2KMMA

Solution nmr structure of the tgs domain of pg1808 from porphyromonas gingivalis. northeast structural genomics consortium target pgr122a (418-481)
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
73
structure length
73
Chain Sequence
MEVMVFTPKGEIKRLPQGATALDFAYSLHSDLGDHCIGAKVNHKLVPLSYVLNSGDQVEVLSSKSLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Guanosine-3',5'-bis(Diphosphate) 3'-pyrophosphohydrolase
publication title Solution NMR structure of the TGS domain of PG1808 from Porphyromonas gingivalis. Northeast Structural Genomics Consortium Target PgR122A (418-481)
rcsb
source organism Porphyromonas gingivalis
molecule tags Hydrolase
total genus 9
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2009-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02824 TGS TGS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2kmmA00
3AE8B 1XLNA 2WU5B 1L6VA 1FFVA 5AUIA 3FAHA 1PUTA 2B76B 2WDRB 1RM6C 1AWDA 4N59A 3AMZA 2EKIA 2N0SB 1JRPA 1NENB 1VJKA 5EE3A 1F0ZA 1N62A 3P4RB 1XLPA 3RPFC 1FO4A 1DGJA 1WXQA 1J7CA 4HROA 3VRAB 3AB5A 2MJEA 1EWYC 3NRZA 1E9MA 1OFFA 4JX1C 5H8YE 1QOBA 4FXCA 5C2TB 4JWUC 1RWSA 2MJDA 1KF6B 1SF0A 2M19A 1QOFA 2WDVB 1UWMA 1XO3A 4N6EB 1A70A 3P4SB 2K9XA 2PKOA 2CJOA 1JWAD 2W55A 3SFEB 1QOAA 3CWIA 3VRBB 5GXGB 4YTPB 3HRDD 5EE1A 1FXIA 3FC4A 1FIQA 2Q5WD 3KWLA 4LTUA 1FMAD 4USAA 1FFUA 3SFDB 1N61A 1FM0D 3AE5B 1E7PB 5G5HA 3AE6B 3P1MA 4YSXB 1N5WA 1E10A 1JROA 1KFYB 2H88B 4YTNB 1TJEA 3AEBB 2BS2B 2PVGC 1JWBD 3VR8B 3SR6A 3CIRB 5EE9A 3AE7B 1OQRA 3P63A 1J7BA 5G5GA 4JWSC 1CJEA 2QIEB 1QT9A 1N5XA 3NVZA 1JQ4A 3ZYYX 3BIID 1YQ4B 2BT6A 1TKGA 2WLBA 3AH7A 1PFDA 3VR9B 1B9RA 3AM9A 4YSYB 4YT0B 3B9JA 4US9A 4IDIA 1ZP0B 2L52A 1FRDA 1TYGB 3AE9B 3HVZA 3L4PA 5C3JB 3AEFB 1DOXA 3AE3B 1ROEA 2K5PA 4C7YA 5AUKA 3ABVB 1OQQA 2W3RA 2LEKA 4P6VF 3NVVA 1YQ3B 1CZPA 1GAQB 1L5PA 1N63A 1RYJA 2CJNA 2FBWB 3AE4B 1NVID 1NEKB 1WRIA 1PDXA 2KAJA 1E6EB 2W3SA 1T3QA 1SIJA 2H89B 2WP9B 4ZHOA 3P4QB 1FRRA 2JX5A 2JQRB 3PO0A 5MPOA 2G1EA 1I7HA 3AEDB 4YTMB 1QLBB 2Y5CA 3ETRA 4HRSA 2DWQA 2MJ3A 2QJLA 2WQYB 4A9AA 1J7AA 2ACZB 1NYQA 3AEGB 3NS1A 1V8CA 1JW9D 3DWMA 1VDVA 1V97A 4ZOHC 4YXDB 1L0VB 1XLQA 2AX5A 2W54A 3HUIA 3LXFA 1JALA 1YJJA 1QOGA 1IUEA 3B2GA 2OHFA 2WS3B 3W5UB 1ZUD2 2L83A 3AECB 1ZOYB 1QF6A 3AE1B 3AEEB 3AN1A 1DOIA 4N58A 1NI3A 1NYRA 4KX6B 1TKYA 4US8A 3W5VB 1GPXA 1TKEA 1WWTA 4ZHPA 5EE0A 2K22A 4YSZB 3NVWA 1VLBA 1SB3C 1WGKA 2CU3A 2MH7A 1DOYA 2HTME 3W9CB 3DWGC 1WYGA 2DBYA 2M56B 2BS4B 2WDQB 1XLOA 4WQMA 5H92C 3WCQA 4C80A 1AYFA 1R7SA 1YJIA 2PVOD 2KMMA 3AEAB 3LB8C 1L6UA 1ZXIA 2E3TA 1E0ZA 4WWMA 1N60A 1RFKA 2BS3B 2PIAA 3NVYA 3EUB2 2WU2B 3AV8A 1KRHA 3B2FA 4ITKA 4C7ZA 1FXAA 3AE2B 3P4PB
chains in the Genus database with same CATH superfamily
2INCC 1FFVA 1UNSA 1KH0A 3T3NA 1J0GA 1F0ZA 3VUWA 4B95A 2BB6A 3BK2A 4LJOB 5BMIA 1Y56A 4FBJB 1SF0A 3AI5A 3RZWC 5C23A 2X38A 3AU4A 1A70A 4JL9A 1JWAD 3CWIA 3J9CA 3U7ZA 1ZKHA 1FXIA 5AZGA 5CHVC 2KHWB 2ZNVC 4J3OD 3P1MA 4AS1A 5BMGA 3RULA 2WXHA 3CIRB 3NUHB 1N5XA 1YD8U 2W82A 1J19A 5DPTA 5LNK1 4K3BA 4GDLA 2BF8B 2ZVOA 1L7YA 2JXTA 4ZYSA 3L4PA 3PZ8A 1D5XC 4WJNA 1VZ6A 3R3MA 1NVID 2KWCA 1P7EA 4ANWA 2KYWA 3DBHI 5MPOA 1TS2A 1RRBA 4XC2A 3PRMB 5E6OA 4B0MA 4EFOA 1FEHA 4P7IA 2N9EB 5BYSA 3KW5B 2J0MA 3LXFA 1WSPA 2CU1A 4W9DA 2RD0A 5D94A 3BVGA 4L2YA 5DPRA 3AN1A 4GSWA 4HLEA 4LNOA 3NVWA 5IOIA 2Y5BB 2I1KA 2PVOD 1F2RC 1I35A 2DYBA 3EUB2 1HE8A 5J17A 4MGZE 2MLBA 3AE2B 4IW0A 4M01A 5HFYA 5AUIA 1OEYA 2FE8A 3FAHA 3PGEA 1YNTE 4DXAB 2V4IB 3RZFA 1FO4A 1NDDA 2BKFA 1EWCA 4JWUC 1SGHA 1HTQA 4DQOC 3PRPB 3KWLA 4LDTD 2KX3A 1FM0D 4G0NB 2O6VA 3AE6B 4W9HA 4YTNB 2LJIA 4RM8A 2C60A 1OQRA 3TUOA 5D3IB 4S0RA 2ZEQA 4C56C 5KHOA 1WX9A 3BZDB 3VR9B 3IFWB 1T0SC 3B9JA 1ZP0B 4FULA 2AWTA 2JU6X 2N7DA 4BKSD 3IAS1 5C3JB 1WM3A 2ZW0A 1MG8A 2JPHA 4C4VB 1OQQA 2GB1A 2WXQA 2FBWB 3H6NA 1PDXA 2H89B 1SIJA 2IBIB 3DPDA 4ZRJA 2QSDA 4FJVB 2IJ0A 2KDMA 3DBSA 1LFDA 3W5UB 5FR6A 3AE1B 1H8CA 2B3AA 4PS7A 3R8BA 4YSZB 1WJ4A 3NOBA 2LMCA 3MTNB 5H92C 1V81A 1TZOA 1R7SA 3Q69A 1HTOA 4EZLA 2KXJA 1UH6A 2DENB 1FCCC 2G4DB 3Q2AC 1V2YA 1L6VA 4MGIE 4RF1A 4A90A 4DDID 2CS4A 4WH4A 5D6JB 3RUIB 2EKIA 5IAAC 1ET9A 1V49A 4OVZA 1OFFA 2RR9A 2INNE 1UWMA 3RD2A 1AW7A 2BYFA 5E6NA 2RDGA 4K81A 3ZDTA 5JHAA 5EE1A 1P1AA 1D6EC 3U4EG 2Q5WD 5DPSA 4GDKB 4GB9A 3IVFA 4DBGA 1JROA 1CK1A 4OZBA 2KK8A 3TEXA 5J2RA 2CR5A 2VZKD 1UELA 3BIID 3HM6X 4DHJB 2MBQA 2PLPA 4YSYB 5L95C 4BZAA 3N20C 3DHGC 2KMCA 4IWQA 1T3QA 4HKZE 1L2NA 4WJOA 1C79A 3RT3B 2JX5A 2G1EA 3ETRA 1SE3A 2HTHA 1J7AA 3KUZA 4MH0E 1JW9D 2N9LA 2JZZA 1I4RA 2XBBC 3K9PB 3FILA 2WS3B 5G2NA 1LO5D 3H7PB 4HCNB 3UIOB 3RNBC 2MP2A 2KQ7A 1NI3A 2DX5B 4L1BA 1ET6A 4M0WB 1TS4A 2KFKB 2GBKA 1GUAB 1WGKA 3O65B 3OG5A 1TZ1A 1IGDA 4YWGG 2MX2A 1AYFA 3WAPA 4HCPB 1N60A 2ZW1A 2CKHB 2FUHB 4W9GA 2ZCCA 4C4VA 3V62A 2YEPB 1WH3A 4WQOB 3A33B 5E6JA 4FJYA 1R4MI 1TGZB 2PE9A 3H7SA 3M3JA 1UWXA 4JX1C 2LUEA 4NQKE 3I9V1 1KF6B 2M0AA 3P4SB 4XZ4A 1MVKA 4GN1A 3D32A 3SFEB 2OJRA 1WM2A 4BBNC 3PLUA 1ENFA 1JMLA 2NMQA 2J0JA 1WGYA 2LASA 2EKEC 3VAWA 1H4RA 1E90A 1L0XB 3A4SC 2V3PA 1ACCA 2Z59B 4BVUC 2FCMA 4ZDVA 3AEFB 4ARIA 3UI3A 3DOWA 2W3RA 2TSSA 4ARCA 5LXIB 3PVLA 3ECIA 4EKUA 2D11A 2QC8A 4M8MA 2KDBA 2UYZB 4BOSC 1FRRA 2IGGA 2JF5A 2JYTA 2WQYB 2K8CA 1VDVA 1R4MB 1XLQA 4WJPA 2K0PA 1UGJA 2K1FA 3CMMB 2LGIA 3IAM1 1VD2A 1WWTA 4HK2A 2JRHA 4F1SA 3A9KB 1KJTA 1XLOA 4JIOU 4AWJA 3AEAB 1P3QU 3DVNU 1MHXA 1F1HA 3M62B 1T0QC 3H1UA 3URYA 3SHQA 3B08A 1WXAA 4D2KA 1XLNA 1PUTA 2B76B 3V61A 2NPTA 1JRPA 2LVQA 3RNFC 4PK1A 2LXCA 1WXQA 2IDYA 3MFGA 3Q8CA 1WJNA 4N6EB 2C9WB 2K9XA 3PZDA 1NI2A 3BYYB 3DVGX 3PT2B 3H7PA 3AE5B 1KLGD 4M0WA 5TSSA 2KFKA 