1YQBA

Human ubiquilin 3
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
88
structure length
88
Chain Sequence
SGLVPRGSPHLIKVTVKTPKDKEDFSVTDTCTIQQLKEEISQRFKAHPDQLVLIFAGKILKDPDSLAQCGVRDGLTVHLVIKRQHRAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquilin 3
publication title The Ubiquitin-like domain of Human Ubiquilin 3
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 20
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2005-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1yqbA01
1WR1A 3DCGA 4CYEA 3V62A 2N4FA 3QA8A 3T9LA 2ZNVC 4E71A 2KDFB 5JH5C 3A33B 5FR6A 2NBUA 2RD0A 1ZW7A 2NVUI 3CMMB 1WH3A 3R66C 4IWQA 2N7EA 4MGKE 2CHZA 1KM7A 3ONSA 4FJVB 4LJOB 4KVGB 3AULA 3VUXA 1WY8A 4HDQA 3IVFA 3EFUA 3QQ8B 3A1QB 3AU4A 4F8CB 3NY5A 3RYTA 3V6CB 2ZPYA 5BO4B 2LZ6A 4XC2A 4W9FA 5IAAC 2NR2A 2AWTA 2GBKA 2D3GA 2MWSB 3S2AA 2D11A 2KK8A 2LXAA 2G45B 2JZ3B 3HK0A 3L08A 1UD7A 2KNBA 2IY1B 2N1VA 2IZVB 2DX5B 5IA7A 4FJZA 2LI5A 3C0RB 4G50A 4ZYNA 4RMAA 1E90A 3Q3JA 2MBQA 4BKSD 1H8CA 3OJ4B 3ZNHB 3M95A 2PJHA 4KZCA 1WGDA 2ZPNA 4RM8A 1WXAA 2JZZA 1G6JA 3UQAA 4EZKA 1WGHA 2LJ5A 4F1SA 3VTWA 1XD3B 1WIAA 2KTRA 2GMIC 4TKNA 2JPHA 3VTVA 1WFYA 2BF8B 3QWZB 4WAAA 1T0YA 4GSWA 3RZWC 2O6VA 5JHAA 4B6WA 4DHZB 3A4RA 5DPRA 4PS8A 2XBBC 3DPDA 2LVOA 3PRPB 2O6VD 4JIOU 3ALBA 1A5RA 1WE6A 1BT0A 1WJUA 2DYBA 2K39A 1P3QU 4EOYA 4K1RB 1TTNA 3D32A 1GC6A 1RFAA 4ASWC 1L2NA 4II3B 3WAOA 2K6DB 1E8YA 2KJ6A 3GZNI 1WYWB 5AZGA 3V61A 1OQYA 2OOBB 1FXTB 3EC8A 3R7QA 1SE9A 1ISNA 1V5OA 3DVGX 1OGWA 1IPGA 3VFKA 2WWZA 1LQBA 2RPQA 5TR5A 2IBIB 1WM2A 1F9JA 2NS5A 3IBEA 4W9JA 2FNJB 2DZIA 4HPLB 2LVPA 4AOFA 5J18A 1SGHA 2UWQA 5J17A 2O6VB 4RM9A 2J7QB 2MA9B 3U8ZA 3V6EB 4GDLA 4K7UA 4JQWC 1P9DU 2MCNB 2AYOB 1R4NI 5CHFA 2FCQA 3HIZA 3JSVA 1WR6E 3PGEA 2NPTA 2ZVNA 4TQ0A 3KUZA 3B0AA 3L13A 4KZ0A 2DHZA 2R2QA 2JVCA 2PEAA 5J2RA 3VTUA 3QJZA 3N32A 3RD2A 2OJRA 2K8BA 3N3KB 4AP4C 2N1WA 3AU5A 3PLVA 2G4SA 2BKRB 2KTFA 2MBEA 5JZEB 2DYMA 2KWUB 4EZLA 3ZVVA 1E5WA 2KANA 2KVRA 1KJTA 4A20A 4BOSC 2GBNA 1J19A 2AL6A 3KUCB 4BKGA 1S1QB 2JRHA 2REXA 2JXXA 2JT4B 4WJOA 2FAZA 2N9EB 2ZCCA 3L10B 1WI0A 4KIKB 2JWZA 3A1QA 3TIXA 1V5TA 2KN5A 3H9DA 2L00B 5KHOA 3I3TB 5DCNA 2NBVB 4MM3A 4X57B 4PYUA 1WE7A 2BYFA 2N9XA 4OVVA 3ZDTA 3APCA 5EDSA 1WX8A 3VH4B 4DWFA 1P1AA 1WJ4A 1Q1OA 4NJ6A 4AUQC 4GOCA 3ZIMA 2CHXA 1S3SG 1OEYA 2DENB 3PLUA 1P0RA 2IO0B 3DBHI 4K7SA 2XEWA 4GU2A 4TUUA 3RZFA 1CMXB 4IM2A 3L0WB 3X0WA 4LJPB 3DDCB 3VH3B 5HKHA 1ZGUB 1GNUA 4WWOA 2LGXA 3KW5B 2N9PC 2YLMA 3KYDD 3SU8X 3OAWA 4W9DA 3IG3A 4HXDA 1X1MA 2C7MB 4MJSB 2M17A 5G55A 4EUTA 3NHEB 4FADA 2AEHA 2MQJA 1YX5B 3AXCA 2IO2B 1XQQA 1U4AA 3PPAA 1TBEA 3V60A 1V81A 2L7RA 2MW5A 4K7WA 3QK0A 2QHOA 3VUYA 4G0NB 2C60A 4DHZE 1GG3A 4XX5A 5E6PA 3OJ3A 4HCNB 3OLMD 2DYOA 5LLIA 1RAXA 4E74A 2L3ZA 1Z5SB 2LRWA 3ZNGC 1UBQA 5CHWA 4BKSA 2MRPA 5GMVA 2KLCA 1EF1A 2LVQA 2JUOA 1WJ6A 3RCZA 4IM3A 4G11A 4IG7B 1HE8A 1NI2A 4N9F4 1J0GA 4LDTD 3PVLA 4M0WB 3U7DA 4DXAB 4IM0A 1D3ZA 4NQLB 1I42A 2L76A 1V49A 3ZLZA 3SHQA 1E7UA 1LXDA 2M1MA 3O65B 2B3AA 4W9IA 2KX0A 2BYVE 3WIMA 3NZSA 3QAQA 1UH6A 2C5LC 2DAFA 3MJWA 4I6LB 3PV1A 5AZFA 1Q0WB 1ZKHA 2RSUA 2J0JA 3L54A 4NY0A 3KUDB 2C7NB 3VUWA 2BWES 2KDEB 4FBJB 1WX7A 3HM3A 4JGHB 2R2OA 3B1LX 1WM3A 2EMSA 3TCAA 2VRRB 2ZEQA 1P98A 3H1UA 4LDTB 1VD2A 2A4ZA 2IYDB 4HCPB 4AWJA 4ZRJA 4MGYE 3A9JB 2ZCBA 1Z2MA 3LDZE 2FIDA 4NPNA 1RRBA 3RULA 3MTNB 4DBGA 5C1ZA 3UIOB 1EUVB 4GXBA 2KDBA 3UIPB 4TV3A 3ZRCA 1NDDA 3RUIB 3AI5A 4KIKA 3GOEA 4A3OA 2DZJA 3ZTDA 2RGFA 1WGRA 2ZJDA 1KLVA 1Y8RC 3QX1A 1KOTA 2LD9A 1LM8B 1PQSA 2DAJA 2IY0B 2JY6A 3JVZX 4HVBA 1WXVA 2G3QB 4G3XB 1WXMA 2BYEA 2C9WB 4DDGD 2O2VA 2KMAA 1JRUA 2ZZPB 4W9HA 2LGYA 3PS6A 4IUMB 4DHJD 4XZ4A 3H7PB 4ANUA 4BBNF 5AZHA 2PE6B 4MJSA 2D07B 3B08A 3UINB 4BFRA 2HTHA 1YX6B 3PZDA 2KLGA 3CSFA 4ZRKA 1R4MI 4MH0E 1GUAB 2CKHB 4ZRIA 4ICUA 3QCAA 4MGIE 4YL8A 2IO3B 1WZ3A 2DZKA 2FUHB 5CTRC 4ANXA 2GBJA 3WAPA 4II2B 4GN1A 2FCMA 3EHVA 1L7YA 3DBSA 2JRIB 3DVGY 2KFJA 5LXHA 1SIFA 3HHMA 4A3PA 4JL9A 2Z0EB 2L0TA 2O2VB 2PE9A 4DHJB 3VAWA 2MSED 3ENEA 4FULA 3WAMA 1K8RB 4WWNA 3T8MA 4BBNC 1EO6A 5E6OA 2K8CA 4CHKA 1E8ZA 1Q5WB 1V80A 2KO3A 3DOWA 5DPWA 2A5UA 3MHSD 4WJPA 5E6NA 3R3MA 3SD5A 1YJ1A 2LUEA 4KDIC 1MG8A 2NCNA 3PRZA 2KC2A 3A9KB 2CHWA 2N7DA 1TZ1A 2KJRA 4WQOB 2KC1A 2KWVB 4GDKB 4B95A 1C1YB 2CU1A 2K8HA 2IO1B 3ECIA 4FHKA 1J8CA 3RT3B 5L83A 2HE7A 4HLEA 4NAWB 4W9EA 1IP9A 4KSKC 2PPHA 2V4LA 2WYQA 3VHTC 2KQ7A 2Z0DB 3W1SC 2RR9A 2CS4A 4HJKA 4KV2A 2GBMA 4AJYB 3ML9A 2WX1A 3A9JA 2BWFA 5AEKB 2XK5A 3P2BA 2D10A 3WA0A 1QZEA 4MELA 4MSQB 1E8WA 4NJ7A 4PYZA 4ANWA 3KVFB 3PSEB 2BPSA 4LCDE 2DZMA 1YIWA 3QARA 3ZDMC 3BY4B 3VQIA 3VXWA 3ZTCA 3CSTA 2NBWB 4FJYA 4HK2A 2LXCA 4WJQA 1NBFC 4KSLC 4M8NA 2KFKA 3SDLC 3HM6X 2KZRA 2FIFA 2LGDA 3WANA 1V9JA 2K1FA 1RLFA 2ASQA 2KHWB 2WX0A 4I6NB 5D7GA 4MEMA 2KXJA 3DVNV 2CR5A 3QC8B 2Y5BB 3N30A 1GC7A 3Q3FA 2Z59B 4FA6A 1IYFA 3M62B 1UELA 3H6NA 3PT2B 3ZRFA 3H7PA 2XK5B 3DVNU 2KMCA 2UYZB 2GBRA 1YQBA 4EFOA 1WMHA 4PS3A 4F7ZA 1V2YA 2C7HA 3TBLD 4WWPA 1WX9A 3PRMB 3UGBB 5KHQA 1OEYJ 3ZNID 2L05A 3K9OB 1UGMA 2I1JA 3M3JA 4W9LA 2BKFA 1AARA 1UBIA 4GMVA 4IW0A 3TL5A 2LWPA 3TMPB 3NOBA 1WF9A 3DQVA 2EMTA 4NNJB 2HD5B 4M8MA 2AL3A 2KFKB 2KX3A 3A4SC 2KD0A 3IFWB 3U30A 4EEWA 5D2MB 3BINA 2JF5A 3LJ3A 4CO7A 1E7VA 4MSMB 3UQBA 2MBOA 4URKA 4W9KA 5DPSA 3X23A 1UZXB 3DBLI 1M94A 4IWOA 3VVWB 3UF8A 4ZDVA 2KKCA 1LFDA 3EECA 1WXSA 2MP2A 2D2QA 2YVCA 4JLCA 1WZ0A 4GGQA 4W9GA 1WRDB 3W1YA 3PTFC 3WALA 2J0MA 2KTRB 4MGZE 2G4DB 2FCNA 3JYUA 4KDLB 3VDZA 1WJNA 1E8XA 2MX2A 1VCBA 1I35A 2KJHB 3JW0X 4WJNA 2M4NA 3CF6E 3PHXB 4PS7A 3TJPA 1WGGA 3NS8A 1WMHB 3IHPC 4TQ1A 4EZJA 2V3SA 4NQKE 3ZW3A 3W1SA 1WGYA 4ICVA 4FLHA 2KQSA 4HDOA 1C3TA 2LASA 2M8SA 3A9KA 4DK5A 2FCSA 1TGZB 4I6PA 1GJZA 1YD8U 2MBBB 3NZUA 4GDKA 3ML8A 3DBRI 4K81A 1V6EA 5D94A 2HJ8A 1XT9B 3QIJA 1EF5A 4MDKE 2EKEC 2I1KA 4GB9A 4DDID 4HWIB 4BOZB 3L17A 5CX3A 4P7IA 4NAWA 3PREA 4B9KA 4IC7B 3M63B 4IWPA 2GOWA 2ZVOA 4J6IA 3ZUNA 2MP2B 2MBHA 3QHTA 3H7SA 3ZO5B 4E3CA 3KH0A 2L0FA 2KOXA 2ZNVB 2MLBA 1H4RA 4GIVA 2M0XA 2V1YA 3L16A 3APDA 5CHVC 4HPMB 4W9CA 2W9NA 3KYCD 1V86A 1OTRB 5L95C 2LRUA 2K6QA 4GDLB 2K25A 4ANVA 5LXIB 2BGFA 3JSVB 5DPTA 5C23A 3ZKJC 5JHBA 2NPTB 2WDTB 4FN2A 4AJWA 2KDIA 2J0KA 4FHJA 2KWCA 3K9PB 3ZNZB 4BVUC 5D6JB 2L8JA 5G2NA 3PHWB 3APFA 4OVUA 3R7RA 4BKTA 4EKUA
chains in the Genus database with same CATH superfamily
