5AZGA

Crystal structure of lgg-1 complexed with a unc-51 peptide
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
119
structure length
119
Chain Sequence
GPHMKWAYKEENNFEKRRAEGDKIRRKYPDRIPVIVEKAPKSKLHDLDKKKYLVPSDLTVGQFYFLIRKRIQLRPEDALFFFVNNVIPQTMTTMGQLYQDHHEEDLFLYIAYSDESVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Protein lgg-1
publication title Structural Basis of the Differential Function of the Two C. elegans Atg8 Homologs, LGG-1 and LGG-2, in Autophagy
doi rcsb
source organism Caenorhabditis elegans
total genus 36
structure length 119
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5azgA00
4MGYE 1U4AA 2KZRA 4GDKA 5AEKB 4NPNA 5BO4B 2XEWA 3KYDD 3H7PB 4GU2A 1X1MA 3RD2A 4EKUA 4WJQA 2KO3A 4MEMA 4HCPB 3L0WB 2O6VA 2JRIB 2K6DB 3NY5A 4ZDVA 3B0AA 3ZNGC 2FCMA 4HWIB 2CKHB 4N9F4 1Z5SB 2GOWA 2RGFA 4I6PA 3R3MA 3WAMA 3VTWA 1WY8A 5CHVC 4IWOA 2DZMA 3HK0A 1GJZA 2BYFA 2LJ5A 4MDKE 3R66C 4KDIC 4FLHA 3HHMA 2DHZA 2IZVB 2NBVB 2PEAA 3Q3JA 4ZRIA 1J8CA 4JLCA 5L95C 1BT0A 2K39A 4TV3A 2LVQA 2KMCA 2KFKB 4ANXA 1YX5B 3BINA 3KVFB 1WX7A 2JRHA 1P0RA 2PE6B 1WM2A 2LI5A 3A9JB 3WANA 3A33B 1V5OA 5JH5C 3NHEB 4PYUA 1NDDA 3PGEA 3DOWA 5IA7A 3CMMB 4BKSD 1NBFC 1XD3B 2DENB 3KUCB 2MP2A 2FUHB 3EECA 3QWZB 4KV2A 2FCSA 1KM7A 1C1YB 2KC2A 3V6EB 1WX8A 3QIJA 3DCGA 3M95A 3VFKA 3V6CB 2CS4A 2KDFB 3A4SC 1V2YA 3NZSA 4EZLA 2AEHA 2O6VB 1GG3A 3BY4B 3RYTA 3N3KB 2XK5B 4LDTB 4GGQA 4G0NB 4GIVA 1OGWA 2D11A 4GSWA 4IG7B 4J6IA 1Q5WB 2GBJA 2Z59B 4DDID 3ZTDA 3JSVA 1RFAA 4HPLB 2M1MA 2FCQA 1OQYA 4LJPB 3UINB 4FJVB 2CU1A 2RSUA 3UQBA 2ZZPB 3B08A 2KK8A 2WDTB 2L7RA 2IO2B 2M0XA 3K9PB 3PV1A 2G4DB 4FA6A 3RUIB 2D3GA 1EO6A 3KUZA 2CR5A 1CMXB 1EF5A 2D2QA 1WGDA 3ZVVA 3T9LA 4CHKA 3T8MA 3R7QA 3UF8A 2BWFA 2N9PC 4F8CB 1WGRA 2N1WA 1D3ZA 3PHXB 2KDBA 3M62B 2MP2B 2YLMA 1KLVA 2C5LC 4XX5A 2D10A 2ASQA 4WJNA 2ZCCA 4EUTA 2V4LA 5FR6A 2GBKA 2GBNA 1I35A 3QK0A 2I1JA 1R4MI 1KJTA 1WXSA 4NAWA 3X23A 3ZW3A 3ZTCA 2CHZA 2KFJA 2KN5A 3WIMA 1Z2MA 3DBHI 4W9GA 1TZ1A 1OTRB 4M8MA 5D94A 5DPTA 3X0WA 3N30A 2KQ7A 3JVZX 2ZNVB 3VXWA 3CF6E 3JSVB 2FCNA 2Z0EB 4CYEA 2K1FA 2JZ3B 3VUWA 3SHQA 2BKFA 2LASA 2NCNA 5E6OA 4JL9A 1MG8A 3KH0A 3LDZE 4NY0A 2A4ZA 2C60A 4KVGB 3PRPB 2LRUA 1P1AA 2KQSA 4B95A 1IPGA 4ICVA 2JF5A 3SU8X 2MLBA 3APFA 4CO7A 4DHJB 5LXHA 1WFYA 1P3QU 4G50A 2LUEA 1P98A 5CTRC 4DHZE 1YQBA 3A1QA 4OVUA 3MHSD 3K9OB 3PREA 2LVPA 1SIFA 1WR6E 1L7YA 3QA8A 3L08A 4KSLC 4DWFA 4FBJB 2ZEQA 4XZ4A 1SE9A 2G4SA 1UBIA 5TR5A 3VH4B 4P7IA 4NQLB 4XC2A 4BKSA 5GMVA 3LJ3A 2NR2A 3M3JA 3TBLD 4K7UA 2MW5A 3ALBA 4BVUC 4EOYA 3PLVA 2KX0A 2ZVOA 2MA9B 4FN2A 3ZRFA 3DVNV 3TCAA 2GBRA 2BF8B 2HD5B 3VH3B 2DAJA 3WAPA 4NJ7A 2JXXA 4PS3A 3VDZA 4W9IA 2KDIA 5C1ZA 2LXCA 1UH6A 3PRZA 4DHZB 5HKHA 3B1LX 2O2VA 1GC6A 2L76A 3NOBA 1YX6B 2L0TA 4HCNB 5DPSA 1PQSA 3VQIA 4M8NA 4URKA 5EDSA 1WE6A 2BYVE 4GMVA 3S2AA 1RLFA 3L10B 1WGGA 2L0FA 3SD5A 3L13A 3WAOA 2WWZA 4HPMB 2A5UA 3RULA 2JWZA 3PRMB 2M4NA 4HJKA 3Q3FA 5KHOA 2FAZA 3IG3A 2NVUI 2DYMA 2KTRA 3C0RB 4FULA 4B6WA 5D7GA 3W1YA 4WJOA 5CHFA 2L00B 4JQWC 5DPWA 3ONSA 1WM3A 4MJSA 4GDKB 2G45B 3M63B 4BKGA 4MH0E 3V61A 1NI2A 4ZRKA 4OVVA 3ENEA 4GXBA 2OJRA 2GBMA 4KDLB 1IYFA 2R2QA 2NS5A 3CSFA 2RD0A 4WWOA 4WQOB 5JHBA 1YJ1A 3IBEA 2J0MA 4IM0A 2PPHA 4IM3A 1F9JA 4IWQA 1WZ3A 2HTHA 2ZPYA 3ECIA 3N32A 5IAAC 2IY0B 4HXDA 2KC1A 1E8XA 4HDOA 2ZNVC 1VCBA 4M0WB 2K25A 1P9DU 1YD8U 1A5RA 2HE7A 4TKNA 1WJ6A 4W9FA 2NBUA 3PLUA 2O6VD 1V81A 2O2VB 5DPRA 1TTNA 4RM9A 4LDTD 3JW0X 2KXJA 4JIOU 4NNJB 2MRPA 2KJ6A 2N4FA 3DVGX 4W9KA 3V60A 1WF9A 1ZGUB 3QCAA 3DBSA 3R7RA 3EC8A 1ZKHA 3OLMD 5J18A 1GC7A 3A9KA 4MELA 3MJWA 4AP4C 2JY6A 5L83A 2LZ6A 4II2B 3ZUNA 2GMIC 1L2NA 2KTRB 2W9NA 4BOZB 3QARA 4MGKE 2PE9A 1C3TA 5AZFA 1R4NI 4FHKA 4ASWC 3APDA 5AZGA 4TQ0A 2MQJA 3OAWA 3TJPA 3DQVA 1XT9B 3TIXA 2KWUB 5AZHA 4FJZA 1OEYA 3VTUA 3ZO5B 2DZKA 2FNJB 2CHWA 2LVOA 1HE8A 3PZDA 3PPAA 1E7UA 2LD9A 3IVFA 2ZVNA 3W1SA 1SGHA 1WE7A 2LGXA 5D6JB 3VTVA 4YL8A 2N7DA 2KLCA 2IO1B 1WJNA 2N7EA 4E3CA 2ZPNA 3QC8B 3RCZA 3DDCB 5CHWA 2KD0A 1I42A 2LGYA 2MBBB 1WGHA 2LXAA 2QHOA 3P2BA 1V6EA 4MSMB 2DZIA 3ML8A 1FXTB 3IFWB 4RM8A 2C9WB 3NS8A 4TUUA 2IBIB 2JUOA 3GZNI 2WYQA 3H7PA 1TGZB 1WXAA 3ZRCA 3UQAA 1E7VA 3PS6A 4DBGA 2EMSA 4K7WA 3AU5A 3PVLA 2J7QB 4RMAA 1WI0A 4KIKA 5KHQA 2L8JA 3AULA 3DPDA 4LCDE 4W9HA 4F1SA 3ZIMA 4A3OA 4IW0A 4II3B 4NQKE 3IHPC 1M94A 3NZUA 3TMPB 1RRBA 3H1UA 4BBNC 3I3TB 1ISNA 3PSEB 4W9DA 3VUXA 1E8YA 4W9LA 3U30A 5CX3A 4DHJD 4K1RB 3H9DA 2C7HA 4GDLA 1EF1A 1E8WA 2XBBC 4NAWB 2HJ8A 2KFKA 2RPQA 5LLIA 2MCNB 2JT4B 2VRRB 1WZ0A 2EMTA 2REXA 1WR1A 3A9JA 3AXCA 3ZDTA 1T0YA 4X57B 3UGBB 4WJPA 1TBEA 4G3XB 4AUQC 1G6JA 1VD2A 4NJ6A 1QZEA 4KZCA 4PYZA 2DYBA 1UZXB 1K8RB 2AL3A 4MM3A 5JHAA 2WX1A 2KMAA 2MBOA 4HVBA 3JYUA 3TL5A 2JZZA 1WXMA 4HDQA 1EUVB 2M17A 5D2MB 2YVCA 2KKCA 4E71A 3ML9A 3HIZA 2K8BA 2KVRA 2JPHA 2J0KA 2L05A 3ZDMC 5J17A 1S3SG 2XK5A 4KIKB 4ZRJA 1WXVA 3ZNID 4BBNF 1XQQA 1E90A 1WH3A 4PS8A 3UIOB 3DBLI 3A1QB 3GOEA 4I6LB 2BWES 4K81A 4G11A 2M8SA 2IO0B 2MX2A 4EFOA 4EZJA 3DVGY 4ANWA 2N9EB 3D32A 2AYOB 2V1YA 3PHWB 3CSTA 1H4RA 2KJRA 4GDLB 1UELA 3VHTC 1WIAA 1E8ZA 2KJHB 4DK5A 2FIDA 1RAXA 5DCNA 2JVCA 2K6QA 2KNBA 2NBWB 1IP9A 3ZNZB 4BKTA 3QAQA 4EZKA 4HK2A 2KWVB 2UWQA 3EFUA 3KW5B 4DXAB 2LWPA 1S1QB 2KWCA 2FIFA 4W9CA 4K7SA 2C7MB 3H7SA 1KOTA 2OOBB 3U8ZA 4FHJA 3KUDB 2DAFA 3A4RA 3VVWB 3UIPB 4IC7B 3WA0A 2DX5B 5E6NA 4KZ0A 2PJHA 4AJWA 1GNUA 1Q1OA 2LGDA 2RR9A 3MTNB 4ZYNA 2KTFA 2MBHA 3L54A 3WALA 4MGIE 3PT2B 4EEWA 4ANVA 3PTFC 1J0GA 1WRDB 2LRWA 1WMHA 2N1VA 1H8CA 2V3SA 4MJSB 3RZFA 1V9JA 2Z0DB 4MSQB 4LJOB 1E5WA 2DYOA 4WAAA 5E6PA 5C23A 1AARA 3RZWC 3DBRI 5G55A 2KDEB 2MBEA 1ZW7A 2ZCBA 1V86A 4KSKC 4FJYA 4GOCA 1V5TA 2K8HA 1YIWA 4I6NB 4BFRA 1Y8RC 3QJZA 4GN1A 2K8CA 2EKEC 2NPTA 1UBQA 1LFDA 3SDLC 3OJ4B 2UYZB 4FADA 1WGYA 3AU4A 3W1SC 4BOSC 1V49A 1Q0WB 1LQBA 4AOFA 2L3ZA 3EHVA 1JRUA 2I1KA 5J2RA 3APCA 2G3QB 4W9EA 2KHWB 3ZNHB 2ZJDA 2MWSB 3DVNU 3HM6X 4E74A 4DDGD 2KX3A 3V62A 4MGZE 1V80A 2IY1B 4IM2A 2C7NB 1LM8B 4F7ZA 2CHXA 5JZEB 5LXIB 2B3AA 4ANUA 4TQ1A 3A9KB 1J19A 2BKRB 2J0JA 3L17A 3VAWA 4B9KA 3QHTA 3H6NA 1OEYJ 2MSED 3KYCD 3RT3B 1LXDA 2KOXA 1WJ4A 3L16A 1WMHB 3QX1A 1WJUA 4HLEA 1UGMA 2N9XA 4JGHB 2BGFA 3AI5A 3ZKJC 1WYWB 1GUAB 4WWPA 2WX0A 2D07B 4IUMB 2NPTB 2KANA 4AWJA 4PS7A 2DZJA 3U7DA 2R2OA 2AL6A 3OJ3A 3O65B 3QQ8B 2BPSA 3HM3A 3VUYA 2IYDB 4IWPA 5G2NA 3ZLZA 2IO3B 1UD7A 4W9JA 4A20A 2MBQA 2BYEA 1WX9A 2Y5BB 4WWNA 4GB9A 2AWTA 2KLGA 4ICUA 4A3PA 4AJYB
chains in the Genus database with same CATH superfamily
