1YQBA

Human ubiquilin 3
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
88
structure length
88
Chain Sequence
SGLVPRGSPHLIKVTVKTPKDKEDFSVTDTCTIQQLKEEISQRFKAHPDQLVLIFAGKILKDPDSLAQCGVRDGLTVHLVIKRQHRAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Ubiquilin 3
publication title The Ubiquitin-like domain of Human Ubiquilin 3
rcsb
source organism Homo sapiens
total genus 20
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2005-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1yqbA01
3VH4B 2FCSA 2LASA 3KYDD 2KHWB 2MBBB 2MCNB 5DPTA 1FXTB 3DVGY 3KYCD 1V2YA 3T9LA 2GBRA 2REXA 2XEWA 3DBHI 1F9JA 1OGWA 2WDTB 4MGKE 3PSEB 3DDCB 1VD2A 3H7PA 1L7YA 1TBEA 3TIXA 3PT2B 2KDIA 2NPTA 2KMCA 1WZ0A 2NBUA 4ANUA 4FN2A 3MTNB 2DZKA 1VCBA 4KZCA 3B1LX 3JVZX 3UGBB 2OOBB 3N30A 1WMHA 2O2VA 3ZNZB 1LM8B 1Y8RC 4I6LB 4E3CA 1GNUA 2GBMA 1CMXB 4NAWA 4BOSC 3RZFA 5JHBA 5BO4B 2DYOA 4W9DA 4EKUA 2KFKA 2K8CA 2L7RA 2KKCA 5CHWA 3HIZA 1V80A 1WXSA 2O6VD 3APDA 4EFOA 3U8ZA 1MG8A 3DOWA 5GMVA 5CX3A 2JF5A 4MH0E 1E8ZA 1WGYA 4BVUC 4E71A 2KMAA 2M8SA 1WGRA 4FULA 1XT9B 2YVCA 4K1RB 5LLIA 2FUHB 4HPMB 4M8MA 4CYEA 3VH3B 4GSWA 2KXJA 5CHVC 1P0RA 2KDBA 2IBIB 1GJZA 4W9HA 2MRPA 1WXMA 5G2NA 2UYZB 2A4ZA 5AZHA 4FJYA 2JZ3B 5CTRC 1S3SG 2N9EB 5D94A 4B95A 2ZNVB 2LZ6A 2LI5A 4DWFA 2LRWA 4AP4C 1RLFA 2LGXA 4HDOA 3ZVVA 2NVUI 2AEHA 1LFDA 2BYFA 4ANWA 2KJ6A 3SD5A 1PQSA 2LGYA 2CHZA 4DDGD 3AU5A 1UBQA 4W9IA 2D07B 2BYEA 1E7VA 4N9F4 2C9WB 2DZJA 3VTUA 1UBIA 2JRIB 2N7DA 3ZRFA 2DX5B 3PVLA 1YJ1A 2GBJA 1M94A 3PLVA 3WAMA 2FCMA 1EUVB 1GC7A 1P98A 2LRUA 3CMMB 3UQAA 2N1VA 3ML9A 4KDLB 4I6PA 2K8BA 2KVRA 1SIFA 3GOEA 2JXXA 5L83A 2LD9A 2M0XA 1R4MI 2GBKA 2WX1A 3PRZA 5JHAA 3B0AA 3KW5B 2VRRB 2IY1B 1E8XA 3L08A 3DQVA 2C7NB 3OJ3A 3SU8X 2JPHA 4HPLB 4F1SA 3VDZA 2GOWA 5DPWA 2BWFA 1WX8A 2JUOA 2J0JA 4G50A 3UF8A 4GB9A 3ZNHB 1WGGA 4HK2A 3W1SC 3IHPC 3APCA 2N9PC 3EFUA 1LXDA 3DPDA 3HK0A 3TJPA 2G4SA 2B3AA 3OAWA 1YD8U 4W9KA 3TL5A 2DYMA 2GMIC 2V3SA 3DBRI 3HM3A 4BKSD 4K7UA 1V81A 5LXHA 1OTRB 2ZCBA 2EMTA 4HLEA 3TCAA 4WWOA 3RULA 4FHJA 3W1SA 5J18A 4TV3A 1WJ4A 2GBNA 4KSLC 1E5WA 2IZVB 2JWZA 2JY6A 2AYOB 1EF5A 3MHSD 1WGHA 3PPAA 1ZGUB 2K25A 2V4LA 4HDQA 2RPQA 1RFAA 3PHWB 2I1JA 2WWZA 2KWVB 1WGDA 2XBBC 4NNJB 1WJNA 2QHOA 1J8CA 2KNBA 2ZZPB 4IUMB 2IYDB 1TGZB 3AI5A 3K9PB 2FIFA 1I35A 2KWUB 4GU2A 4W9FA 2DYBA 2A5UA 4IWQA 4EOYA 4W9GA 3VUWA 1WJ6A 5LXIB 1V49A 2MA9B 3X23A 1E8YA 2LVOA 2XK5A 3W1YA 1GG3A 4BOZB 1XQQA 4W9JA 4PYZA 2MP2B 3TBLD 2KJRA 2ZCCA 5C1ZA 2C7MB 4HCNB 5AEKB 2MBOA 1WR1A 3DBLI 4WQOB 3RYTA 2G45B 4GOCA 2R2QA 2DAFA 5IA7A 3AULA 3VHTC 3VXWA 3H7SA 2LXCA 1E90A 1ISNA 2NCNA 1E7UA 5KHQA 5AZFA 2ZVNA 2J0MA 3QIJA 4J6IA 3TMPB 2BKFA 4MGYE 2HTHA 4XX5A 4GMVA 3A9JA 4RMAA 4RM9A 2HJ8A 4TQ0A 4W9CA 2YLMA 2M4NA 3RCZA 3NOBA 3N32A 3R66C 1WJUA 4MJSA 4BKTA 2NBVB 4BBNC 2K39A 1P3QU 1GUAB 5C23A 4GDKB 2KDFB 1YX6B 1V6EA 3ZDMC 3WAOA 2N9XA 1V9JA 2IO1B 1WM3A 1GC6A 1HE8A 1E8WA 3NHEB 3QQ8B 3AU4A 3RZWC 3VTVA 1UD7A 1WF9A 4LDTB 1G6JA 5J17A 2BF8B 5D7GA 2BYVE 3M3JA 4GN1A 1I42A 4MSMB 2IO3B 2MBHA 4MSQB 5E6NA 4KIKB 2RD0A 4FADA 3NS8A 2CS4A 4GXBA 4ZRJA 3PS6A 2UWQA 3KUDB 3DVNV 2KOXA 1WRDB 3ZLZA 2FCNA 3VTWA 5HKHA 4EZLA 3HM6X 1SGHA 4TKNA 3ZO5B 4AUQC 2D11A 2NBWB 2MSED 4IM3A 3QX1A 1WX7A 3V6CB 4BKGA 3RUIB 4ZRKA 4YL8A 4A3PA 4MGIE 3UQBA 2CHWA 4IWOA 4B6WA 2HE7A 3WIMA 2PEAA 5G55A 1J19A 3A33B 3L17A 2J7QB 2MLBA 2RGFA 3AXCA 1T0YA 4IG7B 4WJOA 4NQKE 3QJZA 3OLMD 3APFA 2CKHB 5JH5C 2MP2A 2KQ7A 4DHJD 2DENB 3SDLC 4ASWC 1Z5SB 2MBQA 1K8RB 2D2QA 3WAPA 3H7PB 4PS3A 2FCQA 1WXAA 4HVBA 5CHFA 1KM7A 3M62B 3PGEA 3QWZB 2KN5A 4ICUA 3U30A 4KDIC 4ZRIA 2KX3A 3ECIA 1NBFC 2BKRB 2DHZA 2WX0A 2KTRB 1XD3B 2AL6A 3M63B 3L13A 3UINB 1S1QB 3IFWB 4K7WA 4W9LA 1Q5WB 1UGMA 1X1MA 2C60A 3NY5A 4MGZE 3BY4B 3L10B 3Q3JA 1WH3A 5EDSA 2ZVOA 2KJHB 3M95A 5AZGA 2N1WA 4IWPA 2L8JA 1C3TA 1KLVA 4DHZE 2KANA 2O6VB 4HJKA 2ZNVC 4WAAA 3PRPB 2KWCA 3DCGA 3V62A 4WJQA 2K6DB 4ZDVA 2PE6B 2EKEC 4OVVA 2EMSA 3A9KB 3HHMA 2WYQA 2LUEA 1KJTA 5D2MB 4BKSA 3A4RA 5FR6A 3L16A 3PRMB 4K7SA 4IC7B 3U7DA 3PREA 3PV1A 2DZMA 3H9DA 4KIKA 4DBGA 4ZYNA 3UIPB 3QCAA 2JT4B 4LCDE 5IAAC 4A20A 4FJVB 4AJYB 2PJHA 4DXAB 2MWSB 1AARA 3T8MA 5E6PA 5L95C 3A1QB 4EZKA 4NPNA 2BWES 4WWNA 4GGQA 4GDLB 1YQBA 5D6JB 4ANVA 4MM3A 1YX5B 2FNJB 3ENEA 2K1FA 3V61A 2BPSA 1L2NA 2KZRA 4MDKE 3QC8B 1NDDA 4AOFA 2KK8A 4G0NB 4KV2A 3P2BA 4CO7A 4FLHA 3VUXA 1C1YB 3KVFB 4PYUA 2BGFA 3DVGX 5TR5A 1WE7A 1UZXB 2L76A 2RSUA 3ZUNA 4P7IA 3C0RB 4HCPB 4F8CB 4AWJA 1SE9A 3NZUA 2NS5A 2Y5BB 3RT3B 3VFKA 4DHZB 4B9KA 2AL3A 4NY0A 2KTFA 4II2B 5DCNA 1V86A 3R3MA 2KDEB 3H1UA 4IM2A 3KH0A 1Q0WB 2L00B 3QAQA 3PLUA 4GIVA 4DHJB 1IP9A 1WIAA 4AJWA 5E6OA 4G11A 2CR5A 3QA8A 3I3TB 3WANA 4EZJA 2KFJA 2M17A 4BBNF 4WJNA 1WM2A 2OJRA 4TQ1A 1LQBA 2KTRA 4ICVA 3ZW3A 2Z0DB 3PTFC 3S2AA 3V6EB 2N7EA 2MQJA 1D3ZA 3JSVB 3DVNU 3ML8A 4HWIB 2V1YA 3NZSA 4II3B 2RR9A 2ZPNA 2KLGA 3IVFA 4E74A 3VUYA 3JW0X 1V5OA 3JYUA 4KSKC 4MEMA 4EEWA 3ZNGC 2KX0A 2O6VA 3IBEA 2MX2A 4G3XB 4WWPA 2DZIA 4FA6A 2IY0B 3A9KA 2JRHA 4I6NB 4URKA 1RAXA 1Q1OA 2LVQA 3KUZA 1WFYA 3R7QA 4TUUA 1TTNA 3CF6E 4F7ZA 3EC8A 4M0WB 2LGDA 2LJ5A 3B08A 3A4SC 3D32A 1WZ3A 4DDID 2ASQA 2M1MA 4BFRA 4FJZA 2D10A 1EO6A 4X57B 3A1QA 4OVUA 2XK5B 1ZKHA 2L0FA 2PE9A 4GDLA 3EECA 3SHQA 2PPHA 2DAJA 4WJPA 2ZJDA 2KC1A 4HXDA 5KHOA 1BT0A 4K81A 4XC2A 2G4DB 1IYFA 4NQLB 2FAZA 4CHKA 3ALBA 2K6QA 2FIDA 1KOTA 3PHXB 2AWTA 2LWPA 4JIOU 1J0GA 3OJ4B 2IO2B 1NI2A 2NPTB 4NJ7A 2LVPA 2K8HA 2ZPYA 1TZ1A 3WALA 3ZDTA 2I1KA 4MELA 1YIWA 4DK5A 3RD2A 3O65B 3A9JB 5DPSA 1WMHB 2O2VB 2ZEQA 4LJOB 4JLCA 1UH6A 1Z2MA 4XZ4A 1WX9A 4NAWB 1V5TA 2C5LC 3N3KB 2KC2A 2Z0EB 4MJSB 2KLCA 2IO0B 1UELA 1H4RA 2Z59B 2G3QB 2LXAA 2KFKB 4GDKA 2HD5B 1ZW7A 1OQYA 3V60A 4JL9A 3X0WA 4M8NA 3ZTCA 2L3ZA 2KO3A 4LDTD 3LJ3A 1WE6A 1R4NI 3L0WB 3ZTDA 3DBSA 4KZ0A 3KUCB 2NR2A 3R7RA 1WI0A 1A5RA 3LDZE 2JZZA 1WXVA 3EHVA 4IM0A 2C7HA 2L05A 3VVWB 4RM8A 3QK0A 4KVGB 1OEYJ 4LJPB 3WA0A 3UIOB 3CSTA 3JSVA 5JZEB 2L0TA 3ONSA 3Q3FA 4IW0A 3L54A 1JRUA 2W9NA 1WR6E 4JGHB 1OEYA 4PS7A 3ZKJC 4A3OA 1RRBA 4W9EA 3H6NA 1IPGA 4FHKA 1P9DU 3CSFA 4NJ6A 1EF1A 2J0KA 2D3GA 2KD0A 3PZDA 1H8CA 1P1AA 2MW5A 4EUTA 2JVCA 3K9OB 2R2OA 2MBEA 3ZRCA 3BINA 1WYWB 3VQIA 4JQWC 1QZEA 1U4AA 3QHTA 3ZIMA 4FBJB 3IG3A 2CHXA 1WY8A 5DPRA 4ANXA 2CU1A 3VAWA 3GZNI 3ZNID 4PS8A 5J2RA 2N4FA 3QARA 3MJWA 2KQSA
chains in the Genus database with same CATH superfamily
