5AZGA

Crystal structure of lgg-1 complexed with a unc-51 peptide
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
119
structure length
119
Chain Sequence
b'GPHMKWAYKEENNFEKRRAEGDKIRRKYPDRIPVIVEKAPKSKLHDLDKKKYLVPSDLTVGQFYFLIRKRIQLRPEDALFFFVNNVIPQTMTTMGQLYQDHHEEDLFLYIAYSDESVYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein lgg-1
publication title Structural Basis of the Differential Function of the Two C. elegans Atg8 Homologs, LGG-1 and LGG-2, in Autophagy
doi rcsb
source organism Caenorhabditis elegans
molecule tags Protein binding
total genus 36
structure length 119
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5azgA00
5E6NA 3ECIA 1WFYA 2DZJA 3L0WB 2DHZA 2UWQA 1UBIA 3RCZA 2KKCA 2DZIA 4OVVA 1P0RA 2JRIB 4DHZB 3ALBA 2BKRB 3EECA 4KZCA 3UIOB 4HPMB 1L7YA 2DYOA 4K1RB 3VFKA 1Q1OA 1XT9B 2L76A 2R2QA 1WGYA 2K8HA 4IC7B 5CHVC 4MSQB 3AU4A 4JIOU 4KVGB 2KZRA 2ZCCA 5KHOA 2LZ6A 1D3ZA 4AUQC 4PYUA 3A1QA 4BKGA 3DBLI 2EMSA 2NBWB 4BOZB 2O6VD 2MCNB 2N4FA 4NAWA 1E8WA 1L2NA 3ZDTA 4FLHA 3PPAA 4WWNA 1OEYA 3DQVA 2NS5A 3AULA 4MGKE 4W9LA 5C1ZA 2KX3A 3PZDA 3APDA 4M0WB 4KSLC 3WALA 2BKFA 4NPNA 3UF8A 1V9JA 4K7SA 4GU2A 4HJKA 2ASQA 3JYUA 3M3JA 1WJ4A 3PSEB 1WXVA 1QZEA 1UELA 1JRUA 2MP2B 2O2VB 2C7HA 4OVUA 5KHQA 1E7VA 4ANUA 4ICVA 4GDLA 1KJTA 3H7PB 5GMVA 3VUWA 4DHJD 5JH5C 3WA0A 3TCAA 4WWPA 1RFAA 2LVQA 3A33B 2CR5A 1WX8A 4NNJB 1G6JA 3GOEA 3WAMA 3SDLC 3LDZE 2KD0A 3A4RA 3VTWA 2HE7A 4GB9A 2FUHB 2MBHA 3JSVB 3IG3A 3APFA 2G4SA 2I1KA 2KX0A 4MGZE 4W9KA 3VVWB 4EKUA 1H8CA 3D32A 4HXDA 4MM3A 2KFKA 2KANA 2ZNVC 4GSWA 1WGHA 1WJ6A 4XZ4A 1IPGA 3K9PB 2M4NA 1WY8A 3KUZA 2MRPA 1WF9A 2LVPA 3R3MA 3DCGA 4NQLB 1XD3B 4MGIE 4LCDE 4GGQA 3X0WA 2JZZA 1E8XA 2K6DB 1TBEA 3UINB 3KW5B 2LGDA 1J19A 2DZMA 3VUYA 2PPHA 2AYOB 2LWPA 3QX1A 3R7QA 3A9JA 4HWIB 1UH6A 2L7RA 4W9CA 2C9WB 1Z5SB 2KHWB 4E3CA 1WMHA 2J0MA 1TTNA 2K8CA 4B9KA 4EZJA 2EMTA 1NBFC 3NHEB 3VUXA 3QWZB 2NPTB 3NZSA 3X23A 4BKSD 4JL9A 5IA7A 2ZJDA 4IG7B 1GNUA 1P9DU 1YX5B 5C23A 3V6CB 2DX5B 2J7QB 2LUEA 2IO3B 2WWZA 5DPTA 4BKSA 1A5RA 1GC7A 3RZFA 1GUAB 5LXHA 2MX2A 1S3SG 2ZVNA 3BINA 4TV3A 5DPSA 2GOWA 1IYFA 2LRWA 4LDTD 3T8MA 4FULA 2K6QA 1RLFA 4AOFA 3W1SA 5DPRA 3TMPB 4DDID 3U30A 3KVFB 1V5OA 2XK5B 4GN1A 2KXJA 1E5WA 2D07B 2IY0B 3B08A 2KDIA 2V1YA 4AJYB 2MLBA 2BWFA 2V3SA 2KFJA 1CMXB 4KZ0A 2AWTA 3ENEA 4ZDVA 3JVZX 2OOBB 4MELA 4I6LB 2IYDB 2L0TA 3UGBB 1C1YB 4TQ0A 5LXIB 3PTFC 4FJVB 1VD2A 3ZVVA 2N9PC 3DBSA 4EOYA 1UD7A 1GC6A 4MJSB 4IWOA 2XBBC 4NY0A 4AWJA 2ZZPB 2KNBA 3B0AA 2FAZA 3W1YA 3N3KB 4JLCA 4DWFA 3L54A 4G11A 2LGYA 3EC8A 1R4NI 2EKEC 4GDKA 2KWVB 3A9KA 3IVFA 1E8ZA 2J0JA 2D10A 3Q3FA 4MDKE 3WANA 4G3XB 3QQ8B 2AL6A 1K8RB 3ZLZA 4J6IA 4DK5A 3H1UA 3PREA 4ZRJA 5AZHA 2JXXA 1OEYJ 2DYBA 3OLMD 2C5LC 3RULA 4RMAA 2KVRA 1Y8RC 4IM2A 3V6EB 3WAPA 4W9IA 1YQBA 4XX5A 1EO6A 1WIAA 2BYEA 1ISNA 2PJHA 2BGFA 2O6VA 3A4SC 3ZRCA 2NR2A 4PS7A 3VXWA 5G55A 1RAXA 3IBEA 1P98A 1J8CA 3WAOA 2BYVE 2A4ZA 5CHWA 4MSMB 5J18A 5J17A 2BF8B 2FCNA 3RT3B 1WRDB 1GJZA 5D6JB 2LRUA 1YJ1A 2HTHA 2PE6B 2LVOA 2W9NA 2NBUA 2FIFA 1C3TA 4KIKA 4X57B 2BYFA 4W9HA 2FIDA 1FXTB 2JY6A 2KFKB 3SHQA 2JT4B 4ZRIA 3QIJA 2LASA 4ANXA 1S1QB 1P3QU 2KMAA 1UGMA 4KDIC 3QHTA 4KSKC 4MGYE 4IWPA 3RD2A 3VTUA 1WR1A 4NJ7A 2KO3A 2MBEA 5AEKB 2L0FA 2HD5B 4IUMB 5CHFA 3TIXA 2N7EA 1WH3A 1KM7A 5JZEB 1WXAA 2FNJB 2CS4A 2KC1A 4G0NB 2RR9A 4IM3A 1WM2A 2KWUB 4F7ZA 2JF5A 2LXAA 2DENB 4EZKA 4HVBA 1V5TA 1WI0A 3UIPB 2KDBA 2KQSA 1YX6B 3UQAA 2VRRB 4WJNA 2N1WA 2KJHB 3W1SC 5EDSA 2WX0A 4B95A 1WXSA 1TZ1A 2MSED 1V81A 2KLGA 2QHOA 1EF5A 2RPQA 3PV1A 4P7IA 3TJPA 2DAFA 3ZNHB 4BOSC 3M95A 2AL3A 3N30A 2D2QA 3DVGX 2LXCA 3H9DA 1Z2MA 4FHKA 3RUIB 3HK0A 2HJ8A 3ONSA 3PRZA 1SIFA 2MP2A 4HDQA 2O2VA 4MH0E 2J0KA 2Z59B 4PS3A 4ZYNA 3DBHI 4FBJB 2Z0DB 5DPWA 2IO0B 2KTRB 4W9JA 3H7PA 3SU8X 2C60A 2ZNVB 3BY4B 3HM6X 3U7DA 2GBRA 2KJRA 3PHXB 5E6OA 4WJOA 4E74A 4A3PA 4GMVA 1WE6A 2KDFB 5L95C 3VH4B 2UYZB 3RYTA 1WX9A 2IZVB 1GG3A 3L17A 5E6PA 2CHZA 3MHSD 3JSVA 1WJNA 2D3GA 2ZVOA 3L10B 3PLVA 3ZW3A 4CO7A 1WR6E 4A3OA 1Q5WB 2AEHA 4JQWC 4LJPB 2WDTB 1UBQA 2LJ5A 3SD5A 5DCNA 5AZGA 3T9LA 3ZO5B 3DVNU 4GDKB 4GXBA 4I6NB 3V60A 1XQQA 1SGHA 2MBOA 4MEMA 2JVCA 1ZGUB 2IO2B 4II2B 4TUUA 5D94A 2NCNA 4K81A 2N9XA 1AARA 3NOBA 1V86A 3CF6E 4WJQA 1R4MI 3IHPC 3QC8B 4WJPA 4E71A 3NZUA 3ZKJC 2N9EB 3PVLA 4IWQA 4EFOA 2KC2A 1MG8A 4FA6A 3DVNV 3GZNI 3A1QB 1E8YA 3O65B 4YL8A 4DHZE 2D11A 2L00B 3R66C 4ICUA 2G3QB 2DAJA 2M0XA 3LJ3A 3NS8A 4NAWB 2O6VB 2NPTA 2GBKA 2KJ6A 2KLCA 2WYQA 3KUCB 2A5UA 3P2BA 1SE9A 3B1LX 2C7MB 4W9DA 2ZCBA 3JW0X 4IM0A 4CHKA 1RRBA 1TGZB 2L05A 3OJ3A 1OGWA 3ZNZB 4HCPB 4HK2A 5L83A 3KYCD 5CTRC 5JHAA 2MW5A 3EFUA 4GDLB 1J0GA 4TQ1A 4A20A 4BVUC 4KDLB 4PS8A 4XC2A 3MTNB 4DHJB 1NI2A 3AU5A 2XK5A 3CSFA 3DOWA 3DPDA 3PGEA 2YLMA 5TR5A 1LQBA 1U4AA 3AI5A 4F8CB 2GBNA 4TKNA 1WX7A 2CKHB 4PYZA 3UQBA 4WWOA 1LM8B 4FADA 2PE9A 3Q3JA 4HCNB 1V6EA 2JUOA 1E7UA 3VAWA 1WZ3A 5JHBA 4MJSA 4GOCA 2JZ3B 2KWCA 2KTFA 3KH0A 2BWES 4FJZA 3QCAA 1UZXB 2LGXA 3L08A 3PLUA 1WZ0A 2PEAA 2C7NB 3VTVA 4HLEA 4AJWA 3QAQA 2LI5A 1IP9A 4W9FA 2R2OA 1F9JA 2KK8A 3APCA 2MA9B 5HKHA 2RGFA 4HDOA 2FCMA 4W9GA 4BBNC 3DDCB 1PQSA 1M94A 4F1SA 1I35A 3CSTA 2XEWA 1HE8A 2RSUA 3M63B 1NDDA 4FJYA 5BO4B 2MBQA 4BKTA 3ZTCA 2WX1A 2IO1B 3VH3B 4FN2A 3A9JB 4B6WA 2K39A 3H6NA 2K25A 3MJWA 3PRPB 4IW0A 2CU1A 3N32A 3S2AA 4EEWA 3ZIMA 4LJOB 2FCSA 3KUDB 1E90A 1WMHB 1WXMA 2ZEQA 2G4DB 2LD9A 3R7RA 2JPHA 4RM8A 2KMCA 2KN5A 3OAWA 2BPSA 2CHXA 4M8MA 1KLVA 2Y5BB 4DDGD 4N9F4 2KQ7A 1ZKHA 2M17A 1KOTA 3DBRI 3PRMB 4ANWA 2NVUI 3K9OB 3OJ4B 1EF1A 4NJ6A 1WGRA 4K7WA 2NBVB 2N1VA 3PS6A 4G50A 3L16A 4EUTA 3PHWB 4NQKE 1WE7A 1Q0WB 4LDTB 3HHMA 3ZNGC 3I3TB 2MWSB 2DZKA 4CYEA 3QA8A 5J2RA 5FR6A 1LXDA 4ZRKA 3V61A 4WQOB 4M8NA 2K8BA 1T0YA 4K7UA 2Z0EB 1WJUA 3VHTC 5IAAC 2JRHA 2REXA 1WYWB 2MQJA 2ZPYA 2GMIC 4KV2A 3CMMB 3M62B 3EHVA 3NY5A 2ZPNA 5D2MB 4HPLB 2M8SA 4W9EA 1V2YA 2DYMA 1P1AA 2FCQA 2IBIB 2CHWA 2V4LA 3C0RB 3TL5A 4GIVA 3ZDMC 1VCBA 2IY1B 3H7SA 2B3AA 1WM3A 2GBJA 3A9KB 2KDEB 3DVGY 4DBGA 3HM3A 3V62A 2MBBB 3QK0A 4DXAB 5AZFA 3ML8A 1V80A 4AP4C 2M1MA 2G45B 2L8JA 1WGGA 1OQYA 2L3ZA 1YIWA 5CX3A 1X1MA 3AXCA 3HIZA 2KTRA 1WGDA 3IFWB 1YD8U 4EZLA 2KOXA 1I42A 3ZUNA 4WAAA 3L13A 3ZTDA 5D7GA 3WIMA 3PT2B 4II3B 1ZW7A 3TBLD 2I1JA 3ZRFA 3QARA 2YVCA 3VDZA 3KYDD 2K1FA 4ANVA 3QJZA 4I6PA 4URKA 1V49A 2OJRA 4JGHB 4FHJA 4BFRA 1BT0A 2JWZA 2N7DA 2RD0A 1LFDA 1H4RA 5LLIA 4ASWC 3ML9A 3VQIA 3ZNID 3RZWC 5G2NA 4BBNF 1EUVB 1OTRB 4RM9A 4KIKB 3U8ZA 2GBMA
chains in the Genus database with same CATH superfamily