4HKQA 5JH5C 2ZNVC 2KDFB 3T3NA 2NVUI 1Y56A 5JXVA 1WH3A 3R66C 4IWQA 1YN4A 2N7EA 3VUXA 1WY8A 1JMLA 3QQ8B 1YQ3B 3AU4A 3NY5A 3V6CB 2ZPYA 3ZQ4A 2LZ6A 4KGSA 4W9FA 3NG0A 3P4QB 4MM3B 2GBKA 3OG5A 1GB1A 2D11A 2KK8A 2JZ3B 2X38A 3EGRA 5BMGA 3C0RB 4G50A 2IDYA 2WLBA 3U7ZA 4KZCA 1WGDA 2ZPNA 1HTOA 2JZZA 1G6JA 4RGTA 5AUIA 3UQAA 1PYWD 2WXRA 4M02A 2BF8B 3QWZB 4WAAA 1EM7A 4B6WA 2LFIA 3A4RA 5MPOA 1KTKA 4XWTA 1WE6A 3C19A 3FAHA 1L0YB 1FFVA 1P3QU 2QCZA 1RFAA 2D3AA 1L2NA 2WXPA 1C4PA 3Q8BA 2G9HD 2L1AA 2KJ6A 1E8YA 2AX5A 1WYWB 3V61A 2XNAC 3EC8A 1CQVA 2DWQA 4AS1A 5G5GA 1IPGA 2WWZA 1ZOYB 2IBIB 1WM2A 3IBEA 4HPLB 1SGHA 2J7QB 1P9DU 1FXAA 1EU4A 1R4NI 2RMMA 3AEFB 4XDDA 2R2QA 4A90A 2M56B 3AH7A 3QJZA 2BS2B 2OJRA 4S17A 4ZRQA 2KWUB 2BS3B 1QOAA 1KJTA 4BOSC 1T0SC 3BWUD 2JRHA 2REXA 2JXXA 3AE8B 1TT5B 2ZCCA 3L10B 2L00B 5KHOA 5DCNA 4X57B 4MM3A 4PYUA 1WE7A 3ZDTA 5EDSA 3RFZB 1WJ4A 1Q1OA 1SF0A 2CHXA 1DOXA 4P1CC 3MC0B 2DENB 1P0RA 3NJTA 2XEWA 4LJPB 3Q8CA 1GNUA 1D5XC 2LGXA 1N60A 1T6BX 3IG3A 3BYTB 1X1MA 5G55A 3IAM1 4FADA 2AEHA 2MQJA 1WYGA 5FR3A 1U4AA 1TBEA 2BVCA 1V81A 1FNVA 3AMZA 1PDXA 1I4GA 3VUYA 4TMAB 2QSDA 3OJ3A 3W9CB 1E7PB 1C79A 4YTMB 1Z5SB 4BKSA 4AQ7A 2KLCA 2JUOA 4G11A 2MJ3A 1HE8A 4N9F4 1TIFA 3PVLA 4M0WB 2ONQA 1V49A 3ZLZA 1QOFA 1SXTA 3O65B 1ESFA 2WXJA 1PUTA 1WGKA 3NZSA 2QIEB 5AZFA 1Q0WB 3DHIC 1JWBD 2C7NB 3BIID 2KDEB 5EE3A 2EMSA 2OEDA 3TCAA 1D4BA 3H1UA 2KDMA 1UNSA 1VD2A 4HCPB 2ZCBA 4LK0M 1Z2MA 3LDZE 3RULA 3MTNB 3UIOB 2KDBA 4TV3A 3ZRCA 3DWMA 1R4NB 2JYEA 4A3OA 2M19A 2HJ1A 1I4HA 1BMLC 1PQSA 2JY6A 1J7CA 3IAS1 1HZ5A 1WXMA 5GXGB 2O2VA 4DHJD 3WCQA 3H7PB 5AZHA 1E9MA 3R8BA 4UDUC 1N63A 3PZDA 5EE9A 3I9V1 3TEZA 1SE3A 1V1OA 2CKHB 2MEKA 4ICUA 3QCAA 1QOGA 4YL8A 4US9A 1WZ3A 2FUHB 2ON8A 5H92C 2GBJA 1RYJA 4II2B 2WP9B 4H2AA 3HHMA 2RDBC 2L0TA 2MSED 3ENEA 4FULA 4WWNA 3TEYA 1EO6A 5G5HA 1PFDA 3TEWA 4M0WA 5DPWA 2A5UA 3MHSD 4WJPA 1XCQL 1MG8A 2CU3A 2NCNA 3A9KB 3KWVA 2CU1A 2DNFA 1VZ8A 3AE9B 2PPHA 2WYQA 4JE3B 1XEEA 3P1MA 2Z0DB 4B0MA 3I5JC 3EUB2 5AEKB 2DBYA 3P2BA 1N5WA 3WA0A 1I4PA 2K22A 4MELA 4ANWA 3PSEB 5EE0A 3QARA 2UU7A 4WQMA 3BY4B 3VXWA 1L5PA 2PMVA 4HK2A 2NTTA 4KSLC 4HROA 1KLUD 2FIFA 3FILB 2LUMA 2KHWB 3ZJTA 3AEAB 2KT7A 2Y5BB 2L83A 2WXGA 2Z59B 1UELA 3H7PA 3DVNU 4EFOA 1V2YA 1WX9A 4M00A 3UGBB 1T5XD 5KHQA 1OEYJ 4RGMA 2L05A 3Q3NC 1UGMA 2BKFA 3TL5A 5T8IA 4XGAB 2EMTA 1A70A 2GI9A 2KD0A 3U30A 1SEBD 4CO7A 2JF5A 2L52A 3X23A 2J53A 2BQQA 4ZDVA 1LFDA 3Q6BA 2J42A 2MP2A 3DHGC 1WZ0A 4GGQA 3WALA 1I35A 1YN3A 3TSSA 3TJPA 2M4NA 3CF6E 2YEPF 3IHPC 2V3SA 4L23A 1F52A 2YEPB 3DBRB 4FLHA 1CJEA 1ROEA 2LASA 3A9KA 4M01A 1GJZA 3NZUA 3NUHB 1V6EA 2D5GA 3QIJA 2INCC 3MC9A 4DDID 3RNCC 1ENFA 3M63B 2GOWA 2ZVOA 2MBHA 3ZO5B 4E3CA 3BVGA 2RDHA 2AQ3B 1T0RC 2W9NA 5L95C 2LRUA 2K6QA 2KAJA 4R3DA 4ANVA 5LXIB 3ZKJC 2QDFA 2NPTB 4FN2A 3ZNZB 2WXOA 2L8JA 5G2NA 4BKTA 4EKUA 3AE3B 4E71A 1FPYA 2NBUA 3FILA 3NRZA 4LNKA 3URYA 1QOBA 1I4XA 4KVGB 3HVZA 2JU6X 4XC2A 2NR2A 2MJEA 2H89B 3LXFA 2MWSB 3S2AA 2G45B 4ARIA 1UD7A 4N6EB 2IY1B 2N1VA 3RNEC 4L1BA 2XN9C 4BKSD 2QJLA 3AE7B 4LNIA 3M95A 4RM8A 1WGHA 4F1SA 1FRDA 3VTWA 1XD3B 1WIAA 2GMIC 2JPHA 3VTVA 2PVGC 1YOVB 4GSWA 2O6VA 5JHAA 2INPE 4B0EA 2XBBC 3V3XA 1BT0A 3D32A 3WAOA 1L6VA 1OQYA 4C7YA 1FXTB 1SE9A 1ISNA 1OGWA 1LQBA 3AEEB 2NS5A 2FNJB 4AOFA 3I63C 5J18A 5J17A 3W2DA 2I2YA 3U8ZA 2MA9B 3B2GA 4JQWC 2N9LA 2MCNB 1JROA 1D5MC 1UWMA 3PGEA 1MG4A 2NPTA 4KZ0A 3L13A 2GLSA 2PEAA 3N32A 3RNBC 4DXFA 2K8BA 1NVID 2WXQA 4AP4C 3AU5A 2G4SA 2BKRB 2KTFA 3IT4B 2MBEA 4EZLA 4A20A 1J19A 3KUCB 1S1QB 4WJOA 2N9EB 5FKAC 3TIXA 1WI0A 4RCOA 1F1HA 1B9RA 2NBVB 3MHZA 1WX8A 4DWFA 4YTPB 1P1AA 2W3SA 4AUQC 3LYYA 1S3SG 4WAFA 4YXDB 3DBHI 4TUUA 1P7EA 1ZDXA 4IM2A 3DDCB 1VJKA 2N9PC 2YLMA 1ZDVA 3AEGB 3SU8X 4XYCA 2E6XA 3AN1A 1N5XA 1N6ZA 3H8HA 1YX5B 4LTUA 1XQQA 2QHOA 1KFYB 2W55A 5HHDG 2IJ0A 1FXIA 5E6PA 2K0PA 3GB1A 3OLMD 4HCNB 2DYOA 5AUKA 1RAXA 3AM9A 3NVYA 3TEXA 2L3ZA 3ZNGC 2LRWA 2LJIA 5GMVA 1NYRA 1EF1A 1WJ6A 4IG7B 1UGJA 2J4XA 1QKZA 4US8A 1ZUD2 4DXAB 1I42A 1ZXIA 2W3RA 2PTLA 2PW9A 2M1MA 3N1ZC 4W9IA 3WIMA 4YT0B 4I6LB 3PV1A 3LB8C 3L54A 1FNWA 1E10A 3Q69A 3VUWA 2BWES 1TKYA 1WX7A 3HM3A 2R2OA 3B1LX 1HEZE 3BVMA 4LDTB 2FBWB 2IYDB 4AWJA 2D3BA 1JWMD 3A9JB 4RH6A 4J3OD 4NPNA 1RRBA 3FC4A 1YJIA 4JWSC 1YMHE 1NEKB 2RGFA 1WGRA 2ZJDA 1KLVA 1KOTA 2LD9A 2MH7A 2IY0B 1YQ4B 4HVBA 5IOIA 1JWSD 2IPKD 2ZZPB 4W9HA 3PS6A 4XZ4A 4BBNF 4ARCA 1FNUA 2PE6B 1R4MB 2IGHA 2D07B 3UINB 4BFRA 2KLGA 2TSSA 4ZRKA 1HQRD 1ACCA 4PK1A 1JCKB 4ZRIA 4MGIE 4MH8A 2MHJA 2IO3B 4ANXA 3DBHB 4WURA 1V8CA 3EHVA 1N62A 4L2YA 1SIFA 4XWWA 4JL9A 2Z0EB 2O2VB 3VAWA 3WAMA 1V80A 2INNE 2V3PA 3BZDB 3ZGZA 1FMAD 5E6NA 2EELA 3R3MA 3SD5A 3PRZA 2KC2A 2N7DA 3N9YC 4WQOB 2KC1A 3CWIA 2LEKA 4GDKB 4RGOS 3VR9B 5BYQA 2QMTA 3B2FA 3P4SB 4HLEA 4W9EA 4HKZE 2KQ7A 4JPSA 4KV2A 3J9CA 2GBMA 3ML9A 3A9JA 2XK5A 2KYWA 2WU5B 1UF0A 4CHKA 4MSQB 1E8WA 4KKJA 3IXSA 3ZDMC 2WDQB 2NBWB 2LXCA 4IOIE 5BYSA 4WJQA 4M8NA 2KFKA 3SDLC 2IGDA 1TS2A 3WANA 1C77A 2K1FA 1RLFA 2ASQA 2KXJA 1K51A 1R7SA 4O1NA 1GC7A 3M62B 4DQOC 3PT2B 1UWXA 2BB6A 3R2IA 4HRSA 1SJED 5HFYA 3L4PA 2GBRA 2WXKA 2C7HA 4WWPA 2WS3B 2Z8LA 3PO0A 4USAA 1MVKA 4GMVA 2LWPA 3NOBA 3DQVA 2HD5B 4M8MA 4IKGA 3A4SC 4EEWA 5D2MB 3BINA 3KQ4A 1PGXA 1E7VA 3UQBA 2MBOA 4W9KA 5DPSA 2KKCA 3EECA 4A8XC 2D2QA 3W1YA 2KTRB 4KDLB 3VDZA 3U2SC 1E8XA 1VCBA 4WJNA 4PS7A 3PHXB 1FCLA 1M4VA 4TQ1A 3ZW3A 3W1SA 4ICVA 2KQSA 2M8SA 4OZBA 3ZJUA 2FCSA 2MBBB 4GDKA 3DBRI 5D94A 1XT9B 1EF5A 4MDKE 3KLSX 4P7IA 1FM0D 3MP9A 2LGSA 3ZUNA 2MP2B 3QHTA 2GB1A 2L0FA 1OFFA 3KH0A 2ZNVB 2MLBA 4GIVA 3L16A 1WRIA 1V86A 2LHEA 4GDLB 1XO3A 2MJDA 3JSVB 5DPTA 1V1PB 4ZHPA 4AJWA 2KDIA 3K9PB 3APFA 4OVUA 1HXYD 3C8YA 4CYEA 3QA8A 3T9LA 2RD0A 1XLPA 2EKIA 1EWCA 1JALA 4FJVB 1XLNA 4A6QA 4HDQA 3IVFA 2KQ4X 4F8CB 3RYTA 3DHHC 5BO4B 4K3BA 2AWTA 2D3GA 4YSZB 1IGCA 1QILA 2LXAA 1NENB 2KNBA 1QQRA 3T3OA 2IZVB 1C4AA 2CJNA 2X8XX 5IA7A 4FJZA 4ZYNA 4RMAA 3VRAB 1H8CA 3OJ4B 3ZNHB 4GLSC 1WXAA 1L0XB 4RF0A 3U52E 2KTRA 4TKNA 1F77A 1IBXB 3RZWC 4RGNA 4XDCA 5DPRA 1TS4A 3DPDA 3PRPB 1C76A 3GZNB 1A5RA 2DYBA 4K1RB 4ASWC 2LHDA 3W5VB 4C56C 4OW0A 4HJGE 2OOBB 2KVZA 1JQ4A 3SEBA 3E56A 3R7QA 2JX5A 1KH0A 1V5OA 4WIPA 1TZOA 3AV8A 5TR5A 3P63A 1ZPSA 4W9JA 1TKEA 2LVPA 2O6VB 4RM9A 4REZA 3V6EB 3CIRB 1F2RI 2CJOA 1QF6A 4GDLA 3AB5A 2FCQA 3HIZA 3JSVA 3NVZA 1V1PA 1WR6E 2ZVNA 4TQ0A 3KUZA 3B0AA 2DHZA 1XXGA 3VTUA 3RD2A 4LNOA 5IKCM 3N3KB 1KF6B 2N1WA 2WXLA 4PT5A 1OQRA 1HTQA 2DYMA 4C4VB 3ZVVA 1E5WA 1ET9A 2KANA 2KVRA 3W5UB 1MFWA 2AL6A 1XLOA 2N0SB 2JT4B 2FAZA 3H9DA 2LGIA 4DXGA 2N9XA 2RDGA 4OVVA 1MJDA 3APCA 3VH4B 1RFKA 5IN7A 4NJ6A 3U4EG 1NYQA 3PLUA 2BBCA 4FXCA 4GU2A 1CMXB 3X0WA 3ETRA 4ACFA 3VH3B 2G1EA 4BAXA 3RNFC 1XF5L 4WWOA 3RI7C 4D2KA 3KYDD 3OAWA 4A55A 3HRDD 4MJSB 4EUTA 1XLQA 3AXCA 1IBXA 3V60A 2MW5A 4XX5A 2ZW1A 3N1YC 1LGRA 2MRPA 2IGGA 3Q3OC 2V3NA 1J0GA 4LDTD 4OZCA 3SFDB 1ZE3D 4IM0A 5HG2A 1D3ZA 2I38A 2L76A 4RNAA 2K3UA 2QILA 2V4IB 2AQ1B 1LXDA 2VZKB 1B1ZA 2KX0A 3QAQA 2RSUA 2J0JA 1FFUA 4NY0A 3KUDB 2NMQA 4FBJB 1WM3A 2BS4B 2VRRB 2ZEQA 4JX1C 3I57A 2N9KA 4MGYE 1IUEA 2J52A 4P1BC 2FIDA 4C4VA 4DBGA 3Q8AA 4CQNA 1EUVB 2WGSA 4ZYSA 1NDDA 4LLGM 3AI5A 2JQRB 4RFBA 3ZTDA 4EE2A 1K52A 1Y8RC 1FIQA 2JWUA 1LM8B 3JVZX 2G3QB 3NS1A 1HZ6A 2C9WB 2VH1A 3ZXRA 1JRUA 2JZPA 2LGYA 1VZ7A 3P4RB 2PLPA 1I4RA 2PIAA 3Q8FA 3E9SA 3RNGC 4MJSA 3P4PB 1YX6B 3HVDA 1MHXA 4C80A 3CSFA 2WDRB 1R4MI 1JW9D 2INDC 2DZKA 3WAPA 4GN1A 2FCMA 2JRIB 5LXHA 1GB4A 4A3PA 2E3TA 1CZPA 2PE9A 3T8MA 1YJJA 1I7HA 3GS2A 3AECB 2KACA 2LUEA 2CHWA 1TZ1A 3PZ8A 4N58A 1C1YB 2WXNA 3ECIA 2IO1B 3HUIA 2ZW0A 4FHKA 1J8CA 1CK1A 2V9HA 4WH4A 2HE7A 5L83A 4NAWB 2R61A 1IP9A 4KSKC 1FRRA 1TS3A 3VHTC 1FEHA 3SR6A 4HJKA 1JWUD 1AYFA 4AJYB 2WX1A 2BWFA 1SJHD 2LMCA 4PYZA 4NJ7A 2BPSA 4LCDE 1PGBA 2N7JA 2DZMA 1YIWA 5D3DA 1KRHA 3VQIA 2BTEA 3ZTCA 4FJYA 2L32A 4Q2JA 3HM6X 2LGDA 2Y5CA 4I6NB 5C2TB 3DVNV 2CR5A 3QC8B 5BYRA 1IYFA 3H6NA 4S0RA 2XK5B 2KMCA 2UYZB 1YQBA 4C00A 2SAKA 1WMHA 4PS3A 3N20C 1V97A 1VRAB 3ZNID 3K9OB 4NAMA 3M3JA 2I1JA 4W9LA 1AARA 3TMPB 2DLBA 3DBLB 4NNJB 1ET6A 4LNFA 