5AZGA

Crystal structure of lgg-1 complexed with a unc-51 peptide
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
119
structure length
119
Chain Sequence
b'GPHMKWAYKEENNFEKRRAEGDKIRRKYPDRIPVIVEKAPKSKLHDLDKKKYLVPSDLTVGQFYFLIRKRIQLRPEDALFFFVNNVIPQTMTTMGQLYQDHHEEDLFLYIAYSDESVYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein lgg-1
molecule tags Protein binding
source organism Caenorhabditis elegans
publication title Structural Basis of the Differential Function of the Two C. elegans Atg8 Homologs, LGG-1 and LGG-2, in Autophagy
doi rcsb
total genus 36
structure length 119
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5azgA00
3H7PB 4TKNA 1WX7A 2AEHA 3QWZB 2BYVE 4HVBA 5G55A 3HM6X 3V61A 4J6IA 3L17A 4W9IA 3V6CB 4BKTA 2BWES 2WYQA 2L8JA 1QZEA 2FIFA 3KUZA 4GB9A 3ZNZB 3JYUA 2IO2B 3ZIMA 2LGXA 3IBEA 2NVUI 3PLUA 1P9DU 2XK5A 3L0WB 1YQBA 2AYOB 3UGBB 3HIZA 4EUTA 4GOCA 5AZHA 1Q0WB 1IPGA 3V6EB 2MBBB 2IO0B 1RLFA 1OTRB 1WI0A 5E6OA 1P98A 2MWSB 4HPLB 2C60A 3DCGA 3GZNI 3W1SA 4W9FA 2KQSA 4ICUA 3ZW3A 1OEYJ 4NY0A 3TBLD 2BYFA 3AXCA 1OQYA 2J0MA 4KZCA 2DHZA 1YX6B 3ZUNA 2KN5A 1EO6A 2KFKB 3VXWA 5IAAC 1SGHA 5D7GA 2AL6A 4JQWC 4ANUA 1E8WA 5DPSA 3VH3B 1YD8U 5E6NA 3V60A 2V1YA 4DHZB 4RMAA 1FXTB 1E7VA 2DENB 4F8CB 3ZTDA 3IFWB 2K1FA 3B08A 3KUDB 4DHZE 3D32A 2L76A 3AI5A 3VVWB 3EECA 3QIJA 2MW5A 2RPQA 3B0AA 3PHXB 4WWPA 4B6WA 4G0NB 4HDOA 3PHWB 3PRZA 4FJVB 2M17A 1WE6A 3JVZX 4BKSD 1EF5A 4IWOA 1V5OA 4ICVA 2V4LA 1LM8B 2DYMA 2JWZA 2KANA 2O6VD 4IM0A 4URKA 3W1YA 4RM8A 1V49A 1V80A 4MGZE 4A3OA 3PVLA 2JUOA 4P7IA 4W9CA 1WGYA 3T9LA 3ZRCA 1T0YA 5C23A 1KJTA 2G4SA 1Q5WB 2KTFA 2MBQA 2GBMA 3RUIB 1WZ3A 2KKCA 3NHEB 1L7YA 3RT3B 5D94A 3WIMA 2EMSA 1ZW7A 3WAOA 1TBEA 3APFA 2KXJA 3X23A 4RM9A 3DVGX 4IC7B 2XBBC 4IUMB 1UZXB 1XD3B 3ZKJC 1J0GA 2N1VA 1M94A 2XEWA 3WAPA 3AU4A 3UINB 1R4MI 1WY8A 2M0XA 2WX1A 2V3SA 1NBFC 4HJKA 2CS4A 3CF6E 1WZ0A 1LFDA 3KVFB 4KIKB 3RZFA 3PREA 4G50A 4E3CA 2PJHA 4A20A 2CHXA 2LZ6A 1D3ZA 4FHKA 2O6VA 2VRRB 3LJ3A 3X0WA 4FULA 3H1UA 1I42A 2R2QA 4IM2A 2WX0A 4M0WB 1WR1A 2RGFA 4K1RB 3ONSA 2DYBA 4CYEA 2KHWB 3MTNB 4MSQB 4N9F4 4BBNC 2PEAA 3H9DA 3VUYA 3QCAA 1UD7A 4WJPA 1EUVB 2BKFA 4FADA 5TR5A 2MBEA 2NBVB 1WE7A 4FJZA 2MCNB 1P0RA 3ZO5B 4GDLB 2BPSA 2EKEC 2Y5BB 4MJSB 3SD5A 1WRDB 4W9KA 1J8CA 5J2RA 3KUCB 2A5UA 4DK5A 2KC1A 2LWPA 2G45B 4M8MA 5CX3A 3DPDA 5HKHA 2NPTB 1SE9A 4JGHB 2KLCA 2LGYA 3NS8A 4LJOB 5DPWA 1RRBA 3KH0A 3S2AA 1TGZB 2JZ3B 3L13A 2M4NA 4AJWA 5AZFA 4F1SA 2KK8A 1RAXA 1Z5SB 3PT2B 4B95A 2BF8B 3QJZA 3UIPB 2J0JA 2BGFA 4W9EA 2FUHB 1YIWA 1UGMA 3JSVB 4MELA 3IHPC 2MA9B 3OLMD 3RULA 2KDIA 2FAZA 3ZNGC 4W9DA 1IP9A 2LVOA 4ANWA 3VTWA 4CO7A 5JZEB 2GBRA 2IO3B 1P3QU 4LCDE 1GG3A 4BBNF 5KHOA 3M63B 3W1SC 2C7HA 2GBKA 4GXBA 2GMIC 2KWVB 4TQ1A 2JRIB 2BYEA 3WA0A 2HTHA 5JHAA 4WWOA 4DWFA 2KTRB 2N7EA 3Q3JA 2LD9A 2D07B 3QX1A 4ZRIA 4AOFA 3VDZA 3ALBA 2JF5A 1HE8A 4A3PA 2HD5B 4MGKE 1V6EA 3VH4B 4MGYE 3ML9A 2KOXA 3DBHI 1V9JA 2QHOA 5EDSA 3DDCB 2A4ZA 4EZLA 2L0TA 5IA7A 3R7RA 3RZWC 3H6NA 4NAWB 4ZDVA 4NJ6A 2D11A 3N30A 3SHQA 1E8XA 5L95C 2MBOA 2FCNA 4HCPB 1A5RA 3DVNV 3GOEA 2CHZA 4K7WA 3OJ4B 3K9PB 1WGRA 2KX0A 3HK0A 3KYCD 4TV3A 3RCZA 4FBJB 3VUWA 2GBJA 1CMXB 3A1QB 1WJUA 2HE7A 2REXA 3PZDA 1H4RA 2ZVOA 3NZSA 3UQAA 2NS5A 4MSMB 3SDLC 3L54A 3TIXA 1NI2A 2KWCA 3A9JA 2OOBB 4GGQA 1WH3A 2JRHA 1UBQA 1MG8A 5DPRA 2FNJB 2K6DB 3AULA 1BT0A 2Z0DB 3MJWA 1J19A 2UWQA 4MH0E 2CU1A 2N9XA 1Y8RC 2C7NB 3QARA 1L2NA 1V2YA 2CHWA 1WXSA 1WJNA 5GMVA 4GN1A 3PLVA 5CHWA 2BWFA 3IVFA 2JT4B 4GDKA 1S3SG 4GIVA 2KO3A 2NBUA 2C7MB 3A1QA 3ML8A 3EHVA 4WQOB 3TCAA 3A9KB 2MRPA 2CKHB 3DBLI 2ZEQA 2DAFA 4AWJA 4G11A 1TZ1A 1V86A 3WALA 4HLEA 3BINA 1NDDA 3QHTA 3ZNID 4DDID 4MM3A 2JZZA 2LVPA 4LDTD 5CHFA 2LGDA 4F7ZA 1S1QB 2LJ5A 2L00B 1ISNA 2I1JA 4JLCA 4EOYA 3Q3FA 2KD0A 4K81A 4G3XB 2RD0A 1UELA 3DBRI 2J7QB 2MX2A 4GU2A 2G4DB 2L7RA 4I6LB 3LDZE 4MDKE 4PS7A 5D2MB 2NPTA 1TTNA 4KZ0A 4OVUA 2MSED 3ZTCA 4KVGB 2ZJDA 1UBIA 2NBWB 3VAWA 4DHJB 5AZGA 1E90A 2ZVNA 4XZ4A 2KNBA 2N9EB 3ZRFA 1WX8A 3HHMA 3VTVA 2KVRA 2MP2B 2PE6B 1WFYA 3CMMB 2C9WB 4W9GA 5LLIA 5LXHA 4DDGD 2K25A 2IBIB 4FHJA 3ECIA 4M8NA 3WAMA 4B9KA 2KDBA 4HPMB 4TUUA 4JL9A 2AWTA 3APCA 3M62B 5DPTA 4NNJB 4BFRA 1WR6E 2G3QB 3U8ZA 4PYZA 2PPHA 1KOTA 1YX5B 4ZRKA 1JRUA 5J18A 1UH6A 4E71A 2KDFB 3H7PA 1WGHA 2NCNA 3APDA 3T8MA 3EFUA 2D3GA 3PV1A 1RFAA 1XQQA 2KC2A 2KQ7A 2KJHB 4K7SA 3PS6A 2NR2A 5AEKB 3R66C 1WGGA 2PE9A 4MJSA 4EEWA 1WXVA 3C0RB 4HK2A 1GJZA 3ZLZA 2R2OA 2W9NA 3M3JA 4NQKE 3CSTA 2LXAA 4MEMA 4FJYA 4IWQA 1K8RB 3VQIA 1WJ4A 3QK0A 3ZVVA 1GNUA 3ZDMC 4HWIB 3HM3A 4BKSA 4DHJD 2KMAA 2L0FA 3TJPA 3CSFA 3PTFC 1X1MA 1E8ZA 2AL3A 2IZVB 3QAQA 4FN2A 2KDEB 2GOWA 4EFOA 2LRWA 1E5WA 2J0KA 3EC8A 1GUAB 3JSVA 4GSWA 3OAWA 3U30A 4XC2A 4MGIE 4BOZB 2JVCA 1V81A 3NY5A 1Q1OA 1R4NI 1F9JA 4AUQC 2LUEA 5CHVC 3B1LX 2K39A 3TL5A 2D2QA 3VHTC 2ASQA 4PS8A 1ZKHA 3QQ8B 4EZJA 4PS3A 2LASA 5L83A 1OGWA 4LDTB 2LXCA 2WDTB 2YVCA 3AU5A 3IG3A 4FLHA 1OEYA 3M95A 2KTRA 2JXXA 2RSUA 4X57B 2Z0EB 2ZCBA 4E74A 4GMVA 2JY6A 2M1MA 2K6QA 3A4RA 2D10A 2KX3A 2KJ6A 2KZRA 2OJRA 3N3KB 2K8CA 4FA6A 1IYFA 3PPAA 1WXAA 4KDIC 2FCMA 2WWZA 5C1ZA 4WJNA 1Z2MA 4KIKA 4AP4C 5D6JB 3H7SA 4KDLB 2EMTA 2XK5B 4W9HA 2O2VA 4CHKA 1KM7A 4NAWA 1EF1A 3NOBA 2HJ8A 4W9JA 3DVGY 3VTUA 3JW0X 2K8BA 1WM2A 4II2B 4WJQA 2ZPNA 3KYDD 2KFJA 2L3ZA 3DVNU 5JHBA 3L10B 4HDQA 4WAAA 3OJ3A 1WXMA 4I6PA 1G6JA 1LQBA 1ZGUB 1U4AA 2MQJA 1XT9B 2FCQA 1WMHB 2GBNA 4AJYB 4DBGA 3DQVA 3ZNHB 3U7DA 2B3AA 3DOWA 3QC8B 2KFKA 1V5TA 3RD2A 4ANXA 1I35A 3A9JB 2DZJA 1KLVA 1WGDA 2CR5A 3UQBA 2UYZB 3PRPB 2I1KA 4ASWC 5J17A 2IY0B 2ZNVB 1P1AA 3A33B 4GDLA 4NJ7A 3PRMB 2O2VB 2N9PC 4OVVA 5E6PA 3I3TB 4II3B 3PSEB 4WWNA 4EKUA 3ENEA 3O65B 2M8SA 1PQSA 3R3MA 1WYWB 1YJ1A 4ZYNA 3SU8X 1WX9A 3R7QA 4NPNA 2ZPYA 5FR6A 2DAJA 2KJRA 2K8HA 4IM3A 1GC6A 4BKGA 4GDKB 4TQ0A 2DZKA 3VFKA 1WMHA 1SIFA 3UF8A 2YLMA 2ZCCA 2DYOA 5KHQA 3NZUA 4KSLC 4JIOU 2JPHA 4IWPA 1E7UA 4BOSC 3MHSD 4I6NB 4LJPB 2C5LC 2MLBA 1WF9A 5G2NA 2LI5A 3QA8A 4HCNB 3VUXA 1WJ6A 2FIDA 2IO1B 3N32A 1H8CA 4IW0A 4WJOA 2N1WA 4IG7B 4YL8A 3UIOB 2KWUB 4ANVA 2DZMA 4W9LA 4ZRJA 2DZIA 4KV2A 2LVQA 2IY1B 4DXAB 2LRUA 4XX5A 5CTRC 2ZZPB 2Z59B 4EZKA 5BO4B 2ZNVC 3BY4B 3P2BA 4KSKC 5LXIB 1GC7A 2KLGA 1LXDA 1WM3A 1WIAA 2DX5B 3A9KA 3PGEA 3DBSA 1C3TA 4K7UA 2MP2A 2N4FA 3WANA 3A4SC 2N7DA 3TMPB 1VCBA 2FCSA 5DCNA 3L16A 1E8YA 4BVUC 2O6VB 3KW5B 3RYTA 2RR9A 1AARA 3L08A 2BKRB 2L05A 2MBHA 4HXDA 3ZDTA 3K9OB 5JH5C 1C1YB 4NQLB 2KMCA 4PYUA 2IYDB 3V62A 1VD2A
chains in the Genus database with same CATH superfamily