2UWQA 1UBIA 3P42A 2KDMA 3BVMA 3AE2B 2PKOA 1PYWD 4HPMB 1N61A 5IO9A 2L76A 2V0GA 2RPVA 1FPYA 2WU2B 3DWGC 3AU4A 4JIOU 4KVGB 3HRDD 2LZ6A 2NBWB 4KKIA 3DBLB 2O6VD 1L2NA 3ZDTA 4DXFA 1UUPA 2KX3A 3RMKC 3APDA 4RCOA 4KSLC 2SEBD 3JYUA 3PSEB 5GXGB 3SR6A 2WXHA 1JRUA 3FC4A 1E7VA 3TCAA 3A33B 1PGBA 3Q14C 1XF5L 2KD0A 2YEPF 2MBHA 2I1KA 4W9KA 2W82A 1N60A 4WWMA 3D32A 4MM3A 1WGHA 1IPGA 3K9PB 4L1BA 1CQVA 3DCGA 1L5PA 4LCDE 1E8XA 3IT4B 3UINB 3BVZA 2IGGA 1VLBA 2PPHA 2AYOB 5G5GA 3A9JA 3ZJUA 2GRIA 4HJGE 2PMVA 3HVDA 3DHIC 3NHEB 2BW2A 4IG7B 2IO3B 1A5RA 2CU3A 3RZFA 1GUAB 1S3SG 3BINA 2WXLA 4RF1A 5FK9C 1MHHE 4AOFA 3DWMA 5DPRA 4DDID 4US8A 4ZRPA 3ENEA 2OOBB 4I6LB 2L0TA 1C1YB 1J7BA 2KVZA 3PTFC 1SE4A 1VD2A 1I4PA 2K22A 1L0YB 2X38A 2BB5A 3L54A 1PDXA 1KFYB 1OQQA 2LGYA 3EC8A 3I9V1 3RFZB 2D10A 4MDKE 3WANA 2JYTA 2LMCA 4DK5A 3U2SC 3W9CB 5AZHA 3UI3A 1WWTA 1YNTE 4IM2A 3V6EB 1ET6A 1WIAA 2L1AA 4XDCA 2BYEA 2M19A 4XWWA 1FXAA 2BGFA 3ZRCA 1DOYA 3SFEB 2A4ZA 1FRRA 2W3SA 4NAMA 2LVOA 1C3TA 3SHQA 1IBXA 2JT4B 1ENFA 4JWUC 1CJEA 4OZCA 3AE9B 2DLBA 4YSYB 3RD2A 4US9A 4NJ7A 5AEKB 2HD5B 3IAS1 1TS4A 1KM7A 1TT5B 2FNJB 1QOAA 2KC1A 4G0NB 1KF6B 2KDBA 2KQSA 2MHJA 3UQAA 1TKYA 2N1WA 3W1SC 4OW0A 4DXGA 2MSED 2KLGA 3ZNHB 4M0WA 3M95A 3N30A 3V05A 4ARIA 5G5HA 3H9DA 1Z2MA 4TSSA 2MJEA 3DBRB 2MP2A 3DBHI 2Z0DB 4W9JA 1VDVA 2BYTA 3BY4B 1HQRD 3PHXB 3I5JC 5MPOA 3Q2AC 4GMVA 2OHFA 3TEZA 2UYZB 2IZVB 2CHZA 2J52A 4ZYSA 2D3GA 3ZW3A 4A3OA 3NS1A 3RI7C 4YSZB 5DCNA 2L32A 3P1MA 4FXCA 3V60A 1XQQA 4MEMA 1FFUA 1C9FA 3GS2A 4MACA 1B9RA 4K3BA 2N9XA 1AARA 1F77A 3PZ7A 4WJPA 1FNUA 1R4MB 4IWQA 4P1CC 4EFOA 1E8YA 4YL8A 3R66C 5EE0A 3EFCA 5FKAC 2WYQA 3KUCB 1ZOYB 4HRSA 3B1LX 2C7MB 4KKJA 1OFFA 4IM0A 4CHKA 2L05A 1MI0A 1UGJA 5L83A 1J7CA 2GB1A 4GDLB 4BVUC 2EKIA 4PS8A 4XC2A 2QMTA 3Q3OC 3DOWA 3AEAB 1LQBA 1U4AA 3KWLA 4F8CB 3TUOA 2GBNA 1WX7A 2CKHB 2Y5CA 1K50A 4HCNB 1V6EA 2JUOA 1E7UA 1NVID 3VR8B 5BMIA 2KTFA 2XN9C 3L08A 4HLEA 3RNAC 2WXKA 2LI5A 2WU5B 5HKHA 2KK8A 2NTTA 4W9GA 3DDCB 2WXGA 2Y5PA 1PUTA 3CSTA 2RSUA 1K51A 4FJYA 2IGHA 4FN2A 2QSDA 3MJWA 2K25A 3PRPB 3J9CA 3ZIMA 5HI1A 1WMHB 2JPHA 1JMLA 3OAWA 3DBRI 1XEEA 3PRMB 2NVUI 3K9OB 4AS1A 5I4DA 4NJ6A 4K7WA 2N1VA 2K0PA 4PT5A 3PS6A 3L16A 1TS5A 4NQKE 1WE7A 4LDTB 3ZNGC 1F0ZA 2IDYA 2JYEA 1FRDA 3V61A 1T0YA 4GLSC 1IGCA 1WJUA 3AB5A 4KV2A 2KQ4X 1SB3C 1D5MC 4JE3B 2IBIB 2CHWA 4Q2JA 3TL5A 4GIVA 1V1PB 3H7SA 2B3AA 1WM3A 2GBJA 3DVGY 4ZHPA 3HM3A 2MBBB 1I4RA 3ZGZA 1V8CA 2WDRB 2QCZA 3ETRA 2G45B 3BZDB 1K53A 1MHXA 5CX3A 1F2RC 4HKQA 1WGDA 2ICIA 1I42A 3IAM1 3PT2B 3QARA 1ZXIA 3KYDD 2RDHA 4KGSA 1GPXA 1V49A 1DYQA 1N63A 4FHJA 2N7DA 1EU4A 1LFDA 5EE9A 1RWSA 3VQIA 2IJ0A 3RZWC 1EUVB 2V3NA 4KIKB 2GBMA 1C4AA 1WFYA 3ECIA 2KKCA 2ZW0A 1R4NB 3E56A 3EECA 3EGRA 4KZCA 2G9HD 1XCTL 4YSXB 3VFKA 2LEKA 4IC7B 1I4HA 4IKGA 5KHOA 1D3ZA 1HXYD 2N4FA 1JW9D 3AULA 4MGKE 5C1ZA 1IUEA 1IGDA 3PZDA 4NPNA 3M3JA 3NVYA 3EA6A 2O2VB 2WXFA 4DHJD 4OZAA 3WA0A 2I38A 2AQ2B 4NNJB 3GOEA 1VZ7A 3JSVB 3RPFC 3IG3A 3VVWB 4MGZE 2IGDA 2J4XA 2KFKA 2LJIA 2ZNVC 3AE5B 4GSWA 4LNKA 4R3DA 1FNVA 3RNGC 1E10A 1NEKB 1XO3A 2AX5A 2D3AA 1GAQB 2MRPA 3W2DA 3R3MA 1YJJA 4NQLB 3FKYA 1XD3B 1TZOA 2WXNA 4MGIE 3LXFA 2WQYB 2LGDA 2DBYA 3ZXRA 2LWPA 2L7RA 2C9WB 1Z5SB 1K52A 2WS3B 4E3CA 1VR9A 3AE7B 2K8CA 4XE0A 4B9KA 3VUXA 4BKSD 3B2GA 4JL9A 5IA7A 2ZJDA 5C23A 1GNUA 1YX5B 2J7QB 2LUEA 2WWZA 2ZVNA 5DPSA 2GOWA 3EUB2 1IYFA 2LRWA 4M02A 4M00A 4FULA 2K6QA 2YEPB 1RLFA 3ZXVA 4UDUC 3TMPB 2NMQA 1V5OA 3KVFB 2XK5B 4LNNA 2KXJA 1E5WA 2D07B 3B08A 3URYA 2MJ3A 4AJYB 2MLBA 1CMXB 4KZ0A 3UGBB 4TQ0A 5AUKA 4FJVB 2N9PC 2RDBC 4XGAB 2WXQA 4DWFA 3N3KB 3GZNB 1R4NI 2D3CA 1PGAA 2EKEC 3U52E 3A9KA 1ET9A 3QQ8B 3ZLZA 4PK1A 5H8YE 3PREA 4RNAA 5HHDG 4C56C 2JXXA 4LNOA 1YOVB 1KH0A 2C5LC 3RULA 4RMAA 2KVRA 4W9IA 1YQBA 4XX5A 4ARCA 1EO6A 2ONQA 3P4RB 1LGRA 4PS7A 1FFVA 3IBEA 2BYVE 4MSMB 5J17A 2BF8B 2FCNA 1WRDB 1GJZA 2W9NA 3KQ4A 2FIDA 1FXTB 2JWUA 2KFKB 4ZRIA 4YTMB 2LASA 1MVKA 1P3QU 2KMAA 1UGMA 3N1XC 5FR3A 1F1HA 2KO3A 2MBEA 3TIXA 2N7EA 2RR9A 4IM3A 2W3RA 1WM2A 3Q8EA 3MFGA 4EZKA 1V5TA 1WI0A 1M4VA 1E0ZA 2VRRB 2WXOA 4WJNA 2KJHB 5EDSA 2WX0A 3AECB 4B95A 2QJLA 2KT7A 3PV1A 2QHOA 3OG5A 4C4VA 2DAFA 4P16A 2D2QA 2G1EA 2LXCA 3DVGX 3HK0A 4HDQA 2PW9A 3DHHC 4MH0E 4ZYNA 4FBJB 4KGTA 3SU8X 3DBHB 3H7PA 2C60A 2ZNVB 3HM6X 1SSNA 1I7HA 1HZ6A 3RYTA 1D5XC 3U7ZA 1GG3A 3TEYA 4N6EB 2MH7A 3MHSD 2ZVOA 2L52A 3PLVA 4D2KA 5E6JA 2AEHA 4JQWC 4LJPB 2WDTB 3SD5A 2WXRA 3T9LA 4GXBA 1ROEA 2MBOA 1T3QA 1ZGUB 2IO2B 1L4DB 4K81A 3T3OA 2E3TA 1F2RI 4LTUA 1JCKB 2R61A 3GZNI 4DHZE 2L00B 2JU6X 2CJNA 2DAJA 3LJ3A 1DGJA 2NPTA 2GBKA 4HROA 1SE9A 4W9DA 3JW0X 2WXMA 4HCPB 1FXIA 3KYCD 5JHAA 2I2YA 1J0GA 4REZA 4HPPA 4TQ1A 1TYGB 3AM9A 3MTNB 3AU5A 1EU3A 1YN4A 2YLMA 3AI5A 1RFKA 4PYZA 4WWOA 1LM8B 2WXJA 3VAWA 4MJSA 1NI3A 4GOCA 2FUG1 2D3BA 2BWES 2QILA 1UZXB 2LGXA 4MM3B 3W5UB 1WZ0A 1JWUD 3QAQA 2J53A 1IP9A 1YN3A 2R2OA 3APCA 2MA9B 4HDOA 1PQSA 2JXTA 3M63B 1NDDA 2MJDA 4YXDB 3MC9A 2WHIA 2IO1B 1UF0A 3A9JB 3S2AA 3N32A 1JRPA 2FCSA 1TKEA 2KWDA 2HDEA 2Y3AA 1SIJA 4RM8A 2KMCA 2BPSA 4CQNA 5TSSA 1ZKHA 1KLUD 3AE8B 1EF1A 1WGRA 4S17A 2NBVB 1CK1A 1HZ5A 3IT6B 4RF0A 4EUTA 4WIPA 4JPSA 1V97A 1WSPA 3HHMA 3I3TB 4ZOHC 4CYEA 3N1ZC 4M8NA 2Z0EB 1KTKA 5IAAC 2PTLA 1WYWB 2MQJA 4O1NA 2GMIC 2SAKA 3CMMB 2ZPNA 1P7EA 5BYQA 3B9JA 4W9EA 2DYMA 1P1AA 2FCQA 4LK0M 2ZW1A 1TKGA 3CWIA 4KGRA 3BVGA 3QK0A 4DXAB 1HTQA 2QIEB 1C79A 1OQYA 3VR9B 2LGSA 3P4SB 2KTRA 4EZLA 3IFWB 2KYWA 4XYCA 3GP7A 4II3B 2I1JA 2YVCA 4YWGG 2K1FA 2WP9B 3R2IA 4JGHB 2JWZA 3H8HA 4ASWC 2Q5WD 3ML9A 4RGOS 5G2NA 3RNCC 5D3IB 4BBNF 2KMMA 1T5XD 3VRAB 3MHZA 3RCZA 3L0WB 2DHZA 3BIID 2DZIA 1IBXB 4OVVA 1P0RA 2JRIB 3GB1A 3P4PB 4DHZB 3UIOB 3FAHA 1TS2A 4L2YA 2DYOA 1GB4A 1Q1OA 1XT9B 4NZLB 1ACCA 3FILA 2R2QA 1WGYA 2K8HA 5CHVC 3WCQA 2VH1A 5T8IA 4AUQC 3A1QA 4BKGA 3HUIA 3DHGC 2LHDA 3AN1A 4A6QA 2MCNB 4NAWA 1E8WA 1DOIA 1D6EC 4FLHA 1OEYA 4M0WB 4J3OD 2BKFA 4GU2A 4HJKA 1WJ4A 3R8BA 2VZKB 1QZEA 2MP2B 2C7HA 4OVUA 3BYTB 4ICVA 3RNBC 3VUWA 5JH5C 1RFAA 2LVQA 1YQ3B 1WX8A 2BVCA 2K3UA 2V4IB 1G6JA 4NJCA 5AUIA 3WAMA 1XLPA 3VTWA 1WRIA 2QEJC 4OVZA 2PIAA 1YJIA 2KX0A 1H8CA 3ZJTA 2IPKD 3SFDB 4ZRQA 4HXDA 4DQOC 3VRBB 2KANA 4OHJA 1WJ6A 4XZ4A 2M4NA 1WY8A 1WF9A 3O13A 1SJED 4GGQA 2JZZA 1QOGA 2K6DB 3AE4B 3KW5B 1SF0A 2DZMA 3P4QB 3R7QA 4HWIB 1UH6A 4W9CA 2KHWB 1N6ZA 1TTNA 3NVWA 1TJEA 3QWZB 3NZSA 1AW7A 1I4XA 5DPTA 4BKSA 3AEFB 1GC7A 5LXHA 2D5GA 4A90A 4RGNA 1QT9A 4LDTD 3T8MA 2QDFA 3MC0B 3U30A 1BUIC 4GN1A 1D4BA 2IY0B 2KDIA 2V1YA 2BWFA 2AWTA 1C4CA 3JVZX 2H89B 1UD7A 1GC6A 1I4QA 2XBBC 1FD6A 4AWJA 2KNBA 3B0AA 3W1YA 4JLCA 4JX1C 2L83A 4RFBA 3IVFA 1E8ZA 2J0JA 3HVZA 1N62A 4G3XB 3AEGB 4ZRJA 2N0SB 3AH7A 3WAPA 1D5ZC 2H88B 4OZBA 1ISNA 1YQ4B 2O6VA 3E9SA 3VXWA 5G55A 2ACZB 3RNFC 1J8CA 5CHWA 3L4PA 3AMZA 5J18A 3RT3B 5D6JB 2LRUA 1YJ1A 4HEA1 2FIFA 4X57B 2JY6A 1XXGA 1S1QB 4KDIC 3QHTA 4MGYE 1ZUD2 4IWPA 1VZ8A 1WR1A 1XLQA 1KLGD 2L0FA 5CHFA 1SBBB 1WH3A 5JZEB 4S0RA 1DOXA 4F7ZA 2BS4B 2JF5A 2N7JA 1E9MA 2LXAA 4HVBA 3C19A 1WXSA 1N5WA 1TZ1A 1EF5A 3TJPA 2GI9A 1E6EB 3Q69A 1NYQA 1FCCC 4FHKA 1JWSD 3PO0A 3RUIB 2HJ8A 3SDLC 1SIFA 1SEBD 1XCQL 1QLBB 2J0KA 2Z59B 4PS3A 5EE3A 2GBRA 2KJRA 4KX6B 5E6OA 4WJOA 4E74A 3N1YC 3R2TA 1WE6A 2KDFB 2WXIA 3NJTA 1GOZA 1BMLC 1ZE3D 3ZYYX 1WJNA 1UNSA 3L10B 4CO7A 1WR6E 1Q5WB 4B0EA 1MPEA 1T6BX 3RN9C 4B0MA 1UBQA 2LJ5A 3P63A 5AZGA 5C3JB 3ZO5B 4C80A 1SGHA 1QOBA 2FBWB 1T0QC 1I4GA 1RYJA 4YT0B 4II2B 4TUUA 5D94A 2NCNA 4E71A 1V86A 2EELA 3QC8B 3Q3MC 3NZUA 1HTOA 3ZKJC 2N9EB 3PVLA 3NVVA 1AN8A 1MG8A 4FA6A 3DVNV 2W55A 3O65B 2D11A 4ICUA 2GLSA 2BTEA 2UU7A 2O6VB 5EE1A 2KLCA 3P2BA 2ZCBA 1EWYC 1FO4A 1TS3A 1SJHD 1RRBA 1JALA 4HK2A 2V3PA 2MW5A 3EFUA 3W5VB 4BZAA 2V9HA 4A20A 5BMHA 5BYSA 3DPDA 2JSVX 4EE2A 2MEKA 5TR5A 3LYYA 2INCC 3UQBA 3GE3C 4FADA 3Q3JA 1WZ3A 2N9LA 3KH0A 4FJZA 1QQRA 3PLUA 1FIQA 2PEAA 1T0SC 2BT6A 3TSSA 4W9FA 2RGFA 4BBNC 3ABVB 4F1SA 1I35A 1YN5A 2XEWA 2KN4A 4BKTA 3ZTCA 1GB1A 2WX1A 4B6WA 3H6NA 1VZ6A 