2G9HD 1U4AA 4MGYE 5AEKB 2JSVX 1X1MA 4EKUA 2PIAA 4HCPB 2DNFA 2WXNA 2JRIB 3NY5A 4ZDVA 3ZNGC 2FCMA 4HWIB 1MHHE 3V3XA 1V1PA 3R3MA 1ZDXA 4ARIA 1QT9A 1UF0A 1GJZA 2WXGA 4MDKE 4M01A 2LJIA 2NBVB 1KRHA 4RGMA 2K39A 3DBRB 3DHIC 4TV3A 2KMCA 2IJ0A 3IT6B 1WX7A 4IOIE 1P0RA 2PE6B 3FC4A 1WM2A 2PVOD 3B9JA 3A33B 1JQ4A 5IA7A 3CMMB 4BKSD 2FUHB 5FKAC 1C1YB 3AMZA 3R8BA 3VFKA 5IKCM 2KDFB 3A4SC 4EZLA 3NRZA 4LDTB 4GGQA 4G0NB 3IXSA 1FO4A 4J6IA 1Q5WB 4XWTA 3JSVA 3FILA 2CJOA 4LJPB 1DOIA 1TT5B 2WXOA 2KK8A 2L7RA 2IO2B 1KLGD 2L52A 3RUIB 5BYRA 1EO6A 1SXTA 1CMXB 4KX6B 3T8MA 5BMIA 3UF8A 1VZ8A 2N1WA 4LNKA 4XYCA 1FXAA 3M62B 1FEHA 1HA5A 2D10A 2ASQA 2V4LA 5FR6A 2GBKA 2KFJA 2KN5A 1FMAD 4HPPA 1OTRB 4P1CC 3JVZX 2FCNA 2VZKD 3VUWA 2BKFA 3NUHB 2NCNA 3NVVA 1XF5L 4KVGB 3PRPB 2LRUA 1P1AA 4B95A 1IPGA 1J7CA 4ICVA 2JF5A 1N5WA 2K22A 4FXCA 2M56B 4HKZE 2V9HA 2W82A 4DHZE 3A1QA 3GS2A 1OQQA 3PREA 2LVPA 1SIFA 4DWFA 2N0SB 4XZ4A 5TR5A 2BS2B 4ZOHC 4NQLB 1FD6A 4HEA1 2RMMA 3TBLD 4EOYA 1DOYA 3PLVA 2V3NA 2GBRA 2BF8B 1DYQA 5E6JA 2DAJA 4NJ7A 2JXXA 4W9IA 4C00A 1UH6A 3RNAC 2L76A 2L0TA 5DPSA 2FE8A 2BYVE 2L0FA 2WWZA 4HPMB 2A5UA 2N9KA 5KHOA 2WHIA 1YJIA 2DYMA 4FULA 5G5HA 4LNOA 4RGTA 2R61A 5DPWA 4BKGA 4M00A 4YXDB 1JWMD 4OVVA 3ENEA 4KDLB 1IYFA 2RD0A 4IM0A 4IM3A 1HZ6A 3TEZA 2L83A 2ZPYA 3ECIA 3N32A 5IAAC 3RMKC 4HXDA 1K52A 3DBHB 5BYQA 2ZNVC 1XLPA 4M0WB 2K25A 1P9DU 2LHDA 1EM7A 1QQRA 1ENFA 4JIOU 3ZXRA 5EE3A 2PLPA 3QCAA 3HVDA 3KQ4A 1ZKHA 3OLMD 1TIFA 1ESFA 3ZJTA 3SFDB 4II2B 1L2NA 2GMIC 2KTRB 2W9NA 1XLQA 3BVZA 3P42A 1ZP0B 2WXJA 4FHKA 4ASWC 3APDA 5AZGA 4KGRA 1C4PA 4A6QA 3TIXA 3MP9A 3ZO5B 2DZKA 1VZ7A 1HE8A 3PZDA 3IVFA 4YWGG 1E9MA 1SGHA 3VTVA 4N58A 2N7DA 2N7EA 3P4PB 3C8YA 4E3CA 3QC8B 2K3UA 3DDCB 2WDRB 2MBBB 2QHOA 1L0YB 3AE3B 3ML8A 1BXTA 2C9WB 3NS8A 1WXAA 3ZRCA 3PS6A 2EMSA 4K7WA 1E0ZA 3ZYYX 4RMAA 1WI0A 4KIKA 5KHQA 3DPDA 4IW0A 4C80A 3Q3MC 4II3B 1RRBA 2D3BA 1VZ6A 2INNE 2FUG1 5CX3A 4DHJD 3H9DA 1JROA 2HJ8A 5LLIA 2K9XA 2IPKD 1XCQL 3A9JA 3ZDTA 3AE7B 3UGBB 5G5GA 4AUQC 1G6JA 1QKZA 1WXMA 2W55A 4HDQA 1EUVB 2M17A 5D2MB 2KKCA 4E71A 3ML9A 3HIZA 2JPHA 3R2IA 1TKEA 2J0KA 5J17A 2BQQA 2XK5A 3ZNID 1SF0A 1WXVA 2MHJA 4PS8A 1WH3A 3GOEA 3TUOA 3NJTA 2MX2A 4EFOA 3DVGY 4LK0M 2LMCA 4GDLB 3VHTC 1CQVA 2KJHB 1DGJA 1FCLA 1RYJA 2K6QA 2KNBA 3AECB 5EE1A 5H92C 1IP9A 4EZKA 3GP7A 4DXAB 1PGXA 2C7MB 4UDUC 3BYTB 2M0AA 3KUDB 3VRAB 3VVWB 3EA6A 1L6UA 5AUIA 3MTNB 2KTFA 3L54A 2RPVA 1YQ3B 4TMAB 4EEWA 3PTFC 3Q2AC 1WRDB 4P16A 2BS4B 4US9A 4MSQB 2QMTA 5E6PA 5BMGA 3DBRI 5G55A 2MBEA 2ZCBA 2PVGC 4BFRA 2AQ1B 2K8CA 5IOIA 1UBQA 3SDLC 1JW9D 2ON8A 5IN7A 1V49A 3EHVA 1JRUA 5J2RA 3SR6A 2G3QB 2KHWB 1QOGA 1KTKA 4YSZB 3ZNHB 2ZJDA 3DVNU 2VZKB 4DDGD 4MGZE 2IY1B 5LXIB 4F7ZA 2B3AA 4D2KA 3TEYA 3VAWA 2J0JA 2DBYA 1IGDA 3OWEB 2WU5B 3Q8BA 3L16A 1XO3A 2OJWA 1ACCA 1CJEA 2WX0A 2D07B 1FNWA 1YN3A 1ROEA 3PZ7A 3OJ3A 3RNGC 4K3CA 1JWUD 3MC9A 4LTUA 1B9RA 2Y5BB 4GB9A 3LYYA 2KLGA 4ICUA 2ZW0A 2LGSA 4O1NA 4GDKA 2IGHA 3Q3OC 5BO4B 3N20C 2XEWA 3H7PB 3RD2A 4WJQA 2O6VA 1ET6A 3T3NA 2KYWA 1QF6A 1C4CA 3WAMA 1UWXA 2NMQA 2BYFA 2LJ5A 4KDIC 3HHMA 2IZVB 2PEAA 4ZRIA 3P4RB 1RFKA 4LNNA 4PK1A 2WDQB 1FPYA 2KFKB 1YX5B 3BINA 3KVFB 2JRHA 2Z8LA 4A90A 4BZAA 3WANA 1TKYA 3NHEB 1NDDA 3PGEA 1IBXB 2MP2A 3EECA 2FCSA 3AV8A 4NJCA 3Q8AA 3M95A 4HJGE 3NG0A 4WWMA 3HUIA 4GIVA 1V1PB 4GSWA 2HDEA 2GBJA 3ZQ4A 3ZTDA 1RFAA 2M1MA 3UINB 4OZAA 2WLBA 2YEPB 4FJVB 3W5UB 3K9PB 2G4DB 4FA6A 2N7JA 3T9LA 2BWFA 2N9PC 5LNK1 2C5LC 1WXQA 1ZXHA 4WJNA 4EUTA 1KH0A 2TSSA 4S0RA 3ZJVA 1DOXA 3QK0A 2I1JA 1I7HA 1L0VB 3CIRB 3X23A 3ZW3A 3WIMA 1Z2MA 3DBHI 4W9GA 4M8MA 3X0WA 3N30A 2ZNVB 3U52E 3JSVB 3DHHC 3FILB 2MJDA 2JZ3B 1PYWD 2VH1A 1T3QA 4JL9A 3LDZE 4NY0A 3EFCA 2A4ZA 1T6BX 3AE4B 3APFA 4DHJB 1WFYA 1P98A 5CTRC 4DXGA 4N6EB 3MHSD 3ZGZA 3K9OB 2KWDA 1L7YA 3QA8A 4KSLC 1D5XC 3PO0A 3RN9C 1K50A 4K7UA 4BVUC 2ZVOA 4LNFA 2HD5B 4K3BA 2BTEA 3VDZA 3AEBB 5C1ZA 2LXCA 3PRZA 2X38A 5HKHA 4EE2A 2O2VA 3NOBA 3H8HA 2I38A 2SAKA 1PQSA 1YN4A 3S2AA 1B1ZA 1RLFA 1WGGA 2JWZA 4MACA 4KKIA 4USAA 3IG3A 1L4ZB 1HEZE 3RI7C 3ONSA 2G45B 1L6VA 2K0PA 1NI2A 1LO5D 4GXBA 2GBMA 3BVMA 1YJ1A 3IBEA 1WZ3A 4JWUC 1VRAB 2IY0B 1E8XA 2J52A 2WGSA 1FXIA 2W3SA 4TKNA 1WJ6A 2NBUA 3DHGC 2O6VD 1V81A 4QAYA 1EWCA 1TTNA 4RM9A 2N4FA 3I63C 4HKQA 2JX5A 3DBSA 2M19A 1GC7A 3A9KA 3IAM1 3NVWA 4MELA 4AP4C 5L83A 1PGAA 3ZUNA 3BK1A 4BOZB 1YN5A 4MGKE 2PE9A 1LGRA 1FRRA 5AZFA 3KWVA 5AUKA 4TQ0A 1C76A 2I2YA 1QOAA 3AE6B 1OEYA 3VTUA 3PPAA 2WXKA 1WE7A 3Q6BA 5D6JB 2KLCA 2IO1B 1WJNA 1I42A 5CHWA 2J53A 3GE8C 3P2BA 1V6EA 4MSMB 3ABVB 4RM8A 3GZNI 2H88B 4WH4A 3UQAA 1E7VA 4DBGA 1UNSA 3AU5A 1XEEA 2J7QB 3PVLA 3AULA 2MEKA 1NENB 1TY2A 4IDIA 4A3OA 4NQKE 1M94A 3I3TB 4W9LA 5HHDG 1FNUA 2XBBC 3I5JC 4KGSA 4NAWB 2RPQA 2VRRB 1WZ0A 2EMTA 3HRDD 2REXA 3AB5A 1WR1A 3AXCA 4AQ7A 1L5PA 1OFFA 1V1OA 4PYZA 1SSNA 2WX1A 3JYUA 2JZZA 1JRPA 1T5XD 1VLBA 2L05A 1S3SG 4KIKB 4JWSC 2N9LA 2LUMA 2IO0B 3AN1A 2KMMA 4KKJA 3D32A 1H4RA 2KJRA 1UELA 1WIAA 1EWYC 3P4QB 1HZ5A 1L0XB 4L1BA 2NBWB 4BKTA 3QAQA 3N1YC 2LWPA 2K5PA 1N61A 2KWCA 1I4GA 3LXFA 4KZ0A 4WAFA 1Q1OA 2RR9A 2YEPF 4MGIE 2FBWB 4ANVA 5GXGB 2LRWA 3KLSX 1H8CA 4MJSB 3RZFA 1V9JA 1D6EC 1F77A 4ITKA 4WAAA 2INPE 5C23A 4FJYA 1V5TA 4I6NB 3AE5B 3DWGC 4NZLB 1C9FA 3AH7A 1WGYA 1C77A 3AU4A 1PFDA 4CQNA 4AOFA 4Q2JA 3Q8FA 3RNFC 1WGKA 3APCA 4BAXA 1JWBD 2MWSB 2PKOA 3V62A 3VRBB 1GAQB 2BVCA 3TSSA 1LM8B 1D4BA 4TQ1A 4B9KA 3L17A 2DWQA 2NTSA 3NS1A 3H6NA 3RT3B 3QX1A 4HLEA 1UGJA 2BGFA 4C4VB 1CZPA 2AX5A 1T0SC 1GB4A 1N5XA 2KANA 2W3RA 3U7DA 2R2OA 1HQRD 3HM3A 2IYDB 2PTLA 2EKIA 2IO3B 1JWAD 2MBQA 2BYEA 1ZE3D 1J7AA 1N63A 4NPNA 2W54A 3KYDD 4GU2A 1UWMA 4MEMA 3RFZB 1E6EB 5HG2A 3B0AA 4N9F4 2QDFA 1Z5SB 2RGFA 4I6PA 3BWUD 3VTWA 1WY8A 4IWOA 4M0WA 2DZMA 3R66C 4FLHA 4HRSA 4WIPA 1J8CA 1MG4A 5L95C 2LVQA 3W9CB 4ZRPA 2XNAC 4C56C 1AYFA 3BZDB 2LI5A 1CK1A 3RPFC 3LB8C 5JH5C 4PYUA 5BMHA 1I4RA 1NBFC 1XD3B 2JYEA 3V6EB 2KQ4X 1WX8A 1JALA 2WXPA 3QIJA 1MJDA 2E3TA 2L32A 1V2YA 3NZSA 3GZNB 2O6VB 1GG3A 3BY4B 3RYTA 3URYA 4RCOA 5EE0A 1SB3C 3MC8A 4DQOC 3UI3A 4IG7B 4LLGM 1XXGA 2Z59B 4DDID 4HPLB 1AN8A 2FCQA 3UQBA 2QJLA 4OZBA 2WDTB 2M0XA 2AQ2B 2D3GA 3KUZA 2D2QA 3SEBA 1EF5A 4CHKA 1WGDA 3ZVVA 4N59A 2PMVA 4ZHOA 2KDBA 2V3PA 2MP2B 2YLMA 2ZCCA 2JXTA 2QCZA 1SIJA 2GLSA 1I35A 4XDCA 1XCTL 1R4MI 4RH6A 1KJTA 1VDVA 2CHZA 3EGRA 1TZ1A 4XWWA 2KDMA 4YTPB 3CF6E 3AEFB 3AEAB 2LASA 4AS1A 1NI3A 1EU4A 1KLUD 4XE0A 5E6OA 1MG8A 2OHFA 1FRDA 1F2RC 4RGNA 5D3DA 5LXHA 1YQBA 1WR6E 4FBJB 3L08A 4IKGA 4A8XC 2ZEQA 1SE9A 1UBIA 3AEDB 3VH4B 2WXFA 1XLOA 3FAHA 4BKSA 5GMVA 1HTOA 2NR2A 3M3JA 3AE2B 2KX0A 3Q14C 1T0RC 4FN2A 3ZRFA 3TCAA 4C7YA 3B2FA 4MH8A 3WAPA 1YJJA 4PS3A 5BYSA 4DHZB 3B1LX 1GC6A 1K51A 3L4PA 4JX1C 4HCNB 1YX6B 1P7FA 2H89B 4URKA 1WE6A 1KFYB 4GMVA 2QILA 4L23A 3B2GA 3Q3FA 2NVUI 1JMLA 3C0RB 4WJOA 5CHFA 4JQWC 3M63B 1FFUA 4MH0E 3V61A 1AW7A 2OJRA 2R2QA 2NS5A 4WWOA 4WQOB 2J0MA 1F9JA 4IWQA 1A70A 2RDGA 1UUPA 1PUTA 2KC1A 1TY0A 3Q8CA 1YD8U 1K53A 4W9FA 1WWTA 2CU3A 2O2VB 5DPRA 2J4XA 3JW0X 2KXJA 4NNJB 2MRPA 2KJ6A 1ZGUB 3R7RA 5J18A 3Q69A 4WQMA 2PW9A 2JY6A 2LZ6A 4P1BC 3QARA 4A9AA 1TS2A 1MHXA 4ACFA 2MQJA 3OAWA 3TJPA 5C2TB 1XT9B 2KWUB 5AZHA 4FJZA 2FNJB 2CHWA 1E7UA 2BW2A 2LD9A 4ZRQA 4YL8A 1WRIA 2ZPNA 2LGYA 3U4EG 1FXTB 3IFWB 5MPOA 5IO9A 2JUOA 3H7PA 2LHEA 2CJNA 5JXVA 2D3CA 2KACA 3AE1B 3WCQA 1I4PA 2GB1A 2BYTA 1Q10A 3H1UA 3TMPB 3FKYA 1N60A 1ISNA 3PSEB 1E8YA 3TEXA 4K1RB 3SFEB 1ZUD2 1E8WA 4B0MA 2KN4A 1WSPA 2KFKA 2JT4B 2D5GA 2Y5PA 1T0YA 4X57B 4XGAB 3P4SB 4WJPA 4G3XB 1VD2A 5FR3A 4KZCA 4MM3A 1K8RB 1F52A 2WS3B 1L4DB 2IDYA 5JHAA 2KMAA 2MBOA 4HVBA 3TL5A 1IUEA 1YNTE 2QEJC 3U7ZA 2YVCA 2INCC 2K8BA 1E7PB 3ZDMC 4B0EA 1XQQA 3UIOB 4ARCA 3DBLI 3A1QB 4I6LB 4K81A 2BWES 4EZJA 4OZCA 4ANWA 1FNVA 1R4NB 2INDC 2AYOB 1RM6C 2V1YA 3N9YC 1J7BA 2UU7A 1BMLC 1ZDVA 1E8ZA 2FIDA 1SBBB 2WXQA 5C3JB 5DCNA 1R4MB 2OEDA 3ZNZB 1NYQA 2BB6A 2E6XA 1FCCC 2KWVB 3N1XC 2UWQA 3EFUA 3KW5B 1S1QB 5HI1A 1KF6B 4K7SA 1YQ4B 3H7SA 4RNAA 2OOBB 3U8ZA 2JWUA 