2MCNB 3PZ7A 4LLGM 2JU6X 3T9LA 2REXA 5I4DA 1OGWA 4MGKE 2PTLA 2BB6A 3PT2B 2L1AA 1WZ0A 4FN2A 3MTNB 1M4VA 2O2VA 2YEPF 3ZNZB 1LM8B 2AX5A 1CMXB 4W9DA 2K8CA 2XNAC 3U8ZA 3DOWA 3KWVA 5GMVA 2VZKD 2JF5A 4MH0E 2CU3A 4FULA 2FUHB 4HPMB 2KMMA 2RMMA 4M8MA 3VH3B 1T6BX 2KDBA 1TS3A 4W9HA 2J53A 2UYZB 5CTRC 1Q10A 2L52A 3Q8FA 4B95A 2LZ6A 4KKIA 2LGXA 1LO5D 2NVUI 2Z8LA 2KJ6A 1SE4A 1KLUD 4DDGD 2BYEA 2C9WB 4HEA1 4BZAA 1GC7A 3AECB 3LYYA 3CMMB 5H92C 4C00A 4YXDB 1RWSA 1V1PB 1YOVB 1DOIA 2WX1A 2EKIA 1L4ZB 4LNOA 4K3BA 1TT5B 4WAFA 3VDZA 1N5XA 3UF8A 4GB9A 1WGGA 1WRIA 2N9PC 1LXDA 3DPDA 3TJPA 1XLPA 2V3SA 3DBRI 1V81A 4FXCA 3E56A 3E9SA 4WWOA 4TV3A 2GBNA 2IZVB 1EF5A 4K3CA 2CJNA 3MHSD 3PPAA 4HDQA 5BYQA 2I1JA 4ZRPA 2KWVB 4M02A 1N6ZA 1D5ZC 1TGZB 4S0RA 2IJ0A 3MP9A 2KWUB 2I2YA 2D3CA 4W9GA 3VUWA 2WXLA 5LXIB 4YSYB 2LVOA 3W1YA 1GG3A 3W5UB 2MP2B 3TBLD 5C1ZA 1QOFA 1JWMD 2C7MB 2LGIA 2MBOA 4ZOHC 4ITKA 2G45B 4ZYSA 2R2QA 5IA7A 2NCNA 1E7UA 2ZVNA 4MGYE 4RM9A 1XF5L 1MI0A 2FBWB 2M4NA 4AS1A 1YN3A 1L6UA 3AE8B 1ET6A 2LFIA 2LGSA 1XLNA 3AEBB 3ZDMC 2N9XA 3Q8AA 1WM3A 1E8WA 3QQ8B 1UD7A 3B2FA 4LK0M 5D7GA 2BYVE 3IAS1 2JYEA 4XGAB 2MBHA 1FM0D 4A9AA 1VZ8A 2RD0A 4JWSC 2V3NA 4A55A 2KOXA 1WRDB 2W55A 3ZLZA 3B9JA 4AUQC 3ZO5B 2JSVX 4TSSA 1B9RA 2JXTA 1YJIA 2KN4A 3URYA 4YL8A 2M19A 4A3PA 1JRPA 1P7EA 2CHWA 4IWOA 4B6WA 2WDVB 3RN9C 3Q8CA 3DBHB 2RGFA 3BYYB 3AXCA 2IGDA 1XXGA 1OQRA 1XCQL 4DHJD 2DENB 2MBQA 4PS3A 1KM7A 3M62B 4KDIC 3ECIA 3IT4B 4LNFA 1RYJA 2WXRA 3M63B 4MGZE 2WS3B 4YSZB 3W2DA 1WH3A 1V8CA 2ZVOA 2KJHB 5AZGA 2JX5A 2KANA 2KWCA 1EU3A 4ZDVA 2EKEC 4OVVA 3A9KB 4GLSC 3EUB2 2WYQA 2LUEA 1C4PA 4IC7B 4RGNA 2BBCA 3H9DA 3PV1A 4DBGA 4ZYNA 3NG0A 2KT7A 4LCDE 4AJYB 2QJLA 3KQ4A 2N7JA 3T8MA 5L95C 4WWNA 4GGQA 4GDLB 4ANVA 3AB5A 3ENEA 4OZAA 3KLSX 1NDDA 3BVGA 3BK2A 4KV2A 4CO7A 3P4SB 3HVZA 5TR5A 1DOXA 3HUIA 4AWJA 2NS5A 4P1BC 4OZBA 4IKGA 1DOYA 2RDBC 3PLUA 3RNAC 1XCTL 1IP9A 1GB1A 4AJWA 4XWWA 3AMZA 2KFJA 1TYGB 4WJNA 3I9V1 4A6QA 3B2GA 1KLGD 5HI1A 4OZCA 1D3ZA 3JSVB 4HWIB 4II3B 1QOAA 2QC8A 3IVFA 3JYUA 4S17A 1JALA 3R2TA 4C7ZA 2DZIA 2IY0B 4I6NB 1I4PA 1RAXA 1WFYA 5LNK1 1C78A 4F7ZA 4M0WB 1FFVA 2V3PA 5D3DA 2ASQA 1BMLC 4OVUA 2XK5B 1ZKHA 2DLBA 4WJPA 2LUMA 4J3OD 4K81A 4NQLB 2FAZA 1TIFA 1T0SC 4YTNB 2LWPA 3OJ4B 4NJ7A 3WALA 1TZ1A 1NI3A 4MELA 3RD2A 4KGRA 2O2VB 4LJOB 1Z2MA 3PO0A 4HKZE 1WX9A 1QOGA 1V5TA 4RFBA 2KC2A 4MJSB 1H4RA 2LXAA 4JL9A 3DHHC 3ZTDA 3TEYA 2NR2A 3VVWB 1R7SA 4P1CC 5C2TB 1T3QA 2L0TA 3Q3FA 3NUHB 3L54A 2W9NA 4PS7A 4ZRQA 4A3OA 4EE2A 4W9EA 1YQ3B 4NJ6A 2J0KA 1PGXA 3PZDA 2JVCA 2R2OA 2MBEA 3T3OA 3BINA 2W3RA 2K3UA 1QZEA 3ZIMA 3DWGC 1GB4A 1RFKA 4YWGG 3QARA 1ZDVA 1QT9A 2KQSA 2FCSA 2KHWB 2MBBB 5DPTA 1FXTB 3DVGY 2WNMA 3MJ5A 1UWMA 2GBRA 2Y3AA 2XEWA 3DBHI 2WXPA 2WDTB 2J52A 3NVVA 3PSEB 2QILA 3DBRB 1L7YA 1TBEA 3TIXA 2KDIA 2MHJA 2NPTA 1TS4A 2NBUA 2QMTA 3RNEC 2X38A 2OOBB 3RZFA 2L32A 2DYOA 2WXJA 4P6VF 3Q3OC 4LNIA 3Q8EA 1FCCC 1WXSA 2KDMA 2L83A 1XLOA 2O6VD 2WHIA 5CX3A 4OW0A 4BVUC 4E71A 2KMAA 3GS2A 1WGRA 2YVCA 4K1RB 4CYEA 1AYFA 2V4IB 2INPE 5G2NA 2A4ZA 2JZ3B 3RNGC 1S3SG 4AP4C 1RLFA 4HDOA 3ZVVA 1VZ6A 1AWDA 2JQRB 1CJEA 1LFDA 2BYFA 2LGYA 4W9IA 2IPKD 4XYCA 1JMLA 3ZRFA 3PVLA 2PIAA 3MC8A 3PLVA 1P98A 2LRUA 3UQAA 2NMQA 4I6PA 4N6EB 5L83A 2LD9A 2M0XA 3AE1B 2GBKA 3PRZA 1E8XA 3L08A 2C7NB 3OJ3A 3SU8X 4F1SA 2Y5CA 1WX8A 4HJGE 1CK1A 1SE2A 4G50A 3ZNHB 4HK2A 3W1SC 3APCA 2IDYA 3R8BA 2G4SA 2B3AA 3BZDB 2DYMA 3HM3A 2WXFA 1OTRB 2ZCBA 4HLEA 4LNKA 3W1SA 3RULA 4FHJA 2E6XA 1VRAB 3AE9B 4KSLC 2WXHA 2JY6A 4RF1A 1FFUA 4KKJA 3H8HA 1FNWA 3PHWB 2WWZA 5FK9C 2QSDA 2XBBC 3ZJUA 1V97A 2N0SB 4NNJB 2KAJA 2QHOA 3N20C 2KNBA 3RNFC 3ZJVA 2IYDB 4JX1C 3BK1A 2HDEA 3BVMA 3I63C 4GU2A 2DYBA 2A5UA 3HRDD 1E8YA 2XK5A 2KQ4X 4W9JA 4PYZA 3V3XA 2KJRA 2ZCCA 1K51A 4HCNB 5AEKB 4GOCA 2DAFA 3TSSA 1KRHA 1NVID 3AULA 3H7SA 1E90A 1NYQA 4M00A 3IAM1 2J0MA 3QIJA 3TMPB 2BKFA 2HTHA 4YSXB 3SR6A 2KWDA 2BW2A 1ZXHA 4RMAA 2HJ8A 1V1OA 4TQ0A 2YLMA 3NOBA 3VRBB 5BMIA 3R66C 1WJUA 4MJSA 2MH7A 2K39A 3P63A 5C23A 3U2SC 1YX6B 5BYSA 1V6EA 3WAOA 1V9JA 3Q3MC 2W3SA 3NHEB 3AU4A 3C19A 3AE3B 1VJKA 4GN1A 1STEA 3NZ3A 4FADA 3MC0B 2CS4A 4GXBA 1JROA 2UWQA 3DVNV 3RNCC 2FCNA 4EZLA 1SGHA 1VLBA 3T3NA 2D11A 2MSED 1FCLA 3RUIB 4ZRKA 4LTUA 2QEJC 3WIMA 2PEAA 1I7HA 3Q2AC 5IO9A 1FRRA 4WJOA 4NQKE 1SF0A 3QJZA 3OLMD 3APFA 5JH5C 2WXIA 1DGJA 1K8RB 1SBBB 3AE2B 1E7PB 1E10A 2WP9B 4RCOA 4HVBA 5CHFA 1PGAA 4O1NA 4ICUA 3U30A 2DHZA 2QIEB 2AL6A 3O13A 3L13A 4W9LA 1IBXB 1X1MA 3NY5A 1KH0A 1F1HA 3BY4B 1K52A 2DWQA 3SFEB 5HFYA 1KLVA 4HJKA 1FRDA 3PRPB 3DCGA 4WJQA 2K6DB 2PE6B 4XE0A 5D2MB 3L16A 2M56B 3PREA 2DZMA 4KIKA 5IAAC 2VH1A 4A20A 4EZKA 4NPNA 4REZA 1TY0A 4YTPB 1JWSD 4BAXA 4MM3A 1YX5B 2K1FA 5IOIA 4AOFA 1OQQA 2KK8A 2INNE 1ZOYB 2LJIA 2D3AA 1HQRD 2E3TA 2AQ1B 4PYUA 2NTSA 4P7IA 3C0RB 1YQ4B 1SE9A 2RPVA 2XN9C 2Y5BB 3RT3B 2SEBD 4II2B 5DCNA 4IM2A 4UDUC 2IGHA 4GIVA 2KACA 1TS5A 4DHJB 1P7FA 2CR5A 3TUOA 3QA8A 3I3TB 4EZJA 3RFZB 2M17A 1QOBA 4TQ1A 1E9MA 2KTRA 3PZ8A 3ZW3A 3PTFC 4C56C 2BYTA 3V6EB 5BMHA 3DHGC 2MQJA 1F2RC 1I4HA 2HJ1A 3ML8A 2NTTA 4ZHPA 2V1YA 1TKYA 3ABVB 2RR9A 3LXFA 2ZPNA 2KLGA 4E74A 4L23A 4H2AA 4KSKC 4MEMA 4EEWA 3ZNGC 2KX0A 2MX2A 2JRHA 1VDVA 3U4EG 1TTNA 1F2RI 3CF6E 1ZE3D 3D32A 1C76A 1WZ3A 1YN4A 3NVWA 3DBLB 1EO6A 4X57B 3A1QA 2L0FA 3EECA 1QLBB 1K53A 1L5PA 2ZJDA 4HXDA 1BT0A 3AEGB 4CHKA 2AWTA 3TEXA 2IO2B 1NI2A 2NPTB 3TEWA 2K8HA 2ZPYA 4M01A 5DPSA 1UH6A 3OWEB 2C5LC 2IO0B 2GRIA 2G3QB 4JE3B 1WE6A 3DBSA 2PVOD 4IOIE 1WI0A 1A5RA 1AW7A 1WXVA 2JWUA 2PMVA 1MHHE 2D5GA 2LEKA 5TSSA 1JRUA 1WR6E 3ZKJC 1JWBD 1ROEA 1IPGA 1TJEA 3CSFA 1H8CA 2MW5A 4EUTA 3K9OB 5JXVA 1WYGA 4JQWC 3QHTA 1JWAD 5FKAC 3MJWA 4IDIA 3VH4B 2LASA 3KYDD 4CQNA 3MFGA 4KGTA 1HZ6A 1BXTA 2KVZA 1ET9A 4US9A 1JQ4A 2ONQA 1VD2A 4AQ7A 5E6JA 1AN8A 4KZCA 3VR8B 4C7YA 1KFYB 4OVZA 4ACFA 3N30A 1WMHA 1FXAA 2PW9A 4I6LB 4E3CA 2K5PA 4BOSC 5JHBA 1C79A 4NAWA 1IBXA 1MJDA 1BUIC 1HA5A 2KKCA 1V80A 5MPOA 3APDA 1MG8A 2M8SA 3N1YC 5LLIA 1GAQB 2WXOA 4GSWA 1P0RA 2IBIB 3C8YA 2MRPA 1WXMA 1FEHA 2QCZA 1FPYA 4ZHOA 2N9EB 5D94A 1T5XD 4RH6A 3SD5A 1WGKA 2CHZA 3AU5A 2RDHA 4N9F4 1E7VA 4XWTA 1VR9A 2DZJA 5C3JB 1UBIA 1YJ1A 1M94A 3WAMA 2K8BA 2KVRA 2WGSA 1R4MI 4NZLB 1ACCA 5G5GA 3B0AA 3KW5B 2IY1B 3DQVA 2N9LA 1NENB 2JPHA 4HPLB 2GOWA 5DPWA 2BWFA 2J0JA 1T0RC 1I4GA 3IHPC 3FKYA 3EFUA 4N58A 2WXGA 3CWIA 4W9KA 4A8XC 2GMIC 2V0GA 4BKSD 4K7UA 2R61A 2W54A 3EGRA 3TCAA 5J18A 2OEDA 4KGSA 3W9CB 1L0YB 1WJ4A 5IN7A 2AYOB 2ON8A 1EM7A 1WGHA 4RGTA 2K25A 2RPQA 3AEAB 1D4BA 2I38A 1WGDA 1GPXA 3SFDB 1XLQA 1I35A 4W9FA 3ZQ4A 1V49A 3R2IA 4BOZB 4YTMB 4L1BA 1UGJA 3KWLA 4HRSA 3DBLI 3VHTC 2AQ3B 2LXCA 1ISNA 5AZFA 1FXIA 4J6IA 1TY2A 4XX5A 5AUIA 2WU2B 1SE3A 4GMVA 3NVZA 3RCZA 1R4NB 3AEFB 1P3QU 1WWTA 3ETRA 4GDKB 2KDFB 3N9YC 3P42A 2CJOA 2IO1B 1HE8A 4XDCA 4NJCA 3RZWC 4RNAA 2W82A 4LDTB 1G6JA 2BF8B 1UWXA 1I42A 1I4RA 1NYRA 5E6NA 1LGRA 4KIKB 3PS6A 3KUDB 1HTQA 2QDFA 5HKHA 3HM6X 4MM3B 2NBWB 4IM3A 3QX1A 1WX7A 2Y5PA 3U7ZA 3V6CB 4WURA 4MGIE 3NRZA 3UQBA 3EA6A 1J19A 1TS2A 3AM9A 3L17A 2WXMA 1T0YA 3AH7A 1PFDA 2KQ7A 3Q69A 3HVDA 3SDLC 4ASWC 3WAPA 2D2QA 4WQMA 3H7PB 3AE6B 2FCQA 2MJEA 3PGEA 3QWZB 2KN5A 2LHDA 5BMGA 2BKRB 2WX0A 2KTRB 1XD3B 1S1QB 1UGMA 3ZXVA 3CIRB 3L10B 5EDSA 1EU4A 4IWPA 3AN1A 3MC9A 4R3DA 2VZKB 2EMSA 4MT5A 1KJTA 4BKSA 3A4RA 5FR6A 4K7SA 2WDQB 3U7DA 1TKGA 4PK1A 1KTKA 3QCAA 2PJHA 2MWSB 1FMAD 1GOZA 2G1EA 5E6PA 1UNSA 3A1QB 2BWES 5D6JB 2FNJB 3V61A 4HPPA 4B0MA 1L2NA 2KZRA 1ZP0B 1MPEA 4MDKE 3QC8B 3AV8A 1C1YB 1N63A 3BYTB 3KVFB 2BGFA 3DVGX 2L76A 3NJTA 3VFKA 4DHZB 4B9KA 4NY0A 2KTFA 2KYWA 1V86A 3P4PB 2KDEB 3H1UA 3R3MA 5EE0A 1Q0WB 3QAQA 3FILA 1WIAA 5E6OA 4G11A 1IGCA 4YT0B 2PLPA 2OJRA 1LQBA 3AE7B 4C4VB 3OG5A 1C4AA 3DVNU 1D6EC 2OHFA 3GE8C 3J9CA 3AE5B 3ZGZA 2N9KA 3VUYA 2BVCA 3JW0X 4JPSA 2O6VA 4B0EA 4WWPA 4G3XB 1C77A 1SEBD 3RI7C 4D2KA 1Q1OA 2LVQA 3KUZA 3R7QA 4TUUA 3L4PA 2WLBA 3EC8A 3IXSA 3A4SC 3EFCA 4DDID 2M1MA 4BFRA 1EWYC 2PE9A 3SHQA 1HTOA 2KC1A 1PGBA 2INCC 2G4DB 1IYFA 2K6QA 2FIDA 1KOTA 3W5VB 3PHXB 4JIOU 1J0GA 3LB8C 3WCQA 3ZDTA 1YIWA 4DK5A 3O65B 2LHEA 1NEKB 3A9JB 