2G1EA 4JPSA 4OZAA 1FCLA 2AEHA 2BYVE 5G55A 3HM6X 1HZ5A 3OWEB 4W9IA 3V6CB 1F2RI 2L8JA 2FIFA 1FXIA 5TSSA 1QQRA 4ZHPA 1HXYD 4LTUA 2XK5A 3V05A 3UGBB 2JWUA 5AZHA 2IO0B 1RLFA 3MJ5A 1OTRB 1WI0A 1E9MA 1FNVA 1P98A 3Q2AC 2MWSB 1DOXA 1FRDA 2C60A 1HQRD 2KQSA 5EE9A 3TBLD 2PMVA 3N1YC 1OQYA 1FCCC 2J0MA 3DBLB 3P1MA 1NI3A 4KGTA 4IDIA 3EUB2 3AEFB 2W55A 3ZXVA 4ANUA 1N61A 1YD8U 1WGKA 1NYQA 3V60A 4RMAA 1FD6A 1E7VA 1IBXB 4YTNB 1CQVA 5JXVA 2KVZA 3BVZA 3PRZA 2M17A 3JVZX 1V5OA 4JWSC 1EWCA 1LM8B 2DYMA 2KANA 4URKA 1K52A 4RM8A 1V80A 4MGZE 1FXAA 4RGNA 1I4PA 1C4CA 5IP4D 2GBMA 4M02A 2Q5WD 2BS2B 1ZW7A 4IC7B 2XBBC 2MJ3A 1C4PA 1J0GA 3PO0A 2IJ0A 2EELA 1HTQA 4TMAB 1YNTE 2N9LA 1I7HA 1LFDA 4KIKB 3RZFA 3EFCA 4G50A 4A20A 4BAXA 3X0WA 3N1ZC 1N60A 3ONSA 1XF5L 4YWGG 1UGJA 4N9F4 2PEAA 3QCAA 4WJPA 1GB4A 5TR5A 1BUIC 1P0RA 3ZO5B 1AWDA 4B0EA 3KUCB 2KC1A 4M8MA 2G45B 5CX3A 2JYEA 2NPTB 2KLCA 1SBBB 2JZ3B 3L13A 2M4NA 4AJWA 5AZFA 3Q69A 1DYQA 1TS4A 4NJCA 4B0MA 4DQOC 1JCKB 3ZNGC 4W9DA 2LVOA 4KGRA 1KLUD 2IO3B 1P3QU 1GG3A 3MHZA 3W1SC 2WDQB 2GBKA 3VRAB 1HA5A 3WA0A 1FIQA 2WXIA 5JHAA 1UUPA 2QSDA 2KTRB 4DXFA 2LD9A 3QX1A 3NS1A 4ZRIA 4DXGA 3ALBA 1HE8A 2D5GA 2AQ1B 2UU7A 1V9JA 2WXFA 2QHOA 3AMZA 4EZLA 3RZWC 4ZDVA 2D11A 1IGDA 2BB5A 2LHEA 2WLBA 3GOEA 4K7WA 5BMGA 3K9PB 1WGRA 5IO9A 1QOBA 3B9JA 2REXA 4S17A 4OVZA 1NI2A 2OOBB 4GGQA 2JRHA 2SAKA 5DPRA 1F77A 4XDDA 1BT0A 3J9CA 2HTME 2Z0DB 2WXKA 1T0SC 5FK9C 3RNEC 2CU1A 2N9XA 1Y8RC 4ZHOA 1JQ4A 1L2NA 1WXSA 5GMVA 1MHHE 4GIVA 2KO3A 2NBUA 3EHVA 1PDXA 2DAFA 4G11A 3WALA 4HLEA 2W54A 3QHTA 3Q6BA 2JZZA 1EWYC 5HI1A 2LGDA 1S1QB 2I1JA 4WAFA 1R4MB 1UELA 3DBRI 3U4EG 2L7RA 4I6LB 4PS7A 2WS3B 4KVGB 3VAWA 4DHJB 1E90A 2N9EB 1WXQA 3PZ8A 1VZ8A 2K0PA 5LXHA 4DDGD 4M8NA 3ECIA 2ON8A 3WAMA 3EA6A 5EE1A 2PPHA 1YX5B 4ZRKA 4HPPA 2ONQA 3NVWA 3NRZA 4NZLB 1MPEA 4BZAA 2KJHB 3PS6A 3TEXA 2PE9A 4MJSA 1ZPSA 2K3UA 1LGRA 1WWTA 3ZLZA 3M3JA 2WU2B 3AEGB 1FRRA 1YJIA 3ZVVA 4YTPB 4BKSA 1L6UA 1X1MA 1E8ZA 2AL3A 2IZVB 2I2YA 4GSWA 3EC8A 2JVCA 1VJKA 2LUEA 2INPE 3DWMA 4QAYA 2VZKD 3EGRA 5L83A 3FAHA 1OEYA 2RSUA 4E74A 2DWQA 2KJ6A 1IYFA 2V0GA 2WWZA 4WJNA 1L4ZB 1Z2MA 1TY2A 4AP4C 2BTEA 3H7SA 4HJGE 1KM7A 4NAWA 1K51A 3NOBA 4W9JA 2BB6A 1WM2A 4GLSC 5JHBA 2FE8A 3L10B 1LQBA 2INNE 2BT6A 4AJYB 1UF0A 4LLGM 1I35A 1WGDA 4ASWC 1XLOA 3PRMB 3Q8AA 2IGGA 3I3TB 5E6PA 3Q14C 4II3B 4LNIA 2TSSA 4WQMA 3AM9A 3O65B 3R3MA 4C00A 1ZOYB 2AX5A 3U7ZA 1YJ1A 4ZYNA 3SFDB 1LO5D 1RWSA 4GDKB 4OZCA 1VDVA 4MT5A 3UF8A 3AEEB 2ZCCA 1FEHA 4KSLC 2JPHA 1E7UA 2D3BA 1L5PA 2LGSA 1WF9A 5G2NA 1QOGA 3QA8A 1H8CA 1WJ6A 3N32A 4C7YA 4WJOA 1N62A 4IG7B 2KN4A 3UIOB 4ZRJA 3RI7C 2IY1B 3IT4B 2H89B 3KLSX 4XX5A 2V9HA 4EZKA 2H88B 3BY4B 1CZPA 1GC7A 2SEBD 3OG5A 3A9KA 1TKEA 2FCSA 5DCNA 4LNKA 1CJEA 4WH4A 4BVUC 1C79A 3RYTA 2RR9A 2L05A 2MBHA 1C1YB 4OHJA 2IYDB 1VD2A 4K3BA 3AEAB 4RCOA 2K9XA 3MFGA 4O1NA 5BYRA 3IBEA 3PLUA 1P9DU 3HIZA 3V6EB 1TIFA 4A9AA 4XYCA 2QEJC 5E6OA 1D5XC 1BMLC 1HTOA 1WSPA 1OEYJ 1C78A 4NY0A 4C56C 5EE3A 4KZCA 1J7AA 2DHZA 2L83A 2RMMA 1C77A 1EO6A 3E9SA 1NEKB 3P4SB 5DPSA 1JMLA 1FXTB 2DENB 3IFWB 2IGHA 3B08A 3KUDB 4DHZE 2L76A 3I57A 3EECA 2GI9A 3PHXB 4WWPA 4HROA 4G0NB 4YTMB 4IWOA 4H2AA 2V4LA 2O6VD 1PGBA 2JSVX 4P7IA 4W9CA 1BXTA 5C23A 2M19A 1ACCA 2KQ4X 1L7YA 3WIMA 2PLPA 1TBEA 3X23A 4RM9A 1K53A 1IGCA 2OEDA 2WGSA 1IUEA 2CJOA 1N5WA 2WX1A 1NBFC 3CF6E 2W82A 2CHXA 4FULA 3MC0B 3H1UA 3AH7A 4M0WB 3W9CB 3RNFC 1WR1A 2DYBA 2KHWB 4MSQB 3DHHC 1UD7A 1ET9A 5G5HA 3IT6B 2BKFA 2LMCA 4FADA 1C4AA 2NBVB 1WE7A 2MCNB 2L1AA 1QKZA 2EKEC 3SD5A 5J2RA 2A5UA 4DK5A 5HFYA 5HKHA 4YT0B 3BWUD 1RRBA 1SB3C 1TGZB 4F1SA 1QLBB 1Z5SB 2MJDA 3UIPB 2J0JA 4C4VA 2FUHB 1YIWA 1QF6A 4MELA 3ZGZA 5IN7A 2MA9B 4AS1A 4ANWA 1WRIA 1N63A 1PYWD 3U52E 1VZ7A 2IDYA 5H92C 4BBNF 2C7HA 2KWVB 1WYGA 1SE2A 4DWFA 4AOFA 2JF5A 3SR6A 4OW0A 1QOFA 2HD5B 2WHIA 3ML9A 4C4VB 2PIAA 1STEA 3ZJVA 2JQRB 1EU3A 1P7FA 2XNAC 1SSNA 5C2TB 3SFEB 3H6NA 2IGDA 1DOIA 3KYCD 4FBJB 3VUWA 1CMXB 3PZDA 1H4RA 3L54A 2DBYA 2KWCA 2HJ1A 1YQ3B 2W3SA 1UBQA 5IOIA 3HRDD 1FFVA 1MG8A 3N1XC 2M56B 3AE1B 3AULA 2W3RA 5AUIA 3BZDB 1IBXA 1J19A 2UWQA 3FC4A 3BVGA 2C7NB 1QOAA 2BWFA 2JT4B 1S3SG 1T3QA 2C7MB 4WQOB 3ML8A 3A9KB 2CKHB 3DBLI 2ZEQA 4AWJA 3AECB 3ZNID 3URYA 4DDID 4JX1C 2QCZA 4EOYA 1E10A 3R8BA 2RD0A 2J7QB 2G4DB 4MDKE 2ZJDA 1F52A 2WU5B 2NBWB 5AZGA 3VTVA 1J7CA 2MP2B 2LHDA 2IBIB 4B9KA 2NTTA 2BBCA 4NNJB 1TS3A 3B2GA 3Q8BA 1WR6E 1T0RC 4MH8A 4USAA 2JZPA 3CIRB 2RDHA 5IKCM 3Q8FA 2NCNA 1GOZA 2D3GA 3PV1A 1RFAA 1A70A 2GB1A 3MP9A 3HVDA 2LXAA 4FJYA 1WJ4A 1GNUA 4A90A 4M00A 1MVKA 1YN4A 3CSFA 1YQ4B 3P4QB 1SIJA 1XLNA 1JWSD 2GOWA 1E6EB 3U30A 4XC2A 1UWXA 1YN3A 1V81A 4OZBA 2J52A 5D3IB 3AE2B 3TL5A 5BMHA 2D2QA 2BYTA 1TJEA 4PS8A 3QQ8B 4EZJA 3RPFC 1Y56A 1OGWA 3FILB 4LDTB 1T6BX 2WDTB 3IG3A 2KTRA 4HEA1 2Z0EB 2KACA 4GMVA 5BYSA 3P4PB 1FPYA 2K6QA 2HDEA 2KZRA 4AQ7A 2K8CA 4XDCA 4KDIC 2FCMA 3KWLA 1GPXA 4KDLB 4R3DA 3GZNB 4W9HA 4REZA 1EF1A 1T5XD 1ZP0B 2ZPNA 3BYYB 2KFJA 4WAAA 3OJ3A 3Q3OC 1U4AA 1JALA 2FCQA 3GE3C 3DQVA 3ZNHB 3U7DA 2B3AA 3DOWA 4P16A 2M0AA 4ANXA 2DZJA 1KLVA 3GP7A 3UQBA 1I4XA 5J17A 2IY0B 4GDLA 3KWVA 2N9PC 2PW9A 2JXTA 3ENEA 1WYWB 1WX9A 4NPNA 2WXPA 4IM3A 2K8HA 2CU3A 3VFKA 5HHDG 4XWTA 2DYOA 5KHQA 3NZUA 4A55A 4BOSC 3L4PA 3MHSD 3T3NA 3Q8CA 4LJPB 2C5LC 2LI5A 1SE4A 4IW0A 2JX5A 2KWUB 4ANVA 4W9LA 1ZE3D 3IAS1 4RGMA 1B1ZA 2G9HD 2DZIA 2LVQA 2R61A 4DXAB 1CK1A 2D3CA 4RF0A 2V3PA 4J3OD 4RNAA 4IKGA 1ROEA 2ZNVC 5LXIB 2KLGA 1DGJA 4P1CC 1LXDA 3PGEA 4K7UA 4ARCA 3A4SC 2N7DA 1VCBA 3L16A 2MH7A 4P6VF 2O6VB 2QIEB 1KLGD 2V4IB 1ET6A 2KMCA 4C80A 4PYUA 4A8XC 4NAMA 2WNMA 2YEPB 3H7PB 1UNSA 4TKNA 1WX7A 3V61A 2FBWB 2LUMA 3L17A 4BKTA 2WYQA 1SXTA 1QZEA 3ZNZB 3JYUA 2IO2B 1ESFA 1YQBA 2AYOB 1Q0WB 1IPGA 2MBBB 2Y3AA 1DOYA 2KAJA 4ICUA 1QILA 3ZW3A 2EKIA 3KQ4A 2INCC 3AXCA 1YX6B 4P1BC 2KN5A 2KFKB 3VXWA 1K50A 4L1BA 5IAAC 1SGHA 3CWIA 5D7GA 2AL6A 3MC9A 4JQWC 2X8XX 2BQQA 3ZJUA 1RFKA 3ZTDA 3AI5A 3QIJA 3B0AA 1F2RC 4B6WA 4HDOA 4FJVB 4BKSD 1EF5A 3I9V1 3NVVA 4ICVA 2JWZA 2QDFA 2WXLA 4A3OA 3RFZB 3HVZA 2JUOA 4JE3B 1TS5A 3W2DA 3T9LA 3ZRCA 1T0YA 1R7SA 2G4SA 2MBQA 3RNBC 3RUIB 2KKCA 1FMAD 2MHJA 3R2TA 4M0WA 3WAOA 4K3CA 2KXJA 2N0SB 4IUMB 3HUIA 3BK2A 2N1VA 1M94A 2NTSA 1KTKA 3WAPA 3ZXRA 3AU4A 3UINB 1WY8A 2M0XA 2V3SA 2CS4A 2OHFA 4E3CA 2PJHA 3RMKC 2LZ6A 1D3ZA 4FHKA 3Q3NC 5EE0A 2VRRB 5LNK1 4HRSA 2LGIA 2WX0A 2XN9C 4K1RB 4CYEA 3MTNB 3H9DA 3NUHB 1V8CA 1EUVB 2MBEA 4FJZA 1TZOA 4GDLB 1PUTA 4MJSB 1WRDB 1J8CA 2VH2A 2LWPA 4JWUC 5I4DA 3DPDA 1V97A 1SE9A 2LGYA 3NS8A 4LJOB 3KH0A 3S2AA 4A6QA 2WXMA 1RAXA 3PT2B 5MPOA 2BF8B 3QJZA 4W9EA 3JSVB 1ZDVA 3TUOA 5BMIA 1MJDA 3OLMD 3Q3MC 2KDIA 1FNUA 1IP9A 2LEKA 3VTWA 5JZEB 2RDGA 2DNFA 4LCDE 5KHOA 4KGSA 2GMIC 3SEBA 2JRIB 4PK1A 2HTHA 3Q3JA 2D07B 3VDZA 4MGKE 1V1PA 3DBHI 4US9A 5EDSA 3DDCB 2L0TA 5IA7A 3R7RA 3AN1A 4NJ6A 1FO4A 4LNOA 3SHQA 1E8XA 4RGTA 2FCNA 2WXRA 4Q2JA 3DVNV 4L23A 3OJ4B 2KX0A 1TT5B 4TV3A 3RCZA 3VR8B 4LNNA 1WJUA 2ZVOA 3NZSA 2NS5A 4MSMB 3AEBB 3SDLC 3A9JA 1WH3A 3TEZA 1V1PB 5AUKA 3H8HA 2FNJB 3TEYA 1SJHD 1L6VA 3QARA 3AE8B 4XGAB 3PLVA 2MEKA 4GDKA 1I4HA 3A1QA 3TCAA 1TZ1A 1V86A 2VZKB 3BINA 1J7BA 1NDDA 2WXOA 4LDTD 2L00B 4JLCA 2KD0A 3BK1A 4G3XB 2CJNA 4GU2A 1T0QC 2NPTA 1TTNA 2INDC 1TY0A 4KZ0A 4OVUA 2MSED 1KFYB 2KWDA 3ZRFA 1WX8A 1WFYA 3VRBB 2C9WB 4W9GA 5LLIA 2FUG1 1I4QA 4FHJA 2JYTA 2AWTA 3APCA 3M62B 2LJIA 5DPTA 5G5GA 4BFRA 2G3QB 3U8ZA 4PYZA 2ACZB 5J18A 1UH6A 4E71A 2L52A 1WGHA 3APDA 3T8MA 3EFUA 1HEZE 1XQQA 2GRIA 4K7SA 2WDVB 3C8YA 2MJEA 4HK2A 2R2OA 3VQIA 3QK0A 3HM3A 4DHJD 3RNAC 3TJPA 3PTFC 2D3AA 2NMQA 3QAQA 4FN2A 4EFOA 2LRWA 1Q10A 1GUAB 4MGIE 4BOZB 1JROA 1F9JA 5CHVC 3ZJTA 1I4GA 1TS2A 1QT9A 4K81A 2YVCA 3AU5A 4FLHA 2JXXA 2ZCBA 2J53A 4LNFA 4XE0A 2JY6A 3A4RA 2OJRA 1WXAA 5C1ZA 4M01A 4LK0M 2ZW1A 5GXGB 5D6JB 1R4NB 2EMTA 2XK5B 3TSSA 2AQ2B 1KF6B 3WCQA 3VTUA 4HKZE 3ABVB 4II2B 4WJQA 3KYDD 4HDQA 1PGXA 4I6PA 1WXMA 1G6JA 1ZGUB 1FNWA 1XT9B 1WMHB 2GBNA 4ITKA 4DBGA 3RN9C 1OQQA 3QC8B 3GE8C 