4FHJA 1KOTA 1R7SA 3P63A 3AE9B 4IC7B 1GNUA 2LGDA 4ZYNA 3MHZA 3T3OA 1YOVB 1J0GA 1WMHA 2N1VA 3NVZA 4LJOB 1E5WA 3ZJUA 1STEA 1YIWA 1P7EA 1TJEA 1Y8RC 2NPTA 3AM9A 5T8IA 4FADA 1GOZA 2I1KA 4YTNB 1C79A 3E56A 3J9CA 4REZA 1V80A 4IM2A 4ANUA 1JCKB 2BKRB 1OEYJ 2MSED 3KYCD 2QC8A 2QIEB 1D5MC 1WJUA 1UGMA 2N9XA 4JGHB 3AI5A 2ZW1A 4KGTA 1WYWB 1GUAB 2WXIA 3Q8EA 2MJ3A 2KAJA 4YSYB 3BYYB 4AWJA 4PS7A 3HVZA 4DXFA 3QQ8B 2ICIA 3VUYA 4RFBA 5G2NA 3MC0B 1UD7A 4W9JA 1WX9A 4WWNA 4A3PA 4AJYB 2KZRA 1TKGA 2IGDA 2KO3A 1C78A 5FK9C 3L0WB 2K6DB 2CKHB 3BK2A 2GOWA 3Q3NC 3W5VB 1QOFA 1SE2A 2LEKA 5CHVC 3HK0A 1MVKA 2DHZA 3Q3JA 2X8XX 4JLCA 1BT0A 2WXLA 2B76B 3AE8B 4ANXA 1V97A 3A9JB 1V5OA 2IGGA 2GRIA 3DOWA 4OVZA 2LGIA 5EE9A 2DENB 3KUCB 1I4HA 3QWZB 4KV2A 1C4AA 1KM7A 2KC2A 3EUB2 4RGOS 3DCGA 2SEBD 3V6CB 4ZYSA 2CS4A 1EU3A 2ACZB 2AEHA 1SE4A 3N3KB 2XK5B 4LNIA 1OGWA 2D11A 2ONQA 3BVGA 1OQYA 5IP4D 4R3DA 2CU1A 2RSUA 2ZZPB 3B08A 2NTTA 5TSSA 3PV1A 2WXHA 2D3AA 2CR5A 4YSXB 3R7QA 3O13A 1ZXIA 4F8CB 1WGRA 1D3ZA 3PHXB 3R2TA 1KLVA 2BT6A 4XX5A 4MT5A 3C19A 4M02A 1PDXA 2GBNA 1QOBA 1WXSA 3NVYA 4NAWA 3ZTCA 1TYGB 1ZPSA 2V0GA 5D94A 5DPTA 1RWSA 2Q5WD 2KQ7A 2WDVB 3VXWA 2Z0EB 4CYEA 3DBLB 2K1FA 1IGCA 3SHQA 2JYTA 1NVID 3U2SC 2GI9A 3KH0A 1QILA 2C60A 2WNMA 2KQSA 2KT7A 4RF1A 2DLBA 2VH2A 3CWIA 3SU8X 2MLBA 4CO7A 1D5ZC 1P3QU 4G50A 2LUEA 4OVUA 3ZXVA 2EELA 2G4SA 4P7IA 4XC2A 1MPEA 3LJ3A 2RDBC 2MW5A 3ALBA 1HTQA 2MA9B 3W2DA 3DVNV 5D3IB 3VH3B 4JE3B 2HTME 2KDIA 3VQIA 4M8NA 5EDSA 2BBCA 3L10B 1VR9A 3SD5A 3WAOA 3L13A 2WXMA 3RULA 3PRMB 2M4NA 4HJKA 2FAZA 2WQYB 2KTRA 4B6WA 5D7GA 3W1YA 2L00B 1WM3A 2WU2B 4GDKB 4MJSA 4ZRKA 2JQRB 1NEKB 3CSFA 5JHBA 2HJ1A 2PPHA 1F1HA 2HTHA 2MJEA 5H8YE 3V05A 4HDOA 1FM0D 1VCBA 1N62A 1SEBD 1A5RA 2HE7A 3IAS1 3PLUA 1NYRA 4LDTD 5I4DA 3IT4B 4W9KA 3V60A 3DVGX 1SJED 1WF9A 4A55A 3EC8A 3DWMA 3N1ZC 4C7ZA 2RDHA 4WURA 3MJWA 4H2AA 2J42A 1C3TA 1R4NI 4L2YA 4C4VA 3DQVA 2LVOA 2AQ3B 1MFWA 2ZVNA 3GE3C 3W1SA 2LGXA 3RCZA 1VJKA 2KD0A 1WGHA 2LXAA 2BB5A 2DZIA 3E9SA 1WYGA 4TUUA 2IBIB 3KWLA 2WYQA 1TGZB 1XLNA 2V4IB 3PZ8A 1M4VA 2L8JA 3VR8B 4LCDE 1JWSD 4W9HA 3MFGA 4F1SA 3ZIMA 1FIQA 4JPSA 3IHPC 3NZUA 2MH7A 4BBNC 2JZPA 1ET9A 4W9DA 3VUXA 3I57A 3U30A 2WXRA 4HROA 1PGBA 1SE3A 2C7HA 4GDLA 1EF1A 1GPXA 1Y56A 4TSSA 2MCNB 1GB1A 1TBEA 4NJ6A 1QZEA 2DYBA 1UZXB 2AL3A 4OW0A 3BIID 2BS3B 2KVRA 4YTMB 4ZRJA 4BBNF 3RNCC 4US8A 1E90A 4GLSC 1TZOA 3RNEC 4G11A 2M8SA 2QSDA 1F0ZA 2N9EB 3AEEB 3GB1A 3PHWB 3CSTA 4DK5A 1RAXA 2JVCA 4XDDA 1I4XA 3I9V1 1T0QC 4HK2A 2FIFA 4MM3B 4W9CA 3RNBC 2JU6X 2DAFA 3A4RA 3NZ3A 1QLBB 3OG5A 1V8CA 3UIPB 3WA0A 2DX5B 5E6NA 4AJWA 2L1AA 2PJHA 1TS4A 1AWDA 2MBHA 1YMHE 3WALA 1SJHD 3PT2B 2V3SA 2Z0DB 3TEWA 3AEGB 2DYOA 1N6ZA 1AARA 3RZWC 2KDEB 1ZW7A 2KVZA 1V86A 4KSKC 4GOCA 1TS3A 2K8HA 3P1MA 3MJ5A 4GN1A 3QJZA 1F2RI 4ZHPA 2EKEC 2WP9B 1LFDA 2LFIA 3OJ4B 2UYZB 1OQRA 2G1EA 3W1SC 4BOSC 1Q0WB 1LQBA 1TS5A 2L3ZA 2Y5CA 4J3OD 4W9EA 3HM6X 4E74A 2KX3A 5HFYA 4YT0B 2C7NB 5JZEB 2CHXA 3A9KB 1J19A 1HXYD 1MI0A 3QHTA 3VR9B 1LXDA 2KOXA 4OHJA 1WJ4A 1WMHB 3ZKJC 1I4QA 4NAMA 4WWPA 1E10A 1ZOYB 4IUMB 1FFVA 2NPTB 2DZJA 2Y3AA 2AL6A 3O65B 4PT5A 4S17A 2BPSA 4IWPA 2XN9C 3ZLZA 1BUIC 4P6VF 4RF0A 4A20A 1IBXA 2AWTA 3ETRA
chains in the Genus database with same CATH topology
4MGYE 1U4AA 2KZRA 4GDKA 5AEKB 4NPNA 5BO4B 2XEWA 3KYDD 3H7PB 4GU2A 1X1MA 3RD2A 4EKUA 4WJQA 2KO3A 4MEMA 4HCPB 3L0WB 2O6VA 2JRIB 2K6DB 3NY5A 4ZDVA 3B0AA 3ZNGC 2FCMA 4HWIB 2CKHB 4N9F4 1Z5SB 2GOWA 2RGFA 4I6PA 3R3MA 3WAMA 3VTWA 1WY8A 5CHVC 4IWOA 2DZMA 3HK0A 1GJZA 2BYFA 2LJ5A 4MDKE 3R66C 4KDIC 4FLHA 3HHMA 2DHZA 2IZVB 2NBVB 2PEAA 3Q3JA 4ZRIA 1J8CA 4JLCA 5L95C 1BT0A 2K39A 4TV3A 2LVQA 2KMCA 2KFKB 4ANXA 1YX5B 3BINA 3KVFB 1WX7A 2JRHA 1P0RA 2PE6B 1WM2A 2LI5A 3A9JB 3WANA 3A33B 1V5OA 5JH5C 3NHEB 4PYUA 1NDDA 3PGEA 3DOWA 5IA7A 3CMMB 4BKSD 1NBFC 1XD3B 2DENB 3KUCB 2MP2A 2FUHB 3EECA 3QWZB 4KV2A 2FCSA 1KM7A 1C1YB 2KC2A 3V6EB 1WX8A 3QIJA 3DCGA 3M95A 3VFKA 3V6CB 2CS4A 2KDFB 3A4SC 1V2YA 3NZSA 4EZLA 2AEHA 2O6VB 1GG3A 3BY4B 3RYTA 3N3KB 2XK5B 4LDTB 4GGQA 4G0NB 4GIVA 1OGWA 2D11A 4GSWA 4IG7B 4J6IA 1Q5WB 2GBJA 2Z59B 4DDID 3ZTDA 3JSVA 1RFAA 4HPLB 2M1MA 2FCQA 1OQYA 4LJPB 3UINB 4FJVB 2CU1A 2RSUA 3UQBA 2ZZPB 3B08A 2KK8A 2WDTB 2L7RA 2IO2B 2M0XA 3K9PB 3PV1A 2G4DB 4FA6A 3RUIB 2D3GA 1EO6A 3KUZA 2CR5A 1CMXB 1EF5A 2D2QA 1WGDA 3ZVVA 3T9LA 4CHKA 3T8MA 3R7QA 3UF8A 2BWFA 2N9PC 4F8CB 1WGRA 2N1WA 1D3ZA 3PHXB 2KDBA 3M62B 2MP2B 2YLMA 1KLVA 2C5LC 4XX5A 2D10A 2ASQA 4WJNA 2ZCCA 4EUTA 2V4LA 5FR6A 2GBKA 2GBNA 1I35A 3QK0A 2I1JA 1R4MI 1KJTA 1WXSA 4NAWA 3X23A 3ZW3A 3ZTCA 2CHZA 2KFJA 2KN5A 3WIMA 1Z2MA 3DBHI 4W9GA 1TZ1A 1OTRB 4M8MA 5D94A 5DPTA 3X0WA 3N30A 2KQ7A 3JVZX 2ZNVB 3VXWA 3CF6E 3JSVB 2FCNA 2Z0EB 4CYEA 2K1FA 2JZ3B 3VUWA 3SHQA 2BKFA 2LASA 2NCNA 5E6OA 4JL9A 1MG8A 3KH0A 3LDZE 4NY0A 2A4ZA 2C60A 4KVGB 3PRPB 2LRUA 1P1AA 2KQSA 4B95A 1IPGA 4ICVA 2JF5A 3SU8X 2MLBA 3APFA 4CO7A 4DHJB 5LXHA 1WFYA 1P3QU 4G50A 2LUEA 1P98A 5CTRC 4DHZE 1YQBA 3A1QA 4OVUA 3MHSD 3K9OB 3PREA 2LVPA 1SIFA 1WR6E 1L7YA 3QA8A 3L08A 4KSLC 4DWFA 4FBJB 2ZEQA 4XZ4A 1SE9A 2G4SA 1UBIA 5TR5A 3VH4B 4P7IA 4NQLB 4XC2A 4BKSA 5GMVA 3LJ3A 2NR2A 3M3JA 3TBLD 4K7UA 2MW5A 3ALBA 4BVUC 4EOYA 3PLVA 2KX0A 2ZVOA 2MA9B 4FN2A 3ZRFA 3DVNV 3TCAA 2GBRA 2BF8B 2HD5B 3VH3B 2DAJA 3WAPA 4NJ7A 2JXXA 4PS3A 3VDZA 4W9IA 2KDIA 5C1ZA 2LXCA 1UH6A 3PRZA 4DHZB 5HKHA 3B1LX 2O2VA 1GC6A 2L76A 3NOBA 1YX6B 2L0TA 4HCNB 5DPSA 1PQSA 3VQIA 4M8NA 4URKA 5EDSA 1WE6A 2BYVE 4GMVA 3S2AA 1RLFA 3L10B 1WGGA 2L0FA 3SD5A 3L13A 3WAOA 2WWZA 4HPMB 2A5UA 3RULA 2JWZA 3PRMB 2M4NA 4HJKA 3Q3FA 5KHOA 2FAZA 3IG3A 2NVUI 2DYMA 2KTRA 3C0RB 4FULA 4B6WA 5D7GA 3W1YA 4WJOA 5CHFA 2L00B 4JQWC 5DPWA 3ONSA 1WM3A 4MJSA 4GDKB 2G45B 3M63B 4BKGA 4MH0E 3V61A 1NI2A 4ZRKA 4OVVA 3ENEA 4GXBA 2OJRA 2GBMA 4KDLB 1IYFA 2R2QA 2NS5A 3CSFA 2RD0A 4WWOA 4WQOB 5JHBA 1YJ1A 3IBEA 2J0MA 4IM0A 2PPHA 4IM3A 1F9JA 4IWQA 1WZ3A 2HTHA 2ZPYA 3ECIA 3N32A 5IAAC 2IY0B 4HXDA 2KC1A 1E8XA 4HDOA 2ZNVC 1VCBA 4M0WB 2K25A 1P9DU 1YD8U 1A5RA 2HE7A 4TKNA 1WJ6A 4W9FA 2NBUA 3PLUA 2O6VD 1V81A 2O2VB 5DPRA 1TTNA 4RM9A 4LDTD 3JW0X 2KXJA 4JIOU 4NNJB 2MRPA 2KJ6A 2N4FA 3DVGX 4W9KA 3V60A 1WF9A 1ZGUB 3QCAA 3DBSA 3R7RA 3EC8A 1ZKHA 3OLMD 5J18A 1GC7A 3A9KA 4MELA 3MJWA 4AP4C 2JY6A 5L83A 2LZ6A 4II2B 3ZUNA 2GMIC 1L2NA 2KTRB 2W9NA 4BOZB 3QARA 4MGKE 2PE9A 1C3TA 5AZFA 1R4NI 4FHKA 4ASWC 3APDA 5AZGA 4TQ0A 2MQJA 3OAWA 3TJPA 3DQVA 1XT9B 3TIXA 2KWUB 5AZHA 4FJZA 1OEYA 3VTUA 3ZO5B 2DZKA 2FNJB 2CHWA 2LVOA 1HE8A 3PZDA 3PPAA 1E7UA 2LD9A 3IVFA 2ZVNA 3W1SA 1SGHA 1WE7A 2LGXA 5D6JB 3VTVA 4YL8A 2N7DA 2KLCA 2IO1B 1WJNA 2N7EA 4E3CA 2ZPNA 3QC8B 3RCZA 3DDCB 5CHWA 2KD0A 1I42A 2LGYA 2MBBB 1WGHA 2LXAA 2QHOA 3P2BA 1V6EA 4MSMB 2DZIA 3ML8A 1FXTB 3IFWB 4RM8A 2C9WB 3NS8A 4TUUA 2IBIB 2JUOA 3GZNI 2WYQA 3H7PA 1TGZB 1WXAA 3ZRCA 3UQAA 1E7VA 3PS6A 4DBGA 2EMSA 4K7WA 3AU5A 3PVLA 2J7QB 4RMAA 1WI0A 4KIKA 5KHQA 2L8JA 3AULA 3DPDA 4LCDE 4W9HA 4F1SA 3ZIMA 4A3OA 4IW0A 4II3B 4NQKE 3IHPC 1M94A 3NZUA 3TMPB 1RRBA 3H1UA 4BBNC 3I3TB 1ISNA 3PSEB 4W9DA 3VUXA 1E8YA 4W9LA 3U30A 5CX3A 4DHJD 4K1RB 3H9DA 2C7HA 4GDLA 1EF1A 1E8WA 2XBBC 4NAWB 2HJ8A 2KFKA 2RPQA 5LLIA 2MCNB 2JT4B 2VRRB 1WZ0A 2EMTA 2REXA 1WR1A 3A9JA 3AXCA 3ZDTA 1T0YA 4X57B 3UGBB 4WJPA 1TBEA 4G3XB 4AUQC 