;  2K39 A;  4W9C A;  3L54 A;  3QC8 B;  2L00 B;  3R7Q A;  3IG3 A;  1Z5S B;  4TUU A;  2CR5 A;  2O2V B;  4W9E A;  1WIA A;  1GNU A;  2LRW A;  2NPT A;  4G0N B;  4ZRJ A;  3U8Z A;  4J6I A;  3DQV A;  3AUL A;  1WH3 A;  3RUI B;  4BKS A;  3OAW A;  3D32 A;  3A33 B;  3QK0 A;  4HLE A;  1JRU A;  2Z0E B;  4K1R B;  4IC7 B;  1WM2 A;  3A1Q B;  4DHZ E;  3AI5 A;  4F1S A;  1SGH A;  3QJZ A;  3GZN I;  2D2Q A;  4GDL B;  4HPM B;  4AWJ A;  3WAP A;  4EZK A;  1RRB A;  3QCA A;  3IFW B;  3DBR I;  4HK2 A;  2PEA A;  2KKC A;  2C7N B;  1V49 A;  2Y5B B;  5DCN A;  4FAD A;  3T8M A;  2IY1 B;  2IYD B;  4FN2 A;  2LGD A;  2R2Q A;  1WGR A;  1S3S G;  2HJ8 A;  3VH4 B;  3QA8 A;  2G4D B;  3I3T B;  3PPA A;  4ZRI A;  2N1W A;  4WJN A;  3KVF B;  3W1Y A;  3U7D A;  5DPR A;  3ZLZ A;  4TKN A;  4KZ0 A;  2N4F A;  4FJZ A;  4G3X B;  2KLG A;  4IM0 A;  2KO3 A;  1WMH A;  4MH0 E;  4I6L B;  2XBB C;  1UH6 A;  4GGQ A;  3QAQ A;  2NVU I;  2LRU A;  3RZF A;  4NPN A;  3L08 A;  4FUL A;  2K8B A;  2PE9 A;  3UGB B;  4EZL A;  4K7W A;  5EDS A;  3UIN B;  1WX7 A;  2BKF A;  4KDI C;  4BVU C;  2DZK A;  1WX8 A;  2Z0D B;  3DBL I;  4MGI E;  3A9J A;  5LXH A;  2D11 A;  3DVN U;  2G4S A;  3MTN B;  2PPH A;  3TMP B;  3K9O B;  5CTR C;  2WDT B;  4PYU A;  2GMI C;  4KZC A;  2GBJ A;  4JLC A;  4JIO U;  4TQ0 A;  3R66 C;  3SU8 X;  2KTR A;  1YQB A;  2LZ6 A;  2IY0 B;  3JSV A;  3WAL A;  2M4N A;  4IWO A;  4RM9 A;  3Q3F A;  4LJO B;  2K1F A;  1SIF A;  2KX3 A;  4MJS A;  2ZCC A;  2G3Q B;  3V60 A;  2LVP A;  3H9D A;  2YLM A;  3HM6 X;  3L17 A;  3PRM B;  4MGK E;  2MLB A;  2RSU A;  2NCN A;  4NQK E;  2MX2 A;  2JRI B;  5LXI B;  2FIF A;  4HCP B;  1VCB A;  1E7U A;  3ML8 A;  2ZJD A;  4FHK A;  3DBS A;  4PS3 A;  2BGF A;  3ENE A;  5DPS A;  1WYW B;  1OTR B;  3TCA A;  2HE7 A;  2R2O A;  4AOF A;  4EOY A;  1I35 A;  3VVW B;  4WWN A;  2MA9 B;  1X1M A;  1P98 A;  1YX6 B;  2V1Y A;  3TJP A;  3ZNZ B;  1WE7 A;  2JY6 A;  4IM3 A;  2AEH A;  1TBE A;  2L7R A;  2KMA A;  2L0T A;  2AYO B;  2O6V D;  3IBE A;  1WMH B;  4F8C B;  3CSF A;  3AXC A;  1UBQ A;  2MBH A;  1Q1O A;  3LJ3 A;  5BO4 B;  4TV3 A;  1H8C A;  5JHA A;  3C0R B;  1HE8 A;  5D2M B;  4KV2 A;  1E8X A;  2PE6 B;  2MP2 A;  2JF5 A;  1TTN A;  3GOE A;  2EKE C;  2REX A;  2K8C A;  3L16 A;  1KOT A;  2K6Q A;  2C9W B;  1Q0W B;  4XZ4 A;  3PHX B;  4HXD A;  4FLH A;  3W1S A;  2LGX A;  3A9J B;  3KUD B;  2M8S A;  1UD7 A;  1H4R A;  3KH0 A;  4W9G A;  5KHQ A;  2KJR A;  4BOS C;  3SD5 A;  1KJT A;  1RFA A;  4URK A;  2FID A;  2KTR B;  3PS6 A;  4W9L A;  3JSV B;  4WJP A;  4B95 A;  4GMV A;  2MBE A;  3ZTD A;  3OLM D;  3VDZ A;  4MJS B;  2DZI A;  4G11 A;  3Q3J A;  4NY0 A;  3PZD A;  2GBM A;  1UBI A;  1J19 A;  3VUY A;  5E6N A;  4K7U A;  2KFJ A;  1Y8R C;  1ZW7 A;  2I1K A;  2KDF B;  1WX9 A;  4IW0 A;  4MEM A;  4AP4 C;  2FCN A;  2BF8 B;  4ZYN A;  2KQ7 A;  3VQI A;  2C7M B;  2LUE A;  2KNB A;  4FJY A;  4GXB A;  1TGZ B;  3EFU A;  2KDE B;  3SDL C;  5HKH A;  2L3Z A;  4NAW A;  2FUH B;  2JVC A;  4ZRK A;  3JW0 X;  4WAA A;  3QIJ A;  1ZKH A;  2ZPN A;  1YD8 U;  3NHE B;  4M0W B;  3NZS A;  2DYB A;  2KC1 A;  3IHP C;  1K8R B;  4BFR A;  5E6O A;  2CKH B;  2LVO A;  4NQL B;  2DAJ A;  2D07 B;  3VUW A;  4CO7 A;  1LXD A;  3CST A;  5J2R A;  3A4R A;  2MP2 B;  4W9H A;  4EUT A;  2D10 A;  2LWP A;  1P3Q U;  5AEK B;  3ZRF A;  2A4Z A;  5AZG A;  2C60 A;  1C3T A;  3KYC D;  2KFK A;  1WI0 A;  4ASW C;  3DDC B;  4ICU A;  1WJU A;  3PSE B;  2RPQ A;  4E3C A;  4EEW A;  2JRH A;  1Z2M A;  4ICV A;  4A3P A;  4K7S A;  3K9P B;  1S1Q B;  2NS5 A;  3HIZ A;  2N9E B;  5L83 A;  4EFO A;  3PHW B;  3PLU A;  4PS7 A;  1XQQ A;  2BYF A;  3VXW A;  4MEL A;  2PJH A;  1IPG A;  3UIP B;  2BWF A;  1RAX A;  2Z59 B;  2KX0 A;  2YVC A;  2J0J A;  3PLV A;  4DHJ D;  4X57 B;  2KJH B;  1V81 A;  1L7Y A;  2O6V A;  2MBO A;  3B1L X;  3L0W B;  4IWP A;  4LCD E;  4IUM B;  1WZ3 A;  3ZIM A;  1ISN A;  2M17 A;  2WWZ A;  2NBV B;  2J7Q B;  2NPT B;  2CU1 A;  1EF5 A;  3NY5 A;  2IBI B;  4NAW B;  4WJO A;  5CHW A;  2A5U A;  4B9K A;  1V2Y A;  2IO1 B;  2LGY A;  3M3J A;  4GOC A;  4OVU A;  1T0Y A;  2JPH A;  5DPT A;  1E90 A;  3ALB A;  3APC A;  2VRR B;  1XD3 B;  2XK5 A;  3PT2 B;  3LDZ E;  2MQJ A;  4WJQ A;  2I1J A;  5G55 A;  4PYZ A;  3RCZ A;  1E8W A;  3M62 B;  3PRP B;  4G50 A;  3SHQ A;  1WJ4 A;  2ZPY A;  4GSW A;  4IM2 A;  3BIN A;  2M0X A;  5TR5 A;  4KDL B;  5GMV A;  3ECI A;  3IVF A;  2KOX A;  2FCS A;  1YX5 B;  2QHO A;  4GN1 A;  4II3 B;  1E7V A;  1YJ1 A;  2C5L C;  4ANW A;  2KFK B;  3R7R A;  2KVR A;  2WX1 A;  3KUZ A;  4W9D A;  2DZJ A;  2G45 B;  1M94 A;  1WF9 A;  2CS4 A;  1I42 A;  1UZX B;  2J0K A;  1UGM A;  4WWO A;  3EEC A;  1NBF C;  3VAW A;  2DYM A;  3M63 B;  2NR2 A;  4KIK A;  2DEN B;  3QAR A;  2K8H A;  4MSM B;  4NJ7 A;  2LVQ A;  1G6J A;  1AAR A;  3H7S A;  5JH5 C;  3R3M A;  2N9X A;  2WX0 A;  5G2N A;  2RGF A;  3PV1 A;  4KSL C;  