3RD2A 3VR9B 2CR5A 2UYZB 5FR3A 2I1KA 1TKYA 2ZNVB 3A33B 2N7JA 2O2VB 4EKUA 2AQ3B 4RF1A 1OQRA 1PFDA 3SU8X 3BIID 1KH0A 1JW9D 5FR6A 2DAJA 2KJRA 1N6ZA 4BKGA 1GB1A 2DZKA 1WMHA 3AE6B 1SIFA 2YLMA 4IWPA 1NENB 1AYFA 1XLQA 2PVGC 4HCNB 2FIDA 2RPVA 1L4DB 2DZMA 4HKQA 3R2IA 4KV2A 1F1HA 1V1OA 4ARIA 4ZRQA 4RFBA 3NZ3A 2ZZPB 2Z59B 2QILA 3P2BA 2RDBC 1WM3A 1WIAA 2DX5B 1C3TA 4IOIE 1EM7A 2MP2A 2PVOD 2KYWA 1FFUA 4MM3B 3GB1A 4UDUC 3DWGC 3L08A 4US8A 1I4RA 4HXDA 1RM6C 4YSYB 3ZDTA 5JH5C 4NQLB 1D5ZC 3LXFA 1PGAA 4RGOS 3QWZB 4N6EB 2Y5CA 4HVBA 4J6IA 3Q8EA 2BWES 3AV8A 3KUZA 4GB9A 4WIPA 3ZIMA 2LGXA 2NVUI 2QJLA 3O13A 3L0WB 4EUTA 2Z8LA 4GOCA 2E3TA 3N20C 5D3DA 4HPLB 3B2FA 1SEBD 3AEDB 3DCGA 3GZNI 4W9FA 3W1SA 2K5PA 3RNCC 2BYFA 3ZUNA 3AE7B 3NVYA 4FXCA 3GS2A 1E8WA 3VH3B 5E6NA 2WXJA 2V1YA 4DHZB 5C3JB 4F8CB 1VLBA 5BYQA 2K1FA 2WXNA 3D32A 3VVWB 2MW5A 2RPQA 3PHWB 2PKOA 1WE6A 1FM0D 1VZ6A 1C9FA 1JWMD 4IM0A 1KRHA 3W1YA 3V3XA 1V49A 1AW7A 3PVLA 2QC8A 1WGYA 1KJTA 1Q5WB 2KTFA 3AE4B 1WZ3A 3DHGC 1RYJA 3NHEB 4N58A 5D94A 3RT3B 2EMSA 3MC8A 4CQNA 3APFA 5H8YE 3DVGX 3UI3A 1UZXB 1XD3B 3ZKJC 2XEWA 1R4MI 3P42A 4HJKA 3ZYYX 1WZ0A 3KVFB 3PREA 1D5MC 2IPKD 2O6VA 4N59A 3LJ3A 1ZXIA 4WURA 1TYGB 2R2QA 1I42A 1JWAD 4IM2A 4KKJA 2RGFA 2WP9B 4BBNC 4YXDB 3VUYA 2L32A 1OFFA 1P7EA 2BS3B 3AE5B 2BPSA 2Y5BB 1MFWA 1XCTL 4W9KA 2J4XA 4XWWA 4JGHB 5DPWA 5HG2A 2KK8A 1ZXHA 2J42A 4B95A 2BGFA 1UGMA 3IHPC 1XCQL 3RULA 1VR9A 2FAZA 3DBHB 4CO7A 2BW2A 2GBRA 1C76A 3M63B 1N5XA 4GXBA 4TQ1A 3FILA 2BYEA 4KX6B 4WWOA 2N7EA 4A3PA 3E56A 3PZ7A 1L0VB 1V6EA 3VH4B 4MGYE 4TSSA 2KOXA 3C19A 1L0XB 3ETRA 1ENFA 2A4ZA 1ZDXA 4NAWB 3NG0A 3N30A 2WXGA 3I5JC 5L95C 3P63A 2MBOA 4HCPB 1A5RA 1XXGA 2CHZA 4ACFA 3T3OA 3HK0A 3TEWA 3W5UB 2GBJA 3A1QB 3IXSA 4ZOHC 2HE7A 1JWUD 2KMMA 2VH1A 3UQAA 3TIXA 3RNGC 1JWBD 4RH6A 3U2SC 2K6DB 2WDRB 3MJWA 4MH0E 3IAM1 1V2YA 2CHWA 1WJNA 4GN1A 4PT5A 5CHWA 3AE3B 3IVFA 3ZQ4A 1MHXA 2MRPA 4MM3A 2LVPA 5CHFA 4F7ZA 2LJ5A 1ISNA 3Q3FA 1ZUD2 2QMTA 1M4VA 2B76B 4EE2A 2MX2A 3LDZE 5D2MB 3W5VB 3N9YC 2ZW0A 2Y5PA 5E6JA 3ZTCA 4L2YA 1UBIA 2I38A 2ZVNA 4XZ4A 2KNBA 3HHMA 1L0YB 2KVRA 2V3NA 1VRAB 2PE6B 2K22A 3CMMB 2K25A 2KDBA 4HPMB 4TUUA 4JL9A 1B9RA 1KOTA 2E6XA 1JRUA 2KDFB 3H7PA 2N9KA 3NVZA 1XEEA 2KC2A 2KQ7A 5AEKB 2NR2A 3R66C 1WGGA 3NJTA 5T8IA 5FKAC 4EEWA 1WXVA 3C0RB 1GJZA 2LFIA 4NQKE 2W9NA 1HZ6A 1UWMA 2BS4B 3CSTA 4MEMA 4IWQA 1K8RB 4MACA 3AE9B 4HWIB 3ZDMC 2KMAA 2L0FA 4S0RA 2KDEB 1E5WA 2YEPF 2J0KA 3JSVA 3OAWA 1MI0A 2BVCA 3NY5A 3FKYA 1Q1OA 1R4NI 4AUQC 3B1LX 2K39A 3VHTC 2ASQA 1ZKHA 2GLSA 3I63C 4PS3A 2LASA 2JU6X 1D6EC 2LXCA 3M95A 1SF0A 4X57B 1EU4A 2M1MA 2D10A 1D4BA 2KX3A 3N3KB 4D2KA 1E0ZA 4FA6A 3PPAA 1NVID 1YMHE 4YSXB 4KIKA 1GAQB 2WQYB 2O2VA 4CHKA 2HJ8A 3DBRB 3DVGY 3JW0X 2K8BA 4YSZB 2L3ZA 2KT7A 3DVNU 1NYRA 2ICIA 2MQJA 3AB5A 4KKIA 3P4RB 1XO3A 4C7ZA 2KFKA 1JRPA 1V5TA 2KDMA 3LYYA 3A9JB 1YJJA 4ZYSA 1SJED 3PRPB 3BYTB 2DLBA 2WXHA 2X38A 4WWMA 1P1AA 4NJ7A 4OVVA 4WWNA 3PSEB 2M8SA 1PQSA 1E7PB 2OJWA 1YN5A 3R7QA 2ZPYA 3BVMA 1GC6A 4TQ0A 2PTLA 3LB8C 4JIOU 1F0ZA 4I6NB 2MLBA 3VUXA 2IO1B 1XLPA 2N1WA 4YL8A 2WXQA 2LRUA 5CTRC 5BO4B 4KSKC 1AN8A 1TKGA 3DBSA 2N4FA 1SE3A 4ZRPA 3WANA 3TMPB 1E8YA 3KW5B 1AARA 3DHIC 2BKRB 1MG4A 3K9OB 1YOVB 3V62A
chains in the Genus database with same CATH topology
3H7PB 4TKNA 1WX7A 2AEHA 3QWZB 2BYVE 4HVBA 5G55A 3HM6X 3V61A 4J6IA 3L17A 4W9IA 3V6CB 4BKTA 2BWES 2WYQA 2L8JA 1QZEA 2FIFA 3KUZA 4GB9A 3ZNZB 3JYUA 2IO2B 3ZIMA 2LGXA 3IBEA 2NVUI 3PLUA 1P9DU 2XK5A 3L0WB 1YQBA 2AYOB 3UGBB 3HIZA 4EUTA 4GOCA 5AZHA 1Q0WB 1IPGA 3V6EB 2MBBB 2IO0B 1RLFA 1OTRB 1WI0A 5E6OA 1P98A 2MWSB 4HPLB 2C60A 3DCGA 3GZNI 3W1SA 4W9FA 2KQSA 4ICUA 3ZW3A 1OEYJ 4NY0A 3TBLD 2BYFA 3AXCA 1OQYA 2J0MA 4KZCA 2DHZA 1YX6B 3ZUNA 2KN5A 1EO6A 2KFKB 3VXWA 5IAAC 1SGHA 5D7GA 2AL6A 4JQWC 4ANUA 1E8WA 5DPSA 3VH3B 1YD8U 5E6NA 3V60A 2V1YA 4DHZB 4RMAA 1FXTB 1E7VA 2DENB 4F8CB 3ZTDA 3IFWB 2K1FA 3B08A 3KUDB 4DHZE 3D32A 2L76A 3AI5A 3VVWB 3EECA 3QIJA 2MW5A 2RPQA 3B0AA 3PHXB 4WWPA 4B6WA 4G0NB 4HDOA 3PHWB 3PRZA 4FJVB 2M17A 1WE6A 3JVZX 4BKSD 1EF5A 4IWOA 1V5OA 4ICVA 2V4LA 1LM8B 2DYMA 2JWZA 2KANA 2O6VD 4IM0A 4URKA 3W1YA 4RM8A 1V49A 1V80A 4MGZE 4A3OA 3PVLA 2JUOA 4P7IA 4W9CA 1WGYA 3T9LA 3ZRCA 1T0YA 5C23A 1KJTA 2G4SA 1Q5WB 2KTFA 2MBQA 2GBMA 3RUIB 1WZ3A 2KKCA 3NHEB 1L7YA 3RT3B 5D94A 3WIMA 2EMSA 1ZW7A 3WAOA 1TBEA 3APFA 2KXJA 3X23A 4RM9A 3DVGX 4IC7B 2XBBC 4IUMB 1UZXB 1XD3B 3ZKJC 1J0GA 2N1VA 1M94A 2XEWA 3WAPA 3AU4A 3UINB 1R4MI 1WY8A 2M0XA 2WX1A 2V3SA 1NBFC 4HJKA 2CS4A 3CF6E 1WZ0A 1LFDA 3KVFB 4KIKB 3RZFA 3PREA 4G50A 4E3CA 2PJHA 4A20A 2CHXA 2LZ6A 1D3ZA 4FHKA 2O6VA 2VRRB 3LJ3A 3X0WA 4FULA 3H1UA 1I42A 2R2QA 4IM2A 2WX0A 4M0WB 1WR1A 2RGFA 4K1RB 3ONSA 2DYBA 4CYEA 2KHWB 3MTNB 4MSQB 4N9F4 4BBNC 2PEAA 3H9DA 3VUYA 3QCAA 1UD7A 4WJPA 1EUVB 2BKFA 4FADA 5TR5A 2MBEA 2NBVB 1WE7A 4FJZA 2MCNB 1P0RA 3ZO5B 4GDLB 2BPSA 2EKEC 2Y5BB 4MJSB 3SD5A 1WRDB 4W9KA 1J8CA 5J2RA 3KUCB 2A5UA 4DK5A 2KC1A 2LWPA 2G45B 4M8MA 5CX3A 3DPDA 5HKHA 2NPTB 1SE9A 4JGHB 2KLCA 2LGYA 3NS8A 4LJOB 5DPWA 1RRBA 3KH0A 3S2AA 1TGZB 2JZ3B 3L13A 2M4NA 4AJWA 5AZFA 4F1SA 2KK8A 1RAXA 1Z5SB 3PT2B 4B95A 2BF8B 3QJZA 3UIPB 2J0JA 2BGFA 4W9EA 2FUHB 1YIWA 1UGMA 3JSVB 4MELA 3IHPC 2MA9B 3OLMD 3RULA 2KDIA 2FAZA 3ZNGC 4W9DA 1IP9A 2LVOA 4ANWA 3VTWA 4CO7A 5JZEB 2GBRA 2IO3B 1P3QU 4LCDE 1GG3A 4BBNF 5KHOA 3M63B 3W1SC 2C7HA 2GBKA 4GXBA 2GMIC 2KWVB 4TQ1A 2JRIB 2BYEA 3WA0A 2HTHA 5JHAA 4WWOA 4DWFA 2KTRB 2N7EA 3Q3JA 2LD9A 2D07B 3QX1A 4ZRIA 4AOFA 3VDZA 3ALBA 2JF5A 1HE8A 4A3PA 2HD5B 4MGKE 1V6EA 3VH4B 4MGYE 3ML9A 2KOXA 3DBHI 1V9JA 2QHOA 5EDSA 3DDCB 2A4ZA 4EZLA 2L0TA 5IA7A 3R7RA 3RZWC 3H6NA 4NAWB 4ZDVA 4NJ6A 2D11A 3N30A 3SHQA 1E8XA 5L95C 2MBOA 2FCNA 4HCPB 1A5RA 3DVNV 3GOEA 2CHZA 4K7WA 3OJ4B 3K9PB 1WGRA 2KX0A 3HK0A 3KYCD 4TV3A 3RCZA 4FBJB 3VUWA 2GBJA 1CMXB 3A1QB 1WJUA 2HE7A 2REXA 3PZDA 1H4RA 2ZVOA 3NZSA 3UQAA 2NS5A 4MSMB 3SDLC 3L54A 3TIXA 1NI2A 2KWCA 3A9JA 2OOBB 4GGQA 1WH3A 2JRHA 1UBQA 1MG8A 5DPRA 2FNJB 2K6DB 3AULA 1BT0A 2Z0DB 3MJWA 1J19A 2UWQA 4MH0E 2CU1A 2N9XA 1Y8RC 2C7NB 3QARA 1L2NA 1V2YA 2CHWA 1WXSA 1WJNA 5GMVA 4GN1A 3PLVA 5CHWA 2BWFA 3IVFA 2JT4B 4GDKA 1S3SG 4GIVA 2KO3A 2NBUA 2C7MB 3A1QA 3ML8A 3EHVA 4WQOB 3TCAA 3A9KB 2MRPA 2CKHB 3DBLI 2ZEQA 2DAFA 4AWJA 4G11A 1TZ1A 1V86A 3WALA 4HLEA 3BINA 1NDDA 3QHTA 3ZNID 4DDID 4MM3A 2JZZA 2LVPA 4LDTD 5CHFA 2LGDA 4F7ZA 1S1QB 2LJ5A 2L00B 1ISNA 2I1JA 4JLCA 4EOYA 3Q3FA 2KD0A 4K81A 4G3XB 2RD0A 1UELA 3DBRI 2J7QB 2MX2A 4GU2A 2G4DB 2L7RA 4I6LB 3LDZE 4MDKE 4PS7A 5D2MB 2NPTA 1TTNA 4KZ0A 4OVUA 2MSED 3ZTCA 4KVGB 2ZJDA 1UBIA 2NBWB 3VAWA 4DHJB 5AZGA 1E90A 2ZVNA 4XZ4A 2KNBA 2N9EB 3ZRFA 1WX8A 3HHMA 3VTVA 2KVRA 2MP2B 2PE6B 1WFYA 3CMMB 2C9WB 4W9GA 5LLIA 5LXHA 4DDGD 2K25A 2IBIB 4FHJA 3ECIA 4M8NA 3WAMA 4B9KA 2KDBA 4HPMB 4TUUA 4JL9A 2AWTA 3APCA 3M62B 5DPTA 4NNJB 4BFRA 1WR6E 2G3QB 3U8ZA 4PYZA 2PPHA 1KOTA 1YX5B 4ZRKA 1JRUA 5J18A 1UH6A 4E71A 2KDFB 3H7PA 1WGHA 2NCNA 3APDA 3T8MA 3EFUA 2D3GA 3PV1A 1RFAA 1XQQA 2KC2A 2KQ7A 2KJHB 4K7SA 3PS6A 2NR2A 5AEKB 3R66C 1WGGA 2PE9A 4MJSA 4EEWA 1WXVA 3C0RB 4HK2A 1GJZA 3ZLZA 2R2OA 2W9NA 3M3JA 4NQKE 3CSTA 2LXAA 4MEMA 4FJYA 4IWQA 1K8RB 3VQIA 1WJ4A 3QK0A 3ZVVA 1GNUA 3ZDMC 4HWIB 3HM3A 4BKSA 4DHJD 2KMAA 2L0FA 3TJPA 3CSFA 3PTFC 1X1MA 1E8ZA 