2KFKB 3IFWB 1SIJA 1L4ZB 1WXSA 4JLCA 2YVCA 3BK2A 4KKIA 4YTNB 3PTFC 2J0MA 4EZKA 2FCNA 4YSXB 3JW0X 4NJCA 1C78A 3O13A 1IGDA 1L4DB 4NQKE 1WGYA 3Q3MC 1EU3A 4DK5A 3ML8A 4MACA 4K81A 3BK1A 2EKEC 2I1KA 4HWIB 1STEA 3L17A 4NAWA 3PREA 4ZOHC 4ZRPA 4IC7B 4B9KA 1UUPA 3MJ5A 1VR9A 3H7SA 2KOXA 2WXFA 2PKOA 2M0XA 3APDA 5CHVC 1JRPA 4W9CA 1OTRB 2WU2B 4NZLB 1TY0A 2K25A 2BGFA 5C23A 2QEJC 2WDTB 1DGJA 2Y3AA 3PHWB 1T3QA 1WR1A 3DCGA 1SE2A 3V62A 2N4FA 3A33B 1TYGB 2FE8A 5FR6A 1ZW7A 1DOYA 3CMMB 3NVVA 3RPFC 3SFEB 4MGKE 2CHZA 1KM7A 2AQ2B 2WDVB 3ONSA 4LJOB 3AULA 1VZ6A 1LO5D 3EFUA 3A1QB 5C3JB 3B9JA 5IAAC 5EE1A 1N61A 3HK0A 3L08A 2KN4A 2DX5B 1J7BA 1QT9A 2K5PA 2LI5A 1E90A 3Q3JA 2MBQA 4P16A 2H88B 2PJHA 2WQYB 3AE5B 2LJ5A 3N1XC 1AWDA 1WFYA 1T0YA 5TSSA 4DHZB 4PS8A 2LVOA 2O6VD 5HI1A 4JIOU 3ALBA 1WJUA 2K39A 3BYYB 4EOYA 1TTNA 1GC6A 2GRIA 4II3B 1SB3C 2JSVX 2K6DB 2WXMA 3GZNI 3AE1B 5AZGA 1YN5A 2WHIA 3DVGX 3VFKA 3GE3C 2RPQA 4YWGG 1VLBA 1F9JA 4HPPA 2DZIA 1TKGA 2UWQA 1K53A 3AE2B 1WSPA 2M0AA 1Q10A 4K7UA 2AYOB 4BZAA 5CHFA 1VDVA 4ITKA 2VH2A 2JVCA 5J2RA 1F2RC 3PLVA 1XCTL 5E6JA 3AE4B 1BXTA 2D3CA 5I4DA 2GBNA 3AEDB 4BKGA 4KIKB 2JWZA 3A1QA 1V5TA 2KN5A 3AEBB 3I3TB 1QLBB 2JYTA 2BYFA 2HDEA 3ZJVA 3MC8A 1F0ZA 1RM6C 4GOCA 3ZIMA 1OEYA 2IO0B 4K7SA 3GP7A 3RZFA 3L0WB 5HKHA 1ZGUB 1FCCC 2PVOD 4RF1A 3KW5B 4A9AA 5BMIA 2WNMA 1DOIA 4W9DA 4HXDA 2C7MB 2M17A 3RMKC 3NHEB 2IO2B 3R2TA 3PPAA 2BT6A 4K7WA 2L7RA 3QK0A 3UI3A 2BB5A 2VZKD 4G0NB 2C60A 4DHZE 1GG3A 3Q8EA 3OWEB 5LLIA 3NZ3A 1OQQA 1TY2A 4E74A 1UBQA 5CHWA 1ZP0B 2JXTA 2LVQA 3RCZA 4IM3A 1NI2A 4KX6B 4ZHOA 3U7DA 4NQLB 1K50A 1C9FA 3SHQA 1E7UA 2SEBD 3VRBB 2B3AA 2BYVE 1UH6A 2C5LC 2DAFA 3MJWA 3RNAC 5IP4D 2W82A 1ZKHA 2BW2A 1AN8A 3KWLA 4JGHB 2K9XA 1P98A 1EWYC 2A4ZA 4MT5A 3RN9C 2Y5PA 4ZRJA 1E0ZA 2ICIA 5D3IB 5C1ZA 4HEA1 4GXBA 3UIPB 3RUIB 4KIKA 3GOEA 1HA5A 2DZJA 2V0GA 4KGTA 1TS5A 4KGRA 4OVZA 4QAYA 3QX1A 2RPVA 2DAJA 1WXVA 4G3XB 4YSYB 2BYEA 1I4QA 4P6VF 4DDGD 1MHHE 2KMAA 1AW7A 1FD6A 1SE4A 1GAQB 4IUMB 4ANUA 2Q5WD 1RWSA 3B08A 2HTHA 4MH0E 1GUAB 3Q14C 4OHJA 1JWAD 5CTRC 1L7YA 3DBSA 3DVGY 2KFJA 4DHJB 1MI0A 1K8RB 4BBNC 5E6OA 2K8CA 3ZYYX 3P42A 1E8ZA 1Q5WB 2KO3A 2KMMA 3MFGA 3DOWA 1GPXA 3GE8C 1PGAA 2ACZB 5IO9A 3PZ7A 1YJ1A 4KDIC 1BUIC 2KJRA 2KWVB 4B95A 2K8HA 5H8YE 3RT3B 1WXQA 2NTSA 3ABVB 2V4LA 3W1SC 2RR9A 2CS4A 3AE6B 2D10A 2KWDA 1D6EC 1QZEA 3IT6B 3KVFB 1FO4A 1P7FA 1WWTA 4LNNA 1GOZA 2HTME 4N59A 3VR8B 4K3CA 2BYTA 1D5ZC 3CSTA 1L6UA 1NBFC 2QC8A 2KZRA 1V9JA 3EA6A 3FKYA 5BMHA 1L0VB 2WX0A 5D7GA 3V05A 4MEMA 4OZAA 4XE0A 3N30A 4FA6A 3Q3FA 3ZRFA 4F7ZA 1SSNA 1TJEA 3TBLD 3Q2AC 3PRMB 2W54A 4WWMA 1UBIA 4IW0A 1WF9A 1E6EB 1T0QC 1MPEA 2AL3A 2KX3A 4C7ZA 3LJ3A 4MSMB 4IDIA 4URKA 3NVWA 1NI3A 1UZXB 3DBLI 1M94A 4IWOA 3VVWB 3UF8A 4W9GA 3TUOA 2OJWA 1WRDB 4TSSA 5JZEB 4MGZE 2G4DB 3DWGC 3JYUA 1WJNA 2MX2A 2KJHB 1DYQA 1J7AA 1KLGD 1WGGA 3NS8A 1WMHB 2OHFA 5LNK1 4EZJA 5FK9C 4JWUC 4HDOA 1C4CA 1C3TA 3EFCA 1TGZB 4I6PA 1YD8U 2HJ8A 4GB9A 4BOZB 5CX3A 4J6IA 4IWPA 3ZXVA 2FUG1 1H4RA 2V1YA 4HPMB 3KYCD 2B76B 2WXIA 3BVZA 1ZXHA 5JHBA 2J0KA 4FHJA 2KWCA 1YNTE 4BVUC 5D6JB 1SBBB 3R7RA 2WXHA
chains in the Genus database with same CATH topology
1WR1A 3DCGA 4CYEA 3V62A 2N4FA 3QA8A 3T9LA 2ZNVC 4E71A 2KDFB 5JH5C 3A33B 5FR6A 2NBUA 2RD0A 1ZW7A 2NVUI 3CMMB 1WH3A 3R66C 4IWQA 2N7EA 4MGKE 2CHZA 1KM7A 3ONSA 4FJVB 4LJOB 4KVGB 3AULA 3VUXA 1WY8A 4HDQA 3IVFA 3EFUA 3QQ8B 3A1QB 3AU4A 4F8CB 3NY5A 3RYTA 3V6CB 2ZPYA 5BO4B 2LZ6A 4XC2A 4W9FA 5IAAC 2NR2A 2AWTA 2GBKA 2D3GA 2MWSB 3S2AA 2D11A 2KK8A 2LXAA 2G45B 2JZ3B 3HK0A 3L08A 1UD7A 2KNBA 2IY1B 2N1VA 2IZVB 2DX5B 5IA7A 4FJZA 2LI5A 3C0RB 4G50A 4ZYNA 4RMAA 1E90A 3Q3JA 2MBQA 4BKSD 1H8CA 3OJ4B 3ZNHB 3M95A 2PJHA 4KZCA 1WGDA 2ZPNA 4RM8A 1WXAA 2JZZA 1G6JA 3UQAA 4EZKA 1WGHA 2LJ5A 4F1SA 3VTWA 1XD3B 1WIAA 2KTRA 2GMIC 4TKNA 2JPHA 3VTVA 1WFYA 2BF8B 3QWZB 4WAAA 1T0YA 4GSWA 3RZWC 2O6VA 5JHAA 4B6WA 4DHZB 3A4RA 5DPRA 4PS8A 2XBBC 3DPDA 2LVOA 3PRPB 2O6VD 4JIOU 3ALBA 1A5RA 1WE6A 1BT0A 1WJUA 2DYBA 2K39A 1P3QU 4EOYA 4K1RB 1TTNA 3D32A 1GC6A 1RFAA 4ASWC 1L2NA 4II3B 3WAOA 2K6DB 1E8YA 2KJ6A 3GZNI 1WYWB 5AZGA 3V61A 1OQYA 2OOBB 1FXTB 3EC8A 3R7QA 1SE9A 1ISNA 1V5OA 3DVGX 1OGWA 1IPGA 3VFKA 2WWZA 1LQBA 2RPQA 5TR5A 2IBIB 1WM2A 1F9JA 2NS5A 3IBEA 4W9JA 2FNJB 2DZIA 4HPLB 2LVPA 4AOFA 5J18A 1SGHA 2UWQA 5J17A 2O6VB 4RM9A 2J7QB 2MA9B 3U8ZA 3V6EB 4GDLA 4K7UA 4JQWC 1P9DU 2MCNB 2AYOB 1R4NI 5CHFA 2FCQA 3HIZA 3JSVA 1WR6E 3PGEA 2NPTA 2ZVNA 4TQ0A 3KUZA 3B0AA 3L13A 4KZ0A 2DHZA 2R2QA 2JVCA 2PEAA 5J2RA 3VTUA 3QJZA 3N32A 3RD2A 2OJRA 2K8BA 3N3KB 4AP4C 2N1WA 3AU5A 3PLVA 2G4SA 2BKRB 2KTFA 2MBEA 5JZEB 2DYMA 2KWUB 4EZLA 3ZVVA 1E5WA 2KANA 2KVRA 1KJTA 4A20A 4BOSC 2GBNA 1J19A 2AL6A 3KUCB 4BKGA 1S1QB 2JRHA 2REXA 2JXXA 2JT4B 4WJOA 2FAZA 2N9EB 2ZCCA 3L10B 1WI0A 4KIKB 2JWZA 3A1QA 3TIXA 1V5TA 2KN5A 3H9DA 2L00B 5KHOA 3I3TB 5DCNA 2NBVB 4MM3A 4X57B 4PYUA 1WE7A 2BYFA 2N9XA 4OVVA 3ZDTA 3APCA 5EDSA 1WX8A 3VH4B 4DWFA 1P1AA 1WJ4A 1Q1OA 4NJ6A 4AUQC 4GOCA 3ZIMA 2CHXA 1S3SG 1OEYA 2DENB 3PLUA 1P0RA 2IO0B 3DBHI 4K7SA 2XEWA 4GU2A 4TUUA 3RZFA 1CMXB 4IM2A 3L0WB 3X0WA 4LJPB 3DDCB 3VH3B 5HKHA 1ZGUB 1GNUA 4WWOA 2LGXA 3KW5B 2N9PC 2YLMA 3KYDD 3SU8X 3OAWA 4W9DA 3IG3A 4HXDA 1X1MA 2C7MB 4MJSB 2M17A 5G55A 4EUTA 3NHEB 4FADA 2AEHA 2MQJA 1YX5B 3AXCA 2IO2B 1XQQA 1U4AA 3PPAA 1TBEA 3V60A 1V81A 2L7RA 2MW5A 4K7WA 3QK0A 2QHOA 3VUYA 4G0NB 2C60A 4DHZE 1GG3A 4XX5A 5E6PA 3OJ3A 4HCNB 3OLMD 2DYOA 5LLIA 1RAXA 4E74A 2L3ZA 1Z5SB 2LRWA 3ZNGC 1UBQA 5CHWA 4BKSA 2MRPA 5GMVA 2KLCA 1EF1A 2LVQA 2JUOA 1WJ6A 3RCZA 4IM3A 4G11A 4IG7B 1HE8A 1NI2A 4N9F4 1J0GA 4LDTD 3PVLA 4M0WB 3U7DA 4DXAB 4IM0A 1D3ZA 4NQLB 1I42A 2L76A 1V49A 3ZLZA 3SHQA 1E7UA 1LXDA 2M1MA 3O65B 2B3AA 4W9IA 2KX0A 2BYVE 3WIMA 3NZSA 3QAQA 1UH6A 2C5LC 2DAFA 3MJWA 4I6LB 3PV1A 5AZFA 1Q0WB 1ZKHA 2RSUA 2J0JA 3L54A 4NY0A 3KUDB 2C7NB 3VUWA 2BWES 2KDEB 4FBJB 1WX7A 3HM3A 4JGHB 2R2OA 3B1LX 1WM3A 2EMSA 3TCAA 2VRRB 2ZEQA 1P98A 3H1UA 4LDTB 1VD2A 2A4ZA 2IYDB 4HCPB 4AWJA 4ZRJA 4MGYE 3A9JB 2ZCBA 1Z2MA 3LDZE 2FIDA 4NPNA 1RRBA 3RULA 3MTNB 4DBGA 5C1ZA 3UIOB 1EUVB 4GXBA 2KDBA 3UIPB 4TV3A 3ZRCA 1NDDA 3RUIB 3AI5A 4KIKA 3GOEA 4A3OA 2DZJA 3ZTDA 2RGFA 1WGRA 2ZJDA 1KLVA 1Y8RC 3QX1A 1KOTA 2LD9A 1LM8B 1PQSA 2DAJA 2IY0B 2JY6A 3JVZX 4HVBA 1WXVA 2G3QB 4G3XB 1WXMA 2BYEA 2C9WB 4DDGD 2O2VA 2KMAA 1JRUA 2ZZPB 4W9HA 2LGYA 3PS6A 4IUMB 4DHJD 4XZ4A 3H7PB 4ANUA 4BBNF 5AZHA 2PE6B 4MJSA 2D07B 3B08A 3UINB 4BFRA 2HTHA 1YX6B 3PZDA 2KLGA 3CSFA 4ZRKA 1R4MI 4MH0E 1GUAB 2CKHB 4ZRIA 4ICUA 3QCAA 4MGIE 4YL8A 2IO3B 1WZ3A 2DZKA 2FUHB 5CTRC 4ANXA 2GBJA 3WAPA 4II2B 4GN1A 2FCMA 3EHVA 1L7YA 3DBSA 2JRIB 3DVGY 2KFJA 5LXHA 1SIFA 3HHMA 4A3PA 4JL9A 2Z0EB 2L0TA 2O2VB 2PE9A 4DHJB 3VAWA 2MSED 3ENEA 4FULA 3WAMA 1K8RB 4WWNA 3T8MA 4BBNC 1EO6A 5E6OA 2K8CA 4CHKA 1E8ZA 1Q5WB 1V80A 2KO3A 3DOWA 5DPWA 2A5UA 3MHSD 4WJPA 5E6NA 3R3MA 3SD5A 1YJ1A 2LUEA 4KDIC 1MG8A 2NCNA 3PRZA 2KC2A 3A9KB 2CHWA 2N7DA 1TZ1A 2KJRA 4WQOB 2KC1A 2KWVB 4GDKB 4B95A 1C1YB 2CU1A 2K8HA 2IO1B 3ECIA 4FHKA 1J8CA 3RT3B 5L83A 2HE7A 4HLEA 4NAWB 4W9EA 1IP9A 4KSKC 2PPHA 2V4LA 2WYQA 3VHTC 2KQ7A 2Z0DB 3W1SC 2RR9A 2CS4A 4HJKA 4KV2A 2GBMA 4AJYB 3ML9A 2WX1A 3A9JA 2BWFA 5AEKB 2XK5A 3P2BA 2D10A 3WA0A 1QZEA 4MELA 4MSQB 1E8WA 4NJ7A 4PYZA 