1C1Y B;  4ANU A;  1V86 A;  2KZR A;  1QZE A;  4CYE A;  1E5W A;  2GBR A;  2V3S A;  1WXA A;  4W9K A;  3H6N A;  2N9P C;  2DX5 B;  4WWP A;  2O6V B;  3VH3 B;  3WA0 A;  2CHZ A;  3DPD A;  4EZJ A;  3V61 A;  1V80 A;  1GC6 A;  1WGD A;  1WJ6 A;  1YIW A;  2KWV B;  3ZNI D;  4HVB A;  1WXV A;  2L0F A;  2OOB B;  1NDD A;  2B3A A;  3V6C B;  2FCQ A;  3TIX A;  3APF A;  4AUQ C;  4MGZ E;  5IA7 A;  2MW5 A;  4MM3 A;  2V4L A;  4M8M A;  3EC8 A;  4HCN B;  4GIV A;  4RMA A;  1BT0 A;  3RZW C;  2ASQ A;  4BOZ B;  3ML9 A;  3QX1 A;  3MJW A;  4DK5 A;  5CHV C;  2FCM A;  2XEW A;  2XK5 B;  1L2N A;  5KHO A;  4LDT D;  1UEL A;  2MSE D;  3S2A A;  2MCN B;  5DPW A;  4ANX A;  4AJW A;  4MSQ B;  4ANV A;  4W9I A;  4LDT B;  3RD2 A;  3ZKJ C;  1A5R A;  2RR9 A;  1GUA B;  2ZEQ A;  3EHV A;  5CX3 A;  3ZVV A;  3N3K B;  5D6J B;  1SE9 A;  2LXC A;  1OQY A;  2UWQ A;  3TBL D;  1ZGU B;  3VHT C;  5E6P A;  4YL8 A;  5LLI A;  4NJ6 A;  3UF8 A;  2JZZ A;  3JVZ X;  1V5T A;  2MBB B;  1WR6 E;  2IZV B;  1P0R A;  4KIK B;  1TZ1 A;  5AZH A;  2K25 A;  3KW5 B;  2ZCB A;  5D94 A;  1WM3 A;  2EMS A;  2GBN A;  2ZVO A;  1OGW A;  4P7I A;  3O65 B;  1LFD A;  4PS8 A;  2CHX A;  3UQB A;  3BY4 B;  4HPL B;  5AZF A;  2BYV E;  3VTW A;  2FAZ A;  3HK0 A;  2JZ3 B;  4BBN F;  3DOW A;  1EUV B;  3UIO B;  3CMM B;  2FNJ B;  3KYD D;  2BKR B;  2KN5 A;  2BPS A;  4I6N B;  2MBQ A;  2HTH A;  4WQO B;  2IO2 B;  3VTU A;  3QQ8 B;  5C23 A;  3RUL A;  4KVG B;  3B0A A;  3KUC B;  3H7P A;  4I6P A;  2DAF A;  4GB9 A;  3ZNH B;  3WAO A;  1WY8 A;  4FJV B;  2AL3 A;  2N7D A;  3WIM A;  3P2B A;  4B6W A;  1WXS A;  4GDK A;  4NNJ B;  3RYT A;  1GJZ A;  1WE6 A;  4GU2 A;  4JL9 A;  3A4S C;  2LXA A;  2K6D B;  2ZVN A;  4HDO A;  5CHF A;  1P1A A;  2BWE S;  1WXM A;  4FHJ A;  2L05 A;  1WJN A;  3V6E B;  4AJY B;  4MGY E;  4W9J A;  2GOW A;  4DHJ B;  3W1S C;  2LJ5 A;  2KAN A;  2C7H A;  3VUX A;  4OVV A;  2KK8 A;  2W9N A;  5J18 A;  2DYO A;  1WRD B;  4M8N A;  3NS8 A;  2UYZ B;  1NI2 A;  2JXX A;  4KSK C;  3TL5 A;  3ZTC A;  3U30 A;  4F7Z A;  2KWC A;  3PVL A;  2GBK A;  3L10 B;  2IO3 B;  3MHS D;  2DZM A;  2J0M A;  4JQW C;  2RD0 A;  4FA6 A;  3DVG X;  4DBG A;  1R4M I;  2JWZ A;  2EMT A;  3A9K A;  3L13 A;  2AWT A;  1WZ0 A;  3V62 A;  1V9J A;  5J17 A;  3OJ3 A;  1LQB A;  3AU5 A;  4BKS D;  2N1V A;  4HJK A;  1XT9 B;  2LAS A;  2MWS B;  2KQS A;  4BBN C;  4DDG D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...