1A70A 1WMHB 2ZEQA 1SB3C 4JLCA 2WXQA 4XZ4A 1RM6C 4NAWB 4RGMA 1UELA 1OFFA 4GDKA 2ZW1A 2HTME 4WWMA 3N1ZC 1OQYA 3X0WA 5FR3A 4M8NA 3ZTCA 3L0WB 1R4NI 4WH4A 4KZ0A 1N60A 1XO3A 3EHVA 1FNVA 3P4QB 2VH2A 4IM0A 5AUKA 3QK0A 1OEYJ 4LJPB 3ZJTA 3WA0A 3UIOB 3I5JC 5JZEB 3ONSA 1MFWA 2B76B 1OEYA 1RRBA 4FHKA 2D3GA 2KD0A 2X8XX 3ZRCA 1WYWB 1R4MB 1U4AA 2M0AA 4FBJB 3IG3A 1WY8A 5DPRA 2CU1A 1HEZE 3VAWA 3GZNI 3ZNID 1MVKA 4PS8A 5J2RA 2N4FA 4L2YA 4DXFA 3KYCD 1V2YA 1L0VB 1F9JA 2WDRB 3DDCB 2BTEA 3H7PA 1B1ZA 2Q5WD 1FO4A 4JWUC 2KMCA 4ANUA 1SSNA 2DZKA 1VCBA 3B1LX 3JVZX 3UGBB 4A90A 2WXKA 4HKQA 1Y8RC 1GNUA 2GBMA 1C4CA 5BO4B 5EE9A 4EKUA 2KFKA 2L7RA 2PKOA 5CHWA 3HIZA 4EFOA 1E8ZA 1WGYA 1ENFA 1XT9B 2GB1A 2KXJA 5CHVC 1GJZA 5IP4D 5AZHA 4FJYA 3VRAB 4DWFA 2ZNVB 2LI5A 1ZUD2 2LRWA 2AEHA 4LNNA 2PVGC 4ANWA 1PQSA 3N1XC 1JCKB 1UBQA 2D07B 1QKZA 1CZPA 3VTUA 2JRIB 2N7DA 2DX5B 2GBJA 2FCMA 1EUVB 3FC4A 1JW9D 3GP7A 3UI3A 2N1VA 3ML9A 4KDLB 4US8A 4USAA 1SIFA 5IKCM 3GOEA 2JXXA 2H89B 5JHAA 3ZYYX 2VRRB 2MJ3A 5EE1A 4P16A 2JUOA 4QAYA 1PYWD 2K22A 2G9HD 3NVYA 3HK0A 3OAWA 1YD8U 3TL5A 5LXHA 2EMTA 4C4VA 2YEPB 4DXGA 5HHDG 1E5WA 2JWZA 1D5XC 1QQRA 1ZGUB 3GE3C 2V4LA 1RFAA 2EELA 5G5HA 3ZXRA 1WJNA 1MG4A 3RPFC 1J8CA 2ZZPB 4IUMB 3AI5A 2FE8A 3K9PB 2FIFA 4IWQA 4EOYA 2BS2B 1ZDXA 1WJ6A 2MA9B 3X23A 4WIPA 1XQQA 1SJHD 1WR1A 4WQOB 3RYTA 3VXWA 1PUTA 5KHQA 1V1PA 4MACA 3A9JA 4MH8A 5EE3A 4W9CA 1ZPSA 2ACZB 3N32A 4BKTA 2NBVB 4BBNC 1GUAB 1FIQA 1ESFA 2DNFA 1GC6A 2BS3B 4C80A 3VTVA 1WF9A 5J17A 1K50A 1J7BA 4N59A 3M3JA 2K0PA 4MSMB 1YMHE 2IO3B 4MSQB 4RF0A 3GB1A 4NAMA 3NS8A 1C9FA 4ZRJA 1Y56A 3VTWA 1WXQA 4TKNA 3AE4B 1E0ZA 4BKGA 1IUEA 2WU5B 3AEDB 2JZPA 2HE7A 5G55A 5BYRA 3A33B 2J7QB 2MLBA 2TSSA 4IG7B 1N5WA 1L6VA 1N61A 2CKHB 3RMKC 2GLSA 1T0QC 2MP2A 3I57A 3BIID 2MJDA 2UU7A 1Z5SB 1N62A 3Q8BA 1XEEA 2AQ2B 2MEKA 3FILB 2BS4B 1WXAA 4ARCA 1JWUD 1TKEA 4ZRIA 1PDXA 2KX3A 1NBFC 5GXGB 1J7AA 3UINB 1HZ5A 3IFWB 4K7WA 1Q5WB 2C60A 3Q3JA 5H8YE 2OJWA 1KF6B 5T8IA 3M95A 2N1WA 1C3TA 2L8JA 1UF0A 4DHZE 2O6VB 2ZNVC 4OHJA 4WAAA 3V62A 1SIJA 3HHMA 1E6EB 3PRMB 3V05A 3SEBA 3UIPB 2JT4B 4FJVB 4DXAB 1AARA 4XDDA 1YQBA 2DBYA 2BPSA 4G0NB 4PT5A 3P2BA 4DQOC 1SJED 4FLHA 3VUXA 2LMCA 3DHIC 1WE7A 1UZXB 2D3BA 2RSUA 3ZUNA 4HCPB 4F8CB 1YN5A 4HROA 3NZUA 2AL3A 1QF6A 2BT6A 1L4DB 2K9XA 3KH0A 2L00B 2JYTA 3Q6BA 1HXYD 3WANA 4BBNF 1WM2A 4RGOS 2RDGA 3MHZA 3DWMA 2GI9A 4ICVA 5D3IB 2Z0DB 3S2AA 1I4QA 3U52E 2N7EA 3RNBC 3NZSA 2J4XA 1V5OA 2H88B 2J42A 1J7CA 3GZNB 3IBEA 4FA6A 3A9KA 4URKA 1WSPA 4ARIA 2LGDA 2LJ5A 3B08A 3NS1A 2FUG1 4KX6B 1TZOA 2WQYB 5HG2A 4FJZA 2D10A 1ZXIA 4GDLA 1DYQA 2PPHA 2DAJA 5KHOA 4XC2A 1UUPA 3ALBA 2BQQA 3P4RB 2LVPA 3FAHA 2SAKA 1F77A 2I1KA 2ZW0A 3Q3NC 1YNTE 1FNUA 4Q2JA 3N3KB 2Z0EB 2KLCA 3BVZA 1YJJA 3Q14C 2Z59B 2KFKB 1VZ7A 2HD5B 1I4XA 1ZW7A 3V60A 2ICIA 2L3ZA 1EWCA 2KO3A 1D5MC 3LJ3A 4LDTD 3TEZA 2WXNA 3KUCB 3R7RA 1L0XB 3LDZE 2JZZA 4TMAB 2C7HA 2L05A 3BWUD 2INDC 4RM8A 4KVGB 1CQVA 3VR9B 3CSTA 3JSVA 3IT6B 2BB5A 3P1MA 1QILA 3AEEB 4IW0A 4JGHB 1FD6A 3H6NA 1P9DU 1IGDA 2IGGA 1EF1A 1P1AA 1SXTA 1MHXA 3VQIA 1F0ZA 2CHXA 4ANXA 1F52A 4M0WA 2V9HA
chains in the Genus database with same CATH topology
3VH4B 2FCSA 2LASA 3KYDD 2KHWB 2MBBB 2MCNB 5DPTA 1FXTB 3DVGY 3KYCD 1V2YA 3T9LA 2GBRA 2REXA 2XEWA 3DBHI 1F9JA 1OGWA 2WDTB 4MGKE 3PSEB 3DDCB 1VD2A 3H7PA 1L7YA 1TBEA 3TIXA 3PT2B 2KDIA 2NPTA 2KMCA 1WZ0A 2NBUA 4ANUA 4FN2A 3MTNB 2DZKA 1VCBA 4KZCA 3B1LX 3JVZX 3UGBB 2OOBB 3N30A 1WMHA 2O2VA 3ZNZB 1LM8B 1Y8RC 4I6LB 4E3CA 1GNUA 2GBMA 1CMXB 4NAWA 4BOSC 3RZFA 5JHBA 5BO4B 2DYOA 4W9DA 4EKUA 2KFKA 2K8CA 2L7RA 2KKCA 5CHWA 3HIZA 1V80A 1WXSA 2O6VD 3APDA 4EFOA 3U8ZA 1MG8A 3DOWA 5GMVA 5CX3A 2JF5A 4MH0E 1E8ZA 1WGYA 4BVUC 4E71A 2KMAA 2M8SA 1WGRA 4FULA 1XT9B 2YVCA 4K1RB 5LLIA 2FUHB 4HPMB 4M8MA 4CYEA 3VH3B 4GSWA 2KXJA 5CHVC 1P0RA 2KDBA 2IBIB 1GJZA 4W9HA 2MRPA 1WXMA 5G2NA 2UYZB 2A4ZA 5AZHA 4FJYA 2JZ3B 5CTRC 1S3SG 2N9EB 5D94A 4B95A 2ZNVB 2LZ6A 2LI5A 4DWFA 2LRWA 4AP4C 1RLFA 2LGXA 4HDOA 3ZVVA 2NVUI 2AEHA 1LFDA 2BYFA 4ANWA 2KJ6A 3SD5A 1PQSA 2LGYA 2CHZA 4DDGD 3AU5A 1UBQA 4W9IA 2D07B 2BYEA 1E7VA 4N9F4 2C9WB 2DZJA 3VTUA 1UBIA 2JRIB 2N7DA 3ZRFA 2DX5B 3PVLA 1YJ1A 2GBJA 1M94A 3PLVA 3WAMA 2FCMA 1EUVB 1GC7A 1P98A 2LRUA 3CMMB 3UQAA 2N1VA 3ML9A 4KDLB 4I6PA 2K8BA 2KVRA 1SIFA 3GOEA 2JXXA 5L83A 2LD9A 2M0XA 1R4MI 2GBKA 2WX1A 3PRZA 5JHAA 3B0AA 3KW5B 2VRRB 2IY1B 1E8XA 3L08A 3DQVA 2C7NB 3OJ3A 3SU8X 2JPHA 4HPLB 4F1SA 3VDZA 2GOWA 5DPWA 2BWFA 1WX8A 2JUOA 2J0JA 4G50A 3UF8A 4GB9A 3ZNHB 1WGGA 4HK2A 3W1SC 3IHPC 3APCA 2N9PC 3EFUA 1LXDA 3DPDA 3HK0A 3TJPA 2G4SA 2B3AA 3OAWA 1YD8U 4W9KA 3TL5A 2DYMA 2GMIC 2V3SA 3DBRI 3HM3A 4BKSD 4K7UA 1V81A 5LXHA 1OTRB 2ZCBA 2EMTA 4HLEA 3TCAA 4WWOA 3RULA 4FHJA 3W1SA 5J18A 4TV3A 1WJ4A 2GBNA 4KSLC 1E5WA 2IZVB 2JWZA 2JY6A 2AYOB 1EF5A 3MHSD 1WGHA 3PPAA 1ZGUB 2K25A 2V4LA 4HDQA 2RPQA 1RFAA 3PHWB 2I1JA 2WWZA 2KWVB 1WGDA 2XBBC 4NNJB 1WJNA 2QHOA 1J8CA 2KNBA 2ZZPB 4IUMB 2IYDB 1TGZB 3AI5A 3K9PB 2FIFA 1I35A 2KWUB 4GU2A 4W9FA 2DYBA 2A5UA 4IWQA 4EOYA 4W9GA 3VUWA 1WJ6A 5LXIB 1V49A 2MA9B 3X23A 1E8YA 2LVOA 2XK5A 3W1YA 1GG3A 4BOZB 1XQQA 4W9JA 4PYZA 2MP2B 3TBLD 2KJRA 2ZCCA 5C1ZA 2C7MB 4HCNB 5AEKB 2MBOA 1WR1A 3DBLI 4WQOB 3RYTA 2G45B 4GOCA 2R2QA 2DAFA 5IA7A 3AULA 3VHTC 3VXWA 3H7SA 2LXCA 1E90A 1ISNA 2NCNA 1E7UA 5KHQA 5AZFA 2ZVNA 2J0MA 3QIJA 4J6IA 3TMPB 2BKFA 4MGYE 2HTHA 4XX5A 4GMVA 3A9JA 4RMAA 4RM9A 2HJ8A 4TQ0A 4W9CA 2YLMA 2M4NA 3RCZA 3NOBA 3N32A 3R66C 1WJUA 4MJSA 4BKTA 2NBVB 4BBNC 2K39A 1P3QU 1GUAB 5C23A 4GDKB 2KDFB 1YX6B 1V6EA 3ZDMC 3WAOA 2N9XA 1V9JA 2IO1B 1WM3A 1GC6A 1HE8A 1E8WA 3NHEB 3QQ8B 3AU4A 3RZWC 3VTVA 1UD7A 1WF9A 4LDTB 1G6JA 5J17A 2BF8B 5D7GA 2BYVE 3M3JA 4GN1A 1I42A 4MSMB 2IO3B 2MBHA 4MSQB 5E6NA 4KIKB 2RD0A 4FADA 3NS8A 2CS4A 4GXBA 4ZRJA 3PS6A 2UWQA 3KUDB 3DVNV 2KOXA 1WRDB 3ZLZA 2FCNA 3VTWA 5HKHA 4EZLA 3HM6X 1SGHA 4TKNA 3ZO5B 4AUQC 2D11A 2NBWB 2MSED 4IM3A 3QX1A 1WX7A 3V6CB 4BKGA 3RUIB 4ZRKA 4YL8A 4A3PA 4MGIE 3UQBA 2CHWA 4IWOA 4B6WA 2HE7A 3WIMA 2PEAA 5G55A 1J19A 3A33B 3L17A 2J7QB 2MLBA 2RGFA 3AXCA 1T0YA 4IG7B 4WJOA 4NQKE 3QJZA 3OLMD 3APFA 2CKHB 5JH5C 2MP2A 2KQ7A 4DHJD 2DENB 3SDLC 4ASWC 1Z5SB 2MBQA 1K8RB 2D2QA 3WAPA 3H7PB 4PS3A 2FCQA 1WXAA 4HVBA 5CHFA 1KM7A 3M62B 3PGEA 3QWZB 2KN5A 4ICUA 3U30A 4KDIC 4ZRIA 2KX3A 3ECIA 1NBFC 2BKRB 2DHZA 2WX0A 2KTRB 1XD3B 2AL6A 3M63B 3L13A 3UINB 1S1QB 3IFWB 4K7WA 4W9LA 1Q5WB 1UGMA 1X1MA 2C60A 3NY5A 4MGZE 3BY4B 3L10B 3Q3JA 1WH3A 5EDSA 2ZVOA 2KJHB 3M95A 5AZGA 2N1WA 4IWPA 2L8JA 1C3TA 1KLVA 4DHZE 2KANA 2O6VB 4HJKA 2ZNVC 4WAAA 3PRPB 2KWCA 3DCGA 3V62A 4WJQA 2K6DB 4ZDVA 2PE6B 2EKEC 4OVVA 2EMSA 3A9KB 3HHMA 2WYQA 2LUEA 1KJTA 5D2MB 4BKSA 3A4RA 5FR6A 3L16A 3PRMB 4K7SA 4IC7B 3U7DA 3PREA 3PV1A 2DZMA 3H9DA 4KIKA 4DBGA 4ZYNA 3UIPB 3QCAA 2JT4B 4LCDE 5IAAC 4A20A 4FJVB 4AJYB 2PJHA 4DXAB 2MWSB 1AARA 3T8MA 5E6PA 5L95C 3A1QB 4EZKA 4NPNA 2BWES 4WWNA 4GGQA 4GDLB 1YQBA 5D6JB 4ANVA 4MM3A 1YX5B 2FNJB 3ENEA 2K1FA 3V61A 2BPSA 1L2NA 2KZRA 4MDKE 3QC8B 1NDDA 4AOFA 2KK8A 4G0NB 4KV2A 3P2BA 4CO7A 4FLHA 3VUXA 1C1YB 3KVFB 4PYUA 2BGFA 3DVGX 5TR5A 1WE7A 1UZXB 2L76A 2RSUA 3ZUNA 4P7IA 3C0RB 4HCPB 4F8CB 4AWJA 1SE9A 3NZUA 2NS5A 2Y5BB 3RT3B 3VFKA 4DHZB 4B9KA 2AL3A 4NY0A 2KTFA 4II2B 5DCNA 1V86A 3R3MA 