4QAYA 2GLSA 2BPSA 2J0KA 1MPEA 3DVGY 3OLMD 2KQ4X 1WMHB 5G5GA 4FN2A 4TQ1A 1QT9A 2DZIA 3WAMA 4W9LA 4IM0A 1TKGA 2WGSA 2WDTB 2D10A 4W9KA 3T9LA 3ZGZA 4B0EA 4W9EA 4EZJA 1PGAA 2KQSA 5IP4D 1D4BA 2DAJA 1SIFA 1C4CA 1LQBA 1YQ3B 1AARA 1WRIA 3ZNZB 2L00B 3PO0A 5L83A 1FD6A 4AOFA 4A9AA 3DWMA 3Q3OC 4GIVA 2Z0DB 3BVZA 3N30A 4RCOA 3L0WB 2V4LA 4RMAA 4G11A 1WIAA 3IHPC 3RYTA 1WGDA 1TIFA 3RNGC 3ZJTA 2BW2A 4FHKA 3ZJVA 1WZ3A 2HTME 3DWGC 5HKHA 3OWEB 5CTRC 3B2FA 2PMVA 2Y3AA 3TEZA 1BMLC 3T3OA 2JRIB 1E8ZA 4MACA 2NTTA 3L13A 1ZXHA 1UD7A 3W2DA 1RWSA 2AL3A 1KTKA 3O13A 4JGHB 4GOCA 2KO3A 1JWSD 3VTUA 3Q8AA 3MC8A 4XX5A 2D3AA 1VR9A 4LLGM 3I5JC 3TMPB 2I1JA 1DYQA 1M4VA 1STEA 4KGRA 3A9KA 3PLVA 4PS3A 1UGMA 3AE7B 4K7WA 2G45B 2KZRA 3ZVVA 1GC6A 3R7RA 4F7ZA 3L10B 2LRWA 3ZRCA 4MSQB 4LNFA 1V5OA 2ZJDA 1FRDA 1YOVB 1XQQA 4WWOA 3VDZA 1D5ZC 1I4PA 3FKYA 1HA5A 3VUYA 2L3ZA 3GE8C 1HXYD 3NVVA 4ACFA 1L5PA 2N9XA 1WE6A 2W3SA 1IPGA 1V9JA 2OJWA 4LNIA 1CMXB 2FCSA 1YX6B 2KVZA 3WA0A 2A5UA 3A4RA 1YN5A 2DWQA 4A55A 3APCA 3NS1A 1V8CA 1YIWA 1XXGA 3I3TB 2LD9A 2OEDA 2O6VD 1C1YB 3LYYA 3N9YC 4ANVA 4REZA 1SBBB 2FNJB 2K25A 1TKYA 2Z0EB 1SB3C 4L23A 1MG4A 3Q14C 3RCZA 4RGTA 2ICIA 2KNBA 2WU2B 3P4PB 3BINA 4M8NA 2J7QB 3L54A 1QQRA 2LXAA 1RM6C 4LDTB 2GOWA 4EE2A 2FIFA 2WXMA 3CF6E 3DDCB 3KYDD 3QWZB 3DBLI 5AZFA 3NRZA 3LDZE 1IBXB 2MBBB 2M19A 2RDBC 3W1YA 2D3BA 2KWUB 2LRUA 1FNUA 2W55A 1QILA 2N9PC 2N1VA 3SFDB 2XK5B 1XCQL 1RFAA 1J8CA 3NZ3A 2WXFA 4IOIE 1XCTL 4OZAA 5D2MB 3ZYYX 1PGBA 3E56A 2WLBA 4BKTA 2MA9B 1WGHA 1KOTA 5D7GA 1F52A 4ANUA 4JQWC 2QDFA 2IO3B 3QK0A 1DOXA 3ABVB 3DBHB 2CHZA 1CQVA 2KJHB 2K8BA 1UZXB 3M95A 3WAOA 1P98A 3QHTA 1YQBA 2NBWB 3KH0A 4B9KA 4NZLB 2G3QB 4ZOHC 1D5MC 3PS6A 2N7JA 2JXXA 2LZ6A 2R61A 3TJPA 3C8YA 4II3B 3DBLB 3TBLD 2FIDA 2WX1A 2Z8LA 1SJED 2KDEB 4PYUA 4US8A 2NBVB 2GMIC 2IGHA 2JWUA 2M1MA 3H8HA 2HE7A 1C9FA 3N32A 3B1LX 2DHZA 4EZKA 5AZHA 4RNAA 4P1CC 2JZ3B 2JVCA 2ON8A 3ZDMC 4HKQA 2N0SB 4FA6A 5BMHA 2M17A 2BGFA 4MH8A 1UBQA 4AUQC 2M8SA 3MP9A 4IKGA 2FUG1 5H8YE 3ZUNA 4BKGA 3QQ8B 2VZKB 1WZ0A 1G6JA 3IBEA 2C5LC 5BO4B 4B6WA 1R4NI 1XD3B 3VRBB 2KTFA 1N61A 3Q8BA 3VR8B 1BXTA 3P63A 4TKNA 2IO2B 5EDSA 2EMTA 3NVZA 4XGAB 1Q10A 3EFCA 4KVGB 2UWQA 3U8ZA 1ROEA 2JZPA 4FJZA 5GMVA 2K6DB 3DQVA 1S1QB 3V6CB 1GAQB 1N63A 1RYJA 4MJSB 1IBXA 1NEKB 2KAJA 2L8JA 3NJTA 2DYOA 3S2AA 3ONSA 1OGWA 1T0YA 4ZRQA 2KFJA 1KM7A 2DZJA 4TMAB 1UUPA 5IA7A 2WXIA 3R2IA 2XK5A 3TSSA 1IUEA 4BKSA 4IC7B 1C4PA 4E74A 3RNCC 2GBMA 2RSUA 4KSKC 2M4NA 4KZCA 4MT5A 1GPXA 5DPWA 4DK5A 3QARA 1EF1A 3ZNHB 2FCQA 2JUOA 3LJ3A 2DBYA 2KTRB 4C80A 1YJIA 2KMMA 1FPYA 1L6UA 1I42A 2MBEA 3VVWB 4HPPA 1WGGA 2PIAA 2HJ8A 3NY5A 3PZ7A 2AQ1B 5EE3A 1QKZA 1ZGUB 2MJEA 4GMVA 1EWYC 3WANA 5IKCM 4FXCA 2PW9A 1C76A 1U4AA 3L16A 4LNNA 4P1BC 3DVNV 3ZQ4A 5IN7A 2PKOA 4FHJA 4II2B 3DBRI 1PGXA 4YTPB 3DCGA 1K52A 1V80A 4HXDA 3W1SC 5TR5A 4NJCA 4YSXB 2LHDA 3PRZA 1N5WA 3IG3A 3ZXRA 1WRDB 2BS2B 2INDC 3NS8A 4HJGE 3HVDA 3B0AA 1RAXA 1CJEA 1N6ZA 1ZDVA 3RI7C 2NBUA 3AM9A 2JWZA 4NY0A 3TEWA 4I6NB 2K5PA 2MBOA 3VTWA 2ZPYA 3BWUD 2WYQA 3GE3C 3ML8A 4P6VF 3GP7A 3Q3FA 2KJRA 1E6EB 2WWZA 4G50A 3P4QB 2JQRB 1UBIA 3PREA 4XYCA 4YTMB 4PYZA 1T5XD 2MJ3A 1NYQA 1EUVB 1V1PB 4YXDB 2SEBD 3QC8B 4HDOA 4JLCA 2AX5A 4WWNA 4PS8A 3W1SA 2NCNA 1K8RB 1L4DB 1QF6A 1WR6E 4A20A 4KX6B 3W5VB 1IP9A 2BB5A 4MGKE 4EEWA 2WDQB 2M56B 2BVCA 2N7EA 3UF8A 3QAQA 2GRIA 2L0TA 2KT7A 4GDKA 2M0XA 3MC9A 4AP4C 1FNVA 1KLVA 4MJSA 4TUUA 1T6BX 1NENB 3KYCD 2K8HA 1ZW7A 1WY8A 3EECA 1XLPA 1BUIC 1DGJA 3MHZA 4A6QA 2FCNA 1FXTB 1AN8A 1TTNA 4RM9A 4ICUA 3P42A 4OW0A 4USAA 1XT9B 3OAWA 1E10A 2LGYA 1GB4A 5HI1A 3JW0X 5J18A 1SE9A 2WHIA 3EGRA 4ICVA 1V5TA 2BYVE 2L52A 1Z2MA 3SD5A 3AE3B 4AJWA 3R2TA 1JCKB 2KC1A 5E6PA 2G4SA 3QX1A 5JHBA 3ZJUA 2PEAA 1IGCA 2J4XA 3UINB 3VHTC 1L4ZB 3NHEB 4TQ0A 4YL8A 1WFYA 4RGNA 1I4QA 2W54A 2MEKA 1QOGA 1WX7A 1DOIA 2W9NA 1NYRA 2WXKA 1PQSA 3ENEA 4BOZB 4ANXA 1K53A 1TKEA 4ZHPA 3ML9A 3EHVA 4WJQA 2INPE 3JYUA 4FLHA 3HM3A 3ZNGC 4RGMA 4W9IA 1E7UA 5AEKB 1ESFA 2AQ2B 1FXAA 3M63B 2FAZA 2KANA 3BVMA 5FR3A 5HHDG 3GOEA 4OVUA 2IPKD 1LM8B 1F2RI 1P0RA 2ZNVB 4K1RB 3N1YC 1P9DU 5DCNA 4I6PA 2GBRA 2KOXA 1J7CA 4HROA 3VRAB 5C2TB 3QCAA 4H2AA 1V1PA 3Q3MC 2DAFA 2R2OA 4MELA 3VH3B 2IGDA 2EMSA 3X0WA 2JT4B 4LTUA 1S3SG 2K6QA 2LVOA 1EU3A 2HD5B 4GU2A 3ZO5B 2KVRA 1FNWA 1SE4A 1KFYB 3U30A 3MJWA 2BQQA 1F9JA 4KZ0A 3IT4B 2WXNA 1WI0A 4NNJB 1YQ4B 3AH7A 4NQLB 4ZYNA 2QCZA 4US9A 1GJZA 3CSTA 5AUKA 4EOYA 2KACA 2O6VB 3KUDB 3ZRFA 2ZZPB 2VRRB 1VZ7A 2C7NB 1K51A 2K3UA 3PHWB 1K50A 4NJ6A 2RMMA 2KKCA 1Q1OA 1QLBB 4XDDA 1SEBD 1WYWB 5IO9A 4J6IA 2ACZB 1EO6A 3SDLC 3V60A 4BBNF 1JALA 1YJJA 2LVPA 4C00A 1ZUD2 3BY4B 3AEEB 4N58A 4A3PA 2ZVNA 3K9OB 4KKJA 4MDKE 1DOYA 1XEEA 3AXCA 1WXSA 3BYTB 3WCQA 3ZW3A 2LUMA 3IXSA 2BWFA 2E3TA 1E0ZA 2VH1A 4RGOS 3NVYA 2BYEA 1GG3A 1NBFC 2LGXA 2RDHA 3N3KB 4M00A 2L1AA 3RNAC 3NZUA 4DXGA 2XNAC 1WMHA 4P16A 1HEZE 1VJKA 3Q8FA 1N62A 4M02A 3KVFB 2KWDA 1E9MA 3TL5A 1UF0A 2KC2A 3HHMA 1QOFA 2WXRA 3UGBB 4ZRKA 4CO7A 1FMAD 4WURA 1MHHE 2ZCBA 3KQ4A 1WE7A 1TJEA 3ZTCA 3SR6A 3AULA 1MFWA 4KGTA 2WNMA 4WAFA 2L76A 3ZXVA 4MEMA 4HWIB 2YEPF 1TYGB 2K39A 3HVZA 5JZEB 3UQAA 2MW5A 4C7YA 2KX0A 4PT5A 1C77A 2SAKA 3RMKC 3A1QB 5LXHA 1CZPA 3AE4B 2AEHA 3ZLZA 2WXOA 3KWVA 1I4HA 2HDEA 2V9HA 2Y5CA 3WIMA 1V97A 4DHZB 2N4FA 2KLCA 4TSSA 1HZ6A 4MSMB 2A4ZA 3AECB 4IM3A 2GBNA 2X8XX 1B1ZA 2NR2A 2K22A 2IO1B 2KJ6A 1VLBA 2CU3A 1WYGA 1TS3A 4WQMA 2KMAA 3L08A 1V86A 2GBJA 4O1NA 2MHJA 2R2QA 1Z5SB 2KLGA 2BS3B 3OJ3A 2XEWA 3ALBA 4ITKA 1V6EA 4XWWA 3RFZB 2ZPNA 1YMHE 3APFA 3NZSA 4URKA 2MCNB 1OEYJ 2WXLA 3FILB 3SEBA 2IY0B 1AWDA 4N59A 1MI0A 2MP2B 3H9DA 1HZ5A 3RPFC 2MWSB 3UQBA 3PHXB 3APDA 2PJHA 2LHEA 2MJDA 3T8MA 4HEA1 2WDVB 1TY0A 3V05A 4HDQA 3C19A 1C4AA 4JE3B 4DWFA 1FIQA 2LI5A 1YJ1A 2V0GA 1A5RA 5CHWA 1L0YB 3N1ZC 1YN3A 2AYOB 3A9JB 1SSNA 1M94A 4KV2A 2KDIA 1EU4A 1ISNA 1GB1A 2YVCA 1I4GA 2BT6A 2HJ1A 1ZPSA 5CHFA 2IY1B 1JWUD 5BYQA 2WX0A 3QA8A 2NS5A 2LFIA 4KIKB 4IWPA 2O2VB 2D2QA 3RN9C 3HK0A 1I7HA 4RH6A 4KKIA 2EELA 2DNFA 5C1ZA 1E8WA 1L0VB 2DZKA 3MJ5A 3B2GA 2YLMA 2L83A 1ZOYB 3EFUA 2BKRB 2WXPA 1HQRD 1TS5A 4BFRA 5FKAC 5EE0A 3X23A 2MH7A 3TIXA 3Q3JA 2V1YA 2VH2A 1WGRA 4FADA 2RPVA 1TY2A 3WALA 3VQIA 2AQ3B 3OJ4B 4NPNA 1VRAB 2PE6B 3L17A 2J42A 2DYMA 2N9KA 1Q5WB 3A1QA 3C0RB 2WXJA 5HG2A 2QHOA 3DHIC 3QJZA 2D5GA 3P4RB 4RF0A 4AJYB 3KLSX 4KGSA 2LGDA 1R4NB 3U52E 1XO3A 3VFKA 2REXA 4KSLC 1Q0WB 1QOAA 2AL6A 3AU5A 4I6LB 4LNKA 2ONQA 4CHKA 5G55A 1E8YA 3I57A 4DHZE 1FFUA 3Q8EA 1MJDA 3V6EB 4DDGD 2DLBA 1E8XA 1JWBD 4LJPB 4HVBA 4NAWB 5I4DA 3DHHC 2NPTB 4JWSC 4WWPA 2QIEB 2ASQA 2BBCA 4ASWC 2I2YA 4W9FA 2PTLA 1B9RA 3EA6A 4XE0A 4YT0B 4IDIA 3AE9B 3JSVB 2JY6A 1IYFA 2IZVB 3GZNI 4ZHOA 2WP9B 4DHJD 1F77A 1LGRA 3KUCB 1VCBA 2MBHA 2V3NA 4HRSA 3PPAA 2QJLA 4W9JA 3AEGB 2LGSA 3RNEC 3A9JA 4WAAA 1ZE3D 1I4XA 1OTRB 2L7RA 1QZEA 1YN4A 3U2SC 4RFBA 3W9CB 3MC0B 1LXDA 2LJ5A 2KDFB 4IUMB 1ZXIA 4WWMA 3V3XA 1KRHA 3NG0A 4KIKA 4C7ZA 1JQ4A 2O2VA 4OHJA 3VUXA 2OOBB 2WU5B 3QIJA 1GC7A 3SU8X 2WDRB 5LLIA 2MQJA 3R66C 3I63C 2IO0B 2PPHA 2D07B 3Q3NC 3AB5A 3TEYA 3DBRB 1ZDXA 2RGFA 4GXBA 5D3DA 3PSEB 4NJ7A 2CJOA 2D3CA 3Q6BA 1WJ6A 3FC4A 1VZ8A 1KLUD 4A3OA 3R7QA 3MHSD 2CHWA 3GZNB 2DZMA 5G5HA 4NAMA 4S17A 2H88B 2PVGC 1WXVA 2CHXA 1J7BA 3GB1A 1EM7A 4G3XB 4N9F4 4A8XC 4MM3B 1SXTA 5JXVA 2D3GA 2BWES 1JRUA 1TBEA 1P7FA 5KHQA 2JSVX 4BAXA 1JWMD 2BYTA 2G9HD 1SJHD 2LEKA 4IWOA 2E6XA 4UDUC 2N1WA 1WF9A 2CJNA 4KDIC 2KTRA 2MSED 2UU7A 1X1MA 2QILA 4E3CA 3AEDB 2KN4A 3P2BA 2Y5PA 4OZCA 5BYRA 1C78A 2WXGA 4OVVA 1BT0A 1SE2A 4LCDE 4NAWA 1E7VA 2V3SA 4LK0M 4K3CA 2LWPA 5FK9C 2KD0A 1EF5A 1RLFA 4JPSA 2BS4B 2IYDB 4X57B 5CX3A 1V1OA 1RFKA 4AQ7A 3AV8A 4GDLB 3JSVA 1D3ZA 2QMTA 4GLSC 4KDLB 3AE8B 4IG7B 3HIZA 3VH4B 3IT6B 4K7UA 3AMZA 3ZNID 1YX5B 2NTSA 1T0RC 4GGQA 2JYEA 1OQYA 4WIPA 3ZIMA 3PV1A 1QOBA 2I38A 4W9CA 1WJUA 2J53A 4IM2A 3BK1A 5GXGB 3HRDD 3JVZX 1E7PB 4Q2JA 3U7DA 4XWTA 1FCLA 3AEBB 1TT5B 5T8IA 3N1XC 5EE9A 4R3DA 4TV3A 3ZKJC 2C7MB 1XF5L 2KWVB 3CSFA 3E9SA 1WXMA 3PTFC 2J52A 1PFDA 2C7HA 3EC8A 4ZRIA 3UIPB 1C3TA 1Y8RC 1PYWD 2KN5A 1WR1A 5JH5C 3VTVA 2GI9A 4MGYE 4HPLB 2L05A 2NVUI 2L32A 4CYEA 4HJKA 4EUTA 1GOZA 1GNUA 3TCAA 3HUIA 2XN9C 3GS2A 2OHFA 3ZTDA 4DXFA 4E71A 4HPMB 4K7SA 2MRPA 2QEJC 4ZRPA 1E5WA 3VXWA 4F8CB 1WX8A 4MM3A 4XDCA 4CQNA 2BTEA 2L0FA 3LB8C 2RPQA
chains in the Genus database with same CATH topology
3PZ7A 4D2KA 1XLNA 3RFZB 1YMHE 1FFVA 1PUTA 1UNSA 1KH0A 2B76B 2WXLA 3FILB 3SEBA 3T3NA 1AWDA 4N59A 1MI0A 1F0ZA 1JRPA 2AQ1B 2BB6A 5EE3A 1HZ5A 3BK2A 3RPFC 1WXQA 1QKZA 2IDYA 2MJEA 1EWYC 2LHEA 4FXCA 2PW9A 1Y56A 3MFGA 3Q8CA 5BMIA 2MJDA 1C76A 1SF0A 4HEA1 2X38A 2WDVB 4N6EB 1A70A 1TY0A 3ZQ4A 2K9XA 2PKOA 1JWAD 3V05A 3CWIA 1PGXA 3J9CA 3U7ZA 1C4AA 4JE3B 3BYYB 4YTPB 1FXIA 1FIQA 1K52A 2V0GA 4NJCA 3AE5B 4J3OD 1KLGD 3P1MA 4YSXB 2LHDA 1N5WA 4M0WA 1L0YB 5TSSA 1YN3A 1SSNA 5BMGA 4AS1A 1MPEA 2BS2B 2WXHA 4HJGE 3HVDA 1EU4A 3CIRB 2KQ4X 5G5GA 3NUHB 1CJEA 4TQ1A 1QT9A 1GB1A 1N5XA 1ZDVA 1I4GA 2W82A 2BT6A 1TKGA 5LNK1 1ZPSA 3AM9A 3ZGZA 4B0EA 1JWUD 5BYQA 2JXTA 4ZYSA 3L4PA 1PGAA 3TEWA 2LFIA 2K5PA 3PZ8A 1D5XC 1D4BA 3BWUD 1VZ6A 4P6VF 1C4CA 1YQ3B 3GP7A 1NVID 1WRIA 1E6EB 1P7EA 3P4QB 2JQRB 3PO0A 5MPOA 1TS2A 1I7HA 4RH6A 4KKIA 4YTMB 1FD6A 2EELA 1T5XD 2MJ3A 4B0MA 4A9AA 1FEHA 5BYSA 1NYQA 3DWMA 1V1PB 4YXDB 2SEBD 1L0VB 2AX5A 3LXFA 1WSPA 3MJ5A 3B2GA 2L83A 3BVZA 1ZOYB 3W1SA 4RCOA 3BVGA 4L2YA 1L4DB 1QF6A 3AN1A 2WXPA 1HQRD 1TS5A 4KX6B 5FKAC 3W5VB 5EE0A 3NVWA 2MH7A 3ZJTA 2BW2A 3ZJVA 2BB5A 2HTME 3DWGC 2WDQB 2M56B 2PVOD 2RPVA 1TY2A 3OWEB 2GRIA 1F2RC 3VQIA 2AQ3B 3EUB2 1VRAB 3B2FA 2PMVA 2J42A 2Y3AA 3AE2B 2DYMA 3TEZA 2N9KA 1FNVA 5HFYA 1BMLC 5AUIA 3T3OA 2WXJA 2FE8A 3FAHA 5HG2A 1YNTE 2V4IB 1T6BX 1NENB 4MACA 2NTTA 2D5GA 3P4RB 1XLPA 1ZXHA 4RF0A 1BUIC 1DGJA 1FO4A 3MHZA 3KLSX 4KGSA 1EWCA 3W2DA 4A6QA 4JWUC 1RWSA 1AN8A 3U52E 1KTKA 1XO3A 3O13A 3P42A 1QOAA 4DQOC 2ONQA 4OW0A 3KWLA 1JWSD 3I57A 4USAA 1FFUA 3Q8AA 3Q8EA 1FM0D 3AE6B 1E10A 1VR9A 4YTNB 4LLGM 2LJIA 2DLBA 1DYQA 1JWBD 1M4VA 1STEA 4KGRA 1GB4A 4NAWB 5I4DA 3AE7B 1OQRA 5HI1A 4JWSC 3TUOA 2QIEB 5D3IB 2BBCA 4C56C 2I2YA 2PTLA 3BZDB 3EGRA 3VR9B 1B9RA 3EA6A 4XE0A 4YT0B 3B9JA 4IDIA 1ZP0B 2L52A 1FRDA 3AE9B 2JU6X 3IAS1 5C3JB 2ZW0A 3AE3B 1D5ZC 1I4PA 3R2TA 1JCKB 1HA5A 1OQQA 2GB1A 1HXYD 3NVVA 2WXQA 1L5PA 2FBWB 1PDXA 2W3SA 2H89B 1SIJA 2WP9B 4ZHOA 1F77A 3ZJUA 1IGCA 2J4XA 2QSDA 2V3NA 1L4ZB 4HRSA 2IJ0A 4TQ0A 1YN5A 2DWQA 2QJLA 4A55A 3AEGB 3NS1A 1V8CA 2KDMA 4RGNA 1XXGA 1I4QA 2W54A 2MEKA 1QOGA 2OEDA 3W5UB 1ZE3D 1I4XA 3LYYA 3N9YC 3AE1B 1DOIA 4REZA 1NYRA 2WXKA 1SBBB 3R8BA 1TKYA 1K53A 1TKEA 4ZHPA 4YSZB 1YN4A 1SB3C 3U2SC 4RFBA 4L23A 3MC0B 3W9CB 2INPE 2LMCA 5H92C 1TZOA 1R7SA 3Q69A 4RGTA 4RGMA 1ZXIA 2ICIA 4WWMA 3V3XA 1ESFA 1FCCC 2WU2B 1KRHA 2AQ2B 1FXAA 4C7ZA 1JQ4A 3P4PB 4OHJA 2WU5B 1L6VA 3BVMA 1QQRA 4RF1A 5FR3A 5HHDG 2WDRB 4A90A 2IPKD 1RM6C 1F2RI 4WH4A 2EKIA 4EE2A 1ET9A 2WXMA 3VRAB 1J7CA 4HROA 3AB5A 3TEYA 4OVZA 3NRZA 1OFFA 5C2TB 1IBXB 1ZDXA 4H2AA 1V1PA 2M19A 2INNE 1UWMA 5D3DA 1FNUA 2CJOA 1AW7A 2W55A 2RDGA 1QILA 2IGDA 5EE1A 1D6EC 3U4EG 3FC4A 1VZ8A 1KLUD 2Q5WD 4LTUA 4GDKB 3SFDB 5G5HA 1EU3A 4NAMA 1FNWA 1JROA 1SE4A 1CK1A 1KFYB 2H88B 4OZBA 1XCQL 2PVGC 3TEXA 3NZ3A 2WXFA 4IOIE 1J7BA 3GB1A 1XCTL 2VZKD 3IT4B 2WXNA 1EM7A 4OZAA 3ZYYX 3BIID 1PGBA 1YQ4B 3E56A 2WLBA 3AH7A 2PLPA 4A8XC 5D7GA 4MM3B 1SXTA 5JXVA 4YSYB 4US9A 1P7FA 1DOXA 2JSVX 1JWMD 5AUKA 3ABVB 2BYTA 