2AL3A 2IZVB 3QAQA 4FN2A 2KDEB 2GOWA 4EFOA 2LRWA 1E5WA 2J0KA 3EC8A 1GUAB 3JSVA 4GSWA 3OAWA 3U30A 4XC2A 4MGIE 4BOZB 2JVCA 1V81A 3NY5A 1Q1OA 1R4NI 1F9JA 4AUQC 2LUEA 5CHVC 3B1LX 2K39A 3TL5A 2D2QA 3VHTC 2ASQA 4PS8A 1ZKHA 3QQ8B 4EZJA 4PS3A 2LASA 5L83A 1OGWA 4LDTB 2LXCA 2WDTB 2YVCA 3AU5A 3IG3A 4FLHA 1OEYA 3M95A 2KTRA 2JXXA 2RSUA 4X57B 2Z0EB 2ZCBA 4E74A 4GMVA 2JY6A 2M1MA 2K6QA 3A4RA 2D10A 2KX3A 2KJ6A 2KZRA 2OJRA 3N3KB 2K8CA 4FA6A 1IYFA 3PPAA 1WXAA 4KDIC 2FCMA 2WWZA 5C1ZA 4WJNA 1Z2MA 4KIKA 4AP4C 5D6JB 3H7SA 4KDLB 2EMTA 2XK5B 4W9HA 2O2VA 4CHKA 1KM7A 4NAWA 1EF1A 3NOBA 2HJ8A 4W9JA 3DVGY 3VTUA 3JW0X 2K8BA 1WM2A 4II2B 4WJQA 2ZPNA 3KYDD 2KFJA 2L3ZA 3DVNU 5JHBA 3L10B 4HDQA 4WAAA 3OJ3A 1WXMA 4I6PA 1G6JA 1LQBA 1ZGUB 1U4AA 2MQJA 1XT9B 2FCQA 1WMHB 2GBNA 4AJYB 4DBGA 3DQVA 3ZNHB 3U7DA 2B3AA 3DOWA 3QC8B 2KFKA 1V5TA 3RD2A 4ANXA 1I35A 3A9JB 2DZJA 1KLVA 1WGDA 2CR5A 3UQBA 2UYZB 3PRPB 2I1KA 4ASWC 5J17A 2IY0B 2ZNVB 1P1AA 3A33B 4GDLA 4NJ7A 3PRMB 2O2VB 2N9PC 4OVVA 5E6PA 3I3TB 4II3B 3PSEB 4WWNA 4EKUA 3ENEA 3O65B 2M8SA 1PQSA 3R3MA 1WYWB 1YJ1A 4ZYNA 3SU8X 1WX9A 3R7QA 4NPNA 2ZPYA 5FR6A 2DAJA 2KJRA 2K8HA 4IM3A 1GC6A 4BKGA 4GDKB 4TQ0A 2DZKA 3VFKA 1WMHA 1SIFA 3UF8A 2YLMA 2ZCCA 2DYOA 5KHQA 3NZUA 4KSLC 4JIOU 2JPHA 4IWPA 1E7UA 4BOSC 3MHSD 4I6NB 4LJPB 2C5LC 2MLBA 1WF9A 5G2NA 2LI5A 3QA8A 4HCNB 3VUXA 1WJ6A 2FIDA 2IO1B 3N32A 1H8CA 4IW0A 4WJOA 2N1WA 4IG7B 4YL8A 3UIOB 2KWUB 4ANVA 2DZMA 4W9LA 4ZRJA 2DZIA 4KV2A 2LVQA 2IY1B 4DXAB 2LRUA 4XX5A 5CTRC 2ZZPB 2Z59B 4EZKA 5BO4B 2ZNVC 3BY4B 3P2BA 4KSKC 5LXIB 1GC7A 2KLGA 1LXDA 1WM3A 1WIAA 2DX5B 3A9KA 3PGEA 3DBSA 1C3TA 4K7UA 2MP2A 2N4FA 3WANA 3A4SC 2N7DA 3TMPB 1VCBA 2FCSA 5DCNA 3L16A 1E8YA 4BVUC 2O6VB 3KW5B 3RYTA 2RR9A 1AARA 3L08A 2BKRB 2L05A 2MBHA 4HXDA 3ZDTA 3K9OB 5JH5C 1C1YB 4NQLB 2KMCA 4PYUA 2IYDB 3V62A 1VD2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H7P B;  4TKN A;  1WX7 A;  2AEH A;  3QWZ B;  2BYV E;  4HVB A;  5G55 A;  3HM6 X;  3V61 A;  4J6I A;  3L17 A;  4W9I A;  3V6C B;  4BKT A;  2BWE S;  2WYQ A;  2L8J A;  1QZE A;  2FIF A;  3KUZ A;  4GB9 A;  3ZNZ B;  3JYU A;  2IO2 B;  3ZIM A;  2LGX A;  3IBE A;  2NVU I;  3PLU A;  1P9D U;  2XK5 A;  3L0W B;  1YQB A;  2AYO B;  3UGB B;  3HIZ A;  4EUT A;  4GOC A;  5AZH A;  1Q0W B;  1IPG A;  3V6E B;  2MBB B;  2IO0 B;  1RLF A;  1OTR B;  1WI0 A;  5E6O A;  1P98 A;  2MWS B;  4HPL B;  2C60 A;  3DCG A;  3GZN I;  3W1S A;  4W9F A;  2KQS A;  4ICU A;  3ZW3 A;  1OEY J;  4NY0 A;  3TBL D;  2BYF A;  3AXC A;  1OQY A;  2J0M A;  4KZC A;  2DHZ A;  1YX6 B;  3ZUN A;  2KN5 A;  1EO6 A;  2KFK B;  3VXW A;  5IAA C;  1SGH A;  5D7G A;  2AL6 A;  4JQW C;  4ANU A;  1E8W A;  5DPS A;  3VH3 B;  1YD8 U;  5E6N A;  3V60 A;  2V1Y A;  4DHZ B;  4RMA A;  1FXT B;  1E7V A;  2DEN B;  4F8C B;  3ZTD A;  3IFW B;  2K1F A;  3B08 A;  3KUD B;  4DHZ E;  3D32 A;  2L76 A;  3AI5 A;  3VVW B;  3EEC A;  3QIJ A;  2MW5 A;  2RPQ A;  3B0A A;  3PHX B;  4WWP A;  4B6W A;  4G0N B;  4HDO A;  3PHW B;  3PRZ A;  4FJV B;  2M17 A;  1WE6 A;  3JVZ X;  4BKS D;  1EF5 A;  4IWO A;  1V5O A;  4ICV A;  2V4L A;  1LM8 B;  2DYM A;  2JWZ A;  2KAN A;  2O6V D;  4IM0 A;  4URK A;  3W1Y A;  4RM8 A;  1V49 A;  1V80 A;  4MGZ E;  4A3O A;  3PVL A;  2JUO A;  4P7I A;  4W9C A;  1WGY A;  3T9L A;  3ZRC A;  1T0Y A;  5C23 A;  1KJT A;  2G4S A;  1Q5W B;  2KTF A;  2MBQ A;  2GBM A;  3RUI B;  1WZ3 A;  2KKC A;  3NHE B;  1L7Y A;  3RT3 B;  5D94 A;  3WIM A;  2EMS A;  1ZW7 A;  3WAO A;  1TBE A;  3APF A;  2KXJ A;  3X23 A;  4RM9 A;  3DVG X;  4IC7 B;  2XBB C;  4IUM B;  1UZX B;  1XD3 B;  3ZKJ C;  1J0G A;  2N1V A;  1M94 A;  2XEW A;  3WAP A;  3AU4 A;  3UIN B;  1R4M I;  1WY8 A;  2M0X A;  2WX1 A;  2V3S A;  1NBF C;  4HJK A;  2CS4 A;  3CF6 E;  1WZ0 A;  1LFD A;  3KVF B;  4KIK B;  3RZF A;  3PRE A;  4G50 A;  4E3C A;  2PJH A;  4A20 A;  2CHX A;  2LZ6 A;  1D3Z A;  4FHK A;  2O6V A;  2VRR B;  3LJ3 A;  3X0W A;  4FUL A;  3H1U A;  1I42 A;  2R2Q A;  4IM2 A;  2WX0 A;  4M0W B;  1WR1 A;  2RGF A;  4K1R B;  3ONS A;  2DYB A;  4CYE A;  2KHW B;  3MTN B;  4MSQ B;  4N9F 4;  4BBN C;  2PEA A;  3H9D A;  3VUY A;  3QCA A;  1UD7 A;  4WJP A;  1EUV B;  2BKF A;  4FAD A;  5TR5 A;  2MBE A;  2NBV B;  1WE7 A;  4FJZ A;  2MCN B;  1P0R A;  3ZO5 B;  4GDL B;  2BPS A;  2EKE C;  2Y5B B;  4MJS B;  3SD5 A;  1WRD B;  4W9K A;  1J8C A;  5J2R A;  3KUC B;  2A5U A;  4DK5 A;  2KC1 A;  2LWP A;  2G45 B;  4M8M A;  5CX3 A;  3DPD A;  5HKH A;  2NPT B;  1SE9 A;  4JGH B;  2KLC A;  2LGY A;  3NS8 A;  4LJO B;  5DPW A;  1RRB A;  3KH0 A;  3S2A A;  1TGZ B;  2JZ3 B;  3L13 A;  2M4N A;  4AJW A;  5AZF A;  4F1S A;  2KK8 A;  1RAX A;  1Z5S B;  3PT2 B;  4B95 A;  2BF8 B;  3QJZ A;  3UIP B;  2J0J A;  2BGF A;  4W9E A;  2FUH B;  1YIW A;  1UGM A;  3JSV B;  4MEL A;  3IHP C;  2MA9 B;  3OLM D;  3RUL A;  2KDI A;  2FAZ A;  3ZNG C;  4W9D A;  1IP9 A;  2LVO A;  4ANW A;  3VTW A;  4CO7 A;  5JZE B;  2GBR A;  2IO3 B;  1P3Q U;  4LCD E;  1GG3 A;  4BBN F;  5KHO A;  3M63 B;  3W1S C;  2C7H A;  2GBK A;  4GXB A;  2GMI C;  2KWV B;  4TQ1 A;  2JRI B;  2BYE A;  3WA0 A;  2HTH A;  5JHA A;  4WWO A;  4DWF A;  2KTR B;  2N7E A;  3Q3J A;  2LD9 A;  2D07 B;  3QX1 A;  4ZRI A;  4AOF A;  3VDZ A;  3ALB A;  2JF5 A;  1HE8 A;  4A3P A;  2HD5 B;  4MGK E;  1V6E A;  3VH4 B;  4MGY E;  3ML9 A;  2KOX A;  3DBH I;  1V9J A;  2QHO A;  5EDS A;  3DDC B;  2A4Z A;  4EZL A;  2L0T A;  5IA7 A;  3R7R A;  3RZW C;  3H6N A;  4NAW B;  4ZDV A;  4NJ6 A;  2D11 A;  3N30 A;  3SHQ A;  1E8X A;  5L95 C;  2MBO A;  2FCN A;  4HCP B;  1A5R A;  3DVN V;  3GOE A;  2CHZ A;  4K7W A;  3OJ4 B;  3K9P B;  1WGR A;  2KX0 A;  3HK0 A;  3KYC D;  4TV3 A;  3RCZ A;  4FBJ B;  3VUW A;  2GBJ A;  1CMX B;  3A1Q B;  1WJU A;  2HE7 A;  2REX A;  3PZD A;  1H4R A;  2ZVO A;  3NZS A;  3UQA A;  2NS5 A;  4MSM B;  3SDL C;  3L54 A;  3TIX A;  1NI2 A;  2KWC A;  3A9J A;  2OOB B;  4GGQ A;  1WH3 A;  2JRH A;  1UBQ A;  1MG8 A;  5DPR A;  2FNJ B;  2K6D B;  3AUL A;  1BT0 A;  2Z0D B;  3MJW A;  1J19 A;  2UWQ A;  4MH0 E;  2CU1 A;  2N9X A;  1Y8R C;  2C7N B;  3QAR A;  1L2N A;  1V2Y A;  2CHW A;  1WXS A;  1WJN A;  5GMV A;  4GN1 A;  3PLV A;  5CHW A;  2BWF A;  3IVF A;  2JT4 B;  4GDK A;  1S3S G;  4GIV A;  2KO3 A;  2NBU A;  2C7M B;  3A1Q A;  3ML8 A;  3EHV A;  4WQO B;  3TCA A;  3A9K B;  2MRP A;  2CKH B;  3DBL I;  2ZEQ A;  2DAF A;  4AWJ A;  4G11 A;  1TZ1 A;  1V86 A;  3WAL A;  4HLE A;  3BIN A;  1NDD A;  3QHT A;  3ZNI D;  4DDI D;  4MM3 A;  2JZZ A;  2LVP A;  4LDT D;  5CHF A;  2LGD A;  4F7Z A;  1S1Q B;  2LJ5 A;  2L00 B;  1ISN A;  2I1J A;  4JLC A;  4EOY A;  3Q3F A;  2KD0 A;  4K81 A;  4G3X B;  2RD0 A;  1UEL A;  3DBR I;  2J7Q B;  2MX2 A;  4GU2 A;  2G4D B;  2L7R A;  4I6L B;  3LDZ E;  4MDK E;  4PS7 A;  5D2M B;  2NPT A;  1TTN A;  4KZ0 A;  4OVU A;  2MSE D;  3ZTC A;  4KVG B;  2ZJD A;  1UBI A;  2NBW B;  3VAW A;  4DHJ B;  5AZG A;  1E90 A;  2ZVN A;  4XZ4 A;  2KNB A;  2N9E B;  3ZRF A;  1WX8 A;  3HHM A;  3VTV A;  2KVR A;  2MP2 B;  2PE6 B;  1WFY A;  3CMM B;  2C9W B;  4W9G A;  5LLI A;  5LXH A;  4DDG D;  2K25 A;  2IBI B;  4FHJ A;  3ECI A;  4M8N A;  3WAM A;  4B9K A;  2KDB A;  4HPM B;  4TUU A;  4JL9 A;  2AWT A;  3APC A;  3M62 B;  5DPT A;  4NNJ B;  4BFR A;  1WR6 E;  2G3Q B;  3U8Z A;  4PYZ A;  2PPH A;  1KOT