1G6JA 1VD2A 4NJ6A 1QZEA 4KZCA 4PYZA 2DYBA 1UZXB 1K8RB 2AL3A 4MM3A 5JHAA 2WX1A 2KMAA 2MBOA 4HVBA 3JYUA 3TL5A 2JZZA 1WXMA 4HDQA 1EUVB 2M17A 5D2MB 2YVCA 2KKCA 4E71A 3ML9A 3HIZA 2K8BA 2KVRA 2JPHA 2J0KA 2L05A 3ZDMC 5J17A 1S3SG 2XK5A 4KIKB 4ZRJA 1WXVA 3ZNID 4BBNF 1XQQA 1E90A 1WH3A 4PS8A 3UIOB 3DBLI 3A1QB 3GOEA 4I6LB 2BWES 4K81A 4G11A 2M8SA 2IO0B 2MX2A 4EFOA 4EZJA 3DVGY 4ANWA 2N9EB 3D32A 2AYOB 2V1YA 3PHWB 3CSTA 1H4RA 2KJRA 4GDLB 1UELA 3VHTC 1WIAA 1E8ZA 2KJHB 4DK5A 2FIDA 1RAXA 5DCNA 2JVCA 2K6QA 2KNBA 2NBWB 1IP9A 3ZNZB 4BKTA 3QAQA 4EZKA 4HK2A 2KWVB 2UWQA 3EFUA 3KW5B 4DXAB 2LWPA 1S1QB 2KWCA 2FIFA 4W9CA 4K7SA 2C7MB 3H7SA 1KOTA 2OOBB 3U8ZA 4FHJA 3KUDB 2DAFA 3A4RA 3VVWB 3UIPB 4IC7B 3WA0A 2DX5B 5E6NA 4KZ0A 2PJHA 4AJWA 1GNUA 1Q1OA 2LGDA 2RR9A 3MTNB 4ZYNA 2KTFA 2MBHA 3L54A 3WALA 4MGIE 3PT2B 4EEWA 4ANVA 3PTFC 1J0GA 1WRDB 2LRWA 1WMHA 2N1VA 1H8CA 2V3SA 4MJSB 3RZFA 1V9JA 2Z0DB 4MSQB 4LJOB 1E5WA 2DYOA 4WAAA 5E6PA 5C23A 1AARA 3RZWC 3DBRI 5G55A 2KDEB 2MBEA 1ZW7A 2ZCBA 1V86A 4KSKC 4FJYA 4GOCA 1V5TA 2K8HA 1YIWA 4I6NB 4BFRA 1Y8RC 3QJZA 4GN1A 2K8CA 2EKEC 2NPTA 1UBQA 1LFDA 3SDLC 3OJ4B 2UYZB 4FADA 1WGYA 3AU4A 3W1SC 4BOSC 1V49A 1Q0WB 1LQBA 4AOFA 2L3ZA 3EHVA 1JRUA 2I1KA 5J2RA 3APCA 2G3QB 4W9EA 2KHWB 3ZNHB 2ZJDA 2MWSB 3DVNU 3HM6X 4E74A 4DDGD 2KX3A 3V62A 4MGZE 1V80A 2IY1B 4IM2A 2C7NB 1LM8B 4F7ZA 2CHXA 5JZEB 5LXIB 2B3AA 4ANUA 4TQ1A 3A9KB 1J19A 2BKRB 2J0JA 3L17A 3VAWA 4B9KA 3QHTA 3H6NA 1OEYJ 2MSED 3KYCD 3RT3B 1LXDA 2KOXA 1WJ4A 3L16A 1WMHB 3QX1A 1WJUA 4HLEA 1UGMA 2N9XA 4JGHB 2BGFA 3AI5A 3ZKJC 1WYWB 1GUAB 4WWPA 2WX0A 2D07B 4IUMB 2NPTB 2KANA 4AWJA 4PS7A 2DZJA 3U7DA 2R2OA 2AL6A 3OJ3A 3O65B 3QQ8B 2BPSA 3HM3A 3VUYA 2IYDB 4IWPA 5G2NA 3ZLZA 2IO3B 1UD7A 4W9JA 4A20A 2MBQA 2BYEA 1WX9A 2Y5BB 4WWNA 4GB9A 2AWTA 2KLGA 4ICUA 4A3PA 4AJYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MGY E;  1U4A A;  2KZR A;  4GDK A;  5AEK B;  4NPN A;  5BO4 B;  2XEW A;  3KYD D;  3H7P B;  4GU2 A;  1X1M A;  3RD2 A;  4EKU A;  4WJQ A;  2KO3 A;  4MEM A;  4HCP B;  3L0W B;  2O6V A;  2JRI B;  2K6D B;  3NY5 A;  4ZDV A;  3B0A A;  3ZNG C;  2FCM A;  4HWI B;  2CKH B;  4N9F 4;  1Z5S B;  2GOW A;  2RGF A;  4I6P A;  3R3M A;  3WAM A;  3VTW A;  1WY8 A;  5CHV C;  4IWO A;  2DZM A;  3HK0 A;  1GJZ A;  2BYF A;  2LJ5 A;  4MDK E;  3R66 C;  4KDI C;  4FLH A;  3HHM A;  2DHZ A;  2IZV B;  2NBV B;  2PEA A;  3Q3J A;  4ZRI A;  1J8C A;  4JLC A;  5L95 C;  1BT0 A;  2K39 A;  4TV3 A;  2LVQ A;  2KMC A;  2KFK B;  4ANX A;  1YX5 B;  3BIN A;  3KVF B;  1WX7 A;  2JRH A;  1P0R A;  2PE6 B;  1WM2 A;  2LI5 A;  3A9J B;  3WAN A;  3A33 B;  1V5O A;  5JH5 C;  3NHE B;  4PYU A;  1NDD A;  3PGE A;  3DOW A;  5IA7 A;  3CMM B;  4BKS D;  1NBF C;  1XD3 B;  2DEN B;  3KUC B;  2MP2 A;  2FUH B;  3EEC A;  3QWZ B;  4KV2 A;  2FCS A;  1KM7 A;  1C1Y B;  2KC2 A;  3V6E B;  1WX8 A;  3QIJ A;  3DCG A;  3M95 A;  3VFK A;  3V6C B;  2CS4 A;  2KDF B;  3A4S C;  1V2Y A;  3NZS A;  4EZL A;  2AEH A;  2O6V B;  1GG3 A;  3BY4 B;  3RYT A;  3N3K B;  2XK5 B;  4LDT B;  4GGQ A;  4G0N B;  4GIV A;  1OGW A;  2D11 A;  4GSW A;  4IG7 B;  4J6I A;  1Q5W B;  2GBJ A;  2Z59 B;  4DDI D;  3ZTD A;  3JSV A;  1RFA A;  4HPL B;  2M1M A;  2FCQ A;  1OQY A;  4LJP B;  3UIN B;  4FJV B;  2CU1 A;  2RSU A;  3UQB A;  2ZZP B;  3B08 A;  2KK8 A;  2WDT B;  2L7R A;  2IO2 B;  2M0X A;  3K9P B;  3PV1 A;  2G4D B;  4FA6 A;  3RUI B;  2D3G A;  1EO6 A;  3KUZ A;  2CR5 A;  1CMX B;  1EF5 A;  2D2Q A;  1WGD A;  3ZVV A;  3T9L A;  4CHK A;  3T8M A;  3R7Q A;  3UF8 A;  2BWF A;  2N9P C;  4F8C B;  1WGR A;  2N1W A;  1D3Z A;  3PHX B;  2KDB A;  3M62 B;  2MP2 B;  2YLM A;  1KLV A;  2C5L C;  4XX5 A;  2D10 A;  2ASQ A;  4WJN A;  2ZCC A;  4EUT A;  2V4L A;  5FR6 A;  2GBK A;  2GBN A;  1I35 A;  3QK0 A;  2I1J A;  1R4M I;  1KJT A;  1WXS A;  4NAW A;  3X23 A;  3ZW3 A;  3ZTC A;  2CHZ A;  2KFJ A;  2KN5 A;  3WIM A;  1Z2M A;  3DBH I;  4W9G A;  1TZ1 A;  1OTR B;  4M8M A;  5D94 A;  5DPT A;  3X0W A;  3N30 A;  2KQ7 A;  3JVZ X;  2ZNV B;  3VXW A;  3CF6 E;  3JSV B;  2FCN A;  2Z0E B;  4CYE A;  2K1F A;  2JZ3 B;  3VUW A;  3SHQ A;  2BKF A;  2LAS A;  2NCN A;  5E6O A;  4JL9 A;  1MG8 A;  3KH0 A;  3LDZ E;  4NY0 A;  2A4Z A;  2C60 A;  4KVG B;  3PRP B;  2LRU A;  1P1A A;  2KQS A;  4B95 A;  1IPG A;  4ICV A;  2JF5 A;  3SU8 X;  2MLB A;  3APF A;  4CO7 A;  4DHJ B;  5LXH A;  1WFY A;  1P3Q U;  4G50 A;  2LUE A;  1P98 A;  5CTR C;  4DHZ E;  1YQB A;  3A1Q A;  4OVU A;  3MHS D;  3K9O B;  3PRE A;  2LVP A;  1SIF A;  1WR6 E;  1L7Y A;  3QA8 A;  3L08 A;  4KSL C;  4DWF A;  4FBJ B;  2ZEQ A;  4XZ4 A;  1SE9 A;  2G4S A;  1UBI A;  5TR5 A;  3VH4 B;  4P7I A;  4NQL B;  4XC2 A;  4BKS A;  5GMV A;  3LJ3 A;  2NR2 A;  3M3J A;  3TBL D;  4K7U A;  2MW5 A;  3ALB A;  4BVU C;  4EOY A;  3PLV A;  2KX0 A;  2ZVO A;  2MA9 B;  4FN2 A;  3ZRF A;  3DVN V;  3TCA A;  2GBR A;  2BF8 B;  2HD5 B;  3VH3 B;  2DAJ A;  3WAP A;  4NJ7 A;  2JXX A;  4PS3 A;  3VDZ A;  4W9I A;  2KDI A;  5C1Z A;  2LXC A;  1UH6 A;  3PRZ A;  4DHZ B;  5HKH A;  3B1L X;  2O2V A;  1GC6 A;  2L76 A;  3NOB A;  1YX6 B;  2L0T A;  4HCN B;  5DPS A;  1PQS A;  3VQI A;  4M8N A;  4URK A;  5EDS A;  1WE6 A;  2BYV E;  4GMV A;  3S2A A;  1RLF A;  3L10 B;  1WGG A;  2L0F A;  3SD5 A;  3L13 A;  3WAO A;  2WWZ A;  4HPM B;  2A5U A;  3RUL A;  2JWZ A;  3PRM B;  2M4N A;  4HJK A;  3Q3F A;  5KHO A;  2FAZ A;  3IG3 A;  2NVU I;  2DYM A;  2KTR A;  3C0R B;  4FUL A;  4B6W A;  5D7G A;  3W1Y A;  4WJO A;  5CHF A;  2L00 B;  4JQW C;  5DPW A;  3ONS A;  1WM3 A;  4MJS A;  4GDK B;  2G45 B;  3M63 B;  4BKG A;  4MH0 E;  3V61 A;  1NI2 A;  4ZRK A;  4OVV A;  3ENE A;  4GXB A;  2OJR A;  2GBM A;  4KDL B;  1IYF A;  2R2Q A;  2NS5 A;  3CSF A;  2RD0 A;  4WWO A;  4WQO B;  5JHB A;  1YJ1 A;  3IBE A;  2J0M A;  4IM0 A;  2PPH A;  4IM3 A;  1F9J A;  4IWQ A;  1WZ3 A;  2HTH A;  2ZPY A;  3ECI A;  3N32 A;  5IAA C;  2IY0 B;  4HXD A;  2KC1 A;  1E8X A;  4HDO A;  2ZNV C;  1VCB A;  4M0W B;  2K25 A;  1P9D U;  1YD8 U;  1A5R A;  2HE7 A;  4TKN A;  1WJ6 A;  4W9F A;  2NBU A;  3PLU A;  2O6V D;  1V81 A;  2O2V B;  5DPR A;  1TTN A;  4RM9 A;  4LDT D;  3JW0 X;  2KXJ A;  4JIO U;  4NNJ B;  2MRP A;  2KJ6 A;  2N4F A;  3DVG X;  4W9K A;  3V60 A;  1WF9 A;  1ZGU B;  3QCA A;  3DBS A;  3R7R A;  3EC8 A;  1ZKH A;  3OLM D;  5J18 A;  1GC7 A;  3A9K A;  4MEL A;  3MJW A;  4AP4 C;  2JY6 A;  5L83 A;  2LZ6 A;  4II2 B;  3ZUN A;  2GMI C;  1L2N A;  2KTR B;  2W9N A;  4BOZ B;  3QAR A;  4MGK E;  2PE9 A;  1C3T A;  5AZF A;  1R4N I;  4FHK A;  4ASW C;  3APD A;  5AZG A;  4TQ0 A;  2MQJ A;  3OAW A;  3TJP A;  3DQV A;  1XT9 B;  3TIX A;  2KWU B;  5AZH A;  4FJZ A;  1OEY A;  3VTU A;  3ZO5 B;  2DZK A;  2FNJ B;  2CHW A;  2LVO A;  1HE8 A;  3PZD A;  3PPA A;  1E7U A;  2LD9 A;  3IVF A;  2ZVN A;  3W1S A;  1SGH A;  1WE7 A;  2LGX A;  5D6J B;  3VTV A;  4YL8 A;  2N7D A;  2KLC A;  2IO1 B;  1WJN A;  2N7E A;  4E3C A;  2ZPN A;  3QC8 B;  3RCZ A;  3DDC B;  5CHW A;  2KD0 A;  1I42 A;  2LGY A;  2MBB B;  1WGH A;  2LXA A;  2QHO A;  3P2B A;  1V6E A;  4MSM B;  2DZI A;  3ML8 A;  1FXT B;  3IFW B;  4RM8 A;  2C9W B;  3NS8 A;  4TUU A;  2IBI B;  2JUO A;  3GZN I;  2WYQ A;  3H7P A;  1TGZ B;  1WXA A;  3ZRC A;  3UQA A;  1E7V A;  3PS6 A;  4DBG A;  2EMS A;  4K7W A;  3AU5 A;  3PVL