4ANWA 3KVFB 3PSEB 2BPSA 4LCDE 2DZMA 1YIWA 3QARA 3ZDMC 3BY4B 3VQIA 3VXWA 3ZTCA 3CSTA 2NBWB 4FJYA 4HK2A 2LXCA 4WJQA 1NBFC 4KSLC 4M8NA 2KFKA 3SDLC 3HM6X 2KZRA 2FIFA 2LGDA 3WANA 1V9JA 2K1FA 1RLFA 2ASQA 2KHWB 2WX0A 4I6NB 5D7GA 4MEMA 2KXJA 3DVNV 2CR5A 3QC8B 2Y5BB 3N30A 1GC7A 3Q3FA 2Z59B 4FA6A 1IYFA 3M62B 1UELA 3H6NA 3PT2B 3ZRFA 3H7PA 2XK5B 3DVNU 2KMCA 2UYZB 2GBRA 1YQBA 4EFOA 1WMHA 4PS3A 4F7ZA 1V2YA 2C7HA 3TBLD 4WWPA 1WX9A 3PRMB 3UGBB 5KHQA 1OEYJ 3ZNID 2L05A 3K9OB 1UGMA 2I1JA 3M3JA 4W9LA 2BKFA 1AARA 1UBIA 4GMVA 4IW0A 3TL5A 2LWPA 3TMPB 3NOBA 1WF9A 3DQVA 2EMTA 4NNJB 2HD5B 4M8MA 2AL3A 2KFKB 2KX3A 3A4SC 2KD0A 3IFWB 3U30A 4EEWA 5D2MB 3BINA 2JF5A 3LJ3A 4CO7A 1E7VA 4MSMB 3UQBA 2MBOA 4URKA 4W9KA 5DPSA 3X23A 1UZXB 3DBLI 1M94A 4IWOA 3VVWB 3UF8A 4ZDVA 2KKCA 1LFDA 3EECA 1WXSA 2MP2A 2D2QA 2YVCA 4JLCA 1WZ0A 4GGQA 4W9GA 1WRDB 3W1YA 3PTFC 3WALA 2J0MA 2KTRB 4MGZE 2G4DB 2FCNA 3JYUA 4KDLB 3VDZA 1WJNA 1E8XA 2MX2A 1VCBA 1I35A 2KJHB 3JW0X 4WJNA 2M4NA 3CF6E 3PHXB 4PS7A 3TJPA 1WGGA 3NS8A 1WMHB 3IHPC 4TQ1A 4EZJA 2V3SA 4NQKE 3ZW3A 3W1SA 1WGYA 4ICVA 4FLHA 2KQSA 4HDOA 1C3TA 2LASA 2M8SA 3A9KA 4DK5A 2FCSA 1TGZB 4I6PA 1GJZA 1YD8U 2MBBB 3NZUA 4GDKA 3ML8A 3DBRI 4K81A 1V6EA 5D94A 2HJ8A 1XT9B 3QIJA 1EF5A 4MDKE 2EKEC 2I1KA 4GB9A 4DDID 4HWIB 4BOZB 3L17A 5CX3A 4P7IA 4NAWA 3PREA 4B9KA 4IC7B 3M63B 4IWPA 2GOWA 2ZVOA 4J6IA 3ZUNA 2MP2B 2MBHA 3QHTA 3H7SA 3ZO5B 4E3CA 3KH0A 2L0FA 2KOXA 2ZNVB 2MLBA 1H4RA 4GIVA 2M0XA 2V1YA 3L16A 3APDA 5CHVC 4HPMB 4W9CA 2W9NA 3KYCD 1V86A 1OTRB 5L95C 2LRUA 2K6QA 4GDLB 2K25A 4ANVA 5LXIB 2BGFA 3JSVB 5DPTA 5C23A 3ZKJC 5JHBA 2NPTB 2WDTB 4FN2A 4AJWA 2KDIA 2J0KA 4FHJA 2KWCA 3K9PB 3ZNZB 4BVUC 5D6JB 2L8JA 5G2NA 3PHWB 3APFA 4OVUA 3R7RA 4BKTA 4EKUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WR1 A;  3DCG A;  4CYE A;  3V62 A;  2N4F A;  3QA8 A;  3T9L A;  2ZNV C;  4E71 A;  2KDF B;  5JH5 C;  3A33 B;  5FR6 A;  2NBU A;  2RD0 A;  1ZW7 A;  2NVU I;  3CMM B;  1WH3 A;  3R66 C;  4IWQ A;  2N7E A;  4MGK E;  2CHZ A;  1KM7 A;  3ONS A;  4FJV B;  4LJO B;  4KVG B;  3AUL A;  3VUX A;  1WY8 A;  4HDQ A;  3IVF A;  3EFU A;  3QQ8 B;  3A1Q B;  3AU4 A;  4F8C B;  3NY5 A;  3RYT A;  3V6C B;  2ZPY A;  5BO4 B;  2LZ6 A;  4XC2 A;  4W9F A;  5IAA C;  2NR2 A;  2AWT A;  2GBK A;  2D3G A;  2MWS B;  3S2A A;  2D11 A;  2KK8 A;  2LXA A;  2G45 B;  2JZ3 B;  3HK0 A;  3L08 A;  1UD7 A;  2KNB A;  2IY1 B;  2N1V A;  2IZV B;  2DX5 B;  5IA7 A;  4FJZ A;  2LI5 A;  3C0R B;  4G50 A;  4ZYN A;  4RMA A;  1E90 A;  3Q3J A;  2MBQ A;  4BKS D;  1H8C A;  3OJ4 B;  3ZNH B;  3M95 A;  2PJH A;  4KZC A;  1WGD A;  2ZPN A;  4RM8 A;  1WXA A;  2JZZ A;  1G6J A;  3UQA A;  4EZK A;  1WGH A;  2LJ5 A;  4F1S A;  3VTW A;  1XD3 B;  1WIA A;  2KTR A;  2GMI C;  4TKN A;  2JPH A;  3VTV A;  1WFY A;  2BF8 B;  3QWZ B;  4WAA A;  1T0Y A;  4GSW A;  3RZW C;  2O6V A;  5JHA A;  4B6W A;  4DHZ B;  3A4R A;  5DPR A;  4PS8 A;  2XBB C;  3DPD A;  2LVO A;  3PRP B;  2O6V D;  4JIO U;  3ALB A;  1A5R A;  1WE6 A;  1BT0 A;  1WJU A;  2DYB A;  2K39 A;  1P3Q U;  4EOY A;  4K1R B;  1TTN A;  3D32 A;  1GC6 A;  1RFA A;  4ASW C;  1L2N A;  4II3 B;  3WAO A;  2K6D B;  1E8Y A;  2KJ6 A;  3GZN I;  1WYW B;  5AZG A;  3V61 A;  1OQY A;  2OOB B;  1FXT B;  3EC8 A;  3R7Q A;  1SE9 A;  1ISN A;  1V5O A;  3DVG X;  1OGW A;  1IPG A;  3VFK A;  2WWZ A;  1LQB A;  2RPQ A;  5TR5 A;  2IBI B;  1WM2 A;  1F9J A;  2NS5 A;  3IBE A;  4W9J A;  2FNJ B;  2DZI A;  4HPL B;  2LVP A;  4AOF A;  5J18 A;  1SGH A;  2UWQ A;  5J17 A;  2O6V B;  4RM9 A;  2J7Q B;  2MA9 B;  3U8Z A;  3V6E B;  4GDL A;  4K7U A;  4JQW C;  1P9D U;  2MCN B;  2AYO B;  1R4N I;  5CHF A;  2FCQ A;  3HIZ A;  3JSV A;  1WR6 E;  3PGE A;  2NPT A;  2ZVN A;  4TQ0 A;  3KUZ A;  3B0A A;  3L13 A;  4KZ0 A;  2DHZ A;  2R2Q A;  2JVC A;  2PEA A;  5J2R A;  3VTU A;  3QJZ A;  3N32 A;  3RD2 A;  2OJR A;  2K8B A;  3N3K B;  4AP4 C;  2N1W A;  3AU5 A;  3PLV A;  2G4S A;  2BKR B;  2KTF A;  2MBE A;  5JZE B;  2DYM A;  2KWU B;  4EZL A;  3ZVV A;  1E5W A;  2KAN A;  2KVR A;  1KJT A;  4A20 A;  4BOS C;  2GBN A;  1J19 A;  2AL6 A;  3KUC B;  4BKG A;  1S1Q B;  2JRH A;  2REX A;  2JXX A;  2JT4 B;  4WJO A;  2FAZ A;  2N9E B;  2ZCC A;  3L10 B;  1WI0 A;  4KIK B;  2JWZ A;  3A1Q A;  3TIX A;  1V5T A;  2KN5 A;  3H9D A;  2L00 B;  5KHO A;  3I3T B;  5DCN A;  2NBV B;  4MM3 A;  4X57 B;  4PYU A;  1WE7 A;  2BYF A;  2N9X A;  4OVV A;  3ZDT A;  3APC A;  5EDS A;  1WX8 A;  3VH4 B;  4DWF A;  1P1A A;  1WJ4 A;  1Q1O A;  4NJ6 A;  4AUQ C;  4GOC A;  3ZIM A;  2CHX A;  1S3S G;  1OEY A;  2DEN B;  3PLU A;  1P0R A;  2IO0 B;  3DBH I;  4K7S A;  2XEW A;  4GU2 A;  4TUU A;  3RZF A;  1CMX B;  4IM2 A;  3L0W B;  3X0W A;  4LJP B;  3DDC B;  3VH3 B;  5HKH A;  1ZGU B;  1GNU A;  4WWO A;  2LGX A;  3KW5 B;  2N9P C;  2YLM A;  3KYD D;  3SU8 X;  3OAW A;  4W9D A;  3IG3 A;  4HXD A;  1X1M A;  2C7M B;  4MJS B;  2M17 A;  5G55 A;  4EUT A;  3NHE B;  4FAD A;  2AEH A;  2MQJ A;  1YX5 B;  3AXC A;  2IO2 B;  1XQQ A;  1U4A A;  3PPA A;  1TBE A;  3V60 A;  1V81 A;  2L7R A;  2MW5 A;  4K7W A;  3QK0 A;  2QHO A;  3VUY A;  4G0N B;  2C60 A;  4DHZ E;  1GG3 A;  4XX5 A;  5E6P A;  3OJ3 A;  4HCN B;  3OLM D;  2DYO A;  5LLI A;  1RAX A;  4E74 A;  2L3Z A;  1Z5S B;  2LRW A;  3ZNG C;  1UBQ A;  5CHW A;  4BKS A;  2MRP A;  5GMV A;  2KLC A;  1EF1 A;  2LVQ A;  2JUO A;  1WJ6 A;  3RCZ A;  4IM3 A;  4G11 A;  4IG7 B;  1HE8 A;  1NI2 A;  4N9F 4;  1J0G A;  4LDT D;  3PVL A;  4M0W B;  3U7D A;  4DXA B;  4IM0 A;  1D3Z A;  4NQL B;  1I42 A;  2L76 A;  1V49 A;  3ZLZ A;  3SHQ A;  1E7U A;  1LXD A;  2M1M A;  3O65 B;  2B3A A;  4W9I A;  2KX0 A;  2BYV E;  3WIM A;  3NZS A;  3QAQ A;  1UH6 A;  2C5L C;  2DAF A;  3MJW A;  4I6L B;  3PV1 A;  5AZF A;  1Q0W B;  1ZKH A;  2RSU A;  2J0J A;  3L54 A;  4NY0 A;  3KUD B;  2C7N B;  3VUW A;  2BWE S;  2KDE B;  4FBJ B;  1WX7 A;  3HM3 A;  4JGH B;  2R2O A;  3B1L X;  1WM3 A;  2EMS A;  3TCA A;  2VRR B;  2ZEQ A;  1P98 A;  3H1U A;  4LDT B;  1VD2 A;  2A4Z A;  2IYD B;  4HCP B;  4AWJ A;  4ZRJ A;  4MGY E;  3A9J B;  2ZCB A;  1Z2M A;  3LDZ E;  2FID A;  4NPN A;  1RRB A;  3RUL A;  3MTN B;  4DBG A;  5C1Z A;  3UIO B;  1EUV B;  4GXB A;  2KDB A;  3UIP B;  4TV3 A;  3ZRC A;  1NDD A;  3RUI B;  3AI5 A;  4KIK A;  3GOE A;  4A3O A;  2DZJ A;  3ZTD A;  2RGF A;  1WGR A;  2ZJD A;  1KLV A;  1Y8R C;  3QX1 A;  1KOT A;  2LD9 A;  1LM8 B;  1PQS A;  2DAJ A;  2IY0 B;  2JY6 A;  3JVZ X;  4HVB A;  1WXV A;  2G3Q B;  4G3X B;  1WXM A;  2BYE A;  2C9W B;  4DDG D;  2O2V A;  2KMA A;  1JRU A;  2ZZP B;  4W9H A;  2LGY A;  3PS6 A;  4IUM B;  4DHJ D;  4XZ4 A;  3H7P B;  4ANU A;  4BBN F;  5AZH A;  2PE6 B;  4MJS A;  2D07 B;  3B08 A;  3UIN B;  4BFR A;  2HTH A;  1YX6 B;  3PZD A;  2KLG A;  3CSF A;  4ZRK A;  1R4M I;  4MH0 E;  1GUA B;  2CKH B;  4ZRI A;  4ICU A;  3QCA A;  4MGI E;  4YL8 A;  2IO3 B;  1WZ3 A;  2DZK A;  2FUH B;  5CTR C;  4ANX A;  2GBJ A;  3WAP A;  4II2 B;  4GN1 A;  2FCM A;  3EHV A;  1L7Y A;  3DBS A;  2JRI B;  3DVG Y;  2KFJ A;  5LXH A;  1SIF A;  3HHM A;  4A3P A;  4JL9 A;  2Z0E B;  2L0T A;  2O2V B;  2PE9 A;  4DHJ B;  3VAW A;  2MSE D;  3ENE A;  4FUL A;  3WAM A;  1K8R B;  4WWN A;  3T8M A;  4BBN C;  1EO6 A;  5E6O A;  2K8C A;  4CHK A;  1E8Z A;  1Q5W B;  1V80 A;  2KO3 