A;  1YX5 B;  4ZRK A;  1JRU A;  5J18 A;  1UH6 A;  4E71 A;  2KDF B;  3H7P A;  1WGH A;  2NCN A;  3APD A;  3T8M A;  3EFU A;  2D3G A;  3PV1 A;  1RFA A;  1XQQ A;  2KC2 A;  2KQ7 A;  2KJH B;  4K7S A;  3PS6 A;  2NR2 A;  5AEK B;  3R66 C;  1WGG A;  2PE9 A;  4MJS A;  4EEW A;  1WXV A;  3C0R B;  4HK2 A;  1GJZ A;  3ZLZ A;  2R2O A;  2W9N A;  3M3J A;  4NQK E;  3CST A;  2LXA A;  4MEM A;  4FJY A;  4IWQ A;  1K8R B;  3VQI A;  1WJ4 A;  3QK0 A;  3ZVV A;  1GNU A;  3ZDM C;  4HWI B;  3HM3 A;  4BKS A;  4DHJ D;  2KMA A;  2L0F A;  3TJP A;  3CSF A;  3PTF C;  1X1M A;  1E8Z A;  2AL3 A;  2IZV B;  3QAQ A;  4FN2 A;  2KDE B;  2GOW A;  4EFO A;  2LRW A;  1E5W A;  2J0K A;  3EC8 A;  1GUA B;  3JSV A;  4GSW A;  3OAW A;  3U30 A;  4XC2 A;  4MGI E;  4BOZ B;  2JVC A;  1V81 A;  3NY5 A;  1Q1O A;  1R4N I;  1F9J A;  4AUQ C;  2LUE A;  5CHV C;  3B1L X;  2K39 A;  3TL5 A;  2D2Q A;  3VHT C;  2ASQ A;  4PS8 A;  1ZKH A;  3QQ8 B;  4EZJ A;  4PS3 A;  2LAS A;  5L83 A;  1OGW A;  4LDT B;  2LXC A;  2WDT B;  2YVC A;  3AU5 A;  3IG3 A;  4FLH A;  1OEY A;  3M95 A;  2KTR A;  2JXX A;  2RSU A;  4X57 B;  2Z0E B;  2ZCB A;  4E74 A;  4GMV A;  2JY6 A;  2M1M A;  2K6Q A;  3A4R A;  2D10 A;  2KX3 A;  2KJ6 A;  2KZR A;  2OJR A;  3N3K B;  2K8C A;  4FA6 A;  1IYF A;  3PPA A;  1WXA A;  4KDI C;  2FCM A;  2WWZ A;  5C1Z A;  4WJN A;  1Z2M A;  4KIK A;  4AP4 C;  5D6J B;  3H7S A;  4KDL B;  2EMT A;  2XK5 B;  4W9H A;  2O2V A;  4CHK A;  1KM7 A;  4NAW A;  1EF1 A;  3NOB A;  2HJ8 A;  4W9J A;  3DVG Y;  3VTU A;  3JW0 X;  2K8B A;  1WM2 A;  4II2 B;  4WJQ A;  2ZPN A;  3KYD D;  2KFJ A;  2L3Z A;  3DVN U;  5JHB A;  3L10 B;  4HDQ A;  4WAA A;  3OJ3 A;  1WXM A;  4I6P A;  1G6J A;  1LQB A;  1ZGU B;  1U4A A;  2MQJ A;  1XT9 B;  2FCQ A;  1WMH B;  2GBN A;  4AJY B;  4DBG A;  3DQV A;  3ZNH B;  3U7D A;  2B3A A;  3DOW A;  3QC8 B;  2KFK A;  1V5T A;  3RD2 A;  4ANX A;  1I35 A;  3A9J B;  2DZJ A;  1KLV A;  1WGD A;  2CR5 A;  3UQB A;  2UYZ B;  3PRP B;  2I1K A;  4ASW C;  5J17 A;  2IY0 B;  2ZNV B;  1P1A A;  3A33 B;  4GDL A;  4NJ7 A;  3PRM B;  2O2V B;  2N9P C;  4OVV A;  5E6P A;  3I3T B;  4II3 B;  3PSE B;  4WWN A;  4EKU A;  3ENE A;  3O65 B;  2M8S A;  1PQS A;  3R3M A;  1WYW B;  1YJ1 A;  4ZYN A;  3SU8 X;  1WX9 A;  3R7Q A;  4NPN A;  2ZPY A;  5FR6 A;  2DAJ A;  2KJR A;  2K8H A;  4IM3 A;  1GC6 A;  4BKG A;  4GDK B;  4TQ0 A;  2DZK A;  3VFK A;  1WMH A;  1SIF A;  3UF8 A;  2YLM A;  2ZCC A;  2DYO A;  5KHQ A;  3NZU A;  4KSL C;  4JIO U;  2JPH A;  4IWP A;  1E7U A;  4BOS C;  3MHS D;  4I6N B;  4LJP B;  2C5L C;  2MLB A;  1WF9 A;  5G2N A;  2LI5 A;  3QA8 A;  4HCN B;  3VUX A;  1WJ6 A;  2FID A;  2IO1 B;  3N32 A;  1H8C A;  4IW0 A;  4WJO A;  2N1W A;  4IG7 B;  4YL8 A;  3UIO B;  2KWU B;  4ANV A;  2DZM A;  4W9L A;  4ZRJ A;  2DZI A;  4KV2 A;  2LVQ A;  2IY1 B;  4DXA B;  2LRU A;  4XX5 A;  5CTR C;  2ZZP B;  2Z59 B;  4EZK A;  5BO4 B;  2ZNV C;  3BY4 B;  3P2B A;  4KSK C;  5LXI B;  1GC7 A;  2KLG A;  1LXD A;  1WM3 A;  1WIA A;  2DX5 B;  3A9K A;  3PGE A;  3DBS A;  1C3T A;  4K7U A;  2MP2 A;  2N4F A;  3WAN A;  3A4S C;  2N7D A;  3TMP B;  1VCB A;  2FCS A;  5DCN A;  3L16 A;  1E8Y A;  4BVU C;  2O6V B;  3KW5 B;  3RYT A;  2RR9 A;  1AAR A;  3L08 A;  2BKR B;  2L05 A;  2MBH A;  4HXD A;  3ZDT A;  3K9O B;  5JH5 C;  1C1Y B;  4NQL B;  2KMC A;  4PYU A;  2IYD B;  3V62 A;  1VD2 A; 
#chains in the Genus database with same CATH topology
 2G1E A;  4JPS A;  4OZA A;  1FCL A;  2AEH A;  2BYV E;  5G55 A;  3HM6 X;  1HZ5 A;  3OWE B;  4W9I A;  3V6C B;  1F2R I;  2L8J A;  2FIF A;  1FXI A;  5TSS A;  1QQR A;  4ZHP A;  1HXY D;  4LTU A;  2XK5 A;  3V05 A;  3UGB B;  2JWU A;  5AZH A;  2IO0 B;  1RLF A;  3MJ5 A;  1OTR B;  1WI0 A;  1E9M A;  1FNV A;  1P98 A;  3Q2A C;  2MWS B;  1DOX A;  1FRD A;  2C60 A;  1HQR D;  2KQS A;  5EE9 A;  3TBL D;  2PMV A;  3N1Y C;  1OQY A;  1FCC C;  2J0M A;  3DBL B;  3P1M A;  1NI3 A;  4KGT A;  4IDI A;  3EUB 2;  3AEF B;  2W55 A;  3ZXV A;  4ANU A;  1N61 A;  1YD8 U;  1WGK A;  1NYQ A;  3V60 A;  4RMA A;  1FD6 A;  1E7V A;  1IBX B;  4YTN B;  1CQV A;  5JXV A;  2KVZ A;  3BVZ A;  3PRZ A;  2M17 A;  3JVZ X;  1V5O A;  4JWS C;  1EWC A;  1LM8 B;  2DYM A;  2KAN A;  4URK A;  1K52 A;  4RM8 A;  1V80 A;  4MGZ E;  1FXA A;  4RGN A;  1I4P A;  1C4C A;  5IP4 D;  2GBM A;  4M02 A;  2Q5W D;  2BS2 B;  1ZW7 A;  4IC7 B;  2XBB C;  2MJ3 A;  1C4P A;  1J0G A;  3PO0 A;  2IJ0 A;  2EEL A;  1HTQ A;  4TMA B;  1YNT E;  2N9L A;  1I7H A;  1LFD A;  4KIK B;  3RZF A;  3EFC A;  4G50 A;  4A20 A;  4BAX A;  3X0W A;  3N1Z C;  1N60 A;  3ONS A;  1XF5 L;  4YWG G;  1UGJ A;  4N9F 4;  2PEA A;  3QCA A;  4WJP A;  1GB4 A;  5TR5 A;  1BUI C;  1P0R A;  3ZO5 B;  1AWD A;  4B0E A;  3KUC B;  2KC1 A;  4M8M A;  2G45 B;  5CX3 A;  2JYE A;  2NPT B;  2KLC A;  1SBB B;  2JZ3 B;  3L13 A;  2M4N A;  4AJW A;  5AZF A;  3Q69 A;  1DYQ A;  1TS4 A;  4NJC A;  4B0M A;  4DQO C;  1JCK B;  3ZNG C;  4W9D A;  2LVO A;  4KGR A;  1KLU D;  2IO3 B;  1P3Q U;  1GG3 A;  3MHZ A;  3W1S C;  2WDQ B;  2GBK A;  3VRA B;  1HA5 A;  3WA0 A;  1FIQ A;  2WXI A;  5JHA A;  1UUP A;  2QSD A;  2KTR B;  4DXF A;  2LD9 A;  3QX1 A;  3NS1 A;  4ZRI A;  4DXG A;  3ALB A;  1HE8 A;  2D5G A;  2AQ1 B;  2UU7 A;  1V9J A;  2WXF A;  2QHO A;  3AMZ A;  4EZL A;  3RZW C;  4ZDV A;  2D11 A;  1IGD A;  2BB5 A;  2LHE A;  2WLB A;  3GOE A;  4K7W A;  5BMG A;  3K9P B;  1WGR A;  5IO9 A;  1QOB A;  3B9J A;  2REX A;  4S17 A;  4OVZ A;  1NI2 A;  2OOB B;  4GGQ A;  2JRH A;  2SAK A;  5DPR A;  1F77 A;  4XDD A;  1BT0 A;  3J9C A;  2HTM E;  2Z0D B;  2WXK A;  1T0S C;  5FK9 C;  3RNE C;  2CU1 A;  2N9X A;  1Y8R C;  4ZHO A;  1JQ4 A;  1L2N A;  1WXS A;  5GMV A;  1MHH E;  4GIV A;  2KO3 A;  2NBU A;  3EHV A;  1PDX A;  2DAF A;  4G11 A;  3WAL A;  4HLE A;  2W54 A;  3QHT A;  3Q6B A;  2JZZ A;  1EWY C;  5HI1 A;  2LGD A;  1S1Q B;  2I1J A;  4WAF A;  1R4M B;  1UEL A;  3DBR I;  3U4E G;  2L7R A;  4I6L B;  4PS7 A;  2WS3 B;  4KVG B;  3VAW A;  4DHJ B;  1E90 A;  2N9E B;  1WXQ A;  3PZ8 A;  1VZ8 A;  2K0P A;  5LXH A;  4DDG D;  4M8N A;  3ECI A;  2ON8 A;  3WAM A;  3EA6 A;  5EE1 A;  2PPH A;  1YX5 B;  4ZRK A;  4HPP A;  2ONQ A;  3NVW A;  3NRZ A;  4NZL B;  1MPE A;  4BZA A;  2KJH B;  3PS6 A;  3TEX A;  2PE9 A;  4MJS A;  1ZPS A;  2K3U A;  1LGR A;  1WWT A;  3ZLZ A;  3M3J A;  2WU2 B;  3AEG B;  1FRR A;  1YJI A;  3ZVV A;  4YTP B;  4BKS A;  1L6U A;  1X1M A;  1E8Z A;  2AL3 A;  2IZV B;  2I2Y A;  4GSW A;  3EC8 A;  2JVC A;  1VJK A;  2LUE A;  2INP E;  3DWM A;  4QAY A;  2VZK D;  3EGR A;  5L83 A;  3FAH A;  1OEY A;  2RSU A;  4E74 A;  2DWQ A;  2KJ6 A;  1IYF A;  2V0G A;  2WWZ A;  4WJN A;  1L4Z B;  1Z2M A;  1TY2 A;  4AP4 C;  2BTE A;  3H7S A;  4HJG E;  1KM7 A;  4NAW A;  1K51 A;  3NOB A;  4W9J A;  2BB6 A;  1WM2 A;  4GLS C;  5JHB A;  2FE8 A;  3L10 B;  1LQB A;  2INN E;  2BT6 A;  4AJY B;  1UF0 A;  4LLG M;  1I35 A;  1WGD A;  4ASW C;  1XLO A;  3PRM B;  3Q8A A;  2IGG A;  3I3T B;  5E6P A;  3Q14 C;  4II3 B;  4LNI A;  2TSS A;  4WQM A;  3AM9 A;  3O65 B;  3R3M A;  4C00 A;  1ZOY B;  2AX5 A;  3U7Z A;  1YJ1 A;  4ZYN A;  3SFD B;  1LO5 D;  1RWS A;  4GDK B;  4OZC A;  1VDV A;  4MT5 A;  3UF8 A;  3AEE B;  2ZCC A;  1FEH A;  4KSL C;  2JPH A;  1E7U A;  2D3B A;  1L5P A;  2LGS A;  1WF9 A;  5G2N A;  1QOG A;  3QA8 