2G9HD 1SJHD 2KACA 2LEKA 2E6XA 4UDUC 1CQVA 1VZ7A 2K3UA 1K51A 2CJNA 1K50A 1T3QA 4HKZE 2RMMA 1C79A 2JX5A 2G1EA 2QILA 3AEDB 2KN4A 1QLBB 3ETRA 4NZLB 1SE3A 2Y5PA 4XDDA 1SEBD 1J7AA 2ACZB 4OZCA 4ZOHC 1D5MC 1JW9D 2N9LA 5BYRA 1I4RA 1C78A 1JALA 1YJJA 2WXGA 3FILA 2N7JA 2WS3B 1ZUD2 2R61A 1SE2A 1LO5D 3C8YA 3AEEB 4N58A 1NI3A 4LK0M 4L1BA 2Z8LA 1ET6A 1SJED 4US8A 1TS4A 5FK9C 4KKJA 1DOYA 1WGKA 1XEEA 2IGHA 2JWUA 3H8HA 1IGDA 3BYTB 4JPSA 2BS4B 4YWGG 3WCQA 1C9FA 1AYFA 2LUMA 3IXSA 2E3TA 1E0ZA 1V1OA 1N60A 1RFKA 4RGOS 2ZW1A 3NVYA 4AQ7A 3AV8A 4GDLB 4RNAA 2QMTA 4GLSC 3AE8B 2RDHA 2L1AA 2YEPB 4DXGA 5E6JA 3IT6B 2XNAC 2ON8A 3AMZA 4HKQA 4P16A 1HEZE 2N0SB 5BMHA 1VJKA 3Q8FA 1N62A 2NTSA 2JYEA 4MH8A 4WIPA 3MP9A 1UWXA 4IKGA 2FUG1 2KWDA 1E9MA 4JX1C 5H8YE 1QOBA 2I38A 3I9V1 1KF6B 2J53A 1QOFA 2M0AA 2VZKB 3P4SB 2WXRA 1MVKA 3SFEB 3BK1A 5GXGB 3VRBB 3HRDD 1FMAD 4WURA 1MHHE 1N61A 1ENFA 1JMLA 1E7PB 4Q2JA 2NMQA 3KQ4A 3Q8BA 4XWTA 1FCLA 1TJEA 3AEBB 3VR8B 3SR6A 5T8IA 4KGTA 1BXTA 5EE9A 3P63A 4R3DA 1XF5L 3E9SA 2WNMA 4WAFA 3NVZA 1L0XB 1Q10A 2J52A 1PFDA 2YEPF 2V3PA 1ACCA 1TYGB 3HVZA 3AEFB 1PYWD 1ROEA 2JZPA 4C7YA 4ARIA 4PT5A 1C77A 3UI3A 2SAKA 2W3RA 2TSSA 4ARCA 2GI9A 1CZPA 1GAQB 1N63A 3AE4B 1RYJA 2WXOA 1IBXA 1NEKB 2KAJA 3KWVA 2DYOA 1FRRA 1I4HA 2HDEA 2L32A 2IGGA 4ZRQA 1GOZA 2Y5CA 2JYTA 4TMAB 2WQYB 1UUPA 1VDVA 1V97A 2WXIA 3HUIA 1XLQA 3R2IA 4TSSA 1HZ6A 3TSSA 1IUEA 2XN9C 3GS2A 2OHFA 1C4PA 3AECB 2K0PA 1UGJA 4DXFA 2LGIA 3IAM1 1B1ZA 4MT5A 1GPXA 1WWTA 2QEJC 2K22A 4ZRPA 1VLBA 2CU3A 1WYGA 2DBYA 1TS3A 1XLOA 4WQMA 4C80A 1YJIA 2KMMA 3AEAB 4XDCA 4CQNA 4O1NA 2BTEA 1L6UA 1MHXA 2BS3B 2PIAA 4ITKA 3LB8C 3URYA 4XWWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AE8 B;  1XLN A;  2WU5 B;  1L6V A;  1FFV A;  5AUI A;  3FAH A;  1PUT A;  2B76 B;  2WDR B;  1RM6 C;  1AWD A;  4N59 A;  3AMZ A;  2EKI A;  2N0S B;  1JRP A;  1NEN B;  1VJK A;  5EE3 A;  1F0Z A;  1N62 A;  3P4R B;  1XLP A;  3RPF C;  1FO4 A;  1DGJ A;  1WXQ A;  1J7C A;  4HRO A;  3VRA B;  3AB5 A;  2MJE A;  1EWY C;  3NRZ A;  1E9M A;  1OFF A;  4JX1 C;  5H8Y E;  1QOB A;  4FXC A;  5C2T B;  4JWU C;  1RWS A;  2MJD A;  1KF6 B;  1SF0 A;  2M19 A;  1QOF A;  2WDV B;  1UWM A;  1XO3 A;  4N6E B;  1A70 A;  3P4S B;  2K9X A;  2PKO A;  2CJO A;  1JWA D;  2W55 A;  3SFE B;  1QOA A;  3CWI A;  3VRB B;  5GXG B;  4YTP B;  3HRD D;  5EE1 A;  1FXI A;  3FC4 A;  1FIQ A;  2Q5W D;  3KWL A;  4LTU A;  1FMA D;  4USA A;  1FFU A;  3SFD B;  1N61 A;  1FM0 D;  3AE5 B;  1E7P B;  5G5H A;  3AE6 B;  3P1M A;  4YSX B;  1N5W A;  1E10 A;  1JRO A;  1KFY B;  2H88 B;  4YTN B;  1TJE A;  3AEB B;  2BS2 B;  2PVG C;  1JWB D;  3VR8 B;  3SR6 A;  3CIR B;  5EE9 A;  3AE7 B;  1OQR A;  3P63 A;  1J7B A;  5G5G A;  4JWS C;  1CJE A;  2QIE B;  1QT9 A;  1N5X A;  3NVZ A;  1JQ4 A;  3ZYY X;  3BII D;  1YQ4 B;  2BT6 A;  1TKG A;  2WLB A;  3AH7 A;  1PFD A;  3VR9 B;  1B9R A;  3AM9 A;  4YSY B;  4YT0 B;  3B9J A;  4US9 A;  4IDI A;  1ZP0 B;  2L52 A;  1FRD A;  1TYG B;  3AE9 B;  3HVZ A;  3L4P A;  5C3J B;  3AEF B;  1DOX A;  3AE3 B;  1ROE A;  2K5P A;  4C7Y A;  5AUK A;  3ABV B;  1OQQ A;  2W3R A;  2LEK A;  4P6V F;  3NVV A;  1YQ3 B;  1CZP A;  1GAQ B;  1L5P A;  1N63 A;  1RYJ A;  2CJN A;  2FBW B;  3AE4 B;  1NVI D;  1NEK B;  1WRI A;  1PDX A;  2KAJ A;  1E6E B;  2W3S A;  1T3Q A;  1SIJ A;  2H89 B;  2WP9 B;  4ZHO A;  3P4Q B;  1FRR A;  2JX5 A;  2JQR B;  3PO0 A;  5MPO A;  2G1E A;  1I7H A;  3AED B;  4YTM B;  1QLB B;  2Y5C A;  3ETR A;  4HRS A;  2DWQ A;  2MJ3 A;  2QJL A;  2WQY B;  4A9A A;  1J7A A;  2ACZ B;  1NYQ A;  3AEG B;  3NS1 A;  1V8C A;  1JW9 D;  3DWM A;  1VDV A;  1V97 A;  4ZOH C;  4YXD B;  1L0V B;  1XLQ A;  2AX5 A;  2W54 A;  3HUI A;  3LXF A;  1JAL A;  1YJJ A;  1QOG A;  1IUE A;  3B2G A;  2OHF A;  2WS3 B;  3W5U B;  1ZUD 2;  2L83 A;  3AEC B;  1ZOY B;  1QF6 A;  3AE1 B;  3AEE B;  3AN1 A;  1DOI A;  4N58 A;  1NI3 A;  1NYR A;  4KX6 B;  1TKY A;  4US8 A;  3W5V B;  1GPX A;  1TKE A;  1WWT A;  4ZHP A;  5EE0 A;  2K22 A;  4YSZ B;  3NVW A;  1VLB A;  1SB3 C;  1WGK A;  2CU3 A;  2MH7 A;  1DOY A;  2HTM E;  3W9C B;  3DWG C;  1WYG A;  2DBY A;  2M56 B;  2BS4 B;  2WDQ B;  1XLO A;  4WQM A;  5H92 C;  3WCQ A;  4C80 A;  1AYF A;  1R7S A;  1YJI A;  2PVO D;  2KMM A;  3AEA B;  3LB8 C;  1L6U A;  1ZXI A;  2E3T A;  1E0Z A;  4WWM A;  1N60 A;  1RFK A;  2BS3 B;  2PIA A;  3NVY A;  3EUB 2;  2WU2 B;  3AV8 A;  1KRH A;  3B2F A;  4ITK A;  4C7Z A;  1FXA A;  3AE2 B;  3P4P B; 
#chains in the Genus database with same CATH topology
 2INC C;  1FFV A;  1UNS A;  1KH0 A;  3T3N A;  1J0G A;  1F0Z A;  3VUW A;  4B95 A;  2BB6 A;  3BK2 A;  4LJO B;  5BMI A;  1Y56 A;  4FBJ B;  1SF0 A;  3AI5 A;  3RZW C;  5C23 A;  2X38 A;  3AU4 A;  1A70 A;  4JL9 A;  1JWA D;  3CWI A;  3J9C A;  3U7Z A;  1ZKH A;  1FXI A;  5AZG A;  5CHV C;  2KHW B;  2ZNV C;  4J3O D;  3P1M A;  4AS1 A;  5BMG A;  3RUL A;  2WXH A;  3CIR B;  3NUH B;  1N5X A;  1YD8 U;  2W82 A;  1J19 A;  5DPT A;  5LNK 1;  4K3B A;  4GDL A;  2BF8 B;  2ZVO A;  1L7Y A;  2JXT A;  4ZYS A;  3L4P A;  3PZ8 A;  1D5X C;  4WJN A;  1VZ6 A;  3R3M A;  1NVI D;  2KWC A;  1P7E A;  4ANW A;  2KYW A;  3DBH I;  5MPO A;  1TS2 A;  1RRB A;  4XC2 A;  3PRM B;  5E6O A;  4B0M A;  4EFO A;  1FEH A;  4P7I A;  2N9E B;  5BYS A;  3KW5 B;  2J0M A;  3LXF A;  1WSP A;  2CU1 A;  4W9D A;  2RD0 A;  5D94 A;  3BVG A;  4L2Y A;  5DPR A;  3AN1 A;  4GSW A;  4HLE A;  4LNO A;  3NVW A;  5IOI A;  2Y5B B;  2I1K A;  2PVO D;  1F2R C;  1I35 A;  2DYB A;  3EUB 2;  1HE8 A;  5J17 A;  4MGZ E;  2MLB A;  3AE2 B;  4IW0 A;  4M01 A;  5HFY A;  5AUI A;  1OEY A;  2FE8 A;  3FAH A;  3PGE A;  1YNT E;  4DXA B;  2V4I B;  3RZF A;  1FO4 A;  1NDD A;  2BKF A;  1EWC A;  4JWU