A;  3DOW A;  5DPW A;  2A5U A;  3MHS D;  4WJP A;  5E6N A;  3R3M A;  3SD5 A;  1YJ1 A;  2LUE A;  4KDI C;  1MG8 A;  2NCN A;  3PRZ A;  2KC2 A;  3A9K B;  2CHW A;  2N7D A;  1TZ1 A;  2KJR A;  4WQO B;  2KC1 A;  2KWV B;  4GDK B;  4B95 A;  1C1Y B;  2CU1 A;  2K8H A;  2IO1 B;  3ECI A;  4FHK A;  1J8C A;  3RT3 B;  5L83 A;  2HE7 A;  4HLE A;  4NAW B;  4W9E A;  1IP9 A;  4KSK C;  2PPH A;  2V4L A;  2WYQ A;  3VHT C;  2KQ7 A;  2Z0D B;  3W1S C;  2RR9 A;  2CS4 A;  4HJK A;  4KV2 A;  2GBM A;  4AJY B;  3ML9 A;  2WX1 A;  3A9J A;  2BWF A;  5AEK B;  2XK5 A;  3P2B A;  2D10 A;  3WA0 A;  1QZE A;  4MEL A;  4MSQ B;  1E8W A;  4NJ7 A;  4PYZ A;  4ANW A;  3KVF B;  3PSE B;  2BPS A;  4LCD E;  2DZM A;  1YIW A;  3QAR A;  3ZDM C;  3BY4 B;  3VQI A;  3VXW A;  3ZTC A;  3CST A;  2NBW B;  4FJY A;  4HK2 A;  2LXC A;  4WJQ A;  1NBF C;  4KSL C;  4M8N A;  2KFK A;  3SDL C;  3HM6 X;  2KZR A;  2FIF A;  2LGD A;  3WAN A;  1V9J A;  2K1F A;  1RLF A;  2ASQ A;  2KHW B;  2WX0 A;  4I6N B;  5D7G A;  4MEM A;  2KXJ A;  3DVN V;  2CR5 A;  3QC8 B;  2Y5B B;  3N30 A;  1GC7 A;  3Q3F A;  2Z59 B;  4FA6 A;  1IYF A;  3M62 B;  1UEL A;  3H6N A;  3PT2 B;  3ZRF A;  3H7P A;  2XK5 B;  3DVN U;  2KMC A;  2UYZ B;  2GBR A;  1YQB A;  4EFO A;  1WMH A;  4PS3 A;  4F7Z A;  1V2Y A;  2C7H A;  3TBL D;  4WWP A;  1WX9 A;  3PRM B;  3UGB B;  5KHQ A;  1OEY J;  3ZNI D;  2L05 A;  3K9O B;  1UGM A;  2I1J A;  3M3J A;  4W9L A;  2BKF A;  1AAR A;  1UBI A;  4GMV A;  4IW0 A;  3TL5 A;  2LWP A;  3TMP B;  3NOB A;  1WF9 A;  3DQV A;  2EMT A;  4NNJ B;  2HD5 B;  4M8M A;  2AL3 A;  2KFK B;  2KX3 A;  3A4S C;  2KD0 A;  3IFW B;  3U30 A;  4EEW A;  5D2M B;  3BIN A;  2JF5 A;  3LJ3 A;  4CO7 A;  1E7V A;  4MSM B;  3UQB A;  2MBO A;  4URK A;  4W9K A;  5DPS A;  3X23 A;  1UZX B;  3DBL I;  1M94 A;  4IWO A;  3VVW B;  3UF8 A;  4ZDV A;  2KKC A;  1LFD A;  3EEC A;  1WXS A;  2MP2 A;  2D2Q A;  2YVC A;  4JLC A;  1WZ0 A;  4GGQ A;  4W9G A;  1WRD B;  3W1Y A;  3PTF C;  3WAL A;  2J0M A;  2KTR B;  4MGZ E;  2G4D B;  2FCN A;  3JYU A;  4KDL B;  3VDZ A;  1WJN A;  1E8X A;  2MX2 A;  1VCB A;  1I35 A;  2KJH B;  3JW0 X;  4WJN A;  2M4N A;  3CF6 E;  3PHX B;  4PS7 A;  3TJP A;  1WGG A;  3NS8 A;  1WMH B;  3IHP C;  4TQ1 A;  4EZJ A;  2V3S A;  4NQK E;  3ZW3 A;  3W1S A;  1WGY A;  4ICV A;  4FLH A;  2KQS A;  4HDO A;  1C3T A;  2LAS A;  2M8S A;  3A9K A;  4DK5 A;  2FCS A;  1TGZ B;  4I6P A;  1GJZ A;  1YD8 U;  2MBB B;  3NZU A;  4GDK A;  3ML8 A;  3DBR I;  4K81 A;  1V6E A;  5D94 A;  2HJ8 A;  1XT9 B;  3QIJ A;  1EF5 A;  4MDK E;  2EKE C;  2I1K A;  4GB9 A;  4DDI D;  4HWI B;  4BOZ B;  3L17 A;  5CX3 A;  4P7I A;  4NAW A;  3PRE A;  4B9K A;  4IC7 B;  3M63 B;  4IWP A;  2GOW A;  2ZVO A;  4J6I A;  3ZUN A;  2MP2 B;  2MBH A;  3QHT A;  3H7S A;  3ZO5 B;  4E3C A;  3KH0 A;  2L0F A;  2KOX A;  2ZNV B;  2MLB A;  1H4R A;  4GIV A;  2M0X A;  2V1Y A;  3L16 A;  3APD A;  5CHV C;  4HPM B;  4W9C A;  2W9N A;  3KYC D;  1V86 A;  1OTR B;  5L95 C;  2LRU A;  2K6Q A;  4GDL B;  2K25 A;  4ANV A;  5LXI B;  2BGF A;  3JSV B;  5DPT A;  5C23 A;  3ZKJ C;  5JHB A;  2NPT B;  2WDT B;  4FN2 A;  4AJW A;  2KDI A;  2J0K A;  4FHJ A;  2KWC A;  3K9P B;  3ZNZ B;  4BVU C;  5D6J B;  2L8J A;  5G2N A;  3PHW B;  3APF A;  4OVU A;  3R7R A;  4BKT A;  4EKU A; 
#chains in the Genus database with same CATH topology
 4HKQ A;  5JH5 C;  2ZNV C;  2KDF B;  3T3N A;  2NVU I;  1Y56 A;  5JXV A;  1WH3 A;  3R66 C;  4IWQ A;  1YN4 A;  2N7E A;  3VUX A;  1WY8 A;  1JML A;  3QQ8 B;  1YQ3 B;  3AU4 A;  3NY5 A;  3V6C B;  2ZPY A;  3ZQ4 A;  2LZ6 A;  4KGS A;  4W9F A;  3NG0 A;  3P4Q B;  4MM3 B;  2GBK A;  3OG5 A;  1GB1 A;  2D11 A;  2KK8 A;  2JZ3 B;  2X38 A;  3EGR A;  5BMG A;  3C0R B;  4G50 A;  2IDY A;  2WLB A;  3U7Z A;  4KZC A;  1WGD A;  2ZPN A;  1HTO A;  2JZZ A;  1G6J A;  4RGT A;  5AUI A;  3UQA A;  1PYW D;  2WXR A;  4M02 A;  2BF8 B;  3QWZ B;  4WAA A;  1EM7 A;  4B6W A;  2LFI A;  3A4R A;  5MPO A;  1KTK A;  4XWT A;  1WE6 A;  3C19 A;  3FAH A;  1L0Y B;  1FFV A;  1P3Q U;  2QCZ A;  1RFA A;  2D3A A;  1L2N A;  2WXP A;  1C4P A;  3Q8B A;  2G9H D;  2L1A A;  2KJ6 A;  1E8Y A;  2AX5 A;  1WYW B;  3V61 A;  2XNA C;  3EC8 A;  1CQV A;  2DWQ A;  4AS1 A;  5G5G A;  1IPG A;  2WWZ A;  1ZOY B;  2IBI B;  1WM2 A;  3IBE A;  4HPL B;  1SGH A;  2J7Q B;  1P9D U;  1FXA A;  1EU4 A;  1R4N I;  2RMM A;  3AEF B;  4XDD A;  2R2Q A;  4A90 A;  2M56 B;  3AH7 A;  3QJZ A;  2BS2 B;  2OJR A;  4S17 A;  4ZRQ A;  2KWU B;  2BS3 B;  1QOA A;  1KJT A;  4BOS C;  1T0S C;  3BWU D;  2JRH A;  2REX A;  2JXX A;  3AE8 B;  1TT5 B;  2ZCC A;  3L10 B;  2L00 B;  5KHO A;  5DCN A;  4X57 B;  4MM3 A;  4PYU A;  1WE7 A;  3ZDT A;  5EDS A;  3RFZ B;  1WJ4 A;  1Q1O A;  1SF0 A;  2CHX A;  1DOX A;  4P1C C;  3MC0 B;  2DEN B;  1P0R A;  3NJT A;  2XEW A;  4LJP B;  3Q8C A;  1GNU A;  1D5X C;  2LGX A;  1N60 A;  1T6B X;  3IG3 A;  3BYT B;  1X1M A;  5G55 A;  3IAM 1;  4FAD A;  2AEH A;  2MQJ A;  1WYG A;  5FR3 A;  1U4A A;  1TBE A;  2BVC A;  1V81 A;  1FNV A;  3AMZ A;  1PDX A;  1I4G A;  3VUY A;  4TMA B;  2QSD A;  3OJ3 A;  3W9C B;  1E7P B;  1C79 A;  4YTM B;  1Z5S B;  4BKS A;  4AQ7 A;  2KLC A;  2JUO A;  4G11 A;  2MJ3 A;  1HE8 A;  4N9F 4;  1TIF A;  3PVL A;  4M0W B;  2ONQ A;  1V49 A;  3ZLZ A;  1QOF A;  1SXT A;  3O65 B;  1ESF A;  2WXJ A;  1PUT A;  1WGK A;  3NZS A;  2QIE B;  5AZF A;  1Q0W B;  3DHI C;  1JWB D;  2C7N B;  3BII D;  2KDE B;  5EE3 A;  2EMS A;  2OED A;  3TCA A;  1D4B A;  3H1U A;  2KDM A;  1UNS A;  1VD2 A;  4HCP B;  2ZCB A;  4LK0 M;  1Z2M A;  3LDZ E;  3RUL A;  3MTN B;  3UIO B;  2KDB A;  4TV3 A;  3ZRC A;  3DWM A;  1R4N B;  2JYE A;  4A3O A;  2M19 A;  2HJ1 A;  1I4H A;  1BML C;  1PQS A;  2JY6 A;  1J7C A;  3IAS 1;  1HZ5 A;  1WXM A;  5GXG B;  2O2V A;  4DHJ D;  3WCQ A;  3H7P B;  5AZH A;  1E9M A;  3R8B A;  4UDU C;  1N63 A;  3PZD A;  5EE9 A;  3I9V 1;  3TEZ A;  1SE3 A;  1V1O A;  2CKH B;  2MEK A;  4ICU A;  3QCA A;  1QOG A;  4YL8 A;  4US9 A;  1WZ3 A;  2FUH B;  2ON8 A;  5H92 C;  2GBJ A;  1RYJ A;  4II2 B;  2WP9 B;  4H2A A;  3HHM A;  2RDB C;  2L0T A;  2MSE D;  3ENE A;  4FUL A;  4WWN A;  3TEY A;  1EO6 A;  5G5H A;  1PFD A;  3TEW A;  4M0W A;  5DPW A;  2A5U A;  3MHS D;  4WJP A;  1XCQ L;  1MG8 A;  2CU3 A;  2NCN A;  3A9K B;  3KWV A;  2CU1 A;  2DNF A;  1VZ8 A;  3AE9 B;  2PPH A;  2WYQ A;  4JE3 B;  1XEE A;  3P1M A;  2Z0D B;  4B0M A;  3I5J C;  3EUB 2;  5AEK B;  2DBY A;  3P2B A;  1N5W A;  3WA0 A;  1I4P A;  2K22 A;  4MEL A;  4ANW A;  3PSE B;  5EE0 A;  3QAR A;  2UU7 A;  4WQM A;  3BY4 B;  3VXW A;  1L5P A;  2PMV A;  4HK2 A;  2NTT A;  4KSL C;  4HRO A;  1KLU D;  2FIF A;  3FIL B;  2LUM A;  2KHW B;  3ZJT A;  3AEA B;  2KT7 A;  2Y5B B;  2L83 A;  2WXG A;  2Z59 B;  1UEL A;  3H7P A;  3DVN U;  4EFO A;  1V2Y A;  1WX9 A;  4M00 A;  3UGB B;  1T5X D;  5KHQ A;  1OEY J;  4RGM A;  2L05 A;  3Q3N C;  1UGM A;  2BKF A;  3TL5 A;  5T8I A;  4XGA B;  2EMT A;  1A70 A;  2GI9 A;  2KD0 A;  3U30 A;  1SEB D;  4CO7 A;  2JF5 A;  2L52 A;  3X23 A;  2J53 A;  2BQQ A;  4ZDV A;  1LFD A;  3Q6B A;  2J42 A;  2MP2 A;  3DHG C;  1WZ0 A;  4GGQ A;  3WAL A;  1I35 A;  1YN3 A;  3TSS A;  3TJP A;  2M4N A;  3CF6 E;  2YEP F;  3IHP C;  2V3S A;  4L23 A;  1F52 A;  2YEP B;  3DBR B;  4FLH A;  1CJE A;  1ROE A;  2LAS