A;  2J7Q B;  4RMA A;  1WI0 A;  4KIK A;  5KHQ A;  2L8J A;  3AUL A;  3DPD A;  4LCD E;  4W9H A;  4F1S A;  3ZIM A;  4A3O A;  4IW0 A;  4II3 B;  4NQK E;  3IHP C;  1M94 A;  3NZU A;  3TMP B;  1RRB A;  3H1U A;  4BBN C;  3I3T B;  1ISN A;  3PSE B;  4W9D A;  3VUX A;  1E8Y A;  4W9L A;  3U30 A;  5CX3 A;  4DHJ D;  4K1R B;  3H9D A;  2C7H A;  4GDL A;  1EF1 A;  1E8W A;  2XBB C;  4NAW B;  2HJ8 A;  2KFK A;  2RPQ A;  5LLI A;  2MCN B;  2JT4 B;  2VRR B;  1WZ0 A;  2EMT A;  2REX A;  1WR1 A;  3A9J A;  3AXC A;  3ZDT A;  1T0Y A;  4X57 B;  3UGB B;  4WJP A;  1TBE A;  4G3X B;  4AUQ C;  1G6J A;  1VD2 A;  4NJ6 A;  1QZE A;  4KZC A;  4PYZ A;  2DYB A;  1UZX B;  1K8R B;  2AL3 A;  4MM3 A;  5JHA A;  2WX1 A;  2KMA A;  2MBO A;  4HVB A;  3JYU A;  3TL5 A;  2JZZ A;  1WXM A;  4HDQ A;  1EUV B;  2M17 A;  5D2M B;  2YVC A;  2KKC A;  4E71 A;  3ML9 A;  3HIZ A;  2K8B A;  2KVR A;  2JPH A;  2J0K A;  2L05 A;  3ZDM C;  5J17 A;  1S3S G;  2XK5 A;  4KIK B;  4ZRJ A;  1WXV A;  3ZNI D;  4BBN F;  1XQQ A;  1E90 A;  1WH3 A;  4PS8 A;  3UIO B;  3DBL I;  3A1Q B;  3GOE A;  4I6L B;  2BWE S;  4K81 A;  4G11 A;  2M8S A;  2IO0 B;  2MX2 A;  4EFO A;  4EZJ A;  3DVG Y;  4ANW A;  2N9E B;  3D32 A;  2AYO B;  2V1Y A;  3PHW B;  3CST A;  1H4R A;  2KJR A;  4GDL B;  1UEL A;  3VHT C;  1WIA A;  1E8Z A;  2KJH B;  4DK5 A;  2FID A;  1RAX A;  5DCN A;  2JVC A;  2K6Q A;  2KNB A;  2NBW B;  1IP9 A;  3ZNZ B;  4BKT A;  3QAQ A;  4EZK A;  4HK2 A;  2KWV B;  2UWQ A;  3EFU A;  3KW5 B;  4DXA B;  2LWP A;  1S1Q B;  2KWC A;  2FIF A;  4W9C A;  4K7S A;  2C7M B;  3H7S A;  1KOT A;  2OOB B;  3U8Z A;  4FHJ A;  3KUD B;  2DAF A;  3A4R A;  3VVW B;  3UIP B;  4IC7 B;  3WA0 A;  2DX5 B;  5E6N A;  4KZ0 A;  2PJH A;  4AJW A;  1GNU A;  1Q1O A;  2LGD A;  2RR9 A;  3MTN B;  4ZYN A;  2KTF A;  2MBH A;  3L54 A;  3WAL A;  4MGI E;  3PT2 B;  4EEW A;  4ANV A;  3PTF C;  1J0G A;  1WRD B;  2LRW A;  1WMH A;  2N1V A;  1H8C A;  2V3S A;  4MJS B;  3RZF A;  1V9J A;  2Z0D B;  4MSQ B;  4LJO B;  1E5W A;  2DYO A;  4WAA A;  5E6P A;  5C23 A;  1AAR A;  3RZW C;  3DBR I;  5G55 A;  2KDE B;  2MBE A;  1ZW7 A;  2ZCB A;  1V86 A;  4KSK C;  4FJY A;  4GOC A;  1V5T A;  2K8H A;  1YIW A;  4I6N B;  4BFR A;  1Y8R C;  3QJZ A;  4GN1 A;  2K8C A;  2EKE C;  2NPT A;  1UBQ A;  1LFD A;  3SDL C;  3OJ4 B;  2UYZ B;  4FAD A;  1WGY A;  3AU4 A;  3W1S C;  4BOS C;  1V49 A;  1Q0W B;  1LQB A;  4AOF A;  2L3Z A;  3EHV A;  1JRU A;  2I1K A;  5J2R A;  3APC A;  2G3Q B;  4W9E A;  2KHW B;  3ZNH B;  2ZJD A;  2MWS B;  3DVN U;  3HM6 X;  4E74 A;  4DDG D;  2KX3 A;  3V62 A;  4MGZ E;  1V80 A;  2IY1 B;  4IM2 A;  2C7N B;  1LM8 B;  4F7Z A;  2CHX A;  5JZE B;  5LXI B;  2B3A A;  4ANU A;  4TQ1 A;  3A9K B;  1J19 A;  2BKR B;  2J0J A;  3L17 A;  3VAW A;  4B9K A;  3QHT A;  3H6N A;  1OEY J;  2MSE D;  3KYC D;  3RT3 B;  1LXD A;  2KOX A;  1WJ4 A;  3L16 A;  1WMH B;  3QX1 A;  1WJU A;  4HLE A;  1UGM A;  2N9X A;  4JGH B;  2BGF A;  3AI5 A;  3ZKJ C;  1WYW B;  1GUA B;  4WWP A;  2WX0 A;  2D07 B;  4IUM B;  2NPT B;  2KAN A;  4AWJ A;  4PS7 A;  2DZJ A;  3U7D A;  2R2O A;  2AL6 A;  3OJ3 A;  3O65 B;  3QQ8 B;  2BPS A;  3HM3 A;  3VUY A;  2IYD B;  4IWP A;  5G2N A;  3ZLZ A;  2IO3 B;  1UD7 A;  4W9J A;  4A20 A;  2MBQ A;  2BYE A;  1WX9 A;  2Y5B B;  4WWN A;  4GB9 A;  2AWT A;  2KLG A;  4ICU A;  4A3P A;  4AJY B; 
#chains in the Genus database with same CATH topology
 2G9H D;  1U4A A;  4MGY E;  5AEK B;  2JSV X;  1X1M A;  4EKU A;  2PIA A;  4HCP B;  2DNF A;  2WXN A;  2JRI B;  3NY5 A;  4ZDV A;  3ZNG C;  2FCM A;  4HWI B;  1MHH E;  3V3X A;  1V1P A;  3R3M A;  1ZDX A;  4ARI A;  1QT9 A;  1UF0 A;  1GJZ A;  2WXG A;  4MDK E;  4M01 A;  2LJI A;  2NBV B;  1KRH A;  4RGM A;  2K39 A;  3DBR B;  3DHI C;  4TV3 A;  2KMC A;  2IJ0 A;  3IT6 B;  1WX7 A;  4IOI E;  1P0R A;  2PE6 B;  3FC4 A;  1WM2 A;  2PVO D;  3B9J A;  3A33 B;  1JQ4 A;  5IA7 A;  3CMM B;  4BKS D;  2FUH B;  5FKA C;  1C1Y B;  3AMZ A;  3R8B A;  3VFK A;  5IKC M;  2KDF B;  3A4S C;  4EZL A;  3NRZ A;  4LDT B;  4GGQ A;  4G0N B;  3IXS A;  1FO4 A;  4J6I A;  1Q5W B;  4XWT A;  3JSV A;  3FIL A;  2CJO A;  4LJP B;  1DOI A;  1TT5 B;  2WXO A;  2KK8 A;  2L7R A;  2IO2 B;  1KLG D;  2L52 A;  3RUI B;  5BYR A;  1EO6 A;  1SXT A;  1CMX B;  4KX6 B;  3T8M A;  5BMI A;  3UF8 A;  1VZ8 A;  2N1W A;  4LNK A;  4XYC A;  1FXA A;  3M62 B;  1FEH A;  1HA5 A;  2D10 A;  2ASQ A;  2V4L A;  5FR6 A;  2GBK A;  2KFJ A;  2KN5 A;  1FMA D;  4HPP A;  1OTR B;  4P1C C;  3JVZ X;  2FCN A;  2VZK D;  3VUW A;  2BKF A;  3NUH B;  2NCN A;  3NVV A;  1XF5 L;  4KVG B;  3PRP B;  2LRU A;  1P1A A;  4B95 A;  1IPG A;  1J7C A;  4ICV A;  2JF5 A;  1N5W A;  2K22 A;  4FXC A;  2M56 B;  4HKZ E;  2V9H A;  2W82 A;  4DHZ E;  3A1Q A;  3GS2 A;  1OQQ A;  3PRE A;  2LVP A;  1SIF A;  4DWF A;  2N0S B;  4XZ4 A;  5TR5 A;  2BS2 B;  4ZOH C;  4NQL B;  1FD6 A;  4HEA 1;  2RMM A;  3TBL D;  4EOY A;  1DOY A;  3PLV A;  2V3N A;  2GBR A;  2BF8 B;  1DYQ A;  5E6J A;  2DAJ A;  4NJ7 A;  2JXX A;  4W9I A;  4C00 A;  1UH6 A;  3RNA C;  2L76 A;  2L0T A;  5DPS A;  2FE8 A;  2BYV E;  2L0F A;  2WWZ A;  4HPM B;  2A5U A;  2N9K A;  5KHO A;  2WHI A;  1YJI A;  2DYM A;  4FUL A;  5G5H A;  4LNO A;  4RGT A;  2R61 A;  5DPW A;  4BKG A;  4M00 A;  4YXD B;  1JWM D;  4OVV A;  3ENE A;  4KDL B;  1IYF A;  2RD0 A;  4IM0 A;  4IM3 A;  1HZ6 A;  3TEZ A;  2L83 A;  2ZPY A;  3ECI A;  3N32 A;  5IAA C;  3RMK C;  4HXD A;  1K52 A;  3DBH B;  5BYQ A;  2ZNV C;  1XLP A;  4M0W B;  2K25 A;  1P9D U;  2LHD A;  1EM7 A;  1QQR A;  1ENF A;  4JIO U;  3ZXR A;  5EE3 A;  2PLP A;  3QCA A;  3HVD A;  3KQ4 A;  1ZKH A;  3OLM D;  1TIF A;  1ESF A;  3ZJT A;  3SFD B;  4II2 B;  1L2N A;  2GMI C;  2KTR B;  2W9N A;  1XLQ A;  3BVZ A;  3P42 A;  1ZP0 B;  2WXJ A;  4FHK A;  4ASW C;  3APD A;  5AZG A;  4KGR A;  1C4P A;  4A6Q A;  3TIX A;  3MP9 A;  3ZO5 B;  2DZK A;  1VZ7 A;  1HE8 A;  3PZD A;  3IVF A;  4YWG G;  1E9M A;  1SGH A;  3VTV A;  4N58 A;  2N7D A;  2N7E A;  3P4P B;  3C8Y A;  4E3C A;  3QC8 B;  2K3U A;  3DDC B;  2WDR B;  2MBB B;  2QHO A;  1L0Y B;  3AE3 B;  3ML8 A;  1BXT A;  2C9W B;  3NS8 A;  1WXA A;  3ZRC A;  3PS6 A;  2EMS A;  4K7W A;  1E0Z A;  3ZYY X;  4RMA A;  1WI0 A;  4KIK A;  5KHQ A;  3DPD A;  4IW0 A;  4C80 A;  3Q3M C;  4II3 B;  1RRB A;  2D3B A;  1VZ6 A;  2INN E;  2FUG 1;  5CX3 A;  4DHJ D;  3H9D A;  1JRO A;  2HJ8 A;  5LLI A;  2K9X A;  2IPK D;  1XCQ L;  3A9J A;  3ZDT A;  3AE7 B;  3UGB B;  5G5G A;  4AUQ C;  1G6J A;  1QKZ A;  1WXM A;  2W55 A;  4HDQ A;  1EUV B;  2M17 A;  5D2M B;  2KKC A;  4E71 A;  3ML9 A;  3HIZ A;  2JPH A;  3R2I A;  1TKE A;  2J0K A;  5J17 A;  2BQQ A;  2XK5 A;  3ZNI D;  1SF0 A;  1WXV A;  2MHJ A;  4PS8 A;  1WH3 A;  3GOE A;  3TUO A;  3NJT A;  2MX2 A;  4EFO A;  3DVG Y;  4LK0 M;  2LMC A;  4GDL B;  3VHT C;  1CQV A;  2KJH B;  1DGJ A;  1FCL A;  1RYJ A;  2K6Q A;  2KNB A;  3AEC B;  5EE1 A;  5H92 C;  1IP9 A;  4EZK A;  3GP7 A;  4DXA B;  1PGX A;  2C7M B;  4UDU C;  3BYT B;  2M0A A;  3KUD B;  3VRA B;  3VVW B;  3EA6 A;  1L6U A;  5AUI A;  3MTN B;  2KTF A;  3L54 A;  2RPV A;  1YQ3 B;  4TMA B;  4EEW A;  3PTF C;  3Q2A C;  1WRD B;  4P16 A;  2BS4 B;  4US9 A;  4MSQ B;  2QMT A;  5E6P A;  5BMG A;  3DBR I;  5G55 A;  2MBE A;  2ZCB A;  2PVG C;  4BFR A;  2AQ1 B;  2K8C A;  