C;  1SGH A;  1HTQ A;  4DQO C;  3PRP B;  3KWL A;  4LDT D;  2KX3 A;  1FM0 D;  4G0N B;  2O6V A;  3AE6 B;  4W9H A;  4YTN B;  2LJI A;  4RM8 A;  2C60 A;  1OQR A;  3TUO A;  5D3I B;  4S0R A;  2ZEQ A;  4C56 C;  5KHO A;  1WX9 A;  3BZD B;  3VR9 B;  3IFW B;  1T0S C;  3B9J A;  1ZP0 B;  4FUL A;  2AWT A;  2JU6 X;  2N7D A;  4BKS D;  3IAS 1;  5C3J B;  1WM3 A;  2ZW0 A;  1MG8 A;  2JPH A;  4C4V B;  1OQQ A;  2GB1 A;  2WXQ A;  2FBW B;  3H6N A;  1PDX A;  2H89 B;  1SIJ A;  2IBI B;  3DPD A;  4ZRJ A;  2QSD A;  4FJV B;  2IJ0 A;  2KDM A;  3DBS A;  1LFD A;  3W5U B;  5FR6 A;  3AE1 B;  1H8C A;  2B3A A;  4PS7 A;  3R8B A;  4YSZ B;  1WJ4 A;  3NOB A;  2LMC A;  3MTN B;  5H92 C;  1V81 A;  1TZO A;  1R7S A;  3Q69 A;  1HTO A;  4EZL A;  2KXJ A;  1UH6 A;  2DEN B;  1FCC C;  2G4D B;  3Q2A C;  1V2Y A;  1L6V A;  4MGI E;  4RF1 A;  4A90 A;  4DDI D;  2CS4 A;  4WH4 A;  5D6J B;  3RUI B;  2EKI A;  5IAA C;  1ET9 A;  1V49 A;  4OVZ A;  1OFF A;  2RR9 A;  2INN E;  1UWM A;  3RD2 A;  1AW7 A;  2BYF A;  5E6N A;  2RDG A;  4K81 A;  3ZDT A;  5JHA A;  5EE1 A;  1P1A A;  1D6E C;  3U4E G;  2Q5W D;  5DPS A;  4GDK B;  4GB9 A;  3IVF A;  4DBG A;  1JRO A;  1CK1 A;  4OZB A;  2KK8 A;  3TEX A;  5J2R A;  2CR5 A;  2VZK D;  1UEL A;  3BII D;  3HM6 X;  4DHJ B;  2MBQ A;  2PLP A;  4YSY B;  5L95 C;  4BZA A;  3N20 C;  3DHG C;  2KMC A;  4IWQ A;  1T3Q A;  4HKZ E;  1L2N A;  4WJO A;  1C79 A;  3RT3 B;  2JX5 A;  2G1E A;  3ETR A;  1SE3 A;  2HTH A;  1J7A A;  3KUZ A;  4MH0 E;  1JW9 D;  2N9L A;  2JZZ A;  1I4R A;  2XBB C;  3K9P B;  3FIL A;  2WS3 B;  5G2N A;  1LO5 D;  3H7P B;  4HCN B;  3UIO B;  3RNB C;  2MP2 A;  2KQ7 A;  1NI3 A;  2DX5 B;  4L1B A;  1ET6 A;  4M0W B;  1TS4 A;  2KFK B;  2GBK A;  1GUA B;  1WGK A;  3O65 B;  3OG5 A;  1TZ1 A;  1IGD A;  4YWG G;  2MX2 A;  1AYF A;  3WAP A;  4HCP B;  1N60 A;  2ZW1 A;  2CKH B;  2FUH B;  4W9G A;  2ZCC A;  4C4V A;  3V62 A;  2YEP B;  1WH3 A;  4WQO B;  3A33 B;  5E6J A;  4FJY A;  1R4M I;  1TGZ B;  2PE9 A;  3H7S A;  3M3J A;  1UWX A;  4JX1 C;  2LUE A;  4NQK E;  3I9V 1;  1KF6 B;  2M0A A;  3P4S B;  4XZ4 A;  1MVK A;  4GN1 A;  3D32 A;  3SFE B;  2OJR A;  1WM2 A;  4BBN C;  3PLU A;  1ENF A;  1JML A;  2NMQ A;  2J0J A;  1WGY A;  2LAS A;  2EKE C;  3VAW A;  1H4R A;  1E90 A;  1L0X B;  3A4S C;  2V3P A;  1ACC A;  2Z59 B;  4BVU C;  2FCM A;  4ZDV A;  3AEF B;  4ARI A;  3UI3 A;  3DOW A;  2W3R A;  2TSS A;  4ARC A;  5LXI B;  3PVL A;  3ECI A;  4EKU A;  2D11 A;  2QC8 A;  4M8M A;  2KDB A;  2UYZ B;  4BOS C;  1FRR A;  2IGG A;  2JF5 A;  2JYT A;  2WQY B;  2K8C A;  1VDV A;  1R4M B;  1XLQ A;  4WJP A;  2K0P A;  1UGJ A;  2K1F A;  3CMM B;  2LGI A;  3IAM 1;  1VD2 A;  1WWT A;  4HK2 A;  2JRH A;  4F1S A;  3A9K B;  1KJT A;  1XLO A;  4JIO U;  4AWJ A;  3AEA B;  1P3Q U;  3DVN U;  1MHX A;  1F1H A;  3M62 B;  1T0Q C;  3H1U A;  3URY A;  3SHQ A;  3B08 A;  1WXA A;  4D2K A;  1XLN A;  1PUT A;  2B76 B;  3V61 A;  2NPT A;  1JRP A;  2LVQ A;  3RNF C;  4PK1 A;  2LXC A;  1WXQ A;  2IDY A;  3MFG A;  3Q8C A;  1WJN A;  4N6E B;  2C9W B;  2K9X A;  3PZD A;  1NI2 A;  3BYY B;  3DVG X;  3PT2 B;  3H7P A;  3AE5 B;  1KLG D;  4M0W A;  5TSS A;  2KFK A;  4QAY A;  2GLS A;  2BPS A;  2J0K A;  1MPE A;  3DVG Y;  3OLM D;  2KQ4 X;  1WMH B;  5G5G A;  4FN2 A;  4TQ1 A;  1QT9 A;  2DZI A;  3WAM A;  4W9L A;  4IM0 A;  1TKG A;  2WGS A;  2WDT B;  2D10 A;  4W9K A;  3T9L A;  3ZGZ A;  4B0E A;  4W9E A;  4EZJ A;  1PGA A;  2KQS A;  5IP4 D;  1D4B A;  2DAJ A;  1SIF A;  1C4C A;  1LQB A;  1YQ3 B;  1AAR A;  1WRI A;  3ZNZ B;  2L00 B;  3PO0 A;  5L83 A;  1FD6 A;  4AOF A;  4A9A A;  3DWM A;  3Q3O C;  4GIV A;  2Z0D B;  3BVZ A;  3N30 A;  4RCO A;  3L0W B;  2V4L A;  4RMA A;  4G11 A;  1WIA A;  3IHP C;  3RYT A;  1WGD A;  1TIF A;  3RNG C;  3ZJT A;  2BW2 A;  4FHK A;  3ZJV A;  1WZ3 A;  2HTM E;  3DWG C;  5HKH A;  3OWE B;  5CTR C;  3B2F A;  2PMV A;  2Y3A A;  3TEZ A;  1BML C;  3T3O A;  2JRI B;  1E8Z A;  4MAC A;  2NTT A;  3L13 A;  1ZXH A;  1UD7 A;  3W2D A;  1RWS A;  2AL3 A;  1KTK A;  3O13 A;  4JGH B;  4GOC A;  2KO3 A;  1JWS D;  3VTU A;  3Q8A A;  3MC8 A;  4XX5 A;  2D3A A;  1VR9 A;  4LLG M;  3I5J C;  3TMP B;  2I1J A;  1DYQ A;  1M4V A;  1STE A;  4KGR A;  3A9K A;  3PLV A;  4PS3 A;  1UGM A;  3AE7 B;  4K7W A;  2G45 B;  2KZR A;  3ZVV A;  1GC6 A;  3R7R A;  4F7Z A;  3L10 B;  2LRW A;  3ZRC A;  4MSQ B;  4LNF A;  1V5O A;  2ZJD A;  1FRD A;  1YOV B;  1XQQ A;  4WWO A;  3VDZ A;  1D5Z C;  1I4P A;  3FKY A;  1HA5 A;  3VUY A;  2L3Z A;  3GE8 C;  1HXY D;  3NVV A;  4ACF A;  1L5P A;  2N9X A;  1WE6 A;  2W3S A;  1IPG A;  1V9J A;  2OJW A;  4LNI A;  1CMX B;  2FCS A;  1YX6 B;  2KVZ A;  3WA0 A;  2A5U A;  3A4R A;  1YN5 A;  2DWQ A;  4A55 A;  3APC A;  3NS1 A;  1V8C A;  1YIW A;  1XXG A;  3I3T B;  2LD9 A;  2OED A;  2O6V D;  1C1Y B;  3LYY A;  3N9Y C;  4ANV A;  4REZ A;  1SBB B;  2FNJ B;  2K25 A;  1TKY A;  2Z0E B;  1SB3 C;  4L23 A;  1MG4 A;  3Q14 C;  3RCZ A;  4RGT A;  2ICI A;  2KNB A;  2WU2 B;  3P4P B;  3BIN A;  4M8N A;  2J7Q B;  3L54 A;  1QQR A;  2LXA A;  1RM6 C;  4LDT B;  2GOW A;  4EE2 A;  2FIF A;  2WXM A;  3CF6 E;  3DDC B;  3KYD D;  3QWZ B;  3DBL I;  5AZF A;  3NRZ A;  3LDZ E;  1IBX B;  2MBB B;  2M19 A;  2RDB C;  3W1Y A;  2D3B A;  2KWU B;  2LRU A;  1FNU A;  2W55 A;  1QIL A;  2N9P C;  2N1V A;  3SFD B;  2XK5 B;  1XCQ L;  1RFA A;  1J8C A;  3NZ3 A;  2WXF A;  4IOI E;  1XCT L;  4OZA A;  5D2M B;  3ZYY X;  1PGB A;  3E56 A;  2WLB A;  4BKT A;  2MA9 B;  1WGH A;  1KOT A;  5D7G A;  1F52 A;  4ANU A;  4JQW C;  2QDF A;  2IO3 B;  3QK0 A;  1DOX A;  3ABV B;  3DBH B;  2CHZ A;  1CQV A;  2KJH B;  2K8B A;  1UZX B;  3M95 A;  3WAO A;  1P98 A;  3QHT A;  1YQB A;  2NBW B;  3KH0 A;  4B9K A;  4NZL