A;  3A9K A;  4M01 A;  1GJZ A;  3NZU A;  3NUH B;  1V6E A;  2D5G A;  3QIJ A;  2INC C;  3MC9 A;  4DDI D;  3RNC C;  1ENF A;  3M63 B;  2GOW A;  2ZVO A;  2MBH A;  3ZO5 B;  4E3C A;  3BVG A;  2RDH A;  2AQ3 B;  1T0R C;  2W9N A;  5L95 C;  2LRU A;  2K6Q A;  2KAJ A;  4R3D A;  4ANV A;  5LXI B;  3ZKJ C;  2QDF A;  2NPT B;  4FN2 A;  3ZNZ B;  2WXO A;  2L8J A;  5G2N A;  4BKT A;  4EKU A;  3AE3 B;  4E71 A;  1FPY A;  2NBU A;  3FIL A;  3NRZ A;  4LNK A;  3URY A;  1QOB A;  1I4X A;  4KVG B;  3HVZ A;  2JU6 X;  4XC2 A;  2NR2 A;  2MJE A;  2H89 B;  3LXF A;  2MWS B;  3S2A A;  2G45 B;  4ARI A;  1UD7 A;  4N6E B;  2IY1 B;  2N1V A;  3RNE C;  4L1B A;  2XN9 C;  4BKS D;  2QJL A;  3AE7 B;  4LNI A;  3M95 A;  4RM8 A;  1WGH A;  4F1S A;  1FRD A;  3VTW A;  1XD3 B;  1WIA A;  2GMI C;  2JPH A;  3VTV A;  2PVG C;  1YOV B;  4GSW A;  2O6V A;  5JHA A;  2INP E;  4B0E A;  2XBB C;  3V3X A;  1BT0 A;  3D32 A;  3WAO A;  1L6V A;  1OQY A;  4C7Y A;  1FXT B;  1SE9 A;  1ISN A;  1OGW A;  1LQB A;  3AEE B;  2NS5 A;  2FNJ B;  4AOF A;  3I63 C;  5J18 A;  5J17 A;  3W2D A;  2I2Y A;  3U8Z A;  2MA9 B;  3B2G A;  4JQW C;  2N9L A;  2MCN B;  1JRO A;  1D5M C;  1UWM A;  3PGE A;  1MG4 A;  2NPT A;  4KZ0 A;  3L13 A;  2GLS A;  2PEA A;  3N32 A;  3RNB C;  4DXF A;  2K8B A;  1NVI D;  2WXQ A;  4AP4 C;  3AU5 A;  2G4S A;  2BKR B;  2KTF A;  3IT4 B;  2MBE A;  4EZL A;  4A20 A;  1J19 A;  3KUC B;  1S1Q B;  4WJO A;  2N9E B;  5FKA C;  3TIX A;  1WI0 A;  4RCO A;  1F1H A;  1B9R A;  2NBV B;  3MHZ A;  1WX8 A;  4DWF A;  4YTP B;  1P1A A;  2W3S A;  4AUQ C;  3LYY A;  1S3S G;  4WAF A;  4YXD B;  3DBH I;  4TUU A;  1P7E A;  1ZDX A;  4IM2 A;  3DDC B;  1VJK A;  2N9P C;  2YLM A;  1ZDV A;  3AEG B;  3SU8 X;  4XYC A;  2E6X A;  3AN1 A;  1N5X A;  1N6Z A;  3H8H A;  1YX5 B;  4LTU A;  1XQQ A;  2QHO A;  1KFY B;  2W55 A;  5HHD G;  2IJ0 A;  1FXI A;  5E6P A;  2K0P A;  3GB1 A;  3OLM D;  4HCN B;  2DYO A;  5AUK A;  1RAX A;  3AM9 A;  3NVY A;  3TEX A;  2L3Z A;  3ZNG C;  2LRW A;  2LJI A;  5GMV A;  1NYR A;  1EF1 A;  1WJ6 A;  4IG7 B;  1UGJ A;  2J4X A;  1QKZ A;  4US8 A;  1ZUD 2;  4DXA B;  1I42 A;  1ZXI A;  2W3R A;  2PTL A;  2PW9 A;  2M1M A;  3N1Z C;  4W9I A;  3WIM A;  4YT0 B;  4I6L B;  3PV1 A;  3LB8 C;  3L54 A;  1FNW A;  1E10 A;  3Q69 A;  3VUW A;  2BWE S;  1TKY A;  1WX7 A;  3HM3 A;  2R2O A;  3B1L X;  1HEZ E;  3BVM A;  4LDT B;  2FBW B;  2IYD B;  4AWJ A;  2D3B A;  1JWM D;  3A9J B;  4RH6 A;  4J3O D;  4NPN A;  1RRB A;  3FC4 A;  1YJI A;  4JWS C;  1YMH E;  1NEK B;  2RGF A;  1WGR A;  2ZJD A;  1KLV A;  1KOT A;  2LD9 A;  2MH7 A;  2IY0 B;  1YQ4 B;  4HVB A;  5IOI A;  1JWS D;  2IPK D;  2ZZP B;  4W9H A;  3PS6 A;  4XZ4 A;  4BBN F;  4ARC A;  1FNU A;  2PE6 B;  1R4M B;  2IGH A;  2D07 B;  3UIN B;  4BFR A;  2KLG A;  2TSS A;  4ZRK A;  1HQR D;  1ACC A;  4PK1 A;  1JCK B;  4ZRI A;  4MGI E;  4MH8 A;  2MHJ A;  2IO3 B;  4ANX A;  3DBH B;  4WUR A;  1V8C A;  3EHV A;  1N62 A;  4L2Y A;  1SIF A;  4XWW A;  4JL9 A;  2Z0E B;  2O2V B;  3VAW A;  3WAM A;  1V80 A;  2INN E;  2V3P A;  3BZD B;  3ZGZ A;  1FMA D;  5E6N A;  2EEL A;  3R3M A;  3SD5 A;  3PRZ A;  2KC2 A;  2N7D A;  3N9Y C;  4WQO B;  2KC1 A;  3CWI A;  2LEK A;  4GDK B;  4RGO S;  3VR9 B;  5BYQ A;  2QMT A;  3B2F A;  3P4S B;  4HLE A;  4W9E A;  4HKZ E;  2KQ7 A;  4JPS A;  4KV2 A;  3J9C A;  2GBM A;  3ML9 A;  3A9J A;  2XK5 A;  2KYW A;  2WU5 B;  1UF0 A;  4CHK A;  4MSQ B;  1E8W A;  4KKJ A;  3IXS A;  3ZDM C;  2WDQ B;  2NBW B;  2LXC A;  4IOI E;  5BYS A;  4WJQ A;  4M8N A;  2KFK A;  3SDL C;  2IGD A;  1TS2 A;  3WAN A;  1C77 A;  2K1F A;  1RLF A;  2ASQ A;  2KXJ A;  1K51 A;  1R7S A;  4O1N A;  1GC7 A;  3M62 B;  4DQO C;  3PT2 B;  1UWX A;  2BB6 A;  3R2I A;  4HRS A;  1SJE D;  5HFY A;  3L4P A;  2GBR A;  2WXK A;  2C7H A;  4WWP A;  2WS3 B;  2Z8L A;  3PO0 A;  4USA A;  1MVK A;  4GMV A;  2LWP A;  3NOB A;  3DQV A;  2HD5 B;  4M8M A;  4IKG A;  3A4S C;  4EEW A;  5D2M B;  3BIN A;  3KQ4 A;  1PGX A;  1E7V A;  3UQB A;  2MBO A;  4W9K A;  5DPS A;  2KKC A;  3EEC A;  4A8X C;  2D2Q A;  3W1Y A;  2KTR B;  4KDL B;  3VDZ A;  3U2S C;  1E8X A;  1VCB A;  4WJN A;  4PS7 A;  3PHX B;  1FCL A;  1M4V A;  4TQ1 A;  3ZW3 A;  3W1S A;  4ICV A;  2KQS A;  2M8S A;  4OZB A;  3ZJU A;  2FCS A;  2MBB B;  4GDK A;  3DBR I;  5D94 A;  1XT9 B;  1EF5 A;  4MDK E;  3KLS X;  4P7I A;  1FM0 D;  3MP9 A;  2LGS A;  3ZUN A;  2MP2 B;  3QHT A;  2GB1 A;  2L0F A;  1OFF A;  3KH0 A;  2ZNV B;  2MLB A;  4GIV A;  3L16 A;  1WRI A;  1V86 A;  2LHE A;  4GDL B;  1XO3 A;  2MJD A;  3JSV B;  5DPT A;  1V1P B;  4ZHP A;  4AJW A;  2KDI A;  3K9P B;  3APF A;  4OVU A;  1HXY D;  3C8Y A;  4CYE A;  3QA8 A;  3T9L A;  2RD0 A;  1XLP A;  2EKI A;  1EWC A;  1JAL A;  4FJV B;  1XLN A;  4A6Q A;  4HDQ A;  3IVF A;  2KQ4 X;  4F8C B;  3RYT A;  3DHH C;  5BO4 B;  4K3B A;  2AWT A;  2D3G A;  4YSZ B;  1IGC A;  1QIL A;  2LXA A;  1NEN B;  2KNB A;  1QQR A;  3T3O A;  2IZV B;  1C4A A;  2CJN A;  2X8X X;  5IA7 A;  4FJZ A;  4ZYN A;  4RMA A;  3VRA B;  1H8C A;  3OJ4 B;  3ZNH B;  4GLS C;  1WXA A;  1L0X B;  4RF0 A;  3U52 E;  2KTR A;  4TKN A;  1F77 A;  1IBX B;  3RZW C;  4RGN A;  4XDC A;  5DPR A;  1TS4 A;  3DPD A;  3PRP B;  1C76 A;  3GZN B;  1A5R A;  2DYB A;  4K1R B;  4ASW C;  2LHD A;  3W5V B;  4C56 C;  4OW0 A;  4HJG E;  2OOB B;  2KVZ A;  1JQ4 A;  3SEB A;  3E56 A;  3R7Q A;  2JX5 A;  1KH0 A;  1V5O A;  4WIP A;  1TZO A;  3AV8 A;  5TR5 A;  3P63 A;  1ZPS A;  4W9J A;  1TKE A;  2LVP A;  2O6V B;  4RM9 A;  4REZ A;  3V6E B;  3CIR B;  1F2R I;  2CJO A;  1QF6 A;  4GDL A;  3AB5 A;  2FCQ A;  3HIZ A;  3JSV A;  3NVZ A;  1V1P A;  1WR6 E;  2ZVN A;  4TQ0 A;  3KUZ A;  3B0A A;  2DHZ A;  1XXG A;  3VTU A;  3RD2 A;  4LNO A;  5IKC M;  3N3K B;  1KF6 B;  2N1W A;  2WXL A;  4PT5 A;  1OQR A;  1HTQ A;  2DYM A;  4C4V B;  3ZVV A;  1E5W A;  1ET9 A;  2KAN A;  2KVR A;  3W5U B;  1MFW A;  2AL6 A;  1XLO A;  2N0S B;  2JT4 B;  2FAZ A;  3H9D A;  2LGI A;  4DXG A;  2N9X A;  2RDG A;  4OVV A;  1MJD A;  3APC A;  3VH4 B;  1RFK A;  5IN7 A;  4NJ6 A;  3U4E G;  1NYQ A;  3PLU A;  2BBC A;  4FXC A;  4GU2 A;  1CMX B;  3X0W A;  3ETR A;  4ACF A;  3VH3 B;  2G1E A;  4BAX A;  3RNF C;  1XF5 L;  4WWO A;  3RI7 C;  4D2K A;  3KYD D;  3OAW A;  4A55 A;  3HRD D;  4MJS B;  4EUT A;  1XLQ A;  3AXC A;  1IBX A;  3V60 A;  2MW5 A;  4XX5 A;  2ZW1 A;  3N1Y C;  1LGR A;  2MRP A;  2IGG A;  3Q3O C;  2V3N A;  1J0G A;  4LDT D;  4OZC A;  3SFD B;  1ZE3 D;  4IM0 A;  5HG2 A;  1D3Z A;  2I38 A;  2L76 A;  4RNA A;  2K3U A;  2QIL A;  2V4I B;  2AQ1 B;  1LXD A;  2VZK B;  1B1Z A;  2KX0 A;  3QAQ A;  2RSU A;  2J0J A;  1FFU A;  4NY0 A;  3KUD B;  2NMQ A;  4FBJ B;  1WM3 A;  2BS4 B;  2VRR B;  2ZEQ A;  4JX1 C;  3I57 A;  2N9K A;  4MGY E;  1IUE A;  2J52 A;  4P1B C;  2FID A;  4C4V A;  4DBG A;  3Q8A A;  4CQN A;  1EUV B;  2WGS A;  4ZYS A;  1NDD A;  4LLG M;  3AI5 A;  2JQR B;  4RFB A;  3ZTD A;  4EE2 A;  1K52 A;  1Y8R C;  1FIQ A;  2JWU A;  1LM8 B;  3JVZ X;  2G3Q B;  3NS1 A;  1HZ6 A;  2C9W B;  2VH1 A;  3ZXR A;  1JRU A;  2JZP A;  2LGY A;  1VZ7 A;  3P4R B;  2PLP A;  1I4R A;  2PIA A;  3Q8F A;  3E9S A;  3RNG C;  4MJS A;  3P4P B;  1YX6 B;  3HVD A;  1MHX A;  4C80 A;  3CSF A;  2WDR B;  1R4M I;  1JW9 D;  2IND C;  2DZK A;  3WAP A;  4GN1 A;  2FCM