2KDEB 3H1UA 4IM2A 3KH0A 1Q0WB 2L00B 3QAQA 3PLUA 4GIVA 4DHJB 1IP9A 1WIAA 4AJWA 5E6OA 4G11A 2CR5A 3QA8A 3I3TB 3WANA 4EZJA 2KFJA 2M17A 4BBNF 4WJNA 1WM2A 2OJRA 4TQ1A 1LQBA 2KTRA 4ICVA 3ZW3A 2Z0DB 3PTFC 3S2AA 3V6EB 2N7EA 2MQJA 1D3ZA 3JSVB 3DVNU 3ML8A 4HWIB 2V1YA 3NZSA 4II3B 2RR9A 2ZPNA 2KLGA 3IVFA 4E74A 3VUYA 3JW0X 1V5OA 3JYUA 4KSKC 4MEMA 4EEWA 3ZNGC 2KX0A 2O6VA 3IBEA 2MX2A 4G3XB 4WWPA 2DZIA 4FA6A 2IY0B 3A9KA 2JRHA 4I6NB 4URKA 1RAXA 1Q1OA 2LVQA 3KUZA 1WFYA 3R7QA 4TUUA 1TTNA 3CF6E 4F7ZA 3EC8A 4M0WB 2LGDA 2LJ5A 3B08A 3A4SC 3D32A 1WZ3A 4DDID 2ASQA 2M1MA 4BFRA 4FJZA 2D10A 1EO6A 4X57B 3A1QA 4OVUA 2XK5B 1ZKHA 2L0FA 2PE9A 4GDLA 3EECA 3SHQA 2PPHA 2DAJA 4WJPA 2ZJDA 2KC1A 4HXDA 5KHOA 1BT0A 4K81A 4XC2A 2G4DB 1IYFA 4NQLB 2FAZA 4CHKA 3ALBA 2K6QA 2FIDA 1KOTA 3PHXB 2AWTA 2LWPA 4JIOU 1J0GA 3OJ4B 2IO2B 1NI2A 2NPTB 4NJ7A 2LVPA 2K8HA 2ZPYA 1TZ1A 3WALA 3ZDTA 2I1KA 4MELA 1YIWA 4DK5A 3RD2A 3O65B 3A9JB 5DPSA 1WMHB 2O2VB 2ZEQA 4LJOB 4JLCA 1UH6A 1Z2MA 4XZ4A 1WX9A 4NAWB 1V5TA 2C5LC 3N3KB 2KC2A 2Z0EB 4MJSB 2KLCA 2IO0B 1UELA 1H4RA 2Z59B 2G3QB 2LXAA 2KFKB 4GDKA 2HD5B 1ZW7A 1OQYA 3V60A 4JL9A 3X0WA 4M8NA 3ZTCA 2L3ZA 2KO3A 4LDTD 3LJ3A 1WE6A 1R4NI 3L0WB 3ZTDA 3DBSA 4KZ0A 3KUCB 2NR2A 3R7RA 1WI0A 1A5RA 3LDZE 2JZZA 1WXVA 3EHVA 4IM0A 2C7HA 2L05A 3VVWB 4RM8A 3QK0A 4KVGB 1OEYJ 4LJPB 3WA0A 3UIOB 3CSTA 3JSVA 5JZEB 2L0TA 3ONSA 3Q3FA 4IW0A 3L54A 1JRUA 2W9NA 1WR6E 4JGHB 1OEYA 4PS7A 3ZKJC 4A3OA 1RRBA 4W9EA 3H6NA 1IPGA 4FHKA 1P9DU 3CSFA 4NJ6A 1EF1A 2J0KA 2D3GA 2KD0A 3PZDA 1H8CA 1P1AA 2MW5A 4EUTA 2JVCA 3K9OB 2R2OA 2MBEA 3ZRCA 3BINA 1WYWB 3VQIA 4JQWC 1QZEA 1U4AA 3QHTA 3ZIMA 4FBJB 3IG3A 2CHXA 1WY8A 5DPRA 4ANXA 2CU1A 3VAWA 3GZNI 3ZNID 4PS8A 5J2RA 2N4FA 3QARA 3MJWA 2KQSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VH4 B;  2FCS A;  2LAS A;  3KYD D;  2KHW B;  2MBB B;  2MCN B;  5DPT A;  1FXT B;  3DVG Y;  3KYC D;  1V2Y A;  3T9L A;  2GBR A;  2REX A;  2XEW A;  3DBH I;  1F9J A;  1OGW A;  2WDT B;  4MGK E;  3PSE B;  3DDC B;  1VD2 A;  3H7P A;  1L7Y A;  1TBE A;  3TIX A;  3PT2 B;  2KDI A;  2NPT A;  2KMC A;  1WZ0 A;  2NBU A;  4ANU A;  4FN2 A;  3MTN B;  2DZK A;  1VCB A;  4KZC A;  3B1L X;  3JVZ X;  3UGB B;  2OOB B;  3N30 A;  1WMH A;  2O2V A;  3ZNZ B;  1LM8 B;  1Y8R C;  4I6L B;  4E3C A;  1GNU A;  2GBM A;  1CMX B;  4NAW A;  4BOS C;  3RZF A;  5JHB A;  5BO4 B;  2DYO A;  4W9D A;  4EKU A;  2KFK A;  2K8C A;  2L7R A;  2KKC A;  5CHW A;  3HIZ A;  1V80 A;  1WXS A;  2O6V D;  3APD A;  4EFO A;  3U8Z A;  1MG8 A;  3DOW A;  5GMV A;  5CX3 A;  2JF5 A;  4MH0 E;  1E8Z A;  1WGY A;  4BVU C;  4E71 A;  2KMA A;  2M8S A;  1WGR A;  4FUL A;  1XT9 B;  2YVC A;  4K1R B;  5LLI A;  2FUH B;  4HPM B;  4M8M A;  4CYE A;  3VH3 B;  4GSW A;  2KXJ A;  5CHV C;  1P0R A;  2KDB A;  2IBI B;  1GJZ A;  4W9H A;  2MRP A;  1WXM A;  5G2N A;  2UYZ B;  2A4Z A;  5AZH A;  4FJY A;  2JZ3 B;  5CTR C;  1S3S G;  2N9E B;  5D94 A;  4B95 A;  2ZNV B;  2LZ6 A;  2LI5 A;  4DWF A;  2LRW A;  4AP4 C;  1RLF A;  2LGX A;  4HDO A;  3ZVV A;  2NVU I;  2AEH A;  1LFD A;  2BYF A;  4ANW A;  2KJ6 A;  3SD5 A;  1PQS A;  2LGY A;  2CHZ A;  4DDG D;  3AU5 A;  1UBQ A;  4W9I A;  2D07 B;  2BYE A;  1E7V A;  4N9F 4;  2C9W B;  2DZJ A;  3VTU A;  1UBI A;  2JRI B;  2N7D A;  3ZRF A;  2DX5 B;  3PVL A;  1YJ1 A;  2GBJ A;  1M94 A;  3PLV A;  3WAM A;  2FCM A;  1EUV B;  1GC7 A;  1P98 A;  2LRU A;  3CMM B;  3UQA A;  2N1V A;  3ML9 A;  4KDL B;  4I6P A;  2K8B A;  2KVR A;  1SIF A;  3GOE A;  2JXX A;  5L83 A;  2LD9 A;  2M0X A;  1R4M I;  2GBK A;  2WX1 A;  3PRZ A;  5JHA A;  3B0A A;  3KW5 B;  2VRR B;  2IY1 B;  1E8X A;  3L08 A;  3DQV A;  2C7N B;  3OJ3 A;  3SU8 X;  2JPH A;  4HPL B;  4F1S A;  3VDZ A;  2GOW A;  5DPW A;  2BWF A;  1WX8 A;  2JUO A;  2J0J A;  4G50 A;  3UF8 A;  4GB9 A;  3ZNH B;  1WGG A;  4HK2 A;  3W1S C;  3IHP C;  3APC A;  2N9P C;  3EFU A;  1LXD A;  3DPD A;  3HK0 A;  3TJP A;  2G4S A;  2B3A A;  3OAW A;  1YD8 U;  4W9K A;  3TL5 A;  2DYM A;  2GMI C;  2V3S A;  3DBR I;  3HM3 A;  4BKS D;  4K7U A;  1V81 A;  5LXH A;  1OTR B;  2ZCB A;  2EMT A;  4HLE A;  3TCA A;  4WWO A;  3RUL A;  4FHJ A;  3W1S A;  5J18 A;  4TV3 A;  1WJ4 A;  2GBN A;  4KSL C;  1E5W A;  2IZV B;  2JWZ A;  2JY6 A;  2AYO B;  1EF5 A;  3MHS D;  1WGH A;  3PPA A;  1ZGU B;  2K25 A;  2V4L A;  4HDQ A;  2RPQ A;  1RFA A;  3PHW B;  2I1J A;  2WWZ A;  2KWV B;  1WGD A;  2XBB C;  4NNJ B;  1WJN A;  2QHO A;  1J8C A;  2KNB A;  2ZZP B;  4IUM B;  2IYD B;  1TGZ B;  3AI5 A;  3K9P B;  2FIF A;  1I35 A;  2KWU B;  4GU2 A;  4W9F A;  2DYB A;  2A5U A;  4IWQ A;  4EOY A;  4W9G A;  3VUW A;  1WJ6 A;  5LXI B;  1V49 A;  2MA9 B;  3X23 A;  1E8Y A;  2LVO A;  2XK5 A;  3W1Y A;  1GG3 A;  4BOZ B;  1XQQ A;  4W9J A;  4PYZ A;  2MP2 B;  3TBL D;  2KJR A;  2ZCC A;  5C1Z A;  2C7M B;  4HCN B;  5AEK B;  2MBO A;  1WR1 A;  3DBL I;  4WQO B;  3RYT A;  2G45 B;  4GOC A;  2R2Q A;  2DAF A;  5IA7 A;  3AUL A;  3VHT C;  3VXW A;  3H7S A;  2LXC A;  1E90 A;  1ISN A;  2NCN A;  1E7U A;  5KHQ A;  5AZF A;  2ZVN A;  2J0M A;  3QIJ A;  4J6I A;  3TMP B;  2BKF A;  4MGY E;  2HTH A;  4XX5 A;  4GMV A;  3A9J A;  4RMA A;  4RM9 A;  2HJ8 A;  4TQ0 A;  4W9C A;  2YLM A;  2M4N A;  3RCZ A;  3NOB A;  3N32 A;  3R66 C;  1WJU A;  4MJS A;  4BKT A;  2NBV B;  4BBN C;  2K39 A;  1P3Q U;  1GUA B;  5C23 A;  4GDK B;  2KDF B;  1YX6 B;  1V6E A;  3ZDM C;  3WAO A;  2N9X A;  1V9J A;  2IO1 B;  1WM3 A;  1GC6 A;  1HE8 A;  1E8W A;  3NHE B;  3QQ8 B;  3AU4 A;  3RZW C;  3VTV A;  1UD7 A;  1WF9 A;  4LDT B;  1G6J A;  5J17 A;  2BF8 B;  5D7G A;  2BYV E;  3M3J A;  4GN1 A;  1I42 A;  4MSM B;  2IO3 B;  2MBH A;  4MSQ B;  5E6N A;  4KIK B;  2RD0 A;  4FAD A;  3NS8 A;  2CS4 A;  4GXB A;  4ZRJ A;  3PS6 A;  2UWQ A;  3KUD B;  3DVN V;  2KOX A;  1WRD B;  3ZLZ A;  2FCN A;  3VTW A;  5HKH A;  4EZL A;  3HM6 X;  1SGH A;  4TKN A;  3ZO5 B;  4AUQ C;  2D11 A;  2NBW B;  2MSE D;  4IM3 A;  3QX1 A;  1WX7 A;  3V6C B;  4BKG A;  3RUI B;  4ZRK A;  4YL8 A;  4A3P A;  4MGI E;  3UQB A;  2CHW A;  4IWO A;  4B6W A;  2HE7 A;  3WIM A;  2PEA A;  5G55 A;  1J19 A;  3A33 B;  3L17 A;  2J7Q B;  2MLB A;  2RGF A;  3AXC A;  1T0Y A;  4IG7 B;  4WJO A;  4NQK E;  3QJZ A;  3OLM D;  3APF A;  2CKH B;  5JH5 C;  2MP2 A;  2KQ7 A;  4DHJ D;  2DEN B;  3SDL C;  4ASW C;  1Z5S B;  2MBQ A;  1K8R B;  2D2Q A;  3WAP A;  3H7P B;  4PS3 A;  2FCQ A;  1WXA A;  4HVB A;  5CHF A;  1KM7 A;  3M62 B;  3PGE A;  3QWZ B;  2KN5 A;  4ICU A;  3U30 A;  4KDI C;  4ZRI A;  2KX3 A;  3ECI A;  1NBF C;  2BKR B;  2DHZ A;  2WX0 A;  2KTR B;  1XD3 B;  2AL6 A;  3M63 B;  3L13 A;  3UIN B;  1S1Q B;  3IFW B;  4K7W A;  4W9L A;  1Q5W B;  1UGM A;  1X1M A;  2C60 A;  3NY5 A;  4MGZ E;  3BY4 B;  3L10 B;  3Q3J A;  1WH3 A;  5EDS A;  2ZVO A;  2KJH B;  3M95 A;  5AZG A;  2N1W A;  4IWP A;  2L8J A;  1C3T A;  1KLV A;  4DHZ E;  2KAN A;  2O6V B;  4HJK A;  2ZNV C;  4WAA A;  3PRP B;  2KWC A;  3DCG A;  3V62 A;  4WJQ A;  2K6D B;  4ZDV A;  2PE6 B;  2EKE C;  4OVV A;  2EMS A;  3A9K B;  3HHM A;  2WYQ A;  2LUE A;  1KJT A;  5D2M B;  4BKS A;  3A4R A;  5FR6 A;  3L16 A;  3PRM B;  4K7S A;  4IC7 B;  3U7D A;  3PRE A;  3PV1 A;  2DZM A;  3H9D A;  4KIK A;  4DBG A;  4ZYN A;  3UIP B;  3QCA A;  2JT4 B;  4LCD E;  5IAA C;  4A20 A;  4FJV B;  4AJY B;  