4EEWA 4LJOB 3KUDB 1E90A 1E7PB 1VRAB 1WXMA 2G4DB 2LD9A 3R7RA 2CHXA 2WXPA 4M8MA 2Y5BB 4N9F4 2M17A 1KOTA 1B1ZA 1JQ4A 1UWMA 2OEDA 3OJ4B 3AE3B 1NYRA 4C00A 3PHWB 1V1OA 1EM7A 2PVOD 1VJKA 2MWSB 2DZKA 3QA8A 5FR6A 3PZ8A 4WQOB 2WNMA 2K8BA 4K3CA 4K7UA 2REXA 1QF6A 2ZPYA 3MP9A 3M62B 5D2MB 4HPLB 1V2YA 3I63C 1AWDA 2V4LA 3C0RB 3ZDMC 1VCBA 3A9KB 4HKZE 2KDEB 3V3XA 3BWUD 1Y56A 4DBGA 3V62A 3ML8A 1V80A 2JQRB 3AEBB 1C77A 2OJWA 1X1MA 3HIZA 1QOFA 1YD8U 2KOXA 3ZUNA 4RH6A 3L13A 3ZTDA 2VH2A 1TY2A 3TBLD 3ZRFA 3VDZA 3QJZA 4M01A 1Q10A 2RD0A 1H4RA 3Q3NC 2B76B 3ZNID 2LUMA 1OTRB 4RM9A 3U8ZA 5E6NA 2DZJA 3ALBA 4N58A 2BKRB 5D3DA 1L7YA 4K1RB 3NZ3A 1OQRA 4MSQB 2KZRA 2ZCCA 1PFDA 2J42A 4PYUA 3DBLI 2EMSA 4BOZB 3KWVA 2M56B 1WXQA 4WURA 3AE6B 3PPAA 4WWNA 3DQVA 2NS5A 4W9LA 2WGSA 1ZDXA 4C4VB 3UF8A 1V9JA 4K7SA 3U4EG 2ASQA 1WXVA 1UELA 5KHQA 4ANUA 4GDLA 1KJTA 3H7PB 5GMVA 1JWAD 1RM6C 4WWPA 2CR5A 3NG0A 3BYYB 3LDZE 3A4RA 1ZDVA 2HE7A 4GB9A 1SXTA 2FUHB 4EKUA 3APFA 2G4SA 1FEHA 2PVGC 3TEXA 3KUZA 3AV8A 2LVPA 3X0WA 1TBEA 5H92C 1MJDA 2X8XX 1J19A 4LNIA 4QAYA 3VUYA 3N20C 1L6VA 1SE3A 2PLPA 4LLGM 1QILA 3QX1A 4TMAB 5IKCM 4P1BC 4ITKA 1WMHA 2J0MA 2E6XA 2KAJA 4EZJA 2EMTA 1NBFC 1J7AA 2NPTB 3X23A 1P9DU 3V6CB 2DX5B 2W54A 2MX2A 4BAXA 4TV3A 2TSSA 2RMMA 4LNFA 4A9AA 3W1SA 5C2TB 4L23A 3Q8FA 4MT5A 4YTPB 2INNE 2V3SA 2KFJA 4ZDVA 4MELA 2IYDB 5LXIB 3ZVVA 4EOYA 3DBSA 4MJSB 4IWOA 1ESFA 4NY0A 4ZHOA 1AYFA 2ZZPB 3LB8C 2FAZA 4G11A 1V1PA 3Q8BA 4GDKA 2KWVB 2FE8A 1R7SA 5JXVA 3Q3FA 2AL6A 1K8RB 4J6IA 3H1UA 3Q6BA 3AEEB 1T0RC 1L4ZB 1STEA 1TY0A 2XNAC 1OEYJ 2DYBA 3OLMD 3Q8AA 1Y8RC 5HG2A 3GE8C 1XLNA 2PJHA 3A4SC 2NR2A 1RAXA 2DWQA 1P98A 3WAOA 2HTHA 2PE6B 2NBUA 4KIKA 2BYFA 4W9HA 3ZQ4A 3QIJA 4ANXA 2BBCA 1FM0D 4KSKC 2CJOA 3VTUA 4YTNB 3RNEC 4IUMB 2HJ1A 1YMHE 2LHEA 2INDC 1WXAA 3N9YC 2CS4A 1NENB 1ZP0B 2KWUB 2DENB 3UIPB 1YX6B 1JROA 1JWMD 2HTME 2RPQA 1V81A 4P7IA 3NVZA 2AQ3B 2VZKD 4BOSC 2AL3A 3MJ5A 3ONSA 4A3PA 4N59A 3PRZA 2O2VA 1ZXHA 5DPWA 2IO0B 2KTRB 3WALA 3U7DA 3CIRB 3NUHB 3TEWA 1N5XA 1XLOA 5L95C 3VH4B 1WX9A 1MG4A 3BK1A 3BK2A 2RDGA 3L17A 5E6PA 3JSVA 1BXTA 2ON8A 2KACA 3DVNU 4P6VF 2M0AA 4GDKB 4I6NB 2JVCA 4ACFA 1FCLA 1FMAD 1UWXA 5BYRA 2BS3B 3FILB 3NOBA 3CF6E 4WJQA 1R4MI 3IHPC 2DNFA 4IDIA 1KRHA 2KC2A 3MC8A 3A1QB 2G3QB 3SEBA 2M0XA 3Q8CA 4A55A 3NS8A 4NAWB 1ZPSA 2AQ1B 2KJ6A 1FNWA 3AEDB 2A5UA 1WYGA 2K5PA 1WGKA 1TGZB 3OJ3A 1OGWA 3ZNZB 5CTRC 4KDLB 4XWTA 4WQMA 4DHJB 1NI2A 3PGEA 2XK5A 3CSFA 4TKNA 2PE9A 5JHBA 2INPE 2JZ3B 2KWCA 5BMGA 3QCAA 2C7NB 1LO5D 3VTVA 4AJWA 1PGXA 1F9JA 2N9KA 2FCMA 4H2AA 1M94A 5IOIA 2JX5A 5BO4B 1HE8A 4RGMA 3KLSX 2MBQA 3I57A 3VH3B 2JZPA 1L0XB 2K39A 4IW0A 4C7ZA 2CU1A 1MFWA 2ZEQA 2KN5A 4AQ7A 2WDVB 1KLVA 4DDGD 2KQ7A 2WDQB 4ANWA 5HFYA 1L6UA 4JWSC 4G50A 1SE2A 4RGTA 5LNK1 3C8YA 3OWEB 2Z8LA 1Q0WB 1CZPA 1C76A 5J2RA 1LXDA 4ZRKA 3ZJVA 2NTSA 5IN7A 2QC8A 3VHTC 2JRHA 4WAFA 1QKZA 2WLBA 1TIFA 3B2FA 5IP4D 3EHVA 3NY5A 2LGIA 1L0VB 2M8SA 1A70A 2LFIA 2IY1B 4USAA 5AZFA 1F52A 1HA5A 4A8XC 4AP4C 4XDDA 2M1MA 1JWBD 2L8JA 1WGGA 2L3ZA 3IXSA 1HEZE 1YIWA 3AXCA 4WAAA 1EWCA 5D7GA 3WIMA 1C4PA 2K9XA 1C78A 1ZW7A 3AE1B 2BQQA 4ANVA 1P7FA 4WH4A 4MH8A 4I6PA 4C7YA 4URKA 2OJRA 3T3NA 4BFRA 1BT0A 5LLIA 3NRZA 2BB6A 4IOIE 2BS2B
chains in the Genus database with same CATH topology
5E6NA 3ECIA 1WFYA 2DZJA 3L0WB 2DHZA 2UWQA 1UBIA 3RCZA 2KKCA 2DZIA 4OVVA 1P0RA 2JRIB 4DHZB 3ALBA 2BKRB 3EECA 4KZCA 3UIOB 4HPMB 1L7YA 2DYOA 4K1RB 3VFKA 1Q1OA 1XT9B 2L76A 2R2QA 1WGYA 2K8HA 4IC7B 5CHVC 4MSQB 3AU4A 4JIOU 4KVGB 2KZRA 2ZCCA 5KHOA 2LZ6A 1D3ZA 4AUQC 4PYUA 3A1QA 4BKGA 3DBLI 2EMSA 2NBWB 4BOZB 2O6VD 2MCNB 2N4FA 4NAWA 1E8WA 1L2NA 3ZDTA 4FLHA 3PPAA 4WWNA 1OEYA 3DQVA 2NS5A 3AULA 4MGKE 4W9LA 5C1ZA 2KX3A 3PZDA 3APDA 4M0WB 4KSLC 3WALA 2BKFA 4NPNA 3UF8A 1V9JA 4K7SA 4GU2A 4HJKA 2ASQA 3JYUA 3M3JA 1WJ4A 3PSEB 1WXVA 1QZEA 1UELA 1JRUA 2MP2B 2O2VB 2C7HA 4OVUA 5KHQA 1E7VA 4ANUA 4ICVA 4GDLA 1KJTA 3H7PB 5GMVA 3VUWA 4DHJD 5JH5C 3WA0A 3TCAA 4WWPA 1RFAA 2LVQA 3A33B 2CR5A 1WX8A 4NNJB 1G6JA 3GOEA 3WAMA 3SDLC 3LDZE 2KD0A 3A4RA 3VTWA 2HE7A 4GB9A 2FUHB 2MBHA 3JSVB 3IG3A 3APFA 2G4SA 2I1KA 2KX0A 4MGZE 4W9KA 3VVWB 4EKUA 1H8CA 3D32A 4HXDA 4MM3A 2KFKA 2KANA 2ZNVC 4GSWA 1WGHA 1WJ6A 4XZ4A 1IPGA 3K9PB 2M4NA 1WY8A 3KUZA 2MRPA 1WF9A 2LVPA 3R3MA 3DCGA 4NQLB 1XD3B 4MGIE 4LCDE 4GGQA 3X0WA 2JZZA 1E8XA 2K6DB 1TBEA 3UINB 3KW5B 2LGDA 1J19A 2DZMA 3VUYA 2PPHA 2AYOB 2LWPA 3QX1A 3R7QA 3A9JA 4HWIB 1UH6A 2L7RA 4W9CA 2C9WB 1Z5SB 2KHWB 4E3CA 1WMHA 2J0MA 1TTNA 2K8CA 4B9KA 4EZJA 2EMTA 1NBFC 3NHEB 3VUXA 3QWZB 2NPTB 3NZSA 3X23A 4BKSD 4JL9A 5IA7A 2ZJDA 4IG7B 1GNUA 1P9DU 1YX5B 5C23A 3V6CB 2DX5B 2J7QB 2LUEA 2IO3B 2WWZA 5DPTA 4BKSA 1A5RA 1GC7A 3RZFA 1GUAB 5LXHA 2MX2A 1S3SG 2ZVNA 3BINA 4TV3A 5DPSA 2GOWA 1IYFA 2LRWA 4LDTD 3T8MA 4FULA 2K6QA 1RLFA 4AOFA 3W1SA 5DPRA 3TMPB 4DDID 3U30A 3KVFB 1V5OA 2XK5B 4GN1A 2KXJA 1E5WA 2D07B 2IY0B 3B08A 2KDIA 2V1YA 4AJYB 2MLBA 2BWFA 2V3SA 2KFJA 1CMXB 4KZ0A 2AWTA 3ENEA 4ZDVA 3JVZX 2OOBB 4MELA 4I6LB 2IYDB 2L0TA 3UGBB 1C1YB 4TQ0A 5LXIB 3PTFC 4FJVB 1VD2A 3ZVVA 2N9PC 3DBSA 4EOYA 1UD7A 1GC6A 4MJSB 4IWOA 2XBBC 4NY0A 4AWJA 2ZZPB 2KNBA 3B0AA 2FAZA 3W1YA 3N3KB 4JLCA 4DWFA 3L54A 4G11A 2LGYA 3EC8A 1R4NI 2EKEC 4GDKA 2KWVB 3A9KA 3IVFA 1E8ZA 2J0JA 2D10A 3Q3FA 4MDKE 3WANA 4G3XB 3QQ8B 2AL6A 1K8RB 3ZLZA 4J6IA 4DK5A 3H1UA 3PREA 4ZRJA 5AZHA 2JXXA 1OEYJ 2DYBA 3OLMD 2C5LC 3RULA 4RMAA 2KVRA 1Y8RC 4IM2A 3V6EB 3WAPA 4W9IA 1YQBA 4XX5A 1EO6A 1WIAA 2BYEA 1ISNA 2PJHA 2BGFA 2O6VA 3A4SC 3ZRCA 2NR2A 4PS7A 3VXWA 5G55A 1RAXA 3IBEA 1P98A 1J8CA 3WAOA 2BYVE 2A4ZA 5CHWA 4MSMB 5J18A 5J17A 2BF8B 2FCNA 3RT3B 1WRDB 1GJZA 5D6JB 2LRUA 1YJ1A 2HTHA 2PE6B 2LVOA 2W9NA 2NBUA 2FIFA 1C3TA 4KIKA 4X57B 2BYFA 4W9HA 2FIDA 1FXTB 2JY6A 2KFKB 3SHQA 2JT4B 4ZRIA 3QIJA 2LASA 4ANXA 1S1QB 1P3QU 2KMAA 1UGMA 4KDIC 3QHTA 4KSKC 4MGYE 4IWPA 3RD2A 3VTUA 1WR1A 4NJ7A 2KO3A 2MBEA 5AEKB 2L0FA 2HD5B 4IUMB 5CHFA 3TIXA 2N7EA 1WH3A 1KM7A 5JZEB 1WXAA 2FNJB 2CS4A 2KC1A 4G0NB 2RR9A 4IM3A 1WM2A 2KWUB 4F7ZA 2JF5A 2LXAA 2DENB 4EZKA 4HVBA 1V5TA 1WI0A 3UIPB 2KDBA 2KQSA 1YX6B 3UQAA 2VRRB 4WJNA 2N1WA 2KJHB 3W1SC 5EDSA 2WX0A 4B95A 1WXSA 1TZ1A 2MSED 1V81A 2KLGA 2QHOA 1EF5A 2RPQA 3PV1A 4P7IA 3TJPA 2DAFA 3ZNHB 4BOSC 3M95A 2AL3A 3N30A 2D2QA 3DVGX 2LXCA 3H9DA 1Z2MA 4FHKA 3RUIB 3HK0A 2HJ8A 3ONSA 3PRZA 1SIFA 2MP2A 4HDQA 2O2VA 4MH0E 2J0KA 2Z59B 4PS3A 4ZYNA 3DBHI 4FBJB 2Z0DB 5DPWA 2IO0B 2KTRB 4W9JA 3H7PA 3SU8X 2C60A 2ZNVB 3BY4B 3HM6X 3U7DA 2GBRA 2KJRA 3PHXB 5E6OA 4WJOA 4E74A 4A3PA 4GMVA 1WE6A 2KDFB 5L95C 3VH4B 2UYZB 3RYTA 1WX9A 2IZVB 1GG3A 3L17A 5E6PA 2CHZA 3MHSD 3JSVA 1WJNA 2D3GA 2ZVOA 3L10B 3PLVA 3ZW3A 4CO7A 1WR6E 4A3OA 1Q5WB 2AEHA 4JQWC 4LJPB 2WDTB 1UBQA 2LJ5A 3SD5A 5DCNA 5AZGA 3T9LA 3ZO5B 3DVNU 4GDKB 4GXBA 4I6NB 3V60A 1XQQA 1SGHA 2MBOA 4MEMA 2JVCA 1ZGUB 2IO2B 4II2B 4TUUA 5D94A 2NCNA 4K81A 2N9XA 1AARA 3NOBA 1V86A 3CF6E 4WJQA 1R4MI 3IHPC 3QC8B 4WJPA 4E71A 3NZUA 3ZKJC 2N9EB 3PVLA 4IWQA 4EFOA 2KC2A 1MG8A 4FA6A 3DVNV 3GZNI 3A1QB 1E8YA 3O65B 4YL8A 4DHZE 2D11A 2L00B 3R66C 4ICUA 2G3QB 2DAJA 2M0XA 3LJ3A 3NS8A 4NAWB 2O6VB 2NPTA 2GBKA 2KJ6A 2KLCA 2WYQA 3KUCB 2A5UA 3P2BA 1SE9A 3B1LX 2C7MB 4W9DA 2ZCBA 3JW0X 4IM0A 4CHKA 1RRBA 1TGZB 2L05A 3OJ3A 1OGWA 3ZNZB 4HCPB 4HK2A 5L83A 3KYCD 5CTRC 