A;  1H8C A;  1WJ6 A;  3N32 A;  4C7Y A;  4WJO A;  1N62 A;  4IG7 B;  2KN4 A;  3UIO B;  4ZRJ A;  3RI7 C;  2IY1 B;  3IT4 B;  2H89 B;  3KLS X;  4XX5 A;  2V9H A;  4EZK A;  2H88 B;  3BY4 B;  1CZP A;  1GC7 A;  2SEB D;  3OG5 A;  3A9K A;  1TKE A;  2FCS A;  5DCN A;  4LNK A;  1CJE A;  4WH4 A;  4BVU C;  1C79 A;  3RYT A;  2RR9 A;  2L05 A;  2MBH A;  1C1Y B;  4OHJ A;  2IYD B;  1VD2 A;  4K3B A;  3AEA B;  4RCO A;  2K9X A;  3MFG A;  4O1N A;  5BYR A;  3IBE A;  3PLU A;  1P9D U;  3HIZ A;  3V6E B;  1TIF A;  4A9A A;  4XYC A;  2QEJ C;  5E6O A;  1D5X C;  1BML C;  1HTO A;  1WSP A;  1OEY J;  1C78 A;  4NY0 A;  4C56 C;  5EE3 A;  4KZC A;  1J7A A;  2DHZ A;  2L83 A;  2RMM A;  1C77 A;  1EO6 A;  3E9S A;  1NEK B;  3P4S B;  5DPS A;  1JML A;  1FXT B;  2DEN B;  3IFW B;  2IGH A;  3B08 A;  3KUD B;  4DHZ E;  2L76 A;  3I57 A;  3EEC A;  2GI9 A;  3PHX B;  4WWP A;  4HRO A;  4G0N B;  4YTM B;  4IWO A;  4H2A A;  2V4L A;  2O6V D;  1PGB A;  2JSV X;  4P7I A;  4W9C A;  1BXT A;  5C23 A;  2M19 A;  1ACC A;  2KQ4 X;  1L7Y A;  3WIM A;  2PLP A;  1TBE A;  3X23 A;  4RM9 A;  1K53 A;  1IGC A;  2OED A;  2WGS A;  1IUE A;  2CJO A;  1N5W A;  2WX1 A;  1NBF C;  3CF6 E;  2W82 A;  2CHX A;  4FUL A;  3MC0 B;  3H1U A;  3AH7 A;  4M0W B;  3W9C B;  3RNF C;  1WR1 A;  2DYB A;  2KHW B;  4MSQ B;  3DHH C;  1UD7 A;  1ET9 A;  5G5H A;  3IT6 B;  2BKF A;  2LMC A;  4FAD A;  1C4A A;  2NBV B;  1WE7 A;  2MCN B;  2L1A A;  1QKZ A;  2EKE C;  3SD5 A;  5J2R A;  2A5U A;  4DK5 A;  5HFY A;  5HKH A;  4YT0 B;  3BWU D;  1RRB A;  1SB3 C;  1TGZ B;  4F1S A;  1QLB B;  1Z5S B;  2MJD A;  3UIP B;  2J0J A;  4C4V A;  2FUH B;  1YIW A;  1QF6 A;  4MEL A;  3ZGZ A;  5IN7 A;  2MA9 B;  4AS1 A;  4ANW A;  1WRI A;  1N63 A;  1PYW D;  3U52 E;  1VZ7 A;  2IDY A;  5H92 C;  4BBN F;  2C7H A;  2KWV B;  1WYG A;  1SE2 A;  4DWF A;  4AOF A;  2JF5 A;  3SR6 A;  4OW0 A;  1QOF A;  2HD5 B;  2WHI A;  3ML9 A;  4C4V B;  2PIA A;  1STE A;  3ZJV A;  2JQR B;  1EU3 A;  1P7F A;  2XNA C;  1SSN A;  5C2T B;  3SFE B;  3H6N A;  2IGD A;  1DOI A;  3KYC D;  4FBJ B;  3VUW A;  1CMX B;  3PZD A;  1H4R A;  3L54 A;  2DBY A;  2KWC A;  2HJ1 A;  1YQ3 B;  2W3S A;  1UBQ A;  5IOI A;  3HRD D;  1FFV A;  1MG8 A;  3N1X C;  2M56 B;  3AE1 B;  3AUL A;  2W3R A;  5AUI A;  3BZD B;  1IBX A;  1J19 A;  2UWQ A;  3FC4 A;  3BVG A;  2C7N B;  1QOA A;  2BWF A;  2JT4 B;  1S3S G;  1T3Q A;  2C7M B;  4WQO B;  3ML8 A;  3A9K B;  2CKH B;  3DBL I;  2ZEQ A;  4AWJ A;  3AEC B;  3ZNI D;  3URY A;  4DDI D;  4JX1 C;  2QCZ A;  4EOY A;  1E10 A;  3R8B A;  2RD0 A;  2J7Q B;  2G4D B;  4MDK E;  2ZJD A;  1F52 A;  2WU5 B;  2NBW B;  5AZG A;  3VTV A;  1J7C A;  2MP2 B;  2LHD A;  2IBI B;  4B9K A;  2NTT A;  2BBC A;  4NNJ B;  1TS3 A;  3B2G A;  3Q8B A;  1WR6 E;  1T0R C;  4MH8 A;  4USA A;  2JZP A;  3CIR B;  2RDH A;  5IKC M;  3Q8F A;  2NCN A;  1GOZ A;  2D3G A;  3PV1 A;  1RFA A;  1A70 A;  2GB1 A;  3MP9 A;  3HVD A;  2LXA A;  4FJY A;  1WJ4 A;  1GNU A;  4A90 A;  4M00 A;  1MVK A;  1YN4 A;  3CSF A;  1YQ4 B;  3P4Q B;  1SIJ A;  1XLN A;  1JWS D;  2GOW A;  1E6E B;  3U30 A;  4XC2 A;  1UWX A;  1YN3 A;  1V81 A;  4OZB A;  2J52 A;  5D3I B;  3AE2 B;  3TL5 A;  5BMH A;  2D2Q A;  2BYT A;  1TJE A;  4PS8 A;  3QQ8 B;  4EZJ A;  3RPF C;  1Y56 A;  1OGW A;  3FIL B;  4LDT B;  1T6B X;  2WDT B;  3IG3 A;  2KTR A;  4HEA 1;  2Z0E B;  2KAC A;  4GMV A;  5BYS A;  3P4P B;  1FPY A;  2K6Q A;  2HDE A;  2KZR A;  4AQ7 A;  2K8C A;  4XDC A;  4KDI C;  2FCM A;  3KWL A;  1GPX A;  4KDL B;  4R3D A;  3GZN B;  4W9H A;  4REZ A;  1EF1 A;  1T5X D;  1ZP0 B;  2ZPN A;  3BYY B;  2KFJ A;  4WAA A;  3OJ3 A;  3Q3O C;  1U4A A;  1JAL A;  2FCQ A;  3GE3 C;  3DQV A;  3ZNH B;  3U7D A;  2B3A A;  3DOW A;  4P16 A;  2M0A A;  4ANX A;  2DZJ A;  1KLV A;  3GP7 A;  3UQB A;  1I4X A;  5J17 A;  2IY0 B;  4GDL A;  3KWV A;  2N9P C;  2PW9 A;  2JXT A;  3ENE A;  1WYW B;  1WX9 A;  4NPN A;  2WXP A;  4IM3 A;  2K8H A;  2CU3 A;  3VFK A;  5HHD G;  4XWT A;  2DYO A;  5KHQ A;  3NZU A;  4A55 A;  4BOS C;  3L4P A;  3MHS D;  3T3N A;  3Q8C A;  4LJP B;  2C5L C;  2LI5 A;  1SE4 A;  4IW0 A;  2JX5 A;  2KWU B;  4ANV A;  4W9L A;  1ZE3 D;  3IAS 1;  4RGM A;  1B1Z A;  2G9H D;  2DZI A;  2LVQ A;  2R61 A;  4DXA B;  1CK1 A;  2D3C A;  4RF0 A;  2V3P A;  4J3O D;  4RNA A;  4IKG A;  1ROE A;  2ZNV C;  5LXI B;  2KLG A;  1DGJ A;  4P1C C;  1LXD A;  3PGE A;  4K7U A;  4ARC A;  3A4S C;  2N7D A;  1VCB A;  3L16 A;  2MH7 A;  4P6V F;  2O6V B;  2QIE B;  1KLG D;  2V4I B;  1ET6 A;  2KMC A;  4C80 A;  4PYU A;  4A8X C;  4NAM A;  2WNM A;  2YEP B;  3H7P B;  1UNS A;  4TKN A;  1WX7 A;  3V61 A;  2FBW B;  2LUM A;  3L17 A;  4BKT A;  2WYQ A;  1SXT A;  1QZE A;  3ZNZ B;  3JYU A;  2IO2 B;  1ESF A;  1YQB A;  2AYO B;  1Q0W B;  1IPG A;  2MBB B;  2Y3A A;  1DOY A;  2KAJ A;  4ICU A;  1QIL A;  3ZW3 A;  2EKI A;  3KQ4 A;  2INC C;  3AXC A;  1YX6 B;  4P1B C;  2KN5 A;  2KFK B;  3VXW A;  1K50 A;  4L1B A;  5IAA C;  1SGH A;  3CWI A;  5D7G A;  2AL6 A;  3MC9 A;  4JQW C;  2X8X X;  2BQQ A;  3ZJU A;  1RFK A;  3ZTD A;  3AI5 A;  3QIJ A;  3B0A A;  1F2R C;  4B6W A;  4HDO A;  4FJV B;  4BKS D;  1EF5 A;  3I9V 1;  3NVV A;  4ICV A;  2JWZ A;  2QDF A;  2WXL A;  4A3O A;  3RFZ B;  3HVZ A;  2JUO A;  4JE3 B;  1TS5 A;  3W2D A;  3T9L A;  3ZRC A;  1T0Y A;  1R7S A;  2G4S A;  2MBQ A;  3RNB C;  3RUI B;  2KKC A;  1FMA D;  2MHJ A;  3R2T A;  4M0W A;  3WAO A;  4K3C A;  2KXJ A;  2N0S B;  4IUM B;  3HUI A;  3BK2 A;  2N1V A;  1M94 A;  2NTS A;  1KTK A;  3WAP A;  3ZXR A;  3AU4 A;  3UIN B;  1WY8 A;  2M0X A;  2V3S A;  2CS4 A;  2OHF A;  4E3C A;  2PJH A;  3RMK C;  2LZ6 A;  1D3Z A;  4FHK A;  3Q3N C;  5EE0 A;  2VRR B;  5LNK 1;  4HRS A;  2LGI A;  2WX0 A;  2XN9 C;  4K1R B;  4CYE A;  3MTN B;  3H9D A;  3NUH B;  1V8C A;  1EUV B;  2MBE A;  4FJZ A;  1TZO A;  4GDL B;  1PUT A;  4MJS B;  1WRD B;  1J8C A;  2VH2 A;  2LWP A;  4JWU C;  5I4D A;  3DPD A;  1V97 A;  1SE9 A;  2LGY A;  3NS8 A;  4LJO B;  3KH0 A;  3S2A A;  4A6Q A;  2WXM A;  1RAX A;  3PT2 B;  5MPO A;  2BF8 B;  3QJZ A;  4W9E A;  3JSV B;  1ZDV A;  3TUO A;  5BMI A;  1MJD A;  3OLM D;  3Q3M C;  2KDI A;  1FNU A;  1IP9 A;  2LEK A;  3VTW A;  5JZE B;  2RDG A;  2DNF A;  4LCD E;  5KHO A;  4KGS A;  2GMI C;  3SEB A;  2JRI B;  4PK1 A;  2HTH A;  3Q3J A;  2D07 B;  3VDZ A;  4MGK E;  1V1P A;  3DBH I;  4US9 A;  5EDS A;  3DDC B;  2L0T A;  5IA7 A;  3R7R A;  3AN1 A;  4NJ6 A;  1FO4 A;  4LNO A;  3SHQ A;  1E8X A;  4RGT A;  2FCN A;  2WXR A;  4Q2J A;  3DVN V;  4L23 A;  3OJ4 B;  2KX0 A;  1TT5 B;  4TV3 A;  3RCZ A;  3VR8 B;  4LNN A;  1WJU A;  2ZVO A;  3NZS A;  2NS5 A;  4MSM B;  3AEB B;  3SDL C;  3A9J A;  1WH3 A;  3TEZ A;  1V1P B;  5AUK A;  3H8H A;  2FNJ B;  3TEY A;  1SJH D;  1L6V A;  3QAR A;  3AE8 B;  4XGA B;  3PLV A;  2MEK A;  4GDK A;  1I4H A;  3A1Q A;  3TCA A;  1TZ1 A;  1V86 A;  2VZK B;  3BIN A;  1J7B A;  1NDD A;  2WXO A;  4LDT D;  2L00 B;  4JLC A;  2KD0 A;  3BK1 A;  4G3X B;  2CJN A;  4GU2 A;  1T0Q C;  2NPT A;  1TTN A;  2IND C;  1TY0 A;  4KZ0 A;  4OVU A;  2MSE D;  1KFY B;  2KWD A;  3ZRF A;  1WX8 A;  1WFY A;  3VRB B;  2C9W B;  4W9G A;  5LLI A;  2FUG 1;  1I4Q A;  4FHJ A;  2JYT A;  2AWT A;  3APC A;  3M62 B;  2LJI A;  5DPT A;  5G5G A;  4BFR A;  2G3Q B;  3U8Z A;  4PYZ A;  2ACZ B;  5J18 A;  1UH6 