2PJH A;  4DXA B;  2MWS B;  1AAR A;  3T8M A;  5E6P A;  5L95 C;  3A1Q B;  4EZK A;  4NPN A;  2BWE S;  4WWN A;  4GGQ A;  4GDL B;  1YQB A;  5D6J B;  4ANV A;  4MM3 A;  1YX5 B;  2FNJ B;  3ENE A;  2K1F A;  3V61 A;  2BPS A;  1L2N A;  2KZR A;  4MDK E;  3QC8 B;  1NDD A;  4AOF A;  2KK8 A;  4G0N B;  4KV2 A;  3P2B A;  4CO7 A;  4FLH A;  3VUX A;  1C1Y B;  3KVF B;  4PYU A;  2BGF A;  3DVG X;  5TR5 A;  1WE7 A;  1UZX B;  2L76 A;  2RSU A;  3ZUN A;  4P7I A;  3C0R B;  4HCP B;  4F8C B;  4AWJ A;  1SE9 A;  3NZU A;  2NS5 A;  2Y5B B;  3RT3 B;  3VFK A;  4DHZ B;  4B9K A;  2AL3 A;  4NY0 A;  2KTF A;  4II2 B;  5DCN A;  1V86 A;  3R3M A;  2KDE B;  3H1U A;  4IM2 A;  3KH0 A;  1Q0W B;  2L00 B;  3QAQ A;  3PLU A;  4GIV A;  4DHJ B;  1IP9 A;  1WIA A;  4AJW A;  5E6O A;  4G11 A;  2CR5 A;  3QA8 A;  3I3T B;  3WAN A;  4EZJ A;  2KFJ A;  2M17 A;  4BBN F;  4WJN A;  1WM2 A;  2OJR A;  4TQ1 A;  1LQB A;  2KTR A;  4ICV A;  3ZW3 A;  2Z0D B;  3PTF C;  3S2A A;  3V6E B;  2N7E A;  2MQJ A;  1D3Z A;  3JSV B;  3DVN U;  3ML8 A;  4HWI B;  2V1Y A;  3NZS A;  4II3 B;  2RR9 A;  2ZPN A;  2KLG A;  3IVF A;  4E74 A;  3VUY A;  3JW0 X;  1V5O A;  3JYU A;  4KSK C;  4MEM A;  4EEW A;  3ZNG C;  2KX0 A;  2O6V A;  3IBE A;  2MX2 A;  4G3X B;  4WWP A;  2DZI A;  4FA6 A;  2IY0 B;  3A9K A;  2JRH A;  4I6N B;  4URK A;  1RAX A;  1Q1O A;  2LVQ A;  3KUZ A;  1WFY A;  3R7Q A;  4TUU A;  1TTN A;  3CF6 E;  4F7Z A;  3EC8 A;  4M0W B;  2LGD A;  2LJ5 A;  3B08 A;  3A4S C;  3D32 A;  1WZ3 A;  4DDI D;  2ASQ A;  2M1M A;  4BFR A;  4FJZ A;  2D10 A;  1EO6 A;  4X57 B;  3A1Q A;  4OVU A;  2XK5 B;  1ZKH A;  2L0F A;  2PE9 A;  4GDL A;  3EEC A;  3SHQ A;  2PPH A;  2DAJ A;  4WJP A;  2ZJD A;  2KC1 A;  4HXD A;  5KHO A;  1BT0 A;  4K81 A;  4XC2 A;  2G4D B;  1IYF A;  4NQL B;  2FAZ A;  4CHK A;  3ALB A;  2K6Q A;  2FID A;  1KOT A;  3PHX B;  2AWT A;  2LWP A;  4JIO U;  1J0G A;  3OJ4 B;  2IO2 B;  1NI2 A;  2NPT B;  4NJ7 A;  2LVP A;  2K8H A;  2ZPY A;  1TZ1 A;  3WAL A;  3ZDT A;  2I1K A;  4MEL A;  1YIW A;  4DK5 A;  3RD2 A;  3O65 B;  3A9J B;  5DPS A;  1WMH B;  2O2V B;  2ZEQ A;  4LJO B;  4JLC A;  1UH6 A;  1Z2M A;  4XZ4 A;  1WX9 A;  4NAW B;  1V5T A;  2C5L C;  3N3K B;  2KC2 A;  2Z0E B;  4MJS B;  2KLC A;  2IO0 B;  1UEL A;  1H4R A;  2Z59 B;  2G3Q B;  2LXA A;  2KFK B;  4GDK A;  2HD5 B;  1ZW7 A;  1OQY A;  3V60 A;  4JL9 A;  3X0W A;  4M8N A;  3ZTC A;  2L3Z A;  2KO3 A;  4LDT D;  3LJ3 A;  1WE6 A;  1R4N I;  3L0W B;  3ZTD A;  3DBS A;  4KZ0 A;  3KUC B;  2NR2 A;  3R7R A;  1WI0 A;  1A5R A;  3LDZ E;  2JZZ A;  1WXV A;  3EHV A;  4IM0 A;  2C7H A;  2L05 A;  3VVW B;  4RM8 A;  3QK0 A;  4KVG B;  1OEY J;  4LJP B;  3WA0 A;  3UIO B;  3CST A;  3JSV A;  5JZE B;  2L0T A;  3ONS A;  3Q3F A;  4IW0 A;  3L54 A;  1JRU A;  2W9N A;  1WR6 E;  4JGH B;  1OEY A;  4PS7 A;  3ZKJ C;  4A3O A;  1RRB A;  4W9E A;  3H6N A;  1IPG A;  4FHK A;  1P9D U;  3CSF A;  4NJ6 A;  1EF1 A;  2J0K A;  2D3G A;  2KD0 A;  3PZD A;  1H8C A;  1P1A A;  2MW5 A;  4EUT A;  2JVC A;  3K9O B;  2R2O A;  2MBE A;  3ZRC A;  3BIN A;  1WYW B;  3VQI A;  4JQW C;  1QZE A;  1U4A A;  3QHT A;  3ZIM A;  4FBJ B;  3IG3 A;  2CHX A;  1WY8 A;  5DPR A;  4ANX A;  2CU1 A;  3VAW A;  3GZN I;  3ZNI D;  4PS8 A;  5J2R A;  2N4F A;  3QAR A;  3MJW A;  2KQS A; 
#chains in the Genus database with same CATH topology
 2MCN B;  3PZ7 A;  4LLG M;  2JU6 X;  3T9L A;  2REX A;  5I4D A;  1OGW A;  4MGK E;  2PTL A;  2BB6 A;  3PT2 B;  2L1A A;  1WZ0 A;  4FN2 A;  3MTN B;  1M4V A;  2O2V A;  2YEP F;  3ZNZ B;  1LM8 B;  2AX5 A;  1CMX B;  4W9D A;  2K8C A;  2XNA C;  3U8Z A;  3DOW A;  3KWV A;  5GMV A;  2VZK D;  2JF5 A;  4MH0 E;  2CU3 A;  4FUL A;  2FUH B;  4HPM B;  2KMM A;  2RMM A;  4M8M A;  3VH3 B;  1T6B X;  2KDB A;  1TS3 A;  4W9H A;  2J53 A;  2UYZ B;  5CTR C;  1Q10 A;  2L52 A;  3Q8F A;  4B95 A;  2LZ6 A;  4KKI A;  2LGX A;  1LO5 D;  2NVU I;  2Z8L A;  2KJ6 A;  1SE4 A;  1KLU D;  4DDG D;  2BYE A;  2C9W B;  4HEA 1;  4BZA A;  1GC7 A;  3AEC B;  3LYY A;  3CMM B;  5H92 C;  4C00 A;  4YXD B;  1RWS A;  1V1P B;  1YOV B;  1DOI A;  2WX1 A;  2EKI A;  1L4Z B;  4LNO A;  4K3B A;  1TT5 B;  4WAF A;  3VDZ A;  1N5X A;  3UF8 A;  4GB9 A;  1WGG A;  1WRI A;  2N9P C;  1LXD A;  3DPD A;  3TJP A;  1XLP A;  2V3S A;  3DBR I;  1V81 A;  4FXC A;  3E56 A;  3E9S A;  4WWO A;  4TV3 A;  2GBN A;  2IZV B;  1EF5 A;  4K3C A;  2CJN A;  3MHS D;  3PPA A;  4HDQ A;  5BYQ A;  2I1J A;  4ZRP A;  2KWV B;  4M02 A;  1N6Z A;  1D5Z C;  1TGZ B;  4S0R A;  2IJ0 A;  3MP9 A;  2KWU B;  2I2Y A;  2D3C A;  4W9G A;  3VUW A;  2WXL A;  5LXI B;  4YSY B;  2LVO A;  3W1Y A;  1GG3 A;  3W5U B;  2MP2 B;  3TBL D;  5C1Z A;  1QOF A;  1JWM D;  2C7M B;  2LGI A;  2MBO A;  4ZOH C;  4ITK A;  2G45 B;  4ZYS A;  2R2Q A;  5IA7 A;  2NCN A;  1E7U A;  2ZVN A;  4MGY E;  4RM9 A;  1XF5 L;  1MI0 A;  2FBW B;  2M4N A;  4AS1 A;  1YN3 A;  1L6U A;  3AE8 B;  1ET6 A;  2LFI A;  2LGS A;  1XLN A;  3AEB B;  3ZDM C;  2N9X A;  3Q8A A;  1WM3 A;  1E8W A;  3QQ8 B;  1UD7 A;  3B2F A;  4LK0 M;  5D7G A;  2BYV E;  3IAS 1;  2JYE A;  4XGA B;  2MBH A;  1FM0 D;  4A9A A;  1VZ8 A;  2RD0 A;  4JWS C;  2V3N A;  4A55 A;  2KOX A;  1WRD B;  2W55 A;  3ZLZ A;  3B9J A;  4AUQ C;  3ZO5 B;  2JSV X;  4TSS A;  1B9R A;  2JXT A;  1YJI A;  2KN4 A;  3URY A;  4YL8 A;  2M19 A;  4A3P A;  1JRP A;  1P7E A;  2CHW A;  4IWO A;  4B6W A;  2WDV B;  3RN9 C;  3Q8C A;  3DBH B;  2RGF A;  3BYY B;  3AXC A;  2IGD A;  1XXG A;  1OQR A;  1XCQ L;  4DHJ D;  2DEN B;  2MBQ A;  4PS3 A;  1KM7 A;  3M62 B;  4KDI C;  3ECI A;  3IT4 B;  4LNF A;  1RYJ A;  2WXR A;  3M63 B;  4MGZ E;  2WS3 B;  4YSZ B;  3W2D A;  1WH3 A;  1V8C A;  2ZVO A;  2KJH B;  5AZG A;  2JX5 A;  2KAN A;  2KWC A;  1EU3 A;  4ZDV A;  2EKE C;  4OVV A;  3A9K B;  4GLS C;  3EUB 2;  2WYQ A;  2LUE A;  1C4P A;  4IC7 B;  4RGN A;  2BBC A;  3H9D A;  3PV1 A;  4DBG A;  4ZYN A;  3NG0 A;  2KT7 A;  4LCD E;  4AJY B;  2QJL A;  3KQ4 A;  2N7J A;  3T8M A;  5L95 C;  4WWN A;  4GGQ A;  4GDL B;  4ANV A;  3AB5 A;  3ENE A;  4OZA A;  3KLS X;  1NDD A;  3BVG A;  3BK2 A;  4KV2 A;  4CO7 A;  3P4S B;  3HVZ A;  5TR5 A;  1DOX A;  3HUI A;  4AWJ A;  2NS5 A;  4P1B C;  4OZB A;  4IKG A;  1DOY A;  2RDB C;  3PLU A;  3RNA C;  1XCT L;  1IP9 A;  1GB1 A;  4AJW A;  4XWW A;  3AMZ A;  2KFJ A;  1TYG B;  4WJN A;  3I9V 1;  4A6Q A;  3B2G A;  1KLG D;  5HI1 A;  4OZC A;  1D3Z A;  3JSV B;  4HWI B;  4II3 B;  1QOA A;  2QC8 A;  3IVF A;  3JYU A;  4S17 A;  1JAL A;  3R2T A;  4C7Z A;  2DZI A;  2IY0 B;  4I6N B;  1I4P A;  1RAX A;  1WFY A;  5LNK 1;  1C78 A;  4F7Z A;  4M0W B;  1FFV A;  2V3P A;  5D3D A;  2ASQ A;  1BML C;  4OVU A;  2XK5 B;  1ZKH A;  2DLB A;  4WJP A;  2LUM A;  4J3O D;  4K81 A;  4NQL B;  2FAZ A;  1TIF A;  1T0S C;  4YTN B;  2LWP A;  3OJ4 B;  4NJ7 A;  3WAL A;  1TZ1 A;  1NI3 A;  4MEL A;  3RD2 A;  4KGR A;  2O2V B;  4LJO B;  1Z2M A;  3PO0 A;  4HKZ E;  1WX9 A;  1QOG A;  1V5T A;  4RFB A;  2KC2 A;  4MJS B;  1H4R A;  2LXA A;  4JL9 A;  3DHH C;  3ZTD A;  3TEY A;  2NR2 A;  3VVW B;  1R7S A;  4P1C C;  5C2T B;  1T3Q A;  2L0T A;  3Q3F A;  3NUH B;  3L54 A;  2W9N A;  4PS7 A;  4ZRQ A;  4A3O A;  4EE2 A;  4W9E A;  1YQ3 B;  4NJ6 A;  2J0K A;  1PGX A;  3PZD A;  2JVC A;  2R2O A;  2MBE A;  3T3O A;  3BIN A;  2W3R A;  2K3U