5JHAA 2MW5A 3EFUA 4GDLB 1J0GA 4TQ1A 4A20A 4BVUC 4KDLB 4PS8A 4XC2A 3MTNB 4DHJB 1NI2A 3AU5A 2XK5A 3CSFA 3DOWA 3DPDA 3PGEA 2YLMA 5TR5A 1LQBA 1U4AA 3AI5A 4F8CB 2GBNA 4TKNA 1WX7A 2CKHB 4PYZA 3UQBA 4WWOA 1LM8B 4FADA 2PE9A 3Q3JA 4HCNB 1V6EA 2JUOA 1E7UA 3VAWA 1WZ3A 5JHBA 4MJSA 4GOCA 2JZ3B 2KWCA 2KTFA 3KH0A 2BWES 4FJZA 3QCAA 1UZXB 2LGXA 3L08A 3PLUA 1WZ0A 2PEAA 2C7NB 3VTVA 4HLEA 4AJWA 3QAQA 2LI5A 1IP9A 4W9FA 2R2OA 1F9JA 2KK8A 3APCA 2MA9B 5HKHA 2RGFA 4HDOA 2FCMA 4W9GA 4BBNC 3DDCB 1PQSA 1M94A 4F1SA 1I35A 3CSTA 2XEWA 1HE8A 2RSUA 3M63B 1NDDA 4FJYA 5BO4B 2MBQA 4BKTA 3ZTCA 2WX1A 2IO1B 3VH3B 4FN2A 3A9JB 4B6WA 2K39A 3H6NA 2K25A 3MJWA 3PRPB 4IW0A 2CU1A 3N32A 3S2AA 4EEWA 3ZIMA 4LJOB 2FCSA 3KUDB 1E90A 1WMHB 1WXMA 2ZEQA 2G4DB 2LD9A 3R7RA 2JPHA 4RM8A 2KMCA 2KN5A 3OAWA 2BPSA 2CHXA 4M8MA 1KLVA 2Y5BB 4DDGD 4N9F4 2KQ7A 1ZKHA 2M17A 1KOTA 3DBRI 3PRMB 4ANWA 2NVUI 3K9OB 3OJ4B 1EF1A 4NJ6A 1WGRA 4K7WA 2NBVB 2N1VA 3PS6A 4G50A 3L16A 4EUTA 3PHWB 4NQKE 1WE7A 1Q0WB 4LDTB 3HHMA 3ZNGC 3I3TB 2MWSB 2DZKA 4CYEA 3QA8A 5J2RA 5FR6A 1LXDA 4ZRKA 3V61A 4WQOB 4M8NA 2K8BA 1T0YA 4K7UA 2Z0EB 1WJUA 3VHTC 5IAAC 2JRHA 2REXA 1WYWB 2MQJA 2ZPYA 2GMIC 4KV2A 3CMMB 3M62B 3EHVA 3NY5A 2ZPNA 5D2MB 4HPLB 2M8SA 4W9EA 1V2YA 2DYMA 1P1AA 2FCQA 2IBIB 2CHWA 2V4LA 3C0RB 3TL5A 4GIVA 3ZDMC 1VCBA 2IY1B 3H7SA 2B3AA 1WM3A 2GBJA 3A9KB 2KDEB 3DVGY 4DBGA 3HM3A 3V62A 2MBBB 3QK0A 4DXAB 5AZFA 3ML8A 1V80A 4AP4C 2M1MA 2G45B 2L8JA 1WGGA 1OQYA 2L3ZA 1YIWA 5CX3A 1X1MA 3AXCA 3HIZA 2KTRA 1WGDA 3IFWB 1YD8U 4EZLA 2KOXA 1I42A 3ZUNA 4WAAA 3L13A 3ZTDA 5D7GA 3WIMA 3PT2B 4II3B 1ZW7A 3TBLD 2I1JA 3ZRFA 3QARA 2YVCA 3VDZA 3KYDD 2K1FA 4ANVA 3QJZA 4I6PA 4URKA 1V49A 2OJRA 4JGHB 4FHJA 4BFRA 1BT0A 2JWZA 2N7DA 2RD0A 1LFDA 1H4RA 5LLIA 4ASWC 3ML9A 3VQIA 3ZNID 3RZWC 5G2NA 4BBNF 1EUVB 1OTRB 4RM9A 4KIKB 3U8ZA 2GBMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E6N A;  3ECI A;  1WFY A;  2DZJ A;  3L0W B;  2DHZ A;  2UWQ A;  1UBI A;  3RCZ A;  2KKC A;  2DZI A;  4OVV A;  1P0R A;  2JRI B;  4DHZ B;  3ALB A;  2BKR B;  3EEC A;  4KZC A;  3UIO B;  4HPM B;  1L7Y A;  2DYO A;  4K1R B;  3VFK A;  1Q1O A;  1XT9 B;  2L76 A;  2R2Q A;  1WGY A;  2K8H A;  4IC7 B;  5CHV C;  4MSQ B;  3AU4 A;  4JIO U;  4KVG B;  2KZR A;  2ZCC A;  5KHO A;  2LZ6 A;  1D3Z A;  4AUQ C;  4PYU A;  3A1Q A;  4BKG A;  3DBL I;  2EMS A;  2NBW B;  4BOZ B;  2O6V D;  2MCN B;  2N4F A;  4NAW A;  1E8W A;  1L2N A;  3ZDT A;  4FLH A;  3PPA A;  4WWN A;  1OEY A;  3DQV A;  2NS5 A;  3AUL A;  4MGK E;  4W9L A;  5C1Z A;  2KX3 A;  3PZD A;  3APD A;  4M0W B;  4KSL C;  3WAL A;  2BKF A;  4NPN A;  3UF8 A;  1V9J A;  4K7S A;  4GU2 A;  4HJK A;  2ASQ A;  3JYU A;  3M3J A;  1WJ4 A;  3PSE B;  1WXV A;  1QZE A;  1UEL A;  1JRU A;  2MP2 B;  2O2V B;  2C7H A;  4OVU A;  5KHQ A;  1E7V A;  4ANU A;  4ICV A;  4GDL A;  1KJT A;  3H7P B;  5GMV A;  3VUW A;  4DHJ D;  5JH5 C;  3WA0 A;  3TCA A;  4WWP A;  1RFA A;  2LVQ A;  3A33 B;  2CR5 A;  1WX8 A;  4NNJ B;  1G6J A;  3GOE A;  3WAM A;  3SDL C;  3LDZ E;  2KD0 A;  3A4R A;  3VTW A;  2HE7 A;  4GB9 A;  2FUH B;  2MBH A;  3JSV B;  3IG3 A;  3APF A;  2G4S A;  2I1K A;  2KX0 A;  4MGZ E;  4W9K A;  3VVW B;  4EKU A;  1H8C A;  3D32 A;  4HXD A;  4MM3 A;  2KFK A;  2KAN A;  2ZNV C;  4GSW A;  1WGH A;  1WJ6 A;  4XZ4 A;  1IPG A;  3K9P B;  2M4N A;  1WY8 A;  3KUZ A;  2MRP A;  1WF9 A;  2LVP A;  3R3M A;  3DCG A;  4NQL B;  1XD3 B;  4MGI E;  4LCD E;  4GGQ A;  3X0W A;  2JZZ A;  1E8X A;  2K6D B;  1TBE A;  3UIN B;  3KW5 B;  2LGD A;  1J19 A;  2DZM A;  3VUY A;  2PPH A;  2AYO B;  2LWP A;  3QX1 A;  3R7Q A;  3A9J A;  4HWI B;  1UH6 A;  2L7R A;  4W9C A;  2C9W B;  1Z5S B;  2KHW B;  4E3C A;  1WMH A;  2J0M A;  1TTN A;  2K8C A;  4B9K A;  4EZJ A;  2EMT A;  1NBF C;  3NHE B;  3VUX A;  3QWZ B;  2NPT B;  3NZS A;  3X23 A;  4BKS D;  4JL9 A;  5IA7 A;  2ZJD A;  4IG7 B;  1GNU A;  1P9D U;  1YX5 B;  5C23 A;  3V6C B;  2DX5 B;  2J7Q B;  2LUE A;  2IO3 B;  2WWZ A;  5DPT A;  4BKS A;  1A5R A;  1GC7 A;  3RZF A;  1GUA B;  5LXH A;  2MX2 A;  1S3S G;  2ZVN A;  3BIN A;  4TV3 A;  5DPS A;  2GOW A;  1IYF A;  2LRW A;  4LDT D;  3T8M A;  4FUL A;  2K6Q A;  1RLF A;  4AOF A;  3W1S A;  5DPR A;  3TMP B;  4DDI D;  3U30 A;  3KVF B;  1V5O A;  2XK5 B;  4GN1 A;  2KXJ A;  1E5W A;  2D07 B;  2IY0 B;  3B08 A;  2KDI A;  2V1Y A;  4AJY B;  2MLB A;  2BWF A;  2V3S A;  2KFJ A;  1CMX B;  4KZ0 A;  2AWT A;  3ENE A;  4ZDV A;  3JVZ X;  2OOB B;  4MEL A;  4I6L B;  2IYD B;  2L0T A;  3UGB B;  1C1Y B;  4TQ0 A;  5LXI B;  3PTF C;  4FJV B;  1VD2 A;  3ZVV A;  2N9P C;  3DBS A;  4EOY A;  1UD7 A;  1GC6 A;  4MJS B;  4IWO A;  2XBB C;  4NY0 A;  4AWJ A;  2ZZP B;  2KNB A;  3B0A A;  2FAZ A;  3W1Y A;  3N3K B;  4JLC A;  4DWF A;  3L54 A;  4G11 A;  2LGY A;  3EC8 A;  1R4N I;  2EKE C;  4GDK A;  2KWV B;  3A9K A;  3IVF A;  1E8Z A;  2J0J A;  2D10 A;  3Q3F A;  4MDK E;  3WAN A;  4G3X B;  3QQ8 B;  2AL6 A;  1K8R B;  3ZLZ A;  4J6I A;  4DK5 A;  3H1U A;  3PRE A;  4ZRJ A;  5AZH A;  2JXX A;  1OEY J;  2DYB A;  3OLM D;  2C5L C;  3RUL A;  4RMA A;  2KVR A;  1Y8R C;  4IM2 A;  3V6E B;  3WAP A;  4W9I A;  1YQB A;  4XX5 A;  1EO6 A;  1WIA A;  2BYE A;  1ISN A;  2PJH A;  2BGF A;  2O6V A;  3A4S C;  3ZRC A;  2NR2 A;  4PS7 A;  3VXW A;  5G55 A;  1RAX A;  3IBE A;  1P98 A;  1J8C A;  3WAO A;  2BYV E;  2A4Z A;  5CHW A;  4MSM B;  5J18 A;  5J17 A;  2BF8 B;  2FCN A;  3RT3 B;  1WRD B;  1GJZ A;  5D6J B;  2LRU A;  1YJ1 A;  2HTH A;  2PE6 B;  2LVO A;  2W9N A;  2NBU A;  2FIF A;  1C3T A;  4KIK A;  4X57 B;  2BYF A;  4W9H A;  2FID A;  1FXT B;  2JY6 A;  2KFK B;  3SHQ A;  2JT4 B;  4ZRI A;  3QIJ A;  2LAS A;  4ANX A;  1S1Q B;  1P3Q U;  2KMA A;  1UGM A;  4KDI C;  3QHT A;  4KSK C;  4MGY E;  4IWP A;  3RD2 A;  3VTU A;  1WR1 A;  4NJ7 A;  2KO3 A;  2MBE A;  5AEK B;  2L0F A;  2HD5 B;  4IUM B;  5CHF A;  3TIX A;  2N7E A;  1WH3 A;  1KM7 A;  5JZE B;  1WXA A;  2FNJ B;  2CS4 A;  2KC1 A;  4G0N B;  2RR9 A;  4IM3 A;  1WM2 A;  2KWU B;  4F7Z A;  2JF5 A;  2LXA A;  2DEN B;  4EZK A;  4HVB A;  1V5T A;  1WI0 A;  3UIP B;  2KDB A;  2KQS A;  1YX6 B;  3UQA A;  2VRR B;  4WJN A;  2N1W A;  2KJH B;  3W1S C;  5EDS A;  2WX0 A;  4B95 A;  1WXS A;  1TZ1 A;  2MSE D;  1V81 A;  2KLG A;  2QHO A;  1EF5 A;  2RPQ A;  3PV1 A;  4P7I A;  3TJP A;  2DAF A;  3ZNH B;  4BOS C;  3M95 A;  2AL3 A;  3N30 A;  2D2Q A;  3DVG X;  2LXC A;  3H9D A;  1Z2M A;  4FHK A;  3RUI B;  3HK0 A;  2HJ8 A;  3ONS A;  3PRZ A;  1SIF A;  2MP2 A;  4HDQ A;  2O2V A;  4MH0 E;  2J0K A;  2Z59 B;  4PS3 A;  4ZYN A;  3DBH I;  4FBJ B;  2Z0D B;  5DPW A;  2IO0 B;  2KTR B;  4W9J A;  3H7P A;  3SU8 X;  2C60 A;  2ZNV B;  3BY4 B;  3HM6 X;  3U7D A;  2GBR A;  2KJR A;  3PHX B;  5E6O A;  4WJO A;  4E74 A;  4A3P A;  4GMV A;  1WE6 A;  2KDF B;  5L95 C;  3VH4 B;  2UYZ B;  3RYT A;  1WX9 A;  2IZV B;  1GG3 A;  3L17 A;  5E6P A;  2CHZ A;  3MHS D;  3JSV A;  1WJN A;  2D3G A;  2ZVO A;  3L10 B;  3PLV A;  3ZW3 A;  4CO7 A;  1WR6 E;  4A3O A;  1Q5W B;  2AEH A;  4JQW C;  4LJP B;  2WDT B;  1UBQ A;  2LJ5 A;  3SD5 A;  5DCN A;  5AZG A;  3T9L A;  3ZO5 B;  3DVN U;  4GDK B;  4GXB A;  4I6N B;  3V60 A;  1XQQ A;  1SGH A;  2MBO A;  4MEM A;  2JVC A;  1ZGU B;  2IO2 B;  4II2 B;  4TUU A;  5D94 A;  2NCN A;  4K81 A;  2N9X A;  1AAR A;  3NOB A;  1V86 