A;  2JRI B;  5LXH A;  1GB4 A;  4A3P A;  2E3T A;  1CZP A;  2PE9 A;  3T8M A;  1YJJ A;  1I7H A;  3GS2 A;  3AEC B;  2KAC A;  2LUE A;  2CHW A;  1TZ1 A;  3PZ8 A;  4N58 A;  1C1Y B;  2WXN A;  3ECI A;  2IO1 B;  3HUI A;  2ZW0 A;  4FHK A;  1J8C A;  1CK1 A;  2V9H A;  4WH4 A;  2HE7 A;  5L83 A;  4NAW B;  2R61 A;  1IP9 A;  4KSK C;  1FRR A;  1TS3 A;  3VHT C;  1FEH A;  3SR6 A;  4HJK A;  1JWU D;  1AYF A;  4AJY B;  2WX1 A;  2BWF A;  1SJH D;  2LMC A;  4PYZ A;  4NJ7 A;  2BPS A;  4LCD E;  1PGB A;  2N7J A;  2DZM A;  1YIW A;  5D3D A;  1KRH A;  3VQI A;  2BTE A;  3ZTC A;  4FJY A;  2L32 A;  4Q2J A;  3HM6 X;  2LGD A;  2Y5C A;  4I6N B;  5C2T B;  3DVN V;  2CR5 A;  3QC8 B;  5BYR A;  1IYF A;  3H6N A;  4S0R A;  2XK5 B;  2KMC A;  2UYZ B;  1YQB A;  4C00 A;  2SAK A;  1WMH A;  4PS3 A;  3N20 C;  1V97 A;  1VRA B;  3ZNI D;  3K9O B;  4NAM A;  3M3J A;  2I1J A;  4W9L A;  1AAR A;  3TMP B;  2DLB A;  3DBL B;  4NNJ B;  1ET6 A;  4LNF A;  2KFK B;  3IFW B;  1SIJ A;  1L4Z B;  1WXS A;  4JLC A;  2YVC A;  3BK2 A;  4KKI A;  4YTN B;  3PTF C;  2J0M A;  4EZK A;  2FCN A;  4YSX B;  3JW0 X;  4NJC A;  1C78 A;  3O13 A;  1IGD A;  1L4D B;  4NQK E;  1WGY A;  3Q3M C;  1EU3 A;  4DK5 A;  3ML8 A;  4MAC A;  4K81 A;  3BK1 A;  2EKE C;  2I1K A;  4HWI B;  1STE A;  3L17 A;  4NAW A;  3PRE A;  4ZOH C;  4ZRP A;  4IC7 B;  4B9K A;  1UUP A;  3MJ5 A;  1VR9 A;  3H7S A;  2KOX A;  2WXF A;  2PKO A;  2M0X A;  3APD A;  5CHV C;  1JRP A;  4W9C A;  1OTR B;  2WU2 B;  4NZL B;  1TY0 A;  2K25 A;  2BGF A;  5C23 A;  2QEJ C;  2WDT B;  1DGJ A;  2Y3A A;  3PHW B;  1T3Q A;  1WR1 A;  3DCG A;  1SE2 A;  3V62 A;  2N4F A;  3A33 B;  1TYG B;  2FE8 A;  5FR6 A;  1ZW7 A;  1DOY A;  3CMM B;  3NVV A;  3RPF C;  3SFE B;  4MGK E;  2CHZ A;  1KM7 A;  2AQ2 B;  2WDV B;  3ONS A;  4LJO B;  3AUL A;  1VZ6 A;  1LO5 D;  3EFU A;  3A1Q B;  5C3J B;  3B9J A;  5IAA C;  5EE1 A;  1N61 A;  3HK0 A;  3L08 A;  2KN4 A;  2DX5 B;  1J7B A;  1QT9 A;  2K5P A;  2LI5 A;  1E90 A;  3Q3J A;  2MBQ A;  4P16 A;  2H88 B;  2PJH A;  2WQY B;  3AE5 B;  2LJ5 A;  3N1X C;  1AWD A;  1WFY A;  1T0Y A;  5TSS A;  4DHZ B;  4PS8 A;  2LVO A;  2O6V D;  5HI1 A;  4JIO U;  3ALB A;  1WJU A;  2K39 A;  3BYY B;  4EOY A;  1TTN A;  1GC6 A;  2GRI A;  4II3 B;  1SB3 C;  2JSV X;  2K6D B;  2WXM A;  3GZN I;  3AE1 B;  5AZG A;  1YN5 A;  2WHI A;  3DVG X;  3VFK A;  3GE3 C;  2RPQ A;  4YWG G;  1VLB A;  1F9J A;  4HPP A;  2DZI A;  1TKG A;  2UWQ A;  1K53 A;  3AE2 B;  1WSP A;  2M0A A;  1Q10 A;  4K7U A;  2AYO B;  4BZA A;  5CHF A;  1VDV A;  4ITK A;  2VH2 A;  2JVC A;  5J2R A;  1F2R C;  3PLV A;  1XCT L;  5E6J A;  3AE4 B;  1BXT A;  2D3C A;  5I4D A;  2GBN A;  3AED B;  4BKG A;  4KIK B;  2JWZ A;  3A1Q A;  1V5T A;  2KN5 A;  3AEB B;  3I3T B;  1QLB B;  2JYT A;  2BYF A;  2HDE A;  3ZJV A;  3MC8 A;  1F0Z A;  1RM6 C;  4GOC A;  3ZIM A;  1OEY A;  2IO0 B;  4K7S A;  3GP7 A;  3RZF A;  3L0W B;  5HKH A;  1ZGU B;  1FCC C;  2PVO D;  4RF1 A;  3KW5 B;  4A9A A;  5BMI A;  2WNM A;  1DOI A;  4W9D A;  4HXD A;  2C7M B;  2M17 A;  3RMK C;  3NHE B;  2IO2 B;  3R2T A;  3PPA A;  2BT6 A;  4K7W A;  2L7R A;  3QK0 A;  3UI3 A;  2BB5 A;  2VZK D;  4G0N B;  2C60 A;  4DHZ E;  1GG3 A;  3Q8E A;  3OWE B;  5LLI A;  3NZ3 A;  1OQQ A;  1TY2 A;  4E74 A;  1UBQ A;  5CHW A;  1ZP0 B;  2JXT A;  2LVQ A;  3RCZ A;  4IM3 A;  1NI2 A;  4KX6 B;  4ZHO A;  3U7D A;  4NQL B;  1K50 A;  1C9F A;  3SHQ A;  1E7U A;  2SEB D;  3VRB B;  2B3A A;  2BYV E;  1UH6 A;  2C5L C;  2DAF A;  3MJW A;  3RNA C;  5IP4 D;  2W82 A;  1ZKH A;  2BW2 A;  1AN8 A;  3KWL A;  4JGH B;  2K9X A;  1P98 A;  1EWY C;  2A4Z A;  4MT5 A;  3RN9 C;  2Y5P A;  4ZRJ A;  1E0Z A;  2ICI A;  5D3I B;  5C1Z A;  4HEA 1;  4GXB A;  3UIP B;  3RUI B;  4KIK A;  3GOE A;  1HA5 A;  2DZJ A;  2V0G A;  4KGT A;  1TS5 A;  4KGR A;  4OVZ A;  4QAY A;  3QX1 A;  2RPV A;  2DAJ A;  1WXV A;  4G3X B;  4YSY B;  2BYE A;  1I4Q A;  4P6V F;  4DDG D;  1MHH E;  2KMA A;  1AW7 A;  1FD6 A;  1SE4 A;  1GAQ B;  4IUM B;  4ANU A;  2Q5W D;  1RWS A;  3B08 A;  2HTH A;  4MH0 E;  1GUA B;  3Q14 C;  4OHJ A;  1JWA D;  5CTR C;  1L7Y A;  3DBS A;  3DVG Y;  2KFJ A;  4DHJ B;  1MI0 A;  1K8R B;  4BBN C;  5E6O A;  2K8C A;  3ZYY X;  3P42 A;  1E8Z A;  1Q5W B;  2KO3 A;  2KMM A;  3MFG A;  3DOW A;  1GPX A;  3GE8 C;  1PGA A;  2ACZ B;  5IO9 A;  3PZ7 A;  1YJ1 A;  4KDI C;  1BUI C;  2KJR A;  2KWV B;  4B95 A;  2K8H A;  5H8Y E;  3RT3 B;  1WXQ A;  2NTS A;  3ABV B;  2V4L A;  3W1S C;  2RR9 A;  2CS4 A;  3AE6 B;  2D10 A;  2KWD A;  1D6E C;  1QZE A;  3IT6 B;  3KVF B;  1FO4 A;  1P7F A;  1WWT A;  4LNN A;  1GOZ A;  2HTM E;  4N59 A;  3VR8 B;  4K3C A;  2BYT A;  1D5Z C;  3CST A;  1L6U A;  1NBF C;  2QC8 A;  2KZR A;  1V9J A;  3EA6 A;  3FKY A;  5BMH A;  1L0V B;  2WX0 A;  5D7G A;  3V05 A;  4MEM A;  4OZA A;  4XE0 A;  3N30 A;  4FA6 A;  3Q3F A;  3ZRF A;  4F7Z A;  1SSN A;  1TJE A;  3TBL D;  3Q2A C;  3PRM B;  2W54 A;  4WWM A;  1UBI A;  4IW0 A;  1WF9 A;  1E6E B;  1T0Q C;  1MPE A;  2AL3 A;  2KX3 A;  4C7Z A;  3LJ3 A;  4MSM B;  4IDI A;  4URK A;  3NVW A;  1NI3 A;  1UZX B;  3DBL I;  1M94 A;  4IWO A;  3VVW B;  3UF8 A;  4W9G A;  3TUO A;  2OJW A;  1WRD B;  4TSS A;  5JZE B;  4MGZ E;  2G4D B;  3DWG C;  3JYU A;  1WJN A;  2MX2 A;  2KJH B;  1DYQ A;  1J7A A;  1KLG D;  1WGG A;  3NS8 A;  1WMH B;  2OHF A;  5LNK 1;  4EZJ A;  5FK9 C;  4JWU C;  4HDO A;  1C4C A;  1C3T A;  3EFC A;  1TGZ B;  4I6P A;  1YD8 U;  2HJ8 A;  4GB9 A;  4BOZ B;  5CX3 A;  4J6I A;  4IWP A;  3ZXV A;  2FUG 1;  1H4R A;  2V1Y A;  4HPM B;  3KYC D;  2B76 B;  2WXI A;  3BVZ A;  1ZXH A;  5JHB A;  2J0K A;  4FHJ A;  2KWC A;  1YNT E;  4BVU C;  5D6J B;  1SBB B;  3R7R A;  2WXH A; 
#chains in the Genus database with same CATH homology
 1WR1 A;  3DCG A;  4CYE A;  3V62 A;  2N4F A;  3QA8 A;  3T9L A;  2ZNV C;  4E71 A;  2KDF B;  5JH5 C;  3A33 B;  5FR6 A;  2NBU A;  2RD0 A;  1ZW7 A;  2NVU I;  3CMM B;  1WH3 A;  3R66 C;  4IWQ A;  2N7E A;  4MGK E;  2CHZ A;  1KM7 A;  3ONS A;  4FJV B;  4LJO B;  4KVG B;  3AUL A;  3VUX A;  1WY8 A;  4HDQ A;  3IVF A;  3EFU A;  3QQ8 B;  3A1Q B;  3AU4 A;  4F8C B;  3NY5 A;  3RYT A;  3V6C B;  2ZPY A;  5BO4 B;  2LZ6 A;  4XC2 A;  4W9F A;  5IAA C;  2NR2 A;  2AWT A;  2GBK A;  2D3G A;  2MWS B;  3S2A A;  2D11 A;  2KK8 A;  2LXA A;  2G45 B;  2JZ3 B;  3HK0 A;  3L08 A;  1UD7 A;  2KNB A;  2IY1 B;  2N1V A;  2IZV B;  2DX5 B;  5IA7 A;  4FJZ A;  2LI5 A;  3C0R B;  4G50 A;  4ZYN A;  4RMA A;  1E90 A;  3Q3J A;  2MBQ A;  4BKS D;  1H8C A;  3OJ4 B;  3ZNH B;  3M95 A;  2PJH A;  4KZC A;  1WGD A;  2ZPN A;  4RM8 A;  1WXA A;  2JZZ A;  1G6J A;  3UQA A;  4EZK A;  1WGH A;  2LJ5 A;  4F1S A;  3VTW A;  1XD3 B;  1WIA A;  2KTR A;  2GMI C;  4TKN A;  2JPH A;  3VTV A;  1WFY A;  2BF8 B;  3QWZ B;  4WAA A;  1T0Y A;  4GSW A;  3RZW C;  2O6V A;  5JHA A;  4B6W A;  4DHZ B;  3A4R A;  5DPR A;  4PS8 A;  2XBB C;  3DPD A;  2LVO A;  3PRP B;  2O6V D;  4JIO U;  3ALB A;  1A5R A;  1WE6 A;  1BT0 A;  1WJU A;  2DYB A;  2K39 A;  1P3Q U;  4EOY A;  4K1R B;  1TTN A;  3D32 A;  1GC6 A;  1RFA A;  4ASW C;  1L2N A;  4II3 B;  3WAO A;  2K6D B;  1E8Y A;  2KJ6 A;  3GZN I;  1WYW B;  5AZG A;  3V61 A;  1OQY A;  2OOB B;  1FXT B;  3EC8 A;  3R7Q A;  1SE9 A;  1ISN A;  1V5O A;  3DVG X;  1OGW A;  1IPG A;  3VFK