A;  1QZE A;  3ZIM A;  3DWG C;  1GB4 A;  1RFK A;  4YWG G;  3QAR A;  1ZDV A;  1QT9 A;  2KQS A;  2FCS A;  2KHW B;  2MBB B;  5DPT A;  1FXT B;  3DVG Y;  2WNM A;  3MJ5 A;  1UWM A;  2GBR A;  2Y3A A;  2XEW A;  3DBH I;  2WXP A;  2WDT B;  2J52 A;  3NVV A;  3PSE B;  2QIL A;  3DBR B;  1L7Y A;  1TBE A;  3TIX A;  2KDI A;  2MHJ A;  2NPT A;  1TS4 A;  2NBU A;  2QMT A;  3RNE C;  2X38 A;  2OOB B;  3RZF A;  2L32 A;  2DYO A;  2WXJ A;  4P6V F;  3Q3O C;  4LNI A;  3Q8E A;  1FCC C;  1WXS A;  2KDM A;  2L83 A;  1XLO A;  2O6V D;  2WHI A;  5CX3 A;  4OW0 A;  4BVU C;  4E71 A;  2KMA A;  3GS2 A;  1WGR A;  2YVC A;  4K1R B;  4CYE A;  1AYF A;  2V4I B;  2INP E;  5G2N A;  2A4Z A;  2JZ3 B;  3RNG C;  1S3S G;  4AP4 C;  1RLF A;  4HDO A;  3ZVV A;  1VZ6 A;  1AWD A;  2JQR B;  1CJE A;  1LFD A;  2BYF A;  2LGY A;  4W9I A;  2IPK D;  4XYC A;  1JML A;  3ZRF A;  3PVL A;  2PIA A;  3MC8 A;  3PLV A;  1P98 A;  2LRU A;  3UQA A;  2NMQ A;  4I6P A;  4N6E B;  5L83 A;  2LD9 A;  2M0X A;  3AE1 B;  2GBK A;  3PRZ A;  1E8X A;  3L08 A;  2C7N B;  3OJ3 A;  3SU8 X;  4F1S A;  2Y5C A;  1WX8 A;  4HJG E;  1CK1 A;  1SE2 A;  4G50 A;  3ZNH B;  4HK2 A;  3W1S C;  3APC A;  2IDY A;  3R8B A;  2G4S A;  2B3A A;  3BZD B;  2DYM A;  3HM3 A;  2WXF A;  1OTR B;  2ZCB A;  4HLE A;  4LNK A;  3W1S A;  3RUL A;  4FHJ A;  2E6X A;  1VRA B;  3AE9 B;  4KSL C;  2WXH A;  2JY6 A;  4RF1 A;  1FFU A;  4KKJ A;  3H8H A;  1FNW A;  3PHW B;  2WWZ A;  5FK9 C;  2QSD A;  2XBB C;  3ZJU A;  1V97 A;  2N0S B;  4NNJ B;  2KAJ A;  2QHO A;  3N20 C;  2KNB A;  3RNF C;  3ZJV A;  2IYD B;  4JX1 C;  3BK1 A;  2HDE A;  3BVM A;  3I63 C;  4GU2 A;  2DYB A;  2A5U A;  3HRD D;  1E8Y A;  2XK5 A;  2KQ4 X;  4W9J A;  4PYZ A;  3V3X A;  2KJR A;  2ZCC A;  1K51 A;  4HCN B;  5AEK B;  4GOC A;  2DAF A;  3TSS A;  1KRH A;  1NVI D;  3AUL A;  3H7S A;  1E90 A;  1NYQ A;  4M00 A;  3IAM 1;  2J0M A;  3QIJ A;  3TMP B;  2BKF A;  2HTH A;  4YSX B;  3SR6 A;  2KWD A;  2BW2 A;  1ZXH A;  4RMA A;  2HJ8 A;  1V1O A;  4TQ0 A;  2YLM A;  3NOB A;  3VRB B;  5BMI A;  3R66 C;  1WJU A;  4MJS A;  2MH7 A;  2K39 A;  3P63 A;  5C23 A;  3U2S C;  1YX6 B;  5BYS A;  1V6E A;  3WAO A;  1V9J A;  3Q3M C;  2W3S A;  3NHE B;  3AU4 A;  3C19 A;  3AE3 B;  1VJK A;  4GN1 A;  1STE A;  3NZ3 A;  4FAD A;  3MC0 B;  2CS4 A;  4GXB A;  1JRO A;  2UWQ A;  3DVN V;  3RNC C;  2FCN A;  4EZL A;  1SGH A;  1VLB A;  3T3N A;  2D11 A;  2MSE D;  1FCL A;  3RUI B;  4ZRK A;  4LTU A;  2QEJ C;  3WIM A;  2PEA A;  1I7H A;  3Q2A C;  5IO9 A;  1FRR A;  4WJO A;  4NQK E;  1SF0 A;  3QJZ A;  3OLM D;  3APF A;  5JH5 C;  2WXI A;  1DGJ A;  1K8R B;  1SBB B;  3AE2 B;  1E7P B;  1E10 A;  2WP9 B;  4RCO A;  4HVB A;  5CHF A;  1PGA A;  4O1N A;  4ICU A;  3U30 A;  2DHZ A;  2QIE B;  2AL6 A;  3O13 A;  3L13 A;  4W9L A;  1IBX B;  1X1M A;  3NY5 A;  1KH0 A;  1F1H A;  3BY4 B;  1K52 A;  2DWQ A;  3SFE B;  5HFY A;  1KLV A;  4HJK A;  1FRD A;  3PRP B;  3DCG A;  4WJQ A;  2K6D B;  2PE6 B;  4XE0 A;  5D2M B;  3L16 A;  2M56 B;  3PRE A;  2DZM A;  4KIK A;  5IAA C;  2VH1 A;  4A20 A;  4EZK A;  4NPN A;  4REZ A;  1TY0 A;  4YTP B;  1JWS D;  4BAX A;  4MM3 A;  1YX5 B;  2K1F A;  5IOI A;  4AOF A;  1OQQ A;  2KK8 A;  2INN E;  1ZOY B;  2LJI A;  2D3A A;  1HQR D;  2E3T A;  2AQ1 B;  4PYU A;  2NTS A;  4P7I A;  3C0R B;  1YQ4 B;  1SE9 A;  2RPV A;  2XN9 C;  2Y5B B;  3RT3 B;  2SEB D;  4II2 B;  5DCN A;  4IM2 A;  4UDU C;  2IGH A;  4GIV A;  2KAC A;  1TS5 A;  4DHJ B;  1P7F A;  2CR5 A;  3TUO A;  3QA8 A;  3I3T B;  4EZJ A;  3RFZ B;  2M17 A;  1QOB A;  4TQ1 A;  1E9M A;  2KTR A;  3PZ8 A;  3ZW3 A;  3PTF C;  4C56 C;  2BYT A;  3V6E B;  5BMH A;  3DHG C;  2MQJ A;  1F2R C;  1I4H A;  2HJ1 A;  3ML8 A;  2NTT A;  4ZHP A;  2V1Y A;  1TKY A;  3ABV B;  2RR9 A;  3LXF A;  2ZPN A;  2KLG A;  4E74 A;  4L23 A;  4H2A A;  4KSK C;  4MEM A;  4EEW A;  3ZNG C;  2KX0 A;  2MX2 A;  2JRH A;  1VDV A;  3U4E G;  1TTN A;  1F2R I;  3CF6 E;  1ZE3 D;  3D32 A;  1C76 A;  1WZ3 A;  1YN4 A;  3NVW A;  3DBL B;  1EO6 A;  4X57 B;  3A1Q A;  2L0F A;  3EEC A;  1QLB B;  1K53 A;  1L5P A;  2ZJD A;  4HXD A;  1BT0 A;  3AEG B;  4CHK A;  2AWT A;  3TEX A;  2IO2 B;  1NI2 A;  2NPT B;  3TEW A;  2K8H A;  2ZPY A;  4M01 A;  5DPS A;  1UH6 A;  3OWE B;  2C5L C;  2IO0 B;  2GRI A;  2G3Q B;  4JE3 B;  1WE6 A;  3DBS A;  2PVO D;  4IOI E;  1WI0 A;  1A5R A;  1AW7 A;  1WXV A;  2JWU A;  2PMV A;  1MHH E;  2D5G A;  2LEK A;  5TSS A;  1JRU A;  1WR6 E;  3ZKJ C;  1JWB D;  1ROE A;  1IPG A;  1TJE A;  3CSF A;  1H8C A;  2MW5 A;  4EUT A;  3K9O B;  5JXV A;  1WYG A;  4JQW C;  3QHT A;  1JWA D;  5FKA C;  3MJW A;  4IDI A;  3VH4 B;  2LAS A;  3KYD D;  4CQN A;  3MFG A;  4KGT A;  1HZ6 A;  1BXT A;  2KVZ A;  1ET9 A;  4US9 A;  1JQ4 A;  2ONQ A;  1VD2 A;  4AQ7 A;  5E6J A;  1AN8 A;  4KZC A;  3VR8 B;  4C7Y A;  1KFY B;  4OVZ A;  4ACF A;  3N30 A;  1WMH A;  1FXA A;  2PW9 A;  4I6L B;  4E3C A;  2K5P A;  4BOS C;  5JHB A;  1C79 A;  4NAW A;  1IBX A;  1MJD A;  1BUI C;  1HA5 A;  2KKC A;  1V80 A;  5MPO A;  3APD A;  1MG8 A;  2M8S A;  3N1Y C;  5LLI A;  1GAQ B;  2WXO A;  4GSW A;  1P0R A;  2IBI B;  3C8Y A;  2MRP A;  1WXM A;  1FEH A;  2QCZ A;  1FPY A;  4ZHO A;  2N9E B;  5D94 A;  1T5X D;  4RH6 A;  3SD5 A;  1WGK A;  2CHZ A;  3AU5 A;  2RDH A;  4N9F 4;  1E7V A;  4XWT A;  1VR9 A;  2DZJ A;  5C3J B;  1UBI A;  1YJ1 A;  1M94 A;  3WAM A;  2K8B A;  2KVR A;  2WGS A;  1R4M I;  4NZL B;  1ACC A;  5G5G A;  3B0A A;  3KW5 B;  2IY1 B;  3DQV A;  2N9L A;  1NEN B;  2JPH A;  4HPL B;  2GOW A;  5DPW A;  2BWF A;  2J0J A;  1T0R C;  1I4G A;  3IHP C;  3FKY A;  3EFU A;  4N58 A;  2WXG A;  3CWI A;  4W9K A;  4A8X C;  2GMI C;  2V0G A;  4BKS D;  4K7U A;  2R61 A;  2W54 A;  3EGR A;  3TCA A;  5J18 A;  2OED A;  4KGS A;  3W9C B;  1L0Y B;  1WJ4 A;  5IN7 A;  2AYO B;  2ON8 A;  1EM7 A;  1WGH A;  4RGT A;  2K25 A;  2RPQ A;  3AEA B;  1D4B A;  2I38 A;  1WGD A;  1GPX A;  3SFD B;  1XLQ A;  1I35 A;  4W9F A;  3ZQ4 A;  1V49 A;  3R2I A;  4BOZ B;  4YTM B;  4L1B A;  1UGJ A;  3KWL A;  4HRS A;  3DBL I;  3VHT C;  2AQ3 B;  2LXC A;  1ISN A;  5AZF A;  1FXI A;  4J6I A;  1TY2 A;  4XX5 A;  5AUI A;  2WU2 B;  1SE3 A;  4GMV A;  3NVZ A;  3RCZ A;  1R4N B;  3AEF B;  1P3Q U;  1WWT A;  3ETR A;  4GDK B;  2KDF B;  3N9Y C;  3P42 A;  2CJO A;  2IO1 B;  1HE8 A;  4XDC A;  4NJC A;  3RZW C;  4RNA A;  2W82 A;  4LDT B;  1G6J A;  2BF8 B;  1UWX A;  1I42 A;  1I4R A;  1NYR A;  5E6N A;  1LGR A;  4KIK B;  3PS6 A;  3KUD B;  1HTQ A;  2QDF A;  5HKH A;  3HM6 X;  4MM3 B;  2NBW B;  4IM3 A;  3QX1 A;  1WX7 A;  2Y5P A;  3U7Z A;  3V6C B;  4WUR A;  4MGI E;  3NRZ A;  3UQB A;  3EA6 A;  1J19 A;  1TS2 A;  3AM9 A;  3L17 A;  2WXM A;  1T0Y A;  3AH7 A;  1PFD A;  2KQ7 A;  3Q69 A;  3HVD A;  3SDL C;  4ASW C;  3WAP A;  2D2Q A;  4WQM A;  3H7P B;  3AE6 B;  2FCQ A;  2MJE A;  3PGE A;  3QWZ B;  2KN5 A;  2LHD A;  5BMG A;  2BKR B;  2WX0 A;  2KTR B;  1XD3 B;  1S1Q B;  1UGM A;  3ZXV A;  3CIR B;  3L10 B;  5EDS A;  1EU4 A;  4IWP A;  3AN1 A;  3MC9 A;  4R3D A;  2VZK B;  2EMS A;  4MT5 A;  1KJT A;  4BKS A;  3A4R A;  5FR6 A;  4K7S A;  2WDQ B;  3U7D A;  1TKG A;  4PK1 A;  1KTK A;  3QCA A;  2PJH A;  2MWS B;  1FMA D;  1GOZ A;  2G1E A;  5E6P A;  1UNS A;  3A1Q B;  2BWE S;  5D6J B;  2FNJ B;  3V61 A;  4HPP A;  4B0M