A;  3CF6 E;  4WJQ A;  1R4M I;  3IHP C;  3QC8 B;  4WJP A;  4E71 A;  3NZU A;  3ZKJ C;  2N9E B;  3PVL A;  4IWQ A;  4EFO A;  2KC2 A;  1MG8 A;  4FA6 A;  3DVN V;  3GZN I;  3A1Q B;  1E8Y A;  3O65 B;  4YL8 A;  4DHZ E;  2D11 A;  2L00 B;  3R66 C;  4ICU A;  2G3Q B;  2DAJ A;  2M0X A;  3LJ3 A;  3NS8 A;  4NAW B;  2O6V B;  2NPT A;  2GBK A;  2KJ6 A;  2KLC A;  2WYQ A;  3KUC B;  2A5U A;  3P2B A;  1SE9 A;  3B1L X;  2C7M B;  4W9D A;  2ZCB A;  3JW0 X;  4IM0 A;  4CHK A;  1RRB A;  1TGZ B;  2L05 A;  3OJ3 A;  1OGW A;  3ZNZ B;  4HCP B;  4HK2 A;  5L83 A;  3KYC D;  5CTR C;  5JHA A;  2MW5 A;  3EFU A;  4GDL B;  1J0G A;  4TQ1 A;  4A20 A;  4BVU C;  4KDL B;  4PS8 A;  4XC2 A;  3MTN B;  4DHJ B;  1NI2 A;  3AU5 A;  2XK5 A;  3CSF A;  3DOW A;  3DPD A;  3PGE A;  2YLM A;  5TR5 A;  1LQB A;  1U4A A;  3AI5 A;  4F8C B;  2GBN A;  4TKN A;  1WX7 A;  2CKH B;  4PYZ A;  3UQB A;  4WWO A;  1LM8 B;  4FAD A;  2PE9 A;  3Q3J A;  4HCN B;  1V6E A;  2JUO A;  1E7U A;  3VAW A;  1WZ3 A;  5JHB A;  4MJS A;  4GOC A;  2JZ3 B;  2KWC A;  2KTF A;  3KH0 A;  2BWE S;  4FJZ A;  3QCA A;  1UZX B;  2LGX A;  3L08 A;  3PLU A;  1WZ0 A;  2PEA A;  2C7N B;  3VTV A;  4HLE A;  4AJW A;  3QAQ A;  2LI5 A;  1IP9 A;  4W9F A;  2R2O A;  1F9J A;  2KK8 A;  3APC A;  2MA9 B;  5HKH A;  2RGF A;  4HDO A;  2FCM A;  4W9G A;  4BBN C;  3DDC B;  1PQS A;  1M94 A;  4F1S A;  1I35 A;  3CST A;  2XEW A;  1HE8 A;  2RSU A;  3M63 B;  1NDD A;  4FJY A;  5BO4 B;  2MBQ A;  4BKT A;  3ZTC A;  2WX1 A;  2IO1 B;  3VH3 B;  4FN2 A;  3A9J B;  4B6W A;  2K39 A;  3H6N A;  2K25 A;  3MJW A;  3PRP B;  4IW0 A;  2CU1 A;  3N32 A;  3S2A A;  4EEW A;  3ZIM A;  4LJO B;  2FCS A;  3KUD B;  1E90 A;  1WMH B;  1WXM A;  2ZEQ A;  2G4D B;  2LD9 A;  3R7R A;  2JPH A;  4RM8 A;  2KMC A;  2KN5 A;  3OAW A;  2BPS A;  2CHX A;  4M8M A;  1KLV A;  2Y5B B;  4DDG D;  4N9F 4;  2KQ7 A;  1ZKH A;  2M17 A;  1KOT A;  3DBR I;  3PRM B;  4ANW A;  2NVU I;  3K9O B;  3OJ4 B;  1EF1 A;  4NJ6 A;  1WGR A;  4K7W A;  2NBV B;  2N1V A;  3PS6 A;  4G50 A;  3L16 A;  4EUT A;  3PHW B;  4NQK E;  1WE7 A;  1Q0W B;  4LDT B;  3HHM A;  3ZNG C;  3I3T B;  2MWS B;  2DZK A;  4CYE A;  3QA8 A;  5J2R A;  5FR6 A;  1LXD A;  4ZRK A;  3V61 A;  4WQO B;  4M8N A;  2K8B A;  1T0Y A;  4K7U A;  2Z0E B;  1WJU A;  3VHT C;  5IAA C;  2JRH A;  2REX A;  1WYW B;  2MQJ A;  2ZPY A;  2GMI C;  4KV2 A;  3CMM B;  3M62 B;  3EHV A;  3NY5 A;  2ZPN A;  5D2M B;  4HPL B;  2M8S A;  4W9E A;  1V2Y A;  2DYM A;  1P1A A;  2FCQ A;  2IBI B;  2CHW A;  2V4L A;  3C0R B;  3TL5 A;  4GIV A;  3ZDM C;  1VCB A;  2IY1 B;  3H7S A;  2B3A A;  1WM3 A;  2GBJ A;  3A9K B;  2KDE B;  3DVG Y;  4DBG A;  3HM3 A;  3V62 A;  2MBB B;  3QK0 A;  4DXA B;  5AZF A;  3ML8 A;  1V80 A;  4AP4 C;  2M1M A;  2G45 B;  2L8J A;  1WGG A;  1OQY A;  2L3Z A;  1YIW A;  5CX3 A;  1X1M A;  3AXC A;  3HIZ A;  2KTR A;  1WGD A;  3IFW B;  1YD8 U;  4EZL A;  2KOX A;  1I42 A;  3ZUN A;  4WAA A;  3L13 A;  3ZTD A;  5D7G A;  3WIM A;  3PT2 B;  4II3 B;  1ZW7 A;  3TBL D;  2I1J A;  3ZRF A;  3QAR A;  2YVC A;  3VDZ A;  3KYD D;  2K1F A;  4ANV A;  3QJZ A;  4I6P A;  4URK A;  1V49 A;  2OJR A;  4JGH B;  4FHJ A;  4BFR A;  1BT0 A;  2JWZ A;  2N7D A;  2RD0 A;  1LFD A;  1H4R A;  5LLI A;  4ASW C;  3ML9 A;  3VQI A;  3ZNI D;  3RZW C;  5G2N A;  4BBN F;  1EUV B;  1OTR B;  4RM9 A;  4KIK B;  3U8Z A;  2GBM A; 
#chains in the Genus database with same CATH topology
 2UWQ A;  1UBI A;  3P42 A;  2KDM A;  3BVM A;  3AE2 B;  2PKO A;  1PYW D;  4HPM B;  1N61 A;  5IO9 A;  2L76 A;  2V0G A;  2RPV A;  1FPY A;  2WU2 B;  3DWG C;  3AU4 A;  4JIO U;  4KVG B;  3HRD D;  2LZ6 A;  2NBW B;  4KKI A;  3DBL B;  2O6V D;  1L2N A;  3ZDT A;  4DXF A;  1UUP A;  2KX3 A;  3RMK C;  3APD A;  4RCO A;  4KSL C;  2SEB D;  3JYU A;  3PSE B;  5GXG B;  3SR6 A;  2WXH A;  1JRU A;  3FC4 A;  1E7V A;  3TCA A;  3A33 B;  1PGB A;  3Q14 C;  1XF5 L;  2KD0 A;  2YEP F;  2MBH A;  2I1K A;  4W9K A;  2W82 A;  1N60 A;  4WWM A;  3D32 A;  4MM3 A;  1WGH A;  1IPG A;  3K9P B;  4L1B A;  1CQV A;  3DCG A;  1L5P A;  4LCD E;  1E8X A;  3IT4 B;  3UIN B;  3BVZ A;  2IGG A;  1VLB A;  2PPH A;  2AYO B;  5G5G A;  3A9J A;  3ZJU A;  2GRI A;  4HJG E;  2PMV A;  3HVD A;  3DHI C;  3NHE B;  2BW2 A;  4IG7 B;  2IO3 B;  1A5R A;  2CU3 A;  3RZF A;  1GUA B;  1S3S G;  3BIN A;  2WXL A;  4RF1 A;  5FK9 C;  1MHH E;  4AOF A;  3DWM A;  5DPR A;  4DDI D;  4US8 A;  4ZRP A;  3ENE A;  2OOB B;  4I6L B;  2L0T A;  1C1Y B;  1J7B A;  2KVZ A;  3PTF C;  1SE4 A;  1VD2 A;  1I4P A;  2K22 A;  1L0Y B;  2X38 A;  2BB5 A;  3L54 A;  1PDX A;  1KFY B;  1OQQ A;  2LGY A;  3EC8 A;  3I9V 1;  3RFZ B;  2D10 A;  4MDK E;  3WAN A;  2JYT A;  2LMC A;  4DK5 A;  3U2S C;  3W9C B;  5AZH A;  3UI3 A;  1WWT A;  1YNT E;  4IM2 A;  3V6E B;  1ET6 A;  1WIA A;  2L1A A;  4XDC A;  2BYE A;  2M19 A;  4XWW A;  1FXA A;  2BGF A;  3ZRC A;  1DOY A;  3SFE B;  2A4Z A;  1FRR A;  2W3S A;  4NAM A;  2LVO A;  1C3T A;  3SHQ A;  1IBX A;  2JT4 B;  1ENF A;  4JWU C;  1CJE A;  4OZC A;  3AE9 B;  2DLB A;  4YSY B;  3RD2 A;  4US9 A;  4NJ7 A;  5AEK B;  2HD5 B;  3IAS 1;  1TS4 A;  1KM7 A;  1TT5 B;  2FNJ B;  1QOA A;  2KC1 A;  4G0N B;  1KF6 B;  2KDB A;  2KQS A;  2MHJ A;  3UQA A;  1TKY A;  2N1W A;  3W1S C;  4OW0 A;  4DXG A;  2MSE D;  2KLG A;  3ZNH B;  4M0W A;  3M95 A;  3N30 A;  3V05 A;  4ARI A;  5G5H A;  3H9D A;  1Z2M A;  4TSS A;  2MJE A;  3DBR B;  2MP2 A;  3DBH I;  2Z0D B;  4W9J A;  1VDV A;  2BYT A;  3BY4 B;  1HQR D;  3PHX B;  3I5J C;  5MPO A;  3Q2A C;  4GMV A;  2OHF A;  3TEZ A;  2UYZ B;  2IZV B;  2CHZ A;  2J52 A;  4ZYS A;  2D3G A;  3ZW3 A;  4A3O A;  3NS1 A;  3RI7 C;  4YSZ B;  5DCN A;  2L32 A;  3P1M A;  4FXC A;  3V60 A;  1XQQ A;  4MEM A;  1FFU A;  1C9F A;  3GS2 A;  4MAC A;  1B9R A;  4K3B A;  2N9X A;  1AAR A;  1F77 A;  3PZ7 A;  4WJP A;  1FNU A;  1R4M B;  4IWQ A;  4P1C C;  4EFO A;  1E8Y A;  4YL8 A;  3R66 C;  5EE0 A;  3EFC A;  5FKA C;  2WYQ A;  3KUC B;  1ZOY B;  4HRS A;  3B1L X;  2C7M B;  4KKJ A;  1OFF A;  4IM0 A;  4CHK A;  2L05 A;  1MI0 A;  1UGJ A;  5L83 A;  1J7C A;  2GB1 A;  4GDL B;  4BVU C;  2EKI A;  4PS8 A;  4XC2 A;  2QMT A;  3Q3O C;  3DOW A;  3AEA B;  1LQB A;  1U4A A;  3KWL A;  4F8C B;  3TUO A;  2GBN A;  1WX7 A;  2CKH B;  2Y5C A;  1K50 A;  4HCN B;  1V6E A;  2JUO A;  1E7U A;  1NVI D;  3VR8 B;  5BMI A;  2KTF A;  2XN9 C;  3L08 A;  4HLE A;  3RNA C;  2WXK A;  2LI5 A;  2WU5 B;  5HKH A;  2KK8 A;  2NTT A;  4W9G A;  3DDC B;  2WXG A;  2Y5P A;  1PUT A;  3CST A;  2RSU A;  1K51 A;  4FJY A;  2IGH A;  4FN2 A;  2QSD A;  3MJW A;  2K25 A;  3PRP B;  3J9C A;  3ZIM A;  5HI1 A;  1WMH B;  2JPH A;  1JML A;  3OAW A;  3DBR I;  1XEE A;  3PRM B;  2NVU I;  3K9O B;  4AS1 A;  5I4D A;  4NJ6 A;  4K7W A;  2N1V A;  2K0P A;  4PT5 A;  3PS6 A;  3L16 A;  1TS5 A;  4NQK E;  1WE7 A;  4LDT B;  3ZNG C;  1F0Z A;  2IDY A;  2JYE A;  1FRD A;  3V61 A;  1T0Y A;  4GLS C;  1IGC A;  1WJU A;  3AB5 A;  4KV2 A;  2KQ4 X;  1SB3 C;  1D5M C;  4JE3 B;  2IBI B;  2CHW A;  4Q2J A;  3TL5 A;  4GIV A;  1V1P B;  3H7S A;  2B3A A;  1WM3 A;  2GBJ A;  3DVG Y;  4ZHP A;  3HM3 A;  2MBB B;  1I4R A;  3ZGZ A;  1V8C A;  2WDR B;  2QCZ A;  3ETR A;  2G45 B;  3BZD B;  1K53 A;  1MHX A;  5CX3 A;  1F2R C;  4HKQ A;  1WGD A;  2ICI A;  1I42 A;  3IAM 1;  3PT2 B;  3QAR