B;  2G3Q B;  4ZOH C;  1D5M C;  3PS6 A;  2N7J A;  2JXX A;  2LZ6 A;  2R61 A;  3TJP A;  3C8Y A;  4II3 B;  3DBL B;  3TBL D;  2FID A;  2WX1 A;  2Z8L A;  1SJE D;  2KDE B;  4PYU A;  4US8 A;  2NBV B;  2GMI C;  2IGH A;  2JWU A;  2M1M A;  3H8H A;  2HE7 A;  1C9F A;  3N32 A;  3B1L X;  2DHZ A;  4EZK A;  5AZH A;  4RNA A;  4P1C C;  2JZ3 B;  2JVC A;  2ON8 A;  3ZDM C;  4HKQ A;  2N0S B;  4FA6 A;  5BMH A;  2M17 A;  2BGF A;  4MH8 A;  1UBQ A;  4AUQ C;  2M8S A;  3MP9 A;  4IKG A;  2FUG 1;  5H8Y E;  3ZUN A;  4BKG A;  3QQ8 B;  2VZK B;  1WZ0 A;  1G6J A;  3IBE A;  2C5L C;  5BO4 B;  4B6W A;  1R4N I;  1XD3 B;  3VRB B;  2KTF A;  1N61 A;  3Q8B A;  3VR8 B;  1BXT A;  3P63 A;  4TKN A;  2IO2 B;  5EDS A;  2EMT A;  3NVZ A;  4XGA B;  1Q10 A;  3EFC A;  4KVG B;  2UWQ A;  3U8Z A;  1ROE A;  2JZP A;  4FJZ A;  5GMV A;  2K6D B;  3DQV A;  1S1Q B;  3V6C B;  1GAQ B;  1N63 A;  1RYJ A;  4MJS B;  1IBX A;  1NEK B;  2KAJ A;  2L8J A;  3NJT A;  2DYO A;  3S2A A;  3ONS A;  1OGW A;  1T0Y A;  4ZRQ A;  2KFJ A;  1KM7 A;  2DZJ A;  4TMA B;  1UUP A;  5IA7 A;  2WXI A;  3R2I A;  2XK5 A;  3TSS A;  1IUE A;  4BKS A;  4IC7 B;  1C4P A;  4E74 A;  3RNC C;  2GBM A;  2RSU A;  4KSK C;  2M4N A;  4KZC A;  4MT5 A;  1GPX A;  5DPW A;  4DK5 A;  3QAR A;  1EF1 A;  3ZNH B;  2FCQ A;  2JUO A;  3LJ3 A;  2DBY A;  2KTR B;  4C80 A;  1YJI A;  2KMM A;  1FPY A;  1L6U A;  1I42 A;  2MBE A;  3VVW B;  4HPP A;  1WGG A;  2PIA A;  2HJ8 A;  3NY5 A;  3PZ7 A;  2AQ1 B;  5EE3 A;  1QKZ A;  1ZGU B;  2MJE A;  4GMV A;  1EWY C;  3WAN A;  5IKC M;  4FXC A;  2PW9 A;  1C76 A;  1U4A A;  3L16 A;  4LNN A;  4P1B C;  3DVN V;  3ZQ4 A;  5IN7 A;  2PKO A;  4FHJ A;  4II2 B;  3DBR I;  1PGX A;  4YTP B;  3DCG A;  1K52 A;  1V80 A;  4HXD A;  3W1S C;  5TR5 A;  4NJC A;  4YSX B;  2LHD A;  3PRZ A;  1N5W A;  3IG3 A;  3ZXR A;  1WRD B;  2BS2 B;  2IND C;  3NS8 A;  4HJG E;  3HVD A;  3B0A A;  1RAX A;  1CJE A;  1N6Z A;  1ZDV A;  3RI7 C;  2NBU A;  3AM9 A;  2JWZ A;  4NY0 A;  3TEW A;  4I6N B;  2K5P A;  2MBO A;  3VTW A;  2ZPY A;  3BWU D;  2WYQ A;  3GE3 C;  3ML8 A;  4P6V F;  3GP7 A;  3Q3F A;  2KJR A;  1E6E B;  2WWZ A;  4G50 A;  3P4Q B;  2JQR B;  1UBI A;  3PRE A;  4XYC A;  4YTM B;  4PYZ A;  1T5X D;  2MJ3 A;  1NYQ A;  1EUV B;  1V1P B;  4YXD B;  2SEB D;  3QC8 B;  4HDO A;  4JLC A;  2AX5 A;  4WWN A;  4PS8 A;  3W1S A;  2NCN A;  1K8R B;  1L4D B;  1QF6 A;  1WR6 E;  4A20 A;  4KX6 B;  3W5V B;  1IP9 A;  2BB5 A;  4MGK E;  4EEW A;  2WDQ B;  2M56 B;  2BVC A;  2N7E A;  3UF8 A;  3QAQ A;  2GRI A;  2L0T A;  2KT7 A;  4GDK A;  2M0X A;  3MC9 A;  4AP4 C;  1FNV A;  1KLV A;  4MJS A;  4TUU A;  1T6B X;  1NEN B;  3KYC D;  2K8H A;  1ZW7 A;  1WY8 A;  3EEC A;  1XLP A;  1BUI C;  1DGJ A;  3MHZ A;  4A6Q A;  2FCN A;  1FXT B;  1AN8 A;  1TTN A;  4RM9 A;  4ICU A;  3P42 A;  4OW0 A;  4USA A;  1XT9 B;  3OAW A;  1E10 A;  2LGY A;  1GB4 A;  5HI1 A;  3JW0 X;  5J18 A;  1SE9 A;  2WHI A;  3EGR A;  4ICV A;  1V5T A;  2BYV E;  2L52 A;  1Z2M A;  3SD5 A;  3AE3 B;  4AJW A;  3R2T A;  1JCK B;  2KC1 A;  5E6P A;  2G4S A;  3QX1 A;  5JHB A;  3ZJU A;  2PEA A;  1IGC A;  2J4X A;  3UIN B;  3VHT C;  1L4Z B;  3NHE B;  4TQ0 A;  4YL8 A;  1WFY A;  4RGN A;  1I4Q A;  2W54 A;  2MEK A;  1QOG A;  1WX7 A;  1DOI A;  2W9N A;  1NYR A;  2WXK A;  1PQS A;  3ENE A;  4BOZ B;  4ANX A;  1K53 A;  1TKE A;  4ZHP A;  3ML9 A;  3EHV A;  4WJQ A;  2INP E;  3JYU A;  4FLH A;  3HM3 A;  3ZNG C;  4RGM A;  4W9I A;  1E7U A;  5AEK B;  1ESF A;  2AQ2 B;  1FXA A;  3M63 B;  2FAZ A;  2KAN A;  3BVM A;  5FR3 A;  5HHD G;  3GOE A;  4OVU A;  2IPK D;  1LM8 B;  1F2R I;  1P0R A;  2ZNV B;  4K1R B;  3N1Y C;  1P9D U;  5DCN A;  4I6P A;  2GBR A;  2KOX A;  1J7C A;  4HRO A;  3VRA B;  5C2T B;  3QCA A;  4H2A A;  1V1P A;  3Q3M C;  2DAF A;  2R2O A;  4MEL A;  3VH3 B;  2IGD A;  2EMS A;  3X0W A;  2JT4 B;  4LTU A;  1S3S G;  2K6Q A;  2LVO A;  1EU3 A;  2HD5 B;  4GU2 A;  3ZO5 B;  2KVR A;  1FNW A;  1SE4 A;  1KFY B;  3U30 A;  3MJW A;  2BQQ A;  1F9J A;  4KZ0 A;  3IT4 B;  2WXN A;  1WI0 A;  4NNJ B;  1YQ4 B;  3AH7 A;  4NQL B;  4ZYN A;  2QCZ A;  4US9 A;  1GJZ A;  3CST A;  5AUK A;  4EOY A;  2KAC A;  2O6V B;  3KUD B;  3ZRF A;  2ZZP B;  2VRR B;  1VZ7 A;  2C7N B;  1K51 A;  2K3U A;  3PHW B;  1K50 A;  4NJ6 A;  2RMM A;  2KKC A;  1Q1O A;  1QLB B;  4XDD A;  1SEB D;  1WYW B;  5IO9 A;  4J6I A;  2ACZ B;  1EO6 A;  3SDL C;  3V60 A;  4BBN F;  1JAL A;  1YJJ A;  2LVP A;  4C00 A;  1ZUD 2;  3BY4 B;  3AEE B;  4N58 A;  4A3P A;  2ZVN A;  3K9O B;  4KKJ A;  4MDK E;  1DOY A;  1XEE A;  3AXC A;  1WXS A;  3BYT B;  3WCQ A;  3ZW3 A;  2LUM A;  3IXS A;  2BWF A;  2E3T A;  1E0Z A;  2VH1 A;  4RGO S;  3NVY A;  2BYE A;  1GG3 A;  1NBF C;  2LGX A;  2RDH A;  3N3K B;  4M00 A;  2L1A A;  3RNA C;  3NZU A;  4DXG A;  2XNA C;  1WMH A;  4P16 A;  1HEZ E;  1VJK A;  3Q8F A;  1N62 A;  4M02 A;  3KVF B;  2KWD A;  1E9M A;  3TL5 A;  1UF0 A;  2KC2 A;  3HHM A;  1QOF A;  2WXR A;  3UGB B;  4ZRK A;  4CO7 A;  1FMA D;  4WUR A;  1MHH E;  2ZCB A;  3KQ4 A;  1WE7 A;  1TJE A;  3ZTC A;  3SR6 A;  3AUL A;  1MFW A;  4KGT A;  2WNM A;  4WAF A;  2L76 A;  3ZXV A;  4MEM A;  4HWI B;  2YEP F;  1TYG B;  2K39 A;  3HVZ A;  5JZE B;  3UQA A;  2MW5 A;  4C7Y A;  2KX0 A;  4PT5 A;  1C77 A;  2SAK A;  3RMK C;  3A1Q B;  5LXH A;  1CZP A;  3AE4 B;  2AEH A;  3ZLZ A;  2WXO A;  3KWV A;  1I4H A;  2HDE A;  2V9H A;  2Y5C A;  3WIM A;  1V97 A;  4DHZ B;  2N4F A;  2KLC A;  4TSS A;  1HZ6 A;  4MSM B;  2A4Z A;  3AEC B;  4IM3 A;  2GBN A;  2X8X X;  1B1Z A;  2NR2 A;  2K22 A;  2IO1 B;  2KJ6 A;  1VLB A;  2CU3 A;  1WYG A;  1TS3 A;  4WQM A;  2KMA A;  3L08 A;  1V86 A;  2GBJ A;  4O1N A;  2MHJ A;  2R2Q A;  1Z5S B;  2KLG A;  2BS3 B;  3OJ3 A;  2XEW