5IOI A;  1UBQ A;  3SDL C;  1JW9 D;  2ON8 A;  5IN7 A;  1V49 A;  3EHV A;  1JRU A;  5J2R A;  3SR6 A;  2G3Q B;  2KHW B;  1QOG A;  1KTK A;  4YSZ B;  3ZNH B;  2ZJD A;  3DVN U;  2VZK B;  4DDG D;  4MGZ E;  2IY1 B;  5LXI B;  4F7Z A;  2B3A A;  4D2K A;  3TEY A;  3VAW A;  2J0J A;  2DBY A;  1IGD A;  3OWE B;  2WU5 B;  3Q8B A;  3L16 A;  1XO3 A;  2OJW A;  1ACC A;  1CJE A;  2WX0 A;  2D07 B;  1FNW A;  1YN3 A;  1ROE A;  3PZ7 A;  3OJ3 A;  3RNG C;  4K3C A;  1JWU D;  3MC9 A;  4LTU A;  1B9R A;  2Y5B B;  4GB9 A;  3LYY A;  2KLG A;  4ICU A;  2ZW0 A;  2LGS A;  4O1N A;  4GDK A;  2IGH A;  3Q3O C;  5BO4 B;  3N20 C;  2XEW A;  3H7P B;  3RD2 A;  4WJQ A;  2O6V A;  1ET6 A;  3T3N A;  2KYW A;  1QF6 A;  1C4C A;  3WAM A;  1UWX A;  2NMQ A;  2BYF A;  2LJ5 A;  4KDI C;  3HHM A;  2IZV B;  2PEA A;  4ZRI A;  3P4R B;  1RFK A;  4LNN A;  4PK1 A;  2WDQ B;  1FPY A;  2KFK B;  1YX5 B;  3BIN A;  3KVF B;  2JRH A;  2Z8L A;  4A90 A;  4BZA A;  3WAN A;  1TKY A;  3NHE B;  1NDD A;  3PGE A;  1IBX B;  2MP2 A;  3EEC A;  2FCS A;  3AV8 A;  4NJC A;  3Q8A A;  3M95 A;  4HJG E;  3NG0 A;  4WWM A;  3HUI A;  4GIV A;  1V1P B;  4GSW A;  2HDE A;  2GBJ A;  3ZQ4 A;  3ZTD A;  1RFA A;  2M1M A;  3UIN B;  4OZA A;  2WLB A;  2YEP B;  4FJV B;  3W5U B;  3K9P B;  2G4D B;  4FA6 A;  2N7J A;  3T9L A;  2BWF A;  2N9P C;  5LNK 1;  2C5L C;  1WXQ A;  1ZXH A;  4WJN A;  4EUT A;  1KH0 A;  2TSS A;  4S0R A;  3ZJV A;  1DOX A;  3QK0 A;  2I1J A;  1I7H A;  1L0V B;  3CIR B;  3X23 A;  3ZW3 A;  3WIM A;  1Z2M A;  3DBH I;  4W9G A;  4M8M A;  3X0W A;  3N30 A;  2ZNV B;  3U52 E;  3JSV B;  3DHH C;  3FIL B;  2MJD A;  2JZ3 B;  1PYW D;  2VH1 A;  1T3Q A;  4JL9 A;  3LDZ E;  4NY0 A;  3EFC A;  2A4Z A;  1T6B X;  3AE4 B;  3APF A;  4DHJ B;  1WFY A;  1P98 A;  5CTR C;  4DXG A;  4N6E B;  3MHS D;  3ZGZ A;  3K9O B;  2KWD A;  1L7Y A;  3QA8 A;  4KSL C;  1D5X C;  3PO0 A;  3RN9 C;  1K50 A;  4K7U A;  4BVU C;  2ZVO A;  4LNF A;  2HD5 B;  4K3B A;  2BTE A;  3VDZ A;  3AEB B;  5C1Z A;  2LXC A;  3PRZ A;  2X38 A;  5HKH A;  4EE2 A;  2O2V A;  3NOB A;  3H8H A;  2I38 A;  2SAK A;  1PQS A;  1YN4 A;  3S2A A;  1B1Z A;  1RLF A;  1WGG A;  2JWZ A;  4MAC A;  4KKI A;  4USA A;  3IG3 A;  1L4Z B;  1HEZ E;  3RI7 C;  3ONS A;  2G45 B;  1L6V A;  2K0P A;  1NI2 A;  1LO5 D;  4GXB A;  2GBM A;  3BVM A;  1YJ1 A;  3IBE A;  1WZ3 A;  4JWU C;  1VRA B;  2IY0 B;  1E8X A;  2J52 A;  2WGS A;  1FXI A;  2W3S A;  4TKN A;  1WJ6 A;  2NBU A;  3DHG C;  2O6V D;  1V81 A;  4QAY A;  1EWC A;  1TTN A;  4RM9 A;  2N4F A;  3I63 C;  4HKQ A;  2JX5 A;  3DBS A;  2M19 A;  1GC7 A;  3A9K A;  3IAM 1;  3NVW A;  4MEL A;  4AP4 C;  5L83 A;  1PGA A;  3ZUN A;  3BK1 A;  4BOZ B;  1YN5 A;  4MGK E;  2PE9 A;  1LGR A;  1FRR A;  5AZF A;  3KWV A;  5AUK A;  4TQ0 A;  1C76 A;  2I2Y A;  1QOA A;  3AE6 B;  1OEY A;  3VTU A;  3PPA A;  2WXK A;  1WE7 A;  3Q6B A;  5D6J B;  2KLC A;  2IO1 B;  1WJN A;  1I42 A;  5CHW A;  2J53 A;  3GE8 C;  3P2B A;  1V6E A;  4MSM B;  3ABV B;  4RM8 A;  3GZN I;  2H88 B;  4WH4 A;  3UQA A;  1E7V A;  4DBG A;  1UNS A;  3AU5 A;  1XEE A;  2J7Q B;  3PVL A;  3AUL A;  2MEK A;  1NEN B;  1TY2 A;  4IDI A;  4A3O A;  4NQK E;  1M94 A;  3I3T B;  4W9L A;  5HHD G;  1FNU A;  2XBB C;  3I5J C;  4KGS A;  4NAW B;  2RPQ A;  2VRR B;  1WZ0 A;  2EMT A;  3HRD D;  2REX A;  3AB5 A;  1WR1 A;  3AXC A;  4AQ7 A;  1L5P A;  1OFF A;  1V1O A;  4PYZ A;  1SSN A;  2WX1 A;  3JYU A;  2JZZ A;  1JRP A;  1T5X D;  1VLB A;  2L05 A;  1S3S G;  4KIK B;  4JWS C;  2N9L A;  2LUM A;  2IO0 B;  3AN1 A;  2KMM A;  4KKJ A;  3D32 A;  1H4R A;  2KJR A;  1UEL A;  1WIA A;  1EWY C;  3P4Q B;  1HZ5 A;  1L0X B;  4L1B A;  2NBW B;  4BKT A;  3QAQ A;  3N1Y C;  2LWP A;  2K5P A;  1N61 A;  2KWC A;  1I4G A;  3LXF A;  4KZ0 A;  4WAF A;  1Q1O A;  2RR9 A;  2YEP F;  4MGI E;  2FBW B;  4ANV A;  5GXG B;  2LRW A;  3KLS X;  1H8C A;  4MJS B;  3RZF A;  1V9J A;  1D6E C;  1F77 A;  4ITK A;  4WAA A;  2INP E;  5C23 A;  4FJY A;  1V5T A;  4I6N B;  3AE5 B;  3DWG C;  4NZL B;  1C9F A;  3AH7 A;  1WGY A;  1C77 A;  3AU4 A;  1PFD A;  4CQN A;  4AOF A;  4Q2J A;  3Q8F A;  3RNF C;  1WGK A;  3APC A;  4BAX A;  1JWB D;  2MWS B;  2PKO A;  3V62 A;  3VRB B;  1GAQ B;  2BVC A;  3TSS A;  1LM8 B;  1D4B A;  4TQ1 A;  4B9K A;  3L17 A;  2DWQ A;  2NTS A;  3NS1 A;  3H6N A;  3RT3 B;  3QX1 A;  4HLE A;  1UGJ A;  2BGF A;  4C4V B;  1CZP A;  2AX5 A;  1T0S C;  1GB4 A;  1N5X A;  2KAN A;  2W3R A;  3U7D A;  2R2O A;  1HQR D;  3HM3 A;  2IYD B;  2PTL A;  2EKI A;  2IO3 B;  1JWA D;  2MBQ A;  2BYE A;  1ZE3 D;  1J7A A;  1N63 A;  4NPN A;  2W54 A;  3KYD D;  4GU2 A;  1UWM A;  4MEM A;  3RFZ B;  1E6E B;  5HG2 A;  3B0A A;  4N9F 4;  2QDF A;  1Z5S B;  2RGF A;  4I6P A;  3BWU D;  3VTW A;  1WY8 A;  4IWO A;  4M0W A;  2DZM A;  3R66 C;  4FLH A;  4HRS A;  4WIP A;  1J8C A;  1MG4 A;  5L95 C;  2LVQ A;  3W9C B;  4ZRP A;  2XNA C;  4C56 C;  1AYF A;  3BZD B;  2LI5 A;  1CK1 A;  3RPF C;  3LB8 C;  5JH5 C;  4PYU A;  5BMH A;  1I4R A;  1NBF C;  1XD3 B;  2JYE A;  3V6E B;  2KQ4 X;  1WX8 A;  1JAL A;  2WXP A;  3QIJ A;  1MJD A;  2E3T A;  2L32 A;  1V2Y A;  3NZS A;  3GZN B;  2O6V B;  1GG3 A;  3BY4 B;  3RYT A;  3URY A;  4RCO A;  5EE0 A;  1SB3 C;  3MC8 A;  4DQO C;  3UI3 A;  4IG7 B;  4LLG M;  1XXG A;  2Z59 B;  4DDI D;  4HPL B;  1AN8 A;  2FCQ A;  3UQB A;  2QJL A;  4OZB A;  2WDT B;  2M0X A;  2AQ2 B;  2D3G A;  3KUZ A;  2D2Q A;  3SEB A;  1EF5 A;  4CHK A;  1WGD A;  3ZVV A;  4N59 A;  2PMV A;  4ZHO A;  2KDB A;  2V3P A;  2MP2 B;  2YLM A;  2ZCC A;  2JXT A;  2QCZ A;  1SIJ A;  2GLS A;  1I35 A;  4XDC A;  1XCT L;  1R4M I;  4RH6 A;  1KJT A;  1VDV A;  2CHZ A;  3EGR A;  1TZ1 A;  4XWW A;  2KDM A;  4YTP B;  3CF6 E;  3AEF B;  3AEA B;  2LAS A;  4AS1 A;  1NI3 A;  1EU4 A;  1KLU D;  4XE0 A;  5E6O A;  1MG8 A;  2OHF A;  1FRD A;  1F2R C;  4RGN A;  5D3D A;  5LXH A;  1YQB A;  1WR6 E;  4FBJ B;  3L08 A;  4IKG A;  4A8X C;  2ZEQ A;  1SE9 A;  1UBI A;  3AED B;  3VH4 B;  2WXF A;  1XLO A;  3FAH A;  4BKS A;  5GMV A;  1HTO A;  2NR2 A;  3M3J A;  3AE2 B;  2KX0 A;  3Q14 C;  1T0R C;  4FN2 A;  3ZRF A;  3TCA A;  4C7Y A;  3B2F A;  4MH8 A;  3WAP A;  1YJJ A;  4PS3 A;  5BYS A;  4DHZ B;  3B1L X;  1GC6 A;  1K51 A;  3L4P A;  4JX1 C;  4HCN B;  1YX6 B;  1P7F A;  2H89 B;  4URK A;  1WE6 A;  1KFY B;  4GMV A;  2QIL A;  4L23 A;  3B2G A;  3Q3F A;  2NVU I;  1JML A;  3C0R B;  4WJO A;  5CHF A;  4JQW C;  3M63 B;  1FFU A;  4MH0 E;  3V61 A;  1AW7 A;  2OJR A;  2R2Q A;  2NS5 A;  4WWO A;  4WQO B;  2J0M A;  1F9J A;  4IWQ A;  1A70 A;  2RDG A;  1UUP A;  1PUT A;  2KC1 A;  1TY0 A;  3Q8C A;  1YD8 U;  1K53 A;  4W9F A;  1WWT A;  2CU3 A;  2O2V B;  5DPR A;  2J4X A;  3JW0 X;  2KXJ A;  4NNJ B;  2MRP A;  2KJ6 A;  1ZGU B;  3R7R A;  5J18 A;  3Q69 A;  4WQM A;  2PW9 A;  2JY6 A;  2LZ6 A;  4P1B C;  3QAR A;  4A9A A;  1TS2 A;  1MHX A;  4ACF A;  2MQJ A;  3OAW A;  3TJP A;  5C2T B;  1XT9 B;  2KWU B;  5AZH A;  4FJZ A;  2FNJ B;  2CHW A;  1E7U A;  2BW2 A;  2LD9 A;  4ZRQ A;  4YL8 A;  1WRI A;  2ZPN A;  2LGY A;  3U4E G;  1FXT B;  3IFW B;  5MPO A;  5IO9 A;  2JUO A;  3H7P A;  2LHE A;  2CJN A;  5JXV A;  2D3C A;  2KAC A;  3AE1 B;  3WCQ A;  1I4P A;  2GB1 A;  2BYT A;  1Q10 A;  3H1U A;  3TMP B;  3FKY A;  1N60 A;  1ISN A;  3PSE B;  1E8Y A;  3TEX A;  4K1R B;  3SFE