A;  1ZXI A;  3KYD D;  2RDH A;  4KGS A;  1GPX A;  1V49 A;  1DYQ A;  1N63 A;  4FHJ A;  2N7D A;  1EU4 A;  1LFD A;  5EE9 A;  1RWS A;  3VQI A;  2IJ0 A;  3RZW C;  1EUV B;  2V3N A;  4KIK B;  2GBM A;  1C4A A;  1WFY A;  3ECI A;  2KKC A;  2ZW0 A;  1R4N B;  3E56 A;  3EEC A;  3EGR A;  4KZC A;  2G9H D;  1XCT L;  4YSX B;  3VFK A;  2LEK A;  4IC7 B;  1I4H A;  4IKG A;  5KHO A;  1D3Z A;  1HXY D;  2N4F A;  1JW9 D;  3AUL A;  4MGK E;  5C1Z A;  1IUE A;  1IGD A;  3PZD A;  4NPN A;  3M3J A;  3NVY A;  3EA6 A;  2O2V B;  2WXF A;  4DHJ D;  4OZA A;  3WA0 A;  2I38 A;  2AQ2 B;  4NNJ B;  3GOE A;  1VZ7 A;  3JSV B;  3RPF C;  3IG3 A;  3VVW B;  4MGZ E;  2IGD A;  2J4X A;  2KFK A;  2LJI A;  2ZNV C;  3AE5 B;  4GSW A;  4LNK A;  4R3D A;  1FNV A;  3RNG C;  1E10 A;  1NEK B;  1XO3 A;  2AX5 A;  2D3A A;  1GAQ B;  2MRP A;  3W2D A;  3R3M A;  1YJJ A;  4NQL B;  3FKY A;  1XD3 B;  1TZO A;  2WXN A;  4MGI E;  3LXF A;  2WQY B;  2LGD A;  2DBY A;  3ZXR A;  2LWP A;  2L7R A;  2C9W B;  1Z5S B;  1K52 A;  2WS3 B;  4E3C A;  1VR9 A;  3AE7 B;  2K8C A;  4XE0 A;  4B9K A;  3VUX A;  4BKS D;  3B2G A;  4JL9 A;  5IA7 A;  2ZJD A;  5C23 A;  1GNU A;  1YX5 B;  2J7Q B;  2LUE A;  2WWZ A;  2ZVN A;  5DPS A;  2GOW A;  3EUB 2;  1IYF A;  2LRW A;  4M02 A;  4M00 A;  4FUL A;  2K6Q A;  2YEP B;  1RLF A;  3ZXV A;  4UDU C;  3TMP B;  2NMQ A;  1V5O A;  3KVF B;  2XK5 B;  4LNN A;  2KXJ A;  1E5W A;  2D07 B;  3B08 A;  3URY A;  2MJ3 A;  4AJY B;  2MLB A;  1CMX B;  4KZ0 A;  3UGB B;  4TQ0 A;  5AUK A;  4FJV B;  2N9P C;  2RDB C;  4XGA B;  2WXQ A;  4DWF A;  3N3K B;  3GZN B;  1R4N I;  2D3C A;  1PGA A;  2EKE C;  3U52 E;  3A9K A;  1ET9 A;  3QQ8 B;  3ZLZ A;  4PK1 A;  5H8Y E;  3PRE A;  4RNA A;  5HHD G;  4C56 C;  2JXX A;  4LNO A;  1YOV B;  1KH0 A;  2C5L C;  3RUL A;  4RMA A;  2KVR A;  4W9I A;  1YQB A;  4XX5 A;  4ARC A;  1EO6 A;  2ONQ A;  3P4R B;  1LGR A;  4PS7 A;  1FFV A;  3IBE A;  2BYV E;  4MSM B;  5J17 A;  2BF8 B;  2FCN A;  1WRD B;  1GJZ A;  2W9N A;  3KQ4 A;  2FID A;  1FXT B;  2JWU A;  2KFK B;  4ZRI A;  4YTM B;  2LAS A;  1MVK A;  1P3Q U;  2KMA A;  1UGM A;  3N1X C;  5FR3 A;  1F1H A;  2KO3 A;  2MBE A;  3TIX A;  2N7E A;  2RR9 A;  4IM3 A;  2W3R A;  1WM2 A;  3Q8E A;  3MFG A;  4EZK A;  1V5T A;  1WI0 A;  1M4V A;  1E0Z A;  2VRR B;  2WXO A;  4WJN A;  2KJH B;  5EDS A;  2WX0 A;  3AEC B;  4B95 A;  2QJL A;  2KT7 A;  3PV1 A;  2QHO A;  3OG5 A;  4C4V A;  2DAF A;  4P16 A;  2D2Q A;  2G1E A;  2LXC A;  3DVG X;  3HK0 A;  4HDQ A;  2PW9 A;  3DHH C;  4MH0 E;  4ZYN A;  4FBJ B;  4KGT A;  3SU8 X;  3DBH B;  3H7P A;  2C60 A;  2ZNV B;  3HM6 X;  1SSN A;  1I7H A;  1HZ6 A;  3RYT A;  1D5X C;  3U7Z A;  1GG3 A;  3TEY A;  4N6E B;  2MH7 A;  3MHS D;  2ZVO A;  2L52 A;  3PLV A;  4D2K A;  5E6J A;  2AEH A;  4JQW C;  4LJP B;  2WDT B;  3SD5 A;  2WXR A;  3T9L A;  4GXB A;  1ROE A;  2MBO A;  1T3Q A;  1ZGU B;  2IO2 B;  1L4D B;  4K81 A;  3T3O A;  2E3T A;  1F2R I;  4LTU A;  1JCK B;  2R61 A;  3GZN I;  4DHZ E;  2L00 B;  2JU6 X;  2CJN A;  2DAJ A;  3LJ3 A;  1DGJ A;  2NPT A;  2GBK A;  4HRO A;  1SE9 A;  4W9D A;  3JW0 X;  2WXM A;  4HCP B;  1FXI A;  3KYC D;  5JHA A;  2I2Y A;  1J0G A;  4REZ A;  4HPP A;  4TQ1 A;  1TYG B;  3AM9 A;  3MTN B;  3AU5 A;  1EU3 A;  1YN4 A;  2YLM A;  3AI5 A;  1RFK A;  4PYZ A;  4WWO A;  1LM8 B;  2WXJ A;  3VAW A;  4MJS A;  1NI3 A;  4GOC A;  2FUG 1;  2D3B A;  2BWE S;  2QIL A;  1UZX B;  2LGX A;  4MM3 B;  3W5U B;  1WZ0 A;  1JWU D;  3QAQ A;  2J53 A;  1IP9 A;  1YN3 A;  2R2O A;  3APC A;  2MA9 B;  4HDO A;  1PQS A;  2JXT A;  3M63 B;  1NDD A;  2MJD A;  4YXD B;  3MC9 A;  2WHI A;  2IO1 B;  1UF0 A;  3A9J B;  3S2A A;  3N32 A;  1JRP A;  2FCS A;  1TKE A;  2KWD A;  2HDE A;  2Y3A A;  1SIJ A;  4RM8 A;  2KMC A;  2BPS A;  4CQN A;  5TSS A;  1ZKH A;  1KLU D;  3AE8 B;  1EF1 A;  1WGR A;  4S17 A;  2NBV B;  1CK1 A;  1HZ5 A;  3IT6 B;  4RF0 A;  4EUT A;  4WIP A;  4JPS A;  1V97 A;  1WSP A;  3HHM A;  3I3T B;  4ZOH C;  4CYE A;  3N1Z C;  4M8N A;  2Z0E B;  1KTK A;  5IAA C;  2PTL A;  1WYW B;  2MQJ A;  4O1N A;  2GMI C;  2SAK A;  3CMM B;  2ZPN A;  1P7E A;  5BYQ A;  3B9J A;  4W9E A;  2DYM A;  1P1A A;  2FCQ A;  4LK0 M;  2ZW1 A;  1TKG A;  3CWI A;  4KGR A;  3BVG A;  3QK0 A;  4DXA B;  1HTQ A;  2QIE B;  1C79 A;  1OQY A;  3VR9 B;  2LGS A;  3P4S B;  2KTR A;  4EZL A;  3IFW B;  2KYW A;  4XYC A;  3GP7 A;  4II3 B;  2I1J A;  2YVC A;  4YWG G;  2K1F A;  2WP9 B;  3R2I A;  4JGH B;  2JWZ A;  3H8H A;  4ASW C;  2Q5W D;  3ML9 A;  4RGO S;  5G2N A;  3RNC C;  5D3I B;  4BBN F;  2KMM A;  1T5X D;  3VRA B;  3MHZ A;  3RCZ A;  3L0W B;  2DHZ A;  3BII D;  2DZI A;  1IBX B;  4OVV A;  1P0R A;  2JRI B;  3GB1 A;  3P4P B;  4DHZ B;  3UIO B;  3FAH A;  1TS2 A;  4L2Y A;  2DYO A;  1GB4 A;  1Q1O A;  1XT9 B;  4NZL B;  1ACC A;  3FIL A;  2R2Q A;  1WGY A;  2K8H A;  5CHV C;  3WCQ A;  2VH1 A;  5T8I A;  4AUQ C;  3A1Q A;  4BKG A;  3HUI A;  3DHG C;  2LHD A;  3AN1 A;  4A6Q A;  2MCN B;  4NAW A;  1E8W A;  1DOI A;  1D6E C;  4FLH A;  1OEY A;  4M0W B;  4J3O D;  2BKF A;  4GU2 A;  4HJK A;  1WJ4 A;  3R8B A;  2VZK B;  1QZE A;  2MP2 B;  2C7H A;  4OVU A;  3BYT B;  4ICV A;  3RNB C;  3VUW A;  5JH5 C;  1RFA A;  2LVQ A;  1YQ3 B;  1WX8 A;  2BVC A;  2K3U A;  2V4I B;  1G6J A;  4NJC A;  5AUI A;  3WAM A;  1XLP A;  3VTW A;  1WRI A;  2QEJ C;  4OVZ A;  2PIA A;  1YJI A;  2KX0 A;  1H8C A;  3ZJT A;  2IPK D;  3SFD B;  4ZRQ A;  4HXD A;  4DQO C;  3VRB B;  2KAN A;  4OHJ A;  1WJ6 A;  4XZ4 A;  2M4N A;  1WY8 A;  1WF9 A;  3O13 A;  1SJE D;  4GGQ A;  2JZZ A;  1QOG A;  2K6D B;  3AE4 B;  3KW5 B;  1SF0 A;  2DZM A;  3P4Q B;  3R7Q A;  4HWI B;  1UH6 A;  4W9C A;  2KHW B;  1N6Z A;  1TTN A;  3NVW A;  1TJE A;  3QWZ B;  3NZS A;  1AW7 A;  1I4X A;  5DPT A;  4BKS A;  3AEF B;  1GC7 A;  5LXH A;  2D5G A;  4A90 A;  4RGN A;  1QT9 A;  4LDT D;  3T8M A;  2QDF A;  3MC0 B;  3U30 A;  1BUI C;  4GN1 A;  1D4B A;  2IY0 B;  2KDI A;  2V1Y A;  2BWF A;  2AWT A;  1C4C A;  3JVZ X;  2H89 B;  1UD7 A;  1GC6 A;  1I4Q A;  2XBB C;  1FD6 A;  4AWJ A;  2KNB A;  3B0A A;  3W1Y A;  4JLC A;  4JX1 C;  2L83 A;  4RFB A;  3IVF A;  1E8Z A;  2J0J A;  3HVZ A;  1N62 A;  4G3X B;  3AEG B;  4ZRJ A;  2N0S B;  3AH7 A;  3WAP A;  1D5Z C;  2H88 B;  4OZB A;  1ISN A;  1YQ4 B;  2O6V A;  3E9S A;  3VXW A;  5G55 A;  2ACZ B;  3RNF C;  1J8C A;  5CHW A;  3L4P A;  3AMZ A;  5J18 A;  3RT3 B;  5D6J B;  2LRU A;  1YJ1 A;  4HEA 1;  2FIF A;  4X57 B;  2JY6 A;  1XXG A;  1S1Q B;  4KDI C;  3QHT A;  4MGY E;  1ZUD 2;  4IWP A;  1VZ8 A;  1WR1 A;  1XLQ A;  1KLG D;  2L0F A;  5CHF A;  1SBB B;  1WH3 A;  5JZE B;  4S0R A;  1DOX A;  4F7Z A;  2BS4 B;  2JF5 A;  2N7J A;  1E9M A;  2LXA A;  4HVB A;  3C19 A;  1WXS A;  1N5W A;  1TZ1 A;  1EF5 A;  3TJP A;  2GI9 A;  1E6E B;  3Q69 A;  1NYQ A;  1FCC C;  4FHK A;  1JWS D;  3PO0 A;  3RUI B;  2HJ8 A;  3SDL C;  1SIF A;  1SEB D;  1XCQ L;  1QLB B;  2J0K A;  2Z59 B;  4PS3 A;  5EE3 A;  2GBR A;  2KJR A;  4KX6 B;  5E6O A;  4WJO A;  4E74 A;  3N1Y C;  3R2T A;  1WE6 A;  2KDF B;  2WXI A;  3NJT A;  1GOZ A;  1BML C;  1ZE3 D;  3ZYY X;  1WJN A;  1UNS A;  3L10 B;  4CO7 A;  1WR6 E;  1Q5W B;  4B0E A;  1MPE A;  1T6B X;  3RN9 C;  4B0M A;  1UBQ A;  2LJ5 A;  3P63 A;  5AZG A;  5C3J B;  3ZO5 B;  4C80 A;  1SGH A;  1QOB A;  2FBW B;  1T0Q C;  1I4G