A;  3ALB A;  4ITK A;  1V6E A;  4XWW A;  3RFZ B;  2ZPN A;  1YMH E;  3APF A;  3NZS A;  4URK A;  2MCN B;  1OEY J;  2WXL A;  3FIL B;  3SEB A;  2IY0 B;  1AWD A;  4N59 A;  1MI0 A;  2MP2 B;  3H9D A;  1HZ5 A;  3RPF C;  2MWS B;  3UQB A;  3PHX B;  3APD A;  2PJH A;  2LHE A;  2MJD A;  3T8M A;  4HEA 1;  2WDV B;  1TY0 A;  3V05 A;  4HDQ A;  3C19 A;  1C4A A;  4JE3 B;  4DWF A;  1FIQ A;  2LI5 A;  1YJ1 A;  2V0G A;  1A5R A;  5CHW A;  1L0Y B;  3N1Z C;  1YN3 A;  2AYO B;  3A9J B;  1SSN A;  1M94 A;  4KV2 A;  2KDI A;  1EU4 A;  1ISN A;  1GB1 A;  2YVC A;  1I4G A;  2BT6 A;  2HJ1 A;  1ZPS A;  5CHF A;  2IY1 B;  1JWU D;  5BYQ A;  2WX0 A;  3QA8 A;  2NS5 A;  2LFI A;  4KIK B;  4IWP A;  2O2V B;  2D2Q A;  3RN9 C;  3HK0 A;  1I7H A;  4RH6 A;  4KKI A;  2EEL A;  2DNF A;  5C1Z A;  1E8W A;  1L0V B;  2DZK A;  3MJ5 A;  3B2G A;  2YLM A;  2L83 A;  1ZOY B;  3EFU A;  2BKR B;  2WXP A;  1HQR D;  1TS5 A;  4BFR A;  5FKA C;  5EE0 A;  3X23 A;  2MH7 A;  3TIX A;  3Q3J A;  2V1Y A;  2VH2 A;  1WGR A;  4FAD A;  2RPV A;  1TY2 A;  3WAL A;  3VQI A;  2AQ3 B;  3OJ4 B;  4NPN A;  1VRA B;  2PE6 B;  3L17 A;  2J42 A;  2DYM A;  2N9K A;  1Q5W B;  3A1Q A;  3C0R B;  2WXJ A;  5HG2 A;  2QHO A;  3DHI C;  3QJZ A;  2D5G A;  3P4R B;  4RF0 A;  4AJY B;  3KLS X;  4KGS A;  2LGD A;  1R4N B;  3U52 E;  1XO3 A;  3VFK A;  2REX A;  4KSL C;  1Q0W B;  1QOA A;  2AL6 A;  3AU5 A;  4I6L B;  4LNK A;  2ONQ A;  4CHK A;  5G55 A;  1E8Y A;  3I57 A;  4DHZ E;  1FFU A;  3Q8E A;  1MJD A;  3V6E B;  4DDG D;  2DLB A;  1E8X A;  1JWB D;  4LJP B;  4HVB A;  4NAW B;  5I4D A;  3DHH C;  2NPT B;  4JWS C;  4WWP A;  2QIE B;  2ASQ A;  2BBC A;  4ASW C;  2I2Y A;  4W9F A;  2PTL A;  1B9R A;  3EA6 A;  4XE0 A;  4YT0 B;  4IDI A;  3AE9 B;  3JSV B;  2JY6 A;  1IYF A;  2IZV B;  3GZN I;  4ZHO A;  2WP9 B;  4DHJ D;  1F77 A;  1LGR A;  3KUC B;  1VCB A;  2MBH A;  2V3N A;  4HRS A;  3PPA A;  2QJL A;  4W9J A;  3AEG B;  2LGS A;  3RNE C;  3A9J A;  4WAA A;  1ZE3 D;  1I4X A;  1OTR B;  2L7R A;  1QZE A;  1YN4 A;  3U2S C;  4RFB A;  3W9C B;  3MC0 B;  1LXD A;  2LJ5 A;  2KDF B;  4IUM B;  1ZXI A;  4WWM A;  3V3X A;  1KRH A;  3NG0 A;  4KIK A;  4C7Z A;  1JQ4 A;  2O2V A;  4OHJ A;  3VUX A;  2OOB B;  2WU5 B;  3QIJ A;  1GC7 A;  3SU8 X;  2WDR B;  5LLI A;  2MQJ A;  3R66 C;  3I63 C;  2IO0 B;  2PPH A;  2D07 B;  3Q3N C;  3AB5 A;  3TEY A;  3DBR B;  1ZDX A;  2RGF A;  4GXB A;  5D3D A;  3PSE B;  4NJ7 A;  2CJO A;  2D3C A;  3Q6B A;  1WJ6 A;  3FC4 A;  1VZ8 A;  1KLU D;  4A3O A;  3R7Q A;  3MHS D;  2CHW A;  3GZN B;  2DZM A;  5G5H A;  4NAM A;  4S17 A;  2H88 B;  2PVG C;  1WXV A;  2CHX A;  1J7B A;  3GB1 A;  1EM7 A;  4G3X B;  4N9F 4;  4A8X C;  4MM3 B;  1SXT A;  5JXV A;  2D3G A;  2BWE S;  1JRU A;  1TBE A;  1P7F A;  5KHQ A;  2JSV X;  4BAX A;  1JWM D;  2BYT A;  2G9H D;  1SJH D;  2LEK A;  4IWO A;  2E6X A;  4UDU C;  2N1W A;  1WF9 A;  2CJN A;  4KDI C;  2KTR A;  2MSE D;  2UU7 A;  1X1M A;  2QIL A;  4E3C A;  3AED B;  2KN4 A;  3P2B A;  2Y5P A;  4OZC A;  5BYR A;  1C78 A;  2WXG A;  4OVV A;  1BT0 A;  1SE2 A;  4LCD E;  4NAW A;  1E7V A;  2V3S A;  4LK0 M;  4K3C A;  2LWP A;  5FK9 C;  2KD0 A;  1EF5 A;  1RLF A;  4JPS A;  2BS4 B;  2IYD B;  4X57 B;  5CX3 A;  1V1O A;  1RFK A;  4AQ7 A;  3AV8 A;  4GDL B;  3JSV A;  1D3Z A;  2QMT A;  4GLS C;  4KDL B;  3AE8 B;  4IG7 B;  3HIZ A;  3VH4 B;  3IT6 B;  4K7U A;  3AMZ A;  3ZNI D;  1YX5 B;  2NTS A;  1T0R C;  4GGQ A;  2JYE A;  1OQY A;  4WIP A;  3ZIM A;  3PV1 A;  1QOB A;  2I38 A;  4W9C A;  1WJU A;  2J53 A;  4IM2 A;  3BK1 A;  5GXG B;  3HRD D;  3JVZ X;  1E7P B;  4Q2J A;  3U7D A;  4XWT A;  1FCL A;  3AEB B;  1TT5 B;  5T8I A;  3N1X C;  5EE9 A;  4R3D A;  4TV3 A;  3ZKJ C;  2C7M B;  1XF5 L;  2KWV B;  3CSF A;  3E9S A;  1WXM A;  3PTF C;  2J52 A;  1PFD A;  2C7H A;  3EC8 A;  4ZRI A;  3UIP B;  1C3T A;  1Y8R C;  1PYW D;  2KN5 A;  1WR1 A;  5JH5 C;  3VTV A;  2GI9 A;  4MGY E;  4HPL B;  2L05 A;  2NVU I;  2L32 A;  4CYE A;  4HJK A;  4EUT A;  1GOZ A;  1GNU A;  3TCA A;  3HUI A;  2XN9 C;  3GS2 A;  2OHF A;  3ZTD A;  4DXF A;  4E71 A;  4HPM B;  4K7S A;  2MRP A;  2QEJ C;  4ZRP A;  1E5W A;  3VXW A;  4F8C B;  1WX8 A;  4MM3 A;  4XDC A;  4CQN A;  2BTE A;  2L0F A;  3LB8 C;  2RPQ A; 
#chains in the Genus database with same CATH homology
 3PZ7 A;  4D2K A;  1XLN A;  3RFZ B;  1YMH E;  1FFV A;  1PUT A;  1UNS A;  1KH0 A;  2B76 B;  2WXL A;  3FIL B;  3SEB A;  3T3N A;  1AWD A;  4N59 A;  1MI0 A;  1F0Z A;  1JRP A;  2AQ1 B;  2BB6 A;  5EE3 A;  1HZ5 A;  3BK2 A;  3RPF C;  1WXQ A;  1QKZ A;  2IDY A;  2MJE A;  1EWY C;  2LHE A;  4FXC A;  2PW9 A;  1Y56 A;  3MFG A;  3Q8C A;  5BMI A;  2MJD A;  1C76 A;  1SF0 A;  4HEA 1;  2X38 A;  2WDV B;  4N6E B;  1A70 A;  1TY0 A;  3ZQ4 A;  2K9X A;  2PKO A;  1JWA D;  3V05 A;  3CWI A;  1PGX A;  3J9C A;  3U7Z A;  1C4A A;  4JE3 B;  3BYY B;  4YTP B;  1FXI A;  1FIQ A;  1K52 A;  2V0G A;  4NJC A;  3AE5 B;  4J3O D;  1KLG D;  3P1M A;  4YSX B;  2LHD A;  1N5W A;  4M0W A;  1L0Y B;  5TSS A;  1YN3 A;  1SSN A;  5BMG A;  4AS1 A;  1MPE A;  2BS2 B;  2WXH A;  4HJG E;  3HVD A;  1EU4 A;  3CIR B;  2KQ4 X;  5G5G A;  3NUH B;  1CJE A;  4TQ1 A;  1QT9 A;  1GB1 A;  1N5X A;  1ZDV A;  1I4G A;  2W82 A;  2BT6 A;  1TKG A;  5LNK 1;  1ZPS A;  3AM9 A;  3ZGZ A;  4B0E A;  1JWU D;  5BYQ A;  2JXT A;  4ZYS A;  3L4P A;  1PGA A;  3TEW A;  2LFI A;  2K5P A;  3PZ8 A;  1D5X C;  1D4B A;  3BWU D;  1VZ6 A;  4P6V F;  1C4C A;  1YQ3 B;  3GP7 A;  1NVI D;  1WRI A;  1E6E B;  1P7E A;  3P4Q B;  2JQR B;  3PO0 A;  5MPO A;  1TS2 A;  1I7H A;  4RH6 A;  4KKI A;  4YTM B;  1FD6 A;  2EEL A;  1T5X D;  2MJ3 A;  4B0M A;  4A9A A;  1FEH A;  5BYS A;  1NYQ A;  3DWM A;  1V1P B;  4YXD B;  2SEB D;  1L0V B;  2AX5 