A;  4E71 A;  2L52 A;  1WGH A;  3APD A;  3T8M A;  3EFU A;  1HEZ E;  1XQQ A;  2GRI A;  4K7S A;  2WDV B;  3C8Y A;  2MJE A;  4HK2 A;  2R2O A;  3VQI A;  3QK0 A;  3HM3 A;  4DHJ D;  3RNA C;  3TJP A;  3PTF C;  2D3A A;  2NMQ A;  3QAQ A;  4FN2 A;  4EFO A;  2LRW A;  1Q10 A;  1GUA B;  4MGI E;  4BOZ B;  1JRO A;  1F9J A;  5CHV C;  3ZJT A;  1I4G A;  1TS2 A;  1QT9 A;  4K81 A;  2YVC A;  3AU5 A;  4FLH A;  2JXX A;  2ZCB A;  2J53 A;  4LNF A;  4XE0 A;  2JY6 A;  3A4R A;  2OJR A;  1WXA A;  5C1Z A;  4M01 A;  4LK0 M;  2ZW1 A;  5GXG B;  5D6J B;  1R4N B;  2EMT A;  2XK5 B;  3TSS A;  2AQ2 B;  1KF6 B;  3WCQ A;  3VTU A;  4HKZ E;  3ABV B;  4II2 B;  4WJQ A;  3KYD D;  4HDQ A;  1PGX A;  4I6P A;  1WXM A;  1G6J A;  1ZGU B;  1FNW A;  1XT9 B;  1WMH B;  2GBN A;  4ITK A;  4DBG A;  3RN9 C;  1OQQ A;  3QC8 B;  3GE8 C;  3RD2 A;  3VR9 B;  2CR5 A;  2UYZ B;  5FR3 A;  2I1K A;  1TKY A;  2ZNV B;  3A33 B;  2N7J A;  2O2V B;  4EKU A;  2AQ3 B;  4RF1 A;  1OQR A;  1PFD A;  3SU8 X;  3BII D;  1KH0 A;  1JW9 D;  5FR6 A;  2DAJ A;  2KJR A;  1N6Z A;  4BKG A;  1GB1 A;  2DZK A;  1WMH A;  3AE6 B;  1SIF A;  2YLM A;  4IWP A;  1NEN B;  1AYF A;  1XLQ A;  2PVG C;  4HCN B;  2FID A;  2RPV A;  1L4D B;  2DZM A;  4HKQ A;  3R2I A;  4KV2 A;  1F1H A;  1V1O A;  4ARI A;  4ZRQ A;  4RFB A;  3NZ3 A;  2ZZP B;  2Z59 B;  2QIL A;  3P2B A;  2RDB C;  1WM3 A;  1WIA A;  2DX5 B;  1C3T A;  4IOI E;  1EM7 A;  2MP2 A;  2PVO D;  2KYW A;  1FFU A;  4MM3 B;  3GB1 A;  4UDU C;  3DWG C;  3L08 A;  4US8 A;  1I4R A;  4HXD A;  1RM6 C;  4YSY B;  3ZDT A;  5JH5 C;  4NQL B;  1D5Z C;  3LXF A;  1PGA A;  4RGO S;  3QWZ B;  4N6E B;  2Y5C A;  4HVB A;  4J6I A;  3Q8E A;  2BWE S;  3AV8 A;  3KUZ A;  4GB9 A;  4WIP A;  3ZIM A;  2LGX A;  2NVU I;  2QJL A;  3O13 A;  3L0W B;  4EUT A;  2Z8L A;  4GOC A;  2E3T A;  3N20 C;  5D3D A;  4HPL B;  3B2F A;  1SEB D;  3AED B;  3DCG A;  3GZN I;  4W9F A;  3W1S A;  2K5P A;  3RNC C;  2BYF A;  3ZUN A;  3AE7 B;  3NVY A;  4FXC A;  3GS2 A;  1E8W A;  3VH3 B;  5E6N A;  2WXJ A;  2V1Y A;  4DHZ B;  5C3J B;  4F8C B;  1VLB A;  5BYQ A;  2K1F A;  2WXN A;  3D32 A;  3VVW B;  2MW5 A;  2RPQ A;  3PHW B;  2PKO A;  1WE6 A;  1FM0 D;  1VZ6 A;  1C9F A;  1JWM D;  4IM0 A;  1KRH A;  3W1Y A;  3V3X A;  1V49 A;  1AW7 A;  3PVL A;  2QC8 A;  1WGY A;  1KJT A;  1Q5W B;  2KTF A;  3AE4 B;  1WZ3 A;  3DHG C;  1RYJ A;  3NHE B;  4N58 A;  5D94 A;  3RT3 B;  2EMS A;  3MC8 A;  4CQN A;  3APF A;  5H8Y E;  3DVG X;  3UI3 A;  1UZX B;  1XD3 B;  3ZKJ C;  2XEW A;  1R4M I;  3P42 A;  4HJK A;  3ZYY X;  1WZ0 A;  3KVF B;  3PRE A;  1D5M C;  2IPK D;  2O6V A;  4N59 A;  3LJ3 A;  1ZXI A;  4WUR A;  1TYG B;  2R2Q A;  1I42 A;  1JWA D;  4IM2 A;  4KKJ A;  2RGF A;  2WP9 B;  4BBN C;  4YXD B;  3VUY A;  2L32 A;  1OFF A;  1P7E A;  2BS3 B;  3AE5 B;  2BPS A;  2Y5B B;  1MFW A;  1XCT L;  4W9K A;  2J4X A;  4XWW A;  4JGH B;  5DPW A;  5HG2 A;  2KK8 A;  1ZXH A;  2J42 A;  4B95 A;  2BGF A;  1UGM A;  3IHP C;  1XCQ L;  3RUL A;  1VR9 A;  2FAZ A;  3DBH B;  4CO7 A;  2BW2 A;  2GBR A;  1C76 A;  3M63 B;  1N5X A;  4GXB A;  4TQ1 A;  3FIL A;  2BYE A;  4KX6 B;  4WWO A;  2N7E A;  4A3P A;  3E56 A;  3PZ7 A;  1L0V B;  1V6E A;  3VH4 B;  4MGY E;  4TSS A;  2KOX A;  3C19 A;  1L0X B;  3ETR A;  1ENF A;  2A4Z A;  1ZDX A;  4NAW B;  3NG0 A;  3N30 A;  2WXG A;  3I5J C;  5L95 C;  3P63 A;  2MBO A;  4HCP B;  1A5R A;  1XXG A;  2CHZ A;  4ACF A;  3T3O A;  3HK0 A;  3TEW A;  3W5U B;  2GBJ A;  3A1Q B;  3IXS A;  4ZOH C;  2HE7 A;  1JWU D;  2KMM A;  2VH1 A;  3UQA A;  3TIX A;  3RNG C;  1JWB D;  4RH6 A;  3U2S C;  2K6D B;  2WDR B;  3MJW A;  4MH0 E;  3IAM 1;  1V2Y A;  2CHW A;  1WJN A;  4GN1 A;  4PT5 A;  5CHW A;  3AE3 B;  3IVF A;  3ZQ4 A;  1MHX A;  2MRP A;  4MM3 A;  2LVP A;  5CHF A;  4F7Z A;  2LJ5 A;  1ISN A;  3Q3F A;  1ZUD 2;  2QMT A;  1M4V A;  2B76 B;  4EE2 A;  2MX2 A;  3LDZ E;  5D2M B;  3W5V B;  3N9Y C;  2ZW0 A;  2Y5P A;  5E6J A;  3ZTC A;  4L2Y A;  1UBI A;  2I38 A;  2ZVN A;  4XZ4 A;  2KNB A;  3HHM A;  1L0Y B;  2KVR A;  2V3N A;  1VRA B;  2PE6 B;  2K22 A;  3CMM B;  2K25 A;  2KDB A;  4HPM B;  4TUU A;  4JL9 A;  1B9R A;  1KOT A;  2E6X A;  1JRU A;  2KDF B;  3H7P A;  2N9K A;  3NVZ A;  1XEE A;  2KC2 A;  2KQ7 A;  5AEK B;  2NR2 A;  3R66 C;  1WGG A;  3NJT A;  5T8I A;  5FKA C;  4EEW A;  1WXV A;  3C0R B;  1GJZ A;  2LFI A;  4NQK E;  2W9N A;  1HZ6 A;  1UWM A;  2BS4 B;  3CST A;  4MEM A;  4IWQ A;  1K8R B;  4MAC A;  3AE9 B;  4HWI B;  3ZDM C;  2KMA A;  2L0F A;  4S0R A;  2KDE B;  1E5W A;  2YEP F;  2J0K A;  3JSV A;  3OAW A;  1MI0 A;  2BVC A;  3NY5 A;  3FKY A;  1Q1O A;  1R4N I;  4AUQ C;  3B1L X;  2K39 A;  3VHT C;  2ASQ A;  1ZKH A;  2GLS A;  3I63 C;  4PS3 A;  2LAS A;  2JU6 X;  1D6E C;  2LXC A;  3M95 A;  1SF0 A;  4X57 B;  1EU4 A;  2M1M A;  2D10 A;  1D4B A;  2KX3 A;  3N3K B;  4D2K A;  1E0Z A;  4FA6 A;  3PPA A;  1NVI D;  1YMH E;  4YSX B;  4KIK A;  1GAQ B;  2WQY B;  2O2V A;  4CHK A;  2HJ8 A;  3DBR B;  3DVG Y;  3JW0 X;  2K8B A;  4YSZ B;  2L3Z A;  2KT7 A;  3DVN U;  1NYR A;  2ICI A;  2MQJ A;  3AB5 A;  4KKI A;  3P4R B;  1XO3 A;  4C7Z A;  2KFK A;  1JRP A;  1V5T A;  2KDM A;  3LYY A;  3A9J B;  1YJJ A;  4ZYS A;  1SJE D;  3PRP B;  3BYT B;  2DLB A;  2WXH A;  2X38 A;  4WWM A;  1P1A A;  4NJ7 A;  4OVV A;  4WWN A;  3PSE B;  2M8S A;  1PQS A;  1E7P B;  2OJW A;  1YN5 A;  3R7Q A;  2ZPY A;  3BVM A;  1GC6 A;  4TQ0 A;  2PTL A;  3LB8 C;  4JIO U;  1F0Z A;  4I6N B;  2MLB A;  3VUX A;  2IO1 B;  1XLP A;  2N1W A;  4YL8 A;  2WXQ A;  2LRU A;  5CTR C;  5BO4 B;  4KSK C;  1AN8 A;  1TKG A;  3DBS A;  2N4F A;  1SE3 A;  4ZRP A;  3WAN A;  3TMP B;  1E8Y A;  3KW5 B;  1AAR A;  3DHI C;  2BKR B;  1MG4 A;  3K9O B;  1YOV B;  3V62 A; 
#chains in the Genus database with same CATH homology
 3H7P B;  4TKN A;  1WX7 A;  2AEH A;  3QWZ B;  2BYV E;  4HVB A;  5G55 A;  3HM6 X;  3V61 A;  4J6I A;  3L17 A;  4W9I A;  3V6C B;  4BKT A;  2BWE S;  2WYQ A;  2L8J A;  1QZE A;  2FIF A;  3KUZ A;  4GB9 A;  3ZNZ B;  3JYU A;  2IO2 B;  3ZIM A;  2LGX A;  3IBE A;  2NVU I;  3PLU A;  1P9D U;  2XK5 A;  3L0W B;  1YQB A;  2AYO B;  3UGB B;  3HIZ A;  4EUT A;  4GOC A;  5AZH A;  1Q0W B;  1IPG A;  3V6E B;  2MBB B;  2IO0 B;  1RLF A;  1OTR B;  1WI0 A;  5E6O A;  1P98 A;  2MWS B;  4HPL B;  2C60 A;  3DCG A;  3GZN I;  3W1S A;  4W9F A;  2KQS A;  4ICU A;  3ZW3 A;  1OEY J;  4NY0 A;  3TBL D;  2BYF A;  3AXC A;  1OQY A;  2J0M A;  4KZC A;  2DHZ A;  1YX6 B;  3ZUN A;  2KN5 A;  1EO6 A;  2KFK B;  3VXW A;  5IAA C;  1SGH A;  5D7G A;  2AL6 A;  4JQW C;  4ANU A;  1E8W A;  5DPS A;  3VH3 B;  1YD8 U;  5E6N A;  3V60 A;  2V1Y A;  4DHZ B;  4RMA A;  1FXT B;  1E7V A;  2DEN B;  4F8C B;  3ZTD A;  3IFW B;  2K1F A;  3B08 A;  3KUD B;  4DHZ E;  3D32 A;  2L76 A;  3AI5 A;  3VVW B;  3EEC A;  3QIJ A;  2MW5 A;  2RPQ A;  3B0A A;  3PHX B;  4WWP A;  4B6W A;  4G0N B;  4HDO A;  3PHW B;  3PRZ A;  4FJV B;  2M17 A;  1WE6 A;  3JVZ X;  4BKS D;  1EF5 A;  4IWO A;  1V5O A;  4ICV A;  2V4L A;  1LM8 B;  2DYM A;  2JWZ A;  2KAN A;  2O6V D;  4IM0 A;  4URK A;  3W1Y A;  4RM8 A;  1V49 A;  1V80 A;  4MGZ E;  4A3O A;  3PVL A;  2JUO A;  4P7I A;  4W9C A;  1WGY A;  3T9L A;  3ZRC A;  1T0Y A;  5C23 A;  1KJT A;  2G4S A;  1Q5W B;  2KTF A;  2MBQ A;  2GBM A;  3RUI B;  1WZ3 A;  2KKC A;  3NHE