A;  1RYJ A;  4YT0 B;  4II2 B;  4TUU A;  5D94 A;  2NCN A;  4E71 A;  1V86 A;  2EEL A;  3QC8 B;  3Q3M C;  3NZU A;  1HTO A;  3ZKJ C;  2N9E B;  3PVL A;  3NVV A;  1AN8 A;  1MG8 A;  4FA6 A;  3DVN V;  2W55 A;  3O65 B;  2D11 A;  4ICU A;  2GLS A;  2BTE A;  2UU7 A;  2O6V B;  5EE1 A;  2KLC A;  3P2B A;  2ZCB A;  1EWY C;  1FO4 A;  1TS3 A;  1SJH D;  1RRB A;  1JAL A;  4HK2 A;  2V3P A;  2MW5 A;  3EFU A;  3W5V B;  4BZA A;  2V9H A;  4A20 A;  5BMH A;  5BYS A;  3DPD A;  2JSV X;  4EE2 A;  2MEK A;  5TR5 A;  3LYY A;  2INC C;  3UQB A;  3GE3 C;  4FAD A;  3Q3J A;  1WZ3 A;  2N9L A;  3KH0 A;  4FJZ A;  1QQR A;  3PLU A;  1FIQ A;  2PEA A;  1T0S C;  2BT6 A;  3TSS A;  4W9F A;  2RGF A;  4BBN C;  3ABV B;  4F1S A;  1I35 A;  1YN5 A;  2XEW A;  2KN4 A;  4BKT A;  3ZTC A;  1GB1 A;  2WX1 A;  4B6W A;  3H6N A;  1VZ6 A;  4EEW A;  4LJO B;  3KUD B;  1E90 A;  1E7P B;  1VRA B;  1WXM A;  2G4D B;  2LD9 A;  3R7R A;  2CHX A;  2WXP A;  4M8M A;  2Y5B B;  4N9F 4;  2M17 A;  1KOT A;  1B1Z A;  1JQ4 A;  1UWM A;  2OED A;  3OJ4 B;  3AE3 B;  1NYR A;  4C00 A;  3PHW B;  1V1O A;  1EM7 A;  2PVO D;  1VJK A;  2MWS B;  2DZK A;  3QA8 A;  5FR6 A;  3PZ8 A;  4WQO B;  2WNM A;  2K8B A;  4K3C A;  4K7U A;  2REX A;  1QF6 A;  2ZPY A;  3MP9 A;  3M62 B;  5D2M B;  4HPL B;  1V2Y A;  3I63 C;  1AWD A;  2V4L A;  3C0R B;  3ZDM C;  1VCB A;  3A9K B;  4HKZ E;  2KDE B;  3V3X A;  3BWU D;  1Y56 A;  4DBG A;  3V62 A;  3ML8 A;  1V80 A;  2JQR B;  3AEB B;  1C77 A;  2OJW A;  1X1M A;  3HIZ A;  1QOF A;  1YD8 U;  2KOX A;  3ZUN A;  4RH6 A;  3L13 A;  3ZTD A;  2VH2 A;  1TY2 A;  3TBL D;  3ZRF A;  3VDZ A;  3QJZ A;  4M01 A;  1Q10 A;  2RD0 A;  1H4R A;  3Q3N C;  2B76 B;  3ZNI D;  2LUM A;  1OTR B;  4RM9 A;  3U8Z A;  5E6N A;  2DZJ A;  3ALB A;  4N58 A;  2BKR B;  5D3D A;  1L7Y A;  4K1R B;  3NZ3 A;  1OQR A;  4MSQ B;  2KZR A;  2ZCC A;  1PFD A;  2J42 A;  4PYU A;  3DBL I;  2EMS A;  4BOZ B;  3KWV A;  2M56 B;  1WXQ A;  4WUR A;  3AE6 B;  3PPA A;  4WWN A;  3DQV A;  2NS5 A;  4W9L A;  2WGS A;  1ZDX A;  4C4V B;  3UF8 A;  1V9J A;  4K7S A;  3U4E G;  2ASQ A;  1WXV A;  1UEL A;  5KHQ A;  4ANU A;  4GDL A;  1KJT A;  3H7P B;  5GMV A;  1JWA D;  1RM6 C;  4WWP A;  2CR5 A;  3NG0 A;  3BYY B;  3LDZ E;  3A4R A;  1ZDV A;  2HE7 A;  4GB9 A;  1SXT A;  2FUH B;  4EKU A;  3APF A;  2G4S A;  1FEH A;  2PVG C;  3TEX A;  3KUZ A;  3AV8 A;  2LVP A;  3X0W A;  1TBE A;  5H92 C;  1MJD A;  2X8X X;  1J19 A;  4LNI A;  4QAY A;  3VUY A;  3N20 C;  1L6V A;  1SE3 A;  2PLP A;  4LLG M;  1QIL A;  3QX1 A;  4TMA B;  5IKC M;  4P1B C;  4ITK A;  1WMH A;  2J0M A;  2E6X A;  2KAJ A;  4EZJ A;  2EMT A;  1NBF C;  1J7A A;  2NPT B;  3X23 A;  1P9D U;  3V6C B;  2DX5 B;  2W54 A;  2MX2 A;  4BAX A;  4TV3 A;  2TSS A;  2RMM A;  4LNF A;  4A9A A;  3W1S A;  5C2T B;  4L23 A;  3Q8F A;  4MT5 A;  4YTP B;  2INN E;  2V3S A;  2KFJ A;  4ZDV A;  4MEL A;  2IYD B;  5LXI B;  3ZVV A;  4EOY A;  3DBS A;  4MJS B;  4IWO A;  1ESF A;  4NY0 A;  4ZHO A;  1AYF A;  2ZZP B;  3LB8 C;  2FAZ A;  4G11 A;  1V1P A;  3Q8B A;  4GDK A;  2KWV B;  2FE8 A;  1R7S A;  5JXV A;  3Q3F A;  2AL6 A;  1K8R B;  4J6I A;  3H1U A;  3Q6B A;  3AEE B;  1T0R C;  1L4Z B;  1STE A;  1TY0 A;  2XNA C;  1OEY J;  2DYB A;  3OLM D;  3Q8A A;  1Y8R C;  5HG2 A;  3GE8 C;  1XLN A;  2PJH A;  3A4S C;  2NR2 A;  1RAX A;  2DWQ A;  1P98 A;  3WAO A;  2HTH A;  2PE6 B;  2NBU A;  4KIK A;  2BYF A;  4W9H A;  3ZQ4 A;  3QIJ A;  4ANX A;  2BBC A;  1FM0 D;  4KSK C;  2CJO A;  3VTU A;  4YTN B;  3RNE C;  4IUM B;  2HJ1 A;  1YMH E;  2LHE A;  2IND C;  1WXA A;  3N9Y C;  2CS4 A;  1NEN B;  1ZP0 B;  2KWU B;  2DEN B;  3UIP B;  1YX6 B;  1JRO A;  1JWM D;  2HTM E;  2RPQ A;  1V81 A;  4P7I A;  3NVZ A;  2AQ3 B;  2VZK D;  4BOS C;  2AL3 A;  3MJ5 A;  3ONS A;  4A3P A;  4N59 A;  3PRZ A;  2O2V A;  1ZXH A;  5DPW A;  2IO0 B;  2KTR B;  3WAL A;  3U7D A;  3CIR B;  3NUH B;  3TEW A;  1N5X A;  1XLO A;  5L95 C;  3VH4 B;  1WX9 A;  1MG4 A;  3BK1 A;  3BK2 A;  2RDG A;  3L17 A;  5E6P A;  3JSV A;  1BXT A;  2ON8 A;  2KAC A;  3DVN U;  4P6V F;  2M0A A;  4GDK B;  4I6N B;  2JVC A;  4ACF A;  1FCL A;  1FMA D;  1UWX A;  5BYR A;  2BS3 B;  3FIL B;  3NOB A;  3CF6 E;  4WJQ A;  1R4M I;  3IHP C;  2DNF A;  4IDI A;  1KRH A;  2KC2 A;  3MC8 A;  3A1Q B;  2G3Q B;  3SEB A;  2M0X A;  3Q8C A;  4A55 A;  3NS8 A;  4NAW B;  1ZPS A;  2AQ1 B;  2KJ6 A;  1FNW A;  3AED B;  2A5U A;  1WYG A;  2K5P A;  1WGK A;  1TGZ B;  3OJ3 A;  1OGW A;  3ZNZ B;  5CTR C;  4KDL B;  4XWT A;  4WQM A;  4DHJ B;  1NI2 A;  3PGE A;  2XK5 A;  3CSF A;  4TKN A;  2PE9 A;  5JHB A;  2INP E;  2JZ3 B;  2KWC A;  5BMG A;  3QCA A;  2C7N B;  1LO5 D;  3VTV A;  4AJW A;  1PGX A;  1F9J A;  2N9K A;  2FCM A;  4H2A A;  1M94 A;  5IOI A;  2JX5 A;  5BO4 B;  1HE8 A;  4RGM A;  3KLS X;  2MBQ A;  3I57 A;  3VH3 B;  2JZP A;  1L0X B;  2K39 A;  4IW0 A;  4C7Z A;  2CU1 A;  1MFW A;  2ZEQ A;  2KN5 A;  4AQ7 A;  2WDV B;  1KLV A;  4DDG D;  2KQ7 A;  2WDQ B;  4ANW A;  5HFY A;  1L6U A;  4JWS C;  4G50 A;  1SE2 A;  4RGT A;  5LNK 1;  3C8Y A;  3OWE B;  2Z8L A;  1Q0W B;  1CZP A;  1C76 A;  5J2R A;  1LXD A;  4ZRK A;  3ZJV A;  2NTS A;  5IN7 A;  2QC8 A;  3VHT C;  2JRH A;  4WAF A;  1QKZ A;  2WLB A;  1TIF A;  3B2F A;  5IP4 D;  3EHV A;  3NY5 A;  2LGI A;  1L0V B;  2M8S A;  1A70 A;  2LFI A;  2IY1 B;  4USA A;  5AZF A;  1F52 A;  1HA5 A;  4A8X C;  4AP4 C;  4XDD A;  2M1M A;  1JWB D;  2L8J A;  1WGG A;  2L3Z A;  3IXS A;  1HEZ E;  1YIW A;  3AXC A;  4WAA A;  1EWC A;  5D7G A;  3WIM A;  1C4P A;  2K9X A;  1C78 A;  1ZW7 A;  3AE1 B;  2BQQ A;  4ANV A;  1P7F A;  4WH4 A;  4MH8 A;  4I6P A;  4C7Y A;  4URK A;  2OJR A;  3T3N A;  4BFR A;  1BT0 A;  5LLI A;  3NRZ A;  2BB6 A;  4IOI E;  2BS2 B; 
#chains in the Genus database with same CATH homology
 5E6N A;  3ECI A;  1WFY A;  2DZJ A;  3L0W B;  2DHZ A;  2UWQ A;  1UBI A;  3RCZ A;  2KKC A;  2DZI A;  4OVV A;  1P0R A;  2JRI B;  4DHZ B;  3ALB A;  2BKR B;  3EEC A;  4KZC A;  3UIO B;  4HPM B;  1L7Y A;  2DYO A;  4K1R B;  3VFK A;  1Q1O A;  1XT9 B;  2L76 A;  2R2Q A;  1WGY A;  2K8H A;  4IC7 B;  5CHV C;  4MSQ B;  3AU4 A;  4JIO U;  4KVG B;  2KZR A;  2ZCC A;  5KHO A;  2LZ6 A;  1D3Z A;  4AUQ C;  4PYU A;  3A1Q A;  4BKG A;  3DBL I;  2EMS A;  2NBW B;  4BOZ B;  2O6V D;  2MCN B;  2N4F A;  4NAW A;  1E8W A;  1L2N A;  3ZDT A;  4FLH A;  3PPA A;  4WWN A;  1OEY A;  3DQV A;  2NS5 A;  3AUL A;  4MGK E;  4W9L A;  5C1Z A;  2KX3 A;  3PZD A;  3APD A;  4M0W B;  4KSL C;  3WAL A;  2BKF A;  4NPN A;  3UF8 A;  1V9J A;  4K7S A;  4GU2 A;  4HJK A;  2ASQ A;  3JYU A;  3M3J A;  1WJ4 A;  3PSE B;  1WXV A;  1QZE A;  1UEL A;  1JRU A;  2MP2 B;  2O2V B;  2C7H A;  4OVU A;  5KHQ A;  1E7V A;  4ANU A;  4ICV A;  4GDL A;  1KJT A;  3H7P B;  5GMV A;  3VUW A;  4DHJ D;  5JH5 C;  3WA0 A;  3TCA A;  4WWP A;  1RFA A;  2LVQ A;  3A33 B;  2CR5 A;  1WX8 A;  4NNJ B;  1G6J A;  3GOE A;  3WAM A;  3SDL C;  3LDZ E;  2KD0 A;  3A4R A;  3VTW A;  2HE7 A;  4GB9 A;  2FUH B;  2MBH A;  3JSV B;  3IG3 A;  3APF A;  2G4S A;  2I1K A;  2KX0 A;  4MGZ E;  4W9K A;  3VVW B;  4EKU A;  1H8C A;  3D32 A;  4HXD A;  4MM3 A;  2KFK A;  2KAN A;  2ZNV C;  4GSW A;  1WGH A;  1WJ6 A;  4XZ4 A;  1IPG A;  3K9P B;  2M4N A;  1WY8 A;  3KUZ A;  2MRP A;  1WF9 A;  2LVP A;  3R3M A;  3DCG A;  4NQL B;  1XD3 