A;  2WWZ A;  1LQB A;  2RPQ A;  5TR5 A;  2IBI B;  1WM2 A;  1F9J A;  2NS5 A;  3IBE A;  4W9J A;  2FNJ B;  2DZI A;  4HPL B;  2LVP A;  4AOF A;  5J18 A;  1SGH A;  2UWQ A;  5J17 A;  2O6V B;  4RM9 A;  2J7Q B;  2MA9 B;  3U8Z A;  3V6E B;  4GDL A;  4K7U A;  4JQW C;  1P9D U;  2MCN B;  2AYO B;  1R4N I;  5CHF A;  2FCQ A;  3HIZ A;  3JSV A;  1WR6 E;  3PGE A;  2NPT A;  2ZVN A;  4TQ0 A;  3KUZ A;  3B0A A;  3L13 A;  4KZ0 A;  2DHZ A;  2R2Q A;  2JVC A;  2PEA A;  5J2R A;  3VTU A;  3QJZ A;  3N32 A;  3RD2 A;  2OJR A;  2K8B A;  3N3K B;  4AP4 C;  2N1W A;  3AU5 A;  3PLV A;  2G4S A;  2BKR B;  2KTF A;  2MBE A;  5JZE B;  2DYM A;  2KWU B;  4EZL A;  3ZVV A;  1E5W A;  2KAN A;  2KVR A;  1KJT A;  4A20 A;  4BOS C;  2GBN A;  1J19 A;  2AL6 A;  3KUC B;  4BKG A;  1S1Q B;  2JRH A;  2REX A;  2JXX A;  2JT4 B;  4WJO A;  2FAZ A;  2N9E B;  2ZCC A;  3L10 B;  1WI0 A;  4KIK B;  2JWZ A;  3A1Q A;  3TIX A;  1V5T A;  2KN5 A;  3H9D A;  2L00 B;  5KHO A;  3I3T B;  5DCN A;  2NBV B;  4MM3 A;  4X57 B;  4PYU A;  1WE7 A;  2BYF A;  2N9X A;  4OVV A;  3ZDT A;  3APC A;  5EDS A;  1WX8 A;  3VH4 B;  4DWF A;  1P1A A;  1WJ4 A;  1Q1O A;  4NJ6 A;  4AUQ C;  4GOC A;  3ZIM A;  2CHX A;  1S3S G;  1OEY A;  2DEN B;  3PLU A;  1P0R A;  2IO0 B;  3DBH I;  4K7S A;  2XEW A;  4GU2 A;  4TUU A;  3RZF A;  1CMX B;  4IM2 A;  3L0W B;  3X0W A;  4LJP B;  3DDC B;  3VH3 B;  5HKH A;  1ZGU B;  1GNU A;  4WWO A;  2LGX A;  3KW5 B;  2N9P C;  2YLM A;  3KYD D;  3SU8 X;  3OAW A;  4W9D A;  3IG3 A;  4HXD A;  1X1M A;  2C7M B;  4MJS B;  2M17 A;  5G55 A;  4EUT A;  3NHE B;  4FAD A;  2AEH A;  2MQJ A;  1YX5 B;  3AXC A;  2IO2 B;  1XQQ A;  1U4A A;  3PPA A;  1TBE A;  3V60 A;  1V81 A;  2L7R A;  2MW5 A;  4K7W A;  3QK0 A;  2QHO A;  3VUY A;  4G0N B;  2C60 A;  4DHZ E;  1GG3 A;  4XX5 A;  5E6P A;  3OJ3 A;  4HCN B;  3OLM D;  2DYO A;  5LLI A;  1RAX A;  4E74 A;  2L3Z A;  1Z5S B;  2LRW A;  3ZNG C;  1UBQ A;  5CHW A;  4BKS A;  2MRP A;  5GMV A;  2KLC A;  1EF1 A;  2LVQ A;  2JUO A;  1WJ6 A;  3RCZ A;  4IM3 A;  4G11 A;  4IG7 B;  1HE8 A;  1NI2 A;  4N9F 4;  1J0G A;  4LDT D;  3PVL A;  4M0W B;  3U7D A;  4DXA B;  4IM0 A;  1D3Z A;  4NQL B;  1I42 A;  2L76 A;  1V49 A;  3ZLZ A;  3SHQ A;  1E7U A;  1LXD A;  2M1M A;  3O65 B;  2B3A A;  4W9I A;  2KX0 A;  2BYV E;  3WIM A;  3NZS A;  3QAQ A;  1UH6 A;  2C5L C;  2DAF A;  3MJW A;  4I6L B;  3PV1 A;  5AZF A;  1Q0W B;  1ZKH A;  2RSU A;  2J0J A;  3L54 A;  4NY0 A;  3KUD B;  2C7N B;  3VUW A;  2BWE S;  2KDE B;  4FBJ B;  1WX7 A;  3HM3 A;  4JGH B;  2R2O A;  3B1L X;  1WM3 A;  2EMS A;  3TCA A;  2VRR B;  2ZEQ A;  1P98 A;  3H1U A;  4LDT B;  1VD2 A;  2A4Z A;  2IYD B;  4HCP B;  4AWJ A;  4ZRJ A;  4MGY E;  3A9J B;  2ZCB A;  1Z2M A;  3LDZ E;  2FID A;  4NPN A;  1RRB A;  3RUL A;  3MTN B;  4DBG A;  5C1Z A;  3UIO B;  1EUV B;  4GXB A;  2KDB A;  3UIP B;  4TV3 A;  3ZRC A;  1NDD A;  3RUI B;  3AI5 A;  4KIK A;  3GOE A;  4A3O A;  2DZJ A;  3ZTD A;  2RGF A;  1WGR A;  2ZJD A;  1KLV A;  1Y8R C;  3QX1 A;  1KOT A;  2LD9 A;  1LM8 B;  1PQS A;  2DAJ A;  2IY0 B;  2JY6 A;  3JVZ X;  4HVB A;  1WXV A;  2G3Q B;  4G3X B;  1WXM A;  2BYE A;  2C9W B;  4DDG D;  2O2V A;  2KMA A;  1JRU A;  2ZZP B;  4W9H A;  2LGY A;  3PS6 A;  4IUM B;  4DHJ D;  4XZ4 A;  3H7P B;  4ANU A;  4BBN F;  5AZH A;  2PE6 B;  4MJS A;  2D07 B;  3B08 A;  3UIN B;  4BFR A;  2HTH A;  1YX6 B;  3PZD A;  2KLG A;  3CSF A;  4ZRK A;  1R4M I;  4MH0 E;  1GUA B;  2CKH B;  4ZRI A;  4ICU A;  3QCA A;  4MGI E;  4YL8 A;  2IO3 B;  1WZ3 A;  2DZK A;  2FUH B;  5CTR C;  4ANX A;  2GBJ A;  3WAP A;  4II2 B;  4GN1 A;  2FCM A;  3EHV A;  1L7Y A;  3DBS A;  2JRI B;  3DVG Y;  2KFJ A;  5LXH A;  1SIF A;  3HHM A;  4A3P A;  4JL9 A;  2Z0E B;  2L0T A;  2O2V B;  2PE9 A;  4DHJ B;  3VAW A;  2MSE D;  3ENE A;  4FUL A;  3WAM A;  1K8R B;  4WWN A;  3T8M A;  4BBN C;  1EO6 A;  5E6O A;  2K8C A;  4CHK A;  1E8Z A;  1Q5W B;  1V80 A;  2KO3 A;  3DOW A;  5DPW A;  2A5U A;  3MHS D;  4WJP A;  5E6N A;  3R3M A;  3SD5 A;  1YJ1 A;  2LUE A;  4KDI C;  1MG8 A;  2NCN A;  3PRZ A;  2KC2 A;  3A9K B;  2CHW A;  2N7D A;  1TZ1 A;  2KJR A;  4WQO B;  2KC1 A;  2KWV B;  4GDK B;  4B95 A;  1C1Y B;  2CU1 A;  2K8H A;  2IO1 B;  3ECI A;  4FHK A;  1J8C A;  3RT3 B;  5L83 A;  2HE7 A;  4HLE A;  4NAW B;  4W9E A;  1IP9 A;  4KSK C;  2PPH A;  2V4L A;  2WYQ A;  3VHT C;  2KQ7 A;  2Z0D B;  3W1S C;  2RR9 A;  2CS4 A;  4HJK A;  4KV2 A;  2GBM A;  4AJY B;  3ML9 A;  2WX1 A;  3A9J A;  2BWF A;  5AEK B;  2XK5 A;  3P2B A;  2D10 A;  3WA0 A;  1QZE A;  4MEL A;  4MSQ B;  1E8W A;  4NJ7 A;  4PYZ A;  4ANW A;  3KVF B;  3PSE B;  2BPS A;  4LCD E;  2DZM A;  1YIW A;  3QAR A;  3ZDM C;  3BY4 B;  3VQI A;  3VXW A;  3ZTC A;  3CST A;  2NBW B;  4FJY A;  4HK2 A;  2LXC A;  4WJQ A;  1NBF C;  4KSL C;  4M8N A;  2KFK A;  3SDL C;  3HM6 X;  2KZR A;  2FIF A;  2LGD A;  3WAN A;  1V9J A;  2K1F A;  1RLF A;  2ASQ A;  2KHW B;  2WX0 A;  4I6N B;  5D7G A;  4MEM A;  2KXJ A;  3DVN V;  2CR5 A;  3QC8 B;  2Y5B B;  3N30 A;  1GC7 A;  3Q3F A;  2Z59 B;  4FA6 A;  1IYF A;  3M62 B;  1UEL A;  3H6N A;  3PT2 B;  3ZRF A;  3H7P A;  2XK5 B;  3DVN U;  2KMC A;  2UYZ B;  2GBR A;  1YQB A;  4EFO A;  1WMH A;  4PS3 A;  4F7Z A;  1V2Y A;  2C7H A;  3TBL D;  4WWP A;  1WX9 A;  3PRM B;  3UGB B;  5KHQ A;  1OEY J;  3ZNI D;  2L05 A;  3K9O B;  1UGM A;  2I1J A;  3M3J A;  4W9L A;  2BKF A;  1AAR A;  1UBI A;  4GMV A;  4IW0 A;  3TL5 A;  2LWP A;  3TMP B;  3NOB A;  1WF9 A;  3DQV A;  2EMT A;  4NNJ B;  2HD5 B;  4M8M A;  2AL3 A;  2KFK B;  2KX3 A;  3A4S C;  2KD0 A;  3IFW B;  3U30 A;  4EEW A;  5D2M B;  3BIN A;  2JF5 A;  3LJ3 A;  4CO7 A;  1E7V A;  4MSM B;  3UQB A;  2MBO A;  4URK A;  4W9K A;  5DPS A;  3X23 A;  1UZX B;  3DBL I;  1M94 A;  4IWO A;  3VVW B;  3UF8 A;  4ZDV A;  2KKC A;  1LFD A;  3EEC A;  1WXS A;  2MP2 A;  2D2Q A;  2YVC A;  4JLC A;  1WZ0 A;  4GGQ A;  4W9G A;  1WRD B;  3W1Y A;  3PTF C;  3WAL A;  2J0M A;  2KTR B;  4MGZ E;  2G4D B;  2FCN A;  3JYU A;  4KDL B;  3VDZ A;  1WJN A;  1E8X A;  2MX2 A;  1VCB A;  1I35 A;  2KJH B;  3JW0 X;  4WJN A;  2M4N A;  3CF6 E;  3PHX B;  4PS7 A;  3TJP A;  1WGG A;  3NS8 A;  1WMH B;  3IHP C;  4TQ1 A;  4EZJ A;  2V3S A;  4NQK E;  3ZW3 A;  3W1S A;  1WGY A;  4ICV A;  4FLH A;  2KQS A;  4HDO A;  1C3T A;  2LAS A;  2M8S A;  3A9K A;  4DK5 A;  2FCS A;  1TGZ B;  4I6P A;  1GJZ A;  1YD8 U;  2MBB B;  3NZU A;  4GDK A;  3ML8 A;  3DBR I;  4K81 A;  1V6E A;  5D94 A;  2HJ8 A;  1XT9 B;  3QIJ A;  1EF5 A;  4MDK E;  2EKE C;  2I1K A;  4GB9 A;  4DDI D;  4HWI B;  4BOZ B;  3L17 A;  5CX3 A;  4P7I A;  4NAW A;  3PRE A;  4B9K A;  4IC7 B;  3M63 B;  4IWP A;  2GOW A;  2ZVO A;  4J6I A;  3ZUN A;  2MP2 B;  2MBH A;  3QHT A;  3H7S A;  3ZO5 B;  4E3C A;  3KH0 A;  2L0F A;  2KOX A;  2ZNV B;  2MLB A;  1H4R A;  4GIV A;  2M0X A;  2V1Y A;  3L16 A;  3APD A;  5CHV C;  4HPM B;  4W9C A;  2W9N A;  3KYC D;  1V86 A;  1OTR B;  5L95 C;  2LRU A;  2K6Q A;  4GDL B;  2K25 A;  4ANV A;  5LXI B;  2BGF A;  3JSV B;  5DPT A;  5C23 A;  3ZKJ C;  5JHB A;  2NPT B;  2WDT B;  4FN2 A;  4AJW A;  2KDI A;  2J0K A;  4FHJ A;  2KWC A;  3K9P B;  3ZNZ B;  4BVU C;  5D6J B;  2L8J A;  5G2N A;  3PHW B;  3APF A;  4OVU A;  3R7R A;  4BKT A;  4EKU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...