B;  1ZUD 2;  1E8W A;  4B0M A;  2KN4 A;  1WSP A;  2KFK A;  2JT4 B;  2D5G A;  2Y5P A;  1T0Y A;  4X57 B;  4XGA B;  3P4S B;  4WJP A;  4G3X B;  1VD2 A;  5FR3 A;  4KZC A;  4MM3 A;  1K8R B;  1F52 A;  2WS3 B;  1L4D B;  2IDY A;  5JHA A;  2KMA A;  2MBO A;  4HVB A;  3TL5 A;  1IUE A;  1YNT E;  2QEJ C;  3U7Z A;  2YVC A;  2INC C;  2K8B A;  1E7P B;  3ZDM C;  4B0E A;  1XQQ A;  3UIO B;  4ARC A;  3DBL I;  3A1Q B;  4I6L B;  4K81 A;  2BWE S;  4EZJ A;  4OZC A;  4ANW A;  1FNV A;  1R4N B;  2IND C;  2AYO B;  1RM6 C;  2V1Y A;  3N9Y C;  1J7B A;  2UU7 A;  1BML C;  1ZDV A;  1E8Z A;  2FID A;  1SBB B;  2WXQ A;  5C3J B;  5DCN A;  1R4M B;  2OED A;  3ZNZ B;  1NYQ A;  2BB6 A;  2E6X A;  1FCC C;  2KWV B;  3N1X C;  2UWQ A;  3EFU A;  3KW5 B;  1S1Q B;  5HI1 A;  1KF6 B;  4K7S A;  1YQ4 B;  3H7S A;  4RNA A;  2OOB B;  3U8Z A;  2JWU A;  4FHJ A;  1KOT A;  1R7S A;  3P63 A;  3AE9 B;  4IC7 B;  1GNU A;  2LGD A;  4ZYN A;  3MHZ A;  3T3O A;  1YOV B;  1J0G A;  1WMH A;  2N1V A;  3NVZ A;  4LJO B;  1E5W A;  3ZJU A;  1STE A;  1YIW A;  1P7E A;  1TJE A;  1Y8R C;  2NPT A;  3AM9 A;  5T8I A;  4FAD A;  1GOZ A;  2I1K A;  4YTN B;  1C79 A;  3E56 A;  3J9C A;  4REZ A;  1V80 A;  4IM2 A;  4ANU A;  1JCK B;  2BKR B;  1OEY J;  2MSE D;  3KYC D;  2QC8 A;  2QIE B;  1D5M C;  1WJU A;  1UGM A;  2N9X A;  4JGH B;  3AI5 A;  2ZW1 A;  4KGT A;  1WYW B;  1GUA B;  2WXI A;  3Q8E A;  2MJ3 A;  2KAJ A;  4YSY B;  3BYY B;  4AWJ A;  4PS7 A;  3HVZ A;  4DXF A;  3QQ8 B;  2ICI A;  3VUY A;  4RFB A;  5G2N A;  3MC0 B;  1UD7 A;  4W9J A;  1WX9 A;  4WWN A;  4A3P A;  4AJY B;  2KZR A;  1TKG A;  2IGD A;  2KO3 A;  1C78 A;  5FK9 C;  3L0W B;  2K6D B;  2CKH B;  3BK2 A;  2GOW A;  3Q3N C;  3W5V B;  1QOF A;  1SE2 A;  2LEK A;  5CHV C;  3HK0 A;  1MVK A;  2DHZ A;  3Q3J A;  2X8X X;  4JLC A;  1BT0 A;  2WXL A;  2B76 B;  3AE8 B;  4ANX A;  1V97 A;  3A9J B;  1V5O A;  2IGG A;  2GRI A;  3DOW A;  4OVZ A;  2LGI A;  5EE9 A;  2DEN B;  3KUC B;  1I4H A;  3QWZ B;  4KV2 A;  1C4A A;  1KM7 A;  2KC2 A;  3EUB 2;  4RGO S;  3DCG A;  2SEB D;  3V6C B;  4ZYS A;  2CS4 A;  1EU3 A;  2ACZ B;  2AEH A;  1SE4 A;  3N3K B;  2XK5 B;  4LNI A;  1OGW A;  2D11 A;  2ONQ A;  3BVG A;  1OQY A;  5IP4 D;  4R3D A;  2CU1 A;  2RSU A;  2ZZP B;  3B08 A;  2NTT A;  5TSS A;  3PV1 A;  2WXH A;  2D3A A;  2CR5 A;  4YSX B;  3R7Q A;  3O13 A;  1ZXI A;  4F8C B;  1WGR A;  1D3Z A;  3PHX B;  3R2T A;  1KLV A;  2BT6 A;  4XX5 A;  4MT5 A;  3C19 A;  4M02 A;  1PDX A;  2GBN A;  1QOB A;  1WXS A;  3NVY A;  4NAW A;  3ZTC A;  1TYG B;  1ZPS A;  2V0G A;  5D94 A;  5DPT A;  1RWS A;  2Q5W D;  2KQ7 A;  2WDV B;  3VXW A;  2Z0E B;  4CYE A;  3DBL B;  2K1F A;  1IGC A;  3SHQ A;  2JYT A;  1NVI D;  3U2S C;  2GI9 A;  3KH0 A;  1QIL A;  2C60 A;  2WNM A;  2KQS A;  2KT7 A;  4RF1 A;  2DLB A;  2VH2 A;  3CWI A;  3SU8 X;  2MLB A;  4CO7 A;  1D5Z C;  1P3Q U;  4G50 A;  2LUE A;  4OVU A;  3ZXV A;  2EEL A;  2G4S A;  4P7I A;  4XC2 A;  1MPE A;  3LJ3 A;  2RDB C;  2MW5 A;  3ALB A;  1HTQ A;  2MA9 B;  3W2D A;  3DVN V;  5D3I B;  3VH3 B;  4JE3 B;  2HTM E;  2KDI A;  3VQI A;  4M8N A;  5EDS A;  2BBC A;  3L10 B;  1VR9 A;  3SD5 A;  3WAO A;  3L13 A;  2WXM A;  3RUL A;  3PRM B;  2M4N A;  4HJK A;  2FAZ A;  2WQY B;  2KTR A;  4B6W A;  5D7G A;  3W1Y A;  2L00 B;  1WM3 A;  2WU2 B;  4GDK B;  4MJS A;  4ZRK A;  2JQR B;  1NEK B;  3CSF A;  5JHB A;  2HJ1 A;  2PPH A;  1F1H A;  2HTH A;  2MJE A;  5H8Y E;  3V05 A;  4HDO A;  1FM0 D;  1VCB A;  1N62 A;  1SEB D;  1A5R A;  2HE7 A;  3IAS 1;  3PLU A;  1NYR A;  4LDT D;  5I4D A;  3IT4 B;  4W9K A;  3V60 A;  3DVG X;  1SJE D;  1WF9 A;  4A55 A;  3EC8 A;  3DWM A;  3N1Z C;  4C7Z A;  2RDH A;  4WUR A;  3MJW A;  4H2A A;  2J42 A;  1C3T A;  1R4N I;  4L2Y A;  4C4V A;  3DQV A;  2LVO A;  2AQ3 B;  1MFW A;  2ZVN A;  3GE3 C;  3W1S A;  2LGX A;  3RCZ A;  1VJK A;  2KD0 A;  1WGH A;  2LXA A;  2BB5 A;  2DZI A;  3E9S A;  1WYG A;  4TUU A;  2IBI B;  3KWL A;  2WYQ A;  1TGZ B;  1XLN A;  2V4I B;  3PZ8 A;  1M4V A;  2L8J A;  3VR8 B;  4LCD E;  1JWS D;  4W9H A;  3MFG A;  4F1S A;  3ZIM A;  1FIQ A;  4JPS A;  3IHP C;  3NZU A;  2MH7 A;  4BBN C;  2JZP A;  1ET9 A;  4W9D A;  3VUX A;  3I57 A;  3U30 A;  2WXR A;  4HRO A;  1PGB A;  1SE3 A;  2C7H A;  4GDL A;  1EF1 A;  1GPX A;  1Y56 A;  4TSS A;  2MCN B;  1GB1 A;  1TBE A;  4NJ6 A;  1QZE A;  2DYB A;  1UZX B;  2AL3 A;  4OW0 A;  3BII D;  2BS3 B;  2KVR A;  4YTM B;  4ZRJ A;  4BBN F;  3RNC C;  4US8 A;  1E90 A;  4GLS C;  1TZO A;  3RNE C;  4G11 A;  2M8S A;  2QSD A;  1F0Z A;  2N9E B;  3AEE B;  3GB1 A;  3PHW B;  3CST A;  4DK5 A;  1RAX A;  2JVC A;  4XDD A;  1I4X A;  3I9V 1;  1T0Q C;  4HK2 A;  2FIF A;  4MM3 B;  4W9C A;  3RNB C;  2JU6 X;  2DAF A;  3A4R A;  3NZ3 A;  1QLB B;  3OG5 A;  1V8C A;  3UIP B;  3WA0 A;  2DX5 B;  5E6N A;  4AJW A;  2L1A A;  2PJH A;  1TS4 A;  1AWD A;  2MBH A;  1YMH E;  3WAL A;  1SJH D;  3PT2 B;  2V3S A;  2Z0D B;  3TEW A;  3AEG B;  2DYO A;  1N6Z A;  1AAR A;  3RZW C;  2KDE B;  1ZW7 A;  2KVZ A;  1V86 A;  4KSK C;  4GOC A;  1TS3 A;  2K8H A;  3P1M A;  3MJ5 A;  4GN1 A;  3QJZ A;  1F2R I;  4ZHP A;  2EKE C;  2WP9 B;  1LFD A;  2LFI A;  3OJ4 B;  2UYZ B;  1OQR A;  2G1E A;  3W1S C;  4BOS C;  1Q0W B;  1LQB A;  1TS5 A;  2L3Z A;  2Y5C A;  4J3O D;  4W9E A;  3HM6 X;  4E74 A;  2KX3 A;  5HFY A;  4YT0 B;  2C7N B;  5JZE B;  2CHX A;  3A9K B;  1J19 A;  1HXY D;  1MI0 A;  3QHT A;  3VR9 B;  1LXD A;  2KOX A;  4OHJ A;  1WJ4 A;  1WMH B;  3ZKJ C;  1I4Q A;  4NAM A;  4WWP A;  1E10 A;  1ZOY B;  4IUM B;  1FFV A;  2NPT B;  2DZJ A;  2Y3A A;  2AL6 A;  3O65 B;  4PT5 A;  4S17 A;  2BPS A;  4IWP A;  2XN9 C;  3ZLZ A;  1BUI C;  4P6V F;  4RF0 A;  4A20 A;  1IBX A;  2AWT A;  3ETR A; 
#chains in the Genus database with same CATH homology
 4MGY E;  1U4A A;  2KZR A;  4GDK A;  5AEK B;  4NPN A;  5BO4 B;  2XEW A;  3KYD D;  3H7P B;  4GU2 A;  1X1M A;  3RD2 A;  4EKU A;  4WJQ A;  2KO3 A;  4MEM A;  4HCP B;  3L0W B;  2O6V A;  2JRI B;  2K6D B;  3NY5 A;  4ZDV A;  3B0A A;  3ZNG C;  2FCM A;  4HWI B;  2CKH B;  4N9F 4;  1Z5S B;  2GOW A;  2RGF A;  4I6P A;  3R3M A;  3WAM A;  3VTW A;  1WY8 A;  5CHV C;  4IWO A;  2DZM A;  3HK0 A;  1GJZ A;  2BYF A;  2LJ5 A;  4MDK E;  3R66 C;  4KDI C;  4FLH A;  3HHM A;  2DHZ A;  2IZV B;  2NBV B;  2PEA A;  3Q3J A;  4ZRI A;  1J8C A;  4JLC A;  5L95 C;  1BT0 A;  2K39 A;  4TV3 A;  2LVQ A;  2KMC A;  2KFK B;  4ANX A;  1YX5 B;  3BIN A;  3KVF B;  1WX7 A;  2JRH A;  1P0R A;  2PE6 B;  1WM2 A;  2LI5 A;  3A9J B;  3WAN A;  3A33 B;  1V5O A;  5JH5 C;  3NHE B;  4PYU A;  1NDD A;  3PGE A;  3DOW A;  5IA7 A;  3CMM B;  4BKS D;  1NBF C;  1XD3 B;  2DEN B;  3KUC B;  2MP2 A;  2FUH B;  3EEC A;  3QWZ B;  4KV2 A;  2FCS A;  1KM7 A;  1C1Y B;  2KC2 A;  3V6E B;  1WX8 A;  3QIJ A;  3DCG A;  3M95 A;  3VFK A;  3V6C B;  2CS4 A;  2KDF B;  3A4S C;  1V2Y A;  3NZS A;  4EZL A;  2AEH A;  2O6V B;  1GG3 A;  3BY4 B;  3RYT A;  3N3K B;  2XK5 B;  4LDT B;  4GGQ A;  4G0N B;  4GIV A;  1OGW A;  2D11 A;  4GSW A;  4IG7 B;  4J6I A;  1Q5W B;  2GBJ A;  2Z59 B;  4DDI D;  3ZTD A;  3JSV A;  1RFA A;  4HPL B;  2M1M A;  2FCQ A;  1OQY A;  4LJP B;  3UIN B;  4FJV B;  2CU1 A;  2RSU A;  3UQB A;  2ZZP B;  3B08 A;  2KK8 A;  2WDT B;  2L7R A;  2IO2 B;  2M0X A;  3K9P B;  3PV1 A;  2G4D B;  4FA6 A;  