A;  3LXF A;  1WSP A;  3MJ5 A;  3B2G A;  2L83 A;  3BVZ A;  1ZOY B;  3W1S A;  4RCO A;  3BVG A;  4L2Y A;  1L4D B;  1QF6 A;  3AN1 A;  2WXP A;  1HQR D;  1TS5 A;  4KX6 B;  5FKA C;  3W5V B;  5EE0 A;  3NVW A;  2MH7 A;  3ZJT A;  2BW2 A;  3ZJV A;  2BB5 A;  2HTM E;  3DWG C;  2WDQ B;  2M56 B;  2PVO D;  2RPV A;  1TY2 A;  3OWE B;  2GRI A;  1F2R C;  3VQI A;  2AQ3 B;  3EUB 2;  1VRA B;  3B2F A;  2PMV A;  2J42 A;  2Y3A A;  3AE2 B;  2DYM A;  3TEZ A;  2N9K A;  1FNV A;  5HFY A;  1BML C;  5AUI A;  3T3O A;  2WXJ A;  2FE8 A;  3FAH A;  5HG2 A;  1YNT E;  2V4I B;  1T6B X;  1NEN B;  4MAC A;  2NTT A;  2D5G A;  3P4R B;  1XLP A;  1ZXH A;  4RF0 A;  1BUI C;  1DGJ A;  1FO4 A;  3MHZ A;  3KLS X;  4KGS A;  1EWC A;  3W2D A;  4A6Q A;  4JWU C;  1RWS A;  1AN8 A;  3U52 E;  1KTK A;  1XO3 A;  3O13 A;  3P42 A;  1QOA A;  4DQO C;  2ONQ A;  4OW0 A;  3KWL A;  1JWS D;  3I57 A;  4USA A;  1FFU A;  3Q8A A;  3Q8E A;  1FM0 D;  3AE6 B;  1E10 A;  1VR9 A;  4YTN B;  4LLG M;  2LJI A;  2DLB A;  1DYQ A;  1JWB D;  1M4V A;  1STE A;  4KGR A;  1GB4 A;  4NAW B;  5I4D A;  3AE7 B;  1OQR A;  5HI1 A;  4JWS C;  3TUO A;  2QIE B;  5D3I B;  2BBC A;  4C56 C;  2I2Y A;  2PTL A;  3BZD B;  3EGR A;  3VR9 B;  1B9R A;  3EA6 A;  4XE0 A;  4YT0 B;  3B9J A;  4IDI A;  1ZP0 B;  2L52 A;  1FRD A;  3AE9 B;  2JU6 X;  3IAS 1;  5C3J B;  2ZW0 A;  3AE3 B;  1D5Z C;  1I4P A;  3R2T A;  1JCK B;  1HA5 A;  1OQQ A;  2GB1 A;  1HXY D;  3NVV A;  2WXQ A;  1L5P A;  2FBW B;  1PDX A;  2W3S A;  2H89 B;  1SIJ A;  2WP9 B;  4ZHO A;  1F77 A;  3ZJU A;  1IGC A;  2J4X A;  2QSD A;  2V3N A;  1L4Z B;  4HRS A;  2IJ0 A;  4TQ0 A;  1YN5 A;  2DWQ A;  2QJL A;  4A55 A;  3AEG B;  3NS1 A;  1V8C A;  2KDM A;  4RGN A;  1XXG A;  1I4Q A;  2W54 A;  2MEK A;  1QOG A;  2OED A;  3W5U B;  1ZE3 D;  1I4X A;  3LYY A;  3N9Y C;  3AE1 B;  1DOI A;  4REZ A;  1NYR A;  2WXK A;  1SBB B;  3R8B A;  1TKY A;  1K53 A;  1TKE A;  4ZHP A;  4YSZ B;  1YN4 A;  1SB3 C;  3U2S C;  4RFB A;  4L23 A;  3MC0 B;  3W9C B;  2INP E;  2LMC A;  5H92 C;  1TZO A;  1R7S A;  3Q69 A;  4RGT A;  4RGM A;  1ZXI A;  2ICI A;  4WWM A;  3V3X A;  1ESF A;  1FCC C;  2WU2 B;  1KRH A;  2AQ2 B;  1FXA A;  4C7Z A;  1JQ4 A;  3P4P B;  4OHJ A;  2WU5 B;  1L6V A;  3BVM A;  1QQR A;  4RF1 A;  5FR3 A;  5HHD G;  2WDR B;  4A90 A;  2IPK D;  1RM6 C;  1F2R I;  4WH4 A;  2EKI A;  4EE2 A;  1ET9 A;  2WXM A;  3VRA B;  1J7C A;  4HRO A;  3AB5 A;  3TEY A;  4OVZ A;  3NRZ A;  1OFF A;  5C2T B;  1IBX B;  1ZDX A;  4H2A A;  1V1P A;  2M19 A;  2INN E;  1UWM A;  5D3D A;  1FNU A;  2CJO A;  1AW7 A;  2W55 A;  2RDG A;  1QIL A;  2IGD A;  5EE1 A;  1D6E C;  3U4E G;  3FC4 A;  1VZ8 A;  1KLU D;  2Q5W D;  4LTU A;  4GDK B;  3SFD B;  5G5H A;  1EU3 A;  4NAM A;  1FNW A;  1JRO A;  1SE4 A;  1CK1 A;  1KFY B;  2H88 B;  4OZB A;  1XCQ L;  2PVG C;  3TEX A;  3NZ3 A;  2WXF A;  4IOI E;  1J7B A;  3GB1 A;  1XCT L;  2VZK D;  3IT4 B;  2WXN A;  1EM7 A;  4OZA A;  3ZYY X;  3BII D;  1PGB A;  1YQ4 B;  3E56 A;  2WLB A;  3AH7 A;  2PLP A;  4A8X C;  5D7G A;  4MM3 B;  1SXT A;  5JXV A;  4YSY B;  4US9 A;  1P7F A;  1DOX A;  2JSV X;  1JWM D;  5AUK A;  3ABV B;  2BYT A;  2G9H D;  1SJH D;  2KAC A;  2LEK A;  2E6X A;  4UDU C;  1CQV A;  1VZ7 A;  2K3U A;  1K51 A;  2CJN A;  1K50 A;  1T3Q A;  4HKZ E;  2RMM A;  1C79 A;  2JX5 A;  2G1E A;  2QIL A;  3AED B;  2KN4 A;  1QLB B;  3ETR A;  4NZL B;  1SE3 A;  2Y5P A;  4XDD A;  1SEB D;  1J7A A;  2ACZ B;  4OZC A;  4ZOH C;  1D5M C;  1JW9 D;  2N9L A;  5BYR A;  1I4R A;  1C78 A;  1JAL A;  1YJJ A;  2WXG A;  3FIL A;  2N7J A;  2WS3 B;  1ZUD 2;  2R61 A;  1SE2 A;  1LO5 D;  3C8Y A;  3AEE B;  4N58 A;  1NI3 A;  4LK0 M;  4L1B A;  2Z8L A;  1ET6 A;  1SJE D;  4US8 A;  1TS4 A;  5FK9 C;  4KKJ A;  1DOY A;  1WGK A;  1XEE A;  2IGH A;  2JWU A;  3H8H A;  1IGD A;  3BYT B;  4JPS A;  2BS4 B;  4YWG G;  3WCQ A;  1C9F A;  1AYF A;  2LUM A;  3IXS A;  2E3T A;  1E0Z A;  1V1O A;  1N60 A;  1RFK A;  4RGO S;  2ZW1 A;  3NVY A;  4AQ7 A;  3AV8 A;  4GDL B;  4RNA A;  2QMT A;  4GLS C;  3AE8 B;  2RDH A;  2L1A A;  2YEP B;  4DXG A;  5E6J A;  3IT6 B;  2XNA C;  2ON8 A;  3AMZ A;  4HKQ A;  4P16 A;  1HEZ E;  2N0S B;  5BMH A;  1VJK A;  3Q8F A;  1N62 A;  2NTS A;  2JYE A;  4MH8 A;  4WIP A;  3MP9 A;  1UWX A;  4IKG A;  2FUG 1;  2KWD A;  1E9M A;  4JX1 C;  5H8Y E;  1QOB A;  2I38 A;  3I9V 1;  1KF6 B;  2J53 A;  1QOF A;  2M0A A;  2VZK B;  3P4S B;  2WXR A;  1MVK A;  3SFE B;  3BK1 A;  5GXG B;  3VRB B;  3HRD D;  1FMA D;  4WUR A;  1MHH E;  1N61 A;  1ENF A;  1JML A;  1E7P B;  4Q2J A;  2NMQ A;  3KQ4 A;  3Q8B A;  4XWT A;  1FCL A;  1TJE A;  3AEB B;  3VR8 B;  3SR6 A;  5T8I A;  4KGT A;  1BXT A;  5EE9 A;  3P63 A;  4R3D A;  1XF5 L;  3E9S A;  2WNM A;  4WAF A;  3NVZ A;  1L0X B;  1Q10 A;  2J52 A;  1PFD A;  2YEP F;  2V3P A;  1ACC A;  1TYG B;  3HVZ A;  3AEF B;  1PYW D;  1ROE A;  2JZP A;  4C7Y A;  4ARI A;  4PT5 A;  1C77 A;  3UI3 A;  2SAK A;  2W3R A;  2TSS A;  4ARC A;  2GI9 A;  1CZP A;  1GAQ B;  1N63 A;  3AE4 B;  1RYJ A;  2WXO A;  1IBX A;  1NEK B;  2KAJ A;  3KWV A;  2DYO A;  1FRR A;  1I4H A;  2HDE A;  2L32 A;  2IGG A;  4ZRQ A;  1GOZ A;  2Y5C A;  2JYT A;  4TMA B;  2WQY B;  1UUP A;  1VDV A;  1V97 A;  2WXI A;  3HUI A;  1XLQ A;  3R2I A;  4TSS A;  1HZ6 A;  3TSS A;  1IUE A;  2XN9 C;  3GS2 A;  2OHF A;  1C4P A;  3AEC B;  2K0P A;  1UGJ A;  4DXF A;  2LGI A;  3IAM 1;  1B1Z A;  4MT5 A;  1GPX A;  1WWT A;  2QEJ C;  2K22 A;  4ZRP A;  1VLB A;  2CU3 A;  1WYG A;  2DBY A;  1TS3 A;  1XLO A;  4WQM A;  4C80 A;  1YJI A;  2KMM A;  3AEA B;  4XDC A;  4CQN A;  4O1N A;  2BTE A;  1L6U A;  1MHX A;  2BS3 B;  2PIA A;  4ITK A;  3LB8 C;  3URY A;  4XWW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...