B;  4MGI E;  4LCD E;  4GGQ A;  3X0W A;  2JZZ A;  1E8X A;  2K6D B;  1TBE A;  3UIN B;  3KW5 B;  2LGD A;  1J19 A;  2DZM A;  3VUY A;  2PPH A;  2AYO B;  2LWP A;  3QX1 A;  3R7Q A;  3A9J A;  4HWI B;  1UH6 A;  2L7R A;  4W9C A;  2C9W B;  1Z5S B;  2KHW B;  4E3C A;  1WMH A;  2J0M A;  1TTN A;  2K8C A;  4B9K A;  4EZJ A;  2EMT A;  1NBF C;  3NHE B;  3VUX A;  3QWZ B;  2NPT B;  3NZS A;  3X23 A;  4BKS D;  4JL9 A;  5IA7 A;  2ZJD A;  4IG7 B;  1GNU A;  1P9D U;  1YX5 B;  5C23 A;  3V6C B;  2DX5 B;  2J7Q B;  2LUE A;  2IO3 B;  2WWZ A;  5DPT A;  4BKS A;  1A5R A;  1GC7 A;  3RZF A;  1GUA B;  5LXH A;  2MX2 A;  1S3S G;  2ZVN A;  3BIN A;  4TV3 A;  5DPS A;  2GOW A;  1IYF A;  2LRW A;  4LDT D;  3T8M A;  4FUL A;  2K6Q A;  1RLF A;  4AOF A;  3W1S A;  5DPR A;  3TMP B;  4DDI D;  3U30 A;  3KVF B;  1V5O A;  2XK5 B;  4GN1 A;  2KXJ A;  1E5W A;  2D07 B;  2IY0 B;  3B08 A;  2KDI A;  2V1Y A;  4AJY B;  2MLB A;  2BWF A;  2V3S A;  2KFJ A;  1CMX B;  4KZ0 A;  2AWT A;  3ENE A;  4ZDV A;  3JVZ X;  2OOB B;  4MEL A;  4I6L B;  2IYD B;  2L0T A;  3UGB B;  1C1Y B;  4TQ0 A;  5LXI B;  3PTF C;  4FJV B;  1VD2 A;  3ZVV A;  2N9P C;  3DBS A;  4EOY A;  1UD7 A;  1GC6 A;  4MJS B;  4IWO A;  2XBB C;  4NY0 A;  4AWJ A;  2ZZP B;  2KNB A;  3B0A A;  2FAZ A;  3W1Y A;  3N3K B;  4JLC A;  4DWF A;  3L54 A;  4G11 A;  2LGY A;  3EC8 A;  1R4N I;  2EKE C;  4GDK A;  2KWV B;  3A9K A;  3IVF A;  1E8Z A;  2J0J A;  2D10 A;  3Q3F A;  4MDK E;  3WAN A;  4G3X B;  3QQ8 B;  2AL6 A;  1K8R B;  3ZLZ A;  4J6I A;  4DK5 A;  3H1U A;  3PRE A;  4ZRJ A;  5AZH A;  2JXX A;  1OEY J;  2DYB A;  3OLM D;  2C5L C;  3RUL A;  4RMA A;  2KVR A;  1Y8R C;  4IM2 A;  3V6E B;  3WAP A;  4W9I A;  1YQB A;  4XX5 A;  1EO6 A;  1WIA A;  2BYE A;  1ISN A;  2PJH A;  2BGF A;  2O6V A;  3A4S C;  3ZRC A;  2NR2 A;  4PS7 A;  3VXW A;  5G55 A;  1RAX A;  3IBE A;  1P98 A;  1J8C A;  3WAO A;  2BYV E;  2A4Z A;  5CHW A;  4MSM B;  5J18 A;  5J17 A;  2BF8 B;  2FCN A;  3RT3 B;  1WRD B;  1GJZ A;  5D6J B;  2LRU A;  1YJ1 A;  2HTH A;  2PE6 B;  2LVO A;  2W9N A;  2NBU A;  2FIF A;  1C3T A;  4KIK A;  4X57 B;  2BYF A;  4W9H A;  2FID A;  1FXT B;  2JY6 A;  2KFK B;  3SHQ A;  2JT4 B;  4ZRI A;  3QIJ A;  2LAS A;  4ANX A;  1S1Q B;  1P3Q U;  2KMA A;  1UGM A;  4KDI C;  3QHT A;  4KSK C;  4MGY E;  4IWP A;  3RD2 A;  3VTU A;  1WR1 A;  4NJ7 A;  2KO3 A;  2MBE A;  5AEK B;  2L0F A;  2HD5 B;  4IUM B;  5CHF A;  3TIX A;  2N7E A;  1WH3 A;  1KM7 A;  5JZE B;  1WXA A;  2FNJ B;  2CS4 A;  2KC1 A;  4G0N B;  2RR9 A;  4IM3 A;  1WM2 A;  2KWU B;  4F7Z A;  2JF5 A;  2LXA A;  2DEN B;  4EZK A;  4HVB A;  1V5T A;  1WI0 A;  3UIP B;  2KDB A;  2KQS A;  1YX6 B;  3UQA A;  2VRR B;  4WJN A;  2N1W A;  2KJH B;  3W1S C;  5EDS A;  2WX0 A;  4B95 A;  1WXS A;  1TZ1 A;  2MSE D;  1V81 A;  2KLG A;  2QHO A;  1EF5 A;  2RPQ A;  3PV1 A;  4P7I A;  3TJP A;  2DAF A;  3ZNH B;  4BOS C;  3M95 A;  2AL3 A;  3N30 A;  2D2Q A;  3DVG X;  2LXC A;  3H9D A;  1Z2M A;  4FHK A;  3RUI B;  3HK0 A;  2HJ8 A;  3ONS A;  3PRZ A;  1SIF A;  2MP2 A;  4HDQ A;  2O2V A;  4MH0 E;  2J0K A;  2Z59 B;  4PS3 A;  4ZYN A;  3DBH I;  4FBJ B;  2Z0D B;  5DPW A;  2IO0 B;  2KTR B;  4W9J A;  3H7P A;  3SU8 X;  2C60 A;  2ZNV B;  3BY4 B;  3HM6 X;  3U7D A;  2GBR A;  2KJR A;  3PHX B;  5E6O A;  4WJO A;  4E74 A;  4A3P A;  4GMV A;  1WE6 A;  2KDF B;  5L95 C;  3VH4 B;  2UYZ B;  3RYT A;  1WX9 A;  2IZV B;  1GG3 A;  3L17 A;  5E6P A;  2CHZ A;  3MHS D;  3JSV A;  1WJN A;  2D3G A;  2ZVO A;  3L10 B;  3PLV A;  3ZW3 A;  4CO7 A;  1WR6 E;  4A3O A;  1Q5W B;  2AEH A;  4JQW C;  4LJP B;  2WDT B;  1UBQ A;  2LJ5 A;  3SD5 A;  5DCN A;  5AZG A;  3T9L A;  3ZO5 B;  3DVN U;  4GDK B;  4GXB A;  4I6N B;  3V60 A;  1XQQ A;  1SGH A;  2MBO A;  4MEM A;  2JVC A;  1ZGU B;  2IO2 B;  4II2 B;  4TUU A;  5D94 A;  2NCN A;  4K81 A;  2N9X A;  1AAR A;  3NOB A;  1V86 A;  3CF6 E;  4WJQ A;  1R4M I;  3IHP C;  3QC8 B;  4WJP A;  4E71 A;  3NZU A;  3ZKJ C;  2N9E B;  3PVL A;  4IWQ A;  4EFO A;  2KC2 A;  1MG8 A;  4FA6 A;  3DVN V;  3GZN I;  3A1Q B;  1E8Y A;  3O65 B;  4YL8 A;  4DHZ E;  2D11 A;  2L00 B;  3R66 C;  4ICU A;  2G3Q B;  2DAJ A;  2M0X A;  3LJ3 A;  3NS8 A;  4NAW B;  2O6V B;  2NPT A;  2GBK A;  2KJ6 A;  2KLC A;  2WYQ A;  3KUC B;  2A5U A;  3P2B A;  1SE9 A;  3B1L X;  2C7M B;  4W9D A;  2ZCB A;  3JW0 X;  4IM0 A;  4CHK A;  1RRB A;  1TGZ B;  2L05 A;  3OJ3 A;  1OGW A;  3ZNZ B;  4HCP B;  4HK2 A;  5L83 A;  3KYC D;  5CTR C;  5JHA A;  2MW5 A;  3EFU A;  4GDL B;  1J0G A;  4TQ1 A;  4A20 A;  4BVU C;  4KDL B;  4PS8 A;  4XC2 A;  3MTN B;  4DHJ B;  1NI2 A;  3AU5 A;  2XK5 A;  3CSF A;  3DOW A;  3DPD A;  3PGE A;  2YLM A;  5TR5 A;  1LQB A;  1U4A A;  3AI5 A;  4F8C B;  2GBN A;  4TKN A;  1WX7 A;  2CKH B;  4PYZ A;  3UQB A;  4WWO A;  1LM8 B;  4FAD A;  2PE9 A;  3Q3J A;  4HCN B;  1V6E A;  2JUO A;  1E7U A;  3VAW A;  1WZ3 A;  5JHB A;  4MJS A;  4GOC A;  2JZ3 B;  2KWC A;  2KTF A;  3KH0 A;  2BWE S;  4FJZ A;  3QCA A;  1UZX B;  2LGX A;  3L08 A;  3PLU A;  1WZ0 A;  2PEA A;  2C7N B;  3VTV A;  4HLE A;  4AJW A;  3QAQ A;  2LI5 A;  1IP9 A;  4W9F A;  2R2O A;  1F9J A;  2KK8 A;  3APC A;  2MA9 B;  5HKH A;  2RGF A;  4HDO A;  2FCM A;  4W9G A;  4BBN C;  3DDC B;  1PQS A;  1M94 A;  4F1S A;  1I35 A;  3CST A;  2XEW A;  1HE8 A;  2RSU A;  3M63 B;  1NDD A;  4FJY A;  5BO4 B;  2MBQ A;  4BKT A;  3ZTC A;  2WX1 A;  2IO1 B;  3VH3 B;  4FN2 A;  3A9J B;  4B6W A;  2K39 A;  3H6N A;  2K25 A;  3MJW A;  3PRP B;  4IW0 A;  2CU1 A;  3N32 A;  3S2A A;  4EEW A;  3ZIM A;  4LJO B;  2FCS A;  3KUD B;  1E90 A;  1WMH B;  1WXM A;  2ZEQ A;  2G4D B;  2LD9 A;  3R7R A;  2JPH A;  4RM8 A;  2KMC A;  2KN5 A;  3OAW A;  2BPS A;  2CHX A;  4M8M A;  1KLV A;  2Y5B B;  4DDG D;  4N9F 4;  2KQ7 A;  1ZKH A;  2M17 A;  1KOT A;  3DBR I;  3PRM B;  4ANW A;  2NVU I;  3K9O B;  3OJ4 B;  1EF1 A;  4NJ6 A;  1WGR A;  4K7W A;  2NBV B;  2N1V A;  3PS6 A;  4G50 A;  3L16 A;  4EUT A;  3PHW B;  4NQK E;  1WE7 A;  1Q0W B;  4LDT B;  3HHM A;  3ZNG C;  3I3T B;  2MWS B;  2DZK A;  4CYE A;  3QA8 A;  5J2R A;  5FR6 A;  1LXD A;  4ZRK A;  3V61 A;  4WQO B;  4M8N A;  2K8B A;  1T0Y A;  4K7U A;  2Z0E B;  1WJU A;  3VHT C;  5IAA C;  2JRH A;  2REX A;  1WYW B;  2MQJ A;  2ZPY A;  2GMI C;  4KV2 A;  3CMM B;  3M62 B;  3EHV A;  3NY5 A;  2ZPN A;  5D2M B;  4HPL B;  2M8S A;  4W9E A;  1V2Y A;  2DYM A;  1P1A A;  2FCQ A;  2IBI B;  2CHW A;  2V4L A;  3C0R B;  3TL5 A;  4GIV A;  3ZDM C;  1VCB A;  2IY1 B;  3H7S A;  2B3A A;  1WM3 A;  2GBJ A;  3A9K B;  2KDE B;  3DVG Y;  4DBG A;  3HM3 A;  3V62 A;  2MBB B;  3QK0 A;  4DXA B;  5AZF A;  3ML8 A;  1V80 A;  4AP4 C;  2M1M A;  2G45 B;  2L8J A;  1WGG A;  1OQY A;  2L3Z A;  1YIW A;  5CX3 A;  1X1M A;  3AXC A;  3HIZ A;  2KTR A;  1WGD A;  3IFW B;  1YD8 U;  4EZL A;  2KOX A;  1I42 A;  3ZUN A;  4WAA A;  3L13 A;  3ZTD A;  5D7G A;  3WIM A;  3PT2 B;  4II3 B;  1ZW7 A;  3TBL D;  2I1J A;  3ZRF A;  3QAR A;  2YVC A;  3VDZ A;  3KYD D;  2K1F A;  4ANV A;  3QJZ A;  4I6P A;  4URK A;  1V49 A;  2OJR A;  4JGH B;  4FHJ A;  4BFR A;  1BT0 A;  2JWZ A;  2N7D A;  2RD0 A;  1LFD A;  1H4R A;  5LLI A;  4ASW C;  3ML9 A;  3VQI A;  3ZNI D;  3RZW C;  5G2N A;  4BBN F;  1EUV B;  1OTR B;  4RM9 A;  4KIK B;  3U8Z A;  2GBM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...