A;  1L2N A;  2KZR A;  1ZP0 B;  1MPE A;  4MDK E;  3QC8 B;  3AV8 A;  1C1Y B;  1N63 A;  3BYT B;  3KVF B;  2BGF A;  3DVG X;  2L76 A;  3NJT A;  3VFK A;  4DHZ B;  4B9K A;  4NY0 A;  2KTF A;  2KYW A;  1V86 A;  3P4P B;  2KDE B;  3H1U A;  3R3M A;  5EE0 A;  1Q0W B;  3QAQ A;  3FIL A;  1WIA A;  5E6O A;  4G11 A;  1IGC A;  4YT0 B;  2PLP A;  2OJR A;  1LQB A;  3AE7 B;  4C4V B;  3OG5 A;  1C4A A;  3DVN U;  1D6E C;  2OHF A;  3GE8 C;  3J9C A;  3AE5 B;  3ZGZ A;  2N9K A;  3VUY A;  2BVC A;  3JW0 X;  4JPS A;  2O6V A;  4B0E A;  4WWP A;  4G3X B;  1C77 A;  1SEB D;  3RI7 C;  4D2K A;  1Q1O A;  2LVQ A;  3KUZ A;  3R7Q A;  4TUU A;  3L4P A;  2WLB A;  3EC8 A;  3IXS A;  3A4S C;  3EFC A;  4DDI D;  2M1M A;  4BFR A;  1EWY C;  2PE9 A;  3SHQ A;  1HTO A;  2KC1 A;  1PGB A;  2INC C;  2G4D B;  1IYF A;  2K6Q A;  2FID A;  1KOT A;  3W5V B;  3PHX B;  4JIO U;  1J0G A;  3LB8 C;  3WCQ A;  3ZDT A;  1YIW A;  4DK5 A;  3O65 B;  2LHE A;  1NEK B;  3A9J B;  1A70 A;  1WMH B;  2ZEQ A;  1SB3 C;  4JLC A;  2WXQ A;  4XZ4 A;  1RM6 C;  4NAW B;  4RGM A;  1UEL A;  1OFF A;  4GDK A;  2ZW1 A;  2HTM E;  4WWM A;  3N1Z C;  1OQY A;  3X0W A;  5FR3 A;  4M8N A;  3ZTC A;  3L0W B;  1R4N I;  4WH4 A;  4KZ0 A;  1N60 A;  1XO3 A;  3EHV A;  1FNV A;  3P4Q B;  2VH2 A;  4IM0 A;  5AUK A;  3QK0 A;  1OEY J;  4LJP B;  3ZJT A;  3WA0 A;  3UIO B;  3I5J C;  5JZE B;  3ONS A;  1MFW A;  2B76 B;  1OEY A;  1RRB A;  4FHK A;  2D3G A;  2KD0 A;  2X8X X;  3ZRC A;  1WYW B;  1R4M B;  1U4A A;  2M0A A;  4FBJ B;  3IG3 A;  1WY8 A;  5DPR A;  2CU1 A;  1HEZ E;  3VAW A;  3GZN I;  3ZNI D;  1MVK A;  4PS8 A;  5J2R A;  2N4F A;  4L2Y A;  4DXF A;  3KYC D;  1V2Y A;  1L0V B;  1F9J A;  2WDR B;  3DDC B;  2BTE A;  3H7P A;  1B1Z A;  2Q5W D;  1FO4 A;  4JWU C;  2KMC A;  4ANU A;  1SSN A;  2DZK A;  1VCB A;  3B1L X;  3JVZ X;  3UGB B;  4A90 A;  2WXK A;  4HKQ A;  1Y8R C;  1GNU A;  2GBM A;  1C4C A;  5BO4 B;  5EE9 A;  4EKU A;  2KFK A;  2L7R A;  2PKO A;  5CHW A;  3HIZ A;  4EFO A;  1E8Z A;  1WGY A;  1ENF A;  1XT9 B;  2GB1 A;  2KXJ A;  5CHV C;  1GJZ A;  5IP4 D;  5AZH A;  4FJY A;  3VRA B;  4DWF A;  2ZNV B;  2LI5 A;  1ZUD 2;  2LRW A;  2AEH A;  4LNN A;  2PVG C;  4ANW A;  1PQS A;  3N1X C;  1JCK B;  1UBQ A;  2D07 B;  1QKZ A;  1CZP A;  3VTU A;  2JRI B;  2N7D A;  2DX5 B;  2GBJ A;  2FCM A;  1EUV B;  3FC4 A;  1JW9 D;  3GP7 A;  3UI3 A;  2N1V A;  3ML9 A;  4KDL B;  4US8 A;  4USA A;  1SIF A;  5IKC M;  3GOE A;  2JXX A;  2H89 B;  5JHA A;  3ZYY X;  2VRR B;  2MJ3 A;  5EE1 A;  4P16 A;  2JUO A;  4QAY A;  1PYW D;  2K22 A;  2G9H D;  3NVY A;  3HK0 A;  3OAW A;  1YD8 U;  3TL5 A;  5LXH A;  2EMT A;  4C4V A;  2YEP B;  4DXG A;  5HHD G;  1E5W A;  2JWZ A;  1D5X C;  1QQR A;  1ZGU B;  3GE3 C;  2V4L A;  1RFA A;  2EEL A;  5G5H A;  3ZXR A;  1WJN A;  1MG4 A;  3RPF C;  1J8C A;  2ZZP B;  4IUM B;  3AI5 A;  2FE8 A;  3K9P B;  2FIF A;  4IWQ A;  4EOY A;  2BS2 B;  1ZDX A;  1WJ6 A;  2MA9 B;  3X23 A;  4WIP A;  1XQQ A;  1SJH D;  1WR1 A;  4WQO B;  3RYT A;  3VXW A;  1PUT A;  5KHQ A;  1V1P A;  4MAC A;  3A9J A;  4MH8 A;  5EE3 A;  4W9C A;  1ZPS A;  2ACZ B;  3N32 A;  4BKT A;  2NBV B;  4BBN C;  1GUA B;  1FIQ A;  1ESF A;  2DNF A;  1GC6 A;  2BS3 B;  4C80 A;  3VTV A;  1WF9 A;  5J17 A;  1K50 A;  1J7B A;  4N59 A;  3M3J A;  2K0P A;  4MSM B;  1YMH E;  2IO3 B;  4MSQ B;  4RF0 A;  3GB1 A;  4NAM A;  3NS8 A;  1C9F A;  4ZRJ A;  1Y56 A;  3VTW A;  1WXQ A;  4TKN A;  3AE4 B;  1E0Z A;  4BKG A;  1IUE A;  2WU5 B;  3AED B;  2JZP A;  2HE7 A;  5G55 A;  5BYR A;  3A33 B;  2J7Q B;  2MLB A;  2TSS A;  4IG7 B;  1N5W A;  1L6V A;  1N61 A;  2CKH B;  3RMK C;  2GLS A;  1T0Q C;  2MP2 A;  3I57 A;  3BII D;  2MJD A;  2UU7 A;  1Z5S B;  1N62 A;  3Q8B A;  1XEE A;  2AQ2 B;  2MEK A;  3FIL B;  2BS4 B;  1WXA A;  4ARC A;  1JWU D;  1TKE A;  4ZRI A;  1PDX A;  2KX3 A;  1NBF C;  5GXG B;  1J7A A;  3UIN B;  1HZ5 A;  3IFW B;  4K7W A;  1Q5W B;  2C60 A;  3Q3J A;  5H8Y E;  2OJW A;  1KF6 B;  5T8I A;  3M95 A;  2N1W A;  1C3T A;  2L8J A;  1UF0 A;  4DHZ E;  2O6V B;  2ZNV C;  4OHJ A;  4WAA A;  3V62 A;  1SIJ A;  3HHM A;  1E6E B;  3PRM B;  3V05 A;  3SEB A;  3UIP B;  2JT4 B;  4FJV B;  4DXA B;  1AAR A;  4XDD A;  1YQB A;  2DBY A;  2BPS A;  4G0N B;  4PT5 A;  3P2B A;  4DQO C;  1SJE D;  4FLH A;  3VUX A;  2LMC A;  3DHI C;  1WE7 A;  1UZX B;  2D3B A;  2RSU A;  3ZUN A;  4HCP B;  4F8C B;  1YN5 A;  4HRO A;  3NZU A;  2AL3 A;  1QF6 A;  2BT6 A;  1L4D B;  2K9X A;  3KH0 A;  2L00 B;  2JYT A;  3Q6B A;  1HXY D;  3WAN A;  4BBN F;  1WM2 A;  4RGO S;  2RDG A;  3MHZ A;  3DWM A;  2GI9 A;  4ICV A;  5D3I B;  2Z0D B;  3S2A A;  1I4Q A;  3U52 E;  2N7E A;  3RNB C;  3NZS A;  2J4X A;  1V5O A;  2H88 B;  2J42 A;  1J7C A;  3GZN B;  3IBE A;  4FA6 A;  3A9K A;  4URK A;  1WSP A;  4ARI A;  2LGD A;  2LJ5 A;  3B08 A;  3NS1 A;  2FUG 1;  4KX6 B;  1TZO A;  2WQY B;  5HG2 A;  4FJZ A;  2D10 A;  1ZXI A;  4GDL A;  1DYQ A;  2PPH A;  2DAJ A;  5KHO A;  4XC2 A;  1UUP A;  3ALB A;  2BQQ A;  3P4R B;  2LVP A;  3FAH A;  2SAK A;  1F77 A;  2I1K A;  2ZW0 A;  3Q3N C;  1YNT E;  1FNU A;  4Q2J A;  3N3K B;  2Z0E B;  2KLC A;  3BVZ A;  1YJJ A;  3Q14 C;  2Z59 B;  2KFK B;  1VZ7 A;  2HD5 B;  1I4X A;  1ZW7 A;  3V60 A;  2ICI A;  2L3Z A;  1EWC A;  2KO3 A;  1D5M C;  3LJ3 A;  4LDT D;  3TEZ A;  2WXN A;  3KUC B;  3R7R A;  1L0X B;  3LDZ E;  2JZZ A;  4TMA B;  2C7H A;  2L05 A;  3BWU D;  2IND C;  4RM8 A;  4KVG B;  1CQV A;  3VR9 B;  3CST A;  3JSV A;  3IT6 B;  2BB5 A;  3P1M A;  1QIL A;  3AEE B;  4IW0 A;  4JGH B;  1FD6 A;  3H6N A;  1P9D U;  1IGD A;  2IGG A;  1EF1 A;  1P1A A;  1SXT A;  1MHX A;  3VQI A;  1F0Z A;  2CHX A;  4ANX A;  1F52 A;  4M0W A;  2V9H A; 
#chains in the Genus database with same CATH homology
 3VH4 B;  2FCS A;  2LAS A;  3KYD D;  2KHW B;  2MBB B;  2MCN B;  5DPT A;  1FXT B;  3DVG Y;  3KYC D;  1V2Y A;  3T9L A;  2GBR A;  2REX A;  2XEW A;  3DBH I;  1F9J A;  1OGW A;  2WDT B;  4MGK E;  3PSE B;  3DDC B;  1VD2 A;  3H7P A;  1L7Y A;  1TBE A;  3TIX A;  3PT2 B;  2KDI A;  2NPT A;  2KMC A;  1WZ0 A;  2NBU A;  4ANU A;  4FN2 A;  3MTN B;  2DZK A;  1VCB A;  4KZC A;  3B1L X;  3JVZ X;  3UGB B;  2OOB B;  3N30 A;  1WMH A;  2O2V A;  3ZNZ B;  1LM8 B;  1Y8R C;  4I6L B;  4E3C A;  1GNU A;  2GBM A;  1CMX B;  4NAW A;  4BOS C;  3RZF A;  5JHB A;  5BO4 B;  2DYO A;  4W9D A;  4EKU A;  2KFK A;  2K8C A;  2L7R A;  2KKC A;  5CHW A;  3HIZ A;  1V80 A;  1WXS A;  2O6V D;  3APD A;  4EFO A;  3U8Z A;  1MG8 A;  3DOW A;  5GMV A;  5CX3 A;  2JF5 A;  4MH0 E;  1E8Z A;  1WGY A;  4BVU C;  4E71 A;  2KMA A;  2M8S A;  1WGR A;  4FUL A;  1XT9 B;  2YVC A;  4K1R B;  5LLI A;  2FUH B;  4HPM B;  4M8M A;  4CYE A;  3VH3 B;  4GSW A;  2KXJ A;  5CHV C;  1P0R A;  2KDB A;  2IBI B;  1GJZ A;  4W9H A;  2MRP A;  1WXM A;  5G2N A;  2UYZ B;  2A4Z A;  5AZH A;  4FJY A;  2JZ3 B;  5CTR C;  1S3S G;  2N9E B;  5D94 A;  4B95 A;  2ZNV B;  2LZ6 A;  2LI5 A;  4DWF A;  2LRW A;  4AP4 C;  1RLF A;  2LGX A;  4HDO A;  3ZVV A;  2NVU I;  2AEH A;  1LFD A;  2BYF A;  4ANW A;  2KJ6 A;  3SD5 A;  1PQS A;  2LGY A;  2CHZ A;  4DDG D;  3AU5 A;  1UBQ A;  4W9I A;  2D07 B;  2BYE A;  1E7V A;  4N9F 4;  2C9W B;  2DZJ A;  3VTU A;  1UBI A;  2JRI B;  2N7D A;  3ZRF A;  2DX5 B;  3PVL A;  1YJ1 A;  2GBJ A;  1M94 A;  3PLV