3RUI B;  2D3G A;  1EO6 A;  3KUZ A;  2CR5 A;  1CMX B;  1EF5 A;  2D2Q A;  1WGD A;  3ZVV A;  3T9L A;  4CHK A;  3T8M A;  3R7Q A;  3UF8 A;  2BWF A;  2N9P C;  4F8C B;  1WGR A;  2N1W A;  1D3Z A;  3PHX B;  2KDB A;  3M62 B;  2MP2 B;  2YLM A;  1KLV A;  2C5L C;  4XX5 A;  2D10 A;  2ASQ A;  4WJN A;  2ZCC A;  4EUT A;  2V4L A;  5FR6 A;  2GBK A;  2GBN A;  1I35 A;  3QK0 A;  2I1J A;  1R4M I;  1KJT A;  1WXS A;  4NAW A;  3X23 A;  3ZW3 A;  3ZTC A;  2CHZ A;  2KFJ A;  2KN5 A;  3WIM A;  1Z2M A;  3DBH I;  4W9G A;  1TZ1 A;  1OTR B;  4M8M A;  5D94 A;  5DPT A;  3X0W A;  3N30 A;  2KQ7 A;  3JVZ X;  2ZNV B;  3VXW A;  3CF6 E;  3JSV B;  2FCN A;  2Z0E B;  4CYE A;  2K1F A;  2JZ3 B;  3VUW A;  3SHQ A;  2BKF A;  2LAS A;  2NCN A;  5E6O A;  4JL9 A;  1MG8 A;  3KH0 A;  3LDZ E;  4NY0 A;  2A4Z A;  2C60 A;  4KVG B;  3PRP B;  2LRU A;  1P1A A;  2KQS A;  4B95 A;  1IPG A;  4ICV A;  2JF5 A;  3SU8 X;  2MLB A;  3APF A;  4CO7 A;  4DHJ B;  5LXH A;  1WFY A;  1P3Q U;  4G50 A;  2LUE A;  1P98 A;  5CTR C;  4DHZ E;  1YQB A;  3A1Q A;  4OVU A;  3MHS D;  3K9O B;  3PRE A;  2LVP A;  1SIF A;  1WR6 E;  1L7Y A;  3QA8 A;  3L08 A;  4KSL C;  4DWF A;  4FBJ B;  2ZEQ A;  4XZ4 A;  1SE9 A;  2G4S A;  1UBI A;  5TR5 A;  3VH4 B;  4P7I A;  4NQL B;  4XC2 A;  4BKS A;  5GMV A;  3LJ3 A;  2NR2 A;  3M3J A;  3TBL D;  4K7U A;  2MW5 A;  3ALB A;  4BVU C;  4EOY A;  3PLV A;  2KX0 A;  2ZVO A;  2MA9 B;  4FN2 A;  3ZRF A;  3DVN V;  3TCA A;  2GBR A;  2BF8 B;  2HD5 B;  3VH3 B;  2DAJ A;  3WAP A;  4NJ7 A;  2JXX A;  4PS3 A;  3VDZ A;  4W9I A;  2KDI A;  5C1Z A;  2LXC A;  1UH6 A;  3PRZ A;  4DHZ B;  5HKH A;  3B1L X;  2O2V A;  1GC6 A;  2L76 A;  3NOB A;  1YX6 B;  2L0T A;  4HCN B;  5DPS A;  1PQS A;  3VQI A;  4M8N A;  4URK A;  5EDS A;  1WE6 A;  2BYV E;  4GMV A;  3S2A A;  1RLF A;  3L10 B;  1WGG A;  2L0F A;  3SD5 A;  3L13 A;  3WAO A;  2WWZ A;  4HPM B;  2A5U A;  3RUL A;  2JWZ A;  3PRM B;  2M4N A;  4HJK A;  3Q3F A;  5KHO A;  2FAZ A;  3IG3 A;  2NVU I;  2DYM A;  2KTR A;  3C0R B;  4FUL A;  4B6W A;  5D7G A;  3W1Y A;  4WJO A;  5CHF A;  2L00 B;  4JQW C;  5DPW A;  3ONS A;  1WM3 A;  4MJS A;  4GDK B;  2G45 B;  3M63 B;  4BKG A;  4MH0 E;  3V61 A;  1NI2 A;  4ZRK A;  4OVV A;  3ENE A;  4GXB A;  2OJR A;  2GBM A;  4KDL B;  1IYF A;  2R2Q A;  2NS5 A;  3CSF A;  2RD0 A;  4WWO A;  4WQO B;  5JHB A;  1YJ1 A;  3IBE A;  2J0M A;  4IM0 A;  2PPH A;  4IM3 A;  1F9J A;  4IWQ A;  1WZ3 A;  2HTH A;  2ZPY A;  3ECI A;  3N32 A;  5IAA C;  2IY0 B;  4HXD A;  2KC1 A;  1E8X A;  4HDO A;  2ZNV C;  1VCB A;  4M0W B;  2K25 A;  1P9D U;  1YD8 U;  1A5R A;  2HE7 A;  4TKN A;  1WJ6 A;  4W9F A;  2NBU A;  3PLU A;  2O6V D;  1V81 A;  2O2V B;  5DPR A;  1TTN A;  4RM9 A;  4LDT D;  3JW0 X;  2KXJ A;  4JIO U;  4NNJ B;  2MRP A;  2KJ6 A;  2N4F A;  3DVG X;  4W9K A;  3V60 A;  1WF9 A;  1ZGU B;  3QCA A;  3DBS A;  3R7R A;  3EC8 A;  1ZKH A;  3OLM D;  5J18 A;  1GC7 A;  3A9K A;  4MEL A;  3MJW A;  4AP4 C;  2JY6 A;  5L83 A;  2LZ6 A;  4II2 B;  3ZUN A;  2GMI C;  1L2N A;  2KTR B;  2W9N A;  4BOZ B;  3QAR A;  4MGK E;  2PE9 A;  1C3T A;  5AZF A;  1R4N I;  4FHK A;  4ASW C;  3APD A;  5AZG A;  4TQ0 A;  2MQJ A;  3OAW A;  3TJP A;  3DQV A;  1XT9 B;  3TIX A;  2KWU B;  5AZH A;  4FJZ A;  1OEY A;  3VTU A;  3ZO5 B;  2DZK A;  2FNJ B;  2CHW A;  2LVO A;  1HE8 A;  3PZD A;  3PPA A;  1E7U A;  2LD9 A;  3IVF A;  2ZVN A;  3W1S A;  1SGH A;  1WE7 A;  2LGX A;  5D6J B;  3VTV A;  4YL8 A;  2N7D A;  2KLC A;  2IO1 B;  1WJN A;  2N7E A;  4E3C A;  2ZPN A;  3QC8 B;  3RCZ A;  3DDC B;  5CHW A;  2KD0 A;  1I42 A;  2LGY A;  2MBB B;  1WGH A;  2LXA A;  2QHO A;  3P2B A;  1V6E A;  4MSM B;  2DZI A;  3ML8 A;  1FXT B;  3IFW B;  4RM8 A;  2C9W B;  3NS8 A;  4TUU A;  2IBI B;  2JUO A;  3GZN I;  2WYQ A;  3H7P A;  1TGZ B;  1WXA A;  3ZRC A;  3UQA A;  1E7V A;  3PS6 A;  4DBG A;  2EMS A;  4K7W A;  3AU5 A;  3PVL A;  2J7Q B;  4RMA A;  1WI0 A;  4KIK A;  5KHQ A;  2L8J A;  3AUL A;  3DPD A;  4LCD E;  4W9H A;  4F1S A;  3ZIM A;  4A3O A;  4IW0 A;  4II3 B;  4NQK E;  3IHP C;  1M94 A;  3NZU A;  3TMP B;  1RRB A;  3H1U A;  4BBN C;  3I3T B;  1ISN A;  3PSE B;  4W9D A;  3VUX A;  1E8Y A;  4W9L A;  3U30 A;  5CX3 A;  4DHJ D;  4K1R B;  3H9D A;  2C7H A;  4GDL A;  1EF1 A;  1E8W A;  2XBB C;  4NAW B;  2HJ8 A;  2KFK A;  2RPQ A;  5LLI A;  2MCN B;  2JT4 B;  2VRR B;  1WZ0 A;  2EMT A;  2REX A;  1WR1 A;  3A9J A;  3AXC A;  3ZDT A;  1T0Y A;  4X57 B;  3UGB B;  4WJP A;  1TBE A;  4G3X B;  4AUQ C;  1G6J A;  1VD2 A;  4NJ6 A;  1QZE A;  4KZC A;  4PYZ A;  2DYB A;  1UZX B;  1K8R B;  2AL3 A;  4MM3 A;  5JHA A;  2WX1 A;  2KMA A;  2MBO A;  4HVB A;  3JYU A;  3TL5 A;  2JZZ A;  1WXM A;  4HDQ A;  1EUV B;  2M17 A;  5D2M B;  2YVC A;  2KKC A;  4E71 A;  3ML9 A;  3HIZ A;  2K8B A;  2KVR A;  2JPH A;  2J0K A;  2L05 A;  3ZDM C;  5J17 A;  1S3S G;  2XK5 A;  4KIK B;  4ZRJ A;  1WXV A;  3ZNI D;  4BBN F;  1XQQ A;  1E90 A;  1WH3 A;  4PS8 A;  3UIO B;  3DBL I;  3A1Q B;  3GOE A;  4I6L B;  2BWE S;  4K81 A;  4G11 A;  2M8S A;  2IO0 B;  2MX2 A;  4EFO A;  4EZJ A;  3DVG Y;  4ANW A;  2N9E B;  3D32 A;  2AYO B;  2V1Y A;  3PHW B;  3CST A;  1H4R A;  2KJR A;  4GDL B;  1UEL A;  3VHT C;  1WIA A;  1E8Z A;  2KJH B;  4DK5 A;  2FID A;  1RAX A;  5DCN A;  2JVC A;  2K6Q A;  2KNB A;  2NBW B;  1IP9 A;  3ZNZ B;  4BKT A;  3QAQ A;  4EZK A;  4HK2 A;  2KWV B;  2UWQ A;  3EFU A;  3KW5 B;  4DXA B;  2LWP A;  1S1Q B;  2KWC A;  2FIF A;  4W9C A;  4K7S A;  2C7M B;  3H7S A;  1KOT A;  2OOB B;  3U8Z A;  4FHJ A;  3KUD B;  2DAF A;  3A4R A;  3VVW B;  3UIP B;  4IC7 B;  3WA0 A;  2DX5 B;  5E6N A;  4KZ0 A;  2PJH A;  4AJW A;  1GNU A;  1Q1O A;  2LGD A;  2RR9 A;  3MTN B;  4ZYN A;  2KTF A;  2MBH A;  3L54 A;  3WAL A;  4MGI E;  3PT2 B;  4EEW A;  4ANV A;  3PTF C;  1J0G A;  1WRD B;  2LRW A;  1WMH A;  2N1V A;  1H8C A;  2V3S A;  4MJS B;  3RZF A;  1V9J A;  2Z0D B;  4MSQ B;  4LJO B;  1E5W A;  2DYO A;  4WAA A;  5E6P A;  5C23 A;  1AAR A;  3RZW C;  3DBR I;  5G55 A;  2KDE B;  2MBE A;  1ZW7 A;  2ZCB A;  1V86 A;  4KSK C;  4FJY A;  4GOC A;  1V5T A;  2K8H A;  1YIW A;  4I6N B;  4BFR A;  1Y8R C;  3QJZ A;  4GN1 A;  2K8C A;  2EKE C;  2NPT A;  1UBQ A;  1LFD A;  3SDL C;  3OJ4 B;  2UYZ B;  4FAD A;  1WGY A;  3AU4 A;  3W1S C;  4BOS C;  1V49 A;  1Q0W B;  1LQB A;  4AOF A;  2L3Z A;  3EHV A;  1JRU A;  2I1K A;  5J2R A;  3APC A;  2G3Q B;  4W9E A;  2KHW B;  3ZNH B;  2ZJD A;  2MWS B;  3DVN U;  3HM6 X;  4E74 A;  4DDG D;  2KX3 A;  3V62 A;  4MGZ E;  1V80 A;  2IY1 B;  4IM2 A;  2C7N B;  1LM8 B;  4F7Z A;  2CHX A;  5JZE B;  5LXI B;  2B3A A;  4ANU A;  4TQ1 A;  3A9K B;  1J19 A;  2BKR B;  2J0J A;  3L17 A;  3VAW A;  4B9K A;  3QHT A;  3H6N A;  1OEY J;  2MSE D;  3KYC D;  3RT3 B;  1LXD A;  2KOX A;  1WJ4 A;  3L16 A;  1WMH B;  3QX1 A;  1WJU A;  4HLE A;  1UGM A;  2N9X A;  4JGH B;  2BGF A;  3AI5 A;  3ZKJ C;  1WYW B;  1GUA B;  4WWP A;  2WX0 A;  2D07 B;  4IUM B;  2NPT B;  2KAN A;  4AWJ A;  4PS7 A;  2DZJ A;  3U7D A;  2R2O A;  2AL6 A;  3OJ3 A;  3O65 B;  3QQ8 B;  2BPS A;  3HM3 A;  3VUY A;  2IYD B;  4IWP A;  5G2N A;  3ZLZ A;  2IO3 B;  1UD7 A;  4W9J A;  4A20 A;  2MBQ A;  2BYE A;  1WX9 A;  2Y5B B;  4WWN A;  4GB9 A;  2AWT A;  2KLG A;  4ICU A;  4A3P A;  4AJY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...