B;  1L7Y A;  3RT3 B;  5D94 A;  3WIM A;  2EMS A;  1ZW7 A;  3WAO A;  1TBE A;  3APF A;  2KXJ A;  3X23 A;  4RM9 A;  3DVG X;  4IC7 B;  2XBB C;  4IUM B;  1UZX B;  1XD3 B;  3ZKJ C;  1J0G A;  2N1V A;  1M94 A;  2XEW A;  3WAP A;  3AU4 A;  3UIN B;  1R4M I;  1WY8 A;  2M0X A;  2WX1 A;  2V3S A;  1NBF C;  4HJK A;  2CS4 A;  3CF6 E;  1WZ0 A;  1LFD A;  3KVF B;  4KIK B;  3RZF A;  3PRE A;  4G50 A;  4E3C A;  2PJH A;  4A20 A;  2CHX A;  2LZ6 A;  1D3Z A;  4FHK A;  2O6V A;  2VRR B;  3LJ3 A;  3X0W A;  4FUL A;  3H1U A;  1I42 A;  2R2Q A;  4IM2 A;  2WX0 A;  4M0W B;  1WR1 A;  2RGF A;  4K1R B;  3ONS A;  2DYB A;  4CYE A;  2KHW B;  3MTN B;  4MSQ B;  4N9F 4;  4BBN C;  2PEA A;  3H9D A;  3VUY A;  3QCA A;  1UD7 A;  4WJP A;  1EUV B;  2BKF A;  4FAD A;  5TR5 A;  2MBE A;  2NBV B;  1WE7 A;  4FJZ A;  2MCN B;  1P0R A;  3ZO5 B;  4GDL B;  2BPS A;  2EKE C;  2Y5B B;  4MJS B;  3SD5 A;  1WRD B;  4W9K A;  1J8C A;  5J2R A;  3KUC B;  2A5U A;  4DK5 A;  2KC1 A;  2LWP A;  2G45 B;  4M8M A;  5CX3 A;  3DPD A;  5HKH A;  2NPT B;  1SE9 A;  4JGH B;  2KLC A;  2LGY A;  3NS8 A;  4LJO B;  5DPW A;  1RRB A;  3KH0 A;  3S2A A;  1TGZ B;  2JZ3 B;  3L13 A;  2M4N A;  4AJW A;  5AZF A;  4F1S A;  2KK8 A;  1RAX A;  1Z5S B;  3PT2 B;  4B95 A;  2BF8 B;  3QJZ A;  3UIP B;  2J0J A;  2BGF A;  4W9E A;  2FUH B;  1YIW A;  1UGM A;  3JSV B;  4MEL A;  3IHP C;  2MA9 B;  3OLM D;  3RUL A;  2KDI A;  2FAZ A;  3ZNG C;  4W9D A;  1IP9 A;  2LVO A;  4ANW A;  3VTW A;  4CO7 A;  5JZE B;  2GBR A;  2IO3 B;  1P3Q U;  4LCD E;  1GG3 A;  4BBN F;  5KHO A;  3M63 B;  3W1S C;  2C7H A;  2GBK A;  4GXB A;  2GMI C;  2KWV B;  4TQ1 A;  2JRI B;  2BYE A;  3WA0 A;  2HTH A;  5JHA A;  4WWO A;  4DWF A;  2KTR B;  2N7E A;  3Q3J A;  2LD9 A;  2D07 B;  3QX1 A;  4ZRI A;  4AOF A;  3VDZ A;  3ALB A;  2JF5 A;  1HE8 A;  4A3P A;  2HD5 B;  4MGK E;  1V6E A;  3VH4 B;  4MGY E;  3ML9 A;  2KOX A;  3DBH I;  1V9J A;  2QHO A;  5EDS A;  3DDC B;  2A4Z A;  4EZL A;  2L0T A;  5IA7 A;  3R7R A;  3RZW C;  3H6N A;  4NAW B;  4ZDV A;  4NJ6 A;  2D11 A;  3N30 A;  3SHQ A;  1E8X A;  5L95 C;  2MBO A;  2FCN A;  4HCP B;  1A5R A;  3DVN V;  3GOE A;  2CHZ A;  4K7W A;  3OJ4 B;  3K9P B;  1WGR A;  2KX0 A;  3HK0 A;  3KYC D;  4TV3 A;  3RCZ A;  4FBJ B;  3VUW A;  2GBJ A;  1CMX B;  3A1Q B;  1WJU A;  2HE7 A;  2REX A;  3PZD A;  1H4R A;  2ZVO A;  3NZS A;  3UQA A;  2NS5 A;  4MSM B;  3SDL C;  3L54 A;  3TIX A;  1NI2 A;  2KWC A;  3A9J A;  2OOB B;  4GGQ A;  1WH3 A;  2JRH A;  1UBQ A;  1MG8 A;  5DPR A;  2FNJ B;  2K6D B;  3AUL A;  1BT0 A;  2Z0D B;  3MJW A;  1J19 A;  2UWQ A;  4MH0 E;  2CU1 A;  2N9X A;  1Y8R C;  2C7N B;  3QAR A;  1L2N A;  1V2Y A;  2CHW A;  1WXS A;  1WJN A;  5GMV A;  4GN1 A;  3PLV A;  5CHW A;  2BWF A;  3IVF A;  2JT4 B;  4GDK A;  1S3S G;  4GIV A;  2KO3 A;  2NBU A;  2C7M B;  3A1Q A;  3ML8 A;  3EHV A;  4WQO B;  3TCA A;  3A9K B;  2MRP A;  2CKH B;  3DBL I;  2ZEQ A;  2DAF A;  4AWJ A;  4G11 A;  1TZ1 A;  1V86 A;  3WAL A;  4HLE A;  3BIN A;  1NDD A;  3QHT A;  3ZNI D;  4DDI D;  4MM3 A;  2JZZ A;  2LVP A;  4LDT D;  5CHF A;  2LGD A;  4F7Z A;  1S1Q B;  2LJ5 A;  2L00 B;  1ISN A;  2I1J A;  4JLC A;  4EOY A;  3Q3F A;  2KD0 A;  4K81 A;  4G3X B;  2RD0 A;  1UEL A;  3DBR I;  2J7Q B;  2MX2 A;  4GU2 A;  2G4D B;  2L7R A;  4I6L B;  3LDZ E;  4MDK E;  4PS7 A;  5D2M B;  2NPT A;  1TTN A;  4KZ0 A;  4OVU A;  2MSE D;  3ZTC A;  4KVG B;  2ZJD A;  1UBI A;  2NBW B;  3VAW A;  4DHJ B;  5AZG A;  1E90 A;  2ZVN A;  4XZ4 A;  2KNB A;  2N9E B;  3ZRF A;  1WX8 A;  3HHM A;  3VTV A;  2KVR A;  2MP2 B;  2PE6 B;  1WFY A;  3CMM B;  2C9W B;  4W9G A;  5LLI A;  5LXH A;  4DDG D;  2K25 A;  2IBI B;  4FHJ A;  3ECI A;  4M8N A;  3WAM A;  4B9K A;  2KDB A;  4HPM B;  4TUU A;  4JL9 A;  2AWT A;  3APC A;  3M62 B;  5DPT A;  4NNJ B;  4BFR A;  1WR6 E;  2G3Q B;  3U8Z A;  4PYZ A;  2PPH A;  1KOT A;  1YX5 B;  4ZRK A;  1JRU A;  5J18 A;  1UH6 A;  4E71 A;  2KDF B;  3H7P A;  1WGH A;  2NCN A;  3APD A;  3T8M A;  3EFU A;  2D3G A;  3PV1 A;  1RFA A;  1XQQ A;  2KC2 A;  2KQ7 A;  2KJH B;  4K7S A;  3PS6 A;  2NR2 A;  5AEK B;  3R66 C;  1WGG A;  2PE9 A;  4MJS A;  4EEW A;  1WXV A;  3C0R B;  4HK2 A;  1GJZ A;  3ZLZ A;  2R2O A;  2W9N A;  3M3J A;  4NQK E;  3CST A;  2LXA A;  4MEM A;  4FJY A;  4IWQ A;  1K8R B;  3VQI A;  1WJ4 A;  3QK0 A;  3ZVV A;  1GNU A;  3ZDM C;  4HWI B;  3HM3 A;  4BKS A;  4DHJ D;  2KMA A;  2L0F A;  3TJP A;  3CSF A;  3PTF C;  1X1M A;  1E8Z A;  2AL3 A;  2IZV B;  3QAQ A;  4FN2 A;  2KDE B;  2GOW A;  4EFO A;  2LRW A;  1E5W A;  2J0K A;  3EC8 A;  1GUA B;  3JSV A;  4GSW A;  3OAW A;  3U30 A;  4XC2 A;  4MGI E;  4BOZ B;  2JVC A;  1V81 A;  3NY5 A;  1Q1O A;  1R4N I;  1F9J A;  4AUQ C;  2LUE A;  5CHV C;  3B1L X;  2K39 A;  3TL5 A;  2D2Q A;  3VHT C;  2ASQ A;  4PS8 A;  1ZKH A;  3QQ8 B;  4EZJ A;  4PS3 A;  2LAS A;  5L83 A;  1OGW A;  4LDT B;  2LXC A;  2WDT B;  2YVC A;  3AU5 A;  3IG3 A;  4FLH A;  1OEY A;  3M95 A;  2KTR A;  2JXX A;  2RSU A;  4X57 B;  2Z0E B;  2ZCB A;  4E74 A;  4GMV A;  2JY6 A;  2M1M A;  2K6Q A;  3A4R A;  2D10 A;  2KX3 A;  2KJ6 A;  2KZR A;  2OJR A;  3N3K B;  2K8C A;  4FA6 A;  1IYF A;  3PPA A;  1WXA A;  4KDI C;  2FCM A;  2WWZ A;  5C1Z A;  4WJN A;  1Z2M A;  4KIK A;  4AP4 C;  5D6J B;  3H7S A;  4KDL B;  2EMT A;  2XK5 B;  4W9H A;  2O2V A;  4CHK A;  1KM7 A;  4NAW A;  1EF1 A;  3NOB A;  2HJ8 A;  4W9J A;  3DVG Y;  3VTU A;  3JW0 X;  2K8B A;  1WM2 A;  4II2 B;  4WJQ A;  2ZPN A;  3KYD D;  2KFJ A;  2L3Z A;  3DVN U;  5JHB A;  3L10 B;  4HDQ A;  4WAA A;  3OJ3 A;  1WXM A;  4I6P A;  1G6J A;  1LQB A;  1ZGU B;  1U4A A;  2MQJ A;  1XT9 B;  2FCQ A;  1WMH B;  2GBN A;  4AJY B;  4DBG A;  3DQV A;  3ZNH B;  3U7D A;  2B3A A;  3DOW A;  3QC8 B;  2KFK A;  1V5T A;  3RD2 A;  4ANX A;  1I35 A;  3A9J B;  2DZJ A;  1KLV A;  1WGD A;  2CR5 A;  3UQB A;  2UYZ B;  3PRP B;  2I1K A;  4ASW C;  5J17 A;  2IY0 B;  2ZNV B;  1P1A A;  3A33 B;  4GDL A;  4NJ7 A;  3PRM B;  2O2V B;  2N9P C;  4OVV A;  5E6P A;  3I3T B;  4II3 B;  3PSE B;  4WWN A;  4EKU A;  3ENE A;  3O65 B;  2M8S A;  1PQS A;  3R3M A;  1WYW B;  1YJ1 A;  4ZYN A;  3SU8 X;  1WX9 A;  3R7Q A;  4NPN A;  2ZPY A;  5FR6 A;  2DAJ A;  2KJR A;  2K8H A;  4IM3 A;  1GC6 A;  4BKG A;  4GDK B;  4TQ0 A;  2DZK A;  3VFK A;  1WMH A;  1SIF A;  3UF8 A;  2YLM A;  2ZCC A;  2DYO A;  5KHQ A;  3NZU A;  4KSL C;  4JIO U;  2JPH A;  4IWP A;  1E7U A;  4BOS C;  3MHS D;  4I6N B;  4LJP B;  2C5L C;  2MLB A;  1WF9 A;  5G2N A;  2LI5 A;  3QA8 A;  4HCN B;  3VUX A;  1WJ6 A;  2FID A;  2IO1 B;  3N32 A;  1H8C A;  4IW0 A;  4WJO A;  2N1W A;  4IG7 B;  4YL8 A;  3UIO B;  2KWU B;  4ANV A;  2DZM A;  4W9L A;  4ZRJ A;  2DZI A;  4KV2 A;  2LVQ A;  2IY1 B;  4DXA B;  2LRU A;  4XX5 A;  5CTR C;  2ZZP B;  2Z59 B;  4EZK A;  5BO4 B;  2ZNV C;  3BY4 B;  3P2B A;  4KSK C;  5LXI B;  1GC7 A;  2KLG A;  1LXD A;  1WM3 A;  1WIA A;  2DX5 B;  3A9K A;  3PGE A;  3DBS A;  1C3T A;  4K7U A;  2MP2 A;  2N4F A;  3WAN A;  3A4S C;  2N7D A;  3TMP B;  1VCB A;  2FCS A;  5DCN A;  3L16 A;  1E8Y A;  4BVU C;  2O6V B;  3KW5 B;  3RYT A;  2RR9 A;  1AAR A;  3L08 A;  2BKR B;  2L05 A;  2MBH A;  4HXD A;  3ZDT A;  3K9O B;  5JH5 C;  1C1Y B;  4NQL B;  2KMC A;  4PYU A;  2IYD B;  3V62 A;  1VD2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...