A;  3WAM A;  2FCM A;  1EUV B;  1GC7 A;  1P98 A;  2LRU A;  3CMM B;  3UQA A;  2N1V A;  3ML9 A;  4KDL B;  4I6P A;  2K8B A;  2KVR A;  1SIF A;  3GOE A;  2JXX A;  5L83 A;  2LD9 A;  2M0X A;  1R4M I;  2GBK A;  2WX1 A;  3PRZ A;  5JHA A;  3B0A A;  3KW5 B;  2VRR B;  2IY1 B;  1E8X A;  3L08 A;  3DQV A;  2C7N B;  3OJ3 A;  3SU8 X;  2JPH A;  4HPL B;  4F1S A;  3VDZ A;  2GOW A;  5DPW A;  2BWF A;  1WX8 A;  2JUO A;  2J0J A;  4G50 A;  3UF8 A;  4GB9 A;  3ZNH B;  1WGG A;  4HK2 A;  3W1S C;  3IHP C;  3APC A;  2N9P C;  3EFU A;  1LXD A;  3DPD A;  3HK0 A;  3TJP A;  2G4S A;  2B3A A;  3OAW A;  1YD8 U;  4W9K A;  3TL5 A;  2DYM A;  2GMI C;  2V3S A;  3DBR I;  3HM3 A;  4BKS D;  4K7U A;  1V81 A;  5LXH A;  1OTR B;  2ZCB A;  2EMT A;  4HLE A;  3TCA A;  4WWO A;  3RUL A;  4FHJ A;  3W1S A;  5J18 A;  4TV3 A;  1WJ4 A;  2GBN A;  4KSL C;  1E5W A;  2IZV B;  2JWZ A;  2JY6 A;  2AYO B;  1EF5 A;  3MHS D;  1WGH A;  3PPA A;  1ZGU B;  2K25 A;  2V4L A;  4HDQ A;  2RPQ A;  1RFA A;  3PHW B;  2I1J A;  2WWZ A;  2KWV B;  1WGD A;  2XBB C;  4NNJ B;  1WJN A;  2QHO A;  1J8C A;  2KNB A;  2ZZP B;  4IUM B;  2IYD B;  1TGZ B;  3AI5 A;  3K9P B;  2FIF A;  1I35 A;  2KWU B;  4GU2 A;  4W9F A;  2DYB A;  2A5U A;  4IWQ A;  4EOY A;  4W9G A;  3VUW A;  1WJ6 A;  5LXI B;  1V49 A;  2MA9 B;  3X23 A;  1E8Y A;  2LVO A;  2XK5 A;  3W1Y A;  1GG3 A;  4BOZ B;  1XQQ A;  4W9J A;  4PYZ A;  2MP2 B;  3TBL D;  2KJR A;  2ZCC A;  5C1Z A;  2C7M B;  4HCN B;  5AEK B;  2MBO A;  1WR1 A;  3DBL I;  4WQO B;  3RYT A;  2G45 B;  4GOC A;  2R2Q A;  2DAF A;  5IA7 A;  3AUL A;  3VHT C;  3VXW A;  3H7S A;  2LXC A;  1E90 A;  1ISN A;  2NCN A;  1E7U A;  5KHQ A;  5AZF A;  2ZVN A;  2J0M A;  3QIJ A;  4J6I A;  3TMP B;  2BKF A;  4MGY E;  2HTH A;  4XX5 A;  4GMV A;  3A9J A;  4RMA A;  4RM9 A;  2HJ8 A;  4TQ0 A;  4W9C A;  2YLM A;  2M4N A;  3RCZ A;  3NOB A;  3N32 A;  3R66 C;  1WJU A;  4MJS A;  4BKT A;  2NBV B;  4BBN C;  2K39 A;  1P3Q U;  1GUA B;  5C23 A;  4GDK B;  2KDF B;  1YX6 B;  1V6E A;  3ZDM C;  3WAO A;  2N9X A;  1V9J A;  2IO1 B;  1WM3 A;  1GC6 A;  1HE8 A;  1E8W A;  3NHE B;  3QQ8 B;  3AU4 A;  3RZW C;  3VTV A;  1UD7 A;  1WF9 A;  4LDT B;  1G6J A;  5J17 A;  2BF8 B;  5D7G A;  2BYV E;  3M3J A;  4GN1 A;  1I42 A;  4MSM B;  2IO3 B;  2MBH A;  4MSQ B;  5E6N A;  4KIK B;  2RD0 A;  4FAD A;  3NS8 A;  2CS4 A;  4GXB A;  4ZRJ A;  3PS6 A;  2UWQ A;  3KUD B;  3DVN V;  2KOX A;  1WRD B;  3ZLZ A;  2FCN A;  3VTW A;  5HKH A;  4EZL A;  3HM6 X;  1SGH A;  4TKN A;  3ZO5 B;  4AUQ C;  2D11 A;  2NBW B;  2MSE D;  4IM3 A;  3QX1 A;  1WX7 A;  3V6C B;  4BKG A;  3RUI B;  4ZRK A;  4YL8 A;  4A3P A;  4MGI E;  3UQB A;  2CHW A;  4IWO A;  4B6W A;  2HE7 A;  3WIM A;  2PEA A;  5G55 A;  1J19 A;  3A33 B;  3L17 A;  2J7Q B;  2MLB A;  2RGF A;  3AXC A;  1T0Y A;  4IG7 B;  4WJO A;  4NQK E;  3QJZ A;  3OLM D;  3APF A;  2CKH B;  5JH5 C;  2MP2 A;  2KQ7 A;  4DHJ D;  2DEN B;  3SDL C;  4ASW C;  1Z5S B;  2MBQ A;  1K8R B;  2D2Q A;  3WAP A;  3H7P B;  4PS3 A;  2FCQ A;  1WXA A;  4HVB A;  5CHF A;  1KM7 A;  3M62 B;  3PGE A;  3QWZ B;  2KN5 A;  4ICU A;  3U30 A;  4KDI C;  4ZRI A;  2KX3 A;  3ECI A;  1NBF C;  2BKR B;  2DHZ A;  2WX0 A;  2KTR B;  1XD3 B;  2AL6 A;  3M63 B;  3L13 A;  3UIN B;  1S1Q B;  3IFW B;  4K7W A;  4W9L A;  1Q5W B;  1UGM A;  1X1M A;  2C60 A;  3NY5 A;  4MGZ E;  3BY4 B;  3L10 B;  3Q3J A;  1WH3 A;  5EDS A;  2ZVO A;  2KJH B;  3M95 A;  5AZG A;  2N1W A;  4IWP A;  2L8J A;  1C3T A;  1KLV A;  4DHZ E;  2KAN A;  2O6V B;  4HJK A;  2ZNV C;  4WAA A;  3PRP B;  2KWC A;  3DCG A;  3V62 A;  4WJQ A;  2K6D B;  4ZDV A;  2PE6 B;  2EKE C;  4OVV A;  2EMS A;  3A9K B;  3HHM A;  2WYQ A;  2LUE A;  1KJT A;  5D2M B;  4BKS A;  3A4R A;  5FR6 A;  3L16 A;  3PRM B;  4K7S A;  4IC7 B;  3U7D A;  3PRE A;  3PV1 A;  2DZM A;  3H9D A;  4KIK A;  4DBG A;  4ZYN A;  3UIP B;  3QCA A;  2JT4 B;  4LCD E;  5IAA C;  4A20 A;  4FJV B;  4AJY B;  2PJH A;  4DXA B;  2MWS B;  1AAR A;  3T8M A;  5E6P A;  5L95 C;  3A1Q B;  4EZK A;  4NPN A;  2BWE S;  4WWN A;  4GGQ A;  4GDL B;  1YQB A;  5D6J B;  4ANV A;  4MM3 A;  1YX5 B;  2FNJ B;  3ENE A;  2K1F A;  3V61 A;  2BPS A;  1L2N A;  2KZR A;  4MDK E;  3QC8 B;  1NDD A;  4AOF A;  2KK8 A;  4G0N B;  4KV2 A;  3P2B A;  4CO7 A;  4FLH A;  3VUX A;  1C1Y B;  3KVF B;  4PYU A;  2BGF A;  3DVG X;  5TR5 A;  1WE7 A;  1UZX B;  2L76 A;  2RSU A;  3ZUN A;  4P7I A;  3C0R B;  4HCP B;  4F8C B;  4AWJ A;  1SE9 A;  3NZU A;  2NS5 A;  2Y5B B;  3RT3 B;  3VFK A;  4DHZ B;  4B9K A;  2AL3 A;  4NY0 A;  2KTF A;  4II2 B;  5DCN A;  1V86 A;  3R3M A;  2KDE B;  3H1U A;  4IM2 A;  3KH0 A;  1Q0W B;  2L00 B;  3QAQ A;  3PLU A;  4GIV A;  4DHJ B;  1IP9 A;  1WIA A;  4AJW A;  5E6O A;  4G11 A;  2CR5 A;  3QA8 A;  3I3T B;  3WAN A;  4EZJ A;  2KFJ A;  2M17 A;  4BBN F;  4WJN A;  1WM2 A;  2OJR A;  4TQ1 A;  1LQB A;  2KTR A;  4ICV A;  3ZW3 A;  2Z0D B;  3PTF C;  3S2A A;  3V6E B;  2N7E A;  2MQJ A;  1D3Z A;  3JSV B;  3DVN U;  3ML8 A;  4HWI B;  2V1Y A;  3NZS A;  4II3 B;  2RR9 A;  2ZPN A;  2KLG A;  3IVF A;  4E74 A;  3VUY A;  3JW0 X;  1V5O A;  3JYU A;  4KSK C;  4MEM A;  4EEW A;  3ZNG C;  2KX0 A;  2O6V A;  3IBE A;  2MX2 A;  4G3X B;  4WWP A;  2DZI A;  4FA6 A;  2IY0 B;  3A9K A;  2JRH A;  4I6N B;  4URK A;  1RAX A;  1Q1O A;  2LVQ A;  3KUZ A;  1WFY A;  3R7Q A;  4TUU A;  1TTN A;  3CF6 E;  4F7Z A;  3EC8 A;  4M0W B;  2LGD A;  2LJ5 A;  3B08 A;  3A4S C;  3D32 A;  1WZ3 A;  4DDI D;  2ASQ A;  2M1M A;  4BFR A;  4FJZ A;  2D10 A;  1EO6 A;  4X57 B;  3A1Q A;  4OVU A;  2XK5 B;  1ZKH A;  2L0F A;  2PE9 A;  4GDL A;  3EEC A;  3SHQ A;  2PPH A;  2DAJ A;  4WJP A;  2ZJD A;  2KC1 A;  4HXD A;  5KHO A;  1BT0 A;  4K81 A;  4XC2 A;  2G4D B;  1IYF A;  4NQL B;  2FAZ A;  4CHK A;  3ALB A;  2K6Q A;  2FID A;  1KOT A;  3PHX B;  2AWT A;  2LWP A;  4JIO U;  1J0G A;  3OJ4 B;  2IO2 B;  1NI2 A;  2NPT B;  4NJ7 A;  2LVP A;  2K8H A;  2ZPY A;  1TZ1 A;  3WAL A;  3ZDT A;  2I1K A;  4MEL A;  1YIW A;  4DK5 A;  3RD2 A;  3O65 B;  3A9J B;  5DPS A;  1WMH B;  2O2V B;  2ZEQ A;  4LJO B;  4JLC A;  1UH6 A;  1Z2M A;  4XZ4 A;  1WX9 A;  4NAW B;  1V5T A;  2C5L C;  3N3K B;  2KC2 A;  2Z0E B;  4MJS B;  2KLC A;  2IO0 B;  1UEL A;  1H4R A;  2Z59 B;  2G3Q B;  2LXA A;  2KFK B;  4GDK A;  2HD5 B;  1ZW7 A;  1OQY A;  3V60 A;  4JL9 A;  3X0W A;  4M8N A;  3ZTC A;  2L3Z A;  2KO3 A;  4LDT D;  3LJ3 A;  1WE6 A;  1R4N I;  3L0W B;  3ZTD A;  3DBS A;  4KZ0 A;  3KUC B;  2NR2 A;  3R7R A;  1WI0 A;  1A5R A;  3LDZ E;  2JZZ A;  1WXV A;  3EHV A;  4IM0 A;  2C7H A;  2L05 A;  3VVW B;  4RM8 A;  3QK0 A;  4KVG B;  1OEY J;  4LJP B;  3WA0 A;  3UIO B;  3CST A;  3JSV A;  5JZE B;  2L0T A;  3ONS A;  3Q3F A;  4IW0 A;  3L54 A;  1JRU A;  2W9N A;  1WR6 E;  4JGH B;  1OEY A;  4PS7 A;  3ZKJ C;  4A3O A;  1RRB A;  4W9E A;  3H6N A;  1IPG A;  4FHK A;  1P9D U;  3CSF A;  4NJ6 A;  1EF1 A;  2J0K A;  2D3G A;  2KD0 A;  3PZD A;  1H8C A;  1P1A A;  2MW5 A;  4EUT A;  2JVC A;  3K9O B;  2R2O A;  2MBE A;  3ZRC A;  3BIN A;  1WYW B;  3VQI A;  4JQW C;  1QZE A;  1U4A A;  3QHT A;  3ZIM A;  4FBJ B;  3IG3 A;  2CHX A;  1WY8 A;  5DPR A;  4ANX A;  2CU1 A;  3VAW A;  3GZN I;  3ZNI D;  4PS8 A;  5J2R A;  2N4F A;  3QAR A;  3MJW A;  2KQS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...